1EL3A

Human aldose reductase complexed with idd384 inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title The structure of human aldose reductase bound to the inhibitor IDD384.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1el3A00
4GACA 1RY0A 4NKCA 1ADSA 4FA3A 2FZ9A 2PDXA 4F40A 4YS1A 2PDCA 5AZ0A 2DUZA 3UG8A 2HE5A 4LBRA 1HW6A 1RALA 1Z9AA 3GHUA 3LEPA 3UP8A 1EXBA 2A79A 2ACQA 1S2CA 3UZWA 1MRQA 3GHSA 2R24A 2PDIA 4FALA 3WCZA 2PD9A 3VXGA 1AH3A 4JIIX 3UZZA 3WBXA 2FZ8A 2IPGA 4LBSA 1FRBA 4Q3MA 3UGRA 3RX3A 2HVOA 1X97A 4XZIA 3FX4A 5HNTA 2FVLA 1Z8AA 4FZIA 2I16A 4LB4A 3EB4A 4IJRA 3LENA 3MC5A 4ASTA 2PDWA 4QBXA 1R38A 1Z3NA 3T42A 3BCJA 4XZNX 3UYIA 4L1WA 4DBWA 1UR3M 4JTAA 3H7UA 2I17A 1HQTA 4IGSA 4OTKA 1ZSXA 2PDKA 2ACUA 1ZQ5A 4XZHA 4HMNA 2PDQA 1AFSA 3M4HA 2PD5A 3LQLA 4H8NA 4ZFCA 3H7RA 1PZ1A 4JQ3A 2IQ0A 4PR4A 1QWKA 2DV0A 4AUBA 2FZDA 2AGTA 4GABA 2PDYA 1Q5MA 1ZUAX 3LN3A 2F38A 2ISFA 4JQ4A 4PUUA 4L1XA 3D3FA 3CMFA 3CV7A 3U2CA 3S3GA 1OG6A 2CLPA 2PDJA 3Q67A 3V36A 3V0SA 1LQAA 3WBWA 4Q7BA 3LNMA 4WDWA 3V0UA 1X98A 3R6IA 3BV7A 3UZYA 3LBOA 5LIWX 3COTA 1K8CA 3G5EA 3MB9A 1EF3A 2IKJA 3O3RA 2PDMA 4PMJA 4WGHA 1PWMA 3UWEA 4LB3A 4JTDA 5HA7A 1C9WA 3UZXA 4LAUA 3ONCA 5LIXX 1RY8A 2DUXA 4GIEA 3M64A 1YE4A 2PDFA 3ERPA 1PYFA 4XO7A 3V35A 4WDXA 3LQGA 1YE6A 2PDBA 2INEA 2IQDA 4ICCX 2PDNA 1JEZA 3G1RA 4EXBA 2IKGA 2HE8A 2WZTA 3R43A 4GQ0A 1EKOA 3CAQA 1T40A 4XZMX 1VP5A 4YVPA 5LIKX 3CAVA 1X96A 2HDJA 3NTYA 4EXAA 3FJNA 2BGQA 3GUGA 4QX4A 5AZ1A 2PDGA 4JQAA 2PDHA 2PZNA 4JQ1A 3CV6A 4JTRA 3WG6A 4JTQA 3N2TA 3BURA 1PWLA 5JH1A 1S2AA 4LAZA 4DBSA 3RX4A 4G5DA 3LUTA 1AH0A 4YVXA 2IS7A 4JIRA 3R94A 2PF8A 2WZMA 1J96A 1XGDA 4XK2A 5DANA 1XJBA 3R7MA 3Q65A 2PEVA 2FZBA 2P5NA 3P2VA 4WDUA 1US0A 1EL3A 1IHIA 2IPWA 5JH2A 3O0KA 4GQGA 1AH4A 3QKZA 2HEJA 1PZ0A 2J8TA 3LZ5A 2PDLA 3C3UA 1T41A 4WEVX 3GHRA 4GA8A 1S1RA 1AZ2A 1IEIA 2INZA 3DN5A 4MHBA 2ALRA 3R8HA 1MZRA 4GCAA 2IKHA 4XAPA 4PRTA 1MI3A 2C91A 4HBKA 2IPFA 3B3DA 5LIUX 2HVNA 4XZLX 4XO6A 1M9HA 4IJCA 5M2FX 4DZ5A 5C7HA 3H4GA 3N6QA 1XF0A 2PFHA 1YNQA 3LZ3A 4H7CA 4JTCA 2BGSA 2FGBA 3EB3A 1YNPA 3UFYA 1Z89A 2F2KA 4WRHA 4QXIA 1S1PA 3WBYA 1SM9A 2ACRA 3V0TA 2BP1A 2IKIA 2PDUA 5HNUA 4I5XA 2IPJA 3GHTA 3M0IA 4PUWA 3R58A 4JIHA 4WDTA 4R9OA 1QRQA 3KRBA 2PDPA 2ACSA 4FAMA 4RPQA 3LD5A 3DOPA 4XVEA 3EAUA 1AZ1A 2NVCA 1A80A 4XVDA 4QR6A 3F7JA 2QXWA 2R9RA 3RX2A 1VBJA 3ONBA 5KETA 2HV5A 4YVVA 4PRRA 5LIYX 1ZGDA 2VDGA 4YU1A 4DBUA 1LWIA 2NVDA 4JQ2A 3R8GA 3CASA 1GVEA 1Q13A 3BUVA
chains in the Genus database with same CATH superfamily
4A3RA 4L6HA 4PUEA 2CLIA 5DEZA 3LU2A 1R8LA 2Q02A 3F2CA 3MW7A 5D38A 2Z25A 4HCLA 3OVPA 1WOAA 1RALA 4LBRA 3URQA 4C60A 4S39A 3T0BA 3CEPA 1R30A 3TZNA 1OCBA 3DERA 1JZ5A 2BGNE 1VJIA 2G50A 1WDWA 1J0YA 3MP5A 3W3OA 2POTA 2Z29A 3V1PA 2R1LA 4DAIA 1FHVA 1V6WA 2PGRA 4AZ7A 1J0JA 4PZVA 4JIIX 5A6BA 3U48A 4O57A 1N82A 4PSPA 4W7UA 3M5VA 2Y6ZA 5HR6A 4LRTA 3OVGA 4H9VA 5J04A 2ZZ4A 3ARTA 3VPLA 3WJSA 3B9DA 3M0KA 1DHPA 2WB5A 1QTWA 1TWDA 2YW3A 4IJRA 4NX0A 5CBBA 1EIXA 1LTDA 5H8UA 3HB9A 5C9ZA 3WK2A 2QDDA 2ZX8A 4XZNX 1OM0A 2XSAA 3CYJA 2IXUA 1XSKA 3UY7A 2ZX6A 1FP8A 1MDRA 3PBVA 1FX6A 3EMQA 4JX4A 3W7EA 4RPPA 1L2QA 4OUIA 1QHOA 2CHOA 4OTKA 4GUJA 3OB8A 1EDGA 4XG1A 1NSJA 1I60A 3LRLA 3F1QA 5C7VA 1C91A 4BEQA 1OCJA 4YIWA 1G4SA 3O6AA 5LXEA 3MSDA 4H8NA 3BH4A 2IQ0A 1Q6EA 1IXQA 3ARRA 2WSPA 2WSKA 2O92A 4H4IA 3UCCA 2F38A 2VM8A 2QDHA 1GQNA 4BQ4A 4FNUA 4PTNA 4NJJA 3TFXA 1QPQA 1FHDA 3H12A 3VMNA 4V1XA 1OX4B 2YL6A 1MNZA 4UOJA 2EPKX 3OVQA 4C6LA 5DT5A 5AHEA 3L7RA 4YJ5A 3SIMA 2VCCA 3QFEA 1XI3A 1JZ3A 4Q8NA 1VBRA 4XKMA 1L8NA 3UJSA 3VIOA 2EG8A 2ALDA 4CD5A 2V69A 4PMOA 1D3CA 5D32A 2CLLA 3UPBA 3UXAA 4PFMA 5F4SA 1H3GA 3B8WA 2V9DA 2W66A 4PMJA 4Q8QA 5LNUA 4JY9A 4DF1A 3CUGA 3QV6A 3SGZA 1NH6A 3TXVA 3QM3A 2DSKA 4FK9A 4CQBA 5LIXX 2QCNA 3W0KA 4E2BA 5AY7A 1EJTC 2PI6A 1TZ9A 4GIEA 1S46A 1C8XA 2R1PA 3QKEA 5C2XA 3VIIA 1WPCA 4XO7A 3K8LA 1V03A 2X1TA 4JTJA 1WCGA 3DECA 1P7TA 3MZ2A 2CZEA 3VUSA 1H5YA 3NQ7A 1HTIA 1SW0A 5HJXA 3VIMA 1THFD 5H1WA 2W62A 2VVNA 2D23A 2VP8A 4J3UA 1Q6QA 5M17A 3S2LA 1YDYA 2PP0A 1ZAIA 4WKAA 2ZA2A 2PZNA 4DJDC 3HPXA 3N3MA 1DOSA 1R3VA 1KM0A 3NM1A 4M6QA 3PPGA 4KESA 4L64A 1XLLA 3GXPA 4D6CA 3WF4A 2HQAA 4XTIA 1UKQA 2PGWA 3TTQA 4GIAA 3LSCA 1VEPA 1CXLA 3SUWA 4UMAA 3CIWA 4W87A 1R7AA 3W9ZA 3WEOA 3TNOA 4LEQA 3OZOA 1XH1A 3WBEA 1SUXA 4M19A 3KCLA 4LWWA 1E0VA 3QOKA 3CZ8A 5BOOA 4H9YA 4H7ZA 4NJIA 3NEVA 4WZHA 1ECEA 4ERGA 2V5JA 1IEVA 2P8BA 5FF4A 3BLFA 1B3YA 3DFPA 1H7RA 3EOLA 3OBKA 4P7QA 4RDZA 4B2DD 3GHRA 4W86A 1X38A 1OJXA 1TPWA 3DFQA 1BSLA 1MZRA 1Q6FA 1V08A 7REQB 4G1NA 4GG9A 4FR1A 4PRTA 4JX5A 2C91A 4J4KA 3PNUA 3OGVA 1UIPA 4KKXA 4QGCA 5AHMA 1XQLA 1F3TA 1OZMA 4IJCA 3H4GA 4KFPA 3B04A 1WB0A 2BHYA 3LPFA 1LOQA 4IMCA 5BXTA 2EPNA 2NQJA 3S1GA 3I3EA 1YNQA 1UMLA 3NL3A 3RR1A 2BGSA 1JAEA 3GU2A 1UP0A 1B1YA 4KIEA 3FS2A 2X05A 2V30A 2FFIA 2ISVA 1U1JA 3U5YA 1L6SA 1XRFA 1VYRA 3VOFA 4PTMA 2QAFA 3EWWA 1CWYA 1OK6A 3NOEA 2VC5A 3R58A 2J25A 1EDTA 5C9UA 1NOWA 1KLZA 4TMCA 3LTYA 5K4ZA 5B80A 4HYRA 3EDJA 1RQBA 1AL7A 4RPQA 2QVNA 4O1DA 2WBGA 4LVGA 5GJPA 3C0JA 3NVDA 1ZP3A 3RU8X 3DHDA 4ZOBA 3L5LA 1XUUA 2KZHA 2YA2A 3H2AA 3UGVA 4NAEA 1Q63A 2C1GA 2QUVA 2V67A 1W17A 1PAMA 3RNDA 1AA1B 1H4PA 4CN6A 3VGFA 3I6RA 3SIZA 1XFBA 1ZGDA 5H8PA 2TSYA 4LUSB 4IMEA 4NILA 4C1NA 2DIJA 4IQEA 5M1TA 1JUEA 4H6EA 3LX9A 3N2BA 5CG7A 4GACA 3VNLA 1UHVA 3WLOA 3P93A 2WVVB 4AHOA 1E0UA 1HXJA 2DUZA 2A21A 2HE5A 2J47A 2XG9A 3L0KA 1IXNA 1WQ5A 5CPTA 1JCMP 1KFKA 2EPOA 4RNHA 1GQIA 3HGOA 3W02A 1H49A 2E6YA 5DQPA 2VFIA 3R12A 3GQYA 4PULA 3PPCA 5I07A 4R3UA 1TO3A 2YBUA 5C5YA 1ALDA 2WAGA 3SB0A 3PN8A 2WHMA 4L4OA 2VR4A 3E2RA 4JTKA 2BMBA 4NVTA 1X97A 1UOKA 5JBDA 3ZT6A 2FVLA 1A0DA 2IQTA 3ITLA 1VPYA 3TIMA 1CENA 1F4AA 1LUCA 2CLOA 3TUUA 3VNMA 3GYCA 1ZBKA 4DUVA 3K8KA 3O7UA 4AIUA 1OD0A 1TPUA 3SRFA 3MI6A 1POKA 1B0IA 4F48A 4QP0A 1OGSA 4QNEA 2Q8XA 4JL1A 3FAXA 5IDIA 1XISA 1Q6RA 2QEZA 2WJDA 2WBKA 3H7UA 2BB0A 2I17A 3M5YA 3ARWA 1UZDA 4CD7A 4HNCA 3G1FA 4ADUA 1SFLA 4IGHA 1KFEA 4CEUC 2YCEA 2GUUA 4GE8A 1SO3A 2JKPA 2PWVA 4YL2A 4RJEA 1GEQA 4UNIA 4UR7A 2DH3A 2XH2A 4AVOA 4FIRA 3A4WA 1BQCA 2Z1VA 3BOXA 2DFAA 1Q7QA 4XD5A 2ZC1A 3FDKA 2F9RA 2VO5A 3R13A 4NXKA 3H2MA 4J35A 4C6IA 3CMFA 1XLBA 1KR1A 4MZ1A 4UQDA 1WDRA 3E0IA 3IJ6A 3CUZA 2DJLA 4A3YA 1ZAHA 4MF4A 2BOEX 2W61A 2NQZA 1K7FA 1JL8A 2V0TA 4DRSA 1XIGA 1P0BA 1NQKA 4FI4A 4HK5A 3UD6A 4E2DA 3Q45A 1BXBA 3AICA 1B4KA 2D3NA 3V5OA 3RGTA 2Z6IA 1DKWA 2GGEA 4G7FA 3THAA 1XBZA 3NQFA 1KBBA 3EX6A 3KP1A 2EKGA 4UXDA 4J3SA 4OZOA 4M51A 4U5KA 1SFTA 1E6PA 1IEWA 5DXYA 2CWNA 1IEQA 2X1RA 1D2KA 2J27A 4IPIA 2WM0A 3B0XA 2J9XA 4B5UA 3HFYA 3FXYA 4C90A 1UG6A 3FSUA 3MUCA 2P53A 4URIA 3UG4A 3CQIA 3N73A 2DUAA 3BLIA 1FHLA 2W3ZA 1CXIA 3HGSA 3M64A 2E6FA 2Q09A 1MNSA 1RBLA 3FY1A 5TD4A 4F3HA 1PTGA 1RBAA 3MMTA 3WQDA 2ZYFA 1KM3A 3CT2A 2TAAA 1XLHA 1EKOA 1DIDA 5TAOA 3F2BA 1Z32X 4OBRA 3WFAA 6REQB 5JBFA 3TR9A 4DJEA 4OIFA 1H63A 1KC7A 3W7RA 1SR9A 2X0SA 3FJNA 1M3UA 3AUJA 3CIVA 1MDLA 4IFKA 3NL6A 3PK7A 3DG6A 4LW7A 3RXZA 1E4MM 1W3NA 2HZGA 3W85A 4XTDA 1HN1A 3CQJA 4NU7A 3UJRA 1QK0A 4JTQA 4UNLA 4L6DA 4LAOA 2VGIA 2ZUWA 2DH2A 3CMJA 3W2UA 5J5RA 4WIWA 3SCRA 1EH9A 2IS7A 5E0KA 1PXGA 4ERAA 1EA0A 4BWLC 1MRAA 2VRQA 1Q85A 4WDUA 1IHIA 2V5KA 1EUAA 5FAJA 1GW9A 4PMUA 1R2SA 1E40A 3S9YA 3S2CA 5CAHA 4BI6A 2KX9A 2X0HA 2DVXA 1WUEA 2EEXA 3TTYA 2A3EA 1J93A 2BHUA 3NG3A 4GCXA 3DN5A 3NFUA 4MHBA 4ILSA 5A6AA 4XWUA 3O6DA 1KRMA 2C19A 1EHAA 5AOUA 3C4UA 4JDBA 2VRJA 4ROQA 2YCJA 4HMDA 2OXNA 3VA8A 2IPFA 1P1MA 4JKMA 1K8ZA 5G1TA 5BMXA 3FSTA 4AZHA 3OODA 5LGZA 3BGAA 2DIKA 2Z1SA 1B3XA 3VIPA 4GC4A 1QNOA 1ZRQA 4H7CA 4JTCA 1JZ2A 5CBJA 4Z0JA 3VO0A 5FJRA 1VS1A 2NXHA 1P0EA 3AYSA 5FOOA 3WQ8A 3LOTA 3RMEA 1J0ZA 3T55A 1DE5A 3V0TA 2Z28A 1TV7A 2YLAA 3KOFA 2ZVIA 4DHGA 4PUWA 1A53A 3PBUA 4R9OA 1QI3A 2MNRA 1BLIA 3W82A 3GSMA 4N4PA 5JVLA 2ZXDA 2VFHA 1PPIA 1CLKA 4WF7A 4NL1A 1AZ1A 3EA1A 1AJZA 1OFBA 2FPVA 3NQVA 4HTBA 4W88A 3WEMA 4BY3A 3SUUA 4GZIA 5K3VA 2AAAA 3EWYA 3JUGA 2G97A 4W93A 4IMDA 3QY6A 5G4HC 1DWFM 4TVUA 1A0EA 1TV5A 1XLAA 2J7HA 5C6MA 3VD4A 2OSWA 1T6MA 5A8QA 2D22A 4AIBA 1Z9AA 3FA4A 2QJMA 3T4WA 1X1NA 3H6OA 3QXBA 1QO5A 4H7VA 4AY7A 1GQKA 1XFCA 3WY1A 1PDZA 3CUJA 3HPAA 3UZWA 5EMUA 2YB1A 2P0OA 4YTTA 2VX5A 2ZA1A 1TVPA 4QROA 3TXZA 3ITVA 4ZO6A 5EMJA 4LRSA 3TC6A 3U0HA 3R25A 4B5VA 4ZXLA 1PX3A 3RAOA 5KINA 4G2DA 2Q01A 4XZIA 3G1VA 4XX6A 3L68A 2G3JA 1ZLPA 4HNLA 4Q8MA 4AH7A 1JZ8A 3W28A 4D8ZA 5AECA 2WVTA 1XLJA 3GXDA 4PRWA 4LU0A 4AWUA 3NVTA 4MPQA 4JN6A 4L1WA 2PU0A 4RNFA 4DBWA 3K4AA 4E8GA 4ZZ9A 1MUMA 3WD4A 3HU7A 4UQBA 4V2XA 4NI3A 1KFBA 1JAKA 4RK8A 3QQ0A 3TWAA 4BK9A 1ISXA 1KCXA 6CGTA 4POCA 2YCKX 1G4EA 2Y7GA 1Q6CA 4P8VA 4XAYA 2GGGA 2CKRA 4QNWA 1AFSA 1XYCA 3G0SA 1NF0A 3KTXA 3VGHA 2RDWA 4HA1A 3BJSA 4XAGA 2ZUNA 1KXVA 1OG0A 1P7TB 3TC7A 1H1ZA 4JFTA 3BW2A 3UPWA 3WL0A 5LHEA 1C3FA 2RFGA 2UBPC 1OVDA 3PZ9A 3EX1A 3UR2A 2VTFA 1E4LA 1H7NA 1O1ZA 2R94A 1WYIA 3U2CA 4RE2A 4D9PA 3V0SA 2VWTA 4B9ZA 2X16A 4GY7A 4BF7A 2YFNA 3HQ1A 4FNQA 3V0UA 1S39A 1SJDA 6XIMA 1K70A 1X98A 1A0CA 2A3AA 3OQ8A 5I06A 2I5GA 4YHEA 4S3KA 2NX1A 2YOCA 4LNYA 3W23A 3ME3A 2EHHA 1CXHA 3TOYA 4AISA 5LIWX 1GVSA 4GBUA 1CGWA 2G5WA 4OKDA 3TA9A 4KERA 5T9BG 1JDAA 3S2MA 3N19B 3TTEA 3OOQA 2CKSA 3W1PA 4KGLA 3EDEA 1EQPA 1F05A 1W3KA 5DMNA 5LNWA 3G8EA 4AVNA 1EEPA 2OX4A 2PLKA 1JCXA 4N42A 1ISVA 1TPH1 2FVKA 1FWHC 5B7YA 2ZUUA 1X39A 1AJ0A 4KWSA 1W1YA 2PUZA 3BARA 5ABFA 4Z2GA 4A21A 2OO0A 1XLGA 1MQRA 1HO4A 3UXKA 3O16A 1YXYA 3NDZA 4JFWA 4AZGA 4LT9A 2QJNA 1XYZA 1PTAA 2HDJA 3NTYA 4EXAA 4MNJA 3L4WA 1HF6A 3WLHA 3TLLA 5I00A 4B4FA 2V5LA 1UC5A 2PLCA 4Q6JA 1MUCA 2VEIA 1TWSA 3LG3A 3CWOX 3AU6A 1WOBA 1XDMA 3LTPA 1GG0A 4HHLA 3TH6A 1RK5A 4JTRA 5AKQA 1GK8A 4HNTA 3UBPC 2CBIA 4F79A 1QK2A 1VRXA 2XYLA 3VDAA 3S5SA 3WUFA 4DO5A 1O4UA 3ANUA 2D1ZA 2PF8A 3E3HA 1EC8A 2WZMA 3W1LA 2DIEA 4V1YA 1SPQA 1RLDA 1I6NA 1J4EA 1XGDA 1I4NA 1B3WA 4G9PA 4KBXA 3DFNA 2XVLA 4UTHA 1KQZA 1G4PA 3N4FA 3GS6A 1UWIA 4DF2A 3QOMA 1DIKA 1FKWA 4NAEB 3NURA 4B5XA 4CNSA 4Q8OA 1IXOA 3S46A 3C2OA 4ATLA 5I24A 4K68A 1T41A 3AMGA 4UFJA 3LLFA 3R11A 2WZIA 4JICA 1BWLA 1L6WA 3GG7A 1JF5A 3NL2A 4PMRA 4ADTA 1J01A 4C1NB 1SYTA 3KOWA 4AZ6A 3NDYA 3HN3A 3I3BA 1MYRA 4IMAA 5JBEA 3CBWA 5BNKA 5CEWA 3N34A 3WDRA 3KOZA 1N8FA 3B8IA 4UB9A 1JCLA 2XPKA 4R53A 3STFA 1WDQA 3ZOAA 5REQB 3DAQA 5FEWA 5DY3A 4F9JA 1YYAA 4JIPA 3H4WA 4NZCA 4QDWA 2QMJA 4ERIA 3UFYA 1N2VA 4MWAD 4DWSD 2YBVA 3TAOA 5AC5A 1SM9A 3WLNA 1AQHA 1LG1A 2WPGA 2ZRWA 3BG9A 4GJ1A 2ZWZA 1P6CA 5HNUA 1RK6A 3IV8A 2HNEA 4LFYA 1IR2A 3T09A 1TYGA 4RZ6A 2ONEA 1YTEA 2VWSA 1GOKA 1EUNA 4DNMA 3SDOA 4YCPA 4HSOA 4CD6A 4PBEA 2VC9A 3LHZA 1F3XA 1LRTA 3AFBA 3BK0A 4U5IA 1LUCB 4HA0A 1FP9A 4QAWA 2OU4A 4J3XA 3S1XA 1OEPA 5LYRA 1JUKA 2DT0A 4J2MA 2GZXA 4U2ZA 1P4CA 1QI0A 2ZZ5A 1NOUA 4TV5A 1H51A 1FWDC 3IGUA 1UWRA 1R46A 1QOPA 3PNZA 3TNBA 2ZDRA 3MSYA 1HG3A 2FJUB 1TWIA 4LVBA 4E4UA 2PDCA 3VGEA 1XBVA 3W75A 4NX5A 3N1AA 1H60A 4GVHA 5BU6A 1G0CA 2ZIDA 4JTFA 3ANYA 3EWUA 2VCBA 3DBPA 3IANA 4S3FA 3LM7A 4UNKA 1XYFA 3AS2A 3I7RA 1F73A 3CZEA 4HU4A 4I90A 2HXTA 4UQEA 3W7DA 3GW3A 5C70A 4DY1A 4QE1A 3SBFA 3EKZA 3PZTA 4Y96A 1DWAM 1JCYA 1FRBA 4HTYA 3C3NA 3VIKA 4O18A 5HNTA 1O7AA 1UQYA 4E3TA 3CAWA 1BEUA 2I16A 2WKGA 4LB4A 3REQA 4J3WA 3BSGA 4RV8A 4W9TA 2OGJA 1VFUA 1XX1A 3P62A 3BCJA 5AYYA 1UUMA 1P0KA 4GVGA 3DFYA 3WQ6A 1BYBA 3EX3A 5G2WA 2HBXA 2J7GA 3GG0A 4S3DA 5J5DA 5M3WA 1V7YA 1M04A 3CGTA 3LHVA 4G1KA 4CCCA 4O13A 3PBMA 3PP7A 4Q4RA 4Z2JA 3DHFA 4ZSTA 2DZBA 2QUMA 3B97A 1OSEA 2O4QA 1I1WA 3HPSA 4FIQA 1DXIA 1SMAA 3DGRA 1Y7VA 4DX3A 4JIQA 2QULA 1UBSA 5DCDA 3P80A 3SR7A 3BDKA 1N8IA 1W1TA 5AHNA 5BXRA 1E3XA 2PDYA 4MNMA 2OZ0A 1CXEA 3SM0A 4JNYA 3RN6A 4IFKB 3NZ1A 3MKKA 2DW7A 1HUVA 5HWJA 5RUBA 1DV7A 1W3HA 3UEQA 5IFPA 4BI5A 1JG9A 4JKKA 4U4MA 3B8SA 2VUYA 3FKKA 5LA1A 2PWHA 1OADA 3AS0A 3P5YA 1T8QA 2HJPA 2E5DA 4YYCA 4S3JA 1EYEA 3COTA 4DB7A 2NQ9A 4GI8A 2G4FA 3BMWA 2EJAA 2VDIA 5D04C 3O3RA 1YKWA 5HR7A 1FVPA 2FHFA 1UP2A 2XN2A 3FGCA 3T0CA 4Z17A 4C6EA 1F3WA 3PR2A 4IG2A 1P0DA 1JPIA 5XINA 4M5PA 4MAZA 3FEMA 4ZE5A 4GXPA 1W32A 5A8OA 2YDAA 1E9LA 2OCZA 5F7UA 4QITA 3P7YA 1AODA 1LWJA 3FNDA 3V7PA 2Y4SA 1W5MA 4GQRA 4YTQA 4DUWA 3NQDA 2J13A 4IIHA 2XISA 1E3ZA 3OP2A 3KUMA 3GIYA 4Z1CA 3NGJA 4HNNA 4S3BA 3O6YX 1OF6A 2J75A 3FHQA 2QNEA 3CAQA 1EP1A 1ZJHA 2YZ5A 3L65A 3WH9A 4YVPA 4Q8UA 3F5KA 3WLPA 4H6RA 1X96A 2FHCA 2ZXQA 3EXRA 4Z2LA 2VKZG 3KBJA 2HWGA 2G3NA 3N6HA 5MKGA 4MTVA 4AQLA 5C54A 4LTSA 4KFOA 4ZO7A 2JGYA 9CGTA 3M07A 2PP3A 1ELSA 1KTCA 4I8YA 4O0QA 4NP7A 3PG9A 1R3YA 3CB3A 1HJXA 4XUYA 3W1QA 5JU6A 3M5ZA 2C14A 3NQ8A 1LBFA 4IL2A 1V02E 3RR4A 4QLJA 1PDYA 1OFEA 1NM9A 2WWDA 2JALA 4MLJA 3W29A 2FZBA 3GNNA 4XD4A 3ZIZA 2GJXA 1TWWA 4M81A 3AYRA 3LB0A 1RSCA 1W1ZA 2Z2BA 3C0SA 5CZ0A 1PB0A 3F2DA 1HVQA 1Y5WA 4MYXA 2QDEA 2PDLA 2W27A 4D2JA 1O60A 4DJEC 4WEVX 3RJXA 1H5VA 6ALDA 1GPWA 2XGBA 4MJMA 5EMMA 2EBNA 1DXEA 1L8PA 5EPDA 3I7SA 3S6OA 3GFZA 2Q3RA 3W24A 3U2ZA 1E6XM 2WJZA 3B8UA 3NDOA 5DT7A 5FEXA 5KITA 4JD4A 2XUCA 3GNDA 2V81A 2WKLA 1MW2A 3GIPA 2CITA 3NYDA 2CZ5A 4DZ5A 1PIFA 4IISA 3TE9A 3VKDA 4B5NA 3B0VC 1W1IE 5I6SA 4JXCA 1BHGA 1JGIA 3EB3A 4K3ZA 3UW6A 1YNPA 3P60A 1WNOA 1SZRA 1VJSA 3NYZA 1KCLA 3TJLA 2DZWA 3CO4A 3CL6A 2Z7GA 4B3KA 3PZVA 4H3DA 4US5A 1ODZA 4ZQPA 3GAYA 2WNNA 1J0KA 3GTHA 3KOYA 3PY2A 4JIHA 3I6TA 1KM5A 3ITTA 3FHAA 1E15A 1W31A 2CWXA 1R3RA 4LUYA 1SO6A 3DOPA 4OU1A 4XVEA 5I3IA 1G69A 1W8GA 2NVCA 1K8XA 2CHRA 1BRLA 3LA4A 4JFVA 2QXWA 4M6UA 1DQWA 1N8WA 3MWCA 4DO6A 3VI2A 3VABA 3OLIA 4NNAA 4MUZA 1LL6A 3W2KA 1CLVA 3CT7A 1T5AA 1TTJA 3NQEA 3LI0A 2BSLA 4ML9A 5LA2A 3BAIA 7A3HA 4IXHA 1UD6A 3QPYA 4IHCA 4YU1A 1XL9A 2GVYA 4HOWA 5TNVA 3CLWA 4D1JA 1Q13A 2NXGA 1RR2A 5C0QA 4DBDA 1E56A 2XU2A 1I2OA 2XIJA 2FGZA 2QJIA 1P0NA 2PDXA 2PMQA 1PSCA 1U33A 3MO7A 3PHAA 1X6UA 4LYKA 2CW6A 1GKRA 4EP8C 3TEVA 5A3HA 4JL2A 3OW1A 3JU2A 3BQ5A 3B0PA 1XC4A 4MDOA 3A4XA 3FYPA 4F2TA 5CG0A 3W1UA 4D6FA 5HWMA 2AL2A 3CHCA 3I10A 3NUKA 3VD5A 3VXGA 2L5HA 4M1BA 5I3KA 1V51A 3NGFA 1WUFA 3IUHA 1GT8A 3WD3A 2HVMA 1LJYA 3N29A 2NX9A 3T8LA 1MW1A 4UTKA 1EPXA 2PA6A 2DDXA 4L56A 3WENA 1AD1A 3A47A 3S4TA 1OCNA 3W2NA 5IHRA 1TFVA 6XIAA 3BGGA 3BGJA 1FHUA 1WAUA 1FWSA 3BLKA 1I9CB 2FDMA 3S2JA 4HPJA 3VOHA 4O1BA 1PBGA 4LVAA 1VKFA 1XRTA 1KFWA 1PL9A 2JIEA 3T6CA 5D4YA 3SEPA 3LQLA 4IF2A 3SECA 5ABFB 1LROA 4ML4A 4HPHA 4ZTXA 2FJKA 3RPDA 4UFKA 1QWKA 1R85A 5CKSA 3UG5A 1JI1A 3IRDA 4JZ5A 4N9DA 3AS1A 3LN3A 3KBVA 3WDQA 2ON3A 2IUZA 3WLKX 4A3HA 4DPPA 2XH4A 1V3HA 1Z69A 3TYZA 3T44A 3CZLA 3VMPA 5CCZA 4UQ9A 2PCQA 1WZMA 5T26A 3W74A 1TMHA 3WLIA 4CD8A 4BQ2A 2F84A 2VR2A 5FJPA 5AYBA 1CLXA 2GSEA 3IV3A 2GWGA 2YX0A 3OZMA 2HPIA 3G5EA 4WKHA 3A3XA 2E40A 4FX7A 5CZJA 3SUTA 1X8CA 3P6LA 2J6VA 1PWMA 3GE7A 3U6WA 4G56A 1TPC1 1I2QA 1KFCA 2HXUA 3TQ0A 3LERA 4QS6A 1A5UA 3W83A 1EWDA 4H9MA 4LS2A 4A05A 4GHRA 3IPWA 4Q32A 2JGQA 3SY8A 3ZZ1A 1MVYA 9XIMA 3GTIA 1EEXA 4LV4A 4XBKA 3AWOA 1E5NA 3UWWA 4JEQA 4U3CA 4PC8A 1BXCA 3CHVA 4D8AA 4HMEA 4TUFA 1UWTA 2HS8A 3A12A 3O0FA 1REQA 1QT1A 1R3WA 3SN4A 2C79A 3PUGA 3NZGA 3GKFA 2Z1BA 4ATWA 1Q2SA 1MZHA 3MU7A 5IXEA 1O5XA 5E9XA 2ZOXA 3L5AA 3WQ5A 2VQTA 1A4LA 2XSXA 3G1AA 5DBTA 2OG9A 3NQAA 1JNDA 3RK8A 2XVPA 5D02A 1NTHA 4GYJA 5DMLA 2O7SA 3FW6A 2Q71A 1XHGA 1FKXA 3K46A 4B5SA 3G0UA 4DIAA 3QPZA 1LQ0A 2WCGA 1FWWA 2EPLX 1YDVA 2CPUA 5I78A 3QW4B 4NG3A 3WQFA 4S3EA 4J3VA 2GDVA 2PLMA 5HULA 4V28A 3AUOA 1EJWC 3CJPA 1HL8A 3W7MA 4GI4A 5ABHA 4MLRA 2OJPA 5FCZA 3GR4A 3ZS4A 2GVGA 2UY5A 1RCXB 1WXYA 4FLRA 1BYDA 4K8EA 4GYPC 1UASA 2VL4A 4XBSA 3VOCA 2JKEA 1YQ2A 4GZ7A 4I7UA 1ISYA 1Q65A 4E8DA 2Z1KA 3WQWA 3ZSSA 4AY1A 4J5NA 1WAWA 1EPVA 2XIOA 2QVHA 3TK7A 4FLQA 3NAVA 4XO6A 2WMIA 4LCSA 4DYJA 3RFAA 3SQSA 3KL5A 2V6AA 1Z48A 1UCWA 4RR4A 1VIZA 4EX4A 3U9IA 3CPRA 2WVSA 4IIGA 2HSAA 4M56A 2CBVA 2QDGA 2XIBA 2WM1A 4MFDA 4ZB5A 1BYCA 2AL1A 3EWDA 4JTSA 1R9YA 3QR1A 2CNCA 1E9IA 2E9LA 2G96A 4D6DA 1EP2A 3N25A 4RW5A 1V0LA 2PTZA 4OECA 3F4WA 2OSYA 2VZTA 2Y85A 3HM7A 2G95A 3UJ2A 1UR4A 1AD4A 5HMEA 4UFLA 2VMFA 4MAVA 2Y8VA 3ARUA 1LYXA 1JFHA 3EDDA 3HTWA 4KEZA 4U31A 4RKAA 2GYIA 3EEGA 3REQB 1TWZA 2R1KA 1IT8A 2OT0A 3KS5A 1BTMA 1QVBA 3EPNA 1JD9A 1V4YA 3MKCA 3OJGA 1P43A 1BGAA 3NQGA 4D71A 4WY0A 1BQGA 5GNXA 1TE6A 2FH6A 4LOCA 4NAFA 4PUMA 4PCFA 4BQ3A 1E0TA 1RLCL 1YADA 4DELA 1RY0A 3SJ3A 3GXTA 2ZQ0A 4PUJA 4AX6A 4FA3A 3W81A 3STCA 2J7FA 3URNA 1B5TA 3DFTA 1OT1A 3SCPA 2E8ZA 1YBQA 3AQUA 3B9OA 5ABTA 3BAJA 2WQPA 4Q8VA 1RVGA 1G7UA 3EBVA 4IFOA 4K1GA 2PLJA 4IPPA 2Q6ZA 1FDZA 2F6KA 1C90A 2YLLA 1P6WA 4PMVA 1WE5A 1XKYA 3GC4A 3R89A 1Q2RA 4HU8A 3W00A 5G2HA 2VEPA 3NZRA 2PTWA 4LBSA 5E6ZA 1YDOA 5C2GA 3GRIA 1NP0A 3M44A 4OV9A 2PWGA 4YWSA 3U8GA 3GX9A 3WJYA 5CGTA 5CGQA 3EB4A 3LENA 2DP3A 3ABXA 4L80A 4QBXA 1XYLA 3WL1A 4G8TA 3RLHA 2FIQA 4DNHA 4QJ4B 2C0HA 1SZGA 3LGEA 4HPXA 3FGCB 1IQ8A 3FFSA 1GNXA 4IG2B 4QISA 4Q8TA 3JW7A 2XHYA 3LXCA 1F6YA 2X1SA 4AIEA 3BLPX 1L6YA 2AQWA 3L2IA 3KBSA 1C29A 2PDQA 4ICMA 3CQKA 2YXOA 4E4FA 1NAL1 3VNZA 1TPDA 2MUCA 3CEUA 3H7RA 1PZ1A 1VFFA 1Y0EA 3RIKA 1OFDA 1H11A 2A7RA 4UCFA 1UD3A 1JD7A 3N13A 4NQ1A 4AUBA 2A3LA 3BAXA 3LGDA 1QCWA 4ZODA 1HKKA 4MY8A 4HNUA 1OYCA 2NW0A 1OK4A 4L6OA 4LGXA 1F6PA 2PTYA 5GJNA 2CERA 5CZTA 5MKGB 3Q67A 4S1FA 2E5BA 4W5ZA 3TW9A 1JPMA 5E0FA 2YW4A 3RLGA 3G77A 4PB5A 3VZYA 2EPMX 4LYPA 1LL4A 1M41A 4JTEA 3UPMA 3PJUA 3RUBL 3IK4A 1GVRA 3SSJA 4DO4A 5U7SA 4ONVA 1TA3A 3FA5A 2PDMA 3SCWA 4DJDD 4RV3A 1ZBVA 3GXNA 2I7GA 2GJXB 2HNHA 3N14A 5L9FA 1D7KA 3ES7A 4MZYA 2WMHA 3AZRA 3VVGA 4MKVA 1X7FA 1TVNA 2H3DA 4GVIA 3VC5A 2Q8LA 1A3HA 4LF2A 1VGAA 3KZSA 3GDBA 1DL3A 2H9AA 1JDCA 4PB3A 1Q7ZA 4HJFA 2VVSA 1YE6A 1AW2A 3EXTA 4IQJA 4CNOA 1E55A 3E74A 1T40A 5EFDA 1VBHA 1VFOA 2TMDA 4X63A 2Z2AA 4L9YA 4J3TA 1B4EA 1R7OA 5CPLA 3D3AA 3M0XA 5I7GA 2AMGA 3OBAA 4C6DA 4Y8FA 3VINA 1UA3A 2VZSA 2A1YA 3AIUA 1BTCA 4AD3A 1T96A 1D9EA 1OQFA 3DKLA 3ALFA 3QMSA 4CN1A 3M0VA 4UFIA 3QZ6A 5FSEC 1J0HA 4H6QA 1HFBA 1E6SM 1EBGA 3L4VA 1AQMA 4PTDA 4K1WA 2QT3A 3W27A 3C56A 5CQ1A 1W3JA 4KRTA 1W1VA 1XJBA 3Q65A 4M1RA 4RUBA 3E2VA 3I65A 1RHCA 2WMFA 2JBMA 3QEZA 4KFNA 5BWAA 1BRLB 1I0BA 2AQVA 3TMQA 3POHA 2OWXA 2P8CA 1KKOA 5FA5A 4AEEA 4FF5A 2E1DA 5FACA 5A2CA 3N15A 4GYFA 1JVNA 4LCRA 1QUMA 4PEEA 1MQQA 1BVWA 3P8IA 1LL7A 1FA2A 5EU9A 4XD3A 1LCOA 2PC4A 3QBUA 4DJFA 3P67A 4NJHA 3GNXA 3AXHA 3MP4A 2PTXA 1K4GA 1OC6A 3KVMA 3QYQA 3IGSA 3WD0A 3VGDA 2Z0IA 5FD0A 3VCCA 3DENA 1AL8A 1E9ZB 3ZR6A 3C2RA 4OE7A 1F3EA 1S5NA 4XZBA 5DRIA 1NJJA 4GD0A 2IKIA 3LXBA 1XD1A 1YHTA 3B06A 4X2RA 3KEHA 3NQ6A 2ZZ1A 2YDRA 5E6YA 4KRUA 2AL2B 3W1NA 2ZRUA 4LUSA 4N6FA 1IIGA 1XIBA 3AHZA 5KZ6A 1G94A 4FAMA 1AQFA 3A13A 2F8QA 1UBPC 5F2LA 3V3WA 3MHUA 2W63A 2V63A 1B57A 1G4TA 4LCQA 5BRBA 1RBOB 2GJNA 2GOKA 3IIVA 5CPNA 2DT3A 3CU2A 3HMJG 1GOMA 3BCFA 4ZQRA 4PMDA 5FEPA 3HMCA 2BX7A 2BVTA 3WQ4A 3SN0A 4JNZA 4D1IA 3TVAA 1UUOA 3ARYA 3I68A 4DUOA 2QQ6A 4D6EA 2VZUA 4US6A 5IBXC 1GVOA 4UWMA 3LNPA 3FYYA 1UJPA 4O8AA 4D6JA 8TIMA 3N12A 3LRKA 3BUVA 3UF9A 3MV01 2V2DA 1XPGA 3E0LA 1FWAC 3VX0A 1VJZA 3MCMA 2VGFA 3KL0A 4JN8A 1Z44A 1LOLA 5I03A 2RDXA 3CK5A 2OZTA 3PZMA 1W5NA 1EOMA 2B0MA 3VFLA 5AHLA 2BDQA 3TJXA 1S5WA 3C8FA 2FVMA 1TR1A 5L6UA 3LCWA 5EMLA 3WLMA 4H9ZA 3GHSA 2R24A 1S5MA 4YWIA 5KZEA 1JQXA 3M6DA 2FZ8A 1LF1A 1XIJA 3AYVA 4UR9A 3RX3A 2HVOA 4OHQA 2G3MA 1M7PA 2A6NA 1FWGC 2YGYA 3GXMA 3QRHA 3QTPA 4X61A 4H2HA 1L2UA 3ZT7A 4PMQA 5HAOA 1V02A 2F2HA 3RMJA 3VIFA 4ASTA 1FH8A 2XTKA 2OOGA 3QF0A 4H8UA 4W85A 2UZ9A 4I9JA 5D2WA 5CAKA 4JTAA 1OX6A 2GOUA 2PRMA 1K6AA 5AYIA 4UOZA 4IGSA 2XFYA 2YXXA 3RO8A 2YB4A 3E1F1 1EDQA 4J3ZA 1DJZA 1SJBA 3QSRA 1WXJA 1U1HA 2C1IA 4PUNA 1CW2A 4NJKA 2NUWA 4QJ1A 3LCGA 4HIBA 1KWGA 3M6YA 4JQ3A 2D69A 2CCRA 2XN0A 1CX9A 1TX0A 2QCLA 2CU0A 1REQB 4G6CA 1XRVA 4NASA 4FB7A 3RCNA 3D3FA 1ODUA 1IZJA 2VX4A 3RILA 4PH6A 4Z08A 3HGJA 1VRDA 1IWPA 1A49A 3AHXA 1CI1A 1R5YA 2FTYA 1H62A 1GONA 5D2XA 1J6OA 4AIOA 1SW7A 1O5RA 5EL1A 5I3HA 2BFGA 1L6GA 1XIMA 1NELA 4LJ3A 3WQGA 4I6VA 1SSDA 4C6KA 5CJMA 1I0DA 3APGA 3BLOA 2PRLA 3ITGA 4N9CA 3A6OA 3UA4A 4JTDA 4IIFA 2QJGA 1FBAA 3NPUA 4DAFA 2VEMA 3VAVA 1ML1A 1KW1A 4AMCA 3LQGA 3QN3A 2DSVA 2INEA 3GY1A 2PDNA 5C71A 1ZHAA 4GK8A 2H8ZA 2REQA 4XZMX 7CGTA 1HJWA 2WLYA 2FGLA 3BG3A 5D9NA 2R1MA 2WMIB 1GOQA 1BXNA 3PUOA 5LXXA 2WYSA 3AYTA 3M0LA 5K4XA 1BPLB 4CQAA 5ABEA 2ZICA 4FXJA 4L9XA 1ZZMA 2PDHA 1K9FA 3LHUA 2NVAA 3NPXA 1QBBA 3L4ZA 4PUKA 1YXDA 1S2TA 2QCMA 1S5TA 1Q8AA 4LAZA 1DJNA 4HZMA 2GSJA 1J79A 2CZFA 2BVWA 1PTDA 2WW5A 3PJTA 4FS9A 4KF1A 3QR3A 3WLRA 2VI0A 3NXFA 4JTGA 2ATSA 1J96A 1O12A 4XK2A 3U57A 3VCRA 1TKKA 1I2NA 4IUGA 1W5PA 4J27A 3GDRA 1H7XA 1VFSA 3PS7A 3KX6A 1JQVA 4LVDA 4O52A 1TV3A 4U33A 3WK3A 2WMKA 4U10A 3LZ5A 4AD2A 4FLOA 3T0DA 3W7HA 5D03A 1VHCA 3BZGA 2XGZA 4P7RA 1NFPA 5JIWA 3W7GA 1M65A 1RA0A 1K3UA 2QHAA 3NPWA 1RCQA 4WY0B 3W1TA 4NAFB 2BY3A 3XISA 1C8YA 4QEHA 1EX1A 3DHUA 5AYZA 3I3DA 2EPHA 1ZB5A 3IJ7A 5HBFA 2PFHA 2PAJA 2X40A 1YBQB 2C13A 5HDRA 3RLUA 4LUTA 1LG2A 4N4QA 3LS9A 2F2KA 3HQOA 1CZ1A 3DI0A 1XC6A 2RHGA 4KIRA 1KRBC 5DFAA 4Q22A 3GVRA 3CL7A 4TX8A 1DPMA 1JI2A 3KRBA 2VEGA 2UY4A 4MZ8A 2BHZA 3FXGA 1HKVA 4NYUA 1OC5A 2VR5A 2DVUA 2X0YA 3G22A 2HISA 1SZNA 4L7ZA 3N2MA 3ZYZA 3YPIA 1FWCC 1KRCC 4ZEPA 4BCEA 4QLLA 4AU0A 8RUCA 1CPUA 2CLKA 3EAUA 1A80A 4QR6A 3DFOA 3W1XA 2ZADA 3SCVA 3C2YA 4Q4KA 1ZCOA 2AMXA 1YPFA 3W86A 3U7BA 1HL2A 3G2GA 1GKPA 2EF9A 3C2VA 3OGSA 4YVVA 4IM4A 3TQKA 5ABGA 1X6LA 3ARQA 1F61A 2Y8KA 4MY1A 3O07A 1YDNA 3R8GA 4DWDA 4PMNA 3CHFA 3MT1A 5E5CA 3TN4A 4PL2A 2CESA 3QGVA 3VZZA 1XCXA 2J8FA 3GTFA 4A8LA 3LEPA 2OLAA 4MSSA 5AYXA 2OKTA 4EOUA 1AMKA 1LLWA 4LAMA 4M80A 3I6EA 4PFHA 4C91A 5HMFA 1QOXA 2ODOA 4LY8A 4AZCA 3UT0A 2GQAA 4Y9NA 3N4EA 3ABOA 2YFOA 1MFVA 3T2PA 3GDMA 1GZGA 3W76A 4HA3A 3K5XA 1WZKA 3MVTA 4IGMA 1DJGA 2J88A 2ZE3A 3R79A 2GWNA 2QCGA 4CCDA 3GO2A 4R7WA 3VFCA 3UZZA 2VENA 4GO8A 5FI8A 4IMFA 1LBMA 4E0CA 1Q66A 5A6BD 3FX4A 1SJCA 3VCNA 2WO5A 5K2ZA 4YMZA 4C6NA 2OT1A 3WH5A 4HPNA 3SCQA 1E73M 3G1YA 3MMDA 3AIRA 3EOOA 1EA9C 1H7WA 1TA3B 5AC8A 3HJZA 5EMYA 1A5AA 1Q6OA 3UYIA 4GLEA 3OZPA 3W87A 1HJQA 4F0LA 1ENUA 1U30A 3A9IA 2XIQA 1XGEA 1IGSA 1TPEA 1IGWA 4IICA 2QCDA 5CC6A 4WLCA 1F4HA 2Z4GA 4GUGA 3PVFA 1J0IA 3TZFA 2W4XA 4IP7A 1KD0A 4Q7NA 4HK6A 4HHPA 1KM4A 3WNKA 3BVJA 4DLFA 4OQVA 2H9AB 3WYZA 1WO2A 3M4HA 4TIMA 2E09A 5A6SA 1NF7A 2E0PA 4JYFA 1XW8A 1W56A 4E6MA 3B9NA 4TU1A 4IPLA 3MMWA 1E71M 4L1GA 3O05A 6PTDA 1JYXA 3T8QA 3EOEA 2YYUA 4GABA 3VKJA 3OTRA 1XLCA 3KS6A 3P0XA 3A22A 3CMGA 2DZTA 5CZKA 3VZXA 3T40A 6TIMA 4LAKA 4B5WA 1S3TC 2B7QA 3NNTA 3ABRA 4MUPA 4JOMA 3NWRA 1KO0A 3LNMA 1UKPA 1CT5A 1AW1A 4CNUA 5D30A 2WC7A 3P82A 1OD8A 1DWIM 3R1ZA 4HJWA 3MI3A 3W25A 1FCQA 3D0CA 1IV8A 3ATZA 1WKFA 3GR7A 3MZNA 3BTNA 2JEPA 2HTMA 1GUVA 3ES8A 4XQ6A 4PGLA 4EWND 2IKJA 2J77A 2INFA 1B54A 4A35A 3WQPA 3OEXA 3SRHA 3QZEA 4BKNA 3NSMA 2TODA 5HOSA 1F7BA 1KTBA 4IIEA 1E6ZA 3EWXA 1RY8A 4HPGA 4R9XA 1YE4A 2RGLA 3CAKA 3EWCA 3V35A 3STGA 1NVMA 3AJXA 3W7KA 3II1A 3W88A 2CC0A 1LT7A 2XZ9A 5A2AA 4UZUA 3TYAA 1R6WA 3G1RA 3VE7A 3AMLA 3MBDA 3CTTA 3HBLA 1VLIA 5K9DA 3TP4A 5A6JA 1UOZA 1VEMA 2A4AA 2J66A 4EF8A 3PUDA 3VNIA 3BC9A 4R5EA 1GCYA 5CBIA 3WMLA 5I3FA 3KVLA 4EPEC 4ZVJA 2P3EA 4Q6XA 1IT7A 5D8ZA 2JF7A 4XISA 2GLKA 5LGXA 3VIJA 3SGGA 1QU4A 3V4BA 2XFRA 4W8LA 3QV7A 1TJRA 4HYWA 1DJHA 1Q7MA 4R88A 4NZFA 2J7EA 3NEHA 4NZ1A 3E0WA 3TYEA 3PTMA 3BLDA 3ORWA 4HGXA 4Q8PA 5FIPA 4F9DA 3PTDA 3DIPA 1H7OA 4FNPA 4C7FA 3R7MA 1ZJBA 3F03K 1CDGA 1R86A 1C8VA 4C6JA 1BVZA 1KCZA 3G1DA 5IRPA 2VXNA 3DH7A 1VIWA 1GOIA 4C6PA 3NL5A 3LRMA 3RM4A 1IIHA 1BYAA 1VCVA 3RM8A 4GUIA 2WWCA 5FF0A 4KCUA 3C3UA 5REQA 3UJEA 3PUEA 5B7ZA 2OKOA 2OZ3A 3H2NA 2OYLA 3R8HA 1T8XA 4WR3A 1V6UA 4JHZA 3XIMA 3ZVHB 2OLHA 3P74A 3CUXA 3TQPA 3RO6A 4GH1A 1LLZA 3G6LA 2QUTA 2V5CA 2RAGA 5A8GA 3OBEA 4XBJA 4QJ5B 3VUPA 3GDLA 1U2YA 4CNNA 2PGFA 3ELFA 3H21A 3KRUA 1OFRA 3HPFA 1YW1A 4QQ3A 4Z1BA 2H3BA 1RD5A 1QHZA 4YTSA 1VCGA 3QLLA 1DQUA 1E1FA 4HN8A 2WMJA 1S1PA 4JTIA 1SSGA 4RCXA 1QWGA 2BP1A 4PODA 2IPJA 3T2OA 1UB3A 2PU1A 1GOXA 2DSUA 3A64A 4AHPA 4PL1A 1A5NC 4AVFA 4NJGA 4LX4A 1PX8A 1FWEC 3W22A 3VNYA 4QCEA 1UROA 1Y5VA 3HOJA 1UP3A 3A24A 2GUBA 2FB3A 4DJFC 1Y5XA 1D8CA 4XAFA 3S5NA 3UR5A 4LNCA 3TKFA 1BF6A 3WF2A 1V6YA 5AB3A 1JCTA 4Z0SA 3CHEA 3KOXA 1QFEA 3PF3A 1VB9A 1EX5A 4R7OA 2DU2A 4XZ9A 1MQPA 2G3IA 3PC0A 1UR9A 3AAMA 1ADSA 5ENLA 2UY3A 1Q6LA 3ABZA 1OZQA 4H83A 2SFPA 4MVAA 1SVDA 3QC0A 2A5HA 1K9DA 1J5TA 3A21A 1A3XA 4H41A 1VFTA 3IJLA 2V38A 4C6CA 1V6VA 5HQEA 1H0IA 2ZRXA 4MG4A 4S38A 3WD2A 1Z41A 4J28A 1VBUA 1R87A 1ONRA 3NO1A 3WFZA 2C3ZA 3DCPA 3FLUA 1XR2A 3C6CA 3STPA 2XH7A 1XIDA 3S1WA 3W7JA 3KM8A 3AWNA 1I8JA 4GINA 5A69A 1VPQA 1SW3A 3TROA 2VFDA 1IT0A 2VFGA 4UTJA 1UWAA 4EAYA 3H2CA 4ZQMA 1A50A 2TYSA 3FV9A 4M8UA 3SFKA 4GISA 4IPNB 1EHNA 1HKIA 5E09A 3SRKA 1HQTA 1R3TA 4UC5A 1U5HA 1PJ9A 3H4XA 4KEMA 1OBAA 1J18A 3GUWA 1VYSX 1ZQ5A 3W1RA 3CHDA 2WC3A 3KXQA 3BW4A 3E2SA 1F8IA 1YXCA 1CGTA 1LQ2A 3QR0A 1KXTA 1XH2A 1VEOA 1R9XA 1ITXA 3VGGA 4LUIA 4PTXA 4K7YA 1QI2A 2REQB 3HFTA 3W53A 1WX0A 2Z1XA 1OFQA 2DEPA 1Q5MA 4HZ8A 2ISFA 3R2GA 4HB7A 2CLPA 1HL9A 3C0QA 3RCMA 2FTPA 4OV4A 1KFJA 4GFSA 5CPQA 1EF2A 5DCEA 3SURA 4WDWA 3ZWTA 1SQ7A 4ROPA 1V0NA 3F4DA 2QPSA 4C1LA 3KRZA 1OB0A 1QHPA 2WV8A 4GX8A 5DXXA 2QUNA 3ZR4A 1OC7A 1AK5A 4K6AA 5A94A 1QXLA 1TE1A 2JIWA 3TW6A 2UWFA 3NO5A 1R3SA 2J7CA 1YLVA 2W79A 1PVNA 3WBAA 4L4PA 3BL3A 1V7AA 1W1A1 3W6MA 2EG7A 1HGYA 1C9WA 3KHJA 3QHNA 1PKNA 1V6TA 4AYSA 1E5JA 3QVQA 4UTMA 1PYFA 1Y8BA 2PWUA 5G4EA 3KCJA 3K1DA 4TTGA 3RPTA 3H53A 2PRHA 1UWUA 3WDJA 1ZU8A 2Y62A 3UXIA 1UJQA 4JTLA 2BV9A 4LC8A 3M0MA 1JIBA 4K8GA 2DZAA 2VCAA 2VT0A 4DJED 4RX0A 4QRNA 2CZVA 5KZMA 3ZMRA 2ZX5A 4F0SA 4AD4A 1H61A 5BMWA 4LUTB 1W9XA 3AC0A 1TIMA 2DZVA 4JHOA 3G1XA 3W7QA 3AISA 3BE7A 1YX1A 2YXGA 1PZ2A 4C5YA 4DBSA 3H7VA 2QW5A 4G5DA 1ITCA 4PTWA 4YVXA 4AAJA 4XAZA 3R94A 2CLMA 2CIPA 3LTSA 1A5SA 2ASHA 3EA2A 4TO8A 3VOGA 1GVFA 2AQOA 1LDCA 1DJXA 2PSNA 2BOGX 1G5AA 2P5NA 3MS8A 3M0JA 3T7VA 4R27A 1EL3A 2PWFA 5JH2A 1QMLA 3FYOA 4CVUA 4EACA 1U83A 2GGIA 3VTRA 3Q94A 1M7JA 3SCTA 4IQLA 5I5RA 2VFEA 2OO6A 1JZ6A 2ABAA 4IFRA 2GQ3A 3LCLA 1SZEA 4D72A 2ZUSA 4UMBA 5F1VA 3BAWA 2E9BA 2AGKA 1ZY9A 1UH2A 3ZM8A 5A95A 3K4WA 2NV2A 1KBIA 1W3LA 1WBJA 3LHYA 4Z1YA 1RQHA 4KMQA 5HMDA 1WZLA 1XF0A 5AHIA 4UFMA 4E2VA 3QQWA 1XG3A 4P8UA 4NNCA 3BCDA 3B4YA 3WLSA 5FSDC 1DQXA 4OJYA 3F4CA 3NSNA 4E4PA 4ZMGA 4PB4A 2ACRA 2J74A 1X7IA 4AZCB 2OVLA 5D9MA 4P7NA 4LC6A 1AQ0A 3PZNA 1QW7A 4QHRA 1QRQA 1SZFA 1J2WA 1TR9A 4MM1A 4O12A 2YKKA 4KWVA 2VEKA 1UPPA 2C16A 4YTUA 1MMFA 5AHFA 3C2EA 4RDWA 5GPRA 1MEWA 5FJUA 4UIOA 5LNRA 1R2TA 1GKQA 3W72A 4JCLA 3ZLFA 1VBJA 2GK1A 2VOMA 4HD5A 1SGJA 2HRWA 3GH5A 3MO4A 4GXWA 1GW1A 4UTTA 5EBAA 4PBFA 3S9IA 1JPDX 1KBJA 2VNCA 3KAOA 3NSXA 1N55A 2QCDB 4I8DA 1V3JA 1KLYA 1FCBA 3DKJA 2OEKA 5FJOA 1S3HA 2BXYA 1DXFA 2E28A 2Y89A 4UTUA 3C61A 4NSBA 4A4AA 3GNOA 2E6DA 1HW6A 3GHUA 3VDBA 2QCCA 1W9PA 4MNKA 1CXFA 1IWBA 4GGHA 2BTMA 1ZJAA 1W6TA 2R14A 1UC4A 3WNOA 4RDVA 1PUDA 3AZSA 4W7WA 3TFCA 3WJZA 4TVDA 3N2OA 3H26A 3S5ZA 3VKKA 7ODCA 3VX1A 1GZJA 3W01A 4FALA 2FZNA 1CBGA 2QJJA 1S2VA 1AH3A 3TYDA 5I3GA 3WBXA 4GIYA 3TN5A 1LORA 5CZSA 4DZHA 1OF8A 1C7SA 1PV8A 2FH8A 4FZIA 1VH7A 4ZBCA 4DN1A 1DP0A 4MNLA 4QE4A 2PDWA 4PBGA 2OEMA 3T42A 3CWNA 3B0YA 4FOJA 5CXPA 1UR3M 4Z2KA 1A5MC 3IIPA 4CNTA 2D2HA 5C2CA 1NFGA 4I5UA 4GYKA 5J8LA 3GAKA 2B81A 1T7LA 3WUBA 2VEFA 4NRRA 2PD5A 3LCXA 5IDZA 2CLHA 1XBYA 4MWAE 2JK2A 3CWHA 4QG8A 1QJWA 6ENLA 3PFRA 5HPOA 2WC4A 3D46A 5C55A 3OHIA 3NQMA 3EPMA 4GZEA 3WN6A 4L4LA 1B9BA 1SO4A 1ZUAX 4F2UA 3KL3A 3HG5A 1NWRA 4IGNA 3RF9A 2YCLA 4Q7IA 2NV1A 1JFXA 3C52A 2EO7A 4AFYA 1N7KA 1DJQA 2W6RA 1OFOA 1GJWA 5IHSA 3L66A 4IT1A 1IZKA 3GDKA 3W7CA 3QQ1A 2NUXA 3B8TA 2OSXA 4W4QA 2EKCA 3O15A 3TJIA 4CGTA 3TQVA 2WKJA 1BF2A 3VD3A 4IQDA 3WKZA 1RPXA 4O0ZA 1C8QA 3QC3A 4NZ3A 2RDTA 3AROA 2XDFA 5GVJA 4JDYA 4CQ9A 4CN4A 4AZIA 3BLEA 3S42A 1NDWA 2J62A 4IX2A 4O28A 1ZENA 3FA3A 1EZWA 1QOQA 3UWVA 2D3LA 3L9CA 4Z2HA 1EJVC 2QIIA 3P3BA 4IH3A 3HV9A 4EXQA 3QV8A 1VC4A 3U4FA 4P2VA 2GJRA 1NQ6A 3SGUA 2GGJA 1YRRA 1X1OA 1TRDA 2R6OA 3NJ3A 3B9EA 4GWEA 2JE8A 3H2FA 1JEZA 4DPQA 5BU9A 2WZTA 1L9WA 1XUZA 3CUFA 1WZAA 3MTWA 4O11A 2NQHA 1EC9A 2P76A 1FXPA 3XINA 5LIKX 1OWQA 3RRXA 3QTGA 3APTA 4NRSA 2VDHA 3WH8A 3P5ZA 4A3QA 3TOPA 1QPNA 3GUGA 2J7BA 1PEZA 5K9XA 4M0XA 3AJ7A 4AC1X 4WUIA 3ZJ8A 3G6MA 2AAMA 3KBNA 5EGRA 1Y65A 5I23A 3TTOA 3KW3A 1JCJA 1XIFA 1UR8A 1EZ2A 4B90A 4CKQA 4GJJA 1FH7A 3CQ0A 1ZP4A 1XLIA 1PIGA 4P8WA 1F76A 2EXOA 4K39A 1SMDA 4KS0A 1C92A 1FOBA 1JPHA 3H70A 1BFNA 1GYLA 3WDHA 1RJRA 4PMYA 3JR2A 3MBFA 3RLVA 4FXFA 4GQGA 1AH4A 4H9XA 3QKZA 3MJMA 4HQVA 4B2DA 1TCMA 3SY5A 1PX4A 1EOKA 3EWZA 1P1XA 3AHYA 3E02A 4GA8A 4EAMA 1IEIA 4GH3A 1ICQA 2C1HA 4HZ6A 2FLIA 1QPRA 2QKFA 1QBAA 4XAPA 4Z1DA 2Y88A 2QCFA 4TMBA 3EMCA 3OA5A 5I79A 4KT2A 5LIUX 5C9XA 1GHRA 1K77A 4G7EA 3O6CA 3EA3A 1O5QA 4J40A 4H1ZA 2ZFAA 4CU7A 3WD1A 3CC1A 1M68A 2O56A 3JRKA 4GI9A 3KRSA 3EPOA 4XSLA 3U2OA 1EP3A 3TJ4A 5HMSA 4I9TA 4N2YA 1E6NA 3V16A 5LA0A 3S0CA 3NIYA 3T0TA 4D8LA 4DF0A 1PKYA 4Y9PA 4C6FA 2R8WA 3G1SA 3OYXA 3M0IA 1TIWA 4LBUA 1CB7B 2ISDA 4GIRA 1CCWB 2YYTA 3AHVA 3LYEA 4GUHA 3WLJA 3OIXA 2ACSA 3LY0A 4B3ZA 3URBA 3N9SA 4XZWA 1YMYA 3LD5A 2X2YA 5G4WA 1D7FA 2B7OA 2PBGA 6TAAA 5CSUA 3E12A 1L6FA 3AXIA 2J9ZA 4AMAA 3L12A 5BOFA 4HZ7A 3W84A 4JHMA 3H54A 3UESA 1WKYA 3WELA 5KETA 1KA9F 4WQ6A 3UQNA 1FWBC 4KEVA 4WJEA 1FWFC 4B5TA 4QS5A 4Y2WA 1GVEA 2QJHA 4RDYA 1U22A 3G18A 4YXGA 2Y5JA 4N02A 5JIPA 3EDFA 3HURA 3TONA 4NKCA 3MMUA 1YPXA 1FWTA 1W91A 3W2MA 1KB3A 4YS1A 4AF0A 2YA1A 3TSMA 2BS9A 3THCA 4LANA 1QW8A 3WDIA 1EXBA 2XGIA 5KTLA 3MJYA 4C6MA 3S83A 1UD4A 1RD6A 2VELA 1DORA 2PTDA 2I56A 1S2CA 3KWSA 3Q37A 1XIEA 4MIMA 2P1FA 1TUFA 3TV8A 4JFUA 2D0FA 4QE5A 3J7HA 1R9ZA 3VDCA 3AIVA 5CSYA 4HNOA 4CCZA 4JR5A 3IVTA 1RP9A 3U4AA 3MQTA 5CJNA 4GNJA 5FF2A 5CLWA 5C8BB 3CS2A 2HK1A 2ZKMX 4WKFA 4LPCA 1YNYA 3FJ6A 3EX4A 2XZ7A 1X8FA 1FDYA 3BSHA 4JKLA 3W6YA 3WJXA 4MKSA 3CB8A 4JCMA 3WIJA 5DELA 2HS6A 5HQLA 4J2PA 3HV8A 3MYPA 2WSRA 1K7EA 1XSJA 5K7JA 1J5SA 1EFZA 4UUIA 5C9RA 1XLEA 1HKWA 3IJDA 1VBGA 4FOUA 3BICA 4ZB2A 3SW6A 1WDPA 4JX6A 2OOFA 1HX0A 3WK0A 3IGXA 4MDPA 4QDPA 3W7OA 1DIOA 4ZFCA 4K38A 2Y0FA 2AKMA 3VKAA 4N0RA 2H90A 3GTXA 3BZJA 1GORA 4U28A 1XKJA 2FZDA 1J12A 1CXKA 3FJLA 1UWQA 3CQHA 2Y7DA 5BRQA 1PHWA 3KP0A 1IZCA 3S3GA 3GBDA 1LT8A 2GDQA 3AXKA 3TYCA 1Z42A 3MWAA 4N7QA 1TQXA 2E4TA 4GKTA 4HP5A 5A8NA 3W2JA 3V1HA 5FF7A 1KM6A 4Q4PA 1KKRA 2W91A 2VZOA 4KQNA 3L0GA 3FOKA 3RHGA 3W4RA 2BODX 3N4AA 3QV9A 3KHDA 3E5BA 3UXDA 1XDJA 3LXAA 4Q8WA 1K6WA 4O54A 3TAKA 4BS0A 1UW9A 3VILA 2VURA 5D05A 1FWIC 1TV8A 3CTLA 3TN3A 3PJWA 2ANUA 3CYVA 3L23A 3M16A 2WLZA 4FHAA 3UZXA 3ONCA 2DZUA 2J6XA 1ZFJA 3IGHX 2HBVA 3RU6A 2D73A 3MSGA 1O6IA 4O10A 2PDFA 5EYWA 1UD2A 4PCPA 1W9DM 3DG3A 4PCTA 2ESCA 5LNVA 1XM3A 1TPB1 5I09A 4EXBA 4GFIA 1XYBA 3R43A 3UWQA 1NIUA 5EA9A 3UA3A 3VKBA 1QI4A 2V2HA 3GNRA 4BQ5A 1ZTVA 1SFSA 1EJRC 4JTUA 1CIUA 2A2IA 3SN1A 4H8VA 4B15A 3KE0A 1BSIA 2G8ZA 4K8HA 4PN2A 2Q8ZA 3IJ8A 4GKLA 4W5UA 1V79A 3FAWA 2FTWA 4Q4OA 3BW3A 2Z6JA 3DGBA 4R7JA 1ICSA 1TPFA 1WV2A 5I3JA 3W26A 4Z2IA 4H9TA 3DFSA 2WNWA 3VNJA 3IUDA 2C8NA 1JUBA 1KR0A 4WGXA 3FVMA 1B3VA 3EGJA 2OTDA 7PTDA 3OO2A 1U5JA 2DVTA 3M1ZA 1KFLA 4I5RA 1XPYA 5E70A 2DT1A 1B31A 1CGUA 4BFAA 4E3VA 4LYRA 3LMYA 1US0A 5TF0A 1TB3A 1RA5A 2DJXA 1UR2A 1XYMA 3HIJA 3OZYA 1PZ3A 4JTHA 3C86A 3TX9A 2DY3A 3NO3A 2GK1B 1RPKA 1GQLA 1AZ2A 1EJXC 1ZS2A 4ZFMA 3QFWA 5HATA 2VGGA 3WF1A 3ZSTA 2GGHA 3RPMA 1MO0A 4ZENA 1J8VA 3GR8A 1FFRA 2O4MA 1PKMA 3GWQA 4ENLA 4JAWA 2QGHA 4D6IA 2XN1A 4XZLX 3DHPA 1EGZA 1M9HA 4UFHA 2OPJA 4RXGA 3S1UA 1W9UA 2E7FA 1GGOA 3I4KA 2QS8A 5AVNA 3R0DA 2FGBA 1FWJC 3IIXA 4OGZA 3MA8A 3DEQA 3M46A 2Y5EA 2EG6A 4EPKA 4CU8A 2VHLA 2D2JA 3POCA 3LMZA 1E72M 3K13A 4ATDA 3SADA 1TTQA 3IJ9A 1JJKA 1UIOA 4US5D 1D3HA 4YNGA 3EOSA 4F0RA 2PDPA 5AC6A 2ZVRA 1XWYA 3AOFA 4I6KA 3AI0A 3ZLHA 1UMYA 5G5IA 1W37A 3W70A 3TU9A 3MI2A 3GIQA 4QLKA 2C71A 2Z00A 3LDVA 3M47A 2V3DA 1JZ4A 3GXFA 2OMAA 2ZXBA 4A2RA 7TAAA 1QNPA 2X1UA 2FB2A 4NIRA 1TCDA 1QR7A 1W8SA 2BASA 5HUOA 1VF8A 1ISZA 1Q4WA 2E6AA 4UMCA 2PPGA 4NF7A 2WQDA 5BOEA 5G1MA 3Q2DA 1MWOA 4UTWA 3T1GA 5EB8A 2LLEA 1K9EA 2TRSA 3B9AA 3RM9A 1H7PA 2F6XA 2VQUA 1A47A 3AS3A 5FAGA 4GQBA 4ECLA 1I2PA 1B90A 4V15A 1MXDA 2WJFA 3VMOA 2J79A 3A5FA 2PWEA 4HOXA 3UCDA 1BKSA 3V5FA 2E9MA 4HK7A 3GM8A 3LCIA 3UP8A 4QG6A 3P14A 2A79A 1XINA 3W7IA 4XIAA 4AD5A 3ATYA 3B8DA 1AVAA 3ZJ6A 1V0KA 3ARZA 2WSYA 4RW3A 1F9CA 2UY2A 2YIHA 3KDNA 4CEXC 4JN7A 4WOQA 1MRQA 5JMUA 4O16A 2WPBA 3GK0A 1RCOB 4HSNA 3WF0A 3HPZA 1ZBWA 3FIGA 2YCLB 1Q4NX 1XV8A 5BWFA 4MB1A 4MB3A 2IPGA 3KVKA 5HUPA 1QNVA 3E38A 3WH7A 3IVUA 3GC5A 2XVGA 1KBLA 4UTTC 2ZRVA 1Z8AA 5DY2A 2ZZ6A 2CYGA 2YCIX 1BGGA 4ZR8A 3O63A 1TX2A 1POJA 5D9OA 1TJPA 1PCKA 3FN9A 4IPJA 4PSRA 1VCFA 2VFFA 3S6TA 3HJEA 3DXIA 3NM3A 4EE9A 2QGYA 3HO8A 2J7DA 5HNRA 4KWUA 1GZ1A 3OG2A 3FDGA 3WLQA 2NQ5A 2PDKA 2P0IA 2GJLA 3HG2A 3KCOA 3O8AA 4OVXA 4IXXA 3WK1A 1EWEA 1M7XA 4MB5A 4AEFA 2Z2UA 3OIHA 4CLMA 4CU6A 3H2OA 4PR4A 4ACZA 1P48A 5KSWA 3IUIA 4WOZA 2NLYA 1KBKA 2NWSA 1EGMA 4AXKA 5D9PA 2VZVA 4JQ4A 4JYEA 1XYAA 2QV5A 1QO2A 2Z1WA 5D09A 2ZUVA 3ITCA 4QDMA 1K9TA 2YZRA 3DYOA 4Q7BA 1XH0A 3LSBA 2OWCA 1OGGA 3N04A 4MFEA 1VFMA 1ITUA 4Y9AA 3T08A 3ZJ7A 3M7SA 4KGJA 1W9VA 2EAWA 3GKAA 3UR8A 1MEIA 1DBTA 2NT1A 3UZYA 3EB2A 5BW6A 5BXSA 4K7VA 3FKRA 1SU5A 2ZTKA 3W2LA 4LV9A 4M7SA 3S5YA 4RNJA 4A3UA 1GHSA 3N2CA 3UWEA 3M43A 2HK0A 2EQDA 1CEOA 1EJ7L 5HA7A 3TTSA 4W8BA 3A3HA 5HWNA 3EMZA 3SUVA 3T2QA 4O15A 1HJVA 2FHBA 3B03A 2DSWA 3N9KA 5HXMA 3L5MA 1ADDA 2DUXA 2WZEA 1US2A 1TSIA 3EYPA 1DEDA 1C93A 2VUNA 3ICJA 1BAGA 4ZTYA 4KCWA 3SCSA 3IJQA 2IQDA 2YDQA 4ICCX 4WJXA 1RV8A 3BWWA 2Z24A 4RZ4A 2IKGA 2HE8A 2Q3OA 5F2MA 1LRQA 1TUXA 2WK2A 3M0HA 4PTVA 1VP5A 3GBEA 1RQEA 1FQ0A 3SRDA 1QPOA 2XVNA 3UXLA 4HVXA 4G7EB 2R82A 2Y24A 4NXSA 2V8ZA 5CLTA 1HIZA 3PB0A 2PE4A 5JXQA 1C7TA 3H2EA 4KWWA 1UA7A 2YL8A 3VD7A 3QLDA 2FPYA 5HQMA 1CGXA 4O8RA 3SO7A 2J9YA 4M24A 4JPGA 3GG8A 3BURA 1PWLA 5JH1A 5LSMA 3PJXA 5A6KA 2NUYA 2DGAA 3ZLGA 3LCFA 4LXFA 2WOQA 3GLCA 3TDFA 3ARSA 1UKOA 1QNQA 5E1QA 2JF6A 3L4XA 1TELA 4M7TA 4E8CA 5XIMA 3A4AA 1X6NA 2PEVA 5FF3A 2Y8UA 1O1HA 3BAYA 1XLDA 3EDKA 3O0KA 4ZB0A 2PGEA 3WZ0E 1X1ZA 1QPKA 4O19A 1M6JA 5BROA 1FUYA 2J8TA 1KGWA 3WQCA 4O1EA 4O4VA 3QW3A 3E2QA 1NWSA 3MUAA 4FEZA 2OQYA 4O1AA 1GJUA 3AIBA 2QZRA 4LUJA 4N6EA 1BVNP 4Y90A 2IKHA 4QQUA 5MF5A 4N9BA 2BNJA 2P3ZA 3ITOA 3E6EA 5BYWA 3GH4A 1E6QM 1XRSA 3EKLA 1TJ0A 2X7WA 3VC6A 4B92A 5ECUA 4MWAA 2G41A 4AF0B 4DWSA 1W5OA 2VYOA 1KGXA 4I3GA 4NY2A 3KFTA 3WMBA 1UH4A 4FR6A 3PWIA 2FQIA 5TIMA 1HKMA 3ARXA 2O9PA 5I3DA 5D2TA 1OYAA 1XSIA 4GYPA 4GVFA 5HK4A 4DBEA 3QHOA 1ZALA 2FKPA 2DQWA 1RAKA 1PYMA 4O4WA 1PKLA 4X0NA 4H00A 5H8MA 2X2GA 2PF0A 1WBHA 1GOWA 4DYEA 3ID7A 2ZE0A 3GH7A 1I45A 3SY1A 2ZCGA 4LSBA 3TYUA 3VDHA 5KEZA 4F2BA 3ONBA 2F6UA 1I1XA 1Q3NA 4DZIA 2DZXA 3H22A 3O2LA 3PZUA 1DJWA 3FK4A 1R0MA 5D8WA 2PCEA 1DHKA 3UWUA 4DBUA 5A6TC 5T9CE 2ZXAA 2V3EA 3KLLA 1NDZA 4PCNA 2X8RA 2QIWA 4DI9A 3DFHA 1WKDA 1QASA 1H1YA 3SQMA 2QUUA 4GY1A 1TJ1A 4IX0A 4U3AA 2WHLA 4H6KA 2G0WA 4GGBA 3CPUA 2GPTA 3P0WA 3PWGA 3GU9A 1SJAA 1TTPA 5FJTA 3TSBA 3DYMA 2ACQA 3RYSA 3WQVA 5CC3A 4O53A 4IJBA 3K8MA 3A3WA 4WSJA 2V3FA 4X0VA 5D2YA 3CNYA 1NY1A 4L65A 2PDIA 3KZPA 1HP5A 1XGZA 1Q6GA 7TIMA 2A7PA 1VHNA 4TQTA 4E2OA 4C1KA 1BG4A 1UKSA 4P8XA 2OWWA 3ARVA 2OLSA 4D6HA 3G1HA 3F5LA 1V3MA 4W84A 4Y6GA 3KWXA 5I2UA 3PM6A 2A0NA 3T07A 4B16A 3MSRA 4HSHA 4IP4A 4A2SA 1NP2A 4QCFA 4HA4A 1Z3NA 3L0NA 3LK6A 1LM1A 1OHLA 2CXEA 1KRAC 5M5DA 2ISSA 4RE3A 3LPGA 2VRKA 1FDJA 4IMGA 4O1CA 4A6GA 3R4IA 4JYDA 4QTGA 2V2CA 4Y9OA 2Y61A 1FH9A 3RJYA 2WANA 1XG4A 2YL5A 1KQYA 1UKTA 1TPVA 3VNDA 3U2EA 1QNRA 3GZ3A 2ABBA 1FWNA 3BJTA 3VNKA 1A3WA 5LNSA 2NLIA 2WZHA 4MPKA 3IIOA 4RNIA 4QEEA 2ZUTA 2BOFX 4TX6A 1Z6KA 1TV4A 4A22A 3MUY1 1UQZA 5CJ5A 2PURA 1YEYA 3DX5A 4A8RA 3MYOA 3QMRA 4CVWA 2GJPA 3K1GA 2DV0A 1CGVA 3W38A 3AHTA 1VD6A 1GVQA 4Y9MA 1PIIA 4X2PA 4RE4A 1BG9A 3AIQA 1OG6A 4V27A 1UR0A 1H09A 3WNMA 1W2PA 2EGZA 1EXPA 4S3GA 3SCUA 2DZSA 2BZNA 3CV1A 5TBOA 3W73A 9RUBA 2E25A 5CC7A 2NZLA 2RJHA 4INFA 3C8NA 3VU2A 3IIZA 4WCJA 4NNBA 2BVYA 5BXPA 1G7VA 4K37A 3N18A 4FNTA 5ECVA 1R3QA 4AC7C 3KTCA 3PSWA 2C0AA 4MJ4A 2G4JA 3B4UA 4OBTA 4CUCA 4YHGA 3HG4A 1NWTA 3JZUA 4F8XA 4IWWA 1YPIA 2F7FA 3MDWA 4YCOA 3DI1A 3DUGA 1TZ7A 2XSBA 4H01A 1GVIA 4W89A 5EKYA 4WDXA 3KTSA 1EJSC 4HOZA 2PDBA 4EKJA 2RGMA 2ZX9A 1JYNA 2RUSA 5GNZA 3P61A 4GQ0A 1WA3A 2C6QA 3S6DA 3GFXA 1EC7A 4XKYA 3CAVA 5F4XA 4WSHA 2BBFA 3ANVA 3B0UX 3INPA 5HANA 3QSTA 3ZVIA 1UYQA 3KVJA 3TA6A 1H50A 3LV6A 2Y7FA 1A4MA 1G67A 1UZ4A 4DM1A 4TX9A 3K30A 4BF5A 3OPSA 1K03A 2WHKA 4AXNA 2BY0A 4ZOCA 1O66A 3WG6A 3CXOA 4UTFA 3WNLA 3SQLA 4S3CA 1DIEA 1PE1A 4DEFA 4YTRA 2KAUC 3RX4A 4Z42C 3R10A 1AH0A 4A8NA 4U2YA 4AX7A 1ME7A 2NXIA 4KETA 4OFCA 3H23A 4I9MA 4KEUA 1RP8A 2R91A 4GXMA 1O94A 2OELA 5A8MA 3ZVHA 3GC2A 3NR0A 1QAPA 1ZAJA 1S2UA 2XWEA 3K4DA 3H24A 1MEHA 4DZAA 4AEOA 1B9ZA 2WSQA 4MYAA 1VZWA 1SR0A 3O1NA 4AW7A 1BWVA 1KV8A 3UWZA 4AZBA 4D6GA 3UG3A 1EBHA 1M7OA 1TJ2A 5K9CA 2INZA 3GD6A 2VJXA 3LHWA 3L21A 1GG1A 4ZOEA 2OX1A 2ALRA 2HMCA 3B05A 4GY0A 2WVUA 4TR9A 1U1UA 1QDSA 3MPGA 2RH9A 4QFUA 3I7QA 2HVNA 5M2FX 7XIMA 4DJFD 3VIHA 4AD1A 5LKYA 1AMYA 4IP5A 1TMLA 4C6QA 3MUIA 1P6BA 2QCEA 3TC3A 1Z89A 1JULA 3TLQA 4IOTA 4QSFA 3B40A 2OYMA 6A3HA 1JDFA 3GYEA 1A5KC 1H41A 1UD8A 3RCYA 1SO5A 4GJIA 4XIMA 3AIWA 5PTDA 1S5VA 2IXVA 2I14A 1SFJA 1Q8JA 4WDTA 1TVLA 2O55A 4X60A 3GB6A 2PC8A 3HQPA 4KH2A 4EPBC 3BQ6A 4M6PA 3RRAA 5GJMA 1FCUA 2Y1HA 3PG8A 3HZ3A 1ISWA 4ZOAA 1Q45A 2R9RA 3V5CA 4FX6M 4EK7A 3EXSA 1EB3A 3G24A 1LWHA 3BLLA 2CBJA 1EYWA 2HV5A 4FPSA 3E49A 4PYSA 3ALGA 4JQ2A 3CASA 3VK5A 3I4EA 1E4IA 1J11A 3PULA 3G0XA 4KWOA 4GC3A 1LP6A 3UVIA 2POZA 2WCAA 4EANA 5IM51 1GOOA 4UOQA 1CTNA 3T05A 1W2VA 2RKXA 2I9UA 1WP6A 4WXZA 4HU3A 1PHQA 1U5VA 2O0TA 4ZXOA 1OX5A 1IXPA 1YTKA 4WXYA 4C7GA 4ACZB 4F4RA 4A29A 4DO7A 4AG0A 3S8HA 4NHVA 3M0ZA 3NQ2A 2QPXA 3L4UA 1KWKA 1V3KA 4GPNA 4REQA 3THUA 1KM1A 2WJEA 3WCZA 2PD9A 2GSHA 4FP1A 3R0KA 3ABQA 3KLKA 4LS0A 3OGRA 3VOJA 3HGRA 4CD4A 3OLDA 5IBXA 3UGRA 4I7WA 2IMRA 3DBNA 3IACA 4O1FA 4L9ZA 3QYSA 4WSKA 3EX2A 3BPWA 2PP1A 4LALA 1HZYA 4UTWC 4H19A 2YR1A 1OINA 1JNEA 3BANA 4EWJA 1R38A 4R33A 4ES4A 1VYPX 1NDVA 3O06A 5DLCA 3S5OA 3WEZA 2GQ9A 3USBA 4A8IA 4LYQA 5M03A 2JFEX 1ZSXA 3OQEA 4WY0F 1JDDA 3DDMA 4O14A 1CNVA 4XZHA 3DC0A 1G6CA 1XS2A 3C2FA 8XIAA 5T91A 4NYYA 4Q4SA 4J1OA 3GU1A 1E9YB 1A5BA 3W7LA 3WX7A 1EO5A 3PAOA 1GPFA 3U5UA 2GFTA 3W1MA 3E9AA 2AGTA 1FY6A 4ZA0A 2B7PA 4FX8A 3IK2A 3T0AA 3UWYA 5EY5A 4L1XA 1FFQA 1CB2A 2P88A 4NZ4A 3S1VA 5I77A 4E38A 1AW5A 2Y70A 1LQAA 3BOLA 2JQXA 3VGBA 2D0GA 4AWTA 3VKCA 3VD9A 1ZBCA 3HA1A 5U4NA 2Z27A 4I9AA 3AZTA 3MUZ1 1V8EA 3BV7A 2BVDA 1ICPA 3WUEA 1HJSA 1K8CA 3DYPA 1IR1A 4OBSA 1EF3A 5HNNA 4X9SA 2FZMA 3WLLA 1XLKA 3DG7A 3IVSA 2QF8A 4FXSA 4LB3A 2FDSA 2PWDA 3BMXA 3B8VA 1W54A 4QG9A 2JEQA 2VD8A 1E6RA 2Y63A 2PZ0A 3RITA 4M3PA 1VLWA 4Z1AA 1TQJA 4M82A 3PTKA 3R5EA 1WDSA 3BAKA 3FJ4A 3G3MA 4H8HA 4UBPC 3EEZA 4TV6A 1RXOB 2OQHA 4EIVA 1E1CA 2D24A 3A9BA 2O9TA 1OY0A 2BWGA 4LF1A 2V5BA 4YYFA 4TTUA 4H04A 3UY8A 1NFBA 2YA0A 5FL0A 5G1YA 4FOKA 2I9EA 3QH2A 4PMZA 1CGYA 4GI6A 3LHTA 4MWAB 3VE9A 4DWSB 2PDGA 3LCHA 4JQAA 2ISWA 3EWBX 2CLEA 2CBUA 1XCWA 4JQ1A 3CV6A 3PZIA 2Y7EA 3BV4A 4B91A 1G1YA 4JTTA 4P5UA 2OFJA 4HHMA 1S2AA 3ITXA 2XM1A 1UR1A 3IJIA 1ONXA 3K2GA 3LUTA 4TVCA 2GVEA 5BCAA 4JIRA 5XIAA 3MUXA 1JZ7A 1Q6DA 1UH3A 4EVZA 2XFWA 4N9EA 1JR1A 4R34A 2H6RA 1FTXA 4HHHA 4CQDA 4E5TA 5CC5A 5FL1A 2ZZ2A 3FCPA 3TR2A 1FWRA 3SAZA 2E68A 2XIIA 5BRPA 2C15A 1ADOA 2DORA 3N3TA 4ZE4A 1AUSL 3CV2A 1E70M 5H6HA 3F5JA 1M03A 2BXVA 2ZRZA 3BXWA 1J2BA 1JRCA 3QJAA 4FMVA 4RL3A 3E0FA 5IOBA 3U3HA 4FNSA 1MUWA 1DWHM 4MJZA 1E4NA 1A5OC 4KW2A 5D37A 4L4MA 2QMKA 3PTQA 3LLDA 4NZ5A 4ZGYA 1NWUA 3MVIA 1O5KA 3IWPA 1R47A 2ATMA 4GX9A 3WH6A 4F0KA 1AG1O 2FMNA 1JYWA 3N6QA 1IEXA 1GTHA 2CETA 5LHFA 3LZ3A 3STEA 2GVLA 2FYMA 5GQBA 1XIIA 4YLWA 3T4CA 3WBYA 4P7OA 3M7WA 2VC7A 3MHGA 4H2CA 2X09A 1GTEA 4C5ZA 2PDUA 4I5XA 4JEJA 2H8XA 3UERA 4GMEA 4Q4QA 2QR6A 2YSWA 1YIXA 1OGBA 3UZ5A 1ME8A 2YL9A 1EGVA 2CZDA 3ENLA 3VM5A 3CO8A 1DVJA 3M0YA 4MJ2A 4QAIA 1PO9A 5CSRA 3Q58A 5D2VA 2GUYA 4R85A 1UUQA 3TYBA 3URAA 1WXZA 2R1NA 1F8MA 1P5BA 1FXQA 1NEYA 3MHFA 3W37A 1J6PA 5DBUA 1V5XA 2A3HA 3Q4DA 1W1PA 3WQOA 2PODA 4PRRA 5LIYX 4GZJA 1DWGM 3FVDA 4MWAC 4DWSC 5EFFA 2UV8G 3VIGA 2CXGA 2NVDA 2ICSA 4MMWA 4BR1A 3DESA 3QPEA 7ENLA 1TG7A 3APYA 8CGTA 2B7NA 3AIEA 2FZ9A 2IW0A 2J4GA 3GW0A 1JXJA 4F40A 5AZ0A 4HT3A 4PCSA 3D5HA 1B2YA 2DT2A 4X3ZA 3CH0A 1BWKA 3OG3A 5KZDA 3S2NA 4IZGA 2J24A 4BZYA 1H0GA 3MCNA 3O9NA 1EO7A 3JZEA 1DE6A 3DC8A 1DJYA 3TCSA 3EZ4A 2NV9A 5HJYA 2EJ1A 3MANA 4MGGA 1H2JA 3PZGA 2A6LA 5AVHA 4Q3MA 3L4TA 1YTDA 5DF0A 1HGWA 3NA8A 4JFSA 3OLGA 4DI8A 4PA8A 2I5IA 3FEQA 2E8YA