2Z0IA

Crystal structure of 5-aminolevulinic acid dehydratase (alad) from mus musculus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
323
structure length
283
Chain Sequence
VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSREDSPTIEAVRLLRKTFPSLLVACDVCLLSEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Delta-aminolevulinic acid dehydratase
publication title Crystal Structure of 5-aminolevulinic acid dehydratase (ALAD) from Mus musculus
rcsb
source organism Mus musculus
total genus 78
structure length 283
sequence length 323
chains with identical sequence B
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z0iA00
4WXYA 1N7KA 3W1QA 4MUZA 3B05A 3W73A 1A53A 2J24A 2VEPA 2H90A 1OVDA 3QH2A 4M7TA 4KFOA 4M19A 4AMAA 1SW3A 3W84A 3C6CA 3M7WA 3N3MA 5BMWA 3ATZA 1DJNA 4TR9A 1SZNA 1G7UA 1XCFA 5I3IA 3H54A 3LTYA 3BARA 5J5RA 5G4WA 3TIMA 1M6JA 3LTSA 3UWUA 3HGSA 3UPWA 3NR0A 5GVJA 3QF0A 3S1VA 3PR2A 4K7YA 1O5XA 2Q8LA 1LOSA 3NQ8A 2NX9A 2FLIA 4QNEA 5DBTA 5AYXA 2ZZ1A 1DKWA 2X16A 5D37A 5K9CA 4JYFA 5U4NA 1IXPA 2E09A 3QQ0A 5FEXA 5I3HA 4O12A 3IIOA 3CPRA 4GNJA 5BOOA 3GXNA 3G1YA 2X1TA 5CPNA 2ZQ0A 1XC4A 5EL1A 1RV8A 3P5YA 3FJLA 1FBAA 3LX9A 3SW6A 1KV5A 1IIGA 2DZTA 3O06A 4I7UA 3W76A 1P5BA 1X1ZA 3LHTA 2VFHA 5FF0A 3UY8A 5HR7A 3NGJA 2ZTJA 3THAA 4WOZA 5HQEA 4HPXA 4DPPA 1P1XA 4K36A 3H53A 4CCCA 4UTKA 1OK4A 1LBMA 4LS1A 1X7FA 3E49A 2NX3A 3L0GA 4AWTA 4GRSA 3TJXA 2BZNA 5D33A 2OMAA 5C55A 3FIGA 2V82A 2ISWA 1Q6OA 3LM7A 3U6WA 1KBIA 1NAL1 3F4NA 2NXIA 4DXVA 2VEKA 3S9YA 4N2YA 3WK3A 3W7GA 3YPIA 1KW1A 3A9IA 1PCWA 3EWZA 2QJIA 1N8FA 1UUMA 3GZ3A 1XDLA 3C8FA 1TJPA 5K9XA 4K6AA 1TB3A 3QQ1A 4YLWA 4MVAA 1VR6A 1EB3A 2PCQA 3G8EA 4DO6A 4PODA 2HS6A 3WJXA 2NV2A 3PB0A 4PEKA 1L2UA 1GTHA 1A5CA 3BLEA 4DBEA 1WBHA 4JTJA 4UTWC 4HHPA 3NO5A 4POCA 4IXHA 3W23A 3A5FA 1ALDA 3IV3A 3UWZA 3SZ8A 4LWWA 3W1AA 3W7NA 1T8XA 1G4PA 3RFAA 1IGSA 3LRLA 3HPZA 4NXKA 4ORMA 3RLUA 3O6CA 4UMCA 2QCEA 3ELFA 1VS1A 2WSYA 1OF8A 2QEZA 4ZMGA 3C61A 4Z1CA 1GVQA 3CWNA 1H7WA 3RU6A 3U8GA 1RQHA 1FWRA 2Y6ZA 2FPVA 1Z42A 1X1OA 1PHWA 1TV5A 5AHFA 3GKFA 3P61A 3DHFA 4Y9AA 1KV8A 4WUIA 2ZA1A 3EXTA 4QM1A 4ZL1A 1E51A 1LDCA 3B06A 1ZENA 3W1TA 4E0CA 3TW6A 2YW4A 4AHOA 2QAFA 4O13A 1KBJA 2VENA 1OF6A 1XFBA 4MJMA 5D32A 1LM1A 1U83A 1XBVA 3G1VA 1X6UA 5KTLA 3IIZA 1OG0A 3INPA 4XTIA 2V8ZA 4EWND 3O07A 2C3ZA 2NLIA 3L5MA 2ZRWA 2HSAA 3DI1A 5LNWA 1G4EA 4XZ9A 3LCLA 1FCBA 4ZVJA 3FA5A 3W83A 3M1ZA 3IIXA 4TU1A 1H63A 4O54A 5HWNA 1TRIA 5HUPA 4E2BA 2ABBA 3QRHA 4ZQCA 5LHEA 5G2HA 3ATYA 1W8SA 3FLUA 3H55A 4IJBA 2I14A 3PUDA 1NF7A 3TC7A 4LS0A 4CQAA 2JKPA 4O50A 3LRKA 1WBJA 4ONVA 3R13A 1W5QA 4DPQA 1W3TA 2A6NA 4RLIA 3T40A 1ICPA 4OT7A 1EWDA 3OVRA 4JS3A 3S5ZA 1MEHA 1BWKA 1K8XA 1MEIA 1PHQA 4JYDA 4NJJA 1T96A 5BRBA 2AGKA 3S0CA 1VQTA 4S1FA 1F2JA 1LLWA 1Q45A 3GK0A 3ZFHA 3NQCA 5AYYA 3W7IA 1RVGA 2V2HA 4O16A 2P1FA 1GVFA 4Y6GA 3W7HA 1QAPA 5K7JA 1ADOA 3M5YA 5D2TA 4Z0JA 4DELA 1KTNA 1I2QA 2GOUA 1MXSA 1LRTA 4Z0SA 3O8AA 1ME9A 3W22A 1R47A 3W2KA 2G5WA 2ZZ6A 4LUJA 5ABTA 1OK6A 5AOUA 3MJYA 2WSQA 3W7JA 4LTSA 2AAMA 1TSIA 1GWJA 3ABQA 1ZAJA 1ZFJA 4YXGA 2XFWA 3EWBX 3PC0A 3QEZA 3MW7A 4RV8A 4JTLA 3WK0A 3GDMA 5LKYA 4NQ1A 1K02A 3LBCA 5D02A 2E1DA 1VJIA 4BWLA 4DQWA 4OV9A 4AWSA 3NL2A 5HUOA 4WQ6A 4JTUA 4GFSA 4D2JA 2W6RA 5F2IA 2J9ZA 4M6VA 2QCMA 4S2BA 4JGDA 4LUIA 4DO4A 2X1RA 2JGQA 3LOTA 3S42A 5FF7A 2YYTA 3MBDA 4Q33A 4ALDA 4PC8A 2YW3A 1YDOA 3HJZA 5CZSA 3I7SA 4HKPA 2PURA 7TIMA 3GR7A 2A7PA 3VE9A 2E5CA 3ZWTA 4CNOA 3PUOA 1O60A 3O15A 5D04C 3MBFA 4UIOA 3EEGA 5F2MA 3WK2A 3KVKA 2Z2UA 5DLCA 3UD6A 5TIMA 4QIUA 1DVJA 1QO2A 3FFSA 4LU0A 3GIYA 2ZRZA 3NAVA 4RZ6A 2A7RA 3L2IA 4K37A 3DGRA 3VFLA 3B0PA 4K38A 2VOMA 2V2CA 3CEUA 4NU7A 1I45A 3P74A 4NJKA 4CNNA 4IX2A 1WOBA 3G0SA 1KFCA 2A6LA 5LGXA 4UTWA 2NUXA 1JCXA 1TREA 3PF3A 2H6RA 1TTJA 2V0TA 3TV8A 1FUYA 4TX9A 3KVLA 3VKJA 1JUEA 3IVTA 1OFDA 2B0MA 2YGYA 2QJHA 4LC8A 3V1PA 1LROA 3B4UA 1VRDA 4XWUA 1YPFA 3W1NA 3BO9A 3G22A 3C52A 2RHGA 3EX4A 3GXPA 5KZDA 3FEMA 5L6UA 1J5TA 1KM1A 1R2RA 4QQ3A 4GJ1A 3P67A 1AL8A 2OT1A 4H3DA 3VI2A 3HF3A 2YSWA 3LHWA 3KAOA 3DFOA 1NEYA 3PB2A 5E1QA 3L68A 1JJKA 1QPRA 3SSJA 4UNLA 4NNAA 2EGZA 1PL9A 1I8JA 4CLMA 4RXFA 1KM6A 1AW5A 4NT0A 5KZMA 1K03A 4NNBA 4AF0A 1SO6A 3R12A 3V75A 1TQJA 3GYEA 3TFCA 1RR2A 3GDRA 2QAPA 5F4SA 2PC4A 1TPDA 1YLVA 1X8FA 3CU2A 5CZTA 1UASA 1TPB1 3LCFA 4RX0A 2FQIA 2WNQA 1TPH1 2C13A 3I65A 3ZWSA 4FNUA 4WOQA 2GVLA 2JBMA 1RD5A 3QMRA 5A5WA 3DH7A 1KFKA 3M41A 3KRSA 4O53A 3L9CA 2A1YA 1JULA 4LRSA 3SECA 4WXZA 2ISSA 4NJHA 3BLFA 4Q4KA 2PE4A 3NQ7A 4O1DA 3BG3A 4MYAA 1I4NA 4WY0B 3LCWA 3TKFA 3EWUA 3EWXA 1OHLA 4A3UA 1SFLA 3QW4B 4RCXA 3UZ5A 1W5PA 3QMTA 1SSDA 1K7EA 4LS2A 4N6EA 4H6KA 3A21A 4FB7A 3MWAA 3N2MA 4QSHA 1H60A 2CLKA 2C0AA 4PFMA 2FDSA 3GKAA 3W86A 3P5ZA 5LSMA 4B5NA 3UPBA 2E5BA 3UWQA 3LXAA 2XN1A 2GQ8A 1DQXA 1V7YA 4ZQNA 3TJLA 1QOPA 3OHIA 4GXMA 4GUHA 3QFEA 3G3DA 2QCDB 3N9SA 3HIJA 4IMGA 4IMFA 3QM3A 4LVBA 4MZ1A 1VYSX 4FIRA 4IWWA 3CWOX 2VFDA 5HWJA 1KFEA 4YWIA 1QCWA 5I3KA 2OX1A 5LNSA 3W7RA 1I2OA 4Q32A 3STCA 2ZRYA 4GUIA 3O16A 2EAWA 1GYLA 5D30A 3VCRA 1QMLA 3N9RA 5G2WA 2OZ0A 3G3MA 4JEQA 4A29A 2FB2A 3GVGA 3DENA 2DJLA 1SZEA 3M9YA 1OFAA 3E0IA 1H1YA 4KFPA 3BW4A 3KRUA 4UFJA 1KM5A 4O28A 4FIQA 1H51A 1GTEA 3FYPA 1FWWA 3NNTA 5G2IA 4K8EA 1TQXA 3W7DA 1KTCA 3FJ6A 5AN7A 1OJXA 3DFQA 4TIMA 5I3FA 4MFDA 1R30A 4JX5A 3NQGA 1IXOA 2DZPA 5C6MA 3NM3A 1G67A 8TIMA 4MFEA 1SU5A 4NX5A 1GVRA 4P61A 1HL2A 3W71A 2C14A 2TSYA 4O1BA 3T44A 3ABSA 1EP2A 1KM2A 1KM0A 4FXRA 3MO7A 5D05A 4OBTA 2ZZ5A 3NPVA 3L0KA 5D2XA 3U2OA 4GUGA 5EY5A 2GQ9A 2JGYA 1UB3A 2P0OA 1DJQA 3LXBA 4JY9A 4OHQA 3DAQA 3N73A 4IUOA 4YMZA 2VELA 3SR7A 1H7PA 3KFTA 3EKZA 3UXAA 1B3OA 3DZ1A 1MO0A 1TYGA 3G1FA 3MI2A 2X30A 3C0JA 3F03K 2E6FA 2R94A 3C4UA 1QPQA 1H1ZA 2V30A 1EUNA 1PVNA 3TC6A 2NUWA 2B7OA 1DQWA 3UQNA 3BPWA 3C56A 4DF1A 2CLIA 2BSLA 3D0CA 1EEPA 4O4VA 1K3UA 1BEUA 1JVNA 1FDYA 4BWLC 1M5WA 5C54A 4WX2A 3MYPA 2E6AA 1EP1A 1FXPA 3SJ3A 3SGUA 4JR5A 4YCOA 2WNZA 4IOTA 2ZZ2A 3G18A 3QW3A 4UTUA 2F84A 4MY1A 3G0UA 4O4WA 2HS8A 1OFPA 5DCDA 1RQBA 3W07A 3IVUA 4P2VA 2O7QA 2NX1A 2ZA3A 2CLHA 3L0NA 1F7BA 1AW1A 4ADSA 2TMDA 5FF4A 1TIMA 5CSSA 2YYUA 4JIPA 3CLMA 3S5OA 3QPZA 1O5KA 3TE9A 2ZBTA 4ADUA 1TMHA 5CG7A 1SR9A 3TQKA 1B4KA 1YYAA 3LV6A 1MEWA 4PH6A 3W1XA 1F73A 3MUXA 4CCEA 4DEFA 4N9CA 4IPJA 4JDBA 4DO5A 4A21A 1LOQA 3LHZA 3FS2A 1AK5A 1YXDA 3C2EA 4WZHA 2AQWA 1KM3A 2QCCA 1JCNA 1GOXA 1EX5A 1I2RA 3CQ0A 3LLDA 4UFIA 1YXCA 2DZSA 3W7PA 3TX9A 4HSNA 3N34A 3JS3A 4UR7A 5D2YA 1DOSA 3W85A 1OX4A 1ZAHA 1LLZA 5CSRA 4KKXA 3NG3A 4U4MA 3KXQA 1H7NA 3W6YA 5F4XA 5F2LA 2CFFA 3QSTA 5DY2A 2FJKA 1H7XA 4UUIA 1GVSA 2G97A 3M43A 3W7QA 5LZLA 3GDTA 3W7CA 1GYNA 3S1XA 3S5NA 2VFEA 1UCWA 3LDVA 2Y85A 4LT9A 2VEMA 5T26A 4IMCA 3W9ZA 3VE7A 2B7NA 2YFOA 4A22A 2EPHA 2ZA2A 3STEA 1VCVA 3OIXA 3CEPA 3OA3A 3TSDA 1VPXA 1VC4A 1FY6A 2A0NA 3G1HA 3MHUA 4I9AA 5CPMA 4O0KA 4GE8A 1C29A 3W7LA 5KSWA 2CW6A 1TCDA 3S6DA 4PL2A 3W2LA 3A5VA 4HPJA 5LHFA 2H8ZA 4LV9A 4UFLA 3NL5A 1TPWA 3EX3A 3SFKA 3K30A 1B4EA 1S5VA 1ML1A 1XBYA 4LV4A 2C16A 3M16A 2ZCGA 3LB0A 3A24A 4O1AA 1D9EA 5AHNA 4O18A 2YR1A 4ZZ9A 4JX6A 3LCIA 4KWVA 1HG3A 1VYRA 1A5AA 1KLZA 2FPYA 3BVJA 3PG9A 4N6FA 3W7EA 1LP6A 1F6KA 5G4EA 2E6DA 3DFNA 3USBA 2WNNA 2QJGA 3B04A 4JICA 3QZEA 1IXQA 5HMSA 4UXDA 2QDHA 3TR2A 1LZOA 1IIHA 2BWGA 1M7PA 2WQPA 3PBWA 4UMBA 3TW7A 4JTSA 5HULA 4UCGA 4NZFA 1W54A 2NUYA 1SZGA 1UBSA 3IVSA 3L21A 1W0MA 4K39A 3BGGA 5DBUA 4LW7A 3M0ZA 2FIQA 2YDAA 5FF2A 1WAUA 4MY8A 4IPIA 4O14A 5HR6A 2H8XA 1NSJA 3A23A 3GXTA 3T55A 4FX8A 3OG3A 3G0XA 3HPSA 1OFOA 3NXFA 1ZAIA 1GEQA 1F74A 5HNRA 5F2GA 1LCOA 2R91A 3DFTA 4LVAA 2E6YA 4EVZA 2NXGA 4TMBA 2W0UA 3IIPA 1FWTA 4AVFA 4X9SA 4IQLA 1DHPA 5H91A 4MZ8A 4RKAA 2DZXA 3UNDA 4JTIA 4MKNA 4RZ4A 3C3NA 2DJXA 2H3BA 1SO4A 1FDZA 2Z0IA 3LCXA 1S5WA 2EF9A 2Y7EA 4L4LA 2ZTKA 4C1KA 3EX1A 1XDMA 3LXCA 1S5TA 3L5AA 5MHBA 1TV7A 2CLMA 3TROA 3KRZA 1U5JA 2ISVA 3THQA 3G1SA 4G1KA 3LGEA 1XM3A 3W70A 4NX0A 3HG4A 3E12A 5BNKA 1ZY9A 2WKJA 1GQNA 1VLWA 3LRMA 4NZJA 1B9BA 4WD0A 5G1TA 4JD4A 4N9DA 4LY8A 3PS7A 2QCGA 1EUAA 5TQLA 3IGXA 3OVPA 4E38A 4X2RA 3UZJA 5C2XA 3DHDA 1Q3NA 2NZLA 2FPTA 1ICQA 2Y63A 5IBXA 3DKLA 5K4ZA 3W87A 2E77A 2FFCA 5FF3A 2Y70A 5AC6A 1RZMA 1I2NA 1DV7A 4UTLA 4LVFA 5FEZA 2YPIA 3O05A 1QO5A 2RDUA 3W2UA 1VZWA 4UTTC 1JR1A 3QPYA 1WA3A 3ANYA 5CPLA 2ZZ4A 1TPC1 3E9AA 1SPQA 2GVJA 5CKSA 4KWWA 2DZUA 1G4SA 2EKCA 4X22A 2OJPA 4JYEA 4QNWA 1QPOA 2DZVA 3NOEA 2CZFA 3GAYA 1O95A 5L9FA 2DU2A 5KINA 1H7RA 3WJWA 3PULA 4I7VA 1M7OA 1VLIA 2GUUA 1XL9A 2YX0A 4HN4A 1YDNA 4UTJA 1F05A 3BG5A 3DBPA 1TTIA 1VH7A 1SW7A 3PBUA 1W5OA 3KHJA 4K7VA 4MLJA 4UFKA 3GDKA 2CLFA 1L9WA 2V2DA 1Q6QA 3M5VA 1GT8A 3TAOA 5EBUA 1WDWA 3I7RA 1RPXA 1PIIA 2WV8A 2Z6IA 3NVTA 1ZCOA 2R8WA 1EWEA 2QKFA 4N4QA 2NWSA 3GX9A 4XKYA 2Q3OA 3WJSA 4Z08A 5FEWA 3W7MA 3NA8A 4H4IA 4EIVA 2JKEA 2VFGA 1FXQA 1THFD 3TA6A 3P84A 3WJYA 4TMCA 3HG3A 1WYIA 4IGHA 2CU0A 3PSVA 3LV5A 3QSRA 1W3NA 1R2TA 3O6YX 4DBDA 1HUVA 3C2VA 2A85A 4JN6A 3NQ6A 3UWVA 3TCEA 4AHQA 5G1YA 5F4WA 1MZHA 3MP3A 1CX9A 3TDFA 1VCGA 4QISA 4O8RA 1JRCA 4XQ6A 5BMXA 2Q3RA 1A5SA 4FXSA 1YTDA 3O63A 1AMKA 1LORA 3HG5A 3W88A 4O11A 4MIMA 5KITA 6ALDA 1G6CA 3PAJA 5KZEA 5FESA 1H50A 3M5XA 3M6YA 1LRNA 4JX4A 4FNSA 2LLEA 4ML9A 2B7QA 1Z48A 4M7SA 3R89A 1R2SA 5EKYA 1DBTA 2E5DA 5AC8A 1PCKA 1G69A 4ZQPA 2CWNA 4NUWA 1FWNA 1J4EA 1S3HA 1XUUA 3N2XA 5A8GA 2Y7DA 3ZS4A 4ICNA 4LVGA 2Y62A 3BK0A 1SSGA 1QFEA 3NQEA 3T4CA 3NPUA 2JKAA 3TQVA 3HMJG 1GZGA 5DXYA 3TU9A 2D73A 2O7SA 3S1UA 4QITA 3T7VA 1ME8A 3N14A 4HNUA 1SO3A 3LLFA 2VKZG 1MSSA 4K8HA 3CB8A 1J2WA 5AHMA 3QYQA 3F4WA 2OT0A 3EWWA 1NVMA 1ZHAA 3GDLA 2GVGA 3PVFA 4NVTA 1W31A 1EA0A 5CZJA 1GVOA 3HGOA 3CM4A 1Y0EA 3NPXA 4WY0F 3BLIA 1I2PA 3E96A 4OU1A 1OYBA 4IMEA 4LOCA 2QCNA 2QDGA 3LTPA 1A5BA 2BXVA 4R34A 2G95A 2ZZ7A 3ABOA 5K4XA 4XUGA 4WJEA 5D38A 1D3HA 3W2JA 2ZYFA 2WJZA 3W1PA 4Y8FA 5U7SA 5F1VA 1F6PA 2I9EA 5DCBA 5E0KA 3EXRA 3M44A 2TPSA 3KX6A 3WFAA 3W1RA 4NNCA 1W1ZA 3C2FA 1K8ZA 3SGZA 3LHUA 4PA8A 3TAKA 1KFBA 3RK8A 1C8VA 4ORIA 1OX4B 2NXHA 4Y96A 4S2CA 2NWRA 3QC3A 3B8DA 3DXIA 1QR7A 3MI3A 3P62A 4UTTA 4YL2A 4XTDA 3GNDA 4A2SA 4YCPA 5DY3A 3W1LA 3DFPA 1UJPA 1XKYA 3W75A 4WY0A 2C1HA 3MP4A 3B0UX 3DKJA 5EMUA 3JRKA 4Y90A 3WK1A 2ATSA 2KZHA 2CLLA 4CNPA 1Z44A 1FX6A 1PS9A 3TK7A 2FTPA 1D3GA 2A21A 2ALDA 1QWGA 2RFGA 2Q8ZA 3UXDA 2ZRVA 2J6XA 2DORA 3C2OA 4UC5A 3W2MA 4JTEA 4AWUA 4FX6M 5AC7A 4Z1DA 1UUOA 3ABRA 3LBMA 2VEIA 3L65A 2QCDA 5LNRA 2CZEA 4RK8A 2GJNA 3P8IA 2ZRXA 1YPIA 2OCZA 4JTFA 4AH7A 3EB2A 4UTMA 2HMCA 3TQ0A 4O57A 4QJ1A 2YFNA 4RR4A 1VGAA 4O15A 4FEZA 2J9XA 1HTIA 4UR8A 2HTMA 1BWLA 3A22A 2VFIA 3PM6A 5D09A 1W3IA 3CC1A 3TNOA 2ABAA 3PY2A 5CZ0A 3UWYA 3LHVA 1XBXA 1H7OA 5E93A 4MJZA 3BG9A 1FCVA 3GNNA 5EYWA 3W7KA 4PCFA 2QUTA 1WQ5A 4LC6A 5IBXC 4FNPA 1P4CA 3NZRA 4KFNA 3AJXA 3HBLA 5AYZA 5J5DA 4NXSA 1LYXA 4N4PA 1CW2A 4OWGA 3JR2A 3PG8A 3L66A 3IEBA 1R46A 1XXXA 4CQ8A 3GAKA 3WJZA 4E2DA 4O17A 3TMLA 1N55A 4IXXA 1G4TA 5HWMA 2Y7GA 2B7PA 5K2ZA 4BK9A 3GR8A 3OBKA 3DFSA 4JNMA 3STFA 2UV8G 1DORA 2NV1A 3NEVA 4JXCA 4LVDA 3TFXA 3CT7A 2RDTA 2GQAA 3HGRA 1P0KA 3MI6A 3FOKA 3O6DA 2BX7A 1H61A 4O19A 5K9DA 3W2NA 5BW6A 2WOQA 3GB6A 4N9EA 1TPUA 5CPOA 3Q58A 3CIWA 1Z41A 3B0VC 1QDSA 1GPWA 1JRBA 2CZDA 1JCMP 3EWYA 1OFBA 3MHFA 4ADTA 2X1UA 2ATMA 5G5IA 1WXJA 3BW2A 3DI0A 3IIVA 1JCYA 1NFBA 1O4UA 1VYPX 2J88A 2ZFAA 3G24A 3S8HA 4L4MA 4ZQRA 2FB3A 2V5LA 3G1XA 2F7FA 3G1AA 2WSRA 4FX7A 3FKRA 4M6PA 4EF9A 1WOAA 3NZ1A 4OQVA 4UTHA 4GUJA 1H5YA 1FDJA 3PUEA 1ONRA 2ZRUA 2X2GA 4XBSA 4CCDA 1B57A 3M47A 1YADA 1GG1A 1WX0A 2PRHA 4BI5A 4GC4A 4UMAA 4MZYA 5D03A 3N19B 1L6SA 1DL3A 1ICSA 1SFJA 4FNRA 1EIXA 6TIMA 3NM1A 4MY9A 2Z1BA 3STGA 3L67A 3TMQA 2XN2A 1KA9F 2V9DA 1C9DA 2V81A 1ZNNA 4HNNA 3HQ1A 3NQFA 1H62A 3T78A 2JK2A 1Q6LA 4HSOA 3EX6A 3R5EA 4O52A 4JTGA 5I3GA 1AL7A 3EXSA 2GPTA 3SIZA 2E68A 4X3ZA 2Y61A 2RDWA 1CI1A 1W56A 4FO4A 3OEXA 4M6QA 2VC6A 4OGZA 5AB3A 3QMSA 5F1UA 3LERA 1JQVA 2QCHA 1JQXA 1L6YA 4OE7A 2C6QA 4IX0A 4RZ5A 3SY5A 3W74A 4AEOA 3TH6A 4JY8A 3DU0A 4UFMA 2VXNA 3RNDA 1IXNA 4N02A 4JTKA 4DF2A 3C2RA 4ZQMA 1TJRA 2EHHA 4BR1A 2Y89A 3I6RA 4CQ9A 2J9YA 5DN1A 3HGJA 5D2VA 4PL1A 5LNVA 1OYAA 2XN0A 2C19A 2PRLA 4OV4A 1O94A 5AHIA 5H2ZA 3UYCA 2BTMA 2H3DA 1XI3A 1OFQA 1A50A 1JCLA 1TPFA 1QPNA 5LGZA 1YTEA 4O1CA 3M5ZA 2V5BA 4XKYB 2BLEA 4O0ZA 1GJPA 3FKKA 4UNKA 2GJLA 5FI8A 1KTBA 3W7OA 1TTQA 3NYZA 4MLRA 2A2IA 1Q6RA 3G1DA 2CLOA 3PWAA 4PTNA 4AF0B 3W3OA 3Q94A 4MYXA 2G96A 1JCJA 3LCGA 1QOQA 3GLCA 1K7XA 3KVMA 5DCEA 3G8RA 1TTPA 3ZR4A 1W37A 3R2GA 4HIBA 3NDOA 5DELA 1F5ZA 4AHPA 3PSWA 2YCEA 1T0OA 4AB4A 5CGQA 2WPBA 4O10A 3SI9A 4GUFA 2PRMA 4C1LA 5EA9A 1AW2A 5FEPA 2DP3A 3LHYA 4GWEA 2C15A 1VHNA 5K3VA 2QUUA 4JDYA 3P7YA 3NQDA 4NJGA 3PBVA 3UY7A 2QCFA 3B03A 2ZZ3A 3KVJA 2RH9A 4EOUA 3OVQA 1LBLA 5LNUA 4TO8A 3IGUA 3I68A 3S1WA 1W5MA 1OX5A 3RLVA 3Q2DA 3LI0A 2I1OA 4BI6A 2QUVA 3F1QA 1SUXA 3RMJA 1RQEA 1TPEA 2VFFA 3HO8A 1W5NA 4A2RA 1ZALA 3HPXA 1HFBA 2QF7A 3QJAA 3UWWA 3W72A 4BFAA 4BF9A 1FCUA 3CHVA 3HB9A 3P8JA 4R7JA 4LNYA 3NPWA 2DZWA 2W79A 4MPQA 1IF2A 4LRTA 4J9JA 2RKXA 5SWUA 1KFJA 3IRDA 5HINA 3MMTA 1SW0A 3TSMA 1LBFA 3NL3A 2ZDRA 3O1NA 1FCQA 1SQ7A 2CZ5A 1PE1A 5I3JA 5D2WA 1KLYA 1YTKA 5AHLA 3BV4A 3P82A 3TSBA 3EX2A 3AO0A 3NQ2A 3CTLA 1F76A 2X1SA 1JUBA 3MP5A 1YDVA 3NL6A 5C5YA 2P10A 4EF8A 1QNVA 1KM4A 3BGJA 3IGSA 4DF0A 4ZQOA 1HO4A 1TO3A 3L5LA 1G7VA 1NF0A 2QR6A 4QAIA 1OABA 4HNTA 1KFLA 5AHEA 3RF9A 1TRDA 1OFRA 3NQVA 4N9BA 1LRQA 3VNDA 5HJLA 1OX6A 3EKLA 1WV2A 1BTMA 1P0NA 2A4AA 2TRSA 3P80A 4M5PA 3MHGA 5AFDA 4IMDA 4U28A 2TYSA 3W1MA 3TUUA 3KOFA 5IM51 1HO1A 2CLEA 1BKSA 1VCFA 4R33A 3P81A 1T99A 4FF7A 3MYOA 3S5YA 1ME7A 3Q37A 3HG2A 1GG0A 4Z1AA 2Y88A 3R8RA 1FWSA 3NQMA 4RJEA 4MOZA 3P60A 3CIXA 1OFEA 1XUZA 4Z1BA 1VHCA 4AXKA 4HNVA 3I7QA 2A5HA 2Y7FA 4BI7A 2R14A 2C18A 1PV8A 4FHAA 4JIQA 4AAJA 1ZJIA 2IQTA 1FQ0A 2YZRA 5KMYA 3W1UA 5EPDA 4UFHA 4UTIA 5DXXA 2YXGA 3TXZA 2A7NA 4JTHA 3LCHA 1L6WA 2B4GA 1OYCA 1K8YA 3HOJA 1LOLA 4FNTA 1SZFA 4NJIA 4XBKA 1AG1O 1LTDA 2QCLA 1K7FA 1TPVA 2WO5A 3E02A 3BW3A 1XBZA 1TV8A 3PBYA 1YXYA 3FYOA 3NQAA 1EPXA 3LI1A 1V5XA 3TXVA 1SO5A 4I7WA 2Z6JA 4R53A 4RXGA 4FNQA 4GBUA 4W9TA 4JTTA 1EP3A 2J27A 4HT3A 5TBOA 1JUKA
chains in the Genus database with same CATH superfamily
2I5IA 4JTDA 3WBWA 3I3BA 3PTQA 4M19A 4QHRA 1SW3A 4GHRA 3NZPA 3UA3A 4XZNX 3U9IA 2CERA 4PBGA 3QY6A 1XCFA 3IACA 3LTYA 5M2FX 3LA4A 3KUMA 5G4WA 1WKDA 3OZPA 3A3HA 3UWUA 3HGSA 1TE6A 4M24A 3S1VA 1XLFA 2J8GA 1O5XA 2Z2AA 4GVFA 2Q8LA 3ARRA 1CB7B 2FLIA 4W86A 4QNEA 2PD5A 4WLCA 3TN5A 4JYFA 4PTDA 1IXPA 5FEXA 1ZQ5A 1RK5A 3CPRA 1V77A 1V6YA 2ZWYA 5CPNA 1EJTC 1BRLA 1XC4A 2ZQ0A 3HU7A 1XYCA 1RBLA 3NUKA 5REQA 3SW6A 1KV5A 2QDEA 1U33A 4HYWA 3IUHA 3NO1A 3IK4A 3LHTA 2XZ9A 5FF0A 3BJTA 4G9PA 3NGJA 4FMVA 3ERPA 4WOZA 5BCAA 5HQEA 1WPCA 1AODA 3VD4A 2D0FA 3WUBA 1X97A 2X0YA 3ONCA 1X7FA 1PB0A 5C55A 3U5YA 2YIHA 3CYJA 1QW9A 2CIPA 2ISWA 3OP2A 1B9ZA 4HYVA 1Q6OA 1O5QA 2VM8A 1XS2A 3RM9A 2DGAA 1M01A 4DXVA 1JD7A 4XAYA 4HOWA 3VO0A 1E71M 1PCWA 4L56A 3GFXA 4HHMA 4PUKA 4UQAA 2AL1A 2HV5A 3GZ3A 1TJPA 2I57A 5BRQA 1TB3A 4JBRA 1C7TA 4YLWA 3ITGA 2PCQA 3APTA 4JQ1A 5CQ1A 1XGEA 4BY3A 3HN3A 3B9OA 5HAOA 4AZCB 3WJXA 3WLJA 4I90A 3BTNA 2NV2A 4DI8A 3TVAA 1E1EA 1OD0A 1Z3NA 3SUVA 4HHPA 3UWZA 3BGAA 3SZ8A 3VKKA 1T8XA 2VCAA 1G4PA 1G0CA 4TX8A 3HPZA 4INFA 5IDIA 4DXKA 1XPYA 4UMCA 2QEZA 4Z1CA 1ODZA 1H7WA 3U8GA 4AZ7A 3W81A 5AHFA 4WUIA 5I6SA 2D23A 3W1TA 1QJWA 2D0HA 1J6OA 2QAFA 4JTRA 5FSDC 3TJIA 3MANA 3MCOA 1VBUA 4JIHA 3LGGA 2XWEA 1FWIC 3L5MA 4FLQA 4CKQA 2HSAA 5LNWA 1FCBA 4ZVJA 3FA5A 5EMYA 4O54A 4WCJA 1FOBA 4E2BA 4GJIA 4ZQCA 4Q7IA 2VCBA 4R85A 4BZYA 1F9CA 5CJMA 3W0KA 4HCDA 4ZGYA 1Q4NX 1XP3A 2NQJA 1BSIA 1NF7A 4LS0A 3ANUA 1AD4A 4RLIA 2Z2BA 1QI4A 2OQYA 3HQPA 3ARZA 3VNMA 2PU1A 4XAFA 4CEUC 3MJMA 4JYDA 3POCA 3BDKA 2Q09A 1T96A 2G3FA 1RXOB 1BYCA 4RZBA 4S1FA 3H2CA 1LLWA 5I77A 1QK0A 1Q45A 3ZFHA 3W7IA 1RVGA 4H01A 4O16A 4Y6GA 4LBSA 1QAPA 5K7JA 3M5YA 4DELA 1VPQA 4DJFD 2HPIA 5CCZA 4Z0SA 3O8AA 4GI6A 3W22A 2DH3A 3W2KA 3WYZA 3BLOA 1OK6A 2ANUA 4LTSA 1TSIA 4GIYA 1ZAJA 5FL1A 1R86A 1KBKA 3NVDA 2XFWA 4C7FA 3S2MA 4PMJA 1K02A 2E1DA 1VJIA 2CLPA 4OV9A 4WGXA 2A3BA 5F2IA 2J9ZA 2Z1VA 4M6VA 3NXLA 4LUIA 2X1RA 2OKTA 2WK2A 4KS0A 3IAQA 1US0A 2YYTA 3MBDA 4PC8A 3VIJA 5CZSA 1P0BA 2A7PA 3RPMA 2WVVB 2OPJA 3VE9A 3OODA 4CNOA 1A5LC 1HKWA 1UR8A 4UIOA 1JZ4A 1VFUA 4AD5A 4GC3A 3BMWA 2OQLA 1XPGA 5TIMA 4V1YA 1MMFA 3B0PA 5DT7A 1W9XA 1TWDA 3LBOA 5HMEA 2VOMA 3VIPA 4UQDA 3CEUA 5BWAA 2EQDA 3BAKA 3RX3A 1WOBA 1OB0A 1KFCA 1BPLB 2A6LA 2ZX9A 5LGXA 2DUZA 5H6HA 1TREA 3COTA 4JTQA 3TTSA 2B81A 4D6EA 2V0TA 3L7RA 4K3ZA 3TV8A 2RGLA 4D72A 1JUEA 3IVTA 1OFDA 2YGYA 3WNKA 1Y5WA 4LC8A 1LROA 1MUWA 3GH7A 1E9IA 5E6ZA 2WB5A 3GHUA 1PXGA 1RD6A 3BO9A 3HV8A 2PDGA 3G22A 2RHGA 3GXPA 2Z28A 4TV5A 1XGDA 1Q6EA 1KM1A 3GXIA 4QQ3A 1DJWA 3UNTA 1AL8A 2BHZA 3SCRA 3LHWA 4E2OA 3FAWA 5I79A 4QG9A 1NEYA 1W9BM 5E1QA 3L68A 2PB1A 2ZIDA 1QPRA 5I2UA 4LB4A 3TJ4A 3CZLA 4D1JA 3OLIA 1OGSA 2DV0A 4I9MA 3WQ4A 1HJWA 1XICA 3MC5A 1GW9A 3R12A 2DVXA 4IIFA 3TFCA 4LSBA 3CUFA 4BQ3A 5CZTA 2YXOA 1UASA 1TPB1 4RX0A 2FQIA 3I65A 1Y5XA 4CN1A 1Z89A 3QMRA 1TZZA 5A5WA 4PN2A 3L9CA 1GORA 3QZAA 2PDUA 3BLFA 2BMBA 4Q4KA 2PE4A 3ZVHB 3BG3A 4WY0B 1DYSA 5EBAA 1YNYA 2R6OA 3CT2A 1OHLA 4A3UA 1SFLA 5CPQA 4RCXA 1W1YA 1W5PA 2O9PA 4G5DA 2QNEA 1XQLA 3SIMA 5C7VA 2EJAA 3PK7A 3OZMA 1UKQA 5FJUA 3IAPA 1H60A 1WKFA 3FDKA 2CLKA 2C0AA 2JF7A 3UPBA 1WZKA 2D2GA 2GQ8A 4AYSA 4Q8QA 3OHIA 4GXMA 3TN4A 3G3DA 2QCDB 3TEVA 4MSSA 2WM1A 3II1A 3QM3A 4LVBA 2BDQA 1UR9A 3EKGA 3ZLFA 4LH8A 4OVXA 1J0IA 5I3KA 1UD8A 2OX1A 4B9ZA 1IZCA 2IKIA 3B9EA 2BGQA 2ISDA 2ZRYA 4GUIA 3CNYA 3O16A 2CNCA 4CD8A 4MAVA 1XCXA 3A6OA 3VZZA 1E3XA 3N9RA 1GONA 5I7GA 3EDEA 1RHCA 3MDWA 4NAEA 1SZEA 5GNXA 4YIWA 4RDYA 3KRUA 4UFJA 5IHRA 4QJ5B 1KM5A 4EKJA 1H51A 3VNYA 5G2IA 1TQXA 4GGHA 1QATA 1DTNA 4M6UA 1X1NA 1IXOA 1P1MA 2GLKA 3CQHA 2HNEA 3F5JA 4ENLA 2XVLA 3RITA 1GVRA 3QHNA 4REQB 2MNRA 1HL2A 3L4YA 1JXKA 2DEPA 1OCNA 4FXRA 1JPHA 1KM2A 3MO7A 3K8LA 1UWAA 5AZ1A 5G4HC 8CGTA 3U2OA 4GUGA 2GQ9A 2BXZA 1MWOA 4EPKA 1X7IA 3VVGA 3CQJA 4JIRA 1H7PA 1KGUA 3KFTA 1L8NA 4EAMA 1T7LA 1B3OA 4LYQA 4W8AA 6REQB 1ZS2A 3C0JA 1CGWA 2E6FA 2VQUA 2V30A 1A5KC 1CENA 1PVNA 1JZ7A 2NUWA 4B92A 4EE9A 2B7OA 1OZMA 1DQWA 2VR4A 4IQDA 3ZXWA 4O4VA 1K3UA 3T2QA 1JVNA 3N2TA 6CGTA 2E6AA 1FXPA 3HFTA 1DJXA 2ZZ2A 4MY1A 1ZCCA 1RLCL 3RPTA 7TAAA 1OFPA 4LCRA 4XIAA 1RQBA 4Q8VA 4ZCWA 2NX1A 3L0NA 1AW1A 2CBUA 2TMDA 2POZA 3KRBA 1O5KA 2ZX8A 3VNKA 1B4KA 1EOMA 2VMFA 3EOOA 2YBTA 4NILA 4N9CA 4IPJA 3MB9A 3LK6A 4DO5A 5LIUX 4U10A 3AMGA 3LG3A 1KM3A 4CU6A 2QCCA 3HPAA 1J0KA 3KOXA 5H1WA 4FLSA 3CQ0A 1NP2A 1KR0A 3LLDA 4TVUA 5AYBA 4DY1A 3N34A 3JS3A 3L4VA 1RVKA 5D2YA 3H4GA 1ADDA 4NYYA 4KKXA 1E15A 3PZ9A 3VC5A 4MNMA 3ORWA 1H7NA 3VX0A 3W6YA 1DXEA 2ZUNA 3DFHA 3T9PA 2FJKA 1BGGA 1GNXA 2XVGA 3KBJA 4HA4A 4N0RA 3S5NA 2O4MA 2VFEA 8A3HA 2J74A 3TWAA 2EPHA 4J2PA 1XH2A 4HQVA 1VCVA 4GVHA 1KKOA 1NM9A 4H8UA 3ABZA 4Z2KA 1LL6A 3G1HA 3FGCB 2DT1A 2HXTA 4GE8A 2ACUA 2VWSA 4MNJA 4P7NA 1CXLA 3S6DA 3A3WA 3E0WA 3W2LA 1I1WA 4NY2A 3W00A 4QJ3B 3NL5A 1TPWA 3K30A 1S5VA 1XBYA 1S2AA 4O1AA 4IT1A 3AOFA 3IUIA 4JX6A 2DPEA 1HG3A 1VYRA 3JU2A 4N6FA 1LP6A 5G4EA 3USBA 3RR1A 2WNNA 5DQPA 2QJGA 3FAXA 3AMKA 4Y2WA 4C6IA 2V69A 2J66A 3VD5A 3GG1A 1JCTA 4GQQA 4JL2A 5LYRA 2BWGA 1AQFA 2GJRA 3AS1A 1F3XA 4LAMA 2DIJA 4UCGA 2GSJA 2OB3A 1UBSA 4C6LA 3L21A 1FH7A 3PZOA 4A8IA 2PF8A 4LW7A 1WAUA 4MY8A 2DUAA 2FHBA 4AZCA 3HPSA 1Z32X 1ZAIA 4MGGA 2VCCA 2OLHA 1H41A 1MI3A 2ZUVA 3EOSA 2MUCA 3GTNA 1FWBC 1C92A 1EKOA 4HGXA 4AVFA 4AY1A 4AEEA 5T9BG 4ROPA 5A1AA 1S2UA 4PSPA 1XSJA 3V1HA 3B8WA 3UNDA 1YE4A 3QTGA 3VOJA 3VTRA 1JPDX 2UY2A 2H3BA 1QNSA 1IT8A 2BGNE 3LCXA 2Y7EA 2EF9A 2OYMA 2IUZA 3LGDA 5BU9A 3LXCA 2PDYA 3TROA 1C8QA 5IHSA 3VKBA 5C0QA 4G1KA 4ZTYA 4NX0A 4D6GA 3DG7A 4YS1A 2CETA 2RJHA 4JKKA 5LXXA 2WKJA 1UOKA 2IW0A 3LRMA 1B9BA 2GOKA 5G1TA 4N9DA 2ZUUA 2NW0A 1VPYA 4E38A 3OVPA 1REQB 4PB4A 5HQMA 2CWXA 1E1FA 1F8IA 3K46A 2NZLA 1ICQA 2Y63A 3W87A 3PFRA 1PJ9A 2E77A 1XISA 3WLOA 2Y70A 3OOQA 2WCAA 4PBFA 1CWYA 2YCIX 3SQLA 5MKGB 4UTLA 3AYTA 2QW5A 4S3AA 5CG0A 1GVIA 2YPIA 4LJ3A 3O05A 4UQEA 2RDUA 1VZWA 5ECUA 4UTTC 4I9TA 3ANYA 3S6TA 4IGSA 1TPC1 1UIPA 5FJTA 5CAKA 4IFOA 4KWWA 1JL8A 2W62A 3D3FA 4JYEA 4QNWA 3FHQA 1I1XA 3I3DA 1QVBA 3CUJA 4I7VA 1UP3A 2JIWA 1VLIA 2YX0A 1X98A 1POJA 3BG5A 3E2RA 1F6YA 1W5OA 1FH8A 1D7KA 1MUCA 2W5FA 3MVIA 3E0LA 3IRSA 1GT8A 3QBUA 3TAOA 1UKTA 3I7RA 5DO8A 4L80A 4GINA 1TVLA 3M7SA 5DRCA 3R0DA 1PKLA 2NWSA 3E5PA 3GBDA 3UG3A 3NA8A 1BXCA 2JIEA 4H4IA 1QHZA 1GKRA 1FXQA 4W85A 1LG1A 1Z9AA 4IGHA 3KP0A 3QSRA 1R2TA 3O6YX 3UJFA 4DBDA 3WQWA 4JN6A 3O6AA 3CAKA 5EB8A 3NQ6A 3TCEA 4AHQA 1ISXA 5F4WA 3TDFA 4GKTA 4ACZB 4GKLA 1PZ0A 4ASTA 2Q3RA 3TYBA 3DEQA 3JZUA 1TA3B 1TJ1A 5EMLA 2WVVA 5B7ZA 3R4IA 4O11A 6ALDA 4WKHA 2FTWA 5KZEA 1H50A 3ZJ6A 4FNSA 4AMCA 1LWHA 2B7QA 5AC8A 2WMIA 4B5XA 2E5DA 1HXJA 3ZO9A 2CWNA 2W63A 4NUWA 1S3HA 5FAGA 3ZS4A 4H9XA 4ICNA 5A6SA 2VD9A 3WENA 4F9DA 3GNXA 3UVIA 1QFEA 5GNZA 3T4CA 2BHYA 3NPUA 3AICA 3TU9A 5DXYA 1T8QA 1RK6A 2XVPA 3QLDA 4NRSA 4XD4A 2D73A 2O7SA 3T42A 4OOUA 1JF6A 1ME8A 1SO3A 2EG7A 3QYQA 3F4WA 1IWAA 4GXPA 3GDLA 4I8DA 4HCLA 4NVTA 1VFLA 1W31A 1EA0A 1Y8BA 4KF1A 3HGOA 3U48A 1I2PA 3E96A 4HU8A 3MWCA 2VOTA 3GUWA 4D6IA 2QDGA 1XLGA 3LTPA 4GPNA 1NFPA 4XUGA 2VGGA 4GNVA 4WJEA 5D38A 4X9YA 3W1PA 2I9EA 2V38A 3SUUA 3W1RA 4D8ZA 4GIRA 3C2FA 5CC5A 1LL7A 4DUVA 3EYPA 3TAKA 1OX4B 4E5TA 3TZNA 4V1XA 3QC3A 3MKKA 3OBAA 1QR7A 3QHOA 4WDUA 4UTTA 4XTDA 3GNDA 1FA2A 4AC7C 1WZMA 1O12A 3DFPA 1XKYA 3EA3A 2OWXA 4RE2A 4WY0A 2C1HA 4Q6XA 2NVAA 4S3DA 3DKJA 3JRKA 3OIHA 1K4HA 4HHLA 2KZHA 4NIRA 1I0BA 2ISFA 4JFVA 4ZA0A 4LUTB 4CU8A 4TUFA 2Y4SA 3DBNA 2INZA 2E7FA 4QDMA 1H5VA 5BWFA 2R9RA 4UC5A 1KRCC 1RY0A 4JTEA 4H6RA 5CSUA 2PLJA 1UUOA 3AAMA 1GHSA 3L65A 2QCDA 1R38A 1OT2A 4FXFA 3AMDA 1F3TA 1XG4A 1C90A 4AH7A 4QJ1A 5A2BA 2J9XA 3MCMA 2HTMA 2E67A 1BWLA 4PCSA 3RO6A 3TNOA 3GM8A 3KM8A 3UWYA 1H7OA 4J28A 5E93A 1FCVA 4PMRA 1OINA 4F8XA 3S1GA 5IBXC 3CZ8A 2GL5A 4ERGA 3AJXA 2WCGA 5AYZA 7PTDA 1VBHA 4JQ2A 2ZICA 3G6LA 1UWUA 1XYBA 1R9YA 4OWGA 1ITUA 1XXXA 4V2XA 4JKLA 4E2DA 2DW6A 4GGBA 4Z2LA 4XAPA 1NARA 1G4TA 3LM3A 2Q02A 1GW1A 2W9MA 3OBKA 4DJDD 2HZGA 3DFSA 3M6DA 1IYXA 3NEVA 3TFXA 3CT7A 4UQ9A 1A3HA 2PLKA 2WBKA 2RDTA 1H61A 4KCTA 3W2NA 3FHAA 4IGMA 4FP1A 3WLLA 3VD7A 1B3ZA 5CPOA 3Q58A 1Z41A 4GH1A 2VX6A 1RJPA 2X1UA 4C5YA 1ZBKA 6REQA 2J7HA 4ZODA 2REQB 1O4UA 4H41A 2AQVA 4WJ8A 3S8HA 1PTDA 1IEXA 1S39A 3AALA 3FKRA 3LSCA 4M6PA 1ZJHA 2QQ6A 2FZNA 4IJCA 4UTHA 4GUJA 3GSMA 1FDJA 1BSLA 1UP0A 1QNPA 3B97A 3EA2A 1B57A 2YOCA 1YADA 1WX0A 2PRHA 4BI5A 2VWTA 4GC4A 1E0VA 2G3MA 2QHAA 3F2DA 3LS9A 3E1F1 4XZMX 3GS6A 2NSOA 1DL3A 2DQXA 4FNRA 6TIMA 4MY9A 3K4AA 3URAA 3S2JA 1ZBVA 4CVWA 2UY3A 4LUYA 1JG9A 1KQYA 3NQFA 3PZMA 1F61A 4GG9A 1EGMA 3T78A 1Q6LA 4HSOA 3RCMA 1PZ1A 4O52A 4JTGA 5I3GA 2G0WA 3EXSA 4WDXA 3QTPA 4MWAC 1S2CA 5A8QA 3RCYA 2P3EA 1X96A 1V3IA 3KL3A 2RDWA 2WJFA 1ZB5A 1MW3A 3OHMB 1XYAA 4YYCA 3WH7A 4IPLA 1JZ8A 3QMSA 3LERA 3GU1A 5JIWA 1L6YA 2VC9A 4OE7A 2C6QA 3SY5A 1UD4A 4AEOA 4ZBCA 4JY8A 3BSGA 3VNLA 4Q8TA 2VXNA 3OGVA 2W4XA 4JTKA 4DF2A 1Q63A 1TJRA 4Q8OA 1FHUA 2GZXA 2G3IA 5E0FA 5DN1A 3VGEA 3U4FA 3VK5A 5AHIA 3UYCA 3TONA 2WZMA 2E4TA 1ZRQA 1OFQA 2DUXA 1CXHA 1FWHC 1JCLA 1W1B1 1FKXA 4HBKA 1QPNA 4Q4MA 3GW3A 4O1CA 3UPMA 3M5ZA 3K5XA 4XKYB 1XIFA 2X42A 4DJEC 4UNKA 2CZVA 1TX0A 4EXBA 1O1ZA 3T6CA 1TTQA 3NYZA 2A2IA 3PWAA 2Z29A 1B31A 1W91A 2JALA 1JCJA 5MF5A 3FGCA 3GLCA 3GFYA 3G8RA 4TXEA 4L5ZA 3ZR4A 4HIBA 3R2GA 4D6JA 3NDOA 5DELA 3VYLA 1Q2RA 4O10A 3SI9A 4J27A 3PPCA 4C1LA 4FS9A 5EA9A 3QR1A 3H4XA 3LHYA 5BROA 1HP4A 3DDMA 1A5MC 1FWCC 3ZZ1A 5K3VA 4PSRA 1V7AA 4JDYA 3KZPA 3W25A 4NJGA 1UG6A 1AJ0A 2EPLX 2PDQA 3B03A 1M7XA 1ENUA 1DEDA 1MW0A 4TO8A 3IGUA 2IPWA 3S1WA 3UEQA 5CBBA 2XGIA 1OM0A 4BI6A 3F1QA 1CBGA 1YMYA 3QQWA 3NCOA 2PDHA 3HO8A 1W5NA 3AWNA 5IXEA 1HFBA 2QF7A 3UWWA 4C5ZA 1FCUA 1UWRA 4FZIA 3IJ6A 1EEXA 4R7JA 4LNYA 1G9HA 1L0PA 4MPQA 4GYFA 1OD8A 4LRTA 2VZTA 4A3HA 1S5NA 3V5CA 5FAJA 4AISA 4HK6A 5IOBA 2O56A 1GHRA 3LU2A 3GZAA 3WLRA 3SEPA 1SQ7A 2E8YA 4M8UA 4F2UA 4JEJA 5D2WA 3P82A 4AWEA 3AO0A 3NQ2A 5I5RA 4HB7A 2D69A 3Q4DA 4FALA 3UESA 4HJFA 2V68A 3VNZA 3ZT5A 3TTOA 3ZJ8A 3C0QA 1WDPA 1LG2A 1NWSA 3BOXA 5JQ9A 1TO3A 2EXOA 2RDXA 3THDA 3WN6A 1OABA 5FJJA 4HNTA 1KFLA 5AHEA 1A49A 1OFRA 1V3KA 4N9BA 2QGHA 2G41A 2F2KA 5HJLA 5B80A 2X1IA 4HOXA 3L4XA 4LAOA 1JNEA 1BTMA 1OC5A 3P80A 5AFDA 3MHGA 1C91A 2E28A 3W1MA 4IUGA 3W27A 2PWVA 5ABFB 2DIEA 1E4LA 1C8XA 3ARWA 4RJEA 4MOZA 2WKLA 5E09A 1XUZA 5A6BA 5MKGA 4W93A 5GJNA 3UZZA 2F8QA 4BI7A 3V3WA 1EYEA 4FHAA 5D4YA 3AS2A 4KQNA 1PKMA 4P7RA 1ZBWA 4FPSA 1ZBCA 3O0FA 4UFHA 2FGLA 4UTIA 3B8UA 5CAHA 1L6WA 4HK5A 1OYCA 5JH2A 4AYGA 4NJIA 1SZFA 1A5UA 3T0BA 3E02A 4DJEA 3KCLA 4GXWA 2PTYA 1A0CA 1XQKA 1CDGA 2GK1B 4KIRA 2PI6A 2YDSA 5HANA 3NQAA 3CZKA 1EPXA 1W1A1 3LSBA 4LEFA 3LZ5A 1V6UA 2GWGA 2FKPA 1K1DA 1XX1A 1TWSA 2WMFA 1EL3A 1W17A 4O0QA 4ZE5A 1KWKA 2Z6JA 1A47A 4RXGA 4Z2GA 3CUGA 4W9TA 5TBOA 1PSCA 4B16A 4WXYA 4EWJA 3H2EA 3B05A 3W73A 2J24A 1OVDA 2OWWA 2GSEA 4M7TA 4KFOA 3NO3A 3W84A 3CV6A 3M7WA 3N3MA 5E6YA 2WLZA 1DJNA 1SZNA 3H54A 2ZX7A 5J5RA 2FFIA 1PIGA 3NR0A 3QV6A 1LOSA 1V6XA 2BVYA 2NX9A 1TA3A 7ENLA 1UWIA 3UR2A 1HL9A 1PTAA 5DBTA 5AYXA 1PX8A 3CXOA 2BY0A 5K9CA 4FXJA 1OZQA 1ZPTA 2E09A 3QQ0A 4GZEA 4RE3A 2VHLA 4O12A 1P0EA 4IIBA 1O1HA 2PTZA 3G1YA 2X1TA 3R79A 1W2VA 4KCUA 3VM5A 2DSWA 3FJLA 3O06A 4E2VA 1GOOA 3R58A 3VKDA 4HSHA 1P5BA 1UQYA 4C6DA 1U1UA 3AI0A 1BYBA 3ZLGA 1BF6A 2OQHA 4EAYA 4IGNA 1UMLA 2BS9A 2I5QA 2ZTJA 3DYMA 3THAA 3V0SA 1R3WA 1N2VA 3KBSA 4DPPA 3H53A 2E25A 1XLHA 1D2KA 3B8VA 4IP4A 4R27A 3E49A 3L0GA 3TJXA 2BZNA 3KLLA 4YN5A 3VMPA 5E5CA 4QX4A 3BQ5A 4TX6A 3H6OA 4PGLA 1KBIA 3U6WA 2ACQA 3F4VA 3IGHX 3NYDA 2CHNA 4ML4A 3QKZA 4FAMA 1MXDA 3S9YA 4ZFMA 4N2YA 4E6MA 4GLEA 3W7GA 2YCKX 1NOUA 1KW1A 4MNKA 2PCEA 3EMZA 3EWZA 2QJIA 1UUMA 2Y2WA 3SN4A 2VDGA 4KCWA 3RHGA 3WDHA 4B3LA 4AIBA 1KCLA 1QW8A 4MVAA 1VR6A 9RUBA 1EB3A 4XB3A 1B30A 1F8MA 3RO8A 3G8EA 4DUWA 4H7VA 3BCFA 3GHSA 1EHAA 1R9XA 2WLYA 2XUCA 4PEKA 4AY8A 1L2UA 1GTHA 3S2CA 2XTKA 4JTJA 4IXHA 3W23A 3IV3A 4C6NA 2HK1A 2P0IA 4LWWA 3W1AA 1FH9A 4JCLA 4DVOA 1DJYA 4UCFA 2QCEA 1M1BA 1VS1A 2WSYA 1OF8A 1GJUA 2PS2A 4XX6A 1J96A 4C6EA 2V3GA 1JZ6A 1Z42A 2EBNA 1X1OA 1PHWA 2OZ8A 1RA5A 3DHFA 4Y9AA 4PR4A 4QM1A 4OECA 4LUTA 1LDCA 1IEVA 3B06A 2WHLA 1CXFA 4ZSUA 3HTWA 3F4DA 1XSKA 1RCXB 2VENA 4MJMA 1XBVA 3GXFA 4AZ5A 1OG0A 1LT7A 5CC6A 3TN3A 2V8ZA 4EWND 2Z1KA 3T2OA 1YKWA 4XZIA 1QRQA 1Y7VA 3DI1A 3WL0A 3LCLA 4QCEA 1T40A 1H09A 2GGIA 3VABA 1TRIA 4AC1X 5HUPA 1V6WA 5AZ0A 3ATYA 4JTCA 2QVNA 4IJBA 1KKRA 2I14A 3TC7A 4O50A 1WBJA 2V5DA 4RDVA 4ONVA 1KGWA 1AQHA 3R13A 1W5QA 1R3VA 1W3TA 3T40A 6A3HA 5CLWA 3N6HA 2WJEA 3V18A 3K4WA 1JDAA 1C3FA 1IEQA 4W87A 1MEIA 1K8XA 1PHQA 4NJJA 2R1KA 1PUDA 4HVXA 5BRBA 1N82A 2AGKA 3O0KA 1HGYA 3AJ7A 1T41A 3GK0A 4IG2B 5AYYA 1XLEA 2YB1A 3GHRA 1AJ2A 3W7HA 2CBJA 2PDMA 2FZMA 4HPNA 5DX7A 3UR5A 2GWNA 4OZOA 2Y5EA 1LRTA 3WLMA 1FHLA 1EJWC 2ZZ6A 5AOUA 3MJYA 4ZO8A 1RY8A 3AU2A 3ABQA 4IFKB 1BQGA 1ZFJA 3GC2A 3UCDA 4QJ4B 3PC0A 4JHMA 3MW7A 1UZHA 3CS2A 1WDDA 4JTLA 3GDMA 3LBCA 1UUQA 3SRHA 5JXQA 3REQB 1PDZA 4BWLA 2GSHA 1XW8A 4AWSA 5HUOA 2XWDA 4WQ6A 1OADA 2GJXB 1YBQB 4D2JA 2IMRA 1W3KA 1NWRA 2WMJA 4W88A 2AQOA 4XKMA 4XO6A 4LGXA 3AFBA 3L4UA 1R85A 4C6KA 2XJ7A 1XLAA 4ALDA 3MMWA 1A80A 3I7SA 4HKPA 7TIMA 1E0XA 2CPUA 1ECQA 1O60A 4I5RA 1RP8A 3O15A 5D04C 5C9RA 3EEGA 2OOFA 2PWHA 2J78A 1TWZA 3JVAA 3KVKA 3UD6A 4QIUA 1JFHA 1DVJA 2J62A 3S3GA 4LU0A 1PWLA 6XIAA 2A7RA 2EPNA 3L2IA 4D6DA 1GKQA 5F7UA 1WNOA 2R1NA 4K38A 4LPCA 2PA6A 4B5TA 3IJ9A 3G0SA 4KT2A 3WQOA 2Z24A 3PF3A 4AD1A 2IQDA 3SCUA 1DE5A 4GYJA 3RM8A 4R7WA 4Q4QA 1BXNA 1MZRA 3H12A 5DFAA 3KVLA 2QJHA 1R7OA 3NJ3A 3WQCA 1Q4WA 2XHYA 1IQ8A 4XWUA 1YPFA 3AUJA 5TNVA 3AZRA 4HMEA 3N6JA 4J35A 4EXAA 3R10A 5KZDA 3FEMA 1GKPA 2OT1A 2YSWA 4I3GA 3DFOA 3VNIA 3NZQA 2XIQA 4J1OA 1RA0A 1G94A 3PANA 4XSMA 4GFIA 4NNAA 4CLMA 1I8JA 1F4AA 2BB0A 3T0DA 1A3WA 1ITXA 4RXFA 1HP5A 1KM6A 2PLCA 1AW5A 1PBGA 3NGFA 4NT0A 3T8LA 2GUYA 5FJRA 1ISWA 4LNCA 1W3HA 1XRVA 3BMXA 3ZR6A 1TFVA 2ZADA 2XIOA 2QAPA 1UBPC 1H0GA 4L9YA 2J75A 2PC4A 2C8NA 1V4YA 4AIOA 1XYFA 1GK8A 1TPH1 1XLLA 4XZBA 2GVLA 5A3HA 1RD5A 1VF8A 3DH7A 3M41A 5LA1A 2A1YA 2OKOA 3BANA 1SFTA 3SECA 5C70A 4WXZA 1JI1A 2ISSA 4NJHA 3AS0A 2GGGA 2HNHA 1ITCA 2PTWA 4YTSA 5A6MA 4MYAA 3LCWA 2ESCA 1MNSA 3EWXA 4S38A 3AHZA 2VGFA 4OKDA 1BRLB 4LS2A 4HPHA 3A21A 4FB7A 3MWAA 3N2MA 2VZOA 1R7AA 1PO9A 3XINA 5LSMA 4HMCA 1HKVA 3VINA 3LXAA 2EG6A 1DQXA 3H70A 4ZQNA 4DZIA 3D47A 1QOPA 4GUHA 3QFEA 4MHBA 1XIHA 3DERA 4J3VA 2ZC8A 2WYSA 4IMGA 2VFDA 2QMJA 4B4HA 5FOOA 3R0UA 1EF3A 4YTQA 5LNSA 2XISA 4Q8MA 2DSVA 3N11A 3STCA 3KWSA 5D30A 3POHA 1QMLA 2VGBA 2BOEX 3KOYA 4A29A 2PEVA 4DM2A 4MMWA 1QI5A 2DJLA 5I09A 1XH1A 3FA3A 2PDCA 5I03A 3XIMA 3QY8A 4XSLA 3FYPA 1FWWA 1Q65A 4S3EA 3KBVA 1OJXA 2PGRA 1UOZA 3DFQA 3AYVA 4TIMA 4B5VA 4H7CA 4AZIA 3M46A 3KOWA 4KESA 1CLXA 3NM3A 8TIMA 4MFEA 1DJHA 2P8CA 2WKGA 2XGZA 3U2CA 1AD1A 3QLLA 4JN8A 4MDOA 1L8PA 3T44A 3STPA 3ABSA 4L4PA 1KM0A 1GCYA 3VXGA 5D05A 1EBHA 3DGBA 1G1YA 1J0JA 2IKJA 2JGYA 4OHQA 3WLNA 1QASA 4DWSA 4YMZA 1EXPA 1EC9A 1LQ0A 3DZ1A 1QWKA 1LLOA 1TYGA 3N25A 3VGHA 3G1FA 3P6LA 1VFHA 3F03K 1HN1A 3PWGA 2R94A 4F0HA 2W92A 2IPFA 1EUNA 2WBGA 3TC6A 4JQ3A 3UQNA 1KR1A 4BJHA 2BSLA 2ZX5A 1EEPA 3QVQA 3MYPA 1EP1A 3MQTA 3UCQA 1UA7A 3PPFA 5LXEA 2WNZA 2D1ZA 2FZDA 3F2BA 4M51A 3G0UA 4O4WA 3B40A 2HS8A 2OEJA 3GE7A 3GH4A 4ADSA 1TIMA 3FV9A 3CLMA 1FHDA 4J3XA 4QTGA 2HWGA 2BVWA 5IFTA 4GBDA 2C71A 3VZXA 3MV01 4ADUA 2VRKA 1SR9A 2PTDA 1JZ3A 4FSAA 3S2LA 1CGVA 4PH6A 4CQCA 4MAZA 2Q71A 3AS3A 4RNHA 4KRZA 4A21A 1BG9A 3QR3A 1KQZA 3VOHA 1EX5A 3H2AA 3NIYA 4C6MA 4NKCA 1YXCA 4W5UA 3EOUA 3W7PA 3TX9A 1XIMA 5I0DA 4UR7A 3E6EA 1UP2A 1ZAHA 3S4TA 1ODUA 1XG3A 3KTXA 3MS8A 2X0HA 3T08A 4U2ZA 3KXQA 5F2LA 4ZO9A 5DY2A 1J0ZA 3WNPA 1H7XA 2G97A 4XD6A 3W7QA 5JUVA 1KXVA 4A05A 3DESA 3GDTA 1GYNA 5BOFA 3C8NA 2VQTA 2AMXA 1UCWA 3LDVA 2PDKA 3A13A 3VE7A 3W9ZA 2YFOA 2A3EA 4CD4A 1B5TA 3UZWA 3PJXA 3RG6A 3W82A 1I6NA 3OA3A 3BC9A 3MHUA 4U5KA 4I9AA 4UQBA 3V5FA 4GQRA 3AIVA 4URIA 5KSWA 2CW6A 2VDHA 4PL2A 3E0VA 2HRWA 3EPNA 4HPJA 5LHFA 5PTDA 4CEXC 2ODOA 2PDFA 2FTYA 1U5VA 5CC7A 3EX3A 1B4EA 3F7JA 4CGTA 3AXMA 5ENLA 3MDUA 4ZZ9A 4KWVA 2X40A 4OIFA 4H8VA 3W7EA 1XSIA 2YBVA 1CYGA 3B04A 4GYPC 2E9LA 4DAFA 2BVDA 1IXQA 4PRWA 3VCNA 2V3FA 2UBPC 4UXDA 2QDHA 2R24A 3FXYA 2WQPA 1M7PA 3EPOA 3CUZA 3TW7A 4JTSA 5HULA 3RDKA 5T91A 3EOLA 1XD1A 4NZFA 2NUYA 3RRXA 5A6JA 1ECEA 4ERAA 4K39A 3BGGA 4K8GA 2V63A 2FIQA 5HPCA 2GDUA 1MW2A 3T55A 2F2HA 4FI4A 1JI2A 3OG3A 1WKYA 1EYWA 1OFOA 3NXFA 3ZIZA 1UHVA 3SCTA 4S3FA 1SYTA 3DFTA 4A35A 4EVZA 3ES8A 5A8OA 1B54A 2W0UA 3AMLA 4PBEA 4IQLA 1HGWA 1DHPA 2DVTA 4RKAA 3ZOAA 4YYFA 2XPKA 3TP4A 2DZXA 4RZ4A 4EANA 3R1ZA 3UXIA 2XGBA 3BV7A 1NY1A 2ON3A 4L4LA 3EX1A 3BQ6A 3L5AA 4ACYA 6XIMA 3THQA 1ZZMA 3G1SA 2P5NA 4H2HA 3LGEA 3WNNA 1QT1A 2HQAA 1XLIA 2J6VA 3HG4A 1HKKA 5BNKA 5C9ZA 3ARQA 1E1CB 1GQNA 5C9XA 4BEUA 3FW6A 4WD0A 4F0LA 3PN8A 3NEHA 4GX8A 3PS7A 2QCGA 1EUAA 3UG5A 1W32A 4X2RA 4JNZA 4AIUA 2FPTA 2PDXA 4ZB0A 1RZMA 5AYIA 1DV7A 4LVFA 2J4GA 3ITYA 1UROA 1QO5A 5C2CA 3W2UA 3PZVA 3QPYA 1WA3A 1GQLA 2V5CA 3FYYA 2FHCA 1LF1A 4DRSA 3EOEA 4KEVA 4TTUA 3BOFA 4D6FA 3DHUA 2AKMA 2GVJA 5A8MA 1G4SA 4X22A 2Y24A 3VX1A 4GY1A 2DZVA 1EO7A 2CZFA 5L9FA 1KNWA 2Y5SA 3WZ0E 1H7RA 5KINA 3PULA 5I24A 1M7OA 3EDFA 4I9JA 3C5QA 4HN4A 3HQNA 1YDNA 2I7GA 1F05A 5A6KA 5I78A 3DBPA 4D6CA 3PBUA 3KHJA 4MLJA 4NP7A 2DH2A 3GDKA 2CLFA 4B5WA 1PYFA 1Z69A 5EBUA 3UZYA 4XD5A 2Z6IA 2R8WA 2WZEA 1EWEA 4N4QA 5DRIA 5LIKX 3ZM8A 3WJSA 2NT1A 3OLEA 3W7MA 1GQKA 1OGGA 4MADA 1EJRC 2ZXDA 2JKEA 3DFYA 2VFGA 3REQA 4TTGA 1H49A 3MKCA 1TWIA 3P84A 4D1IA 4TMCA 1WYIA 2XINA 2GJXA 3PSVA 1YBQA 3LV5A 1U5HA 4QCFA 4GACA 4S3JA 2A85A 3L2LA 1TUFA 3UWVA 4DO7A 4GYPA 2ZVIA 1CX9A 1VBGA 4QISA 2PPGA 4XQ6A 5LA0A 4P7LA 3GVQA 4FXSA 1YTDA 3O63A 2F6UA 2F9RA 3WH6A 1KRAC 2OXNA 3HG5A 4ICCX 4PUWA 2BOFX 5KITA 2ZXAA 1RP9A 3M6YA 4JX4A 1ISZA 2QDDA 4M7SA 8RUCA 3R89A 3RX4A 3SCQA 1WZAA 4ZQPA 4I8YA 1E56A 3C2YA 1FWNA 4KEUA 5HXMA 2Y7DA 1PZ3A 3H24A 1XIEA 4LVGA 2Y62A 4LCSA 2OZ3A 3OZYA 4IL2A 5CXPA 2XZ7A 3CL8A 2A3CA 3KP1A 4ZTXA 3C86A 4D71A 3ARXA 3JUGA 3S1UA 3T7VA 4HNUA 3WH5A 1E40A 1MSSA 3SFWA 4K8HA 1CZ1A 1D3CA 1H11A 1NVMA 1ONEA 3PVFA 2GVEA 4G8TA 2F38A 4J2MA 2EEXA 4WY0F 3ALGA 3UXLA 1UKPA 4OU1A 1OYBA 4IMEA 1EX1A 4LOCA 4NYUA 2GGHA 2VURA 3OYZA 4YPJA 1A5BA 4R34A 4DN1A 2VC5A 1GZJA 3UXKA 2G95A 2ZZ7A 3ABOA 4ZSTA 3RU8X 3MSDA 4AQLA 1GOWA 1D3HA 1LQ2A 1IWBA 4AW7A 5F1VA 3CAWA 5A2CA 3M44A 2V67A 1RBAA 2PTXA 3RR4A 3TC3A 5IDZA 1MRAA 3UJEA 3SGZA 3LHUA 4HTYA 1FKWA 1KFBA 4F2TA 3GH5A 1C8VA 5G1MA 1JEZA 3N12A 5KETA 1JGIA 3DXIA 3N4EA 1PZ2A 3SUSA 1F4HA 4KCVA 4GISA 4HA3A 2A79A 3HZ3A 5DY3A 3P0WA 4NSBA 4A8LA 3W1LA 2EJ1A 1UJPA 3W75A 1S46A 4F0MA 3PZIA 5A8NA 3B0UX 5EMUA 4H9YA 3WK1A 3WMBA 4Z2IA 3TK7A 4C7DA 2QYGA 1B1YA 4JIEA 4PTMA 2RJGA 2DORA 4IPNB 1XIIA 3LUTA 4UWMA 5JU6A 3LBMA 2VEIA 6TAAA 4DX3A 2P50A 2X7VA 4JFSA 5E9AA 5LNRA 3PZQA 2GGEA 2OCZA 2XYLA 4QRNA 5E0CA 2HMCA 3HA1A 2DIKA 3WDIA 2YFNA 1VGAA 4O15A 3CBWA 1CPUA 5A95A 3A22A 3HM7A 4HA1A 5D09A 2ABAA 3PY2A 5CZ0A 1HQTA 3MUIA 1XBXA 3BG9A 3W7KA 2QUTA 2ADAA 5D9PA 1EJSC 2Z00A 1P4CA 3NZRA 2WHJA 1H4PA 5E9XA 3ARUA 3TYDA 3GTIA 3ZLHA 3VOFA 4PUJA 1CW2A 1BWVA 3IEBA 4KGLA 3GAKA 3WJZA 4EPDC 1RH9A 3TMLA 4IQJA 1N55A 1CGYA 1S38A 5HWMA 2Y7GA 3CPUA 3MUY1 4BK9A 3ZJ7A 3N6QA 4DZ5A 3CMJA 4MKSA 1ONXA 3HGRA 2X7WA 3T09A 3FOKA 2Z27A 3P93A 2GQ3A 5BW6A 2WOQA 3GB6A 4N9EA 2QJJA 3MTWA 3CIWA 1C93A 2BHUA 3B0VC 3WLIA 1QDSA 4GQ0A 3M0XA 1JRBA 1JCMP 1OFBA 2G3NA 1ESWA 2VR5A 2CBVA 3NSNA 3R6IA 3TQPA 1WXJA 3W4RA 5CGMA 3CMGA 4ZOBA 3S47A 3BW2A 4ZO6A 1VYPX 2V3DA 3G1XA 2WSRA 4Q4OA 1DWAM 2WANA 2DSKA 3R8HA 3UCCA 3PUEA 4XG1A 4XBSA 4CCDA 4DJDC 5AC4A 3EZ4A 2L5HA 1GG1A 3UERA 4W7WA 1A5OC 4PMOA 4UMAA 1XRSA 2D2OA 3B0YA 3RGTA 1BTCA 1ICSA 5TD4A 1ZP4A 3L67A 3UBPC 1OCQA 3PUGA 2XN2A 3LPOA 2V9DA 4OBRA 2V81A 4D6HA 1S2VA 3HQ1A 1N8IA 3EX6A 4IM4A 1AL7A 2GPTA 3SIZA 1QXLA 2Y61A 2I9UA 3SUWA 4W84A 2IKGA 4X2PA 4LXFA 4FO4A 1W56A 2WVTA 3NOYA 2FZBA 1V02E 2VC6A 2PDBA 4OGZA 1E9YB 4H04A 1E0TA 1E6QM 1JQVA 1TJ2A 1XINA 4LAKA 4LX4A 4V28A 3SDOA 2WQDA 4A8NA 4IIHA 4PFHA 4ZQMA 5C7HA 1YQ2A 2J9YA 2PFHA 5D2VA 5LNVA 1OYAA 2XN0A 2C0HA 4OV4A 3B4YA 4IF2A 4QGCA 2H3DA 3CH0A 2GUBA 1TPFA 1XDJA 1YTEA 4JKMA 1W1TA 2I17A 2V5BA 1UD5A 4IP7A 4O0ZA 4CNUA 2Y8KA 4JQ4A 5FI8A 1KTBA 1UZDA 4NI3A 4MLRA 1Q6RA 3G1DA 2CLOA 3O2LA 4G7FA 3S2NA 4MYXA 4L1GA 2A3AA 1UW9A 4AX7A 2BY3A 3KVMA 1K7XA 2UY4A 4H19A 3VGFA 1TTPA 3PSWA 2YCEA 1T0OA 3ITCA 1J11A 4GUFA 5HA7A 4H9UA 1AW2A 2DT0A 2E40A 3V4BA 1QTWA 3B0XA 2TAAA 1VHNA 2GYIA 1HIZA 2VRJA 2OX4A 2QCFA 1CB2A 4HZ6A 1RCQA 1KXHA 1H3GA 3OVQA 1LBLA 3OGSA 2WMIB 1W5MA 4QDWA 3Q2DA 1WP6A 2O9TA 4P8UA 2X8RA 5CJ5A 1RQEA 2P8BA 4PMUA 4ZB2A 5FD0A 2VFFA 4NZCA 3HPXA 3QJAA 3W72A 2Z26A 3QV7A 1TWWA 2W79A 5BXPA 2XIBA 2PDIA 5HINA 1KBBA 3KBMA 5T9CE 3MMTA 3MSRA 3VOIA 4BHYA 2XIIA 3TSMA 1D8CA 1Z6KA 3B8SA 4XAGA 3WMSA 1K9TA 3NL3A 3B8IA 1E6PA 1KLYA 1YNPA 5AHLA 3K1DA 2FH6A 2WJDA 3BV4A 3EX2A 1GOMA 1O7AA 4DLFA 7REQA 2Z1WA 2FYMA 3T05A 1EZWA 4R3UA 3VIIA 3NZGA 3MP5A 4MJ2A 2OU4A 2P10A 2WC4A 4XVDA 1SR0A 1H1NA 4EF8A 3VUSA 4DF0A 1JYNA 3MSYA 4ZQOA 3L5LA 2QR6A 2YCJA 3ITVA 4KRUA 1NQ6A 1BGAA 3WDJA 1KCXA 4HNCA 2YA2A 4QE1A 2J13A 3EKLA 1E1CA 2GGJA 3VUPA 2QF8A 1P0NA 2TYSA 3TUUA 4LF1A 2OSYA 4CCZA 2QIWA 4C1NB 5AECA 4D9PA 4ZXOA 4R33A 4AD0A 4EPBC 2V5KA 1KWGA 4FF7A 3S5YA 4PUMA 1ME7A 4FOUA 1QNRA 1GG0A 4Z1AA 1W1VA 2Y88A 1VBRA 1FWSA 1E0UA 3P60A 1OFEA 4Z1BA 4HNVA 1VENA 4M3PA 1XGZA 5T8GA 1Y5VA 1Q6CA 2R14A 4Q6JA 4LY4A 4AAJA 1ZJIA 2YZRA 1V79A 3U4AA 3W1UA 3MT1A 4FOKA 3PP7A 5EPDA 1CGXA 5DXXA 2OO6A 3IK2A 3V0UA 3TXZA 3GTFA 1TIWA 3IJIA 1K8YA 3G1RA 1LOLA 1AQMA 1SZRA 1MQQA 4JHOA 1AG1O 4IHCA 1TPVA 1Q8AA 2VTFA 2BGSA 3WEMA 4F79A 3PBYA 1YXYA 2GDQA 5A6LA 3TNBA 3V7PA 4QDPA 2R82A 4QQUA 1XF0A 3E2SA 1SO5A 3AYRA 4W8BA 4JHZA 2VO5A 3VU2A 2XFRA 2YKKA 3VD3A 2OGYA 2DZBA 1EP3A 2J27A 3H2FA 4HNLA 1JUKA 4P7QA 4H00A 3W1QA 4DBSA 4MUZA 1OIFA 1Q13A 4AMAA 4L7ZA 1TV3A 1E43A 1XRTA 1ZP3A 2DSZA 5BMWA 3ATZA 5DT5A 4TR9A 1IZKA 1G7UA 5I3IA 1LJYA 3BARA 2PZNA 4PE8A 3TIMA 1M6JA 3UPWA 5GVJA 3QF0A 1R8LA 1OWQA 3VA8A 4HNOA 4J3SA 3NQ8A 3OYXA 1VD6A 3V36A 1V03A 3WUEA 4HU3A 2ZZ1A 1DKWA 2X16A 5D37A 3WQ6A 4RNJA 3AHVA 5I3HA 1NWTA 1C8YA 3IIOA 4GNJA 3BCJA 1T5AA 3GXNA 4ZO7A 1BVZA 1RBOB 3PPHA 4CD5A 5EL1A 1RV8A 3P5YA 1IIGA 2DZTA 1P48A 3VMNA 2F61A 4ZXLA 4E4UA 3WUGA 1X1ZA 3RLHA 1KXQA 3UY8A 5HR7A 1FHVA 1JDCA 3WDQA 1UQZA 3Q67A 1TR1A 2D20A 3UT0A 4H7ZA 1FP9A 4K36A 4CQDA 4UTKA 3EMCA 1OK4A 5CZKA 1FFRA 4UZUA 2CKSA 4MJ4A 4RE4A 4QEHA 3SM0A 3CB3A 2WMKA 2NX3A 3CASA 1EFZA 2DFAA 4GRSA 4AWTA 2UWFA 1BAGA 2QGYA 2FGZA 2OMAA 1AZ2A 3DG3A 1YEYA 3FIGA 2V82A 1HVXA 2PP1A 3F4NA 4LFYA 2VNCA 4KWSA 1PEZA 1AZ1A 3CGTA 2VEKA 1PAMA 4LF2A 3YPIA 1NWUA 3A9IA 1N8FA 2BG5A 1M04A 3C8FA 2A3LA 2IQ0A 4K6AA 2QLYA 1TG7A 4L4OA 3B3DA 1ONWA 1CCWB 1GZ1A 3AXXA 3VAVA 3GWQA 1DXFA 3GG8A 3VD9A 2VEGA 3ZT7A 4DBUA 1TV2A 3SRFA 3BLEA 2ACRA 1WBHA 4UTWC 4AIEA 4POCA 3MA8A 1XR2A 1ALDA 3SGGA 1JYVA 3RFAA 3LPGA 3LRLA 2TODA 4YNGA 3TN6A 3N13A 4NXKA 2WC3A 4ORMA 4XZLX 1E6ZA 4N42A 3O6CA 3ELFA 4AD4A 5BXSA 3AQUA 2XSXA 2FMOA 3RU6A 3M0VA 2Y6ZA 4CUCA 2FPVA 5EMJA 1TJ0A 1TV5A 4W5ZA 3GKFA 1KV8A 3EXTA 1E51A 1Q6DA 1PTGA 1ZENA 3IARA 2VP8A 4E0CA 2W66A 1ZU8A 3UJ2A 4AFYA 1KBJA 1OF6A 5D32A 1LM1A 4Z17A 5A6BD 1X6UA 4DZAA 4QE4A 5KTLA 4NZ1A 3ID7A 3IIZA 3GVWA 3INPA 2WZHA 4XISA 4XTIA 2PGFA 3A4JA 4B5SA 1V6VA 1XLKA 2YL5A 1XFCA 2C3ZA 1SMDA 2ZRWA 1G4EA 4XZ9A 2QPSA 3W83A 3M1ZA 4TU1A 5HWNA 1XIDA 2FZ8A 3QOKA 2ABBA 1BFNA 3CZGA 3GIPA 5LHEA 2INEA 5G2HA 4NZ3A 3ES7A 4J3ZA 1W8SA 4HJWA 1JFXA 3H23A 3H55A 2G3JA 5BZAA 4DBWA 4CQAA 5JMUA 3DIPA 3M0IA 3RX2A 1FP8A 1M68A 3W02A 4DPQA 4JL1A 4DJED 3E74A 3GU9A 4OT7A 5HJYA 5HOSA 1EWDA 3KS5A 3WNMA 2GVYA 2FJUB 4KETA 3B9DA 3S0CA 1VQTA 1VFFA 3NQCA 2WSPA 2V2HA 5TAOA 3GYCA 2YA0A 4Z0JA 8XIMA 3SUTA 1MFUA 1ADSA 3GXMA 1I2QA 2GOUA 1MXSA 2XM2A 2XSAA 1ME9A 3TLQA 1R47A 2OVLA 4LUJA 2WSQA 4GZ7A 3W7JA 4GY0A 3T8QA 2ZUTA 3UYIA 2PU0A 3EWBX 1WAWA 3QEZA 1S5MA 4RV8A 3RPDA 3WK0A 3L4WA 3EB3A 4KW2A 1EIBA 1M3UA 3HPFA 2FZ9A 4MM1A 3W24A 3WL1A 2BFGA 2XM1A 4GFSA 4UOJA 1UH2A 2O9OA 4JGDA 2JGQA 4B9YA 5FF7A 3SSZA 3L12A 2HCVA 4X63A 1HF6A 2YW3A 2WSKA 4IIDA 3CWHA 4Y7EA 3GDBA 3URBA 2J7GA 3AIBA 3J7HA 4C6QA 4IJRA 4JQAA 1UR4A 3AMCA 1KXTA 3CL7A 1AUSL 3B9AA 3E2VA 3WK2A 2Z2UA 5DLCA 1MNZA 5HBFA 2NVDA 1YDYA 1FWJC 3LNMA 2VGIA 1QO2A 3FFSA 3GIYA 2ZRZA 3VNJA 3OLGA 4K37A 3DGRA 3C0LA 2V2CA 3ME3A 3EDDA 3N2OA 4NU7A 1DIKA 1I45A 2OTDA 2PDLA 4NJKA 4CNNA 1Q8JA 2DT3A 3WY1A 4UTWA 1WKEA 2YLAA 2NUXA 3PBGA 1JCXA 1K8CA 4GZJA 2X05A 3TOYA 1TTJA 1AH0A 5HATA 2NVCA 2VVSA 4TX9A 1YE6A 1QI2A 4DI9A 2B0MA 4CN6A 4H2CA 4RL3A 3UFYA 3V1PA 3BAXA 1VRDA 4PRTA 2PMQA 3W1NA 2XFYA 4RNIA 4LBRA 3OGRA 4E8GA 1J5TA 1FWGC 3CV1A 1R2RA 1AMYA 4GJ1A 3P67A 4JOMA 3VI2A 2AKZA 3HF3A 3M07A 1VIZA 3ABXA 3PB2A 4GJJA 1JJKA 3K4DA 4ZOEA 1Q6FA 3SSJA 3IJ8A 3AU6A 4UNLA 2EGZA 3UGRA 3NFUA 4PMDA 1QBAA 2D0GA 4NNBA 4N7QA 3RJYA 5E70A 1TQJA 3GYEA 1RR2A 2QJNA 2GFTA 4MNLA 1V0KA 5F4SA 4AZGA 1J5SA 1TPDA 4MB1A 3CU2A 1ISYA 2EPOA 3LCFA 3ZWSA 2E8ZA 4WOQA 4X0NA 1SJCA 3EDKA 4QAWA 2OODA 3UGVA 5M03A 1KFKA 4O53A 2V6AA 2WZIA 4LRSA 1WUFA 3BXWA 4O1DA 1I9CB 3BLPX 1I4NA 4LEQA 2J47A 2W67A 3TWBA 3QW4B 3UZ5A 4UTFA 3QMTA 3EBVA 4IIEA 4WF7A 3SADA 1B90A 2J77A 3QN3A 4F0SA 4QSHA 2VX4A 4DZHA 4PFMA 2FDSA 3W86A 2QT3A 4B5NA 3AUOA 3V35A 2XN1A 1V7YA 3TJLA 3T4WA 3N9SA 5JIPA 4IMFA 4MZ1A 1VYSX 5CBIA 1PX4A 4IWWA 5FJOA 3CWOX 1JPKA 3BAIA 4YWIA 3FDGA 4F0KA 4NHVA 4AX6A 3MO4A 3W7RA 3KL0A 3AYSA 2XH2A 4WGHA 2EAWA 1F3WA 2OZ0A 4FOJA 4JEQA 4PMXA 2DW7A 2FB2A 3GVGA 1R3YA 3DENA 1GVYA 3M9YA 5LIXX 3E0IA 4KFPA 4OBSA 4B5UA 3BW4A 4YHGA 2BASA 4O28A 4FIQA 3H2MA 3VGGA 3LY0A 1CGTA 3NNTA 3PBMA 4K8EA 2RUSA 3FJ6A 2OSWA 5AN7A 4C60A 1R6WA 4U3CA 3VFCA 5I3FA 2AL2A 1R30A 4MFDA 4JX5A 2DZPA 3W29A 1G67A 1TR9A 1LL4A 1SU5A 1WDRA 5J04A 2I5GA 1MDRA 3W71A 3LYEA 4EPEC 4H8HA 4ZOCA 3VOCA 2C14A 4O1BA 4MPKA 1VJZA 1EP2A 2YZ5A 2ZUSA 2AGTA 2BY1A 2ZZ5A 4J40A 5D2XA 3ZSSA 1YRRA 4C1NA 6PTDA 3LXBA 2CXEA 1DJQA 2P0OA 4JY9A 3DAQA 1BKHA 2CKRA 4IUOA 2VELA 1ELSA 3SR7A 3BICA 3PZGA 4AXNA 3EKZA 5ABGA 1MO0A 4PTXA 3WSUA 2X30A 2QS8A 3C4UA 1QPQA 1H1ZA 5HQLA 2NQZA 4XZHA 4YHEA 1J79A 3H7UA 2CLIA 2E3ZA 3D0CA 1CECA 1VEOA 1BEUA 1FDYA 1M5WA 3T07A 4WX2A 2IPJA 2VUYA 3SJ3A 4JR5A 5HK4A 2A3HA 4IOTA 4MUPA 4UTUA 1J2BA 3DYPA 1Q6GA 1VFOA 1CT5A 3WBEA 2P76A 4LUSB 3FJNA 8XIAA 3IVUA 4P2VA 2O7QA 2ZA3A 1F7BA 4TVDA 5FF4A 3CUXA 5CSSA 4JIPA 2XIMA 4QLLA 3QPZA 2ZBTA 3OTRA 2XH0A 4C91A 2ZE0A 1TMQA 4RDZA 1TMHA 5CG7A 3WBAA 3TQKA 3LV6A 3WD3A 1MEWA 4CCEA 2IPGA 4IISA 4JDBA 1LOQA 3LHZA 3FS2A 1AK5A 3TTQA 1YXDA 2OLAA 3C2EA 1ITQA 4WZHA 2J7FA 1L6FA 4C6JA 1GOXA 1EA9C 1I2RA 4TQTA 3T81A 1WXYA 4IMAA 2Y5JA 2DZSA 3R7MA 2ZC1A 3SRKA 3W85A 2W27A 1GOKA 1CEOA 4K68A 2HBXA 3LEPA 3HFYA 3CHDA 5F4XA 5CBJA 2YCLB 2PP3A 3QY7A 4HA0A 4EP8C 4Q22A 1GVSA 1RALA 3M43A 3AWOA 3W7CA 3S1XA 2QXWA 4IICA 1S2WA 1BLIA 2Y85A 4LT9A 1DWGM