4PTVA

Halothermothrix orenii beta-glucosidase a, thiocellobiose complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
445
structure length
445
Chain Sequence
IIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMEDRPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoside hydrolase family 1
publication title Biochemical and structural characterization of a thermostable beta-glucosidase from Halothermothrix orenii for galacto-oligosaccharide synthesis.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 172
structure length 445
sequence length 445
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ptvA00
2XVLA 4B15A 4JAWA 1NWTA 1VAHA 2CYGA 4HZ7A 2O9RA 2XVGA 3FHAA 5TD4A 1HJVA 1V0LA 1MW0A 1V0KA 4CD5A 2BVYA 2WW5A 1GOKA 4OIFA 3PZ9A 1DWGM 4URIA 3WH5A 4GO9A 2YL6A 2AOSA 4TUFA 5D8ZA 1KBKA 1H41A 3RMEA 4M81A 3AS1A 2G3JA 3WQWA 5LA1A 2XSAA 3VNYA 5ABFA 1QI3A 2VRJA 1HKMA 3WQVA 2WHMA 3OG2A 3AS3A 1GNXA 1JYNA 5LA2A 1H11A 5BROA 3WUGA 3AI0A 3A4AA 2OWXA 4D6IA 1EH9A 2J7GA 5BRQA 3UESA 2YA1A 4GO8A 3UR7A 2EPMX 1J0HA 1LLOA 1NARA 2WKGA 4CKQA 3HN3A 1HJWA 5I2UA 1WB0A 4WSJA 3VIOA 2ZE0A 4GIAA 3OZOA 2CXGA 3QOMA 5E6YA 1KFWA 3K8MA 3T2OA 4MB5A 4DWSB 1EGZA 2ZUMA 5FCZA 2VZSA 3U7BA 4MNLA 1R8LA 3CLWA 1PAMA 2YDSA 1FH8A 1BYDA 2YA2A 2V3GA 2YIHA 1XD0A 3VGEA 3MKKA 4FF5A 5BYWA 3NSXA 4E8DA 3T09A 2BY1A 2W5FA 5HPCA 2OYMA 3WNOA 5HBFA 1UKOA 3CO4A 5DO8A 4CGTA 1ECEA 1J11A 2ZX7A 3CH9A 4BF7A 1RD6A 4KWUA 4LXFA 4PCTA 1UR2A 3F5LA 3QR3A 3WD4A 4M24A 1H0GA 1E3ZA 1EOKA 1QHPA 2XTKA 1JI2A 4AW7A 2W61A 4PN2A 1UWSA 3VNZA 4UQBA 1KCLA 3VDAA 3MUIA 1XGZA 4GZIA 1V6UA 3VIKA 4P8UA 4ZENA 2ZX8A 5E70A 1F4AA 3UCQA 5IHSA 1WZLA 5CJ5A 2VX4A 1WCGA 3VIFA 4LGXA 5ECUA 3VMNA 1WDQA 3MSDA 2D0HA 1KWKA 1ZJAA 4RE2A 2FH8A 2GDUA 5GNYA 2EPLX 1B90A 1J18A 3W6MA 1C90A 4W8LA 4QDMA 3EMQA 1BYCA 1E6QM 3ZJKA 2A3HA 3GH7A 3N04A 1W3LA 1UD8A 3AXHA 1PZ3A 4RE4A 1UYQA 3WEZA 3N1AA 3VM7A 4OJYA 4XZBA 2J77A 3LMYA 2DT2A 3MS8A 1BGAA 5CXPA 5A94A 2CBJA 3B9EA 5A6BA 3BCDA 3SCTA 1NWUA 1KBBA 3VOCA 1JNEA 2E3ZA 1CPUA 4TVUA 4M82A 4EE9A 1CYGA 3ZSSA 1V02E 3W24A 3LPPA 4JKLA 4MNKA 4M56A 4AEEA 3OA5A 1UD6A 3TTOA 1B3YA 1V0NA 4PUEA 2ZOXA 3EDFA 1BF2A 2E9LA 1OSEA 4B3KA 4CCDA 4HOWA 3PZMA 2WYSA 5CSYA 1MYRA 3EDKA 3WEMA 3FAWA 3QHOA 1KXHA 1XYZA 3IAQA 2NW0A 1J0JA 1C7TA 3EDJA 2PWDA 1MW2A 4AZGA 1CECA 3I3DA 1SMDA 4PUDA 4OZOA 3FN9A 5A6MA 1G9HA 2D3LA 1NOUA 3GBEA 4BA0A 2YJQA 5CLWA 3W0KA 4MB1A 4UOZA 3K8LA 2YA0A 1UZ4A 5DT7A 3CZJA 2PWHA 5D9MA 3AIVA 1W91A 3IJ9A 1I75A 3W27A 2PI6A 1JZ8A 1EDQA 4U5KA 5A6AA 1JAKA 3CHFA 1VEMA 4U3CA 4WKHA 5FD0A 1WZMA 3WENA 4AZCB 1EO5A 3WMBA 3VD4A 1QHOA 1TE1A 1ISVA 1UUQA 4J3WA 2QMJA 4AIUA 1JZ6A 3GTNA 2ZX6A 2G4FA 3WQ8A 3VD7A 2F2HA 2E8ZA 1C7SA 4CUCA 1IT0A 4J3TA 3AYRA 1HXJA 3T08A 1W2PA 3GNOA 4JKKA 3CBWA 3PHAA 1W9DM 2BVTA 1FHLA 2D24A 4BS0A 4AISA 2WNWA 5D9PA 3WNMA 3SUSA 1HJUA 1HKIA 2WCAA 2XWDA 1UKPA 1DEDA 4UZUA 2J7DA 3AIWA 1US2A 4H2CA 2J47A 4CN6A 5BXPA 3WQ6A 1FP9A 1QHZA 3VIIA 1JZ4A 1WO2A 2GUYA 4UZSA 3N17A 4WLCA 5A8PA 5BRPA 3GNPA 4FMVA 3OLEA 1VBRA 4PMXA 1UA3A 1QNPA 3N12A 2W67A 5A8MA 4TTGA 3SUUA 1Q6FA 3KL0A 3WQ5A 2J74A 2VVSA 3SCPA 5A6JA 2EXOA 1R7AA 3AMGA 3F5JA 3WH6A 1PJ9A 1QNSA 3CPUA 4HA1A 2NSXA 4D6FA 4U3AA 2J78A 3DYOA 4GI9A 4UQ9A 3RJXA 2WVVA 4HZ8A 1JYXA 2HVMA 3VD9A 3AOFA 1HN1A 3ALGA 1OGSA 2FHFA 2V5DA 4NSBA 3CGTA 4IPLA 1I1WA 1V03A 3BC9A 1LJYA 1H3GA 1CXFA 4UOJA 1ITXA 3ZT7A 3UETA 1EHAA 5AC5A 2YBUA 4QLLA 3GXMA 1BHGA 3L4YA 4MJ2A 3CUIA 3LPFA 1JZ5A 2BNJA 2UY4A 5M5DA 2XJ7A 4A4AA 4N42A 1E40A 1JFXA 1JL8A 3OLGA 3WL1A 3NSNA 4MB3A 1KR0A 1OT2A 4D6GA 4C7FA 1UH3A 3WF1A 3MV01 2OLHA 3ZM8A 5D8WA 1J9YA 4GQQA 1VBUA 4JFTA 1F4HA 3SCSA 3GH4A 1VFOA 4YHGA 2FHCA 2XFRA 2WAGA 3WUEA 4UFJA 1TCMA 2YDRA 2C7FA 1H2JA 2G3MA 5IDIA 5I78A 1ISXA 4H8UA 2DSVA 1Q6DA 1KWGA 3AHTA 4M1RA 4U33A 5I6SA 1MWOA 2E4TA 2ZXQA 2V5CA 4A3HA 3K4DA 5CG0A 2EBNA 3G6LA 1W1YA 2DH2A 1UHVA 2XFFA 4HMCA 5A2AA 2FDMA 1J01A 3T2PA 4KRUA 2ZUTA 3QGVA 4AZ5A 1WDPA 1SYTA 3OIHA 1UQYA 3VU2A 2EPKX 3MMWA 4LQ1A 2PBOA 3SUVA 2DIEA 1Q4NX 3GM8A 4HP5A 3BAXA 1JGIA 1OGBA 4ZXOA 4GINA 2OWWA 1W9UA 3G6MA 3PN8A 1J0ZA 3CUFA 2PWEA 3O6AA 1ZS2A 2XUCA 4TVCA 3WY1A 2WPGA 1WP6A 4MDPA 3PZIA 2VCAA 1BGGA 1PZ2A 3ZO9A 5JIWA 4ACYA 1UG6A 2PF0A 3VPLA 4JL1A 4ATWA 2WMKA 4W93A 2J7CA 4KRTA 1VFFA 1UR8A 4PMZA 1CEOA 2Y8VA 1LL4A 4W5UA 4P7QA 1KGUA 2FGLA 1JYVA 5E0FA 1UD4A 2BS9A 4Z2JA 1B9ZA 2BHYA 1ZL1A 3PTMA 1HIZA 3UERA 1J0KA 1E56A 1VFUA 4P7RA 2VCCA 3BLKA 3WNKA 2VOTA 3ZR5A 2WCSA 1OIFA 3AIQA 1BG4A 4KGJA 4DWSD 1JZ2A 3WNLA 3AZSA 3BAWA 4MPKA 4J27A 4H8VA 3MO4A 3QHNA 5CPTA 4AD2A 4CN4A 3EBVA 4XZWA 5GNZA 3OGRA 3UEQA 1L0PA 1NWRA 4P7NA 1XH1A 5DF0A 2XWEA 2QLYA 1AQMA 1E0XA 4HU0A 2UY2A 3ZJ6A 3WELA 4QLJA 1ISYA 1HVXA 3NUKA 3L4ZA 3AIEA 4W89A 2BY0A 2GK1B 3KWXA 3K46A 3ZSTA 2Y4SA 7CGTA 4IUGA 3NJ3A 1OT1A 1NP2A 2AAAA 2GFTA 4JKMA 1EA9C 2CBIA 4TX6A 1D2KA 3ALFA 1EDTA 4AZIA 3KZSA 3FXYA 3CZLA 3VDHA 1HX0A 4UOQA 3TP4A 3WFZA 1DWJM 1JD7A 3BH4A 4OKDA 1PX8A 5A8NA 1R7OA 3W29A 2W66A 3PBGA 1XV8A 4ZE5A 1GOQA 1AQ0A 1VB9A 1SFSA 2J7FA 3ARQA 1KB3A 2WWCA 1BVNP 2WMJA 4PCSA 2ZIDA 4JCLA 5BXSA 1LG2A 3PZQA 1NOFA 1TR1A 2DT1A 2J79A 3AS2A 4UQEA 1ISZA 2YLLA 1W2VA 3VIJA 2VT0A 1MQPA 1CXEA 3J7HA 1QI4A 3RJYA 3W28A 3ARRA 4LYPA 1QOXA 1UR1A 4UQCA 3SCWA 3WH9A 3B9DA 1PIGA 2ZX9A 1ZU8A 2VMFA 3EMCA 4HA3A 2CIPA 4D1JA 3WD1A 4R27A 3UG3A 3CIVA 3BXWA 5CSUA 2VR4A 1CXIA 4AD4A 1EQPA 4WIWA 4MAZA 1JF5A 2W62A 2XFYA 1JYWA 4PSPA 4UFHA 3VGFA 1C91A 5IFTA 3RM8A 3DHUA 4P7OA 3WF3A 4S3KA 4PMDA 4DUVA 4NZCA 3VUPA 3UR8A 3RM9A 2DSKA 2GDVA 3CMGA 3W4RA 2ZUSA 1U2YA 4J3UA 5HPOA 1O7AA 4OOZA 1QW9A 4PMRA 1X1NA 1QNOA 1J0IA 2W4XA 1W1VA 4AZ6A 4CD8A 2JALA 3WH8A 1H49A 1HNYA 1UD5A 4GZEA 2JF6A 2WVSA 1B31A 1DHKA 4L4OA 4WJXA 1K6AA 3CZEA 3WDIA 5A6KA 1D7FA 3FY1A 3M6DA 5D4YA 4HMDA 4C7GA 5JBEA 3IAPA 4D6CA 5E9AA 3BAJA 3AZRA 3ARWA 5E6ZA 3AJ7A 1NWSA 1CGYA 1D3CA 3OZPA 5JBFA 2BY2A 5I0DA 3APGA 2J7BA 1H4PA 4CCCA 1DTUA 3T0DA 2VI0A 3EDEA 1G5AA 2WVTA 4GI8A 4QAWA 4ZXLA 4EAMA 1JIBA 5C8BB 2JIEA 4P7LA 4BQ3A 2F61A 1S46A 4CD4A 2WZHA 2W92A 3A3HA 3BAKA 4GI6A 2WANA 3FHQA 3PTQA 1PX4A 1EQCA 1GQJA 1DWHM 3AROA 4W84A 3M07A 2A3EA 2Y8KA 1TFVA 3GXFA 2J7EA 3WNPA 2V3EA 3WUFA 1XCWA 4B9ZA 1V0MA 3N18A 2ZWZA 4JL2A 2VNCA 2D20A 4UQDA 1JF6A 5C70A 3K4AA 2CKRA 1J0YA 1V6VA 4JZ5A 1JDCA 2DIJA 3SEPA 2ZUVA 3GDBA 4Z2LA 2DPEA 1Y7VA 1CIUA 1C92A 3CUGA 5M17A 1WE5A 4OOUA 2B31A 3L2LA 1UKTA 1M01A 3PZUA 1GQIA 3W26A 1OD0A 4D72A 1TA3A 5C71A 4WKFA 1B3ZA 3KEHA 3VIMA 1QI0A 1JG9A 4F9JA 2IXVA 1ZBVA 2CPUA 4PTXA 3MV11 2AMGA 3AXIA 1FFRA 2WB5A 1W1TA 1EOMA 1V3KA 2NT1A 5A2CA 3T2QA 4EKJA 4R5EA 1GZJA 1G01A 3OLIA 2CHNA 2JE8A 1GORA 4AY1A 1HP5A 1VF8A 4PMUA 5A2BA 1W3HA 1CDGA 1BYAA 3ZQ9A 1BFNA 1Z32X 4CU7A 4D6EA 5M03A 5HNNA 2WMFA 4XUYA 1B0IA 2GSJA 1HVQA 1A3HA 2D0FA 4UFKA 1B2YA 1DP0A 1QW8A 4UR9A 4NI3A 4WF7A 3DC0A 5AC4A 1W3JA 4CN1A 3S2CA 4DM1A 3IK2A 2GVYA 3VMPA 4JHOA 1WNOA 3CHCA 4M80A 2OSYA 4PMOA 4YPJA 1JI1A 3WN6A 4MNJA 1UWQA 2EEXA 1JD9A 2CESA 2CHOA 3I3BA 3PZOA 1CGXA 2IUZA 2G3IA 3D3AA 4AZ7A 2YKKA 3NDYA 4B9YA 4H04A 3OGVA 2D2OA 3AS0A 4FLQA 4BCEA 4LYRA 3TA9A 1GHSA 2DEPA 1R86A 2ZWYA 3VINA 2W63A 3WIJA 1M53A 3SUWA 4D1IA 1W9BM 4AMCA 5I23A 2D23A 2XGBA 3B8SA 5CLTA 2OSWA 2Y2WA 2VTFA 2JEQA 4E4PA 2D3NA 2QPUA 3WDQA 2EPOA 4W85A 3CUHA 2CERA 4AEFA 3AHXA 2IXUA 5FKYA 1J12A 2WC7A 5I5RA 1QNRA 3BAIA 4CCEA 3W6LA 3MMDA 1E55A 4AWEA 3RO8A 1XH2A 1GJUA 4FLSA 1ODZA 5A3HA 1JFHA 4AD3A 3EMZA 3GXIA 2PC8A 2JF7A 4XB3A 4YHEA 5EFDA 2WM0A 1CXHA 4U31A 1JDAA 4UCFA 3ARYA 2YOCA 1E0WA 4DM2A 3KL5A 1TVNA 3A4WA 3VGGA 2HISA 5CGMA 3WMCA 2DSZA 5IFPA 3KE0A 4P8XA 4U2YA 3TTYA 7A3HA 2X2YA 3BMWA 3AIUA 4LX4A 3F4VA 3IJ8A 1VFMA 4PRWA 4GZJA 4AD5A 4CVWA 2WVUA 1HL8A 4J3SA 3DECA 1K9DA 5EB8A 3WD3A 1RPKA 1TG7A 2VVNA 3AQUA 3PZNA 4PYSA 8CGTA 4AZHA 3RIKA 2O9OA 3WH7A 4N0RA 3AISA 1E6PA 5I24A 1C93A 2A3CA 2XVNA 1SMAA 2E9BA 5I77A 1CGTA 4BZYA 3WNNA 1KXVA 1XHGA 2VQUA 2WZEA 1B3WA 1B3VA 2GJPA 5KEZA 1PX3A 4CD6A 4HMEA 3ZJ8A 3THDA 3UG4A 2J75A 1EHNA 4X0VA 5DMYA 4YN5A 2CKSA 1W9PA 2O9PA 5I3DA 2EJ1A 3GXDA 4H7VA 2PBGA 1V3IA 1QNQA 3WD2A 3CTTA 1GJWA 3L4VA 1I1XA 4FLRA 1ZBKA 1K9TA 3FNDA 3AYSA 4ACZB 3WSUA 3CZGA 4BQ4A 2O9TA 1W1PA 4HU8A 2BY3A 4AIEA 5AYBA 1MXDA 3O2LA 3ARUA 4FLOA 1E43A 2CBVA 4NF7A 2YL8A 4PMNA 5CPSA 1E4LA 4HTYA 4HOXA 2CETA 1IZKA 1AVAA 2YL5A 1V6YA 2WMIB 3AFBA 4AYSA 3VDBA 1LL7A 1L8NA 5EFFA 1GW1A 2ZX5A 3RCNA 1KR1A 2VZUA 3UG5A 1QBBA 5A6BD 4HPHA 5M3WA 1JNDA 4AD1A 3VILA 5HDRA 1OWQA 1H09A 5AY7A 1LG1A 1VJZA 1U33A 2CITA 1E5JA 3A6OA 5IHRA 4IISA 2XG9A 4PSRA 4W88A 1YQ2A 3N11A 4TOQA 4JIEA 2VRKA 5LYRA 1VEOA 1E5NA 3HJEA 2BV9A 1PEZA 2ZXDA 1GONA 2V38A 3SCNA 1TUXA 3L4UA 3VX0A 4PMYA 5ABFB 1ZBCA 1UA7A 4A3YA 2VZTA 1SR0A 3OB8A 1UH2A 2GJXA 1UD3A 1CGWA 4PMQA 3F5KA 1FH7A 1WDSA 3RM4A 4P8VA 2VR5A 3ARVA 3U7VA 1E70M 5DT5A 4CVUA 3L4TA 1WAWA 1WDRA 4Z2HA 3N13A 1E15A 1UWUA 3NYDA 2OYLA 3W25A 3WD0A 3ARZA 4AD0A 4W8BA 2FGZA 4P8WA 2FHBA 3MMUA 1C3FA 3VTRA 3CHEA 3WBEA 1EXPA 4UQAA 4JFUA 1PIFA 3WFLA 2BFGA 2UWFA 3N15A 3EYPA 2JIWA 2J62A 1RP9A 1ZJBA 1WKYA 1QI2A 4CU8A 7TAAA 3GYCA 1AMYA 1TZ7A 4V2XA 5EBAA 1JZ7A 2ZUWA 3W38A 2WMGA 1CNVA 3WF2A 2DSWA 2X09A 2FH6A 4GXPA 2BXZA 2RGLA 1W9XA 1W32A 5GPRA 2Y24A 2WHLA 1GPFA 3ARXA 2VJXA 1KQZA 3WL0A 3AHYA 4JCMA 1MVYA 1OM0A 4AXNA 4HA4A 3SCOA 4UFMA 3VD3A 2D0GA 3U5UA 2DT3A 2C8NA 2F8QA 2PWFA 1BAGA 4UFIA 4Z2IA 1LF1A 3VO0A 4ZE4A 1XSKA 1B30A 3VIGA 3WEOA 3VM5A 4Z2KA 2XSBA 3WDHA 1XCXA 4MTVA 2QPSA 1OB0A 1ITCA 1M03A 2QV4A 3SUTA 1UWRA 1VJSA 4MB4A 1CWYA 2WKLA 1NH6A 1HT6A 4IM4A 1CTNA 1BSIA 1V02A 1M7XA 2A3BA 1UQZA 3WF4A 4DUWA 2WC3A 6TAAA 4HPGA 1MQQA 1PPIA 4E2OA 5CQ1A 3B9AA 1CXKA 5CPQA 1BVZA 1FFQA 2XPKA 2WXDM 4M29A 1JXKA 3MANA 2YLAA 3BMVA 4MNMA 4JFVA 1OINA 2VC9A 3KL3A 1G1YA 2WLYA 1TA3B 1X6LA 3HMCA 3OBAA 1BPLB 2V3FA 1FP8A 1OCQA 1UZ1A 1Q6GA 1LWJA 1E71M 3A47A 4H8HA 3SCVA 2XIIA 1OIMA 2CBUA 1JAEA 5ABHA 1AQHA 3POHA 1CZ1A 1E6RA 1E73M 1H1NA 3OGSA 3VGDA 5FL1A 1K9FA 2XHYA 5CZKA 2XIBA 1V6WA 2BVDA 1CGUA 5F7UA 4AZBA 1JZ3A 3U57A 1WPCA 1XSJA 2VX7A 5I79A 2GK1A 4W7VA 4NRSA 3NCOA 2VL4A 1E6XM 1GOIA 2X0YA 5A8OA 2VQTA 3POCA 4GKLA 1UR0A 1TVPA 3PZVA 4ATDA 1UOKA 1UKSA 2VZOA 2EO7A 5A1AA 1US3A 1LL6A 1V3JA 1B3XA 3AMDA 1W3KA 3ARPA 5A8QA 4Q7NA 4CD7A 3VGBA 3VIPA 2DGAA 1X6NA 5AYIA 3ARSA 3RPMA 3MUAA 1E0VA 3VD5A 1UR4A 4XV0A 3VX1A 4AC1X 4KGLA 2YBTA 3SCRA 2DT0A 1MW3A 4HOZA 2BXYA 3ZMRA 1UWIA 1WZKA 3FW6A 3L4WA 3LPGA 3IJ7A 2D22A 1OGGA 3VDCA 3K8KA 5IXEA 4TXEA 3JUGA 3WF0A 2VCBA 2JEPA 5HOSA 1V6XA 4W86A 1E4NA 4HZ6A 1V3HA 3NSMA 5DEZA 1XH0A 4V27A 2WHKA 3AHVA 4J3VA 2G8ZA 2BHUA 1R85A 2ZXAA 4L4PA 2CNCA 5JIPA 4LPCA 3N9KA 4H41A 5CGTA 3NDZA 4W8AA 2WMHA 1UH4A 3ECQA 1ESWA 3DYMA 4UTFA 3ZT6A 3LPOA 1HJQA 4W87A 4CU6A 2WCGA 2WVVB 1QI5A 4W5ZA 3PZTA 1NP0A 5FL0A 2QHAA 5ABGA 1UWTA 1GQLA 4MADA 1BTCA 1G94A 1ODUA 3CUJA 2ZUUA 2J7HA 2XYLA 1QVBA 4LYQA 4RL3A 4EK7A 4F66A 1GCYA 1VRXA 5DFAA 1GVYA 4DWSA 1GOMA 3K1DA 1C8XA 3W82A 3A4XA 1WZAA 2UY3A 2WZIA 1GVIA 1GOWA 2ZICA 3PTKA 2XVPA 2VUYA 4GQRA 1CLXA 1O6IA 2RGMA 4WSKA 2UY5A 3SIMA 4X9YA 3WBAA 3GH5A 4UNIA 1E1FA 3II1A 1XSIA 3RILA 5GNXA 4C7DA 4RE3A 2Z1SA 3AMCA 6A3HA 2YL9A 4JFSA 1GOOA 2O92A 3FAXA 1TMQA 3MUY1 3WDPP 3I3EA 4JHZA 3T0AA 1UD2A 1N82A 2C0HA 2ZXBA 2CEQA 2WHJA 1E72M 3CHDA 1C8QA 3MSGA 3SCQA 4BQ5A 1DWFM 4TVDA 4PBGA 2DQXA 4ZEPA 2VO5A 2J8GA 2ESCA 3AHZA 1EO7A 1J10A 2EQDA 4ML4A 3E1F1 2VX6A 1CGVA 2WBGA 5BCAA 1NM9A 1E6ZA 4PTMA 4V28A 4OBRA 2BHZA 4TTUA 2J8FA 5A69A 1NOWA 3AIRA 3HU7A 2DDXA 3WMSA 1ZBWA 3WQ4A 1GHRA 1XD1A 3ZT5A 1W9VA 3M7SA 4PMVA 3L2MA 1IV8A 4S3JA 1FOBA 1VEPA 2WLZA 4AIOA 4Z2GA 2VRQA 2X8RA 4B3LA 1YHTA 3SURA 1HF6A 5FOOA 1MFVA 3NIYA 2XVKA 5ABEA 3WDRA 4W7UA 4IPNB 2E8YA 3MU7A 1MXGA 3ZIZA 1MW1A 2QF8A 1XC6A 5D9NA 2QMKA 1KXQA 5BWFA 1RH9A 2X1IA 4QFUA 2Z1KA 3D5HA 3GNRA 3MUZ1 3RDKA 3S6TA 2TAAA 1HL9A 1JXJA 3CMJA 1Q6EA 2VX5A 4D6JA 1BG9A 3BAYA 1HKJA 5E09A 1UKQA 1PBGA 2E40A 3ZOAA 3AMLA 3EDDA 4QCEA 3OLDA 1DWIM 3TONA 2XM1A 4F79A 2X0HA 4D6HA 3BLPX 4KMQA 2A3AA 1E3XA 3W81A 3QOKA 5JUVA 1EDGA 2GJRA 3WKZA 2GJXB 1BLIA 1G0CA 1NQ6A 2J25A 2MANA 2OYKA 2PWGA 3TTQA 5BXRA 3DHPA 2E9MA 1E6SM 5HXMA 1ZB5A 1FH9A 1R87A 2W91A 3ZR6A 3ZJ7A 4DUXA 1MFUA 2XM2A 3TOPA 3WUBA 1KGXA 1XRVA 4Y7EA 3CZKA 1MQRA 1BQCA 1K9EA 3THCA 5JBDA 4AZCA 3BSGA 3DYPA 1HP4A 2VZVA 3M46A 4F8XA 5FIPA 3VMOA 3W53A 4U5IA 2E0PA 1VENA 1V3LA 3T0BA 3GBDA 1DWAM 1U30A 2V3DA 3GZAA 1OD8A 4U2ZA 3BSHA 1A47A 1E9LA 4DWSC 1Q6CA 5BXTA 4Q22A 4KH2A 4D6DA 4K68A 2YDQA 1HJSA 3AXXA 5A6LA 2J4GA 1UR9A 2OWCA 4GPNA 8A3HA 3IANA 5A6SA 3TTSA 4PTVA 5LA0A 4J28A 1HKKA 1QPKA 2DH3A 1GUVA 1E1EA 2WWDA 1GQKA 1P6WA 2Q8XA 3ARTA 1B1YA 3AIBA 3U5YA 4MAVA 4TX8A 4ZFMA 1OBAA 2D1ZA 1CBGA 1FHDA 2VURA 4ATLA 2NT0A 4JFWA 3VGHA 3VVGA 1JDDA 1CLVA 1KGWA 2WC4A 4MDOA 1RP8A 2JFEX 4E8CA 2G3NA 4EANA 5GQBA 2DSUA 1EIBA 4QCFA 4J7RA 1HJXA 3BCFA 4PTWA 2PB1A 3PZGA 1KXTA 4MJ4A 1M04A 1ISWA 4OBSA 1CENA 1CXLA 4X0NA 3W37A 1V3MA 4PEEA 3WDJA 1E4IA 4QLKA 2EPNA 3BGAA 9CGTA 3AICA 2XGIA 3CZ8A 1IZJA 4D71A 1V08A 3VIHA 1C8YA 4W7WA 2G41A 4F9DA 4M8UA 1KCKA 3QHMA 4UFLA 1KQYA 1BYBA 1H0IA 3VKKA 3O9NA 1LQ0A 5A95A 1LWHA 2ZUNA 1XYFA 4OUEA 2CCRA 3AMKA 4WK9A 2OSXA 2Y5EA 3AZTA 3SCUA 1QBAA 1E4MM 6CGTA 4FK9A 2WK2A 4BQ2A 5D9OA 4J3XA 4ACZA 4NRRA 5EMYA 1VIWA 1H5VA 4XX6A 4B16A 1FA2A 3L4XA 5E0CA 4QP0A 2WBKA 2X05A 2WSKA 5KZ6A 2WMIA 4WKAA 2WSPA 1E6NA
chains in the Genus database with same CATH superfamily
2P0IA 1Q65A 4YTUA 3EA1A 4DJFD 1VAHA 3S2LA 4KIRA 3NPUA 3IJDA 2O9RA 1W8SA 3WQCA 2XVGA 2NQHA 1Q8AA 4B90A 5BZAA 2PDJA 4GC4A 4KW2A 3GVWA 4Q32A 2WW5A 4OIFA 2UV8G 2AOSA 4DXVA 5D8ZA 1KBKA 3P74A 4DNMA 3I65A 4IFKB 1LQ2A 5LA1A 3VNYA 4G5DA 3U4FA 1QI3A 1YADA 3AS3A 3FYPA 3BLLA 1W37A 4M51A 3TFXA 3AI0A 4D6IA 2W6RA 4KF1A 3QW4B 3UESA 3UR7A 1GEHA 4GO8A 4CQAA 1J0HA 3RLVA 4CKQA 1KFBA 2A79A 1R3RA 2R1PA 2P5NA 3VXGA 3M41A 3VIOA 2IQTA 2YCLA 1EF2A 3BLDA 1DL3A 3T2OA 4MB5A 1EGZA 2VEFA 3O05A 2ZUMA 3TR9A 1M3UA 3SJNA 5C9UA 4MNLA 3PPFA 3M5ZA 1R8LA 3CLWA 4RUBA 2NXIA 4A3QA 4AH7A 4ROPA 4S3FA 2OYMA 6ENLA 1LRNA 1AD4A 4Q4RA 1OHLA 2DZSA 3UNTA 4R85A 3SN4A 2PCQA 2GQ8A 1IEXA 1J11A 2ZX7A 3G1DA 3A13A 4QG6A 1U1JA 3MZ2A 3LTPA 4E4UA 2PD9A 3F5LA 3WD4A 4M24A 1EOKA 3G5EA 1QOQA 4PN2A 1UWSA 4QM1A 3VIKA 3UCQA 1ONXA 2ZE3A 2ZX8A 4UTKA 1OC7A 3H2EA 3LENA 3TH6A 4XD6A 5ECUA 1OX5A 3VMNA 3PR2A 3DFYA 1XP3A 4LAOA 2FH8A 2EPLX 3W6MA 3ZJKA 4LTSA 3N04A 4PULA 3RXZA 1W3LA 1RBOB 4ZB2A 3QQWA 3VM7A 2RJHA 2J77A 2DT2A 4JQAA 4XKYA 8XIAA 1DYSA 3U48A 4S3EA 4JIQA 1A5KC 2HQAA 3B9EA 3BG5A 3SCTA 1KM1A 4H83A 4B5XA 5LXXA 1KBBA 1JNEA 3B04A 4NAEA 1O68A 4A2SA 4M82A 1IWAA 2HDJA 5DRCA 1JPKA 3ZSSA 1DQWA 3OA5A 3AU6A 3N6JA 3K1GA 3WQEA 1V0NA 4GMEA 4HOWA 2VUNA 4PUKA 2QYGA 3EDKA 3WBXA 1XYZA 1DJWA 3FCPA 1AQFA 4S39A 5JMUA 3I3DA 1AH4A 4AZGA 4PUDA 4RZ4A 1XLMA 1XIHA 4C6MA 3TSBA 2XDFA 3S1WA 4WDTA 1PWLA 2BXVA 3UZ5A 1I75A 3UA4A 1JZ8A 1Q7QA 3OZMA 1KCZA 2OXNA 1JAKA 4GK8A 1S2UA 4QGCA 1YDNA 3WMBA 1ICQA 1Q66A 4K36A 1M1BA 2OQHA 3W02A 1QHOA 3LG3A 4J3WA 3R12A 2QMJA 1H60A 4JIRA 2F2HA 4E5TA 1JCLA 1SO6A 1ZPTA 5G5IA 4CUCA 1TTJA 3AYRA 4JKKA 5KZDA 3PHAA 1FHLA 2D24A 3W00A 1F07A 3R5EA 1SZNA 3I7QA 4LEFA 3P6LA 4FNTA 1HKIA 1UKPA 3NVTA 1US2A 4CN6A 5BXPA 4Q3MA 3G1VA 3LLDA 3VIIA 2GUYA 3QMRA 5A8PA 4P61A 3GNPA 4US6A 1UA3A 4TTGA 2W67A 3SUUA 3EPMA 1IEVA 1Q6FA 3FK4A 1WDWA 2EXOA 3WH6A 1XPYA 2ZBTA 4HA1A 3TKFA 1RK6A 3UWVA 3BSMA 5EPDA 3XIMA 3GNXA 4GI9A 3NQBA 3LUTA 4MIMA 4L1GA 2WVVA 4IIHA 4LH8A 1QMLA 5LXEA 2CZEA 1XIFA 1OYAA 3R89A 5XIAA 3QSTA 4KKXA 3UW6A 1ZGDA 2CLOA 1FCVA 3JZUA 1LJYA 1CXFA 2HE5A 2QKFA 5REQA 5AC5A 5IBXC 1BHGA 5IRPA 4E4FA 1GG1A 1A53A 2XJ7A 4AYGA 3VKAA 1H63A 4AVOA 1VYRA 1UH3A 3MV01 2OLHA 3ZM8A 2NX1A 1F4HA 4Y9AA 1Q45A 3GH4A 1XQLA 3F1QA 2PODA 3KVJA 2XFRA 2ICSA 4WY0B 3PNUA 2PDXA 2FFIA 5DN1A 1AD1A 1H2JA 1DXEA 2G3MA 1ISXA 3BANA 3ANVA 4H8UA 4LANA 2DSVA 2GWNA 1KWGA 3PBMA 1M65A 3HA1A 2ZXQA 1VHCA 1ZLPA 4MF4A 5CG0A 1RVKA 1W1YA 1B9BA 2VGIA 3NTYA 2E5BA 4KRUA 3C56A 3DOPA 1TIWA 4AZ5A 2HXUA 5FAJA 1XGEA 1WA3A 3LI1A 3BAXA 3LSCA 4ZXOA 4Y9PA 2GYIA 4R53A 3RX4A 2ISFA 3GFXA 1J0ZA 3GDKA 2PA6A 3O6AA 1XI3A 1ZS2A 4YNGA 1WP6A 1FDZA 4N4PA 1NDWA 4JNZA 3S5SA 2A7PA 5C2GA 1BGGA 2VKZG 4ACYA 2W0UA 4JL1A 2WMKA 4W93A 4QX4A 4KRTA 4ZBCA 2NLIA 1LZOA 3FLUA 3CWOX 4A8RA 1CEOA 2Y8VA 4RKAA 1GZGA 4W5UA 3QPZA 1JEZA 1JYVA 4REQB 5E0FA 2B7QA 3H24A 2BS9A 4M5PA 2CLFA 2Q3OA 3H70A 5G4EA 5K2ZA 1ZL1A 1ZCCA 1J0KA 1VFUA 4I6KA 3HFTA 3BLKA 3FIGA 3TK7A 1HGWA 4TMCA 4FHAA 4DWSD 3F4WA 4V15A 1PZ1A 3WNLA 2Y8UA 4N6EA 2V8ZA 4HHPA 3QHNA 4CN4A 1K70A 1UPPA 4XZWA 5GNZA 4IIDA 2VGGA 2IS7A 5DF0A 2V2DA 5DRIA 1XL9A 4HU0A 4QLJA 2FQIA 3FGCB 4IIEA 3R10A 3P67A 1IXNA 2KX9A 3KWXA 2V5KA 4QEHA 2Y4SA 1UJPA 5F2MA 3RU8X 4LAMA 3NQ7A 3NJ3A 1NP2A 1EA9C 2CBIA 3QY7A 3CZLA 1DBTA 1IIHA 1HX0A 3OVGA 4UOQA 1DWJM 3W7NA 1PX8A 1JJKA 1ML1A 4PTDA 1SVDA 1XKJA 3JU2A 1R7OA 3EZ4A 2HTMA 3ITXA 2UBPC 1XV8A 4IF2A 4JTKA 3ARQA 2VDHA 2PDWA 1KB3A 3OHIA 1BVNP 1YPIA 4JCLA 4JHMA 3PZQA 3THUA 2J79A 2DP3A 2EGZA 4BI6A 2PF8A 4ORMA 1TQXA 4FNQA 3LQGA 3NFUA 1MQPA 2D2JA 4NUWA 3RJYA 2R1MA 3CAVA 2FKPA 5D2XA 4DY1A 3LMZA 4NI8A 1YE6A 4X9SA 1FDJA 1PIGA 2ZX9A 3BOFA 2P8CA 1H7WA 2OT1A 3EMCA 1R3SA 3WD1A 5CSUA 1D3HA 2FJKA 4U4MA 5U4NA 1JYWA 4X63A 2OKTA 4GWEA 5I06A 5ECVA 3RCYA 2QCDB 3FOKA 5C7VA 3G1YA 3WK2A 4NNCA 4S3KA 4DUVA 4NZCA 1ELSA 5FJJA 3NL6A 2GL5A 3CMGA 1YPXA 4J3UA 2JBMA 2HPIA 4HN8A 1QW9A 1RQEA 4PMRA 4XZNX 2OPJA 4LW7A 2WQPA 1FKWA 4GYJA 3UA3A 4GCXA 4MYAA 1XLJA 2EJAA 4GYKA 3V3WA 4MY9A 2ZRYA 5EU9A 1MXSA 1HNYA 1QU4A 2ZRUA 4KPLA 1Z6KA 4GZEA 2Z27A 1DHKA 2FIQA 3CZEA 4AVNA 1D7FA 3KRBA 3FY1A 3ZR4A 5JBEA 3G22A 4GOAA 4D6CA 4JNYA 1ADDA 5E6ZA 2BY2A 4NHVA 2J7BA 1H4PA 4GX8A 2PD5A 2INZA 2RAGA 3EDEA 1G5AA 2PDCA 4QJ4B 3WFAA 4IIBA 3MCOA 1RALA 4EAMA 3WQGA 1RCOB 2JIEA 2BOEX 4Q4PA 4P7LA 4BQ3A 3MBDA 3U8GA 4GI6A 2OZ0A 3NZGA 3PTQA 3KP1A 3AROA 1WAUA 2EF9A 1KFCA 5HMEA 3GKFA 1KTBA 1W3IA 3UWYA 4B9ZA 3URNA 3N18A 4DO7A 2E6YA 2ON3A 5AC6A 3A12A 1FTXA 1D7KA 2GUUA 1A0DA 1I8JA 1UR3M 2WJZA 2ZUVA 4Z2LA 1G4TA 1Y7VA 3SADA 3CUGA 1WE5A 1DJZA 4OOUA 1T96A 1WKFA 2B31A 2E1DA 4I5RA 1JCTA 4D72A 1E9ZB 1TA3A 2FYMA 3S1VA 1DIDA 3WLRA 4HNNA 1B4EA 3KEHA 3VIMA 1ITQA 5CKSA 1JG9A 3SSJA 2PSNA 2QJJA 2CPUA 3R11A 1XBXA 4H9TA 4NJJA 3TYCA 1GVFA 1KA9F 1M68A 3MV11 5JH1A 1YPFA 5JU6A 2C13A 1G6CA 3BLOA 1EOMA 1REQB 3T2QA 5AN7A 1BVWA 2FFCA 4BJHA 4EKJA 3IVUA 3OVRA 3OLIA 2QJIA 3M5VA 4Z17A 3M7WA 1QO5A 4XAGA 1VF8A 4PMUA 3TUUA 5HNNA 4XUYA 2GSJA 1TRIA 4K7YA 1B2YA 3HO8A 3PNZA 4ASTA 1DP0A 4UR9A 2Q01A 4WF7A 2PRHA 3IIZA 3DC0A 1EJ7L 1W3JA 4ERAA 4PFMA 4QE1A 3S2CA 4DM1A 2QJMA 2J27A 1D8CA 3VMPA 4RZ6A 4UTTC 2VC6A 3NQ8A 2OSYA 1OFQA 1W54A 1WYIA 5DY2A 4NX5A 1UWQA 3VNIA 2NQZA 1JD9A 2CHOA 1XLCA 3PF3A 3D47A 3F7JA 2QCCA 3TAOA 2ZTKA 3VNKA 3UWEA 4FLQA 3TW9A 4H00A 4LYRA 3SR7A 3WK1A 3PWAA 3DDMA 1YE4A 1BXBA 1LT8A 3HGOA 1HO4A 4XO6A 3SUWA 2QEZA 1HW6A 3GW0A 3PWGA 2VC7A 4A21A 3WQDA 4JN8A 2XGBA 2H3BA 5CLTA 2Y2WA 3H4GA 2GGIA 2D3NA 4QR6A 3BG9A 4TR9A 2CERA 1VJIA 4LJ3A 5FKYA 2IXUA 2WC7A 2OX1A 3O0KA 3E74A 3KWSA 3W6LA 3OVQA 1K03A 3W7JA 2OZTA 2XU2A 1E55A 2GOUA 1XH2A 4FLSA 1ODZA 3BW3A 2W79A 3MP4A 4AD3A 4IPIA 2PLCA 4YHEA 4C5ZA 3R4IA 5EFDA 2Z1XA 4LC6A 4U31A 3GNNA 3HIJA 1A0CA 2PDUA 3TLQA 4IQLA 2Q09A 3W23A 4O1CA 1EP2A 2G96A 2HISA 4DJDA 3ELFA 4GI4A 4HJWA 7A3HA 3BMWA 1WBJA 2Z4GA 4KBXA 4PRTA 4OQVA 3F4VA 1J6OA 2I17A 2R24A 2NWSA 2GJNA 4CVWA 2WVUA 1H5YA 3UNDA 4PGLA 3PZNA 3INPA 3YPIA 3R43A 3UXLA 2O9OA 3WH7A 4N0RA 3AISA 1TR9A 2Y5JA 2Z0IA 2G97A 2XVNA 3LRKA 2G50A 4LBSA 4GJIA 1KXVA 4FO4A 3KBSA 2VQUA 4DI8A 3OBEA 3KDNA 1B3VA 1MNSA 4AAJA 2V6AA 1EWEA 4HMEA 3UG4A 5CEWA 4X0VA 4IL2A 4A6GA 3ANUA 1W9PA 2G37A 3TYDA 2PBGA 1V3IA 3PFRA 4WX2A 3L4VA 1K9TA 3ENLA 4UNLA 5EKYA 3AYSA 4IHCA 3SGZA 4H9UA 3CZGA 1W1PA 4AIEA 1DKWA 1XRTA 2ISWA 3W2JA 1UZHA 3GFYA 1E4LA 4HTYA 1GOXA 2D2HA 3FYYA 4HOXA 2CETA 3AFBA 1KM2A 3H23A 5AYZA 3GG8A 3QV6A 2VZUA 1RJRA 2DY3A 3UU0A 4HPHA 2QDEA 5M3WA 1EL3A 1JNDA 4AD1A 1J79A 5C0QA 1OWQA 3A6OA 1KV8A 1SUXA 1IXQA 1YBQA 2C19A 2X1UA 3DX5A 1YQ2A 5CAKA 3UPWA 3HJEA 2ZXDA 4H9XA 2V38A 3SCNA 3RCMA 3W7QA 4PMYA 5BU9A 2A7RA 3UGRA 1SFJA 3VDGA 1EJRC 1W17A 1UD3A 1CGWA 3TX9A 3GXNA 4P8VA 2VR5A 3U7VA 4PUJA 1E70M 1WXZA 2NQJA 4Z2HA 4ZR8A 3ES8A 3W25A 4XG1A 3GC4A 2YCLB 3A5FA 4P8WA 2X42A 5CPOA 1C3FA 3N34A 2C6QA 4AVFA 1XLFA 3VNJA 1JCYA 1NDVA 2BFGA 1ZJBA 3A64A 4C60A 4HCDA 2Z1VA 3NDOA 5HMFA 1AMYA 3KRZA 4EF8A 1A0EA 4HK6A 1TWSA 4LV9A 3GO2A 4JTAA 4ADTA 2BXZA 2HE8A 3E6EA 3HPFA 5HWJA 2QUMA 3O06A 3UYCA 2WHLA 2YCEA 4R9XA 2DIKA 2PZNA 4DZAA 5HJLA 1YKWA 4HA4A 3BQ5A 3E02A 3Q65A 2DT3A 2XH0A 3E3HA 2C8NA 3N4FA 1LF1A 1G7UA 3CAQA 4XAYA 3VO0A 6XIMA 3VIGA 2E6DA 3TVAA 4XSLA 3WDHA 1XCXA 5C55A 1N8FA 2REQA 2QPSA 1OB0A 1ITCA 1PUDA 4IMAA 1HT6A 1CTNA 2GQ9A 3ZWSA 4GVFA 1IWBA 1UQZA 3WF4A 4RCXA 4PB4A 1MQQA 4XKYB 4E2OA 4YTTA 2EG6A 3DFSA 2ZZ2A 1CXKA 2V67A 5K4ZA 3DFHA 3O6YX 4NAEB 5TIMA 1RQBA 1KBIA 3BMVA 4JOMA 4JFVA 1OINA 2VC9A 3KL3A 4I8YA 1X6LA 4WY0F 4PR4A 1PKNA 1OCQA 1UZ1A 4ZOCA 3CQ0A 3A47A 4FXRA 4H8HA 1OIMA 3W86A 2PLJA 4B4FA 3UXDA 3HFYA 3VE7A 3PC0A 4J2MA 2BOFX 3OGSA 4O19A 3OYXA 1X38A 5FL1A 3STFA 5CZKA 5C9XA 4GUIA 2XIBA 5EYWA 3PS7A 1QUMA 1MI3A 1E6XM 1OX4A 4GKLA 3LSBA 1UR0A 5D2VA 4ATDA 2VZOA 5A1AA 1V3JA 3FJNA 1XJBA 3AMDA 3GX9A 3LHTA 4NYUA 4ZOAA 1X8FA 1X6NA 1V93A 4OU1A 5AYIA 3RPMA 3VD5A 1XIEA 3M9YA 4KGLA 1TTQA 3ZMRA 3RLGA 2G4JA 4DZHA 3LPGA 1TPDA 2O56A 4JEJA 2F6KA 1OGGA 4K8GA 3SFKA 4TXEA 3MP3A 2VCBA 4YVXA 3MA8A 2PEVA 1FWSA 3NQ6A 4FIQA 2PLKA 1Q85A 4IWWA 1H62A 3IS4A 1XH0A 4I7WA 2OX4A 3H4WA 3AHVA 4MWAC 4AX6A 2I16A 4L4PA 2CNCA 2QDGA 1FWFC 3GZ3A 3N9KA 3VKJA 3NL2A 5DQPA 1UOZA 2O7SA 1U83A 3NDZA 3NQMA 4C1NB 2WMHA 1UH4A 4Q4KA 1MO0A 3T1GA 4EXQA 3I7SA 4UTFA 1RUSA 3ZT6A 4Z08A 1RJPA 4W87A 2ZZ3A 2WVVB 2AQOA 1C29A 5E9XA 1QI5A 4W5ZA 1F3WA 1FKXA 3B03A 2QHAA 1J8VA 4FR1A 1ODUA 3CUJA 2J7HA 2GZXA 2XYLA 4FNPA 4JIPA 4RL3A 5U7SA 1W1IE 4KEZA 1XLDA 4KS0A 3E0LA 5DFAA 1GVYA 5REQB 1C8XA 4PE8A 3EPOA 3PTKA 1TREA 1CLXA 3QF0A 4WSKA 1OX6A 4IXXA 3T6CA 2YZRA 4RV3A 1OCNA 4FXFA 5CBBA 4RDWA 1S2VA 1AMKA 1XSIA 2I14A 3RILA 5GNXA 1IGWA 3TU9A 4RE3A 4L56A 2YL9A 2NUWA 1GOOA 2B4GA 4GQ0A 3F4NA 5FJRA 1P1XA 4DNHA 3MUY1 3WDPP 5JQ9A 5CSRA 3E49A 3W01A 2DUAA 3LEPA 2CEQA 2WHJA 3C0LA 3DFNA 3LK6A 1K8ZA 4PBGA 4DB7A 5EGRA 1BXCA 5H6HA 5DMMA 2Z1WA 5AYYA 4ZEPA 1LOLA 3AHZA 1EO7A 5F4WA 1O1HA 5TAOA 1P0DA 3IACA 2EQDA 2F9RA 4A8IA 3W1RA 2WBGA 4LCSA 2NZLA 4S2BA 2NQLA 2QUUA 5A69A 3NO1A 2R1NA 2DVXA 3VUSA 3WMSA 1RBLA 5AFDA 1W9VA 4PMVA 4LB4A 4Q8OA 3HGRA 1IV8A 1HTIA 4J5NA 3LD5A 4S3JA 1SPQA 4Z2GA 2X8RA 4JY8A 1TSIA 1HF6A 1MFVA 3CWHA 4L80A 3VOHA 2XVKA 4HYRA 4NP7A 3DFPA 4W7UA 3T4CA 3MU7A 3V0TA 1XC6A 5D9NA 1KXQA 1RH9A 3GS6A 3RHGA 3P82A 2ABBA 4S1FA 3TNOA 7PTDA 2Z1KA 3EXSA 2FJUB 4BR1A 3MVTA 3GAYA 3NPWA 1HKJA 2YXOA 4RNFA 2HNHA 3ZOAA 3EDDA 3JS3A 5C2XA 2G95A 4LUIA 3WK3A 1JDFA 1N7KA 3Q94A 3L7RA 4AWTA 3TEVA 3I6TA 4Y8FA 3L23A 4CNSA 4E3VA 3H7UA 3VC5A 3S47A 3C2EA 4KMQA 2A3AA 4MHBA 4C6PA 3WKZA 1R47A 2GJXB 3QYSA 1NQ6A 2J25A 1RY8A 3QY6A 4JPGA 5HJYA 3GU1A 3EWCA 1ME7A 4YYFA 1ZB5A 1R87A 2W91A 2VFDA 3WUBA 1XRVA 5KZMA 4Y7EA 4LWWA 3CZKA 1AW5A 1LYXA 1K9EA 1RA5A 2PRLA 5JBDA 2Z24A 4YTSA 2R82A 4F8XA 3SGGA 2GGGA 5FIPA 3GY1A 4ZMGA 2OCZA 1H50A 3GBDA 3C3UA 3UZWA 3CIXA 1VFTA 3W72A 4EXAA 1QXLA 3NQDA 3KOFA 1U30A 3GZAA 4U2ZA 3QZ6A 1FCUA 4L9ZA 3SQSA 1AW1A 3PPHA 4Q22A 1HJSA 3M6YA 4WDXA 1HZYA 1HQTA 1LOQA 1WBHA 2NV2A 5K4XA 3BJSA 3SQMA 1RJQA 4LUTB 2RJGA 4HZMA 3TTSA 3KTXA 4EPDC 1QPKA 3W1NA 2DH3A 1GUVA 2DUZA 1P6WA 1GQKA 3EX3A 3AYVA 1IWPA 1O95A 1IT7A 3MHFA 2D1ZA 3LNMA 2Y7DA 1KNWA 4HMNA 3TQ0A 4JFWA 3VGHA 3VVGA 5DCDA 3W7LA 2ZADA 2WC4A 4GXMA 4L6OA 1RP8A 4YJ5A 4EPBC 3GDTA 5RUBA 1EIBA 3CV6A 3G18A 2PE4A 2FPYA 1HJXA 1YXYA 2E68A 2DORA 1M04A 3S2NA 4A35A 3O0FA 1CENA 1CXLA 2ALRA 4C1KA 4IG2A 3IIPA 4X0NA 1VLIA 4ZQOA 1KV5A 4V1YA 4O57A 3GIPA 5C5YA 1E4IA 2QCNA 1YDYA 1A5SA 3PWIA 5FEWA 3V0SA 2CLHA 3DG6A 3CAKA 4O17A 3CEPA 5G1MA 1C8YA 5E0KA 3ERPA 2ZYFA 3BGGA 5G2HA 5C9ZA 1H0IA 4KCUA 1FWCC 3BICA 4JS3A 5A95A 5CPNA 2GVEA 2QUNA 3B0PA 3KHJA 2ZUNA 1XINA 3IVSA 4IJBA 3T05A 4FOUA 2PDQA 1Z44A 2P1FA 3AMKA 4WK9A 2Y5EA 1R6WA 1QBAA 1VQTA 5KMYA 2HK0A 4UWMA 2Y85A 4ACZA 1OZQA 4AF0B 5EMYA 5J5RA 1RCXB 3AYTA 3E0FA 3DESA 1H5VA 1NEYA 4QEEA 4XKMA 3BPWA 3UQNA 1B5TA 4B16A 5E0CA 3CQHA 2WBKA 2X05A 1HFBA 2WMIA 1I0BA 4WKAA 2DZTA 4HJFA 1E6NA 4S3DA 2GVLA 5KINA 3QKEA 2CYGA 4O0QA 4LEQA 3NR0A 4LSBA 3FHAA 3WLTA 1MW0A 1V0KA 2EPHA 4C91A 1GOKA 4LUSA 3PZ9A 1DWGM 3VC6A 4GNKB 2YL6A 5EMMA 2OQYA 4FB7A 4BFAA 3AS1A 2CHRA 5LIUX 3NXFA 3WQVA 1HKMA 1ITUA 3GG1A 2O0TA 4Z1BA 4F0RA 1HGYA 4DWDA 4NZ4A 4QJ5B 2DZVA 1K4GA 3OODA 3WUGA 1N8WA 1KTCA 4B92A 2E7FA 1EH9A 1PV8A 2YA1A 3UY8A 1WV2A 1LLOA 1SO4A 3GHTA 5GJMA 4WGHA 2CLMA 3TV8A 3V18A 1D9EA 4WSJA 1BQGA 1QK0A 2ZE0A 3OZOA 2PDGA 1O5KA 2ZKMX 1G4PA 3QOMA 1JCJA 1KFWA 1SO5A 4Z1YA 4FP1A 5FCZA 1AJ0A 3U7BA 4J2PA 3L68A 4PB3A 3TXZA 5DELA 3LDVA 4A05A 1PAMA 1FH8A 4DN1A 5PTDA 1XICA 2YA2A 3VGEA 3MKKA 4FF5A 1V7YA 5DCBA 4YWIA 3RN6A 4Z0JA 3TSDA 2BY1A 2W5FA 5CGQA 3WNOA 1UKOA 2PDIA 4I90A 4JTQA 3KP0A 3FS2A 5FF2A 1ECEA 1R0MA 3N2MA 4BF7A 4KWUA 4PCTA 3S0CA 1UR2A 3QR3A 1QDSA 2BB0A 1V77A 2DZPA 1GJPA 4DZIA 1UASA 2W61A 2A6NA 4WR3A 3GTIA 3H6OA 3GK0A 3SBFA 5AHEA 3TW6A 1Q7MA 3IPWA 3IV8A 4V1XA 3KUMA 1XGZA 3W87A 4MWAE 1FWIC 1WZLA 4F2TA 1N8IA 3WJYA 1VH7A 3SIZA 4H7ZA 1A5AA 5GNYA 1KKOA 1B90A 1C90A 2PRMA 4QDMA 3EMQA 1BYCA 1E6QM 5IBXA 2OEMA 2RDUA 3GH7A 4DX3A 4RE4A 4ZQPA 1SGJA 1UYQA 1EZWA 2AAMA 1PKMA 4OJYA 1RLCL 3IARA 4G7EA 2HJPA 1A5BA 3MS8A 2ZRVA 4YXGA 2HZGA 4LCQA 1ZJHA 4G6CA 5XINA 5A94A 1FWGC 2A1YA 5A6BA 3SZ8A 4ONVA 3EWBX 4MJZA 1BKSA 2E3ZA 3K2GA 1UP2A 4DEFA 3ABZA 3G1RA 1CPUA 3W7MA 4AXKA 2RFGA 3EEGA 4ADUA 4JTDA 5CZSA 3GG7A 4C6FA 3LPPA 4M56A 3BO9A 3W84A 1UD6A 3S5YA 4C90A 3C61A 3EDFA 4MM1A 1BF2A 2E9LA 3HGJA 2Y1HA 3DGBA 3PZMA 5AHFA 1MYRA 3WEMA 3FAWA 5LHFA 1KXHA 3IAQA 2YDAA 1XIDA 3QZAA 1CECA 1SMDA 4OZOA 4ZO8A 5A6MA 3GR7A 7ENLA 4HSNA 4WXZA 5CLWA 3W0KA 4UOZA 2PP3A 3CZJA 1S3HA 4HYVA 1H7OA 3IJ9A 4BEQA 1FWBC 3P8JA 3RLHA 4DI9A 4DO4A 2VD8A 2FDSA 1DXFA 2V2HA 3PB0A 4WKHA 1VEMA 3EX4A 4ZB5A 4AZCB 3VD4A 3TR2A 3WLQA 1ISVA 4AIUA 2XN1A 3TCEA 1DQXA 3NG3A 4QE5A 1TV4A 2G4FA 3WQ8A 3GWQA 1WXJA 4Y96A 3S9IA 4UIOA 3PBVA 1DHPA 4J3TA 1EUNA 1F05A 3FA3A 4XAZA 3N9SA 3W7PA 1FCQA 3GQYA 4BS0A 4AISA 2WNWA 3KCJA 1X96A 4QJ1A 3SUSA 1HJUA 2WCAA 2PTDA 2XWDA 1DEDA 3O15A 4UZUA 1Q2SA 1ZZMA 2J7DA 4H2CA 4XTIA 3PK7A 3WQ6A 1FP9A 1JZ4A 3MT1A 4GKTA 2CLKA 2V0TA 7REQA 3R2GA 2C14A 4OT7A 3N12A 3KL0A 2J74A 3SCPA 5A6JA 1SSGA 3F5JA 3CPUA 4PUWA 2NSXA 5DMLA 1R3TA 1YBQB 3DYOA 3TTEA 4N02A 3RU6A 4HZ8A 4Y8EA 1JYXA 3VD9A 1K8CA 3AOFA 3ATYA 4G1NA 2QCMA 4QBXA 5HUPA 2FHFA 2DVUA 3BC9A 3MW7A 3H12A 3ZT7A 1ITXA 1R38A 2YBUA 4QLLA 3UCCA 3L4YA 2WKJA 4ZVJA 2ISDA 3UZZA 3EX2A 2UY4A 3ITGA 2GLKA 1H7XA 1E9YB 1ZRQA 1JFXA 1JL8A 1TV8A 3OLGA 3NSNA 4MB3A 4XBSA 1KR0A 2YB4A 3LY0A 4RX0A 3HQ1A 4D6GA 3WF1A 3W7OA 4XO7A 1E0TA 1DJHA 3KRSA 3WQFA 1OK6A 2C16A 1XBYA 3CUXA 1PXGA 3H22A 4YHGA 3WUEA 3OA3A 4TQTA 2XN0A 3CB3A 3QMTA 2YDRA 5IDIA 3S2MA 3OG3A 2XZ9A 1J2BA 3EAUA 3AHTA 3T44A 4GGBA 4K1WA 2V5CA 3KW3A 2P76A 2DH2A 2XFFA 1J01A 2VYOA 4QE4A 1Q8JA 1WDPA 1UIOA 1BWKA 2BMBA 1O60A 3MMWA 1QOPA 2PBOA 2DIEA 4UC5A 4LY8A 1VFSA 2WSRA 1OGBA 1JUKA 3SRKA 2OWWA 2ZC8A 3APTA 4IMDA 4LF2A 4AY8A 5LZLA 2REQB 1XYLA 3VKDA 3RYSA 4MDPA 1PZ2A 3B0UX 1HUVA 1UG6A 2PF0A 3VPLA 4ATWA 5FACA 1Z42A 1UR8A 3U3HA 3W7EA 4NXSA 1UC4A 1XYBA 3H2MA 1XDMA 2FGLA 1BXNA 2BHYA 3AXKA 2BDQA 2OR2A 1HIZA 1E56A 4P7RA 1QPRA 3CASA 4F0HA 3G0XA 4GYPC 3GR4A 3WNKA 1MZHA 3ZR5A 3AIQA 3VOJA 3QFWA 4UTUA 1XFBA 4KGJA 1JZ2A 1SJDA 1Y5VA 1A3XA 2OO0A 3AZSA 3BAWA 4MFDA 1T8XA 4LNYA 2FVMA 5B7ZA 1F9CA 3OGRA 4Q7IA 1VRDA 1SFTA 3P80A 4P7NA 3EWYA 4NY2A 5FJUA 2GQAA 2VFFA 2XWEA 2QLYA 3DFQA 3CYJA 4MYXA 3U4AA 1ISYA 3LZ5A 3BDKA 4YYCA 1HVXA 3AIEA 1S5MA 2UZ9A 4W89A 1Y8BA 1DJNA 2V2CA 1OX4B 4O50A 3ZSTA 7CGTA 5I02A 5G4HC 1LRQA 3V16A 2AAAA 2GFTA 4X60A 4AZIA 3ITVA 1PTAA 1P0BA 3VDHA 4B2DA 4L5ZA 3WFZA 4LY4A 3OQ8A 4XZMX 3WJZA 5HNUA 1W5PA 3RPDA 4XVDA 4ZE5A 1AQ0A 1TPVA 1LLWA 1VB9A 4JQ3A 1IEWA 3LI0A 4IP5A 2WWCA 4PMJA 4PCSA 1KRAC 3ES7A 4LOCA 4O4VA 3GDLA 3WYZA 1TR1A 2QF7A 1Q63A 3IK4A 3AS2A 3LXBA 3VCRA 1VFHA 2ODOA 1R2SA 3DUGA 1V51A 4UQEA 5EMKA 5LGZA 3D46A 4AG0A 4R88A 2YLLA 3VIJA 5D38A 4GYFA 1CXEA 1TJRA 1EJWC 1LP6A 3J7HA 1TPFA 1QI4A 1F76A 3W7GA 5HWNA 1ZFJA 3SCWA 3WH9A 4MOZA 1OF6A 3BV4A 2E25A 1FXPA 1FWDC 3KOXA 1EEXA 4A3UA 2QJGA 5I7GA 3CIVA 3UG3A 3QRHA 4NZJA 1ZENA 1EQPA 4MAZA 3VGFA 1UP0A 1PYMA 1G67A 3GAKA 1C91A 2A0NA 3UR8A 3UZYA 2GDVA 4D9PA 2AQVA 3LGDA 2B0MA 3LCWA 1X1NA 3P0XA 1Q5MA 2CLLA 1J0IA 4WQ6A 1W1VA 4CD8A 4O13A 5DY3A 4H6QA 2JALA 4ECLA 5FJPA 4PB5A 1H51A 1UD5A 1V6TA 4F4RA 2WVSA 4WJXA 4ML9A 3B0YA 4C6EA 1GVEA 3EKLA 3M6DA 4HMDA 5E9AA 3BAJA 3AZRA 1OJXA 4BK9A 3E9AA 4AU0A 1NWSA 4TMBA 1D3CA 3N3MA 5JBFA 4ENLA 3PJWA 3GTFA 2VDGA 2OB3A 2I57A 1FWEC 5LNUA 3AALA 4GI8A 4QAWA 5HR7A 3BJFA 2Z28A 4RW5A 3MO7A 1C9DA 2WZHA 3A3HA 4M7SA 3BAKA 2YXGA 2WANA 3IRDA 1EQCA 3REQA 3QLLA 2Y8KA 3R1ZA 5K3VA 2GUBA 3G2GA 3MDUA 2J7EA 4W9TA 1XDJA 4ZCWA 2V3EA 3WUFA 4UUIA 5C70A 3K4AA 3U2ZA 2CKRA 1V6VA 4JZ5A 4WUIA 1JDCA 3BV7A 1XLAA 1C92A 1SJCA 2YCIX 3CAWA 2Y70A 3M0VA 4LUYA 2QVHA 1NF7A 3PZUA 1OD0A 3OIXA 4DPQA 2C18A 4KWVA 2CXEA 3QV7A 5G1YA 1EC9A 2BGQA 2EG7A 4XQ6A 3G0UA 4C6DA 4F0KA 2Q3RA 5LGXA 4GVHA 4IGHA 3KOZA 3NQAA 1XGDA 2AMGA 2VM8A 3AXIA 1FFRA 3GIYA 3S1XA 2WB5A 4O1DA 3DERA 1W1TA 2NT1A 3PAOA 2Y61A 4R5EA 3QV8A 3CB8A 4BWLA 1GORA 4AY1A 2P0OA 1P43A 5A2BA 4NZ1A 1CDGA 2C0AA 1Z7AA 2WMFA 3NEHA 3CV1A 3CJPA 3VABA 1A3HA 3W71A 3ICJA 4UFKA 5AVHA 4CNUA 2NXHA 4L9XA 3UWQA 4NI3A 4KERA 5AC4A 4CN1A 2Q8ZA 2GVYA 1DE5A 1LUCA 1N2VA 4JHOA 1WNOA 3UD6A 3RFAA 1AH0A 4KCVA 3QKZA 4PMOA 1VBHA 3EPNA 2RUSA 3WN6A 4MNJA 1EB3A 2CZ5A 5KSWA 3I3BA 3D3AA 4O1AA 4AZ7A 3TJXA 4JTEA 2YKKA 3NDYA 2QZRA 2ACSA 5HR6A 4H04A 3C4UA 2D2OA 1N55A 4O14A 1GHSA 2ATSA 3QV9A 1DOSA 4QROA 1R86A 3BZGA 2ZWYA 3WIJA 3L5MA 4N4QA 1W9BM 1XQKA 4QAIA 2D23A 1EBGA 1TPUA 3UPMA 2VTFA 4JTFA 3A9IA 3WDQA 2EPOA 4W85A 3QZEA 1YXCA 1EIXA 3TIMA 4C5YA 4HNLA 3AHXA 1LORA 3TYAA 4Q6XA 3BAIA 1JCMP 2ABAA 5G1TA 3MMDA 3CIWA 9RUBA 3RO8A 2IW0A 1VFLA 1OG0A 3GVRA 4FR6A 1EJXC 4CQBA 2WM0A 4F48A 4H01A 5HANA 3KDOA 3SAZA 3DHDA 2F6UA 3D3FA 3ID7A 2G0WA 2Y88A 3MP5A 3WMCA 1YDOA 4C6OA 2QUVA 5IFPA 3KE0A 2FZMA 2X2YA 4IG2B 4IP4A 2BZNA 4WJ8A 4UTJA 4GZJA 1K9DA 1RPKA 8CGTA 4AZHA 3EGJA 3QTGA 3ONCA 1J5SA 2A3CA 1SMAA 4XK2A 3ZLGA 4GFSA 5I77A 2V69A 1BWVA 5IM51 4Q6JA 3WNNA 3LZ3A 1AL7A 1XWYA 5KEZA 1I0DA 2GPTA 4IMGA 4FAMA 3QC3A 2JKPA 1B54A 3N2BA 3LCFA 4XUGA 1BKHA 1TPH1 3VNLA 4YN5A 1J4EA 2XIMA 1P48A 5I3DA 1L6WA 1TV7A 2HS8A 1I1XA 5F4SA 1WQ5A 4ACZB 5AB3A 2ALDA 2MNRA 1W56A 3MB9A 4O1EA 4HU8A 4KEUA 3SB0A 4O16A 4H3DA 4IMEA 3O2LA 3W2LA 3ARUA 4O12A 1K3UA 2CBVA 4PMNA 3BW4A 2CZVA 4FNUA 5AECA 1XYMA 1IZKA 1OFAA 1PWMA 3OP2A 2WMIB 4TIMA 1LL7A 5KTLA 1OFBA 2PTXA 1S2AA 3QR0A 4O54A 3T8LA 5A6BD 4AX7A 4EX4A 1XLLA 2Y0FA 5HDRA 1LG1A 5IHRA 2J24A 4LUSB 3N11A 4TOQA 4JIEA 5H8UA 1F6YA 2QCHA 1GONA 7TIMA 3MVIA 1TUXA 1ZBCA 3UJEA 5F2GA 3BUVA 2GWGA 1UCWA 3GR8A 1ZAJA 4A3YA 5HQEA 3LV5A 4KFNA 2P3ZA 4PMQA 3LM7A 3LV6A 3G1AA 4MVAA 4D2JA 1WDRA 4QDWA 3N13A 3M44A 2V63A 1JUBA 3OTRA 3KS6A 1XR2A 4AD0A 4WHBA 2FHBA 4LCRA 1DE6A 2EAWA 5FJOA 2BODX 1O5RA 3VTRA 2JGYA 3WBEA 1JVNA 4GG9A 2TPSA 4L1WA 1F2JA 4QISA 4UQAA 4Z1DA 4JFUA 1PIFA 2CC0A 3QW3A 1O94A 1S5VA 1EGVA 4IGMA 2J62A 4ZQNA 1WKYA 3GRIA 4E3TA 4CU8A 3GYCA 4N6FA 2WNZA 1JZ7A 1TJ2A 3VOGA 2XH2A 3DG7A 4DPPA 3W38A 2WMGA 3P14A 2X09A 3NQ2A 4ERGA 4HU4A 1KM4A 2RGLA 2AQWA 3TWBA 4FALA 4LS2A 2RDWA 4WZHA 2Q02A 4RW3A 1FHVA 1KQZA 3WL0A 3DG3A 4RNHA 3F2DA 1MVYA 3UZXA 4UFMA 4XISA 3VD3A 1R2TA 3M5YA 1J6PA 4MLRA 5I00A 2ADAA 5C6MA 4JR5A 1QFEA 4ZE4A 1XSKA 9XIAA 3WEOA 4EP8C 4PUNA 1YRRA 4I9TA 2I9EA 2QV4A 3SUTA 1AH3A 2CWNA 1CWYA 2WKLA 4IM4A 1BSIA 1ADSA 2WZTA 1QRQA 3TYEA 1YTEA 2HBXA 2A3BA 4DUWA 2WC3A 2A7NA 3MHGA 4G7EB 4HPGA 4LS1A 1Q6OA 4ICCX 5J5DA 2OT0A 1BVZA 1EUAA 1FFQA 3ZXWA 3DAQA 3VK5A 4M6PA 1XUZA 3UG8A 3U2EA 2QJHA 1PCKA 4M29A 3ZLFA 3SQLA 2I1OA 3E5BA 4EOUA 2QDHA 4ZB0A 2WLYA 1TWDA 3HMCA 4OVXA 1XIJA 2VC5A 1S5NA 2VHLA 3NM3A 1ZNNA 1Q6GA 1E71M 1V79A 5HK4A 3SCVA 1Y5XA 2GOKA 1AQHA 1CZ1A 3EA3A 2BASA 1E6RA 4J40A 5HNTA 1K9FA 1S3TC 2ZDRA 4FZIA 1CGUA 2V81A 5F7UA 2VX7A 2GK1A 4W7VA 3NZRA 1K8YA 5A8OA 3B0VC 1TVPA 2DV0A 1LROA 4JN7A 1CB2A 1IGSA 3LBMA 1B3XA 3Q37A 2LLEA 3ARPA 4Q7NA 1TVLA 2Y63A 3VGBA 4C6LA 3EXTA 2JKAA 2Y5SA 3TYUA 2X0SA 3ARSA 4IFRA 4XV0A 2ACQA 2YBTA 2DT0A 1MW3A 2NVDA 2ANUA 6REQA 1SZEA 2XIJA 2D22A 3FJLA 4IH3A 1BRLB 3ZVHA 1TE6A 3P84A 3TSMA 1F73A 4XZLX 5IXEA 4JQ4A 5A6TC 4A29A 3DZ1A 2E5CA 4JTGA 5HOSA 1V6XA 3MCNA 2R94A 4B5UA 4V27A 1A3WA 2G8ZA 4Q4OA 4XBJA 1R85A 2ZXAA 3ABQA 3BURA 3ZFHA 1MRAA 4N9EA 2P8BA 5JIPA 3BK0A 3GHUA 1LT7A 4ERIA 3TZFA 4EPKA 4V33A 3IJIA 1ESWA 3NXLA 3DYMA 3M0IA 5H91A 5DXYA 5IOBA 1W5NA 3PZTA 1NP0A 2ACRA 2ISSA 3P93A 3Q67A 1LBMA 3EWXA 3THQA 2OZ3A 3U9IA 1SW0A 3M5XA 3GXTA 3NEVA 1R9XA 3FKKA 5FEPA 4Z42C 3E0VA 3A4XA 3M0ZA 1WZAA 1R3YA 1NFPA 1GOWA 4L64A 2ZICA 3IGUA 4C6QA 1QPOA 2QT3A 2XVPA 3GYEA 1K6WA 1P0NA 2RGMA 3HBLA 3S1UA 1A5OC 1MDLA 2GQ3A 3SW6A 3GH5A 1O66A 1E1FA 3II1A 4B2DD 1A50A 1FY6A 4C7DA 4UNKA 3AMCA 2PCEA 4G8TA 2PGFA 3UBPC 2VENA 2HPMA 5DX7A 1N82A 2HK1A 2C0HA 4DRSA 1C8QA 1LQAA 4C6KA 3NQCA 4TVDA 4OBTA 4L4LA 3I4KA 3U2OA 1J10A 2F84A 1R3QA 3E1F1 4BI5A 1CGVA 5BCAA 1NM9A 1F61A 4OBRA 4C6BA 3HM7A 1NOWA 2DDXA 4NAFA 5AKQA 3TN6A 3WQ4A 3PBUA 2Q71A 3B0XA 1VEPA 2WLZA 3NZQA 4AIOA 4MJMA 2VRQA 3QGAC 5FSDC 5FOOA 1KTNA 3LS9A 4L1XA 3NIYA 3WDRA 2E8YA 4GY1A 3URAA 2QCEA 1Z3NA 1MXGA 3ZIZA 4FNRA 1YXDA 5BWFA 4QFUA 4QJ3B 3H2FA 2VOMA 3E2QA 1E9IA 2TAAA 2FPTA 3GG0A 3FSUA 2VX5A 4XSMA 3PPCA 1EP3A 1UKQA 1D3GA 1E0UA 3KBMA 3KCOA 4X2RA 4LALA 5C54A 4F79A 1XLKA 3DH7A 3BLPX 1S2TA 2GJRA 2G3FA 4LFYA 2A4AA 1M41A 3GC5A 3T78A 2PGWA 1XG3A 5BXRA 4GRSA 3NYZA 2E9MA 4WXYA 2SFPA 3T4WA 3T42A 1XG4A 1FVPA 3ZR6A 4DUXA 2XM2A 2WM1A 3TOPA 4US5A 1W8GA 4O53A 4PEKA 1S5WA 1BQCA 3THCA 3LTYA 3T07A 3QBUA 1U22A 2WJDA 2D69A 2P10A 2QAFA 3BSGA 1CLKA 4DYKA 2ZRWA 1UJQA 2WOQA 4WSHA 3MYPA 4M6QA 3H53A 3T0BA 3GW3A 4NL1A 1YLVA 3AU2A 1SJBA 1P1MA 4ZTYA 3UP8A 4POCA 4IJCA 3AAMA 1FDYA 4D6DA 2YDQA 3AXXA 1ME8A 2ZZ7A 2DZXA 4HPXA 3FJ4A 2HSAA 4GPNA 3IANA 4HK5A 4F0SA 5D09A 4XZIA 5DXXA 9XIMA 4CEXC 1HKKA 6ALDA 1S1PA 1E1EA 1M7OA 1FCBA 1GVSA 4H9YA 2HEJA 1B1YA 3AIBA 4ZFMA 4EAYA 1CBGA 4IX0A 2NT0A 3IJLA 3LLXA 1CLVA 2BOGX 4MDOA 3HQOA 1FWNA 4E8CA 4EANA 5GQBA 2DSUA 4J7RA 1XYAA 4MY8A 4XBKA 3E2SA 1F3EA 1U5VA 3W2MA 3C0QA 3W37A 3OU8A 5F1UA 1W0MA 1S2CA 3WDJA 2NUYA 3L66A 1W6TA 2B7NA 3MWCA 4Q7BA 4JTRA 3C86A 2FMOA 4XD5A 3SRDA 3CZ8A 3R79A 5I09A 4QG8A 1IZJA 1POKA 3O63A 1ADOA 2G41A 1MRQA 4UFLA 2QCFA 3EOEA 3BVJA 1UP3A 4S38A 3KTSA 4DJDC 3G3DA 3TJLA 3USBA 3WX7A 2YCKX 3QXBA 2FZDA 5HMDA 4OUEA 2HROA 1KKRA 3AZTA 3DFTA 3SDOA 1FQ0A 6CGTA 4YLWA 2Y89A 1PO9A 4PRRA 4HPNA 4IQDA 2CFFA 1GYLA 3N9RA 2PFHA 1O5XA 3F03K 1SZGA 3EB4A 1MUWA 3MUXA 3ORWA 3UWWA 2QV5A 3L4XA 3REQB 4R3UA 4QP0A 4GHRA 5KZ6A 1F8IA 2XISA 2DZAA 2WSPA 2DW6A 3PM6A 3N14A 2E5DA 2XVLA 1IR1A 4B15A 4JAWA 1NWTA 3TWAA 4IIFA 2PLMA 4WEVX 5TD4A 3O3RA 4XZ9A 3TMQA 1XYCA 3MCMA 3M43A 3C52A 1RXOB 4URIA 3WH5A 5FESA 4GO9A 2J88A 4TUFA 4C1LA 1H41A 3RMEA 4M81A 3M0MA 3TROA 3WQWA 1PIIA 5B80A 2VRJA 2WHMA 3OG2A 3SY5A 1GNXA 4U28A 2F6XA 4GIRA 3CC1A 5LA2A 3W1LA 5BROA 3DI1A 3DHFA 4O28A 1W3NA 2J7GA 1UROA 2EPMX 3HN3A 2OOFA 1OYBA 2V9DA 1WB0A 4GIAA 2CXGA 3KOWA 4EPEC 5E6YA 3W7KA 5EMUA 2X1TA 4U10A 1R5YA 1L6FA 4DWSB 3W1UA 2VELA 3LU2A 1IYXA 3AO0A 3PSVA 1WUFA 4L9YA 3SRHA 3U0HA 2YDSA 2POZA 4B5VA 1EPVA 1KFLA 2V3GA 3UXAA 4LYKA 3WLMA 1VS1A 1XD0A 3NSXA 4OGZA 4E8DA 3T09A 1P6BA 1LUCB 3VZZA 5H2ZA 3RK8A 1YIXA 5DO8A 1TPB1 1UBPC 3CH9A 3M0KA 1RD6A 4LXFA 3GLCA 2ZZ4A 1H0GA 1E3ZA 5D32A 4AW7A 3VNZA 2PPGA 3KHDA 1KCLA 3VDAA 1W5MA 1L2UA 3MUIA 1TMHA 3NOEA 4P8UA 4ZENA 1F4AA 2PDPA 4QTGA 4AHPA 1C9WA 1WCGA 3CT2A 3ONBA 4LGXA 1TTIA 3MSDA 2QAPA 2ZCGA 4J35A 2OG9A 1KWKA 3IVTA 4F2BA 3CPGA 2GDUA 2BX7A 1LDCA 1ALDA 2OEJA 1GVRA 2RDXA 1PZ3A 1F74A 3WEZA 1JCXA 4XZBA 1TUFA 3GHRA 3R25A 3LMYA 3M64A 5K9CA 1UUMA 1LBFA 4IT1A 4I5UA 2CBJA 3FV9A 1OZMA 3M0HA 3BCDA 1NWUA 4S3BA 3VOCA 3P0WA 4PA8A 4E0CA 1QATA 4TVUA 4EE9A 4ZA0A 3T8QA 1HKVA 3AWOA 3RR4A 4CQ8A 3A4JA 4KCTA 1UIPA 5C2CA 4PUEA 2ZOXA 2ATMA 3NQEA 2IPJA 4KFPA 3W1MA 3WMLA 1MZRA 3QHOA 4JTCA 1C7TA 2V5LA 1RSCA 3EDJA 1MW2A 2R9RA 3FN9A 1ZUAX 3RRXA 4TX9A 4RPQA 5D05A 2D3LA 4JQ2A 3N73A 2YJQA 4EVZA 3N6HA 3K8LA 2YA0A 1UZ4A 4MWAD 2PWHA 5D9MA 1YEYA 1W91A 5MF5A 2PI6A 4GISA 1XBVA 3ME3A 1EDQA 1EJUC 5ENLA 5A6AA 3W2NA 3CHFA 5FD0A 1XLHA 3IUHA 4MLJA 3HG2A 1JZ6A 1A5CA 2ZX6A 4GACA 5BU6A 1JDEA 3CTLA 2WNNA 2NX9A 5FF0A 2O55A 1IT0A 1CI1A 3EB2A 3CBWA 4NJIA 4GYPA 4JQ1A 3CQKA 1DJQA 2BGSA 4GH1A 3VNDA 5D04C 3N2TA 4LVBA 5D33A 2I56A 2XFWA 2IQ0A 1WO2A 3PAJA 4UZSA 3N17A 4WLCA 5D2TA 4Q8WA 4LAUA 3V75A 3GUGA 4FMVA 3OLEA 3NWRA 4PMXA 5FEXA 1QNPA 5A8MA 3PP7A 2OODA 4ZO7A 3QTPA 3WQ5A 2VVSA 5M2FX 3AMGA 4YTQA 1A5MC 1PJ9A 5J8LA 1T0OA 1P0KA 5I3IA 1TJ1A 3R0UA 4O10A 3FXGA 4UQ9A 1SSDA 2J9ZA 1GG0A 1C8VA 3STCA 4CQ9A 3BCJA 4AMAA 3OQEA 1HN1A 5LNSA 3WZ0E 2V5DA 4N7QA 4NSBA 3CGTA 4KETA 3KBWA 1VLWA 4UOJA 1UMYA 1EHAA 3QQ0A 3UETA 3DFOA 4MJ2A 2QULA 3DN5A 3LPFA 2BNJA 1XKYA 4JYDA 6PTDA 1TELA 1EWDA 3NVDA 4EF9A 1T8QA 5D8WA 1J9YA 4GQQA 1OFPA 1GQNA 1A4MA 3SCSA 3BOXA 3ABOA 2FHCA 1TCMA 5CJNA 3MQTA 5I78A 3QLDA 3V7PA 3H55A 4RZBA 3FEMA 1IXOA 1Q6DA 2E4TA 4H8NA 3KS5A 3PJXA 4A3HA 3HGSA 2EBNA 2DZWA 3FDKA 3W9ZA 5A2AA 2FDMA 3CL6A 4M6UA 1XX1A 1GZ1A 3CT7A 3OIHA 1DTNA 3G8EA 4HSOA 2EPKX 3LX9A 1NSJA 4QXIA 3P2VA 4GINA 5CJMA 1W9UA 3G6MA 3PN8A 3N2CA 2XUCA 3WY1A 2WPGA 3DENA 2FVLA 1KRBC 1OADA 4A3RA 5JIWA 1FWAC 4MY1A 2J7CA 5HAOA 1NAL1 3H21A 4LT9A 1KGUA 2X30A 4CQDA 1T99A 4GBUA 4F0LA 1B9ZA 3B9NA 5I3KA 1UZDA 3UERA 1F6PA 3TYZA 5L6UA 2VCCA 4DJEC 2XGZA 3CQIA 2VOTA 1UPMB 1L2QA 2WCSA 1OIFA 1BG4A 4C6CA 3HPAA 3GKAA 5FSEC 1AZ1A 4RK8A 3B97A 4H8VA 3VOIA 3MO4A 5CPTA 3EBVA 3FVDA 3QSRA 1L0PA 2IQDA 1NWRA 1KM6A 3A9BA 1IE7C 2I7GA 4HHHA 4Q8QA 3WELA 3W83A 1I45A 1Y65A 4Q8TA 3NNTA 2BY0A 2GK1B 4N9DA 3K46A 2FVKA 3DCPA 3QH2A 3WLNA 1OT1A 4JKMA 1D2KA 4WDWA 3KZSA 4G9PA 3RAOA 1X1ZA 4NNBA 1JD7A 4IL0A 5H8MA 2JKEA 1ZP3A 2PURA 4FIRA 3W29A 3QR1A 1T7LA 3PULA 4YVPA 2W66A 5AC8A 4RXGA 3PBGA 1I9CB 2Z7KA 2J7FA 3DU0A 2WMJA 1UUOA 2GVJA 2ZIDA 1R3WA 4WJEA 1NOFA 5AYXA 2DT1A 1NY1A 3ZVHB 3MY9A 2WSYA 3S9ZA 4BF5A 3N4EA 1W2VA 2ZDSA 2VXNA 5D02A 1S5TA 5LNWA 4HNTA 4AEOA 1FHUA 4LYPA 1QOXA 1CCWB 2WJFA 1TPEA 4UQCA 4XD3A 4ES4A 4O1FA 2H3DA 1VIZA 2VMFA 2PWVA 1XFCA 2IKHA 4R27A 2VR4A 3HG4A 4AD4A 1R46A 1QASA 1JF5A 5HATA 4PSPA 4UFHA 1R3VA 3GTHA 5IFTA 4GVIA 3RM8A 1BD0A 1K1DA 4JTHA 3WF3A 4MZYA 3GDMA 2QW5A 2ZUSA 1U2YA 3W4RA 4AWSA 3WLKX 5HPOA 4GVGA 3A21A 1PS9A 3WLHA 1QNOA 3TQVA 2W4XA 1J5TA 4RNIA 1ZQ5A 2ISVA 4US5D 4AZ6A 4M1BA 4GC3A 1TJ0A 4F40A 1GT8A 4IQEA 1B31A 3EOLA 4L4OA 3R13A 3P8IA 2ZVRA 5A6KA 1TKKA 3H26A 5C9WA 5D4YA 3TN5A 1XLBA 2IKGA 4GCAA 4C7GA 3IAPA 2F38A 1TIMA 2ZA2A 5EY5A 3ITCA 3M0YA 3W1XA 3ARWA 2P53A 4LU0A 3OEXA 1L6YA 5LIXX 3OZPA 3RG6A 3M0LA 3QQ1A 5I0DA 3APGA 3LA4A 1YNYA 3I68A 4OHQA 2VI0A 4FNSA 4G2DA 2WVTA 2PUZA 2H6RA 4FOJA 5TF0A 3WLSA 4ZOBA 1DVJA 2F61A 1S46A 4CD4A 1R2RA 4ORIA 2W92A 1B57A 4HHLA 3B4YA 4DELA 3APYA 3KCLA 3FHQA 2QR6A 1ZAIA 1PX4A 1X6UA 1GQJA 1DWHM 3GVVA 3NZPA 4W84A 2A3EA 1F3TA 3GXFA 3WNPA 4NAFB 2ZWZA 4JL2A 2VNCA 4UQDA 1JPIA 3ATZA 1J0YA 4NZ3A 1SW7A 2B81A 2DIJA 3S1GA 4F0MA 2PTWA 2NQ5A 1CIUA 4IGSA 2VGFA 4LVGA 3H7RA 1SZRA 5M17A 1BF6A 3L2LA 1KW1A 5T8GA 1UKTA 1M01A 4IP7A 3KRUA 3W26A 4ZTXA 1EYWA 3LHWA 2YFNA 5DLCA 4WKFA 3C8FA 3O16A 4F9JA 3R58A 3C0SA 4PTXA 2NV9A 3N2OA 1TMLA 3ITOA 1XDLA 1J93A 1K8XA 4KRZA 1XCFA 1GZJA 1RBAA 4O18A 3S5NA 3QPEA 1P7TA 2JE8A 2AKZA 5E93A 1HP5A 1H1ZA 4NXKA 2VWTA 1BYAA 1BFNA 1GYNA 4CU7A 4D6EA 4UMBA 1B0IA 1Q2RA 1FWRA 4DF2A 3OPSA 4WGXA 3GC2A 2P88A 3RITA 4K8EA 3NAVA 1RCQA 4LB3A 2DU2A 3ZS4A 4M80A 2C1HA 4H7CA 1PZ0A 4YPJA 1V8EA 1QO2A 4IFOA 1VPQA 2EEXA 2CESA 2NUXA 2PDBA 3PZOA 1CGXA 2G3IA 3A3WA 4B9YA 2L5HA 1OEPA 4AC7C 2Y6ZA 4IOTA 1ZSXA 5SWUA 2J9XA 4IIGA 3PANA 3VINA 1VGAA 2DZBA 4GZ7A 3VA8A 3S4TA 4CCZA 4HT3A 1VBJA 3LOTA 3I6RA 4K2SA 3CH0A 2OSWA 3SECA 2JEQA 1VYPX 2FLIA 4JX5A 2XSXA 1TYGA 4N9CA 3CWNA 3CUHA 3HPZA 4C1NA 3E0WA 4K39A 2H8ZA 1SO3A 4AEFA 4AB4A 1J12A 3N3TA 2F7FA 4CCEA 3FX4A 4AUBA 4WOZA 4AWEA 2CZFA 2TODA 3QPYA 5A3HA 1JFHA 3EMZA 1TO3A 3MKVA 2PC8A 2JF7A 4XB3A 3HG5A 4HD5A 3V1PA 1JDAA 2YBVA 2Z2AA 4UCFA 2YOCA 2CU0A 1ICSA 4DM2A 2EKGA 2BGNE 3MDWA 3A4WA 4FXSA 2VFIA 5CGMA 4ZL1A 4P8XA 4NJKA 4U2YA 3TTYA 4AY7A 4C6IA 1V4YA 4RZ5A 2H8XA 3LLFA 1DJYA 4B91A 2FPVA 3IJ8A 4PRWA 4AD5A 3F2CA 1HL8A 3DECA 3W3OA 5EB8A 4IPJA 3WD3A 1TG7A 3AQUA 4PYSA 4DBWA 3WJXA 3E2RA 1E6PA 4DF0A 3CL7A 2X7WA 1C93A 3I7RA 3IGXA 1MMFA 3QN3A 4FX8A 1CGTA 3G0SA 4Z0SA 3HV9A 3H7VA 4EACA 4YU1A 2J8TA 2PTYA 2X1RA 5G2WA 1Q6RA 1SJAA 4X22A 3RGTA 3ZJ8A 2INFA 2YGYA 4BF9A 1A4LA 5DMYA 2NQ9A 1GEQA 2Y7GA 3LNPA 2EJ1A 3M47A 3GXDA 4LNCA 4DUOA 1QNQA 3PG9A 4ADSA 3K5XA 2WV8A 4CEUC 4FLRA 3FNDA 4FEZA 2GGEA 2QCLA 3B4UA 2BTMA 2O9TA 4IICA 2XH4A 1JPHA 2EKCA 2YW4A 1MXDA 1YTDA 4FLOA 1JR1A 1E43A 4H6KA 4NF7A 2YL8A 1X39A 1MUCA 3GVGA 4NJHA 5CPSA 5EL1A 1AVAA 1V6YA 4KESA 4AYSA 3VDBA 3MYOA 3KVMA 2YX0A 3UG5A 1QBBA 1YX1A