1EL3A

Human aldose reductase complexed with idd384 inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
b'MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title The structure of human aldose reductase bound to the inhibitor IDD384.
pubmed doi rcsb
total genus 105
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1el3A00
2PD9A 4JIHA 4WGHA 1YNPA 4RPQA 2HEJA 1S1RA 2ACSA 3LN3A 3C3UA 3T42A 2PDUA 2PDFA 4EXAA 4LB4A 4IJCA 3H4GA 3CAVA 5DANA 1EL3A 4Q7BA 4ASTA 3MC5A 2PDJA 2F38A 4YVVA 4GQ0A 4XZIA 2FZBA 3LZ5A 3LZ3A 4PR4A 3FX4A 1R38A 1C9WA 3WG6A 3UZYA 1RY0A 2HE5A 1Z89A 3UZZA 2INZA 4ICCX 1XF0A 3H7UA 3GHUA 1X97A 3CV6A 1X96A 4QBXA 2A79A 1YE4A 3ONCA 1RALA 4JQ4A 4WDWA 1PZ1A 2PDYA 3D3FA 2I16A 1ZUAX 4FZIA 1OG6A 4PRRA 3S3GA 2FZ9A 2DV0A 2PDNA 3G1RA 2FVLA 4JQ2A 5LIYX 2R24A 2BP1A 3R8HA 4GQGA 1ADSA 4HBKA 2NVCA 3BV7A 4IJRA 4LBRA 4XZMX 1PWMA 1S2AA 1EF3A 1AH0A 2FGBA 1FRBA 1AH3A 4JTDA 4FAMA 2CLPA 3UYIA 2PDKA 2F2KA 3FJNA 4LB3A 1VBJA 2FZDA 1US0A 1T40A 3ONBA 1SM9A 1Z3NA 3GHRA 2PEVA 3V36A 2I17A 4YS1A 3P2VA 1AZ1A 3VXGA 4H8NA 3UZXA 1MZRA 3RX3A 4EXBA 2PDBA 4JQ1A 4JTAA 3CMFA 1Z8AA 3LBOA 3COTA 2VDGA 4L1XA 3BCJA 4GCAA 1X98A 2PDXA 3NTYA 4NKCA 3V0SA 1UR3M 3WBWA 2IKHA 2J8TA 3GHSA 2PF8A 4DBSA 1MI3A 3H7RA 3WBYA 4XZLX 1XJBA 4WDTA 4XZHA 3CASA 3UGRA 4XAPA 1YE6A 3CAQA 1AFSA 1XGDA 4XZNX 2WZMA 1QRQA 5HA7A 2PDMA 3WCZA 4DBWA 4YVXA 4GACA 4JIRA 5LIUX 4JTRA 1S1PA 1EKOA 4XK2A 3QKZA 4PUUA 3RX2A 3UZWA 1PWLA 2FZ8A 4QX4A 2PDIA 3LQLA 3RX4A 2ISFA 1QWKA 2ACUA 2HV5A 3V35A 4JTQA 4F40A 1M9HA 3KRBA 3N2TA 4XO6A 2IQDA 2PDGA 3BURA 3M0IA 4Q3MA 1MRQA 2HDJA 3F7JA 4DZ5A 4XO7A 5M2FX 4PMJA 1YNQA 5LIXX 3Q67A 1AH4A 2INEA 3EAUA 2ACRA 4FA3A 3UWEA 2PDCA 2IPJA 4XVDA 1ZSXA 3DOPA 4OTKA 5JH2A 2IQ0A 4GIEA 4WEVX 4L1WA 1EXBA 1GVEA 1S2CA 2IPFA 4H7CA 4R9OA 4JIIX 2DUZA 4HMNA 2HVOA 1VP5A 3LQGA 3O0KA 1K8CA 3R6IA 3R58A 4MHBA 3UP8A 3V0TA 2ACQA 4QR6A 4LBSA 4G5DA 3DN5A 3N6QA 2WZTA 3G5EA 3UG8A 5JH1A 4WDUA 3UFYA 5C7HA 4I5XA 1Z9AA 3V0UA 3EB4A 4ZFCA 4QXIA 3R43A 3MB9A 5AZ1A 2PZNA 1LWIA 5LIWX 2P5NA 2IKJA 3O3RA 4DBUA 3R94A 4GA8A 3R8GA 4IGSA 4YU1A 1LQAA 2AGTA 3CV7A 1PYFA 4WRHA 4FALA 3LEPA 2C91A 1ZQ5A 2PD5A 2ALRA 4PRTA 4LAUA 5KETA 1T41A 3GUGA 4GABA 1HQTA 3Q65A 3BUVA 3GHTA 5HNTA 2PDHA 1IEIA 4JQ3A 3WBXA 3B3DA 3LENA 4XVEA 5AZ0A 4LAZA 2BGSA 4YVPA 4PUWA 2HVNA 2R9RA 2IKGA 3ERPA 2DUXA 1PZ0A 3R7MA 1ZGDA 1Q5MA 1IHIA 4AUBA 2IPWA 5LIKX 2IS7A 3M4HA 1Q13A 2IPGA 4JTCA 3LUTA 1HW6A 2HE8A 1J96A 2QXWA 4WDXA 5HNUA 3LD5A 1A80A 1AZ2A 2BGQA 2PFHA 2PDLA 4JQAA 1JEZA 2NVDA 2PDWA 2PDQA 2PDPA 3LNMA 3EB3A 3U2CA 2IKIA 3M64A 1RY8A
chains in the Genus database with same CATH superfamily
3FCPA 3KLLA 1EQPA 4DF2A 4B5VA 2E3ZA 3OZPA 2GOKA 4GO9A 4UTFA 3EKGA 4Z2GA 2GQAA 4FMVA 4IH3A 3U48A 2Y89A 3T8QA 3GD6A 3OGRA 5GJMA 4C6OA 4AW7A 3SIMA 5LSMA 3CO4A 4NI3A 4EXAA 3ARZA 4F66A 2V67A 3DIPA 4GUHA 3GXDA 3E6EA 3PAJA 5K9CA 2OJPA 2QCNA 3WLSA 2GPTA 2Y85A 4MWAB 1A49A 3NPWA 4FPSA 5CZKA 4KGJA 3BMWA 4BR1A 1ZJIA 2A3HA 5JUVA 3O2LA 4LY8A 1T5AA 5HAOA 3WNPA 3K8LA 4MNMA 1C90A 4ZTXA 2YCEA 4AXNA 1RY0A 5KZMA 5BMWA 3B9AA 4E8DA 1GORA 1XF0A 3H7UA 2FH8A 3M41A 4QTGA 2I5QA 2ZFAA 1BG4A 2P1FA 3LHVA 4DO5A 4QBXA 2VT0A 4U4MA 4ZTYA 1E6SM 4IQJA 3QY6A 1TZ7A 4QG9A 3CUXA 4N4PA 4Q8VA 5H8UA 4PRRA 1AQMA 3E0WA 3FAXA 2EEXA 4LTSA 2EPLX 3KEHA 5D38A 1OCNA 4RL3A 4WIWA 3VKCA 5DMYA 2NXIA 2PGRA 1SR0A 3UEQA 2JKEA 4NAEA 4GJJA 4U28A 4U2ZA 2Z2AA 2YCLA 1A3HA 2P3ZA 4RR4A 4JFWA 4LBRA 1AQFA 3GTHA 4MB3A 1OVDA 2JF7A 4GUIA 1PKYA 2J62A 3HOJA 4JN8A 1XIHA 2EG6A 1I2NA 1XLKA 2CBVA 4DRSA 1VBJA 3VKBA 4DJEC 2KAUC 3WNOA 2TSYA 3VZZA 2QF8A 4B3KA 1WBJA 2PTZA 3RF9A 2AL2A 2NZLA 1UWTA 5CZTA 1QNSA 3SSZA 1YMYA 4LV9A 2GGJA 4GGBA 1Z8AA 2X0HA 1W5OA 1V08A 1X98A 4C91A 4DJDC 1I2QA 8A3HA 3RLVA 3QQ0A 1RLCL 3LPFA 3GHSA 3GXIA 4AQLA 4DNHA 2J6XA 3ZXWA 4P7QA 4JAWA 5K4ZA 4YTTA 3GB6A 1FXPA 3RCMA 1OWQA 1U33A 2DP3A 3URQA 1AL7A 4WDTA 4BWLC 3BOFA 2DY3A 5D2VA 1FWGC 4ACZA 1K77A 4NZ1A 1XGDA 4OIFA 2ISDA 3ZR5A 3H8AA 4N6FA 1V77A 2WZMA 3VMNA 1Q6FA 1XLJA 5I07A 3SCNA 1NJJA 3SBFA 4C1LA 3TA9A 3IGSA 3P62A 2D3NA 3DBPA 4GFIA 3LHUA 3T08A 4RPPA 1YW1A 3B03A 3LBCA 1UP3A 1UD4A 3NL3A 1JYNA 1HKWA 1KRCC 2PDIA 3HPXA 2ZUNA 2J7FA 1GVIA 5AHFA 4LV4A 4NQ1A 3WF0A 3ANYA 3KDOA 4GFSA 4OV9A 1BXCA 2HTMA 2ACUA 5CSYA 3LHWA 3V35A 1VEMA 3GDBA 1TPDA 5PTDA 1AJ0A 3AIQA 3T8LA 2PDGA 1IF2A 5FKYA 4B3LA 1KO0A 5AY7A 3F2BA 3GVQA 3DAQA 4PMJA 4QE4A 5G1TA 1JPHA 5HQEA 1CT5A 1KM2A 1TR9A 1H50A 3UQNA 1ZENA 4FA3A 3GKAA 2XG9A 2V30A 1UROA 3A13A 2E5CA 3AHXA 5AHNA 3SY5A 1GCYA 3OVPA 2OO6A 1MFVA 3U9IA 3DU0A 4GIEA 2I14A 1GOXA 3NQAA 4R9OA 2QUVA 3T1GA 1C9DA 1TPB1 4E3TA 2QCGA 1UG6A 4PODA 1UQYA 3LPGA 1JXKA 4P8WA 4C6IA 2ZX7A 3ALGA 4JZ5A 5FF0A 3EMQA 2Y7GA 4HA1A 4MB5A 1OQFA 4M0XA 2B7QA 4A3HA 4PMYA 4GBDA 4MHBA 3UG5A 1KQZA 1P0NA 2H3BA 4GUJA 3RN6A 1EYEA 2XVPA 1QOQA 4OE7A 3EMZA 1KW1A 3OHMB 4U3CA 4RUBA 4NYYA 5AZ1A 1OB0A 3WLQA 1MSSA 3MY9A 3O3RA 2XZ7A 4AZIA 3EWBX 3K5XA 2C79A 3RLHA 2D20A 3ARXA 3QLLA 1CGTA 4AMAA 4Q6JA 1PAMA 3RU8X 3QR1A 4H8UA 4X9YA 3IIVA 3QKEA 3PPGA 4F9DA 3MU7A 3TFXA 4F48A 4GABA 1XBVA 3P80A 4DYJA 4KWUA 3W1RA 4EAYA 1EIXA 5HNTA 4FNUA 5G4WA 1YEYA 4NRRA 1PV8A 4YTQA 3F2DA 4WJEA 1GOMA 3ZT5A 3W84A 4MM1A 1MMFA 2ZX9A 3O16A 1J01A 2G97A 2HVNA 4ATLA 5DF0A 4MZYA 2DSVA 4P7LA 1Q5MA 3HGOA 4FNSA 3URAA 2NT0A 3VGBA 3SJ3A 5GNYA 4PULA 3HMJG 1V51A 1UHVA 3FEQA 4XD6A 1SFLA 5LNSA 2EPMX 1JL8A 5CQ1A 1ITCA 1KV8A 4MKVA 5BW6A 3T0BA 3USBA 3WF2A 1F2JA 1S2TA 3LD5A 2OWWA 3AYSA 2HQAA 4Z0JA 4Q7NA 3AZTA 2OGYA 2EPKX 2ZWYA 3UXDA 4H8HA 1C7SA 4LCRA 4KFNA 4FR1A 4GYFA 3WX7A 1MEHA 3HQOA 1PIFA 2NUXA 1LRNA 3R0KA 3UG3A 2QUTA 1E6XM 4HHLA 1E15A 4ZOBA 3ZT6A 4LRTA 4C1KA 2VMFA 3LM3A 3LK6A 1IQ8A 1X6NA 5TBOA 1TWWA 3KS6A 2B0MA 3CTLA 3IUHA 2Q02A 4TMCA 2QCMA 1L2QA 3ALFA 1KCKA 2GQ9A 3VIHA 5EMUA 2EXOA 5D9MA 4CU7A 1D9EA 5FSDC 2Z1KA 3TNBA 1C91A 1XPYA 3ATZA 3HG5A 4R9XA 5C2CA 1H1ZA 3C2EA 2PTDA 2J66A 3VFLA 1HG3A 2OLSA 3MKKA 2FPTA 4BF5A 1W5PA 3W28A 1CXIA 4GZJA 4BQ3A 1FFQA 2NSOA 1MZHA 3V5OA 3GHUA 2BODX 2HWGA 5BNKA 2FB2A 3LCWA 5FEWA 3SY1A 1UUOA 1YPIA 4AVNA 2WCSA 3CUJA 3BGJA 2ZUTA 4EPDC 2WMJA 2ZE3A 4JFVA 1M53A 2W67A 3IK4A 4JTGA 3H54A 3RCYA 2OFJA 4CNOA 3MCOA 4GQGA 3PJWA 4FR6A 2O56A 4S3JA 2DUAA 4F9JA 4OFCA 4I7UA 3WDJA 5C5YA 2O9TA 4WQ6A 3RU6A 1NF7A 1AL8A 1TX0A 3CWNA 3F03K 2JGYA 1T8QA 4AD2A 4FHAA 2J7EA 3UESA 3UG4A 2I17A 5A8PA 2BSLA 3JW7A 4MDPA 2YBTA 3SCWA 3F4NA 4KWWA 4LOCA 3E2QA 5HJYA 1J5TA 1BRLB 1FDZA 1JCNA 1TTQA 2OEKA 3VE7A 5MF5A 1NIUA 4S2BA 3V0SA 1QPQA 4XD3A 1J0YA 1OYBA 2QMKA 2D69A 3AYTA 4Y7EA 2GJXB 1CW2A 4ZQMA 4KCUA 3DYOA 5A8GA 1LRQA 3AZSA 4WZHA 4C6FA 3WDPP 4XZNX 2PB1A 2O55A 5HA7A 2GGHA 1YHTA 2ODOA 1XQKA 4TUFA 4XSMA 3VKJA 5EFDA 4Q4PA 1T8XA 3RFAA 1UC5A 2WHMA 3MVIA 2J88A 2PZ0A 3VDAA 5BYWA 3TYBA 3MP5A 4ORIA 3PPCA 3U5UA 6REQB 2PWFA 1E71M 4CQ9A 2YBVA 2C1GA 3OZMA 5IM51 4JHMA 3O15A 3FKRA 4YHGA 1AQHA 2ISFA 1RAKA 1ODUA 3CQJA 2VC5A 3BVJA 2OSXA 4XKYB 3NL5A 3PC0A 5DMNA 2QAPA 1RBOB 5FF7A 1Y5VA 1TTIA 1LZOA 1V0LA 1FWBC 2QJMA 7CGTA 4NNAA 4P8XA 2Z1XA 4ES4A 4AU0A 3E5BA 4UOJA 3PTDA 3BQ5A 3WDIA 1KV5A 4FNRA 3M0LA 1JFHA 4AD5A 1JZ7A 3DFTA 2ISSA 5E0KA 1XSKA 1JCJA 2DIKA 1GYLA 2ABAA 3WKZA 4AD0A 3NDZA 3CUFA 3OZYA 1RP8A 1POJA 3KE0A 5KZDA 3WH9A 2ZZ2A 3S83A 4AIUA 3P5YA 3AS3A 3UR2A 1GKQA 4G5DA 3O07A 3LY0A 4K38A 2OT1A 4O1BA 4X9SA 1CGWA 3PBWA 4S3GA 2DSWA 2Z2UA 2PZNA 3NAVA 4UTKA 4EPKA 3SCPA 1MUWA 3M0XA 5LIWX 5G5IA 5AYIA 3FA5A 2E4TA 3NQCA 4NZ4A 2EPHA 5DXXA 2GQ3A 2INFA 4GOAA 4AY1A 3LMYA 1VBRA 1E51A 4Y9MA 2UBPC 2ZUSA 3VILA 1T99A 2CNCA 4AB4A 2A1YA 4NHVA 2YIHA 3ORWA 4MUPA 3OB8A 4TV5A 1LM1A 1WO2A 4AZCB 3WUBA 4W86A 1GQKA 4ZE5A 2PRLA 2PDHA 4ZOEA 1SFSA 3GX9A 3B3DA 3KVLA 4GXPA 3L68A 5C8BB 3YPIA 3PR2A 5A6SA 3I6RA 3R1ZA 2A6NA 4H9YA 8RUCA 2XTKA 3VIMA 3BAYA 3WENA 3NFUA 3OTRA 1KBIA 2R9RA 1YDNA 1FFRA 3P0XA 3O1NA 1CWYA 1NTHA 2XIJA 1E1FA 3OGSA 1IHIA 4GGHA 3JU2A 3QPZA 1JDEA 3ARPA 3MQTA 3WK1A 2XUCA 2P50A 4L61A 4Z08A 2CPUA 1FHDA 1LWJA 4M1BA 2WMHA 1UH4A 4HK6A 3ENLA 4QQ3A 3GXNA 2WMFA 2QNEA 3FOKA 3FKKA 3G8EA 1IWPA 3UZ5A 3WD3A 1CGUA 4J3ZA 4HD5A 3O63A 2NVDA 4GNJA 4R53A 1K70A 1POKA 3CO8A 4CD6A 1REQA 2OMAA 3CPUA 2YBUA 1CEOA 7TAAA 1SUXA 4HMCA 2ATMA 3KHJA 3A5FA 4Y2WA 2Q3RA 3ARWA 3HIJA 3U2CA 3SJNA 1GQIA 1TZ9A 4O8RA 2YCJA 2BVTA 2LLEA 2E25A 1AJ2A 3NQEA 3UNDA 5A8NA 2EKGA 3O05A 4RNHA 3NJ3A 4WGHA 5I23A 3EKZA 3NDOA 4GRSA 4UNIA 5ABHA 3S1VA 3KOYA 2P8BA 4HPHA 4KRUA 3HZ3A 4PTDA 1LOQA 2YGYA 1OCJA 2J7BA 4O50A 2X1UA 2YXOA 3RPTA 2VNCA 3RPDA 5CAHA 3WQDA 2Z00A 1Z32X 4A3RA 5I0DA 4DXXA 3GM8A 1HGWA 3LZ5A 3TE9A 1M41A 5D02A 4F0RA 3IRDA 1WNOA 6XIMA 4RZBA 3MCNA 3C2RA 3GDMA 2VZVA 3UY7A 1PX4A 4GQRA 4N4QA 1FHLA 4I8YA 2I5GA 3UNTA 4V1YA 5I3GA 3SGUA 4QG8A 1HJQA 2CLLA 4NAEB 2NWSA 1GPFA 4GLEA 4JQ4A 1S46A 4G1KA 4A35A 3U3HA 1LT8A 1E73M 4ORMA 5HNNA 1Q6GA 1XLCA 1O60A 5DT5A 1QR7A 2XM1A 5G2IA 2J9XA 4JD4A 2QQ6A 4JTHA 1SQ7A 1GZJA 2VQUA 3RRAA 3T6CA 4QCEA 2E9MA 1XC6A 4NJGA 2C18A 3GW0A 4ZO6A 1JVNA 3NL2A 4S1FA 3QN3A 2CLPA 3TONA 1G0CA 2H6RA 2G3FA 2FZDA 1CGYA 4L9YA 4LVDA 1LLWA 2QULA 2PEVA 1TV8A 5XIMA 5CPQA 1FKWA 4YS1A 4B92A 4W85A 1E70M 4MAVA 3W0KA 2UY2A 4D8ZA 4EXBA 4JTAA 4M5PA 2PURA 1HUVA 1RA0A 5EY5A 4C7GA 1DJQA 2Z1SA 2PWHA 5LA1A 1JZ2A 4H8VA 3TJXA 5ABGA 1QHOA 3H24A 1IE7C 1KXTA 1LG2A 5F2GA 1Y0EA 1QOPA 3MO4A 2A3LA 2F6XA 4RNJA 4F79A 3AXKA 2CEQA 4EVZA 1XC4A 1UH2A 4IZGA 3L4WA 4E2VA 2DZAA 3CJPA 2DZVA 1OIMA 3UW6A 3GBEA 3ZFHA 3PB0A 2VX7A 4DIAA 4N9BA 1US3A 4I9TA 2GJRA 4ZEPA 1H49A 1EUAA 3I3EA 1F61A 1K1DA 4E4UA 4HGXA 4R5EA 3I7QA 3W2UA 2E5DA 3ZJ8A 4HA4A 1EKOA 4XK2A 4PUUA 1U22A 3IS4A 3PZQA 2CYGA 2PS2A 4C6CA 3EX3A 1E6ZA 2NWRA 5FCZA 2IMRA 3LBMA 4ICMA 4PCFA 3VOCA 3QV7A 4HCLA 1R47A 1VFHA 2ZXDA 1V3KA 2W5FA 1FWRA 3AHTA 1H1YA 5EPDA 3E2VA 1H51A 1N8FA 1YNQA 5LIXX 4QSHA 2DT0A 2E7FA 3C86A 2IXVA 5FESA 4KCTA 2VI0A 2A3EA 1IGSA 5JBDA 4ZFMA 4F2UA 2RUSA 1IXQA 1R7AA 3P7YA 7PTDA 3QH2A 2CHNA 5AB3A 3VZXA 1F9CA 4BF7A 2HJPA 4H00A 1AMKA 1KM6A 1SR9A 3GU9A 4UZUA 4MPKA 2HVOA 3I68A 3C8NA 1TV5A 1K7XA 4ML9A 2WNZA 4IPJA 2ZZ3A 4PFMA 2VR4A 4JGDA 4EF9A 1NP0A 3TLLA 1NAL1 2AMXA 3BOXA 5HATA 1CYGA 1SW0A 3EYPA 5C7HA 1H5VA 1V0KA 1YDYA 4NJKA 3KXQA 3U0HA 1J8VA 1TPFA 4C1NB 3IEBA 5BROA 3LRKA 3SCSA 4L9XA 3OJGA 4S2CA 1Q7QA 4CCDA 1F4HA 2QPXA 3MWAA 3H55A 1Q45A 1UB3A 3PPFA 4QNWA 1JD7A 4W5ZA 4WXZA 3ZS4A 3E9AA 4AZGA 1F3TA 9XIAA 3EDFA 1JRCA 3KM8A 1T41A 2WHLA 1L6WA 2YB1A 1I0DA 4KMQA 4LS0A 1TMLA 3IGXA 2DU2A 4MUZA 2RJGA 2W63A 3H12A 1SZEA 3HU7A 3GHTA 2Z24A 4JQ3A 3VIJA 1YDOA 1QT1A 4LC6A 5JBFA 4HSOA 5AC8A 1WDQA 5FOOA 2CC0A 3PK7A 3Q37A 1JZ8A 3M0JA 1EEPA 3S2JA 1M6JA 4XAFA 4Z2KA 1FBAA 2QJJA 3W74A 3TTEA 4UQAA 3SQLA 2YA0A 5LIKX 4LXFA 5DMMA 4AX7A 1TIMA 4MZ1A 3GFXA 4NILA 4A3UA 1J0KA 3SUVA 2ATSA 3S2NA 1AZ2A 4NY2A 3HQPA 4RJEA 4Z1CA 1FDJA 2PDWA 4V33A 4DM1A 5F4SA 3NPXA 3EA2A 1GVFA 1E9YB 1FWDC 2PI6A 4AXKA 2WSRA 3MP3A 3SN1A 1I0BA 1WZLA 2DQWA 4M81A 2C1HA 2YSWA 2X05A 4ZMGA 3LPOA 4JIHA 2TPSA 3IRSA 2NQ9A 3MTWA 4GH3A 3CL8A 5G1YA 4QLLA 4HTYA 3WD4A 4GZEA 2J74A 2PDUA 2PDFA 1TWZA 1XSIA 5I3FA 1Q6QA 3AMDA 5EMYA 1FTXA 1XCFA 1GGOA 1JCYA 4PTVA 4X60A 4L7ZA 2PDJA 2CXGA 2Y61A 2D0HA 1BFNA 2GDQA 1F5ZA 1MRAA 3ZYZA 2OT0A 1VRDA 3WH7A 2OLHA 1SPQA 3EA3A 4GYKA 1DKWA 1CXFA 3L0GA 1DXFA 1NU5A 1Z89A 2B7PA 3HF3A 4GJIA 5BOFA 4WVXA 3TV8A 3I3DA 4X61A 2RDXA 1H2JA 1X96A 3S2MA 2A79A 3GVRA 4XTDA 3NWRA 5IBXC 2VEPA 4E2BA 4F4RA 1OGGA 2P0IA 3OBKA 1MWOA 1S39A 3MKVA 4E2DA 2EPOA 4B9ZA 2CWNA 1G4PA 1TWSA 4EF8A 5LIYX 3VX1A 3LCIA 3P84A 5DY3A 4J3VA 4LYQA 2REQA 1YTKA 5BRBA 1TPEA 4AVFA 5EKYA 4BI6A 2V2CA 2C7FA 2XH2A 1FHUA 5LXXA 1OT2A 1BSIA 1UR1A 2XIBA 2JF6A 2UWFA 3RG6A 4ZZ9A 3GHRA 4BF9A 1ALDA 3W7GA 1LORA 2VX4A 1ZS2A 3QHOA 1LBFA 5CBBA 4IG2B 3P81A 1K7FA 4KFPA 2XVKA 5A2BA 1KBKA 4XAGA 3G18A 4US6A 4RE2A 4ZQNA 1XD0A 2NQHA 1E6PA 3P14A 1QDSA 1ECEA 1OFAA 3F5LA 4I5RA 4UCGA 3HB9A 2PTYA 4RLIA 4J2PA 1TIWA 1V3JA 2W27A 3SO7A 4A6GA 3PZUA 4O1AA 1V6XA 2W66A 2P76A 1ICSA 1EEXA 2G4FA 1WA3A 4JN6A 4MIMA 5KITA 1TV4A 3CMGA 4IXHA 5A2AA 2YJQA 4AD1A 1H7RA 3CZ8A 4QX4A 1XYZA 4QS6A 3REQB 2DW6A 2ZC8A 3IVUA 5M1TA 4JIEA 2V5LA 2WOQA 1F6YA 2VX6A 1YDVA 4ZOCA 4Z1YA 4ADUA 4HNNA 5I78A 4CKQA 4K2SA 1RQHA 2ZTKA 3M0IA 1AK5A 4Q3MA 1KB3A 2QJNA 2YFNA 4JYDA 4W7UA 2QIIA 2O0TA 1S2VA 5I3JA 4PBGA 3S6TA 5AVNA 4UR9A 2INEA 3LERA 2NXGA 3UWEA 1AW1A 3SURA 2Y88A 3MT1A 3FV9A 1ONXA 1QI5A 2BXVA 3MO7A 3TYEA 3MCMA 3T2OA 2WB5A 3GO2A 4H7CA 4JIIX 3OOQA 3CPGA 3VDBA 3WEZA 3PUEA 2GVLA 2ZRWA 3WLIA 3SY8A 1MQPA 3UBPC 4HYRA 1WDPA 2RFGA 3FK4A 3TYAA 4UQBA 4CD5A 4L64A 2ACQA 1Z7AA 1H09A 2BB0A 3BG9A 2WZTA 1XXXA 1XIBA 4GY1A 3WLRA 3BSMA 3PZGA 3E38A 3IGHX 3AROA 2PU1A 2YXGA 1XDJA 1VD6A 3R43A 4FXRA 3L4TA 1Q6DA 3ZLFA 1R7OA 3GKFA 4J2MA 5IHSA 2FVMA 3R94A 4ZODA 4M6VA 4GA8A 4NJJA 5H91A 2Y7FA 1KFKA 3HQ1A 2BY1A 3F5KA 4INFA 3LCHA 2B81A 1PYFA 1UUMA 3OHIA 4LS1A 1B4EA 3EOEA 1LQ2A 3SZ8A 3WLLA 2C91A 3WEOA 5CLWA 3USZA 5AC4A 1T7LA 1VEOA 2VEMA 3BZJA 4MB1A 1V7YA 4H1ZA 4DQWA 2GSJA 2HK1A 3ZVHA 1IEIA 5EU9A 2GGGA 3L65A 3V1HA 3B4UA 3AIRA 1MW2A 1G5AA 1JNDA 5EYWA 1QHPA 4LUSB 4PTXA 1ITQA 1F7BA 2XIIA 1A0EA 4HN4A 3CHEA 3OA5A 3IGUA 1H7WA 4CD4A 3GR8A 3V5FA 3BAWA 3ZO9A 3IWPA 3GU1A 1OCBA 3TXZA 2NT1A 5DT7A 4M82A 2XVNA 2V81A 1X6LA 3PFMA 1K9EA 2OZTA 1D3HA 2WNQA 1NDWA 2HE8A 2QF7A 5FJRA 4WSKA 3VABA 2O9PA 2E6DA 3KAOA 1WBHA 1EH9A 1MW0A 4REQA 4S39A 3GE7A 1QW8A 6TIMA 1NDYA 1B30A 1Q85A 4YL2A 2XSXA 4EACA 4UZSA 4J3XA 2WWDA 2DJLA 3DECA 5K9XA 1SJDA 1UMLA 1W37A 5C54A 2QIWA 3W27A 2XN2A 3SRHA 4D6IA 3VU2A 1RH9A 1ZFJA 3O7UA 4ML4A 5DX7A 2ZIDA 4UIOA 1SU5A 5C9XA 1OFPA 1XRSA 4Y8FA 1XH0A 3B04A 5D4YA 2Z6JA 1R0MA 4GYPC 1YNPA 3F2CA 2NLYA 3HGRA 2J7HA 4LVAA 4LAOA 1VFMA 2BY3A 3NDYA 1WOAA 3UJRA 4TV6A 1R46A 6PTDA 1C93A 4DWSD 4L5ZA 4IJCA 2OYLA 2WMGA 1XIDA 3EEZA 4FX7A 4GKTA 4O19A 1TA3A 3TJLA 1LYXA 4YVVA 2VCBA 4UQEA 4PZVA 3VM7A 3DGRA 4LNYA 3AXHA 4XZIA 5K2ZA 4L6HA 2HVMA 2Z1VA 5G4EA 5A6JA 2Y63A 3W00A 2VL4A 1FDYA 3QHMA 4UQ9A 3TNOA 3TJ4A 4JL2A 3RJYA 4YXGA 2FGLA 2NUWA 3WMSA 5BU9A 1ZJAA 1ECQA 5EMJA 4ZBCA 1V6TA 1OYCA 1R8LA 4PMQA 4C1NA 3EWUA 1KNWA 1H7NA 1JULA 1WDWA 4KIRA 5E5CA 3AI0A 1VC4A 1NOUA 1AQ0A 1Q3NA 2B4GA 5M03A 2VWSA 2WMIB 3DGBA 5D9PA 3S1XA 2V3FA 1VFUA 4WDWA 1PZ1A 3U4AA 2HK0A 4DWDA 2V38A 4S3CA 1W1B1 4C6DA 4H6KA 3VOHA 1L8PA 2PLKA 4J1OA 3BLIA 4JFUA 5C6MA 4PMNA 2VVSA 3BGAA 4HNLA 3RM9A 3R8HA 1OIFA 4RE4A 2QCDB 4HMDA 3BV7A 1G7VA 4FAMA 1N7KA 3M1ZA 2ZZ7A 3QY8A 2HNEA 4IX2A 1LQ0A 4ZVJA 3UXAA 1O68A 1B54A 3S1UA 5EMLA 1JCLA 1JUBA 3GS6A 3F4CA 4LGXA 3HPZA 3AMLA 3ARYA 1IT0A 1IXOA 3RMEA 4UTWA 3GZAA 3WQVA 1LLOA 4UTUA 1HT6A 5T9CE 3CV1A 4JN7A 4J3SA 3MSRA 1H4PA 4V27A 3W23A 1LCOA 4QSFA 2J9ZA 1VJZA 2VCAA 1KD0A 2ZADA 1NWSA 3CZKA 3CZEA 1XJBA 3DFQA 2CZVA 2IW0A 4HKPA 5JVLA 3NL6A 3N34A 4FOJA 3L2IA 1OINA 2YKKA 4Z2JA 3KRZA 4O1CA 3W71A 3KWXA 2DZBA 1DP0A 3ZIZA 4JL1A 4JY8A 1YXYA 4DBWA 3E0VA 3QFWA 4MLJA 1G4TA 2XFRA 5C55A 3NOEA 4EK7A 1NSJA 5AFDA 2TYSA 3BW3A 1Q4WA 2I9EA 1G7UA 4HZ6A 3KS5A 6TAAA 4WD0A 4O28A 3MUY1 2PTWA 4A8RA 4KRTA 3S2LA 1Q4NX 2VYOA 2YCKX 3C5QA 4ACYA 3GDKA 1YNYA 1RJQA 3TDFA 3C4UA 1ZCOA 3Q67A 2VQTA 2W9MA 2E28A 4DJED 3QTPA 5LNUA 3GH4A 3UPWA 1QPKA 3FGCB 4JBRA 1NELA 3IANA 4HYVA 4JX4A 4F0LA 3SFKA 2O9OA 3MI2A 2OXNA 3L12A 4L1WA 1VRXA 3GTIA 1VBHA 1VP5A 4AIBA 4LNCA 4NX5A 4R7JA 3EPMA 4XQ6A 1XKYA 2ZVIA 3W1XA 3MBDA 3LGGA 3G5EA 1RLDA 1MUCA 3DERA 3UFYA 3CYVA 3AUOA 2V5KA 4O4VA 1C8YA 4KFOA 1EGVA 1R2SA 5JIPA 4B5WA 1EZ2A 1OM0A 1BF2A 4HPJA 5C9UA 2E5BA 2RH9A 3JZUA 2IKJA 1BG9A 3EDJA 4GXWA 1YBQB 1E0VA 4YN5A 4AF0A 3AS2A 4ECLA 3M5ZA 4D2JA 3UETA 2QVHA 2X2GA 2J77A 1JDDA 3VMPA 2WKGA 2QZRA 4UQCA 3BMXA 2G37A 4JIPA 4TX8A 1UR8A 2X41A 4O11A 4LJ3A 4H7VA 3HFTA 4A8IA 4LVFA 4J3TA 2OZ8A 1M3UA 2Y1HA 3GIYA 4XVEA 1R87A 1XLBA 1XIEA 3O6YX 4FLOA 3UJFA 3WLKX 1PX3A 1XYLA 3PBMA 1KRAC 4PE8A 1DWJM 3ANVA 3CL7A 4IIFA 3B9EA 3FHQA 3EWYA 4K37A 4KESA 1ICQA 3K8MA 1DJGA 3STGA 3VA8A 1KM3A 4HNTA 4FB7A 1IR1A 2VX5A 1Z42A 3PVFA 1V8EA 2CLIA 5HR7A 3THAA 1TE6A 3N15A 3FFSA 2V5BA 5DEZA 3M6YA 3QTGA 2VURA 3SCOA 1TJ1A 2VFEA 3P61A 4X3ZA 4P8UA 4F0HA 2XN1A 1SGJA 3GYCA 1DEDA 1QI2A 3M43A 1K3UA 2H8XA 5TF0A 1W56A 3SCQA 3PNUA 2ZZ1A 5A95A 3LNMA 3NPVA 3EWCA 3H6OA 4US5A 1R85A 3VC6A 2WHKA 4PB3A 4UTHA 4D72A 1D7KA 9CGTA 1TJ2A 2IKIA 4FLSA 5A8OA 3BCFA 3TTOA 3GVWA 5TQLA 2R1PA 5I06A 3A12A 1A3WA 1XLFA 2RDTA 3FVMA 3KZSA 1R3RA 5CZ0A 3UY8A 3W72A 4QDMA 5D30A 1UJQA 4DLMA 2FTYA 4TU1A 2YL9A 5IOBA 1ZBWA 5K7JA 1GQLA 4LEFA 4RNIA 2NQJA 1WV2A 3GXPA 2P8CA 1G9HA 3KRSA 1F07A 5HQLA 4Q7IA 1XYMA 4QP0A 1VS1A 3MC5A 1NFBA 1KM1A 1HVQA 2WV8A 2QCHA 1PXGA 4HVXA 2PWEA 1MNZA 5CKSA 4GC3A 1X8FA 1C9WA 4PBFA 1W3IA 4JEJA 3TQVA 4O12A 5C71A 1RP9A 1B90A 4RZ4A 1CGXA 2YL8A 2E77A 4KW2A 4HSNA 4DZIA 3CLWA 3GUWA 3WJWA 1PDZA 4RE3A 3CV6A 2OEMA 3T0CA 3E5PA 1EJUC 3VOGA 3CL6A 1ZUAX 3I4EA 3RDKA 2FZ9A 4LY4A 3AYVA 1UZ1A 4Z1AA 4WGXA 4UTMA 4G6CA 4WSJA 1VCFA 1MW1A 4M19A 5E93A 5I09A 4TOQA 3MHUA 1A53A 3BV4A 3DG3A 1UKQA 1UQZA 3IIOA 3LHZA 4KBXA 4AISA 1NH6A 2NVCA 5CSSA 4XZMX 1PIGA 3L9CA 4D6HA 3O9NA 2TODA 3N4FA 4JR5A 4Q4SA 3W75A 5AC7A 3UYIA 4AYSA 1Q6EA 3CQKA 4LANA 4K7YA 4LB3A 1KTBA 3A4JA 2GGEA 1ZAIA 4MNLA 3L5LA 1Z3NA 3W7IA 4AY8A 4Q8UA 4TVDA 1B57A 1DJYA 3IJIA 2WC4A 3P2VA 3WLPA 1MZRA 4W8LA 2ZZ6A 4JQ1A 4C90A 3HJZA 3FVDA 3W7NA 4QJ1A 4PA8A 3WZ0E 2Z7KA 4L4MA 1QK0A 1W1PA 5GNZA 4EXQA 1HKVA 1UR3M 3PPHA 2I56A 2YOCA 2Y8KA 3FLUA 3BQ6A 2VOTA 1EC7A 3W73A 4AWSA 3FIGA 3K4WA 4H3DA 3WF1A 4MWAD 2Y6ZA 2Q71A 1NM9A 4ENLA 4ZENA 3CASA 1AFSA 3NO5A 1X7FA 3VUPA 1VQTA 4PB4A 4QGCA 4RKAA 1XH1A 3MP4A 4GH1A 4Q33A 5A3HA 3B0PA 4MADA 3QGAC 4AAJA 3C8FA 1QVBA 2PC4A 3PB2A 1E3ZA 1EOKA 2WKLA 5DBUA 1KFWA 3FHAA 1PWLA 2XH0A 1QPOA 1HJVA 3STEA 2BZNA 4KWSA 1CBGA 2VRKA 2C14A 5BRQA 3RO6A 6CGTA 4F40A 5I6SA 1WXYA 4GCXA 7XIMA 4WK9A 2X1SA 3I65A 5I3KA 3F7JA 4FSAA 4DUOA 4TTUA 3RM4A 3NQDA 1YTEA 1P5BA 3VGFA 8CGTA 3MDUA 3OQ8A 2XVLA 4Y9AA 1EWDA 5A8MA 1BXNA 5FL1A 1VF8A 2XU2A 1O6IA 1QWGA 1ZPTA 4NUWA 5KEZA 4OOZA 5JH2A 1NWTA 4HCDA 3R25A 3A64A 4LYPA 1JQXA 1DHKA 5I3HA 4CLMA 3GG0A 1I45A 1ZAHA 3CYJA 2DUZA 2HBXA 4HMNA 1REQB 3W25A 1QAPA 2X2YA 1EDTA 3PTQA 3OVRA 3FW6A 4NI8A 4QR6A 1US2A 3D3AA 2XFWA 3LSBA 1E9LA 3N19B 1JD9A 1EZWA 5AKQA 1RA5A 5B7YA 3WK2A 4WSHA 2RKXA 3BJTA 1M65A 4WKAA 2GJXA 1KBBA 2CZFA 2ZRUA 1JPMA 1PL9A 1BKHA 3ME3A 4E4PA 1EJTC 1XYFA 4DBUA 1M7OA 1YXDA 2P53A 5FJJA 1BKSA 3W3OA 3B97A 4H6EA 4G7FA 1EJ7L 1NFPA 1KCLA 2ALRA 2V69A 1Q7ZA 2G3IA 2X7WA 3GFZA 3BGGA 3LXAA 4ICNA 2YCLB 1KKOA 4QLJA 3BXWA 3C52A 3WD2A 3REQA 4D6FA 1TX2A 4HZMA 4XD4A 3WELA 2PC8A 3M47A 4O14A 1K9DA 4I6VA 1UWAA 3V18A 4DAFA 3VGDA 1IZJA 3W86A 2XFYA 3R7MA 1JYVA 3GY1A 2WPBA 3E2RA 2WMIA 2Q09A 1KR1A 5AC5A 2EKCA 4EWND 1DOSA 3XIMA 3N12A 1SZRA 1R3QA 3CUGA 3KCLA 3CIXA 4MB4A 3VIOA 4S3KA 3LUTA 3GR7A 1PHQA 3VD5A 1J96A 3UCQA 2FVKA 2F84A 1HX0A 4FP1A 1A80A 1H7XA 2BVDA 2BGQA 3U7VA 2VJXA 4GNVA 4KIEA 3RJXA 4E8GA 1UA3A 2CBIA 3CM4A 4Y90A 5DRIA 3W37A 4CEXC 3NQ6A 3MYOA 4JTSA 1ZBVA 4PFHA 2NV1A 4IGHA 4W87A 1U1HA 1NDZA 2C8NA 1OJXA 2WZEA 3CQIA 1RY8A 4IIGA 5T26A 1KFBA 4WOQA 2V8ZA 3B05A 5LKYA 1UKPA 1UCWA 3IARA 4D6EA 1LL6A 3TK7A 3L66A 3CWHA 1TV2A 4A8LA 4D71A 4RPQA 3WNNA 4BQ4A 4O53A 3S5YA 4DPQA 3W22A 4ERIA 4ALDA 3C3UA 3CQ0A 3AXXA 1PKMA 1OFBA 3OIHA 1B2YA 1UC4A 4CGTA 4IMDA 1A5CA 3W2NA 3E0IA 3CEPA 4QITA 4HOZA 5AYXA 3CHVA 3ZSSA 2TMDA 2Z1BA 2FHCA 1HO4A 5A6TC 1FQ0A 3TTYA 4ZB5A 3UZYA 2W62A 1PHWA 3T09A 4KQNA 1OHLA 5F1UA 3ZQ9A 1TTJA 2E0PA 3M16A 4EP8C 3SFWA 1I2PA 4UTTC 3VGHA 2TAAA 4J4KA 1CI1A 4O15A 4Q8MA 4MMWA 1LRTA 2A0NA 1E0TA 1XM3A 3OA3A 1VKFA 3A3WA 1CECA 3PTMA 2R14A 1CB7B 4D6JA 3OZOA 4G56A 3E0LA 3KTXA 4LCSA 4E38A 4PEEA 2EPNA 4JX5A 2CXEA 1W9PA 1FWCC 2F8QA 1IWBA 2CBJA 2E9BA 3M07A 3W87A 1EOMA 3LXBA 3CHCA 3BJFA 2C19A 1WUFA 4LS2A 1Q2RA 3G0UA 2CZDA 4PMRA 4CQ8A 4PC8A 1G69A 5C2XA 3RAOA 1U1UA 4IX0A 5A6MA 3GAYA 3VD9A 3CUIA 2PDKA 1LT7A 3A9IA 4NJIA 1Y7VA 5L6UA 5AHLA 1A0CA 5DXYA 1Y5XA 4LEQA 2FH6A 1EBGA 4PUEA 1I60A 4NZ3A 1B3XA 1TPUA 3MI6A 2ZBTA 4QLKA 4GE8A 4JICA 1GTHA 2Y0FA 1KBLA 3CMFA 4NJHA 1EB3A 1PZ3A 5GQBA 3LBOA 1FKXA 4HK7A 3UXLA 3CB3A 4L1XA 4O57A 3ZVIA 4NKCA 2ZUVA 3KL3A 4NAFB 1XLHA 3IV8A 1P43A 3K2GA 1GKRA 2PF8A 2JEPA 1EA9C 2HROA 3GQYA 5BXTA 2E09A 1B9ZA 1OF6A 3AS0A 4B5SA 4AZ6A 1DV7A 4FF7A 1HJSA 3M44A 1ADOA 1FH7A 4HB7A 3M0MA 4DI9A 4XTIA 1SZGA 4DYEA 1Q65A 4XUYA 4GX9A 4WJXA 2Y70A 5BOEA 1OADA 3RX2A 5A8QA 2OX4A 1NOWA 2V63A 3OBAA 3OG3A 4TVUA 1PUDA 4GIYA 3QFEA 4PEKA 3GRIA 1DQUA 3VM5A 2HV5A 4E4FA 1LBMA 4M51A 5CZSA 3OU8A 1TRIA 4IIBA 2CITA 3E0FA 4GIRA 3WD1A 2GVYA 1UP2A 1HJXA 4DJDD 1XLLA 1FA2A 3EA1A 3EWDA 1UWSA 4XZBA 1P0BA 1JDFA 1GVRA 4NNBA 5DBTA 3UERA 4CN4A 2WVTA 1VBUA 4XVDA 1ZSXA 2HXUA 3TH6A 3WJXA 1XGEA 3TWBA 3N2CA 1S2CA 1QATA 3SQMA 1OY0A 3IJ7A 5C9RA 2GWNA 2WJEA 1R2TA 3OLGA 3LA4A 3LQGA 2Y24A 3PJTA 3NQFA 4JNYA 5F2IA 2QDEA 4RK8A 3DFNA 2WC7A 4HA0A 2GVGA 3WUFA 3HPFA 1ZP3A 1OBAA 4XX6A 4Y8EA 3LLDA 2ZZ4A 1RUSA 4W5UA 3NG3A 4YJ5A 3N9RA 1OX5A 1GEHA 1YIXA 2OQLA 2WZHA 1MXSA 4D1IA 1TB3A 5D9NA 1BD0A 5E09A 1L0PA 4H04A 2BHYA 1EJXC 5D2YA 3RCNA 3NZ1A 4TX9A 2ZUWA 1LQAA 2AGTA 3T2QA 1GOOA 1ME9A 1XSJA 5HPOA 4FXFA 2PD5A 1A50A 1NFGA 1DWHM 4LAUA 5KETA 3ZWTA 1XRFA 3VCCA 5REQA 3AU2A 1C8XA 5G2HA 2VELA 3EDKA 6REQA 4TIMA 4YPJA 3TCEA 1KRMA 2Y2WA 2VENA 2YDSA 3NXLA 4PMDA 1IT8A 3K1DA 3AO0A 4CNPA 2FJKA 2W92A 1E0XA 4PUWA 2V2HA 2DUXA 3NQ8A 1VB9A 3ITGA 2E1DA 3N3TA 4EX4A 1EJVC 4HJWA 1MW3A 1U5VA 1TG7A 1L6GA 1F6KA 3PUOA 5E70A 3TROA 3ARRA 2F9RA 4Q8OA 3LMZA 4Z2HA 1K6AA 1EHNA 3L7RA 5EMKA 3NZPA 2P88A 1PJ9A 1IXPA 4GZIA 4HPNA 2VUYA 4JQAA 2IUZA 2ZRYA 4QDWA 1KFEA 2CWXA 1OC5A 3DI0A 1KLZA 3LI1A 2CZ5A 4BA0A 4M8UA 2GWGA 2CKRA 2R1MA 5GVJA 3STCA 4BY3A 1P6CA 3QQWA 1W32A 3AIEA 1XINA 4H9TA 3UWZA 4CU6A 1XP3A 2ZCGA 3N11A 2QLYA 5FJIA 4O8AA 5ECUA 3AXIA 3UA3A 4D6GA 4UR7A 1HP4A 4XV0A 3L67A 2VZUA 3M7SA 4MY9A 3B40A 2ACSA 2PRMA 4NRSA 4YYCA 4F0MA 4O1FA 4AG0A 3DFSA 3ZLGA 3QOMA 3BMVA 1VFLA 1IEWA 2YDAA 3K8KA 4ZO8A 1WKDA 1V6UA 4I90A 4ZO7A 5FA5A 3BOLA 1WX0A 4PBEA 3NO1A 4QROA 1XLAA 4F0SA 3W38A 4Q22A 1I6NA 3SUWA 1R38A 1DIOA 4NZCA 3LU2A 1QMLA 4MNJA 3KHDA 1BXBA 5LYRA 3UZZA 2RGMA 4MYAA 4ICCX 3IUIA 1R9YA 3W7MA 3B8TA 1BHGA 4PTNA 4IISA 1XI3A 4PMOA 2FDSA 3VDCA 3ONCA 3B0VC 4QCFA 5DN1A 6ALDA 1UOZA 1E4MM 1QUMA 4RXFA 3ZZ1A 2PDNA 1GOIA 1RD6A 3GC2A 3KRUA 4R3UA 4HZ7A 3CNYA 4M80A 4F8XA 1KTNA 2FGBA 3URBA 3S6OA 1E55A 5CBJA 3G1XA 3A47A 4A8NA 1M04A 1AH3A 4PCTA 1IEXA 1E5NA 4AEOA 1SZNA 4AC1X 3SUUA 2W6RA 3N9KA 4AWUA 2O92A 3N6JA 5K9DA 1GNXA 1SM9A 1B5TA 3CZGA 3TP4A 4GUFA 5C70A 1OT1A 5J04A 3VINA 4AIOA 3TTQA 3GNDA 4H8NA 4NZJA 3GNNA 3RX3A 3A21A 1FWHC 3UF9A 2VFDA 2Z29A 3BH4A 3WL0A 2X8RA 2Y8UA 3CS2A 4EANA 5EGRA 3HV8A 5IBXA 1E9IA 1W0MA 1WKFA 3A4XA 4HHMA 3MDWA 3P3BA 1F4AA 4DBSA 2VDHA 3W76A 3NSXA 3TZFA 3UVIA 1CXLA 2E67A 3PJUA 1WPCA 2BGNE 4XUGA 1V3MA 1XKJA 2W61A 3W7LA 3G3MA 2XISA 4RCXA 4YMZA 4O54A 1IEQA 2V5JA 1QRQA 3RR4A 2EO7A 3W6LA 2EQDA 3KVMA 3H2MA 5LIUX 4JTRA 2ZX5A 2JIEA 1R30A 1W1YA 3H70A 3P82A 5J5DA 4WUIA 4PUMA 3KP0A 2FZ8A 1A47A 1R3VA 3ITVA 3C0JA 4DJEA 2VEFA 3B8DA 2A85A 3W81A 3W1QA 1WAUA 3VIPA 2V3DA 3UJ2A 3H4WA 1KLYA 5LA0A 4ZCWA 3N6HA 2DZWA 1GJPA 1M9HA 2IQDA 3BURA 3LTSA 4Q8TA 1XIIA 4BCEA 3DEQA 4O1DA 1TUXA 1O94A 3W7KA 4AHQA 1PYMA 3PZ9A 2YW3A 1QO2A 3T2PA 4NIRA 1AH4A 3WMCA 4OHQA 2QAFA 5CJNA 4US5D 4MG4A 3THUA 2CU0A 2H8ZA 3HM7A 5I03A 7REQB 1PEZA 4IQDA 3W07A 3IAQA 5D8WA 2XVGA 2POTA 3PZNA 4WEVX 1V3IA 1TELA 3GXMA 5CCZA 3W83A 3R6IA 2B7NA 3MZNA 3V0TA 3DZ1A 1XBZA 2W0UA 4OZOA 1VBGA 4G7EB 1VCVA 3TKFA 2OKTA 1J12A 3MHGA 4KRZA 4QHRA 3RMJA 2FJUB 2GUYA 1UIOA 1LUCB 3UXIA 4B9YA 3KWSA 4AZBA 1L8NA 1QXLA 2JE8A 3OVQA 2OOFA 1AD1A 2E40A 1TVLA 3FAWA 1FY6A 3ITLA 1DBTA 4MFEA 4ACZB 1TO3A 3VVGA 1SW7A 3L4VA 1CXKA 3WLTA 3RUBL 1B31A 4CCEA 4LX4A 3CV7A 3DFYA 3SCTA 4OV4A 4PRTA 3VD4A 4R34A 5HUOA 4MJ2A 2FYMA 1BYBA 2OKOA 4LPCA 3G24A 4PMXA 1W9DM 4A4AA 1RQBA 3NM1A 1X1OA 1J0ZA 2NX1A 3WBXA 1DJNA 2PP3A 3QW4B 4L6DA 1VFTA 2W4XA 2XWEA 1HO1A 5FIPA 1V5XA 3T44A 3GBDA 1X6UA 4CN6A 5JMUA 1XLMA 1W9XA 5AZ0A 4LAZA 2YCIX 4DUVA 4GD0A 3XISA 4HN8A 3M0VA 4AD4A 1WXJA 5U7SA 2CFFA 1J2WA 3AC0A 1TYGA 1W17A 2HCVA 1QI4A 3K4AA 5I00A 1SFTA 3L21A 3V1PA 1H0GA 3CC1A 3VNKA 3LSCA 3KBVA 3GW3A 3W7OA 1H63A 3RLUA 4BQ5A 3QF0A 3VO0A 2YDRA 3KFTA 1F6PA 3ITOA 1XIGA 2QCDA 2PFHA 3GNOA 3VD3A 3HGSA 1SO5A 1DXEA 1QPRA 3PZIA 1XIFA 5CPOA 5BXSA 2A5HA 1UOKA 3G1FA 5CBIA 5AOUA 2CETA 4O1EA 3N3MA 3LTPA 2WVVA 3FEMA 4ADTA 3R12A 2PD9A 6XIAA 3WMBA 2BASA 1KFLA 3DG7A 2HEJA 4B5NA 4C7FA 1OZQA 2C1IA 3CAWA 4YWIA 2FZMA 5ABEA 4XISA 3NQBA 3II1A 1OFQA 3NVTA 4P7OA 1PS9A 5DELA 4JNMA 4R7OA 5BXPA 2ZXAA 3H4GA 2MUCA 4DWSC 4POCA 4JTLA 3VDHA 5ABFA 3NVDA 3S5NA 2GSHA 3DX5A 1YPXA 3M0KA 2D1ZA 4DF1A 4PR4A 4BI5A 4DPPA 1EGMA 1EF2A 3UZJA 3L4UA 3Q4DA 2BFGA 1QBBA 4TVCA 2X09A 4N42A 3JZEA 5GNXA 1BQGA 1B3OA 3S42A 3PNZA 3DC0A 1HL9A 4N9EA 3LGEA 5DCBA 5AYZA 3WN6A 1RHCA 1I2OA 4J3WA 3P8JA 3DHDA 4LAKA 1ONRA 3UYCA 4K3ZA 3S3GA 2L5HA 1IT7A 3LOTA 3UD6A 5TNVA 1BF6A 2AAAA 3TYZA 3HJEA 1QNVA 2BDQA 1N8WA 4N2YA 4AY7A 3WLJA 2OOGA 1WDDA 4K36A 1W1ZA 1PPIA 1ZAJA 2ZUUA 1TPC1 4HBKA 2VR2A 5FJTA 1C92A 2YLLA 4URIA 2PGEA 4GI8A 3TLQA 3S47A 4DVOA 1EF3A 1AH0A 1E1CB 5E9XA 4GQQA 3OODA 4LUYA 4DXKA 2QS8A 3W7RA 4C6EA 1KGWA 3QQ1A 3CUZA 4C6LA 1QO5A 3LTYA 3GYEA 3W24A 1E40A 3H2AA 4OUIA 2OWCA 2Q01A 1DXIA 3GTNA 1Q2SA 1EXPA 3V36A 4DZAA 4AH7A 1A5KC 1TVNA 1VYPX 3AJ7A 2PDBA 2Z27A 3VFCA 2HZGA 2VDGA 2P10A 1UWUA 3D5HA 3ITTA 3WBWA 2IKHA 3W1NA 2X1IA 3EPNA 3PBVA 2QEZA 5HWJA 5I5RA 1VYSX 3PWAA 1EIBA 1V7AA 2YZ5A 4GY7A 3O8AA 4DM2A 3BG3A 7ODCA 2D24A 3LYEA 3UGRA 4FXSA 2J7CA 1R6WA 3MVTA 4QEEA 4JTFA 4XAPA 3TQ0A 1LL7A 1MYRA 3N17A 4LSBA 2VGIA 2CLMA 3S9YA 3QKZA 2GJNA 5DO8A 3TYDA 1H41A 4XAZA 2CLEA 3N13A 4Y6GA 1TPWA 1ZZMA 2ZQ0A 2DZSA 1B4KA 2JFEX 3HQNA 3UWUA 4DB7A 1C3FA 5FJPA 4NG3A 1KGUA 1UR2A 4FIQA 2NV9A 4LF1A 3ABSA 1PKNA 1UWRA 2QT3A 5HK4A 2V6AA 4C65A 1IR2A 4CVWA 4L6OA 4WHBA 4YTUA 1FH8A 5M2FX 3BL3A 2R1LA 2Y8VA 2DVTA 2VKZG 1IZKA 1Q6OA 3EPOA 1VLIA 3MUIA 3T81A 4K39A 4S38A 1E5JA 3EAUA 4QAIA 4K8GA 3M9YA 3AWOA 1P6WA 3O0FA 4DN1A 3KBMA 4BWLA 4Z0SA 3ABZA 3BTNA 1K8YA 3MWCA 4YNGA 4H6QA 2OLAA 2PWDA 1ZJHA 1RCQA 2W79A 1MNSA 5F7UA 4ONVA 2O9RA 3XINA 4O0QA 1RQEA 4NU7A 3WH6A 3PANA 1K8CA 1J4EA 1IEVA 1ZTVA 2WK2A 1X39A 4D1JA 5HULA 1O7AA 4HK5A 5LGZA 5TD4A 4PL2A 3DYMA 1K8ZA 1CENA 4TXEA 3UT0A 5LHFA 3EX1A 4PCPA 1Z9AA 3EB4A 3D0CA 5CZJA 2MANA 2BWGA 4NAFA 1LWIA 2C0HA 3W7DA 4E5TA 3EX2A 3FY1A 4BEUA 1MFUA 3FSUA 1UKOA 3MMUA 1GWJA 3U2ZA 2VEGA 3PZMA 3I7SA 4O0KA 3TA6A 1H5YA 3BAKA 4CVUA 3QZAA 5CPLA 2BBFA 4AEEA 4ZO9A 2POZA 1N8IA 4WKHA 2CZEA 1XPGA 4TTGA 3W1TA 5AYBA 3E02A 5HINA 1GYMA 1X1ZA 2QDHA 4XIAA 1KC7A 4YYFA 1WAWA 3MSDA 1M68A 3DKLA 2RHGA 3OEXA 1UWIA 1E56A 2IXUA 1XHGA 5F1VA 1ODZA 4H6RA 1VLWA 3IIPA 5KSWA 4UOQA 5HOSA 3LPPA 1M7JA 1TWDA 2PWGA 1PZ0A 3NPUA 1ZGDA 2XZ9A 1S38A 1Z44A 3NYDA 1W2VA 3G6MA 1GOWA 3K4DA 4HU3A 3NEVA 4IG2A 4TO8A 1R3SA 3SB0A 4Z17A 4J27A 1GHRA 3TOYA 4E3VA 2UY5A 3WH5A 2XSBA 4JX6A 3GDLA 1ZALA 3BCDA 2DPEA 4XD5A 1P6BA 2CESA 4YHEA 2V3EA 3SEPA 4Q8NA 1GEQA 2HPMA 1EO5A 1J93A 4JHZA 4BHYA 3W1MA 1DIKA 3CBWA 3MPGA 1F3XA 3QEZA 1IXNA 2V5DA 2NV2A 4F3HA 4PYSA 4N6EA 3G0XA 2D3LA 2GK1B 4RX0A 5C2GA 3W70A 2O4QA 2JALA 1V02E 2PODA 4ZL1A 3K13A 1YTDA 3GTXA 4IQLA 2E9LA 1WKEA 3TZNA 1VIWA 3QJAA 1XYBA 3AHYA 4DX3A 2V9DA 4HIBA 1KBJA 1T0OA 4S3AA 4NZ5A 3GTFA 1J0IA 1EP2A 4UNLA 5HPCA 1XG4A 5CLTA 5A94A 2QCFA 4IPPA 4DY1A 2G3MA 3G22A 1EP3A 1S3HA 1XS2A 2O4MA 1TZZA 5REQB 2OZ3A 1GONA 3FX4A 4I3GA 4A3YA 5A6LA 4GUGA 3QZEA 1J2BA 2HRWA 1QPNA 3B4YA 3CLMA 5FSEC 1JF5A 1W9BM 2PLCA 3ZWSA 1VPXA 2X1TA 3HFYA 4MLRA 3ITYA 1DPMA 3NQMA 4UB9A 1M5WA 3IUDA 3ECQA 3UWWA 3R13A 2YX0A 2H90A 2BLEA 2GLKA 3MYPA 1EJWC 4S3EA 2I16A 2OU4A 1ONEA 4IIDA 1TFVA 1UZHA 4QM1A 3MMDA 3B8SA 4AZCA 2DORA 4A21A 3IJ6A 4B16A 3SN4A 3URNA 3VNIA 3EX4A 1I1WA 2WM1A 4HQVA 5A5WA 2C15A 3KOXA 3FJLA 4DJFC 1XD1A 4JTDA 2VFIA 2DT3A 4R33A 5J8LA 1EX5A 4QDPA 3FJNA 5DFAA 3W2JA 1I75A 2WVVB 4BFAA 4RDVA 3THCA 2WO5A 3ONBA 1JPKA 2WJDA 2WPGA 5HMFA 5HUPA 1CXHA 1QFEA 3KTSA 3KBJA 1QK2A 1KXHA 3NQ2A 1AZ1A 3UZXA 4ZXLA 5D2XA 1U5HA 3G2GA 3VE9A 1OX4A 3COTA 5CJ5A 3BCJA 5LNVA 4QJ4B 1K9TA 4PMVA 4AFYA 4ZB0A 4G7EA 4CQAA 1CX9A 3B8UA 2FQIA 4FXJA 1DJWA 4G9PA 2ZUMA 1EC8A 1SVDA 1H0IA 2A3CA 3BK0A 2G0WA 1UKTA 4GZ7A 3INPA 1E43A 3WDRA 4B2DD 1J6OA 3M46A 2C6QA 3EWXA 3BLLA 3LI0A 1EPXA 4I9MA 4LYKA 3M6DA 3QZ6A 1O5RA 2PBGA 5M5DA 3H4XA 1PIIA 3N4AA 4IP4A 5FI8A 5FEPA 5HJXA 4QE1A 1PCWA 3ARVA 1OGSA 1PTAA 1ISXA 4HNVA 2IQTA 3M0YA 3W85A 2DZXA 4REQB 3NOYA 1E72M 1CLVA 3GK0A 3SRFA 4GBUA 2Y4SA 4LQ1A 2VGFA 5H2ZA 3PM6A 3VUSA 1KM0A 1AW5A 4IMEA 3H26A 3BAJA 1XDLA 2V82A 2HDJA 4FO4A 4DZ5A 1EDGA 3C0QA 3N29A 2PLMA 1YRRA 3D6NA 5XINA 1YX1A 3PUGA 3GXFA 4ROPA 2QMJA 2FHBA 3QY7A 4JYEA 3R79A 4ZQRA 3VIFA 5LHEA 1VJIA 4GC4A 5CC6A 3GH7A 3C61A 1ZJBA 4IL0A 3LLXA 3VGGA 4KH2A 3S1GA 2E8YA 1C8VA 3AOFA 3WBAA 3MUCA 5RUBA 3D47A 1SJCA 5ABTA 5C7VA 3OLDA 3O0KA 2VD9A 3BAIA 3WQ4A 1DVJA 3GFYA 1JQVA 2PF0A 1RCXB 4HNUA 1IGWA 1WYIA 3B0UX 2WLZA 4I5XA 4XZWA 1G4SA 1JUEA 4W8BA 4ZGYA 2QCCA 5CPNA 1NEYA 2C16A 1FXQA 4V15A 4LF2A 3G1VA 5DCEA 1FCUA 4JTEA 3L4YA 2V5CA 1V02A 4DLFA 4UTLA 3WUEA 2B31A 2X0YA 3SGZA 1UASA 5D8ZA 1PBGA 1QTWA 4UUIA 3IAPA 5HMDA 1J79A 1F3EA 3UR7A 3I3BA 3PY2A 4UCFA 1GG0A 3VNYA 4YCOA 4S23A 3ABQA 3CT2A 3DHFA 3B06A 4KGLA 2DEPA 3LS9A 1ONWA 2XYLA 2OQYA 1Q8JA 4P7NA 3IACA 2A3AA 2OELA 4WKFA 2VCCA 3NZRA 2YYUA 3U57A 3B0XA 2WSYA 1B0IA 3R10A 1EYWA 2QJGA 1PSCA 4OU1A 4W89A 1S2WA 2I1OA 3C2FA 4DYKA 3CK5A 5BWFA 2VXNA 1PB0A 4CCCA 2XH4A 3VOJA 1ZNNA 1SSGA 4EPBC 1Z41A 4QEHA 2BXZA 4M56A 3BG5A 1HN1A 3I6EA 3SN0A 2VR5A 5I3DA 1PVNA 3S4TA 1DHPA 1HW6A 3RGTA 1OG0A 1KR0A 4LBUA 2QXWA 2Z2BA 1D8CA 3QPEA 2ABBA 1VHNA 3KL5A 4EIVA 4UFIA 2Z25A 1WCGA 2EJ1A 3L4ZA 5IDZA 4D6DA 5M3WA 5FEXA 1FOBA 3ZMRA 4NYUA 2PSNA 3BW2A 2OVLA 2ZX6A 1LOLA 2VC6A 4XSLA 3T0TA 3U6WA 3VOIA 5MKGA 2XGBA 4ZQCA 4X22A 3AWNA 5FF2A 4A05A 3GIQA 3MSGA 3MUZ1 3UPMA 1FVPA 4ZSUA 1KM4A 3MBFA 5KZEA 1LUCA 3EDEA 4LVBA 1Y5WA 1S1RA 4CQBA 3CIVA 1CB2A 2VC7A 9XIMA 2RJHA 4KT2A 4LRSA 1TKKA 1Z6KA 3RHGA 4K68A 3QPYA 1KFJA 1LROA 3W88A 3DENA 3UWQA 3W1PA 1JCXA 5CGQA 4LW7A 3I6TA 4AHOA 2F38A 5D05A 2VTFA 4AZ5A 5EFFA 4IUOA 4ZE4A 1JIBA 2NX9A 3T0DA 5AHIA 2OB3A 2VFFA 2O7QA 1JYXA 3SECA 4HP5A 1DTUA 3GNRA 1A5SA 3ZT7A 1M1BA 2BXYA 3PG9A 4GVHA 1UD2A 5CGTA 1O95A 4GO8A 4CUCA 2VGGA 5HNRA 2OGJA 4KCVA 4MJZA 3ARUA 3W7QA 4N9DA 4OBTA 1L6YA 5F4XA 2A4AA 3FSTA 1UBPC 2NLIA 4J35A 1HKIA 1YE4A 4UFLA 4MYXA 4FX8A 2PDYA 1W3NA 4FZIA 1G4EA 2ZTJA 3EX6A 5CXPA 2C3ZA 4CNNA 1UH3A 3QMSA 5GPRA 3WF4A 1J0HA 1XYAA 4MY1A 1G01A 1MEWA 1H7PA 3IIZA 2J47A 2ZWZA 3BW4A 1K4GA 4AHPA 4WR3A 1RBAA 3AHVA 3WQWA 3MZ2A 3LV5A 3BPWA 4B90A 3WH8A 3MUAA 1PWMA 3I10A 3TC7A 4A22A 1NQKA 1TJRA 1GJWA 3DDMA 2VGBA 3OG2A 3W26A 2HISA 5G2WA 2RDUA 4QE5A 4IJBA 2BS9A 4O18A 4GIAA 2DDXA 3WD0A 3CAKA 1LG1A 3PWIA 1TVPA 1R9XA 1MUMA 2UZ9A 3RM8A 4H7ZA 4GHRA 1RZMA 4F2TA 2OWXA 1HKKA 1Q63A 4OECA 5H8PA 4LUTA 2D23A 5CG0A 3NEHA 3AS1A 4GISA 2VZOA 4Q8PA 4NXKA 3N9SA 1P7TB 4IFKB 5DCDA 4BJHA 5LNWA 1DE5A 1UW9A 2DW7A 1W3TA 2J4GA 3L4XA 2Q8ZA 1XIMA 1ESWA 1Q6RA 3CQHA 3EOLA 3WCZA 5CSUA 1BPLB 4LAMA 4AC7C 4B3ZA 3CXOA 4HNCA 3KW3A 2ZC1A 1G1YA 2J6VA 4C6MA 1GOKA 1RK5A 4RNFA 2VEKA 3WK3A 1S5MA 3UZWA 2AQWA 3SCRA 5BCAA 3ES8A 3P60A 3PG8A 3W82A 1BGGA 2YXXA 3WQEA 5JXQA 4UBPC 5CSRA 2R91A 1VFOA 3ARSA 2J27A 3FN9A 4OQVA 1EP1A 4H2CA 5D2WA 1GUVA 4CNSA 4IHCA 1BGAA 4G8TA 4J9JA 1GW1A 1Q6CA 4XO7A 1JCTA 4JCLA 3WDQA 1YQ2A 1EUNA 3IJDA 1Y65A 3VKDA 3WDHA 2ACRA 4KEVA 4ZA0A 3L5MA 4OTKA 1A5OC 3EOOA 3DI1A 1NWRA 3G1AA 3K46A 3KVJA 3RK8A 2WSPA 4N02A 4PCNA 3RO8A 4QRNA 3QGVA 3FDGA 2KX9A 3N18A 3CV2A 1GVQA 3STPA 4M6UA 1DJHA 1RVGA 5BWAA 1NARA 2AGKA 1UYQA 2XN0A 1FWSA 4IL2A 4UXDA 4E0CA 5JH1A 3BLOA 4WDUA 1VGAA 4RV3A 1IV8A 3WQCA 4C6JA 2QCEA 3VCRA 3FXYA 4ZFCA 4QXIA 1B3YA 4ATWA 4UMBA 3PF3A 1HFBA 1EFZA 3E49A 1TCMA 3A4AA 4OBSA 7A3HA 2A2IA 4V2XA 5T8GA 1UP0A 3O6CA 1XH2A 1LTDA 5FAJA 1EHAA 1EWEA 4M7SA 2PWUA 4TMBA 3B8IA 2ISVA 2QPUA 3W2LA 1HQTA 3V16A 3VMOA 1MVYA 4PUNA 3A22A 3LCGA 2E6AA 2I57A 2Y5JA 1CNVA 2UY3A 3PFRA 3QC0A 2DSKA 4DO4A 3TC3A 2HS8A 4FLQA 1XRVA 4GYJA 2CBUA 3L0NA 1W1IE 2DSZA 3ERPA 3KBWA 2CHOA 2X1RA 1D3GA 4MDOA 4GJ1A 1WB0A 3T55A 2VRQA 3TR2A 3ZLHA 2QDGA 4TR9A 4GWEA 5AHEA 3ABXA 2GYIA 5D04C 1I4NA 4JIQA 1DL3A 4DF0A 3AUJA 1XFBA 4UOZA 1T96A 2WW5A 1MXGA 2WHJA 4FS9A 3AAMA 2DZTA 1GQNA 3THDA 3L2MA 2PDQA 2ZDRA 2GDUA 2NXHA 4XIMA 4D9PA 1XDMA 4ILSA 3IVTA 1R5YA 1AMYA 5IXEA 2QJHA 1ZHAA 4UTTA 2XIOA 3W2MA 3EB3A 3BSGA 2EG8A 3CUHA 1A5UA 3QV6A 1FWWA 1ME7A 1IIGA 1C7TA 3E96A 4IWWA 4W7VA 2DZUA 4JKKA 1BTMA 2ZE0A 3M5VA 4HJFA 3U2OA 4LH8A 3C6CA 5CG7A 2J7GA 4AMCA 1JXJA 4G2DA 5SWUA 1JGIA 2Q8XA 1UJPA 1ZL1A 3ATYA 1VEPA 2OQHA 1N2VA 1OX4B 2AQOA 2BY2A 1THFD 4Y9NA 1HTIA 3PAOA 2XINA 2VM8A 1OC6A 1KM5A 3TQPA 1EL3A 1BAGA 4AZ7A 4GQ0A 1DYSA 3IVSA 4H41A 1E6NA 3UXKA 5GJPA 2J24A 1SMDA 4QG6A 1OEPA 2WBGA 2NQ5A 4JEQA 1ZCCA 4HNOA 5T91A 3DG6A 2E6FA 3ZR4A 4FNQA 4MNKA 1BYCA 2ZOXA 5KTLA 3GXTA 5D33A 3P6LA 2HNHA 3GDRA 4LVGA 4XBSA 4QJ3B 2HE5A 3PZVA 2NX3A 2TRSA 5EA9A 3N2BA 3OLIA 1ISWA 1MEIA 2Q6ZA 4H9ZA 1N82A 1XV8A 3W29A 2WBKA 4HHPA 3R11A 1O12A 1QNPA 3H2FA 2GJPA 3CTTA 3W7CA 2GVEA 5T9BG 4XKMA 1NF0A 3W7HA 1VFSA 4C6BA 3LXCA 1LL4A 2OTDA 1G67A 1ADSA 5LXEA 3S1WA 1ELSA 4IJRA 3SUSA 4K1WA 1W6TA 1VPYA 3LGDA 4GI9A 3F4DA 5A6KA 2BV9A 4Q4MA 4RZ5A 2QHAA 3FJ4A 2F2KA 3CHDA 3WLOA 1RD5A 1QNOA 4MZ8A 1FWJC 3U4FA 4L56A 4O4WA 1HJUA 1YLVA 1BQCA 1R86A 2WWCA 4Y9PA 1Q66A 4FNTA 3VX0A 1UPMB 4Z1DA 3WIJA 3GIPA 1L2UA 4Z2IA 1RPXA 3KLKA 4QJ5B 3APGA 3DHPA 1JZ3A 5CJMA 3ABRA 2PBOA 3NTYA 3OYXA 1KCZA 3DESA 2YL6A 4JDYA 3V5CA 5IFPA 1HNYA 1QW7A 1KCXA 4YWSA 4HPXA 3GG7A 3H7RA 3IJ8A 1L6SA 3ZJ6A 1TJ0A 4XZLX 1M7PA 4IPLA 4N7QA 4AVOA 4K7VA 3CAQA 1UA7A 3S9IA 4KEUA 3IV3A 2PDMA 2J79A 3AIWA 3BO9A 3GSMA 4GPNA 3B0YA 3A23A 1UKSA 3WQFA 4GMEA 3U5YA 3ZSTA 4I9JA 3T40A 3VK5A 3TOPA 4HCHA 2XM2A 3EOUA 1TMQA 2YPIA 3OBEA 3G6LA 5FL0A 4PUDA 4PUKA 4RDZA 1ZRQA 1SFJA 3LCFA 3QVQA 4D8AA 3LQLA 1VHCA 3EBVA 3S5ZA 3G1DA 1R3WA 2D2HA 3SADA 4JTQA 3H53A 3Q45A 3MJYA 4IMAA 4HU8A 3N2TA 2X40A 1W3KA 1JGMA 5A69A 1SJAA 2JGQA 1SJBA 4RXGA 2QR6A 2FIQA 4V1XA 4LUIA 4MKNA 3I7RA 4OKDA 3GR4A 1TV3A 1FHVA 3C56A 4MGGA 2FGZA 2ICSA 4H19A 1BYDA 4DJFD 1JR1A 1A5LC 2X42A 3VAVA 4JS3A 2V68A 2I9UA 4OWGA 1K03A 2QPSA 3BLDA 1Q8AA 4H01A 4L65A 4HA3A 2YA1A 4IMCA 4MWAA 2ALDA 4B4FA 4GI6A 3VIGA 3E74A 2XSAA 2R1NA 3EXTA 3JR2A 2DGAA 3TC6A 2AAMA 1ISVA 3TU9A 2XH7A 2ON3A 1JZ5A 5MKGB 5BMXA 2PMQA 1KXQA 2ZA2A 4E2OA 3MW7A 4LU0A 2BG5A 2OSWA 5HWNA 1XQLA 3C0SA 4KWOA 1YPFA 1E0WA 4M7TA 1UUQA 1HL8A 4Q6XA 3UWVA 4N9CA 4G1NA 2A21A 3MV01 4RZ6A 3SCUA 1HJWA 4LUSA 4U31A 4C60A 2E1WA 2XGIA 2YB4A 5E0CA 1H7OA 2P3EA 4J3UA 1JDCA 1CXEA 4U33A 3LM7A 2Y7EA 1BWKA 2G95A 2HBVA 5HMEA 1O5QA 2H3DA 2Z28A 4D8LA 3WYZA 1B3VA 1FWAC 3BZGA 4HYWA 3DXIA 3WFLA 4GVGA 4GK8A 2XIMA 1QOXA 4S3BA 1Q6LA 1GK8A 4N0RA 3WQ8A 2D2GA 2YYTA 3W53A 2IPWA 1K4HA 2F7FA 2JEQA 1FCBA 1V4YA 2ZVRA 4CQCA 2AMGA 3WFAA 3B9OA 3K30A 1PKLA 1PCKA 1W8SA 4QQUA 1EGZA 3KX6A 1S5WA 1P0DA 4IFOA 1Q7MA 3S9ZA 2CLHA 2GJLA 3R5EA 1V03A 3P74A 4I6KA 3TTSA 2PDLA 4HSHA 1E1CA 4H83A 3MMTA 5KZ6A 4Q4RA 1WZAA 1SZFA 1IZCA 2WAGA 1E4LA 3MI3A 2OG9A 1K02A 1G94A 4W4QA 1NQ6A 4M29A 1XBYA 2XGZA 4XKYA 2PPGA 2FTWA 4HOWA 2QV4A 3BDKA 1BTCA 4PN2A 1OC7A 4FNPA 1U83A 1WDSA 2EHHA 3WLNA 4V28A 4IGNA 1G6CA 2VVNA 3AU6A 1RJRA 4QFUA 1WUEA 1WZMA 2ZRXA 3BANA 1NWUA 2FFCA 2Q8LA 3UPBA 4JY9A 3F4WA 3QV9A 3WFZA 1SO6A 1FCQA 4JTIA 4C6NA 2PCEA 3HV9A 3NZGA 2FFIA 1GVYA 4Q7BA 5LNRA 4R7WA 3TVAA 2GGIA 3A24A 3PJXA 2EAWA 3P93A 3LZ3A 4WY0B 3BC9A 1JUKA 3KTCA 5CC3A 4OUEA 2DT1A 1DJZA 1FWTA 2WJFA 1GG1A 1HL2A 2Z1WA 3AICA 1J6PA 3SW6A 2ZRZA 4I7VA 3W1LA 1TRDA 2INZA 2OEJA 3PZTA 4MJMA 1XLIA 3UR5A 3JVAA 5A1AA 6A3HA 3MA8A 2FDMA 2PE4A 2RDWA 4P2VA 3AMGA 2BY0A 1GKPA 1X97A 1VENA 1OFDA 1ZLPA 4IMGA 4PCSA 1WP6A 1F05A 2X0SA 3VDGA 3IJLA 5KINA 3C3NA 2A7NA 3MANA 4KETA 3CGTA 4GNKB 4IFRA 4OJYA 3UGVA 2UV8G 3NO3A 3G1RA 5C9ZA 4UTIA 5D03A 3RR1A 3PULA 5B7ZA 2WSKA 1A5AA 4W84A 1RR2A 2CIPA 2R1KA 4Z1BA 2R8WA 4I8DA 1S2AA 3VIIA 5A6AA 3TMLA 2E68A 1OFRA 3BLFA 1DWFM 3P0WA 4GX8A 1FWFC 5A2CA 2ANUA 1V0MA 3WEMA 4B91A 3LG3A 5AC6A 1YKWA 1VZWA 1NDVA 4CEUC 4DZHA 2J9YA 3B9NA 1OGBA 3N2OA 1FWIC 5EMMA 4B2DA 3V3WA 3W2KA 1ZBKA 3DKJA 4UQDA 2GFTA 1WZKA 5IDIA 3WQPA 1X38A 4FOUA 4C5YA 2PU0A 4GCAA 2AKMA 2PDXA 3PN8A 1HIZA 2BX7A 1HKJA 3IJQA 5F2LA 3SQSA 1HF6A 2OR2A 4P7RA 1O1HA 5FF3A 3UJSA 3B8VA 1MI3A 2JKAA 4RW3A 1XBXA 5EB8A 2XFFA 1QI3A 4IM4A 3SRKA 3F1QA 3PSWA 4BQ2A 1JNEA 1V79A 4UWMA 1XLEA 2FB3A 4L4LA 4PH6A 3H2EA 2CERA 5DLCA 4L9ZA 5I79A 3Q2DA 1A0DA 4KEZA 1SW3A 4DXVA 4FOKA 1JAEA 4UNKA 2AL1A 1KA9F 2ZRVA 1W5QA 4WY0F 2YL5A 4H9VA 2EF9A 2OZ0A 3APYA 1W3HA 1N55A 3STFA 2CHRA 2NUYA 3GC5A 4HZ8A 1QW9A 4X2RA 2DFAA 4KS0A 3QC3A 4WOZA 5AHMA 2J7DA 3G8RA 3FYYA 1XIJA 3NM3A 1W91A 5G4HC 2Z26A 5E1QA 1MXDA 4ZQPA 4Q8WA 4H9XA 4RDYA 3GG1A 3ISIX 3PZOA 4KKXA 1CDGA 4FX6M 3DHUA 4DO7A 2VZSA 1TV7A 2IPJA 4FI4A 3WLMA 3OGVA 3DOPA 5M17A 2OYKA 2IQ0A 3DFOA 1J0JA 5TIMA 5GJNA 4MSSA 5CPSA 3QXBA 3Q94A 5B80A 4Q4KA 2C0AA 3EXRA 2G5WA 2PGFA 3OLEA 4FEZA 3OQEA 1W3LA 1OK4A 4AX6A 1JFXA 4AF0B 9RUBA 4A2RA 2GK1A 4LBSA 1FP8A 4HOXA 1XR2A 2G4JA 3N6QA 3TYCA 4LYRA 3CH0A 3S5OA 2ZDSA 3AXMA 4MY8A 5JBEA 1R2RA 3R0UA 4DI8A 4BS0A 5F2MA 1EBHA 1VCGA 5A6BD 1E4NA 1E6RA 1UWQA 1GZ1A 3AYRA 3POCA 1QHZA 3G1HA 4NNCA 2WVUA 5G1MA 4AD3A 1HZYA 4GG9A 4DUWA 2GQ8A 7ENLA 1B3WA 3T9PA 5KMYA 4WX2A 3V75A 4DO6A 2ZXQA 2J78A 4I9AA 5HBFA 1J10A 3AISA 4UFMA 2YDQA 4WY0A 4TX6A 1A3XA 2X7VA 3KDNA 3TN3A 3MKCA 1YBQA 2OO0A 1JRBA 5ENLA 4PGLA 1YXCA 3S2CA 2YW4A 3KVKA 4PSPA 3GG8A 4MWAC 3B9DA 2V2DA 3AJXA 5DRCA 2OSYA 3DH7A 3ABOA 3LDVA 2W91A 1C8QA 4R88A 1QASA 4FLRA 1SSDA 1BSLA 3BJSA 3N14A 5HQMA 3VD7A 2IS7A 5HXMA 3ES7A 3M4HA 4NT0A 4WCJA 4IP7A 3QR0A 4M1RA 2WC3A 3NCOA 3QRHA 3WMLA 2G41A 3LV6A 2Z4GA 3EDDA 4DJDA 3H7VA 3C2YA 3TCSA 2XWDA 4L80A 4W88A 1UD3A 2I5IA 1K8XA 2PDPA 2ONEA 4R27A 1I1XA 5HWMA 3OPSA 4XAYA 1W1A1 1XICA 1AG1O 4ZR8A 3TYUA 4A3QA 2VEIA 3TSDA 4O52A 4C6PA 3PS7A 1VPQA 1E0UA 4BKNA 3GDTA 2OPJA 3W02A 5ABFB 2BNJA 4Z42C 3N25A 5K4XA 3H2OA 3TN6A 5IHRA 2G3NA 4K6AA 4GXMA 2DIEA 4K1GA 1F8IA 3LN3A 3T42A 3WQ6A 3UA4A 3M5XA 3DFPA 5ECVA 1TQXA 2X30A 3CAVA 3FDKA 3UR8A 4EPEC 4IIHA 2PAJA 2PLJA 2XJ7A 3BE7A 4ASTA 4C5ZA 3KP1A 2AKZA 2FZBA 3QR3A 2GL5A 1GJUA 1WXZA 3GNPA 1O1ZA 3FJ6A 1QJWA 1ZY9A 3BWWA 3K1GA 2Q3OA 5FEZA 1XISA 1TTPA 1BWLA 1H61A 3J7HA 3EEGA 3TEVA 2BOEX 4YTRA 1GT8A 1Z48A 2D0GA 3OO2A 1B9BA 3N1AA 1V6WA 4TQTA 4DHGA 2H9AA 1LDCA 1W54A 4BK9A 1KRBC 1AW2A 3NURA 3U7BA 2VUNA 1RALA 1QBAA 1J11A 4J5NA 3D3FA 3BARA 1RSCA 1OG6A 4AYGA 2DV0A 1KWKA 1GVSA 3H23A 3VGEA 4JOMA 5JIWA 5U4NA 2ESCA 5CPMA 2GUBA 4O10A 3O06A 3NZQA 3ARTA 1D2KA 3LLFA 5J5RA 1EPVA 4ZOAA 5FF4A 3FYPA 1FWNA 2D73A 5I7GA 4MVAA 4DBDA 3PTKA 3QLDA 5LGXA 4NSBA 3GC4A 4FF5A 3W6YA 3W7EA 3ITCA 3WK0A 1TPVA 2DVUA 4D6CA 2Z7GA 1P4CA 2ZA3A 3ZR6A 5C0QA 2GSEA 1HXJA 2BMBA 4IXXA 1US0A 2QW5A 5E6ZA 4KEMA 2PGWA 2CKSA 4GQBA 1PE1A 3G0SA 5IFTA 2HSAA 3WBEA 2PA6A 2PP0A 4JTTA 2YZRA 1E1EA 3LCXA 2NVAA 3C0LA 2FKPA 3T0AA 4Q32A 4OVXA 4L1GA 1D8WA 1M7XA 4LCQA 2DH3A 4MPQA 3RXZA 4MWAE 1H1NA 1SMAA 2QJIA 3D46A 1WE5A 5LZLA 1XUZA 3GZ3A 1W9UA 1GOQA 1O4UA 1CLXA 1ME8A 3KCOA 3TW6A 3ID7A 4U3AA 3VTRA 1YE6A 3TN4A 1S5TA 2HPIA 3MSYA 1DJXA 5HDRA 1S3TC 1X7IA 4JIRA 1M01A 3ELFA 5D37A 3VNLA 1WQ5A 2FPVA 4ADSA 1GZGA 1DQXA 1HGYA 1CCWB 1RV8A 2VC9A 3HO8A 2VZTA 4PL1A 1DQWA 4P61A 5BZAA 3EKLA 1JZ6A 1EO7A 1J9YA 1ZBCA 3TW7A 1V3HA 2RAGA 3NGJA 2ZYFA 2QKFA 5CPTA 3WY1A 4FK9A 5D09A 1BYAA 5EL1A 3TXVA 1HKMA 3WQGA 1A4MA 1MRQA 1F73A 3CHFA 3NIYA 3MS8A 5JU6A 2CW6A 3QMRA 3AFBA 4IMFA 3O6DA 3C2OA 3CB8A 3NUKA 3TQKA 4IP5A 1P48A 3A5VA 4IPIA 3EXSA 2AOSA 2PDCA 3QMTA 3LB0A 2J8FA 3GWQA 3VZYA 3A4WA 2PUZA 3BLPX 1GVEA 5K3VA 1RCOB 1VAHA 2ZX8A 2BHUA 4J7RA 4A29A 4R85A 2E6YA 4XBKA 3PBUA 1P0KA 3A9BA 3WL1A 3R58A 3R0DA 1U30A 1U2YA 5AN7A 1O5XA 4P8VA 5MHBA 4DUXA 2DIJA 1WOBA 4J40A 4AZHA 1L9WA 3JUGA 3V0UA 1OD0A 4RV8A 3IIXA 1O5KA 4MFDA 1XWYA 4IICA 3T05A 2DQXA 4P5UA 4PTWA 4Y96A 1LF1A 4I5UA 1H60A 1XRTA 4O17A 3RILA 2WXDM 5JQ9A 4JXCA 3TIMA 3E1F1 3EZ4A 3G3DA 4QISA 3LCLA 4YTSA 3CT7A 2DVXA 2D0FA 3HTWA 1EJSC 4NASA 2FZNA 3LEPA 1MQRA 1ZQ5A 1UR9A 4ZB2A 4X2PA 3GUGA 1GQJA 3BLEA 4QIUA 4M24A 3Q65A 4HU4A 1E3XA 2YR1A 1E9ZB 4PRWA 5FD0A 4ZSTA 4BI7A 8XIAA 1IYXA 1KTCA 4O0ZA 5L9FA 4DWSA 1CIUA 4GVFA 3LENA 2ZICA 2ZZ5A 3TJIA 2ISWA 3CPRA 1I8JA 4PSRA 2NQZA 2H9AB 3VNDA 4HTBA 4C6KA 1EA0A 3W1UA 3DCPA 1T6MA 3SM0A 4CD7A 4NVTA 2EGZA 1NOFA 3WO8A 3BAXA 3KZPA 3WNKA 3H2NA 4AWTA 1DWGM 1Q13A 1Y8BA 5I3IA 4H4IA 1VFFA 2OX1A 4JYFA 4JTCA 1F74A 1W31A 1OCQA 4X0NA 2WMKA 1TQJA 1W1TA 2FMOA 1H3GA 1A5NC 3RPMA 3NNTA 4S3DA 4BZYA 3HG3A 2AQVA 1GHSA 3LX9A 3HG2A 2F2HA 2EBNA 2WNWA 3PUDA 3UCDA 2P0OA 3MMWA 2VFGA 3HG4A 5D2TA 1JI1A 3NQ7A 1FP9A 2VOMA 1K7EA 5AYYA 3KBSA 3KUMA 4CNTA 3POHA 1CPUA 4HT3A 1R9ZA 1P1XA 3NYZA 1Z69A 3IK2A 4NP7A 4WF7A 1OX6A 2VO5A 5I77A 4NZFA 3GVVA 1OFEA 3ITXA 5BOOA 1XW8A 2PTXA 5H1WA 3IPW