3W1TA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-095
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-095
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1tA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1tA01
2A6NA 3TCEA 2Y88A 1P4CA 3MI3A 4JTUA 3LRLA 3G3MA 4CCCA 3A22A 3EXSA 5AC6A 3N9RA 3UNDA 3G1XA 4LRTA 5KMYA 4YL2A 4B5NA 2B7NA 4CQAA 1SZNA 3ANYA 3B04A 1LBLA 1AMKA 3TAOA 2ZBTA 3GZ3A 3C61A 3CHVA 1SZFA 5G1YA 1QPOA 5HUOA 3EB2A 1ME9A 3W1UA 3GYEA 4WY0F 3EWXA 5K7JA 2VKZG 1KFEA 1G67A 3NXFA 4HIBA 3DU0A 3L67A 3CIXA 1Q6QA 1XUUA 4RXFA 3P67A 3L5MA 1WOBA 1XUZA 3ZWTA 2C16A 1P5BA 4M19A 3TQVA 3SIZA 1QWGA 2FPTA 1OJXA 3M16A 5G1TA 4MZ1A 5CPOA 1K7XA 3NR0A 4FO4A 4UC5A 4A3UA 4WOQA 4MLRA 1BTMA 5FESA 4WY0B 2NWSA 3LRKA 3GNNA 3E02A 3TSBA 1VYRA 2FDSA 3A24A 2Y70A 3O1NA 1B9BA 4R34A 3T78A 2V0TA 4GWEA 3P5ZA 2OT1A 4QM1A 1IXOA 4JNMA 1LRNA 2Y62A 4UR8A 5D02A 2YYTA 4NX0A 3T4CA 5L6UA 3VE7A 2CLOA 2Y6ZA 1WYIA 3A9IA 2WQPA 1F6PA 1GYLA 3PM6A 3N19B 2ZRUA 1X1ZA 4FNUA 3W73A 3BLFA 4MLJA 3BG3A 1G69A 3B0PA 3U8GA 1KFJA 4GUGA 5G4EA 4HSOA 1XI3A 2Y7FA 1Q6RA 2PRMA 3NO5A 5AHLA 2FFCA 3UPBA 2XN1A 1KM5A 3G0SA 1TPC1 1I8JA 2EF9A 3QPZA 5DCEA 3O6YX 5IM51 5A8GA 3JRKA 1PE1A 3M41A 4JX4A 3VI2A 1TV5A 5D2WA 1O60A 4EWND 5EA9A 4RCXA 4NJGA 4GE8A 3W74A 1YXCA 4OV4A 4QQ3A 4O0ZA 2R8WA 4DXVA 1W56A 1SW0A 2QJGA 2PCQA 3CWOX 1K8ZA 3C0JA 4ADTA 3KFTA 4JTJA 1VRDA 1GG0A 3FIGA 2B0MA 4UTWA 3W2NA 4MOZA 1MZHA 3N73A 2QCFA 3IGXA 3G1YA 3BW2A 2J27A 1TTIA 2D73A 4RXGA 1W5MA 3H54A 2EKCA 4Y96A 2C6QA 5AN7A 2Q8LA 4LVGA 5CZSA 3CT7A 3W7DA 2W79A 3FKRA 1GPWA 3HJZA 4JTEA 2ZDRA 5HINA 1VJIA 2J9XA 5H91A 3RF9A 3TU9A 2WO5A 4MZYA 3QMTA 1S5TA 1W5OA 1SFLA 4JTFA 1GVRA 3BG5A 3W7JA 3SY5A 2GVGA 1H60A 3S1WA 5E93A 2X16A 2W6RA 1KFKA 1KV8A 4IJBA 4WXZA 1TB3A 3HG3A 3RLVA 3TC6A 3LERA 4QITA 3M9YA 3UXDA 5EYWA 4LW7A 5FF2A 3TFXA 3HGRA 1NEYA 2C19A 4JTHA 5D2TA 2VOMA 1DQWA 3I7RA 5G5IA 3EXTA 3OVRA 1I4NA 3WJSA 3NG3A 5AHMA 4FXSA 4FNPA 4JTSA 4CNOA 1I2RA 3TMLA 1I2NA 3NL6A 2FB3A 2CLFA 4O1AA 1H50A 3QMSA 1PCKA 2GVLA 4JICA 3UPWA 3NAVA 2ZZ1A 2Y7GA 4HNNA 4LWWA 2CLEA 5DCBA 3GDKA 5F2LA 4AF0B 5BRBA 3NYZA 1RVGA 1DOSA 2ZTJA 3WK3A 2ZA2A 4CQ9A 4IX2A 4XTIA 3M47A 3R89A 2VFGA 2HS8A 2E1DA 2DORA 5AHIA 4CCDA 4YLWA 1R46A 5SWUA 3NQMA 1Z41A 3WJXA 5I3JA 3DKJA 1WOAA 2NXGA 3EWZA 3I7QA 2ISSA 1QPNA 1SW3A 2HMCA 3CIWA 4LC6A 1NF7A 5F2MA 3BV4A 3HG2A 3GR7A 2VENA 2F7FA 3W7NA 1TPFA 3W76A 3I65A 2J9ZA 3CM4A 1QO5A 3Q37A 3IRDA 3C2FA 3TW6A 4NT0A 3MHGA 1XKYA 1FBAA 2HSAA 2QF7A 2CZEA 3G8EA 4LS0A 4OBTA 2QCLA 3NPUA 1Q6LA 1LM1A 2VFHA 4R33A 2G95A 4GUJA 4O53A 1GTEA 1NF0A 3NPWA 1LDCA 3PBVA 1WXJA 4U4MA 3B4UA 3LTYA 4EIVA 3S8HA 4O54A 4WY0A 1KTBA 5G2HA 3W22A 4ZZ9A 1H63A 2TRSA 4H6KA 1F76A 1WBHA 4RV8A 3S5YA 2ZRXA 3STFA 3USBA 3G3DA 5G2IA 3UWYA 1WX0A 4PFMA 3MHUA 3NQDA 5LHEA 1RV8A 3W1LA 1DORA 1HFBA 1TPH1 4RK8A 3LV6A 2DZTA 4JY9A 2B4GA 1C8VA 4N02A 4GXMA 1YXDA 1PIIA 2CLIA 4I7WA 4Z1BA 1IF2A 2V82A 1YDNA 2NUYA 4FNTA 1LLZA 4O52A 1KM6A 3QEZA 2I1OA 3VNDA 1IIGA 1XBVA 4LVDA 3W84A 4IUOA 1ICSA 4LY8A 4EF9A 2GJLA 3W70A 5LHFA 4K8HA 2XFWA 4N6EA 5K4ZA 3EWYA 5HMSA 4OV9A 5CG7A 3WJZA 1LOSA 3GKAA 3QJAA 3W7HA 3KRSA 3E49A 3O07A 4EF8A 3ELFA 1ONRA 3HGOA 3FS2A 2ZYFA 1OX4B 3GX9A 1K02A 1G7VA 3P8IA 5FEZA 3BW3A 4MUZA 5LGZA 3LLDA 4AHOA 4O1DA 8TIMA 1UUOA 3R5EA 2B7QA 4TO8A 1H51A 1RQEA 1PV8A 3ATYA 2CZFA 5G4WA 1QDSA 5HWNA 1EP3A 2WSYA 3HQ1A 3L65A 1SSDA 4LT9A 4O28A 4ALDA 4HPJA 1I2OA 1SO6A 3V1PA 1OF6A 4J9JA 1OYCA 4FX6M 4Q32A 4LUIA 1P0KA 3MYOA 1HO1A 3G1VA 2H3DA 3G0XA 1TO3A 1QOPA 4Y9AA 2VFIA 4KWWA 4UUIA 3UZ5A 3IVSA 4R53A 4LU0A 2YDAA 3P5YA 3S5ZA 2OMAA 2NXHA 3ABOA 5DCDA 1DKWA 5IBXC 1AW5A 4DO4A 1O95A 1OG0A 3PC0A 2FPVA 3Q58A 3CEUA 2E6DA 1LLWA 4PH6A 1AL7A 1OFBA 3EKZA 3JR2A 3QH2A 3EX3A 1N8FA 4N4PA 4CLMA 1G6CA 1F74A 2FTPA 1F5ZA 2BXVA 4GUIA 1M7OA 1H1YA 1QCWA 3S6DA 4AMAA 1R2SA 3L5LA 4Z0JA 2YYUA 4BF9A 5D04C 4NJJA 1V5XA 3MBFA 4O15A 3KRZA 4MKNA 3E96A 2EPHA 4DO5A 2YXGA 4N2YA 2C1HA 3NL3A 2ISVA 1T0OA 3BGGA 3W1QA 1JVNA 4QAIA 3TAKA 3ZWSA 3EX2A 1JULA 1RQHA 1FWRA 3GDLA 3QM3A 2YCEA 2VELA 1KM3A 4JTIA 4FNRA 1W5QA 4HN4A 1IXNA 1BEUA 4LVAA 5F1UA 2GOUA 3M5XA 4N4QA 1B3OA 1TPDA 3PSWA 3FYOA 3MHFA 5KZEA 3F4WA 4JR5A 3ZFHA 2V2HA 3OEXA 4DPQA 1DJQA 2P1FA 2V30A 2C0AA 4AVFA 4ZQMA 3LHTA 4HHPA 3STEA 1WAUA 4ICNA 1Q45A 1B4EA 1E51A 5EY5A 5CSSA 1RPXA 4XTDA 4DF0A 5E1QA 4O19A 1G4PA 3LM7A 2YFOA 5LZLA 4CNPA 1OFPA 3FFSA 1JCYA 2ZRWA 1L6WA 3GKFA 3W2LA 4JD4A 1GWJA 4O12A 2C18A 1N7KA 1JCLA 4XKYB 2ZRVA 4CNNA 3W1XA 5HJLA 5C55A 4R7JA 1MXSA 3GLCA 3SZ8A 1DHPA 1ZAHA 3S9YA 3W2JA 4AEOA 4ZQRA 1K8XA 4FF7A 4K38A 3AJXA 1PL9A 3M5YA 1TTQA 2Q3RA 4N9CA 5GVJA 4DBDA 2BX7A 2H6RA 2DJXA 3DGRA 3PULA 4KFPA 4IMCA 3EWUA 3T44A 1UJPA 1W8SA 4MFDA 5DELA 3HO8A 1VHCA 5EL1A 3QQ1A 2H3BA 4IMEA 3TA6A 1VCFA 4NXKA 3TV8A 3QQ0A 3W71A 2CLLA 4WD0A 1O5KA 3DFTA 3HG5A 2FPYA 1ZNNA 1CW2A 1R30A 1WDWA 5U7SA 4NZFA 1KM1A 2X2GA 4GRSA 4MVAA 4UIOA 4UTTC 2Q3OA 4GFSA 1XM3A 2A4AA 1UUMA 3QSTA 3DH7A 2CZ5A 3O6CA 3BLEA 4DBEA 4PEKA 1JQVA 4JXCA 4IMFA 2YFNA 3WJWA 3NGJA 3EEGA 2ZRYA 1I2PA 3S42A 2NX1A 1LBMA 4ML9A 1IXQA 2CLKA 3K30A 3KVLA 4JX6A 3A21A 4GC4A 2AGKA 2WKJA 3DFSA 4ZMGA 4ORMA 3HG4A 4JN6A 5KITA 3NOEA 5D30A 4JX5A 5KSWA 2JBMA 3KVMA 5F4WA 1UASA 2ISWA 1YDOA 2EHHA 3NQGA 4GBUA 1YADA 4C1LA 5EMUA 1LZOA 2ABAA 1TCDA 1D9EA 2PURA 3CPRA 3G0UA 1I2QA 1N55A 1XCFA 2DZPA 1SO4A 3GAKA 1J5TA 3NDOA 1WQ5A 3HGSA 3RU6A 1SW7A 5FEWA 3TX9A 2V8ZA 2XN2A 3PUEA 1YYAA 3LLFA 4JTLA 4M5PA 4LOCA 1M5WA 2OX1A 3TQ0A 2J6XA 5I3FA 6ALDA 5H2ZA 1GVOA 3TR2A 1L9WA 3W7OA 3W1PA 2CW6A 2R91A 3N2XA 1W3IA 2ZA3A 4O16A 4BK9A 4IPIA 1SPQA 2VEMA 2WSQA 4I7UA 5E0KA 3DBPA 4XQ6A 3C4UA 1VS1A 1FWTA 4ADUA 3P84A 3W7KA 2CLMA 3QW4B 1JCNA 2ZRZA 3BPWA 2NX9A 3LCWA 3MP3A 1EX5A 3TMQA 4JGDA 4M7SA 4P2VA 4UTKA 1ZAJA 5FF0A 5HR7A 1TQJA 2O7SA 3Q2DA 5K9XA 3UY8A 2X1RA 4Q4KA 3S1UA 1HUVA 3BVJA 3GR8A 1H7NA 1FCQA 2WPBA 1EP1A 4PODA 5AHFA 1RD5A 2A0NA 4N9EA 3TDFA 3PG9A 4RZ5A 2E68A 1WA3A 2TYSA 2X1UA 3WFAA 1T96A 3BLIA 5DY2A 4MY9A 4LC8A 4M6VA 3DFQA 4O13A 2HTMA 1VHNA 3LXBA 1J4EA 2NLIA 1VCGA 2ZZ5A 4H3DA 5EBUA 3B0VC 2OZ0A 5C5YA 1TREA 4TR9A 1MEHA 1KTNA 3LRMA 3NVTA 4NNCA 4TMBA 2YSWA 2C15A 3GIYA 3W2MA 3CTLA 2DP3A 3L0GA 2QUUA 3L2IA 3UWQA 2V9DA 3DXIA 1A50A 3HBLA 2BTMA 2YZRA 3BARA 3EKLA 1JUKA 3YPIA 4WUIA 2VEKA 3PSVA 3TJXA 4IXHA 3VCRA 5CPLA 1FXPA 3FYPA 4JTGA 1GVQA 4ZQCA 5LGXA 4LRSA 2A7NA 3FEMA 4YMZA 2ALDA 2RHGA 2J88A 2FLIA 1JQXA 4OE7A 5DXXA 3S5NA 3GXTA 3P82A 4L4LA 4QIUA 3P62A 1T99A 2WNQA 1V7YA 1FCBA 5ABTA 4OQVA 3F4NA 5A5WA 1FDZA 2IQTA 2BLEA 1PS9A 5EPDA 1GOXA 1KM2A 1ML1A 5BMXA 2DZSA 1IGSA 4WQ6A 3W7MA 3PBWA 4X3ZA 5D2YA 4ZL1A 4O1BA 2YW3A 3PVFA 4JEQA 4HNUA 1TIMA 2QCNA 1K7EA 2GJNA 3GDRA 1DV7A 1TTJA 1UCWA 1EA0A 4UFJA 3MW7A 3PB0A 3THAA 3C52A 1VR6A 4K36A 1ZFJA 3MMTA 4JTTA 3KOFA 4A22A 1JUEA 3FA5A 3OBKA 4U28A 3RFAA 1TRIA 1SUXA 4A21A 1FUYA 4DF1A 2X1TA 3NQ2A 4O10A 4TX9A 3D0CA 4Y8FA 4E38A 3W88A 3LHZA 5EKYA 3G8RA 1P0NA 2YPIA 2CZDA 1TYGA 3QC3A 3NNTA 2DZWA 5BNKA 3TXVA 4NVTA 5I3KA 1XBYA 4UMAA 1WBJA 1SSGA 2QDGA 3TSDA 2WOQA 5TBOA 4CCEA 7TIMA 5LNRA 1GT8A 1SZGA 4MJMA 4UTHA 1TTPA 4NX5A 3T55A 3NPXA 1TJRA 5FEPA 4LVFA 5CZTA 2Y61A 4GNJA 3QW3A 3L0NA 3UZJA 2QCGA 3GAYA 4G1KA 1D3GA 1C9DA 2OJPA 1FWWA 1NSJA 1ADOA 4QNWA 5HWJA 5CGQA 3MP5A 2E5DA 3HPSA 4GUFA 4WOZA 1F2JA 2QR6A 3QF0A 1QR7A 4AH7A 3VKJA 1EWEA 1KV5A 3UYCA 2Y7EA 5MHBA 3O15A 1VQTA 4WX2A 3MBDA 2G5WA 4AWSA 4OT7A 3M1ZA 5LSMA 3DFPA 4POCA 1W0MA 3NQAA 1VLWA 4RX0A 2NX3A 3R8RA 3NL5A 2CLHA 4UNLA 3GNDA 4BI7A 3IIPA 4RZ6A 1HO4A 4QJ1A 3C3NA 4ZQNA 1GEQA 3OVPA 1Z48A 2B7OA 4ORIA 1OX5A 4K39A 4IPJA 2NUXA 1XL9A 2VFDA 3UWZA 3HIJA 5D2XA 1LRTA 3ABQA 4X9SA 2ZQ0A 2QUTA 4UMCA 3N14A 4Z1CA 2ZFAA 1SQ7A 1M6JA 2FJKA 3VFLA 4JTKA 1YTKA 1P1XA 3IGUA 3ABRA 5D05A 4O1CA 4UMBA 3DAQA 2JKPA 3W1MA 3I6RA 2PRHA 4A2SA 4FIRA 3TIMA 2TMDA 3S0CA 2JGYA 2Y7DA 4Z0SA 1MSSA 4BFAA 2ZZ4A 5U4NA 3LX9A 1LROA 2A85A 4BI5A 5K9DA 5IBXA 1MEWA 4Z1AA 4TIMA 3IVTA 2PC4A 6TIMA 3V75A 2A1YA 2H8ZA 3ZR4A 3P7YA 3PBYA 3C2OA 5LNVA 1G4SA 4X2RA 5AYXA 2P0OA 3MUXA 2NXIA 3GXPA 3C2VA 2A6LA 3A5VA 3R13A 1L6SA 3R12A 1H5YA 4JYDA 2E6FA 3UD6A 1OFRA 2G96A 4UTJA 4OU1A 1HG3A 5HNRA 1S5VA 2QCMA 4K7YA 3M5VA 1IIHA 2QUVA 5KINA 1PHWA 1KBJA 2E6AA 3NQVA 3L0KA 2QCDB 1LOQA 3BO9A 2DJLA 4WXYA 1OYAA 3W75A 3IGSA 2FQIA 3MI2A 2JKEA 4FHAA 1W1ZA 5G2WA 2RDUA 1U83A 1YXYA 5DN1A 3FJLA 3AO0A 1GQNA 3LBCA 3BGJA 1TMHA 1LBFA 2NWRA 5KTLA 1LOLA 2DZUA 4JIQA 1TPUA 1ZY9A 3O8AA 1O94A 3BW4A 1OYBA 4JY8A 3W7LA 2TSYA 2C3ZA 3W86A 4MZ8A 3E12A 3NQFA 4AF0A 3IIVA 2H90A 5AOUA 3S1VA 2WNNA 3U6WA 4LNYA 3W2UA 1TV8A 2VEIA 3MWAA 1F6KA 1YLVA 4Z08A 1GZGA 1A53A 1WV2A 1OABA 1KA9F 2PRLA 2VFEA 4WJEA 2Z1BA 3TW7A 5TQLA 2R94A 4PA8A 4S2CA 4UTLA 1T8XA 2E09A 4LVBA 3W6YA 1M7PA 1TPB1 1H62A 5AHNA 4A29A 2QKFA 4IMDA 3M44A 2GUUA 1DQXA 1OX6A 3KVKA 3T40A 4IOTA 1EPXA 4DO6A 4FXRA 1KM4A 3LCHA 5DBTA 3H53A 5KZDA 4FX8A 2QEZA 1KM0A 3U2OA 1PCWA 4JS3A 4K6AA 5CZ0A 1LTDA 1VYSX 3ZS4A 3PUDA 3B05A 2NUWA 4M6PA 2NZLA 3LCIA 3TKFA 1CI1A 2YX0A 3G1DA 3NQ7A 4BWLA 3I68A 3NQ8A 1J2WA 5I3HA 3L68A 1TV7A 2ABBA 2A2IA 1GVSA 1JCJA 5FF4A 4NNBA 4RR4A 3LCLA 1OVDA 1DVJA 2QDHA 1X6UA 1XFBA 1JCMP 5F1VA 4UTTA 1LP6A 1Y0EA 3NM3A 2J24A 5K2ZA 5CSRA 4BWLC 3NM1A 3Q94A 1XBZA 2OCZA 1A5CA 1JRCA 1AG1O 5L9FA 4RJEA 1AW2A 1FX6A 4DELA 4E0CA 1W3NA 3TJLA 3CQ0A 1ME8A 4TMCA 3W07A 3P61A 4FX7A 4XBKA 5D09A 3N34A 1DBTA 4HNTA 3C2EA 1H7PA 5BMWA 1GVFA 3SFKA 3C56A 3N3MA 5BW6A 1OF8A 1Q3NA 3W3OA 4DEFA 3O6DA 4ZQOA 4IWWA 4FB7A 3S5OA 2G97A 1TPWA 1NAL1 1YPIA 3C2RA 3WK2A 1OX4A 3EXRA 4N9DA 3UWWA 3LTSA 2ZZ6A 4BR1A 1H1ZA 3PF3A 4O57A 3G18A 4M7TA 5C6MA 1PHQA 2V5LA 1EWDA 1KW1A 3B8DA 4OGZA 4JDYA 4K8EA 1JCXA 1LYXA 2J9YA 1ZALA 4AWTA 3A23A 3TNOA 3DKLA 2Z6IA 4I9AA 3M0ZA 3L21A 1HTIA 4AB4A 4MPQA 4YCPA 5D03A 3FJ6A 3W9ZA 4IGHA 3DENA 1VYPX 2E6YA 1QOQA 3PWAA 4LV9A 4NQ1A 1ZJIA 3WK0A 2ZCGA 3G22A 3LHUA 1OFAA 2EGZA 2QCCA 3KVJA 4A2RA 3EWBX 3BK0A 4GJ1A 4NZJA 3SW6A 3TSMA 3C6CA 3G1AA 4O50A 1ICQA 5AC7A 2E77A 1W3TA 1KFBA 1K7FA 2YW4A 3DI1A 1YPFA 2GQ8A 2QCEA 4O11A 4KFOA 5I3GA 3P60A 1H61A 1RR2A 1H7WA 5FI8A 2QCDA 4UFHA 5K4XA 1ICPA 2GPTA 4UFIA 3CEPA 3EX1A 4MYXA 5D2VA 4UFMA 5HQEA 3C8FA 3L5AA 4JYEA 3TH6A 2PE4A 1AL8A 3GXNA 2C14A 2OT0A 4KWVA 2ATMA 4S1FA 3CLMA 4NJKA 3SR7A 4OHQA 1SZEA 1Z44A 4FEZA 4MFEA 4IXXA 3W2KA 5T26A 3G1HA 2RFGA 3P74A 4PTNA 1XDMA 3TE9A 4DQWA 1U5JA 3EX6A 3LOTA 2ATSA 3BG9A 3MYPA 1W31A 1QFEA 1CX9A 1SO3A 4OWGA 3B0UX 2AQWA 1F05A 1K03A 4UXDA 1TRDA 3GDTA 4E2DA 2FIQA 4AHQA 4ZVJA 4XBSA 1XXXA 2V2CA 2X30A 1LRQA 5F4SA 4UTIA 1B57A 3RLUA 1VLIA 3P81A 2WSRA 2O7QA 4MY1A 3DFNA 3GB6A 3CWNA 4W9TA 1EEPA 4UTWC 4M6QA 1FY6A 2QAPA 2B7PA 4HT3A 4O17A 1H7OA 4UTUA 3H55A 2C13A 3MJYA 2V81A 1O5XA 3QSRA 2A7PA 3NL2A 3QFEA 1S3HA 4ZQPA 4O14A 1EB3A 1SR9A 4KFNA 1YTDA 2XN0A 3L9CA 3TXZA 5I3IA 4O18A 3W7IA 1D3HA 1O4UA 1EUNA 4PL1A 4Q33A 4K7VA 2QJHA 1OHLA 3PBUA 3LB0A 1GG1A 3W1RA 4KKXA 4GUHA 4S2BA 4L4MA 1OFOA 1RZMA 4PCFA 1GJPA 1L6YA 1VPXA 2Z0IA 5FF3A 1TJPA 4NU7A 3SECA 3W1TA 2VFFA 1JJKA 4XKYA 3N9SA 3ABSA 4QISA 5TIMA 2CFFA 1EIXA 3PS7A 4UR7A 2EAWA 2JKAA 4QSHA 1OFQA 1TPEA 3NA8A 3HPXA 3W1NA 2BZNA 3O05A 3KHJA 1BWLA 1VCVA 2Y63A 4NJIA 3IIXA 2BWGA 1TSIA 3PR2A 4NNAA 4DF2A 1SO5A 4HNVA 1VH7A 5F2IA 4WZHA 2RH9A 2V2DA 3M43A 1NFBA 3DFOA 1R2RA 4EOUA 4AAJA 4UTMA 5D37A 4MY8A 2VXNA 3NQCA 5DLCA 2HS6A 3W7RA 3GVGA 2X1SA 4NJHA 1VZWA 2ZZ3A 3F03K 2WJZA 2R14A 4MYAA 1FWSA 1W5PA 5AHEA 3T7VA 1LORA 2UV8G 5J5DA 1XC4A 1OFEA 4LS2A 3IEBA 3B03A 3CU2A 3NQEA 2CU0A 5AYYA 4JDBA 4N9BA 4UFLA 1EUAA 5AYZA 4RZ4A 5K3VA 3VE9A 3UY7A 4I7VA 1AW1A 2QJIA 1W54A 5CPMA 1L2UA 5HWMA 3W87A 1X7FA 1DJNA 1JUBA 1NVMA 1H7XA 2GQAA 3QPYA 3CC1A 4D2JA 5F2GA 1THFD 3HF3A 4PL2A 3G1FA 2Q8ZA 3FKKA 5HUPA 1QAPA 2WV8A 1X8FA 3DI0A 3NQ6A 3NZRA 2F84A 3SGUA 2QCHA 4IQLA 4UNKA 2A7RA 2V5BA 2AAMA 4TU1A 3W85A 1KFCA 1TQXA 3R2GA 1KBIA 2Y85A 5LNUA 3I7SA 2TPSA 1FXQA 1K3UA 2RDTA 5C2XA 3SI9A 3W7PA 3IIZA 1JR1A 1QMLA 4HPXA 4YCOA 2ZA1A 3LXAA 3KX6A 3PUOA 4CQ8A 4ADSA 3NPVA 1S5WA 4JIPA 3SGZA 2BSLA 2P10A 3LI1A 4UCGA 4AWUA 4FNSA 2A21A 4Z1DA 3W7EA 1G4EA 3SSJA 3STGA 1QO2A 3L66A 3HMJG 3PAJA 3G1SA 4Y6GA 3HPZA 5AB3A 2DU2A 3TK7A 3LCXA 5FF7A 3FLUA 3P80A 4NXSA 2VC6A 3LBMA 1LCOA 4ONVA 4JYFA 5HULA 3DHFA 4E2BA 4Y90A 1FCUA 1EP2A 2DZVA 1OK6A 2KZHA 5D33A 3W7GA 3IVUA 1DL3A 1FDYA 5HR6A 1R2TA 1OFDA 1AK5A 3TFCA 3KXQA 4K37A 1F73A 4NUWA 3OIXA 3W83A 3W7CA 4QNEA 1QPQA 2NV1A 1UB3A 4XZ9A 5C54A 2GVJA 3MI6A 2E5CA 2QAFA 3RK8A 3W72A 3OG3A 1K8YA 3A5FA 1OK4A 4LS1A 1BKSA 4X22A 3UXAA 2FB2A 3M6YA 3QYQA 3LHYA 4MJZA 4UFKA 2I9EA 3UWUA 3IIOA 4H4IA 5LKYA 1R47A 3HOJA 4RLIA 1FCVA 3W23A 1A5SA 1G4TA 5FEXA 3CB8A 1FWNA 1Z42A 3HB9A 3LCGA 1Q6OA 4MIMA 4O4WA 3E0IA 3S1XA 3DHDA 3WK1A 1KLZA 3TROA 5AC8A 3UQNA 1PVNA 2ZZ7A 2E5BA 3LXCA 1GYNA 1RQBA 4XUGA 1SFJA 3WJYA 3QRHA 2Z2UA 4IX0A 1JRBA 5DBUA 3OHIA 5F4XA 4N6FA 2Y89A 3NEVA 4YXGA 3DZ1A 1ZHAA 3O06A 3UWVA 1H7RA 1IXPA 3STCA 4EVZA 2DZXA 3GDMA 4AXKA 3MP4A 3W1AA 3EX4A 1B4KA 1VGAA 5CPNA 3P8JA 1UBSA 1ZENA 3QMRA 5D32A 4AHPA 4O4VA 1KTCA 3GK0A 3LV5A 3IV3A 1ZCOA 1YDVA 1TPVA 3OVQA 2JGQA 4P61A 3B06A 3SJ3A 5LNSA 3KAOA 1HL2A 1QPRA 1SU5A 3E9AA 1C29A 2GQ9A 3KRUA 3LI0A 2ZZ2A 2Z6JA 4LUJA 3O63A 1MO0A 1YTEA 2VEPA 3EWWA 4IMGA 3LGEA 2JK2A 5LNWA 1KLYA 3NZ1A 3LHVA 4LTSA 3RMJA 1W5NA 3LDVA 2RDWA 5BOOA 4YWIA 4PC8A 1A5BA 2WNZA 1I45A 3HGJA 1GTHA 1X1OA 4BI6A 5CZJA 3M7WA 4FIQA 1ZAIA 3LTPA 1A5AA 3N2MA 1XBXA 1FQ0A 3THQA 2CWNA 2YR1A 1ALDA 5AFDA 1W37A 3O16A 1G7UA 2RKXA 3TQKA 1VC4A 4O8RA 3TUUA 3RNDA 3PB2A 2A5HA 4HKPA 1BWKA 5KZMA 1QNVA 3F1QA 3TC7A 1XDLA 1KFLA 2LLEA 2YGYA 3W7QA 3M5ZA 1F7BA 1MEIA 3JS3A 4LV4A 4XWUA 2ZTKA 3QZEA 4C1KA 5D38A 5J5RA 3FOKA 3INPA 2I14A 1ME7A 4O0KA 2W0UA 3LCFA 5K9CA 4HSNA 5DXYA 2H8XA 3PY2A 3ATZA 4FNQA 4RKAA 3G24A 4DPPA 1FDJA 3PG8A 2NV2A 5DY3A 3OA3A 5CKSA 3LHWA 3MO7A
chains in the Genus database with same CATH superfamily
2A6NA 4H04A 1ZBWA 2Y88A 1P4CA 2J7CA 3RHGA 5J8LA 1MFUA 4JTQA 4JTUA 4CCCA 2DVXA 3A22A 3N9RA 4LRTA 1GQIA 4W8BA 1GORA 4ASTA 3ANYA 3KBWA 3TAOA 2IPFA 3C61A 1LQ2A 3CHVA 1QHPA 4AEEA 2RJHA 2X40A 1Q7MA 3GYEA 2XH7A 1AJZA 3EWXA 1J18A 4NY2A 1KFEA 2BY0A 3NXFA 3E5PA 1J79A 2J7GA 2F9RA 4J4KA 1Q6QA 1V6XA 4XAPA 3DX5A 2C16A 1HIZA 4KCTA 4PSRA 1A3XA 3URQA 4C7GA 3FAXA 2WZIA 4UC5A 3CZEA 1BAGA 1BTMA 5FESA 2PTWA 2FGLA 2NWSA 3GNNA 3E02A 3TSBA 2Y70A 3O1NA 2VZSA 1A5OC 4NZ4A 4LF2A 3AIBA 4GWEA 1XCWA 2PWFA 5T91A 1IEXA 3ECQA 1IV8A 1LRNA 2YYTA 3WF4A 2E9LA 3SADA 1X1NA 1F6PA 1XLCA 1NM9A 3K8LA 1X1ZA 4MLJA 1M41A 3B0PA 4GUGA 1BQGA 2YCIX 5JQ9A 3MTWA 4N42A 3VOFA 3NO5A 1JD9A 4H8UA 3UPBA 2XN1A 3KP0A 1CT5A 1KM5A 1TPC1 1I8JA 2EF9A 5DCEA 5LIKX 3VIJA 3WQ6A 1TV5A 3ARRA 5D2WA 1O60A 2CXEA 4JTAA 1DPMA 2QVHA 1KCZA 4ZO7A 1FWEC 4I5RA 4O0ZA 1JI2A 5AZ0A 1V79A 1U1JA 2BGSA 1SW0A 2QJGA 3LGDA 1UPPA 2GZXA 3VFCA 2YIHA 4MB4A 4Y8EA 4HNCA 4UTWA 3W2NA 3ZVHB 4A8NA 1MZHA 4UOJA 3IGXA 3K2GA 3A12A 1JPHA 3RX4A 3UFYA 1Q65A 3BW2A 4L4PA 1ZPTA 5GJMA 2WW5A 1W5MA 3H54A 2X7VA 1ELSA 4XO7A 4LVGA 5CZSA 5A3HA 1Q7ZA 1GPWA 3MZ2A 2QVNA 2VL4A 1VJIA 4KGJA 1CENA 3TU9A 1UZ1A 3FK4A 1VF8A 3QMTA 1S5TA 5CBJA 1W5OA 1SFLA 4JTFA 1AJ2A 3SFWA 3W7JA 3SY5A 3EDJA 1WZLA 1Q8JA 1W1YA 3VC5A 3S1WA 4H6QA 3WY1A 2VX5A 4IJBA 1NDVA 4BQ5A 4L9YA 1NOWA 3H24A 3U2ZA 1CWYA 1U2YA 2PDKA 4QITA 3VD5A 3D3AA 3TFXA 2Z00A 1NEYA 1Z6KA 3E0WA 3IJ8A 4DHGA 1EC7A 2VOMA 3I7RA 5G5IA 1I4NA 3WJSA 2E8YA 4P8VA 4FXSA 4D6IA 4JTSA 1DIEA 4CNOA 1NOFA 1I2RA 4LH8A 2XH0A 3E3HA 4S39A 1MWOA 4Z2JA 2EQDA 4Q7IA 4HNNA 1RBLA 1ISVA 1XGDA 3GDKA 4IGSA 3WG6A 3KDOA 1TVLA 1RVGA 3W38A 3L4ZA 2ZTJA 2ZA2A 2PDCA 4W8LA 1AH0A 1VBRA 2E25A 2VFGA 3D6NA 2DORA 4FOKA 1R46A 1M7XA 4L6HA 1R0MA 5I3JA 2ISSA 1QPNA 3DG7A 3WDPP 3PZNA 5M3WA 4AG0A 2WYSA 5F2MA 4QEHA 4QX4A 2GWGA 4WGHA 3W7NA 4GIYA 1KCKA 5A2CA 4JKLA 3Q37A 3WQEA 3IRDA 4ZB0A 1CIUA 1IHIA 2X41A 1XKYA 4W93A 1RLCL 1UA7A 2QF7A 3MUAA 2QCLA 4ROQA 3R1ZA 4KQNA 4B5SA 1QJWA 1GOIA 1UUQA 3CZJA 3L4XA 3MUIA 3B8WA 2BASA 1C8YA 3S8HA 4O54A 2HXTA 2CC0A 2P0IA 5G2HA 2TRSA 4H6KA 3I3BA 1WBHA 3QKEA 3S5YA 3STFA 1B5TA 3BAXA 5LHEA 1JCTA 2QUMA 1XGZA 3SCTA 2F2KA 3W1LA 3NYDA 4N02A 4I5XA 3NO3A 1YXDA 4I7WA 1YDNA 2NVAA 4Q8TA 3UJEA 4R9XA 3G1RA 1KM6A 2I1OA 2DIKA 2RGMA 4PMYA 1ICSA 4PMOA 3WNMA 3LNPA 4LY8A 3PFRA 4EF9A 2ZXBA 3CQIA 2GJLA 3P0WA 3P3BA 2XFWA 3AISA 1R3SA 3CUJA 3WJZA 3E49A 3UZYA 2V63A 3PPHA 1JXKA 4AC7C 4BS0A 4GNKB 1ONRA 1QU4A 2OYLA 3WL1A 2ZYFA 4F3HA 2BB0A 4HD5A 2WZEA 4MUZA 3B9DA 2VWSA 2QF8A 3LLDA 4AHOA 4O1DA 4HA0A 3R5EA 2XFFA 3EDFA 3PJWA 3WLHA 2B7QA 3V1HA 1JYNA 1H51A 1PV8A 2CZFA 1CGUA 1QDSA 1SYTA 1EP3A 2WSYA 3HQ1A 4JKKA 4TX6A 3DIPA 4U5KA 2QJJA 2W61A 3MYOA 3SY1A 2HROA 3N29A 1E6SM 1TO3A 1US0A 1QOPA 4P7NA 4BA0A 3A9BA 4HZ6A 4GI9A 4UUIA 4Y2WA 3HV9A 4GI6A 3G77A 4QLJA 3VCNA 4PBFA 2OMAA 2NXHA 4GZIA 1E4MM 4DO4A 3FDKA 3BMWA 3AWOA 3VD4A 2UBPC 2PTXA 3EB3A 2VCAA 3EKZA 3QH2A 3EX3A 1N8FA 3WLPA 4CLMA 5CJ5A 1F5ZA 2V3FA 2VRKA 1M7OA 5BWFA 3KDNA 4B16A 1GZ1A 1R2SA 3BGAA 3GH4A 4BF9A 5D04C 4R5EA 1V5XA 4MB5A 4BF7A 4O15A 3KRZA 1OGSA 3ES7A 4N2YA 1XG3A 3AI0A 3ITXA 1XYCA 2ANUA 4AYSA 1V3KA 3EX2A 3GDLA 3QM3A 1UZ4A 2WZTA 2YCEA 1C90A 3RRAA 3WLIA 1KM3A 2PU1A 4KRZA 1W5QA 1IXNA 2FHBA 3OG2A 4X61A 1J0YA 2GOUA 3STPA 4J7RA 3W28A 4MJ2A 4DX3A 3PSWA 3EDDA 1TWIA 2IXUA 2ADAA 4IIGA 3EKGA 3E0VA 1US2A 1XQKA 1EEXA 1UR0A 3DGBA 5CSSA 4C1NA 4H9XA 3TCSA 1R3TA 3QXBA 4O19A 4NASA 3B9NA 3FFSA 1ZBCA 1ZJHA 3M4HA 3PP7A 1BYDA 2BODX 5E70A 1TFVA 2G3MA 2PWDA 5D9OA 4G6CA 5C55A 3GLCA 3SZ8A 3WLTA 3H23A 3S9YA 4D71A 4AEOA 3MV01 4ZQRA 3S1GA 3UPMA 5DF0A 5JUVA 1IWAA 1MRAA 5A1AA 4GIRA 1Q2RA 3QY7A 3DGRA 2A3BA 1FFQA 4B3LA 2VEGA 5J04A 1SJCA 1W8SA 4MFDA 1V02A 4XX6A 3W0KA 4CU7A 5GNZA 5EL1A 3VIHA 4PUEA 4QLKA 3TQPA 1U1HA 4HA4A 2CLLA 2OZ3A 3VNJA 1O5KA 4DJEA 1CW2A 2O4QA 1G0CA 1KM1A 2VGGA 2A3AA 3H4GA 4MG4A 4RW5A 2HDJA 1UUMA 2CZ5A 5CPQA 2E3ZA 1O6IA 4JXCA 4IMFA 4K1GA 3PZOA 4C6MA 2QGYA 1PSCA 3WJWA 4HPGA 1CXEA 4OTKA 3S42A 2CLKA 4KIRA 4GC4A 2AGKA 3DOPA 2WKJA 2PD9A 4ORMA 4JN6A 3RJXA 1WE5A 4UB9A 5KSWA 5F4WA 1K9TA 4NI8A 3NQGA 3QLLA 2JEQA 1XRVA 4MDOA 1U5VA 1ISZA 4P8XA 3G0UA 1H09A 4ATDA 2Q02A 1N55A 4JFUA 1J5TA 5FJUA 1HKKA 1VFHA 3TTYA 1CGTA 3TX9A 2OB3A 2V8ZA 1Q85A 4H9UA 1JF6A 4JTLA 4W8AA 4M5PA 5HMEA 2ZXQA 4FMVA 3VGDA 2J62A 6ALDA 5I3FA 4KT2A 3N2XA 5E0KA 1TVNA 4XQ6A 4YJ5A 3PN8A 1R38A 3N6QA 3CZGA 3K8MA 3UVIA 5FCZA 1W1TA 4XD6A 1JZ8A 1LT7A 1UWSA 4HOXA 4P2VA 2QGHA 5K9XA 3AHXA 1HUVA 3GR8A 3V0SA 3OHMB 2VP8A 1PKYA 2HQAA 3I10A 1OGBA 1GZJA 4GK8A 4RZ5A 2ZUWA 2TYSA 3CIVA 1T96A 5DY2A 1NDZA 4MY9A 1FP8A 3FYYA 4O13A 2NLIA 1JZ7A 2YL5A 2ZZ5A 3B0VC 1Q63A 3WZ0E 4GKTA 4HCHA 2XSAA 2VC5A 1KTNA 4TMBA 4NNCA 3N2CA 5REQA 2C15A 3W2MA 1TV3A 3GIYA 2DP3A 3H7VA 3ZJ7A 1I1XA 2QUUA 3L2IA 3UWQA 3PZMA 1KRAC 1ZU8A 3BARA 2OQLA 2VEKA 3TJXA 4MNKA 3KUMA 3CV6A 2WJFA 3V4BA 4ZQCA 5LGXA 2Z2AA 3RU8X 3UR7A 2A7NA 3FEMA 3GD6A 2ALDA 2XVKA 4IP4A 4J40A 2DT2A 1BSIA 2WNQA 4E6MA 1FCBA 3GG8A 1JZ2A 4OQVA 3BV7A 4Z2HA 1FDZA 3ITGA 3ZJ6A 2VMFA 1GJUA 3RX2A 3GXMA 1KM2A 2IPWA 2CPUA 2Y8UA 1IGSA 4WQ6A 3W7MA 4MWAE 5D2YA 2VGFA 4PE8A 3H6OA 3O6AA 2YW3A 3PVFA 1MRQA 1TIMA 3VD3A 1S1PA 1K7EA 3KOYA 1TTJA 1UCWA 1WKFA 5CBIA 4U3CA 3MW7A 3OIHA 3PB0A 4JL1A 2QJMA 3FGCA 4K36A 4GMEA 3KWSA 4KETA 3PZ9A 1B0IA 4E2OA 3OBKA 3RFAA 3P14A 4I9TA 1W32A 1QHZA 3K4AA 3KTSA 3VO0A 1P0NA 4IJRA 5BNKA 4NVTA 5I3KA 1XBYA 1SSGA 3W26A 4GINA 1O5QA 2QHAA 1KCXA 5LNRA 1SZGA 4MJMA 4DLMA 3QR1A 4F8XA 4XSMA 5HNTA 1ESWA 3NPXA 2HCVA 5CZTA 3JZEA 4RZBA 1L6FA 3GAYA 4G1KA 1C9DA 3VDBA 5HWJA 4QNWA 1TV4A 1Q4NX 1MVYA 1J0IA 2FZBA 1XICA 3AMLA 4L65A 5BYWA 4LGXA 3RDKA 5MHBA 3O15A 5CQ1A 4WX2A 1HF6A 3ERPA 1MXGA 3M1ZA 2YCJA 1P48A 1S2WA 1W0MA 3NQAA 1KRCC 1S2VA 4RX0A 3R8RA 1UR8A 2CLHA 3GNDA 4LCRA 4MAVA 1UYQA 4QJ1A 3C3NA 5FOOA 1EDTA 2FH8A 5MKGA 2PLMA 4K39A 4IPJA 2NUXA 1QVBA 3VU2A 2ZQ0A 4JN8A 1S46A 3WBYA 2XFRA 4ERAA 1PDYA 2ZFAA 5D05A 3IGUA 2J8GA 2PDPA 3KWXA 2JKPA 3W1MA 4GJJA 4MADA 1EGMA 2WMJA 3CPUA 2Y7DA 4AY8A 4Z0SA 1JYVA 2ZZ4A 4BQ4A 4BQ2A 3WF2A 2IKHA 3ARSA 2D2OA 4Z1AA 2V5CA 3IJ6A 3IVTA 3PZUA 3PJTA 3T42A 4H7VA 4O0QA 3GU1A 2ZXDA 3P7YA 3PBYA 5LNVA 1EZ2A 3TYCA 3C2VA 3R13A 1L6SA 3R12A 1H5YA 4JYDA 4DJFA 1OFRA 4HHLA 4OU1A 2QCMA 3QTPA 4LJ3A 2YCLB 2XGIA 3SIMA 3QR3A 1T8QA 3L0KA 1XC6A 3DYPA 2WVVB 1W1ZA 4AD4A 5DN1A 3FJLA 3N6HA 1YIXA 1TMHA 1EFZA 1MNSA 3BLPX 1TPUA 1ZY9A 5F7UA 3O8AA 2W3ZA 3WQ4A 3BW4A 4D8ZA 2WLZA 2ZUMA 3W7LA 5FAGA 1O1ZA 3WQDA 5CC5A 1M68A 4MZ8A 1OD0A 1WZAA 4HZ7A 4LNYA 5H1WA 1M1BA 4CQCA 3AUOA 5D8WA 1TV8A 4QGCA 1IZCA 4Z08A 1TR9A 1NQKA 4GZEA 5CAHA 3M0IA 3CL6A 1UD4A 5CPTA 3AU2A 5I7GA 4FXFA 4P5UA 4WSJA 4US6A 1K9EA 4D6JA 1V6VA 1R9ZA 4LB3A 3NZPA 3KTXA 4PMVA 1LL7A 4IMDA 1EJWC 1E5NA 2BHUA 1DQXA 4BY3A 3WDQA 3SM0A 1KM4A 4I9MA 2XUCA 3HPFA 4PUNA 4XD3A 2Z25A 1KM0A 2E4TA 3KHDA 4K6AA 2WHKA 5IDIA 1PZ1A 2J7BA 1ECQA 4XKMA 1MDLA 3AIWA 1M9HA 2WK2A 3AC0A 3CAKA 4HYRA 1CI1A 2JIEA 2WB5A 2J13A 1A5MC 5I3HA 3L68A 4FS9A 2GL5A 4ZODA 4YNGA 2A2IA 4GQQA 2OPJA 1R7AA 4JEJA 2AGTA 4Z2IA 1DVJA 2NLYA 1W9XA 1CBGA 2YDRA 1JNDA 4NI3A 3K8KA 1B2YA 5F1VA 7A3HA 4UTTA 3NM3A 5K2ZA 3MUCA 1PX8A 1B3YA 3Q94A 2IKIA 3NZGA 4HCDA 2GK1A 5L9FA 4RJEA 3KCJA 3RRXA 4PRTA 2GSEA 4B90A 3F2CA 1W9UA 3IGHX 1DEDA 1V6UA 4TMCA 3W07A 4FX7A 8CGTA 4K1WA 4XBKA 2EG7A 3N34A 3MUY1 1DBTA 1FKWA 2E40A 1H7PA 3FHAA 1GVFA 3SFKA 1TA3B 2XVPA 4DEFA 2PWUA 2EKGA 4Z17A 5HA7A 1MFVA 1TPWA 1NAL1 1XYFA 1GCYA 2HBVA 3EXRA 4AZ7A 4S3AA 4BR1A 3QV7A 4H8VA 3OLEA 3PF3A 1YMYA 2WKLA 4M7TA 3VKAA 4A3YA 4J3UA 1KW1A 1VEMA 4JN7A 4K8EA 1E4NA 3CJPA 4HMEA 1PWLA 1QK0A 1UD6A 4U2YA 2A3CA 4YCPA 5HBFA 5D03A 4IGHA 1C91A 4H41A 3MZNA 1BGAA 4YVVA 2ZCGA 3G22A 4US5D 3PNUA 3SW6A 4IH3A 3TSMA 1ZUAX 4O50A 1TUFA 5AC7A 1DIKA 4NZ3A 1K7FA 3DI1A 3U5UA 4C6NA 1KXTA 2GQ8A 3PZVA 3QGKC 4MWAD 4ZTYA 3NO1A 4O11A 2BOFX 4U5IA 4X0NA 4UFHA 5FA5A 2BGQA 4AZIA 2PUZA 3RGTA 2JE8A 5D2VA 4HQVA 4UFMA 5HQEA 3L5AA 4GX8A 3UA4A 1OT1A 3AFBA 1AL8A 2OT0A 2VX6A 4KWVA 2ATMA 3LSBA 3FJ4A 4DB7A 5CGMA 5M17A 4E4PA 4FEZA 3GTIA 4MFEA 4ZE4A 1CXKA 4GY7A 2OOGA 3P74A 2RFGA 3UR8A 5CCZA 2WJDA 4XIMA 4C6QA 4J1OA 2G3IA 2WZMA 1W3JA 3V0UA 1QFEA 5CZKA 4EKJA 1EPVA 3WF3A 4UXDA 2VX4A 3GDTA 4PB4A 4E2DA 2XHYA 4Y9NA 4R85A 1W1B1 3L4UA 1XXXA 1TUXA 1QBAA 4JFTA 3AZTA 1YHTA 4LEFA 4XZMX 4HB7A 3BQ6A 3DFNA 4UTWC 3CWNA 2QAPA 5G1MA 3GBEA 3H55A 3T0TA 2PP0A 2C13A 4P8WA 1QXLA 5HDRA 5D9NA 1YTDA 2XN0A 2ZXAA 2BVWA 4B3KA 1BLIA 3TXZA 1WZKA 3WDIA 2R1PA 3W7IA 4Q22A 2Z1XA 4DRSA 1V3MA 3BXWA 1GG1A 4H9YA 4J3XA 3W1RA 3ORWA 1GJPA 4JIEA 1OB0A 2VFFA 3W01A 1JJKA 3N9SA 4GYKA 3UJ2A 2C1IA 2J7HA 4QSHA 3CO4A 3NGFA 4PTVA 1H2JA 4DBWA 3NCOA 1H0GA 3PR2A 4NNAA 2FTWA 1PXGA 5F2IA 2V2DA 3DFOA 1GVYA 5D37A 2IKGA 5DLCA 4TX8A 1OZMA 3H2CA 1C92A 4NJHA 4HNLA 2WJZA 2R14A 1FWSA 1W5PA 3UWEA 4ZFCA 5AYBA 5GJPA 2VC7A 1NP0A 4PMZA 1OFEA 3KOWA 3NQEA 3HPAA 4UFLA 3VGBA 5AYZA 5AECA 1GNXA 3OO2A 3V5OA 1E0TA 3BJTA 1OC5A 3BAWA 1N8WA 3VGFA 3M0KA 1X7FA 1JUBA 1NVMA 1H7XA 3DESA 3PZTA 3HF3A 1X6LA 3G1FA 3R58A 4A3HA 4IPNB 4PFHA 3KOXA 4IQLA 2DT0A 2A7RA 5C9ZA 4ILSA 4JCMA 3W85A 1KFCA 3W24A 3ZVIA 1QTWA 3H2FA 3B8SA 2JIWA 3I7SA 8A3HA 1K3UA 1XIBA 5H8MA 9CGTA 1QMLA 1EXPA 2PWHA 4FLQA 2PDMA 4CNUA 2EPOA 3PUOA 4ADSA 4CD8A 3NPVA 3ONBA 2XZ7A 3SJNA 2P10A 4AWUA 3ZJKA 3RJYA 2A21A 4Z1DA 3W7EA 2NV9A 1G4EA 1MI3A 3COTA 2J7DA 1QO2A 3D5HA 2DU2A 3M7SA 4XG1A 3TK7A 2VWTA 1RBOB 4F79A 5HULA 3SQMA 3VOHA 4AD5A 3DHFA 3W4RA 3CNYA 2ZX9A 4OUIA 3IVUA 1DL3A 1LWIA 5EBAA 4H9MA 4B2DA 1AK5A 1DWHM 2WCSA 4KEUA 4K37A 1F73A 3DHPA 2DEPA 3QY8A 2DIEA 1JG9A 5BU6A 2XIMA 3DHUA 1CB7B 2GVJA 2VT0A 3S5SA 1V0MA 1OSEA 3A5FA 1OK4A 3UXAA 2XM1A 1HJSA 4MJZA 4NP7A 2I9EA 3IIOA 1UC5A 1KC7A 2XZ9A 5TF0A 4KEVA 1QT1A 3CB8A 1Q6OA 2NSOA 5FL0A 3TROA 1DP0A 3UXKA 5AC8A 1I6NA 2J75A 2ZZ7A 2RJGA 3LXCA 3AIRA 3WJYA 2Z2UA 3ZT6A 4LAUA 5DBUA 5D4YA 4DNMA 1FFRA 1XX1A 1RH9A 1XLLA 3O06A 2Z1VA 3DC0A 1IXPA 1KO0A 4EWJA 3ANUA 3STCA 4EVZA 4HZ8A 1F4HA 3MP4A 3LPPA 1B4KA 1VGAA 2Z1WA 4MB1A 1GHSA 3QMRA 5D32A 3TTOA 4AHPA 1DHKA 1ENUA 3CS2A 1R6WA 3VD9A 3BAYA 1TPVA 3WQ8A 4V2XA 4DZAA 3R11A 1SU5A 1C29A 4H83A 3LI0A 4HJFA 3N25A 1MO0A 1YTEA 1UA3A 2DZAA 1E0XA 1X7IA 4LTSA 2VHLA 1XQLA 1QASA 1W5NA 3L4VA 2RDWA 3HU7A 1MQRA 4LUTB 2ACUA 4ZB5A 1E1CA 4D8LA 4E3TA 1GTHA 4FIQA 1R9YA 2GGIA 3D46A 4I8YA 5A6TC 1FHUA 1CGXA 1GJWA 2CWNA 2YR1A 1ALDA 1OCBA 2GDQA 1W37A 1YE4A 3TN5A 1CXFA 4NAEA 1VC4A 4HNOA 3RNDA 3PB2A 4XB3A 3T8QA 3FA3A 4REQA 2OX4A 2PDJA 4MF4A 3F1QA 4MDPA 2LLEA 2VVSA 1F7BA 1RP9A 1DTNA 1MEIA 3JS3A 1ZTVA 5PTDA 4C1KA 5D38A 1MUMA 1KRMA 1SFSA 2I16A 1TVPA 4QDPA 1GOMA 4I6KA 4FPSA 3N2BA 2AL2B 4FNQA 1S2CA 4IFKA 1PWMA 3Q4DA 1ZBVA 2GDVA 3HJEA 2NV2A 3IPWA 4DUWA 4L64A 3HQOA 1UWRA 3LHWA 8RUCA 3F2DA 3KL5A 1S5NA 2YL8A 1NIUA 1VIWA 3EXSA 5AC6A 1VB9A 1MQPA 3SO7A 1MW1A 5ECUA 1UKSA 2VI0A 4EXQA 4YL2A 5KMYA 3UETA 2B7NA 4FLSA 3WL0A 1LBLA 3BSMA 1AMKA 2ZBTA 2ZOXA 3GZ3A 1PKLA 3BUVA 4GQBA 1N8IA 1HX0A 1ME9A 1DJGA 1BVWA 4MHBA 2XIOA 1TG7A 3KTCA 2YL9A 1E0WA 1MW2A 5LIUX 3L67A 3V35A 1ITCA 4KIEA 4AWEA 3C8NA 3RUBL 4HVXA 3IJ7A 3SIZA 1QWGA 3WLNA 1OJXA 5G1TA 4K68A 4MZ1A 1K7XA 4A3UA 1RPKA 2EG6A 4J2MA 4DJEC 2VOTA 1GKRA 2BVDA 2VQTA 3LRKA 3OGSA 1B9BA 4ZGYA 1Z32X 3T78A 3II1A 3P5ZA 4RW3A 1IXOA 4JNMA 2Y62A 5D02A 2BOEX 1SGJA 5A6AA 3VE7A 2CLOA 2Y6ZA 4YS1A 1WYIA 3NIYA 1UOKA 1PTAA 2FHCA 3EMQA 1GYLA 1G94A 4WDUA 3N19B 2WWDA 2ZRUA 3BLFA 3BJFA 4XK2A 1SFTA 2V6AA 2O0TA 5G4EA 2XH4A 1QNQA 3ARQA 2A3HA 2X05A 5BXRA 1E43A 5DRCA 3T1GA 3O6YX 5IM51 4XZNX 5A8GA 3AJ7A 1PE1A 5AC5A 1E6ZA 3K4DA 3VNLA 2CZVA 4RCXA 4NJGA 3RLHA 2GGGA 3RCYA 1AODA 3T2QA 4JQ1A 1W56A 2QYGA 2GJXB 2XM2A 3CWOX 1V03A 1IEVA 4JTJA 1GG0A 6PTDA 3TTEA 3AS2A 3QHNA 1AQFA 4L56A 1X98A 3CQKA 1BSLA 3MO4A 5RUBA 3B9OA 2WMFA 1TTIA 2ZUSA 1HW6A 1PTGA 1E6XM 3EOOA 1NARA 1PUDA 4Z2GA 2G3JA 2DUXA 4H8NA 3CT7A 2W79A 5ABFA 4CNSA 3WEMA 4CVWA 2RAGA 5A8NA 2R1KA 2E28A 4MSSA 2R1LA 4AY7A 3PBGA 4IHCA 2J9XA 1QI0A 4RUBA 4H6EA 3SRDA 1Y65A 2GVGA 3SDOA 5LXXA 1H60A 5E93A 4LNCA 2VUNA 1B9ZA 2X16A 2ZUNA 1WKDA 4DY1A 4WXZA 2HE8A 2JF6A 1VEPA 3LERA 3M9YA 5FF2A 4JQ4A 4QDMA 3HGRA 2PODA 4OJYA 2GJPA 3JVAA 3EWDA 3RX3A 5AHMA 1UH3A 2O55A 3WMLA 4IL0A 1AA1B 1I2NA 2CLFA 3R43A 3T0DA 1H50A 3B0XA 3UPWA 3NAVA 4EAMA 3SQSA 1UZHA 1XIIA 5HAOA 4X9YA 3GC5A 4H2CA 2I17A 1DOSA 1LL4A 1JD7A 3SY8A 2QMJA 5CJMA 4IX2A 3OVGA 3M47A 3R89A 1GHRA 2E1DA 5AHIA 2ACQA 4YLWA 4ES4A 1Z41A 3CZLA 2NXGA 1J5SA 3OLDA 3H2EA 3CIWA 1NF7A 1GQLA 4EXAA 3HG2A 3GR7A 1ONWA 4C1NB 2QS8A 3MCMA 1B1YA 3I65A 1M01A 1E5JA 4NT0A 3SURA 4TVCA 1S2UA 1FBAA 2HSAA 4OBTA 2PGEA 3NPUA 3FSUA 2VFHA 4R33A 3OZPA 2G95A 4GUJA 3AMGA 4EX4A 1XIDA 3POCA 1IEWA 1NF0A 4MB3A 1CEOA 3UGRA 1WXJA 3LTYA 1PO9A 4WY0A 1KTBA 3W22A 4ZZ9A 1H63A 5AZ1A 4CQDA 3T6CA 2WMGA 1F76A 4RV8A 3FJNA 4UWMA 3AMDA 3UWYA 4W88A 4PFMA 3C86A 3IWPA 4AZHA 1RV8A 4ZR8A 4EPBC 1DORA 1NWRA 2BMBA 1TPH1 4F40A 4RK8A 4JY9A 1D2KA 1PIIA 2CLIA 4Z1BA 4JZ5A 3B8TA 3MV11 2NUYA 3IUIA 1O66A 4O52A 3QEZA 2C7FA 2YB1A 1XPGA 2PDHA 2G8ZA 3T0BA 5BU9A 1DXFA 4XZIA 2J8TA 5LHFA 2XISA 4K8HA 5HMSA 2D20A 2O9PA 3QJAA 2CEQA 1W3LA 3LGGA 5JVLA 5LA1A 3ELFA 2V3EA 5E6YA 1BVZA 1UKTA 3AIEA 3FS2A 3GX9A 3DN5A 3GXIA 1UW9A 5DRIA 5FEZA 4DBSA 5LGZA 1Y8BA 4TO8A 4F9DA 2UY4A 5DEZA 1M7JA 1RQEA 5G4WA 2O9RA 4M8UA 3W37A 3OZOA 4LT9A 3VMNA 3V1PA 1OF6A 1GGOA 1ITQA 1I0DA 4GBDA 1YX1A 4WDXA 1EBHA 3JUGA 3AU6A 4Y9AA 4WEVX 2VFIA 3IJDA 5C9UA 4PRRA 2BVTA 3TYEA 4R53A 2GVYA 1JPKA 3LU2A 3P5YA 4BQ3A 6XIMA 4HOZA 3S5ZA 2FZNA 4AZ6A 3U48A 2ZVIA 3M0JA 1VFMA 4JHMA 4AVNA 1RP8A 1IYXA 5C9WA 2EJ1A 3PZGA 3WLMA 1GUVA 3POHA 2YBTA 3JR2A 3KBJA 2OELA 4AIOA 1AH3A 4GUIA 4W84A 3BLOA 3MT1A 4C6KA 4AMAA 2HZGA 4DJFC 3V18A 4LBUA 5GQBA 2CHNA 1PPIA 4YVPA 4QJ5B 4V27A 3VMPA 1DJYA 1V6WA 4HBKA 1T0OA 4D6DA 1C8QA 4ERGA 1JULA 1RQHA 1E15A 4GJIA 2VELA 2HVMA 4BKNA 2FMNA 3LLXA 3WX7A 4C65A 1BEUA 3APTA 3PBMA 1GYMA 4UNIA 1KWGA 3M5XA 1VFSA 4N4QA 4QE1A 1B3OA 1XHGA 1PIGA 4WKAA 1DWFM 3FYOA 5KZEA 3GTHA 2PGFA 2V2HA 3ZFHA 4DPQA 3L23A 2P1FA 2V30A 1RD6A 1JL8A 1SMAA 4R7WA 4GYFA 3GH5A 3WNPA 4ICNA 1Q6FA 1Q6EA 3CO8A 1B4EA 1E73M 1A4MA 4XIAA 1QHOA 5EY5A 4UBPC 1EHNA 1E70M 1W9BM 1XRSA 4DF0A 1G4PA 3DYMA 2JQXA 2YFOA 3VZXA 1OFPA 4CNPA 2ZRWA 1L6WA 3GKFA 3GIPA 2PSNA 4O12A 1W17A 2IW0A 3TJ4A 3A3HA 2C18A 5CSUA 1R3YA 1YNYA 4XKYB 2ZRVA 3RN6A 3A6OA 4CNNA 3W1XA 2WAGA 1UOZA 4PMXA 1F07A 3EDEA 4EPEC 5CGTA 4HK6A 1ZAHA 1BWVA 4PMDA 1GW1A 2UY3A 3OJGA 3O2LA 4K38A 2DW7A 5HATA 1PL9A 3M5YA 1TTQA 2VDHA 4L9ZA 3URBA 3PULA 4IMCA 2IMRA 3T44A 1UJPA 3QQ1A 2ZC8A 4CQBA 3FGCB 3QQ0A 4U31A 4ZOCA 2DSWA 3PTKA 2Z4GA 4IGMA 2D2GA 2V68A 3B8UA 4NZFA 4JOMA 1YEYA 4MVAA 4WCJA 4UIOA 4I6VA 4UTTC 2Q3OA 1F6YA 4GFSA 1KGXA 3BLEA 4TV6A 1R3QA 3WUFA 1XFCA 4B5TA 2FGZA 4GNVA 3NGJA 1NELA 3PPFA 4EACA 2WLYA 2CBUA 1IXQA 3NEHA 3KVLA 1NWSA 3A21A 4ZMGA 3AYRA 3MVIA 1PZ0A 3VXGA 5KITA 3OBEA 1ZSXA 2P88A 3KVMA 3F7JA 2NVCA 2EHHA 4C1LA 1SM9A 1LUCB 3OA5A 1FWAC 1KKOA 4PMRA 1RJRA 1D9EA 1OWQA 3CPRA 5HMDA 3TZFA 4NZCA 2QNEA 4S38A 2XIBA 4LYPA 4W5UA 3GAKA 2VM8A 4JBRA 4PUJA 3NDOA 1WQ5A 1WXZA 1XH0A 5A6BD 3Q65A 1SW7A 5E0FA 1WNOA 2WC7A 3IAPA 4GO8A 1CPUA 2XN2A 3M0HA 3LLFA 1JPIA 3ARPA 1JPMA 4M51A 2VD8A 1S38A 2J6XA 4QBXA 5H2ZA 1GVOA 1L9WA 3W1PA 1EO5A 2R91A 3TWBA 1W3IA 2ZA3A 4O16A 4IPIA 2VEMA 2WSQA 4I7UA 3DBPA 3C4UA 2OLSA 3C0QA 2R24A 1FWTA 1UJQA 3P84A 4QJ3B 1VKFA 2CLMA 3NURA 1JCNA 2ZRZA 4GD0A 2NX9A 1REQA 2WM1A 4C5YA 4CKQA 3L2LA 4YHEA 2FZDA 3UXLA 1EX5A 3JZUA 3PWIA 4M7SA 3U2EA 2F6KA 3A64A 1Q8AA 1ZAJA 2J79A 4K2SA 1TQJA 1F4AA 3Q2DA 4AX6A 3BVJA 2V5KA 3EWCA 1H7NA 1XYMA 4PODA 5AHFA 3WH6A 2DT1A 1RD5A 2XVGA 4GG9A 4N9EA 2WQDA 3TDFA 4Q6XA 3K1DA 2HJPA 1TZZA 2X09A 2ZUTA 3EA1A 5I6SA 3HN3A 3WFAA 3DFQA 5CLWA 2HTMA 3TC3A 3LXBA 2OZ0A 5C5YA 4AIBA 1AUSL 3ZLGA 3VKKA 1RCXB 3ITOA 5C70A 4PCSA 4TR9A 1UP2A 2PTZA 3EGJA 1DWGM 3NVTA 4QDWA 4KRUA 3L0GA 3UR2A 3DXIA 4AVOA 4RDYA 3HBLA 2BTMA 2YZRA 1HJWA 1M03A 3EAUA 3EKLA 4WUIA 3SUTA 3VCRA 3U3HA 1GVQA 3C3UA 3S2JA 1CDGA 2Z26A 4GY0A 2RHGA 3REQB 2FLIA 1JQXA 4OE7A 3OQEA 1J96A 1HN1A 3GFZA 2XSBA 1NJJA 5C71A 5ABTA 1UWAA 3F4NA 2PLKA 2BLEA 1PBGA 3WH7A 5E6ZA 5EPDA 1GOXA 5BMXA 2DZSA 4A4AA 4DWSC 3PK7A 4C6OA 2DZBA 1XR2A 1IWPA 4WDTA 4HNUA 1PYMA 4I9JA 3GDRA 1EA0A 1V3JA 3BJSA 3WFLA 3CWHA 1BYAA 4MWAB 5BCAA 4CVUA 1FA2A 3THAA 1R87A 1J10A 1VR6A 1J2BA 2PDFA 4JTTA 1JUEA 3CUGA 4ZO8A 1TRIA 4A21A 1DJHA 3N12A 4LYKA 3H2NA 4RE0A 1JZ6A 2X1TA 2UWFA 1WB0A 4DVOA 4O10A 4Y8FA 4ATWA 3WIJA 2CZDA 4UOZA 3QC3A 2BGNE 2Q09A 4ZOEA 3NNTA 2DZWA 3TXVA 3PZQA 2EG8A 1WBJA 3TSDA 3WLLA 4C6BA 4CCEA 4F66A 1GW9A 1GT8A 2ZDSA 3AOFA 1OCNA 4H01A 1Q6DA 5CC6A 1E71M 3T55A 1VRXA 1TJRA 3OOQA 1M65A 2QT3A 3VA8A 4GIAA 2IPGA 3LQLA 1H41A 4TVDA 5CGQA 1E4IA 1CGVA 3MP5A 2E5DA 4GUFA 4WOZA 2QR6A 1QR7A 2C0HA 3VKJA 1EWEA 3UYCA 3SN1A 4DI8A 2OSXA 3CASA 4IQJA 3MBDA 2GK1B 5I07A 4AWSA 1QPKA 3QQWA 2Z29A 1TX2A 3DFPA 2HK0A 4BI7A 4RZ6A 2NQJA 4NAFB 4IZGA 5FJRA 1OX5A 3ITYA 4IMAA 3SCRA 4Q6JA 3UWZA 5D8ZA 2XWDA 3HIJA 3MWCA 4BHYA 2DUZA 3ABQA 4X9SA 4C91A 1DJZA 2YA1A 2J4GA 2QUTA 2WM0A 3ZVHA 4UMCA 4DYKA 1M6JA 1J6PA 1ZJBA 4AXNA 4JTKA 1P1XA 3GHUA 1W3KA 5I02A 3DAQA 1VIZA 3TIMA 3S0CA 4UZUA 3VK5A 4S3BA 5U4NA 1TV2A 4BI5A 5IBXA 2XFYA 1MEWA 2CHOA 3V75A 3R10A 2H8ZA 2P0OA 2NXIA 3SCQA 2R1MA 4LB4A 3GXPA 2A6LA 2WJEA 3A5VA 3EB4A 4P8UA 2E6FA 2BY2A 1HG3A 4LANA 3M5VA 2F6UA 2YBVA 1PHWA 3GVRA 3A4AA 3NQVA 2W27A 4WXYA 1AFSA 3GG0A 3MI2A 1JFHA 1EF2A 4FHAA 4AYGA 5AVHA 1YXYA 5I0DA 2XPKA 3AO0A 2W9MA 4OECA 1LBFA 2VNCA 5KTLA 3GXDA 3TVAA 5E0CA 2PP3A 1EC8A 4EPDC 4JY8A 2C3ZA 3W86A 3E12A 5AOUA 3EMCA 2FVKA 2Y4SA 3AXMA 3V3WA 4Q4OA 3WUGA 2VEIA 4HU8A 3MWAA 1F6KA 4DJDC 1A53A 2PRLA 4WJEA 2Y5EA 2OGJA 2GUYA 3N2OA 4S2CA 2FFIA 1FRBA 3W6YA 4QAWA 1KBKA 1KQYA 1ZQ5A 1H62A 2QPXA 1IEIA 2BVYA 3S2NA 3R4IA 1SJBA 3ONCA 1ITXA 1XLAA 1J93A 3ISIX 4DO6A 1QUMA 1R9XA 2DSZA 4FX8A 3U2OA 3U5YA 1W3HA 3I4KA 5CZ0A 2PF0A 3TYUA 2D24A 3WDRA 1XSJA 5AC4A 3HA1A 3VKBA 3LCIA 3CHEA 2Z1KA 3N18A 3WBEA 3I68A 4QS5A 3SCNA 1J2WA 4LSBA 1TV7A 2ABBA 1UH4A 4PUDA 4NILA 4S3FA 1DIOA 3LCLA 4G7EB 2IKJA 3AXHA 3ZLHA 3GHTA 1XFBA 1YKWA 5I79A 5CXPA 1LP6A 1Y0EA 2ZE0A 4OVXA 2J24A 3WEZA 5CSRA 1FWGC 1XGEA 3NM1A 3MCNA 4QG9A 1TX0A 1KFWA 4Q7BA 1AW2A 1WDPA 7REQB 1B54A 1QNOA 2VZOA 3TJLA 5EMJA 3MU7A 2MANA 3LPGA 2EPLX 4RDZA 1AQHA 3B3DA 3A3WA 1Q3NA 4XSLA 4ZQOA 3VNZA 2G97A 1IQ8A 3C2RA 4V1XA 2DQWA 3R6IA 1JDFA 2XWEA 5A69A 3G18A 2E9MA 2OWXA 4ZA0A 1LL6A 4IP5A 1IR2A 1Q66A 4QROA 4QE5A 4JDYA 2D1ZA 2J9YA 4ROPA 4QG6A 1HZYA 3WF1A 3GNRA 4Q8PA 2HNHA 2OODA 2V69A 5T8GA 3EPMA 4KCVA 1HTIA 1KBLA 1QI4A 3FJ6A 3W9ZA 5LA0A 3PWAA 3WH5A 3QR0A 4NQ1A 3B0YA 4RDWA 3LHUA 4UR9A 4A2RA 2QXWA 1TJ1A 4GJ1A 4TVUA 1ICQA 2J7FA 4J3WA 1EJ7L 2E77A 2B81A 1KFBA 1ZB5A 2YW4A 1YPFA 4CD5A 2ZKMX 5I3GA 1CLXA 4NL1A 3TN3A 5K4XA 4UFIA 4MYXA 3OGRA 2OQHA 1CLVA 2POZA 4W7WA 4S1FA 3A4WA 4JKMA 4OHQA 1Z44A 5T26A 4ZFMA 4N0RA 3TE9A 3C2YA 3ES8A 2PCEA 4HA3A 3RM9A 3K46A 3BG9A 4FOJA 3SN0A 4FLOA 6REQB 3ARZA 4OWGA 3B0UX 3ZLFA 1KRBC 1F05A 1DWIM 3ENLA 2FIQA 1ISYA 4AHQA 4ZVJA 3NSMA 4XBSA 2OLAA 2V2CA 1LRQA 1B57A 3TEVA 1VLIA 3F2BA 1DYSA 3WUBA 1O7AA 3ZSTA 1FY6A 2WHLA 2VZTA 3HURA 4UTUA 1OZQA 1O5XA 2V81A 4C6EA 3VKDA 3QFEA 1QNRA 1EB3A 4KFNA 3L9CA 1KGUA 3VZZA 5M2FX 4CU6A 3GU9A 3QGVA 1MDRA 3KLLA 1D3HA 3H7UA 4G9PA 1EUNA 4PL1A 1VBHA 1OHLA 3PBUA 3LB0A 3LSCA 3QHMA 3BE7A 1NY1A 4GUHA 4D72A 1RZMA 1HNYA 4PCFA 5A8OA 3MJMA 2D23A 1L6YA 4S3JA 5FF3A 3I6TA 3IJLA 1TJPA 1BHGA 4NU7A 4DZ5A 3M64A 1EIXA 3HQPA 3PS7A 3SRHA 3UJRA 1X38A 1OFQA 3NA8A 1GOKA 5TD4A 2HV5A 3W1NA 3O05A 1BWLA 4M29A 3ITTA 2Y63A 2ZUUA 3MA8A 3OYXA 1VH7A 3WQGA 2RH9A 3DFYA 4X60A 4EOUA 4B91A 4DNHA 2DPEA 4FLRA 4L6OA 4YYFA 1BG4A 4LALA 1LT8A 3F03K 2VUYA 4PRWA 4W7UA 4MYAA 2QJNA 3OBAA 3VMOA 1TMQA 2P5NA 5J5DA 3RLGA 1T5AA 4LS2A 3WNKA 1NFGA 4CN4A 3CU2A 3IACA 1XLIA 1EUAA 2ZVRA 4F0KA 4Q4MA 3DC8A 1EGVA 3U57A 4F0MA 1XLKA 4TQTA 1UD2A 2P50A 5HWMA 1DJNA 4GQGA 3QPYA 1KQZA 1T6MA 4ZOBA 3BOFA 1L8NA 2Y8KA 4KEZA 3SN4A 4B5WA 5GJNA 2XINA 4QP0A 3PTQA 3LEPA 4J35A 4A35A 3KE0A 3CHDA 2GGHA 5LNUA 3BQ5A 2RDTA 4BEUA 3LXAA 3GFXA 5CSYA 2YCKX 4GGHA 1FWFC 5BXTA 1V02E 4LFYA 3SGZA 3RYSA 2BSLA 2PLCA 4KS0A 4UCGA 1JZ4A 3HQNA 1C93A 3PPCA 3PAJA 1GONA 1QBBA 3HPZA 3BZGA 3QPEA 2V3GA 5C0QA 3TOYA 3FLUA 4KCUA 5FACA 4NXSA 2VC6A 2FGBA 4GQ0A 2J47A 1LCOA 4NRSA 4JYFA 3E38A 1OCQA 2NT0A 1E3XA 1EP2A 1OK6A 3AICA 3RMEA 5D33A 3KBNA 1FDYA 2PS2A 2PB1A 5HR6A 4AEFA 1R2TA 3KXQA 1EJXC 3ZYZA 1XLMA 2G0WA 1Q2SA 4NUWA 3WQ5A 1HL8A 4DUVA 5E9AA 3W83A 2AKZA 2ZE3A 2NV1A 4EAYA 3ZR5A 3GFYA 2VQUA 2V67A 5JBDA 3BURA 3V7PA 1K8YA 3ITCA 2CHRA 4X22A 1XIJA 2CXGA 3M6YA 3LHYA 5D9MA 3L12A 5I3DA 3TYDA 3WLKX 3V36A 4DLFA 4RLIA 3FNDA 1EKOA 4YTRA 1FWNA 3CAQA 1E9ZB 4MIMA 3ZT7A 4KCWA 3S1XA 2DFAA 1OM0A 4PBGA 3NVDA 1PVNA 4URIA 1P7TB 1DTUA 2HNEA 3QRHA 1HKWA 2X42A 4BZYA 4JFVA 5F4XA 3FXGA 4YXGA 1EJUC 3SCWA 2J25A 3UT0A 3UWVA 1KKRA 3QV8A 4HTBA 1EA9C 4M80A 3EX4A 5CPNA 4F48A 3ID7A 1ZENA 3VNKA 3N15A 3UBPC 3GIQA 4O4VA 1TR1A 4IQEA 1KTCA 2DSKA 4AFYA 3GK0A 2ASHA 3Q67A 3IV3A 1ZCOA 5A2BA 3DBNA 1YDVA 1BYCA 3SJ3A 1HL2A 1TKKA 4JTRA 5BOEA 3VX1A 5A2AA 3KRUA 4NYYA 3G6LA 1OBAA 1HJVA 4R88A 1KLYA 3KP1A 2W92A 2E9BA 5I2UA 3RMJA 3QFWA 1LJYA 1HXJA 4PC8A 2I5GA 4HPHA 5C2CA 4X63A 5JIWA 3CAWA 2W4XA 3THQA 1XD1A 3VDHA 1T40A 5C2GA 1FH7A 2XG9A 1A0DA 1G7UA 4LEQA 5IXEA 4F2TA 3CUXA 4LBSA 2A5HA 2GSJA 4GI4A 2VZVA 3TWAA 3W29A 4B9ZA 4IPPA 3TC7A 1KCLA 3W7QA 4CN6A 4NKCA 4WLCA 1J0KA 4AD2A 4I3GA 4GGBA 6TAAA 5J5RA 4GXPA 1CCWB 4O0KA 2W0UA 3L7RA 2E1WA 5K9CA 3WF0A 2KX9A 4HSNA 3RR1A 2CBVA 2J6VA 3UERA 3A3XA 1VJZA 5DT5A 1P0DA 3G24A 1EJRC 3LQGA 3VABA 1SVDA 1MW0A 4PR4A 3TONA 4EANA 3KS6A 1LWJA 3OB8A 4GO9A 3UZXA 2J7EA 4RNHA 3MC5A 3KCOA 3LRLA 3G3MA 2QULA 3KOZA 1ZCCA 1X8CA 3PWGA 3GNXA 4CQAA 1SZNA 1D8CA 1EC9A 3B04A 4FALA 1FKXA 1HKJA 1E6NA 4WGXA 5LA2A 3BSHA 4CD7A 1SZFA 1H49A 5G1YA 4H9VA 2CESA 3HMCA 4MNJA 2PGWA 3H21A 5LIYX 2C79A 1J8VA 3HZ3A 3W1UA 3MSYA 1O5RA 5K7JA 2VKZG 4IJCA 3UXIA 3ALGA 1V0KA 1UPMB 3DU0A 4E2VA 3CIXA 4GH3A 4HK7A 1K70A 4UQEA 1LG2A 3L5MA 1WOBA 1VD6A 4DO7A 1GOOA 1JZ3A 1P5BA 3BICA 1DWAM 3ZZ1A 4KERA 4FO4A 3SRKA 4WOQA 1XLGA 3ZSSA 3FVMA 4PCTA 4WY0B 3E74A 2V5DA 1XLHA 1TIWA 4R34A 2V0TA 2HK1A 2GQ3A 3AUJA 2GGJA 3BCJA 3S2CA 3CUIA 3PAOA 1MNZA 2Y5SA 4NX0A 1HKMA 5L6UA 4Z2KA 1UR3M 3N4EA 2WQPA 5AY7A 2QV4A 3IJ9A 2PDIA 1TCMA 3AXKA 2H9AB 4H6RA 3BG3A 1G69A 3A47A 3SUWA 3U9IA 4LF1A 2FZ9A 2VURA 2JALA 1XI3A 2YCLA 1U30A 3A4XA 5AHLA 3G0SA 1UR9A 4GIEA 1DJIA 4B15A 3VIPA 2WVVA 2WMIB 3M41A 4JX4A 2EPMX 4P7QA 3VI2A 1BKHA 1V4YA 3WQVA 1J0ZA 4EWND 4WJ8A 3HV8A 5LIXX 3W74A 3MKVA 4OV4A 1QOXA 3MPGA 4RPQA 5DMLA 1DQUA 1HGYA 2BBFA 2PCQA 3C0JA 3KFTA 1VRDA 4YTSA 5DO8A 2WZHA 3FIGA 2B0MA 3UESA 3VM5A 3S6TA 3GE7A 4EXBA 3VIFA 2QCFA 4AZBA 1PZ2A 3SCPA 1UR2A 1QW7A 2D73A 3E0FA 4RXGA 1B3WA 2EKCA 4ZXLA 3AALA 3EOLA 4Y96A 2PMQA 5AN7A 1DJXA 3IV8A 3W7DA 1FTXA 4TXEA 4F0SA 2OKTA 5AVNA 3HJZA 1OT2A 1ZP4A 4JTEA 4L9XA 4QJ4B 3OZMA 3RF9A 4XV0A 3L4WA 3WBWA 3MB9A 2XU2A 2WO5A 3BG5A 3C0SA 4PSPA 4ZSUA 3GS6A 1FOBA 3CHCA 1KV8A 3EYPA 4B4FA 3LBOA 3VILA 1TB3A 3HG3A 5C7VA 1UQZA 3TC6A 3UXDA 5EYWA 4LW7A 4DJED 4E3VA 3QVQA 2C19A 4JTHA 3HM7A 3GG7A 3EXTA 3P6LA 3UJSA 4IIEA 1V6TA 5C8BB 3TTQA 4WVXA 1NWUA 4O1AA 1JAEA 2GVLA 4ZB2A 2GLKA 2ZZ1A 2XH2A 2CLEA 5DCBA 5F2LA 4AF0B 5BRBA 2Z7GA 4UQAA 1X39A 5A6JA 3QHOA 1RVKA 2PAJA 3H70A 4QS6A 2HS8A 3APYA 4CCDA 3CAVA 1R5YA 5SWUA 3NQMA 4B3ZA 3MS8A 3KBSA 3DKJA 5HJXA 3EWZA 2DY3A 3WMBA 2HMCA 4LC6A 2ZX8A 4F2UA 3BV4A 1BYBA 1G9HA 2F7FA 3DYOA 1QK2A 1TA3A 1XSIA 3OZYA 2QLYA 3CM4A 1OEPA 1QO5A 1Q6GA 3TW6A 1WDSA 1EIBA 1JEZA 1F3WA 2BOGX 2QIIA 1FHVA 4LS0A 4WR3A 1Q6LA 2REQB 1PZ3A 1EXBA 4O53A 4B92A 3NPWA 4M81A 3PBVA 4U4MA 2NW0A 2PZNA 1X97A 4ACZB 1SMDA 3CV1A 3OP2A 4XVDA 5CC3A 2V38A 4D6CA 1PX3A 2YZ5A 3USBA 3G3DA 5G2IA 4ATLA 3MHUA 5ECVA 2CYGA 3E5BA 2KAUC 2CKSA 2FYMA 5E09A 2FH6A 4XAZA 1IZKA 4LPCA 3PANA 5D9PA 4FR6A 4NZ1A 2Z27A 3SSZA 3GVWA 2B4GA 1XWYA 4L61A 3CYVA 1PB0A 1W9PA 1BF6A 3VOJA 3RPTA 3W53A 4S3EA 1IIGA 4LVDA 1HJUA 3GSMA 3W84A 2EPNA 1WPCA 3W27A 4TV5A 3G2GA 4ZOAA 3M07A 3NWRA 3EWYA 1GK8A 4OV9A 2QPUA 4B4HA 5CG7A 2INFA 2Z7KA 3GKAA 2ESCA 3O7UA 4O1EA 1J0HA 3LPOA 3GDBA 5XIAA 1OX4B 3WSUA 4GPNA 1QI2A 3UNTA 2GDUA 4C6FA 1CECA 1MUCA 2E0PA 3RO8A 4CCZA 3AHYA 2W63A 4HGXA 4GI8A 5DX7A 2FJUB 5GNXA 2TODA 3MSRA 2D22A 4OBRA 2GJRA 4OUEA 2D0GA 3UCQA 4HHHA 5HWNA 4C60A 3L65A 1K77A 1ZRQA 3N1AA 4R3UA 4F0HA 4V1YA 4TTUA 4ALDA 4HPJA 2YDSA 3AIQA 4J9JA 1OYCA 5CLTA 4PCNA 4FX6M 4Q32A 3RITA 1TZ7A 1P0KA 1HO1A 2Q01A 3G1VA 3S47A 2BXYA 2OWWA 4QHRA 3UZ5A 4AIEA 3AIVA 2PDQA 1POKA 3IVSA 4KESA 4HK5A 2FMOA 2CNCA 3ABOA 1DKWA 3GTFA 5IBXC 1AW5A 3G5EA 4BEQA 1EF3A 1O95A 1OG0A 3QZAA 5M5DA 5A6KA 3CEUA 2E6DA 1LLWA 1WDDA 1AL7A 4QEEA 3N9KA 1G6CA 2FTPA 4XZLX 2DIJA 7ENLA 3F4CA 1BF2A 4TTGA 3S6DA 3L5LA 5KEZA 3T09A 1REQB 2DVTA 4G2DA 4Q3MA 4WF7A 4NJJA 1TWDA 2VR5A 2IS7A 3MBFA 4TOQA 2XIIA 2F2HA 2YXGA 1MW3A 3UF9A 3NL3A 2ISVA 4HJWA 3BGGA 3W1QA 3RM4A 3ZQ9A 3UCDA 3BCDA 3ZWSA 1YBQB 4LAMA 5E9XA 4AZCB 1WKEA 2XTKA 3LZ3A 4I90A 1PKNA 1A4LA 4HN4A 1ISWA 3RILA 2YKKA 3MHFA 5E5CA 5C9XA 4J27A 4JR5A 3ANVA 1F3XA 1DXEA 2VC9A 3WMCA 1DJQA 2C0AA 4AVFA 1E6PA 2VZUA 3LHTA 1HL9A 4HHPA 3STEA 1WAUA 1B30A 3PZIA 1Q45A 2Y0FA 2DGAA 3LM3A 1E51A 1W9DM 1XYZA 3MMUA 3N4AA 4E8DA 2XYLA 1Q7QA 3LM7A 4O8AA 5LZLA 1JCYA 3R25A 3MVTA 4JD4A 4YWSA 5BROA 4DN1A 1VPQA 4AD0A 3I6EA 5HJLA 4GFIA 1MXSA 2DV0A 1K8XA 4U2ZA 4FF7A 4PUKA 4JQ3A 2WVUA 2CLPA 1I75A 4N9CA 5GVJA 4DBDA 4IG2A 1UQYA 2H6RA 2DJXA 4LAZA 2ON3A 3IUHA 3JW7A 4KFPA 3EWUA 4DZIA 5FJPA 3HO8A 1VHCA 4AUBA 3TA6A 5I24A 1K6AA 3TV8A 3E2RA 4WD0A 4KPLA 3DFTA 3N4FA 3KBVA 4EK7A 1WDWA 3GXFA 1KB3A 4GRSA 2MNRA 3GH7A 4LUSB 2DSVA 4DJFD 3SCOA 3ITVA 1XM3A 3WLRA 2A4AA 2INZA 2IUZA 4PEKA 2PC8A 1RSCA 3EEGA 4ML9A 1LBMA 4PMQA 2D2HA 3CUZA 4O1FA 3DFSA 1XISA 1LF1A 1XH1A 2ISFA 5D30A 4JX5A 2I56A 4MM1A 2JBMA 3V0TA 2PD5A 1UASA 2ISWA 4ZSTA 1YDOA 2NQ5A 4GBUA 5EMUA 4QQUA 5DMMA 2OEJA 2ABAA 1TCDA 3NQBA 1RBAA 3N11A 3CYJA 1XCFA 5EMLA 2PP1A 2DZPA 1SO4A 3LZ5A 3B40A 1R3VA 2WNWA 3CTTA 3RU6A 4I5UA 5FEWA 1AZ2A 3LYEA 2YA0A 2WC4A 4LOCA 3SUVA 1SR0A 1Q13A 2OX1A 1HVQA 3T8LA 3TR2A 3W7OA 2CW6A 2RGLA 1BRLB 5DQPA 1SPQA 4TUFA 3VUPA 3LENA 1VS1A 4JNYA 1UH2A 3QW4B 3ABZA 2CERA 3BPWA 2HPMA 3LCWA 4GVGA 5T9CE 1AMYA 4XUYA 4JGDA 1DE6A 3F5JA 4WKFA 1R7OA 1J9YA 5HR7A 3UY8A 1NU5A 2X1RA 1WO2A 4Q4KA 4XBJA 3IAQA 1FCQA 2WPBA 4Q7NA 3WEOA 3PG9A 2DW6A 1RCQA 5C9RA 1WA3A 4HTYA 4LUTA 1WCGA 4PULA 2X1UA 3BLIA 3WBXA 1F9CA 4LC8A 4M6VA 5I00A 3WO8A 2BFGA 4LUYA 1VHNA 4C6DA 1J4EA 1VCGA 4H3DA 4PB3A 5EBUA 1Q5MA 1HJQA 1MEHA 5M03A 1EOMA 1AH4A 4WJXA 3LRMA 4NYUA 1HVXA 2YSWA 3S83A 1XV8A 3SCVA 4ICMA 2V9DA 1PJ9A 3THUA 2Y1HA 3CHFA 1JUKA 3N04A 3PSVA 5CPLA 3UR5A 1S5MA 1S2AA 4JTGA 3XINA 4LRSA 6CGTA 3CB3A 1G5AA 2AL2A 2VGIA 2FVLA 4YMZA 3GW0A 4DWSA 5DXXA 3S5NA 3THDA 3GXTA 4L4LA 1JF5A 4QIUA 4U33A 3P62A 4I8DA 1T99A 4DUOA 2GVEA 1V7YA 3B8IA 5A5WA 4QRNA 2IQTA 3WD4A 1PS9A 3H12A 3ZJ8A 2RDXA 1ML1A 4FP1A 3PBWA 4AIUA 4O1BA