2Z0IA

Crystal structure of 5-aminolevulinic acid dehydratase (alad) from mus musculus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
323
structure length
283
Chain Sequence
VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSREDSPTIEAVRLLRKTFPSLLVACDVCLLSEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-aminolevulinic acid dehydratase
publication title Crystal Structure of 5-aminolevulinic acid dehydratase (ALAD) from Mus musculus
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 78
structure length 283
sequence length 323
chains with identical sequence B
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z0iA00
3ZFHA 3DFTA 3MYPA 3I65A 3LLDA 3A9IA 1AMKA 5EY5A 2RH9A 3QEZA 3DKJA 4TU1A 3PM6A 1TREA 1EX5A 2ZA3A 3G1YA 4WXZA 3CIXA 1ADOA 4DEFA 1XBXA 1KFBA 4MKNA 4JXCA 5A5WA 2J27A 2C19A 3MI3A 3QJAA 2GVLA 2ISSA 4H6KA 4ICNA 4OWGA 5FESA 4JTKA 3P8JA 1LBLA 3IV3A 1X8FA 3TKFA 3C2OA 3WK1A 3V75A 2GJLA 3E96A 2RDUA 1T99A 1H7PA 1N55A 2FPYA 4XUGA 4UTKA 5EBUA 1SU5A 3G8RA 2A6NA 4NNAA 1BWLA 4MZ8A 3BO9A 2QDGA 1OX4A 4NX0A 4O1BA 4HNNA 1TMHA 4QITA 1RVGA 4YWIA 2QCMA 5G2IA 2DZUA 1K8YA 1OVDA 5LZLA 4IWWA 4JR5A 2YFOA 3UPWA 1FCBA 1LROA 2FIQA 2G97A 1F6KA 5AYZA 2ABAA 3W7EA 2BZNA 4M5PA 3A24A 1G4EA 3PG9A 4O1AA 2QCLA 1LLWA 4GNJA 1GVQA 3LHUA 4AHOA 3DXIA 4UTLA 4Z08A 3BG5A 4Z1CA 3CT7A 3UZ5A 3Q58A 1ZHAA 2NUWA 2UV8G 1JCMP 5G2HA 1P0NA 3LV6A 3MBFA 4HSNA 1OF8A 4GUHA 3IVUA 2OX1A 1QR7A 2EGZA 4X9SA 1GVFA 1VCVA 2W79A 2NX1A 4GXMA 4LRSA 4BWLA 4RZ4A 2DJXA 2Q8ZA 3N19B 2A4AA 3PAJA 1WX0A 2C3ZA 5DCBA 4G1KA 2NXGA 4HNTA 2Y89A 5K3VA 5KTLA 1OFOA 5LNWA 1U5JA 3NPVA 3STGA 5LNUA 4QIUA 1HUVA 4JTGA 3SY5A 3W6YA 3WJSA 2CLMA 3FS2A 2PRLA 4TR9A 4MFEA 4IX2A 3SJ3A 5F2MA 2NXIA 3PBUA 3STCA 3KRSA 3GKFA 4AMAA 5DN1A 3LLFA 4GC4A 5DY2A 1NSJA 1LBMA 1S5TA 2ISVA 4LC6A 3R89A 2BTMA 1OFAA 1W5QA 4Q32A 1IIHA 2QEZA 1JQVA 4ZMGA 3W2JA 4U4MA 1GT8A 1TPB1 2ZTKA 5K7JA 4OBTA 4XTIA 3IIOA 1IGSA 4A3UA 2JGYA 5TBOA 4CCDA 1ICQA 3KAOA 3M5ZA 3P80A 2IQTA 2QCEA 3M7WA 1VYRA 2ZZ3A 3P60A 3R12A 3C61A 1VJIA 5K9DA 1JJKA 2CZDA 2V2CA 2ZTJA 2V0TA 1M5WA 2HTMA 3LX9A 4DO4A 2A0NA 3PSWA 1GPWA 4UFMA 4L4LA 4LOCA 4DF1A 4LS0A 1OFRA 5KZEA 2Z0IA 2WSRA 1XCFA 3USBA 2B7OA 3PBVA 4YXGA 2JGQA 3ABSA 3W07A 2YXGA 1Z41A 5D02A 2YDAA 3ELFA 1G7UA 1ZFJA 4GWEA 4JTFA 4ORMA 2XFWA 5CSSA 4M7TA 2Z2UA 3M6YA 3NZ1A 1OX5A 1A5CA 1KA9F 3C52A 3LCFA 4ML9A 4UTTA 4DBEA 4LVAA 1X1ZA 2X2GA 2ZZ4A 3B03A 4JIPA 4JTHA 1TCDA 1SZNA 1LBFA 5F4XA 1L6WA 3G24A 1SSGA 1GYNA 3NEVA 3W7JA 2A7NA 3TQVA 2YFNA 4K39A 3W1MA 1LZOA 2H3BA 8TIMA 4FO4A 4W9TA 3M5VA 3L67A 4QQ3A 1QPNA 4CQAA 3CU2A 5TQLA 3GXTA 3W1XA 2FJKA 3I7QA 2ZRZA 3IGXA 4JX4A 5E93A 2DZPA 2ZZ5A 1W5MA 2QKFA 4K36A 3UZJA 1ONRA 1ZCOA 3EKLA 2WNNA 4I7VA 1YTEA 2ZA1A 1O95A 3R5EA 2D73A 1PCWA 2VFFA 1ZJIA 4QSHA 1ME9A 3TROA 3NYZA 4JNMA 3S5ZA 3LXBA 2YYTA 3G3DA 1ALDA 4UMCA 3DFQA 5C2XA 4Z1AA 2CLOA 1XXXA 3QZEA 3H54A 4UTUA 2V81A 3P8IA 5HWJA 2CZFA 3N9RA 3G1AA 3K30A 1OYAA 1B9BA 4WUIA 4CLMA 4YCOA 3LM7A 3TIMA 1OFPA 4GUJA 4UR7A 4O4WA 4OV4A 1JCXA 2P10A 3FJLA 3P81A 4D2JA 3LCGA 1ME8A 3HMJG 4UFHA 3A5VA 5F2GA 1TPC1 2H90A 3NQDA 3MO7A 4UUIA 4GBUA 3M44A 3EWUA 4WX2A 2C6QA 2CLIA 3W1UA 3NPWA 1LOSA 1LRQA 4JYDA 2QCDB 5A8GA 2WQPA 3NPXA 4GUIA 4UXDA 1BKSA 4HPXA 4RCXA 4OE7A 3NQAA 4BK9A 1YTKA 3O6YX 2WKJA 2J9XA 3C0JA 4IMCA 1RQBA 2KZHA 3L9CA 3S1UA 4I9AA 2GJNA 3LGEA 3MP3A 4LNYA 3MYOA 3PF3A 1DJNA 3W7GA 4ADSA 3A5FA 2CLKA 1G6CA 3VFLA 2QF7A 2BXVA 4XBSA 1P4CA 1ZALA 3NXFA 3I68A 4EF9A 4UTWC 4JTIA 2E6DA 4GE8A 1XL9A 3W7PA 1CW2A 1GQNA 3F4WA 1UASA 3FYOA 4H3DA 3C4UA 3A22A 4NVTA 2WNZA 1F7BA 4X3ZA 2ZZ1A 3EEGA 5LHFA 4JY9A 2FTPA 3L0KA 4A22A 3EKZA 3NL3A 1GYLA 2EHHA 4R34A 2GQ8A 5F4WA 1VHNA 4PC8A 5AHIA 3UPBA 1KTBA 1THFD 1CX9A 1FWTA 2CFFA 2VFDA 3IIZA 5FEXA 3PG8A 3S5NA 4YCPA 3O05A 2I14A 4MY1A 3THQA 3QW3A 2PRMA 4LWWA 3B4UA 1L6SA 3CQ0A 6ALDA 3DFNA 4AWTA 4HHPA 2HS8A 3QPYA 3E0IA 4BI7A 5CGQA 2NUYA 1MEHA 2G5WA 4OV9A 3SW6A 1WV2A 4PL2A 1DL3A 3IGUA 3T7VA 1OFBA 3YPIA 4QJ1A 2NV1A 4HNVA 1VPXA 4XWUA 1OX6A 5E0KA 1GZGA 3UXAA 3EWYA 4H4IA 2TRSA 3BLFA 1Z42A 3W7HA 3G22A 3GNNA 5AB3A 3B0UX 2C13A 3TSBA 2VEIA 4XKYA 4LU0A 3WJYA 5D37A 4Y96A 3CB8A 1GG0A 1HG3A 2ISWA 3O16A 1OYCA 4A21A 2QJIA 1F05A 1FX6A 2C14A 3W70A 3NAVA 3VI2A 3UQNA 2P1FA 1I2OA 4K37A 3TFCA 4HKPA 3FJ6A 3W85A 4O15A 4IOTA 1VH7A 3NL2A 5DXXA 1X7FA 1NF0A 2ZCGA 3BPWA 2I9EA 4AVFA 4N9EA 3QMSA 1VGAA 4KKXA 4LV9A 2CU0A 2XN2A 1OYBA 2X1RA 1KM3A 4WXYA 3C2VA 4NX5A 1F73A 5DELA 2V9DA 4WY0F 2VFHA 3BG9A 3CTLA 4O52A 1LYXA 2Y7GA 1IXNA 3PB0A 4EF8A 3HPXA 3P82A 3BW4A 5BW6A 1TPH1 3S5OA 3UWZA 3EB2A 3EWXA 5L6UA 5G4WA 4TIMA 3UNDA 1TJRA 3NA8A 3O63A 4PH6A 3S0CA 1VYSX 4KWWA 3UWYA 2VXNA 1A53A 1K7EA 4FX6M 3GK0A 3O06A 3M1ZA 3KVLA 2NV2A 4ORIA 4OQVA 2EAWA 2V2DA 3PULA 1XDLA 2W0UA 5I3IA 1O60A 3SSJA 4DF0A 4POCA 4AAJA 4AHQA 4JDYA 1UUOA 3M41A 4KWVA 1DOSA 1TO3A 3HJZA 2ZRVA 3EX1A 2HMCA 4N6EA 5D38A 1WOBA 3OEXA 3B0VC 3KHJA 4K7VA 2Y7FA 1DV7A 5HUOA 3FKRA 3LTYA 1QDSA 2J6XA 4MZ1A 1UUMA 2OZ0A 4LUJA 2DZTA 5DBTA 1DVJA 2ZYFA 2CLHA 3CEUA 4HPJA 4UFKA 3BW2A 1F76A 4UTMA 3UWWA 3W7CA 4R7JA 4FIRA 3HGSA 1XC4A 3LCHA 3CC1A 3RLVA 5FI8A 4JTTA 4S1FA 5HMSA 5I3JA 2ZZ2A 3P74A 1VLWA 2ZRUA 1I2RA 5FF3A 3RK8A 4XQ6A 1KFLA 1GOXA 3C6CA 3W1RA 1G4SA 4IXHA 4IQLA 4X22A 3NZRA 3TFXA 5BRBA 1EWDA 3LBCA 3ABQA 5FF4A 3EX3A 2WO5A 1VCGA 3W7KA 4CNPA 3RNDA 3VKJA 1JUKA 1HL2A 2YW4A 1SO5A 2JKEA 5BNKA 1XDMA 3W1AA 5EMUA 2VFEA 1TRIA 1W3NA 2TPSA 1FXQA 1VYPX 1JRBA 3W2UA 4Z1BA 1FWWA 4DELA 4R53A 7TIMA 1LP6A 2A85A 5FEZA 4AF0A 5I3HA 5I3FA 4ALDA 1KM4A 2QUUA 3GX9A 1Y0EA 2FB2A 4JTSA 1TQXA 2WJZA 2VENA 4RJEA 4A2SA 4YL2A 1W37A 3QYQA 1DQWA 1HO1A 2QDHA 2JBMA 3KVJA 4UTIA 3TJXA 1TPEA 1EA0A 1G69A 4R33A 3MJYA 4NJIA 3IVSA 4ADTA 4AB4A 5D33A 1R2SA 3U6WA 5SWUA 4LRTA 4AHPA 2Y7EA 5KZDA 1TTPA 4NT0A 1O5XA 1AL8A 3QW4B 1EIXA 3TQKA 3MHUA 3NM1A 3HF3A 1KV8A 1ML1A 3E02A 3W7QA 4MOZA 3WK2A 4LT9A 5K9XA 3L66A 3L5MA 4QNEA 3T78A 3QMRA 1H7NA 5AHLA 3MHGA 1QWGA 2B7NA 5AYYA 2PRHA 5LGZA 2CLLA 1J4EA 3G1FA 3RU6A 5C54A 5CZJA 1XUUA 5FEPA 2X1SA 5AHEA 4JD4A 3GR8A 4RXGA 3MBDA 3PVFA 1B4KA 5D09A 1LM1A 3T40A 3TC7A 5F4SA 1GVSA 3PUDA 4UNKA 1TTQA 1QPRA 4CCEA 3S9YA 4PCFA 2FPTA 1XBZA 4UC5A 4N9DA 5I3KA 2QCHA 5CPOA 3QH2A 4C1LA 4UFLA 2Y6ZA 3LBMA 3T44A 4EOUA 4M19A 4UTWA 4JTJA 4ZQNA 2Y61A 1TV8A 3W71A 1M6JA 3DU0A 1C9DA 2YPIA 3GXNA 2VFGA 3PUEA 4KFPA 1QPOA 1UCWA 5HNRA 3TA6A 1G4TA 1FDZA 1MZHA 5CZTA 3C2EA 1PHWA 1SW3A 3HG2A 4RK8A 3BLIA 1XUZA 4DPQA 3BARA 4JTUA 1EUNA 1YXCA 3N9SA 3GIYA 1G4PA 2O7QA 3NQCA 2Y85A 3HGRA 2VEPA 1QNVA 1R47A 4RX0A 2E77A 3KOFA 3OA3A 1YPIA 1FWRA 1T96A 2VOMA 1SO4A 3LRLA 2C0AA 3SR7A 3W86A 3OVPA 1F6PA 1GEQA 2RFGA 4M7SA 1JCYA 3QFEA 4ZQCA 1WAUA 4TX9A 4ZQPA 4K6AA 4Z1DA 2AQWA 1K7XA 2R8WA 3FKKA 2WOQA 3DI0A 4EWND 1M7PA 3EX2A 2V5LA 4NXKA 4RR4A 2QJGA 4XBKA 5H2ZA 3PS7A 1R2TA 1A5AA 4LY8A 2ALDA 2QUTA 1WOAA 4MY9A 1W8SA 2QAFA 3NQVA 3W1LA 3OG3A 3W74A 1RV8A 1IF2A 1S5WA 1I2QA 2DJLA 3KVMA 4UFIA 5F2IA 2P0OA 1W5OA 4XZ9A 5DCEA 1OF6A 2Z6JA 3L0GA 4IGHA 3TMQA 4JTLA 5G5IA 3M0ZA 3QQ1A 2Y62A 1W5PA 2GQAA 1C8VA 1MEIA 2DZSA 1OFDA 3O07A 4IMGA 2Q3RA 1A5SA 2Y88A 5D2WA 2ZRYA 5TIMA 5K4XA 4O53A 1M7OA 1DKWA 1C29A 2Y70A 4MJMA 1FDJA 2QAPA 3N14A 2Q8LA 4A2RA 5U7SA 1V7YA 1X6UA 3IIVA 3CM4A 4O57A 4LV4A 5IBXC 4E38A 3L21A 1DQXA 1XFBA 1IXQA 1K03A 3CIWA 1FXPA 1FBAA 3LXCA 2V2HA 4DF2A 1VRDA 1W3TA 2E1DA 2VEKA 2WPBA 2YCEA 4GUGA 5AOUA 3OIXA 3W1QA 1QPQA 5FF2A 4O13A 3W73A 3CPRA 3TCEA 3DFPA 3T4CA 1Z44A 3GKAA 3LTSA 3TSMA 3LRMA 3ATZA 1IXOA 4IX0A 3JS3A 1GJPA 3EXTA 3W76A 4C1KA 2ZQ0A 1OJXA 4NZJA 1PVNA 3PB2A 1VHCA 2C16A 3NDOA 1YXDA 3LV5A 4JYEA 1AG1O 4AXKA 3DHDA 1YLVA 3IIPA 2VELA 3LI0A 1I45A 5D2YA 5F1UA 4HNUA 4NQ1A 3TE9A 4L4MA 4Z0JA 1EUAA 3M9YA 5DLCA 3W7LA 4MLJA 1EEPA 3GZ3A 5AHNA 2YW3A 5BOOA 3VNDA 3TUUA 3G18A 3BV4A 2BWGA 1U83A 2J9YA 2E6YA 4E2BA 3C3NA 1F5ZA 2O7SA 3M43A 1NVMA 1RQEA 1DJQA 3WJXA 1RPXA 2CZEA 1QAPA 3Q37A 3W87A 2C1HA 4O12A 1KFJA 3ZWSA 3MUXA 4NZFA 1RD5A 1G7VA 4NJHA 5EKYA 2WSQA 3KVKA 3O1NA 1LRTA 4JGDA 4LVBA 2B7QA 4QISA 1FWSA 4TMBA 1KM1A 2ZZ6A 4NUWA 4JX6A 1TB3A 4Z0SA 3HPZA 4N9CA 3GXPA 1W56A 2EPHA 2NZLA 1OK4A 3P7YA 1FUYA 2NX9A 2A21A 2YZRA 4IJBA 4DXVA 1KM5A 4MVAA 4K8HA 2A6LA 3E9AA 1TPUA 3WJWA 3O8AA 2J24A 1SQ7A 3DGRA 1LORA 1SFJA 4N02A 2H3DA 5EYWA 4NU7A 4UNLA 3CHVA 1K3UA 2CLEA 1PS9A 5E1QA 3LB0A 1YDOA 3R2GA 4JX5A 3ANYA 3NQ2A 1HTIA 5BMXA 3STEA 1FCUA 1P5BA 4FNSA 1DBTA 4IPJA 4DQWA 5HR6A 1KV5A 3ZS4A 5U4NA 1BWKA 3G0XA 4OU1A 4TO8A 5DCDA 1PCKA 2ZRWA 3TDFA 4JN6A 5K2ZA 1R2RA 3IIXA 3N3MA 4NJJA 3C8FA 4RV8A 2WNQA 1JQXA 2PCQA 3KRZA 4JY8A 5FF7A 3P62A 5HINA 3Q94A 3UY7A 3HQ1A 3LHZA 2QCDA 3LHTA 3I6RA 5HWMA 4ZQMA 5G2WA 3HBLA 1VQTA 2PE4A 2Z1BA 1KLZA 2B7PA 1G67A 5CPLA 3GAKA 2TSYA 2HSAA 3W72A 1DORA 1Q3NA 1PL9A 4IPIA 1D9EA 2X1UA 2ZFAA 3DAQA 3W2NA 1SFLA 1LOQA 2PURA 5D30A 1SZEA 2TMDA 3ZWTA 5KINA 3W88A 4N4QA 2RHGA 3CWNA 1SPQA 4N9BA 4M6QA 3INPA 5EL1A 2OCZA 2WSYA 3RMJA 4ZL1A 5J5DA 4JEQA 1QCWA 1JRCA 4E2DA 3UYCA 4FX8A 4Y9AA 3SECA 1PIIA 3R13A 3MW7A 1TYGA 1JVNA 4LW7A 1B4EA 2ZDRA 4RKAA 1UJPA 5LGXA 1JULA 1TV5A 3P5YA 5D2TA 1OHLA 5K9CA 3W2KA 1SZFA 5DBUA 3TJLA 1OX4B 3BW3A 1H7RA 3TQ0A 5CZSA 4FF7A 1VLIA 1H51A 4GRSA 4X2RA 3DKLA 1W5NA 4Q4KA 4O4VA 3QQ0A 4NJKA 4WZHA 1ZENA 1MSSA 4M6VA 4TMCA 4DPPA 2EF9A 1T8XA 3CLMA 2C15A 4YMZA 4ADUA 2A1YA 1ZAIA 3IVTA 5D04C 3GAYA 1EP3A 4MY8A 2QUVA 3PY2A 3HG5A 4FHAA 1A5BA 2DZXA 3LRKA 1IXPA 1SUXA 2V30A 2E68A 2E09A 5AC6A 2GQ9A 2G95A 3NR0A 5D2VA 1Q6OA 2FLIA 4UMBA 5I3GA 4JICA 1OFEA 4FEZA 3W84A 1KM6A 6TIMA 3L68A 3SGZA 3TK7A 4O18A 3W1PA 3DBPA 2NWSA 4Y8FA 3SIZA 4O8RA 4O1DA 4E0CA 1LLZA 3THAA 3JR2A 1VC4A 4CQ9A 3NG3A 4Q33A 3GVGA 5KSWA 1UB3A 3EX4A 3D0CA 1KTCA 4FX7A 3S5YA 4CNOA 2X16A 3F1QA 2VC6A 1EP2A 1P1XA 1QO2A 3NL5A 3OHIA 5LKYA 4PODA 1TPWA 1ZAJA 3NOEA 4O10A 2JK2A 3HGJA 5DY3A 3QC3A 2ABBA 4LS1A 1LRNA 2GOUA 2H6RA 3VCRA 1W31A 4MFDA 1DHPA 3JRKA 1TPFA 1KBIA 4GJ1A 1NEYA 4LVDA 3H53A 4ZZ9A 3DENA 4HSOA 3OVRA 3U2OA 3IRDA 3F03K 5G1TA 1S5VA 3GR7A 1VCFA 2ATSA 4O50A 3NPUA 1Q6QA 1H1YA 1AL7A 4U28A 4WJEA 3W83A 1SW7A 4OHQA 1ICPA 2AGKA 3TAOA 4I7WA 5LNSA 5LHEA 2FDSA 5KITA 5HJLA 1V5XA 5IBXA 1XBYA 3LXAA 4FNPA 1AW2A 4NJGA 1FDYA 4UR8A 1EWEA 4FB7A 3P84A 1L2UA 1XI3A 3IEBA 4MPQA 2A2IA 3HB9A 4FNTA 2X1TA 3E12A 1WQ5A 3BLEA 3TR2A 4BI6A 5D03A 1TTIA 4JIQA 1EB3A 3DFOA 3HG4A 1YTDA 3NM3A 3W22A 2LLEA 2JKAA 2FQIA 4IUOA 4LTSA 3TU9A 3WFAA 1R46A 2B0MA 4CQ8A 3EWZA 3HOJA 3PBWA 3FEMA 3M47A 3G8EA 5CPNA 1XBVA 1WXJA 3SI9A 2NWRA 4HIBA 3PUOA 3HPSA 3S1XA 2QCFA 5CZ0A 1H61A 4IXXA 2Z6IA 1OG0A 4MYAA 5CSRA 1W0MA 3OBKA 5F1VA 5KZMA 2DZVA 1QMLA 2V82A 3TAKA 1BEUA 3W1NA 2YGYA 1MEWA 5T26A 3W7OA 5ABTA 2EKCA 3MHFA 1KFEA 3W7RA 3EWBX 3L0NA 5HUPA 1Q6LA 1TSIA 3QSTA 3C56A 4AEOA 2BSLA 3L2IA 4LC8A 4O0KA 2E6FA 5GVJA 4K7YA 1FQ0A 1JUEA 2X30A 3BGJA 2E5DA 4JTEA 4PFMA 3PBYA 1PE1A 4NXSA 3R8RA 3LTPA 1RR2A 4O1CA 3CEPA 3ABRA 1O5KA 4UCGA 3UY8A 2J9ZA 3FLUA 3W1TA 1VZWA 3WJZA 4DBDA 3B04A 4WY0B 3DI1A 4NNCA 3S1VA 4O54A 3NO5A 3W75A 3P61A 3NQ7A 1N8FA 1H7OA 1HFBA 4MYXA 3FA5A 4P2VA 3O6CA 2QCCA 4IMDA 2CWNA 4LVGA 1I2PA 1K02A 2NXHA 3G1XA 3S1WA 1S3HA 2PC4A 3W9ZA 4WD0A 1O94A 3HGOA 1YPFA 4MZYA 2ZBTA 2HS6A 1F74A 2GUUA 4KFOA 1K7FA 5IM51 1AW5A 4YLWA 3FOKA 4FNUA 4O0ZA 3N34A 4DO6A 4ZQRA 4JYFA 3S6DA 4N4PA 3RF9A 1LTDA 3NL6A 5C55A 4LUIA 2RDWA 4MIMA 1KFCA 2A5HA 4O14A 2DORA 1QFEA 1E51A 4O28A 3W2MA 5D32A 2OJPA 4RZ6A 5G4EA 5EA9A 3TH6A 4HN4A 4O16A 1T0OA 4FXRA 3G0UA 3LCLA 1SW0A 3GLCA 1JCJA 1H7WA 1CI1A 2Y7DA 3U8GA 1O4UA 1OABA 1TQJA 3NQ6A 3QPZA 3NNTA 5EPDA 3TNOA 1ICSA 3GDTA 3HO8A 5G1YA 1I8JA 4JDBA 2YYUA 1N7KA 1FCVA 3QF0A 2CZ5A 2YSWA 2VEMA 3N2XA 2FPVA 2I1OA 3T55A 2VKZG 2RKXA 4PEKA 1AW1A 2C18A 3LERA 1QOPA 2OT1A 1ME7A 3VE9A 3GB6A 3STFA 5AFDA 3B06A 2ZRXA 3E49A 1H5YA 3W7NA 2BX7A 3HG3A 1GG1A 3UD6A 4UTHA 1ZNNA 1SSDA 3V1PA 5LSMA 4EIVA 3LOTA 3H55A 5CPMA 1H7XA 2BLEA 1MXSA 2JKPA 3C2FA 1GVRA 1KBJA 3A23A 4HT3A 3KXQA 4ONVA 3S8HA 3B8DA 2J88A 5FF0A 2TYSA 1YDNA 3W3OA 5AC8A 4PTNA 1YDVA 1OFQA 2DZWA 4N2YA 4GFSA 4WY0A 4PL1A 1J5TA 5AYXA 4BF9A 1GTEA 2QR6A 3KX6A 1SZGA 1B3OA 1QOQA 1H50A 5FEWA 5C5YA 3TSDA 1JR1A 1X1OA 4Y6GA 4WOQA 3PC0A 3MP4A 4XKYB 3UWVA 3QMTA 3EXRA 5D2XA 1D3GA 5HWNA 1YXYA 1L9WA 5CG7A 4BWLC 3DZ1A 1SR9A 3W7DA 5KMYA 1RQHA 4FXSA 1TPVA 4N6FA 4QNWA 5LNRA 3W23A 3PSVA 4K38A 1GWJA 2NUXA 1TTJA 4S2BA 3BVJA 3L5LA 2GPTA 1TRDA 4XTDA 1H63A 2B4GA 2ZA2A 1TJPA 4AH7A 1MO0A 4JS3A 3G1SA 1YYAA 1WDWA 5AHMA 4J9JA 2AAMA 4CCCA 1YADA 3FFSA 1VR6A 4LS2A 4ZQOA 3KRUA 5CKSA 1L6YA 2OT0A 1OK6A 2ATMA 2V5BA 1AK5A 1KM0A 3SFKA 3TXVA 5HR7A 4O11A 5F2LA 3TV8A 1PHQA 3NQ8A 3EXSA 1WA3A 4P61A 2FFCA 3MWAA 3NVTA 1KTNA 3C2RA 3M5XA 1B57A 1Z48A 3MP5A 4QM1A 4A29A 3NQEA 3G1DA 3QRHA 2Q3OA 2OMAA 4S2CA 3G3MA 1EPXA 3GDMA 3GYEA 2YR1A 1W54A 3LCXA 3PWAA 2R91A 3DHFA 3NQMA 3I7SA 3G0SA 1A50A 3TMLA 3MI2A 2F84A 3ABOA 4RZ5A 4AWSA 1TV7A 3MMTA 3NQFA 4CNNA 3LDVA 2CW6A 3L5AA 1WYIA 4MLRA 4BI5A 4FIQA 2GVGA 3KFTA 1WBHA 1JCLA 4DO5A 4RLIA 1I2NA 3TW6A 2QCNA 4K8EA 4PA8A 3ZR4A 3RLUA 2A7RA 4UIOA 2F7FA 1GTHA 3GDRA 4UMAA 2V8ZA 1HO4A 3W7IA 1TPDA 1I4NA 1ZY9A 4Y90A 3QSRA 3OVQA 3M5YA 2CLFA 4UTTC 1XM3A 3A21A 4M6PA 3PR2A 2E5BA 3GNDA 4GUFA 3LCWA 4RXFA 3BGGA 3LHWA 4MUZA 3LHVA 3GDLA 5HQEA 4QAIA 2ZZ7A 1JUBA 3N73A 1QO5A 4LVFA 2W6RA 1EP1A 3B05A 5HULA 1R30A 1UBSA 3TXZA 3P5ZA 4BFAA 5L9FA 3NGJA 3G1HA 1K8ZA 1H62A 5MHBA 3BK0A 5D05A 4FNQA 1SO3A 3B0PA 1NAL1 3TC6A 3SZ8A 1KFKA 1TIMA 3HIJA 1NFBA 3DH7A 3QM3A 3O15A 3TW7A 4BR1A 4KFNA 3DFSA 4UTJA 3EWWA 3F4NA 3N2MA 3LCIA 4ZVJA 1H60A 3S42A 4I7UA 4EVZA 2R94A 1KM2A 1WBJA 3I7RA 3W7MA 3VE7A 2DU2A 1LOLA 1NF7A 2E5CA 4O17A 2E6AA 3LI1A 1XKYA 5J5RA 4O19A 4AF0B 4WOZA 1GVOA 4AWUA 5AHFA 4OGZA 5C6MA 2GVJA 3ATYA 3IGSA 2QCGA 3UXDA 4OT7A 1SO6A 1FY6A 4FNRA 3O6DA 3P67A 3SGUA 1FWNA 3TX9A 1J2WA 3UWUA 3L65A 3EX6A 3MI6A 1D3HA 1VS1A 3CWOX 1Q45A 1W3IA 3BG3A 3NQGA 2H8XA 3M16A 5AN7A 1BTMA 1P0KA 2XN0A 3AO0A 3FYPA 2FB3A 3FIGA 1LDCA 3Q2DA 1KW1A 2A7PA 3W2LA 5LNVA 3GDKA 5AC7A 2NLIA 3G1VA 3RFAA 1F2JA 3AJXA 2XN1A 4IMEA 3LHYA 5DXYA 1JCNA 1H1ZA 4IMFA 1KLYA 4UFJA 4WQ6A 2Y63A 2R14A 4NNBA 2QJHA 1IIGA 4B5NA 1W1ZA 2RDTA 4MJZA 1Q6RA 1FCQA 1ZAHA 1RZMA 2WV8A 5BMWA 2G96A 3WK3A 3UWQA 2H8ZA 1PV8A 3WK0A 2NX3A 2VFIA 2YX0A 5H91A 5K4ZA 1LCOA 2DP3A 1K8XA
chains in the Genus database with same CATH superfamily
2YA1A 2YBTA 3LLDA 1W1IE 4Q7NA 3DKJA 4D6HA 4J27A 1SJCA 2FZMA 2QUNA 1MDRA 4WXZA 4W8BA 2AOSA 3CIXA 2V5KA 2HNEA 1QOXA 1TV4A 5LXXA 3M46A 3O2LA 3MI3A 2C19A 4NZ1A 2WCAA 3QJAA 4ZO7A 4QGCA 4PGLA 5CSYA 4L64A 4IPLA 3DCPA 4HMDA 2XWDA 4P7NA 4URIA 4AZCA 1LBLA 3IV3A 4D6DA 3H24A 3C2OA 9CGTA 3E96A 3H7RA 1W9UA 3ZJ7A 1H7PA 2ICSA 4UOQA 4B2DD 3BLOA 2ACSA 1BWLA 2DZAA 4Q8MA 3BQ6A 2YL6A 4NX0A 4O1BA 4HNNA 1J9YA 1Q13A 3FDKA 4ZB2A 2QCMA 4HJWA 1E5NA 5G2IA 5FJIA 2FTYA 1K8YA 1OVDA 5LZLA 4IWWA 4JR5A 2YFOA 5DT5A 2G97A 4DUVA 5I00A 4M24A 5AYZA 1XV8A 2ABAA 3W7EA 4IFOA 3SCNA 3A24A 3PG9A 2FGLA 5CAHA 1LLWA 1GVQA 1UKSA 3LHUA 3SN0A 1H0GA 1ZHAA 1C7TA 3LV6A 4GUHA 4X9SA 1BXCA 4X60A 1RPKA 1JGIA 1GVFA 1VCVA 2W79A 2NX1A 2R82A 2RUSA 1H1NA 1RALA 4KQNA 1Q7ZA 4JKKA 4KGLA 1WX0A 3GBDA 4HOWA 4G1KA 4HNTA 1TR9A 3JU2A 1DPMA 2PCEA 5IOBA 5LNWA 4D6GA 3BURA 4CKQA 4G8TA 3NPVA 3STGA 3KE0A 3DYMA 2PRLA 1Y65A 2UY2A 1HGWA 3AZTA 3A6OA 3WNPA 3AHXA 3WELA 3RR4A 4B91A 2PLJA 4R9OA 2REQB 1KB3A 4IM4A 1S5TA 3V3WA 5JBDA 4LC6A 2DT1A 1OFAA 3IANA 3GIPA 4F0SA 2GSHA 2OLAA 4OBTA 3VKDA 4XTIA 2YL5A 4PTMA 2DPEA 3RX3A 5TBOA 4CCDA 4AIUA 4HCLA 3WLLA 2D0HA 3PANA 3PJUA 3M7WA 1VYRA 3P60A 4KS0A 3ZVHB 1C8XA 1M5WA 3TYCA 2GFTA 1GPWA 1X96A 4H7ZA 2VQTA 4LS0A 3SCSA 3ZOAA 4WLCA 2Z0IA 3ANVA 1DJZA 1E6PA 2BVDA 3QHMA 3ABSA 5CGMA 3UCDA 1Z41A 2YDAA 4ACYA 4DUOA 3LBOA 4B5TA 3FV9A 3M6YA 3Q67A 2WJDA 2F61A 4M82A 3C52A 4DBEA 3WYZA 4JTHA 2FH8A 1SSGA 3NEVA 3W7JA 3S6OA 3TQVA 3N6HA 5DX7A 4CQAA 3CU2A 2ZXQA 3IGHX 3QC0A 4AW7A 3BMWA 2WJEA 2WNWA 4JX4A 1BSIA 4JHZA 1H09A 1FH9A 3UZJA 2EPLX 4HCDA 3UG8A 1E70M 1A49A 1RBLA 5M5DA 2OEJA 2ZA1A 4XISA 1B3ZA 2AL2A 3WBAA 2VFFA 3PZOA 3BAYA 1ME9A 3S5ZA 1ALDA 4F79A 4GIRA 1FWGC 4UTUA 3S46A 2OWXA 3N9RA 1IWBA 1TJ2A 3R79A 2WMFA 4CLMA 4HK5A 2YOCA 5CEWA 4GD0A 4WHBA 1JD9A 5M1TA 4OV4A 1XSIA 1ME8A 2QV4A 2V67A 7XIMA 2H90A 1JPHA 3V5FA 3M44A 2G3MA 4GJIA 2YZ5A 3NPWA 1LOSA 5I06A 3DFYA 2V38A 5A8GA 4HPXA 3O6YX 2E28A 4DM2A 1HKIA 4IMCA 3L9CA 2XG9A 4LNYA 3PF3A 5EMYA 3A5FA 1EOMA 1OQFA 4A8NA 4BEQA 1YMYA 1DWAM 1V0MA 2BXVA 4XZNX 3IJLA 1AFSA 3NXFA 3NFUA 2AL1A 2E6DA 1XL9A 3W7PA 3MSRA 3F4WA 3FYOA 4H3DA 3MUIA 4ZOEA 1YE6A 1UKPA 3NL3A 1GYLA 2AMGA 3KBMA 2CFFA 3U4FA 1GW1A 1XH1A 2RJHA 3PG8A 3QY8A 4DBSA 3HQOA 4YCPA 4JL1A 4IH3A 2ONEA 4WEVX 3CYVA 3SO7A 3OLIA 1S46A 1L6SA 1RCOB 2VGGA 3QPYA 4YVPA 4GYFA 1MEHA 1WV2A 5ABHA 1DL3A 3CO4A 4J3XA 3IGUA 1MYRA 1OFBA 4AXNA 5C71A 4AVNA 2BS9A 1VPXA 1Q8JA 4XWUA 5H8UA 1F8MA 1PX3A 2W91A 4Q4SA 1WUFA 3AXIA 3G22A 2C13A 3VZZA 3TSBA 2VD8A 1VPQA 2VEIA 1MVYA 4XKYA 4LU0A 1UWUA 2YJQA 3CB8A 1GG0A 3EB4A 3QZ6A 1OYCA 4A21A 4H19A 1UZ4A 1F05A 1CCWB 3RM4A 4B3KA 4K37A 2W63A 1E71M 3TFCA 2GWNA 3KM8A 4DWDA 2WZHA 4HKPA 3WLTA 2H9AB 3RM9A 2V63A 4PCPA 1N82A 2VZTA 3NSXA 3BPWA 2L5HA 5GPRA 3CAVA 4AVFA 5GNYA 2PDFA 2WC7A 2VWTA 1I0DA 4XSMA 4JTCA 3B8WA 4QG8A 2X1RA 1HJXA 3RX2A 1JFXA 4GQ0A 4WY0F 2VFHA 4O52A 2D0FA 3V4BA 5GJNA 1KCLA 1MNZA 3GBEA 3BW4A 5BW6A 4S3EA 1L0PA 3QKZA 4F9JA 5L6UA 4TIMA 1TJRA 3NA8A 3O63A 4WR3A 3CUJA 4KW2A 3TC3A 1ZPTA 2XVGA 1POJA 1CGYA 3GK0A 3O06A 3M1ZA 1S2VA 4KWSA 1JIBA 2W0UA 2HVMA 4CD5A 4LY4A 1B3WA 4JDYA 1I1WA 3VUSA 3UJ2A 1UUOA 1BFNA 5T9CE 1TWIA 3EX1A 1WCGA 3KHJA 2OZTA 4Y8EA 4R3UA 3FKRA 4Q4QA 3HMCA 3NQBA 2QYGA 4MZ1A 4LUJA 2GQ3A 1BG9A 4S23A 3VZYA 1F76A 4UTMA 2ANUA 3OP2A 3UWWA 4FIRA 3CC1A 3RLVA 1AQHA 4EWJA 4AG0A 4C5ZA 1K4HA 2Y4SA 1E0TA 1IEXA 1WKEA 4JTTA 3P74A 4EXQA 1E5JA 1QBAA 1E4IA 4GI4A 2XGBA 2XVKA 1BYDA 2WLZA 4HHHA 3RK8A 1GW9A 1Y7VA 1REQA 5C7VA 3O6AA 5A6BA 1GOKA 3OYXA 1VJZA 1G4SA 1PIFA 2HBXA 4OOZA 4WDXA 5CZKA 4AISA 5FF4A 2PDYA 4GIAA 3TJIA 3W7KA 4ZO6A 4RUBA 1SO5A 4AY7A 2DUAA 4HK6A 3NGFA 4A6GA 3W1AA 5EMUA 3IK2A 3MT1A 3WLPA 1JRBA 3W2UA 3AZSA 4KIRA 4F3HA 4Q8PA 5DEZA 3IV8A 3NUKA 3GX9A 4BQ3A 3RPDA 1O7AA 1TQXA 4XAGA 3VNLA 1QK0A 3NTYA 4LYPA 4PBGA 4YL2A 4DM1A 4PULA 1OCJA 6CGTA 1DQWA 3O0KA 2W61A 4UTIA 3RPMA 3APGA 4X2PA 3GTHA 3PTDA 1R2SA 3HQNA 3IJ7A 2Y7EA 5KZDA 3FGCA 1TTPA 2V68A 5HQMA 1O5XA 4NAEA 1AL8A 3TQKA 1EIXA 4L9YA 1I75A 3WF4A 2XVLA 3VDCA 4LT9A 3FK4A 2D0GA 3L66A 3L5MA 4QNEA 5AHLA 1QK2A 3TLQA 1QWGA 5AYYA 2PTWA 3F4VA 2FZ8A 1P0EA 4F0LA 2X1SA 4PCTA 4QSFA 5E0FA 5F4SA 5C9XA 2OG9A 3QHOA 1V6WA 3U4AA 3SCPA 1L6FA 3TQPA 4UC5A 4N9DA 1CGWA 1RP9A 2QCHA 3F5JA 3QH2A 3LBMA 1R3WA 1NQ6A 3W71A 3DU0A 1VBJA 2RJGA 1FDZA 1MZHA 3B3DA 3WH6A 3BZGA 1SW3A 3MCMA 4R7WA 1R86A 3H4WA 2ODOA 1XUZA 3PPFA 4UQAA 3V16A 3DG7A 4DPQA 4JTUA 2DDXA 3MC5A 1T5AA 4S3KA 4WDTA 7PTDA 3OTRA 5CC6A 4HJFA 5LIUX 2E77A 1HGYA 2XVPA 3A12A 1T96A 1QASA 1PX8A 4L6HA 1F6PA 2RFGA 5D4YA 4EPEC 4YWSA 5GJPA 3SN1A 3RLHA 4R9XA 4GG9A 4GIEA 2G3NA 2WXDM 2XUCA 2VGIA 2GGIA 5C9UA 3PS7A 4IQJA 3N4EA 1R2TA 1A5AA 1IE7C 1W8SA 3OG3A 5HQLA 3GVRA 4W7VA 1IF2A 2CYGA 1W5OA 3URNA 1M1BA 5EFDA 1OF6A 4IGHA 4MGGA 3TMQA 4DZHA 1QNSA 1VFUA 2ZUTA 4DHGA 3OB8A 2I16A 3AS2A 1RXOB 3E3HA 4JHMA 3O07A 2Q3RA 3OGVA 3SGGA 1SFSA 3HURA 1GKQA 4DUXA 1BD0A 1JZ5A 4LV4A 3UR2A 5IBXC 4BF7A 1OIMA 1UOZA 1QNPA 1XFBA 3L4ZA 1PDYA 3MKKA 1IXQA 1K03A 5DMLA 3LXCA 4TUFA 3WNNA 1MZRA 1BRLB 2XFFA 4S38A 3IUIA 1EGVA 1PKYA 4OUIA 5ECVA 3W73A 3CPRA 3OGSA 5C9RA 3GKAA 2CESA 4IX0A 3JS3A 3GNPA 4X0VA 3EXTA 1OCQA 4C1KA 1KBLA 2ZQ0A 1GOWA 2PODA 2XIOA 1PVNA 4PTDA 4C6PA 4IGNA 3FA4A 1AG1O 4AXKA 3DHDA 1W3HA 1YLVA 1I45A 5D2YA 2POTA 4NQ1A 1TG7A 2J7GA 4L4MA 4Y9NA 4DN1A 5JVLA 2YBVA 1ESWA 3M9YA 5DLCA 1X97A 4YU1A 1V03A 5E09A 3OPSA 4MLJA 1EEPA 1XGZA 3CPGA 5AHNA 3VOGA 4GBDA 3TUUA 3PWGA 2OZ3A 3G18A 2BHZA 2BWGA 4JFUA 1ECQA 1EYEA 3VMNA 1XSKA 1JZ8A 1HJVA 4ACZA 3C3NA 4NRSA 1T41A 1LJYA 4KRTA 2AAAA 3WJXA 3M0VA 2CZEA 3RO6A 5C7HA 3ARPA 3E6EA 3ZWSA 3MSGA 3B4YA 4MJ4A 4LALA 5H8PA 3GC2A 2XINA 5EKYA 1LRTA 3P3BA 3Q4DA 2B7QA 5HMDA 1KM1A 2GDVA 3AMKA 3QXBA 1BWVA 4NUWA 4JX6A 3V0TA 3RJXA 3ITLA 3GXPA 3IJDA 4N9CA 1LQAA 2NZLA 1OK4A 4FPSA 3B9AA 4IJBA 1DEDA 1UR9A 1TPUA 3WJWA 3RGTA 4D8ZA 3BGAA 2J24A 3DGRA 2R1NA 4N02A 1EEXA 2H3DA 3N11A 3MMWA 4Q22A 1JDEA 2QVNA 1UR0A 5AVNA 1DBTA 2GL5A 4ZR8A 3UP8A 4IP5A 5DCDA 3ALFA 5FD0A 2SFPA 3V36A 4GHRA 3R11A 2HPIA 4H9MA 1JQXA 2OEMA 2BGSA 1KXVA 3KHDA 3UVAA 5PTDA 4IG2B 3LZ3A 3P62A 1PWLA 1AA1B 3LHZA 2GJPA 2OOGA 2QCDA 3LHTA 3N13A 3VVGA 4YJ5A 4H7CA 3CZJA 3M64A 1ZGDA 1VQTA 1EO7A 1XINA 2B7PA 4MAZA 1G67A 5CPLA 4F2TA 3GAKA 1JPDX 2TSYA 2P3ZA 3E0VA 5IXEA 4QHRA 1PL9A 2ZFAA 3HN3A 3DAQA 1XG4A 4JCLA 1LOQA 1MW1A 1SZEA 3ZWTA 1YNPA 2VZVA 4A4AA 3MJMA 3B9OA 2RHGA 4HK7A 4XAPA 1A5KC 2PZ0A 3RMJA 1R85A 3I10A 1ZBCA 4E2DA 1P43A 4DNHA 4P5UA 4KWOA 4Y9AA 2CC0A 2QW5A 2YB1A 5H8MA 3VFCA 1TYGA 1JVNA 3BUVA 4CQCA 4LW7A 1H3GA 3A64A 2XIJA 3QHNA 5LIXX 4I5UA 3CIVA 4LUSB 3TJLA 4ZOBA 4MMWA 3TA9A 3BW3A 3U48A 3BCJA 5G4HC 1H7RA 3DC8A 2BXYA 1TCMA 1UROA 4QX4A 4FF7A 1VLIA 2OSYA 4GRSA 4X2RA 3VU2A 1W5NA 2PMQA 1VFMA 4NJKA 3BSGA 4TMCA 1UYQA 1M53A 1T8XA 2C15A 1SMDA 3IVTA 3L7RA 5D04C 3CLWA 4MY8A 1E9IA 1R5YA 2GGEA 3K1GA 3LRKA 4N0RA 2ZXBA 3CNYA 2V30A 3GE7A 5CC5A 2GQ9A 3NR0A 5D2VA 1UH4A 2FLIA 4UMBA 4J3VA 4FEZA 1KM6A 2CXEA 3L68A 4IP7A 2Y5SA 1PKLA 4NY2A 4Y8FA 3CL7A 4FXJA 3CB3A 2VCBA 1PAMA 1ADDA 3CH0A 3D0CA 4K3ZA 1AQFA 4W88A 2X16A 3F1QA 2VC6A 1EP2A 3GHRA 1RBAA 3WQ6A 4PODA 3N04A 3VABA 4O10A 3HGJA 3NWRA 5DY3A 2ABBA 4H01A 2HK0A 4LS1A 3GIQA 1PWMA 2NVAA 3VCRA 4HU8A 1CLXA 1DHPA 3JRKA 2BP1A 3WBWA 5ABEA 5CG0A 4C7GA 4Q6XA 3H53A 1R3SA 1ZLPA 4RE3A 2J7CA 4C6CA 5HANA 1GJWA 3GU2A 2ZICA 1XYBA 2WCSA 1G5AA 4CD4A 3F03K 1Q4NX 5G1TA 1VCFA 3ZR5A 4CVUA 2ATSA 1HKMA 3UZZA 1ZSXA 3VX0A 4I7WA 5HJLA 2DQWA 4FNPA 1AW2A 4NJGA 2VUNA 3P84A 1XI3A 2BVWA 3IEBA 3RCYA 2PWGA 4FNTA 3L2MA 2QQ6A 4KWUA 4A3RA 1QW7A 4Q6JA 4C5YA 4LTSA 3FYYA 1Q85A 4CQ8A 2G50A 3EWZA 1EPVA 3HOJA 3PBWA 5EBAA 3G8EA 1XBVA 1WXJA 3S1XA 3HPSA 5DRIA 5IFTA 1H61A 1TVPA 1OG0A 5CSRA 4DJFA 3IPWA 4PUKA 4Q3MA 1EA9C 1R3QA 3W6MA 4LANA 4BHYA 5ABTA 2EKCA 2F2HA 1KFEA 4J2MA 2WWDA 1M68A 1ZBVA 3WDHA 1VENA 1UA7A 3L2IA 1PZ0A 5GVJA 2TODA 2E5DA 1EJTC 4JTEA 3D3AA 5A6KA 4PFMA 3PBYA 4QAWA 2BNJA 2AKMA 3UJRA 4RPQA 4AD1A 2AL2B 1O5KA 4KERA 5M17A 2CBVA 3W1TA 4GO9A 3WJZA 2YCIX 4IQDA 3B04A 2WYSA 3NO5A 1U1JA 1DIDA 3P61A 1J10A 2GGHA 4RL3A 1H7OA 1HFBA 3URBA 4EPKA 3BC9A 1ENUA 5DMNA 1S3HA 2PC4A 4WD0A 1J0HA 2ZBTA 3XISA 1J6PA 4KFOA 2PAJA 3AWOA 2CCRA 4UBPC 3S47A 4PMUA 1FRBA 2J66A 4O0ZA 4DJDA 2XVNA 1JG9A 4JPGA 1LTDA 3NL6A 4MIMA 1KFCA 4O14A 1E51A 1V6YA 3W2MA 1XRFA 5M2FX 1MUWA 4XZLX 4O16A 4C6QA 5AYIA 3G0UA 1NOWA 1SW0A 3GLCA 4ZO9A 2Y7DA 1TQJA 2PU0A 2OSXA 3GDTA 3N6JA 4DZIA 2YYUA 3UGRA 3QF0A 3ITOA 4YTUA 3A3HA 2I1OA 3TN5A 2QIWA 5AC4A 2CHOA 2RKXA 3VD3A 5E9AA 2OELA 4M0XA 2OTDA 3VGBA 3GXIA 3STFA 4QG9A 3SUWA 4Q8QA 2WM0A 4QLKA 4PMYA 1FP9A 1UR4A 3GY1A 4AD0A 2XFRA 3UD6A 2JE8A 4EIVA 3H55A 2QUMA 2XH4A 2AGTA 1MXSA 3C2FA 1L8PA 3CZGA 3KBJA 1KBJA 3QLDA 2BBFA 3KXQA 4Z2GA 4ONVA 1CTNA 3IJ8A 2YDSA 1Z9AA 3ZIZA 3W3OA 5AC8A 2Z25A 3SFWA 1YDVA 1E1EA 4GFSA 4HZMA 4KCVA 1J5TA 4NILA 5AYXA 4Z1YA 1PZ3A 5A69A 1GTEA 1B3OA 3EOOA 1TV2A 1S1RA 5C5YA 2PP0A 3GXDA 4WOQA 4XKYB 2WLYA 1JI1A 3O9NA 5D2XA 1D3GA 3VKAA 3GU9A 3WH8A 1UBPC 5CG7A 3T0CA 3UA3A 2F38A 1FWBC 1JYXA 1SR9A 3W7DA 4GNVA 1TPVA 4N6FA 3TP4A 4GZIA 3PSVA 1SJBA 3BVJA 3N4AA 5I24A 4XTDA 2D2JA 2B4GA 3L4UA 4HNCA 1WZMA 2ZC1A 1MO0A 4AH7A 4JS3A 5AHMA 3V1HA 3FX4A 2DW7A 4H6EA 4PUMA 4CCCA 1YADA 3BJSA 3FFSA 4LS2A 3MCNA 4LYRA 2QJMA 3GHUA 2J79A 4UB9A 2PDQA 2AQVA 2V5BA 4L80A 5I7GA 2Y5JA 2O9RA 4B5UA 3TV8A 3EXSA 1WA3A 1DJWA 3C2RA 3RXZA 4PE8A 2WMHA 4A29A 4BS0A 1ODZA 5T8GA 2OMAA 1KQYA 1EPXA 3GDMA 3PZUA 3ABZA 3PWAA 3DHFA 4EXBA 3WUEA 3TMLA 3MI2A 3ABOA 4ROQA 1DWFM 4WGXA 1TV7A 3MMTA 4HHLA 1IT7A 2CW6A 2PDHA 2WCGA 2GVGA 1WBHA 2IKGA 4RLIA 4J35A 1RH9A 3TW6A 2PDJA 2A7RA 1AZ2A 5FJOA 3OVQA 1S38A 4B5XA 3EPNA 5DO8A 1E56A 4XO6A 3FAWA 5KETA 2E5BA 3EA3A 4GUFA 4FALA 4Q8VA 2V3GA 3GFXA 3BGGA 3LHWA 4BA0A 2O9TA 4JQ4A 4S3JA 1KRCC 4QAIA 4R7OA 2EPKX 1RP8A 2X42A 4UZSA 3OJGA 3SCVA 1REQB 1EZ2A 3B05A 4JTQA 1Z7AA 3WQDA 5L9FA 1ADSA 3G1HA 2GJXA 1QXLA 3QZAA 1H62A 1KD0A 4DYEA 2X7WA 2HCVA 3SZ8A 3HIJA 4QFUA 1W2PA 2FMOA 3DH7A 3ARUA 2P88A 4X61A 4YIWA 4P8VA 3LCIA 4RNFA 1EBHA 4CQDA 1H60A 4I7UA 3LMZA 4FAMA 1FFQA 1MQRA 2NV9A 1CLKA 4ENLA 3VE7A 2DU2A 3SRHA 3UJSA 1LOLA 4UNIA 1XKYA 5J5RA 2WVUA 4O19A 3SEPA 5C6MA 2RGLA 1AH0A 2VZSA 1HKVA 2QCGA 1ISZA 4WSJA 1FY6A 3PNUA 3AYTA 4DXKA 3KOZA 3SGUA 1FWNA 1BF6A 2D2OA 3TX9A 3QPEA 4F40A 2J7BA 1VS1A 3CWOX 5DMYA 3NQGA 2E9LA 2ZWZA 4MDOA 3M16A 5A8OA 2INFA 3WD2A 4B5WA 1VF8A 2PB1A 1OADA 2FVKA 3MTWA 1VPYA 4XB3A 1LDCA 4NAEB 4E8CA 4KF1A 1X38A 3AYRA 3RFAA 3AJXA 3C5QA 4IMEA 3VIFA 1NOFA 3W4RA 1JCNA 1UIOA 3MV11 1E0WA 4UFJA 4WQ6A 4XVEA 1A4LA 3MCOA 1TA3A 1W1ZA 4MJZA 3KDOA 1Q6RA 1FCQA 5A6SA 3WK3A 2H8ZA 3EOLA 2KAUC 2NX3A 1TX2A 2HBVA 3ZFHA 3MYPA 5EY5A 2RH9A 3K4WA 1TREA 8XIAA 3WQ4A 3CYJA 1CT5A 3CZ8A 4MNLA 2ACUA 4MKNA 4NZCA 3VZXA 2J27A 3UGVA 2ISSA 4H6KA 3CK5A 4ICNA 4OWGA 3VOJA 2YBUA 2WC4A 4FR1A 4CEXC 1NM9A 4JTKA 3P8JA 5EB8A 3H2FA 3WK1A 4H9ZA 3KOWA 1OSEA 3RR1A 1T99A 1WZAA 2GK1B 2FPYA 1OCBA 5EBUA 1MMFA 1SU5A 3G8RA 2A6NA 1IT0A 1H49A 4IFKA 4MZ8A 3BO9A 2QDGA 1OX4A 3DHUA 2NW0A 3M7SA 1TMHA 4QITA 4CCZA 1KCXA 1XLIA 4KCWA 1WP6A 2F8QA 2E40A 4S3BA 2FIQA 1F6KA 4GCAA 3JUGA 2BZNA 1PTDA 2QCLA 1A5LC 4E5TA 4GNJA 1Q2SA 4Z08A 1TWDA 3BG5A 3MZ2A 3Q58A 2NUWA 2UV8G 1SZRA 5G2HA 1P0NA 1FH8A 2WVSA 1OF8A 3FDGA 2YCLA 3IVUA 2EGZA 1W6TA 3S4TA 2PDWA 5A94A 4GXMA 4BWLA 4HNOA 2DJXA 2Q8ZA 3N19B 2C3ZA 5DCBA 1TFVA 2WBKA 5DRCA 2Y89A 2J78A 1BGGA 1OFOA 1U5JA 2Q01A 4JTGA 2PDLA 3SY5A 3WJSA 2CLMA 1O5RA 3AIEA 2XFYA 2VTFA 3GVVA 3SJ3A 4M1BA 1W8GA 1JF5A 2BGQA 2E9MA 1MUMA 2EG6A 3LLFA 1A3HA 2ISVA 3VMOA 3VKCA 2QEZA 5J04A 4RDYA 4ZMGA 3V7PA 5EMKA 4D6IA 2ZTKA 5K7JA 1AVAA 3EA1A 1MRAA 4A3UA 3QN3A 4LBSA 3KAOA 1PTAA 4AZHA 3WQ8A 3K8KA 2DSUA 3R12A 1E1CA 1JJKA 2V5JA 1RSCA 4YVXA 2W5FA 3LX9A 4DO4A 4RV3A 3MUY1 2Q09A 2A0NA 1UKQA 3UT0A 4L4LA 4LOCA 4DF1A 3E1F1 3AHTA 4Q7IA 4FP1A 3FSTA 5KZEA 3VD7A 4E4UA 4DZAA 3USBA 3PUGA 1EQCA 4U2ZA 2JGQA 3N3TA 4ACZB 3VTRA 3ELFA 1G7UA 4JTFA 4GWEA 4HCHA 4ORMA 1QW8A 4U2YA 2V5DA 3ZT6A 2VR5A 3NZ1A 4DVOA 4AZIA 1KA9F 1EL3A 1S39A 3NO3A 4C6KA 4W8AA 4ML9A 4CNTA 4IT1A 2X2GA 4LVAA 4JIPA 3AUOA 1EDTA 1I60A 3G77A 2YFNA 4CN1A 3GUGA 3W1MA 2H3BA 3L4WA 2G4FA 3M5VA 2WKLA 5TQLA 2IKHA 3GXTA 2G3JA 4ATDA 2FJKA 3I7QA 5E93A 2ZZ5A 3WQGA 2DFAA 1K6AA 3L4YA 2QKFA 4WIWA 4K36A 1OT1A 3M0HA 1V77A 4P7OA 5A8NA 2XYLA 3OOQA 4JQ2A 4KGJA 1O95A 2D73A 2ZUWA 3DYOA 3LMYA 3B0YA 1DYSA 2WWCA 4PSRA 4LAMA 4L6OA 3WH7A 3S5SA 4E4PA 3NYZA 3GW3A 4IIFA 2YYTA 2CLOA 1XXXA 3H54A 4IQEA 3P8IA 2OQLA 5HWJA 4HSHA 3G1AA 3DERA 1B9BA 3UZXA 4UR7A 4TVDA 1JCXA 2P10A 4D2JA 2WAGA 5F2GA 3NQDA 3MO7A 4UUIA 1BVNP 4GBUA 1CENA 3EWUA 3H6OA 4WX2A 2CLIA 3KBNA 3M0KA 3CMFA 3FHAA 3TTEA 4JYDA 2QCDB 2WQPA 3NPXA 4GUIA 3BL3A 3SCWA 3WDQA 1BKSA 4OE7A 2JEQA 4OUEA 1EC7A 5HNNA 3H7UA 5A6LA 3C0JA 3S1UA 1WDDA 3CUZA 1GK8A 1DJHA 3MP3A 3MYOA 3OGRA 3W7GA 4ADSA 4RNIA 2CLKA 3K5XA 3MKVA 3R6IA 1P4CA 4JKLA 2XM1A 1ZALA 1DJXA 2EBNA 2OQYA 3M0LA 4W7UA 2V5CA 3GH4A 1UQZA 3ZLGA 1RA5A 1UASA 3EMCA 4GFIA 2NVCA 2FHBA 1B90A 1R3TA 1XQLA 1NY1A 3OZPA 3EEGA 3JW7A 3L0KA 3BXWA 2GQ8A 3VDAA 5F4WA 1VHNA 1V6XA 4HP5A 3UPBA 1THFD 1V3KA 1A0CA 2VFDA 3PZMA 3KL5A 5HJXA 4OIFA 3O05A 2I14A 3THQA 3ARRA 4JHOA 4LWWA 1Z6KA 2X7VA 3DFNA 3MDUA 1NU5A 1XIDA 4BI7A 2NUYA 2BVYA 4HU0A 3ZM8A 3V5CA 3YPIA 3KBWA 4GQGA 2D3LA 3LGGA 4NIRA 3HV9A 1GZGA 3B40A 4REQA 2Z00A 3BAXA 1Z42A 1FWEC 3UEQA 1MQQA 5FL0A 4HHMA 4HYWA 3WJYA 3MU7A 4DAFA 5XIMA 1GOQA 1XH0A 3EAUA 1PB0A 3H21A 4TXEA 2AMXA 4MF4A 1OG6A 1XD1A 4GACA 3UQNA 1NARA 2O4QA 3NZQA 3CQJA 5IRPA 1WDQA 4AX7A 4Q4RA 4IOTA 1VH7A 2VNCA 2Z1KA 3AYSA 2W9MA 3NL2A 3H2MA 3R43A 2EPMX 5JH1A 1X6LA 2OPJA 1VGAA 4KKXA 4D71A 3SQSA 2XTKA 4RZBA 3UNTA 3WF1A 4H2HA 4G5DA 1KM3A 1M9HA 1SR0A 4WXYA 3HA1A 3LLXA 1F73A 5A6JA 5DELA 3IJIA 1P7TB 1B30A 1NJJA 2Y7GA 4EF8A 4JTRA 4E4FA 4DLFA 3UWZA 3EWXA 3MANA 3DBNA 2VDHA 1JFHA 1Q6FA 2D22A 5E9XA 2QMJA 4PH6A 1VYSX 1A5UA 4KWWA 5FAGA 1GGOA 3QV7A 2VXNA 4AZ6A 1QVBA 3HPAA 1FWIC 4Z42C 2J6VA 4OQVA 5C9WA 3PULA 3KP0A 5I3IA 3T2PA 4DF0A 4AAJA 1J18A 1C8QA 1PKNA 4BJHA 5A6BD 3OYZA 4KWVA 4ASTA 3WBYA 1WOBA 3OEXA 3B0VC 1XC6A 2Y7FA 5BXTA 5HUOA 2C8NA 3LTYA 1QDSA 1EJWC 2J6XA 3CZEA 4MADA 3E2VA 2CLHA 1JZ2A 4HPJA 4QS5A 3BW2A 1KC7A 4R7JA 1XC4A 3AXMA 5FI8A 3GTIA 4GLEA 1B9ZA 3EPMA 3KLLA 1LUCB 2I57A 5FF3A 4XQ6A 2WQDA 1DIOA 4GZJA 3RIKA 1KFLA 1M3UA 3LY0A 5HMEA 3USZA 3TN3A 4IXHA 1QT1A 1WDRA 4X22A 3FVMA 3SADA 1EWDA 3ABQA 2WO5A 4QJ5B 1K70A 4GXPA 4ATLA 5I79A 1S3TC 3UERA 2JKEA 5BNKA 3IUDA 2VFEA 3WH5A 1VYPX 1ITQA 1FWWA 3VD4A 3CQHA 4R53A 3F5LA 7TIMA 3TLLA 2HZGA 3UF9A 2A85A 2I5IA 3ABXA 3O0FA 1Y8BA 5I3FA 1IR2A 4ALDA 4K68A 4AD4A 3AMCA 3UCQA 1QRQA 4WSHA 2VENA 1VFLA 1W37A 4MWAE 3QYQA 1JD7A 3VIHA 4IISA 1TPEA 3MJYA 3IVSA 3LPOA 3WDPP 4LRTA 4AHPA 4MNKA 3FJNA 4U10A 2WANA 4GX9A 3NVDA 4NYYA 4KRZA 3WF3A 3IJ6A 2V3FA 3HF3A 1ML1A 3VCNA 5I2UA 4PZVA 3FXGA 2QDEA 1XIMA 4MOZA 2W66A 4D8LA 5K9XA 1ZS2A 1H7NA 3GG7A 2Y1HA 2PRHA 4W7WA 4O1EA 4JFTA 3RU6A 3BJTA 4QJ4B 1XUUA 5FEPA 5AHEA 3UG3A 3GR8A 4RXGA 3MBDA 3PVFA 1A4MA 3WLOA 1LT8A 1LM1A 1J0JA 3B97A 3TC7A 1XIGA 5FAJA 3WQCA 1GVSA 3PUDA 1S2CA 2ZX6A 1VIWA 2XWEA 1VEPA 4NZ5A 5I3KA 4FI4A 5A1AA 1M65A 3ARSA 4EOUA 4M19A 4UTWA 4JTJA 3ECQA 1TV8A 4H8UA 1C9DA 2HVOA 2YPIA 2RAGA 1UCWA 3TA6A 1V3MA 1G4TA 2ISFA 1JYWA 5CZTA 1C7SA 3ZJ8A 4IL2A 3BLIA 3CMJA 4EX4A 4L61A 1VD6A 1D3CA 3ARQA 3PK7A 4HOXA 3PTMA 4AMCA 1G4PA 2O7QA 1JAEA 2VC9A 3ARTA 4PSPA 2VEPA 3FSUA 4M29A 1R47A 2ACQA 3OA3A 3WQVA 4GGBA 3LRLA 2C0AA 4ZFMA 1JYVA 3OVPA 4M7SA 4J7RA 5DF0A 3LNMA 4HB7A 1WAUA 4JNZA 4N7QA 5AC5A 4Z1DA 2FTWA 4I90A 4NXKA 1OIFA 4UQCA 5H2ZA 1TR1A 3A47A 2IPFA 1P6WA 1WOAA 3CWHA 4MY9A 2QAFA 3W74A 4J40A 1RV8A 3WF0A 1EOKA 2BOEX 3N2OA 4UFIA 4M1RA 3QQ1A 1RLDA 5CJ5A 2GQAA 1GCYA 4H8VA 1AMYA 3FVDA 3LA4A 5CPQA 4IMGA 3MZNA 2Y88A 1NP2A 4HD5A 1XD0A 5TIMA 4PCNA 1M7OA 1DKWA 2PTDA 4EPBC 1C29A 4HMEA 4JIIX 4O0QA 1RA0A 2IW0A 1X6UA 4KEVA 4NHVA 3CM4A 3C2YA 3L21A 1KRMA 1HJWA 4P7QA 1HNYA 2V2HA 4DF2A 2WPBA 4GUGA 5B7ZA 4DB7A 3W1QA 1DJYA 1QU4A 5F7UA 1EZWA 3DFPA 2EG8A 3OU8A 3LTSA 4JQAA 3E38A 1IXOA 3CUIA 2NT0A 4HA4A 1OJXA 5JH2A 3N12A 2A3AA 1TVNA 1XYFA 3CV7A 3IIPA 3C8NA 4OBRA 5F1UA 4DJFC 1XLGA 1R3RA 1SVDA 2UZ9A 4Z0JA 1XYZA 1KCZA 3W7LA 3LN3A 3I3EA 3CO8A 4GYPA 3AIQA 2WK2A 2YW3A 3VNDA 2A79A 3OIHA 2E67A 4E2BA 3EDDA 1EH9A 2O7SA 4GNKB 4ZO8A 4BEUA 1CGUA 5I78A 1DJQA 1HN1A 1QAPA 4H83A 2HNHA 1J93A 4NZFA 5FSEC 1T8QA 4EAMA 1G7VA 1RJQA 1EJ7L 2VT0A 3O1NA 1W2VA 4JGDA 4LAOA 3FXYA 4TMBA 1XLAA 2O9PA 4CUCA 1TB3A 3IS4A 3HPZA 1UWRA 4TVCA 4B5VA 3GNXA 2NX9A 3SDOA 2PLKA 4XG1A 3TYEA 4K8HA 1GKPA 3BSMA 5I3DA 1SQ7A 1LORA 4Q7BA 4W5UA 3KLKA 4NU7A 3CHVA 5BXSA 1FWAC 4DJDC 1DWIM 3R2GA 3ANYA 4AIBA 1HTIA 1W9BM 1MWOA 4FNSA 3SM0A 1E4MM 3EMZA 4ZENA 5HR6A 3UESA 1CXKA 3JZEA 3G0XA 4OU1A 4TO8A 1K77A 2VRJA 3TDFA 5K2ZA 1TA3B 1YBQB 3IIXA 3N3MA 4FLSA 3VX1A 2PCQA 3KRZA 4JY8A 2PDXA 8RUCA 1E72M 4PBEA 3AXHA 4UZUA 3Q94A 3T9PA 4ZQMA 2DVUA 3W37A 1R3VA 1U22A 1I9CB 3ZVIA 3WNMA 1DORA 3UXIA 3VIJA 3LEPA 4GGHA 3GUWA 1D9EA 3ORWA 2D24A 1M01A 3W2NA 4US6A 5D30A 2TMDA 3ITGA 5CBIA 4DJEA 3CWNA 3RCMA 1E6QM 4UQDA 1MW3A 4M6QA 3INPA 2OCZA 2WSYA 1J5SA 1QNOA 1UC5A 4Z2KA 5A6MA 1JRCA 4ZE5A 2DQXA 1UD3A 2GJRA 4DBUA 1WDPA 4WRHA 1B4EA 5LGXA 1JULA 4TTUA 3KCJA 3P5YA 3VIIA 1SZFA 5DBUA 5HPCA 1P0DA 1OX4B 1XH2A 4GK8A 4LAZA 3TQ0A 1EF3A 1V6TA 4XUYA 2W92A 2VURA 1U1HA 2Z2AA 2YKKA 1O1HA 5BCAA 3WDRA 3B8IA 1KGXA 4DXXA 2V3DA 4M6VA 3QV8A 4MPKA 3CLMA 4H9XA 3PJXA 2A1YA 4I8DA 3IRSA 1CBGA 2YCLB 2VEFA 1UR3M 2D23A 1GZJA 1SUXA 4XV0A 2E68A 1Q6OA 3DIPA 3T0TA 2I5GA 3GYCA 2QPSA 2IKJA 3AWNA 1VRXA 6TIMA 2HJPA 3ZSTA 1CXEA 5A6TC 1LLZA 2XISA 3JR2A 1VC4A 1XIJA 2MNRA 4PFHA 4Q33A 4CQ9A 3PHAA 1JNEA 3RU8X 1LLOA 1P48A 3WLSA 2JALA 4FX7A 5FA5A 4CNOA 1QO2A 4IG2A 4DI8A 2JK2A 1GUVA 1UH2A 3G6MA 2ZX9A 1XLMA 2QIIA 3IJ9A 2H6RA 1W31A 4MFDA 1TPFA 1AJZA 3B9EA 4EXAA 4RPPA 3WO8A 3RILA 1IEQA 1WKDA 4PUUA 4YHGA 5FJTA 2CIPA 3U2OA 1EX1A 2J7HA 4AWEA 2I56A 2WBGA 1V6UA 3NPUA 2JFEX 4WJEA 3T0BA 3AC0A 3VIMA 4OHQA 3W83A 2OO6A 4PCSA 2F6XA 1ICPA 2WHKA 1PEZA 1E1CB 4R85A 5LNSA 4NRRA 5LHEA 2VD9A 5KITA 1V5XA 2XZ7A 1XBYA 4A8RA 4L4PA 1FDYA 4I5XA 4UR8A 4DJFD 4Z2JA 1L2UA 4F66A 1NWSA 3HB9A 4EE9A 4FA3A 3L4XA 3E12A 1X98A 3BLEA 2INEA 3TR2A 1XCWA 3LUTA 3VC6A 4UR9A 4LUSA 2BG5A 5D03A 1B31A 1U1UA 3U9IA 3HG4A 3W22A 4L9ZA 5HNUA 3WD1A 2PWUA 1BKHA 2B0MA 3FAXA 4J3ZA 5LIYX 4ZB0A 1F8IA 4HPNA 3EEZA 5H6HA 3OBAA 3M47A 5HA7A 3WKZA 1XQKA 2QCFA 4IPNB 5CZ0A 4I9JA 4MB1A 4MYAA 1W0MA 3OBKA 5F1VA 1UD2A 2DZVA 3UZWA 2HXUA 2V82A 4NZ3A 2R1PA 1MEWA 3VDBA 3SRDA 3R58A 4BQ2A 4V27A 3MHFA 2VR2A 1CXHA 3NCOA 5CAKA 2BMBA 3L0NA 2IUZA 1BYCA 1QBBA 1Q6LA 1TSIA 3ITVA 3B0XA 1IWPA 3TW9A 2DT2A 1YQ2A 4ZTXA 1U5HA 4K7YA 1JUEA 3OBEA 3WL0A 3R8RA 3LTPA 3QV6A 4IJCA 4IICA 3UY8A 1EJUC 3DGBA 5B7YA 1YNYA 4DJDD 1V3IA 3GR4A 4JNYA 3S1VA 4O54A 2W62A 3W75A 4KEMA 3GH7A 4RDZA 4HA0A 3E2SA 1X1NA 2CWNA 1GQJA 2J47A 4PYSA 5AVHA 1OB0A 5TAOA 2XH0A 4XZMX 1K02A 2W4XA 2HWGA 1V0LA 2Q8XA 1YPFA 4DLMA 4Y2WA 3T0AA 1F74A 5IM51 5BU6A 2Q6ZA 4WKFA 1F6YA 3MS8A 1B1YA 4N4PA 2QVHA 5CPSA 1YHTA 4HTBA 3BLLA 3PTKA 1S2UA 3J7HA 5G4EA 5EA9A 3VDGA 3STPA 4IIDA 2QS8A 3U57A 1TELA 1JCJA 3WN6A 1J6OA 1H7WA 3U8GA 4A3YA 4DWSA 3NQ6A 1V7AA 1ISXA 3SCOA 3B9NA 4LXFA 3EA2A 3HO8A 5G1YA 4B4FA 4ICMA 4JDBA 3UG5A 1FCVA 2CETA 3VNMA 1FH7A 3VGDA 3LQGA 3SJNA 1BTCA 3U5UA 4AFYA 4PEKA 2C18A 3W82A 1QOPA 3CHFA 4IZGA 1ME7A 5GQBA 2WZTA 3LYEA 1XWYA 5FL1A 2ZRXA 4PB4A 3E49A 4ERGA 3WD4A 1XX1A 2BX7A 1GG1A 3GDBA 3V1PA 2G3FA 1OBAA 2B31A 4M6UA 3WLJA 1Q6EA 2BLEA 2OU4A 2JEPA 9XIMA 4FR6A 5T9BG 2JKPA 4F9DA 2R1KA 5KEZA 1Z89A 5DMMA 1UZDA 3S8HA 3B8DA 4QXIA 3ISIX 1EIBA 2JQXA 3SAZA 1OFQA 2DZWA 2YL9A 3I3BA 1CNVA 4PL1A 3AMGA 1TVLA 1FWHC 2YB4A 3CHDA 4BF9A 2P0IA 2QR6A 3KX6A 3FEQA 4REQB 1R9YA 5FEWA 4AIEA 4XD4A 3RX4A 1Z8AA 3MP4A 1RY8A 5IDZA 1Q8AA 3QMTA 1ECEA 1WXZA 3EXRA 4AQLA 2HXTA 2ZADA 5FJJA 1QNRA 4BWLC 4LF2A 3N9KA 4HU4A 5KMYA 4CVWA 1EDQA 2PTZA 4WJ8A 7ODCA 1QWKA 4QNWA 4LPCA 1XLBA 3W23A 4J1OA 1GWJA 3TTQA 1OWQA 4S2BA 4PMNA 4BQ5A 3L5LA 1AJ2A 1H63A 4DBWA 5HOSA 1K9DA 3NDZA 1PKMA 3GHSA 3G1SA 4AZ7A 1WDWA 4PMOA 1T40A 5CBJA 2AAMA 4MKSA 2MANA 2BODX 4OBSA 1V4YA 3KUMA 3AS3A 5CKSA 1DXIA 6A3HA 2ATMA 2ZIDA 1TMLA 1JDFA 3BDKA 3TXVA 4KEZA 1J11A 3SY8A 3DUGA 1PHQA 1MW2A 4D6JA 3NQ8A 3TZFA 2FFCA 3MWAA 2J62A 3NVTA 1B57A 1Z48A 3G1DA 2Q3OA 4S2CA 2GGGA 1W54A 2R91A 3VXGA 4JL2A 2B81A 2DVTA 2QNEA 1A50A 3GNRA 4HA3A 4AWSA 3NQFA 1K9TA 2Z4GA 3LDVA 5A2CA 3L5AA 1WYIA 4MLRA 3PJTA 4FIQA 1FVPA 4D1JA 1JCLA 8XIMA 3W6LA 4CNSA 5AZ0A 4GINA 3BMXA 4PA8A 3ZR4A 4QJ3B 3W25A 2F7FA 4L65A 3GDRA 3EOEA 2V8ZA 3BTNA 3EDEA 1MNSA 3W7IA 1TPDA 1I4NA 3NJ3A 1ZU8A 3WZ0E 4E8GA 3M5YA 3C0SA 3ZSSA 1J79A 3TOPA 4L56A 4N42A 3PR2A 4LBRA 5J8LA 1A5NC 4I6KA 3QBUA 1BXBA 3EBVA 1R9ZA 4MUZA 5AKQA 4OOUA 3GTNA 2W6RA 1R30A 3W28A 4YTRA 3UVIA 3P5ZA 1UPMB 4NI8A 2A3LA 1J0YA 1K8ZA 4PUWA 1NH6A 2YA2A 2HDJA 4FNQA 1NWRA 1SO3A 3B0PA 1W9PA 2ZUVA 1NFBA 1G9HA 3O15A 4WSKA 5D9OA 3DFSA 4UTJA 3EWWA 5ABFA 3N2MA 4ZOCA 3H26A 1UWIA 4EVZA 4IGMA 1P1MA 2QMKA 3CHCA 1PSCA 2R94A 1WBJA 3I7RA 2X05A 4IF2A 2I7GA 3VMPA 4PTVA 4S3DA 3UXKA 1AD4A 1H2JA 1GVOA 2PI6A 2GVJA 3ATYA 3H4XA 3UZYA 4UQ9A 4OT7A 1SO6A 2Y2WA 3BLPX 3M4HA 4W8LA 2VC7A 3ZR6A 1Q6CA 3HV8A 2XIQA 5DANA 1WDSA 1YEYA 3U7BA 3MI6A 1Z32X 3BG3A 2H8XA 3OVGA 4XK2A 1BTMA 1P0KA 2DV0A 3FYPA 3QR0A 3SBFA 3FIGA 2O4MA 3Q2DA 2A7PA 2WKGA 3GHTA 3GDKA 3GVQA 3DC0A 1F2JA 3WQEA 2XN1A 5HAOA 5DXYA 1H1ZA 4CD6A 1W9DM 1A5MC 2XHYA 3PP7A 4B3LA 4OJYA 1YPXA 2QJHA 4K2SA 4B5NA 1TJ1A 1HJSA 2VX5A 1EJXC 2WV8A 5BMWA 3UWQA 2PDPA 1OY0A 3B8UA 1VFHA 5H91A 1EDGA 3I65A 3A9IA 1R38A 3WDIA 1LL4A 3H4GA 3M0YA 3PM6A 5I0DA 2CKRA 4ZGYA 1ADOA 4DEFA 2J8GA 4B15A 1KFBA 1R8LA 3A13A 1M03A 3TYAA 4RDVA 3WLIA 1AH3A 3SQLA 5FESA 1XLCA 3VDHA 1FOBA 4UQBA 2ZE3A 2A3HA 5CLWA 4GH1A 2P5NA 2RDUA 3C86A 1OZQA 3TNBA 1GYMA 1GNXA 4UTKA 5I6SA 4WDUA 4NNAA 1YX1A 4HZ7A 1RCXB 3WLNA 4A35A 1CGXA 3NZGA 2UBPC 1FCBA 1RY0A 4TV6A 2POZA 3T4WA 3WNOA 3WBXA 3VOHA 4M5PA 1XLHA 3DXIA 4UTLA 3G2GA 3CT7A 3UZ5A 1SMAA 1EXBA 2UY3A 3EDFA 4QQUA 3V18A 1QHPA 1JDDA 2OX1A 5T91A 4NKCA 2Y0FA 4RNHA 4RZ4A 5JU6A 3WFLA 2A4AA 2P53A 3PAJA 2NXGA 5KTLA 1XLJA 2D2HA 4DYJA 2DY3A 3RRAA 3OQ8A 4M8UA 5CC7A 1XG3A 4QIUA 2DSWA 1HUVA 3W6YA 4DNMA 5IHRA 4NG3A 1CXFA 2C71A 2XSXA 1XRVA 5F2MA 4W85A 3U5YA 2NXIA 3STCA 3KRSA 4AMAA 5DN1A 3H23A 1QI4A 4GC4A 3W53A 1XIHA 2CHNA 5LA2A 2X41A 4Q32A 1IIHA 1JQVA 2WMGA 2X1IA 4H9UA 4YS1A 1TPB1 5BXRA 2EG7A 3WLHA 3AS1A 4W93A 3IIOA 1IGSA 1ITUA 4PMVA 5CGTA 2JGYA 3WNLA 3A4AA 1F3EA 1ICQA 3M5ZA 2IQTA 4BKNA 2ZZ3A 3C61A 2PUZA 2CZDA 2V2CA 2ZTJA 2V0TA 2HTMA 1NDZA 3PSWA 3PPHA 3HM7A 2GK1A 4UFMA 4GVGA 1OFRA 2V3EA 3WUBA 2WSRA 1VP5A 4DZ5A 2B7OA 2BY1A 4YXGA 3W07A 2XJ7A 2YXGA 3BE7A 5D02A 1ZFJA 4YYCA 2BHUA 1KRBC 4ERAA 3VGGA 4M7TA 2Z2UA 1OX5A 1A5CA 1O66A 2F2KA 3LCFA 4UOJA 4UTTA 4LJ3A 1X1ZA 3B03A 2ZZ4A 3M0XA 3BOLA 2OWCA 1EHAA 3BAKA 2G4JA 1Q6GA 1XISA 1GYNA 3ZJKA 1W3KA 2A7NA 3RO8A 3B9DA 4K39A 4WKHA 1LZOA 8TIMA 4IPPA 5HJYA 4J3WA 4W9TA 4S3AA 7ENLA 3TTOA 1PYFA 3GH5A 3RYSA 3K8LA 3EWCA 2BDQA 3L67A 2VWSA 3HQPA 1OD0A 2GVYA 3W1XA 3WUFA 2P3EA 3BAJA 4ZB5A 2X0SA 4YYFA 2DZPA 1FWFC 3QY6A 4GY7A 4E6MA 2WNNA 3CUGA 1ZRQA 3KWSA 1V3LA 3LM3A 3R5EA 1RUSA 1PCWA 4AEFA 2O92A 3TROA 5HATA 3G3DA 4UMCA 3LENA 3DFQA 3UR5A 4Z1AA 3CL6A 2CBJA 5HMFA 3T42A 1XGEA 4ZCWA 1TX0A 2CZFA 3HTWA 4WUIA 4YCOA 3LM7A 1OFPA 2R24A 3CL8A 3P81A 5BU9A 3A5VA 2GSEA 1JZ4A 5FJRA 4GMEA 1XYAA 2C6QA 3DOPA 1LRQA 1JXJA 3GZAA 1K6WA 1FA2A 4KIEA 1WXYA 1MRQA 1OGSA 1CIUA 4RCXA 4L1XA 4H1ZA 1ZUAX 3VIOA 1HZYA 2J9XA 2KZHA 3SY1A 2GJNA 5JIPA 3CQKA 1DJNA 2QZRA 4E8DA 3VGFA 1PPIA 1XLLA 3VKBA 2BVTA 1PDZA 1G6CA 2QF7A 2GLKA 3R94A 1SJAA 1AD1A 4I5RA 3H12A 1NDVA 2PC8A 3I68A 3WQFA 4UTWC 4JTIA 3UPMA 4GE8A 3NXLA 2FHCA 1CW2A 5D8ZA 3C4UA 1FTXA 4NVTA 1F7BA 4QDWA 4QLJA 3R10A 3QTGA 4A22A 3BWWA 1V08A 2EHHA 3MMUA 3WD3A 1XS2A 4PC8A 5AHIA 4QTGA 3AHVA 1FWTA 1WZKA 3IIZA 3S5NA 2VVNA 4ZODA 4MY1A 3ZJ6A 3W01A 2PRMA 3LZ5A 1OD8A 4XD5A 6ALDA 4AWTA 4HHPA 1MXGA 3E0IA 1BG4A 3BLDA 2YLAA 4OV9A 4PL2A 5BWFA 1J01A 4FZIA 2EPOA 4J5NA 4IIHA 3M0MA 3APYA 3PFMA 2C1IA 4LSBA 2IQ0A 5E0KA 4AYSA 3ERPA 4XIAA 3QTPA 3LPFA 6REQB 2ZX8A 3UU0A 5C8BB 2IKIA 3GNNA 5AB3A 1DJIA 1JEZA 3DHPA 1EKOA 4JTAA 1WAWA 5D37A 3PBMA 1HG3A 1UWSA 5JXQA 3O16A 3TN6A 1FKXA 3ITXA 1M7XA 2PGFA 1FX6A 3W70A 3P2VA 2O56A 3NAVA 3CAWA 3VI2A 1I2OA 4E2OA 4QEHA 3P0WA 1CYGA 1JXKA 1LG1A 3MUZ1 4KCUA 3FJ6A 3P0XA 4O15A 4J3SA 1XPGA 1X7FA 4U3CA 2ZCGA 4DY1A 5EFFA 3TVAA 3L23A 5XINA 1US0A 1W3LA 1CZ1A 1GQIA 3QGKC 4WKAA 3N4FA 1JL8A 2XN2A 3BJFA 3C2VA 1ODUA 2V9DA 5FOOA 2ON3A 3CTLA 3AU6A 1UQYA 1CB2A 4KRUA 3T2OA 3HPXA 4BCEA 3P82A 4U3AA 3MMDA 3E5PA 4PMXA 4JFSA 3PBGA 3UNDA 4K8GA 3KWXA 3F5KA 3XIMA 3CAKA 1TIWA 1UR8A 1KRAC 3PZ9A 5JUVA 3UW6A 3UWYA 1K7EA 4FX6M 3L4TA 3ONCA 1UC4A 3KVLA 2NV2A 2HPMA 1HX0A 2V2DA 1XDLA 1GEHA 1O60A 3LNPA 3SSJA 4NF7A 4GYPC 4TOQA 3ENLA 3SSZA 5AY7A 1DOSA 4UWMA 2ZRVA 3REQB 3THDA 4N6EA 1W1VA 4G7EB 3CV6A 4IIBA 1W3JA 4K7VA 1ITCA 2DZTA 5DBTA 4QEEA 1DVJA 2ZYFA 4HVXA 1N8WA 3WEMA 1E6NA 1YE4A 3W7CA 4IUGA 3WEOA 4QR6A 3HGSA 4IMAA 5I3JA 4JEJA 2ZZ2A 2D1ZA 2Y5EA 1RHCA 3AQUA 2ZE0A 2D69A 2Y8VA 1IGWA 1GOXA 3C6CA 2YIHA 4GQQA 5AYBA 2NQ5A 3W1RA 3VD9A 2F6KA 2EEXA 2Z1VA 5BRBA 1FHLA 5BZAA 4JN7A 4CNPA 3RNDA 4Q4PA 1HL2A 2PWVA 1CWYA 3K8MA 3KW3A 1TV3A 1W3NA 3W0KA 4AC1X 1FXQA 1LWJA 2YA0A 4FLQA 3BAWA 2ZWYA 1TWZA 4Z1BA 2G37A 4DELA 2X0HA 4LYKA 4CD8A 4I8YA 1P7TA 3A3WA 1LP6A 4H7VA 5HXMA 2INZA 4AF0A 4ICCX 2I5QA 1KM4A 1VJSA 3TYDA 1Y0EA 1W1PA 1XLEA 2GGJA 3H8AA 4A2SA 3THUA 1H0IA 1HO1A 4M56A 1D8WA 3KVJA 3SB0A 1EA0A 4R33A 1TZ9A 3AU2A 6PTDA 4AB4A 1L2QA 1WKYA 1A0EA 4DWSB 1V02E 3NO1A 2C7FA 4ECLA 1ZJAA 4NT0A 2NVDA 3MHUA 3NM1A 1KV8A 3R8HA 3E02A 2IPGA 4MAVA 3WK2A 1UR1A 4XZWA 3QMRA 1BVZA 3MHGA 1LF1A 3S2NA 3WNKA 5LGZA 4DJEC 3G1FA 4JIEA 5CZJA 1GVYA 4XKMA 4PMQA 1D2KA 4F0RA 1C3FA 3NZPA 5D09A 1V51A 3AYVA 4UNKA 1TTQA 1QPRA 4CCEA 1EJSC 2J7FA 3N6QA 3S9YA 4MSSA 1TZZA 4E2VA 4YPJA 2PBOA 3BMVA 2Y8KA 1LUCA 5CPOA 2A3CA 4US5A 4FOKA 4MNJA 4TTGA 2Z27A 4V2XA 4ZQNA 2Y61A 4PMDA 4DIAA 1M6JA 1IV8A 5BRPA 1US3A 1XYLA 1UKTA 3GXNA 3PUEA 4KFPA 2OYLA 1QPOA 1HKJA 3C2EA 2ALRA 4RK8A 2EJ1A 1J96A 3UWEA 4NL1A 3S9IA 2G8ZA 4CN6A 3HPFA 4JFVA 3GD6A 3BARA 1OC7A 4BQ4A 4FK9A 1DXFA 4P8UA 3N9SA 5BOEA 3GNOA 3NQCA 3HGRA 1QNVA 4RX0A 5C70A 1EHNA 1RD6A 1FWRA 2VOMA 3SR7A 7REQA 3ARZA 3ARVA 3POHA 4E3VA 1H41A 5A6AA 4LEFA 1KKOA 4TX9A 4ZQPA 2HRWA 2R8WA 3MVIA 2WOQA 3DI0A 4EWND 4GCXA 3EX2A 2V5LA 4RR4A 3AALA 4XBKA 3AHYA 2P50A 3QR1A 4LY8A 2QUTA 2FZDA 4M80A 4XBJA 8CGTA 2PDGA 3NQVA 3W1LA 2CLPA 5F2IA 3VIPA 5BWAA 3QYSA 2Z6JA 3L0GA 4JTLA 5G5IA 4XAFA 2Y62A 1W5PA 1RLCL 4LUYA 2FDMA 2Y8UA 4CEUC 1MEIA 2DZSA 1OFDA 1L8NA 2ZXAA 2W3ZA 1T7LA 5D2WA 4GKLA 5K4XA 4O53A 3GVWA 5BYWA 1UWQA 4MDPA 3TYBA 2QAPA 4EKJA 2Q8LA 4A2RA 1A5OC 4PB3A 4J3TA 4O57A 2VI0A 2IS7A 4E38A 2CNCA 4B90A 3SRFA 3VINA 1TWSA 3CIWA 2OFJA 1FBAA 1FKWA 3ANUA 1VRDA 2E1DA 5AOUA 1SM9A 3OIXA 1QPQA 3PAOA 1P6BA 1FHVA 1KXQA