1O5XA

Plasmodium falciparum tim complexed to 2-phosphoglycerate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structure of Plasmodium falciparum Triose-phosphate Isomerase-2-Phosphoglycerate Complex at 1.1-A Resolution
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1o5xA00
4XBSA 3N14A 3GAYA 1ONRA 2TMDA 4O52A 5EBUA 1TPEA 1KLZA 1TJRA 1A5AA 3NQ7A 3NQ6A 4IWWA 3L0NA 3NPXA 3WFAA 3M5YA 3R5EA 4HPXA 4NZJA 5LNVA 3A5FA 4N9EA 2FLIA 1XBVA 4S1FA 1EUAA 3C52A 2B7OA 4RXFA 3WJWA 1SSDA 2PE4A 1VJIA 2H3DA 3G1XA 3QW4B 5D04C 1H7RA 1L6WA 1TV8A 4ORIA 1HTIA 3DXIA 1H7PA 4FX6M 1NFBA 3FYOA 1W3TA 2QUTA 4O54A 2LLEA 1F2JA 1GYNA 3LHUA 4LV4A 4HNTA 3KVMA 3TSMA 2NV2A 1R47A 2J88A 3CB8A 2UV8G 5DN1A 2GVJA 1EWEA 1OFDA 2CLEA 3E02A 3VFLA 4A29A 4UTKA 2VENA 1PVNA 3M47A 1ML1A 2P1FA 3ZS4A 4WJEA 2FPTA 1DV7A 4JGDA 2BXVA 1A5SA 3P61A 3UYCA 3HG4A 3IIXA 3W1AA 3MI6A 4QAIA 4RKAA 3DI0A 3O15A 5BMWA 2RDUA 1LOSA 5A8GA 2VC6A 3NL2A 3UWQA 2QJIA 3TSDA 1T99A 1W1ZA 2TYSA 3UZ5A 2YW4A 1RQHA 3HG2A 4ZQMA 5I3FA 1QOQA 1XUUA 4YLWA 3NQCA 1AMKA 3GLCA 3S5YA 4MFDA 1R2RA 2A1YA 3PULA 3MP5A 3O6CA 4POCA 2OT1A 3VI2A 3M44A 1QPOA 5F1UA 1GYLA 1UUMA 3NQ8A 3MO7A 4UMCA 4JTLA 1OK4A 3G1YA 4DO6A 2E6DA 3NM1A 5ABTA 2TPSA 2Y62A 2O7SA 2W79A 3BG9A 1MZHA 4PFMA 2CFFA 3EX1A 1N8FA 2WSRA 2A4AA 1I4NA 3THAA 1QR7A 5KZDA 2AGKA 3FEMA 4JTJA 5G2IA 3RLVA 3PB2A 2C18A 1N55A 3TXVA 3S1UA 3GDLA 5DLCA 4TMCA 1WBHA 1VLWA 3FYPA 3EEGA 4Y6GA 3PBWA 2FJKA 3WJXA 1VHCA 1YTDA 4O18A 2Y70A 1I8JA 5J5RA 1DBTA 1F73A 4UXDA 4AVFA 1K02A 3OBKA 1F05A 5I3GA 4ZL1A 1SO5A 1SW0A 4UC5A 4HKPA 4C1KA 5D38A 1JCNA 4JTSA 1OX5A 4MYAA 3T78A 2I1OA 1GVRA 3S42A 4UFMA 2VFHA 1B3OA 2CZDA 5CSSA 5KTLA 3HPXA 4UTTC 3W74A 1LBFA 3ZFHA 3HOJA 2J9ZA 1KM3A 2HMCA 4O11A 4IMEA 1ZHAA 1OABA 3DKLA 1KTNA 1SZEA 3BO9A 1SSGA 3DBPA 3O06A 2G97A 4RX0A 3FLUA 3M1ZA 3P74A 4K7VA 1W56A 1TPH1 3NR0A 4K39A 1G7UA 2VEMA 1OYBA 1VHNA 1OF6A 5AHNA 5D2TA 2QJGA 3IEBA 3N19B 4JXCA 3NQVA 1GVFA 3KFTA 3HGOA 5EL1A 3L68A 3GKAA 3MHGA 4O15A 5U4NA 2WNQA 2V82A 5LGXA 4LS0A 1WYIA 4JTHA 3RK8A 4UUIA 4E0CA 4Y96A 4OV9A 5HJLA 1DJNA 4PH6A 2H6RA 3CPRA 2ALDA 1I2RA 5LSMA 1EPXA 1H60A 1ICQA 4W9TA 2QDGA 1UJPA 3G1SA 1XDLA 2RFGA 4O19A 3W7RA 5EYWA 1VZWA 3HB9A 3A23A 1QO2A 3D0CA 3LDVA 3HGSA 3KOFA 3LRKA 4FXSA 4JR5A 4TO8A 2ZRYA 3DFPA 3NPUA 4N6EA 4U28A 2Y85A 4FX8A 4AWUA 1MEWA 5DBUA 1S5WA 1CI1A 3B4UA 4G1KA 1OX4B 2GQ9A 5LNWA 4LVAA 3ANYA 1X1OA 4LRTA 3C2RA 4N6FA 3LI1A 7TIMA 1C9DA 2RH9A 2ZRVA 4RZ4A 1TPB1 1PCWA 4ADUA 1JVNA 1WOAA 4CNOA 2Y7DA 4DBDA 2B4GA 3LXCA 3C3NA 1DKWA 1DQWA 1VCFA 5D02A 2E6YA 3N34A 5K3VA 3W7IA 2VEKA 1X1ZA 4ZQNA 4LUJA 1I2NA 3R12A 3BG3A 4WZHA 3M0ZA 1FCBA 2B7NA 5F2IA 3GXPA 1GTHA 1WDWA 5HINA 1O5KA 3A24A 1LCOA 2V8ZA 5HWMA 1B9BA 1YDNA 4CQ9A 3ABRA 1TQXA 3UWWA 5G2HA 5AHFA 1W5NA 4GBUA 2CLMA 4OT7A 1KV5A 3C8FA 4OWGA 3DKJA 3MYOA 2GJNA 3C2FA 1SFLA 1A53A 2X1SA 3ABQA 4A22A 4K8EA 1X6UA 3P67A 4H3DA 3S5OA 5D09A 5L9FA 5D2VA 4KFPA 4JTEA 3OIXA 1SZGA 2DZUA 3V75A 3USBA 3LX9A 1RV8A 4M5PA 4OV4A 4PTNA 3N3MA 1HUVA 1ZAIA 4UTTA 4L4MA 5E0KA 3EKLA 4LWWA 1E51A 5AYYA 4I9AA 4M19A 1FWNA 3STCA 5D37A 1OX4A 3S1WA 3GDMA 3NPWA 1IXQA 3TR2A 1OJXA 1NAL1 3L5AA 3OHIA 1JCXA 3W07A 3LLDA 3B06A 3SSJA 3VE7A 2VFEA 1MO0A 4ICNA 1TPVA 2NX3A 2Z0IA 5LNUA 1TV7A 1JCLA 5LHEA 3PBUA 4CLMA 1W54A 4NQ1A 4A2RA 3MI2A 2X2GA 2OT0A 3P82A 3B03A 1P0NA 2A85A 4HIBA 3STGA 5HMSA 4X3ZA 3QQ0A 4H6KA 5MHBA 2WSYA 3WK1A 3EWUA 4WX2A 3BLFA 2ISWA 2CLHA 1A50A 4KKXA 3PG9A 1G4EA 4LOCA 3PG8A 3FKKA 1Q6OA 1UASA 5CZTA 2ZA2A 2NUWA 1D9EA 3L66A 2RKXA 2QCMA 1VC4A 2ZZ1A 1RPXA 3P5YA 2E09A 2BWGA 4U4MA 5HNRA 4JYFA 6ALDA 3IGXA 3W88A 3W7CA 4FNTA 3LXAA 4MZ8A 3PR2A 3NL5A 3EX2A 4Z1BA 5H2ZA 5G1TA 5K2ZA 2HTMA 3G0UA 4GWEA 1TTIA 3L5LA 2W0UA 1UBSA 4PL2A 5FF4A 3L2IA 2G95A 2R91A 1SW7A 4JEQA 1ICSA 4IPJA 3EKZA 3HO8A 2C13A 4MJZA 2VEIA 4OQVA 3W1QA 1D3GA 1AW1A 1SU5A 3W70A 4IXXA 1EP2A 1JUKA 4LVGA 4NVTA 1W37A 1GQNA 4JY9A 3W1RA 1EEPA 3L67A 5CZ0A 1O4UA 3CIWA 3TJXA 2QCCA 1KFKA 1DVJA 3BGGA 3GXNA 5AHMA 2R8WA 2X30A 4MPQA 1F6PA 4ZVJA 2CZEA 1X8FA 4JYDA 4M6QA 5HQEA 2RHGA 3G0XA 4HSNA 1TO3A 3C6CA 4IPIA 3NQFA 1PL9A 4HNNA 3QMTA 5F1VA 2BTMA 1O60A 1L6YA 2Z6JA 4QITA 1VGAA 1BWLA 4UR7A 3YPIA 4GRSA 3OVQA 1FCUA 4ALDA 4RR4A 4IMFA 1V7YA 4LU0A 3TFXA 1VQTA 1YPFA 3WK2A 4XBKA 2ZZ7A 2A7RA 4DF0A 3UY7A 3B05A 5TQLA 4WXZA 3NEVA 4O12A 4CCDA 5D2YA 1QPNA 1PIIA 2VXNA 1KFLA 3I7QA 4UTWC 4NXSA 1Q6RA 5D2WA 1PE1A 1R30A 1GPWA 3UNDA 3B8DA 5E93A 3BGJA 4UNKA 4AH7A 1F74A 3G18A 3QPYA 4PA8A 1FCQA 1H1YA 3V1PA 3INPA 3DGRA 2DZVA 4DF2A 3W7MA 4Z1DA 3MJYA 2A6NA 2V9DA 4QM1A 3OEXA 3EXTA 2QUVA 5AHIA 1T96A 1MEIA 5F4SA 2YSWA 3LCWA 2QF7A 4BF9A 1ZCOA 1W3IA 3OVPA 2PCQA 5KITA 3UXDA 2FB2A 3W7HA 3H55A 5G4EA 3QPZA 4XQ6A 5AOUA 4K36A 1EUNA 2A2IA 2JKAA 1ZAJA 4LVDA 4BI7A 4DBEA 3KVLA 2EPHA 3L21A 4UTHA 2WNNA 4FNRA 4ZQPA 3M5VA 3W2MA 4GUHA 4NU7A 5CPOA 3ZWSA 3UWYA 1D3HA 4WOQA 4Z1AA 1G4PA 1KM2A 3W1TA 2QAFA 4RV8A 5K7JA 3B0PA 3LBMA 4LS2A 5DCBA 3DENA 3WJSA 3OG3A 2X1TA 2E6FA 2A21A 2CLIA 1AW2A 3ZWTA 3W2KA 1Q6QA 4EF9A 1HL2A 3BPWA 2V2HA 5I3KA 4JTUA 5K9CA 1MEHA 1ZNNA 4GUFA 2VELA 3MHFA 3U8GA 2QCEA 5FESA 1W5MA 3I65A 4GUGA 5G4WA 3UPBA 1J4EA 2ISVA 5LNRA 4ML9A 5DY3A 4XKYB 2H3BA 3O16A 2JKPA 5AC8A 1H5YA 3P8IA 4NUWA 3QFEA 3DFQA 3NGJA 2V0TA 2Q8LA 2DJXA 3DH7A 4UR8A 2PRLA 2Y89A 3A21A 4YWIA 4I7UA 1W8SA 2Y7GA 5I3HA 3G8EA 1L9WA 1EX5A 2DZPA 3M6YA 2PURA 4LC8A 3STEA 1IXNA 2R14A 5K9DA 2FDSA 3IGUA 5DBTA 2J27A 4DF1A 3PUEA 4Q33A 4LV9A 3UWZA 3NL6A 3TU9A 1GOXA 2RDTA 3G1FA 3SECA 4GUJA 3ABSA 3MW7A 1GZGA 3PVFA 2A6LA 3DFOA 1SFJA 1TRIA 4AAJA 3SW6A 4MY9A 3NL3A 1CW2A 3F1QA 1NSJA 1H61A 3PC0A 1OG0A 4N9BA 1K8YA 2I14A 3SZ8A 2Y7FA 4IGHA 1FUYA 1KFEA 2ZZ2A 3DHFA 2Y6ZA 3PUDA 3G1HA 4MIMA 3NZRA 2NZLA 3TA6A 6TIMA 4CCEA 1QAPA 2CLOA 4HSOA 3LI0A 1TPWA 3HPSA 1I45A 3S6DA 5D33A 5HWJA 5TIMA 1G67A 2NUXA 2ZZ5A 5EMUA 3ATYA 4B5NA 4AWTA 3HPZA 2O7QA 3W1MA 1GG0A 1A5BA 3R89A 4MZYA 3S1XA 3NVTA 1KM5A 2QCHA 1YXDA 4GFSA 1OYAA 1LYXA 1FXQA 1ME8A 1XUZA 1BTMA 5K4ZA 4UTWA 4BI5A 4PC8A 2C6QA 3LCLA 4S2CA 1J5TA 3L0KA 1O95A 5LGZA 2E1DA 1EP3A 4K37A 3KHJA 2BX7A 3SGZA 3T7VA 1IIHA 2RDWA 1QCWA 1DL3A 1P4CA 2ZZ6A 3LCHA 4AXKA 3GIYA 3N2MA 4IJBA 3CLMA 1TTPA 3W85A 4XKYA 3W72A 1ME7A 1VYRA 1Z42A 4BWLC 4Y9AA 3MUXA 1M6JA 5CPNA 1PV8A 1YTKA 2FTPA 5CG7A 3W7OA 1W5OA 3TKFA 3F03K 3G22A 1Z41A 4A3UA 4S2BA 3DI1A 4O1DA 1H50A 4XWUA 3QMRA 3LLFA 1BWKA 1F7BA 3ELFA 3FA5A 1RD5A 2X1UA 2VKZG 1OFEA 4JTFA 3SR7A 5FI8A 4MLJA 2WNZA 4UTLA 1OF8A 4ZQRA 3TMLA 1OFRA 3E12A 3MP4A 1B4KA 1WOBA 5FF0A 1TRDA 3O6YX 1VS1A 2ZDRA 1WV2A 4QSHA 5LZLA 1W31A 3UD6A 3OA3A 4YMZA 4DPQA 3GDRA 4FNSA 4E2BA 4YXGA 3TCEA 1SW3A 3LTPA 3W83A 4UNLA 1JCJA 3W86A 4Q32A 4BR1A 4M6VA 3I7SA 3W6YA 1S5TA 1TPUA 4Z0SA 2QR6A 4NJJA 2F84A 1BKSA 3M43A 3IV3A 3W3OA 4FIRA 3R8RA 2DZXA 4FXRA 3LV5A 5K9XA 1RQBA 1GTEA 1YTEA 3CQ0A 3G1AA 2ABAA 3W2UA 1PHWA 2DZWA 2FIQA 5IM51 3TH6A 3DZ1A 1FQ0A 2GOUA 3HGRA 4RZ5A 5HULA 3PS7A 4HT3A 3KX6A 2V81A 4UFIA 4IXHA 4BFAA 5U7SA 3OVRA 3GNNA 3IIZA 1J2WA 5A5WA 4MOZA 5KINA 3AJXA 2WSQA 1ALDA 1JR1A 3W73A 1GVOA 3R13A 4LRSA 1IXPA 3C2OA 3G3DA 4DQWA 1A5CA 3A5VA 1XBZA 4Y8FA 2OZ0A 4LS1A 4KFNA 4UFKA 3W23A 4GNJA 1QDSA 2ATSA 3L0GA 4KWVA 4XTIA 2VFGA 1K3UA 3AO0A 1LORA 5L6UA 4LW7A 3FJLA 3CWNA 3C56A 1VYPX 2YFNA 3LTYA 3SI9A 4O1AA 4ZMGA 5LHFA 5DCDA 4IMDA 2WQPA 3W7KA 1IXOA 4MFEA 3QC3A 4J9JA 2JGQA 1K8XA 2ABBA 1AG1O 3TQKA 2B7PA 1M5WA 3QF0A 1K8ZA 1P0KA 2Q3OA 4K7YA 2D73A 4RXGA 1LM1A 2XN2A 1U5JA 4QNWA 1LRNA 1LROA 1MSSA 3NQAA 4O0ZA 4LT9A 5D2XA 1ZENA 4I7WA 1XCFA 3EX4A 2BLEA 3O1NA 4WY0B 1WXJA 3MI3A 3TV8A 1I2OA 4GE8A 5F4XA 1FY6A 2NXGA 3FKRA 1Q3NA 4FNUA 5AHEA 3W2JA 4BK9A 3UWUA 2JK2A 3UWVA 1ADOA 1GVQA 1Z48A 3P84A 4JX5A 1LLZA 1WBJA 4MLRA 4DO5A 3TMQA 2AQWA 3CEUA 2NV1A 4OHQA 3LRMA 5F2LA 2C0AA 5D03A 3U6WA 4DEFA 4KWWA 1FXPA 4BWLA 2NUYA 3QZEA 3LM7A 3BV4A 5KZMA 1VR6A 2YPIA 4IMCA 3P5ZA 4EWND 1NEYA 4O16A 2DP3A 2TSYA 4IX2A 4TR9A 3W1XA 3DU0A 1L6SA 4NNAA 2QKFA 3G0SA 3CIXA 4ONVA 1JULA 1FWSA 1NF0A 2YW3A 2YFOA 4GC4A 5D05A 1JQXA 2EAWA 1P5BA 4JTTA 3NZ1A 3GZ3A 4CNPA 1PHQA 2A7NA 1GEQA 2GVLA 3GK0A 3KVKA 3NNTA 4WQ6A 4N4PA 2DZSA 3HG3A 3STFA 1M7OA 4MKNA 3UZJA 3EX3A 1EB3A 1FCVA 3KAOA 1NVMA 3KRUA 5FEWA 1P1XA 3IVTA 1QFEA 1FDZA 4LTSA 4K38A 1XL9A 4IQLA 1H7OA 4O28A 3W7QA 2J6XA 3MWAA 5AN7A 3MBFA 4JICA 5AYZA 4WXYA 1QPRA 1FWRA 1EIXA 3BARA 1OFQA 3O63A 2X16A 4FHAA 2YYUA 3GYEA 1LDCA 3CHVA 5KSWA 1Q6LA 3G1DA 4GJ1A 4O1BA 2V5BA 4DXVA 3T4CA 4HNUA 8TIMA 4JTKA 3W71A 1JQVA 2QAPA 3S5NA 3W7JA 2BSLA 3M41A 1THFD 2OX1A 1T0OA 4R33A 1EWDA 5LKYA 1UCWA 2QDHA 2Y61A 5CZSA 2WOQA 3G1VA 3QRHA 4FB7A 4WY0A 1KV8A 3LHVA 4TU1A 2QCFA 1KM4A 3TUUA 2E5DA 3A9IA 3EWBX 1I2PA 3W2NA 5AB3A 1KW1A 1FX6A 3IIPA 5HUPA 3DAQA 5EA9A 2J24A 3M5XA 4A2SA 4Z0JA 2JKEA 4LC6A 3NA8A 2GPTA 3S9YA 1SO6A 5TBOA 4OE7A 3TX9A 4LVBA 1F76A 4E38A 3UY8A 2NLIA 2GVGA 4YL2A 2P0OA 1Q45A 4K6AA 3BG5A 2NX9A 4TX9A 1K03A 4FNQA 3I6RA 5AC6A 1K7XA 1EA0A 2X1RA 2ZYFA 4JIPA 1JRBA 3PAJA 1KFJA 4Q4KA 1W0MA 3F4NA 3NQDA 5KMYA 3FOKA 3NAVA 1OFAA 2QEZA 2QCGA 3FIGA 1OFBA 3LHYA 4PODA 3W7NA 3UQNA 1XBXA 4O50A 1SUXA 5HR6A 4LUIA 1IIGA 3N9RA 1DQXA 3VNDA 1ZJIA 3GB6A 4WOZA 3HQ1A 3ZR4A 4RLIA 3LCIA 4JYEA 3IIVA 4N4QA 3HBLA 2EKCA 3W7GA 3TJLA 3BVJA 3EWWA 3IVUA 1H1ZA 2J9XA 5AC7A 5FEZA 4Y90A 4NX0A 4AF0A 3FJ6A 3SY5A 5I3JA 2NWRA 4L4LA 5CPMA 2FQIA 1KM1A 3P60A 1XBYA 3C2EA 1YYAA 4PL1A 3UPWA 3JR2A 4XZ9A 2ATMA 1AL7A 2YZRA 5KZEA 3W7DA 3EWZA 3MP3A 3W1UA 4GXMA 2C19A 3O6DA 1ME9A 1VH7A 1WA3A 3CTLA 5D30A 5AYXA 2Y88A 4OBTA 4HNVA 2CLLA 1XC4A 5HUOA 3W7EA 1EP1A 1TREA 4NNCA 2QUUA 4E2DA 3GDTA 3TW6A 1QNVA 3O05A 3EXSA 1OK6A 4FF7A 2P10A 3C61A 5I3IA 1XXXA 4UFHA 3PF3A 1GWJA 4RZ6A 4HPJA 3M16A 2YR1A 1TYGA 3LHZA 4Z08A 2B7QA 1TPFA 4RCXA 3U2OA 4O53A 1LBMA 4JTGA 3FFSA 3HMJG 4FX7A 1NF7A 1GJPA 1FDJA 3BLEA 3TQVA 1VYSX 5FF7A 3PB0A 4CQ8A 4YCPA 1KFBA 5F2MA 2C16A 3CT7A 4XTDA 2EHHA 1QO5A 4IOTA 3VE9A 3SGUA 4ORMA 2CLKA 1U83A 3E9AA 2PRMA 2Z1BA 4JX6A 3LCFA 4EIVA 3G8RA 4H4IA 3GDKA 1K7FA 4JNMA 2CZFA 5FF3A 1B4EA 4MUZA 2OCZA 3QW3A 1S3HA 1VRDA 2EGZA 3FS2A 2G96A 1XDMA 5AFDA 3GXTA 2FFCA 1N7KA 1LLWA 3GX9A 4QIUA 2E6AA 3VCRA 2H8XA 3TW7A 1VPXA 4I7VA 1IF2A 4EF8A 2EF9A 5D32A 2NX1A 3QSRA 2ZTKA 3PUOA 2E68A 5T26A 3MBDA 3ATZA 3O07A 4X22A 1IGSA 2B0MA 1KM6A 4LNYA 2Y7EA 4AHOA 3H53A 2FPVA 3NG3A 4AEOA 4O0KA 3IGSA 3N9SA 2WPBA 4N2YA 3P62A 1GG1A 4CQAA 1YADA 4RJEA 2QCDB 3HF3A 3W76A 3TE9A 3C2VA 4LVFA 3TDFA 1LZOA 2VFFA 2DJLA 1SR9A 3H54A 5DXXA 5H91A 3NQMA 3CC1A 4K8HA 3PY2A 4WD0A 3SFKA 1HFBA 1HG3A 3HJZA 1AL8A 1G4SA 2H8ZA 3WJYA 3KRSA 2CWNA 2ZFAA 2C14A 4QQ3A 3UXAA 1XFBA 2HSAA 1LBLA 2JGYA 1YDOA 3EB2A 4O13A 1UUOA 3MMTA 2G5WA 2ZA1A 3QYQA 3NQGA 2IQTA 3TC7A 2E5BA 4IX0A 5E1QA 1KTCA 1W3NA 3GKFA 1SZFA 1XI3A 2A5HA 4Z1CA 1M7PA 1FDYA 1O94A 5K4XA 3T55A 1AK5A 3R2GA 2VEPA 3W22A 4N02A 4D2JA 3BW3A 4TMBA 2C3ZA 2V2DA 2I9EA 4ZQOA 4UMAA 1H7XA 1UB3A 3N2XA 1SO4A 2ZRUA 4P61A 2ZRXA 3W1PA 3NDOA 4UTJA 3W9ZA 4NJGA 4M6PA 1ZALA 1OX6A 1QWGA 2F7FA 3LBCA 4C1LA 4YCOA 2YCEA 3RFAA 1K7EA 2ZZ3A 5DY2A 1TCDA 1WX0A 3W1LA 1ZY9A 3QM3A 5LNSA 5F2GA 4NNBA 5GVJA 4UCGA 2OJPA 4UTIA 3WK0A 2HS6A 5BOOA 2YGYA 5BRBA 1XKYA 2V30A 3QQ1A 2TRSA 3KRZA 4FNPA 3CEPA 3PBYA 3T40A 4O14A 5F4WA 1B57A 1I2QA 2E5CA 2ZBTA 1TPC1 2JBMA 3TC6A 3CM4A 4MVAA 2KZHA 3LCGA 4NJKA 2NXIA 4UMBA 3M7WA 3G24A 3KVJA 3S5ZA 3W7PA 3G3MA 4NJIA 4HHPA 2QCDA 3DFTA 2XN1A 5CPLA 5C55A 4AMAA 2YX0A 1TJPA 4O4WA 3IIOA 1XM3A 2V2CA 1HO4A 4BI6A 3BLIA 4MJMA 5BW6A 1JJKA 4O4VA 4ADSA 2OMAA 2ZRWA 4R53A 1GT8A 1KTBA 5C6MA 1SZNA 3GNDA 2HS8A 2YXGA 1TB3A 1LTDA 4IMGA 3Q58A 3BK0A 3W7LA 1JUEA 4IUOA 3GR8A 1LRTA 3IVSA 3P81A 3Q37A 3HG5A 4ADTA 4NT0A 1KBJA 2Z6IA 1LRQA 3TAKA 2VFIA 3I7RA 1WAUA 4MY8A 3RF9A 4PCFA 2GUUA 3DFSA 3NQ2A 1X7FA 1TPDA 4FEZA 4FIQA 2YDAA 4R34A 1G69A 1BEUA 1R46A 1DJQA 1QMLA 1GVSA 1FWTA 3O8AA 3W87A 2ZTJA 4QISA 1DORA 4JS3A 5EY5A 1C29A 5BNKA 3TFCA 4WUIA 3P7YA 3Q2DA 1JCMP 2WJZA 3M9YA 4AHPA 3DFNA 3GVGA 4QNEA 3LGEA 3LV6A 1LP6A 3RLUA 4DO4A 1OVDA 3NM3A 4A21A 5C2XA 1F5ZA 5CGQA 5BMXA 1TV5A 1R2SA 3I68A 1OHLA 1G7VA 4UFLA 3Q94A 5EKYA 1YLVA 3W84A 2AAMA 4NXKA 2CW6A 1R2TA 1T8XA 3TSBA 4OGZA 3E96A 4UIOA 2WKJA 4P2VA 5CSRA 3ABOA 3W2LA 2DU2A 3LRLA 3WK3A 3N73A 1KM0A 2PRHA 4MY1A 1H62A 2PC4A 3NOEA 1VCVA 4X9SA 5HWNA 3CU2A 3BW4A 2ZZ4A 4PEKA 4EOUA 4AHQA 3THQA 4OU1A 1G6CA 1H63A 1Y0EA 1HO1A 2FPYA 3PM6A 1ZAHA 3BW2A 5IBXC 3PBVA 2NWSA 1JCYA 5G1YA 5FF2A 4DPPA 3LHWA 3L5MA 4O10A 3EWXA 4JD4A 4MYXA 4JX4A 3IRDA 4QJ1A 5J5DA 2ZA3A 4DELA 3TNOA 3T44A 3NQEA 4M7TA 3CWOX 2XFWA 3QMSA 1H7WA 5G5IA 3P80A 3JS3A 1JUBA 3L65A 1LOQA 3W1NA 2ISSA 3VKJA 3TXZA 3TROA 1SPQA 1WQ5A 3QH2A 3LTSA 3WJZA 3HGJA 3A22A 1LOLA 4N9CA 4NX5A 2C1HA 1RR2A 2Q3RA 4EVZA 1YDVA 3PSWA 3LHTA 4JTIA 3S8HA 1O5XA 4O1CA 4UTUA 1TQJA 1TMHA 5DELA 2NXHA 3NO5A 2J9YA 4ZQCA 2VOMA 4AF0B 3M5ZA 5FEPA 5DCEA 3GR7A 3NYZA 4MZ1A 5G2WA 1ZFJA 2DZTA 1YXCA 2W6RA 1DHPA 3S1VA 1TSIA 4ZZ9A 2VFDA 3EX6A 1DOSA 4GUIA 3TIMA 1W5QA 1SO3A 3GAKA 1L2UA 5HR7A 1RQEA 3PWAA 2BZNA 3SIZA 2Y63A 2V5LA 4KFOA 1V5XA 3LXBA 1YPIA 4UFJA 3P8JA 4CNNA 2Z2UA 1ICPA 3LERA 4JDBA 3LCXA 2Q8ZA 4JIQA 4O17A 4X2RA 3PSVA 4R7JA 1PS9A 3DHDA 1VCGA 5FEXA 5AHLA 4UTMA 1FBAA 3QSTA 1KA9F 3B0VC 2GQAA 3EWYA 4O8RA 1RVGA 4NZFA 5C5YA 5CKSA 3RMJA 1W5PA 3L9CA 4TIMA 2FB3A 3C4UA 2A0NA 3RNDA 4AB4A 1H7NA 1OFPA 5C54A 3S0CA 2H90A 4RK8A 2GJLA 1SQ7A 2C15A 2QCNA 3HIJA 1FWWA 1C8VA 1RZMA 4O57A 4NJHA 1CX9A 1KBIA 3RU6A 3LB0A 3F4WA 4FO4A 4XUGA 2CLFA 2E77A 3E0IA 4M7SA 1OFOA 2WV8A 3TK7A 5SWUA 1YXYA 3KXQA 1QOPA 1H51A 1TIMA 3QJAA 1TTJA 3C0JA 2XN0A 1VLIA 4JDYA 4N9DA 3JRKA 5EPDA 3QEZA 3W75A 1MXSA 2ZQ0A 3TQ0A 2CZ5A 4JN6A 4LY8A 1QPQA 3LOTA 1PCKA 2YYTA 3MYPA 3TAOA 3B0UX 3MHUA 2A7PA 1AW5A 1OYCA 1S5VA 3B04A 4JY8A 2ZCGA 2ZRZA 3E49A 1KFCA 5CZJA 1JRCA 4CCCA 1KLYA 2DORA 2QJHA 3NPVA 2CU0A 1TTQA 2QCLA 1F6KA 3SJ3A 1G4TA 4AWSA 3K30A 4HN4A 3EXRA 3NXFA 1Z44A 2GQ8A 5IBXA 2WO5A 4WY0F 2R94A 5DXYA
chains in the Genus database with same CATH superfamily
3BSGA 4XBSA 1TPEA 3R5EA 3ZM8A 5LNVA 3HA1A 1TMLA 3C52A 4RXFA 4ROPA 1SSDA 1H1NA 3QW4B 2YBUA 3G1XA 4UOQA 4BKNA 1H7RA 1OC6A 3MCMA 1L6WA 4ORIA 1DWIM 2E25A 1K1DA 4H04A 1H7PA 3B9DA 3OW1A 1MUCA 1UWAA 3LHUA 4LV4A 2OG9A 4HNTA 1Q6DA 3EA1A 5BWFA 3TSMA 2NV2A 3SRHA 5A6TC 1OFDA 2CLEA 3WDIA 4UTKA 4MB3A 3M47A 1ML1A 3ZS4A 4WJEA 4ZO8A 1DV7A 1UR3M 2JFEX 3RJXA 4GINA 1EYEA 5XIAA 3R8HA 3GU9A 4DRSA 3HG4A 3IIXA 4WK9A 2E9MA 1QJWA 3L4VA 5A8GA 3NL2A 4ZA0A 5EMYA 3GG7A 3UZ5A 2YW4A 2ZXBA 4QCFA 4ZQMA 4CQCA 1UMLA 3A12A 4ATDA 3FVDA 3GE7A 3BL3A 5FD0A 1YE6A 3G77A 3CZLA 4KWOA 2I5QA 3PULA 3M44A 5F1UA 3VNZA 3EEZA 3ZR5A 2I5GA 2XJ7A 3GVQA 3MO7A 4IPLA 1OCBA 2AKMA 1B5TA 5ABTA 3DFYA 4J4KA 4F0KA 3B9NA 4FS9A 1MZHA 1WB0A 3UZYA 3K46A 1N8FA 2WSRA 2XWDA 1I4NA 4CU8A 2NQ9A 3THAA 2BASA 2AGKA 1GKQA 2J75A 4NSBA 3A3HA 3PB2A 2C18A 1N55A 3S1UA 4LH8A 1FWEC 2UY5A 3WZ0E 2FHBA 5J5RA 1DBTA 4AVFA 1LWJA 5B80A 3RXZA 3MDUA 4DX3A 4GO8A 1F05A 4MWAC 4ZL1A 5EMKA 1SO5A 4HKPA 4C1KA 5D38A 3HJEA 4XG1A 4JTSA 4H8NA 1WKYA 5FL1A 3W25A 3IGHX 9XIAA 1E0UA 5KTLA 2BOFX 3HPXA 3VA8A 2Z25A 3NIYA 3IJDA 3N29A 3RIKA 1HW6A 4AG0A 2J9ZA 3NGFA 4H9ZA 2A3LA 4IMEA 1OABA 3R0DA 4JL1A 1KTNA 1SZEA 3MY9A 5A6AA 3DBPA 3E3HA 3V5CA 3P74A 4E3VA 1YBQB 1DJYA 3HQPA 2XSAA 1VEOA 3WBEA 4EKJA 1OYBA 5XINA 4CD4A 1AH0A 1KC7A 3U2EA 4HU0A 4JXCA 4C6MA 2A3HA 3OGSA 1GVFA 4HYWA 2V63A 3AROA 3EOOA 3MHGA 1WYIA 5HMEA 3CIVA 3RK8A 4QDMA 2QJJA 1R7AA 1GOOA 5H8UA 4K1WA 2BVYA 1H60A 1ICQA 3IARA 4MWAE 2J8FA 2PWGA 1XDLA 2RFGA 3W7RA 3B8TA 1ADSA 1S3TC 1AH4A 1H3GA 5DO8A 5FJTA 3KS5A 1QO2A 2ACUA 2CETA 1XH2A 1QI2A 3ARTA 3KOFA 3LRKA 4JR5A 3LGGA 4JKLA 3WENA 3NPUA 4PRRA 1QI0A 2WVVA 2QNEA 1NOWA 3KCJA 4G1KA 2OOGA 1OX4B 2VOTA 2GQ9A 4A3YA 4EPKA 4TX6A 4FOKA 3ABXA 1X1OA 4RE3A 3LI1A 5HOSA 1C9DA 4PMXA 2ZRVA 4RZ4A 3VGGA 1YX1A 1PCWA 3Q67A 1DWHM 4JBRA 3RN6A 2O4QA 1UKPA 1BQGA 1WOAA 4QDWA 3SURA 2FGBA 3UPMA 2OZ8A 2DQWA 4W8AA 1YBQA 3W7IA 4HHLA 1X1ZA 1I2NA 3WUFA 1S38A 3GXPA 4LUTB 4YTRA 3WQOA 1B9BA 1YDNA 3SRKA 5AYIA 2FH8A 4OT7A 1PZ1A 3MYOA 4MNJA 1WE5A 4ACYA 1SFLA 1A53A 4K8EA 4JFVA 2V3FA 5D09A 5FIPA 5I06A 1Q65A 4JTEA 3ZQ9A 3VOCA 3V75A 3LN3A 3SM0A 1C8XA 2VVSA 4C6IA 3GHSA 1BYCA 4OV4A 5BWAA 1VF8A 1HUVA 1P7TA 1JFHA 4FXFA 4UTTA 1HKJA 2VDHA 2J8TA 4I6KA 4M19A 1M3UA 4C65A 3ENLA 1FWNA 1FHDA 1OX4A 3T08A 4IT1A 3WNPA 1BGGA 4JFSA 3NPWA 1IXQA 2NVCA 1VFFA 5DF0A 1ZZMA 4RV3A 3B06A 4YIWA 3SSJA 4GY7A 1QVBA 3MSYA 5B7YA 3VC6A 4W87A 1O66A 4HPHA 3PBUA 4CLMA 1W54A 4A2RA 3MI2A 1L6GA 3P82A 1P0NA 1XIDA 1M41A 3AXIA 4XIMA 4WDTA 3URAA 3STGA 2WANA 5HMSA 4H6KA 3SN1A 4RUBA 3U2ZA 4HCDA 3UCCA 2D2JA 3S2MA 2C0HA 1GVYA 1M7XA 3GNRA 1E73M 1G4EA 4PSRA 1UASA 4LUTA 5CZTA 1D9EA 3L66A 2RKXA 2XPKA 1VC4A 1OY0A 3I10A 1RPXA 2E09A 3DGBA 4CN1A 3GHRA 4JYFA 6ALDA 4V2XA 3W7CA 4FNTA 2XGIA 1E15A 5T9BG 4PCNA 4GIAA 3QOMA 1MFUA 3MC5A 5M5DA 1VIWA 5I02A 2PWVA 4I9TA 3L4ZA 2VCBA 1BTCA 2G95A 3CUZA 4JEQA 1SW7A 1ICSA 3AIWA 3OYZA 1XGEA 4FMVA 3RLHA 4HOXA 1JDFA 5FJOA 2OEMA 4OQVA 3RCMA 1D3GA 3JVAA 2WHMA 1O7AA 4GH1A 4IXXA 1JUKA 1W37A 4JY9A 4HZ6A 1EEPA 5CZ0A 3CIWA 3TJXA 2XIMA 2QCCA 1GQKA 3BGGA 2R8WA 4MPQA 3I6EA 3WLHA 4ASTA 1XD0A 1EXPA 4ZO6A 1E6XM 3ES7A 1V6TA 3Q65A 1OBAA 2RGLA 3AHYA 1L6YA 2Z6JA 1VGAA 1B3ZA 4US6A 1NWRA 1RD6A 4JIIX 5FJJA 3OVQA 5JU6A 2MUCA 3UJSA 3K4AA 1YPFA 1JZ7A 2BOEX 2Z1KA 3WK2A 2ZZ7A 2A7RA 3OZOA 5HQLA 3EZ4A 2ISDA 3NEHA 5TQLA 1TELA 3K8LA 4O12A 1QPNA 1PIIA 2VXNA 3TVAA 4OECA 4PYSA 1BRLB 1PE1A 3RPMA 1R30A 1FFQA 1AUSL 4MSSA 2PDIA 2PLJA 3NO3A 3QPYA 1H1YA 3INPA 3UVAA 5A8NA 3PZNA 3UP8A 3RM9A 3SCTA 1IEWA 2ICSA 3R1ZA 2V9DA 1NDYA 3E2QA 2IQ0A 4MMWA 2GWGA 2BV9A 2QUVA 3R25A 2QUNA 4TTUA 4PBEA 3TYUA 3LCWA 2QF7A 3W29A 3N2CA 4WEVX 3DYPA 1W3LA 2PCQA 3D3AA 3N13A 3UXDA 1R3YA 2XIOA 1A5OC 1CYGA 1EUNA 2F6KA 2JKAA 4RZBA 5IHRA 3LGDA 4J3ZA 3UW6A 3W2MA 4HQVA 2C71A 3T0TA 3CHDA 1ISWA 1D2KA 4Z1AA 4PTVA 2GDVA 1BVNP 1R3QA 1W9XA 1S2UA 1Z32X 2QAFA 2QYGA 5DCBA 4GNVA 3DENA 3B8IA 3WJSA 3OG3A 8A3HA 1EOMA 5AYBA 2E6FA 2EPMX 4H83A 4JQ4A 2CLIA 3EDJA 3VZXA 3F2DA 1NIUA 4F0LA 1VBJA 1J8VA 1ZNNA 1P0EA 2QJNA 5FESA 4XIAA 3UPBA 1TVNA 5EFFA 2H3BA 2F38A 2PLCA 3QFEA 1SMDA 4CVWA 4AQLA 4UR8A 2PRLA 2E8YA 3A21A 2YIHA 3IAPA 2YCIX 1EX5A 4HU4A 3C5QA 5K9DA 4AZCB 1EL3A 3S6OA 3LD5A 1J96A 3WEZA 4YJ5A 3WLPA 3NZQA 4EACA 1GHSA 1TRIA 1RAKA 3TC3A 3F1QA 1E3ZA 4URIA 2I14A 2Y7FA 1OT2A 3A9BA 4JL2A 2Y6ZA 4CNUA 3D46A 4MIMA 3ZLGA 3WH5A 2NZLA 5CQ1A 1E5JA 2ZUTA 1RHCA 2CBUA 4DUXA 3HPSA 1I45A 2PU0A 3S6DA 3OP2A 5TIMA 1G67A 1UKQA 4Z1YA 5T91A 5EMUA 2DSKA 2O7QA 1XP3A 3LPOA 4ZB0A 3FN9A 1XUZA 5K4ZA 1UD3A 2JE8A 2C6QA 3LCLA 4HA0A 5LGZA 1EP3A 7ENLA 3T0CA 4A8IA 3PZTA 2QDDA 3LCHA 3BAYA 4DZHA 3N2MA 4LBSA 3WKZA 3EB3A 3KRBA 2GDQA 1Z42A 2OELA 2UZ9A 3N4EA 1EZ2A 3MUXA 5CPNA 1VBUA 1Q63A 1D3CA 1W5OA 3KBVA 1UA7A 3RCYA 1Z41A 2QS8A 1A5UA 4TVUA 3UYIA 4AZCA 3DI1A 3LSCA 2WMFA 1DIOA 4XWUA 4H2CA 2Q01A 4XB3A 1MW0A 3LLFA 1BWKA 1F7BA 1X7IA 3XIMA 3ELFA 3FA5A 1KQYA 4MDPA 4DXXA 2X1UA 3GVWA 2VKZG 4JTFA 1RCOB 1XJBA 2ZADA 2ASHA 4AIUA 4U33A 3GTFA 2O9TA 1OF8A 3HPFA 3NDZA 3O0KA 4QROA 1OFRA 5FF0A 5A6LA 4WDWA 3V5FA 2G4JA 1WV2A 4QSHA 5LZLA 1W31A 3PWIA 3AHVA 4DPQA 4BJHA 4E2BA 4YXGA 3TCEA 1SW3A 3WEOA 3W83A 9CGTA 3DIPA 4D6HA 4F40A 2R24A 3NUKA 4WJXA 4ERIA 3T09A 2QR6A 2F84A 4FALA 1F3WA 1EFZA 3R8RA 5CC3A 3LV5A 5K9XA 4JAWA 3G1AA 2ABAA 3W2UA 1B31A 4OOZA 2WHLA 5IM51 3W24A 1FQ0A 5HULA 4RZ5A 4HT3A 4IXHA 4F4RA 3FHAA 2DPEA 5KINA 2OU4A 3R13A 4ZSTA 2XM1A 4S3DA 2E40A 4J3VA 4UFKA 1QDSA 2ATSA 5DEZA 4KWVA 2VFGA 3A3WA 3FJLA 3CWNA 2WVTA 2NLYA 1TMQA 3VNJA 3SI9A 2HNHA 4AIEA 1T40A 4O1AA 1FA2A 4MNMA 3AOFA 4S3JA 4K1GA 2WMKA 2XH0A 2OSYA 1IXOA 4EP8C 3QC3A 1MFVA 1DWJM 2ABBA 4NZ4A 1MQQA 2Q3OA 3NZPA 3WBWA 4A05A 3ALGA 1KCLA 1LRNA 1B3YA 5CC5A 4OBSA 1BG9A 1ODZA 3FGCB 4LT9A 3MZ2A 1ZENA 4I7WA 1XCFA 4ECLA 2BLEA 3O1NA 3IAQA 4MWAD 3PPFA 3TV8A 1I2OA 3FKRA 1B9ZA 4BK9A 3UWUA 1FWCC 4INFA 3BDKA 1O5RA 4E3TA 1LLZA 4DO5A 2BHYA 3VOFA 4L65A 2C0AA 1GVIA 2J7CA 1KNWA 4RDVA 4BWLA 3LMZA 4M1BA 3QZEA 3LM7A 4C6OA 3P5ZA 2DP3A 5HQMA 3TN4A 3ARWA 4ZEPA 4HNCA 4IIDA 1JQXA 2EAWA 2CXEA 4M24A 4JTTA 3NZ1A 3GZ3A 4CNPA 3TYBA 1KRBC 4QSFA 3WYZA 1PHQA 3GK0A 2GVLA 3KVKA 1PYMA 4DB7A 4EWJA 4PUKA 1M7OA 4W5ZA 1Z7AA 1FCVA 4IH3A 1FDZA 1UJQA 1XL9A 1QNPA 2XZ7A 2J6XA 3KBSA 4D6EA 2G4FA 1A3HA 4Z42C 4WXYA 2PWFA 3O63A 1A3WA 2YYUA 3EA2A 3GYEA 4XZNX 1XRTA 3NURA 5KSWA 1Q6LA 4GJ1A 5HAOA 4DXVA 1RY8A 4HNUA 1BAGA 2WBKA 4E8GA 1DP0A 8TIMA 4HCLA 1THFD 2OX1A 2VZVA 1T0OA 2EQDA 5LKYA 1YPXA 3H22A 3GH7A 5CZSA 3QGAC 3LHVA 2QCFA 1V77A 4WSKA 5AB3A 4Q8TA 9RUBA 3OGRA 2P50A 4WGHA 3M5XA 2JKEA 3AYRA 4H6EA 4JKMA 3TTYA 3N18A 3GU1A 3VGHA 1JDAA 1FWDC 4LVBA 1UZ4A 2Y1HA 2NLIA 3A4WA 4YL2A 3S2JA 4K6AA 1Q45A 2NX9A 3CQJA 5JBDA 3CTTA 4FNQA 3I6RA 1EA0A 2D69A 2X1RA 1IV8A 2QF8A 1JRBA 4JIPA 1V0NA 3AIUA 4OOUA 3F4NA 3EAUA 3FOKA 3NAVA 2QCGA 3FIGA 3LHYA 4PODA 3W7NA 3CYVA 5HR6A 4LUIA 1DQXA 1OGBA 1ZJIA 2IPGA 2WLYA 4S3CA 3PZUA 4RLIA 3LEPA 3RHGA 4JYEA 3FK4A 3RITA 3ITGA 1XLIA 4ZGYA 3IIVA 4N4QA 4UTFA 3KLKA 3W7GA 3VZZA 1UZ1A 1MQPA 2QW5A 1QATA 2X1IA 2J9XA 1VP5A 1M04A 4DJED 2DVUA 5REQB 5I3JA 3LS9A 1FH8A 3HURA 5CPMA 1VFHA 1KM1A 4R27A 3UPWA 3E74A 3JR2A 3AALA 2DY3A 5CGTA 1E43A 3W7DA 3EWZA 1QXLA 1VH7A 1A49A 4GMEA 5D30A 2FGZA 2O92A 1PX3A 3BLOA 2Z27A 2D22A 3KOWA 4HNVA 3WDHA 1XIFA 5HUOA 3W7EA 1WCGA 2PP1A 1PSCA 2AMXA 4LEFA 3TW6A 3H2EA 2QVNA 4FF7A 4HMCA 1OCNA 3IANA 3M0JA 1I0DA 3DFHA 1HJXA 4JQAA 1EQPA 2QULA 1GWJA 3QXBA 4QHRA 3M16A 2YR1A 3AZSA 1Z69A 5FACA 3GTNA 2VZSA 3WF0A 5M17A 3HZ3A 1E4IA 2E0PA 1M68A 2HJPA 3LQLA 4GGHA 1AQHA 2PLMA 1R85A 4GC3A 3HMJG 4M82A 4OIFA 1JG9A 3TQVA 4CQ8A 5BU6A 5F2MA 5CJNA 1R3WA 3H6OA 3BGAA 3CQHA 1E3XA 1CLXA 2IKIA 3PBGA 3E9AA 2PRMA 1XLDA 2Z1BA 4FOUA 4X9YA 1REQB 1KWGA 3RYSA 5E9XA 4EIVA 4H4IA 4PGLA 2CKSA 2GGJA 4AD1A 2CZFA 2EG8A 1B4EA 2OCZA 4PB3A 3BAJA 2OFJA 3FS2A 3QFWA 2VC7A 5REQA 1CGTA 3FJ4A 5AFDA 2FYMA 5LYRA 3VCRA 2BB0A 1V3KA 3TW7A 3OVGA 2O56A 3C0LA 4I7VA 4JNZA 2EF9A 5EU9A 4QE1A 4DUVA 3S5SA 5D32A 1TZZA 3PUOA 3MBDA 2WWCA 5A8QA 4IQDA 4X22A 2QPUA 2PMQA 4Q4OA 4LNYA 3ZXWA 1PZ2A 2Y7EA 3H53A 4DJDA 2QMKA 1TV4A 3IGSA 2OWWA 3L4TA 2WXDM 4CQAA 1WP6A 5JIPA 4RJEA 5EMLA 1GJUA 3AIBA 1NWTA 1TA3B 4B2DD 3HF3A 3AMDA 3QYSA 4LVFA 3MSRA 1EBGA 2Z2AA 2DJLA 1E9LA 5H91A 2OSWA 3R94A 3NQMA 4PEEA 3W00A 3Q45A 2XFRA 1IQ8A 4R88A 1SJDA 2G3JA 2FZNA 3T2QA 1KR0A 3OLDA 3QBUA 1U5HA 3WJYA 2PDCA 2ZFAA 4IIFA 1YIXA 1DTNA 1LBLA 2JGYA 3SJNA 3GR4A 2VRKA 3EGJA 1PO9A 3NQGA 1E40A 5TF0A 2E5BA 2Z1VA 1F4HA 5CLWA 4IX0A 3VX0A 3OIHA 1SZFA 1XSJA 4DNMA 2I57A 3CAQA 1T8QA 1O94A 1REQA 1AK5A 2XIBA 2VEPA 4EANA 4N02A 4TMBA 4WSJA 2C3ZA 1PWMA 2Z29A 1UB3A 1SO4A 2ZRXA 2XFYA 1OX6A 1QWGA 2F7FA 4MHBA 1C91A 2I7GA 2VO5A 3LBCA 4C1LA 3H24A 1EX1A 3FCPA 3FSTA 4MKVA 5F2GA 5CSYA 4BS0A 5GVJA 1AH3A 1NFGA 4GYPC 2VX7A 1CEOA 3PBYA 2KX9A 3VINA 2E5CA 5BOFA 1TPC1 1OGSA 3SN4A 4NKCA 4O1EA 3GC5A 5BROA 1TA3A 4HHPA 1HT6A 4GQ0A 5CPLA 1VFMA 2YX0A 1TJPA 4O4WA 3H4WA 3DC0A 1UWSA 2V3DA 1J2BA 3BUVA 3WUEA 1EHAA 4MJMA 2PDMA 2ZRWA 1H4PA 1F61A 1SZNA 3SADA 4R9OA 1WO2A 3QQWA 1LTDA 1GOMA 4IMGA 5A3HA 3BK0A 4RDWA 3W7LA 2XM2A 3P81A 4F2BA 1GCYA 4NT0A 1O68A 3NOYA 2Z1SA 4KCWA 1LRQA 3VVGA 3PBMA 3TAKA 5A6BA 2TODA 3I7RA 3O0FA 3SO7A 2GUUA 5ECVA 3DFSA 5T8GA 3KZSA 4R34A 1R46A 1QMLA 3WQWA 1GVSA 2QQ6A 1CDGA 4NI8A 3CMGA 2Y5SA 4EPBC 4QISA 1SJCA 1QOXA 3Q2DA 1JCMP 4AHPA 4ERGA 2D2OA 1OC5A 4JQ2A 1WZLA 3TYDA 3NM3A 5C2XA 5CGQA 1R2SA 4XVDA 1K9FA 4YPJA 5EKYA 4HK6A 4NXKA 2CW6A 4QX4A 1R2TA 2ZUSA 1Q13A 2GOKA 4AZHA 4UIOA 4YYCA 3EDEA 1KD0A 3ABOA 3W2LA 3CAKA 3LRLA 3DYMA 4H01A 3JUGA 1H62A 3VOIA 1B3WA 4MJ2A 2BS9A 5DRIA 2ZUWA 2QHAA 4EOUA 2CEQA 3THQA 3V1HA 1G6CA 1Y0EA 2J7FA 1HO1A 3QN3A 3QHOA 1V0LA 3BW2A 4BF5A 5IBXC 4PCSA 3MZNA 4UR9A 5G1YA 1F8MA 3IV8A 1BXCA 3IRDA 4RE2A 4XZHA 3GHUA 3NCOA 3SRDA 3URNA 3T44A 4Z2LA 2FH6A 2XFWA 5AC5A 1H7WA 1DJIA 4XV0A 5G5IA 1OM0A 1BF6A 2JALA 1JUBA 3VD7A 1LOQA 3VM7A 2PF0A 4H41A 3ERPA 3EKGA 5JBEA 4Z2IA 4Q7IA 4PMUA 3UG5A 3PJUA 4DI9A 1IYXA 3A22A 3I4EA 3A6OA 3DCPA 4H8VA 4NX5A 2JF7A 2Q3RA 3S8HA 4O1CA 3MUIA 4E6MA 2XSBA 1PXGA 2ACRA 3M07A 5D9PA 1QBAA 3GTIA 3EYPA 4UQDA 1EJSC 2J9YA 1RP9A 3VMOA 1P0DA 4RPPA 1CGYA 5DCEA 4ZCWA 3GR7A 1JPMA 1UH3A 4IFRA 5G2WA 1ZFJA 4AY8A 3G1RA 3CUXA 3RDKA 1H49A 3LPGA 1CECA 1TSIA 2IXVA 4L80A 3C3UA 3Q4DA 7XIMA 3ARQA 3VAVA 4L9ZA 3BAIA 1W5QA 1SO3A 3EOLA 2V5LA 3P8JA 3WSUA 2Z2UA 3W53A 2Q8ZA 1R38A 3KBJA 4KPLA 4TQTA 1VCGA 4H2HA 1FWIC 4UTMA 3DN5A 3W01A 3EWYA 3FVMA 1RVGA 3L9CA 4TIMA 4CQDA 5C9WA 1MW2A 4AB4A 1H7NA 4I5XA 2GGEA 1ZQ5A 2YLLA 2O0TA 1V3IA 1SQ7A 2C15A 7REQB 3TN6A 3HIJA 4R9XA 1ZUAX 1CX9A 4GJIA 3ITOA 1Y7VA 1EDGA 1IEVA 4ZOBA 3F4WA 2G50A 2VZOA 4FO4A 1HQTA 4JIRA 5M03A 3KXQA 1F3EA 1TTJA 4DYKA 3C0JA 2XN0A 3ARUA 4JDYA 3JRKA 5LIUX 3QEZA 4HHHA 2DV0A 3NSNA 3LOTA 1BHGA 1W9PA 3MYPA 3TAOA 3MHUA 1IZCA 3PWGA 4S3BA 2A3EA 3SDOA 2V5DA 1KFCA 5CZJA 1JRCA 3CO4A 4LQ1A 2CU0A 4LYQA 1TTQA 3CO8A 1F6KA 5I78A 3K30A 1FWAC 5I79A 4M8UA 3EDFA 5A94A 3AIRA 2XU2A 2R94A 5DXYA 3EBVA 3PZQA 3ABZA 3N14A 4TVCA 4W88A 2GJXB 1A5LC 1A5AA 3NQ7A 1JF5A 5JIWA 2O9RA 4HPXA 4R7WA 3PFMA 1BXNA 2FLIA 2J74A 5JQ9A 1XBVA 3TOYA 4W8LA 4EE9A 4LCSA 2PE4A 2FTYA 1TWSA 3DXIA 3SAZA 3WLSA 3S83A 3FYOA 1W3TA 1F2JA 1GYNA 3S3GA 3KBMA 3CV1A 2ZKMX 2XDFA 5DN1A 2XIJA 1LG2A 2JIEA 3E02A 3VFLA 2VENA 1UOZA 4XX6A 3CQKA 2P1FA 3P14A 1V08A 1CGWA 5RUBA 1E4LA 3WBAA 4RPQA 5HPCA 4ZE4A 2E9LA 4GZEA 3UYCA 4QAIA 3DI0A 5BMWA 4QLKA 1LOSA 3NDYA 2VC6A 3UWQA 4H9YA 2QJIA 2WM0A 1W1ZA 3N15A 1XIMA 2OQLA 2TYSA 1CB7B 2WSKA 4UCFA 1RQHA 3LY0A 1LWIA 2PA6A 1QOQA 3T81A 3AHTA 3POHA 1XUUA 1BVWA 4KWUA 3MWCA 1AMKA 5ABGA 1DJGA 1T41A 3RX2A 3TYAA 4POCA 3VI2A 5JMUA 1QPOA 3AU6A 2PWUA 1UUMA 3KHDA 3NQ8A 4UMCA 2R82A 4H9XA 1AJ0A 3G1YA 2GJXA 1CT5A 3NM1A 1KRMA 1CGUA 3HFYA 3R10A 4DAFA 3FY1A 1E0XA 1XW8A 2O7SA 2ZX6A 2W79A 3BG9A 3W27A 4PFMA 4QQUA 2WCGA 1MZRA 4XK2A 2PB1A 2VD8A 1MMFA 2A4AA 4AZ5A 1QR7A 1WDQA 4W7WA 3FEMA 4JTJA 2F6UA 4L4OA 2ZX7A 1GORA 1MQRA 3VYLA 3TXVA 5DLCA 1UD6A 3EEGA 2PI6A 3WG6A 2XG9A 5DFAA 2QXWA 3LU2A 1T5AA 5I3GA 3U2CA 1RSCA 3KL5A 3CASA 4B3KA 4UC5A 4PMDA 3BQ6A 3CZJA 1H0GA 2XHYA 2X41A 3HTWA 4UBPC 3T78A 2I1OA 3S42A 4AD4A 2POTA 2VR4A 2CZDA 1LG1A 3ID7A 5I77A 1NU5A 3GW0A 2H9AB 1WZMA 2XH2A 2W4XA 4QCEA 4QG8A 2V6AA 1WZKA 4I8DA 1SSGA 3O06A 4RX0A 1LUCB 2PDGA 5GJMA 3ZIZA 3SY8A 1W56A 1TPH1 3DYOA 4GZIA 1ZJBA 4QJ4B 3GG8A 1AODA 1OF6A 5G1MA 5AHNA 5D2TA 3NQVA 1V6XA 3KFTA 3HGOA 3EB4A 3L68A 2Y2WA 3AICA 4YWSA 1JYWA 5A2BA 2HQAA 2EJ1A 5U4NA 5LGXA 5DMNA 4LS0A 2VP8A 1NDZA 3AMGA 4DBSA 2CIPA 4E0CA 2H6RA 3H2OA 1I2RA 1EPXA 2GLKA 4B4HA 1EJ7L 2ZC8A 3QZAA 1UPMB 4O19A 4A8RA 3F4VA 1VZWA 3HB9A 1FHLA 3D0CA 2HVMA 3HGSA 2FMNA 5DX7A 5LIWX 3WNMA 1JDCA 3EMZA 2ZRYA 3DFPA 5C7HA 3QZ6A 4U28A 2Y85A 2CBIA 3HQOA 1MEWA 1S5WA 3MQTA 1N82A 3SUWA 3B4UA 4W93A 1PTDA 5LNWA 3ANVA 3GZAA 4N6FA 7TIMA 1EOKA 1E71M 2RH9A 4GOAA 1XPYA 1IT0A 4ADUA 1P43A 2H9AA 2HNEA 4DBDA 3IJLA 2HV5A 4XAFA 1VCFA 2E6YA 3QPEA 4RDYA 1E6RA 4J5NA 3WQPA 4H6QA 4C6DA 3BV7A 4LUJA 3ZSTA 3LENA 3R12A 3BG3A 3W28A 4ICCX 4M6UA 1R87A 1PX4A 2V8ZA 4NRRA 4D6CA 1TQXA 4KRTA 3CUIA 4ZENA 5AHFA 4G1NA 3ITCA 2CLMA 3DKJA 3VTRA 3SUUA 4A22A 3ABQA 3S47A 3QR0A 4DIAA 1F07A 4CU7A 5D2VA 6PTDA 1SZGA 1RP8A 2DZUA 1A5MC 4OJYA 4BEQA 2Y8KA 3MTWA 4M5PA 2CCRA 2WW5A 4PTNA 3N3MA 1ZJAA 2GSHA 4CCZA 3H2FA 2V68A 4HHMA 1ZAIA 4LWWA 4I9AA 4L61A 3STCA 5M1TA 1VD6A 3AS1A 3UU0A 3S1WA 3U9IA 1S1PA 4E4UA 4JNYA 4PTDA 4QBXA 1OJXA 1NAL1 3JU2A 4Q4SA 3BMWA 1DWFM 1W9UA 5C9XA 4V28A 4J7RA 4LEQA 1MO0A 1E55A 1TPVA 1TV7A 1JCLA 1E9YB 3ZJKA 3CS2A 1SR0A 4KRZA 1A4LA 3IS4A 1PZ3A 3IJ7A 1IEIA 3B03A 2A85A 4XZLX 2G3IA 3MPGA 3QQ0A 3GSMA 3N6QA 1CLKA 3EWUA 3VNMA 5C70A 3N11A 4WX2A 2E8ZA 3ZOAA 2ISWA 2CLHA 4I9JA 3PG9A 3FKKA 3CL6A 2HK1A 1KCXA 1UP2A 4DZ5A 1HX0A 2ZA2A 5FA5A 2WCAA 1YDYA 1G1YA 1AFSA 2BWGA 4KIRA 2ZUUA 3KZPA 3NL5A 3EX2A 3T1GA 4Z1BA 1XGDA 5H2ZA 2EPNA 1UR9A 4GWEA 2GGGA 3WY1A 3L5LA 1OWQA 2W0UA 3B0XA 1UBSA 3MMDA 2R6OA 5KETA 1DWGM 3R0UA 4DLMA 2R91A 4PMZA 3BAXA 1XIGA 1YNYA 3TJ4A 1R3RA 2QGYA 4PRTA 1UD2A 1RUSA 1SU5A 3W70A 4NY2A 1L8NA 3LYEA 4L64A 2KAUC 3K13A 2E3ZA 4LVGA 4W84A 3E2RA 4A3HA 4AEEA 4DO7A 4HA1A 1DVJA 2X30A 3SCQA 3UR2A 3ITLA 2RHGA 3G0XA 4HSNA 3NQFA 4HNNA 4QITA 2FTWA 4AU0A 3YPIA 4GRSA 1FCUA 1HKMA 4ALDA 2FKPA 4RR4A 4IMFA 1V7YA 5C0QA 3REQA 1JAKA 1AZ1A 3B05A 3ARRA 1OC7A 2CBVA 5D2YA 4AD5A 5D2WA 4AIBA 4M29A 2VHLA 2PD5A 4B5XA 1F74A 4JHZA 3KE0A 1KO0A 3G18A 3WDRA 1IR1A 4UZSA 2CLPA 4Q8VA 1P0BA 3GH4A 3DGRA 4ZTYA 3KBWA 4XD6A 2D0HA 3G2GA 4S3AA 3UG3A 4QGCA 5C8BB 3W4RA 2XVKA 1POJA 3WF2A 4BF9A 1ZCOA 4RNHA 5HBFA 3GS6A 3OVPA 4J3XA 2GVEA 3SGGA 4ZOEA 3H55A 5G4EA 5AOUA 4XQ6A 2A2IA 4LVDA 3V4BA 3L21A 1I1XA 4IQEA 1DE5A 5CPOA 3UWYA 4K68A 3LPPA 1D3HA 4QJ5B 1G4PA 1KM2A 3DBNA 1U1HA 2BG5A 3W1TA 4L9YA 4KT2A 5K7JA 2XZ9A 3B0PA 3SBFA 5AZ0A 1RA0A 1W1PA 1AW2A 1XQLA 3HN3A 1HL2A 4QXIA 3T0BA 1XR2A 1MEHA 2XISA 3U8GA 3KOYA 1E72M 2X8RA 2F8QA 3MSGA 1CWYA 3TR9A 2ISVA 3TZFA 4B5TA 4ML9A 4XKYB 2DVTA 1AVAA 3O16A 2JKPA 4GXWA 5JH2A 3P8IA 4NASA 4NUWA 1V6VA 1U30A 4DUOA 3DH7A 3CV2A 3RM4A 1R3TA 5I3HA 3LK6A 4BF7A 4LC8A 3STEA 3FDGA 1IXNA 2R14A 4NZ1A 1ONXA 2FDSA 1JL8A 1JDDA 3IGUA 3WN6A 4GVHA 1DJZA 1JZ5A 3N9KA 3UWZA 3G1FA 3AI0A 4GUJA 2OYMA 3ABSA 3MW7A 3GXIA 3L4UA 1ZP3A 1GZGA 3MCNA 2AQVA 3JW7A 4MY9A 1KBBA 4G7FA 3BTNA 2WVUA 3KL0A 3PC0A 1FUYA 4CD8A 4QLLA 1OCJA 5A6JA 1KFEA 1XV8A 1LJYA 3C86A 3NZRA 4PULA 4GJJA 4MAVA 4CCEA 1QAPA 4BQ5A 1MDLA 3AMLA 1SJBA 2J8GA 3BCDA 2OQHA 3LBOA 3WL1A 4B5NA 2I56A 3W1MA 2BODX 4MZYA 3S1XA 3EOUA 4F2UA 2QCHA 1YXDA 2ACQA 1TCMA 2I9UA 1FXQA 1ME8A 3M0XA 1BTMA 1EEXA 4UTWA 4BI5A 4S2CA 1J5TA 3L0KA 1V6WA 2E1DA 4K37A 3SGZA 3T7VA 2Z28A 3AHXA 3BOXA 2WJEA 2HWGA 1WZAA 1QCWA 4MF4A 2GSJA 2ZZ6A 4AXKA 2W92A 4IJBA 2G3FA 4ZE5A 3F4CA 4Q22A 4XKYA 3W72A 4PB5A 3A64A 1OT1A 3LA4A 4B9YA 3KEHA 2P76A 4HJFA 1PV8A 1E1CB 3VD5A 3SRFA 1XYAA 5CG7A 3F03K 5I0DA 1NARA 2WQDA 3E5BA 4S3GA 3IUHA 3RRXA 1H50A 4L6HA 2C79A 3N17A 3QMRA 2OYKA 4WKFA 4CNTA 4F79A 4UNIA 1ZLPA 1RD5A 1W8GA 4PUWA 1OFEA 1MW3A 3GC4A 4PMQA 2WNZA 1QI3A 4PMYA 4DJFA 2J7BA 1HJSA 3MP4A 1WOBA 4MDOA 1TRDA 3WLNA 4P5UA 1M9HA 1VS1A 4XVEA 4F3HA 1Q6CA 3OA3A 2PTXA 4A3QA 5E0CA 4FNSA 1R5YA 3LTPA 2VQTA 3W86A 4E8DA 4Q32A 1XHGA 4HMNA 4BR1A 3I7SA 1WUEA 1TUXA 1DHKA 3UGVA 4NJJA 4XD3A 3M43A 3ITXA 4EPDC 2DZXA 2CWXA 4LBUA 4AD0A 1RQBA 2GUBA 4LX4A 1YTEA 3CQ0A 4YYFA 4JTDA 3WQEA 1BQCA 2Y8UA 3ONCA 2FIQA 3VGEA 3W02A 2QV5A 1OD8A 1K4HA 4Q4MA 2QT3A 2ZUNA 4QR6A 2PC8A 1U2YA 2V81A 4OUEA 4Q8UA 4UFIA 3GNNA 2P8BA 3SIMA 3WF3A 3PJWA 1JNDA 1JR1A 3W73A 4IP7A 5IDIA 2NQ5A 3NZGA 3ITVA 3G3DA 3D3FA 4NP7A 5TNVA 1YHTA 2Z7GA 1XSKA 4Y8FA 1R3SA 4DWSC 2HRWA 4GNJA 4XTIA 3PZGA 1RCXB 5BU9A 2BBFA 2OR2A 1WKFA 4ZMGA 5LHFA 5DCDA 4PUUA 4PUEA 2QLYA 3WQFA 1OGGA 2UY4A 4R85A 4MFEA 3SY1A 3WUGA 1K8XA 1OD0A 3TQKA 1AG1O 2B7PA 1M5WA 2XH7A 1Z6KA 4NILA 1CIUA 3AXMA 2D73A 4NIRA 1UD5A 4M51A 5EGRA 2XN2A 5BXPA 2DSUA 2QVHA 3NQAA 4Y2WA 1VAHA 4C6PA 4IISA 4C91A 8XIMA 2OGYA 1IEXA 4IIGA 1FY6A 4FXJA 3W2JA 1UH4A 4WSHA 3CAWA 2JK2A 3QHMA 1Q2SA 4KMQA 1MXDA 4GVIA 4CN6A 3P84A 4MLRA 2QPSA 4X63A 4GVGA 5F2LA 5D03A 1XYMA 4DEFA 1FXPA 1WXYA 1FWGC 3A4XA 2Z26A 4GI8A 2NUYA 3VDBA 3DDMA 4C5ZA 2XINA 3DHPA 1VR6A 4EWND 4O16A 2VR5A 4IX2A 4J3SA 3W1XA 1QPKA 4V1XA 3GTHA 8RUCA 4NNAA 2Q71A 1FWSA 5D05A 3W6MA 1P5BA 1PYFA 3AYSA 1GEQA 4WQ6A 4J2PA 2I17A 3N4FA 4N4PA 4PE8A 4DY1A 3HG3A 3TWBA 5HNNA 3W81A 1EB3A 1DIDA 3KAOA 1E4MM 4WDXA 3H12A 3KRUA 5FEWA 1P1XA 4L9XA 1H7OA 4PN2A 3W7QA 2EPOA 4AD3A 3VNLA 2E4TA 1PEZA 3MBFA 5AN7A 5AYZA 3S46A 3BARA 2X16A 3VNKA 1LDCA 4P7OA 8XIAA 2RJHA 4JIEA 4O1BA 3GNXA 1B1YA 1XSIA 2V5BA 3AYTA 3I3BA 1XIHA 2VGGA 3QV8A 4ZR8A 1ONWA 1LF1A 3ARVA 3S5NA 3W7JA 4IM4A 2GL5A 3N2TA 1M53A 1EWDA 3ICJA 1UCWA 4IFOA 2WOQA 4FB7A 4U2YA 4TU1A 2PSNA 1QHPA 3GM8A 4HN8A 4GKTA 1KM4A 3WMCA 3EWBX 1I2PA 4U3AA 3W2NA 2EPLX 1KW1A 3I6TA 3IIPA 3OG2A 4EAMA 3DAQA 1L8PA 2F2KA 4JKKA 2WC7A 1A47A 3NA8A 2HROA 3HMCA 1D7FA 1SO6A 1EYWA 1E6PA 2DFAA 4OE7A 3TX9A 3WMSA 1F76A 4E38A 2GVGA 2QUMA 4FI4A 1LWHA 2P0OA 3T05A 1QNOA 4J35A 3URBA 1UIOA 2C1GA 3VIKA 4JHMA 4ZB2A 1JYNA 3VIGA 3V5OA 4Q4KA 1W0MA 3ARXA 3IJ6A 2QEZA 2J6VA 2HBXA 1OFBA 3CLWA 5D8WA 3TN3A 1SUXA 2WMGA 2V67A 3N9RA 3SCVA 1W3HA 4RW5A 4A3RA 3HQ1A 3ZR4A 1K70A 3VKAA 3VIIA 1TJ1A 2POZA 2HE8A 3SFWA 4D1JA 3GTXA 1QU4A 5AC7A 1XIIA 2FHCA 1JGMA 3SY5A 2NWRA 1MNSA 4L4LA 2OSXA 1HKKA 2FQIA 3HM7A 5IHSA 3FEQA 3P60A 1S5NA 1XBYA 3BJTA 4PL1A 5AY7A 3QHNA 4NG3A 1AL7A 2YZRA 4E5TA 4W5UA 3UZWA 4IL2A 3ZSSA 1UP0A 1X1NA 3L2MA 2VWSA 3KDOA 3WNLA 3WH8A 4E2DA 3GDTA 1XLBA 1V02A 3EXSA 1OK6A 3C61A 5I3IA 1BFNA 1N8IA 1XXXA 3OQEA 1ONEA 1VIZA 5I23A 4HPJA 4Z08A 4RNFA 1DYSA 1TPFA 4Z2GA 2PS2A 1VKFA 4J28A 2VMFA 4O53A 2HVOA 4GLEA 2EJAA 3CUHA 3FFSA 4ZFCA 3O3RA 1UR1A 1FDJA 4ROQA 1IT7A 2BVWA 1VYSX 2CYGA 4YTSA 1EA9C 3CT7A 1JD7A 3UR8A 1ECQA 1W91A 1LQAA 4NZ5A 3SGUA 2CLKA 4H7CA 4AEFA 2FFIA 2IUZA 3GFZA 4JX6A 3LCFA 3ZJ8A 3G8RA 3QGVA 1KKRA 4C6FA 5FF3A 3AXHA 1E0WA 3S1GA 1ESWA 2X09A 2BVDA 1N7KA 1YW1A 1LLWA 4QIUA 5DANA 2XGBA 2H8XA 1XYCA 1VPXA 1JF6A 2WMIB 2YDSA 3QSRA 5LXEA 2E68A 2FVKA 3R11A 1SVDA 5T26A 1BD0A 2RUSA 2ZX5A 1Q85A 3ATZA 1Q6EA 2B0MA 1BSIA 3NG3A 4X60A 2OLHA 4O0KA 5IRPA 3EOSA 2J4GA 1QHOA 3N9SA 2WPBA 4J1OA 4N2YA 3K1GA 2GDUA 4FK9A 2ACSA 4HMEA 1QNQA 3O2LA 3BSHA 1RJRA 3H21A 3CZEA 2QCDB 3C2VA 1LZOA 3DG6A 1OIMA 1SR9A 3H54A 3CC1A 1GW9A 4G56A 3VDHA 4CVUA 4WD0A 3S4TA 2VX4A 2R1NA 3HJZA 1CXEA 4QEHA 3SCNA 2H8ZA 4U2ZA 3SQMA 1NWUA 2C14A 3LZ3A 1DIKA 1RBOB 1MW1A 2BVTA 1DPMA 1UMYA 3P6LA 1WDRA 2R9RA 3V0TA 3QYQA 3TC7A 1OEPA 3UXLA 1NP0A 1XQKA 1PTGA 1TFVA 1UHVA 1FDYA 3ARZA 3T55A 3R2GA 1J10A 3BW3A 5H1WA 2V2DA 4LF2A 3TYEA 3W1PA 2XVNA 4MPKA 4UTJA 2E1WA 3VKDA 4ENLA 4YCOA 3FDKA 3RFAA 1S1RA 2ZZ3A 3OODA 1M7JA 2ADAA 2RAGA 1ZY9A 2XTKA 3KS6A 1Y5WA 4XZWA 2HS6A 1XKYA 4PTXA 2TRSA 3KRZA 3CEPA 3BSMA 1VFOA 2RDXA 1PKNA 3TC6A 4MVAA 1KXQA 1JDEA 2NXIA 4UMBA 5CAKA 3G3MA 2QCDA 2JF6A 2XN1A 1TWDA 5BXTA 1PKMA 1AA1B 3T2PA 1XM3A 1B2YA 5C9UA 2VQUA 1JJKA 4O4VA 3WNNA 1Y65A 1GT8A 5C6MA 2HS8A 1TB3A 3WLOA 3B8UA 1GOWA 3L12A 3IVSA 1LRTA 3Q37A 3VGFA 1PKLA 2Z6IA 4JTAA 5HANA 4Y9OA 4MY8A 1WAUA 3ISIX 1XLKA 1S2CA 5BCAA 4GIRA 4FEZA 2YDAA 1G69A 3LM3A 3H2AA 3ME3A 2P0IA 1DORA 1VEMA 2A3AA 1K8CA 1XLGA 1VB9A 1GUVA 3UVIA 3MU7A 1ZU8A 4PCTA 5M3WA 3FA3A 1F5ZA 2PEVA 3I68A 3W84A 3OZYA 1C93A 1VEPA 3UT0A 1T8XA 4OUIA 3TSBA 2PGRA 2W66A 3E96A 2WKJA 4P2VA 5E70A 2ZWYA 2DU2A 3H26A 1LL7A 2E9BA 2PRHA 1CZ1A 3CH9A 1VCVA 3UR7A 4GYJA 5JXQA 2EKGA 3BW4A 4DJEC 1VFTA 4AHQA 4W8BA 3CB3A 4YTQA 2WVSA 3PBVA 2NWSA 4LCRA 1OZQA 5FF2A 5I07A 1HKIA 2XSXA 3LHWA 1UUQA 3EWXA 1VJZA 3PAOA 4MYXA 4JX4A 3VDGA 4RE0A 5J5DA 2QZRA 4RW3A 2HVNA 4DELA 2HK0A 3NQEA 2VWTA 4M7TA 3CWOX 2V5KA 1SJAA 3QR1A 3BQ5A 1Q2RA 3GNPA 3E6EA 3TROA 2C7FA 3LTSA 2PUZA 1D8CA 3WJZA 1M03A 1N8WA 2X7WA 4N9CA 3GXFA 3KTXA 1WXZA 3PSWA 3LHTA 4JTIA 2OB3A 4V27A 4Q7NA 4UQBA 2VM8A 4H9MA 1XGZA 1RBLA 4ZFMA 4ZXOA 4XO6A 3NO5A 1TZ9A 2ANUA 4ZQCA 2VOMA 4AF0B 4HNLA 1UIPA 5FEPA 4CGTA 3ZYZA 3NYZA 3QLDA 3G6MA 2W6RA 3S1VA 3BCFA 4XAZA 2VFDA 4I5RA 1IE7C 4Y8EA 3THDA 1GGOA 4LYKA 4GQBA 5A6MA 3HV8A 1B30A 4UQ9A 1Q7ZA 3SIZA 3GC2A 1OIFA 1UC4A 3LXBA 1YPIA 2IPWA 3UJFA 5ENLA 2D2GA 3LERA 4X2RA 4B92A 3VD9A 1PS9A 1WKEA 3KP0A 3AC0A 2YDRA 1KA9F 4O8RA 2G3MA 5CKSA 3RMJA 2WHKA 1I60A 2C91A 1OFPA 4GH3A 1AD1A 3LUTA 4DWSD 1C8VA 1RZMA 4O57A 2W5FA 4LCQA 2WSPA 2WZTA 1CTNA 3EMCA 3RG6A 4XUGA 2CLFA 4FLQA 3CUGA 3TK7A 4FA3A 1X98A 3CMJA 1E4NA 4OFCA 4N9DA 2P3ZA 1RK5A 5EPDA 1EBHA 1MXSA 1RALA 4PMVA 3MUCA 1KWKA 1EC7A 2X05A 2HDJA 4GZJA 3UXKA 4F66A 3A3XA 3B0UX 1KQZA 2IKJA 2ZCGA 3WUBA 3H8AA 4BQ2A 3QV7A 1V3HA 1DJWA 3ZJ6A 3VMPA 3PZMA 1KLYA 3PTKA 4L1XA 2ZE3A 3H7VA 4GI4A 1UBPC 2QCLA 3MJMA 3OB8A 3VUPA 1R86A 1Z44A 1HL8A 4W4QA 4FLOA 5CG0A 1J11A 4US5D 3GAYA 2GJRA 4H1ZA 2W3ZA 5EBUA 3MV11 1KLZA 4B5VA 1M1BA 4F8XA 3QTGA 3NQ6A 4IWWA 1JZ3A 4FLSA 3WFAA 3M5YA 3C0SA 2PDHA 1I1WA 3JZEA 1JIBA 5BYWA 4XAPA 2B7OA 1VJIA 2H3DA 5D04C 4ZODA 4D8ZA 1TV8A 2GFTA 1V6UA 1HTIA 4U5IA 4GVFA 4X61A 1GKRA 4NF7A 4OBRA 2HXTA 2AL2B 1ZTVA 1QW9A 3N6HA 1R47A 2J88A 1W1TA 1EWEA 2GVJA 4QJ3B 2IPJA 3GYCA 3BANA 1PVNA 5CSUA 3UJRA 4JGDA 5D8ZA 4H9UA 5HNTA 3GHTA 2BXVA 1A5SA 3GG0A 3P61A 3W1AA 2R1MA 2WJFA 3MI6A 2RDUA 1UYQA 2VZTA 4LAUA 4C6JA 3TSDA 1T99A 2YCLB 4F0RA 2WKLA 1V8EA 1P48A 3WQGA 1BSLA 2BXYA 3AJ7A 1BRLA 4YLWA 4P8WA 3NQCA 3GLCA 3S5YA 2HPMA 5F7UA 4WLCA 4W85A 4QLJA 3VD4A 1J18A 3O6CA 4WIWA 3F7JA 4DUWA 1R7OA 2DT0A 2XVGA 4JTLA 4D6IA 2E6DA 1GYMA 1N2VA 4FPSA 5CC7A 3BURA 1RH9A 3GG1A 2GGHA 4XAYA 3TTSA 3E5PA 3EX1A 5E6ZA 4JTRA 1EDQA 3NXLA 1KFWA 5KZDA 3RLVA 2FVMA 5E09A 2NVDA 4TMCA 1WBHA 2INFA 1VLWA 2X0YA 5A95A 1W1B1 3FYPA 1A5NC 4HPGA 1UA3A 2FJKA 3ZZ1A 1YTDA 2Y70A 1I8JA 1UW9A 4S38A 1H0IA 4UXDA 4IL0A 2DH3A 4IIHA 1K02A 4PRWA 4E2OA 2R1LA 3AAMA 1VRXA 1IHIA 3EDKA 4PUMA 2NQJA 2FVLA 1GVRA 2VFHA 1B3OA 2P3EA 5CSSA 2D24A 4F0HA 3MSDA 3SUSA 4UTTC 2IXUA 2VTFA 5FKYA 1YNQA 1LBFA 3W74A 1NM9A 3ZFHA 4O11A 3N12A 3ECQA 4XKMA 4LXFA 1AD4A 1PZ0A 2G97A 3M1ZA 3OZMA 4K7VA 1H2JA 1G7UA 3CNYA 1CXIA 1IEQA 3BH4A 4H00A 4B9ZA 2QJGA 3N19B 1XS2A 4OKDA 1C8YA 1EJUC 4LYPA 5ABHA 4QP0A 4O15A 1JXKA 4QDPA 2PU1A 4Y96A 3UFYA 5HJLA 1BVZA 5FJUA 5LIYX 4PH6A 3CPRA 1GOIA 3A13A 2ALDA 5LSMA 3KL3A 4Z2HA 4MWAB 2VRQA 2QDGA 3WD1A 3DG3A 1JFXA 1PDYA 5EYWA 2FHFA 4W89A 4B5WA 4GX8A 3A23A 4KBXA 1EC8A 3LDVA 1ITUA 1EPVA 4FXSA 4TO8A 2YLAA 4WJ8A 3MKCA 2VC5A 4QFUA 2UBPC 4FX8A 2DUZA 4YVVA 1C7SA 3PZ9A 5DBUA 5I3DA 2YBTA 1CI1A 2YJQA 3TEVA 2Z1XA 4GCXA 2J47A 3AXXA 3WEMA 5TD4A 4LRTA 2REQB 3U4AA 3P3BA 1US3A 4H9TA 1TZ7A 1XYZA 3N2BA 4LB4A 4XISA 4AXNA 4L4PA 1JVNA 1JPDX 1S2WA 4Z17A 3UA3A 2XVPA 3C3NA 1DKWA 1DQWA 1XRSA 5A6KA 2D23A 5K3VA 2VEKA 4GIEA 1E1EA 3U7BA 3NQBA 5CGMA 1Q6GA 4WZHA 3M0ZA 1FCBA 1WUFA 4QRNA 1GTHA 3A24A 3BC9A 3LMYA 4PMOA 2ZICA 2INZA 4PBGA 2ZDSA 4CQ9A 4LALA 1O12A 3ABRA 5BXSA 1W5NA 2I16A 4YVXA 1KV5A 3M4HA 3C8FA 4OWGA 4C7FA 2GJNA 3DERA 5BRQA 3R79A 2X1SA 5KZ6A 1X6UA 3IWPA 1XLEA 3P0WA 3FSUA 5L9FA 4EXBA 2VT0A 4MWAA 4KFPA 3OIXA 2CESA 3USBA 3PANA 2PDYA 4FR6A 1RV8A 4D1IA 1XYFA 1ZB5A 4H19A 3SCWA 3NWRA 4LYRA 4XD4A 4AISA 4C6CA 5E0KA 2PDKA 3CH0A 1T6MA 3EKLA 5DMLA 1E51A 1EO5A 5J8LA 2I5IA 4GCAA 5D37A 6A3HA 3GDMA 3IPWA 1E6NA 3OHIA 1JCXA 4QS5A 3LLDA 2REQA 1KR1A 1E5NA 3EA3A 1UP3A 2G37A 3VE7A 2FDMA 4ICNA 1S5MA 1ITCA 1W3JA 3WIJA 4C60A 5I09A 5LHEA 5CLTA 2CKRA 2D0GA 2PD9A 2X2GA 2WMJA 3H7UA 4HIBA 1ZSXA 3R43A 5MHBA 4WF7A 2INEA 2WSYA 4GD0A 2QDEA 1GOKA 4LOCA 2YB4A 3PG8A 4GZ7A 4U10A 4MM1A 1HN1A 1KXTA 2QCMA 3H7RA 3P5YA 4CN4A 3RPTA 3RAOA 4DAIA 3PHAA 3IGXA 4EX4A 3PR2A 4BCEA 1KGXA 1QW8A 5G1TA 5K2ZA 3G0UA 1TTIA 4P7QA 3OLEA 1EJTC 3LNPA 4PL2A 3FGCA 5FF4A 2Y0FA 4FAMA 3URQA 4JOMA 2BDQA 3AU2A 3L2IA 3UBPC 3ITTA 2WM1A 1PDZA 3OBAA 2NW0A 3VGBA 1JXJA 7CGTA 3W1QA 1AW1A 1KB3A 3MB9A 3UGRA 1E0VA 4JFUA 3L67A 1H11A 1XRFA 1F9CA 5IFTA 2A3CA 1D8WA 3V0UA 1IGWA 3GXNA 5AHMA 5C71A 1DXFA 2CZEA 4JYDA 2Z00A 5HQEA 2Z24A 1TO3A 2MNRA 3VILA 1LL4A 1PL9A 5F1VA 1EQCA 3LNMA 3PPCA 4MGGA 4UR7A 2A79A 6TAAA 3EWDA 4LU0A 3C8NA 4DF0A 4N0RA 4DNHA 1V0MA 2WAGA 1XKJA 4G9PA 4WXZA 1JPHA 3NEVA 4CCDA 1KFLA 3I7QA 3B97A 1Q6RA 1KGWA 1I75A 3GRIA 3UNDA 3B8DA 5E93A 3BGJA 2PTDA 4B16A 3KWSA 2X0HA 3WQDA 3W6LA 1JGIA 3DX5A 1FCQA 1GZ1A 1NOUA 1F6YA 2WHJA 3CPGA 3TTOA 2DZVA 3W7MA 3CZKA 1L6FA 4AZGA 1LQ0A 3MJYA 1AMYA 1CNVA 3OEXA 4B3ZA 5F4SA 1MEIA 2YSWA 2TAAA 4KS0A 1CB2A 2X2YA 1W1YA 4JEJA 4CEUC 3V16A 2J7GA 3TJIA 1W3IA 4KGLA 5D4YA 3F5LA 2OOFA 3WH9A 3R4IA 3W7HA 4J3TA 3QPZA 4K36A 2GWNA 3GVRA 1ZAJA 4BI7A 4DBEA 2PGEA 1ZS2A 3KVLA 2EPHA 5GJNA 3RO8A 4UTHA 4EPEC 1J93A 2PDFA 2WNNA 4Y9NA 4FNRA 4ZQPA 3M5VA 3ZR6A 3DOPA 1FWBC 4KERA 3SSZA 4S3FA 3VNYA 4LFYA 2BY2A 1V3MA 4M0XA 2PWEA 4S39A 1SFSA 2V3EA 2A21A 2IQDA 1S46A 4UOJA 1IWAA 4JCMA 2WLZA 3BPWA 4GQRA 1XWYA 4TOQA 2V2HA 5K9CA 3WQCA 1XINA 2VELA 3MHFA 3KTSA 1BG4A 3M46A 3UETA 3I65A 5G4WA 4KW2A 4D6JA 1YEYA 4D6GA 3WD2A 3OYXA 3GXDA 2PODA 5AC8A 4HSHA 4IJRA 3B9AA 1AJZA 4FOJA 4HTBA 2V0TA 3VUSA 2Y89A 2WZHA 2AAAA 4I7UA 5AECA 2Y7GA 3G8EA 1A4MA 2DZPA 3M6YA 2PURA 4EXAA 1JEZA 2XUCA 3COTA 4N7QA 2PF8A 1Q4NX 2J27A 6REQB 2YKKA 3PUEA 4Q33A 4LV9A 2V5CA 2ZOXA 2Q02A 3TU9A 4RDZA 1GOXA 4LY4A 3SECA 1CXLA 3PVFA 2A6LA 4AAJA 1EC9A 3SW6A 3NL3A 1NSJA 1H61A 4XBJA 1K8YA 4WHBA 3SZ8A 4IGHA 4LSBA 2GYIA 3DHFA 3G1HA 3R58A 2BHUA 2OLAA 5A1AA 3SEPA 1SMAA 3B8VA 4B2DA 4D71A 2AKZA 2SFPA 3WDJA 1TPWA 4ES4A 4C7DA 5HWJA 1AZ2A 2IMRA 1AQFA 2NUXA 3T42A 2ZZ5A 2WVVB 2G8ZA 3ATYA 4B5SA 4AWTA 3HPZA 4L6DA 7A3HA 1GG0A 3NVTA 1HVXA 1LYXA 1NOFA 1JPKA 2Y5EA 1V3JA 4KEUA 2OTDA 5C9RA 1IIHA 1EXBA 3F5JA 4DI8A 2RDWA 1DL3A 1P4CA 4EK7A 3RGTA 3GIYA 4Q6JA 3CLMA 1TTPA 1VYRA 2HBVA 1XYLA 4BWLC 4Y9AA 2VZUA 1M6JA 4IPPA 4U31A 2ZXDA 5A6SA 3VIFA 1J0ZA 2FTPA 2VDIA 3W7OA 1FP9A 3G22A 3TKFA 4AIOA 4Q8WA 4S2BA 2ZX9A 3CBWA 3VCCA 1TKKA 6REQA 2VC9A 3T2OA 3WQ5A 5I2UA 3CXOA 2PDNA 2PDWA 2EPKX 2J77A 3D6NA 1J0JA 1VBRA 2NQHA 4PMJA 3S9IA 3SR7A 4KCVA 5CXPA 4MLJA 1BXBA 4YTUA 3ONBA 2XVLA 3TMLA 1R9ZA