1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
b'TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
3ITTA 1CLKA 1QTWA 4A8IA 4K1GA 3AYVA 3KTCA 3L23A 4QEHA 3DX5A 3IUIA 4EACA 5AVHA 2X7WA 2OU4A 1D8WA 4XIMA 3XINA 5C9ZA 4XSMA 3UA4A 4YTRA 8XIAA 9XIAA 1XLEA 3M0MA 1XYAA 5B80A 1DIEA 4YTUA 3UA3A 3VNKA 3TVAA 1XIMA 1QUMA 2X7VA 3WQOA 3KBSA 3NGFA 4XIAA 1XIJA 1XICA 4HNOA 5FA5A 4EAYA 3UVAA 4QEEA 5XIAA 2QULA 2G0WA 1O1HA 4ZB0A 2GYIA 1XLLA 3KBVA 3QZAA 4XISA 5I7GA 3QXBA 4QE1A 6XIMA 2HK0A 3IUDA 4A8NA 3XISA 2NQJA 1QT1A 1XYMA 2GUBA 2J6VA 2G4JA 1XLDA 3C0QA 4J4KA 5AVNA 1XLBA 5B7YA 1DXIA 5H1WA 3VNLA 2QW5A 1OADA 1TZ9A 3QC0A 1XIBA 5B7ZA 2XISA 3KBNA 3CQJA 2ZDSA 4PGLA 4KW2A 1XLGA 1XLMA 3BZJA 2GVEA 3AAMA 1DE5A 1BXBA 3BANA 1A0DA 1XIGA 1XYBA 3CWHA 2XIMA 3KWSA 5J8LA 1S5MA 4G56A 3VNMA 1XINA 4OVXA 3M0LA 3C0LA 3ITVA 1XLKA 3VNIA 7XIMA 3ITYA 3P14A 4DVOA 3VNJA 3M0YA 4QE5A 8XIMA 9XIMA 4X63A 4HGXA 1XLCA 1MUWA 1XLAA 2QUMA 1XLFA 1XIEA 5EMMA 3M0XA 2HCVA 2Q02A 3CQKA 3GNXA 3BDKA 4YTSA 2I56A 4K3ZA 3AYTA 1XIHA 3N4AA 1XIDA 2GLKA 4QDWA 6XIAA 4YTQA 1XP3A 4HHLA 4GJIA 1S5NA 1K77A 1A0CA 3LMZA 5H6HA 3CNYA 4ZBCA 3AALA 3DBNA 4US6A 4XKMA 2QUNA 2ZVRA 3P6LA 3KBWA 5EMKA 1XLJA 3QYSA 3U0HA 2HK1A 4QE4A 3BWWA 3BZGA 3ITXA 3U3HA 1GW9A 5EMLA 1XISA 3M0VA 4PFHA 4ZB5A 4GJJA 4A8LA 2XINA 4GQBA 1I60A 3CQIA 5EMJA 4A8RA 4HHMA 2NQ9A 4Q7IA 1I6NA 3VYLA 2I57A 1BXCA 5TNVA 3IUHA 1XYLA 1YX1A 3UU0A 4DUOA 3JU2A 1XIIA 1MNZA 3FVMA 3C0SA 4E3VA 3KCJA 4W4QA 3OBEA 1DE6A 1XLIA 3M0HA 3XIMA 4QDPA 5XIMA 3TC3A 1XIFA 3KCLA 4XSLA 4ZB2A 3KBMA 1XLHA 3CQHA 3KCOA 4X61A 3UXIA 4YTTA 3ITLA 3ITOA 2NQHA 1A0EA 5XINA 4X60A 4GLEA 4LNCA 1DIDA 1XYCA 3KBJA
chains in the Genus database with same CATH superfamily
4CNNA 2CNCA 3P62A 1PBGA 3A9BA 4EPEC 1S5VA 2ATSA 3OTRA 3T05A 3TR9A 1LLZA 5DBUA 4NHVA 1DORA 1M65A 1NSJA 2E9MA 1KR1A 3PWAA 4Z08A 4NRRA 3NCOA 7REQA 3P84A 1MW3A 2GSEA 3IVTA 3DHUA 1BTCA 4O54A 2GUYA 1VFFA 7A3HA 2WJEA 3UXAA 1K1DA 3VDAA 3FA3A 4C6FA 3UZZA 3WF3A 3ZJ6A 2ZICA 4YIWA 4ICNA 2ZDRA 2ZWYA 4BKNA 1BYCA 2D2HA 5FF4A 2QYGA 1P0NA 3DFTA 2AQVA 1P7TB 4ZQCA 4P7LA 4WJXA 2ZQ0A 2ICSA 4TTUA 1W2VA 4YN5A 3CJPA 1Q2RA 1KW1A 3CUFA 4TX8A 4D9PA 3KZPA 2QQ6A 3TLQA 1B3VA 5EPDA 1J4EA 3DG3A 3O2LA 3B9OA 1O12A 3QPEA 4EX4A 1XYLA 1J0ZA 2INZA 3EPNA 3NVTA 5FESA 4CQDA 3G8EA 2Z26A 1BFNA 2NQHA 2Z2AA 5T9BG 4DEFA 3I3BA 2WZTA 3TH6A 1E6QM 1QHOA 2WC7A 1XUUA 3NQVA 3WG6A 4IOTA 2E5DA 4JBRA 3K1GA 2X7WA 2O9OA 3FV9A 1IZKA 1XYAA 3VILA 1KFJA 4QG9A 4I9JA 1J6OA 1GEQA 3PY2A 1VP5A 5FA5A 2WQPA 4J3VA 3UVAA 2DQWA 1KXHA 5D04C 1W3LA 2ABAA 5CSUA 4ENLA 3HQPA 1GUVA 2QJNA 2AL2B 3DCPA 1XLDA 4E2VA 3VM7A 3GVVA 5BOEA 1G01A 2HE5A 2DSZA 4HJWA 5JBFA 4HB7A 1A53A 1XLFA 5KINA 3VOJA 4M6VA 4WHBA 5BYWA 3MUZ1 2EG7A 3AROA 1KLYA 3T2OA 3DHDA 3M0IA 1JDDA 4MAVA 1HP4A 3AALA 1XRSA 4Z1AA 1UR3M 4B9ZA 4W8AA 2BY0A 3GDRA 1GORA 1PXGA 3L4YA 4A8LA 3W82A 1XG3A 1FCBA 1Z48A 4JTQA 1M7XA 4U31A 5IDZA 3U48A 3WBWA 4C1NB 3UPWA 4XSLA 1XLHA 4X61A 4PB4A 5LNVA 4ZSTA 3NFUA 3ITTA 2VX4A 1JGIA 3LBOA 3C86A 3F1QA 1FP9A 4AHPA 3K30A 3VKKA 2D3LA 2XVKA 1OFPA 2DY3A 1GEHA 1VFLA 2IKJA 3CUXA 3EWYA 3R0KA 4RPPA 3EXSA 1C7TA 1XGDA 3PJTA 2HPMA 1TG7A 3N3TA 3KTXA 2GUBA 3BK0A 5A6AA 3IJ9A 3P8JA 4I3GA 4TQTA 2FZ9A 3V7PA 1UWIA 2D1ZA 3WKZA 1UD4A 4JCMA 1S5MA 1R38A 2HVOA 4O8RA 4DVOA 3I6EA 4QE5A 1T5AA 1KFKA 1PHQA 3UF9A 2PBGA 1G7VA 1XBXA 4Q8OA 1XIHA 3B4YA 3MBFA 4WCJA 1EL3A 1X1ZA 3EEZA 3EOUA 3EPOA 4U33A 4PMOA 1UKOA 5GQBA 5H6HA 2DZWA 4ILSA 2CCRA 2W62A 1H1NA 1DHPA 1FXPA 1VLIA 1SVDA 5EMJA 4C6JA 4UB9A 1YTDA 3MHFA 3C0SA 3VGDA 3TJXA 4IX2A 3G0UA 4U3AA 2DZTA 3FEQA 3FOKA 3LTSA 3NVDA 1ONEA 2W66A 4KRUA 1KFCA 1DWHM 2Y1HA 2FLIA 3S8HA 3LPGA 3IACA 4QDMA 5E9AA 1U33A 1XBVA 1YPIA 3KX6A 4P7RA 4DO4A 4TOQA 5BXRA 3E38A 4QX4A 5I0DA 4XK2A 3EB3A 3WLKX 2IW0A 3N19B 4XO6A 4CD8A 4DJDD 3NEHA 2OT0A 3PZQA 2VR2A 4Q33A 4KGJA 4PTVA 5DCBA 3UNTA 1UASA 1QW9A 4IICA 1E73M 2VI0A 2HS6A 4JX6A 2WNWA 2XHYA 4H83A 3EDFA 3MHGA 3ZQ9A 2JKPA 3LXBA 3LQLA 2A6LA 1FWIC 5TAOA 3A4WA 4CU6A 2QF7A 1FRBA 1U5VA 3RU6A 2OVLA 3BW4A 2P10A 3IAPA 1OX4A 3KLKA 4GWEA 1YDNA 2GFTA 2A7NA 4Y9MA 3I7QA 5DXYA 4A8RA 1KQZA 4JN7A 3DKJA 5HDRA 3C2FA 4G7FA 3I3DA 2ZBTA 4WVXA 1N8IA 2XIOA 1G5AA 4GY1A 2CKSA 2R8WA 1SW7A 2XH4A 5M3WA 3QZEA 1JPDX 1Z3NA 2X2GA 3I7RA 4MWAA 4KF1A 4ML9A 5E0KA 3C2RA 2XJ7A 3W83A 3Q58A 4H04A 1EZWA 2X7VA 1RV8A 1QUMA 2HDJA 4CD7A 1CGTA 3N34A 3F4NA 1O1ZA 3IV3A 5I7GA 3U8GA 1VJZA 2VD9A 3P93A 2YOCA 3C0QA 2YCLB 3PNZA 3W7CA 4PL2A 1OK4A 1MZRA 3N2XA 4K37A 4R53A 2VGBA 1G0CA 4LU0A 4IP4A 2VKZG 4GQGA 3MSRA 4P5UA 1FWJC 1THFD 3F4CA 1ODZA 1OZQA 4GBUA 2QMKA 4KERA 5AHNA 1A4MA 3L12A 1KRMA 4HPGA 1Y65A 2IKIA 2ZWZA 1U1JA 2AQOA 2I14A 4NSBA 2PAJA 2XN2A 3LMZA 1BEUA 2DSUA 4YWSA 1BG4A 3S5YA 3VGFA 4MADA 3B4UA 4Y2WA 4PUWA 4BQ5A 5JXQA 4HVXA 4RNFA 1V3HA 3PUEA 3NL2A 2PWVA 2CXGA 3FK4A 2A5HA 4LC6A 4PUKA 1J96A 1B4EA 4JIRA 4EE9A 3WD0A 3MO7A 5A8GA 1VFUA 1C3FA 3CHDA 2A3CA 1MEHA 2FKPA 4GHRA 1TV3A 4NAFA 5D4YA 3NPVA 1B9ZA 4K8EA 1UD3A 1OYBA 3EMZA 2VXNA 3H4XA 2PE4A 1RQBA 3UZ5A 4JS3A 3VGHA 4QR6A 4H2CA 4XG1A 2ZTKA 2FTWA 2OMAA 4GPNA 1D7KA 3W7GA 2NQ5A 4NAEA 4R7OA 3O6AA 4XBKA 2F84A 2P0IA 3CBWA 1DIOA 1UH4A 3H2OA 1YQ2A 4NASA 3NQ2A 4Q4QA 3SCSA 5CG0A 2WZHA 4FX7A 1MDLA 1Q2SA 4JDBA 1JZ3A 2GSHA 5C5YA 4O52A 3IIPA 1UWSA 1IT0A 1FH7A 1SJAA 1WX0A 1PYMA 2OO6A 1LQ2A 3WF4A 1DJGA 2J6XA 4M1BA 1FCUA 3MCNA 3VIIA 2VQTA 1IEVA 1VENA 3B3DA 3XIMA 3SUVA 3T2PA 2XU2A 1NM9A 3G77A 3EKGA 3GY1A 3UXIA 2FVLA 1H5YA 1N7KA 4UFLA 2EPHA 3QJAA 4FP1A 3GXFA 4DF2A 4ZL1A 3K46A 5DF0A 1OINA 2HVNA 4S3AA 5E93A 5G4HC 2YA2A 1QASA 3M5VA 3CUIA 1K3UA 2EEXA 2W27A 4XX6A 3VNKA 4LS1A 2Z2BA 5IOBA 4RLIA 1ZJHA 1AQHA 4NZFA 1K8XA 4PL1A 2PC8A 2IXUA 1WO2A 1DXEA 1E1CB 3MP4A 1PKNA 3K4WA 1WXYA 1UUMA 4GQQA 3P74A 2EJ1A 4GQ0A 2BWGA 2FGZA 1I45A 5JBDA 1OC5A 4L9YA 5CSSA 2X1SA 3DFNA 3PZVA 1OFOA 4C90A 3DYPA 2V2CA 2PWFA 5G4WA 2ZUTA 2YJQA 1X96A 3GUGA 3SIZA 1AQFA 4M3PA 5FIPA 3T2QA 2QUMA 1XIEA 1H7OA 3U2CA 2ZZ2A 3DU0A 1V79A 1XF0A 2CC0A 1AMKA 4FF7A 1XXXA 2GDQA 2P88A 3FSUA 1FUYA 5LA1A 2YLAA 1JNDA 3LHYA 4P8XA 3ZR5A 2BSLA 1F74A 5BCAA 3N9RA 4BI7A 5IBXC 1LWJA 4FIRA 4GI9A 2CBJA 2WJFA 3CT7A 3CQIA 3R2GA 2JEQA 1BRLA 3OVGA 3N2BA 4E3VA 2C7FA 4O1FA 2O9RA 2X1UA 4GZ7A 3T4CA 1TV4A 1CIUA 1TREA 5G2IA 1UROA 5G4EA 1Z8AA 4C7FA 4J3UA 3CPUA 4QEHA 1KCKA 4DX3A 3QVQA 3EOOA 3O8AA 4DELA 4MB4A 1OFAA 1AJ0A 3L68A 4O1AA 2OZ3A 3W7KA 1OG0A 4HCLA 4AXNA 1F3XA 1XLLA 2EAWA 2Z1KA 3TC6A 4GQRA 1BVNP 1EJSC 2BASA 4DRSA 3MCOA 2YB4A 2ISSA 4HOWA 5CC3A 3AHTA 1W5QA 2ZA2A 5DCDA 2FMOA 4G56A 3PNUA 5HR7A 1KM6A 1G4TA 1I2NA 3ABZA 3QMRA 5M5DA 1EF2A 4Q8WA 2NSOA 1IXPA 3LI0A 2GGIA 1BWVA 2P8CA 3GHTA 4J7RA 1H0GA 4GI8A 3EDJA 5JH2A 1E3ZA 3U9IA 5EFDA 3P0WA 4B3LA 3H23A 4WXZA 3S4TA 2Y24A 5D9OA 2W91A 3H7VA 5AYYA 4LYPA 4ZEPA 3SN0A 1LL7A 4DBUA 1IXOA 4J35A 1EC7A 1DTUA 3K8KA 4LBRA 3E0WA 3NUKA 4G5DA 4IPLA 3GXNA 4AY8A 2Z1WA 4OTKA 4XZ9A 1J79A 3MTWA 3TIMA 1UBSA 2VC6A 1ISYA 2QS8A 4S3JA 3WFLA 3D6NA 2JALA 5BWAA 5A6TC 2ZUVA 1R6WA 3T55A 1L6YA 5A2AA 3SCPA 1GNXA 3V0SA 4DUWA 3TLLA 2WMIB 2E25A 4YTRA 4N7QA 3ZSSA 1XICA 1JXKA 2FYMA 1QATA 1L9WA 3AIUA 1RH9A 1UKSA 1PIIA 2UY5A 5F7UA 2XGZA 1XLBA 4F66A 2P3ZA 1ISVA 3M7WA 4L1WA 1PUDA 2VZVA 4TMBA 3PBMA 1Z42A 3BANA 4OOUA 4L5ZA 1R9ZA 2PGRA 1RY0A 1F3WA 2QDHA 4RK8A 2I1OA 3M9YA 1YRRA 1VHCA 5CSRA 4WJEA 1J0HA 4REQA 4IX0A 4BS0A 2WSYA 3A3HA 3L66A 4DM1A 3CK5A 5HJYA 5E09A 1SO5A 2QPXA 3PB0A 4GCAA 1XPGA 2V5KA 2I17A 3BZGA 3WQ5A 1AUSL 4HNCA 3WNKA 3IJ8A 1T99A 4U3CA 2Q3OA 3LSBA 4F0LA 3CLMA 4OKDA 4UQAA 3M0ZA 5AZ0A 4MLRA 1B54A 3R0UA 3GR8A 3BH4A 4OE7A 4IGHA 1FWTA 4A2RA 1WKDA 3G1VA 2QIWA 1A5BA 1OGGA 3JRKA 3U5UA 1GHRA 3CPGA 3CV2A 4QG8A 3SN1A 5FJRA 4WSHA 1Z44A 1GJWA 4CU7A 2ACUA 5AHMA 1M7OA 2AAMA 3LA4A 5C71A 4LC8A 3ZSTA 4IFKA 3KVJA 3IUDA 4GZEA 2DSWA 1UP0A 3AFBA 4C91A 4LNYA 4O13A 3B0VC 1PZ1A 1F73A 1RK5A 2BMBA 1B3OA 4Y8EA 3H22A 4GNJA 4HK7A 1LJYA 5HNNA 1GOMA 3M0XA 1TV8A 5HWNA 3BOLA 1TE1A 3NWRA 4G1NA 4CNSA 2ATMA 4FXJA 2YA1A 1PDZA 3D47A 1M03A 5HQMA 4Q4MA 3HM7A 3MDUA 1CT5A 1E0VA 3EXRA 2YDAA 1GJUA 3NQCA 2VVNA 4MLJA 4R7JA 3GTXA 5G1YA 3HG3A 5BXPA 4LUSA 4ACZA 4BF9A 4FSAA 1XQKA 2VR4A 2BVWA 3TROA 2Y5SA 3UGRA 3T40A 2BY3A 4D1JA 4IQLA 3BAWA 3L5MA 3WF0A 4WR3A 2WZMA 5AC5A 3QKZA 1F8MA 4BHYA 1EP3A 3VCNA 2FDSA 5BU9A 3VDBA 3W6YA 1XM3A 3E96A 3C0JA 5I3DA 5LIUX 1PX8A 4MJZA 3URQA 3SAZA 3H12A 1FCQA 2RDUA 1P0KA 2PDHA 3AXXA 1LT8A 4QROA 1W3NA 6ALDA 3XINA 3IPWA 3C6CA 4JQ1A 3R43A 3UA3A 4NJKA 2B7OA 4C6EA 3WLJA 1M53A 1F9CA 3GR7A 3IVUA 2IS7A 3GXDA 4W88A 1YXYA 3W86A 2WCAA 1W0MA 5CZTA 3N17A 1VBRA 2IQ0A 4C6DA 5B7YA 1TPB1 3VIOA 2XISA 5E9XA 5LSMA 1T7LA 2NV9A 1DJWA 2ZX7A 3WLQA 4JICA 2QVHA 1A49A 5JIWA 4DYEA 1G6CA 5HNRA 3J7HA 3NSMA 5HBFA 3WH9A 4O11A 4TU1A 1S3TC 3W1TA 1RZMA 1UR4A 3N4AA 1CGYA 4Z2HA 4JOMA 1EPXA 1XLJA 2ZC1A 3ARVA 5FAJA 4CLMA 3LCFA 2GDUA 3QQ0A 3MZNA 1TZ7A 3RDKA 5ABHA 3WEZA 3URBA 1YX1A 5A8OA 1GTEA 3ALFA 1GKQA 1O94A 5I79A 1C8QA 4MNLA 1NDZA 1YYAA 3BXWA 4ZOEA 1G69A 2FMNA 2GZXA 1V3MA 3RX2A 1W54A 3FJ6A 4U5KA 4AZHA 3VA8A 1XCWA 1E1FA 2E8YA 2XH7A 4NXSA 3PWGA 4DO5A 3DFOA 1G94A 1MW1A 2OU4A 2UV8G 3HGSA 4JR5A 1TWIA 1ME7A 3RX4A 5B80A 2D22A 3FGCA 2OYKA 3BGGA 4POCA 5CC6A 3L2MA 4FXRA 4PTDA 3S1VA 4AD4A 4ZTXA 2BXYA 4WY0B 1TRDA 2ZYFA 2PD5A 3PTMA 2A3HA 1I9CB 3NL5A 4IM4A 5LNUA 1M6JA 2V82A 3PJUA 1NJJA 2E68A 4HN8A 2PC4A 4GOAA 1IR2A 5DMMA 1RY8A 1O4UA 2C1HA 1IEQA 3JZUA 3JVAA 1VB9A 2E6AA 1S1RA 2GJLA 5BXSA 1XINA 1QXLA 3HV9A 1GKPA 3B40A 2HJPA 3C2VA 2BOEX 3VE9A 4DZHA 2XUCA 2G3FA 3ATYA 4LS0A 4ACZB 4XTIA 3B06A 3ARQA 3I6RA 3NJ3A 1JCYA 1AVAA 4RX0A 3QYSA 3F03K 4R5EA 4LUTB 1WP6A 4V1XA 3F4VA 2Q8XA 4ALDA 1TPFA 3T08A 1OEPA 4HZ7A 3LX9A 4FX6M 4HNLA 4JAWA 4KQNA 4RZ5A 3WMBA 3PF3A 3V3WA 5AY7A 4AZGA 3RRAA 3NQDA 3W2LA 4HYRA 4JHOA 3TC3A 3VDCA 3Q2DA 3N6JA 1OF8A 4PCSA 4LWWA 5M03A 1EH9A 3INPA 4UQ9A 4MVAA 2J25A 3ZT6A 2J62A 5M1TA 3VNZA 1GPWA 1BXNA 3DFPA 5A8PA 3KAOA 1DJYA 2FGBA 2BY1A 3ARUA 3IJDA 3HJEA 5KZDA 5LGZA 3QKEA 3RAOA 2QPUA 1KGUA 2F2KA 1JCTA 2P0OA 1TZZA 4KS0A 3S9IA 1AH4A 4CCCA 4IFOA 3C56A 1IGWA 4HNVA 3W85A 1F61A 4HTBA 3UGVA 2B7PA 4JN8A 1XSJA 1C7SA 3E0VA 1CPUA 1LOLA 5FD0A 6REQA 4JYDA 2WV8A 5FJTA 4JTFA 4D8ZA 5FF7A 1LG2A 2WHMA 4PEEA 3CO4A 3GO2A 4ZQRA 4S3EA 4HA0A 4YL2A 4UBPC 2QKFA 2WBKA 4NZJA 4GVFA 2V3EA 3W1RA 3VOIA 4FB7A 2R82A 1VZWA 1PHWA 4IG2A 1NDYA 5REQB 3GVRA 4ZVJA 4ZB5A 2V3GA 2BTMA 2VUYA 3SCQA 1SMAA 1SW0A 1JCMP 1EFZA 4HP5A 3WIJA 4WXYA 2CFFA 1EUAA 3ZVHB 1SJBA 1C9DA 1AMYA 1JZ8A 2DORA 4KCUA 3K8MA 3VIGA 4H9TA 3AISA 3DX5A 4LAKA 5G2HA 3I6TA 2E09A 1S2TA 2GOKA 1W56A 3GKAA 4E4PA 3TA6A 1MNSA 2BG5A 3B0XA 3UWQA 3N04A 1A5LC 1H7XA 4B3ZA 2PWEA 1FA2A 2QPSA 4G9PA 1QHPA 1HGYA 4K7VA 5AB3A 2OFJA 2CBIA 3OJGA 5H8MA 2OOFA 1GTHA 3QYQA 1X7FA 1RBAA 4MKNA 4C6OA 1YE6A 4DJDA 3ZS4A 2QGHA 3H8AA 2ZKMX 3KWSA 7PTDA 7CGTA 3MUAA 2PP0A 4MY9A 2XSBA 2WB5A 3MMUA 3FA4A 3A4AA 3B0PA 3VOCA 5TBOA 1MFVA 1GHSA 2BVDA 3ONBA 2DW6A 3SO7A 4JNYA 2WO5A 4ERGA 2PGFA 2BP1A 3TQPA 4UQBA 3N4FA 3GDLA 2R1PA 1CXEA 3DN5A 1Q8JA 5A6LA 5EL1A 3OZYA 4HU3A 1BPLB 4B92A 2QCDA 3TTQA 5IHRA 1VFMA 3AUJA 2ZE0A 2JE8A 3TOYA 1TJRA 1M1BA 2ISDA 3BGAA 3ZXWA 1W1PA 3GG0A 3H53A 3LERA 2VOTA 2P8BA 1G4SA 3A21A 1QK2A 2Q01A 5CPLA 4A8IA 4ZOBA 3OBAA 4DZ5A 5I77A 4KIRA 1P0BA 3GB6A 1E1EA 3BCDA 1UWUA 1KBBA 3T1GA 2REQB 1OD0A 3WMCA 3MU7A 3MVTA 5FF2A 4GX8A 2W63A 2NT0A 3REQB 4NJGA 3ITCA 1HJQA 4D6JA 2O92A 3STCA 2J88A 3L67A 1LT7A 1EYWA 4ACYA 3W23A 2WLYA 3TTSA 4HZ6A 2H90A 2PDKA 3CWHA 1FWBC 4NG3A 1QBAA 3M0YA 4MNMA 3PM6A 2C19A 3NQ6A 3GNXA 3BDKA 2PTWA 2Z1VA 4CN6A 2HE8A 2ZRVA 3W29A 4W89A 1C92A 1ZFJA 1UD2A 3TW9A 1UH3A 4IXHA 4WIWA 1N8WA 4MWAC 2GJXB 3H4WA 3C3NA 3UXDA 1TUFA 1Y5XA 3QGVA 2VFGA 1AH0A 2E28A 1VYRA 3OBKA 3GWQA 3G22A 2OGYA 4GFSA 3P80A 3IGXA 2H3BA 4AYSA 4JXCA 1J6PA 3V35A 4YYFA 4AUBA 4DO7A 5DQPA 1CDGA 2ZZ6A 2I5IA 2NT1A 3RG6A 2Z28A 3GM8A 3PZOA 3DYMA 1YLVA 4ADUA 3MMTA 3IJLA 1V6UA 1HGWA 3LLDA 3VFLA 2HMCA 2Y5EA 3EX2A 4PMYA 1W3JA 1KKRA 4L61A 3VD5A 4I7UA 1HIZA 3GYCA 3KRZA 1EPVA 1LOSA 1NELA 2E40A 2GDVA 3PBVA 3M44A 3NPXA 8RUCA 2IKGA 4NYUA 4S3BA 2V81A 4ERIA 3UWZA 2E3ZA 2FVKA 4HMCA 1XKJA 4B5TA 1LTDA 4GIRA 3WLLA 3QC3A 1OCNA 3WDHA 1QHZA 4DNMA 4BR1A 4F40A 3QV8A 1MXGA 3BUVA 2QCNA 4MZ8A 2F2HA 3OQEA 4RKAA 5HATA 5MKGB 5AFDA 3LN3A 2VEPA 2ZZ3A 5FSDC 3P5ZA 3CZKA 3WQGA 4LUIA 3T07A 2ZVIA 1W1A1 2O56A 3WCZA 4V1YA 1GW9A 4XAZA 3VFCA 1Q63A 4X22A 5SWUA 1AA1B 2NV2A 1V6YA 3KCJA 2DZXA 1KV5A 4UZUA 1KBLA 4MKSA 4JEQA 1SQ7A 4NILA 3LCHA 3P8IA 4X60A 3DYOA 4PFMA 4HBKA 4PMJA 1ZHAA 4W7UA 1E4LA 2RHGA 3W1NA 3MSYA 4H01A 5IM51 4QEEA 1VYSX 3UG5A 1JCLA 2QNEA 1BTMA 4W7WA 2DUXA 3HGRA 2WCGA 4GNVA 2GK1A 3QRHA 3UG8A 4IIHA 3N73A 2DH3A 1K70A 1IXNA 3M6DA 4YYCA 3W72A 5DO8A 1EC8A 1CB7B 3D5HA 5D8WA 4ZE4A 3S9YA 1KM5A 3OW1A 3UP8A 4XD6A 5LXXA 1N2VA 2X8RA 5CGTA 4ICMA 1A5AA 1CGUA 4AQLA 5M17A 3RITA 4NZCA 1CW2A 2PWGA 4RNIA 1NWTA 2C3ZA 3TUUA 1OY0A 1H41A 4O1EA 4LGXA 1WE5A 4PMZA 1K9FA 3L4WA 4PBGA 3ZT7A 1XISA 4KBXA 4EP8C 3IK4A 1UB3A 2OQLA 3UJ2A 5AYXA 3H21A 1K7EA 4E2BA 3BAYA 3BC9A 2DH2A 3WDIA 4XAGA 3F4DA 3WQ8A 3C61A 4N9EA 2AAAA 3I3EA 3IGHX 4NP7A 2DVXA 4GY0A 2DIKA 2YR1A 3GVWA 4TMCA 2PF8A 2AQWA 5DMNA 1FHVA 3MP5A 3O3RA 5BRBA 2QUUA 1NEYA 3SFKA 3HFYA 4IPNB 1CXFA 3N2TA 4RXGA 4BK9A 1E4IA 3TYZA 5HINA 1BGAA 1JFXA 4QJ5B 1H4PA 2Z4GA 2F7FA 4PA8A 3ANVA 2C0AA 4RV3A 1X8FA 2A85A 4HT3A 1FWAC 3LYEA 1E4MM 1E9YB 3G1FA 6A3HA 3AO0A 3R7MA 2WJDA 3MKCA 4A3RA 1R3TA 3KUMA 5BW6A 2FZNA 1KM4A 3MT1A 4Y90A 4AZ6A 1DEDA 1DWIM 2VX7A 3TMLA 4TVCA 2GLKA 3GIYA 5KMYA 4A2SA 3F2CA 2EKGA 4MGGA 3P5YA 5CJNA 4YMZA 2EF9A 1E0UA 2XGBA 3WQ4A 1YTEA 2YGYA 1UR0A 1CLXA 4H4IA 2BB0A 3FHQA 4CQCA 3LTYA 3STFA 1MQPA 1DPMA 3PZ9A 3WD4A 2NQ9A 5ENLA 2VWSA 1EGVA 1V6XA 3QQWA 1BQCA 3GH5A 3N25A 3T42A 3QY7A 1QFEA 3L4VA 2Q3RA 3UPMA 2OR2A 1XYCA 3ZR4A 3ZOAA 3MJMA 5JIPA 4Z17A 5D05A 2X05A 4BEUA 3POCA 4Q8PA 3VZXA 3UA4A 4LX4A 1KD0A 3EWDA 3E12A 1J18A 3BJTA 1CZ1A 3LCWA 3R12A 2KX9A 3EX1A 3PSVA 1PE1A 4PB3A 3EBVA 3STGA 3W53A 5A6KA 2R94A 4EK7A 3H24A 1E6RA 1VF8A 1R2SA 3TYBA 1ICQA 2W92A 1DJQA 3GRIA 3O05A 2GOUA 3WK0A 1SO4A 1NOFA 1JAKA 4PE8A 3N12A 2QR6A 4PUUA 3USBA 2PDCA 4ZQOA 1LRNA 3MP3A 3F4WA 4GVIA 3ARWA 3OGRA 4URIA 1R87A 1YMYA 1TO3A 2DVTA 3UBPC 2Q02A 4IZGA 3LS9A 1J01A 3WK2A 3BLKA 1Q13A 4QCEA 3AMLA 1E6NA 2Z25A 4IPJA 5C7VA 4RXFA 1QNVA 1GW1A 2HXUA 3OU8A 4PODA 4ZQNA 3PWIA 4E2OA 4JNZA 2OZTA 2E1WA 3AIQA 1XLIA 1W5NA 3S1GA 2B7NA 5XIMA 1HT6A 3NZ1A 3WQDA 2OPJA 1OGSA 3ITOA 3ITLA 5HAOA 1TPWA 4JTHA 1Q65A 2C16A 5D9PA 3QMTA 4BF7A 1KC7A 3PVFA 2RFGA 1IYXA 1OC6A 2CZFA 2YX0A 4LPCA 1F76A 2A3BA 2XN1A 2CZEA 5A1AA 3OPSA 5GNXA 9RUBA 3AIWA 3UESA 2D69A 5I23A 1C8YA 5FEXA 2QCCA 2WVUA 4KWWA 4M7TA 5I07A 4DJFC 2H8XA 3QMSA 2CLKA 1W9BM 4I7WA 3N9SA 2XZ7A 2J6VA 1AW2A 3PSWA 1LOQA 2PLMA 2O9TA 4UNLA 4GK8A 4OGZA 2JFEX 1S2AA 5D2XA 5HK4A 3LPOA 2FB2A 1JD9A 2C14A 3NQFA 3LCIA 3RLHA 4UQEA 1FFQA 4CQAA 3ARXA 1RP8A 1X1NA 2ZXQA 2BHYA 4LJ3A 4QIUA 5CJ5A 2PDMA 1PCKA 4GYPA 3L4TA 3W7LA 3PG8A 1S5NA 3CB8A 4I5XA 1KM0A 4WGHA 3W00A 2EPKX 3K5XA 3S2CA 2J8GA 4QSHA 1MZHA 2ZCGA 3M47A 2PS2A 3LNMA 4HSNA 3T0AA 3B8UA 4HMDA 4GIEA 1KRCC 1NFBA 3KOFA 3JU2A 3QV7A 1X97A 4R88A 3YPIA 4ZB2A 2H9AA 3BMWA 1TMQA 3RR4A 3NQGA 1WNOA 4LBSA 1GZGA 3W75A 3L7RA 2XPKA 3HMCA 2YW4A 6XIAA 4BF5A 3GC2A 4QSFA 5BRPA 2HRWA 2XVNA 1ADOA 2QLYA 4IISA 2V5CA 2R1LA 4L9XA 1EBGA 3LB0A 1UYQA 1K9DA 1DIEA 4YTUA 2BZNA 2DV0A 4ROPA 1Y8BA 4EAYA 4IGNA 3S1XA 1A3WA 3PANA 2E5BA 1B3ZA 1RPXA 2WOQA 3SFWA 4CN1A 1WQ5A 2H6RA 3AYSA 1M01A 1NWSA 2G37A 4FXFA 1VD6A 4D1IA 1OX6A 2NXIA 1FDJA 4W5UA 1QW7A 3NPUA 2GQAA 1PEZA 3DZ1A 1YIXA 2KZHA 3AHYA 3CYJA 2ACQA 3EMCA 4KWUA 4RW3A 4GUIA 3UVIA 4J9JA 1XDLA 4MNKA 4F0RA 3VD7A 1GQIA 3IS4A 1PTGA 5LXEA 1PKLA 3K1DA 4V27A 3H26A 4FNQA 1GOWA 1EDGA 3WF2A 1SFSA 3APTA 4PR4A 3ZFHA 3U2ZA 1XH1A 3C2YA 4JHZA 2A2IA 2INFA 3RJXA 5IFTA 3A4JA 2TAAA 1J0JA 3L5LA 4WEVX 4M81A 3H55A 4DXKA 1KXVA 2IPWA 1ZALA 1IE7C 3W0KA 4AX7A 1AW1A 1TUXA 5A3HA 4EF8A 3CMFA 2D3NA 4Q8VA 3MYPA 4ZOCA 3AXKA 3CIVA 3R13A 2BOGX 2VL4A 3TYAA 2DZAA 3EMQA 3ZLHA 4XIMA 2A6NA 2PDXA 1L8NA 5LA2A 4QAIA 1L6FA 1BSLA 5AC4A 4Y9OA 3BSHA 1W31A 3VC6A 2XTKA 3ZLGA 1P48A 3BV7A 1QI0A 3SUSA 5T8GA 2VGIA 1TZ9A 2WSPA 1SJCA 3U7VA 2YL9A 3UWWA 1UIOA 3W01A 1JAEA 1HTIA 1JRCA 3IJQA 1QCWA 4Q32A 5E5CA 1P43A 1AD4A 2HCVA 2WLZA 4IP7A 1H5VA 2CHRA 2VDIA 3TK7A 4AZCB 5LIYX 5CQ1A 1HJUA 2OODA 4XKMA 5G1MA 1SFLA 4KFNA 3SN4A 4A3UA 3BWWA 4QBXA 3CWNA 3N3MA 3O0KA 4L6DA 3Q67A 4NU7A 2ZXDA 5FCZA 4V2XA 3KFTA 1GJPA 3LNPA 4FF5A 3EOLA 3M0HA 4UTUA 4NZ5A 1PCWA 4XZMX 1I2RA 4DN1A 2OSWA 2PRLA 4DI9A 1E5NA 1WYIA 1XGEA 4PUEA 5DANA 2QIIA 2OT1A 2WVVA 4UTTA 2JKAA 1V02E 5I2UA 4JHMA 5I02A 3NDOA 2GGHA 1JCXA 1FTXA 1S39A 1ME8A 3U2EA 2PTDA 4YS1A 3QY8A 3HPFA 1LM1A 1U22A 3SR7A 2UWFA 1JUKA 3FXGA 3PAOA 3G1XA 3VD4A 3LBMA 3T44A 2CLHA 3ABOA 1EJVC 5D9MA 1F8IA 1RLCL 4DBSA 1SZEA 4MPKA 3AMGA 3CB3A 2VFDA 4GVGA 5U7SA 3VNJA 2YW3A 3VIMA 1YNQA 2QJHA 4FLOA 3SRFA 3NXLA 1XLCA 3ZJ8A 8CGTA 2MANA 5CSYA 3A13A 4WKFA 4LALA 3CV6A 3TC7A 5HANA 3CNYA 3O15A 3CEPA 2QZRA 3CL6A 5TIMA 4S2CA 2X16A 2XVPA 2YDRA 1C9WA 1UD8A 2RDXA 3VYLA 4ZFCA 2NW0A 1OHLA 1DJHA 3WN6A 1F6KA 2VMFA 3W07A 4GC3A 1QPRA 2WM1A 3CO8A 3SM0A 3CQHA 3W7HA 5CH9A 5C2GA 1JZ6A 3AQUA 1TCMA 3BLLA 4NT0A 4DZIA 5CAKA 2O4MA 2A7PA 4B9YA 4EF9A 4IXXA 1EX5A 5F2LA 3K2GA 4WZHA 3F7JA 5CBBA 1H50A 3PTDA 4IPIA 3GSMA 1ELSA 2J7EA 4ZOAA 1HVQA 2PDBA 3IIZA 3MANA 3WJSA 5AN7A 5BNKA 4JTAA 4A8NA 2ZX8A 1WXZA 3LHVA 1UJPA 3G24A 4LXFA 4KCVA 2VEMA 3EDEA 4RZBA 4YVVA 4FALA 3DAQA 1B90A 4HMEA 5D2TA 2NUYA 3UR7A 4F2UA 1IWPA 4DJED 2OLHA 1MSSA 2W5FA 4XUGA 1DVJA 1CTNA 3CUJA 3WDQA 3B97A 2V5BA 4CKQA 2J79A 3CPRA 1QO2A 4F8XA 1QBBA 4ZSUA 2D2GA 4GCXA 2WSRA 1KBJA 3H70A 1V6WA 1O5QA 3SUUA 4Q8NA 3GNNA 3O6DA 4MJMA 2DP3A 3KDNA 4YVXA 3S2LA 1TELA 1E0XA 7ODCA 1ITCA 2VJXA 3UD6A 4A22A 4PBFA 1PX3A 4IMAA 1IT8A 4QDPA 3TFCA 5DCEA 4QHRA 5EMUA 1UIPA 1AODA 4NRSA 3BJFA 2HQAA 3WLIA 5JBEA 1PSCA 1REQA 3S0CA 4INFA 5FF3A 2BGQA 1ZL1A 4DJDC 4J3XA 4WF7A 1JUBA 4MOZA 5FF0A 3R8GA 3CTTA 1UUOA 4N4QA 1MXSA 3IIVA 1PO9A 2EPLX 1LLOA 4GNKB 2R24A 3FNDA 4GXPA 4XZIA 5JQ9A 2OCZA 1TSIA 4Z2KA 2FB3A 1TPH1 2J8FA 3BW2A 3QC0A 4W9TA 2FH8A 4TIMA 1F6YA 1XUZA 2ZUSA 2RH9A 2WAGA 1A5UA 4ZO7A 3WYZA 4GXWA 2VZUA 1XIGA 1GQJA 1RPKA 1RXOB 3G3DA 1ZJIA 3A12A 3G6LA 5IXEA 3NSNA 3W1MA 3GC5A 4IQDA 4MUZA 5CPSA 5ABFA 2V5DA 5I03A 4PSPA 4IFRA 2Y5JA 3V16A 4JZ5A 5CC5A 4MZYA 4JFUA 4RDVA 2BS9A 1SPQA 3U0HA 3UR8A 3CV1A 5HULA 3B03A 4GE8A 2UY3A 3K13A 3OODA 3BV4A 4MYXA 3AZRA 3QOMA 1AJZA 3K4DA 3ABSA 2HXTA 1YPXA 1EZ2A 3GE7A 4AF0A 4WRHA 1DL3A 3BAKA 1D2KA 2OKOA 3NM1A 2QXWA 4O1BA 3ELFA 2YCEA 1S2WA 3UZXA 2VR5A 1MW2A 4I9TA 2NVCA 1FH8A 1VJSA 4U28A 4K39A 2IQTA 2V38A 4UMCA 1R47A 4XKYB 4LVAA 5HUOA 1UZ4A 1LQAA 3TNBA 4E4UA 1O1HA 1X6LA 4C7DA 1CXIA 4IIDA 3AMCA 1JL8A 4D6DA 1NWRA 2C15A 1OJXA 4IIFA 3EXTA 1XLGA 4PMXA 1JXJA 3OVRA 2OJPA 5AOUA 2D0GA 3LMYA 3WY1A 3C0LA 4KESA 8XIMA 4HU4A 4NNBA 1KTBA 3NQ7A 3SRDA 3URNA 4H7ZA 4DBEA 2E6DA 1TYGA 3O7UA 1UA3A 2VRJA 1ZTVA 2YFOA 3RCYA 4L4PA 1K03A 4TR9A 4YTQA 3NGJA 1EC9A 1O6IA 4WGXA 2VOMA 3LENA 5H91A 2OSYA 3GQYA 5A8NA 2F61A 2ZUUA 1KCXA 1LRQA 3T78A 2ZC8A 4PC8A 3VGEA 3W4RA 1W3TA 4M29A 1M7JA 3L0KA 1JZ7A 3ONCA 3KOXA 1VBUA 5C2CA 2AL1A 3GK0A 3RIKA 4C6QA 5DLCA 1M3UA 1QTWA 4FMVA 5HJXA 3LGDA 1I4NA 4HOZA 1XL9A 5CGMA 3MB9A 4K2SA 3DUGA 3P3BA 5HMFA 4KEZA 1JYXA 2VX6A 3D0CA 1ZBKA 4XD4A 3O16A 1QI5A 3NZQA 3EX3A 4PMDA 5CCZA 5GPRA 1RCOB 3AIBA 1XX1A 4DNHA 4HA3A 1Y0EA 4XZHA 2RAGA 5AYBA 4OBTA 4L80A 4GXMA 2ZUWA 2Z1SA 2FFIA 4PGLA 2PWUA 1IIGA 2G41A 3CQJA 5JU6A 4UTFA 3GC4A 2CEQA 2ZX9A 4AIEA 2WNNA 3LM7A 5H8PA 3UWUA 3R1ZA 4AD3A 3G6MA 1FWCC 3AHXA 4P61A 2VYOA 4R9OA 5FL0A 3MQTA 2WHKA 4YJ5A 1TJ1A 3VUPA 2B7QA 2ACSA 3VD3A 3B9EA 4CGTA 5H8UA 1WB0A 4H9UA 3HPSA 4H8NA 2J7GA 4GJJA 3AHZA 3BICA 4UOZA 3CUZA 1L0PA 3N14A 1JYWA 1MVYA 4D6HA 3LK6A 1FWSA 3W3OA 1U30A 1V3JA 1X39A 3WBAA 4YVPA 1ITXA 3DI0A 1WZLA 2VTFA 3CYVA 3MA8A 2A3LA 3FDKA 3S5OA 3BO9A 2Y8KA 4PRRA 1GOKA 2WYSA 2DZBA 2YXGA 4AMAA 4HN4A 4GUFA 3QLLA 2DGAA 2RDWA 3SJ3A 1HP5A 4JTTA 3W7QA 4M6PA 3EX6A 2ISVA 5EGRA 2VD8A 3ARSA 2WC4A 3NQEA 6ENLA 1XH2A 4HIBA 1YBQB 1LP6A 3TONA 3W7DA 4AZ7A 2OYLA 4IMDA 1OFDA 1VIWA 4DYJA 1K8ZA 3KVKA 2B4GA 3M64A 2XWDA 3LOTA 4A3YA 1JNEA 2OWWA 1PWLA 2D2OA 1HX0A 1UWQA 1UOZA 4U2ZA 3PBGA 2DIEA 5F2GA 1CLVA 4B5SA 3ZJ7A 1XWYA 3P60A 1XIDA 1MXDA 2GJPA 3KTSA 5EMKA 3GG8A 4FLQA 4UFHA 1X7IA 4B4HA 1XS2A 2G5WA 3TEVA 1VC4A 2NVDA 4HTYA 1EDTA 1R2RA 1H60A 3MSDA 5F2IA 5M2FX 1V7AA 4IUOA 2BVYA 1U1UA 4E5TA 1WZMA 4XQ6A 4WY0F 1A5SA 3AIEA 2ZXBA 4NF7A 3ZT5A 4YXGA 1VBGA 1KFWA 1E6SM 5LA0A 3QFEA 3AI0A 3W81A 3FA5A 4PCTA 4O50A 4LAZA 4ZZ9A 1RCQA 2O4QA 1TVPA 3SRHA 3TKFA 1HKWA 2V30A 1VGAA 2D0FA 4QJ1A 2DSVA 4Q4PA 4E3TA 1NFGA 1SW3A 3TYCA 5LIKX 3I68A 3ARRA 3NO5A 1X6NA 1UMLA 3GTIA 1W1IE 5CBIA 2F38A 1ADSA 1WXJA 4JQ3A 1GOXA 3N6HA 1EUNA 4GYKA 3NL3A 1Q6QA 3OLIA 3CL7A 1HKKA 2PTYA 3BLEA 2WNQA 2Z7KA 3R4IA 1XBYA 1DTNA 1YXDA 4F9DA 4Q4OA 3AC0A 1V0NA 1OYCA 4H3DA 4MPQA 2POZA 4OOZA 3IANA 1LBMA 4RDYA 4Z2JA 3QM3A 4EXBA 3OGSA 1K7FA 4OU1A 2VC5A 2HBXA 7REQB 4ES4A 1JYVA 1WDWA 2NV1A 3PZGA 1VFHA 3MO4A 1OC7A 1TFVA 1F5ZA 1FWWA 4QLKA 3PP7A 1QWGA 1GVQA 4JIHA 1TMLA 1I8JA 3N2OA 4WUIA 2ZX6A 3W76A 3ZVIA 4RDWA 3P61A 3OHMB 3Q45A 2ISWA 3TMQA 1GCYA 2OYMA 1T8XA 1IZJA 4C6LA 5C9ZA 2C79A 1TE6A 2Y8VA 4W85A 4CNOA 1ICPA 2PCQA 2J77A 4L65A 3NZRA 1OABA 2G3NA 5DY2A 2OSXA 3TAKA 1RQHA 3SY5A 3XISA 3HGOA 4AC7C 4N6FA 4JNMA 1O5XA 1FCVA 4DPPA 5H1WA 1IR1A 2J7FA 3CUGA 2FH6A 1KM2A 3W7JA 1FQ0A 2ASHA 3W27A 1WBJA 4KFPA 2I16A 1ISXA 1J10A 3HB9A 2VFFA 1A0DA 3OG3A 1ZENA 1X8CA 1GVFA 3UWYA 3SGZA 4H9YA 4M82A 4BQ2A 3RPDA 2Y4SA 1D8CA 1UA7A 3LGEA 1PZ3A 3G0XA 3S3GA 2QF8A 3WH8A 1XPYA 1HO4A 2Y63A 1VS1A 5DT5A 3A23A 4N9BA 1OFQA 4GFIA 1L6WA 5D2YA 1OWQA 4H6QA 3NXFA 4IMFA 4QLJA 5HPOA 1GOQA 3BURA 1NDWA 1KGWA 1VFOA 1EP2A 3HG4A 4HU0A 3RILA 4D72A 3GBEA 3TX9A 2FPTA 2E6FA 3WNLA 3NO3A 4GLEA 5DRIA 3WFAA 4IL2A 7TAAA 1YKWA 4PMRA 3T7VA 3ICJA 5AVHA 3L2IA 2XFWA 3PFMA 1V0MA 2B31A 2A1YA 4HSOA 3MUY1 3R89A 1B3XA 2DFAA 5I24A 1NFPA 2ZFAA 1JD7A 2GVYA 3OVQA 2X0YA 1U5JA 3VX1A 1SGJA 3IGSA 4GYPC 2XN0A 5L6UA 3SQLA 4AWTA 1QDSA 1RJRA 2WHJA 3OP2A 3CLWA 4FIQA 2PTXA 1IZCA 1MO0A 3SSZA 4LVGA 2J7BA 4DBWA 1XLKA 2VZOA 5AHIA 3QSRA 4HGXA 1BG9A 1LWHA 4GI6A 3OO2A 1J9YA 2C8NA 3RLGA 1TIMA 2W79A 1Q6CA 4GINA 1K8YA 4G7EA 4Y8FA 4B91A 1K7XA 1A0CA 4UMAA 5CKSA 3EX4A 3TAOA 3DBNA 3PK7A 4UFKA 3RCNA 3D46A 1US2A 1AL7A 4XZNX 3MV01 4UR7A 3KL5A 3WUGA 3BQ6A 1N8FA 3HQOA 2YBUA 4D8AA 4JYFA 1BXCA 4P7NA 4OV4A 1KFEA 3UU0A 3S1WA 4MJ4A 3HO8A 5I5RA 1YNPA 1KLZA 4TVUA 2O7QA 1DWGM 4AEOA 2PF0A 2Q71A 1CGWA 1Q4NX 3CT2A 1ITQA 2VO5A 3HA1A 5C70A 1UW9A 3VKDA 5C2XA 2QMJA 2Y7EA 1BGGA 2BVTA 5LZLA 5AC7A 1B9BA 3SBFA 3TXZA 3RU8X 2WBGA 2J27A 3NM3A 1H09A 2R1KA 3COTA 3KL0A 1H62A 4TX9A 5BMWA 3TJIA 3VDHA 3KBVA 3RUBL 4FS9A 2XGIA 2A3AA 3H2AA 1QT1A 1RR2A 2WKGA 3FS2A 4NKCA 4X2RA 2HBVA 3WLNA 4XTDA 4LVBA 4WDUA 2EO7A 1TTJA 1E9IA 5K4XA 2GVJA 3HOJA 3VUSA 3VOFA 3W2KA 1GYLA 4CUCA 5I3GA 4OVXA 1A47A 2QJMA 3RF9A 1UC4A 3CH9A 1SZGA 3WQPA 4FAMA 4UTMA 4O28A 1SZNA 4HCDA 1A5KC 3N29A 4LYQA 2YBVA 1ONXA 5A6MA 4E38A 1V0KA 1GG1A 3H2EA 1V0LA 5EB8A 4C6KA 1RLDA 4UCGA 3A47A 4QE4A 3N1AA 1MDRA 3ALGA 2RDTA 2XINA 2CHNA 1RA0A 2Y85A 2I57A 2PLJA 3WUFA 1X38A 2CBUA 4H6KA 3FVMA 3NNTA 1BLIA 1PAMA 3BGJA 3IJ7A 1BWLA 1B31A 1BF2A 2C1IA 5LNSA 3MCMA 2PU0A 1DJXA 4OV9A 1RA5A 3BL3A 3VZZA 5DXXA 4K68A 4HK5A 3MI2A 2QAFA 3B04A 4B2DD 4KEMA 1EXBA 2RJGA 4AVNA 1KM3A 4GISA 3W7EA 5JH1A 4HK6A 1AZ1A 1GYMA 1NP2A 4OBRA 3TVAA 4GD0A 5CLTA 4XZWA 3NGFA 2CESA 2YCKX 1HKJA 3B8DA 1CI1A 3E1F1 4H9XA 3ABXA 4X3ZA 1OX4B 5A5WA 3A22A 1E4NA 1VCVA 4IIEA 2ZE3A 3HFTA 4J4KA 5I09A 2NQZA 4GUHA 2TSYA 4PBEA 3APGA 3E0FA 3GZAA 1XLMA 4PN2A 3WLOA 4G7EB 4FNPA 2ZTJA 2WZEA 2OLSA 3GHUA 5DT7A 4BA0A 4CU8A 1E55A 1TX0A 4FK9A 1HG3A 3N13A 2XVLA 4MWAB 4GMEA 1B4KA 4Q8MA 1IEXA 2R14A 1OF6A 1F05A 4F0MA 2EPOA 3KZSA 3RFAA 3MI6A 4S2BA 2Y8UA 1GVSA 1EOKA 2YCIX 4MUPA 4QNEA 1OIFA 3H7UA 3SGUA 4BJHA 5BMXA 1TPDA 1NARA 1XIFA 4DBDA 1Q6RA 5KZ6A 1VRDA 3GAYA 3PPCA 4OWGA 2DT3A 2QCGA 2G95A 3W22A 1P6CA 5D03A 1LUCA 2CETA 5K7JA 4ERAA 1HL9A 2PZ0A 3CV7A 2D0HA 5EY5A 5AECA 1PIFA 1OBAA 2W4XA 1R7AA 4NVTA 3KBSA 1YTKA 1JDCA 1Z41A 4KPLA 1U5HA 3ATZA 3RYSA 3OOQA 1L2UA 1ISWA 4AD1A 5FJUA 3QXBA 4QE1A 1AW5A 3UJEA 3N6QA 5A8QA 2PLKA 2VX5A 3O9NA 3FIGA 1LROA 4CQBA 5GJNA 4AHQA 3OYZA 2VCAA 2NLIA 8A3HA 1HJXA 3NAVA 1I75A 1LBFA 4CNTA 4WSKA 1GOOA 1IEIA 3V5OA 3A3WA 4NAFB 3LLFA 4DJEA 4O4WA 2JEPA 5F4WA 3SSJA 3B9DA 3CASA 1E6ZA 1HO1A 1LZOA 5A95A 1XSKA 1VBHA 3FCPA 2XIIA 3W2NA 4C6IA 4PUNA 4CD4A 3GTHA 4J3ZA 4PCPA 4DUOA 3ARYA 1ZJAA 5A6BD 1EA0A 1Y5VA 4DPQA 1M9HA 2FVMA 4JX4A 1FWRA 2VFIA 4A21A 4NAEB 2V6AA 3MMDA 3WX7A 2QCFA 3W7PA 3GHRA 4EPBC 3MUIA 3NL6A 3TV8A 4K38A 3ZMRA 1AK5A 5D32A 2EJAA 4S3FA 3L23A 3VKAA 4P2VA 2NUWA 3FEMA 2FTYA 2X40A 7ENLA 3T9PA 1V4YA 2PMQA 1OFRA 3L4XA 1WUEA 4EOUA 3G1HA 4O17A 3OIXA 1AG1O 3WD2A 2CLEA 1ODUA 2QV4A 3WNPA 2PDFA 2DSKA 2DW7A 3A64A 3R6IA 1TTQA 3O1NA 4HYWA 3RM9A 5B7ZA 1Q6FA 1EEXA 1FWGC 3VVGA 1BF6A 1BXBA 5FL1A 5BU6A 1GK8A 2R9RA 4UFJA 3GXIA 4KRTA 5D38A 4CNUA 1TA3A 1Q6GA 5RUBA 3FYPA 1H63A 1PV8A 1F4HA 1KO0A 2NWSA 3G1AA 2PWDA 1VR6A 2YDQA 1OZMA 4UNKA 1J2BA 1RALA 4GY7A 4UTWA 3CZJA 3GNRA 2F6UA 4PTWA 4GO8A 4ROQA 4FNTA 4GZJA 3WD1A 2Q8ZA 4IT1A 1WDRA 3JR2A 2NWRA 5AC8A 3IUHA 4QTGA 2QDGA 3IWPA 1MQRA 4XWUA 1PZ2A 3VMPA 3MKKA 1POJA 4HJFA 3KBJA 3NOEA 4AG0A 5I78A 3SUWA 1OIMA 1C29A 3ZZ1A 1T40A 1VQTA 2WK2A 3DC0A 1VKFA 1UD6A 4BEQA 5K9DA 4A3QA 3HQ1A 3C52A 3U6WA 4LQ1A 1L6SA 4LT9A 1FOBA 1XV8A 2GJRA 3W73A 1KFBA 5HUPA 1VCGA 1EWEA 5IDIA 1OYAA 1C8VA 3BCFA 1BRLB 1WBHA 1CWYA 5U4NA 5D02A 1R3SA 3E5PA 3PUOA 3KDOA 3VIFA 4D8LA 1UZDA 2YZ5A 1W91A 3PAJA 3UZYA 4V28A 1XC4A 3FJNA 2BY2A 4NZ3A 4GZIA 3SZ8A 2H8ZA 1YW1A 1KA9F 1UHVA 2HTMA 3CQKA 3E2QA 4N4PA 3AYTA 4S3CA 5FJJA 3GTNA 4ZBCA 3ZO9A 3WQFA 2OTDA 4J2MA 3ENLA 1JI1A 2A0NA 1W9PA 2TODA 1JF5A 2DIJA 2TRSA 3A24A 5K2ZA 1ZBVA 3K4AA 2J9XA 3LHZA 1A5MC 1J11A 4WDTA 2CLLA 1K6WA 4QITA 4S23A 3HJZA 4AW7A 4XZLX 2V2DA 4HPHA 3EWZA 3C5QA 3BG5A 4JTJA 2VC7A 2QCMA 3BG3A 3M7SA 4R85A 3MW7A 4L1GA 4KH2A 5C9XA 4AIUA 3WH5A 4WKHA 3WJZA 5L9FA 1KRBC 3LTPA 5DN1A 1P7TA 1P0EA 1V6TA 4MNJA 3C8NA 3DFQA 2ZX5A 1UZHA 1BAGA 2XIQA 4O19A 1YDVA 3F5LA 1FH9A 4D6IA 3TJLA 1V6VA 3TTYA 2PRMA 3FJ4A 5TF0A 2VEGA 2IQDA 3S47A 2PDJA 2WWDA 2XWEA 1NOUA 1IQ8A 4YCOA 1QOPA 3EKZA 5BXTA 3WLMA 4RL3A 4F4RA 3E2SA 3O0FA 1EYEA 3WNNA 1UQZA 3B9AA 1B5TA 1ECEA 4K1WA 1H49A 5FI8A 1X98A 3WENA 2YCJA 4UR9A 1XLAA 4LF1A 3L0NA 1W3HA 4YTSA 4FXSA 2AOSA 2CHOA 2PODA 3BARA 1Z7AA 3QN3A 5C55A 3DECA 2HPIA 3A4XA 3GS6A 3OLEA 4ORMA 1J12A 4GA8A 1P6BA 3WSUA 1R3YA 3FHAA 2KAUC 5T91A 4KWOA 2AL2A 4Z0JA 1UP3A 2JBMA 3USZA 3JZEA 2P3EA 5HMEA 4AX6A 2V63A 1R3VA 3MY9A 1JPMA 1FY6A 1E72M 3B8TA 3C8FA 4KKXA 3KBMA 4JCLA 3TQKA 2G3JA 4W5ZA 5XINA 1TR9A 1AQ0A 1DWAM 5DFAA 1C91A 3AYVA 3LU2A 2PSNA 3W1UA 4REQB 3AIRA 3TCSA 2Z6IA 1M68A 1YADA 3V1PA 4M56A 5A6SA 1ADDA 2FPVA 2XSXA 4X0VA 1KB3A 2PUZA 2QULA 3RMEA 2CZDA 4CCDA 2OGJA 1JQVA 1XYMA 3LRLA 1A5NC 2CBVA 4L6HA 4C1NA 2J13A 5FACA 2V9DA 3RJYA 4KW2A 3LHUA 1BVZA 1TPEA 3NTYA 2NZLA 4CD6A 3G1YA 1BD0A 3S1UA 1BYDA 1JIBA 3G0SA 2EXOA 3GXPA 4Q22A 3IJIA 5FEPA 2PBOA 4UMBA 4J27A 4Z1CA 3STEA 5EMMA 3PZIA 1US3A 2VZSA 3LZ3A 3U4FA 2EKCA 2ZA3A 3H7RA 3S5ZA 5EBUA 4NX0A 3RNDA 3FSTA 3GW0A 1H1ZA 1R8LA 3RGTA 1NQKA 3SCUA 3L4ZA 4JN6A 3TWBA 3VOHA 4IFKB 3BAXA 3WO8A 3DI1A 1RSCA 3VIHA 5AYIA 3THQA 2WW5A 1ZBWA 5I3KA 1VEOA 4ZODA 1KWGA 3U2OA 4R7WA 3HURA 4LNCA 2RKXA 1NU5A 2G4FA 1HZYA 1KXQA 4D6CA 3O07A 3C3UA 1E5JA 2DU2A 1HJSA 4DF1A 3O63A 1XSIA 3F2BA 3GVGA 4F0HA 1DIKA 2GQ8A 3WMSA 2XM1A 1QW8A 3GVQA 2VCBA 5DX7A 3QLDA 3H6OA 2JK2A 3AHVA 4LUSB 4YLWA 1Q85A 4H7VA 1ISZA 2DEPA 5EMYA 2Q6ZA 3BZJA 4IJCA 3KP1A 4XUYA 3AWOA 1SSGA 4PTXA 3AYRA 3AU2A 7XIMA 3ITYA 4LAMA 3GU9A 3TSBA 1FWDC 4UXDA 1WZAA 4ZXLA 2CU0A 2OQYA 1UWRA 4I6VA 3VZYA 1V08A 3GZ3A 2PDGA 3OLDA 4HYVA 4KFOA 3LCLA 3DHPA 5E1QA 1TV5A 4Q7BA 4NL1A 3EWCA 2HK1A 1GONA 3SADA 3M0VA 4C6CA 1RCXB 2YKKA 2Z00A 4HSHA 1TR1A 3V5CA 5LIXX 2MUCA 2NVAA 5J04A 1XIIA 4AEEA 3ORWA 1GVYA 2TPSA 1WUFA 1HKMA 4KETA 3BOXA 2CLMA 3S6OA 3HN3A 2XZ9A 3NG3A 5HWMA 4AIOA 3UZWA 3MZ2A 3N15A 2JIEA 3EWBX 2G50A 1UPPA 1V02A 2I5QA 4LEQA 5K9XA 3SQSA 4F2BA 3UJRA 2CZ5A 1O7AA 2FHCA 2A3EA 4W87A 3PB2A 3ZLFA 1EGZA 4HHHA 2WPBA 3VDGA 5FJIA 2EQDA 1HQTA 1Q6OA 3TQVA 4B5UA 2WMJA 4MIMA 3NURA 1GZ1A 4UFIA 5HOSA 1IEWA 5CPTA 3CU2A 3CAQA 4GG9A 4LTSA 5A2CA 5GJMA 3CWOX 3AJ7A 4GYJA 2P1FA 1VCFA 3B9NA 2F9RA 1ZQ5A 3PJWA 4LCRA 4O0QA 4U5IA 4UZSA 1XYBA 1V3LA 1B57A 4W84A 4I7VA 4O0ZA 2PPGA 4UUIA 3WLHA 1LCOA 4HNTA 4E4FA 3QGAC 3RN6A 2A79A 2JQXA 1XDMA 3FGCB 3KXQA 2BNJA 3W28A 1H7NA 3EYPA 1VHNA 4JPGA 4F0SA 4LY4A 2YCLA 2ADAA 2PD9A 1VEMA 1XG4A 3CL8A 3KM8A 5HQLA 3BMVA 4ATDA 3WL0A 2FZ8A 2FTPA 1ITUA 3E0LA 3EKLA 2QHAA 1KBIA 4DYKA 3M5YA 2PRHA 1A0EA 2OEKA 4A29A 1G67A 3KTCA 1UCWA 4GJ1A 4DY1A 1Q7QA 3O6CA 5D9NA 9XIAA 3OQ8A 3VINA 1H1YA 3IGUA 4O10A 1ZP4A 3W87A 3KW3A 5ABEA 4GIAA 4AC1X 3LCGA 1E71M 1FFRA 4MDPA 2I5GA 3LRKA 4EVZA 4H41A 4IGSA 3QF0A 4N02A 4NI8A 5C0QA 2GL5A 1PS9A 3GIPA 3FVDA 2QJIA 3HBLA 1HNYA 3VNIA 1GYNA 3BSGA 3E49A 4UFMA 4ZXOA 2LLEA 2V3FA 3R58A 4K6AA 4DM2A 4E8DA 2QCHA 4DLMA 1V3KA 4HA1A 3HF3A 4K3ZA 4XO7A 3V18A 3W84A 4M19A 2QDEA 1KM1A 3R11A 4H6RA 1S1PA 2W6RA 4H6EA 1W1YA 1TJ0A 1TKKA 3U7BA 3P6LA 3FN9A 4NXKA 1V7YA 4KEVA 3WNMA 1ENUA 4C1LA 3S2JA 4OT7A 1EJXC 3RM8A 4MAZA 2OEJA 4DWSD 3V0UA 3EWWA 1YNYA 3DXIA 4OUEA 2Z1BA 1FDZA 1KV8A 3I4EA 4B3KA 1F7BA 4Q4SA 2XSAA 4NQ1A 2IPFA 4RNJA 3TP4A 3DFHA 3WK1A 3PPGA 6REQB 2OZ0A 3PUGA 3NEVA 1W37A 4ZMGA 1ZB5A 1G1YA 3S2MA 2V0TA 4FHAA 3MDWA 3NPWA 1GPFA 3SI9A 2GGJA 2ZRUA 4L4LA 3RLVA 3NQAA 2J24A 4EXAA 2ON3A 4BWLA 1MEWA 3ARTA 4PMUA 5I6SA 2Z29A 4XBJA 2ALRA 3WLTA 4IG2B 2PWHA 3SY1A 3EPMA 4Z1YA 1QU4A 3MMWA 1XYZA 3EOSA 3W1AA 1OGBA 1YEYA 4Q3MA 3WNOA 3ID7A 1S38A 1U1HA 3AAMA 4O53A 1AFSA 1JF6A 5CZJA 3WLPA 1JZ2A 4PB5A 1MWOA 2X1IA 1MUWA 3LBCA 1JZ4A 2VQUA 2DT1A 1OB0A 2B0MA 4NJHA 3Q65A 3UPBA 1UUQA 1E0TA 4O15A 5DBTA 1TTPA 3NDZA 3GBDA 1W1ZA 1K77A 4K7YA 5E0CA 3EDDA 1BYAA 1E1CA 3B8IA 3N4EA 5HXMA 4GIYA 3WL1A 1RUSA 1OSEA 4FLSA 3ABRA 4S3DA 1R5YA 2ZZ4A 4UTHA 1SO3A 5KITA 4P7OA 1T0OA 3QZ6A 4N42A 2V68A 1ZU8A 1WAUA 3ZR6A 1JULA 4OQVA 3WBEA 4O4VA 1MMFA 3I7SA 1D3CA 3BLIA 3UWEA 1TV7A 3TZNA 3MC5A 4MM1A 4GI4A 1BWKA 2ISFA 1D8WA 4B2DA 3GDTA 2HS8A 3M0MA 5D8ZA 4OUIA 3VK5A 1FHLA 4NNAA 4B5VA 3EGJA 1K9TA 3W6MA 3GXTA 2CWXA 2PEVA 5AKQA 3L5AA 1DJIA 1MQQA 3AZTA 3V1HA 3HGJA 3RX3A 4BI6A 3RMJA 1BKHA 3QHOA 1HUVA 2E4TA 4OZOA 1YDOA 2ACRA 1M41A 2QCDB 3ERPA 2PDPA 1E51A 3OA5A 1FWEC 1Y7VA 4HZMA 2Q09A 4UNIA 1OVDA 2JGYA 1H7PA 1R9XA 4AEFA 2FZDA 2P53A 4MYAA 2OZ8A 1JVNA 4JY8A 1PJ9A 3AZSA 1R30A 1US0A 4JIQA 3SY8A 2OWCA 1JZ5A 3BLDA 4I9MA 3JUGA 1V51A 4MHBA 4QQ3A 4PFHA 5ABGA 1UR1A 3MI3A 3URAA 4Q8UA 2E6YA 1O95A 3LHWA 4M6UA 1HFBA 1UD5A 2OX1A 3TQ0A 3TW7A 1DOSA 1TQJA 4Y6GA 1E6XM 1KBKA 4UIOA 1RJQA 3NIYA 2ZA1A 1JGMA 3DERA 4IP5A 3W37A 1WZKA 4XVDA 5EA9A 4IJBA 8XIAA 2J7DA 1GZJA 3RK8A 5LIWX 1O5RA 5KZMA 5LGXA 1ZJBA 1RP9A 4DIAA 4TO8A 2PDWA 3PHAA 3VOGA 2NQJA 5BOFA 4I8YA 4C6BA 5LHFA 2VENA 3NZPA 2WQDA 5GNYA 3WELA 2Y88A 5CBJA 1MW0A 4XZBA 2C91A 3TW6A 5KSWA 1QNRA 2A4AA 4QXIA 2PDIA 4OFCA 4Q4KA 2WMIA 5D37A 4JD4A 1AH3A 1MI3A 4US5D 1SR9A 2W3ZA 2PB1A 3M07A 4QDWA 3AOFA 3THDA 4DLFA 4FI4A 1VIZA 1HKIA 3MKVA 4LH8A 3NZGA 1B2YA 3IJ6A 3R79A 5AC6A 1QMLA 3M5ZA 4L1XA 2PDYA 5FJPA 5TNVA 1EBHA 4ATWA 3TCEA 1CYGA 1Q4WA 2HEJA 5BOOA 3WQVA 2W67A 1KRAC 1QPOA 5KTLA 1HKVA 1B0IA 5A6BA 2L5HA 1UR9A 1F3EA 3IIOA 1S5TA 3H2CA 3VKJA 4O57A 2V69A 4EACA 2XH2A 3S6TA 2YYUA 3T8LA 1EJRC 2XVGA 4M51A 1RJPA 3N9KA 1XRFA 1DKWA 1YPFA 3K8LA 1XLEA 3DFSA 1LLWA 1GVIA 4XIAA 4FR6A 2NX1A 3ZYZA 1PIGA 3T09A 3QQ1A 5C9RA 3UCDA 4UQDA 3UNDA 4DJEC 1OFBA 2GVLA 1EKOA 3KEHA 4BCEA 1JCNA 4S1FA 3IVSA 2J7CA 3UQNA 3V0TA 5GVJA 3VCRA 3QTPA 4LUJA 4JTSA 4LSBA 2FQIA 2VC9A 3VC5A 1VBJA 1R3WA 4CQ9A 4AZIA 1WDPA 1BHGA 4Q6XA 2XDFA 1ZBCA 3TA9A 3ES7A 4N9DA 1UMYA 1UC5A 1L2QA 2Y61A 4JKKA 3U3HA 3AS2A 1J5SA 4HHMA 3G2GA 5D2WA 3W02A 1CGXA 1FX6A 3OLGA 3RO8A 2GK1B 5DMLA 3V36A 4FO4A 4MFDA 4IMGA 1QVBA 3A3XA 3AUOA 3T8QA 1PTAA 1BSIA 4N0RA 4QQUA 2E77A 2X1RA 5F4XA 3TR2A 3W24A 1FWFC 3IUIA 3E2VA 3I65A 2R1NA 1TWWA 4E8CA 3TWAA 4Q7NA 4C6NA 1QI4A 2YSWA 5GJPA 3L9CA 1AJ2A 5I06A 4HNOA 2EHHA 2DT0A 4FR1A 2QT3A 1TIWA 4ICCX 5E6ZA 4JTEA 3PULA 3VNDA 3WQ6A 5CZSA 3NQBA 1EJUC 1KTCA 4U2YA 1TWZA 2DDXA 4ZO6A 2QUTA 3TZFA 3WQCA 1EEPA 4QRNA 1J5TA 4UTWC 3KBNA 1W9VA 4HHPA 4Z2LA 1K4HA 1W6TA 4UTJA 2BODX 2IMRA 3PS7A 4Z2IA 2WZIA 2DQXA 3MVIA 3P14A 4QNWA 2QEZA 1AD1A 1R3QA 3QV6A 1Q45A 4K36A 3QFWA 2WANA 4E0CA 3QBUA 2NX3A 4Q4RA 1CENA 2WMGA 1A50A 1H0IA 2PI6A 3G8RA 3HG5A 4MZ1A 4RE0A 1DYSA 2J66A 1Q6LA 4O16A 2D20A 1SU5A 1XFBA 4TXEA 3VE7A 3S46A 2PP3A 5EYWA 2CLFA 2Y7GA 1VPQA 1WKFA 1TCDA 3GDKA 3WDRA 1SO6A 4DJFA 4GACA 4WOZA 1QNQA 3M4HA 4IQJA 3VGBA 3F5KA 4A4AA 4ZR8A 1P5BA 3TYEA 3CZGA 3O6YX 1EB3A 2E8ZA 3QHMA 3CXOA 3TNOA 4DB7A 3R25A 3W7OA 4ZO9A 4CQ8A 1PZ0A 3S83A 2Y62A 3E2RA 4AY1A 2WKLA 3W74A 4FOKA 4QISA 4X0NA 4GH1A 4S3KA 4KEUA 4DXXA 1NY1A 3PTQA 1KQYA 3PBWA 4AMCA 4M1RA 2ZADA 4ZB0A 3WDJA 1QK0A 4CEUC 1LL6A 1DWFM 2FHBA 1W3KA 3FY1A 3RXZA 3W1LA 1W1VA 2W61A 1R7OA 2YXXA 4BFAA 4IHCA 1RQEA 2Y7DA 2XFYA 1KWKA 4JQAA 4CD5A 1XI3A 1TQXA 4RE2A 4IMCA 3UXKA 4LV4A 1UH2A 1JI2A 3MWCA 3KOWA 4BY3A 2JF6A 4WQ6A 2FJKA 3R0DA 1FKXA 3L2LA 2ZUNA 3P2VA 5EFFA 1GOIA 1FDYA 2HSAA 1ESWA 4GO9A 4GVHA 3ZJKA 3HV8A 5BZAA 2MNRA 1JDAA 3M46A 1GVRA 1W2PA 4WY0A 4D6FA 2Y7FA 2VRQA 3FAWA 3POHA 2VURA 1CGVA 5HA7A 4O12A 3VXGA 3KWXA 4WDWA 1I6NA 2NSXA 4WDXA 4PUMA 1RD6A 3AMDA 3SRKA 4D71A 1EOMA 4LRTA 1SFJA 3BG9A 3MWAA 4H8VA 5CPMA 1BVWA 2VUNA 1DV7A 4B16A 1CEOA 1I1WA 2BV9A 3UJFA 2J9YA 1W9DM 1CLKA 4B90A 1R3RA 1T8QA 1HJVA 3AIVA 2WMFA 4Q8QA 4S38A 4UWMA 5HNUA 4PUDA 1C8XA 1ZZMA 4LUTA 2JIWA 4RDZA 4U10A 4MJ2A 4J2PA 3LGGA 1I2OA 3QZAA 2FZMA 1P1MA 2VRKA 3UW6A 3DHFA 4OHQA 2QW5A 2AKZA 2WC3A 3FW6A 5LNWA 3L0GA 2O55A 3PZNA 1A3XA 3KHJA 2XH0A 1OCBA 1WV2A 3CS2A 2ODOA 3ZWSA 3GR4A 1J0IA 3LXCA 5F1VA 3H4GA 1QRQA 3GU2A 3GDBA 3TOPA 1V93A 4JX5A 1NF0A 4DQWA 4H7CA 2PU1A 2R91A 4NUWA 3EEGA 3RM4A 1ZPTA 3GD6A 1EO7A 4GABA 3NDYA 1PL9A 2ZRZA 1OD8A 1NOWA 1EO5A 2BDQA 2BHUA 1POKA 1R86A 4AVFA 1DXFA 2DZUA 4PMVA 3W1PA 4QFUA 1E15A 4E8GA 3CMJA 4EWND 4J3WA 3KCLA 1EA9C 3OEXA 1ECQA 2NLYA 2I9EA 3JW7A 1P1XA 2XFRA 4A3HA 3W38A 4YU1A 4XD3A 1XKYA 4RPQA 3GTFA 2R1MA 3O06A 2X2YA 1XIMA 1IF2A 5REQA 3CAVA 4G2DA 4MMWA 1VH7A 5TD4A 2CLOA 3LXAA 5DMYA 3WH6A 1Q8AA 3WBXA 1PDYA 2RUSA 4I5UA 5JUVA 1MEIA 3LPFA 4I9AA 1R85A 4RJEA 3ZVHA 1RHCA 1VFTA 1HW6A 3SECA 3UXLA 1QOXA 4D6EA 3OYXA 3G5EA 9CGTA 1U2YA 5J8LA 2H9AB 2HWGA 4H1ZA 4ZQPA 3AXMA 2VEFA 4ASTA 3QV9A 1EJWC 4B5WA 3W7NA 2OKTA 5C6MA 1Y5WA 4L4MA 3HPAA 3GFXA 1QPKA 3LV5A 4AVOA 4UOQA 2BHZA 1LYXA 4F0KA 1Q66A 3LRMA 5FAGA 1YE4A 2Z6JA 4OJYA 2G96A 3TE9A 3I4KA 1ZAJA 4LANA 4HPJA 1ZUAX 1SSDA 2ANUA 4ZENA 3I10A 3D3FA 4QJ4B 3WJXA 2BBFA 3WQEA 1Z9AA 1A5CA 1TVNA 3PFRA 1EHAA 4O8AA 2QV5A 3W25A 4NX5A 4HD5A 2A7RA 1OK6A 4RNHA 4UTKA 4H9VA 2JF7A 2AGTA 3DG7A 1RBLA 1VRXA 4QS6A 4FOJA 3SCNA 3LEPA 3UERA 1QJWA 4AWSA 1F4AA 1LRTA 2VDHA 1QOQA 3P82A 3NQ8A 1O68A 2WKJA 1TWSA 1GQKA 2F6XA 1GG0A 4NNCA 1U83A 3B0YA 4DUVA 4JTRA 4JIIX 3SDOA 1GVOA 4QLLA 3SCVA 5HMDA 4PUJA 5CJMA 3RRXA 3VIJA 2G3MA 3SURA 4W86A 3NOYA 2XM2A 1OG6A 3TTEA 5EBAA 2VFHA 3EOEA 3VU2A 3T0CA 4Z2GA 1LBLA 2GSJA 2X0SA 4GH3A 1W1B1 3LM3A 1B1YA 2REQA 1VLWA 4LEFA 2NUXA 4EPKA 1VYPX 2NXHA 2YZRA 4C6PA 4WLCA 3REQA 4NYYA 4Z42C 4M5PA 1EF3A 3IAQA 4HNUA 1NH6A 1NVMA 4NY2A 4W8LA 3TJ4A 1Q7MA 4G1KA 1W9XA 4AYGA 1DWJM 4RE3A 3W2UA 1CECA 2OWXA 1EDQA 4R9XA 4CCZA 3THUA 4ZQMA 2ZZ7A 3LPPA 3DDMA 4X9SA 1R2TA 6CGTA 3QR0A 4PEKA 4BQ4A 1JUEA 1NIUA 1K9EA 4B5NA 3WDPP 3SIMA 1TJ2A 4CNPA 3M0JA 3Q37A 3UCQA 1F2JA 1VAHA 4JL2A 4M0XA 3CH0A 4A35A 4TX6A 4PCFA 4MDOA 3MUCA 2GJXA 2O9PA 3M0KA 3A9IA 3T4WA 3BTNA 3PPFA 5ABTA 4Y9PA 4IUGA 1KCZA 3WJYA 2EGZA 2VP8A 3ABQA 4PULA 3S5SA 1TTIA 2Y2WA 3SB0A 2WCSA 1JJKA 1JYNA 3LV6A 3LD5A 3SQMA 1SZRA 1Q3NA 1ZCOA 4JFVA 4RR4A 3VKCA 3G18A 3MV11 9XIMA 4XV0A 5CLWA 1TPC1 2Z1XA 5FEWA 4DI8A 5FSEC 5H2ZA 1UG6A 2E9LA 4J5NA 4GJIA 1DBTA 1ML1A 3DG6A 3GH7A 2WVVB 2I7GA 2PGWA 1VJIA 3WK3A 2ZVRA 2NX9A 3S42A 4Y7EA 3N11A 2UY4A 2BXZA 3DGBA 1WDDA 1J0YA 3N2CA 3Q4DA 3VD9A 1A80A 3TXVA 4ADTA 3VIPA 3ZWTA 4M80A 4EPDC 3T0TA 2YFNA 3HPZA 1MYRA 2EPMX 2QCEA 1IHIA 4DWSA 3NA8A 1S5WA 1M7PA 3FKKA 2DUZA 1G4PA 5I3HA 2Z2UA 2E67A 2EG6A 5MKGA 4QCFA 5F4SA 3E0IA 4MWAE 4F79A 3C4UA 5CGQA 3E02A 4N2YA 4JTIA 3WZ0E 2QGYA 1I2QA 2JGQA 4AFYA 4LBUA 3DH7A 3ITGA 4AZBA 2Z7GA 4UTIA 4N9CA 1Q6EA 2AGKA 3W1QA 2CLIA 3P67A 3WMLA 1E43A 1XBZA 2A21A 2G97A 3RPTA 2D24A 1EGMA 1KTNA 1MRQA 1W8GA 3VM5A 1ZLPA 2Q8LA 2FDMA 1T6MA 1JDEA 3F5JA 2AMXA 3KS6A 4IH3A 3E9AA 1WKEA 4Y9NA 3M6YA 1QO5A 4JL1A 1LQ0A 4ZO8A 4R34A 2DJLA 1NWUA 3GFZA 2YDSA 5G5IA 1GT8A 4R33A 2AKMA 5FEZA 3B0UX 1LF1A 2JKEA 3ECQA 1HVXA 4P8VA 4EWJA 1XR2A 1UR8A 3PN8A 4US6A 4ATLA 3KS5A 4XAPA 4HCHA 3APYA 3TYDA 5D09A 1B3YA 1VEPA 1ONRA 3QW4B 1YXCA 2ZIDA 1TPVA 1XFCA 4LYRA 2P50A 1JEZA 2YXOA 1WDSA 4H9ZA 3R10A 1JCJA 5FOOA 4W4QA 1VPYA 3S2NA 2WMKA 4JFSA 4BWLC 3PBYA 4WD0A 2W9MA 2TMDA 3BW3A 3II1A 4YTTA 1E9ZB 1K6AA 3PR2A 3CAKA 4E6MA 4TV6A 2B81A 3FDGA 1W9UA 3G1RA 4OIFA 4HA4A 3ZM8A 3DEQA 5AHFA 4FLRA 4M6QA 1CXHA 4JY9A 4IIBA 1G4EA 4W93A 3N2MA 3GYEA 4EAMA 1IIHA 2GYIA 2IUZA 2HZGA 4GKTA 3TN5A 2WMHA 1O5KA 3DBPA 5C7HA 4J3SA 1E0WA 1ZRQA 3TN6A 5I00A 3IK2A 1PWMA 1DXIA 3H2NA 5LNRA 3N18A 1CNVA 3CHVA 4XAYA 3BJSA 2OX4A 3VNMA 1XJBA 1FWHC 5A69A 4XAFA 1ZY9A 4X63A 1FHUA 3EZ4A 1OX5A 1IGSA 3VNYA 3AU6A 3GXMA 4QM1A 4KT2A 1I1XA 5CPOA 4JFWA 4G8TA 5K9CA 2EBNA 1REQB 1NQ6A 3UR2A 3AJXA 3WJWA 4Y96A 4GYFA 2D23A 2VDGA 1W1TA 2PLCA 3BMXA 1PPIA 4DWSB 3BPWA 3M1ZA 3NO1A 1XQLA 4HPXA 3CAWA 3AS3A 1OT1A 2WVTA 3U5YA 2CWNA 1MNZA 3OBEA 1R9YA 3OG2A 3VKBA 1PKMA 2E1DA 1BYBA 5DY3A 3MJYA 3FKRA 1P0DA 4RW5A 4ML4A 1ALDA 1B30A 4RZ4A 4WK9A 4IPPA 3KLLA 3L4UA 3U57A 2C18A 4NJIA 3EAUA 1ZNNA 4V33A 1EQPA 1UKQA 5FKYA 5ABFB 1Z6KA 1LG1A 3WF1A 2Z24A 3OZOA 4NZ4A 1GKRA 1XIJA 2VEKA 3DENA 5XIAA 4FZIA 1ONWA 5G1TA 5JVLA 1TJPA 1WA3A 2V67A 4AISA 1EQCA 1JFHA 3IEBA 4S3GA 3THCA 3ME3A 2D73A 4J40A 4HOXA 4PTNA 2DVUA 5FJOA 3GG7A 4ECLA 1XCXA 4AF0B 4TV5A 2J8TA 4LAOA 2E5CA 3ITVA 2OEMA 2Y70A 2NXGA 1BQGA 1UP2A 3NYDA 3IARA 3WBYA 1V3IA 6TAAA 1EIBA 5AHLA 5C8BB 1E3XA 4US5A 4PMNA 2CITA 2GVGA 3V5FA 1XRTA 3CTLA 4J3TA 5HQEA 3OA3A 1OT2A 4KWSA 4GX9A 2WPGA 4Q7IA 3UCCA 2OOGA 4L64A 3GG1A 3VAVA 2V5JA 4JFTA 3FJLA 4U4MA 3E6EA 8TIMA 2X1TA 3G1SA 4FOUA 1Q7ZA 3STPA 2YL6A 5A6JA 2ONEA 1R0MA 3CZEA 4K1GA 2BX7A 4O14A 4W8BA 4LYKA 1QR7A 3BAIA 1V8EA 3SCTA 5LYRA 1XH0A 3THAA 4F2TA 3M16A 2QVNA 2ZZ5A 4BZYA 2G0WA 5F1UA 1YDYA 1SM9A 3A6OA 1WOAA 5EKYA 4JGDA 3EA1A 2YL8A 2V2HA 3KOZA 5CEWA 3KE0A 3ARZA 4MB1A 4I5RA 1HL8A 3SUTA 1WKYA 1LORA 4IF2A 1UPMB 3G3MA 3CHCA 1EJ7L 1IXQA 1AL8A 4NIRA 1W5OA 1UKTA 5I3IA 3C2OA 1QNSA 4GUGA 2P5NA 3S5NA 3HG2A 4QAWA 2WSKA 1SZFA 3HQNA 3RHGA 2BLEA 1E9LA 4E2DA 3R94A 1LDCA 4MY8A 4C1KA 4B5XA 3L65A 1I2PA 3MPGA 2OLAA 2ZOXA 4B4FA 1UWTA 4XSMA 2XYLA 2WM0A 4R27A 3UYCA 5A2BA 4I8DA 3CUHA 2GUUA 5EU9A 3A5VA 4WSJA 3GLCA 3IRSA 4XISA 1HL2A 4M7SA 4QS5A 4Z1DA 4DO6A 5CAHA 2PDQA 1S46A 5JMUA 4AU0A 3Q94A 3VMOA 1MUMA 2QJGA 3V75A 1FWNA 4I6KA 4X2PA 2ZDSA 6PTDA 2PGEA 3MSGA 1QWKA 4MSSA 2CZVA 2XIMA 3VABA 3QPYA 1KNWA 2BFGA 4Z0SA 5J5RA 2IPJA 3CHFA 3S9ZA 1DJNA 1T41A 2VM8A 4YNGA 3QGKC 3BSMA 1UBPC 3P0XA 1SJDA 4KMQA 3CIXA 2P76A 1IT7A 2I9UA 4PRTA 1XW8A 3BLPX 4NJJA 4ONVA 3P7YA 2GWGA 3RR1A 1H51A 2ZUMA 3D3AA 2CYGA 4JTKA 3RO6A 1EIXA 3IRDA 3LSCA 3TSMA 2PA6A 1JPHA 1PTDA 4TTGA 2DPEA 1WAWA 1GQLA 1C90A 1KFLA 1RVKA 4LUYA 3B8WA 2POTA 1SR0A 1DP0A 1J0KA 2UY2A 1UJQA 1WDQA 1Z32X 4XVEA 2UZ9A 4LV9A 1QI2A 3SGGA 1V77A 3AS1A 1EP1A 1K02A 3CGTA 3GKFA 2BXVA 3GX9A 2C6QA 3V4BA 2FGLA 1PKYA 4L9ZA 4MF4A 6XIMA 2F8QA 4GC4A 3KOYA 3W2MA 2G8ZA 5ECUA 4KRZA 1P4CA 5T9CE 4PYSA 4JDYA 4IMEA 1A3HA 3OZPA 4C65A 1GGOA 4YWIA 2GGGA 2Y89A 3W26A 2OB3A 1XRVA 3BCJA 4C5ZA 3IV8A 1PB0A 2SFPA 4LVDA 5HR6A 4UR8A 4G6CA 1DQXA 3DFYA 5A8MA 3HMJG 2PCEA 2PP1A 5LHEA 1XCFA 4AD0A 4B15A 4CEXC 2C0HA 2YB1A 4ZFMA 4FPSA 2RJHA 4S39A 1I60A 2C1GA 2J74A 3CMGA 5D2VA 4DUXA 1K8CA 3DKLA 4GBDA 2TYSA 2HVMA 5CC7A 4Q6JA 3PZMA 1UKPA 1RAKA 4F9JA 3WD3A 1X1OA 2FJUB 3QW3A 3ARPA 1KKOA 5HWJA 3P81A 4YHGA 4AZCA 1W5PA 1CBGA 1O66A 3QH2A 1SYTA 4FNSA 3WEOA 1JQXA 3VCCA 3FX4A 1RK6A 4O1CA 2BOFX 5E6YA 3T0BA 3UYIA 4JTUA 3OGVA 4JKLA 5AHEA 1RVGA 1KXTA 4KWVA 4HNNA 4LW7A 2ZXAA 4C6MA 1J93A 5F2MA 3M41A 4ZTYA 2O0TA 3PC0A 4MG4A 4YPJA 4PCNA 4TUFA 4YCPA 4UOJA 3QHNA 3HIJA 3LLXA 4PZVA 5AVNA 1TV2A 1FXQA 2BGSA 4DZAA 3DGRA 1NP0A 4Z1BA <