3UPWA

Pichia stipitis oye2.6 complexed with nicotinamide
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Old Yellow Enzyme 2.6 (OYE2.6), NADPH dehydrogenase
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis
total genus 156
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3upwA00
2DZPA 3CIXA 1ICSA 5AFDA 3NG3A 3EB2A 4BF9A 5G1TA 3MMTA 1DL3A 4XTDA 3GX9A 1CX9A 1TPDA 3G1XA 5KZDA 3VI2A 4N6FA 5D38A 3L5LA 3TDFA 2WNZA 4JDYA 1NFBA 4NX5A 3BARA 3NPUA 4X22A 1FWRA 1EP2A 2Z6JA 1GWJA 2HS8A 5HQEA 3SGUA 4DF2A 2ZA2A 3PB0A 2OT1A 1XCFA 1LOQA 4HSNA 5BMXA 3LCWA 3DFOA 1H51A 3M5ZA 4AHOA 4OU1A 2V0TA 3IEBA 3W7MA 4CLMA 2E6AA 3L65A 3M5XA 4IMEA 4GWEA 4GXMA 3C3NA 3CTLA 1QCWA 3BW2A 4Z0SA 4IX2A 4E38A 4JIPA 1YADA 1TV7A 3MP4A 2CLMA 3DFPA 3SFKA 2PE4A 4NNAA 3OVQA 1WQ5A 2ZBTA 3W9ZA 2NLIA 3O06A 3FKKA 3F1QA 3FA5A 4OQVA 3RFAA 1SW3A 1ZCOA 4UXDA 5HULA 3WK0A 1KM0A 2DZVA 1WOBA 4UMAA 3P81A 5CPOA 3LOTA 4PL1A 4RZ6A 4IMFA 1VLWA 5I3IA 1JVNA 2ISVA 3PWAA 4N4PA 4NNCA 4Q32A 3CEUA 1R46A 3BK0A 3UYCA 1YTEA 3W7OA 5HINA 3K30A 1S5VA 1ZAJA 2C18A 5E93A 1C8VA 4K7VA 3I65A 4NQ1A 2ISSA 2PURA 1N7KA 1TTPA 2DZTA 4HT3A 1YLVA 5D2YA 1AL8A 3T44A 3M5YA 1ME8A 3C6CA 3LI1A 4MVAA 1BWKA 1NSJA 3EKZA 3IIVA 3O1NA 3Q37A 4RR4A 4UNLA 3P8JA 4HIBA 3DKJA 3W83A 3G1AA 1AW1A 1JCJA 4DO6A 2ZZ7A 3P84A 4RCXA 1FWWA 1W5NA 3GDRA 4UUIA 2PRLA 3NVTA 1FXQA 1IXQA 1T8XA 3NXFA 3HQ1A 4N9EA 4UMBA 2QDGA 4O11A 2W0UA 2GVLA 4IMGA 1NAL1 1K3UA 1FY6A 1KFLA 1G69A 4HPJA 2WJZA 4LTSA 4YMZA 4UFHA 3A24A 3TSDA 4P2VA 4O12A 1W54A 4Z1CA 1JULA 2DJXA 1KFEA 3NQ6A 2H3BA 4A21A 3MI3A 3NGJA 4S2BA 4U4MA 4FNSA 3BO9A 3W1TA 4QAIA 5EPDA 1G4PA 5LNRA 1G4SA 3M6YA 1I2RA 3TK7A 4I7UA 4AHQA 3UPWA 1KLZA 3I7RA 3HGJA 1MSSA 3B8DA 4EWND 2YPIA 2ZYFA 3S1UA 3MUXA 1OFEA 4MY1A 1PVNA 1RZMA 2QDHA 1VYSX 4O18A 1LROA 1WX0A 5DCDA 2FLIA 1QPNA 4U28A 1RQHA 3PUOA 1F74A 4GUFA 4K6AA 1W0MA 2VFDA 3HPSA 3PSWA 5H2ZA 1EWDA 4FIQA 4DF0A 3S1XA 4B5NA 3NZ1A 4DO4A 3TUUA 2P0OA 1W3TA 1K8ZA 3HG5A 1F5ZA 3LTSA 5A5WA 3O6YX 4AH7A 5G5IA 1L6SA 3WJZA 4BFAA 1LRTA 1F05A 4FX8A 3W2UA 6TIMA 2JKAA 3TSBA 2GUUA 3G8RA 1H7NA 5D04C 1H7WA 1KBJA 3W07A 1W1ZA 1ZALA 3VKJA 4AWUA 4HN4A 5HWMA 3G24A 4LV9A 1FXPA 3B04A 5DBUA 4ZQMA 3WJSA 3T40A 2E09A 3B0UX 5D2VA 1YXDA 5AYXA 3KVMA 1VCFA 2WQPA 1EUAA 3EWWA 4FXRA 3L66A 3W7LA 3TFCA 4UTJA 2HMCA 4I7WA 3W7NA 2C19A 1T0OA 3GLCA 3BLFA 4LOCA 4CCCA 3TH6A 4UTHA 2ZDRA 1YXCA 1LP6A 5DXYA 4DF1A 3S8HA 2FB2A 1OFRA 1HO4A 1PL9A 4H4IA 1RD5A 1VC4A 3CB8A 4XBKA 3EXTA 3NQ2A 2CLHA 2NUYA 3FJ6A 1M7PA 4MYXA 1TCDA 1LRNA 3OEXA 3QH2A 3TJXA 4GNJA 3GXNA 2A5HA 3R89A 3IV3A 4CNNA 4CCDA 4MOZA 2RDWA 3LTYA 5AC8A 3UWQA 5DN1A 2X1TA 4FHAA 2QEZA 4I9AA 1GVOA 4GJ1A 5EKYA 1Z41A 5F4XA 4BWLA 5HWJA 3NAVA 3E96A 4Z08A 3W3OA 1ZENA 1F73A 1GT8A 2E77A 4YLWA 1UCWA 3B06A 5AYZA 3W88A 3PSVA 5HUOA 5C54A 5I3KA 1XI3A 3UXAA 3ZS4A 4Y9AA 4JTUA 3LTPA 1D3HA 2A7PA 2ABBA 3WFAA 2CLIA 4AAJA 1SO3A 3DFQA 3GR8A 3QPYA 1OFOA 4FIRA 2TPSA 1KM5A 4UTWC 3IVSA 4HNUA 1BKSA 1OHLA 3KX6A 1LBFA 4O57A 3FKRA 5IBXC 1HG3A 4LWWA 5FF7A 3W22A 3NQAA 5K9DA 4IJBA 3AJXA 3F03K 1IXNA 1PV8A 1GTEA 1F6KA 2JBMA 3M0ZA 3W1PA 4HNTA 1XXXA 2YR1A 3S1VA 4O10A 1K02A 4O13A 1WAUA 2TYSA 2QCLA 2HS6A 2Q3OA 1H50A 4WOZA 4Y6GA 3HGRA 3EEGA 1FCUA 4M19A 3SR7A 3ZFHA 3GDMA 3RMJA 1VHNA 3UZ5A 3W7PA 3P7YA 4S1FA 5BW6A 3FLUA 4K8HA 3O8AA 5G2IA 3W23A 5EMUA 3UY8A 1TV8A 1BTMA 3BPWA 1GVRA 1GYNA 5KSWA 1UUOA 1TPUA 2RDTA 3THAA 2X30A 2NUWA 5H91A 4Q33A 1GG0A 2QCMA 4UMCA 5FEZA 1VPXA 3E9AA 3MHGA 4M6PA 3GKAA 4AMAA 3IGUA 2EPHA 3A9IA 3W72A 1Z42A 5CZJA 4JTLA 1TSIA 1TJRA 3FYOA 1YTKA 3W76A 1N55A 3ELFA 2R8WA 3LGEA 3N9RA 1KM3A 4TX9A 3DENA 3OVRA 1H7XA 3UWYA 4PCFA 2H6RA 3R5EA 1MEIA 4XQ6A 4E2BA 1K7XA 3IIXA 3QYQA 4RLIA 3LHVA 1HFBA 1YYAA 3W7CA 1O95A 3W85A 1CW2A 1T99A 2FTPA 2X2GA 2CZDA 3W1NA 1G4EA 1Z44A 3NM3A 4LT9A 3IGXA 2ZA3A 5BNKA 1TJPA 3L67A 1LORA 3M41A 1F6PA 3C2FA 5J5RA 2I14A 1OK6A 3S0CA 3LCGA 3P5YA 5AB3A 2CLLA 4O52A 2YW4A 1IIHA 5AHFA 5C55A 3DFSA 3L21A 2FJKA 1GOXA 1X8FA 5FF2A 5EA9A 2EGZA 3LCLA 2NV2A 1FCVA 4DBEA 1SR9A 4JYFA 1KM4A 3VE9A 5FF0A 1KTNA 2QR6A 3F4WA 3KVKA 4QIUA 1GEQA 3PC0A 3NQFA 3W7HA 1DVJA 3TMQA 3LRLA 1X1OA 3GIYA 3KFTA 4FX6M 4K8EA 4AWTA 3P82A 1VZWA 3PS7A 3QZEA 2ZZ1A 1I2PA 2X1UA 2TRSA 5LSMA 3MI2A 4N02A 4AEOA 1O4UA 1LM1A 2CLKA 4RK8A 5DLCA 3A21A 1VGAA 3G1DA 5TBOA 3TIMA 3TSMA 4WD0A 2RFGA 1EWEA 4ORMA 5SWUA 1K03A 1XFBA 3DKLA 2XN0A 3UWVA 2C1HA 2ALDA 3DHFA 2R14A 1SO4A 5F2LA 4YCPA 3DU0A 1I45A 1DJQA 4YWIA 4UTUA 1JJKA 2E5DA 4JYEA 4O1AA 2J24A 3QMSA 4UFJA 1G67A 4NU7A 4RZ5A 1DHPA 2Q8ZA 5LHEA 3G1HA 3SJ3A 2R91A 4UTIA 5DY3A 3TE9A 1GVQA 4XTIA 3BLEA 2GQAA 5DCBA 2CWNA 3I7QA 3LB0A 4OV4A 3TKFA 2ZZ5A 3M1ZA 5K9XA 4KWVA 4NNBA 1OFAA 1F76A 3BGGA 2Y62A 3TJLA 4NJGA 3LDVA 3C8FA 3SY5A 1TPEA 1B9BA 1PS9A 4Z0JA 2GJNA 4KFPA 3BVJA 1L9WA 4LNYA 1A5SA 2VFHA 3TMLA 2JGYA 1LLZA 2Y85A 5DBTA 2YX0A 3KHJA 1WOAA 4PA8A 3PBVA 4GUIA 4UFIA 3QW4B 2OJPA 2YW3A 5CPLA 1E51A 4QJ1A 3WK1A 5MHBA 1W5PA 2JGQA 2V2DA 3C2VA 3BG3A 1ICPA 3C56A 2CLEA 3OA3A 2NXGA 1I2OA 4MJZA 3L0NA 1DORA 4IPIA 5K3VA 2QCDB 4NVTA 4O4WA 1TPC1 1HL2A 3LI0A 3TU9A 1DV7A 3GYEA 3O6DA 5I3FA 2YYTA 3QM3A 2VC6A 4K36A 1R47A 5DCEA 3TXZA 4AXKA 4Y8FA 4PL2A 4Z1AA 4YL2A 4K37A 5L9FA 3TAOA 1LBMA 1WDWA 5BOOA 2WOQA 3STEA 3FIGA 3NA8A 2X16A 5U7SA 5FEXA 1SQ7A 4O28A 4ORIA 4RZ4A 5C5YA 2FB3A 1W31A 4JXCA 3SZ8A 1LOSA 2DP3A 4MY9A 3GXTA 1EPXA 2BZNA 3UWUA 3DGRA 4MY8A 5CSSA 5LHFA 3S42A 4TO8A 3UNDA 2G97A 2CZFA 1V7YA 3HGOA 4XBSA 2ZFAA 1KTBA 5FEWA 1IF2A 1AW5A 3S1WA 3FEMA 3N34A 1B4EA 4BI7A 1H60A 1SSDA 3DFTA 3W73A 4RKAA 1OG0A 4ZQOA 4ZL1A 3LHYA 4FF7A 1HUVA 3G1YA 4P61A 3NL3A 4MLRA 2CU0A 4GBUA 3LM7A 3VFLA 3W6YA 1PHWA 2QCDA 4O1CA 4WY0B 4NUWA 4LC6A 4JTIA 2UV8G 3I6RA 5F4SA 1XDMA 1FWTA 3V75A 1W56A 1H62A 5DXXA 3W7RA 3NQEA 3LERA 3AO0A 3BW3A 5F1UA 3W87A 4S2CA 5C2XA 4PC8A 5G2HA 2NX3A 2QJHA 3EWZA 3TROA 3NPXA 3W84A 1V5XA 3DH7A 1OFQA 2Y70A 1H61A 5F1VA 3LX9A 2ZRWA 1KM2A 4POCA 1FX6A 3GAKA 3DHDA 1P1XA 3DBPA 4HNVA 2AQWA 4JICA 3CU2A 1MEHA 4JY9A 5HJLA 4JTFA 1LBLA 4AWSA 3ATYA 3R13A 1X7FA 2J9ZA 1QO2A 1P0NA 2G5WA 1TPVA 2FDSA 3IGSA 2Y7FA 3W1XA 1SO6A 1TQJA 1JCLA 1H63A 4MJMA 4KWWA 4TU1A 1Z48A 2QCEA 3E0IA 1KV8A 1G4TA 3DAQA 3Q58A 4QQ3A 3T78A 2Y6ZA 2E1DA 3QEZA 1KM6A 4JDBA 4K39A 3T7VA 1KM1A 3L5MA 1N8FA 4LRSA 3UY7A 3G0XA 3NQ8A 5E1QA 4WQ6A 1EIXA 2YGYA 3CWNA 4JTHA 4PODA 4WY0A 2ZA1A 1QAPA 2Q8LA 5K4XA 1TPWA 2B7NA 4EF9A 2RH9A 3C2OA 1TRDA 3S5NA 4FEZA 1I8JA 1R2TA 1SFJA 4M5PA 1WBHA 2VENA 1OVDA 2GJLA 1FBAA 5D03A 4LVDA 2XN1A 4UTLA 2J88A 1J5TA 4TMCA 1QFEA 3BLIA 2PC4A 1DBTA 1TTQA 2QAPA 2VKZG 1XC4A 2ZTJA 4QNEA 1H1YA 4WX2A 4CNPA 2C13A 1XKYA 3E12A 3QSTA 2YZRA 2Y88A 1U83A 3YPIA 2F7FA 2J27A 3CWOX 5TQLA 2YXGA 2H8ZA 3TW7A 1QPRA 3SI9A 4YCOA 8TIMA 1EB3A 2YFNA 3BV4A 5G1YA 1PCWA 4Y90A 3C2EA 1NEYA 3PUDA 3B03A 1Q6LA 1H5YA 3M16A 4UFMA 3USBA 4WOQA 2NWRA 2YYUA 3T55A 4A22A 1B4KA 3JR2A 4O54A 4JIQA 4ICNA 1XDLA 4O50A 3EX2A 1OX5A 2D73A 4LVBA 3GK0A 4QSHA 5G2WA 3S6DA 3SIZA 5EL1A 4N2YA 1ML1A 4NJIA 5AYYA 1LLWA 4OT7A 4GFSA 3R2GA 1OFDA 3EX4A 3P8IA 2V2HA 2V5LA 2FPYA 5DY2A 1B57A 4FNUA 2B7QA 4UTWA 3M5VA 3BG9A 4MIMA 2BLEA 4LVGA 5IBXA 2C6QA 2BXVA 4BR1A 5LNVA 3ABRA 4IX0A 2JK2A 4M6QA 3B05A 3NNTA 3MO7A 3W7QA 4QM1A 2C0AA 2ZRUA 3HOJA 1RQEA 3E02A 1O5XA 5FEPA 3N19B 3HBLA 2PCQA 2CFFA 1Y0EA 4O8RA 1J2WA 1S5TA 3QMTA 1TB3A 4LS1A 4TMBA 3A5VA 3DI0A 3G0UA 3NQMA 5F2MA 5F2GA 4KFOA 1LZOA 3NOEA 3EWYA 3B0VC 1C9DA 2JKEA 4UCGA 3C2RA 5A8GA 2G95A 1OF6A 2GVGA 3QRHA 2CW6A 1TTIA 1UUMA 2ZRYA 3GR7A 3CEPA 4O0KA 7TIMA 3QSRA 2A1YA 4D2JA 4O53A 2BWGA 3RU6A 3OBKA 3NQVA 3M43A 1JCNA 1ZJIA 3NR0A 3P74A 4XWUA 1XM3A 4AB4A 3HG4A 4DPQA 5K9CA 1VS1A 2QJIA 3L0KA 2O7SA 1P5BA 4I7VA 4O1DA 5LNUA 1H7PA 1KBIA 4CQ8A 4O15A 2VFGA 1ICQA 2VFEA 1G6CA 3HJZA 2CZEA 2GOUA 1LRQA 2FIQA 4NZJA 3GNDA 1JR1A 3G3DA 1EP1A 2QKFA 5K7JA 2LLEA 5D30A 3DFNA 4LC8A 3N9SA 1GG1A 3DXIA 2B4GA 3EWBX 3NPWA 2QCCA 3C61A 4LY8A 2XN2A 1AMKA 5G4EA 1QOPA 3SECA 3P80A 1H1ZA 4IQLA 2E5CA 2KZHA 4QISA 2GPTA 1G7UA 2NX9A 4UR7A 3M7WA 2R94A 2CLOA 3RF9A 3G22A 4MLJA 4CQ9A 1F7BA 4ADUA 1TPFA 3LXCA 3CT7A 1SFLA 4K7YA 5BRBA 1ME7A 2AAMA 3LCIA 3ABQA 3UZJA 3DI1A 4OBTA 3S5YA 5D2WA 3L0GA 5GVJA 3QFEA 1IGSA 1Q6RA 2J9XA 3UXDA 1MEWA 3OVPA 1O94A 2X1RA 4DO5A 3UWZA 1W5MA 1DJNA 4MKNA 3W7KA 1XBZA 2QCHA 1ME9A 2ZZ6A 3NL5A 4JTEA 3TC6A 2C16A 1AG1O 3HPXA 4R33A 1AW2A 4UFLA 4ZZ9A 1OX6A 3KRZA 4LS2A 2AGKA 4JX4A 1QWGA 4O0ZA 1J4EA 1VRDA 4CCEA 4PEKA 2VOMA 3LXBA 5HR7A 1D3GA 3W2LA 1TYGA 2Y63A 1VYRA 3HGSA 4IXHA 4E2DA 1KFKA 3KVLA 4EOUA 3NPVA 3G18A 4JX6A 2V81A 3A23A 5HWNA 1YTDA 1S5WA 3C0JA 3NL2A 1KFJA 3EX1A 3TC7A 4ZMGA 4FNTA 3L9CA 4RJEA 1A5CA 1X6UA 3INPA 4N9CA 2X1SA 5KMYA 1NF7A 3MWAA 5CZSA 3GKFA 1ONRA 5EYWA 4EF8A 1SSGA 2FFCA 1A5BA 4ML9A 1LOLA 2JKPA 1U5JA 4LV4A 1JCXA 3GDLA 2BSLA 2WKJA 4W9TA 5CZ0A 4M7TA 4UTTC 4DBDA 2DZSA 1OX4B 2WSQA 3TA6A 4UTKA 5HMSA 3I7SA 3OG3A 3LLDA 5CZTA 4XUGA 3N73A 2YSWA 2GQ8A 3QW3A 4IOTA 5D37A 2EAWA 3CM4A 2GQ9A 3G1FA 3WJYA 3TQ0A 4NJJA 1TTJA 2E6YA 1EEPA 4FNRA 4BI5A 2H90A 4AHPA 3NM1A 3UWWA 1M5WA 3IRDA 3KRUA 3MP5A 3W86A 1FWNA 1W3IA 1G7VA 2DZXA 1KW1A 4KKXA 1Q3NA 3ZWTA 1GJPA 2W6RA 2WNNA 1YPFA 4A2RA 5I3JA 3LHWA 3D0CA 4AF0B 5DELA 1YDNA 4BI6A 1UBSA 4LW7A 5AHEA 1A50A 3VE7A 1XBXA 2BX7A 1SUXA 2VEKA 4N4QA 5TIMA 1WBJA 5HR6A 2VXNA 3PUEA 4RXGA 2Y61A 3MW7A 4UFKA 3O16A 3CPRA 3KAOA 1ZY9A 3MJYA 3NQCA 2ZRVA 3WK2A 4DQWA 1OX4A 2V82A 1K8XA 3KXQA 3W1QA 2CZ5A 3M44A 5EBUA 1YPIA 3QQ0A 2ZRXA 4HHPA 3NO5A 1F2JA 4A2SA 1IXOA 4X9SA 3IVTA 3SW6A 3PVFA 3M47A 2A7NA 1RQBA 3HPZA 4UR8A 1TPH1 2A7RA 1VCVA 4GC4A 1GQNA 4JS3A 3STGA 5D2TA 4JTTA 1PCKA 4NXSA 3HG3A 4JR5A 2QF7A 1TREA 2Y89A 1QMLA 4NX0A 4QITA 5HNRA 4J9JA 3UPBA 6ALDA 2V8ZA 3NEVA 5D05A 4DPPA 3PAJA 1M7OA 2NXIA 4LU0A 4OE7A 1FQ0A 1KFBA 2W79A 4FB7A 3QF0A 1YXYA 3BW4A 2OMAA 5U4NA 4IPJA 4MFDA 1GTHA 3P61A 1YDOA 3TNOA 4AF0A 1ZAIA 2VELA 1ALDA 2A21A 3NQ7A 2C14A 1ZAHA 4R7JA 5F4WA 5HUPA 3TW6A 3L2IA 3C4UA 4JTJA 1JCMP 5CGQA 2RKXA 3B4UA 1TIMA 3QC3A 4Z1DA 2OX1A 1CI1A 3P67A 3EWUA 3LRKA 1OYBA 3W2KA 2E68A 2EF9A 3MI6A 3LV6A 4HPXA 5CG7A 4GE8A 2BTMA 2GVJA 1FCQA 2NUXA 1VLIA 1M6JA 3MYPA 3PULA 3W2NA 3MBFA 4JNMA 2H8XA 4JTSA 2I1OA 3MHUA 4UIOA 2QUTA 1R2RA 3GVGA 2I9EA 3W7DA 5G4WA 2ZCGA 1R2SA 3IIZA 1JCYA 4L4LA 5K2ZA 3QPZA 1YDVA 4JGDA 2NV1A 4UC5A 3E49A 1L6YA 3FFSA 4K38A 4EVZA 4CNOA 1W3NA 3L68A 1SW7A 1TQXA 5T26A 2WPBA 3WJWA 4LUJA 1I2NA 2VFFA 4EIVA 3PY2A 2QJGA 3G0SA 3LXAA 4TR9A 5FF4A 5KITA 1SZFA 3T4CA 1W5QA 3BG5A 2FPVA 4JYDA 3GDTA 5I3GA 1UJPA 1OF8A 2A0NA 1THFD 4NJHA 4AVFA 4WXZA 3ZR4A 5LNSA 4PFMA 4XKYB 2A6NA 3LHTA 3NQGA 2WSYA 4ADSA 3EX3A 1OFPA 3P62A 5FESA 3P60A 4WUIA 3UQNA 2NZLA 1JQXA 2QAFA 1SZGA 1TMHA 1KLYA 3OHIA 3HO8A 5LGZA 1SPQA 2Y7EA 4C1KA 1OK4A 1MO0A 4RX0A 4HNNA 1GZGA 5D09A 4NXKA 2DZUA 2WSRA 4O14A 1VCGA 1EP3A 1XUUA 1O5KA 1C29A 5CSRA 2ZZ2A 4ZQCA 3THQA 3NDOA 4TIMA 4Y96A 1SZEA 1SW0A 4O19A 4OHQA 2FPTA 2EHHA 4HKPA 2EKCA 5AC6A 3U2OA 2OCZA 1OYCA 1XL9A 2B7OA 1KA9F 3O63A 2QCFA 1DQXA 1A53A 1MXSA 3KOFA 2C15A 1TRIA 5D33A 1SO5A 3R8RA 3KRSA 4C1LA 3MP3A 3UD6A 2V5BA 3QQ1A 1RR2A 4GUHA 4WY0F 4Q4KA 2YCEA 2ZTKA 3PR2A 4XKYA 1DKWA 3W1RA 1DQWA 1EX5A 2Y7GA 3STFA 2OZ0A 4ZQNA 3RNDA 2NX1A 1W5OA 3W1MA 1QDSA 3MYOA 1K7EA 4NJKA 3W7JA 4RXFA 2TSYA 3EX6A 4X2RA 5I3HA 5K4ZA 1DOSA 4DEFA 3NL6A 5LKYA 1JUKA 3ANYA 3W70A 3LCFA 3GB6A 3FOKA 1T96A 4R34A 3H53A 2ZZ3A 3LLFA 1K7FA 2WNQA 4HSOA 2YDAA 5CPMA 3O15A 2PRHA 2ATSA 4MZ8A 4IWWA 1FUYA 2HTMA 4E0CA 3PG8A 4BK9A 1QPQA 1WYIA 2ISWA 2G96A 2ZZ4A 2QCNA 1ZFJA 3O05A 1JQVA 3L5AA 3PBYA 4MUZA 1I2QA 4G1KA 4L4MA 3CQ0A 2V2CA 4MZYA 3GAYA 1SU5A 1GYLA 1SZNA 3CLMA 1BEUA 1NF0A 4WJEA 2A6LA 3PF3A 3LHZA 4LS0A 4UNKA 4ONVA 3SGZA 5FI8A 1OJXA 3DZ1A 3W2JA 4MPQA 1RV8A 3S5OA 1A5AA 3N14A 3U6WA 3FS2A 5LZLA 5AC7A 4A29A 1KTCA 3GNNA 3EXRA 3RK8A 4O4VA 1K8YA 3N3MA 1H7OA 1AL7A 2F84A 4IXXA 4Z1BA 1EUNA 3W71A 4JX5A 2TMDA 3RLVA 1QOQA 5EY5A 4FNPA 5F2IA 2P10A 3R12A 5CKSA 4MZ1A 3TAKA 3H55A 1R30A 1XBYA 2A4AA 1OABA 4NZFA 3NZRA 2DU2A 1Q45A 3N2MA 2Z1BA 3FYPA 2Y7DA 3MBDA 2ABAA 2QUUA 4DELA 1RVGA 3PBUA 3W7IA 2A2IA 3MHFA 4WXYA 1Q6OA 2Q3RA 4OGZA 5AHMA 5L6UA 3TR2A 3WK3A 4NT0A 2H3DA 2V9DA 1Q6QA 3IVUA 1GPWA 1AK5A 3W74A 3PBWA 4ZVJA 1QR7A 2DORA 5FF3A 1L6WA 4DXVA 1VJIA 3S5ZA 4FO4A 2HSAA 1UASA 2OT0A 2YFOA 3PM6A 3EWXA 2ZQ0A 2IQTA 3I68A 3TQKA 3W7EA 3PB2A 5KZMA 3W1LA 1D9EA 3EKLA 2J9YA 3M9YA 4IUOA 5AN7A 3TQVA 2B7PA 1QPOA 3GZ3A 4BWLC 5D2XA 4LUIA 1L2UA 4JTKA 2Z0IA 4IMDA 1VH7A 4N6EA 5KINA 3W7GA 4X3ZA 3HG2A 3Q2DA 2ATMA 2DZWA 4OV9A 5J5DA 2A85A 1LYXA 3ATZA 3LHUA 1TO3A 3JS3A 2QUVA 3ABOA 3QMRA 1EA0A 3VNDA 3TFXA 3IIPA 3LV5A 5LNWA 4UTMA 1ZHAA 3O07A 4JY8A 5LGXA 1P0KA 5KZEA 1JRBA 1WA3A 1VR6A 1PIIA 4PTNA 2NWSA 4LRTA 3W1AA 3LBMA 1P4CA 3PG9A 3A22A 3H54A 4IMCA 4CQAA 3HMJG 1JUBA 2WV8A 3LCXA 3ZWSA 5CPNA 3FJLA 5BMWA 1FWSA 4UTTA 1JUEA 4XZ9A 2ZRZA 3ABSA 3S9YA 3KVJA 1PE1A 1XBVA 4O16A 4ZQPA 1JRCA 1OFBA 2B0MA 4GRSA 2RHGA 1S3HA 1W8SA 1GVFA 1ZNNA 2PRMA 4MFEA 4N9DA 4M6VA 3B0PA 4JN6A 5IM51 2VEPA 3CC1A 3GXPA 4MYAA 3W75A 2P1FA 3TXVA 3U8GA 2WO5A 1H7RA 5D02A 1NVMA 1UB3A 4KFNA 1HTIA 4ALDA 4H3DA 3IIOA 4GUGA 3TV8A 1FDYA 4JEQA 1LTDA 3HF3A 2O7QA 3A5FA 1GVSA 4OWGA 1LCOA 1O60A 3LCHA 1WXJA 1QNVA 4FXSA 2CLFA 5AHLA 1VHCA 3EXSA 2VEIA 4N9BA 3W1UA 1BWLA 3CIWA 4ADTA 5AHIA 4R53A 4GUJA 2C3ZA 3G1VA 3TX9A 3C52A 3LBCA 5ABTA 4O1BA 4H6KA 1VQTA 2J6XA 3BGJA 1OYAA 1FDZA 3P5ZA 4WZHA 2DJLA 3O6CA 5AHNA 3HB9A 3CHVA 4A3UA 3F4NA 1KV5A 3LRMA 4O17A 2XFWA 4PH6A 4FNQA 3OIXA 2V30A 1HO1A 3Q94A 3STCA 5C6MA 2VFIA 4LVFA 4IGHA 3HIJA 1KFCA 1QO5A 5AOUA 1I4NA 1ADOA 3SSJA 3JRKA 3G8EA 3NQDA 4QNWA 1XUZA 2E5BA 2E6FA 2Z2UA 3V1PA 5KTLA 3N2XA 1W37A 1WV2A 4JTGA 3WJXA 4RV8A 5D32A 1VYPX 3W2MA 3G1SA 1IXPA 4ZQRA 1IIGA 2NXHA 1TPB1 4FX7A 2RDUA 2Z6IA 3VCRA 4YXGA 1PHQA 3GDKA 1X1ZA 1MZHA 2E6DA 3RLUA 2VEMA 3NYZA 1TV5A 4LVAA 1B3OA 1LDCA 4JD4A 2FQIA 1FDJA 1RPXA 2QCGA 4M7SA 3TCEA 5E0KA 3QJAA 1FCBA 3G3MA
chains in the Genus database with same CATH superfamily
4UZSA 1RPKA 1ICSA 3OYXA 3JZUA 4G8TA 1DL3A 2Q02A 1O1HA 4LBSA 2VQTA 3G1XA 4KCWA 5KZDA 3VI2A 5KETA 3L5LA 2WNZA 1DJGA 1NFBA 3NPUA 4X22A 4AZIA 3SGUA 3BOLA 3WQVA 2ZA2A 1UD3A 3PB0A 3AHVA 4GXWA 4PSRA 4C6JA 3LCWA 3V18A 1WUFA 2J8FA 3IEBA 3W7MA 4CLMA 2E6AA 3L65A 1RAKA 1K9TA 3PPCA 4IMEA 3WD3A 4GWEA 3C3NA 3CTLA 4XAGA 4E38A 2O4MA 1TV7A 1ONEA 3DC8A 2WZTA 4GPNA 3AU2A 4R88A 3OVQA 4DB7A 1UMLA 3TTOA 2E0PA 1NWSA 5IXEA 4LBUA 3VDGA 3KBVA 4HU0A 3V7PA 4J40A 1A5LC 2WJEA 2KX9A 1XDJA 3EOLA 5CPOA 2BVYA 1TVPA 3LOTA 3WH9A 4RZ6A 1VLWA 2FJUB 4N4PA 4NNCA 1H0GA 3IJ9A 1R46A 3BK0A 1VIZA 3HU7A 1BG9A 1BGAA 1ZAJA 1D7KA 2C18A 4GJJA 5E93A 1C8VA 4K7VA 1BXNA 1S5NA 4GZEA 3WX7A 4V15A 3WZ0E 4HT3A 1AL8A 2NT1A 3BMVA 3M5YA 1QK2A 3C6CA 4MVAA 1NSJA 3O1NA 1SJDA 3VIMA 3RMEA 3P8JA 3W83A 3QTPA 3U7BA 3GS6A 1E1EA 1RY8A 4UUIA 2EPNA 4C6KA 1FXQA 4G5DA 2VDGA 4A8NA 4C7FA 4N9EA 2VI0A 4UMBA 1SYTA 2GVLA 4IMGA 1NAL1 1FY6A 3BJTA 4LTSA 3U4AA 1FHUA 3RPMA 1XYFA 2I5QA 3OLGA 5JBEA 4Q4OA 1WDPA 3EYPA 1P6CA 7A3HA 3SIMA 4GNVA 1KFEA 3NQ6A 1H3GA 1W2VA 2ESCA 4NF7A 2QVNA 1RHCA 3WQDA 3ZLGA 4S2BA 2BY2A 4U4MA 2HVNA 3W1TA 4QAIA 5ABGA 5EPDA 5A6TC 1I2RA 3VNKA 4GO9A 2QJMA 2IXVA 4U3CA 2IPGA 2YPIA 2ZYFA 5C7HA 1XQLA 4F4RA 3CUJA 4MY1A 5AC4A 1GORA 2PDWA 1T6MA 1QPNA 4QLJA 3ZJ6A 1RQHA 2XSBA 1W0MA 1DQUA 2QDDA 1EWDA 4DF0A 3S1XA 4W88A 4B3ZA 1W3TA 3VMNA 5A5WA 3L4UA 2CC0A 4XVEA 4DVOA 1QHZA 2F8QA 5KEZA 2WZEA 2XYLA 1XWYA 1HT6A 4GZIA 4FX8A 1F05A 2OYLA 3VUPA 2JKAA 2PWDA 4JCMA 1H7WA 4UQDA 3VKJA 5JQ9A 4ZGYA 1O66A 1OC7A 3G24A 3ZSSA 2BASA 3OB8A 4M1BA 3B0UX 3CQJA 1AFSA 1TJ2A 2GJPA 2BVTA 3GSMA 1YXDA 1ZS2A 4KRUA 1UZDA 1VCFA 3EWWA 3H7RA 1E5JA 2BMBA 3BSHA 2ZXDA 4EXAA 3W7LA 3TFCA 2CXGA 2C19A 1DWHM 3BLFA 4LOCA 4GY7A 2J77A 1YXCA 1MW0A 5T9CE 3PTQA 4XAZA 3VD9A 1PL9A 4H4IA 1VC4A 3CB8A 3EXTA 4JFWA 1LL6A 2VM8A 1LQAA 5IOBA 2PFHA 3AWNA 1XICA 3A64A 1A3XA 2YCJA 4CNNA 2RDWA 2WJDA 3UPMA 1DTNA 1C3FA 1TX2A 2X1TA 4FHAA 2PBOA 4JKKA 2QEZA 3T09A 1GVOA 5EKYA 1Z41A 4TVCA 4AMCA 5HWJA 3PBGA 3E96A 3R79A 1CGTA 2CKRA 1F73A 4GX8A 2E77A 1BF6A 5AYZA 3WBEA 2G8ZA 3PSVA 3U4FA 5C54A 5I3KA 3ZS4A 3FGCA 1D3HA 5I03A 1PTDA 2QUNA 3AOFA 2FMNA 4ZOBA 2VZTA 3DFQA 3GR8A 3QPYA 3UG4A 1OFOA 1B3XA 4CQCA 4UTWC 3IVSA 4HNUA 1OHLA 1VJSA 3KX6A 5IBXC 3FKRA 3W22A 1FA2A 1C8YA 1PV8A 4WHBA 1GTEA 2XIJA 1F6KA 3QQWA 1GNXA 5CEWA 2YR1A 2VEFA 2TYSA 3M46A 2HS6A 3EEGA 4M19A 1W2PA 3ERPA 4JFTA 4S1FA 1XG3A 1EEXA 2CWXA 1A5NC 4D6FA 3QTGA 4A3QA 4K8HA 3O8AA 5GQBA 2YLAA 5FAJA 1GVRA 4S38A 5KSWA 3THAA 1B54A 5C9ZA 3AS0A 4Q33A 1GG0A 2QCMA 2UZ9A 1HJQA 2QZRA 4UMCA 1EX1A 2FVLA 3GKAA 1XLLA 2VGIA 3W72A 4IZGA 4GYFA 1BXBA 1J0IA 3KL5A 1J96A 5PTDA 3VUSA 3W76A 1GHRA 4NAEA 1XINA 3N9RA 5I79A 1PJ9A 2MNRA 4TX9A 4MWAE 3ZJ7A 2R9RA 2DSUA 2H6RA 4IFRA 2GSEA 3R5EA 5CGMA 1K7XA 3QYQA 2Z2AA 3W7CA 1QK0A 1O95A 1WDRA 1T99A 1M1BA 3GVQA 1Z44A 3NXLA 5BNKA 1TJPA 4R27A 1LORA 2HPIA 3C2FA 3ALGA 3WNOA 3GE7A 1OK6A 2DEPA 3LCGA 2AKMA 5AB3A 1JZ2A 3ITYA 3TOPA 2FJKA 1WZLA 2G50A 1NP2A 4U3AA 2HQAA 4PGLA 2NV2A 1FCVA 1RCQA 1SR9A 4JYFA 4IICA 3RO8A 2J8GA 4INFA 3F4WA 4QIUA 1GEQA 1NH6A 4ZBCA 3NQFA 4GQGA 2W91A 2INEA 3LRLA 1X1OA 4F9JA 1WP6A 3GIYA 4FX6M 1FWAC 4OUEA 1VZWA 2JEQA 5DFAA 1U5HA 1XRTA 1I2PA 2TRSA 3B9AA 3COTA 4NAFA 2WC3A 3B4YA 4N02A 1O4UA 4AEOA 2CLKA 1VGAA 3G1DA 3OZMA 3TIMA 2WBKA 2HXTA 3LLXA 4B5SA 1EWEA 2BGSA 1NP0A 1AD4A 1UUQA 2I5IA 2YIHA 3DKLA 1S2TA 2ALDA 1XV8A 3DHFA 2XIBA 1SO4A 5F2LA 2CHNA 1I45A 1DJQA 4FLRA 1H4PA 1JJKA 2E5DA 4O1AA 2J24A 3QMSA 4CQDA 4YNGA 4Q7IA 1DHPA 1V6WA 3UF9A 3R8GA 4UTIA 4GCAA 1NOWA 3TE9A 1UPPA 3GU9A 4BF5A 4Y2WA 5A1AA 2CWNA 3I7QA 3LB0A 1XIDA 1FKWA 4S3KA 1QATA 2VZOA 3M1ZA 3UCDA 3TJLA 1F76A 2E7FA 3BGGA 3C8FA 3SY5A 3ES8A 4LAMA 3AS3A 3DG6A 4V28A 2GJNA 4KFPA 3BVJA 4LNYA 3CAKA 3TMLA 1LLZA 5CC3A 5BOEA 3GNRA 1WOAA 1KCXA 5LXXA 1OZQA 3PBVA 1D8WA 3UVAA 1OADA 4UFIA 1FFRA 4QJ1A 1R3YA 4GINA 3C2VA 4PR4A 3QY6A 3QR3A 4W4QA 4AXNA 5FJRA 1XR2A 1I2OA 4MJZA 1DORA 4IPIA 1EDQA 3BANA 4NVTA 1TPC1 3SCPA 3H8AA 1HL2A 1VKFA 1XFCA 4KCVA 1GOIA 1E0XA 1T7LA 3QM3A 2VC6A 2WSKA 4NYUA 1DIOA 2FH8A 4CGTA 2CYGA 1SFSA 4Y8FA 4ZOAA 3AAMA 3VZXA 1LBMA 2QPXA 1BAGA 3MSYA 4E5TA 1JD9A 4M82A 2WHMA 4JXCA 4UQBA 1LOSA 2DP3A 1A5UA 3S1GA 1MDLA 4EPDC 5LHFA 3UNDA 1DE5A 1XSKA 3MZ2A 1V7YA 1KTBA 3ZM8A 4FA3A 1E1CA 1DPMA 1UA7A 1H60A 4LF1A 3UJFA 4D6GA 1OG0A 2GK1A 3LHYA 1M41A 4FF7A 4HK7A 3WLSA 3WLHA 3AHYA 3A4WA 4ZA0A 3VFLA 1J10A 4WR3A 3UJEA 4QS6A 4NUWA 3CJPA 2BBFA 3V75A 1O5RA 3OTRA 3W7RA 3NQEA 3RCNA 3AO0A 4QSFA 4S2CA 5TF0A 2YB1A 4C65A 4GH1A 3WIJA 3NPXA 4MNLA 3KBSA 2J7EA 4X9YA 1YBQB 4PMZA 1H61A 1PPIA 5C9RA 3LX9A 3N1AA 4JTDA 1A5KC 5E6ZA 4O1EA 9RUBA 2WJFA 5TAOA 1J12A 4JQ2A 4Q7NA 1XKJA 4JTFA 1HX0A 4E6MA 3R13A 2NSXA 3WD2A 3IGSA 2G4JA 1V8EA 1SO6A 1JI2A 4KWWA 4TU1A 1Z48A 5M03A 3DAQA 1UWSA 4QQ3A 2Y6ZA 1RCXB 3QEZA 2OFJA 3CUFA 1VFOA 1ZGDA 4G7EB 2ZWYA 4YHGA 3T7VA 4S23A 2O9PA 2PTDA 1S5MA 5E1QA 4WQ6A 1EIXA 2YGYA 4PODA 2ZA1A 5DRIA 2BXYA 1ENUA 2RH9A 2Y8KA 2GWGA 2Y2WA 3S5NA 4FEZA 4M5PA 4QDPA 3TW9A 1M9HA 2DT3A 3VC6A 3H2OA 3SRKA 1YW1A 3E0VA 1UD5A 1UD8A 3SRFA 4TMCA 1QFEA 2PC4A 4QNEA 2FGZA 1H1YA 4WX2A 2Q09A 1EXPA 4YHEA 1V79A 3CHEA 3E2QA 3TN6A 4G6CA 2CPUA 3CWOX 2H8ZA 1DWAM 3TW7A 1C7TA 1E15A 8TIMA 3KWSA 3PUDA 4PUJA 3S83A 1V3HA 4Q8TA 1XS2A 4WOQA 2NWRA 4A22A 3U48A 1R6WA 4JIQA 4WIWA 1HGWA 4ACZB 3S2NA 2IW0A 3EX2A 3OLDA 1OX5A 1VEMA 3LENA 4CKQA 3SCNA 2YL9A 3NEHA 4NL1A 5EB8A 1A4MA 4HD5A 3MTWA 3GHUA 4YYFA 2YLLA 3HQOA 4FNUA 1JZ3A 1R87A 2B7QA 3GZAA 4UTWA 5LA2A 3BG9A 1O12A 5IBXA 4F79A 2C6QA 3QV6A 1QXLA 1S46A 3NNTA 4XX6A 1MMFA 1W91A 5C71A 1Q65A 3H7UA 1W1YA 4O8RA 2ZDSA 1EPVA 3FXGA 4YVXA 3N12A 4E4UA 3A5VA 3B8IA 1LF1A 3CL8A 3GC2A 3KOZA 1ITUA 5F2MA 1CXFA 1E72M 4HA0A 4E2OA 3EWYA 5LIKX 3LMZA 4YU1A 4ZO7A 3C2RA 2CW6A 3F7JA 5A6BA 1AA1B 4DZIA 7TIMA 1X6NA 4NZCA 1OCBA 3DN5A 4D2JA 4NAEB 3WD1A 2BWGA 3OBKA 1CGWA 3DFYA 4BHYA 1ZJIA 4QG6A 2OYMA 1GKQA 3PPGA 1H7PA 3QXBA 5I77A 1KBIA 1J8VA 3T4WA 2VFGA 2VFEA 4M80A 3WF1A 1LRQA 2FIQA 1AZ1A 3GNDA 2OVLA 1OD0A 5FSEC 4WDUA 5D30A 3WBXA 4LC8A 1GG1A 3OLIA 5FL0A 3UP8A 3DXIA 2B4GA 4FI4A 3C61A 3QGAC 4LY8A 2R1PA 3TR9A 2A3BA 1JGIA 1QOPA 3ZJ8A 2X1IA 1KB3A 4QJ5B 2CLOA 3RF9A 4MLJA 1NQ6A 4CQ9A 1UR9A 3KBMA 2BOEX 3WKZA 4L6DA 3CT7A 1SFLA 4ATLA 4K7YA 3LUTA 1ME7A 2DQWA 3DI1A 1UQZA 3QFEA 1E4IA 1Q6RA 4OBSA 1MEWA 4PYSA 1PEZA 2POTA 1GOKA 4MKNA 3U0HA 3PANA 1R0MA 2QCHA 2ZZ6A 1BYCA 2D22A 2PDCA 2HJPA 4I90A 1TJ0A 4ZZ9A 3GHTA 5BOFA 1MZRA 1QWGA 2OWXA 1J4EA 1JD7A 4H2HA 4BEUA 4CCEA 4PEKA 1EH9A 4KWOA 5HR7A 1CT5A 3KS6A 1TWIA 1NU5A 5GJMA 2V5JA 2Y63A 2VT0A 3BSMA 4IXHA 4E2DA 3VMPA 3KVLA 4LB4A 1XIHA 4GVGA 2W4XA 1PIFA 1A80A 3A23A 1QASA 4PUDA 2V3EA 4ZMGA 4DWSC 2E9MA 3LU2A 3INPA 3IJ7A 1RCOB 2C0HA 1JCTA 2X1SA 5KMYA 2XISA 1R8LA 1ONRA 2JKPA 2FKPA 1JCXA 3WLIA 2BSLA 4ICMA 1HKMA 2OXNA 2WVTA 1R3WA 4UTTC 5BU6A 2W62A 4DBDA 2WSQA 4MM1A 4UTKA 1CIUA 5HMSA 3I7SA 3OG3A 3H2CA 3O2LA 1YNPA 3VNLA 3WQCA 4HMCA 1NJJA 3CAWA 4XUGA 1VFHA 3N73A 1YPXA 2GQ8A 5D37A 2EAWA 4QG8A 1UMYA 5CJNA 3G1FA 4TTGA 4A3RA 3W6LA 4WEVX 1EEPA 4JTRA 2UY3A 2H90A 3VC5A 3KZSA 4AHPA 3NM1A 2IPWA 3IRDA 3W86A 1FWNA 1G7VA 1EO7A 3ZWTA 4HA1A 4M0XA 5I3JA 4ZR8A 3R0KA 1T8QA 3IWPA 3WNKA 4BI6A 1UBSA 4LW7A 3VDBA 2R6OA 3IS4A 4N4QA 1QI0A 5TIMA 5F7UA 1M68A 1JZ8A 5HR6A 4XBJA 4RXGA 5MKGA 1XIEA 3B8TA 2GK1B 1S39A 2E28A 3NYDA 1XH0A 2WKLA 1MW1A 4I3GA 4Q22A 3NJ3A 3MJYA 4ECLA 2D0GA 2QV4A 3I3BA 2NQZA 1S2CA 3WK2A 1E9IA 2V82A 3KXQA 5I09A 1EJSC 4P8XA 3M44A 3QQ0A 3JZEA 4A2SA 4IMAA 1YNYA 1TPH1 1A5MC 1VB9A 4JS3A 4AWEA 2E9LA 4RE0A 5D2TA 4LUTB 2ANUA 3TQPA 1Y8BA 3C0QA 1TREA 2YB4A 4R9OA 3UPBA 4HK5A 3IAQA 4MKSA 3NEVA 1U1HA 4XO6A 1M7OA 1VEPA 4LU0A 4OE7A 1QNPA 4FB7A 2NVDA 4N42A 2GVYA 3K4AA 5I02A 1YDOA 4GH3A 3VD5A 4W93A 2WHLA 1U30A 3NQ7A 5F4WA 4GIRA 4XKMA 3BZJA 3L2IA 3STPA 2RKXA 3B4UA 1R85A 3MB9A 1M65A 3UG5A 2E68A 2EF9A 5I5RA 3MS8A 2YDQA 2BTMA 2ZIDA 1K8CA 1RK6A 4N0RA 4LPCA 5E6YA 3ONBA 1PTGA 2C71A 1X38A 1F6YA 4JTSA 5HMEA 3ID7A 2VD8A 3SCTA 4IM4A 4WGHA 4DUWA 2ZCGA 3D3AA 2YDRA 5E0CA 3TYDA 2NV1A 3QBUA 4JPGA 5CG0A 1TV2A 3WF3A 5M2FX 4PMRA 3EDFA 4EVZA 3NZGA 4GQBA 3TYCA 3R58A 3WJWA 2VRQA 3VIKA 1GHSA 2VFFA 5LIXX 1F4HA 3BWWA 2QJGA 3ZT5A 4IG2A 4JQAA 3GTHA 4W87A 2HXUA 2P3ZA 1GOQA 4I5UA 5I3GA 4NJHA 3WLJA 2QNEA 3K8MA 4G1NA 2A6NA 3NQGA 4QQUA 5AY7A 3RU8X 5XIAA 1OFPA 4D72A 3P60A 3UQNA 2QAFA 3DEQA 3HV8A 2BOFX 3OOQA 1QW9A 1O1ZA 4X0NA 1KLYA 3OHIA 5LGZA 1MO0A 2VO5A 4HNNA 4NXKA 5BZAA 2DZUA 4G56A 1EP3A 1K9EA 3WNLA 1O5KA 1POKA 3KP1A 1YE4A 1UQYA 5CSRA 5CC6A 3DFHA 7TAAA 3NDOA 1SZEA 1SW0A 5BXRA 4Z2HA 4CD7A 2X09A 5A6BD 5AC6A 3U2OA 1UR2A 4Q4MA 3RLHA 2VUNA 2ACUA 3KOFA 1SVDA 9XIAA 3GM8A 4F2UA 3OU8A 2V5BA 3QQ1A 1E4NA 2VUYA 1UWRA 1WDDA 3PR2A 3C0LA 1GZJA 3CZ8A 1UJQA 1DKWA 5E5CA 1EJWC 3H7VA 2Y7GA 2X0YA 2O0TA 1QDSA 1BVZA 4X2RA 1QI5A 3KBNA 1SR0A 5K4ZA 3TYZA 5LXEA 1DOSA 3ZO9A 3ANYA 3E2VA 1HKWA 2ACRA 4BJHA 1U2YA 5CLTA 3VAVA 4HSOA 5BROA 1ZUAX 1ZSXA 2ATSA 1HZYA 1R7OA 2Q01A 4E0CA 5FCZA 4PB3A 2ZUTA 4H9MA 3EZ4A 1BYBA 3EA1A 2WMHA 2A3EA 5M1TA 4L4MA 3GAYA 1KFWA 1UD4A 1PKYA 4C60A 1SZNA 3PF3A 4PCPA 3SGZA 5FI8A 3OGVA 3QR0A 4AD3A 5BCAA 4DUOA 1OJXA 1J18A 2W27A 1A3WA 2POZA 4LUYA 5J8LA 1RV8A 1ESWA 3GUGA 1A5AA 2XVLA 4CD5A 4JIHA 4AD2A 4A29A 3EXRA 5A8OA 2GJXB 3RK8A 1OT1A 2DUZA 2PDGA 4HZ7A 3M0MA 5ENLA 3VZYA 2WWDA 1A0DA 4Z1BA 3F4DA 1EUNA 1HXJA 2YKKA 1EGMA 1QOQA 3RLVA 1QRQA 4C6BA 1V4YA 4IIFA 3BQ6A 1PZ0A 5C8BB 3H55A 3IK4A 4NZFA 3TCSA 1TR9A 1Q45A 4UZUA 4X61A 1FFQA 2Z1BA 4JFSA 1Q7ZA 1QPKA 4WXYA 5L6UA 1TVLA 3TR2A 1K6AA 1V3LA 5I78A 2V9DA 3T8QA 3W01A 4WLCA 4CN6A 5E0FA 1C7SA 1DJIA 1XD1A 3W74A 4V1XA 3PBWA 3PZOA 4ZVJA 2DORA 1B3WA 3S5ZA 4FO4A 3TN4A 3EWXA 3CMFA 4GIYA 3I68A 5FOOA 4WK9A 3EKLA 3TQVA 1W1VA 2B7PA 4K1GA 4LUIA 4YIWA 3CASA 4IMDA 4GVFA 1EL3A 3KLLA 4M51A 3W7GA 4X3ZA 5A8NA 3HG2A 3Q2DA 2NQLA 1NY1A 4DWSA 3UXIA 3JS3A 2QUVA 3ABOA 1EA0A 3H70A 3TFXA 3CMJA 3LV5A 3MUY1 1ZHAA 4MWAC 4QX4A 3GIQA 1CXHA 3H54A 5CPNA 5I0DA 2DSKA 4UTTA 2X05A 1JUEA 2DH3A 3EA3A 3SQLA 3S9YA 1V3JA 3VGEA 4O16A 4CEXC 4ZQPA 4CVWA 2DY3A 4JKMA 4N9DA 4JN6A 4E2VA 3N3TA 4Z2GA 3UJ2A 5DMNA 4HMNA 3C2YA 4RL3A 1P0BA 1I0DA 3CZKA 3WFLA 1UB3A 2QIWA 3D47A 5T91A 4IIEA 4R85A 4ALDA 4H3DA 1DJYA 4GNKB 5EFDA 3UG8A 3SUVA 3A5FA 1GVSA 4H01A 4OWGA 1LCOA 4H9UA 3NVDA 4B16A 3E1F1 4AIBA 1U33A 2DIJA 3F5JA 2CHRA 5IFTA 1IR1A 3M0XA 1BYAA 3RUBL 1GK8A 4JCLA 1VHCA 3EXSA 2Z24A 2OYKA 3GH7A 1BWLA 3CIWA 5AHIA 1GOMA 1HNYA 2VRKA 2C3ZA 1EYEA 3C52A 1IWPA 3W82A 1EGVA 3BGJA 3A4XA 2HRWA 4J3SA 1MI3A 2DJLA 3CMGA 1GGOA 5AHNA 4IJRA 1CXKA 3LRMA 2BFGA 2IKIA 2XFWA 2DT1A 4PH6A 2G3MA 1GONA 1HO1A 2VFIA 5GPRA 1KFCA 1QO5A 3H4XA 4KT2A 1H49A 1ADOA 3SSJA 4A6GA 3WLTA 2EXOA 3G5EA 2E5BA 2Z2UA 1F3TA 1E73M 1W37A 4FS9A 1W3KA 1CEOA 5D32A 4TOQA 3G1SA 3IGHX 2X42A 2NXHA 3BSGA 4DJEC 1XYZA 3WN6A 4XG1A 5JBFA 4REQA 2VEMA 4JL1A 3AUOA 4C6QA 5DANA 3NYZA 4Q8WA 1B3OA 4Y9OA 2FQIA 3HM7A 2QCGA 1PKNA 4M7SA 4O0QA 5E0KA 2OWCA 3RHGA 2HNEA 4GQ0A 2DZPA 3CH9A 2BG5A 1BTCA 2FTYA 3EB2A 4D6IA 4BF9A 3ZOAA 4KBXA 3U3HA 3MMTA 4XTDA 3GX9A 3PP7A 1CX9A 4DBSA 4QCFA 5D38A 2AMGA 4AFYA 3M0VA 3TDFA 4JDYA 3H4GA 2DIEA 1FWRA 1OZMA 2Z6JA 1VFUA 2HS8A 4DF2A 3W26A 2OT1A 1DWFM 1LOQA 2BS9A 3PHAA 3DFOA 2GGJA 3M5ZA 4QE5A 2V0TA 2INZA 3M5XA 4RV3A 3QHMA 1FOBA 4AX7A 1RLDA 2XG9A 4W85A 1QCWA 5IRPA 1YADA 3GVVA 2F2HA 2CLMA 3GVWA 3SFKA 1AUSL 2XH0A 1E40A 4DO7A 4YTTA 4ZO6A 1QNRA 1JDDA 1AZ2A 1SW3A 4UXDA 2VCAA 4ZO9A 1LT7A 1KM0A 4AY7A 4TX6A 2DZVA 2EPLX 4PL1A 4IMFA 3BCFA 4HOZA 4A8IA 2ISVA 3PWAA 3WF4A 5I3IA 3CEUA 1HP4A 4R7WA 4AIUA 4U10A 1S5VA 2FHCA 2PBGA 4TTUA 4NQ1A 4GZJA 2PURA 4S3DA 3GG0A 2PWUA 1YLVA 1V0KA 1BWKA 3EKZA 4MPKA 3MO4A 3PWIA 4ZFCA 4RR4A 1ITCA 4UNLA 3TTSA 4HIBA 3V0UA 3DKJA 5D4YA 3W02A 1FWWA 1W5NA 4ERIA 1T8XA 3BCDA 4O11A 2P53A 4DJDC 5AECA 3WQFA 4HPJA 3H2FA 5HNNA 1FWIC 2RGLA 4XZHA 1PKLA 4ZTXA 1R38A 6TAAA 1UKQA 5JH2A 4Z1CA 5BRQA 4WSKA 4BA0A 4RW5A 5I7GA 1TUXA 4QAWA 3NGJA 4AVOA 3DYPA 3VZZA 4KWUA 3EAUA 4QGCA 2ISFA 2PZNA 1DP0A 1G4PA 4MSSA 1IE7C 1S3TC 4I7UA 1KLZA 2DFAA 2W92A 5A3HA 1FWFC 5EBAA 1ZQ5A 3VMOA 3MUXA 1NWTA 4AG0A 5RUBA 4O18A 1JZ4A 1WX0A 5DCDA 2P8CA 3I4EA 2FLIA 4GUFA 4K6AA 2VFDA 3HPSA 1RH9A 1HJWA 4Q8NA 4XV0A 4FIQA 4B5NA 3SUWA 1HJVA 4DO4A 1W6TA 3SCUA 5C9XA 3O6YX 1ISZA 4AH7A 4KERA 1S2UA 3AXXA 1L6SA 1TZZA 3QC0A 2DGAA 3W2UA 2PTYA 3UXLA 1BPLB 4HHLA 4PRWA 3F2CA 5JBDA 1KBJA 3T6CA 4AWUA 1F9CA 4HN4A 4NKCA 4LV9A 3ARXA 3WJSA 1K9DA 1TWDA 8CGTA 4L4OA 5AYXA 2ZC8A 4HQVA 4IH3A 4FXRA 3PTKA 3AS1A 4WRHA 4I7WA 4DWSD 1VFFA 3HFYA 1ISXA 1CGUA 4UTHA 3TH6A 3WO8A 2Z2BA 5DXYA 1LP6A 4DF1A 4UOQA 4TQTA 2VVNA 3K1DA 1DXIA 2HVMA 1VENA 3VOJA 3TLQA 1LRNA 3QH2A 4GNJA 3EDJA 3OZPA 5AC8A 3T0AA 3DDMA 1KQYA 2FH6A 2DZAA 4RNHA 3A9BA 1A4LA 2ONEA 5BYWA 4AZCA 4M81A 1EDTA 3R43A 3VM7A 1EZ2A 4H04A 3NAVA 1ZENA 2EJAA 5HBFA 4C5YA 3VD3A 1UCWA 1DIDA 1Z89A 2Y5EA 5HUOA 1XI3A 4GC3A 3KHDA 3TWBA 4GISA 3UA3A 2A7PA 3CYJA 3WFAA 1Q5MA 2UWFA 2CLIA 4AAJA 2OEJA 2DT0A 4FXFA 4C6EA 1R9XA 4BY3A 1KM5A 1ZZMA 4NZ4A 1LBFA 3ECQA 1HG3A 1US3A 3DX5A 1MUMA 3NQAA 3CUZA 4IJBA 4PMNA 2PWEA 1IXNA 4EANA 4MWAA 3R11A 5ECUA 2JBMA 4NIRA 4QRNA 3W1PA 4HNTA 4KGJA 3S1VA 1K02A 4UB9A 4KETA 2VR5A 3GW3A 3N11A 2ISDA 3UG3A 3G6MA 2PZ0A 3II1A 3RMJA 3UZ5A 3P7YA 3R94A 2EPKX 1PAMA 2XGIA 1ZBWA 3W23A 4F0MA 1TV8A 4GI9A 3BPWA 2RDTA 4IIHA 4LYKA 2DT2A 5FEZA 4QR6A 2PDMA 3AJ7A 3MHGA 3JUGA 2EPHA 3A9IA 2QMKA 4QP0A 1Z42A 2DW6A 5CZJA 4E8DA 2GOKA 2REQB 2OSXA 2GWNA 1N55A 5JUVA 3ELFA 2R8WA 3LGEA 1XIBA 3MA8A 1KM3A 2BV9A 3QR1A 1BXCA 1DTUA 3MCNA 1H7XA 3UVIA 4XQ6A 3RO6A 3IIXA 4BS0A 3QHNA 4XUYA 4KESA 1B9ZA 4IQDA 2D69A 3L4WA 2CZDA 3W1NA 3M07A 1E6PA 3IGXA 4LT9A 2WMIA 4NG3A 4IF2A 2FMOA 4KIEA 5CAHA 4Q8PA 3RYSA 3MJMA 4OTKA 4D8ZA 4H8UA 4JN8A 3SCVA 2PWHA 4RDYA 4OKDA 2CLLA 4O52A 2YW4A 1ADSA 3CUGA 1SGJA 3SADA 2B31A 3L21A 5FF2A 5EA9A 1M53A 3BLLA 3LCLA 5C70A 1FHDA 3GXIA 5KZ6A 5HAOA 4IL0A 4DBEA 4DIAA 2YL6A 3MZNA 2GGHA 3VIHA 1KM4A 1KTNA 2QR6A 4GKLA 1CDGA 1DVJA 3TMQA 3MANA 2VDHA 4K8EA 2ZVRA 2WVUA 3VIIA 1B3VA 2ZZ1A 3MKCA 4DJEA 3W4RA 4LF2A 4R7OA 5TBOA 2JFEX 3CTTA 2RFGA 3CLWA 2WKGA 4ORMA 4ML4A 1K03A 1XFBA 1HGYA 4IHCA 3TTEA 4Z17A 3S5SA 5H8MA 2HBVA 2BHZA 4FOKA 4MGGA 4UTUA 3LMYA 2VDIA 3GBDA 4PCTA 2J7BA 5DRCA 3S9ZA 1J0KA 3FSUA 4QDMA 3GUWA 3WDQA 4J3VA 1GVQA 1QT1A 1E6XM 4XTIA 3L7RA 5DCBA 4D6EA 4OV4A 3TKFA 2X41A 3OA5A 1WCGA 5D8ZA 3LDVA 1TPEA 1B9BA 4ERGA 1LUCA 3KCJA 1L9WA 3A4JA 3KEHA 4M3PA 2VFHA 2JGYA 3EOUA 2YX0A 3KHJA 1XSJA 2FZMA 3F4CA 1R3TA 3AXMA 4EXQA 2OZTA 3M0HA 3QW4B 2OJPA 5CPLA 4M56A 2XVGA 4DAFA 3WK1A 1W5PA 1WB0A 3AZRA 2WHJA 4J35A 3BG3A 1ICPA 3EWDA 2RAGA 3WLPA 2F6KA 2VL4A 1GKRA 2V5DA 4B5XA 1W9PA 3WH5A 2DVXA 5IDZA 5LA1A 4O4WA 1PBGA 1VEOA 5FL1A 2RJGA 3TU9A 3EA2A 1JI1A 2NQHA 3TXZA 4AXKA 5LA0A 4Z1AA 1WDWA 5FJOA 3NA8A 3VDHA 2X16A 4M1RA 5U7SA 4O28A 4H1ZA 3VD7A 3WLMA 2FB3A 1W31A 1UWAA 4MY9A 4C6DA 2VEGA 3UWUA 3S42A 3AIBA 4IFKB 4TO8A 2G97A 1WKFA 3O7UA 2CZFA 2PB1A 5BWAA 4ZTYA 2PAJA 5FEWA 1IF2A 1AW5A 4HSHA 3S1WA 1DYSA 5JIPA 4H7ZA 1SSDA 1L6FA 1IT0A 3M4HA 3DFTA 4PMQA 3RX4A 4RKAA 4ZQOA 2QMJA 4L9XA 4DJDA 3G1YA 3NL3A 2CU0A 2PUZA 4GBUA 1ECQA 3W6YA 2DSWA 1VFSA 2QCDA 4CN4A 2EG7A 1XH2A 4O1CA 4WY0B 3K4DA 1PO9A 4JFVA 1UZ1A 4JTIA 3E0LA 3I6RA 3F5LA 1NWUA 1MXDA 1JGMA 3L23A 1FWTA 1I1WA 1AQMA 5DXXA 1BLIA 4U5IA 4CQBA 4XO7A 2VYOA 5AZ1A 2CBJA 2WZHA 5G2HA 2NX3A 1V93A 2QJHA 1V6TA 2VD9A 3EWZA 4GLEA 5CSYA 4PBEA 4GG9A 3UZXA 3DH7A 3ITGA 4TUFA 3WLKX 3ARUA 2FVMA 4GVHA 3GFZA 1LG2A 5EMJA 2BODX 1EA9C 4HNVA 1JPIA 4J3TA 4JICA 3TJ4A 3DUGA 3CYVA 3A3HA 7ENLA 4AWSA 4R5EA 2IMRA 1P0NA 2G5WA 2INFA 4Q4RA 3W81A 4UQEA 1JCLA 2QCEA 4YS1A 4JHZA 2X7WA 1G4TA 3Q58A 2H9AB 1JYWA 3T78A 3AYRA 1QJWA 3CL6A 3DHPA 1VF8A 4JDBA 4K39A 1KM1A 3N29A 4PUKA 3L5MA 3UY7A 1KD0A 1E9LA 4JTHA 1CTNA 1PWMA 1QAPA 3ONCA 1TPWA 1Z32X 3CHFA 3VKDA 4EK7A 5BU9A 2RDXA 1EC7A 3C2OA 1ZLPA 4QTGA 3RRAA 1TRDA 4GKTA 3MMDA 3SO7A 1R2TA 1NFGA 1P7TA 1WBHA 2BY0A 4QJ4B 2VENA 4GVIA 1JAEA 3PK7A 1R3SA 8RUCA 2Z1XA 2GJLA 1O6IA 3NWRA 1P43A 4LVDA 4UTLA 2J88A 2WBGA 2FTWA 2XVKA 4HA3A 1I6NA 1YX1A 3ABZA 4HZ6A 1DBTA 2QAPA 1K1DA 4LY4A 2W5FA 1E6SM 5H8UA 3QSTA 2YZRA 2Y88A 3GVRA 3YPIA 4D6HA 5TQLA 2YXGA 2J13A 3FVDA 2QGHA 3MMWA 1HL8A 4YCOA 2Y5SA 2YFNA 4B4FA 5G1YA 4HCHA 5DT7A 3F2BA 3B03A 4HCDA 3WD0A 1SZRA 3T55A 1AMYA 4PRTA 1XDLA 5I3DA 4O50A 3B3DA 3S6DA 3D46A 3EGJA 3N25A 1ML1A 4NJIA 3N4AA 4H9YA 4GFSA 3R2GA 3EX4A 4F0RA 1E6RA 4PUUA 2E3ZA 2XZ9A 1Q6CA 3UGRA 4LVGA 4AUBA 1PYFA 3SSZA 2BXVA 4HMEA 5LNVA 1AQHA 3BJSA 1W9UA 4IX0A 2OOGA 3W7QA 4B2DD 3U2EA 2OB3A 2VX5A 4DUXA 4EAYA 6A3HA 1O5XA 4QJ3B 2PCQA 2V67A 2CFFA 1Y0EA 2WK2A 4ZO8A 1S5TA 4HVXA 3HMCA 1P6BA 1UWIA 2Y0FA 1JXKA 4I9TA 1L0PA 3BUVA 3NQMA 1H1NA 2C8NA 3RDKA 4ATWA 1JNDA 3TTYA 1C9DA 2JKEA 4UCGA 2W66A 3CV6A 1N8IA 1E5NA 1QNOA 2G95A 4YTQA 1OF6A 3AU6A 3QRHA 4JN7A 1TTIA 3GH4A 2F6XA 3CEPA 4O0KA 3T08A 3WD4A 1KR1A 2A1YA 2O4QA 4DRSA 1MRAA 4O53A 3UR5A 1JCNA 1GOWA 1Q4NX 3KBJA 4RE2A 2CESA 4RE4A 3VOGA 3VYLA 4DPQA 2GQ3A 1VS1A 1VRXA 4KMQA 1P5BA 2NQ5A 4CQ8A 1G6CA 4AD0A 4DJED 4NZJA 2YA1A 2WMIB 2HBXA 3GHSA 4UNIA 3QY7A 2V3GA 3NZPA 1HJSA 3URNA 4XSLA 3EWBX 3NPWA 3V36A 3WLOA 3IJDA 2CBIA 2D2JA 3SECA 3SCSA 5HQMA 3AMDA 2E5CA 4PBFA 3P0XA 4QISA 4UR7A 3R1ZA 4DZ5A 1ZJAA 2V5KA 4HTYA 4EAMA 2OO0A 1F7BA 3T0TA 4PMYA 3LXCA 3UZJA 1KNWA 5D2WA 5FJJA 3J7HA 3CZJA 1IGSA 2VOTA 3OVPA 1O94A 2JIEA 3UWZA 1X97A 3WDPP 4IPPA 3GR4A 1MW3A 4IPLA 4US5A 4ZSUA 4V27A 2AGTA 1Q2SA 1AG1O 1SM9A 2BP1A 3HPXA 1UC4A 4H00A 2XINA 4LS2A 6REQA 3TEVA 1MNZA 2VOMA 1Y5VA 3LXBA 3E3HA 1T40A 4HOXA 1EC8A 3W2LA 1V0NA 4DYJA 4PE8A 1VYRA 3HGSA 2I17A 3NO3A 3AXHA 4EPKA 4AD4A 2V81A 1NDYA 1PX8A 5HWNA 1S5WA 3C0JA 4JOMA 1KFJA 4XIMA 3ARZA 5I24A 3TC7A 1LUCB 5CCZA 5DF0A 3GQYA 4JQ4A 1A5CA 1KRAC 3WBYA 3MY9A 3LYEA 1F3XA 2VJXA 1NF7A 3MWAA 3GKFA 4EF8A 1SSGA 1BHGA 4CUCA 1OGGA 1U5JA 1KCZA 4KGLA 1A0CA 5CZ0A 1JL8A 4XK2A 3AS2A 4NRSA 2Z28A 2DZSA 2XGZA 3AALA 3N18A 3LLDA 2YL5A 5CZTA 3I4KA 2BGQA 3KUMA 4H8VA 3B97A 4WJ8A 1CZ1A 3A47A 3WJYA 4J5NA 3CB3A 1ZTVA 1TTJA 2ICSA 2E6YA 2PDYA 2XIIA 4M29A 3HFTA 3H12A 1LQ0A 1PXGA 4W5UA 1JDCA 1M5WA 3MP5A 3N17A 4HHMA 5FJTA 3POCA 3W53A 4WJXA 2YZ5A 1KWKA 1W3IA 2QGYA 3B8WA 1Q3NA 3THUA 1U5VA 4B5UA 3AC0A 3LHWA 4QLKA 3D0CA 4AF0B 1K77A 5DX7A 2UY4A 5AHEA 1A50A 1S2AA 4IGSA 2BX7A 3EMZA 5E09A 1UR1A 1FP8A 4HU3A 1WBJA 4FAMA 1BF2A 3MW7A 3O16A 1XLGA 4IIDA 3CPRA 5GNXA 3AYTA 3NQCA 3VNMA 2ZRVA 1E0TA 4DQWA 1OX4A 2MANA 3LM3A 2Z7KA 2CZ5A 2BGNE 3MQTA 2OQLA 4NY2A 1F2JA 1IXOA 2E8YA 3PVFA 4AZHA 4UR8A 2A7RA 5I07A 2OLSA 3TP4A 3STGA 2WANA 4HK6A 3P6LA 4H9VA 2ZXQA 2AL2B 3OIHA 3VDAA 1PYMA 4PFHA 4NX0A 5HNRA 3NDZA 1FKXA 4C1NA 4UOJA 3SQMA 7ODCA 3WH7A 4E3VA 2FVKA 2ZE0A 4GI4A 1EJVC 2OMAA 4MTVA 4IPJA 4MFDA 4PTWA 1GTHA 1OIMA 3BDKA 3P61A 2WSPA 2VELA 5A95A 4FR6A 1UIOA 3BMWA 4XZWA 2QF8A 1Q8AA 1ZAHA 1K9FA 1MQRA 3E5BA 3FVMA 2V69A 4JTJA 5CGQA 1KXQA 1OSEA 3GHRA 4ZEPA 1NTHA 3QC3A 4LFYA 1CI1A 3P67A 3EWUA 2PTWA 3MI6A 4XZMX 3LV6A 1Y5WA 2YCLA 5CG7A 4GE8A 2NUXA 2D20A 1W8GA 3PZIA 1L2QA 4GQQA 3PULA 4GIEA 2XM2A 3MBFA 1NDWA 2I1OA 3PNUA 1R2RA 3ARPA 2NSOA 3W7DA 5G4WA 3CUXA 2QV5A 3MPGA 3SBFA 4JBRA 1OGSA 3S2LA 2VNCA 5K2ZA 1HJUA 1YDVA 3AMGA 3I3EA 4LCSA 5G1MA 1E6NA 4ZE4A 4JIEA 3E49A 1L6YA 3L68A 1SW7A 3VCCA 2VZVA 3NGFA 4UCFA 3U9IA 1PSCA 4LUJA 1I2NA 3S47A 4H83A 3CO8A 1HVQA 2XHYA 5KITA 1G9HA 3RM8A 3T4CA 3U2CA 4AVFA 3RR1A 4WXZA 3ZR4A 4XKYB 1BQGA 4ADSA 5FESA 2Q6ZA 4WUIA 4XZLX 4AYGA 1SZGA 1UR0A 1SPQA 2OGJA 1CYGA 2Y7EA 3RR4A 4RX0A 3WLNA 4NI3A 2V6AA 3GH5A 3WDJA 4EX4A 3SY1A 4O14A 4QS5A 3FCPA 3EDKA 2W61A 2WVVB 1SJAA 3PTMA 3VABA 4Y96A 4Y9NA 4M8UA 3DERA 2FPTA 4HOWA 4L1XA 1IEWA 3I10A 3SAZA 2AKZA 1HKJA 3BLDA 2J79A 3WEOA 2CEQA 1NWRA 1KA9F 4FALA 2QCFA 3URQA 3ZLHA 1MXSA 1XLJA 1QBAA 1TRIA 4GYJA 1GQJA 2UY5A 2VGBA 4GY0A 1RP9A 1RR2A 6XIAA 2C7FA 3LS9A 1DQWA 4D9PA 4HPNA 1E0VA 3EPMA 3UU0A 3EB4A 3W1MA 4C7GA 1NM9A 3W7JA 2TSYA 2TODA 1TA3B 4GOAA 3NL6A 1JUKA 3W70A 4LUSA 1G5AA 3LCFA 3GO2A 1PZ2A 3FOKA 4PMDA 1ISYA 3SY8A 3ENLA 1K7FA 1ZP4A 5CPMA 4PTVA 1QNQA 1PX3A 4GI6A 4DBWA 5D8WA 4A05A 4BQ5A 1FUYA 1FH8A 3IJ8A 3BAJA 2ZZ4A 2G96A 1ZFJA 3O05A 1ODZA 3PBYA 1I2QA 1TUFA 2XH2A 8XIMA 5A8MA 2J7DA 4W8LA 2OSWA 1GYLA 1FWDC 3LHZA 4US5D 4LS0A 4AEFA 1C8QA 4IPNB 3AMCA 4IISA 3DZ1A 3W2JA 4XD6A 1E6QM 4L61A 4FMVA 2PLCA 3GNNA 1QHPA 3U7VA 3SCQA 4O4VA 1P6WA 3CV7A 1K8YA 2ZWZA 3N2BA 3N3MA 1H7OA 1ZBVA 3BLKA 3NO1A 4I5XA 1FWBC 5EY5A 5F2IA 2P10A 2PTZA 3LSCA 2E67A 1W1PA 1E56A 5ABEA 5JIWA 3NZRA 4MMWA 1J93A 2BB0A 3I6TA 3PBUA 3PZTA 2ZE3A 1BSIA 3WDIA 2DPEA 1REQB 3AIRA 5BWFA 3MHFA 1Q6OA 3L2LA 4W7WA 5AHMA 4L6HA 4NT0A 3OODA 3IVUA 2DVUA 3WMBA 4MB1A 1BFNA 3KOXA 4MNKA 5FF3A 1ITQA 3HURA 1JDEA 1X6LA 2HSAA 3PM6A 2G3IA 3N4FA 4BZYA 2ZQ0A 2BY3A 1TX0A 1LQ2A 2IQTA 3TQKA 3DOPA 1D9EA 2ZC1A 4ZB0A 3V1HA 3M9YA 2OLAA 4IUOA 2HCVA 3R10A 5AN7A 1GVIA 7REQB 4BWLC 4PMUA 1L2UA 2ZXBA 1TWZA 1V02E 4B9ZA 4AIOA 3TN3A 1IWBA 3WLLA 4QE4A 3OQ8A 4P8VA 3OW1A 4NRRA 5A6SA 3AXKA 1LYXA 1SJCA 3B9OA 1OD8A 3T42A 3LHUA 1TO3A 3QMRA 1Z6KA 4ROPA 4TV6A 3IIPA 3L2MA 1RD6A 5TNVA 5KZEA 1WA3A 1VR6A 4Q8MA 3M0KA 3A12A 2NWSA 3PG9A 4RNFA 3HMJG 3EMQA 1L8PA 3ZWSA 1KR0A 4H9XA 3FJLA 1KBBA 5BMWA 5HMFA 1CPUA 2Y8VA 4OBRA 2I9UA 4GCXA 2F2KA 2ZRZA 4DN1A 1NOFA 4JHMA 4L7ZA 1W8SA 2E1WA 1GVFA 1ZNNA 2ZICA 4MFEA 4M6VA 1VAHA 3B0PA 4GX9A 2VEPA 1R7AA 4K2SA 4Q4QA 2PGWA 2TAAA 2P1FA 1E9YB 2WO5A 2PDBA 7XIMA 3U2ZA 1UPMB 2WXDM 4GUGA 1C9WA 3ZR5A 1FDYA 1JPMA 1LTDA 4CD4A 1O60A 1XLCA 3LCHA 3V4BA 2PU0A 4C5ZA 5I00A 1QNVA 1ODUA 1YE6A 3CQIA 4FXSA 4ZFMA 3A4AA 1ELSA 1KQZA 1BKHA 3W1UA 4RNIA 1KBKA 3LPOA 1J01A 1DXEA 4GUJA 3VM5A 3G1VA 3NDYA 3BE7A 4TV5A 3MCOA 3WBWA 4HU8A 3V0SA 1E55A 1ZJBA 1P0DA 3WL0A 3N04A 3OQEA 2GL5A 3HB9A 4C1NB 3F4NA 2PDHA 1KV5A 3ISIX 4XD4A 4O17A 4GZ7A 3T9PA 1M7JA 2V30A 5C6MA 3PN8A 4LVFA 4IGHA 3HIJA 2PODA 1PDYA 1WAWA 3VINA 3GTXA 3JRKA 1XUZA 3V1PA 4AEEA 3PZUA 3TTQA 4LYRA 2Z6IA 2CZVA 3VCRA 1MZHA 2E6DA 3RLUA 4WVXA 2WM1A 1X1NA 3AISA 2R1NA 1LDCA 4JD4A 4DNMA 4PTDA 2FFIA 3ANVA 3M6DA 1FCBA 3G3MA 1CCWB 4C6LA 3N2CA 3PJUA 3WDHA 4KH2A 3AZSA 1J0JA 4V2XA 1G0CA 2YA0A 1TPDA 3R0UA 1C92A 3L4ZA 4N6FA 3S2MA 5A94A 3EBVA 2ODOA 2Z1SA 1XHGA 1YEYA 1U1JA 1XLFA 2XIMA 4DAIA 1KXVA 4NX5A 3RCMA 2EO7A 3BARA 3NSMA 4FLQA 1EP2A 4IFOA 1OBAA 5HQEA 2D1ZA 4I5RA 3R25A 4LAZA 5BMXA 3AHTA 1UP2A 2PDUA 4OU1A 3WUBA 1X8CA 3BAKA 3GYCA 1SFTA 4KIRA 3BAXA 1GOOA 1WNOA 4PZVA 1TZ7A 3BW2A 3UJSA 2EG6A 2V63A 3GFXA 4JIPA 3PFRA 4U2ZA 4QDWA 4F48A 3DFPA 3G77A 3N15A 1TMLA 1WQ5A 2ZBTA 1M01A 1H09A 3W9ZA 1JIBA 3H21A 3O06A 1XYMA 3N6QA 3FKKA 3KCOA 3FA5A 4OQVA 2GUBA 1ZCOA 5HULA 3UA4A 1WOBA 3W00A 3SFWA 3QOMA 5I23A 1JVNA 2RUSA 3IK2A 1YTEA 5HINA 1RBOB 2OODA 3T2OA 2JF6A 2ISSA 1KO0A 1YHTA 5CBIA 2DZTA 1XYBA 3K2GA 2WCGA 1EJXC 3LI1A 2W3ZA 3IIVA 2GJRA 4CD6A 3G1AA 1FWHC 3CAVA 4C6IA 2YBTA 4RCXA 3GDRA 2PRLA 1EBGA 3GC4A 4CEUC 1AQFA 2QDGA 2DH2A 3QLDA 4NILA 2ZX6A 4H8NA 1G69A 2WJZA 4YMZA 5HMDA 4UFHA 3A24A 2PWVA 4A3YA 1ZCCA 1W54A 2PU1A 5CAKA 5HANA 8A3HA 1YKWA 4WSHA 1TIWA 1M7XA 3WUEA 2H3BA 4X63A 1W1B1 2PLKA 3H6OA 1LT8A 3MI3A 3ARVA 3BO9A 2Y8UA 5LNRA 1G4SA 3M6YA 3TK7A 2PF0A 1ZB5A 3I7RA 3ORWA 1MSSA 3B8DA 1CLKA 4L1GA 3RG6A 4EWND 1Y65A 2VC9A 2HDJA 3S1UA 1D3CA 5IHRA 1OFEA 1UH2A 1PVNA 1RZMA 1VYSX 3BLPX 3LD5A 1CGYA 3PUOA 1F74A 2PA6A 4QE1A 5D9PA 5EMLA 1BWVA 1NDVA 1V51A 2GDUA 5BXTA 2Z1VA 3NZ1A 4B5WA 3MKVA 4W5ZA 2P0OA 4L1WA 1K8ZA 3HG5A 2QYGA 4GA8A 1F5ZA 3LTSA 4Y9MA 4AIEA 3AIEA 4B9YA 3DC0A 5A8QA 1OT2A 2WCAA 2QUMA 3O9NA 2HE5A 4BFAA 4P7RA 1LRTA 1QVBA 5A69A 5FAGA 3BICA 1H7NA 5D04C 4PSPA 3IJ6A 2AQOA 1ZALA 5HWMA 4AD1A 3B04A 4ZQMA 3TWAA 3T40A 3FGCB 6CGTA 3KVMA 1EUAA 2PDNA 3TLLA 3L66A 3PZQA 2HMCA 1UOZA 1QI2A 1MXGA 2Z26A 3WUGA 1XIJA 2FB2A 1OFRA 1AODA 2YJQA 4F2BA 4XBKA 4JFUA 4QHRA 1JDAA 4GYPC 4F40A 3KL0A 3NQ2A 2NUYA 3WG6A 1M7PA 2Y5JA 4MYXA 1TCDA 1GVYA 1KGUA 1IEXA 3R89A 3HZ3A 4PN2A 1AH4A 1TG7A 2VP8A 3CIVA 3UWQA 1JFHA 3SM0A 3HQPA 3O0KA 5JVLA 4I9AA 4XIAA 1IQ8A 3K5XA 5F4XA 4BWLA 4Z08A 4A3HA 4CU8A 1GT8A 4E8GA 1HP5A 1HQTA 1S38A 3UXAA 5DMYA 1DJZA 1HKVA 4PRRA 4HA4A 5FACA 3AFBA 1XGEA 4UTFA 3IPWA 3PZVA 1Q63A 1EHAA 1FP9A 4O57A 4LWWA 4AX6A 4H6RA 1I1XA 3AJXA 1PWLA 5REQA 2VWSA 9XIMA 3M0ZA 4JTQA 3FJ4A 2GUYA 5HOSA 3QPEA 1XXXA 3G2GA 3VKBA 1EJUC 4Y6GA 1UIPA 3HGRA 1FCUA 3VX0A 3SR7A 3ZFHA 4RDVA 4UQ9A 3GDMA 1VHNA 2VRJA 5TD4A 4X2PA 3V5FA 1B0IA 5BW6A 3KTCA 3C0SA 3CHCA 5EMUA 1UUOA 1TPUA 2NUWA 5A2AA 3B9NA 4YYCA 3PPHA 1KRBC 2NLYA 5H8PA 1F3WA 3IGUA 4DI8A 1TSIA 1TJRA 4JAWA 2BDQA 1YTKA 5EMMA 1OCNA 4AC1X 1T41A 4XAPA 1HJXA 3GDBA 3DENA 3OVRA 4NAFB 3UWYA 4J7RA 4PCFA 4LJ3A 1MEIA 2WNWA 2HK1A 4RLIA 1W32A 3B8VA 3EOSA 1CW2A 3ZVHA 1CBGA 3MUAA 1G4EA 3NM3A 1LG1A 3C5QA 2ZA3A 1I9CB 1MWOA 4OJYA 3RPTA 1V6XA 5J5RA 2HNHA 3QY8A 2CHOA 1FVPA 2PD5A 4GHRA 1RA0A 2I14A 3S0CA 2A3LA 4ZB2A 3EKGA 4NASA 1IIHA 5AHFA 5JXQA 3N4EA 3L4YA 2ZUUA 1Y5XA 5AKQA 2VCCA 3E74A 3FAXA 2BVDA 4XSMA 1R9YA 4H2CA 3O0FA 5HQLA 1J5SA 5FF0A 3WENA 3KVKA 4W8AA 3PC0A 3W7HA 2P5NA 3WF0A 5MF5A 5M17A 1EJRC 3L4VA 4AWTA 2WPGA 3P82A 3QZEA 1UWTA 2X1UA 3FDKA 5LSMA 3APTA 1LM1A 4D6JA 4M6UA 2VVSA 2WM0A 3SUUA 4ASTA 1WXZA 2XN0A 3UWVA 4JHOA 2R14A 5D9MA 1XF0A 4IQJA 3KTXA 1WE5A 4NU7A 4Z2JA 2P3EA 2Z1WA 3UYIA 2Q8ZA 2R91A 4S3AA 2WLYA 3S4TA 2ZZ5A 4B90A 1OFAA 4NJGA 1M03A 4JTAA 4AISA 3IJIA 3MV01 1PS9A 1A5SA 4Q8QA 3UCCA 2VX6A 4PA8A 4LYQA 1KRCC 1J11A 1E1CB 4HYVA 1O5QA 2XVNA 2J62A 4GUIA 2YW3A 3Q45A 5MHBA 2JGQA 1LWHA 2FZDA 2CLEA 3OA3A 2NXGA 5M3WA 2YA2A 2IKHA 5A6MA 5I3FA 4WCJA 4GYKA 2FZBA 1R47A 5DCEA 3K8KA 1S1PA 4PL2A 4YTSA 5HNUA 5EGRA 2AL1A 1RBAA 3TAOA 5AVHA 1XPGA 2WOQA 3STEA 5FEXA 3RX3A 4ORIA 5C5YA 1JPHA 3GXTA 3MVIA 4QLLA 4Q4SA 4P7LA 3VIPA 2EG8A 5HPOA 3DGRA 4IIBA 3BGAA 1RJRA 3BURA 3B40A 2Y24A 3EEZA 2V3DA 3P2VA 3N6JA 1PKMA 2D3NA 5AVNA 1XIMA 1PZ3A 3FEMA 3VKCA 1B4EA 4D71A 2DUAA 3JW7A 3LNPA 1ZBCA 4WDTA 1HIZA 4P61A 4MLRA 3S3GA 3LM7A 1FHVA 5J04A 2HROA 1O7AA 3NIYA 3UT0A 4LC6A 4W7UA 4EE9A 4BQ3A 3Q4DA 3LERA 3AIQA 2F61A 2FZ9A 3BW3A 3HQNA 3LG3A 3MSRA 4WKHA 5EFFA 5F1UA 3RITA 3DBNA 5C2XA 3TONA 4PC8A 4DHGA 3W84A 4FOUA 1V5XA 5BRPA 1OFQA 1FRBA 5F1VA 4WSJA 3TYAA 3M0IA 3PZGA 2D3LA 4AD5A 1P1XA 2AQWA 1VBRA 3CU2A 1E70M 1QO2A 3W1XA 4CD8A 1TQJA 4MJMA 1NDZA 1PIGA 3VU2A 3H2MA 1UZHA 4GO8A 2E1DA 3CL7A 3SEPA 2SFPA 4GQRA 4D8LA 4LRSA 1N8FA 3B8SA 2XZ7A 3CWNA 1W1IE 3AROA 4C6OA 4OIFA 2Q8LA 2XIQA 1CWYA 5DT5A 1GUVA 3BH4A 4EACA 1SFJA 2OLHA 2XH7A 1OVDA 2W9MA 3VOHA 4DNHA 1FBAA 1YBQA 4B3KA 1J5TA 5IDIA 6XIMA 3O6AA 3BLIA 3AYSA 1XC4A 4IUGA 1EOKA 1XKYA 2NQ9A 3KS5A 4GXPA 3KOWA 3LQLA 2PDXA 4GYPA 4QCEA 1OEPA 3DYMA 3RXZA 1U83A 2F7FA 2J27A 4FXJA 2HZGA 3PWGA 4BEQA 1QPRA 3LBOA 4PMXA 3SI9A 3S9IA 4ROQA 2ASHA 1XLKA 1EB3A 2D2GA 3C2EA 1I60A 1NEYA 2PSNA 4G7EA 4KS0A 3URBA 1H5YA 3M16A 2VWTA 3USBA 2VR4A 3NQBA 2YYUA 1B4KA 3HA1A 4O54A 5ECVA 4ICNA 4H9ZA 4HHHA 1PUDA 1GKPA 3LPPA 2XH4A 2D0FA 3B9EA 4TVUA 2D73A 2Q71A 4QSHA 2Z7GA 5G2WA 1FH7A 4N2YA 1LLWA 2OKOA 3BCJA 3DGBA 3P8IA 3JU2A 2V2HA 5DY2A 1B57A 1V6YA 5REQB 2BLEA 1OCJA 2ADAA 3AUJA 3UNTA 1ONXA 3MDWA 4PCSA 3FEQA 4K1WA 5CZKA 3KBWA </