2J88A

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
324
structure length
319
Chain Sequence
b'EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONONGLUCOSAMINIDASE
molecule tags Hydrolase
source organism Apis mellifera
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
total genus 125
structure length 319
sequence length 324
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j88A00
1KFCA 5D2XA 3G3MA 1ZNNA 4GUJA 2CLFA 3UXDA 1A53A 2Y7GA 1XDLA 3LCIA 1XC4A 4CQ9A 3LCFA 1OFAA 1KTNA 5HWMA 3G8RA 1QR7A 4KWVA 2V0TA 1GWJA 1JUBA 3QZEA 4LRTA 5BW6A 5LZLA 4I9AA 2BSLA 2ZRXA 3LX9A 1YPFA 2ABAA 4JYFA 3W1RA 3A23A 3G8EA 2TPSA 3C56A 1E51A 5ABTA 1D3GA 1XL9A 1F6KA 5FEXA 4RKAA 5D38A 2YSWA 3D0CA 3E96A 3PF3A 4MJMA 5CGQA 3VI2A 1VS1A 3O05A 4LC8A 1AL7A 1GEQA 1ALDA 1LLZA 4UTHA 1TPFA 2NWSA 1I4NA 4UFLA 3C2FA 4MY8A 5G5IA 3SJ3A 1EP1A 1GG0A 1LCOA 2GUUA 4GNJA 3LERA 5F2GA 1W0MA 2QJHA 3NA8A 2ISSA 3NVTA 1Q6LA 2R91A 4O17A 2B0MA 1OABA 3CLMA 3DHFA 5F4XA 5KMYA 3GX9A 3DI0A 3QRHA 3VFLA 3FOKA 3WJXA 3LXCA 3LTPA 1ME8A 3W7MA 1RVGA 5LGZA 1UCWA 4X2RA 3BG9A 4P61A 4NXKA 1I8JA 2YX0A 3E0IA 3SW6A 4JTKA 1SSDA 4FF7A 1JQVA 3W7OA 5C6MA 1NFBA 3NDOA 1NAL1 4AF0A 2AGKA 3GNDA 3MBDA 3KHJA 3CU2A 4ONVA 3CQ0A 4PEKA 3W76A 1SSGA 4XBSA 3DFNA 5F2MA 3I7SA 4JYDA 2Z2UA 5C2XA 1NF0A 4B5NA 1ZFJA 4O14A 3HGOA 5K2ZA 1XFBA 1ICPA 2GVLA 2DU2A 2VC6A 2E5DA 2VELA 4U4MA 3Q58A 3OVQA 1TB3A 3R12A 4M6QA 5I3IA 1B9BA 5BMXA 5U4NA 3TMLA 3LLFA 1QFEA 5K9XA 1K8YA 1FWNA 2E6DA 1JCMP 4JTLA 1PE1A 2QCEA 3EKZA 4Q4KA 1PHWA 4LVFA 4K36A 3W2LA 5KINA 1XDMA 3I65A 5LNWA 1ZAHA 2ABBA 2CW6A 1DHPA 3IIPA 1X1ZA 3IIXA 1UUMA 1QPOA 1FDZA 4PTNA 2AQWA 1N8FA 3ZFHA 3A5FA 4XUGA 1HO1A 1F76A 4JY8A 3LI0A 2OMAA 5F4SA 2E6AA 3VE9A 1OFDA 4LS2A 4ADSA 1A50A 3IIVA 3NQVA 1OFRA 4RZ5A 5IM51 4Z1BA 4JTEA 1K02A 1GVOA 1VHNA 4JD4A 3N34A 4O53A 1QPNA 1L6WA 1IGSA 1OYCA 4O8RA 3S1VA 3BW3A 3QSRA 2ZZ4A 4WY0F 1W3TA 2J9XA 4IXXA 3EB2A 2EKCA 3M16A 3W1TA 5CZSA 3LHTA 4LS0A 3FKKA 3HG4A 2ZTJA 3TUUA 1ICSA 5F4WA 1X6UA 3LOTA 4JIPA 4KKXA 3TDFA 1LRQA 4N9CA 5HUOA 3DAQA 2GQ8A 4MPQA 1YYAA 3EWYA 4K37A 2ZA1A 3W2JA 3TFCA 3G0UA 3DZ1A 3G1AA 1ONRA 4FNQA 4DF1A 3PBYA 3PBWA 4KFNA 1EWDA 4BWLA 5J5RA 3RF9A 1LOSA 3MBFA 3P7YA 1LYXA 1F74A 4LVBA 5A5WA 2ZA2A 2YR1A 3TW7A 4DBEA 3OVRA 3I7QA 3T4CA 4JDYA 3W87A 1TQXA 1DBTA 3ABOA 3NXFA 4K7YA 2YXGA 3TX9A 4XTIA 2GVGA 5J5DA 1FCBA 1LROA 1TPDA 4FNUA 3IV3A 3W7JA 3P81A 3MUXA 4HHPA 4QITA 2J9YA 1XUZA 2RDUA 3DGRA 2D73A 3CIWA 3TQ0A 1SW7A 1JCXA 2ZZ6A 3S5OA 1YADA 1XBZA 1W5OA 5SWUA 3TSBA 3RNDA 1HL2A 5CSRA 4BK9A 1M7PA 3HG5A 4DO6A 1UB3A 3QM3A 2Y6ZA 5EBUA 3N2MA 1P4CA 3FA5A 4MYXA 5CSSA 3NYZA 1Q6RA 1H7OA 3ANYA 1AMKA 3DFOA 4I7WA 4EIVA 2ZA3A 2CLHA 1OF6A 4LTSA 1EWEA 1RV8A 3ATZA 1KLYA 2Y89A 5TBOA 5D37A 4UC5A 2C15A 2V30A 6TIMA 3R13A 3QW3A 1OK6A 3BPWA 4CNPA 3CPRA 3SY5A 1S5TA 4QISA 3CIXA 4JS3A 4LS1A 2R8WA 1SO5A 3EXRA 1CX9A 1R2TA 3KRSA 1G6CA 1SO3A 1VCFA 2YYUA 4DPPA 3LHWA 5AN7A 4AHOA 4JGDA 2Y7EA 4U28A 4QNWA 5G4EA 5BOOA 1P1XA 3W7KA 1Z41A 3PR2A 1V5XA 3W7GA 3UWWA 2QJGA 2A7NA 2YZRA 3STFA 4DO5A 4UNKA 5K9DA 3O63A 1KTBA 4O0KA 3C2RA 3QSTA 4WQ6A 2BTMA 3DHDA 1HUVA 4ZQCA 3QW4B 1S5VA 3UD6A 3W1XA 5D2TA 4O4VA 2HS8A 3W88A 3LHZA 1QDSA 5TIMA 3GAKA 2IQTA 5U7SA 2GJNA 3EWXA 3BV4A 3W1NA 4LW7A 3QPYA 3PB0A 4WXZA 1WA3A 4GXMA 4A22A 1LBMA 2VENA 3ABSA 1FWWA 4I7UA 4PH6A 3W86A 4LVDA 1FCUA 3GVGA 4O13A 1S5WA 4FX8A 3UNDA 5C55A 5AB3A 3DKLA 3UWUA 3P8IA 3M0ZA 1LP6A 1O4UA 3TU9A 4NVTA 4LU0A 4UFHA 3L5LA 2QCMA 1DJQA 1LRNA 3TCEA 3G1YA 1NEYA 4LY8A 2F84A 2VEIA 1H7NA 3GDLA 3HF3A 3IVTA 4Z0SA 1ZAJA 2Z1BA 1OFOA 2ZZ2A 2ZBTA 1PIIA 2A1YA 5F2IA 3W1QA 1IXOA 3ABQA 4E2DA 3NNTA 3W7IA 3C8FA 4HPJA 1SW3A 2FB3A 4JDBA 3C3NA 1JR1A 4NJIA 4CLMA 3P61A 4XQ6A 2A6LA 3KRZA 3N9RA 5LGXA 3W7HA 3NQ8A 4PL2A 4CQAA 2A7PA 3PG8A 3W23A 2GQAA 2JK2A 5EKYA 4GRSA 4AEOA 4EVZA 3W2KA 3A21A 4GC4A 2FPYA 1YTDA 5I3KA 1Q6QA 1OFPA 4HKPA 3W84A 4RR4A 3LHVA 3CHVA 4JTHA 5D33A 2GPTA 3QQ0A 3CWOX 2E1DA 4C1LA 3AJXA 4QAIA 4AAJA 4O10A 1JJKA 2Y88A 3N14A 3W07A 1U83A 1EP2A 4FX6M 4HN4A 2A21A 1QMLA 3UPWA 5DCDA 3PULA 1QPQA 3MHGA 1V7YA 2H3DA 3TQKA 5C54A 3BG5A 1VHCA 4N4PA 3DFPA 4M6PA 3MWAA 2ATSA 5LHFA 3P62A 1QNVA 2HTMA 3GDKA 2RDTA 3GK0A 4UTIA 3G1FA 4MFEA 4A3UA 3QJAA 4M7TA 2JGYA 2ZRUA 3L0NA 3TAOA 4FO4A 5AHMA 4UTKA 4JTUA 1YXYA 3P82A 4ADTA 4E38A 1N55A 4RLIA 2OT0A 5DXYA 1D3HA 3FJ6A 3GR8A 2WNZA 3L2IA 3PS7A 3MP5A 1EEPA 1VQTA 2X2GA 1WQ5A 2Q3RA 3CT7A 2V5LA 1Z42A 2E77A 1Z44A 1TV8A 1W54A 3W2NA 1JVNA 3HGJA 4GUGA 1OX5A 1L6YA 5D04C 1CW2A 1GOXA 3S6DA 1G4TA 5KZDA 4JTTA 3CWNA 1TRIA 3BW4A 3M7WA 4ML9A 1AW2A 1AG1O 1RD5A 4L4MA 4ALDA 1FUYA 3GAYA 2Q8LA 3KRUA 3WK1A 1H1YA 1G67A 1TTJA 4O15A 3NL6A 1WOAA 1HTIA 3DENA 3SSJA 3G1XA 1VYPX 2W0UA 2OX1A 2WO5A 4YMZA 3EEGA 3M5YA 1OF8A 1UUOA 2A6NA 1J2WA 3S8HA 3IVSA 3JR2A 3PC0A 4BWLC 4HNTA 3KVLA 4MLRA 1LM1A 3W7LA 1MEHA 4O12A 3TNOA 2DZTA 3HG2A 2A4AA 3W71A 2R94A 1ZJIA 2EAWA 2X1TA 1XI3A 2CZDA 2WOQA 1DQXA 1QO2A 2FJKA 4GBUA 4UNLA 4Y96A 5E1QA 1SR9A 1ZY9A 4M6VA 4K38A 1KTCA 3BLFA 2NUYA 4XKYA 2QUTA 3G18A 3HG3A 3I68A 4DBDA 1NVMA 1OYBA 5F1VA 3STCA 1KBJA 4UMBA 3DI1A 1TPEA 3UYCA 3M5XA 4O50A 2ZZ7A 3C0JA 3LV5A 4IMDA 2B7QA 3TROA 5D30A 3NQMA 5BMWA 2ZDRA 2EF9A 4QM1A 3N9SA 4UTJA 4K8HA 2VEMA 5I3GA 2VFIA 1L6SA 3MI2A 3PWAA 3QMSA 1GTHA 1JRCA 2B7NA 2VFGA 3LCLA 2WJZA 1YLVA 1NF7A 3TC7A 1F05A 1SZGA 2QDGA 1PVNA 1R46A 5HWNA 3NZRA 1I2NA 4UCGA 1X1OA 2O7QA 4NZJA 5LKYA 2NV2A 1ADOA 1RR2A 2QJIA 4FXRA 4M7SA 2RHGA 4X22A 1DV7A 5DN1A 3ZWSA 5EL1A 3WJYA 3W22A 1Z48A 3H55A 1K8XA 1QO5A 3FLUA 3O16A 2BXVA 4XKYB 3VNDA 1EB3A 1IIHA 4TR9A 5FF4A 1W5PA 4LV9A 1EA0A 4JN6A 1VC4A 3TR2A 4GUIA 1KM3A 1Q6OA 4KFPA 3M41A 3NQEA 3YPIA 4FNSA 4O54A 3F4NA 2PRMA 2F7FA 2VFEA 5LNVA 1F2JA 2RKXA 4IX0A 1IXQA 4E2BA 1RQEA 4DEFA 1T8XA 2Q8ZA 3PM6A 5G4WA 3NQ6A 1TPC1 2HS6A 3TE9A 1GQNA 2QR6A 3GDMA 4UTTC 5DY2A 3W72A 3G1DA 2E6YA 3GZ3A 3LTYA 4POCA 5DELA 3GDRA 4HNUA 5HR7A 4QJ1A 3UWVA 2V9DA 1J4EA 3BG3A 4Z1CA 2VKZG 2QCCA 3GYEA 5DCBA 3MHUA 3GNNA 3F1QA 1FXPA 5EPDA 4EOUA 1ME9A 3NM1A 1DOSA 4UFIA 3MI3A 2WV8A 1LBLA 4JR5A 1H63A 3LHUA 3M6YA 1LRTA 1EX5A 1WBJA 4JTIA 2QDHA 3W2UA 2PC4A 2B7OA 4L4LA 3BLEA 4UIOA 3T44A 3G0XA 3QEZA 2ZTKA 2QCLA 3L5AA 3N3MA 4K7VA 2V82A 3RFAA 2P0OA 1BTMA 3M1ZA 3PVFA 4DELA 1A5BA 3FS2A 3W7PA 3LGEA 1UJPA 4KWWA 3UY8A 2QF7A 1H1ZA 5HUPA 4Q32A 1WDWA 4FNTA 3M5ZA 3PAJA 3W85A 3P5YA 1G7UA 3FKRA 3T40A 4JTGA 2TRSA 1QCWA 2DJXA 3W2MA 4IWWA 1JCYA 1OJXA 5FESA 3MO7A 3G3DA 1XBXA 3EWZA 3B03A 4X3ZA 4JX5A 2Z6IA 2JGQA 3BO9A 4UMCA 3VCRA 4N6EA 4Z08A 4AWSA 2V81A 2H3BA 5CZTA 2I14A 3O07A 4WOQA 5CKSA 3JRKA 1WYIA 3C2OA 1O95A 2HMCA 1P0KA 4TX9A 3EX1A 3QQ1A 3L21A 4ZL1A 2OZ0A 1O5XA 5I3JA 1OYAA 3E12A 5FI8A 3G24A 1BWKA 1FBAA 4IGHA 3SR7A 2Y70A 1K3UA 2DZSA 1R47A 2A2IA 3LCWA 4JEQA 5K7JA 5LNSA 4UTMA 5H2ZA 2ZYFA 4Z1DA 3MW7A 3P84A 1QOQA 1HO4A 1DQWA 4NNAA 4LVGA 4ZMGA 3B04A 3R5EA 1GTEA 5A8GA 3W1AA 1P5BA 4O1BA 4MY9A 1H7PA 5HQEA 3TSDA 4UUIA 3LV6A 4LRSA 5LSMA 2DZVA 4FEZA 2VFDA 4AXKA 3NPUA 2QKFA 3HO8A 3GLCA 2Y85A 4UXDA 2G97A 2V2DA 1H5YA 3O06A 4R33A 3NAVA 1F73A 2LLEA 4WD0A 4YCPA 3GKFA 3IGXA 1TV7A 4MVAA 1XXXA 2QUUA 4O16A 3C6CA 3W1PA 4EWND 3QF0A 4ZVJA 5D2WA 1KV8A 1MSSA 1TCDA 1SW0A 4NJKA 3KVJA 5DBUA 1K8ZA 1H7XA 3FYOA 4D2JA 2G96A 4G1KA 1C9DA 1B4KA 1TPUA 3KFTA 1FDJA 3KX6A 4P2VA 4E0CA 3UWQA 1QOPA 3QYQA 1I45A 4DQWA 1LDCA 3NQFA 4FIQA 1KFKA 3LRMA 4WZHA 1WAUA 2CLKA 1FY6A 3Q37A 4RCXA 3QPZA 3IGUA 5D32A 2YW3A 4PA8A 3WK0A 4DXVA 5MHBA 4IMEA 1PS9A 3LCGA 3UXAA 3GXNA 3TKFA 1FCQA 4Y9AA 3T78A 1RQBA 1H62A 2ZZ1A 2A5HA 1RPXA 3NQCA 4RZ6A 1A5CA 4HIBA 4XTDA 3ZS4A 1ZCOA 2WSQA 1G4SA 1K7FA 3NL5A 4C1KA 5FF0A 5I3FA 1W3NA 3CEUA 3LHYA 1K03A 5AYXA 5GVJA 3FJLA 2H8XA 3DKJA 3UWYA 1C29A 3H54A 1P0NA 2VFHA 2DZPA 3F4WA 5G1TA 3DU0A 3IGSA 3DH7A 4ADUA 1AL8A 4UFMA 1JUEA 2CZEA 2Q3OA 4MLJA 4FNPA 2V2CA 3L67A 3GDTA 1TJPA 4O1AA 1K7EA 4IXHA 3NQAA 1AW5A 2H8ZA 1LBFA 4TU1A 3HPSA 4WUIA 1G69A 1DJNA 3EXTA 1EP3A 4MIMA 2NUXA 1VRDA 4NUWA 3HB9A 1JCLA 1I2OA 1Q45A 4N4QA 4FNRA 2ZRVA 1LZOA 3OEXA 3B06A 3TK7A 2ZFAA 2YFNA 3H53A 5AYYA 2AAMA 2XFWA 5EA9A 2VEKA 5EMUA 4H6KA 4I7VA 4YL2A 1TIMA 3WK2A 3O6DA 1TMHA 2VXNA 3NQ7A 5AHFA 1YDVA 4A2SA 2WNQA 8TIMA 1ZENA 5C5YA 1B57A 1BEUA 2Y62A 2G95A 1R2RA 3FEMA 4XWUA 4LNYA 3BVJA 2E5CA 1SPQA 3NG3A 1GZGA 2E5BA 2QCDB 3QMTA 4NZFA 4OWGA 3S0CA 2A85A 4M19A 2RFGA 3EWBX 2P1FA 4IX2A 3S1UA 1M7OA 3KVKA 4MZ8A 1JRBA 1B3OA 3TW6A 3WK3A 3W7DA 4CCDA 1DVJA 1LORA 4RK8A 1H7RA 4CCCA 4R53A 5HINA 4AB4A 5K4XA 2RDWA 1GYLA 5IBXC 5HMSA 1GJPA 3MJYA 1YXDA 3NQGA 3SIZA 3BGJA 1WOBA 3NM3A 5I3HA 3TIMA 4O4WA 4UR8A 4WX2A 4IUOA 3M47A 2JKEA 4ZQRA 3R8RA 3U8GA 1G4EA 5K9CA 3LM7A 4JX6A 2EHHA 3ZWTA 3G1VA 3DXIA 3HGRA 3PSWA 3OIXA 1BKSA 2Z6JA 1TO3A 3C61A 3SECA 4OV4A 4N9DA 1HFBA 2WSYA 4Y8FA 5D03A 1MEIA 4PCFA 3IVUA 1R2SA 5AFDA 5HULA 1F6PA 2CWNA 3LXAA 1KV5A 2NX9A 3W83A 2OT1A 4NJHA 4FX7A 4Y6GA 3U2OA 3STGA 4RXGA 1A5AA 3CTLA 4Y90A 1IXPA 2PURA 4HSOA 1YTKA 4Q33A 4YWIA 1GYNA 4XZ9A 2YGYA 2J27A 5EYWA 1OVDA 4UR7A 4ORMA 4TMBA 3B8DA 3KVMA 1VYRA 3W7QA 4N9EA 3WJSA 5D2YA 3G1SA 1VCVA 2NXIA 3L65A 3NO5A 4MZYA 3LDVA 2B4GA 3G0SA 2PE4A 5CPNA 4A21A 2CZ5A 1LLWA 4W9TA 1UBSA 3L68A 5DXXA 4OV9A 3W9ZA 3BLIA 4O11A 5FEWA 1G7VA 4UMAA 3P8JA 3IEBA 1O94A 1KA9F 2DZXA 1SZFA 2C1HA 3OA3A 5G1YA 2FPVA 1XCFA 4RXFA 1FQ0A 1L2UA 2QCFA 3P67A 4NX0A 3TV8A 3P60A 4R34A 4S2CA 2FIQA 3M43A 1XKYA 3LXBA 1T99A 1OFEA 2CLEA 3MYOA 4FB7A 1N7KA 3S5YA 4MZ1A 5KITA 3LLDA 1KFJA 4GUFA 2XN2A 3USBA 3C4UA 5E0KA 3EKLA 4NNBA 3FIGA 2CLLA 2C19A 4OE7A 2WPBA 4IQLA 2ZCGA 3HIJA 2QCGA 1SUXA 3B0PA 3DFTA 5L6UA 1IIGA 5AC6A 2NV1A 4RZ4A 3TJXA 4QSHA 3UQNA 2DJLA 1KBIA 3S1XA 1DKWA 1FCVA 1LOQA 1TPH1 3PSVA 1VZWA 1SQ7A 4OT7A 3SI9A 4EF8A 1YDOA 3TXVA 1TTPA 3B0UX 5D02A 4HNNA 5FEZA 1O60A 4ORIA 3HJZA 2A0NA 4EF9A 1W5MA 3UZJA 1K7XA 4QNEA 4UTTA 3LBMA 3MI6A 3M9YA 3EX6A 4WXYA 1U5JA 5L9FA 4O28A 3A22A 5H91A 3THQA 2E6FA 4LWWA 2TYSA 3AO0A 4ZQOA 5F1UA 3KXQA 3PY2A 2C3ZA 4JICA 1F7BA 3PB2A 3SFKA 3GXTA 1TYGA 3MP4A 4WJEA 5LNUA 1VYSX 1GPWA 1OG0A 1TV5A 4QQ3A 2BZNA 2V8ZA 3C52A 4HSNA 1LOLA 1MEWA 3DFQA 4NX5A 4X9SA 3W3OA 2QCDA 2W79A 4O52A 4JTSA 4LT9A 1F5ZA 1GVRA 3INPA 1TTIA 3NQDA 1TPB1 5T26A 1KM6A 1XM3A 3W74A 1IXNA 3FFSA 2Y7DA 3NOEA 1KFBA 1ML1A 2PCQA 3S5ZA 3MMTA 5FEPA 3O6YX 1WXJA 2NUWA 3SZ8A 1JCNA 2OCZA 4FIRA 2ALDA 3GKAA 1KLZA 4IPJA 2X1UA 1W5QA 4PODA 1X8FA 3NEVA 5AC7A 5BRBA 3BGGA 3BW2A 3P74A 4OU1A 2CU0A 3UPBA 2QEZA 4CNOA 3NZ1A 1TPWA 2NWRA 3HGSA 4ZQNA 1KM4A 5FF7A 3QH2A 3TSMA 3G1HA 2Z0IA 4ZQMA 5HR6A 2CLMA 2FTPA 3L9CA 1BWLA 4J9JA 1R30A 5F2LA 3R2GA 4DO4A 4N02A 1ME7A 3A5VA 4IMGA 4BF9A 4BR1A 4O57A 3ABRA 2Y61A 2O7SA 1D9EA 3ATYA 4LUIA 1AW1A 2J6XA 1OFQA 2CLIA 5KZEA 3MHFA 2YW4A 1SFJA 3RLVA 2J88A 1DL3A 3LRKA 4IMCA 1TJRA 2FLIA 3KAOA 5HNRA 1WBHA 1JULA 4UFJA 1WX0A 1H51A 4RX0A 2QCNA 2P10A 2FFCA 1W8SA 3NL2A 2NLIA 3QMRA 1ZAIA 4DPQA 5KZMA 2DZWA 3A24A 1PCWA 3S1WA 4PFMA 3NL3A 2E68A 1EUAA 3W7RA 4IMFA 5DY3A 4CCEA 4UTUA 4AF0B 1VR6A 3KOFA 3NPWA 3HOJA 3TH6A 3NR0A 1FWRA 3WJZA 1KM1A 1KFEA 3W6YA 3E02A 4JNMA 3NPVA 3GR7A 3HBLA 5AHIA 4OBTA 2FQIA 2NZLA 2C14A 4JIQA 3W7NA 4BI7A 1A5SA 4YXGA 3IIZA 4O1CA 7TIMA 2XN1A 1KM0A 3WJWA 2WNNA 3V1PA 2BLEA 2DORA 3DFSA 2GQ9A 1FX6A 4N9BA 3E49A 2JKPA 1VLIA 3PBVA 2QAPA 1OX4A 4YLWA 3N2XA 2V2HA 3B4UA 2Y7FA 1WV2A 1M5WA 2J24A 3TJLA 2C13A 2VFFA 1L9WA 3EX4A 3UWZA 4CNNA 2VOMA 4JX4A 1TREA 2BX7A 4O0ZA 3L0KA 4AMAA 5D09A 4IJBA 4JXCA 3TXZA 4JYEA 2NXGA 3NPXA 4HT3A 5G2HA 2YYTA 1T0OA 4JTFA 4UFKA 1PL9A 4O1DA 3W1MA 2GVJA 2QAFA 4TIMA 2ATMA 5AHEA 4HNVA 3M5VA 2FDSA 2NXHA 2E09A 4S1FA 4ICNA 4OQVA 4AHQA 1YDNA 3NQ2A 4MKNA 1ZALA 3QFEA 2ZZ5A 5DLCA 5IBXA 4ZZ9A 4JTJA 4RJEA 1W1ZA 2FPTA 5AYZA 3UY7A 1I2QA 5KTLA 3FYPA 1QWGA 4MJZA 4GWEA 3HQ1A 4OHQA 3EXSA 3SGUA 5AHNA 1GG1A 3RK8A 1S3HA 4ZQPA 4LOCA 1KM2A 4O18A 2V5BA 3P5ZA 1PHQA 4GUHA 3NGJA 1KM5A 3T7VA 3JS3A 4GFSA 2G5WA 1H50A 2I9EA 3GIYA 4K8EA 5DBTA 1W31A 2C6QA 5G2IA 3IRDA 4N2YA 3GB6A 2FB2A 4UTLA 2RH9A 5AHLA 1FDYA 3DBPA 1QPRA 3W1LA 2GOUA 3LB0A 2JKAA 2CFFA 4R7JA 3STEA 2ZRWA 1OHLA 3S42A 2ISWA 3K30A 2C18A 1PCKA 4DF2A 4KFOA 2YCEA 3RU6A 4GJ1A 2ZRYA 3SGZA 4AVFA 4NJGA 4DF0A 3PUDA 4TMCA 5CZ0A 1EPXA 3LRLA 2XN0A 1JQXA 1THFD 4NU7A 4NNCA 5HJLA 1EIXA 2ISVA 3W7EA 3I7RA 4S2BA 3QC3A 5CPOA 2WQPA 1VH7A 1YXCA 4OGZA 4GE8A 1SZNA 5CZJA 5TQLA 1VLWA 5K4ZA 1YPIA 4AH7A 3W73A 3MP3A 3HMJG 3Q94A 1OFBA 2EGZA 2W6RA 4MYAA 1C8VA 2HSAA 3OG3A 2VEPA 4MUZA 1W3IA 1TRDA 1Y0EA 5AOUA 5FF2A 4UTWA 4AHPA 3LCXA 4AWTA 2WSRA 5CPLA 2X16A 3L66A 3IIOA 1LTDA 2H6RA 5LHEA 3LTSA 1TQJA 3OHIA 1HG3A 4QIUA 1GVSA 1QAPA 4O19A 1MO0A 2QCHA 1H7WA 2JBMA 4MY1A 1W37A 1PV8A 3THAA 1ZHAA 1VJIA 5BNKA 3O1NA 3VE7A 3W7CA 4WY0A 1IF2A 4PL1A 5CG7A 4FXSA 1EUNA 2ZRZA 1NSJA 3CM4A 1I2PA 4JY9A 3RLUA 3BK0A 4AWUA 5KSWA 3F03K 2DP3A 4NT0A 5AC8A 5K3VA 3G22A 2BWGA 3HPXA 3N73A 1MZHA 3RMJA 4CQ8A 2X30A 4H3DA 4BFAA 2ZQ0A 4YCOA 2WKJA 1Q3NA 4LUJA 3EWWA 1XBYA 3C2VA 3E9AA 2KZHA 4LVAA 3CEPA 3TQVA 2NX3A 5DCEA 1FWTA 3ZR4A 5LNRA 4WOZA 1GVFA 3OBKA 3TFXA 1FXQA 1GVQA 3TC6A 3Q2DA 1MXSA 3PUOA 4IPIA 4N6FA 4NXSA 1SFLA 3L0GA 4HPXA 2C0AA 3EWUA 4K6AA 5D2VA 3O8AA 4LC6A 1VPXA 2OJPA 3M44A 3LBCA 3WFAA 4WY0B 6ALDA 2PRHA 1OX6A 1RQHA 2DZUA 1AK5A 1O5KA 5G2WA 5D05A 1X7FA 3B0VC 1OK4A 4Z0JA 4Z1AA 1CI1A 1SO6A 1M6JA 4H4IA 3TMQA 3OVPA 3R89A 4FHAA 1VCGA 1T96A 1J5TA 3LCHA 3MYPA 2CZFA 4MFDA 3LI1A 3S9YA 1H60A 2NX1A 3V75A 1SZEA 3N19B 3W75A 2Y63A 2YFOA 1XBVA 4UTWC 3O6CA 4K39A 2H90A 2CLOA 3HPZA 4NQ1A 1B4EA 4A29A 1JUKA 4TO8A 2A7RA 1RZMA 2B7PA 1I2RA 1KW1A 3GXPA 3W70A 1FWSA 4BI5A 4A2RA 1W5NA 3PG9A 4BI6A 1TSIA 1VGAA 4RV8A 3L5MA 1YTEA 2PRLA 3PBUA 3ELFA 4PC8A 1KFLA 3BARA 3I6RA 2YDAA 3P80A 2UV8G 1XUUA 3TA6A 2I1OA 3VKJA 4MOZA 2QUVA 3O15A 5FF3A 1DORA 1ICQA 3W1UA 3A9IA 1JCJA 1G4PA 1OX4B 2TSYA 3EX3A 2EPHA 3U6WA 1TPVA 2X1RA 2X1SA 4LV4A 4NJJA 3TAKA 2TMDA 5HWJA 3B05A 1TTQA 3C2EA 1UASA 2GJLA 3UZ5A 5EY5A 2R14A 3EX2A 1W56A 3CB8A 2J9ZA 3S5NA 1GT8A 4IOTA 3CC1A 2C16A 4XBKA 5CPMA 3T55A 5E93A 1H61A 1SU5A 2YPIA 4M5PA 1SO4A 2ZZ3A 3PUEA
chains in the Genus database with same CATH superfamily
1UR9A 5D2XA 3U2ZA 3E5BA 2CLFA 3DYMA 3SRDA 3UXDA 1XDLA 5HOSA 2Z29A 3UESA 1XC4A 1VIZA 3GR4A 3PAOA 1JD7A 1UP3A 4KWVA 3L4WA 1GWJA 2EG8A 4LRTA 5BW6A 3FDKA 3GHRA 3CV6A 1W9DM 2BSLA 2J4GA 3MVIA 1HKIA 2YXOA 2FZ8A 1YPFA 3H26A 2YL8A 4JYFA 4IQEA 4LAMA 3W1RA 3WEZA 3DERA 2ZUMA 3C56A 1Q8AA 5ABTA 1D3GA 1YNPA 1R9YA 3KS5A 4GI8A 4MJMA 3AIEA 5CGQA 3VI2A 1EDQA 1VS1A 3O05A 3EMQA 1GEQA 1ALDA 1LLZA 4HU3A 3ZJ8A 1UZHA 2XVLA 2NWSA 1I4NA 4UFLA 3C2FA 1BTCA 3M0XA 5G5IA 1ISWA 1EP1A 4Z2LA 4V1YA 3LERA 3GG0A 2QJHA 1CZ1A 3BWWA 3NVTA 3ITYA 2E1WA 3QYSA 3OIHA 2XZ7A 2NSXA 3QLLA 3KDOA 4F4RA 2AMXA 3WCZA 4BF5A 1RVGA 1UC4A 3B0XA 3SW6A 1FWDC 4DWSA 4JTKA 4FF7A 1HVQA 1NAL1 3MBDA 4MTVA 4ZB5A 2W67A 3I7SA 1XGDA 4ZCWA 4R27A 2D69A 1NF0A 3IUHA 4B5NA 3VD7A 3FGCB 4O14A 3HGOA 3IJIA 4PSPA 5K2ZA 2DU2A 2VELA 2WZEA 4IL0A 1WDQA 4M6QA 5BMXA 5U4NA 4C1NB 4XUYA 5M17A 1REQB 2E6DA 3BAKA 4D6IA 4HCLA 4J3UA 3EKZA 3F4VA 2PP3A 4LVFA 4K36A 4LX4A 1XDMA 3L4YA 3I65A 5E9AA 2J7DA 3IIPA 1X1ZA 2FZ9A 4Y9PA 1UUMA 1HJSA 4PTNA 1E5NA 2AQWA 3ZFHA 2VL4A 4XUGA 2PD5A 3RPDA 2E6AA 1M53A 4OTKA 3VE9A 4ADSA 1M1BA 4S23A 3QOMA 4MF4A 3AHZA 4O53A 1QNPA 3CWHA 1OYCA 4EACA 1D7KA 4LALA 4RNIA 2V5JA 3QSRA 4HB7A 4MB3A 1HF6A 2PDMA 2ZZ4A 1C91A 4WY0F 4IXXA 4QGCA 4ERIA 1UWSA 3W1TA 3VXGA 4AZCB 1EEXA 1XJBA 1ICSA 4HA3A 4C6OA 4JIPA 3E5PA 4N9CA 3EWYA 3AMGA 3W2JA 3TFCA 3G0UA 3DZ1A 3T42A 3G1AA 1ONRA 3WNLA 3DG3A 1HGYA 2QNEA 4L80A 2E9BA 2HDJA 4IT1A 3PZUA 1PIFA 1EWDA 2AKZA 5FJRA 2VGFA 3SCWA 1LYXA 3E0WA 4QJ5B 2CITA 4IGNA 3CAKA 3OVRA 3POHA 1XDJA 3WDIA 4ERAA 4PUNA 5AVHA 1DBTA 3RGTA 1C3FA 4WR3A 1DXIA 1DPMA 3IV3A 1EDGA 4HHPA 4XZMX 2V68A 4GO8A 3DGRA 2D73A 2IMRA 4PBFA 3S5OA 1XBZA 1XKJA 4GY1A 4P7QA 3GFXA 1M7PA 4IIFA 2R1PA 1UB3A 3I3DA 2W63A 2PWVA 3VDGA 2CWXA 3NYZA 1Q6RA 1H7OA 1P1MA 1AMKA 4I7WA 1RVKA 3TVAA 3H12A 2Z4GA 4V2XA 2J7EA 1HP4A 1H2JA 1UWIA 1RV8A 3ATZA 4N0RA 5TBOA 4J2MA 1T41A 4Q3MA 4UC5A 2C15A 2V30A 3R13A 3WLHA 4QJ3B 4CNPA 5TNVA 1B1YA 4JS3A 3MKCA 4CCZA 1SO5A 3I3EA 3W6MA 3UR2A 1R2TA 4JKMA 1CBGA 1EX1A 1SO3A 1VCFA 3LHWA 2YBVA 2Y7EA 1JPKA 4RPQA 3FXYA 3IK4A 3W7GA 6REQB 3STFA 3WF1A 4UNKA 4GZIA 4REQB 3C2RA 4ICCX 4C6QA 5XIAA 3BMWA 3DHDA 3RM9A 1HUVA 1S5VA 1X6NA 3W1XA 1QNOA 4O4VA 5T8GA 4GMEA 3W88A 4FPSA 2CHOA 3W1NA 2C71A 2HBXA 4GXMA 1PZ3A 3ABSA 3PZ9A 1FWWA 4PH6A 2ONEA 3CHFA 3GVGA 1WXZA 4HNCA 4FX8A 1UW9A 2WZMA 3DKLA 2XGBA 3FXGA 1NWUA 3M0ZA 3P8IA 4FOUA 1N8IA 4NVTA 3L5LA 2QCMA 2F84A 2VEIA 4XVEA 3PUGA 1V0NA 4HOXA 1TE1A 1YNYA 3L7RA 2G3JA 5BRQA 3B0YA 2YJQA 3W1QA 2VYOA 3ABQA 2OODA 4MAVA 5HMFA 5ABFA 4HPJA 2FB3A 3VGBA 4AZ7A 5EMJA 1UR2A 2GFTA 3C3NA 1JR1A 1BYBA 1LWHA 4I6VA 1V6VA 1OGBA 4XQ6A 3BH4A 3KRZA 3GH5A 4R7OA 3EYPA 3U9IA 4AU0A 2JK2A 4L65A 5EKYA 3WLJA 3A3HA 4ZB2A 3W2KA 4AD5A 3WQPA 1GGOA 5I3KA 5CJNA 4NP7A 1OFPA 2GGEA 3PZGA 3W84A 4FALA 3LHVA 3SUSA 3KBWA 5A6BA 5IHSA 1XLAA 3W07A 4BEQA 9XIMA 4H41A 4I90A 4JZ5A 4HVXA 4CN6A 5DCDA 2H3DA 2WMHA 4L56A 3K13A 5LHFA 3P62A 1UWUA 3GDKA 2RDTA 3GK0A 4A3UA 4GQQA 5A2BA 1MNSA 4FO4A 5AHMA 3CQKA 3CUXA 4H9MA 3CV7A 3CT2A 4RLIA 4QJ4B 3ZLGA 1V7AA 1Q7ZA 4AZGA 3L2IA 4QX4A 4LYRA 3QV7A 1VQTA 2X2GA 1WQ5A 3WUBA 2Q3RA 4DJEA 1IWPA 1Z42A 1Z44A 1UR1A 1XG3A 1FP8A 4GUGA 5D04C 1CW2A 1GOXA 3GG1A 3AUOA 3CWNA 3QOKA 1WKDA 2Z1XA 3BW4A 2INEA 3WQDA 2QVHA 3K4DA 3WEOA 1AG1O 1RD5A 3MMWA 1S2VA 3GAYA 3WK1A 3WF3A 1R86A 1G67A 1OC5A 3NL6A 2CHNA 3SSJA 3VX1A 1UPPA 1VYPX 4GXPA 3EA1A 2WWCA 3PTQA 4D6GA 3EEGA 3AXKA 1J2WA 2FMNA 3UF9A 3JR2A 4DB7A 3AYTA 3S8HA 1IEWA 1GQIA 4HNTA 3U4AA 2V63A 4W86A 4O12A 3HG2A 2Z00A 1V51A 5E0CA 3ITLA 3GVQA 3AIWA 4PTMA 2V3EA 1C93A 2R94A 5BXPA 1V6UA 1BXCA 5D9PA 1ITCA 2RAGA 3NFUA 4Y96A 4C6FA 2OX4A 4HU8A 4BQ2A 3BLFA 4AEFA 1M7JA 3G18A 4DBDA 4IM4A 1C8QA 5F1VA 2VX4A 1K9EA 2ZKMX 4TOQA 5FSDC 2OEJA 3M5XA 4O50A 3GBDA 3GFYA 1PPIA 5HDRA 5BMWA 4QM1A 3AMDA 3PP7A 3QR0A 1VJSA 1V6WA 4G8TA 1L6SA 3MI2A 1ZJBA 3PWAA 4E6MA 4OUIA 4XAPA 4GVGA 1J0KA 2WJZA 1YLVA 4MG4A 2QDGA 1PVNA 3CUJA 3IV8A 1I2NA 1X1OA 1LLOA 2H9AA 4AX6A 5FJPA 4FXRA 2PUZA 1YDYA 4CQDA 4YHGA 4X22A 4D72A 1W8GA 3ZWSA 4DUVA 1X96A 5AC5A 3WG6A 5FACA 2HPIA 3VNDA 1EB3A 2WVVA 1SGJA 1US2A 1IIHA 2DSKA 5D9OA 3LGGA 4YJ5A 2PP1A 1EA0A 1BD0A 2C91A 1VC4A 1KM3A 2PD9A 3YPIA 3B9NA 1VRXA 1F2JA 3PK7A 1KR0A 1RQEA 4LBSA 3M0IA 3NQ6A 1TPC1 5ECVA 3TE9A 2QR6A 2PWGA 3LTYA 1QI0A 2F6UA 4TUFA 2QDEA 2VEGA 4POCA 4I3GA 1AQHA 3R10A 2JEPA 1BYCA 3LNPA 2J78A 3WDRA 3NM1A 4UFIA 1OD0A 2WV8A 1LBLA 4JR5A 1B9ZA 4W4QA 1EX5A 1WBJA 4HK5A 1R3VA 1XLJA 4TQTA 3QEZA 4E8GA 3N2CA 2QCLA 3N3MA 4GYPA 1DTNA 4Z2IA 4DELA 3HTWA 3LGEA 2XTKA 1ODUA 3UY8A 1H1ZA 3TYAA 1RSCA 1WDWA 3W85A 3P5YA 4ACZB 4KS0A 3W2MA 4CNTA 1OJXA 1NOFA 5C9RA 4R7WA 3G3DA 3QV9A 5IOBA 5A3HA 4B9ZA 4A3RA 1J01A 1MFUA 4HQVA 1DEDA 3EPOA 2DVXA 4XAZA 4AWSA 2V81A 1VFFA 1BLIA 1TIWA 2QJMA 4TV5A 4L4OA 4M0XA 1XLCA 1FHVA 1RJRA 1KNWA 2CBIA 2J8TA 1ZBWA 2OWWA 3QV6A 1AD1A 3QQ1A 2HXTA 2HXUA 2PDQA 2BY2A 5I3JA 5JH1A 2QW5A 1BWKA 1FBAA 3CH0A 1R47A 3LCWA 3URBA 5K7JA 1UD4A 5A2AA 1KO0A 3ONBA 2PWEA 1E6RA 2DT0A 4AZCA 2PDYA 4Z1DA 2AAAA 4Y9NA 1DQWA 4NNAA 3UCCA 4LVGA 3L2LA 4WKHA 1JZ5A 1P5BA 2V3FA 5HA7A 4O1BA 4P7RA 4ZB0A 4MWAD 1DJIA 2ZOXA 1H7PA 3QLDA 3TSDA 4UUIA 4XAYA 3LV6A 4YU1A 1CLXA 4LRSA 2HEJA 1U22A 2PDJA 3VGHA 2Z27A 3NPUA 3UG4A 5CPTA 3GLCA 3AS3A 3CAQA 4DJDD 2G97A 2V2DA 3QKEA 3O06A 3NAVA 2WQDA 1U2YA 1E1EA 4RDZA 1TV7A 1JFHA 4MVAA 2VOTA 2I57A 4L6DA 3C6CA 2BVDA 5CAHA 1WKEA 4C65A 4EWND 1ITXA 4V1XA 3E0VA 5DBUA 3FYOA 1IZCA 1AVAA 1TZZA 4CD4A 3KX6A 4E0CA 4NAEA 1BG4A 1BFNA 3UWQA 3K8MA 1K77A 1X39A 3G6LA 1HJVA 1WZLA 1DE6A 5AVNA 4RCXA 1A47A 1GVEA 1OGGA 1R3TA 4GYJA 3IGUA 3HFTA 5D32A 4PA8A 2PAJA 1CLKA 3WK0A 5CBIA 4DXVA 4AC7C 4Y9AA 1LT8A 1GNXA 2IKGA 4NL1A 3BZGA 1V4YA 5JXQA 4C91A 3DBNA 2F8QA 1A5CA 1AH0A 2OQLA 3ZS4A 1ZCOA 2GZXA 1G4SA 1K7FA 2P3ZA 1MXDA 4WEVX 4DXXA 5IFTA 1S1PA 3I6TA 1P0NA 4QAWA 2IXUA 1V6YA 4GQ0A 1IEQA 2DZPA 2Y24A 3VIGA 3IRSA 3IGSA 3DH7A 4ADUA 3JUGA 1AL8A 4UFMA 4M8UA 3SY1A 4OBSA 4MNMA 1LL4A 1RH9A 2V2CA 2WVTA 4DJDA 3HN3A 4MKVA 3K8LA 3ARVA 1DWJM 1K7EA 4IXHA 2YIHA 3NQAA 4TU1A 3GG7A 4P8XA 2WZHA 2PMQA 4GISA 3WH9A 1CENA 1FWCC 3VK5A 1IEVA 4NUWA 1Q45A 1HIZA 2XUCA 2ZRVA 4FNRA 1LZOA 3OEXA 3QGVA 2PDPA 2VDIA 2YFNA 2GLKA 1TELA 5EA9A 2VEKA 1D8WA 4PBGA 3MV01 4E4FA 4I7VA 3TN5A 1KRCC 3VIJA 1A80A 2CBUA 1TMHA 2VXNA 2I5IA 1VEPA 1ZP4A 2WNQA 2IW0A 2WKGA 8TIMA 3UR8A 1XG4A 4UQ9A 3NO3A 2E28A 2WK2A 3T8QA 5FJIA 2YDSA 1IT0A 4FAMA 1HJUA 3VILA 2QCDB 3QMTA 4FLRA 4OJYA 3LMYA 1SFSA 4D1JA 2AL1A 4ZOAA 4GX8A 3KTCA 2RFGA 1Y8BA 3O9NA 2FH8A 3G2GA 3SRFA 3VNYA 2RJGA 1IZKA 1DWHM 2ASHA 1B3OA 3WK3A 5HANA 4PUKA 4GNKB 1DVJA 4PMNA 1IZJA 1F8IA 1O1ZA 3QR1A 4AIBA 4R53A 4AB4A 4LCSA 1BYDA 2QQ6A 4U5IA 1TFVA 3RCYA 1XRFA 2MANA 4J28A 3BGJA 3WDJA 2CYGA 3MMUA 5I3HA 1MUWA 4I9TA 3LSCA 2JKEA 4KQNA 1BSIA 4ZQRA 1V77A 1G4EA 1VP5A 2Y1HA 2EHHA 1HKJA 3G1VA 4JHOA 1TO3A 5REQB 2WC4A 5JBEA 4DAIA 4B5TA 1OCQA 2I9UA 2BY3A 1NWSA 3LXAA 3ABZA 2NX9A 2XPKA 2OT1A 1XF0A 3JW7A 3ZXWA 4H7CA 1NFPA 5LIYX 4JFUA 1V02E 1VPYA 4RXGA 1A5AA 4AFYA 2WCGA 1IXPA 2PURA 2DSUA 1KKRA 4Q33A 1ISXA 1GYNA 1HJXA 1XS2A 1XRVA 3KW3A 1BF6A 3TZNA 4GCXA 1YPXA 4TMBA 3IS4A 4O1FA 3CZ8A 3SBFA 1DJXA 2V67A 4GZJA 3PZVA 1VCVA 5H8MA 4MZYA 5PTDA 4MDOA 3VDHA 4ZA0A 2CZ5A 3UW6A 2BB0A 4W9TA 1QHPA 4HA1A 1QWKA 4O11A 4UMAA 3P8JA 3AALA 2VZVA 3BJFA 2JF6A 1KA9F 1VBGA 2C1HA 2F6XA 4S3AA 2QCFA 4I9MA 3WMCA 3BLDA 1D8CA 4NX0A 1TMLA 3WQVA 2QUMA 1OFEA 5AKQA 1AJ0A 2FVLA 1OADA 5LA0A 3IJ9A 2XN2A 3KZPA 5CC3A 2DIJA 2D0FA 4NNBA 2C19A 2WPBA 3N1AA 1UMYA 2QCGA 4F0LA 3AMCA 1KBIA 3RCNA 4DJDC 4GIEA 4KETA 1VZWA 3H2AA 4PMYA 2CLPA 2OGYA 1M7XA 1ZPTA 5D02A 3PTMA 1B3WA 3E0LA 2A0NA 4KEMA 3UZJA 4QNEA 2IPFA 4W8LA 3LBMA 2ZADA 2C79A 1JDDA 5ECUA 3WLLA 1CGUA 5H91A 5F1UA 3KXQA 3PB2A 3SFKA 1TYGA 4WJEA 1VYSX 4QQ3A 3E3HA 3I10A 1LT7A 5CPQA 2BZNA 3CB3A 4NX5A 4LT9A 2WB5A 3XINA 3FJ4A 5T26A 4YTTA 3DCPA 3W74A 2PCQA 1UP2A 2Z7KA 5CZKA 4AW7A 3ITVA 5EB8A 2CEQA 4FIRA 2ALDA 1W1VA 1XRTA 5CC6A 1X8FA 2VJXA 3A4XA 1Y7VA 3BW2A 4OU1A 2BVYA 4CNOA 2J13A 4TXEA 4YPJA 1KM4A 3G1HA 2EEXA 2RDXA 1U33A 3AZSA 5FJTA 2CLMA 3BLOA 2D2JA 3L9CA 3B8TA 4MNKA 1C90A 4HSHA 1HJWA 3VNKA 4BF9A 1Q2RA 3ABRA 2Y61A 2O7SA 4EPDC 2OO6A 1D9EA 4LUIA 1SJCA 2CLIA 5KZEA 1W2PA 2YW4A 1AH4A 4F0HA 2FLIA 1FOBA 4ZBCA 3I6EA 1E40A 4DVOA 4UFJA 1J0ZA 3WMSA 2QCNA 2F6KA 1W8SA 2DH3A 5DMNA 1UZ4A 3L4XA 4Y2WA 5BROA 4DPQA 3N25A 2J62A 3A24A 3S1WA 4PFMA 4RE4A 3GHUA 2DSZA 5DY3A 1GZJA 3KOFA 4LXFA 4L61A 1BRLB 1W3HA 3NR0A 1XLLA 3E02A 1W9UA 3OZYA 4P8WA 3GR7A 3P0XA 2FQIA 3DYOA 4GQBA 2NZLA 1UD2A 1OB0A 1JZ4A 3UEQA 3W7NA 4ROPA 4GJIA 1PZ2A 4CU8A 1KRMA 4Q6XA 3GC5A 4JNYA 4DNMA 4MJ4A 4J3WA 3RLHA 4IICA 4PFHA 3M46A 3V1PA 4CKQA 2G4FA 1GJUA 2GQ9A 2GOKA 1FX6A 4MMWA 3M0JA 3S83A 4JHZA 4PUWA 3SCVA 3T2OA 5I07A 2QAPA 3SDOA 1UOZA 1ZQ5A 4YLWA 3FEQA 3R0UA 2Y7FA 3B4UA 1M5WA 3TJLA 4C6JA 3EX4A 3UWZA 4CNNA 3V5CA 2VOMA 5FJJA 1EC8A 3NZQA 2BHYA 1JDFA 1TA3A 4JYEA 2NXGA 1RY0A 1OBAA 3L4UA 2OWCA 2YYTA 1T0OA 4TTUA 4UFKA 1PL9A 3W1MA 1KB3A 2F9RA 1KRAC 2GVJA 5AYIA 1UIOA 3M7SA 3AQUA 1XC6A 2O92A 3ITTA 2KAUC 4OQVA 2DT2A 3ITXA 2ZZ5A 5IBXA 2FMOA 5FL1A 2BGSA 4DN1A 5FAJA 4RJEA 3ARSA 3LK6A 1WAWA 3H22A 3EXSA 3RPTA 3SGUA 5AHNA 1S3HA 4JNZA 5E6ZA 1ZZMA 1KM2A 4DJEC 3H70A 3UJRA 1PHQA 3MCMA 4K8EA 3IRDA 4LF2A 4JTAA 2OG9A 1AZ2A 4EAYA 2YKKA 3GB6A 4UTLA 4D6HA 1SJBA 2RH9A 1FDYA 3BOFA 4HA0A 4QG8A 1C8YA 2VZTA 3S42A 1XSJA 1EO5A 4LAZA 2C18A 5D8WA 1EF2A 4KFOA 1F6YA 3KWXA 3PWIA 3GE7A 3SGZA 5HNTA 3M0KA 2OLAA 3H23A 3HPFA 3CQIA 2EPLX 4NJGA 1XYZA 5G4HC 4LUSA 4TMCA 3TZFA 1FKWA 3RYSA 3LRLA 4WF7A 1JQXA 4NU7A 3QQWA 4NNCA 5HJLA 1EIXA 4C90A 4RNJA 4S2BA 3QC3A 2QPUA 5CSYA 4DZHA 5TQLA 1VLWA 1KWKA 5HATA 1YPIA 1DXEA 1GHSA 1VB9A 3W73A 3N6QA 3APTA 5AOUA 5FF2A 5HAOA 1U1UA 5HMDA 1P48A 2WSRA 3ITGA 1CEOA 3L66A 3FHAA 3SB0A 4H6QA 3WQWA 3LTSA 2WHLA 3OHIA 3MT1A 3MUCA 4D8AA 4K1GA 1MO0A 2QCHA 4PMDA 1MQPA 3AZRA 1I9CB 1W37A 3THAA 3Q67A 1QNQA 4B5SA 1O68A 2WWDA 3B8WA 1EUNA 1Z6KA 4B15A 2DT3A 2ZRZA 1NSJA 3CM4A 3S1GA 4C6KA 1T5AA 4JY9A 1J0IA 3BK0A 3BL3A 3UG3A 4AWUA 2JFEX 2DP3A 3D46A 3WLMA 1NP0A 3R79A 3G22A 1FWEC 3P2VA 1ZL1A 2BWGA 2W91A 1Q4WA 2X30A 4H7ZA 1K9TA 1E15A 1JD9A 3EWWA 3C2VA 4KEUA 1DIDA 1IEIA 3T0DA 5ENLA 3ZR4A 1EQCA 3ZVIA 1EZ2A 3OBKA 1FXQA 1Z7AA 3EDFA 1VBRA 4B3LA 2NLYA 3PN8A 4HPXA 3EWUA 1PWLA 2R9RA 3QHOA 4XKMA 3OQ8A 3L23A 5GNYA 3QKZA 4KGLA 2OEKA 2HZGA 3S3GA 5G2WA 5CGTA 3MUZ1 4Z1AA 1CI1A 4AG0A 4FHAA 1J5TA 3LCHA 2CZFA 2HE5A 3EA2A 1Q6GA 1F4AA 4R5EA 2DGAA 1BVWA 1H0IA 1XBVA 1PZ0A 3O6CA 3G77A 4H8HA 2J47A 3RR4A 3WN6A 4NQ1A 3O7UA 1JUKA 2PODA 2A7RA 2QULA 2B7PA 4G7EA 3W70A 4BI5A 4GA8A 3CAVA 5LA2A 4JOMA 4EANA 2ZIDA 1VGAA 2ZVRA 2PRLA 2VR2A 3WLIA 4PC8A 1CGYA 2P3EA 2WW5A 3P80A 4UQBA 2UV8G 2I1OA 3W27A 3GVVA 1QI2A 3CHEA 4JL1A 1E6ZA 3NVDA 5H8PA 1EF3A 3O15A 2D22A 1W1TA 4LAUA 3OB8A 1TX2A 3A9IA 1XYFA 2TSYA 4Z2HA 1TPVA 2X1RA 4LV4A 3VTRA 2TMDA 1J96A 5M1TA 1JDAA 1NJJA 1X8CA 1RY8A 2MNRA 1W56A 4TTGA 1KCXA 3CB8A 2G0WA 3P93A 3R43A 3APYA 5BU9A 3WLQA 2WNWA 2EBNA 2NQZA 3EKGA 4XBKA 3O2LA 5XINA 1AJZA 1GOKA 4GH3A 2ZZ3A 5A6SA 2REQA 3G3MA 4QDPA 1ZNNA 4GUJA 3VA8A 1A53A 3LCIA 1QTWA 4RE0A 3LCFA 1OFAA 5HWMA 2YL6A 3LG3A 4AMCA 3BXWA 1JUBA 2PI6A 4AZ6A 6XIAA 1E4MM 4I9AA 2ACQA 1HP5A 1U5HA 1V3IA 3A23A 2X42A 1POJA 2VX6A 2FGZA 2X1IA 3W02A 3TWAA 3V0SA 1MXGA 3FW6A 5KETA 2PLKA 2YBUA 3E96A 4BHYA 6CGTA 4CEUC 4LC8A 3VIIA 2KX9A 4ZFCA 1TPFA 1XWYA 4Q4SA 5JH2A 1JDEA 2Z26A 4N42A 2REQB 4RPPA 4WGXA 2PP0A 3EMZA 4JL2A 3W24A 4WHBA 3LU2A 2B0MA 3SCPA 2PU0A 3VFLA 1PB0A 3WJXA 1ME8A 4O0QA 3W7MA 4W5UA 5LGZA 1REQA 4P61A 4X2RA 3UWEA 4NXKA 3FNDA 2YX0A 1SSDA 5A6AA 3TYBA 3GNDA 4PEKA 4KCTA 3H7RA 3A4AA 4PTWA 2PA6A 1PDYA 4KRUA 2OYMA 1SMDA 3BUVA 4UNIA 2VC6A 1E0XA 2E5DA 4U4MA 3Q58A 3R12A 4ASTA 2O55A 3CAWA 4BQ5A 3W28A 4PZVA 5I3IA 4UTFA 4HZ6A 5EMKA 4B5XA 4A8RA 2J25A 1XISA 3H2NA 2NQHA 2HPMA 1PE1A 1XIJA 2OVLA 4GIRA 4RZBA 2VT0A 2YZ5A 2Z25A 1M01A 1QI3A 1VIWA 1ZAHA 1DHPA 1NDYA 1ZCCA 3MY9A 1V93A 1J10A 1IR1A 4AD1A 1SZRA 4YWSA 1N8FA 3SCQA 3WF2A 3WLNA 2PWDA 1F76A 4JY8A 4QLJA 3AAMA 4Q8VA 3IIVA 4RZ5A 4ZODA 2Y2WA 3LPOA 1GVOA 2XGIA 4P8VA 3FSTA 4JD4A 1NARA 4UR9A 1QPNA 1L6WA 3S1VA 1WKFA 4MB1A 2YXXA 3MANA 2PTZA 1TJ0A 2PF8A 3EB2A 1TR1A 3M16A 4YNGA 2PTYA 1PX3A 5A8QA 4PE8A 1MQQA 3TUUA 2X2YA 1X6UA 3LOTA 5HUOA 3DAQA 4Q6JA 2PEVA 5LXXA 3R8GA 4W84A 4FNQA 4DF1A 1G5AA 4WVXA 1W3JA 3PBWA 1N82A 5J5RA 1DWFM 3DGBA 3N6JA 3RDKA 1Y65A 3OOQA 1F74A 2BOEX 2ZA2A 2YR1A 4KMQA 3T4CA 4JDYA 3W87A 1JYVA 3WH8A 2ZX6A 3ABOA 2O0TA 1TUXA 3NEHA 1W6TA 2BXYA 1F3TA 4US5D 4K7YA 2YXGA 2QS8A 1KBLA 2J6VA 1LROA 1KR1A 3P81A 1UWQA 2QXWA 4QITA 2J9YA 1X97A 3VKBA 5HPCA 3CIWA 4QP0A 1SW7A 3MDWA 1A4LA 1W5OA 5SWUA 3TSBA 3RNDA 4ROQA 3VC5A 1HL2A 1QHZA 1CLVA 4DO6A 2Y6ZA 4KWSA 1UOKA 3WY1A 4LUTB 4EIVA 2OYKA 2CLHA 1PBGA 1OF6A 1EWEA 5E5CA 2NVCA 1DE5A 5D37A 1TVPA 2PF0A 3QW3A 4GACA 2BGQA 1P0BA 4QISA 3RAOA 2R8WA 2HISA 2CNCA 3TR9A 1QBBA 2CKRA 2YB4A 4Q4RA 4W7UA 4V27A 2GVYA 5AN7A 4AHOA 1IE7C 4U28A 1F9CA 3OTRA 2O4QA 5G4EA 3UJEA 5C9ZA 2A7NA 3B9AA 4DO7A 2WM1A 3AMLA 3AHVA 5K9DA 4HMDA 3RXZA 1J79A 2BTMA 4WLCA 1CGXA 1I0BA 3UD6A 5D2TA 4H9TA 2VWTA 2HS8A 1RP8A 2ZVIA 1I1WA 3W6LA 3LHZA 3SQLA 1UR3M 2FJUB 5TIMA 2GJNA 4L5ZA 3BV4A 4LW7A 1BGAA 4B16A 3EOEA 3IAQA 1UH3A 2VENA 2QMKA 1CXLA 1JF5A 1S5WA 2A3HA 1A5NC 3LZ3A 1GQJA 5AB3A 3WQ5A 3FDGA 4H9ZA 1M41A 4GI4A 1EDTA 3TP4A 3TU9A 4UFHA 4DWSD 3A47A 2D3NA 2VR4A 1QT1A 1H7NA 2EPKX 3IVTA 3MZNA 5C71A 4IFKB 1ZAJA 1OFOA 1TX0A 2ZZ2A 3D47A 1Q66A 4EPKA 1QNRA 2H9AB 4FF5A 4S3FA 3W7IA 3MU7A 4H6EA 3UZWA 4B90A 1SW3A 1KCLA 2C7FA 2A6LA 3N9RA 3W7HA 4CQAA 3CPUA 1EH9A 3VGFA 4H2HA 3KL3A 2PBGA 4GRSA 4EVZA 1HKKA 2DEPA 3AIUA 1Q6QA 4LJ3A 4HKPA 3H7UA 4RR4A 3LPPA 1JPHA 2GPTA 3AHYA 2E1DA 4AAJA 1JJKA 1XYLA 3STPA 3IUDA 3ITCA 3RCMA 4HN4A 2FDMA 4XBJA 3GXFA 3QR3A 1QPQA 3MHGA 4ZO7A 1XGZA 5C54A 3BG5A 3E1F1 1J93A 5BU6A 3VABA 1R0MA 2HTMA 4UTIA 3ZT6A 3G1FA 3QJAA 4M7TA 2ZRUA 3T8LA 3TAOA 4OZOA 1XLMA 4UTKA 1MW1A 4JTUA 1LQ2A 2IPJA 2AL2B 1JIBA 4ADTA 4A8NA 5DXYA 1NTHA 3GUGA 1E72M 4UOZA 1D3HA 4C6LA 3OBAA 1HN1A 3PS7A 4GINA 4M51A 3FY1A 5HBFA 4AD4A 3WBEA 3VDBA 1NDWA 4J3VA 3CT7A 5GQBA 1W54A 1JVNA 1OX5A 4KERA 5D9MA 3S6DA 3N6HA 4IG2B 3EB4A 2XH7A 3PTKA 1TRIA 2WM0A 3LM3A 3M7WA 4ML9A 2JF7A 3M0YA 3DX5A 4L4MA 4ALDA 2D23A 2Z2AA 3KRUA 4XZHA 2WJFA 2C8NA 4OBRA 4H19A 1WOAA 1HTIA 1I0DA 4B3KA 3RO8A 1EGZA 4ZO6A 2OX1A 2GL5A 2HNHA 1H41A 2QGYA 4PMOA 3IVSA 3PC0A 2OO0A 4MLRA 3V0TA 2WVSA 3TOYA 1T8QA 1MEHA 3CH9A 2YA0A 7CGTA 1EOMA 4DJFA 2UY3A 5A1AA 5KZ6A 1QK0A 3MKKA 2X1TA 3F5JA 1XI3A 2IKHA 2CZDA 4W93A 1DQXA 2OFJA 3H8AA 4ECLA 2FJKA 4HMNA 3GD6A 3BQ5A 4QDMA 2BVWA 2AMGA 2W5FA 3MMDA 4OKDA 3VZZA 1E1CB 1KTCA 4XKYA 2QUTA 3WF0A 1NVMA 1OYBA 4DAFA 4UMBA 1WNOA 3WELA 3UYCA 2QLYA 1BVNP 1XLGA 2B7QA 1IT8A 1NDVA 3NYDA 3RX2A 2ZDRA 4C6MA 4J5NA 3KM8A 2VEMA 2I56A 3QMSA 2I7GA 2Y0FA 4RW5A 1NF7A 3TC7A 1QU4A 1JNDA 1SZGA 4LF1A 1R46A 2QGHA 1ADOA 1RR2A 4H2CA 4M7SA 2RHGA 4ZOCA 4TX6A 5DQPA 3R7MA 2VM8A 3LS9A 1S2CA 4H00A 3T6CA 1K8XA 3O16A 4XKYB 1W3LA 3TWBA 4TR9A 1XIEA 5I06A 1W5PA 2PDUA 4LV9A 4FLSA 4JN6A 4KFPA 3U3HA 3M41A 4YVVA 2POTA 2PRMA 2F7FA 2IXVA 2VWSA 4HU0A 3ME3A 2E9MA 2RKXA 1HVXA 2GK1A 2Q8ZA 3V7PA 4JN8A 4UTTC 4MHBA 4ENLA 3GDRA 2ZUVA 3EDDA 2A3AA 4QJ1A 1J4EA 1M9HA 4Z1CA 3WBYA 2Q01A 5AC4A 3ZJ7A 2QCCA 3GYEA 2DFAA 3GBEA 3B9EA 3F1QA 1FXPA 4WDTA 4X9YA 3MCOA 1LF1A 3KBSA 4W5ZA 1OZQA 2ZUSA 3PJXA 4E3VA 1LRTA 2UZ9A 3KS6A 4BKNA 5EMMA 1EYEA 2WKLA 3VFCA 3WQOA 4ATWA 3BAIA 2QDHA 2V38A 3W2UA 2OXNA 3K4WA 1ADDA 3G0XA 1J5SA 4K7VA 2R82A 2V82A 2P0OA 1BTMA 2OQYA 3VZXA 1A5BA 3FS2A 1S38A 4KWWA 3ZMRA 4Q8MA 4DBSA 3G1RA 1G7UA 4JTGA 4J3XA 2V6AA 1QCWA 4QBXA 4JBRA 4F66A 1NP2A 2R1KA 2EJ1A 1XBXA 4JX5A 4ZTXA 3R58A 4FMVA 3VCRA 4N6EA 3VIMA 3NSNA 1S2WA 2NVAA 1J11A 4S39A 4JQAA 4WDWA 4JEJA 3WMBA 5A8PA 4ZGYA 3IWPA 1WYIA 2GWGA 2HMCA 1P0KA 4TX9A 2RUSA 3MSYA 4QS5A 4LFYA 1EYWA 3E12A 3G24A 4MJ2A 4DI8A 1VF8A 4D71A 4U5KA 2G8ZA 4JEQA 3WEMA 1K9DA 4XAFA 3UFYA 3OP2A 1VBJA 3ORWA 3MW7A 3C0SA 2R24A 1HO4A 4X63A 4DYKA 3KP1A 1CIUA 1QK2A 4S38A 4JFVA 5M03A 1NFGA 4MY9A 5HQEA 4XSLA 2OYLA 2DZVA 2PBOA 5CC7A 3KE0A 4IFKA 3OZPA 2QKFA 3HO8A 2Y85A 1WPCA 2Q6ZA 4XSMA 1PYFA 5I24A 1H5YA 4R33A 1ENUA 1JI1A 3GIQA 1XINA 4YCPA 3GKFA 1E73M 4KIRA 1UZ1A 1XH1A 3MCNA 2HNEA 1XXXA 2QUUA 4Z17A 1JZ7A 1Q6CA 4NZ5A 4QG9A 2DQXA 4ZVJA 1C92A 1KV8A 4NJKA 1MSSA 1TCDA 4HCHA 1K8ZA 1H7XA 5AECA 4G1KA 1C9DA 1TPUA 3EPNA 3CASA 5B7YA 3NSXA 3DFHA 2WANA 3PFMA 4ZO9A 3ARPA 1I45A 4PRTA 1LDCA 1PX4A 3LRMA 1RA5A 1WAUA 2CLKA 2OZTA 1LQ0A 1K70A 3A6OA 3FHQA 1M04A 5MHBA 2PDLA 3GXNA 1VFOA 3QY7A 1ADSA 2HV5A 2VCBA 3KLLA 3FN9A 1G1YA 1H62A 2ZZ1A 5A6BD 2WSQA 1X1NA 3KOXA 4C1KA 5FF0A 2XWEA 1W3NA 3CEUA 3LHYA 3BCDA 1J2BA 3LMZA 1K03A 3FJLA 3DKJA 1EQPA 1Z89A 4H83A 1C29A 4B4HA 3D6NA 3AI0A 2VFHA 5T9CE 5CH9A 3DU0A 5LXEA 2HK1A 3WNKA 4MLJA 3N29A 4FNPA 2O9PA 2X8RA 1RXOB 4PMJA 1AW5A 2FZNA 2H8ZA 2Z1SA 3OLEA 3HJEA 3N15A 3T2QA 1XLEA 4MIMA 2NUXA 2VO5A 2CBVA 4M56A 3HB9A 3N2BA 3ZT5A 1WZKA 5JVLA 3B06A 4EXBA 8RUCA 2X7WA 3E2RA 4IMAA 5AYYA 2AAMA 3OW1A 2XFWA 4G9PA 3RU8X 3ALFA 3NQ7A 1UKPA 4NRRA 5H1WA 5IRPA 1YDVA 2ACUA 5H6HA 2ZUTA 1ZENA 5C5YA 4JQ4A 4RE3A 2VD9A 1BEUA 2G95A 3COTA 4MAZA 1R2RA 3FEMA 4QDWA 4XWUA 5IFPA 1P6BA 1O5RA 1RBLA 3BVJA 3U5YA 2E5BA 5GJNA 2VX7A 4NZFA 2E25A 3CNYA 1W17A 5CJ5A 2VMFA 3EWBX 2P1FA 3J7HA 1Q6DA 5JIWA 3TW6A 3R94A 5E70A 4C7GA 1H7RA 4CCCA 4Q4OA 4EX4A 3CGTA 3MJYA 1FFQA 3W00A 6TAAA 4R85A 4O4WA 4UR8A 1PJ9A 4S3JA 1O1HA 3TCSA 2VVNA 5K9CA 4O8AA 2EQDA 4JX6A 3KOZA 3PSWA 2UY5A 3DXIA 3HGRA 1BKSA 1FHDA 2Z6JA 3C61A 3OYZA 4OV4A 4N9DA 2VCAA 1HFBA 1YBQB 2PTWA 4Y8FA 1BF2A 1Q7QA 3PZOA 4PCFA 4AZHA 5AFDA 4LYKA 1RALA 1R3SA 3VOHA 1MRAA 4FX7A 4Y6GA 1J18A 4HSOA 5C8BB 3GM8A 4YWIA 1OVDA 5FAGA 4ORMA 1UPMB 1GKPA 4HD5A 3R11A 3W01A 3B8DA 1UD6A 5EBAA 1VYRA 3W7QA 3WJSA 3K2GA 4HNOA 5GNXA 4HBKA 3TOPA 3NO5A 4LAOA 3G0SA 1CXIA 2PE4A 4UOJA 3WD1A 1LLWA 3AWOA 2CIPA 3L68A 2E9LA 4NILA 1EXBA 3BLIA 1G7VA 4TVDA 3FGCA 3EZ4A 2X0HA 3SIMA 3IEBA 9XIAA 5CAKA 2DW7A 1SZFA 5HNNA 2FPVA 3LQGA 2I17A 1XCFA 1A0CA 3USZA 1E0TA 3P60A 2PC8A 1GONA 3IACA 3T08A 4F0KA 1XH0A 4U10A 5HXMA 3U5UA 2CLEA 3EBVA 3D5HA 3UJ2A 3S5YA 3GZAA 2J7CA 4ML4A 4LSBA 5H8UA 5KITA 2GGIA 4C60A 4DUWA 4GUFA 5E0KA 5AYBA 2WJDA 3EKLA 3FIGA 2CLLA 3M64A 4IQLA 1GKQA 4N7QA 3ZJKA 3KDNA 5L6UA 1IIGA 3UQNA 2NV1A 4QSHA 1OQFA 3FYYA 1DKWA 3S1XA 1PKNA 4HHHA 3OG2A 1TTPA 1AA1B 4L1GA 3U4FA 3HJZA 5B80A 1FFRA 2NQLA 3RM4A 3EX6A 1U5JA 4BZYA 4E8DA 1MI3A 4NZCA 4F8XA 2DUAA 2OU4A 4M3PA 3THQA 4GIYA 4KESA 2ZXDA 1OG0A 4JKKA 3U7BA 5HJYA 3S9ZA 2V8ZA 1MEWA 3W3OA 2DVTA 4GI9A 4L6OA 3OLDA 4PN2A 1F5ZA 1V08A 1GVRA 1L0PA 3LUTA 3ZO9A 2XDFA 2YL5A 1JZ6A 1D2KA 1KM6A 3VMOA 1W9VA 1IXNA 1ZS2A 1F3XA 2PCEA 1BQCA 1CXHA 3NOEA 3S5ZA 1ML1A 2CERA 5FEPA 1WXJA 3GXDA 4KRTA 3QBUA 1MFVA 3GKAA 3WNPA 1YW1A 2X1UA 4AISA 4NAFB 3NEVA 5AC7A 2VUYA 3BGGA 1TPWA 3AMKA 3MS8A 4ZQNA 4HU4A 4P5UA 4P7LA 2VC9A 1V0MA 4MPKA 5HR6A 1BWLA 4IQDA 4J9JA 1R30A 4M1RA 4AD2A 3GNPA 3W82A 3VOIA 4N02A 4LEQA 1W1IE 4DY1A 1AFSA 2QMJA 3A4WA 4EPBC 2GVEA 3SO7A 3KUMA 1FHUA 3ATYA 3EEZA 4CD5A 1OFQA 1CGTA 4F2UA 1SFJA 1PYMA 1DL3A 3LRKA 8XIMA 1HXJA 1WBHA 4Q8NA 1JYXA 2DSVA 2GK1B 2Z24A 2X05A 2DZWA 1PCWA 4PMZA 2J8GA 1EUAA 3W7RA 3AUJA 4UTUA 4AF0B 1NOUA 2CKSA 3NPWA 4QEEA 4P7OA 4ZENA 1FWRA 3TTYA 1JZ3A 3NQBA 1RK6A 4NAEB 3W6YA 1TV4A 3UJFA 4RDWA 1MZRA 3GTHA 4QR6A 1EL3A 3SY8A 4Z2KA 4OBTA 3OGVA 2PDFA 3BSMA 5MKGB 2C14A 4JIQA 1P6WA 1LL6A 4IJCA 3T0CA 2XN1A 2QV4A 3B8UA 3WJWA 1EXPA 3GU2A 4HYWA 2BLEA 2DORA 3SCTA 3H21A 1RP9A 4QE4A 2JKPA 1AH3A 4DLMA 4WKAA 5BWAA 1Y5WA 2DY3A 3FX4A 3GW3A 1EJ7L 4GY7A 1JPMA 1E6XM 1WV2A 2C13A 2VFFA 1L9WA 2BFGA 1JXKA 4LGXA 4O0ZA 3F5KA 1BXBA 3NPXA 1UD8A 3KLKA 1B54A 3ZT7A 3HZ3A 3GNOA 4GZ7A 3HMCA 2ATMA 2PLJA 2WLYA 2OWXA 4HNVA 1BXNA 3WBXA 3VIPA 2PGWA 4ICNA 3ANVA 1AUSL 3H2MA 4MKNA 4XIAA 4Z2GA 4ZZ9A 3B4YA 1DTUA 4JTJA 4FLOA 1K8CA 3KCLA 4G5DA 3UY7A 5KTLA 1QWGA 4AEEA 2XVNA 4O1EA 3HQ1A 2WJEA 3IJ6A 1GG1A 3RK8A 2QT3A 4O18A 1VEOA 4J3SA 1Y5VA 1NY1A 1W1A1 3BOLA 4H9XA 3JS3A 2G5WA 2I9EA 1JL8A 4HK7A 1YE6A 4N2YA 4XVDA 4UZSA 1XCWA 2BY0A 5C9XA 1AQMA 5BYWA 2X7VA 5C7HA 3UXKA 5DT7A 4ZTYA 2ZRWA 3GTFA 2PB1A 2C1IA 2Z28A 5TF0A 4NZ4A 3DHPA 4LQ1A 3CMJA 1FWGC 3KBVA 2YCEA 1IQ8A 2AL2A 4AVFA 4IFRA 3CZLA 3PUDA 4E4PA 1EPXA 2XFRA 2NQ9A 1Z3NA 3BLPX 4XZNX 1RHCA 3I7RA 2WQPA 4OGZA 1Q5MA 4W87A 5CZJA 2VZOA 3MB9A 5K4ZA 4AH7A 4XX6A 2P50A 3II1A 2J7FA 2V69A 1C8VA 2HSAA 3OG3A 1P0DA 3A9BA 1TRDA 2XIIA 4UTWA 4IPLA 1LG1A 3T09A 4C6DA 3QZAA 3LCXA 2X16A 4FR6A 3CBWA 3IIOA 1LTDA 1N2VA 4GH1A 1XGEA 1GQLA 4CU6A 1HG3A 2GWNA 1XP3A 1QAPA 4O19A 4B92A 3UNTA 1PV8A 2FZMA 5BNKA 2G50A 3O1NA 4GG9A 1IF2A 4DX3A 5CG7A 4QCEA 1I2PA 4RUBA 3WNNA 3LN3A 1PAMA 3RPMA 2VURA 4NT0A 3JVAA 4ZFMA 3H24A 7PTDA 3AICA 2Y8UA 1R3RA 3C0LA 4BFAA 2ZQ0A 4J7RA 4YCOA 2WKJA 1Q3NA 4LUJA 1BQGA 5MF5A 3E9AA 5JBFA 2KZHA 3BMXA 3CEPA 2NX3A 1Z69A 2XIOA 2FVKA 3ZM8A 1V8EA 4LPCA 2VCCA 1SM9A 4UBPC 5LNRA 2QUNA 4WOZA 1RLDA 1BAGA 2BDQA 4IPIA 2C0AA 2Y5JA 4K6AA 1MUCA 3O8AA 4LC6A 1VPXA 3LBCA 3M0VA 3T05A 1NOWA 3IPWA 1OX6A 1RQHA 3ZVHB 3M07A 3WBAA 1ESWA 1KXQA 1ZSXA 2HRWA 1M6JA 3TMQA 3OVPA 3PZTA 1VCGA 5A95A 2W9MA 5IHRA 1WZMA 1XHGA 1H60A 5E9XA 2W3ZA 4DJFC 1JNEA 3UGVA 1PSCA 3EAUA 1ISVA 4K39A 1IT7A 1LG2A 5CXPA 1I2RA 3V0UA 4UQCA 1DWAM 3GXPA 3BAWA 5M3WA 4GVHA 1YEYA 1W5NA 2GSHA 3PG9A 3TTEA 4BI6A 1UBPC 1OCJA 5A8NA 4RV8A 1EIBA 1YTEA 3ELFA 4KWOA 4YVXA 1SR0A 3I6RA 1S5NA 1XUUA 4HGXA 2ZWYA 5GJMA 4MOZA 4OOUA 1VBUA 3CMFA 5FF3A 3W1UA 4F2TA 2Y5EA 1JCJA 1H1NA 2YLLA 3TAKA 1B90A 2X1SA 4DWDA 3B05A 1BGGA 1TTQA 1EC9A 3CK5A 1XLKA 3UZ5A 5I0DA 5A2CA 4AC1X 4IOTA 3CC1A 4PTDA 3CIVA 1PEZA 3GH4A 5CPMA 3E2QA 3W0KA 3PZQA 1H61A 3CZKA 2YPIA 2ZX5A 4HN8A 1YE4A 3PUEA 1ECQA 1KFCA 3P14A 2F2HA 3U48A 3GVRA 3MQTA 2Y7GA 1W2VA 3GY1A 5DRIA 4CQ9A 4FXFA 3S46A 3QZEA 5BRPA 4RE2A 2ZRXA 2QPXA 2Q09A 5E09A 4QXIA 2OKTA 3W29A 3S6OA 2X0SA 1E51A 1V0LA 1HL8A 1A5KC 1XL9A 4U3CA 3MUAA 5D38A 2YSWA 3D0CA 3U2EA 4CGTA 4UTHA 3DOPA 2NVDA 4MY8A 2GGGA 4F9JA 1GG0A 3EOLA 2ZC1A 1LCOA 2GUUA 4GNJA 4BQ4A 5F2GA 4OIFA 3PANA 4D6FA 1ZTVA 1V03A 1Q6LA 1EJUC 4O17A 5KMYA 4H8NA 1CXFA 3QRHA 3FOKA 3VMNA 1GYMA 3SUVA 4MNJA 4Q4QA 3BG9A 3A12A 4QEHA 1I8JA 5C6MA 1JQVA 3W7OA 4G56A 4AF0A 1OIFA 2AGKA 3KHJA 3CU2A 1RA0A 2ZC8A 3W76A 1SSGA 3AS1A 4F0SA 3GTXA 3F4CA 2Z2UA 5C2XA 3DN5A 4MUPA 5E6YA 2HVOA 4TVUA 1M03A 3KZSA 1XFBA 1GOMA 1ICPA 2GVLA 1OSEA 1XYCA 4OECA 4XD3A 3OVQA 4PGLA 1OIMA 4PSRA 4QLKA 3WENA 4DRSA 5K9XA 3QY8A 4L4PA 1FWNA 1TJ2A 3PPCA 1GCYA 1JCMP 2QCEA 1PHWA 4JIIX 4KIEA 1MUMA 3W2LA 5KINA 3W53A 1FH9A 2WMGA 1ELSA 1XR2A 4QS6A 5LNWA 2ABBA 4AXNA 2CW6A 4PB3A 3IIXA 2RGMA 3KCJA 1J6PA 5HQLA 2QYGA 3SSZA 1HO1A 1J12A 3LI0A 1OFDA 3NQVA 1OFRA 5IM51 2JIWA 4JTEA 4J40A 2GDVA 4JFWA 1K02A 1WKYA 4X60A 4C6NA 1VHNA 3KL5A 1PXGA 4O8RA 4XAGA 3K5XA 3S2NA 6XIMA 2FKPA 3M0LA 3RIKA 2EKCA 1OY0A 5CZSA 3HU7A 3LHTA 4LS0A 3UVIA 2ZTJA 3T2PA 1ZJHA 2PWHA 1VPQA 3TDFA 1LRQA 3NDZA 2GQ8A 4J27A 4MPQA 4QQUA 2ZA1A 1F07A 2R6OA 1XLHA 1H49A 4U31A 1A3HA 3PPFA 1ZRQA 1PKMA 4GNVA 3PBYA 3EWDA 4XD5A 1K4GA 4KFNA 4BWLA 1XIFA 3M6DA 1LOSA 3AYSA 4LVBA 5A5WA 4B9YA 3TW7A 4DM1A 1DJYA 4FA3A 1TVLA 3QHMA 1UKTA 3RHGA 3EB3A 3AZTA 2NSOA 4J1OA 2GVGA 5J5DA 4FNUA 4Z1YA 3H7VA 3MUXA 1XUZA 3H2OA 1G0CA 1VBHA 5FD0A 2ZZ6A 4MADA 3D3AA 3GG8A 4U33A 1CB7B 1R8LA 3WUEA 5CSSA 2FH6A 3ANYA 3DFOA 2P8CA 2VRJA 3ALGA 3C2YA 3UBPC 2ZA3A 4S3GA 3LY0A 4X61A 1TE6A 4YYCA 1WUEA 2NT0A 3CV1A 2VD8A 1KLYA 2Y89A 3H6OA 3N4FA 4HZ8A 3V5FA 3DECA 1ZJAA 1OK6A 2Y8VA 3SCUA 3BPWA 3CPRA 1S5TA 3CIXA 2EPOA 4LS1A 1GORA 1E5JA 3FSUA 2D2OA 3KRSA 1G6CA 2G4JA 4I8DA 4AD3A 1YBQA 2FHCA 4GJJA 2IPWA 3OO2A 2BS9A 4JGDA 1A5UA 5M5DA 5BOOA 3T0BA 2GJRA 3QZ6A 1K6WA 1V5XA 3PR2A 2QJGA 2BBFA 2OOFA 1V02A 1PKYA 2E40A 4FI4A 3O63A 1KTBA 4O0KA 3QSTA 5A69A 4WQ6A 1E4LA 3VD4A 4ZQCA 1MDLA 4JQ1A 4JKLA 4GPNA 1P6CA 1QDSA 3GAKA 5CGMA 4E4UA 3QPYA 3BZJA 2ICSA 4YHEA 5CEWA 1LBMA 1FCUA 1NM9A 4YN5A 4YIWA 2V5KA 3E2SA 4XO7A 4DZAA 3UNDA 1X38A 4G7EB 5C55A 5C0QA 7REQB 2TODA 5LIXX 1LP6A 1O4UA 3O0KA 2BG5A 3SADA 2PWFA 1J0JA 4FP1A 5EU9A 1E56A 4LU0A 4BS0A 1DJQA 3ZVHA 1NEYA 4F40A 4LY8A 3GDLA 3VIKA 3HF3A 4Z0SA 3IANA 3WLSA 3EMCA 3VNZA 1ZBVA 2Z1BA 2ZBTA 1J9YA 3BGAA 1PIIA 3DEQA 3NNTA 1DHKA 3C8FA 2CBJA 5LGXA 3NQ8A 4PL2A 2A7PA 3PG8A 1GVYA 2WZTA 4AQLA 2ANUA 1QASA 4AEOA 3EGJA 3KRBA 3URQA 3A21A 2FPYA 1YTDA 3HURA 2RJHA 1H09A 3TYZA 3CHVA 2YDRA 1S5MA 3AJXA 3N14A 1YNQA 1C7SA 1U83A 4HZMA 4FX6M 3UU0A 2FYMA 2A21A 3BAYA 4ILSA 4FOKA 1UD3A 3PZNA 3ISIX 1JG9A 3VDCA 1VHCA 1KCKA 3DFPA 4M6PA 3BLLA 4K68A 2ATSA 1QNVA 5A8OA 3AU6A 2OZ3A 3L2MA 4MFEA 1O5QA 4B5VA 4F2BA 1YXYA 1XLBA 3ERPA 3P82A 3GC4A 1N55A 4R9XA 4E38A 2YB1A 3RJXA 4Q7NA 3GR8A 2PDHA 2VDHA 3CUZA 1RAKA 2E77A 2PDIA 1TV8A 5I77A 3HGJA 1L6YA 2IKIA 1GOQA 3DIPA 3SURA 1KC7A 2GSJA 3CUHA 4Q8PA 3TW9A 4KCVA 3VGDA 3JU2A 4KT2A 3UZXA 4QTGA 1O6IA 3ZJ6A 1AW2A 2Q8LA 3S47A 4EXAA 1QW7A 1H1YA 1TTJA 1DP0A 1VFUA 1E3ZA 4GKLA 1TA3B 4PCPA 3FA3A 4URIA 2WSKA 5A6JA 3N3TA 2NQJA 1OF8A 3OZOA 2BXZA 1XIIA 4E5TA 2QZRA 1V0KA 3KVLA 4GI6A 1LM1A 4W8BA 3W7LA 3TNOA 3PWGA 4MWAB 2YA2A 4HTBA 4A6GA 1FKXA 2EAWA 2HE8A 1B3VA 4Q8TA 4GBUA 4IGMA 1EO7A 4IIBA 5DT5A 4M6VA 4K38A 3BSGA 1V6TA 2X09A 3LBOA 2ZZ7A 3LV5A 4IMDA 1BPLB 3NQMA 2JALA 2HJPA 2A3CA 5I5RA 3F4DA 1UWAA 4G6CA 2XISA 3VYLA 4I5UA 3VUSA 1JRCA 5DRCA 3N4EA 2E8YA 2XU2A 1E70M 4NAFA 4GVFA 1F05A 3CZEA 3T81A 5HWNA 3NZRA 5I00A 3EOOA 4FLQA 1ONWA 3GS6A 4NZJA 2NV2A 2QJIA 3UXLA 1VFTA 1IGWA 5DANA 4F0MA 1UIPA 2DQWA 4PR4A 4K1WA 3WJYA 3W22A 1A49A 4BA0A 1B3ZA 1Z48A 5FOOA 1QO5A 2BXVA 1KBBA 1T40A 1KXVA 3HV9A 1CB2A 4JN7A 1G94A 2HROA 3VCNA 3PNZA 1Q6OA 3NQEA 1ZUAX 4FNSA 1TUFA 5LNVA 4ZE4A 2ZX8A 3ANUA 1TMQA 4IX0A 1IXQA 4XZBA 4E2BA 2W92A 1T8XA 5G4WA 3CYVA 4PBEA 3GDMA 5DY2A 3W72A 3G1DA 4WK9A 2UY4A 4HNUA 1H11A 5HR7A 3ICJA 3AHTA 3PNUA 2V9DA 5CJMA 4JPGA 5DCBA 4BEUA 3MHUA 3GNNA 3VC6A 5EPDA 4EOUA 4L9YA 1DOSA 3MI3A 1GK8A 2AQVA 1B3YA 3LHUA 3M6YA 3B3DA 3EDKA 3NZGA 4JTIA 2J66A 3HFYA 1V3LA 2PC4A 5GPRA 2OQHA 4OUEA 1F4HA 2XH4A 4L4LA 4UIOA 2WZIA 3DHUA 4JCLA 3THDA 3PVFA 4L9XA 1EA9C 5I79A 4LBUA 1UJPA 1KQYA 2QF7A 5HUPA 3MZ2A 3S2JA 4Q32A 4D6EA 5DX7A 3KOWA 1R5YA 2OSYA 5ABHA 4FNTA 3FKRA 1XICA 3T40A 2XIQA 1JCYA 2OLHA 4IWWA 5FESA 4HOZA 3KWSA 4IJRA 2Z2BA 1C9WA 1P7TA 4X3ZA 2Z6IA 3BO9A 4UMCA 3URAA 1VAHA 1HT6A 1MW3A 3SN0A 4JFTA 1WXYA 2H3BA 2C0HA 2YCIX 3WH6A 3GVWA 3QXBA 4JHMA 5DO8A 4HYVA 3AYVA 3JRKA 1O95A 2POZA 4X0VA 4W8AA 3EX1A 4Q8QA 3NJ3A 1G01A 1W3KA 2PLCA 3CL8A 3L21A 1DXFA 3XIMA 1O5XA 1WCGA 2EG7A 4ZEPA 3GSMA 1VENA 5FI8A 3SR7A 1DYSA 1R3QA 2DZSA 2A2IA 1QJWA 2G3MA 5DMYA 3WQCA 1Q65A 1V6XA 3QC0A 1OD8A 2J79A 4JIEA 3H2FA 3WLTA 4AZ5A 2ZYFA 3LEPA 1QOQA 1TV3A 4ZMGA 3B04A 3GW0A 3R5EA 1T6MA 5A8GA 3W1AA 4AZBA 2HBVA 4IIGA 4UQDA 5LSMA 2WMKA 3SRHA 2VFDA 4C1NA 4AXKA 5FJOA 1EJVC 1OCNA 4UXDA 3U0HA 3LSBA 4UWMA 3PJUA 3AWNA 4WD0A 3IGXA 3ZQ9A 3TN3A 4M24A 1LUCA 4O16A 3W1PA 4HCDA 1Q63A 4V28A 4LBRA 3QF0A 2VR5A 4XISA 4DM2A 3KVJA 2X40A 2G96A 4D2JA