1O5XA

Plasmodium falciparum tim complexed to 2-phosphoglycerate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Plasmodium falciparum Triose-phosphate Isomerase-2-Phosphoglycerate Complex at 1.1-A Resolution
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1o5xA00
5EKYA 3RFAA 5F2LA 3DFQA 3NQ6A 5HQEA 1LOSA 4MZ8A 3MI3A 2J88A 5AYYA 2QR6A 3N73A 1OFBA 1P0KA 1KM4A 1T8XA 3LCFA 4YCPA 3MP3A 4FIQA 1ICQA 3B05A 3W83A 4O11A 1TCDA 3PULA 5DXYA 4AWSA 3L0NA 3EWXA 2FB2A 3FJ6A 1M5WA 3UD6A 1XBXA 3CLMA 1FXQA 4UR7A 3T44A 3DH7A 4Z08A 2RKXA 3FKKA 4BWLC 4CCEA 4EOUA 2A5HA 2WSYA 4Z1AA 1W0MA 1JCMP 3NPUA 1O95A 1S5VA 4ADTA 4CNPA 4HNUA 2VEKA 2BWGA 2QUUA 3WJXA 1OFQA 2GPTA 4JTGA 3G8EA 5LHFA 5LNWA 2J24A 1TPH1 1VHCA 3HQ1A 1L6WA 4NZJA 3GR7A 4HNTA 2R14A 2ZTJA 4POCA 5FF4A 4LVFA 5CKSA 3EX4A 3PVFA 1A50A 3G0XA 4IMFA 3QMSA 3MHFA 4JNMA 4TIMA 1YXCA 1OJXA 4JYDA 3BG9A 4UFLA 1GTHA 1K7FA 3DKJA 4K7VA 4I7WA 3JR2A 1LROA 3EWWA 4HIBA 4JS3A 4PFMA 4Z1CA 1R47A 2NXIA 1G6CA 1T99A 4N6EA 4JTIA 1KFKA 1RVGA 5G2WA 5CGQA 3TW7A 1T0OA 4NZFA 3L5LA 3F4NA 2B0MA 4WOQA 4O18A 3DXIA 5AB3A 2H3DA 4JEQA 3N14A 4MLJA 3NVTA 5FF7A 3TSBA 2X2GA 3QQ1A 2GVGA 4UFKA 1F05A 3NM3A 2WO5A 5C2XA 4C1LA 4WX2A 4EF8A 1HO4A 3MWAA 4Q4KA 5AHNA 3CQ0A 3UWQA 1EEPA 3FOKA 1QAPA 1H5YA 5BMWA 2OT0A 2DZWA 4O53A 2YYUA 4Y96A 5DBTA 3EXRA 2YW3A 3EWYA 4NUWA 1X7FA 4MIMA 3QRHA 4UNKA 3CTLA 3G3DA 2GVLA 1GYLA 2WNNA 3VKJA 2VFHA 3M0ZA 2E5DA 4JD4A 1AW1A 4ALDA 2I1OA 3C2FA 3IVTA 4OT7A 1OFPA 4A21A 1TPWA 4PEKA 4UTKA 5F1VA 1KLZA 2XN1A 4XWUA 2CZ5A 4Z1DA 1UUMA 1VCFA 1OK4A 5LHEA 3DFNA 5D05A 4AWUA 3KAOA 1H1YA 3P7YA 1G4TA 4UUIA 1KM0A 3QYQA 2I14A 3H54A 2VFGA 3P61A 4MZYA 3DENA 4E0CA 5D32A 3TW6A 4ML9A 2ZA1A 3M5YA 3C8FA 4S2CA 5DXXA 5CPLA 3GZ3A 1Z44A 3WK1A 2YR1A 5IBXA 3C3NA 4RR4A 1RQBA 2FFCA 1G4EA 3DHDA 4O1CA 5FF2A 1ZAIA 3HPSA 5U7SA 1VCGA 3O07A 3V75A 2QCDA 4K8HA 1Q45A 3V1PA 3MHGA 2VKZG 3C4UA 4BFAA 3SY5A 1SO6A 3TQKA 1D3GA 1L2UA 3LB0A 4LC6A 1JCNA 1SZGA 4LV4A 2QCEA 1VLIA 3P67A 5D02A 3Q2DA 2NV2A 1XDMA 1JRBA 3PUEA 3MJYA 4MJZA 1BWLA 1ZCOA 1OF8A 1KFLA 3VI2A 5L9FA 1BEUA 1AL8A 1YADA 4FNQA 3OIXA 5D33A 4LS2A 3W2KA 1KFEA 4ZQNA 4U28A 4XBSA 1W56A 3NPXA 3MYOA 3ZWTA 4AH7A 4GJ1A 1FX6A 3MBFA 2FIQA 1EP2A 1FUYA 2FLIA 2V8ZA 2X1SA 4AXKA 2NX1A 4EVZA 3G1XA 2Q8ZA 5AHIA 3MI6A 3KVJA 1HTIA 1N55A 1EWEA 4QSHA 1Z41A 4P2VA 4UMAA 4JTLA 4FNSA 4QITA 1KLYA 4IX0A 3T4CA 2F84A 4AMAA 1P5BA 3A23A 3UWVA 3PC0A 2P1FA 2WKJA 1TV8A 3CIWA 3A9IA 1AW5A 2JKPA 2CZFA 3HPZA 1DBTA 3JRKA 1W37A 5HUOA 3ABQA 3USBA 3T40A 3TFXA 1YTKA 3U6WA 2H6RA 3TUUA 1J5TA 5F4XA 4AVFA 3AO0A 4LVGA 2VFFA 2EHHA 3OVPA 4N4PA 5FEXA 3W88A 4AHQA 3B0VC 3LBMA 3C0JA 2O7SA 4W9TA 3PB2A 1XL9A 3W7NA 3G1DA 4O4WA 1NEYA 3L67A 4XQ6A 5EA9A 1JQVA 2X1RA 1Q6OA 3LTYA 3R13A 2A7NA 1O4UA 4LS0A 4DEFA 1QPRA 4WXYA 2Y85A 1FCQA 3M5XA 1K3UA 3PG8A 4R53A 2PCQA 3TIMA 5H91A 3DFTA 1GVSA 3NNTA 3WK0A 3T55A 4TMBA 2ZZ2A 3ABOA 4LVAA 1QOPA 2C14A 3M5VA 1GYNA 4M7SA 1IXQA 3CHVA 3QC3A 3HOJA 3G1VA 2DZTA 3PSVA 2FDSA 4S1FA 1W5MA 4XZ9A 1FXPA 4ZMGA 1GJPA 1PS9A 3W22A 3UY8A 5I3GA 1SW3A 1WV2A 1RR2A 5TIMA 5HULA 2HS8A 3M44A 3N19B 1XBZA 2C3ZA 1W5OA 2ZYFA 2QCGA 3EKZA 2E6FA 1VS1A 4IXHA 1JVNA 1CX9A 3N2MA 3NZRA 4ZZ9A 4OV4A 3C6CA 1IF2A 3RLVA 1CW2A 1KBJA 3LTPA 3D0CA 2WPBA 2DZSA 2ZZ3A 4N6FA 2PRHA 4QJ1A 3QSRA 2QCCA 2V2HA 3E96A 4GUIA 2FPTA 4LU0A 2VFIA 1TQJA 3LRKA 2GQAA 4Z0JA 5AC7A 2CLIA 3EWUA 5KITA 2GUUA 3QW3A 3A22A 1JQXA 1MO0A 4IX2A 2E1DA 4FX6M 2ZFAA 2VEIA 3LLDA 3MYPA 4LT9A 2ISWA 3HPXA 1PCKA 4KFNA 3O63A 3W72A 4CQ9A 4N9DA 1EA0A 4IMDA 4S2BA 3NQAA 1E51A 5CZSA 2QKFA 3NQ2A 1LRQA 1W5NA 1B3OA 3EB2A 2BXVA 4H3DA 4XTDA 4MOZA 5G1TA 3WJYA 3TE9A 4O28A 3S5OA 3NQMA 1A5CA 4N2YA 4O14A 3ATZA 1W8SA 3M47A 2OJPA 1LTDA 2NXHA 2ZA3A 2YYTA 5KTLA 3U2OA 1DL3A 4K36A 3PS7A 1GVQA 2RDTA 4XKYA 4ADSA 4OU1A 4IXXA 3TCEA 4YL2A 2E68A 3LCIA 1ME9A 4M5PA 3GXPA 5SWUA 4NJJA 3W7IA 3DAQA 1VZWA 1ME8A 1NF0A 5KINA 4FNRA 1JRCA 1MSSA 4LWWA 1DQWA 4D2JA 3O6CA 2Y7DA 2OZ0A 1TTJA 3W7LA 3TX9A 4KWVA 1C9DA 4NT0A 1UCWA 4KKXA 3P8JA 4BF9A 3PBVA 1PIIA 4JIQA 4ADUA 2J27A 3W74A 3DI1A 4WQ6A 1G67A 3MO7A 4AWTA 2NWRA 5E93A 3HF3A 3Q94A 3F4WA 3M16A 5GVJA 5H2ZA 5AC6A 2QJGA 1GPWA 2UV8G 3G1HA 3P84A 5EYWA 3GNNA 3NQGA 2QUTA 1AG1O 2X30A 1W1ZA 2ALDA 4NQ1A 5BW6A 3ABSA 4QM1A 4Y90A 4HNVA 2RDUA 3QH2A 2V30A 4DELA 3MP5A 3PR2A 3W7DA 3CWNA 1KM2A 3UZ5A 5LGXA 1Z48A 4JIPA 3PUOA 2ATMA 3IGSA 1GG1A 5LNVA 1FWRA 3BGGA 4LW7A 4JXCA 3UY7A 4LRSA 3GKFA 1A53A 1LLWA 4JICA 3UWYA 6TIMA 4A22A 3HGJA 4JX4A 1OFRA 2QAFA 3TSDA 3GK0A 3ABRA 3QMTA 3W23A 7TIMA 4UTTC 1ONRA 4PA8A 5C54A 3UPWA 1S3HA 4MY1A 8TIMA 3L68A 3E02A 1OG0A 4ZQRA 4R7JA 3B8DA 3M6YA 2YX0A 5CPMA 4UFHA 2DZVA 2A2IA 3W2UA 3L5AA 4HPXA 2DZXA 1RQEA 1YYAA 3LI1A 5AHLA 1PV8A 1U5JA 3QFEA 3NL5A 2QCNA 3GAKA 4FXRA 4RZ4A 1YLVA 2B4GA 3CPRA 1XUZA 1SW7A 5BRBA 1DJQA 2R91A 2HTMA 3KX6A 2TSYA 1K02A 3EKLA 3HG2A 3N2XA 4QNEA 5HWMA 1F5ZA 1LOQA 4N9BA 3W1NA 1FDZA 1K03A 5EMUA 2DP3A 4YLWA 4GUFA 4M6PA 4XBKA 1THFD 1VJIA 3HO8A 4OGZA 2V9DA 2A1YA 2C13A 2V0TA 3R12A 3W86A 2BZNA 2ZRZA 3LBCA 3IIZA 2QCMA 3FS2A 4RJEA 3O06A 3O6YX 3N9SA 3HIJA 3IIXA 1HO1A 5K4XA 5K4ZA 1WDWA 3LOTA 4JTFA 3DHFA 3DGRA 1N7KA 5U4NA 4YMZA 3W3OA 1G4SA 3G22A 1XXXA 5C6MA 3F03K 4IWWA 3P81A 4PODA 2GOUA 3IRDA 3Q58A 4BWLA 5D04C 1LRTA 3BW4A 2V81A 3GR8A 1QNVA 1TPVA 4LUIA 1JCJA 1ZAHA 1WOAA 4GC4A 2CLFA 1H1ZA 2A21A 3S9YA 5F4WA 1VLWA 3BW2A 2VEMA 2J9YA 5HUPA 3UXDA 2ZRVA 3PB0A 1H7WA 4GNJA 2Y7GA 5D2YA 4WZHA 1QFEA 2E6DA 3LTSA 4HNNA 1W5QA 2DZPA 2CU0A 5FI8A 5A8GA 3GDMA 3NXFA 2ZZ6A 2QCFA 5DCEA 3TH6A 1R2SA 5EPDA 1SPQA 3L0KA 3LCXA 3YPIA 5I3FA 1OX4A 3G1YA 4AHOA 1DVJA 4GE8A 3BLIA 3S5YA 3STCA 4NU7A 3W7HA 3TSMA 1EB3A 1MEWA 1JCLA 3O05A 4ZQCA 1VYPX 2A7PA 4LVBA 4MFDA 4RKAA 1M6JA 2GJLA 2ISVA 1OFOA 3RF9A 1L6YA 2C16A 4RX0A 4UFIA 4WY0F 5J5RA 1OFDA 3FFSA 3NL3A 4BI6A 4XKYB 1WBHA 3BLEA 5AYZA 4UTUA 1B4EA 4RXFA 3GLCA 5E0KA 2QAPA 3H55A 3Q37A 1WYIA 2ZZ1A 2V5LA 1RPXA 3B4UA 1TPDA 3A5VA 4UIOA 5BNKA 3NR0A 4FEZA 2EKCA 1F7BA 1NAL1 3P5YA 5LZLA 3O8AA 2NUWA 1H62A 4MUZA 3HGOA 1RQHA 5MHBA 1PHWA 1QOQA 2PE4A 4RZ5A 1R46A 2YCEA 5D37A 4KWWA 3OA3A 1WOBA 4IMEA 3NPVA 3S8HA 4M7TA 4UTWA 3PWAA 4FX7A 5CSSA 5ABTA 1Q6LA 2F7FA 1FDJA 3DBPA 1W3NA 3NL6A 4J9JA 1Z42A 3B03A 1AL7A 4OV9A 3BLFA 1KBIA 1W54A 3EEGA 1VC4A 3LCWA 1SUXA 4JTSA 2Z2UA 4FF7A 1B57A 3W1RA 3CWOX 3W84A 3TJLA 2I9EA 3W1XA 1MEIA 4BI5A 2G96A 1ML1A 1SQ7A 4XTIA 2DJXA 3TMQA 1H7NA 3TROA 3NOEA 2BTMA 2WNZA 1YXYA 3HG3A 1YTEA 3NG3A 2CWNA 1J2WA 1OVDA 4Y8FA 4FIRA 2V2CA 2C15A 4CQ8A 3BGJA 1SFJA 4MY9A 2CZDA 2RHGA 4IMCA 2BLEA 5G2HA 4A2SA 5F2GA 3LRMA 1H51A 4OE7A 3IVSA 3U8GA 1QWGA 1WX0A 3B0PA 3LHYA 3KRUA 5CSRA 3GXNA 1XM3A 1TRIA 3UNDA 1NSJA 5F2IA 1JULA 3W7GA 4FX8A 3R8RA 4GRSA 2YPIA 3C2EA 3KVMA 3FYOA 2YSWA 3NQEA 3UYCA 4X2RA 1XI3A 4JTKA 3A21A 2FPVA 2R94A 3WJZA 3S5NA 4DO4A 1YPIA 3A5FA 3NQVA 2E09A 2E6YA 5DBUA 4A2RA 3A24A 4K38A 4HT3A 3I7QA 4K39A 1KTNA 5KZMA 5TQLA 3VNDA 5EL1A 4DF2A 3W76A 4P61A 2NUYA 2VELA 3WFAA 1ICSA 4A3UA 3E12A 3AJXA 4NJHA 3SZ8A 4O57A 4HN4A 1WAUA 3S6DA 3L9CA 2Y7EA 5HINA 4WY0B 1LOLA 1SO5A 2Y62A 2GVJA 1W31A 1D3HA 3UWZA 4O0KA 2FTPA 2ZZ7A 3S42A 3H53A 3O1NA 5DN1A 3L65A 3LHZA 2QJIA 3SSJA 3BPWA 1KV8A 4MPQA 3PF3A 1JR1A 4MVAA 4NNAA 3DFSA 4UTJA 4JY9A 4MYAA 4I7VA 3BVJA 4JYEA 3W7PA 1DKWA 1PE1A 2CLKA 4GBUA 3N3MA 3I65A 4PC8A 1H7RA 2JKAA 4PCFA 2CLMA 5FEWA 1K7EA 3PM6A 3FYPA 3ATYA 3G1SA 3JS3A 1VYRA 2XN0A 1XFBA 4Y6GA 3EX6A 2QF7A 3OEXA 3W7RA 3RMJA 1NFBA 5EBUA 4FNPA 2J9XA 4GUGA 1I8JA 1TPC1 2TYSA 1DHPA 3NL2A 4PL1A 4M6VA 5DELA 1PCWA 2AGKA 4UNLA 3TJXA 3ZWSA 1TPFA 1X1OA 5AOUA 4HHPA 2BSLA 3N34A 3W6YA 1KM3A 1TV7A 3LV6A 1HFBA 4K6AA 1QDSA 3KFTA 1AMKA 4LC8A 3QZEA 4Q33A 1SO4A 2VOMA 4QIUA 1QPOA 4CLMA 1FCVA 5G4WA 1VHNA 3FJLA 4UCGA 1ZY9A 2E5CA 2EAWA 4OWGA 1O5KA 4IPJA 2ZA2A 4WOZA 3SFKA 1VGAA 4O19A 3MUXA 4AF0A 1OYAA 4IJBA 3M1ZA 3GKAA 4BI7A 4C1KA 4CCCA 5DCDA 1YTDA 1C8VA 4LUJA 3BG3A 5CZTA 1H7PA 4O13A 4HKPA 3PBWA 2OX1A 4ZQOA 4DPQA 3PBYA 1QPQA 3LI0A 3CT7A 4FXSA 1LDCA 1ZJIA 3EX2A 3I6RA 3BV4A 1A5AA 3W73A 5BMXA 3CU2A 4X3ZA 1KM6A 4N02A 2WNQA 1G69A 1UUOA 3C2RA 3LXCA 2J6XA 3MW7A 2WOQA 1NVMA 3W7QA 3EX3A 2CFFA 1ZFJA 1XC4A 4LOCA 3TDFA 3ZS4A 6ALDA 1G4PA 1PVNA 3MI2A 1Y0EA 2VEPA 2NLIA 4JX6A 5I3HA 4Q32A 4OQVA 2ZZ5A 4UMBA 3I68A 4LTSA 3UWWA 3NEVA 3P82A 1EWDA 4HSNA 3W87A 4UXDA 3W1LA 4IOTA 4KFOA 1GVOA 5TBOA 4NX0A 5DY3A 1PL9A 2ZCGA 2Y6ZA 2C6QA 2C18A 1TIMA 3KRZA 2E5BA 3LXBA 3TAKA 2Q3OA 5LNRA 2NWSA 1H7OA 3SGUA 3QW4B 5FEPA 3T7VA 2OCZA 2DZUA 3INPA 1TPUA 1QMLA 1WBJA 2XN2A 3FKRA 2NUXA 1XUUA 4X22A 4I9AA 4OBTA 1RD5A 3M9YA 3NQ8A 2P10A 2OT1A 3DKLA 3G1AA 5LNUA 2B7QA 1XKYA 4O1DA 2JK2A 3GAYA 1F2JA 5E1QA 2H8XA 3W85A 2B7PA 1EIXA 4RCXA 3HGRA 3TKFA 3LHWA 3KOFA 4NNCA 3W07A 1MEHA 3RK8A 3W71A 4U4MA 4FHAA 4DPPA 2CLHA 4TX9A 5D2TA 2W6RA 3LCGA 1YXDA 4DQWA 1TPEA 2ABAA 4EF9A 1SO3A 3GDKA 3HJZA 5LKYA 3KRSA 2Z1BA 4UTWC 1H7XA 1IIHA 1EP1A 4AHPA 3EX1A 2FJKA 5HR7A 1A5SA 1OYCA 5IBXC 4B5NA 1GZGA 1QCWA 4I7UA 4MYXA 3L66A 3IGXA 5K3VA 2WSQA 3W9ZA 4UTHA 3B06A 1UASA 5LGZA 1TRDA 1CI1A 1S5WA 3LCLA 1ZAJA 2FB3A 2GQ9A 2P0OA 3KXQA 1OX5A 3TQ0A 1OFEA 5AYXA 3UQNA 3TQVA 1HL2A 1QR7A 4ICNA 2TRSA 3SIZA 2H8ZA 1OK6A 3LLFA 3MHUA 1G7UA 3L2IA 2G95A 5LNSA 1GEQA 3GB6A 4AB4A 4QAIA 5K2ZA 1JCXA 1SFLA 3UWUA 3W2LA 4FNUA 2H3BA 4RXGA 2YXGA 1K7XA 1SSDA 4ZL1A 2V2DA 4H4IA 1TYGA 4QQ3A 3GNDA 1OHLA 4PH6A 4TMCA 4LNYA 1TTPA 3G3MA 1AW2A 4HSOA 5G2IA 4ORMA 4MJMA 1V5XA 1Q3NA 4CNNA 1K8ZA 5KMYA 1VYSX 2EGZA 4JDBA 3T78A 1FWTA 5BOOA 1EUNA 1KV5A 2HMCA 3RLUA 4RV8A 2A85A 3P5ZA 1LP6A 1GTEA 2RH9A 4LY8A 4AF0B 3BK0A 3QSTA 4DF0A 4DBEA 4DXVA 5HR6A 3FIGA 3PAJA 1IXOA 1UB3A 3DU0A 4MFEA 1F76A 1TTQA 3HG4A 2IQTA 2GQ8A 4MKNA 2Z6IA 2ZBTA 4O10A 1SR9A 1M7PA 3LX9A 4GXMA 4CNOA 3BW3A 4LS1A 4O54A 4JR5A 4UTIA 3WJWA 3LERA 2VENA 1NF7A 1VQTA 2Q3RA 1XBVA 5CZJA 2Y63A 4WJEA 3VCRA 4E38A 4EIVA 4AEOA 1TREA 5AHMA 2NX9A 1JCYA 2H90A 4NX5A 3L5MA 4MY8A 3ZFHA 2JKEA 1PHQA 3P62A 1GVFA 4R33A 5C55A 3C61A 3NQ7A 3HG5A 4NJKA 3EXTA 1S5TA 2VC6A 5KZDA 1ADOA 5I3KA 3W2MA 2ABBA 2QEZA 2V82A 3TC7A 5CZ0A 3NZ1A 1KM5A 1YDOA 1ALDA 1I4NA 3BG5A 5DY2A 4ORIA 1I2QA 3B0UX 2DJLA 2DORA 4GUHA 3G18A 5CG7A 3SR7A 3P60A 2CZEA 1K8XA 3W7KA 5HMSA 3DZ1A 4MLRA 5AHEA 4UMCA 3TA6A 1FBAA 3CEUA 4IMGA 4HPJA 1QO2A 2G5WA 2C1HA 2WSRA 4NXKA 1OABA 3QQ0A 4WY0A 4EWND 1UBSA 4N9EA 4QISA 3K30A 3W1TA 3GDLA 1KTBA 5FEZA 3RNDA 3TR2A 1F6PA 2LLEA 3OVQA 5F1UA 3UXAA 5AFDA 3PG9A 4M6QA 3EWZA 1SZEA 1EX5A 4IUOA 3W1UA 3W1QA 5IM51 1X1ZA 3IVUA 1TO3A 4WXZA 4N4QA 3TK7A 2NZLA 3OG3A 2VFDA 5K9XA 1X6UA 2QCDB 3STEA 1SU5A 2W0UA 1QPNA 1UJPA 4RZ6A 5I3IA 3NA8A 3NO5A 3HBLA 5FF0A 5DCBA 1ICPA 2C19A 1ZHAA 2A6NA 3TFCA 3ANYA 4NVTA 1LBFA 1FCBA 4JX5A 1FWSA 3F1QA 2O7QA 2X1TA 4K8EA 3W1MA 3GXTA 5HWJA 1OYBA 1LRNA 3HGSA 3W1PA 2HS6A 1KFBA 1V7YA 3TMLA 5D2WA 4L4LA 3DFPA 1OFAA 2A0NA 3LHTA 4K37A 4BR1A 1GG0A 3W70A 4JDYA 4FB7A 1GVRA 3P80A 2QDHA 1IXPA 1SW0A 2A6LA 4RLIA 2QCLA 5AN7A 2J9ZA 5J5DA 3W2JA 3L0GA 2Y88A 3QJAA 2NX3A 4L4MA 1TQXA 3CIXA 1XCFA 2R8WA 3R2GA 3E49A 3LGEA 2Z0IA 4JTUA 3O6DA 2ISSA 1HUVA 3W7JA 1P0NA 3NDOA 2VFEA 3LXAA 1I2RA 2FPYA 1TSIA 1DOSA 1X8FA 2B7NA 3IGUA 5HWNA 2KZHA 5D38A 4UR8A 4NJIA 1DJNA 2NXGA 4UFMA 1O5XA 1TMHA 4O52A 3BO9A 3IIVA 3VFLA 1DORA 3PUDA 3S1VA 2Y70A 3OVRA 5G1YA 3LCHA 3IIPA 3SW6A 1OX6A 1KA9F 1ZNNA 2ZRYA 2AQWA 2JGYA 2QUVA 3ZR4A 1FWNA 1R2RA 1YPFA 3GIYA 4YCOA 4XUGA 1KFJA 1P4CA 5D2VA 2YDAA 4GUJA 3QMRA 1LCOA 5F4SA 5FESA 2PRMA 5KSWA 1TJRA 2FQIA 1D9EA 4PTNA 1L9WA 4DO5A 3C52A 2TPSA 3TC6A 1DV7A 4Y9AA 3LDVA 3VE9A 1KW1A 3THAA 1W5PA 2B7OA 3IEBA 3FA5A 1FY6A 2OMAA 1I2PA 4IGHA 3C56A 2ZTKA 4N9CA 3I7SA 2ZDRA 4UTTA 1MXSA 4JN6A 2ZRWA 3E0IA 3LRLA 2Y61A 3HMJG 3OBKA 1R30A 2JBMA 1SSGA 2YW4A 3M5ZA 1FQ0A 2HSAA 3QEZA 3LHUA 2E6AA 5D09A 1FCUA 1P1XA 1IXNA 3LV5A 1WA3A 1K8YA 4X9SA 3CC1A 2G97A 3BARA 3DFOA 5CPNA 2JGQA 3M43A 2CLOA 3IIOA 2WQPA 1VR6A 3G0SA 3UZJA 3O16A 4M19A 3N9RA 4TU1A 2NV1A 3GDTA 1J4EA 5AC8A 1RZMA 2PRLA 4KFPA 3SI9A 3SGZA 3NQDA 1EPXA 4R34A 2D73A 3MP4A 1KM1A 1I45A 1GOXA 1L6SA 3VE7A 1F74A 2C0AA 2PC4A 1IGSA 3PY2A 4UTLA 3WK2A 1RV8A 2WJZA 5K9CA 3WK3A 3QPYA 4ONVA 4RK8A 4O15A 4O0ZA 1VH7A 1VRDA 3RU6A 2X1UA 4NJGA 3P8IA 2QCHA 2A7RA 1EUAA 2TMDA 1LBLA 1SZNA 1XBYA 3FEMA 2PURA 5KZEA 3PBUA 1TB3A 4Z0SA 5HNRA 4TR9A 3B04A 1H61A 3FLUA 3M7WA 4O1AA 4PL2A 1LZOA 1F73A 4IPIA 1VCVA 2RFGA 3QF0A 4LRTA 1C29A 5EY5A 3KHJA 5DLCA 3W7CA 1OF6A 3I7RA 1XDLA 4LV9A 4CCDA 2BX7A 1VPXA 1KTCA 1A5BA 1BTMA 1ZENA 2CW6A 5HJLA 3S1UA 5F2MA 1TTIA 5K7JA 4LVDA 3GYEA 4UC5A 3GVGA 5LSMA 4DO6A 4O12A 1JUBA 1JUKA 3STFA 3EXSA 3UPBA 1EP3A 5K9DA 2YFOA 1TPB1 2VXNA 4K7YA 2Z6JA 5D30A 2AAMA 3CM4A 1OX4B 3E9AA 3S1XA 3NPWA 4YWIA 3CEPA 2A4AA 2YGYA 5A5WA 4ZQPA 1Q6RA 3TXZA 3LHVA 4NXSA 4QNWA 1M7OA 4WD0A 1YDNA 3O15A 3SECA 4A29A 5I3JA 3WJSA 3DI0A 3W7EA 2ZRXA 3KVKA 3NGJA 1N8FA 1G7VA 4FNTA 3R89A 4BK9A 3S0CA 3G0UA 4G1KA 2XFWA 3TNOA 1KFCA 3QPZA 2CLLA 3OHIA 4O16A 4AAJA 4OHQA 1WXJA 1LM1A 1O94A 4O4VA 4ZQMA 1FWWA 5FF3A 3C2VA 3S5ZA 1Q6QA 3NQFA 1SZFA 5C5YA 2EPHA 1O60A 3QM3A 1GT8A 1AK5A 2ZZ4A 2Y89A 4TO8A 2DU2A 1TV5A 3SJ3A 1LBMA 2WV8A 3P74A 1W3IA 1B4KA 1YDVA 4JTHA 3MMTA 1WQ5A 3NAVA 5AHFA 4ZVJA 2QJHA 3NQCA 4JTTA 3R5EA 1H50A 1ZALA 3W7OA 1JUEA 3GDRA 4MZ1A 3LM7A 1ME7A 2ATSA 1GQNA 1GWJA 2RDWA 4IQLA 4JTEA 4UFJA 2V5BA 4DBDA 4GWEA 4O50A 5D2XA 1H60A 3GX9A 4E2BA 4JYFA 1U83A 4GFSA 5G5IA 1LLZA 1I2OA 1MZHA 3G24A 4CQAA 2Q8LA 4NNBA 2ZRUA 2YFNA 1LORA 1QO5A 1JJKA 2E77A 4O17A 2W79A 3NM1A 1I2NA 3PSWA 4H6KA 3STGA 1TJPA 3HB9A 3THQA 2EF9A 5L6UA 5D03A 1IIGA 4WUIA 3TXVA 3MBDA 1W3TA 3W7MA 4FO4A 3G1FA 2Y7FA 4JY8A 1B9BA 5T26A 3TU9A 3W75A 4DF1A 3C2OA 3IV3A 2QDGA 3L21A 3M41A 1R2TA 3NYZA 1FDYA 3G8RA 4UTMA 4YXGA 1T96A 1HG3A 2ZQ0A 3KVLA 3ELFA 4O8RA 4Z1BA 3TAOA 2CLEA 5G4EA 4E2DA 3W2NA 1BKSA 3CB8A 3W1AA 1H63A 2YZRA 1F6KA 3S1WA 3EWBX 1LYXA 1DQXA 4O1BA 4JTJA 5CPOA 2GJNA 1BWKA 2X16A 3TV8A 4JGDA
chains in the Genus database with same CATH superfamily
5A8QA 1MW1A 1LOSA 4MZ8A 3VUSA 2J88A 2GOKA 2CKSA 2QR6A 1OFBA 3R1ZA 2J8TA 3NEHA 3WEZA 3R8GA 2V5DA 3UF9A 4KRUA 1ICQA 5I78A 5DXYA 1PYFA 2QULA 1TKKA 1XBXA 1EEXA 1JEZA 2RKXA 4LYKA 4BWLC 2XIMA 4Z1AA 1W0MA 4DZAA 1O95A 4A35A 4GI8A 3N2BA 4JNYA 2JQXA 3EDFA 3OTRA 3AI0A 4ZTYA 1TWZA 5LNWA 2J24A 4GIAA 1IEIA 1M7XA 4NZJA 3GR7A 1C92A 2O9PA 5FF4A 1YIXA 3VD3A 4ZOEA 5FL1A 1BYDA 5ABHA 2Q71A 4NZ3A 3S47A 4I7WA 1XJBA 1R3TA 3EWWA 4HIBA 3V18A 4IHCA 5FJRA 4WK9A 4PMQA 1T99A 3W24A 4N6EA 4H04A 4JTIA 3IJQA 1VP5A 1CXHA 1E43A 4LALA 3BSMA 4ERIA 4GZEA 1T0OA 2PDWA 4EK7A 3CUFA 1E6XM 2BBFA 2OXNA 5AB3A 1S2VA 4JEQA 8XIMA 5FF7A 2F6XA 2X2GA 3VFCA 1HJUA 3N9KA 3VX0A 2GVGA 1F05A 2WO5A 2XSBA 1DYSA 4C1LA 3WLSA 5GNZA 4WX2A 2E8ZA 4EF8A 1HO4A 1PPIA 3CQ0A 3QR1A 4J3XA 3FOKA 4W93A 1QAPA 1H5YA 5I24A 1P1MA 4LCSA 4J3UA 1Z69A 4U31A 4KESA 4H2CA 1X7FA 4MIMA 3QRHA 4OKDA 1F3XA 1V6TA 4G5DA 1GYLA 2EQDA 2VFHA 1F07A 3M0ZA 2GL5A 1AFSA 1V4YA 1VBHA 1XWYA 4DJFD 1TPWA 4PEKA 4UTKA 3NJ3A 3OP2A 2XN1A 2DIJA 4XWUA 3VIOA 2PTYA 4Z1DA 1V93A 3DYOA 4QLLA 2GJXB 2O4MA 4XBJA 4YS1A 4M81A 3WN6A 1DXEA 1KM0A 3QYQA 5EBAA 2VFGA 1EO7A 5D32A 5C2CA 4H6QA 3GH5A 3QR3A 1E1EA 3WK1A 2FFCA 3EA2A 3DHDA 1AH0A 4O1CA 1RY8A 4Z2IA 3EMCA 5CH9A 3VDAA 5U7SA 1RCXB 3O07A 3UEQA 4AZ5A 3CV2A 4CD6A 2G3NA 4B91A 3MHGA 2VKZG 4P7LA 4FOUA 3C4UA 2FMNA 1I75A 3M64A 2PDIA 2GVEA 3SN0A 3SY5A 2XVNA 4LV4A 5KEZA 1VLIA 4WKHA 1MW0A 2BVYA 4AD0A 3AIBA 4GINA 2WYSA 3MJYA 5B7YA 4MJZA 3VI2A 1EBHA 4IIGA 2Z28A 3V0SA 4QCEA 4W7UA 3BTNA 1E4IA 5T8GA 5AZ0A 3W2KA 3L23A 1X39A 1PTGA 1K4HA 1W56A 2CCRA 1U30A 1K1DA 3MUAA 1FX6A 2FIQA 1DWAM 3EYPA 1P0DA 2FLIA 1H41A 4F4RA 4BEUA 4QLJA 2DW7A 2Q8ZA 3QGVA 3MI6A 4I5RA 1N55A 1EWEA 4QSHA 4P2VA 4UMAA 3THDA 4AFYA 1MYRA 1T8QA 4AY1A 4E2OA 2FHFA 2ANUA 3S46A 1P5BA 3VIJA 4J2PA 3RPMA 4AZ7A 1GZJA 2QHAA 2P1FA 3CIWA 3TTQA 1BQCA 3A9IA 1GJUA 2XGZA 3RR4A 5FCZA 1TE6A 4B3KA 1FTXA 5HUOA 2W91A 3ERPA 2H6RA 3TUUA 4AVFA 4LVGA 2Z24A 3AMDA 1OCNA 4HTBA 4IP7A 4N4PA 5FEXA 3W88A 2BY2A 3LBMA 4GI9A 3H2FA 4UQEA 2O7SA 4IIBA 4S3JA 5IDIA 1NEYA 4JIHA 1DIDA 1Q6OA 3XISA 2A7NA 4S3AA 4LS0A 4L6DA 1W9BM 3FJ4A 1FCQA 4U10A 1XYFA 2PCQA 4WDUA 1U5HA 3WK0A 2EG6A 4KRTA 3APGA 1QOPA 1GYNA 1S2UA 3F2CA 5CGTA 2ZX6A 3G1VA 1VBRA 1CGYA 4DNHA 4H9TA 3S9IA 3W22A 3ZJ8A 5A3HA 4F2BA 2C3ZA 2IPFA 4IFKB 2AGTA 3EKZA 1VS1A 4GISA 1QNSA 1BYCA 3M0JA 1KBJA 2G3MA 3WLKX 2DZSA 4XVDA 1JAEA 2ZZ3A 3AJ7A 2PRHA 4N6FA 3E96A 5CG0A 3BDKA 2DW6A 2P3EA 4OUEA 4X9YA 2WCAA 3AS3A 4XVEA 1EGVA 1QPKA 4AY8A 4LU0A 1M3UA 2INZA 2GQAA 2IPJA 4Z0JA 5AC7A 3C5QA 2CLIA 3VTRA 1ISZA 1R3YA 1U33A 1A0DA 3QW3A 4S38A 4IX2A 4PZVA 3SM0A 1S3TC 3IUIA 4ICMA 3O63A 1WDRA 4QE5A 2IW0A 4KRZA 3ZT6A 1EA0A 4QSFA 3B40A 2XVGA 1JDAA 3NQAA 1E51A 5CZSA 1W5NA 1F3TA 3WJYA 1UWUA 4PMYA 4N2YA 1IGWA 3EOEA 3REQA 1K9DA 3MUCA 2OJPA 5H6HA 4RE4A 2VP8A 1Q65A 2BFGA 1FHLA 2YYTA 3T2OA 4DXXA 5A8MA 2EBNA 3GVRA 3TCEA 4YL2A 2E68A 3B3DA 1ME9A 4QROA 4KBXA 2ZXQA 3L4UA 2WPGA 1VZWA 3KEHA 1NF0A 3TTSA 1GPFA 4CVUA 1V6XA 4DLFA 4FNRA 1JRCA 4LWWA 4LGXA 2XPKA 4XZHA 3RILA 5HNUA 1TA3A 1JPHA 4IGNA 1Q2SA 1QVBA 3TX9A 4KWVA 1C9DA 3SUVA 4NT0A 4BF9A 4Y9MA 1O1HA 4JTQA 4DBUA 2VJXA 3GU2A 2J27A 3UG4A 3M4HA 3A47A 3WD1A 3F4WA 5I2UA 1JPMA 3VZYA 2PDHA 2QJGA 5REQB 3G1HA 3T0CA 2INFA 3P84A 4YVPA 4Q7IA 2X30A 3WNOA 4NQ1A 4JN8A 4MJ2A 3ABSA 2PTXA 4Y90A 2AKZA 3ZYZA 3EBVA 3CHFA 2V30A 3W7DA 2PEVA 2QDDA 4GIRA 3EB4A 3PUOA 4P7RA 2YOCA 1GQJA 1FWRA 3PWGA 4LW7A 2OSYA 4W7VA 3GWQA 4A22A 4JN7A 2QPSA 1SJCA 4DX3A 2BG5A 4PUEA 4JCMA 7TIMA 4PA8A 3TLLA 1S3HA 2WVVA 4GI4A 2PFHA 3L68A 4ILSA 3E02A 5HK4A 4JPGA 2G50A 3B8DA 1REQA 3FXYA 3M6YA 2YX0A 1B9ZA 2DZVA 3L5AA 3LI1A 2AMXA 2FDMA 4LAKA 4XSLA 5CC3A 3QVQA 2QCNA 4Q22A 3OODA 3S1GA 1HKVA 2AL2A 3I3EA 4FXRA 2B4GA 2VX4A 1JAKA 2F8QA 3RX2A 1DJQA 3W25A 1K02A 3EKLA 3HG2A 4GQRA 1F5ZA 1H0IA 3AMKA 4M6PA 3RM4A 4IP4A 2HBXA 5EB8A 3GY1A 2A1YA 2C13A 2EKGA 4ZOAA 2ZRZA 3FS2A 4HGXA 3GHSA 3GVVA 3H22A 1R87A 4IIHA 5K4XA 1WDWA 3LOTA 4JTFA 2E0PA 1SMAA 1FKWA 4L9ZA 1UWRA 3VIKA 1XXXA 2G41A 4R27A 4HJWA 4L65A 3KTXA 1IZKA 4W89A 1KXQA 1LRTA 1TJ2A 3BW4A 3K46A 4F9DA 4BCEA 1QNVA 3NQBA 1JCJA 3K5XA 3OGRA 1ZAHA 2J74A 3AHZA 4AZIA 3CV1A 2Y8KA 2PDNA 3S9YA 2Q02A 3BW2A 1GVYA 5C71A 2ACQA 3UXDA 4MJ4A 2G3JA 5AY7A 1IT8A 2VTFA 1H7WA 3ITTA 5D2YA 2INEA 3A9BA 4Q7NA 4HNNA 5AC4A 5FI8A 5A8GA 2QXWA 3VGDA 4DVOA 5EPDA 3G1YA 1OGSA 3S5YA 7ODCA 3KDOA 4NU7A 1WXYA 3TSMA 1RAKA 1MEWA 4I9TA 3QY8A 2J7BA 2W4XA 3ENLA 3M0VA 4UZSA 2OWXA 4MFDA 4RKAA 2Z29A 1OFOA 2W61A 4H8HA 3RF9A 5A8OA 2C16A 4WY0F 5J5RA 4MAVA 4H7ZA 3F2BA 2VOTA 1WBHA 1B4EA 4RXFA 1V3LA 3H55A 4AW7A 4LXFA 1BYBA 1WYIA 2ZZ1A 3IJ6A 2V5LA 2ESCA 3WLOA 2DVTA 3LGGA 5LIKX 5BNKA 4FEZA 4JL2A 5IXEA 1NIUA 1F7BA 2HNEA 4XAZA 1GOOA 3O8AA 1WUEA 2KAUC 1PHWA 1C8XA 1QOQA 4CEXC 5D37A 1FFQA 3VK5A 2BHUA 1UIOA 3DIPA 4QXIA 4L6OA 1WOBA 3NPVA 4ZE5A 1XQLA 3WD2A 4FX7A 5CSSA 5ABTA 5DANA 2PP1A 2F7FA 4LANA 6REQA 3DBPA 2WB5A 1B31A 3VNLA 3CHEA 1X98A 1RP8A 3KOXA 1W17A 4OV9A 3VINA 3CBWA 1VC4A 4JNZA 3PANA 2BOGX 3W38A 3P93A 3W1RA 4Q4RA 3VOCA 2GGHA 1MEIA 3WL1A 1ML1A 2E9MA 1SQ7A 4G56A 2DJXA 3QY6A 1ECQA 3TROA 2BTMA 2DH2A 1E5JA 1YPXA 3UGVA 3MKVA 2AMGA 3NG3A 1OVDA 1Z3NA 3GM8A 4FIRA 3BGJA 2PSNA 2VR5A 4ZBCA 4MY9A 1VPYA 5G2HA 3LRMA 3AAMA 3QQWA 1WUFA 2OPJA 3P0WA 3LSBA 3GHUA 3B0XA 3CXOA 1NJJA 1Y7VA 3G1RA 4ZB0A 4N7QA 3GXNA 3GE7A 4V15A 1NSJA 4BQ3A 2Z1KA 2PLJA 3R8RA 3AS0A 2A3BA 5A6AA 1E4MM 1QRQA 1UD3A 2EJ1A 2YPIA 3KVMA 2DDXA 3FAWA 3UYCA 2ISFA 3M0YA 4JTKA 3S5NA 4GC3A 5DBUA 2E6YA 4A2RA 1EOMA 3H2MA 4OOUA 1E3XA 2VDHA 1KTNA 3VNDA 3S3GA 2C1IA 2NQ5A 3WUBA 3W76A 4P61A 2NUYA 3EOOA 1QNRA 1HF6A 1KCLA 1J6OA 4IL0A 2WHLA 4IJCA 3AJXA 4HN4A 1WAUA 3S6DA 2D0HA 1LOLA 3HFYA 5BYWA 2CBVA 2PS2A 3OJGA 1GOWA 1YBQB 1ONWA 2GVJA 1W31A 1XLGA 4A8IA 3FN9A 5HXMA 2ZZ7A 1O66A 2DT2A 2X05A 3S42A 1JCTA 2ONEA 3O1NA 3LHZA 4PTDA 3SSJA 3NWRA 3PF3A 1JR1A 1VEOA 2X1IA 1K6WA 4JY9A 3M6DA 3BMXA 4Y2WA 3K8KA 4H83A 4QDWA 3U3HA 3WQ5A 5ABFB 4DYEA 4HYRA 4PC8A 2CLMA 3PM6A 3R8HA 4NZ5A 2GJPA 4PE8A 3DUGA 1D7FA 1W9UA 4HOWA 2PGRA 1A5LC 2QF7A 3W7RA 1A47A 4GUGA 1I8JA 1Y5WA 1TPC1 2TYSA 3NL2A 5JQ9A 1US2A 3N4EA 1PCWA 2AGKA 3CB3A 2PWGA 4UNLA 3BAYA 4HHPA 2D20A 3VDBA 1HFBA 2WJEA 1NFGA 4LC8A 1SO4A 4FLRA 2C0HA 2X0SA 5G4WA 3AALA 1R9XA 4UCGA 1GOKA 1O5KA 3O0KA 4UQDA 4HA3A 4QFUA 4GJIA 3SFKA 3OLIA 4IJBA 1JZ5A 1EJWC 3M1ZA 2WW5A 2WBGA 2W27A 3WQDA 4C1KA 4E6MA 3MA8A 3PZIA 1IEVA 4LUJA 3BG3A 5CZTA 2JE8A 3UJ2A 1RPKA 4O13A 3AYTA 2D2JA 1UYQA 3PBYA 1QPQA 3LI0A 1CXLA 3BV4A 3RO8A 3FHQA 1L2QA 3W73A 4IIFA 1KM6A 1UH2A 4H8UA 4TVDA 2X40A 4X2PA 3URBA 2J6XA 3MW7A 3W7QA 2XUCA 1ZRQA 1BVZA 1YNYA 1FWJC 4GJJA 5IRPA 2VEGA 1PEZA 2Y24A 1PVNA 1AODA 1CYGA 2VEPA 1UD5A 1TZ9A 3PZTA 3GRIA 4ES4A 4HOZA 3I68A 4LTSA 3P82A 5EMYA 1DJZA 4EP8C 3W1LA 1A49A 5DY3A 2Y6ZA 3PJWA 3WX7A 1QNPA 4C6CA 8A3HA 2C18A 1TWDA 2E5BA 3KRZA 2OEJA 3LXBA 3TAKA 2Q3OA 3SGUA 5FEPA 4HP5A 2Z2BA 2WWCA 3T7VA 2DZUA 4TV6A 3FKRA 1M1BA 1XUUA 4X22A 1CLVA 2GWGA 1SGJA 3M9YA 3NQ8A 4QG6A 3G1AA 4ZOCA 2WZEA 3ZR6A 1Q6EA 3VOGA 4J3WA 3B4YA 3FV9A 3HGRA 3E0VA 1FHUA 2VT0A 3CZ8A 2YBTA 1MEHA 3H2CA 1XYAA 4DPPA 4YHGA 4LSBA 3MTWA 4TX9A 6CGTA 1W1B1 1P6BA 3LCGA 4DQWA 4EF9A 2W5FA 4GYPC 1RJQA 3KRSA 2SFPA 4UTWC 2FHBA 4IJRA 4J2MA 4GOAA 3TYAA 2VX5A 1CLKA 3VDHA 2QGHA 2VRQA 4AHPA 1BSLA 2GWNA 3BE7A 1T6MA 1G5AA 2G3FA 5CC7A 2WJDA 5C7HA 3OO2A 1ZZMA 3PNUA 1UASA 3QTGA 1ZQ5A 2XFFA 1G01A 1VD6A 1ZAJA 2P0OA 3KXQA 1OX5A 1M04A 3T05A 1UJQA 2ZDSA 2BP1A 2WMIA 2YB1A 3BSGA 1BRLA 2G95A 4DYJA 4AB4A 1UOKA 1SFLA 4PB3A 3EOSA 4ZL1A 3S2CA 3GNDA 1P43A 4A05A 4XIMA 2HE8A 4H19A 3WNMA 1OHLA 5JVLA 4QGCA 5I03A 3WLMA 4HSOA 5A6BD 1U5VA 3TZNA 4MJMA 3OLDA 4JAWA 2DQXA 1GONA 1Q3NA 2QUMA 4JTCA 1FWTA 3C8NA 3SGGA 5DF0A 3D3AA 4F0HA 2A85A 2QJJA 3B8VA 4WDWA 1J0YA 1ZP3A 5E09A 4HK6A 5HR6A 3PAJA 3R0DA 2QPXA 1IXOA 2C91A 3DU0A 3H6OA 1TTQA 4MKNA 2Z6IA 1M7PA 3LX9A 3HU7A 1M03A 3ANVA 2JFEX 1KRCC 3CWHA 3BW3A 2XIBA 4JR5A 4JKLA 3VC5A 3OLEA 3K2GA 4L9YA 1GGOA 1UKPA 5CZJA 2Y63A 1TREA 3D6NA 3H2NA 2H90A 1XYCA 3L5MA 3H2OA 4ASTA 1PHQA 1JGMA 1Q2RA 1GVFA 3LNPA 3H70A 3DYPA 8XIAA 3RRAA 1I0DA 2QEZA 4DZIA 1J0KA 3DHUA 1D2KA 4F9JA 4LEQA 4YNGA 2GQ3A 1ALDA 4H8NA 1I2QA 1EL3A 2DORA 3AXMA 3G18A 1FH7A 1LWIA 1VFMA 4DN1A 1JXKA 4PUMA 1T7LA 2CZEA 3RAOA 2BVTA 4PMNA 2V6AA 3WDRA 3DZ1A 5DMNA 5AHEA 1QO2A 4NKCA 4EXAA 5EFFA 3QQ0A 5BXRA 4QISA 3TNBA 3KL0A 2YXXA 5LXEA 3SCUA 1TMLA 1DJIA 3VIFA 2Z2AA 3UXAA 2A3EA 4HA0A 1UD8A 2NQHA 1EX5A 2J7CA 1E6RA 4IUOA 2ZUUA 3EA3A 3IK4A 5A2CA 1PX8A 1B3WA 5BWFA 4EPEC 3OG3A 3KZPA 4US5D 1C8QA 4HQVA 3UG8A 1QPNA 2NQZA 4KWSA 2OWWA 3NA8A 4CD7A 3NSMA 1KKRA 3M07A 1NDYA 1ICPA 1ZHAA 1S2AA 3ANYA 2W63A 3WEOA 1LBFA 2QF8A 1LUCA 2ZVRA 4K8EA 5HWJA 2F2HA 1PX3A 3HGSA 1E5NA 1V7YA 1W2PA 4L4LA 3DFPA 3VZZA 1OFAA 3WQGA 4K37A 3GS6A 3P0XA 3UG3A 2ZICA 2YDRA 1UQZA 3KOZA 3NO1A 4RLIA 2QCLA 1F4AA 5J5DA 2PUZA 1FFRA 3L0GA 3T81A 2Y88A 5I77A 2PBGA 4C6IA 1R8LA 1XCFA 4EPKA 3R2GA 4PSRA 2O0TA 4DB7A 4IG2B 2BGQA 3NDOA 2VFEA 1TSIA 2J7DA 4A3RA 1X8FA 3IGUA 2KZHA 4UR8A 2FTWA 1XISA 4O52A 1BG9A 2P0IA 4G7EA 1X1NA 3LBOA 3SSZA 2WZTA 3OVRA 4W86A 2BS9A 2YBUA 3LCHA 3SW6A 5HANA 3LLXA 1ZNNA 2J8GA 1E0WA 3W81A 1FWNA 4DJEC 4PTXA 1T40A 5D2VA 3OOQA 2EJAA 4GUJA 3IWPA 4IPLA 1QW9A 3RLHA 1HJQA 1D9EA 4PTNA 1L9WA 3TC6A 4HOXA 3VE9A 3L12A 4OBSA 1E9YB 2HZGA 2OMAA 5A6KA 2ZTKA 2ZDRA 5FIPA 1E1CB 2W66A 4R5EA 4JN6A 4E8DA 3OBKA 3KBMA 4P5UA 4AC1X 3GVWA 4B3LA 1TV4A 1SSGA 3ITGA 3EOUA 1WA3A 1BWVA 1K8YA 4JHZA 3DC8A 2VYOA 2GDVA 4HN8A 3IIOA 8RUCA 1EIBA 4M19A 3N9RA 4HCDA 1UR1A 4GVIA 1IR1A 3AHXA 2GDUA 5AC8A 1RZMA 4MB1A 4HCLA 3NQDA 4R34A 1TV3A 1VEMA 3VE7A 2VCCA 1F74A 2VWSA 5CJ5A 2WJZA 3CUZA 3WK3A 2OLSA 3TC3A 1XPYA 2WMJA 4M29A 4O15A 4GX8A 1VH7A 1VRDA 1YW1A 4O0ZA 1Q7QA 3VMOA 3W00A 3WIJA 2IPGA 1NH6A 3B04A 1REQB 3FLUA 3M7WA 2VC7A 3QF0A 5IOBA 4GY7A 1C29A 5EY5A 4YYFA 3GG8A 1OF6A 1XDLA 4D9PA 1MMFA 4LV9A 3RU8X 4CCDA 1VPXA 4F2TA 3PAOA 1ZENA 2CW6A 4J7RA 1B3XA 3VDGA 2OG9A 4JQ2A 3GVGA 1JYWA 5LSMA 2POTA 1JUKA 4J40A 3EXSA 5K9DA 1IT0A 2YFOA 2VXNA 2QPUA 1KCZA 1S1PA 3S1XA 3RUBL 5A94A 4J3SA 4PCSA 3KP1A 3LHVA 4NXSA 2B31A 3QR0A 4C5YA 3RYSA 4D71A 1YDNA 3B9DA 4DIAA 3DI0A 3WF3A 2QNEA 2WKLA 4Z2LA 4G1KA 1DIOA 2VR2A 2XFWA 4JZ5A 3RM9A 2CLLA 3SJNA 2J75A 2J47A 4KEMA 2VM8A 2DIEA 4O4VA 3VNIA 4OJYA 1Q6QA 4F0LA 3WF1A 4LUTB 5AECA 3WKZA 5C5YA 3LY0A 3QM3A 4MSSA 3ZM8A 1GT8A 3NOYA 4BF7A 1TE1A 3V5OA 1SVDA 2Y89A 1TV5A 2WV8A 3P74A 4JTHA 3MMTA 4F0KA 3W01A 3NAVA 3CUIA 4HHMA 4ZVJA 2CC0A 2QJHA 4A8NA 3WNLA 3LPOA 1ZALA 3CYVA 1JUEA 4DWSC 1IEWA 3KTSA 3WY1A 3CHCA 3QC0A 5BRPA 7REQB 1A0CA 4Z1YA 2VGBA 4JTEA 2RDWA 4IQLA 4GWEA 4O50A 5D2XA 1H60A 3VD4A 1U83A 4FZIA 3BLLA 3GTNA 4NNBA 3A6OA 1JL8A 1ZLPA 1QO5A 5FJTA 1GNXA 2E77A 3NM1A 2Z25A 5BXSA 3PSWA 5TD4A 1IZCA 3HB9A 3Q4DA 4AZHA 1FWFC 4WUIA 3TXVA 1DP0A 5E70A 1W3TA 4FO4A 2Y2WA 1ECEA 1B9BA 4HPGA 1MNSA 2OB3A 4PFHA 3EPNA 1TWSA 1AA1B 3LQLA 2XYLA 4PCNA 5C9RA 4YXGA 4HVXA 2ZXAA 5XIMA 2G4JA 1JI1A 1QOXA 3TAOA 2O55A 1E3ZA 1JPDX 3CB8A 4ACZA 1X7IA 3LENA 3H4XA 4O1BA 2PF8A 4JTJA 2WC7A 3KCOA 4TTGA 3MANA 5EKYA 1NWRA 5F2LA 3SEPA 3NQ6A 2RAGA 2YL8A 3MI3A 2FZMA 3LCFA 3BURA 3TOPA 1H0GA 3MP3A 4FIQA 1QHOA 3W83A 1HW6A 1XIJA 3L0NA 4AWSA 3Q65A 2FB2A 3FJ6A 4AG0A 1BRLB 2ADAA 3K13A 4ZXOA 3CLMA 4REQA 4UR7A 3T44A 1POKA 2E7FA 4Z08A 1Z8AA 4US6A 3MKCA 4CCEA 2A5HA 4D6IA 3NPUA 1VJZA 4ECLA 1S5VA 1QUMA 4CNPA 4LY4A 2BWGA 2G0WA 3AXXA 3WJXA 2XGBA 4Q3MA 4BQ5A 3PPCA 3GZAA 1JDFA 3T08A 1TPH1 1VHCA 3WFZA 2PI6A 3UWEA 4HNTA 3ALFA 1AD1A 1ADDA 3N12A 4IZGA 4LVFA 3EX4A 2YDSA 3PVFA 1A50A 4LEFA 1H09A 4JNMA 4IQEA 3B0YA 1ZSXA 2GSHA 1EF2A 4JYDA 1GTHA 1K7FA 3JR2A 4JS3A 4Q8WA 2VEFA 2PZNA 4C5ZA 2J8FA 3SCNA 3ARQA 2I5GA 1KFKA 5CLWA 2HDJA 3MMDA 3BJTA 3LD5A 2XWDA 4WOQA 1OM0A 5JIPA 3N14A 4MLJA 3NVTA 3A3HA 1TZ7A 5C2XA 3NM3A 3FDGA 4Q4KA 5AHNA 1MUWA 3BUVA 1XH1A 3UWQA 3WQ4A 5BMWA 2OU4A 4O53A 3MJMA 1BKHA 3EXRA 3VMPA 3EWYA 2O9OA 2ZX8A 1NWUA 4AEFA 4UNKA 1XIHA 2XWEA 2VX6A 3VKBA 3G3DA 1EJSC 2P3ZA 2E5DA 4JD4A 3VYLA 4ALDA 3C2FA 2OTDA 3QOMA 3ES8A 4HPNA 3ONCA 1NDZA 2DT1A 2CZ5A 1UUMA 5HPCA 4MDPA 3PZVA 1J10A 1H1YA 1UH4A 3P7YA 3CJPA 1G4TA 3UU0A 1KFWA 6XIAA 1XV8A 1AQHA 3P61A 3KWSA 3HA1A 2QIWA 3A13A 5BRQA 3FA4A 3RMEA 4Q8UA 5CPLA 3GZ3A 1R7AA 2YR1A 2HROA 2V67A 4B3ZA 3ZLHA 2HXUA 1UP3A 3WQVA 1VCGA 4FR1A 3WSUA 2BGSA 1OSEA 1I60A 1YEYA 1OADA 3VIGA 4FLOA 3LB0A 4LC6A 3VNMA 4W5ZA 2XGIA 3GR4A 1HVXA 3Q2DA 3OG2A 3HPAA 3AUOA 1R9ZA 4RPQA 4D72A 2PWEA 1RVKA 4RV3A 5L9FA 1BEUA 3L4ZA 4MB4A 1RBAA 3OIXA 3SQLA 1JNEA 4ZQNA 4LPCA 3NSXA 3NPXA 5D4YA 1LG1A 3GG1A 3MYOA 1UH3A 1JZ7A 4JHOA 2JIWA 2X1SA 2NX1A 1IEXA 1WB0A 4D8AA 4EVZA 2IS7A 3CV7A 4ACYA 5AHIA 5I79A 1XIBA 4WSHA 1B54A 4JTLA 4FNSA 1KLYA 4CNSA 1OCQA 3B8TA 4AMAA 3LYEA 1RY0A 3A23A 3QY7A 2DT3A 3UR8A 1VF8A 4Q6JA 3TZFA 1BXNA 2WKJA 1TV8A 1EF3A 4EXBA 3GFXA 4DJFA 2JKPA 4QE1A 3BC9A 4X0NA 3HPZA 3ABQA 1VENA 2PWUA 4PTVA 4GKLA 3AO0A 3VKCA 1PKYA 1EJ7L 2OFJA 4AVNA 1LQ0A 4DUWA 1W6TA 3FGCA 1G94A 3C0JA 3KLLA 4H9XA 4TTUA 3GW3A 1XL9A 3EEZA 3W7NA 3G1DA 4O4WA 1Q63A 3L67A 4XQ6A 2X1RA 5H8MA 3LTYA 3JUGA 4BQ2A 3NTYA 3QLDA 4ERGA 3GXIA 2Y85A 3TCSA 3M5XA 3DFTA 1GVSA 1MXDA 3T07A 3NNTA 3R79A 3F5KA 4NG3A 3ABOA 3NURA 3ZVIA 5PTDA 2C14A 1HL9A 3QC3A 3QKEA 3HOJA 1M01A 1MVYA 3PSVA 3OW1A 1MQPA 4XZ9A 2WSPA 1GJPA 4QHRA 3ARXA 3KWXA 1Z32X 3MU7A 3N29A 5FJIA 4IUGA 1WV2A 5TIMA 2HS8A 1FWIC 1W5OA 4D8ZA 4I6KA 3DG7A 3EPMA 1CX9A 3N2MA 4F0RA 3O2LA 4OV4A 3D0CA 2WPBA 3JZUA 4QJ1A 1OB0A 4NSBA 2QCCA 2V2HA 2PDUA 2UWFA 4D6CA 4HNCA 4F66A 1BGAA 2HXTA 2OEMA 4E4FA 2Q8XA 1GHSA 4QBXA 1Q7ZA 5KITA 3ZXWA 3WLJA 1JQXA 3IJDA 1MO0A 1QNOA 3QV6A 5JIWA 3APTA 2ZFAA 4CEUC 4QR6A 3LLDA 4LT9A 1F3EA 2ISWA 1PCKA 4N9DA 4AY7A 4L4PA 1DTNA 3UXKA 4IMDA 1VBGA 1HKIA 2OSXA 1CGVA 2QKFA 3NQ2A 1LRQA 4YTTA 3BAKA 1W1IE 3EB2A 1KGUA 5G1TA 3ORWA 4O28A 3S6TA 4DM2A 2IXUA 1SMDA 2ISDA 1L6FA 1AJ0A 4K36A 3DX5A 3CL6A 1GVQA 2RDTA 4OU1A 3LCIA 1JZ2A 1CWYA 2XG9A 5T9BG 1ME8A 4ZB2A 1MSSA 2GLKA 4D2JA 2DV0A 2QGYA 3OQEA 4Z2HA 4M80A 3EDJA 8CGTA 4B4HA 5LA1A 3MDUA 1UCWA 5KETA 1XYLA 2NVAA 4JIQA 3THUA 3B9EA 4ADUA 4I5XA 3DI1A 4WQ6A 1QATA 3LZ5A 2ACUA 3UVIA 1E1CA 1QI4A 3STPA 5E93A 1J2BA 3ICJA 3N6QA 1G0CA 3U4FA 5H2ZA 1HT6A 2UV8G 1GPWA 1UP0A 3MCOA 1PYMA 1KRBC 1AG1O 1ITQA 3HJEA 4ZFCA 1W1ZA 1MUMA 5BW6A 1ESWA 4RW5A 4QM1A 1MRAA 4DI9A 3QH2A 4DELA 3PR2A 3CWNA 1OT1A 3EKGA 3BAWA 2NSOA 1S2CA 4QCFA 2ATMA 2BNJA 2FMOA 5E5CA 1PZ0A 4DJED 4JFWA 1O5QA 4LRSA 1A53A 3LQGA 4JICA 2YJQA 3TP4A 3AZSA 1HX0A 2E4TA 3VABA 3LZ3A 3HGJA 2F9RA 1TZZA 3PPGA 1JDDA 1VIZA 4H9YA 3UPWA 2PA6A 2WC3A 4MY1A 8TIMA 1QWKA 3RG6A 4H9ZA 5CPMA 1GOMA 3W2UA 1RQEA 1UWTA 4HPXA 2BV9A 1FWAC 3UGRA 2I16A 3NL5A 4HU8A 2GJXA 1YLVA 1KRAC 2W62A 1XUZA 4HYWA 4DM1A 3KX6A 1CEOA 2TSYA 3UZWA 1LOQA 4N9BA 3VNZA 1KRMA 1FDZA 1K03A 4GUFA 4XBKA 5BOEA 3T0AA 3UCCA 3GG7A 2J7EA 3DN5A 3VUPA 3ZMRA 2BZNA 4FP1A 4LBUA 2R1LA 1TWWA 3O6YX 2XZ7A 2EPLX 2QS8A 3WH5A 1PIGA 4I8DA 3DHFA 3EB3A 3PJTA 5C2GA 3DGRA 1N7KA 3U2EA 2GUBA 9XIAA 4D6FA 1G4SA 3G22A 3FCPA 4PUWA 3BCJA 5C6MA 3F03K 3IRDA 3ZIZA 5D04C 4B9ZA 3I4KA 2V81A 3GR8A 1R3WA 1AUSL 1ITCA 3F4VA 3IJIA 1UD2A 3WQFA 1WOAA 1B3VA 1B3YA 3DHPA 4Y7EA 5A8PA 5F4WA 1VLWA 4C6OA 1E6QM 2VEMA 2OYLA 3WUGA 2ZRVA 4J3VA 4XAYA 1CNVA 3VIMA 1A5KC 1QASA 1XP3A 5E0CA 3UJFA 2D3NA 1E0XA 2CU0A 1H5VA 3NXFA 4S3DA 1IEQA 3TH6A 3PJXA 1R2SA 3A3WA 1SPQA 3HQPA 1OX4A 5I5RA 2ZWYA 1BVNP 1DVJA 4GE8A 3BLIA 4WJXA 3STCA 1MXGA 2X41A 1EB3A 3PZOA 1JIBA 4IFOA 1FP9A 4S39A 2VD9A 2A7PA 3VM5A 4OUIA 4IQDA 3R0KA 3M0HA 2YA2A 1PTAA 1L6YA 1X8CA 2NVDA 3WNPA 4ZSTA 1XLMA 2YIHA 1B2YA 1J12A 2QAPA 3Q37A 3R0UA 1XLEA 2XIQA 4HHHA 2BXZA 1RPXA 4LQ1A 3EDDA 1KBLA 3WG6A 4UIOA 1A5UA 2J77A 2EKCA 2HCVA 2F6UA 1RUSA 3P5YA 5LZLA 4B2DA 2NUWA 5LA2A 2PE4A 3K4AA 4G2DA 2OKTA 4RZ5A 1XH0A 4KWWA 3S83A 4DWSD 3CAWA 2PWDA 4IMEA 3WQPA 5J04A 3S8HA 1VPQA 4M7TA 2ZWZA 3MVTA 1RK5A 3FDKA 1Q6LA 2OQYA 1W3NA 1LG2A 4Z42C 3NL6A 2OVLA 3ZO9A 1EPVA 3B03A 1IWPA 3PZQA 2QMKA 1Y5XA 4DJDD 3LCWA 2J25A 3O3RA 3W1XA 4BI5A 6REQB 3S2MA 4FK9A 1E71M 3TMQA 3ISIX 1H7NA 2UY5A 3MUY1 2HE5A 1OC7A 3L4YA 1YXYA 3HG3A 1YTEA 3WNNA 5XIAA 2HV5A 2CWNA 2HNHA 3RIKA 4CQ8A 1CXKA 2BHZA 1XICA 4ZO7A 3WD0A 4IFKA 4IMCA 4OE7A 1RP9A 1VIWA 4S3FA 3IVSA 4Q8VA 2BGNE 1M68A 1WX0A 2EPNA 5CSRA 3U7BA 3CZKA 4BY3A 4K1WA 4C6QA 5F2IA 1JULA 3K1GA 1S2WA 4FX8A 1XH2A 2UY4A 5E9AA 3H24A 3OZPA 1O1ZA 3BLKA 3CAKA 1XI3A 2E1WA 3V7PA 2AQOA 3AROA 2FPVA 2MUCA 3WJZA 4DO4A 3A5FA 2REQB 3NQVA 1HIZA 4K38A 3TN3A 5KZMA 5TQLA 3BLOA 2JF7A 2VZTA 5EL1A 4DF2A 1RHCA 1F4HA 3WFAA 2HWGA 5HA7A 2E25A 4KMQA 4AC7C 2HVNA 4KCVA 1LL7A 3BMWA 4Q4MA 3UNTA 3L9CA 5HINA 2GK1B 4WY0B 3BCDA 4W5UA 3GUWA 3R11A 5IFTA 3UWZA 3AFBA 4B2DD 4O0KA 1JPIA 4CU8A 4MADA 4Y9OA 3H53A 4MUPA 3L65A 1NU5A 2ZXDA 3IJLA 1KV8A 1EXPA 4MVAA 4NNAA 4U2YA 2XM2A 4MYAA 1X6NA 3DERA 1J79A 2YZ5A 3FGCB 3BCFA 3W7PA 2O92A 1PE1A 1CXEA 5JH1A 2FVLA 5CAHA 4GH3A 4P8XA 4H01A 1KQZA 4AZCA 4GY1A 4ZFMA 2VL4A 3ATYA 4LUSB 1JG9A 3EDEA 2V68A 3ZJKA 1MQRA 1ZPTA 1CB7B 1NFBA 5DMYA 4FNPA 1DHPA 3H2EA 4PL1A 5DMMA 3G6LA 3UCQA 1V02E 2WK2A 1TPFA 3GC5A 4D6GA 2BSLA 1W2VA 4C6BA 4DJEA 4YHEA 2VI0A 3LV6A 4MNKA 3TA9A 4K6AA 1UA3A 1AD4A 1UWQA 3UFYA 5H8UA 1K9FA 4S3BA 4QIUA 1XG4A 1QPOA 4PUDA 2E5CA 4OWGA 3ZOAA 4P8VA 4C6DA 5A6BA 5B80A 1E40A 3T0TA 1ZGDA 4NF7A 3LPFA 4W4QA 5DCDA 3EWCA 3MSYA 4A6GA 3PBWA 4ZQOA 4DPQA 3FHAA 1N8WA 1LDCA 3I6RA 1C90A 1A5AA 2PDGA 1WPCA 1ZJAA 1HNYA 4BS0A 4JHMA 3OU8A 5C0QA 5A2AA 4NP7A 1D3CA 3EX3A 4GH1A 4PN2A 1XC4A 1XIMA 3TDFA 1GQKA 3V5FA 1V3HA 1XD0A 1G4PA 2P8CA 3MI2A 4TUFA 1Y0EA 1HJXA 2NLIA 4JX6A 2PDFA 4L4OA 1XLDA 2ZZ5A 3U4AA 3AIRA 1LWHA 3S2NA 1EWDA 4HSNA 3HZ3A 3W87A 4UXDA 2YBVA 4KFOA 5TBOA 2P76A 3WBAA 1B3ZA 1ZTVA 1QNQA 1OD0A 4HU3A 3URQA 3BAIA 2E9BA 4DZHA 1VFOA 3D47A 4CD4A 2OYKA 1UR4A 2NWSA 1LQ2A 1MW2A 3DEQA 3MY9A 1W8GA 3PTDA 4GD0A 2Q01A 2EPOA 3INPA 1TPUA 1GUVA 1WBJA 2PDYA 2XN2A 2IKHA 3CH0A 4OBTA 1ZU8A 2QV4A 4YYCA 4Q8QA 1VFLA 1XIDA 2VZVA 2OT1A 2WMKA 1XKYA 2JK2A 3GAYA 3AZRA 4GNKB 2H8XA 3VD7A 1WKFA 2B7PA 1EIXA 2J78A 1CLXA 2YLAA 3KOFA 4NNCA 5ENLA 4YTSA 3W71A 4PB4A 3QZ6A 2W6RA 4D6DA 1CIUA 1MI3A 3IAQA 3SRHA 2QVNA 4GQ0A 2R1NA 3MB9A 3HJZA 1EGZA 2Z1BA 5FAJA 5GNYA 1C8YA 1UWIA 4LFYA 2CKRA 2QT3A 5HR7A 5IBXC 4B5NA 3KTCA 4PEEA 4REQB 4W8AA 3L66A 4AU0A 1X96A 3R4IA 3FYYA 4GMEA 2R1PA 4AUBA 4PGLA 4WSKA 4KT2A 3IV8A 1S5WA 1XYMA 2Z4GA 3TQ0A 1OFEA 5AYXA 1AJ2A 4TOQA 1HL2A 3TQVA 3NZGA 2TRSA 2WVVB 3DG3A 1AZ2A 1OK6A 1H1NA 3MHUA 1G7UA 3L2IA 5LNSA 4UBPC 2X7WA 3GB6A 2TODA 1C7TA 4FNUA 4RXGA 3AIVA 1SSDA 4MB3A 2V2DA 4H4IA 1TYGA 2YKKA 2FZBA 2PC8A 3G3MA 4CNUA 5G2IA 1N82A 3UERA 1V5XA 3GSMA 2EGZA 3TJ4A 4EACA 4JDBA 3T78A 1UR0A 5FA5A 3I3DA 4KGLA 4AIEA 4RV8A 3WLPA 4IIEA 5JBDA 1XX1A 4LY8A 3T09A 1R0MA 4H6RA 3BK0A 3FIGA 4GI6A 2DQWA 1HKJA 3OYZA 1F76A 2IQTA 1S5NA 1J96A 2GQ8A 3RN6A 2J4GA 4O10A 3VNYA 1A5OC 1HN1A 4O54A 4AD4A 2FZDA 4E3TA 3WJWA 1NF7A 2Q3RA 1XBVA 1BVWA 3VCRA 4E38A 4EIVA 3W6MA 1JCYA 2CITA 3FAXA 3M0KA 4NX5A 3IJ9A 3VAVA 4MY8A 3ZFHA 1PBGA 4H6EA 1H11A 1OZQA 1LLOA 5C55A 3B9AA 3NQ7A 4B90A 3S4TA 2NQ9A 2XU2A 4NASA 2POZA 2PDXA 3H7RA 2RJHA 2VC6A 1ADOA 2ABBA 4YU1A 4U33A 1DPMA 3TC7A 1G9HA 5CZ0A 4GBDA 1OCJA 4IF2A 4ORIA 3QGKC 3GO2A 4AD3A 1SR0A 3SR7A 3P60A 3H4WA 1PDZA 3W7KA 3W37A 2ACRA 4MLRA 2PCEA 4QRNA 4UMCA 3IS4A 3TA6A 4IH3A 1VFSA 3G6MA 1PZ1A 2GK1A 4NXKA 4WY0A 4EWND 5HQLA 2YXOA 4KEZA 1W9PA 3K30A 4Z2GA 3SRKA 3GDLA 1E72M 3WD3A 1CT5A 1F6PA 5F1UA 1AZ1A 3VKKA 4DUVA 4M6QA 3EWZA 2Z00A 1V0NA 3VM7A 2WHKA 3PPFA 3SUWA 4NRRA 4H7CA 5K9XA 4CD5A 1X6UA 2QCDB 1RD6A 4F40A 1UJPA 4XD4A 3EA1A 1BTCA 4RZ6A 4PMZA 3HBLA 5DCBA 1H3GA 1EX1A 1HKKA 3AZTA 2W9MA 4A8LA 1ENUA 4JX5A 3GXTA 4JIIX 3REQB 4RNJA 3WUEA 1JDCA 3W1PA 2HS6A 4IPNB 1KFBA 3SIMA 3FSUA 1JXJA 5D2WA 2XH4A 3VILA 2PP3A 1X6LA 3LHTA 2FZ9A 1UKOA 1ONXA 1NTHA 3RX3A 3P80A 4WF7A 3CV6A 4HZ6A 1NDWA 1R86A 1EHAA 1XRVA 3W2JA 3QJAA 3ZSTA 3ARUA 3KDNA 2R8WA 2VVSA 3CAQA 1UR8A 3E5PA 1B0IA 3W7JA 1I2RA 1DOSA 2B7NA 2DSVA 3Q45A 2VVNA 1W32A 3W28A 4XKMA 2RGMA 3BO9A 2RUSA 4E3VA 3UR5A 1KKOA 2WLZA 3WMSA 5JU6A 3L7RA 1CGXA 2ZRYA 2AQWA 2JGYA 3KZSA 2QUVA 3P6LA 4YCOA 4XUGA 5FESA 2PRMA 4CGTA 2PD5A 5LIUX 1L6GA 3V5CA 2TPSA 4Y9AA 3LDVA 1KW1A 3THAA 4XZIA 4HU0A 1C9WA 4I5UA 1S38A 3C56A 3B8UA 4N9CA 3I7SA 1HL8A 4UTTA 3E0IA 3CUXA 2Y61A 2Y1HA 4RL3A 3M5ZA 1FQ0A 3LSCA 5D09A 4WIWA 1FCUA 1UBPC 3MCMA 4GLEA 3LV5A 1ISVA 1FHVA 4IIDA 3BARA 5CPNA 2QVHA 4DUXA 1VR6A 3UZJA 4AD1A 4TU1A 2Q6ZA 3WLTA 3AIWA 2VURA 3KCJA 1T41A 3SI9A 3SGZA 3TJIA 4PCPA 1ITUA 2D73A 1IWAA 1I45A 1GOXA 1GZ1A 4R9XA 1L6SA 3N4AA 3PY2A 4Q4OA 5T91A 1UA7A 3TOYA 5M17A 5HBFA 1UWSA 4TVCA 5G4HC 3EWDA 3RU6A 3XIMA 2QCHA 1EUAA 3HV9A 1SZNA 3WQOA 3AOFA 2PURA 3OZMA 3PBUA 3WL0A 4DXKA 1WKYA 3WLQA 5HNRA 2FVMA 2C71A 4DNMA 1H61A 4B5XA 1GHRA 3ARPA 3WO8A 2RFGA 1LUCB 2ASHA 3V36A 3W4RA 5DLCA 1BF6A 3R43A 3W7CA 4B5UA 4C6FA 2R6OA 5HJLA 1KWGA 3MDWA 4UC5A 4O12A 3PBMA 4CD8A 3UPBA 4L5ZA 2ZOXA 1CDGA 1TPB1 4HMEA 1A5NC 1OX4B 2C8NA 2PMQA 1XGZA 1Q6RA 3TXZA 2XDFA 5CJMA 2G4FA 4QNWA 1PUDA 4ZO8A 4P7QA 2PBOA 4DYKA 2ZRXA 3KVKA 1JNDA 3NGJA 1BGGA 5I09A 1G7VA 4FNTA 2NSXA 3R89A 4BK9A 3HFTA 4LCQA 1DWHM 3SUUA 3S0CA 1A3XA 4KCTA 4FOJA 1XIIA 2PGFA 3TNOA 2FZNA 3KS5A 2GVYA 1LM1A 2WM0A 3AYVA 2DEPA 4GYKA 3S5ZA 3CPGA 2EPHA 2Q09A 1AK5A 4M1RA 3R10A 3N2TA 2CBUA 5A6SA 3SJ3A 4GGBA 3KL3A 1YDVA 1XCWA 3CMFA 1YBQA 1WQ5A 3GW0A 4LYQA 4IMAA 2VGFA 1I0BA 1XF0A 2FFIA 4M24A 4NZ1A 2VO5A 1QBAA 3GDRA 3KOYA 2DSWA 1PAMA 2ATSA 3LEPA 1GQNA 4YJ5A 3NFUA 3AHTA 4UFJA 4DBDA 4JYFA 4GFSA 2XISA 1LLZA 1MZHA 1PWLA 2Y8VA 1J93A 2PAJA 2ZRUA 1LORA 4KQNA 1JJKA 3UW6A 1L8PA 4MWAE 4C7FA 4DAFA 1JZ8A 2E67A 5BXPA 3NZQA 3THQA 5D03A 2QJMA 2UY3A 3MBDA 1JFXA 4P8WA 4BQ4A 3G1FA 3ANUA 1EA9C 3TU9A 3E0LA 2WHJA 4FXFA 2DT0A 3W75A 2XVKA 3L21A 4KERA 1MW3A 1R2TA 4XISA 2PGEA 1KR0A 2FGLA 3BWWA 3NYZA 3PN8A 3OYXA 1QHPA 4S3GA 4OZOA 3VGEA 3VC6A 3ELFA 4S3EA 3ITVA 4S3KA 1S5MA 4E2DA 3W2NA 3AU2A 4QS6A 1H63A 3LM3A 2PF0A 3OVGA 3EWBX 1DQXA 3HPFA 5I06A 4A3QA 1QI5A 5CPOA 5IDZA 2CXEA 3DFQA 1XR2A 4J1OA 5AYYA 3N73A 1P0KA 4LH8A 1LL6A 3T6CA 4ZEPA 4GQGA 3C2YA 3VNJA 1K4GA 3ITXA 3PULA 3UD6A 4WSJA 3ZJ7A 1NOUA 3DH7A 3FKKA 2V5KA 3NDYA 2ZUTA 2GGGA 1XINA 3QHMA 4HNUA 1NWTA 2QUUA 3VGHA 1BXBA 5HATA 2AL1A 3G8EA 3PZGA 1PDYA 1ZP4A 3HQ1A 1W3LA 4XV0A 5GPRA 3TQPA 2ZTJA 4DJDA 4POCA 7PTDA 5D8ZA 1L0PA 3F2DA 2JALA 4XZNX 3G0XA 3EZ4A 3MHFA 4TIMA 1U1UA 1YXCA 1MWOA 1UMLA 1OJXA 3NUKA 4UFLA 5C9XA 1LROA 4PFMA 4Z1CA 4ATWA 2VGGA 3GVQA 1RVGA 1ZUAX 3L5LA 1TV2A 4KS0A 4O18A 5FOOA 3DXIA 3UP8A 2H3DA 4PRRA 4DRSA 3UXIA 3T0DA 3U7VA 3QQ1A 1V3MA 1UC4A 4PUJA 4G7EB 1VFHA 4Q4PA 4GGHA 3MWAA 3TVAA 4B9YA 1EEPA 2OT0A 2DZWA 4MMWA 2WVSA 5DBTA 4B4FA 1D8CA 4NUWA 1IR2A 4D1JA 3FJNA 4C6LA 2D22A 5HDRA 3CTLA 5LIWX 2WNNA 4XX6A 3VKJA 4CN4A 4HNOA 4PBFA 1AW1A 3IVTA 1OFPA 3BV7A 4Q4QA 1KLZA 1M9HA 1FWCC 3ABZA 3AISA 4IICA 1VCFA 1VB9A 2ALRA 1OK4A 4U3CA 3UG5A 3DFNA 1SZRA 3H54A 4GVHA 4E0CA 4ML9A 3TYBA 2WSKA 2YCKX 3C8FA 4S2CA 5DXXA 3C3UA 2VZSA 1Z44A 5IBXA 3C3NA 4RR4A 2QMJA 1RQBA 1G4EA 4KIEA 5EMMA 5FF2A 4JIRA 5MKGA 4UR9A 1ZAIA 3HPSA 3DCPA 1DE5A 2IQ0A 3V75A 2P5NA 1Q45A 1NQ6A 3V1PA 3ZT7A 2XIJA 4MM1A 1KCKA 1CXFA 2FTYA 1M41A 1SO6A 3GHRA 6A3HA 4J27A 3P67A 5D02A 2AL2B 5AYIA 1Q8AA 2NV2A 1XDMA 3PUEA 1BWLA 1ZCOA 1WDSA 3CMGA 1NP0A 3QBUA 4FNQA 1AL8A 3SY8A 4H9MA 5D33A 2Y5SA 4LS2A 4G7FA 4QP0A 4U28A 4XBSA 3SCTA 4DWDA 4GK8A 3ZWTA 4AH7A 4GJ1A 1EP2A 2PWHA 2V8ZA 4AXKA 1RJRA 3XINA 3G1XA 2V5CA 3KVJA 1A80A 4C1NB 1BPLB 2DSKA 4QITA 3T4CA 2QZRA 3GTHA 3QN3A 4XD3A 3ARWA 3UWVA 3VD9A 1OD8A 3DESA 3E0FA 3PC0A 4ZGYA 1O5RA 3SCSA 1AW5A 2GFTA 1V6YA 1JD7A 2X09A 4QJ4B 2CZFA 1W37A 3AS2A 3T40A 3TFXA 3U6WA 3ZLFA 1J5TA 1JF5A 2C7FA 3LNMA 3WBWA 2YDQA 2VX7A 3WQEA 2HK0A 4AHQA 4GX9A 1EQCA 1QI0A 5I23A 3RM8A 3ABXA 1KNWA 1W9DM 2VQUA 1YX1A 2DZBA 5CZKA 4DEFA 1ZL1A 3R94A 4AD5A 3CQKA 3HN3A 1IQ8A 1NP2A 2WMGA 3PG8A 4R53A 1US3A 1EC8A 4I6VA 4PRTA 3G77A 3AHVA 4JCLA 2ZZ2A 3T8LA 4ZO6A 1R3RA 1KGWA 4LVAA 3M5VA 2UY2A 4M7SA 3CHVA 1R3SA 4HK7A 4F0MA 3BLDA 3WQ8A 2NV9A 3SQMA 2FDSA 1JYVA 2QUNA 4S1FA 4IGMA 3UZXA 3VOIA 1FXPA 1Q6CA 2BY1A 1HP4A 3CLWA 3MUIA 4WGXA 4ZTXA 1ODUA 5HULA 1DJXA 3M44A 1ELSA 3NZRA 1JVNA 3C6CA 2ZUNA 3RLVA 1CW2A 3LTPA 4A8RA 1JZ6A 1TELA 4IT1A 1RBOB 1VBJA 1WNOA 5FL0A 3GH7A 5LA0A 1UPPA 1RCQA 1XCXA 2FPTA 3KBSA 2VFIA 3ZLGA 3VCNA 3LRKA 3IPWA 3BANA 3EWUA 3SCPA 2GUUA 1GYMA 3THCA 1ADSA 1OGBA 6ENLA 3E3HA 2XTKA 4AD2A 1VFUA 1CXIA 2VEIA 5I02A 4KFNA 3QHNA 3W72A 4ACZB 2GGIA 4W7WA 1YE4A 3GU9A 1OIMA 1RSCA 2WC4A 3GC2A 2BXVA 4KIRA 4MOZA 3PTKA 2Y4SA 3TE9A 1TVPA 3VOHA 3NQMA 5FSDC 1A5CA 1HZYA 2WLYA 3L2MA 2Z7GA 1W8SA 4GQBA 3GU1A 3M47A 2HVMA 1LTDA 3PTQA 4B5TA 1PZ2A 3VU2A 2NXHA 1XPGA 5KTLA 1DL3A 1EC9A 1KGXA 4M1BA 3SUTA 4IXXA 1UR9A 4NJJA 2V69A 3VNKA 1CCWB 3DAQA 3COTA 1HQTA 4L64A 3QZAA 3O6CA 4AISA 4L7ZA 4C91A 3GC4A 3WH9A 3OBAA 3M46A 4JKMA 1TTJA 3RXZA 3W7LA 1OINA 1V6VA 1PIIA 3PNZA 3LS9A 1EQPA 3W53A 1G67A 3MO7A 3VZXA 2NWRA 1BD0A 1DTUA 3HF3A 3M16A 5GVJA 4H00A 1TX2A 1F61A 1VAHA 1MDLA 1UG6A 3GNNA 2QUTA 1UUQA 1O68A 3WLHA 4DO7A 1JDEA 4YTQA 1XIFA 2RDUA 3F7JA 4AIOA 1HP5A 4FF5A 1KM2A 3UZ5A 1Z48A 5TNVA 1NY1A 1C91A 4JIPA 4HMCA 4XO6A 3IGSA 4WLCA 4LB4A 1UKTA 5LNVA 4HCHA 1HJWA 1I1WA 4E4UA 4JXCA 3GKFA 2HJPA 4PMOA 1QI3A 5H8PA 1KC7A 1AQFA 3UA3A 3TSDA 3GK0A 3CO4A 3QMTA 3W23A 5C54A 1W9VA 3H21A 4EKJA 1OG0A 3WELA 4HZ7A 1XLFA 4UFHA 2A2IA 2DZXA 2VD8A 3LG3A 1U5JA 2YCJA 1TVLA 1XGEA 1GCYA 3MT1A 2D24A 1SW7A 3BJFA 1RK6A 2OOFA 4Y8EA 3MMUA 4QNEA 1EDGA 4X0VA 1V3KA 3W1NA 4J3TA 1XGDA 2DH3A 5EMUA 4ROQA 2DP3A 1QW8A 3MC5A 1VJIA 4JOMA 4OGZA 4KEUA 4PMJA 1YHTA 3UVAA 3W86A 3GTIA 3F4DA 3CMJA 3AQUA 3IIZA 2QCMA 2Z27A 4RJEA 3O06A 3K8LA 3N9SA 5MKGB 4C6PA 4UWMA 3HIJA 1HO1A 1XQKA 3VGGA 1XDJA 4PB5A 2FYMA 2JF6A 5U4NA 3KBWA 3CZLA 4YMZA 3W3OA 4MPKA 1UP2A 3ARTA 1CECA 3NO3A 3NVDA 3P81A 2GOUA 3Q58A 4BWLA 3PZMA 3GHTA 1QK2A 4ZA0A 3QTPA 4F0SA 4W8LA 1J01A 3VOJA 1KXTA 1Q7MA 5FSEC 4CVWA 1H1ZA 2A21A 1W1YA 4WJ8A 4UOZA 3DECA 4AIUA 1QJWA 3BOFA 5T9CE 3UZZA 2PDLA 4GNJA 2Y7GA 5FJUA 3E2RA 4HBKA 4HB7A 2WZMA 4WCJA 3VIHA 1R3VA 5HPOA 3GDMA 2ZZ6A 2QCFA 5DCEA 4C6NA 4D1IA 3UT0A 3B8WA 3L0KA 3LCXA 4YVXA 3BZJA 1JYXA 4HA4A 4JQAA 3AHYA 2YCLB 3W7HA 5I0DA 3PTMA 4LF1A 1A0EA 3ONBA 1VYPX 3GQYA 3R58A 4LVBA 3CGTA 4PTWA 1M6JA 2GJLA 2WQDA 4O0QA 2OKOA 4H7VA 4RX0A 2A3AA 1XG3A 1OFDA 2VGIA 3FFSA 3KBNA 3NL3A 3HM7A 3TYDA 1C7SA 3RJXA 2ZVIA 5AYZA 3BMVA 4OFCA 3BSHA 3GLCA 3GXFA 4IISA 2CERA 4H41A 2PU0A 1E1FA 3BAXA 3TLQA 2G37A 3AWOA 1TPDA 4DWSA 4KH2A 3CAVA 2L5HA 3C0LA 4WKAA 1H62A 3AWNA 2XIOA 1KCXA 1RQHA 3HGOA 1RXOB 1XW8A 2YCEA 3WDHA 1RCOB 1IYXA 3APYA 4H8VA 3FK4A 3VX1A 4C60A 4ZODA 3N4FA 3OZYA 1KXHA 1BG4A 1FDJA 1J5SA 4DJFC 3VKAA 5I00A 2CLPA 3ITCA 3ARVA 4J9JA 5CBIA 3GXDA 3U57A 1AL7A 1BSIA 3BLFA 1KBIA 5AKQA 2IXVA 5D9MA 1W54A 3EEGA 2Z2UA 1B57A 3C0SA 3U5UA 3TJLA 4IQJA 1ZBWA 7ENLA 5E0FA 3WH6A 2IQDA 3OBEA 3NOEA 2WNZA 1K9EA 2E9LA 5AC5A 3ES7A 4OOZA 2VMFA 2V2CA 3BGAA 3OHMB 2C15A 1QK0A 1W1VA 4ZCWA 1QT1A 5F2GA 2BLEA 3CH9A 2VRKA 4LJ3A 4O1FA 1E6PA