4PTVA

Halothermothrix orenii beta-glucosidase a, thiocellobiose complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
445
structure length
445
Chain Sequence
IIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMEDRPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 1
publication title Biochemical and structural characterization of a thermostable beta-glucosidase from Halothermothrix orenii for galacto-oligosaccharide synthesis.
pubmed doi rcsb
source organism Halothermothrix orenii
total genus 172
structure length 445
sequence length 445
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ptvA00
3N17A 2QF8A 1KWGA 4GQQA 1FP9A 1OSEA 1E6QM 4H04A 3WD2A 5C71A 3IANA 1CXHA 2D0FA 2EQDA 1HJVA 2ZUTA 3VINA 4E4PA 4D6HA 3MUY1 4XX6A 4CU7A 3OGSA 1C91A 1JXJA 2GJPA 4CVUA 2GDVA 2YL5A 5D9PA 2W61A 1GVIA 2W67A 3AZTA 2IXVA 3BC9A 1XC6A 3I3BA 3RIKA 2DDXA 4M24A 1D7FA 3EMCA 1Q6GA 3W82A 1HNYA 1WZAA 4QLKA 4B3KA 5AYIA 1DWHM 4W89A 1UQZA 2WKLA 1OWQA 4MDOA 1EIBA 4AD1A 3WENA 4MNMA 1F4AA 5HPCA 1UWUA 4UQBA 4BQ3A 1E56A 1U30A 4BF7A 7CGTA 2ZUWA 4FF5A 4J28A 4BQ5A 5I23A 3VUPA 4AMCA 1TVNA 4EK7A 3OLIA 1E55A 2DSKA 1IV8A 4AD3A 3VTRA 3RJXA 1VJSA 4AYSA 4W85A 1UD8A 1V0LA 4UTFA 1US2A 1E9LA 3AHTA 4AZGA 2J4GA 1H0IA 3VOCA 1V08A 4MJ4A 2WVUA 4PEEA 2WKGA 4OOZA 3HMCA 1Q6DA 3RMEA 2WMIB 1K9DA 5BXTA 4DUXA 3W37A 1JNEA 1Q6FA 4MNJA 4D72A 4NRRA 4HOWA 3O2LA 4XV0A 1NWTA 1EA9C 3VNYA 4UOQA 3AIBA 5E09A 4NRSA 1KQZA 2DH2A 5E0FA 3LPFA 5CPTA 1H0GA 1C8YA 3WN6A 2J7BA 3WH5A 3WNLA 2OWCA 4ACYA 1UA7A 5I3DA 1GCYA 1QBAA 3QR3A 1EQPA 3CZGA 1CXKA 1OINA 1HKKA 3WF2A 5CPQA 3U57A 1WKYA 3SCRA 5HBFA 1UHVA 1DWFM 3GXDA 1R85A 3WQ4A 4H7VA 3WFZA 4QAWA 4PUEA 4UFHA 4AIUA 1GOQA 3GBEA 4Z2HA 4HMCA 3L4VA 1JFXA 3BAYA 4IM4A 3CUFA 1DWGM 4MAZA 3VMPA 5ABGA 4Q7NA 1WCGA 2WHJA 4JKKA 4OJYA 1JZ3A 1E6NA 5M03A 1JZ6A 1V3LA 1US3A 2XFYA 4TX8A 3T09A 1BVZA 5I0DA 2RGMA 5A6BA 4GQRA 1MXDA 3T0DA 3TP4A 2DIJA 2VCCA 4TXEA 5IDIA 2YL8A 3W29A 1G0CA 1JNDA 5M17A 1M7XA 3T2PA 2VT0A 1CGYA 3SCNA 1ESWA 1NOWA 2VR4A 4CUCA 3LPPA 3AS1A 3VD3A 1LQ0A 4QCFA 1KBKA 3VKKA 1UWRA 3B9DA 3AOFA 1G94A 1RD6A 1HL8A 2WVTA 2E40A 9CGTA 4DM1A 4GZEA 3IK2A 3AHYA 1H5VA 5IHSA 2X8RA 4JKMA 4PTVA 4DWSB 3F5KA 3ZMRA 4UQAA 2VX4A 4OOUA 2D0GA 3WMCA 3NIYA 3VMNA 3W0KA 5M5DA 4Z2LA 1ISYA 1BYAA 1WE5A 5FD0A 4BS0A 4GPNA 2XIIA 3APGA 1OCQA 2XWEA 3CBWA 2X2YA 5KZ6A 1JXKA 5ECUA 4D6EA 2E8YA 3MMWA 1KFWA 3ZO9A 4WSKA 5EFDA 1WZLA 3HJEA 2WAGA 3FHQA 3ECQA 1WPCA 2ZUVA 3WDJA 1XHGA 1PPIA 3BAXA 3M6DA 1BQCA 1JF5A 4JL1A 5JBDA 2VI0A 2WHMA 3N04A 4CGTA 4ACZA 3QGVA 1V02A 4AZ7A 4IUGA 5BCAA 2DIEA 3RM9A 4OUEA 5A6AA 3AYRA 4JHZA 4HA3A 3PZUA 2RGLA 3J7HA 3TTOA 4W7UA 4MAVA 3AXXA 4ZE4A 5IFPA 1W3LA 1VFFA 3B9AA 1MWOA 1UOKA 4WKHA 5EBAA 3KL0A 3GM8A 1W1PA 5CZKA 5HPOA 3NSMA 2BXYA 1ZJBA 2J47A 2AAAA 1SMAA 1G5AA 2DSZA 3QHMA 2J7HA 2WPGA 1CBGA 1HKJA 3VGFA 5A8PA 3FW6A 2OYMA 3ARWA 2PBGA 3WNPA 3CZLA 2XVNA 2O9RA 4FK9A 4AZBA 3FN9A 2D0HA 1CGUA 3WH7A 2WHLA 3T0BA 2GSJA 2W92A 2D23A 1RPKA 1V0MA 2ZXDA 1PJ9A 4LGXA 2E9MA 3K8LA 3AQUA 3UG4A 5E6YA 3WNOA 5A6JA 2O9TA 3VD7A 1MVYA 3MMDA 2WBGA 1W1VA 1TMQA 3WF3A 3TTQA 2OYLA 1J0ZA 3PTQA 2YDRA 1OT1A 2AMGA 2W66A 4LQ1A 1H4PA 3BSGA 3UESA 2GFTA 4P8UA 2J74A 1JZ5A 1UD4A 3AROA 5ABFB 4D6JA 4QCEA 1Y7VA 1H11A 4NSBA 3K4DA 3ZT6A 3WUFA 3VIJA 1E40A 1E43A 1HF6A 1E3XA 1UZ4A 3SCQA 1NARA 3ARVA 2WYSA 1JAEA 1JZ7A 3WD0A 2X1IA 4W8AA 1WAWA 1V6UA 3WELA 2WWDA 2VMFA 1W9XA 2JF6A 3VX1A 2VOTA 3DHUA 3BAJA 4YN5A 1QI3A 1F4HA 3KWXA 1EH9A 1CPUA 3BCFA 4OBSA 2G3JA 4JL2A 3IJ8A 2PBOA 3CZ8A 2V3GA 4M81A 3ZSSA 2BXZA 2UY4A 4V28A 3WDQA 4HPGA 3BXWA 1JZ2A 1C92A 4B16A 1EDGA 3GXFA 4C7DA 1QI5A 2XG9A 1EHAA 2XVLA 4KWUA 3FAXA 1PZ2A 5A1AA 1MW0A 1FOBA 1ECEA 3K1DA 5DEZA 3WNNA 5JBFA 3W28A 1BYBA 4OKDA 4MB1A 4AD5A 3VIGA 1VJZA 1H09A 3WD4A 5CQ1A 1C3FA 3PZQA 4L4OA 1GW1A 1VEOA 3WH9A 4GXPA 1VB9A 1XSKA 1LL7A 4Z2JA 2CBJA 3AS2A 1GQKA 4U31A 4ACZB 1V3JA 1UR0A 3OBAA 1WDQA 4ATDA 4C7GA 3VO0A 5GNZA 1R7OA 2XIBA 1G9HA 2NT0A 3VGGA 1TA3B 3WSUA 3BGAA 3EDKA 3AMGA 1ISWA 4E8CA 2XVKA 4NF7A 1MQQA 1CXFA 1NWSA 4F79A 3FNDA 1D2KA 2W4XA 1DWIM 4GI9A 1G1YA 2G41A 3A6OA 4QFUA 3ZJKA 4W8LA 2DEPA 1BGAA 2XSAA 3GDBA 3CGTA 1DEDA 4UFMA 2J8FA 3WH6A 3AHVA 1EHNA 1LWHA 5DT7A 4AXNA 1O6IA 1HT6A 2XUCA 2XSBA 1J01A 4WSJA 1MW3A 2FHBA 1CEOA 3D5HA 1EOMA 3UG5A 1B3YA 1GHSA 1B0IA 3M46A 3WQ5A 1W91A 2ZICA 3ARSA 2YL6A 1EOKA 1UKOA 4FLOA 4GI6A 1V02E 4W93A 5DT5A 1MQPA 2VQUA 5I6SA 3AZSA 1Q6CA 3VIKA 2X05A 2EPMX 2XWDA 4KGLA 1BPLB 2WWCA 4PMZA 2BHYA 4AC1X 1R8LA 3K8KA 2J7GA 3T2QA 4JFUA 4U5IA 5F7UA 2Y24A 1PAMA 4UQEA 1W32A 1K9EA 1LJYA 2ZXBA 2J78A 3WD3A 3A47A 1CGXA 1H3GA 2DH3A 3AS3A 1E4MM 3KE0A 3N11A 4IISA 1ISXA 4MTVA 3ZJ8A 2FDMA 1UZ1A 3EMQA 3RM4A 4AZHA 3VIHA 5A2AA 5GPRA 3VGDA 1J0YA 2DT0A 1GZJA 1H41A 3AJ7A 1MXGA 1W9UA 3LPGA 2ZX6A 1JF6A 1VENA 1VRXA 1J0HA 4PMRA 1BG4A 4M29A 3WDPP 4YPJA 4TUFA 1M04A 4MADA 1PX4A 4PBGA 4E2OA 1BLIA 4UQ9A 1V6VA 4TTUA 1XCWA 1FHLA 4P8VA 4AEEA 4WKFA 1SMDA 2G3IA 3U5UA 3RM8A 1JYNA 1NQ6A 4BQ4A 3ZT7A 4MPKA 1E1EA 4LX4A 2YIHA 3UEQA 1E6RA 1UWSA 3FHAA 2G8ZA 2A3AA 5FL1A 1FH9A 1TG7A 3AXIA 4U2YA 2V3DA 3THDA 4B9ZA 6TAAA 3GTNA 2W63A 4W5ZA 3KL5A 4NI3A 1XSIA 2WMJA 3ZR5A 2VRJA 2PF0A 5A69A 2YA2A 3AXHA 3VDHA 4A3YA 2Y5EA 1TUXA 3CO4A 1QOXA 3SUWA 2V3EA 5LYRA 1FFRA 1B9ZA 3OZPA 4IPLA 3PZTA 4X0NA 2BY3A 3B9EA 1XH1A 4M1RA 1B3ZA 2WVVA 3DC0A 3WQVA 5BRPA 1U2YA 1WDRA 4PYSA 3QOKA 1XSJA 4F66A 5A2CA 4PSRA 3ARZA 2WXDM 3POCA 4D6DA 3SCTA 5CGMA 1OM0A 3TOPA 1KB3A 2CIPA 1GQIA 2WZHA 4UOZA 2A3BA 2X0HA 1E3ZA 2F8QA 3GNOA 2YOCA 2BVTA 5CLWA 2PWDA 1XD0A 4PMDA 2TAAA 1QNSA 4CKQA 2J77A 3ZQ9A 3PZMA 3E1F1 2D2OA 3DECA 3IJ9A 3AMCA 4P8WA 4KGJA 3B8SA 3WDHA 1JAKA 2CESA 4PMXA 4A3HA 1DWJM 4CD8A 1E4IA 2JIWA 3PZGA 1QW9A 4QLLA 2E4TA 5HOSA 1LWJA 1QHOA 1UKSA 1UUQA 3GNPA 3RO8A 3HU7A 1JIBA 1GNXA 3CHDA 4PTXA 1GOMA 1DTUA 1JYWA 3SIMA 2Z1KA 3MO4A 1MW2A 2WZIA 1Q4NX 1UA3A 2ZOXA 3SCPA 5C70A 3SURA 3WEOA 2EPKX 4AW7A 4AD2A 1ZBVA 4Z2KA 3VILA 3AMKA 3WUGA 2CCRA 5I5RA 1JDCA 4RE3A 3EDJA 4P7NA 4CN1A 4AZIA 4CU8A 2WNWA 3RJYA 1VFUA 2A3CA 7A3HA 2XTKA 4H8VA 1K9TA 3CUHA 5E6ZA 1NH6A 5FCZA 3BAKA 2JE8A 2CKSA 3ZSTA 3MU7A 4ZEPA 5DMYA 5A8OA 3SCOA 1V6XA 3MSGA 4JFVA 5ABHA 2VO5A 4Y7EA 5BROA 8A3HA 1ZJAA 1J18A 1ZBCA 1UH2A 4HZ7A 1UWQA 2ZWZA 2VZTA 2EPNA 3VU2A 3HN3A 2EPLX 3AIUA 4AWEA 1B3XA 3WH8A 3SCWA 4PMYA 1ISZA 2GK1A 2YA0A 2YBUA 2EJ1A 2VL4A 1JD9A 5I77A 1XYZA 3EDFA 1KGUA 4HPHA 3OB8A 4FLSA 3MS8A 2XFRA 1J0JA 2Q8XA 2ZIDA 3WF1A 3OLEA 2YDSA 4HU0A 4B9YA 1DWAM 5A6LA 4XUYA 1GQLA 1QNQA 1YQ2A 4HU8A 2JALA 2WVVB 1W3HA 3TTSA 1UH4A 3A3HA 3L4TA 1UR2A 2HVMA 2J75A 4KRUA 1UR4A 1R86A 4P7OA 4N42A 2E0PA 5E9AA 2VTFA 1V6YA 4UFJA 1E71M 2EBNA 1UR1A 3AIVA 3ARYA 4QDMA 1NOFA 2BHUA 1H2JA 2G3MA 1WO2A 1ZBWA 2BNJA 3OLGA 5FIPA 4MDPA 1KXVA 4PSPA 1HP5A 4TVCA 2WLYA 2WLZA 1XYFA 2CKRA 5LA0A 4HZ6A 1W1TA 3RILA 1N82A 3GNRA 3BMWA 3ALFA 1GOWA 4M56A 3AI0A 2PWFA 3AHXA 1ODUA 4J27A 4KMQA 3T08A 2YL9A 1BYCA 1UD2A 1KWKA 2VZOA 2WSKA 1EQCA 2F61A 4XZBA 4PTWA 1HXJA 3PTKA 5CJ5A 2E8ZA 4U2ZA 3L4UA 3AICA 1UKPA 3UR7A 4ATLA 4UFIA 1HIZA 4EAMA 4UCFA 1C8QA 1QI2A 3AS0A 4FLQA 4Z2GA 1DP0A 3WEMA 4F9DA 1BGGA 4UZSA 2ZUMA 1QBBA 4U5KA 4BQ2A 3VX0A 3W6LA 2E3ZA 2ESCA 1EDQA 5D4YA 2FHCA 3SCUA 4CD5A 3DYMA 2J79A 3L4WA 1E4NA 3LMYA 1KXHA 4HA1A 5A2BA 5I24A 1ITCA 1BVNP 3CMJA 2DSUA 1P6WA 3CPUA 2GJXA 4P8XA 1UKQA 5JIWA 4D1IA 1M03A 1NM9A 3PN8A 2ZX9A 3PBGA 3UCQA 2VNCA 1JL8A 1E15A 2WVSA 3K46A 2WHKA 4FLRA 3K8MA 1WNOA 1BTCA 1ZS2A 3MV01 5AYBA 5BWFA 3MKKA 2WMFA 2ZE0A 1W3JA 2GK1B 4UZUA 4D6FA 1BSIA 4PUDA 4A4AA 6A3HA 3MUIA 1CLVA 4MNKA 2CHNA 1J10A 3GBDA 3VM7A 3MV11 5ABEA 1QW8A 1ISVA 1KQYA 4JFSA 1TVPA 3WUBA 3CTTA 4CD4A 3ZR6A 4AZCA 3N15A 2WCGA 2WK2A 1I1WA 3CLWA 2WW5A 1J12A 2DT3A 1GOKA 2Z1SA 2W5FA 1H1NA 2Y2WA 1Z32X 2CERA 2CETA 4MB5A 2ZUUA 3GYCA 5EB8A 1GOOA 2XVGA 2A3EA 4UNIA 1BYDA 2QHAA 3VMOA 5D8WA 4V27A 2FHFA 1VAHA 1PX3A 1GJWA 1TE1A 3VIPA 3TONA 1OGGA 4J3WA 1UD3A 5DFAA 2D22A 1J9YA 2UY2A 1KR1A 3N1AA 3VIOA 1R87A 3FAWA 1M01A 5A95A 4J3SA 1C7SA 1CNVA 2CXGA 2D1ZA 2WC3A 2XGIA 5E70A 1GOIA 3AHZA 3PTMA 4HMEA 4CU6A 2OYKA 4GZJA 3ARXA 3WQWA 1UKTA 1UYQA 4CD7A 1L8NA 4AD0A 4AIEA 3F4VA 1I1XA 5KEZA 3SUUA 1JYXA 5CLTA 2YA1A 1EGZA 1KBBA 2VX5A 2VURA 1H49A 4HZ8A 3W6MA 3U5YA 2DT1A 4E8DA 1HJSA 1W9BM 4PMOA 3ARPA 4HMDA 2ZUNA 1V0KA 4TVUA 1XD1A 2ZWYA 1V3HA 1UR8A 3CZKA 1OIFA 3AMDA 3W24A 2D24A 4PCTA 4GIAA 3IAPA 2E9BA 2PI6A 1K6AA 1XRVA 4CD6A 3VIIA 1HN1A 2JFEX 2J62A 2NSXA 2AOSA 2FGLA 1E4LA 2PWGA 3ZJ6A 2GJXB 4PMQA 2BHZA 2MANA 2D20A 4KH2A 4MB3A 3NUKA 2VRQA 2O9PA 3PZIA 2WM0A 1WZMA 1OD0A 2DQXA 3BAIA 3S2CA 4HOZA 3G6MA 3AIRA 4D6CA 4J3VA 1CDGA 1FP8A 3PHAA 2GDUA 4DWSD 1JD7A 5A6KA 3AIWA 1FHDA 3WBEA 1PEZA 4Q22A 3WNMA 1OT2A 2VX6A 2VJXA 1KGXA 1MQRA 2E9LA 3KL3A 2WMGA 4J3TA 5HDRA 5AC4A 2VZUA 3AMLA 3NSNA 1EXPA 5CXPA 1V3MA 2W91A 5CG0A 4MNLA 4H8HA 1W3KA 1MFVA 3MUZ1 3W26A 2CPUA 3NCOA 4AZCB 1IT0A 4UR9A 2OSXA 1GUVA 1VIWA 2XFFA 2QPSA 1J11A 5CSUA 2QPUA 2BV9A 4AISA 4HA4A 1AQHA 2VVNA 2EO7A 5D9OA 4HOXA 2Y8KA 5EMYA 3WBAA 3RDKA 3QHOA 2B31A 4ZFMA 1IZKA 3N18A 3PZNA 4D6GA 1YHTA 1U33A 4LPCA 3ARRA 4EKJA 4BZYA 3TTYA 5I78A 2Y4SA 5IFTA 2FGZA 4D6IA 2EXOA 4EE9A 1CECA 2XYLA 4UOJA 2PWEA 2BVDA 4UFKA 3M7SA 2OWWA 5HXMA 1FH8A 1SFSA 1BG9A 1QNOA 1CLXA 1PX8A 3I3DA 2J7FA 2WBKA 4S3KA 4DWSA 1VEMA 5A94A 1CTNA 4IPNB 4J3XA 5JBEA 2J7EA 3TA9A 4OZOA 2GJRA 3L2MA 3WFLA 4ZENA 2BY2A 5EFFA 3SUTA 4CN4A 4W7WA 1MFUA 4U33A 5TD4A 4P7RA 2J8GA 5LA1A 3CZEA 1W9PA 2Y8VA 1W9DM 1WB0A 1QPKA 4ML4A 2VX7A 1CXEA 1GJUA 3NDYA 4X0VA 3K4AA 3EYPA 1QNRA 2CHOA 3VIMA 3VD4A 4GINA 3WKZA 5A6BD 3SEPA 5CPSA 2VQTA 3EBVA 2FH8A 2HISA 3ARTA 2OSWA 2DSWA 4AZ6A 1CGWA 3L4YA 1NP0A 1XH0A 1QI4A 1OGSA 2V5CA 5DO8A 1CYGA 4K68A 2ZX8A 3NYDA 2WZEA 3ARQA 1AMYA 3AZRA 3UERA 1ITXA 4L4PA 1KXQA 2BFGA 3II1A 2PC8A 4EANA 1PIFA 5AC5A 1V3KA 7TAAA 3VGHA 3IJ7A 3WDIA 1CIUA 3ZM8A 1B90A 3SCVA 1PZ3A 2WMHA 4UFLA 2XVPA 1TCMA 2WANA 1EO7A 1RP9A 4UQDA 3CZJA 4JHOA 4LYPA 3G6LA 4JCMA 4PTMA 3VD5A 1OB0A 3NJ3A 1XV8A 3W38A 4R27A 3LPOA 4LYQA 1QI0A 5BXSA 2UWFA 5DF0A 1B3VA 1O7AA 5E0CA 1BAGA 2C8NA 3MSDA 1JZ4A 1AQMA 1D3CA 1MW1A 1BHGA 4PMUA 2BY0A 2V38A 2CYGA 3PZVA 1JI2A 3VDCA 2G3NA 3AYSA 3CMGA 3WQ6A 3OA5A 4TOQA 5D9MA 1HKIA 1HJXA 3F5JA 2XHYA 1FA2A 4WLCA 3VPLA 3D3AA 2DPEA 3THCA 4HP5A 3SUVA 1A3HA 2WB5A 1XGZA 3WF0A 1X6NA 5A6MA 3GXMA 5A3HA 1HL9A 1B2YA 1MYRA 2JF7A 3U7VA 2D3LA 3NDZA 3QHNA 5ABFA 4R5EA 2YLAA 5A6SA 4CVWA 2YJQA 4RE4A 1V3IA 1L0PA 2WC4A 3GH4A 4X9YA 2X0YA 2VCAA 1HP4A 2ZUSA 3WF4A 1EO5A 2W62A 3SUSA 2WCAA 3BMVA 1UR9A 3WDRA 1CGVA 1WP6A 5BXPA 2VZSA 1C93A 2F2HA 3OIHA 4AD4A 1LG1A 4PCSA 2VRKA 3O9NA 4P7LA 5GQBA 2CBVA 4W8BA 2CNCA 1B30A 1CZ1A 3U7BA 2YDQA 3CUGA 5FKYA 1QVBA 3WUEA 3AIQA 1TR1A 2VZVA 3A4AA 4WKAA 4ZXOA 4GO9A 2A3HA 4JAWA 3W25A 2JEQA 4W86A 1BFNA 5AY7A 4ATWA 1GQJA 4NZCA 1XCXA 4TTGA 4DM2A 2CITA 3S6TA 2OWXA 3BH4A 4XB3A 4H2CA 3FY1A 1JYVA 3N9KA 3KEHA 3PZ9A 2G4FA 1JG9A 1GPFA 1OBAA 4J7RA 3WD1A 2ZXAA 5C8BB 3GH5A 8CGTA 2JIEA 1X6LA 1E0VA 1OIMA 1LF1A 3CUJA 3QOMA 1K9FA 1E5JA 4TX6A 4PN2A 4U3CA 1LG2A 2X09A 1CXLA 1PIGA 4V2XA 2J7CA 2WSPA 2ZX5A 4RE2A 5A8NA 1HX0A 4JFWA 1TA3A 1E73M 1LLOA 2WC7A 3WEZA 2DT2A 4YHGA 3AIEA 3W4RA 2DSVA 4ZE5A 4OIFA 3W81A 2ZXQA 3FXYA 3BLPX 3WMSA 1JGIA 1VBUA 1NP2A 2GUYA 1E6PA 4UQCA 3N13A 4TVDA 3WY1A 3N12A 1AQ0A 1ZBKA 3IAQA 5D8ZA 1KXTA 3VGBA 1ZB5A 3OZOA 4W87A 3CHEA 2VC9A 4D1JA 3T0AA 1B3WA 1UD5A 2XGBA 5I2UA 1JDAA 1UD6A 4LYRA 1V0NA 3WL0A 4AEFA 4GO8A 1CWYA 2EPOA 3VIFA 3ZOAA 3ZIZA 3CUIA 2XPKA 4CCCA 1DHKA 4M82A 5JUVA 1AVAA 1E6ZA 1G01A 4JIEA 2J25A 3L2LA 5IHRA 3WIJA 1LL6A 1TFVA 5GNYA 1E70M 1E6XM 4QLJA 1UWTA 1ZL1A 1HKMA 2CBIA 4WF7A 1WDSA 3VVGA 3POHA 4J3UA 3WL1A 4S3JA 3MMUA 3A4WA 2WMKA 3ARUA 4B15A 1FFQA 3L4ZA 1OD8A 4RL3A 1HJQA 1WDPA 4H41A 1HJWA 3NSXA 1NOUA 1PBGA 2YKKA 5BYWA 1C8XA 1W9VA 3WQ8A 5FOOA 4GZIA 3BAWA 3ZT5A 1NWRA 4C7FA 2NW0A 1R7AA 2QV4A 3PZOA 3OLDA 3CHFA 4FMVA 3W27A 3W53A 1XH2A 3GH7A 3DYPA 1UQYA 2O92A 1CGTA 2IUZA 3VD9A 3JUGA 3RCNA 1NWUA 3GZAA 4JKLA 2DGAA 4N0RA 2FH6A 4WIWA 3AISA 1B31A 2D3NA 5GNXA 2NT1A 3SCSA 2WCSA 2CEQA 4GI8A 1A47A 1VBRA 2YLLA 3ALGA 1CXIA 1KR0A 3WMBA 1W1YA 1OGBA 4W84A 4W7VA 2UY5A 1WZKA 3CIVA 3VNZA 3RPMA 1ODZA 1KCKA 1E72M 4URIA 2C0HA 3EDDA 3OGVA 4B3LA 3DHPA 3I3EA 2UY3A 3BCDA 1JDDA 4MJ2A 1JZ8A 4W88A 1QHZA 2OSYA 3BLKA 4GKLA 1VF8A 4WJXA 3MUAA 2PB1A 1IZJA 3ZJ7A 5A8MA 2XM1A 3VDBA 4D71A 4YHEA 2CBUA 3EDEA 4P7QA 3CH9A 1C7TA 2BS9A 1VEPA 4BA0A 4AIOA 3OG2A 1UWIA 4M8UA 1HVXA 2VUYA 4AY1A 1GHRA 4AZ5A 1GVYA 1J0IA 1HVQA 4QP0A 5JIPA 1TZ7A 2JEPA 2EEXA 1GORA 1X1NA 1C90A 2YBTA 1E0WA 4M80A 1I75A 2IXUA 3OGRA 4BCEA 2BVYA 1BF2A 4MB4A 2V3FA 1SYTA 3M07A 3T2OA 5I79A 6CGTA 1S46A 4PRWA 3AFBA 1SR0A 1W2VA 3A4XA 5BRQA 4DWSC 1JI1A 1HJUA 3L4XA 5IXEA 5D9NA 3UETA 1Q6EA 5M3WA 2OLHA 4JZ5A 1W2PA 2WMIA 4DUVA 1FH7A 4F8XA 4W5UA 4XZWA 1JFHA 3CHCA 4H8UA 3UG3A 3GXIA 1VFMA 1V6WA 3DYOA 1QNPA 3VDAA 1ZU8A 4PMVA 2XM2A 1UH3A 1J0KA 2QMKA 4CN6A 1RH9A 3VGEA 1KGWA 4LXFA 2VCBA 1CENA 3F5LA 5A8QA 5CSYA 1GONA 1E5NA 1B1YA 2J7DA 4CCEA 1LL4A 4HTYA 1E6SM 2QMJA 1RP8A 4PMNA 4U3AA 1UG6A 2C7FA 3UR8A 1V03A 2GVYA 2O9OA 1QHPA 3MANA 4Z2IA 4KRTA 5FL0A 5HNNA 4DUWA 3VM5A 4ZXLA 3KZSA 1M53A 2V5DA 3EMZA 5BXRA 2VVSA 1EDTA 2QLYA 4F9JA 1VFOA 3BSHA 2BY1A 4WK9A 3O6AA 5CGTA 2ZX7A 4JCLA 2VR5A 1E1FA 4CCDA 1E0XA 1KCLA 2XJ7A 4OBRA 2PWHA 4JFTA 3WNKA 5LA2A
chains in the Genus database with same CATH superfamily
4YYCA 2IKJA 1KWGA 4JEQA 4GQQA 2YYUA 2J6XA 3IANA 4HYWA 2EQDA 1HJVA 1EX1A 4US6A 5LKYA 3KDOA 4O14A 1FY6A 4CU7A 1C91A 4NX0A 2GJPA 2OQLA 3PR2A 5FF7A 3WQEA 1KRMA 4CVUA 2QDHA 1IHIA 1X8FA 2NQLA 4H2HA 2IXVA 1FWIC 1XC6A 1V93A 4ZR8A 4L64A 4M24A 3EA3A 2VEPA 3EMCA 1K4GA 3WJWA 4Y6GA 1TWIA 3DFPA 1UQZA 4WOQA 4MDOA 4C1LA 2P53A 4UQBA 1PB0A 4BQ3A 3QSRA 1U30A 3W2JA 2Z1BA 2GWNA 1Q8JA 3EOEA 4FF5A 4J28A 4BQ5A 3DFNA 4AMCA 3OLIA 2DSKA 1AA1B 3NO3A 4AD3A 3VTRA 1VJSA 2P10A 2E6DA 3OO2A 2Z2UA 1ZPTA 4W85A 4GGHA 1US2A 1E9LA 4AZGA 1DTNA 3VOCA 2PZNA 1EC7A 3HPZA 4MJ4A 4JXCA 1YNQA 3FJ6A 1FWHC 1Q7MA 4AVOA 4DUXA 2ISSA 1JNEA 1Q6FA 1N7KA 1T8XA 4D72A 3BLFA 5BW6A 1S2TA 4O1BA 1A5AA 1YYAA 4UOQA 3O16A 5E09A 4OT7A 2DH2A 4O8RA 4RZ4A 2R94A 4JQ1A 3G18A 4LCSA 3IGUA 3NEVA 3T1GA 4JTRA 3W1AA 2J9YA 2BG5A 3PBWA 3WNLA 5D37A 2BGQA 1UA7A 1A4LA 2E1DA 6ALDA 1EQPA 3B8WA 3CZGA 3TSMA 2OKOA 1GZGA 3U57A 3SCRA 2YCLA 2XDFA 1R3YA 4H7VA 4AIUA 3NXLA 3GBEA 1BVWA 3OVQA 3L4VA 1JFXA 3THUA 3BAYA 2VFDA 4JKKA 2WHJA 1C9WA 3AU6A 4ORIA 4JTLA 1JZ3A 1EC8A 3VKCA 6REQA 5M03A 3M0HA 3PWGA 1O1ZA 5G1YA 4WDUA 4S3GA 5BMXA 5D33A 1POKA 3ES8A 4GQRA 2PLJA 4KETA 3TP4A 4D8ZA 1PKYA 4AB4A 4TXEA 4XO6A 2YL8A 1M7OA 4DLMA 2F6XA 5EKYA 5M17A 3NGJA 5FAJA 4GWEA 4LAMA 3FGCA 4X63A 3OVRA 3PUEA 3NZ1A 3AS1A 3VD3A 4FR6A 4LS2A 3G8RA 3GNDA 3DX5A 3AOFA 1DL3A 1G94A 1RD6A 4NY2A 4WQ6A 1PTDA 1W3NA 4MMWA 2WVTA 5B7ZA 4R9XA 2OLAA 3IK4A 4J5NA 4PUUA 1XI3A 4PL1A 4GZEA 1SO3A 5IHSA 2X8RA 2FZDA 3BOXA 2R8WA 4GZ7A 3L67A 5AYXA 1ITQA 4UQAA 2VX4A 4DJEC 5AYZA 2PDCA 4UR8A 3RK8A 3WMCA 3NIYA 3VMNA 2VFIA 4Z2LA 1WE5A 4HD5A 1KM5A 1T5AA 3CJPA 4YXGA 1XC4A 5G2WA 3FX4A 1XRSA 1OCQA 2JKPA 5C7VA 1R47A 2X2YA 2PWVA 4MFDA 1FUYA 1PCWA 2HDJA 3MMWA 5FJIA 1ZY9A 1WZLA 5CAKA 3WDJA 1WPCA 2HVNA 2PDNA 5AHMA 3BLOA 1JF5A 3G1SA 1I0DA 4Y9MA 1VCVA 1F8MA 4ACZA 1OC5A 2OFJA 2B7PA 4AZ7A 3S2MA 4YVPA 4GBDA 4XK2A 1KKOA 2JKEA 3AYRA 4F2TA 1WOBA 2RGLA 3HGSA 1D3HA 3LCHA 4DO7A 3RRAA 3CL7A 2CLIA 3J7HA 1X8CA 4ZE4A 1W3LA 1XLAA 3KUMA 3O7UA 4DYEA 1XIFA 1NDYA 3PJUA 3VOJA 4UMAA 5CZKA 3NSMA 2QUMA 2AAAA 1UPMB 4WDXA 2FPVA 4C5YA 1G5AA 4FNUA 3T78A 2NWSA 5G2HA 3PB2A 1THFD 2WPGA 1PHWA 4YTQA 5H8UA 5FF2A 2OKTA 3QC0A 1R3WA 3XISA 2XVNA 3SO7A 3QMSA 4UMBA 4OU1A 2D0HA 1L2QA 3VAVA 2GSJA 4RDVA 3LZ5A 4IP4A 4JTIA 1VQTA 4XTIA 3UQNA 4GBUA 2E9MA 1PWLA 3DKLA 3WNOA 5AECA 1TTIA 2O9TA 4GCAA 3VD7A 4L56A 4XWUA 3U48A 1MVYA 1VFLA 2IPJA 2RH9A 4L1XA 1X7FA 3H54A 3CQHA 1OT1A 2AMGA 1ZTVA 4KESA 4CEXC 5DELA 1H4PA 2B81A 1HUVA 1JPDX 1H11A 3LLFA 4HIBA 4YVVA 2NUWA 1E40A 1E43A 2F2KA 1LBLA 3KTXA 4FXFA 2Z7KA 4FB7A 4JX6A 3LM7A 1UBPC 3H4WA 2WYSA 3WD0A 4I9MA 4W8AA 2WWDA 2F6KA 3LCFA 2VMFA 1W9XA 4HHLA 1PZ0A 3DHUA 4FOJA 5AHIA 3RUBL 1QI3A 3KWXA 4OBSA 4JL2A 3IJ8A 2V3GA 1R3TA 3F4NA 4RE0A 4V28A 1LBMA 1C92A 3UZJA 4E8GA 1EDGA 2REQB 3GXFA 1TV4A 1EHAA 4INFA 1Q5MA 1GKPA 5JBFA 1GKRA 3W28A 4OKDA 1J2BA 1TTJA 1TQJA 1GJPA 4KS0A 3PZQA 2FJKA 5AHLA 4QXIA 1VEOA 4GXPA 4FALA 1VB9A 1XSKA 4Z2JA 2CBJA 2CLLA 1A4MA 1YE4A 5JH2A 4RXGA 2BX7A 3DU0A 4UC5A 2NT0A 2PDPA 3WSUA 3BGAA 3EDKA 3AMGA 4XZNX 1ISWA 2XVKA 3V0TA 3GC4A 4DF1A 1EEPA 3G0SA 3QY8A 4FXRA 4ZOCA 3ISIX 2VC7A 1D2KA 1TZZA 3USBA 3BSMA 2G41A 3A6OA 4FF7A 3TW7A 3ZJKA 3CGTA 4O57A 4M7SA 3AHVA 1LWHA 4AXNA 2QJGA 2ZQ0A 1HT6A 4IJBA 4KBXA 3NQEA 2Y7GA 4WSJA 3KRSA 5I06A 4ERIA 2PDYA 5XIMA 2EKGA 1CEOA 5BNKA 1EOMA 5FEPA 1B3YA 1B0IA 1TUFA 3WQ5A 2ZICA 4LRTA 4Q4SA 3AYTA 4GI6A 4W93A 2FVKA 2VQUA 5I6SA 4WY0A 2X05A 2EPMX 5I02A 1A80A 3OPSA 5TNVA 2WWCA 3JR2A 2J7GA 7REQA 3T2QA 4JFUA 1RA0A 1SW0A 3WD3A 4LVDA 4EWJA 1MI3A 3SN4A 3L0NA 3FJ4A 1E4MM 3PG9A 2BASA 2EHHA 2F9RA 3N11A 1FCQA 4N6EA 3BOFA 4DJDA 3ITTA 3RM4A 3VIHA 2H6RA 2NX3A 1XLIA 5GPRA 3W1RA 3QKEA 1J0YA 1GZJA 1H41A 1W1IE 3M16A 3CM4A 3SQSA 2ZBTA 3NXFA 1Y65A 1GVOA 1VRXA 5D2VA 4YPJA 1XLHA 3GO2A 1PX4A 3KZPA 5HANA 3JS3A 4AQLA 3NAVA 1BKHA 2DY3A 4JTDA 4WKFA 4LUYA 1JYNA 2Z2BA 3MA8A 3NQDA 5KINA 2HPMA 3V0SA 1NQ6A 2J8TA 4BQ4A 3UWYA 4ZO9A 2C71A 1X6UA 4MPKA 4CCZA 2YGYA 1TPC1 4LX4A 1OFQA 3OOQA 3W71A 3BARA 4HN8A 4S3BA 3W2LA 3GHSA 5FL1A 1TG7A 4IGMA 2Z1VA 4AAJA 2V3DA 4R53A 2YW4A 3HA1A 4ADTA 6TAAA 1EJXC 3ITXA 2QJHA 2WMJA 3ZR5A 2VRJA 5A69A 3SRDA 4LFYA 5HUOA 3VDHA 2Y5EA 2DU2A 2PP0A 3TW6A 1RPXA 3LXBA 4YMZA 3FIGA 3Q94A 4IPLA 3PZTA 3QYQA 4X0NA 3BG3A 5JH1A 3QLDA 4U4MA 1A5MC 4GX9A 3BLIA 2YW3A 4XAZA 3WYZA 4BWLC 4JQ4A 3W7LA 1XSJA 5A2CA 2R24A 1XIMA 2ZCGA 4PSRA 3GNNA 3WLRA 4PB5A 2PGEA 3SZ8A 4D6DA 1NEYA 3SCTA 5I3KA 4H9VA 1OM0A 1GQIA 1B4EA 1JULA 2WZHA 2O7SA 4A22A 2FIQA 2FKPA 4HCHA 3WK1A 2A3BA 5LNSA 2J27A 3EAUA 2WJEA 4NZ4A 2TAAA 2X1RA 4CKQA 3UWUA 3NL3A 3E1F1 3DECA 1SZNA 3IJ9A 4ECLA 2HBVA 3AMCA 1DOSA 2GDQA 2BB0A 4KIEA 2BOEX 2CESA 3QMTA 3B9OA 4C1NA 4AH7A 1QW9A 2BSLA 2WNNA 2ZRWA 4J2PA 3K5XA 3HU7A 4PFMA 1JIBA 3EX4A 3CHDA 1ZJHA 1DTUA 1JYWA 1OYAA 5FSDC 1MW2A 1FVPA 2TPSA 3UZYA 4PGLA 1ZP4A 4DPPA 4GD0A 4JTHA 4IG2A 4CU8A 5HATA 3IIPA 4HQVA 2WZTA 3URQA 2QVHA 4QITA 1YPIA 4TMCA 5E6ZA 3QZ6A 2JE8A 3ZSTA 2Q3OA 4MWAD 1HO4A 5A8OA 2NWRA 1O60A 1BWVA 3NPVA 3Q37A 3DAQA 4IMDA 1UH2A 2TODA 4NJIA 2P76A 3TV8A 1UWQA 5DY3A 1I2QA 2XN2A 3HN3A 2O4QA 3WH8A 2QEZA 4GNVA 3EB2A 2QJJA 4K7YA 4UB9A 3G22A 2GOUA 4JDBA 2VL4A 1EC9A 5TIMA 3IV8A 1Q6LA 2Q8XA 3WF1A 2YBVA 3M0IA 1GQLA 3CEPA 4JYFA 1QRQA 2WVVB 2X16A 3AXMA 4J1OA 1UR2A 1ICSA 4KRUA 3BLDA 3WBXA 3RCMA 3A23A 3KFTA 1Q4WA 3VNLA 4B92A 2VTFA 1V6YA 3SQMA 4PCNA 1ZQ5A 1SU5A 2GZXA 4JNZA 4QDMA 4EAYA 2BHUA 3KTCA 1H2JA 4LBSA 3CV2A 1ZBWA 1AK5A 3STPA 1KFEA 3OLGA 2WPBA 1KBIA 3BV4A 4PSPA 3S9ZA 4CQAA 1TWSA 2WLZA 4ZZ9A 5G4EA 4UR7A 5AB3A 3N29A 4MUPA 3BMWA 4Z17A 1OK4A 3EZ4A 4E6MA 3AI0A 3QMRA 3T08A 4Z1DA 1SJCA 1BYCA 1UD2A 1UMYA 4I5RA 4L9ZA 2F61A 4XAFA 2CLOA 1PE1A 4LC8A 3GLCA 5DCDA 3KBVA 4UCFA 1Q6OA 5CSSA 3BOLA 4Z2GA 3WEMA 3KP1A 1T96A 3VX0A 1O5RA 3SADA 1X97A 1D7KA 3H21A 3WQFA 4QDWA 4K1GA 2RJHA 3IIVA 3NDOA 1OCNA 3HO8A 6REQB 1UW9A 5A2BA 3SFWA 1ITCA 1XCFA 2DZTA 4JTCA 1BVNP 3CMJA 3ZLGA 3DFHA 4P8XA 5DLCA 1NM9A 3I7QA 2WSRA 4FNTA 3W76A 3FGCB 5F1UA 4FLRA 1XFCA 3K8MA 1SSDA 1ZP3A 4I9JA 4ZOBA 1SFLA 1KW1A 1R6WA 4EXQA 3L5MA 3ABSA 1IGSA 3EB4A 5F2IA 5TAOA 2Y70A 4UZUA 1K70A 3G5EA 4D8AA 1QPQA 4GIEA 4IUOA 1F61A 3S6DA 1BSIA 3EB3A 5FI8A 9XIMA 1BEUA 4MNKA 2CHNA 1T0OA 2EJAA 1AH4A 5C2CA 3VM7A 1QW8A 3L65A 4MJZA 2XH4A 4M6PA 1TVPA 3CTTA 4AC7C 3DFYA 2WCGA 4UTJA 3FA4A 3LNMA 3U2EA 3CLWA 4IL2A 4DO4A 1J12A 2DT3A 2Z1SA 4BEUA 1TWZA 1EEXA 1RBAA 1Z32X 3SFKA 1S5WA 1GOOA 1P7TB 2C16A 2QHAA 3GB6A 3DFSA 1OGGA 1UC4A 1J9YA 3FAWA 4L9XA 2GVLA 3FA5A 1REQA 4OGZA 2P0OA 4J3SA 1C7SA 2WC3A 5E70A 1JPHA 5HMDA 3EX1A 3AUJA 2XGZA 3ARXA 4I7UA 3WQWA 3UY8A 2A3LA 4AD0A 3G24A 3E38A 3IJ6A 5KEZA 2QUTA 2YA1A 1E9IA 2VX5A 4EIVA 3W6YA 2X0SA 3T55A 3MO7A 2DT1A 3SY1A 1E0TA 2ZUNA 3PUGA 4GY7A 3EX6A 3P61A 1OIFA 1E1CA 2OX4A 2FLIA 1J2WA 2E77A 4PCTA 3WK3A 3NGFA 3IAPA 4R7JA 4IPPA 2JFEX 3TR9A 5HJYA 4M6QA 3P7YA 3UYCA 4PMQA 1EJTC 1ADSA 1XYCA 3M6YA 5IBXA 2D20A 3AWOA 2V2HA 4NZJA 1OCBA 2O9PA 4MVAA 3IVSA 4F2BA 1OD0A 1E0UA 1A5LC 4NAFA 3IIOA 4PRRA 3S2CA 4JBRA 1TB3A 3G6MA 4D6CA 3C2EA 3LTPA 3TYBA 2FTWA 1QAPA 3O1NA 5A6KA 3CASA 3CIWA 3AIWA 1XLBA 1KCZA 1S39A 2CLEA 1VR6A 1MQRA 2VZUA 1ZAHA 3B97A 1EXPA 3PF3A 4QJ3B 5CG0A 5L6UA 4O52A 5F4SA 3C86A 4C6NA 1MFVA 3W26A 1AW5A 1VH7A 4B2DD 3TQKA 3NCOA 2CLMA 2C14A 1QJWA 1IE7C 5FA5A 1EIXA 3L68A 3TW9A 3OBKA 4GUJA 1A3WA 1OEPA 5F2LA 3SAZA 4KFNA 1TJ1A 2NSOA 3WLNA 1XBZA 3U2CA 2Y5JA 2VVNA 2EG6A 3UXKA 2QDGA 3QHOA 2B31A 1IZKA 4ICNA 4D6GA 5DXXA 3QY6A 2PE4A 3JU2A 1XKJA 2Y4SA 1DIOA 5CAHA 5LNWA 2FGZA 3M9YA 1HTIA 2Z6IA 2EXOA 4AFYA 3E0FA 3C2OA 1XICA 1ZALA 2BVDA 2OWWA 1SFSA 3W2MA 1LQAA 1SR9A 3EX3A 1BG9A 3R13A 4HMNA 4I9AA 3U3HA 3N2TA 3B0YA 5T26A 3RFAA 2G0WA 4UTUA 2GPTA 3R8HA 2QCDA 3L2MA 2I9EA 3FKKA 5D2WA 3TQ0A 4LCRA 3CAKA 1GZ1A 1F3EA 3BE7A 3ES7A 2ZDRA 4N2YA 3QBUA 4IIFA 4L61A 4MYXA 5LA1A 1DQUA 3H8AA 3CZEA 3QW3A 2Y8VA 4RCXA 5AHEA 1QPKA 3OTRA 3TMLA 3GY1A 3ITYA 3EYPA 1QNRA 1FWNA 4GINA 4ALDA 3SEPA 2HISA 3EBVA 3TSBA 3WK0A 2DORA 2ZZ3A 3UXDA 4UTMA 1CGWA 4LS0A 5CC3A 5DO8A 3GR4A 2ZX8A 3GZ3A 2IKIA 1K3UA 1ITXA 2OZ8A 4L4PA 4EANA 1PIFA 2HXTA 4HPNA 1H7RA 4GYPC 1QO5A 3IJ7A 3NO1A 4H8NA 4K1WA 1CIUA 1Z3NA 1XUZA 1AD4A 2EG8A 3LY0A 1PZ3A 1P6BA 1VYRA 4NG3A 4IJCA 2X1UA 2O0TA 1EO7A 3ABOA 1RP9A 4UQDA 1GVFA 2VC6A 4ZO8A 4JCMA 1SZRA 2PGRA 3HQOA 3B9NA 4PTMA 1TELA 1Y5VA 4Z42C 1OB0A 5DY2A 2DZSA 1EX5A 1QI0A 1S3TC 4MYAA 5E0CA 3KOWA 3SR7A 1W5OA 2C8NA 3MSDA 3V7PA 5LXEA 1JZ4A 1AQMA 1SW7A 3H2EA 5MKGB 2BY0A 1JI2A 2PRHA 1DIEA 1GEQA 5LXXA 3CMGA 3WQ6A 3OA5A 1QMLA 3F5JA 4QSHA 4GJJA 3TN3A 1EZ2A 1QNVA 1XR2A 4JTAA 2WB5A 2HRWA 3WF0A 1HL9A 3HPFA 1YMYA 1MYRA 2VFFA 2ZZ7A 1NVMA 1Z8AA 2PDIA 3WJXA 1I0BA 5A6SA 3ABXA 4ZO6A 4JR5A 3LTSA 3CLMA 2WC4A 4XSLA 4O19A 1HP4A 2OODA 1EO5A 1PXGA 2W62A 2WCAA 3SUSA 1L9WA 3SQLA 1PHQA 2H90A 4LAUA 3EOUA 4JY9A 4C6PA 2OO6A 5LSMA 3O9NA 3R1ZA 4P7LA 2ZVIA 3N2OA 5GQBA 4W8BA 5FKYA 3BGJA 3A4AA 3TYAA 1DJGA 1Q3NA 1DE6A 4NZCA 1XCXA 3UZ5A 4LF2A 3N73A 2CITA 4JQ2A 5FSEC 3BH4A 4H2CA 2J9XA 2A21A 3RLVA 1A0EA 3ANVA 3PZ9A 1XP3A 1XIBA 1WX0A 2X1SA 4J7RA 3WD1A 2ZXAA 4E2DA 1O12A 1LORA 1M7JA 1XLKA 2F7FA 1E0VA 1LF1A 1QTWA 1H50A 3QOMA 1K9FA 4KF1A 2DV0A 5FACA 1KBLA 1PTGA 4DY1A 4O1FA 1RVKA 4GHRA 2ZX5A 4HA0A 3W7RA 1HX0A 4JFWA 1TA3A 3NQAA 4YHGA 1E51A 3VOIA 3W81A 5D38A 3BLPX 3KBMA 4AHOA 2FPYA 2GUYA 3TC7A 1IIHA 3B0VC 4TVDA 3WY1A 3N12A 1AQ0A 1BF6A 3IAQA 5D8ZA 2EKCA 3VGBA 1ZB5A 4B3ZA 3FEQA 4W87A 3CHEA 4X9SA 2XGBA 3KCLA 2H9AB 1VLIA 4LYRA 3VIFA 4A8LA 5FF0A 3R4IA 4IG2B 4CCCA 1KRBC 5JUVA 4GUIA 2PPGA 3V75A 2PTXA 3PNZA 4GXMA 1AVAA 1E6ZA 1AFSA 5H2ZA 4Z1BA 2WO5A 4KCWA 1FWJC 1TFVA 1MUCA 4QLJA 2WJFA 1I2RA 1HKMA 2CBIA 4DJEA 4HVXA 4ZB5A 3POHA 4J3UA 3I6RA 4S3JA 3UF9A 3MMUA 4UTTC 3L4ZA 4RL3A 4HB7A 2H8XA 4QR6A 4HT3A 1HJWA 1TRDA 4TQTA 4KQNA 2OTDA 3EPMA 5BYWA 4Q8QA 4NNBA 2V2DA 1M1BA 1YXCA 3P81A 2BLEA 3ZT5A 3FSTA 2QCLA 3GXNA 1R7AA 2NW0A 3IIXA 3W27A 4NYUA 4HNNA 4AG0A 1UQYA 3G3MA 4L80A 1S1PA 4PE8A 3JUGA 1MUMA 1QUMA 1KTCA 4N0RA 4NZ3A 2I9UA 1IF2A 3FJNA 2YXOA 1B31A 2D3NA 4OQVA 1KR0A 3WQPA 4BK9A 1JVNA 2IMRA 3VDGA 4W7VA 2ASHA 1R3QA 3VNZA 2RUSA 5KZDA 3ITVA 3RPMA 1KCKA 3EDDA 2QUNA 1GQNA 5H8PA 3DHPA 1JDDA 1XIJA 3KOZA 1FXPA 3GAYA 2OSYA 3BLKA 4G7EB 3FYYA 4GKLA 2DFAA 4WJXA 3W7EA 1IZJA 1TPEA 1H63A 2Y0FA 4D71A 4GE8A 4BKNA 3W3OA 4OV9A 3CH9A 2BS9A 4OUIA 4BA0A 1QDSA 3CB8A 1UWIA 4AY1A 4AZ5A 3MTWA 1S5MA 4K39A 3VUSA 5FJJA 5JIPA 1Z89A 1U1UA 1A5CA 1GORA 4FNPA 4V1XA 3D47A 4H9XA 3JVAA 2YBTA 3P5YA 1BF2A 3PPFA 4FX6M 3UXLA 3M07A 2C0AA 3WBYA 3AO0A 3PC0A 2ACUA 1V7AA 4C91A 1X7IA 4DWSC 3ICJA 2DW7A 2WOQA 3W70A 2WMIA 2Y61A 4PFHA 4F8XA 2VDGA 2ZC1A 4QG8A 4XD3A 2I17A 1QPOA 4H6KA 1JCTA 1R2SA 1LM1A 2OOGA 1QNPA 4E5TA 1PIIA 4PMVA 2PS2A 1J0KA 2Z26A 1I2OA 1JRCA 1QCWA 3BLLA 4IX0A 2V5BA 4ZQMA 4GLEA 2VCBA 2XINA 3RXZA 5A8QA 2XH2A 3KX6A 2QJNA 2YZ5A 5CJMA 4CCEA 4HTYA 1EJUC 1BWKA 4PMNA 3HOJA 2C7FA 1TV2A 4WGXA 2ZA2A 3MANA 3ZWSA 1F7BA 4KRTA 3A5VA 5FL0A 3IUIA 4JYEA 1ZRQA 5BXRA 1EDTA 2QLYA 3BSHA 2GVGA 7XIMA 3O07A 2X42A 3TVAA 1E1FA 4CCDA 3H2AA 4OBRA 2PWHA 4DPQA 3H4XA 3H12A 3S9IA 3BG5A 5F2GA 2A1YA 1SVDA 2CWXA 1FP9A 1E6QM 3WD2A 3VNMA 5CBIA 3VINA 4B91A 3MUY1 4O28A 4XX6A 1QK2A 1LOLA 1JXJA 1JQVA 1YTEA 5DANA 3P2VA 4LY8A 5EL1A 3KXQA 2YL5A 3FVDA 4IIBA 4JX4A 1GVIA 3AZTA 4J4KA 5G4HC 3BC9A 4B4FA 3MHFA 3I3BA 3VFLA 4DBWA 1BXNA 3PJTA 3TZFA 3W82A 4UTHA 2FJUB 1WZAA 4B3KA 4Q4MA 1DWHM 1FWFC 3GW0A 3H2OA 3M44A 1FTXA 4EWND 4MNMA 3W07A 2V9DA 1UWUA 3W85A 5KMYA 3RITA 2ZUWA 3GTFA 3VUPA 4CEUC 3WLMA 4LNYA 1QO2A 1HW6A 1G7UA 4DBDA 2V8ZA 1W3IA 2JGQA 2PCEA 1Q2SA 3RX2A 3T40A 3VKBA 4O13A 2QXWA 2BGSA 2WVUA 4PEEA 2WKGA 2KAUC 3HMCA 2C1HA 1Q6DA 3NQMA 1PDYA 2WSQA 5BXTA 4MNJA 5EGRA 3HG5A 5BOFA 3APYA 4HOWA 3O2LA 5DRIA 4XV0A 1F6YA 1NWTA 4LUSA 3WQOA 3KVMA 2P88A 4NRSA 3GDLA 3CT7A 2Q8LA 3N34A 1H0GA 4UNLA 4Y96A 1I8JA 3W83A 1C8YA 3M0ZA 3A12A 4QSFA 1Q45A 3WN6A 2J7BA 3WH5A 4EPDC 3A13A 4BF5A 2Z24A 1ONWA 2CLHA 4HBKA 2QGHA 1OINA 2YB4A 5CPQA 3ZLFA 3LHYA 1R3RA 3G1RA 5HBFA 1R85A 3FSUA 3U2OA 3BJSA 4QAWA 2XFWA 4JTGA 4PUEA 1W5PA 2A6LA 3OIXA 3CV6A 1PVNA 1U5VA 4US5A 3CUFA 4MAZA 1IEIA 1WCGA 1UMLA 3BCJA 1E6NA 2ICSA 1V3LA 2BP1A 4IMGA 1H7WA 5HWJA 2PDLA 5EMUA 4TX8A 1MXDA 1JCNA 4X2PA 3W29A 3BTNA 1JNDA 3XINA 1M7XA 3T2PA 1VYSX 3SCNA 3HG2A 2BWGA 3CQJA 1JQXA 1VP5A 3VKKA 1UWRA 3W74A 2VR2A 3ELFA 3L7RA 4DM1A 4BWLA 1X1OA 1KV8A 2NZLA 3IK2A 1H5VA 4LT9A 4QM1A 4IICA 4OOUA 2GL5A 4B5SA 3MT1A 2QCDB 3JZEA 2FGBA 4N7QA 4ZCWA 2ABAA 4BS0A 1OF8A 3K1GA 2Y7DA 1FKXA 5KZ6A 2P0IA 3HQNA 2D2JA 5HMSA 3V1PA 4Z0JA 1GYNA 1YW1A 1NY1A 3MVIA 2WAGA 3FHQA 1KCXA 3HJEA 3IGHX 1XHGA 3BAXA 3S5SA 4ZSUA 1H7NA 4FAMA 3B0PA 4JX5A 1I2NA 3ABRA 3CO8A 4IUGA 1WKFA 5BCAA 2DIEA 1YBQA 1TX2A 3MP5A 4Q8WA 3PZUA 3V35A 3E9AA 3FKRA 2WKJA 4PZVA 3AXXA 3P14A 3EWYA 5FEXA 2QF7A 4RV3A 4WKHA 4IL0A 1FRBA 3CUZA 3GM8A 5LNRA 4JIIX 5HPOA 2NLIA 2BXYA 5E0KA 1SMAA 4XIMA 5HR7A 3QHMA 3R8GA 1CBGA 3CMFA 1FQ0A 2G5WA 2OYMA 3ARWA 3VC6A 1RALA 3IV3A 2O7QA 1CGUA 1MDRA 4UTLA 3N2XA 3DZ1A 2ZRUA 1PJ9A 4PB4A 3AQUA 2V82A 2UZ9A 2E1WA 4XKYB 3HQPA 4NNAA 4ADSA 1W1VA 1Q65A 3WF3A 3PTQA 2YDRA 4AYGA 3ANUA 1D3GA 1AJ0A 4LQ1A 4C6MA 1QXLA 3UPWA 4HNCA 1EBHA 4QE4A 4P8UA 4FR1A 1V51A 5AYYA 4EOUA 4B5WA 1P1MA 2V30A 3K4DA 3ABZA 3GTHA 3SSJA 1E3XA 5CPLA 2X30A 1UUOA 1EJVC 1JAEA 2FYMA 3B8IA 2X1IA 3CXOA 3W1MA 1K1DA 1V6UA 1TIMA 4YCOA 3V1HA 4GUHA 2JF6A 1XINA 3S1XA 1OCJA 2GGIA 1CPUA 3BCFA 2G3JA 4M81A 3VXGA 1Q8AA 4HHHA 3C56A 1L6WA 2UY4A 1PKMA 5ECVA 4FX8A 1S5VA 3BXWA 3H26A 4DF0A 5PTDA 3OYXA 2V6AA 1XKYA 2XG9A 4C7DA 4Z1YA 2XVLA 1MW0A 1FOBA 4DZ5A 1F6KA 5CPMA 3WNNA 5DEZA 2G4JA 4JN6A 3E3HA 1RCQA 3GD6A 3WD4A 4NJHA 4L4OA 2TSYA 1KLZA 1O4UA 1IEQA 1A3XA 3NPUA 4JIPA 1GQKA 4R7WA 3U4FA 3KVKA 3S1WA 4DJDD 4ZFCA 1UR0A 3OBAA 3B05A 4LEQA 5GNZA 2OJPA 6XIMA 4O1AA 1TA3B 5FEZA 4MM1A 3UNTA 3TA6A 5K4ZA 4NF7A 1MQQA 3FFSA 3GHRA 4QFUA 3GDBA 1TVLA 3GC5A 5DT7A 1KM3A 4ZODA 4O18A 3NQ6A 1O94A 3VCCA 3D5HA 4KCVA 5D2XA 2IPGA 1Q63A 2YL6A 1EOKA 1UKOA 4MGGA 4OWGA 3G0UA 2Y89A 2XWDA 4KGLA 3RPDA 4C6FA 4I3GA 2CLKA 1BPLB 1HZYA 1OADA 3C52A 1IXPA 3PTDA 2HK0A 4IZGA 3R58A 2Y24A 5D30A 1TREA 4KCTA 5GJPA 5I3FA 1LJYA 1A0DA 1UZDA 1PSCA 1H3GA 3MJMA 4KT2A 2OB3A 3UJFA 3KLLA 2XZ9A 4XKMA 4DJFD 4NILA 4IISA 1NAL1 1YIXA 2Y85A 2FDMA 3ZJ8A 2CLPA 1ZZMA 3T8QA 1QWGA 1YEYA 3EMQA 4AZHA 4B5VA 2GJLA 3TQVA 3GXPA 1JPIA 2NQHA 4IGHA 1MXGA 1W9UA 3LPGA 2QR6A 4RLIA 4ZA0A 2ZX6A 3REQB 2I5IA 3GUWA 5D09A 4PMRA 1BG4A 4IJRA 3N6QA 4WGHA 1M04A 2QCEA 4PBGA 3LU2A 2PAJA 4E2OA 5U7SA 5EMKA 3TN6A 3A22A 3ENLA 3U5UA 3H53A 2NQJA 1K7FA 1NSJA 3WK2A 4O16A 4IFKB 1E1EA 4QBXA 3P84A 1UWSA 3IVUA 2EG7A 3FHAA 2AAMA 3P93A 1SZFA 3OP2A 3UGRA 2C19A 2A3AA 1FH9A 1ZLPA 4HSNA 3ZZ1A 3DOPA 3W7QA 3GTNA 3GIQA 3F2BA 4W5ZA 3UT0A 3KL5A 1XSIA 1J6OA 2VDIA 2PF0A 2YA2A 3M5VA 2Z7GA 4DIAA 1RHCA 3TROA 1QOXA 1TIWA 2V3EA 3R0UA 5LYRA 3ANYA 2RDTA 1B9ZA 1XISA 3UWVA 1UP2A 1CB7B 2BY3A 4LBRA 3WLTA 2HMCA 4WRHA 3TE9A 3LBMA 1YDNA 3P0WA 1IIGA 4K6AA 1WDRA 2I5GA 4PYSA 4HK5A 1Y5XA 5M1TA 5HQLA 1Q66A 5I3GA 3NQCA 2XISA 4GX8A 4EF8A 3NNTA 1OY0A 1J5SA 3ARZA 1GVEA 2WXDM 3BDKA 3QXBA 4RUBA 1RAKA 1TJ2A 4PR4A 4GY1A 3TOPA 1KB3A 3OZMA 9RUBA 3GNOA 4Q3MA 2BVTA 1A5KC 3T9PA 1YKWA 2NQ9A 1QNSA 1FKWA 3ZQ9A 4DO6A 3MCOA 3ITLA 2GLKA 1M41A 5HK4A 1DQXA 1XQKA 4XBKA 4F3HA 1OZMA 3WDHA 1JAKA 1WXYA 3T6CA 2J88A 4RZ5A 4M51A 3PZGA 1GW9A 3JZUA 2UV8G 1UUQA 3GNPA 1VIZA 4PTXA 1GOMA 3SIMA 1DJYA 2YCEA 1XPYA 5E5CA 3MO4A 3TN5A 4YTUA 1F76A 4I90A 1Q4NX 3IEBA 1UA3A 1PZ1A 1LT7A 1V8EA 1A5OC 5HA7A 3SCPA 2W0UA 5C70A 4A05A 4AW7A 4JY8A 1ZBVA 2ZTJA 5HWMA 5IOBA 3W7DA 4R88A 2CCRA 3WUGA 2WJDA 1JDCA 4RE3A 4IP7A 1OK6A 4Q4PA 2WNWA 3GSMA 4AWSA 4ZTYA 3M7WA 2XTKA 1NH6A 4G7FA 4ZOAA 1ELSA 1LT8A 3S8HA 4UXDA 4XO7A 1TPB1 3LCIA 4ZEPA 3UY7A 3MSGA 4JFVA 3LRMA 1TPUA 1W54A 1ZBCA 2JK2A 4HZ7A 2VZTA 2EPNA 2XH0A 2PDJA 4GYFA 2EPLX 1NFGA 1B3XA 3BGGA 4ONVA 3TQPA 3SCWA 2WSYA 2GK1A 3SY8A 3H2NA 2EJ1A 3MY9A 1GVQA 2VUNA 5HWNA 2QCFA 2GUBA 3OB8A 4FLSA 3MS8A 3S5NA 1VRDA 3OA3A 1XF0A 5K4XA 1J0JA 2DP3A 2YDSA 4P61A 1QNQA 1PV8A 4HU8A 1UH4A 3L4TA 2HVMA 2J75A 3A21A 5BU9A 3R25A 4GNKB 3I10A 1R86A 5J5RA 1BTMA 3QVQA 1E71M 1TV8A 5I3JA 2XH7A 5CC5A 1UR1A 1KM4A 1NOFA 3ITOA 1WO2A 3DG3A 1OX4B 5FIPA 4GYPA 4MDPA 3NQ8A 3MI2A 4L9YA 4LUSB 1HP5A 4R9OA 1R9YA 5F4WA 3PPGA 1XRTA 2CKRA 4S39A 4HZ6A 2QGYA 3EXSA 3RILA 5MHBA 1KFKA 4DYJA 1GOWA 3GWQA 2PWFA 4QS6A 4J27A 2YL9A 4RXFA 1RY8A 4FNQA 1KWKA 4KPLA 2VZOA 2G97A 4KKXA 4HJFA 2E8ZA 5CJ5A 3FVMA 4Y9OA 3AICA 1UKPA 2IKHA 3P67A 5HNUA 2V2CA 2W6RA 4EAMA 1LRNA 1DP0A 4F9DA 5JVLA 3F4DA 3MYPA 1UASA 1K4HA 3TFCA 4HYVA 1G69A 3W1QA 4LVGA 1M68A 1EDQA 4CQBA 1X1ZA 2FHCA 4Q8MA 3TEVA 3ZVHB 2PDBA 2PDGA 4DZIA 1E4NA 4A3RA 3LMYA 4HNVA 3H24A 3BZJA 4HA1A 3H4GA 3S5ZA 3FYOA 4BI7A 2DSUA 2GJXA 3E0LA 3W1XA 4M6VA 4D1IA 4TO8A 2PMQA 1FWCC 3PN8A 2ZX9A 2PODA 2NUYA 1BRLB 2YYTA 2WHKA 4QJ5B 3QRHA 1WNOA 2Y1HA 1ZS2A 3GC2A 3MCNA 3QQ1A 4IIDA 2YZRA 1P0EA 3VNDA 4A21A 5AYBA 5XINA 2W3ZA 2WMFA 2QJMA 1EJ7L 3C6CA 3SJNA 3HG3A 1XM3A 5EA9A 4MZ8A 3E6EA 3N2BA 4PUDA 2NV2A 2Y5SA 3GBDA 1I9CB 1FCBA 2CWNA 2X7VA 3W87A 5IBXC 3MV11 1OF6A 4JTFA 1KQYA 1D9EA 3PVFA 3N15A 4NXKA 2WK2A 1I1WA 5FEWA 3M0VA 3VKDA 2WW5A 4A29A 2X7WA 2CETA 3CAQA 4MB5A 2VDHA 4OHQA 3W7PA 4FNSA 2ZRZA 5CH9A 1DPMA 1BYDA 3DGBA 1VAHA 1PX3A 4X61A 1GJWA 1TE1A 4S38A 3PBUA 3TZNA 5DFAA 1MZHA 2UY2A 3VIOA 3N1AA 4O17A 4UIOA 1R87A 4GQGA 1XX1A 1M01A 4N6FA 1CNVA 2AQWA 2CXGA 1YBQB 1XYBA 1I6NA 3DFTA 3DESA 3AHZA 3PTMA 4CU6A 4GZJA 1UYQA 4CD7A 1TE6A 2QKFA 2INFA 3VKJA 4AIEA 3L23A 1L8PA 4GJIA 7ODCA 1KBBA 3R0DA 4F40A 4HZ8A 3H6OA 1UOZA 3TN4A 5H91A 4QQUA 1Q6RA 4C6CA 2DQWA 3TFXA 2V81A 3EWXA 5HINA 3CZKA 4DELA 3RLHA 3K2GA 4KWVA 4GIAA 3TXZA 4IXHA 5EMLA 2E9BA 3TC6A 3E2RA 3VIIA 4A8RA 1CLKA 3C61A 2J62A 4RJEA 2ALDA 2AOSA 3EPNA 4TR9A 3UA3A 1KFLA 4S2BA 2OEKA 3ZJ6A 4JGDA 4XD5A 3OYZA 3NUKA 2VRQA 3HM7A 1PYFA 5H6HA 1WZMA 1U5HA 2WM1A 4HOZA 4XG1A 2DUAA 4WXZA 4KIRA 5DXYA 4J3VA 1FP8A 1O1HA 3GU9A 1RCXB 1L6GA 4O0KA 4KEZA 1Z9AA 3PK7A 4QEHA 3WBEA 1PEZA 2OXNA 3RGTA 3HFTA 2VJXA 1KGXA 2E9LA 2WMGA 4J3TA 1DJWA 3GHUA 3RCYA 3MWCA 3AMLA 1WUFA 5CXPA 1V3MA 2W91A 1C29A 4MNLA 4H8HA 5KITA 4CNPA 3SGUA 1P4CA 4AZCB 1IT0A 5XIAA 4UR9A 3M4HA 1YXDA 3HBLA 5J8LA 1VPXA 3EWWA 5CSUA 2BV9A 4H6QA 3HGRA 1AQHA 4YL2A 3SN0A 4W4QA 4HOXA 2Y8KA 5EMYA 3WBAA 4UMCA 2P8CA 3P8JA 2AGKA 2ZADA 1UCWA 4EKJA 4BZYA 3A5FA 2PTZA 3I4EA 3HURA 4EE9A 5HMFA 1CECA 2XYLA 1OC7A 3MI6A 3H2FA 3ZS4A 1MXSA 3CL8A 1SJDA 3M7SA 4ADUA 1FH8A 1EGVA 3C0SA 4G5DA 3NQBA 4BY3A 4AEOA 3I3DA 4WXYA 4S3KA 4DWSA 2IKGA 1ZJIA 4REQA 3MC5A 5KZEA 1PWMA 3DG7A 5JBEA 3D46A 7TIMA 2QT3A 2GJRA 3WZ0E 4S3DA 3QGAC 1HFBA 2BBFA 4ZENA 4LUTB 4KEUA 4CN4A 1MFUA 4Y8FA 4GACA 4RW3A 3LA4A 1ME9A 4GFIA 3TTEA 2QYGA 1UJQA 2E7FA 1W9DM 2R91A 5DMMA 3VIMA 3WKZA 5A6BD 3KHDA 3E5PA 1VYPX 3CQIA 2OSWA 4R3UA 2GUUA 3BL3A 2AGTA 4AZ6A 3NL5A 3DENA 3DBNA 1ME7A 1EWEA 1NP0A 5TF0A 3G3DA 2GVJA 4AY7A 4K68A 3VA8A 3II1A 2PC8A 7TAAA 3VGHA 5C2XA 4OTKA 3K4WA 4G56A 3QZEA 1B90A 1MEHA 3MHGA 2WMHA 2XVPA 1TCMA 2WANA 2UBPC 3CZJA 1XL9A 1VFTA 2VEFA 4FSAA 1WUEA 2I14A 1OFRA 1XV8A 5I09A 3EA2A 1B3VA 2NVDA 3OHIA 4MF4A 3T07A 2I7GA 1MW1A 2ZE3A 4PMUA 1OVDA 4JPGA 1XG3A 3PZVA 3E12A 3F4CA 3UW6A 3LHZA 2XHYA 2DZUA 4K8HA 4DBEA 2DPEA 1HO1A 4HP5A 1TQXA 3SUVA 4GIRA 2Y88A 1SZGA 3GXMA 1B2YA 1IEVA 4YTTA 5D2YA 2PDXA 4PBEA 1RUSA 2JF7A 2D3LA 1JPKA 3C2FA 4R5EA 3VKAA 5FF4A 1V3IA 2DVUA 2HE5A 1KNWA 1L0PA 2MUCA 1P0NA 4H00A 5HQMA 2X0YA 3OVGA 2ZUSA 3NPWA 1WV2A 1W8SA 4WZHA 3WDRA 1EJRC 1QOQA 5BXPA 4ENLA 1FWEC 1W31A 3AU2A 3M0MA 3OIHA 2VHLA 4GUFA 4AD4A 2Q8ZA 2GQAA 2VEKA 1ICPA 3N3TA 1FWSA 3DERA 3S4TA 1CZ1A 2F84A 3U7BA 3UWWA 3RAOA 3LI1A 3R12A 3WUEA 1IGWA 4WKAA 3DCPA 3OU8A 3W25A 2JEQA 1BFNA 1K8CA 1XDMA 4ATWA 4HKPA 4DM2A 4JNYA 3NEHA 2HCVA 3S1GA 2PDFA 4ZQRA 1XLFA 3RLGA 1WQ5A 1JYVA 3TOYA 3N9KA 3GKFA 3KEHA 5L9FA 4DJED 4NL1A 4MWAA 4F0MA 8CGTA 1LLWA 1A53A 1X6LA 3OHMB 1EP2A 2Z6JA 3PG8A 4LSBA 1E5JA 3UVAA 4DAFA 4DI8A 3GVGA 3AAMA 1LG2A 4F2UA 1L6YA 3ZVIA 2J7CA 2NLYA 5A8NA 4PUNA 1E73M 3WEZA 5F1VA 1RJQA 2A4AA 1Q13A 2DT2A 1NU5A 4ZE5A 1ZAJA 3KBJA 2A2IA 4GI4A 3N13A 2IQ0A 1KXTA 1H7PA 3OZOA 4J35A 2FMNA 3BQ6A 2VC9A 3T0AA 5T9CE 1UD5A 3GG8A 1V0NA 3WLQA 3ZIZA 3TC3A 3CUIA 2XPKA 3CV1A 3MHUA 4UTKA 1DHKA 3PANA 1OYBA 1G01A 4JIEA 4OV4A 3NZGA 3WIJA 1GVRA 2QW5A 5F2MA 3EEGA 4R85A 1O95A 1ZL1A 3LEPA 4A3QA 2R1NA 3BO9A 3WJSA 1UP3A 3NR0A 3OQ8A 3VVGA 4DXXA 3ZYZA 3PS7A 3WL1A 3RF9A 3IJQA 4Q8TA 4HPJA 3A4WA 5REQA 1OD8A 2XZ7A 1GT8A 4H41A 4U10A 3H55A 1VPQA 3PFMA 1W9VA 5C9WA 5FOOA 3W1TA 1VKFA 3E2VA 3DUGA 4BEQA 2QV4A 3TIMA 3PM6A 4C60A 3CHFA 1P6CA 3W53A 4MY9A 1GYMA 3LYEA 3DYPA 4GYKA 1J79A 2IUZA 3CT2A 3V5CA 3RCNA 2W27A 3B8UA 3GZAA 1RVGA 1JPMA 4HK6A 3NL2A 3R6IA 5GNXA 4HU3A 3QYSA 4GI8A 5LGZA 1A47A 2YLLA 3ITGA 4S3EA 3BICA 1ZCCA 4ILSA 2CZVA 4JIRA 2HZGA 4ASTA 3H7UA 3R7MA 1ODZA 1E72M 1EBGA 1L2UA 5CZJA 3ID7A 4B3LA 1SZEA 4PMJA 3H22A 4XSMA 1AG1O 4LAOA 1IWBA 4IQDA 2PB1A 3VZYA 1DXIA 3IARA 1XGEA 4JQ3A 4UCGA 3W2KA 1C7TA 1VEPA 3DHFA 2DZPA 3OG2A 5AC8A 2VUYA 1GHRA 3O8AA 4FIRA 4GIYA 1HKVA 4XTDA 4PTNA 1EZWA 2C1IA 1MRAA 2EGZA 1OG6A 1X1NA 1XFBA 1UIOA 4BCEA 4DJFC 1AZ1A 4M6UA 2PDKA 5LHEA 1O5KA 3UU0A 6CGTA 4PRWA 3MUXA 2VELA 3MP4A 4FP1A 1XRFA 3HQ1A 5BRQA 3I7RA 3MKCA 1JI1A 1HJUA 4MWAE 4ZL1A 3UETA 5M3WA 2OLHA 4JZ5A 1V7YA 1W2PA 1TYGA 4N4QA 4O4WA 2JGYA 3M5ZA 1ZCOA 1TPDA 1YDVA 5I7GA 1V6WA 4E4UA 3DYOA 2VEMA 3VDAA 4GC3A 3UYIA 4EF9A 4CN6A 1AJZA 1VBHA 1CENA 3STFA 5CSYA 3QV6A 4M5PA 1Z69A 1LL4A 4BF9A 3QN3A 4CNSA 3NOYA 1UG6A 3D0CA 1QHPA 3LRKA 4NNCA 2C91A 1AUSL 5HNNA 2VKZG 3VM5A 4X60A 4ES4A 1AJ2A 2V5DA 5JMUA 1VFOA 2PDQA 3O6AA 3QKZA 4AF0B 3GTXA 4AUBA 2V68A 1E0XA 1KCLA 1F3TA 3F2DA 4JFTA 4WDTA 2WV8A 3NQFA 3OVPA 1U22A 2E09A 2YR1A 1OSEA 4H04A 2E5BA 4M19A 1R9ZA 2ZUTA 3SECA 4E4PA 1W5QA 3RO6A 3OGSA 3NZRA 3P74A 3FDGA 5LGXA 2NXHA 4WJEA 3WQGA 3RPTA 4XD6A 2I5QA 5D9PA 2ZRXA 4IX2A 2W67A 3B04A 5J5DA 4QEEA 4IOTA 2ODOA 1D7FA 4HNOA 4QLKA 1F8IA 1SFJA 3LCXA 3BLEA 4CQ9A 4L1GA 4GMEA 4PH6A 4GUGA 1LCOA 2ZRVA 2FQIA 3TAKA 3G8EA 4ZQCA 1AW1A 3CB3A 3WJZA 1E55A 1IV8A 4LALA 3FCPA 2PURA 4U28A 3M5YA 2RHGA 2L5HA 1HG3A 4UTFA 1EL3A 1WXJA 1UUMA 4DNHA 1XGDA 2J4GA 4RV8A 1H0IA 1VLWA 1V08A 4IPJA 4IIGA 3BZGA 3MCMA 1GGOA 2TRSA 3E02A 4OOZA 4GH3A 2I1OA 5FJOA 5HAOA 3W37A 3R43A 2Q6ZA 3UXIA 4QHRA 4RW5A 3V18A 2QUUA 3M0XA 2H3BA 1A5SA 4DVOA 1F05A 3G77A 3AIBA 4AWUA 2CZ5A 1KQZA 1EUAA 3LPFA 3UGVA 5DN1A 3LG3A 5AHFA 2QNEA 5E93A 2OWCA 3SM0A 1GCYA 4D2JA 3TMQA 4MZYA 4MJMA 3QTPA 3WF2A 8TIMA 4C1KA 3SSZA 4KERA 3DFOA 4AX7A 1UHVA 3N25A 3WQ4A 3WFZA 4XZMX 4DUOA 2QPXA 1GOQA 2CFFA 4Z2HA 5AN7A 5K9XA 3LHUA 4MHBA 5CZTA 4HMCA 5AOUA 3LGEA 1DWGM 5ABGA 4Q7NA 4CQCA 1JZ6A 3C8FA 1US3A 3DI1A 2XFYA 1GYLA 2GQ8A 3T09A 4QE5A 4GA8A 1M6JA 3MZ2A 5I0DA 2RGMA 2E67A 6ENLA 3T0DA 2DIJA 6TIMA 5IDIA 1MZRA 1KD0A 1G0CA 4CLMA 5IM51 2VT0A 1CGYA 1A50A 3MJYA 1QU4A 3LPPA 1LQ0A 3TDFA 3IIZA 1KM2A 3C2RA 1T7LA 3F2CA 3O06A 2E40A 9CGTA 1DJIA 3QR0A 2YX0A 4IMFA 4JKMA 4PTVA 4DWSB 3RMJA 4REQB 3F5KA 1W3TA 2DZVA 1EPXA 2D0GA 3E2SA 3W0KA 1DQWA 4ZQNA 1BYAA 4XAYA 4ERAA 4GPNA 3THQA 2XIIA 4DWDA 4RKAA 3CBWA 3V3WA 4DHGA 2PTYA 3KP0A 1JXKA 5ECUA 4JHMA 4D6EA 3B8VA 2REQA 2E8YA 3TSDA 1S5NA 3HGOA 3KBWA 5ABTA 4QX4A 1KFWA 3G1FA 4QROA 1LTDA 4WX2A 2OG9A 3ZO9A 1AH0A 4LW7A 1NDZA 3ECQA 1H62A 1PPIA 2YPIA 4JN8A 1OYCA 3M6DA 1BQCA 5JBDA 2WHMA 4CGTA 1QASA 3KHJA 1V02A 2QZRA 3RM9A 4F48A 4OUEA 3IRDA 5A6AA 3HIJA 1JJKA 4HA3A 3WLKX 1EUNA 4NIRA 3GX9A 1NFPA 3TTOA 4MAVA 2PCQA 1MWOA 1UOKA 2YXGA 3RR1A 2NUXA 5EBAA 3KL0A 3QM3A 1O5XA 1W1PA 3QLLA 3LDVA 4AU0A 2DUXA 3LCLA 2J47A 2HTMA 2B7OA 4LCQA 2YCLB 1XDLA 1HKJA 1VCGA 5A8PA 3IJLA 2PBGA 3MSYA 3CQKA 3LGDA 4ROPA 2WHLA 3SBFA 3T0BA 5HQEA 3RHGA 3S9YA 3WQDA 1VZWA 3UJSA 4LGXA 4ZB0A 3K8LA 3UG4A 5EY5A 3CWOX 3C3NA 4HU4A 3O3RA 2WBGA 5BOEA 1TMQA 4JYDA 2OYLA 1J0ZA 3PUOA 2ZTKA 4RNJA 4N9DA 2YXXA 3BSGA 3CS2A 1VCFA 3Q2DA 2J74A 2OO0A 1JZ5A 1UD4A 5CPNA 4D6JA 1Y7VA 1TMLA 1MEIA 4NSBA 3ZT6A 3MWAA 3WUFA 4YLWA 1TWDA 1XLJA 4ML9A 1RSCA 1UP0A 3O0FA 3EKGA 1FXQA 3WELA 2WQPA 3ITCA 3VX1A 2VOTA 4GGBA 3W84A 2FZNA 1J8VA 2PD9A 4L5ZA 1F4HA 1EH9A 1VBGA 5CG7A 2PBOA 4A35A 1BSLA 2BXZA 2OELA 2VYOA 3MBDA 4HSHA 3WDQA 3CQ0A 4B16A 1QI5A 3D6NA 1TR9A 2WNQA 3FAXA 4KFOA 1PZ2A 5IDZA 3Q45A 4S2CA 2NQZA 3T4CA 3UFYA 1VC4A 4JEJA 4MB1A 3KLKA 3VIGA 1MUWA 5AKQA 1GTHA 4HNTA 1YTDA 5CQ1A 1C3FA 1GW1A 1LOQA 2RDXA 4OE7A 3Q58A 3W73A 1LL7A 1OFBA 1D8WA 2ISWA 3AS2A 3B0XA 4ACZB 3Q4DA 3F1QA 3I68A 3CYVA 1ML1A 1WDQA 3P0XA 4LC6A 4C7GA 1XYMA 3DKJA 3VO0A 4E0CA 1R5YA 3IGSA 4XUGA 1GWJA 2ZZ2A 4XAGA 3VGGA 3RNDA 2X2GA 4XZLX 1CXFA 1NWSA 1GG1A 1SO6A 3FNDA 1DBTA 1OQFA 1DWIM 4GI9A 1G1YA 2DEPA 1DEDA 4UFMA 2J8FA 3WH6A 2QUVA 1F07A 2C6QA 1PTAA 4FIQA 1BXBA 5C9RA 2EPHA 2XUCA 4GH1A 3WBWA 3KWSA 1MW3A 3OG3A 2CZFA 3KBSA 3VOGA 5FJUA 3O6DA 1TTQA 1GHSA 3M46A 4HNLA 5DRCA 1S2WA 1V02E 5G1MA 3T44A 3VIKA 1Q6CA 4MKVA 4NASA 3TAOA 1XQLA 4PMZA 1IWAA 1R8LA 4U5IA 1PAMA 1W32A 5C9UA 2ZXBA 4EPBC 1W56A 4O15A 2J78A 3A47A 3DI0A 3SY5A 1CGXA 5BZAA 2DH3A 3LM3A 3F03K 2J6VA 1RCOB 1KA9F 2IPFA 3IRSA 4F0HA 3LTYA 1UZ1A 3C4UA 3QZAA 3LLXA 5A2AA 3DEQA 4IFRA 2PWUA 1AZ2A 1IR2A 3VGDA 1EP3A 1BD0A 3NQ7A 1PS9A 1XLGA 3W02A 1LBFA 2G37A 3BMXA 4ZSTA 2XIJA 2ZFAA 1VENA 1OFAA 1J0HA 4ZO7A 4TUFA 4D8LA 2QAPA 2ADAA 2A0NA 2FZ9A 1BLIA 3VNIA 1DIDA 1V6VA 4TTUA 1XCWA 3S83A 2PLCA 1DJXA 3RM8A 1WKDA 4B90A 1VHNA 3W1LA 1FWWA 1M3UA 3GK0A 3ZT7A 3SJ3A 2AQVA 3KRZA 2QCNA 2OQYA 1LROA 3AXIA 4IMEA 5D04C 4XIAA 4B9ZA 3R8RA 3V5FA 2AL2A 4NXSA 5JQ9A 2GQ3A 3AXHA 3TU9A 4QIUA 1XYLA 1RA5A 1R2TA 1W17A 3TYUA 2ACRA 1TCDA 3SUWA 3GNXA 1R46A 3N9SA 2DZBA 4PB3A 2CXEA 1XH1A 2WVVA 4H9ZA 4W9TA 3GIPA 3M0JA 3WQVA 1U2YA 4PUMA 3V5OA 1H5YA 3CUXA 2VFHA 4YWIA 4F66A 4M3PA 3LN3A 2BVWA 1X38A 5B80A 3QGKC 2Z25A 4XVDA 2D2HA 2HK1A 4WY0B 2ANUA 3VFCA 1JCYA 2YOCA 1SQ7A 2CHRA 3VNKA 4Y2WA 2HNEA 7REQB 1W37A 3PZMA 2D2OA 5I3IA 4P8WA 5F4XA 3KM8A 4NVTA 1XLMA 4KGJA 1QR7A 4IWWA 4Z1AA 1FDYA 4LUJA 1DWJM 4CD8A 1TO3A 4EX4A 2JIWA 3PNUA 4QLLA 2RJGA 3W75A 1LWJA 3APTA 3TX9A 2PLKA 5G2IA 3SRFA 3EX2A 4TV5A 1MNZA 3TXVA 3MPGA 5HUPA 1P5BA 2Z1KA 2WZIA 3TLQA 3SURA 4C6IA 3URAA 4K8GA 3VZZA 2DJLA 3W7GA 3BV7A 4Z2KA 3UWQA 2NVAA 5I5RA 2HEJA 1PKNA 3EDJA 4CN1A 5AZ0A 2ACQA 4NP7A 3RJYA 1VFUA 2QCCA 3RX4A 3IUDA 7A3HA 4H8VA 1K9TA 3CUHA 3GG7A 4WY0F 4RPQA 5CKSA 1NFBA 3P5ZA 3QY7A 3URNA 3SCOA 3FYPA 1T40A 2VO5A 1K8ZA 1RR2A 3QSTA 5FAGA 8A3HA 3MI3A 4LRSA 1JR1A 2ZWZA 1DYSA 3AIUA 4AWEA 3IS4A 2CC0A 3ATYA 4PMYA 1OHLA 3O63A 2YA0A 4FS9A 3NL6A 5LNVA 3RLUA 4D9PA 1WDDA 3EDFA 1KGUA 4HPHA 3ZFHA 3LNPA 2ZIDA 3OLEA 1SUXA 5BMWA 3UZXA 1JRBA 4B9YA 3S47A 5A6LA 5K9CA 4MKNA 1YQ2A 4LH8A 2JALA 3VNJA 2D73A 4X22A 4DZAA 5C0QA 3TTSA 3A3HA 5GVJA 4DXKA 1CT5A 4HCLA 4P7OA 4N42A 1GTEA 4Y9PA 4UFJA 1P7TA 5T8GA 3WLSA 2EBNA 3QF0A 4Q4OA 5BOOA 3ARYA 4XD4A 2RAGA 4C6JA 5IRPA 2BNJA 2RFGA 4XBSA 2ZZ5A 1KXVA 3N19B 2PRLA 1RQBA 2RDUA 2WLYA 4LEFA 4JD4A 1QPNA 1XYFA 5LA0A 1FWDC 1W1TA 2OPJA 1N82A 3GNRA 1TJ0A 3LHVA 2EAWA 3KVLA 4M56A 1ODUA 1F3WA 2CLFA 5AHNA 4RDYA 2WSKA 1TPH1 4XZBA 2ZZ6A 4PTWA 3PTKA 3L4UA 4C1NB 1UBSA 5A8GA 3W7IA 2HWGA 2BXVA 4ATLA 3UR7A 1KC7A 1ONXA 4UFIA 4TV6A 1IEWA 1C8QA 2I56A 3AS0A 4FLQA 5K2ZA 1XLEA 1AH3A 5SWUA 4BQ2A 1QBBA 4YYFA 3C2VA 5C9ZA 3W6LA 1ICQA 5C55A 4QE1A 4LWWA 4UBPC 3BW3A 3MP3A 4CQDA 2CW6A 4K8EA 3TUUA 5B7YA 3SCUA 4CD5A 3DYMA 1YADA 2J79A 3L4WA 4IHCA 1S3HA 1KXHA 1XXXA 3OQEA 2VWSA 1W5NA 3UXAA 1P6WA 1B4KA 3CPUA 1UKQA 3N2CA 5DBTA 3PP7A 4JTSA 4HNUA 4CNNA 3PBGA 1SFTA 2D2GA 2VNCA 5FJRA 2WVSA 3K46A 1OX5A 3USZA 4BJHA 1FWAC 3FXGA 2BGNE 1BTCA 1E9YB 2D69A 3MV01 5T91A 3ORWA 1PCKA 1EYEA 1UR3M 1H7XA 3PBVA 2Q3RA 1W1B1 2YCJA 4BI5A 1JCJA 4D6FA 2OMAA 4J9JA 1BKSA 3G1YA 4MPQA 4A4AA 3MUIA 3HF3A 1J10A 3WG6A 4EPEC 1ISVA 4PC8A 1W0MA 4CD4A 3B8DA 1Z48A 3PPHA 3TJIA 1CX9A 4DXVA 1GOKA 1OFOA 2W5FA 1H1NA 2WJZA 2CERA 1TJRA 1RK6A 4PRTA 3RRXA 2ZUUA 3KOYA 2R82A 1UB3A 3W22A 3WCZA 2XVGA 4YTRA 5LZLA 3CAWA 3NYZA 4V27A 5I07A 3GDMA