3UPWA

Pichia stipitis oye2.6 complexed with nicotinamide
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
404
structure length
404
Chain Sequence
b'SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old Yellow Enzyme 2.6 (OYE2.6), NADPH dehydrogenase
molecule tags Oxidoreductase
source organism Scheffersomyces stipitis
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
total genus 156
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3upwA00
2FPTA 3PBUA 3NO5A 1QFEA 1H61A 1AW5A 3AJXA 4JICA 2WOQA 3LV5A 3CU2A 3QEZA 4MLRA 4MYAA 3RLVA 3PUEA 3TR2A 1YTEA 3LBCA 4MJMA 1FY6A 3DH7A 1T99A 1Q6OA 4QAIA 1KFBA 4K8EA 5AYXA 5DBTA 3W7IA 3LI0A 3B0UX 2DJLA 1L6YA 4PEKA 1GTEA 3W7QA 2TMDA 4ZZ9A 3PB2A 4I7VA 1ME8A 4UTLA 2C3ZA 3L0NA 1K8XA 1H7OA 3F4NA 5D02A 2QR6A 2WQPA 2DU2A 4D2JA 2GVGA 1O60A 1RZMA 3U2OA 1DKWA 2RHGA 2ZZ5A 4Z1AA 4LWWA 2FPVA 3HG4A 1ICSA 3W83A 3M5YA 1EP2A 3S9YA 3W76A 3C0JA 1N7KA 3PB0A 4FHAA 2QJGA 3QZEA 2Z6JA 3W1AA 1ZHAA 5LGZA 3GXTA 3QMSA 2XFWA 2YW3A 3QJAA 2OJPA 4GFSA 5G2WA 2ZDRA 3GZ3A 1I4NA 4IPIA 2ISWA 4DF1A 1LOLA 1KM2A 2ZZ6A 3LI1A 4UFHA 5DXYA 3B8DA 3HGRA 3TUUA 4TMBA 1KFCA 1K3UA 5FF3A 5D2WA 3UWYA 3KHJA 1H7RA 3C2VA 3EXTA 3NDOA 2ZBTA 3F4WA 4JX5A 4AB4A 3DXIA 1LCOA 1KV8A 4HNTA 1VYRA 3OHIA 3PR2A 2CLKA 4OHQA 4W9TA 3KVMA 1LOQA 5D04C 1K8YA 5KZEA 3I65A 1TMHA 3QPZA 1TQXA 4JN6A 3TH6A 1UASA 5G1TA 4YWIA 2RDTA 3IV3A 1QWGA 3W70A 3OVRA 3LCFA 3EX3A 3NG3A 1IXQA 3IGXA 2WO5A 4IGHA 3IIZA 1O5KA 2ZA3A 3C2EA 3HJZA 3N14A 2QCNA 4QQ3A 2Y6ZA 1OYBA 5L9FA 2H90A 3W72A 4E2BA 1DQWA 4BK9A 3L0KA 1G7VA 1HG3A 1FX6A 4GXMA 3CQ0A 1FXQA 3W7GA 1FUYA 1JCXA 2AQWA 1VR6A 5K7JA 3P67A 1EIXA 3KFTA 4XUGA 5KTLA 3L5AA 2V82A 3FYPA 1KFLA 1OHLA 3DFOA 3W75A 4RXGA 4UUIA 2ZRYA 1XUUA 3T55A 4B5NA 5K9DA 1OX4A 3WK3A 3DU0A 5LNVA 4HIBA 5G4EA 3UQNA 4PC8A 1H60A 2CLIA 2ZRZA 4O0KA 3TA6A 1OYCA 1L9WA 4IXHA 1FDZA 4JDBA 1A53A 3KVJA 4OU1A 2G97A 1GT8A 1GYNA 4O57A 8TIMA 1YDOA 3LCWA 1GOXA 4CNNA 3WK0A 4AHOA 5D38A 3BO9A 3VKJA 2DZWA 3BLFA 4WXZA 4M6PA 5AFDA 1F76A 4Y9AA 1TQJA 3WJYA 5I3IA 2FPYA 2Z2UA 3M16A 5AHNA 1T96A 4K37A 4O14A 2X1TA 1XUZA 3EXRA 3M9YA 4N6FA 2A5HA 5I3FA 3M1ZA 1QPRA 1XL9A 3GAKA 4CCDA 3MO7A 2NV1A 4WX2A 1W5OA 5LGXA 3T7VA 4HSNA 1SUXA 1J5TA 2DZPA 4UNKA 2OMAA 3TMQA 4LOCA 4R53A 3A23A 5F1VA 2F84A 4ORIA 4YCPA 1I2NA 1W37A 2J9YA 4OE7A 3W7EA 2B7QA 1TPC1 2PC4A 3O6DA 3GXNA 4Q4KA 3OEXA 3INPA 3P62A 4IOTA 2DP3A 3HGJA 3TXVA 4K39A 1OFRA 2ZYFA 2EKCA 5K4XA 3ATZA 1Q3NA 3QMTA 5HR7A 3QQ0A 2J6XA 2Y7GA 1AMKA 4OWGA 5HWJA 2P1FA 3V75A 1HO1A 3G22A 1XBZA 5EMUA 3C8FA 2ZA2A 3S5OA 2C13A 1PL9A 4OBTA 3GYEA 4ZQNA 5I3JA 2VFHA 5D30A 5FF7A 2O7SA 2QAPA 2GVLA 4MPQA 1C29A 1EPXA 1GVFA 4QSHA 3WK2A 1FWNA 2E5CA 2EHHA 3PUDA 3ABRA 3I68A 3GKFA 3TMLA 4UFLA 5G2HA 1ML1A 1X7FA 2FIQA 1SO3A 3LHTA 3DHFA 2OT1A 2X1RA 1GJPA 3GR8A 2BLEA 3RU6A 3UXAA 3C2RA 3QW4B 5D2VA 3FEMA 1HL2A 3T40A 3PUOA 4O13A 2VOMA 3LV6A 3BW2A 3W1XA 4NNCA 1OJXA 4LRSA 1EWEA 3C2FA 3LCGA 2I1OA 1QDSA 1LORA 1P0KA 1P0NA 3M0ZA 3ABOA 5G2IA 2YFOA 4X22A 3L0GA 4UR8A 4WY0B 1XDMA 2GJLA 1H1ZA 2TPSA 1SFJA 4HT3A 1EUAA 4WUIA 4NXKA 4NT0A 3NPVA 4JTJA 1DVJA 2WSYA 4QJ1A 3STCA 3JRKA 3I7SA 4OT7A 3CIXA 4BFAA 3TROA 1MSSA 4RCXA 1KLZA 5CPLA 5EKYA 3IGSA 2VEKA 2A4AA 4DF2A 3FKRA 1X8FA 4AWTA 1VHCA 4AVFA 1I2OA 5F2GA 2CLEA 3T44A 4JTIA 4NNBA 1Q6QA 5CSRA 3MP3A 3GLCA 4N9CA 3RLUA 4UXDA 4HNUA 4GRSA 3QPYA 1QPOA 2HS6A 4NJGA 2QCMA 3P80A 5BOOA 3QF0A 1FDJA 1SW3A 1B4EA 3E96A 4UTMA 2QCHA 4JXCA 4LRTA 3W1LA 2Z1BA 2NUYA 3UYCA 4UTWC 3CEUA 2VKZG 1CI1A 1WQ5A 5LZLA 1IF2A 3LHUA 4JTKA 3MI3A 4UTUA 2JGYA 3I7QA 3C56A 1TPFA 1S5WA 3NM1A 4HPJA 4AF0A 3A22A 1JUKA 3BG9A 3ZR4A 3BG3A 2ABBA 2Q3OA 2OZ0A 1S3HA 4JTHA 2RDWA 2A6NA 1JCLA 1RQEA 1VYSX 1A50A 5AN7A 2E09A 5KZMA 4QITA 2VXNA 3UZ5A 5FESA 1W54A 5CG7A 2NXIA 3BVJA 4FNSA 2DZUA 5AHEA 2WNQA 1G69A 3S1VA 4UTWA 3IVSA 4M7SA 3OBKA 1BEUA 3NQVA 3NVTA 2QF7A 3R89A 2NWSA 3HPSA 3TQKA 2B0MA 3P84A 4BWLC 1TV5A 3RK8A 3G1YA 5I3KA 4FO4A 4O15A 3THAA 5CKSA 1NAL1 2ZTJA 1KM3A 3E12A 4AMAA 3W7KA 1IXNA 3QQ1A 4ADUA 1TPEA 1AK5A 4UTJA 2WV8A 1J2WA 3W2UA 5K9CA 1LM1A 2DZSA 5K2ZA 1AW2A 3KVLA 3CLMA 3H54A 2H8XA 3GK0A 4LVFA 3M5XA 2J9ZA 3NZ1A 1W5PA 2EPHA 3DKJA 3NGJA 2VFFA 2BWGA 1H62A 4RK8A 2V9DA 1QO5A 5H91A 3W2KA 2GVJA 4JYEA 3GIYA 4JX6A 1M6JA 3LHWA 3PSWA 5LHEA 1W3NA 1P4CA 1LYXA 2WNNA 1KBJA 4UMAA 3PULA 2QUVA 3VFLA 1Q6LA 1K7XA 3HG5A 2C6QA 4H3DA 1K7FA 1QPQA 2Y62A 1Q6RA 3LXBA 3E0IA 3NM3A 3NQAA 1UJPA 4I7WA 1IXOA 4LC6A 4YXGA 4Z0JA 3ZWTA 3GDTA 3EX1A 1PE1A 2VFEA 1KFJA 1HO4A 1IIGA 3NQCA 1VZWA 3S6DA 2V8ZA 3FA5A 1EWDA 4QISA 4HPXA 3W74A 2ATMA 2WKJA 3P74A 4N9DA 5D33A 3Q58A 3NPWA 4LV4A 2FJKA 1R2SA 1V5XA 3QMRA 2E5BA 4O8RA 3W2LA 3STEA 2G95A 3FJLA 4EWND 3P8IA 3G1VA 3TSBA 4FNUA 3W07A 1I45A 4XKYA 2NZLA 1VS1A 1QCWA 3M44A 1FXPA 1PCKA 3M7WA 5D2TA 5IBXC 3NQ8A 1IIHA 5F2LA 3C2OA 4PODA 4FX7A 3G1AA 2VEMA 2KZHA 1H5YA 2NX3A 1MXSA 4RZ6A 2B4GA 3W1UA 3QFEA 1XDLA 3CEPA 3RNDA 2GQ8A 1OX5A 4DPPA 5MHBA 3P60A 5FEZA 1QNVA 4PFMA 3KVKA 3W1TA 1TTIA 3SGUA 1MEHA 4JTGA 3OG3A 5D03A 3UWVA 3HOJA 3B03A 1ZAIA 4JY8A 3VI2A 4MLJA 2EF9A 5E93A 2ZCGA 1ZALA 4EOUA 1XXXA 4DO6A 3GAYA 1JRBA 4ICNA 4LW7A 3HG3A 2AAMA 2PRHA 1GG0A 5C6MA 5CSSA 4K38A 2BX7A 2R14A 1Y0EA 2W0UA 3S5NA 1TPUA 4UMBA 3USBA 3M41A 4M19A 2JGQA 2TRSA 3MI6A 3P7YA 1R2TA 1LZOA 1BKSA 4YMZA 5G5IA 3E9AA 1SFLA 1LOSA 3ABSA 1B9BA 1TPDA 2HTMA 3BGGA 2G96A 1ZFJA 3CB8A 3LX9A 4HHPA 1X1OA 1DQXA 2V2DA 1LRTA 5KITA 4LVBA 4N6EA 1ALDA 4LU0A 4NU7A 4Z1DA 4AHPA 5DY3A 3T78A 1W31A 1JUBA 3B0VC 3QYQA 3P5YA 4CQAA 2NX9A 3W88A 1YLVA 3S5ZA 1TPWA 3NQGA 5LNRA 1S5TA 3SFKA 4P2VA 3NQ7A 1SSDA 4IMGA 5BRBA 3RF9A 2ZRUA 3W7RA 3GVGA 1XI3A 2FFCA 5BNKA 3HMJG 1JUEA 5DELA 1RPXA 4DQWA 1D9EA 3NYZA 1JR1A 2E6YA 1WBHA 4BWLA 3NA8A 1JQXA 4NZFA 4EVZA 3GDRA 1SZEA 4NZJA 1K02A 3DKLA 2YYUA 3NAVA 1L6WA 1O4UA 4AXKA 4H6KA 3UY8A 4ZQMA 5J5DA 2J24A 1H50A 4FNQA 3NQMA 3EWXA 2R8WA 1YTKA 2YX0A 1SU5A 1GEQA 2CLOA 3PG8A 3L9CA 1FCUA 5CZTA 2QCCA 1UUOA 1AG1O 4TMCA 2GUUA 1SO4A 3NQDA 1OFQA 1S5VA 3YPIA 3UZJA 1GTHA 3DFQA 2DZVA 1NVMA 4JX4A 4GUFA 5FEWA 2FDSA 3L21A 1MO0A 4LS0A 5H2ZA 3MJYA 5LSMA 4LVGA 4L4LA 4FX6M 2A85A 5U7SA 1YYAA 3SJ3A 3W1NA 1WV2A 3B05A 1RR2A 3B04A 2H3BA 5CPMA 1GWJA 2X1SA 1C9DA 3CM4A 1K03A 3L67A 3LHYA 4JTSA 4JIPA 4P61A 1BTMA 3TKFA 2X30A 3NQ2A 2E1DA 3C4UA 4UMCA 2A6LA 1ZENA 4IMCA 4R34A 3VCRA 3JR2A 4NJJA 3U8GA 2DZXA 2YW4A 3W2MA 3UWUA 1YXCA 2Z6IA 3L2IA 3ABQA 4IX0A 2P0OA 3U6WA 2GOUA 3W7NA 3DZ1A 3HQ1A 2OX1A 1R47A 2ISSA 2JK2A 2H3DA 2O7QA 3NZRA 1VJIA 4WY0F 4YL2A 1YDNA 3NQEA 1ZCOA 3M6YA 4UFJA 4X2RA 3PS7A 3N34A 3G8EA 3WJXA 2W6RA 3KX6A 3SR7A 4LVDA 1FCQA 3O6YX 3W7JA 1PHQA 3DHDA 2A7NA 3TV8A 3TJXA 2D73A 1VQTA 3PG9A 2NLIA 2ATSA 1XKYA 1EP3A 2WSRA 1G67A 3M47A 2YPIA 3EWZA 4GUHA 1VGAA 3QH2A 4UTIA 5D2XA 5GVJA 3CC1A 3P82A 1TJPA 4O16A 5HWMA 1WYIA 3W1RA 1LLZA 4O54A 3TCEA 2G5WA 5HUOA 1O95A 4A21A 2V2HA 3CIWA 4A2RA 1E51A 1RVGA 2LLEA 2VELA 4BI7A 1SQ7A 3LB0A 4JTLA 2CLFA 2GPTA 3IIVA 1BWKA 3PF3A 2ZRXA 1KA9F 1W3IA 2ZTKA 3TFXA 2V81A 3TW7A 5D05A 2E6FA 4O12A 4I7UA 1XFBA 4O4VA 4E38A 1FWSA 4ADSA 5DY2A 4O11A 3NXFA 2HMCA 3EXSA 5D32A 4O19A 3MHUA 1TTQA 1ZAHA 2JKAA 4IMFA 4NNAA 1NF0A 4MJZA 5LKYA 2Y7DA 3O1NA 4UIOA 3GNDA 3E02A 5FEXA 4IMEA 4OGZA 3DAQA 4IWWA 5TQLA 3GNNA 5EYWA 4XZ9A 1Z48A 3G1FA 3ZFHA 3L66A 3EWYA 1JCNA 4HN4A 1N8FA 1GVSA 4O1AA 3C6CA 1DL3A 5FEPA 4CCEA 3HPXA 3LXCA 3LOTA 1KM1A 1KTCA 1XBVA 5LHFA 3LCHA 4LT9A 5KINA 5FF2A 1G6CA 1NEYA 4AWUA 5AYZA 3RFAA 2CLHA 2V2CA 2DJXA 4RX0A 2QCDB 1QAPA 5CPNA 6TIMA 1D3HA 1OX6A 3L5MA 2QCGA 1VCFA 3FYOA 4ZQRA 4UFMA 2IQTA 4GWEA 4RR4A 4WY0A 2QAFA 3TSDA 2B7OA 1T0OA 4MZ1A 4K8HA 4ZL1A 3W7PA 4CQ8A 1TV8A 1H1YA 3LRLA 2CZEA 1KTNA 1ADOA 3CT7A 3BLIA 1VPXA 5CPOA 4UNLA 2ZQ0A 3LERA 4IJBA 2CZDA 1L2UA 3LDVA 2A1YA 1SW0A 4AF0B 4MY9A 4AHQA 5C54A 1JCYA 3NL5A 3JS3A 4C1LA 1SO6A 2NX1A 1TRDA 3SGZA 3L65A 1W56A 4K7VA 3FLUA 3R5EA 5BW6A 4GUJA 3SSJA 2AGKA 4X9SA 1TTJA 2CLLA 4NXSA 1F7BA 4QNWA 2Y70A 4HNNA 2V5BA 5EY5A 4BI6A 4AWSA 3D0CA 1KFEA 3W7MA 4MKNA 3UPBA 1EB3A 1ONRA 1ME7A 4GC4A 4RJEA 5F2IA 4MFEA 2A7RA 3FIGA 3O15A 5FI8A 3UPWA 5J5RA 3G1DA 4TU1A 2EAWA 5D2YA 1H7PA 3A24A 3LBMA 3HPZA 1G4PA 3R2GA 1H7NA 4JGDA 1BWLA 3Q37A 4IQLA 5C2XA 3BLEA 4Z08A 1H7XA 4HKPA 3GDMA 4JNMA 4LUJA 2YYTA 4YLWA 1KW1A 1M7PA 3LRMA 3Q2DA 2FB2A 2Z0IA 1LBLA 3GXPA 4QNEA 4DXVA 4JTEA 1SO5A 3DFPA 4JS3A 3MHGA 2WPBA 4FNRA 3TAKA 1R30A 2BZNA 3FFSA 1XM3A 5LNSA 1B57A 4XTIA 3WJWA 1MEIA 1PV8A 3QC3A 1I2PA 3W22A 1JQVA 1OFAA 1HTIA 2BXVA 1EEPA 4LY8A 3SZ8A 1W5NA 4IUOA 1NFBA 2PURA 4EF9A 1LRNA 3O06A 1W0MA 1QPNA 1SPQA 4NJIA 3A9IA 4HNVA 1T8XA 2FTPA 4PL2A 4A22A 3WFAA 4ALDA 3I7RA 3L5LA 4LUIA 4ZVJA 2Q8LA 5I3GA 3HO8A 4XBKA 1A5BA 4RLIA 2VFIA 4JY9A 4CQ9A 2QUUA 1VLIA 4Y90A 4N4PA 4LS1A 1VRDA 2NUXA 1OYAA 1YXDA 3HGOA 3G0XA 4KFOA 2E6DA 2E68A 1XBYA 4O1BA 4FNTA 4Y96A 3STGA 5IBXA 3MHFA 4BF9A 3QM3A 2QCFA 5DCEA 3MBDA 4JYDA 3M5VA 3NL3A 3TJLA 1SW7A 4OV4A 1LP6A 3W71A 5F2MA 1EA0A 3OVPA 3R13A 4K6AA 5A5WA 1LRQA 4ZQPA 3V1PA 1KTBA 2YDAA 5AC6A 3VE7A 1EP1A 1AL8A 1DBTA 3EKZA 5CZSA 4U28A 1UB3A 3EX6A 3TNOA 4AAJA 4I9AA 1ZAJA 3BW4A 1A5CA 3NL2A 1EX5A 4KKXA 7TIMA 3O07A 3S0CA 3W6YA 3N2XA 1JVNA 3SIZA 3WK1A 2QUTA 3W1QA 4TIMA 2E77A 4O52A 3K30A 4ML9A 3IVTA 4FIQA 5F4SA 5DN1A 3FS2A 1O5XA 4PA8A 4R7JA 1RQBA 4EIVA 4A3UA 5CZ0A 4MIMA 2HSAA 3PM6A 3W7DA 4MZ8A 4XTDA 3W87A 5F4XA 3SECA 2ABAA 4MZYA 2NV2A 5BMXA 4UTTC 3Q94A 5DCDA 2CLMA 5U4NA 1YDVA 3P5ZA 4NX0A 5AOUA 1YXYA 4POCA 5EPDA 2B7NA 5KMYA 1I2QA 2Q3RA 2QCDA 3CPRA 3O8AA 3N9RA 4LTSA 4RZ4A 1U83A 3LCIA 1WXJA 4LNYA 1TPVA 4TX9A 2E6AA 2PRLA 1GVQA 3LTYA 1QOQA 3EWBX 1F6KA 1H51A 3P81A 1ZNNA 4MY8A 2C15A 4N9EA 3VE9A 4JYFA 4DO4A 4S2CA 4WD0A 3LHZA 4EF8A 4O1DA 5K4ZA 2ALDA 3B4UA 2H6RA 3G1XA 3O6CA 3A5VA 3VNDA 1F74A 3O63A 2YZRA 1AL7A 3BV4A 3W84A 5E1QA 1FBAA 1F5ZA 3G1SA 3R8RA 1YPIA 1OF6A 3PWAA 5AHLA 3EX4A 1F6PA 4IXXA 2ZZ4A 3TK7A 1IXPA 1HUVA 2Y7EA 4Q32A 3TSMA 3IVUA 3CHVA 3IIXA 3L68A 3TXZA 4MYXA 4ONVA 2J9XA 1F2JA 3W7LA 3BPWA 1OK4A 3S1UA 3N9SA 3NEVA 2V30A 4CNOA 3MUXA 5ABTA 1MEWA 1KFKA 1QMLA 5A8GA 4UR7A 2JKEA 4K36A 1R2RA 1QOPA 5KSWA 2CU0A 4JEQA 4RZ5A 1JCMP 3TX9A 1EUNA 5EL1A 1VYPX 4FEZA 2P10A 3DI1A 3G0UA 1KLYA 3O05A 2C16A 3P61A 1WAUA 3LXAA 5IM51 1GZGA 2FQIA 1I8JA 5T26A 1R46A 1M5WA 2YSWA 5D37A 1KM5A 2VEIA 4UCGA 1DHPA 2ZZ1A 4A29A 5FF0A 1OFPA 1FWWA 4GUIA 1U5JA 4FF7A 3G3MA 1TREA 3BW3A 2C18A 4UTTA 4PH6A 2XN0A 2NUWA 2ZRVA 4C1KA 3NQFA 2BTMA 1B3OA 2UV8G 1JRCA 1W8SA 3NPUA 4GUGA 1UCWA 1KM6A 1RD5A 1LBFA 4GBUA 5DXXA 1G4TA 4NX5A 4K7YA 2ZZ7A 1XCFA 2YGYA 1HFBA 2QDGA 2RKXA 4O1CA 3UWWA 5F1UA 5HUPA 3LLFA 3QSTA 3W2NA 3W7HA 3OIXA 4AH7A 3C61A 1YTDA 4BI5A 1I2RA 4DPQA 4Y6GA 2GQ9A 1LDCA 3LTPA 1NF7A 4IX2A 4JTTA 4JD4A 3HBLA 5AHFA 3MYPA 3TC6A 3PBYA 1FWTA 3EB2A 3W73A 3HG2A 2RDUA 4XWUA 3SW6A 1X6UA 4ORMA 2HS8A 1KV5A 1OABA 1P1XA 3G24A 1A5AA 5F4WA 6ALDA 2QCLA 2A7PA 1KM0A 2QDHA 3IIPA 1TV7A 2I14A 3NL6A 2QJIA 1DJNA 1GVOA 2WSQA 4O0ZA 3PC0A 1GG1A 3B0PA 2Y63A 3ATYA 1LROA 2QJHA 1TJRA 1D3GA 3S5YA 4MFDA 4Q33A 3B06A 3N73A 3NR0A 3AO0A 3ELFA 4DEFA 2FB3A 5HULA 1W5QA 2OCZA 3PSVA 2Y85A 3EWUA 1PIIA 4O10A 4QIUA 1SZGA 2C14A 4PTNA 5L6UA 1VHNA 2YXGA 3TFCA 3MYOA 4U4MA 1WX0A 1B4KA 3CWNA 1F73A 3LRKA 5K9XA 4JTFA 3ZWSA 4A2SA 1OFBA 1JJKA 2WJZA 1OK6A 1GPWA 3PY2A 2ZZ3A 4UFKA 2JKPA 3S42A 3GDLA 4KFNA 4NJKA 4Y8FA 4KWVA 3T4CA 5HMSA 1TPB1 1TB3A 1WBJA 4GNJA 3MMTA 4MUZA 4DELA 2J88A 3ANYA 3HB9A 1F05A 4DF0A 1L6SA 1Z42A 3FOKA 1UBSA 1FWRA 4Z1BA 2CWNA 2ZA1A 3LHVA 2I9EA 2CZFA 1VCVA 4YCOA 2F7FA 2CW6A 4MOZA 1OX4B 1WDWA 4UFIA 3MW7A 3C3NA 3SY5A 1TYGA 2QKFA 4RXFA 1JCJA 4M6VA 3MP4A 3GKAA 3DENA 4O17A 1OF8A 3QRHA 3UD6A 5HR6A 1TIMA 4XKYB 2XN1A 5SWUA 1AW1A 2TYSA 3FJ6A 3MBFA 4ZQCA 1TTPA 1PCWA 5C55A 3HF3A 4KWWA 3NQ6A 1GQNA 1FDYA 4ADTA 4OQVA 2ZFAA 5TIMA 2V0TA 3CTLA 5K3VA 2XN2A 4TO8A 3N19B 1O94A 3DFNA 3EEGA 2B7PA 4FXSA 2FLIA 1H7WA 1Z41A 1C8VA 2NWRA 4PCFA 2A21A 3DI0A 4UTKA 3NPXA 2J27A 3SI9A 5D09A 4XBSA 1W1ZA 3TQVA 1SZNA 1ZY9A 1VH7A 1VLWA 4M5PA 1FCBA 4LC8A 3GB6A 1DV7A 3LGEA 5AC7A 4NJHA 3C52A 4M7TA 4MY1A 4KFPA 4FB7A 1A5SA 3F1QA 4JR5A 3PBVA 2Q8ZA 3O16A 3TC7A 3HIJA 1KM4A 5C5YA 1TPH1 1V7YA 2C0AA 4N02A 3TW6A 4JDYA 2OT0A 2W79A 4FIRA 1THFD 4QM1A 2JBMA 4FX8A 1G7UA 1FCVA 4E0CA 5HJLA 4RV8A 2Y89A 3UXDA 4CNPA 5G4WA 3PBWA 4E2DA 2Y7FA 2Y88A 1ICQA 4G1KA 3KRZA 1W3TA 3HGSA 3LCXA 3UWZA 1OFOA 5BMWA 3DGRA 3PVFA 2R94A 1LBMA 4JTUA 3STFA 3UNDA 3MP5A 4H4IA 3OA3A 4ZMGA 1TCDA 5I3HA 1WA3A 3WJSA 3KRSA 5KZDA 3MWAA 3TQ0A 3DFSA 1PVNA 1DORA 4UC5A 4IMDA 2ISVA 1Z44A 3BK0A 4L4MA 4J9JA 4JIQA 3TE9A 3FKKA 2YCEA 1M7OA 4Z1CA 3CWOX 5G1YA 2C19A 1QR7A 4BR1A 2X2GA 3EX2A 1LLWA 3P8JA 1MZHA 1CW2A 3DFTA 3M43A 3GR7A 1H63A 3TIMA 2DORA 1YPFA 1G4EA 3IIOA 2VC6A 4WZHA 3QW3A 5HQEA 2X16A 5AHIA 4PL1A 1J4EA 3G3DA 2NXHA 4WOQA 2ZRWA 4O53A 3I6RA 2VFDA 3G18A 3LM7A 1YADA 4LS2A 3R12A 4NUWA 1OFEA 1TO3A 3BG5A 4S1FA 1PS9A 2BSLA 3KOFA 3G0SA 1CX9A 5DLCA 5AYYA 1FQ0A 1PHWA 1SZFA 3W7CA 3LLDA 2NXGA 1P5BA 2YFNA 1WOBA 2YR1A 4S2BA 3W7OA 2Y61A 4O4WA 5HWNA 2GJNA 3W1MA 5AC8A 5TBOA 2QCEA 4N2YA 3BGJA 4LVAA 3OVQA 3TDFA 4Z0SA 4ZQOA 5DCBA 3A5FA 5AB3A 1RQHA 2GQAA 3H55A 4GE8A 4AEOA 1ZJIA 2ZZ2A 1ME9A 3IEBA 3M5ZA 3PAJA 3WJZA 3S8HA 4N9BA 3ZS4A 1X1ZA 4XQ6A 2E5DA 1TSIA 1DOSA 2RH9A 2X1UA 4MVAA 3THQA 4TR9A 3W23A 2R91A 3LTSA 3S1XA 4DBEA 3GX9A 4IPJA 3GDKA 1XC4A 4WJEA 5E0KA 3IGUA 2CFFA 4WQ6A 1KBIA 3W85A 3NNTA 2A2IA 2DZTA 3RMJA 3N2MA 3KRUA 3MI2A 1K7EA 4DO5A 2A0NA 1GVRA 3KXQA 1TRIA 4O50A 5FF4A 2VENA 3H53A 1NSJA 3N3MA 4N4QA 1WOAA 5EBUA 5HNRA 3IRDA 2PE4A 3G1HA 3G8RA 1Q45A 3UY7A 5LNWA 3EKLA 3DBPA 2TSYA 5LNUA 2VFGA 4WOZA 5CZJA 3UWQA 1UUMA 5CGQA 3BARA 3KAOA 5DBUA 2WNZA 2RFGA 4FNPA 2V5LA 4O28A 1W5MA 2PRMA 4CLMA 4CCCA 3TAOA 3NOEA 2CZ5A 1G4SA 3W2JA 4HSOA 1SR9A 2C1HA 3W1PA 1LTDA 3W9ZA 4M6QA 1OG0A 1OFDA 3QSRA 5HINA 4RKAA 2H8ZA 4WXYA 1RV8A 1XBXA 5AHMA 1K8ZA 3W86A 3TU9A 1SSGA 2VEPA 4DBDA 2EGZA 3F03K 4FXRA 1OVDA 4NQ1A 4UTHA 1IGSA 3A21A 3LCLA 4LV9A 1VC4A 3EWWA 2PCQA 1ICPA 1QO2A 4OV9A 1GYLA 3W3OA 4NVTA 4O18A 3S1WA 4R33A 1JULA 4GJ1A 3E49A 1N55A 1VCGA 1DJQA 2QEZA 4X3ZA 5EA9A
chains in the Genus database with same CATH superfamily
3VNJA 2FPTA 1F3XA 4G7FA 1JZ4A 1KXHA 1AH0A 1DIOA 2WOQA 3LV5A 3CU2A 2WJFA 3QEZA 3RLVA 3PUEA 1YTEA 3K8LA 3LBCA 1MW2A 2YOCA 4MJMA 3DH7A 1Q6OA 1Q8JA 3QOMA 4K8EA 1XLGA 3GFXA 2WQDA 4B2DD 3LI0A 4GJJA 3B0UX 4PEKA 1GTEA 1ME8A 4UTLA 1R3SA 5JQ9A 3FXGA 3GS6A 4B2DA 3PJUA 2WQPA 4D2JA 5B80A 1O60A 1DKWA 1JAKA 4LWWA 2I56A 1N7KA 4JL2A 2IKJA 3SY8A 1NWRA 3HA1A 4RPQA 1RXOB 5IHRA 1N82A 4LYPA 2Y0FA 3EA1A 1MNZA 1R3VA 2YW3A 4HQVA 2OOFA 2ZDSA 4GFSA 4GLEA 5G2WA 3IGHX 2ZDRA 2PDFA 3GZ3A 1AA1B 4GZIA 4DF1A 4FPSA 1FRBA 3LI1A 4UFHA 5DXYA 4WGHA 2ZX8A 2NSOA 3OLEA 3WELA 1TG7A 1UR3M 4L65A 2ZBTA 2YB1A 3L2LA 3DXIA 4EXBA 3BAIA 2IS7A 2FH6A 5E6YA 4H01A 4D1JA 4Q8OA 3OHIA 3PR2A 2CLKA 2J79A 4W9TA 1J0JA 3ZVHB 2CHOA 5KZEA 4RDVA 3QPZA 2WWDA 3CPUA 4XZBA 5G1TA 5C0QA 4M81A 4YWIA 3FYYA 3AALA 3LCFA 3NG3A 3IGXA 2WJEA 2ZA3A 3TZNA 1OYBA 4MGGA 1MXGA 4UQCA 3BAKA 4E2BA 1HG3A 2OEKA 4FLOA 1DJWA 1FUYA 1JCXA 3H24A 1VR6A 4NL1A 2XVPA 4XX6A 4XUGA 5KTLA 2V82A 3DHUA 1FA2A 4PRTA 4LCSA 4FLSA 4RXGA 4TV6A 2ZRYA 4KQNA 4ROQA 5G4EA 4DO7A 4PC8A 3DCPA 3L7RA 4F8XA 2CLIA 3AI0A 4UQ9A 3BDKA 2VMFA 1GOWA 1OYCA 1L9WA 4C6PA 4JPGA 3MDWA 2BHZA 2EXOA 4OU1A 3QTPA 1EJWC 2FYMA 4URIA 2QDDA 1IV8A 4O57A 3B9NA 8TIMA 2ZUSA 3LCWA 5GJMA 4AHOA 3BO9A 5IRPA 3W26A 4JHMA 1EBGA 3BLFA 3H4WA 3MKVA 1BKHA 2V3DA 3UR5A 1R3YA 1IE7C 5BU6A 1RD6A 1F76A 1W3KA 1IEXA 1T96A 1BYCA 4K37A 2P8CA 1GQIA 1XUZA 3EXRA 4BY3A 3GAKA 3MWCA 4Z17A 4EANA 4WX2A 3TJ4A 5LGXA 3T2OA 4UNKA 4F4RA 3TMQA 3HQPA 4LOCA 4R53A 5F1VA 2BODX 5A8OA 1W37A 3MC5A 2B7QA 1GUVA 2PC4A 5EMYA 3UJ2A 4J3ZA 1M1BA 1W9VA 4BF5A 2D23A 3P62A 4H2HA 3JW7A 1EOMA 4IOTA 1XPYA 1OFRA 3WLMA 4AZCA 4R3UA 2GFTA 4YTUA 2A79A 2Q71A 2J6XA 1R5YA 1AMKA 3DGBA 4MG4A 5HWJA 3GXIA 4E4FA 3H2MA 1XBZA 4KH2A 3C8FA 1GYMA 1MXDA 1BG4A 1WXZA 3H12A 4OBTA 3GYEA 1A0EA 1XIGA 2VFHA 1XIHA 2QAPA 5FF7A 4C1NB 1C29A 1XH0A 1FWNA 3GKFA 4PBGA 1H1NA 2ZVIA 4ERIA 3RYSA 2PTYA 2PD9A 1SO3A 3DHFA 4W7UA 2OT1A 5E9AA 2DEPA 5LA0A 1A0CA 1BVWA 4XISA 1CLXA 3PUOA 2PLCA 3VC6A 4DWSD 4NNCA 5A94A 3BMXA 1OJXA 1V3JA 2CNCA 3HFYA 1QDSA 1LORA 4FOUA 1P0NA 3AYTA 4REQA 2ZXAA 4PTWA 4UR8A 4WY0B 1M7XA 2DVXA 3N2OA 1BYAA 3MZNA 1EUAA 1QK2A 2OYMA 4NXKA 4UQDA 2DQXA 3STCA 5CAHA 3JRKA 3I7SA 1XF0A 3JVAA 1MSSA 4S39A 2X1IA 5C8BB 3AIRA 3D6NA 4QDPA 2XGIA 2RJGA 3SQMA 1WKEA 2CLEA 1N8IA 2VNCA 1DWIM 3U9IA 4WLCA 4PMJA 2F8QA 4WKAA 3VGDA 4GVIA 1Q5MA 3RLUA 2E1WA 3HURA 4CD8A 4HVXA 3WDIA 4D9PA 4NJGA 1B4EA 1EJTC 2NUYA 2V69A 4G9PA 3QKZA 3URAA 2C0HA 2Q01A 3BOFA 1CI1A 1UYQA 5BXTA 3CMFA 5IOBA 5LZLA 3BCDA 2QF8A 4E2VA 1CLKA 2JGYA 3I7QA 1TPFA 1XLHA 1U22A 2XGZA 3A22A 4B3ZA 1JUKA 4DLFA 4YTRA 3UZXA 4E6MA 4JTHA 4HK7A 3VUSA 3WLJA 2RDWA 2A6NA 3E0WA 3WLPA 4DJDC 1VYSX 3SY1A 1A50A 5AN7A 2E09A 2WXDM 1MZRA 5CQ1A 3OTRA 3VIJA 3BVJA 4HK5A 3M0HA 4DUOA 5AHEA 5BXSA 4PB3A 4PCSA 2PWEA 2F38A 3IVSA 4M7SA 3PP7A 3WQPA 1Q4WA 3NVTA 3BSMA 3HPSA 3GUGA 2B0MA 3P84A 2FHCA 4MMWA 3VIOA 5AZ0A 2BMBA 4S3FA 3RK8A 4FO4A 3THAA 2ZTJA 3VDBA 3FY1A 2XGBA 3LNPA 1AK5A 5EGRA 4GCXA 2UY2A 2WV8A 2XFYA 3WX7A 3TYZA 3SCVA 2WM0A 4QLKA 1KO0A 3H54A 3ZM8A 4DZAA 3GK0A 3ABXA 3NZ1A 1OEPA 1V4YA 2HBXA 3NGJA 3T6CA 4RK8A 1QO5A 4OUEA 2Z4GA 1EJ7L 4JYEA 3RIKA 1PTAA 1W3NA 1TWWA 1LYXA 2WNNA 4B5XA 3NXLA 3TEVA 3AYVA 1N2VA 4AZGA 2C6QA 1I1XA 4H3DA 1A80A 1CBGA 3LXBA 1Q6RA 2INZA 3MCOA 1FWGC 4I7WA 2Z7GA 1IXOA 4LC6A 1RAKA 1XKJA 3K1DA 3GH4A 3W4RA 2QHAA 4GHRA 3W53A 4HPXA 3W74A 2WKJA 3LBOA 2XSXA 1J0YA 1OT2A 3GFZA 4N9DA 2PMQA 4CN1A 1DEDA 5D33A 1ZSXA 3ARQA 3W2LA 3ZJ8A 3STEA 3VIIA 2WMFA 3P8IA 3G1VA 3TSBA 3QGKC 4FNUA 1FTXA 3W07A 1VS1A 4U5KA 4NAFB 5LIKX 3M44A 1FXPA 3RGTA 4YTQA 1R38A 4L5ZA 1IIHA 1ECQA 3C2OA 5F2LA 4PODA 2VEMA 4KBXA 2BGSA 3EA3A 2NX3A 3H7VA 2X8RA 3W1UA 5DMYA 2WHJA 3CEPA 1OX5A 2REQB 3P60A 3E1F1 3KVKA 4BA0A 3SCWA 2B81A 3UWVA 3HOJA 1ZBKA 1J9YA 3TC3A 1UMLA 3CZ8A 1Z32X 4Q4PA 5E93A 2ZCGA 2PA6A 2GGEA 4DO6A 5KETA 3GAYA 1EJVC 2Z24A 1GG0A 5D8ZA 3KS5A 3VTRA 2W62A 4AISA 2PDQA 3KTXA 3N4AA 1TPUA 2TRSA 3WUGA 3WD4A 2IXVA 3O3RA 1BKSA 4YMZA 2PWFA 2XH0A 3NZGA 4LUSA 3GHTA 1TPDA 2D3NA 3UJRA 1ZFJA 3UR7A 3CAKA 3REQB 3H2FA 5A6JA 1ITQA 4LVBA 4N6EA 2W66A 4AHPA 5DY3A 1DPMA 2EJ1A 1OD8A 3P5YA 4CQAA 3CL8A 3SAZA 3S5ZA 3IUIA 4DWSC 3B0YA 5LNRA 3ANVA 3N11A 2QVNA 5D8WA 1QNPA 2FFCA 3HMJG 5DELA 2A3LA 2PU1A 2A3BA 3NYZA 3ABZA 2E6YA 1E9YB 1NIUA 2QJNA 1JQXA 4NZFA 4Z2GA 1JYWA 4WF7A 2OYKA 3UY8A 1P6CA 2W4XA 3KBMA 2J24A 1H50A 4PYSA 4IIGA 4KERA 3EWXA 3LY0A 2R8WA 4OJYA 5GJNA 2DQWA 1KBBA 1YTKA 4HCHA 1SU5A 3VX0A 3E38A 2O9RA 1W8GA 2CLOA 3W02A 3AIUA 1BF6A 3VILA 1AG1O 4TMCA 4ZGYA 1PZ2A 2CZVA 3WNNA 2PP1A 4JX4A 4ZXOA 2CIPA 3TCSA 1V77A 1X6LA 2GSJA 4L4LA 4KRZA 5U7SA 3SJ3A 1L6GA 4HTBA 3B05A 3UU0A 1XS2A 1P1MA 3C5QA 2GZXA 3CM4A 3UWEA 3KP0A 1OD0A 1UKPA 4J40A 4P61A 1GOMA 1R3WA 6REQA 4UMCA 2A6LA 1ZENA 2ESCA 2WC3A 5A6BA 3KE0A 5JIWA 5HPOA 3BC9A 1R9XA 4WEVX 4IX0A 2P0OA 2OX1A 1R47A 2DT1A 4EKJA 4B9YA 3NZRA 2AGTA 4F0SA 3WUFA 1YDNA 3NQEA 3I10A 3M6YA 3PS7A 2BY2A 3QTGA 2ZUTA 2W6RA 2Y1HA 4FP1A 4LVDA 2D1ZA 1UZHA 3OVGA 1KCZA 2R82A 3V7PA 4Q8UA 1VQTA 4DI9A 5GJPA 1Q66A 3UGVA 3QHMA 3AIEA 3VXGA 2YBVA 2YPIA 1KKOA 3EWZA 1IT8A 4GUHA 3M0XA 1VGAA 4AW7A 4DYEA 3CC1A 1RP8A 1TJPA 1WYIA 1T6MA 3W1RA 4O54A 3TCEA 1O95A 3LQGA 2V2HA 4PGLA 3VNMA 4A2RA 3BWWA 2LLEA 4DWDA 4BI7A 3LB0A 1GVIA 1ZBCA 4FLRA 3IIVA 3V5FA 1BWKA 4A8LA 1KA9F 1S2CA 2ZTKA 4GISA 3WN6A 2Z25A 4P8VA 1KXVA 1OBAA 1XIFA 3FN9A 3BH4A 1V0KA 4LUTB 5DY2A 4O11A 3ZXWA 5C71A 3UJFA 4I9MA 3OW1A 2YKKA 3GG1A 1MUWA 4XAYA 4MJZA 4ACYA 3O1NA 1XLBA 3DECA 1IHIA 2UBPC 1H41A 1UW9A 1VENA 3DAQA 3DDMA 1RUSA 3L4TA 4ZCWA 3L66A 4PBEA 1CGXA 2WZIA 3C6CA 1ZJBA 3RO6A 3LXCA 2A3CA 1HQTA 2DUAA 4XZIA 2G8ZA 5LHFA 3LCHA 7PTDA 1NEYA 4S3AA 5FJTA 2V2CA 2DJXA 6CGTA 4RX0A 3GTFA 5FSDC 2VX5A 1QAPA 1A4MA 4IF2A 3UFYA 1XIIA 2WVTA 3KEHA 2R1PA 3N17A 3WLSA 4F2BA 2PDLA 3VINA 3J7HA 1WZKA 1VCFA 3FYOA 5DT7A 3ITXA 2PDJA 1QBBA 3VVGA 1JCTA 4GWEA 4RR4A 2QAFA 4FK9A 4BQ2A 2E9MA 4DJFD 4ZL1A 3HV8A 1LL4A 1H1YA 1TCMA 2WBKA 4HU3A 4HU0A 5C9ZA 3BLLA 1XCXA 2F6KA 3QOKA 2CITA 2ZQ0A 3N13A 5FL0A 4RE4A 2Y2WA 3VZZA 3HZ3A 3KUMA 4H7CA 4DJEA 1SW0A 4AF0B 4LFYA 4D6GA 2HCVA 2YDSA 4TVDA 1UHVA 1TRDA 2V3FA 1B2YA 1H3GA 4JTCA 4K7VA 4NKCA 3R5EA 4PB5A 4GUJA 2X2YA 3CL7A 1TTJA 5EY5A 4AWSA 3D0CA 3PZNA 1JXKA 4Q8NA 2OZ8A 1PXGA 4GXPA 1ONRA 3O15A 5FI8A 2Z1XA 5J5RA 4GI9A 4TU1A 2EAWA 3QLLA 1BWLA 4O1FA 3IJLA 4AD1A 3HMCA 4JNMA 2YYTA 1EYWA 2D24A 1P0BA 2Z0IA 1LBLA 2FZ8A 4HBKA 1QHPA 4QNEA 1IWBA 3PN8A 2AKZA 4NYYA 2PSNA 4HZ8A 4WHBA 1EF2A 4JS3A 3MHGA 3GH7A 1UZ4A 1CTNA 4XKMA 2F2KA 1R30A 4IICA 2XU2A 1I6NA 3FAWA 5LNSA 3FA4A 4XTIA 4NZCA 4L6DA 4X0VA 2BXVA 3KBNA 1FFRA 2FTWA 5GPRA 1TR9A 1B3VA 3SZ8A 4IUOA 3ARZA 3LU2A 1LRNA 2J7FA 3O6AA 2J7CA 4A22A 1ZUAX 3PAOA 3AXKA 4LUIA 3TW9A 3WNOA 2Q8LA 4XBKA 1U33A 3IJIA 4RLIA 4YWSA 3U4AA 2Y5EA 4JY9A 4CQ9A 2BOGX 2V3GA 4JTQA 2DIKA 5HQMA 4RDYA 4WRHA 2PDKA 3B3DA 3G0XA 1XBYA 4O1BA 1WDSA 3KOYA 4P7NA 4A05A 1XLCA 3F2DA 4PCTA 1O1ZA 5DCEA 4H00A 1UD3A 4LAUA 4A3QA 3MBDA 4Q7BA 3NL3A 1JNEA 1XLLA 4GFIA 1LP6A 3AU6A 5F2MA 1UH3A 1VBHA 4C6IA 4K6AA 3BAWA 1KTBA 3VE7A 4MHBA 1AL8A 3EKZA 1VIZA 4U28A 3K5XA 1UB3A 3EX6A 3TNOA 3BW4A 1XC6A 4GX9A 2OO6A 2IPFA 7TIMA 1XJBA 2VRQA 2PWUA 1EF3A 4HMNA 8CGTA 5AVNA 3JUGA 1E55A 3IVTA 4HMDA 5F4SA 5DN1A 2X0HA 5DRIA 4A3UA 3ES8A 4M51A 3RAOA 1HL8A 2YL9A 4MZ8A 3W87A 3RJXA 2ABAA 4MZYA 3Q94A 5DCDA 3UERA 4F66A 3OP2A 1JD9A 2INFA 1TX0A 4TQTA 5M5DA 3P5ZA 5AOUA 3H70A 3ITGA 5D9NA 3RLGA 2OQLA 4POCA 5ECUA 2B7NA 3TLQA 1OCNA 1I2QA 2Z00A 4XZMX 1ITXA 1AZ2A 2X41A 3NSXA 3O8AA 4E5TA 3N9RA 1U83A 4LNYA 3GY1A 1UROA 2E6AA 5DT5A 1OQFA 2XDFA 3GXFA 1VD6A 3VE9A 4HMEA 3W6MA 4S2CA 4EF8A 5K4ZA 2EBNA 2YDRA 3B4UA 3OODA 2PEVA 4XZWA 3PPFA 2PDGA 4B4HA 5HMFA 3O63A 3PTQA 2YZRA 1AL7A 1F5ZA 1Z3NA 4M1RA 1OF6A 4I5UA 4MPKA 1QI3A 1VPQA 1F6PA 3EX4A 1SMDA 1IXPA 3AFBA 3IVUA 1ITUA 4C7GA 4EACA 1F2JA 1WZLA 3VGEA 3CL6A 3N9SA 2V30A 4LEQA 4H9MA 2Y8UA 2J8GA 1MEWA 1KFKA 2VZSA 5A8GA 1ZJHA 2JKEA 1GVEA 1ZP3A 4GI4A 2W92A 4RZ5A 1C93A 1EUNA 1VYPX 1HKIA 3UR2A 4H8HA 3TLLA 2C16A 3P61A 1JAEA 2ZE3A 3AC0A 1GZGA 4E3VA 5T26A 1R46A 1KFWA 1M5WA 2YSWA 3OYZA 2OWWA 4GPNA 2ZZ1A 3WH5A 4DYJA 3UPMA 1MRAA 1FWWA 4GUIA 2XIMA 2QPUA 1J8VA 4IISA 4CQDA 3E74A 1GQLA 2ZRVA 4C1KA 4GQGA 1B3OA 4ES4A 1JRCA 1GQKA 2FMNA 2HRWA 1UCWA 1KM6A 5A8QA 4NI3A 4CU6A 5DXXA 2GYIA 4MNMA 5LIXX 2ZZ7A 1LUCB 4J27A 2OPJA 5F1UA 5HOSA 1EH9A 4NAEB 3MMDA 3OIXA 4NZ5A 3DERA 4AH7A 3ZLFA 1I2RA 4YJ5A 4Y6GA 3K13A 3HBLA 4HJWA 1BXCA 3W73A 1XYBA 2RDUA 2DPEA 2HS8A 3AHZA 2QJMA 3GR4A 2A7PA 2GSEA 3W82A 4GNVA 2BVYA 1DWHM 2QDHA 1OGSA 1GVOA 1Y5WA 3B0PA 2ACQA 2QJHA 2X05A 4UOQA 3NR0A 3AO0A 3AXIA 1RK6A 2FB3A 2J74A 2OCZA 2JQXA 3ITLA 4XD5A 3LPGA 4PMRA 3MSDA 4RUBA 3V5OA 3SCTA 4GO8A 4B16A 5CBBA 3S2JA 3CWNA 2YXXA 1PKYA 4HP5A 3WF0A 1S1PA 2EG7A 3AIQA 1ENUA 1CT5A 4KRUA 3WQ8A 1Y8BA 3BLKA 1DJHA 4QCFA 1PWLA 3NOYA 1MI3A 4AC1X 1WBJA 1E6XM 1BLIA 3MMTA 4B9ZA 1L8PA 3HB9A 1QI4A 3UG4A 4AG0A 4OUIA 1L6SA 2J62A 3TVAA 1FWRA 3N1AA 4Z1BA 3VM5A 2PDBA 4ZB5A 2I9EA 4PMVA 4YCOA 3DHPA 4MOZA 2WKGA 4NF7A 4CVUA 4UFIA 3TR9A 3BOLA 4AZBA 2GJRA 2XVNA 5H8MA 4H9UA 1EKOA 3SUVA 4JBRA 2DY3A 5CAKA 1TIMA 4XKYB 2WZHA 3CS2A 3MKCA 1AW1A 1Q6FA 3MUCA 3VGBA 3MBFA 3EA2A 1TTPA 1PCWA 3SBFA 4B4FA 5I0DA 4HGXA 2BDQA 4H8NA 3UEQA 4OQVA 1TJ2A 4GA8A 5CC6A 2ZFAA 2J7DA 2I5QA 3CTLA 1VIWA 2XN2A 5DF0A 1E0TA 1O94A 1V3MA 4HYWA 3O0KA 2B7PA 3I4EA 4PCFA 1D7KA 3A6OA 3DI0A 4UTKA 3CAVA 1M03A 3QV8A 5D09A 1JPIA 1W1ZA 3EPMA 2WSPA 1SZNA 4UNIA 3LGEA 5AC7A 1H11A 4JKLA 3C52A 3W38A 4M7TA 4KFPA 3F1QA 2Q8ZA 3TP4A 1V7YA 2C0AA 1BFNA 1BSLA 2D2GA 2WMIB 1THFD 4OTKA 4QM1A 3PPGA 1G7UA 1FCVA 3CUJA 3ORWA 4AIOA 3A4XA 1IT0A 4Z2KA 2MNRA 3UXDA 4QE4A 3CO4A 4CNPA 5G4WA 5A6MA 4TTGA 2Y88A 1ICQA 1UD6A 3TN6A 3KRZA 1SGJA 1W3TA 3LCXA 3A3WA 1U1UA 3APYA 5BMWA 2ON3A 2JIEA 3UNDA 1BGAA 1HP4A 4X0NA 3UZZA 4ZMGA 5I3HA 1WA3A 1S2UA 1AMYA 2G3MA 5BXRA 1O66A 2OELA 2HROA 3F4VA 1TX2A 3ZJKA 1BSIA 1PWMA 3WQOA 5J04A 3LUTA 1PKMA 3TQ0A 1PTGA 3DFSA 1DORA 4UC5A 4J9JA 1WO2A 3CWOX 4LPCA 5CSYA 2WMGA 4D8AA 1PIFA 3IK2A 2FZMA 4BR1A 4D6CA 1TV4A 1MZHA 1EHNA 3PZIA 1CW2A 3DFTA 1TZZA 2WCAA 1JZ7A 4IGMA 3IIOA 1Z9AA 3QW3A 3CGTA 3BE7A 1UP0A 5AHIA 1J4EA 2Z28A 4WOQA 2ZRWA 2WM1A 3S1GA 1VFTA 3POHA 2OLSA 3TN5A 4MADA 1K4HA 1TO3A 3BG5A 4YIWA 2BSLA 1D3CA 4UB9A 4ECLA 1NDZA 3W7CA 3LLDA 1PPIA 2NXGA 1P5BA 2YFNA 4RV3A 3KBWA 4DHGA 3EPNA 1FFQA 8XIAA 5TBOA 4N2YA 3BTNA 4GZJA 3OVQA 1W2PA 4ZQOA 3WLIA 3VFCA 5DCBA 5C9RA 3W81A 1JDFA 2GQAA 3H55A 2V63A 3QGVA 2ICSA 3W25A 4I9TA 4XQ6A 2E5DA 1TSIA 2PF0A 4MVAA 4RE2A 3II1A 4J2MA 1W1A1 3S1XA 4RNFA 4HU4A 3GDKA 1XSIA 1XC4A 4ZOCA 4WJEA 3GU9A 4WQ6A 1A3HA 3W85A 2ZVRA 4B5SA 2Y8VA 3MI2A 1K7EA 4JN7A 1GVRA 4O50A 1WOAA 3IRDA 3XINA 3G8RA 1B3WA 1Q45A 3EKLA 3T05A 2Z1SA 1B1YA 4KS0A 4Q8MA 3FDGA 1DYSA 3QLDA 3OLGA 4O28A 2EJAA 1M68A 4IM4A 3PFRA 3W1PA 1F6YA 4CCZA 1EGMA 3SCQA 3UG5A 3VNZA 4RPPA 1ZLPA 1RV8A 3W28A 1XBXA 1KBKA 2GVYA 2QXWA 4UZSA 1XIEA 3VOFA 2D69A 4LUTA 3GNXA 1VC4A 1JDEA 1HVXA 1QO2A 4OV9A 4HHMA 4NVTA 3UBPC 1ESWA 1NQ6A 3DG7A 3KHDA 4RW5A 1JULA 3E49A 1W91A 1N55A 2X7WA 2QQ6A 5BU9A 4X3ZA 3R43A 3NO5A 2RUSA 4ICMA 1BF2A 4LYQA 1H61A 1AW5A 4CQBA 4MLRA 1K9TA 4MYAA 2GJPA 1WZMA 1FY6A 1QNOA 1T99A 4QAIA 4G6CA 5AYXA 3ECQA 4XVDA 2HDJA 3W7IA 2CKSA 2J7EA 1JZ2A 2TMDA 1M7JA 4I7VA 2XG9A 4WCJA 1W6TA 3L0NA 2G3NA 3WUEA 1H7OA 5ECVA 1V6TA 3F4NA 2QR6A 2GVGA 3CZGA 1QI2A 2ZZ5A 4Z1AA 2XUCA 3EOOA 1EP2A 3S9YA 3C0JA 3PB0A 3EDFA 3WF1A 4WKHA 1RCOB 2HZGA 1ZHAA 5LGZA 3QMSA 1L8NA 2PF8A 2XFWA 3GC4A 2NT1A 3PUGA 2WW5A 3ERPA 2ISWA 1JPDX 1LOLA 3TUUA 1KFCA 4KCVA 4KMQA 4GY1A 5D2WA 3UWYA 4RDZA 4H6RA 3C2VA 3F4WA 1A49A 1J11A 1W1VA 1S5MA 3HQNA 1KV8A 2BXZA 2DIEA 1QASA 1D2KA 2GGHA 5XIAA 1IZCA 4OHQA 3KVMA 2FTYA 3S46A 4G7EA 2P3ZA 1LOQA 2WLYA 5LIYX 1K8YA 3NCOA 1TMHA 1TQXA 3TH6A 1UASA 4B15A 3AWOA 2RDTA 3IV3A 2PBGA 3GIQA 4GVGA 2V67A 3W70A 4JIHA 4QAWA 3IIZA 4PE8A 3HJZA 3T0AA 2QCNA 1SFTA 5L9FA 2H90A 3W72A 1DQWA 4F0MA 4BK9A 3ZT7A 2XWEA 1RA0A 1E5JA 3M0MA 7XIMA 3P67A 2E9BA 1T7LA 3N2BA 4XO6A 3L5AA 2VRJA 4GYFA 1GPFA 1OCQA 3H22A 3CHCA 2WB5A 2QGYA 1VFSA 3OG2A 5K9DA 3WK3A 5AC4A 5LNVA 3UQNA 1YKWA 1BVNP 1NDVA 4PUNA 2HWGA 2ZRZA 3AUOA 4JHZA 2XM1A 2OQYA 2YBTA 1FDZA 1A53A 3WQVA 3KVJA 3RHGA 1GT8A 1RPKA 5JH1A 2UWFA 4QFUA 3KBJA 1GOXA 4ZE5A 4CNNA 1ODUA 3EB3A 1XGZA 3WK0A 2DZWA 1P43A 4WXZA 3WEOA 2BOFX 4DY1A 1DJYA 4Y9AA 2FPYA 2Z2UA 3V5CA 3M16A 2XHYA 4GCAA 3AHYA 4XUYA 2NQHA 3OIHA 2X1TA 4O14A 2BV9A 3M9YA 1MDRA 4N6FA 1QPRA 4CCDA 3MO7A 2NV1A 3ZZ1A 1E9LA 3V4BA 1EDQA 4HSNA 3V18A 4FSAA 2DZPA 2PGFA 3T8QA 2OMAA 3A23A 3GVRA 2F84A 3QHOA 4N7QA 4PRWA 3VD4A 1IGWA 4OE7A 4US5A 2IKHA 2OGYA 4GQRA 4MTVA 1TPC1 2H9AB 3K8KA 4V28A 3GXNA 3INPA 2VX6A 2FZBA 3WH7A 5D9MA 4HHHA 3TXVA 3RX4A 1YHTA 3RRAA 1X96A 3QMTA 1DP0A 3QQ0A 2EPNA 3GTHA 4Z2JA 4X2PA 3GD6A 3OZOA 4OWGA 2P1FA 3O2LA 5EMUA 4PR4A 2ZA2A 3S5OA 2J7HA 1PL9A 3AMGA 1PKLA 2NVCA 3IUDA 3UVAA 4ZQNA 5I3JA 5D30A 2NQ9A 3AS1A 1FKWA 3LEPA 4MPQA 1EPXA 3WK2A 4P8UA 1R7OA 2E5CA 2EHHA 4A6GA 5J8LA 4UFLA 1GZ1A 2FIQA 1V3LA 1MFUA 1OZMA 3LHTA 2DH3A 1DJIA 4P8XA 5EMLA 3RU6A 3C2RA 4KIRA 2WWCA 3NDYA 4B5UA 4IPPA 3TTEA 3W1XA 3NDZA 4GI8A 2QVHA 3TJIA 2OZTA 3VIPA 3SEPA 2IXUA 3S9IA 4ZSTA 4ZR8A 2CHNA 2ZIDA 3ABOA 4B3LA 3L0GA 3VNLA 3F2CA 4MB1A 3B0XA 4GGHA 2RJHA 3N9KA 4W93A 3GG7A 4KW2A 4ATWA 2O56A 2DZBA 3CB3A 4WUIA 4NT0A 3NPVA 1DVJA 2WSYA 3W27A 3I3EA 2PDYA 4OT7A 3TROA 4RCXA 1NOFA 4X63A 3THDA 1E4LA 2VHLA 2A4AA 4DF2A 2HVOA 2VZUA 2QMJA 1I2OA 4JTIA 4C91A 2PDXA 3P2VA 3CJPA 3BV7A 3VGFA 3MP3A 1DWGM 2HJPA 2EQDA 2QGHA 4N9CA 4Q8VA 1GJUA 2PU0A 4UXDA 3TZFA 1V03A 1VBJA 1QPOA 3HM7A 4KGLA 2QCMA 1EHAA 4MNLA 4JEJA 4C1NA 1SW3A 2QCHA 2ZWYA 2J77A 4ZO9A 2OYLA 3UYCA 4UTWC 4FR6A 2TODA 1WQ5A 3FX4A 3U0HA 1F4AA 4CU7A 3F5LA 2WMIA 5I79A 2VEGA 4HPJA 4GIRA 4L64A 3ZR4A 3MSRA 2Q3OA 1EQPA 3UZWA 1LT7A 1V6UA 3AHTA 1POKA 3G5EA 2VXNA 3UZ5A 5FESA 1W54A 5CG7A 2PDCA 2NXIA 3EOLA 1IT7A 3S1VA 1AD1A 4UTWA 4REQB 1BEUA 3T2PA 5CGMA 4KWUA 2NWSA 2A3HA 1E40A 3CHEA 3LA4A 1TV5A 4XD4A 3IJ6A 1HJVA 3T4WA 4QLLA 1NAL1 2DVUA 4AMAA 2DT3A 1IXNA 3N04A 3QQ1A 2VCBA 1TPEA 4ZFMA 5CPTA 3W2UA 5K9CA 3GDBA 2PTZA 4E3TA 5K2ZA 1O1HA 4KF1A 3KVLA 3ZIZA 3CLMA 4C7DA 2H8XA 3AMKA 5D4YA 2J9ZA 1WAWA 3CQJA 4DZIA 1YIXA 5H91A 3W2KA 4IL0A 1OG6A 3MANA 3GIYA 4JX6A 4QRNA 1M6JA 5I2UA 3ARUA 1UQZA 4RNJA 4DAFA 3OLDA 3PULA 1B9ZA 1TA3A 1K7XA 4AC7C 1F8IA 1K7FA 1QPQA 3AZRA 2CBUA 3WDHA 3E0IA 3NQAA 3B9EA 1UJPA 3VKBA 3UJSA 3LQLA 2PP0A 2WHMA 2AMXA 4Z0JA 3S83A 4IG2B 3ZWTA 2XSAA 4A35A 3GDTA 5RUBA 4U2ZA 1SVDA 2VM8A 3H26A 1H09A 3NQCA 3ARTA 2YL5A 4B90A 3S6DA 2V8ZA 3FA5A 4QISA 2ZUMA 4IP7A 1HF6A 5FAJA 1C8YA 1PZ0A 1R2SA 2G95A 3FJLA 4QCEA 3N2CA 4GY7A 2XH2A 2X09A 4XKYA 4Q7NA 4RZBA 5CZKA 4DYKA 1ISWA 4QE5A 3JU2A 1K8CA 4UZUA 1HJUA 3QY8A 2I5IA 4DN1A 1P48A 3S2LA 1MXSA 4EPEC 4RZ6A 4YVVA 4XIAA 3DESA 2GQ8A 1MMFA 4DWSB 4DPPA 1FHVA 3EDDA 1RBAA 1E71M 1KQZA 1QNVA 4S23A 3OG3A 1UR0A 2PLJA 4MLJA 2EF9A 3GNRA 1S39A 2FVMA 4BHYA 3ANUA 1JGMA 3MQTA 4UQBA 1QNRA 5C6MA 3H2OA 2BS9A 1Y0EA 2W0UA 5JBEA 4PMUA 4HNCA 4IP4A 3USBA 3M41A 4M19A 3P7YA 4N42A 1LZOA 5G5IA 3E9AA 3PZGA 1SFLA 1LOSA 1A3XA 1UPPA 2HTMA 2G96A 3WQDA 4JAWA 4CD4A 3CB8A 5MF5A 4HHPA 1X1OA 2ACUA 4HJFA 1LRTA 5KITA 4NU7A 1W31A 1RK5A 5DO8A 2BXYA 3R0KA 4LF1A 3PJTA 3NQGA 3SFKA 2JE8A 4P2VA 3W37A 3MUAA 2ZRUA 3W7RA 1XI3A 3B40A 1RPXA 8XIMA 2DDXA 2HPMA 2I7GA 5A6BD 1WBHA 2OFJA 4BWLA 4XIMA 4F3HA 1ZL1A 2D2HA 3GDRA 5EBAA 1K02A 3NAVA 1XGEA 5IHSA 3OPSA 4ZQMA 2VR2A 3CHDA 3PG8A 1NQKA 4ZTYA 1P6BA 2VRKA 1TA3B 1EYEA 4H83A 3BAJA 2GUUA 1SO4A 1XCWA 3GNOA 3DYMA 3UZJA 1GTHA 1P0EA 3DFQA 5DQPA 1NVMA 2PWDA 4JIIX 3M4HA 1MO0A 5H2ZA 3MJYA 4M80A 3R7MA 4IGNA 1YYAA 1TV2A 1WV2A 1NWUA 3ITCA 1RHCA 1GKRA 3KOZA 3B04A 3B8TA 1KRMA 2X1SA 3EWCA 1C9DA 3WD2A 1K03A 4XO7A 4ZO7A 3L67A 3S2MA 4PTDA 1YBQB 4OECA 4M82A 3NGFA 3TKFA 7TAAA 2X30A 3NQ2A 5CH9A 4Q4QA 4NIRA 3JR2A 1K9FA 3WH8A 2DZXA 3SUWA 2FMOA 2YW4A 4QX4A 2HISA 1B3ZA 3E2QA 3L2IA 1L6FA 3ABQA 1TZ9A 1X38A 2OLAA 3U6WA 3W7NA 4LAMA 1SMAA 3UXIA 1W9DM 2O7QA 4XD3A 2ZX9A 1C8XA 1VJIA 4YL2A 4WY0F 4H9ZA 1ZCOA 4UFJA 3KWSA 2Y5JA 1E9ZB 3N34A 3WJXA 4W4QA 3GZAA 4JFTA 1UMYA 2GLKA 1J0HA 4H2CA 1FCQA 1PHQA 1CPUA 2A7NA 3RM8A 3PG9A 3CT2A 4FOJA 4KCWA 1S46A 1V6XA 1H4PA 2X40A 1WB0A 2E4TA 3L4ZA 3QN3A 3M47A 2RGLA 3P82A 1KWKA 1LLZA 3Q45A 2G5WA 5HUOA 3BL3A 4DJDA 3R58A 3ARWA 4B5TA 2J13A 2D2OA 2CLFA 1NH6A 1WNOA 1ZU8A 4DJEC 1XYLA 2ZRXA 1W3IA 2V81A 1GNXA 5D05A 2E6FA 4O12A 4AXNA 3A12A 4I7UA 1XFBA 3DC8A 2HVMA 3FV9A 3NXFA 3EXSA 5D32A 2HK1A 1VEPA 4O19A 3IANA 2G3IA 3SFWA 2XIJA 1OC5A 4NNAA 1UWQA 4H8UA 3L4YA 1YNPA 4QE1A 1BTCA 4WK9A 3RRXA 3E02A 4LANA 3MZ2A 3SCPA 3TTOA 5TQLA 4WIWA 4DB7A 3GNNA 5EYWA 3R0UA 4J3SA 2DT2A 2QV4A 3MDUA 1GVSA 4O1AA 1XYFA 1JNDA 4CCEA 3HPXA 4I8YA 1IEVA 3CQHA 1HL9A 1US0A 3BICA 4E8DA 2PDHA 4US6A 4YN5A 3VIGA 3W6LA 5KINA 5FF2A 1ZQ5A 1UP2A 5AYZA 3RFAA 4LUYA 4PZVA 3AXHA 3OQ8A 4K68A 4LCQA 6TIMA 1E6SM 1O5QA 1D3HA 4J5NA 4DZHA 2QCGA 4RW3A 4IGSA 4ZQRA 4UFMA 4MAVA 2FHFA 4WY0A 3TSDA 3N18A 2OVLA 4MZ1A 3MO4A 3O9NA 3W7PA 4CQ8A 3PTDA 1TV8A 4Y8EA 3QHNA 1KTNA 5M03A 1ADOA 4B3KA 1FWEC 3CT7A 4GQ0A 2XFFA 4UNLA 4LBUA 1PEZA 4IJBA 2X7VA 2VOTA 3LDVA 3AICA 4MY9A 1JCYA 4MWAB 4Q4SA 5LXEA 1SO6A 3L65A 4J7RA 4GC3A 3EOSA 5BW6A 3OZYA 5A6LA 3WYZA 3CMJA 3SGGA 1F7BA 2XH4A 4BI6A 5I06A 4F9DA 1KFEA 3UPBA 1RCXB 2WPGA 1ME7A 5I07A 4GC4A 4RJEA 5F2IA 1M9HA 1V3IA 3E0VA 3FIGA 4K1WA 3UPWA 3G1DA 1PYMA 4L6HA 3KDNA 3A24A 4PMQA 1JL8A 4L1WA 1F07A 2QV5A 3VA8A 4Z08A 1LWIA 1H7XA 3RMEA 4U3CA 1D8WA 3EMCA 1KW1A 3LRMA 2Z29A 2PWHA 4DXVA 4XAZA 3F4CA 3IARA 3QKEA 2WPBA 4FNRA 1GK8A 1ZRQA 3WEMA 2QUNA 4MB4A 1KC7A 5EMKA 2J66A 3WJWA 1QBAA 3EB4A 2OKTA 3W22A 1GEHA 1JQVA 4XV0A 1B0IA 1EEPA 2E67A 1W5NA 5BROA 4FAMA 4S38A 3O06A 3IAPA 1BVZA 1SPQA 2NV9A 3MB9A 4IQDA 4J3WA 1QJWA 3I7RA 3OBEA 4ZVJA 4WSKA 1YMYA 3CQIA 3HO8A 5CGTA 1X39A 1FOBA 1W3HA 3GE7A 7A3HA 4Y90A 2YJQA 1UWUA 3GH5A 1T8QA 1OYAA 1VEOA 1DXFA 4KFOA 4C90A 2E68A 5ABFA 3STGA 3ARRA 5IBXA 2D0FA 3MHFA 4BF9A 5D9PA 3NURA 2CYGA 3E2SA 4HU8A 4JYDA 3BMVA 4UQAA 3TJLA 1YNYA 3A3XA 1SW7A 1CXFA 3OVPA 5A5WA 3M0JA 1LRQA 1Q8AA 2YDAA 4HOZA 1M04A 1QNQA 5CZSA 4INFA 4AAJA 3SRHA 1AQHA 3ZJ6A 1A5CA 4D6DA 2YXOA 1EX5A 4KKXA 2DV0A 2UY3A 3R79A 3ME3A 1XICA 3AHVA 4JL1A 1X8CA 4D6EA 2E77A 3LLXA 4O52A 1UJQA 1TKKA 4JQ2A 1EIBA 3SM0A 7REQB 4PUUA 5CZ0A 3WFZA 5HMEA 4ZE4A 5FACA 3W7DA 2I17A 3PPHA 3R8GA 1YPXA 2CHRA 1NP2A 4C5YA 5U4NA 1FWDC 1YDVA 4Z1YA 4NX0A 1YXYA 4DXKA 5I6SA 4FLQA 5EPDA 5A6KA 2G3JA 3ARYA 1CGTA 2QCDA 4W8LA 3CPRA 3UXLA 3LCIA 1WXJA 1GVQA 3LTYA 1H51A 4X60A 3C0LA 1ZNNA 4MY8A 2C15A 2IKIA 1ODZA 1TVLA 3N15A 4QS5A 4F0LA 1VFOA 4DO4A 3LHZA 4R9XA 4EX4A 3AS2A 3VNKA 2ALDA 1S2TA 1KB3A 3WMBA 3G1XA 3O6CA 1W9BM 3A5VA 4LBRA 3P0XA 1WP6A 3VNDA 4OKDA 1F74A 1VJZA 3GXMA 5C7VA 2PDIA 1GOOA 1YPIA 4GH3A 5FL1A 5E6ZA 4IXXA 2ZZ4A 3TK7A 4LCRA 2E9LA 1TMLA 3CNYA 3OZPA 3CHVA 3NZPA 1WUFA 5EFFA 3L68A 4I5XA 2VX7A 1Z6KA 3BPWA 1JIBA 3NEVA 1GHSA 3MUXA 3VGHA 5ABTA 5JXQA 2QJJA 2X42A 3VOIA 4UR7A 3AMDA 1U1JA 1QOPA 3CAWA 3AISA 2NQZA 1XLAA 1TVNA 1IWPA 3TX9A 3E2RA 1UH4A 2J25A 4DBWA 5H1WA 1C3FA 1XIJA 6A3HA 4PSRA 1OADA 2VT0A 1EXBA 2D20A 1EJRC 1KM5A 1DHPA 4OVXA 3A4AA 3ITOA 2I5GA 2C91A 2VZOA 3C0QA 4PMZA 2VR5A 3VMOA 3VZXA 2QPXA 1JDDA 2ONEA 4FF7A 4UTTA 4PH6A 2XN0A 2NUWA 3ZVIA 1NELA 3NPUA 3ARPA 1RD5A 3E5BA 1WUEA 3BOXA 4ZENA 1LBFA 1HNYA 4GBUA 5HJXA 5BOEA 4Q4OA 4XG1A 3CBWA 3L4VA 2RKXA 3UWWA 4MJ2A 2FZ9A 3W7HA 5C2CA 2PLMA 4DPQA 4G7EB 1LDCA 3LTPA 4IX2A 4JD4A 1S38A 3MYPA 3PBYA 2XINA 9XIMA 1OC7A 3VUPA 1KV5A 3G24A 1A5AA 3MS8A 2QCLA 3KRBA 1E72M 2PI6A 4QG8A 3ZSTA 4AX7A 3KL3A 3APGA 4GGBA 1KM0A 1TV7A 1DJNA 3PFMA 4O0ZA 5LA1A 3PC0A 2Y63A 4YHEA 3BAYA 5HBFA 6REQB 4Q33A 5CG0A 4DEFA 1UWTA 4MM1A 1H49A 1W5QA 3C2YA 3EWDA 1AD4A 3PSVA 1UKQA 2Y85A 2C7FA 3EWUA 4CN4A 3IJ8A 1SZGA 3T42A 5CSUA 4H8VA 1VHNA 3VABA 1XV8A 4W8AA 2YXGA 1FWFC 4U4MA 5T91A 1WX0A 3UESA 2J8TA 3NSNA 4H41A 3LRKA 4U2YA 4YVXA 4JTFA 3U48A 1XLFA 4LQ1A 3WNMA 4MSSA 4J3VA 2OODA 1JJKA 4MJ4A 2V5DA 4AIUA 1GPWA 3DG6A 4QJ5B 1BRLB 4UFKA 3S42A 5HNNA 3OOQA 4KWVA 2VDGA 4Y8FA 3T4CA 4GNJA 4MUZA 4DELA 1V3KA 4DF0A 3FOKA 1FHLA 4HYRA 1UBSA 5CLTA 3LZ5A 7CGTA 2ZA1A 1QXLA 4UOJA 5HA7A 3KP1A 1VCVA 1KKRA 2F7FA 1JGIA 4C60A 3G1RA 4H9YA 3LENA 2DUZA 5DX7A 1WPCA 3SY5A 4CGTA 1J0KA 4AEEA 1A3WA 1AQFA 5C70A 2QKFA 4RXFA 5A8NA 4M6VA 3MP4A 1UWAA 3VOJA 3UD6A 1TR1A 4NILA 2XN1A 5SWUA 4V1YA 1NTHA 1RJQA 1QUMA 5C55A 1GQNA 3NIYA 1W1B1 3I3DA 2XISA 4S3DA 4TO8A 3DFNA 3VD5A 5LIUX 3EEGA 3KL5A 1H7WA 1Z41A 2NWRA 2A21A 1M01A 2HE8A 3AOFA 1E1CA 4AD0A 2J27A 3QR1A 4HPHA 4XBSA 1VH7A 1VLWA 1FCBA 3MA8A 4C6MA 1CXKA 4FB7A 2PODA 3ENLA 3PBVA 3UW6A 4Y2WA 3TC7A 3O16A 3HIJA 3OA5A 1HGYA 1A5KC 3ISIX 4OFCA 3JZUA 3STPA 2OT0A 1BWVA 1EL3A 4RV8A 2BGQA 4LB3A 4WJXA 2XIQA 4EXAA 3KZPA 4E2DA 1TV3A 4XK2A 2C8NA 2BVDA 3HGSA 3UWZA 3FHQA 4EWJA 1CXHA 1NWTA 4A3RA 1PB0A 2A3EA 4M0XA 4UWMA 4WVXA 4NSBA 2DSKA 3SIMA 5MKGA 2J47A 3GXDA 4W86A 4ICCX 3PZ9A 3M0KA 1XYAA 4QQUA 3AS0A 3CUFA 3MWAA 3GW0A 1Q65A 4IMDA 2ISVA 2I57A 2JEQA 4YYCA 2JFEX 3TE9A 3FKKA 4QTGA 5ABHA 2AQVA 3SRKA 5G1YA 3VO0A 2J7BA 1DIEA 2YLAA 2C19A 1QR7A 3WSUA 3CO8A 3NVDA 4IJCA 1H63A 3TIMA 2DORA 3WLQA 1YPFA 1GORA 2C79A 3DYOA 1G4EA 3VNIA 2VC6A 3PZTA 5HQEA 2HPIA 2X16A 4YTTA 1BQCA 4O53A 3I6RA 1YW1A 2VFDA 3G18A 3W29A 2R1LA 3EZ4A 3CZLA 2DSZA 4LS2A 3FAXA 2QT3A 1Q6CA 3A4WA 1PS9A 4LXFA 4PEEA 3G0SA 2JF7A 3UCDA 3ID7A 3ZR5A 1SZFA 1Z8AA 2YR1A 4S2BA 4LVAA 4FF5A 2NQJA 2GK1A 4JTAA 3AROA 3A5FA 4AEFA 3SB0A 1HP5A 1PZ3A 4KWSA 4AEOA 2ZZ2A 1ME9A 3PAJA 3M5ZA 4GZ7A 3WJZA 3S8HA 4N9BA 1XSKA 1G0CA 2V68A 1ZPTA 2RH9A 2HXUA 4TR9A 3W23A 4WR3A 4AU0A 3LTSA 4DBEA 1A5LC 4IPJA 3WMCA 3IGUA 2HBVA 1DTNA 4IIDA 2JEPA 3IS4A 5HNUA 2FZDA 1LLOA 1TRIA 4JNZA 1PYFA 3H53A 1NSJA 5E5CA 2PE4A 4ZTXA 5LNWA 1FWIC 2VUNA 3UGRA 1UUMA 4QR6A 1UKSA 5DBUA 1R3QA 2Y5SA 3FNDA 2PGRA 3AYSA 3C3UA 1W5MA 3KBVA 1TJ1A 4CLMA 2PC8A 4CCCA 2WVSA 1CB2A 3TAOA 2CZ5A 3CLWA 1G4SA 3W2JA 5TD4A 1CNVA 1SR9A 2C1HA 5CBIA 3U57A 2G0WA 1FP8A 2VR4A 2QLYA 1OFDA 3QSRA 2EO7A 4RKAA 4A8RA 3GG0A 6ENLA 3W86A 4GXWA 1JEZA 1SSGA 2WMJA 1EPVA 2W67A 4LV9A 1EJXC 2PCQA 4WGXA 3VYLA 1ICPA 2VP8A 3T0TA 1GYLA 4M8UA 5I09A 2GUBA 4AQLA 1XLEA 1KGWA 5HJYA 3CK5A 1DJQA 2WCSA 1F8MA 3PBUA 2E28A 3UA4A 3RR1A 4YU1A 4E4PA 5B7ZA 3GM8A 5FJIA 4JN8A 4XVEA 4AY8A 3AXMA 1KFBA 3F4DA 4M3PA 5DMNA 4QHRA 2DJLA 1L6YA 4BQ3A 1UR1A 2FGBA 4JNYA 5EMJA 4ZZ9A 3PB2A 3MCNA 4EE9A 1LG1A 4C6CA 4RNHA 3T81A 1ISYA 1S1RA 3L4XA 4EPBC 4LF2A 4Q3MA 4DUXA 1US3A 5D02A 1RZMA 3U2OA 1GGOA 2FPVA 3M5YA 3W76A 5FA5A 1JPMA 2QJGA 3QZEA 2Z6JA 3VDGA 3W1AA 3WMSA 2OEMA 1IZKA 2WCGA 2FGLA 3BLDA 2X0YA 3QJAA 4Q4RA 2OJPA 4P7RA 2PDPA 3N29A 3DIPA 3VU2A 3AYRA 3EOEA 3B8DA 1MRQA 3QV7A 4TMBA 1K3UA 5FF3A 3NTYA 3UYIA 3OGSA 3VAVA 1SJDA 4FMVA 4JX5A 2MANA 4UOZA 4JTRA 1LCOA 4HNTA 1VYRA 1BXNA 4Y9PA 4Y9OA 4JZ5A 2PCEA 4WSHA 3RCMA 3GVWA 1OM0A 2AKMA 8RUCA 4MWAC 3WF4A 3DBNA 5H8UA 2HV5A 4GKLA 3CASA 1QWGA 3EX3A 2O0TA 4WSJA 4IGHA 1O5KA 3N14A 4QQ3A 4W85A 4IP5A 3R4IA 3LSBA 1G7VA 1W9PA 1C7SA 4H6QA 4Y9MA 1ADSA 2OSWA 4GXMA 5C9UA 1FXQA 4P7LA 1HVQA 2AQWA 2GWNA 2E7FA 4CNSA 1EIXA 3KFTA 4F79A 3RJYA 1M41A 3L23A 2VJXA 4J4KA 4B5VA 3FYPA 1KFLA 1OHLA 3DFOA 3W75A 4UUIA 4W84A 3FXYA 2D22A 3TYAA 1OX4A 2OWXA 1VF8A 4HN8A 3VIHA 3ONCA 4HIBA 1EFZA 3U5YA 1H60A 4ZBCA 1Q7ZA 3CZKA 4O0KA 2VC7A 1TFVA 1IQ8A 4M1BA 4D72A 1Q7QA 4AZCB 1WKDA 2G97A 4C6LA 3MVIA 1E6ZA 1PZ1A 1XHGA 1HW6A 3PHAA 1YDOA 1LF1A 2ZE0A 1DIDA 3UJEA 1E73M 1MVYA 5D38A 1OWQA 2J75A 3TYCA 1EZWA 1E0WA 2W61A 5AFDA 1UWIA 5FCZA 5AHNA 3TYBA 3QGAC 4KCTA 2IPGA 4A8NA 4BJHA 1M3UA 2A5HA 2P3EA 1HZYA 3M1ZA 2E40A 2DSUA 3L4WA 2BOEX 1EOKA 1JFXA 4NRRA 1I0DA 3T7VA 5HDRA 3GHSA 4F40A 5HANA 2DSWA 3CV1A 5HAOA 2BASA 1ONXA 1I2NA 2J9YA 3W7EA 2VZVA 2V3EA 3VDAA 1LUCA 1UH2A 3QBUA 2DP3A 3HGJA 2ZYFA 2EKCA 5K4XA 3ATZA 1Q3NA 5HR7A 4TVUA 2VYOA 3SN4A 1LQAA 3HPAA 1MDLA 1BYDA 2NW0A 2WJDA 3V75A 1V0LA 1HO1A 3OYXA 4OZOA 4U3AA 1LWJA 2C13A 3U3HA 3O0FA 3AJ7A 1MUMA 1C7TA 3M0YA 2R24A 2GVLA 1FWAC 4XZNX 4HK6A 3I68A 4QS6A 3TMLA 3RILA 1E6NA 5G2HA 1ML1A 1E0XA 3E5PA 3GSMA 4B92A 3LK6A 1HJSA 4AD3A 3VGGA 5B7YA 3GR8A 2BLEA 2EPKX 1QPKA 3AS3A 1WE5A 5A2AA 3QW4B 3FEMA 1ZP4A 4W5ZA 2VOMA 2GDQA 3LV6A 9XIAA 3WBAA 5EFDA 3R94A 4DNMA 3C2FA 3Q65A 3LCGA 2ZICA 3QC0A 5G2IA 2YFOA 1B3YA 5E09A 2XFRA 2QULA 2GJLA 4CNUA 2EPMX 4PMNA 1H1ZA 2VD9A 1IWAA 1B3XA 5FJRA 4BFAA 3B9AA 2IW0A 5CPLA 4H9XA 2J7GA 5EKYA 4ZFCA 1C92A 1DE6A 1E6PA 2WBGA 2VEKA 1XIMA 4D6JA 3BSHA 3WBEA 4FR1A 4K3ZA 1X8FA 3H21A 4AWTA 4PSPA 1VHCA 4AVFA 2BP1A 5F2GA 4PCNA 3T44A 3RR4A 4NNBA 5CSRA 1J10A 5BWFA 3V36A 3VIKA 1JI2A 1JG9A 3QPYA 2VDHA 3GHRA 2HS6A 3SSZA 1OIFA 5BOOA 3QF0A 1FDJA 2AMGA 5CC7A 3E96A 4UTMA 1ISXA 2DW7A 5I5RA 1AH3A 4JXCA 1IYXA 3W1LA 2Z1BA 4DUVA 2HK0A 2VEFA 1EZ2A 1VRXA 4JTKA 3MI3A 1S5WA 3NM1A 2QYGA 4AD4A 4L61A 3M7SA 5G1MA 3BG3A 2ABBA 3UG3A 2OZ0A 1JCLA 5FJOA 1RQEA 1J93A 1W1IE 4HA0A 4FNSA 2ZUUA 2WHLA 2WNQA 1G69A 3B8SA 1UBPC 3NQVA 5M2FX 3UP8A 1ECEA 1XYCA 2WVVB 1XYMA 3TQKA 3FEQA 3R1ZA 4S3EA 3IJ9A 1P0DA 4O15A 1KM3A 3E12A 4JOMA 1QI0A 4Q22A 3VD9A 3W7KA 4ADUA 3A9BA 3K2GA 1CGYA 1SZRA 5HXMA 2PGWA 4UTJA 4NZ1A 2YCJA 2VQTA 1J2WA 3CMGA 1TJ0A 1LM1A 4KWOA 4GACA 2P53A 1AW2A 4RE3A 4BEQA 5HPCA 2VUYA 4LVFA 1O68A 1XRSA 3DKJA 3W0KA 2VFFA 1H62A 1R87A 2V9DA 4RNIA 4XAGA 3LS9A 1RH9A 3PSWA 3GTIA 5CJMA 3CUXA 1WDRA 3POCA 1V6VA 3S6OA 2QUVA 1E5NA 5CPQA 3HG5A 4OIFA 4BF7A 2QPSA 1XSJA 4LH8A 3THCA 2Z7KA 3LN3A 2QNEA 1V93A 5CCZA 2XSBA 3OGVA 2PDMA 4IJRA 1EJSC 3EX1A 4X61A 4PCPA 1PE1A 1P6WA 3SUTA 1KFJA 1HO4A 2CEQA 1IIGA 3T8LA 1VZWA 3L2MA 1EWDA 2ATMA 3WQWA 4LV4A 5EU9A 3QMRA 3S6TA 1FHDA 4GOAA 3CTTA 4Y7EA 4ZODA 4AYSA 2I16A 4LSBA 4Q8QA 1AZ1A 1I45A 2NZLA 4KIEA 3IK4A 1QCWA 1SYTA 1ELSA 1PCKA 5D2TA 2XWDA 2ZADA 4FX7A 4QEHA 3WLTA 2KZHA 2B4GA 3RM9A 3QFEA 1XDLA 3BZJA 1E3ZA 2XIOA 3CYVA 3WEZA 4Q6XA 4I6VA 3NYDA 4PFMA 3W1TA 1KNWA 3WBWA 1QHOA 4LAOA 1E0VA 3SGUA 1MEHA 3G6LA 2NQ5A 4HZMA 5D03A 2PD5A 1TWSA 3W24A 2QMKA 3B03A 4AZIA 3VMPA 3M6DA 1LL6A 1JRBA 1E4NA 4I90A 3CUGA 3AWNA 4LW7A 3VD7A 4PUDA 3URQA 3LPPA 2PRHA 3AMCA 4PMOA 3VIFA 3CZJA 4K38A 2BX7A 4XAPA 1X97A 3FVDA 5F7UA 3BUVA 3S2NA 2JGQA 3MI6A 2EG6A 1KWGA 3R8HA 1NU5A 3GVQA 3JZEA 3ABSA 2HNHA 1XR2A 3LX9A 1JZ3A 1JYNA 3BSGA 4AIBA 4LU0A 4Z1DA 3OBAA 3WQGA 3T78A 1A0DA 3ITTA 2NX9A 3ONBA 1YLVA 4AY7A 2BY1A 1J0ZA 3W01A 1TPWA 4U5IA 1MW0A 3NQ7A 2FGZA 1FH9A 1RJPA 5BRBA 3SJNA 5H6HA 3RF9A 2OQHA 3M0VA 3KOWA 3GVGA 5BNKA 1M53A 4DQWA 3GBEA 1JDCA 5AC5A 1JR1A 4CU8A 4ZB2A 4EVZA 1EXPA 4NZJA 3WL1A 1CZ1A 6PTDA 4MKVA 4C6FA 1O4UA 3TYDA 4H6KA 4D6HA 2FHBA 1UR9A 3NQMA 4NAFA 6XIMA 1TIWA 2R6OA 1VFFA 5CPSA 4IZGA 2Z1VA 3C8NA 3SO7A 4IFKB 1GEQA 3L9CA 1FCUA 3R6IA 3M46A 1UUOA 3LPOA 2VQUA 5KEZA 4ENLA 3VDHA 1OFQA 1S5VA 3QR0A 1UP3A 3YPIA 1YE4A 2DZVA 4DBUA 1XINA 5DMMA 5FEWA 4PRRA 3EDJA 4G8TA 4LVGA 1VAHA 4FX6M 2PDWA 3W1NA 1LWHA 2NSXA 4V15A 7REQA 1L2QA 2HE5A 5CPMA 1TUXA 1CXEA 1GWJA 5REQA 4Z2LA 4JTSA 1G01A 1V02A 3H4GA 4JIPA 3U7VA 4W88A 2E1DA 3C4UA 7ENLA 4R34A