3W1TA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-095
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-095
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1tA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1tA01
2Y88A 4JR5A 3P61A 4MZ1A 3ATYA 2TRSA 3MMTA 4O0ZA 4RX0A 2QCNA 2OT1A 3PWAA 3EKLA 1JCNA 3QPZA 3NQGA 3NAVA 2A21A 3B03A 1SSDA 3G1VA 3QZEA 5CPOA 1P0NA 3HGRA 3NQAA 1GVRA 1ZCOA 4EOUA 4ZQOA 4UMCA 1DKWA 3BK0A 4J9JA 5K2ZA 1SR9A 1TTQA 3MI3A 4MFEA 2ZZ2A 1W31A 2ZRYA 3OHIA 1KM3A 1JVNA 3FJ6A 1MEIA 3HPXA 3DH7A 2YW3A 1UUOA 4ZL1A 4JTGA 1HO4A 4AWUA 3QC3A 4FX7A 4ZVJA 3NNTA 4AHOA 3G1FA 3B04A 4JTTA 3HG4A 3EEGA 7TIMA 4JX5A 1O5XA 4UTUA 3M43A 3PBVA 4UFLA 2ABBA 1EP3A 3L5LA 4OHQA 1BEUA 4RCXA 3N3MA 3TH6A 4GXMA 4AH7A 1BWKA 1UJPA 3STCA 1KFJA 3VCRA 2E5BA 4XBKA 4FX8A 3W9ZA 1FCQA 4HNVA 3M6YA 2YR1A 5D32A 1JR1A 3WFAA 4UFIA 5CZTA 1FCBA 5T26A 1O94A 3HG2A 5HQEA 4MFDA 4BI5A 4O53A 1HFBA 4GFSA 2OZ0A 1PVNA 1DJNA 3TA6A 3KOFA 3W87A 1FDZA 3E02A 3W7HA 5G2IA 4LWWA 1D9EA 3M5XA 3HPZA 4PL1A 2DZVA 2VFEA 4JY9A 3KVMA 4A3UA 1W5NA 3UXAA 1AK5A 3UXDA 3R5EA 2C16A 5L9FA 3QMSA 1NEYA 3UD6A 2QJIA 4FNUA 2Z1BA 4TX9A 1THFD 1VHNA 2UV8G 3PR2A 4ADSA 1W8SA 1ADOA 2V9DA 1OYBA 3STGA 2OX1A 3LOTA 4N02A 2C3ZA 3UY8A 3S5YA 3FA5A 5AN7A 1QOQA 4POCA 4IMEA 5SWUA 4QIUA 5AHEA 1WX0A 3MP4A 5HR6A 1Q6OA 3JRKA 3LLFA 2EGZA 2FB2A 4XWUA 4XTDA 4O1BA 3KVKA 1G69A 2XN1A 2IQTA 4FNTA 2EAWA 3F4WA 3LCIA 5LSMA 3GXNA 4NNAA 4S2CA 1YXDA 1Q45A 3QJAA 4TR9A 2A1YA 2A85A 4IMGA 3AO0A 3Q94A 2QCGA 1GQNA 1KFKA 5FF0A 3NVTA 1PV8A 3A5FA 3W7GA 1KM2A 1SU5A 3O1NA 1F73A 3S42A 1H7PA 3G3DA 5H91A 2NLIA 3B0VC 4CNOA 4BWLC 2CLHA 3TNOA 4A21A 4X22A 1OYAA 2JKEA 1ME9A 1N8FA 2WKJA 4UTWC 3NM1A 1OG0A 5AHFA 3DENA 4M7TA 1G4SA 1C8VA 3S5OA 1DJQA 4O1AA 3M0ZA 3R13A 4JYFA 3GAKA 2VEPA 4PC8A 2CZFA 1DOSA 3C2FA 2ZRZA 3P67A 3L0NA 1OFBA 5EA9A 5TIMA 4JY8A 3DFPA 2BWGA 1Q6RA 1VCFA 5G2WA 4NJJA 4UNLA 2DZWA 2KZHA 2QAFA 1D3GA 3I65A 4N2YA 4ZZ9A 1W5PA 4KFNA 3L5MA 2E09A 5C55A 3K30A 3BLFA 3E96A 3W7CA 5G2HA 2V82A 3UZ5A 4FNRA 2OT0A 3THAA 1FWRA 4PA8A 3LGEA 4KFOA 3FKKA 4FNQA 3O63A 3QF0A 3IV3A 3I6RA 1QO5A 1XUZA 3W1QA 1LDCA 1XKYA 1AL8A 3W7IA 5IBXA 5AC7A 1HG3A 3STFA 5F2MA 3W7EA 5AC8A 3O8AA 1H63A 1OFOA 3LLDA 3ZR4A 1IF2A 3BO9A 1JULA 4RKAA 3TX9A 4JTIA 3CPRA 1TRIA 2WSRA 2CZEA 2R8WA 4EF8A 3CB8A 1GTEA 4DBDA 3NM3A 5HWNA 1TO3A 2R91A 1R2SA 2FB3A 3PBWA 4LC6A 5AC6A 4HKPA 2DJLA 2V0TA 3NDOA 3NL5A 1T0OA 3QSTA 5D2TA 3NPVA 2A2IA 3R12A 2TMDA 1WAUA 3E9AA 1OF8A 1IIHA 3MP3A 1PS9A 2H6RA 5CZ0A 2Q8LA 1C9DA 4JYEA 1VYPX 4JTLA 4AXKA 5HWJA 1YPIA 3LXBA 1JRBA 4N9CA 1GG1A 2ZZ3A 2WNNA 2R94A 3GZ3A 1G7UA 2JK2A 1LOQA 1WV2A 1FBAA 3TDFA 1J2WA 3QYQA 3W2UA 1H7NA 1SW0A 5LNRA 3HGOA 3C4UA 5E1QA 3A21A 5A5WA 3SGUA 3C61A 3KHJA 3LI1A 3IVTA 4C1LA 2G5WA 1VJIA 3BW2A 3W7NA 3F4NA 3LRLA 1KFEA 3CWOX 5KMYA 3CM4A 2DU2A 3O6YX 1VPXA 2RKXA 2W79A 2DZPA 1WOBA 3E0IA 4UNKA 3OVPA 3HIJA 3LRKA 3S8HA 4AF0B 4HN4A 1QR7A 4UFMA 1I2NA 3QW3A 5BOOA 2CFFA 1IXNA 4UUIA 2P1FA 3CWNA 1YYAA 5HJLA 1VCVA 2V2DA 1XBZA 3DU0A 3QMRA 3HB9A 4Z0JA 4FHAA 4WD0A 3MHFA 5FF4A 4RXFA 2QDHA 3G0XA 3M47A 2JKPA 5G4EA 1EA0A 3NPWA 4RZ4A 3OG3A 1NF7A 4NX0A 3VFLA 4BK9A 2EHHA 1XDLA 5E0KA 1LOLA 2GVGA 3KRUA 1H50A 2BX7A 4PTNA 3TFCA 1LLZA 3VE9A 4WZHA 2F84A 4ZMGA 5K7JA 5I3KA 4E2BA 3EWBX 4I7VA 1A5BA 3MWAA 1SO6A 1LRTA 3WK0A 3TXVA 4S1FA 3QRHA 2WPBA 1OFAA 5FEWA 1W5OA 5AHMA 1JJKA 3PBYA 4X3ZA 1UASA 4CNPA 3DI0A 4GWEA 2GJLA 1FDJA 2JBMA 1JCXA 3I7RA 1EUNA 5F4WA 2PRHA 5G4WA 5KZDA 1K8ZA 3SW6A 4AB4A 2FLIA 4E0CA 3G1AA 3W72A 2X1UA 1B9BA 3C0JA 4LVDA 3QQ0A 4R34A 3MI2A 1QFEA 1RQEA 5LHEA 3CIWA 3TSDA 3KRZA 1NSJA 3LHVA 3JS3A 3DXIA 3C8FA 1VZWA 1G6CA 4DQWA 1F5ZA 2I9EA 2DJXA 2DP3A 1TMHA 2NUYA 4AVFA 2NXHA 2QCHA 2BSLA 3A24A 4TIMA 2QCEA 2DZUA 3DFOA 2Y6ZA 2JKAA 5KSWA 2A7NA 4IOTA 3S1VA 2B7NA 1F76A 3W7PA 1L6YA 4XQ6A 1XL9A 4OWGA 1YPFA 4NJHA 4UIOA 3M1ZA 2WSYA 3PULA 2DZTA 4IGHA 3HG5A 2B7PA 2VXNA 3EX2A 4OU1A 3F1QA 3W1PA 5BRBA 6ALDA 1PCKA 1FY6A 3GB6A 2CLFA 1SW7A 4YCOA 3TR2A 5DELA 1VCGA 4BFAA 3W70A 3CC1A 2YGYA 4WQ6A 4QITA 2ZRVA 3UZJA 1XXXA 1H51A 2EPHA 4JTKA 3SI9A 5DXYA 4Q4KA 5D30A 3CEPA 1HTIA 1XM3A 2NUXA 5CKSA 3EXSA 1YADA 1EWEA 1G4PA 4XTIA 3W7LA 2Y89A 4OV4A 1FCVA 1H1ZA 1XFBA 2V5LA 2ISVA 4OV9A 5F2LA 3TE9A 3UNDA 3F03K 1A5SA 4CCDA 3HBLA 4NZFA 1YXCA 5KZEA 1QCWA 2O7SA 1MEWA 4O11A 1F7BA 3LXAA 5LNWA 3PB0A 3QH2A 2WSQA 1WYIA 1VLIA 4YL2A 3W2LA 2VEIA 3UWZA 1W37A 3LERA 1PHQA 3NGJA 1IXOA 3UWQA 3L9CA 3EWYA 4R53A 4ADUA 4RZ5A 4X2RA 3LTSA 2BXVA 3E49A 2VOMA 3SY5A 3S1WA 3W23A 2V81A 1I8JA 1QPRA 1TSIA 2OJPA 3PVFA 3W1LA 1Q3NA 3TV8A 3UWVA 3HGSA 1KM0A 2Y61A 1JUEA 2FIQA 1LBMA 4NJGA 1FQ0A 4O54A 2CLKA 2YCEA 4M6PA 4DBEA 5L6UA 3UWWA 4UXDA 1IIGA 3IIPA 2RDTA 4PEKA 1EUAA 5KTLA 3NQCA 3FKRA 4GC4A 1V5XA 3LHZA 3GNNA 4HSOA 3GKFA 1YTKA 3EWUA 2VEKA 2PURA 4UMBA 5HULA 3RFAA 4HPXA 3BGGA 3LCWA 3ELFA 2XN2A 1GYLA 3B8DA 4FX6M 4GNJA 3MW7A 4IMFA 5MHBA 4XKYB 1BWLA 2CLLA 1L6SA 4FIRA 1TRDA 4L4LA 1G7VA 5AB3A 5DXXA 2VFDA 4MYXA 4Z0SA 1B4KA 4ONVA 1K03A 1RPXA 3LB0A 3B05A 4JYDA 5EBUA 2CLIA 4A2SA 1RQHA 4FNSA 3PAJA 1OFDA 1W1ZA 2NZLA 5G1YA 2E6DA 1H7XA 3SJ3A 4MY1A 4QNWA 3O6CA 4UFKA 3OVRA 3LV6A 1XC4A 2WV8A 4N6EA 3Q37A 1H1YA 4MYAA 1YXYA 1CI1A 1KM1A 5HWMA 4O57A 2Y7DA 4IXXA 1F05A 4HNTA 1KBIA 3E12A 3PUOA 1DBTA 4MOZA 1ZFJA 1H5YA 4X9SA 3M7WA 4E38A 4IMDA 2CU0A 3HGJA 5AHLA 4JD4A 1X1OA 1KA9F 3P62A 4O18A 1LYXA 1W3TA 4FEZA 4C1KA 3LHTA 1KV5A 2PC4A 1GZGA 3TMLA 2V5BA 4FXSA 3GNDA 2P0OA 4R33A 1JCLA 3W1XA 4LRSA 1A53A 4GUHA 1AW1A 2QKFA 1H7OA 4RZ6A 4RV8A 1J4EA 2DZSA 1W54A 5DCEA 2FPVA 1QOPA 4NX5A 1LBLA 3W6YA 3DHDA 4BI7A 3EWWA 3T55A 1S5TA 4IMCA 3ABRA 3SSJA 3NOEA 4GUIA 5HUOA 2C19A 4DELA 1TJRA 2AQWA 1VR6A 1Z41A 2WJZA 2D73A 1OK4A 2FDSA 4AMAA 2Y7EA 3L21A 3TJXA 5H2ZA 3S1UA 1OFEA 1FWWA 3JR2A 2HSAA 1G67A 1QPOA 5D09A 2JGQA 3M9YA 2VEMA 2X1RA 1XBVA 2QF7A 1GYNA 1JUKA 2NWRA 3HPSA 4K8EA 2EKCA 4PCFA 1DV7A 5CSSA 4M5PA 4M6VA 2ZA1A 5F2GA 2VFHA 4UFHA 4O0KA 5LKYA 4Y6GA 3L65A 2VELA 5D04C 1OF6A 3MO7A 3RLVA 4DF2A 2VFGA 8TIMA 4Z1BA 3BGJA 2YDAA 2VFIA 5I3HA 3NQMA 3EX1A 1EIXA 4IJBA 1OX6A 5BNKA 1K7FA 4UFJA 4FNPA 2C15A 2C14A 3LHWA 1AW2A 1K3UA 4JS3A 4FF7A 1N7KA 3WK1A 5F1VA 3NQ8A 1WOAA 5DCBA 2W6RA 3DBPA 3G22A 2ZCGA 4XZ9A 3V75A 1VGAA 4HSNA 1XI3A 1KFLA 5FEZA 2EF9A 4ZQMA 4U28A 3U2OA 5K9DA 4DO6A 3S1XA 3N2XA 3EB2A 5AYYA 3Q2DA 2RDWA 3N2MA 2DORA 3W7OA 4LVAA 4QM1A 4GJ1A 4QJ1A 5DY2A 3YPIA 4ZQNA 3QPYA 3Q58A 1H7WA 1O4UA 3UWUA 1KW1A 1I2RA 4WUIA 1H60A 3CIXA 4UR7A 1V7YA 4QSHA 1I4NA 5BMXA 4N9BA 3M5VA 3A22A 1TV7A 2V30A 3DGRA 2NXIA 1F74A 4DPPA 3IVSA 4ML9A 3QFEA 3TCEA 3NL6A 1PCWA 3GK0A 3W71A 1KV8A 4A29A 5EMUA 4AHPA 4O14A 2YPIA 4UTJA 3T7VA 1GG0A 2PE4A 3GX9A 3CHVA 1LP6A 3G1SA 1WQ5A 1LRNA 1CW2A 2P10A 4HPJA 3QSRA 5C2XA 1OK6A 1TPH1 2TPSA 1TYGA 3GR7A 4PH6A 1GVOA 4K37A 4O17A 1OFRA 5G1TA 1AG1O 1MO0A 5KZMA 3FYOA 4KWWA 4LC8A 2Z6JA 2E6FA 1LROA 4MLJA 3TROA 2B7OA 3O05A 1PHWA 4BR1A 2AGKA 4OBTA 3GDLA 4WOZA 4UCGA 5HR7A 3KX6A 3W1RA 3G1HA 4JDBA 3W84A 3S9YA 3PUEA 3PG8A 5DBUA 5F2IA 1QMLA 2J9ZA 4CCEA 4MKNA 4O12A 1TPVA 3EX3A 4K8HA 3W7JA 3C56A 2C6QA 1W5QA 4JX4A 3GVGA 5AYXA 3RU6A 1KTNA 1ALDA 3N19B 3G3MA 3NA8A 3P5YA 5EL1A 1BKSA 1SO3A 3EX4A 4JTHA 2ZA2A 3CEUA 4HNUA 4LOCA 4MUZA 3S6DA 3WK2A 3HOJA 5C54A 1M6JA 1O60A 3BPWA 1K8XA 2YFOA 4WX2A 1KTCA 1OX4B 1TPWA 5U7SA 4MLRA 5I3IA 3W7QA 2RDUA 1VC4A 2Y85A 3N14A 4LVFA 1LCOA 3NL2A 2XFWA 2ABAA 3LX9A 5KITA 4JX6A 2GPTA 3FYPA 5FF3A 3BW3A 1UBSA 1FUYA 4BI6A 2YXGA 5K4ZA 1DQXA 1JCMP 2QUUA 1ICPA 3UPWA 4BWLA 1NAL1 3DFTA 3FIGA 3HF3A 4P61A 1F6PA 5D2VA 3IRDA 3M44A 4IPJA 4WXYA 3MI6A 3HMJG 2ZZ4A 3EWXA 2X30A 1OX4A 4RR4A 5DCDA 1KTBA 4HHPA 3KVJA 4MVAA 4AWTA 1O95A 1RV8A 1OABA 3LCXA 2J9YA 4NJIA 2YFNA 2VFFA 4A2RA 1XBYA 1ICQA 3A5VA 4LT9A 2QCLA 3ABOA 4MZ8A 1MEHA 4EIVA 1HL2A 2A5HA 3IGXA 4WY0A 2DZXA 3C52A 4TMBA 1S5VA 1SFJA 4RK8A 4O19A 5LGZA 3RLUA 2ZRXA 4AWSA 4CQ8A 4NVTA 4MY8A 1ZNNA 3NPXA 5AFDA 4HIBA 1XBXA 1VLWA 5LZLA 1Z48A 1OYCA 1GWJA 4PFMA 2QEZA 5AOUA 2ZRWA 3M16A 3R8RA 4DXVA 2GQAA 5K3VA 4IX2A 1OFPA 1SFLA 2YYUA 5D2XA 3TFXA 3VKJA 3TQ0A 1Z42A 3N34A 2H90A 4I9AA 2WNQA 3G24A 4CLMA 1GOXA 2W0UA 3VI2A 3P8JA 5LNUA 1ZY9A 4R7JA 1YLVA 4MJMA 3P7YA 3GDRA 3SECA 1RD5A 2Y7FA 3EXRA 3W2NA 1H7RA 2GOUA 2G96A 4LTSA 2FFCA 1TTJA 2QUTA 1P5BA 4IPIA 2QCCA 3C2RA 2YYTA 4OT7A 5CSRA 3B4UA 4XUGA 5ABTA 3DAQA 1TTPA 3W7DA 3OEXA 1HUVA 1FX6A 2OMAA 1I45A 3H53A 5LGXA 3GIYA 2Z6IA 2LLEA 3TKFA 3M41A 1P0KA 3LDVA 3MYOA 3NQ7A 1QO2A 1YDOA 4KFPA 3NL3A 4Y90A 3S0CA 3W74A 4LW7A 3WJZA 4UTMA 3TIMA 1K7EA 1OHLA 2ZZ5A 1I2OA 4IQLA 3CQ0A 1VHCA 5AHIA 4WY0B 1DORA 3HQ1A 1VH7A 1TPC1 1SZNA 5CPMA 5J5DA 2OCZA 2CLOA 3BG9A 3W73A 2NX9A 3THQA 1KBJA 2GVJA 1TQXA 2E77A 5CGQA 3RK8A 4OGZA 3O07A 2C0AA 4AHQA 4KKXA 4Z1DA 3PY2A 1W3NA 3C3NA 2E6AA 3UWYA 1R2TA 2H8ZA 2C13A 5LNVA 1VQTA 3IGUA 4ZQRA 1QWGA 4ZQCA 3TXZA 1XUUA 3NQ2A 3FLUA 4JDYA 3PS7A 1R2RA 3D0CA 3LCHA 3NZ1A 4LV9A 2B0MA 3PSWA 3I7SA 2V2HA 4Q32A 1ZALA 1JCYA 2I14A 4PODA 1DL3A 1SSGA 1TPUA 2XN0A 3DKLA 2QJHA 1LOSA 2CLEA 2WQPA 3W1MA 3I7QA 5CZSA 1SO4A 5FI8A 2WOQA 1Q6QA 4B5NA 1K7XA 4O10A 5BW6A 2H8XA 2ZTKA 3W86A 1LRQA 3P84A 3ZWTA 2NX3A 3EXTA 5HINA 3NXFA 2CW6A 1M7PA 1S3HA 1LLWA 1QDSA 4E2DA 3BVJA 2NV2A 2B7QA 1L6WA 2QUVA 1RVGA 4IWWA 2CWNA 2H3DA 3MP5A 4H3DA 4EF9A 3HO8A 5J5RA 2F7FA 2YZRA 2ZBTA 4UMAA 5AYZA 3RF9A 1W3IA 2WNZA 2WO5A 1FWNA 1X1ZA 1QNVA 1Y0EA 4RXGA 3W1UA 1S5WA 1GVFA 1ZAHA 1WBJA 4K39A 1XDMA 2VKZG 2E1DA 2RH9A 3KFTA 2X1SA 2G95A 3P82A 2ZZ6A 2NUWA 3WK3A 3LM7A 2GJNA 3MYPA 2ISSA 3KAOA 3W1AA 1R47A 2QR6A 3PBUA 5D33A 3W7MA 3TC7A 2GQ9A 3P80A 3EWZA 3L66A 3SGZA 4A22A 1Z44A 1WXJA 5LNSA 3TU9A 3NQVA 4YMZA 2ZRUA 4UTIA 4O1CA 4JTJA 3SIZA 4Y9AA 1W56A 4O4WA 3CLMA 1FWTA 1FXQA 3MBDA 6TIMA 3LCGA 3W2MA 4NUWA 1KLZA 5KINA 3NQEA 3LTYA 3P5ZA 3RMJA 1LM1A 3DFSA 3STEA 2ZQ0A 2YSWA 3FFSA 3NG3A 3LHUA 3M5YA 3NPUA 3PG9A 3C2VA 3HG3A 3O06A 4LUJA 4Z08A 4FXRA 1VYRA 3QM3A 3NZRA 1TIMA 2NX1A 1TCDA 1U5JA 4GE8A 4O1DA 4ICNA 1YTDA 3QEZA 3NR0A 1LTDA 5D2WA 3WJSA 1GVQA 5K9CA 3ZWSA 3UY7A 3UPBA 3DFQA 3NQFA 3W2KA 3L2IA 2ATSA 1JRCA 5DLCA 1OX5A 2J88A 3U8GA 3G0UA 4UTLA 4Y8FA 4D2JA 5E93A 2ZYFA 1F6KA 1ME8A 4O8RA 5CPNA 3ATZA 2CZ5A 3C2EA 3W76A 4NNCA 3W7KA 1HO1A 3AJXA 2C1HA 3DHFA 3L0GA 4BF9A 4LS1A 2RFGA 1D3HA 3FEMA 4LV4A 4N9DA 4AAJA 2NXGA 5EPDA 4NT0A 2BLEA 5C6MA 1ME7A 1ML1A 5EY5A 3O15A 3TQKA 1UUMA 1KM5A 3USBA 3B0UX 1TV5A 2ZFAA 1J5TA 4TO8A 2B4GA 5CG7A 4FO4A 5FF2A 3T44A 1EP1A 3N73A 3LRMA 2J9XA 1GPWA 1T99A 2FJKA 1OFQA 4W9TA 1E51A 2H3BA 3BLEA 1ONRA 4MIMA 1AW5A 4QNEA 3NEVA 4JTSA 5DN1A 5HUPA 3TJLA 1WA3A 2X16A 1B57A 4ORMA 3TUUA 3W22A 3W3OA 4JEQA 2X1TA 2A7PA 5HMSA 3LI0A 3HJZA 4GUGA 4DF0A 3DZ1A 3BV4A 4Q33A 2PRMA 4CQAA 5D2YA 5FF7A 3MUXA 2GVLA 2Y70A 5D05A 1TB3A 3GAYA 2HS8A 3BG5A 3EKZA 4IXHA 5F1UA 1K8YA 1TPEA 3G8RA 4UTTA 1B4EA 2QDGA 4MZYA 4I7WA 2VC6A 4O15A 4NU7A 1L9WA 2Q3OA 1UCWA 4ORIA 1MZHA 5FEPA 3IIZA 4YLWA 2NV1A 3WJXA 3GDMA 3H54A 1GT8A 4O13A 3TAOA 1ICSA 2E5CA 1YDVA 3A23A 3LV5A 3W75A 4O4VA 2GUUA 4OQVA 4DO4A 4JTEA 1TV8A 4JIPA 4O52A 4AEOA 4UTTC 3WJYA 5LHFA 1SZEA 4KWVA 2J6XA 4NXSA 2E6YA 2FPYA 1SQ7A 1AL7A 4Y96A 1I2PA 3C6CA 1PIIA 1C29A 1AMKA 1RZMA 2GQ8A 3G8EA 5D37A 4O50A 4MPQA 3GYEA 1NF0A 3O16A 4LNYA 4LVGA 1UB3A 2E68A 3NQDA 4DF1A 1IXQA 4RLIA 2HMCA 4WXZA 4DEFA 3MBFA 3W88A 3FJLA 3S5NA 1NVMA 1QPNA 4U4MA 4LU0A 3TW7A 2QCDB 3L67A 4Z1AA 3LCFA 3CTLA 2QCFA 4S2BA 2A6LA 4EVZA 1SW3A 1GTHA 5G5IA 3CT7A 4NQ1A 1TPFA 4N6FA 2PRLA 3ANYA 2V2CA 1VRDA 3W1NA 3KVLA 3W1TA 1NFBA 3ZFHA 4NNBA 1OJXA 2ZZ1A 4QISA 1VYSX 4YXGA 2NWSA 3R2GA 4LS2A 3BLIA 3IEBA 2RHGA 1EWDA 3TSBA 1T96A 5DY3A 3UYCA 1TPDA 1M5WA 3S5ZA 3N9SA 1W0MA 4UTHA 4K7YA 2I1OA 1A50A 4QAIA 2BTMA 4WJEA 1KFCA 1GJPA 1RQBA 4M7SA 3GXTA 4DO5A 2BZNA 5FEXA 2HS6A 4JXCA 4K36A 5K9XA 3FS2A 3GDKA 3ABSA 2Y63A 3GR8A 3NQ6A 3B06A 3A9IA 5BMWA 3WJWA 4I7UA 1TPB1 1WBHA 3PC0A 1Q6LA 1EPXA 4IX0A 4AF0A 1TREA 3T4CA 1U83A 4XKYA 2A6NA 1PE1A 4N4PA 2TSYA 3IIOA 4H4IA 2Y62A 3BG3A 4NZJA 1SPQA 2Z0IA 3GDTA 3R89A 1FCUA 3MHGA 2C18A 3TQVA 1RR2A 1MSSA 5TQLA 4NJKA 1YDNA 2Q8ZA 3PB2A 4TMCA 3PSVA 4CQ9A 2J27A 1DQWA 1ZHAA 3KRSA 2A4AA 3B0PA 1TJPA 4K6AA 4JTFA 3LBCA 2ZA3A 3NO5A 3OIXA 4UTWA 1ZAIA 3PM6A 4JICA 2Z2UA 1P1XA 3TMQA 2ZTJA 3LTPA 3OVQA 4WOQA 3G1XA 3RNDA 1BTMA 4DPQA 1F2JA 4FIQA 4OE7A 1DVJA 1DHPA 3P8IA 1B3OA 1LBFA 4UC5A 4LS0A 3LHYA 5I3FA 3UQNA 5CPLA 4EWND 3MJYA 2QJGA 1KFBA 3W85A 2A7RA 4JNMA 3G1YA 1ZJIA 4GUFA 1JUBA 2ZZ7A 4JN6A 4JIQA 1EB3A 1MXSA 4JGDA 4ALDA 1ZENA 3SR7A 3P60A 4UR8A 1R46A 4ZQPA 5CZJA 3TAKA 3TC6A 4UTKA 3V1PA 1TTIA 3G1DA 3NYZA 4JTUA 5GVJA 4YWIA 3ABQA 2Y7GA 3CU2A 3W2JA 5D38A 1SUXA 3M5ZA 3I68A 5AHNA 2YX0A 1N55A 1KM6A 1W5MA 3T78A 3LBMA 1IXPA 1JQXA 4XBSA 3U6WA 1R30A 5C5YA 3TSMA 4G1KA 3OA3A 2ISWA 2QCMA 3G18A 1KLYA 5IBXC 4NXKA 2A0NA 3W7RA 2PCQA 2V8ZA 3P81A 3GXPA 1FXPA 1H62A 1K02A 4LRTA 1SO5A 3L68A 4L4MA 2ALDA 4O16A 2ZDRA 3GKAA 3FOKA 3SZ8A 1L2UA 4HT3A 1IGSA 3O6DA 3L5AA 1JCJA 3SFKA 3C2OA 1LZOA 4H6KA 4GUJA 4LVBA 1PL9A 2ATMA 1LORA 2CLMA 3QW4B 4MJZA 1O5KA 3TW6A 5D02A 4FB7A 1FWSA 4WY0F 3P74A 4P2VA 2AAMA 3ZS4A 4M6QA 3GLCA 4CCCA 1G4TA 1FDYA 3H55A 1JQVA 1A5AA 1X6UA 3L0KA 3VNDA 3W07A 1WDWA 4N4QA 5EKYA 5U4NA 4LUIA 3N9RA 1P4CA 2X2GA 3G0SA 5I3GA 1XCFA 4M19A 3LXCA 4MY9A 1I2QA 3INPA 3QMTA 4GBUA 1ZAJA 3VE7A 5D03A 1X7FA 1SZFA 2FQIA 3KXQA 1M7OA 2JGYA 5FESA 3MHUA 4K7VA 1CX9A 3IIXA 4QQ3A 4N9EA 4LY8A 1H61A 3LCLA 5IM51 2TYSA 5I3JA 5F4SA 2QAPA 3QQ1A 2Q3RA 5HNRA 5EYWA 3DFNA 3IGSA 3OBKA 3T40A 5K4XA 2J24A 1OVDA 2HTMA 4Z1CA 3PUDA 1KM4A 3PF3A 1SZGA 3BARA 4YCPA 2QCDA 2O7QA 1T8XA 4HNNA 5A8GA 2E5DA 3BW4A 4PL2A 1G4EA 5TBOA 4GRSA 4IUOA 2FTPA 1VS1A 3EX6A 4K38A 4O28A 4RJEA 5F4XA 1GEQA 3W83A 2CZDA 1EP2A 2VENA 4TU1A 3IIVA 1GVSA 1EEPA 1X8FA 2R14A 3DI1A 1EX5A 1TQJA 3IVUA 1A5CA 3TK7A 5DBTA 2G97A 2FPTA 3DKJA 4CNNA 4ADTA 1YTEA 1QPQA 1QAPA 2YW4A
chains in the Genus database with same CATH superfamily
4V27A 4DLFA 1B3ZA 2DT1A 1YRRA 4RX0A 1MYRA 3G77A 3PWAA 1JCNA 4LEFA 3MPGA 3B03A 1OEPA 1TZ7A 3QQWA 3HGRA 5AY7A 1F4AA 1EPVA 3JZUA 4L1GA 3BK0A 4J9JA 1C91A 3MI3A 4GA8A 1W31A 2ZRYA 3OHIA 4YTSA 1JVNA 4L64A 2NQZA 3CMJA 3HPXA 2PS2A 2A79A 3DH7A 1UUOA 3BZJA 1V3LA 4JTGA 5CGTA 2ZX8A 1KCXA 4FX7A 4ZXOA 4ZVJA 4AHOA 4DWSB 3FEQA 3B04A 1Q63A 4DUOA 3WFLA 3HG4A 3EEGA 4UTUA 2OFJA 3U7VA 4MMWA 3MZ2A 4R27A 3NFUA 1K9DA 1XISA 3K1DA 4RCXA 4Q8PA 3GTIA 2JF7A 4AH7A 2D0GA 3LA4A 3TQPA 3VCRA 4F0RA 4GJJA 4FX8A 3TWBA 3WQDA 3SY8A 4HNVA 1IR1A 1JR1A 5D32A 3WFAA 5CZTA 1R6WA 1O94A 3HG2A 3EDFA 3RO8A 2OSXA 1LWHA 1XQKA 4P8VA 4BI5A 1TIWA 2WVUA 1TG7A 2J7CA 1PVNA 5C9WA 6ENLA 1FDZA 1AQ0A 1V6VA 3W7HA 4F4RA 3T08A 4A4AA 1OINA 3HPZA 1AODA 3FYYA 1P6CA 3CMFA 4IIGA 3F2DA 3O6AA 2PTYA 3QMSA 3RO6A 4X61A 4TX9A 5J8LA 1THFD 1VHNA 3BMWA 3PR2A 2AQVA 3HPAA 4KQNA 3WNOA 4H7VA 3GH5A 3S5YA 4IMEA 4GINA 3OP2A 4QEEA 4J3SA 2DV0A 3JRKA 4XZMX 4O1BA 4CD5A 1IZCA 4FNTA 1B9ZA 4EPBC 3BAKA 3CZJA 3S3GA 3CMGA 8CGTA 2Y24A 3OYZA 3RM9A 4S38A 1WKEA 4G56A 3AO0A 1GQNA 1KFKA 5IOBA 3I3EA 3AS2A 2ESCA 2FHBA 1PV8A 4ZODA 5DT5A 3K46A 1KM2A 4ZA0A 3O1NA 1HJQA 1F73A 1H7PA 1W1IE 3B0VC 5DANA 4D72A 3H2FA 1JXKA 3TNOA 1OYAA 2G3FA 4HN8A 4KCTA 1JF5A 1ME9A 1N8IA 1N8FA 4QLLA 3RLGA 1OG0A 2C1GA 4M7TA 3S5OA 4O1AA 3M0ZA 3R13A 2XM2A 3BJTA 2J8FA 3CL6A 3OZMA 3GVVA 1UH4A 3GAKA 2VEPA 2CZFA 2ZRZA 1OFBA 4JFUA 2W9MA 4JY8A 3RCYA 3DFPA 4HMDA 1VCFA 3MV11 3URBA 1VFHA 2ZUWA 1GW9A 3I65A 4FSAA 3KL5A 2J7GA 3GVWA 1RPKA 2ZUTA 3W7CA 4DBSA 2V82A 5D9OA 2OT0A 4OBSA 3LGEA 3FKKA 3QF0A 2VGBA 3IV3A 4HTBA 1XUZA 3W1QA 3GG7A 5BXTA 5IRPA 3W7IA 1E0WA 5I07A 4EPDC 1H63A 1OFOA 3ZR4A 3CQIA 1HL8A 1JULA 4S3JA 3MY9A 4JTIA 3LBOA 4GABA 3CPRA 3VOFA 5H8PA 1GTEA 3SCTA 1GQKA 2F2HA 2VZSA 4XV0A 5EFDA 4HKPA 1CGWA 2DJLA 2V0TA 4L6DA 4LAUA 2ISFA 4H9TA 3QSTA 4KESA 1JPKA 3R12A 3E9AA 1OF8A 1EOKA 1DP0A 3MP3A 1P0BA 1R9XA 1LLOA 4JYEA 1EJSC 1YMYA 4JTLA 4H9YA 2YB4A 4XAFA 1JRBA 3GXMA 2XIIA 3DFHA 3H4GA 2JK2A 3F4CA 5BOFA 1ISXA 3W2UA 1SW0A 5LNRA 3GHUA 5E1QA 3RYSA 3A21A 3KHJA 3IVTA 5M3WA 1OD0A 3UERA 1XP3A 1KFEA 2DZBA 3CM4A 2DU2A 4PR4A 2C71A 1GW1A 2ZUVA 3E0IA 4UNKA 3CIVA 3HIJA 2FKPA 1JZ2A 5JU6A 4PMYA 3LRKA 4DNMA 3S8HA 1M01A 3MUAA 4HN4A 1QR7A 3FXYA 3QW3A 2AL2A 2VRJA 4EP8C 2BHUA 1YYAA 3CWNA 1XSJA 4ZOEA 3APYA 3E3HA 4NILA 1NOUA 1VCVA 3BTNA 4GI8A 4B5WA 1O5RA 2PDFA 1S2VA 5FF4A 1EH9A 1B5TA 3SRKA 3WX7A 3M47A 1U1JA 3NPWA 4NX0A 7ODCA 4BK9A 4GYPC 1LOLA 1VFLA 2GVGA 1P48A 4PBGA 1NFGA 1HKKA 1UP0A 3VE9A 4LBUA 2PF0A 3TN5A 1A5BA 4QCFA 4PTMA 3WK0A 2QDDA 8XIAA 4HGXA 1JJKA 3AWOA 1CCWB 2EPNA 3URQA 1E71M 3DI0A 3M0YA 3I7RA 5EMYA 5G4WA 5KZDA 2WVTA 2FLIA 3CV1A 4LVDA 3QQ0A 4R34A 3BOFA 2ZX5A 4LUYA 1TWSA 4IQJA 2EO7A 3CIWA 4GYPA 4AYSA 1AUSL 3JS3A 5E0FA 3C8FA 4J5NA 4BF7A 4DQWA 1Z69A 4Q4RA 2QW5A 3SN4A 2NUYA 1NQ6A 3WLJA 4EE9A 3A24A 2QCEA 2DZUA 3DFOA 3WF1A 2JKAA 3ZIZA 1Z89A 3WMLA 1JDFA 2PA6A 1L6YA 4XQ6A 1XL9A 2OKOA 4OWGA 1YPFA 3EDKA 2I9UA 2BY2A 4C6PA 4C90A 4LBSA 3PULA 2DZTA 1S2AA 1E9YB 1CB7B 4OU1A 3WY1A 2W62A 2CLFA 2XVLA 2VGFA 3WLQA 3TR2A 5DELA 1JGMA 3B9NA 4QITA 1UD3A 2ZRVA 3MKCA 2EPHA 3SI9A 5DXYA 5D30A 3GD6A 3BC9A 1XM3A 2NUXA 1EX1A 1XYLA 2Z7KA 3OA5A 3S9ZA 2HEJA 4OV4A 3TVAA 4OV9A 2V5LA 2ISVA 3TE9A 1UD4A 2ALRA 1A5SA 3IJ6A 3OVGA 2JE8A 1EJWC 3QV7A 3S2LA 4CCDA 1EF2A 4NZFA 1YXCA 3EWDA 1QCWA 1BF2A 1MEWA 2RDXA 2X7VA 4AC1X 1S46A 5LNWA 1UG6A 7REQA 4Q8UA 2I16A 3VDGA 1CECA 3KTXA 3PBMA 4V28A 3LERA 1PHQA 2J74A 4I9JA 4DB7A 3RXZA 2PC8A 3EWYA 3EA1A 4X2RA 4ZB2A 2XVKA 3S1WA 2PDCA 3W23A 2PPGA 3UA4A 1VIWA 2V81A 3N29A 4IP7A 3JVAA 1TSIA 2ACSA 3BXWA 4PUDA 2DIEA 5I5RA 1RUSA 3L12A 1M04A 1XIFA 4GVGA 3GNOA 1NWUA 3SCNA 4NJGA 1FQ0A 2DW6A 4O54A 4IF2A 4AZCB 2ZX9A 5L6UA 3UWWA 3PNUA 3EAUA 3IIPA 2AMGA 3NIYA 3O7UA 2VUYA 5KTLA 3NQCA 2VQTA 4PUNA 1V5XA 2A3BA 4RNFA 1PYFA 2DEPA 1TMLA 5BU6A 2D3NA 4ZOBA 3EWUA 4UBPC 2PURA 4UMBA 5HULA 3RFAA 1NP2A 3RCNA 2R1MA 3LGGA 4FX6M 5ABEA 4GNJA 2WHMA 1RAKA 2X41A 2BOFX 5A8PA 2F61A 5I0DA 4XKYB 1L6SA 4FIRA 4L4LA 5DXXA 2VFDA 4C6JA 4UTFA 4Z0SA 2J25A 4ONVA 1RPXA 2EPMX 3S1GA 3M0XA 2OO0A 3VYLA 5EBUA 3RITA 5IFTA 4A2SA 1GORA 1X96A 3KP0A 3PAJA 3RX2A 1OFDA 4FAMA 4GZ7A 2WVVA 2XDFA 4MY1A 1QJWA 1GKRA 5I2UA 1V3KA 1XC4A 3A6OA 3W00A 1VJZA 1H1YA 1YXYA 1FRBA 5HWMA 1HJSA 4H8VA 1QI0A 1F05A 3V18A 1KBIA 1UR9A 4EK7A 3E12A 2PCEA 1DBTA 1RK6A 1ZFJA 3VA8A 4ATDA 2CU0A 4JD4A 4UOZA 3WLOA 1LYXA 1NTHA 1QHOA 2VGIA 2PC4A 1BF6A 1QU4A 3WNMA 1S2UA 1Y5VA 2V5BA 4FXSA 1KFWA 3BH4A 4R33A 1ODZA 4H6EA 5CPTA 2INFA 2O4QA 2V6AA 3OBAA 2FPVA 1G5AA 3RRAA 2J7BA 4XISA 4REQB 2ZVIA 4E8CA 3T55A 5GJPA 5FD0A 3SSJA 4NZ3A 2J47A 3NOEA 4GUIA 3WUGA 4WGHA 4DELA 4PGLA 1TJRA 4HPNA 2MUCA 2WJZA 1OK4A 3U2EA 3GRIA 2FHFA 3RMEA 5H2ZA 2GOKA 3RLHA 3S1UA 3JR2A 1FP8A 2HSAA 3BV7A 5D09A 2JGQA 2C79A 3PPCA 3BGAA 4DZHA 2VO5A 1ZL1A 3HTWA 1YW1A 4FK9A 4D6EA 3R58A 4GIAA 4AZ5A 4M5PA 1NP0A 1Z6KA 3UVIA 3AYVA 4UFHA 2HK1A 1NM9A 1RBOB 5D04C 8TIMA 1AZ1A 4YN5A 3BGJA 2YDAA 4GLEA 2VFIA 1WDPA 3CAWA 3EX1A 1BKHA 1EIXA 1EJUC 3H7UA 3SDOA 2JFEX 5A1AA 1B31A 2C15A 2C14A 1K3UA 1MRQA 4IUGA 4FF7A 1V0NA 5DFAA 2PWDA 3WK1A 3MKVA 2CITA 2W6RA 2Q02A 1TJ0A 3VGGA 4HU4A 3PTDA 2HVNA 1ECQA 1XI3A 1KFLA 2EF9A 1A0CA 4ZQMA 4ICMA 3OYXA 4MF4A 4WKHA 2FHCA 4HJWA 5K9DA 3S1XA 3N2XA 1HGYA 3RX3A 4LVAA 4BY3A 3W7OA 4HOXA 3B3DA 1EXBA 1O4UA 4WUIA 3CIXA 1V7YA 4NZ4A 4FP1A 2INZA 3QPEA 1WE5A 1JI1A 3UYIA 1MUWA 1MXGA 3A3HA 1F74A 4NHVA 4WKAA 4KEZA 2OPJA 4C91A 4A8IA 3NL6A 2NVDA 3NUKA 2W67A 1VEMA 1YIXA 4A29A 4LCQA 1C92A 3U0HA 3MTWA 4AHPA 3B0XA 4O14A 1EYEA 2YPIA 2XG9A 4V1XA 4CN4A 3GX9A 1NIUA 5DX7A 3G1SA 2W27A 1LRNA 2ZKMX 5KZ6A 3QSRA 5C2XA 1OK6A 1UIOA 1EJVC 2VHLA 1UYQA 3GR7A 1GVOA 4K37A 1PJ9A 2AOSA 4F0SA 2PGWA 4PCNA 2CPUA 2QIWA 2YL5A 1LROA 1ITQA 2J66A 1PEZA 2B7OA 3WIJA 3O05A 4FLRA 2AGKA 4OBTA 3QLDA 3KX6A 4F9DA 3GO2A 3BICA 4XAYA 1BG4A 4CCEA 4MKNA 1JCTA 5T9CE 2FGBA 4BQ2A 5JBDA 1RY0A 2C6QA 1W5QA 3QFWA 1TWIA 3VMNA 3RU6A 1KTNA 1ALDA 2XYLA 1R3QA 5EL1A 1NY1A 1BKSA 5CH9A 4M29A 4GYJA 3CEUA 1QOXA 3TYUA 3BPWA 4WX2A 2YFOA 1KTCA 3CO4A 4GVFA 2GDUA 5I3IA 3W7QA 1AJZA 1VC4A 3IGHX 3G6LA 1A5UA 2XFWA 3QHNA 1XIHA 5FF3A 4DM1A 2OZTA 2YXGA 4GJIA 1FWFC 3DUGA 5K4ZA 1DQXA 4QX4A 2QUUA 3N6JA 3IACA 5CQ1A 5FAJA 3UPWA 3EPOA 5D4YA 3WDRA 4BWLA 3DFTA 3FIGA 4GPNA 4GQ0A 4WDWA 3IRDA 5B80A 4IPJA 4EXAA 3SQLA 1DXEA 2E67A 2X30A 1T5AA 2GVYA 3WKZA 3VUPA 4MVAA 2VD8A 1OABA 2EBNA 1MUCA 3LCXA 1P7TA 2F6KA 4Z1YA 3SN0A 1ICQA 1BTCA 2XJ7A 4MZ8A 4OZOA 3T6CA 2UZ9A 4EIVA 1B54A 3IGXA 4JTDA 2DZXA 3C52A 4XKMA 3VNZA 4CUCA 3JU2A 3SURA 4LX4A 1SFJA 4IG2B 5LGZA 2V3GA 2HCVA 1H5VA 2BVDA 3AC0A 1UIPA 3DFYA 4HPGA 1Z48A 4BKNA 5AOUA 4DXVA 4GNVA 1BVWA 1U5VA 2RGMA 1SFLA 3VKJA 5HANA 3TYEA 4QG8A 3ME3A 3P8JA 4XZBA 1HGWA 1HP4A 1UWRA 3P7YA 1RD5A 5GNZA 3W2NA 1H7RA 2G96A 4GQBA 2FFCA 3R1ZA 2QUTA 2QCCA 1UPMB 4PRWA 2YIHA 1NELA 4GQRA 4XAGA 3CUIA 4ACZA 5E5CA 4Q4SA 3GIYA 2Z6IA 3NQBA 5I06A 4UWMA 3ONBA 1P0KA 3LDVA 3I6TA 3NQ7A 1DWIM 4KFPA 3W74A 4AC7C 4LW7A 4V2XA 4L5ZA 3EPMA 4UTMA 3F2CA 2ZZ5A 4IQLA 4HA0A 3BCFA 2OCZA 3LUTA 4C6OA 4A8NA 3PY2A 1W3NA 4X0NA 5AVNA 3CHEA 2HZGA 2YXOA 3B9AA 3ERPA 4JDYA 1UR8A 3D0CA 3LCHA 4AMCA 2Q01A 4YTQA 1YX1A 3I7SA 4Q32A 3LG3A 5EMKA 2ACQA 4G1NA 1SSGA 2XN0A 2PZ0A 2ZE0A 3MO4A 4HQVA 3W1MA 4N42A 3GHSA 3M0KA 4WK9A 1K7XA 1XSIA 3IJ9A 3GBDA 2H8XA 2PD5A 3B97A 3P84A 3TOPA 1BRLA 1E70M 3AHXA 2YL8A 3CL7A 1W1B1 1L6WA 1XH1A 4ERAA 2AL2B 4ECLA 1Y5WA 4H3DA 3SCOA 5AYZA 2QXWA 3TC3A 5FJPA 3VKCA 1H11A 1X1ZA 1Y0EA 4DWSC 3W1UA 4MB3A 2RH9A 4PEEA 2X1SA 2ZZ6A 2X0SA 1I75A 3FX4A 3LM7A 1WDSA 2GJNA 1IT7A 4TUFA 1R47A 3PAOA 2JIEA 5ABGA 5MKGA 4QXIA 4A22A 2HXTA 4GCXA 4S23A 3TU9A 3UCDA 1IWAA 2C0HA 4O1CA 4GY7A 4JBRA 2F6UA 2VX5A 2WCAA 4LQ1A 1FXQA 3GFYA 3L4YA 4RW5A 3NQEA 3LTYA 2V3DA 1LM1A 3DFSA 3STEA 2ZQ0A 1HJXA 1ISVA 3NG3A 4GACA 3LHUA 3C2VA 2HVOA 4G2DA 3KE0A 2PLJA 3NZRA 3K2GA 2OWCA 1UROA 3ANVA 1U5JA 3DG7A 3WQ5A 4ICNA 4ZFCA 3QY8A 4PUJA 4NZ1A 1RHCA 4W84A 3K1GA 2BB0A 5K9CA 3UY7A 3UPBA 2UY2A 3W2KA 3BQ6A 2HWGA 2J88A 4UTLA 5E93A 2WMKA 1EQCA 1ME8A 4O8RA 3VVGA 2CZ5A 4NNCA 1TV3A 3DHFA 3FXGA 3K8MA 2VT0A 3ZVIA 5GNYA 3L2LA 3OLIA 4JIRA 1RCQA 6CGTA 2BLEA 5C6MA 1ME7A 5EY5A 3TQKA 3O15A 1KM5A 2O0TA 3B0UX 4W7UA 2VTFA 3F7JA 3W6LA 1J5TA 2GSHA 5ABHA 5CG7A 3T44A 4QP0A 4LYPA 2VVSA 5HA7A 3PFRA 3BMVA 3USZA 2W3ZA 1W17A 3OLGA 2X2YA 1TV2A 2QLYA 4W7VA 5DF0A 1L6FA 1BYAA 3KDNA 5DN1A 3GYCA 1KXTA 1B57A 4ORMA 1TWZA 2C7FA 1PX8A 3DEQA 3S2NA 3W22A 3W26A 3KOZA 2X1TA 2A7PA 3PZTA 2PDKA 3HQPA 4Q33A 5DRIA 1HKIA 2Y70A 1TB3A 4IXHA 1ZCCA 1Q6DA 1TPEA 5BXSA 3G8RA 3TCSA 4QLJA 2Q3OA 1UCWA 4ORIA 5FEPA 2BGSA 2NV1A 1W1PA 1QPKA 3H54A 1GEHA 2XSBA 1YDVA 5E9XA 2GUUA 5IDZA 3VIJA 4AEOA 1XIJA 4KWVA 4NXSA 1EIBA 1J6OA 2FPYA 4XZIA 3BANA 3C6CA 1OD8A 1C29A 2GVEA 2GQ8A 3G8EA 4F40A 4MPQA 3AXHA 1NF0A 1XINA 2JEQA 4B5SA 3T0AA 2HBXA 4LNYA 1UB3A 4D8LA 3NQDA 1FWEC 1IT0A 3S5NA 1NVMA 2ZOXA 3C2YA 3DC0A 2VOTA 1UOKA 4NZ5A 3VXGA 2QCFA 3MUIA 3CQJA 4EVZA 1T40A 2C91A 3QKZA 1SW3A 2OODA 4HSHA 3O2LA 2PRLA 2V2CA 1CXLA 1VRDA 1FFQA 4NAFA 5A2AA 3ZFHA 1PSCA 1OJXA 2ZZ1A 4X63A 4YXGA 3PZIA 5EB8A 2L5HA 1WO2A 5DY3A 2GWGA 3H2CA 4CN6A 3KCLA 3N9SA 1HVQA 4OBRA 3AYTA 4C6NA 2W92A 5ABFB 4S3KA 2DH3A 3GXTA 2EG8A 4G6CA 3ABSA 1S1RA 2XH4A 1R38A 2IXUA 4YIWA 1UPPA 5BMWA 2AMXA 1LF1A 1WBHA 4EAMA 5XIAA 3ANUA 4AF0A 1KXHA 3SCPA 4AISA 2A6NA 4BA0A 2TSYA 1E0VA 1Z9AA 3IIOA 5TAOA 4NZJA 1SPQA 4DUWA 1JAKA 3HQOA 2PGRA 5CLTA 3R89A 1N82A 3EOEA 2WAGA 1HF6A 3G1RA 1YDNA 4JHZA 4UQDA 1F61A 4S3CA 4UR9A 2QZRA 3PSVA 3REQB 3ITTA 3B0PA 1UH2A 1AH0A 1QK0A 4IIDA 3BAIA 3HU7A 4Y9MA 3NO5A 3OIXA 4UTWA 3PM6A 3MSYA 2HNHA 1UP2A 3VM7A 1W91A 2QGHA 3RNDA 4PBFA 1EC8A 3UCCA 3PJXA 1REQB 3CO8A 4PB3A 1DHPA 1LBFA 1EEXA 5I3FA 3TW9A 4AW7A 5CPLA 2J8TA 3IRSA 3W85A 1BQGA 4GMEA 3G1YA 1ZJIA 3RGTA 3VD5A 1WDDA 4E3TA 4GUFA 1R3YA 1JUBA 5HDRA 2I5QA 1QASA 1ZENA 5HQLA 9XIMA 3SR7A 5A6AA 3P60A 4UR8A 1R46A 4ZQPA 2WC3A 3CZEA 3TC6A 4UTKA 1TTIA 3LPOA 4WCJA 3NYZA 3ABQA 1US3A 1V6XA 4MB1A 3A9BA 3WLKX 2HPIA 1KM6A 1TE1A 3T78A 1C7SA 4AIOA 3LBMA 2XISA 5EMLA 4A8RA 1JQXA 1R30A 4OOZA 5C5YA 1C9WA 3NJ3A 4G1KA 4DJEA 3G6MA 1HN1A 2QCMA 3UU0A 4L9YA 3AISA 1KLYA 3VIOA 4Q7BA 1GVEA 1RALA 4ZB5A 3T8QA 3P81A 3GTHA 4MB5A 1FKWA 1FXPA 2E1WA 5D8ZA 4DIAA 3GG1A 4LRTA 1RJRA 4ZTYA 4L4MA 3PK7A 3FOKA 1L2UA 4HT3A 2NW0A 5C9RA 4H6KA 1LZOA 3C8NA 4GUJA 3EB4A 1PL9A 2CLMA 2YCLA 2E40A 3V36A 3TW6A 2HISA 1JGIA 1FWSA 2WVVB 1W3LA 1XYFA 4XSLA 4J3UA 1UWUA 5AECA 3GFXA 3E5PA 4K68A 3E0LA 3T0TA 3NCOA 3QV9A 3VNDA 2PDYA 3W07A 1WDWA 5EKYA 3IARA 1P4CA 1I6NA 4RE4A 1GNXA 2J7EA 3G0SA 2A3HA 3ITXA 4ASTA 2J77A 3LXCA 4MY9A 3MVIA 1I2QA 1UKQA 4JN7A 1ZAJA 3PJWA 2NQLA 4GQQA 5D03A 3E0VA 4JL2A 2FQIA 1M7OA 3VIGA 5FESA 4AZ6A 2DT2A 1CGUA 2CZVA 2IUZA 4IICA 4QQ3A 2Y5JA 5I3JA 4H9XA 1XIDA 3U4FA 2QAPA 2V68A 4MKSA 4JIEA 3I4EA 5E09A 4MJ2A 3CAVA 3A47A 1R3SA 2P8CA 1KNWA 3SQMA 4L9ZA 4E4FA 3PF3A 4QS6A 1CLVA 3GU1A 1M53A 4CQCA 4YCPA 2VEFA 1UWIA 2O7QA 3WQFA 1A80A 4GBDA 3BW4A 2CWXA 5FA5A 4GRSA 1OGGA 1VS1A 3EX6A 4K38A 3VNJA 4LALA 3W83A 2VENA 1EP2A 4R3UA 3IIVA 1EZWA 1PZ3A 3T0DA 1X8FA 1JZ6A 1A5CA 3UP8A 1R85A 4CQBA 3DKJA 1QAPA 3UEQA 5FIPA 4BQ3A 2Y88A 4JR5A 2Z2BA 2YJQA 1M7JA 3MMTA 1US0A 2GGGA 2R82A 2WCSA 2QCNA 4L4PA 2OT1A 3EKLA 2FDMA 4R7OA 1SSDA 1SJCA 5CPOA 1EDGA 1GVRA 4ZQOA 1XKJA 2NVAA 4UMCA 2A3LA 1DKWA 5FJOA 1MEIA 4FR6A 1CXIA 1ZBKA 4XBJA 2VX4A 3ARQA 1CLXA 1A3XA 1HO4A 3S46A 3A64A 4LUSA 3CYJA 1X39A 2RJGA 2DIJA 2VNCA 4TQTA 4B91A 5TF0A 5E70A 3VOIA 5FCZA 1PZ2A 2VMFA 3KOYA 3VTRA 3ZR6A 1OG6A 4LAOA 4UFLA 2ABBA 1EP3A 3L5LA 3KZPA 3WF3A 3OHMB 3D5HA 1DIEA 3EZ4A 1QNOA 3F5LA 4LAMA 4MPKA 2PBGA 2FVLA 1Q5MA 5HBFA 5T26A 5HQEA 1V3MA 4G7EA 3TYAA 2OZ0A 1DJNA 3CWHA 3KOFA 5MF5A 3B9OA 3E02A 3UG5A 1CGYA 4MWAE 4XZWA 4PL1A 3KVMA 3SUSA 4A3UA 1W5NA 2W5FA 3GC4A 5DT7A 3UXDA 3R5EA 5D9PA 4DNHA 9CGTA 5AC4A 5L9FA 1NEYA 2IPFA 1Q6CA 3UD6A 2QJIA 3P0XA 4FNUA 3LPPA 1UKPA 4ADSA 1W8SA 1ADOA 3IUIA 2PF8A 3I4KA 4H7CA 4LJ3A 4YTUA 2WMJA 3ZYZA 3VDHA 4N02A 2C3ZA 2P50A 1E72M 2WZTA 4X2PA 1OIMA 3SUTA 3NTYA 3G5EA 3ZQ9A 1E6ZA 3MP4A 5HR6A 3ORWA 4R88A 1G69A 2XN1A 5JBFA 3GG8A 3ARPA 3BLDA 3U5YA 4F0MA 2ZX7A 3PN8A 4L80A 4W4QA 1S38A 5LSMA 3GXNA 4NNAA 1YXDA 2VCBA 1Q45A 3AJ7A 4AFYA 5FF0A 6REQB 4KETA 3GZAA 3WLLA 4GX9A 3S42A 2VZTA 3EMZA 4BWLC 1P6BA 4X22A 3SCWA 1R9ZA 4S3EA 2WKJA 1KR1A 3DYPA 3DENA 1S5MA 2Q8XA 1DOSA 4DJFC 4C6IA 3L0NA 1SFSA 5G2WA 4UNLA 2DZWA 2E0PA 1NWRA 2PEVA 2EPOA 4C5YA 3GXDA 3L4ZA 4YS1A 1U22A 3MMDA 3FA3A 3MCOA 1W5PA 3BLFA 5G2HA 4PB4A 3ALGA 2PDQA 4HCDA 3MJMA 1Y5XA 1V6YA 5C7VA 4FNQA 3O63A 4J1OA 1E55A 1Q8AA 3I6RA 1ECEA 3MWCA 4UB9A 1AFSA 5FACA 4IFRA 1HG3A 1WKDA 4XZNX 1VRXA 5AC8A 4HVXA 1IF2A 3QR3A 3GTFA 4AX6A 3H12A 3RUBL 1GOWA 2ZUNA 1TRIA 2X1IA 4RPPA 4DZIA 2CZEA 2WMGA 4DBDA 5HWNA 2VURA 5IHSA 1E56A 3CTTA 3PBWA 4AIEA 4LC6A 5AC6A 1BWVA 2AKMA 3NL5A 5C9XA 2PDUA 2VWSA 5EGRA 3EDEA 3NXLA 3H21A 4CVWA 3OGRA 3UJRA 1PS9A 1A5MC 2H6RA 3QGKC 4HOZA 4RNIA 3WF4A 3PJTA 2WHKA 3BWWA 3LXBA 4N9CA 4IFKA 4DZ5A 2R94A 3GZ3A 1LOQA 1WV2A 3TDFA 1UC4A 3QYQA 3K5XA 3V0UA 1GJUA 3EYPA 3N2TA 1E6PA 3HGOA 3C4UA 4F8XA 1ZLPA 2GQ3A 3UR7A 2G5WA 5A6TC 2WCGA 3F4NA 2G8ZA 3IANA 3O6YX 1VPXA 3AS3A 2Z1SA 3E2SA 1OADA 3B8SA 1P0EA 3N25A 3VABA 2ZWZA 3ZZ1A 4K1GA 2ICSA 1IXNA 5E0CA 1R8LA 2D2OA 5F7UA 3MMUA 3GSMA 2PLKA 2WC4A 4US6A 3F4DA 2V2DA 3GNXA 2J4GA 4H01A 3DU0A 3QMRA 3HB9A 4NASA 1VFTA 1QWKA 2ZC8A 3MHFA 1UJQA 3G0XA 2QIIA 2IPWA 3UZXA 3ZVHA 1XDLA 2CBIA 3GBEA 3VOHA 1V51A 2BX7A 4PTNA 3V35A 1VAHA 2X09A 3NGFA 5I3KA 2QPUA 4E2BA 4GXWA 4QTGA 3MWAA 3OG2A 3TXVA 4XD4A 3QRHA 3CQKA 1REQA 3PZNA 4URIA 4TX6A 4KEMA 4X3ZA 1UASA 4CNPA 1XIIA 1BHGA 1FDJA 2JBMA 3N6HA 3W01A 1JCXA 1RLCL 1EUNA 3B8TA 1Z7AA 2FZBA 4AB4A 1NJJA 1KO0A 3C0JA 4OJYA 1V3IA 2A3CA 3MI2A 4WEVX 4ATLA 1NSJA 2DT0A 3BL3A 1KRBC 1VZWA 2WSKA 2X42A 1G6CA 4FLQA 4P8WA 2DJXA 6PTDA 3D3FA 1GGOA 3MU7A 4S3AA 3ZT6A 4D6CA 3GHTA 4DJFA 1P6WA 4YHGA 3KRBA 2QCHA 4JQ1A 4TIMA 2GUYA 1OY0A 2Y6ZA 1JDEA 1XIMA 2JQXA 2F2KA 4IOTA 1UMLA 2YCKX 2VX7A 1F76A 3W7PA 4P8XA 2P76A 2VR5A 1RJPA 3VNMA 4I5UA 1IR2A 2OTDA 2XWEA 4NJHA 4Q6XA 3PUGA 3LD5A 2PU0A 1IYXA 3KHDA 5AZ0A 3WUFA 4HZMA 3C86A 3HG5A 2B7PA 2VXNA 5M1TA 3F1QA 3W1PA 3WDJA 3VILA 1PCKA 3WLSA 1J96A 1SW7A 1DHKA 3NSXA 1FH7A 3H2AA 1QK2A 1ZSXA 5B7YA 1LJYA 2V38A 3DG3A 1XG3A 5C8BB 1HTIA 1LQ0A 4FXJA 1HIZA 1EWEA 5GPRA 3W7LA 1H1ZA 1XFBA 2Z7GA 5F2LA 4XD3A 1BLIA 4C5ZA 3HBLA 5CC7A 3WG6A 4PMVA 2ZADA 3VX0A 3AU6A 2J8GA 1UWQA 1F7BA 3LXAA 2VX6A 2XH0A 2CKSA 2WSQA 4LYRA 2GGEA 4U5IA 3UWZA 3UWQA 4Q8NA 1S3TC 3H70A 3TTQA 4RZ5A 1XFCA 1Z32X 3SY5A 1I8JA 2R1NA 4NRRA 1JF6A 3CZLA 4WF7A 3PVFA 3W1LA 3T42A 1QRQA 3AFBA 4C6MA 4I5XA 3W81A 2Y61A 3ARWA 2WZMA 5H1WA 1LBMA 3BDKA 1QT1A 2QPXA 4M81A 7TAAA 2YCEA 4DBEA 4FLOA 4K1WA 4UXDA 4AIUA 1XDJA 3QXBA 1EUAA 3IK4A 4J3ZA 1XIEA 3FKRA 4GC4A 3LHZA 4M8UA 1GONA 4L56A 2QMKA 4Q4MA 3ZLGA 4HPXA 3P2VA 3AALA 2XN2A 1A5OC 4PBEA 4BCEA 3HZ3A 2G3IA 2Z25A 3KLLA 4LANA 5AB3A 3DC8A 1V3HA 4H6QA 1B4KA 2ACRA 3LB0A 4E5TA 1UWTA 2CLIA 2VZOA 4FNSA 3PWIA 1W1ZA 4F2TA 4PE8A 1D8CA 4YTRA 4JNYA 4UFKA 3PP7A 4GC3A 4W8BA 2CHRA 2I57A 3PZQA 4N6EA 4MYAA 1XPYA 1Q6FA 5BROA 5DMYA 2O4MA 1E4IA 4RDVA 4HNTA 3ZR5A 4L1WA 2R24A 2NVCA 1H5YA 1XGEA 3HGJA 5AHLA 1X1OA 5LXXA 1KA9F 2GFTA 5AYBA 3CAQA 4W5UA 5CBIA 1UR3M 1GZGA 1V6WA 1O1HA 1VENA 3AXKA 4JKLA 4H00A 4PMJA 1UZHA 4GUHA 1AW1A 3WLIA 2QKFA 2E8YA 3QV8A 3N4AA 5FJIA 3CL8A 1QOPA 4NX5A 4M56A 1LBLA 4R85A 4BI7A 2NT1A 4W86A 1XLCA 4PUUA 1CPUA 1S5TA 4IMCA 1LG1A 1JFXA 4H8NA 2C19A 3UJFA 2V5CA 5HXMA 3CZGA 4HHMA 2FDSA 1Q7QA 5CPSA 3BAJA 4AEEA 1XIGA 5XINA 2X1RA 3MKKA 1JUKA 1WUFA 5A69A 3PWGA 3H2MA 1QTWA 4MWAC 1DV7A 3NZQA 2XZ9A 2ZA1A 5F2GA 1N8WA 3R6IA 2PDJA 2VFHA 3NWRA 4Z2GA 1W32A 1XLLA 4O0KA 5LKYA 5IFPA 3L65A 2VELA 3MO7A 3RLVA 4DF2A 4Z1BA 5JVLA 3NQMA 1DQUA 3F2BA 1OZQA 4RZBA 4DYEA 1A0DA 4FNPA 3WNKA 3LHWA 1R5YA 2WW5A 1M9HA 1WOAA 1M03A 1TA3B 2O92A 1F4HA 3NYDA 3PZ9A 1BXCA 3G22A 3COTA 1V02A 1TJ1A 4A3YA 1VGAA 1BXNA 8RUCA 4HSNA 5I24A 3MA8A 5A2CA 3BCJA 3R11A 2ZE3A 4U28A 2D0HA 2DH2A 2YZ5A 3E0WA 2XU2A 5AYYA 3N2MA 4GJ1A 3CV2A 3Q58A 4AY8A 1H7WA 1VEOA 3UWUA 1J0JA 4IIEA 4UQCA 1I2RA 1O68A 1S2WA 2WPGA 2PP1A 1I4NA 3W4RA 5BMXA 3DDMA 3N15A 3QLLA 5I02A 3DGRA 3N11A 5JBEA 2NXIA 4C7DA 3GC5A 4ENLA 1E1FA 5EMUA 4FOUA 5AYIA 1EKOA 1JIBA 2HVMA 1CW2A 4XK2A 1C90A 1US2A 1OC5A 4MKVA 5M17A 3E2VA 1UWSA 4W87A 2OYKA 3OZOA 1F07A 1MO0A 4XAZA 3FYOA 1D2KA 4KWWA 4LC8A 4E3VA 4MLJA 3TROA 4GZEA 2FTYA 2PP3A 4ZGYA 3NVDA 1EFZA 4HZ8A 4UCGA 4W8AA 5HR7A 4QJ4B 3REQA 3K4WA 5ECUA 3G1HA 4KCVA 3PUEA 2J9ZA 3NDYA 1TPVA 4K8HA 3N9KA 3W7JA 3PJUA 4E4UA 3W37A 4OUIA 4Y7EA 2ZWYA 3TTOA 3GVGA 2BP1A 5HNTA 5AYXA 4HNOA 3H2EA 4Q8TA 4HU0A 3B9DA 3G3MA 2HV5A 4HZ7A 4DO7A 1GPFA 3BMXA 4JTHA 3HN3A 5HQMA 4GZIA 1K8XA 2XHYA 3GU2A 1TPWA 5U7SA 1O7AA 4MLRA 2Y85A 3N14A 3NL2A 2YBTA 4FZIA 2ABAA 5KITA 1RP8A 3FYPA 1C93A 4A8LA 5A8QA 4F0LA 4BI6A 4DJFD 1JCMP 1ICPA 4DWSA 5I3DA 2CXEA 3HF3A 4P61A 1F6PA 4FMVA 1IZJA 5D2VA 4DXXA 4WXYA 2GGHA 3MI6A 3HMJG 1OX4A 2JALA 3U5UA 5AKQA 3RILA 3DHUA 1O95A 4JFTA 2PWUA 4A2RA 2WXDM 3EKGA 4GI6A 1V0KA 1A0EA 1JZ7A 1XYCA 3F5KA 2PB1A 3WUBA 3GG0A 2I5GA 4QFUA 3QGAC 4RK8A 2J62A 3RLUA 2FGZA 1G94A 2CC0A 1K9FA 4CQ8A 1JPIA 1A4LA 4MY8A 4XD5A 4HCHA 4G5DA 3RU8X 3HURA 1HP5A 5HJXA 2VJXA 3HA1A 2ZRWA 5LXEA 2GQAA 1HX0A 1A4MA 1J5SA 7XIMA 3BAYA 4B9ZA 1OFPA 1YPXA 1X6NA 3K4DA 3TQ0A 1Z42A 3N34A 2H90A 2WNQA 3G24A 4HD5A 4CLMA 3KOXA 4CD6A 5LNUA 2UY4A 3BSHA 3CHCA 3WQVA 1PBGA 5EMMA 4PMZA 2YCJA 4LYQA 4NSBA 4AZGA 3SJNA 1J0KA 1UWAA 4IPIA 2YYTA 5CSRA 3B4UA 1DIKA 1K1DA 1TTPA 3OEXA 1FWCC 5JUVA 1IEQA 5HMDA 2OMAA 2O9OA 1S1PA 4DM2A 1QO2A 5BOEA 3NL3A 5ABFA 3M64A 3WJZA 1KBBA 1I2OA 3T81A 1Q65A 5AHIA 3T0CA 1V03A 1TPC1 1SZNA 1ENUA 2CLOA 1PO9A 3BG9A 3AUOA 2NX9A 3WMCA 1AJ0A 4HTYA 2E77A 5CGQA 3WQCA 2EKGA 1M3UA 4AHQA 3T05A 1GOMA 4Z1DA 9RUBA 3TOYA 3C3NA 3DECA 2E6AA 3ENLA 3UWYA 1R2TA 2H8ZA 1H1NA 1SVDA 4FS9A 5HNUA 1NDWA 3UWEA 2XGIA 1QWGA 2PAJA 1HJWA 3KL3A 3FLUA 1VFFA 2B0MA 3PSWA 3PZOA 1GZJA 2V2HA 5DMMA 3ZXWA 1EJ7L 1ZALA 1QUMA 2OZ3A 4ML4A 1ZJHA 1B0IA 3D3AA 2WQPA 4INFA 3I7QA 1SO4A 4ICCX 1Q6QA 4GO9A 4B5NA 4HA3A 3VCNA 1LRQA 3ZWTA 1W1A1 3EXTA 3NXFA 2CW6A 1M7PA 3QOKA 3Q4DA 4KWSA 2ANUA 2NV2A 5JH2A 1EF3A 1ADSA 2QUVA 5DMNA 1BFNA 4IIHA 2AGTA 3GXIA 3ZMRA 1GZ1A 2CWNA 2WLYA 5J5RA 1WP6A 2BNJA 4UMAA 1VBHA 3RF9A 4I8YA 1OQFA 1PTAA 1GUVA 4NL1A 2WO5A 3VOJA 2BG5A 1GVFA 1ZAHA 2VKZG 2E1DA 4GOAA 1XSKA 3KFTA 3IV8A 3P82A 4U3CA 3WK3A 3MYPA 2ISDA 2QR6A 3PBUA 1XYMA 3W7MA 4CKQA 2GQ9A 3EWZA 1Z44A 1WXJA 5LNSA 3ITCA 2ZRUA 2OYLA 1V6TA 1V7AA 1FHUA 4XD6A 4QDMA 2CETA 1WCGA 1KGUA 1W56A 1KWKA 5FSEC 1PDZA 3I10A 2J7HA 2X0HA 4I9MA 1JD7A 2GK1A 3OODA 4Y2WA 3UXLA 3HV9A 4GCAA 1DXFA 3THDA 1I1XA 2F38A 4B5XA 3TLQA 3NPUA 3PG9A 3O06A 4FXRA 1VYRA 3AMCA 1TIMA 4TTUA 1SR0A 4GE8A 4O1DA 4R7WA 3NR0A 1BYCA 4GVIA 3NZPA 1GVQA 3ZWSA 3R8GA 3DFQA 3NQFA 2YCIX 1Y65A 3DG6A 2ATSA 3NDZA 5DLCA 1OX5A 3G0UA 3R4IA 5CLWA 2ZYFA 1F6KA 3W0KA 1H09A 3R94A 3LENA 1EOMA 4RE0A 2RFGA 3KTSA 4LV4A 4AAJA 1T6MA 3TEVA 5EPDA 2I7GA 2QMJA 3D47A 4FO4A 3N73A 1HL9A 3LRMA 3I3BA 3ZO9A 1GPWA 1XLAA 3TWAA 3WH9A 2RAGA 4UNIA 3HMCA 1ONRA 3DOPA 3SEPA 3TJLA 4HU8A 4W7WA 1FTXA 2VDIA 4JEQA 2PDIA 1E4LA 3DZ1A 3VZXA 2QS8A 1FA2A 4CQAA 5D2YA 2GVLA 5D05A 1R86A 3C5QA 4LAZA 1IWBA 1B4EA 4MZYA 2WMIA 1JZ5A 2NQ9A 2F8QA 2VC6A 5LIYX 4NU7A 1JYVA 1QNQA 1A5NC 1C3FA 4GZJA 1JPMA 3WJXA 3GDMA 3SGGA 1CGTA 1PZ0A 3CV7A 2E5CA 5DRCA 2X40A 3ITGA 4UTTC 4QDPA 2EPLX 1SQ7A 1YE6A 1PIIA 3QYSA 3UW6A 1RZMA 5D37A 4S3BA 3GYEA 5ENLA 2XGZA 3O16A 4RDZA 4IGMA 4LVGA 5PTDA 4DF1A 1IXQA 3MBFA 1CXFA 3FJLA 4C6QA 3T2OA 4LU0A 3TW7A 4C60A 3QY7A 1LQAA 3R0UA 2J75A 5G5IA 3CT7A 3KWXA 3DYOA 3UJEA 4RDWA 3W1NA 3KVLA 1UH3A 4X60A 2DSUA 1K4GA 4LS2A 4QJ3B 3TSBA 2DDXA 3S5ZA 1HKWA 2DSWA 5A3HA 2IKHA 4F9JA 3TJIA 4D6GA 2I1OA 1A50A 2UY3A 1IE7C 1OCBA 4QAIA 2BTMA 3AI0A 1KFCA 3FAWA 4F79A 1GVYA 1SJBA 5K9XA 4R5EA 2XWDA 3N4EA 2Y63A 1FWGC 1D7KA 3NQ6A 2IKIA 1TX0A 3B06A 3A9IA 3FV9A 2I5IA 2QDEA 3TLLA 4C6FA 3GTNA 4BZYA 2DSVA 5C9UA 4IX0A 1TREA 3T4CA 4XKYA 4TXEA 3RCMA 4H4IA 2Y62A 3BG3A 2OELA 2Z0IA 2POTA 1FCUA 2C18A 3B4YA 3VNLA 4O8AA 3UG3A 3XIMA 3SUVA 3LN3A 1OZMA 1RCOB 2HQAA 1UR4A 3A12A 4CQ9A 4QDWA 1DQWA 1GQJA 1NOFA 4K6AA 2YB1A 3AIVA 3WLNA 3LBCA 3ES7A 2ZA3A 4FOKA 2FFIA 2CHNA 3TMQA 1Q6GA 2XIJA 1EO7A 4I6KA 1F2JA 4FIQA 3URNA 4OE7A 2WWCA 1M65A 1WXYA 1KFBA 2ZZ7A 4JN6A 2Y8VA 1EB3A 2YA0A 5GJMA 1H0IA 3H22A 4W88A 1E6XM 3S4TA 1KXQA 2YKKA 2CYGA 3V1PA 5H8UA 4JTUA 3GU9A 5GVJA 1V0MA 2YOCA 4HZ6A 3GIPA 1XICA 1MVYA 4TVUA 5AHNA 4CEUC 1W5MA 5LIXX 4DAFA 3U6WA 4EKJA 5I03A 4CD4A 3WN6A 3TSMA 2WNWA 3OA3A 3UETA 4GK8A 3V5FA 1HJVA 4S3FA 1UD6A 2ASHA 1YKWA 1W6TA 4HNCA 2PCQA 1EYWA 1VJSA 3RM4A 2HE8A 3GXPA 2CBVA 3S9IA 1YQ2A 4I3GA 1LWIA 1K02A 3AS1A 4CNTA 3ISIX 3L68A 4LYKA 3L5AA 1JCJA 4B16A 3C2OA 3EDJA 4W89A 3EMCA 3GS6A 4LVBA 2ATMA 1S2TA 3LSBA 3QW4B 3WBXA 4FB7A 4GKLA 2WJFA 4WY0F 4P2VA 3SCQA 3CUHA 4M6QA 4XAPA 3SBFA 4EPEC 4ZSUA 4D6FA 4U5KA 1A5KC 1A5AA 3L4XA 4C1NB 3OLDA 3DHPA 1G1YA 4N4QA 1ZP3A 4E2VA 1UUQA 3CS2A 1QATA 5GQBA 4F48A 3OOQA 5JH1A 4KWUA 4GBUA 2G37A 3M7SA 4B3LA 4S3DA 3T0BA 4KT2A 4QE4A 4DBWA 1UA3A 2QHAA 1X7FA 3V7PA 2CHOA 4KERA 4Q7NA 2JGYA 1EC9A 1LT8A 5JMUA 2DSZA 4L6OA 4KIRA 4N9EA 3WH8A 4LY8A 4ACZB 3ARXA 1Q6EA 2WYSA 2G3NA 3PTMA 2QUMA 3QQ1A 4GG9A 3TYCA 3BAXA 1KCZA 4NIRA 3RPDA 1C8QA 2QJMA 4UZSA 1E40A 3PTKA 3ID7A 1H49A 4EXQA 3WNNA 4CVUA 5A8GA 1G4EA 5TBOA 3WQ4A 2FTPA 2YDRA 4B4FA 4WRHA 4TVDA 3MVTA 5F4XA 1GEQA 1XV8A 4AX7A 4TU1A 1FWJC 3H7RA 1FWHC 1E4NA 2R14A 3DI1A 1DJIA 1EX5A 1OIFA 1TQJA 3TK7A 5DBTA 2G97A 1YDYA 4CNNA 3S5SA 1YTEA 4IPPA 4ZO8A 3TYBA 4MZ1A 4PUWA 2FYMA 4I5RA 3SAZA 5FKYA 3FCPA 1U30A 3DN5A 4Q4OA 4U31A 4QSFA 3QPZA 1DE6A 1ESWA 2A21A 3FDKA 3QGVA 1P0NA 3NQAA 1R7AA 2O9RA 3UA3A 1TTQA 1MDRA 4MFEA 2ZZ2A 4LNCA 1F8MA 2VCCA 2BASA 2WZEA 4ZBCA 2DUXA 1MFUA 4ZL1A 4AWUA 4QE1A 1J10A 4KCWA 4AQLA 5HMEA 3NNTA 3G1FA 1XYZA 2JEPA 4JTTA 4FF5A 4JX5A 2Z29A 4B2DA 1TUXA 3M43A 3PBVA 4X0VA 4GXMA 3AAMA 4P7QA 4B9YA 3U3HA 3STCA 3G2GA 1KFJA 1X6LA 3BLKA 2E5BA 1FCQA 4O1EA 2QVHA 3M6YA 4DZAA 3S2JA 3CUGA 1FCBA 5CJNA 3FK4A 3UF9A 4PUKA 4MFDA 2EQDA 4O53A 4Z2LA 4GFSA 3CUZA 2CEQA 3W87A 1LG2A 3UBPC 5FL1A 3P93A 5G2IA 4LWWA 1GK8A 4PYSA 3LLXA 1WZAA 1J18A 2UWFA 4XX6A 2DZVA 2VFEA 4XB3A 5KEZA 5M2FX 3UXAA 1AK5A 2C16A 1DXIA 3BZGA 3TP4A 1MNSA 1FWAC 2Z1BA 4N0RA 1E73M 5D8WA 4WKFA 2V9DA 1OYBA 2Y8UA 2IS7A 3K8LA 3STGA 2OX1A 3M0HA 4C6KA 1WKFA 1XPGA 4TTGA 1KRMA 1PDYA 5AN7A 3F5JA 4CQDA 2Y5EA 3QR1A 3VMPA 1POJA 3WZ0E 5IHRA 3KBWA 1Q6OA 3LLFA 1DE5A 4XTDA 3GVQA 4M1RA 4A3RA 4XZLX 2IQTA 1S2CA 3SRHA 4XG1A 2VDGA 3LCIA 3W27A 1IWPA 3R79A 4S2CA 2D3LA 1YBQA 3QJAA 4WDXA 4CNUA 1DJYA 2QCGA 7ENLA 2PTZA 1I0BA 3VO0A 3NVTA 3FSUA 3A5FA 3U57A 1E6SM 4PMDA 3W38A 5A6JA 3G3DA 4EX4A 2CLHA 4M82A 4A21A 3BQ5A 3SIMA 1SJAA 3OZPA 2NV9A 1EJRC 2JKEA 4OECA 3NM1A 4UTWC 4JCMA 1G4SA 2GGIA 2OLAA 3CGTA 1A5LC 4JYFA 4G7FA 3C2FA 5EA9A 5TIMA 3VGHA 2BWGA 1Q6RA 5CZKA 4UOQA 2QAFA 1F3WA 4KS0A 4KFNA 4ZZ9A 3L5MA 3RRXA 2E09A 2JIWA 5C55A 1DWJM 4IPLA 3UZ5A 2B81A 1FWRA 2BGQA 4PA8A 2QJNA 3TN3A 1YE4A 1QO5A 4RL3A 3QTGA 1XKYA 4JNZA 1R3TA 1V6UA 3STFA 3OTRA 5F2MA 1S39A 5RUBA 2WLZA 3BO9A 1KQYA 1E3XA 2NT0A 5LIWX 5TD4A 3TX9A 1DEDA 2WSRA 2R1PA 3CB8A 4YJ5A 3NM3A 4PUEA 1UR2A 1TO3A 2R91A 4P5UA 1VEPA 4LAKA 1F8IA 3LPGA 5D2TA 3NPVA 1CTNA 2TMDA 1WAUA 3TTYA 4PFHA 2V3EA 5CSYA 3RG6A 1VFUA 2BY0A 4AXKA 5HWJA 2PDXA 1FP9A 3VOGA 1NQKA 2ZZ3A 1IEXA 4OFCA 4JTRA 3WBEA 1H7NA 3UPMA 4J27A 4QGCA 5I7GA 2PTWA 3SGUA 3LI1A 4C1LA 3MZNA 3HFYA 1VJIA 3BW2A 2WC7A 3CUFA 5FL0A 3WLPA 3RIKA 3RAOA 1CGXA 1W9VA 2RKXA 1WOBA 3QHOA 2XUCA 4M24A 4E6MA 2XVPA 3LS9A 3OVPA 2FZ9A 4AVNA 2BFGA 3AHVA 4UFMA 1ZJAA 3VU2A 1PX3A 1Z3NA 3GW3A 5BOOA 2CFFA 1XD0A 3IS4A 4MM1A 2P1FA 8A3HA 3RPTA 4WJXA 1J0HA 4ZO6A 5HJLA 4ZFMA 1GKPA 4BEQA 1KD0A 1EBHA 1XBZA 3E0FA 3WH6A 4I9TA 4Z0JA 3WD0A 1PKNA 4WD0A 4RXFA 2QDHA 3WBYA 5HATA 2JKPA 3R10A 3T8LA 4RZ4A 3N3TA 1LUCA 2EHHA 5B7ZA 1TZ9A 3WD2A 3KRUA 1EZ2A 1GOQA 3QV6A 1LLZA 1V3JA 4WZHA 5BU9A 4ZMGA 4ZO9A 4Y9NA 4I7VA 1Q7MA 2WSPA 1XGZA 1SO6A 4LXFA 4PTWA 1PIFA 1LRTA 1VFOA 2PFHA 4NYYA 2WZHA 2YL9A 4J28A 1QNSA 4AEFA 1I9CB 4AD4A 3H8AA 5AHMA 2VUNA 3PBYA 4NAEA 3BLOA 4GWEA 1JFHA 3KS5A 4W93A 3ZSSA 4PTDA 1CXKA 1XLFA 2GJXA 4GFIA 4A35A 3VIKA 2PRHA 1KCKA 3SW6A 4E0CA 1C8YA 2X1UA 1B9BA 2BXYA 3WLMA 4H04A 3TTSA 3C0SA 5LHEA 3TSDA 1XLGA 3KRZA 4J2MA 4V33A 4YU1A 2YDQA 1J0YA 3GNRA 1CGVA 1TMHA 2FVMA 2NXHA 4M1BA 4U10A 1UOZA 4GNKB 1UW9A 3QY6A 4JFSA 4RDYA 2FVKA 5C70A 4MNLA 1PXGA 3NO1A 3VK5A 3E1F1 2B7NA 4PCTA 1TR1A 2VQUA 1EJXC 1MXDA 3PZVA 2OYMA 1HT6A 3N2CA 4DAIA 4C6BA 2WSYA 1XLDA 5A8NA 3EX2A 3CAKA 6ALDA 1FY6A 1Z8AA 3H4WA 5A6MA 4YCOA 4NI8A 4QE5A 2DQXA 1VCGA 2GSEA 4Q8MA 1AMYA 1JD9A 3H2OA 1M7XA 1VP5A 4JTKA 3VD7A 3IJ8A 3CEPA 1W3JA 5CKSA 3EXSA 4MHBA 4B3KA 2NQHA 3CPUA 2Y89A 4H9VA 2QV4A 1FCVA 2TAAA 3N13A 2GDVA 1W8GA 3F03K 3T1GA 3EEZA 3O0FA 3CUXA 5KZEA 2XIBA 2O7SA 4HK7A 8XIMA 1BQCA 3MUZ1 2PDHA 4B5UA 4O11A 5A6LA 3SN1A 1A47A 1NARA 3KL0A 3QH2A 3JZEA 2FZMA 3RPMA 2WWDA 3W2LA 1W37A 3LNMA 1YEYA 2BODX 1XLKA 4I90A 3L9CA 4R53A 2ONEA 3LTSA 3E49A 2PDMA 1O12A 1ADDA 4ERGA 2OJPA 4FOJA 3II1A 5CAKA 2X05A 1Q3NA 1ZU8A 3TV8A 1F3EA 1FHDA 3HGSA 1KM0A 1JUEA 2FIQA 1H4PA 1NWTA 3U9IA 2QNEA 2OGYA 3P3BA 4M0XA 1YNQA 2RDTA 4PEKA 1JZ4A 4DJDC 2P3ZA 2CIPA 4DVOA 3GNNA 3VZZA 1WDRA 1YTKA 2V3FA 4AIBA 2VEKA 5DO8A 3UT0A 3LCWA 2D0FA 3JUGA 4L1XA 3N2BA 4OOUA 3T9PA 4QR6A 1A3HA 3E38A 3K13A 4AZIA 2WQDA 3B8IA 4IMFA 4J4KA 4ZEPA 1BWLA 2CLLA 1RCXB 2BOEX 5T91A 1UA7A 3SQSA 4MYXA 1K03A 1V77A 3CXOA 1Q8JA 4JYDA 1WUEA 4L61A 2H9AB 1SYTA 2POZA 1RQHA 3THCA 3ZT7A 1OCQA 4WHBA 3MDUA 3WH7A 2E6DA 1KGWA 1VBUA 3GIQA 3BURA 2NSOA 4QNWA 2D2HA 2E7FA 1CI1A 1KM1A 4O57A 6XIAA 4IXXA 2HROA 4MADA 4CCZA 1ZBWA 3H6OA 2WANA 2X0YA 4X9SA 3M7WA 4E38A 4IMDA 3S83A 2GL5A 3XISA 2AKZA 3BCDA 2OSWA 4O18A 4FEZA 4C1KA 3LHTA 2PBOA 5DQPA 1AJ2A 3GNDA 2P0OA 1JCLA 1H7OA 2OEMA 4RV8A 4Q8WA 3VMOA 2P0IA 2HJPA 1W54A 2NQJA 3GY1A 3W6YA 1I0DA 4UCFA 1RJQA 3EWWA 5HMFA 3ABRA 2G3MA 2Y1HA 4YVXA 5HUOA 1MQPA 1VR6A 1Z41A 3LM3A 4IP4A 4AMAA 2V5JA 2Y7EA 3L21A 4UQAA 2PLCA 3M6DA 1BGAA 1TUFA 1G67A 1C8XA 3M9YA 2P3EA 2YBUA 4JL1A 2QF7A 6A3HA 1BSLA 3S6OA 1QI2A 3H26A 2NWRA 2XSXA 2ZXQA 1UKOA 4K8EA 3VGBA 2Z4GA 2EKCA 5CSSA 1WPCA 4PRRA 5CSUA 1E43A 3M0IA 4M6VA 3MCMA 2PTDA 4Y6GA 3MUCA 1EO5A 5A6BA 3BOLA 3TONA 5BNKA 1K7FA 4UFJA 1FWIC 4JS3A 1N7KA 3TTEA 3GM8A 2WB5A 3VD9A 3ARTA 5DCBA 3DBPA 3FHAA 3QVQA 4F0HA 4AVOA 1EGZA 1FFRA 2GYIA 3V3WA 5BXPA 4XZ9A 2CERA 3D6NA 3V75A 5FEZA 1OBAA 4QAWA 1F3TA 4OKDA 3U2OA 4DO6A 1UZ4A 2RDWA 5DY2A 3YPIA 2DORA 4NP7A 4QJ1A 1TWDA 5DMLA 3BLLA 3ECQA 4UR7A 4GY1A 3FY1A 4QSHA 1FWBC 3BJFA 3KBSA 3M5VA 3A22A 1TV7A 2V30A 2WKGA 5CC6A 1A49A 2GK1B 4DPPA 1KC7A 3IVSA 1LL7A 5BRPA 1KQZA 1L0PA 3QFEA 4A6GA 2Q71A 3O0KA 4LCSA 3APTA 5C7HA 3T7VA 3SADA 2PE4A 4B5TA 4KWOA 3WENA 1LP6A 1WQ5A 2OB3A 2P10A 1I1WA 2QGYA 2TPSA 3OJGA 4PH6A 2PZNA 1OFRA 5LYRA 1AD4A