3W1TA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-095
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-095
rcsb
source organism Trypanosoma cruzi
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1tA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1tA01
4A2SA 2WNZA 4BI5A 4O1DA 3BARA 5AFDA 3LXBA 5DCEA 1JCLA 2X30A 2CZFA 1ZJIA 2VFFA 3HGJA 2JBMA 3DFQA 5DBTA 1FCVA 1HO4A 2CWNA 2EGZA 1WYIA 3PF3A 1O4UA 1U83A 5CZ0A 1TPUA 3GYEA 1GOXA 3KVLA 4KFOA 4LT9A 4QNEA 2DU2A 3B05A 2ZCGA 2O7QA 4RXFA 4UFMA 1OYAA 4IMFA 2DORA 1FCBA 1XXXA 3BV4A 3C3NA 4OT7A 3UWUA 2Y6ZA 1J4EA 3NYZA 3RLUA 2A5HA 1DQXA 1VH7A 2V0TA 3CT7A 2C0AA 3GXPA 4NNCA 4CLMA 5KTLA 5AHMA 5KITA 1J2WA 2V2DA 1ICSA 3W7RA 3UXDA 1LBFA 1OK4A 1SUXA 1YADA 3JRKA 2WSRA 3QPZA 3ABQA 2QUVA 5I3IA 3CHVA 3IIZA 3CEPA 5K9DA 4E0CA 1RPXA 1YXDA 4DQWA 1F76A 2E6DA 5I3JA 3ATZA 3O15A 3BW2A 1S5TA 2NLIA 3TSBA 4P61A 4NXSA 1KTNA 2VELA 3TXVA 3W7EA 3HG4A 4JN6A 4WOZA 1OYCA 4DXVA 4UTTA 4IMEA 7TIMA 4DF1A 1XC4A 1W5MA 4UFHA 3W73A 2ISWA 1EPXA 1PHWA 2YR1A 3W3OA 3GZ3A 4RLIA 4JTEA 1KV8A 1XI3A 5T26A 2VFEA 4B5NA 2VEMA 1F7BA 4WY0B 3W87A 1D9EA 1OFDA 4LY8A 4O52A 4BI7A 5I3FA 4BR1A 3UPBA 3NGJA 3S8HA 4ORMA 1JCNA 3HIJA 1HTIA 1OFOA 2QCCA 3LB0A 4NX0A 5H91A 1NAL1 5AHNA 5TQLA 1D3HA 2V2HA 3C2EA 2C3ZA 1AW5A 2CFFA 4WY0A 1SO5A 5TIMA 4WQ6A 2RDWA 3LDVA 3H53A 3KOFA 2FIQA 1OFAA 2YFOA 1YPFA 3A9IA 3QSRA 5HWNA 3NZ1A 2H3DA 2ZBTA 2V8ZA 2A7RA 3BLEA 1KFEA 2OT1A 4XBSA 3PWAA 1QPOA 3M5ZA 5KSWA 3TX9A 2DZPA 2VFHA 1JUEA 1PCKA 3BG9A 4KWWA 1L9WA 1EUNA 1AW2A 2OT0A 4IPIA 3LCLA 2V5BA 4O1AA 3ZWSA 3L0NA 1TPDA 4O16A 4M7TA 2Q8LA 2YW3A 1V7YA 3G1HA 1V5XA 4BF9A 3T4CA 1A5SA 4JTTA 3DHFA 4UTWA 2UV8G 3P60A 3THAA 1B9BA 2YW4A 3EEGA 4IQLA 1AW1A 4O4WA 1GPWA 2XN1A 2VFGA 2NWSA 1YXYA 1I2RA 1P1XA 3QJAA 4WOQA 4DBDA 2X1SA 1K03A 4O4VA 4RK8A 4IMGA 3L0GA 3DH7A 4DPPA 4WXZA 3QF0A 1ME7A 2C19A 1TPC1 2VEKA 4NNBA 2J88A 3NDOA 3QMTA 4XBKA 1VHNA 1I2QA 3LERA 3R89A 2ZZ2A 4Z1DA 4O8RA 3DFOA 1ME9A 3E02A 3QZEA 3LOTA 3MHUA 3FJLA 5EBUA 3NL3A 1WV2A 3LXCA 4NX5A 1OABA 3P5YA 4I9AA 4GUIA 3P80A 4MFEA 1TV7A 3W1MA 5DN1A 4IUOA 1A50A 4AWSA 3DFSA 4TR9A 4UTWC 3O6CA 3INPA 2A21A 3G1YA 3W1UA 3SR7A 4UMAA 5D05A 2QUUA 1VYSX 2QJIA 2RKXA 4ONVA 1XL9A 1N8FA 1KTBA 4UFLA 3B03A 4PL1A 2A85A 4AVFA 4XTDA 3M16A 4K8EA 4O17A 4CNPA 1JUKA 4FX7A 2B0MA 5FESA 1YXCA 3BG5A 5HR6A 2ABAA 2E6YA 3DGRA 1TPEA 1VCFA 1PCWA 3G1FA 1GG0A 1GVSA 5J5DA 3IRDA 2E5CA 2BX7A 1PVNA 4K38A 1K8YA 2HS6A 3UY7A 2RDUA 4GFSA 2E77A 5LNVA 5LNSA 3LX9A 3W74A 1R2RA 5C54A 2H8ZA 5EPDA 4BWLA 3A24A 1W8SA 3GAKA 3TJLA 3S5NA 3EKLA 1FCUA 1NFBA 2RHGA 2QJHA 3N2MA 1IXQA 1QDSA 1I8JA 3O8AA 5H2ZA 1A5AA 4RCXA 1L6YA 1F73A 3WJZA 3TAOA 3V1PA 5AHEA 4NZFA 3OA3A 5G1YA 2EF9A 4WZHA 1GZGA 4LOCA 3STFA 2Z6IA 5D03A 5LKYA 1XCFA 3UXAA 3IEBA 4ZQMA 3LTPA 4JTJA 2ISSA 4MJMA 3G8RA 1JQVA 4O57A 2RDTA 2KZHA 2HTMA 3W1NA 4O0ZA 3OVPA 4MVAA 2H90A 4O19A 3KAOA 2JGYA 3QEZA 1UASA 2CLFA 4NVTA 3W2NA 3TJXA 3E12A 3B0PA 1O5KA 3MHGA 3W7MA 2RFGA 4TU1A 3NG3A 5D37A 1KFBA 1H7WA 1W56A 1BTMA 4Y6GA 6ALDA 1YDVA 3T40A 3NR0A 3NOEA 2EKCA 6TIMA 1P4CA 4RZ4A 4LS1A 4UNKA 3G8EA 1DJQA 4IWWA 4IXXA 1TQJA 4WX2A 3W76A 2E09A 3ZWTA 2CZDA 3LCFA 3W86A 1RQBA 1X8FA 1FXPA 4LS2A 3P8JA 5AC8A 3QMSA 2YPIA 4AHQA 1WAUA 1P0KA 5CPOA 1LZOA 2XN2A 4A2RA 4O14A 4UTUA 1KTCA 3TK7A 2ZA2A 5L6UA 3GDKA 4RZ6A 3FIGA 4LVAA 3NQVA 2W79A 3LCHA 3DXIA 1UUOA 1LM1A 3W1TA 1N7KA 3PBWA 3B04A 2OCZA 1LLWA 4DO6A 2V82A 1A5BA 4ZQPA 1VCGA 3M6YA 1F74A 2GPTA 3QW3A 2EPHA 2FJKA 4OHQA 4LVBA 4P2VA 4AMAA 4O1BA 3MWAA 4GUGA 4CNOA 4CQ8A 1VQTA 3LRMA 1R47A 3OIXA 3BVJA 1ZENA 4TIMA 2A6LA 2ISVA 1QPNA 4JTIA 3PR2A 3RF9A 3BPWA 4K6AA 3NO5A 3CB8A 2A2IA 1UUMA 1MSSA 3FYOA 2PRLA 2WNQA 5A5WA 1VR6A 4FNPA 2QDHA 3GR7A 4XKYB 1N55A 1VS1A 3OEXA 1F05A 4XUGA 5G5IA 4ZL1A 1DV7A 3T7VA 1GQNA 3NNTA 2C18A 4JXCA 1P5BA 4PTNA 3FYPA 4JIQA 3LGEA 2CLKA 2ZDRA 3UWYA 3SY5A 4TMBA 4XKYA 2X2GA 1R30A 2NX3A 2NUXA 3OVRA 1VJIA 2Q3RA 4KFPA 4GNJA 2Y89A 3CM4A 3LHTA 1KM4A 4GXMA 3SW6A 2I9EA 4MLJA 4UUIA 1FDYA 4N9BA 3PULA 2ZRYA 2ZZ3A 3LBCA 3QC3A 1TTIA 1GWJA 1TJRA 1VLWA 4LVFA 3A5FA 2YX0A 2VC6A 1OK6A 4NJKA 1WXJA 1OF6A 2QCFA 3NL5A 3W7JA 3FKKA 4S1FA 4E2DA 3LI0A 4O54A 4FNSA 5IBXC 3G24A 1DORA 3N3MA 3QPYA 1OF8A 2LLEA 3TW7A 1GT8A 8TIMA 2V81A 3UQNA 5KZDA 3W7HA 1FXQA 3ZS4A 2WPBA 3ATYA 4AEOA 1RD5A 1XBYA 1TTQA 4HNNA 4AF0B 1Q3NA 1KFKA 4GUJA 4K7YA 4A3UA 2FLIA 3GLCA 4PH6A 1Y0EA 3A22A 4HSOA 4UTKA 4AF0A 4FEZA 1DJNA 4ICNA 2WV8A 4OV4A 3PBYA 4ADSA 1WDWA 3GR8A 5CPNA 3UWZA 5IM51 3C61A 3IVTA 2J6XA 4UTLA 3GVGA 4ORIA 3B4UA 3L65A 5G2WA 4LUJA 4YXGA 2DZVA 4A29A 5GVJA 3TIMA 3L0KA 2WKJA 3SECA 3PY2A 1OVDA 1EP2A 1SW7A 4UC5A 3N9SA 2C13A 1LLZA 3DFPA 2ZRZA 2J9ZA 3W88A 1A53A 3GNDA 1UBSA 3GB6A 4WXYA 3MP4A 1G69A 1K7FA 3HJZA 5MHBA 3W7KA 2CLIA 1GVFA 4QITA 2ABBA 3LLFA 1G4EA 3MYPA 4LVGA 2E68A 4QQ3A 3CIWA 2QAFA 3P81A 3LLDA 3DFTA 3QQ0A 4UTMA 1ONRA 4M5PA 3W84A 2AGKA 4XTIA 3SIZA 3NPVA 3IGUA 5EYWA 1DVJA 4N6EA 4S2CA 1DKWA 4N4PA 3IIPA 1HFBA 2F7FA 2FPVA 4FO4A 4C1KA 4NJGA 2P1FA 3TROA 1H60A 1H7OA 3W2MA 3K30A 4L4MA 3NQFA 1X1ZA 4GE8A 3RFAA 2QAPA 3N2XA 4LUIA 1DOSA 1YTEA 3L21A 4HPJA 4OBTA 4DELA 1J5TA 3NPXA 1THFD 5AHFA 5CKSA 1K8ZA 5DBUA 5F1UA 2P0OA 4QISA 3SFKA 1KV5A 1FWRA 1T99A 1F2JA 2E6AA 4UTIA 2Y88A 4DF2A 4LWWA 4YMZA 4DBEA 3DAQA 3EXRA 3G1XA 2BZNA 3LM7A 5KINA 3PB2A 4JY9A 5F4XA 1W3IA 2YZRA 3N9RA 4UR8A 1JCXA 3LCWA 4H3DA 5AYZA 5LHFA 1O94A 1LBLA 4OU1A 3A21A 1TJPA 1F6KA 2Z1BA 4TO8A 4JY8A 2A0NA 5C5YA 3G1VA 1TSIA 3ABSA 2AQWA 3P62A 4X2RA 3N14A 3HMJG 1Q6LA 1W37A 4QIUA 3E96A 2Z6JA 4CNNA 3QW4B 5CGQA 5EL1A 3NQDA 5K2ZA 2H3BA 2QCMA 4AHOA 1P0NA 1Z41A 4OWGA 3MI3A 3CQ0A 3TR2A 1JULA 3LRKA 3PSVA 1ADOA 1ICQA 4Q4KA 1EWDA 4UMCA 5F1VA 3CPRA 2ZZ5A 3THQA 4GUFA 3NL2A 3W1LA 3UPWA 4GJ1A 1VLIA 4WJEA 3TFCA 5BW6A 4PL2A 3F03K 5HWMA 4IOTA 1W54A 2ZRVA 3O06A 2QCDB 3S1XA 1SZEA 4I7UA 4JS3A 3W2LA 3PG9A 2JKAA 3HPSA 1M7PA 2OZ0A 3JS3A 2CLHA 5BNKA 5FF7A 3TCEA 4OGZA 4HIBA 2HMCA 4UTTC 1PIIA 1TQXA 5D32A 2X1TA 5D30A 4FX6M 1KFCA 3GXTA 2ATSA 3TSMA 1QOQA 1LCOA 2Q8ZA 1WQ5A 3GKAA 1KBJA 1BWKA 1XKYA 2C15A 5F4SA 2ZA1A 5I3GA 1Z42A 4ZQOA 4LS0A 4LV4A 1LTDA 5HMSA 3VE7A 5TBOA 5BOOA 1NEYA 1W3NA 5HNRA 2FQIA 3DZ1A 2TRSA 1ALDA 5D2TA 4ZZ9A 3M43A 3MO7A 3CU2A 3N73A 3USBA 3GIYA 3YPIA 4J9JA 4N2YA 2G96A 4MY9A 2H8XA 2CLOA 2JK2A 3M0ZA 1S3HA 1OYBA 3B0UX 1B57A 4HNTA 1H50A 3NPUA 3WK2A 2G97A 3W1PA 2VXNA 3I68A 3BW3A 3C8FA 5FF4A 1SZFA 4NT0A 3G1AA 3PVFA 1H5YA 5HR7A 2CLMA 4FNUA 4MJZA 4DEFA 3S6DA 2A7NA 5D2VA 4UTHA 3DU0A 1EX5A 1LROA 2XN0A 3TQ0A 1O95A 3W6YA 1B4KA 3L68A 4HKPA 1H7RA 3C2FA 3LHYA 3G0XA 4FF7A 3G1SA 1KBIA 3V75A 4UTJA 3DI1A 2NUWA 5LGXA 3ZR4A 1TRDA 4JDBA 3NM1A 1ML1A 4JD4A 2Y7GA 1XUUA 4M6VA 1TPB1 5K9CA 1VC4A 3IVSA 3NQAA 3KVMA 1WOAA 3TFXA 3B0VC 4JTLA 2Y85A 3CEUA 2PC4A 1HG3A 5FI8A 1QFEA 1XBXA 3NQCA 3WK3A 1M7OA 5EMUA 1VRDA 5I3HA 3UYCA 5HULA 4AHPA 3Q2DA 3UWWA 2F84A 4QAIA 5BRBA 1KM2A 2H6RA 2Y63A 1R46A 4L4LA 4MZYA 3EWBX 1JUBA 4W9TA 1H7XA 1NF7A 3LRLA 3PB0A 4HNUA 1GTHA 1AK5A 2B7QA 4U4MA 3CLMA 3GDTA 3M47A 2E5DA 5K3VA 2GVLA 5E93A 3BW4A 1GTEA 3PBVA 4NJIA 3ABRA 4LC8A 3PUOA 3RU6A 2CLEA 2CU0A 2YXGA 3NVTA 2VFIA 1OX4B 3H55A 4UMBA 3P5ZA 3QQ1A 2YDAA 4QSHA 4HHPA 4CCEA 4O10A 4LRSA 1ZFJA 1H61A 2BWGA 4LV9A 2TSYA 4I7VA 1SPQA 2ZQ0A 1K3UA 2NXHA 3W71A 4GC4A 1OX4A 4BWLC 3U8GA 4XWUA 3GNNA 3G1DA 4A21A 4Q33A 3SI9A 3A5VA 2CZEA 3S5YA 3C52A 3AO0A 1TCDA 2A6NA 3MBDA 5DXYA 3VI2A 1OX5A 2JGQA 1Z48A 4LVDA 2BSLA 3W1QA 1QWGA 1W5OA 5E1QA 1VYRA 3FEMA 1OG0A 2WQPA 4R34A 4YLWA 3M7WA 4Y90A 2YSWA 4FX8A 1RZMA 3VFLA 3O6DA 4QNWA 3I7RA 3UZJA 2G95A 3EX6A 1S5WA 3W7DA 1QPQA 5LHEA 1A5CA 1RVGA 5C2XA 5FF2A 3UWQA 2QCGA 1DQWA 2DZSA 3TNOA 5K4ZA 3N34A 3TV8A 1NSJA 5HJLA 1GYNA 3LCIA 4QJ1A 5CPLA 3PBUA 5CG7A 4K8HA 3MP3A 5LZLA 3W75A 3NQEA 2FPTA 2WSYA 2PCQA 5I3KA 2NWRA 1QAPA 4U28A 3W1AA 2CZ5A 3RK8A 2CW6A 1HL2A 4BFAA 4FNRA 2WNNA 1I4NA 4K37A 1QO2A 1ZAJA 3NQ2A 2C14A 5F4WA 1LRQA 5L9FA 2GQAA 3MMTA 3F4WA 3T55A 5AYXA 1VPXA 1R2TA 3HOJA 2V30A 1JCJA 1K7XA 5LGZA 1LRNA 1RR2A 4NZJA 4YCOA 1L6WA 1QMLA 1WA3A 1SO6A 3L5LA 1M6JA 4O50A 3NZRA 1SR9A 4A22A 4EVZA 3LHWA 3DBPA 4R7JA 2VENA 3NQ6A 3QRHA 5HUPA 3S1VA 4RV8A 5D04C 4N02A 4JGDA 3EX3A 1ZY9A 3S42A 1NVMA 2GVJA 3M44A 2DJLA 2YYUA 1WBJA 2C16A 4ADTA 4OQVA 4JYFA 5AN7A 2VOMA 1FWWA 2Y7FA 3GDLA 3ZFHA 3IIOA 4CQAA 3LV6A 4EIVA 4WUIA 1BKSA 3KRUA 4MZ8A 1OFQA 2QR6A 3LHUA 1L2UA 4FB7A 1AMKA 4GRSA 1DHPA 1E51A 3NAVA 1AL8A 1F5ZA 4G1KA 1QO5A 4WD0A 4PODA 2C1HA 4PFMA 1JRBA 4KKXA 1JCMP 3FFSA 5F2LA 3Q37A 4N6FA 2B7PA 4UFIA 4MKNA 3QH2A 1LOSA 1EP1A 3W7IA 2NZLA 3T78A 4Q32A 3C6CA 2ZTJA 2QCNA 3W07A 2V9DA 2OMAA 2FFCA 3OHIA 3W7LA 1OHLA 1Q45A 3HPXA 5FEPA 1KM3A 3S5ZA 4LTSA 4JEQA 1LRTA 3B8DA 1ME8A 3TDFA 1FBAA 3M5YA 1CX9A 3U2OA 3R5EA 1LBMA 3EX2A 4MPQA 1MEIA 2ZRXA 4DF0A 1SFJA 1H1ZA 4NU7A 1EP3A 2QCEA 3FOKA 2GJNA 3PAJA 1IIGA 3EB2A 1JRCA 3W7OA 1TMHA 2FTPA 4YL2A 2Y7EA 3M5VA 3W2UA 1B3OA 4O15A 3UZ5A 3LHZA 2ZFAA 3NPWA 5FF0A 4E2BA 2A7PA 1LYXA 5ABTA 1FWTA 1G4PA 3TC7A 1TV8A 3HG5A 1L6SA 1EIXA 4FHAA 3I6RA 1W5PA 3TMLA 3CWNA 4NXKA 4ZVJA 1LOLA 3W7NA 3M41A 4O18A 3W7GA 3W2KA 2RH9A 4QM1A 3BGGA 3GDRA 2NX9A 2Y70A 3F4NA 3UWVA 5EY5A 3PUEA 2QCHA 5AHLA 3LI1A 5EA9A 4IX0A 3WJXA 4H6KA 1PHQA 2QEZA 1WBHA 2X16A 3O07A 3SGZA 1GVOA 1QR7A 1ZCOA 4K36A 2FB3A 3FLUA 3BO9A 4Z08A 3L9CA 4LW7A 5FF3A 4LU0A 4MIMA 3LCXA 3LCGA 3ANYA 1FY6A 4JDYA 3H54A 4MYAA 4UFJA 3FA5A 5F2MA 2NXIA 3I7QA 4JIPA 1M5WA 4HT3A 2TPSA 4RR4A 5U4NA 1W5NA 4RZ5A 3P8IA 2J24A 2YYTA 1TPH1 3UY8A 3HBLA 3STEA 1AL7A 1K7EA 2ALDA 4AAJA 1DL3A 1CW2A 5C6MA 1HO1A 2DZTA 3TE9A 3NQMA 3GXNA 2E1DA 3MI6A 3P82A 2J27A 3GX9A 4MOZA 3E0IA 4PEKA 3W1RA 3VE9A 3G3MA 3VNDA 2G5WA 1SSDA 4IMDA 2FB2A 2JKEA 3HPZA 2O7SA 5A8GA 4JICA 1UB3A 4CCCA 2XFWA 2DP3A 2ZZ1A 1Q6QA 4FXSA 2WOQA 3OVQA 1QOPA 3NQ8A 2NV2A 3HQ1A 3W7PA 3L2IA 4OE7A 5DELA 5FEZA 5G4EA 1EUAA 3GK0A 1T8XA 4JX5A 3KVJA 4JTUA 4TX9A 3TC6A 1IIHA 3EXSA 4Z1BA 1X6UA 2I1OA 4K39A 2R8WA 3KFTA 3LV5A 4NJHA 5DCBA 1HUVA 1FQ0A 1OFEA 3OG3A 5LNWA 3C0JA 3G0UA 3HGOA 4O28A 4UFKA 4H4IA 3KHJA 4AWTA 1C8VA 3NXFA 1XDMA 1ZALA 2A4AA 3PG8A 4DO4A 3M1ZA 3GKFA 4MY8A 2ZYFA 5HQEA 3C2OA 1K02A 2ZZ6A 2PRMA 2VEPA 2CLLA 1VCVA 3DKJA 2ZZ7A 3MYOA 3EX1A 1JCYA 4KWVA 2YCEA 3QFEA 3WJYA 3P7YA 1NF0A 3TQVA 2ATMA 2X1RA 3MHFA 3SZ8A 1DBTA 3P74A 2ZRWA 1G7VA 3EX4A 4JTKA 1SQ7A 3CC1A 2OJPA 3LTYA 3NA8A 4IJBA 5E0KA 3B06A 2B4GA 3E9AA 2E5BA 1JR1A 2QCDA 3JR2A 1JJKA 3WJSA 3RLVA 3M5XA 2EAWA 1D3GA 1EEPA 3W2JA 1YPIA 3PS7A 3Q94A 4ZQRA 4JTSA 4I7WA 4FXRA 1YYAA 3EWUA 1RQEA 3R12A 5BMXA 4WY0F 3TMQA 1GJPA 2YFNA 1TREA 2DJXA 4HN4A 5FEWA 1I2PA 1W3TA 3LBMA 3G18A 1W0MA 2PURA 4IMCA 1WX0A 5F2IA 3SSJA 4CQ9A 4UXDA 3TW6A 2WO5A 1PE1A 3W70A 1KLZA 2FPYA 1QNVA 3ABOA 2FDSA 4FIQA 4O13A 5D38A 1IGSA 4Z1AA 3W7CA 2P10A 4M19A 1YDNA 1EWEA 1C9DA 1T96A 1OFRA 3OBKA 2Y61A 4EOUA 2BXVA 1IF2A 1KM1A 4CCDA 1G67A 1IXOA 4IXHA 4Z1CA 3A23A 1KM6A 3C56A 2YGYA 3I7SA 3GDMA 4X22A 4IGHA 5DLCA 5D02A 4RKAA 3M9YA 4O1CA 1XM3A 1KM5A 1TB3A 4N4QA 3BG3A 4NNAA 5FEXA 3RNDA 3W7QA 4UIOA 4Y8FA 5K4XA 2NUYA 4UR7A 1LOQA 2GJLA 1T0OA 1OFBA 4YWIA 3HG3A 4R33A 3TQKA 1SW0A 2Z0IA 1G4TA 1TRIA 1H63A 3L5AA 3C2RA 4MFDA 3GAYA 2DZWA 2PRHA 5K9XA 1SFLA 1TYGA 3G0SA 1ZAHA 3S1WA 1H51A 4M7SA 4DPQA 2R91A 5CZSA 2X1UA 3QSTA 3W1XA 1QPRA 3UD6A 1H1YA 3HGRA 3EWYA 4ML9A 2ZA3A 3HG2A 4K7VA 2QDGA 1Q6RA 3O6YX 1SU5A 3SJ3A 1FCQA 2IQTA 4JX4A 3S1UA 3KXQA 1W5QA 1MXSA 1FUYA 3IV3A 1TPVA 1O5XA 1SSGA 4MZ1A 4Y96A 5J5RA 4JYEA 3IVUA 5D2YA 2Q3OA 3I65A 4O53A 5AHIA 1ZAIA 3IIVA 2DZUA 1TIMA 1KA9F 3MP5A 2QKFA 3D0CA 3HF3A 2V5LA 1CI1A 1TTPA 3G3DA 3S9YA 3MUXA 4MY1A 2HSAA 3ELFA 1PS9A 5D09A 4JYDA 1O60A 3NEVA 1YTDA 4N9CA 3TH6A 2Y62A 1KFLA 5KZEA 1K8XA 4KFNA 1H7PA 4JTHA 4M6PA 5K7JA 1PL9A 1C29A 2QF7A 3SGUA 4BK9A 3Q58A 4EF9A 3O1NA 3KRSA 2AAMA 3N19B 2B7OA 3W22A 1TO3A 1TTJA 1I45A 2GQ8A 3LTSA 3TSDA 3O63A 5DCDA 2DZXA 3BLFA 1G4SA 3S5OA 1OJXA 3NL6A 3STGA 3MI2A 4IX2A 4JX6A 4ZQNA 3G22A 4R53A 2R14A 4IPJA 1VHCA 5D2XA 2ZZ4A 4PC8A 5DY2A 3UNDA 3P61A 1MO0A 3DI0A 2WSQA 5DXXA 1I2NA 5HWJA 1Q6OA 4NQ1A 1SW3A 5CZJA 1W1ZA 4S2BA 1KM0A 1G6CA 1FDJA 4PCFA 3IGSA 5G1TA 1XBVA 2NX1A 2GVGA 2QCLA 3DKLA 1GVQA 4UCGA 2W6RA 3EWWA 3W72A 3KRZA 3KX6A 1KW1A 4POCA 1H7NA 1GVRA 3PM6A 3IGXA 5AC7A 3BK0A 3L5MA 4ZQCA 4Z0JA 1ZHAA 1WOBA 4MUZA 3TKFA 5DY3A 4JTFA 1GG1A 3VKJA 5AC6A 5G2IA 3CTLA 1S5VA 2HS8A 2I14A 2C6QA 3STCA 3R13A 1Z44A 4AB4A 4ADUA 1XDLA 2R94A 2W0UA 1IXNA 1OFPA 1SZGA 3CIXA 4C1LA 4LNYA 3EWXA 3W83A 4X9SA 1W31A 1KLYA 2JKPA 4D2JA 3BGJA 4XQ6A 4XZ9A 1GYLA 5HINA 1YLVA 5AOUA 4TMCA 5LSMA 3NM3A 2WJZA 1B4EA 3CWOX 2BLEA 2ZRUA 3DFNA 2VKZG 4BI6A 2J9YA 3NQ7A 5AB3A 5C55A 4E38A 5IBXA 1MZHA 3EKZA 4ZMGA 4JTGA 3QYQA 3FKRA 2GOUA 3T44A 4X3ZA 1FWNA 3P67A 3O05A 1QCWA 2V2CA 5CSSA 3FJ6A 2GQ9A 2GUUA 1I2OA 4UNLA 1BWLA 1YTKA 4AWUA 2B7NA 1JQXA 1SO3A 5U7SA 3WJWA 3TU9A 1EB3A 3MW7A 3E49A 3NQGA 3C2VA 3PSWA 1XBZA 1GEQA 4GBUA 1F6PA 3LXAA 1BEUA 2BTMA 3HO8A 4FNTA 1IXPA 5AYYA 4AXKA 4EF8A 3R2GA 4HNVA 1XFBA 4NUWA 4Y9AA 3C4UA 3HB9A 3TAKA 4YCPA 4RJEA 2PE4A 4FNQA 3LHVA 2Z2UA 3W23A 1JVNA 2VEIA 5EKYA 3IIXA 1ICPA 3L67A 1LDCA 4JR5A 1VGAA 5CPMA 1SO4A 1EA0A 1LORA 3RMJA 3W9ZA 4LRTA 3FS2A 1AG1O 1YDOA 4OV9A 1R2SA 4N9DA 3PC0A 2ZTKA 2QJGA 3TA6A 1FWSA 5KMYA 3AJXA 2VFDA 1XUZA 5D33A 1FDZA 1KFJA 2TMDA 3QMRA 3MBFA 4RX0A 4GWEA 1SZNA 1FX6A 2OX1A 5CZTA 1VYPX 4MYXA 1ZNNA 5F2GA 4O11A 4NJJA 3VCRA 3R8RA 3WFAA 1UCWA 2EHHA 3EWZA 3U6WA 2NV1A 1LP6A 3S0CA 2E6FA 2QUTA 3BLIA 4PA8A 4HSNA 3TUUA 4EWND 4MLRA 2A1YA 4O12A 3W85A 1RV8A 5KZMA 5LNRA 1OX6A 1H62A 5G4WA 5HUOA 4JNMA 1TPWA 5D2WA 3F1QA 3QM3A 4N9EA 4Z0SA 2D73A 1TV5A 1X1OA 5BMWA 1VZWA 2TYSA 4M6QA 1PV8A 1G7UA 4FIRA 3KVKA 3MJYA 1U5JA 4HPXA 3DENA 4ALDA 4LC6A 1RQHA 5G2HA 4DO5A 5LNUA 2Y7DA 5CSRA 3L66A 3P84A 3WK0A 1UJPA 3PUDA 4AH7A 4GUHA 1TPFA 4RXGA 3O16A 3EXTA 3HGSA 3DHDA 3TXZA 2NXGA 4O0KA 1MEWA 1X7FA 2J9XA 3WK1A 5SWUA 1MEHA
chains in the Genus database with same CATH superfamily
2CESA 3GH4A 1IEIA 3I10A 4R9OA 5DCEA 1JCLA 2XPKA 3V5CA 2CZFA 1ZJIA 1ZCCA 1DWJM 3AIEA 4NZ4A 4QJ4B 4JN8A 1H5VA 1HO4A 2CWNA 2Q01A 1WYIA 4GY1A 4US5A 5CZKA 4JPGA 2PDWA 1RY8A 1E70M 3PF3A 1U83A 3DC0A 1B0IA 3MKVA 4AY7A 3WQWA 1RSCA 3S2LA 1JZ5A 3KL5A 1B3XA 4WVXA 3A4JA 1JAEA 3A6OA 2VGGA 4OT7A 2BS9A 1J4EA 3RLUA 2WJEA 2V0TA 4CLMA 1V7AA 2ZIDA 2IXUA 1J2WA 2V2DA 3KCJA 2CETA 3ARRA 2VURA 1LBFA 1X1NA 3JRKA 3VIKA 2QMJA 2W9MA 2PDPA 3CEPA 1MNSA 5BXRA 2QIIA 5K9DA 2XWDA 1A49A 1QRQA 2O0TA 2VZTA 1F76A 1H41A 3GSMA 3ATZA 3RX3A 3BW2A 2NLIA 4W5ZA 5CCZA 2WZTA 1KTNA 4HPNA 1VB9A 4ZE4A 4WOZA 3N17A 4TOQA 1BXBA 1XC4A 3W27A 4UFHA 2J79A 3RLGA 4JTEA 1KV8A 4XAYA 2Q09A 3APGA 1F7BA 4WY0B 1VF8A 1UKOA 3W87A 4O52A 3F2BA 3NGJA 1XIJA 2PSNA 1OFOA 2QCCA 4C6FA 3EDFA 1D3HA 1N8WA 2V2HA 3C2EA 4C6BA 3TYUA 2HZGA 1XG4A 3H53A 2YFOA 3QSRA 3VGEA 3MCOA 1DP0A 2H3DA 2ZBTA 4H8VA 3IUDA 5EU9A 4JKMA 2CZVA 3BLEA 3H6OA 4YTQA 2OT1A 3M5ZA 3TX9A 2VFHA 1EGZA 4E3VA 3PZGA 2OT0A 3TOPA 1DJYA 2OKOA 4RW3A 1U2YA 1TWWA 4KWUA 2YW3A 3AIBA 3G1HA 3WBWA 1Q8JA 4ZGYA 1JZ8A 3T4CA 1A5SA 4D71A 4UTWA 4H7CA 1B9BA 2YW4A 1V3KA 3WO8A 1UWRA 1AW1A 3CPUA 2QHAA 2XN1A 4PSRA 4QR6A 2OYMA 3CZGA 2Z7KA 3UJRA 4GGHA 4QE5A 3TW9A 3VPLA 4CVWA 1RAKA 1ME7A 1TPC1 4IJRA 1Q6GA 3NDOA 3QMTA 1PIGA 3CL8A 1P1MA 2NV9A 3UGRA 1VHNA 3VDAA 4KWSA 3V0UA 1WV2A 3P5YA 1WUFA 2B31A 3W1MA 4R9XA 5DN1A 3T81A 1A50A 4FAMA 3AAMA 4TR9A 4D6HA 4V28A 4UTWC 2DFAA 2VX5A 3INPA 3K13A 2VZSA 4GO8A 1G9HA 3VGHA 2X1IA 1R9ZA 2P8BA 3WQ4A 3T8QA 2G41A 1N8FA 3CO8A 4FX7A 2YDRA 3MY9A 4NI3A 5FESA 3D47A 4UZUA 2ABAA 4HA4A 2E6YA 3RM8A 3EKGA 1QNSA 3SQSA 3UJSA 2E5CA 3DOPA 3ZVIA 3WLPA 2BX7A 3B8WA 4K38A 2VO5A 2BVYA 2RDUA 2WMIB 2E77A 5LNVA 4F66A 4EXBA 3W74A 4F9JA 3GAKA 1UP2A 3N2MA 2RHGA 3UWEA 1QDSA 3O8AA 3BMWA 1T6MA 3L7RA 4ERGA 3SIMA 4H8NA 4RCXA 1F73A 4JFWA 2OSYA 2HVNA 2WM1A 3VM5A 3N11A 1UPMB 4LOCA 2Z6IA 5LKYA 1XCFA 4X61A 2HWGA 2ISSA 4RE2A 4MJMA 4RZBA 5XINA 1BSLA 2RDTA 2D0FA 3W1NA 2WJDA 3AOFA 1VJSA 2OYKA 3CH0A 5E6ZA 1UASA 3TJ4A 4URIA 4EPDC 3RR4A 2PGRA 1QBBA 8CGTA 3EAUA 3PBMA 3WX7A 3W7MA 1JGIA 3MHGA 3NG3A 3ANVA 5D37A 1KFBA 4QG6A 3W28A 4NYUA 4ENLA 3AHYA 4CD5A 2WKLA 4BF7A 4U33A 2VD8A 1P4CA 4RZ4A 2XHYA 3WY1A 3G8EA 3IJLA 4IXXA 2KX9A 2E09A 4WX2A 3FGCA 3W86A 1RQBA 1X8FA 2PDQA 1PYFA 1XYMA 3CH9A 2BXZA 2CYGA 4F2BA 1PAMA 4LVAA 3LK6A 1WDPA 3NQVA 4G8TA 3B4YA 2IXVA 3JZUA 2QULA 2C1IA 3HV9A 4XV0A 1LLWA 2V82A 1A5BA 4ZQPA 1R3WA 4E8CA 3QW3A 3UA3A 2FJKA 4OHQA 3FJNA 1B1YA 1PWMA 4IP7A 8XIAA 1G94A 3IUHA 1ZENA 8RUCA 5EMMA 4DIAA 3BPWA 3CB8A 1ECEA 5T9BG 4PBGA 1W2VA 1WE5A 3BLPX 2WNQA 3SUTA 1XIDA 3AWNA 3OEXA 1MVYA 1A4MA 1XW8A 3NNTA 2C18A 4AIOA 2CLKA 2ZDRA 1VPQA 1AJ2A 2OG9A 4XKYA 4TXEA 1W9XA 2NUXA 5I09A 3CZEA 4GNJA 3OLIA 3CM4A 3SW6A 1FDYA 1JDEA 1OGGA 1TELA 3LBCA 4KIEA 3USZA 1VD6A 1JGMA 1OK6A 1ZBVA 3WN6A 1WXJA 1OF6A 3W7JA 2D24A 3FKKA 5H8MA 2PWEA 4C6CA 4FNSA 1DORA 1HJQA 1OF8A 1FWGC 1GT8A 1UQZA 3UQNA 2QIWA 3DYMA 1RD5A 3KW3A 2Y24A 2VVSA 5HPOA 4PBEA 1DXEA 1KFKA 1TV3A 3GLCA 1WUEA 8XIMA 3S6OA 3MUZ1 1V93A 4AF0A 4ICNA 4P7LA 3AMCA 4MPKA 4Q8VA 4U2ZA 1OIMA 1XR2A 4ADSA 1MUMA 1UWUA 1EF3A 2DVXA 3C3UA 1WKFA 4PUNA 3C61A 1EQPA 4O0QA 1V0NA 3GVGA 3QOKA 2QT3A 4LUJA 2DZVA 3U7VA 4RPPA 5BCAA 2E9BA 5FJTA 2WKJA 4GVIA 1HT6A 5T9CE 1QT1A 4LUYA 1NP2A 2C13A 2GGEA 1LLZA 4BF5A 5MKGB 3SQMA 3GNDA 4C65A 4J3WA 1ZGDA 2W63A 2YLAA 1R9YA 1UBSA 3WUBA 2F2HA 3W7KA 3VABA 3BAXA 3GE7A 3LLFA 3R4IA 3GRIA 3MYPA 1ISWA 4QQ3A 3CIWA 2XTKA 3HURA 4PBFA 4QCFA 3W84A 5DO8A 1AUSL 5A6JA 4MWAA 3A64A 4Z2KA 3GFYA 1RLCL 2EJAA 2F7FA 4DJFA 4C1KA 4Q4OA 5E0CA 4FLSA 3TA9A 3G6LA 1J6OA 4L4MA 4H2CA 1UR1A 4NZ3A 2G3IA 4P7RA 4QJ3B 3W29A 3E0LA 2VNCA 4B5VA 4CN6A 4HPJA 4L6OA 3FYYA 1K77A 1J5TA 3LY0A 1F3TA 1GNXA 1W9UA 3NFUA 3GXMA 3GR4A 2E8ZA 3NEHA 3EXRA 3LM7A 2BZNA 4HK6A 4KCVA 5KINA 3PB2A 1O66A 3AUOA 3CUJA 1V3LA 2XH0A 4KCUA 4S3JA 4RV3A 3KOXA 1LBLA 4OU1A 1QNRA 1UG6A 1TJPA 1U1UA 4JY8A 3MA8A 3ZLHA 2VR4A 4Q8UA 3IJ9A 5A6LA 1LL6A 3HMJG 4K8GA 5I00A 3A4WA 4ROPA 3PPGA 4D6CA 5EL1A 1V6XA 3AS0A 1KGXA 1U22A 3MI3A 3TR2A 1JULA 4PUUA 1KRCC 4P7NA 3CPRA 2P0IA 1RY0A 1W2PA 3LG3A 3UPWA 1WXZA 2X0HA 3PZIA 3RO8A 4DXXA 3F03K 4MG4A 4IOTA 1W54A 4M56A 2QCDB 3QGAC 1SZEA 3W2LA 3GIQA 3B8TA 2VX7A 2QJJA 3VUPA 1M7PA 3TCEA 3ZT5A 1NWTA 2PUZA 2D2OA 4ACZB 4J5NA 3UJ2A 1TQXA 3WYZA 3DX5A 5D32A 5D30A 4FX6M 1O1ZA 3TSMA 1WQ5A 1KBJA 1JDCA 2GOKA 1R3YA 4B4FA 1Z42A 4W86A 1UZDA 3A12A 4LV4A 4GH1A 5BOOA 4GO9A 2E8YA 1UD2A 2G3JA 4O1EA 4PYSA 5C2GA 2TRSA 1EPVA 3IJ7A 1ALDA 1U1HA 3M43A 1XH1A 4WIWA 4ZXOA 3USBA 1L8NA 3MCNA 1JI1A 4MY9A 4KRTA 2H8XA 2AQVA 2FVLA 1B57A 4LB4A 1X6LA 3NPUA 3WK2A 4OKDA 3UXLA 3TTQA 2VXNA 1EF2A 4NT0A 2WLYA 1DJGA 3LQGA 3PVFA 3QZ6A 4FNUA 4K3ZA 5CPQA 2A7NA 5D2VA 5E9AA 4HGXA 3DU0A 1XX1A 3GWQA 1H09A 3PWGA 4XZMX 4CU6A 2XN0A 1K1DA 3W6YA 2ZWYA 3G0XA 4HPHA 4MTVA 4FF7A 3G1SA 3V75A 2PDBA 4PZVA 4V33A 2OGYA 3ZR4A 3HJEA 1TRDA 3NM1A 1ML1A 2VR2A 1VC4A 4HU0A 3LNMA 5I24A 5IHSA 4B9ZA 3B0VC 5FI8A 3VOFA 3AI0A 1FKXA 3NQCA 2WKGA 5EMUA 2R1KA 3WQGA 4GYPC 2RJHA 3EOUA 5M17A 1R46A 1Z6KA 3FHAA 3EWBX 1B9ZA 1JUBA 4W9TA 1XKJA 4GIEA 4KQNA 2G0WA 3MZNA 4M6UA 2PODA 5HATA 3AXMA 1L0PA 1N82A 3P0XA 3UJFA 2GDQA 3CLMA 2X8RA 2E5DA 1JXJA 2Y8UA 3PBVA 4LC8A 5C7VA 1S2WA 3MUY1 3P3BA 1FFQA 3GTHA 1XRVA 2YDAA 3AYRA 4HHPA 4O10A 4MM1A 4HHLA 4LRSA 1QUMA 4LV9A 3TYDA 4TQTA 2TSYA 5JBDA 4I7VA 3KL3A 4GC4A 1KRBC 1VBHA 3E5BA 2CZEA 3MV01 3C52A 3PJWA 3OYZA 3AO0A 4RE0A 2I5QA 2A6NA 5DXYA 1OX5A 2W3ZA 1Z48A 3F4VA 1HP5A 1QWGA 2YB1A 4X60A 1W5OA 2CKSA 3FEMA 3UETA 1OG0A 1B31A 1F61A 2FH8A 4F79A 4Y90A 2PDJA 4FX8A 1E1EA 1Y5VA 4ZO9A 3UCQA 3UZJA 2G95A 2E1WA 3W7DA 3RX2A 1QPQA 1FRBA 5K4ZA 4CQDA 3N34A 3VOGA 1NSJA 2DSUA 1L8PA 4A8LA 5CPLA 3PBUA 5CG7A 1QW9A 3BLKA 3E2RA 3MP3A 3W75A 5D9PA 5JMUA 1QAPA 1D3CA 1JF6A 3ICJA 1AH0A 4LQ1A 3VDCA 3RK8A 1HL2A 1DJZA 4K37A 1ZAJA 1B3YA 4HTYA 4EK7A 2BY2A 4ICMA 4RNJA 1MDRA 2GQAA 3GNPA 1K6WA 5AYXA 4IIDA 1T5AA 3A4AA 3HTWA 2EEXA 4KGJA 4YCOA 1QHPA 1YBQB 5GQBA 3OQEA 1SO6A 2C8NA 4MMWA 3VIFA 4CD7A 3LHWA 4JKLA 2FFIA 4YIWA 2J13A 4RV8A 3CL6A 1PKLA 1UIOA 2OWWA 2V5KA 3S42A 1RJPA 4DWDA 4OQVA 4CNUA 3GDLA 3ZFHA 3IIOA 5FJOA 3KOWA 3EOSA 1K9TA 4TV6A 4H7VA 1J12A 4XAZA 3Q45A 3U3HA 1OFQA 2QR6A 3LHUA 4PRWA 1NARA 4GRSA 2JIWA 3BCFA 2D22A 4KRZA 1GKPA 2BNJA 2VX6A 2VOTA 5EMYA 4UFIA 5A8NA 1LOSA 4Q32A 4RE4A 2OELA 3W07A 2V9DA 2VCAA 5HQMA 1J0KA 1ITUA 1CXEA 1Q45A 3HPXA 2AAAA 1FBAA 3U2OA 1CX9A 1ZZMA 3R5EA 1ZS2A 2ZRXA 1SFJA 1H1ZA 3H2CA 3MMWA 4XVDA 1P6BA 3ZLGA 3LPGA 1JRCA 1DPMA 1TMHA 2PLJA 3M5VA 4TVDA 1K9DA 1NFPA 2NQ5A 3UZ5A 4W87A 1KRAC 3E0FA 1MW3A 2YBVA 5FCZA 1CWYA 5ABTA 2GSJA 1BHGA 3ARZA 3HG5A 1L6SA 3VKBA 3I6RA 1NELA 2IKIA 2YXXA 3L4ZA 4NASA 3CWNA 1TKKA 3DN5A 4NXKA 2CEQA 4ZVJA 3W7NA 3CL7A 2V3FA 4QDMA 1PYMA 1RA5A 1JPIA 3GBDA 3KLKA 3GDRA 2NX9A 3CZ8A 3TP4A 3UWVA 1YIXA 3PANA 1FWHC 4AUBA 1XFCA 5EFFA 4MHBA 1VFOA 3B9NA 3FLUA 3URNA 4FA3A 5FF3A 4I9MA 1LT7A 4MIMA 3UVAA 1FY6A 4JDYA 3H54A 1Q63A 4GI4A 4HOXA 4PB4A 3I7QA 1M5WA 2G3NA 3RG6A 1CLVA 3FSTA 3GC5A 3NSMA 4AAJA 5C6MA 3WD0A 3B3DA 4MOZA 4PEKA 3E0IA 3W1RA 3UBPC 1V6VA 3W82A 4G7EB 4AD0A 4PTVA 2JKEA 3HPZA 4JICA 1UB3A 5CH9A 3WDRA 2ZZ1A 4QGCA 4FXSA 4BKNA 5HDRA 4H9UA 3HZ3A 1TFVA 5DT5A 4KMQA 2YCLB 2JEQA 1KCKA 2BP1A 2D0HA 1XHGA 3KVJA 3TC6A 2HV5A 2O9PA 3EXSA 2I1OA 3GC2A 2R8WA 3KFTA 1PDYA 5CGMA 1JD7A 3VYLA 2ZOXA 1HXJA 4DVOA 1XLBA 3QV7A 1N2VA 3KHJA 2Z2AA 4GQQA 2XUCA 3NXFA 2PD9A 2A4AA 2UY5A 3BOFA 3M1ZA 1YW1A 2WSKA 4MY8A 5HQEA 4DWSD 1WP6A 2ZZ6A 4IFRA 2VEPA 1T40A 5CC3A 2WCAA 1B30A 3ZSSA 2OOFA 3WD3A 3K1DA 3PP7A 2YCEA 1JI2A 3P7YA 1NF0A 2GK1A 3TQVA 2ATMA 2ZX9A 3MHFA 4PMVA 4BY3A 3P74A 3PNZA 4FSAA 2ZRWA 3KP0A 1SQ7A 3CC1A 3LTYA 1MQQA 3H2AA 5HMEA 3WQPA 2QCDA 2HROA 1UD8A 3BAIA 1UYQA 3M5XA 5FIPA 2HEJA 4OFCA 3WF0A 3PS7A 3V5FA 3FHQA 3Q94A 4NSBA 5BROA 4I7WA 1QXLA 3VMOA 3WQ8A 4DJDC 3MZ2A 1E9IA 1P0EA 3V36A 4HYWA 2VEFA 3A4XA 2YFNA 2DJXA 2DQWA 4HN4A 1W3TA 2AMXA 3K4DA 1HJVA 2FZMA 4UQBA 1VAHA 5F2IA 3R94A 3SSJA 4CQ9A 1ESWA 3TW6A 5JH1A 2WO5A 3W70A 2QW5A 4U3CA 1KLZA 1J79A 5JH2A 4JIRA 3T0DA 4LBUA 4HU3A 2GWGA 2FDSA 4XSLA 4FIQA 3UG3A 4Z1AA 3W7CA 5C71A 5KETA 4REQB 1EWEA 3AXIA 5CC6A 2C91A 2ZWZA 4EOUA 3CJPA 1KM1A 2AQOA 3BJSA 3VIIA 4C90A 3A23A 1LWIA 1B3WA 4O1CA 4US5D 9XIMA 2X2YA 4JFUA 1UA7A 1N8IA 3KRBA 1VFUA 2HBXA 4UIOA 3WENA 4TVCA 3GG1A 4C7DA 1TRIA 2F6KA 1VIZA 6CGTA 4ZTYA 3WLRA 2C79A 3SCPA 1D8WA 3GG7A 2F8QA 4H1ZA 5GNZA 5HQLA 1I60A 4J35A 4DUOA 3SB0A 3KBWA 5CZSA 1UH3A 4CEXC 1WAWA 2X1UA 3VOCA 4IGMA 3EWYA 3RUBL 4F4RA 1V51A 2REQA 4JTQA 3LLXA 3LQLA 5A2BA 2ZXAA 3LBOA 4H6RA 3SJ3A 4JX4A 5DANA 4D1IA 4GCAA 3M46A 3IV3A 1D8CA 1TPVA 1SSGA 4Y96A 5J5RA 4JYEA 4QDWA 1XLEA 4HOZA 1CCWB 1V6TA 5D2YA 2CKRA 4DJEC 2Q3OA 3IIVA 3W24A 4ZXLA 2ACSA 2QXWA 3D0CA 3HF3A 1R85A 1JZ6A 3L4VA 1U5HA 2HSAA 4CVUA 5C9RA 3PTQA 5EFDA 2CBVA 1VFHA 1KFLA 5KZEA 3M7SA 3R25A 1EYWA 3EOEA 2Z25A 1H7PA 3VIMA 3MO4A 3VOIA 3RPDA 5K7JA 4GIAA 4OIFA 1JL8A 2QF7A 1J2BA 2QMKA 2BGQA 4F40A 5JVLA 5LIYX 1TTJA 1QU4A 1UKPA 5DCDA 1G4SA 3RXZA 3SFWA 1FP8A 3GVVA 3MI2A 1DIKA 3QYSA 5EB8A 2PDFA 1Q2SA 4HHMA 5D2XA 1VPYA 2IUZA 2WSQA 5DMNA 5HWJA 1Q6OA 5E70A 4ZR8A 5CZJA 1OB0A 1ZP3A 4S2BA 4DYEA 1FDJA 1NIUA 4HCDA 4YTUA 3CTTA 3SCRA 5G1TA 3W37A 1QATA 2DSVA 2FJUB 4NKCA 2QCLA 1GVQA 3DERA 3W72A 2QPUA 3KRZA 1VENA 1OT2A 1GVRA 1FH9A 3IGXA 3L5MA 3K4AA 5G2IA 4W89A 1WNOA 4LNCA 1F8MA 4AB4A 3VX0A 1CECA 1XDLA 2W0UA 1IXNA 1OFPA 4I90A 1KBKA 3HQPA 3IAQA 3GTIA 2J7CA 3HFYA 3EWXA 4X9SA 1W31A 1Q66A 2DUZA 3RJYA 5BXTA 1GYLA 2IKGA 5LSMA 2WJZA 1RPKA 2J9YA 5AB3A 3GFZA 3EKZA 1J8VA 4ZOBA 4ZMGA 3QYQA 3T08A 3POCA 4US6A 5CSSA 3FJ6A 3AIQA 1W1B1 1OD0A 2VR5A 1E0VA 5CBJA 3DCPA 2GUUA 4HZ6A 4UNLA 3ARSA 2O9RA 2IKHA 3STPA 4AWUA 4ZB5A 5ECUA 1SO3A 3GHUA 3HMCA 3TU9A 3MW7A 3C2VA 2VP8A 5LXEA 1P0BA 1T8QA 2E4TA 1F6PA 3GHSA 5ENLA 1DJXA 3HO8A 4FNTA 3ZR6A 4EF8A 5GJPA 4NUWA 4IQDA 3C4UA 3TAKA 4YCPA 1XCXA 2I16A 4EANA 2PE4A 4FNQA 2Q6ZA 3IIXA 1ICPA 4OECA 1NQKA 3LGGA 2GGIA 3N25A 3L2LA 5CPMA 5FJUA 1EA0A 1R5YA 1TVLA 3OQ8A 3W9ZA 1LUCB 2JEPA 1UKTA 4MWAE 5MF5A 3AJXA 1PTAA 5JBEA 2TMDA 3KS6A 4RX0A 3WD1A 1SZNA 4A3HA 2A3HA 2X0YA 4J4KA 1VYPX 1D7FA 1LWHA 3ZZ1A 1ITQA 2PZ0A 3AHTA 3S0CA 3QLLA 4L1WA 3TUUA 4EWND 1JFXA 3UZXA 4S23A 3W85A 4JIIX 5FSDC 4IIBA 5DMYA 4FR1A 1M9HA 3TLQA 5HUOA 3GW0A 2WHMA 2VI0A 1TPWA 3F1QA 3QM3A 1KQYA 5TF0A 1HX0A 4Z0SA 3MWCA 1X1OA 5BMWA 3LD5A 4ES4A 1PV8A 1EYEA 1NP0A 1Q5MA 1U1JA 2GJXB 3DENA 4O8AA 4ALDA 3F5KA 4YJ5A 3SN0A 4KW2A 4LC6A 2WZEA 1I0BA 2YA1A 1E5NA 3VKDA 1TX0A 3OJGA 1C90A 1L2QA 3WK0A 1AZ2A 4GPNA 3O16A 4MJ4A 4BJHA 2QGYA 1IWPA 1MW0A 1MEWA 2J7GA 1MEHA 1GOMA 3ALGA 1Y7VA 3H26A 3JUGA 4YYCA 5AFDA 3LXBA 3MU7A 1PSCA 3LZ5A 4ZSTA 2VFFA 1QHZA 2F6UA 3N2CA 2PDLA 4Y9MA 4PMJA 3WBYA 2NSOA 1VEOA 1TPUA 1BD0A 1IEVA 1GOXA 3KVLA 3QHMA 4R88A 1POKA 1EOKA 1HGWA 1E3ZA 4IMFA 1KCLA 2PFHA 1FCBA 4G7EA 1XXXA 3C3NA 2Y6ZA 1EC7A 4A35A 1KXTA 3SJNA 3NYZA 2FZBA 4LAOA 2A5HA 1DQXA 5A3HA 2FVKA 2OQHA 4NNCA 5KTLA 1ONXA 1DWIM 5KITA 2DV0A 3W7RA 4JNYA 1B2YA 4MB1A 4WLCA 3UXDA 1SUXA 2YLLA 2PDIA 1X97A 2F6XA 4AZHA 4L1XA 3QPZA 4PMNA 1GORA 5IOBA 3GO2A 1YXDA 4DQWA 5CLTA 1ZPTA 4HZ8A 2E6DA 3O15A 1S5TA 2EG7A 4P61A 3WEOA 3IWPA 4YNGA 3W7EA 4JN6A 3W6MA 1OYCA 1DWAM 4UTTA 4IMEA 7TIMA 4TVUA 4DF1A 1EX1A 1S2VA 4GI8A 1VFFA 4KIRA 2DT2A 2VD9A 4A3QA 4B5NA 2QV4A 5AYIA 5C9WA 4LY8A 3SDOA 4BR1A 4DHGA 3S8HA 4ORMA 3F2DA 4RNHA 1EJRC 4S3FA 3LB0A 5AHNA 1F8IA 4QSFA 2CFFA 2ASHA 5TIMA 3AXHA 4PUMA 3LDVA 3KOFA 2FIQA 1EHAA 3BZGA 3SGGA 1J01A 1DXIA 2ZUNA 2OZ8A 2FZ8A 4XBSA 3PWAA 2E28A 3WL0A 5KSWA 1PUDA 3BG9A 5JU6A 4Y7EA 1EUNA 4KRUA 1AW2A 2WQDA 5KZ6A 2UZ9A 2V5BA 1Q85A 2DVUA 4LF2A 2Q8LA 2WMGA 3VC5A 3WMLA 3MPGA 1V7YA 4XIAA 3AZTA 4BF9A 3ITVA 1E43A 4XZIA 4WKAA 4KETA 4NAEA 1UIPA 3DHFA 3THAA 3ITXA 4PCSA 1XGEA 5GNYA 4O4WA 1GPWA 2VFGA 3QJAA 3NZQA 2X1SA 1K03A 3S46A 4MWAD 2WVTA 4IMGA 4WXZA 4AZCA 3DIPA 3QF0A 4H9YA 2V6AA 1YNYA 4AC1X 2YCIX 4DJFD 1IWAA 2GVYA 2J88A 4XBKA 1OEPA 3LERA 4R7OA 3R89A 4Z1DA 3E02A 4J1OA 1JYXA 5EBUA 3NL3A 4NX5A 1TMLA 1OABA 4GUIA 3P80A 4MFEA 1ISZA 1TIWA 2A21A 2HXTA 3G1YA 3QV9A 4R3UA 3ARXA 3BSGA 4UMAA 3DESA 3S4TA 2QUUA 4JL1A 1UC5A 3VD9A 1S38A 2PP3A 1UR2A 1XL9A 1YEYA 3B03A 4B5XA 3AICA 3PZNA 1PPIA 4JCLA 1RJRA 4XTDA 4NF7A 1GQJA 3S83A 5FOOA 1CTNA 1YXCA 1CGXA 2GDVA 5HR6A 1TPEA 3FX4A 3G1FA 5ABGA 1GOKA 4S3KA 1QBAA 1RH9A 3IRDA 4HJWA 4RDVA 4GG9A 2HS6A 4K2SA 3JW7A 1E0WA 4Q22A 1R2RA 3AHZA 4LYQA 5EPDA 2OKTA 3A24A 3U2ZA 3W25A 3EGJA 2DY3A 3S5NA 4DZAA 1FCUA 1NFBA 2QJHA 3ITOA 1A5AA 4PTDA 1L6YA 1XLIA 2OFJA 5AHEA 2GFTA 2QDEA 3VUSA 4NZFA 2VUNA 3MUCA 5G1YA 4WZHA 4F0SA 3STFA 2HK0A 3UXAA 4OBSA 4PR4A 1FHUA 3LTPA 4HN8A 1FOBA 4IL0A 4AD2A 4D72A 2OLSA 2D0GA 1JQVA 1H4PA 4AD3A 2ZXDA 2XIBA 3OVPA 5CQ1A 3RX4A 2H90A 3KAOA 1HN1A 3AXKA 3QEZA 1O5QA 2CLFA 1VRXA 1SM9A 4BA0A 2BFGA 1JYNA 1E9YB 3B0PA 1UR9A 1W56A 1R6WA 5I79A 6ALDA 2ZUWA 1TZ7A 3NOEA 4PN2A 2XVGA 4LS1A 6REQB 1XD1A 4UNKA 4IWWA 1DJQA 2HPMA 3W76A 1U30A 3A3HA 4UQ9A 5FJRA 1RA0A 1HZYA 1R3SA 1FXPA 2ZUUA 1JZ3A 5AC8A 2YPIA 1LJYA 3UR5A 3ZOAA 1P0KA 3VIGA 4XD3A 4O14A 2YIHA 1KTCA 3U4AA 2ZA2A 3AJ7A 3GDKA 4RZ6A 4NY2A 2QJNA 1UUOA 4U5IA 3UF9A 4IF2A 3W1TA 1S2CA 2PWGA 3FVDA 2OO6A 2GGHA 3JVAA 3MJMA 5CG0A 2BVWA 4ZBCA 2OCZA 4DO6A 1CGWA 1W1TA 2GPTA 1UZ1A 2IMRA 1VKFA 4P2VA 4DXKA 1TWDA 1Z9AA 1L6FA 1VQTA 3LRMA 3BVJA 5I7GA 2A6LA 2ISVA 1J96A 4KH2A 1XGDA 3PR2A 4QLJA 4K6AA 3NO5A 2NVDA 1S2TA 5CBIA 1LL4A 1MSSA 3FYOA 3OLGA 4QEHA 2WXDM 4FNPA 4FMVA 3S2JA 4LUSB 2D3NA 4AIEA 1F05A 4LUTB 5HJYA 4ZL1A 3V0SA 1DJIA 3PZVA 3T7VA 2QGHA 3KS5A 4Q3MA 1V0MA 4JIQA 2BGNE 2ODOA 2G3FA 7ODCA 4GVFA 3OVRA 1VJIA 4KFPA 2Y89A 3BLLA 4H9MA 5FAJA 1KR0A 4N9BA 3QC3A 1TTIA 2D1ZA 3A5FA 4C6OA 2YX0A 1JCTA 3LZ3A 4NJKA 2QCFA 1V03A 5BWAA 3QN3A 1C3FA 4S1FA 3B0YA 2GWNA 3ANUA 3N15A 3QPYA 2IQDA 2LLEA 1E1CB 4XZNX 3U57A 3W7HA 2AGTA 3WH5A 1FXQA 2WPBA 3ZLFA 3ATYA 4GX8A 4R85A 3QLDA 3EB3A 4GUJA 1EO5A 4PH6A 1KXHA 1TMQA 1UA3A 3A22A 4ATWA 4HSOA 3QY7A 3B8IA 1WDSA 4OV4A 3PBYA 2BY3A 5A8QA 3BH4A 3EOLA 1WDWA 1UR4A 3KZPA 2VGBA 5TNVA 3PUGA 4UTLA 3CZKA 1CBGA 4U5KA 2X0SA 4AZ7A 3BC9A 3L0KA 3PY2A 2YJQA 2HVOA 1EP2A 4MUPA 1F4HA 3EB4A 2YBUA 2W62A 2J9ZA 2ADAA 5AYBA 1A53A 4XSMA 5FACA 4E2OA 4DYJA 3MP4A 4HBKA 1DE5A 5MHBA 2CLIA 3KOZA 2ABBA 1Y65A 1G4EA 3VK5A 4AW7A 3P81A 1E4MM 3F4DA 3N2OA 3B8SA 4QX4A 3VM7A 1XH2A 5CLWA 4PUDA 4XTIA 4YVXA 2FTYA 4JIHA 1XLHA 5EMKA 3O0KA 4N6EA 2PA6A 4N4PA 4EXQA 1Q7QA 3GQYA 2PTZA 2P1FA 4CQBA 5D9NA 2GGGA 1UOKA 4YWSA 1XD0A 1CGUA 3NQFA 4GQGA 4CEUC 1K70A 4GE8A 4C6EA 4ZOEA 3N2XA 4A3YA 2DUAA 1YTEA 3L21A 1XIIA 4KEUA 3NPXA 5ABFA 1THFD 5AHFA 5CKSA 5DBUA 1M65A 2QQ6A 2P0OA 2A3LA 5F1UA 4AD4A 1KV5A 1T99A 1S39A 1FWEC 3K5XA 2Y88A 4I5XA 4DF2A 4LWWA 3G1XA 2V3DA 4CN4A 1E6PA 1W3IA 1JDDA 4H2HA 1ZTVA 4PTWA 1NM9A 1ZUAX 1HIZA 2AL2B 4DY1A 1LQ2A 5LA2A 3NO1A 4TO8A 2P76A 3KDNA 3E2VA 1EDQA 2DVTA 5BXPA 4EPBC 1TSIA 3ABSA 2AQWA 2QPXA 1TJ1A 3P62A 2HNHA 3CUHA 1W37A 3XIMA 3OGSA 4IM4A 1ENUA 4NAFB 4IFKB 3GG8A 3QW4B 5CGQA 3NQDA 2VTFA 2QCMA 4AHOA 1P0NA 4OWGA 3B40A 3AYSA 3WF2A 1EWDA 4K68A 4HYVA 4QE1A 3THQA 3THUA 2EXOA 3NL2A 2YXOA 3W1LA 2PDYA 3VIJA 5M1TA 4HCHA 2ZRVA 3O06A 1EJSC 3PFMA 1P7TB 3QY8A 3UT0A 4UBPC 3HPSA 7ENLA 2Y0FA 3VKCA 4GLEA 3H8AA 1G01A 4KEMA 2AMGA 1FHDA 3UVIA 2HMCA 3CAKA 3C0SA 2EBNA 2VUYA 1GOWA 4QS5A 1KFCA 3WD2A 3V7PA 2GUYA 3QC0A 2VT0A 1OZMA 1IGWA 3UJEA 2Q8XA 3R8GA 2C15A 2ZA1A 2J7BA 4ZQOA 4IIGA 4ZODA 3UZZA 3VE7A 5TBOA 1LQ0A 1IZCA 1W3NA 3E0VA 3DZ1A 2YDSA 5D2TA 1QI5A 4ZZ9A 4PCPA 3MO7A 2XFFA 5I23A 3T0AA 1PB0A 5LIKX 1A5MC 4J9JA 2EJ1A 2JK2A 4D6FA 1HKWA 3MKKA 4EPKA 4P8UA 3CV2A 5EBAA 3W1PA 1B90A 3H2FA 3N18A 3G1AA 2P3EA 4JTCA 5HR7A 2CLMA 4MJZA 3TC3A 4DEFA 4YN5A 1EX5A 1KB3A 4D8AA 1W3JA 5AC4A 2OGJA 4WSJA 5E0FA 1M68A 3DG3A 2CERA 4UTJA 3DI1A 2P5NA 3TTYA 3BAKA 5G4HC 5LGXA 1M04A 3ZM8A 4JDBA 5TD4A 4WK9A 3OA5A 1Q7ZA 3OODA 4QFUA 2O55A 2ZXBA 1HGYA 1M53A 1WOAA 3TFXA 3QHNA 2PC4A 3LENA 1MYRA 1MUCA 4OVXA 5A69A 1XBXA 3M64A 1I1WA 4AC7C 3WK3A 1M7OA 4F8XA 3KOYA 4Q4MA 5I3HA 1GHSA 2D2JA 3ZXWA 2I56A 2Y63A 1W9DM 4MZYA 4OUIA 1NF7A 3WLHA 4LEFA 4W8BA 1BVWA 3B8UA 4B90A 3FY1A 4B15A 3REQB 4HNUA 4XO6A 1UD5A 1EJ7L 5HA7A 4KEVA 5LA0A 1F07A 3M47A 5E93A 3T2PA 3BW4A 4Q8WA 2Z7GA 1F4AA 3PUOA 2CU0A 2CWXA 2PF8A 1RK5A 3NVTA 4DNMA 3LU2A 4CNTA 1OX4B 2C1GA 3VOJA 4UMBA 3QQ1A 1H61A 4WDWA 1SPQA 1K3UA 4BWLC 3U8GA 4XWUA 5FJPA 5FA5A 3G1DA 3KDOA 3SI9A 4H19A 3N4EA 2XU2A 4V15A 1TE1A 3MBDA 3AZRA 3S9IA 2JGQA 1BTCA 1E0TA 3R6IA 3RAOA 2VWSA 4NG3A 3KBJA 5E1QA 4IGNA 2B81A 3WLNA 1QASA 4YLWA 3VZYA 1JG9A 3M7WA 4GIRA 4Q8TA 2YSWA 2WMKA 5DEZA 4H8HA 4KS0A 4V2XA 1CIUA 2YL5A 4BQ5A 3I7RA 1AQMA 3JZEA 1HKVA 1UC4A 1S5WA 2JALA 4H04A 5LHEA 2JE8A 3URAA 2NVAA 1DQWA 2DZSA 4IICA 3RN6A 3CUIA 4K8HA 3WQDA 5LZLA 4D6EA 4Z1YA 2WSYA 3CO4A 2PCQA 2NWRA 4GQRA 1XINA 3DG7A 4PMOA 3W1AA 4JCMA 4N0RA 3CAQA 4BFAA 1W1A1 1QO2A 3H21A 4AZGA 5L9FA 3MMTA 2JQXA 3F4WA 1MUWA 1DE6A 1RVKA 3ARYA 3QOMA 2X7WA 1BXNA 2AKZA 3CHCA 3SRHA 4D8LA 4J3UA 1UR3M 1EJUC 2ZC1A 2IW0A 1L6WA 1QMLA 1WA3A 4LUSA 2DSKA 4I3GA 3L5LA 3N6JA 3WH8A 4LUTA 1P6WA 1XF0A 5A6KA 4A22A 2XGBA 3CMFA 2WCGA 4R7JA 4ZFMA 3NQ6A 3S1VA 4Z2JA 5D04C 3UCCA 1K4HA 1UKSA 3M0XA 3VMNA 1RJQA 1WBJA 2C16A 2EPMX 1W9PA 3VNJA 5I03A 1FWWA 2X05A 3V3WA 4L4OA 2WZMA 5JXQA 4C6LA 2F38A 4LAKA 1OT1A 1UBPC 1J0YA 4IUGA 1BKSA 4MZ8A 1GK8A 4AD5A 4KCTA 2BB0A 1RCOB 1L2UA 4FB7A 1AMKA 1E1CA 4Q7IA 1DHPA 1EO7A 3NWRA 4G1KA 1BG9A 2C1HA 4PFMA 1JRBA 1JCMP 4N6FA 5FJIA 3QH2A 1XSKA 1EJWC 3IK2A 2ZTJA 2QCNA 3E38A 1R9XA 4L9XA 1JZ7A 3OHIA 4DRSA 5REQB 5FEPA 3B8DA 4BZYA 2WW5A 1ME8A 4L64A 2WVVB 1MW2A 1YHTA 2Q02A 1MEIA 1LT8A 4NU7A 1EP3A 2QCEA 3BAJA 4PMUA 4HNLA 2FTPA 2Y7EA 1F9CA 3W2UA 2JF7A 2XVLA 1B3OA 1VEMA 4O15A 4DX3A 3LHZA 1WO2A 4PSPA 3MMDA 2ZFAA 3NPWA 5FF0A 1GZJA 4UWMA 2WB5A 4E2BA 1BXCA 2A7PA 3AMGA 3S1GA 1LYXA 1FWTA 1C93A 3WLIA 1UHVA 1W5PA 3TMLA 2PBOA 1X8CA 3GU1A 3M41A 3W2KA 1Z3NA 2RH9A 4B91A 3VINA 2Y70A 3N13A 3A9BA 1WPCA 5EA9A 4MDOA 3ENLA 3WNPA 3I3DA 1V6YA 3U7BA 4DI9A 3IJQA 4BQ3A 2FDMA 3SGZA 1ZCOA 3SCQA 5D9MA 4C6IA 3QGKC 1QWKA 4Z08A 4LW7A 3EDJA 4PMYA 2VEGA 2OODA 3LCXA 2X7VA 3ANYA 2WWDA 4UFJA 4J27A 3FA5A 5F2MA 1UR8A 3UXIA 4HT3A 4RR4A 1W5NA 2WMFA 3HBLA 2PDNA 4GZIA 7A3HA 1CW2A 1UD4A 1HO1A 3EBVA 3NQMA 4ZFCA 1EBGA 1OC5A 3P82A 5HANA 2J27A 3N1AA 3GUGA 3FCPA 3G3MA 1XPGA 2G5WA 1SSDA 1NTHA 4IMDA 4AZBA 2J74A 2FB2A 1YX1A 1HVQA 5IDIA 4L6DA 2DP3A 4HK5A 1AFSA 2YKKA 1Q6QA 5J8LA 1KO0A 3OIHA 3BCJA 1QOPA 3NQ8A 2GYIA 1KWGA 3L2IA 2EG8A 3EOOA 5DELA 5FEZA 1EUAA 2A3CA 1U33A 1T8XA 1KKRA 3R58A 1ZU8A 4JX5A 2WMJA 4K39A 4Q4RA 4NJHA 1IZKA 1HUVA 4OZOA 1OFEA 3OG3A 4NRRA 4O28A 4UFKA 3ME3A 1SMAA 4IFKA 4DO4A 1CZ1A 3ZO9A 4LAMA 1WDQA 3ABXA 4JTDA 4MB5A 3DKJA 2ZZ7A 3MYOA 3AC0A 2XISA 3QFEA 4DUXA 2YL6A 3P0WA 3E5PA 4LJ3A 2TODA 3EX4A 3I3EA 5E0KA 2B4GA 1F6YA 3E9AA 4JQ4A 3WJSA 5D4YA 3WBAA 2EAWA 2EKGA 1D3GA 4HA3A 2OB3A 3O9NA 3W2JA 1JYWA 3M4HA 3TN4A 1SMDA 2YA0A 4F48A 5CSUA 1W3LA 4ILSA 1QNPA 1A4LA 1P48A 3E0WA 1YYAA 1A47A 3ID7A 3R12A 5AZ1A 4MNKA 5CPTA 5BMXA 1IYXA 1W9BM 4LSBA 3AMLA 5FEWA 1VFMA 3G18A 4WJ8A 3MTWA 1W0MA 2WAGA 1EHNA 1WX0A 4D8ZA 3CPGA 3VGDA 2HCVA 3POHA 1XLGA 2GSHA 1FWDC 2FPYA 2ICSA 3M0KA 3ABOA 3LGDA 5CPSA 4AFYA 1FWAC 1JF5A 5D38A 1A0DA 1TJ2A 4M19A 1C9DA 4DBSA 1CT5A 3OBKA 2Y61A 1Z89A 1IF2A 1M03A 3FXYA 3IRSA 1G67A 4G56A 1IXOA 1YNPA 4Z1CA 1Q65A 2J8FA 3C56A 2PDKA 3SCOA 4I9JA 4X22A 1XICA 3M9YA 1TB3A 4GY0A 4N4QA 3TTSA 2PGFA 4PTMA 3UESA 1OD8A 4J28A 3WLLA 3W7QA 4U3AA 4Y8FA 3SCSA 1LOQA 2GJLA 1T7LA 3D5HA 3BXWA 1XYAA 4R33A 3AQUA 3TQKA 1SW0A 2Z0IA 3KTSA 1E6NA 3DHUA 3N4AA 1GW1A 3L5AA 1GW9A 2BVDA 1IWBA 2DZWA 2PRHA 4IG2A 3QFWA 4OJYA 5K9XA 4YU1A 1GVIA 2PGEA 4IH3A 1TYGA 4RE3A 4PMQA 1PZ2A 1J0JA 4M7SA 3HM7A 4F0MA 4NZCA 4ERIA 3QSTA 3W1XA 3HGRA 4ML9A 2ZA3A 4YVVA 1H2JA 5HNUA 4QDPA 1SU5A 2IQTA 3LMZA 3S1UA 1RD6A 2DSZA 1E15A 3KTCA 1R7AA 2VJXA 2NQJA 2POZA 3NQBA 2E9MA 1SJBA 1XSJA 3IVUA 3HQOA 3I65A 4GQ0A 1US2A 5XIMA 3REQA 1TIMA 4JEJA 4Y2WA 5A1AA 3D3FA 3LM3A 3MP5A 3C2YA 4XO7A 3TYEA 2QKFA 2WYSA 1NOFA 3P6LA 4I5RA 3S9YA 3TCSA 3ZVHB 3N6QA 3ELFA 2VX4A 1S5MA 1O60A 3CV1A 3NEVA 1YTDA 3TH6A 2Y62A 1K8XA 5HNNA 3PN8A 4JTHA 1PL9A 1VBRA 5RUBA 2G8ZA 2Z29A 1X96A 4BK9A 3Q58A 3MKCA 4EF9A 3O1NA 4AU0A 4RDZA 3KRSA 2AAMA 4CD8A 1DXFA 1P6CA 3ARVA 3WQFA 2ON3A 4LBRA 1I45A 4N7QA 3TVAA 4C6PA 4JHZA 2DZXA 3PWIA 3VD4A 3CV7A 3CQIA 3T4WA 3MCMA 1OWQA 3G22A 2R14A 4IPJA 4FP1A 1MDLA 3UNDA 1YKWA 4LPCA 4DUWA 5DXXA 1I2NA 4JOMA 2OLAA 3AMDA 1E0XA 1SW3A 4JKKA 1W1ZA 5IFPA 2NLYA 1C9WA 1XBVA 4ZO6A 3KX6A 3KLLA 3KWSA 4AXNA 1ZHAA 3PFRA 1HKMA 3WDJA 5DY3A 3VKJA 4ZOCA 4H9TA 5BU6A 3VZZA 1DJWA 2I14A 4YHGA 4FXJA 1UW9A 3XISA 4J3SA 3STCA 1EJXC 1KR1A 1SZGA 1JAKA 3DC8A 4LNYA 2VC5A 4Y9PA 3FDGA 4NP7A 3W83A 3KEHA 1VIWA 2RGLA 4D2JA 4XQ6A 3VDBA 2VC7A 1YLVA 1B4EA 3CWOX 1ZLPA 3DFNA 4RW5A 4BI6A 1PX8A 3SCTA 3NQ7A 4W7WA 4PTXA 1RLDA 3FKRA 3T44A 3ZT6A 4HTBA 4JTAA 2Y8VA 4YTRA 2GQ9A 5CBBA 3QVQA 1R86A 1E72M 3EWCA 1JQXA 3FK4A 3G2GA 5U7SA 4UOQA 1EB3A 3E49A 4Y9OA 3ZSTA 1XBZA 4L4PA 1BEUA 1IXPA 2W66A 2F9RA 1XFBA 4DWSB 2JF6A 4M0XA 4RJEA 4PUEA 2INEA 2YBTA 2J7DA 2VEIA 5EKYA 2FZNA 5C70A 2L5HA 1M7JA 3U48A 4JR5A 1JNDA 2BV9A 1YDOA 1QHOA 3QPEA 3UR2A 2QDDA 5KMYA 2VFDA 1XUZA 1KFJA 4QRNA 4UQEA 2OX1A 5C0QA 1MQRA 2O4MA 3IV8A 1JFHA 2NQLA 3R8RA 3UERA 2EHHA 1HQTA 5I07A 2W4XA 1LP6A 2PZNA 1EXPA 4AIBA 1MFUA 5KZMA 3NSXA 1QNQA 4FLRA 4JNMA 1IR1A 1GQIA 2D73A 4PULA 2TYSA 4FIRA 4Q4SA 4HPXA 1R87A 3LA4A 2MANA 2YOCA 3SSZA 4X0NA 4LCSA 2RJGA 5I6SA 1RQHA 4B3ZA 5AY7A 5G2HA 1F3XA 4GINA 5CSRA 3L66A 3PZ9A 3WF4A 4W8LA 3M0IA 1GONA 3QZAA 4RXGA 3HGSA 3DHDA 3L2MA 4NILA 2J9XA 3WK1A 1E4LA 5SWUA 4WJXA 1AJ0A 5JIWA 4A2SA 3H7VA 3H12A 1ZQ5A 1UD6A 3AZSA 5E9XA 2JBMA 4UQDA 2RDXA 5DBTA 1FCVA 3W00A 3BLOA 2EGZA 4J3VA 3UA4A 6XIAA 3RMEA 2DZBA 1E1FA 1O4UA 1C91A 2VGFA 1HL9A 5CZ0A 2WC7A 3CB3A 3GYEA 2Y5SA 4HJFA 3II1A 4H9VA 1WDDA 1R38A 2DU2A 2ZCGA 2O7QA 4RXFA 5FD0A 3KZSA 3F2CA 3GD6A 4L5ZA 2PWHA 1YDYA 3LSCA 3UWUA 5A6BA 4F9DA 2XFRA 4GX9A 4ZEPA 1VH7A 2C0AA 3LN3A 2G3MA 2WBKA 2VC9A 1ICSA 5HOSA 4C5YA 2XH7A 1YADA 1AZ1A 2WSRA 3GZAA 4L80A 5I3IA 2DT3A 3T0BA 3CHVA 3VO0A 5A94A 1UP0A 4KGLA 3WF1A 3CAWA 2OXNA 2WC3A 1NOWA 3BCDA 4FOKA 3AWOA 4MJ2A 4NXSA 4CD6A 3HG4A 1QK2A 4DXVA 3MDWA 4PMDA 1AQ0A 2ISWA 1V6UA 1PHWA 3B9OA 1XYLA 3GZ3A 2AOSA 2CC0A 3CZLA 4RLIA 5T26A 2VFEA 4H41A 3ES7A 1Q7MA 3NUKA 2PD5A 4BI7A 4HVXA 1YMYA 1HTIA 3KL0A 2PLMA 3ITLA 1NAL1 3BJTA 3KTXA 4IFOA 3Q4DA 4WY0A 3AU2A 3FJ4A 5I02A 3UU0A 3TLLA 4DB7A 1OFAA 1YPFA 2XM2A 5HWNA 3NZ1A 1XIGA 3WZ0E 3MT1A 3QKEA 3UZYA 4F3HA 5DX7A 1PZ1A 1KFEA 4V1YA 1QPOA 1PCKA 3RITA 4KWWA 1FWJC 4IPIA 4XD5A 1NJJA 4KBXA 3ZWSA 1M7XA 2PWDA 4E8GA 2OEMA 3L0NA 1TPDA 1V0KA 5IHRA 7TAAA 2XIIA 4GMEA 3T9PA 4JTTA 1NH6A 4X9YA 3OGVA 4LB3A 3EEGA 1Y5WA 2NWSA 4DBDA 4O4VA 2C71A 1SFSA 1WZMA 3R8HA 3L0GA 3DH7A 4DPPA 4JHMA 3GVRA 2C19A 3FVMA 3FA4A 1AJZA 3WLJA 2FKPA 2W92A 1O12A 1ME9A 5FJJA 3QZEA 3P14A 3LOTA 3FJLA 2YCKX 3LXCA 1RK6A 1J93A 4S39A 3PTDA 4IUOA 4AWSA 4GYPA 4AYSA 5HJXA 1JIBA 1UWAA 1XLCA 3VD3A 4BQ2A 2V3EA 1WZKA 3W1UA 5D05A 3WBEA 4W85A 1VYSX 2QJIA 3E3HA 4FALA 4U10A 3PPHA 4PL1A 2A85A 4AVFA 4AQLA 4B16A 3M16A 3S2MA 5HK4A 1JUKA 5H8UA 2B0MA 3SRDA 1ZRQA 3DGRA 1VCFA 1PCWA 4DZHA 3LNPA 1XCWA 3VNYA 4A6GA 4R5EA 3WQCA 1GVSA 4PMZA 5J5DA 3V18A 2JIEA 4D9PA 1RUSA 1PVNA 3UY7A 3VIHA 1QTWA 2PBGA 2WZHA 5LNSA 2GJPA 5C54A 4JHOA 2H8ZA 1BAGA 1W8SA 1OCQA 4D6GA 1IXQA 3Q65A 4MB4A 3WJZA 3RILA 2WMIA 3OA3A 3EMZA 1H11A 2Y4SA 3IEBA 4ZQMA 3B97A 4JTJA 5M5DA 1L6GA 3U2EA 3IS4A 3G8RA 4O57A 3OTRA 4O19A 3TN5A 2J75A 3W2NA 3TJXA 1RXOB 2P88A 4OBRA 3N6HA 2HPIA 2P3ZA 2NQHA 3ITGA 4PB3A 4ZENA 1O5KA 4TU1A 4V1XA 1H7WA 1XIFA 1BTMA 4Y6GA 3VNKA 1YDVA 2QVHA 3T40A 1V8EA 3NR0A 2EKCA 6TIMA 2OZTA 2VCCA 4S3BA 1TQJA 3WG6A 1NDYA 1J9YA 1CNVA 2CZDA 2DW6A 4LS2A 1KFWA 4IIHA 3URBA 2ONEA 3QMSA 2PP0A 4AHQA 1WAUA 5CPOA 1O1HA 2XN2A 2F61A 4UTUA 3TK7A 2OU4A 2XIJA 3FIGA 4I9TA 3LCHA 5LIWX 1CGYA 2PI6A 1W91A 1GZ1A 1N7KA 3PBWA 3B04A 4FXFA 3M0LA 2X42A 3AUJA 1VCGA 2XIMA 3GVQA 3VD5A 3R7MA 3M6YA 1F74A 4E3TA 2EPHA 4IPNB 4PUJA 1OC6A 4AMAA 1FHVA 2BDQA 4GUGA 4CNOA 3S5SA 3VFCA 3OIXA 1E4NA 1QPNA 4JTIA 1Q6FA 1UUMA 3E1F1 4H00A 4AG0A 2PRLA 3T07A 3IK4A 1IQ8A 1VR6A 3UG8A 3TJIA 4XKYB 3MSGA 5G5IA 2WLZA 1NWRA 1AQHA 4JXCA 5IXEA 3OB8A 2VM8A 1P5BA 2ZDSA 3FYPA 3LGEA 3UWYA 2HE8A 6PTDA 3SY5A 5HMDA 2X2GA 3F7JA 1I0DA 3VMPA 1Q6EA 1SVDA 2NX3A 4FOJA 1FWBC 2EO7A 3N3TA 3IACA 3R79A 4ZSUA 1KM4A 4GXMA 3BWWA 3TN6A 2QPSA 2I9EA 4MLJA 1V79A 3VGGA 3PULA 2ZRYA 4IMAA 3LUTA 1GWJA 4LVFA 2OSWA 3UW6A 4IJCA 2VC6A 3WMBA 4ECLA 3M6DA 4HNCA 4E2DA 1J0IA 4FLQA 4O54A 5IBXC 1I9CB 3I4KA 4F2UA 3N3MA 1KQZA 4I6KA 3TW7A 4HZMA 2ACUA 1A0CA 1EJVC 2V81A 3OBEA 1XIEA 5HNTA 2XH4A 1XBYA 2WVSA 1TTQA 4HNNA 4AF0B 1GKRA 1Q3NA 2BMBA 4AVOA 3WFZA 4K7YA 1ZBWA 2FLIA 2KAUC 1HF6A 4UTKA 1A5NC 1S46A 4KESA 4M3PA 3DUGA 3IJIA 1R3TA 3OW1A 1V4YA 3AIUA 5CPNA 3UWZA 2ESCA 5IM51 5I2UA 2J6XA 1E6ZA 2QLYA 3K4WA 4ORIA 3B4UA 2VZVA 5G2WA 4A29A 4DWSC 5GVJA 4AEEA 1BVZA 3TIMA 1OVDA 3DHPA 1SW7A 4UC5A 3N9SA 3DFPA 3N29A 3AIRA 3W88A 4H8UA 1CGVA 1AD1A 2X41A 3GB6A 4WXYA 3HFTA 3W02A 1G69A 3TYCA 5CEWA 2C7FA 4QITA 4XD4A 1GHRA 5MKGA 4JZ5A 1EOMA 2RGMA 2QAFA 3LLDA 1OY0A 2CHOA 4AWEA 4UTMA 2AGKA 4J7RA 3SIZA 3IGHX 3NPVA 3IGUA 4S2CA 3GC4A 3IIPA 4X63A 3SAZA 3N9KA 2FPVA 1S3TC 4NJGA 3V16A 1H60A 3ONCA 1H7OA 3K30A 1A3XA 1S1RA 1VFTA 3QXBA 1X1ZA 3RFAA 2QAPA 1O6IA 2HNEA 4MNLA 2EPOA 4AX6A 4LUIA 1LG1A 4DELA 2V63A 2DW7A 3BLDA 1K8ZA 1BVNP 1DWFM 4QISA 4GA8A 1J5SA 3N2TA 1F2JA 2OQYA 4TX8A 4GC3A 4C5ZA 3IPWA 4UTIA 1W3HA 4YMZA 5E6YA 3LEPA 2UBPC 4DBEA 3DAQA 4J2MA 3WNMA 3N04A 4CD4A 4JY9A 5F4XA 2YZRA 3N9RA 4UR8A 1JCXA 4GGBA 3ITTA 1I75A 3HN3A 3XINA 1LL7A 1RP8A 5AYZA 2DIJA 3AS2A 4LANA 3NURA 2Z1BA 2WANA 3CUXA 2QYGA 3VVGA 4JNZA 1EKOA 1J11A 2CITA 4NL1A 1PKYA 2XWEA 3PNUA 4X2RA 3FA3A 4M24A 4CQCA 4IL2A 4QIUA 4ZO8A 1YQ2A 2Z6JA 5HAOA 4CNNA 1P0DA 1JYVA 2ZE3A 4I5UA 5K2ZA 4GCXA 2GZXA 2H3BA 1W1PA 1Z41A 3BL3A 3HPFA 2DSWA 4X2PA 3EMCA 4GZ7A 3LRKA 3PSVA 1ADOA 4Q4KA 3DEQA 2J6VA 1BQCA 4DJDA 2ZZ5A 5C9UA 3CLWA 4GKTA 1ITXA 1VLIA 4WJEA 3TFCA 3NZPA 4PL2A 3T05A 2DZAA 3S1XA 3B9DA 4JS3A 2JKAA 4QJ5B 5HPCA 5F7UA 2OZ0A 3GNRA 3JS3A 2CLHA 4YTSA 5BNKA 4HIBA 1GEHA 4RNFA 2E7FA 3W4RA 3GXTA 2ATSA 3ITYA 2ZX6A 2Q8ZA 2OWXA 3RJXA 1XRSA 1HKJA 1PBGA 3BE7A 5F4SA 5I3GA 3VAVA 4ACZA 1HJXA 1ONWA 2OVLA 5HNRA 2P50A 2I17A 2FQIA 4RPQA 3I4EA 3T2OA 2QJMA 3CT2A 2VYOA 3CU2A 1WB0A 1XGZA 3GIYA 2G96A 2E25A 3M0ZA 2Z1VA 1OYBA 3B0UX 4HNTA 1H50A 3I68A 5FF4A 4CU8A 1SZFA 5M2FX 4DI8A 4Z2GA 1H5YA 5I3DA 2G4JA 1J0HA 3M07A 1NWSA 4C7GA 3OZPA 3CK5A 4E2VA 4UTHA 3OBAA 2NT0A 3CBWA 9XIAA 1LROA 1S5NA 4GYJA 1ECQA 3TQ0A 4KERA 1B4KA 3GTFA 3L68A 1SJAA 2VDGA 3LHYA 4MKSA 3S9ZA 1GJUA 1KBIA 2WSPA 2NUWA 3SM0A 1XUUA 5K9CA 2PEVA 3MS8A 3IVSA 2HE5A 3W01A 1XG3A 1AVAA 3KVMA 1X6NA 1US3A 3NZGA 3UR7A 2UWFA 1A5OC 2Y85A 4QEEA 4DJEA 4CNSA 1HG3A 3CHDA 3OP2A 1XH0A 1QFEA 4OOZA 3HA1A 2PLKA 4FS9A 2VCBA 1VRDA 3TYZA 1K9EA 2F84A 5BRBA