3W1TA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-095
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-095
rcsb
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1tA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1tA01
1OX4A 4UFJA 2NXGA 1GTEA 2WSRA 4TMCA 2C0AA 3QPYA 1VJIA 3G8RA 3LCHA 4O12A 3QRHA 4KWVA 4M7TA 3W1MA 1TJRA 5D03A 3LCLA 1FBAA 4N4QA 4JX5A 3L67A 1H7OA 3CB8A 5FEXA 2VXNA 4DO6A 4JICA 3UXAA 1JCYA 2GPTA 1OYBA 2WNQA 3GXPA 2FTPA 2PE4A 2RHGA 3LLDA 5AFDA 2CZFA 4XBSA 3LTPA 1H5YA 1KFCA 2NUWA 3NXFA 4ZZ9A 2J6XA 2E68A 2B7PA 1S5TA 1KM2A 4HNUA 1TPH1 1XDLA 3H55A 1EUNA 3HOJA 3WK2A 1TCDA 2Y63A 3TAKA 2FB3A 2NV2A 3TDFA 3MI3A 1N7KA 2VFDA 4O18A 1D3HA 1ICPA 2QCCA 3BGGA 2JBMA 4GJ1A 1TQJA 2CZ5A 1FWSA 1IXPA 3GKFA 5KMYA 4TMBA 2NXHA 1LBMA 3C3NA 4MJMA 3NNTA 3M41A 4Z1AA 1G7UA 4QITA 2VELA 4PA8A 3CT7A 3S1VA 1FWNA 2GQAA 3F1QA 1QNVA 3USBA 3LCXA 1SR9A 1WQ5A 5D37A 5G1TA 2Z1BA 3V75A 1VLIA 5BMWA 4C1LA 3SECA 1PHWA 1JUEA 3DAQA 3SSJA 3BG9A 1NFBA 2G95A 1FX6A 3MWAA 3HGJA 4O54A 4LOCA 5FF0A 4XUGA 3EB2A 3L0NA 1H61A 4UCGA 2Y61A 5D2WA 3KVLA 3W1PA 1R2SA 4UTHA 4GUJA 3W7KA 3G22A 3CLMA 2JGYA 1YDNA 1SUXA 1VZWA 3WK0A 1LLZA 1NF7A 4HPJA 1YXYA 3HG2A 3HG4A 3N3MA 4J9JA 3C52A 3G8EA 4PTNA 5CPLA 1HFBA 3L2IA 3MP4A 2Y7EA 3Q2DA 3KOFA 2YZRA 3QQ0A 5DBUA 4AWTA 3FOKA 3M5XA 3W76A 1MZHA 4ORMA 3P61A 1K8XA 3V1PA 3KRSA 2R14A 5F2GA 3PS7A 2DORA 2X1RA 5LSMA 4O17A 3R8RA 2PURA 5AYYA 3HGOA 4DO5A 5TQLA 2B7QA 1TV8A 4JX6A 4ZQNA 2QAPA 5KZDA 1TPC1 1JCJA 1QPQA 2ZQ0A 3TFXA 4O1AA 1W5MA 1XBVA 4O11A 1ZJIA 2GVLA 3W7RA 1GVSA 1IXQA 3UZ5A 4X2RA 1GVOA 1TTPA 4UTTA 3SGUA 4FNSA 2CLFA 3CEPA 1T96A 2NXIA 3ATZA 3QQ1A 3GDKA 4XTIA 2DZXA 5K4XA 1Z42A 4K37A 4O14A 4CQ9A 1THFD 1I2OA 2YYTA 5DLCA 1A5SA 4Q32A 1X8FA 4IXHA 3NQEA 5I3JA 2QCDA 3NQAA 3GVGA 2J9XA 4GUHA 4N2YA 2C3ZA 4FXSA 3KAOA 3DXIA 3N34A 4Z1CA 4JYDA 3W3OA 5EL1A 4IPIA 3LHUA 3LERA 3DENA 1F6PA 4JTFA 4AHQA 3WFAA 1K02A 2ATSA 4MOZA 3IVTA 1FDJA 2JKAA 2V2DA 4I7VA 5HJLA 2ZTKA 2EAWA 1SZEA 2A5HA 4FHAA 3IIPA 3FKRA 3PG9A 4M5PA 1EX5A 3VKJA 2V30A 4LVDA 1QPRA 2FB2A 3QSTA 4JTKA 1NSJA 4FXRA 2CFFA 3W7EA 4BFAA 4U28A 4DO4A 3G24A 4H4IA 4RR4A 4U4MA 1PIIA 1KM0A 3RLVA 2J9ZA 1V7YA 3I7RA 3LXCA 1TO3A 1ICSA 4GNJA 3KRZA 2BXVA 4UFMA 2QUTA 4FNQA 3PVFA 5GVJA 4LVFA 3RK8A 3W7JA 5CPOA 1VR6A 4X3ZA 1H51A 1H62A 1NAL1 2Q8ZA 3CHVA 3HG5A 3CM4A 4NZJA 1TIMA 1TV7A 1W5NA 1KLZA 2PCQA 2V5LA 3RFAA 3EWYA 1LP6A 2QDGA 4DBDA 2I14A 3E9AA 1O5KA 5LNRA 4I7UA 4NNAA 3NYZA 3O07A 1A53A 2NUYA 1GQNA 3G0XA 3GX9A 1QCWA 3NPXA 2JK2A 4NXKA 3JR2A 4R53A 5EBUA 1OFOA 2ZA1A 4MY1A 5AC7A 3R89A 1W56A 4JR5A 4LUJA 2YW3A 4KFNA 4BWLA 4EF9A 1C9DA 3FJ6A 2QCDB 4OBTA 1I2PA 2AAMA 5G4WA 3UD6A 1TYGA 2ISSA 4DQWA 4I9AA 2TYSA 1K8YA 2DU2A 1FDYA 3UWYA 1BWKA 3MI2A 3LRMA 5C55A 2P10A 4O19A 5E0KA 2VEIA 5CPNA 1LRQA 1B9BA 3PB0A 1I2RA 4LWWA 2QCHA 3W1QA 3FFSA 3MBFA 1ZAIA 3PWAA 5LGZA 5D2YA 1N55A 2UV8G 3NPUA 1GYLA 1AL8A 2NLIA 4H3DA 1G67A 2Y7GA 3Q94A 3W7MA 2VEPA 3NZ1A 1VLWA 2QCFA 4QJ1A 3DI1A 1VYSX 1ZNNA 5D2TA 3CWOX 4JIPA 4O10A 3S6DA 4PEKA 1JVNA 1K7FA 3IVSA 3LI0A 1UJPA 2GOUA 1C29A 5LHEA 2Y62A 3PY2A 3CTLA 5K9DA 1EEPA 2R8WA 3TK7A 3S9YA 4OHQA 1VHCA 3HO8A 3Q37A 1RR2A 3UPBA 3LRKA 1LOQA 4GXMA 5D38A 2Y7FA 1HUVA 4IX0A 2W79A 4JTHA 3PAJA 2V82A 5IBXA 3W84A 1Z41A 1QPNA 4O53A 1DJNA 3I7QA 3W85A 2ZCGA 1LTDA 3OVQA 4A21A 5D09A 2R91A 4LC6A 3NA8A 5D32A 3EX2A 3LTYA 2IQTA 2Y89A 3GDTA 1KFBA 1QO5A 1TJPA 1YTKA 3EX3A 5AHEA 2A6NA 4AHPA 1KTNA 3DHDA 3THAA 1YXCA 1QDSA 1LCOA 2NV1A 1DORA 4XTDA 3SGZA 3MJYA 1KTBA 3M0ZA 1PHQA 3M1ZA 1QWGA 5AYZA 1D3GA 1VCGA 1QOPA 4IMFA 3LDVA 3STEA 5DCDA 3FS2A 3NO5A 3M5YA 1ALDA 1GVFA 5F4WA 2QUVA 3B0UX 1AW2A 3IRDA 4Y6GA 3LHWA 1WA3A 2E1DA 3FKKA 2QJGA 4MFDA 1B3OA 3W1NA 1P0KA 1OABA 1Q3NA 5C54A 1WOBA 2A7NA 3TQKA 1JULA 2H90A 4N9CA 1ZFJA 1J2WA 1LZOA 1PV8A 1OX5A 5KSWA 4FEZA 4P2VA 1OFRA 4NU7A 5DY2A 3SI9A 3QSRA 2ZBTA 4DELA 4JNMA 1M6JA 3BARA 1BTMA 1ADOA 2V2CA 3NPWA 3IGSA 1C8VA 4ORIA 3RF9A 1I2NA 4R7JA 3TSDA 1SO4A 3A5FA 5LNVA 3W1XA 3L5AA 1GZGA 4CNNA 4HHPA 3IGUA 1W3IA 1SO5A 2VEKA 2HMCA 4K8EA 1RQHA 2EKCA 3TIMA 3FEMA 3T7VA 3WJYA 5HULA 1KTCA 3UXDA 1ZENA 1NF0A 3LV6A 3MP3A 1G4PA 3BG3A 2JKPA 4JXCA 4N9DA 4ONVA 4CNOA 3ZFHA 2OMAA 4UC5A 3S5YA 5LNSA 5H2ZA 3PBYA 4EIVA 2EF9A 1TTQA 5U7SA 3W71A 3B8DA 3W7OA 5MHBA 1EP2A 4UR8A 3MI6A 5AHNA 1X1ZA 5CZJA 4A2SA 3TFCA 1VH7A 1LORA 3LRLA 2NX3A 3W75A 3NG3A 4MFEA 3KVKA 3HIJA 4JN6A 4MVAA 4NXSA 1Y0EA 4JTGA 3BW3A 3S5ZA 3TH6A 3UNDA 1SFJA 1XDMA 4MZ1A 1YADA 4KFPA 3DFOA 5EMUA 1YLVA 5TIMA 4IMGA 4MZYA 8TIMA 3KX6A 1FY6A 1IIHA 4Q4KA 3M9YA 3W74A 1FWRA 4WUIA 3INPA 4ALDA 4MJZA 4O1BA 1Z48A 2BWGA 3HG3A 3LM7A 4M6PA 1OF8A 3P8JA 3L5MA 5HUOA 3NZRA 5I3GA 4ADTA 1SW3A 4E2BA 2J24A 3L9CA 4LNYA 1KM1A 3W2KA 3HGSA 3UYCA 2I1OA 5EA9A 1DJQA 3GNDA 5D2XA 1XC4A 2ZZ4A 1P4CA 1Q6LA 4LY8A 3NQ8A 3IVUA 1R47A 3O1NA 3MMTA 2Z6JA 3N2MA 1H7NA 4RX0A 4UTLA 2G97A 5DXXA 1EUAA 3TMLA 5BOOA 4KFOA 3OA3A 2RDUA 5AHFA 5E93A 3QZEA 1K7EA 1VCFA 4A22A 1OX4B 3S42A 2HS6A 3NQDA 1TPVA 1OG0A 3LCWA 5K7JA 3MYPA 2ALDA 1CI1A 4HT3A 3T40A 2CLLA 3PBVA 5LGXA 4OQVA 3GYEA 3W7GA 1WV2A 2OJPA 1RPXA 2GVGA 3P81A 3QC3A 2A7PA 2PRHA 3P60A 1G4EA 3KRUA 4LUIA 3QPZA 4XKYB 3EX6A 4JTEA 3E0IA 4HPXA 1KFKA 4NJGA 3LXAA 1ZALA 2B7NA 3W2MA 3HJZA 3TKFA 1X7FA 2FQIA 2WV8A 1JQVA 1W54A 3BW4A 4O1CA 5EYWA 1YXDA 1KM6A 1UCWA 4WD0A 3EXTA 3OIXA 3FA5A 2NZLA 3NVTA 1PCWA 3QW4B 3EKLA 3GNNA 5U4NA 3BLEA 3JRKA 1SW0A 5FI8A 2TSYA 3NQGA 4DBEA 5G1YA 3TJXA 4C1KA 6TIMA 3B06A 4E2DA 3NR0A 1MXSA 4CNPA 4NZFA 3WJSA 1SO3A 4UTUA 1WOAA 3B05A 5I3IA 3B03A 4NNCA 3IEBA 3T55A 2ABBA 2XN1A 1OVDA 2ZZ2A 3LBMA 2ZTJA 3C2RA 2ZA3A 4FNPA 3LTSA 5A8GA 3THQA 4A3UA 4B5NA 4L4LA 4ZQPA 3AJXA 1OK6A 1R30A 3EWXA 2EPHA 4DEFA 1I2QA 4UNKA 4S1FA 4K38A 4RZ4A 3O63A 3G1VA 2CZEA 3GXNA 1U83A 4GWEA 3BO9A 3EWBX 3O06A 1ZAHA 1XI3A 2W6RA 3GXTA 3MW7A 2WSYA 4MZ8A 3W2LA 5G2IA 5CGQA 1G4TA 1W5QA 3BG5A 2Q3RA 1EP1A 4FNUA 3QEZA 1L9WA 2E77A 2VFHA 3BK0A 5K9XA 1GPWA 1JCXA 3C2EA 4ZL1A 3QJAA 3TSMA 1VCVA 4HSOA 5T26A 5BNKA 3GAYA 1J5TA 4PODA 3EWZA 3EWUA 3S0CA 1OFBA 4MKNA 3SY5A 5AOUA 4MY9A 3G0UA 2A1YA 4FIRA 1GOXA 1RD5A 4OU1A 5AB3A 1LRNA 3P80A 4DXVA 4YMZA 4TU1A 1P1XA 3MYOA 3QYQA 2EGZA 4BI5A 4FNRA 1PS9A 4K39A 5C5YA 1DHPA 1JR1A 4IGHA 3ABRA 3P8IA 2CLIA 3OEXA 4X9SA 1VYPX 1B4KA 3GR7A 4GUIA 1H60A 1OYAA 4IWWA 2P0OA 3LHTA 1WAUA 4AEOA 1TPUA 4Z1DA 1XUUA 2QUUA 7TIMA 2EHHA 4WJEA 3TSBA 3AO0A 3C2OA 3DKJA 1EP3A 4K8HA 1S3HA 2FPYA 1G7VA 5KINA 2C18A 2DZUA 4UTWC 1KBJA 3M5VA 3VFLA 1DL3A 2FPVA 5HWMA 2TPSA 4P61A 5HWJA 3IIZA 4UFHA 3ATYA 2G5WA 1IXNA 3F03K 2PC4A 1ZCOA 2HSAA 1SPQA 3TV8A 5D33A 4QIUA 1H1YA 5FF4A 2O7QA 4OV9A 5D30A 1M7OA 4NT0A 4GBUA 1FWWA 3N9SA 4LVBA 2BX7A 4JX4A 4O50A 2J9YA 1AMKA 4H6KA 3P84A 2G96A 4EF8A 3NM1A 1TREA 3PSWA 3HPSA 1F05A 4AXKA 4MUZA 1FCVA 3PUOA 2VFFA 4GC4A 3F4WA 2J27A 4QAIA 1S5WA 3O05A 3W7PA 2WKJA 3TC6A 1A50A 3MP5A 2CW6A 5HINA 3ANYA 5FF3A 5LKYA 2ZFAA 5D2VA 1D9EA 5CSSA 3WJXA 4LS2A 2VOMA 4FNTA 1I8JA 1F6KA 3MHFA 3MHGA 4IMCA 2QCLA 4UMCA 3OVPA 4HNNA 4JTSA 1YDVA 3W22A 1FDZA 2XN0A 5LNWA 2DZSA 3DZ1A 4QISA 3DFTA 2GJNA 1MEWA 4KKXA 2V9DA 2B4GA 5FEPA 1KBIA 5AYXA 3BLFA 4OGZA 2WJZA 4OE7A 3O6YX 2BTMA 2JKEA 2FLIA 3TC7A 2E5DA 3PULA 3NPVA 3G1DA 1MEHA 4DPQA 2NX9A 1GVRA 3O6DA 4YLWA 1CX9A 3S1XA 1SZNA 2ZYFA 4CQ8A 1WBHA 3FJLA 2J88A 5G2HA 3NQ6A 2P1FA 4JDBA 1TTIA 5KTLA 1SFLA 3UQNA 3C4UA 4NJJA 3C2FA 2CLOA 3GDLA 4MLRA 1VRDA 2QAFA 1ML1A 3IIOA 3L65A 2XFWA 4OV4A 4BF9A 5F2LA 1E51A 1W3TA 1ME8A 5DCEA 3DGRA 2HTMA 3CEUA 5ABTA 3B04A 3M47A 4JYFA 1L6SA 4IPJA 4QNEA 4ZQMA 2X1TA 1P5BA 3PBWA 2DZVA 1HO1A 3DBPA 1A5CA 1M7PA 4PL2A 4HSNA 3C6CA 3G3MA 2FJKA 2YPIA 3CU2A 4LT9A 4R34A 4N9BA 4ZQCA 5FEWA 3G18A 1W31A 4GFSA 3A9IA 3DH7A 5KZEA 4AMAA 5HWNA 4ICNA 4AAJA 4E38A 1O94A 3NL5A 4M19A 4AB4A 2X1SA 1JCLA 5LNUA 2CLEA 2GUUA 3PM6A 2BLEA 3LGEA 3I68A 1F73A 5DN1A 5FEZA 3TQ0A 3WK1A 1Q45A 3W23A 5LHFA 2E6YA 4O1DA 4TR9A 4UTJA 2E5BA 3KXQA 3W1TA 1JCMP 3GK0A 3A23A 3S5OA 2H3DA 2QDHA 5LZLA 1PE1A 1H50A 1SZGA 2H8XA 1RQEA 2GJLA 4X22A 5DBTA 1R2TA 5L9FA 1B4EA 3G1AA 4GUFA 4Y9AA 3F4NA 4WQ6A 4AH7A 4YXGA 1WX0A 1IGSA 1UBSA 2Q8LA 1KM3A 3QMTA 5BW6A 2Z0IA 3STFA 3QM3A 1G6CA 4JTLA 3CWNA 3HGRA 1RQBA 2JGQA 4BK9A 4JTIA 4Z0SA 3LHVA 1W37A 2ZDRA 3LCFA 3QMSA 4S2CA 4JEQA 3GDRA 5BRBA 4PC8A 4XBKA 1J4EA 3VE7A 4BI7A 5KITA 5EKYA 4CCDA 3ABQA 4RXGA 4A29A 4Z08A 2A6LA 1WYIA 4DF1A 5IBXC 3A5VA 2X30A 2DZTA 1TPFA 2ZZ1A 3DFNA 2DZPA 1FCBA 5HMSA 1XL9A 1GG0A 4WX2A 2V81A 1NVMA 4WOQA 5K2ZA 1UB3A 2ZZ5A 3L21A 1AK5A 1XXXA 2WSQA 5AN7A 4YCOA 4N9EA 2WOQA 5C2XA 3LXBA 1DQXA 2BSLA 3EXRA 1ZAJA 4NJIA 4NJKA 1EPXA 1JJKA 3TCEA 4PL1A 1OX6A 4Y8FA 3C8FA 3H54A 2DP3A 4I7WA 5A5WA 4R33A 1A5AA 2O7SA 5G2WA 4JTJA 1W1ZA 3U8GA 3GDMA 3IV3A 1FQ0A 4MPQA 3OHIA 3JS3A 3M43A 1LROA 3L68A 1DQWA 3OVRA 4BI6A 3CIXA 4JY9A 3L0KA 1ZY9A 4ADUA 1Q6OA 4HN4A 3E12A 3W73A 1KV8A 1BEUA 3BVJA 2Y88A 1NEYA 4UTIA 4JYEA 2E6FA 1YYAA 2ZRUA 2H3BA 5I3HA 1Q6QA 1XBXA 3EXSA 4O4VA 1GVQA 3W72A 2AGKA 5L6UA 1H1ZA 2ZRZA 1TPDA 3LHYA 3N19B 4JD4A 3KFTA 2OCZA 2QCEA 2CWNA 4UIOA 4D2JA 1HO4A 5AHLA 4O13A 1FWTA 3TAOA 3W07A 5IM51 4WZHA 1DVJA 4UMAA 1F74A 5F1UA 3C2VA 4UMBA 2Y7DA 4LRSA 2VFEA 5FF2A 3PC0A 4DF0A 3NQCA 5DY3A 3O15A 1GT8A 3S8HA 3I7SA 3GR8A 1XFBA 5E1QA 4FO4A 4LU0A 2V5BA 4WY0A 1P0NA 3HPZA 3PG8A 1UUMA 1W5OA 4FB7A 3LBCA 4Z1BA 5KZMA 1G4SA 3N9RA 4TIMA 3W2UA 2RDWA 3UZJA 1OYCA 3RU6A 3B0VC 2VFIA 1VPXA 1K3UA 3W1LA 3T78A 1SO6A 1T99A 4MY8A 1LBFA 3G1HA 1SU5A 3EX4A 1L6WA 3KVMA 1FCQA 4AWUA 2FPTA 1QAPA 1LOLA 2GQ9A 1QMLA 1SZFA 2OT0A 3GLCA 5K3VA 5D05A 4RXFA 3NAVA 5H91A 2OT1A 4XWUA 4LVGA 3CQ0A 4MYXA 3G1XA 4LV4A 3SFKA 1PL9A 1XKYA 3NEVA 4E0CA 4W9TA 3HBLA 3P5YA 3SZ8A 1AG1O 2YSWA 2Z6IA 2C16A 1EA0A 4PH6A 4ZMGA 4RKAA 3BGJA 3C0JA 4IQLA 1SSDA 2H8ZA 3QF0A 3W87A 2WNNA 3DU0A 2DZWA 4NJHA 1DV7A 1K7XA 1PCKA 2VEMA 4QM1A 2E09A 2FIQA 4K6AA 3I6RA 3ZS4A 3EX1A 4AHOA 2RDTA 2HS8A 4GE8A 5G5IA 3NQMA 1QPOA 4LTSA 1W0MA 3G1FA 3MUXA 5D02A 1SW7A 3NM3A 3TUUA 3FIGA 3LCGA 3HMJG 3DKLA 3EWWA 3TXZA 3TE9A 2PRMA 2C13A 4HKPA 2QCNA 3W83A 4IXXA 5HR7A 1WXJA 1TV5A 1OK4A 1O95A 1O5XA 3ELFA 4IUOA 1FXQA 1MO0A 1KA9F 3CIWA 1EIXA 3M44A 3K30A 5C6MA 1EB3A 1VQTA 1TRDA 2Q3OA 4NX5A 6ALDA 1GYNA 4NQ1A 2QJIA 3WK3A 2A0NA 3P7YA 1YTEA 5EY5A 1R2RA 2CZDA 5K9CA 5J5DA 4Y96A 2CU0A 3T44A 4O16A 2ZRYA 3QFEA 4AF0A 5AC8A 4NNBA 3M6YA 3LX9A 4K7VA 3W70A 2V2HA 3NL6A 3E96A 1W8SA 3W6YA 3R5EA 3GAKA 2ZRVA 3NQ7A 3IIXA 1TMHA 2I9EA 4IX2A 5SWUA 1JRBA 1LOSA 2CLKA 3L0GA 4LV9A 4JTTA 3W9ZA 4FX7A 3BW2A 1GWJA 2DJLA 3LI1A 5F2MA 3U2OA 5HQEA 3W2NA 1W5PA 4K36A 4K7YA 1U5JA 1XCFA 1OF6A 1ZHAA 2C6QA 4JIQA 1ME9A 2ISWA 2B0MA 3A24A 2YFNA 2D73A 1XUZA 4FX8A 4YCPA 3TJLA 5D04C 3O6CA 1R46A 2OX1A 2ZZ6A 2YGYA 2H6RA 4LS1A 3W2JA 1I4NA 4QSHA 1OFPA 1H7PA 3RMJA 3TMQA 3LB0A 3W88A 3MO7A 4ZQOA 3G1SA 3R13A 3ZWTA 4FX6M 1T0OA 2TRSA 4GRSA 2ATMA 4IOTA 3DI0A 4LVAA 1LRTA 1KFLA 2Y70A 3W1AA 4UXDA 3UWZA 1F5ZA 1QO2A 3NOEA 4MIMA 4LS0A 2ISVA 4JGDA 5CKSA 4TO8A 5HNRA 1WBJA 4FIQA 3FLUA 1N8FA 3YPIA 3GZ3A 4M6VA 2W0UA 1DKWA 3NQ2A 4RZ5A 1QFEA 3PUDA 4UFLA 3TW7A 5I3FA 4O28A 3LOTA 2ZRXA 2YDAA 2QF7A 4UNLA 4UR7A 1H7XA 3TNOA 2X1UA 4IMDA 3D0CA 3S1UA 1O4UA 3SW6A 4PFMA 3P82A 1I45A 4ADSA 4M6QA 3PR2A 1RZMA 3Q58A 5DXYA 4Q33A 2WNZA 1JUKA 3PBUA 1WDWA 4GUGA 3P5ZA 4XZ9A 1KFJA 3P74A 3N14A 3BPWA 3W7NA 4NX0A 1EWDA 3W1RA 1W3NA 1YPIA 3UWQA 2R94A 3C61A 1LYXA 4XKYA 2C19A 1YTDA 1A5BA 1OFEA 1IF2A 2VENA 4UFIA 2OZ0A 1FUYA 1L6YA 2TMDA 2QR6A 1KV5A 4IJBA 5F4SA 3BV4A 2NUXA 4OT7A 5DELA 5CG7A 3SIZA 1JRCA 3KHJA 4G1KA 3UWWA 2WPBA 1B57A 1GJPA 3EEGA 3PSVA 3GKAA 2A4AA 2A2IA 1K8ZA 5CZ0A 1IIGA 1VYRA 3LCIA 3DHFA 4A2RA 3NGJA 4WXZA 3CPRA 3GB6A 1GG1A 4DPPA 1S5VA 3VI2A 3A22A 3G3DA 2ZZ3A 3UY7A 2LLEA 3R2GA 2AQWA 1V5XA 3OBKA 3TW6A 1VS1A 1LBLA 2Z2UA 1KW1A 4POCA 4UTTC 4LW7A 3P62A 4JDYA 1H7RA 2A21A 2YYUA 4O8RA 2A7RA 3NQVA 3W7DA 1UUOA 1L2UA 3E49A 2CLHA 2XN2A 1OJXA 1IXOA 4O0ZA 5FF7A 4UTKA 3PF3A 1TPEA 1EWEA 5CZSA 4O0KA 2YXGA 2Y85A 1XBZA 2FFCA 2A85A 2E5CA 2VKZG 3G1YA 4Y90A 1OFQA 3IIVA 3L5LA 4CQAA 5J5RA 4O57A 1FXPA 1TPWA 5BMXA 3LLFA 4RCXA 1KM4A 5AHMA 3A21A 3TX9A 4S2BA 3W1UA 3NDOA 5EPDA 1OFAA 2GQ8A 3RLUA 3FYOA 1LM1A 2B7OA 5HUPA 1RVGA 3HPXA 3T4CA 1BWLA 1MSSA 4O52A 1XM3A 3S5NA 4WY0F 1OHLA 3ABOA 1QR7A 1SQ7A 2KZHA 1T8XA 4WXYA 4JY8A 2F7FA 2C14A 3WJZA 4AF0B 2VFGA 1FCUA 4JTUA 2QEZA 3TROA 5CPMA 2YW4A 1Q6RA 4LRTA 1JQXA 4LC8A 4EOUA 2E6AA 3HQ1A 4RJEA 3M16A 3UY8A 3VE9A 3KVJA 4N4PA 5I3KA 3H53A 5FESA 5AC6A 2WQPA 1BKSA 1K03A 4QNWA 3VCRA 3QW3A 3B4UA 4O4WA 1MEIA 1F7BA 2ABAA 1HG3A 5AHIA 4QQ3A 1Z44A 4L4MA 4CCEA 3DFQA 4UUIA 4AVFA 3MHUA 1CW2A 1TQXA 2ZRWA 3W7CA 5F1VA 3S1WA 2V0TA 3SR7A 1OFDA 4CLMA 1TTJA 3W7LA 3DFPA 3HF3A 1SSGA 4RLIA 3DFSA 3P67A 1H7WA 2RFGA 4RV8A 1KFEA 2Y6ZA 2RH9A 1JCNA 3ZWSA 4N6EA 5G4EA 2ZZ7A 3SJ3A 3W7HA 1AW1A 3TQVA 4FF7A 1AW5A 1M5WA 3N2XA 1TB3A 1HL2A 4YWIA 2WO5A 4ZVJA 4HNVA 1XBYA 4TX9A 2V8ZA 3E02A 3MBDA 5CZTA 2YX0A 3W7IA 4OWGA 3FYPA 3B0PA 2YCEA 3C56A 2BZNA 4RK8A 1PVNA 5F4XA 1ICQA 2NX1A 2YR1A 2NWRA 4O15A 2C1HA 3N73A 5F2IA 3LHZA 3NQFA 1VC4A 4BR1A 2E6DA 2C15A 3IGXA 2ZA2A 3TA6A 1YPFA 2QKFA 1O60A 1G69A 1LDCA 3RNDA 4Z0JA 5CSRA 1X1OA 1GTHA 3BLIA 3OG3A 1LLWA 4MYAA 1AL7A 4HNTA 3W86A 5DCBA 4MLJA 4YL2A 3TR2A 4IMEA 1F2JA 4BWLC 4UTMA 3STGA 3PUEA 1ME7A 3ZR4A 1KLYA 1YDOA 3HB9A 3TU9A 3I65A 4EVZA 2X16A 3M7WA 5TBOA 3O8AA 1H63A 2PRLA 4M7SA 1F76A 2QJHA 4HIBA 2FDSA 3LV5A 2F84A 1UASA 3G0SA 3UWUA 5HR6A 3UPWA 2NWSA 2DJXA 3PB2A 4N6FA 4N02A 4CCCA 5K4ZA 1RV8A 3STCA 1GEQA 4XQ6A 3R12A 3ABSA 4KWWA 1VGAA 3QMRA 1DOSA 4WOZA 1JUBA 1TPB1 3W7QA 4EWND 2YFOA 3L66A 2RKXA 3EKZA 3NL2A 1QOQA 4ML9A 3NL3A 2VC6A 4PCFA 1TSIA 4UFKA 1ONRA 3M5ZA 3VNDA 4DF2A 4ZQRA 4UTWA 4JS3A 3O16A 1X6UA 4NVTA 1TRIA 3CC1A 4WY0B 3WJWA 3U6WA 1HTIA 1VHNA 4RZ6A 3GIYA 2QCMA 2GVJA 1KM5A 4NUWA 3TXVA 2QCGA 2X2GA 3UWVA 3QH2A 2CLMA 1DBTA 4AWSA
chains in the Genus database with same CATH superfamily
1OX4A 1LG1A 3V5OA 3G8RA 2AKMA 4YS1A 3ENLA 4DJEC 5IFPA 3RO8A 1ODUA 3VMPA 4M8UA 1JYWA 3TLQA 5D03A 3SIMA 1MDLA 2Y0FA 3VC6A 2V3EA 3SRFA 3R8GA 2QIWA 3WDHA 3CTTA 3GG1A 2I5QA 2C8NA 3ZMRA 5E0CA 2NVAA 3UXAA 3R8HA 3QLDA 1E1CB 1TR9A 2ZVRA 1JCYA 1OYBA 4G7EB 2VEFA 1J2BA 1X98A 5AFDA 1ADSA 4FXFA 4AY8A 1H5YA 3NXFA 4D6EA 3N3TA 4U3AA 5C0QA 3B8VA 2B7PA 1S5TA 4LUSA 4HNUA 5IFTA 1W1PA 1TVPA 1OT1A 4Y8EA 1SR0A 4HCLA 2NV2A 5FL1A 4ECLA 7CGTA 2QCCA 3T0DA 2O9RA 1RAKA 1P0DA 3OIHA 4UZUA 1TQJA 3IV8A 2J13A 3M4HA 4QHRA 4B2DA 2PWVA 1FWSA 3I6TA 4TMBA 1JGMA 3A47A 2ZX7A 4WKAA 2Q8XA 4PA8A 3S1VA 1FWNA 1J93A 1EGMA 4TX8A 1HKKA 3WLTA 1QNVA 4EPDC 3USBA 3LCXA 3O0KA 1WQ5A 5G1TA 2EJ1A 2Z1BA 4H6RA 4C1LA 2WCSA 2WNWA 4PB3A 3SQSA 2NQZA 3VKAA 3SSJA 2G95A 1J0JA 1FX6A 3MWAA 4O54A 4LOCA 2C1IA 2VC5A 4XUGA 3L0NA 1H61A 1VFSA 1AUSL 5D2WA 3UBPC 1F3WA 2VMFA 3H6OA 1GHRA 3L4TA 4UTHA 3UEQA 3PZGA 4GUJA 2JGYA 1YDNA 2W3ZA 3OA5A 3WK0A 4C1NA 1LLZA 5CBJA 4HPJA 2R82A 3HG4A 3G8EA 5A8NA 3L2IA 3MP4A 3V4BA 3Q2DA 4O1FA 2YZRA 5DBUA 3AMLA 2J78A 1S5MA 4JCMA 2DORA 2X1RA 4Q8QA 3R8RA 5EMYA 1FWEC 1NWTA 1WZMA 2DV0A 3ITLA 1E71M 1BWVA 3PPCA 3EMZA 1UJQA 4JX6A 3ZO9A 2QAPA 4QJ5B 5KZDA 3F2CA 2ZQ0A 4O11A 5C9XA 4LPCA 3SRHA 1XGEA 4GMEA 1GVOA 1ZRQA 4S3FA 1PUDA 4FNSA 2GGEA 1VJZA 2NXIA 3GDKA 5K4XA 1THFD 4YVPA 4YNGA 2DH3A 4BEUA 4DXKA 5LA1A 2HPMA 4Q32A 4XK2A 3NQEA 2Z27A 3NQAA 1R3RA 2J9XA 3OO2A 4GUHA 4S3DA 3ALGA 2EPOA 1G1YA 4FXSA 1JDEA 3W3OA 4IPIA 3LHUA 2P5NA 3LERA 3DENA 4JTFA 1K9DA 2VVSA 4B5TA 2J7DA 3L23A 2ATSA 1XIHA 3IVTA 1FDJA 4OZOA 2R1MA 1XJBA 5I79A 2ZTKA 1PX8A 4H2HA 3IIPA 2HE5A 1RA0A 3H12A 1EX5A 4C6QA 1G94A 4FXRA 4KS0A 3E0WA 1GCYA 2CFFA 2XFFA 1ZPTA 4AZGA 3CQKA 3ISIX 1UWRA 3VD9A 4RR4A 1UQYA 1ICSA 3GYCA 4GNJA 1NELA 2HDJA 4NZ4A 2VNCA 5DT5A 5I00A 4UFMA 5CPTA 3VUPA 5GVJA 3RCMA 2ACSA 4NY2A 3LMYA 4QAWA 1VR6A 2Q8ZA 3CHVA 5CJ5A 2PCQA 4JCLA 3RFAA 1LP6A 2QDGA 1Q2SA 1XGDA 1O5KA 4I7UA 2NQLA 4PMVA 4NNAA 1YBQA 4V33A 2NUYA 1GQNA 4EANA 1QCWA 5CAKA 3WLJA 1PKLA 2GGIA 5CGTA 3EBVA 3RYSA 1ZZMA 3R89A 2FHFA 3MB9A 5HPOA 4MAZA 4LUJA 2YW3A 4KFNA 5I23A 4Q4OA 1C9DA 3AIBA 1XYLA 3DCPA 1UW9A 2AAMA 5G4WA 2WQDA 2OOFA 1K8YA 3GO2A 1B3ZA 3IJIA 4LB3A 1V93A 3UXIA 4XISA 1J6OA 1OWQA 2P10A 4MB1A 4C6LA 4OKDA 3M0LA 4CVUA 5CPNA 4M81A 3PB0A 4BQ3A 1HJQA 2QCHA 3ARYA 1LWHA 1PJ9A 1YPXA 3PWAA 2UV8G 1QPKA 3NPUA 5I78A 2PDNA 4H3DA 1G67A 2VEPA 3NZ1A 4W84A 1VLWA 4QJ1A 1M53A 2Y5EA 1J5SA 4HNCA 4QJ3B 4GXPA 3AIRA 4O10A 3S6DA 3FJNA 1JPKA 2Y62A 5K9DA 1EEPA 2PDUA 3TK7A 3S9YA 1M03A 1VHCA 3CAKA 4OHQA 1UR1A 5FCZA 1LOQA 2D0HA 2Y7FA 3S2NA 4PMQA 4FLOA 4DJFA 1QPNA 4O53A 3VDCA 5KEZA 3W85A 2ZCGA 3NA8A 1JGIA 4WDXA 3EX2A 5D32A 2Y89A 4AC7C 1KFBA 4D71A 3EX3A 4R5EA 2A6NA 1DXEA 1KTNA 1V6VA 3THAA 1RALA 4JZ5A 2NV1A 1EO7A 4XTDA 1EJVC 2CBUA 4ZTXA 3MJYA 1OG6A 2BOEX 5AYZA 4E2VA 1VCGA 3QTGA 1F4HA 2WJFA 3CHEA 3STEA 1B3WA 2OWXA 1MDRA 5F4WA 1AW2A 4Y6GA 3HU7A 1R9ZA 1B3OA 1BRLB 3W1NA 1P0KA 1Q85A 3ZOAA 2A7NA 1OGGA 3WQPA 2D3LA 3DUGA 4N9CA 2YCKX 1ONEA 3SN4A 4E2OA 1PV8A 2PUZA 1ZGDA 3GC4A 3A4WA 5KSWA 3GVQA 4FEZA 4P2VA 2OYKA 1Z89A 2XDFA 4IJRA 4DELA 5BWAA 4JNMA 3NPWA 4XD3A 2W66A 1QTWA 3WD0A 4TQTA 3MCNA 1DJHA 4AXNA 4CNNA 3R43A 3M6DA 3GDBA 2Z7GA 2E9BA 4OIFA 4K8EA 4X0VA 2EKCA 3TIMA 3T7VA 1VFUA 2YKKA 2PDGA 4D1JA 3PTKA 4JXCA 1CWYA 1P6WA 2ZUVA 5LNSA 1VEPA 4NI3A 1OZQA 3GG7A 1TTQA 5I0DA 3WD2A 5CZJA 5I77A 1VH7A 5LA0A 3LRLA 2J7CA 4L6OA 1NU5A 2ZXBA 4BJHA 4MVAA 3S5ZA 3UNDA 3TH6A 1SFJA 4MZ1A 3GD6A 1UWQA 1VF8A 3B8SA 3CHCA 5LIKX 5TIMA 4UQEA 1J18A 4M0XA 3RG6A 1CXEA 4HPGA 1FY6A 1WE5A 1F07A 3VILA 4ALDA 1EEXA 1HW6A 5DRIA 4O1BA 2BWGA 3HG3A 3LM7A 4M6PA 3TYUA 4OBRA 3P8JA 1W9UA 5HUOA 3NZRA 4Z2HA 2Y5JA 3PPGA 1FHVA 1SW3A 2J24A 1KM1A 1QUMA 4WGHA 5EA9A 4L9XA 3EDJA 3NYDA 5D2XA 4E5TA 4QRNA 4KCWA 3PUGA 2ZX8A 1V02A 4WSKA 1VFTA 5FD0A 2Z6JA 3M0MA 4A6GA 3VIMA 4UTLA 1TWIA 4X0NA 1UD4A 4JNYA 5DXXA 4RNIA 3UCCA 1NIUA 7REQB 4DJED 2RDUA 1ODZA 1TX0A 5AHFA 1K7EA 4KCTA 2VUYA 2DPEA 4GYFA 7ODCA 2ACQA 2HS6A 1OG0A 3LCWA 4L9YA 3T40A 5A2AA 3PBVA 5LGXA 1DJYA 1G5AA 4OQVA 1YE4A 3GYEA 4NAFB 3W7GA 3RM9A 3GFXA 2OJPA 2O92A 4MKVA 4AZIA 1Z9AA 3PPFA 2BVWA 4XKYB 1RXOB 2D2JA 4NJGA 3LXAA 1CIUA 2B7NA 3W2MA 1X7FA 4M80A 2WV8A 2OZTA 1JQVA 5BYWA 2D20A 4D6JA 4M6UA 2NZLA 5TAOA 1SGJA 1DTUA 3KBNA 4W7UA 3AS3A 3TONA 3UNTA 3EDFA 4AC1X 3NQGA 2YB4A 4JHOA 4CEXC 1HX0A 1JNDA 5G1YA 3ARSA 3B06A 1VBJA 1KRBC 2PGEA 1MXSA 4DHGA 1SO3A 4UTUA 2ZADA 4X61A 3EDKA 3DHPA 5I3IA 4NNCA 3RPDA 5H8MA 3FXGA 1OVDA 3V16A 2ZTJA 4A3UA 2ZA3A 5CPQA 4B5NA 4L4LA 1OK6A 2WBKA 1I2QA 3KBJA 3M07A 4RZ4A 3O63A 3BJFA 1ZAHA 3GXTA 3VGGA 2FKPA 3E5BA 3MW7A 1Z32X 3CMGA 4ZEPA 3SCSA 2XH7A 2O9OA 3BG5A 1QW7A 4FNUA 3AHXA 5FSDC 3RU8X 1WZKA 2CBVA 5T26A 4E4PA 5BNKA 1VFLA 3GAYA 1J5TA 4AIUA 3UJEA 4I9TA 2ZUSA 1ISVA 1S1RA 4L1GA 4A8IA 3CZKA 1IT0A 3QV8A 2RJGA 3WZ0E 2A1YA 1GOXA 1RD5A 4DXVA 4AEFA 2Z24A 1FVPA 3QYQA 2EGZA 4BI5A 4J3XA 1MNSA 1PS9A 4K39A 3FGCA 1KGXA 3ABRA 2QDEA 2P0OA 3LHTA 2EHHA 3C2OA 3DKJA 2RAGA 1GNXA 1UWUA 1S3HA 2FPYA 1G7VA 3N1AA 4UTWC 1JD7A 3L4VA 1K70A 2D22A 1EZWA 2TPSA 4P61A 1C9WA 1CXKA 3AUJA 3ATYA 4U33A 5EFFA 1W9PA 1V08A 1SPQA 2YLLA 1PZ2A 5D33A 1RK5A 3VAVA 1TELA 3P14A 5FF4A 1S2CA 5D30A 3VNLA 5C2GA 5HNNA 1M7OA 1GKPA 1US2A 4HCDA 3SADA 1FWWA 3N18A 5A6AA 4H6KA 4CN1A 2G96A 4NRSA 3HPSA 1F05A 4ZSTA 4HJFA 4MUZA 2JIEA 2PGRA 1NY1A 4QAIA 2E28A 4J28A 4LAOA 2ZX5A 3W7PA 3QR3A 2X0HA 1A3WA 2W27A 5HINA 4JKLA 1V3KA 5BWFA 1JAKA 1D9EA 4ZE4A 4IUGA 2REQA 3WJXA 4Z1YA 4W4QA 5FJIA 2D2OA 5GJPA 2QCLA 4B2DD 2OGYA 4DVOA 5A2CA 1YDVA 1FDZA 1OC7A 2VUNA 4PMZA 2DZSA 1GGOA 3WLMA 1XLCA 4R9OA 2D0GA 5DO8A 2PDLA 2V9DA 4WLCA 5FEPA 1XLMA 2FDMA 3SRDA 3O6YX 1RBLA 4DBUA 1C8YA 3TC7A 5G4HC 4IP5A 4RZBA 4DPQA 3O9NA 5BRQA 5RUBA 3MUZ1 1CX9A 3S1XA 1SZNA 4CQ8A 2WK2A 1FHUA 1QI4A 5G2HA 3NQ6A 4JDBA 3PNUA 5KTLA 3UQNA 3KWXA 3C4UA 4NJJA 1OD8A 1K6WA 4WJ8A 3C2FA 5IRPA 1H11A 3CHFA 4OV4A 1E6SM 4BF9A 1E51A 3U2ZA 3DGRA 3F4DA 2QGHA 3IJLA 3M47A 2QLYA 5FJRA 2X1TA 3M7SA 4XAFA 3EA3A 4PL2A 1HF6A 4HSNA 1V3JA 2V3GA 2YPIA 1CB2A 2PC8A 3G18A 4H01A 1E6XM 1HJUA 4AMAA 1H0IA 3ARXA 3CQJA 3NL5A 4C6BA 2I9UA 3CAWA 2J8GA 3KOXA 4WCJA 3UJRA 3PM6A 3EOSA 1UPMB 2FH8A 4ZSUA 1QHOA 3R7MA 1PZ1A 5DN1A 3VIJA 3W23A 2E6YA 3S2JA 3W1TA 3N4EA 1QK2A 3A23A 2H3DA 2QDHA 1V8EA 4G1NA 2HNHA 1PE1A 3LYEA 1MVYA 3C5QA 3SEPA 1RQEA 2WWDA 4X22A 1PX4A 4GINA 1R2TA 4W87A 5L9FA 4PMRA 1RJQA 4Y9AA 2DSVA 4NZ3A 2Y2WA 1VENA 1GW1A 1WX0A 3IAPA 4B3KA 2Q8LA 4GPNA 5BW6A 1JF6A 4P8UA 1DJZA 2JGQA 4AIEA 4BK9A 4ZFMA 3D47A 2O4QA 3LHVA 4YPJA 1W37A 2ZDRA 4NYYA 4S2CA 3W29A 4GXWA 3F2DA 3EB4A 1JDFA 3VE7A 5EKYA 1U5HA 3ABQA 4S3GA 4RXGA 1BG4A 2A6LA 1E15A 1FP8A 3GHRA 3GFZA 2DZPA 3FV9A 2WM1A 1YNQA 4WOQA 1UB3A 2ZZ5A 4CD8A 3ONBA 1A5MC 3L21A 4REQB 2WB5A 2WOQA 5CBIA 1DEDA 5C2XA 2BDQA 1W1VA 4NJIA 1U5VA 3NVDA 1UD2A 2DP3A 4I7WA 2O7SA 1QXLA 2WJEA 3WCZA 3UFYA 4JTJA 2IKGA 3GDMA 1XYCA 4BI6A 1B3VA 3CIXA 2C7FA 4ADUA 4LF2A 3SQMA 3EZ4A 1VAHA 1KV8A 3EGJA 3BVJA 3WN6A 5CLTA 3V35A 1YYAA 2ZRUA 1FHLA 2H3BA 5I3HA 3MV01 2WM0A 4C90A 3GXIA 3EXSA 4O4VA 3CUXA 1KRMA 4CU8A 1XG3A 3FYYA 5A94A 3HA1A 4LSBA 5MKGB 3KFTA 2GJXA 1RP9A 4FALA 1XLGA 2OCZA 2QCEA 3K4AA 3VCCA 4B92A 2CWNA 2XIBA 5AHLA 1Q13A 3NSNA 4PRTA 3PJXA 1FWTA 3TAOA 2BXZA 2DSUA 4UMAA 2PI6A 1LG2A 5F1UA 3ZR5A 1A0DA 3LN3A 5I03A 5FIPA 2W61A 3E2QA 2PZNA 3O15A 1DHKA 3TYCA 3QY8A 3S8HA 1YNPA 4JFVA 4DM1A 4DJEA 4CKQA 3TNBA 4YHGA 4LU0A 2VWSA 1UUMA 4Z1BA 5BXPA 4HJWA 3M46A 2CHNA 1G4SA 1OGBA 3W2UA 2X1IA 1CNVA 4A35A 4LY4A 4W89A 4HK6A 3T78A 1SO6A 1LBFA 5ENLA 3W00A 3G1HA 3BSGA 5HXMA 2FZBA 3PZOA 4KCVA 3I4KA 1L6WA 1QI2A 2PU0A 4L1XA 2FPTA 4BA0A 4MNJA 2OT0A 3G5EA 4RXFA 3ZVHA 1JZ7A 3W38A 3NAVA 1XD1A 3ALFA 3IRSA 4LCQA 2YB1A 4MYXA 4ZENA 2PLJA 3NEVA 3VABA 2XGIA 4W9TA 3TC3A 1EH9A 1AG1O 2C16A 2PFHA 4PH6A 3K13A 4GNVA 3WBWA 2VX7A 1J01A 3KWSA 1ZL1A 4H83A 2A3HA 4IQLA 4IFRA 2YXXA 3QF0A 3DU0A 2DZWA 1DV7A 2FIQA 3I6RA 2AMXA 3VC5A 4DIAA 1W8GA 4V1XA 2HS8A 2BG5A 2GFTA 4LF1A 5G5IA 3NQMA 4GIRA 1W0MA 1QNOA 2XVPA 3MUXA 3V1HA 4LYQA 3TUUA 3PTDA 4CGTA 2QCNA 1JDDA 3W83A 4DNMA 1WXJA 4XV0A 4LYKA 4IIDA 1O95A 4Q6XA 3BLPX 4IUOA 5I3DA 1KA9F 2XM1A 3B97A 4QLJA 2PDWA 1EB3A 1Q7QA 2CKRA 1AH0A 4D8LA 3VM7A 1XLAA 4NQ1A 4PUJA 2VJXA 4R7OA 5K9CA 1JPHA 2YBVA 4Y96A 2OLHA 2R1KA 1DJWA 3WENA 3B4YA 3QFEA 3TEVA 1NOWA 4AF0A 1XIFA 5AC8A 4KH2A 4NNBA 2EG8A 3LX9A 4K7VA 1OIFA 1PWLA 1HQTA 3W70A 1F3TA 3R5EA 3MCMA 2PWDA 2ZRVA 1D3CA 3PTMA 2CLKA 4EPBC 1S3TC 3RO6A 1T6MA 3W9ZA 1L6GA 1BSLA 2OX4A 2J79A 2DIEA 3AS2A 3MPGA 5F2MA 1MQRA 3CBWA 3KCLA 2E7FA 3MZNA 1ZHAA 1TJ0A 3DERA 2A79A 4GLEA 1TUXA 4JIQA 1ME9A 2BXYA 2ISWA 2CETA 3IJQA 2B0MA 5JBEA 2FZNA 4FX8A 4RDYA 3VIHA 4S3CA 3C0QA 3O6CA 4PBEA 3TZNA 1R46A 2YGYA 1EXBA 1XLJA 2H6RA 2ON3A 1QATA 4AYGA 3S2MA 3W2JA 1I4NA 1OFPA 3RMJA 3W88A 5M1TA 3OGVA 1V7AA 1D7FA 2QJNA 2Z26A 3N13A 4B9YA 3UZWA 4HMEA 3LQLA 3FHQA 2D3NA 1K9TA 3NOEA 2ISVA 4JGDA 4C91A 1NWSA 4UQAA 1ZQ5A 2DSKA 1N8FA 4M6VA 4JL1A 3LNPA 2XSBA 2BY3A 4UFLA 3V0TA 3DYMA 3TW7A 1ZU8A 4H9ZA 4O28A 1QT1A 3O2LA 4ZOCA 2OSXA 1WDRA 1HGWA 3QTPA 1H7XA 1NJJA 3TNOA 3AXXA 4QTGA 4AUBA 2PF0A 3C0SA 2OFJA 3IK2A 1CBGA 4Z2JA 2WNZA 1WDWA 2YCIX 2G50A 3T1GA 2YL5A 2P3ZA 2O56A 1JZ2A 3VNMA 3GG8A 3BOLA 4PCSA 3BPWA 2VZSA 4NX0A 1UP3A 1EWDA 9XIMA 1YPIA 4B4FA 1ITCA 2PDFA 3C61A 3BOXA 4XKYA 1YTDA 2VI0A 1A5BA 4HU3A 1EOKA 4QCFA 4AVNA 2FGBA 4D72A 3BV4A 4DWDA 4QFUA 1JI1A 1DE5A 3CYVA 1SJCA 5CJMA 4IICA 2EO7A 3UWWA 1B57A 1QNPA 3CMJA 3HPAA 4GQBA 2P3EA 3ZIZA 1XC6A 3HQPA 3W26A 1BD0A 3LCIA 3CUHA 3CV7A 2IMRA 3H4WA 4DPPA 3S2LA 1RUSA 4JQ2A 4GGBA 3AMDA 1LBLA 2PDBA 4OBSA 1E43A 2CWXA 1GUVA 3P62A 5EMMA 1W6TA 2A21A 2YYUA 2I17A 5REQA 2A7RA 4HZ6A 2GQ3A 3NQVA 4ZGYA 3E49A 2XN2A 2XIIA 3AZTA 4H9YA 4RNHA 2GDUA 3PF3A 3VGHA 1EWEA 1KNWA 2Y85A 1XBZA 4IGMA 2G8ZA 4HYVA 2E5CA 1LT7A 4C6EA 1YMYA 3L5LA 4M3PA 4DI9A 4O57A 4PUEA 5BMXA 2PB1A 4RCXA 1REQA 3SY1A 1M3UA 4S2BA 4X63A 1E1FA 4U2ZA 4F0KA 4AD0A 2OO0A 3DG7A 2B7OA 5HUPA 3HPXA 3T4CA 1L0PA 1VFFA 4K3ZA 3MJMA 3L12A 3E74A 6XIMA 3VVGA 1GOQA 2GDVA 3MZ2A 3N2OA 1OHLA 2EPMX 1MYRA 2C14A 3WQGA 4MSSA 3U2EA 1ZB5A 1FCUA 3BLLA 1EOMA 2VZOA 1KXQA 4C6MA 3MUAA 1XWYA 2QEZA 2VYOA 4EP8C 4G2DA 1AMYA 4LRTA 1JQXA 3MVIA 2WVUA 4HMCA 2WZMA 3SRKA 1FP9A 4ACZA 2Z29A 3F7JA 3H53A 1K03A 1C7SA 1VBRA 3VZXA 3R0KA 2FVLA 4GI9A 4I9JA 4QQ3A 4YTQA 3SCTA 1N8WA 4AVFA 4CNTA 1NH6A 2Y8VA 1CW2A 1DXFA 4F66A 3ZSSA 3W7CA 5F1VA 3WNNA 3S1WA 2WAGA 3SR7A 3DFPA 1TZZA 2DVUA 3WL1A 4L80A 2V5CA 4DUOA 1MI3A 3W28A 1BVNP 2RH9A 3R10A 3T0TA 1EF3A 4UQCA 3E38A 1JCNA 5CJNA 1E5JA 2CPUA 4XVDA 2ZZ7A 3AIVA 3W7HA 5GPRA 3PP7A 3D5HA 4ZVJA 1AVAA 3W7IA 4PSPA 3TYAA 2FZ9A 1DWHM 3WLOA 1RCOB 2DEPA 2YCEA 1G9HA 3RX4A 3JZEA 2YR1A 2NWRA 5CQ1A 4W8AA 2C1HA 3N4FA 2X8RA 1VC4A 3HN3A 3U5YA 1P6BA 2C15A 3IGXA 1XH1A 4H6QA 3G6LA 3TA6A 1OZMA 2HRWA 4P5UA 4AZHA 2JE8A 1A3XA 1O60A 4FR1A 5HJYA 1RLCL 3CS2A 4MYAA 4O1EA 1AL7A 4E3VA 4HNTA 3W86A 4HZ8A 4IMEA 1F2JA 4BWLC 4GBDA 4KRZA 1KLYA 1YDOA 2E25A 3N12A 1RCXB 4C60A 3UXKA 1F76A 2Y8UA 4K8GA 4UNIA 2FGLA 3LV5A 5HR6A 3CAVA 2NWSA 4CCCA 1Y8BA 4FAMA 1RV8A 1GEQA 6PTDA 4KWWA 4WOZA 1VGAA 3QMRA 3VOIA 1UD3A 1KD0A 1K6AA 5ECUA 1H09A 4DF2A 4U10A 2ZOXA 1P6CA 3TTOA 3O16A 1NFPA 1EPVA 3ARWA 6A3HA 3CC1A 1IQ8A 3U6WA 2YZ5A 1K77A 3GIYA 2QCMA 1KM5A 3MSGA 1AA1B 8RUCA 3JVAA 1CPUA 2X2GA 3QH2A 1ZJAA 1DBTA 3A64A 1Y5VA 2HNEA 2NXGA 4QP0A 1K4HA 1S39A 1J0KA 2XFRA 1VJIA 3QPYA 4WVXA 1BAGA 4GG9A 4DUWA 1JIBA 1JFXA 4O12A 3VPLA 4KWVA 3LCLA 1FBAA 4JX5A 3MY9A 3R11A 1H7OA 1UKPA 3D46A 3CB8A 2Y1HA 2J75A 4DO6A 2Y4SA 3S6OA 4K2SA 1PKYA 1AQFA 2BGSA 3GXPA 2PBOA 2FTPA 1DWAM 2G4JA 1M1BA 1KFCA 4ZZ9A 1UA7A 1KM2A 3EOEA 3VDBA 1XDLA 2NT1A 2F8QA 3HOJA 3WK2A 2INFA 1AH3A 2VVNA 2VFDA 1D3HA 1ICPA 3UETA 2P76A 5IOBA 1CGWA 1GEHA 2JBMA 3UR8A 2V68A 3BLDA 2CZ5A 3GKFA 5KMYA 1XW8A 3OGRA 2Q6ZA 2WHMA 1H1NA 3H2NA 1TWZA 1UROA 3FW6A 3V75A 4B5UA 4H04A 2ACRA 3SECA 4DJDA 3GRIA 3DAQA 2ZUUA 2PBGA 3HGJA 1IWBA 1LQ2A 1BXNA 3CJPA 2ANUA 4LAZA 5FF0A 4DJFD 4UCGA 5E6ZA 2DW7A 1GOMA 6TAAA 3F5LA 2E3ZA 3ORWA 3WF1A 4EX4A 5EMKA 1FFRA 5AYBA 4DBWA 3G22A 3CLMA 4NILA 1VZWA 4JIHA 1UYQA 4IFOA 3W6MA 1JAEA 1V3LA 4PTNA 2XH2A 2Y7EA 4G6CA 4I8YA 4J2PA 4CNUA 1E1CA 1E4IA 4G7EA 3NCOA 4M29A 3M5XA 4HOXA 2R9RA 4ZB2A 3P61A 3KRSA 2R14A 3GXMA 4US5D 3ARVA 3PS7A 5IDIA 4DO5A 2B7QA 2V69A 1QHZA 4ZQNA 3GTXA 4A3QA 4GJJA 4HHMA 3TFXA 5LXEA 1ZJIA 1IXQA 2X0YA 3H8AA 4X2RA 1TTPA 2IKJA 3SSZA 3N2TA 1V6UA 3UGVA 3CLWA 4XO7A 3ATZA 4XTIA 4A3YA 3MO4A 2DZXA 4K37A 3WQWA 1I2OA 1S2TA 2OWCA 4CN4A 3RGTA 3R6IA 3CUGA 2QCDA 1OQFA 5BZAA 1EX1A 2BHUA 4D6FA 3OQEA 2PCEA 3DXIA 3N34A 3KP0A 4Z1CA 4JYDA 4JIRA 3T8LA 2PDPA 4AHQA 4PMDA 5IHSA 1K02A 3O6AA 2J77A 2HXTA 1FWGC 2I7GA 2JKAA 3VD3A 5HJLA 1QK0A 2EAWA 3F4CA 4C1NB 2HK1A 1QI3A 4M5PA 3VKJA 4YN5A 3BL3A 4LVDA 1QPRA 3AIWA 3QSTA 5JBDA 3QYSA 3CZJA 4BFAA 2QT3A 3DG6A 3MKCA 4YJ5A 3H2MA 1W1TA 3IJ7A 1CZ1A 4DWSC 4DN1A 3PVFA 3HTWA 4PMXA 1DIOA 4LVFA 3T2QA 1QHPA 2VL4A 3H70A 1NAL1 1SJDA 1MXDA 3AC0A 1P1MA 4C6OA 3P6LA 2I14A 1E6PA 3E9AA 5LNRA 3BMVA 2V67A 3TP4A 1TA3B 3O07A 3UZZA 3GX9A 5HNUA 3EWCA 5DMMA 3S2CA 1P7TA 2PEVA 1ZP3A 1X7IA 1K1DA 3JR2A 3I6EA 1GJWA 4MY1A 5AC7A 1W56A 4BWLA 4EF9A 3FJ6A 4YIWA 2Z00A 2TAAA 3WH8A 2WANA 1BHGA 4DO7A 5CZKA 1CDGA 2DUZA 4I9AA 3WH5A 1FDYA 4XAZA 1RSCA 3VOGA 3WUBA 2FVKA 5FJPA 3KTCA 1EJRC 4FR6A 4O19A 2VEIA 1B9BA 1EYEA 1I2RA 1Z69A 1JXKA 1QI0A 5B7YA 3H23A 3FHAA 3MBFA 1XHGA 1VBHA 5FJUA 1N55A 1GYLA 1AL8A 2Y7GA 2XVLA 1HL9A 1VYSX 1BYDA 1EHNA 3T09A 5D2TA 1IV8A 3CWOX 1KRCC 4PEKA 1JVNA 3POCA 3IVSA 3LI0A 1XIGA 1C29A 1X1NA 3QGAC 3PY2A 3CTLA 1XCXA 1GPFA 2J4GA 2C1GA 1UOKA 3HO8A 4FMVA 3Q37A 4IJCA 4J1OA 4J3ZA 5T9CE 3LRKA 4QROA 4GXMA 3AI0A 3V0SA 3SURA 4BS0A 1HUVA 4UQBA 3PAJA 2V82A 5IBXA 1EKOA 4IP4A 1DJNA 1HJVA 2AL2A 1LTDA 2GLKA 4TX6A 4ZOAA 1E3XA 2CXEA 3QKZA 2CYGA 2QGYA 4GI8A 2XVKA 1XLEA 1TJPA 4JKMA 3SUTA 2WC7A 4EXAA 4I3GA 1QDSA 1LCOA 1MWOA 1VB9A 3GQYA 3WQDA 3M0ZA 3KS5A 1O1HA 4XZMX 1QOPA 3BICA 3CT2A 1QU4A 2GOKA 4B91A 4IG2A 1GVFA 2QUVA 3IRDA 3LHWA 5GJMA 2E1DA 2QJGA 1OABA 1SVDA 5AC4A 3M0XA 3H26A 3L4WA 1WOBA 1V79A 3LG3A 3KE0A 4NZ1A 2DSWA 3B9DA 1EF2A 3STPA 1J2WA 2AMGA 1CT5A 1LZOA 4KEZA 2VDHA 3NDZA 1B30A 1XISA 3H21A 4MTVA 3AYRA 3QSRA 2HVNA 1BTMA 2V2CA 1C8VA 3ITYA 3TSDA 1HT6A 4OJYA 6XIAA 4UWMA 2YOCA 1UH4A 2YBUA 3DC8A 1WNOA 3T0CA 4HHPA 2WZTA 1CLKA 4B15A 3UG3A 4CUCA 4ZO7A 3FEMA 4JNZA 3SUSA 3WJYA 1KTCA 3GNXA 1NF0A 3WYZA 3SO7A 3BG3A 2JKPA 3BLKA 3ZFHA 1XIIA 3PBYA 4EIVA 2WMJA 1Y5XA 2WC4A 5U7SA 4ML4A 1GOWA 3MI6A 1X1ZA 1LORA 1S2VA 2NX3A 4NXSA 4JTGA 4GIEA 4KFPA 2MANA 3DFOA 5EMUA 2XSXA 1DWFM 3UR5A 4HP5A 1IIHA 4ZODA 4GI4A 3IJ8A 1KGWA 5HA7A 4M1RA 4MJZA 4D6DA 1V6TA 4G9PA 2VURA 3B8TA 4ADTA 4RE3A 1A5KC 3R25A 4LNYA 3HGSA 4LQ1A 4Q4SA 2PLMA 1EJXC 2QIIA 4DLMA 3U7BA 3ANUA 2EPNA 1L8NA 1RK6A 3N2MA 1H7NA 1CLVA 4J2MA 4RX0A 3WIJA 3ZT5A 3VIFA 5BOOA 4KFOA 1LQ0A 2G3JA 4A22A 3U57A 1SFSA 3U9IA 2RJHA 4O8AA 3UGRA 4HT3A 1B54A 3TZFA 4AX7A 1VIZA 4J3SA 3CL6A 1FKXA 2GSHA 1RPXA 1EBHA 2Q02A 1YX1A 3BH4A 5DF0A 3EX6A 3VZYA 3E0IA 2PDHA 3TR9A 4GKLA 4JFWA 2ZKMX 3NWRA 4BF5A 5EYWA 2BOFX 1KM6A 4HHLA 3NVTA 3WNKA 3QW4B 2XIMA 1UWIA 4PEEA 1GQJA 3QKEA 5U4NA 1XDJA 3RJXA 1SW0A 5A6JA 4BCEA 4XKMA 4DBEA 3Q4DA 4NSBA 3GSMA 4JTAA 4NZFA 3SN1A 1WOAA 3B05A 3VUSA 1KXTA 5GQBA 2XGZA 2ABBA 2BS9A 2XN1A 2ZXQA 4AD2A 3LBMA 3C2RA 4FNPA 3B9AA 4EPKA 1W9BM 3O7UA 3AJXA 1DJGA 3VIOA 1R30A 3B8WA 2EPHA 4DEFA 4DWSD 1GZ1A 2DZBA 3G1VA 2GJRA 3WEOA 2INZA 3GXNA 3EWBX 1XI3A 3UA3A 4R27A 2WSYA 3W2LA 3UG4A 5PTDA 1VIWA 1A4LA 1OY0A 1EP1A 3QEZA 4WKHA 3VOFA 5K9XA 1JCXA 4ZL1A 1XYMA 3QJAA 3SCOA 3R0UA 1UR0A 4HSOA 3EWZA 3QC0A 3EWUA 4ICCX 2VGGA 4PMNA 3ECQA 2BBFA 4MKNA 4PTWA 2XTKA 3SY5A 4V15A 3RRAA 1MW2A 4EACA 1CB7B 1LRNA 3LPFA 3LS9A 4QR6A 3W24A 4J27A 4TU1A 3HMCA 4FNRA 4PBFA 5HDRA 1DHPA 4IGHA 5C70A 3P8IA 1OBAA 4X9SA 1B4KA 3GR7A 4GUIA 1H60A 3BUVA 4RDZA 1WAUA 1RBAA 1XUUA 4WJEA 3WMBA 3JW7A 3L4ZA 4NASA 2ZXDA 2E9MA 3CPGA 2ZIDA 3M5VA 3VFLA 1DL3A 3QV6A 3RCYA 2G5WA 1UWSA 1TE1A 1DIEA 3F03K 1CENA 4QIUA 3WBEA 1VEMA 4OV9A 2FFIA 4L5ZA 4CQCA 4LGXA 5E70A 3N9SA 4JX4A 2J9YA 4QE1A 3NM1A 1U2YA 3PSWA 3WDRA 4AXKA 3NIYA 4GZJA 1FCVA 3D6NA 3PUOA 3RN6A 4GC4A 1E72M 4IZGA 3F4VA 3WUFA 4KPLA 2WKJA 3TC6A 1FH7A 3MP5A 3B9EA 5LKYA 4IMAA 4L6DA 5CSSA 4IHCA 3RILA 2VOMA 3QHOA 3TJ4A 4IMCA 4DZHA 1Q63A 3W22A 2XN0A 1E6RA 2NSXA 1EDQA 4QISA 2GJNA 1OCNA 4Q7NA 4Q6JA 4KKXA 1KBIA 3TYBA 1BLIA 2WJZA 1PKNA 4HNLA 2BTMA 2JKEA 3IS4A 3WD4A 3PULA 4H2CA 3G1DA 1OC5A 4XSMA 3G6MA 2ZYFA 3LZ5A 1FWCC 1WBHA 2YL8A 3FJLA 2J88A 2P1FA 1TA3A 4LBUA 4QBXA 4CNSA 2CLOA 3C3UA 2XFWA 2YL6A 1BYBA 4PCTA 1QW8A 1R86A 3B04A 4IPJA 1F3XA 2VOTA 3KHDA 4B3ZA 1HO1A 1LUCA 3VO0A 4B3LA 2OOGA 1RCQA 4W8BA 5I09A 4R34A 4ZQCA 3VGEA 5FEWA 3VA8A 3I3EA 4GFSA 3A9IA 3WF4A 3WUGA 2ZC1A 5KZEA 5HWNA 3HV8A 1IEVA 3WY1A 5I5RA 2XUCA 2GUUA 3W53A 3SM0A 1BGGA 3NJ3A 4Q8OA 1F73A 4YTTA 4GQQA 3KUMA 1XPYA 3VD5A 3LUTA 3DBNA 5LHFA 1KGUA 4GQ0A 4UTJA 4KQNA 3KXQA 4F3HA 3CUZA 2VRKA 1PPIA 4QG6A 2DT2A 2WLZA 3RMEA 2PDIA 1W9DM 1DJIA 3FCPA 4P8WA 4IL0A 1B4EA 4KEVA 3O3RA 4MWAD 4YXGA 1A5NC 1ZCCA 2PWFA 4UBPC 4H9MA 1UBSA 3ZQ9A 4NZ5A 3OLEA 2Z0IA 3EPMA 3EDEA 3STFA 3QM3A 1G6CA 1RQBA 4FLSA 4Z0SA 3LCFA 3GDRA 2X0SA 5T91A 4RW5A 4BI7A 1UH2A 2D24A 9RUBA 1MNZA 4NYUA 1UA3A 3GVVA 5IBXC 4GI6A 2DZTA 1TPFA 2VD9A 2WZIA 2ZZ1A 4MDOA 1SZRA 3DFNA 1FCBA 4CEUC 1XL9A 3CK5A 4HU0A 4RV3A 1NVMA 4HYRA 4YWSA 2FHCA 1XH0A 1C92A 1XXXA 2WSQA 4URIA 4H41A 4L4PA 3AICA 1S2UA 3UJFA 4NJKA 3MUY1 4Y8FA 2F9RA 2GUBA 3TN3A 1A5AA 5EFDA 1W1ZA 3MMDA 1CCWB 4BQ5A 3ME3A 4MNMA 1LROA 3URBA 1DQWA 1I9CB 3L0KA 4I5UA 4HN4A 3N29A 4UTIA 1OCJA 2VM8A 5HATA 1R85A 3UJSA 1R7AA 3HURA 1XP3A 2AGKA 5L6UA 1H1ZA 3BZGA 4F0RA 3CMFA 4Q4RA 2VP8A 3N19B 1XLKA 1NDVA 4KIRA 4J35A 1JXJA 4D2JA 4FI4A 1UP0A 4JBRA 4O13A 5I24A 3WMCA 2X40A 4WZHA 1E4LA 1F74A 3U0HA 2Y7DA 3B8UA 2W5FA 2VFEA 3EYPA 5FF2A 4DF0A 4S39A 5FL0A 5DY3A 5D8ZA 1R3SA 2ZXAA 2DT0A 3WLQA 3R58A 4AZCA 3GUWA 4A4AA 4RDWA 4NL1A 5E1QA 2GK1A 4WY0A 1P0NA 1XQKA 3LBCA 1UH3A 4TIMA 3BQ6A 3GS6A 3R79A 2RDWA 2V5JA 1CGTA 4ZE5A 2QZRA 4RPPA 3REQA 4A8NA 4MY8A 3EX4A 3KVMA 1UR3M 3DG3A 2Q01A 1QNRA 1QAPA 5K3VA 5D05A 2HJPA 2ZUTA 4AZ6A 3E6EA 1ZBWA 5H91A 3UG5A 3NGFA 4DUVA 4X60A 1FWHC 4LV4A 5LYRA 4L65A 3UVIA 2XZ7A 1LL6A 5CC5A 3P5YA 2YSWA 2V38A 2EEXA 4U3CA 1KBKA 2BASA 4RKAA 4IFKA 3C0JA 1ZJBA 4PB5A 1SSDA 3ARQA 1E6NA 5HQLA 4PZVA 4NJHA 1L2QA 1K7XA 2VEMA 4K6AA 3CGTA 3ZS4A 4EE9A 3EX1A 3BV7A 4AHOA 2XH4A 1MQPA 4GE8A 2PS2A 1XIDA 1L8PA 3G1FA 1SW7A 3NM3A 3MA8A 4NZCA 3H7UA 3FIGA 2WPGA 3LCGA 3MS8A 3HMJG 1A5OC 3DKLA 5EU9A 3TXZA 2OELA 2PRMA 2QULA 2C13A 4HKPA 3QXBA 4IXXA 1OT2A 4Y9PA 3WQ4A 4AFYA 3ELFA 3A4AA 4JEJA 1FXQA 4IT1A 1Y5WA 2XHYA 1EIXA 3M44A 2JFEX 5BXSA 3M64A 1VQTA 3PZMA 1WKYA 4Q8TA 1E0XA 4HQVA 2Q3OA 1RD6A 2QJIA 2A0NA 3TVAA 1YTEA 2Z25A 5J5DA 1YBQB 2CU0A 2OSYA 3MU7A 4FLQA 2GYIA 4Y9OA 1ECEA 3WNLA 1GOIA 3CH9A 4W93A 1K4GA 3SCRA 3A3HA 3E96A 3DC0A 3BJTA 1Q66A 5ABFA 1ESWA 4GC3A 3EAUA 2AQOA 2BP1A 2OWWA 2I16A 1PTDA 3B9NA 4FX7A 4PUMA 4PULA 3BW2A 1UKOA 1E56A 3AYTA 3U2OA 3UCDA 5HQEA 3UVAA 4K7YA 1U5JA 1XCFA 1OF6A 2C6QA 3L4UA 3LEPA 3HFYA 2HPIA 2YDRA 2YFNA 1XUZA 2OZ3A 4YCPA 3TJLA 1ZUAX 4H9UA 3CL8A 3I4EA 2Z28A 4QSHA 4ZQOA 3G1SA 4UTFA 5FA5A 3N4AA 2ATMA 4GD0A 2D0FA 4QS6A 5CSUA 1U1HA 3AJ7A 2VR2A 4UXDA 3UWZA 4LJ3A 4DX3A 1R3QA 3L2LA 4MIMA 3GU1A 4TO8A 1P0EA 4FIQA 3SCVA 1UUQA 3WNOA 3WSUA 2CHRA 3B0XA 3PBGA 5J8LA 2ZRXA 2CNCA 1F3EA 4IMDA 1XLLA 2OPJA 3PZNA 4KF1A 3ABZA 3D0CA 1GHSA 3SW6A 3WH9A 2O9PA 4Q33A 1JUKA 1R9XA 4GO9A 4FK9A 1X96A 3P5ZA 1RH9A 3PHAA 2VGBA 3P74A 4XAPA 3N14A 1KQZA 4LYPA 4Q8PA 4DJDC 2JF7A 2VDGA 3KDNA 5I06A 3RRXA 2R94A 1EZ2A 1BYCA 4HNOA 2XVGA 4ROQA 3WNPA 4C7DA 3E2VA 3UWEA 1R7OA 4MHBA 1L6YA 4EWJA 1KV5A 2ZWZA 3EMCA 1HNYA 4DM2A 4OT7A 5DELA 1QOXA 5CG7A 1JRCA 3CQHA 2QUMA 1QI5A 5C8BB 1GJPA 4FP1A 3PSVA 5JH2A 1W3KA 2BY2A 3VCNA 2CERA 3QVQA 1VYRA 1PDYA 2QDDA 2QJJA 1NWRA 4A2RA 3NGJA 4WXZA 2PWHA 4OUEA 3GB6A 2PMQA 1S5VA 4DBSA 3A22A 4YVVA 4PE8A 1LWJA 1TFVA 4H9TA 2XFYA 3TW6A 1VS1A 1OEPA 2YLAA 3AXHA 2WW5A 4N42A 4WEVX 1EQCA 2QMKA 2BY0A 4ZXOA 2GUYA 1UZ4A 1I6NA 1HVXA 1L2UA 4E4UA 2CLHA 1IXOA 3WLNA 5JBFA 4O0KA 1I0DA 2YXGA 2JEPA 2J74A 1JPIA 2J25A 5CXPA 1HP4A 1IEWA 1XLBA 3VIKA 3A21A 2CXGA 1LUCB 5EPDA 2IPWA 2QQ6A 3WO8A 5HNTA 3FYOA 1QRQA 2CESA 1J0ZA 1H4PA 3Q67A 1XM3A 2Y8KA 4OTKA 4BQ2A 1NTHA 1E0VA 5LIWX 1BPLB 1UG6A 2VX6A 1NOUA 3GG0A 4JQAA 4DI8A 3W0KA 2GGJA 3KOWA 4KEUA 3OQ8A 1J0IA 2R1PA 1Q6RA 3VINA 3ARTA 3SY8A 4R85A 4LC8A 2Z1SA 1EHAA 4MDPA 4RJEA 3M16A 3VE9A 1NWUA 4GIAA 5I3KA 2X42A 4QCEA 5FESA 2WQPA 4QNWA 4H8HA 1ZLPA 1BVZA 1RA5A 3VMNA 2QVNA 2ABAA 1EIBA 4F48A 2OSWA 4DZAA 4L4MA 4CCEA 1TWSA 2ACUA 1W9VA 3OZMA 3VDHA 3MHUA 1TQXA 3ZLGA 2ZRWA 2VT0A 4FA3A 3VOCA 3TA9A 2FMOA 4PMUA 3APYA 1TTJA 3DOPA 3P2VA 3HF3A 2FH6A 1GQKA 1V3MA 4YHEA 3P67A 2G0WA 1H7WA 3OLDA 3AALA 3QLLA 4UB9A 3I10A 4F0LA 1NDZA 4DYJA 4CQDA 2PP1A 3TQVA 1AW1A 1ECQA 1AW5A 1M5WA 4YWIA 2WO5A 4IQJA 4E8CA 3SCPA 3E02A 3MBDA 1WUEA 5CZTA 3ZM8A 5CLWA 5JXQA 4J5NA 1C3FA 2BZNA 3NXLA 5HBFA 5AC5A 5F4XA 3EOLA 1B1YA 4BR1A 1Q8AA 2ZA2A 4WF7A 2E4TA 5E0FA 1LDCA 4E4FA 3POHA 5A8OA 2ZICA 3TYEA 2CIPA 5CSRA 1X1OA 1KWKA 3OG3A 1LLWA 1UWAA 5A8QA 4RE4A 1GK8A 4AX6A 4LYRA 4YL2A 7ENLA 3STGA 3PUEA 3E5PA 1A47A 2YDSA 1V3HA 3DX5A 3VKCA 3ZR4A 3TU9A 3CNYA 3O8AA 1H63A 2WCGA 1JDAA 4C5YA 1F4AA 2WSPA 2J47A 3UWUA 3G0SA 3PB2A 2DJXA 4N02A 1RBOB 3CYJA 3AHTA 1TPB1 3W7QA 4EWND 1O6IA 2RKXA 1EGZA 3NL2A 2OEMA 3T6CA 1PZ0A 4UFKA 3M5ZA 3R0DA 2EKGA 2ZC8A 3P0XA 4ZQRA 4AZCB 3WQ8A 4ZA0A 4DWSA 4WY0B 4GZEA 1HTIA 2WLYA 1NOFA 5JMUA 5DRCA 2GVJA 4NUWA 1YW1A 2ZUNA 1JG9A 3UWVA 5C71A 1Q6GA 4K68A 2IUZA 3T08A 4UFJA 2WSRA 4TMCA 3QY7A 4D8AA 3LCHA 2OZ8A 4DAIA 3QRHA 2GVYA 2VC9A 2BVYA 2E8YA 4M7TA 2G3NA 2OKOA 3M0HA 5C9ZA 3F5JA 1MW3A 4N4QA 1X39A 5E6YA 3L67A 5A3HA 5DMYA 3LZ3A 5DMNA 2UBPC 2VXNA 1JZ8A 4V1YA 2ZUMA 2GPTA 2WNQA 1O12A 3WLKX 3LLDA 4XBSA 4IFKB 4XD5A 2NUWA 4LALA 3KOZA 2IQDA 4B90A 4UQ9A 4NAEA 1EUNA 2Y63A 2FB3A 3MI3A 2XWEA 4YYCA 4ZO8A 4O18A 3CHDA 1VJSA 1JEZA 2P53A 3SB0A 1FHDA 5E09A 3ZSTA 1NP0A 2NXHA 1LBMA 2F38A 3QR0A 3M0JA 4XZNX 4Z1AA 5M5DA 1G7UA 2DVXA 4QITA 1DWJM 3CT7A 4IIBA 3WLSA 3PZIA 3RAOA 3F1QA 5B80A 2PU1A 1VLIA 1E4MM 1PHWA 3BG9A 1NFBA 5C7VA 3RXZA 4DJFC 5G1MA 1YKWA 2DH2A 4YYFA 2QPXA 3EB2A 3H2OA 1W3HA 1TE6A 2Y61A 3OZOA 3KVLA 3W1PA 3I3DA 3I3BA 2PDQA 3VX0A 3H24A 2IPJA 1KXVA 2GWGA 3LPPA 4GVIA 3ZJ7A 3XISA 3V7PA 1ELSA 3CWHA 1YXYA 3HG2A 5HMDA 3N3MA 4MB3A 5CPLA 1HFBA 3THUA 2XPKA 4GO8A 1WDSA 3IACA 3KOFA 2DT1A 4HGXA 3H7RA 3FOKA 3W76A 1D8WA 3V1PA 2HQAA 2ZE0A 3EPOA 3T0BA 5F2GA 1JYNA 4H6EA 2XIOA 5TQLA 1AZ1A 1EC8A 5DEZA 3RX3A 1F61A 5BRPA 1A0EA 1EDTA 1O5QA 1JCJA 1QPQA 4O1AA 1W5MA 1XBVA 2GVLA 1GVSA 1UZDA 1GOOA 2ZX9A 3UZ5A 4GACA 3SGUA 1ITXA 3DDMA 1T96A 2VCCA 3QQ1A 3GBDA 7XIMA 2YYTA 3M0VA 1PB0A 1A5SA 4DYEA 1Q8JA 3J7HA 4WJXA 3GVGA 3PZUA 1CXHA 4C6DA 2VR5A 4B5XA 4N2YA 3BCFA 4CU7A 2W9MA 1HKJA 3GNRA 4MNKA 1R3WA 3DFYA 3BCDA 1V0NA 4GOAA 2XINA 1F6PA 3WFAA 2R1NA 2GWNA 3WEZA 1XSKA 3E2RA 2OQHA 4B5WA 2BMBA 2A5HA 4FHAA 4RNJA 1WZAA 3GZAA 2CBJA 2VX5A 2FB2A 3LU2A 1HZYA 4JTKA 4W5UA 2RGMA 4AY7A 3SBFA 2NVDA 4ACZB 4H4IA 4RE0A 1KM0A 3KEHA 4P7RA 2J9ZA 1V7YA 4MUPA 1TO3A 5AECA 2OVLA 4FNQA 3MWCA 5FSEC 3RK8A 3FXYA 2V63A 5CPOA 1H62A 3HG5A 4HSHA 1W5NA 1KLZA 2GGGA 1FA2A 3AFBA 1DPMA 3VMOA 4X2PA 1VBGA 2PDMA 3FAXA 3NYZA 3T9PA 3MDWA 1A53A 4S38A 2IXUA 3G0XA 2NQ9A 3TTEA 4KWSA 5EBUA 4WRHA 1E3ZA 2ZA1A 2C0HA 1LWIA 3SQLA 1XRTA 2WMGA 3OBEA 4XZLX 2QCDB 4OBTA 1I2PA 2O55A 5HMFA 3UD6A 1EDGA 1TYGA 3GBEA 2TYSA 2DU2A 4IQEA 3UWYA 1BWKA 4XO6A 1JF5A 5HANA 3TTSA 4AD5A 3LRMA 1FFQA 5C55A 4AMCA 5E0KA 1AJZA 1LRQA 3WUEA 4LWWA 3W1QA 3WH7A 4MB4A 5D2YA 2WMKA 3U7VA 4PGLA 3W7MA 3S47A 1VD6A 1ZNNA 3MUCA 4A3RA 1K7FA 1OGSA 4Y9NA 1UJPA 4I90A 1PTAA 4MWAE 3KBSA 1HKIA 2R8WA 4LAMA 5EBAA 3H7VA 1UD6A 3QN3A 3UPBA 4US6A 3SN0A 1RVKA 3AHVA 2A3BA 4IX0A 2QJMA 2WMHA 4JTHA 1SM9A 3W84A 2OG9A 3TYZA 3OVQA 8XIMA 4S3JA 1BF2A 2PD5A 1OM0A 2P8CA 1ZSXA 2IQTA 3LTYA 3GDTA 1DP0A 4QXIA 2OTDA 2SFPA 3PZQA 4AHPA 2NQJA 2V6AA 1YXCA 2E40A 1DORA 1PHQA 1DIDA 2ISFA 5CSYA 1ENUA 4UZSA 3BXWA 4AYSA 4KWOA 1M7XA 5DCDA 3FS2A 2DQWA 3NO5A 2OQLA 1UR4A 4LCRA 1E55A 1WA3A 3FKKA 5XIMA 1GQLA 3VNYA 1KC7A 1Q3NA 3TQKA 4PCPA 1IZJA 4M24A 4AZ5A 1OX5A 3OLIA 3XINA 3WQCA 2OEJA 4JL2A 1OFRA 4NU7A 3SI9A 3WLRA 1Q6CA 4GY7A 1LL7A 1M6JA 4ERGA 1OCBA 1ADOA 3S1GA 3AIUA 4ORIA 1OB0A 1SO4A 3DFHA 5C2CA 3VIPA 2PODA 1WKEA 4ROPA 5GJNA 2IW0A 2J7GA 1M04A 3A3WA 3WQEA 4CVWA 4OECA 4E8DA 1Y65A 3U4AA 5HULA 3UXDA 3WF0A 1O7AA 3MP3A 1G4PA 4CD7A 5CCZA 1TMQA 2VQTA 4N9DA 4ONVA 4CNOA 4UC5A 3S5YA 2EF9A 2GVEA 1XR2A 3B8DA 3W7OA 1EP2A 4J3WA 3TFCA 2AQVA 3NG3A 5CBBA 2W92A 1BVWA 4JN6A 1H0GA 1XDMA 4BEQA 1J11A 3SCNA 5IXEA 4BZYA 3BZJA 1ISYA 3L2MA 1YLVA 3S3GA 3GVWA 3OPSA 4F2UA 1DYSA 2PD9A 4MZYA 4DLFA 8TIMA 4Q4KA 4QGCA 1F6YA 3W74A 3MC5A 3INPA 5CPSA 4W86A 3UERA 1OF8A 3DGBA 3L5MA 4AIOA 1E70M 3L9CA 2A3EA 1TZ7A 3W2KA 2XGBA 3ZVHB 3AIQA 3AS0A 4CD6A 1DJQA 3CB3A 3BCJA 1P43A 1KKOA 4HA4A 4RL3A 3UPMA 2EPKX 1Q6LA 3IVUA 3AWOA 1R47A 2GSJA 1SMDA 1C8XA 3WQOA 3D3FA 4BQ4A 1IGWA 1AFSA 4GGHA 4AZ7A 2BODX 2G97A 4QLLA 1QVBA 3OA3A 4GVHA 4H9XA 3WLHA 3QZEA 4AD1A 1VCFA 4E8GA 3RR4A 1OX4B 3S42A 3LPGA 4JHZA 4Q4QA 3UR7A 3A12A 4MJ4A 4GYPC 1CI1A 3BAJA 4GX9A 4PMYA 3VKKA 2CLLA 3QHMA 1AJ2A 1W9XA 5CEWA 4F4RA 1WV2A 3P81A 2A7PA 1Q5MA 3P60A 1G4EA 5EMLA 3QPZA 4JTEA 3EA1A 1M68A 1KFKA 3WDJA 4CD4A 3ARPA 1UMLA 1W54A 3BW4A 4R9XA 4O1CA 3EXTA 3NSXA 3OIXA 3FK4A 4JKKA 2QHAA 3GNNA 2C79A 1W32A 1A49A 2TSYA 3CIVA 2RUSA 3EB3A 2X7VA 4J3TA 6TIMA 4OFCA 2H9AB 2BGQA 5HOSA 3N11A 3IAQA 1M9HA 3ZJ6A 1Q4NX 2PTYA 2NT0A 3B03A 4DZ5A 3T55A 4M1BA 4MM1A 1G0CA 3LTSA 5A8GA 2X05A 5A8MA 4XBJA 3EWXA 4TTUA 4UNKA 4S1FA 2CZVA 3WDPP 2XIJA 1PZ3A 1EFZA 4MZ8A 3QZAA 2OQYA 2V5DA 2E0PA 1L9WA 2E77A 2VFHA 3BK0A 1GPWA 3C2EA 3C2YA 3TSMA 1VCVA 1CEOA 4RW3A 2FHBA 2OB3A 3IUDA 4L4OA 4PODA 3BDKA 2ISDA 1PDZA 1C7TA 3MT1A 2J7FA 3PWGA 3WQ6A 1HGYA 2GSEA 1WCGA 1IR1A 3N6JA 3ITGA 3II1A 3EOOA 1RY8A 3CL7A 3G0UA 5A69A 1UR9A 2QS8A 4FIRA 5AB3A 3P80A 3T4WA 1P1XA 1DWIM 2PA6A 2ICSA 5C5YA 1V3IA 5BROA 3TTQA 1JR1A 2VD8A 4IGNA 1R5YA 6REQA 4JTRA 1T40A 4Z1DA 2FJUB 2QUUA 1FH9A 2D1ZA 1EP3A 1K8CA 3FDGA 4LUTA 4XD4A 3WBAA 1MW0A 4K8HA 5KINA 3TQPA 3WNMA 4HZMA 4H7ZA 3GH7A 4Q8NA 4DUXA 3AIEA 1KBJA 2FPVA 2NSOA 5HWMA 3IIZA 2GGHA 3GW0A 1IXNA 2PC4A 3L7RA 1JPMA 2I57A 3VK5A 2O7QA 2JF6A 1O66A 3FJ4A 4F9JA 4GY1A 4NT0A 2INEA 1YIXA 4KCUA 4O50A 1AMKA 4PBGA 4H19A 4C6IA 4BF7A 4EF8A 1MW1A 1S46A 2VFFA 3LMZA 4HN8A 3F4WA 2J27A 4I5RA 1S5WA 2VDIA 1WKFA 2AL2B 3IK4A 3O05A 4WGXA 1A50A 2CW6A 5FF3A 4JN7A 2ZFAA 5D9NA 4IPLA 1DWGM 1MMFA 4FNTA 1I0BA 3TYDA 1F6KA 4PUNA 3GW3A 3MHFA 4UMCA 3OVPA 2G3IA 4PRRA 1JYVA 1FRBA 4AISA 5LXXA 2VCBA 1OADA 3F2BA 5LNWA 3DZ1A 2Z1WA 1MEWA 4G5DA 1V6XA 1GVEA 3BLFA 4OGZA 3GWQA 4IH3A 3VZZA 4OE7A 1I1WA 2DVTA 2FYMA 1XICA 3OP2A 1KO0A 3NPVA 1MEHA 2NX9A 3V3WA 1GVRA 1N82A 1HKVA 3M0KA 2XH0A 4PTMA 4WIWA