4PTVA

Halothermothrix orenii beta-glucosidase a, thiocellobiose complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
445
structure length
445
Chain Sequence
b'IIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMEDRPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoside hydrolase family 1
publication title Biochemical and structural characterization of a thermostable beta-glucosidase from Halothermothrix orenii for galacto-oligosaccharide synthesis.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 172
structure length 445
sequence length 445
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ptvA00
3AFBA 1XCXA 3RM4A 1UZ4A 4AEEA 2VMFA 2E9BA 1BG9A 1KXVA 3BXWA 4D1JA 1NWTA 4KMQA 5A6SA 4WLCA 1NOUA 3K4AA 4TTUA 1BFNA 1E6NA 4AD2A 2X05A 1GQKA 3GH4A 1UD6A 2XVPA 4MAZA 1EHAA 5ABGA 2V5CA 3BLPX 1PEZA 4W8BA 4JIEA 2NT0A 1ZBWA 1GOWA 1E40A 4JFUA 1QNSA 3QOMA 3POCA 1CYGA 4LYQA 5IFTA 1NWRA 3W25A 4Z2GA 1BSIA 3VOCA 3BSHA 3CMJA 4JCMA 4WKFA 1H1NA 3VGBA 1ITXA 1TZ7A 2XPKA 4FLQA 1TA3B 3DYMA 5E6ZA 4AZHA 1XSJA 1MXGA 1Q6EA 5A6MA 1QNOA 1TE1A 2FGZA 2G4FA 3OBAA 4UOJA 4AD3A 2VT0A 3UR8A 1GNXA 2XVNA 4AWEA 1JI2A 1RD6A 1UWRA 4BQ4A 1QHZA 4ZENA 5BXTA 1WNOA 3AHXA 3U7VA 4UQBA 5E6YA 4GO9A 3L4VA 2D0HA 1W91A 1CXHA 2PF0A 1OT2A 1BPLB 2J7FA 3WSUA 3ZOAA 2O9OA 4JFSA 4BZYA 2DH2A 4CD4A 1Q6DA 1M7XA 3W37A 4FMVA 2BNJA 3VDAA 5CLWA 3OLGA 1EDQA 2HVMA 4WJXA 1IT0A 4JKKA 2NW0A 5CPSA 5E9AA 3W27A 1E4MM 4WSJA 1Q4NX 1WZMA 4ATWA 1BYAA 2YL5A 1UR8A 4PRWA 3KE0A 4W7VA 3WD4A 1VF8A 1W9UA 1GORA 1J11A 1B3XA 4YHEA 1E70M 1HL8A 5C71A 1EQCA 2EO7A 4P8VA 2VZSA 1BTCA 5JUVA 1VFUA 3VD4A 5ABEA 2X2YA 1R85A 5CXPA 3MMDA 1HP5A 4XB3A 4HA4A 3T08A 1CLXA 1HN1A 4W8AA 3THDA 5I24A 4R27A 4QP0A 3WFZA 1CGXA 3BH4A 3VINA 3LPGA 4AZIA 3J7HA 1NOWA 3WY1A 1FOBA 1BGAA 3RMEA 4CCCA 3A47A 3VILA 5IHRA 1UD4A 2BY0A 1JYVA 4JFVA 4CVWA 1E3ZA 1CGVA 1WE5A 3OZPA 4TX6A 4U2YA 3ARXA 1JDDA 4HZ7A 3N9KA 4H2CA 1EQPA 3CZJA 4AYSA 1HVQA 3WQVA 3WNOA 3K4DA 4HMDA 2GSJA 3QOKA 3VTRA 5JBFA 1CENA 4P7QA 1DHKA 2XUCA 1AVAA 2CHNA 1LWJA 3VGGA 1LQ0A 4AISA 2VOTA 3B8SA 4J7RA 3CUJA 2BXZA 3QHNA 1NWSA 2OSXA 4PTMA 5E09A 1W3LA 2FHCA 1E43A 2XWEA 3NUKA 1WP6A 4M24A 4C7FA 4OJYA 3VIPA 2OYLA 5TD4A 3N1AA 3L4YA 5CPQA 1E5JA 4N42A 4D71A 2ZWYA 4P8UA 5A69A 1WDPA 4W89A 1QI0A 4FF5A 3WD0A 2J8GA 4W87A 3SEPA 1E4IA 1ZL1A 4H8HA 1B9ZA 3ECQA 4PYSA 2DDXA 4F8XA 2VRKA 5DT5A 5E0CA 1GOQA 1VFMA 1PZ3A 1LL4A 5CG0A 2YKKA 1LJYA 5FCZA 3WBAA 4GI8A 2D1ZA 1UHVA 3WNNA 1XCWA 1Q6CA 5FL0A 2YOCA 3ZSSA 5C8BB 1TVPA 2F2HA 1BLIA 4U5KA 4XUYA 2ZUSA 4PTWA 2J4GA 2WSPA 4UFMA 4H7VA 4GZEA 1HF6A 4E2OA 5A6BD 4JKMA 1HX0A 1PIFA 3FAWA 3ZJ6A 3OB8A 3AIBA 2WVTA 3WL1A 2VVNA 3GYCA 2OWWA 2FH6A 3N15A 3VIGA 1ZB5A 5DEZA 1N82A 1XRVA 3OGVA 2VZTA 1QBBA 2G3JA 3LPPA 3AHZA 2CIPA 3PTKA 1E55A 2F61A 1HT6A 4RE3A 3WF4A 1NWUA 3A4AA 4GPNA 2WW5A 2ZUWA 3PZTA 1ZS2A 1C93A 2J78A 1MQRA 1QI2A 2XIIA 2B31A 4W88A 3AIRA 4BQ5A 1GOKA 2WHLA 2CXGA 2W4XA 3EMZA 4CCEA 2V3FA 3DECA 3AXHA 3RCNA 3N11A 2WMGA 1U2YA 2EPOA 2WVVB 4AC1X 1EO5A 4ACYA 4IM4A 2VJXA 1E3XA 1VAHA 2IUZA 1QNRA 3U57A 1VB9A 1H09A 4M8UA 3QHOA 1W9DM 4XZBA 5GNXA 3IAPA 1EDGA 3EMQA 1CXEA 4UFLA 1H49A 4WIWA 1KXQA 3OLIA 4JHZA 2A3CA 1CIUA 3TTSA 5D9NA 1DWAM 2WKGA 4DM2A 1TR1A 3BAJA 1E15A 1O7AA 1E6XM 3POHA 2Z1KA 4JFTA 5BRPA 3N04A 1SYTA 1J10A 2E9MA 2XVLA 3E1F1 1UA7A 2WMIA 2XM2A 5BXSA 3WEOA 2Y24A 2CBIA 1MXDA 2PWEA 4J27A 3ARWA 1WDQA 3AI0A 3OIHA 4RE4A 1XD1A 4UZSA 1JDAA 3TTOA 1OIFA 4H04A 3SCSA 2Y4SA 3B9DA 1IZJA 1UUQA 1JYXA 3TP4A 3MV11 3VNYA 2GFTA 4URIA 4IISA 1XGZA 1J0JA 2WZIA 2WWDA 1OGSA 1V3JA 2WK2A 3AMLA 5GNYA 1BQCA 1JZ6A 1OGGA 3VGDA 3VX0A 2FHFA 2WCSA 3MV01 3VIOA 3K46A 3RIKA 3WEZA 4TVDA 3WF0A 1H0IA 2C0HA 5ECUA 4BS0A 1C7SA 1D3CA 2VTFA 3GXDA 4PTXA 3DHUA 5HOSA 1UKSA 1GZJA 4BF7A 3W38A 1J0KA 2EPNA 3L4XA 1HKKA 4AZBA 4AMCA 3MANA 3GNRA 2VR5A 3AZSA 4UFKA 1YQ2A 2DQXA 4M29A 4WSKA 4TVCA 5I3DA 5I79A 3T0BA 4MTVA 1C7TA 5AC4A 1B2YA 2J7HA 2WCGA 1KR0A 3T2PA 2X8RA 3AYRA 2CETA 2RGLA 3GH5A 4CU6A 2UY5A 1JGIA 5M17A 1JF6A 4M1RA 4CGTA 3PZNA 2RGMA 2WC3A 5A8PA 4P7RA 3WEMA 2VCBA 4DWSC 3ZIZA 1JL8A 4W5UA 2A3EA 2XFYA 3VDBA 1PPIA 1UYQA 3MUIA 3VGHA 2E8YA 1NARA 2EPLX 2XYLA 3LMYA 3PZQA 1CXFA 3L4ZA 2BY2A 4AY1A 3CZGA 1GVYA 4IPLA 4D6JA 3VM5A 4YPJA 1GQJA 3N17A 4HZ8A 1CGTA 2DSWA 2GJXA 3L4UA 3T0DA 1R7AA 2IXVA 2WHJA 3AIEA 3DHPA 1JYNA 4QLKA 3AOFA 1EXPA 2XSBA 5ABFA 3SCPA 1B1YA 5KZ6A 4MNLA 4F9JA 1XH0A 4AIEA 3UG3A 2XGBA 1ZU8A 5LA0A 1HJWA 4PBGA 1JAEA 3FXYA 3AIWA 2QPSA 4PMVA 1HJQA 2G8ZA 3OLEA 2ZUTA 4CD5A 1KCLA 1XSIA 3FAXA 2UY3A 4WKAA 4QCEA 2VURA 4YHGA 4MNKA 1CXIA 4QAWA 5I6SA 2DT2A 2W62A 3AZTA 5CGTA 4FLOA 4NSBA 4F9DA 4UNIA 1AQMA 3EDDA 2WCAA 1JG9A 2CBVA 4M56A 3RJYA 4PMQA 2J7CA 1V3MA 3GXIA 1PZ2A 2YDSA 3KZSA 1BF2A 3WN6A 3CHDA 3GXMA 1KGUA 3GBEA 2DSVA 3CHFA 3DYPA 1J0YA 4HP5A 1VFFA 2BHZA 2XG9A 2ZX5A 4D6CA 2D22A 2FGLA 3ZO9A 4PMDA 1NM9A 2ESCA 2EEXA 3GM8A 4OKDA 1DWIM 1JI1A 1JYWA 1R87A 1GJWA 3ARVA 2W91A 1EH9A 4ACZB 1UG6A 2VCCA 5DF0A 4HA1A 2GDUA 4IUGA 1NQ6A 4RE2A 5A6KA 1QHPA 4PN2A 5I0DA 1CZ1A 2OLHA 4X9YA 3AHTA 2E8ZA 1I75A 4Q7NA 2YA1A 1UZ1A 4UTFA 1UQZA 1UWQA 3N18A 1E6QM 1WAWA 1QOXA 3WH8A 4GZJA 3WUGA 3WENA 3CZKA 5HNNA 1QW8A 4X0VA 2PBGA 5E0FA 4N0RA 3IJ9A 1UR9A 5EMYA 2PWHA 4DM1A 3FNDA 1WPCA 5IFPA 3SCWA 1CTNA 5BWFA 1Y7VA 3CMGA 3PZIA 3CIVA 1UR0A 3G6LA 1HP4A 5D4YA 1JIBA 4B15A 3SCVA 8A3HA 4HPHA 3TTYA 5C70A 4MPKA 1E6RA 2J25A 1EDTA 3VD5A 2WZHA 5HDRA 2E0PA 3BC9A 3BAIA 2JF7A 1FH7A 2CEQA 1XYFA 1W9PA 1IV8A 3SCOA 1JFHA 1ZJBA 2D2OA 3SUVA 3VIJA 4OBRA 3VMOA 1BVZA 1TUXA 3VIIA 4PMZA 2WMKA 3HJEA 1V0LA 1KBKA 2JALA 3U7BA 4DWSD 3RPMA 3CTTA 3U5YA 2EPKX 3PN8A 5JIWA 4W7WA 1VJSA 5CQ1A 2OSWA 3MMWA 4JZ5A 4K68A 2WLYA 2A3AA 8CGTA 1C8XA 4P7OA 4M81A 1GHRA 5LYRA 5CJ5A 5F7UA 1W1VA 2WVVA 1F4HA 3K8LA 1MVYA 1TVNA 4EE9A 2YBUA 2EQDA 1ZJAA 1H4PA 2GJXB 4U31A 1E1EA 2YL9A 2VL4A 5A3HA 1H41A 1WB0A 5FKYA 3W4RA 1XH1A 4MDPA 1OGBA 3ARTA 5ABFB 1E1FA 1B3WA 2UY2A 3GZAA 4HU0A 3MSGA 4ZE4A 1WKYA 4D6HA 4L4OA 2D3NA 1MFVA 1UR2A 4KH2A 4UFJA 4H8VA 3F5JA 4KWUA 3UR7A 4HMEA 3ZR5A 1E56A 1V3KA 3OA5A 5FOOA 4PMYA 2QV4A 1QI3A 4AZ6A 3MUY1 4PMOA 1W9XA 5DT7A 4B3KA 1Q6GA 1BGGA 4Q22A 3GH7A 2NT1A 3AHYA 2ZXQA 4NF7A 5JBDA 1WZAA 4YN5A 3B9AA 4A4AA 1J0ZA 1Q6FA 2WM0A 3SCUA 3ZM8A 2CKRA 4UQDA 4ZEPA 3AS2A 1LG2A 3NJ3A 2YA2A 2WZEA 4QLLA 3DYOA 1J0IA 3MO4A 4CU7A 3BMWA 5A2AA 2XVGA 2DT0A 1BAGA 4QLJA 4Z2LA 4P8WA 1MW3A 3PHAA 2W61A 4UR9A 4PTVA 2VX6A 2YDQA 1ITCA 2E4TA 1G94A 3L4TA 4B9YA 4HOZA 2O9PA 4AD5A 3WDPP 5M03A 1M03A 4W7UA 1C8YA 1UD5A 1GVIA 3ZR6A 3KL5A 3WD1A 4F66A 4OZOA 1KWKA 2WMFA 1W3KA 2JF6A 4PCSA 3WQ6A 5JIPA 2QHAA 3W29A 2J79A 4OUEA 3WUFA 5I5RA 5D9PA 1U30A 2WAGA 2PI6A 1FFRA 1ZBCA 4MNJA 2XIBA 4J3XA 2CBJA 2DPEA 1WCGA 4Z2HA 3UEQA 2V3DA 5IXEA 5CGMA 1QNPA 3ARZA 1C92A 1LLOA 2C8NA 5A8QA 1QBAA 1E6SM 1G9HA 3CPUA 3KL3A 2WB5A 2JE8A 5AYBA 5D8WA 1X6LA 3VX1A 1ISWA 1CDGA 2J7EA 4UOZA 4MDOA 1RPKA 3AMGA 1OB0A 1W2VA 2CKSA 2WHMA 2WPGA 1HJVA 3UERA 1UKQA 3AMDA 1ZBKA 2ZICA 2V38A 2O92A 5CSYA 4W86A 2DIJA 4J3SA 1UD8A 2DIEA 3RILA 1KQYA 4Z2KA 1JZ7A 1QPKA 2VC9A 3AS0A 3W24A 1O6IA 3ARQA 3BAKA 4LYPA 2OYMA 1V6XA 4JL1A 2J8FA 1E6PA 1PJ9A 1DWGM 1AQHA 1CGUA 1ISYA 2VO5A 3GNPA 2V3GA 3PZUA 1EGZA 3W26A 2VX5A 3ARYA 3IJ7A 3K8MA 4PMRA 4U3CA 2DSZA 3MMUA 1CNVA 1PAMA 4HZ6A 2G3MA 4E8DA 3II1A 1L8NA 1JD9A 4LX4A 2NSXA 3QGVA 3WH6A 1F4AA 1MWOA 4GZIA 1LL6A 4WF7A 3CLWA 3RO8A 2HISA 1QVBA 2ZE0A 3CUIA 5IHSA 4OBSA 4D6IA 1NP0A 1EO7A 1UR1A 2PBOA 2BS9A 4AD1A 2V3EA 4ACZA 2D23A 1QHOA 3CHCA 2DEPA 3WIJA 1H11A 4HU8A 3WF1A 1OWQA 1FHLA 1JDCA 1R7OA 1V3IA 4ML4A 4JL2A 3OGSA 3WNKA 1A3HA 3RM8A 3HMCA 1AQ0A 3KL0A 4S3KA 4MJ4A 2PC8A 4GINA 4PSRA 2AMGA 3AISA 2ZX8A 4U2ZA 1OCQA 3HN3A 5A6JA 2W5FA 1GHSA 3VMPA 4MB3A 2PWFA 5HPOA 3I3BA 2GDVA 3K1DA 4BCEA 1U33A 2CITA 2WKLA 1B3ZA 3GBDA 2WMJA 5EFFA 4Z2IA 1ODUA 1QI4A 3VPLA 1KR1A 4XZWA 3WNLA 2VI0A 4AZCA 2J7BA 4MB5A 5E70A 2PWGA 1ISVA 2ZIDA 1JXKA 5DMYA 1ZBVA 1VBRA 5CPTA 2BVYA 3WNPA 2X09A 1BVNP 4JAWA 3OGRA 1I1XA 2A3BA 3NIYA 3NDYA 3WUBA 1ISXA 3U5UA 2XHYA 2VNCA 4P8XA 3CGTA 5D9OA 5A8OA 1MYRA 1C3FA 2EXOA 1K6AA 1TG7A 2WBGA 1V0KA 1UWTA 1PBGA 1GQLA 1I1WA 1Z32X 1B90A 2XJ7A 4LPCA 4CD8A 4J3UA 3EDJA 3SUSA 1V03A 1GCYA 2BHUA 2TAAA 3WDQA 2OWXA 1CGWA 1BG4A 1E6ZA 1X6NA 1WZLA 2E9LA 1HKMA 2YLLA 3W0KA 2E40A 3VDHA 5AC5A 3AROA 4Y7EA 3SCRA 1HXJA 3I3EA 3BMVA 1KGXA 1HKIA 3W6MA 3LPOA 1OBAA 3SCQA 3ARSA 1KWGA 4D1IA 1W3HA 7TAAA 2C7FA 1K9EA 2D20A 3LPFA 3MUAA 1RP8A 2Z1SA 2WWCA 3EBVA 3ZQ9A 3VGFA 2ZX7A 2YJQA 4P7NA 1DEDA 3O6AA 3SCNA 1VEMA 1J12A 2J62A 3PTMA 2CESA 5A2CA 4D6EA 6CGTA 3T0AA 1OD8A 4D6DA 7A3HA 1SR0A 5BROA 1C91A 4L4PA 3SUWA 2OYKA 3AYSA 1S46A 4UZUA 4X0NA 1HJXA 4TUFA 3VIMA 5ABHA 4PMUA 2J47A 5A6BA 2YL8A 3DC0A 3WMSA 3WQWA 2EJ1A 2DT3A 2XVKA 1B0IA 3AXIA 2BVDA 3VMNA 2WYSA 3VU2A 3VD7A 3WQ8A 1UWIA 1PIGA 1MW0A 1LG1A 4NRSA 2YDRA 3CZLA 1HL9A 3WL0A 2X0HA 2CERA 4J3VA 1DTUA 2J75A 3CBWA 3MKKA 1C90A 4KRUA 1US2A 1BYCA 1BYDA 3B9EA 4EAMA 1WDSA 4KGLA 5GQBA 4UQCA 2V5DA 4D6GA 4Z2JA 4UOQA 5DO8A 5I78A 1HKJA 1D7FA 2GJRA 2Y5EA 3BAXA 1E0XA 1TFVA 2QF8A 5FD0A 4AD0A 1EOKA 5I2UA 2VRJA 3CZEA 3BCFA 3M6DA 2ZUMA 4TXEA 2G41A 3UESA 3WMBA 3ARRA 1W1TA 2ZXAA 4B9ZA 1E73M 1AMYA 1G1YA 4OIFA 3BGAA 5A6AA 3AXXA 1FFQA 4TVUA 1BYBA 2CPUA 1JNEA 4AZCB 3A6OA 4WKHA 4DUVA 4PUDA 4H41A 4V27A 3WUEA 2FH8A 3T2QA 2GK1A 4E8CA 1XD0A 3GXFA 1HJUA 3AQUA 3I3DA 2A3HA 3WDIA 4TOQA 1V6VA 2Y8KA 4R5EA 2G3NA 4GIAA 3KWXA 3WD2A 1V08A 5I77A 2QMJA 3W28A 1B3VA 3FW6A 3BSGA 4AIOA 3VIKA 3ALGA 5EB8A 2F8QA 3WNMA 4FLSA 3W53A 2XSAA 2JEPA 4P7LA 1E71M 5M5DA 5DFAA 3AHVA 1GUVA 1V3LA 4UFIA 1UKTA 3GTNA 2QLYA 3FHQA 1HVXA 1L0PA 5A8MA 3VDCA 4AZ5A 1GOIA 1UKOA 4W84A 4AD4A 4ZXOA 1GOOA 1PX4A 9CGTA 3CHEA 2BXYA 2WNWA 2IXUA 4MJ2A 3RDKA 4MB4A 1EA9C 1VEOA 5I23A 4B16A 4E4PA 1JAKA 3WDJA 4CVUA 3TTQA 4JKLA 3EDEA 3VIHA 1VENA 1W32A 3F4VA 3FN9A 3NSMA 7CGTA 3OZOA 2WLZA 4LQ1A 5AYIA 3SURA 4ATLA 2YBTA 2PWDA 1V0MA 5M3WA 2EPMX 3VM7A 2VX7A 5LA2A 4GQQA 4BQ2A 1XHGA 4AXNA 1JXJA 4HTYA 2VCAA 3VKKA 4QDMA 5CLTA 4JFWA 3OG2A 4GO8A 4D72A 2WXDM 2BY3A 3RJXA 4MB1A 1C8QA 5JBEA 2WSKA 5KEZA 1DWHM 1KXTA 4U3AA 1XC6A 4LXFA 2XWDA 3ZJ8A 1V6WA 4GI9A 1MW2A 3M07A 4LGXA 3IAQA 2EBNA 2BHYA 2J77A 2XFRA 4JHOA 3EDFA 1W9VA 2CBUA 1H0GA 4AIUA 4OOZA 2CCRA 2VUYA 2WHKA 4KGJA 1VIWA 3WF2A 4BA0A 1MFUA 4MAVA 1UA3A 2WVUA 1EOMA 3AIVA 2BFGA 4CN4A 1PX3A 1EHNA 3A4XA 4OOUA 3NSXA 4U5IA 4PEEA 4ZXLA 3WBEA 5HBFA 1WDRA 1YHTA 2ZUVA 3WQ4A 3AIQA 3WDHA 1NOFA 4TX8A 3O2LA 3ZMRA 3ZT5A 5A2BA 2CNCA 6A3HA 2XFFA 4NI3A 3L2MA 3CH9A 1R86A 2D24A 1K9DA 1SMAA 1GW1A 1K9FA 1CECA 5BRQA 3TOPA 3PBGA 1BHGA 3KEHA 1QI5A 1V02E 2MANA 3PTQA 4C7DA 3N13A 3AMCA 1CGYA 2JFEX 3SCTA 5A8NA 2O9RA 3CUGA 1OT1A 2D3LA 2J7DA 2PB1A 3RM9A 3WH7A 4ZFMA 4CUCA 5FIPA 1E9LA 4HPGA 3WQ5A 3MSDA 1UD2A 2W92A 4EK7A 1V6UA 3S6TA 2VR4A 4M80A 1VFOA 2OSYA 2GVYA 3VNZA 3ZT7A 3IANA 1W1YA 1KFWA 1RH9A 2GK1B 3A4WA 1WO2A 1JZ2A 4PCTA 1JFXA 3AJ7A 4EANA 1TCMA 3CUHA 1JD7A 3AS1A 2UWFA 3IK2A 4AZGA 5EBAA 3M7SA 5HXMA 4HOWA 1KGWA 1VJZA 1FP9A 2Y8VA 1LF1A 1NH6A 3MU7A 2DT1A 1P6WA 1UH4A 3CUFA 4QFUA 1R8LA 2GUYA 2VVSA 4W5ZA 2ZX9A 2WVSA 3VVGA 1XYZA 1V0NA 5CSUA 1UQYA 1US3A 1FA2A 3PZMA 2VQTA 5A6LA 2E3ZA 1LWHA 4JCLA 1UOKA 4J3TA 1J0HA 3GDBA 1W9BM 3MUZ1 3QR3A 1B3YA 3OLDA 2ZXBA 3ARUA 1KB3A 3AICA 1UH2A 4CU8A 1GJUA 1V02A 4UQAA 1X1NA 5D8ZA 3FHAA 3W6LA 3K8KA 1JF5A 1UWSA 2ZOXA 3M46A 2WANA 3PZ9A 4HA3A 4M82A 3ZJ7A 6TAAA 2WBKA 4DUXA 1UWUA 1VBUA 2AOSA 4CN1A 1E0VA 1E0WA 1HNYA 2Y2WA 2ZXDA 3CZ8A 5AY7A 3VD9A 2CHOA 1G5AA 4DUWA 1J18A 1OSEA 2X0YA 5EFDA 5CZKA 1G01A 1K9TA 2ZX6A 2BVTA 1E72M 1GPFA 1EIBA 1NP2A 3D5HA 3PZGA 5BXRA 2QMKA 1JZ5A 4D6FA 1OM0A 2QPUA 1FH8A 3VUPA 1FHDA 3BCDA 4B3LA 1ECEA 1M01A 4J28A 4KRTA 1A47A 4DWSA 3AMKA 1XV8A 5A95A 4MNMA 1UR4A 4F79A 2JIEA 2G3IA 5A1AA 4CD6A 1FP8A 1JZ8A 3TONA 5GPRA 4UQEA 3WKZA 5BXPA 1H3GA 1DWFM 1MQPA 1E5NA 3THCA 2DSUA 4GKLA 2BY1A 4QCFA 3T09A 5BCAA 2VX4A 1UKPA 4ZE5A 1CXKA 1CBGA 2Q8XA 2CYGA 1PX8A 1VRXA 3WH9A 3VD3A 1J01A 3WMCA 1G0CA 2VZVA 4HOXA 1D2KA 1HIZA 3T2OA 2VZOA 3SUUA 4EKJA 3NDZA 3L2LA 1E4LA 4W8LA 1HJSA 4AEFA 3NYDA 2WC7A 4IPNB 1JZ4A 4GI6A 4ATDA 1SFSA 3WH5A 1CXLA 2DH3A 1CLVA 2W63A 2X1IA 4CD7A 3WELA 1IZKA 3BAWA 1LL7A 3F5LA 2DSKA 4W85A 3GNOA 3SIMA 2D0GA 4RL3A 1GONA 4PUEA 1UH3A 3PZVA 3W82A 4FLRA 4WK9A 1JZ3A 1W2PA 2FHBA 1KBBA 2DGAA 3G6MA 1TA3A 4S3JA 4UQ9A 4C7GA 3NSNA 2WC4A 1ODZA 3HU7A 1JNDA 1QNQA 5A94A 4HMCA 1M04A 3QHMA 1CPUA 2VRQA 1VEPA 3S2CA 3NCOA 4U33A 4V28A 2YL6A 1B30A 2JEQA 3VO0A 1OIMA 1J9YA 4PMXA 1TMQA 3AS3A 3ZSTA 3W81A 4XX6A 1MW1A 3BLKA 3CO4A 1H2JA 1H5VA 2W66A 3UETA 1MQQA 3FY1A 4CCDA 4UCFA 3WF3A 2VQUA 2ZUNA 3BAYA 3D3AA 3A3HA 2XGIA 2J7GA 5LA1A 2OWCA 1GQIA 2VZUA 3UCQA 5BYWA 5IDIA 4FK9A 3ARPA 3F5KA 5GNZA 2J74A 1KXHA 2YA0A 2O9TA 3PZOA 2FDMA 3WFLA 3AZRA 1W1PA 4CKQA 4NZCA 2UY4A 1FH9A 3ALFA 4LYRA 3VIFA 2ZUUA 4J3WA 2AAAA 1DWJM 1OINA 4GQRA 1ESWA 1RP9A 4TTGA 2BV9A 1DP0A 2D0FA 3JUGA 4GXPA 4AW7A 3O9NA 4MADA 3APGA 4V2XA 3TA9A 3WD3A 1W3JA 1V6YA 4A3HA 1V3HA 4A3YA 1WZKA 1KQZA 1SMDA 2W67A 1OD0A 4PMNA 3IJ8A 3L4WA 5D9MA 1XH2A 4W93A 1GOMA 2WMHA 4CN6A 2XM1A 3MS8A 4H8UA 3AIUA 1CEOA 3EDKA 3EMCA 1UD3A 2ZWZA 3UG4A 2YIHA 3WDRA 2JIWA 4BQ3A 5FL1A 1ISZA 1KCKA 4PSPA 1B31A 1QW9A 5HPCA 4AZ7A 3EYPA 4NRRA 1CWYA 3SUTA 1M53A 2GJPA 3UG5A 1E4NA 4DWSB 4XV0A 3ZJKA 3N12A 1XSKA 4UFHA 3VGEA 2WMIB 2YLAA 3ZT6A 2XTKA
chains in the Genus database with same CATH superfamily
1XCXA 1Z89A 3LHUA 3M41A 1AD4A 2YCLB 3WJZA 4AEEA 3B06A 3W1UA 4AD2A 3GH4A 1UD6A 1AJ0A 2XVPA 4EAYA 4XVDA 4KW2A 3UPMA 2OZ3A 4HGXA 3EOEA 4B5NA 1WUFA 1IEQA 3VOFA 1GT8A 4JFUA 1QNSA 3MP4A 4NVTA 2GUUA 5IFTA 3BSHA 4GQBA 3VGBA 1TZ7A 2PC4A 3W7GA 2VOMA 4FLQA 2DJLA 4Q4QA 1RVGA 2Q8ZA 5A6MA 1QNOA 2FGZA 3BL3A 1OF6A 1XYBA 2QCFA 1H5YA 1MMFA 1TPH1 3UR8A 2XVNA 1JI2A 1E1CA 4RNJA 3F2BA 2FZ9A 1QHZA 5BXTA 3AJXA 2HMCA 1NSJA 3WMLA 4A3RA 4G8TA 1EA0A 3U7VA 4ERAA 5E6YA 1XLDA 4B5WA 1MUWA 5CC3A 2NUYA 4BZYA 3OU8A 4CD4A 4MSSA 4G9PA 1UPMB 5IBXC 3F2CA 4I9AA 3L5MA 3A9BA 2BNJA 3VDAA 4MVAA 3ZLGA 4WJXA 1P1MA 1YNYA 2NW0A 4WSJA 3VC6A 2C71A 4JTCA 3WK0A 3PC0A 4EPKA 5DXXA 4AUBA 1UIPA 1IXQA 1Q66A 1W9UA 1GORA 2PD5A 5L6UA 4WDTA 4OV9A 3STCA 5C71A 2EO7A 3LXCA 5JUVA 3VD4A 1R85A 4K8HA 1BXBA 3MMDA 2XIQA 1HN1A 2DZWA 4PCFA 4PH6A 3W07A 4YNGA 3LU2A 4IQJA 3KLLA 4DWDA 2DW7A 3LPGA 3EWWA 3J7HA 2NXHA 1B5TA 4YTUA 1FOBA 4Q33A 5IHRA 1U22A 3VILA 3P80A 4JFVA 4CVWA 3OZPA 2B7OA 4KFOA 3Q37A 2IW0A 4HZ7A 1S5NA 5LHFA 1EQPA 1KFLA 2GUBA 3WNOA 3K4DA 4HMDA 1FKWA 2E5DA 2A7PA 1H63A 2GGHA 2REQA 4MY1A 2CHNA 4UBPC 4AISA 2VOTA 3LGEA 3HA1A 2YPIA 3CUJA 4MLJA 4PTMA 3SQSA 4GHRA 2FHCA 3GG0A 3OHMB 3NUKA 4OJYA 1BWLA 4PE8A 4IIFA 2OYLA 3N1AA 4N42A 2CZFA 3UY7A 3PUEA 4HN4A 3OBEA 1O60A 2POTA 4N9DA 4W89A 4QE1A 3P2VA 4P5UA 3QGKC 2J8GA 4W87A 3SEPA 3DOPA 3P82A 2QEZA 1RCOB 1Q6OA 4X60A 1POJA 2BGNE 3HG2A 2BLEA 4D2JA 4BJHA 5CG0A 1LJYA 2P88A 1ZUAX 1G7VA 1UHVA 1X7IA 2V67A 5CAHA 1XLIA 3M5VA 4MPQA 1Q6CA 3BLOA 3WG6A 3JZUA 5C8BB 1TVPA 1BLIA 4XUYA 1EZ2A 5D2VA 1NQKA 4PTWA 2WSPA 4UFMA 4DAIA 1HF6A 2HSAA 4DXKA 1HX0A 1H51A 5LGZA 3ZJ6A 1Y5VA 5CPNA 3T05A 3TQ0A 3WL1A 1TTPA 3NAVA 2VVNA 2OWWA 3OO2A 3NOEA 2H9AA 3T0CA 1ZB5A 4I7UA 1N82A 3P7YA 1XRVA 3OGVA 4WDUA 1QBBA 2I14A 4DYKA 2G3JA 3LPPA 2CIPA 3R12A 1E55A 1JCMP 1FHVA 1PKNA 3B8UA 4GUHA 3W9ZA 2CZDA 1C93A 2E6FA 1GVOA 1QI2A 3EWYA 1G7UA 4NJKA 3HQNA 3AIRA 3GDRA 3WBWA 2IPFA 5TAOA 3AXHA 3IUDA 3N11A 1U2YA 2EPOA 1REQA 2WVVB 2UBPC 4BI6A 4Z42C 4MIMA 4NP7A 1ML1A 4DXVA 5F1VA 3QHOA 1V7YA 4IMDA 1ME8A 1P4CA 1XBVA 2OMAA 4C5YA 3KS5A 4JHZA 1GZ1A 2A3CA 3UJRA 4DPQA 3QSTA 2WKGA 4DM2A 1E15A 1A3WA 3UF9A 3H6OA 2Z1KA 4JFTA 2HXTA 3EX3A 1GEQA 3E1F1 2WMIA 4E38A 5BXSA 4X22A 2YDAA 2VEKA 3U4FA 5IRPA 3QFWA 5TQLA 4UZSA 4DBEA 2WJFA 1W3NA 4QTGA 1W31A 1TB3A 2Y4SA 4WDWA 1TV3A 4Y9PA 3O06A 3RRXA 3MV11 1EWEA 4LOCA 3NZRA 1XGZA 3BZJA 5CC7A 1RJQA 3T8QA 1J5TA 1V3JA 1WKFA 3PBUA 1BQCA 3DEQA 3LB0A 1JZ6A 4H00A 3AU2A 4Q8WA 5CPLA 1YDVA 1VYRA 3S5YA 3VIOA 3ITLA 1H0IA 3ORWA 2C0HA 1ZENA 1C7SA 1D3CA 3GXDA 3LHWA 1MXSA 4PTXA 3EWDA 1SJDA 5HOSA 1UKSA 2DW6A 2Y85A 4BF7A 4GYPC 5E9XA 1G4PA 2EPNA 3VKCA 4OGZA 2VR5A 3UZJA 3VZZA 1YQ2A 1WXJA 3V0TA 2A79A 2FVMA 4M29A 4H6QA 5EU9A 4DPPA 3CU2A 4MKSA 1KR0A 4JTDA 1W5MA 2WJDA 2CETA 2RGLA 3TYAA 1JUKA 2OZ0A 1JPMA 1XF0A 2Z7KA 1R3WA 1K7XA 2VEGA 3TDFA 2VCBA 4DWSC 5H8UA 3IGSA 1JL8A 4C1NB 3IK4A 3EKGA 4J1OA 1XRFA 1RPXA 3MUIA 4OECA 2HRWA 3KZPA 4KETA 1CXFA 2QQ6A 2BY2A 2ZC1A 3C86A 3SW6A 3LX9A 4Z08A 4KWOA 4O12A 4D6JA 3CAWA 4FNPA 4I7VA 4HZ8A 2DSWA 2ATMA 2ZFAA 2IXVA 4XAGA 3EPMA 4M6QA 4PBFA 3DFSA 5KZ6A 1A0DA 4YWIA 3FVDA 4F9JA 3A9IA 3LLXA 3SR7A 1ZU8A 4H7CA 3URNA 1F7BA 1JAEA 2BSLA 4XKYB 4IP4A 4TV5A 2QPSA 1HJQA 3CL7A 2UY3A 1DQUA 3BMXA 4FIRA 4L64A 1CXIA 4R7JA 1AUSL 3SRHA 4GC3A 2W62A 1RV8A 3TIMA 5LSMA 3I6EA 3NGFA 4QSFA 1JG9A 2CBVA 3JVAA 3ES7A 4PMQA 3OG3A 1PZ2A 2YDSA 2V5KA 2BOEX 5EA9A 2Y6ZA 3CHDA 3GXMA 2HE5A 3MYPA 4OQVA 1J0YA 1JCYA 2BHZA 2XG9A 1RR2A 3B0VC 1NM9A 3C52A 1OFBA 4RZ5A 3L5LA 1HFBA 4OKDA 3INPA 1UMYA 2VD9A 3N2OA 4NX5A 3CPGA 3QV9A 1VYSX 1GJWA 1H7OA 1EH9A 3GB6A 1NQ6A 5A6KA 1QHPA 4PN2A 1CZ1A 4ORIA 1YBQA 2RDTA 3AHTA 3NQVA 4Q7NA 3GWQA 1S1RA 1UZ1A 4UTFA 1DXIA 4GJJA 1E6QM 4XWUA 3HFTA 4DBUA 3DDMA 4TIMA 1D8WA 2KZHA 5E0FA 3IS4A 3IJ9A 4CNOA 2IMRA 5DCBA 5EMYA 5IFPA 3G18A 3SCWA 4XVEA 4IFOA 4RW3A 1UR0A 1HP4A 4XUGA 1JIBA 4B15A 3SCVA 4IQLA 3UWQA 3FGCB 4HU4A 4V1YA 4KCUA 4MPKA 2J25A 4MKNA 2WZHA 3N9RA 3BC9A 1ZJIA 2BX7A 4H3DA 3BAIA 3VKDA 3AYTA 1EZWA 2ACRA 2VHLA 1H7PA 4EP8C 1I6NA 4DJEC 3C2FA 3N2XA 2NV9A 4C6KA 1DIKA 3FJ6A 3VIIA 2GQ9A 1KM6A 2NQHA 1V0LA 3CJPA 4ADTA 3NA8A 1N7KA 2GZXA 4W7WA 1S5WA 4HSOA 4K68A 2OB3A 4DAFA 4M3PA 2ACQA 1TX2A 1G4TA 5CZJA 3LV6A 2Y7FA 4QE4A 4Q8NA 5F7UA 1EB3A 3S2MA 3CH0A 4CLMA 4EE9A 2YBUA 3L2IA 4GVHA 1SR9A 4C5ZA 1NY1A 1WDWA 2GJXB 4IMGA 2ZE3A 1GVEA 2VL4A 4BWLA 3R10A 5MKGA 1P5BA 5T8GA 4XK2A 1GVRA 1GTHA 1HG3A 2D2HA 2F2KA 3ARTA 3JS3A 1E1FA 2Y70A 1B3WA 2RDUA 1G67A 1QPNA 3A64A 4GVGA 3APTA 3DH7A 1GPWA 2VUNA 1XLHA 3DX5A 4R3UA 1KTCA 4DNMA 2NQZA 3G8EA 4JQAA 3F5JA 1X39A 5AHEA 2PDPA 3UR7A 1E56A 3ABQA 3OA5A 3DFNA 3UWZA 3GUWA 4L6OA 1I0DA 2ISDA 3W2UA 1DJHA 4B3KA 5K4ZA 4B5SA 3H7RA 3GH7A 3K30A 1RK6A 3N4FA 3VNMA 5JBDA 5D32A 4A4AA 4IX0A 1Q6FA 3LS9A 3HURA 1MEHA 1R3SA 1LG2A 7PTDA 3NJ3A 4Z0SA 5T9CE 2YA2A 1IIHA 2WZEA 3DYOA 2QUNA 4HMNA 2DT0A 4S3FA 6PTDA 2QNEA 4Z2LA 4K39A 1TVLA 4P8WA 1M41A 1MW3A 4HQVA 1XQKA 2OZTA 2FZNA 1SFJA 2VX6A 2YDQA 4RE0A 4LVFA 4ZOEA 1QAPA 1G94A 2O9PA 2OEJA 1UWAA 3WDPP 1M03A 1O4UA 3ITTA 2PDQA 2NLYA 3HBLA 3MDUA 2X1TA 3ZR6A 1N55A 1XPYA 3BJSA 1U1HA 1FDYA 4UB9A 2WMFA 3UVIA 2FFIA 4WGHA 2YXGA 2OEKA 5JIPA 2QHAA 1M68A 1AG1O 5FA5A 2WAGA 2AQWA 3L12A 4L7ZA 1FFRA 2NXIA 2XIBA 2NWSA 1WCGA 4Z2HA 5IXEA 4FHAA 1QNPA 3LG3A 4O8AA 1A49A 4PCNA 1C92A 2D2GA 2C8NA 3ITVA 3KOZA 4IXHA 2JE8A 1ZQ5A 3I4KA 4QJ5B 1X96A 2PDWA 4LBRA 5AC6A 1DKWA 4HCHA 1JRCA 1X7FA 2J7EA 4UOZA 1RPKA 1X6UA 5DBTA 3V75A 4E2DA 1W2VA 4TX9A 2CKSA 3R2GA 3UXKA 4ADSA 1IF2A 1TWWA 3DHDA 4B3ZA 1HJVA 4MWAE 2V38A 2ZICA 2XIJA 5CSYA 4J3SA 5LNUA 3N2BA 3W73A 1KQYA 2ZDRA 3HPAA 1QPKA 1OG0A 3AS0A 3LUTA 3M47A 4X61A 2DP3A 3NQEA 1KA9F 1TIMA 1RBOB 3BAKA 4EWND 2OYMA 1AQHA 1QO5A 2B81A 3LYEA 3GNPA 4ZGYA 2V3GA 1TWDA 4DZ5A 1EGZA 3CL6A 2YX0A 3CQ0A 1CNVA 2Q01A 1FBAA 1PAMA 4GYPA 1GW9A 4NAFA 3II1A 4LX4A 3WH6A 1F4AA 2ZYFA 1MWOA 3TYZA 5BWAA 4GZIA 3V0UA 3CLWA 3RO8A 2EAWA 4WHBA 3AUJA 2ZE0A 3RO6A 4KF1A 4OBSA 2V3EA 4HTBA 4ACZA 2I5GA 1QHOA 4BEUA 1OWQA 2OLSA 1EC7A 3NR0A 4ML4A 4WCJA 4JL2A 1YXYA 3OGSA 2ZVRA 1PE1A 3W7NA 3U2ZA 3MUXA 3LCXA 4MJ4A 2PC8A 4GINA 1I2RA 2AMGA 1W56A 4B5XA 4O15A 1FRBA 5I02A 4U4MA 3OQ8A 4L1GA 2PWVA 2W5FA 1L6SA 1GHSA 4MB3A 1I9CB 4J2MA 1QW7A 3TK7A 1ZP3A 3DIPA 4JQ2A 2CITA 2OGJA 5HANA 3E9AA 1QI4A 3S1VA 4WY0F 2VI0A 4ERIA 5D03A 2Z27A 1XM3A 3DCPA 2VKZG 5F4WA 4N2YA 4LV4A 1ME7A 3P67A 1ZBVA 4H9XA 2BVYA 1Z69A 3CT2A 3W3OA 1POKA 1DV7A 4MJZA 2NLIA 1I1XA 1I2NA 2RDWA 3NIYA 3NDYA 4EXBA 2YFOA 4P8XA 4DIAA 2ALDA 2X7VA 3RRAA 1V0KA 1UWTA 4NJIA 1GQLA 1B90A 3TC6A 4CD8A 3SUSA 4JX4A 1V03A 2TAAA 3S9IA 3AWNA 4KWVA 5HINA 4GACA 1E6ZA 1WZLA 4GJIA 4JYEA 3NPWA 2YLLA 3MW7A 4GCAA 3W0KA 2E40A 2GVGA 8XIMA 3PNUA 4Y7EA 3SCRA 1R2RA 4XZNX 1KGXA 1HKIA 4J4KA 4NJJA 3SCQA 2OXNA 2BGQA 4C6CA 1GKPA 3M0HA 3WX7A 1LLZA 1RQBA 4IZGA 4D1IA 1W3HA 4JNYA 1OYAA 1K9EA 1Q6RA 2ZADA 3DXIA 3LPFA 1K4HA 4I5XA 3ITCA 3MUAA 4JTGA 3EBVA 2VEMA 4P7NA 3ZWSA 3H8AA 2XINA 3U8GA 4LUSB 4ICNA 2J62A 3P60A 5A2CA 1OX4A 1TO3A 4Q3MA 4DNHA 2NX9A 4ERGA 3TLLA 1K03A 1SR0A 2DFAA 3K13A 1QCWA 5G4WA 4LBSA 3BK0A 3A24A 3SUWA 4QG9A 5E5CA 1ALDA 3JU2A 3VIMA 1OFPA 2VC5A 4EF8A 5HAOA 3OVGA 5FACA 2PLCA 2EJ1A 2XN1A 4DJEA 2XVKA 1B0IA 2QCEA 3VMNA 2WYSA 4NAEA 3VD7A 1PO9A 2XN2A 4S3DA 2V6AA 4R7OA 1GG1A 2BMBA 2YDRA 1XLCA 3KCLA 3W7LA 4JIHA 1VR6A 3UZYA 2GYIA 1SGJA 1C90A 2PTZA 3B9EA 4KGLA 4UQCA 4INFA 4MWAB 2E67A 3GD6A 1OY0A 1OC7A 1T0OA 1A5KC 3E0IA 4QG6A 3TKFA 4AWTA 4GX9A 3IRDA 9XIMA 1XISA 4TXEA 4QX4A 3WMBA 1W1TA 2ZXAA 1C9DA 2Y7DA 1TPB1 1G1YA 1K1DA 3MWAA 3GC2A 3KDOA 4NNAA 3CB8A 4O57A 4F48A 2Z2UA 1MRQA 4AZCB 4FR1A 4NXSA 3GNXA 1Q2RA 2FH8A 2GK1A 4ZR8A 4DBSA 4XAYA 1AH0A 4E0CA 3WDIA 2A3HA 4TOQA 3RCYA 1WUEA 4R5EA 3IJIA 3TJLA 4QG8A 2QMJA 5A6TC 2PRHA 1R3QA 3FW6A 3NO1A 1MDRA 2LLEA 1OFOA 4P7LA 3NQGA 5CPMA 2NVAA 3G2GA 1S5VA 4XTDA 1GG0A 4ZOAA 1L0PA 4AD4A 2PDMA 2HBVA 2BXYA 1YTKA 4US5A 2VDGA 3RX2A 3VDGA 4EPBC 1NDYA 3SECA 4B16A 4GIYA 1XLFA 2ATSA 1TPC1 4E4UA 1VENA 3DFYA 4UTTC 1VPYA 4ATLA 1I0BA 4FX6M 3ABOA 4HPXA 4HCLA 5M3WA 1WKDA 2EPMX 4GQQA 1EJ7L 4EPEC 4E3TA 5AHMA 5KMYA 2HZGA 4HTYA 2PE4A 4QDMA 3I4EA 3W1LA 1OVDA 3RJXA 4MB1A 1C8QA 5JBEA 2WSKA 5DRIA 3KLKA 1KM2A 1KXTA 3D3FA 2QDDA 1Q3NA 3WJWA 1NELA 3OQEA 2XWDA 1OK4A 1MW2A 3M07A 4RV8A 5JXQA 3URBA 3LCFA 4FA3A 3H23A 3UPWA 3TCSA 3CXOA 4PUUA 3EDFA 2BOGX 4OOZA 4CQ9A 3UD6A 2WHKA 4KGJA 2F7FA 4H9ZA 1U5HA 1VIWA 3WF2A 1SO4A 1F6KA 1V79A 3VI2A 3A4XA 1VHCA 4NG3A 3WBEA 5HBFA 3OJGA 4BHYA 5FI8A 4NILA 3AIQA 3WDHA 3ZMRA 1EJUC 2H6RA 6A3HA 2XFFA 4QJ1A 4NI3A 3L2MA 4DELA 2ZZ5A 2I16A 3MZNA 4IGHA 1ZCCA 2BB0A 1CECA 1K9FA 1BHGA 4C7DA 3EWXA 3NQFA 4JTSA 2O9RA 1K4GA 2J7DA 1PWLA 1I2QA 1E9LA 3KHDA 3WQ5A 2ZTKA 4C6QA 2W0UA 1TE6A 2W92A 4QJ4B 3BLEA 1RBLA 3W7EA 4KS0A 3ZT7A 5G1TA 7ODCA 3N73A 2PD9A 4F0HA 2BG5A 4JTRA 3SSJA 3G77A 1JD7A 1KLZA 4PUWA 3RLHA 5HXMA 2Y8VA 2YZRA 3EA1A 4UMCA 4XZLX 5HQEA 4WR3A 4PULA 1ZP4A 3GHRA 1CB2A 3PS7A 3VVGA 1LRQA 1LT8A 1XYZA 1XWYA 3H7VA 4WDXA 3PZMA 5A6LA 4BF5A 2QCDA 1UOKA 1B3YA 2Y62A 3URQA 2OR2A 2OKTA 1KB3A 2GDQA 4CU8A 1XLBA 1GJUA 5D8ZA 3PY2A 1R46A 2QIIA 2IQTA 1ZZMA 3R11A 6ALDA 1E9IA 2WBKA 5BW6A 3F03K 4OUIA 1E0VA 2ZXDA 4PGLA 2CHOA 2QJIA 1R5YA 5FEXA 1J18A 2X0YA 1G01A 3PUGA 5CJNA 3G1FA 1E72M 1O5KA 1GPFA 2NZLA 3GDKA 3B05A 4ZCWA 5BXRA 4K1WA 1PCWA 1XPGA 4FOJA 4N9EA 1FH8A 2DUAA 3MI6A 3VUPA 3UXLA 5C7VA 4KWWA 3SDOA 4WOZA 4MNMA 4GG9A 3TONA 1KV5A 1YXCA 1H3GA 3SJ3A 5DQPA 4L9XA 4PR4A 3H2CA 1UKPA 1QO2A 4ZE5A 1AH3A 2VM8A 4EOUA 3GLCA 2Q8XA 2CYGA 1VRXA 1L9WA 1G0CA 4HOXA 1HIZA 3M0KA 4H4IA 3L2LA 5EMMA 3UGVA 3QKEA 4FO4A 4RZ4A 4ATDA 4Q8PA 3WH5A 1PHQA 2DH3A 4CD7A 2X1IA 4UMBA 2Y5JA 2DSKA 4W85A 3GNOA 3JRKA 4RL3A 2FTYA 4WK9A 2PDJA 2FHBA 1P43A 2DGAA 3F4NA 3R7MA 2WC4A 1ODZA 2R24A 4S2BA 3HU7A 3MI3A 1QNQA 2OT1A 4G5DA 4HMCA 5A94A 5HMFA 2J6VA 2VRQA 1A5AA 3S2CA 3W02A 3ANVA 3NCOA 4IFRA 4V28A 2EJAA 3G3DA 4UR8A 3DUGA 4XQ6A 3ZFHA 2DIKA 3VO0A 1OIMA 4KCVA 3ZSTA 3QZEA 2A7NA 4YLWA 4LAMA 2G96A 3NL2A 2GQ8A 2UZ9A 4YMZA 5DBUA 1M65A 1MQQA 3FY1A 1XIMA 3QGAC 2TRSA 4A2RA 3L0KA 2DZXA 3W01A 3D3AA 3A3HA 1FXQA 3S2NA 1TRDA 3WLSA 1N8FA 5AYYA 4S3CA 1T99A 4ZBCA 2H9AB 1AW5A 2PLJA 4GKTA 1KRMA 3H2FA 3HF3A 1TMHA 1LYXA 4CKQA 2UY4A 3NZGA 3TYUA 4J3WA 1SZFA 1DWJM 4MJMA 1ESWA 4A8IA 2BV9A 1FWTA 4Q4RA 2JKPA 3QYSA 3JUGA 3OVQA 3W72A 3N6QA 5E0KA 3APGA 4LNYA 3TA9A 4JDBA 2INEA 1G6CA 5AB3A 3UZZA 1QK2A 3A3XA 4A3HA 3FLUA 1Q8AA 1TREA 4PCPA 3O63A 3CNYA 4PMNA 3UNTA 5CBBA 1RBAA 3GR4A 4H8UA 3AIUA 5LNVA 3EDKA 1X8FA 3GTFA 3PBMA 3WDRA 3BDKA 1EF2A 5FL1A 1M3UA 5B80A 4JX6A 4PSPA 3L0NA 3CQIA 3ATYA 1B31A 2PFHA 3GO2A 1CWYA 1M53A 3UG5A 5CPOA 3V4BA 1E4NA 3NURA 2XZ9A 4UFHA 2WMIB 3ZT6A 2WVTA 4XD4A 4ZTYA 3B3DA 4JXCA 1UZ4A 1BG9A 1OABA 2QJGA 4ZSTA 2YCJA 4UWMA 5EKYA 3VCRA 1KFCA 4KMQA 4WLCA 1NOUA 4TTUA 1XIJA 1BFNA 2P0IA 3NPXA 1GQKA 2PTWA 3SFKA 4GYJA 1W54A 4JDYA 4W8BA 3R0KA 1VD6A 3H22A 2NT0A 4GLEA 4PRTA 1ZBWA 1GOWA 1VPQA 3ANUA 3WQDA 3E5BA 4HT3A 7REQB 3L65A 5I3FA 5I03A 3QOMA 3DG6A 1T6MA 4RDZA 3W25A 3Q58A 4NZJA 3VOCA 3LLFA 3HB9A 4WKFA 3UWEA 3KTCA 1ITXA 1V8EA 3MJYA 3DYMA 4JTIA 5E6ZA 4AZHA 1TPFA 4RJEA 1MXGA 1TE1A 4X63A 2G4FA 3OBAA 3KTSA 5F2MA 4C6OA 2VT0A 2ZRWA 1XGEA 2WNZA 5DY2A 2Y63A 1SVDA 1DYSA 3S6DA 3CC1A 4ZENA 3C3UA 2ZZ6A 3OYXA 3VE7A 2PDIA 5DANA 3L4VA 2PRLA 1D3HA 4E2VA 2PF0A 1BPLB 3ZOAA 4F0LA 2O9OA 4JFSA 1Q6DA 4MWAD 3MI2A 5CLWA 5CEWA 1KC7A 2HVMA 4DO7A 3ENLA 4G6CA 3K4WA 4JKKA 5E9AA 1Q4NX 5HWMA 3KE0A 4W7VA 3WD4A 3W1NA 4GBDA 1HL8A 4GOAA 2X0SA 1EQCA 4P8VA 2VZSA 3T8LA 1EBHA 2X2YA 1BRLB 3DG3A 1KBIA 1R47A 3W7KA 2Z1VA 3QN3A 1VBHA 1B4KA 2PTXA 4E2BA 3TTEA 1QASA 1PWMA 3RXZA 1YLVA 2ON3A 3LLDA 1F3WA 4N4QA 2C16A 1CGXA 3VINA 4ORMA 4GA8A 1NOWA 3BQ5A 1BGAA 4CCCA 3A47A 2BY0A 1E3ZA 2FZMA 2CWNA 2RH9A 1K3UA 1FY6A 3NZQA 4OTKA 3F2DA 1TKKA 3N4EA 3JR2A 4DF1A 1ZTVA 3WQVA 4HJFA 3QOKA 4NZ4A 2PU1A 2PDCA 1JCLA 2XUCA 4NI8A 3PPFA 4Q6XA 2HDJA 3EEZA 3B8SA 2BXZA 3CYVA 3QHNA 5E09A 4AYGA 1DOSA 3M5YA 5KINA 1E43A 3OP2A 4C6IA 4G7FA 4C7FA 5LGXA 3WQGA 5TD4A 1E5JA 5D2TA 4P8UA 5D30A 5A69A 1WDPA 4XSLA 1QI0A 5EGRA 4FF5A 3WD0A 1Z6KA 3IACA 1OQFA 4ZA0A 1OHLA 4PUJA 2DDXA 5DT5A 1VFMA 3PJTA 1YBQB 1O1ZA 2YKKA 2X30A 2EHHA 4GI8A 2ODOA 1TPWA 4HPNA 3MZ2A 3RITA 1D3GA 5HR7A 1XCWA 1VCFA 5BMWA 1O12A 2YOCA 3ZSSA 1JPKA 3NL3A 4YXGA 4A35A 2ZUSA 1EJVC 2J4GA 4H7VA 4GZEA 4M7TA 1O5QA 3CV7A 3FAWA 2Y0FA 3WK2A 4UC5A 1YPXA 3A12A 3GYCA 2FH6A 5C55A 3EWBX 3MBDA 2VFFA 2VZTA 3P14A 3W86A 3CAQA 1XYLA 2VFEA 3AHZA 3PTKA 1HT6A 3WF4A 3TC3A 4Z1BA 3G1DA 4GPNA 4KIEA 4IXXA 3FKKA 2CZ5A 3PZTA 3VA8A 2TODA 1MQRA 1EJXC 5DMNA 4ZODA 1GOKA 1SW7A 5GJMA 4C6LA 1C8VA 1GK8A 2HE8A 2CXGA 5D2XA 2W4XA 4XKYA 3EMZA 3EGJA 2PMQA 1MSSA 1YMYA 3DECA 3I6RA 4AC1X 1EO5A 3B40A 4ACYA 4IM4A 3NFUA 3M0YA 3MWCA 4FX7A 4O1FA 3GW3A 5JVLA 3IAPA 1EDGA 1CXEA 4XAPA 3PWIA 4JEQA 1ZCOA 3P0WA 3OLIA 3MKVA 1PTAA 1QPQA 2BOFX 1DWAM 5LXEA 1O7AA 3FXGA 1VFLA 3POHA 5KETA 2VDHA 1W5OA 5G5IA 2FJKA 1J10A 2E9MA 2XVLA 4PUKA 3GC5A 4IL0A 5M1TA 4J27A 3ARWA 2ZRZA 2ZZ7A 5DCEA 3VKBA 2V2CA 1JCJA 3UG8A 4MZ1A 1P0EA 5D05A 1IZJA 3TP4A 4Q7IA 4IISA 4QEHA 1TPDA 2O4QA 2DVTA 3CYJA 5C9ZA 2WK2A 3KP0A 5GNYA 1X1ZA 3S47A 3T7VA 1KFBA 2NSOA 3BG3A 3VGDA 3W75A 2R8WA 5DN1A 4S3EA 3RIKA 3FFSA 3FGCA 4HNTA 3N25A 1G4EA 4R53A 2VTFA 4RZ6A 3EA2A 4GUFA 1DJYA 2YBVA 1RXOB 1ZJHA 3EB3A 5KTLA 1J0KA 3L4XA 4BF9A 2FVKA 2FVLA 4TVCA 5I3DA 1W5PA 3GKFA 4JN7A 1C7TA 2A3LA 4MF4A 5AC4A 1B2YA 2J7HA 3TN5A 1ONRA 1UASA 5M17A 1JF6A 4M1RA 5C2CA 2G97A 4CGTA 1B9BA 3BW4A 4QJ3B 3PZNA 4LT9A 3WEMA 4O14A 3Q4DA 4YYFA 4JTQA 4W5UA 2XFYA 1XS2A 2PDKA 3B03A 2VGIA 1PPIA 3AC0A 4PBEA 2EPLX 2XYLA 3F4CA 3WBXA 3FVMA 3L4ZA 2CZEA 4IPLA 4K8GA 1YTEA 3VM5A 4YPJA 1GQJA 1FUYA 3ITYA 3EEGA 1K6WA 2GJXA 1JULA 2I1OA 3LTSA 1KBJA 4Y96A 3DHPA 4WOQA 4QLKA 3AOFA 4YWSA 1XBZA 4LALA 1TQXA 4QSHA 3RMJA 1E9YB 2C1GA 3GR7A 2YYUA 1EEPA 3UG3A 3HPFA 4N4PA 3FXYA 4I5UA 3AIWA 1SO5A 4JEJA 2FIQA 5K9DA 1JDFA 2G8ZA 1S38A 1MEIA 3CEPA 4K6AA 4QCEA 4PZVA 4C6PA 4MNKA 4EX4A 5CGTA 4NSBA 3BVJA 2FPTA 4M56A 2E28A 1JQVA 2IKIA 4DYJA 1V3MA 3PJWA 1GQNA 1T8XA 4KCTA 3GXIA 3HGJA 3KZSA 1BF2A 2E1DA 1QWKA 2F6UA 2Y5SA 2GJNA 3CHFA 3DYPA 1TV2A 1EJWC 3E0VA 4JNZA 3NQBA 3KRSA 3HJZA 3GU9A 3G8RA 3E3HA 4PMDA 2ESCA 5AN7A 3GM8A 4YVVA 1KKOA 1JI1A 3QVQA 1OFDA 4ICCX 2W91A 4ACZB 2G5WA 3TMQA 3UA3A 1UG6A 5DF0A 4ZO8A 3MBFA 2GDUA 4ONVA 3UBPC 3KFTA 2HS6A 1IWAA 2OLHA 1W1B1 4X9YA 4WX2A 1XGDA 2VP8A 3CK5A 1R0MA 3B8VA 2ZA3A 3I7SA 4GZJA 4FS9A 4UXDA 5HNNA 3WLOA 1QW8A 3L23A 5CC6A 4GFSA 2Q6ZA 3IVTA 3BTNA 4MUPA 1UR9A 4DM1A 3ITOA 3LRKA 3PZIA 1F3XA 3UA4A 1JEZA 8A3HA 4CQCA 3TOYA 4HPHA 5C70A 3HGSA 3RGTA 3SGZA 3VD5A 2ZZ2A 5B7YA 2ZDSA 2ZVIA 5HDRA 5AZ0A 3GY1A 3PBWA 2CLPA 1FCQA 2Z2BA 3PNZA 3FK4A 2CEQA 4DJDA 2ZKMX 1ZJBA 3C2OA 3CIWA 3VIJA 3GU2A 4MZ8A 1DJWA 3OPSA 1V93A 1W1ZA 1TUXA 2GVEA 4PMZA 2WMKA 2VGFA 1M7OA 2PODA 3C56A 1FDZA 3PN8A 2CLMA 5FF7A 5I07A 4I3GA 4LCQA 3MMWA 3M5ZA 3W83A 2O56A 2IPGA 4B4FA 3A21A 1L8PA 4KESA 4JQ3A 2YB1A 2OVLA 1TZ9A 2YFNA 1XIGA 4ASTA 5CJ5A 3NTYA 2FTPA 5M2FX 3CAKA 3P84A 3F7JA 1QDSA 2B7NA 2YXOA 3S46A 1ZJAA 1H4PA 1S2TA 1E1EA 3GTXA 2YL9A 3BO9A 4J9JA 5A3HA 3ATZA 2ACSA 2FB3A 2ZQ0A 1PHWA 4AHPA 3GTHA 2V68A 4GY1A 1R9XA 4NJHA 1TQJA 3H2MA 4HU0A 4ZE4A 1WKYA 1LBLA 1MFVA 1OX4B 4UFJA 4UIOA 1WV2A 4HHHA 3STPA 1V3KA 5D04C 1RUSA 1TX0A 3E38A 4K37A 3MUY1 2ZZ3A 2QGHA 1RA0A 4DI8A 2NT1A 1PYMA 3W7JA 3LZ3A 3SCUA 2WM0A 4AX6A 3W7PA 3B9NA 1O95A 3XIMA 4QLLA 5CZTA 5G1MA 3CQJA 1J0IA 1KRCC 2KX9A 3BMWA 1XLAA 4O54A 3FEQA 4QLJA 2Q71A 2QJMA 3RUBL 3L0GA 3LA4A 4LS1A 2GVLA 4PTVA 3TNBA 2E4TA 1F74A 2OT0A 1F8MA 4AD5A 2NQ5A 1TUFA 1LOLA 1B4EA 2FB2A 4J5NA 3RLGA 1GVIA 3PF3A 4LTSA 3W2JA 4NYUA 1H7WA 4AIBA 4F66A 1NU5A 4DZIA 1KWKA 3DI0A 3EXSA 2R1MA 4XAFA 4HN8A 2J79A 4OUEA 1SJAA 2DVUA 4HHLA 3WUFA 1ZAIA 1YEYA 3UXAA 4H83A 1VS1A 3UEQA 2V3DA 1TR9A 3V5OA 2RFGA 3I7RA 3V16A 4LWWA 3P5YA 3W6YA 5CZ0A 3KOFA 1H1ZA 5H1WA 3CPUA 1KW1A 2XH4A 4XBSA 4N7QA 3OW1A 4H01A 3LY0A 1O68A 1ISWA 2QF7A 4MDOA 3AMGA 1DTNA 4QAIA 1XQLA 2BDQA 2WPGA 5AHFA 3OVPA 3UERA 2IS7A 1M6JA 3L21A 3DGRA 3HGOA 4W86A 2DIJA 4V1XA 1A4LA 5C9XA 1UD8A 3RILA 4WXZA 2FPVA 4LUSA 3W24A 3B97A 3NXLA 5BOFA 3O0FA 3ARQA 4MHBA 1E6PA 2J6XA 4TR9A 3KBJA 1Z41A 4LF2A 3IUIA 4N6EA 1KV8A 2A1YA 3W26A 1EJSC 2VX5A 3IJ7A 4U3CA 2ISFA 2DSZA 4REQA 3L66A 4GIRA 1SJCA 4CQAA 1P0DA 1OX6A 2G3MA 3SSZA 3VFLA 1VP5A 4M19A 2WSQA 2NSXA 3QGVA 1A50A 4X3ZA 1LL6A 5FAJA 3ICJA 3T78A 4DO5A 4C6BA 3USZA 3CUIA 4O1EA 1BKHA 4JQ4A 4D6IA 4F2TA 1NP0A 2BS9A 2OU4A 2D23A 3WIJA 1SUXA 2W3ZA 4KKXA 2HNHA 2GOKA 2F38A 1GTEA 4MWAA 3FSUA 1A3HA 5HJLA 1I2PA 1I60A 5AKQA 4KQNA 1AL7A 4PSRA 2PU0A 3SIZA 1CW2A 3AISA 4U2ZA 3D6NA 3HN3A 4O11A 1Y0EA 4YU1A 4XKMA 3H2OA 1PKYA 2PTYA 5HPOA 2KAUC 3GZ3A 4BCEA 1U33A 4LVAA 3GBDA 2WMJA 5EFFA 1ODUA 1HW6A 1KR1A 3BV7A 3WNLA 4GFIA 4AZCA 4LFYA 4MB5A 1I2OA 3QLDA 4GQGA 1JRBA 2DQWA 4AVOA 4N6FA 2WZMA 1H7NA 4EF9A 3MP5A 1JXKA 1Z8AA 5DMYA 1CX9A 2CXEA 3RG6A 5CPTA 1IEXA 1RD5A 2QPXA 2ZRUA 1KM3A 3G1HA 1KFJA 1BVNP 2VD8A 3OGRA 5AOUA 3WUBA 2WKJA 2WJZA 3U5UA 2DJXA 2OO6A 2XHYA 2VNCA 4D8AA 4NJGA 1BXNA 4A21A 5A8OA 1TG7A 5JH1A 2WBGA 4WGXA 2JGYA 2V8ZA 4J3ZA 1UUOA 1DHPA 1MUMA 2XJ7A 4AWSA 3EDJA 1QK0A 1VFHA 1DJIA 2AGTA 2GQ3A 3HFYA 3KHJA 3GHUA 1XIFA 2PDYA 4GVFA 2E9LA 2QUMA 2OQLA 3VDHA 1CT5A 5AC5A 3KBSA 3AROA 1HXJA 3I3EA 2ISVA 3QKZA 1Z3NA 4NX0A 1E0UA 2HVNA 5HQLA 3S2JA 5CAKA 4MY9A 5ECVA 4KCWA 7TAAA 2C7FA 2WWCA 2HWGA 2ZX7A 2HVOA 4H9VA 4S3BA 3SCNA 1KBLA 1D8CA 4KBXA 1TTQA 4JTHA 3WLJA 4WVXA 3PTMA 3P0XA 3IIVA 4D6EA 1TELA 4F40A 6CGTA 4NQ1A 4YTQA 1IXOA 5GJPA 3LD5A 3WLIA 1VFTA 3TZNA 2WQDA 2SFPA 7A3HA 2PP0A 1F61A 5BROA 4PB3A 1GKRA 2OX4A 1C91A 3TUUA 3QJAA 3DKLA 4FP1A 4X0NA 5ABHA 1J2WA 4PMUA 4FNSA 4L80A 1QATA 3DC0A 2RJGA 3WMSA 1K7EA 1GJPA 3UZXA 4RNIA 3P3BA 3PG9A 3IIXA 4HIBA 3VU2A 3EOSA 1LG1A 3GVRA 3SADA 4NRSA 5LIWX 4V33A 3CZLA 1F6YA 3R89A 3WL0A 1A4MA 2JQXA 3LK6A 3TQVA 4J3VA 1DTUA 2GGGA 3BWWA 4AG0A 2CLEA 1NAL1 1ZHAA 1HUVA 2JKAA 3BG9A 3RLVA 1WDSA 5GQBA 1DJXA 2ZA1A 4D6GA 1WX0A 1X98A 2GJRA 3O6YX 3Q65A 5F4SA 2PAJA 4WY0A 1BEUA 1EWDA 1XIDA 3PM6A 1EOKA 4GQ0A 3BCFA 2IKGA 3LXAA 3VXGA 2ZUMA 3UESA 3ARRA 4B9ZA 3ANYA 3N3MA 1AMYA 3WQEA 2D69A 5A6AA 3LCHA 4G1KA 1FWEC 4O0ZA 2W27A 1BYBA 5PTDA 4DUVA 2X1SA 4V27A 4H41A 5XINA 3WUEA 4E8CA 3TN6A 1GZGA 4AWUA 4JYFA 1HJUA 3AQUA 4L65A 1F9CA 4LUYA 4HK7A 4JN8A 3EXRA 3U2EA 1TSIA 1AK5A 3VOJA 4GNJA 3GNDA 3KWXA 4MFDA 1V08A 5I77A 4TO8A 1B3VA 1Q6LA 2HROA 4ZQCA 5KSWA 3C0QA 2PUZA 5EB8A 3ERPA 2Y89A 3WNMA 3FYPA 4ZQMA 1YTDA 4IFKB 4FLSA 1W0MA 2JEPA 3SGGA 1TPVA 1RK5A 4US6A 4XSMA 4UFIA 2QLYA 3FHQA 5A8MA 3E2RA 3VDCA 3B0XA 1UKOA 3LCWA 4DO6A 2QS8A 3B4UA 3I10A 4AY8A 3G1SA 3QTGA 1EF3A 2WNWA 2IXUA 3RDKA 4MB4A 1VEOA 2OLAA 3P61A 3HZ3A 5HJYA 1JAKA 2ZA2A 4CVUA 3TTQA 3GIYA 3GYEA 3VIHA 4OHQA 3ABRA 7CGTA 5AYIA 3SURA 1A5SA 2YBTA 4P2VA 1V0MA 1RJRA 8RUCA 4IJCA 2X41A 1QOQA 5LA2A 4BQ2A 1XHGA 1XIBA 4AXNA 4JN6A 2R91A 3VKKA 4B91A 5CLTA 3PAJA 4GO8A 2BY3A 3TN3A 2A85A 4HKPA 5AZ1A 5K3VA 1OX5A 4YYCA 5KEZA 1DWHM 4WRHA 2P76A 4U3AA 4NIRA 1XC6A 4LXFA 3ZJ8A 5GVJA 1V6WA 4DUOA 4GI9A 4FALA 4LGXA 3V7PA 2I56A 4JHOA 2CBUA 2NX3A 1JJKA 1H0GA 3TFXA 2VUYA 3NZ1A 3ME3A 3VNJA 2QVHA 3ONBA 6ENLA 1UA3A 2WVUA 4ZSUA 2BFGA 4CN4A 1LP6A 3UR2A 4N02A 1EHNA 4OOUA 2BZNA 3G1VA 2CLFA 4EXAA 1WDRA 2ZRYA 2ZUVA 3SRKA 3O2LA 5A2BA 4QDWA 3OEXA 1K9DA 2V2DA 1SMAA 3AAMA 5FJTA 3G1RA 3TOPA 3PBGA 1V02E 2MANA 1F6PA 1VIZA 3HTWA 1CGYA 3SJNA 2XSXA 3H2AA 1OT1A 2D3LA 4L6DA 1WBHA 3E74A 4BWLC 1EC9A 3MDWA 4CUCA 3MCNA 1ADSA 3PUOA 1AL8A 1Q7ZA 2Z00A 1M1BA 4LW7A 2YGYA 2Z24A 2OSYA 4UTIA 3W1QA 1RLDA 3CAVA 3IANA 1A0CA 3EAUA 1DJGA 4WUIA 2FQIA 3IV8A 4R7WA 1MZHA 2XZ7A 3TAOA 4O1CA 1TCMA 5FSEC 4Q4MA 4YTSA 3DERA 3IK2A 1XUZA 1KGWA 1LF1A 3ZLHA 2EG8A 2X2GA 4XZHA 3COTA 1T41A 1YYAA 4XIAA 2PDNA 1V0NA 5CSUA 4GNKB 1F07A 1US3A 1DBTA 3V5FA 1P0BA 2VQTA 3FEMA 4R34A 4UR7A 5C6MA 5C9WA 1U1JA 1J0HA 3V36A 4AQLA 5U4NA 5CKSA 4RKAA 3W7MA 3VOGA 5I3JA 2XU2A 4GABA 1J5SA 3K8KA 3A13A 2ZOXA 4IIDA 4M82A 3M46A 2FGBA 2WANA 3ZJ7A 1UWUA 1VBUA 3AYVA 3GIPA 3VZYA 5AY7A 2DZSA 2GWNA 2XISA 1OSEA 1VLIA 4FSAA 4OE7A 4FX8A 1W1IE 5F1UA 2C3ZA 4Y6GA 1K9TA 4AVNA 1DJZA 2E5BA 3DHFA 5C0QA 3PZGA 4LAKA 3W1MA 4D6FA 2QPUA 3F1QA 3BCDA 3G0SA 2CLHA 3HPSA 3E5PA 4JS3A 4MYAA 3TSDA 1M01A 1UZHA 1MI3A 3A3WA 5C5YA 4K7VA 3BPWA 3ZR4A 4I6KA 2QCNA 5A1AA 3TX9A 1JZ8A 3UPBA 1DPMA 1E51A 1U83A 3CUXA 3EB4A 5BXPA 5FF2A 1MQPA 1E5NA 1FWNA 4GKLA 3T09A 4KERA 3M0JA 4JY8A 3U2OA 1PX8A 3WH9A 3VD3A 2O0TA 1D2KA 2DUXA 3NQCA 3T2OA 3M64A 1VFSA 3NDZA 3ZVIA 1E4LA 1U5JA 4GI6A 7REQA 4GX8A 3MVIA 3HOJA 1IZKA 3RPTA 3BAWA 1LL7A 1S2CA 4PUEA 4XBJA 1UH3A 3PZVA 4FLRA 1RA5A 1UJPA 1JZ3A 4S3JA 2A6LA 4YJ5A 4JY9A 1RY0A 1JNDA 3THQA 1WYIA 2CLKA 1S39A 1XDMA 2OCZA 2JKEA 2PCQA 1TV5A 2W9MA 3NM3A 2R6OA 3SN4A 5K9CA 1AODA 1VZWA 1UMLA 3H55A 1ICQA 2JEQA 1Z7AA 1J9YA 1BD0A 5AC8A 1TMQA 3W84A 4QM1A 3LERA 1ENUA 3CO4A 1H2JA 3UY8A 5AVHA 5J04A 3Q94A 3VABA 3QZAA 3RAOA 2QCHA 4NY2A 2QYGA 1WBJA 2FPYA 4M5PA 2OWCA 2VZUA 5BYWA 4AMAA 3M5XA 2DUZA 3ARPA 3PVFA 3H54A 2AAMA 2YA0A 2O9TA 3PZOA 3TAKA 2PTDA 5H6HA 2BBFA 3AZRA 3N4AA 3ALFA 5TBOA 2VEIA 1JPHA 1DE5A 3BLLA 3RU6A 4GK8A 1BRLA 1V4YA 1Q8JA 4RR4A 3EX4A 1DP0A 2D0FA 4HB7A 1EEXA 3HPZA 3DGBA 3C6CA 3I65A 4LUTB 3W71A 4AC7C 4GYFA 1FWFC 1V3HA 4A3YA 9XIAA 4ZTXA 3KP1A 3GXNA 1SFTA 3T6CA 1DIOA 2PGEA 1XH2A 4MY8A 4GJ1A 1HQTA 3SBFA 3UCCA 2XH0A 4I9MA 5H91A 3UG4A 4PUMA 2VELA 4PRRA 2JIWA 4BQ3A 2FJUB 3UQNA 4L6HA 2ZRVA 4C6DA 3EYPA 2ZZ4A 1K8CA 4ZOBA 1JVNA 2GJPA 1A3XA 4DJFD 4DWSB 5HJXA 3MVTA 2FLIA 2PPGA 3VGEA 3V1PA 1KRBC 3ELFA 3L7RA 2VMFA 2E9BA 3MA8A 3EB2A 4D1JA 2OOFA 1NWTA 4QDPA 1QTWA 5A6SA 4RZBA 2X05A 3W70A 4MAZA 2Z2AA 3QMRA 2PS2A 3LCGA 2V5CA 3BLPX 1PEZA 3PPCA 4B5VA 4DHGA 1HKWA 4JIEA 1ICPA 3LQGA 3FOKA 1TJRA 1PS9A 3FX4A 3R25A 3TH6A 3IVSA 1EYEA 4DQWA 1CYGA 4LEQA 3EWCA 2AQVA 1MEWA 4Z2GA 3OOQA 3CMJA 1H1NA 3O1NA 5DMMA 1XIHA 2XPKA 4UTWA 1B3OA 1W1A1 1XSJA 1QPOA 3IJDA 5AYXA 3DAQA 4H9UA 1GNXA 3M44A 4AWEA 1RD6A 2CU0A 4D8ZA 3BE7A 1UWRA 4BQ4A 3SAZA 3ZYZA 6TIMA 3AHXA 4LY4A 1FWIC 4C90A 4I8YA 4GO9A 4JTEA 4E3VA 2D0HA 1ZPTA 1CXHA 3WSUA 5C54A 1RCXB 2DH2A 5I7GA 3TJIA 3GXPA 1X38A 3CQHA 3OTRA 4PTNA 3S4TA 3OLGA 1EDQA 2C15A 1GVQA 1IT0A 1GKQA 5CPSA 4GCXA 1E4MM 3S83A 1WZMA 4ATWA 1BYAA 2YL5A 3W85A 3WK1A 4PRWA 2Q8LA 5DCDA 3PB0A 2OGYA 1PTDA 1B3XA 3LRLA 1E70M 3BLDA 3NVDA 4C6FA 3QF0A 2E5CA 1BTCA 4A2SA 1ICSA 1VFUA 5U7SA 6REQB 3LEPA 2VFHA 3H2EA 4C91A 4XB3A 5D38A 4NU7A 4F0KA 3T08A 1CLXA 4H2HA 1ADOA 4W8AA 3THDA 1JR1A 5I24A 3QRHA 4QP0A 4QR6A 3WFZA 1D9EA 3T07A 1YW1A 4AZIA 2HCVA 3WY1A 3H4GA 3RMEA 3GDMA 3R79A 1CGVA 3UJSA 4IQEA 3B8WA 4U2YA 3ARXA 1Q4WA 4AYSA 4O18A 4E6MA 3QV8A 2GL5A 2OPJA 1WOAA 1ZLPA 3VTRA 5MF5A 2TPSA 2ALRA 3BANA 2QJNA 1FWWA 1AD1A 3CV2A 5FSDC 1EC8A 3N9SA 1TJ1A 5EL1A 5FJUA 1NWSA 1FHUA 5D02A 1W3LA 1PYFA 2XWEA 4O52A 1WP6A 1MRAA 3VIPA 2FDSA 4CEXC 5D2YA 3L4YA 3P62A 5HWNA 3CUZA 4NXKA 4D71A 1NDWA 2A21A 1AA1B 1E4IA 1EP1A 4Q8OA 2AQOA 5C2GA 3IIOA 3CLMA 2VGGA 3ECQA 4PYSA 3V3WA 4F8XA 3S9ZA 3BW2A 5E0CA 3FA4A 4FXSA 4ZFCA 2J27A 2ACUA 3VUSA 3O7UA 2D1ZA 3UT0A 4Z1AA 3MY9A 2P8BA 1HO4A 3MCOA 3N19B 4GD0A 5FL0A 4BEQA 5EMJA 2R1PA 2F2HA 4FNQA 3BZGA 2V81A 4Z1DA 2JBMA 4O4WA 3IJQA 5A6BD 2PURA 3LENA 4QHRA 2CFFA 3OB8A 1SW3A 2EKCA 3E0WA 3N15A 3VIGA 2QCLA 5DEZA 4NL1A 4L4MA 3W1XA 2F61A 4L5ZA 4RE3A 1NWUA 3A4AA 1J79A 2GGIA 1GYLA 1K8ZA 5IOBA 1XR2A 2ZUWA 2Z26A 5HNRA 4H8NA 3KS6A 2J78A 3LCIA 2B7QA 2ZTJA 4GYKA 2XIIA 2B31A 5EMLA 3TW7A 3LM7A 1Q6QA 2I57A 4DLMA 3BCJA 4CQDA 2V3FA 1FWGC 4DX3A 2VJXA 3LZ5A 1E3XA 1VAHA 2IUZA 3U57A 3WJXA 4M8UA 4XZBA 5GNXA 4BI5A 1G69A 4IMAA 1H49A 3B0PA 2DZTA 3LNMA 5CGQA 3MHGA 4AB4A 1D7KA 3LRMA 1U5VA 1TR1A 3LHZA 4AEOA 4HNLA 3VKJA 5D33A 3N04A 3WQFA 4C6JA 1IR1A 2J66A 1UA7A 5CG7A 2DU2A 2DZUA 4XZIA 2Y24A 2CBIA 3JZEA 1MXDA 2PWEA 1PDYA 2CZVA 3AI0A 4RE4A 1XD1A 3TTOA 1EKOA 4H04A 5EY5A 2GFTA 4URIA 3CHVA 4ES4A 2CLLA 1AJZA 2PGRA 3GNNA 1YE4A 2PP1A 1OGSA 5SWUA 3AMLA 4JGDA 3FYYA 4S39A 1XP3A 1A80A 1WA3A 2RKXA 1OGGA 2FHFA 1ZAJA 4XG1A 4TVDA 3KWSA 1QJWA 3WF0A 2H3BA 1YIXA 2A6NA 1XBYA 4JPGA 4G56A 1VBGA 3CS2A 4X2PA 1PKLA 4JTJA 3W38A 1THFD 1HKKA 3GVGA 3GNRA 4UFKA 3R43A 3LBCA 2DQXA 4IPIA 1A0EA 3MSRA 4K38A 4MTVA 2E77A 1WOBA 1L2QA 3T2PA 2X8RA 1R6WA 2C18A 1PZ1A 2FZBA 1UBSA 1I8JA 3GH5A 4CU6A 2WJEA 2UY5A 1E0TA 2RGMA 4LEFA 2QV5A 4P7RA 3ZIZA 3WK3A 3VDBA 3NEVA 1UYQA 3VGHA 2E8YA 2Z1BA 3NZPA 5LIUX 4YIWA 3LMYA 5HUPA 1PUDA 3ABZA 3C0JA 3WFAA 3F4DA 3MUCA 2XH7A 1YKWA 2OG9A 2X42A 4XAZA 1CGTA 3L4UA 3KDNA 4Q8TA 3T0DA 2P50A 1R7AA 4NYYA 2WHJA 2G95A 1DIEA 2XSBA 2ZRXA 3MT1A 3RFAA 4BR1A 2I7GA 1XXXA 3G22A 4MNLA 1XH0A 4QROA 3N6JA 4AIEA 2BODX 3B0UX 1DXFA 2NUWA 1HJWA 4PBGA 2CLOA 4ALDA 4PMVA 3M16A 4QNEA 2FKPA 1XBXA 4HSNA 3W00A 1H7XA 3FDGA 1XSIA 4WKAA 3XINA 3NQ7A 4YHGA 5HQMA 3H53A 5BNKA 1ONEA 1IGSA 4R85A 2DT2A 4NNBA 3IJLA 4E5TA 3C8FA 3EDDA 4QBXA 4FI4A 4REQB 3RJYA 5EMKA 1LQ2A 1T96A 2J7CA 3G3MA 1J2BA 2Z6JA 3P93A 3WN6A 2F9RA 1F73A 1KGUA 3GBEA 1TV8A 3QM3A 3ES8A 8XIAA 3C0LA 2ZX5A 4D6CA 2D22A 3NO5A 3ZO9A 2EEXA 4GGHA 2IQDA 4PEKA 1QFEA 1XKYA 1XYAA 1R87A 4IJBA 4ZQNA 1PTGA 5JQ9A 4LYKA 4HA1A 3UFYA 3V5CA 4IUGA 2FZ8A 5I0DA 2E8ZA 1I75A 3WZ0E 4RX0A 1UQZA 1UWQA 1WAWA 1QOXA 1PCKA 2P8CA 3CZKA 4B4HA 3R94A 1ELSA 3O3RA 2VFIA 3RR1A 4X0VA 3R8HA 4QIUA 3FNDA 1WPCA 3FV9A 1CTNA 1Y7VA 4RNFA 3OZYA 5D4YA 5JH2A 4QQUA 4L56A 1PL9A 2FFCA 3TTYA 1E6RA 3MQTA 1H50A 1W5QA 4DF2A 3B4YA 3TU9A 1XYFA 1W9PA 4IICA 2E09A 3S6OA 3EKLA 3U2CA 5LIYX 3WJSA 2GPTA 3RPDA 4OBRA 3VMOA 4L61A 4IG2A 1BVZA 3ZS4A 3PK7A 1XLLA 1J96A 3VC5A 3UWYA 2HQAA 1BWKA 4DWSD 3E2VA 3NQ2A 3CTTA 1IT8A 4A22A 3M0IA 5CQ1A 5H8PA 4JZ5A 1YDNA 2WLYA 4ZVJA 3WCZA 1ZNNA 1OJXA 2A3AA 3B0YA 5DXYA 4MM1A 1C8XA 4P7OA 4M81A 1W1VA 3GVQA 4CCZA 3TQKA 3K8LA 3LMZA 1RALA 3H4WA 1BSLA 3TFCA 1KTNA 1TV7A 4ROQA 2VENA 3ZWTA 3QBUA 1H41A 2QDEA 5FKYA 3L9CA 3W4RA 2NQ9A 1XH1A 2BGSA 1OGBA 5ABFB 1Q65A 3K5XA 1DORA 3VNDA 5CSSA 4D6HA 4KH2A 1UR2A 4H8VA 3R0UA 4KWUA 4C60A 5G4EA 3QPZA 3ZR5A 3VCNA 4B2DD 4DEFA 2QV4A 1QI3A 4TQTA 4PMOA 1W9XA 5DT7A 4LVGA 1LM1A 4I7WA 3IPWA 4Q22A 4RV3A 3AHYA 1EPXA 2ZXQA 4MYXA 4DVOA 4NF7A 4IGMA 1FCUA 3KW3A 1TYGA 4LB3A 1FWDC 1J0ZA 3ZM8A 1E9ZB 4XISA 2CKRA 4UQDA 4ZEPA 3AS2A 3E2SA 3BQ6A 4OVXA 3D47A 3IV3A 1T8QA 1KFKA 5A2AA 2XVGA 1BAGA 1P0NA 1LORA 2W61A 1LBMA 1K70A 1H61A 4ROPA 3KVLA 1TJPA 3OZMA 3L4TA 4AXKA 1KM0A 4Q32A 1R9YA 5BRBA 3G1XA 2AL1A 1C8YA 3U3HA 3S1WA 3FA5A 3KL5A 4ZQPA 3W1AA 3WD1A 1LWIA 4JIQA 4UTKA 3BOLA 2ISWA 4WY0B 3VZXA 4PCSA 3O0KA 3IIZA 4UMAA 3W29A 3WLQA 4F2UA 3BJTA 1R3VA 5I5RA 5D9PA 1U30A 2PI6A 1ZBCA 2PP3A 4YTRA 2CBJA 3VNLA 3ABXA 1TTJA 3UW6A 4XIMA 3QW4B 3M1ZA 5CGMA 2O7QA 3CEUA 1LLOA 5A8QA 1QBAA 1E6SM 3KL3A 2WB5A 4HSHA 3S8HA 1OEPA 1TWZA 2DVXA 4DJED 4BY3A 1X6LA 3GS6A 3VX1A 7ENLA 4NKCA 4IIEA 1Q5MA 4JTAA 4DJFA 4JQ1A 5AC7A 5BOEA 4IF2A 2ZZ1A 1OC6A 2AKMA 3PR2A 1ZBKA 3AMDA 4DB7A 3GTIA 2E25A 2DIEA 4C1KA 1KCXA 1JZ7A 3KVJA 3NDOA 1OCJA 1O6IA 3ZVHA 4WJEA 4LYPA 4JL1A 4TV6A 3DU0A 3TYCA 2J8FA 1PJ9A 3PSWA 1DWGM 2BVWA 1CGUA 2IPJA 2VO5A 5C7HA 4NZ5A 3ARYA 3K8MA 4PMRA 1EIXA 1K8XA 4HZ6A 3IGHX 4E8DA 1L8NA 3CWNA 1MNSA 5LKYA 6XIAA 4DI9A 1F5ZA 3G0UA 4GNVA 4J40A 4XBKA 2HISA 4F4RA 1XDLA 3NO3A 4DO4A 3B9OA 4UTLA 5IHSA 2FZDA 1UR1A 2PBOA 4AD1A 4HNUA 1H11A 4HU8A 1TWIA 3AUOA 1FHLA 1JDCA 2QW5A 2HS8A 3WYZA 3T42A 4H1ZA 4H7ZA 3W7QA 1AW2A 3WNKA 4NZ3A 2QVNA 3RM8A 4ILSA 3HMCA 1AQ0A 5HMDA 1P6CA 5G2WA 2ZX8A 3G5EA 4IOTA 3EWZA 1QUMA 1H60A 4US5D 1R2TA 3R8RA 1AZ1A 3I3BA 2GDVA 4YCPA 3K1DA 4HPJA 4MZYA 3USBA 2WKLA 3NOYA 3STGA 1B3ZA 4IT1A 4Z2IA 4WZHA 4Q4KA 4CNUA 3NM1A 4JTLA 2J7BA 1XL9A 3OIXA 4O17A 1W3TA 3HG5A 3N2TA 5G4HC 5E70A 1JGMA 1GEHA 1ISVA 3O8AA 4GUJA 1VBRA 3FA3A 4ML9A 3U9IA 3MJMA 2X09A 2HJPA 4UUIA 4A3QA 4DBDA 2A3BA 3M0LA 3ONCA 1XKJA 3TXVA 4HK6A 5EMUA 1TMLA 1RHCA 4GGBA 2ISSA 5FF4A 1C3FA 2EXOA 3WQCA 1K6AA 3LXBA 4IUOA 1VKFA 4IFKA 1PBGA 1I1WA 3LBOA 3PJUA 3APYA 2X1RA 5FJOA 2WV8A 4J3UA 3TJXA