2J88A

Hyaluronidase in complex with a monoclonal igg fab fragment
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
324
structure length
319
Chain Sequence
b'EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONONGLUCOSAMINIDASE
publication title Identification of a B-Cell Epitope of Hyaluronidase, a Major Bee Venom Allergen, from its Crystal Structure in Complex with a Specific Fab.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 125
structure length 319
sequence length 324
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j88A00
1VYSX 4EWND 3BPWA 3L0KA 1P0KA 1SO5A 3CU2A 4O13A 2F7FA 3CQ0A 4DF2A 2YCEA 1XCFA 2E5CA 5TIMA 2Y62A 3I7RA 4J9JA 3O6DA 2NX9A 1GTHA 2NWRA 1AL7A 1SW7A 2OX1A 3W23A 1YDNA 4NZJA 1W5QA 3G22A 3V1PA 3NPWA 2HMCA 3LRMA 3O07A 2DJXA 1SW3A 2PE4A 1N55A 5TBOA 2WPBA 3VE7A 3LTSA 4N6EA 4O28A 3W85A 4OV4A 1KM3A 4LVAA 2J24A 1C8VA 5DBTA 1HL2A 5LNUA 4Y8FA 5LKYA 3A9IA 4UTIA 2VFHA 4DO6A 5KZMA 1H50A 1GVSA 1MEHA 4AVFA 2ISVA 3S5NA 3W1UA 4I7VA 1ALDA 3MI2A 3EXTA 1SO3A 1GTEA 3W7HA 1FXQA 2CZFA 3OVRA 4K38A 1YADA 4O8RA 3ABSA 5I3JA 1GWJA 1G4EA 1DQWA 4U28A 3W71A 2NX1A 2GPTA 2W0UA 3QW3A 1W5NA 2RDTA 4RXFA 3C2FA 1Q6LA 3C2EA 2V2DA 2C13A 2WNNA 1IXOA 4HHPA 3ELFA 1P5BA 3VKJA 1ME9A 1TPB1 2TMDA 4JN6A 4IMFA 1Q45A 5K3VA 5HULA 2D73A 2P0OA 1W0MA 1TYGA 2E1DA 3QM3A 2C18A 4FNUA 1JVNA 1W5OA 3P62A 1SUXA 2UV8G 2PRHA 5DY3A 4YWIA 2W6RA 4NJIA 3DU0A 1C29A 3BW2A 4UMBA 3KHJA 3C2RA 1TQJA 3EWUA 3UXDA 3DI0A 4IMCA 3MO7A 1H51A 5MHBA 4WOZA 1EP1A 4LRSA 5DXXA 1BWKA 3TE9A 1FQ0A 4LV4A 3KFTA 1PE1A 3IVTA 2ZA1A 4Z1DA 1XDMA 5EA9A 1OFBA 4UXDA 1LYXA 4PODA 3F4WA 5C5YA 2V5LA 5CZTA 1EEPA 5HWJA 1XDLA 2Y70A 4JR5A 4MJMA 3DKLA 2FB3A 1TCDA 4QISA 4K8EA 2Y7GA 5HR7A 3WK2A 5AFDA 4C1KA 3LI1A 1WA3A 2QCNA 3M44A 4JTIA 1OFDA 2YZRA 5FI8A 3W2KA 3LDVA 2J27A 1JCYA 3ATYA 4NJKA 1JULA 1OG0A 3TJLA 1D9EA 1QPQA 1OYAA 2OCZA 1A5AA 4AWTA 4JTHA 3G24A 5FEXA 1VLWA 1LBLA 2A6LA 4N02A 3O05A 3OVPA 1G7UA 2X16A 5G1TA 1F74A 3HB9A 3S1WA 3FOKA 2NV1A 4D2JA 3W6YA 4BI6A 5C54A 4FO4A 5EYWA 3M0ZA 3LHVA 4IX0A 2H6RA 2NZLA 5KSWA 3FLUA 4R33A 3I7SA 1OX4B 4GXMA 4ORIA 3GAYA 5F2LA 2Y61A 2G97A 3LTPA 1P4CA 2E68A 3BK0A 1Z44A 3AJXA 3GX9A 5G2IA 4DBDA 1DV7A 4NUWA 4X2RA 3P60A 5D38A 3SY5A 4OQVA 5LSMA 5FF4A 4MY8A 2A6NA 1MSSA 4JY8A 5FEWA 3UY7A 4CCCA 4UIOA 4Z1CA 1TJRA 3NYZA 2E6DA 4DO5A 1OFRA 3LXAA 1VCGA 2XFWA 4HNVA 1SO4A 4JTJA 4WOQA 3A22A 2WO5A 5AHMA 1YTKA 1VQTA 4HIBA 4MFDA 1MEIA 2KZHA 1UJPA 4O4WA 2FQIA 3NVTA 3A5FA 2ALDA 3QRHA 4JGDA 3NQCA 4JDYA 1TV5A 5GVJA 3E02A 1ZENA 2VXNA 1S3HA 2R91A 1PIIA 3NPXA 3O1NA 4AHQA 3PSWA 4IX2A 5AHLA 5C55A 4K6AA 2Y88A 3TDFA 3GDMA 3PAJA 1M5WA 2BZNA 2E6AA 5I3GA 2ZZ4A 2RKXA 3PBUA 1TSIA 1I2RA 3S5YA 2B7OA 1TRIA 8TIMA 3HQ1A 2VELA 1I2QA 1IIGA 1ICQA 4UR8A 1XUUA 4TU1A 3NQFA 1M7PA 3LXCA 3HPZA 1VJIA 4LVGA 2JGYA 1KBIA 3IGUA 1EB3A 3OHIA 3NPVA 4Z08A 4UUIA 1NVMA 1RVGA 5CKSA 5CG7A 3K30A 5G2WA 3DBPA 2A7NA 3H54A 3LI0A 1G69A 3NGJA 3T4CA 3W7MA 4JTTA 4H4IA 4OV9A 2R94A 2C15A 3TX9A 5J5RA 4MYXA 4NJGA 3FYOA 3B05A 2AGKA 4X3ZA 4O54A 2Q8ZA 3WJYA 1DOSA 3MYOA 2DZWA 1R47A 5SWUA 3NQDA 1QO2A 2YFNA 4LY8A 1FX6A 1VYRA 1ZJIA 1W37A 5E93A 5D33A 3QZEA 2QCDA 1F76A 1U5JA 4NVTA 1PHQA 3P74A 1W31A 3N9SA 4YLWA 2X30A 3GVGA 3NPUA 4O15A 3WK0A 1O95A 4UFIA 2QAFA 3NQMA 4JY9A 2AAMA 2ZTKA 3PSVA 2B0MA 4UCGA 3P80A 3PVFA 4WJEA 1XI3A 2X1SA 4M7TA 4GWEA 5D02A 4JDBA 1L6YA 3W1RA 2RFGA 3EXSA 5KINA 3QMRA 3GK0A 1H7RA 1KM4A 4PCFA 3UQNA 4FNSA 5FF7A 5D03A 3NA8A 1FCUA 2FFCA 5CPMA 4PH6A 3Q37A 4JX5A 3AO0A 2FIQA 1AW2A 4CCEA 3EWWA 3GR7A 2V9DA 4IPJA 4UTTC 3RNDA 1RD5A 5F4XA 2LLEA 4AMAA 4MZ8A 4DF0A 4O16A 5DCEA 6ALDA 3HGSA 3MMTA 3NQ2A 5KZDA 3RF9A 1HG3A 4WUIA 4UC5A 4TMCA 3H55A 1G6CA 3HJZA 3L0GA 1AMKA 1R2RA 1IXPA 3GR8A 1SR9A 2HTMA 4OBTA 2NWSA 3L68A 4C1LA 1LBMA 2Y63A 4S2CA 2B7PA 2CLKA 1OYCA 5LGXA 4U4MA 1OFQA 3UXAA 5HUOA 1LDCA 3M43A 4FB7A 1GEQA 7TIMA 1NF0A 2B4GA 3G1YA 1FWWA 3LTYA 1W8SA 3L67A 2QCHA 3P5ZA 3W70A 4KFOA 3W1PA 1BWLA 3LRLA 4Q33A 1H7PA 1NSJA 1VR6A 1OFEA 1UUMA 3NQGA 4ADUA 3W3OA 3GAKA 2GJLA 1EP3A 3MHFA 3C3NA 1GG0A 3NZ1A 4MIMA 2J6XA 3NM3A 5I3IA 1O5KA 3R89A 3SR7A 1H62A 3W2JA 2FLIA 2NV2A 2NXIA 1QAPA 1XM3A 1Y0EA 1ZCOA 2Y7DA 3C52A 3P67A 4RCXA 3FFSA 1ZFJA 3LCFA 2JK2A 3BLIA 1EWDA 3TV8A 3I7QA 3G1VA 3TFXA 4LVFA 5CZJA 3KXQA 1G4TA 3DI1A 5D32A 1GVOA 4UTTA 2CLIA 2ZFAA 1WX0A 1W5MA 2A85A 2DZTA 3W7GA 3WJZA 2WKJA 4JIQA 3SJ3A 3GZ3A 4P2VA 1Q6RA 2IQTA 3E12A 3R12A 5AC6A 4GNJA 1SU5A 2QCCA 4N4PA 4LT9A 1KM0A 3WJXA 3OBKA 2FDSA 3RLUA 3EX1A 1BEUA 1HUVA 3T44A 3UWQA 1QDSA 3MHGA 2E09A 2J9XA 3GXNA 4LNYA 1H1ZA 4BF9A 2VEIA 1OFAA 2G96A 3TQKA 2GJNA 4R53A 4HSNA 3OEXA 3NNTA 4LWWA 4LUIA 2ABAA 3Q2DA 5FF0A 1IF2A 3G8EA 1KFBA 2ISSA 2J9YA 5F4SA 5EL1A 4MVAA 1PV8A 1DQXA 3TUUA 2Z1BA 1WBJA 3STCA 4HNTA 1FDYA 1S5WA 1QFEA 3KAOA 4FX8A 4MUZA 5EMUA 5CSRA 3SZ8A 1CI1A 3GLCA 2I14A 3LERA 2E6YA 1KV5A 4PFMA 3TSDA 3LCIA 4DPQA 1QPNA 1ZAJA 3SIZA 4HPXA 3ABOA 2YYTA 3INPA 3EB2A 3HF3A 3LHUA 3NOEA 4Q4KA 5FESA 1FY6A 4BFAA 2B7QA 4BK9A 4L4MA 4ADTA 3H53A 4IMGA 4PC8A 3OVQA 1P0NA 3G1AA 3JR2A 4A2SA 3S1VA 1AW5A 5EBUA 4UTJA 4EIVA 1AL8A 4M7SA 1JR1A 3L21A 3FKRA 3W2MA 2C19A 5CPLA 3FKKA 3S5OA 3GB6A 5D37A 3SW6A 3BARA 2Z6JA 1F6PA 3QFEA 4MY9A 2A21A 4CLMA 1W1ZA 2V2CA 2V5BA 4K37A 4AXKA 3GDTA 5K9XA 1QWGA 2EKCA 1ZNNA 4WX2A 3RLVA 3LV5A 4XTIA 1OHLA 1QR7A 3NM1A 4ICNA 3N73A 3B8DA 4M6QA 1A50A 1X8FA 3M1ZA 3DFOA 1KM1A 2RDUA 1KFCA 2YR1A 1GVRA 5T26A 1JUBA 1XUZA 2YSWA 3W1LA 2H3BA 3VFLA 1UCWA 3LHYA 1HTIA 3NQ8A 2OJPA 2P1FA 4MZ1A 2YW4A 3B0VC 3EX4A 2DZVA 1JRBA 2CLOA 2YX0A 3N2MA 5G5IA 3LBMA 1KTNA 3L65A 3ABRA 3V75A 3ZWTA 4ML9A 3C0JA 2R8WA 3LCHA 1VRDA 4PA8A 3TXZA 3OA3A 1OF8A 3BG3A 3QQ1A 2V30A 4TMBA 5AHNA 1SZGA 3HOJA 3CTLA 2O7SA 3KVLA 1QO5A 2JKPA 2VEKA 3M9YA 1VCVA 5LNSA 5U4NA 3SECA 4WXZA 4IOTA 3M5YA 3QPZA 1KW1A 3WK3A 1RV8A 4TR9A 5D04C 3TQVA 1ICPA 3NO5A 1LOQA 3QH2A 2VEMA 3QYQA 1MZHA 3P8JA 1B9BA 1W56A 4JYDA 4FXSA 4Z1BA 3W7DA 4CNNA 1DL3A 3QF0A 3T40A 4N9BA 2HS6A 3LCLA 3IIVA 1T96A 4QITA 2ZZ7A 3TFCA 1WYIA 5D2XA 3YPIA 2QCMA 2BTMA 1TPFA 1RQBA 5DLCA 4AF0A 4JTGA 4UTHA 1FDZA 1LRNA 3QW4B 4YCOA 4ORMA 4BR1A 4BI7A 2A0NA 3RU6A 4XZ9A 2WSQA 3HIJA 1P1XA 1EX5A 1KBJA 1D3HA 4H6KA 1PHWA 1Q3NA 1QNVA 3ABQA 3W86A 4QAIA 2NLIA 2CU0A 4UNKA 2WV8A 4NXSA 3PG8A 3C8FA 1GYNA 4LRTA 3TXVA 1FBAA 3DFSA 1TPH1 3UD6A 4Q32A 4N9EA 3LV6A 3DH7A 5D2VA 1Q6OA 1H60A 3LRKA 4KWVA 2TSYA 4UFJA 5BNKA 4Z0JA 1JJKA 1RQHA 5LZLA 3HGOA 4CQ9A 2ABBA 1KFJA 4MY1A 1H5YA 3B0UX 3UY8A 2ZQ0A 4O50A 3TAOA 5HUPA 1TRDA 5DY2A 2Q3RA 4WXYA 4NJJA 3FS2A 2PURA 1BKSA 3EWYA 2H90A 1CW2A 4LU0A 4LS2A 4E0CA 1EUAA 2V2HA 5DXYA 4ZVJA 3DFPA 3DFQA 1YXDA 3CC1A 2X1UA 1K8YA 1R2TA 1YXYA 3L66A 5BOOA 1TO3A 3MYPA 1TIMA 2G95A 4QIUA 5D2YA 4PL1A 3PUOA 1PCWA 3TKFA 3CT7A 3W7JA 3NAVA 5K2ZA 3DGRA 3IIPA 4QQ3A 3STGA 1GVQA 5DBUA 1DKWA 2QKFA 3FJ6A 3PBVA 4FNPA 3FA5A 1UASA 4GBUA 3NL5A 3Q58A 3W83A 3U2OA 3IEBA 3W7RA 2WQPA 1M6JA 1V5XA 3RMJA 3LLFA 2YW3A 4RV8A 3IVUA 3S42A 3PWAA 4N9CA 2WSYA 5DN1A 4CNOA 4RZ5A 2QF7A 4O1DA 3SFKA 2ZCGA 4AWUA 3LHTA 1QCWA 4YMZA 1NF7A 2WJZA 3PS7A 3DENA 3U6WA 2QCGA 1AK5A 4UTLA 2V0TA 1H7NA 1F6KA 3PY2A 1JCJA 3EKZA 3S6DA 2QCDB 2O7QA 4M5PA 4NJHA 2YDAA 1ZY9A 3MP5A 3O8AA 4LS1A 5G1YA 2TYSA 1FDJA 1H1YA 5AB3A 4DELA 3IRDA 4AEOA 4UFHA 1DHPA 4XQ6A 5E0KA 4NT0A 3W22A 5HR6A 4CQAA 5DELA 2I1OA 5F1UA 3W1NA 4WZHA 3TR2A 2CLLA 3W7EA 2BXVA 3HG2A 4JNMA 5HMSA 5D2WA 3THAA 4HNUA 4IUOA 3CM4A 1VS1A 2VFDA 1DBTA 3W73A 2C0AA 4MKNA 1WBHA 1AG1O 5K9CA 4O0KA 4JD4A 4H3DA 3IIZA 2X1TA 1TPC1 4RJEA 4WQ6A 1LTDA 3CIXA 2EAWA 4JXCA 4QNWA 4OU1A 3W9ZA 1A5BA 1HFBA 3GKAA 4A21A 4O53A 1I2OA 4MFEA 4IWWA 3UPWA 3SI9A 3LCGA 3KRSA 4M19A 4RZ6A 3DHDA 3JRKA 5HJLA 2WNQA 3BVJA 4LW7A 4K36A 2ZDRA 4KFNA 1TTJA 2RHGA 1GQNA 4LVBA 2DU2A 3NXFA 1UB3A 2NXHA 5G4WA 3M16A 2FB2A 4LTSA 1F73A 1ZHAA 4UFKA 2CW6A 2QDHA 1X7FA 1YPFA 1X1ZA 4O57A 3CLMA 3W1XA 3G1FA 3W7LA 1FWTA 3WJWA 3G1DA 2Y85A 5CPNA 3WFAA 3IGSA 4PTNA 3QSRA 1TV7A 5AYXA 3TROA 3UZJA 4QSHA 3W7CA 1XKYA 4GE8A 1TPUA 4JYFA 4MJZA 5IBXC 3STEA 4P61A 3UWVA 2ZRXA 4BI5A 2GQ9A 1H63A 3R13A 1ME8A 1SPQA 2ZZ1A 2QUUA 1YPIA 5K4XA 3GNDA 1VCFA 1S5TA 1IXNA 1T8XA 3UNDA 2Z2UA 3W2LA 3RFAA 5LGZA 4YCPA 4ZMGA 2JGQA 2VC6A 3LXBA 4A2RA 1SZFA 3A5VA 4K39A 4RX0A 1OK6A 4WY0A 4IPIA 2ZZ3A 1W3NA 1FUYA 4UTMA 4WD0A 3IVSA 5F2IA 4JTLA 4FXRA 2VFIA 2CZEA 3L5MA 1XL9A 3A24A 1X1OA 4UR7A 3NQVA 2EF9A 3KOFA 1MEWA 4O1BA 1QOQA 4FF7A 2C6QA 1H7OA 3D0CA 5EPDA 2ZZ5A 1SO6A 1N8FA 4M6PA 1NEYA 2ZRWA 3USBA 1K3UA 3GDLA 3Q94A 1WOAA 4NU7A 3BGGA 1VYPX 2CLMA 3O6CA 1Z42A 5HINA 2WOQA 3O63A 4BWLC 1FWSA 2GVJA 1J2WA 5G4EA 1YLVA 5K4ZA 2VENA 2QJHA 3W7NA 5F2MA 1L6SA 2ZA2A 1IIHA 2W79A 1GOXA 3S0CA 4JTKA 3ZFHA 4JEQA 4JIPA 1XXXA 3GXTA 3TSBA 1L6WA 1WOBA 2C3ZA 3LCWA 4QNEA 3T78A 1DJNA 4CCDA 4ZQRA 4FX6M 3I68A 4O1AA 3HGJA 1R46A 2ZYFA 3TC7A 2ZBTA 3SSJA 1B4EA 5IBXA 3TNOA 1WDWA 1TB3A 3TCEA 1OABA 2F84A 3W2UA 3W87A 2I9EA 5J5DA 3O06A 3DAQA 4K7VA 4DO4A 1ZALA 1YTDA 2QCEA 3HG4A 3NL2A 3LCXA 3QC3A 2Z6IA 3TMQA 4DPPA 1K7XA 1KLZA 4NNCA 1XBXA 3MP3A 2G5WA 1ME7A 1H7XA 2HSAA 1LZOA 1K8XA 3GDRA 1GJPA 2QUTA 4GC4A 3LX9A 1GG1A 4L4LA 1I2PA 1UUOA 1W54A 3PR2A 4K8HA 4TX9A 5AOUA 3QMSA 4DXVA 1D3GA 4JX4A 5I3HA 3W84A 1JCLA 4JICA 5I3KA 4Z1AA 1VC4A 2ZZ6A 3KRUA 1LM1A 2PC4A 2BSLA 5FEZA 3ZWSA 3PBYA 1TPEA 2VEPA 3P82A 3L0NA 3W1MA 3CHVA 1PL9A 3DFNA 4BWLA 1NFBA 1FXPA 1DVJA 4GUJA 3MJYA 4R34A 5DCDA 1VLIA 1DORA 1JRCA 1JCMP 3QEZA 3PF3A 2EPHA 3N3MA 1SW0A 3WK1A 3NR0A 2TPSA 3L5AA 1VGAA 3A23A 3A21A 4KWWA 5FEPA 5LHEA 3OIXA 2EGZA 3TU9A 5D09A 1S5VA 1LP6A 4ZQPA 1WV2A 2H3DA 3MWAA 5FF3A 2H8ZA 3JS3A 4LUJA 2ZA3A 1HO4A 1QPRA 1TJPA 1G67A 5A5WA 3VI2A 4GUGA 3BW3A 3OG3A 1VH7A 3W72A 3EWBX 2V81A 4FEZA 3C2OA 5F1VA 3LM7A 3S5ZA 2A2IA 3KX6A 3BV4A 1OYBA 3THQA 5LNWA 5C6MA 1I2NA 5H91A 2QDGA 2NUXA 3KRZA 3B04A 3P61A 4IGHA 2YGYA 1LOSA 4AB4A 1KM5A 2VFEA 4DF1A 3W1AA 4AF0B 1XFBA 1L9WA 4LS0A 5AHIA 2C14A 3M41A 5H2ZA 4JTFA 2YYUA 4OT7A 1G7VA 4UTUA 4E2BA 1Q6QA 4B5NA 1GT8A 3N14A 4O1CA 2R14A 3M5ZA 4E2DA 5A8GA 4XWUA 2ZZ2A 3TAKA 3PB0A 1QMLA 1ZAIA 2ZRUA 5L9FA 4HN4A 4AAJA 3NQ7A 3GXPA 2J9ZA 2XN0A 2DP3A 3NDOA 2XN1A 3ZS4A 4W9TA 3LHWA 3BG9A 3WJSA 2A4AA 3DHFA 1KFKA 1JQXA 3IV3A 3DKJA 3G0XA 2E77A 2DORA 1H61A 4MYAA 1FCQA 4R7JA 1KV8A 4XTDA 4O14A 2E5DA 2QEZA 3NQAA 3R5EA 4RR4A 3ZR4A 1K03A 3GKFA 3MP4A 3I6RA 2C1HA 1TTQA 1OVDA 1FWRA 2WNZA 3LGEA 1LLZA 2VOMA 2CZ5A 3P84A 4RKAA 1LRTA 4O17A 4UFMA 1KTCA 4PL2A 4OWGA 4O52A 3STFA 4A3UA 3EX3A 1DJQA 5HWNA 3I65A 2PRMA 3W1TA 4ZQNA 3SGZA 3G0UA 2NUWA 4JX6A 4XKYA 4MOZA 2A5HA 3HO8A 4NQ1A 2ZRYA 4GUIA 1SSDA 3HG3A 5KMYA 2Q8LA 3EKLA 1XBYA 3C61A 4FNTA 2NUYA 3N34A 3G8RA 3HG5A 4GJ1A 3S8HA 3N2XA 4MZYA 4UFLA 3LHZA 4S2BA 1A5CA 2V8ZA 4UNLA 1CX9A 3G1SA 1B4KA 5EY5A 3W88A 4O0ZA 1WAUA 1EA0A 1E51A 1GYLA 3SGUA 5AHFA 1BTMA 2NX3A 2WSRA 1EPXA 3CEPA 2AQWA 1R2SA 3W76A 4Y96A 3L5LA 1IGSA 1LROA 2FPVA 3E96A 4Y90A 4I9AA 4JTEA 4JTUA 1YDVA 2ATSA 2Y89A 1LRQA 3BG5A 4JYEA 4M6VA 4EVZA 3MBFA 3QJAA 3PM6A 4UMAA 2Z0IA 1ADOA 3G18A 1KLYA 2OT1A 3VE9A 1TPVA 2ATMA 4UMCA 1VHCA 2FTPA 1JUEA 3E9AA 4UTKA 3B0PA 4OHQA 3TW6A 1GZGA 2OT0A 1I45A 1GVFA 4ZQMA 1Z48A 1W3TA 3W75A 4ALDA 3IIOA 1IXQA 3TMLA 1KM2A 4IQLA 1FWNA 2Y7EA 1I4NA 4RK8A 4QJ1A 4RXGA 3W1QA 3G3DA 3HMJG 4NNBA 5IM51 1LCOA 3TQ0A 3B06A 4G1KA 4PEKA 3QSTA 2CLEA 3G3MA 2HS8A 1O60A 1YTEA 4CNPA 3DXIA 1B57A 3M7WA 3MI6A 4HNNA 3M47A 3KVKA 4S1FA 2GOUA 3UYCA 3TIMA 4IMEA 4AHOA 4ZQOA 4Z0SA 3P7YA 1YDOA 3UWWA 3TH6A 3E49A 4LC8A 4ZZ9A 5AYZA 1OJXA 1VZWA 2DZUA 3HPSA 3S9YA 3TK7A 1X6UA 2GQ8A 2JKAA 5TQLA 3IIXA 3BW4A 2JKEA 3UWZA 2VFGA 2TRSA 2FPTA 2CLHA 3O6YX 3L9CA 1PS9A 3NG3A 4GRSA 3PG9A 3CB8A 4A29A 3F1QA 4N6FA 1RQEA 2QUVA 1LOLA 2BX7A 4YL2A 2Y6ZA 4WY0F 3VNDA 1MXSA 4E38A 3TSMA 1EWEA 3FYPA 3W07A 5HWMA 3VCRA 3NEVA 3W7OA 5AC8A 4DEFA 1TREA 4WY0B 2P10A 2ZRZA 4I7WA 3W74A 5AC7A 2YFOA 4O10A 3S1UA 4ZL1A 4HT3A 2X2GA 2PRLA 5HNRA 3BO9A 3GYEA 1O4UA 3LLDA 5BW6A 3ANYA 1TV8A 3R2GA 2EHHA 4DBEA 3NL3A 4MLRA 4TIMA 4FNQA 3C6CA 3KVJA 4FIRA 3W7QA 3N19B 1W3IA 1OK4A 4LOCA 2QCLA 4LV9A 1W5PA 3BLEA 1SFLA 4GUHA 5I3FA 1ML1A 2DJLA 1XBZA 1OX4A 4EF9A 4N2YA 3G1XA 3FJLA 1LLWA 5FF2A 1EIXA 1OX5A 1T99A 1OFPA 3NQ6A 1Z41A 5CGQA 1QPOA 3DFTA 4FNRA 3QMTA 3FIGA 3HGRA 2A7RA 3RK8A 5C2XA 4OE7A 1SSGA 4XBKA 1T0OA 5BRBA 3U8GA 1KM6A 4HPJA 3PUEA 3UZ5A 1PCKA 3LOTA 3DZ1A 4EF8A 3MW7A 4RZ4A 3NL6A 2Q3OA 3MI3A 4TO8A 4AWSA 1EP2A 3O15A 1SFJA 3BLFA 3KVMA 1L2UA 2CFFA 3UWUA 3PULA 1TMHA 5CZSA 1AW1A 4HKPA 2V82A 4JTSA 3PB2A 2RDWA 2FJKA 1K7EA 3C2VA 5AYYA 1YYAA 2GUUA 3EWZA 1F05A 2B7NA 4GUFA 5LNRA 4FX7A 3MUXA 4N9DA 2QR6A 1F7BA 1YXCA 3PUDA 3B4UA 2ZRVA 3W2NA 4A22A 4DQWA 4XBSA 4LC6A 5K7JA 3EXRA 3CEUA 1I8JA 3T7VA 1VPXA 3HPXA 2YPIA 4O4VA 1H7WA 3NZRA 1TTIA 3M5XA 5BMWA 1U83A 3CIWA 1SZNA 1XC4A 3PC0A 4LVDA 3G1HA 2GVGA 1G4SA 4XUGA 4IXXA 4UTWC 4IXHA 5KTLA 1A53A 1O94A 4IMDA 3W7PA 2A7PA 4CQ8A 4AHPA 5KITA 2A1YA 1K02A 1M7OA 3IGXA 3EEGA 5F2GA 5CPOA 4O11A 4EOUA 1NAL1 2PCQA 3LBCA 5L6UA 1KTBA 2VFFA 3T55A 3TC6A 3G0SA 4K7YA 1ZAHA 3GNNA 2QCFA 1HO1A 1UBSA 2J88A 1EUNA 4JS3A 3B03A 1WQ5A 1TPDA 2BWGA 1C9DA 2E6FA 4AH7A 2CZDA 1THFD 4KKXA 3QQ0A 4O12A 1OX6A 5LNVA 4Y6GA 1GPWA 2E5BA 2GQAA 4MLJA 2ISWA 2DZPA 2GVLA 2QAPA 1K8ZA 1WXJA 1F5ZA 2OZ0A 1KFLA 3MHUA 4X22A 2DZXA 1KA9F 3UPBA 4FHAA 4ADSA 1FCVA 2DZSA 3M5VA 1VHNA 3R8RA 2X1RA 1RR2A 5HQEA 2QJGA 3BGJA 4Y9AA 3FEMA 4O19A 3EWXA 3CPRA 5LHFA 4IJBA 4O18A 4KFPA 1R30A 3LB0A 4RLIA 3F4NA 2JBMA 4GFSA 5E1QA 1JUKA 1RZMA 5BMXA 1F2JA 5D2TA 1QOPA 4UTWA 1TQXA 5CSSA 4ONVA 5DCBA 4OGZA 1G4PA 1ICSA 5EKYA 3EX2A 1J5TA 5AHEA 3MBDA 3ATZA 2YXGA 2C16A 1LORA 3TJXA 4NXKA 2VKZG 1XBVA 3M6YA 1TTPA 3C56A 3E0IA 4NNAA 3P8IA 1K7FA 1SQ7A 5G2HA 3P5YA 4POCA 1PVNA 5K9DA 3QPYA 1N7KA 3O16A 1LBFA 2NXGA 1J4EA 3GIYA 4I7UA 1B3OA 5D30A 3HBLA 3W7KA 3EX6A 2RH9A 1O5XA 2XN2A 5KZEA 3TA6A 1FCBA 1ONRA 1OFOA 3C4UA 5U7SA 2H8XA 1JCNA 4N4QA 1SZEA 5D05A 3TW7A 1OF6A 2CLFA 3L2IA 3PBWA 1A5SA 5AN7A 4HSOA 3S1XA 3NQEA 5F4WA 1JCXA 2BLEA 3P81A 4NX5A 4NZFA 3GDKA 1V7YA 2QJIA 1KFEA 5CZ0A 3N9RA 4YXGA 3CWOX 4FIQA 1MO0A 5ABTA 1TPWA 2Y7FA 1RPXA 4ZQCA 3CWNA 4QM1A 4NX0A 2OMAA 4MPQA 2ZTJA 4X9SA 2CWNA 3W7IA 3UWYA 1JQVA 4XKYB 2FPYA 6TIMA 3F03K
chains in the Genus database with same CATH superfamily
1VYSX 2DUAA 3BPWA 1T7LA 1YEYA 3QR0A 4ZBCA 1P0KA 3UZXA 3TTYA 5FACA 1N82A 3S1GA 2F7FA 3CQ0A 2VMFA 1XCFA 2E5CA 2XVGA 3GDBA 2Y62A 3GQYA 2NX9A 3WLQA 4HHMA 1VEPA 5M3WA 2OX1A 5BU9A 1JYNA 4DO7A 1D3CA 1E56A 1H11A 2DQWA 2HMCA 2XVLA 1UOKA 3F7JA 4Y9OA 4RE0A 4G5DA 1DWGM 4F9JA 2FGBA 2PE4A 3KOZA 1K9EA 1ECQA 4DBWA 3PWIA 3LTSA 5FSEC 3OA5A 3BLLA 1C8VA 5GJPA 4Y8FA 3BCFA 1CXFA 1XH1A 4UTIA 4ZOEA 4ECLA 1GVSA 5I07A 4HMDA 1VB9A 4QCFA 3AIQA 4IJCA 4GI9A 2WMIB 2CZFA 4J2PA 1CECA 3UGVA 5C7VA 4LEQA 4O8RA 3G1RA 3H2CA 1P0BA 3WNPA 1DQWA 4L6HA 3AHZA 3VM7A 3W71A 2GPTA 1J2BA 3WFLA 2PDMA 2C13A 1UKSA 1XYCA 3ELFA 1D7FA 4W8LA 1TPB1 2TMDA 4JN6A 1Q45A 2VC7A 2P0OA 3KZPA 4DUWA 5G4HC 1V3HA 2HK0A 1W5OA 2ZIDA 3W28A 4J40A 4B5WA 2R1MA 4YWIA 4NJIA 4W7VA 5C2CA 3C2RA 1TQJA 1ZJAA 4EX4A 1EP1A 1FQ0A 4IH3A 4LV4A 4X9YA 4WK9A 3IVTA 2PSNA 1GUVA 3RM4A 1W17A 2QIWA 1XDMA 1OFBA 1EJUC 4PODA 3WBEA 1MXGA 2V5LA 5CZTA 2GOKA 1VJSA 4K8EA 7REQA 4KCUA 3LI1A 1BD0A 2YZRA 4U33A 4YJ5A 3WUFA 3ATYA 3VD3A 3DYPA 2ZDSA 3SIMA 2DT1A 2EJAA 2JQXA 1OQFA 1OG0A 3SCPA 1O68A 4JTHA 1VLWA 4LAKA 1TR9A 4GKLA 1G7UA 2J7CA 5ECVA 4MPKA 5G1TA 2XGIA 4AUBA 3HB9A 3S2JA 4S3FA 4HZ8A 3MB9A 3VGFA 4BI6A 5C54A 2XSXA 1KCZA 2WVTA 3SO7A 3QOKA 3GXMA 3RCMA 4I9JA 1GJWA 3G6LA 3LHVA 5KSWA 3R4IA 3VKBA 4GXMA 2CIPA 5FJUA 4ORIA 4XD5A 1CB2A 5FJTA 3MVIA 3GX9A 5G2IA 2WW5A 3IK4A 4NUWA 4X2RA 3V5FA 1XLMA 5FF4A 4L56A 2D24A 4JY8A 4B3ZA 5CJNA 4Z2IA 1TJRA 3LXAA 3RUBL 2F2HA 4JTJA 1BRLA 1XRSA 4RNIA 1QI3A 4PMZA 4HD5A 3OZPA 1UR0A 5HQMA 1ZP3A 2WM1A 1MEIA 5DQPA 4AEFA 4LCQA 2J7GA 1FRBA 3SCOA 2ALDA 3L12A 3PZQA 4JDYA 1AQ0A 1TE1A 1ZENA 4HOXA 1N8IA 2VXNA 3UZZA 1S3HA 2E28A 2ZC1A 4JHZA 3O1NA 5AHLA 5C55A 1OCBA 1M5WA 3VOFA 2E6AA 1WZAA 3WH8A 3PBUA 1TSIA 1I2RA 2QV5A 2QT3A 2A3HA 8TIMA 1KCLA 3AS0A 1E70M 5GNYA 4UR8A 1RK6A 2XZ9A 1SJBA 1SJCA 3NQFA 4U2YA 1HW6A 4LVGA 2JGYA 3N2CA 1EJVC 3L2LA 1XIEA 4UZUA 3NPVA 1JZ4A 5G2WA 3OTRA 2I5GA 3H54A 4CQCA 3LI0A 3KLKA 1R9XA 1G9HA 4JTTA 4H4IA 1W9XA 2CKRA 1DJIA 3U9IA 3VPLA 1X97A 2J4GA 1KXTA 2DZWA 4NIRA 1Q63A 3SCSA 1FH9A 3VIFA 1ZJIA 1W37A 3UWEA 5D33A 2QCDA 2F2KA 1HXJA 2YIHA 1PHQA 1W31A 4BA0A 3TWAA 3N9SA 4YLWA 2X30A 3GVGA 5H8MA 4O15A 3O0KA 4IFKA 1HKKA 3APTA 3WD2A 4UCGA 1RD6A 3C0QA 1XI3A 3ARYA 4JDBA 3B8SA 3W1RA 4H2HA 2RFGA 3T0BA 4PCFA 1UQYA 3VFCA 2Y4SA 3AO0A 3EWWA 2V9DA 4IPJA 1E72M 2LLEA 2IKIA 4DF0A 4XZMX 3ZYZA 3HGSA 4QE5A 4NL1A 1U1HA 2BGQA 3GG7A 3QBUA 2UY5A 1L8PA 4M56A 1VPQA 1ELSA 3RF9A 2ODOA 4WUIA 2REQB 3L0GA 1CPUA 1QBBA 1IXPA 3MSYA 1SR9A 4PUUA 2NWSA 1JGIA 3CYVA 1W1YA 3AALA 2CLKA 4ML4A 3OB8A 4HMEA 3UEQA 2VR4A 3M43A 2Y0FA 1NF0A 5E0CA 3LTYA 4GZJA 1XIIA 4WHBA 1QTWA 2BGSA 3SCNA 1QW9A 4KFOA 4UCFA 1BQCA 3LRLA 4Q33A 1H7PA 1E9YB 1UJQA 2VDHA 1IEWA 1UUMA 2PDYA 4TUFA 1PKNA 1X6NA 2GJLA 3CQJA 3CTTA 3VDAA 1O5KA 3R89A 1JEZA 1QAPA 1XM3A 1ZCOA 3P67A 3FFSA 2JK2A 4LPCA 3VOJA 3TV8A 3I7QA 3G1VA 1BF2A 3LZ3A 4MB1A 3B9NA 1G4TA 3DI1A 3KTSA 4UTTA 4MWAB 1EX1A 4MJ2A 2ZFAA 4REQB 2A85A 2DZTA 1OCJA 3IUHA 4JIQA 1UMYA 3ZSSA 1Q6RA 2IQTA 3E12A 5MKGA 3UCCA 2WVUA 3OU8A 4AXNA 4JN8A 3WJXA 4IM4A 3T44A 3EX1A 3UWQA 1QDSA 3MHGA 2GUYA 2J9XA 4LNYA 1H1ZA 4AW7A 3GSMA 2ACRA 2ZXBA 8XIMA 2VC9A 3PJXA 1XLIA 3UF9A 3IJ8A 2X0SA 4LWWA 3VIHA 3Q2DA 3G8EA 1Z32X 1FHLA 2PU0A 3OO2A 2Z1BA 4LUYA 3TUUA 3STCA 1FDYA 2DSVA 3QPEA 5CSRA 4W93A 4AMCA 3KL3A 1CXEA 4M1RA 2UWFA 1A49A 4ZENA 4DWSA 5B7ZA 5IFTA 4YU1A 5FESA 1FY6A 2G0WA 3H24A 3XIMA 1OD0A 3FN9A 3VNLA 4LUSA 4GKTA 3OVQA 4HU3A 1P0NA 3G1AA 1MVYA 1RCXB 1JR1A 5CLTA 2VHLA 4XIAA 2C19A 3AAMA 3FKKA 3GB6A 3IJQA 5D37A 3SW6A 1R3RA 4GQBA 3QFEA 3AROA 2ZX6A 2V5BA 2PLJA 4V2XA 4IP7A 4XSMA 4HK6A 4DJFA 4G1NA 2AKZA 1F4HA 4M6QA 1UW9A 1JYVA 1A50A 3KDOA 1MNSA 3MMUA 1G0CA 5T26A 2Q71A 2P1FA 3PTKA 3W38A 1BGAA 2O4QA 1XLKA 1XIGA 2XH2A 4MMWA 2Q6ZA 4P7RA 3ABRA 3ZWTA 1C7SA 3E3HA 3C0JA 2W63A 1VRDA 3SFWA 1YNQA 2OWCA 2V30A 5A8MA 5AHNA 3KVLA 1QO5A 1MXDA 2JKPA 3WEMA 4CKQA 2HQAA 3SECA 4S3CA 1AQHA 1DIEA 2DW6A 2X40A 3M5YA 3QPZA 4C6DA 5D04C 2WANA 3NO5A 4IHCA 3QH2A 1MZHA 2QMJA 3LD5A 3KM8A 5GNZA 2ZUMA 3NO3A 1DL3A 4OKDA 1T96A 4QITA 3TFCA 1DJXA 1KXVA 1H0GA 3N11A 3YPIA 2BVWA 4L9ZA 1TPFA 4UTHA 2YBTA 3WF3A 1LRNA 1H09A 1DE5A 3GO2A 3E2QA 1R0MA 4BI7A 2A0NA 4BHYA 5D8ZA 2VL4A 1EH9A 2WSQA 1K9DA 3CT2A 3HIJA 4NASA 4AYGA 4DNMA 1WXZA 1KBJA 1AODA 1PHWA 3QQWA 1Q3NA 2Q09A 3TW9A 1QNVA 3H8AA 2NLIA 2CU0A 2QJJA 3MANA 2WV8A 1IEIA 1GYNA 1FBAA 2YCLA 3FJ4A 1TPH1 1ESWA 3UD6A 3CZKA 4QCEA 2OKTA 4XZIA 5D2VA 2QNEA 4B90A 4UFJA 3VX1A 1RQHA 1OG6A 5LZLA 4ZR8A 3VIIA 3VAVA 3V3WA 5HMEA 4MY1A 1H5YA 3B0UX 2CHNA 1SJAA 3TAOA 1Q6EA 1TRDA 3V16A 5DY2A 4NI3A 3T8QA 3BSHA 4HA3A 4RL3A 4PTMA 3NVDA 1EUAA 2V2HA 5TD4A 2WNWA 3MO4A 4O1FA 1RH9A 2GJRA 2VUNA 3ME3A 3ARWA 3L66A 3M0XA 3WF0A 1TIMA 5LXXA 2G95A 3TTOA 1IWAA 1UIPA 4PL1A 5LIUX 4WSHA 5T9CE 4EXBA 3PUOA 1LUCA 1PCWA 2I5QA 5E5CA 4PRRA 5AC4A 1LL4A 3UG3A 3CUIA 4FK9A 4XBJA 4C6QA 3IIPA 4QQ3A 3STGA 1GVQA 5DBUA 1DKWA 4FNPA 1J0KA 3FA5A 4GBUA 4MF4A 3GD6A 4LB3A 3W83A 3U2OA 1WZLA 3IEBA 3W7RA 2WQPA 4JEJA 3RMJA 3VGEA 3LLFA 2YW3A 3IVUA 4QLKA 4MNKA 3PWAA 3NYDA 4GQRA 4YVPA 3I4EA 3I4KA 3DHPA 2WJZA 5I06A 1KD0A 1PTDA 2QCGA 4IF2A 3HV9A 1F6KA 3PY2A 3EKZA 4MWAD 3S6DA 1SZRA 4ILSA 2TYSA 1H1YA 4DELA 2XJ7A 4Z2JA 4AEOA 5E0KA 1M3UA 5HR6A 3W22A 5FOOA 1X7IA 3CHEA 3W7EA 4AZ7A 2EG7A 4H9TA 2QIIA 4OVXA 4HNUA 4IUOA 3CM4A 3XISA 1DBTA 2C0AA 1WBHA 5K9CA 1TPC1 1TG7A 5C0QA 1R86A 3W26A 3TYDA 4RJEA 1ISWA 1KGWA 3W01A 1CLXA 3W9ZA 3ZXWA 1HFBA 3KBNA 3UYIA 4A21A 4O53A 1I2OA 1I75A 1HKVA 3UPWA 2BB0A 4M19A 4K36A 5KETA 1GQNA 1EQCA 1OCQA 3M16A 2FB2A 4LTSA 4GD0A 1F73A 3N1AA 1ZHAA 2ZX8A 5FCZA 2QDHA 2G4FA 1XLHA 3VZXA 3W1XA 2ZXQA 1FWTA 3WJWA 3G1DA 2Z28A 4PZVA 4HJFA 4PTNA 3W7CA 4C7FA 1LWHA 1JPKA 4F2UA 1JAKA 5IBXC 2PWEA 4P61A 3UWVA 4H9YA 2GQ9A 3QLLA 2EPNA 3ARPA 3R13A 4DZAA 2ZZ1A 2QUUA 5FD0A 3GZAA 2PB1A 1VCFA 3GNDA 4PUDA 1UMLA 3PHAA 4ZOCA 4O0QA 2HV5A 1V0LA 5E09A 4GVGA 3MQTA 4A2RA 1SZFA 1D2KA 4K39A 2BMBA 1OK6A 4WY0A 3BZGA 3TNBA 3IVSA 5DX7A 2VFIA 1GORA 3L5MA 1XICA 1VBJA 2D22A 3LYEA 1XCWA 2GDQA 4JKMA 4M6PA 1WOAA 2ZWZA 4C6EA 3GUWA 2ZUSA 3B8VA 5HA7A 3O63A 1J2WA 3T09A 1PTAA 5F2MA 1P7TA 1GOXA 1F3WA 2WMHA 1S2VA 3VGDA 4JIPA 1XXXA 3PTDA 4Z2GA 4IUGA 5H6HA 2IPWA 3G77A 1DJNA 4CCDA 4ZQRA 3IJ6A 3POHA 2QS8A 1R3QA 2PDGA 3WIJA 2R1LA 2ZBTA 4DM1A 4FPSA 3AXMA 3V35A 1B9ZA 1WB0A 2F84A 3W87A 2QDDA 3AMLA 2I9EA 4HA0A 5J5DA 1YTDA 2OEKA 3HG4A 1V6XA 5TNVA 4YTRA 1KLZA 1HF6A 3MP3A 3VOCA 3CPGA 3BLKA 1JPMA 1LZOA 1K8XA 1C8YA 4H1ZA 3TN4A 4RE4A 1XLGA 3DERA 2F9RA 1E9LA 1H1NA 1JDAA 1Q85A 5AOUA 1I2PA 4TX9A 3PR2A 4LEFA 4W84A 3DFYA 4JX4A 3W84A 1JCLA 4I6VA 2V3EA 1OT1A 5I3KA 1VC4A 5CC7A 3K8KA 2PC4A 5FEZA 3R25A 3PBYA 3E6EA 2VEPA 1E1CB 4D6DA 4WJXA 2Q02A 1FXPA 4PSRA 4CD4A 1DVJA 3SAZA 4KERA 2OZ3A 6A3HA 4C6BA 3DHUA 1CGVA 3N3MA 2PDFA 4C6JA 5IOBA 2VNCA 2ZX5A 4EP8C 3A21A 5JU6A 3OZOA 1R3SA 2EGZA 5D09A 3AI0A 3WCZA 2DDXA 1K8CA 4AY7A 3UBPC 1WV2A 3PNUA 4QG8A 3MWAA 5ABHA 1EJRC 2J7HA 3HMCA 3PNZA 3KCOA 3PPHA 3VI2A 1J5SA 4XZBA 3GHRA 4ZODA 3VZYA 3UP8A 1AA1B 3ZVHA 3W29A 1Q2SA 5ENLA 3ZJ8A 3VNIA 1NDZA 4EANA 2P3ZA 5H91A 3QGKC 4JNYA 2OKOA 4WSKA 1CBGA 4A3YA 1PKMA 4KMQA 5DRIA 4DLMA 4DF1A 1XKJA 1XFBA 4H9ZA 1L9WA 4IL0A 4Q7NA 3WL0A 4KESA 2C14A 3RO6A 1LLOA 4TVUA 4JTFA 1O5RA 4E2BA 4NI8A 3M5ZA 1K6WA 3EYPA 7PTDA 1IGWA 5GQBA 4D6IA 3BE7A 2X7VA 2V67A 1RVKA 3GWQA 3SURA 4AAJA 4CVWA 3NQ7A 4JZ5A 1XH0A 2VURA 1PWLA 3GVWA 1UR8A 1TWDA 1YBQB 5T9BG 2DP3A 3S2CA 2NW0A 1CXKA 3QHMA 2WYSA 4QTGA 1VD6A 3WJSA 2A4AA 1KFKA 4Q4RA 1QU4A 1JQXA 3DKJA 4S3DA 1V93A 3TYZA 3EMQA 4R7JA 3UVAA 3BAYA 3WQOA 5FL1A 3D6NA 3EBVA 5CPQA 4O14A 4C91A 3VKAA 4J3WA 3UJFA 1RJRA 2UY4A 4L7ZA 3IS4A 3LGEA 2J66A 4V33A 4CEXC 4O17A 2O55A 3VKCA 2MUCA 4UFMA 1KTCA 3N17A 1E55A 2HPIA 5BZAA 1W91A 1FH7A 3IACA 1AMYA 5BRPA 2BVTA 3L4ZA 3W1TA 4L1XA 3SGZA 4JPGA 3EGJA 4EACA 3VZZA 2V3FA 2NUWA 4XKYA 2A5HA 4F0LA 3MT1A 3OVGA 1SSDA 2OO0A 3FY1A 3BCDA 2Q8LA 3CQHA 3C61A 3NSNA 1TZ9A 4GJ1A 3S8HA 1TCMA 4UFLA 1CCWB 3LHZA 4AIBA 2V8ZA 1ZTVA 1B4KA 5EY5A 2INFA 1JZ8A 3RR4A 2AQOA 3SUUA 1WAUA 3TYEA 1P43A 2E67A 3VILA 1E51A 4PUWA 2NX3A 1W9PA 2WSRA 2AQWA 1R2SA 2HCVA 4GVIA 4Y96A 1GKQA 2NSXA 5HMFA 3HPFA 1VEMA 3E96A 3TONA 4OECA 1JXJA 3SQSA 3WX7A 4I9AA 2D0GA 1YDVA 5HK4A 1U33A 3BG5A 2YL6A 5IXEA 3ZJKA 1B3VA 3MBFA 1C8XA 2GLKA 3QJAA 3PM6A 3BSGA 3OGRA 3ZJ7A 2Z0IA 1ADOA 3G18A 3B8IA 4GVHA 2ATMA 1JUEA 2F61A 3MKKA 4MNJA 4WDXA 4UTKA 4R85A 3H2FA 3P14A 4B2DA 5A8OA 1QK0A 1XFCA 2OT0A 1Z48A 4ALDA 2VQTA 3IIOA 1IXQA 4GYPA 4PTVA 3TMLA 2XIIA 5IRPA 4QS6A 3RAOA 3IV8A 4RXGA 5C9RA 3G3DA 2QDEA 4NZ1A 2BBFA 5IM51 3B06A 4XZHA 2HS8A 2VVNA 4Y2WA 4M51A 3QFWA 1VEOA 1B57A 3M47A 4S1FA 4ZQOA 4FA3A 4DAIA 2UZ9A 4L5ZA 4LAUA 4L6DA 2O4MA 4ZZ9A 5AYZA 3S9YA 2GQ8A 5FAGA 3U3HA 3O0FA 4K68A 3L4YA 1XRTA 2XH4A 3FNDA 3R79A 3O2LA 3L9CA 4V27A 3R1ZA 4GRSA 3VMPA 4PGLA 3CB8A 1RQEA 2GK1A 5G1MA 1KWKA 4C6IA 1LOLA 4QP0A 4Z42C 1A3HA 2VOTA 2Y6ZA 3ZR5A 4E38A 4ERGA 3UNTA 3W07A 3VKKA 3VCRA 4INFA 5F7UA 3W7OA 3WYZA 4B9ZA 1TREA 1Z89A 1RY8A 3OP2A 1NQ6A 4D8AA 1MW2A 2ZRZA 4I7WA 1EC8A 3NXLA 4NILA 3S1UA 4YNGA 1RY0A 3SJNA 5HNRA 4E4FA 4GACA 1XIFA 3R11A 2YLLA 1BAGA 3AIUA 3FXYA 3ANYA 1TV8A 4C6CA 4YN5A 1JYWA 1O66A 1QASA 4K1WA 4DAFA 4YYCA 4TIMA 2VX6A 3N19B 4E4PA 1OK4A 1H4PA 1DQUA 1W5PA 3BLEA 4GUHA 4BCEA 2Z1VA 5I3FA 1ADSA 1XBZA 4N2YA 4TTUA 3WD3A 1DWHM 2ZKMX 3VDHA 1YHTA 5FF2A 1EHAA 1Z41A 3DFTA 1OD8A 2A7RA 2BFGA 1JYXA 4OE7A 1T0OA 4ASTA 2HROA 3U8GA 3PUEA 5CSYA 4WKFA 4RUBA 1PCKA 4H83A 2Q3OA 1PXGA 3MI3A 4HMCA 4HYVA 1KXQA 3KVMA 3PZNA 1L2UA 1GOWA 2XFFA 2XM2A 1V3JA 2WMKA 1AW1A 4JTSA 1IE7C 3M0YA 3VIGA 3VNYA 3PB2A 3NO1A 1K7EA 1OC7A 1PX4A 5AYYA 1YYAA 3EWZA 4UWMA 4LQ1A 3MUXA 3B4UA 1ZSXA 2IPFA 3WF2A 1BWVA 4DQWA 4XBSA 4QBXA 1RAKA 3V5CA 4GXWA 2FVKA 1VIZA 3CEUA 4QHRA 1YNYA 3HPXA 1H7WA 3COTA 5M03A 1TTIA 2P76A 2CNCA 1IWBA 4HNCA 3BOFA 3TVAA 1G4SA 1B3XA 4UTWC 3N18A 1EQPA 4Q7IA 2GGJA 4W5UA 2DT0A 3AIRA 3A9BA 3IGXA 1AD1A 2QXWA 1S2AA 4R9XA 4EOUA 2PCQA 3LBCA 5L6UA 1KTBA 2VFFA 3T55A 4K7YA 1ZAHA 2XUCA 3B0YA 1JI2A 2J88A 4YS1A 1E0WA 4J2MA 1PZ2A 1WQ5A 1E43A 4AWEA 2XTKA 1C9DA 4DWSB 4UOQA 4GIYA 1UZDA 3QQ0A 1UR1A 2X1IA 3ARZA 5BXSA 1W3KA 4Y6GA 3OODA 2GQAA 1A80A 4D6EA 3BCJA 5HMDA 2DZPA 2GVLA 2QAPA 2XH7A 4I5RA 1F5ZA 3ICJA 3TYAA 1NWUA 4TTGA 1RLCL 2XIQA 4X22A 2GGGA 3NOYA 4ADSA 1HP4A 3M5VA 1CLVA 1VHNA 3R8RA 1EJXC 1RR2A 1ZU8A 1BXNA 2QJGA 4O19A 3QGAC 3RN6A 5LHFA 4QS5A 1REQA 2OQYA 3DG6A 3T05A 4GFSA 2D69A 1US3A 1BYBA 2C7FA 1ZUAX 1OIFA 3K1DA 3WQEA 2CC0A 1QI0A 2ISFA 4OGZA 3RJYA 1G4PA 4OJYA 3EX2A 4JNZA 2A79A 1Q66A 5CBJA 3MBDA 3VX0A 3TJXA 1PX8A 1J0JA 1TTPA 3C56A 4NNAA 2J79A 2IPJA 1K7FA 4S3GA 3CZLA 4POCA 2H9AA 3QPYA 3U4AA 3LN3A 5I00A 1PDYA 4Y9MA 1IYXA 5U7SA 3ITGA 2GJXA 1W1IE 3DG3A 1JCNA 1SZEA 1OF6A 1A5SA 3BUVA 4BQ5A 2X0YA 3P81A 4QJ4B 4NZFA 3GDKA 2F38A 4HHHA 4PR4A 1TIWA 3N9RA 1S2TA 3CWOX 4GO9A 2OYKA 4KWUA 1RPXA 3W0KA 3CWNA 3QTPA 2BOGX 4PCSA 3AWOA 5ABEA 1UZ4A 4P7NA 4HZ7A 2Z2BA 4QAWA 3CAKA 4EWND 1EHNA 2GQ3A 3OLEA 1SO5A 3CU2A 4IICA 8XIAA 3U7BA 4KIEA 4DF2A 4J9JA 1SW7A 4A35A 4NZJA 1W5QA 1SM9A 3G22A 1KWGA 1E9ZB 3MS8A 3R8HA 2DZAA 4WF7A 2ON3A 3I6EA 1N55A 3WSUA 2WPBA 5A8PA 1RJPA 4OV4A 2Y5SA 2J24A 4PMXA 4NAEA 3FX4A 5LKYA 1EFZA 2VFHA 3WBYA 4JHMA 5KZMA 1H50A 1HVXA 1MEHA 4AVFA 2ISVA 3S5NA 3W1UA 4I7VA 3EXTA 1GTEA 1YKWA 4E6MA 1FXQA 1IT0A 3OVRA 4IIHA 4WDUA 1BSLA 3ABSA 5I3JA 1G4EA 1UD2A 3CAVA 2X09A 4RXFA 3C2FA 4M8UA 3SUVA 3BQ6A 3CO4A 2FZ9A 2NLYA 1P5BA 4GHRA 2BVYA 5K3VA 2D73A 1W0MA 3QM3A 3AQUA 3ANVA 3P62A 1SUXA 3AWNA 2W6RA 4QG6A 3DECA 1UWAA 3DI0A 1RK5A 3MO7A 1H51A 2I57A 2J25A 4LRSA 3KL5A 3KFTA 1PE1A 2PTXA 5C9ZA 5EA9A 4IL2A 1O12A 3MMDA 3LENA 4O8AA 1VRXA 2PDBA 3PUGA 5HWJA 1XDLA 4JR5A 1GKRA 4MJMA 4D6FA 2WCSA 3WF4A 3BMWA 3USZA 4QISA 5AKQA 5AFDA 5CGTA 2DZBA 3GW0A 2FTWA 3LDVA 1XP3A 2GWNA 1TVLA 2NT0A 3MKVA 3GTIA 2CPUA 1QRQA 1D9EA 3CASA 2CEQA 3URBA 3UR8A 4C1NA 4AWTA 4AD4A 3G24A 2PDWA 4FLSA 3AYSA 4AD2A 1W9VA 3GFYA 4A3QA 2YBUA 4O1EA 1A3XA 5A2BA 4M6UA 2NV1A 4DWSD 3TYCA 1RUSA 3QC0A 4FO4A 1V08A 3VIPA 4BY3A 5JXQA 4D71A 4D6JA 2DSUA 2GVYA 2H6RA 3PJTA 3FLUA 3UGRA 4R33A 1OX4B 3VINA 4MG4A 1UKQA 4WKAA 1HJUA 4P8UA 2Y61A 1P4CA 3QLDA 4FR1A 1DV7A 3WELA 1BVWA 3SY5A 4OQVA 5LSMA 4MY8A 3EWDA 2A6NA 2YDSA 3UY7A 4UIOA 1Q8AA 4Z1CA 3BJFA 3DX5A 4F4RA 4GX8A 3NYZA 1V6YA 2UY2A 3HQPA 1LWJA 1SO4A 4LUTA 3A22A 4PMOA 1HKMA 2WO5A 3UA4A 4Q3MA 4OUEA 3CZ8A 1VQTA 3FSTA 1JZ6A 3NVTA 3GIQA 2FDMA 1TV5A 4LF2A 3KS6A 1HN1A 1OT2A 2R91A 4ZB5A 3L2MA 2DFAA 2GUBA 1F6YA 4JFTA 4K6AA 1W6TA 2Y88A 3GDMA 4AX7A 3FDGA 2BZNA 3TN5A 2ZZ4A 2RKXA 4LCRA 1ONEA 2PDIA 2XSAA 1GOIA 1VP5A 4Q8OA 4PMVA 2B7OA 3HQ1A 3HA1A 1K4GA 2DY3A 5A94A 1NTHA 1XUUA 3UR7A 2PLCA 4EXAA 1MQPA 3MUIA 3AZRA 3WD1A 3HPZA 2GGEA 5J04A 5I79A 1KBIA 1EB3A 3GH7A 2Z1SA 3WMBA 3KOYA 4Z08A 1G94A 4DVOA 4ZGYA 3LPOA 4HA4A 3NGJA 1BXCA 3W7MA 5TF0A 1FVPA 1BVZA 3IK2A 5J5RA 1UP2A 1S2CA 1EL3A 1PPIA 3U5YA 4JIIX 3CS2A 4O54A 2Q8ZA 3OPSA 1FX6A 4W88A 3RILA 4XAFA 3OLIA 2O9RA 3E1F1 1NARA 1DE6A 1ITUA 1DYSA 1O95A 4UFIA 3PSVA 2OEMA 3P80A 1ODZA 2X1SA 3CUFA 4U5IA 1PO9A 4K8GA 3WUGA 5D02A 1W1B1 5FAJA 5KINA 3B9EA 2CBIA 1HJQA 3UQNA 3ITYA 4FNSA 1LQAA 1GKPA 1FCUA 5BOFA 4PH6A 3Q37A 4JX5A 4HN8A 3QY6A 2J13A 4CCEA 3GR7A 4NKCA 3RNDA 4RW5A 1RD5A 1F8MA 4AMAA 4MZ8A 1Y8BA 4V28A 3SQMA 4C6PA 4O16A 1EGMA 2HBXA 1LG2A 3TCSA 1M1BA 3PANA 1P6BA 5AZ1A 1KBBA 5KZDA 4UC5A 1G6CA 2C1IA 2DH3A 3WQDA 1R2RA 3GR8A 1M03A 2GGIA 1MFVA 2PD9A 5LGXA 1JD7A 4U4MA 1OFQA 3UXAA 4G8TA 1WCGA 1LDCA 1FP8A 1GEQA 7TIMA 1M9HA 3G6MA 4V1XA 4N0RA 2WC7A 2Q8XA 4UQCA 1FWWA 3P5ZA 1MQRA 5M17A 1JDCA 5HJXA 2R1PA 2CITA 2KAUC 2QPXA 4ATDA 3ONBA 1OFEA 3ZT7A 1CGWA 3NQGA 3MMWA 3W3OA 1DXEA 1EP3A 4RE2A 3UW6A 3ARSA 3MHFA 2J78A 3NZ1A 1U1UA 2IKGA 3NM3A 5REQB 1Z7AA 2XVKA 1AH4A 1H62A 1W1VA 2VZVA 3QTGA 4DJEA 5A6BA 2NXIA 1E4IA 3C52A 4RCXA 1UUQA 1ZFJA 2WWCA 3LCFA 2HNHA 3S6OA 4LVFA 3VC5A 1Q7MA 4W8BA 4GJIA 5D32A 1UIOA 3QV8A 1NWRA 1HVQA 4MUPA 3WJZA 3JUGA 3B9AA 1CGUA 2WCAA 3SJ3A 4P2VA 3ZZ1A 1EXBA 2XIJA 3T2PA 1OB0A 4CQDA 2QCCA 4LT9A 2VO5A 3RLUA 4HTBA 1ZBVA 4BS0A 4BF9A 2VEIA 5EFFA 1OFAA 4IIDA 4R53A 2J8GA 2E3ZA 4FAMA 1XPGA 4HSNA 3KL0A 4LUIA 1QW7A 5FF0A 6PTDA 1IF2A 2ISSA 3S46A 1GEHA 1PV8A 1DQXA 4XZNX 2DUZA 2I5IA 3GVRA 4HNTA 1QFEA 3B0XA 3KAOA 4XAYA 4MADA 3T0DA 1UD5A 4N42A 5EMUA 3SZ8A 1CI1A 3GLCA 2WZMA 1V3LA 4Q8TA 3LERA 2E6YA 4QEHA 3TSDA 5CSUA 3LCIA 3SIZA 3LZ5A 2YYTA 1QNQA 3GXFA 3HF3A 4Q4KA 5BYWA 4ZOAA 2B7QA 1JNDA 2XH0A 3WD4A 2PWDA 3H53A 1I1XA 2FVMA 3JR2A 3VIOA 1AW5A 3WNOA 4M7SA 2OTDA 3FKRA 3MSGA 3W2MA 1BPLB 4QLLA 5CPLA 1J0YA 1RA5A 3CQKA 4GGBA 4KETA 2Z6JA 1F6PA 5H1WA 4CLMA 3WMCA 1GVEA 3URAA 3GS6A 1JXKA 3GDTA 2OG9A 1RLDA 2EG6A 2EKCA 1ZNNA 4WX2A 3LV5A 1XIHA 4ICNA 2VRQA 3GFZA 4IP4A 3BLDA 3B8DA 3MWCA 3VD5A 2ICSA 1R7AA 2OYMA 3NCOA 4WLCA 3UZYA 1PYFA 4HGXA 3W1LA 2H3BA 3REQB 3LHYA 2UBPC 2YW4A 3EX4A 4ZSUA 1JRBA 1MFUA 2CLOA 3N2MA 2G8ZA 3LBMA 1KTNA 3DC0A 3KDNA 3NZQA 1E5JA 2R8WA 4IJRA 3BG3A 5FJJA 2PP0A 3S5SA 4US5A 1SZGA 3HOJA 3CTLA 2O7SA 1ZL1A 2VEKA 3VGGA 3M9YA 1B0IA 4PTDA 4PRTA 1YE4A 2GFTA 4UQ9A 2YA2A 1AH0A 1IR1A 9XIAA 3TQVA 2PDLA 2R9RA 4CVUA 2VEMA 2AMXA 4RPQA 1A5NC 3P8JA 5RUBA 1W56A 2YB1A 4JYDA 4RDZA 3W7DA 1MW1A 4ERAA 4CNNA 4N9BA 3LCLA 2OGYA 3IIVA 3AC0A 4NZ5A 3CIVA 1WYIA 1IEVA 2PF0A 4Q6JA 2QCMA 4KCTA 5B80A 2BTMA 5DLCA 3GC2A 4ACYA 4YCOA 4BR1A 1IHIA 2CETA 2CXEA 3RU6A 3BAXA 2OOGA 2ZX7A 1PTGA 3KBJA 3VD9A 1VFLA 3PJUA 4H6KA 2VDIA 3ABQA 3K1GA 5CPSA 3T42A 2WSPA 1OINA 2G3JA 4LRTA 1CDGA 1JZ3A 2Z00A 2D2OA 4N9EA 3LV6A 4LB4A 4KWVA 2TSYA 1JJKA 1RHCA 3S2NA 1SFSA 2NSOA 3B40A 1KFJA 3LSBA 3M46A 4O50A 4GC3A 4WXYA 2XISA 4NJJA 1WDPA 4ACZA 1BKSA 1QPKA 4E0CA 4ZVJA 3DFQA 3SRFA 3CC1A 2X1UA 4W86A 5C9WA 1K8YA 1HJSA 2DIJA 2I17A 2JEQA 2P8CA 3MYPA 3P6LA 2V3DA 5JBFA 5IHRA 1EGVA 3WLIA 2XFYA 3HU7A 5ABFB 3NAVA 3WMLA 3RJXA 2VC5A 3OQEA 1E73M 4LY4A 3TN3A 3ARUA 2QKFA 3FJ6A 4AVNA 3VDBA 2XVPA 1CIUA 3PPFA 4YVXA 4OIFA 3V36A 1ZJHA 2Z1KA 1V4YA 2VYOA 3IUIA 1VFOA 4H01A 3RPTA 1HJVA 5DANA 2QF7A 3U2EA 3SFKA 2MNRA 1CEOA 3NZPA 3LHTA 1NF7A 2ZUWA 1BXBA 1HKJA 3U6WA 2VUYA 3P2VA 4UTLA 1C92A 1H7NA 2J7BA 2VVSA 1UZHA 4IGMA 3RM8A 1JCJA 2P88A 3T2QA 4I8YA 2BY2A 4OFCA 4M5PA 3WY1A 1EC9A 2YDAA 1EOMA 2ZVRA 3IRDA 4XX6A 4NT0A 5EBAA 3I3DA 4WZHA 3V1HA 4C6KA 1S1PA 4JNMA 1HT6A 1YE6A 3LQGA 3THAA 3H23A 4MKNA 4JD4A 1XSKA 3IIZA 1A47A 4B91A 5I7GA 1ZLPA 4WQ6A 4LCSA 4Q8UA 2CESA 4OU1A 3GKAA 4PMYA 1V3MA 6TAAA 2IPGA 3VU2A 4IWWA 3SI9A 3LCGA 4HU8A 5LIYX 1ITCA 4FXFA 3JRKA 4PUMA 3BVJA 3B8WA 1YRRA 4KFNA 1TTJA 3GNPA 3W00A 5G4WA 3DN5A 4AEEA 3AMGA 1FFRA 1GJUA 5GJMA 5CQ1A 4LBSA 4PMNA 5LA2A 2PWVA 1Y5XA 1X7FA 1R6WA 1YPFA 1C9WA 2Y85A 5DMMA 3QSRA 3TROA 3UZJA 2PDHA 2GSHA 1TPUA 3T08A 3AISA 4MJZA 3STEA 4XO7A 1NDWA 4F3HA 1H63A 1EOKA 1O6IA 2JIEA 1MI3A 1GVYA 2QPSA 2Y5EA 4JFUA 1AUSL 3UNDA 3RLGA 2Z2UA 4XG1A 5AY7A 5J8LA 1FKXA 4J3SA 1XV8A 1GPFA 1QI5A 2VC6A 4HVXA 4TX8A 3CGTA 3QXBA 4AU0A 3PTQA 4AY1A 3ITLA 5E70A 2ZZ3A 1W3NA 2BDQA 3KBVA 4WD0A 1K6AA 3DCPA 4UTMA 4I5UA 5AECA 3KOFA 3KTCA 1XH2A 1ONWA 2C6QA 2RJHA 3BQ5A 4NYYA 2GZXA 4FALA 1L2QA 4HPHA 4DB7A 1K3UA 3GDLA 4NU7A 3BGGA 1VYPX 4H8HA 3OZYA 1Z42A 5HINA 2ZE3A 4BWLC 4DNHA 4DJDA 1X38A 5G4EA 5K4ZA 4XISA 3UR5A 2QJHA 1TA3A 1KB3A 4JTKA 1R3VA 4GX9A 3GXTA 3TSBA 2FTYA 5AYBA 3LCWA 1NWTA 3T78A 1LT8A 1P0DA 2FZBA 1P0EA 4XAZA 3UXKA 4O1AA 1SMAA 3VKDA 1XRVA 1C3FA 1PWMA 2ZYFA 1CLKA 3TC7A 3MPGA 2AQVA 3TNOA 1HNYA 1WDWA 2G50A 2FGZA 1TB3A 2YA1A 4MKSA 1OABA 2J7EA 1UR9A 3W2UA 3DAQA 2QCEA 3TMQA 2Z6IA 1E6XM 2DPEA 5HXMA 4NNCA 1PJ9A 2X41A 2G5WA 4AG0A 3KCJA 3GDRA 1GJPA 2QUTA 4GC4A 3WQ5A 1UUOA 4K8HA 3CV1A 3AYVA 1C91A 3GYCA 5I3HA 4KH2A 2ZZ6A 4Q7BA 2BSLA 3D5HA 3AICA 4EKJA 4RNHA 2FZDA 4B9YA 4A8NA 1OADA 3OLGA 1ISYA 4F0RA 1QHOA 3AS1A 3TTSA 1NFBA 6REQA 4GUJA 1XGZA 2YB4A 4AZCA 1DWAM 1VLIA 3MUCA 4HYRA 3VDCA 4NAEB 2GJPA 3WK1A 3MDUA 3KEHA 1EKOA 2V5DA 4L9YA 3BOXA 3T9PA 4BF7A 5LHEA 3N6HA 3H2EA 2ZUTA 3VDGA 3EDEA 4GMEA 5FF3A 2EQDA 3WG6A 3JS3A 2ESCA 3P93A 1QPRA 1TJPA 5A5WA 2IQDA 4AZ5A 5HJYA 1J18A 1IZKA 4P8WA 3EWBX 1JF5A 4LBUA 5F1VA 3LM7A 3C0SA 4KWSA 3KX6A 1OYBA 3MTWA 1X6LA 4XAGA 2RUSA 4FXJA 2WAGA 2QDGA 5T8GA 3P61A 5JIPA 4B5SA 1GQIA 1LOSA 1R8LA 2VFEA 3A3XA 7ENLA 3W1AA 4AF0B 2VEFA 3QV7A 1VFUA 4XZWA 4XO6A 4GINA 4GOAA 5AHIA 2ZVIA 2WK2A 2PD5A 2YYUA 3BWWA 2J47A 5C71A 1GT8A 2ZADA 4O1CA 4E2DA 3KE0A 2WXDM 4R88A 3NSMA 2OEJA 2DSZA 1QMLA 1OEPA 3WF1A 2DSWA 2OO6A 4ERIA 4ZB0A 4K2SA 4HN4A 2PGRA 1B31A 3ES8A 2PDPA 3GXPA 2J9ZA 2XN0A 5GJNA 1NP0A 2OVLA 4W7UA 3ZS4A 3AYRA 3U4FA 3IV3A 4FOKA 3FXGA 4MYAA 3GC4A 1FCQA 5H8PA 4B5XA 3FGCA 5HBFA 3AJ7A 3NQAA 3EA3A 8CGTA 1LWIA 1PB0A 3MP4A 3I6RA 4QGCA 3R8GA 3N12A 2C1HA 2WPGA 2WNZA 2OELA 1IWPA 1LLZA 2CZ5A 4RKAA 1CGYA 1E6SM 4FS9A 4HTYA 3S9IA 4WCJA 2WMFA 1GYMA 2PC8A 3EX3A 1DJQA 3MCOA 5HWNA 3I65A 1W9UA 2IXVA 1XYMA 4M82A 3G0UA 1Z8AA 3WUBA 4CD6A 5EU9A 4MOZA 1XGEA 1UR2A 3W6MA 2ZRYA 3QYSA 4AISA 1VFTA 4OZOA 3HG3A 5KMYA 3AU2A 3EKLA 3IANA 5I24A 4FNTA 1K9FA 3ARRA 4I8DA 3NGFA 1CX9A 3G1SA 2EBNA 3E0FA 4LUTB 4MNLA 4JKLA 3SN4A 3LPFA 1HL8A 2VZTA 3CEPA 3FJNA 3W76A 1Q6CA 1IGSA 1LROA 1UR3M 1NOUA 2WJFA 1E6NA 4OTKA 4JTUA 1DWFM 4GYFA 2Y89A 1LRQA 4M6VA 3PJWA 4EVZA 1KKOA 1MDRA 2FH8A 5C70A 1KLYA 3VE9A 4NZ3A 3E9AA 2OQLA 4LXFA 3WDHA 4AZGA 1E1EA 4CNSA 1C7TA 1JDFA 3GG0A 1I45A 1GOKA 4DX3A 4ZQMA 4Q4PA 3AXIA 1FA2A 2CBVA 4RK8A 4QJ1A 5CBIA 3ABZA 3VNMA 2QHAA 4NNBA 3GTNA 2PDKA 1LCOA 3ORWA 4PEKA 1W32A 2CLEA 2R1NA 2X8RA 3AS3A 1YTEA 1R85A 1X8CA 2TAAA 4U31A 3MI6A 3M7WA 2IKJA 2E4TA 3UYCA 3RHGA 4AHOA 1KFWA 3WQ6A 4DRSA 4Z0SA 3P7YA 5A6TC 4DXXA 2GYIA 3TH6A 2R24A 4LF1A 4LC8A 1KRCC 3HPSA 4GA8A 3TK7A 5I09A 2UY3A 2JKAA 5TQLA 3T0TA 2JKEA 2TRSA 3WQCA 3AXKA 3RX2A 3T4WA 5CLWA 3F1QA 2DVTA 4KW2A 3E0LA 4YL2A 2W3ZA 3VNDA 1EWEA 3SUWA 5IDZA 1V0NA 3F4VA 2OQHA 2FZNA 2CZVA 1AZ1A 2VGGA 5AC7A 4O10A 4FP1A 3UVIA 5DEZA 3QGVA 1RP9A 3JVAA 7ODCA 4EPDC 2JFEX 3CUXA 1QXLA 1JD9A 2IW0A 2VM8A 5BW6A 3B4YA 3RCYA 2EHHA 3NL3A 5BWAA 2CBUA 2ZUVA 4FNQA 3KVJA 2QMKA 3W7QA 4KIRA 4M3PA 3JZUA 5D9PA 2QCLA 1UWQA 3WDJA 1ML1A 2DJLA 3LSCA 3G1XA 2G3NA 2EO7A 4L64A 1EIXA 4MWAE 3KWXA 3ZSTA 5CAHA 1FP9A 2IUZA 3LY0A 3QMTA 2CBJA 3FIGA 3IJLA 4M81A 3HGRA 3VUPA 3RK8A 5C2XA 4W7WA 4CNTA 4XBKA 3M0HA 4H00A 2PA6A 3GBEA 3VM5A 2RDXA 2J62A 2C8NA 3UZ5A 5E6ZA 1OGSA 3DZ1A 4CUCA 3NL6A 1S5MA 2NQHA 1EO5A 2OWXA 4KPLA 3O15A 3N13A 1SFJA 2OLHA 4G6CA 4W8AA 2XZ7A 1JGMA 4H19A 2RDWA 2FJKA 2QYGA 5HQLA 4GVFA 5LNRA 4J3TA 3SSZA 3E2VA 3MV11 3PUDA 2PLMA 5FJPA 4H8UA 4A22A 4PEEA 3CUZA 2HWGA 4GI4A 4LC6A 7XIMA 1CWYA 1I8JA 3T7VA 1VPXA 1YW1A 2YPIA 4O4VA 1K1DA 4TQTA 4WRHA 3K2GA 1U83A 3PC0A 2WZHA 2P0IA 1ZGDA 1UH3A 5CBBA 1TWSA 5C8BB 3U5UA 4IMDA 4ZTXA 4AHPA 1WXYA 2A1YA 3VOGA 4XZLX 5F2GA 4Y9NA 5CPOA 4LYKA 5CG0A 3TC6A 3G0SA 1ITQA 1WP6A 3GNNA 3GW3A 2QCFA 1HO1A 5I78A 3GC5A 4E2OA 1EUNA 3ENLA 4PMRA 1Q8JA 2BWGA 4F9DA 2E6FA 4AH7A 1THFD 4AFYA 2V5CA 1HIZA 4CQBA 2X0HA 1OX6A 3PZOA 1BKHA 2BY3A 8A3HA 5LNVA 4L9XA 1PAMA 2ISWA 2PODA 3N4AA 1OC5A 1WXJA 4MJ4A 3EEZA 2OZ0A 1KFLA 4DYKA 2OXNA 2W67A 4FHAA 4QJ3B 4L65A 3CXOA 1S2WA 2X1RA 3LLXA 5DO8A 4MGGA 3EWXA 4DI8A 4GABA 3RPDA 1R30A 2HNEA 4HNLA 1NELA 1JZ5A 3HFTA 2D2JA 4NZ4A 2HBVA 1FOBA 4YTUA 1EC7A 4IZGA 4PSPA 1KGUA 3FA3A 5D2TA 1J6PA 1QOPA 4MB3A 3VD7A 1TQXA 5CSSA 3CAQA 2REQA 2YXGA 1LORA 1XBVA 3E0IA 2ASHA 3VCNA 3F5LA 2VR5A 4S3JA 4YHEA 5G2HA 1PVNA 4DI9A 5K9DA 1LBFA 2NXGA 3O16A 5D30A 1GQKA 3PFMA 4ES4A 2RH9A 2XN2A 1XYZA 3TTQA 3TA6A 1GQJA 1FCBA 1OFOA 1WDSA 3ISIX 1QBAA 3TYBA 3WLTA 3TW7A 3PBWA 3L2IA 4XB3A 4M1BA 4LALA 4HSOA 2YA0A 1JCXA 1XIMA 1XLLA 3BAWA 1V7YA 1V79A 3EB4A 3NSXA 1KFEA 3K4DA 5CZ0A 3CO8A 4FIQA 2VCAA 3UU0A 5ABTA 2Y7FA 3GFXA 3ARVA 2ZTJA 3CMJA 3BICA 2CWNA 4JFSA 3MSDA 1DWJM 3QV9A 1NM9A 2HPMA 3VO0A 1EDTA 4DZ5A 3OQ8A 2WVVB 5M2FX 5IDIA 4MWAA 3L0KA 1GGOA 1EPVA 4LNCA 3VOIA 4XK2A 4REQA 3RG6A 4GNVA 4O13A 2YCEA 4WDTA 4JQ1A 2E9MA 1FWEC 3I7RA 1JFXA 3V1PA 3V5OA 3NPWA 3WO8A 1O1ZA 2TODA 2W4XA 5EMLA 3O07A 3FW6A 3GNOA 1SW3A 4ICCX 3LK6A 3WQWA 5A6AA 4O28A 3W85A 2NT1A 5DBTA 3A9IA 1Y5VA 3S6TA 3G2GA 4B92A 2PS2A 1GCYA 3MI2A 2INZA 4Z2HA 4K3ZA 1SO3A 1IQ8A 4K38A 1YADA 4ZE5A 3IWPA 1GWJA 4H2CA 4BEQA 4GCAA 4U28A 1Q6FA 2NX1A 3M0KA 2C0HA 4UZSA 3QW3A 1W5NA 2RDTA 1JNEA 1Q6LA 3C2EA 2V2DA 5H8UA 3EDDA 3ZIZA 4HHPA 3TJIA 3QKEA 3VKJA 1ONXA 4IMFA 1QNRA 1TX0A 1UG6A 3H4XA 2C18A 5ABGA 1JVNA 4PBGA 2UV8G 3RXZA 2KX9A 4DJED 3PP7A 3SQLA 5A6BD 1NH6A 3DU0A 4A8LA 5HDRA 4L80A 3BW2A 1FWJC 3KHJA 3PZGA 3UXDA 1Y7VA 4IMCA 4OOZA 5MHBA 2DUXA 3KZSA 5DXXA 3TE9A 3WBXA 4I5XA 2HEJA 4E8DA 2AL2B 4H7VA 3THDA 4KF1A 4UXDA 3F4WA 2XFRA 4DY1A 5C5YA 5I2UA 1EEPA 3GUGA 4Q22A 5DMYA 2FB3A 1TCDA 5CCZA 3LUTA 1UPPA 5HR7A 2Y7GA 4XVDA 3WK2A 3EPMA 2QCNA 4G7EB 1OCNA 4GG9A 4CN6A 5FI8A 3W2KA 3AU6A 5GPRA 1JIBA 4Z2LA 2J27A 4Q8WA 1D8CA 4NJKA 1JULA 3AIBA 1UD8A 2GL5A 1A5UA 4W85A 2OCZA 4F8XA 3DUGA 1A5AA 1XQLA 2QQ6A 3CPUA 3GXDA 2A6LA 4DZHA 4HCLA 2PBGA 2QGHA 4N02A 1ISZA 2HRWA 3O05A 1T8QA 3OVPA 2X16A 3D3AA 3VOHA 3BV7A 4FSAA 4CU6A 3L4UA 4TVDA 4ENLA 2GVEA 3GG1A 2HVOA 1DP0A 3M0ZA 4IX0A 3R7MA 4JN7A 3I7SA 2AKMA 1TKKA 5F2LA 3F5KA 2EPKX 2VCBA 2E68A 3BK0A 1Z44A 3AJXA 1E6QM 4GQ0A 2Z1WA 3VA8A 1E0XA 4UQBA 5D38A 2B81A 1LF1A 2Z25A 1XR2A 3SCUA 1NIUA 3UCQA 4DO5A 1OFRA 1CT5A 4ZE4A 3QZAA 4WOQA 3MVTA 3WDIA 2D0HA 1YTKA 4HIBA 2QPUA 2YJQA 2XGBA 2KZHA 1UJPA 2FQIA 2YCIX 3PK7A 4PFHA 3A5FA 3CYJA 1CXHA 3QRHA 4JGDA 3NQCA 4F79A 4AX6A 3E02A 2L5HA 3OIHA 5I02A 3NPXA 3W82A 3ALFA 3G5EA 3E38A 4TVCA 3ALGA 3PAJA 4S39A 4ZFCA 5I3GA 2XIBA 4ZXLA 4C6OA 3S5YA 1DJYA 4QRNA 1TWWA 4PCPA 2BY0A 1TRIA 3EWCA 2VELA 1GVIA 4Q8QA 3F2CA 2BV9A 4TU1A 3BTNA 1G01A 1M7PA 4WVXA 3LXCA 1VJIA 4V1YA 2X05A 1V8EA 3O7UA 1NDVA 3UETA 5E0FA 2XIOA 4Y8EA 4K1GA 4UUIA 1NVMA 4F2TA 5CKSA 4CNUA 3K30A 3DYOA 3DBPA 1UKPA 3OLDA 1G69A 3PBMA 4OV9A 3KLLA 1H49A 1VFSA 3TX9A 4MYXA 2C1GA 2AGKA 3B05A 3D47A 1DOSA 3MYOA 1R47A 2YFNA 1KBKA 4LY8A 1FWHC 1XLEA 1TELA 2BHUA 5E93A 1V02E 1TJ0A 3P74A 3WNKA 1NFGA 3H7RA 3NPUA 2ACUA 3NQMA 2AAMA 2ZTKA 2B0MA 3PAOA 3VVGA 3ZT5A 4GWEA 3KBWA 3SUSA 1ZB5A 1L6YA 4MSSA 3WEOA 4MAVA 1BHGA 4AD1A 3GK0A 1OBAA 2ANUA 3WL1A 1Q6DA 4XUYA 2W61A 4RPPA 1J11A 2FIQA 4PMQA 1AW2A 3A3WA 4UTTC 4GK8A 3H4WA 3W53A 3F5JA 6REQB 4PB5A 1YDYA 4E3VA 3ZM8A 3SRDA 3GH5A 1YNPA 2VJXA 4Q8MA 3WNNA 4FR6A 4A6GA 4OBTA 3L68A 4C1LA 1LBMA 2Y63A 4P5UA 4S3AA 3HV8A 5DMLA 1OYCA 2A3AA 4GXPA 2V3GA 1QNSA 2GWGA 4LSBA 4FB7A 1DJZA 4ZB2A 3G1YA 4BF5A 3SDOA 2EPMX 1WDDA 4QFUA 1VF8A 3ARQA 1IZCA 1TV3A 3W1PA 1BWLA 4J4KA 2NQ9A 1VR6A 5AC5A 4DWSC 3GAKA 3RPMA 1TUFA 6CGTA 4A4AA 1GG0A 2VX7A 4MIMA 2XPKA 5I3IA 2FZMA 4JBRA 3T1GA 3HJEA 3SR7A 4I3GA 5A3HA 2FLIA 1UD4A 1XLDA 5TAOA 4W4QA 1EWDA 5C9XA 4KRUA 5I03A 1L0PA 4IT1A 3GU2A 1UD3A 4CGTA 3KXQA 3L4XA 4CEUC 2DVUA 5LIWX 5A8QA 1GVOA 2E9LA 1XISA 1JF6A 1EXPA 1WX0A 1W5MA 4HK7A 1KNWA 2ZUUA 3GZ3A 4D9PA 4HQVA 3R12A 5LIKX 4B5VA 1SU5A 3BJTA 4DJFC 2W5FA 3OBKA 1W1TA 3XINA 1DTNA 2E09A 5LA0A 1LT7A 4C60A 2G96A 3TQKA 4GY0A 3OEXA 3MZNA 3W6LA 3NNTA 4I90A 4DWDA 2ABAA 4ROQA 2AAAA 1OM0A 2CYGA 4IISA 3SRKA 2J9YA 3OJGA 5EL1A 4HOWA 4MVAA 1ISXA 3TZFA 1R38A 1S39A 4HU4A 1RBAA 2BOEX 1LJYA 1YIXA 4AC7C 4GZIA 2RGLA 1FWFC 5CH9A 2JALA 4PFMA 4RV3A 4DPQA 3VXGA 3T6CA 4ATWA 1ZAJA 4H6RA 4HPXA 3ABOA 1CXLA 3VC6A 2VGIA 3LHUA 4Y7EA 4IQDA 4JIRA 2V63A 4BFAA 2ZXDA 4BK9A 4L4MA 2CLPA 2RGMA 4ADTA 1FH8A 3RO8A 1OGBA 4GH3A 4A2SA 3S1VA 5EBUA 4UTJA 2INEA 1AL8A 2NV9A 2OX4A 3L21A 4PB3A 1UHVA 4DN1A 2ZWYA 5DRCA 1S3TC 2E25A 3B8UA 3LGGA 4YIWA 3BARA 4MY9A 4PYSA 2A21A 4MTVA 4W89A 2NQZA 2YDQA 5E9AA 4K37A 4AXKA 1O7AA 2VX4A 1A3WA 4C6FA 1OHLA 2A3LA 1QR7A 1KCKA 1E1CA 3N73A 2W91A 2GGHA 4H7CA 1A0DA 3M1ZA 2WCGA 1V02A 1UH2A 2RDUA 1KFCA 3H12A 1GVRA 1JUBA 1XUZA 1XWYA 1UCWA 3WLHA 3VNJA 3H26A 2OJPA 3B0VC 3ITXA 3NURA 2YX0A 5G5IA 1GQLA 3V75A 7REQB 3LCHA 1KXHA 5A95A 4AY8A 4J3ZA 4DJDD 3KOWA 4PA8A 3OA3A 1OF8A 3QQ1A 4TMBA 1I0BA 4HBKA 4P7QA 4KGLA 1VCVA 5AZ0A 5LNSA 1UR4A 5U4NA 4GZ7A 3WK3A 2FJUB 3MU7A 1RV8A 1ICPA 2Z4GA 3N3TA 4JTRA 3AHTA 3ZJ6A 4ZOBA 3H6OA 4FXSA 3OYXA 2A3BA 3QF0A 4PBFA 1ZBCA 4BQ4A 2ZZ7A 5FSDC 3OOQA 2PZ0A 2HZGA 1RQBA 1XG3A 4JTGA 1FDZA 1HZYA 1VKFA 3QW4B 1D7KA 4P7OA 1XYAA 1J01A 2VGFA 4FMVA 1IT7A 4XZ9A 4YWSA 3SY1A 2HVNA 1DJHA 2BNJA 4FLQA 1D3HA 3GU1A 3W86A 4QAIA 4UNKA 3PG8A 3C8FA 1A4MA 1BRLB 4GI6A 3DFSA 1YBQA 2ZICA 3PZ9A 4RW3A 1Q6OA 2XVNA 4HA1A 4Z0JA 4CQ9A 2ABBA 1UD6A 2W92A 3UY8A 3WQGA 2ZQ0A 3THUA 3CL8A 5HUPA 5JUVA 2Q3RA 3K46A 3FS2A 3EWYA 2H90A 2QV4A 4C7DA 1R3WA 1N2VA 1CW2A 1M65A 3GNRA 3TJ4A 4LS2A 3WD0A 1PZ3A 2C71A 3UJEA 1NOWA 3R0DA 1YXDA 3B97A 1R2TA 3S4TA 3IARA 1FHVA 2PDQA 4ZXOA 3DC8A 3SEPA 3GU9A 4JOMA 1MDLA 1HX0A 3GNXA 5EFDA 3CT7A 4AZ6A 2PDNA 3W7JA 1FWIC 3LNPA 3DGRA 1QUMA 3CMGA 3PZUA 1P6WA 1HKWA 3Q58A 1QOXA 1V5XA 1I60A 2QUMA 4RV8A 4AC1X 3S42A 1LL6A 2WSYA 4NSBA 1KCXA 4CNOA 3V7PA 1OSEA 3KBMA 2ZCGA 1QCWA 3WQPA 2WB5A 3WLLA 4Q4OA 1VIWA 5EB8A 3DENA 3BGAA 1KRBC 3LU2A 1AK5A 3DG7A 2V0TA 4C5YA 2WZEA 3I3EA 2J8TA 4KEUA 1QNOA 3M07A 2QCDB 2O7QA 3IJIA 3GTXA 3LNMA 4NJHA 1ZY9A 4IIFA 4LS1A 2W27A 1X39A