4PTVA

Halothermothrix orenii beta-glucosidase a, thiocellobiose complex
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
445
structure length
445
Chain Sequence
IIFPEDFIWGAATSSYQIEGAFNEDGKGESIWDRFSHTPGKIENGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRILPEGKGRVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQDKGGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHAFGNHAPGTKDFKTALQVAHHLLLSHGMAVDIFREEDLPGEIGITLNLTPAYPAGDSEKDVKAASLLDDYINAWFLSPVFKGSYPEELHHIYEQNLGAFTTQPGDMDIISRDIDFLGINYYSRMVVRHKPGDNLFNAEVVKMEDRPSTEMGWEIYPQGLYDILVRVNKEYTDKPLYITENGAAFDDKLTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIEKGQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and structural characterization of a thermostable beta-glucosidase from Halothermothrix orenii for galacto-oligosaccharide synthesis.
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 1
total genus 172
structure length 445
sequence length 445
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ptvA00
2J7BA 1ESWA 4BQ5A 2X0HA 2ZWZA 4MB5A 5A1AA 1XCWA 3CLWA 1BPLB 1E0WA 1PX8A 2J7DA 1XD1A 5DFAA 3N15A 5IHRA 3ZJ7A 4OBSA 5E0CA 3OA5A 1ISVA 1W9VA 2FH8A 3QHMA 3CZLA 2WK2A 4TUFA 4D6CA 1KQZA 3N17A 3WY1A 1VFUA 4FLQA 4N0RA 5DT5A 2D23A 3K1DA 4KGJA 1HKKA 2G3MA 5CLWA 4PCTA 2PBOA 2X8RA 5FOOA 1EGZA 1QW8A 4CKQA 4UOQA 4W93A 2OLHA 1W9UA 1LG1A 2W63A 3VM5A 1BF2A 5CJ5A 4FLRA 4H04A 4UFHA 2CHOA 4B3LA 9CGTA 1VFOA 1D7FA 1XC6A 3DYPA 3TONA 3VD7A 3HU7A 1W1TA 3VM7A 4EE9A 2GJXB 5I3DA 2WVVA 4P7RA 2DH3A 1W3HA 3L4VA 3QR3A 3NIYA 3PZQA 2E8ZA 1WPCA 1JXKA 2XJ7A 1F4HA 2W61A 4MAVA 3ALGA 4AD3A 3VVGA 4PMNA 4U2YA 2X2YA 1J12A 4W8BA 4MB3A 4LX4A 4E4PA 4NSBA 3VPLA 1WCGA 2WZEA 3ARQA 4GI8A 5HDRA 1TVPA 2WZIA 4PUEA 1KXVA 4C7GA 2OSXA 4WKAA 1CNVA 3MUY1 3O6AA 5D9NA 2ZX9A 3WUBA 5GNYA 2BS9A 4H41A 2NT1A 4M56A 1GPFA 5A3HA 5JIWA 3WD3A 1Q6CA 4PUDA 3S6TA 3EDJA 3VIGA 1HJQA 1CXEA 2XHYA 2BVYA 2FHFA 2J7GA 1ISYA 3UEQA 2YOCA 4J28A 3AZSA 1R86A 3ZT6A 4D71A 3VDBA 4CGTA 2O9TA 4U2ZA 4D6IA 3VGBA 5ABHA 1VB9A 1WZMA 1BYBA 2DH2A 3SCRA 1E43A 2XWEA 1OB0A 1WDQA 3MV01 1C93A 5DEZA 3WQ4A 3MSGA 1KXHA 3WNOA 2QPSA 2JF6A 2Z1SA 1E6QM 1Q6GA 4LQ1A 1P6WA 4DUXA 1CLXA 3T2PA 4W5UA 3E1F1 3RM9A 3SEPA 1OGBA 3VGGA 1HNYA 5BYWA 1ZJAA 2J74A 1UA7A 5D9PA 4QCFA 4B16A 5A6KA 1VJSA 8A3HA 3ARRA 2EPOA 1BTCA 4UOJA 1JGIA 1UR1A 1J0HA 1CGTA 4Q22A 4HA1A 3ZJKA 4UFMA 2VRJA 2JALA 1BVZA 1RP9A 5BXPA 3EBVA 2AMGA 1H1NA 2V3DA 2GJRA 3FNDA 3BCFA 1HIZA 4DWSC 5I78A 1GHRA 1W32A 3U57A 4Q7NA 4IUGA 4WKHA 3T2QA 1BAGA 1E71M 4F79A 4EANA 3LPGA 3UETA 2O9OA 3EMQA 3KE0A 5E6ZA 3PZOA 3MU7A 1W9DM 2J7EA 1V0MA 3ZT7A 4M8UA 1ZBWA 1UZ4A 3NSXA 3BAYA 5D8WA 4GZJA 3AYRA 4OBRA 1V0NA 1LG2A 2V3GA 4MDPA 4TTGA 3SCTA 2QV4A 2J8GA 4MADA 4TX6A 1V6WA 1HN1A 5A6MA 3AS0A 4YHEA 2ZUWA 4AZ6A 5CQ1A 3KL0A 2D3LA 1M7XA 1B1YA 4OJYA 3SCSA 1XCXA 3NJ3A 1SMAA 2J79A 1PZ2A 1OCQA 4AYSA 2ZWYA 4JFWA 4MPKA 3KL5A 4IM4A 4ML4A 4PMUA 3L4XA 4D72A 2ZOXA 1V6VA 3N11A 4XB3A 3UR8A 4HZ8A 1UKPA 4WSKA 4B3KA 4W84A 3WFLA 1E15A 4M1RA 4F66A 5I24A 3KL3A 1B2YA 1MW1A 3CTTA 5A6LA 4TX8A 1W3KA 5HOSA 2B31A 1WO2A 1UD6A 3WEOA 4W85A 3WDIA 3HJEA 1QI4A 3KZSA 2A3HA 4J7RA 4CCEA 2WKGA 3VNYA 2WHMA 2XPKA 1ZB5A 5A2CA 4PMOA 2DGAA 4CCDA 1Q6EA 1R8LA 3MMDA 5JIPA 4L4OA 2V3EA 3RIKA 4DWSA 3GNOA 1CZ1A 4HMCA 3TTYA 4XX6A 3ZM8A 3BMWA 4JL2A 1E55A 3MMWA 1AQMA 2EQDA 2OWCA 1UR8A 3WD2A 1UWUA 4PTXA 3W25A 2WAGA 3VIFA 1OD0A 4JHOA 1U2YA 6CGTA 4AD5A 2YL6A 4AZHA 1TUXA 2IXVA 5EFFA 2RGLA 5A2BA 4KWUA 4PTVA 3OZPA 1KXTA 2HISA 2VUYA 2E40A 3TTSA 1ZU8A 3VIMA 3W81A 3WNLA 5JBFA 3BLKA 1E6ZA 4QLKA 3NYDA 1TVNA 1JZ8A 3VGDA 1RPKA 2VTFA 3UESA 2ZIDA 4BQ3A 2NSXA 4GKLA 3OIHA 3L4TA 1U33A 2D24A 3K4AA 1YQ2A 4J3WA 1D2KA 1MQPA 1N82A 3WENA 5HNNA 1XGZA 2XG9A 3MUAA 3IJ9A 3T0AA 5KZ6A 3POHA 4J3SA 1K6AA 4PMRA 1TFVA 3N18A 1PX3A 2J75A 4PRWA 1CDGA 1EIBA 1JDDA 1EOMA 2QHAA 2ZUMA 3WSUA 2DIJA 1XYZA 1CXFA 1E72M 4WKFA 3RCNA 2WMIB 2AOSA 3I3EA 4AXNA 4AD4A 2GVYA 1MFUA 3CZKA 3L2LA 4S3KA 3AZTA 2DT0A 1JNEA 1LL6A 5I23A 1B31A 2FGLA 1CYGA 5JBEA 3VDHA 1UHVA 1VFFA 2DIEA 4ZEPA 1BGAA 1W9XA 5GQBA 2J47A 4J3XA 3OGRA 1JYWA 3G6MA 2WHLA 3U5YA 1ISXA 3AROA 4AZCA 2CBIA 5HBFA 1J0IA 5A94A 3BAIA 2E9BA 1ISWA 2D0FA 3GDBA 4BQ2A 3UERA 1I1WA 1V0LA 5LA1A 4MB4A 2J8FA 2BXYA 2Y8KA 3BAKA 2V5CA 4OUEA 3GNPA 2W66A 1VF8A 2GJPA 1B0IA 4WF7A 4FMVA 3W28A 4PMXA 4OOUA 4NRSA 1GVYA 4AZIA 1WE5A 1LWHA 1IT0A 4AD1A 2QMJA 5AC5A 1W1VA 3EDEA 4TVCA 3J7HA 1WAWA 4GXPA 5GNZA 3RM8A 5E09A 2PB1A 3WKZA 4U3CA 2DPEA 2ZX8A 2G41A 1J0KA 4RE4A 3CPUA 2WYSA 1XV8A 1E6PA 3VDCA 1GW1A 1X6LA 4PN2A 3WDJA 3EYPA 5ABFA 2WW5A 2J78A 5CSUA 1UWSA 5A6SA 1HKIA 1US2A 1E3XA 2WCGA 3F5KA 4PTWA 2TAAA 2E3ZA 3SCUA 2D2OA 2ZUSA 1XH0A 4A3HA 2VVNA 1OIMA 4ACZB 2ZXQA 3RJYA 1PPIA 1K9EA 1JXJA 4UR9A 2D0GA 4R27A 2VCCA 3RMEA 3WQ6A 4NF7A 2UY3A 1V6YA 2GK1B 4CU6A 3RDKA 1HL9A 4CVUA 3LPOA 1H41A 2WC3A 2CESA 3SUTA 1H0GA 3SUVA 2VC9A 2ZXDA 1BQCA 2FH6A 3FY1A 5FL0A 3GXDA 4BZYA 2EPNA 3LMYA 1B90A 2DDXA 4P7LA 1FA2A 3VMNA 2EBNA 4U31A 2BVDA 1R7AA 1FH8A 2W5FA 2BNJA 4PBGA 1ITCA 3DHPA 5IXEA 1PEZA 5CPSA 3WUGA 4ZE5A 1PIGA 4H8UA 4KH2A 2WWDA 2XIBA 3M7SA 1GVIA 3CZJA 3EDFA 4HU8A 2OSYA 2F2HA 5LA0A 1XRVA 3I3BA 2EXOA 4BS0A 2A3CA 3CUIA 4ATLA 2WSKA 1NQ6A 4W8LA 4JIEA 2DT1A 5M3WA 1JZ7A 3WUEA 2WPGA 1E1FA 4WSJA 3ZOAA 4U5IA 1BG4A 1R85A 2VT0A 4AEEA 2E9MA 2D20A 1BVNP 3ZT5A 1DEDA 1RD6A 2DQXA 3WMSA 3L4ZA 1IZKA 5I5RA 2WLYA 1V08A 1GOIA 2XGBA 1CENA 5HXMA 1H3GA 5AC4A 5A6JA 2ZX7A 2G4FA 1JFXA 1M01A 4AZ5A 3OLEA 1US3A 4PMQA 1X6NA 3W53A 2C7FA 3AS3A 2F61A 1SMDA 2YJQA 4UFKA 1EHAA 2VOTA 4P8XA 2YLAA 2XUCA 3ALFA 2UY2A 4WLCA 3S2CA 3DYOA 1LLOA 2FHBA 1GOQA 1WDSA 3BC9A 3UG4A 5FCZA 1UD3A 1HVXA 3WD1A 1KR1A 1ZBKA 4DWSB 3L2MA 4KGLA 1VBUA 1KWGA 1D3CA 2DSVA 3IJ7A 1ZS2A 1Q6DA 1JD9A 3WH5A 2YDSA 3AXHA 1ECEA 1MXGA 3AMLA 3A4AA 1HP4A 2UY4A 1CTNA 2JIEA 1GOWA 2PWEA 4JCLA 5IFTA 2G3JA 4U3AA 1NARA 1VEPA 4LGXA 3WBEA 4NZCA 2WMHA 1PJ9A 3GXIA 3VMOA 4JKLA 2ZXBA 5D9OA 2X1IA 5JUVA 2J7HA 2PWHA 2VZOA 1B3VA 3A3HA 4CN1A 1UD2A 4E8CA 1C3FA 1S46A 3AMCA 3WDPP 3N1AA 2VR5A 4Z2LA 1ODUA 2GDUA 4GO8A 2C0HA 4PSPA 4UQAA 2X09A 1QVBA 4PYSA 1QBBA 3ARWA 3BAWA 3EDDA 1TA3A 5BRQA 1OIFA 7TAAA 4IISA 1KXQA 1KR0A 4MJ2A 4MNLA 1XSIA 4JFUA 4CD4A 5E6YA 5DF0A 1E9LA 4GINA 1K9TA 2Y24A 1C8YA 3OGSA 1G5AA 5A6BD 3WQ5A 3VO0A 2W91A 4HTYA 2BHZA 2V5DA 1AQ0A 1CGYA 3F5JA 2WZHA 3VIOA 3W29A 6TAAA 2E8YA 1IZJA 2D22A 2Y2WA 4W86A 2PWGA 3POCA 1Y7VA 4Z2HA 5I77A 4CD7A 2UY5A 4AZBA 1TA3B 2J25A 1ZJBA 3VIJA 3ZSTA 1B3XA 1NWUA 3HN3A 3FXYA 1RP8A 1VAHA 1TG7A 1E6RA 1VRXA 3KWXA 3ZQ9A 3CO4A 4DM2A 2D1ZA 3B8SA 3AHVA 2PI6A 3THCA 1FFRA 2JEQA 3HMCA 2WXDM 2Z1KA 1HJXA 1J10A 2FGZA 1GJWA 4D6DA 1KCKA 3AHXA 1JI2A 1KCLA 1LWJA 1V3LA 3AIRA 3WDQA 1NP0A 1DHKA 1BGGA 1EH9A 3GBEA 3AIVA 3W0KA 1JZ2A 1Q6FA 4ZXLA 1EDGA 4JFSA 4PEEA 3VINA 1MW0A 3AFBA 3VD4A 2ZUUA 3RO8A 2VZSA 1EOKA 1LL7A 3ARPA 2WB5A 1FHDA 4M29A 4V2XA 3SCOA 4DWSD 5A69A 3G6LA 1PBGA 1BLIA 5E0FA 3A47A 2XM1A 1EQPA 2A3EA 1CXHA 1QI3A 2NT0A 1J0JA 4C7DA 6A3HA 1FH9A 3NUKA 4D6FA 3T0DA 2GSJA 3K46A 1WZKA 2WLZA 1C91A 1UQYA 3BAXA 2WMKA 1C8XA 2YKKA 3APGA 1WZAA 4AD2A 4HMDA 1G9HA 4B9YA 4OZOA 2VMFA 4TVUA 1LL4A 2PF0A 3RJXA 2OWWA 1DWAM 3TTOA 3O2LA 3RILA 4JCMA 3MANA 4ACYA 5CPQA 1R7OA 2CYGA 1WP6A 1F4AA 2C8NA 4KMQA 2W4XA 3AXIA 3WD4A 3BMVA 5BCAA 3CZ8A 3WH8A 4M24A 3WQ8A 2BFGA 3BSGA 4W7UA 1C92A 1W3LA 1BSIA 1V02E 3O9NA 1FHLA 4QCEA 2G3IA 1VIWA 3WL1A 4PMYA 3DC0A 1HJUA 3WH6A 4BCEA 4IPLA 2XIIA 3CH9A 4L4PA 5M5DA 3VD5A 2WVUA 4KRUA 3GXFA 4AZGA 1TE1A 1V3JA 2MANA 4PCSA 5LA2A 2OYLA 3ECQA 1QHZA 1W2VA 1BYDA 1UOKA 1UD5A 3AIQA 4PMDA 3MO4A 1UR0A 1CLVA 5ABFB 4H8VA 3EMZA 1X1NA 2PC8A 3MV11 1MQRA 4OOZA 1J9YA 3PTMA 1HX0A 2WBKA 2J77A 2JIWA 5LYRA 1JZ5A 1B3ZA 3SUUA 4AY1A 1QHPA 1DP0A 2GUYA 3WIJA 2WBGA 3K8KA 3VX1A 4GI6A 4AIOA 1EO7A 5HPOA 2GDVA 2XWDA 4M80A 2VX6A 4XUYA 4LYPA 1JIBA 2CEQA 1E4IA 3CUGA 5E9AA 2VX7A 2VX4A 3BH4A 2XM2A 4W7WA 2D3NA 2A3BA 1V3MA 3WDRA 2YA2A 1W9PA 2YA0A 3LPPA 3PZNA 1HVQA 4JFVA 2VX5A 3WN6A 2UWFA 3AS2A 2ZE0A 1BYCA 3IANA 3QOMA 3VILA 3L4UA 4N42A 2YL8A 3WF3A 1QOXA 2YLLA 3K8LA 1EQCA 4AZCB 3GH4A 1V02A 3EDKA 3WF2A 4P8UA 1LF1A 2ZX6A 4P7NA 2VVSA 3SCQA 2GFTA 3VD9A 1E4NA 3AIWA 4UFIA 5BRPA 3ZMRA 1MFVA 4HA3A 1UYQA 5CZKA 3W82A 1UD4A 2BHUA 2WMJA 4Z2KA 1HKJA 2PBGA 1V6UA 5C8BB 4CD8A 1JFHA 1XSKA 3RPMA 1UH2A 3ARVA 3IK2A 3AISA 1E1EA 2WMIA 3AZRA 1NWRA 3MSDA 1VEOA 2DEPA 1OT2A 4CVWA 3VIKA 3WBAA 3VDAA 3PZ9A 5A8MA 3SUSA 2V38A 1UKTA 2X05A 1VJZA 1H49A 1UR4A 5EFDA 1EDTA 1UZ1A 1OT1A 3MKKA 3BXWA 1DWHM 3VGEA 3GBDA 1B3YA 3WNKA 4MJ4A 1JYXA 1CGWA 1FP9A 2O9PA 1VENA 3SCWA 3IAPA 3ZR6A 4D6JA 4W7VA 2WCSA 4ACZA 1GJUA 3WL0A 1MW2A 3CUHA 3CZGA 4S3JA 3CIVA 3MUZ1 4CD6A 2XFYA 3VUPA 2A3AA 3T08A 1GORA 3VIHA 1GQKA 1K9FA 5M03A 2BY0A 1R87A 5CXPA 2O9RA 3CZEA 5BXSA 4F8XA 2Q8XA 3UG5A 4HPGA 3WEZA 1EDQA 4UZUA 2JF7A 4Z2GA 1GCYA 4Z2JA 1QNPA 3K8MA 4AIEA 3WMCA 4BF7A 3OG2A 1JF5A 3CMGA 2YDQA 5A6AA 4MB1A 3AOFA 2QF8A 2WC7A 4JKMA 2WMGA 4HZ6A 3PTKA 1JDAA 1UH4A 3WNNA 3BSHA 2DSUA 1W91A 5C71A 1FH7A 5IFPA 3ZSSA 1ITXA 2ZUTA 3WF4A 3MMUA 1E56A 4E2OA 1KBKA 1UWRA 2WC4A 4GZEA 4AISA 1M04A 3QHNA 4PMZA 1IV8A 2VURA 2CETA 2J4GA 3WELA 2BXZA 1Q4NX 2BV9A 2VCBA 4XZBA 3CUJA 2O92A 4RL3A 1OINA 4D6HA 4K68A 3AHZA 3ARXA 3ZR5A 2VZVA 3U7VA 4ATDA 2WANA 3ZIZA 3UCQA 4EKJA 3NSMA 2VRKA 5ABEA 2CCRA 1W9BM 3OLGA 4EK7A 1G01A 1VFMA 4MTVA 3AJ7A 1EHNA 3OLDA 4D6GA 1NOUA 5D4YA 1J18A 3GZAA 1V0KA 4V27A 4H7VA 1W3JA 4H2CA 4A3YA 2QMKA 1WNOA 3RM4A 2YIHA 1H0IA 5A2AA 1WB0A 1BYAA 3A4XA 1E5NA 4FK9A 4XV0A 2WVTA 3T09A 2QLYA 2CBJA 1KGUA 1ZL1A 2EO7A 3GTNA 1JNDA 1JL8A 3GYCA 3M07A 2BY2A 4J3UA 4M82A 5CLTA 3WD0A 4TTUA 3N12A 2CERA 4W88A 2DSKA 1JZ6A 2BVTA 2VQUA 2JEPA 3PZUA 5A8PA 1UWIA 1JZ4A 3NDYA 4JZ5A 1JG9A 3CHDA 5DO8A 2WHKA 2WSPA 2VI0A 1OBAA 3M46A 2EEXA 1E6NA 2JFEX 4AC1X 1HXJA 1WDRA 2CHNA 1OWQA 3MUIA 1OD8A 1ODZA 1NOWA 1UH3A 5BXRA 1C8QA 2W92A 3OBAA 1ISZA 5AYIA 2XVNA 1DWGM 1UWQA 1DWIM 3GH7A 1WKYA 3F4VA 1CPUA 1K9DA 3SCNA 4LPCA 1GQJA 1HJVA 1XYFA 1FFQA 4HOXA 2ZUNA 5ECUA 3QHOA 4TXEA 3GXMA 5GPRA 5A6BA 3TOPA 2EPLX 4TVDA 5JBDA 3PBGA 3FAWA 5IHSA 1HT6A 3WUFA 1MWOA 3FW6A 1CGUA 3N9KA 1BHGA 5I2UA 3FHAA 1V03A 2OYMA 3AHYA 4E8DA 4UCFA 2WKLA 5E70A 3WF1A 3ZJ6A 1MYRA 2XVPA 1UKQA 1KWKA 4F9JA 4F9DA 1DWJM 1GOOA 5HPCA 1EA9C 2CKSA 4HP5A 2CNCA 4UQEA 1YHTA 3D5HA 2XYLA 4LYRA 4ZE4A 4D6EA 3PN8A 3I3DA 5GNXA 1NWTA 1UA3A 3N13A 3NSNA 4RE3A 4PTMA 2BY3A 3NCOA 1G0CA 3II1A 1XHGA 4W89A 1PZ3A 3UG3A 4EAMA 2G8ZA 3PZTA 3B9EA 5BXTA 4OIFA 1H4PA 1MQQA 3SIMA 3AIUA 1E6SM 1VEMA 5BWFA 2E4TA 2J7FA 3TTQA 3VOCA 4ZXOA 4MNKA 2QPUA 1OM0A 2ZUVA 4PSRA 4URIA 2EJ1A 1V3HA 4PMVA 3VU2A 3AMKA 2W67A 4GO9A 1TZ7A 2OWXA 5FD0A 1BG9A 5M17A 4ATWA 1GOMA 1OSEA 3OZOA 4R5EA 4UZSA 4AMCA 1AMYA 3PZMA 5FKYA 4AW7A 2YL5A 3BCDA 5A95A 4GI9A 4FLOA 5I79A 5F7UA 3M6DA 4YN5A 4U5KA 5CG0A 3DHUA 3OB8A 4HPHA 5FIPA 4BQ4A 2WVVB 1J0YA 3SURA 4CN4A 4UFJA 1Z32X 2XVLA 2ZX5A 3DECA 4GQQA 1KFWA 3T2OA 3QGVA 1JD7A 4CU7A 2RGMA 3WEMA 5ABGA 4LXFA 4AIUA 7A3HA 2IUZA 4AZ7A 1E4MM 4UQ9A 4X9YA 4JAWA 3PZVA 4QAWA 1PX4A 1O6IA 2VZTA 3VNZA 1A3HA 4WIWA 1JAKA 1A47A 1SYTA 1XSJA 1E70M 3AQUA 3SUWA 1CIUA 1JF6A 3ZO9A 4QFUA 4UTFA 1QI0A 3ZJ8A 1GUVA 5BROA 1AVAA 1I75A 4KRTA 1EO5A 1FP8A 4B15A 2VO5A 1MXDA 5EBAA 2XSBA 1CWYA 3WDHA 4Y7EA 3WH7A 3VGFA 3GM8A 4CN6A 3WQWA 5IDIA 2VJXA 2EPMX 1HJWA 3AICA 1WDPA 1CXKA 3B9AA 2WVSA 2DSZA 1CXLA 4X0NA 2IXUA 1DWFM 4HZ7A 1H5VA 3N04A 4RE2A 1V3IA 1ZBVA 1JAEA 2J62A 1XH2A 4FF5A 3OLIA 3BLPX 4DUVA 1G94A 4UQCA 1V3KA 4XZWA 1M03A 1UKOA 2WM0A 1E4LA 3ARUA 1UR2A 1GNXA 1W1YA 1QW9A 1DTUA 3BAJA 1G1YA 4HOZA 3AXXA 1W1PA 3TP4A 3W27A 4C7FA 4DUWA 1GQLA 1CGXA 3UR7A 2GK1A 4TOQA 3U5UA 4A4AA 3VTRA 3ARTA 3FN9A 4FLSA 4YPJA 2CXGA 2EPKX 3A4WA 5I0DA 3IJ8A 3L4YA 7CGTA 4JFTA 1UR9A 1GZJA 2YBUA 5I6SA 2BY1A 1FOBA 5KEZA 4CD5A 1HL8A 2ESCA 4D1IA 4X0VA 2NW0A 2E0PA 3CGTA 4AWEA 1E3ZA 2E9LA 3AYSA 1E6XM 4MAZA 1B9ZA 1BFNA 5AYBA 3D3AA 3VX0A 3CUFA 3AIEA 3NDZA 4QLLA 4ZENA 4YHGA 4AEFA 3LPFA 5TD4A 2VRQA 1M53A 3K4DA 2DSWA 3VIIA 4P8VA 3GNRA 3L4WA 1PAMA 5FL1A 3WMBA 4W5ZA 1OGSA 4LYQA 1UKSA 4CUCA 1E0VA 3DYMA 2D0HA 1GHSA 1GOKA 3FHQA 4JKKA 1JZ3A 3W37A 1MW3A 3IAQA 2XVGA 4UQDA 3FAXA 3VIPA 2Y5EA 3U7BA 1MVYA 3SCPA 3MS8A 2HVMA 1UD8A 4P7QA 4B9ZA 1JDCA 5CGMA 2VNCA 3PZIA 2YDRA 5A8QA 3AHTA 4HU0A 8CGTA 4UOZA 1J01A 1QI5A 2YA1A 2PWDA 3EMCA 3SCVA 5CSYA 1W2PA 2GJXA 3A6OA 2W62A 2XFFA 3F5LA 2V3FA 1AQHA 3CMJA 1QNRA 1E73M 2WCAA 4CCCA 1XH1A 2AAAA 2CBUA 3TA9A 2F8QA 3JUGA 4AD0A 1CECA 2FDMA 4GPNA 2CPUA 3WNMA 1UUQA 4W87A 1WZLA 4NRRA 1O7AA 3THDA 1J11A 4HA4A 1LJYA 3KEHA 4JL1A 2XGIA 4MNMA 3OGVA 4GQRA 1KBBA 1EXPA 5AY7A 3ARYA 3W6LA 1NM9A 1CGVA 1HF6A 1HJSA 3T0BA 1C7TA 4QDMA 5D8ZA 1CEOA 1NP2A 1KGXA 3VD3A 1KQYA 1KGWA 5EB8A 1NOFA 1UWTA 1QBAA 1C7SA 2VCAA 4GIAA 3W4RA 4QLJA 2XTKA 2XSAA 4BA0A 1I1XA 5C70A 4M81A 1E0XA 1JYVA 4QP0A 3WF0A 2CIPA 2WHJA 4J27A 1JYNA 2VR4A 2Y4SA 2FHCA 1NWSA 1H11A 2XFRA 1JI1A 2DT3A 3W38A 2J7CA 1QNSA 1E5JA 3VKKA 1J0ZA 5CPTA 1B30A 2BHYA 5EMYA 4P7OA 3PZGA 2CKRA 4D1JA 3AS1A 4UNIA 3AMDA 1OGGA 1SR0A 4J3VA 1UG6A 4UQBA 2OSWA 2OYKA 4HOWA 1VBRA 3CHEA 2WMFA 2CITA 3VMPA 3WFZA 2VZUA 1LQ0A 1NH6A 1KB3A 2WWCA 4ZFMA 1TMQA 1L0PA 2Y8VA 1QNOA 2ZICA 3CHFA 4H8HA 1TR1A 4MDOA 4WK9A 3PTQA 3BGAA 2PWFA 4W8AA 3WH9A 4U33A 1B3WA 4IPNB 2G3NA 3WNPA 1XD0A 4UFLA 4GZIA 3VGHA 3AIBA 1RH9A 3AI0A 1QPKA 1H09A 1U30A 3ARSA 3ARZA 3W26A 5DT7A 3W6MA 3WQVA 1SFSA 3CBWA 1L8NA 4HMEA 4MNJA 2DT2A 5D9MA 1E40A 1UQZA 5A8NA 1H2JA 3AMGA 1QHOA 1TCMA 2VL4A 4Z2IA 4OKDA 5CGTA 2YL9A 5DMYA 2ZXAA 4J3TA 2X0YA 1V6XA 1C90A 1GONA 1HP5A 3PHAA 3GH5A 4CU8A 4NI3A 2YBTA 1CXIA 1CBGA 4V28A 3W24A 2VQTA 4P8WA 4WJXA 2WNWA 1GQIA 1QI2A 1QNQA 3B9DA 1HKMA 2XVKA 3CHCA 5A8OA 4DM1A 2JE8A 4JHZA 1PIFA 1ZBCA 3QOKA 2CBVA
chains in the Genus database with same CATH superfamily
5H8UA 3W1UA 2X0HA 3VKJA 2ZWZA 1KV5A 1Q8AA 3LGEA 1XCWA 3ID7A 3IJLA 2DIKA 3HGRA 3N15A 1YTDA 3KRBA 4M19A 1ISVA 4HNTA 1W9VA 2FH8A 4H7CA 2AL1A 3N4EA 2FJUB 2WK2A 3CIWA 2FTPA 1KQZA 3WJYA 3IGSA 3L68A 1R9YA 3N17A 1VFUA 2VEFA 3NL5A 4RDZA 3ZLHA 3DGRA 2GGHA 4RNFA 2G3MA 5CLWA 2QUNA 2W9MA 2X8RA 4MFDA 3TAKA 3ATZA 1IIGA 1NDVA 2ZADA 3GHUA 1EJSC 1DJXA 3KBJA 2R1MA 2RDWA 4J2MA 4OVXA 3VD7A 1H63A 2XH7A 3QLLA 3OQEA 6REQA 3HG4A 4P7RA 3CQHA 1VCGA 2ONEA 3KHJA 1EWDA 4MAVA 4US5D 4PMNA 4FX7A 5TNVA 2X2YA 4XWUA 1J12A 1LTDA 1WCGA 3KX6A 2HV5A 4GI8A 2F84A 4C6BA 3MY9A 1TVPA 2V9DA 4PUEA 5D2YA 1DJNA 1XRFA 4EAYA 4PGLA 4WKAA 1KBIA 3TYZA 3GTFA 2CWNA 3MZ2A 4X3ZA 3TC7A 2BS9A 3E0IA 4DO6A 3ITVA 5A3HA 3WD3A 1WX0A 4O28A 1J5SA 2BODX 4QJ3B 1D3HA 2FHFA 3UEQA 4D9PA 3C86A 3WBYA 3ZT6A 3DI1A 1ADOA 3VGBA 5ABHA 1BYBA 2V68A 3B97A 1OB0A 1H5YA 5FAGA 2IKHA 1KRBC 3WQ4A 2Z1SA 4BFAA 1LUCA 2BZNA 3WJZA 5AHIA 3GR7A 2A0NA 4NVTA 1CLXA 1NVMA 3T2PA 3QSRA 2OGJA 3GW0A 3SEPA 3BMXA 4EVZA 4HNCA 5BYWA 4DO5A 4WGHA 5D9PA 1VJSA 8A3HA 3LHTA 4H9XA 1V7AA 1VQTA 1RR2A 1JVNA 1IQ8A 4EWJA 5K4XA 1PYMA 1L6YA 2JALA 3CO8A 3GIPA 5BXPA 3EBVA 2JGYA 4Y9OA 3KLLA 1XLLA 2GVGA 2V3DA 1T5AA 3MDUA 4NJGA 3TYDA 5E5CA 4WXYA 1FQ0A 1PKMA 4EF9A 2NQJA 3ITGA 3ZT7A 2GJLA 1ZBWA 1UZ4A 4HHPA 3R0UA 1V0NA 1MDRA 4JNZA 2V3GA 4PTNA 2QR6A 4MADA 1V6WA 1XIDA 4O52A 1H1YA 5CQ1A 1K8ZA 3KL0A 1M7XA 4S23A 5H91A 4MYXA 1SMAA 1B5TA 1LORA 1XIBA 4Y9AA 3KL5A 4IM4A 5CSSA 3L4XA 4D72A 2WSRA 1V6VA 3UR8A 3W72A 4W84A 4JTFA 5CKSA 3WFLA 4K7YA 1E15A 4F66A 5G4WA 3HM7A 3SQSA 4JQ2A 2B31A 2IPFA 2QW5A 1WO2A 3WEOA 3XINA 1QI4A 4HGXA 3KZSA 1Q45A 4C6OA 5T9BG 4O15A 4XAPA 5A2CA 4PMOA 2DGAA 4CCDA 5HNTA 3MMDA 1W8SA 4XIMA 4C6DA 1SU5A 4LS1A 3RYSA 4GG9A 3BMWA 3PSVA 3MMWA 4MWAA 4AVFA 3N6JA 4IQLA 1W56A 3GLCA 3EWBX 4UUIA 3AXKA 2YL6A 1TUXA 4HK5A 3MI6A 4GUIA 1W6TA 1YXDA 3LXBA 4NZ5A 1D7KA 3WNLA 1TVNA 1JUKA 2NZLA 1RPKA 3UESA 3CHVA 2X1RA 4GUHA 4JTUA 1R3TA 3L4TA 5HQLA 1YQ2A 2G0WA 1N82A 3CQIA 5HNNA 2ZFAA 4E5TA 3IIXA 3MUAA 4FIQA 2ISDA 3IJ9A 1AJZA 3POHA 4J3SA 2CLPA 4JTKA 1FVPA 1HFBA 3C3NA 4IP5A 4ILSA 3N18A 1O5RA 3GC5A 3TZFA 1EIBA 4IX2A 1N8WA 3B40A 1K70A 1NDZA 2OVLA 4AHOA 5D2WA 2WNZA 4PB5A 4AD4A 4Z1DA 5EBUA 2AAMA 1KO0A 4FR6A 1XLIA 1B31A 1TJPA 1GYNA 3UY8A 2I7GA 1S2UA 2CLIA 1UHVA 1VFFA 2Y85A 3KOZA 4KKXA 4QHRA 4MUPA 1EJVC 2R1PA 3NZPA 4ZEPA 1LT7A 5GQBA 2J47A 3HTWA 3RGTA 2PPGA 2HBXA 2P0IA 3V4BA 4YCPA 2CBIA 3RG6A 1Z89A 4BQ2A 1I1WA 3H22A 3SR7A 2VWSA 2JKEA 4LEFA 5FESA 2CZDA 2V5CA 2HE5A 3GNPA 1JQXA 1E1CB 1B0IA 3VOFA 3W28A 1I2OA 4ZA0A 4PMXA 4OOUA 3SGGA 1UWAA 4C5ZA 3EKLA 3OIXA 2HK1A 5C7VA 2Y1HA 3TH6A 3G0SA 1LWHA 2KZHA 3DBNA 1TSIA 3WLIA 4GJIA 4KWOA 3TR9A 3YPIA 1TPEA 7TIMA 2H9AB 2PB1A 4U3CA 3CT2A 3RU6A 2ZX8A 1T8QA 5FACA 2OKOA 3IK4A 2H8XA 1TO3A 5ABFA 3S2MA 5CSUA 2GVLA 1HKIA 1US2A 1E3XA 2D2OA 4WDUA 2VVNA 3SGUA 2PGFA 4ZVJA 3WQEA 4GYJA 4PFMA 3CM4A 3RJYA 4NJJA 3VK5A 2D0GA 3ZVHA 1TUFA 4NF7A 2GK1B 1JPKA 3LPOA 3R0DA 4Q7IA 1LUCB 4R9XA 3SUVA 3APYA 5FL0A 4BZYA 5HQMA 1W5PA 1NAL1 4BWLA 3LMYA 1OCNA 4S3EA 2CFFA 2DDXA 5DX7A 2PCEA 1FA2A 3PUGA 4MHBA 5BU9A 1R7AA 2O7SA 2BNJA 3IJQA 5IXEA 4WOQA 4ZQRA 4ZE5A 1A0DA 4H8UA 2WWDA 2XIBA 3MUXA 3M7SA 2GOUA 4S2CA 4DBSA 4O0KA 1IXPA 4IMFA 3EOUA 3CZJA 2OSYA 4AWUA 4BS0A 4NZ1A 3INPA 5B7YA 3K2GA 2PD9A 4NYYA 4E4UA 1PXGA 4W8LA 2DT1A 1JZ7A 3WUEA 4WSJA 3ZOAA 3URNA 3I6TA 4I9TA 2VC6A 4U5IA 2PLKA 1Y5WA 4DZ5A 4Q8UA 2OB3A 1RD6A 3BW3A 1G7VA 1M5WA 3M4HA 3GKAA 1BKSA 2DZSA 1S5NA 3E0FA 4XVDA 1F3XA 4WDXA 3OOQA 1H3GA 2G4FA 3VNJA 1VPQA 1OZMA 2NXHA 4JTRA 5DXYA 3BANA 1X6NA 2C7FA 3AS3A 1UW9A 4KETA 3L66A 1Q66A 1JCJA 2HZGA 4WLCA 3DYOA 3ICJA 3VZXA 2FHBA 1TV8A 3N2CA 2X1SA 1RJRA 3UJRA 4FXFA 3W7EA 3STEA 1MRAA 3W1MA 1UUMA 4U28A 5FCZA 1HVXA 1EGVA 4DI8A 3EX2A 4DWSB 1KWGA 1Q6DA 2YDSA 1XL9A 3AXHA 5CAHA 3AMLA 1TTJA 3OYZA 1GOWA 2PWEA 4GKTA 4U3AA 3WBEA 3U6WA 4X22A 1CCWB 5D9OA 3UQNA 5JUVA 1NIUA 2PWHA 5FEZA 3BSMA 3UZYA 3FA4A 1A5LC 2OO0A 1EYWA 2ACRA 3DN5A 3WDPP 4HU4A 5HMSA 4IL2A 1XPGA 4O50A 2GDUA 4PSPA 1EKOA 4QIUA 4NKCA 2PGWA 1E0TA 4IP7A 4G2DA 1BD0A 2WQDA 3G2GA 1QVBA 5F2GA 2GVEA 1QBBA 3E12A 3MVIA 3OBKA 4C6IA 3TNBA 2NXGA 2DUZA 1Z8AA 3GU2A 2AGTA 2OFJA 5BRQA 2RHGA 1OIFA 7TAAA 2FKPA 2IPWA 4O1FA 5GVJA 1K9TA 2EKGA 3B3DA 1G5AA 3THQA 3WQ5A 3H8AA 5G2WA 1K77A 2W91A 1T0OA 2BHZA 1AQ0A 4EWND 4XAZA 3F5JA 1TWSA 1IZJA 4W86A 2PWGA 1AODA 3POCA 3U4AA 4Z2HA 1YTEA 4LBSA 1DVJA 3MCNA 3R43A 1MNSA 2NWSA 3NFUA 1VAHA 1GVOA 1TG7A 1VRXA 4GC3A 3E5BA 3K1GA 3L5MA 4N9DA 2HXTA 4L4MA 1ZENA 2JEQA 4F2BA 2P5NA 4NZJA 1EX1A 3B8VA 1KCKA 3AHXA 3GHSA 4HA0A 3T8LA 1KCLA 2OZ0A 2OEJA 2OZTA 2PEVA 4JBRA 5I3HA 1BGGA 2QDDA 1VJIA 3B0PA 1EH9A 3GBEA 4JN6A 4ZQCA 1K7EA 4O14A 3W0KA 5B80A 1EDGA 3VINA 2PTDA 3FGCA 2B7NA 3QFWA 2RDTA 5AFDA 1P1MA 3M0IA 2WB5A 4M29A 4DWSD 2PDNA 1BLIA 5E0FA 3A47A 3BWWA 2CLKA 3B0YA 2H6RA 4Q33A 3N4AA 2E7FA 6A3HA 1T7LA 4XKYA 3PVFA 3IIZA 3H23A 2QIWA 1UQYA 3SN0A 3URQA 3LD5A 2YKKA 4HMNA 3VA8A 4E3TA 4B9YA 1T40A 2VMFA 4TVUA 5D2TA 1DWAM 2ANUA 2HRWA 4KFNA 3VNDA 3HPXA 4ACYA 1RAKA 2AQOA 3QMTA 4A35A 4S38A 3WCZA 3EWCA 1WA3A 3V3WA 1RA0A 1W3LA 3KTCA 3S83A 1TWIA 1S39A 1FWSA 4IPPA 1XPYA 3WO8A 1VIWA 4R53A 4EXBA 2YBVA 3VABA 3WH6A 4IPLA 5M5DA 4L4PA 2Y61A 4NX0A 1CW2A 3BQ5A 3LQGA 3VD5A 4NP7A 1V3JA 5T26A 5F4SA 2FZNA 3RR4A 2PDMA 2TMDA 1Z6KA 2Y0FA 5ABFB 3UWWA 4Q4KA 3EMZA 4QX4A 2A21A 3MV11 1J9YA 1OEPA 3TC3A 1L2UA 2EG7A 2JKPA 3S2LA 1W54A 4XIAA 5F4WA 3TW7A 3R94A 2WBGA 3CWOX 4ZODA 2OEMA 1G7UA 2QCGA 3VX1A 3TV8A 3FVMA 2XWDA 3V1HA 2ZBTA 4B90A 3LTYA 1FCUA 2CEQA 1A5CA 1YPIA 3CUXA 2XM2A 4E0CA 3TU9A 3RPTA 2YA2A 3LM7A 4IFOA 2OQLA 4JFVA 1TIMA 3HG3A 3S8HA 1SZGA 3IANA 3QOMA 3VILA 5HATA 1IEWA 2Z29A 3P93A 1EQCA 3UVAA 3W7KA 1RBOB 4O53A 4QE5A 4QJ5B 3WF2A 3EB2A 1LF1A 2VVSA 3LBMA 3SCQA 3QQ0A 2P50A 4LUYA 3VD9A 4DF2A 4XZIA 3ZMRA 3HFTA 3W7QA 4YTQA 3F2DA 5CZKA 1JCLA 4NILA 2WMJA 1FXPA 5BOOA 3SZ8A 3R13A 4LV9A 3W1PA 4CD8A 4YTSA 4H4IA 1JFHA 3LQLA 3OP2A 3PM6A 5AVHA 4IH3A 4RXGA 4GUGA 4YMZA 1JCNA 2BVWA 1OT2A 1WV2A 3VIKA 3VDAA 3PZ9A 3LXCA 3SUSA 2V38A 1UKTA 3TK7A 1LROA 1H49A 3KVJA 5EFDA 3VNKA 3BXWA 3GBDA 2NV2A 4MJ4A 1PWLA 1SM9A 3W1RA 4F40A 5DELA 1VENA 3SCWA 4W7VA 4ZOEA 3TCSA 3LHZA 4CQDA 5XIAA 3CIXA 5D30A 1PL9A 2PRMA 3W84A 3MUZ1 2YW3A 4CD6A 3QC0A 5D38A 4WQ6A 3CL8A 3KWSA 4RR4A 3NDOA 5H6HA 1GQKA 2I16A 2BB0A 2BY0A 1A5BA 1KCXA 3WX7A 1THFD 1EEXA 4V1YA 3CEUA 3MCMA 2JK2A 3A24A 4HPGA 3WK1A 2DQWA 1GEQA 3NQEA 3IV3A 3GU1A 3TN3A 1QNPA 4H6QA 1UC5A 3DOPA 4H83A 3W23A 4QM1A 3BG3A 5AYYA 2FZ8A 2RJHA 1XYBA 2YDQA 2PDQA 3ENLA 4B4HA 2QF8A 2YFOA 3MPGA 4OT7A 1UH4A 3BJSA 4IIEA 3FKKA 3VNLA 2YXXA 1E1CA 1YE6A 1LM1A 4AX7A 5EU9A 4KT2A 3UWZA 1KBKA 4GZEA 3QW4B 5TF0A 3SQLA 1IV8A 4HYRA 1DHPA 4QISA 2CETA 2I1OA 2J4GA 3F4CA 5C6MA 2D2GA 2VCBA 2MNRA 4XZBA 4Y9MA 2E5CA 2B81A 2DZUA 1OINA 2IKGA 3AHZA 1UUOA 4AEOA 3I7RA 1C9WA 1YADA 4FB7A 2CCRA 4I3GA 1S1PA 3OLGA 4ZO6A 3QH2A 1Z3NA 1EHNA 1LBMA 2QCNA 4D6GA 3PNUA 1RK5A 2GUBA 3RLVA 4DBWA 4E2VA 1QJWA 5HANA 4C1LA 4H2CA 4A3YA 3W88A 4HIBA 1EBGA 3ABXA 4YU1A 4C1NB 4DJDC 4IXXA 3S5NA 1O5KA 4UTTC 3LRKA 4C1KA 3TJIA 3C2YA 3M47A 4HU3A 4O12A 2CBJA 4O4WA 4JIQA 1KGUA 1ZL1A 2EO7A 1JNDA 2ZQ0A 3GYCA 3M07A 2HPIA 5CLTA 3OVPA 3WD0A 4M6PA 2CERA 3GG0A 3SJNA 3DBPA 3GXTA 2DSKA 3ES8A 1JZ6A 5JU6A 3ERPA 4DPQA 2WHKA 3SFKA 1WUEA 3DCPA 2Q8ZA 4RKAA 2EEXA 1DIKA 3GAKA 4WVXA 1N55A 2PMQA 1YNQA 1WDRA 1OWQA 1IGSA 1W1A1 3MUIA 1PKNA 1UH3A 1XICA 3OBAA 4TO8A 1DWIM 1KM1A 1WKYA 1CPUA 1HJVA 2QKFA 3G1VA 1QAPA 2NLIA 5MF5A 4HT3A 3NXLA 2Z00A 1J2WA 4L61A 5A6BA 3QN3A 2EPLX 3IVUA 3PBGA 3W7OA 5IHSA 3PBYA 1M65A 3WUFA 1XIHA 1P5BA 1CI1A 4IMCA 2A4AA 2ZTKA 2QJHA 4BK9A 4JTSA 3WLRA 4LWWA 2WKLA 1VBGA 1VYRA 1P0NA 3KXQA 1RK6A 1KWKA 1RVKA 2BLEA 2E25A 3CNYA 4MPQA 5HAOA 3QV6A 2P88A 5DCBA 3D5HA 1WUFA 4OV9A 1XKJA 3N3TA 3IGXA 5IRPA 3B8DA 3M43A 3PN8A 4YXGA 3WQGA 4EXQA 4QJ4B 1UA3A 3N13A 4IPJA 4MY9A 2BY3A 4W89A 2RFGA 4A3RA 1PZ3A 4F0RA 2QXWA 3UG3A 1S5WA 3G1DA 2Z2AA 1VEMA 2LLEA 2X0SA 3TTQA 2INEA 4ZXOA 3ABOA 3IWPA 1ELSA 1V3HA 3SM0A 1LLWA 3APTA 4GIRA 3CAKA 1A80A 2JQXA 3VOIA 5CBBA 4Q8MA 4WY0F 4HNLA 1CX9A 1BG9A 3TLLA 4DJEA 1UC4A 3SW6A 1XXXA 3GXNA 5A95A 2DJXA 2E6AA 4OFCA 1Q7ZA 3DIPA 3OB8A 5FIPA 2WVVB 2Z1WA 4UFJA 4NU7A 3DU0A 5AKQA 2BGQA 5CPOA 3P2VA 3T2OA 3QGVA 4LCSA 3BLFA 2V0TA 5ABGA 1Q63A 4XD3A 2HDJA 4H3DA 3WQCA 3W7DA 3H4WA 4ERGA 4X9YA 4QAWA 3P5ZA 2VZTA 4HHHA 3VNZA 2XZ7A 3CL6A 2CHRA 2VEIA 3ABRA 1Q8JA 3AQUA 3KOWA 3MHFA 4JQ1A 1JF6A 2R1LA 1WDWA 3ZJ8A 3U0HA 4DEFA 2QCHA 1CB2A 1YDYA 5AHEA 2DJLA 1OX5A 4L65A 3M7WA 1UBSA 2X1UA 2PP1A 4RK8A 1NFPA 3VGFA 1R3WA 2I14A 3GM8A 4IX0A 3RMJA 4CN6A 3A3XA 1FWWA 3G1AA 1YIXA 2O56A 2IXUA 1XLEA 1D8WA 1DOSA 1LQ2A 1E9YB 3KZPA 1AUSL 1Q7QA 4UQCA 4XZWA 1M03A 3W01A 2WM0A 3UFYA 3ORWA 2ACSA 1H7PA 4WDTA 1AD4A 1W1YA 1DTUA 3NQ2A 4HOZA 3TP4A 1W1PA 3GVGA 3W27A 1Q2RA 1GQLA 3B0XA 4F0HA 2VWTA 3UR7A 4S3FA 2DU2A 4C6KA 3R1ZA 4FLSA 4GIEA 2EPKX 3IJ8A 3L4YA 1PTDA 3QR0A 2QVNA 2F2KA 1O94A 1UR9A 4JTQA 3P74A 3WBWA 2YBUA 4EF8A 9XIMA 2Z1XA 1KLZA 2NV1A 3WLSA 3P82A 1EPVA 3B4YA 4X0VA 3AAMA 5K4ZA 4O18A 1E3ZA 3O63A 2E9LA 4RNHA 4Y6GA 2I57A 5DY2A 2YXGA 5C5YA 3AIEA 4AX6A 2PDPA 4F0KA 4FNQA 4YHGA 4NNBA 1AFSA 2YCEA 2VRQA 1VFHA 1S2CA 3GNRA 3QR1A 1TIWA 3W75A 4I6VA 1GG0A 4Q3MA 3R58A 4LYQA 4CUCA 1E0VA 2QCFA 3FHQA 1MW3A 2XVGA 4UQDA 3O8AA 3SCPA 1A3XA 1UD8A 3W7CA 2TRSA 5CGMA 2VNCA 3ZYZA 3LG3A 3BW4A 3VYLA 1DIDA 4ICCX 1QI5A 5D33A 3TJXA 3EMCA 1XCFA 4E6MA 4ORIA 4L80A 3GUWA 2XFFA 4LB3A 5FEXA 2J6XA 1QR7A 2O4MA 3KCJA 4HPNA 1B4EA 4IMEA 1J5TA 3NO1A 2A7RA 1IGWA 4TR9A 5D32A 2AAAA 4FNTA 3UVIA 3TA9A 3NQGA 1HKWA 4AD0A 2YFNA 3QMSA 1LDCA 3O6DA 3DX5A 1UUQA 9XIAA 1LRQA 4O8AA 4AVNA 1I8JA 4UMBA 1XUZA 4GHRA 3TQPA 2XGIA 4GQRA 2FLIA 5AY7A 4I9MA 2Z27A 1CGVA 1M7JA 2BG5A 2ZRYA 2GQ8A 4LB4A 1Z69A 5T9CE 4LS2A 3G1RA 4H7ZA 1KGXA 3VD3A 4QLJA 3FJLA 1J2BA 4Y9PA 4BA0A 3EKZA 1XM3A 4QP0A 4PBFA 8XIAA 2VR4A 4LF1A 1H11A 1J0ZA 3NWRA 2IQ0A 4P7OA 4KIRA 3E0VA 3H2NA 4OWGA 3I6EA 3WFAA 3IIPA 1VBRA 4J4KA 3LCHA 1WXYA 1NH6A 4DELA 4A8LA 4ZFMA 1OFDA 1GVQA 3I68A 1S5TA 2G4JA 1QNOA 3CHFA 3QBUA 4WK9A 1XLBA 4UTLA 5IDZA 3G0XA 1B3WA 3H21A 2OU4A 2FZDA 4UFLA 3QSTA 1Q65A 4O57A 3VGHA 1RH9A 1QPKA 1I6NA 3NVTA 1SFSA 5D9MA 1AQFA 5A8NA 3VCCA 4I7UA 1FHVA 4G7FA 4QSFA 4OKDA 2WNNA 1ZPTA 3AALA 1JULA 3HBLA 4JGDA 3R4IA 4LC6A 1FRBA 4DJFA 1V6XA 3M5VA 1ZUAX 3Q67A 3PHAA 3GH5A 1SJAA 1P0BA 2VQTA 4AQLA 4KCWA 4GVIA 1WKFA 3B9DA 3DHFA 4C5YA 2XH4A 3HZ3A 3QY7A 1NSJA 3FJNA 3HIJA 3EA3A 2JE8A 3QOKA 3THUA 1ESWA 1VZWA 3NZ1A 4AHQA 2YGYA 3CLWA 1BPLB 2E68A 1P0EA 3IVTA 1Q6OA 5IHRA 1G4EA 1RLCL 4ZTXA 3PBUA 3QHMA 1BXCA 3DERA 3SY5A 4IXHA 2QNEA 3RUBL 4FLQA 4H9UA 5CPMA 4DVOA 1HKKA 3PPCA 1MMFA 1JJKA 4PCTA 3W7IA 1T41A 3MP4A 1EGZA 1QW8A 5FJRA 2OLHA 1W9UA 2CLEA 1BF2A 1L6FA 3SRDA 4FLRA 2XIOA 4H04A 2CHOA 1EUNA 5AVNA 1E0UA 1D7FA 3TONA 2FMNA 5I3DA 2WVVA 3CWHA 1GVEA 3LOTA 3NIYA 3QKZA 4BI5A 1OHLA 1F4HA 2W61A 3KS5A 2WZTA 1WKDA 4HK6A 5CC3A 1QU4A 4AD3A 1Y5XA 4W8BA 4MB3A 4LX4A 4NSBA 3VPLA 1JEZA 4GNKB 2WZEA 4J5NA 3HMJG 2WZIA 5MKGA 2OSXA 1RQBA 3O6AA 3T6CA 4IG2A 5GNYA 4H41A 4M56A 4GWEA 1Q6CA 3S6TA 3VIGA 2XHYA 5DMMA 3HOJA 4J28A 3WLKX 3E2RA 3CPRA 3R12A 4D71A 3VDBA 4U2ZA 1R3QA 2FFCA 3LCGA 3NPUA 5LHFA 2CU0A 2VFGA 5DEZA 4CQBA 3FXGA 2QPSA 5DMLA 3F2BA 3UNTA 1H1ZA 1P6WA 5CJNA 1TVLA 5C7HA 2IKJA 4LH8A 2PD5A 1UA7A 4QCFA 4ZL1A 5I03A 2V69A 2VFEA 1JGIA 2Z25A 5SWUA 3CLMA 3ZJKA 2VRJA 6ENLA 4NNAA 2AMGA 3UCCA 1H1NA 3IRSA 1DQXA 2GJRA 3WK3A 3WQFA 3BCFA 1PUDA 1PYFA 1H7RA 4DWSC 5I78A 1GHRA 3U57A 1SO4A 2Z2BA 4WKHA 1BAGA 1E71M 3L0GA 4EANA 2C1HA 3UETA 2O9OA 3ZVIA 3UXAA 1XKYA 2OQYA 1KC7A 3PFMA 5L6UA 4D2JA 2J7EA 3A13A 3TZNA 1JPIA 2GUUA 3BAYA 2CZ5A 3NSXA 4MKNA 5D8WA 4OBRA 4GH3A 3QYSA 1PIIA 2B4GA 1TPWA 2V5JA 3BTNA 2QV4A 4TX6A 5KMYA 3ZS4A 3AS0A 2RH9A 4AZ6A 2P53A 3QPEA 4ZB2A 3O6CA 4OJYA 3SCSA 1KM5A 3NJ3A 2J79A 3WZ0E 4AYSA 2ZWYA 4YTRA 1GKQA 3E6EA 2ZOXA 1S2WA 3HPAA 4XB3A 1VGAA 4WSKA 2OODA 4NXKA 3GIQA 2VENA 1HL2A 1PVNA 1MW1A 3A3WA 5A6LA 3GYEA 4B2DA 1DXEA 4Y96A 2FPTA 4QROA 1DJYA 3HJEA 3WDIA 3GG8A 3H26A 2WHMA 2XPKA 2NQLA 2Z24A 3WQOA 2XN0A 2IPGA 3NNTA 1SFTA 5JIPA 2PDXA 2ZZ5A 2GGGA 3CYJA 5KSWA 2P8BA 4L4OA 1R0MA 2V3EA 4DWSA 3TTYA 2IW0A 2QAFA 3BPWA 1YMYA 5KZEA 4AWTA 4JNYA 2OWCA 1UR8A 3N2MA 4NX5A 1H7WA 2WAGA 3ZLFA 3VIFA 1OD0A 4JHOA 4NZFA 4AZHA 5E93A 1HG3A 4UC5A 4INFA 3L67A 3RO6A 3VC5A 4ICNA 4DWDA 3NZGA 3OZPA 2HISA 4UXDA 4YLWA 2P10A 2E40A 3TTSA 1ZU8A 1RXOB 2XN2A 3F1QA 3BLKA 1E6ZA 1F61A 1R5YA 2VTFA 2HPMA 2YDAA 3PNZA 1QOQA 4LAUA 1LT8A 2D24A 2DUAA 3IPWA 2OGYA 5F2IA 1XGZA 3VKDA 4H01A 4J2PA 1IWAA 3B0UX 4UTWC 1R30A 2ZDRA 2R9RA 4QQUA 4PUJA 4KW2A 4L9YA 3KP0A 1AW1A 1TFVA 2NXIA 3HV9A 4LY8A 2J75A 1CDGA 4IFKA 1JUBA 4LCQA 1EOMA 2QHAA 2R94A 3WSUA 1XYZA 4XBKA 3EWXA 3HQ1A 3U48A 1V5XA 3L2LA 4FS9A 3NQMA 4XUGA 1XLKA 4M0XA 2FGLA 5JBEA 2QPXA 3GDRA 4LEQA 1BGAA 4I9AA 2YCIX 3AU2A 4KPLA 4J3XA 3OGRA 2DW7A 4JTDA 4N7QA 1JYWA 5EYWA 1OCBA 4QEEA 4AZCA 1JUEA 2ZZ1A 2E1DA 3OVGA 2CWXA 1IWPA 3UERA 3RHGA 1F74A 3RAOA 4MB4A 1OYAA 3FA5A 2PDKA 4EXAA 1BTMA 2NQZA 4K8HA 4GBUA 5T91A 1O60A 4WF7A 4FMVA 4D8ZA 4NRSA 2PDUA 4WY0A 4AZIA 1WE5A 5HNUA 4A3UA 4JEQA 4LV4A 1I9CB 1PS9A 4DYKA 1SO3A 5AZ0A 4DO4A 1GT8A 4GXPA 3GU9A 5GNZA 3RM8A 3WKZA 3MC5A 4RE4A 1J0KA 3EPMA 1XV8A 2OX4A 1BWVA 3DG6A 4XKMA 2EKCA 4UTKA 4GXWA 1DPMA 1X6LA 4BEQA 2WW5A 5A6SA 1PDYA 2WCGA 3F5KA 2TAAA 2GVJA 3R89A 1XH0A 3LHYA 4ACZB 4UR9A 4HHLA 1IEIA 3RLUA 3WQ6A 3MW7A 2UY3A 3ES7A 3UU0A 4JHMA 5I09A 1GYLA 1H41A 2WC3A 3QV9A 2CESA 1BQCA 4Z0SA 3CK5A 4MVAA 1YPFA 3RN6A 5FJPA 2EPNA 3IJDA 2XDFA 4IWWA 3ITXA 1B90A 1ZJIA 1KBLA 3GE7A 2Z7GA 4P7LA 1DIOA 1EP2A 4ONVA 4PBEA 4RPQA 1KKRA 2ATSA 2BVDA 2W5FA 3W1TA 3UPMA 4N2YA 3DHPA 3WUGA 4J9JA 4KH2A 4DAFA 2DZWA 3PJUA 4HU8A 1XRVA 4XZLX 3I3BA 4PE8A 2A3CA 3N2XA 3CUIA 3BGGA 3XIMA 4ATLA 5LIWX 1NQ6A 1AW5A 1TQXA 1XJBA 5M3WA 1C29A 4KEUA 1JRCA 7REQB 1BG4A 4Z0JA 4JTCA 4AEEA 4TIMA 1RCQA 2D20A 2QUVA 3ZT5A 1DEDA 3NGFA 5I06A 3WMSA 2RAGA 3L4ZA 4GQ0A 3A5VA 5I5RA 5HWMA 3KDNA 2XGBA 4NAFB 5AC4A 1FBAA 2ZX7A 2PDWA 3A4JA 1IR2A 4XAGA 5HA7A 5AB3A 4S3CA 3MQTA 3BV7A 4A29A 3LU2A 4IIFA 3Q94A 4AZ5A 3OLEA 1US3A 3TXZA 3GY1A 4Z42C 4KBXA 2F61A 3LA4A 2YJQA 4YVXA 4UFKA 2Y8UA 3ABZA 2QGYA 4P8XA 2YLAA 2XUCA 1LZOA 4Q4OA 4ES4A 1DJHA 1GOQA 2Y70A 4JN7A 1WDSA 3BC9A 3EKGA 3RU8X 3QY8A 1F73A 3NAVA 1KR1A 3L2MA 2HSAA 3SAZA 4FNRA 3P5YA 4ZBCA 3R7MA 5DQPA 2I5GA 3RR1A 4ZTYA 3IGUA 1XG3A 1HP4A 2UY4A 1CTNA 3VE9A 1XLHA 3MJYA 4JCLA 3L5LA 3PP7A 2G3JA 5EMLA 4JQ4A 4NZCA 4O19A 4EPBC 1FCVA 3NG3A 2J7HA 5D04C 4B5UA 4JNMA 1B3VA 5K3VA 3A3HA 4O54A 4CN1A 4MWAC 3KBVA 1S46A 3QQ1A 3G8EA 1OG0A 4A22A 2C0HA 2VEKA 4UQAA 3GVQA 2V2DA 2X09A 1GW9A 2XSXA 4LUSA 2HQAA 1XBVA 1KLYA 1QCWA 3BGJA 7ODCA 1KXQA 1KR0A 3O16A 5DF0A 1E9LA 3I7QA 3M1ZA 4KERA 2VYOA 4LCRA 3OGSA 2PZ0A 4GX9A 5A6BD 3NEHA 5LXEA 3DFQA 4HTYA 2V5DA 4JTGA 1CGYA 3BOLA 3GKFA 1EJUC 3E2QA 3VIOA 6TAAA 2D22A 2BXVA 4LALA 2FVMA 1J79A 5EMKA 4CD7A 3RNDA 1K8CA 1PO9A 2J25A 4AZBA 1G67A 2WSYA 2Y63A 3PG8A 1B3XA 3QMRA 1X7FA 1E6RA 3KWXA 3IJIA 1G6CA 2RDUA 5AOUA 4XTIA 3UZ5A 1EJXC 1KM6A 4JTEA 3PFRA 2QJIA 3M0MA 4HB7A 4L6DA 2PDGA 1D9EA 1IIHA 2FGZA 1GJWA 4FNUA 3A23A 6XIMA 3N14A 4CNTA 1UP2A 4G1NA 3CV1A 3D3FA 1DHKA 1HW6A 3W2NA 3WK2A 1WXJA 3NQAA 4XG1A 2DZBA 4QDWA 5XINA 2OO6A 3VD4A 3GFZA 5CH9A 4EPDC 4LAKA 4GK8A 5LKYA 3S9IA 5I3GA 3SCOA 5A69A 1PBGA 5BMWA 3ZWTA 3U4FA 3UZJA 2XM1A 3FSTA 1JDEA 2A3EA 1XGEA 4HJWA 1A5KC 3W1XA 1CXHA 1TJRA 1QI3A 3DH7A 1SFJA 1FKWA 3K46A 2WPBA 1E51A 4QXIA 2WMKA 2C91A 2BASA 4X2RA 3P8JA 3GX9A 3CWNA 1WZAA 2DZPA 3CJPA 1G9HA 5F1VA 5D09A 1LL4A 1YBQB 2Z2UA 2DORA 1W1IE 2JBMA 3TYUA 1LWIA 1R7OA 1F4AA 3WD4A 4M24A 3GFXA 2D69A 3N3MA 2BFGA 1ADSA 3BSGA 3LSCA 1BSIA 4ML9A 2PTYA 3O9NA 1FHLA 4QCEA 2X7VA 2G3IA 3DC0A 1QPQA 5D2VA 3W86A 3CH9A 3UJEA 4KRUA 1OFEA 1XRSA 4AZGA 4IQEA 4PCSA 5LA2A 2INFA 1YDNA 4PB3A 1W2VA 3CH0A 1UOKA 3KTXA 1UD5A 1AL8A 3AIQA 1XUUA 3GTIA 1F3WA 1TPH1 3TMQA 3PUDA 4DRSA 1XRTA 4H8VA 4C60A 4QITA 1RVGA 1X1NA 2PC8A 1MQRA 4K6AA 4XQ6A 2Q09A 4K38A 1VPYA 1TWWA 4Q6XA 5DY3A 5LGZA 2JIWA 1Y8BA 5LYRA 4HQVA 1RD5A 1JZ5A 1B3ZA 1QHPA 3I6RA 3K8KA 4MZ1A 3CT7A 1NEYA 4GNVA 4AIOA 1KW1A 3EB4A 3ATYA 4XUYA 3T40A 2UBPC 5J04A 3LGDA 3EAUA 3MZNA 4W7WA 3NOYA 3MWCA 3WDRA 1P4CA 5L9FA 3NQCA 2QCEA 4UNKA 3LPPA 3PZNA 2OOGA 3K13A 5FF3A 4DB7A 1DXIA 1HO1A 2VX5A 1TREA 4IF2A 2QUTA 2UWFA 3AS2A 3O07A 1BYCA 1TPFA 4GI4A 3QTPA 3V0UA 2RJGA 4N42A 5I3KA 1WDDA 2YL8A 1QOXA 2YLLA 3K8LA 3P0WA 4WDWA 3Q2DA 3JZUA 4XVEA 3M64A 3F7JA 4P8UA 4LUTA 1EC9A 4L5ZA 2YB1A 3G1YA 2GSHA 2H3BA 1VC4A 3QLDA 1ONWA 4JTAA 5BRPA 4K8EA 3N2OA 1MFVA 1QK0A 1TR9A 3H53A 4F0SA 4RZ5A 1HKJA 2Z7KA 2Z1BA 4L4LA 2XISA 1DBTA 2C79A 3AISA 1E1EA 3TYEA 3MSDA 1LRTA 2VKZG 4PUUA 2ABBA 4QRNA 4J1OA 1SR9A 3M5YA 3NL2A 3L9CA 1BVWA 3S5YA 2WKJA 2X05A 1V51A 1QOPA 1VJZA 1UZ1A 3TFCA 1N7KA 3MKKA 1DWHM 3VGEA 4JYEA 3DFHA 1REQB 3GDLA 3WNKA 3TIMA 2AQVA 1JYXA 1AK5A 1FP9A 1MZHA 2O9PA 3LCFA 3ZR6A 2ZDSA 1FWGC 1GJUA 2AKMA 1DORA 3T55A 4Q8OA 3WL0A 1RZMA 2DW6A 3NQFA 1UROA 3VOJA 2X2GA 2A3AA 3T08A 3BQ6A 3W9ZA 4JICA 4V1XA 5U4NA 5BZAA 1XR2A 2V5KA 3RCYA 3GC4A 2DZTA 2O9RA 3N29A 3SJ3A 3SBFA 3UG5A 3WEZA 5E1QA 3HPSA 4BF7A 3SADA 1HGWA 1JF5A 3CMGA 5A6AA 2WMGA 4HZ6A 3BSHA 3HJZA 2PDHA 1W91A 5C71A 1FH7A 1KFBA 1AL7A 2ZUTA 3WF4A 1Q3NA 3LV5A 4RW3A 4HNOA 3OHIA 4E2OA 1UWRA 3PWIA 1N2VA 2WC4A 1UCWA 4OECA 3V5FA 3VOHA 3RLGA 4GYKA 3MI2A 3H4GA 3NXFA 1AZ2A 5F2MA 5FJJA 3FDGA 4LF2A 4MMWA 3H7RA 2C15A 4OE7A 1A5OC 4DF1A 2OQHA 2O92A 2P0OA 4W9TA 4HBKA 2V30A 4RZ6A 3BDKA 3ZVHB 4K68A 3ITYA 2VZVA 4ATDA 2BX7A 2ZA1A 3W2JA 3MSRA 2VRKA 3NSMA 1XFCA 5I3IA 3B8WA 4GOAA 1W9BM 5HMDA 4EK7A 1VFMA 1I2RA 2PSNA 2O4QA 4PCPA 1RCOB 5D4YA 4DLMA 3GZAA 1XDLA 3PJTA 3UWYA 5FSEC 2QMKA 3RM4A 1H0IA 4ZOBA 2YXOA 3G8RA 5AZ1A 5A2AA 1VRDA 1PZ1A 2XH2A 1NDYA 2I5IA 4J35A 5TBOA 2VD8A 2R1NA 4WR3A 3UJFA 3V36A 3W74A 3PK7A 1SJDA 3N12A 4GRSA 4W88A 3DC8A 4GFIA 2JEPA 4S3BA 2XU2A 5A8PA 1JZ4A 3NDYA 1JG9A 4GJ1A 4KFOA 4A3QA 1S1RA 1OBAA 4DBEA 3A22A 1VCFA 4HYVA 4AC1X 4DXVA 3DFOA 2QUUA 1KV8A 2C71A 4DI9A 4OUIA 4GBDA 4GA8A 2W92A 3FYYA 1YPXA 5CBJA 1UPPA 3F4VA 1K9DA 1GQJA 1QATA 4Y2WA 4HOXA 3LTSA 2Q02A 2I17A 4YIWA 3STGA 4NG3A 4ECLA 3EOOA 4G6CA 4R85A 5JBDA 2X41A 3FAWA 3P81A 4BJHA 3C2VA 1MWOA 3LZ3A 3FW6A 4B2DD 1H62A 3N9KA 3FHAA 1V03A 4CQAA 3TE9A 1SSDA 3TJLA 5CJMA 2PDBA 4UCFA 3G18A 4WGXA 3WF1A 2PWUA 2PCQA 4GMEA 1DWJM 1EA9C 1GVRA 4HP5A 1TPDA 2QCMA 1AJ0A 3U3HA 3MHUA 3WLNA 4LYRA 1MNZA 1PWMA 2R14A 4HSHA 1UIPA 3I3DA 4H00A 4BWLC 5GNXA 1A4LA 2BBFA 2DY3A 1A53A 3MUCA 3NSNA 4RE3A 3NCOA 1XHGA 3PZTA 1IEVA 3A9IA 4MZYA 5AHNA 3PPHA 1WKEA 3I65A 2J88A 2PDIA 3VOCA 3TYBA 3RRAA 1KBJA 2HE8A 1OM0A 1W5MA 2E6DA 4PMVA 3SN1A 3AMKA 3S9ZA 3M44A 1TZ7A 5M17A 5J5RA 4ATWA 1GOMA 1OSEA 4PZVA 1AD1A 3OZOA 4F3HA 2BGNE 4AMCA 1AMYA 1W5NA 1SZRA 3S6OA 5FKYA 3I4EA 1EA0A 5DLCA 1X1ZA 4FLOA 5I79A 3M6DA 1H50A 1RY8A 2NQ5A 6REQB 5H8PA 1TTPA 3SURA 4YJ5A 4DNHA 1Z32X 3BLLA 3QPYA 1KFWA 2WJZA 1RBLA 3UXLA 2AL2A 3WEMA 4LXFA 3E02A 1NF0A 3SN4A 4AZ7A 3W2LA 4UQ9A 3GIYA 2HNEA 3TR2A 1O6IA 1X38A 3RX2A 2OEKA 2PS2A 1A47A 1DJQA 1SYTA 1E70M 3BV4A 3QZAA 3UBPC 1CIUA 1QI0A 4GC4A 1AVAA 1EBHA 4ZZ9A 3RITA 3BW2A 1EO5A 2VFHA 1Y5VA 3PULA 5JXQA 2E67A 3G1SA 4DHGA 3WQWA 4B5WA 2EPMX 1OF8A 2YR1A 1CXKA 4LUIA 3ZFHA 1CXLA 3CL7A 3GNXA 3TTEA 3COTA 4L1WA 4LBUA 4MZ8A 1JAEA 2J62A 5LXXA 3VXGA 1F7BA 3VKAA 4DUVA 1G94A 2OPJA 3TYCA 3W1AA 4IJBA 2GWGA 1UR2A 4C7FA 4DUWA 3LBOA 1CGXA 4NASA 4ERIA 4A4AA 3VTRA 3ARTA 5C2GA 5G2IA 4FXSA 3S0CA 3W07A 2OZ8A 3NQ6A 4AH7A 1ALDA 4GYPA 3C0SA 1ZLPA 3UWUA 1O5QA 3EWYA 5HR7A 5KEZA 4HN4A 1J8VA 1W0MA 3O3RA 2NW0A 1PKYA 4AWEA 3URBA 3AYSA 2GQAA 1E6XM 4MAZA 4H1ZA 5AYBA 3D3AA 3LSBA 2VEGA 4MJMA 3VFCA 3CUFA 3UY7A 3E9AA 1FKXA 3QTGA 4QLLA 5DBTA 4PL2A 1DJGA 1MEHA 3LPFA 4E8GA 2VC5A 1M53A 3K4DA 2DSWA 3GD6A 3L4WA 4LUJA 3WMBA 4F0LA 1OGSA 1VIZA 4JTLA 4MLJA 1XI3A 2D0HA 3UD6A 1JZ3A 4JKKA 3IAQA 1FWNA 2WOQA 1QTWA 2V5LA 4US6A 3W22A 2Y5EA 4C6MA 4CQ8A 4H6KA 4DJDA 4P7QA 3T0TA 3M0JA 4FAMA 4C6JA 3U8GA 4HU0A 4YCOA 2C13A 4UOZA 2PE4A 1VBJA 5BU6A 3P60A 4H19A 4KWSA 1POKA 5CZJA 4YYCA 4C6CA 3A6OA 3QF0A 3B8TA 2H90A 4IPIA 1AQHA 4MWAE 1RQHA 3QQWA 4CCCA 3NQ7A 1XH1A 3NQBA 3WJXA 2XINA 4E38A 1QMLA 2F8QA 2RDXA 3KM8A 4GPNA 3WNMA 3VNIA 1WZLA 2DZAA 3THDA 4S3AA 2V81A 3ITLA 2NWRA 4JL1A 4MNMA 3OGVA 4AIBA 1SJCA 4PUWA 1EXPA 4U10A 3PBVA 1F2JA 3R8GA 2NLYA 3NQVA 4QDMA 5D8ZA 1CEOA 3A9BA 5CBIA 1V4YA 3ANYA 1KQYA 3AXMA 5EB8A 4UTJA 2Q01A 1UWTA 2G3FA 2VCAA 3W4RA 2XTKA 2XSAA 3MYOA 1F5ZA 5A5WA 4RZ4A 3V18A 4D8LA 4M81A 4ZQMA 1XGDA 1XLAA 2O0TA 2CIPA 4QE4A 1F6YA 2Y4SA 5FSDC 3B9NA 1NWSA 4MOZA 2XFRA 2DT3A 2J7CA 4HNVA 1E5JA 2R8WA 2WSQA 2AL2B 1B30A 2VD9A 1SO6A 3W76A 1Q6QA 4NXSA 3PZGA 4IQJA 2ZZ4A 1XG4A 2V82A 3JZEA 3IIOA 4UQBA 4HOWA 3CHEA 1GK8A 3NR0A 4QR6A 3QEZA 3DG7A 3VMPA 2EAWA 2VZUA 4WUIA 4Y8EA 3GAYA 4FOJA 4FF7A 4ZOAA 1L0PA 2Y8VA 2ZICA 3QM3A 4KCTA 4MDOA 2V2HA 4W8AA 4U33A 1UOZA 3OG3A 7ENLA 1IXOA 3VKCA 3ARZA 5LIYX 3AI0A 3W6MA 2C6QA 3W26A 3WQVA 4HMEA 1L8NA 1UB3A 3R11A 2DT2A 1E40A 1TCMA 3XISA 2VL4A 4L1XA 4LW7A 4ZOCA 3KBWA 3G3DA 4CQ9A 4IGMA 1GONA 1I2NA 7XIMA 1CBGA 1OX4A 1UP0A 4YWIA 4P8WA 3S1XA 3M6YA 5TIMA 1XISA 3W3OA 1ZAJA 3LLFA 4JHZA 1OFOA 2J7BA 1XS2A 4H2HA 4RX0A 2G97A 3R5EA 3VKBA 3W02A 4A8IA 3HGJA 3VAVA 4MB5A 5A1AA 5CEWA 1UIOA 1M3UA 4LAZA 3VZZA 3ZJ7A 4OBSA 3UGRA 5C55A 3OA5A 4H6EA 5C2CA 3KHDA 4S39A 5EA9A 4C6NA 4BF5A 4D6CA 4NI8A 1U5JA 3N4FA 4LT9A 3WY1A 3DKJA 2WQPA 2VDHA 4IT1A 2D23A 1O12A 4O1EA 4KGJA 3D47A 3GTHA 3W85A 3PB0A 1R47A 1FWRA 3C2EA 4UOQA 2IMRA 4AUBA 2W63A 1LG1A 1FY6A 3VM5A 5CJ5A 3QJAA 4E4FA 4PC8A 4B3LA 1VFOA 2C3ZA 1XC6A 3GDTA 1EP3A 1W1TA 1S38A 4EE9A 2GJXB 1X39A 2DH3A 1W3HA 1W31A 3QR3A 4GH1A 1WPCA 2D73A 1REQA 2L5HA 4KWVA 2SFPA 3ALGA 1P7TB 3M41A 1M9HA 3GHRA 5REQA 4ALDA 4U2YA 4WD0A 2Q3OA 4YS1A 4QGCA 3FX4A 5HDRA 1WBJA 1M7PA 1OFQA 1KXVA 1S5VA 4C7GA 2POZA 2CW6A 3VOGA 4N9EA 4OQVA 4Z1BA 3PANA 3GQYA 5D9NA 1OK4A 4LAMA 2ZX9A 1PSCA 3WUBA 2NT1A 1GPFA 1I4NA 3IUIA 3EDJA 3GG1A 1CXEA 1JPHA 2R1KA 1EC8A 2VR2A 4FO4A 4FIRA 3AZSA 1R86A 1ME8A 4D6IA 2OG9A 2V6AA 1VB9A 3MB9A 2PP3A 3SCRA 1E43A 3DZ1A 4JQ3A 4DUOA 2TSYA 3FA3A 4UB9A 1C93A 1ICSA 4B3ZA 1WBHA 3MSGA 1KXHA 3GG7A 4CLMA 3WNOA 1PTGA 3HPFA 3CQJA 2Z6IA 3GW3A 4CNSA 1Q6GA 3R10A 4LQ1A 4DUXA 5LZLA 4W5UA 3TYAA 4ZFCA 3E1F1 4IIGA 4OHQA 3W2UA 1OGBA 3VGGA 5AHMA 1YYAA 3S5ZA 2J74A 3BOXA 1GYMA 1L6GA 3LZ5A 1TQJA 4IOTA 2GGIA 5AC6A 4JIRA 1KM4A 3ARRA 3WLPA 4UOJA 3E96A 4DXKA 1Q6RA 1UR1A 1J0HA 1CGTA 5HK4A 4AY7A 4CEXC 4UFMA 5FF4A 4O0ZA 1LOLA 4FALA 3LXAA 1GGOA 2ZC1A 4JX5A 3FNDA 3ZXWA 1HIZA 1W32A 1W17A 3SI9A 2FTYA 3Q58A 1QO2A 4AY8A 1WYIA 2NVDA 4AYGA 3OA3A 1FWHC 4F79A 1EXBA 3LPGA 3EMQA 2OT0A 3LI1A 4TMBA 5DRCA 3PZOA 3MI3A 1Z42A 2V63A 3PPGA 4L6OA 1W9DM 1V0MA 1NFBA 4EPKA 1F3TA 3NVDA 1TV7A 4YVVA 4G8TA 2PODA 4MF4A 3GO2A 4PR4A 4MDPA 4AB4A 4TTGA 3SCTA 4QS6A 3DGBA 1HN1A 5A6MA 2I5QA 4YHEA 2ZUWA 2V2CA 2W27A 2D3LA 4DLFA 3G3MA 2GGJA 1RLDA 4JFWA 1W37A 3OODA 3TQ0A 4ML4A 5GJPA 4PMUA 3S46A 3FYPA 3H4XA 3N11A 1MXSA 1UKPA 4BI7A 4M1RA 1K4HA 2EPHA 2XGZA 3BO9A 1W3KA 4GY7A 5DRIA 4CNPA 4C90A 2B7QA 3T9PA 2A3HA 1KRCC 2A1YA 1LRNA 4J7RA 4CCEA 2WKGA 1ZB5A 1M68A 1LQAA 2WJFA 5FF2A 1Q6EA 3OU8A 4GQGA 1R8LA 2AQWA 4NIRA 3E3HA 2OKTA 3RIKA 3GNOA 4HMCA 1MI3A 4YWSA 1MUCA 3I7SA 5M1TA 4S1FA 1X8CA 1FUYA 3T1GA 1TPC1 3WD2A 4PTXA 3W25A 2IXVA 4PTVA 1QPRA 2VUYA 4GGBA 4LYKA 3VIMA 4US5A 4I90A 4RDYA 3W81A 3R79A 4QLKA 3NYDA 1JZ8A 5HQEA 3VGDA 2ZIDA 1EIXA 1T96A 3UYCA 1K7XA 3OIHA 1NFGA 1U33A 1HQTA 1C9DA 3U2EA 4M6VA 2QDEA 5AC8A 4DJFC 5KZ6A 3H2EA 4JX6A 4K1WA 5F2LA 1K6AA 3KVKA 3TN6A 4PMRA 2ZZ3A 1XLCA 3MTWA 4OTKA 3DFSA 5ENLA 2H9AA 3NL6A 5CZTA 3FCPA 3B06A 1JDDA 2ZUMA 4O17A 3S6DA 2IQDA 4WKFA 5I3JA 3RCNA 4XD6A 2WMIB 2AOSA 5T8GA 4AXNA 3QYQA 4JY8A 2GVYA 1O5XA 1MFUA 4PRTA 1KFKA 2DT0A 2KX9A 1JNEA 1P1XA 5I23A 3HF3A 3VDHA 3KDOA 3GXPA 3MJMA 3C8NA 2DIEA 4RZBA 3NOEA 1W9XA 6PTDA 4AC7C 3GUGA 1TJ2A 4N4PA 1BEUA 1KM2A 3SRKA 4Z08A 2WHLA 1KNWA 1ISXA 1N8IA 1TMHA 3VFLA 2J9YA 1JPDX 3IGHX 3GDBA 4GUFA 2YCLB 3KBNA 1V0LA 5LA1A 2BXYA 2Y8KA 1J6PA 1YBQA 1XQLA 4OUEA 4W4QA 1R9XA 5BRBA 4PH6A 4FOKA 1W5QA 5IBXA 3E0LA 2VDIA 4PCNA 1OQFA 4LTSA 4K36A 1IT0A 5DCEA 4AD1A 1EZ2A 2QMJA 1W1VA 4TVCA 3NURA 4IGNA 1WAWA 4JQAA 3GB6A 1OCJA 1SJBA 5E09A 4B5NA 4HHMA 4K3ZA 4G9PA 4DN1A 4MWAD 2X40A 3PTDA 2UV8G 1NJJA 2PZNA 1AMKA 3OQ8A 1GEHA 3P3BA 4PN2A 3LY0A 1XBXA 1E9ZB 3O7UA 1WXZA 2QVHA 5EMMA 1UWSA 3I10A 1TCDA 4NAEB 4Q4PA 4CQCA 4PTWA 1A0EA 2WZMA 2E3ZA 2ZUSA 4A3HA 2OJPA 3OVRA 5C9UA 2P3ZA 1EJ7L 3T78A 2GGEA 1HTIA 1ICQA 1PPIA 1QPNA 2PF8A 3EX3A 3LS9A 4PFHA 4RW5A 4R27A 2VCCA 3JR2A 3UYIA 3HA1A 2OCZA 1HL9A 4CVUA 4AXKA 3S2NA 1F9CA 5JH1A 2Z6JA 5CGQA 1H0GA 3P6LA 2FH6A 3FY1A 1JQVA 2Y7GA 1W5OA 2GOKA 4UTMA 2CXEA 2DUXA 3REQA 3BICA 4IMGA 3PAOA 3VMNA 4U31A 2QJJA 1OC6A 2R6OA 1FH8A 2FB2A 3OHMB 4PBGA 5CPSA 2VXNA 3UR2A 2A7PA 4O10A 1H7OA 1PIGA 1R2SA 2DZVA 3KRZA 4CEUC 1TPUA 2DVTA 5AC7A 1FDZA 1X7IA 3EDFA 3U2CA 3TW9A 3W6YA 5LA0A 4FXRA 2EXOA 1DL3A 1DE6A 2ZZ2A 2QYGA 2W3ZA 2WSKA 3FSUA 4JIEA 9RUBA 2WPGA 4KEZA 1E1FA 1P7TA 4K8GA 1R85A 1Q13A 3TWAA 3GNNA 1SVDA 2OR2A 1IZKA 5IOBA 3VZYA 2WLYA 4KFPA 4I5RA 1XF0A 5HXMA 1NU5A 3V1PA 1M01A 3C0LA 4DAIA 4FX8A 4JIPA 3CV6A 4WEVX 1R3RA 3W53A 3HFYA 1SMDA 1GZ1A 4LVDA 1EHAA 1VLIA 2VOTA 3PAJA 1F6KA 2ACUA 2UY2A 5I00A 2GYIA 3UG4A 3EOEA 4QSHA 3LENA 1UD3A 3MP5A 3OTRA 3WD1A 1ZBKA 1S2AA 2YSWA 3K30A 2FZBA 3R2GA 4KGLA 4R88A 3G1FA 3IJ7A 3RF9A 3WH5A 1NDWA 3FVDA 4JX4A 1ECEA 1MXGA 3S42A 4S3DA 2FZ9A 5IFTA 1R6WA 4ZO9A 4LAOA 6ALDA 3BUVA 2WMHA 1MSSA 3VMOA 4JKLA 2YYTA 1EP1A 2X1IA 4L9ZA 3WYZA 4F0MA 2VZOA 1OZQA 2YYUA 3M0LA 1UD2A 4IIHA 2CLFA 3H2CA 1C3FA 3EXRA 3N1AA 4LRSA 4X63A 4Z2LA 1V93A 1ZCOA 3KBMA 1ZAIA 2W79A 4PYSA 4NQ1A 2QCLA 4GGHA 4JTTA 1IWBA 3BLOA 3KRSA 3L5AA 2BTMA 4G1KA 2VELA 4WJ8A 3FJ4A 4I8YA 1TA3A 3PBMA 3LBCA 4IISA 4MJ2A 2E6YA 1XSIA 4JFUA 1IZCA 5AHFA 4GE8A 5H8MA 4R33A 1RBAA 2Y24A 2QGHA 1C8YA 3KW3A 1ECQA 3LX9A 3SO7A 3VO0A 1M41A 2G96A 3NO5A 2QV5A 3QZEA 2WZHA 3W29A 2Y2WA 4O1DA 1S3TC 2UY5A 1P48A 1I2QA 3L21A 3TSBA 3HN3A 3FXYA 2ISFA 4FZIA 3FOKA 5LNWA 1M7OA 4M6QA 1ML1A 1EF2A 4DM2A 4KCVA 3OZMA 1WAUA 1F8IA 3B8SA 3AHVA 2OT1A 2WXDM 1K6WA 1LOQA 1ONRA 2Z1KA 1X8FA 3N6HA 4M7SA 4D6DA 5BOEA 3CV7A 4OU1A 1V77A 1ITQA 2VGFA 2ZA2A 4HSNA 3WDQA 4PEKA 1LOSA 1DV7A 3LCWA 5XIMA 3AUJA 4PUKA 4HPJA 5TQLA 1AG1O 4GCAA 3IUDA 1Q6FA 5HWJA 4PEEA 4KEMA 4TX9A 3AFBA 4Y90A 1AJ2A 3RO8A 2ZE3A 4DO7A 2B7OA 2VZSA 5LGXA 1NTHA 1FHDA 3QV7A 4V2XA 2P1FA 1AW2A 1U5HA 1EF3A 1VYSX 4ICMA 2NT0A 1J0JA 4C7DA 1TV2A 1FH9A 1C91A 3BAXA 1C8XA 3FFSA 4Q8WA 2AGKA 1V7YA 2R24A 3APGA 3LRMA 5JMUA 1M1BA 5C9ZA 4MSSA 2PF0A 4F4RA 5CSRA 1NY1A 2OWWA 3O2LA 2OLSA 1YE4A 3IRDA 4Z1YA 1QWKA 5CPQA 2ZZ6A 1WP6A 2C8NA 4Q8VA 4KMQA 2W4XA 3AXIA 2HBVA 3BMVA 3WH8A 1OY0A 1P0DA 3WQ8A 4M3PA 2ZVRA 1C92A 1F6PA 1QUMA 1UR3M 1V02E 4J3ZA 3TAOA 4K2SA 4L7ZA 4UTWA 4HCLA 3WL1A 4PMYA 4FHAA 1QW7A 1HJUA 1R2RA 4XAFA 4BCEA 4RLIA 2WVUA 4FOUA 4HZMA 3DI0A 1DQWA 4A8NA 2NQ9A 1TE1A 2MANA 2ISSA 2OYLA 3ECQA 1QWGA 4G5DA 3N19B 1BYDA 2Z4GA 4L1GA 4PMDA 3MO4A 1UR0A 5HJLA 1U1UA 3MT1A 3N73A 4XKYB 5JH2A 3EWZA 1PCKA 2YCJA 2WBKA 5EL1A 1SGJA 4JOMA 3HG2A 5EGRA 3W73A 3SUUA 3F4DA 2Y7EA 5EY5A 3NPVA 5HPOA 2GDVA 4M80A 2VX6A 2E77A 1OG6A 4LYPA 4KQNA 3C4UA 1JIBA 1E4IA 5E9AA 2VX7A 1ZRQA 1I0BA 4NJKA 4EX4A 1DJWA 1IEXA 3BLEA 2QCCA 3W7MA 3DXIA 5CG7A 1V3MA 3QXBA 4M1BA 4RE0A 4ZGYA 2PU1A 2Q8LA 1P0KA 2ZE0A 4MGGA 3TQKA 1ENUA 2ZRXA 1FCBA 2C0AA 1V02A 4XZNX 3EOSA 4LJ3A 4AVOA 3B0VC 3EDKA 5G5IA 1XIJA 2ZX6A 3E74A 2GFTA 3WJSA 1E4NA 4HTBA 2PDJA 3AIWA 1QFEA 2Y5JA 3BE7A 1UYQA 1VS1A 3W82A 1UD4A 2BHUA 2CZVA 3C0JA 3OW1A 4NT0A 2JKAA 1XLJA 1V6UA 5C8BB 4N6FA 4MM1A 3LMZA 4RNIA 1XSKA 5LIXX 3URAA 2XZ9A 1VLWA 1XLDA 2WMIA 1FTXA 4O1CA 1NWRA 1VEOA 4O1BA 1TX2A 4CVWA 2ZVIA 3LDVA 3C52A 1ZCCA 4XZ9A 3CUZA 1UR4A 2QEZA 1OT1A 4RJEA 1B3YA 2A85A 4GCXA 4WSHA 2XN1A 4E3VA 2E09A 3EPNA 3GNDA 4O13A 3CUHA 3IEBA 4QG9A