2Z0IA

Crystal structure of 5-aminolevulinic acid dehydratase (alad) from mus musculus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
323
structure length
283
Chain Sequence
VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSREDSPTIEAVRLLRKTFPSLLVACDVCLLSEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-aminolevulinic acid dehydratase
publication title Crystal Structure of 5-aminolevulinic acid dehydratase (ALAD) from Mus musculus
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 78
structure length 283
sequence length 323
chains with identical sequence B
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z0iA00
4PFMA 5K4ZA 1FBAA 3ELFA 3GIYA 3UY7A 3W2UA 4JYDA 5FF0A 2A7RA 1SW7A 1WOBA 3W7HA 1UJPA 2D73A 1ZENA 4M5PA 1TV5A 5AHIA 4HSOA 1W54A 4JTEA 3DFTA 2CLOA 1X8FA 5HWJA 3CIWA 4FXSA 3WK1A 1O60A 1AG1O 3G24A 3M5ZA 4FX7A 2FPYA 1LOQA 1XFBA 3QW4B 3FA5A 1JJKA 4RV8A 1SU5A 3PSWA 1FY6A 3S5ZA 3ZR4A 2E68A 3RMJA 4OT7A 4UTKA 1OJXA 3TJLA 4I9AA 4A2SA 1EA0A 4O15A 2PCQA 3NZ1A 3UYCA 2ISWA 1HG3A 4LRSA 1HUVA 4UTWA 3W23A 4AXKA 1IXPA 3MUXA 3M5XA 3R2GA 3DKJA 4QQ3A 1ZNNA 2CZDA 3USBA 1K8YA 4FNPA 2QCNA 4XZ9A 2Z2UA 4MFDA 3QQ1A 2Y7GA 2OJPA 4YMZA 4NJIA 2VFHA 3MYPA 1GQNA 2QCDB 2HMCA 3O07A 1N55A 3E49A 5CKSA 1J4EA 2QEZA 3PM6A 3NAVA 3G0UA 4O1AA 1LRTA 5HULA 4LW7A 4ALDA 3C56A 4LOCA 3QJAA 2PRLA 3G1FA 4RLIA 5K2ZA 4HKPA 2J88A 3LHUA 3O6DA 4K7VA 1S5VA 3M0ZA 1G4SA 4QM1A 1MO0A 1GTEA 1F6KA 1KTBA 4LS2A 4Y9AA 2PC4A 2WKJA 1BTMA 3PR2A 4IMDA 3GB6A 4GXMA 1YTEA 2A4AA 3LM7A 3MJYA 3C2EA 3QMRA 5I3KA 1FDYA 4GE8A 2E5CA 3C8FA 3DHFA 3OVQA 4CNOA 5HR6A 4GUGA 1OFRA 2E6DA 2ZA3A 3TA6A 3ABSA 3GX9A 1TRIA 2QCHA 1YDOA 1B4KA 5HJLA 3BG3A 2VFIA 3LX9A 4NUWA 2OCZA 1W0MA 2B7PA 1O94A 4QNEA 3ATZA 4DO6A 4WD0A 3UWZA 1DL3A 3W84A 3LCLA 3AO0A 1FQ0A 3TQKA 4NU7A 1SFLA 4C1LA 4TMBA 4TU1A 1QOQA 4K8EA 1DORA 3SJ3A 1OF8A 4UFKA 4AHOA 3TMLA 3HPSA 3DAQA 5T26A 2QDHA 5U7SA 4AF0A 3GXTA 4CQAA 2GQ9A 3VKJA 1M5WA 3DFPA 4NNCA 4IXXA 3EX1A 3L9CA 3M1ZA 3W7CA 2ALDA 1AK5A 1HL2A 1FDJA 1OX4B 4GJ1A 5DLCA 1F05A 5F4SA 4XBSA 4FO4A 3STEA 5EA9A 2ZZ4A 4KFOA 1TPEA 1TRDA 5E93A 3NL2A 1VCGA 2EF9A 3C3NA 1QR7A 4G1KA 4RK8A 3KFTA 1J2WA 1DVJA 3L67A 1EUAA 2VENA 3NR0A 2OT0A 2V5BA 3TXZA 3G3DA 3TSBA 2B7OA 4FEZA 3BGGA 3DFSA 3FYOA 3JS3A 4GBUA 3C4UA 1XCFA 4O4VA 4UNKA 3Q94A 2CLEA 3TH6A 3QSRA 3G22A 4Y8FA 1O5KA 1WDWA 3U6WA 5LHEA 1SZNA 1XI3A 3ZWSA 3H53A 4ADUA 4UTJA 5D2VA 2YSWA 1K03A 3DKLA 4EF8A 2A5HA 3L5MA 1RZMA 3CU2A 1TPDA 3DFNA 3W88A 1PVNA 4O19A 4FNTA 4MLJA 3EX4A 1O4UA 1R2RA 3HMJG 4OU1A 3MP3A 1ALDA 3P80A 5AHEA 4Z1BA 3GDKA 1LOSA 3QMSA 3L21A 3MP5A 3KRSA 4MUZA 4IUOA 3M7WA 1FWTA 4DELA 3JRKA 1RQEA 4U4MA 4QAIA 2BLEA 4JYFA 3O15A 5LNWA 3SECA 3DFQA 4LY8A 1LLWA 2GVLA 3OG3A 1Q6LA 1QPRA 4Y96A 3IRDA 3CC1A 4UXDA 3BLFA 4GUHA 1F5ZA 4MJZA 3PBVA 3QFEA 2GPTA 3PUDA 3T44A 5C2XA 4AEOA 3T4CA 1BWKA 4A21A 2HTMA 2YW3A 4FNQA 2TRSA 4MY1A 1GYNA 5C6MA 3KHJA 1QPNA 3A23A 3UXDA 1S3HA 1TTQA 3NOEA 4XQ6A 2ZTKA 4PCFA 5D38A 2B7QA 3GKAA 4FXRA 4R53A 4QNWA 1JCNA 1EIXA 2H8XA 3EWUA 4MLRA 1H62A 4QIUA 1LDCA 2VKZG 4JD4A 1D3GA 1TPB1 2QAPA 4O54A 3L2IA 1LYXA 5D03A 2HSAA 1J5TA 3CIXA 4UNLA 2ZRZA 4IX0A 4JEQA 3KX6A 4ZQMA 2GVJA 5FF3A 3DGRA 3LV5A 1XBXA 3LB0A 2XFWA 2A7PA 2QCDA 1KFEA 3F1QA 3KVLA 4H4IA 3W6YA 1H50A 3CTLA 3UPBA 5HUPA 3WJYA 3W85A 4J9JA 1I2RA 4LUJA 4MZ8A 4QJ1A 3W1QA 1TIMA 1ME9A 2NLIA 2BXVA 4ZVJA 5DXXA 2QAFA 3TK7A 2R94A 4UIOA 3EEGA 2P10A 2QKFA 1QOPA 1ZCOA 3T7VA 4O1CA 2VFFA 1JUBA 5DXYA 4A3UA 4AHQA 3TUUA 1ZALA 2VC6A 1N7KA 4B5NA 2QCCA 3E96A 2J9ZA 3LXBA 2WNNA 2V30A 5D37A 3W7GA 4UFIA 4Q33A 3A5FA 4A29A 3EWYA 2RH9A 5FI8A 5HNRA 1GG1A 4MVAA 5G2WA 3A21A 4FX6M 3TROA 4YCOA 4PL1A 1OYAA 1FCQA 3BK0A 5F1VA 1SR9A 3B0VC 2ZCGA 4BWLA 3BGJA 4FIRA 4UFHA 2Y89A 4JNMA 3W7QA 4WZHA 3G1VA 2NX9A 1FWNA 3FKRA 5CZ0A 3TCEA 3TJXA 2Q3OA 3MW7A 1V5XA 3PSVA 2ZRVA 4OQVA 2XN1A 3GAYA 2C19A 1G4TA 4AAJA 3G8RA 1H7PA 2NZLA 2W79A 3UWUA 2CZFA 2DJXA 4YWIA 2WPBA 3L0GA 1H7WA 3W2JA 2DU2A 2ZDRA 2PRMA 4N4PA 4BI7A 3FJ6A 5CPOA 3THQA 5KZMA 1VHCA 1TO3A 1W5PA 3TW6A 1ZJIA 4S1FA 4IMFA 1IF2A 3S5NA 5LKYA 3MI3A 3TMQA 1ML1A 1VYPX 1Q45A 2FQIA 1ADOA 3LHZA 4FIQA 1KA9F 1TJRA 1DJQA 4RXGA 1NF0A 5CZSA 4AHPA 3W7NA 2PURA 1P0KA 1OX4A 1X7FA 5HWNA 2WJZA 4KFNA 1MEIA 1K02A 1PL9A 4ORIA 2X1TA 3EKZA 1XXXA 3OIXA 4JY8A 1SSGA 3WJWA 2J27A 1OX5A 4O0ZA 2G97A 3HG3A 1ME8A 1DV7A 4JTJA 1VYRA 1F73A 1Q3NA 3PY2A 3BVJA 3PULA 3FEMA 2H8ZA 3RF9A 4NXSA 1IXNA 1KTCA 4HN4A 1EB3A 3NPXA 3BW2A 3DI0A 3HBLA 4N02A 2RDWA 4UTTC 1YXCA 1JCJA 3LXAA 2GJLA 1FXPA 5DCDA 2GOUA 3N3MA 1K7EA 3HF3A 2NWSA 3W1MA 1B3OA 4EIVA 3S9YA 3P60A 3PUOA 4ICNA 3H54A 1TTPA 3NQ2A 1B9BA 4IXHA 4UFJA 2DJLA 5GVJA 3LBMA 4BK9A 1JQVA 1R30A 1OF6A 3LTPA 4N9BA 5DCBA 2ZZ2A 5EMUA 1KW1A 3FIGA 4OGZA 2B4GA 1EPXA 3MI6A 1MEHA 4YCPA 1LBFA 5LZLA 2NV2A 2WSYA 4LV9A 4P2VA 4NZJA 3IVUA 3VI2A 3MYOA 1I2OA 1OFPA 5BNKA 4MZYA 1H7NA 4JICA 2PRHA 3LHYA 1W3IA 4TIMA 3HGRA 1KV8A 3M9YA 3KVMA 1JQXA 2ABAA 2VFEA 3NQDA 3GNNA 3S1UA 1LM1A 3QEZA 4R7JA 3W7KA 3TIMA 3UNDA 3G1AA 2A6LA 3O63A 4D2JA 3QPYA 1GZGA 3IIXA 3CLMA 3SGUA 1ZY9A 4TMCA 5DY3A 3LLDA 1W3NA 4AWUA 1I2NA 5KTLA 5KZEA 3LI0A 3G3MA 3HG5A 1GOXA 2PE4A 4UTUA 3NQGA 2P0OA 3IIOA 2FIQA 4O13A 1Z42A 4L4LA 5CSSA 2C16A 3N2XA 2AGKA 3S1WA 3FKKA 1KFKA 1IIHA 1VCVA 3PB2A 2JGYA 3V1PA 1RPXA 3GAKA 3LV6A 3LERA 1RD5A 1U5JA 1LOLA 2J6XA 3M6YA 3G0SA 3S1VA 2C18A 5D2WA 3WFAA 3MI2A 3G1SA 1AW2A 4MJMA 5LNSA 4EVZA 1K8ZA 4JXCA 1P0NA 1FX6A 5FF7A 1P1XA 3BW4A 3W1NA 4ZZ9A 1TMHA 3S42A 5J5RA 4GFSA 3NYZA 3W70A 4K7YA 4Z1CA 3UWVA 4E0CA 3W7MA 1GT8A 4UTHA 1I45A 1KBJA 2J9YA 1G7VA 4S2BA 3W7RA 3OVPA 5K9XA 3W83A 4DPQA 5L9FA 3KOFA 3C2RA 1OYBA 3C61A 3RNDA 1SO6A 1QMLA 4O52A 3N34A 1TQJA 1W1ZA 3W2KA 4JGDA 2E5DA 4PC8A 1K3UA 2QF7A 2Y62A 4LVDA 7TIMA 3LOTA 3UD6A 1YDNA 4LU0A 4CCCA 1DJNA 4JTFA 3A24A 4K6AA 3HPZA 4N9EA 1BKSA 5D33A 2FFCA 3HQ1A 2FB2A 3ZFHA 1WOAA 3NO5A 4NJGA 2E5BA 2H3DA 2ATMA 4GRSA 5LGXA 1G4PA 2CWNA 3L5LA 4UFLA 3LLFA 4JTLA 4KWWA 2WSRA 3HG4A 1OHLA 2JKAA 1XC4A 1M6JA 4RJEA 1H1ZA 3LXCA 3SZ8A 4NZFA 5AYYA 1SQ7A 5D09A 4UTMA 3L0KA 4HHPA 3P8IA 2WV8A 3W1XA 5I3FA 3AJXA 3MHGA 3D0CA 1QNVA 3FLUA 3R89A 2E1DA 3WK0A 1FWSA 3NGJA 2TMDA 1JRBA 3R13A 2ZZ3A 3QC3A 1TPH1 1EP3A 3UXAA 4LC8A 3SIZA 1F7BA 3TSDA 2ZQ0A 3IVTA 4AH7A 3LRLA 5AHFA 3W7OA 1QPQA 4XTDA 4RKAA 5CPMA 1NSJA 4S2CA 3F03K 4ZQPA 1XKYA 4FNRA 3QH2A 2ZRUA 5KINA 3HGSA 4N2YA 4UMBA 3P74A 4HNUA 4EOUA 1UASA 3N73A 5G5IA 3S8HA 3UY8A 4LVAA 3W9ZA 2GVGA 3FYPA 4IGHA 4X2RA 4H6KA 4KKXA 1SW0A 5AC7A 4X9SA 2V9DA 4KWVA 1LZOA 4U28A 5D32A 3SI9A 5I3GA 4OV9A 3VCRA 1A5CA 1C8VA 4OV4A 2DZWA 4HNTA 1WYIA 3KAOA 3HJZA 3STGA 3NPUA 4O0KA 3MBFA 1TPUA 3HPXA 4LWWA 3M47A 3FS2A 3T40A 1YYAA 3NM1A 4JDYA 4RZ5A 3W7JA 2ZFAA 3MBDA 5AHMA 2ZA1A 1D9EA 4O16A 3RFAA 4DBEA 1AW5A 1TTJA 2R8WA 3P62A 4RX0A 1TJPA 3H55A 3QZEA 2JK2A 1K7XA 2ZTJA 4UTWC 1GPWA 1KTNA 2IQTA 5TQLA 3DFOA 3IGXA 1V7YA 1W56A 1JCXA 5MHBA 3W1AA 5HINA 3UZ5A 3RLVA 4K39A 3W75A 3TC6A 3W74A 2EGZA 1XUZA 2G95A 1JULA 3L65A 3VNDA 5G4WA 1VQTA 1TPC1 3NQVA 5F4WA 5A5WA 3MO7A 3GR8A 3NQ7A 4IMGA 5G1YA 3INPA 2QCGA 1F6PA 2YZRA 3E0IA 1DQWA 4K37A 5D2YA 2XN0A 3CM4A 3EX3A 4JTIA 5BRBA 5AYZA 4AWTA 4OWGA 1ONRA 1XBZA 4W9TA 3NQ6A 1FCBA 5EY5A 3C2OA 1ZAJA 1VHNA 2ZRWA 1LP6A 3C6CA 2YPIA 3M44A 4O11A 5G1TA 1MEWA 4NNBA 1BEUA 4K36A 3NA8A 3CWOX 5D04C 2Q8LA 4UR8A 2A2IA 5D05A 1W31A 1X1ZA 3I7RA 2V5LA 5BMXA 3HGOA 4MKNA 2E6FA 5CPLA 4EWND 1A5SA 3W7LA 3FJLA 4WXZA 5C55A 2VOMA 3TDFA 2ATSA 3W73A 2HS8A 3IIZA 3IV3A 3W7IA 2NWRA 4IMEA 4JX4A 4ADSA 5DELA 2F7FA 1I2PA 3PVFA 2E09A 3MHFA 4N9DA 2OT1A 1K8XA 3GLCA 1PHWA 1T99A 3HOJA 4UTLA 4E38A 3UQNA 3NQFA 1R2TA 3OEXA 3L68A 5CGQA 4RZ4A 2AAMA 1YTKA 2BTMA 3LBCA 1JCMP 2DP3A 5IBXA 4M6VA 2CFFA 2YX0A 5I3IA 2Z6JA 3VE7A 2ZZ1A 5CSRA 2RHGA 3OHIA 1ZHAA 3EWXA 1GVOA 2GUUA 3KRZA 4RXFA 3O6YX 5J5DA 2ZYFA 1LROA 3CB8A 1LRQA 5G4EA 4Y90A 1H7RA 3TAKA 2TPSA 3BG9A 4UTTA 5AC6A 4OHQA 3F4WA 2KZHA 2X30A 5AHNA 3MWAA 2CW6A 2CLHA 4JX5A 5K3VA 4UC5A 1OK6A 4A2RA 3UWYA 3TE9A 4MOZA 4BF9A 1KM6A 2ZA2A 5DN1A 1HFBA 2W6RA 1Z48A 5F2GA 2Y7FA 4BI6A 3LDVA 3JR2A 4BI5A 3TR2A 3ANYA 4DF1A 1YADA 4WY0F 1VPXA 2WQPA 3B06A 2JGQA 2NXHA 4I7UA 4O28A 3LCIA 1RV8A 3K30A 2VEMA 3T78A 2NUYA 4DXVA 3R8RA 5LNUA 4CQ9A 3PF3A 1KM0A 3L0NA 3Q37A 4MY8A 4BR1A 3B05A 1L2UA 4ADTA 3IVSA 5CZJA 2QCFA 2GJNA 5AN7A 4XUGA 2QCLA 5K9DA 2R14A 4O50A 1LORA 4AB4A 3M43A 1FWWA 4IX2A 1EP2A 4N6EA 2Z0IA 3GDMA 3WK2A 2RFGA 4Z1DA 4MYAA 3CQ0A 5LHFA 2C13A 1QWGA 4O1DA 1SSDA 4GWEA 5FF2A 3S5YA 4MFEA 4IJBA 4Z1AA 1H60A 1A5BA 2BX7A 2QDGA 3LI1A 3I68A 2C15A 1O5XA 2WO5A 3EKLA 5K7JA 1DHPA 4Z0SA 4DO4A 1SO3A 1AW1A 2O7SA 3ZWTA 3PBUA 5I3JA 4MPQA 2VXNA 3NNTA 3W76A 1BWLA 4I7VA 2QJIA 2X1RA 3MMTA 1XUUA 5LGZA 2DZUA 2NUXA 1WX0A 5CZTA 5EPDA 2FTPA 4CQ8A 2OMAA 1SO4A 2H6RA 4M6PA 3WK3A 3DHDA 3G1DA 2WOQA 3P61A 3G18A 1JVNA 4JY9A 1KLYA 4O4WA 1OK4A 4NT0A 2QCEA 5F1UA 1GVFA 4JTGA 1Z44A 4ZQOA 1WXJA 4N4QA 5EBUA 1IXQA 1TV8A 1KBIA 4FB7A 3O8AA 4DEFA 3NQMA 3W86A 4QSHA 1I8JA 1Q6OA 1SZEA 1VYSX 1W5QA 3TKFA 1Q6RA 5U4NA 3W1LA 2R91A 1YPIA 3W7DA 4WOQA 4IMCA 1GEQA 2Z6IA 3PG8A 1T8XA 2Z1BA 3U2OA 2ISVA 3KVJA 2V2HA 1I2QA 3U8GA 2C0AA 3GKFA 2NX1A 1ZFJA 4UMCA 4UMAA 3RLUA 1G6CA 3YPIA 1WAUA 3ABQA 1SFJA 1TPWA 1F76A 4UUIA 3WJSA 1MXSA 3CT7A 5SWUA 2CZEA 4AMAA 4LT9A 3NL6A 3S5OA 1OABA 3G1HA 1QO2A 4RR4A 3C2FA 1JCLA 2Y85A 1OG0A 1GJPA 3NXFA 1VC4A 1KM5A 1A53A 3PC0A 4ZQNA 3LHWA 1B57A 3WJXA 3O16A 3G0XA 3L5AA 2NXIA 1H5YA 4LC6A 1JRCA 4TX9A 3SR7A 5ABTA 4GNJA 2NXGA 5KZDA 3RU6A 4BWLC 2V2CA 3C52A 3NPWA 2F84A 1XBYA 1TCDA 1IIGA 1KLZA 1RR2A 3PBWA 1THFD 2ZZ6A 1VRDA 2QJHA 3DZ1A 4YLWA 2EKCA 2VEKA 4WY0A 1AMKA 4O18A 1GVQA 1W5MA 5DCEA 2E6AA 3NVTA 4X3ZA 1KFLA 1RVGA 3EXTA 4EF9A 2QUVA 1SUXA 1A5AA 3UPWA 3P8JA 3ABRA 1JR1A 4ONVA 3ZS4A 3EX6A 3WJZA 1DBTA 3TQ0A 1VLWA 3OA3A 3QF0A 3W2MA 5AB3A 3W2NA 5KSWA 1P5BA 4ML9A 5KITA 3QPZA 1IGSA 4NJJA 3EB2A 5E0KA 3BLIA 4IQLA 1KFCA 1SZFA 4H3DA 5G2HA 3SGZA 4HT3A 3PUEA 1N8FA 2X1UA 5AOUA 8TIMA 3GYEA 3P7YA 1EX5A 3P81A 4N6FA 1GVRA 4JTTA 1C29A 3HIJA 2C14A 4OE7A 1HO1A 4PODA 4BFAA 4O8RA 1DOSA 1KM1A 3NL5A 2Q3RA 4POCA 4RCXA 1NFBA 5DBUA 1JCYA 3GXNA 3TV8A 3ATYA 1AL8A 1W37A 1KM2A 4YXGA 3R12A 3LGEA 4JX6A 1DKWA 2LLEA 3T55A 1NVMA 2YYUA 5F2IA 1PCWA 1XDMA 1WA3A 1XM3A 3ABOA 3PAJA 1HO4A 2C6QA 4WX2A 4MZ1A 1TQXA 5FF4A 3W22A 4IWWA 3PS7A 1VR6A 3BO9A 4RZ6A 2YYTA 4DO5A 2JBMA 4A22A 1TPVA 3KRUA 1ZAHA 2DORA 1OYCA 3TC7A 2NV1A 4LRTA 1FCUA 1EEPA 3IGSA 4LNYA 5K4XA 2ABBA 3LRMA 4CLMA 2A1YA 4HIBA 1ICQA 4O14A 3N19B 5D2TA 1WBHA 2B7NA 4HNVA 3G1XA 2YW4A 1B4EA 1OFBA 3HGJA 4Z08A 2W0UA 1VCFA 4LVBA 3V75A 3GDTA 2Y88A 3W1TA 3W1UA 3PG9A 3GDLA 3TAOA 3FOKA 3N9RA 1W5OA 4MYXA 4ZMGA 1RQHA 3NM3A 2QUUA 2CLMA 1X1OA 4DPPA 2C3ZA 2C1HA 2V2DA 3BARA 3BW3A 3NDOA 1TREA 1C9DA 1AL7A 3F4NA 4P61A 4FNSA 2FJKA 4HPXA 1FWRA 2Y70A 3MP4A 1SO5A 3E12A 3E9AA 4MIMA 3QQ0A 4R33A 5FESA 3W2LA 1XDLA 5C5YA 3THAA 2V8ZA 3C0JA 3CEPA 4WOZA 1NEYA 1QDSA 1TYGA 3QSTA 1M7OA 3P5ZA 4FF7A 3W87A 3BPWA 5D02A 3A5VA 3NZRA 1TB3A 3FFSA 1FDZA 2GQAA 1I4NA 4PH6A 1GVSA 2YGYA 1PHQA 3DBPA 1OFOA 2JKEA 2WNZA 1MZHA 3NQCA 3GR7A 3DU0A 1KFJA 2EHHA 3KVKA 2Y7DA 3W72A 1OFEA 2RDUA 3TXVA 5F2MA 3B0PA 2BSLA 3M41A 2ZZ7A 5AHLA 1X6UA 3IEBA 2YFNA 4C1KA 1PE1A 3DXIA 1W8SA 1KM3A 3GZ3A 1UBSA 3TW7A 5BW6A 1XL9A 1LTDA 2ZBTA 5C54A 1TPFA 4CCEA 5IM51 2A0NA 2FB3A 3NEVA 4Z0JA 2P1FA 6TIMA 2ZZ5A 3CWNA 3S1XA 3S6DA 3A9IA 4LVGA 5F4XA 1G7UA 3W7PA 4NJKA 5FEWA 1QCWA 4XTIA 2UV8G 3VFLA 1JUKA 1TV7A 1VH7A 2RDTA 1KM4A 3P82A 4E2DA 3B8DA 2YCEA 1JUEA 1YLVA 5H91A 3S0CA 2CZ5A 2X2GA 2CLIA 1EWDA 2E6YA 2X1SA 3UWWA 2TYSA 1F2JA 4FNUA 1IXOA 3LCFA 3LCXA 3BV4A 2Y63A 4JIPA 4TR9A 4O17A 1T96A 2Q8ZA 4R34A 1FXQA 3GXPA 3NQEA 1ICPA 1LCOA 3CPRA 3QYQA 5HUOA 4MY9A 4XWUA 5CG7A 3OBKA 1H63A 4AVFA 4O12A 1L6WA 2G96A 4XKYB 3W3OA 4UFMA 2I1OA 5H2ZA 4GUJA 2HS6A 2Y7EA 1W5NA 4O53A 5I3HA 1ICSA 3C2VA 4HSNA 1YDVA 2CLFA 2CU0A 4HNNA 4M7TA 4KFPA 4FHAA 2J9XA 5DBTA 3P84A 6ALDA 3BLEA 2EPHA 4M7SA 3TQVA 3DENA 1Q6QA 4YL2A 4WY0B 3LRKA 2BZNA 4XBKA 5D2XA 1G4EA 1ME7A 1L6SA 4NX5A 3TFXA 5CPNA 1KV5A 5E1QA 1R47A 4N9CA 3GNDA 4ORMA 1LBLA 2VFDA 4WQ6A 1UUOA 2FDSA 1A50A 4LVFA 5HQEA 2JKPA 5TIMA 1PCKA 4FX8A 4M19A 2CLLA 1K7FA 2I9EA 4PEKA 1Z41A 4JTSA 3P5YA 1T0OA 3OVRA 4Q32A 3B04A 2YR1A 3LTSA 4ZQCA 1HTIA 3BG5A 4O57A 3LTYA 3I7SA 1YTDA 3UWQA 5AYXA 1LRNA 3CHVA 4WXYA 4NX0A 3O1NA 2A21A 1E51A 2H3BA 3W71A 4LUIA 2BWGA 4PTNA 4IPJA 4HPJA 1L6YA 3STCA 1F74A 4CNPA 4PA8A 1G69A 3IIVA 4DF0A 3TU9A 3LCHA 3P67A 1R46A 2DZTA 2H90A 4E2BA 2DZXA 2DZVA 4LS1A 1QPOA 4NXKA 2Y61A 2A6NA 3IIPA 4WUIA 1ZAIA 1VGAA 5D30A 1QAPA 1YXYA 5G2IA 1D3HA 3TNOA 4L4MA 5BMWA 3N9SA 2X16A 1WQ5A 1EP1A 5HR7A 1WBJA 2YXGA 4JDBA 5HMSA 5BOOA 4AWSA 4LS0A 4IOTA 3A22A 3HG2A 3NQ8A 3EWBX 3O6CA 4JTHA 2YDAA 1OVDA 4OBTA 1VS1A 4O10A 2GQ8A 5DY2A 2YFOA 2VELA 2QJGA 3QM3A 3QMTA 4Y6GA 2I14A 1NF7A 3QW3A 1S5WA 4LV4A 3DH7A 4CCDA 4NQ1A 1WV2A 2VEIA 3QRHA 1GWJA 3G8EA 2OX1A 1G67A 1OFAA 4JS3A 3TX9A 4CNNA 4DF2A 1CW2A 3PB0A 2G5WA 1H1YA 5KMYA 4GUIA 2CLKA 4QITA 4Q4KA 1PIIA 4JR5A 1MSSA 3LCWA 4ZL1A 5AC8A 1H51A 3TFCA 4K38A 5TBOA 5LNVA 4M6QA 3GVGA 4NNAA 3EWZA 3NG3A 2WNQA 4I7WA 3W07A 3L66A 1H7XA 1CI1A 1KFBA 3B4UA 2DZSA 1W3TA 1U83A 3LHTA 1FUYA 4QISA 1QFEA 5LSMA 1TSIA 2EAWA 3I65A 1P4CA 3Q2DA 3GDRA 2J24A 3B03A 3LHVA 4JYEA 2DZPA 5EL1A 1UB3A 2XN2A 3SFKA 3E02A 1XBVA 1OFDA 4ZQRA 2V0TA 4GC4A 5AFDA 4NJHA 3NL3A 3EXRA 4LTSA 3GK0A 3NQAA 4PL2A 1OFQA 3R5EA 1VLIA 3DI1A 4JTKA 4UCGA 2AQWA 4JIQA 5FEZA 1H7OA 5IBXC 1DQXA 2WSQA 2FLIA 1RQBA 1EWEA 3STFA 1GTHA 2FPVA 2A7NA 4K8HA 2QCMA 4O1BA 5EKYA 4DBDA 3M16A 3RK8A 1PV8A 3M5VA 2E77A 5F2LA 3TSMA 3B0UX 4WJEA 4AF0B 4DQWA 4TO8A 2V82A 1S5TA 1QO5A 3IGUA 1VJIA 2OZ0A 3VE9A 1UUMA 4JTUA 2FPTA 2QR6A 3N2MA 5FEPA 2QUTA 2VEPA 2A85A 2B0MA 1M7PA 3SSJA 1L9WA 4GUFA 4UTIA 1R2SA 3CEUA 3PBYA 1SW3A 3I7QA 3LCGA 3NPVA 3SY5A 1O95A 2V81A 1VZWA 2ZRYA 3W1RA 2ZRXA 3I6RA 4IPIA 1SZGA 2NUWA 2ISSA 1PS9A 5K9CA 1SPQA 3W7EA 1TTIA 3KXQA 1OX6A 1UCWA 5EYWA 1YPFA 3SW6A 3EWWA 2Y6ZA 2O7QA 2RKXA 2NX3A 4JN6A 1CX9A 3HB9A 5LNRA 3N14A 1EUNA 2VFGA 4XKYA 3Q58A 4UR7A 2TSYA 1FCVA 3MHUA 1YXDA 1H61A 1LBMA 5FEXA 3G1YA 1Y0EA 5A8GA 3W1PA 1LLZA 3UZJA 4NVTA 3M5YA 3O06A 4X22A 5HWMA 3O05A 1GG0A 3HO8A 1GYLA 1NAL1 5L6UA 3EXSA 3EX2A 3PWAA
chains in the Genus database with same CATH superfamily
1TJ0A 3K1DA 4PFMA 1IZJA 1PDYA 1MFUA 5HJXA 4IQDA 3GIYA 3W2UA 5I07A 2A7RA 4M5PA 3ONCA 4H04A 3VNJA 3UR5A 4JTEA 4IUGA 1RK5A 3BZGA 1BPLB 3ZT5A 2O9OA 5FIPA 1HVQA 3WK1A 1LL7A 3G24A 4H6QA 3WQFA 2DQXA 4FX7A 1FHUA 3IK4A 3QW4B 4RNJA 1JJKA 1Q66A 4RV8A 5FSDC 1L2QA 3ZR4A 1SR0A 4UTKA 3RMJA 4URIA 4YHGA 4A2SA 1EA0A 1QTWA 4AZBA 1HKKA 2AL2B 2OYKA 2ISWA 4JTRA 3UPMA 5I09A 1LUCB 4AXKA 1IXPA 6PTDA 4NASA 3RJXA 3S6OA 3R2GA 5ECVA 4UOJA 3DKJA 1W9UA 3N04A 3USBA 4WK9A 2F6XA 2QCNA 1VP5A 4Y9NA 4MFDA 4NF7A 2Y7GA 4YMZA 3WQOA 3MYPA 4H83A 2NVCA 1LF1A 2HK0A 2XWDA 3G0UA 5HULA 3U0HA 4ALDA 3DIPA 3C56A 3DFHA 4NYYA 3QJAA 1M68A 2PP1A 4Q6JA 4RLIA 4JIHA 3CUFA 2P50A 1RALA 1MO0A 4QM1A 1F6KA 1HIZA 3RX4A 1U2YA 2AOSA 2A4AA 2I9UA 3WMBA 4GI8A 3MJYA 1NIUA 1GOIA 3C2EA 3QHMA 3QMRA 5I3KA 3OVQA 4AD3A 3U57A 5HR6A 1BGGA 3SUTA 8XIMA 2GGIA 1YDOA 4NRRA 4HMEA 4W7WA 3BG3A 1V8EA 3WD4A 4ZBCA 1NY1A 2OCZA 1W0MA 1CENA 4QNEA 4WD0A 3UWZA 1BRLA 1FQ0A 3TQKA 4NU7A 4IIDA 2E0PA 1QOQA 4K8EA 3A3XA 5CPQA 3TMLA 3SUSA 4CQAA 4L1GA 3XIMA 1M5WA 3FXGA 6XIMA 2GK1B 3FSUA 3D3FA 2D3NA 4DUOA 3EX1A 2PDCA 3AHZA 1FDJA 4XBSA 4LAZA 3VZZA 2W91A 1CBGA 2OWXA 1TPEA 1TRDA 2EF9A 1OBAA 1B90A 4EX4A 4RK8A 3QKZA 1J2WA 4GD0A 3LNMA 3G3DA 4FSAA 2IPJA 4QXIA 1UJQA 4HOZA 1EH9A 4J3XA 3FYOA 1XCFA 3FJNA 2CLEA 3TH6A 2C7FA 3QSRA 3S1GA 3G22A 3NUKA 3U6WA 5LHEA 2GYIA 4JFUA 1OB0A 2YSWA 3DKLA 1DXFA 3MJMA 1V6TA 3E2VA 1MQRA 3UJFA 1PVNA 4MLJA 4IICA 1R2RA 1PX4A 2HBXA 3S47A 4HNLA 4MKVA 1OCJA 4XIMA 4LNCA 2CERA 3QMSA 4NAEA 3UA3A 4MUZA 4ZFCA 3M7WA 2OEKA 3JRKA 4GYJA 4UQCA 1TIWA 3TTEA 4HJWA 4JYFA 3PPFA 2CBUA 5LNWA 5BXRA 4NKCA 2XTKA 1LLWA 4UQDA 3SJNA 5TD4A 1Q6LA 5CGTA 3VUPA 4GUHA 3RR4A 4GMEA 4PZVA 5XIAA 1ZGDA 3T44A 1LWJA 3OZMA 2YW3A 2TRSA 4MY1A 3WMLA 5EMLA 1QPNA 3A23A 2DH3A 1TTQA 3OGRA 2B7QA 3GKAA 1TE1A 4FXRA 1E1FA 4QNWA 3H8AA 5FSEC 4Q4PA 2H8XA 3EWUA 5H1WA 1LDCA 5KEZA 4O54A 3K4DA 3WBWA 3EGJA 3AZRA 4UZUA 4HJFA 3EBVA 4GPNA 3H2AA 4ZQMA 1C90A 3FDGA 1X6NA 2PWDA 2IW0A 4R5EA 3VM5A 1CGXA 3LB0A 2XFWA 2B31A 2ISDA 2Z2AA 1W3LA 1E5NA 3G1RA 2QDDA 1XV8A 3UPBA 2PTDA 5HUPA 3WJYA 3WMSA 4DAFA 4LUJA 4MZ8A 4U5KA 4PMUA 1TIMA 1F3WA 4OFCA 4ZVJA 4Y7EA 5EMMA 1DJGA 3LA4A 4UIOA 2P10A 3TWAA 3ZJKA 2E9MA 2F8QA 4N0RA 4O1CA 3ZR5A 5EFFA 4KWSA 4Q4QA 4HU3A 3TUUA 1JL8A 1HNYA 3R94A 3V7PA 2WNNA 4XO7A 2BVTA 3A5FA 3EWYA 5FI8A 4HA3A 1MNSA 1AJZA 2PGRA 4MVAA 1FHLA 4FX6M 2Y0FA 1V0LA 3ARXA 5M03A 3B0VC 4FIRA 4JNMA 1E40A 1H1NA 1FWNA 2NX9A 1L0PA 3FKRA 2Q3OA 4F0HA 4H7ZA 2C19A 3EDDA 3G8RA 4YWIA 3WCZA 2HV5A 3OLIA 2DU2A 4BI7A 5CPOA 3LUTA 3EA3A 3N4EA 4PBGA 4F0LA 5BU9A 1BG9A 1VYPX 3WG6A 1ADOA 1XIEA 5CZSA 4AHPA 3W7NA 2PURA 1P0KA 1OX4A 2OQLA 4F66A 2BVDA 4BQ5A 1XLGA 4KBXA 2PI6A 3UZWA 1XLKA 3WJWA 2E28A 3D5HA 3CO8A 3DCPA 2G97A 2GFTA 1DV7A 4LUSA 1E6QM 2O9TA 3PY2A 1XYBA 4H9XA 3H7UA 3RF9A 4LAUA 4NXSA 2EJ1A 3I3BA 3NPXA 3DI0A 4X9YA 4N02A 2B81A 4I9TA 1YXCA 2BBFA 3VABA 1JCJA 2DIKA 4AZCB 1XGDA 1FXPA 3UP8A 4M6UA 3IUHA 1EOKA 1O66A 2L5HA 3S83A 3HF3A 3LD5A 3LM3A 2J66A 1B3OA 4IQJA 1RK6A 4IPNB 5GVJA 2V68A 4N9BA 3LTPA 3KBSA 2IQDA 4E4PA 2ZZ2A 3FIGA 4QJ3B 3MI6A 4P2VA 4NZJA 3TVAA 3VTRA 1OFPA 1TWWA 5A8MA 1H7NA 4M1RA 4KCUA 5A6BD 4US6A 3M9YA 3ITYA 4PMJA 4AMCA 2J4GA 2ABAA 1GZJA 1LM1A 1BYCA 2QPUA 3QEZA 4K68A 4R7JA 3PHAA 3GXMA 3P3BA 3TIMA 2WZTA 2E67A 2XM2A 3NZGA 3SGUA 1ZY9A 3GM8A 4WGHA 4TMCA 5DY3A 1U30A 2DVTA 1JZ5A 1I2NA 1WKYA 5KTLA 2J13A 3SCNA 2PE4A 4UTUA 4PTWA 4O13A 4P7NA 2AGKA 3TYDA 4J3SA 1VCVA 3PB2A 3RYSA 4TQTA 1RPXA 1F9CA 3LV6A 1MVYA 1XH0A 3FV9A 1XH2A 2W63A 2J25A 3A9BA 3RR1A 3G0SA 3NGFA 3WFAA 1V51A 1W3HA 1AW2A 3G1SA 2ACUA 3ZVIA 1P0NA 3BJSA 2I16A 5FF7A 3ITVA 3MC5A 3THDA 2Q01A 3GFYA 1TMHA 1V3MA 3PP7A 2VEFA 4A3QA 1L6FA 3UWVA 1Z69A 1T41A 4CU8A 1KBJA 2J9YA 1BVZA 4DPQA 5L9FA 4J3UA 3KOFA 3C2RA 4HB7A 1SO6A 3P6LA 2WMKA 2HK1A 4LUYA 4YWSA 1TQJA 2Y8VA 1W1ZA 5A6SA 3W2KA 4FLQA 4HK6A 2R1PA 4DJFC 1E73M 5A2BA 3LOTA 4QR6A 1EJVC 1YDNA 4G2DA 4HGXA 1VFHA 4N9EA 1UBPC 1E1CB 3K1GA 4GRSA 1G4PA 3L5LA 4UFLA 4KWWA 4OECA 3ARTA 1XC4A 1GOWA 1VBJA 3EPNA 3SZ8A 4NZFA 4QG6A 3VPLA 5D09A 3W1XA 1R87A 2FYMA 1JAEA 2YBUA 1QNRA 1QNVA 1GVEA 2E1DA 4F79A 3NGJA 1TZ7A 4C6PA 3NSXA 1TPH1 4J28A 3SIZA 1HW6A 4U5IA 2ZQ0A 3TSDA 2A3HA 2P5NA 3ZVHB 2XGIA 4S2CA 1UQYA 3VIPA 4C1NB 5A1AA 2ZRUA 4UOZA 4N2YA 4GYPC 4UMBA 3P74A 1MRQA 3H2OA 4EOUA 1RBOB 3R7MA 3N73A 4GXPA 1V3HA 3TTQA 2REQB 1PX3A 1AD1A 2GVGA 2FZMA 3T2OA 1VFSA 4X2RA 4RDZA 1SW0A 3R6IA 1QNPA 1E0XA 3HZ3A 3L4UA 3V0TA 1LZOA 3SI9A 5I24A 3VCRA 3GVWA 1C9WA 3BWWA 1ISZA 3HJZA 1EYWA 4C6LA 1J2BA 3MBFA 4NIRA 4GVFA 5JQ9A 4MB5A 3M47A 2VCAA 3T0TA 3A12A 1EIBA 3W7JA 4OJYA 4O16A 1UD4A 5FACA 1TTJA 3VYLA 2R8WA 1S2VA 2BOGX 1IGWA 1FWIC 1K6AA 1TJPA 4Q7BA 3AICA 3DYPA 4AW7A 2ZUUA 1K7XA 4UTWC 1GPWA 1KTNA 2DUAA 4C6JA 3GBEA 4GNKB 1V7YA 4ZB0A 1JCXA 5HINA 5I0DA 3K4AA 3UZ5A 3OBAA 1PEZA 5C70A 2W4XA 3BDKA 1E5JA 1PX8A 2G95A 3OVGA 4LJ3A 3GNXA 1JULA 4QBXA 4PUWA 3WEOA 3ENLA 3WQPA 1IEIA 3GNPA 3INPA 4DJDD 4YS1A 3AS2A 4K37A 2PDHA 2XN0A 3BE7A 1A47A 4E2VA 4OWGA 4Q8QA 3M64A 5EY5A 3C2OA 3BAWA 1VHNA 1CXHA 4IF2A 4GVIA 5G1TA 3CYVA 4I6VA 4FAMA 4KEUA 4B2DD 5D04C 1V03A 1EF3A 3CL7A 3URBA 1BXBA 3HGOA 3F5JA 4MKNA 5CPLA 1FVPA 4D71A 2QUNA 2WW5A 3W73A 3ITGA 3IIZA 2R1KA 2NWRA 1E4NA 4XZBA 5DELA 3PVFA 3W01A 4N9DA 6ENLA 1QNSA 3ANVA 1K8XA 4HN8A 5CGQA 4MSSA 3WDHA 4QRNA 4QEEA 1AVAA 1JCMP 5IBXA 4M6VA 2CFFA 2YCLB 3VE7A 2DH2A 2RHGA 1UYQA 3K5XA 1ZHAA 3OHIA 2GUUA 4BKNA 5ABFA 1K9TA 2ZYFA 3CB8A 2WLZA 1NDYA 3TAKA 1BSLA 3GHUA 2KZHA 3D46A 2E3ZA 3MWAA 3WD2A 2CLHA 3ABZA 3GU1A 3LG3A 1HKIA 1OK6A 1OT2A 1EO5A 3LGDA 4MOZA 4WCJA 4ROQA 1WE5A 5F2GA 4BI6A 3JR2A 3TYZA 1NDZA 1QW9A 3B8TA 4B2DA 2WQPA 1T5AA 2HROA 3B06A 4HZ6A 2JGQA 4O1EA 1X7IA 1RV8A 1I60A 2QJNA 3OQEA 1XPYA 2XH4A 3HV8A 3T78A 2NUYA 3WQ4A 3DERA 4NP7A 3PF3A 1KM0A 3OLEA 3M0YA 3Q37A 4BR1A 4ADTA 3PNZA 1L6GA 1KKOA 1XF0A 2PTXA 2QCFA 2WMIA 2GJNA 3ARPA 3D3AA 3ZLGA 3DUGA 5K9DA 3G2GA 3POHA 3M43A 1FWWA 3HPAA 3QYSA 4LCRA 3PZVA 4PSRA 1JCTA 2TODA 3ZJ6A 4B5WA 3MUZ1 3T09A 3FGCB 1W91A 3ARQA 3S5SA 4IJBA 2OSXA 2BX7A 3WLIA 4XAGA 2HNHA 2PUZA 4X61A 2WO5A 3EKLA 5K7JA 1DHPA 3CTTA 3TR9A 1SO3A 1PWLA 1E6RA 4MNJA 4L4PA 3M0IA 4LXFA 2X1RA 3MMTA 4DWSD 3LQLA 3VOCA 4EXAA 2DZUA 3IS4A 1WX0A 4GNVA 5EPDA 4C6NA 4F0SA 4IFOA 4DIAA 3G1DA 2ZUMA 4FXFA 3PTMA 1O1ZA 3WLOA 2YB4A 2DSUA 1OK4A 2QCEA 1GVFA 3CBWA 2BS9A 3BAKA 3EOEA 2C0HA 1E15A 1TWSA 1KCXA 2QPSA 3TKFA 3KCLA 3IJ6A 2CBJA 3W7DA 3BSHA 1Q85A 4QHRA 4X0NA 1NDWA 4BQ2A 1T8XA 2DZBA 2PD5A 4BF5A 3GKFA 2NX1A 1G6CA 3GRIA 3IPWA 2ZC8A 2QIWA 1SFJA 1TPWA 2E9LA 4UUIA 3TOPA 1C7SA 1XG4A 3GE7A 4FA3A 1HT6A 3CT7A 1A0CA 3PJTA 1MYRA 3RILA 1QPKA 2I56A 2VWTA 1OABA 3G1HA 1TV4A 1QO2A 3C2FA 1O5QA 1JCLA 1ZUAX 1LLOA 3NXLA 3VINA 3UT0A 2QVHA 4CQBA 1A53A 5IFTA 3PC0A 5RUBA 2I5GA 3XISA 2VZSA 3L5AA 3TQPA 3QY8A 2PDBA 5LIWX 4LC6A 1JRCA 4TX9A 4GNJA 1VAHA 2FVLA 2CHOA 3BV7A 1SZRA 1E3ZA 2ONEA 3NPWA 2F84A 1OADA 2OSWA 1WCGA 2IS7A 2Z00A 2NQ9A 1W9PA 5D9MA 3PBWA 1THFD 2ZZ6A 4DM2A 3W81A 4DB7A 4AZ7A 1UWRA 4WY0A 3T4WA 1DHKA 1GVQA 1UUQA 3MS8A 3VKBA 5DCEA 2Q02A 3FYYA 3BQ5A 4NRSA 1HN1A 2EG7A 1GQJA 5FJOA 4ZO8A 4EF9A 4ERAA 1SUXA 3U4AA 2VRQA 3RLHA 4XD4A 4F8XA 3PK7A 4J3VA 1PXGA 2VZOA 3SB0A 4JTDA 1VLWA 3QF0A 1BKHA 3W2MA 3W2NA 1YNPA 1P5BA 4ML9A 3RO6A 3L7RA 3QPZA 1JDEA 3EB2A 2EQDA 3AS3A 3CQJA 3U2CA 1KFCA 4HTBA 3MANA 3T42A 1D7FA 1NDVA 5G2HA 3SUUA 1N8FA 2X1UA 8TIMA 1EJ7L 2GGJA 1EX5A 1GVRA 4HMNA 3SN4A 3NL5A 4RCXA 5BOFA 1D2KA 5DBUA 2ACQA 1KM2A 2WB5A 4ZO9A 3R12A 3EZ4A 3U5YA 4JX6A 2X1IA 1DKWA 2HPMA 5CPTA 1PCWA 1HO4A 2Y5EA 4PB5A 4CQCA 4WX2A 3GY1A 2I5QA 4IWWA 1JI1A 3VKAA 2EBNA 4L65A 2IPFA 2VC9A 3OU8A 4A22A 1TCMA 2QUMA 7CGTA 9CGTA 1WKDA 2DORA 1OYCA 1V6XA 1JD7A 1EEPA 2YA2A 2VX4A 3KUMA 1ICQA 5D2TA 4QE5A 1HJXA 2AL1A 1VFOA 1CWYA 2YW4A 2J62A 1B4EA 4ZB5A 1VFUA 2QZRA 4LSBA 1DIDA 2VX6A 3SCVA 4CD6A 4GVHA 4PMNA 3W1TA 3QR3A 3OO2A 1US3A 1W1A1 2QVNA 3FOKA 3N9RA 3MUAA 2Y5JA 3WD1A 2QUUA 1B31A 8RUCA 2C1HA 1E0WA 1TREA 1C9DA 3AXIA 4P61A 4FNSA 3CV2A 1MUCA 4HPXA 2Y70A 4MNLA 3MP4A 3AWNA 4J7RA 1YPXA 3E9AA 2YL5A 4R33A 3W2LA 5JBFA 1XDLA 3RM8A 3SQSA 4WOZA 1QDSA 3QSTA 4GBDA 1JZ8A 3BPWA 1ZJAA 3QC0A 4Q7NA 1I4NA 5E0CA 2PBOA 2ZUWA 3FEQA 3H7RA 1OFOA 2JKEA 2WNZA 2CESA 2UY2A 4AYSA 2E40A 2Y7DA 3TXVA 2HE5A 4JFWA 3B0PA 1XSKA 3WELA 1P6BA 3DXIA 3H12A 2E8ZA 1BSIA 1P0EA 1POKA 3TW7A 2W92A 3WBXA 3WQCA 1LTDA 4I8YA 4H6RA 2A0NA 2J78A 3GC5A 2CETA 3A9IA 5LYRA 4LVGA 3W7PA 1G7UA 2VNCA 1MDLA 3UZZA 1VB9A 4ZSTA 3BXWA 2CCRA 2RDTA 1KM4A 3VD7A 3PZNA 5A8OA 2ZE0A 3P82A 3WLTA 3QV7A 1JUEA 1Z8AA 3S0CA 4N7QA 5E0FA 3DC8A 1EWDA 4B5UA 4QCEA 1MW0A 2XGZA 3JVAA 1GONA 1AODA 2Y63A 3KS6A 4TR9A 1T96A 3IJLA 1FOBA 5HNUA 2Q8ZA 3GVRA 1FXQA 3GXPA 1E6PA 2C71A 1LCOA 4CD7A 1P6WA 5HUOA 4JQAA 1F61A 4DYKA 3OTRA 1L6WA 3D47A 4S3GA 2QXWA 3DEQA 4UFMA 2I1OA 1UH2A 4GUJA 2HS6A 4A8LA 1R3SA 4C6QA 4O53A 5I3HA 1CZ1A 3C2VA 2G3NA 2CLFA 3AQUA 4M7TA 4HU0A 3TYBA 2J9XA 1P7TB 3JU2A 2CHNA 2J75A 3J7HA 2BZNA 4RNIA 5HANA 1Y5XA 2DVUA 1C8QA 3CHCA 1KV5A 5E1QA 3GNDA 4W89A 1FWDC 2FDSA 2JKPA 2MUCA 4FX8A 3KZSA 2CLLA 1K7FA 2I9EA 1Z41A 3P5YA 1FKWA 3PNUA 4RPQA 4YJ5A 1T0OA 4J1OA 3B04A 3F4CA 1ZJHA 1GJUA 5AYXA 2OELA 3LPGA 3RIKA 2A21A 1Q13A 4GCAA 4PRWA 2BVWA 5C9WA 4H8VA 4IPJA 3I3DA 1O12A 5GJPA 4F2TA 2WM1A 2DUXA 2XIMA 3SN0A 1M41A 4F3HA 1V3KA 4E2BA 2OQHA 4HK7A 4LS1A 4NXKA 4HA0A 4GY0A 2A6NA 1ZAIA 4P8XA 1U5VA 1DWGM 3WBYA 3WL1A 2BHUA 3OGVA 5HR7A 1WBJA 3FAWA 5HMSA 4PULA 1HL9A 4IOTA 4NZ5A 5DY2A 2VELA 3ES7A 3QM3A 4Y6GA 2IQ0A 1G94A 3FHQA 1S5WA 1PKYA 5PTDA 2ZUSA 4D6CA 1XYMA 1C93A 2ZUNA 1B0IA 4PCPA 2QMJA 1AJ2A 4CNNA 1CW2A 5HATA 1H1YA 3E6EA 1TE6A 3DBNA 3TN5A 4GUIA 4G8TA 4QITA 1UPMB 3LCWA 2WAGA 3LU2A 3L66A 4NG3A 1KFBA 3B4UA 5FAGA 5LSMA 1QFEA 1OCNA 5FCZA 1IEWA 3I65A 3Q2DA 1XLAA 4LYKA 2DZPA 5EL1A 4UOQA 3SFKA 5LXXA 2WMGA 2EKGA 4CVUA 1E1EA 2P8CA 2DSVA 5AFDA 3NL3A 4LTSA 5E6ZA 3DFYA 4E8GA 2OX4A 1HKMA 4JTKA 2ODOA 3UGRA 4UCGA 2AQWA 1E6SM 4JIQA 4RW5A 5FEZA 3NEHA 3E2QA 1QNQA 1RQBA 4EWJA 1DE5A 2FPVA 2A7NA 5FA5A 3KRBA 2BB0A 4O1BA 3GFXA 4Z42C 1B3YA 2E77A 3TSMA 2PODA 1BD0A 3T9PA 1CCWB 1XIJA 1S5TA 5C0QA 1VJIA 3FCPA 3VE9A 1ONWA 4WF7A 1L8NA 4DJED 5E09A 2IPWA 3CV1A 1E70M 4F9JA 3CEUA 4OIFA 2GLKA 3I7QA 4V33A 2V81A 4B3ZA 1VZWA 2ZRYA 2ZRXA 1DWFM 2RAGA 3S2JA 1EYEA 2ZX6A 5I02A 3I6RA 2NUWA 1PS9A 4FOUA 3BMVA 4CN1A 1SPQA 3W02A 3IANA 3W7EA 2OGYA 3UERA 4JN6A 2RKXA 3WLQA 1K6WA 2JF6A 2NX3A 1CX9A 4B92A 4GIEA 5LNRA 3N14A 2CLPA 1PKLA 4IL0A 4AISA 1FCVA 1NJJA 3H70A 1LBMA 3WUFA 5FEXA 3VNZA 3ITLA 3OQ8A 3AU6A 3UZJA 3WLHA 3M5YA 4IJRA 1DJHA 3O06A 4X22A 4F48A 1NAL1 4KEVA 3DYOA 4YVVA 3PWAA 1ZS2A 3PPHA 3LPFA 5K4ZA 4GY7A 4U3CA 4JYDA 5FF0A 4DJEA 4LUTB 1TKKA 1UJPA 4MHBA 2D73A 1JYNA 3H6OA 5MKGB 1W54A 3DFTA 4M81A 4B5VA 2CLOA 4S3JA 2GSHA 4H6EA 3CIWA 1AG1O 3QR1A 3SO7A 1XLCA 2JQXA 1UG6A 3SM0A 4L6HA 3SRKA 4PEEA 1DIOA 4HU8A 2YA0A 3FXYA 4OT7A 2JALA 1R38A 4NI3A 4QDWA 4XO6A 1A5NC 3FK4A 2VUYA 4E4UA 5A69A 3UYCA 4RNHA 1HG3A 3BGAA 2HVOA 2MNRA 3BOXA 3N13A 1GKQA 4K1GA 2FKPA 2VT0A 1JXKA 1ZNNA 1OC5A 1K8YA 4FNPA 1J0HA 1XGEA 2OJPA 4HMCA 5HXMA 2VFHA 2XIBA 4S3EA 2QCDB 4GIYA 1N55A 3E49A 5M3WA 2ZADA 3QQWA 4JFVA 1U1UA 3NSNA 4LOCA 2JIEA 4U3AA 1ZQ5A 3GBDA 2PRLA 3G1FA 1PKNA 5K2ZA 2J88A 4JL1A 4PBFA 3THCA 4K7VA 4B4HA 4AD0A 1G4SA 1OIFA 1DXIA 1KTBA 4LS2A 2WKJA 4IMDA 4PMYA 3W00A 1YTEA 1JDDA 1AMYA 3LM7A 3SGGA 3UJEA 1NWTA 1IZCA 4GE8A 4J3ZA 4DN1A 2E6DA 3VIKA 2ZC1A 1LL6A 1B2YA 3GX9A 1TRIA 5HJLA 1JF5A 2CXEA 2B7PA 3MMWA 1C8YA 3GH7A 1NQKA 4KGJA 3ATZA 1K9EA 3AO0A 3QVQA 4GYKA 1ZLPA 3GNOA 4C1LA 4TMBA 3RGTA 1Q2SA 3SDOA 4WLCA 3MKCA 3DAQA 3ZM8A 1LJYA 2WPGA 1V02E 3DFPA 4IXXA 1GW9A 1E0VA 3W7CA 2ALDA 2WBGA 1AD4A 1LT7A 3WDPP 1AK5A 1HL2A 1UA7A 4G7FA 2ACRA 4W85A 5DLCA 4LEFA 1F05A 2UY5A 3STEA 1XRTA 2ZZ4A 3NL2A 1JI2A 7REQB 5CLWA 3C3NA 4G1KA 1DVJA 2OT0A 2AAAA 2V5BA 1WZLA 2DQWA 2JFEX 1US2A 3TSBA 4E8CA 3LZ3A 2R6OA 3SQMA 2A79A 4GBUA 1W9BM 4GQGA 4Y8FA 1IE7C 4ZO6A 2XZ9A 3B0XA 4L9ZA 1K03A 4AD4A 1RZMA 3W88A 3DG3A 4FNTA 1WDRA 1QATA 3HMJG 3H4XA 1EGZA 1K77A 4O0QA 1AH0A 2D0GA 3VVGA 1R5YA 1R0MA 2Q09A 3GW3A 3JZUA 1F4HA 2WKLA 3SCPA 4IUOA 1E9ZB 3TOYA 4U4MA 4QAIA 2BNJA 4QJ5B 4PUNA 3SECA 3WLLA 4LY8A 4WJXA 3CC1A 1W9DM 4AIEA 2RJGA 3QFEA 2YBTA 4GKLA 1KXVA 3KCOA 3IGHX 3LSCA 3PUDA 2OOGA 5C2XA 3E0LA 2H9AB 2PWUA 3T4CA 4A21A 2HTMA 3MKVA 4GOAA 3L12A 1OG6A 1EBHA 1US0A 3KHJA 1S1PA 5I3DA 2D2JA 2JEPA 3NOEA 5D38A 4PCFA 4S3AA 2Z1KA 2AL2A 1JCNA 4MLRA 1WUEA 2VKZG 3NO1A 4JD4A 1D3GA 4V2XA 1KRMA 1Q4WA 1LUCA 3GTNA 3OYXA 2HSAA 1KCLA 3WNKA 3CIXA 3WLJA 1REQB 5GJNA 1YBQA 4IX0A 2XUCA 3KX6A 5B7YA 4LYRA 1MXDA 2J7DA 5FF3A 2O56A 1XBXA 2C1GA 1TZZA 2A7PA 1KFEA 3F1QA 3KVLA 4H4IA 5DMMA 2YCIX 3W85A 4LEQA 1MFVA 3F2BA 3TK7A 2R94A 3EEGA 1QOPA 3T7VA 2EPLX 1R86A 5C71A 4HSHA 3IWPA 4A3UA 5A95A 1CXIA 1A3XA 5CG0A 4ZB2A 4AHQA 1ZALA 2VC6A 1N7KA 2GZXA 4B5NA 1DPMA 3VKKA 3OZYA 4W86A 2V3FA 1G5AA 1H49A 3KHDA 4EP8C 1QI5A 4R7OA 4UQEA 3TROA 3WBAA 3BK0A 1UWSA 3WQ5A 3CYJA 2ZCGA 4BWLA 2Y89A 3W7QA 2VOTA 3TJXA 1V5XA 3PSVA 2ZRVA 5H8UA 2J7EA 1GQLA 4KETA 1JZ7A 2DJXA 3EOUA 5A2CA 2XDFA 3FHAA 2WPBA 3L0GA 3CAKA 1H7WA 2ZDRA 2DIEA 4YYFA 4K1WA 4C6KA 4I90A 1Q2RA 3TW6A 2XG9A 4IMFA 4DNHA 4M24A 1ML1A 5EU9A 1Z9AA 3UW6A 1UZ4A 1KA9F 1DQUA 1NU5A 1DJQA 4RXGA 3MV01 3TJIA 4V27A 4U10A 1PL9A 4MUPA 1XXXA 3RHGA 3LZ5A 1UP0A 1JDFA 4O0ZA 4JIIX 3RMEA 3HG3A 1BQCA 4GQRA 1VYRA 1E43A 3HPFA 3WKZA 1TJ2A 1BRLB 4UR9A 5KETA 1KTCA 4HN4A 3VIFA 2E9BA 2VGFA 4FP1A 3UVIA 1UZHA 3GSMA 1B3WA 5EFDA 3ZYZA 3WF0A 3GTHA 2GOUA 4GQBA 2NWSA 3W1MA 1EHNA 4JNZA 1MUWA 1E3XA 3M0JA 3CO4A 2BFGA 1PTGA 1B9BA 4UFJA 2GSEA 4JHZA 4G56A 4NZ1A 3LBMA 1XW8A 3OJGA 3V5FA 2WZEA 1R30A 5EMUA 1KW1A 3USZA 1UW9A 4YCPA 1LBFA 5LZLA 2NV2A 3UR8A 4LV9A 4HBKA 4KGLA 3MYOA 1I2OA 3U3HA 2J8TA 4JICA 3B9OA 3LHYA 1W3IA 4ACZA 5A6JA 3KVMA 2ZKMX 4EPBC 1JQXA 4WSHA 2Y4SA 2XIQA 2VFEA 2R9RA 2IKIA 1U33A 1HP4A 1B30A 4HCHA 3CPGA 1RLCL 4XV0A 3G3MA 3JZEA 3NQGA 1N8WA 3ECQA 2Z25A 1ZJBA 4H2HA 5C9UA 3FKKA 1KFKA 2XFYA 1XLBA 1I0BA 3GAKA 1UMLA 3RX2A 2GQ3A 4HVXA 1UD2A 4AZIA 1LOLA 4P7RA 1KGXA 3M6YA 2C18A 2WHMA 3MI2A 3WMCA 3WNMA 4MJMA 4M29A 3GC2A 5LNSA 1EA9C 1EF2A 1K8ZA 4JXCA 4Y9OA 1FX6A 4EVZA 5D9NA 3EMCA 3VMNA 1P1XA 2XHYA 5C9XA 1TELA 4GFSA 1PWMA 1UR4A 5BXPA 2GWGA 3W7MA 2WKGA 4CKQA 1I45A 4ZCWA 4S2BA 2G4JA 3W7RA 3OVPA 5K9XA 3W83A 1U22A 3RNDA 1K8CA 2QHAA 1S38A 2BXZA 3R8HA 4WRHA 1T7LA 4JGDA 2XIIA 4H9UA 2YDQA 4UQAA 3THUA 3WIJA 2WVTA 1K3UA 3VO0A 2HRWA 3UD6A 4HNCA 3HPZA 4FLRA 3GU2A 1KCZA 2ZWYA 1CGWA 2FB2A 3VZXA 4OUIA 2CITA 2D2HA 1BVWA 3IUIA 2E5BA 2H3DA 1QHOA 1QBAA 4LH8A 3AXXA 2CWNA 4AX6A 4JTLA 3WF2A 3HG4A 1OHLA 2PP0A 1M6JA 1H1ZA 3ZT6A 1XRFA 4CD5A 3L0KA 4HHPA 4HD5A 7ODCA 3N6JA 1AA1B 1JDAA 3MHGA 1TWDA 3D0CA 5A8PA 3C2YA 3R89A 3VIJA 3T8LA 1FWSA 1UD8A 5ABHA 3BOFA 1JRBA 2OU4A 4PTMA 3UXAA 4LC8A 1F7BA 3RUBL 2EG6A 3U4FA 1NOUA 3LRLA 3OOQA 2WMJA 1J01A 3WQWA 2R1LA 4RKAA 1ZU8A 5CBJA 3GZAA 4GG9A 5MF5A 4ZQPA 1ISXA 3U2ZA 1UWUA 1KNWA 4JAWA 3VIIA 2WHLA 4DZIA 1H11A 3ES8A 1AUSL 4K8GA 3FYPA 3GNRA 4GCXA 3QGVA 3EPMA 5ABEA 3DHUA 4H6KA 4KKXA 1HQTA 4IMAA 1M04A 5AC7A 2V9DA 3CUXA 1XC6A 1VENA 5D32A 2HXTA 5I3GA 3A3WA 4QS5A 4GA8A 4M3PA 2DT1A 1A5CA 2ZDSA 1C8VA 4OV4A 2DZWA 4HNTA 1WYIA 3KAOA 3WQ6A 3NPUA 1TWZA 3C0LA 1TPUA 3HPXA 4LWWA 2HE8A 3DG6A 4JDYA 2GUYA 2DEPA 1QW8A 1RJQA 1D9EA 3KLKA 4MB1A 3RFAA 1KRAC 4C6BA 4RX0A 4CUCA 3SCUA 1JZ2A 1HGYA 2JK2A 5DT7A 1NOWA 2XSXA 3WFLA 3DGBA 1UD3A 1EC8A 3DFOA 2A3EA 3E3HA 3IGXA 4WDXA 1W56A 3W1AA 2OKOA 4K39A 4WR3A 3TC6A 4JFTA 4MPKA 3AMKA 1XLLA 1PZ3A 5G4WA 1VQTA 4MJ4A 3TYCA 1TPC1 1H0IA 3MO7A 3GR8A 4IMGA 5G1YA 2OPJA 1NQ6A 5D2YA 4AX7A 4UQBA 3CM4A 3EX3A 4JTIA 4CNTA 1ONRA 1XBZA 5EGRA 4REQB 1ZAJA 4D6JA 2I5IA 3M44A 4Q4MA 4NNBA 4K36A 3VXGA 2PS2A 4ZEPA 1XGZA 4JPGA 4KIRA 4JBRA 4WKAA 4GQ0A 1W31A 1X1ZA 2V5LA 5BMXA 1RH9A 2E6FA 3W7LA 3KBVA 5C55A 2ZX9A 2E8YA 2HS8A 4F4RA 1QHPA 4JX4A 3TN6A 4ADSA 4C65A 3IJ8A 3F2CA 4FF5A 2ADAA 3GLCA 1UR9A 4E38A 3UQNA 1R2TA 3EDKA 2AAMA 1RHCA 1IWPA 2OYLA 3L4XA 2BTMA 4EXQA 1Q8AA 2ZXAA 5I3IA 4XSLA 1PZ1A 2Z6JA 4C6CA 2D2GA 5CSRA 4D6HA 1UQZA 2XWEA 3VD9A 3EWXA 3OLDA 1LROA 4Y90A 4NILA 3VDHA 1UKPA 2TPSA 3BG9A 5BZAA 1S2UA 3GTXA 2EPOA 3UFYA 5AHNA 3SCWA 4JX5A 4AEFA 3VGBA 1SFSA 4NAFA 1EHAA 1K9DA 1E1CA 5A3HA 4BF9A 1HFBA 1I6NA 3CJPA 4PUMA 3NTYA 5CLTA 3ANYA 4DF1A 3WN6A 1VPXA 3WQ8A 2XIOA 5T8GA 3K30A 2PDXA 5LNUA 4CQ9A 1JFHA 1OT1A 1B9ZA 1DJYA 3QOKA 4RE4A 3IVSA 4F40A 1UOZA 1VD6A 5AN7A 1XYAA 2D3LA 4AB4A 4Z17A 2WMFA 1G0CA 3ZVHA 5B7ZA 3BSMA 3GDMA 3WK2A 3O6AA 2RFGA 4MYAA 1FH9A 2X7VA 2O0TA 4RZBA 3E74A 3R8GA 4C1NA 1A5LC 1ZBKA 2AKMA 2J7GA 2UY3A 1QWGA 1J6OA 4Z2IA 3S5YA 4Z1AA 3LYEA 1H60A 4BQ4A 1ADSA 2QDGA 3KDNA 1V6WA 3I68A 3LI1A 4FK9A 1HJQA 1O5XA 1UIPA 3M46A 1HJWA 1HJUA 1AW1A 2EG8A 3WDRA 4DY1A 4MPQA 4ZGYA 4IPPA 3P93A 4L6DA 1BWLA 4B9ZA 2VUNA 1HZYA 2OMAA 4M6PA 2GVEA 2WOQA 3P61A 4M8UA 3G18A 1JVNA 4JY9A 1R9ZA 2BHYA 4NL1A 1XS2A 4O4WA 4GKTA 3E0WA 2A3CA 4ZQOA 9XIMA 2PAJA 4DWDA 1TV8A 4ZOBA 2G3MA 4DEFA 3NQMA 3W86A 3L2MA 2VCCA 1VYSX 5A8NA 1UR1A 1YPIA 3M0VA 3HA1A 4WOQA 1W9VA 4JTAA 1XSIA 1GEQA 2Z6IA 5G1MA 2O9PA 2ISVA 2XFRA 3KVJA 2V2HA 2C0AA 2AQOA 2OODA 4PTDA 1GHSA 3RLUA 5AYBA 2FGZA 3MCMA 1WAUA 2IPGA 2F2KA 2QT3A 5A6LA 1R3RA 1KFWA 1T40A 4XBJA 3CL8A 1F76A 1DJIA 4US5D 1MXSA 5G4HC 3T2QA 5SWUA 2AKZA 2CZEA 3URNA 3WH7A 1SGJA 5I77A 2XSBA 3I6TA 1OWQA 4LT9A 3IAQA 1FH8A 4FI4A 1CGVA 1VC4A 1UD5A 3GG7A 1JPMA 2QYGA 1PB0A 3GDBA 4I5UA 1Z3NA 1H5YA 3TTYA 3H2MA 3CASA 4GZIA 4TTGA 3OB8A 1XBYA 4BA0A 1E6NA 4D1IA 1RLDA 3UR7A 3GYCA 2XPKA 3GS6A 4AIOA 3C86A 3B3DA 5XIMA 5E6YA 3URQA 1AMKA 2YCLA 1W5MA 4WKFA 1EDQA 1VPYA 1KQYA 3MY9A 1RVGA 3EXTA 3IACA 1CIUA 3MVTA 2OFJA 4FZIA 1A5AA 3UPWA 3P8JA 3CMFA 4US5A 2ZOXA 1W1VA 1WUFA 3TQ0A 2MANA 3W24A 5AB3A 6REQB 2DV0A 2V5CA 5KITA 1IGSA 1HVXA 3KL3A 2PLMA 3DECA 5E0KA 4B3LA 4IQLA 1VJZA 3UEQA 1QK0A 4FALA 3ID7A 2J8GA 4H3DA 3G6MA 4Q8OA 5CJMA 3OW1A 3N2BA 2WM0A 4N6FA 2BY0A 4JTTA 2YZ5A 4OE7A 1HO1A 4PODA 4BFAA 4KRUA 2D2OA 1DOSA 1KM1A 4B5TA 2Q3RA 3VU2A 2BV9A 5ABFB 3ATYA 1AL8A 1W37A 3URAA 3G5EA 4YXGA 3REQB 4DXKA 1V0NA 2I17A 2LLEA 2PDUA 2W3ZA 2VC5A 5F2IA 4XUYA 1XM3A 4B16A 2XM1A 2V6AA 2XVGA 3W22A 1J11A 1E72M 3PS7A 1VR6A 4L7ZA 3HFTA 2JBMA 3FGCA 3N18A 4ZE4A 4AXNA 3TC7A 1UKOA 1ISWA 2PP3A 1XCWA 1FCUA 4GI4A 3WLKX 3ZZ1A 4LNYA 2ABBA 2HNEA 2Z29A 3KBMA 3LRMA 4HIBA 3RCMA 4AIUA 1OGGA 5CXPA 4RE3A 2B7NA 2VDGA 3G1XA 3EDFA 4BS0A 1YIXA 2Z26A 3O3RA 4IG2A 4XIAA 5DMYA 2D69A 2WBKA 1P6CA 2WMHA 4LVBA 3GDTA 1KBBA 4BCEA 1LT8A 3T1GA 4MYXA 4KIEA 2PA6A 2CLMA 4AY8A 4DPPA 3S2CA 3BARA 1VFFA 2DW6A 2UY4A 4UWMA 1AL7A 3DX5A 1W9XA 5TAOA 3HU7A 2IXUA 4S3CA 2PMQA 2ZX8A 2GVYA 5CC3A 4MIMA 3QQ0A 1MW1A 1C8XA 4AC1X 1Q6EA 1BYBA 3P5ZA 3L2LA 3UG5A 1GKPA 2D22A 3HMCA 3A5VA 2PTYA 4TX6A 1FDZA 3PUGA 4AG0A 2CHRA 1YE4A 1PHQA 3DBPA 4KMQA 1MZHA 1WDQA 3NQCA 4Z2GA 1HL8A 2FH8A 3M4HA 3DU0A 1TVLA 2EHHA 2RDUA 4J4KA 1PO9A 5CGMA 2NQJA 3M41A 2ZZ7A 5AHLA 3BAXA 1J0ZA 2YFNA 4C1KA 3CH9A 2Y8UA 3L4WA 3MT1A 3VGGA 4TVUA 3N1AA 2CXGA 3UZXA 5J04A 2YKKA 1UROA 3EA1A 2IUZA 5DEZA 1JYXA 3OPSA 2FB3A 3A13A 1QT1A 3MTWA 4EE9A 3CWNA 1UR3M 4HMDA 4W93A 1I1XA 1XLEA 2BXYA 1YDYA 1SJDA 5HNNA 4XTIA 1S39A 3SQLA 2D20A 1RA0A 3B9AA 4K2SA 3AS0A 1FP9A 1E9LA 2OLHA 3A64A 3MUIA 1FHDA 3TA9A 1XIMA 4FNUA 3AHXA 3DESA 1Q6CA 3FX4A 3BV4A 4XZNX 4O17A 4E3TA 2NSXA 3QR0A 1XJBA 4KWOA 1YKWA 2OZTA 1ICPA 4E6MA 1AZ2A 4U31A 4Q4OA 5CG7A 1JPHA 3OBKA 2V63A 4PRRA 3WF3A 3AIRA 4O12A 3HFYA 5IHSA 1V77A 2G96A 4XKYB 2VC7A 3CUHA 3W3OA 3SN1A 1J96A 1NOFA 4XX6A 3S2NA 1ICSA 3SIMA 1XIGA 2Q71A 2PDJA 2FGLA 5DBTA 3AIVA 3BLEA 2EPHA 4KS0A 3DENA 4YL2A 4WY0B 1NWUA 1H3GA 4QE4A 1G4EA 1Q5MA 4NX5A 4HK5A 3TFXA 3WDIA 2EEXA 3FN9A 4FR1A 1ECQA 4WQ6A 1FRBA 1A50A 2PDWA 1OGSA 1PSCA 3WF4A 3V0SA 1XD0A 3QY7A 4CN6A 3CUZA 1FH7A 3Q45A 3NJ3A 2YR1A 3QTGA 4O57A 2DSZA 2NT1A 3I7SA 3WBEA 3UWQA 2FZ9A 3CHVA 1AZ1A 2Y1HA 3CK5A 4LUIA 4PTNA 5I78A 3VX0A 2V67A 1FHVA 4CNPA 3KDOA 3RM4A 1PBGA 1A4LA 3W25A 2WQDA 2Y61A 3IIPA 4YTTA 2O4QA 1D8CA 4LALA 4GGHA 2PLCA 5G2IA 1E56A 3TNOA 2G3JA 1MNZA 1A5MC 1RVKA 3N9SA 1EP1A 3IJIA 1NARA 3BSGA 3M0MA 4Q22A 3VM7A 2VHLA 2O9RA 4LS0A 3A22A 3HG2A 4W5UA 2GGGA 3NQ8A 4JTHA 2YDAA 3LLXA 4OBTA 3P0XA 3R11A 2QJGA 1A5OC 3QMTA 3QW3A 2EJAA 4CCDA 4DJFD 4QG9A 4JHMA 2DPEA 4KPLA 2OX1A 4JS3A 2PDGA 4FPSA 4GACA 2YL6A 3SFWA 5CSYA 1QK2A 3MPGA 4DVOA 1X1NA 4HQVA 4HOXA 4CEUC 4OZOA 3VK5A 1EJTC 1QUMA 2Q8XA 3F5KA 3UXKA 4NI8A 4YIWA 5LXEA 1MSSA 1WNOA 4ZL1A 4DYJA 2BDQA 4IHCA 5AC8A 1H51A 2GJXB 2R24A 3GVGA 3NG3A 3W07A 3PTDA 1W3TA 1U83A 3B8SA 2J79A 3GVVA 4J2PA 1FUYA 2VL4A 1P4CA 1Y5WA 3GDRA 4JYEA 3WL0A 3BOLA 4IIEA 4DRSA 5FD0A 1OFDA 1LQAA 4ZQRA 4A35A 3B8WA 4GC4A 3ZSTA 4JOMA 3OP2A 3N2OA 3EXRA 3N2CA 1WDDA 1DWJM 2JF7A 3GK0A 3NQAA 4PL2A 1OFQA 3AYRA 2GSJA 3CH0A 1Q63A 1W1IE 2W61A 1QVBA 4EXBA 4PR4A 3MCOA 3QOMA 3SURA 3S2LA 2WSQA 3A6OA 1EWEA 4F2UA 3STFA 4ZOEA 4F0RA 2VMFA 1EXBA 3V0UA 4AFYA 4DBDA 5JU6A 1MRAA 2HQAA 1PV8A 3M5VA 4DJFA 3VAVA 3V5OA 3N12A 3BJFA 4WJEA 4AF0B 4DO7A 4DQWA 4TO8A 3EB3A 3AZSA 3HV9A 3N15A 1UUMA 4EACA 3I4KA 3QXBA 3Q67A 1M01A 4EANA 2A85A 2B0MA 1M7PA 3SSJA 4GUFA 1T8QA 3AJ7A 1R2SA 1SW3A 3WD0A 4C5ZA 3VNLA 1WXYA 4XISA 4IFRA 5HJYA 2HWGA 5EYWA 1JAKA 1YPFA 3SW6A 2X0HA 2YBVA 4MB3A 2O7QA 5I00A 8CGTA 1YX1A 1TUFA 2VFGA 3N25A 1YNYA 1RD6A 5JMUA 5C7VA 4GIRA 3O2LA 1Y0EA 3AS1A 1XKJA 4I9JA 3WH8A 4W8BA 2F61A 3CNYA 1EQPA 4H9MA 4GO9A 5HWMA 3O05A 3HO8A 2WVVA 5JUVA 2CPUA 1ZSXA 3EX2A 1FWJC 1J6PA 1MW2A 4GYPA 3VUSA 2AQVA 3WUEA 4PTVA 3VNYA 3UG3A 3UY7A 5A8QA 4HYRA 4OUEA 1WOBA 2Q6ZA 4PN2A 3NIYA 1IV8A 1TV5A 2DT0A 4HSOA 3BAJA 4F9DA 1QNOA 4H00A 2VZVA 5HWJA 4FXSA 3UZYA 4DBSA 1O60A 4GXWA 4EAMA 3M5ZA 2FPYA 1LOQA 4B15A 1IEVA 1SM9A 1XFBA 4YTRA 1SU5A 5IDZA 3PSWA 1FY6A 2PC8A 4EPEC 2E68A 3EPOA 4UB9A 1OJXA 1M3UA 1OC7A 3TJLA 3GXDA 4GI6A 4I9AA 5A6BA 3RAOA 4O15A 2PCQA 4UTWA 1HUVA 2PLJA 3W23A 3MUXA 1QU4A 4GZEA 4DZHA 2CZDA 3BMXA 4C5YA 4XZ9A 2Z2UA 4LF2A 2C8NA 5A94A 4IFKB 3QQ1A 2EPMX 3ZLHA 4TV6A 3ZJ8A 2HMCA 2FHFA 4H7VA 4ASTA 1RAKA 1L8PA 3PM6A 4O1AA 4LW7A 1X6LA 2QQ6A 3BLLA 5CZKA 2QLYA 1GJWA 2WYSA 2AMXA 3DC0A 3WY1A 3LHUA 4QE1A 3DDMA 4Y9AA 2PC4A 3WNNA 3ICJA 4Z2LA 3S2MA 1RP8A 4A8RA 2FHBA 3R0UA 4TOQA 3C8FA 3DHFA 4CNOA 2WWCA 4GUGA 1OFRA 2ZA3A 2P76A 3TA6A 3R58A 3HQPA 5DRCA 3ABSA 3K8MA 4M51A 1B4KA 2J7FA 2NQZA 2QNEA 1EKOA 4KEZA 3BTNA 2AGTA 3C0QA 5FJRA 1O94A 2FFIA 2INEA 4Q3MA 4DO6A 3ITOA 1V93A 3W84A 3LCLA 1SFLA 4AZHA 3QBUA 4YTUA 4TU1A 1DORA 3SJ3A 1OF8A 4AHOA 5T26A 1V08A 2QDHA 3AMDA 2P8BA 5BOEA 4ZXOA 4L6OA 2GQ9A 4DLFA 1EDTA 1S2TA 4NNCA 4DUXA 3P14A 2O92A 1Y5VA 3L9CA 1BYAA 4GJ1A 1EJRC 5F4SA 4FO4A 2PWHA 4GJJA 1VCGA 4JTQA 4DLMA 1EUAA 4BF7A 3L67A 2VENA 2PWEA 1IWAA 1FWEC 1DE6A 2PDLA 2B7OA 4FEZA 4EPDC 4H01A 4YYCA 2OXNA 3BGGA 3DFSA 3JS3A 3E5BA 1M7JA 3PANA 3TLQA 4IIFA 3MMUA 4WKHA 1O5KA 1VJSA 1WDWA 1SZNA 1XI3A 3H53A 4ADUA 4C6IA 3UXLA 1PIFA 5D2VA 3BH4A 2CKSA 1RCOB 1ONXA 3L5MA 3CU2A 1TPDA 3DFNA 5JH1A 1PIGA 2XISA 4O19A 4OU1A 3MP3A 3B97A 1ALDA 3P0WA 3P80A 2PDIA 1S5MA 4CCZA 1LOSA 2QGHA 2OYMA 2Y24A 3TONA 4LQ1A 3L21A 9RUBA 1EX1A 3KRSA 4XAPA 3WDQA 4DELA 1RQEA 1NP0A 2BLEA 3CWHA 4A3HA 4AZGA 1ZRQA 3DFQA 3OG3A 1QPRA 4Y96A 4UXDA 1JGIA 3T8QA 3RLGA 4MJZA 3PBVA 4KT2A 2GPTA 4PMOA 1OY0A 4AEOA 3VNKA 5FL0A 1WZMA 1XIDA 1S2CA 2V38A 1GYNA 5C6MA 3NURA 5HPOA 1GHRA 3UXDA 1S3HA 2VP8A 3E0FA 2ZTKA 4LBSA 3ALFA 4H8HA 3VFCA 1GW1A 4R53A 3LBOA 1PYFA 1GOMA 3GXFA 3WLPA 1H62A 3KOWA 4IM4A 4QIUA 3C0SA 2QAPA 3CUJA 3IJ7A 1LYXA 5D03A 3H21A 3QLLA 1J5TA 4D9PA 3AISA 5E5CA 2V5JA 1HP5A 2GVJA 2YB1A 5I2UA 3N29A 4Q8WA 4UCFA 4LFYA 2QCDA 4O8AA 1H50A 3UU0A 4DJDA 1RBAA 3CTLA 5FOOA 1CLXA 3TZNA 4GLEA 2VRJA 4QJ1A 1NTHA 1KXQA 4WEVX 1R8LA 4XKMA 2WC4A 4A05A 1EFZA 2NLIA 3IK2A 1ITXA 2VVNA 2QF8A 1QI4A 5DXXA 3B40A 1NM9A 5AC4A 2QKFA 1IT8A 4PTXA 4ENLA 1SMAA 1JUBA 5DXYA 1E9YB 2BY1A 1ZCCA 4AVOA 4GIAA 4LAOA 4AYGA 3TTOA 1Z89A 4GI9A 1FWBC 2ESCA 3VZYA 4IH3A 1TVPA 2QCCA 3E96A 1TA3B 5AZ1A 5D37A 1EXPA 4QAWA 4L61A 4UFIA 3QV8A 4Q33A 1F07A 2BVYA 2QJMA 1O7AA 2RH9A 6TAAA 2W5FA 3TN4A 4YCOA 3RX3A 4PL1A 1FCQA 2PLKA 2R1NA 4A4AA 3BGJA 4UFHA 2UWFA 2G37A 4PMDA 5CZ0A 3MW7A 3ARRA 4MDPA 1Q7MA 3W53A 4OQVA 3VGHA 3KBNA 4BZYA 1G4TA 5FAJA 1YEYA 1H7PA 2W79A 3UWUA 2ZIDA 4C6OA 2NQLA 1NELA 4G5DA 2XGBA 3E38A 3ARUA 1VHCA 4ML4A 4MWAC 1TO3A 4XK2A 1ZJIA 4S1FA 4H9YA 1IF2A 3S5NA 2DT3A 3MI3A 5LKYA 1CXKA 1SYTA 4B91A 2FQIA 4FIQA 3OIHA 4ZSUA 1NF0A 3HURA 3UJSA 1X97A 5HWNA 5ENLA 2WJZA 1MEIA 4ORIA 1AQHA 3EKZA 4ZE5A 3EAUA 7REQA 2OWWA 3SCRA 2QJJA 2QULA 2OO6A 1J12A 5CJ5A 1ME8A 1XLDA 4JTJA 3EYPA 1DJWA 1R3QA 4G7EA 1F73A 1Q3NA 2X0SA 3BVJA 3PULA 3FEMA 2H8ZA 1BTCA 1IXNA 2G50A 3A3HA 3W26A 3R43A 2XVLA 4RDVA 4B5SA 1EB3A 3HBLA 2YIHA 1BWVA 3N17A 4QTGA 1JF6A 5DCDA 1QI2A 1K7EA 2FZNA 3BCJA 4ZTXA 3KL5A 3APTA 3S9YA 4BJHA 4ICNA 3H54A 4DZ5A 1JIBA 3NQ2A 5IDIA 4BK9A 1JQVA 4W8LA 3NSMA 2HXUA 2YA1A 4OGZA 1EEXA 4ICMA 3VI2A 5BNKA 4DWSA 4TIMA 2CBVA 3HGRA 1BAGA 1KV8A 2FZDA 3II1A 3M0XA 4LGXA 2H9AA 2DW7A 4RUBA 3BLKA 1ZTVA 3W7KA 3UNDA 1MI3A 4D2JA 3PBMA 5BYWA 4U2YA 3CLMA 3LLDA 3ZOAA 3VDCA 3HG5A 1GOXA 1BHGA 4MM1A 3GC4A 2P0OA 2FIQA 3W0KA 3KOXA 4L4LA 5CSSA 3S1WA 4C7FA 2V5DA 3IARA 1AH4A 1REQA 3MSYA 3LERA 5REQB 2INZA 1U5JA 4AVNA 3TTSA 4GFIA 3RPTA 3AIUA 4HU4A 3VMOA 3UNTA 3UCDA 3PZUA 4PRTA 3IV8A 3BW4A 1O6IA 3W1NA 1IEQA 1EJXC 5J5RA 3NYZA 3MQTA 2FHCA 4MTVA 1XX1A 2YCKX 4E0CA 3AXMA 3PPGA 2V3GA 4BY3A 5HA7A 1OYBA 2A3AA 1QMLA 2HBVA 4ZENA 4O52A 4DXXA 3N34A 1CNVA 4GX9A 3BAIA 5F7UA 2E5DA 4RL3A 1YBQB 3C5QA 3BAYA 1YHTA 1TG7A 2Y62A 5EB8A 3MSDA 1R9XA 4LVDA 7TIMA 4JTFA 4AZ5A 3A24A 1WZAA 3KBWA 2VRKA 1XLIA 3ZFHA 3HJEA 4A8NA 4NJGA 4LCQA 2ATMA 2GDVA 4FR6A 1WP6A 3MO4A 3APGA 4UQ9A 3NO3A 4H1ZA 4ZODA 2JKAA 3A4JA 5HBFA 1GGOA 4R9XA 5C7HA 5IFPA 2Z27A 4FS9A 1SQ7A 4UTMA 3P8IA 2WV8A 5C9ZA 5I3FA 1F3XA 2QIIA 3IUDA 3NOYA 4F0MA 4LAKA 4XZIA 5FJPA 3VCNA 3HTWA 4I3GA 1Q65A 3MVIA 1FWGC 5FKYA 1RUSA 2TMDA 3R13A 1JZ4A 2ZZ3A 3QC3A 1JD9A 3IJQA 3KS5A 3PFRA 2PWGA 1RPKA 4AH7A 3H2NA 1R3WA 2VGIA 1QPQA 1UZ1A 1NSJA 2ZVIA 3KE0A 3QH2A 3QV9A 5KINA 4QLJA 2J77A 3T08A 3B9DA 5G5IA 3UY8A 3W9ZA 1GVYA 4IGHA 3TJ4A 1KXTA 2XVPA 2YXXA 4KWVA 5DF0A 1A4MA 2PGEA 2BASA 3RU8X 1KXHA 2NW0A 3PTKA 4TTUA 1QXLA 4OV9A 2PD9A 5C2CA 3PFMA 3WEMA 3STGA 1Q7ZA 2CWXA 4O0KA 3CV6A 5LA2A 3ZT7A 3T40A 4H9VA 3NM1A 2ZFAA 5HMDA 2FH6A 2ZA1A 1QBBA 2ALRA 3A4XA 2NT0A 2ANUA 4DBEA 3KL0A 1AW5A 3OODA 4MWAE 3H55A 3QZEA 3H22A 2X05A 3UJRA 4JQ1A 3I6EA 2ZTJA 1RA5A 4JQ2A 2ZXQA 2OLAA 1V02A 1J18A 2Z7GA 5MHBA 3GXIA 1PZ2A 3FA3A 1GQKA 4QX4A 1AFSA 1X39A 3W74A 5AYIA 3L65A 4ERIA 5ABGA 1DYSA 3NQVA 5F4WA 5A5WA 3H2FA 4L1WA 5HK4A 2QCGA 2X09A 1F6PA 3BLOA 1GKRA 2YZRA 3E0IA 3UXIA 1DQWA 3AUJA 2YL9A 4EAYA 5AYZA 4AWTA 3CXOA 2OSYA 1TWIA 1YQ2A 3C6CA 2YPIA 1GNXA 4O11A 3RCYA 1VFTA 1MEWA 5IXEA 3RPMA 4ACZB 3CWOX 2PF8A 4OOUA 3WEZA 3AMLA 4L4OA 1FWHC 3B9EA 4KRTA 4XVEA 2OZ8A 3W27A 5D05A 4C7GA 4WXZA 2VOMA 4IIHA 1ECEA 3SY8A 5FJIA 1XIFA 3W7IA 3WLNA 1GOKA 4IMEA 4F2BA 1LQ0A 2E09A 1W8GA 4LPCA 1PHWA 3AMCA 3HOJA 4UTLA 2I57A 3OEXA 4RZ4A 1YTKA