1O5XA

Plasmodium falciparum tim complexed to 2-phosphoglycerate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Structure of Plasmodium falciparum Triose-phosphate Isomerase-2-Phosphoglycerate Complex at 1.1-A Resolution
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1o5xA00
3GKAA 2X1TA 1GVQA 3LI1A 5L6UA 1H50A 2ZZ4A 3PS7A 1VC4A 2CU0A 5CPMA 1ML1A 5D03A 1LBFA 3G1YA 1TPDA 4Q4KA 3WK0A 3NM3A 3NL6A 1ICQA 1MXSA 3G0SA 1VJIA 3PG8A 5F1UA 3N14A 3IGSA 3INPA 2VFDA 3FYOA 4A3UA 2VFFA 4QNWA 3TFXA 4PFMA 1JUBA 4YWIA 1TRIA 3QSTA 1S5VA 1JCXA 3CC1A 1L2UA 1FWSA 2YFOA 1LM1A 2GVGA 4UFJA 4AH7A 2QF7A 2Y63A 4LNYA 1QDSA 3KRZA 1OF8A 5CZ0A 4UUIA 5AHIA 1RD5A 1OYBA 4JTIA 1RVGA 3KOFA 2QUVA 3HG2A 4PL2A 3O8AA 5IM51 4LVAA 5EBUA 4CCCA 3S1WA 5F2MA 2XFWA 2TPSA 1VHNA 4NJHA 3DHFA 3LM7A 1KBJA 3H54A 2CZEA 2NXHA 1D3HA 3I7QA 1GQNA 1VYRA 2FFCA 1TV5A 1B57A 3W7QA 3TROA 1QFEA 1DV7A 4QQ3A 4NVTA 4HSNA 2D73A 5K9DA 4AEOA 1SW0A 1FWTA 3NA8A 4XTDA 4RZ4A 1C29A 4R34A 2E5CA 4M7SA 1T0OA 5CKSA 2BLEA 3HPSA 1NVMA 3EXRA 2JKEA 4NT0A 1F7BA 1B4EA 1ZAHA 4LS2A 1TPEA 5DN1A 4UTTA 3TNOA 4WY0B 5D32A 3MBFA 2J9ZA 2V9DA 2OT1A 1M7OA 2EKCA 3MI3A 2HSAA 1U83A 1S5TA 1EX5A 1H5YA 2JBMA 4O1BA 1D3GA 5BNKA 2ZA1A 3C8FA 3EXSA 1GOXA 4R33A 3G1DA 1A5BA 5K9CA 5LNVA 2A2IA 3L67A 4A21A 5D37A 4GXMA 1OX4A 1THFD 3ABRA 2OCZA 2ABBA 5AB3A 4O13A 4UFMA 1JUEA 4OT7A 2XN0A 3W23A 3NQ2A 4MFEA 4TU1A 3TXVA 3MO7A 3HG3A 3CHVA 5FF0A 1IF2A 5CSSA 4GUIA 3PR2A 4I7WA 3I6RA 4DPPA 1G6CA 1Y0EA 1YADA 3PVFA 3W2UA 2CLHA 3U6WA 4RXFA 3W72A 4XQ6A 4K7YA 3M44A 3NDOA 2ATMA 3LCHA 3S6DA 3NQ8A 1VLWA 4FXSA 1I2OA 1EB3A 4JTEA 3O6DA 4QIUA 4XWUA 2DJLA 3GR8A 3B05A 3HG5A 1OFPA 1WV2A 3EKLA 2NX1A 3W86A 5HUOA 1Q3NA 1LROA 2A21A 1AW2A 1RPXA 5LSMA 1W3IA 2WO5A 4N9BA 4QM1A 1PCWA 3LXBA 2DU2A 4Y9AA 5CPLA 3FLUA 3I68A 3ATZA 3LLFA 1F2JA 1W37A 3PUOA 1ZCOA 2B0MA 2JGYA 3B04A 3UWQA 1P0KA 3MHFA 4UNLA 4P61A 3AO0A 2PRLA 5AHMA 3GDLA 2V8ZA 4FF7A 4XKYB 1AG1O 1XC4A 2CWNA 2NV1A 4ZL1A 4IMGA 2Z6IA 4N9DA 4GE8A 2VFHA 4OBTA 1G4SA 3THAA 4O15A 3ZFHA 3I65A 1JQVA 2CLOA 3LV6A 3W87A 4ADUA 2JKAA 3OG3A 4S2CA 2CLEA 1UJPA 4FHAA 4CCEA 1ME9A 1OFQA 1JCNA 1JR1A 1H7XA 5FEXA 1F6PA 5F2GA 5U7SA 3MI2A 5AHFA 3LDVA 1BKSA 4LTSA 4C1LA 4YL2A 2VC6A 1YTEA 3L66A 4AF0A 1SZEA 3UWYA 3UPBA 5MHBA 2V82A 1H1ZA 2ZYFA 4ONVA 2FB2A 1W3NA 2C14A 4DPQA 3O07A 3GXPA 2AAMA 1Z48A 3PSVA 5F4WA 3SR7A 4NZFA 1GEQA 3UWZA 4FX8A 3W75A 4RZ6A 2DZWA 4FX7A 1QOPA 3DGRA 2P0OA 2Z1BA 3DI1A 4LT9A 3GXNA 3LI0A 3EX3A 1C8VA 3RK8A 3GVGA 4O50A 1AK5A 4ZQCA 3BV4A 3M5XA 1OVDA 1YDNA 5AN7A 4FB7A 3IRDA 1OFBA 4KFOA 3DFNA 3USBA 4LS0A 3LTPA 3NQ7A 2QCDB 2NUWA 1U5JA 3NQAA 1L6YA 1SSGA 1BWKA 2QJIA 3SJ3A 4TMBA 4GUHA 1IXQA 1VYPX 4X2RA 3TKFA 2E68A 2C15A 3E0IA 4N4QA 4Q33A 1FCVA 3FEMA 3LHUA 3W9ZA 1VH7A 4PA8A 1QPQA 4X22A 4DF1A 3A21A 1OFEA 4NXSA 4AB4A 5TIMA 2QCLA 1R30A 1F74A 3W1MA 3FS2A 2ZRVA 4HNNA 1FDJA 4MLRA 3HO8A 2VELA 5U4NA 1WBJA 4ZQMA 1PIIA 2YGYA 2WQPA 4WZHA 3P81A 1Z41A 4MVAA 2ZQ0A 2WNZA 1GVSA 1VCGA 3PBVA 2JK2A 1P0NA 3TC6A 2RH9A 2VEMA 4OQVA 2DZVA 2HMCA 1B4KA 3RMJA 3LGEA 3QJAA 4DF2A 2GVLA 2P10A 3M16A 3R8RA 4JIQA 1G4EA 3W2LA 3CEPA 4R53A 4AAJA 3O05A 1M5WA 1A5CA 2CLMA 3TK7A 3PBUA 1XKYA 5EYWA 2DZUA 1TTJA 1PE1A 2R91A 3GYEA 2J88A 2ABAA 4HNTA 2UV8G 4Z1BA 3IIVA 4BI5A 1TTPA 3IIOA 4FIRA 2J6XA 4JX6A 4JD4A 3W7KA 2ZRXA 3FKRA 5FF4A 4UFLA 4M5PA 3WK3A 4ML9A 3BVJA 4OE7A 3LCWA 3HOJA 2A5HA 3EWZA 6TIMA 3KFTA 3RU6A 3NGJA 2QJGA 1AL8A 2V2DA 3HGJA 5K4ZA 4WOZA 4LY8A 3W1PA 5E0KA 3TC7A 3N2XA 3MP5A 1IIHA 5HMSA 4O4WA 3VI2A 3WK2A 1YTDA 1NF0A 4CNOA 2ZZ7A 3ATYA 5HNRA 4HPJA 2ISWA 4E38A 5DCBA 3S5YA 3W2JA 3PBYA 1SU5A 4TIMA 5G4EA 4I7VA 5DCEA 1SZFA 5KINA 1NAL1 3UWWA 4LV4A 2ZTKA 4HSOA 3PAJA 2ZRWA 3LHWA 5I3IA 1EPXA 4RJEA 5F4SA 3S1UA 2DZPA 4QITA 1RQEA 5D02A 1YDOA 3RNDA 2PRMA 1TTQA 3KRSA 4O54A 1WX0A 3A9IA 3A23A 2A85A 4O28A 4UFHA 3W7GA 3LRKA 4AMAA 2Y7FA 2DP3A 4ZQOA 1TPVA 4PCFA 4H4IA 1LRNA 2FPTA 3NG3A 4LVGA 3ZWSA 1KM6A 1EWDA 4IQLA 2QCGA 4ZQRA 5HR7A 1H7NA 4E2BA 1PCKA 3W76A 4AHQA 3E96A 1ME8A 3BO9A 3QQ1A 1ZNNA 4Z1DA 1UUMA 5IBXA 1SZGA 3HJZA 4K8HA 2NX9A 4PEKA 4ZVJA 4UTIA 4JXCA 4XBSA 3MJYA 2NUXA 1QPRA 5LNUA 3ELFA 1SFJA 3F4NA 4XTIA 1OK6A 3CEUA 2FQIA 4GJ1A 4RZ5A 3EX2A 4KWVA 4M19A 4UTTC 3L0GA 4Z08A 2NZLA 3EWUA 2A4AA 1ADOA 1GYNA 3GR7A 3FJLA 3L65A 3IEBA 2I9EA 1Q45A 2Y7GA 3UNDA 1LOSA 3CU2A 4JTLA 1H7PA 3N19B 3STGA 3DFOA 1FQ0A 1TV8A 2EPHA 1DBTA 5EL1A 5AFDA 3SSJA 2A7NA 5A8GA 3M47A 4OGZA 2Y89A 3EX1A 2OX1A 1FY6A 1OFDA 3MI6A 3TW6A 1J2WA 2ZZ6A 4FNUA 1N7KA 3SIZA 3GZ3A 4NUWA 1G4PA 1XDLA 2J24A 2AQWA 4UXDA 5HJLA 3CT7A 3LRMA 3O6YX 3W88A 2WNQA 2QR6A 5HWJA 2VKZG 4CQ8A 3TDFA 3F1QA 3NPXA 2QCFA 2FTPA 4DQWA 1JCLA 1QCWA 1LLZA 3KVMA 4LUJA 3HBLA 1M7PA 1WXJA 2GVJA 4LW7A 1LORA 2ALDA 3L5AA 3UYCA 3LHTA 4BF9A 4JEQA 1EIXA 2CZDA 1VLIA 2Y88A 2C16A 3IVUA 1XI3A 3NPUA 3LLDA 4UFKA 5CG7A 2BTMA 3LHZA 3W73A 4EF9A 1B3OA 4LVBA 3DU0A 2VEPA 2V2CA 1TTIA 3THQA 4JTTA 1LRTA 4IMDA 3BG5A 3QPZA 1XBYA 4A22A 4NJKA 3EKZA 5HUPA 1JQXA 3DH7A 1F73A 2YFNA 3C2FA 3NL3A 2YZRA 5G2WA 4LWWA 3LB0A 3UXDA 3RLVA 3E9AA 1CW2A 2E5DA 4O57A 2O7SA 2V81A 3GNDA 3BLEA 3R2GA 4M6VA 3S9YA 2QAPA 4FNRA 1RR2A 2H90A 4UTJA 2X1SA 2WV8A 4JICA 2Y7DA 3W7DA 2WPBA 2TRSA 4LRSA 1AMKA 2ZCGA 2IQTA 3ANYA 1A53A 3UY8A 1A50A 3SFKA 2OZ0A 1UCWA 3W07A 4Y6GA 4GNJA 4TMCA 2YW3A 3MBDA 3W1QA 4B5NA 1YXCA 1CI1A 1Q6OA 3B4UA 5D04C 2QUUA 4A2SA 3DFTA 1SO3A 3E12A 4MFDA 1YPFA 3LHVA 5AC6A 4K38A 2CLIA 2FLIA 1MEWA 1O5KA 1GT8A 3W7CA 4Z1AA 3EWWA 2XN1A 2ZTJA 3NQEA 3MWAA 1OK4A 5F2LA 4O0KA 1W5MA 1G4TA 2J9XA 3BK0A 2PURA 5J5DA 3BLIA 1WDWA 1KM4A 3MYOA 4KFPA 4HKPA 4IOTA 1F5ZA 5F2IA 2VEKA 1GVRA 4FEZA 1T8XA 1BEUA 1T96A 1YPIA 3S1XA 3M6YA 4CQ9A 3LCXA 4JYDA 3CIXA 4MYAA 4O14A 3TUUA 2VXNA 3W2MA 3GX9A 1TV7A 5HWNA 2G97A 3KXQA 1O4UA 2Q8LA 3M7WA 3PUEA 4ADTA 3P8IA 1WYIA 3O06A 4KWWA 3S5OA 3U8GA 3WJXA 5AC7A 2Y62A 2VEIA 1KFBA 2QKFA 1SPQA 5I3GA 1LTDA 1HFBA 2QCDA 3LHYA 1T99A 2YYTA 5D2XA 2NX3A 2GQ8A 3EXTA 3QSRA 4JTUA 5LHFA 3MUXA 4Q32A 4UMCA 3B0VC 3NPVA 5D33A 1W1ZA 3P84A 1F76A 4FO4A 3W7IA 3W7OA 1BTMA 4UTKA 2ZRZA 3P80A 4CLMA 1RZMA 3GDKA 3QQ0A 1EP3A 3W7NA 1XCFA 5ABTA 1W5NA 4MJMA 4QSHA 1DORA 4PTNA 3NL5A 1W31A 4CNNA 3ZWTA 3P67A 2A0NA 4U4MA 1K8XA 3C2RA 2I1OA 3QFEA 2EGZA 3QMSA 1GTEA 1MEHA 4FNQA 1PHWA 5BW6A 3I7SA 3JS3A 3NOEA 4WX2A 3MHGA 2EAWA 4E0CA 2W0UA 1OFRA 4IPJA 4UTUA 1DJQA 4ADSA 5K3VA 1PVNA 4WY0F 1WA3A 4OU1A 4UTWC 4H3DA 2Y61A 1DJNA 3B03A 5TBOA 3LCIA 3C52A 4JGDA 5CPNA 1H61A 4XZ9A 3T40A 1XUZA 3MP4A 5SWUA 1XBXA 4BWLA 4AWSA 1GTHA 3EWXA 1H51A 3QW4B 3G1AA 1FCBA 5D30A 2HS8A 3WFAA 1TJRA 3C2OA 3C61A 7TIMA 5TQLA 2X16A 3IVTA 1FWNA 1W3TA 3DI0A 1ZFJA 1RV8A 4A29A 1HO4A 3EEGA 2V2HA 3WJWA 2XN2A 5HINA 3PWAA 3VKJA 1W54A 3CM4A 5DXYA 1QR7A 3TXZA 4X9SA 1SO4A 1YYAA 2DJXA 4WUIA 3VCRA 5CZTA 1SO5A 5EY5A 4JTJA 3OVQA 3UXAA 3SW6A 1VHCA 5G4WA 5BOOA 3N3MA 2VFEA 1ICSA 3A22A 1QWGA 3N2MA 5I3FA 1RQHA 2PE4A 4IX2A 2GJLA 2H3DA 3LTYA 2WSYA 3UD6A 1B9BA 4AWUA 5FESA 3TW7A 3WJZA 3HG4A 4BI6A 2QCHA 2YSWA 3DFQA 1V7YA 4NJJA 5DY2A 2O7QA 3TQVA 5A5WA 4CQAA 3T7VA 4NX0A 3SY5A 3RFAA 3K30A 3O1NA 3TMLA 3SGUA 3A24A 3L2IA 3VFLA 1JJKA 1H7OA 3UY7A 1F6KA 1HO1A 1JVNA 3E02A 1OX4B 3LOTA 3TQ0A 3BLFA 2ISVA 2E09A 5EPDA 3M5YA 4FNTA 5D2WA 4UCGA 2JKPA 3NZ1A 2NUYA 3F03K 1QOQA 2PC4A 4GC4A 3CTLA 3T4CA 1EEPA 1NFBA 1FX6A 3L0KA 3P5ZA 4RX0A 4DO6A 4YCPA 4Z1CA 2Y85A 1O95A 2FB3A 3N34A 4IMFA 4N6EA 1O94A 1J5TA 5EMUA 2FPYA 4EF8A 4WOQA 5G2IA 3W1RA 1TPWA 2X2GA 2VFGA 4MIMA 1QO2A 3TR2A 1SSDA 2H6RA 4ICNA 5DELA 1TPUA 3PBWA 5I3KA 4ALDA 3TU9A 5G2HA 5DCDA 1R46A 4UMAA 3TE9A 1WOAA 1L6SA 5IBXC 3BW3A 5D09A 2TSYA 1TPB1 3D0CA 4IWWA 3DHDA 2Z6JA 4MUZA 1KLZA 4EIVA 3Q58A 2I14A 4K7VA 1TYGA 3W2KA 1IIGA 2YCEA 3HIJA 1K8ZA 2ZRYA 4O17A 3P7YA 4LUIA 3TV8A 1G67A 4JX4A 3ZR4A 4AVFA 3MW7A 4O52A 5K9XA 3S42A 1AW1A 1D9EA 4DEFA 4UFIA 3CIWA 2R94A 3W7PA 3GAKA 1ZY9A 4BFAA 3M43A 2B7QA 3KVLA 4MZ1A 3NQCA 1K7XA 1W8SA 3O63A 5EKYA 2P1FA 1LYXA 3NO5A 2YXGA 3CQ0A 2HTMA 2E6DA 4N6FA 3GDMA 3QM3A 5BMWA 3HQ1A 3LCFA 1KFCA 3MYPA 4NZJA 1RQBA 5FF3A 1KM0A 2RDWA 5HR6A 5LNRA 3NQGA 4N9CA 4AF0B 4GUGA 4MY9A 5K2ZA 5FI8A 1TJPA 4MJZA 1PL9A 1KFJA 1GWJA 3E49A 3UWVA 3DFPA 3FOKA 3DZ1A 3QZEA 1TPFA 4HNUA 2DZTA 3L0NA 1JCJA 3QPYA 5KITA 5C55A 2B7NA 4FIQA 5E1QA 1V5XA 4JYFA 4BK9A 1OX6A 1FWRA 1UASA 2B4GA 4Z0JA 4EVZA 3VNDA 1H60A 4QNEA 3PB0A 4LVDA 3G0UA 3VE9A 4IMEA 4MOZA 1ICPA 4JTSA 2J27A 2BWGA 4H6KA 1KTCA 4UC5A 1SW3A 1XL9A 4MKNA 2C1HA 4JTGA 1KFLA 2GOUA 1LOLA 4M6PA 4UIOA 6ALDA 2G95A 4JYEA 1QMLA 1XM3A 4N9EA 3R13A 2V5LA 5GVJA 3S0CA 4ZMGA 2KZHA 4LRTA 3QRHA 1KV5A 1I2PA 3W70A 1XDMA 1WOBA 4LOCA 5KTLA 2RKXA 1TCDA 3N9RA 2C13A 2Z0IA 1PHQA 4Y96A 1QO5A 3W7EA 1TQXA 3B8DA 4WJEA 3ZS4A 2RDTA 3W71A 4JDBA 4ZZ9A 1X8FA 2ZRUA 4MZ8A 1ZAIA 5G5IA 4YMZA 3UZJA 2JGQA 3NQVA 3NYZA 4OWGA 4WQ6A 3W7LA 3P82A 1Q6RA 5KZDA 4RCXA 3WK1A 3KX6A 4WY0A 3WJYA 1R2SA 3LV5A 4K37A 4K39A 4UTHA 1ZHAA 3S5NA 3G1HA 1KTNA 2Q3RA 1EP2A 3S5ZA 1JCYA 1K3UA 3FJ6A 4NU7A 5CPOA 2A7RA 3DBPA 1VRDA 3NQMA 4FNPA 4DXVA 4HPXA 3T44A 3G1SA 3TFCA 3IGXA 2A7PA 4QISA 1GJPA 3UQNA 5K7JA 3UPWA 1HG3A 1KV8A 3QW3A 4I9AA 3NR0A 1PV8A 4LVFA 1N8FA 2GUUA 4N02A 4JTFA 3BG3A 1VCFA 2ZBTA 3M1ZA 1KM2A 1UUOA 5C54A 1YDVA 1ALDA 2QDHA 3PM6A 4GUJA 2ZA3A 3I7RA 1QPNA 5KMYA 1ZAJA 3FFSA 3NQ6A 1W0MA 3OEXA 3QMRA 3GAYA 2CLFA 1UBSA 2GJNA 4MY8A 5E93A 5D2TA 1DKWA 3GKFA 1OYCA 1HTIA 4LC8A 3M9YA 4IXXA 4NXKA 1VCVA 1Q6LA 3B06A 5F4XA 3EX4A 4K36A 4JY9A 1ZALA 1R47A 3PUDA 2E6AA 3W83A 1K03A 1NF7A 4ZQPA 3ABOA 1SW7A 1FCUA 1S3HA 1YXDA 5LNSA 3LX9A 1MO0A 3DAQA 1P5BA 5CGQA 1HUVA 4W9TA 4ORMA 2WNNA 2G5WA 4AHPA 1Z44A 4FX6M 4EOUA 1TREA 4X3ZA 2ZA2A 1KTBA 3IIPA 5KSWA 4MPQA 2NLIA 1I2QA 1O5XA 5KZMA 1I8JA 1XUUA 4O1AA 4YCOA 4XKYA 2RDUA 2X1RA 1TPC1 1DVJA 2C6QA 3TAOA 1A5AA 4IUOA 3HMJG 1GG0A 1X7FA 1XBZA 1X6UA 1TB3A 1W5OA 5K4XA 1M6JA 4BWLC 4JS3A 3W7JA 4ZQNA 4MY1A 3BG9A 1GVOA 1VS1A 5AYZA 3NPWA 3EWYA 4K6AA 3W74A 4AWTA 3PB2A 1W5PA 1LRQA 2ZFAA 1JRCA 1IXOA 2QUTA 3W7HA 3R5EA 2QCEA 5C6MA 1FWWA 3P62A 3C56A 3TX9A 1FUYA 1G7VA 2H3BA 1R2RA 4PL1A 2FPVA 2Y70A 5FEWA 3N9SA 3ABSA 3HGOA 2E5BA 1DOSA 3LCGA 3PF3A 3OVRA 3OVPA 1JULA 4JTHA 4WXYA 3LBMA 4O8RA 4UNKA 1WBHA 2WKJA 3A5FA 1SFLA 4MLJA 2ATSA 1H7RA 5D2VA 2OJPA 3LERA 3FIGA 4HHPA 2CLLA 1Q6QA 1DQXA 4HT3A 4POCA 1C9DA 3T78A 3P5YA 3GDRA 3Q2DA 4IPIA 4LU0A 5AYXA 2QDGA 1WQ5A 2BXVA 4BI7A 4J9JA 3RLUA 4HIBA 1LDCA 3B0PA 1LBMA 1TQJA 1VGAA 5F1VA 4E2DA 1TPH1 4JIPA 4UTLA 2V0TA 2ZZ2A 1MZHA 1W5QA 1LLWA 3IGUA 3TMQA 3WJSA 3M41A 1EUNA 2Z2UA 2H8ZA 3JR2A 1LBLA 1L6WA 3W6YA 3IVSA 2PCQA 1K7FA 4U28A 2WSRA 4KFNA 4UMBA 2YX0A 1VPXA 4M6QA 3KVKA 5HQEA 1K8YA 3MMTA 3TA6A 2NWRA 1DQWA 3QF0A 1FCQA 1KM1A 2DZXA 2Q8ZA 2VENA 4DBEA 3TH6A 2X30A 3W1LA 3KRUA 4RKAA 2FIQA 4BR1A 2GQAA 3L9CA 3Q94A 5AC8A 1SO6A 3NM1A 3W1NA 2R8WA 4R7JA 3QEZA 3W85A 2CZ5A 3DFSA 2ZZ1A 3TJXA 5L9FA 5FF2A 2TMDA 3CWNA 4RR4A 1LP6A 4RLIA 3PY2A 4AHOA 1SZNA 3R89A 1ZJIA 5AHEA 1EA0A 3CPRA 3T55A 5FEZA 2W6RA 1AL7A 5CZSA 3BW4A 5HWMA 1Z42A 5BMXA 1E51A 1P4CA 5G1TA 1TSIA 1GPWA 1OJXA 1ZENA 2W79A 1XXXA 4DO5A 2QCMA 3RF9A 2WJZA 4AXKA 2CLKA 4LS1A 1EUAA 3G18A 2GPTA 1WAUA 1JRBA 2NWSA 3C4UA 4JDYA 1GG1A 2NV2A 1VZWA 2V30A 5C2XA 1AW5A 3LXAA 3VE7A 1K02A 4GWEA 3NZRA 2CZFA 4OV9A 4O1DA 1OABA 2QCNA 4DO4A 3NL2A 2ISSA 4NJIA 3JRKA 1K7EA 3FYPA 3C0JA 3O6CA 1IXNA 1YLVA 3NVTA 3LTSA 5I3JA 3B0UX 4O12A 1TIMA 3STFA 5FEPA 3BPWA 3C2EA 3CB8A 3FKKA 1XBVA 4Y90A 5FF7A 3G1XA 3G8EA 3C2VA 4PH6A 4GFSA 1QPOA 3V75A 1FDYA 3S8HA 3HF3A 1KBIA 5LGXA 5AHNA 2FJKA 2LLEA 3DXIA 3IV3A 3EB2A 1H62A 4IX0A 5T26A 4IXHA 2GQ9A 3U2OA 3O16A 4DF0A 1KA9F 4JN6A 1I2NA 2QJHA 3G1FA 5LZLA 3GNNA 3H53A 3AJXA 3UZ5A 1FXQA 2AGKA 5DY3A 1SR9A 2E6YA 1KFEA 2OT0A 3W22A 3G3MA 2YDAA 4NQ1A 3TJLA 2TYSA 2QCCA 4D2JA 1TRDA 1W56A 3LBCA 4NJGA 3KAOA 1QNVA 3NXFA 3HPXA 2DZSA 5EA9A 1DHPA 1H7WA 4K8EA 1LZOA 4KKXA 2HS6A 2C3ZA 3C6CA 4NNBA 2EF9A 3OBKA 3MP3A 4GBUA 2ZDRA 1XFBA 2A1YA 4YXGA 5LGZA 2B7OA 3TCEA 1GZGA 3STEA 4CNPA 2B7PA 2RFGA 2CW6A 2YW4A 1KW1A 4JX5A 2BZNA 2YYUA 3PC0A 4MZYA 4M7TA 4EWND 3W3OA 4G1KA 4LV9A 2F7FA 2ZZ5A 3HGRA 1A5SA 5LKYA 4YLWA 1S5WA 3OA3A 3W1UA 5DBTA 2Y6ZA 3P74A 1KLYA 3SGZA 2QEZA 2X1UA 4C1KA 3DKLA 5CZJA 3N73A 2CFFA 4UTWA 4HNVA 3M5ZA 4TX9A 2DORA 3PG9A 3BGJA 1P1XA 1FXPA 2V5BA 4JR5A 2C18A 4TR9A 5AYYA 3BW2A 1R2TA 3S1VA 5AHLA 1NSJA 2C19A 2BX7A 1X1OA 3KVJA 1JCMP 4NNCA 4HN4A 3TSMA 3TIMA 1IGSA 5G1YA 1MSSA 3HGSA 3P8JA 3G24A 4I7UA 4LC6A 4CCDA 1YXYA 3IIXA 4QAIA 2Y7EA 4UTMA 1I4NA 2BSLA 3O15A 4RV8A 3NQFA 1VQTA 1FBAA 2C0AA 2G96A 1J4EA 3GIYA 1SUXA 4PODA 3PSWA 4O19A 3G3DA 3H55A 2PRHA 2WSQA 4NX5A 1SQ7A 4XUGA 4O4VA 2NXIA 4IJBA 1VR6A 3L5MA 4XBKA 3YPIA 3OIXA 2ZZ3A 3QH2A 3L5LA 3PULA 2R14A 2VFIA 3SECA 3DKJA 4IMCA 1LOQA 1YTKA 4O1CA 3QMTA 2RHGA 2OMAA 3IIZA 2YR1A 4MYXA 5LHEA 1PS9A 2YPIA 4WXZA 1NEYA 1ONRA 3LCLA 3CLMA 3GDTA 8TIMA 3L21A 5BRBA 2J9YA 4A2RA 4N4PA 3P60A 4OV4A 1EP1A 4ORIA 4O53A 3V1PA 1OHLA 1UB3A 3EX6A 3W1XA 3W2NA 1JUKA 3C3NA 1EWEA 1G7UA 1OYAA 3TSBA 1H63A 4P2VA 2FDSA 5CSRA 4JY8A 3F4WA 2A6NA 3SZ8A 1CX9A 4IGHA 1F05A 1GYLA 2VOMA 3G8RA 1N55A 5DXXA 1OX5A 4O0ZA 1HL2A 1MEIA 5HULA 1LCOA 3BGGA 3NEVA 3LRLA 4Y8FA 4O16A 1QAPA 2WOQA 4DBDA 3GLCA 1OG0A 4UR7A 3GXTA 3LXCA 4WD0A 3TSDA 3UWUA 3GK0A 1OFOA 3QC3A 3FA5A 4FXRA 3W1TA 3SI9A 3A5VA 3DENA 3G1VA 1KM5A 1TO3A 3EWBX 1L9WA 2A6LA 3CWOX 3M5VA 1X1ZA 2EHHA 1FDZA 5LNWA 3M0ZA 4PC8A 1ME7A 4RXGA 5I3HA 1OF6A 3MHUA 1IXPA 5C5YA 3HPZA 5DBUA 4JTKA 4NNAA 1I2RA 4S1FA 4L4LA 3NNTA 4JNMA 5H2ZA 5D2YA 3ABQA 3W1AA 1O60A 2NXGA 5D38A 3HB9A 1GVFA 3STCA 2E1DA 3G22A 1TMHA 1I45A 4S2BA 3BARA 4OHQA 2F84A 1DL3A 2E77A 1G69A 3W7MA 5AOUA 4GRSA 3W84A 3KHJA 3G0XA 3NQDA 1VYSX 2Q3OA 3W7RA 4QJ1A 4DELA 5KZEA 3OHIA 4N2YA 1KM3A 4TO8A 5DLCA 5H91A 4O18A 1BWLA 2QAFA 3P61A 3TAKA 3TQKA 4UR8A 5J5RA 3QYQA 4FNSA 4L4MA 1H1YA 1OFAA 4GUFA 5D05A 4O11A 2E6FA 3NAVA 3R12A 4Z0SA 4O10A 4RK8A 3Q37A 3GB6A 1KFKA 2H8XA 3L68A
chains in the Genus database with same CATH superfamily
3AXHA 3GQYA 1GVQA 3CBWA 5L6UA 2ZZ4A 3PS7A 1U5HA 1TUFA 2CU0A 1FRBA 1ML1A 1EL3A 1XLLA 3WMCA 5CXPA 1W17A 1MXSA 2HK0A 3OYZA 4PGLA 2BXZA 3N14A 4HHHA 3MKKA 4CQCA 4R27A 3IRSA 3VAVA 4A3UA 1BLIA 1TR9A 3BE7A 4CN4A 4PFMA 1TRIA 1HKVA 3QSTA 4A8NA 1VBUA 4TTGA 2NSXA 1FWSA 2YFOA 3VUPA 3AICA 3PTDA 4IIFA 3CIVA 3VD4A 3EEZA 2ZADA 1RD5A 1OYBA 4JTIA 4CQBA 4GYPA 3KOFA 4LQ1A 3O8AA 3WSUA 1GKRA 4V2XA 5EBUA 3S1WA 4IGSA 2EPLX 3WMSA 1VP5A 1VHNA 1EA9C 3PBMA 3LM7A 3L4YA 2HZGA 3MQTA 1PUDA 2NXHA 2GSEA 1R85A 4Q3MA 1GQNA 1NDZA 1VYRA 2VCAA 3CHFA 4QQ3A 2D73A 4AEOA 3NA8A 1GOQA 4M7SA 1U1JA 1V08A 3FDKA 4NT0A 3IJ6A 1B4EA 4B5TA 2W92A 1E6QM 3RHGA 1RUSA 2EPMX 2ALRA 4B5VA 3OLIA 4KWOA 1A5LC 4JFWA 1M7OA 3LNPA 3Q65A 2AMXA 1U83A 1EX5A 4KCTA 2ZA1A 1OBAA 3C8FA 3EXSA 1UC5A 5BWFA 3H22A 2G50A 2GVYA 1A80A 3QR3A 4HTBA 5LNVA 3L67A 2PEVA 3VILA 4PTMA 1ISVA 4GXMA 3GD6A 1OX4A 3GIQA 4PN2A 2OCZA 5AB3A 4PZVA 2OGYA 6A3HA 4MKVA 3GC2A 3HG3A 1E0VA 4DPPA 1G6CA 1Y0EA 4EPBC 3U6WA 1BFNA 1M3UA 5C9WA 4FPSA 4XVDA 4H19A 4K7YA 4LBSA 1VAHA 3M44A 1S38A 1DJWA 4JKKA 3NDOA 3S6DA 4JTEA 1QBAA 3OJGA 4U2ZA 4QIUA 5IHSA 4XWUA 3UPMA 4GY7A 3O0KA 2PAJA 1B3ZA 3AI0A 3UP8A 2A21A 2VRJA 1C9WA 2WO5A 2GWGA 3LXBA 1VPQA 4Y9AA 4F0KA 3M46A 1W1YA 3IARA 5CPLA 1XSJA 5GNZA 1TX2A 2XH4A 1F6YA 3PUOA 4IMAA 1VB9A 1ZCOA 2B0MA 3BMWA 2JGYA 1P0KA 2Q8XA 3BV7A 3AO0A 1XRFA 5AHMA 4FF7A 1AG1O 1HQTA 1XYMA 2QJNA 4QSFA 2Y4SA 4ZL1A 4JTAA 4B3LA 2VFHA 2OTDA 1ODZA 4QDPA 4KEVA 3QHOA 4KCVA 3UESA 2AOSA 3OG3A 4MPKA 1K6WA 1UJPA 1OFQA 2FDMA 5BOFA 1HKWA 1F6PA 5AHFA 1BKSA 1DE5A 4LTSA 4YL2A 3L66A 4ZSTA 1VFOA 2Z25A 1SZEA 3UWYA 4GZ7A 4WLCA 2ZYFA 1E73M 1R7OA 2C14A 3NZGA 1PB0A 5A3HA 1XC6A 5T91A 2QXWA 4FR6A 4FX8A 2IPWA 3CMJA 4FX7A 2Z1BA 2E9MA 4Q6JA 1C8VA 3RK8A 2ZUTA 2PDNA 4HU8A 1HIZA 1E5JA 5CAHA 1GK8A 4O50A 3WUBA 3BV4A 5AC5A 4LAZA 4HMEA 3DFNA 3GH7A 4HBKA 2XIIA 3AHYA 2QCDB 1SSGA 3IJQA 4I5RA 3K46A 4GUHA 1IXQA 1VYPX 4N4QA 4QG9A 2VDGA 3FEMA 4PEEA 1VFHA 4DF1A 3A21A 3P0XA 1KC7A 2TODA 3ZJ8A 4DWDA 4GJIA 2JQXA 1LF1A 1F74A 4PMVA 1ZCCA 2ZRVA 2VELA 1ZTVA 5U4NA 1PIIA 2YGYA 3CV2A 1Z41A 2WNZA 1VCGA 2ACRA 1DJHA 1P0NA 1RY8A 2RH9A 2VEMA 4OQVA 3RMJA 1ONXA 3LGEA 4DBSA 2GVLA 4DF2A 2P10A 3M16A 3R8RA 4JIQA 3CQJA 1V0NA 1KRCC 5AY7A 3W2LA 4R53A 1M5WA 4BF5A 2CLMA 4C60A 2PTDA 2DZUA 4HNTA 3F2DA 3ME3A 3PZOA 4WR3A 4Z1BA 3IIVA 4FIRA 4MAVA 1ZS2A 3IPWA 3W7KA 2PLMA 3WK3A 1XH1A 4MGGA 1O5RA 4OE7A 4NYYA 4H9XA 2OWWA 3TLQA 1Q7ZA 1ZBKA 2WKLA 2V3EA 3SY8A 3RU6A 4M1RA 3WH5A 3V18A 4OZOA 2CC0A 1AA1B 5K4ZA 4H6RA 3TR9A 3VDAA 1WDSA 2FTWA 3KS6A 1W1A1 1YDYA 3MP5A 2DUZA 4V33A 4O4WA 1MZRA 3VI2A 3WK2A 4ZOCA 4CNOA 4DWSB 2QMJA 2ZZ7A 1Q85A 1ZBVA 5HNRA 4E38A 2C79A 5DCBA 4J3XA 4GNVA 1SU5A 3T2QA 4XIMA 1NAL1 3UWWA 1UD8A 2XWDA 4LV4A 3R94A 4DJFC 1F8MA 4ZO7A 2ZTKA 1J0YA 4ZTXA 3PAJA 4OJYA 2PS2A 2OB3A 3GW3A 2ZRWA 1EPXA 1REQA 1K4GA 1M41A 1BF6A 2EPOA 4HQVA 1F4AA 2NT0A 3KRSA 1WX0A 5HMDA 1F3XA 4GY0A 2XINA 2A85A 1BYCA 1XLMA 3S1GA 3LRKA 3AIWA 3M4HA 5LIWX 3IUIA 4DJDA 3CL8A 1QI5A 2DIKA 1Q13A 3EPNA 2BBFA 4Q8MA 1B3WA 4CN1A 3GHUA 2FH8A 1DJIA 1ZNNA 4MG4A 3H4GA 2VZVA 2VD9A 1SZGA 3HPFA 4P7LA 3NOYA 4PEKA 4UTIA 4XBSA 2X42A 3UZZA 1QPRA 3SEPA 3SSZA 1E4MM 4AY8A 1RA0A 4RZ5A 3FVMA 2PDJA 4WF7A 3I3EA 2ZX6A 2A4AA 3FXYA 5BXSA 3GR7A 3FJLA 2BXYA 1ONWA 3L65A 2XSAA 4G7EA 1TE1A 2Y7GA 3UNDA 1LOSA 4JTLA 5EMYA 2WMJA 4S3CA 3STGA 3DFOA 3SBFA 1EH9A 4GZIA 3SSJA 5A8GA 2OEJA 2I56A 2YL8A 4OGZA 1BQCA 1IEQA 3CQHA 1DXEA 3KTCA 1QNQA 4CVUA 1OFDA 5CSUA 2P50A 1YKWA 4LAOA 3SIZA 1UOZA 2AQWA 4GPNA 3TVAA 3S2MA 3TTEA 3CT7A 3O6YX 4ATDA 4L6HA 8CGTA 4KRZA 5HWJA 1SFTA 2VKZG 3F1QA 3NPXA 3WQWA 4EE9A 2QPSA 1E70M 4DQWA 3CTTA 1QCWA 1WXJA 2ISDA 5M1TA 2GVJA 4HHLA 3SCPA 2PDGA 2C0HA 4RPPA 5M03A 3L5AA 2BOFX 4XKMA 4P7NA 2CZDA 1VLIA 3IVUA 4NRSA 2FVKA 2Y8VA 3RIKA 4WCJA 3W73A 1D3CA 1HGWA 1ENUA 1PIFA 1TTIA 1QI4A 4WK9A 4JKLA 3QPZA 3CHEA 4A22A 1F73A 3AMKA 2YDSA 3VD9A 4U2YA 2WVVA 4Y8EA 4WEVX 1XSIA 4LB4A 1TV4A 4PMOA 2MUCA 3WQVA 1R9ZA 3M07A 1U1UA 2Y7DA 3UBPC 2JEQA 5CPTA 3LMYA 1BRLA 2J7GA 3W82A 3ID7A 2OZ3A 1UCWA 3A47A 2YW3A 3W1QA 3E5PA 2XFYA 3MB9A 2DEPA 3QOMA 2YBUA 3E12A 1YPFA 3LHVA 4K38A 5ECUA 3SUWA 3VM5A 3OLEA 3CWHA 4Z1AA 2XN1A 1LQAA 4GNKB 4UQAA 1QNSA 3ES7A 5HBFA 3UG5A 2XIJA 3B8TA 4NP7A 1F5ZA 4WGXA 4IZGA 1GKPA 1I1XA 2VEKA 2ZVRA 4FEZA 3LA4A 4PMXA 4CQ9A 4P5UA 3S1XA 5FL1A 2HISA 1UMYA 1TWWA 4AIEA 3TUUA 1OADA 3W2MA 3GX9A 2G97A 4H04A 2Q8LA 2XSBA 1PBGA 3R4IA 4TUFA 3N6JA 4ES4A 4US5D 3WD3A 2OYMA 3O06A 5AC7A 1TMQA 3A4XA 3TNBA 1EJSC 2VEIA 1KFBA 3SURA 5I3GA 2VP8A 1NARA 2YB1A 4RDWA 5AZ1A 3EXTA 3VOIA 4JTUA 3CUXA 3PPHA 4A3YA 1W1ZA 4WVXA 3OZMA 4GVHA 3W7IA 3BAWA 4UTKA 1KCXA 3N17A 3QQ0A 4CD8A 4YVVA 5I00A 4F0HA 1W5NA 2NLYA 4GI4A 3FAWA 3KLLA 2XZ7A 3P3BA 3NL5A 1JZ3A 3UFYA 1E6SM 5E9AA 2WKGA 4B5WA 1K8XA 2EGZA 5BWAA 3T08A 5J8LA 1GTEA 1MEHA 4AC7C 1PHWA 3LQGA 4TV5A 3NOEA 4WX2A 3MHGA 4MB1A 1FP8A 4GX9A 5HMFA 3S6TA 4E0CA 4R88A 4W8AA 4IFRA 3KBVA 4UTUA 1GVIA 3HQNA 1US2A 1WA3A 1MXDA 2Y61A 1Z69A 5TBOA 1MW3A 1V3MA 4JGDA 3VCCA 1W9UA 4PMNA 4K68A 1F3TA 3S6OA 1A3WA 1JXKA 4EAYA 1EJWC 1KBBA 3T0TA 1EXBA 1GTHA 1IR2A 3KBSA 2HS8A 4E8CA 4GYJA 2FJUB 3C2OA 3VX0A 7REQA 2WYSA 3FN9A 7TIMA 2X16A 3IVTA 4I8YA 1FWNA 5E9XA 4DUOA 3DOPA 4A29A 3PAOA 1HO4A 5DO8A 2WMKA 2V2HA 2XN2A 3PWAA 3UW6A 3CM4A 4H1ZA 1YYAA 2DJXA 3VABA 3VCRA 1D8CA 3WO8A 3OVQA 1P48A 5HAOA 4L1XA 3SW6A 5CZKA 5BOOA 4F48A 4EX4A 4GI6A 1ICSA 3TJIA 3A22A 3QV9A 2VR4A 2XH0A 4IX2A 2PGFA 4W84A 2E1WA 2WSYA 3U5UA 3SFWA 5REQA 3VNJA 4PCPA 3C3UA 3IAPA 4XK2A 3CUJA 3GNRA 3NZQA 1V7YA 3QLLA 1OT1A 2EXOA 2WLZA 5A69A 3T7VA 1QATA 4NX0A 2HWGA 3GRIA 1EF2A 1BXCA 3BCJA 2EG8A 1JJKA 1H7OA 3WH8A 3UY7A 1HO1A 3TWBA 4US5A 2E09A 4E4FA 1LT8A 4N7QA 4IHCA 3M5YA 3EGJA 3GG8A 3NZ1A 3UJ2A 1LLOA 2PC4A 3T4CA 1EEPA 4I9MA 3A3XA 4F4RA 4RX0A 4W5UA 4YCPA 1UR8A 1O95A 2CBUA 3BGAA 4IMFA 1MI3A 3HQPA 2Q6ZA 3OVGA 5G2IA 2XM1A 1QNOA 1XGDA 1MMFA 2X2GA 2VFGA 3I6EA 3OW1A 1CTNA 1YNYA 1ECQA 5DELA 4PBEA 5I3KA 3TU9A 3ISIX 1PYMA 4PRWA 4DNMA 3QLDA 2HXTA 3VNIA 6ENLA 3CH0A 1WOAA 4PUWA 4P8WA 4IPPA 1P7TA 1A0CA 2G3IA 1JPIA 3FSTA 3U4AA 2YCJA 3DHDA 4PTDA 5FJOA 4EIVA 4W8BA 1B90A 1VEMA 3P7YA 4Q4MA 3ZR4A 5K9XA 4H9VA 4FXJA 1AW1A 5MKGB 3H12A 1W1IE 3CIWA 4H7VA 3OBEA 1ZY9A 3RMEA 3NQCA 1W8SA 4JQ2A 3O63A 5C0QA 3CQ0A 1ISYA 2HTMA 4N6FA 4PRTA 3MYPA 1KFCA 3MCMA 4NZJA 1RQBA 3CLWA 1KM0A 4CEUC 5HPOA 5HR6A 3NQGA 3R79A 4DJEC 3PZ9A 2RDXA 4GUGA 1TJPA 1PL9A 1KGUA 1DXIA 3AROA 1MWOA 3QZEA 1TPFA 2C8NA 1CNVA 4RE2A 2B7NA 4D6IA 5C55A 1SJAA 4FIQA 3DYOA 4RNFA 1V5XA 4JYFA 1FWRA 2DH3A 5FJRA 4Z0JA 3UU0A 1CBGA 4EVZA 1H60A 4QNEA 1P0EA 1UP0A 3G0UA 3VE9A 3ZLHA 2XGIA 2XPKA 3N1AA 4JTSA 5TD4A 4A4AA 4AVNA 2PWHA 2W66A 3MDWA 6ALDA 1MXGA 4JYEA 3H6OA 4N9EA 1AMYA 3ENLA 4LRTA 5HNTA 1EJVC 3FGCB 1XDMA 4LBRA 5KTLA 1TCDA 3MV01 2C13A 2EQDA 4Y96A 3EKGA 2PLJA 3ARVA 2J47A 3ZS4A 4ZZ9A 2ZRUA 2QUNA 1ZAIA 2BMBA 3OQEA 3W7LA 4MWAD 1Q6RA 2YOCA 4P7OA 5KZDA 1V6UA 3BMXA 3WK1A 5GJPA 3N6HA 1J12A 3WJYA 3LV5A 4K37A 1JCTA 4UTHA 4Z2IA 3K8KA 4G8TA 2WJDA 3G1HA 1EJRC 1VPYA 5CLTA 4EAMA 3JW7A 3AU6A 3DBPA 2YL6A 3SQSA 3A64A 2F38A 3VK5A 2VHLA 3M0IA 3GFZA 2R6OA 2PBGA 4JNYA 6REQB 5K7JA 4AXNA 3UPWA 1J0HA 2PLKA 4FOUA 3AIUA 1FWIC 4LVFA 3SUUA 3NJ3A 1J96A 4YJ5A 2OSYA 4Q4OA 4JTFA 1P6WA 4QE5A 3BG3A 2ZBTA 8RUCA 5C54A 2CYGA 3PM6A 2PP3A 5M17A 3I7RA 5KZ6A 4JFUA 1ZAJA 3FFSA 4LAMA 5LIXX 3GAYA 2GJNA 4AISA 2DSKA 1OYCA 1HTIA 3CV1A 3ARUA 3W29A 3AZSA 4IXXA 4NXKA 1VCVA 4ZE4A 1KGWA 1HT6A 2JIEA 5FSEC 1K6AA 3PUDA 4JOMA 4L5ZA 3WLJA 2JE8A 5C9ZA 1LJYA 1SVDA 1K03A 2BY2A 4ZQPA 3C0SA 3VOFA 4QDMA 4S3GA 3OG2A 3IJDA 1JNEA 3VKKA 4GVGA 3THCA 3FDGA 5CGQA 1BVZA 1VFTA 3K8MA 2G5WA 2PB1A 1Z44A 2D24A 4Y9OA 4EOUA 3OZOA 1C7SA 3IAQA 1KTBA 4EACA 2OZTA 4YCOA 1YRRA 3JUGA 2OSXA 4FLQA 3S46A 1IV8A 2VC9A 3VKBA 4IUOA 1KO0A 3QTPA 1GG0A 3DX5A 3WENA 4Q8PA 2QIIA 5EFFA 1XD1A 5D9OA 2DVTA 1VKFA 3HA1A 4BWLC 4JS3A 3AS2A 5GPRA 1C91A 1BYBA 2W27A 1GPFA 4C6IA 4K6AA 2ZXDA 4E3TA 5CAKA 3VIGA 1YMYA 3WLMA 3C2YA 3U0HA 5CQ1A 2FHBA 3ZT6A 2ZFAA 1OSEA 1XDJA 3R5EA 3WELA 2YBTA 3P62A 1TVNA 4JTDA 4RE4A 5D9NA 4L1GA 1B30A 1TZZA 1DWHM 4MWAA 5FEWA 4WDTA 3N9SA 2E5BA 3PF3A 3XISA 3OVPA 4MNKA 4QDWA 1K9FA 3KDOA 4KESA 3UG8A 4J5NA 4MLJA 1X6NA 2J7EA 4ZXOA 4NASA 1Q6QA 1DQXA 4LB3A 3P5YA 5E5CA 3EBVA 2PMQA 3KRBA 3W28A 3Q2DA 1HKMA 2YIHA 3CO4A 3RLUA 4HIBA 1TA3B 3PNZA 2BVTA 3PK7A 4GO9A 3TMQA 5JXQA 1CXFA 3WJSA 3M41A 4F2TA 4MB3A 4C5ZA 2A3HA 1EUNA 3ECQA 4F2BA 1XLAA 4ACZB 1KB3A 2WSRA 4U28A 4UMBA 2YX0A 5HQEA 3KVKA 3MMTA 3TN3A 1EPVA 5DF0A 1DQWA 3QF0A 1KM1A 2DZXA 2VENA 1XGEA 2QS8A 2XG9A 4XAYA 2X30A 1W8GA 3W1LA 4UOJA 2D2JA 3OZYA 3W1NA 2R8WA 4TQTA 3B9EA 3DGBA 1V02A 5C9XA 1IZJA 4HP5A 3CWNA 3SRFA 3PY2A 4AHOA 2OELA 2FHCA 1IEWA 2VYOA 2VZSA 3RJXA 3T55A 1EDGA 2W6RA 1W91A 2G3NA 1EZ2A 4C91A 1Z42A 2PDIA 2PF0A 1P4CA 5G1TA 1TSIA 1OJXA 3R0DA 4DO5A 3RF9A 2WJZA 3ABXA 2CLPA 2PDHA 4LS1A 1EUAA 1JRBA 2RJHA 1H0GA 1KFWA 1EGZA 1FHLA 4GC3A 3D6NA 6XIMA 2C1GA 4DN1A 3CQIA 3RR4A 2CZFA 2ON3A 5EB8A 2QCNA 1Y7VA 3ITLA 4J3ZA 2ISSA 2O9RA 2XYLA 3C0JA 3UG3A 4AY1A 3M0XA 2OOFA 1YLVA 3NVTA 3B0UX 1ZJBA 4DLFA 4DWSA 2VC7A 3CB3A 1IR1A 2CBIA 4PUDA 5FEPA 3C2EA 3CB8A 2A3CA 5FF7A 3H26A 1H3GA 2QHAA 3G8EA 3V3WA 1QPOA 1UIOA 2VGBA 1O12A 3URAA 3VIIA 3DXIA 3IV3A 4ROQA 3MWCA 4V28A 1I2NA 2QJHA 1Y5WA 3GNNA 1L8NA 3UZ5A 4OBSA 5DY3A 2E6YA 1D7KA 5PTDA 3CYVA 1S2CA 3XINA 3BICA 3T0CA 3LBCA 4KERA 2NQ5A 1QNVA 1FH8A 5EA9A 4QLJA 2YCLB 5E0FA 4JN8A 1LZOA 3RN6A 4XISA 3R58A 2HS6A 2C3ZA 3C6CA 4M0XA 2EF9A 1ITXA 1EFZA 4GBUA 3AIVA 3LBOA 9CGTA 2B7OA 1M53A 2AKMA 4YTRA 3VTRA 3E0WA 3SCOA 2VX7A 2YW4A 2NQLA 2VGGA 2YYUA 4XX6A 1POJA 1QXLA 3VD7A 4KETA 5HPCA 4G1KA 1S3TC 1A5SA 5LKYA 4YLWA 2D69A 1QK2A 4DO7A 3W1UA 1E55A 3SGZA 2Y0FA 3AU2A 3DKLA 1L8PA 1BVWA 4Z42C 2DVXA 3R8GA 3WDRA 3BGJA 5AYYA 4K1WA 3S1VA 1W2VA 1AQHA 3WF4A 1X1OA 2XGZA 3KVJA 1TJ1A 1TCMA 1B31A 4Q6XA 4Z2GA 1DIDA 1NELA 1QI0A 3P8JA 1YE6A 4I7UA 5LA1A 4EXBA 3IIXA 4RV8A 4IG2A 4GKTA 4W7VA 3GIYA 2YZ5A 3CUGA 4PODA 4O19A 3GVQA 4DJED 4HA4A 2WHMA 2J74A 4XBKA 2WMHA 2XFFA 2OO6A 1J6PA 3BQ6A 4JEJA 3AMLA 3PULA 2O56A 2VFIA 3L23A 3DKJA 4QEHA 4IMCA 3LGGA 3W01A 3KTSA 1YTKA 1X8CA 1VBHA 2RHGA 1PS9A 4WXZA 1WXZA 3UR2A 3CLMA 5BRBA 1UHVA 2J9YA 4A2RA 4AMCA 4RUBA 4ORIA 3N4AA 4IL0A 4LJ3A 3EX6A 4XZHA 5AYIA 4PMRA 1EWEA 2FDSA 2CHOA 4JY8A 2I16A 1EHAA 4IGHA 4WDXA 4JHMA 3T07A 4H8NA 3D5HA 1Z89A 3MO4A 2PC8A 3WF0A 2QGYA 3WLRA 5JBDA 1DWFM 5HXMA 2WANA 2O92A 1LCOA 4ICCX 1BHGA 4NZ3A 5JH1A 5EBAA 1QOXA 2WOQA 5CLWA 4DBUA 3GXTA 3KL3A 1JNDA 2WQDA 3TSDA 3POHA 3QC3A 4FXRA 1NDWA 1UR1A 3W1TA 3RDKA 3KP1A 4KEZA 3BTNA 3JZEA 7TAAA 2A6LA 3CWOX 4Y7EA 4BJHA 1YBQA 5C5YA 4JTKA 3CAKA 2BY1A 4DI8A 4S3JA 4KPLA 4KEUA 4GACA 2XZ9A 5D38A 4WDUA 3VUSA 3CAVA 3T8QA 4BQ4A 4DZAA 1ZSXA 1DL3A 4AY7A 2CHNA 3HQOA 2INFA 4GRSA 3G0XA 4PMDA 3AXMA 4DELA 1LWHA 1EOMA 4N2YA 4TO8A 3NTYA 4AG0A 2O4MA 3KW3A 4O18A 4S23A 4DUWA 3T09A 4GZEA 1MQRA 5J5RA 3APYA 4W93A 4L4MA 4JTCA 3WIJA 4GUFA 1SMDA 3EOOA 4O11A 4ERIA 4XVEA 3NAVA 3B8SA 3RX3A 1KFKA 3CMGA 3LI1A 2UBPC 2XJ7A 1E0TA 3N4EA 3WK0A 2MANA 1XLHA 3GYCA 5F1UA 3L2MA 3FYOA 1EBHA 2O0TA 2ANUA 1I60A 3TFXA 1S5VA 1JCXA 2QIWA 5KEZA 4F40A 2GVGA 3MY9A 1K1DA 4LNYA 1MW2A 3ITXA 4CU7A 3PJUA 3B9OA 1O5QA 3DC0A 3PZTA 1R3YA 3HG2A 3LYEA 4IFKB 5F2MA 1F61A 4A3RA 1TKKA 4CD6A 3OQ8A 1WUEA 2CZEA 1MUCA 1XIFA 3W7QA 1DV7A 1X1NA 3VGDA 5DQPA 4G9PA 4NVTA 1LL7A 3LU2A 2FMOA 1A5KC 3GU9A 4UNIA 3ERPA 4ZSUA 1C29A 2E5CA 3REQB 3GTHA 5CKSA 3K4WA 2BLEA 3HPSA 1NVMA 2ZC8A 1B3XA 2UY5A 3RX2A 1TPEA 2XGBA 3TNOA 4WY0B 2J9ZA 1QPKA 1QW7A 1RALA 4XUYA 1EZWA 2IXUA 2W5FA 2D22A 2GFTA 2JBMA 4U33A 2BY3A 4R33A 4W5ZA 3P2VA 4MNMA 4NIRA 4ASTA 1AFSA 3U2CA 1XF0A 4A21A 4JQAA 3LLXA 2PA6A 2ZXAA 2BVWA 1W1TA 3NQ2A 4MFEA 3PJWA 5FJJA 3MO7A 1E15A 1H2JA 4HK7A 4IP7A 4GUIA 3TN6A 3PR2A 2OG9A 3I6RA 3IJIA 1B2YA 3IV8A 3PVFA 1YADA 4CNTA 1WZAA 1NP0A 2QT3A 4GX8A 4RXFA 2XHYA 3AC0A 4Z1YA 2QDDA 3VINA 3KDNA 3W4RA 1MUWA 5BRQA 1VLWA 2IUZA 1I2OA 1V3JA 1EB3A 1ZP3A 4LEFA 2DJLA 3HG5A 4GOAA 3U2ZA 3W86A 1Q3NA 4DM1A 2YB4A 4NKCA 2DT0A 4N9BA 3RX4A 4QM1A 2DU2A 2PDFA 3G1RA 4WKHA 4O1FA 3I68A 3WQOA 2GGHA 3LLFA 4D6JA 1F2JA 3UCQA 3FSUA 3UWQA 3B04A 3B8UA 3LMZA 4Q8WA 4UNLA 4Q4QA 2PRLA 4ZO8A 3WH7A 3GDLA 5MKGA 2V8ZA 3NGFA 3FNDA 4AZ6A 3S5SA 2CWNA 4MDPA 5JBFA 5ABFB 1E4NA 1JQVA 1U30A 2P5NA 2JKAA 2CLEA 4FHAA 1CGXA 5IHRA 1H7XA 3MI2A 3C8NA 3ZVHB 4C1LA 3T0DA 1YTEA 1NFGA 3HFYA 3H24A 2V82A 5HQLA 1H1ZA 4DVOA 2QMKA 1WZKA 2PDUA 1WNOA 4AUBA 1Z48A 4LF1A 5F4WA 3M0LA 1GEQA 4B9YA 2DZWA 4KW2A 4JQ3A 3VM7A 4GI9A 1QOPA 3DGRA 1QT1A 1XV8A 5BOEA 1RCOB 3LI0A 2FGBA 3EX3A 5I07A 3BANA 2ADAA 1AK5A 3R7MA 2QF8A 1PX3A 1OVDA 3ARSA 4XO6A 3IRDA 1OFBA 3TYAA 5DX7A 2F6XA 3R6IA 1U5JA 3EMCA 3NQAA 1L6YA 1UZ4A 1BWKA 2QJIA 3CPUA 4TMBA 4PMZA 3FGCA 3CAWA 1UWUA 3E0IA 4Q33A 4HVXA 1E71M 4PA8A 3K4AA 5BCAA 3UGRA 2VTFA 4CUCA 3VVGA 3ABZA 2QCLA 4HCDA 1BXNA 3W1MA 3KZPA 1SJCA 3HO8A 2W91A 4LCRA 1WBJA 4ZQMA 3VD5A 2WXDM 3WFLA 2F6UA 1E3XA 3P81A 4H7ZA 4JIHA 3HU7A 4MVAA 3QQWA 1GVSA 1W3LA 1QI3A 3IK2A 1B4KA 4CNUA 2CEQA 1X38A 3KEHA 4GQRA 3BMVA 3LG3A 3CEPA 4AAJA 3PBUA 1E6PA 4E5TA 1T5AA 5EYWA 5DMNA 1TTJA 2ABAA 4CVWA 3WY1A 4DZHA 4B90A 2XWEA 2DIEA 4NY2A 4JX6A 4AZCB 4JD4A 3A9BA 2V67A 1E6RA 5FF4A 1OC6A 5ECVA 4ML9A 3HURA 3B9AA 1XYZA 2BHUA 3E0VA 2D0GA 2NQ9A 2A5HA 3USZA 3IUHA 3KFTA 2DIJA 4TXEA 5CBIA 2BODX 3PPFA 4NAFB 3W1PA 1MDRA 3TC7A 1NDVA 1NOFA 2P8BA 3A4JA 5I79A 4UQEA 1NF0A 2DSUA 4U3AA 1P43A 2ISWA 2Z1XA 3K5XA 1ESWA 3S5YA 4YS1A 4TIMA 5G4EA 1M65A 4HGXA 3LSBA 1QW9A 2AMGA 3H7VA 1SZFA 5KINA 1LUCA 2FVMA 4HSOA 5GJNA 3ARWA 3LHWA 4RJEA 3FA4A 3URBA 4H83A 4QITA 5D02A 2ZXQA 3RNDA 2PTZA 5JVLA 2PDQA 4XZLX 3VXGA 4O28A 1OCBA 3GNPA 4UFHA 3W7GA 2Y7FA 4GYPC 3DFHA 4GQ0A 1V77A 3WG6A 3D47A 2DP3A 2WC4A 3RM4A 3VNZA 2PTXA 3MANA 1AD1A 4PCFA 4H4IA 2FPTA 4LVGA 1FWJC 2IKJA 4C7DA 3RRXA 2QCGA 4ZQRA 3GW0A 1PCKA 1JZ2A 3QQ1A 2FVLA 5A6LA 2B31A 4Z1DA 1RJPA 3B8VA 3HJZA 4LUTB 3MU7A 4X0NA 1RAKA 2NX9A 4FSAA 1GZ1A 1JF6A 2NUXA 4OOUA 3ELFA 3S47A 3CEUA 1W2PA 2FQIA 3G6LA 1MW0A 1GYNA 3VKCA 3O2LA 1SYTA 3TTOA 5D8ZA 3ANVA 4LFYA 2XSXA 4QJ4B 1HNYA 2I9EA 1DIKA 1Q45A 3IGHX 2YDRA 1S2TA 1FQ0A 5A6BA 1DBTA 5AFDA 1VIZA 1HF6A 4U5KA 2OX1A 5DRCA 4CKQA 4US6A 4WIWA 5BRPA 3MI6A 1J2WA 4JIIX 1AODA 4HZ6A 4JCLA 3UJSA 4HMDA 4S3EA 4V15A 1AZ1A 4IPNB 3QV6A 4UXDA 1EX1A 1YW1A 2QR6A 4H00A 2QCFA 4BY3A 4ACZA 4HHMA 2J7BA 1JCLA 2ZUVA 3ITCA 1LLZA 3KVMA 3MMUA 3HBLA 4DUVA 4LW7A 3UYCA 1EIXA 2G3JA 3PBGA 3TZNA 3V35A 2BASA 3VIPA 5FAGA 1T40A 5CG7A 3GG0A 3LLDA 3WCZA 2HEJA 4EF9A 1B3OA 3QBUA 4RDZA 3F4CA 2EPNA 2OWXA 3H4WA 1YNQA 1XBYA 1JL8A 4NJKA 3EKZA 2YFNA 2OKTA 2REQB 3NL3A 2YZRA 4ZB5A 4QXIA 4YHGA 2DSZA 3HPAA 1CW2A 1Q65A 4A8RA 4FZIA 2G3MA 3WNNA 1E9LA 2CESA 4GLEA 4FNRA 2H90A 2WV8A 3H2CA 2TRSA 2X41A 4ZTYA 1R5YA 3ANYA 3SFKA 2GSJA 4J3WA 3W07A 1CCWB 1E1FA 1YXCA 3BZJA 2GDUA 1CI1A 3OA5A 4RNJA 1MVYA 1UWAA 5D04C 1SJDA 3KE0A 3BJSA 1IEIA 2QUUA 3QV8A 5IDZA 3WX7A 1SO3A 4MFDA 4HNLA 5AC6A 2NQHA 4H6QA 5G4HC 4IIDA 2HVOA 1OCQA 2GYIA 1EXPA 3SCSA 1EC8A 3U57A 5A8OA 4J7RA 5F2LA 4O0KA 4L6DA 1G4TA 4PMJA 2VT0A 1UPPA 2PDMA 5J5DA 3BLIA 4KFPA 1VBRA 1BSIA 4IOTA 5F2IA 1GVRA 1D2KA 3LD5A 4JYDA 3CIXA 2X1IA 4I9JA 1Q4WA 2A3LA 3KS5A 5H1WA 1JZ7A 1U22A 1PX4A 2AAAA 4UBPC 3KXQA 3RO6A 1QVBA 3GXFA 4U10A 4BEQA 1S39A 1UC4A 4ADTA 1IZCA 3LGDA 4KIEA 1XCXA 4KWWA 3QOKA 3WUEA 3WL0A 1NIUA 2NT1A 1HFBA 4LYQA 1EHNA 2GQ8A 2NX3A 3QSRA 4EP8C 5LHFA 4UMCA 3B0VC 4YTUA 3P84A 1HJUA 1BTMA 3BAIA 2ZRZA 4CLMA 1RZMA 2VR5A 2POTA 2ZUSA 3W7NA 1XCFA 5ABTA 3RO8A 4MJMA 3KOWA 4XAPA 4Q4RA 3GBEA 4RL3A 1H5VA 3G5EA 3UYIA 4CNNA 3ZWTA 2NSOA 4L9ZA 2ACUA 3N6QA 3W0KA 1A4LA 1E0WA 1XRSA 3KL0A 2QDEA 4QROA 3TYBA 5BW6A 1YPXA 3JS3A 4NL1A 4ZR8A 2DV0A 2OZ8A 4QX4A 2DUAA 3N12A 2I5QA 4ADSA 5K3VA 5BU6A 1OD0A 1BTCA 3UXLA 1QJWA 4C1NB 1EYWA 5HQMA 1FWBC 1OM0A 4IFOA 4KWSA 3GE7A 3P0WA 1H61A 2Y2WA 3NURA 3MP4A 2IPGA 4A8IA 5CBBA 4NZ4A 3EWXA 1H51A 3N3TA 3OGSA 3G1AA 4GYKA 1FCBA 3WFAA 2WB5A 3BLOA 5TQLA 2OOGA 4MTVA 2VVNA 2VQUA 1R3RA 1W3TA 2VC5A 1ZFJA 4NI8A 3NSMA 3WJWA 2E67A 3VKJA 4ZFCA 2YA2A 3M0VA 5DXYA 1TVLA 3FVDA 2JALA 4X9SA 1XICA 5CZTA 5EY5A 2X05A 3IUDA 3P6LA 4R7OA 5I0DA 1IGWA 2WZHA 2NV9A 3N3MA 2VFEA 4J3VA 1QWGA 3N2MA 1HP4A 5I3FA 2PE4A 3K1GA 2H3DA 3T0AA 2QYGA 1I0BA 1M7XA 1EF3A 3DFQA 4XB3A 4DHGA 3NO3A 2O7QA 5CH9A 3CT2A 3SY5A 1J5SA 3RFAA 1ODUA 3K30A 3O1NA 3TMLA 3B0XA 3SGUA 5RUBA 2RGLA 3A24A 3L2IA 3VFLA 2PU0A 4H2HA 1KWGA 3E02A 3LOTA 3TQ0A 4GIAA 3BLFA 2ISVA 2BGSA 1JIBA 1S2UA 1UR4A 2D2GA 2WC7A 1Q2RA 4H9ZA 1NFBA 1Y5XA 2BB0A 1YIXA 1FX6A 3L0KA 3P5ZA 3GUGA 2Y85A 2PDLA 4CEXC 2GL5A 3N34A 2FYMA 4CCZA 1EJXC 2IKGA 4DJDC 4GBDA 4MJ2A 5A95A 1ZBCA 4PYSA 1QO2A 5JH2A 2XH7A 2F61A 2H6RA 1TPUA 1E0UA 2ZICA 5MF5A 4JZ5A 5G2HA 1Q63A 4UMAA 3VMNA 4RE3A 1L6SA 3BURA 1TELA 3MDUA 2X0SA 3F5LA 2ZOXA 4IWWA 3WL1A 2Q02A 5IDIA 3DHPA 4QCFA 3Q58A 2XVKA 1TYGA 3W2KA 3ZO9A 3RXZA 3SRHA 1K8ZA 3ARRA 4LUIA 2X8RA 1G67A 4JX4A 3QV7A 3EB3A 1D9EA 3CS2A 1UH3A 1FWCC 2I7GA 2FZBA 3W7PA 4BFAA 3M43A 2B7QA 3KVLA 3LS9A 3TYDA 3RCYA 1K7XA 1TWIA 1AZ2A 2P1FA 3SUSA 2YXGA 4EXAA 2E6DA 3W6MA 2PF8A 4DIAA 4JQ1A 3QM3A 3OGVA 1O7AA 3ZJ6A 1UD3A 3HQ1A 3LCFA 3ZJKA 3U48A 3LENA 5FF3A 2RDWA 4HN8A 1JFXA 5LNRA 3CYJA 2C7FA 4AF0B 5LIKX 4MY9A 3WQ8A 2IW0A 1N8WA 5TF0A 3H4XA 2VRKA 3DFPA 1Z6KA 4XG1A 2FZMA 1IWPA 1DQUA 3NQBA 1DTUA 1O68A 3L0NA 4J35A 1JCJA 5KITA 3KZSA 3QKEA 4B2DA 3UJRA 7CGTA 1OX6A 3WH6A 4Q7IA 1HW6A 4HK6A 1C90A 1CXEA 3PB0A 5BROA 1PKLA 1MFVA 3RJYA 1XX1A 2R24A 3O0FA 4GZJA 1JDEA 1HP5A 2GOUA 4PUNA 2G95A 4A05A 1V51A 4GIRA 3UG4A 1J0ZA 1KV5A 2Y8UA 3B97A 4LOCA 4LGXA 2RKXA 2HNHA 1KCLA 4J3UA 3GHRA 1UUQA 1AQMA 2XTKA 4QRNA 4XSLA 3ZLGA 1BWVA 1QO5A 4DZIA 3W7EA 1DPMA 1TQXA 2W3ZA 3PZVA 3REQA 4MZ8A 4HOZA 1PZ1A 4YMZA 4P8VA 3NQVA 4WQ6A 3E2RA 3WLIA 5C7HA 3WNMA 2JFEX 4WY0A 4K8GA 1PEZA 1US3A 3S5NA 4IL2A 1KTNA 3H2NA 2A7RA 1VRDA 4FNPA 1V03A 3T44A 3G1SA 4YVPA 3TFCA 2A7PA 2Q01A 2WJEA 6CGTA 5LA2A 4C6PA 1HVXA 3TZFA 3QW3A 3BZGA 3NR0A 4D6EA 1G9HA 3ZJ7A 4JL1A 1IT0A 2GUUA 3VOCA 1J2BA 4INFA 1VCFA 1ZUAX 3M1ZA 3EYPA 1KM2A 3IJ9A 1YDVA 1H09A 1WDQA 4F8XA 3OEXA 3WLQA 4RZBA 2CLFA 1KRAC 1UBSA 3ITTA 4MY8A 5D2TA 1DKWA 2FZNA 3H2MA 4J40A 4XO7A 1SZRA 1Q6LA 3A3HA 3UA4A 4C7FA 4D6DA 1E72M 1T8QA 1ZALA 2ZUNA 3SN1A 2E6AA 1QW8A 3ONCA 3NO1A 4HK5A 1F8IA 3PTQA 1S3HA 3NEHA 1Q6FA 1MO0A 4FS9A 1PYFA 3G77A 3DAQA 3FEQA 1HUVA 4W9TA 3V5OA 4FX6M 1TREA 4C6DA 2ZA2A 5KSWA 1JD7A 1O5XA 1ADDA 1C8QA 3SY1A 1U5VA 1XUUA 4O1AA 2RDUA 3FCPA 3TWAA 1TPC1 2Z2BA 3CO8A 2C6QA 3AS3A 1CGYA 5ABFA 1Q2SA 3W53A 1X6UA 1CXIA 5E70A 4Q8OA 3IWPA 1DWGM 1KRMA 3W7JA 1WB0A 3UZYA 4FOKA 4HU4A 4F66A 7ODCA 3W74A 3ZVHA 3QZ6A 3LNMA 1LRQA 1JRCA 2QUTA 3W7HA 1GVEA 1F3WA 2WSPA 1CGWA 3GR4A 4KMQA 3K13A 3TX9A 3EA1A 2H3BA 4PL1A 1V6VA 3ABSA 3LCGA 3OVRA 4IIGA 1HKJA 4JTHA 3WQDA 2BFGA 3BJTA 3UR8A 2J6VA 4ZFMA 1QHPA 1W9DM 4UNKA 2GLKA 2WKJA 1XIDA 3KTXA 1IYXA 3A5FA 3AIEA 4UOQA 3CZEA 2ATSA 5D2VA 2OJPA 3WDHA 2XFRA 4HT3A 1PWMA 4GVFA 3T78A 4D8ZA 4MB5A 2C71A 3VC6A 5AYXA 1WQ5A 5LA0A 2Z1VA 3CASA 1CLXA 1LDCA 5E6YA 1D7FA 1TQJA 5F1VA 3BSHA 4JIPA 1Q6EA 1I9CB 4UTLA 4XZMX 2Z27A 3ALGA 3GY1A 1LLWA 3I4EA 2P88A 2G4FA 2V6AA 3LY0A 1TWDA 2Z2UA 4UQBA 3B40A 1LBLA 3W6YA 3IVSA 1V7AA 2Z1KA 3TA6A 1WUFA 2R9RA 1EO5A 2Q8ZA 1EDQA 4B3KA 4DBEA 3GDBA 3TH6A 3KRUA 2FIQA 2GJXA 3V5CA 4P8XA 1SO6A 4IUGA 1HN1A 3SCVA 4R7JA 3QEZA 2GGGA 2PWDA 2P0IA 4IJRA 2Y5JA 1US0A 5FF2A 2DGAA 1JPKA 1QI2A 4JKMA 5FEZA 4ZOAA 4J1OA 3BW4A 1W1PA 2YL5A 3AWNA 3N15A 5HWMA 5BMXA 4JL2A 3TONA 2KAUC 1AJ0A 1GPWA 5A6SA 4R9OA 4AZCA 3I3DA 4HJWA 3RUBL 4ZCWA 1GG1A 3MZ2A 5LIYX 1VZWA 3TYEA 3DERA 3GNXA 2IQ0A 4C5YA 1AW5A 2YCKX 4O1DA 2J8FA 4RNIA 4DO4A 3NL2A 4W89A 4A6GA 5BXPA 1E1CA 3GSMA 4NAFA 1K7EA 1QU4A 3O6CA 5B80A 1IXNA 3B0YA 4YTQA 3LTSA 5M2FX 4O12A 2BGQA 5CC6A 3AUOA 2X7VA 1J9YA 3G1XA 3FV9A 1FWEC 4H01A 1R6WA 4GFSA 1KNWA 1DJZA 3HF3A 1PZ3A 3CZ8A 2FJKA 1H62A 1I75A 4IX0A 2VOTA 4AZHA 3L4TA 3Q67A 3KOXA 4OFCA 3EOUA 5HANA 1JDCA 1XQKA 3PUGA 4FI4A 5DMYA 3BAJA 3AJXA 5B7ZA 1G5AA 2EO7A 2AGKA 1R9XA 3QGKC 1KFEA 1GOOA 4QR6A 3W22A 1YE4A 2TYSA 4D2JA 5FACA 3AYRA 1DJYA 4NJGA 3N2OA 4S39A 3NXFA 1HGYA 2DZSA 4DJDD 3H23A 1R38A 1UPMB 3VX1A 1XG4A 3EOSA 4ZB0A 2FMNA 2OQYA 2VR2A 2J13A 3WF2A 3KCLA 4H9MA 1L2QA 3MP3A 1CIUA 2PP0A 3GU2A 4MNLA 1XFBA 4YXGA 4WKFA 3STEA 4HCLA 4LUTA 1KW1A 4JX5A 1OGBA 2VDIA 3PC0A 3NVDA 3W3OA 2F7FA 1UKOA 5FJTA 1NOWA 4BA0A 3OA3A 1PIGA 4JHZA 3WBEA 4J28A 2AQVA 2Y6ZA 3P74A 3TOYA 1KLYA 2QEZA 2X1UA 1JPMA 5E6ZA 5CZJA 3N73A 2CFFA 3N13A 1M68A 4B5SA 2CHRA 1FXPA 1OD8A 1R2TA 3N11A 4GCXA 1NSJA 3QZAA 2PUZA 2BX7A 4NNCA 4RW3A 4HN4A 3TSMA 1LL6A 1MSSA 3HGSA 3S2NA 3VKAA 2BSLA 2GQ3A 1UWIA 3NQFA 1VQTA 2C0AA 1J4EA 2EKGA 2Y8KA 2CBJA 3TW9A 2HE8A 2VNCA 2PRHA 1A49A 4NX5A 1SQ7A 4O4VA 4QTGA 2NXIA 3KBJA 4UB9A 2CXEA 3YPIA 3CZGA 2PWUA 3BOFA 4TVCA 3NSNA 1RCQA 2PWVA 1LOQA 1KR1A 1J79A 1CENA 3H2OA 1ECEA 2YR1A 3M0MA 1E4IA 1IEVA 8TIMA 1EP1A 1GKQA 3ITYA 3V1PA 3FX4A 3PWIA 1OHLA 2NVCA 1RXOB 1JG9A 2REQA 2DW6A 3CUFA 1SJBA 5CSRA 2EEXA 3WBXA 4W4QA 5E09A 1F05A 4HD5A 2J25A 1GEHA 1N55A 1E0XA 3EDDA 1X98A 1WKDA 4WDWA 4L80A 4O0ZA 5I77A 3NEVA 4JNZA 4J2MA 1EIBA 4MMWA 2CWXA 2BHYA 2WBGA 4WD0A 3UWUA 3GK0A 4P7QA 1FWHC 3POCA 1DWIM 3GHTA 3A5VA 3DENA 4GO8A 4QQUA 2ZVIA 3G1VA 1GUVA 3H2EA 1UJQA 2R1NA 5LNWA 4F0MA 1UG6A 3MHUA 1IXPA 5DBUA 1PZ2A 4NNAA 4XAGA 4JNMA 5H2ZA 1JYXA 5D2YA 3PFMA 4LAUA 1O60A 1Q8AA 4QFUA 2C1IA 4LUYA 1PTAA 4I8DA 1H4PA 1I45A 4DRSA 4MWAC 2E9BA 1X96A 3BARA 3WDIA 2ASHA 2VJXA 2E77A 1J6OA 4GA8A 4AWEA 3BQ5A 3KHJA 1E9YB 2NQJA 3NQDA 1VYSX 1R3QA 3THDA 3W7RA 2EG6A 1FKWA 2OXNA 1KM3A 1IZKA 5I02A 1XFCA 3CV6A 2QAFA 3WUFA 4M82A 3P61A 4NSBA 2OYLA 1Z3NA 3L4XA 3AHVA 4FNSA 3ZSTA 1OFAA 2OEKA 5D05A 4RW5A 4Z0SA 3PNUA 3GB6A 4X63A 3VNMA 5BU9A 4Y9PA 3GKAA 2X1TA 5FSDC 1H50A 3UA3A 1VC4A 5CPMA 1LBFA 5AYBA 3G1YA 3ZYZA 3NM3A 3NL6A 1ICQA 3G0SA 2EJAA 1UKQA 2W61A 4AX6A 5JUVA 1PWLA 3IGSA 2GUYA 4GINA 1OIFA 2VFFA 4QNWA 1ZJAA 4CU8A 2GGIA 5BYWA 4XZBA 1C3FA 1L2UA 1UMLA 5FJPA 4UFJA 4XZWA 2TAAA 4PMYA 1ISXA 1UZHA 2QF7A 2HBVA 2Y63A 1QDSA 1E6NA 3KRZA 3FHAA 1TE6A 2IKIA 5CZ0A 4C1NA 4D8LA 2VQTA 5TAOA 1V4YA 2WC3A 2QUVA 4JPGA 3GNOA 3WEZA 3RCMA 5IM51 3KWSA 3WZ0E 2V69A 5H8MA 4NJHA 3DHFA 3H54A 4PCSA 1D3HA 3I7QA 4FLSA 4DUXA 2P76A 3R0KA 1TV5A 1XIJA 5AVHA 3TROA 1QFEA 1TUXA 4JHOA 4HSNA 1SW0A 1V6TA 5EMJA 3N2TA 4RZ4A 4R34A 2WW5A 1T0OA 1CGUA 4PTWA 1F7BA 4UCFA 3VO0A 1ZAHA 5HDRA 3UJEA 4HNOA 7PTDA 4I9TA 3OYXA 4UTTA 3AYSA 5D32A 2V9DA 3CK5A 2OT1A 4KT2A 4QGCA 3MI3A 4DWSC 3DG7A 1OCJA 4O1BA 4WRHA 2ZUMA 4G7EB 4PUJA 4PULA 1AJZA 1UKTA 1A5BA 2A2IA 5H8PA 3IJLA 3ITOA 4REQA 2R82A 3FA3A 1C8YA 2FZDA 3ABRA 2ABBA 3AMGA 4UFMA 1XLFA 2YL9A 1XCWA 1JUEA 3RU8X 3UETA 3CHVA 5FF0A 1IF2A 3JVAA 5CSSA 1XYAA 4I7WA 2W63A 4Z2KA 3VIHA 3MA8A 1G1YA 3W72A 3GC5A 4HZMA 5FKYA 2E4TA 3ZVIA 2ATMA 3VNYA 3LCHA 4FXSA 4LYPA 2D0FA 3LUTA 3RPDA 4M80A 3O6DA 3HJEA 3SGGA 1NQKA 3GR8A 1OFPA 1WV2A 3EKLA 5A8PA 2QZRA 1AW2A 1FH9A 2AQOA 1W3IA 4NAEA 1V0MA 4C90A 5DT7A 3ARZA 4L64A 1V3LA 1CB7B 3ATZA 2Q71A 4YU1A 1F4HA 1W37A 2WMFA 4HU0A 1F07A 3MHFA 4P61A 3PZMA 4AD2A 2RGMA 3T6CA 4ERGA 4XKYB 3ANUA 1V3KA 2BDQA 2NV1A 4N9DA 3GH5A 4GE8A 1G4SA 3R43A 4ENLA 4O15A 1KWKA 1BXBA 3ZFHA 5IFPA 1A3XA 2CLOA 3I65A 1RPKA 4GIEA 4ADUA 4S2CA 2PDWA 4CCEA 1W9PA 3CMFA 1VFUA 1XRVA 4J27A 4D6HA 5F2GA 5U7SA 2GJPA 3LZ5A 4WGHA 3LDVA 3ORWA 1I1WA 1CGVA 2VUNA 4AF0A 3O3RA 3UPBA 1Y65A 2V5JA 5DANA 4F79A 2FB2A 1W3NA 3O07A 3TP4A 3PSVA 3WQCA 3SR7A 3WLHA 2IS7A 3BOLA 4A3QA 2HXUA 4RZ6A 1VJSA 4TV6A 4LAKA 4C6FA 3DI1A 4LT9A 4L7ZA 3GXNA 1FWFC 3OO2A 2CKRA 5A6KA 3WD1A 1ITUA 4ZQCA 1ZU8A 3M5XA 4AD3A 1CECA 1YDNA 1OB0A 4MUPA 1WDDA 3E2QA 3WEMA 2B81A 3NQ7A 2OQHA 2NUWA 2ZE0A 3K2GA 4ZODA 5EMMA 4LPCA 3II1A 5C2CA 2ZUWA 3BLPX 3TKFA 4X2RA 2E68A 2FZ9A 4Z2HA 5LYRA 3SAZA 1HX0A 1PJ9A 3LZ3A 3W9ZA 3VZYA 2YXOA 3AXIA 1PO9A 1OFEA 2V3GA 3MC5A 4NXSA 4AB4A 5TIMA 2I5IA 2OR2A 1YEYA 1W1VA 1FHUA 5A2CA 2WQPA 4WZHA 1WKEA 4MB4A 4W8LA 3OIHA 2ZX9A 1WE5A 3PBVA 2JK2A 3T05A 3TC6A 3OODA 3EPOA 2DZVA 1BG9A 2HMCA 4Q8TA 3D3FA 3QJAA 4IQDA 3E0LA 1C93A 3GS6A 3RYSA 1CZ1A 3O05A 2VUYA 1XKYA 1EKOA 1PE1A 2R91A 3B9DA 3FAXA 2J7CA 1LWIA 3QHNA 3LPPA 3KM8A 4HCHA 5C7VA 5CBJA 4GHRA 2J6XA 3GWQA 3VOHA 7ENLA 2D3LA 7REQB 2ZRXA 3FKRA 4UFLA 4M5PA 2QNEA 3BVJA 1WKFA 1NWUA 3B3DA 1GOWA 3BWWA 2DW7A 1J11A 3PTKA 1OCNA 3HOJA 4AD1A 6TIMA 2PGEA 4XZNX 4NF7A 1TV2A 2V2DA 1IT8A 2W9MA 3HGJA 1H1NA 4WOZA 1ZBWA 1OC7A 1OC5A 3N2XA 2NW0A 4IISA 5HMSA 2HJPA 3BAKA 4HPJA 4TVUA 5REQB 3W02A 4X0VA 3C5QA 5JBEA 1H11A 3W2JA 3PBYA 2A3AA 5DCEA 1XGZA 1GHRA 5CGMA 1NU5A 3STPA 4B92A 1CWYA 1UWTA 3EDKA 1TMLA 1S2AA 3K4DA 3HTWA 3TLLA 2ZIDA 4QJ3B 4E8GA 5F4SA 3GTIA 3M0YA 2UY2A 4YYCA 1HKIA 1DEDA 1RQEA 1YDOA 3PPCA 1R87A 4O54A 3H7RA 3A9IA 3P93A 3A23A 4E4UA 2OEMA 4PSPA 4AMAA 4BQ5A 3TYUA 4YTSA 4M29A 4ZQOA 1TPVA 1NY1A 2IPJA 1LRNA 2G3FA 3RGTA 3NG3A 4MDOA 1KM6A 4PMUA 3SIMA 1FFQA 4IQLA 3S9ZA 1A4MA 2DH2A 5D9MA 3E96A 1ME8A 3BO9A 1MFUA 1NH6A 4EPDC 5IBXA 3AQUA 3ZM8A 4OKDA 4ZVJA 3LPGA 1JPDX 1CPUA 1UR3M 5LNUA 5M5DA 1OK6A 1BKHA 3EX2A 4PTVA 4KWVA 1B5TA 3BJFA 4M19A 3L0GA 4Z08A 3WH9A 3RG6A 3A6OA 1EJUC 3TN4A 5IXEA 4A35A 3IEBA 1V6WA 1XIGA 3CU2A 2XDFA 3ZSSA 3N19B 4HA1A 2EPHA 1RSCA 5EL1A 2P3ZA 2A7NA 3CNYA 3T4WA 3TJ4A 2BP1A 1KBLA 4Z2LA 2ZZ6A 4ZXLA 3GZ3A 4JFTA 1KGXA 1M03A 1XDLA 2J24A 2BY0A 3AIQA 5HJLA 1DWJM 3LRMA 1FOBA 3W88A 1TR1A 3S2JA 3KHDA 3QY6A 4PUEA 4S3BA 1R9YA 2VM8A 4LUJA 1KKRA 2OO0A 4EANA 5FAJA 1LORA 1VEPA 2ALDA 1IQ8A 4MAZA 3LHTA 6TAAA 4JEQA 2Y88A 7A3HA 2C16A 4C6JA 1XI3A 5I03A 2BTMA 3LHZA 3MUY1 3MUAA 3DU0A 1J8VA 2V2CA 3THQA 4IMDA 4V1XA 3DBNA 4OUEA 3E38A 3F4VA 4O8AA 4WJXA 5HUPA 3AHZA 1ZZMA 1JQXA 4W7WA 1VRXA 4Z2JA 3UXDA 4LWWA 3EA2A 3RLVA 3M0KA 2E5DA 4O57A 3GC4A 2O7SA 2OLHA 2V81A 3GVWA 4UR9A 5JIPA 3BLEA 3J7HA 4M6VA 2AL1A 2DVUA 2QAPA 1RR2A 4UTJA 2X1SA 3WBYA 4JICA 3BH4A 4C6LA 2BS9A 1IE7C 4YN5A 3W7DA 2WPBA 4LRSA 4DNHA 3WQGA 4YPJA 3UY8A 1A50A 2WHLA 2OZ0A 4Y6GA 4TMCA 3MBDA 4B5NA 1WP6A 3DFTA 3W00A 1OGSA 2FLIA 1MEWA 3W7CA 4C65A 3EWWA 1TWSA 4LBUA 1XINA 4X61A 1XIEA 2ONEA 4DWSD 1OK4A 2V68A 1W5MA 2J9XA 4X9YA 3EDFA 1WDWA 2R1LA 4QHRA 1NM9A 2OSWA 1T96A 1YPIA 4O14A 3ZMRA 4FLRA 2HVNA 1VBGA 2CXGA 1PKNA 1TV7A 5HWNA 2HPMA 3PZQA 4HZ8A 1XIHA 3H70A 4E2VA 4GQGA 3PUEA 4Q4SA 3RITA 1WYIA 2VD8A 1VBJA 3WJXA 3U8GA 1EBGA 2Y62A 3QTGA 1SPQA 3HV9A 2QCDA 1AH4A 3UCCA 3OOQA 3LHYA 3TTYA 3WLTA 3APTA 2YYTA 3HFTA 3MUXA 4Q32A 4GGHA 4O0QA 3NPVA 2PBOA 3W7OA 3P80A 3GDKA 2WM1A 4KS0A 4GG9A 4AFYA 1EP3A 2X7WA 2FZ8A 4PTNA 5XIMA 1R8LA 2QVHA 2BOEX 2W4XA 3P67A 4LUSB 4U4MA 2I1OA 3QFEA 2YLLA 2D2OA 3WMLA 2WNWA 3QMSA 4FNQA 3MT1A 3I7SA 2EAWA 3VIOA 3B8WA 4AX7A 2W0UA 3E3HA 4TX6A 1JZ4A 4OU1A 4UTWC 3ITVA 4H3DA 4ECLA 3B03A 2ZX8A 4AIBA 3KBNA 2SFPA 5CPNA 1B1YA 3T40A 5SWUA 3OGRA 2VI0A 4YYFA 3QW4B 4B5UA 1TJRA 1XLGA 1XLIA 4PB3A 3DI0A 1RV8A 4U5IA 5XIAA 2H9AB 3U9IA 4R7WA 3T0BA 1PX8A 3GVRA 3TXZA 1XLEA 2AGTA 1SO4A 4WUIA 4JTJA 4FA3A 3CGTA 1VHCA 5G4WA 1UZ1A 4MWAB 4BHYA 4LX4A 1RY0A 2D0HA 3MCNA 2Z28A