3UPWA

Pichia stipitis oye2.6 complexed with nicotinamide
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old Yellow Enzyme 2.6 (OYE2.6), NADPH dehydrogenase
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis
molecule tags Oxidoreductase
total genus 156
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3upwA00
2G95A 3W7CA 1LM1A 1VZWA 5BW6A 1JCYA 3HF3A 4PODA 1OHLA 3QSRA 5F1VA 1G4SA 3DXIA 5DBTA 2VFIA 1H51A 1WXJA 2Y62A 2NWRA 3SI9A 1LTDA 2QCLA 2ZZ3A 3GZ3A 2V82A 3FIGA 3VNDA 1BEUA 5FF4A 4O54A 3BARA 5KZEA 3W87A 1P4CA 2G5WA 2ZZ7A 3NQ6A 3R2GA 5HQEA 3EX3A 3TX9A 2BWGA 3LDVA 4B5NA 3LCFA 2DZTA 4LS2A 2GVJA 4UFKA 3U6WA 4BK9A 3MBFA 2F84A 3L5LA 5CPLA 5G2WA 4GUJA 1LLZA 3HO8A 3UPWA 1FWRA 1ALDA 3TJXA 1OFRA 3IGXA 4WOQA 3LTPA 3I7RA 1R2SA 3S42A 3EWWA 3UZ5A 3K30A 2OZ0A 1Z48A 5E93A 3I68A 5FF3A 1H62A 1OK4A 2J9XA 3GDMA 2E6YA 3NQAA 4RJEA 3JS3A 4MPQA 4O16A 5HWMA 1K8XA 3L5AA 1HTIA 5EBUA 3O07A 5K9CA 4H4IA 4K39A 1ZALA 4TX9A 4XUGA 1GOXA 1IIHA 3TC6A 4JX4A 1FXQA 2FLIA 2QCMA 4QJ1A 3PM6A 3EXTA 1K3UA 1PL9A 4GBUA 3L5MA 2BSLA 1I8JA 3W3OA 2JKAA 1G7VA 2QJHA 3SJ3A 1J4EA 3FFSA 1FX6A 2ZA2A 5K3VA 5F4XA 2NUYA 4LW7A 1SR9A 2YZRA 5D03A 1Q3NA 3MP3A 5K9DA 1SO3A 4BR1A 1N8FA 2Y6ZA 3LM7A 3FJLA 3EX6A 2NXIA 4HSNA 3I6RA 4MKNA 5AHEA 4GUGA 1UBSA 4AVFA 1H1ZA 2P1FA 5F4SA 3RFAA 3M41A 3WJZA 4O15A 1QPOA 2VFGA 1QR7A 5TIMA 4YLWA 3NQ7A 4LUJA 4OGZA 4AHPA 5D30A 1W8SA 2WOQA 1GG1A 2C3ZA 3GIYA 4HN4A 1OFDA 4FO4A 5DXXA 2E6DA 3E12A 2A0NA 2VKZG 4GUFA 1UUMA 4Q32A 1KW1A 4LNYA 1V5XA 1KFKA 4RZ6A 3FLUA 3BG9A 2PRMA 3O05A 1K02A 1VCFA 1WBJA 3EB2A 4DXVA 7TIMA 4I7UA 5CSSA 3NM1A 1GT8A 2YYUA 4JS3A 1K7EA 3W1NA 1B3OA 1SO6A 2V2HA 4FHAA 5F2LA 1A5BA 1NVMA 4Z1DA 4QSHA 1DQXA 3M5VA 4AHQA 3EWBX 4XBKA 4XZ9A 4A2SA 3W7LA 4A3UA 4NNCA 2QKFA 4N9DA 1AG1O 1KV8A 2QR6A 4MUZA 1ZENA 5I3HA 1K8ZA 1TPC1 1I2RA 4HPXA 2J27A 3G0SA 2NWSA 4QM1A 1KA9F 3QQ1A 4TO8A 3O1NA 4XTIA 3G1VA 3C2FA 1EA0A 2EPHA 2WSRA 2X1RA 1AL8A 4U4MA 4WXZA 2KZHA 4X9SA 2FTPA 3BW3A 3TROA 2I14A 1KM3A 1YXDA 1G4EA 5D38A 1OG0A 1TTJA 4MLRA 2DORA 3TR2A 3TMLA 3W1LA 3ATZA 3HG4A 3S1VA 3BLFA 1MZHA 4CQAA 1RR2A 5LNSA 2VFEA 3MYOA 1A50A 1I2NA 1S3HA 1LRTA 1RQHA 1XCFA 3DFPA 4LVBA 5DY2A 2IQTA 3W2NA 1HUVA 2GJLA 3EEGA 3SSJA 1PE1A 1EB3A 2CLLA 4C1LA 3G1HA 3UXAA 4WQ6A 1KM6A 2V2CA 3P5ZA 5LSMA 3C2OA 2YX0A 3PG9A 4JYDA 3S0CA 2H8XA 4PL2A 1J2WA 1W3TA 1YADA 3NPXA 4CNNA 1D3GA 3NL3A 4ORIA 1I4NA 3LCGA 3LCIA 1GTHA 1L9WA 4EIVA 2YFOA 3E96A 4O10A 4IMEA 3W7RA 1ME7A 1OFOA 3P8JA 1H7OA 3VCRA 4EVZA 4O11A 1FY6A 3TW7A 1Z41A 1YDOA 1PCKA 3TCEA 2B7OA 2CU0A 3W2MA 3TNOA 4Z08A 2ZYFA 3BG3A 2C1HA 3F4NA 1GYLA 1IXPA 3PWAA 4D2JA 2QAFA 3C2RA 4OQVA 1NF0A 1F76A 2Z0IA 2A2IA 3I7QA 3TXVA 1VGAA 4OU1A 1F73A 3NGJA 1TO3A 3PB0A 3SW6A 3HGRA 4TR9A 4UMCA 5LNRA 3N9SA 3O8AA 4LV4A 4CQ8A 3TC7A 3FYPA 2RHGA 3P67A 4RK8A 4Y90A 1WOAA 1CW2A 4YXGA 2B7QA 4O53A 5A8GA 4S2BA 2J6XA 4UC5A 3STGA 4RKAA 3ZWSA 1W5QA 1JCMP 1VYRA 1DV7A 4H3DA 5HWNA 1GYNA 3F03K 3IGSA 3I65A 3NO5A 3NQCA 1O95A 4ADUA 2DZUA 5TBOA 3NNTA 1M7OA 1D3HA 4K8EA 4MJMA 3KRSA 4I7WA 2PRLA 3USBA 3S5ZA 3B4UA 1UASA 3TIMA 2CZDA 3N2MA 3PUEA 2A4AA 1G67A 1FQ0A 4UCGA 2GVLA 1WYIA 1W0MA 4X3ZA 1WDWA 3CTLA 1EWEA 4NUWA 1DKWA 1IXQA 4ZQPA 4UTTC 3W2JA 2BXVA 4K36A 1OYAA 1L2UA 1MEHA 3MHFA 3ELFA 3STFA 1XXXA 1KLYA 2DP3A 3P80A 3C2EA 3WK1A 3C4UA 3A9IA 3QYQA 5AYZA 1OX4B 5EKYA 5DLCA 1QNVA 5DELA 4HKPA 4LVGA 4IPIA 3GYEA 1FXPA 1QDSA 3LX9A 1KM2A 3KOFA 4M6VA 4N4PA 5D33A 1GVQA 1SZEA 4K38A 5AHIA 5CG7A 4O13A 1DJNA 3B0UX 1TPFA 1B4KA 1RPXA 5DY3A 1LORA 3MJYA 5GVJA 4AF0B 4AMAA 4PH6A 2Y7FA 4ZZ9A 1MEWA 1OFAA 3G1AA 3B04A 3QC3A 3SIZA 2X1UA 4IJBA 3HG3A 1QCWA 4RV8A 3W1MA 3NEVA 1TV5A 1KV5A 2E68A 4C1KA 3BK0A 1TPWA 4TMBA 4Z0SA 3ZS4A 2WQPA 1ZJIA 3GR7A 2TRSA 4Y8FA 4QISA 1AW1A 4K6AA 3S9YA 3L9CA 1FCQA 1EEPA 3HPZA 4QIUA 4GWEA 1U5JA 2G97A 2AAMA 4NJHA 3OIXA 4PA8A 3LLFA 4OT7A 4MZYA 1KFCA 1XBVA 3QSTA 3GK0A 2QJIA 3SECA 5L9FA 4JTSA 2Y7DA 5D05A 4NNBA 3C3NA 2CLIA 3DAQA 4JN6A 4O52A 2YGYA 4QNEA 4RR4A 5LGXA 3W88A 4HNTA 4S1FA 1JCLA 1OFEA 3HBLA 3BO9A 4JTKA 3TFCA 2WPBA 3PSWA 3M44A 1W31A 5G1TA 3W7DA 4FIRA 3O15A 2WSYA 1W3IA 3NM3A 4DO5A 1UB3A 1F2JA 1GVFA 4UFMA 3LHUA 3DU0A 4AWTA 4GUIA 4RZ5A 4N6EA 1OFPA 2ZCGA 4QITA 3WJYA 4AB4A 1FDJA 3ANYA 1GVRA 3L67A 3W7HA 2NUWA 3HG2A 2JK2A 3W2LA 3NQEA 4PL1A 3IGUA 4YCPA 3KXQA 4FX8A 4ZL1A 4HT3A 5DN1A 3M6YA 3RK8A 2C6QA 2NX1A 4N6FA 5HJLA 2Y63A 5DBUA 3P5YA 1ICSA 3NQVA 5F2MA 1ZAIA 3RU6A 5LZLA 2RKXA 5F2IA 2XFWA 4MFEA 4HNVA 4DPQA 3GNNA 2P0OA 5EA9A 4WZHA 1H7NA 3GDRA 1OX4A 2NZLA 3F1QA 1MEIA 1OYCA 4XTDA 1SPQA 4GJ1A 1W3NA 5AOUA 5EYWA 3M7WA 4RLIA 3QPYA 3OVPA 4BWLA 3DKJA 3W7IA 5LHEA 2VEKA 4JDBA 1Q45A 2FIQA 5KZMA 5F1UA 3VKJA 4NJKA 2B4GA 1XDMA 3BGJA 2QUUA 3L66A 1ONRA 2RFGA 2GPTA 1ZY9A 3P7YA 4O0KA 1QPQA 1SSGA 4IWWA 4LRTA 5CPMA 3TKFA 4JY8A 1TCDA 5G4EA 5CSRA 1TV8A 2CWNA 3LTYA 3G8EA 3LXCA 1H7PA 3DFSA 2Y61A 1Q6RA 3WK0A 1H50A 3SGUA 2VFFA 3EWUA 4UNLA 2J9YA 3H53A 4HSOA 3G1YA 3UWZA 4ZQOA 1B9BA 1G69A 4NNAA 4YMZA 5HUOA 4ALDA 3MMTA 4HPJA 5FESA 4UUIA 2C15A 3ZWTA 1S5WA 3F4WA 3EKLA 3PSVA 4JIPA 3FS2A 5E1QA 2RDUA 2Y7EA 4ICNA 3W7EA 3TFXA 4DELA 3GLCA 1ME8A 1QPNA 1Z44A 3DBPA 3LHZA 5HULA 5CZTA 4WJEA 2WNQA 2W79A 3CEUA 4U28A 2QCEA 2V30A 4FXRA 1ICQA 3VFLA 4OWGA 4R53A 4KFPA 4WX2A 3LB0A 1UCWA 4OE7A 4HNUA 3PUOA 4WOZA 2ISWA 3HIJA 3N14A 1Q6LA 1OJXA 4CCEA 2A5HA 2AQWA 1S5TA 3IEBA 4WD0A 4PTNA 4LVDA 5C6MA 2EF9A 2QUVA 1M5WA 3G3MA 4JDYA 5C55A 3T40A 4IXXA 4A22A 1TTQA 4RXFA 2ZZ5A 3O63A 4DBDA 3QEZA 4PC8A 2J24A 4FIQA 2EAWA 3NQDA 3IV3A 1YDNA 1XBYA 1TRIA 2WSQA 5EMUA 4GNJA 1VHCA 4NXSA 3KRUA 4EF9A 3G8RA 2FQIA 1T8XA 4GXMA 5HNRA 5BOOA 4MY8A 1YXCA 3W1AA 4TIMA 2FPYA 3R13A 4O12A 5FF7A 3TQ0A 3I7SA 5KSWA 1OK6A 5I3KA 3SY5A 1RQBA 2C14A 1WA3A 4K8HA 1H7XA 4Y6GA 1VHNA 1TV7A 3QJAA 1EIXA 2J9ZA 1YPFA 1TSIA 3SGZA 3EX4A 5BMXA 3GB6A 2ABBA 3H54A 3UZJA 4JTTA 2ZTKA 3EWZA 1XC4A 1VH7A 4MIMA 4ZQRA 3S8HA 1KBIA 2ATMA 1W5PA 3OVQA 3UWUA 2LLEA 4XWUA 1I2OA 5I3JA 3KFTA 1EX5A 4AHOA 2FPVA 2ZRZA 3CQ0A 1S5VA 3S5NA 1PHQA 5K7JA 3P60A 3PBVA 3BW2A 3O6DA 4P61A 1JUEA 3W23A 1O5KA 4RCXA 4Z1BA 1DJQA 4LUIA 1KM4A 3W7NA 1OF8A 1U83A 3UWVA 3CIWA 3FEMA 3UNDA 3MWAA 3W7PA 2QCGA 3P8IA 1SFJA 5K2ZA 3O6CA 1DQWA 1RVGA 5KINA 1VQTA 2ISSA 1AL7A 4PEKA 4L4MA 3UY7A 1A5SA 3O06A 1OX5A 2CFFA 2ZA1A 2PCQA 4IUOA 3HPSA 4Z0JA 4NX5A 5E0KA 2O7SA 4TMCA 3NR0A 3NPVA 1X1ZA 2ZQ0A 4IOTA 4RX0A 3FOKA 5MHBA 3NDOA 2Y85A 4GRSA 5CPNA 4QNWA 4X2RA 4O4WA 1DORA 3CC1A 3W73A 5A5WA 3NL5A 5G2HA 4K37A 1T99A 1TMHA 1FCUA 1G4PA 2V0TA 2NV1A 2FDSA 3BLEA 1L6SA 3W7GA 1EUAA 2Z6JA 1W5OA 2DJLA 2WNZA 2JGQA 3IIZA 4JY9A 3M9YA 4O1AA 5KITA 2YDAA 3W72A 1TPB1 2E5BA 4LTSA 1KFEA 3NPWA 1ZFJA 4EWND 2ZBTA 3GX9A 4BI6A 2ZFAA 1VLWA 1MSSA 1R30A 3E49A 1SUXA 3HMJG 2A6LA 1KTBA 2H8ZA 3BLIA 3LCXA 3QPZA 1WQ5A 4OHQA 1X8FA 1R2RA 4O8RA 3ABSA 4UTUA 3BV4A 1JRCA 4A2RA 8TIMA 2CZ5A 3LCHA 5D2XA 3C61A 2VXNA 3DZ1A 3L2IA 1H60A 4IX0A 1R46A 4XKYB 3W85A 3P82A 3LHVA 2X30A 1H7RA 4R7JA 3QRHA 5G1YA 1AK5A 1X6UA 4LC6A 2B7PA 3N2XA 3W7KA 3R8RA 4O57A 2X16A 3DKLA 3LXBA 2A21A 3VE7A 3UPBA 1E51A 4UNKA 3MO7A 1QO5A 1ZAJA 1FCBA 3UXDA 2FJKA 5KMYA 3W70A 3O16A 4AWUA 2TSYA 2PC4A 2AGKA 4RZ4A 3IVUA 1NF7A 1AMKA 4MZ1A 3EXSA 3AJXA 1K7FA 3IVTA 4FNQA 2CW6A 1OYBA 5F2GA 4JTGA 2NUXA 1SSDA 3QMSA 5I3IA 2ISVA 2Z2UA 3LRKA 1BTMA 2O7QA 2HSAA 2V2DA 4ML9A 3W9ZA 1LDCA 3GNDA 2RH9A 1F6KA 5CPOA 2PE4A 1W54A 3TH6A 2FB3A 3S6DA 3W7MA 1K8YA 4O0ZA 5HR7A 3QW4B 3TMQA 4H6KA 3GDKA 3VE9A 4M6QA 3A5FA 5EL1A 3WJXA 1FWWA 3L0NA 4NVTA 1GQNA 5I3FA 1OVDA 3CWNA 2JKPA 3HJZA 4E2BA 1HL2A 1WV2A 4DO6A 1DVJA 4DF2A 3FKRA 3MBDA 5AYXA 1SZNA 5TQLA 3HGSA 5U4NA 1KTCA 3L21A 4KWWA 5AYYA 4UTWC 3DI1A 2GUUA 1KLZA 3W6YA 1VLIA 2NLIA 2JBMA 4NXKA 3EKZA 2HMCA 3LCWA 2ZRXA 4NJIA 3Q37A 3M16A 5FEPA 3QFEA 1F5ZA 1GEQA 4CCCA 4WXYA 2DZSA 2QDGA 4N02A 4LY8A 5J5DA 1TIMA 2I9EA 2Q3OA 4MFDA 3W1QA 5D09A 1G4TA 1YTKA 4UTIA 2NV2A 1BWLA 1W37A 1P0NA 5AHLA 4XKYA 3W2KA 3BG5A 3T55A 4O4VA 1ADOA 2QCNA 1QO2A 1TTPA 2GQAA 2CLMA 2CZFA 2ZZ2A 1Q6OA 5HUPA 3CLMA 1FBAA 5C5YA 3A5VA 3IRDA 3PY2A 3ABRA 1LLWA 3LBCA 2E09A 2HS8A 1RD5A 1XKYA 1KTNA 4LS0A 2C19A 4ZQNA 1O94A 2Q3RA 3MI2A 3W22A 3B05A 4JTEA 1RQEA 4GUHA 4I9AA 1AW2A 1VYPX 4UTWA 2C13A 1VC4A 3RLVA 3LV5A 3GXPA 3W7OA 1XL9A 1XBZA 3CEPA 1TRDA 4KFNA 1SO5A 3S5OA 4MYAA 1ML1A 4JTUA 3WK2A 2WKJA 4JR5A 3W2UA 4UFJA 1LRQA 5D37A 4MOZA 5FEXA 5G2IA 1EWDA 5AHFA 2ZA3A 3HB9A 3TQVA 2C16A 4BWLC 1B57A 4YWIA 3N9RA 3W71A 4LVAA 2GJNA 2UV8G 2A85A 1IF2A 3C6CA 4O1CA 1LOSA 3EWXA 3OG3A 5FF2A 1T96A 3LRMA 1CI1A 2H90A 1WAUA 4K7YA 1XM3A 3QM3A 3A24A 5LNWA 2VFHA 1WBHA 2A1YA 3IVSA 1TJPA 2E6AA 4YCOA 3PR2A 4E38A 1L6WA 2GVGA 3LRLA 3LOTA 2YW4A 1VCVA 3KRZA 5BNKA 4K7VA 2X2GA 3P74A 1QOQA 1EP3A 3UYCA 4NX0A 3UD6A 2NX3A 3TAOA 4GE8A 4JYEA 1SQ7A 4M6PA 3MP4A 2DU2A 4FB7A 1T0OA 1TPUA 1KM5A 4W9TA 3LCLA 4N9CA 3LHYA 5K4XA 3UWQA 1LP6A 3TJLA 3IIXA 3ZR4A 1WOBA 4JTJA 3TV8A 2FB2A 3IIPA 5HR6A 1NAL1 1QPRA 4ZVJA 1V7YA 2ALDA 3C52A 3G24A 2CLEA 1FDZA 1LBMA 4AF0A 4ZQMA 1GVSA 2E5CA 3W74A 3M5YA 2JKEA 3GXNA 4X22A 4FNRA 3TSDA 3NQMA 5CZ0A 2X1TA 5AC6A 5AHMA 5IM51 3W83A 1M7PA 2ZZ4A 4CNPA 3G3DA 5CGQA 3MHUA 4IGHA 5AC7A 2QF7A 3E9AA 1UJPA 3L0KA 3PG8A 2YCEA 2TYSA 3A22A 1Q6QA 1W5NA 2OT1A 3TU9A 5K4ZA 2Q8LA 5LHFA 1GTEA 3O6YX 5D2YA 3S1WA 2QCCA 1G7UA 4JNMA 5CZSA 1TREA 1X1OA 2TMDA 1GVOA 1ZAHA 1TJRA 1LRNA 4POCA 3GDTA 1FWTA 5LGZA 5HMSA 2PRHA 5CZJA 1P0KA 2VEMA 3S1UA 4I7VA 3TQKA 3NAVA 5H91A 3W1RA 3DFTA 1F05A 4NZJA 6TIMA 4UR8A 4JIQA 3INPA 1R2TA 5F4WA 4O50A 1LZOA 4LC8A 3S1XA 5FEWA 3T4CA 4O18A 4WUIA 4UR7A 3KAOA 3LBMA 1YTDA 5BMWA 1YYAA 1N7KA 1TPH1 3W7JA 4CNOA 3YPIA 4N9BA 3SZ8A 2R8WA 3BPWA 2QDHA 1A5AA 4Q33A 2XN0A 5G5IA 1ICPA 1UUOA 3T44A 1SFLA 3RF9A 2FFCA 1HO4A 5J5RA 4IMCA 4AEOA 1BWKA 2ZRUA 4LU0A 3DFQA 1H61A 4LOCA 1XI3A 2OX1A 3ABQA 3UWWA 5D02A 4MJZA 3WFAA 5LNVA 3N19B 1GG0A 2VELA 1XDLA 4Z1AA 2ZZ1A 3Q58A 4HIBA 4ZMGA 1ME9A 3UQNA 1THFD 5D2WA 3PAJA 5AFDA 5EY5A 1XBXA 1PS9A 2B0MA 3L0GA 3U8GA 3LHWA 2HTMA 3QF0A 2WJZA 5ABTA 4ORMA 4OV4A 4DEFA 2DJXA 2GQ9A 1FCVA 4OBTA 4ADTA 1LBLA 3MP5A 5C2XA 4CQ9A 1KFJA 2ZZ6A 1VYSX 5D2TA 1JUKA 2QJGA 3LTSA 1QOPA 5K9XA 2V5LA 1EUNA 3NZ1A 2Y7GA 3CHVA 4CCDA 1PV8A 1W56A 3RMJA 3E0IA 3U2OA 1JCXA 1NEYA 3CWOX 3IIVA 3HGJA 1KFBA 2DZPA 3M5ZA 4FXSA 2R94A 4IX2A 3G18A 3PBYA 1EP2A 2YFNA 4MYXA 1AW5A 5G4WA 2V8ZA 3DFOA 3MI3A 3G1FA 3FKKA 5DCDA 2V81A 5FF0A 4BI7A 1H1YA 1VR6A 5U7SA 4PFMA 4DPPA 2GOUA 1P1XA 3NXFA 4FF7A 4UTKA 5IBXC 3NQ8A 1IXOA 3FJ6A 2ABAA 3HQ1A 1TPVA 5AHNA 4QAIA 3NZRA 2H3DA 3DHDA 3V1PA 3L68A 3B06A 4JTLA 5AC8A 3OEXA 4JD4A 1TB3A 4MVAA 3M0ZA 4EOUA 3VI2A 4UTLA 5I3GA 3TK7A 3GKAA 1IIGA 4A29A 1TQXA 3EXRA 2J88A 3QMTA 3CM4A 3R89A 3QH2A 4NT0A 2CLOA 4BF9A 3KVKA 1QMLA 3P62A 4UMAA 1B4EA 3FYOA 3NYZA 4DF0A 1OABA 3ZFHA 4DBEA 3MW7A 2F7FA 1ZHAA 2R91A 4NJJA 2P10A 1LBFA 3THQA 1C8VA 2HS6A 1TPDA 3KVJA 1IGSA 3NQFA 3HGOA 3NA8A 4UTMA 4NQ1A 4GFSA 1VRDA 2A7RA 4O28A 3W1TA 1HO1A 1A53A 2E6FA 1TYGA 1PIIA 3W75A 5DXYA 5IBXA 3M43A 2QAPA 3NL2A 2Y70A 1HG3A 5AB3A 1GPWA 4HHPA 4AH7A 4BI5A 2WO5A 5T26A 3HPXA 4UFIA 4UIOA 2OCZA 3TW6A 1JUBA 4WY0B 2QCDB 1C29A 3C0JA 3B03A 3PC0A 3PULA 2BLEA 3G0XA 4IMFA 1P5BA 1SU5A 4JTFA 4KKXA 3IIOA 1M6JA 3HOJA 1SZFA 1FWNA 3N3MA 4N2YA 3R5EA 3B8DA 3PVFA 4EF8A 3DI0A 1RZMA 1CX9A 4PCFA 2VEIA 6ALDA 3TE9A 2QCHA 3M47A 3C2VA 4FNPA 1WX0A 4Q4KA 4N4QA 3AO0A 3STEA 3W86A 3W76A 4WY0F 1K7XA 3PF3A 3PUDA 2YPIA 1YLVA 4L4LA 1QWGA 1YDVA 2RDWA 4IMDA 4JXCA 4JTIA 1NSJA 3UWYA 2C18A 2CLFA 1VJIA 3FA5A 3T7VA 2Z1BA 4ONVA 4FX7A 3WJWA 1H7WA 1EPXA 2QUTA 1KM1A 4JEQA 1GZGA 1SW0A 4S2CA 2A7PA 3JRKA 2W0UA 3LGEA 2DZXA 1DL3A 4MLJA 3DENA 2Y88A 1N55A 4NJGA 3GAYA 3V75A 1NFBA 3OHIA 1JQXA 3E02A 2H6RA 1G6CA 1RV8A 4AWSA 4KWVA 3PS7A 3CB8A 3CT7A 4XBSA 5D2VA 1K03A 4MY9A 3A23A 2VENA 3RLUA 3TXZA 2XN1A 3GKFA 1TQJA 5DCBA 4IMGA 1W5MA 3W1XA 3TUUA 1LCOA 4LT9A 1DHPA 1O60A 4DO4A 3W84A 4IQLA 2ZRYA 3WK3A 4NZFA 1IXNA 2I1OA 4DQWA 3KX6A 2H3BA 4ZQCA 3G1DA 3G1XA 3N73A 1J5TA 3LERA 1SO4A 2JGYA 5CKSA 2Q8ZA 4P2VA 3G22A 3UY8A 2Z6IA 4R34A 4UFLA 4N9EA 5FEZA 4JYFA 3NVTA 4JICA 2OJPA 2YW3A 1ZNNA 4E2DA 3KHJA 4M7TA 1XFBA 1PVNA 2V5BA 1XUUA 1I45A 5D04C 3NOEA 2VFDA 4XQ6A 3NQGA 1PHWA 3BW4A 1L6YA 4Y96A 5AN7A 3MHGA 2E5DA 5SWUA 4LWWA 1DOSA 4OV9A 1F74A 3Q94A 3PBUA 1EP1A 1JQVA 1QAPA 5L6UA 3NG3A 1JCJA 3DHFA 3JR2A 5KTLA 1BKSA 4IXHA 4M19A 4WY0A 2QCDA 3H55A 3LLDA 3R12A 1DBTA 3BVJA 2NXHA 3EX1A 5LKYA 3B0PA 2E77A 3B0VC 3GXTA 1FUYA 3NPUA 3MUXA 1OX6A 2A6NA 2V9DA 4YL2A 2CLKA 2C0AA 3GDLA 1D9EA 1JR1A 4FX6M 4A21A 1F7BA 4Z1CA 2GQ8A 3OVRA 4JX6A 4HNNA 4FEZA 4M7SA 1YXYA 3QMRA 3M5XA 4M5PA 4FNUA 4MZ8A 4JX5A 2BZNA 3W7QA 2BX7A 1O5XA 1SW3A 3SFKA 2TPSA 1KBJA 3D0CA 3G1SA 3DFNA 3LHTA 1H5YA 3TSBA 3NL6A 4CLMA 4UTTA 1Y0EA 1FWSA 2D73A 3HG5A 1QFEA 2W6RA 3C56A 4O19A 2FPTA 3C8FA 5DCEA 2ZRVA 4E0CA 1I2QA 1YTEA 1OFQA 3W1UA 1TTIA 1JJKA 3L65A 5BRBA 5HWJA 3W07A 2X1SA 4O14A 1OF6A 2VOMA 2A7NA 4Y9AA 3TSMA 1VPXA 2ZDRA 2OMAA 4JGDA 2ZTJA 2YR1A 4R33A 1F6PA 3PBWA 4LRSA 2R14A 3SR7A 3PB2A 1LOQA 3T78A 4NU7A 3NQ2A 4O1BA 4KFOA 3A21A 5FI8A 4DF1A 1VCGA 4LS1A 1GWJA 3QW3A 1Z42A 1JVNA 4G1KA 1OFBA 3G0UA 1PCWA 3LI0A 4FNSA 2VC6A 2QCFA 1H63A 1MO0A 1X7FA 4AAJA 1LOLA 3DH7A 2WV8A 1JCNA 1GJPA 2XN2A 2CZEA 4FNTA 3GVGA 3STCA 2E1DA 3TAKA 2ZRWA 3GR8A 3TDFA 3S5YA 2DZWA 4UTJA 3N34A 5LNUA 1A5CA 4LV9A 3ABOA 4LVFA 3BGGA 3QZEA 1TPEA 2YYTA 1R47A 3P84A 1LYXA 1YPIA 5H2ZA 3DGRA 3KVMA 2NXGA 4UXDA 2B7NA 3EWYA 1I2PA 3M1ZA 4AXKA 3Q2DA 4J9JA 1MXSA 2OT0A 3CU2A 4QQ3A 1VS1A 2EGZA 4GC4A 3P61A 1KFLA 3CIXA 2YXGA 4ADSA 4UFHA 4O17A 3LV6A 1FDYA 1SW7A 2EKCA 3EX2A 4RXGA 1JRBA 3WJSA 3MI6A 4IPJA 5HINA 3OBKA 2BTMA 1O4UA 4BFAA 3LXAA 3CPRA 2EHHA 2PURA 4MY1A 3KVLA 3OA3A 5KZDA 1W1ZA 4UMBA 1JULA 1KM0A 3W1PA 5C54A 2Y89A 4O1DA 4UTHA 3ATYA 2ATSA 1C9DA 2VEPA 1XUZA 3LI1A 4JTHA 1ZCOA 3P81A 2NX9A 3RNDA 2YSWA 2DZVA 3THAA 3TA6A 2WNNA 1LROA 3GAKA 1HFBA 5EPDA 1SZGA 4TU1A 3QQ0A 5D32A 2RDTA 2CLHA 2QEZA 2G96A 3MYPA
chains in the Genus database with same CATH superfamily
2G95A 5GQBA 4QLLA 2XZ7A 3KHDA 3KS5A 3RDKA 4DYEA 5LA2A 5DBTA 5H8MA 1WXJA 1OWQA 3H4XA 2Y62A 1GEHA 4S3JA 3WNKA 3VNDA 2PS2A 5EMYA 5FF4A 1RHCA 3BARA 3TR9A 3MT1A 2G5WA 2W5FA 4UB9A 3NQ6A 1DP0A 2OLSA 4X0NA 2REQA 4IJRA 3TX9A 4QCEA 3UZXA 1ONWA 3LDVA 3FV9A 4LANA 5EMKA 5T9BG 5CJNA 4LS2A 3BOFA 2AKMA 4MNMA 4UFKA 5CSUA 3QKEA 4BK9A 5M3WA 3UR7A 5CPLA 1E3ZA 1HP4A 3AYRA 4F48A 2F2KA 2P5NA 3TTQA 3U4FA 4Y2WA 3IGXA 3AU6A 4WOQA 3RLGA 3WUGA 3S42A 4HOZA 3K30A 2OZ0A 4RNIA 2CWXA 1JI1A 5E93A 3PZGA 1OK4A 4GK8A 3GW3A 3WX7A 2AOSA 1V3HA 3B3DA 3JS3A 4MPQA 5LYRA 3L5AA 3OYXA 2D0FA 5C9UA 3O07A 5K9CA 3H6OA 2AL2A 4JX4A 1CTNA 4HBKA 3WNPA 2QCMA 3MSGA 4QJ1A 1PL9A 1J0ZA 1LL7A 4L56A 1I8JA 4W5UA 2PUZA 3SCRA 4CU6A 4P8XA 1SR9A 1Q3NA 2OWCA 4G7EA 3CJPA 1LQ0A 1J0HA 4BR1A 1K6WA 2Y6ZA 2CYGA 1SJAA 3EX6A 3QHNA 4MKNA 4OBRA 4PUUA 1QR7A 3SY1A 1V0NA 4GI4A 4YLWA 3U57A 2OSXA 2HK1A 3GTIA 2HXTA 1W8SA 2WOQA 1GG1A 4OUEA 3ONBA 2E6DA 2A0NA 3BDKA 2VKZG 3TYCA 3R4IA 4AZIA 3AHTA 1E1CB 1MWOA 1VCFA 1WBJA 4YJ5A 4DXVA 7TIMA 1GT8A 2YYUA 5JIPA 1NARA 5HMFA 3VYLA 1NVMA 1XYFA 2OKOA 1V6YA 3SRFA 1KV8A 1TPC1 1I2RA 5I23A 1XIFA 4BHYA 3WD2A 3G1VA 1RAKA 3C2FA 2EPHA 2WSRA 1OSEA 2X1RA 1AL8A 2D3LA 3KOXA 5FL0A 4FLRA 2FTPA 3RRXA 2HXUA 3BW3A 2I14A 2ZKMX 5FJPA 1G4EA 3B9NA 4ICCX 1H2JA 1TV4A 1BYBA 1E1EA 1TTJA 3CL7A 3HG4A 3Q4DA 5JUVA 6XIAA 3BLFA 1MZHA 1RR2A 5LNSA 2PDHA 3H23A 5FL1A 1S3HA 1RQHA 1XCFA 2PD5A 2W91A 4J5NA 4LNCA 4H8UA 5I77A 2GJLA 3MUY1 2CLLA 1GJUA 2V2CA 5LSMA 4NL1A 4Z42C 2PF8A 4QS6A 2VMFA 5A95A 3NPXA 4AZ5A 3LPOA 5CPQA 1O5QA 3BURA 1I4NA 3LCGA 4Y9NA 3RJXA 2YFOA 3IARA 1XIJA 3E96A 4S3AA 3UR8A 4GYFA 1H7OA 3IPWA 2YBVA 1PTGA 3OZPA 1HJVA 3MSRA 1UROA 1VFUA 2VX6A 1ZL1A 1LWHA 2R24A 2C1HA 4KESA 1XIEA 2XFYA 3KBNA 4WF7A 4XAGA 7A3HA 4V2XA 1A4LA 3RO6A 4EPEC 2Z0IA 1TZZA 1XWYA 4GIYA 3GXFA 3NGJA 3V0TA 4TR9A 2D2HA 2HVOA 4CQ8A 1RCQA 3TC7A 4GABA 4UQDA 1E1CA 1E9YB 3RUBL 3VKAA 3STGA 1AQFA 2E9MA 4E4PA 2WHMA 3AMGA 4KRZA 3K8LA 4Y8EA 3GG8A 2WHJA 3IGSA 3FXYA 4C1NA 3NQCA 1LLOA 2GL5A 4W89A 1M7OA 1W1PA 4IFKB 1CYGA 1RP9A 4MJMA 3KRSA 3KTCA 2PRLA 4H2HA 7XIMA 3TYUA 3AS2A 3S5ZA 3RX3A 4PUNA 3PUEA 3LGDA 4UCGA 1LQAA 2Z2AA 4UTTC 4ZO7A 1FP9A 4S3BA 5C0QA 1L2UA 1MEHA 2C91A 1WDDA 1RALA 1GOMA 2XGZA 1GK8A 3P80A 2PZ0A 3IJ6A 1CXKA 1UC5A 3A9IA 4J7RA 2VZUA 2YLLA 1W91A 1JFHA 4AIBA 4K1GA 2FJUB 3TEVA 4LVGA 4IPIA 1CBGA 3LX9A 1A0DA 4M6VA 4ZOAA 3WQ8A 3M4HA 4K38A 3GRIA 4O13A 3B0UX 1RPXA 3MJYA 1JD7A 4AF0B 2D22A 4AMAA 2PDCA 1GW9A 4GQ0A 2HBXA 4HP5A 4ZZ9A 1OFAA 3NFUA 5FD0A 3B04A 4PFHA 4IJBA 1PX3A 5AZ0A 4XZLX 1QCWA 1KV5A 4XZHA 1VD6A 2ZICA 1TPWA 3ZS4A 3QPEA 4P7RA 1TMLA 2HISA 4ICMA 2DUXA 4HMDA 3LA4A 3LMYA 3SO7A 3O6AA 5HAOA 2G97A 4NJHA 3CB3A 3GK0A 2Q09A 2Y7DA 1LF1A 2VZOA 3WDRA 2VX7A 2YIHA 4JN6A 2GVEA 2FZBA 5LGXA 4NAEB 2EG7A 2X7VA 4MNKA 3EDEA 3BO9A 1MQPA 2WPBA 4Q6JA 6CGTA 1M03A 1HN1A 4FIRA 3W25A 4JKMA 4UFMA 1XLFA 3DU0A 2IPGA 3BMXA 3R79A 3WL1A 2QPXA 3AZSA 2VO5A 4W4QA 4H7CA 4IFKA 4LUTA 2UY4A 1J6PA 5FJIA 3QHMA 5HPCA 3IGUA 1EH9A 3KTXA 2O55A 4E2OA 1Q66A 1UH3A 2NX1A 5HJXA 1JYVA 5DBUA 3P5YA 1XLIA 2PLJA 2PWUA 4MKVA 1W2VA 4ZA0A 4HNVA 4FOUA 3T9PA 4DPQA 3GNNA 5EA9A 3S4TA 2ZUWA 3SGGA 6REQB 3PPGA 1OYCA 5DF0A 1EJUC 3WBYA 3SM0A 2WHLA 5AOUA 3II1A 5EYWA 3M7WA 3OVPA 4GNVA 4HVXA 1QNOA 3W7IA 4A4AA 1XX1A 4JDBA 2FIQA 4GXWA 2W3ZA 4LCRA 1UR0A 3D3AA 2BOEX 4FLSA 1G9HA 3VKJA 2B4GA 3B8VA 4LB4A 1IE7C 3SCWA 3DDMA 2RFGA 3I6EA 4O0KA 4ZO6A 1SSGA 4W84A 4LRTA 3VX1A 1OC6A 3VCCA 2HJPA 3TKFA 4ZSUA 3ALFA 1TCDA 4XD4A 1B90A 2CITA 5CSRA 2OKTA 3VDHA 1H7PA 2VC9A 4Q7BA 8XIMA 3EWUA 4UNLA 3T0AA 3DX5A 4HSOA 1R9ZA 1Q6GA 4PUJA 3LZ3A 4AIUA 4K8GA 1G69A 5FESA 3T8LA 1J12A 1H5VA 3EKLA 4JHZA 3WMLA 1ME8A 1Z44A 4D6HA 3TOYA 8A3HA 1UR9A 2QJJA 4AU0A 1UMLA 1WZKA 2W79A 3CEUA 5HMEA 2QCEA 4NAEA 4LUSB 4FXRA 1DJIA 3BLKA 4OWGA 3PBGA 4WX2A 1CB7B 5CSYA 4WOZA 1U22A 2P3ZA 1Q6LA 3SADA 2GGGA 4GVGA 2A5HA 2AQWA 1S5TA 1PSCA 4XSMA 3T09A 4LAUA 4JQAA 4JDYA 3VDAA 2G3FA 4IXXA 1TTQA 4HHMA 4RXFA 1F07A 3RM4A 2PWDA 4DBDA 2PDGA 4CN6A 6PTDA 2J24A 3VDBA 3NQDA 1XBYA 4QR6A 4XD5A 1ZP4A 3VGFA 4GNJA 4LH8A 3ERPA 5HNRA 3NO1A 3CV1A 6REQA 2FPYA 1XRVA 1QHOA 3I7SA 1AMYA 5A6MA 5KSWA 3A4JA 3PJUA 1XLCA 3PN8A 4TV6A 2XVLA 4JAWA 3QJAA 1CLKA 2EG8A 2WZTA 3GB6A 1GVIA 4Q4OA 3H54A 3CZKA 2CC0A 2BOFX 3W53A 4MIMA 5I03A 4P8VA 4JBRA 1FVPA 1ITCA 1W5PA 3VIKA 3VUPA 1W9PA 5I3JA 2HROA 4RDYA 1R3YA 3CQ0A 4LBRA 4YNGA 3S5NA 1PHQA 3UVIA 5K7JA 1KGWA 3O6DA 2PDFA 5AKQA 3W23A 3MUZ1 5BRPA 1US3A 5DQPA 2GSJA 4C90A 2BOGX 3UWVA 3CIWA 3FEMA 3T2QA 4NI3A 3MWAA 3AZRA 2QCGA 1FP8A 5A2CA 3P8IA 3O6CA 2WC7A 1VQTA 4R7OA 1AH3A 1AL7A 1K8CA 1PTAA 1ELSA 4L4MA 2V38A 4A3YA 4FK9A 3O06A 1PEZA 1OX5A 2ZA1A 1W17A 2PCQA 3SRKA 4Z0JA 2FZ8A 3OVGA 3NPVA 3H4WA 2HV5A 3W24A 1FWDC 1EC7A 3DEQA 1S3TC 2D0GA 4B9YA 2ZX8A 4HMNA 3TCSA 1T99A 1TMHA 1FCUA 4WJ8A 4J4KA 2NV1A 2FDSA 1ECQA 2WNZA 2JGQA 4EKJA 4JY9A 3M9YA 4O1AA 4L80A 2YDAA 4Q8MA 1TFVA 2E5BA 2J13A 3GDBA 3FGCA 1UP0A 1KFEA 1ZFJA 4EWND 4KRTA 1MSSA 1R30A 4CD6A 4D6FA 1SUXA 4ZR8A 1KTBA 4GGHA 3BLIA 2YA1A 4IIHA 3AUOA 3AMLA 1SJCA 4QE5A 4LAMA 4H9VA 8TIMA 4DYJA 3DZ1A 4YTRA 1NQ6A 1QNRA 1H60A 3VUSA 1QT1A 4JKKA 4XKYB 2X30A 3T05A 1H7RA 4PUEA 1ADSA 1X6UA 1D8CA 3EPOA 2BFGA 3AUJA 1HJXA 4NRRA 4ZB0A 5LIXX 1TVLA 3VE7A 1PBGA 3FX4A 2OLAA 1ZBKA 1FCBA 4D71A 2FVKA 1EHNA 1AMKA 5C9WA 3UXLA 3EXSA 2WHKA 1K9DA 4L1WA 3AJ7A 3N4AA 1MW3A 3U5YA 2CW6A 5BWAA 2XGIA 5I3IA 2Z2UA 3WF2A 5I09A 3H7UA 1BTMA 1KRAC 3PFMA 2HSAA 1LDCA 3GNDA 2RH9A 1Q65A 5CPOA 3CK5A 3TH6A 3TOPA 3QN3A 2Z28A 1W9VA 1H3GA 1JF5A 3A5FA 1V77A 1HX0A 4JFWA 4XIMA 3FA4A 3L0NA 4R3UA 3CWNA 2A3BA 2JKPA 4E2BA 3VKDA 1JPKA 4AZGA 2J62A 2FZ9A 2NSOA 3FKRA 3MBDA 3N04A 1SZNA 4XBJA 2ON3A 3EKGA 1FHVA 2Y8KA 5B7ZA 4CUCA 2VEGA 4KWWA 4UTWC 2BGQA 4B3ZA 4GYPC 3N6QA 2GUUA 1GZJA 4CEUC 4HOXA 2OFJA 3R25A 1P48A 3EKZA 4GQBA 3S47A 2YBTA 3GC4A 1E6QM 2SFPA 3Q37A 4F0HA 2X05A 2DIEA 1F5ZA 1GEQA 4CCCA 2DZSA 2PWHA 3CO8A 3HFYA 1XLGA 3FSTA 1NFGA 2OGYA 1IWPA 1G4TA 2EXOA 4GZIA 1QI2A 2PODA 5I3DA 2J6VA 2NV2A 5AHLA 4PB3A 4XKYA 1QO2A 3NOYA 2GQAA 4L9ZA 3SUUA 2ZZ2A 1UZHA 1GQKA 2CHNA 3N2BA 2DDXA 4LYKA 4URIA 4LUYA 1F9CA 5C5YA 1UWAA 3A5VA 1LLWA 3GHSA 4LS0A 2Q3RA 3MI2A 3B05A 1RQEA 2D20A 4I9AA 2C13A 5EFFA 3UXIA 3W7OA 1RLDA 1B3XA 4XZNX 3QQWA 4KFNA 5I79A 3NO3A 2ZE0A 4MYAA 4W7VA 3VGBA 2PTXA 4DWDA 1W3LA 3W2UA 3RCNA 1LRQA 5D37A 1TJ0A 1HJQA 2OQYA 2WM0A 1EWDA 4GISA 2I57A 2ZA3A 3DG6A 3TQVA 3MMDA 2C16A 4HMCA 3EMQA 4YWIA 3N9RA 3RAOA 4XZIA 2GJNA 1IF2A 1XQKA 1VIWA 2YL8A 1B3VA 1CI1A 4K7YA 2C1GA 2OEKA 2ZX9A 3BAKA 3QLDA 3BL3A 3S83A 3NIYA 1WBHA 3KP1A 1GORA 4YS1A 3EGJA 3N1AA 4HA3A 5T91A 2E6AA 2GFTA 1XW8A 3KL0A 2ASHA 3LOTA 3DG3A 3EOSA 5BNKA 4K7VA 1DQUA 4YTUA 2A79A 1U5HA 1ZSXA 2A3LA 4NX0A 3S2NA 3UD6A 3WQ6A 4XKMA 2OQLA 1SQ7A 1DIDA 3K13A 2E40A 4BF5A 2DU2A 2INZA 2WYSA 3M0MA 4Y9OA 3QZAA 3UWQA 1LP6A 2XFRA 5FAJA 3VZZA 4JTJA 4J40A 1NAL1 4ZVJA 3CUHA 1WDSA 4C6KA 1W8GA 3C52A 2CLEA 7TAAA 3NWRA 4HTYA 1TUFA 3W74A 3HA1A 1QW9A 4P7QA 2JKEA 3ARQA 3WY1A 2GSHA 3TSDA 1ESWA 3B9AA 5AHMA 4R9XA 4CQCA 3IK4A 1V03A 4ILSA 3F4VA 1UJPA 2YCEA 3N15A 3A22A 2OT1A 2WWCA 3K5XA 4L9XA 4QLKA 1GVOA 1NY1A 1ZAHA 1XRSA 4POCA 1IWAA 3AMKA 3EAUA 3GBDA 2CBVA 1J18A 3BH4A 2PRHA 5CZJA 4GX9A 3S46A 1PJ9A 3NZPA 2V3DA 1XSKA 1ODUA 3S1UA 6TIMA 1JAKA 3KBWA 1MYRA 2ZIDA 3N11A 5T9CE 4I9JA 1QATA 4YHGA 3JUGA 4E3VA 3H12A 4OFCA 2BNJA 3L4TA 2G3IA 1XYBA 1N7KA 1ADDA 1X6NA 2G3JA 2R8WA 2I16A 1JPMA 2VDIA 3WUBA 2L5HA 4JOMA 4GIEA 1NU5A 3RF9A 3W01A 1UZ1A 1HO4A 4AEOA 4PE8A 3N18A 3VOIA 4LOCA 1XI3A 1UUQA 2X09A 3GR4A 2ZX7A 4OTKA 4E2VA 4GIRA 1XDLA 1I6NA 2ZUUA 5AC4A 3UQNA 2X0YA 3WQVA 1I0DA 2WVTA 1PS9A 3VFCA 3L0GA 3LHWA 1N2VA 3POHA 2WJZA 5ABTA 1CXLA 5H1WA 2DJXA 1IEWA 1Q6DA 4ADTA 2O56A 3MP5A 1KFJA 2ZZ6A 4DJDC 5AECA 2Q8XA 1QOPA 1TV2A 4LYQA 1RCXB 4CCDA 3UCCA 3B8TA 1XLMA 4PBFA 4CNUA 2DY3A 1JCXA 3CWOX 3HFTA 1B3ZA 3M5ZA 4FXSA 3NZQA 3PBYA 2V8ZA 3G1FA 1HKIA 4DUXA 4MSSA 4BI7A 3M0YA 5LIKX 3GNPA 4DPPA 4UTKA 5E0FA 1RK6A 1ZUAX 1O1HA 3CAWA 2H3DA 3DHDA 3FAXA 3L68A 1M53A 1TB3A 4J28A 3LN3A 5I3GA 4IQDA 4AZ7A 3NYDA 3GKAA 1IIGA 3GTFA 1EIBA 3CM4A 3R89A 3T0TA 4GBDA 3QH2A 4RL3A 3A12A 4BF9A 4GKTA 3WLPA 5BU9A 2G41A 3TYBA 1E6RA 1A4MA 4CD4A 4UMAA 2CETA 1B4EA 4RPPA 2JQXA 3NYZA 4DF0A 5BU6A 3TQPA 4RE0A 4QJ5B 1FWGC 2X1IA 4IICA 3W81A 1UWUA 2CLPA 2WANA 1SMAA 2HS6A 1AD4A 1CENA 1ZJAA 4PB4A 3CHCA 2OO0A 1CGWA 4Q8QA 4P8UA 4JN7A 1Q2SA 4GFSA 4S3CA 2E6FA 1A53A 3S6TA 1PIIA 2BY1A 4ZOCA 3M43A 3NL2A 2WMGA 2Y70A 2NQ5A 1JDEA 3D47A 4HHPA 4UIOA 4WY0B 3WH5A 3FK4A 3B03A 2WZHA 1JD9A 2ACQA 2BLEA 4IMFA 2TAAA 3USZA 4IISA 1M04A 1M6JA 1SZFA 2OOFA 4DB7A 1NFPA 4W8LA 2VEIA 6ALDA 1LL4A 1WX0A 5HANA 1JAEA 4GACA 3W82A 1A0EA 3W86A 4W85A 1OD8A 2XH7A 4GO8A 3PUDA 1UD2A 1YLVA 4OKDA 2I9UA 4JXCA 1NSJA 1TVNA 4H9UA 3T7VA 1BFNA 4FX7A 2P0IA 1H7WA 4WIWA 2QUTA 4JEQA 2WC3A 4V1XA 4AFYA 3LGEA 2PC8A 1DL3A 5M5DA 3VAVA 3F4CA 1O6IA 1JGIA 2Y88A 3OJGA 1N55A 4NJGA 1DE6A 1JQXA 1X97A 2H6RA 4KWVA 4TTGA 3BUVA 3CIVA 1H49A 4MY9A 3A23A 2WC4A 3MVIA 3RLUA 3GKFA 4L61A 1TQJA 1VRXA 3W1XA 3TUUA 2OU4A 3W84A 3DHPA 3RR1A 1B3WA 4DQWA 3KX6A 1XYMA 2VTFA 2NV9A 4G7FA 1V02A 1KXQA 3WUEA 3TTSA 1RA0A 2Q8ZA 2QDDA 3LSBA 3BQ6A 5FEZA 2OJPA 4PTXA 1DJZA 4JL2A 1XUUA 3FSUA 4XQ6A 5KZ6A 4K1WA 3V1HA 3NQGA 3BW4A 4OOZA 4ROPA 4OV9A 3DCPA 1F74A 1Q4WA 1SZRA 5A8MA 1EP1A 5L6UA 3RR4A 4ATLA 3JR2A 4C65A 1UWSA 1YDYA 4IXHA 4PTWA 4WY0A 1DHKA 3CZEA 1DBTA 4ZOEA 3FAWA 2NXHA 4RNHA 1BGAA 1U1UA 3EX1A 4Z2LA 3GHRA 4HYWA 4GGBA 4ZFMA 1OX6A 2CLKA 2C0AA 2DT3A 1D9EA 4YVXA 1XIBA 2C1IA 4Z17A 4HCLA 4WDTA 4A21A 1A3WA 3NURA 3QC0A 2GDUA 4IQJA 4L65A 1VBUA 1RY8A 3HZ3A 1VENA 3NQBA 4MZ8A 2YCKX 4NASA 5FJUA 3LLXA 1QTWA 4NKCA 1SW3A 2D24A 2HRWA 1FH7A 4I3GA 2XHYA 4CLMA 2D73A 3HG5A 1QFEA 4KEZA 2ODOA 4Z2JA 3C8FA 4E0CA 1I2QA 1YTEA 3W1UA 2WCGA 5BRBA 1BVZA 1ZS2A 3I3EA 2VOMA 5I0DA 3TSMA 3H7VA 1S38A 2WB5A 2WPGA 4NP7A 1LWIA 3PB2A 3CASA 3U5UA 3OA5A 3W38A 4O1BA 4G6CA 1S2AA 2WVSA 1GONA 4KCVA 4Q8PA 2R1LA 1T7LA 4X0VA 2RUSA 3A3XA 4L6DA 1JVNA 1OFBA 3FN9A 4FNSA 2QCFA 1LJYA 2WV8A 3DH7A 1JCNA 4P8WA 5HQLA 4HU0A 2C71A 3N34A 1VBHA 4U2ZA 2PF0A 2QNEA 2WMJA 3GU2A 4D8LA 1OT1A 1TPEA 2YYTA 1XLAA 3PK7A 1R47A 1YPIA 2D2GA 2XFFA 3GE7A 4LXFA 2QVNA 4AXKA 1OB0A 2OT0A 3CZGA 2EGZA 4GVIA 3E5BA 4ZE5A 4O17A 1FDYA 1JRBA 3WJSA 3MI6A 3QXBA 2QQ6A 2F6KA 4J2MA 3WF3A 3F2CA 2IKIA 4AZBA 3MO4A 1JULA 3WD0A 2C79A 5A8PA 3QOKA 2YB4A 3PWIA 3THAA 1LROA 3GAKA 3PZ9A 3M7SA 1B5TA 1UR3M 5EPDA 3TN5A 4TU1A 3QQ0A 4B5SA 2HE5A 2CLHA 4HNLA 4Q4RA 2QEZA 4M7SA 3TU9A 1LM1A 1OCJA 2UWFA 1OHLA 3WF0A 4R88A 3KOYA 1H51A 3G2GA 1LTDA 2YB1A 2ZZ3A 4AIOA 4Q8TA 3WF1A 4M6UA 4A6GA 1TR1A 2AMGA 3MMWA 1SR0A 5A6KA 4ZOBA 5HQEA 3NDZA 1EJRC 2D3NA 3HJEA 4B5NA 3VIJA 3LCFA 3B8WA 4P7LA 3BOLA 3K8KA 4QG8A 4JFSA 5G2WA 1EPVA 4GUJA 3EA1A 4W93A 3HO8A 3DC8A 3TJXA 4QAWA 1OFRA 3LPPA 3MU7A 1BYAA 1KD0A 2AMXA 2X8RA 4QBXA 4PBGA 4ACZB 1R2SA 5BXRA 1E4LA 4IH3A 4H8HA 1Z48A 1R7AA 2OWXA 1JZ4A 3GYCA 5C7HA 1H62A 2J9XA 2E6YA 1XRTA 1K8XA 5EBUA 3GD6A 4TX9A 3EOUA 2ICSA 5IRPA 3TC6A 1FXQA 3BJTA 4C6FA 3EXTA 1K3UA 1B0IA 3L5MA 2BSLA 3W3OA 3SJ3A 1VIZA 3QZ6A 1J4EA 1UYQA 1FX6A 5K3VA 4CNTA 4I6VA 2YZRA 3OB8A 3KCJA 3M0IA 3KCOA 4U3CA 3ABZA 2X2YA 3GH4A 1E73M 2NXIA 2WVVB 5AHEA 4GUGA 1H1ZA 2P1FA 3M41A 2O4QA 3P2VA 5TIMA 1CCWB 1N8WA 1Z3NA 4LUJA 4OGZA 4PULA 3HQPA 4AHPA 5D30A 4LB3A 2WJDA 2C3ZA 3GIQA 3EEZA 3GIYA 1OFDA 5DXXA 3WQ4A 4KEMA 4DAFA 1UPMB 4GUFA 4Q32A 1KW1A 2VJXA 4PRWA 1POJA 1V5XA 4RZ6A 1UR1A 1MNZA 3FLUA 2J7GA 3BOXA 1UD5A 3BAXA 3W1NA 2E4TA 3BLLA 4WVXA 3SBFA 3HQNA 2E8ZA 3UP8A 4A2SA 1ONEA 4PMUA 3URQA 2QKFA 4N9DA 1W6TA 5I3HA 1X1NA 2AAAA 1K8ZA 3M6DA 1QHZA 3EWDA 2P8CA 4HPXA 4IM4A 4I8DA 1JF6A 1KA9F 2C0HA 3O1NA 4KH2A 1EA0A 5FIPA 3ZSSA 3ZXWA 2YL6A 3FVMA 4N0RA 4U4MA 1JZ6A 2KZHA 4XISA 4X9SA 4DX3A 3B8SA 1FWEC 2Z1WA 1BWVA 4PMXA 3GU9A 3TMLA 1N8IA 3ATZA 4N7QA 3S1VA 4ACZA 3APYA 4CQAA 4ZTXA 4WDXA 1M7XA 2VFEA 1ITUA 3CUZA 1A50A 4DJEA 1I2NA 3RCMA 4DRSA 2IQTA 2HWGA 1D7KA 3P5ZA 4GYKA 2YX0A 4OUIA 3PG9A 2VC7A 2Y5SA 3SIMA 4JYDA 4ENLA 3S0CA 2JIEA 4HHHA 4B15A 4A8LA 2Y5JA 1YADA 1EOKA 3KLLA 5IDZA 4NSBA 4CNNA 3NL3A 3VXGA 3L2MA 2BHZA 2J47A 2H9AA 3IJQA 1ME7A 4EVZA 4O11A 2GDVA 1P1MA 3TCEA 2B7OA 2CU0A 3H2NA 3RPMA 2QIWA 3W2MA 3TNOA 1TKKA 4XAPA 3EDFA 1GYLA 2ALRA 3VNLA 3S1GA 4D2JA 2IXVA 3H26A 1GZ1A 4MB4A 3ZJ6A 2W63A 5LNRA 3O8AA 2X7WA 1E6NA 3FYPA 2B7QA 3VCNA 4M56A 1G0CA 4NZ3A 4RKAA 1JGMA 4CGTA 3ZWSA 1W5QA 4ZE4A 1JCMP 3OLIA 1MUCA 3L4WA 1ZPTA 3I65A 3SUWA 4FP1A 4IP7A 1O95A 5BXSA 4B90A 3KL5A 5TBOA 1UIOA 1D3HA 3NVDA 4JTRA 4I7WA 3B4UA 3OGVA 1PIGA 3DUGA 3R0UA 1FQ0A 1CIUA 1WYIA 1XCWA 1W0MA 1WDWA 1EWEA 4NUWA 1DKWA 1IXQA 3W2JA 2F6XA 1W1TA 2WSPA 4UOZA 5CPTA 1UOKA 1V3MA 3MHFA 2WCAA 3VPLA 3E3HA 2ZXAA 3C2EA 2W4XA 3QYQA 5AYZA 1OX4B 4GOAA 5DLCA 3BZJA 4XD3A 3GYEA 1FXPA 1GOIA 4A05A 1GVQA 4GC3A 1A5UA 1QW8A 5CG7A 3SSZA 1B4KA 4HU3A 5GVJA 3QVQA 1YEYA 2DSUA 1KKRA 4M3PA 4J3VA 4CD8A 1QBBA 3OIHA 3F5LA 4X60A 1EGZA 3NJ3A 1ZP3A 3QC3A 1JNEA 3SIZA 3OHMB 2EQDA 3HG3A 3UCDA 1CB2A 3KWSA 4RV8A 3NEVA 1ZGDA 2E68A 1Q6FA 4C6QA 3BK0A 4TMBA 4WDWA 1S2VA 3IJ8A 3HPAA 4OVXA 1QI0A 2DGAA 4PRTA 3HPZA 3PP7A 3AICA 5IOBA 3QR1A 3RYSA 2AL1A 3OIXA 4PMYA 1XBVA 3F2DA 3QSTA 4QP0A 3AIUA 3DAQA 5CGTA 4D1JA 3GUGA 1XH0A 4QNEA 4J3SA 3F2BA 2YCLA 3K2GA 1JCLA 3ORWA 1XF0A 3HBLA 1LG2A 1IZJA 3QYSA 4JTKA 3SQMA 3M44A 3W7DA 2J74A 3MDUA 1W3IA 3NM3A 1L8PA 4GUIA 2NQLA 3UZYA 3VO0A 3WJYA 4US5A 4AB4A 1FDJA 3ANYA 3L67A 2DIJA 2FH8A 1IHIA 4YCPA 2GYIA 4FX8A 3M6YA 3RK8A 2C6QA 5HJLA 1EOMA 1EZWA 3B40A 4JL1A 5F2MA 3NQVA 4H9MA 2BY2A 3RU6A 5F2IA 4MFEA 1J5SA 2J78A 1Z8AA 2P0OA 4KWUA 1GYMA 2XIJA 4QS5A 3R0KA 4WZHA 2ZOXA 4HMEA 3GDRA 3PWGA 1HP5A 1OX4A 2HVNA 2NZLA 4GJ1A 1L6GA 4AXNA 1W3NA 3WBXA 3QY7A 4BWLA 3DKJA 3LU2A 2ZX5A 3CT2A 4JIIX 5KZMA 4UR9A 4BQ2A 1QU4A 5F1UA 3SB0A 1KBKA 1ONRA 1ZY9A 3P7YA 4O0QA 3SJNA 1QPQA 3VNIA 1YPXA 2WAGA 4HYVA 1IEQA 3OPSA 2J66A 2CWNA 4AW7A 1K4HA 3G8EA 3LXCA 1Q6RA 1VB9A 3WK0A 1OG6A 2VFFA 1WB0A 2J9YA 3M07A 3UPMA 3QHOA 3VABA 4US5D 2XTKA 3G1YA 3UT0A 3E2SA 4ZQOA 1B9BA 4YMZA 5HUOA 4ALDA 4HPJA 2NSXA 4UUIA 4CU8A 3PSVA 2RDUA 4ICNA 3W7EA 4WCJA 1XIMA 3GLCA 2XINA 2WJFA 4FPSA 3ARUA 4EP8C 4PMVA 3LD5A 2O9PA 3FHQA 3AIVA 3MV01 1AQHA 3VFLA 4S3GA 3A47A 3WLLA 3AXKA 4AD1A 3LB0A 2Y4SA 3BE7A 1V6WA 2QW5A 5DRCA 3IEBA 4PTNA 1ZJBA 1C93A 2GUBA 3EYPA 4BEUA 5C6MA 4REQB 4DBSA 2QUVA 5C55A 5TAOA 3M0VA 5FAGA 3T42A 1EEXA 1L6FA 3G6LA 4F0MA 4M51A 4PC8A 4FIQA 2XVGA 3AHVA 1YDNA 4H8NA 1TRIA 4KIEA 2WSQA 1QHPA 5EMUA 1VHCA 1DJWA 2FHBA 1V93A 2XWEA 2BHYA 4DWSC 2FQIA 4L1GA 1J0IA 3BMWA 4Z2HA 1YXCA 3MCMA 4TIMA 2O9RA 3TQ0A 1K9EA 1RQBA 5BXTA 1VHNA 1TV7A 3SUSA 1P0DA 1EIXA 3WQPA 5IHSA 2J9ZA 1YPFA 3SGZA 5BMXA 4B2DA 2HCVA 9CGTA 2ZTKA 1XG4A 3VGDA 4KT2A 2DH3A 3ZVHB 5A69A 4DNMA 1W2PA 5JBEA 3S8HA 1EJSC 3WN6A 4XWUA 1I2OA 3L4YA 1S2UA 3KFTA 1DXIA 1S5VA 1US0A 3LK6A 1UP2A 3PZMA 4XUYA 1O5KA 1XPGA 2P53A 4RCXA 4Z1BA 1DJQA 1HKKA 4FOKA 4DJEC 3GHUA 2YBUA 4ZCWA 1MUMA 3UNDA 2QLYA 2WMKA 1G5AA 1E40A 3CNYA 5A6AA 2QUMA 5KINA 2ISSA 1XLHA 5B80A 1M1BA 1PTDA 2CFFA 4IFOA 3ZJ7A 4KCWA 4NX5A 3NR0A 1X1ZA 4IOTA 4XAZA 4RX0A 3FOKA 1AD1A 3A3HA 3NDOA 4GRSA 4KGLA 5CPNA 3CMFA 3R0DA 2BXZA 4X61A 3CC1A 3W73A 5A5WA 1E9LA 3AWNA 1Y5WA 1W9BM 4F0LA 4NIRA 3W7GA 2EPMX 1W5OA 2Z6JA 4B2DD 4GQGA 4REQA 3H21A 4UCFA 4LF1A 5KITA 3ARVA 1XCXA 1TJ1A 4LTSA 3WH8A 5FOOA 3VIPA 4L64A 2ZBTA 1DJGA 3H22A 4C6NA 3GX9A 2ZFAA 1VLWA 4CQDA 1E0XA 3E49A 1GKRA 3HMJG 2NQHA 3BCDA 1F4AA 4CQBA 2BVDA 3LCXA 4F9JA 1ISVA 3EOLA 4AY8A 1WQ5A 4OHQA 2DW6A 4UTUA 3IUIA 3V18A 4A2RA 3MTWA 3LCHA 1KC7A 3WBAA 1GKQA 2JFEX 1R46A 3LG3A 1W9DM 3P82A 1PXGA 1KKOA 2J77A 5GJMA 3VINA 4C7GA 3N2XA 4O57A 2X16A 3ZVHA 3TJ4A 3U4AA 2NVAA 1UJQA 5BXPA 4I6KA 3GFYA 4XD6A 2VX4A 3W70A 1NWTA 4H2CA 2TSYA 2PC4A 3VNZA 1JDDA 3IVUA 1NF7A 4S3FA 3CS2A 4YYFA 4JQ2A 4MB1A 4BJHA 4ZENA 1K7FA 1B2YA 4FNQA 3PZOA 1OYBA 4LY4A 2NUXA 1SSDA 3E0FA 4UBPC 1EC9A 1RSCA 5E70A 3E0LA 4IG2B 1JZ3A 1WZAA 4M24A 3IGHX 2ISVA 2V5JA 2V2DA 1F6KA 1VKFA 1R3TA 4FLOA 4M6QA 4N42A 3ES8A 1JYXA 3WJXA 4NVTA 1GQNA 4XK2A 3GH5A 1OVDA 4MM1A 3W37A 1X96A 3HJZA 2P76A 3SCQA 1WV2A 2PDKA 3GTNA 3WMSA 1DVJA 2VVSA 3GUWA 2X0HA 1CGUA 2DUAA 3HGSA 2PZNA 3IANA 5U4NA 4D9PA 1KTCA 2AKZA 4DZAA 4K3ZA 3DI1A 3VC6A 1R38A 3GG7A 1YE6A 2HMCA 5FEPA 3QFEA 2VRKA 4WXYA 2QDEA 1TIMA 2I9EA 2Q3OA 5AY7A 2WLYA 1RVKA 1XG3A 4HD5A 1XV8A 3LENA 4HU4A 2VR2A 3T55A 5I78A 4HTBA 1ADOA 1TTPA 3AS3A 2CIPA 2DV0A 3T0DA 2PTZA 4AD2A 1Q6OA 2CERA 6A3HA 1E6PA 1XGZA 1ZBCA 2E09A 1P6CA 2HS8A 4QDMA 1XKYA 1KTNA 4JQ4A 1MXDA 3W22A 1FWBC 2V6AA 2VWTA 3K46A 2PA6A 3GXMA 3GXPA 1TRDA 1XKJA 2Z25A 1M3UA 3GG1A 4HHLA 3WK2A 4UFJA 4MOZA 4CN4A 5G2IA 3GXIA 4IG2A 4CN1A 4BWLC 2P3EA 2QIIA 2MUCA 2IUZA 4O1CA 1KGXA 2IMRA 4LYRA 3EWXA 4FOJA 1FWIC 1O68A 1T96A 3LRMA 3KOWA 5KETA 4M8UA 1TV3A 3RU8X 1HW6A 1UR2A 4AX6A 1PAMA 3RPTA 2V3EA 4BS0A 1J2BA 2QGYA 3M64A 1UD3A 3WDPP 3CLWA 1LT7A 3OBEA 1S5MA 4KRUA 3B0XA 3CO4A 3FY1A 5HBFA 2HE8A 1TJPA 4YCOA 3PR2A 5CC5A 4E38A 2RGLA 1OC7A 2GVGA 3LRLA 2YW4A 3KRZA 1SGJA 2X2GA 3FW6A 4AD3A 4F79A 3LBOA 1QOQA 2R6OA 1EP3A 1PKLA 3UYCA 2QPSA 3PPHA 1CXEA 2G3NA 3MS8A 4M6PA 4KCTA 1U2YA 4FB7A 1T0OA 3LCLA 4N9CA 1EKOA 3KS6A 5GNZA 1P43A 5K4XA 4IGMA 3IIXA 4TX6A 4WKAA 1NDVA 3AIEA 4F0SA 1IV8A 1QPRA 3ONCA 1AFSA 2I5IA 1DWFM 2ALDA 1TWWA 4B4FA 1FDZA 2ZUSA 1LBMA 2XIOA 5J8LA 2E5CA 5B7YA 3TWAA 3VKCA 3GXNA 2DSZA 3NQMA 5IM51 2HVMA 1M7PA 3UR2A 4J3UA 3UZZA 5AC7A 1XQLA 1XIDA 3PG8A 2GGHA 1M68A 1L0PA 2V3GA 4AZHA 1KRCC 1Y65A 5A2BA 1XS2A 4JNMA 2RJHA 4H83A 1X1OA 3KDNA 4L1XA 1GOKA 5F7UA 4IIGA 1NWSA 1EJVC 1FWTA 2WNWA 3XINA 1FWCC 2WZIA 2VEMA 5EMJA 3TQKA 5H91A 3DFTA 1F05A 3BMVA 4NZJA 1IYXA 5DO8A 1TVPA 4UR8A 3GSMA 4JIQA 1R2TA 5CC3A 3A3WA 4O50A 4LC8A 3WLKX 5FEWA 3T4CA 4DJFC 1RBAA 1PUDA 2POTA 3KUMA 2XWDA 4RW5A 2WKGA 3IK2A 2OYLA 4JPGA 4MKSA 3VGGA 3O0KA 3LBMA 4D8ZA 3TYZA 1TPH1 3ZR6A 3W7JA 1PX8A 4CNOA 4N9BA 1EQPA 2XG9A 4TVUA 1K9FA 4AVOA 2QMKA 1ICPA 3T44A 2ZADA 3BQ5A 4C5YA 2ZRUA 3WF4A 4LU0A 4C91A 3DFQA 3BANA 1JCTA 2OX1A 3PFRA 2DVXA 1ZLPA 1HKVA 4H19A 1C7TA 1RBLA 1JDFA 4MJZA 4EXQA 3N19B 1GG0A 4QE4A 3CAVA 4S3EA 9RUBA 3H2FA 3Q58A 2ACSA 3P0XA 4ZXLA 2XZ9A 3BLOA 4Q4QA 5D2WA 3PAJA 3RPDA 2ZUVA 1W1VA 5EY5A 3SQSA 3U8GA 1TWZA 3QF0A 4ORMA 3KLKA 3VD9A 2VCCA 2D23A 4OV4A 1HGWA 2GQ9A 3CQJA 3WQEA 5C2XA 2E9BA 4CQ9A 4JN8A 4H00A 3LTSA 4F2UA 3M0HA 1KXHA 4I8YA 5K9XA 3W4RA 2DH2A 2V5LA 3NZ1A 1RJQA 2Y7GA 1GVEA 5ABGA 1T41A 7ENLA 3WNLA 1SVDA 3PZUA 1NEYA 2Y1HA 3UGRA 1A49A 1CGVA 3GZAA 2R94A 4QTGA 3KL3A 1EP2A 2YFNA 4GI9A 3B9EA 3DFOA 1YW1A 2EPOA 1TE1A 3FKKA 5DCDA 5FF0A 3VOGA 3S5SA 5U7SA 2ESCA 3RITA 2VT0A 1BTCA 2Q02A 4FI4A 1IXOA 1JYWA 1PWMA 1DYSA 4INFA 3W02A 2ZXBA 4B5UA 4YVVA 4IGNA 4RDVA 3WUFA 1F6YA 4JTLA 3OEXA 4JD4A 4MVAA 3PANA 3VI2A 3TK7A 3ZVIA 1TQXA 2J88A 1CECA 3QMTA 2BV9A 1MVYA 2CLOA 2ZVIA 2X0SA 1QI3A 3UWEA 3QV9A 3RX2A 3V4BA 1HL8A 1OABA 3ZFHA 1YX1A 2Z4GA 4C1NB 2F7FA 4QJ3B 4NJJA 1F3WA 1LBFA 2CKRA 1X6LA 3TJIA 1IGWA 4E4FA 1TPDA 3P14A 2KAUC 2CXGA 4Q7NA 1IGSA 3NQFA 3F7JA 1Y5VA 3VIHA 3NA8A 4NQ1A 1E4MM 3EOOA 2OWWA 3W1TA 4DN1A 1QBAA 4IL2A 5DXYA 3COTA 1GJWA 3CUFA 5IBXA 2QAPA 5AB3A 2VL4A 3REQB 3UESA 2PDMA 4MDPA 2EO7A 1HJUA 5JBDA 3LGGA 4IIFA 4IP4A 5D8ZA 1UC4A 4Q4PA 2WO5A 3HPXA 4UFIA 1JUBA 3C0JA 3PC0A 1BF2A 3G0XA 4MUPA 1NP0A 1CXFA 2VGBA 4KKXA 3UG3A 1A5KC 4XO7A 8XIAA 1FWNA 3AYTA 3R5EA 3B8DA 4PCFA 3TE9A 4DO7A 4MJ4A 3AXMA 3WEMA 5ABHA 4FNPA 3MUAA 4F8XA 3IAPA 3I6TA 3WYZA 5C9RA 3CUJA 3MV11 4R7WA 1BHGA 4L4LA 1YDVA 1ZQ5A 1HVXA 5CLTA 2RDWA 4JTIA 2VZVA 3UWYA 5M03A 1VJIA 4ONVA 4CD5A 3UA3A 1EPXA 4QRNA 3E0VA 1LL6A 1NOFA 1SW0A 3CPGA 2BASA 2A7PA 1GHSA 3JRKA 2W0UA 2F8QA 4X9YA 1PZ0A 4MAVA 3DENA 3TTYA 1PDYA 3V75A 5I7GA 1TMQA 3ZYZA 5M17A 3UZWA 4MWAC 3MJMA 4S38A 1DE5A 2VR4A 2E1WA 1K03A 2EBNA 1UA3A 4R5EA 5HDRA 2XN1A 2EPNA 5DCBA 1W5MA 3ECQA 1LCOA 2GGEA 1V0KA 4PMJA 1XD1A 3PPFA 3WK3A 1IXNA 2XISA 4CCZA 5DMLA 4V1YA 4DZ5A 3G1DA 4MHBA 3N73A 1J5TA 3LERA 3Q45A 1NWRA 1TCMA 3VX0A 3RM9A 1AJ0A 1WKEA 1Q4NX 2Z6IA 4LUTB 4NZ5A 4UFLA 2C7FA 2Y8VA 3KHJA 1PVNA 4QHRA 3MVTA 1V7AA 4FXJA 1WNOA 5JIWA 3PJWA 2DEPA 4KERA 2BDQA 1DOSA 4LQ1A 3NSNA 4J2PA 3REQA 3ZJ8A 3PBUA 1QAPA 2G3MA 3VD4A 3H2AA 4AY1A 1JCJA 1VAHA 4Z2GA 2AGTA 3TLQA 5A6TC 3LLDA 3R12A 3HN3A 2QPUA 3B0PA 4U3AA 2E77A 4HSHA 4KEUA 2OELA 1FUYA 4EPKA 1E3XA 1Y8BA 3K1DA 3MUXA 2A6NA 2V9DA 3BLPX 3G5EA 3GDLA 4AD0A 4TOQA 1CZ1A 4FX6M 1QNQA 3I4KA 3WQDA 3OVRA 3ARTA 1YNQA 4JX6A 3EDJA 1AH0A 3I4EA 4D6IA 4M5PA 2DSKA 4FNUA 1DWGM 2Z27A 2BX7A 4IIBA 3QBUA 3TA9A 1KBJA 3URNA 2OEJA 3HTWA 2JE8A 2WW5A 4QQUA 1HGYA 6ENLA 3NL6A 4QEEA 2YDRA 2W6RA 3C56A 3GH7A 5DCEA 3ISIX 3CH9A 1A0CA 4IJCA 5DEZA 3W07A 1ZTVA 5A6BA 2A7NA 1J93A 5FJOA 5JMUA 3AYVA 2YR1A 4R33A 1F6PA 4LRSA 1QW7A 5C9XA 1UWIA 3CL6A 4TTUA 3T78A 4NU7A 3NQ2A 5BRQA 4NI8A 3DG7A 5FI8A 2B31A 1I1WA 3R43A 3RX4A 2I5QA 3STPA 1GWJA 1UWRA 3QW3A 3MWCA 2GDQA 2BGNE 3VM7A 1ZBVA 3G0UA 1PCWA 5EBAA 3LI0A 4PCSA 1V6UA 4W7WA 1R3QA 2VC6A 1UA7A 1MO0A 1X7FA 3WNNA 3VZXA 3SRHA 3HM7A 1V8EA 5HNUA 1BQGA 1GJPA 4U5KA 2CZEA 4FNTA 3GVGA 3STCA 2EJAA 3BAIA 3GWQA 1MUWA 4WKHA 4ZO9A 3TAKA 2ZRWA 5CAKA 3QZEA 5GPRA 3P84A 1NDWA 3JZEA 3KVMA 4UXDA 4NYYA 2GJXB 3MPGA 1I2PA 1MXSA 3ZLGA 3CU2A 3MCOA 1YMYA 1HXJA 4GC4A 1KFLA 1MW0A 2YXGA 4ADSA 3O0FA 2GUYA 4L6OA 3LV6A 1SW7A 2EKCA 4RXGA 1S46A 4IPJA 5HINA 4BFAA 3GBEA 1MDLA 3IS4A 3OLGA 5A6BD 1KGUA 2EHHA 1O7AA 4KGJA 3OA3A 3FDKA 3OODA 1YE4A 1H09A 4UMBA 2Y89A 4O1DA 2E3ZA 4JTHA 3P81A 2NX9A 1XR2A 3RNDA 1WKFA 4F2TA 5EB8A 4Q4MA 2NQ9A 4ZGYA 5HPOA 5D32A 1R85A 3RJYA 1OQFA 4AZ6A 4DUWA 3W7CA 1VZWA 1JCYA 4PODA 3WH7A 4LCSA 3QSRA 1EJTC 1G4SA 3DXIA 2VFIA 4Y9PA 1JXJA 3OO2A 2Y0FA 3T8QA 5D4YA 3RO8A 1P6BA 3FIGA 4OECA 7ODCA 4O54A 1HZYA 3R94A 2YDSA 3UBPC 1P4CA 3W87A 3LUTA 1BVNP 1E6XM 3ZZ1A 1NDYA 4DLFA 1U1HA 3MUCA 5BROA 4TUFA 3U6WA 1IT0A 2F84A 3L5LA 3GC2A 4WRHA 1FWRA 5M1TA 4H7ZA 1ALDA 2I17A 1S1RA 4DM1A 2WQDA 4E4UA 1REQB 5E09A 3FGCB 3K8MA 1VJSA 2MANA 1XLBA 1BLIA 2A3EA 1B9ZA 1W9UA 2BMBA 4RJEA 3WBWA 5HWMA 1HTIA 2PWEA 4FLQA 4K39A 4NAFB 1ZALA 5C2GA 4XUGA 1IIHA 5G1MA 1JPHA 3OZOA 2FLIA 2GJXA 3PM6A 1ZCCA 2F2HA 4L4PA 2J7HA 2JKAA 1G7VA 3DC0A 3LZ5A 3FFSA 3L23A 4UQCA 5F4XA 2VGFA 2YDQA 1MDRA 4GO9A 4IIEA 4P7NA 4LW7A 3V7PA 3A64A 5D03A 1EYWA 2FH6A 2Q6ZA 5K9DA 1N8FA 3ZJKA 3LM7A 1BG4A 4HSNA 3I6RA 1UBSA 4BZYA 1QPKA 3FA3A 3MDWA 4UWMA 3V0SA 4LBSA 5E5CA 1FHLA 1T5AA 5PTDA 4HN4A 3CZJA 1NDZA 3WQOA 3E12A 2OQHA 1TA3B 2EJ1A 2DT1A 4GY0A 1C8YA 3UU0A 4LNYA 4GVHA 1C92A 1TR9A 1E5NA 1KFKA 3R10A 2PRMA 4I7UA 5CSSA 2OSYA 3NM1A 4HNOA 4JS3A 1IT8A 1K7EA 2J25A 1B3OA 2WBKA 2V2HA 4FHAA 5F2LA 1A5BA 4Z1DA 1GGOA 4JKLA 4BA0A 3EWBX 4XBKA 1ECEA 1JEZA 2PDLA 4A3UA 4PUKA 2QR6A 3ID7A 4MUZA 3AZTA 1E71M 2FZDA 2NWSA 4QM1A 3QQ1A 3IJ7A 4G5DA 1OGGA 3ARXA 3PPCA 5CBJA 1U5VA 1AZ1A 4EANA 3H2EA 3THCA 4NZ4A 3TROA 1KM3A 1YXDA 5D38A 2GLKA 1TWIA 1REQA 1C9WA 2BY3A 3WLRA 3MYOA 3K4DA 4NY2A 3T0CA 3GTXA 5H8UA 2XVKA 1X98A 1QNPA 1LRTA 3DFPA 1UQYA 4BCEA 2BG5A 1HUVA 3EEGA 3GVWA 3G1HA 3UXAA 1KM6A 3GFXA 3HV8A 3C2OA 4NAFA 5A6LA 5AVHA 4EACA 2H8XA 1QWKA 1OIMA 1VPQA 1F3XA 3ITYA 4PL2A 4CVUA 1J2WA 1W3TA 2HNHA 4ZEPA 3UJRA 1QUMA 1D3GA 4ORIA 4F40A 2OVLA 3LCIA 5HOSA 2WMIB 1L9WA 4Q8UA 4EIVA 5JXQA 4IMEA 4AUBA 4HCHA 3TW7A 2ISFA 1YDOA 2FVLA 4I5UA 2BODX 4Z08A 3CMJA 2ZYFA 1BYDA 1IXPA 1NJJA 3AXXA 2QAFA 2GJPA 3C2RA 1NF0A 2XH4A 1NQKA 4GXPA 3FDGA 2XSBA 2A2IA 3I7QA 4FZIA 2V5DA 3TXVA 1VGAA 1TO3A 4FF5A 2QS8A 1VJZA 2PGFA 3HGRA 1MRQA 1TA3A 3MY9A 1ODZA 3R58A 4LV4A 3IJIA 4Y90A 2NLYA 1HIZA 1ZBWA 4KIRA 1J9YA 4AYGA 1WXYA 4KW2A 2DPEA 4O53A 1C3FA 1HT6A 3W6MA 2HZGA 2WCSA 1RJPA 4B5TA 4XZMX 3VIOA 4PB5A 5HMDA 2CXEA 1VYRA 1DV7A 4H3DA 3RILA 4HA4A 3SN4A 2E7FA 4CKQA 1XIGA 2DZUA 4IPNB 3QV7A 4K8EA 1L2QA 1Q63A 3IUHA 1UASA 3TIMA 2CZDA 2A4AA 4JHMA 4X3ZA 4ZQPA 4PSPA 2BXVA 4K36A 1XYZA 4WEVX 3OG2A 1GVYA 2OXNA 2DP3A 2Y8UA 5HQMA 3UG8A 1YBQB 3C4UA 3CUIA 1BSLA 5EKYA 2EKGA 4LF2A 4TQTA 3VDGA 2YXXA 1YNYA 1MFVA 4HKPA 4MDOA 3I3BA 1QDSA 3ZLFA 1R3VA 5D33A 1SZEA 3W27A 1BKHA 1DJNA 1OT2A 2R1PA 4EPBC 2UZ9A 1UD8A 3UJFA 1MEWA 3CUXA 3G1AA 3E2VA 2WMIA 3SCUA 1XC6A 2X1UA 1Q7MA 3A6OA 1TV5A 6XIMA 4D6DA 3U2EA 3BJFA 2EPKX 2YL9A 3KBSA 1PZ2A 3MQTA 2WQPA 1ZJIA 3GR7A 2TRSA 4Y8FA 4QISA 4F66A 1AW1A 4K6AA 4Q6XA 3L9CA 3S9YA 1FCQA 4LCQA 4E8DA 4GWEA 2AAMA 1SM9A 2R9RA 2PLCA 3LLFA 4PA8A 3AFBA 4DI8A 2QJIA 5D05A 2FKPA 2CLIA 3VOJA 4O52A 3XIMA 1XLJA 3FXGA 3AAMA 4RR4A 5DMYA 3VTRA 3WKZA 5BZAA 3S3GA 1GQLA 1R3WA 2E0PA 3TFCA 4YIWA 1M01A 3PSWA 1W31A 4D8AA 3ZT7A 1H0GA 3OLEA 2D69A 4TV5A 3EB4A 2QHAA 1A80A 2WSYA 5CH9A 4DO5A 1UB3A 1F2JA 4WSKA 2Z1SA 4AWTA 2GOKA 4MMWA 4N6EA 1OFPA 2ZCGA 2DVTA 4ATWA 2NUWA 2VDGA 4XVDA 1I75A 3W2LA 1Q7QA 4PL1A 3KXQA 5C2CA 4ZL1A 4HT3A 5DN1A 1ZU8A 3BCFA 4PMZA 1ZAIA 1YIXA 5LZLA 1ISWA 2AQOA 2RKXA 2XFWA 1WPCA 1XYLA 2QXWA 1YBQA 4C6BA 3APGA 5IFTA 1MEIA 1YHTA 1VBJA 4XTDA 1E6ZA 1GUVA 1K70A 3ARSA 3PZIA 4RLIA 4LBUA 5A6JA 5LHEA 4G2DA 3RHGA 4JHOA 1G01A 1PKNA 4GY7A 2XH0A 1QXLA 3D3FA 2QGHA 1MRAA 1XDMA 2QUUA 3L66A 4C6PA 5DT7A 1OINA 5EGRA 1HL9A 3KWXA 3VGEA 2QJMA 1J79A 4IWWA 5CPMA 4JY8A 4GQRA 5G4EA 1NP2A 1TV8A 3UG4A 4RE4A 2BVTA 3DFSA 3GTHA 4PEEA 1H50A 3SGUA 1KCZA 2IPJA 3BSMA 3CXOA 5CBIA 1H11A 3QLLA 1R86A 3WLMA 5CJMA 2PGRA 3MMTA 1S5WA 3ITVA 3F4WA 4JIPA 5E1QA 4NZCA 3TFXA 1QPNA 3A4XA 4CNSA 1KCXA 1TJ2A 3DBPA 2IS7A 3LHZA 1KR1A 2XVNA 3HU7A 4PZVA 5CZTA 3RG6A 4MB3A 4U28A 4D6CA 3F4DA 3TW9A 2IPWA 3ALGA 3DERA 4GYJA 3VOHA 4F3HA 4R53A 4KFPA 2PBOA 4HNUA 3PUOA 2ISWA 1OCNA 1DXEA 5FACA 4LAZA 1OJXA 4WD0A 2IKGA 4DIAA 2YA0A 1AJ2A 2J7FA 3G3MA 2PLKA 4A22A 1E43A 1UPPA 3GNRA 1I60A 2ZZ5A 2PDYA 3O63A 4ERGA 2PP0A 4UNIA 1Q6EA 3WEOA 3IV3A 4DM2A 1F61A 3EWCA 4C60A 3VMOA 4JNYA 1HKMA 4NXSA 3G8RA 2WZMA 1T8XA 4M82A 1W3HA 5LA0A 3R13A 4O12A 1XINA 4IIDA 5FF7A 4V27A 3U0HA 1OK6A 5I3KA 3SY5A 1POKA 1WA3A 1H7XA 2YA2A 5AZ1A 1RP8A 1TSIA 4J27A 3EX4A 1X39A 2ABBA 2OOGA 1G1YA 3WD3A 3EWZA 1VH7A 3V16A 1W3KA 2OGJA 4ZQRA 3PHAA 3KCLA 3SEPA 5CC6A 2ATMA 3OVQA 4JFUA 2LLEA 1JFXA 1DWHM 1XISA 1O12A 3P60A 3PBVA 4MB5A 3BW2A 5G4HC 4P61A 4GNKB 1KQYA 4O8AA 1KM4A 1TELA 4HK7A 2V5KA 4DVOA 1U83A 2XJ7A 2EG6A 1WXZA 3CYJA 1UP3A 3M0LA 2OR2A 3W7PA 1WO2A 3ZIZA 4KQNA 3WH6A 2CHOA 2PSNA 3EDKA 1SFJA 1XLEA 3KBJA 5K2ZA 4I90A 4ES4A 1DQWA 1RVGA 4PEKA 3UY7A 1A5SA 5HJYA 3I3DA 4IUOA 2WK2A 3ARPA 5E0KA 4TMCA 1UBPC 6TAAA 2VRJA 3V5OA 5MHBA 1V6XA 4QNWA 4X2RA 2P88A 3WDQA 3Q65A 1OEPA 1BF6A 3CMGA 1CLXA 5G2HA 1BAGA 4AY7A 1G4PA 4ERIA 5IDIA 2V0TA 3BLEA 3OW1A 3EMCA 4H9XA 1L6SA 1OD0A 3UW6A 4B5WA 1LWJA 1N82A 1CGTA 2FVMA 3IIZA 3VZYA 2W67A 4ZO8A 3O9NA 5DANA 1ISYA 3UETA 3NPWA 3KOZA 1R9YA 4BI6A 4XIAA 2GZXA 2H8ZA 1JL8A 3QPZA 4JQ1A 2A3AA 2ONEA 3FCPA 1KWKA 1X8FA 1DIOA 1R2RA 3ABSA 4BQ3A 2PWFA 4A3QA 2CZ5A 3C61A 4D6JA 4MNJA 3L2IA 1CNVA 4DUOA 2PDUA 2ZWZA 3W85A 1UIPA 4KCUA 2XGBA 2Q71A 3QRHA 4AWEA 1AK5A 4WDUA 4LC6A 5D9OA 1VBGA 2BP1A 2WBGA 2PTDA 3EA3A 3LXBA 5CG0A 3AOFA 2VQTA 3UPBA 4QFUA 3E74A 4G8TA 1E51A 3MO7A 2XH2A 4JEJA 4L7ZA 4DY1A 1ZAJA 3L4VA 3UXDA 3CQHA 2FJKA 1I1XA 5KMYA 4AWUA 2AGKA