2J88A

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
324
structure length
319
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HYALURONONGLUCOSAMINIDASE
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
total genus 125
structure length 319
sequence length 324
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j88A00
3SGZA 3MP4A 1I2QA 3W1QA 4IMEA 4LOCA 2PRHA 3G3DA 2Y7EA 3LDVA 3O07A 2ZA3A 4AMAA 5HWMA 1QWGA 3BARA 1WOBA 4JTIA 4E38A 4ZZ9A 3OBKA 3W2NA 4FB7A 4JIQA 4DF1A 1KFLA 4KWVA 3FKRA 3W73A 1UUMA 2V82A 4UFKA 2E5DA 4NNBA 1K8ZA 2C6QA 3RU6A 1G6CA 3QFEA 4AHQA 1MEWA 4BWLA 1ALDA 1SSDA 3KAOA 1W31A 1X7FA 1KM3A 5A8GA 1K7FA 4GUFA 1OK6A 4Y9AA 3C61A 5LNVA 3TSMA 3TQVA 1W3TA 1VLIA 4RCXA 1VCGA 1XBXA 5IBXA 2Y70A 2E1DA 4MVAA 3WFAA 2YDAA 4O1AA 3LBMA 4RK8A 3B0PA 3GAKA 4Y8FA 3W87A 4UFJA 1R30A 1QO2A 1HO1A 1YDOA 3W1TA 2B7PA 1SFJA 1ZAHA 4GUJA 1TTIA 4ZVJA 5KSWA 2F7FA 3L5AA 1WV2A 3NQ2A 4NZJA 5CPMA 1TTQA 1TTPA 4OE7A 4BI5A 1FWSA 1DBTA 2QCEA 4YXGA 3HOJA 1TQJA 2Q3RA 3M43A 1EP2A 1G4TA 3S1XA 1R46A 2QJIA 2VEMA 4LUJA 1H7NA 3FYPA 4FX8A 1LLZA 2WQPA 1N8FA 1JCLA 5D2VA 5KZDA 1TPEA 2X16A 2QCCA 2NX3A 3WK1A 4DF0A 3W85A 1LORA 3V75A 1RZMA 1VHCA 3KVKA 1K8YA 3G0UA 3TA6A 2GPTA 3F4WA 4FXSA 3HG2A 3TFXA 5F1UA 4MJZA 1TSIA 4JTJA 3BGJA 1AMKA 1JQVA 2DJLA 2VEPA 1JCMP 3NA8A 3SECA 4JDBA 3UQNA 1I2OA 1YDNA 3MHUA 4FNTA 4ZQPA 3P60A 3PY2A 5D32A 2ATMA 1DKWA 4GUIA 3MW7A 4JTFA 3ATZA 4P61A 3TUUA 5F2MA 3UWUA 4M6PA 1H7WA 5IM51 2Z0IA 1NF7A 5F2IA 1P0NA 2XN2A 3O15A 2X2GA 3W6YA 4PEKA 2J27A 4NJJA 3OVPA 3PBVA 4R34A 3QQ1A 4K36A 3LXBA 3TAKA 2E77A 3EWZA 3O05A 4FO4A 3W76A 4D2JA 4AHOA 2GJLA 1GVOA 1RD5A 3G8EA 5CKSA 5HUOA 2C16A 1CW2A 3NL3A 3P84A 5F1VA 4AF0A 4MFDA 1NVMA 3BG9A 1LLWA 3HBLA 4E2DA 1FQ0A 3W1XA 5F4WA 3QMRA 4JXCA 3QMSA 2QAFA 4FNUA 3ZS4A 1ZENA 4R53A 1DOSA 1M5WA 3EB2A 1E51A 3W7EA 3PG8A 1C29A 1LOQA 2A6LA 3CM4A 4RKAA 4O28A 3Q2DA 1PL9A 2V2DA 3E9AA 3FJLA 4HN4A 1TV5A 1TTJA 3I68A 3NQ8A 4WXYA 2ABAA 5K3VA 5AC8A 1Q6QA 1SO5A 2BZNA 2G5WA 4PODA 4KFPA 3DKJA 3G1HA 3TW6A 2ZZ1A 4QISA 2FJKA 5AYZA 3W2UA 5K9DA 1LTDA 1VHNA 1OF6A 2TPSA 2GQ9A 3LCGA 3FJ6A 3G1FA 2CZEA 4L4LA 3BW3A 2TYSA 5LGZA 3W07A 5D09A 1WX0A 3S1VA 3P80A 5KITA 4XBKA 1QOQA 2QF7A 4MJMA 2Y88A 3NGJA 4YLWA 4O50A 5DY3A 2DP3A 1KFEA 3M47A 3E49A 3NQ6A 2E5BA 3NQVA 4DPQA 3L5LA 2QCNA 4LY8A 2X30A 3BVJA 1FCBA 2Q8LA 4AWUA 2I14A 3H53A 3TMLA 3L0GA 3UXAA 2NUXA 3W1RA 1TPH1 1MZHA 2V0TA 3PAJA 3GDRA 3UWVA 2GJNA 2W79A 3P5YA 4HSOA 1SZFA 2G96A 3SGUA 2OJPA 3TC6A 1CI1A 3IIOA 4M6QA 1OYCA 4MLRA 3RMJA 1T8XA 4O53A 5C55A 1KV8A 1N55A 2AGKA 4Y90A 5TIMA 2V30A 2JKAA 3S1UA 3NAVA 2V8ZA 2BTMA 4XTIA 3WK0A 3VNDA 3L5MA 3L66A 1Z48A 3JR2A 3NOEA 1EP1A 1JR1A 3OVRA 3STEA 3NQMA 4UTUA 5K4XA 2X1UA 3N2XA 1LYXA 1OABA 1IIGA 1W54A 4QIUA 5LKYA 2BWGA 4EWND 1SW0A 3NXFA 3UD6A 1VS1A 5BOOA 3NQCA 4JX5A 3QF0A 3A22A 2WNNA 3QZEA 4WY0A 4N2YA 6TIMA 1FDJA 1NSJA 3TCEA 3H54A 2BXVA 1H61A 2CFFA 1FUYA 4QM1A 4O10A 5K2ZA 3LM7A 1GG1A 1ZAJA 3DZ1A 1OVDA 1AW5A 1YPIA 3GR8A 1VQTA 3HG4A 1GOXA 1T99A 3PM6A 1TJRA 4S2CA 3O6DA 2A1YA 5DCEA 4BI6A 1I2PA 1RQEA 2QCDB 4O0ZA 2A5HA 3DU0A 2I9EA 5KTLA 3MI2A 4UTWA 3DHFA 1XC4A 2ZRWA 1VYPX 3PUEA 1VGAA 4UUIA 3EWBX 1IGSA 1Q6RA 4E2BA 1H7XA 1IXOA 5HWNA 4MZYA 1OX6A 3W3OA 2CLOA 4CNOA 1KBIA 1GZGA 3UY8A 1KLZA 1ADOA 4MY8A 5AN7A 4RLIA 2CLKA 1GPWA 2Y62A 1XKYA 4AH7A 3G1VA 2C3ZA 2BX7A 4K6AA 3M5YA 4GXMA 5LHEA 2YXGA 3USBA 2EKCA 3W84A 1RQBA 4JD4A 1RPXA 2XN0A 5DELA 5CSRA 3GYEA 4UNKA 1B3OA 2GUUA 3R5EA 3G18A 5CGQA 3IIPA 1I8JA 1GQNA 3MYPA 5LSMA 2BSLA 4LS2A 3W1NA 3QQ0A 1J2WA 2PCQA 4I7VA 4WY0F 1GYLA 2QCDA 3EX6A 2UV8G 3W70A 2RDTA 3K30A 3RLUA 1JUKA 4Z1BA 1P1XA 4LV9A 3OHIA 4JYEA 1PIIA 2YX0A 5G2WA 1XBYA 3EXRA 3E12A 4MLJA 3G1XA 1IXPA 1AW2A 1F6PA 1OFBA 4LS1A 1L9WA 3AO0A 1R47A 1MEIA 3EXSA 1FXPA 5I3HA 4NNCA 4UTTA 1TPVA 1C8VA 4JTLA 3CEUA 1I2RA 7TIMA 3P62A 4S2BA 4HNTA 1M6JA 4UFLA 2QKFA 4FNSA 1T0OA 2GVLA 5G4EA 1XM3A 4U4MA 1FWRA 1TO3A 1G4SA 2Y61A 3U6WA 4Y6GA 2ZZ2A 2XFWA 3MP3A 4NT0A 3GX9A 3TR2A 2DZWA 3W88A 2Q3OA 1RR2A 3VE9A 5F4XA 4PC8A 3DFNA 5D04C 4UTIA 5BNKA 3NM1A 3W7JA 4WUIA 4I7WA 3G1AA 3THQA 3W7OA 1UUOA 1LRQA 3MO7A 4ALDA 3HJZA 4JTSA 3LB0A 3LCFA 4RZ6A 3SJ3A 3F03K 1I4NA 1VJIA 3S5YA 3NEVA 4ICNA 4HNUA 5I3KA 3NG3A 1I45A 1UASA 1YTKA 4GUHA 5FF7A 4CQ8A 5EPDA 3NPUA 4JGDA 1R2RA 4ORMA 3KFTA 2VFFA 4DELA 1QMLA 4GC4A 3GKAA 3ZWSA 1TPB1 4PH6A 3TJXA 4FX6M 1WDWA 4HHPA 4QNEA 4ADUA 3T78A 5AB3A 3TH6A 4DPPA 3LRLA 4JY9A 2GVJA 4MIMA 5HINA 2OCZA 4O1DA 4NU7A 1F7BA 2CLHA 4X2RA 5GVJA 4N4QA 5K4ZA 4MZ8A 3P5ZA 4I9AA 4IJBA 1EUAA 3FLUA 1OFRA 2QDHA 3LI1A 3P81A 4N9BA 4X3ZA 4OBTA 1TV8A 1AL8A 2B7OA 5D38A 4JTTA 4UFHA 1QPQA 5TQLA 4EVZA 4QAIA 3W1LA 1S5TA 4IX2A 2E6AA 1J5TA 3DKLA 4TMBA 2VC6A 4BI7A 5AHNA 5CZTA 3NNTA 1W37A 3LTYA 3GDTA 1H7PA 3OIXA 3TQ0A 4PTNA 1XFBA 4DO5A 1W3IA 3CPRA 3N14A 2ABBA 4CQ9A 3W7NA 4JTKA 1F73A 5D2YA 3W7MA 4B5NA 2B4GA 4UCGA 4IWWA 1FDZA 1A5SA 1A5CA 3B8DA 4OQVA 4QNWA 5EMUA 1O4UA 2NV1A 4PL2A 2V9DA 1KFJA 3M16A 4RZ5A 3IVSA 4HNNA 4NQ1A 4U28A 4LC8A 3S0CA 3NR0A 2HTMA 2GVGA 5EBUA 2WOQA 3ABQA 1HTIA 1N7KA 1A53A 1LBFA 1V5XA 3GK0A 4M19A 3UPWA 3S42A 1ME9A 4DQWA 3KOFA 4JDYA 4Z1DA 4A29A 4DO4A 1SO6A 1OFEA 1EX5A 2V5BA 1S3HA 3M1ZA 5D33A 2Y7DA 3O1NA 3CT7A 3LXCA 2YR1A 1Q6LA 4N6FA 1QNVA 4N6EA 4XKYB 5BMWA 2CZDA 1VCFA 4GE8A 4KFNA 4RZ4A 3EXTA 4RXGA 2A6NA 2WSQA 3QC3A 2BLEA 2OT1A 2J9XA 1MSSA 4FNPA 1YTEA 4GJ1A 1EP3A 2R14A 5HMSA 3UY7A 3EWYA 4H3DA 1Q3NA 3VI2A 5DBTA 4AF0B 2DZPA 3CWNA 2QUVA 3LOTA 5K7JA 4Z08A 3BK0A 4Z1AA 5AHEA 1HL2A 3M5XA 4WX2A 1M7PA 1SZEA 1Y0EA 5DCBA 1W8SA 1WBJA 1XUZA 3LTPA 3T44A 2DZUA 3P82A 3I7RA 3TROA 1FDYA 4Z1CA 1UB3A 3W1UA 1MO0A 3LI0A 5CZ0A 3W23A 3PWAA 2F84A 3U2OA 2CLLA 4NJHA 5D02A 5KMYA 3WJXA 1LDCA 1O95A 3W2KA 2YGYA 3GXPA 3C2EA 4RXFA 2YYTA 3WK2A 3LRKA 2ZRYA 3GXTA 3MBDA 3GKFA 1KM0A 1SUXA 3T4CA 4GBUA 3S8HA 1ZCOA 4NJGA 3TU9A 5ABTA 3LERA 4XKYA 4N4PA 2FQIA 4IMFA 5G1YA 2P10A 3QEZA 1JCNA 4O57A 2DZTA 5HULA 3P61A 2YW3A 4O17A 2ZA2A 4MFEA 1PHWA 3PSWA 1JULA 4LS0A 3FYOA 1YLVA 3BG3A 2CWNA 3LHYA 3SIZA 3G24A 4YL2A 3W7IA 1HG3A 2CU0A 3TKFA 3KRSA 3BLFA 2A0NA 2ZZ4A 3W22A 5BW6A 2NUYA 1ONRA 2Y63A 1KA9F 3CC1A 2FTPA 3DBPA 4IGHA 2A21A 2J6XA 3GDKA 2ZRZA 3VFLA 2AAMA 4GRSA 2HS6A 2FPYA 2P1FA 3PS7A 4JNMA 3PC0A 1D9EA 5A5WA 3DGRA 4AXKA 2WO5A 1OF8A 1PHQA 3QRHA 5EA9A 1Q6OA 2ISWA 4UR7A 4LC6A 4O1BA 2QR6A 2Y85A 3GDLA 4LVAA 4EF8A 4LVDA 1AW1A 4O54A 3PR2A 4LTSA 1CX9A 1OYBA 4YCPA 4FNQA 1SPQA 1PCWA 1TJPA 3TAOA 3OVQA 1PV8A 4LW7A 2V81A 2RHGA 4BWLC 1WQ5A 2E68A 3G1DA 1GVSA 3LLDA 1RV8A 5TBOA 3L68A 1FCQA 3ABSA 5CPNA 4ZMGA 3SY5A 2YPIA 4W9TA 2Y7GA 2VELA 4MKNA 1H51A 3O63A 2H6RA 3SSJA 5IBXC 5SWUA 5AHMA 1K02A 3IGUA 3W7LA 2A4AA 3MMTA 4WY0B 2ZTJA 3LLFA 4JS3A 4MY9A 1PVNA 3W7QA 5I3JA 2W6RA 2FB2A 4HSNA 4O12A 1LZOA 2QUTA 4IOTA 1OJXA 2V2CA 2VFHA 3T7VA 4BF9A 1BEUA 2CLMA 4JEQA 4P2VA 4ADTA 1IIHA 1OX5A 5H2ZA 1TPWA 1LM1A 5EY5A 5FESA 3I65A 3O6YX 1BWKA 3GNDA 1ICPA 2IQTA 1ZHAA 3STFA 4CCCA 3RF9A 1V7YA 3O8AA 1DQXA 1W5QA 4UR8A 1Z42A 3NZ1A 1O5XA 4IQLA 1JCXA 1Z41A 4NNAA 2G97A 4LVFA 3TXVA 1KLYA 2E6FA 4JYDA 1FBAA 3C2OA 1F05A 1GJPA 1OFPA 1LRNA 2VEKA 3CWOX 4X22A 5BRBA 1ME7A 4IXHA 1F74A 2E5CA 1GVQA 3SI9A 3DFQA 4Q32A 1EWDA 4QQ3A 4IUOA 1I2NA 5G4WA 2O7QA 5G2HA 4XQ6A 5CZSA 1W1ZA 5AYXA 4JX4A 3M6YA 4HT3A 3QPYA 5D03A 3M0ZA 1SO3A 4R33A 1K7XA 1P4CA 4MY1A 3ZFHA 3W74A 1LROA 1OHLA 1DVJA 1KTCA 4CNPA 1B4KA 2YSWA 5HR7A 2ZYFA 1ZAIA 3SFKA 4OHQA 1TRIA 2A7NA 3LHVA 1IXQA 3DFPA 3MYOA 3W86A 5G1TA 3OG3A 4XWUA 3B0VC 1QDSA 1ZNNA 4S1FA 5C5YA 1O94A 1K8XA 2A85A 4OU1A 3PUOA 2B7QA 2Y89A 4AWSA 1DHPA 2C0AA 1B9BA 4XTDA 5FF2A 1YPFA 4KFOA 3Q94A 1SZNA 3KXQA 4QJ1A 1ML1A 2E09A 3KVLA 1G4EA 1GEQA 1OX4B 3QPZA 3BGGA 1F2JA 4UTMA 3L0NA 2EHHA 4O11A 4CLMA 4IX0A 3L0KA 5H91A 1LP6A 1QFEA 2ZRVA 1UCWA 2QJGA 5FI8A 1XL9A 1LBLA 2OT0A 3QW3A 3W7HA 3NL2A 1TQXA 3P8IA 3LBCA 3T40A 3DFTA 1BKSA 3WK3A 2DZVA 3S9YA 1T96A 1D3GA 5D05A 4K8HA 5E93A 3HPZA 4ONVA 2H90A 2O7SA 3AJXA 2DU2A 3HPXA 1OFAA 1EPXA 4OV4A 3B0UX 2PRMA 4EIVA 4K8EA 5LNSA 1RVGA 2AQWA 1OFDA 4IPJA 3ABRA 1WBHA 1W5OA 4ZQRA 2WKJA 3M5ZA 1QR7A 1X1ZA 1XBVA 1R2TA 1WA3A 3ZR4A 3L67A 3JS3A 1YXDA 1O5KA 3NDOA 2JGYA 5DY2A 3D0CA 3TFCA 3RFAA 1OX4A 5EKYA 1JJKA 4O19A 4FHAA 2Q8ZA 2Y6ZA 2X1TA 2VFEA 3N34A 3W7PA 3NO5A 1KV5A 4O14A 1XBZA 4CCEA 2VFGA 3C2VA 2FB3A 4M7TA 4UTHA 4N9EA 3R8RA 5DLCA 1SZGA 4RX0A 5U4NA 3TDFA 1FWNA 4WJEA 3W2LA 4EF9A 2JKPA 1G69A 1TRDA 1EUNA 3G8RA 4PA8A 4FIRA 4YWIA 3DAQA 4JTHA 2PE4A 3G1YA 4UXDA 1KTBA 2JGQA 1XUUA 3NQEA 1QCWA 3VCRA 1UJPA 3P7YA 3TMQA 3LCWA 1VLWA 3DHDA 4Z0JA 5AHLA 3W1MA 3BO9A 5CPLA 3QM3A 2NXHA 2ZA1A 1WAUA 1B4EA 4K7VA 3DFSA 3IIXA 4DEFA 2QCGA 3NPXA 5D37A 1ZY9A 1HUVA 3M5VA 1W5PA 1KM5A 3ANYA 4DXVA 1XDMA 1YADA 2A7RA 2FIQA 2HMCA 5D30A 2GQ8A 3KX6A 3OA3A 3IIZA 3I7QA 4ZL1A 1F6KA 1P0KA 2C15A 2ZCGA 4AB4A 3W1PA 2NX9A 2ISVA 2YFNA 3A21A 2JK2A 3RNDA 2ZZ3A 1KFBA 5LNWA 3A24A 2WPBA 2LLEA 5MHBA 3C3NA 1XI3A 1HFBA 1TPFA 1J4EA 3NQGA 2OMAA 3C8FA 3SR7A 3SW6A 1G67A 2EPHA 1BWLA 2Z6JA 3CU2A 4C1KA 2PC4A 1SFLA 1KM4A 1H1ZA 1PE1A 4M6VA 2D73A 3W9ZA 3F1QA 4LU0A 3LHWA 1TYGA 4GFSA 3NQFA 4UTWC 2RDWA 4TO8A 4J9JA 1R2SA 3UWQA 1DV7A 4GUGA 1SU5A 3TSDA 3NL6A 3EEGA 4CNNA 5DN1A 3UWWA 4NXSA 1AL7A 4BR1A 5L9FA 1YXCA 3TXZA 1JUBA 4O16A 2G95A 1W5MA 1SO4A 3BLEA 1EWEA 4MZ1A 4OT7A 1U5JA 1QAPA 3ABOA 5AC7A 4O4WA 4XUGA 3R89A 4UC5A 4RV8A 3GZ3A 4FNRA 1AK5A 4JTEA 4N9DA 3DI0A 1NAL1 2Z2UA 3TC7A 2OX1A 1JVNA 4FX7A 1O60A 1TREA 5E1QA 1KW1A 4N02A 4G1KA 4BFAA 3KVJA 3HGSA 3GLCA 5HNRA 4AEOA 1RQHA 4FEZA 2QCLA 1BTMA 3EX3A 4X9SA 4C1LA 3HG5A 1VYSX 1FY6A 4JN6A 3FEMA 1SSGA 2PURA 3GVGA 2V5LA 2TMDA 4O4VA 3C52A 1QPRA 4AWTA 4AHPA 2NUWA 4LRTA 3N2MA 2ISSA 2YZRA 2J88A 3TE9A 2E6DA 3M7WA 4KWWA 3N19B 2YW4A 3G0SA 1LBMA 4UTTC 5E0KA 1DORA 4JR5A 3KHJA 2NXGA 1KTNA 4YMZA 3LRMA 5L6UA 5D2TA 3N3MA 1GT8A 4IMCA 1G4PA 3W72A 3PULA 2H8XA 1QPOA 4NX5A 3N9SA 2NLIA 2VFDA 3DENA 3W83A 1VCVA 3DXIA 2ATSA 4L4MA 1FX6A 3E96A 4WQ6A 4TX9A 4LVGA 3NL5A 1IXNA 4ZQCA 3THAA 2DZSA 2V2HA 3UXDA 1H50A 3NQ7A 1H62A 3BPWA 3EWWA 1VZWA 2WJZA 4TIMA 3S5ZA 3QYQA 3QSRA 4O0KA 1JQXA 6ALDA 1TPUA 1LCOA 2H8ZA 3N73A 1QPNA 2QCFA 1KBJA 1DJQA 3B03A 5J5DA 2NWRA 1VYRA 4A2RA 4OV9A 1YTDA 5FF0A 1ICSA 5CG7A 3W7RA 2YYUA 2FFCA 1NF0A 2H3BA 2C18A 3BLIA 4IMDA 5AYYA 3M44A 4Y96A 4UMBA 2X1SA 1TB3A 3BV4A 3O16A 3KRZA 3LXAA 3W7DA 4O13A 3TQKA 1LOSA 3WJZA 4K39A 3LCXA 5C54A 4H6KA 3PVFA 5BMXA 1W5NA 4UNLA 2CZFA 4FXRA 4JTUA 2C1HA 3GB6A 3NVTA 1W56A 5CPOA 1OYAA 3LTSA 3W75A 2YCEA 3O6CA 1A5AA 1B57A 4NJKA 3EX4A 4TU1A 3HGJA 2QJHA 5HUPA 2VFIA 1F5ZA 3WJYA 2WV8A 4FIQA 3VE7A 1A5BA 4NVTA 1GG0A 1GYNA 3KVMA 1OG0A 5DCDA 3S5OA 4YCOA 4IXXA 5HQEA 4WOQA 3G3MA 5K9CA 3G1SA 2C14A 2NX1A 3CIXA 4K7YA 4UMCA 1X8FA 8TIMA 3MI3A 1HO4A 2QCMA 2FDSA 2Z1BA 3VKJA 3WJSA 4O18A 3PB0A 3GAYA 3B06A 3I7SA 5FEPA 2A2IA 2ZZ7A 1TPDA 3A5FA 3IIVA 2FPTA 4PFMA 3NPWA 1XCFA 4JY8A 4DO6A 2ZDRA 1OK4A 2W0UA 2ZZ6A 4MYAA 4WZHA 3IVUA 4UIOA 3W7GA 3DH7A 3FKKA 1X1OA 1H60A 4OGZA 2RH9A 3HPSA 3E0IA 3W7CA 4NZFA 3L65A 1VC4A 2JKEA 1H7OA 1SQ7A 1WYIA 4KKXA 1KM1A 2NXIA 4UTLA 5I3GA 3DFOA 2GOUA 3L2IA 1ZJIA 2FLIA 3HIJA 4MUZA 1VPXA 4HNVA 4JICA 2ZRUA 4WD0A 3C6CA 1TCDA 4A2SA 1ZALA 1ICQA 2EGZA 4N9CA 2P0OA 1EA0A 3INPA 2CZ5A 3HMJG 1LOLA 3LGEA 2XN1A 3LCIA 3YPIA 4LRSA 3LV5A 1X6UA 4K38A 1OFOA 3TIMA 3R2GA 4LVBA 3CB8A 5FEWA 1FWWA 1WXJA 2J24A 3B05A 1H63A 2WSRA 3U8GA 4JTGA 3UWYA 1GWJA 5FF4A 3LCLA 4UFMA 3B4UA 3MP5A 2HSAA 3S1WA 3CTLA 1MXSA 2Z6IA 4DBDA 1G7UA 2Y7FA 3W2JA 1TIMA 3I6RA 2DZXA 2TSYA 3S6DA 3HF3A 5KZEA 2R91A 1WOAA 3HGOA 3RK8A 1P5BA 4BK9A 5C2XA 2VEIA 4K37A 2RKXA 1ME8A 4HPJA 5G5IA 1NFBA 2KZHA 5D2XA 4LT9A 4ZQMA 3MJYA 2C19A 1GTEA 4Q33A 1QO5A 3L9CA 4XZ9A 2I1OA 2OZ0A 1K3UA 3JRKA 3FS2A 4DBEA 3H55A 3NQDA 4UTKA 4ORIA 1M7OA 3N9RA 1VH7A 2RDUA 3LX9A 1U83A 4M5PA 3C4UA 4LNYA 5AHIA 3PBYA 5DXXA 1NEYA 3LV6A 3C56A 5DBUA 3PG9A 3PBWA 5C6MA 2QCHA 1JCJA 1W0MA 4A22A 1FXQA 3C2RA 4LWWA 1AG1O 3MBFA 4A3UA 2ALDA 1H7RA 4LV4A 3UWZA 1VR6A 1KFCA 3L21A 3HG3A 3T55A 3HGRA 3DI1A 2R94A 3MHGA 2VOMA 3GDMA 3PB2A 3G0XA 1F76A 1D3HA 1Q45A 3A9IA 3TV8A 5J5RA 1H1YA 4O15A 1JUEA 1KM6A 4E0CA 1TV7A 4NUWA 3FA5A 3TJLA 2ZBTA 5AOUA 1K03A 4ADSA 3A5VA 2CW6A 4ZQOA 1SR9A 1DJNA 2DORA 1YYAA 4PL1A 1MEHA 5LGXA 4HIBA 5G2IA 5KINA 4JX6A 5CSSA 1SW7A 3HO8A 3MI6A 1JRCA 2J9ZA 3A23A 4NXKA 2B0MA 3TX9A 3NZRA 1C9DA 1GVFA 4DF2A 3E02A 3W71A 3TK7A 1DQWA 4EOUA 2B7NA 3QJAA 1SW3A 3IVTA 3C2FA 5LHFA 1H5YA 4WXZA 3UPBA 3BW2A 4HPXA 3LHTA 4POCA 1K7EA 1FCVA 3KRUA 1VRDA 2FPVA 2ZQ0A 3FIGA 3CHVA 3TSBA 5EL1A 1UBSA 2ZTKA 1FCUA 1YDVA 2VKZG 3Q58A 4PCFA 3GNNA 4LUIA 5F2GA 4NX0A 1EIXA 4R7JA 2X1RA 3BW4A 3NM3A 4MYXA 2E6YA 3NPVA 4M7SA 2WNZA 2EAWA 2VXNA 3OEXA 4MPQA 3SZ8A 4QSHA 5I3IA 3STGA 4OWGA 3P74A 1S5WA 5DXYA 1L6WA 1EEPA 4A21A 3W1AA 3IEBA 1GVRA 3CIWA 2H3DA 1A50A 3NQAA 4UFIA 3ELFA 2CLIA 5AHFA 4UTJA 4AAJA 1Z44A 4RJEA 4CQAA 1LRTA 3PF3A 3HQ1A 1S5VA 3GXNA 3EKLA 2WSYA 3W2MA 1KM2A 5K9XA 3PSVA 3ATYA 3QMTA 5KZMA 3MWAA 5LZLA 3CLMA 5HWJA 2QAPA 1L6YA 1PCKA 2ZFAA 1ZFJA 1W3NA 3NYZA 4O8RA 3EKZA 5CZJA 5LNUA 2NZLA 5FF3A 4Q4KA 2WNQA 1OFQA 2A7PA 2NWSA 3QSTA 2GQAA 4IPIA 3MUXA 3WJWA 3CEPA 1YXYA 5AFDA 4GNJA 4JYFA 5EYWA 2JBMA 4TMCA 4IMGA 4JIPA 1TMHA 3LHUA 2C13A 3FFSA 1G7VA 2VENA 3LHZA 1GTHA 3S5NA 2DJXA 3UYCA 2CLEA 3C0JA 5F2LA 5LNRA 1XDLA 4H4IA 1JRBA 3CQ0A 5T26A 4FF7A 3O06A 3W7KA 3ZWTA 3R13A 3M9YA 3STCA 5HJLA 3TW7A 3HB9A 2CLFA 3EX1A 3RLVA 3QH2A 4I7UA 1FWTA 3P67A 3Q37A 3UZJA 1KFKA 3EX2A 2NV2A 4XBSA 2ZRXA 1TPC1 5F4SA 2PRLA 3M41A 2ZZ5A 3QW4B 4Z0SA 3FOKA 2J9YA 1PS9A 3LCHA 4TR9A 2EF9A 5AC6A 1L2UA 1XXXA 3EWUA 3PBUA 4AVFA 3B04A 5D2WA 1THFD 5U7SA 3TNOA 4CCDA 3IGXA 3IRDA 4O52A 1QOPA 3PUDA 2R8WA 3IV3A 5FEXA 3UZ5A 3IGSA 4HKPA 1DL3A 3F4NA 5I3FA 1IF2A 2RFGA 2QEZA 4ZQNA 3G22A 2HS8A 2QDGA 3GR7A 3MHFA 3GIYA 5HR6A 4GWEA 3EWXA 2YFOA 4O1CA 3R12A 3P8JA 1L6SA 5FEZA 1EB3A 4WOZA 4ML9A 4MOZA 2TRSA 1JCYA 2QUUA 3V1PA 4NJIA 4QITA 4UMAA 4RR4A 3BG5A 3UNDA
chains in the Genus database with same CATH superfamily
3SGZA 3VAVA 2PRHA 3I4EA 4DO7A 5HWMA 1WOBA 2QW5A 1ISWA 1ITUA 4F0SA 1KFLA 1ZGDA 3GE7A 4YTQA 1JF6A 3CMFA 4HA3A 2E5DA 3ARSA 4TVUA 1G6CA 3T2OA 3PP7A 1MEWA 3RR4A 4DWSD 1W31A 5A8GA 2Q8XA 3UWEA 4GUFA 3H4GA 1UD3A 2J4GA 2EPLX 2WMGA 1VCGA 1TG7A 4I90A 3VD4A 2Y70A 4REQA 2RDXA 2VZVA 2YDAA 3GIPA 2BBFA 3S2MA 3TYCA 4UFJA 1UKPA 1QO2A 1F3EA 2XIIA 4QE4A 1SFJA 1V3HA 3UERA 3L4UA 2QZRA 3L5AA 4PSRA 1E6PA 1RP9A 5CPMA 1B3ZA 1BRLA 4M6UA 3CLWA 3BQ6A 4F2UA 4BI5A 4F40A 3EMCA 1H1NA 3HOJA 3LZ5A 4ZODA 2PD5A 1E9YB 1RLCL 1W9XA 1R46A 4EXAA 5CJ5A 3N6QA 3UG4A 4HYRA 4LUJA 4GZ7A 3FYPA 3WDJA 2BOGX 2WQPA 1JCLA 2V5DA 3OYZA 5D2VA 2X16A 4DVOA 3W85A 3MWCA 3RCNA 1K8YA 4GY1A 2GPTA 4LAMA 4UTFA 2OYLA 4FXSA 5BZAA 2I5GA 4IISA 5F1UA 1JDCA 1DQUA 3W27A 2PLJA 1JCMP 1Q85A 4QLJA 3SECA 3EAUA 4AZCA 1HKVA 4JDBA 3UQNA 1YDNA 4FNTA 1XWYA 2OLAA 5D32A 3VOFA 4K1WA 1DIKA 1CZ1A 5FJJA 1AH3A 4K8GA 3VUPA 3GRIA 4PYSA 5LIYX 1EJUC 1UYQA 3WLLA 2QPUA 2PDGA 4S38A 3MUAA 3KL0A 4D2JA 1XIHA 5CPSA 4H2HA 1ZJHA 3G8EA 2PDLA 2J7EA 5HUOA 3V0UA 3P84A 2DSZA 2V5KA 3CQHA 4MFDA 1R5YA 1LLWA 3HBLA 2X0SA 1FQ0A 3W1XA 5F4WA 3QMRA 3QMSA 2X7WA 5A8NA 1MWOA 1E1EA 3WQ6A 5KEZA 4A05A 3ARXA 1UKSA 1C29A 3CM4A 2XINA 4KGJA 1TV3A 3I68A 4WXYA 5AC8A 4KFPA 3G1HA 5E6ZA 2FJKA 4IUGA 1OF6A 4I6KA 3FJ6A 1WKEA 3LEPA 2KX9A 3FXYA 5LGZA 3ANVA 3S1VA 3P80A 4XBKA 5CSYA 3UU0A 1KQYA 3CT2A 2DV0A 3UGVA 4Y9PA 2V6AA 5A2CA 4V33A 1YQ2A 2E5BA 4MDOA 3BVJA 4AWUA 2WHLA 2I14A 2UBPC 1OD0A 4HK5A 1D7FA 1MZHA 1UWIA 4LYQA 1WNOA 2ZUVA 3RUBL 1R7AA 1X6LA 1GW1A 1K9DA 1A3XA 1CI1A 3DECA 3IV8A 3EDKA 2PB1A 3RMJA 1GVYA 4O53A 1XW8A 3U7VA 3KP1A 1XV8A 3AHYA 2DUAA 3T08A 4ACYA 5DQPA 3VK5A 3S6OA 4Y90A 4KW2A 2V30A 2JKAA 2QNEA 3UG8A 3XINA 4DZHA 2VC9A 2BTMA 2VHLA 1MXGA 2EJ1A 3WK0A 3JR2A 3NOEA 1EP1A 3AZSA 3ITVA 1ITXA 4L1GA 3BSMA 1AZ1A 2I16A 3N2XA 1KKRA 1OABA 4IH3A 1SW0A 1DHKA 1XPGA 4HPGA 3UCDA 4WY0A 2WLZA 3UR5A 1FDJA 2E7FA 4IPPA 3H54A 1V93A 4LUSA 2BXVA 4ERGA 2YCIX 2XYLA 2RJGA 2CXGA 3DZ1A 1Z7AA 1YPIA 4WVXA 4FXJA 1IHIA 5GNYA 2VGBA 3SRKA 1TJRA 2A5HA 3DU0A 1BSLA 3WN6A 3MI2A 5I09A 1FHUA 3E0LA 3LNMA 1KGXA 1E4NA 3K4AA 4F2BA 1IGSA 4E2BA 4WSHA 5HWNA 3JU2A 2OXNA 9CGTA 4XZHA 4MY8A 4RLIA 1JPKA 1V0KA 2P5NA 3B9AA 4AVOA 1KRAC 6A3HA 1XLDA 4K6AA 3BQ5A 4ZEPA 5D8WA 3ES8A 3W84A 4M1RA 4KWUA 1HKIA 3QV6A 1B3OA 4DWSC 3G18A 1OT1A 5C71A 2RGLA 4M3PA 1P48A 1HIZA 3HFTA 3TZFA 4DYJA 2VC7A 3EX6A 1GEHA 3CPGA 4PBEA 4HJWA 5FA5A 3RLUA 4C6CA 3IWPA 3KL3A 2YX0A 5HATA 4R5EA 4B5VA 1QI3A 1R9XA 3SCQA 1UW9A 1L9WA 3W6LA 2HVNA 1UWRA 3AO0A 3I4KA 1R47A 3E2VA 3AS3A 3PPFA 4XZNX 4ASTA 4XK2A 3WBEA 7TIMA 3WDRA 3P62A 1ZCCA 4NZ4A 5D9NA 1ZQ5A 2ON3A 4UFLA 3OZMA 1F07A 4IGNA 3CS2A 3OG2A 2HEJA 4LCSA 4OFCA 2WMFA 1FWRA 4UQDA 1XSJA 4H1ZA 3H6OA 3WEMA 4GABA 3THCA 4ZOEA 3ITCA 3AYSA 4X9YA 2YB1A 5MKGB 1LT8A 3UJEA 2BGQA 1UUOA 4RPQA 4FALA 4JHZA 4DUOA 4JTSA 1S2AA 3MTWA 1EZ2A 1VJIA 3OYXA 3S5YA 3QY8A 4ICNA 3NG3A 1EPVA 4KWSA 1YTKA 4GUHA 4W93A 4LYKA 2DVXA 4JGDA 1R2RA 2C71A 2QMKA 3O0KA 3R0DA 4DELA 2PDHA 1GPFA 4GC4A 4IPLA 5I06A 4XZLX 4ADUA 1BTCA 3T78A 4TX6A 4GYPC 2NQJA 5HINA 4UBPC 2XSBA 2OCZA 1LLOA 3WL0A 4NU7A 2CLHA 1XLEA 5TNVA 2Y4SA 5K4ZA 2PS2A 3UZZA 5LA2A 4JKMA 3P81A 4N9BA 3PUGA 1J10A 1R3QA 5D38A 4MTVA 2ZXQA 6PTDA 3W1LA 4W8AA 1OT2A 1S5TA 4GI4A 4AX7A 4CD5A 2QVHA 1W37A 2G3FA 3VGEA 1HJSA 1XFBA 4OZOA 4EPBC 5KETA 1O1HA 3BZJA 3W7NA 2YB4A 2B81A 2XWEA 3W7MA 1L6FA 4AIUA 3RX4A 1A5CA 5I79A 2GJXB 4P8WA 4QBXA 3KCLA 3R11A 3A6OA 4KEVA 2Y5SA 3VIJA 4HD5A 3M16A 3B0XA 1E72M 1Q4NX 4W88A 3OLDA 1NDWA 4XD6A 3NR0A 3MQTA 2CWXA 3ABQA 1MYRA 3S2NA 1N7KA 3SCTA 3PJTA 1OD8A 3MUIA 4GNVA 1G1YA 2WKGA 1XD0A 3KOFA 4JDYA 3M0LA 4GQGA 1HN1A 3B97A 3C5QA 4A29A 1SO6A 4NG3A 1OFEA 1M01A 1R3YA 1EX5A 5CBIA 4GINA 1S3HA 3CV7A 3B8TA 2Y7DA 3CT7A 3LXCA 1QNVA 1Q7MA 1ZJBA 5BMWA 3GM8A 3HM7A 4GE8A 2ASHA 2OO0A 4RZ4A 2OT1A 4GACA 4C6QA 4GJ1A 2WMIB 5HMSA 4A6GA 1OG6A 3QKEA 2GZXA 1ADSA 4OOZA 4R3UA 1A3WA 3LOTA 1EH9A 2FKPA 4R88A 2VEGA 4DIAA 3AWNA 3K2GA 1W8SA 3II1A 1WBJA 4H8VA 3P82A 4KRZA 1E9IA 4B3ZA 2XIQA 4O0QA 4Z1CA 4QXIA 4RNHA 1F8IA 2EJAA 2F84A 4ZA0A 2OSWA 3WJXA 1LDCA 2HROA 2PMQA 2YYTA 1HVXA 3WK2A 3LRKA 2ZRYA 4ZSUA 4H2CA 4J4KA 1NWRA 3GXTA 1KM0A 2I5IA 4GBUA 3R0KA 1LL7A 3S8HA 3HPAA 4GH3A 5ABTA 4XKYA 3EA2A 4D6CA 5J8LA 1BD0A 5E9AA 1JXJA 3W25A 1ZBCA 3QEZA 2G4FA 1CYGA 5HULA 3P61A 4P8UA 5FAJA 4O17A 1FP8A 3AIBA 3LGDA 2JIWA 4LS0A 3AIWA 3FYOA 1FWFC 2CWNA 4F9JA 3LHYA 4PRRA 4C6KA 4YL2A 3KRSA 2XTKA 3BLFA 1ONRA 2Y63A 3CC1A 2AAMA 4GRSA 5E0CA 2FPYA 4LUTB 2VT0A 4JNMA 1OIFA 4PB5A 1D9EA 1XGDA 2WO5A 1PHQA 4A3YA 2INZA 1Q6OA 2F2HA 3R4IA 4UR7A 2PFHA 3EBVA 4A8NA 2WLYA 4O1BA 4IQDA 2Y85A 4LVDA 4HA1A 4FI4A 4FNQA 1UQYA 1MVYA 3WH8A 3H21A 1ISVA 3L12A 4G7EA 4LW7A 1FOBA 1V03A 1FCQA 4ZMGA 1WCGA 3SY5A 2YPIA 2J47A 1OSEA 1BYDA 1H51A 2I56A 3FYYA 1RJQA 2XDFA 5AHMA 2E40A 2VTFA 4MWAE 4G9PA 4GC3A 4GX8A 1REQA 4HSNA 2PDKA 4C6IA 4O12A 2QUTA 4LAKA 3LD5A 2V2CA 2VFHA 3E38A 4JQ4A 4BF9A 3VNMA 1BEUA 1KO0A 1DJHA 4PUWA 2NVAA 5H2ZA 5DFAA 3SCPA 1BWKA 2IQTA 5AC5A 1OGGA 3STFA 4CCCA 3O8AA 1W5QA 2GLKA 1Z42A 3QC0A 5AZ1A 1JCXA 4NNAA 2G97A 1QBBA 2BVWA 4UCFA 3VMNA 1F05A 4U33A 4EP8C 1GJPA 5CPQA 4X22A 1ME7A 2WBKA 4IXHA 4W7WA 2E5CA 5H8MA 3SI9A 3W01A 3ICJA 2GJRA 2PTXA 3MCOA 1EWDA 3WQPA 3TYUA 1EYEA 2Z1VA 4C6MA 5ABHA 1OY0A 4JX4A 3QPYA 3M0ZA 4EPKA 3MVTA 3ZFHA 3UNTA 3LENA 4MB1A 2YXXA 1TRIA 1WO2A 3EMZA 1V6WA 3MYOA 3W86A 2CHRA 1MW3A 4S1FA 3APYA 2HISA 1E43A 1UWSA 3GWQA 3RM8A 2B7QA 4AWSA 3PJXA 1VEMA 4XTDA 3VU2A 4KFOA 1RBAA 3MCNA 2E09A 3KVLA 3G2GA 1GEQA 1OX4B 3SSZA 3QPZA 3BGGA 4BS0A 1YNQA 2Y2WA 1P7TA 1UCWA 2QJGA 3GNPA 3A3HA 2UZ9A 1LBLA 3VIHA 3TN5A 4PMNA 2Z00A 4PUUA 4C65A 1BKSA 3S9YA 1T96A 1HXJA 5D05A 2WC3A 4K8HA 2Y8UA 3AUOA 5AECA 3HJEA 2FMOA 4HZ8A 1UR8A 2AQWA 1UD6A 4ZQRA 3VIGA 7REQA 1XBVA 3ZR4A 1WA3A 1GQKA 4IP5A 3AICA 4EXBA 4DXXA 3PZTA 4HOXA 1O5KA 3NDOA 3TFCA 3RFAA 4M80A 2BHYA 1J6OA 1JJKA 4O19A 5E70A 3A4JA 3LA4A 4OUEA 1PAMA 1FH8A 2YCLB 1PZ3A 3VNIA 1XBZA 1JD7A 2VFGA 3C2VA 5IRPA 4QROA 4M7TA 3W6MA 4UTHA 4N9EA 3R8RA 5DLCA 3AIUA 4NZ5A 3W26A 4CVUA 5U4NA 1E40A 4EF9A 2CBVA 1G69A 1TRDA 1UOZA 1U22A 3G1YA 3MMDA 2HJPA 1XUUA 3C0QA 3NQEA 1V3MA 4UOJA 3WEZA 3IAPA 3P7YA 4QS5A 3L4TA 3BO9A 3U5YA 3LZ3A 4FA3A 5CPTA 5JIPA 1J0ZA 3ZXWA 3QM3A 3DC0A 2V3EA 2HNEA 4K7VA 3QN3A 1CXLA 3IIXA 5FSEC 4LH8A 1HUVA 3N11A 4PB4A 1DXIA 1TE1A 4FS9A 3ZSTA 4DXVA 1XDMA 3BMVA 1YADA 2A7RA 3CNYA 1VEPA 2ZX7A 4ZL1A 2ZCGA 4AB4A 2ZVRA 3M0XA 3W1PA 2NX9A 3IUDA 4O1EA 3VZZA 1NTHA 1Y8BA 1ECQA 1KFBA 5LNWA 4LCQA 2WPBA 5MHBA 1XIGA 1TPFA 2OMAA 3SW6A 3SR7A 4RPPA 4AD0A 4JTCA 3RCYA 2VEFA 2Z6JA 1LQAA 3CU2A 3GYCA 4C1KA 1P0DA 4JTQA 5CJNA 2C79A 1PE1A 2E9LA 3SN4A 1RHCA 1R2SA 1MMFA 4MJ4A 1DV7A 4FOKA 1KRBC 1SU5A 1NELA 2WZTA 5HNNA 3TSDA 4CNNA 4KS0A 4NXSA 4BR1A 5L9FA 1KKOA 2ANUA 1A4MA 3TXZA 4D6HA 3K8LA 4MF4A 2CLPA 5HK4A 1PJ9A 1EWEA 3WIJA 3T05A 1BPLB 3IGHX 3R89A 3QPEA 3GHTA 1AK5A 2DSWA 3DI0A 1NAL1 2D2JA 1O60A 3HQOA 3AIQA 4JFSA 1TREA 5E1QA 4X2PA 2VZUA 3ARUA 4C90A 3EGJA 3MV11 5HNRA 4DRSA 3W37A 3MDUA 1KC7A 3CQKA 3ME3A 4HK6A 2VQTA 4C6PA 1QPRA 1MI3A 3AHZA 4AWTA 4HTYA 3XISA 2WC7A 3M7WA 3N19B 4J5NA 1XLFA 3UJ2A 2VWTA 3KHJA 1US3A 4C6JA 2NXGA 1SJBA 5D2TA 3LSBA 4NRSA 3GTIA 3DENA 3Q67A 4B91A 3DXIA 3BSGA 3E96A 2FHFA 3NL5A 1IXNA 3EYPA 3UP8A 1H50A 3ZLGA 3NQ7A 1H62A 2WJZA 3VUSA 5ABFB 1R3SA 3FCPA 4O0KA 6ALDA 1CGYA 1FH7A 5A1AA 2GDUA 3WSUA 1W3JA 4DXKA 1KBJA 3B03A 1US2A 5XIMA 4A2RA 4H7CA 4GX9A 3GNXA 3WENA 3VGFA 3KRBA 2EPMX 4ZB5A 1JFXA 2AOSA 5CG7A 3MSDA 2WZMA 2H3BA 3LYEA 3M44A 5FJIA 4HHLA 5HNTA 4XIAA 1UWAA 1E3ZA 4FR1A 1B90A 2OYMA 1L8PA 4K39A 1W5NA 1BG4A 4FXRA 1IR2A 4S39A 2VC5A 3W75A 2YCEA 1A5AA 2WSKA 1RSCA 4TU1A 4Z2HA 3WF0A 2X0YA 1QXLA 3HGJA 3GVRA 2FVLA 2OGYA 1S2UA 1V8EA 4A3RA 2PAJA 3KVMA 3GH7A 3VOHA 4IXXA 1KNWA 3G1SA 2NX1A 3CZLA 5I2UA 2GSHA 8TIMA 3PANA 1OM0A 4W7VA 3PB0A 1TZZA 5FEPA 1GOMA 1J79A 3GHSA 4DO6A 2ZDRA 4GFIA 4D9PA 4QAWA 5DO8A 3V0TA 2W0UA 2ZZ6A 2F8QA 3RAOA 4UIOA 3W7GA 1U1HA 4Y9OA 3DH7A 3SRDA 1X1OA 4BCEA 3QR0A 1DWIM 2RH9A 3GTFA 3BWWA 3E0IA 1VC4A 3THDA 3GW3A 1SQ7A 4KKXA 1JNEA 3TYDA 2NXIA 3PFMA 5C9UA 1OIMA 4NZ1A 5I3GA 2GOUA 3L2IA 2SFPA 2V67A 2D23A 3K5XA 2ZRUA 3C6CA 4OVXA 4C7DA 4A2SA 2WHJA 4CD4A 3ZT5A 2PF8A 1SZRA 3NQBA 3LGEA 2PDYA 4CUCA 2IQDA 3LCIA 3TIMA 4LVBA 3CB8A 3CXOA 3M64A 5FEWA 2WSRA 3U8GA 3ZIZA 3WDQA 4JTGA 3OO2A 3VOCA 5JBFA 2F9RA 4RDWA 3SY1A 4H8UA 4QQUA 3ZOAA 1MXSA 5CH9A 2F6KA 1TIMA 2QGYA 4GCXA 1VFOA 4PMRA 4CD8A 2RKXA 1NFBA 2PGWA 1HL8A 1DIOA 1NDYA 4AZBA 4JNZA 4LT9A 3WDHA 3VM7A 1HW6A 1PKLA 3W53A 2ZX8A 3FGCB 5I7GA 3BLPX 2OZ0A 3BOLA 2ZICA 4RNFA 4ORIA 3WBWA 1M7OA 2YA0A 3N4EA 3N9RA 4PB3A 2E3ZA 3LX9A 2IQ0A 2ZXDA 3C4UA 4QJ5B 4GGBA 3WELA 3PBYA 1JZ8A 2P50A 3OGSA 4IIBA 4E6MA 4DAIA 1W0MA 1ONEA 1UH4A 3MB9A 5T8GA 1FXQA 1ZZMA 4GHRA 1BGGA 3MBFA 2ALDA 1H7RA 1VR6A 1IEVA 3HG3A 3HGRA 3DI1A 4C7GA 4EX4A 3PZVA 3ZLFA 2GUYA 1KWKA 3G1RA 3ZR5A 2ZWZA 1W1PA 3G0XA 4KCVA 1F76A 4NAFA 1JZ5A 3A9IA 4H9MA 3V7PA 3GG1A 3FA5A 4U5IA 2PTDA 3WD3A 2XFFA 4PRTA 1DJNA 1YYAA 4W4QA 1W9PA 3KWXA 5KINA 2NVDA 1JRCA 4NXKA 2B0MA 2Y8KA 1XLHA 1W9UA 5FSDC 2FH6A 4GZIA 4EOUA 1UD5A 3I3BA 2YL6A 1Y7VA 2R1NA 2WZIA 3C2YA 3IVTA 3C2FA 5LHFA 5DMNA 4HMCA 1DYSA 4POCA 4OIFA 4V28A 1MXDA 2ZXBA 1GVIA 3FIGA 1VRDA 1J12A 1AUSL 4F66A 3VDGA 5D4YA 1QK0A 4CEUC 3AI0A 3AHTA 4YNGA 4R7JA 2X1RA 3BW4A 4TVCA 1OBAA 4M7SA 3WBYA 1E4MM 1UQZA 4QSHA 1NDVA 3P74A 4F79A 1GKQA 1L6WA 2VVNA 3IEBA 2CBJA 1GVRA 2H3DA 2V3FA 2DSVA 1V6VA 4UFIA 3SQMA 1OC5A 3ELFA 1UIOA 4CQAA 3HQ1A 3GXNA 3EA1A 1WXYA 3EKLA 3H2NA 4F0MA 3UFYA 4JCLA 3RILA 2GGJA 5H8UA 4Q8WA 1PCKA 1XLAA 2PLMA 3APGA 5IOBA 5CZJA 5IFTA 1FFRA 4KIEA 5FF3A 4Q4KA 2WNQA 4MGGA 3Q4DA 5HNUA 3WNKA 2QIIA 3KDNA 3WJWA 3CEPA 3RDKA 3TEVA 4GNJA 1DWHM 4CEXC 2A3CA 4MB3A 3TQPA 2CLEA 5LNRA 4MNLA 3CPUA 1UP2A 3BMXA 3CQ0A 4ZB0A 3O06A 3QR1A 3CMGA 4P5UA 1OB0A 2HE8A 1C9WA 3STCA 1Z9AA 3HB9A 2BS9A 4Q8PA 4DX3A 4S3EA 5FIPA 3QH2A 3RO8A 2VDGA 3P67A 1DP0A 3WF1A 3UZJA 4YPJA 1RJRA 1VBGA 6ENLA 5CGMA 2NV2A 4ATDA 2Z28A 3LMYA 1PYFA 4YYFA 4CGTA 5F4SA 2NQHA 1XISA 4Z0SA 4J3XA 1PS9A 2CCRA 1L2UA 4DI8A 1QK2A 4Q4PA 3PBUA 3QVQA 4AVFA 1PSCA 1THFD 1DXEA 2YZ5A 4DJEA 3WUBA 3F4NA 4RDVA 2QEZA 4AU0A 3G22A 5AZ0A 2BY1A 3OODA 4QDPA 4PTVA 2I17A 4EK7A 2GFTA 1CXHA 4WKHA 3F2DA 5FD0A 3EWXA 2YFOA 4O1CA 4XD4A 5FEZA 5BOEA 4WOZA 4ML9A 4PBGA 2PDMA 3WQVA 1XRFA 2QUUA 4PUMA 2VI0A 1F61A 5BU9A 5D8ZA 3VOJA 2X41A 3UNDA 4GQ0A 4RDYA 3MP4A 4JIHA 3T0BA 4LOCA 1E9ZB 4HTBA 3O07A 2ZA3A 2EPKX 3WX7A 3OBAA 2VRJA 4D1IA 3W2NA 4JIQA 3APTA 3FKRA 3QLDA 4DBSA 1UUMA 3IJ9A 1MFUA 4LSBA 3VABA 1K8ZA 4C6EA 1W2PA 3QFEA 4AHQA 5FJUA 4BWLA 3F4VA 4NAEB 4W8BA 4GZJA 1X7FA 3ITLA 2QMJA 4Y9AA 3TSMA 1W3TA 4RCXA 1C90A 3B8SA 5IBXA 4HZ6A 4TUFA 4RK8A 3LBMA 3ABXA 4R7WA 4B4FA 4Y8FA 3ZJ7A 4J3ZA 4DLMA 3W87A 1AMYA 1HO1A 1YDOA 3W1TA 4GUJA 3AALA 4WF7A 4JBRA 4IQJA 1WV2A 1XG3A 2VD9A 3NQ2A 2WM1A 3BC9A 3PAOA 1TTPA 1UKOA 4A8LA 3ARRA 4YXGA 3LPGA 1YW1A 3VGDA 3QGVA 5A8PA 1TQJA 2XZ7A 3M43A 1U5HA 1JDDA 4C6OA 1G4TA 3S1XA 2QJIA 2VEMA 2DUXA 4FX8A 2O9OA 1LLZA 1ZPTA 1N8FA 3QTPA 1KFWA 5KZDA 3WK1A 2NX3A 3UPMA 3V75A 3TA6A 1CXKA 4ZO7A 3HG2A 3QGKC 4AEFA 5PTDA 1Q4WA 1ZBWA 1TSIA 1AMKA 2XVKA 2VEPA 3MUY1 1ZL1A 3NA8A 2XFYA 3DFYA 5H8PA 1S3TC 1TVNA 2YDSA 2MUCA 4URIA 3P60A 3PY2A 4Q7NA 2ATMA 1DKWA 1EA9C 1SYTA 4GUIA 4JTFA 3ATZA 4P61A 3TA9A 3WKZA 1H7WA 3L2LA 3VKKA 1NF7A 4Z2LA 5B7ZA 1P0NA 4WK9A 2XN2A 3I3EA 3KUMA 4EAMA 2OEKA 1XJBA 3WQEA 3TCSA 1NU5A 3EWZA 4PCTA 5CKSA 1Q5MA 4JFWA 2C16A 3NL3A 4B92A 4AF0A 5A6TC 4XAFA 1AD1A 1LWJA 3BG9A 4XD5A 2Y5JA 3E6EA 4ATWA 3N18A 1YX1A 3H26A 1E0TA 3AMLA 1M5WA 3W7EA 4S3CA 1JZ7A 3RPTA 3KTXA 1OADA 4XAPA 4GOAA 3WH7A 1PL9A 1TELA 3E9AA 4HN4A 5C7VA 3MMUA 3U4AA 2ABAA 2BZNA 4PODA 3DUGA 4IGMA 3PNZA 5AYZA 5K9DA 1VHNA 2NV9A 4NZ3A 3E1F1 4GYKA 4ZE5A 2AL2B 2CZEA 4L4LA 3UZYA 3ONCA 3BH4A 2TYSA 3W07A 1BFNA 3CUFA 4IP7A 5HMFA 1QOQA 1S2TA 3F5LA 5HQLA 5DY3A 4C7FA 3ARTA 3E49A 3NQVA 2X30A 2Q8LA 1XINA 3GR4A 4PR4A 3UZXA 3OPSA 2NUXA 1MW2A 4Q4QA 2WAGA 3UWVA 4H8NA 3P5YA 3RIKA 2OJPA 5HQMA 3IIOA 1T8XA 3VC5A 1EJSC 3GU2A 3IJIA 3R58A 1L0PA 1UH3A 2AGKA 3GVQA 1UZDA 1CDGA 4XX6A 3NAVA 2V8ZA 3THUA 1KCZA 2IUZA 3BCJA 3L66A 3OVRA 3STEA 3UGRA 4UTUA 1V0NA 1Q2RA 1BAGA 1LYXA 4DZ5A 3T8LA 3MSRA 3UCQA 3UD6A 1VS1A 2CBIA 3KEHA 3U2ZA 1GUVA 4JX5A 3JZUA 3PTQA 2ZX5A 4X0VA 1R3VA 1C93A 3QZEA 3K1GA 2PU1A 5I77A 4N2YA 3TCEA 5CQ1A 4DNHA 4EWJA 1FUYA 4LPCA 4PBFA 2DIJA 1U33A 3LM7A 1YNPA 3AFBA 1ZAJA 2CYGA 3TOYA 3GR8A 4C6LA 3HG4A 1EHNA 1JPIA 3PM6A 1QT1A 2W3ZA 4S2CA 4CD7A 1I2PA 1ZP4A 1P6CA 3D6NA 1XFCA 2I9EA 5KTLA 4HNOA 1QHPA 3DHFA 2OX4A 4PMVA 1VYPX 2FHBA 3UJSA 3WLHA 1VGAA 3EWBX 3PFRA 1AFSA 1H7XA 4AEEA 4AZ5A 1C92A 3GIQA 2CLOA 3A4AA 1K77A 3BZGA 2D24A 3CZJA 1ADOA 4V15A 1R87A 1GPWA 2Y62A 4L6OA 2GUBA 1XKYA 1SJCA 1ONWA 2BX7A 4A3QA 1IT8A 2HVMA 2DIKA 5LHEA 1GHRA 1PKNA 3N2OA 4JD4A 2XN0A 5CSRA 3GYEA 2O56A 4UNKA 3R5EA 4J1OA 1T7LA 1GQNA 2OG9A 3MYPA 5LSMA 2BSLA 4LS2A 1J2WA 4PFHA 4I7VA 4KEZA 3EPOA 5BXPA 1GYLA 3VNKA 2QGHA 2RDTA 4H6QA 3PTDA 4MWAB 2CEQA 1JUKA 4LV9A 3OHIA 1A80A 5G2WA 2ZUNA 3G6MA 1OCQA 4NKCA 5CJMA 3CV6A 4KF1A 3QZAA 1H0GA 3M0YA 1IXPA 4L80A 5C70A 1AW2A 1EIBA 1F6PA 2W9MA 2WHMA 4LS1A 1UOKA 1IEWA 3CL6A 4AY7A 1RCQA 1VBJA 3VZYA 1EF2A 3EXSA 2CHNA 1K9TA 2ACQA 1EF3A 3T2PA 4UTTA 4JTLA 3CEUA 1VFUA 1I2RA 1V6UA 4D6JA 4HNTA 4GQRA 1M6JA 3M0KA 1K4GA 2GDVA 2XVGA 2QKFA 4FNSA 2QIWA 1AJZA 2VVSA 1XM3A 1DJWA 2BOEX 1DWAM 2XIOA 1TO3A 1JPHA 3U6WA 3WEOA 1DXFA 4DZAA 2ZZ2A 2VURA 2ALRA 4BQ4A 3BUVA 4YHGA 4IGSA 2Q3OA 4I3GA 1RR2A 1V6YA 1QTWA 4UQBA 5F4XA 1YHTA 1L8NA 2IXVA 1A0DA 3NM1A 3W7JA 4WUIA 3G1AA 1TWZA 5AYBA 4WLCA 1LRQA 4ALDA 2FZMA 3WDPP 3LCFA 2PZNA 2QJNA 1QHZA 1ZJAA 1W1YA 2QJMA 5FF7A 4W87A 3KFTA 3WBAA 1TPB1 3TJXA 4FX6M 4QGCA 3IACA 1WDWA 4HHPA 4DYKA 2FMNA 4QG8A 4ZOCA 1PPIA 1A0EA 2GDQA 1JFHA 1AVAA 2HPIA 5A6MA 1HP4A 4F9DA 4IL2A 3KCOA 4J2MA 3IK4A 2A79A 5LA1A 2DW7A 4I9AA 3CL7A 5MKGA 2D0GA 1MUMA 4OOUA 3FLUA 3QBUA 3CO4A 3TVAA 1TV8A 1QPQA 5TQLA 4QAIA 3PWGA 1CXFA 1CPUA 3V16A 2E6AA 1QNQA 4RV3A 3DKLA 2OWWA 2UWFA 3AYRA 3LTYA 3GDTA 1H7PA 4PTNA 3WD4A 5G4HC 3CPRA 1LUCA 1TJ0A 1WZAA 3FVMA 2VZTA 5D2YA 2JEQA 3QYSA 1GORA 4GNKB 5EFDA 1A5SA 4MAVA 1P1MA 1O5RA 3E5PA 2XWDA 4OQVA 5A6JA 1IGWA 4QNWA 1JZ6A 1UA3A 4Y2WA 3LLXA 8XIMA 3WZ0E 1XC6A 3ZZ1A 3IVSA 1CGXA 4HNNA 2F61A 4NQ1A 1WDDA 3WO8A 2E8ZA 1RA0A 3UA3A 3LM3A 3OVGA 5EBUA 5B7YA 1A53A 4BF7A 1NARA 4N42A 4HOWA 4Q4MA 1XGEA 3GK0A 4IIFA 3UPWA 1ME9A 4GI6A 1JGMA 5T9CE 3ARZA 4AZCB 1K1DA 5HA7A 5GJNA 4DO4A 1UJQA 2BODX 1A47A 1GKRA 1CWYA 1GKPA 1K6AA 3O1NA 2YR1A 4N6FA 1CTNA 4N6EA 4PULA 2GJXA 4XD3A 4FNPA 3VTRA 1FRBA 2PTYA 3ENLA 1KXVA 1YTEA 2R14A 4H3DA 3P0XA 3C86A 4KEMA 4FP1A 3CWNA 1RCXB 1R7OA 4Z08A 1WDPA 5BWAA 5AHEA 1HL2A 3M5XA 4WX2A 3VILA 4ICCX 1SZEA 5DCBA 3E74A 4YTTA 4ICMA 3T44A 5GNXA 1V7AA 2BDQA 3TROA 4IJCA 4JFTA 2V3GA 1AD4A 3W24A 3LI0A 3D3FA 5CZ0A 3W23A 1BGAA 3PWAA 2FJUB 2GWGA 5D02A 5KMYA 4I9JA 1O95A 1OINA 2ZVIA 2YGYA 1X97A 2PF0A 4RXFA 2J7FA 1R86A 2L5HA 1SUXA 3T4CA 1HGYA 3N04A 4QX4A 4IMFA 2GGHA 5G1YA 5ENLA 1K9EA 3VDBA 1RY8A 4O57A 4PCNA 1GVEA 2WMIA 4RW5A 3PSWA 2XM2A 2YL9A 4Q4RA 4KCTA 3A4WA 5JBDA 3CUJA 3SIZA 3AXXA 4ACZA 1I0DA 3G24A 2CU0A 4O1FA 8RUCA 1Q6EA 1ZRQA 3WD2A 3DBPA 1VFMA 2Z7GA 4L1XA 2ZRZA 4L4PA 3VPLA 1Z89A 1X98A 3AMDA 3PS7A 3OB8A 4HPNA 4AXKA 3W02A 2VWSA 3W29A 2ISWA 4QLLA 4R9XA 4KCWA 3RLGA 1YBQB 4M51A 4Q8UA 1IWBA 3GDLA 4LVAA 4O54A 3CUHA 4GVIA 3DFHA 4DAFA 3CJPA 4B3KA 1TJPA 3KTCA 3TAOA 2PCEA 5HMEA 2F38A 1OQFA 2RHGA 1TX0A 5GJPA 3W4RA 1GVSA 3LLDA 1Y5VA 4QS6A 4FSAA 5D9OA 4CQDA 5HJXA 2GJPA 3PJUA 3SO7A 2A4AA 3MMTA 4WY0B 3LLFA 4MY9A 2Z1KA 4M29A 3CL8A 5I3JA 3P6LA 1PYMA 1WKFA 2D1ZA 3SUTA 1LZOA 4LUTA 1W9DM 4JFVA 4QTGA 2WJFA 3T7VA 1EC8A 1GOKA 2CLMA 5CC5A 3SUWA 3FJ4A 4P2VA 2XGBA 3K4WA 3K4DA 4AD1A 1H09A 2QUNA 3I65A 2F6UA 2O9PA 1ICPA 2ZUWA 2VZOA 3KOWA 2FVKA 1V7YA 3VD9A 4UR8A 1O5XA 4XZMX 1AZ2A 1KLYA 1F8MA 4P7LA 1FBAA 3C2OA 3EPMA 4JN7A 4RE2A 1VF8A 1TWSA 4D8AA 1SFSA 4QQ3A 3UBPC 3RJXA 1UWUA 4XQ6A 1W1ZA 4AQLA 5AYIA 4HT3A 2R1PA 4L9ZA 3MO4A 3UA4A 1SO3A 3BTNA 2MNRA 4MY1A 1B0IA 1MNZA 3ZJKA 6XIAA 3HQNA 3RM9A 1DVJA 4L61A 4XAYA 4E4PA 1JZ2A 5HR7A 1ZAIA 2A7NA 3DESA 3GW0A 5DMLA 1JPDX 1IXQA 3FV9A 1HJUA 4QJ4B 4FLQA 3OG3A 3M4HA 5A6BA 5C5YA 1ZNNA 3REQB 3WLIA 4H9VA 3PUOA 1ONXA 1WZMA 5FF2A 1XLCA 4E3VA 2Z4GA 1J0JA 4ZOBA 1F2JA 1XYFA 1TVLA 4P7RA 1FWHC 2YJQA 2E0PA 4CLMA 1MQQA 1C8QA 3L0KA 1J0IA 1S2WA 3BCDA 3N3TA 5H91A 1XIEA 3VNJA 3W7HA 3NL2A 1NP2A 2VYOA 4PCSA 3DFTA 3CUIA 3WK3A 2DZVA 4XSLA 5E93A 4JKKA 3HPZA 2ACUA 2H90A 2O7SA 2DU2A 1E1CA 1EPXA 1U1UA 1C7SA 3HTWA 4KRUA 3B0UX 4LX4A 4EIVA 4K8EA 2WZEA 1EJWC 4IFOA 2V5CA 4UQAA 3XIMA 1SJDA 3A47A 3M5ZA 1TX2A 1QR7A 4C1NB 4ERAA 1SR0A 4H6RA 3LUTA 4BQ2A 5JUVA 5DY2A 1YMYA 1OX4A 2GQ3A 4FHAA 3W7PA 2VFEA 1XYCA 3NO5A 3M0MA 4O14A 4Q4OA 4MNKA 4R9OA 4V1YA 1VKFA 3MANA 2FB3A 4H9XA 4XB3A 3M0VA 4WDTA 3TDFA 4XAGA 3VX0A 3PPGA 1EUNA 4PA8A 3ITYA 3EEZA 1J96A 4GZEA 2PE4A 1EBHA 1XYMA 1QCWA 4CU6A 1VLWA 3DHDA 3SRFA 2Y24A 4X60A 1R3WA 3W1MA 5CG0A 3JUGA 1SJAA 2W27A 3SAZA 4I5UA 4U31A 1B4EA 4HU4A 1KBLA 2QCGA 3BMWA 3ONBA 1ZY9A 5XIAA 3M5VA 1EJVC 3T1GA 4GIEA 1KM5A 2ESCA 2J77A 1EBGA 1PUDA 2WVUA 3WD0A 2INEA 3JZEA 4PTDA 3IIZA 1P0KA 5ABGA 3L4VA 3OQ8A 3PZOA 2P53A 4KMQA 3KDOA 1UMLA 2KAUC 1J11A 2BXZA 2VZSA 3C8FA 3GSMA 5CLTA 2D3LA 1M65A 4HA0A 1IYXA 4YS1A 1WB0A 1SFLA 1H1ZA 4M6VA 1M68A 2POZA 3F1QA 4LU0A 4GFSA 1TYGA 3NQFA 5HXMA 2YLAA 4Y9MA 4J9JA 3VINA 1Q6CA 3WMCA 2QV4A 2PC8A 3LPFA 1E70M 3R7MA 3EEGA 1AL7A 1GJUA 3N12A 3UXLA 4BZYA 1FWJC 1LL4A 2OSXA 4IFRA 1GCYA 1W6TA 1QAPA 5AC7A 4XUGA 3GZ3A 1EO7A 1MNSA 4JTEA 2EXOA 1AJ2A 3TOPA 4Z1YA 3MT1A 3TC7A 1P6BA 4DJFA 4N02A 4G1KA 4D6IA 3GLCA 1RQHA 2E28A 1M1BA 1UZHA 2QCLA 3RYSA 2CIPA 4B5XA 3KCJA 3HG5A 5DT5A 3TP4A 3FEMA 3G6LA 4TQTA 3T09A 1N8IA 4O4VA 2FTWA 3C52A 3TTSA 3TYBA 3V4BA 4HSHA 2QPSA 4AHPA 1Z6KA 1PBGA 4LRTA 3DG6A 5A95A 4NP7A 1L6GA 4YIWA 3TE9A 2E6DA 3S2LA 2YW4A 1LBMA 5E0KA 1KTNA 3LRMA 5L6UA 2H8XA 1VBHA 4NX5A 5E09A 2NLIA 1R8LA 2VFDA 2WQDA 1VCVA 4L4MA 1G9HA 1ELSA 3GG8A 4TX9A 4PTMA 4ZQCA 1H0IA 5T9BG 1S1PA 3BPWA 3EWWA 3N6HA 1VZWA 4TIMA 3ZSSA 3N13A 2AMGA 3TTEA 2DZAA 2H8ZA 3N73A 1QPNA 4IT1A 4ZCWA 1DJQA 2PWDA 3WNNA 4WJXA 2QT3A 4AZIA 1TJ2A 4OV9A 1HKJA 5FF0A 1LJYA 1ICSA 2NSOA 3W7RA 5AVNA 4M56A 1J8VA 4B9ZA 1UHVA 5AYYA 4UMBA 2X1SA 2YL8A 2E9MA 1XLMA 4GBDA 1XYBA 1TB3A 3BV4A 3QOMA 1WKYA 4O13A 1LOSA 1G01A 4K1GA 1FHLA 2XZ9A 1E0WA 5JVLA 2ODOA 1RAKA 3SADA 2PWEA 3NVTA 4WGXA 4DHGA 2FZ8A 1OYAA 1JAKA 2PDQA 4DWSB 3EX4A 5DMMA 3BAWA 5ABFA 4M1BA 2VFIA 1F5ZA 3WJYA 3OZPA 4FIQA 1A5BA 1GG0A 1G94A 1EHAA 1MRQA 4MJ2A 3S46A 2CZVA 4E8DA 4WOQA 5K9CA 2C14A 3CIXA 3AC0A 4K7YA 4UMCA 4H7ZA 3MI3A 4XIMA 2FDSA 3WJSA 2XFRA 3L4XA 3B06A 1LQ0A 2A2IA 2JIEA 5C2CA 3EB4A 3TR9A 3IIVA 3M07A 4JY8A 1JCTA 1LF1A 1BF2A 2HE5A 3ERPA 3QQWA 4MYAA 3IVUA 2VR2A 1UUQA 3VO0A 3AIVA 3WLRA 4H9YA 1CB2A 3W7CA 4NZFA 2J7GA 1MUWA 1EJTC 1A0CA 3W0KA 1WYIA 1IEXA 1R3RA 4R85A 1EJ7L 3UR2A 3DFOA 3TYEA 1QW9A 3GHRA 1ZJIA 3HIJA 1VPXA 4QE1A 1O12A 2OO6A 2CPUA 4K68A 2GOKA 1TCDA 1ZALA 2EGZA 4RE3A 1OC7A 2P0OA 2VCBA 1LOLA 3EA3A 2J25A 5HBFA 1OFOA 3R2GA 4JHMA 2BNJA 1WXJA 2J24A 1EO5A 3WG6A 3ZO9A 3U7BA 3UWYA 1JXKA 1E3XA 4LB3A 1VBUA 4LQ1A 6CGTA 1HKWA 3QHMA 4UFMA 2HSAA 3L23A 4LEFA 1WUFA 4GG9A 4XV0A 1G7UA 3H4WA 4W5ZA 4NIRA 2DZXA 3KBNA 4Z2KA 2PODA 4NI8A 3W82A 1WOAA 3WLJA 3RK8A 1P5BA 5C2XA 2VEIA 4B9YA 4LJ3A 4ZQMA 3MJYA 4AX6A 3UCCA 1GTEA 2XH2A 1Z3NA 3QGAC 3H2OA 4JTRA 4H7VA 4UTKA 2WWDA 1VH7A 1U83A 1RBLA 3O6AA 4GO8A 1EQCA 3VNYA 4P8XA 1ZU8A 3NWRA 4A22A 3C2RA 4PSPA 9RUBA 2WW5A 4A3UA 1IZJA 3B8UA 2J6VA 4QFUA 3T55A 3M7SA 2P3ZA 2R94A 1I1WA 2W92A 1C8XA 3GFZA 5J5RA 1H1YA 1FP9A 4O15A 3CIVA 4PMYA 4CD6A 1C3FA 1ZTVA 1KM6A 1T6MA 3S47A 4NUWA 7REQB 3TJLA 2ZBTA 5AOUA 1K03A 4ZQOA 1OC6A 2VDHA 3T81A 1SR9A 3HU7A 3SDOA 3FGCA 4HIBA 1U2YA 1SW7A 3HO8A 3MI6A 1CGTA 1RPKA 3A23A 2FGLA 3TC3A 1XG4A 1BVWA 3TX9A 2PP3A 3NZRA 1NY1A 1GVFA 4B5UA 3GBDA 4LEQA 1DQWA 2B7NA 1RUSA 1JD9A 3F4DA 1SW3A 1W3LA 1H5YA 4L65A 3DG3A 4WXZA 3BW2A 4PMXA 1V3KA 4F0LA 4KESA 2FPVA 4FLSA 3CHVA 1H41A 3VIPA 3U9IA 5A6AA 1FCUA 2BP1A 5I03A 3GNNA 4BF5A 4DM1A 2CNCA 3WBXA 3TNBA 4ZFCA 4Q22A 1TIWA 2GK1B 2WNZA 5D9PA 3OEXA 3SZ8A 4Q8TA 2BVTA 5I3IA 1S5WA 3VVGA 4QE5A 1OGBA 4ML4A 5I3DA 1TE6A 2FFIA 4GKLA 1A50A 2WWCA 4GMEA 4C6DA 3U5UA 4RE0A 1E71M 3PZNA 2XM1A 2IKIA 5K9XA 2GYIA 1GOIA 3RHGA 5KZMA 4NILA 3CLMA 4F0RA 2QDDA 2ZFAA 1I60A 2PDCA 3KS6A 3DBNA 1ZFJA 1W3NA 3H12A 1DWGM 4TV5A 3EKZA 4JAWA 4QP0A 3QV8A 1RJPA 2B31A 5A2BA 1OFQA 2DY3A 4PMZA 3V5FA 3AAMA 2GQAA 4IPIA 3MUXA 4MB4A 2J8FA 1NFPA 4TMCA 4Z42C 1B2YA 2C13A 4BY3A 2VENA 2XJ7A 3VMOA 5F2LA 1XDLA 4J7RA 3IPWA 5T26A 2D0FA 4FK9A 3W7KA 3ZWTA 4CKQA 3M9YA 5FOOA 5HJLA 3N6JA 2CLFA 3RLVA 1JDFA 4AIOA 4I7UA 3BLLA 1FWTA 1F3TA 5FJRA 3Q37A 2E8YA 2PWVA 3OZOA 4US5A 4XBSA 5C9RA 3MV01 1Q13A 2R1LA 2PRLA 3M41A 3FOKA 1E0XA 2PGFA 4J3UA 4TTGA 3EWUA 5CSUA 1OCJA 5D2WA 5RUBA 3TNOA 1QPKA 1QOXA 3CUXA 5FEXA 3CZGA 2PPGA 4BKNA 5I3FA 3UVAA 3EZ4A 4ZO6A 2HS8A 3ITXA 3BXWA 1UH2A 2QDGA 3D5HA 1NWUA 3MHFA 2FGBA 4IFKB 3URNA 1N8WA 3GD6A 3KZPA 4PUEA 4XVEA 4GWEA 5JH1A 1JZ3A 5BXRA 3P8JA 1CLXA 3N25A 2OR2A 3TZNA 4MOZA 1US0A 4QITA 1LQ2A 2J7HA 4WRHA 3TWBA 3BG5A 4W89A 5HOSA 1I2QA 3L7RA 3W1QA 2DT1A 3VKDA 3G3DA 3LDVA 5B80A 4Q8NA 5BYWA 4H04A 2VM8A 4AMAA 4LCRA 3BARA 1K4HA 4E8GA 1E0VA 1XYLA 2ZADA 2CERA 3POCA 4KWVA 1O6IA 4JNYA 1V6XA 2HK1A 1QUMA 2V82A 2FH8A 1Q7ZA 4QDWA 1TJ1A 1TMQA 3EMQA 4NNBA 2C6QA 3NEHA 4HOZA 1ALDA 1SSDA 1KM3A 5LNVA 4DJDA 3WQFA 3ZYZA 2ZDSA 4W84A 4GJJA 3FHQA 3B9NA 1XBXA 4FR6A 2E1DA 3WFAA 2YA2A 1EXPA 1E55A 4GJIA 4O1AA 1XRSA 3NGFA 3GAKA 5C9ZA 1R30A 4QDMA 4FMVA 2ACRA 2Y8VA 3LY0A 1XCXA 3WFZA 1VJZA 1TTIA 4ZVJA 5KSWA 3A12A 1TZ7A 1B9ZA 2F7FA 4LGXA 1TTQA 4OE7A 1FWSA 3TONA 2QCEA 3NUKA 1EP2A 1ZBVA 1X39A 3B8WA 1H7NA 5I0DA 4R7OA 7ENLA 1B3VA 1AQFA 1HP5A 1W1B1 1QRQA 1TPEA 1RALA 1XGZA 4NAEA 1VHCA 3QY6A 3G0UA 4GCAA 3F4WA 1KXQA 1KCXA 2C1GA 5TD4A 4Y8EA 3C0LA 1BQGA 2OODA 4JTJA 3BGJA 3KE0A 2NQZA 1XYZA 2DJLA 2HCVA 3AUJA 2JFEX 3PZIA 4L64A 3AOFA 3CAQA 1DJIA 1S2CA 3F5JA 4PUDA 1I2OA 3MHUA 2VP8A 2DH3A 1DPMA 3MW7A 1PZ0A 3AXHA 2V69A 1WDRA 2G8ZA 3TUUA 3MZ2A 4GA8A 2NQ5A 3H2FA 4I9MA 5IM51 2Z0IA 5F2IA 3O15A 3V18A 2FDMA 3OVPA 3PBVA 3QQ1A 3LXBA 2OYKA 1EC7A 3W76A 3O05A 4FO4A 4EKJA 2EPNA 1OCBA 2GJLA 3OHMB 1X8CA 3O9NA 4HHHA 1VEOA 2ZE0A 3FDKA 5EU9A 3VOIA 4E2DA 2I9UA 2QAFA 3ABZA 4FNUA 3AHVA 3L2MA 1ZENA 3FN9A 2OQLA 1DOSA 1G5AA 3EB2A 3TLQA 3EOEA 2Z2AA 1BVZA 1KGUA 2OZ8A 2P88A 4S3GA 2BVYA 3KL5A 3H2MA 4RKAA 4O28A 2VOTA 3Q2DA 3FJLA 1TV5A 2AKMA 3K8KA 1EDQA 2YA1A 5K3VA 2G5WA 4Q3MA 3BAJA 3TW6A 1K6WA 2ZZ1A 4QISA 3W2UA 4B3LA 3T0AA 2GQ9A 2WCSA 2D2GA 3AXMA 3LCGA 2WMJA 1JYXA 3BW3A 2YDQA 5D09A 1WX0A 4DWDA 1UWQA 5KITA 4EAYA 2QF7A 2Y88A 3NGJA 4YLWA 1KFEA 3M47A 4V27A 1ITCA 3K13A 1GHSA 4LY8A 3LU2A 2AKZA 3H53A 2W62A 3TMLA 4KRTA 3ZVIA 3UXAA 3W1RA 3PAJA 4G56A 4YJ5A 3GDRA 2GJNA 4HSOA 1SZFA 2G96A 1KWGA 1PTAA 1OYCA 4MLRA 3RPMA 4PMOA 5C55A 1KV8A 4A8IA 9XIMA 1D7KA 2PP1A 1N55A 3B3DA 4Q4SA 4U3AA 1YE6A 4HJFA 3USZA 4G5DA 3S1UA 3ZLHA 1FTXA 3L5MA 3U3HA 3VNDA 1LWHA 1JR1A 3UJRA 1M53A 2AL2A 3NQMA 2QV5A 1E6RA 2E67A 2X1UA 2OKOA 2PWFA 4CN6A 5FJPA 1IIGA 4QIUA 4EWND 4B5TA 3NXFA 2O92A 3NQCA 1PKMA 3NJ3A 3QF0A 2HZGA 3A22A 5AVHA 3S83A 4J40A 1N2VA 3GFXA 1H61A 2CFFA 4QM1A 4O10A 1DWFM 5K2ZA 3WMSA 4AZ7A 1XHGA 3K8MA 1OVDA 1AW5A 4B15A 1TUXA 2E1WA 1GOXA 1S5NA 4IG2A 3RM4A 3CB3A 3JVAA 1SM9A 1RQEA 4BI6A 4ZGYA 2QCDB 4O0ZA 2ICSA 1CCWB 3DYOA 4UTWA 2Y5EA 1MUCA 1XC4A 2ZRWA 4XKMA 3RJYA 2Q6ZA 3GUGA 2R9RA 1Q6RA 4JFUA 1S46A 1IXOA 4DJED 5BRQA 3N17A 1OX6A 2OU4A 4U10A 1GZGA 3UY8A 4S3FA 2IPFA 1JPMA 1J9YA 1KLZA 3NSMA 4INFA 5AN7A 1B3WA 2GGGA 3DYMA 2Q02A 3G1VA 2C3ZA 1SMDA 4GXMA 3VIOA 1O5QA 3GDBA 2G0WA 4F8XA 1FWBC 4KQNA 3PZMA 2Z1XA 2GUUA 2HRWA 5CGQA 1DE5A 3IIPA 1I8JA 2H9AB 3W1NA 3I6EA 3QQ0A 2PCQA 4WY0F 3AZTA 5BWFA 3ITOA 4NL1A 2UV8G 3K30A 1E0UA 4Z1BA 1P1XA 4YN5A 4JYEA 2WMKA 1WP6A 1XBYA 3AIRA 3E12A 3K1DA 4M8UA 1ODUA 1W17A 4MLJA 5DX7A 3G1XA 3UW6A 1TA3A 3GU9A 1OFBA 3VX1A 2WVVB 1MEIA 2IMRA 1FXPA 2PDIA 1XIFA 3PWIA 4NNCA 5CCZA 5GNZA 1NP0A 5CEWA 2GSJA 1TPVA 1IR1A 5KZ6A 1J18A 4JIIX 1V3IA 4S2BA 2WXDM 3FK4A 4HB7A 4U4MA 3WNPA 3OU8A 2Y61A 3AMCA 1UKTA 4DI9A 4Y6GA 1UP3A 2XFWA 2OOGA 2PBGA 4NT0A 3VIMA 4C5YA 1GONA 2HBXA 2DZWA 3ITTA 3TR2A 1EQPA 3FSUA 2J79A 4N0RA 1AQHA 3POHA 1K70A 3RRAA 4PC8A 3DFNA 1VENA 2Z2BA 4WCJA 1MDRA 2VGGA 4MWAA 3WLTA 4I7WA 3THQA 3DX5A 4HZ7A 2GWNA 1B54A 2XGIA 3MO7A 1TWWA 1WKDA 3U2CA 1DTUA 4IZGA 2J66A 3HJZA 1EL3A 1RH9A 4RZ6A 5XINA 3SJ3A 4H41A 3F03K 1I4NA 4UNIA 4XUYA 3EOLA 4AZHA 5LXXA 1UASA 4ROPA 4CQ8A 4L9YA 3NPUA 2IKJA 1F3WA 1CGVA 1QMLA 5IHRA 4RDZA 1EGZA 1Z32X 3GKAA 4PH6A 3M0JA 4GH1A 3C8NA 1WZLA 3OJGA 2FZ9A 1YRRA 1BF6A 4A3HA 1X96A 5AB3A 4DPPA 3LRLA 4JY9A 2GVJA 2OB3A 1F7BA 4LANA 4X2RA 5GVJA 4N4QA 2J74A 4HVXA 2FHCA 1Q8JA 3T9PA 1OFRA 3IUHA 3NZQA 3Q65A 3LI1A 4AVNA 3SIMA 1U1JA 3RRXA 1AL8A 4JTTA 5C9WA 4UFHA 4EVZA 4US6A 1KGWA 1TR1A 3C0SA 4QHRA 3PZQA 3U48A 4TMBA 2VC6A 5AHNA 5CZTA 1UC5A 3OIXA 1E6ZA 5EMYA 3AXIA 4DO5A 1W3IA 1W3KA 3N14A 2ABBA 4JTKA 4I8YA 3SCNA 4YVPA 2OZ3A 3M46A 3QR3A 4B5NA 1EKOA 4MKSA 3CUZA 3NIYA 3NDYA 1FDZA 1WAWA 5DEZA 2Q01A 3B8DA 1IQ8A 2V3DA 4QCFA 3MA8A 5EMUA 2NV1A 4PL2A 1KXTA 2V9DA 3E0VA 1KFJA 3N9KA 4GLEA 3CHDA 4RZ5A 3SUUA 1GOQA 3E2QA 1YDYA 4PGLA 4DYEA 3S0CA 4GYFA 4HPHA 3NCOA 1ISYA 2HTMA 3EWCA 1XSKA 3WCZA 4YWSA 2HNHA 1QNSA 1V5XA 2Q09A 3S42A 3ES7A 4DQWA 3M0HA 2Z29A 3OLIA 3P2VA 5I24A 1ZB5A 2YBUA 3LGGA 5EMJA 2V63A 3ANUA 2PU0A 1JL8A 3M1ZA 1DJXA 2CKRA 3CV1A 1PTGA 5E6YA 1Q6LA 1IZCA 3C3UA 3UYIA 3VGBA 3E5BA 1VCFA 4KFNA 4HMDA 3IJLA 3EXTA 2A6NA 3QC3A 2BLEA 2QXWA 3CK5A 1NM9A 1PDYA 3EWYA 2PDUA 4AF0B 3VDHA 2QUVA 5K7JA 3BK0A 3I3DA 4Z1AA 3WLMA 2QQ6A 1M7PA 1XIBA 1Q6FA 1Y0EA 2DSKA 4JEJA 2J7BA 2XIJA 1XUZA 4TV6A 3UG3A 1BVNP 1UB3A 3W1UA 1MO0A 4H00A 4CQCA 2HQAA 1WDQA 1OWQA 3MKCA 3BGAA 4WJ8A 1FWGC 2CLLA 4NJHA 3WF3A 1JF5A 5I23A 3HN3A 1XLKA 1P6WA 3V1HA 4PMUA 1BYAA 3GKFA 2QF8A 4DJEC 3CHFA 1ZCOA 3TU9A 2CKSA 1V0LA 3LERA 4XISA 2XU2A 2FQIA 5LIUX 2AQOA 2J7CA 2P10A 3IJ8A 2OGJA 1JCNA 3KW3A 2DZTA 3NZPA 3V5OA 3LPOA 4GY7A 1YLVA 3IANA 3BG3A 4G2DA 4F0KA 2BXYA 4ECLA 3NO1A 3B0YA 2YIHA 2A0NA 1JI1A 3W22A 2P3EA 3VCCA 1KA9F 3T07A 3S5SA 2FTPA 2A21A 4ROQA 2J6XA 1JI2A 3VFLA 3GG0A 2Q71A 4ZR8A 2DGAA 3R10A 3SJNA 3DGRA 1OF8A 4Q7IA 3QRHA 5EA9A 4LC6A 3HMCA 3H8AA 2PLCA 2G4JA 1AW1A 3PR2A 1CX9A 1OYBA 1CT5A 1SPQA 1MQPA 1PCWA 3H2CA 3H4XA 3OVQA 1PV8A 3VIIA 4BWLC 4NRRA 3ABSA 1XRVA 2GVEA 5BOFA 4W9TA 2Y7GA 2VELA 4X0NA 1FFQA 3DOPA 5IBXC 5SWUA 3BURA 1OCNA 3IGUA 3W7LA 3TW9A 2ZTJA 3B9OA 4JTAA 3OIHA 3DYPA 2V5JA 4WSJA 3WYZA 4IOTA 3ZR6A 3ZQ9A 1VPQA 3GHUA 4JEQA 5BRPA 4ADTA 1LG2A 1H5VA 1ZSXA 5BU6A 4DB7A 5FJTA 1LM1A 5EY5A 1YBQA 5IHSA 7TAAA 3BLKA 3SCUA 4KIRA 3RF9A 2I5QA 1MRAA 3NZ1A 3TWAA 4IQLA 1ENUA 3GNOA 2PGEA 2VCCA 4LVFA 2AL1A 2E6FA 1PWLA 3FA4A 4JYDA 3ZJ6A 3BOFA 2VL4A 2VEKA 5BRBA 2OFJA 1F74A 5C0QA 3CQJA