1O5XA

Plasmodium falciparum tim complexed to 2-phosphoglycerate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structure of Plasmodium falciparum Triose-phosphate Isomerase-2-Phosphoglycerate Complex at 1.1-A Resolution
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 95
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1o5xA00
2JBMA 5IM51 2A6LA 4ZQOA 2LLEA 3W83A 2Y63A 1KFJA 4FHAA 4GUGA 4KWVA 3LCWA 3MWAA 2G97A 1R2RA 4HT3A 1ZENA 1L9WA 2TRSA 4K39A 5LNUA 1F7BA 5LSMA 1L6WA 1H7OA 3LI1A 4RR4A 3D0CA 3TAKA 1MEIA 3QSTA 3GVGA 4DO4A 2QCDB 3OVRA 3MP3A 5FEXA 1FBAA 1X6UA 4Y90A 3OVQA 2QDHA 3O16A 4UFJA 1W54A 2ZQ0A 3EWWA 2VC6A 3LHWA 1KV5A 2V82A 1FWNA 5C5YA 1KLZA 3G1DA 2BX7A 4JTHA 3O06A 1XCFA 2VEKA 4WZHA 1SUXA 3SECA 5KMYA 1Z42A 3TUUA 1OABA 3IIVA 3NL6A 1EP1A 1EWEA 2J88A 1ZFJA 1DQWA 1TPWA 1LBFA 2ZZ4A 3EWXA 4GXMA 5LHFA 3G1XA 2VFEA 1LZOA 3GX9A 4DPPA 2WNNA 1TCDA 2F7FA 4NJHA 4CNNA 5FF3A 3TIMA 2XFWA 2QCHA 2ZA2A 4GWEA 4Z1CA 3I68A 1RQHA 3UYCA 1R2TA 1G7UA 2OZ0A 2E09A 5U4NA 1EIXA 3H55A 1LCOA 3FA5A 3L2IA 1P0NA 1O60A 2ISSA 1JCLA 5AYZA 3W2UA 1MXSA 4LRSA 4JTJA 3IVUA 1IGSA 2HSAA 1WAUA 3BG5A 3GDLA 1QCWA 4MYXA 2QDGA 2DZUA 1SR9A 2ZRYA 3P80A 1NFBA 3QC3A 5AC8A 4UR8A 4X2RA 1Q6QA 1X8FA 1O94A 4MJZA 2Z2UA 2C15A 1BWLA 2NUYA 4QAIA 3F1QA 3A23A 4UFKA 2V81A 4XUGA 3NEVA 4Z08A 3TMQA 2YCEA 5FF7A 2W0UA 5D03A 4DXVA 2PURA 1CX9A 4OWGA 3FKRA 1KFLA 1EP2A 2DZVA 1ZHAA 1PL9A 3GXTA 3MMTA 4R7JA 1BWKA 1FXQA 4QNEA 3G1YA 3ZR4A 1OF8A 2ZYFA 1Q6RA 3OIXA 2ATMA 3QYQA 1MEHA 4O28A 1SU5A 2NX1A 3HGJA 4XKYB 3JS3A 4I7UA 1T0OA 4NUWA 1HFBA 3G1FA 3N3MA 4GNJA 4IUOA 3CWOX 5AOUA 1KBJA 4CLMA 2Y7FA 1YXDA 3M41A 2Y62A 2E5CA 3NZRA 3RK8A 1QMLA 2E5DA 3R12A 2C13A 3R89A 3EX3A 1H51A 4KFNA 5AYYA 1KW1A 1Q3NA 1KM4A 1GWJA 2CLHA 3HB9A 5I3FA 2C18A 3B0UX 1QWGA 4LW7A 4ZQRA 2BZNA 3PUOA 1TSIA 3B03A 5DN1A 3MP5A 3BO9A 1K7EA 3G1VA 3MHGA 1OFEA 2CZDA 4IMCA 3YPIA 3PG8A 3LCXA 4FXRA 3NNTA 4BI5A 1W3IA 4YCPA 4M7TA 4K38A 1YTKA 3QW3A 2PRHA 4UTHA 1PHQA 5G4EA 2ZZ5A 1H1YA 3FYOA 2H8ZA 2TSYA 4UR7A 3Q2DA 1WX0A 1FDYA 1RD5A 5LNRA 5D2VA 1WOBA 3PSWA 3NQDA 3B4UA 1I2RA 1O5XA 2A21A 3MI3A 3CHVA 4XBSA 1ZAHA 2GPTA 3LTSA 4EWND 3I6RA 3I7QA 2HS6A 1BTMA 3DFNA 3PS7A 3L21A 1ZY9A 5F2IA 3LCIA 1GEQA 4K7YA 3L5AA 5E0KA 2A1YA 2V5BA 4AH7A 2HS8A 1W5MA 3QZEA 2ZZ3A 1TPC1 3BLIA 4NNAA 4LTSA 1QOQA 3W9ZA 4LV4A 3T7VA 3TK7A 3W7LA 5TBOA 1RZMA 4ADSA 1YDNA 1GVFA 4NX5A 5AN7A 1R46A 4AAJA 2R91A 3NZ1A 3BPWA 1FX6A 3WK0A 5J5DA 1G69A 3EX1A 3TCEA 3MI2A 2WQPA 3Q37A 4AMAA 1SW7A 3HQ1A 4IMDA 1UUOA 3RFAA 3MUXA 3NR0A 3RNDA 4H6KA 3UXAA 1K8ZA 5I3JA 3M47A 3MBFA 1YXCA 4IMGA 3UD6A 1GVRA 2XN2A 4UMAA 2VEIA 1TYGA 3QMRA 1A5AA 4Y96A 5HULA 4MIMA 5K3VA 4X9SA 2QCDA 3KHJA 3KFTA 1H60A 4M7SA 5FEWA 4IX0A 3USBA 2GUUA 3G3MA 3GZ3A 3NAVA 3TMLA 2X1RA 1YPIA 3LCFA 5AHIA 4A22A 2CZFA 4M6QA 4JY9A 1XUZA 3OVPA 4MYAA 3TFXA 2NXHA 2WJZA 1W31A 2CW6A 3GAYA 1TQJA 1Q6LA 1Z48A 3P8JA 3N14A 4O50A 4JGDA 1ADOA 2PC4A 2QKFA 2B7OA 2R14A 4BI6A 1VHCA 5CPNA 3W7MA 3LV6A 1K8YA 4HPJA 1YPFA 3EWZA 3GDTA 3STCA 3FLUA 1VYRA 1QDSA 5G5IA 1YTDA 4H3DA 5BRBA 5DCDA 2X1TA 1LM1A 3DBPA 5KSWA 4FIRA 4UNLA 3P82A 1PIIA 4N6FA 4CCDA 3NQ7A 3E02A 2WKJA 3JR2A 3RMJA 4UIOA 3W76A 4PA8A 1IXNA 2ZA1A 1H7WA 4JTUA 4UFMA 3E9AA 1KBIA 4LY8A 1QR7A 2Y70A 4WY0B 4JN6A 1NF7A 1IXOA 4UTJA 5KTLA 3C2RA 2AQWA 4ZQNA 2YDAA 2XN0A 3WJSA 1WBHA 4K8EA 1ZCOA 3MBDA 5D38A 3TX9A 3EB2A 3EX2A 3GIYA 3M0ZA 3PB2A 2E6FA 2NZLA 5EKYA 1F2JA 2D73A 3NXFA 3NGJA 4JYFA 3EKLA 4PFMA 3N2XA 4LNYA 1AW5A 4UNKA 4RXFA 1AW2A 2FLIA 2NV1A 4DBEA 4R33A 4ADUA 1OFBA 3FFSA 4QITA 3QM3A 3U8GA 4JTSA 4K37A 1M5WA 2GVGA 2WO5A 5CPLA 3QH2A 2Y7EA 4XKYA 1GJPA 4RZ6A 2FPVA 2E5BA 3G1AA 5CPOA 2X2GA 4LUIA 5F1VA 5EBUA 2V0TA 4E2DA 2YGYA 1JUEA 4N9DA 4M6VA 4FX7A 4DPQA 1VYSX 1QAPA 2QJHA 3G1HA 1Z41A 4AB4A 5K9CA 2ZZ2A 3S1WA 3F03K 3M44A 3MYPA 4MZ1A 2CLEA 3LM7A 4ADTA 3PM6A 1K8XA 2J6XA 5I3KA 3C3NA 5D32A 2VKZG 3ATZA 1UB3A 1I2OA 3GXNA 1OVDA 5TIMA 5IBXA 1VR6A 1TTIA 4GUHA 2CLOA 3DH7A 4PC8A 2ZTJA 4FIQA 5ABTA 3ABRA 1I8JA 4TO8A 1F5ZA 3LLDA 4JTKA 1O5KA 3BV4A 1JUBA 2NUWA 3EEGA 3CLMA 3O6DA 4LS2A 3N19B 3V75A 4Y6GA 3QQ0A 3NYZA 4BF9A 4NU7A 4FNRA 2FB3A 3LHVA 4LS1A 4FB7A 1SO6A 3P67A 4AHPA 3AO0A 3W2MA 1IIGA 1A5SA 4DQWA 1S5TA 5LGXA 1FWSA 4NX0A 3C8FA 4A3UA 3O15A 3G0SA 1C29A 3A21A 2V5LA 1DVJA 4LUJA 2YFOA 1ZJIA 1SQ7A 2FDSA 4BI7A 1LP6A 1I2NA 1OFDA 3ABOA 5C54A 3SR7A 5HINA 3DFPA 4JTLA 1SZEA 1FDZA 3LXBA 4AF0B 1B4EA 2X1UA 3T78A 2ZZ6A 3LTPA 2WPBA 3G18A 2R8WA 3N9SA 4BWLA 1I45A 1TB3A 1WBJA 4EOUA 1TPFA 4YXGA 2BXVA 3NQVA 4DO6A 1PV8A 3CIXA 1VYPX 3WFAA 4O18A 3PBYA 1SSDA 5CZJA 1OFPA 2Y61A 3W1NA 2Y88A 3RF9A 1H50A 1JQVA 4WXZA 4UMCA 1K03A 3EXRA 5AHNA 5F1UA 1JCXA 1TRDA 3L67A 4UC5A 2J9XA 2ZBTA 5HNRA 4Z1BA 3CEUA 1LBMA 1HTIA 4GBUA 5D05A 1W5QA 3BLEA 3HO8A 3M5YA 3W1AA 5DBUA 1Y0EA 7TIMA 1TPH1 4GE8A 3M9YA 1KLYA 1MSSA 5CG7A 3P84A 1SO5A 4AXKA 3MYOA 2WV8A 4CCEA 3S5OA 1B57A 1YDOA 4ZQPA 1GG1A 3OG3A 2J9ZA 5D2TA 5CZTA 1DJNA 3WK1A 4MVAA 1FY6A 2BSLA 4JICA 5EMUA 5BNKA 2AAMA 3NDOA 1OFOA 1JJKA 3PBVA 4LVGA 2QCGA 3W1QA 3NVTA 2OJPA 5AHFA 2E68A 1J2WA 3IIPA 4WJEA 3QQ1A 5BW6A 3L9CA 4ZL1A 3BW3A 1D3HA 2TMDA 4EF9A 1W37A 1J5TA 2QAPA 2QAFA 4RV8A 2FTPA 2DZPA 1K02A 4UTLA 2DZSA 2W6RA 4K6AA 3S1VA 1WA3A 3NA8A 4LS0A 3AJXA 2B7PA 3UWZA 5D2XA 5FESA 4ZMGA 1DHPA 4UCGA 3TFCA 5HWJA 4O14A 1ICPA 3G3DA 5G1TA 1R30A 2RDUA 2X1SA 4WY0A 5LNVA 3TA6A 1LLWA 2QCMA 5HR7A 3EWBX 2GJNA 4QNWA 3WK3A 1IIHA 3RLUA 5L6UA 4HNTA 3S5NA 1PCWA 3PB0A 3UWWA 3IRDA 4JTFA 1N55A 2ZRWA 3N9RA 2OCZA 3W2KA 1JCMP 1Q6OA 5FF2A 3W88A 5CGQA 2ABBA 5TQLA 3LTYA 2A5HA 3LCHA 1TTJA 3WJZA 1M7OA 4JX5A 4DBDA 1TV7A 1WDWA 3GLCA 2NX9A 1LTDA 2OT1A 3TE9A 3IGXA 4YCOA 4O16A 3U2OA 2CLMA 5LNSA 5HR6A 2RDWA 5D33A 1TMHA 4GUIA 4IPJA 1Z44A 1G67A 3FOKA 1ZAJA 5DY3A 1C9DA 3MHFA 4YLWA 4TMCA 3KX6A 3LOTA 3BVJA 1W5OA 3VFLA 2VFFA 2EKCA 4DELA 1XI3A 1L6SA 2RFGA 4N6EA 1CW2A 1XKYA 2KZHA 4ALDA 3THAA 5LHEA 1OYBA 4NNBA 3S5ZA 3TH6A 1H7NA 4DF1A 3GYEA 4OU1A 1FWTA 4N4PA 1EA0A 3KVMA 2Q8ZA 3W84A 3VCRA 5EYWA 2PE4A 4JX6A 2H90A 3U6WA 3CM4A 4NZFA 3ABQA 1JQXA 3K30A 1FCBA 3P74A 4GUJA 3KOFA 2RKXA 1LORA 3DENA 3VI2A 1W1ZA 5D2YA 3BG3A 2DP3A 3EX6A 4S2BA 3SI9A 3QPYA 1RVGA 1VCFA 2VOMA 3TNOA 3HJZA 4TU1A 1DL3A 1JUKA 1HUVA 4ZQCA 5D2WA 5AC7A 4R53A 3W7KA 2GVLA 1V5XA 2JKEA 4I9AA 2GQAA 3FIGA 2Y89A 3NG3A 1ML1A 1XBVA 2QCLA 3L5LA 4IMFA 3IVSA 3LX9A 1OX5A 3QW4B 4M19A 4A2RA 2B7QA 3NM1A 3W7NA 3SIZA 1GVQA 3TXZA 3CTLA 4WY0F 4HSOA 3W3OA 3L65A 4DO5A 1FDJA 5G2HA 1GYNA 3PULA 3OBKA 1H61A 5LNWA 1C8VA 3W1MA 4IXHA 1YXYA 4ZVJA 3KRUA 4O10A 4O13A 1KFBA 1FCQA 4AF0A 3PBWA 5A5WA 1ICQA 1ALDA 3HPZA 5CKSA 5K2ZA 4UTWA 3W7CA 3CIWA 3A5FA 6TIMA 1FXPA 5KINA 1GG0A 3TSBA 4O12A 1TV8A 3UZ5A 3IIZA 4GRSA 3P60A 3FKKA 1WV2A 4PL1A 4WOQA 1EEPA 3CQ0A 1VQTA 2YYTA 1AMKA 3LLFA 5H91A 2ZTKA 3P7YA 1RPXA 4LU0A 4S1FA 4FX8A 3DHFA 4MOZA 3B05A 3UWQA 3HOJA 2C3ZA 1ZAIA 3KVJA 2E6AA 5HWNA 3HPXA 3PG9A 3W2NA 2CLIA 4FNPA 4N2YA 1RV8A 4MZYA 1W56A 4NNCA 4P2VA 4CQ8A 4PL2A 6ALDA 1AL7A 3CEPA 4TIMA 3LI0A 4ORIA 1HO1A 1U83A 4Q32A 4XBKA 3LHZA 1KTNA 4MY1A 4JTGA 4RCXA 4LC6A 3TJXA 2ZZ7A 3FYPA 4QJ1A 5EY5A 3WK2A 5K7JA 4N4QA 4C1LA 2EHHA 1L2UA 4DF0A 3P61A 5IBXC 4HN4A 1B9BA 1TTPA 1GT8A 2OT0A 4RZ4A 3KXQA 3NL2A 3H54A 4Z0JA 3IGUA 3BW4A 3LRMA 3P62A 3N2MA 2QUTA 3T55A 3GXPA 2ZRVA 2DZTA 3NPXA 5HUPA 4PH6A 5AC6A 5C2XA 1QPRA 4JYEA 2VEMA 4I7VA 3QFEA 1YDVA 1W5PA 4Y8FA 4UTMA 5E1QA 4CQAA 2C16A 2P1FA 3NQ6A 5A8GA 1GZGA 3FJLA 2VFHA 1THFD 1KM3A 4BFAA 4X22A 2YW4A 1H7RA 1OFRA 3LHUA 3UNDA 1NF0A 2NXIA 2ZFAA 4KKXA 4RJEA 1RR2A 4QISA 2HTMA 3VKJA 2QJGA 4OQVA 3Q94A 5C55A 3W86A 4TX9A 3EX4A 3GDMA 1DV7A 3L66A 2TPSA 4WOZA 3DFSA 3Q58A 1OYCA 5AB3A 4JNMA 8TIMA 3W2LA 1K3UA 3A22A 4EIVA 1W3TA 5AHMA 1LLZA 4ICNA 3L0KA 4NQ1A 3L0GA 4N9BA 4PODA 3TQKA 3P5YA 3DKLA 3F4WA 2ZRXA 4JR5A 3W72A 2J24A 4BWLC 3GNNA 3M43A 3SJ3A 5GVJA 4HKPA 2TYSA 3NQ2A 2Y7DA 3R5EA 2ZA3A 3S5YA 4UFHA 4L4LA 4NJJA 1DBTA 2ZZ1A 3M6YA 3THQA 3PAJA 2AGKA 2VELA 2QCNA 3TC6A 1JCNA 3UZJA 1JR1A 3PUEA 4CQ9A 2BTMA 5HQEA 2ISVA 1OG0A 3C56A 3HIJA 1QPNA 3NM3A 2NWSA 3WJWA 4XTDA 5DXXA 2Y6ZA 3E49A 4BR1A 5F2GA 3KVKA 3QF0A 4IXXA 3CT7A 1I2PA 1XL9A 3DGRA 5FF4A 3HGOA 2GVJA 2I1OA 4XTIA 2A7RA 5CZSA 1VPXA 1H63A 3EXTA 4QIUA 3W74A 3QJAA 1VC4A 4HNNA 3TSDA 3DI1A 1OYAA 3DKJA 4CNPA 1NVMA 1NAL1 3G1SA 2FJKA 3MHUA 4MPQA 2I9EA 3NQAA 2WSQA 1WOAA 3DHDA 3W1TA 2QF7A 2EAWA 3SZ8A 2RHGA 5D04C 2DJXA 3W7RA 4PEKA 5F2LA 3TAOA 1G4SA 2DU2A 2CZEA 3B04A 3CPRA 4JX4A 4LOCA 3DFOA 4OGZA 4N9EA 4O15A 1KM1A 3W2JA 2FPYA 1KV8A 3PC0A 3SY5A 2A6NA 1XXXA 3IIXA 2ATSA 4EVZA 1OJXA 1I2QA 2ZRUA 3P81A 3LRKA 5LGZA 3UQNA 3O6YX 3VNDA 5EPDA 1TPVA 1AG1O 1MZHA 4JTEA 4IJBA 1UASA 5HUOA 3VE7A 1XFBA 1EUAA 2O7QA 3GB6A 1KFEA 2V30A 1ICSA 1SW3A 5H2ZA 2H6RA 1PVNA 1XDMA 4JY8A 3HF3A 3M5VA 4GUFA 3IGSA 3A5VA 2VFIA 2DZXA 1T8XA 1R2SA 1G4TA 2NUXA 2V2HA 4C1KA 1A53A 5AHLA 4O4WA 1G6CA 3T40A 3TW6A 5DCEA 3STFA 1SO3A 5BMXA 1SFLA 1SO4A 3NQGA 4JYDA 1UJPA 5E93A 1ZALA 1EUNA 1LOLA 3IV3A 3S6DA 3H53A 2EF9A 3O8AA 3GNDA 4UFLA 1KM5A 2Q8LA 1S5WA 3VE9A 5CSRA 3TU9A 5K4XA 3TC7A 4O52A 2BWGA 3GDKA 4GFSA 1VLWA 4MZ8A 1OK6A 5FEZA 3KRSA 1A5CA 4WD0A 3LHTA 3DAQA 4FNSA 2H3BA 3C2VA 4JDYA 3NQCA 1OHLA 1P0KA 3CU2A 2FQIA 4U28A 4RZ5A 4NJGA 3RLVA 3CWNA 1FQ0A 4B5NA 1X1OA 4FNUA 1QO2A 3L5MA 4RK8A 3S9YA 2V8ZA 1KFKA 3TDFA 2QCCA 5I3IA 3SGZA 1R47A 2V2CA 5CZ0A 1LROA 2CWNA 3P5ZA 4AWUA 2Y85A 1RQBA 1KA9F 5SWUA 4D2JA 1VS1A 3LDVA 2ZDRA 3NPWA 3QPZA 3QSRA 1YTEA 3STEA 2R94A 4K7VA 4LVDA 4QSHA 1PHWA 3B8DA 1JRBA 1GVOA 4KFOA 4AHQA 1OFAA 3W7HA 2FPTA 1ZNNA 4O1BA 5AHEA 4UTTA 2OMAA 1XBZA 1LOSA 2DORA 1G4EA 1QFEA 3TROA 5F4WA 1LRQA 1ME7A 5F2MA 4RXGA 3DFTA 3W7QA 3SFKA 1DORA 2DJLA 5L9FA 1H1ZA 3MI6A 5K4ZA 3BGJA 3W7GA 1D9EA 4IQLA 2WNQA 4UTWC 3EWUA 3W07A 2A4AA 3IIOA 1GPWA 3UY7A 1QO5A 1X7FA 3L0NA 3G0XA 1CI1A 1S3HA 3BW2A 4O57A 1ME9A 3E96A 1B4KA 5DY2A 2YYUA 3O05A 2RDTA 1F76A 2JGYA 1KM6A 1OF6A 1XUUA 1GVSA 1AK5A 4LV9A 3MP4A 4R34A 1BEUA 3BK0A 1JCYA 3BARA 4JTTA 4QQ3A 1T96A 3E12A 2GQ9A 4N9CA 2WSRA 3ELFA 4HPXA 1KTBA 3QRHA 1K7FA 3FJ6A 1LOQA 2FIQA 3WJXA 1SZFA 4WUIA 1F05A 3A24A 3KRZA 2A2IA 3M7WA 1SFJA 3M5ZA 2I14A 3W1UA 4HSNA 3OEXA 4AVFA 1HG3A 2Z6IA 4O17A 3O1NA 1T99A 3G0UA 3TJLA 4UTUA 4MLJA 3BLFA 2JGQA 3DZ1A 3M1ZA 2E77A 2QUUA 4O1CA 3STGA 4MFDA 4M5PA 5K9DA 3W1XA 3UPWA 1TRIA 3PY2A 5MHBA 4LRTA 2NXGA 2VENA 3BGGA 3M16A 2EPHA 2C14A 3PWAA 4JXCA 3W1LA 4FO4A 5BMWA 3DFQA 5T26A 3W85A 5I3GA 3WJYA 1PCKA 1BKSA 1TJPA 3C2EA 1N8FA 1AL8A 5EL1A 2YPIA 1PS9A 1OX4B 3G24A 4FEZA 2Q3RA 3GAKA 3EKZA 4RLIA 3N73A 1D3GA 1E51A 4UFIA 1LDCA 2X16A 4O0KA 1QPOA 4Q33A 3ZFHA 4JTIA 1EPXA 2JKAA 1AW1A 4FNQA 2XN1A 3HGRA 1TPEA 4MY8A 5CPMA 4IMEA 4GC4A 1SZGA 2VFGA 4RX0A 2G95A 3HBLA 2BLEA 1XC4A 1QNVA 3QEZA 4O1DA 3V1PA 2JKPA 1VJIA 4LVBA 4O54A 2V9DA 4TMBA 1HL2A 2WNZA 5DLCA 4MJMA 1FUYA 4HIBA 2DZWA 1JVNA 3HG5A 2YW3A 4HHPA 4K8HA 3EWYA 3W7JA 4A2SA 2GQ8A 2A0NA 3C0JA 2C0AA 2P0OA 4YL2A 4AEOA 4CCCA 3UWVA 3IVTA 3LBCA 1QOPA 4HNUA 2Y7GA 4OT7A 4MUZA 4ORMA 5U7SA 1UCWA 1W5NA 5D30A 3QMTA 1VCVA 1PE1A 2Z1BA 2QR6A 1A5BA 4AWSA 2YSWA 5FI8A 1WQ5A 4NJKA 2X30A 2Z6JA 3S8HA 4PCFA 3QMSA 4FX6M 1XBYA 5G2WA 1OFQA 2B7NA 1F6PA 3SSJA 1JCJA 1MEWA 4O1AA 3UWYA 4JIPA 2V2DA 1WXJA 5G2IA 1LYXA 3C2FA 4LVAA 2CZ5A 1GQNA 1JRCA 4LT9A 3HGSA 3W7EA 3SGUA 1P1XA 1NEYA 3PSVA 3DXIA 3G8EA 4NVTA 4ML9A 3W1RA 5K9XA 3HG2A 1DQXA 3W75A 4OHQA 4IX2A 4NZJA 3T44A 1H7XA 1VHNA 3R8RA 1XBXA 5D02A 2WOQA 3GR8A 2CLFA 3DI0A 3W71A 2NWRA 3FEMA 4I7WA 4MFEA 1IF2A 4RKAA 1YADA 3OHIA 1FCUA 2A7PA 2ALDA 2QEZA 1TPDA 2VFDA 2Z0IA 4E2BA 2WSYA 1H7PA 2YFNA 5FEPA 1VCGA 3S42A 4O11A 5BOOA 1FCVA 1F6KA 4LVFA 3INPA 1S5VA 1KFCA 4W9TA 3HG4A 4YWIA 4BK9A 1H5YA 3I65A 1V7YA 3NQEA 2ABAA 1P5BA 3LB0A 4XWUA 3L68A 3NL3A 4A29A 3PF3A 4JDBA 3UY8A 1VH7A 4O19A 2UV8G 3ATYA 1TIMA 3LXAA 1KM2A 4J9JA 2E6YA 4JEQA 3ZWTA 2C6QA 3HPSA 2CLLA 3LRLA 1SSGA 2JK2A 4MLRA 1K7XA 3JRKA 3MO7A 4L4MA 5HJLA 1A50A 4UTIA 1MO0A 1O95A 1LRTA 1UBSA 4WQ6A 3TQ0A 3R2GA 3F4NA 4FNTA 3B0PA 3OA3A 5G1YA 4LWWA 4TR9A 3C2OA 3KAOA 1TREA 1EB3A 4JS3A 2GOUA 4UMBA 3TW7A 4GJ1A 3NPVA 4YMZA 1VRDA 5F4XA 1NSJA 5KITA 3B0VC 1DKWA 2H8XA 3EXSA 1F73A 5J5RA 2FB2A 4DF2A 2RH9A 3LV5A 3G22A 3I7RA 2J27A 2Q3OA 4ZZ9A 3R13A 2CU0A 2G5WA 1HO4A 4DEFA 4UUIA 1OK4A 4KWWA 1VLIA 5AYXA 3NOEA 4O53A 1GTEA 1GYLA 3W87A 4P61A 2ISWA 3LXCA 1P4CA 2A85A 1XM3A 2ZCGA 4Z1DA 3S1XA 2EGZA 4OV4A 2QUVA 1H62A 3O6CA 4WXYA 2PCQA 4XQ6A 3GKAA 1KTCA 3W22A 1LRNA 2B4GA 2YXGA 4Z0SA 3UWUA 1OX4A 2PRMA 3O63A 4UXDA 3C6CA 2VEPA 3S0CA 4UTTC 4MY9A 2J9YA 4N02A 4QM1A 5LZLA 1J4EA 1VGAA 3ANYA 2C1HA 4E38A 3NQFA 2W79A 3ZS4A 3N34A 3TV8A 1TO3A 2CLKA 2NV2A 4Z1AA 4KFPA 4JIQA 1SPQA 4WX2A 3TR2A 3W23A 3UPBA 3NO5A 4M6PA 2E6DA 2YX0A 3C61A 1IXQA 3I7SA 1B3OA 2ZRZA 3LCGA 3SW6A 5LKYA 1SW0A 4FXSA 1X1ZA 4FF7A 2NX3A 5CSSA 1G7VA 1GOXA 3NQMA 4OBTA 4HNVA 1W8SA 4AHOA 3G8RA 1OX6A 5F4SA 2H3DA 4LC8A 5D37A 1M6JA 2P10A 1ONRA 5D09A 1U5JA 3LCLA 3W73A 4OV9A 1N7KA 3CB8A 3S1UA 4NJIA 4O8RA 3C4UA 3W7OA 1SZNA 2HMCA 4MKNA 3FS2A 4UTKA 1TQXA 1ME8A 2O7SA 1Q45A 1TPUA 4IWWA 4XZ9A 3W7IA 1TPB1 1LBLA 2C19A 3LHYA 4E0CA 4NXSA 3PVFA 2GJLA 3E0IA 3P8IA 2FFCA 4S2CA 3TQVA 4CNOA 4PTNA 5G4WA 1VZWA 2E1DA 3TSMA 5FF0A 2OX1A 1QPQA 4NXKA 3MW7A 3GK0A 4K36A 1L6YA 3C52A 1EP3A 1W0MA 4O4VA 2CFFA 1W3NA 1GTHA 1FWWA 3T4CA 5I3HA 4X3ZA 1KM0A 3A9IA 3NPUA 2G96A 3W70A 2PRLA 5EA9A 3W7PA 1G4PA 2QCFA 3KVLA 1EWDA 3RU6A 3PBUA 1JULA 3BG9A 5KZEA 3W1PA 1M7PA 2VXNA 5KZDA 1YYAA 1I4NA 3LGEA 4U4MA 5DBTA 3LERA 3PR2A 2QCEA 2YZRA 3W6YA 5DCBA 3NL5A 3M5XA 4Y9AA 3GR7A 3TXVA 5DXYA 4ONVA 4IGHA 5AFDA 1WYIA 3O07A 3PUDA 5DELA 2QJIA 3HMJG 5HWMA 3DU0A 3GDRA 5C6MA 3NQ8A 4JD4A 2B0MA 3W7DA 1UUMA 3MJYA 4H4IA 4Q4KA 1EX5A 2A7NA 4IPIA 3UXDA 2NLIA 3B06A 3ABSA 2IQTA 1RQEA 4G1KA 4NT0A 1TV5A 2YR1A 4IOTA 4EF8A 1YLVA 4A21A 1DOSA 1IXPA 4O0ZA 1TJRA 4AWTA 1TTQA 3LBMA 1O4UA 3HG3A 4POCA 3IEBA 3TKFA 1FWRA 5HMSA 3ZWSA 1DJQA 3GKFA 5KZMA 1F74A 1XDLA 4OE7A 3CC1A 2F84A 4ZQMA
chains in the Genus database with same CATH superfamily
4HD5A 4QGCA 2HJPA 3W83A 3ARWA 1KFJA 3LCWA 2YZ5A 4AMCA 4IIFA 1UD4A 1ZENA 1L9WA 3GH4A 1HJSA 3EDKA 4QTGA 1F7BA 2CNCA 3WKZA 4RR4A 3HTWA 2VVSA 1E9IA 2HE5A 4E2VA 4IIBA 4MNKA 4L64A 3MP3A 1PX4A 1A5MC 4QCEA 2IMRA 1NDWA 1OZQA 3KBSA 3KLLA 1EJTC 4QFUA 4CN6A 3EWWA 2VC6A 1BG4A 5C5YA 4AVNA 2BX7A 1BFNA 1M65A 2E9LA 1MFVA 1BXBA 4QROA 5KMYA 2XYLA 3TUUA 3IIVA 1JFHA 4M8UA 3TJIA 3EWXA 3ZSTA 3G1XA 2VZUA 3PTKA 2VFEA 1UHVA 3T2QA 4AZCB 2WNNA 1PZ1A 4NJHA 4CNNA 1IWAA 3TIMA 3CLWA 3NTYA 4GWEA 4Z1CA 4QS6A 2BXYA 4DUXA 4XO6A 2X05A 1PIGA 1EIXA 3H55A 3FA5A 3L2IA 1O60A 4A6GA 2UY3A 4XD3A 4XKMA 1I1XA 1UMLA 2EJ1A 1SR9A 5J04A 1V3LA 1NFBA 5C8BB 1ZB5A 3UNTA 5DMLA 4IG2B 5H8MA 4EK7A 4AG0A 1O94A 3L12A 2Z2UA 1EIBA 3KE0A 3UR7A 3F1QA 1ZLPA 4NAEA 4XUGA 3BGAA 3TN5A 5EB8A 4OWGA 4S3DA 1KFLA 4J40A 1EP2A 1W2VA 1ZHAA 3WD4A 4LPCA 3RUBL 4J4KA 2O92A 1Q63A 1BWKA 3WX7A 2PDLA 4QNEA 3G1YA 4X0VA 1OF8A 1ONXA 4O28A 1J0KA 2YLLA 3HGJA 1DXEA 3WLOA 1UC4A 4U3CA 4DY1A 4NUWA 2YBUA 4IUOA 3EDFA 3DDMA 4MM1A 2Z1VA 1YXDA 1XD0A 4DBSA 1U33A 1PTDA 3F5KA 4GIYA 1R3SA 4PSPA 1EYWA 5I3FA 1QWGA 1MRQA 1L8PA 5C70A 2BZNA 4R7OA 1TSIA 2VTFA 2PB1A 4JKMA 4JHZA 3MCMA 3YPIA 1CWYA 3W37A 2D3NA 1RHCA 3TONA 1I1WA 3T07A 2PRHA 1PHQA 4HP5A 1K1DA 3N9KA 3WQWA 3FXYA 1T40A 2BBFA 5LNRA 4PTXA 2V38A 4ZTXA 1ZAHA 2GPTA 4ENLA 4N0RA 3LTSA 3ITVA 3DFNA 1ZY9A 4N7QA 3LCIA 1GEQA 4K7YA 2J74A 3QY7A 5E0KA 3VO0A 5FL0A 3J7HA 2PTDA 2ZZ3A 3BLIA 4WR3A 4NNAA 1QOQA 1XYAA 1B5TA 3TK7A 5LA2A 3UESA 5HPOA 1GVFA 3E2QA 1R46A 3A13A 4CQCA 3URAA 3RLHA 4LUTA 4JL1A 5J5DA 2MNRA 3BZGA 1I6NA 2AOSA 4AMAA 1SW7A 1ODUA 4IMDA 1UUOA 3MUXA 3NR0A 4PMXA 1QASA 3M47A 3VZYA 3MBFA 3SIMA 4QJ3B 2XN2A 4UMAA 4G5DA 1CLXA 3KHJA 2WBGA 1Z89A 4K2SA 5DQPA 4IZGA 4MWAD 2EG8A 1ZJAA 2UBPC 4FZIA 3TMLA 3R58A 4YYCA 1YPIA 3LCFA 2PD9A 1ZUAX 4IMAA 1TWSA 3G2GA 3VUSA 1XUZA 4I9JA 2WSKA 3CTTA 1U1HA 3UZWA 1W31A 1V93A 1TQJA 1Q6LA 3P8JA 5D9NA 2PF8A 2PC4A 3L4YA 3NSMA 1REQB 2HISA 1PUDA 1FHVA 5CLTA 1YTDA 2PP1A 4OBRA 2PWEA 5KSWA 1B54A 2D23A 4LBUA 3SSZA 4B5SA 4HVXA 4QSFA 3QV8A 2WKJA 3JR2A 4H2CA 2CWXA 4PA8A 1H7WA 1XCWA 1WAWA 1XLMA 1QR7A 4QCFA 1UKOA 2Y70A 1CXHA 1IXOA 3HFTA 3AFBA 3M07A 4K8EA 1RJPA 1ZCOA 3A4XA 1BYBA 3GUGA 3EX2A 3PB2A 5FIPA 2NZLA 4CU7A 2D73A 3NXFA 4JHOA 1OGBA 3NGJA 2ZX9A 3N2XA 4LNYA 1R3RA 3RX4A 3BCFA 4MGGA 1ZJHA 3BSHA 2FLIA 4AYSA 1UH3A 3CZKA 1OFBA 3PZTA 4QITA 1RBAA 3BURA 5A6TC 5C0QA 2YL8A 2HCVA 3IJDA 2E5BA 5CPOA 1XDJA 5F1VA 2I17A 1XLHA 1TUFA 2ZWZA 2YGYA 5HK4A 4N9DA 3PZOA 3BQ6A 6TAAA 4FX7A 2PAJA 3ZMRA 3KL3A 3AIRA 1EBHA 3G1HA 3GC2A 1Z41A 4AB4A 4XVEA 4FK9A 4F48A 2ZZ2A 5K9CA 4AUBA 1MUWA 3MYPA 4C6DA 3LM7A 4ADTA 3PM6A 2CERA 1K8XA 2J6XA 2VZOA 5D32A 3TYBA 1EYEA 1VIZA 1Q7MA 3ATZA 1LL7A 2I5GA 4GUHA 3S5SA 1GJUA 1GHSA 2ZTJA 4FIQA 5ABTA 3ABRA 4IPPA 1J10A 4TO8A 3SN1A 4IL2A 2XIBA 4JTKA 3BV4A 3GO2A 3MY9A 3O6DA 4LS2A 4LS1A 2J4GA 1YPXA 4AY7A 5I06A 4HOWA 4DUOA 3M0KA 1IIGA 1A5SA 2P88A 4MTVA 4DI8A 4NX0A 4B3KA 1OSEA 3MUIA 1Q7QA 1HIZA 2ZUNA 3PZMA 2YFOA 1SR0A 4L5ZA 1MI3A 2ZXAA 1AZ1A 1MVYA 1I2NA 1UD6A 5C54A 5HQMA 3DFPA 2XUCA 5I02A 1R9XA 4FR6A 2ZZ6A 3LTPA 1KGXA 2R8WA 3MANA 1TB3A 4C1NB 1WBJA 4YXGA 2E1WA 1W1YA 3ARRA 5HMEA 3W0KA 3PBYA 4GZ7A 1W17A 4NZ1A 4FLSA 4RE2A 1LUCA 3TC3A 3ZQ9A 4PRWA 3EXRA 4WIWA 5AHNA 1JCXA 1TRDA 4NYUA 4UC5A 1TA3A 4ACZA 1LBMA 3U0HA 2FMOA 4FSAA 2E40A 3K2GA 7TIMA 3LZ5A 3M9YA 2QYGA 4P7OA 1SO5A 4AXKA 2Y8VA 4ZR8A 1ZBVA 1B57A 1MNZA 1LWHA 5D2TA 4NYYA 5CZTA 4ERGA 2D2JA 3NZPA 1SM9A 4W8BA 4JICA 5EMUA 1UWIA 5BNKA 4P7RA 4OBSA 1E6NA 2VR2A 4B2DD 3WIJA 3HV8A 4JN7A 5AHFA 2VX5A 4WJEA 1HVQA 1U1UA 4BHYA 3L9CA 5BRPA 2TMDA 1DE5A 2ESCA 1W37A 3QXBA 2NQ5A 1GUVA 1K02A 1XRTA 4K6AA 4L7ZA 4TTGA 1SJBA 4LS0A 3T8LA 1O7AA 3GXMA 3AJXA 2B7PA 2QLYA 3MSGA 3UWZA 5D2XA 4QG8A 4PMZA 4HK5A 2J7DA 3S6OA 2PD5A 5G1TA 4UBPC 3JW7A 3E0FA 2RDUA 4S38A 1MXGA 4WY0A 1LLWA 1F8MA 3WBAA 4KWOA 2Z29A 3WUEA 2FVMA 3EWBX 4LUYA 3MVIA 2NSXA 1BRLA 4X0NA 1IIHA 5L6UA 4GO9A 3T1GA 3RPTA 1S5MA 4MWAC 1ZS2A 3BTNA 1UD8A 3K13A 4KCTA 3SCPA 2OCZA 1XCXA 3ECQA 3W2KA 3OVGA 1JCMP 1L2QA 4PULA 5TQLA 3ZJ6A 4UNIA 1G01A 2RJGA 2DVTA 3NCOA 4JX5A 1WDWA 2NX9A 1LTDA 2OT1A 3AIVA 4YCOA 4IFKA 4O16A 3U2OA 2CLMA 1M01A 3SM0A 3RRXA 4WRHA 3N3TA 2OZTA 3GTNA 4GUIA 3O2LA 3R1ZA 3CB3A 1ZAJA 3LOTA 1ADDA 3PWIA 1WDDA 3RITA 3FA4A 1C8QA 1VEOA 2EKCA 4LQ1A 1KC7A 4QDWA 4M24A 2C1GA 3XIMA 5LHEA 3VM7A 1OYBA 1V6VA 1XGDA 2XIJA 4LF1A 4DF1A 3LGDA 3RR4A 1QBAA 3VD4A 4Q8MA 1KBBA 2H90A 4B90A 3ABQA 2VOTA 2ZXDA 5LA1A 4WKHA 3KOWA 2Z24A 1ZCCA 4GUJA 3KOFA 1LORA 3DENA 1Q6DA 4S2BA 6A3HA 4GOAA 4Q7IA 4OOUA 4B3LA 3V5CA 4ZQCA 1WDRA 4R53A 2Z1KA 3GM8A 4QJ4B 1KXVA 2Y89A 1ML1A 2QCLA 4QEHA 2A79A 4IMFA 1ZL1A 3IVSA 2QVNA 3QW4B 3NM1A 1BD0A 3TXZA 8A3HA 1K9EA 4C6EA 3VGFA 5IFTA 1FDJA 3FX4A 1GYNA 3AYRA 5EFDA 3FHQA 5LNWA 4DXXA 1B90A 1U2YA 2ACRA 5HNUA 1YXYA 3VDGA 4GVIA 2HBVA 1JEZA 3PBWA 1ICQA 1ALDA 2FGLA 3CUFA 5K2ZA 3REQB 3RPMA 3W7CA 4HJWA 3WH7A 2J7GA 4UQEA 4KF1A 3A5FA 2G0WA 4TV6A 5LIUX 3UCQA 5KINA 1GG0A 3MSDA 3SCVA 2E9BA 3ERPA 1H0GA 3ALGA 3P60A 1KGUA 4MG4A 2PZ0A 2GOKA 3MMUA 3MS8A 2WHJA 4XV0A 4RNFA 4G7FA 4JTQA 3B05A 2R1LA 4ASTA 2AQVA 5HAOA 3SJNA 4DRSA 4HK7A 4Y9PA 4N2YA 2DV0A 3LD5A 1QOXA 4MZYA 4CQ8A 4PL2A 6ALDA 3LI0A 3N4EA 1HO1A 4Q32A 1GEHA 2ADAA 4MY1A 1GVYA 4JFWA 4N4QA 2EHHA 1R3YA 4LAOA 2ZICA 3ITGA 3RO8A 3CV7A 3H54A 3NL2A 3BW4A 1Q8AA 1GOWA 3XINA 1EEXA 3GXPA 4FP1A 2OVLA 3NPXA 3IJ6A 5HUPA 4ZCWA 2QPXA 1H1NA 1PIFA 1QPRA 3WEOA 2JF6A 3PPCA 4JYEA 1W5PA 4Y8FA 3R0DA 5AKQA 2P1FA 3NQ6A 3E6EA 2VFHA 1THFD 3I3BA 4FOKA 4X22A 5I5RA 1ZTVA 1GZ1A 4U5IA 4KESA 1KCLA 4AD4A 1RR2A 5C7HA 3OHMB 2OZ8A 2QJGA 3W86A 1DV7A 1HP5A 2TPSA 4WOZA 3Q58A 1H49A 5AB3A 4JNMA 2EKGA 1K3UA 3STPA 1W3TA 4UWMA 2MANA 4NQ1A 4PCNA 3SQMA 3GC4A 4S3BA 2ZRXA 4JR5A 3CS2A 5A6BD 4BWLC 4LBRA 5E0FA 4P7NA 1LG2A 2EXOA 1UG6A 2TYSA 3NQ2A 1OBAA 2DW7A 1S46A 1XISA 2VUNA 3N18A 1DBTA 3THQA 2OKOA 3C2YA 2QCNA 1ZP4A 1A80A 3RX2A 2ISVA 1NDVA 1XSJA 3MKVA 2NWSA 1C91A 1A47A 4B5XA 4J3TA 1GQKA 4KH2A 1Q13A 2FZMA 3BOFA 4IXXA 2GJXA 3DGRA 4XBJA 3EXTA 1E6ZA 1C8YA 1PEZA 2BNJA 1FWBC 1T5AA 4HNNA 3TSDA 3JVAA 3DKJA 1BF2A 4CNPA 1NVMA 1NAL1 4PTDA 2FJKA 1VEPA 3MHUA 3DECA 4GI9A 2I9EA 4HMDA 1MRAA 1WOAA 3W1TA 2QDEA 1TWZA 1BAGA 1NQ6A 2CBUA 2EAWA 3OBAA 4OTKA 3SZ8A 2DJXA 3RG6A 3W7RA 1Q6GA 3AZSA 4KERA 5ABGA 3KP1A 5ABFB 4PTWA 4CUCA 1XIDA 4M56A 1V6YA 3DFOA 4OFCA 4N9EA 4O15A 4DJDA 2FPYA 1JI1A 4J3SA 3PC0A 3ISIX 2A6NA 8RUCA 1XXXA 1XKJA 3IIXA 2ATSA 1KKOA 2VNCA 1I2QA 2OWWA 2YDRA 3O6YX 2Q8XA 3EA2A 4K3ZA 4XZMX 1AG1O 1MZHA 2JEQA 4JTEA 1IT7A 5HUOA 3VE7A 3FXGA 1WZMA 2O7QA 1KFEA 1V02E 2V30A 3DN5A 1XDMA 4JFUA 1VBHA 2EPOA 1E9YB 2Y5EA 2VFIA 5CBIA 2DZXA 2NUXA 3NSNA 4EE9A 3AHXA 1E0VA 1IR1A 2W62A 2V2HA 4C1KA 5AHLA 1G6CA 3T40A 5CPQA 1E0TA 5DCEA 1SO3A 1CLKA 1SFLA 3NQGA 4C6QA 3UG8A 1XF0A 4KEUA 2D24A 4AZ5A 5A6AA 1ZALA 2WCGA 1EUNA 3WZ0E 1JCTA 1LOLA 1GW9A 2O4QA 2P3ZA 2EF9A 2P0IA 3O8AA 2JIWA 2WZHA 4TX8A 3AMLA 4DNMA 3GNDA 4CN1A 3VE9A 5CSRA 5IHRA 4JFVA 5I23A 1MUMA 1OC6A 2YL5A 1CGXA 3TC7A 5K4XA 3TU9A 4O52A 2BWGA 1QI2A 2PDQA 1OK6A 4C6IA 1A5CA 4WD0A 3VMPA 3D5HA 2EPMX 3S2LA 5A2BA 4US5D 3QV6A 1EOKA 1OHLA 1P0KA 4XO7A 2ZUMA 2OYLA 3O7UA 2DW6A 4JTDA 4MNMA 4W86A 4FF5A 1QW7A 4ZO6A 2FTYA 3L5MA 4FPSA 3TEVA 2Z4GA 3S9YA 2X7WA 4ZXLA 1KFKA 3L4XA 3TDFA 5FJTA 2PP0A 5D4YA 5DANA 1ZP3A 2EBNA 3WH6A 4ATWA 2ZX7A 5SWUA 2QQ6A 4F2TA 1YTEA 4H8VA 5XIMA 1VEMA 4YTQA 1WZLA 2VRJA 4LVDA 1POKA 3W53A 4KFOA 4AHQA 1OFAA 3UXLA 4O1BA 4JHMA 4XSMA 4U5KA 3PANA 3A4AA 1PO9A 4XZIA 1LOSA 3KLKA 2DORA 4MNJA 1QFEA 4AYGA 5F4WA 1LRQA 1ME7A 5F2MA 4PE8A 4B4FA 1XPGA 3WLIA 3N2BA 1H1ZA 3BGJA 9XIAA 4NY2A 1BPLB 4IQLA 4XZNX 4C6PA 3EWUA 1JGIA 1GPWA 1CCWB 1V77A 1G5AA 3G0XA 1CI1A 1XLFA 3GG0A 3E96A 3BMVA 3Q65A 3HMCA 1R38A 2RDTA 5HJXA 1OF6A 4H83A 2V5CA 1AK5A 4LV9A 2FMNA 4JTTA 5CGMA 1UBPC 3E12A 2GQ9A 4N9CA 5A8NA 1EX1A 1KTBA 4QBXA 1K7FA 3FJ6A 2R1NA 4G9PA 3TTEA 3SGGA 3VIOA 1HX0A 2ZOXA 2Z27A 4UQDA 4AVFA 1W1TA 4O8AA 4XZLX 3UEQA 3TJLA 4DJED 4UTUA 4MLJA 2E0PA 3OZOA 3V4BA 2JGQA 3R6IA 7REQB 5RUBA 2QPSA 3CQJA 3H22A 5K9DA 3AS0A 5HOSA 3SUWA 3UPWA 3OZMA 2POZA 4LRTA 2AL2B 4Y7EA 4MNLA 2VENA 3T0AA 3U2ZA 2PDKA 3NIYA 3GR4A 1DJHA 5I77A 3WQDA 3ZJ8A 5I3GA 3VU2A 3WJYA 1CTNA 1BKSA 3JUGA 1YE6A 3C2EA 1FFRA 3VNZA 3T08A 3IJ8A 1IEVA 1VD6A 1UP0A 2DIKA 2XG9A 3FY1A 4GCXA 3EKZA 2V5JA 4RNJA 1D3GA 1OQFA 4H9ZA 4UFIA 2XWEA 1EJXC 1QPOA 3K8MA 3WBWA 1VENA 4JTIA 1EJWC 1OADA 1CB7B 4ZOEA 2X42A 3WBEA 5CPMA 5CH9A 2RGMA 1SZGA 1S1PA 3SUVA 2DZAA 2QMJA 3HBLA 3CQHA 1VBGA 1MW3A 1GGOA 1FWDC 1O68A 2JKPA 2XGIA 1VJIA 2W9MA 2WVVB 1AH0A 1JDAA 5DFAA 2DZWA 4K8HA 5A6KA 1R86A 4V1XA 4A2SA 1YNQA 5HPCA 4AEOA 3IVTA 2VO5A 3QGVA 4OT7A 1F9CA 4ORMA 5U7SA 4EP8C 3ARTA 3QTGA 1L0PA 3T81A 1A5BA 2EG7A 2WMHA 5FI8A 4CEXC 4NJKA 1UKTA 1XYFA 3S8HA 2PU1A 2P5NA 1XBYA 1KR1A 1F6PA 1MEWA 1A5UA 1XIFA 2V2DA 1WXJA 2WANA 4DO7A 1LYXA 4PBEA 1GQNA 3W7EA 2W61A 2NT1A 1P1XA 4GGHA 4U2ZA 3GHTA 4ML9A 1HKMA 4DWSB 3ZVHA 3S2JA 2WOQA 3GR8A 1RH9A 1OD0A 1E1FA 2PEVA 1ISXA 3LEPA 3TZNA 1JAEA 1A0EA 4PMNA 3B4YA 3UW6A 1YADA 2ALDA 1TWDA 3TTQA 4E2BA 3WDHA 1DQUA 2YFNA 2VRQA 3RM4A 4O11A 3T42A 5BOOA 1FCVA 1OT1A 4UOJA 3I6TA 3JZUA 4W88A 3INPA 1JZ2A 1S5VA 3NQEA 2ABAA 4D6JA 1OM0A 2CBJA 3AHYA 2EG6A 3L68A 2CYGA 4QR6A 3UY8A 5C9XA 2UV8G 1I0DA 3Q4DA 3BLLA 2P53A 4W7VA 2JQXA 4BEQA 2C6QA 1XLBA 1KBKA 3AI0A 1LWJA 2JK2A 3PJUA 3MO7A 4C7GA 4IIEA 4LGXA 3FGCA 2BS9A 2VWSA 4D8LA 1KQZA 4XIMA 2AAAA 2PTXA 3UXKA 4GMEA 2PDIA 4LWWA 2QUNA 3C2OA 1EB3A 2GOUA 1QNRA 4YVXA 1VRDA 5GQBA 5KITA 4L9XA 3NO3A 3WQ4A 1F73A 4AWEA 2FB2A 4FLRA 4GX8A 4HHMA 4XK2A 3I7RA 1E5NA 2Q3OA 8CGTA 4ZZ9A 1UWUA 2CU0A 1T8QA 1XICA 1EPVA 2HVMA 4ZO8A 1HGWA 2Y1HA 3LXCA 1P4CA 4YTTA 4ATDA 4WXYA 1W32A 1KTCA 3W22A 3F5JA 3QBUA 3P14A 3OLEA 4Z0SA 3MUCA 3VIGA 1A0CA 4AVOA 3EGJA 1J18A 2BOGX 4UTTC 3VOJA 4DJFD 4MY9A 1D8CA 3QC0A 1DWHM 1J4EA 4QM1A 4AC1X 3ZS4A 3AAMA 3TV8A 4GKTA 4Z1AA 4KWUA 4DJEC 1SPQA 4IIGA 4RZBA 4NAEB 1IXQA 2VRKA 1CNVA 4UCFA 1B3OA 3BAKA 1O12A 1UR3M 4J3ZA 5A8MA 1SW0A 4FXSA 4HK6A 4FF7A 5I79A 5CSSA 2PF0A 4BCEA 4Z2IA 4HNVA 2OSWA 4WGXA 4LC8A 3POHA 1M6JA 4IGSA 3DYMA 1AJ2A 1JPDX 1H09A 4NJIA 3C4UA 1SZNA 2O4MA 2QIIA 4MKNA 3FS2A 4LAKA 4IWWA 4XZ9A 1J0ZA 1TPB1 3UFYA 4OVXA 3VIHA 1RP9A 5FAGA 3W38A 4W87A 3WLQA 1GCYA 3TTOA 2E1DA 1YQ2A 2FDMA 1QPQA 1XV8A 4K36A 1L6YA 1W0MA 1GOKA 3AJ7A 1J5SA 1GTHA 1LL6A 1WCGA 4KS0A 1T6MA 4W5UA 1FWWA 4Q22A 1KM0A 1LQ0A 2GZXA 3H8AA 2PRLA 5EA9A 3T2PA 3AXHA 2QCFA 4GI4A 4M80A 4W84A 1EWDA 3RU6A 1DYSA 4LBSA 4NIRA 2POTA 4AY8A 1QATA 1I4NA 3MCOA 3R0UA 2PDJA 6XIAA 3R10A 3W6YA 1S2WA 4Y9AA 1PYMA 1D7FA 5DXYA 5CSYA 5FJIA 3MUZ1 4IGHA 1WYIA 3AC0A 3HMJG 1KKRA 5HWMA 1B0IA 3C0LA 2XWDA 4MMWA 2GSHA 3W7DA 7CGTA 5AY7A 3WD1A 3FV9A 1XGEA 1XJBA 2A7NA 3B06A 4NT0A 3QGAC 3BCDA 4EXQA 1YLVA 1JPHA 3ONCA 1DJXA 1W9PA 1TTQA 4UTFA 5IOBA 1E1CB 4POCA 3TKFA 2GGIA 5HMSA 3ZWSA 2PDMA 1CENA 3AHZA 3XISA 3R7MA 3RCYA 1F74A 1A3WA 4GH3A 1QI4A 4LUTB 4DWSD 5IM51 2LLEA 1K4HA 2F38A 4KWVA 2J66A 3FAXA 3PUGA 2ZDSA 3CV2A 5LNUA 4QP0A 3VIPA 1H7OA 2JF7A 3TAKA 1MEIA 4V28A 4GVHA 1ZGDA 3AS2A 3BE7A 2O9PA 4EWJA 3WLLA 1Q8JA 1X6UA 4HQVA 2QV4A 3GY1A 3OVQA 4W7WA 3O16A 1J96A 1W54A 2GYIA 4LYKA 2V82A 2BXZA 4JTHA 2ZX6A 4WZHA 3CZ8A 3SECA 2BOEX 4C7FA 4L56A 2J88A 3VD7A 1ZFJA 1DQWA 1KO0A 1LBFA 1TPWA 8XIAA 3U4AA 3FSUA 3GX9A 4H8HA 2RGLA 1UKSA 1UD5A 5C7VA 2QCHA 2ZA2A 3UYCA 2WZTA 2O9TA 1R2TA 5BRQA 3HA1A 1ZJBA 3HQNA 1AA1B 1LCOA 3SCRA 1P0NA 4IHCA 1AQMA 1BVWA 2G41A 1UKQA 4MADA 1IQ8A 4MUPA 1WAUA 3BG5A 1QCWA 4MYXA 1EDGA 4KEMA 4ZOAA 5AC8A 1W1IE 1PKLA 1PBGA 4UR8A 1TCMA 1E6QM 2OU4A 2YA0A 1X8FA 5XINA 5GJPA 1RLCL 5FKYA 4QAIA 3A23A 4XAPA 4Z2JA 3NEVA 1DWFM 1RLDA 4CD4A 2YCEA 5FF7A 5D03A 2RJHA 2QULA 4LJ3A 4Y9OA 4DHGA 2NSOA 4MB4A 2PGFA 3MVTA 1UD2A 3GXTA 5KETA 4U2YA 4R7JA 3WUBA 1FXQA 3CUJA 2HBXA 5FJUA 3ZR4A 3AHVA 2ATMA 1MEHA 1UC5A 1SU5A 3JS3A 1R0MA 3VZXA 3ZSSA 2VD8A 1KR0A 1T0OA 3CZJA 3G1FA 4GNJA 3TW9A 3DOPA 4R7WA 1KCXA 1EL3A 3WLNA 3CAWA 1EHNA 1JYWA 1PKMA 1TWWA 4A8IA 3EA3A 2Y62A 2KAUC 2E5CA 3RK8A 1M9HA 4L4OA 1GHRA 3ZLFA 4LSBA 4WDUA 1VP5A 3R12A 4AIOA 4H9MA 4S3KA 3R89A 5AYYA 4DJFC 3TTYA 3BCJA 3H2AA 2CLHA 3HB9A 3UCDA 2C18A 2XVPA 2O56A 4ZQRA 3PUOA 2ZX5A 5IXEA 3QZAA 3MP5A 1X96A 3ITTA 1SFTA 3MHGA 1OFEA 4KWSA 1J0IA 1DJZA 4IMCA 2WMJA 3PG8A 1P6WA 4FXRA 4E2OA 3EPNA 1Y5XA 4M7TA 4PTVA 1YTKA 3PN8A 4QDMA 5G4EA 2ZZ5A 3R0KA 3FYOA 1A3HA 3B97A 4GQQA 2QS8A 3IPWA 1WOBA 3NQDA 1UOKA 1I2RA 1O5XA 2A21A 3MI3A 3N2OA 3CHVA 2G3NA 4PUUA 1RY0A 3I7QA 2HS6A 1BTMA 3EWCA 3PS7A 1B3ZA 3GW0A 3L5AA 2VM8A 3W7LA 5TBOA 1B9ZA 1FWHC 4NX5A 2R91A 2IS7A 4OOZA 3NZ1A 3BPWA 1EC9A 3KEHA 2CLPA 4J2PA 1XG3A 2P3EA 2WM0A 3GFYA 1FVPA 2OGYA 4L1GA 3RM8A 1VAHA 3RFAA 3ZZ1A 4H6KA 3SEPA 5I3JA 1LUCB 2IUZA 1GVRA 1GOOA 3T6CA 4KRZA 1E6RA 1YDYA 1TYGA 4Y96A 1TA3B 4ACZB 5K3VA 5A6BA 1H60A 3RIKA 4E6MA 3USBA 2DZBA 2GUUA 5CC5A 3NAVA 1YBQA 2Q09A 3F4CA 5AHIA 4A22A 2CZFA 3GTIA 1A5LC 3TFXA 1CYGA 3WNNA 1V79A 1FA2A 3N6JA 5REQA 3GAYA 1PXGA 1Z48A 3RGTA 3N14A 4O50A 4HA1A 4BI6A 1ONEA 5CPNA 1KRCC 3LV6A 1QW9A 4HPJA 1EJVC 3LUTA 3GDTA 4LCQA 4Q4PA 3G5EA 4H9UA 3SCNA 5BRBA 5DCDA 1LM1A 3DBPA 3PBMA 1OCQA 3G1RA 3DG6A 4XZHA 4DWSC 4CCDA 1DWIM 3NQ7A 3LMYA 3SCUA 4IIHA 1BWVA 5JBFA 5I0DA 1S2UA 4UIOA 1TUXA 1IXNA 3UVIA 5I03A 3KWSA 4LY8A 4YTSA 1Q7ZA 4WY0B 4JN6A 1NF7A 2C71A 2WKLA 5KTLA 2PWVA 1MQPA 3C2RA 1TKKA 4Q8NA 2X0HA 1CGYA 1BRLB 2YDAA 1EJUC 1WBHA 1W3KA 5CG0A 4KPLA 2FKPA 1WDPA 3GIYA 3SCTA 2VGFA 1RCXB 5BYWA 1JZ5A 3VUPA 1NJJA 3W02A 4C6FA 3GH5A 4JYFA 3EKLA 4PFMA 4OUIA 3N15A 1IZCA 4RXFA 1AW2A 2NV1A 3N4AA 4IFKB 3WMLA 1UROA 4HTBA 3QM3A 4FALA 3DX5A 1M5WA 2GVGA 3QH2A 3LK6A 2PDYA 3G1AA 3ARYA 1HJQA 3NZQA 3RCMA 2XINA 1CT5A 1VFMA 1XYZA 1LT8A 4GIAA 4DPQA 5T9BG 4XAFA 1E56A 2WPGA 1UZ4A 1B3WA 3S1WA 2JALA 4EAMA 2CLEA 1A4MA 2OPJA 4ICCX 3OLGA 4QE4A 2V63A 2I57A 3N2TA 1I2OA 2AGTA 1U5HA 5TIMA 3OLIA 5IBXA 1VR6A 4WJ8A 4TTUA 1QNOA 3VD3A 4CNUA 1PZ0A 3FDKA 1K6WA 3TWBA 1UH4A 3FW6A 2DT0A 3LLDA 1JUBA 3EEGA 3R8HA 2YB1A 4V15A 4B9ZA 3NYZA 4FNRA 4WLCA 1EZWA 4AHPA 1H4PA 1JDFA 3V16A 3NOYA 4HU8A 1K4GA 5LGXA 4CKQA 4H9VA 3DFYA 4ATLA 4PYSA 4HPHA 2GL5A 1WP6A 2PGEA 2PDFA 3AZTA 2WHKA 4M81A 1HKKA 4BI7A 1LP6A 3VC5A 1OFDA 4B9YA 3M6DA 4JTLA 3AUOA 2BY1A 3WH8A 2CKSA 3FYYA 3D3FA 1TPFA 5D9MA 2CHOA 4DO6A 1CGWA 3CIXA 3U7VA 4E8GA 4O18A 2OGJA 1E72M 2BVWA 3HU7A 2Y61A 1PAMA 3AZRA 4M3PA 3RF9A 3HJEA 4WXZA 3L4TA 3EKGA 3H2MA 4O1EA 5F1UA 2OQLA 3HZ3A 4IP4A 2J9XA 4JNYA 5HNRA 4GKLA 1J2BA 4G7EA 1VFOA 2PLKA 3M7SA 2Z1SA 3B8UA 4JQ3A 5DBUA 5CPTA 2OOFA 2VWTA 1JZ7A 1KLYA 4H04A 4HZ6A 3OYZA 5CG7A 1V6XA 4I3GA 3ITYA 3SUTA 4K1GA 4CCEA 2OLHA 4PGLA 4ZQPA 1GG1A 3OG3A 2J9ZA 1M7XA 1DJNA 3OGSA 1JZ4A 4MVAA 2REQA 2VGBA 3CYJA 4ZTYA 1OFOA 2PTYA 3WNMA 4AISA 1W3LA 2PDHA 3E5BA 3QQ1A 3U7BA 3H4XA 1X6NA 1EJSC 1G94A 4AQLA 4G1NA 1J5TA 2QAPA 4KMQA 2FZ9A 2GDUA 2FTPA 1V6TA 2F6KA 1IWBA 3EMZA 1UH2A 4TOQA 1Q5MA 1WA3A 3EB3A 4EPBC 5FESA 1UWRA 5HWJA 1ICPA 3G3DA 2XTKA 2X1SA 4AIBA 4FXFA 2BY2A 2MUCA 2BGQA 4H2HA 3WK3A 4Z2LA 4MDOA 3RLUA 4DAFA 3S1GA 3IUHA 1ITQA 1F6YA 3UWWA 3B8IA 3OW1A 3CIVA 5CJ5A 3N04A 3W88A 5CGQA 2ABBA 1TV7A 3GLCA 4PBFA 4HU0A 3IGXA 1UIOA 3WL0A 5CC7A 5LNSA 2Z00A 5C9RA 4DN1A 5IDZA 1AQHA 2XVLA 3H2EA 1Z44A 2R82A 5DY3A 1C9DA 3MHFA 3BVJA 1FHLA 1ITUA 1SVDA 4CD8A 3VIFA 2VFFA 3V18A 3WN6A 4N6EA 4B91A 2EO7A 3UJFA 2KZHA 3BLPX 5BCAA 3S5ZA 3TH6A 1H7NA 4PMRA 2GJXB 2ZXBA 2Q8ZA 3H70A 1N2VA 3UERA 1DHKA 5H1WA 1CDGA 3B0YA 2J77A 3U6WA 3CM4A 3WF1A 3VNYA 1JXKA 4MB1A 2ZADA 3CAKA 1FCBA 4DX3A 3DCPA 2RKXA 1W1ZA 1CIUA 3AQUA 2C8NA 4C7DA 3SI9A 1EDTA 1RVGA 4TU1A 2ZVRA 1DL3A 4GABA 1J9YA 4KW2A 2GVLA 4CU6A 1EA9C 2WQDA 4NF7A 3E74A 2Y0FA 4L6HA 3UA3A 1XBVA 3GBDA 3L5LA 1WXZA 4MJ2A 1NTHA 3LX9A 1OX5A 1AJ0A 1OGSA 3PP7A 1HNYA 2Q02A 4WY0F 4HSOA 1V4YA 1WZKA 5G2HA 3MKKA 5ECVA 1UP3A 2Y4SA 3PULA 3N1AA 3OBKA 2V68A 5BXSA 2P8CA 2PWUA 3W1MA 3M46A 4ZVJA 1A4LA 2ZUTA 3KRUA 4C6CA 4DIAA 1FCQA 2CHNA 4AF0A 5A5WA 5CKSA 4KBXA 4BA0A 2YJQA 4UTWA 5CC6A 4PZVA 1XLDA 4Q8VA 2JFEX 1RUSA 1J8VA 4MSSA 2YA2A 1XSIA 3TSBA 4JKLA 1PB0A 5GNXA 1HKWA 4GRSA 5E6ZA 2VR4A 3EPMA 4V2XA 3FVMA 4WOQA 1EEPA 3ARUA 1VQTA 4IP5A 2VX4A 3PAOA 5H91A 2HRWA 3GTFA 1RPXA 1FTXA 4LU0A 3I4KA 2A3CA 3GXFA 2AKZA 2E6AA 3E0LA 3PG9A 2CLIA 4GYFA 2FH8A 3CEPA 4QE1A 3VINA 1C93A 4BY3A 3LHZA 1KTNA 3TJXA 2ZZ7A 3FYPA 4QJ1A 3VGEA 5A2CA 3ABXA 1L2UA 5A6JA 3W26A 4JIEA 3B40A 1TTPA 2OT0A 2FYMA 3QR0A 3LRMA 2V67A 2WAGA 1EC8A 1EDQA 3N2MA 1FFQA 3RYSA 4PH6A 5AC6A 3TLLA 4W8AA 4LAUA 1X6LA 3KCJA 4WVXA 5FD0A 3CXOA 4CQAA 3ICJA 3B9AA 4I5RA 3LHUA 4HHHA 3N6HA 4QISA 3AIWA 3S2CA 2DQXA 5C55A 2XISA 1C92A 3URNA 3L66A 1XLCA 3DFSA 3UVAA 2PWFA 2QJJA 3A22A 5AHMA 1V3JA 3L2LA 1VBJA 4BF7A 4GK8A 5TD4A 3UYIA 2OQHA 4IQJA 2Y7DA 3R5EA 4LNCA 4ZO9A 3CHDA 4RL3A 3VAVA 4NJJA 2ZZ1A 2AGKA 3D47A 1W9BM 1ZBCA 1QHOA 1JCNA 4J7RA 4AD1A 1JXJA 4MDPA 2BTMA 4J27A 4CQBA 1UWTA 4F8XA 3C0SA 4BR1A 2XFRA 5IHSA 2WHMA 3KVKA 1YIXA 2X8RA 1HGYA 2BFGA 5FF4A 4ZODA 3KS5A 2F9RA 4XTIA 1SMDA 2A7RA 5AC5A 4KCWA 4QG6A 4IIDA 3W74A 4U31A 3V0UA 1QHPA 3LYEA 1U30A 3QJAA 3DI1A 1TVLA 5KZ6A 2XSXA 3CL8A 4ES4A 3HURA 4MPQA 3H7RA 4V1YA 1UWSA 3DHDA 2IPJA 1VBUA 3N11A 2PDBA 5H8PA 4P8WA 1CBGA 4PMYA 1FWAC 3UGRA 2DSKA 4JAWA 5C9ZA 5BZAA 5CBJA 3RU8X 1G4SA 4XSLA 1XC6A 4D6DA 3H2OA 4EVZA 3P81A 4GO8A 3LBOA 5EPDA 2C91A 4IJBA 1UASA 2I7GA 4RE4A 1YMYA 1ESWA 3WQVA 1IGWA 1ICSA 1SW3A 4IFOA 4H41A 5HQLA 1KGWA 1W6TA 2F6XA 1J0YA 4JY8A 3RPDA 3IGSA 5A6SA 2Z28A 3DC8A 1A53A 2ZE3A 4O4WA 3F4DA 4ZOBA 3TW6A 1T7LA 3IUDA 3STFA 2GSJA 4A3YA 2PLMA 5BMXA 1XLIA 4JYDA 1UJPA 1J0HA 2Y5SA 3E3HA 4ZFMA 4CEUC 1XFCA 1ISZA 4DJDD 4BQ2A 1E3XA 1E9ZB 2Z1XA 3SY8A 2GJRA 3GU9A 1W3HA 1VF8A 3UA4A 4UFLA 1KM5A 4NILA 1HJWA 4ECLA 4NI8A 4DZ5A 4GFSA 4B92A 5FEZA 2G50A 3KRSA 3TYCA 9CGTA 3LHTA 2NQHA 2E4TA 3SRHA 1WKDA 2H3BA 3IK4A 3WQ5A 3UBPC 2FQIA 5T8GA 1B2YA 3IJIA 5JQ9A 1FQ0A 1EF3A 2WMFA 4HOZA 5AC4A 2Z2BA 1B1YA 3FA3A 2QCCA 3SGZA 2V2CA 4H6RA 2PU0A 4AWUA 2GDQA 2Y24A 1RQBA 1KA9F 3MSYA 5HA7A 3ZVHB 3LDVA 2GDVA 1SMAA 3QSRA 1E5JA 3GHRA 2X40A 2QF8A 2R94A 4K7VA 1PHWA 1XH2A 1GVOA 3LMZA 2FPTA 2WWDA 6REQA 2OMAA 3HV9A 3SRFA 2R24A 4IM4A 3IUIA 2DUXA 4E8DA 1HVXA 3S2MA 3VIJA 4RXGA 3W7QA 1IHIA 2V5DA 4FLOA 2BGNE 1QNSA 3QLLA 1JI2A 1DORA 4YYFA 4R3UA 5L9FA 1J79A 3UGVA 3MI6A 3VA8A 3CUXA 1SYTA 1M7JA 5C2CA 2WNQA 4AD3A 3MDUA 4M29A 3V7PA 1WUFA 3W07A 3IIOA 1OD8A 1PDZA 1JF6A 3GE7A 4HNOA 1S3HA 2A3LA 4O57A 1WE5A 1ISVA 1B4KA 3WCZA 5FCZA 2XH7A 4DI9A 1HT6A 1OCNA 3CZLA 4X2PA 3MP4A 3FGCB 4QQ3A 3EOEA 4GPNA 1HQTA 3BWWA 3P2VA 3QRHA 5DT5A 4GC3A 4GY0A 4I8YA 2FIQA 4WUIA 2F2KA 1F05A 3A24A 3U5YA 3M7WA 1F3WA 4GY7A 3W1UA 3OEXA 2Z6IA 1H41A 1KRMA 3O1NA 5HBFA 5I00A 1UR1A 1TE1A 1M68A 2OFJA 3E2RA 4HZ8A 2QUUA 1CGTA 1PTGA 3STGA 1Q2SA 2BB0A 3WUGA 2OODA 3U3HA 3PY2A 5MHBA 1JZ8A 3BGGA 2VL4A 3LSCA 1BGGA 4JXCA 4FO4A 1JD9A 3DFQA 2PLJA 1VRXA 1KBLA 2IKHA 1P7TA 3APYA 2CIPA 3K1GA 1TJPA 2D1ZA 3AXIA 3WNOA 1ISWA 2BVYA 2GWGA 2PWGA 3ZLGA 3GAKA 4RLIA 3VC6A 5A6LA 2X16A 3A9BA 1IEWA 4O0KA 3TYZA 3ANVA 1OT2A 4EAYA 1DP0A 5KEZA 3F2CA 3M0VA 1PTAA 2B81A 5I24A 4RX0A 2G95A 4RPPA 1QNVA 3MDWA 3QEZA 3V1PA 3L4UA 2OR2A 4PCTA 1UQZA 2V9DA 4PMDA 4TMBA 1HL2A 4MJMA 2Y5JA 5FA5A 4HIBA 4HBKA 4U33A 3GVVA 3WDIA 3IANA 4ERAA 3D6NA 3EWYA 2OX4A 4IJCA 2WK2A 1BYCA 1XRFA 5GJNA 2P0OA 3CV1A 4ML4A 3S4TA 4CCCA 3UWVA 3MU7A 4QEEA 3VNLA 3MWCA 1YE4A 1UMYA 3CHCA 3QMTA 4QX4A 3GTHA 2Z1BA 4AWSA 1WQ5A 3SCQA 2PFHA 2QZRA 1PWLA 4PCFA 3GDBA 3QMSA 3A4JA 3S3GA 3LZ3A 4RNHA 5AECA 4ZE5A 2DT2A 3GZAA 4JIPA 4W85A 5G4HC 1NDYA 3C2FA 3MV01 3HGSA 4L65A 3T05A 5JXQA 1PX3A 1WKEA 1NEYA 2WB5A 3O9NA 3S2NA 3PSVA 4NVTA 3WQGA 5K9XA 2X2YA 1DQXA 3HG2A 4IX2A 3T44A 1H7XA 1WDSA 1MDLA 3VDCA 4FS9A 4I7WA 3HQOA 4MFEA 4RKAA 3OHIA 3EWDA 4DJDC 3OP2A 2VUYA 4NAFA 1U5VA 3A3WA 4PUMA 5ABHA 4P7LA 2YDQA 2PPGA 3ALFA 1WB0A 4LVFA 4F2UA 3RAOA 5A3HA 1KFCA 4QLLA 3HG4A 3WF3A 4YWIA 1V7YA 1XR2A 4UQBA 3LB0A 1VFHA 3NL3A 4F0KA 4A8RA 3PF3A 2VX6A 1IZKA 1VH7A 3AISA 3ATYA 1KM2A 2E6YA 4JEQA 3ZWTA 1BGAA 4G2DA 3LRLA 5HJLA 2BHUA 4HGXA 4AEEA 1A50A 1MO0A 3CUHA 1LRTA 4NZCA 1JPIA 3WD3A 1DJGA 4FMVA 4OUEA 2DT3A 3F4NA 4CNTA 3BJTA 1US0A 3OA3A 4KEZA 2DVUA 3MO4A 2DFAA 2WVTA 4LFYA 3LQGA 3NO1A 3KBJA 3IAPA 4LUSA 1XYLA 5F4XA 3EPOA 1DKWA 2PP3A 4S3JA 2TODA 1W9UA 2QDDA 3EXSA 4HZ7A 4DF2A 1M41A 3MC5A 3LV5A 3MQTA 3G22A 2HK0A 4B16A 1HO4A 3OO2A 3TP4A 1OC5A 1DEDA 1OY0A 4JBRA 1OK4A 2UWFA 4XAYA 1VLIA 5AYXA 2ZUVA 3NOEA 3WEZA 1NOWA 4WEVX 4P61A 3AMCA 2A85A 1HP4A 3O3RA 4PUKA 2F61A 1NOUA 3EOSA 4Z1DA 3LNPA 1UA3A 4OV4A 1XLAA 1B3XA 3W01A 1OB0A 4H6EA 4P7QA 3ABZA 1OX4A 2RDXA 2PRMA 2DIJA 3S83A 5CEWA 4GJJA 3N29A 2J9YA 2NW0A 4E38A 2HPIA 2H9AB 3NQFA 1CGVA 1DXFA 1KXTA 4UQ9A 2W63A 1S2CA 1TO3A 4Z2GA 4KFPA 4NG3A 3TR2A 3QY6A 3UPBA 3NO5A 4M6PA 3OU8A 2E6DA 2WZIA 2YX0A 4W4QA 5HNTA 2XIMA 3I7SA 4BQ3A 2ZRZA 1LL4A 1DE6A 3WLJA 5FSDC 4EPDC 5CPSA 3BH4A 5A8OA 3KBMA 3UG4A 1GOXA 4OBTA 1W8SA 4AHOA 3G8RA 1OX6A 3W6MA 3PZQA 5F4SA 5G1MA 4E4UA 3UJ2A 1RJQA 5AVHA 2J25A 1ONRA 4XD4A 1PJ9A 1U5JA 3W73A 1N7KA 3CB8A 3RLGA 2XSAA 4O8RA 3P6LA 3T4WA 3VKDA 4RE3A 1Q45A 2NV9A 2P76A 1NU5A 1MFUA 1BTCA 4E0CA 3PFMA 4NXSA 2XU2A 3PVFA 2GJLA 1RBOB 3WEMA 3P8IA 3ZO9A 4S2CA 1S2VA 4CNOA 2Z7KA 3EOUA 1XG4A 4Q6JA 3TSMA 5M5DA 1E6PA 3C52A 1EP3A 4L4PA 3KL5A 4A4AA 2CFFA 3H4WA 3VNMA 4X3ZA 3A9IA 2XH4A 4YPJA 3W29A 3W70A 3W7PA 3KVLA 2VZVA 4GGBA 1Y5WA 1M7PA 3E38A 1AD1A 3G6LA 4U4MA 1UKPA 2HROA 3LERA 3PR2A 4TQTA 3NL5A 4ZO7A 4G8TA 2CEQA 2CCRA 1YHTA 4QLJA 3SADA 2OO0A 4ONVA 3VOCA 3BSGA 4C5ZA 3CUIA 3O07A 3BZJA 5DELA 1KQYA 3GDRA 5C6MA 2BOFX 3NQ8A 4JD4A 4YN5A 4H1ZA 2IPFA 3CMGA 1UUMA 3MJYA 4Q4KA 3W25A 4IPIA 4G1KA 1TV5A 2YR1A 4GY1A 3PZGA 4O0ZA 3SRDA 2VDGA 3P3BA 3FEQA 1V8EA 2W3ZA 1DJQA 4D71A 4PRTA 3CH0A 3B9OA 4X63A 2JBMA 2A6LA 1P0BA 4Q4OA 2Y63A 4FHAA 4GUGA 3UP8A 3SCWA 2G97A 1F3TA 3V35A 1QNQA 1ODZA 1R2RA 4HT3A 4LF2A 2PMQA 3DBNA 1ADSA 3AXMA 1L6WA 3D0CA 3QSTA 4F0RA 4DO4A 2WCAA 1JDDA 4HCLA 1R3QA 1NARA 2VZSA 3LS9A 3DHPA 1A0DA 2BGSA 1C90A 5FEXA 2XZ7A 1PZ2A 4J28A 3OJGA 2QDHA 2XZ9A 2PS2A 1YBQB 2ZQ0A 3LHWA 5DX7A 1FWNA 3G1DA 4XAZA 4CQDA 3O06A 2VEKA 2A3HA 3EBVA 1TZ7A 1Z42A 5HMDA 5REQB 3FJ4A 2GGGA 1ZQ5A 1EWEA 1UPMB 2A3EA 3F5LA 3SY1A 4D6CA 4DPPA 2BP1A 3URBA 3M0JA 4YIWA 1TCDA 2AQOA 1E4LA 4FAMA 2XFYA 2XFWA 3I68A 1RQHA 5FOOA 3RN6A 3UXIA 2J6VA 3HN3A 4GYJA 1G7UA 2OZ0A 4WDXA 5U4NA 3VX1A 3WELA 3ME3A 2OWCA 1UR2A 3M0LA 1JCLA 1GKPA 2OOGA 4LRSA 3LN3A 4JTJA 3PTMA 4JCMA 3IVUA 2HSAA 4DM1A 3VD5A 3B9DA 2QDGA 2DZUA 3P80A 4L1WA 3TVAA 5E6YA 2EQDA 3QC3A 4GQRA 1XLGA 2WMGA 3GU2A 1Q6QA 4EX4A 2CETA 3TZFA 4MJZA 2C15A 1BWLA 3CAQA 3EDJA 3W6LA 1IT0A 3S9IA 1HW6A 2B31A 3DESA 2PI6A 2HXUA 5DMYA 2V81A 2GGHA 1KRBC 1GOQA 3TMQA 3QFWA 1PZ3A 4DXVA 2PURA 4I9MA 5BXPA 4AZIA 2DZVA 1PL9A 3F4VA 3POCA 1JAKA 1ITCA 3BAJA 1QRQA 2ZYFA 1E0XA 3OIXA 3QYQA 4H8NA 4ACYA 1R87A 3AALA 9XIMA 1YKWA 1HFBA 4NHVA 3UR2A 1EXBA 1KBJA 2NVDA 4CLMA 4EKJA 4L9ZA 1H0IA 1JZ6A 4N42A 3EX3A 3VDBA 3N12A 1KW1A 3PK7A 4ZB5A 1GWJA 2W66A 3T2OA 2INFA 4NSBA 1XWYA 4OJYA 3B0UX 4QLKA 4W89A 2ONEA 3T0TA 1HXJA 1JL8A 2WJEA 3GBEA 3B03A 4XISA 3BO9A 1K7EA 3G1VA 3UZXA 4C60A 3CPGA 5AYBA 2VYOA 5EFFA 3AUJA 4BI5A 4AZBA 3ANUA 1W3IA 4YCPA 2OO6A 3A4WA 4Q8QA 3V1HA 1CZ1A 3PPFA 1H1YA 3CGTA 2H8ZA 2TSYA 1CXFA 2QUMA 2Y8UA 3GFZA 1RD5A 4K1WA 4ROPA 3PSWA 3B4UA 4XBSA 4QS5A 3QTPA 3I6RA 1KXHA 3L21A 5F2IA 4KETA 4J5NA 2A1YA 2V5BA 4AH7A 2HS8A 1QHZA 2BHYA 2CITA 4Y2WA 4C6JA 4LTSA 4M1RA 3W9ZA 3T7VA 4OECA 1RZMA 4HZMA 1C3FA 2WZMA 1TG7A 1MUCA 5AN7A 4FA3A 4NASA 4GYPA 1TV2A 1FX6A 2YDSA 5EMYA 4GD0A 1G69A 1RY8A 1SGJA 2O0TA 3EX1A 1O66A 3TCEA 1RK6A 2WQPA 3Q37A 3HQ1A 3UXAA 1K8ZA 1YXCA 4IMGA 3UD6A 3U2EA 4YHEA 1BVNP 1SZRA 1UQYA 4MJ4A 2VEIA 3QMRA 5HULA 1ZZMA 3L23A 4G7EB 4X9SA 1TJ0A 2QCDA 3V5OA 4RUBA 3V36A 4IGNA 2PBGA 4IISA 3T0CA 1RBLA 3GZ3A 4LCRA 1EC7A 2ODOA 4M6QA 1J93A 1QI5A 3OVPA 2NXHA 1XD1A 2WJZA 2PBOA 3AYSA 2J13A 3A3HA 1ADOA 2QKFA 2B7OA 1VHCA 3TQPA 2HXTA 1K8YA 3EWZA 3STCA 3FLUA 1QDSA 4H3DA 1YNYA 5LIWX 2X1TA 3N2CA 1HJUA 3BQ5A 1X1NA 4FIRA 1TR9A 2V5KA 1JNEA 1M53A 4N6FA 3K8KA 1QBBA 1IEQA 2YCIX 3BLDA 4ZB2A 1LWIA 3W76A 2W4XA 2ZA1A 2BV9A 1R8LA 1KBIA 1K70A 4UTJA 2AL2A 1UA7A 3PJXA 3NURA 1UIPA 3MBDA 2FVLA 3BOLA 3EB2A 3WQOA 3BV7A 5EKYA 5BWAA 1LF1A 1F2JA 3GYCA 1Y65A 4RDVA 2XIQA 1AW5A 1U22A 2P50A 4UNKA 5I6SA 2JEPA 4R33A 1UWQA 4ADUA 3FFSA 1XYCA 2GGJA 4JTSA 2DH3A 2VI0A 2Y7EA 4XKYA 1GJPA 4RZ6A 3KCLA 4AXNA 4TUFA 1W8GA 1MDRA 2V0TA 4E2DA 1UZHA 3Q67A 4TVCA 4M6VA 2ACUA 5GNYA 1JGMA 4AX6A 2XH2A 2QJHA 3CMFA 1TV3A 4NRSA 4US6A 2OQYA 1QWKA 1E4IA 3M44A 1NFPA 4MZ1A 1ZPTA 1OCBA 2WJFA 3C3NA 2VKZG 4GVFA 1V0KA 1OZMA 4GVGA 4KIEA 3GXNA 1OVDA 2BHZA 2PDXA 1E9LA 4HU3A 3DH7A 2PDGA 3AMGA 1F61A 1V6WA 1F5ZA 1QPKA 1ZBWA 3SUUA 2NUWA 4I6KA 3CLMA 3N19B 3V75A 3QQ0A 4Q6XA 2WMIA 2ZXQA 3LPOA 1IT8A 1SO6A 2CBIA 3P67A 5MKGA 2PDPA 3AO0A 2I56A 5JVLA 6CGTA 4A8NA 4WK9A 2IPGA 4DQWA 2A3AA 1S5TA 1IE7C 4D8AA 2VURA 4QG9A 3C8FA 3PZVA 1P1MA 3O15A 3G0SA 3D3AA 3TNBA 4LUJA 1M3UA 1SQ7A 4C6KA 1LQAA 3PNUA 4P8VA 1EGZA 1KB3A 3BLKA 3SR7A 1E3ZA 2GJPA 4AF0B 4Y9MA 5HDRA 1XRVA 2X1UA 3T78A 3S6TA 3LY0A 2WPBA 7PTDA 2X41A 3U5UA 3VK5A 4PTMA 5I7GA 2BXVA 1XGZA 1CEOA 4HU4A 2DDXA 4JN8A 4YU1A 3SURA 3VOIA 1OFPA 3CZGA 2Y88A 4AZGA 4YJ5A 1H50A 1JQVA 1AZ2A 4UMCA 3UCCA 2HZGA 2ANUA 2DIEA 2AMGA 1LJYA 4X61A 3PPHA 3BLEA 3HO8A 1Y0EA 1W1A1 5TNVA 3P84A 3THCA 3MYOA 4K68A 4LYQA 2VCBA 1UOZA 4KGLA 3A3XA 2AAMA 4GISA 4ZSUA 4LVGA 2QCGA 3W1QA 3V0TA 4GLEA 3FK4A 4U10A 4LYPA 4JQ4A 4E4PA 3VGDA 1D3HA 2GUBA 1EGMA 4LB3A 2QAFA 3EB4A 3H2NA 2DZPA 4UTLA 2DZSA 2W6RA 4F0SA 3S1VA 3NA8A 3WMBA 1GKRA 3APGA 3NQBA 4ZMGA 5JIPA 2CZVA 2FZNA 4O14A 3LLXA 1VPQA 1PPIA 2IPWA 5ENLA 3FN9A 4AIEA 3TA6A 3TN3A 4UOQA 2QCMA 5HR7A 1VFLA 5I09A 3UWEA 1BG9A 1WUEA 1LQ2A 4BQ4A 4REQA 2ICSA 3S5NA 5BOFA 3PB0A 3IRDA 1N55A 2J7EA 3CQIA 2W5FA 5FF2A 1DTUA 1V3MA 1BYAA 3VZZA 3WJZA 1TTJA 1M7OA 3VXGA 3TTSA 3SO7A 4DBDA 1R9YA 1O5QA 3TE9A 5HR6A 2PDUA 3NEHA 3KL0A 4D6IA 2RDWA 4TVDA 5D33A 2FHCA 4KRUA 1TMHA 4IPJA 3WF4A 4CU8A 3WDQA 1G67A 1NQKA 4JFTA 4JFSA 4TMCA 3KX6A 1QUMA 2V3GA 4AY1A 1W1VA 1MW0A 1W5OA 3VFLA 2HV5A 1UP2A 2RFGA 3CWHA 3ZM8A 1MNSA 1XKYA 3THAA 3CBWA 3MUY1 1YEYA 4N4PA 1EA0A 4GINA 3KVMA 3VCRA 5EYWA 3KTSA 1GONA 2PE4A 3MV11 1KD0A 3UR5A 1IYXA 1MMFA 3WQ8A 2YLAA 4NZFA 2EPNA 4GZJA 4IP7A 1V02A 1JQXA 3K30A 3WFLA 5H8UA 1DJWA 4PB5A 4ZXOA 3AWOA 5D2YA 4CD6A 3EX6A 3VNJA 4CVWA 4PMOA 2QIWA 1QJWA 3HJZA 5GJMA 4PSRA 5D2WA 4Q8TA 3SAZA 5AC7A 3G77A 1V5XA 3NYDA 4AD2A 4IT1A 4Z2HA 1HJXA 4I9AA 2GQAA 1SJDA 1OINA 3RMEA 2G4FA 3EOLA 2NQZA 1IR2A 2J7FA 1GVQA 3WLTA 3W3OA 4R9XA 4C65A 3P0XA 1H61A 2YCKX 2L5HA 1N8IA 1C8VA 1TVPA 1KWKA 1KFBA 3BSMA 4LALA 3IJLA 2D0FA 3W82A 1MW2A 4F4RA 3IWPA 5FJRA 6TIMA 4HA0A 3M0IA 1FXPA 3QY8A 2ZUSA 4O12A 4M51A 4JL2A 3FKKA 3L4WA 4PL1A 2D2GA 3CQ0A 3GD6A 4ZGYA 2YYTA 1AMKA 3LLFA 2HQAA 3MUAA 1E0UA 3P7YA 4E3TA 1XIJA 1E1CA 2UZ9A 3WSUA 2O9RA 3B8WA 4S1FA 2PZNA 4S23A 4DNHA 3HOJA 5E70A 3T09A 5HWNA 4F79A 3AYVA 3W2NA 4FNPA 3KCOA 2W27A 1RV8A 1Y5VA 4NNCA 5BWFA 3SRKA 3VD9A