3UPWA

Pichia stipitis oye2.6 complexed with nicotinamide
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old Yellow Enzyme 2.6 (OYE2.6), NADPH dehydrogenase
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis
molecule tags Oxidoreductase
total genus 156
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3upwA00
3MHUA 4AVFA 5CPLA 1ML1A 4Q4KA 2WQPA 1XUZA 3NQCA 5KZMA 1L6YA 3HGOA 5G2IA 4YWIA 4AWUA 3L68A 3TMLA 3NQ2A 4MJZA 4XBKA 4AWSA 5F1VA 2VEMA 3HMJG 3P82A 3PBVA 4MFDA 4QM1A 5H2ZA 4HNUA 2QCGA 1DVJA 4NQ1A 2Y89A 5G2WA 3U2OA 1G4EA 4BI7A 3M41A 3EXRA 3GIYA 1JCNA 4GUFA 4EIVA 4PODA 1DQXA 3LHTA 3BLFA 1FDYA 1TCDA 4JTUA 2DZUA 3NAVA 5IBXC 3PG9A 2F84A 5E0KA 5I3IA 3CC1A 4GC4A 3KHJA 4WQ6A 2RKXA 3R89A 1G7VA 1SR9A 3GXTA 4GJ1A 2V2CA 2VEKA 3W7PA 1IXOA 3L5AA 3TJLA 1PE1A 5A8GA 4AAJA 4MY9A 1MEHA 2NV1A 1F7BA 1YLVA 4K38A 3O6YX 3TQ0A 2C6QA 3MHFA 4HT3A 3W7EA 5LKYA 3N34A 2QCDA 4R7JA 2YXGA 2FPVA 3QM3A 1W8SA 3HPSA 1R2RA 2CLLA 4DQWA 4MIMA 1TPEA 3P84A 2C0AA 2EHHA 3TQKA 2H3BA 4UMCA 1B4KA 3ANYA 3UPWA 3W72A 4UFIA 3LHUA 3R13A 3Q37A 2NUYA 2NUWA 1AW5A 3GB6A 4NT0A 3EX3A 3W2UA 1PL9A 4QISA 3C52A 3P5ZA 5HINA 4DF2A 1AW2A 5CZTA 1ME8A 2A7NA 3TSMA 5EKYA 5F2LA 2YSWA 4KWVA 5CPMA 1BKSA 2GUUA 3STFA 1W5OA 1DHPA 2OT1A 4JXCA 3QSRA 3LV6A 3B04A 4QNWA 1WOBA 4JTLA 1JUBA 1FXPA 4QIUA 1OK4A 2VEPA 3UWVA 1EP1A 1K7EA 1ZHAA 3IIVA 5C55A 5KINA 1DQWA 1W3NA 3O8AA 3PS7A 3C2OA 3TAKA 3S42A 1R46A 2XN2A 3ELFA 4JY9A 2NV2A 1H7PA 3R8RA 1ALDA 3DH7A 1JCXA 2VC6A 5CG7A 3B05A 2GJLA 4DF1A 1SZFA 2OJPA 3LCFA 5FI8A 3TMQA 2ATMA 3C2EA 5I3KA 1GT8A 2FB3A 4WY0A 3G3MA 2AGKA 3ZFHA 3EWZA 3OVPA 3WFAA 1GQNA 3W75A 3E9AA 1JQXA 2JGQA 5E93A 1K7XA 1F2JA 3RF9A 2QCMA 3EX2A 4O8RA 1PHWA 3B06A 1TO3A 3DXIA 3NA8A 3DI0A 3G0XA 1W1ZA 1OYCA 2OT0A 1W5MA 5D2WA 2ZDRA 3P60A 1TTIA 5G2HA 2R94A 4IMDA 3W23A 2FDSA 4ALDA 3MP5A 2VELA 1BEUA 2E68A 1SZNA 3W7NA 4B5NA 3PBUA 4JIPA 3NVTA 3LRLA 4UFLA 1C9DA 5F2MA 5EMUA 2QCCA 4N4PA 3JR2A 1D3GA 1FCVA 5LHEA 1NSJA 3CIWA 1OX6A 4N6EA 3TC6A 4Z08A 2QUVA 1I8JA 3G8EA 2GPTA 3TIMA 3G1AA 2CLIA 1OX4B 3C2FA 4WD0A 1EPXA 2ALDA 3RLVA 3C61A 3O05A 3W1QA 4LTSA 1LRQA 1F5ZA 3WJWA 3CEPA 1SFLA 2ZBTA 3SGZA 1JCMP 3P81A 5TIMA 1OFPA 1DKWA 1M7PA 3C8FA 2YPIA 4N02A 4O1DA 2JBMA 4JTFA 3VNDA 2G97A 1H7OA 4LS2A 4NJHA 4ICNA 4DXVA 3H54A 4XQ6A 3TA6A 2V2HA 2ZCGA 1L6SA 4ZZ9A 2RHGA 3I7QA 2OCZA 3KRSA 1YDOA 3GR8A 4I7WA 2A6NA 1OABA 3LB0A 2C19A 3LCXA 4O54A 4K36A 5AYZA 3INPA 4PEKA 3UYCA 2RH9A 2QKFA 3TC7A 5CSRA 1I2PA 3F03K 4Z1AA 4M6PA 3WK2A 1UUMA 3PBWA 3L0GA 3M6YA 3LHZA 2E6FA 3SZ8A 2Z0IA 1KW1A 4A29A 3LOTA 1W5PA 5FEXA 3IGUA 4HSNA 3TR2A 1KLYA 1YDNA 4AXKA 2ABAA 3TX9A 4FNUA 1AG1O 4CNNA 2J24A 1YTEA 1FWSA 1G6CA 1G7UA 2A6LA 5AHEA 2ATSA 4O13A 4LC8A 1GJPA 1NAL1 4C1LA 2ZYFA 5K9XA 5D37A 4JTTA 3NPWA 3BW3A 4LU0A 3E02A 5D2XA 1I2QA 4GBUA 1Q6RA 2Z6IA 5KITA 1JQVA 5EL1A 4K39A 1JVNA 2X2GA 1FCBA 3M43A 2DZTA 4UUIA 5HWMA 3IV3A 1OFOA 1WBJA 1HUVA 4JTHA 4LVFA 4ZQRA 3TK7A 4FF7A 2ZZ7A 3NQDA 1XCFA 3TFCA 3MYPA 2ZTKA 1KM1A 2NX9A 2A5HA 5D2TA 4HPXA 4JYEA 2GVGA 4GUIA 3UZJA 4AH7A 1DV7A 3NR0A 3PB2A 1F05A 1JR1A 3GDLA 3W1XA 5AYYA 2JK2A 1VYPX 1JCYA 3NQEA 4O14A 4MY1A 1JUKA 4A3UA 4WY0F 1WAUA 5AYXA 1TQJA 1TYGA 3P74A 1G67A 4O16A 2ZRWA 5FF4A 4O57A 1F6PA 4U28A 2RDWA 4GWEA 3QJAA 5DCEA 1OFRA 2P0OA 1G69A 3VE9A 3S5NA 1FBAA 3NOEA 3TW7A 3NQMA 2H90A 1H7XA 2DZPA 1LP6A 3FA5A 3GAKA 3TROA 3A5VA 2CLOA 4FEZA 4A2SA 2AQWA 4S2BA 5D30A 1GOXA 1H51A 1QNVA 3MBFA 3FLUA 1I2RA 1SO6A 1K02A 1OJXA 1QCWA 5HNRA 3AO0A 4HHPA 3UWUA 3I65A 4AHOA 1TPH1 4P61A 4TIMA 4Y90A 2YFOA 3PC0A 2NUXA 5HR6A 2X16A 3BO9A 2O7QA 3PY2A 4ML9A 3B0PA 3JS3A 4JTJA 3ATYA 5BNKA 4X22A 4M6VA 3WJXA 3NXFA 1SPQA 4X3ZA 3W7CA 5C6MA 4M7SA 1AL7A 2QR6A 3LCGA 4Z1BA 4O4VA 1SO3A 2CWNA 3R12A 2FFCA 4MVAA 1ADOA 2B0MA 3C56A 5DXXA 1HO1A 3N9RA 3NQAA 1TIMA 1K7FA 1PCKA 2Z2UA 1V7YA 2F7FA 4E38A 1SQ7A 1EP2A 1ONRA 2J9ZA 1CI1A 3DGRA 2QJIA 1GTHA 3PG8A 1WQ5A 3PWAA 3QMSA 3FFSA 4H3DA 3KAOA 1PHQA 4K8HA 3HB9A 5F4XA 2G95A 1PS9A 1T8XA 4CQ8A 5LSMA 1TV7A 1EP3A 2V5BA 4FIRA 5D33A 1RD5A 4X2RA 2Y85A 1QPNA 4DBEA 3C0JA 2PC4A 2WNZA 3LTYA 1UASA 1XUUA 3O07A 1TREA 3CPRA 3GK0A 2ZZ4A 5AB3A 3NO5A 1TMHA 3DZ1A 1SUXA 3E49A 2RDUA 1NF0A 4M6QA 3LHYA 3G0SA 1ZAIA 3OVQA 3QMRA 1IGSA 1YXCA 4N9BA 4OT7A 1NF7A 4IPIA 5BMWA 3STGA 4GUHA 3NZ1A 4R53A 1TPDA 1W37A 4IWWA 4RZ4A 4O10A 5F4WA 4FXRA 1OX4A 3DFTA 4LRTA 1TQXA 4WXZA 5AC8A 1EA0A 1QPQA 3LRKA 2PURA 3G1HA 1S5VA 3W9ZA 1ZALA 3WJZA 4JX5A 3LGEA 4UTKA 5AHLA 4NU7A 3L0KA 1K8XA 1XDMA 1LOQA 5AC7A 3G24A 3BG3A 2YCEA 4IX0A 4JD4A 3W7HA 3OIXA 1XKYA 3NPVA 2NX3A 4RV8A 3LCIA 3H53A 5AHNA 2OX1A 3W1TA 4OGZA 1J2WA 2A4AA 4MY8A 1H60A 5FEPA 2YFNA 1A5SA 2YDAA 3PM6A 2WO5A 4IJBA 1VCFA 2FPTA 1C8VA 3QQ0A 3EX1A 3LLDA 1TTJA 2ZA2A 4K7YA 1O94A 4JTIA 4AHPA 2E77A 1GVOA 2VFIA 4ADSA 3BW2A 5LNSA 4JR5A 2QF7A 4YCPA 3CIXA 5DN1A 1LBMA 2QDHA 3MMTA 3N73A 2J9XA 4PH6A 4Z0SA 1YYAA 3HJZA 1S3HA 4UTMA 3W7JA 1VGAA 3B03A 2C1HA 1TJRA 1TV8A 5F2IA 1VPXA 1JCLA 3LHVA 1TB3A 3FJLA 4UMBA 4MFEA 2ZTJA 1U83A 3PSWA 2WSRA 3MUXA 3W84A 2VENA 3CM4A 4R34A 2WJZA 1RPXA 3VI2A 4L4LA 1GG1A 2VFEA 3ZWTA 4OBTA 3NM1A 2FPYA 3MO7A 5TQLA 2TPSA 4LT9A 3ZWSA 3N14A 1W3TA 2CLMA 3LLFA 2YW4A 4ZQMA 3E0IA 4Y9AA 4JGDA 5KZEA 4LVGA 3A21A 5HJLA 2J9YA 1YDVA 4FX7A 4O1AA 4E0CA 3DHFA 4ORIA 3MI6A 1VLWA 1QWGA 4OV4A 2RFGA 4LUJA 8TIMA 4NX0A 1K03A 2B7NA 3PULA 3L66A 4FX8A 4LY8A 2WKJA 3YPIA 4NJKA 5F2GA 2FTPA 1OFAA 5BMXA 5K7JA 1TPC1 1SFJA 3W2LA 3BG5A 1IIHA 4UC5A 1QR7A 1W5QA 1O5KA 1UJPA 4MKNA 3IVUA 1EUNA 2ISWA 1THFD 4JX4A 1M5WA 1XFBA 4RZ6A 3CWOX 3W83A 3T4CA 2BXVA 1N7KA 1IXNA 2NWSA 4MUZA 1DJQA 4QJ1A 3A22A 4IMGA 1U5JA 5K3VA 4FNQA 2DJLA 5K4XA 1VQTA 3A23A 4UFMA 5DXYA 3F1QA 4NXSA 2PRHA 4CQ9A 3LTPA 1OF6A 3OG3A 1O95A 1LROA 1R47A 3DHDA 4NVTA 2CZ5A 3LDVA 4ZVJA 3NM3A 1ZFJA 2H3DA 5D09A 4CCEA 4TMCA 3MBDA 3QPYA 4O19A 3LRMA 3NQ6A 1OK6A 1KM2A 4EOUA 3NPXA 5ABTA 3UZ5A 3EKLA 3M5ZA 2R8WA 3M44A 3RFAA 3BK0A 3GDRA 4JX6A 2ZZ2A 4I7UA 3HG3A 5D04C 3L67A 2RDTA 5H91A 2Q8ZA 4ZQPA 4GNJA 1GVFA 1XBYA 5IBXA 3FOKA 1W56A 3EXTA 2HTMA 2CW6A 1G4PA 3P61A 1F74A 2PCQA 3MWAA 4CQAA 3UXDA 1OF8A 2AAMA 5A5WA 3VE7A 1B3OA 3U8GA 3SY5A 1RV8A 1X1ZA 3RMJA 4N4QA 5CSSA 3PB0A 2CU0A 1FQ0A 4QQ3A 4N6FA 3W88A 4LVBA 5LHFA 4HNNA 4RX0A 2V82A 2CZFA 1BWKA 5AHFA 1T0OA 4R33A 4BWLC 1B57A 4EWND 3S0CA 4OE7A 3HGJA 2KZHA 2NWRA 1T99A 4FNRA 3IIOA 1J4EA 1H50A 3NZRA 3UPBA 3ZR4A 2EKCA 2PRLA 2QCFA 3W7IA 4P2VA 5HQEA 2BX7A 3IVTA 2I1OA 3HG2A 4BF9A 1ZNNA 2QJGA 1ZY9A 3QMTA 1XDLA 3B8DA 3W2NA 4E2DA 4O1BA 5FF0A 3C3NA 3NL3A 1SW0A 1OFQA 3EX6A 3WJYA 3NYZA 2V9DA 4WZHA 4TO8A 3DFSA 4DEFA 5C2XA 1EX5A 3G1DA 3DU0A 1NEYA 1TV5A 1MEWA 3MI3A 2BWGA 3SW6A 1TPUA 3N19B 1V5XA 3TSDA 2C14A 1IF2A 2Y70A 2HSAA 1Q6QA 3N9SA 2VKZG 4LW7A 3BGGA 3GVGA 3W7GA 2GVLA 4PC8A 1UUOA 4Q32A 1LZOA 4QSHA 4TX9A 1JCJA 1LLZA 4EF8A 1A5CA 1KLZA 1H7WA 1WXJA 4YMZA 2DORA 2FIQA 1XBXA 1OX5A 1W54A 3QQ1A 4PL1A 4CCDA 5IM51 4KFOA 4MPQA 5G4WA 4UTWC 4LVDA 3LI0A 3W76A 2NX1A 4N9DA 1EWEA 4UTUA 1AMKA 2VFDA 1CW2A 2BZNA 2FLIA 1DOSA 4XUGA 2E6AA 4NNAA 3BW4A 3W1MA 1F6KA 3W70A 3THQA 4IUOA 4Q33A 3QW4B 3NL6A 4W9TA 3UXAA 4NJJA 3L0NA 4RXFA 4NZJA 3W73A 3BPWA 2GQ9A 2V81A 5SWUA 2ZZ6A 2JKEA 3HG4A 4ADUA 1H62A 2ZZ1A 1KM0A 5KMYA 4O0ZA 2A0NA 3R5EA 2QUTA 3KVJA 2ZZ3A 3EWXA 3O15A 5D32A 3RK8A 4BR1A 4CNOA 3GDMA 2DU2A 4BWLA 1R30A 5FEZA 2VEIA 4RJEA 1PV8A 3Q2DA 4HPJA 5AC6A 1A5AA 3NDOA 5AHIA 1X8FA 5DBTA 1EB3A 4WOZA 3QF0A 2QAFA 2Y7GA 4KWWA 3M1ZA 1M6JA 1OFDA 1A53A 3HGRA 2QCHA 1GTEA 4TU1A 4JYFA 3NQ7A 1JUEA 2V30A 4MZYA 1P1XA 3M5XA 3QPZA 3PSVA 4Y96A 4LS0A 5I3HA 4O52A 1KA9F 4JIQA 3P62A 3O6DA 5DLCA 3DAQA 2QDGA 3STCA 2P10A 3VFLA 4ONVA 1OG0A 2C13A 3M16A 3BV4A 2XFWA 1LCOA 1SW7A 3P80A 5CZ0A 1DL3A 7TIMA 3CLMA 3GNDA 2GOUA 1SZGA 3IRDA 4IXHA 1LYXA 2DZXA 4QNEA 5LGZA 2D73A 4LNYA 4O15A 3V1PA 1TPWA 4JTKA 3USBA 1Z48A 4EF9A 2QAPA 3ZS4A 3O63A 1SU5A 1LBLA 4O4WA 4HNVA 2H8ZA 1PVNA 3GYEA 1YXYA 5D05A 1BTMA 1F73A 1WOAA 3A9IA 4UTJA 3W74A 1DBTA 3S5YA 4AF0B 2A2IA 1HFBA 1XL9A 4BK9A 2B7OA 4DF0A 3N2MA 1S5WA 3UY8A 5G4EA 2ABBA 1GVRA 4L4MA 2WOQA 1ICSA 1FCQA 4MZ8A 3THAA 4IMFA 4WJEA 4Z0JA 2G5WA 1W31A 1FWRA 4JTEA 2C15A 2P1FA 2DZVA 1QO2A 3W22A 2Q3OA 4K8EA 1TRDA 3NG3A 3T55A 5CGQA 4JICA 2HMCA 3TCEA 4G1KA 1LDCA 2GQ8A 3DKJA 3PUEA 3TQVA 3L9CA 1DORA 3T7VA 1HO4A 5AN7A 4JS3A 3HBLA 3P8IA 3WJSA 5LNUA 2Y7DA 3BGJA 1FXQA 2NLIA 1Q3NA 3GR7A 1MEIA 3T78A 5I3GA 3NQGA 4H6KA 1S5TA 2V2DA 3IEBA 1SZEA 3UD6A 1LRNA 3TU9A 1Z41A 5LNRA 3LBCA 2YGYA 2WNNA 4YLWA 2CLKA 3I68A 5EBUA 1QDSA 4CCCA 4FNPA 4PFMA 1B9BA 2X1RA 4PL2A 3W3OA 5HWNA 4BI5A 4LVAA 2CLHA 5AFDA 2DP3A 4KFNA 1FWWA 3MI2A 5FF2A 1X6UA 5FEWA 1H7RA 2VFFA 3H55A 3ABSA 2I14A 4U4MA 1Z42A 3C4UA 4NX5A 3T40A 2DZSA 3HOJA 3SECA 1H7NA 2NXGA 1AW1A 1NFBA 4DPPA 3QYQA 5E1QA 3MW7A 1VLIA 3LV5A 1HL2A 2Y63A 1QOQA 3WK1A 5BOOA 4ZL1A 2ZRVA 5AOUA 4TR9A 3FIGA 3IGXA 3QFEA 4PA8A 1D9EA 3P7YA 3W1PA 1YXDA 3S5ZA 1XI3A 4O18A 3E96A 3TV8A 4UTTC 1XM3A 3WK0A 4N9CA 3HF3A 1KFKA 4LRSA 3QW3A 1PCWA 3G3DA 4Y6GA 1FWNA 4ORMA 4DO6A 2DJXA 3B4UA 4AMAA 3TXZA 4K7VA 3V75A 2VXNA 4O17A 1EWDA 4BI6A 3TSBA 4JTSA 4PCFA 1KFBA 2ZFAA 5GVJA 5J5DA 1GG0A 2CFFA 1VS1A 3DFNA 1ZAHA 3UWYA 2W6RA 1XC4A 3W2MA 3W7QA 4UNKA 3O16A 2E09A 3MJYA 3UQNA 1FWTA 3NGJA 2X1TA 3PR2A 4ZQNA 3W1AA 2R91A 3L5MA 4IPJA 3UWZA 3Q94A 1HTIA 2H8XA 3L5LA 4MYAA 1T96A 1QFEA 4NJGA 1ZENA 4X9SA 3W7KA 3G1YA 1R2SA 1R2TA 4NJIA 4O28A 3S9YA 4UR8A 4UFJA 3VCRA 3NEVA 1H5YA 4E2BA 2OMAA 1TTQA 1GYLA 2OZ0A 1ICPA 1LOSA 1FUYA 4MYXA 4MJMA 3LI1A 4RKAA 1IXQA 2ISSA 4UTLA 3QSTA 4XTIA 2XN1A 3GNNA 2V5LA 1W3IA 1XXXA 1LOLA 3GX9A 4RXGA 3CQ0A 1B4EA 3S6DA 1P4CA 3G8RA 2YW3A 3EWBX 1RQBA 1BWLA 2QCLA 3O06A 5DBUA 5D2VA 4UR7A 3MYOA 1TSIA 3OA3A 1SO5A 2UV8G 5FF3A 3R2GA 5FF7A 1LLWA 4UMAA 4J9JA 4UTTA 2EPHA 3C6CA 1FY6A 3W7DA 1IXPA 4DPQA 1VZWA 3M7WA 1TPB1 4OHQA 1JJKA 1WV2A 3S1VA 4DO5A 1WDWA 3W7LA 5C54A 4GRSA 1YPFA 1RR2A 2CZDA 1LTDA 1SSGA 1X7FA 4N9EA 3TJXA 5F4SA 1AK5A 1AL8A 5BRBA 3MP4A 1LORA 5F1UA 3RU6A 2PRMA 3BG9A 3CTLA 3GZ3A 2Y7FA 3W71A 4DBDA 3BVJA 4AF0A 3DENA 1K8ZA 4O0KA 1XBZA 1EIXA 3W7RA 1L6WA 5HMSA 2V8ZA 1Y0EA 2YR1A 2ZA3A 2X1UA 4XWUA 2E5DA 3WK3A 4GUJA 2B7QA 2FQIA 2ZA1A 2VFGA 4FXSA 1I45A 1QO5A 3MP3A 6TIMA 3NQVA 4QAIA 1UBSA 2W0UA 5HULA 3GXNA 3P67A 1L2UA 3LERA 3FS2A 5LNWA 3ABQA 4IMCA 3UWQA 3LXCA 3G22A 3CB8A 1L9WA 4IOTA 3FEMA 4POCA 4JYDA 1I2NA 2CZEA 3NQ8A 3W07A 2E6YA 2Z1BA 1KM3A 4NNCA 4IQLA 4JY8A 1WA3A 3AJXA 3TDFA 2DZWA 3MHGA 5KZDA 5G5IA 3BLEA 1MO0A 2EAWA 3GAYA 3EWUA 3M0ZA 3CHVA 1P0KA 4MLJA 3DBPA 2H6RA 5CZJA 1KV5A 4ZQOA 2EF9A 4HSOA 2QEZA 3TXVA 1MZHA 2JKAA 1W5NA 4MOZA 4AB4A 3GDTA 2HS8A 1GEQA 5EY5A 4JN6A 1VHCA 1H61A 2O7SA 3KOFA 3CU2A 2VFHA 4BFAA 4Y8FA 1O5XA 2HS6A 3FYPA 2R14A 4JDYA 1VR6A 3FKKA 1SSDA 3EXSA 1I2OA 2J88A 4LUIA 2Y61A 3ATZA 2V0TA 4FNSA 3KVLA 5LGXA 3GLCA 3CWNA 4YL2A 1GPWA 3QZEA 1D3HA 2YX0A 1KBJA 1X1OA 1VCVA 2EGZA 4UTIA 2QUUA 5BW6A 3S1WA 3CEUA 1P5BA 1Q45A 5FESA 4YCOA 4LWWA 2LLEA 3HQ1A 2J6XA 1TTPA 5DCDA 3QRHA 1K8YA 3QEZA 5D02A 4RCXA 4ZQCA 3I6RA 4DO4A 2ISVA 2B7PA 3NPUA 1MSSA 4IX2A 4GXMA 3EX4A 3CT7A 3FYOA 5G1TA 3KVKA 1KM6A 1KFCA 2E5CA 5I3FA 5EPDA 4UTHA 1RQEA 3L2IA 2Y6ZA 1KV8A 3PBYA 1YPIA 1VCGA 4OV9A 3SJ3A 1RVGA 4C1KA 4K6AA 1JRCA 2TRSA 4A22A 2BSLA 2ZRUA 1JULA 4UNLA 1KFJA 2Q8LA 3TW6A 3QC3A 1OHLA 4GE8A 3KFTA 4WOQA 4JEQA 4XKYB 5LZLA 1RQHA 4JNMA 5HUPA 3B0UX 3LXAA 3PUDA 3K30A 3G1FA 1RZMA 1UB3A 2E6DA 2YYUA 1LBFA 1WX0A 3TE9A 1EEPA 4MLRA 5I3JA 1KBIA 3O1NA 2Q3RA 1VYRA 1KFLA 1NVMA 4ADTA 4FX6M 3G1XA 5K9DA 3EWWA 3W87A 1H1ZA 4TMBA 4XZ9A 4PTNA 2CLFA 3IIPA 3I7RA 2QCNA 1H1YA 1OFBA 4I7VA 2WSYA 3HO8A 4A2RA 1A50A 2A7RA 3DFQA 3OVRA 3C2VA 2I9EA 3IIZA 1GVQA 4AEOA 3OHIA 3BARA 4RK8A 4FB7A 5DELA 2NZLA 2YYTA 5CKSA 3ABRA 1P0NA 3VKJA 1UCWA 4OWGA 5K4ZA 3FKRA 3W2JA 3U6WA 1WBHA 3KRUA 1QOPA 4JDBA 2JKPA 3HG5A 2W79A 1MXSA 3NL2A 3G1VA 1GZGA 1OYBA 3HIJA 2PE4A 3EEGA 1OYAA 3EKZA 4D2JA 3Q58A 3IIXA 4FNTA 4HKPA 5L6UA 3PF3A 1ZAJA 2B4GA 1I4NA 1KTCA 4O53A 4MZ1A 3M9YA 2VOMA 4XTDA 1VC4A 4LOCA 1VRDA 4XBSA 3A5FA 2TSYA 3NL5A 2CLEA 1GYNA 1VH7A 4K37A 3E12A 1M7OA 4Z1DA 3D0CA 2NXHA 1C29A 5EA9A 3KRZA 3N3MA 1TPFA 2A21A 2A7PA 3DFPA 3LCWA 4IXXA 4JTGA 3FJ6A 4RLIA 4GUGA 4UTWA 3EWYA 5D03A 5G1YA 4HN4A 2C18A 3G18A 5TBOA 2QJHA 1KFEA 3LCLA 3I7SA 1QPOA 3W1NA 2E1DA 4NNBA 3STEA 3W1RA 2QCDB 3SR7A 1CX9A 2ZZ5A 6ALDA 1GWJA 3C2RA 5DCBA 3UY7A 3SIZA 3KX6A 2TYSA 4HIBA 1TRIA 1OFEA 2FB2A 1YADA 4M5PA 5D2YA 3L65A 4O1CA 1KTBA 4NUWA 4UCGA 1Z44A 4KFPA 4A21A 4M19A 2GQAA 2NXIA 3S1XA 5DY3A 3O6CA 3LHWA 1ZJIA 2Y7EA 3W1LA 4UFHA 4I9AA 1FDJA 3RLUA 1FX6A 2X1SA 1E51A 4FIQA 4AHQA 1TPVA 3W85A 5MHBA 3OEXA 3W6YA 5HUOA 5KTLA 1TJPA 2G96A 3DFOA 2E5BA 2Y62A 3F4WA 1DJNA 3M5YA 2J27A 3NNTA 3KXQA 5HWJA 2QCEA 4CNPA 5D38A 2YZRA 4EVZA 3LXBA 4N2YA 1YTDA 1PIIA 1G4SA 3HGSA 2X30A 3G0UA 1A5BA 1KTNA 1VHNA 3IGSA 4YXGA 3W1UA 3TAOA 3UNDA 3GDKA 4RZ5A 4NZFA 3W7MA 3M5VA 3SGUA 2TMDA 2Z6JA 3HPXA 1QAPA 1LRTA 1SO4A 2WPBA 4S1FA 3QH2A 3PUOA 3P5YA 3TUUA 4O50A 3SSJA 4FO4A 5CPNA 1O4UA 2Y88A 2WV8A 3B0VC 1ICQA 1FCUA 3P8JA 4WY0B 5L9FA 2ZRZA 3S8HA 3S1UA 1VYSX 3W2KA 1Q6LA 4S2CA 5AHMA 3SFKA 1ME7A 3W7OA 3M47A 4OU1A 4NXKA 2XN0A 3TFXA 4ZMGA 4WUIA 3UWWA 3F4NA 4UFKA 4QITA 2C3ZA 2WSQA 3SI9A 2ZQ0A 3DKLA 5U4NA 3LM7A 5U7SA 3OBKA 1N55A 4LS1A 4HNTA 4UXDA 1FDZA 1EUAA 1F76A 1SW3A 1J5TA 3TKFA 5DY2A 4UIOA 3GKAA 3ABOA 3LCHA 4FHAA 3EB2A 2GJNA 1GVSA 1JRBA 2C16A 4KKXA 2IQTA 2ZRXA 2JGYA 3IVSA 5CZSA 4GFSA 3RNDA 5J5RA 1Q6OA 3JRKA 2WNQA 1H63A 4DELA 2A1YA 4WX2A 1N8FA 3HPZA 4Z1CA 1WYIA 1VJIA 5LNVA 5K9CA 3DI1A 4H4IA 1O60A 4O12A 4CLMA 1QMLA 3BLIA 3N2XA 3T44A 3GXPA 2A85A 4LV4A 1LM1A 4XKYA 5CPOA 3L21A 1IIGA 1KM5A 2ZRYA 4RR4A 2FJKA 1G4TA 1KM4A 5K2ZA 1W0MA 5T26A 3G1SA 5HR7A 3LTSA 1K3UA 1ME9A 3W86A 1ZCOA 5C5YA 2GVJA 3PVFA 4IMEA 3TH6A 3S5OA 4IGHA 3KVMA 1XBVA 3PAJA 1YTKA 5KSWA 4LC6A 4M7TA 4AWTA 1HG3A 4OQVA 1OVDA 1QPRA 3NQFA 3A24A 5EYWA 3TNOA 3LBMA 2BTMA 3LX9A 4O11A 4WXYA 3GKFA 2BLEA 4LV9A
chains in the Genus database with same CATH superfamily
4LBSA 1KB3A 4UCFA 1UQZA 3HGOA 3HV8A 3OIHA 2OSYA 5G2IA 3HPFA 3MS8A 1HKMA 4AWUA 2X0YA 2HE5A 4MAZA 4MJZA 2VEMA 1Z3NA 1WZKA 4QM1A 4CEXC 3H2FA 4XUYA 4CUCA 3AZTA 4QCFA 4YN5A 4LF1A 1RCXB 2ZVIA 1I60A 4KCTA 2ZE0A 4X60A 4EPEC 4H7ZA 5I5RA 4JTUA 1ZBWA 3VILA 3AIUA 3QR3A 3GIPA 4GC4A 2F2HA 4GI8A 5DMNA 3A4JA 1G7VA 3H2CA 3GXTA 4GJ1A 4LGXA 1GKPA 2V2CA 2OSXA 3PWGA 1DXEA 1Q8JA 3TJLA 1PE1A 4FOUA 4R3UA 5A8GA 1MEHA 1D3CA 3MHFA 4HT3A 4WDTA 4RDVA 5LKYA 5E9AA 1J0KA 2F38A 4WGHA 1V08A 1CPUA 4E4UA 2CLLA 1TPEA 3FK4A 4BCEA 1RK5A 3RPDA 1C7SA 5I0DA 3VD3A 3H4GA 3UPWA 4CQBA 3DESA 3PJTA 3Q37A 4PMNA 2NUWA 3GB6A 3B3DA 3EX3A 4PSPA 1EJRC 3B8WA 1AH4A 4UZSA 4QISA 4KESA 3JUGA 1ELSA 1KGXA 5HINA 3RN6A 4DF2A 1AW2A 3LA4A 2XIIA 5AKQA 4H1ZA 1IT8A 3AWOA 2GUUA 3AIQA 1VFMA 4AD4A 1DHPA 1WKEA 3B04A 4DUXA 3QHNA 3SCPA 3VKBA 4HMNA 3WG6A 3UWVA 1ZHAA 3O8AA 3HZ3A 1QI4A 3TAKA 3C2OA 4W8LA 4AISA 2CYGA 2VC6A 1JFXA 3ABZA 4FLRA 3O6AA 2OJPA 3ARSA 3TMQA 3C2EA 1GT8A 1X98A 1OC5A 3KCLA 2BDQA 2XH4A 3AYRA 3E9AA 3KBNA 2NQ9A 4GLEA 2WXDM 1DJGA 1FVPA 3KWXA 1WAWA 4YTUA 1W1ZA 4GG9A 2EPOA 1CXKA 3F4VA 5D2WA 3P60A 2R94A 3W23A 2FDSA 4ALDA 3MP5A 1BEUA 4PBGA 5AZ1A 4H7VA 2PLMA 3KBWA 3PBUA 4UFLA 5EMUA 3CQKA 1D8WA 4ZO6A 1LT8A 5GNZA 3MDWA 2UBPC 2QJNA 1UHVA 5HXMA 3E0WA 3U0HA 3FA4A 4LB3A 1ZP4A 3G8EA 5JXQA 3RM8A 2CLIA 3EDKA 4WD0A 4GBDA 1UA3A 1FHLA 3C61A 2XZ9A 3ARYA 2HPIA 4REQB 2ZBTA 3DHPA 1JCMP 4GH3A 3P81A 1OFPA 1DKWA 6XIAA 1ZPTA 1TX0A 4F0SA 3T09A 1BVZA 4O1DA 1BLIA 3GUGA 3VNDA 1H7OA 3WSUA 3GG1A 1EC7A 1OEPA 1LUCA 1J0YA 4CU8A 3R1ZA 2PWEA 2OCZA 5EMMA 2OPJA 6ENLA 3EYPA 5HA7A 4IF2A 1EC9A 1HJWA 3ZLGA 4NIRA 3LBOA 4O54A 4K36A 4PEKA 1P1MA 3VU2A 4QROA 2W3ZA 3AWNA 4AUBA 3TC7A 1I2PA 3WK2A 1R3WA 2J78A 3FN9A 4AEEA 4JOMA 3OVGA 1A5UA 3T0AA 4HSNA 2Z27A 3P2VA 3WD1A 2GDQA 4FNUA 1AG1O 4CNNA 2UY3A 5HOSA 3N2BA 4IIBA 3VD4A 1JIBA 1NAL1 4C1LA 5K9XA 1EF3A 3ISIX 2NT0A 3A3HA 4LU0A 5D2XA 4KWSA 3VIMA 3ITXA 4GBUA 1Q6RA 2Z6IA 4GISA 4YPJA 1JQVA 4IP4A 4AW7A 4AMCA 3IV3A 1B30A 4W84A 1WBJA 5KEZA 3FHQA 1JPKA 2ZZ7A 3TFCA 3LPFA 1KM1A 2RUSA 2AKZA 3SQSA 1UH4A 4A8NA 4NAEA 2A5HA 1V6UA 4V1YA 4US6A 4GUIA 5HDRA 1V6YA 1YNYA 4GX8A 1DV7A 3TTSA 4AH7A 1F05A 1JR1A 3GC5A 2JK2A 1JCYA 2W9MA 3H2NA 1VFSA 1DWGM 4O14A 1R3SA 3TNBA 1TQJA 3BXWA 2DIEA 1JCTA 1G67A 1MFUA 2ON3A 2ZRWA 2ZX7A 4O57A 3C8NA 2BOEX 2E7FA 2V3GA 4AZCB 1G69A 3WF2A 1T40A 3TW7A 1H7XA 1XGDA 3WLMA 2Y2WA 3A5VA 4WKFA 2AQWA 4S2BA 3ITCA 4M80A 1XPYA 2Q01A 3AO0A 3UXKA 1BD0A 1REQB 2J47A 2XGZA 3K8LA 4JTJA 1EEXA 2PDIA 1A5LC 5DX7A 1PIFA 4B5XA 4M6VA 1SPQA 3W81A 2CESA 4AY8A 3W7CA 1V02A 2YL8A 2YOCA 3TYZA 4MG4A 3LCGA 4DJDD 1YQ2A 3R12A 4KPLA 4DZIA 5DXXA 3VINA 5A3HA 1E0VA 1TIMA 2XIJA 2XGIA 2WMHA 2Z2AA 3ALGA 2XH0A 2F7FA 4C5YA 1E9IA 1S2UA 2DEPA 2J9ZA 3AIEA 3N04A 3PAOA 3B0YA 2O9TA 1WQ5A 3QMSA 3FFSA 3KAOA 2WMJA 4K8HA 1UR0A 2J8GA 5F4XA 3ZVIA 1R9XA 4FIRA 1V0MA 4H8UA 5D33A 2X42A 4UQ9A 4BJHA 4X2RA 3RM4A 1QPNA 4V33A 4DBEA 3CMFA 3QOKA 3UPMA 1WUEA 2V63A 1NTHA 2PGFA 3LSBA 3O07A 1TREA 3NSXA 3GK0A 2ZZ4A 4HHMA 1VAHA 4RV3A 3E49A 3UJEA 3G0SA 1QATA 1ZAIA 3WBXA 2GK1A 1US0A 4DN1A 4N9BA 4OT7A 2JIEA 3LQLA 1W1A1 1XYLA 1TPDA 1W37A 4IWWA 4B9ZA 3AS0A 3V7PA 4LRTA 4WXZA 4D6IA 3CUIA 1EA0A 3LRKA 3ZJ6A 3CAWA 2A3EA 3N17A 3GG0A 3W9ZA 3WJZA 2O0TA 3SUVA 4NU7A 3UW6A 4ZFMA 1K8XA 1AH3A 2X09A 1KRMA 3F5JA 3RO8A 4HQVA 3LEPA 2HNHA 3BICA 3SSZA 3W7HA 2QQ6A 4AEFA 3WMCA 2EJ1A 2NQZA 3BMXA 4E4FA 3LCIA 5AHNA 3J7HA 4KBXA 3JW7A 1J2WA 4MY8A 1H60A 4E8GA 1JPMA 1L6FA 4NILA 2WO5A 1J0HA 3N11A 4IJBA 4RDWA 2FPTA 3EMQA 2ZA2A 3PPHA 2QPUA 4K7YA 1IEVA 1RY8A 2HDJA 1HKIA 4AHPA 1WDDA 8A3HA 1Q4WA 3CGTA 1UH3A 2FHBA 3MZNA 4LYRA 2VD9A 1JDAA 5REQB 4LBRA 3MMTA 2G37A 2W4XA 4FXFA 1XQLA 2WQDA 3HJZA 3DIPA 3VKAA 3W7JA 4RNIA 2C1HA 1NARA 4J3SA 2VZVA 4J35A 1TJRA 3BQ5A 5F2IA 1JCLA 2J7GA 3ANVA 2CC0A 2DDXA 1ODUA 4DXKA 1OD8A 4I9JA 3W84A 3AQUA 4GQ0A 1HKVA 4IGNA 3BCDA 3CM4A 2WJZA 5FD0A 1E70M 1QNSA 3ZWTA 3VZXA 1R6WA 3MO7A 1JEZA 2TPSA 3N14A 3QGVA 2CLMA 3K8MA 1HP4A 4JHOA 3WQDA 4UBPC 1Q6DA 1QTWA 3ZSSA 4Y9AA 5KZEA 5HJLA 4FX7A 1CLVA 3BOXA 3DHFA 2GGIA 4OV4A 4NX0A 1KGWA 1K03A 2WKJA 1EPVA 3VOJA 3Q4DA 3W28A 1JZ8A 1NOFA 4FXJA 3OO2A 1QPKA 1QR7A 1O5KA 3ITVA 2W62A 4MKNA 1EUNA 3FX4A 2VI0A 4JX4A 4FMVA 1VFHA 3TQPA 2CBJA 3LK6A 1O5RA 3MKCA 1VJZA 2NWSA 2V5DA 2POTA 4GZEA 1VQTA 5C7HA 1BVWA 4UFMA 2R1NA 5AYIA 4E4PA 1JDFA 3LTPA 1E56A 1HVQA 4L64A 2A3CA 3OG3A 4HTYA 3WQPA 3DHDA 2P88A 1QRQA 4KH2A 2VCCA 2YDSA 4RDYA 4NKCA 1CGXA 4TMCA 4O19A 2WKGA 2WCGA 2X41A 1RJRA 1OK6A 4KETA 1KM2A 3VAVA 2IPWA 5ABTA 3EKLA 1WDQA 2R8WA 1ZU8A 3BK0A 3GDRA 1ZSXA 3LNPA 4I7UA 1CGTA 1M04A 2HBXA 3VPLA 3MUAA 3L67A 2RDTA 4U5KA 4UOQA 4EWJA 1GVFA 5H8MA 1W56A 2H9AB 2DSVA 3P61A 3QLDA 4LUYA 2AAMA 5A5WA 3VE7A 3C5QA 2QVHA 2Y8KA 4YJ5A 3U8GA 3OG2A 4WSHA 1RV8A 1JPHA 5CXPA 1X1ZA 4N4QA 3CZEA 3PB0A 1D7KA 4HNCA 1ITUA 4LVBA 4KGLA 4N6FA 3VX0A 5LHFA 3ZSTA 3ZJKA 4HNNA 5AHFA 3ECQA 4IUGA 3S0CA 4PMRA 1T99A 3U7BA 3TYBA 1Y65A 3NZRA 3UPBA 4B3ZA 2QCFA 4L1WA 4JAWA 3W7IA 5BXPA 4EAMA 2BX7A 3IVTA 1RBLA 1SZRA 5HQMA 1HX0A 2QJGA 4D6FA 1IHIA 2X7WA 3CMJA 2XPKA 3UZYA 3ZYZA 3WLKX 4YTRA 2DUZA 1SW0A 4BKNA 3WJYA 2WJFA 3GVVA 3PWIA 4WZHA 3OBEA 1SJAA 1CLXA 4QCEA 1OWQA 3MI3A 2YL6A 3N19B 4LAUA 4LFYA 1H11A 2ACQA 2WHLA 3GDBA 1Z89A 1Q6QA 2VKZG 2CWXA 4H9XA 3GVGA 4PUNA 4GVIA 2PBOA 4KRUA 5KETA 1CEOA 2GVLA 2INFA 3EOEA 1JCJA 1UWIA 3USZA 2UY2A 4HVXA 2FIQA 1PO9A 3T8LA 1QU4A 4JCLA 2ZC8A 3H7UA 4WJ8A 3LI0A 3U4AA 3W76A 3ZM8A 1UKPA 1TV4A 1CGYA 1M68A 2WZMA 4HZ6A 1DOSA 3BW4A 4QG6A 4TV6A 4IUOA 3QW4B 3EA2A 3BH4A 3DYMA 4ML4A 3UG3A 4PUMA 4G7EB 3GFYA 3BPWA 3APTA 2ZZ6A 4NAFB 2VZTA 1MW1A 3RRAA 4ZTYA 4O0ZA 3R5EA 1ZBVA 1BKHA 4PMXA 4XK2A 3GG8A 2ZZ3A 3O15A 4CNOA 3I3BA 3GDMA 1MRQA 5MF5A 1FWAC 5C9WA 2VEIA 3EDEA 1Z7AA 3KL3A 4RW3A 5AC6A 5DBTA 1LG2A 3PNUA 4H8VA 3I3DA 4Z2KA 4WOZA 4GD0A 4OIFA 1M6JA 3GXMA 4GY7A 2CHNA 3HGRA 1FTXA 3BAYA 4RW5A 1AVAA 3PSVA 5I3HA 4O52A 1E6QM 4H6EA 3O6DA 2PU1A 2P10A 4QDWA 3TP4A 1QBAA 1UUQA 1MVYA 1E9LA 4K68A 1OG0A 1GYMA 1HXJA 1B31A 5XINA 3WLOA 1SW7A 1DL3A 5CQ1A 1QJWA 1MFVA 1LYXA 3V0SA 2ZUTA 1OD0A 2DZXA 2Z1WA 1KNWA 5LGZA 3V1PA 5B7YA 4LAZA 4EF9A 4JFTA 5CSUA 1FWDC 5C9UA 1V6WA 1ZP3A 1LBLA 1PVNA 5D05A 3RJYA 4W8BA 4UTJA 3W74A 1V0NA 1HFBA 5XIMA 1XL9A 3VDAA 1WZAA 2XU2A 3UY8A 5G4EA 1OIMA 1U5HA 2B31A 3SURA 4MB3A 4WJEA 2G5WA 2C7FA 1W31A 1FWRA 1EDTA 3FJNA 3QXBA 1QO2A 3EB4A 2EPMX 4C6NA 1HKJA 1KKOA 4K8EA 1JI2A 1EJTC 1SMDA 1TRDA 3POCA 5FA5A 4BF5A 1M1BA 2W27A 2HMCA 2VUYA 4J4KA 1XISA 3DKJA 1V3KA 4EP8C 1DORA 5M2FX 3HBLA 4S3CA 3WJSA 5AVHA 2ZXDA 1A5NC 2VDIA 1DXIA 1J0ZA 3F7JA 1MEIA 4JFSA 4NL1A 2IXUA 4H6QA 3VNLA 2YBVA 3LPGA 1LRNA 1B3YA 3N29A 2WNNA 4DZAA 2MUCA 3QPEA 2CLKA 3IANA 4DJFD 4J3ZA 2VVSA 2VMFA 5BXTA 4PFMA 2WJEA 3W37A 3KCOA 2ZC1A 2PDCA 2CETA 1B9BA 1XLHA 5HWNA 3PK7A 2WSKA 3O7UA 2CLHA 4KFNA 3THDA 5FEWA 1H7RA 2FTYA 2IPGA 2AKMA 3KWSA 4NX5A 3N12A 3GNPA 1H7NA 3A47A 2QVNA 3BSMA 5ECVA 1AW1A 2PDFA 3BAWA 4DPPA 2VZUA 3WLSA 1TE6A 4DM2A 4IPLA 1HL2A 1QOQA 4Z2LA 2PDGA 3ITGA 1UR3M 5BRQA 3WK1A 5FAGA 5D8ZA 1B9ZA 2ZRVA 5AOUA 2YKKA 3S9ZA 3AS2A 3IGXA 1BAGA 3SIMA 5LIWX 1D9EA 1WKDA 4AIUA 1B1YA 4O18A 2R1PA 3TV8A 1XM3A 1GZJA 7TAAA 4H9VA 4N9CA 1VENA 2OLHA 3QW3A 1V3JA 4Q8NA 4CNSA 4Y6GA 2DJXA 4I9MA 4TX6A 3B4UA 3V75A 4IICA 1UR9A 4YTSA 2ZOXA 3XISA 4BI6A 1Q8AA 1UBPC 1EO5A 1XYCA 2VWTA 2W6RA 1XC4A 3B9DA 3S6TA 3W2MA 4CKQA 3W7QA 3ITOA 4UNKA 3MJYA 3NGJA 2X1TA 4ZQNA 2X40A 4ZO9A 3L5MA 2OYMA 1HTIA 3CUZA 4H7CA 4MM1A 1T96A 4NJGA 3W7KA 1R2SA 4XO6A 3GS6A 2DW7A 2FVLA 5IFTA 3GVRA 3C0SA 5A6SA 1POKA 4L5ZA 2XM2A 4MKSA 1QI5A 8XIAA 1GYLA 2OZ0A 1ICPA 3TA9A 3RUBL 4MYXA 3GNXA 5M1TA 2WC7A 3OQEA 4MJMA 4RKAA 2ISSA 4YTQA 4XTIA 4DNMA 3NTYA 2VGFA 1Q63A 3GNNA 2OLSA 3KOYA 2GOKA 1DJIA 4RXGA 4QE1A 4HK6A 3EA1A 3QKZA 2R1KA 2DSUA 3RGTA 3OLGA 1KWKA 4W88A 1RSCA 2QCLA 5DBUA 3VIHA 2ANUA 4UR7A 2XDFA 5LYRA 1JNDA 1UKQA 2ACSA 2FVKA 1IR2A 3E74A 4IQEA 3R2GA 3MCOA 4P8UA 3U5YA 4C6KA 1F4AA 1QHZA 3UZWA 1IXPA 2PLJA 1UKSA 4DPQA 2CNCA 3M7WA 4NAEB 5C8BB 1WV2A 1RUSA 5C54A 2GGJA 3TN4A 4AZIA 4GRSA 2QMKA 2L5HA 1RR2A 2YL9A 5BROA 1SSGA 3RU8X 4N9EA 3MB9A 4HA1A 5BRBA 1LORA 2PRMA 4DBDA 5ECUA 4YVPA 2YCIX 2UZ9A 4Q7BA 4AF0A 3DENA 4DLFA 1Y8BA 1XBZA 1MMFA 4JHZA 2V8ZA 2Q8XA 5EMLA 4B92A 3WIJA 1KCZA 4GUJA 4C6BA 1PX4A 2FQIA 4LCQA 1M03A 1UZHA 3MKKA 3EWCA 1JZ2A 4JTQA 3NQVA 3GXNA 3S5SA 2BB0A 4MJ4A 2EJAA 5I24A 4NI3A 4BF7A 1L9WA 5HQLA 1XP3A 4JL2A 4GIAA 4GCXA 2E6YA 4F79A 3WQ6A 4G2DA 2DZWA 5KZDA 3UCQA 1PDZA 5G5IA 2W91A 1MO0A 2OLAA 5J04A 3URAA 2VGBA 4MLJA 5CZJA 4ZQOA 3AU6A 4QJ4B 5CSYA 1W5NA 2J8TA 1GEQA 4BA0A 4JN6A 2E67A 3CT2A 3ARTA 1WDRA 5ABGA 4C6QA 2VFHA 2HS6A 1LWIA 1US2A 2R14A 4I5UA 1VR6A 4W86A 3EZ4A 3VXGA 4FK9A 2O4QA 3EXSA 4LEQA 4ZXLA 2J88A 4LUIA 3ATZA 2V0TA 4FNSA 5EFFA 1JG9A 4DUOA 3EMZA 5LGXA 3UFYA 3GLCA 4YL2A 4JCMA 3QZEA 1O6IA 4JIEA 4BY3A 1IWPA 1E6RA 2HZGA 3MSGA 4UTIA 4XAPA 5FESA 4C7FA 2C91A 2J6XA 2OWCA 4QE5A 5A6KA 4AVOA 4DO4A 2ISVA 3KE0A 4AZ5A 1XLCA 1MQRA 2VC7A 5GJPA 2X8RA 4PMOA 4ATWA 5G1TA 2OX4A 5EPDA 2V5KA 3L2IA 2Y6ZA 3DYOA 3IAQA 4I6KA 4K6AA 3CQIA 3QZ6A 4A22A 2INEA 4UNLA 4DJED 3KLLA 4F8XA 3VMNA 1BXNA 5HPOA 4GE8A 4P8WA 4EX4A 2WJDA 4F3HA 2ONEA 4JNMA 3K30A 9RUBA 3G1FA 4XD6A 4EXQA 1DYSA 2ISDA 4CNTA 1PYFA 5I3JA 2Q3RA 2F8QA 2ISFA 3A4XA 1NVMA 3DC0A 4IG2B 3W87A 1H1ZA 4TMBA 2CLFA 1W3JA 3VIIA 3WNKA 1ODZA 1A50A 4CVWA 2I9EA 7CGTA 3DECA 3CXOA 1GVQA 5TF0A 4ZFCA 3AMLA 3OHIA 3BARA 3PZTA 1P0NA 1QASA 3W2JA 7A3HA 1WBHA 2TODA 2KAUC 2W79A 1JYWA 1OYBA 3HIJA 1V6TA 3CPUA 2E0PA 4HA3A 3SN1A 3UG8A 5AC5A 1AUSL 5FIPA 5FJTA 5L6UA 2B4GA 3W82A 3PZUA 1I4NA 3VIJA 2CBUA 2HNEA 4QS6A 4XBSA 4D8ZA 1LF1A 3APGA 2QNEA 1UZ4A 2XH2A 2NXHA 2XVLA 4WLCA 3N3MA 1TPFA 3LCWA 4IXXA 2BGNE 5EMYA 1R3YA 2E9MA 4RLIA 4HPHA 5TBOA 4A8RA 2J7DA 1MZRA 4NNBA 3K4DA 2ZZ5A 6ALDA 3WF1A 1CIUA 5DCBA 1WDSA 1YBQB 1CWYA 3STPA 3CO4A 4PUJA 1VIWA 1XLEA 3M0VA 3QY7A 1D2KA 3KBMA 4Q4SA 1NU5A 2GQAA 3O6CA 4IQDA 2A3BA 2NVDA 3GHTA 3ARWA 1C91A 3IUHA 2EKGA 1FDJA 5CJ5A 1EJXC 1UC5A 4A3HA 4FIQA 4TTUA 3W6YA 5HUOA 1DE6A 8RUCA 5LXXA 4ZODA 4ATDA 4X0VA 3AXMA 3F4WA 4WRHA 5HWJA 2YZRA 3LXBA 4Q8TA 4N2YA 1G4SA 2X30A 2RDXA 4EAYA 4DBSA 2DVXA 1VPQA 4ILSA 3TAOA 1HJVA 1HJSA 4NZFA 4AZ7A 3TJIA 2DIJA 4NSBA 3P0XA 4PUDA 1KC7A 1Q6EA 3ALFA 3VIPA 3RLHA 1E4IA 1G9HA 3SSJA 2I5QA 4A8IA 3OA5A 3B0VC 1O1ZA 3P8JA 9XIAA 1HL8A 4WY0B 4DX3A 3S8HA 4KT2A 3W2KA 4US5A 2WAGA 4LPCA 1GONA 3M0IA 2XSBA 4UFKA 4QITA 4S38A 2WSQA 1M65A 4AZ6A 3DKLA 2VZOA 1WXZA 3LM7A 3CASA 4LS1A 3WEOA 4LAKA 5XIAA 3O0KA 1SJCA 1VBRA 4GA8A 4QS5A 1NELA 1J5TA 2X7VA 4UIOA 3N18A 3ABOA 3BQ6A 3QBUA 1Z32X 4LYKA 1JRBA 2C16A 3AIVA 4KKXA 3B8TA 1QI0A 1GHRA 1H63A 3KUMA 2PBGA 3ITYA 1MXDA 3HPZA 5CGTA 3L7RA 5ABFB 3N4FA 5K9CA 1CGWA 1QMLA 4GVGA 1F3WA 3GXPA 1XIBA 2A85A 4DYJA 3GY1A 5CPOA 2PTZA 4GNKB 3CYJA 2XVNA 1ONXA 1V6VA 4P7OA 5HR7A 3T0CA 4Q6JA 3AHXA 3PAJA 4ROQA 4LC6A 4AWTA 1VKFA 3BMVA 4KIRA 1AZ1A 5A8NA 2W67A 4JNYA 4O11A 3P93A 2I9UA 5CPLA 4HTBA 2XIOA 1UH2A 1VFTA 1N8IA 2C1IA 1L6YA 3EOSA 2PC8A 1QXLA 1PKNA 3VDHA 2QPXA 3WBWA 4C6IA 4AWSA 5F1VA 4BEUA 4DO7A 3P82A 5H2ZA 1VBHA 2QCGA 3VA8A 5G2WA 3VNKA 2R24A 3K46A 3GIYA 1JD7A 4MWAC 2OWXA 1XHGA 1DJYA 4I9TA 4HA0A 3NFUA 2WMGA 3GHRA 3AUJA 3BLFA 3EOUA 4H8NA 2D2GA 3NAVA 1WUFA 1HIZA 5E0KA 2NSXA 3CC1A 1XIMA 1NQKA 1RY0A 4WQ6A 3R89A 1W3HA 2QXWA 3WEZA 2PDPA 1TIWA 2VEKA 2EPLX 1IXOA 1HW6A 4GYPA 2YIHA 3L4TA 2NV1A 3R58A 4IISA 3O6YX 5BWFA 1IEXA 2P8CA 2YXGA 3QM3A 4U2YA 4DQWA 4MIMA 4HMDA 4YTTA 1KQZA 4L9ZA 2C0AA 3WNLA 4S3DA 3WNOA 1O12A 4H6RA 3TQKA 4TVCA 4WDWA 3ZT6A 1FFQA 1YDYA 3ANYA 1C9WA 3W72A 5ABHA 4QX4A 1SJBA 3VYLA 3B9NA 3MC5A 1XRTA 2OXNA 1RHCA 1K9TA 1GOIA 3P5ZA 2J62A 2ZX8A 4ZXOA 3WBEA 1DJXA 3TSMA 3CL6A 5DF0A 2XVGA 4XD3A 5CPMA 2OGJA 4ZOCA 1IZCA 1UD2A 2GJXA 2O92A 3RIKA 2J4GA 3V0TA 3N4AA 4QNWA 2ZVRA 3JVAA 3CIVA 1DIEA 3MCNA 1OK4A 4HD5A 1K7EA 3I3EA 2O9OA 3PS7A 3DHUA 4LXFA 2XN2A 1ITXA 2NV2A 1PBGA 4MB1A 1Q7ZA 3DH7A 4PEEA 4ZENA 1E0UA 5CG7A 4S3AA 5EU9A 1W3LA 1XD0A 1GW9A 2FMOA 1SZFA 1BG4A 2XFFA 2FB3A 4KF1A 2R82A 3G3MA 3ZFHA 3NURA 2PP0A 4NF7A 1E1EA 2BVYA 4M6UA 4HOXA 4C6MA 2JGQA 2VX7A 3C86A 3RF9A 1R3QA 2QCMA 5AYBA 3OGRA 4H2HA 3DI0A 3G0XA 1I1WA 5E6ZA 2OT0A 2DPEA 1W5MA 4XSLA 4FOJA 5G2HA 1T5AA 1H2JA 3Q45A 1DJHA 1SZNA 3W7NA 5E70A 3ES8A 4D6EA 4GQGA 2HRWA 4L6OA 4GIRA 4HZ7A 5F2MA 1JZ7A 4N4PA 4PCSA 1FCVA 2C8NA 5CLWA 3CIWA 3VC6A 1B3VA 2QUVA 2WVTA 2GPTA 4PRWA 1OX4B 4B3KA 3VUPA 3DFHA 1W9XA 3W1QA 3SM0A 1SFLA 3SGZA 1PTAA 5TIMA 3AMGA 3C8FA 4ZSTA 3CAQA 3WDQA 1UQYA 4CU7A 2GLKA 4MHBA 2JBMA 4JTFA 3N1AA 4NJHA 5FSEC 1B54A 4G8TA 3TA6A 2WVSA 2V2HA 2PDMA 2RHGA 8CGTA 1EBHA 1YDOA 1TFVA 1OABA 4DAIA 3LB0A 1XSIA 2AQVA 3TOPA 1XH0A 5AYZA 5CBBA 4PTVA 2V38A 3UYCA 2RH9A 2J75A 1EQPA 3L0GA 4IP7A 3LHZA 2OELA 3OP2A 3BOLA 4A29A 1ZJHA 3MPGA 5FEXA 4HJFA 3CB3A 1HGWA 1X6NA 3TR2A 1KGUA 2ZX9A 3SADA 2XWDA 1E0XA 4AXKA 2ABAA 3LMYA 2J24A 3QR1A 1FWSA 1NJJA 4W89A 3SCSA 2ESCA 1CBGA 3VC5A 1FH9A 4LC8A 1GJPA 3UF9A 4KCVA 2ZYFA 4DVOA 1P6CA 1BYDA 2PTYA 3F2CA 1ZL1A 4Z2IA 5KITA 4K39A 2X2GA 1FCBA 4UUIA 2DZTA 4HK5A 1OFOA 1HUVA 5I06A 4A35A 3NQDA 4LEFA 1K70A 3MYPA 3I6TA 4QTGA 2QW5A 5D2TA 4ZBCA 4HPXA 1XX1A 1UROA 4GI9A 3PB2A 3W1XA 4QQUA 2NW0A 4PMQA 2CBIA 2J8FA 1EGVA 3HMCA 4MY1A 2ZKMX 1X39A 1DWIM 4O16A 4LF2A 5FF4A 2AAAA 4GWEA 4PMYA 3QJAA 1JD9A 2P0OA 3UGVA 3VE9A 1FBAA 4XBJA 4B91A 3WLJA 3OHMB 5D30A 1RP8A 4UQCA 2BVTA 1QNVA 3MBFA 3WL0A 3T6CA 4HSHA 2VQUA 3FSUA 3OTRA 3QFWA 4HHPA 3I65A 1W1PA 4NZ5A 4AYSA 1KXVA 3VOCA 3PY2A 2O56A 3B0PA 3SQMA 5BNKA 3KM8A 1Q65A 2AL2A 2F6KA 1FWIC 2VEGA 4IGMA 5C6MA 4M7SA 4OBRA 4Z1BA 3S1GA 1SO3A 4YNGA 2CWNA 3DG6A 1QW7A 2RAGA 1XG4A 4Q22A 3POHA 4AC7C 1GEHA 3NQAA 2VUNA 1OGGA 2Z2UA 4E38A 4XVEA 1SQ7A 1G01A 4JIIX 3H4XA 3T08A 4WR3A 3PG8A 5EMKA 3MVIA 1PHQA 3GHSA 2G95A 5M03A 1T8XA 4B4FA 1TV7A 4M3PA 2V5BA 5FSDC 2Y85A 3DFYA 2PC4A 4JN8A 3PZ9A 1ISYA 3K1GA 2SFPA 2YXXA 4CN6A 2RDUA 4U3AA 4M6QA 1IGSA 2XSAA 1YXCA 3VDGA 3GU2A 2CKSA 3CH9A 3STGA 3NZ1A 3G2GA 3PTDA 3CZGA 4RZ4A 4O10A 3OLIA 1V93A 4AVNA 4DWSC 2GGEA 3VTRA 2VR2A 5AC8A 2GUBA 3S46A 4REQA 1AA1B 4R7OA 3G1HA 3VMOA 4XB3A 1S5VA 4D1IA 3MCMA 4JX5A 1XLJA 2Y1HA 1H0IA 3E38A 5CC3A 3UJ2A 3WQWA 1CXIA 5AC7A 3BG3A 7XIMA 3RCMA 1H4PA 4IX0A 5A8OA 3OIXA 5JIPA 2NX3A 4HYVA 3H53A 2YCJA 4OGZA 4H9YA 4D6JA 5FEPA 3SRHA 4EPBC 3SCTA 1WB0A 8XIMA 4KEZA 1MUCA 1UJQA 3UYIA 4HJWA 3IUIA 1YNPA 1Q5MA 3I4KA 3V5CA 1BG9A 3VD7A 3WQFA 1WKYA 1GVOA 1OC7A 1C92A 4ADSA 3QV8A 3SJNA 3WO8A 4F2TA 2Z7GA 4YCPA 5DN1A 3V1HA 1BHGA 2DY3A 3E1F1 2Q6ZA 2J9XA 4OZOA 5BZAA 2BASA 1E15A 3HFTA 3B03A 4CN1A 3AMDA 4L80A 1ISWA 1VPXA 2PWUA 3BSHA 1BFNA 5TD4A 3OZOA 2NSOA 1TB3A 4FSAA 2ZTJA 1U83A 2ZUWA 3UG5A 4F0KA 2VOTA 3HN3A 3MUXA 3NYDA 3KOXA 2VENA 3GH7A 1W91A 1J12A 2E4TA 4L4LA 1S2VA 3VIKA 2VFEA 2I5IA 2FTWA 3AC0A 5C70A 5HAOA 3R94A 2YW4A 4PUUA 4LVGA 3UNTA 3REQB 4B2DA 3LGDA 1RCOB 1GOOA 3F4DA 5E5CA 5M3WA 2HVMA 3KZSA 4RE4A 5HATA 4AZCA 4LY8A 1P7TA 3E2RA 3B8IA 5F2GA 2FTPA 1U1HA 2WZTA 4HCHA 1TPC1 1UJPA 1GOKA 2AQOA 2W92A 4U5IA 4GK8A 1XFBA 3CWOX 6CGTA 3T4CA 3U57A 4QG9A 1M41A 2JF6A 1N7KA 1REQA 3BLDA 4MUZA 5HJXA 4QJ1A 1B2YA 3ZXWA 5K4XA 4RPPA 1XYAA 2FZMA 2Z25A 3HM7A 4GPNA 1R9ZA 5D9OA 5BWAA 1XS2A 3CUHA 1OF6A 3N6JA 4HN8A 3KW3A 3GTFA 3GH4A 4HMCA 1LROA 3MSYA 4M82A 4NVTA 4F0RA 1BGAA 3LDVA 3NM3A 1TKKA 1MI3A 4CGTA 1Q4NX 3MBDA 3A13A 2QLYA 3OODA 4G56A 4V28A 3UZ5A 3M44A 3N2OA 4JX6A 3PHAA 2J66A 5FJOA 1I75A 5D04C 5E0CA 2Q8ZA 4ZQPA 4GNJA 3MUIA 3TCSA 1XBYA 2BBFA 3HTWA 5IBXA 4TQTA 3FOKA 2CW6A 2WKLA 3WFZA 2PCQA 3MWAA 3UXDA 4DAFA 2ZXQA 1S1PA 2GJPA 3D46A 4IZGA 1LWJA 2CU0A 1U22A 1KO0A 3F2DA 2V82A 1VFLA 1T0OA 4BWLC 4PRRA 5FACA 2PF8A 4OE7A 3ZZ1A 4F9DA 5A1AA 4E2VA 1H50A 2AMGA 3JZUA 2OSWA 1DWFM 4WEVX 4P2VA 3S6OA 3RR4A 4IL2A 1ZY9A 5E0FA 3EPMA 4E2DA 4IJCA 4XZIA 4PTXA 2GFTA 2VL4A 2PLCA 2FZDA 3EX6A 3MO4A 5DT5A 2XINA 2D0GA 4TO8A 3H24A 1OB0A 1WXYA 1TV5A 4XG1A 3F5KA 3SW6A 1AJ0A 1V5XA 3TSDA 2DT3A 1VBJA 1IF2A 2BHYA 2Y70A 2JEPA 4LW7A 5DRIA 2Z24A 4WKAA 3M0JA 4Q32A 1LZOA 3L2LA 3TYDA 3VZZA 4H9MA 1WXJA 1A3HA 2GSHA 2CHOA 4GJIA 2DORA 1UD3A 2D3LA 2G0WA 1XBXA 1OX5A 4PL1A 4KFOA 5G4WA 4PTWA 4ZEPA 4ZB5A 4LQ1A 2F9RA 2NX1A 3C0LA 3CWHA 4MADA 1OM0A 1AMKA 2VFDA 3PZGA 4UWMA 4Q33A 2PDQA 4NJJA 4H9UA 3UXAA 3L0NA 4RXFA 4MTVA 1W2VA 3W73A 4ZB2A 4L61A 4HPGA 4JTCA 4C6CA 3TTQA 3MUCA 2VNCA 3VKDA 2QUTA 4K2SA 4MPKA 5D32A 4BR1A 2V68A 4BWLA 4FI4A 4RJEA 4HPJA 3BTNA 1A5AA 3NDOA 2CZVA 1EB3A 1R87A 1EDGA 2BS9A 1UW9A 4BZYA 2Y7GA 3H26A 1TG7A 1A53A 3CHDA 4HZ8A 1TWWA 1GTEA 4IH3A 4JYFA 1NDVA 3OZPA 2V30A 3M0LA 1P1XA 3M5XA 3WNNA 1AJ2A 4LS0A 2PB1A 1J79A 3RM9A 3I10A 3KRBA 5DLCA 4XD5A 3E2SA 2QDGA 4P5UA 4QJ3B 3R11A 4EPKA 3CO8A 3AYTA 2A3LA 2C13A 3M16A 4ERGA 1GJUA 4WK9A 2XFWA 3IWPA 1LCOA 3GTIA 2OEJA 4WGXA 3OYXA 3DGBA 3IRDA 4BQ4A 3NO3A 5CC7A 2R1LA 1JZ6A 3ME3A 4GGBA 4QNEA 2D73A 4LNYA 1JXKA 5I6SA 1P0BA 2Y0FA 3GVWA 3IRSA 3ZS4A 1SU5A 4O4WA 1BTMA 1WOAA 1KCXA 1XRFA 1DBTA 4DF0A 1S5WA 4WF7A 2WOQA 2BG5A 2IKJA 1FCQA 4MZ8A 5T8GA 1R8LA 4UQBA 2PDNA 3SBFA 3TYAA 4MNMA 2C15A 3AYSA 2WC4A 3BAXA 3AHVA 3D47A 1FH7A 2GSJA 4GINA 3AS3A 1WCGA 4X63A 4BS0A 4JICA 3VD9A 4PSRA 3KP0A 4S3BA 2E1WA 5I3DA 3PUEA 3L9CA 2RGMA 1NOUA 5LNUA 4NYYA 3APYA 2Y7DA 3IGHX 4QSFA 2JE8A 3GR7A 3SFWA 3CTTA 2H9AA 2V2DA 1SZEA 1M9HA 1V3HA 3UD6A 1RLDA 5LNRA 1UIOA 2WB5A 3LBCA 1RBOB 2VURA 4TOQA 1XJBA 4C6EA 1F3TA 1KBBA 2XTKA 4FNPA 3RLGA 3UR8A 4R9XA 3FDKA 3GR4A 3T0BA 1E5NA 4PL2A 4BI5A 1TV3A 5FF2A 1DWAM 4GIEA 4JZ5A 2VFFA 3H55A 3ABSA 2I14A 4U4MA 4KW2A 3PN8A 3M64A 3IJLA 4ES4A 2Z00A 1XGZA 3A3XA 1WPCA 5MKGB 4J3XA 2AGTA 2GYIA 3R8HA 5E1QA 3QYSA 3MW7A 4QEHA 1VLIA 3LV5A 2I5GA 1HQTA 1ISVA 1GQIA 3FIGA 3TW9A 3HPAA 4JTDA 3FGCB 1CZ1A 1BVNP 3W1PA 2G3FA 4Q8VA 3S5ZA 1P43A 1YMYA 3DG3A 4UTTC 4MSSA 3WK0A 3AISA 4H00A 5M17A 4S3EA 4O1FA 3B8UA 4QJ5B 2JFEX 3OLDA 4LRSA 4UB9A 4QAWA 5B7ZA 5FJRA 1UD5A 1VRXA 4E3TA 2VGIA 4Y9OA 4DLMA 1EWDA 4ACZB 3TSBA 4JTSA 1KFBA 2VCBA 5J5DA 4LCSA 3DFNA 4F9JA 4AY1A 4BHYA 2QDEA 3UVAA 2YA0A 1FWTA 3PR2A 3W1AA 2ZUVA 5GQBA 5BOFA 2R91A 4NAFA 4O0QA 3UWZA 5G4HC 4HNLA 3AAMA 1GOQA 4X9SA 2JF7A 3G1YA 4UR8A 3QKEA 4LBUA 3RRXA 5JVLA 4NHVA 3NEVA 1H5YA 3NOYA 1TTQA 3LYEA 4PBFA 1EJVC 2D1ZA 1UWTA 3D3AA 1RCQA 1IXQA 2BVWA 4AZBA 1XIDA 1ZZMA 2PP3A 4C6DA 5I78A 1IGWA 3C2YA 2PCEA 2XN1A 4PTMA 4EPDC 2V5LA 1W3IA 2PWDA 1SVDA 3CQ0A 3QN3A 3BAKA 2ASHA 1RPKA 3EA3A 4PYSA 2YW3A 1BSIA 4Z1YA 2DQWA 1BWLA 5JQ9A 5IFPA 3A64A 4QE4A 4DUWA 1CXHA 4AZGA 2Z4GA 1HJUA 3H23A 1YRRA 1XICA 2UV8G 4XAFA 1YKWA 3WCZA 4J9JA 3GU9A 4UTTA 2EPHA 1I0DA 4D8AA 1R86A 1F6YA 1TPB1 1E6XM 1GGOA 5CC5A 1VFFA 4ZE4A 4UQAA 4A3QA 3MMDA 1LTDA 1CXLA 2IQDA 3U5UA 3GD6A 3B4YA 1AK5A 1T41A 5F1UA 1GKRA 3RU6A 3CTLA 3BG9A 1N2VA 3GZ3A 2Y7FA 4GO9A 3W71A 1UC4A 1SM9A 3BVJA 3FY1A 2QPSA 1K8ZA 4O0KA 3CH0A 1QW8A 1E4NA 2QIWA 1MXGA 1WKFA 1TR1A 2YR1A 3CNYA 4XWUA 2E5DA 3DEQA 3WK3A 2B7QA 2WPGA 3GYCA 4N42A 3WH7A 2E3ZA 1QO5A 5LA2A 2YBUA 2WW5A 4IGSA 4L4PA 3MP3A 6TIMA 4QAIA 2IUZA 3WMBA 3M0YA 1KR1A 5LNWA 4IMCA 2PSNA 3UWQA 2E40A 3G22A 4EE9A 2MNRA 5JMUA 4MAVA 2PTXA 1TCMA 1L8PA 3M4HA 2AOSA 1T6MA 4JY8A 2FZNA 1WA3A 4CQDA 1XH1A 2WCAA 2PDUA 3BLEA 2F2KA 5A2AA 2EAWA 2AL2B 4XZMX 3CHVA 3DC8A 2H6RA 2EF9A 2HK0A 2QEZA 1MZHA 4AB4A 1RK6A 3W6LA 2WZIA 4GI6A 1LJYA 2BMBA 2DT2A 3BE7A 3T07A 4E8CA 1H61A 2O7SA 3KOFA 3CU2A 1DXFA 3FKKA 4PFHA 4G6CA 1XCWA 1SSDA 3RHGA 4Q8MA 2V3FA 3K4WA 1UMLA 1N8WA 1XLKA 1BSLA 1NQ6A 1GPWA 1BQGA 1D3HA 4Q4MA 1X1OA 4GVFA 1DWJM 5BW6A 3WDJA 4H19A 1QHPA 3ONCA 2YJQA 3MKVA 5HNTA 2LLEA 3HQ1A 1TTPA 2IKIA 1RA5A 3RMEA 3KBJA 1I9CB 4ZQCA 1XLIA 4GQRA 1OCQA 2D69A 3PZQA 4DJDC 1MSSA 3OLEA 4IX2A 3TN3A 3NQBA 3AIWA 1PEZA 3IACA 1KM6A 1DHKA 1KCLA 5I3FA 1UD8A 4OV9A 3KTXA 1IWBA 4G7FA 2CLPA 3HJEA 1BTCA 2BSLA 2OWWA 1J18A 2ZRUA 4MWAD 1ZRQA 4LUTB 1DIKA 1OHLA 4EKJA 4Q4QA 3KFTA 1VFOA 5LZLA 2OQHA 3B9AA 5HUPA 1XLAA 1UB3A 4IHCA 3T42A 3VO0A 4HGXA 4C7GA 1EEPA 1EIBA 1A4LA 2OKOA 2NQJA 1DQUA 1VYRA 1Q7MA 5C2CA 4PCTA 3WD0A 4FX6M 5K9DA 3SRFA 3XIMA 2ADAA 4OJYA 4MMWA 4C6LA 2A7RA 3OVRA 2P0IA 3C2VA 3IIZA 3WF4A 1UPMB 4H83A 4ZA0A 3UESA 5DELA 2YDRA 3GNOA 4X9YA 2F6UA 4Z17A 4OWGA 3ZVHB 4HNOA 3MWCA 3UZZA 1QOPA 1MW0A 4JDBA 1KR0A 4B5VA 1V3LA 3G1VA 2Z7KA 3GW0A 3EEGA 4DJDA 1OYAA 4D2JA 3LUTA 3UBPC 3FW6A 2BVDA 3IIXA 4FNTA 2O9RA 1XD1A 3E0VA 2PD5A 4L65A 4QGCA 1EBGA 4O53A 1HKKA 2VOMA 3H2EA 3A5FA 2CLEA 3LS9A 3SEPA 1M7OA 1V0LA 1XIEA 3FSTA 2CCRA 1CCWB 3OGSA 1TUXA 1GOWA 1C29A 4L7ZA 5EA9A 3KRZA 4PB4A 4LX4A 1NIUA 2HV5A 4JTGA 3FJ6A 3UJSA 4UTWA 1B0IA 2JQXA 5G1YA 2OKTA 2C18A 3CV7A 3ZIZA 3BJFA 2C79A 1NP0A 3W1NA 1MWOA 3G6LA 3W1RA 1P7TB 2QCDB 3UGRA 3UCDA 3QHMA 3C2RA 1VD6A 3KX6A 3FYYA 2FB2A 5D2YA 3MSRA 4UCGA 1OZQA 1Y5WA 5M5DA 3P3BA 4M1RA 4KFPA 3OGVA 4M19A 4C6OA 2GGGA 5DY3A 3W02A 4IIEA 1IE7C 3W1LA 4L1XA 2WZEA 3WMSA 4UFHA 1JGIA 1PTDA 1LWHA 3VK5A 1O7AA 1TPVA 5MHBA 1ZGDA 3OEXA 4ICCX 3NDZA 4C5ZA 5KTLA 4OOUA 2GVEA 2E5BA 3VOFA 4B5UA 3DYPA 4CCZA 3M5YA 1MQPA 3KTCA 1PIIA 3HGSA 3G0UA 4DY1A 1VHNA 3OYZA 1KD0A 3W1UA 5TAOA 4MJ2A 3SGUA 2XG9A 1S39A 1A5MC 1AMYA 3TOYA 3QH2A 3PUOA 2IKGA 1R38A 2Y88A 3NCOA 2WLZA 2ZRZA 1VYSX 1Q6LA 4S2CA 5AHMA 3SFKA 4UR9A 3FDGA 3W7OA 2OEKA 4R7WA 5C9ZA 2MANA 4ZMGA 4WUIA 2J77A 3F4NA 1D8CA 3FHAA 2YXOA 3SI9A 2PZNA 3EPOA 4I5RA 3LSCA 1F76A 1W9BM 1BRLB 2FZ8A 3EMCA 1CTNA 3LCHA 5GJNA 3C3UA 2WMFA 3PP7A 2JGYA 3IVSA 3R10A 3H22A 3JRKA 4LUSB 2WNQA 3TN5A 4DELA 2A1YA 4HOZA 2OZ3A 1VJIA 4F0MA 3EB3A 2PFHA 3T44A 1K8CA 1LM1A 3NZQA 1EC8A 2PDBA 3H70A 1HF6A 2FJKA 1G4TA 3AHTA 1KM4A 5K2ZA 1QNPA 3M7SA 3T4WA 3KOZA 3LTSA 3W86A 1ZCOA 4AQLA 5C5YA 2VM8A 2DQXA 3L4YA 1TA3B 2FH8A 3PVFA 4J2PA 4GVHA 3LLXA 4IG2A 3O9NA 4PZVA 1OVDA 1QPRA 3A24A 1BPLB 4G5DA 1UYQA 5EYWA 3HV9A 3TNOA 3TR9A 3LBMA 2VX6A 4LV9A 4QRNA 4YS1A 3SRKA 3MHUA 3T0TA 4AVFA 4KS0A 1AQ0A 1XUZA 3P0WA 1EJ7L 1GZ1A 3H8AA 5ABEA 1IT0A 5I2UA 4LALA 1Q6FA 3TMLA 3NQ2A 4XBKA 2W66A 5IDZA 1U5VA 3HMJG 3PBVA 4MFDA 2QHAA 1DVJA 3TTYA 2Y89A 3CL7A 3BZJA 3U2OA 3S2LA 3M41A 1QW9A 4A6GA 3K13A 2HJPA 4EIVA 1TWSA 1W1VA 1DQXA 3WLTA 1K6AA 2DUXA 4K3ZA 4B4HA 4Q7NA 2RKXA 4P7NA 4F48A 2HCVA 3BSGA 3WH5A 2FHCA 2HROA 1F7BA 1GQJA 4PMDA 1MDLA 1TZ9A 4IIFA 4U10A 3RPMA 1EZ2A 3TQ0A 3VM5A 3W7EA 3RG6A 1I6NA 1QVBA 3A6OA 3IJIA 2PDYA 1NWSA 1W8SA 3HPSA 1R2RA 4P7RA 1G1YA 1WP6A 1YBQA 1QUMA 2IS7A 3UVIA 4HU3A 2EHHA 3IJ9A 3WENA 2OYLA 1M7JA 1XQKA 3LHUA 3R13A 4DI8A 6REQA 2EG8A 4R85A 2NUYA 4GZJA 4XISA 4NT0A 3W2UA 2V69A 1VP5A 3C52A 2QS8A 3LM3A 3NXLA 2J13A 4JTRA 2BHUA 2A7NA 5EKYA 5F2LA 2YSWA 5A6BD 4KWVA 1BKSA 4F0LA 3NZGA 4DWSD 3QSRA 3B97A 3PZNA 1WOBA 4JTLA 1JUBA 1FXPA 4QIUA 1MUWA 2VEPA 1A47A 1VEPA 5KINA 4MUPA 3S42A 1R46A 3ELFA 4JY9A 3AXXA 3TYCA 3R8RA 1W8GA 1JZ3A 5GPRA 4OECA 3CZ8A 1JCXA 3W26A 4ICMA 3B05A 3GW3A 2GJLA 3ZO9A 3LCFA 5FI8A 3PPFA 3PZMA 1B3ZA 4WY0A 1EA9C 3EWZA 3B8VA 3OVPA 3BLKA 3W75A 2VR4A 5HMDA 1JQXA 1F07A 2PLKA 3R43A 1K7XA 5E93A 1PHWA 3B06A 1TO3A 4Q8PA 3DXIA 1RLCL 5JBFA 3NVDA 3KL0A 2ZDRA 2Z2BA 4IMDA 4IPNB 2VELA 2E68A 4B5NA 4JIPA 4J3UA 2BGQA 3NVTA 3LRLA 1C9DA 2QCCA 3JR2A 1D3GA 5LHEA 1WE5A 1ZUAX 1NSJA 2ACRA 2OGYA 3ARQA 5CEWA 4G9PA 2PEVA 3PZOA 3TC6A 6PTDA 3DX5A 5H1WA 1AODA 2VZSA 1I8JA 3E0LA 2FMNA 3G1AA 4KRZA 3C2FA 1EPXA 2ALDA 3WLIA 5ABFA 4LTSA 3WJWA 4Z2JA 3CEPA 3F4CA 3CQJA 1M7PA 3VGGA 5H6HA 5F7UA 2YPIA 4N02A 2G97A 4LS2A 3G77A 4DXVA 1H5VA 1OZMA 4XQ6A 3ZLFA 3QY6A 2PA6A 3PJUA 1UR2A 2EQDA 3KHDA 5HNNA 3U2EA 3WLLA 3NEHA 3I7QA 4I7WA 1E72M 2A6NA 2Q09A 1TWDA 4GHRA 3INPA 4HZMA 1XRSA 4A4AA 3PBMA 2QKFA 5CSRA 1EOKA 4Z1AA 2Y5EA 4QR6A 3AICA 4KQNA 4FA3A 4WDUA 3PPGA 4ZO7A 1EFZA 2Z0IA 1KW1A 3LPOA 5FL1A 3N2CA 3IGUA 2VWSA 1HN1A 1YDNA 1VPYA 3IJDA 3M46A 3KS6A 1UD6A 2ZWYA 4M24A 1G6CA 2A6LA 1R3RA 2ATSA 1EL3A 3BCJA 4C90A 3U2ZA 3NPWA 3E02A 3CHEA 1S38A 1O66A 4Q8UA 4LH8A 2CITA 4RNJA 1JVNA 4O1EA 4YYCA 4IP5A 3QVQA 4JTHA 3TK7A 4GX9A 1UOZA 2FZ9A 1S2WA 2ZTKA 4JQ3A 4D71A 5T91A 1MW2A 4GYKA 2GVGA 3UZJA 3NR0A 3GDLA 2DZAA 3A9BA 1WNOA 1YHTA 1UKTA 2Z1XA 3CLWA 3GFXA 3MV01 4DJFA 1H0GA 2BODX 4A3UA 1WAUA 1XG3A 4D9PA 5AYXA 1TYGA 4C65A 2HWGA 2QUNA 4AFYA 2HEJA 2DH2A 1F6PA 4WJXA 2RDWA 4J7RA 5DCEA 4V2XA 2DZPA 1LP6A 3FA5A 3GAKA 1UR4A 4GH1A 4QEEA 3WKZA 1NWTA 1DJZA 1GOXA 1H51A 5BYWA 3FLUA 1I2RA 5FJPA 1WZMA 1OJXA 1QNOA 1JAKA 5A2CA 4AHOA 4P61A 3T2PA 4Y90A 2NQLA 2YFOA 1AQHA 2NUXA 5HR6A 2X16A 5A8QA 2O7QA 1PB0A 4ML9A 3TZFA 1AZ2A 2PUZA 3ATYA 3BJSA 3E5BA 4GYFA 1XC6A 4X3ZA 3T05A 1W9UA 1AL7A 1U33A 5CPSA 4O4VA 5LIUX 5DMMA 3CHCA 3SDOA 4MVAA 4PULA 3VNJA 3C56A 5IHRA 1HO1A 3N9RA 3HU7A 1K7FA 1JI1A 3FJ4A 4NASA 2CEQA 1V7YA 1TZ7A 1ONRA 4C7DA 3DGRA 4L56A 1GTHA 3PWAA 3OPSA 1XIHA 3BDKA 2BOGX 3WELA 3HB9A 5AC4A 1PS9A 1EP3A 2F61A 1OQFA 1RD5A 4XIMA 4KRTA 3C0JA 3AYVA 3LTYA 5AB3A 3VGFA 2QUMA 3NO5A 1A3XA 1W9PA 4GZ7A 3DZ1A 4ASTA 2D2HA 1SUXA 2DFAA 4XV0A 1TE1A 1NF0A 1NDYA 3WQOA 4V15A 1X97A 3WLPA 3OVQA 3QMRA 1O1HA 4YWSA 1NF7A 4JQ2A 4IPIA 1PX3A 5CJMA 3MVTA 2HISA 3GZAA 1OX4A 1HT6A 4HHLA 1TV2A 3HQOA 2G50A 1Z8AA 2JIWA 4QBXA 1KBLA 3CPGA 2PURA 2Y4SA 2WM0A 1XR2A 4D6CA 1ZALA 4FR1A 4ECLA 2VQTA 3LGEA 4UTKA 5AHLA 3JU2A 3L0KA 4CD6A 1YE4A 1XDMA 1LOQA 4CNUA 3G24A 2WANA 4L9YA 2FZBA 3GXDA 1XKYA 4RL3A 4KWUA 4ZR8A 3S83A 3NPVA 1PPIA 4H8HA 4D72A 1KXHA 3A3WA 3IJ7A 2QJMA 5HMEA 3B9OA 3NSMA 3MMWA 3W4RA 4AIEA 7REQA 1UP3A 2YFNA 1QOXA 4E5TA 1A5SA 2YDAA 1RVKA 3K1DA 5A2BA 2WLYA 3G1RA 3NIYA 3EX1A 1E0TA 4JHMA 5CAHA 1O94A 4JTIA 4AD1A 2VFIA 4L4OA 3TWAA 2CXEA 1F8IA 3BW2A 2QF7A 2WWDA 3CIXA 3VNMA 1UP2A 3AIBA 2POZA 4HP5A 4IM4A 3N73A 1K9DA 3UR7A 4XZWA 4PH6A 1YYAA 3LQGA 1S3HA 1XIJA 4UTMA 1VGAA 5AY7A 1E4MM 3QV6A 1RH9A 1R3TA 1TV8A 2WMIA 1XIIA 2DSWA 2DUAA 1FH8A 3QTGA 3GO2A 4PB3A 1DIOA 3EEZA 4CD8A 2WSRA 3T0DA 4GIYA 1NP2A 4DJEC 2OOFA 3W0KA 1EYEA 3EDFA 1RPXA 5CAKA 4UNIA 3VI2A 2GDUA 4OBTA 1LG1A 2YCLA 4LT9A 3ZWSA 1W3TA 3BV7A 4JTAA 4ZQMA 2BNJA 4LNCA 1QHOA 2XH7A 1P6BA 4JGDA 3A21A 2J9YA 4O1AA 4E0CA 4OKDA 3LU2A 4GKLA 5IXEA 2RFGA 5G1MA 2XGBA 4C6FA 4LUJA 2FYMA 4DUVA 8TIMA 3WF0A 4FX8A 3L66A 4FLQA 1E1FA 4W7UA 1OFAA 1SFJA 1A49A 1IIHA 1EF2A 3UETA 3IVUA 1HKWA 2ISWA 2XFYA 2D24A 1THFD 2ZUMA 3UJRA 4RZ6A 1LL7A 2BXVA 2XIBA 1IXNA 3DG7A 3A22A 4IMGA 4A8LA 4M29A 1EHNA 1U5JA 4FNQA 3A23A 3F1QA 2PRHA 3L23A 1RAKA 1I0BA 4Y9PA 4ZB0A 3PFRA 3T81A 4W8AA 2PGWA 1R47A 2CZ5A 4ZVJA 4J1OA 4Y9NA 2H3DA 2YL5A 5T9CE 4CCEA 4TVUA 4P8VA 3QPYA 5IHSA 3MANA 1VFUA 4PE8A 3NQ6A 2WC3A 5LIYX 3RFAA 4DJEA 2ZXBA 2RGLA 4Q3MA 3CUFA 1IEWA 3CK5A 5H91A 1AQFA 3O0FA 5BOEA 5JH1A 1H3GA 3EXTA 2HTMA 1AD1A 1G4PA 1TJ2A 3R7MA 1F74A 2HVOA 4CQAA 4GXWA 1B3OA 4JL1A 2D3NA 3SY5A 2PDWA 5DEZA 3UJFA 4DIAA 3WY1A 1FQ0A 3W88A 4H9ZA 3RXZA 1C8QA 4RX0A 2CZFA 3WDIA 4J40A 4R33A 3GSMA 2G3MA 3VFCA 2NWRA 2F6XA 3VUSA 1QBBA 3WQEA 5HQEA 3V36A 2I1OA 3HG2A 4XZHA 4BF9A 1ZNNA 2Y8VA 3S3GA 3QMTA 1XDLA 3B8DA 4O1BA 3ARZA 1H1NA 2O9PA 1ISXA 2BXYA 2BOFX 1WO2A 2ZWZA 4Z2HA 4FF5A 2ZE3A 3DU0A 1NEYA 1TPUA 4QLKA 2C14A 3GWQA 3VOGA 2HSAA 1GHSA 2GWNA 4J5NA 3W7GA 1TVLA 1UUOA 4Q8QA 4TX9A 4EF8A 1YW1A 1A5CA 1H7WA 4CU6A 3JZEA 1W54A 3QQ1A 4LVDA 4L1GA 3NWRA 1V51A 1EWEA 4UTUA 2BZNA 2FLIA 4XUGA 4N0RA 3W70A 1V02E