3UPWA

Pichia stipitis oye2.6 complexed with nicotinamide
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Catalytic Characterization of Pichia stipitis OYE 2.6, a Useful Biocatalyst for Asymmetric Alkene Reductions
doi rcsb
source organism Scheffersomyces stipitis
molecule tags Oxidoreductase
molecule keywords Old Yellow Enzyme 2.6 (OYE2.6), NADPH dehydrogenase
total genus 156
structure length 404
sequence length 404
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3upwA00
3GXPA 1XBVA 3LGEA 2QJIA 3GDMA 2DZPA 3M5YA 3EXSA 1DJQA 3QRHA 3LRLA 4AWSA 2VKZG 1H7OA 2CWNA 2VEIA 1MEHA 3DXIA 4JXCA 4MYAA 2GUUA 4LC8A 3W7MA 4WJEA 3P82A 3TSBA 3NDOA 2PURA 2ZZ5A 1G4SA 3AO0A 4N9CA 1MEWA 3W7PA 3CHVA 4YWIA 1RD5A 2ZZ4A 4FB7A 2V0TA 4PL2A 2Y7DA 4IPIA 3B0PA 3W07A 4Q33A 1H7PA 4HHPA 1D9EA 4MZ8A 3QH2A 4NT0A 3QMSA 5BNKA 3L0GA 1VCVA 2A5HA 3M5ZA 4K37A 4IWWA 3U2OA 3W23A 3G3MA 3D0CA 4AF0B 5DCEA 3RLVA 3EKZA 2VFEA 2NUWA 5G2IA 3TQVA 4LUJA 3HPSA 4TMCA 1ZAJA 2I9EA 5L9FA 3L21A 3TC6A 1OX4B 2WSYA 3FJLA 3PSVA 2A6LA 4S1FA 1TV5A 1QWGA 4XTDA 4KFOA 2HSAA 3Q94A 4N6EA 3W7RA 4ML9A 1HTIA 3MHFA 4MLRA 1X1ZA 1J5TA 1QDSA 3A23A 3PULA 4JTTA 4MLJA 3QQ1A 3KAOA 1F76A 3LCIA 1P5BA 5DELA 3M16A 5F2MA 4LVBA 4GFSA 3TIMA 4E2DA 2C1HA 3DBPA 1KA9F 3CEPA 4EF9A 3HG4A 4A29A 3W1PA 3DHFA 4UTLA 3FKRA 4MVAA 3I7RA 2ZTKA 4K7VA 4TU1A 3G1XA 1W1ZA 1OFAA 4YCOA 4JYFA 1ZY9A 3UWQA 1B4EA 1EIXA 1KFEA 3KRUA 4JGDA 4EVZA 3W1AA 3C8FA 5EA9A 8TIMA 2DU2A 4DEFA 4HNNA 1WYIA 4RXGA 4UTTA 4ZQNA 3WK3A 3W7JA 3FKKA 1TMHA 2B7NA 3H53A 4QNEA 4DELA 5CZTA 1SR9A 1O5KA 2NLIA 5TQLA 4E2BA 3W73A 4CQ8A 3I68A 2QR6A 3C3NA 2ZCGA 3UD6A 5HINA 2YYTA 1MXSA 3L2IA 4ONVA 1XBYA 4UIOA 4UC5A 1GYLA 4FX7A 4Z1CA 1CI1A 3LLFA 1QFEA 2CLKA 5FF3A 3Q2DA 2ATSA 3NPXA 3A5VA 3PUDA 2RKXA 1JULA 2FQIA 4TO8A 4HPJA 2I1OA 1SW7A 3M6YA 1D3GA 4I7UA 4NXKA 2H3DA 1FUYA 3B06A 5AC8A 1WQ5A 3DFSA 2E5BA 3LHYA 4NQ1A 1UUOA 4JR5A 1R2SA 1ZJIA 4O1CA 3MHGA 2H3BA 2HTMA 3NL5A 4N02A 1PE1A 2JKAA 4LVFA 2VEPA 3B03A 1FDYA 4JICA 4OBTA 3BGGA 5HJLA 2YCEA 5HMSA 3KFTA 1SO3A 4LUIA 1WX0A 2QCLA 2WO5A 5IM51 1EEPA 4GWEA 2H8XA 2ZTJA 2E68A 3G1HA 4KFPA 2ZA1A 3GDKA 5D38A 3GXTA 3R12A 4JX6A 3EXRA 1TTQA 1NFBA 5AHIA 1ICQA 3L67A 3W2LA 3W7HA 5HWMA 4QAIA 5G4WA 2O7SA 3QW3A 5GVJA 1H60A 3S42A 4QSHA 4FXRA 1N55A 4A21A 2Y70A 1U5JA 1UJPA 2H6RA 2Z1BA 3HG5A 3EKLA 4PA8A 2PRMA 4OE7A 1JCMP 3S8HA 3MYOA 4Y90A 3W71A 1YXYA 3DFNA 1RQBA 2GQ8A 4DBEA 1UASA 4DF2A 4ADTA 4RZ4A 3TJLA 3LLDA 4YCPA 3RLUA 3UPWA 2P1FA 3LHTA 5DY3A 5D09A 3BPWA 4TX9A 2Y85A 1NF0A 1KFLA 1SSDA 1MSSA 4DF1A 2TRSA 1W5PA 5HQEA 1TTJA 1DVJA 4O18A 1D3HA 3T55A 4EWND 4M6VA 5FF7A 4WY0B 1LP6A 2QUUA 5I3JA 3PWAA 1OFDA 3THQA 2V30A 4O19A 2ZRYA 4JTSA 4A22A 2R94A 2QCNA 1GQNA 4IUOA 1FCQA 5HWNA 2NXGA 3M9YA 3PVFA 2QCEA 3I7SA 5HULA 1JJKA 2CLFA 3KVMA 3L5MA 2YXGA 3PBUA 5IBXA 1P4CA 2ZZ3A 1N7KA 3S5YA 4XBSA 1Q6OA 4O50A 4MJMA 1FWNA 1A5BA 4RCXA 2NXHA 3W6YA 4NU7A 3M41A 3SW6A 1QPQA 4LWWA 1TRIA 3U8GA 1SO5A 2B0MA 4U28A 2DJLA 3VNDA 1LRQA 2QCHA 2QCMA 1VH7A 1OF8A 2ZZ6A 3BLEA 3FLUA 3DGRA 4WXYA 1TO3A 4K6AA 4JX5A 2Y89A 1AL8A 3PY2A 2FB2A 3M47A 2CLOA 3UZ5A 4JIPA 1GG0A 3IGUA 2DZTA 4TR9A 4UTHA 3MMTA 1W31A 1KFKA 1F73A 3NR0A 3LTYA 3LCWA 2FTPA 3STEA 3NQDA 2WQPA 4ZMGA 4QQ3A 1TV7A 4LOCA 1GT8A 2W79A 3UWYA 5FF4A 3KRSA 3P7YA 1WOBA 3LXAA 3LBMA 3RNDA 1A5AA 3UXDA 1A50A 3TDFA 2AGKA 2QCCA 1FCUA 4IGHA 1XKYA 3TSDA 2ZRUA 4EOUA 2V2DA 4PEKA 2YW3A 2CU0A 2GOUA 1R2RA 3DI1A 4UFKA 4LRTA 3LCXA 1IXOA 4ZZ9A 3O63A 1F2JA 2GVGA 3VI2A 2ATMA 4FNSA 4GUGA 1FBAA 2FPTA 3JR2A 4IJBA 4K39A 2QJHA 2ZRXA 1GVFA 4R34A 1HO1A 1YDNA 3QM3A 5F1UA 2DZWA 2YW4A 3ATZA 3DFOA 2WNNA 1OJXA 3PF3A 3P60A 3GXNA 5AC6A 2GJNA 2FFCA 3UXAA 1TPUA 2VEKA 3GIYA 1ML1A 2CLLA 1N8FA 3PG9A 1T99A 4BWLC 2QCGA 1FCVA 1ZCOA 2CZ5A 3KVKA 2FB3A 3LBCA 1JUKA 3RFAA 1XDLA 1JR1A 1EPXA 3OVRA 4BFAA 7TIMA 3DZ1A 5LHFA 1W37A 2R8WA 1RV8A 3P8JA 4KWVA 5K4XA 1J4EA 3S0CA 4DO6A 1PV8A 2E09A 1M5WA 3LHWA 4O52A 3GDLA 3LXCA 4ADSA 4IMDA 1G67A 3P62A 2A85A 1VYSX 1XDMA 4FXSA 3NNTA 4UTJA 3UWWA 3ZFHA 3OIXA 3SIZA 3PAJA 5F1VA 1KBJA 3W2UA 3C4UA 2XFWA 4BI5A 2FJKA 4J9JA 3NQVA 1YPFA 3EWBX 3NGJA 4LVGA 1OFQA 3G1SA 2BTMA 5F4SA 2X1TA 2C3ZA 4UMBA 5DLCA 3TK7A 3IVTA 5D02A 4P61A 2F7FA 4UFMA 3TFCA 3NQEA 1WBHA 3W7GA 1FWRA 3O06A 3VKJA 1V7YA 1LM1A 2JBMA 1OFOA 3THAA 2VFHA 3HGJA 1TPWA 4M5PA 3RMJA 3HIJA 3NYZA 5I3IA 5L6UA 3NM1A 3I6RA 4GUIA 4O8RA 5FF2A 3CB8A 3NQFA 2Y6ZA 3MO7A 2VFDA 2V2HA 4UR8A 1FXQA 1ZAIA 3N14A 3U6WA 3HMJG 4FNRA 1KBIA 2B7PA 5EPDA 1W0MA 3E02A 3CC1A 1FWWA 1S5VA 3HG2A 4XKYA 2QJGA 4PFMA 1LDCA 5TIMA 4UUIA 3NL6A 4A2RA 2Y7FA 3S5NA 3TSMA 1PCWA 4IXXA 2YFOA 2GVJA 4DPPA 1L9WA 3HO8A 3C0JA 1Y0EA 1A53A 3N19B 4JTKA 1YLVA 5KZEA 3WK0A 3MJYA 2CZDA 3WJZA 4K8HA 4NJGA 4HT3A 5KITA 1RPXA 5AHMA 2CLMA 3L5LA 5AFDA 2ISSA 3SJ3A 1QMLA 2XN2A 1OG0A 3GR8A 5F4XA 1EP2A 3OVPA 3R13A 4M6PA 3T78A 1XM3A 4I7VA 1PHQA 3G1VA 2XN1A 4O0KA 5BMWA 3NOEA 4N9BA 1DORA 4QJ1A 1R2TA 4A2SA 1TPH1 4OQVA 4Q32A 3G1YA 1TYGA 4NJJA 3W22A 3UWZA 1IXQA 5D03A 5CZSA 4IMFA 2C14A 2C19A 1Q6LA 1XBXA 3M43A 4DO5A 3BARA 3H54A 4LS1A 4WZHA 5CPLA 3DFQA 2GVLA 1FY6A 3MI2A 3P84A 2E6DA 1C8VA 3ABSA 3BG5A 3OEXA 3E49A 3L5AA 5HNRA 3QYQA 4O4WA 4Z1DA 2VEMA 1SZGA 1JUBA 2EAWA 2NZLA 3EWUA 3DKJA 3W7NA 4ADUA 1L6YA 4UNKA 4JDBA 4LNYA 1X8FA 3W7EA 1CX9A 2CLHA 2NUXA 3QF0A 3OHIA 4LS2A 2I14A 2Y7GA 4O57A 2VOMA 1K8ZA 4YMZA 2Q3RA 2C15A 3B04A 3CIWA 1XC4A 2NXIA 3LCGA 4LV4A 1EWDA 3MP4A 2ZRWA 1I8JA 5AYZA 3EWYA 3P5ZA 3W1TA 4JN6A 2PE4A 1C29A 3G1AA 3LI0A 1W5NA 1VC4A 2QEZA 2HS8A 4I9AA 3EX3A 4HNVA 5I3FA 5A5WA 4K7YA 3QPZA 3G22A 3VCRA 2H8ZA 3W7QA 4MZ1A 3TV8A 1TB3A 5AHEA 1A5SA 1XCFA 2G95A 3F03K 3W83A 5H2ZA 3HGOA 1FDJA 4LV9A 5C55A 2VFIA 2A0NA 3M5XA 3NQ2A 3S1WA 1M6JA 3ZR4A 2CLEA 1W5MA 3P67A 1B9BA 3UYCA 4O11A 1QPNA 2IQTA 1Q6QA 3RF9A 3PBWA 5DCBA 3LCFA 4UFLA 1LRTA 2YR1A 2V81A 1OF6A 2H90A 5C5YA 3NM3A 3S1XA 4CQ9A 3WK1A 3W76A 4FX8A 3TFXA 4PH6A 3TE9A 3NPUA 3A24A 4GRSA 2J88A 5KINA 5CPOA 5D33A 3UY8A 2NX3A 1AL7A 1IIGA 3S9YA 1EUNA 2DORA 1JUEA 3FFSA 4OGZA 4BF9A 1GOXA 4ZQMA 4HSNA 1F5ZA 3HGRA 3CT7A 1SO4A 1JQVA 3EX6A 1O94A 1Z44A 3SY5A 2YFNA 3TMLA 4QNWA 4PL1A 4AH7A 4NVTA 1L6SA 2AAMA 2Y62A 3QEZA 3W2MA 1QNVA 1XI3A 4ORMA 1WV2A 2YPIA 3OG3A 1XL9A 2WSQA 3SGUA 2QDHA 2CW6A 5H91A 1IGSA 1BWLA 2QAPA 1T8XA 1EB3A 3W7IA 3NQMA 3UPBA 4DO4A 1LOQA 4O15A 4OV4A 1H61A 4MY9A 3W2JA 3C6CA 2R14A 4H4IA 2YSWA 4RXFA 4IQLA 1P0KA 2A4AA 2A2IA 3EXTA 4DPQA 4JDYA 4X2RA 1VYRA 3G24A 2ZZ2A 3W84A 1TPEA 3EWXA 3PS7A 5KMYA 4UFIA 2E1DA 3O1NA 5BMXA 4RZ5A 2OZ0A 3O6YX 1FCBA 5BW6A 3NO5A 1EP1A 2VFGA 1ADOA 4O12A 1TCDA 4IMCA 1JCLA 3P81A 3DAQA 1OFEA 4MYXA 1SUXA 3DFTA 1OK4A 3M7WA 3VE7A 1P1XA 3W1LA 1KV8A 3LB0A 4X9SA 1CW2A 1LYXA 2X16A 2ZA2A 4O17A 2YZRA 3TJXA 4CQAA 1AG1O 4NZFA 2FPYA 2DJXA 4H6KA 5D32A 2OT0A 3INPA 1RQHA 3O05A 1KM2A 1QPOA 2JK2A 4OWGA 1I2OA 3CTLA 3IIVA 4DBDA 2QCDA 3F1QA 6ALDA 2WPBA 3C2FA 4XBKA 1BEUA 3STCA 4LS0A 1VR6A 2EPHA 4GJ1A 3TX9A 1LORA 4ZQCA 4UMAA 2E77A 3T7VA 2ZRZA 2HS6A 1NEYA 1G4PA 2J27A 3AJXA 1LZOA 2V9DA 1SZEA 3R5EA 3B0UX 1W3NA 1ICPA 2GJLA 4FNUA 5E1QA 3VFLA 2FDSA 2V8ZA 3UZJA 1LROA 1PCKA 1I4NA 5FEPA 3ATYA 3SSJA 4EIVA 1Q45A 5FEWA 4YL2A 1NSJA 4GBUA 2RFGA 1VLIA 4WD0A 5IBXC 1LBMA 3EX1A 1JCYA 2J9XA 5KSWA 1UB3A 2R91A 5BOOA 5J5DA 5F2IA 3IGSA 1VYPX 2EKCA 4NNAA 3ZWSA 5FF0A 1TV8A 3G8RA 1SO6A 3PSWA 4AHQA 4OT7A 1YPIA 3CWNA 3GAYA 1O60A 1TTPA 3MUXA 5KZMA 5K9DA 1H7RA 3NQAA 3R2GA 3IGXA 3K30A 3MP3A 3CPRA 1QPRA 4UTWC 5SWUA 2X2GA 1KM4A 1LBFA 4XTIA 5KTLA 1SW0A 1OYCA 3CIXA 4ICNA 1K02A 3LRMA 1FWTA 3GZ3A 3QQ0A 3QMTA 4JTEA 1T0OA 5I3GA 1ME7A 2QDGA 4O1DA 4L4LA 5LNUA 1XUUA 1QOQA 1ZALA 4M19A 4O13A 4JTGA 1FDZA 2E6YA 3EX2A 4Z0SA 3ABQA 3G3DA 1M7OA 3P61A 2WNQA 3NZ1A 3W7CA 3MBDA 4WXZA 5K9XA 2EHHA 1HL2A 4UTUA 4N9DA 2ZYFA 1LOSA 1DKWA 1WDWA 4JTLA 4BI7A 1I2RA 2WJZA 3JRKA 1SQ7A 1G69A 3NQGA 4KWWA 4LRSA 5C54A 1GZGA 4NNBA 4RV8A 1E51A 3EEGA 1YTEA 3QPYA 3HJZA 2PC4A 2A21A 3M5VA 1DV7A 4AHOA 5LZLA 3L0NA 4YXGA 2YDAA 3L68A 4YLWA 4LC6A 4MFDA 3TQKA 3N3MA 5LGZA 4DF0A 1I2PA 1I2QA 3S1UA 1GVRA 1W56A 2KZHA 5LSMA 4E38A 4L4MA 4M7TA 1VRDA 1SSGA 4G1KA 3NQ6A 1YYAA 3LRKA 3OVQA 5K4ZA 5I3KA 4O53A 2ZDRA 4RX0A 5AC7A 1KM0A 5EL1A 3G1FA 4JNMA 3W85A 4PTNA 3TXVA 3SGZA 4WQ6A 2E6FA 5BRBA 3ZWTA 1GWJA 4IX0A 1KFBA 4FNPA 1AK5A 2Z2UA 2QKFA 3MBFA 3B4UA 5EBUA 2O7QA 2Q3OA 4GC4A 4M7SA 2ZBTA 4MKNA 5CZJA 3R8RA 1Q3NA 3OBKA 2OMAA 5LKYA 3TCEA 3BG9A 1V5XA 1J2WA 1LCOA 1DJNA 5I3HA 3LHZA 4Z1BA 4LW7A 3FYPA 1AW1A 4BR1A 1DL3A 2NV1A 5D2TA 1NVMA 4M6QA 3A5FA 3PBYA 2C0AA 4O14A 3QW4B 2QAFA 5F2LA 2ZQ0A 2QUVA 3RK8A 3G0SA 4IMEA 4EF8A 1R30A 1YXDA 3NQCA 4UNLA 1LTDA 4KKXA 2VC6A 3MWAA 1A5CA 3QJAA 2V82A 5E0KA 3WFAA 4UTMA 1R46A 5EMUA 4E0CA 1GTEA 2VFFA 5KZDA 1ZAHA 3TROA 3GX9A 1K7EA 5T26A 2Q8ZA 4NXSA 2QUTA 1XBZA 3KX6A 3W1NA 1YTKA 4JTJA 1RZMA 4Z0JA 4O1BA 2RHGA 4AEOA 1BTMA 2LLEA 2ABAA 4ZQOA 1Z48A 2XN0A 2W0UA 3SR7A 1NAL1 4JTUA 3LM7A 1OX5A 4JEQA 3TW7A 3NL2A 1Z42A 3DENA 1YXCA 3BW4A 3FJ6A 3L65A 3LV5A 1S5WA 2GQAA 2NV2A 5MHBA 3SI9A 3LXBA 1VQTA 3GDTA 4CCCA 5CG7A 4R33A 1DQWA 3W7DA 3N9SA 3E96A 3HG3A 1L6WA 1SZNA 3LHUA 4NNCA 1H62A 5K3VA 4MJZA 1HFBA 6TIMA 1KM1A 2CZEA 3UNDA 1VGAA 3HQ1A 5LGXA 5AB3A 2E5CA 3O6CA 4UTTC 5HUPA 4UR7A 1UCWA 4MZYA 3NPWA 2V5LA 4IX2A 3T4CA 4X22A 1OX4A 5DBUA 2VELA 3PC0A 1TPDA 3V75A 3WJWA 3PB2A 2J24A 3G8EA 5C6MA 3TAKA 4U4MA 3BV4A 2ZZ7A 5G1TA 1EA0A 2P10A 4UTIA 4LVDA 3PB0A 4ALDA 3TA6A 4XKYB 4RJEA 3MHUA 1YDOA 3B0VC 4OHQA 3FEMA 2E6AA 3HB9A 1H1ZA 2YGYA 3GYEA 5LNVA 3V1PA 3BLFA 2OX1A 3EX4A 4IPJA 1TTIA 2RH9A 1PHWA 2X1UA 4N4QA 4ZVJA 4BI6A 1X1OA 3KVLA 2JGYA 5TBOA 4NUWA 2NX1A 1R47A 1SW3A 3W87A 1UBSA 2X1RA 1LOLA 4D2JA 3M44A 3N9RA 2ISWA 4Z1AA 1B3OA 3LTSA 3O15A 2PRLA 2Z6JA 3CWOX 4PODA 3ANYA 4RK8A 4IOTA 1S5TA 1O95A 4Z08A 1H50A 3L0KA 4PCFA 4AWUA 3KHJA 3W70A 1DBTA 3T44A 1GYNA 3DU0A 3FOKA 1OFBA 5DBTA 2Y88A 4QM1A 4RR4A 1TJPA 2D73A 1O5XA 3LDVA 3I7QA 3Q37A 1L2UA 5CPNA 3NG3A 4FF7A 1IXNA 2TYSA 1RVGA 5E93A 4RKAA 3W74A 1U83A 1ONRA 1OYBA 5HR6A 1T96A 1VCGA 1YTDA 1Z41A 1BKSA 3GNDA 1AW5A 1K3UA 3IIOA 4A3UA 2QCFA 3NVTA 2W6RA 2B4GA 1RR2A 2J9ZA 1VPXA 3UWUA 4AWTA 3STGA 4JTFA 5G2WA 1F6PA 4AHPA 4FO4A 3G0UA 1WOAA 3S6DA 3LCLA 3M0ZA 1KM6A 4X3ZA 3LCHA 4ZQRA 3HOJA 1LLWA 4LY8A 1EUAA 4OV9A 4UTKA 3BGJA 4W9TA 3W1XA 1JQXA 3TXZA 4LVAA 4JIQA 5DCDA 4AB4A 5LNWA 5D04C 5EY5A 1I2NA 5A8GA 3NQ7A 1P0NA 3TH6A 3SZ8A 2RDWA 3NEVA 1JVNA 2DZUA 2OJPA 5AHFA 3LI1A 2QF7A 4NX5A 4FNTA 3WJSA 1GVSA 4PC8A 4MY8A 1OYAA 1X7FA 5FEXA 1G4TA 3KVJA 3W86A 1FX6A 3GR7A 2DZVA 5G4EA 1K8XA 4O28A 1IF2A 4C1LA 4FHAA 3L66A 3BK0A 4UFJA 3ZS4A 3GNNA 1S3HA 4DXVA 1FQ0A 2V2CA 1B4KA 3TQ0A 2JKEA 3ABRA 3NXFA 1QO5A 5AYYA 3O07A 1H7WA 3O8AA 3P74A 3RU6A 2WNZA 3S1VA 3QSTA 3MP5A 3N2MA 2FPVA 5HUOA 4HNTA 1GVOA 2A7NA 3C52A 3BLIA 4NZJA 3W1UA 1VHCA 3GB6A 5AHLA 2AQWA 4XUGA 1ZENA 2C13A 1DHPA 3DKLA 4FNQA 4CCEA 3NZRA 3CEUA 5AOUA 2NWSA 1LBLA 1KW1A 2TPSA 5K2ZA 1TRDA 1QAPA 1ZNNA 3LERA 4GE8A 3LHVA 1SU5A 4UCGA 1SFJA 3P80A 3T40A 4MFEA 4K8EA 3CQ0A 4BWLA 1H51A 5CSSA 1F7BA 1ZHAA 3W88A 1TPFA 1K8YA 2OCZA 2ALDA 2G5WA 2GQ9A 3P8IA 5CKSA 5D2XA 1MZHA 4XWUA 5C2XA 5CSRA 4WOZA 1VS1A 2X30A 3C2EA 2HMCA 1SZFA 2TSYA 5J5RA 4JS3A 1GPWA 4WY0F 3EWWA 4UTWA 3MW7A 1TQXA 1W5QA 5HWJA 5CGQA 3IV3A 3C56A 2ISVA 1W54A 4IXHA 3W1MA 4UMCA 4HPXA 2BWGA 4GXMA 3BO9A 4WOQA 1THFD 4TMBA 3QZEA 5F4WA 3QSRA 5DXYA 1AMKA 1NF7A 1PVNA 2VENA 4WUIA 4JY8A 3MYPA 2B7QA 3N34A 1C9DA 3UWVA 2QCDB 4CCDA 2A7PA 4AXKA 1ALDA 1IXPA 1TSIA 1G7UA 1QCWA 4CNNA 4TIMA 1KM5A 4CNPA 1PL9A 3H55A 4JTHA 4QITA 4Y96A 4B5NA 1PS9A 1OABA 3FYOA 3A21A 5DY2A 3M1ZA 4IMGA 3DI0A 3EB2A 1H7XA 4AAJA 2G97A 1TJRA 3B8DA 3PUEA 4QISA 2OT1A 4QIUA 1OFPA 4NJHA 4WX2A 2CFFA 5HR7A 2A7RA 4XQ6A 4BK9A 5D30A 1HUVA 3QMRA 1JCJA 3JS3A 4CLMA 4ZL1A 3UQNA 1GJPA 1EP3A 3GLCA 2BX7A 4JY9A 1F6KA 3ABOA 3LV6A 4WY0A 2NWRA 1G6CA 3FA5A 4POCA 3KOFA 4S2CA 5F2GA 2ZRVA 3W2KA 2PRHA 3TR2A 3IVUA 1GG1A 2JGQA 5AN7A 1BWKA 4MY1A 2FLIA 3DFPA 4LU0A 3W9ZA 2FIQA 1GTHA 1K03A 1VCFA 3PBVA 3PG8A 2Y63A 4LTSA 1FWSA 2WKJA 5D2WA 2ZFAA 2A1YA 3B05A 3BG3A 1SFLA 5FI8A 3MI6A 1HG3A 4DQWA 2WOQA 4Y8FA 3PM6A 1K7FA 3N73A 3KRZA 4RZ6A 4N9EA 4GNJA 2WV8A 2ZA3A 2EF9A 3A22A 4P2VA 5G5IA 4O1AA 5AHNA 1TIMA 1KTCA 1W5OA 3GKAA 1W3TA 2E5DA 2TMDA 2CLIA 2Q8LA 2RDTA 5G1YA 2A6NA 5CZ0A 1OFRA 1ME8A 1WXJA 3W75A 4JTIA 4Q4KA 1H5YA 2JKPA 2Z6IA 3C2OA 3CU2A 3Q58A 3IIXA 3W1QA 4FX6M 2BSLA 3YPIA 3GKFA 1ZFJA 4RLIA 1HO4A 4Y9AA 3WJXA 2ABBA 5AYXA 1DQXA 3DHDA 3QFEA 3KXQA 3W7KA 3E12A 3BVJA 3UY7A 2NUYA 4UFHA 3NAVA 1I45A 2Y7EA 3W3OA 1MO0A 1G7VA 1OK6A 1Q6RA 5K7JA 3CM4A 4ZQPA 1W8SA 3A9IA 4FIRA 3E9AA 1TPVA 1EWEA 4N6FA 3FS2A 4K36A 3G0XA 2V5BA 3E0IA 5D37A 1VZWA 2Y61A 3C2VA 3S5OA 1JRCA 1KTNA 1LLZA 4MIMA 2GPTA 4UXDA 1TQJA 4CNOA 2PCQA 1RQEA 2CZFA 3G18A 3G1DA 3QC3A 3GVGA 1XFBA 4Y6GA 1KM3A 1ME9A 3F4WA 2BXVA 3OA3A 1JRBA 5U7SA 1KFJA 1IIHA 1KTBA 4HSOA 4O16A 4HN4A 3EWZA 3MI3A 5EKYA 3PR2A 3WK2A 3NPVA 1SPQA 2F84A 4O4VA 4AMAA 3GK0A 5EYWA 3HGSA 4O10A 3S5ZA 5DXXA 5D2VA 3HPXA 1KLYA 2P0OA 3LTPA 3NQ8A 3BW2A 1QOPA 3F4NA 3TC7A 4O54A 2C16A 3CLMA 4K38A 1JCNA 1JCXA 2Z0IA 3C61A 3HPZA 3WJYA 4LT9A 4ORIA 3O16A 5U4NA 3IEBA 3DH7A 4FEZA 5DN1A 5K9CA 3TMQA 1F74A 3TW6A 1VHNA 3TNOA 2BLEA 4OU1A 4I7WA 2C6QA 5FESA 1VJIA 1B57A 2UV8G 4N2YA 3TKFA 4JYDA 3L9CA 5ABTA 3W7OA 1H7NA 1UUMA 1GEQA 4N4PA 1M7PA 2J6XA 2ZZ1A 5D05A 2EGZA 1H1YA 4MPQA 1OHLA 4NX0A 3W7LA 3W72A 3USBA 3N2XA 3R89A 1EX5A 1F05A 5CPMA 1FXPA 4HIBA 3LOTA 3IVSA 3IIZA 1O4UA 4GUFA 3C2RA 5LNRA 4FIQA 1QR7A 4R53A 3W2NA 4R7JA 1H63A 3NL3A 4HNUA 4XZ9A 1AW2A 1QO2A 2C18A 3I65A 1TREA 3VE9A 3IIPA 4AF0A 1KLZA 1YADA 4JX4A 2B7OA 3LX9A 3P5YA 1KFCA 2RDUA 3GAKA 3STFA 1XUZA 4AVFA 3O6DA 1PIIA 4H3DA 4GUJA 2WSRA 5G2HA 3TU9A 2DZSA 3GDRA 3TUUA 4NJIA 3ELFA 1DOSA 4C1KA 2BZNA 1KV5A 3W1RA 5LNSA 2DZXA 2VXNA 1ICSA 1WAUA 4NJKA 2X1SA 3SFKA 3BW3A 3HF3A 1XXXA 2J9YA 1VLWA 1YDVA 2DP3A 4HKPA 1G4EA 3HBLA 3NA8A 1MEIA 4MOZA 4JYEA 4S2BA 1W3IA 2G96A 2YYUA 4MUZA 2NX9A 1LRNA 3PUOA 1TPC1 1TPB1 5FEZA 3TAOA 1OX6A 4KFNA 5LHEA 3SECA 1X6UA 2YX0A 1K7XA 5D2YA 1GVQA 4O0ZA 1WBJA 3IRDA 1OVDA 1WA3A 4GUHA 4JD4A 3FIGA
chains in the Genus database with same CATH superfamily
1QPKA 4JNYA 1QNQA 4AX7A 3LGEA 3ES7A 3VZYA 3GDMA 2F8QA 2ZUUA 1DJQA 2Q09A 4AWSA 2VKZG 2CBJA 2VEIA 1MEHA 3BICA 3W7MA 4WJEA 3GYCA 2VEFA 2PURA 2ZZ5A 1G4SA 3AO0A 3HQNA 1NFGA 3CHVA 1HL8A 2V0TA 3VIMA 5BROA 4IPIA 1S2AA 3H2OA 1D9EA 3QGVA 1D8WA 5BNKA 3VD9A 3G3MA 2VFEA 4WLCA 2O92A 4LUJA 3SUTA 1ZAJA 1C7TA 3L21A 1RPKA 3PSVA 3MSGA 2BHUA 2HSAA 1CGVA 4OIFA 5GNXA 1M65A 3W7RA 4L6OA 2E9LA 1E1CA 3DFHA 5D4YA 3QQ1A 4AD2A 1F76A 2OQLA 1BVNP 3LCIA 4W4QA 1TV2A 1P5BA 5DELA 4RZBA 3N3TA 3TIMA 4E2DA 3DBPA 4D6EA 3CEPA 4B3KA 4GYPC 1J0JA 3W1PA 4LBSA 1CZ1A 2YCIX 3G1XA 4YCOA 3T9PA 4JYFA 4MWAE 3TN5A 3WQEA 1XLEA 3OGSA 4NAFA 1B4EA 4JGDA 4GJIA 3V0TA 1XGDA 3CIVA 2RUSA 4RXGA 3WK3A 3W7JA 3WD1A 4L6HA 2WZTA 1OIFA 4LYQA 4QE4A 5JIWA 5A8NA 2PFHA 2NLIA 1XPGA 4JN7A 1TKKA 4QCEA 2OOFA 5D9PA 3I3EA 1W91A 4CQCA 3G6MA 3EAUA 5IHRA 3C3NA 3FAWA 2ZCGA 3UD6A 2UY2A 2VX7A 4ONVA 5FJIA 1XBYA 3N2CA 4XG1A 1VBRA 1QHPA 2QV5A 3PUDA 4LH8A 1M7XA 2IPFA 1D3GA 1DWJM 1MWOA 1FWJC 1E6NA 1FKXA 5I07A 1DIKA 2WK2A 4K2SA 2XM2A 1K9DA 2DZAA 2H3BA 2HTMA 4XZMX 1EDTA 4N02A 2BHYA 2PWDA 1YX1A 4F9DA 3TZFA 1FDYA 3R79A 2FZNA 2HDJA 4LUIA 1EEPA 1MRQA 4Q8UA 3W27A 5D38A 3GXTA 3T2QA 2IW0A 5FJUA 4XAFA 1V51A 2OTDA 1XD0A 5LA2A 1PZ3A 4ZEPA 4QSHA 3M0LA 1XLMA 3FDGA 1VRXA 1YRRA 4PA8A 2HWGA 2PRMA 3R6IA 4OE7A 3MYOA 5EU9A 4WKAA 4HU3A 2D69A 3N1AA 3AHZA 3RLUA 3MB9A 1A5MC 5DY3A 3PNUA 5CAKA 3W81A 1U2YA 3PNZA 3QR3A 4MG4A 3FHAA 2PTYA 5C71A 1H4PA 2J77A 3L4WA 1TTJA 2GUBA 2OYLA 1GW9A 1SFTA 3DESA 2H9AB 1ZBVA 1D3HA 4EWND 4MB3A 3FN9A 3VC5A 3U7VA 2QUUA 5I3JA 3ZJKA 5CPQA 1OFDA 2ZRYA 4JTSA 3DFYA 2QCNA 1FCQA 5HWNA 1EHAA 1XLBA 4GYFA 3WBEA 1W3LA 1PZ2A 3PVFA 7REQB 4PMVA 2QCEA 3I7SA 3KVMA 3L5MA 1UMLA 2YXGA 4L64A 1VEMA 3S5YA 4XBSA 3MTWA 1FWNA 2NXHA 1RY8A 4C91A 4EK7A 1P0DA 5FL1A 1WB0A 3TWBA 4LWWA 2B0MA 2VDIA 1ZRQA 1XIJA 1OF8A 2ZZ6A 1MI3A 3GBDA 2AMGA 1OINA 4J7RA 1JPDX 4L80A 4GNKB 4K6AA 4LAZA 1JFXA 1AL8A 1DJYA 3GS6A 3KHDA 2CLOA 2BB0A 1HJSA 3BCDA 4Q4OA 5ENLA 4P8VA 2DZTA 1ONXA 3MMTA 1KFKA 3AIQA 1MW3A 2FTPA 3STEA 4LB3A 3G1RA 4QQ3A 1X1NA 4DM2A 3E2RA 3F2DA 1PX4A 5FF4A 2QULA 3TYUA 3P7YA 4U5KA 5D9MA 2E3ZA 1P0EA 2ZUNA 1J0KA 2OO6A 1GCYA 4LFYA 2QCCA 2X7WA 3N18A 2ZRUA 1ITXA 2JE8A 2V2DA 2YW3A 4PEKA 4KRUA 2CU0A 1ZCCA 3R11A 2WJDA 3N29A 1KGXA 5BCAA 1IXOA 3O63A 4GO8A 2P88A 1VIWA 3VI2A 2ICSA 3ANUA 2PDGA 3E6EA 5EFFA 2ZRXA 5A8QA 1VENA 1GVFA 1KWKA 2J8TA 3GDBA 1WKYA 1JF5A 3BZGA 4QDPA 3DFOA 3K8MA 2WNNA 2XFRA 4HMDA 3P60A 3GXNA 5AC6A 4U33A 3UR2A 2FFCA 4M82A 4ZB5A 2YIHA 4R85A 1PKMA 1WUFA 2CLLA 4UOQA 3PG9A 3VOGA 3AXHA 1ZCOA 3VIPA 4UTFA 1M03A 1JUKA 4QR6A 4PUUA 1XDLA 1JR1A 3UJFA 3E3HA 3OVRA 4G9PA 4MGGA 1AVAA 2DT2A 3P8JA 2XH7A 1J4EA 4PMUA 4DO6A 5C7HA 1M5WA 3BE7A 4D6JA 2WJEA 4IMDA 4ZCWA 1GW1A 1AJZA 3VVGA 3MCOA 1XDMA 1WXZA 2DIJA 4G56A 3ARQA 1JPHA 3KE0A 2NQLA 2EG8A 3OPSA 1ZZMA 3SQLA 3WUBA 2XISA 5FL0A 4IP7A 3EZ4A 3H7RA 2WCGA 3NGFA 4GI9A 3MKVA 3AIVA 1IHIA 1J2BA 2XFWA 3OGRA 2FJKA 1OWQA 4FR6A 1K6WA 1IEXA 4CEXC 1R7OA 3WMLA 5F4SA 2X1TA 4P61A 1BTCA 1WBHA 2VJXA 4Z2KA 3VIGA 4GFIA 1OFOA 4V15A 4M8UA 1KRBC 4M5PA 1UKPA 4DWSA 4IIBA 4K8GA 4GVHA 2BNJA 4YPJA 3BV7A 4GUIA 4O8RA 4MAVA 1FH7A 2Y6ZA 4Z2HA 3LGGA 4QXIA 5HATA 3HMJG 4TX6A 2HPMA 2QLYA 4GKLA 3E02A 1QI4A 1V3KA 2QJGA 4PFMA 5TIMA 2QPSA 5A1AA 3NL6A 4A2RA 1W3JA 3SCSA 1FWEC 2YFOA 1B3YA 3HO8A 3PWIA 4FPSA 1K6AA 1A53A 4JTKA 3W6MA 1H0GA 4EX4A 5KZEA 3WK0A 4W7UA 2CZDA 3WJZA 3G2GA 3WZ0E 3L5LA 4Y2WA 3T78A 3S9IA 4M6PA 1CYGA 2AL1A 3NOEA 4HMNA 5I79A 3BLDA 1EKOA 1FP9A 3O3RA 1V0MA 4OUEA 1TYGA 1GNXA 3WDIA 5T8GA 3W22A 4JIHA 3AS2A 3UWZA 5CZSA 4IMFA 4I90A 1T8QA 5CC6A 1CCWB 1XBXA 4W8AA 3BARA 5CPLA 4PE8A 1XRFA 3CBWA 3DCPA 1PTAA 3ABSA 3BQ6A 3VNJA 3E49A 4GY1A 3WY1A 1XLJA 5HNRA 4RNFA 3UJEA 3PTKA 4UNKA 5FJRA 4JDBA 2WM0A 4ZO8A 3W7EA 3ANVA 2NUXA 1CENA 3FVMA 4O57A 3IK2A 4N0RA 2Q3RA 1A0DA 3B04A 1KXVA 5CH9A 1HKMA 4UQ9A 2CC0A 1RK5A 3A9BA 1YW1A 5AYZA 3W1TA 4LCSA 3PPFA 3I3BA 4U31A 3LI0A 3R7MA 2GWNA 2QEZA 1R3YA 4I9AA 5I3FA 1FOBA 2PP0A 1QUMA 3M0KA 1A5SA 4ZSTA 5FACA 3F03K 3HGOA 1NARA 2A0NA 1V3IA 3OB8A 3M5XA 3NQ2A 5REQB 2WWDA 1WZKA 3WLMA 1D7FA 3FEQA 2IQTA 3DOPA 4UFLA 1U22A 2XIQA 2OG9A 2UZ9A 3K8LA 3W76A 2HVMA 4FX8A 3NPUA 4X63A 3A24A 3DG6A 5CPOA 2D2GA 5C9UA 1US0A 4H83A 2NX3A 1LLOA 4AIUA 1AL7A 3H2AA 3W0KA 1XKJA 3S9YA 5D8WA 5C9XA 4P7QA 1JUEA 3I6EA 4TXEA 4BEUA 3KBJA 4BF9A 4AZHA 4ZQMA 4PUJA 1CIUA 3JU2A 4HSNA 1OT2A 3CT7A 4LXFA 1SO4A 2ZOXA 1NOFA 3TNBA 3SQSA 2QMJA 4AH7A 4DXKA 1UD6A 4NVTA 3B8VA 1J0IA 2PBOA 1YNPA 3JVAA 2Y62A 1QNVA 2YPIA 1KR0A 2WSQA 3WLLA 1U1UA 3VC6A 1I60A 2QDHA 3KTSA 1ECQA 2ESCA 2IXUA 4PR4A 3NQMA 2B81A 1QXLA 4AD4A 2WCSA 1E0WA 4QE5A 1I0DA 4QDWA 4DO4A 1XP3A 3SIMA 1H61A 4MY9A 3C6CA 3K1DA 2I16A 4K1GA 2YSWA 4RXFA 1QASA 1P0KA 2A2IA 2W92A 4AZBA 1V93A 3WQOA 4X2RA 3TC3A 1KKRA 3CB3A 4UFIA 1BG4A 2E1DA 3IJ6A 3O1NA 4KS0A 5BWAA 2VQUA 5BW6A 1ADOA 1E0XA 4CN1A 4IMCA 1JCLA 3VGHA 3P81A 3T4WA 2EKGA 1CDGA 3M7WA 1P1XA 3W1LA 3LB0A 4RL3A 2ZA2A 3MCNA 4PTVA 4O17A 2YZRA 3C86A 5HQLA 4URIA 2BY0A 4D9PA 3TJXA 4CQAA 4NZFA 2FPYA 4RDWA 3PTQA 3INPA 1LUCB 1QPOA 2JK2A 3OYZA 2OSYA 3D5HA 3NIYA 1I2OA 1DJWA 2QCDA 4TV5A 3V16A 2WPBA 2RJGA 6ALDA 3C2FA 3E74A 3ES8A 4DJDC 4GJ1A 4ZQCA 1EPVA 1SGJA 1CGWA 4O1FA 2J27A 1LZOA 2V9DA 3EPMA 1SZEA 1YMYA 3BSHA 1C90A 3SN0A 2GJLA 1ZS2A 5BU9A 3VFLA 2FDSA 1EHNA 1PCKA 1VBHA 2H9AA 5FEWA 1NSJA 3LGDA 4W85A 2VMFA 2PDIA 2RFGA 1VEOA 1VLIA 2VCBA 4WD0A 3VMOA 2YBUA 1XDJA 3E0VA 3QV6A 1UB3A 1UR4A 2R91A 1QTWA 4Y9NA 5J5DA 2EKCA 2FFIA 1TV8A 1B1YA 1TUXA 3RO6A 3NZPA 4AHQA 2DGAA 1PYFA 1TTPA 1R3TA 5KZMA 1QK2A 3R2GA 1JYNA 3IGXA 1EXBA 1ITQA 4L4OA 1KM4A 1LBFA 5E5CA 3AHYA 1SW0A 3GNXA 4ICNA 5BRQA 4LUTB 3LRMA 4HCHA 3QMTA 1MUMA 3NTYA 1AD4A 1ME7A 3M0MA 1XUUA 3A4WA 2P76A 2Y8KA 5G4HC 1Q6FA 4JTGA 1SMAA 2J47A 5AKQA 1NP2A 4GGBA 1M7OA 3RX4A 2UY4A 4LANA 2WNQA 1VBGA 1NM9A 4WXZA 2EHHA 1VP5A 4LAOA 1M53A 2UWFA 1LOSA 1WDWA 1XYAA 4E2OA 3SQMA 3CUFA 1VJZA 1V8EA 3B0YA 4JHZA 3WF3A 4LRSA 1WKEA 4RV8A 2DSUA 3WD3A 4ML4A 2AOSA 3OLDA 5FJJA 3VGGA 4E8CA 5IDZA 1Z89A 1DWFM 5FAJA 2XM1A 5DFAA 4LC6A 3IV8A 2X8RA 3O2LA 4U2ZA 1I2PA 3S1UA 3GSMA 1NDZA 3VIIA 4E38A 4M7TA 1VRDA 3AYSA 5A95A 4G1KA 1YYAA 2IKIA 2ZVRA 5AC7A 1IQ8A 4FLSA 5EL1A 1MVYA 3WNMA 4GCAA 4ZXOA 4IQJA 1V79A 5GNZA 3SGZA 1J6PA 4GZJA 4WQ6A 4IX0A 2F6KA 3NXLA 1I6NA 4FNPA 2Z2UA 5EBUA 3SBFA 4GX8A 2WCAA 2NVDA 1Q3NA 2OU4A 5H6HA 3SFWA 1V5XA 3R25A 4B90A 1DJNA 1TVPA 3WLTA 4GVGA 1KRCC 3P6LA 3S4TA 5D2TA 2REQB 3W53A 2IQ0A 1U1HA 4NP7A 2C0AA 2DUXA 2HQAA 5AZ0A 3QW4B 2QAFA 4RV3A 4PMJA 5F2LA 2QUVA 3G0SA 5FIPA 4AVNA 1XIGA 2HRWA 4UNLA 4AUBA 4H9YA 1US3A 4KKXA 3MWAA 5E0KA 2P5NA 3UJRA 2VUYA 3A4XA 1K7EA 4AU0A 3VCCA 3BLPX 3W38A 1UZHA 3URAA 4JTJA 4Z0JA 3SCUA 1E1CB 1XQKA 4D8AA 4LB4A 3ZYZA 1QI2A 2RHGA 4IPPA 4CNTA 2ODOA 2ABAA 5HXMA 2XN0A 1XLAA 3H7VA 2HBVA 3EB4A 1RUSA 3LM7A 1CBGA 1OX5A 1WZAA 4JEQA 4GYJA 3TW7A 2PTWA 4X0VA 1Q6GA 1WP6A 2GUYA 3M4HA 3FJ6A 3L65A 4GC3A 1NQKA 3LXBA 1RP9A 2XGZA 4R33A 1DXFA 3VGFA 3TQPA 3WENA 2WC4A 4PUKA 1L6WA 1QNOA 4A8RA 1H62A 5K3VA 4HPGA 6TIMA 1TZ7A 1AH0A 3HQ1A 3B9DA 3WUGA 2E5CA 3L4VA 2E8YA 1Q6DA 4AYSA 9CGTA 2YCJA 3LK6A 1WDPA 2WSPA 4IX2A 3M0HA 3WCZA 3V75A 3PC0A 4H9ZA 3PB2A 2J24A 3G8EA 3TTOA 3TAKA 1ISXA 4UTIA 2XVNA 2BGQA 3COTA 3PB0A 4Q7IA 3LPGA 2E6AA 3HB9A 1H1ZA 3GYEA 3PZUA 4JQ1A 3BLFA 1T6MA 1UIPA 1LL6A 3EOEA 1X1OA 3KVLA 2JGYA 4DZ5A 3EOOA 2VURA 3ARWA 4NUWA 1R47A 1TX2A 1CGUA 3AQUA 1LOLA 3M44A 1JZ5A 2R1LA 1NIUA 4Z1AA 3LZ5A 3LTSA 3GTIA 2Z6JA 4PODA 1S5TA 1OY0A 4Q4PA 1FKWA 1GYNA 5ABEA 3MUY1 3FOKA 1OFBA 1TJPA 1MMFA 1U1JA 4AC7C 1UD2A 4RE4A 1RVGA 5ABFA 4UR9A 2OODA 4V1XA 4EAYA 1J8VA 2ONEA 2RGMA 4CCZA 2F9RA 1ONRA 3R58A 1YTDA 1K4HA 3H2CA 2WHJA 2B4GA 2YBVA 1DJIA 4YHEA 4ZB2A 5AECA 2XG9A 4AWTA 2QXWA 1VD6A 5G2WA 2DIEA 5I7GA 2OKTA 2P8CA 4X3ZA 4LY8A 4UTKA 3EDKA 4FLRA 3T8QA 1JQXA 1VF8A 1R6WA 4ILSA 2E67A 1H3GA 5C8BB 5D04C 1DYSA 1I2NA 3E38A 1WUEA 3WQCA 1Q66A 3TH6A 2Z7KA 5DT5A 1PZ1A 4IMAA 4MWAC 2WVUA 3LI1A 1WZLA 5BXPA 4U10A 4MY8A 4D8ZA 2QUNA 1G4TA 2DQXA 4AZGA 1DWGM 3GR7A 3ZJ8A 4L56A 4O28A 1IF2A 2WM1A 4W5UA 3BK0A 2FGLA 5JH2A 3NFUA 2FTYA 1UUQA 3ITOA 1UD3A 2E4TA 4P5UA 3A6OA 2V3EA 1B4KA 1ONWA 3TQ0A 4ASTA 5H8MA 3O07A 4ACZB 3GFYA 4KWUA 3RU6A 2PGEA 3QSTA 1VFSA 3VM7A 1D2KA 2FPVA 3GIQA 3UR5A 1VHCA 2PGRA 1F3XA 4QP0A 2HE8A 2AQWA 3BDKA 1VJSA 4PCNA 4FNQA 3QZ6A 4CCEA 4CUCA 1LBLA 5K2ZA 4XV0A 1QAPA 1MQQA 4GE8A 1XFCA 3CQIA 4UCGA 1JG9A 1SFJA 3T40A 2VGFA 3ORWA 3QBUA 4YYFA 1ADSA 3KOYA 2ANUA 3MPGA 3KBMA 4Y9MA 2PZ0A 3RCNA 3W26A 3C2EA 1SZFA 2J74A 2CLPA 2E25A 4Q8WA 4WY0F 4JFUA 8RUCA 3MW7A 1W5QA 2Y1HA 1AFSA 4LYKA 5CGQA 3C56A 2ISVA 2PF8A 4H8HA 3W02A 5IXEA 1W54A 1CGYA 4UMCA 1OGGA 2Y5SA 4HPXA 4WOQA 1THFD 1P0BA 5F4WA 1EJWC 4L6DA 3A47A 1S5NA 1PVNA 2VENA 3WNLA 4XZIA 3MYPA 4C1NB 3N34A 3T0CA 2Z28A 4MWAB 2QCDB 4CCDA 2A7PA 1GQIA 2VGGA 3ZJ7A 1QCWA 1GYMA 2OLHA 1B31A 1AJ2A 4TIMA 1KM5A 1JZ6A 4CU6A 1P6WA 4X2PA 5CZKA 1LT8A 2AQVA 1PS9A 2JQXA 4H9TA 3UW6A 3FYOA 5C0QA 3M1ZA 4S3CA 1O1ZA 4FS9A 3MZNA 1F61A 3T42A 2G97A 3MC5A 1XIFA 2OT1A 3DHPA 1IGWA 1OFPA 2G3JA 4NJHA 2CFFA 4IP5A 3K1GA 4BK9A 1KCLA 2OSXA 1JXKA 1AD1A 2YBTA 3QMRA 3JW7A 4GY7A 1GJPA 3V5CA 2BX7A 2VZSA 3LV6A 4WY0A 4RNJA 5A8OA 1R3VA 4A3RA 3TR2A 3IVUA 1BWKA 3A3WA 4MY1A 4G8TA 3W9ZA 3AYRA 4B15A 3PG8A 2Y63A 4Q3MA 3UNTA 2VZUA 1XIHA 2ZFAA 1JDDA 2OKOA 5FI8A 1V08A 2WOQA 1MDLA 3N73A 1WDSA 2ZA3A 5G5IA 4O1AA 1KO0A 3AXKA 3H2EA 1GZ1A 2D0FA 4QJ4B 4YTTA 4MSSA 1S1RA 3TLLA 3RJXA 3B9NA 1SJAA 4Y7EA 4JTIA 5HQMA 2JKPA 3C2OA 4GVFA 3CU2A 2PLKA 3N4AA 3GKFA 5JMUA 3WNPA 3WJXA 3WKZA 2ABBA 3I6TA 3K4DA 3OLGA 3BH4A 1CXKA 1MW0A 3MWCA 1GK8A 3KXQA 1XYFA 2O4QA 3GR4A 5M17A 3RM4A 1TE1A 1MO0A 2C0HA 1B0IA 5JH1A 1ITCA 5K7JA 5C9RA 5FJPA 4ZQPA 2GGGA 3A64A 4FIRA 3UVAA 1TPVA 1W9BM 2VVNA 2PDCA 5AVNA 1EWEA 2EPMX 5CJ5A 3E0IA 3VD4A 1VZWA 2Y61A 1J10A 3C2VA 4KQNA 3IUDA 3SRFA 1KTNA 1OIMA 1X38A 3H6OA 1JIBA 5HPCA 4CNOA 2PCQA 2YKKA 2CZFA 4S3FA 8XIMA 2GSJA 4DRSA 4XVEA 2R82A 3U4AA 1JRBA 5U7SA 2GLKA 4HN4A 5EKYA 2Y8UA 2P50A 3PR2A 4Q8MA 3UU0A 3WYZA 3VXGA 3FK4A 2ALRA 5C70A 3WQ5A 3HPXA 3IAPA 2V3DA 3A12A 3MCMA 3TC7A 1QOPA 4C6FA 4L4PA 5J04A 2VGBA 5U4NA 3IEBA 4FEZA 5DN1A 3F4CA 2WBKA 5H1WA 3E5PA 5FESA 2C6QA 2Z1XA 2PDKA 4LUSA 4MJ4A 2J13A 1UR3M 1UUMA 3VNZA 4N4PA 3SUVA 1HF6A 4ATWA 2ZZ1A 5D05A 1H1YA 4MPQA 4NX0A 4H1ZA 3R89A 1EX5A 4W88A 1V7AA 3GC2A 1FXPA 1QNSA 3IVSA 1YQ2A 2WPGA 4QCFA 3VDAA 2WMJA 3GXDA 1O68A 2PD5A 1QR7A 4KIRA 3W2NA 1ZUAX 4R7JA 4DN1A 1AZ2A 4HNUA 2DSZA 1AW2A 1RK6A 1CT5A 4J4KA 5EMJA 2QDEA 3VE9A 3TJIA 3M0IA 2F38A 3P5YA 1MNZA 3BGAA 4KEMA 3STFA 1TFVA 3B4YA 4GZIA 3QYSA 3O6DA 2GDUA 3ARRA 3GDRA 1TWSA 2OO0A 1R87A 1CGTA 1XIMA 3ELFA 1OCBA 4C1KA 1AMYA 1KV5A 5LNSA 3AZSA 3IJ8A 3CH0A 2VXNA 2DW6A 3OLIA 3WQFA 2A79A 1G4EA 3HBLA 3N9KA 1MEIA 4ERAA 3GG8A 5I2UA 2YYUA 2NX9A 4MMWA 3UR7A 4HA0A 3TAOA 1LF1A 4D8LA 5D2YA 1GVQA 4O0ZA 3UETA 1GKPA 4ZTYA 3IRDA 4D6GA 1OC5A 1Q85A 3UR8A 2DZPA 3E5BA 1REQA 4CD6A 3EXSA 3QRHA 3LRLA 1EX1A 1ITUA 3NURA 1R9XA 2W63A 1LWIA 5HDRA 3DXIA 2A3EA 2GUUA 3IK4A 3WH9A 4H6QA 2VWSA 3NDOA 4Q4MA 1O6IA 3WG6A 4N9CA 4GQRA 4PTWA 4YWIA 1C91A 2NT0A 4EPBC 2Y7DA 2ADAA 3B0PA 3W07A 3QH2A 1VCVA 3M5ZA 2BGSA 4K37A 3U2OA 2PDHA 5XIAA 4PUEA 4AC1X 4AF0B 3RLVA 3WELA 2PDUA 2NUWA 3TQVA 5EMYA 4AIEA 2I9EA 5L9FA 1S2WA 3TC6A 4LQ1A 1IT0A 4M29A 2PWHA 3AS1A 3FJLA 4S1FA 3U9IA 1TV5A 2Q6ZA 4XTDA 4PMNA 1XYZA 4KFOA 1E1EA 3Q94A 4N6EA 2INZA 2RGLA 4MLRA 1J5TA 1QDSA 3W6LA 4HZMA 3PULA 4MLJA 4M3PA 2Y24A 1M41A 2Q02A 2HEJA 2C1HA 1KA9F 2R1MA 1E15A 4A29A 3DHFA 4J35A 3H4XA 2ZTKA 3OBAA 4K7VA 4AISA 3M0VA 4TU1A 2YZ5A 4WKFA 3NOYA 1ZY9A 4HZ8A 2Y5EA 1EZ2A 4IIEA 3C8FA 1PSCA 1WYIA 3KRBA 3H26A 4UTTA 3BOXA 3FKKA 4UQDA 3IAQA 5DMLA 1JF6A 3QKZA 5J8LA 5BXSA 3H53A 3QY6A 4QNEA 4DELA 5CZTA 1HJUA 4A3YA 4R27A 1Q6CA 4E2BA 3KOWA 3W73A 1E6ZA 2O56A 2BMBA 2PWFA 3AAMA 3Q65A 4H8UA 1V3MA 2YYTA 1MXSA 2YOCA 2CWXA 5HNUA 3MS8A 4UIOA 4PBEA 3DEQA 4UC5A 3WLRA 1POJA 1GOQA 1QFEA 4JKKA 2QDDA 4JOMA 2ATSA 5CGMA 4GY0A 2OB3A 3H4WA 4TO8A 2I1OA 4J3XA 2PDYA 1WDQA 1VBUA 3EMQA 4NXKA 2H3DA 2X2YA 1H2JA 2I56A 5AC8A 2I5GA 3DFSA 5EGRA 3HQOA 2GGIA 4PMRA 2I57A 4X9YA 3OBEA 5DMMA 4F4RA 1HGYA 5HMDA 3VUSA 4D71A 1X6NA 4B3LA 3MSDA 1BXCA 4GI4A 4C7GA 2DUZA 1JZ8A 2WBGA 3N15A 5F7UA 5IM51 4D1JA 4NYUA 3A3XA 3GDKA 1FH8A 1KGUA 4J3WA 4GZEA 2KX9A 2QQ6A 2V69A 3W2LA 3W7HA 4FLQA 3LD5A 4QLJA 1V77A 4HBKA 3W29A 1TWWA 4N42A 4FXRA 1E9IA 4A21A 4YTRA 4QE1A 3S8HA 1YIXA 4Y90A 2J7HA 1YXYA 2GQ8A 1UASA 4RZ4A 3LLDA 1UZDA 4WKHA 4LSBA 3UPWA 5D09A 3BPWA 3MUIA 3TN4A 1FTXA 3H7UA 3QKEA 1KFLA 1FWGC 1SSDA 1MSSA 4PMYA 2ZXAA 3B8IA 3HA1A 4Q7BA 4EACA 3C3UA 4GOAA 4H9MA 4O18A 3WL1A 2ACQA 1OT1A 4XZLX 5EMLA 5E0CA 5FF7A 2XVGA 1CGXA 2VZOA 3ARZA 2V30A 3L4ZA 4O19A 2WANA 4CGTA 1PDYA 4KETA 4DZIA 1Q2SA 4DJFD 1JAEA 5CQ1A 4AMCA 1R5YA 3E2VA 1QHZA 3LY0A 3PBUA 3SM0A 2O9PA 2A3HA 1V02A 1N7KA 4DB7A 3RU8X 3W6YA 3M41A 2QUMA 3SW6A 4XK2A 1UIOA 1QPQA 1TRIA 3ONCA 3U8GA 5RUBA 3LSCA 2FZ8A 2QCHA 1K9EA 1EGZA 3BLEA 5DANA 1LWHA 4C6OA 1JI1A 3EOSA 3B9OA 2HVOA 1TO3A 4JX5A 2Y89A 4GX9A 2FB2A 5E9AA 2PGFA 3SCPA 4HK6A 2XFYA 4CNSA 4HVXA 3OW1A 3F7JA 2VC7A 5TD4A 1HKWA 3NR0A 3LTYA 3LCWA 3NQDA 4ZMGA 3EKGA 2VC5A 1TV7A 1GT8A 2W79A 3UXKA 3KRSA 3QTGA 1WOBA 4FXJA 3LXAA 1A5AA 3CLWA 3GW3A 3OVGA 3BOFA 1OB0A 1PEZA 3UXDA 5HAOA 1AZ1A 3CMJA 3LUTA 4OKDA 2AGKA 1FCUA 1XG3A 2YDSA 1FWIC 4FP1A 2J4GA 2FZDA 5CGTA 3TYAA 3WLPA 4YVXA 2VHLA 2Z1WA 3E2SA 2ZC1A 3VKAA 1W2VA 4DWDA 2ATMA 2WC3A 4GUGA 3JR2A 2V63A 1V03A 2F6XA 4K39A 2QJHA 2YL8A 3GVRA 1H49A 3ATZA 1HKJA 4MB5A 1LL4A 4XISA 5BRPA 4B5SA 3ZQ9A 1VFUA 3PF3A 3LQLA 3AALA 3QTPA 2GJNA 4ZBCA 4FXFA 1UBPC 2IKHA 2VEKA 2YA1A 3E0FA 6PTDA 4BWLC 5TAOA 2QCGA 4AZ5A 4P7OA 1FCVA 4S3KA 2CZ5A 3LBCA 4PN2A 4NRRA 4JIRA 2DH2A 2CHNA 3UZXA 1MZRA 3DZ1A 1W37A 1RV8A 3QR1A 1UR2A 4XBJA 3M0XA 3M46A 3VOIA 2EJAA 1PV8A 2E09A 4DWSB 4KIEA 3LXCA 3M6DA 4YVPA 1DIDA 1R38A 1G67A 2A85A 1OCQA 4C5YA 3HM7A 1RLCL 5PTDA 4GACA 2QIIA 3ZZ1A 1EDGA 2AL2B 4UTJA 3TTQA 3KCLA 3F4DA 5F1VA 2WXDM 2ZKMX 3VKDA 3MA8A 2ZUSA 3W2UA 4FMVA 1F3EA 3FA4A 2PDJA 3PPHA 1YPFA 3EA1A 1UWAA 5BXRA 4K1WA 5I5RA 3U7BA 3LPOA 1L6FA 9XIAA 2BTMA 1DPMA 3LPPA 5M03A 3WUFA 2FH6A 4H6EA 4ERIA 2F7FA 3NQEA 3IJ7A 5LIUX 4I9MA 3K13A 4W86A 1GEHA 3O06A 3VKJA 1RA0A 1LM1A 3HGJA 1XLDA 3OA5A 1TPWA 2OX4A 4REQA 4R9XA 3RMJA 2X0YA 1H11A 3JUGA 4HHHA 5L6UA 3NM1A 3IRSA 1F4HA 2IKGA 3WD4A 1B3ZA 3S9ZA 3B8SA 5FF2A 3TYEA 4GVIA 1QVBA 1EJTC 2QGHA 4IPNB 2J8FA 1TWDA 1A49A 2CBVA 1NDVA 1FWWA 1S5VA 4UUIA 4DUVA 2Y7FA 3TSMA 4DPPA 2BVWA 3C0JA 3W24A 3VGEA 3DHUA 4OUIA 3C0LA 4FI4A 5AHMA 4JQAA 3PPGA 1OG0A 3R13A 1XM3A 3AIEA 2WHKA 4I7VA 1PHQA 4C60A 4O0KA 3GC5A 2X1IA 3ZO9A 8A3HA 4W93A 3ZT5A 1R2TA 3HV9A 1B54A 1TPH1 4JKMA 4OQVA 4Q32A 3G1YA 4QEHA 3ZVHA 1UWUA 1EZWA 1TMLA 5D03A 2C14A 2QZRA 2C19A 4XAGA 1DIEA 3SN4A 4LS1A 2Y5JA 4G5DA 3SRKA 3NDZA 1FY6A 4NZ5A 1EBGA 3OEXA 3OYXA 3L5AA 3S2LA 4QRNA 3LMZA 1GONA 2EAWA 2NZLA 3EWUA 4ADUA 2Z7GA 2OZ3A 1TR1A 2VX4A 4LNYA 1V0NA 3EEZA 2CHOA 2I14A 3CPUA 3O7UA 2VOMA 1QI5A 1Q7MA 3B3DA 2P3ZA 2GFTA 1K8ZA 2JF7A 3SN1A 2NXIA 3HU7A 5LA0A 1ZP3A 1JZ2A 1C7SA 3KTCA 4D6HA 1T5AA 3MP4A 2WVVA 1I8JA 2ZRWA 5REQA 3P5ZA 3GUWA 1C29A 1W5NA 3EX3A 1XD1A 5A5WA 3QPZA 4AZ6A 2H8ZA 1AQHA 4PBGA 3MO4A 5MKGA 3W7QA 2WMIB 3TV8A 5AHEA 1XCFA 4RPPA 2FYMA 1KR1A 3SO7A 2OGJA 1N2VA 1FDJA 1ZBWA 5C55A 3B8WA 1U33A 1HJXA 3PZOA 3P67A 1QPNA 1WDRA 1Q6QA 3PBWA 4JQ2A 4J2MA 1LRTA 2YR1A 1YPXA 1OF6A 4OBSA 3UG5A 5C5YA 4Q8OA 3S1XA 3WK1A 3SCTA 3TE9A 1XICA 4GRSA 1X97A 3AHVA 2J88A 5KINA 1XLGA 3UY8A 1XLCA 3RPMA 5GJPA 4LAUA 1TR9A 4LX4A 1IIGA 3CUZA 1J11A 2DORA 1TVNA 3LMYA 4F0RA 3B8TA 5I00A 1W9DM 2OEKA 3EX6A 1Z44A 3SY5A 4QNWA 4PL1A 1BFNA 3PTDA 2GJXA 1BXNA 2AAMA 1KBLA 3VAVA 2I17A 1WV2A 3DDMA 1XL9A 2WB5A 2CW6A 5H91A 1IGSA 4JQ4A 4BKNA 1T8XA 1EB3A 4B91A 4E6MA 1UC5A 4C1NA 2F2KA 3NYDA 1GVIA 4OV4A 1F4AA 3CASA 4M1BA 4O0QA 3W2JA 2HCVA 3EBVA 3II1A 3T09A 5LIXX 3WDRA 3BAKA 2A4AA 4R7WA 3EXTA 1UG6A 4JDYA 4RDZA 4P7RA 3G77A 1TPEA 3EWXA 4HNLA 3QVQA 1O5RA 4GMEA 3VNYA 3O6YX 1FCBA 3NO5A 2BDQA 4O12A 4UQAA 1ODZA 2DT1A 2J25A 3DAQA 1OFEA 3DFTA 2ZXQA 1QOXA 3AHTA 1CW2A 2NVAA 1VB9A 1F6YA 4ERGA 1QT1A 2QJNA 1Z6KA 5D32A 1O1HA 2OT0A 3GO2A 4Q6XA 1RQHA 3BAWA 3FDKA 1KM2A 3MUZ1 3DYPA 2XWDA 1XGZA 2VRKA 3F1QA 3UP8A 4P8XA 2P3EA 4XBKA 3UCQA 1VR6A 2EPHA 3P0XA 3TX9A 3WNNA 1LORA 2E77A 3SCNA 1NEYA 1X8CA 1UPMB 1X7IA 3AMKA 1Q7ZA 2YCKX 2PC8A 3P14A 3P0WA 2JIWA 5DQPA 4FNUA 3KW3A 4J2PA 1I4NA 2R9RA 5FEPA 3ATYA 3SSJA 1Q45A 4YIWA 1SMDA 4YL2A 4GBUA 1SJDA 1RXOB 3EPOA 1QI3A 3MMWA 2QGYA 3LNMA 3MZ2A 3P93A 5BOOA 5I09A 4NNAA 2YXXA 6TAAA 3HMCA 3N13A 4DX3A 1AH4A 5FF0A 3G8RA 2PWGA 4FSAA 3BJSA 2W27A 1ECEA 3V3WA 1XH2A 3UG3A 1TV3A 3GZAA 3U5YA 2YJQA 2CIPA 3BOLA 3WBWA 3LYEA 3GXIA 5CJNA 2V67A 3NQAA 3BAIA 3K30A 1XSKA 5SWUA 4XTIA 5KTLA 5GNYA 4HU4A 3CIXA 1K02A 3AC0A 5DRCA 2ZXBA 4Q4SA 1J0YA 5I3GA 2QDGA 4B2DD 3LPFA 4M19A 2AMXA 3WIJA 2E6YA 3RO8A 3ABQA 3KM8A 3G3DA 3OG2A 3NZ1A 5BXTA 2OXNA 1HL2A 4Q4RA 2OQHA 3VIOA 4PCTA 3QPEA 3ZM8A 3TZNA 4BI7A 1G69A 1QU4A 4NNBA 1E51A 3K2GA 1IR2A 3EEGA 3QPYA 4IQEA 2PDWA 2PC4A 2A21A 1JAKA 3M5VA 1TELA 2YDAA 4J3ZA 3L68A 4MM1A 4MFDA 4WEVX 5LGZA 4DF0A 2QMKA 4JHMA 4B16A 2BGNE 1Z3NA 1W56A 3FY1A 3OVQA 5I3KA 2FJUB 2X42A 4RX0A 4CU8A 3G1FA 2DVUA 3T2OA 3W85A 3DGBA 4C6MA 1MRAA 2E6FA 5BRBA 3ZWTA 6ENLA 1KFBA 4EE9A 3HFTA 3MBFA 3B4UA 1W6TA 4M7SA 2ZBTA 5CZJA 4AEEA 2OMAA 5LKYA 3BG9A 3CQKA 3WLHA 1TE6A 1LCOA 3ARTA 3FYPA 2NV1A 4MPKA 4MADA 2IPWA 1IWAA 4O14A 1Q8JA 1BLIA 3RK8A 4L9YA 3HQPA 4IMEA 4EF8A 1YXDA 1FHUA 2VC6A 4IH3A 5EMUA 3MV01 1ZAHA 3TROA 3H2MA 3RM8A 5T26A 1XCXA 3A3HA 2Q8ZA 5T9BG 2QUTA 3AROA 1XBZA 3W1NA 1YTKA 3EDFA 4YNGA 6A3HA 4O1BA 3WF0A 1XX1A 1JGIA 1ZL1A 1HZYA 4W8BA 2OYKA 2C91A 3SR7A 3ZVIA 1SM9A 3ZXWA 4A35A 5C9WA 4X0NA 3S1GA 3W00A 1NAL1 2GWGA 1UMYA 1R8LA 4BQ4A 4HNCA 5A69A 3IJDA 4GABA 1OSEA 1S5WA 5MHBA 4WSHA 3GDTA 3PJUA 4L5ZA 3V0UA 4XUYA 3VOCA 4Q22A 5C7VA 3THUA 1V6WA 3PZVA 4DVOA 4AEFA 1JDAA 3FV9A 3BSGA 1WO2A 4MNKA 4XKMA 3VDHA 5AB3A 4I9JA 3OHMB 4UTTC 2ACSA 1FWHC 4Q8TA 1B90A 4UR7A 1UCWA 1REQB 1W9PA 3NPWA 4TOQA 3T4CA 4X22A 2FDMA 1R3RA 2HNHA 3SDOA 1S39A 4NG3A 4U4MA 3BV4A 1FP8A 2GSEA 2P10A 1DHKA 6XIAA 1XS2A 4M51A 3TA6A 3V5OA 3RX3A 5HMFA 3UFYA 1YDOA 1OM0A 1RCXB 1F8IA 4OHQA 3CHCA 3EPNA 4IZGA 2HZGA 2V5KA 3TLQA 1S3TC 2WHLA 4IPJA 1UZ1A 1FWBC 3LNPA 2X1UA 4N4QA 5HOSA 2WC7A 5GJMA 3AUOA 2GVYA 1PIGA 2W9MA 1SW3A 1UBSA 4QS5A 2VYOA 2A3AA 3O15A 2PRLA 4B92A 4RK8A 3GW0A 2FZ9A 4OFCA 1H50A 3L0KA 4PCFA 4US5D 3ZSSA 4UZSA 1I75A 4RR4A 2D73A 3BTNA 4H9UA 2CEQA 1L2UA 4FOKA 3NG3A 1IXNA 4B5WA 4F0KA 2Q71A 3N4EA 3HN3A 5A6SA 5CCZA 1XCWA 1BKSA 1EBHA 4GCXA 1TUFA 4A3UA 4DI9A 1GOKA 1H5VA 2F61A 1UKSA 2W6RA 5HMEA 1VFLA 4B9ZA 1RR2A 3OZMA 2Y2WA 5HNTA 4CD7A 3AZRA 3GNPA 3CAVA 2C8NA 1F6PA 2DVXA 2EG7A 3ABZA 3G0UA 1PDZA 1TJ0A 2IXVA 3O0FA 3LCHA 3HOJA 3BGJA 4Q8VA 1UD5A 4AB4A 4IICA 3H23A 4V33A 5LNWA 1OZMA 3NQ7A 3FAXA 5TNVA 4XD6A 1V0LA 3SZ8A 3NEVA 1WPCA 4EP8C 1JVNA 3SY8A 1VKFA 2G3MA 5AHFA 3ZR6A 1GVSA 1E9YB 1FX6A 3QZAA 1K8XA 7ODCA 4FHAA 3L66A 2DIKA 3GNNA 5IRPA 3GVQA 2YA0A 1UH3A 3FHQA 3BAXA 4Z2IA 2VT0A 3CZGA 3NXFA 1QO5A 5AYYA 3TN6A 3P74A 3W25A 3S1VA 3BLOA 2YXOA 5A6TC 5I03A 3GUGA 3C52A 4NZJA 3USZA 5E70A 5I77A 2DEPA 4YJ5A 1JI2A 2G8ZA 4GZ7A 4HPNA 1ZJHA 5AOUA 2NWSA 2TPSA 1KW1A 5A2BA 1PTGA 4AZ7A 1ZNNA 3LERA 3LHVA 1SU5A 4H9VA 3FJ4A 4IFKA 3CQ0A 1H51A 4B5UA 1K8YA 3I4KA 2C79A 2GQ9A 3WLOA 4GYKA 6CGTA 4WOZA 3H21A 4IT1A 1VS1A 1VPQA 4A3QA 1HKVA 2HMCA 1E5JA 3CYVA 4AW7A 4M80A 1GPWA 4UTWA 1IZCA 1TQXA 5HWJA 3H24A 1FHLA 1UQYA 1F8MA 3BO9A 4OBRA 3DYOA 3NJ3A 3AMCA 2ZWZA 2WZEA 1PWLA 4B2DA 4FLOA 4JY8A 1E55A 2B7QA 1I1XA 1C9DA 1SJCA 3UWVA 4PTDA 3LU2A 3U2CA 1TSIA 3KS5A 3WH7A 1TVLA 4NL1A 1J5SA 4CNNA 4OVXA 1E70M 1RBOB 2R24A 1PL9A 3H55A 3ARVA 3GHUA 4B5NA 4A05A 1A47A 1OABA 3A21A 2I9UA 5JVLA 4GQBA 4MJ2A 2NQHA 4IMGA 2DPEA 3DI0A 1H7XA 4S3JA 1TJRA 3B8DA 2OLAA 4IIDA 4D6CA 2I7GA 4QISA 4QIUA 3LLXA 4WCJA 4XQ6A 3S3GA 4CD4A 3EWCA 1JCJA 1LT7A 3JS3A 4CLMA 4ZL1A 3GM8A 1UP3A 1EP3A 4IM4A 5AYIA 2NWRA 3FA5A 3KOFA 3IPWA 2BY3A 1CXEA 2VX5A 4R88A 4A6GA 2DSVA 3DFPA 2O9RA 3B97A 3GU9A 4LU0A 2GGJA 3PBVA 2XTKA 3K5XA 4LTSA 1FWSA 3KL0A 2A1YA 2HPIA 4GINA 3FW6A 4F0MA 3MI6A 1WNOA 3ZIZA 1HG3A 2XSAA 4Y8FA 1W32A 1HT6A 5BYWA 4BQ5A 2J7CA 1R7AA 4R3UA 3GHRA 5GQBA 3ID7A 2HBXA 1E0UA 1G9HA 1MDRA 3Q4DA 1Q6EA 4HSHA 3KOXA 3GKAA 2CCRA 1W3TA 2E5DA 4AZCA 2TMDA 1BRLA 3R0KA 2Q8LA 2RDTA 4YWSA 2E40A 4D72A 4DI8A 3RDKA 1ISWA 4S23A 1WKFA 1W8GA 1ME8A 1P6CA 1KKOA 1WXJA 5E6YA 2A3BA 1H0IA 3SUUA 3ZLFA 1J18A 1E56A 5GPRA 2NQZA 4TQTA 2PZNA 1E4MM 2Z6IA 1S2TA 3IIXA 3UA4A 3W1QA 2VRJA 4J27A 4DJEC 4FX6M 3R4IA 4KCVA 3YPIA 1HO4A 3CL7A 3BURA 1XG4A 1JZ4A 3KBVA 3DHDA 3QFEA 4L1XA 5EFDA 2WVVB 5DF0A 3RYSA 1SZRA 1XGEA 3MUAA 2E28A 1I45A 3W3OA 1Q6RA 1IT8A 3CM4A 1W8SA 2PGWA 4DIAA 3E9AA 3ALFA 1EO7A 3FS2A 5E09A 4K36A 3G0XA 1M9HA 1EYEA 5D37A 3UZWA 2XUCA 4E3VA 3S5OA 1XYBA 4MIMA 4UXDA 2PU1A 4AZCB 6XIMA 3D6NA 4GNVA 3RGTA 1RQEA 3G18A 3GVGA 4C7DA 1AA1B 1VEPA 2E9MA 2JIEA 1GKRA 4M81A 1YHTA 1RCOB 4AMAA 1UD8A 3HGSA 3LBOA 4E4UA 5DXXA 2W4XA 3LTPA 5C2CA 3NQ8A 3BW2A 4S3BA 3RM9A 4J3UA 1Q65A 5C2GA 3WNKA 4K38A 1JCNA 4G1NA 3HPZA 2G3FA 4LT9A 3DBNA 4RNHA 3O16A 3CUGA 5K9CA 3TMQA 1S2CA 4A8IA 3TKFA 2UV8G 4JYDA 2BXYA 5ABTA 3W7OA 1MQRA 1GEQA 3TJ4A 5CBBA 1OHLA 3N2XA 1E4NA 1F05A 3RAOA 1DTUA 5A3HA 4J3SA 4FIQA 1LJYA 4R53A 4XZ9A 4A8NA 3RRXA 2E0PA 4W89A 4AF0A 1KLZA 2B7OA 3LX9A 3VKKA 1T40A 3TYBA 1XRTA 3FCPA 3GAKA 2DQWA 3IJ9A 3UZZA 2D2JA 1Q4WA 4J1OA 4AVFA 3CV1A 1PIIA 4CQBA 4GUJA 2WSRA 5G2HA 3TU9A 2DZSA 2KAUC 3ZJ6A 3W37A 3KUMA 1DOSA 4B3ZA 1OGBA 4ICCX 4AD1A 1E6XM 4WHBA 2WMGA 2PTXA 1ICSA 4XIMA 1B30A 1EJRC 1L8PA 1WAUA 3SFKA 1XXXA 4MHBA 1EH9A 2GDVA 5JBDA 4MOZA 4GIAA 3GTNA 1W3IA 3BLKA 4EXBA 1U5HA 1NY1A 4MUZA 1QBBA 4ZSUA 1LRNA 3PUOA 4I5RA 3VIHA 1TPC1 2PDLA 4WR3A 4M0XA 3QC0A 3RCYA 1OX6A 1X6UA 3WQGA 3CH9A 1HKIA 2Z26A 3MUCA 1TZ9A 4PZVA 3FIGA 2Z1SA 2PP3A 2W66A 3ITVA 2QJIA 3GD6A 3F4VA 4UWMA 1XRSA 4M56A 1V3HA 1H7OA 1Z7AA 3MT1A 4US5A 3GH4A 4TTUA 4MYAA 3CV7A 3EMCA 4HQVA 4LC8A 3L2LA 3TSBA 3MMDA 4I9TA 1UA7A 3UWEA 3LZ3A 4P7NA 5DEZA 1BSIA 3W7PA 1RD5A 1FWDC 2ASHA 2UBPC 4XIAA 1BPLB 5CEWA 4TVDA 5CG0A 4MZ8A 2Q8XA 4NT0A 3QMSA 3L0GA 2A5HA 4H9XA 3D0CA 5DCEA 3TEVA 3EKZA 2OZTA 3UYIA 3NSXA 1WDDA 4HTYA 4TMCA 5I78A 1DJHA 4I5XA 4NASA 1OX4B 4QEEA 1QWGA 4HU8A 5LXEA 2JFEX 1ZTVA 5FAGA 3CHFA 1HTIA 3A23A 4QSFA 2PBGA 1UKOA 5HBFA 2FZMA 4HA1A 4DUWA 1CPUA 1BF2A 3PUGA 3AICA 4KEVA 4LVBA 8XIAA 4JZ5A 1D8CA 4UTLA 4MVAA 4H7VA 4G7EB 1W1ZA 7REQA 2HE5A 3BLLA 1EQCA 1EIXA 1KFEA 3ERPA 3KRUA 2NQ5A 4GO9A 4EVZA 4EPKA 3AOFA 8TIMA 5EA9A 2DU2A 3RR4A 4LYRA 2HISA 4DEFA 2REQA 1ESWA 4PTMA 2UY3A 3PANA 3PJTA 1OBAA 1L2QA 3SCVA 3R8GA 4F0LA 2E9BA 1TMHA 4GISA 2B7NA 1WZMA 4BQ3A 4F79A 1SR9A 1O5KA 3L4UA 4QROA 5TQLA 3TR9A 2CNCA 3F5LA 2G50A 4C6LA 1HX0A 4C6BA 3I68A 4J3VA 1XLFA 2QR6A 1X98A 2WQDA 3POHA 5D8ZA 2V5JA 5HINA 3U57A 4AZIA 3THCA 4IFKB 1GYLA 2BHZA 4EAMA 2AGTA 1OG6A 4IL0A 3NPXA 3A5VA 5HK4A 1A0CA 1S2VA 4LBRA 4HPJA 3IUHA 3OP2A 2FMOA 1FUYA 1A0EA 2E5BA 1XH0A 1OD0A 3LHYA 4NQ1A 3IACA 2MANA 2PUZA 4ZO9A 1R2SA 1ZJIA 1GJUA 3NL5A 3XINA 1PE1A 2VEPA 4JHOA 3B03A 2OWXA 4OBTA 3BGGA 1EJXC 2YCEA 5HMSA 2RAGA 4F2UA 1OZQA 5CLTA 1SO3A 1WX0A 2WO5A 4V2XA 2ZTJA 2E68A 3G1HA 3U2ZA 1Y65A 4KFPA 4LGXA 1GOWA 4BCEA 1BGAA 4YTUA 1PKLA 2BOFX 1TX0A 3CAWA 4PRTA 1TTQA 5T9CE 5AHIA 1ICQA 2BOEX 5HWMA 2FGZA 4GLEA 4QAIA 3W01A 5GVJA 3LS9A 4PMZA 1CECA 5CC3A 5JUVA 2Y70A 1UJPA 2H6RA 2Z1BA 2ZX7A 4NZ3A 4HOWA 1JCMP 1YEYA 4DBEA 4DF2A 4ADTA 2ZX9A 3LHTA 4TX9A 2Y85A 1NF0A 2XGBA 3VOFA 5CC7A 1SVDA 1F07A 3MSYA 4PFHA 3RG6A 1ZJAA 1W5PA 5HQEA 1AH3A 4HB7A 1XRVA 3T55A 2CZVA 4WY0B 1UR1A 4V1YA 1IEQA 1A5KC 1E40A 4W5ZA 4UB9A 4INFA 2CYGA 3PWAA 4HZ7A 2WMFA 4OJYA 3W28A 4G7FA 4KH2A 4ZA0A 5FKYA 1XHGA 2NXGA 1DJZA 4GJJA 4KGLA 2V5CA 3M9YA 3XISA 5HULA 1JJKA 2JF6A 3S6OA 3S2JA 5IBXA 1C3FA 3L2MA 2ZZ3A 1OCNA 1U30A 1EGMA 1XLKA 4AIOA 1RHCA 3WX7A 3TVAA 1Q6OA 4YS1A 2DDXA 4MJMA 4XZHA 2FGBA 5D9NA 1PXGA 5FSDC 1A3XA 3HJEA 4DBSA 1QK0A 4U28A 2DJLA 1LRQA 3OJGA 4EWJA 2DW7A 2D2OA 2WKGA 1A5LC 3BXWA 3FLUA 1G94A 2OLSA 1W9VA 3PBMA 2DSKA 1OEPA 4D1IA 3PY2A 1BVWA 5A6AA 3M47A 1XSIA 3PZMA 2C7FA 2PEVA 4JIPA 2EEXA 1GG0A 3PFMA 2CKRA 4TUFA 1XW8A 1M01A 1F73A 3ARPA 1BVZA 1FH9A 4IIGA 3FGCA 2WQPA 5CLWA 2PLCA 4KT2A 3TYCA 3RNDA 3LBMA 3WQ4A 1IE7C 3D46A 1KFWA 3OZPA 1A50A 1AQFA 3TDFA 2J7GA 4GQGA 3AXIA 1EC9A 1J0ZA 3TSDA 3T0DA 5XIMA 1UYQA 1UR8A 4I5UA 2GOUA 1R2RA 1KQYA 1IZKA 1ZB5A 4HGXA 4XD3A 2D3LA 3LCXA 4ZZ9A 2WNWA 1F2JA 2GVGA 1RBLA 2FPTA 4AWEA 3TP4A 1EJ7L 4R34A 5F1UA 2YW4A 3T0TA 4ES4A 1IYXA 1XR2A 4NZ4A 4IG2B 1OJXA 3TOPA 4DJDD 1R3WA 1NDYA 3UXAA 2RDXA 5ECVA 1TPUA 1JPKA 1N8FA 4Q6JA 1T99A 2C71A 2P8BA 4P7LA 1R86A 2FB3A 3DG7A 2X0HA 3GVVA 3VX1A 4BEQA 1V3JA 2J75A 7TIMA 4YYCA 5K4XA 4ZTXA 4HN8A 3LHWA 1IR1A 4O52A 4F48A 4ADSA 3BJTA 3T81A 1XJBA 2VWTA 4CEUC 2NQ9A 1TWZA 3QLDA 4FXSA 3GFZA 4US6A 2YL5A 3UWWA 2YB4A 4NY2A 3A13A 1RSCA 3LG3A 2HNEA 1YBQA 3SAZA 3SIZA 4WJ8A 4PB4A 1KBJA 3GNOA 4IISA 3PZGA 2PF0A 4BI5A 4LUTA 3EWBX 4PTXA 3NGJA 1P6BA 4LVGA 3VGBA 2VC9A 2C3ZA 4BY3A 4FOUA 3ARYA 1CLKA 2BV9A 2G4JA 5D02A 4UFMA 5EBAA 2ZUWA 1FWRA 5E0FA 2AAAA 2E7FA 2PDXA 2J66A 1V7YA 2JBMA 3T2PA 2VFHA 4ZENA 4PUDA 3BZJA 4H41A 5JQ9A 3HIJA 4BS0A 5I3IA 3I6RA 2NVCA 3CB8A 3MO7A 3CTTA 2VFDA 3QV7A 2V2HA 2YCLA 1FXQA 1ZAIA 4H8NA 1K1DA 3U6WA 4J40A 4FNRA 3CC1A 4GQQA 4XKYA 1SFSA 1PCWA 3AWNA 1RY0A 2VD8A 1TMQA 4HNOA 1L9WA 1Y0EA 3N19B 1WAWA 1WE5A 3AIWA 1B9ZA 2WMKA 4K8HA 4NJGA 1QNRA 2AQOA 3WEOA 5AFDA 3GR8A 1ZSXA 1ZLPA 1JYVA 3T0BA 2ZWYA 5HNNA 1JYXA 2VRQA 2XVKA 2XN1A 2FMNA 3PZNA 3VNIA 4HYVA 4FZIA 4QJ1A 3R0UA 5A6KA 4C6QA 2CITA 1ZP4A 3CZ8A 3T05A 4TX8A 4XD4A 3V7PA 3R8HA 2QVHA 2WWCA 3RJYA 3PZ9A 4AXNA 1HIZA 1I0BA 4DO5A 2Z2BA 4BF7A 3DFQA 1NWTA 2GVLA 3MI2A 4QG8A 1MW2A 2XGIA 3L7RA 3OQ8A 4O4WA 1E43A 2PB1A 4Z1DA 4DZAA 2Q01A 3W7NA 1E3XA 4UNIA 3B0XA 1X8FA 1CX9A 2EQDA 2CLHA 3QF0A 4OOUA 4LS2A 2PDMA 2Y7GA 1E9LA 4S3GA 2IMRA 2C15A 3CIWA 1XC4A 4KPLA 4ENLA 1PJ9A 3APGA 3ZLGA 4C6JA 4AY8A 3EWYA 1Z9AA 3EDDA 4JN6A 2PE4A 4AG0A 3CV2A 3FJNA 3S2MA 4HNVA 4JFTA 1UROA 1F3WA 3RPTA 3OGVA 3FVDA 4MZ1A 1TB3A 1UPPA 4AIBA 2PA6A 3W83A 3C0QA 2IKJA 3KWSA 4M1RA 3F2BA 4LV9A 1JYWA 2DFAA 2G37A 3S1WA 1M6JA 3ZR4A 1W5MA 3GH7A 3O9NA 1B9BA 3UYCA 4O11A 1QW7A 3C2YA 4JKLA 2JALA 5DCBA 3UT0A 1P48A 4YU1A 4NF7A 1EFZA 1EJUC 3NM3A 2EPKX 4LALA 4AX6A 3TFXA 4PH6A 3ITCA 3UERA 1V6VA 4E5TA 1UWSA 2A3CA 1FHVA 5B7YA 1VBJA 3URQA 3KL3A 3PJXA 1K4GA 2ZUVA 1HNYA 4KMQA 1B3VA 2PDPA 3FFSA 4OGZA 1W9UA 4GKTA 1O94A 3TMLA 3UGRA 2YFNA 1OCJA 4QDMA 2RJHA 4D6DA 1BQGA 3KBNA 1MW1A 3QEZA 3T0AA 1XI3A 2EG6A 4CKQA 4GG9A 3SGUA 1RVKA 2GSHA 5H8PA 1BWLA 3AIUA 1E73M 3DERA 2EO7A 3W7IA 1MUCA 1QATA 2XINA 1HQTA 1WXYA 2O55A 4UOJA 4AD3A 1VFHA 3RX2A 1LOQA 4O15A 3TTSA 1PB0A 4H4IA 4HJWA 3CAKA 2OSWA 4IQLA 4DUOA 1XWYA 5CSUA 2G3IA 5BWFA 1PKNA 3G24A 1ISZA 1IEIA 3W84A 3PS7A 3STPA 1ZJBA 2PTZA 5KMYA 5BMXA 1EC7A 3MDWA 4ZXLA 2VFGA 3I4EA 4KCUA