1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
3VNKA 3VNLA 3UVAA 2XINA 2OU4A 3ITTA 3KCJA 4A8LA 3XISA 2QULA 3AYVA 4ZB5A 1XLJA 3CNYA 3XINA 2GLKA 4G56A 2I57A 3LMZA 3VYLA 1XLFA 4A8NA 2NQHA 1XIGA 5EMKA 1MNZA 1XICA 4X61A 4DVOA 1QTWA 2HCVA 5AVHA 1CLKA 1BXBA 3WQOA 2HK1A 3QXBA 1DIEA 3KBJA 4ZB2A 3P14A 3VNIA 4K3ZA 4X60A 5EMMA 3BZGA 3UXIA 2HK0A 3BANA 3M0HA 1XYBA 4XIAA 4A8RA 1DIDA 4HHLA 1BXCA 3GNXA 2G0WA 1XIEA 1XLGA 3ITLA 4EAYA 2X7VA 6XIAA 4US6A 3C0QA 4A8IA 2QUNA 1XIMA 4GJIA 3IUIA 3BZJA 9XIMA 1TZ9A 1OADA 1XYMA 4EACA 4OVXA 3KBWA 5C9ZA 3KBNA 1A0EA 4YTSA 2GVEA 4PFHA 3TC3A 3C0SA 3BWWA 2I56A 2XIMA 3KBSA 1XLDA 5H1WA 1XYAA 1A0CA 1XYLA 8XIAA 4HNOA 1XLKA 3QZAA 4W4QA 3TVAA 4ZB0A 1XIJA 1DE6A 3CQKA 3IUHA 4QE4A 4K1GA 4GJJA 3IUDA 5EMLA 4QE5A 5B7ZA 1XLMA 1D8WA 1I60A 3UA3A 2XISA 3UA4A 4HHMA 2X7WA 3OBEA 4QEEA 4XIMA 3CQJA 2NQ9A 4GQBA 5J8LA 5B7YA 3M0MA 2J6VA 2ZVRA 1QT1A 3VNJA 3KCLA 3AYTA 3CWHA 1XLIA 2NQJA 1GW9A 4YTRA 3FVMA 5I7GA 3KBVA 4XSLA 3L23A 4KW2A 7XIMA 1XLEA 1XYCA 4GLEA 3ITVA 2QW5A 1MUWA 3KBMA 4YTQA 2QUMA 3DX5A 3NGFA 3AALA 4QE1A 1I6NA 3DBNA 3M0YA 1XISA 3QC0A 5FA5A 6XIMA 1DXIA 1S5MA 5AVNA 3U0HA 2GYIA 2Q02A 4XSMA 3CQHA 2G4JA 3P6LA 1XIHA 1K77A 1XLHA 1XIIA 2ZDSA 3JU2A 9XIAA 3KTCA 2GUBA 1XLLA 4XKMA 5XINA 5H6HA 3U3HA 4Q7IA 1XIDA 3QYSA 1XIBA 1YX1A 4QDPA 3N4AA 5EMJA 4XISA 4PGLA 4YTTA 3UU0A 5XIAA 3ITYA 5B80A 4QEHA 4ZBCA 4E3VA 3C0LA 3M0LA 5TNVA 1O1HA 1DE5A 4LNCA 3XIMA 4YTUA 8XIMA 3M0XA 1QUMA 1XP3A 4HGXA 4J4KA 3KCOA 3VNMA 1XLAA 1XLBA 3AAMA 4DUOA 3BDKA 3ITXA 1XINA 3KWSA 3M0VA 4QDWA 4X63A 1XIFA 3CQIA 3ITOA 5XIMA 1A0DA 1XLCA 1S5NA
chains in the Genus database with same CATH superfamily
4AU0A 4LTSA 4J1OA 4Z1CA 3VKDA 3VX1A 3WLSA 4X2PA 5D2WA 1TRIA 1G01A 4MUZA 4BQ4A 3VOGA 1R85A 4MM1A 4NYYA 2X1TA 2IS7A 3TJLA 2YB4A 3UJSA 1XW8A 2VCBA 1HG3A 1RH9A 1E55A 3UPWA 2J79A 5AHEA 1B3OA 1WAWA 2ZX8A 3AWNA 3CZ8A 1M1BA 4F9JA 1W91A 4HJWA 3O15A 3E3HA 1KTCA 2GJXB 3WUFA 4BHYA 4PULA 3UETA 2PA6A 2VHLA 1J10A 1HT6A 3GBEA 2INEA 1J0YA 5K9XA 1VBUA 4GI6A 5T9CE 1VR6A 1GW9A 1ZAJA 1EB3A 1AD1A 4JTUA 2J9XA 3ARRA 2Z0IA 4IX0A 1UASA 3OW1A 3FKKA 3JRKA 2RUSA 3WH9A 5GNYA 2J4GA 5EFFA 2FMNA 2GZXA 3CYJA 3EMQA 3H8AA 5FJIA 2PDJA 4KESA 2XFYA 2Z1SA 3GD6A 4QNEA 1LQAA 4ORIA 3SBFA 1Z89A 3HZ3A 1E1CB 2BVTA 4JNYA 3R5EA 2UY2A 1GOMA 4GINA 1VIWA 1XBXA 2QIWA 4S3EA 1BVNP 4JZ5A 5MF5A 3T9PA 4TQTA 3U9IA 1A5CA 2V3DA 3A9BA 2OGYA 1M53A 5XIMA 4WIWA 3SFWA 2JEQA 4HNTA 4B16A 3G1HA 4BI5A 1ADDA 4JHZA 2DSZA 3W7RA 3AQUA 1XWYA 2PDUA 3KL0A 2YGYA 4S3JA 4FMVA 4W86A 4MWAA 1I8JA 2WKJA 1RHCA 2XIBA 5FACA 4GQRA 2PFHA 2DVTA 1OC6A 3BMVA 4JQAA 1YKWA 2IMRA 5HJYA 4NT0A 5KITA 3WUEA 4LBRA 3L4YA 3L0GA 1QVBA 4WKHA 4DZAA 3WMCA 3LQLA 5FKYA 4KWSA 3RPTA 4Q22A 1MW0A 4P8VA 1E4NA 1KB3A 1XIJA 3W71A 4QS6A 3EWUA 4GX9A 4K2SA 2GQ9A 4C1NA 3DOPA 2YFNA 2IXUA 1OFEA 3QW4B 2ISFA 3K8MA 2VZOA 3D47A 2EJAA 1JYWA 1M41A 3W7MA 3TN6A 3JW7A 5DELA 2XIJA 3OGVA 5G4HC 4AY1A 1HO4A 4EXAA 1FH8A 3E96A 1VLIA 5JBFA 3N04A 4HHPA 3C56A 4G1NA 1LBFA 4CCDA 1N55A 1C8QA 1V7YA 4HK5A 3L5AA 1VJZA 1OZQA 4UFMA 3VGGA 4DJEA 1UWUA 3WNLA 4NI3A 2F9RA 1IGSA 3TNBA 3ES8A 5TQLA 1EF2A 3GAYA 3KEHA 3ZIZA 2IPJA 5DQPA 1PIFA 2GLKA 5EB8A 1GUVA 3K8LA 2GDQA 5LNSA 3R79A 2VOTA 4XAYA 3NWRA 5AC7A 3RU8X 1P0EA 1V0LA 3BANA 1QNRA 1MW3A 1OJXA 3RIKA 2OOFA 4PE8A 5D37A 1K8YA 2P8BA 3LZ3A 4G9PA 5C8BB 1V6TA 3TQPA 3DI1A 4RE0A 2WNQA 1Z69A 1Q3NA 3CV2A 4G5DA 3G0XA 5DT7A 3U6WA 4WKFA 1DQWA 4C6JA 4CQBA 1R46A 4S3AA 3MW7A 3LG3A 1HW6A 1OFDA 2VUYA 3LUTA 3PTMA 4NAFA 3ZWSA 3GB6A 4EANA 2G3IA 3NZQA 2RHGA 1WE5A 3PZTA 4PBGA 3FJNA 3EOOA 3W7KA 2QXWA 3B9EA 2GVYA 4ADSA 1PSCA 2YCEA 2MNRA 3TE9A 2VI0A 3VD4A 2PB1A 4S3GA 3AI0A 4HSNA 5A6JA 4IFOA 3OG3A 1ZBVA 2FZMA 4GVFA 3L2IA 4MNLA 3T78A 1Y5VA 4WD0A 4XKYB 2NVCA 2PBGA 4IHCA 4BY3A 2X1RA 2YDSA 1Q63A 3GFXA 3URBA 3CUZA 3UZ5A 1IZKA 2HK0A 4U4MA 2VD8A 4AY8A 2UY4A 1W1IE 1VBJA 4DYEA 3HG4A 2F7FA 2PD5A 4NZ1A 1Q7MA 4Q33A 3GTIA 3U7BA 5H8PA 3MU7A 4AXKA 2XZ9A 4GYJA 4KH2A 3NJ3A 1N8FA 1FTXA 4JEJA 3M6DA 3MKCA 3L2MA 3CL8A 3UGVA 3A3HA 4IPPA 1V51A 3LV6A 5BU6A 3S5ZA 2ZRXA 4NXSA 3R7MA 3TYEA 2J74A 4IIGA 1BYCA 1J6OA 2QJHA 1E56A 1RQBA 1KTBA 4Q8WA 2VDIA 1LF1A 4XZ9A 3ID7A 2O7SA 4PA8A 1ONWA 4DAFA 1FWAC 1MXDA 4CQ9A 3TLQA 1KXVA 3MT1A 1LM1A 2CHOA 1JPHA 4M0XA 3OB8A 3W81A 1XLHA 3QMTA 1QJWA 5K4ZA 2J13A 1EOKA 2H8ZA 4NNAA 2IKIA 3SCPA 2QCNA 2BOGX 1MW2A 4Z1BA 3TA6A 1QNQA 4O57A 1BXNA 1KD0A 2E8YA 4Y9MA 3RN6A 4A29A 1PEZA 3BAKA 1HKVA 2OEMA 2D20A 3EEGA 4WOQA 2ZUTA 4GI4A 6TAAA 2A7RA 5AC5A 1ISXA 3VILA 4YIWA 1FWDC 2VQTA 3G1RA 1H60A 1KW1A 4JNMA 3LTSA 1ZQ5A 5CAKA 4Q6XA 4ZQCA 2XH7A 3UCDA 5C2XA 3TMQA 2HQAA 3MA8A 2NQLA 2NQZA 2G0WA 1UPPA 2QCLA 3M0JA 1YDNA 5BMXA 1Q6EA 1IZCA 5DX7A 1XPGA 2E0PA 4DBSA 3G6MA 3VKBA 4LS1A 3WYZA 5DFAA 1LBLA 1DWGM 3GC4A 1ZU8A 5FOOA 2D24A 1IEQA 3TVAA 4YVXA 4MJ4A 1SJAA 4PEKA 3UA4A 1WAUA 4GZJA 3CAQA 3UXAA 5DCEA 2WNZA 3HPZA 4UB9A 3RX3A 3W2UA 5I7GA 3REQA 1AQFA 2E5CA 1W2PA 3WLOA 4LH8A 3MKVA 4WCJA 2H9AB 5BW6A 3W85A 3ZLGA 1V7AA 4E2DA 2EKCA 4RR4A 5C2GA 2YA2A 1EPXA 5BXSA 2VEFA 4C7GA 2FPYA 3GZ3A 4D6EA 4A22A 3BE7A 3EA2A 1TIMA 1LUCA 2E09A 3GIYA 3W1XA 4TIMA 5A8OA 3N2XA 4N6FA 4G7EA 4O1AA 3ARTA 2EQDA 4UTWC 1QMLA 5U4NA 2PDGA 8A3HA 4PTMA 3BLKA 3WDJA 4QIUA 1CDGA 3KCJA 2QHAA 2DUAA 2X2YA 3WMBA 3WSUA 2BODX 5I00A 1F8IA 3VFLA 4LRSA 1A50A 1QFEA 3S9ZA 4L64A 3BLOA 2IQTA 1LROA 1UUQA 2DSKA 2F61A 5A6LA 1NDZA 5F4SA 2ZZ2A 1SO5A 5EMMA 3WF3A 1OF8A 2O56A 1N82A 3B8UA 1VD6A 3DUGA 1XIEA 1UWAA 2POZA 3GRIA 3W0KA 3CV7A 1PCKA 1JD9A 4EAYA 4CCZA 1NP0A 3RM8A 4G1KA 3BGGA 1MEHA 2V68A 2XIMA 3MHFA 3EKZA 1DJQA 3QC3A 4K1GA 4GMEA 3N2MA 1P6WA 3I6EA 1DXFA 2QJNA 4J3VA 1JJKA 4Q6JA 4YPJA 4HU3A 5G2WA 2ZZ7A 2I5QA 2WHMA 3L12A 1P6BA 3BC9A 1JZ2A 2ZRUA 4RK8A 1KBBA 5BCAA 1DXIA 1JZ6A 1QATA 4HTBA 1AMKA 3B0UX 3CM4A 1H0IA 1KCKA 1SFJA 4XKMA 4C6CA 4AD4A 3INPA 5CJMA 1ONEA 1M6JA 3N13A 1AH4A 4PMQA 2WW5A 4FP1A 2QCDA 4I3GA 3STEA 4PCSA 1X6NA 2XSXA 3IAQA 2QUUA 4QQUA 4JX4A 4KFPA 5EY5A 4GOAA 2VR5A 2WVUA 2WBGA 1M01A 1BF2A 1X97A 3FEQA 2HWGA 1VZWA 2V69A 1DQUA 3SGZA 4BZYA 1W1YA 3K4AA 4Q3MA 3EA3A 3W2MA 4EPDC 4DI8A 4F0MA 3H2EA 2ACRA 4JL1A 3S4TA 4K3ZA 3ABOA 4ERIA 3URQA 1R47A 1H1ZA 4H9VA 4FPSA 4FLRA 3ANYA 4XVDA 4MDPA 2ZRVA 5I3HA 3DCPA 3N9KA 3TROA 2DZAA 1VKFA 3RLVA 1DKWA 1KM3A 1XH0A 3I4KA 4OIFA 3PSWA 3GTXA 3VCRA 1ZAIA 1JXKA 1E0VA 1SUXA 3UR5A 2I9UA 4U2ZA 3TX9A 1A53A 2FFIA 3NNTA 2ZRWA 4L61A 2WKLA 1HNYA 3IGXA 3H2NA 4R7WA 3EXTA 3RPDA 1CXHA 5MHBA 5AVNA 5AHMA 3F03K 1JCYA 1UWTA 3SSJA 3T7VA 1EJXC 2Q3RA 4JQ3A 1XLLA 5LIWX 3A4WA 1K03A 3LHTA 1TJPA 4JQ4A 3C5QA 4AHPA 3W2NA 3CPUA 3QY6A 1EP3A 7REQB 1TG7A 3STGA 4DJED 8CGTA 4AIUA 2DT0A 1ME8A 3GH4A 3OA3A 1BGAA 3SRKA 3OEXA 4GGBA 2PS2A 2WMHA 5D2XA 1JL8A 1BYAA 1Q6OA 1UR2A 4V1XA 1R2SA 3USZA 2ZX7A 3SCNA 3V1HA 5LGZA 3TTEA 3T8LA 4Y7EA 2HDJA 3FXYA 3OVGA 1TVNA 3VGHA 5ABFB 4Q4SA 5F2MA 3W7HA 3QGKC 4UFKA 4IOTA 4F0RA 2WJDA 4JTRA 3VMPA 3TZFA 2ZX9A 4WUIA 4DX3A 2BFGA 2Z28A 4NI8A 4DXXA 1LWIA 1VEMA 2X42A 4QP0A 4O11A 3WD4A 4KS0A 2AQOA 2I56A 3P81A 4OOUA 1P0DA 3TSBA 3QSTA 1QWGA 3BW3A 7A3HA 5EPDA 1EDGA 4UQEA 5FIPA 4UCFA 1YYAA 3IRDA 5E6YA 2DJLA 2ISSA 4IPLA 4GCXA 3OOQA 3CV1A 4UNIA 2PGFA 4PUMA 1B5TA 4FOUA 2A0NA 3P6LA 3VI2A 3T4CA 1TMQA 3RAOA 3CL6A 1GHSA 1UP2A 2Z2AA 3N4AA 1OINA 3Q4DA 1JUBA 2H3BA 2PDIA 5G5IA 1TPB1 4X9YA 4DWSB 3ABQA 3GZAA 4AZ6A 3A13A 3KDOA 1Z44A 1TUFA 4C6DA 3HURA 4G6CA 4ACZB 2PWEA 5FAGA 3M43A 4J3XA 4DM1A 5CLWA 4DUWA 1RV8A 3P14A 4CD7A 3UF9A 1R3VA 3U57A 4YHGA 3S1XA 4LF2A 5HMSA 4LU0A 3DKLA 4LUSA 4GHRA 1EYWA 3OQEA 2ALRA 4UTWA 3PNUA 1LYXA 2J7DA 3ZM8A 4NX5A 5FL1A 2OKOA 3MZ2A 5LXXA 2W27A 2VOMA 5IOBA 4BCEA 3SCQA 3C2RA 3B9OA 1UZHA 1GVSA 5JIPA 1IEIA 1FBAA 3UERA 4H9UA 1H63A 3KVMA 3GVGA 1M3UA 3M07A 4FLQA 2BWGA 3GDMA 1JYXA 4KWVA 1TX0A 2E28A 3LCLA 5M2FX 3P62A 3GH7A 4P7LA 2R1PA 3B0PA 4D6HA 1DJXA 4KEUA 3E1F1 4JTGA 4BEQA 4KCVA 1GQNA 1NOFA 1Q2RA 3DHUA 4E4UA 4ICMA 1RY8A 1KXQA 3PZIA 3P61A 1DXEA 2PP0A 1SR9A 3GTHA 1W9XA 3WLQA 5CZJA 1XLCA 3PPCA 4PMNA 4MG4A 4LGXA 2AGTA 1JDDA 3M0KA 2GSJA 5HOSA 1VC4A 1WZMA 4DO6A 3LI0A 1QO5A 3DHFA 2CBVA 5AB3A 3QF0A 4FXFA 2YW3A 5HNTA 2Z1WA 2PUZA 3C8FA 4PC8A 1QNSA 4PSRA 3GXMA 3K1DA 3NPUA 1MXSA 1KM1A 2E6DA 1W56A 1EJVC 3GVRA 2VMFA 2ZOXA 1OC7A 2XWEA 4TTUA 1ZZMA 1HGWA 4RLIA 3UVIA 2JIEA 2YR1A 2FZ8A 5REQB 3EA1A 1CGYA 3R2GA 2Y8KA 2PDYA 3FGCB 4U33A 1YPFA 1K7FA 1IE7C 1IT8A 3KVKA 1HZYA 4LCRA 1GQKA 4H1ZA 5E70A 1T41A 4E5TA 3EWYA 3QFWA 3BG3A 4H9YA 5CC5A 1XYFA 3ECQA 3WBYA 3LMYA 4F8XA 1V3HA 1CXKA 3SADA 3KS5A 4YL2A 4RDWA 3HN3A 3ITXA 2NZLA 1JGMA 3QMSA 1H5YA 3WF2A 3F2BA 4MJMA 1ZRQA 3FW6A 4AZCA 3S1UA 4JYEA 5HNRA 2PLJA 4MKVA 2Z2BA 3EYPA 2DH3A 1QU4A 1B90A 3VE7A 4I9JA 3JS3A 5DRIA 2W5FA 5C7VA 4FOKA 1ZENA 4IUGA 4IIHA 3HGSA 4JFSA 3FA5A 3STCA 4GXMA 4ZZ9A 4TVCA 3CUJA 4DEFA 1GJPA 3BSHA 4MY8A 4C65A 1XF0A 5I79A 2ZZ4A 1UMYA 4WJXA 4GH1A 4M56A 3VKCA 2WM0A 1E0TA 3OBKA 3V1PA 3K5XA 3KBSA 4YYCA 2Y8UA 3LCFA 3Q58A 3L4UA 1VPQA 3GVQA 1K1DA 2DP3A 4FNSA 4GRSA 4HA0A 3WQCA 1IXQA 2OLSA 1XRFA 2ZX6A 4FNRA 1J0ZA 3EZ4A 4RW3A 3LHZA 4LW7A 3ZVIA 3TUUA 1GKQA 1E6SM 1JFHA 1QNPA 4S2CA 4S3BA 2NV9A 3TONA 4O54A 4LYKA 3BTNA 3FIGA 2ZFAA 5D32A 4LBUA 1XISA 3TWBA 1F76A 3ZR4A 2VRKA 4IFKA 4A6GA 2FIQA 3LSCA 1KM2A 3FSTA 1W1ZA 3BCDA 4ZOCA 4ERGA 1X6UA 3ZS4A 2ZZ6A 2XIOA 1DE5A 4OWGA 4ICNA 2NX1A 1GOOA 1W3TA 4WY0F 1SMDA 4DUOA 2XIIA 3KRUA 3GIPA 2OU4A 2V5KA 1MDRA 4RNIA 3V36A 2V3EA 3BCFA 1MNZA 4WZHA 2OYLA 5DN1A 3LD5A 5FJPA 3TJXA 1HGYA 4HBKA 1F3XA 1I9CB 1FFRA 2CLFA 4IFKB 1CW2A 4JTSA 1A5SA 3BAYA 2REQA 5I3DA 1JYNA 3QY8A 4K8HA 3DI0A 4FF5A 5E9AA 2J27A 2GQ3A 4F48A 4L9ZA 3QPEA 1XYZA 4W93A 2J7CA 1OCJA 4JICA 2QNEA 4LS0A 3D5HA 4DZIA 3E9AA 4WOZA 1E0XA 3WBEA 3UZWA 3KCLA 4YTRA 1UA7A 4ZTXA 2G50A 2PGRA 3KBVA 2PU1A 4AZHA 4KWWA 2YZ5A 2XZ7A 3B8WA 2CCRA 3QH2A 2PWGA 1SZGA 1WV2A 5DXXA 1ECQA 1QCWA 2G4JA 2IKHA 3S2JA 3DFTA 3T8QA 4CNNA 2NQ5A 1V8EA 3B8IA 1V0MA 4V15A 4ADUA 2H6RA 3C2OA 3N25A 4IGSA 4XD3A 1SW3A 4CU7A 1VQTA 3G1FA 4AW7A 1O68A 2IUZA 3PJUA 4I8YA 3SCOA 1B9BA 3KCOA 3AAMA 4I5UA 4W85A 3GY1A 3W2LA 1OFPA 3GHUA 1JYVA 3WIJA 3I7QA 4Q4KA 5I23A 4FNTA 1FWRA 2DIJA 3VDGA 1UP0A 1EC9A 4A3HA 4O1EA 1MUCA 3AU6A 1LOLA 1R5YA 3PBWA 4AF0A 2ZZ5A 2HCVA 4KEVA 5KZDA 2DVXA 4QSHA 3TZNA 4RL3A 4B4FA 1XC6A 5CZ0A 3BZGA 4OT7A 2PTZA 1TPFA 3GNXA 1T0OA 3KWXA 4CKQA 4X0VA 3CT7A 1YEYA 1UZ4A 2ZADA 1YADA 4GQQA 2X40A 3VNDA 1Q13A 4HK6A 2JALA 4JDYA 2HXTA 3PJTA 4UNKA 1MNSA 4QE5A 3N19B 3S5OA 5HINA 2NVAA 3SRDA 2QCFA 2J78A 2ASHA 3F5LA 3W7EA 1D2KA 3KLKA 2ZUNA 1GORA 3S6DA 1TPWA 4PTDA 1BFNA 3MJMA 3QV6A 3VGFA 2BS9A 4IP4A 3MUIA 4NAEB 2BXVA 1NDWA 3RFAA 3ZJKA 3WQWA 3M5YA 4YTTA 4XAFA 1R7OA 5EFDA 3VIHA 3BV4A 3FVDA 4X3ZA 1Q2SA 1W37A 3TCSA 4JTTA 1QUMA 2A7PA 2FFCA 3G3DA 4DO7A 2Y7FA 2YIHA 4QDWA 4UIOA 3IIXA 4JTFA 4EF9A 4UMBA 4UTTC 1W9DM 2NT1A 2FVLA 3FXGA 5U7SA 3H55A 4M7SA 3MYOA 4HZ6A 3W6YA 1E6QM 3MO4A 4L9XA 3N11A 4IGHA 4O8AA 1KGWA 4Q8PA 3DU0A 4UR7A 1A5AA 4B2DA 3CAKA 3DERA 3BLDA 1KGXA 4O53A 1B54A 4NJKA 4PTWA 3WD2A 3T44A 3GG0A 4Z42C 1ZJHA 2A3HA 3TC3A 1G9HA 3H2AA 1P7TA 1UYQA 2VYOA 3SQMA 4Y6GA 3PZ9A 4V28A 4XAGA 1EDQA 3UG3A 2CBJA 3IPWA 4DN1A 1JCXA 2OYMA 4AH7A 1US2A 4REQA 5EGRA 5HWMA 5FAJA 2Q8ZA 1G94A 2J25A 2Y7GA 1UUOA 2C6QA 4HU4A 4LRTA 1LLZA 2HE5A 3UZXA 3QC0A 3NQEA 4S3KA 1PTAA 3QY7A 4ENLA 1EC7A 3BOXA 3TYDA 2XFRA 4MPKA 5G4EA 1UR0A 3GYCA 3M9YA 2IQ0A 6ALDA 4IM4A 1DP0A 4ZMGA 1T7LA 2VT0A 1VP5A 3M5VA 1NTHA 5CGQA 1LT8A 2OT1A 4HNUA 3TNOA 4M6VA 3RM9A 2Y0FA 1UD4A 1XLAA 4REQB 1O5QA 3ITGA 3IAPA 2DUZA 1LDCA 1C90A 1Q4WA 4PTVA 1QBAA 2R1MA 3ZJ8A 1NFBA 3BVJA 2ISDA 2VP8A 2QGHA 1PUDA 3TH6A 1UQZA 3WZ0E 1G4SA 1AMYA 1POJA 3PAJA 3EWXA 4JTHA 1J0KA 1OF6A 3RM4A 3UYIA 4P2VA 3WDRA 2NX9A 4RW5A 3GFYA 4WXYA 4O0KA 5E0CA 3R8GA 2DQWA 6A3HA 5GJMA 1WUEA 4IJCA 1LTDA 3MZNA 1GOXA 1GEQA 2PGEA 3C2EA 1UZDA 2NX3A 2ZZ3A 1XRTA 1WKEA 1YBQA 5K4XA 3VMNA 1F4HA 2VELA 3KZPA 3MSRA 5EBUA 1CXFA 1QNVA 4DLMA 3IIOA 4O28A 1RA0A 1PJ9A 2GUUA 1AH3A 4B5VA 1Q6RA 2FZDA 4ONVA 6XIMA 1YNYA 4UZSA 3CQHA 3GNOA 3RMJA 3NFUA 2CETA 3GKFA 2ZE3A 1FCUA 1OFAA 2VCCA 2W79A 3UNDA 2NW0A 4DO4A 4R7OA 1JD7A 3SN4A 3WJWA 2PLKA 1CBGA 3O63A 4HGXA 1GZJA 1RXOB 2QQ6A 2EPOA 2JK2A 4IG2A 1SW0A 1RVKA 3OZPA 4RUBA 2QCEA 2FMOA 3S9IA 3AXKA 3WLNA 4WQ6A 1EDTA 3K8KA 3CPGA 2EKGA 4DVOA 1XD1A 4B3ZA 4UCGA 3NO5A 1IEWA 4PTXA 2HJPA 1HJXA 1X8FA 4M6PA 1V93A 4GBUA 2VGBA 4CNOA 1BHGA 1F61A 2QIIA 1TKKA 4IGNA 1IR2A 5GQBA 2B81A 1YTKA 4JFUA 3UP8A 3MBDA 3DKJA 2VFGA 1TUXA 5F4WA 3OLEA 3LHVA 1XYAA 4UTUA 3CZEA 3ARXA 4QJ4B 3B8VA 1LQ2A 4R27A 4ZB0A 3N4FA 2WMIB 3RCMA 1HL2A 2GVLA 4DRSA 3HG3A 5J8LA 3DFSA 1V6YA 1S2WA 1M68A 3G77A 3LRMA 3T40A 1W3KA 4ZOBA 1A5NC 3H4XA 4Y9AA 3QBUA 3MV01 2A3LA 3NQAA 3W7IA 3HV8A 3T42A 4H3DA 1A5LC 3QV8A 1C8VA 3IEBA 4OUEA 3EB3A 3F7JA 3HMCA 5C55A 5PTDA 1ZB5A 1T99A 4TV6A 3CLMA 3VUSA 4FX8A 2EBNA 3I7SA 3WQEA 3CTTA 3M41A 4N7QA 3NL6A 2GK1B 1EL3A 2FZBA 3OA5A 1XINA 1OCQA 4HVXA 4MB1A 3USBA 3UVAA 1HVQA 1ZBKA 1VPXA 4BQ3A 5D04C 1ZBWA 3HGOA 2O9RA 1NWUA 4JAWA 3WEMA 1CXEA 3VFCA 4D1IA 1X1NA 5I5RA 1PXGA 1XGZA 2AAMA 2BVWA 3MPGA 3UCQA 4RV8A 4X60A 3PFRA 1MQQA 1EA0A 1E72M 2XM1A 4US5A 3VO0A 3PSVA 3LI1A 4YS1A 4JTCA 1PCWA 2EEXA 4F0LA 2R14A 3VD7A 5C9ZA 2TPSA 3VIKA 1VLWA 3LLXA 4UTTA 1EHNA 1AW5A 4ROQA 3TR2A 2TODA 2QJIA 2YCJA 3WENA 3BAJA 3CAWA 1D3GA 2FVMA 3UG4A 3BAIA 1KFBA 3VD9A 2VJXA 3C52A 1RP9A 5FF3A 2E9MA 4AHOA 1CLVA 3FHAA 3WG6A 1JAKA 3ZVHB 2AKMA 2PDMA 2CXEA 1NOWA 3H2FA 4JEQA 3WK2A 4ZODA 2I16A 2Z1BA 1LRNA 1F3TA 1TB3A 4C91A 3W4RA 1WDPA 4KF1A 1TREA 3N73A 1ZBCA 2OWCA 3OPSA 2PWFA 4ZBCA 5A8QA 5D2VA 1TELA 3H12A 4QR6A 4TR9A 4GWEA 1VIZA 5AKQA 1MRQA 4JY9A 2OB3A 4HU0A 4XZIA 4AEFA 2WSQA 4EIVA 1T8XA 2FQIA 4G8TA 3AYVA 1LRQA 1P0KA 3NVDA 4DBDA 4P7RA 5AYIA 4CNTA 4M6QA 4FSAA 2CYGA 4NZ3A 1K9EA 4GCAA 1LCOA 1CGTA 3RPMA 1THFD 3GXPA 3GX9A 5H8UA 2YA1A 2V8ZA 4GKLA 4NIRA 3B40A 1U2YA 3SCUA 1CGUA 1B4KA 1FXPA 1LWJA 4YTSA 5ABEA 3DYOA 4GZIA 1OYAA 2WWDA 4EXQA 2A4AA 1AK5A 3NL5A 4KERA 4B15A 4IZGA 2BP1A 5KETA 5E6ZA 2P10A 3SM0A 1UC5A 1KBLA 4IGMA 2FH8A 1L0PA 3Q94A 4OQVA 4GKTA 1MMFA 1WKYA 5CBIA 1OD0A 4H4IA 2ZBTA 1UH4A 3FVMA 1XQLA 2PTYA 2OWWA 3PPFA 2V2CA 1O66A 3MMTA 1S5MA 3CXOA 1RAKA 1S2UA 3UJEA 3GXFA 5AZ0A 3P60A 4AUBA 1SZFA 2JEPA 2I17A 4PL1A 3UJFA 1PV8A 3NUKA 4POCA 1TQJA 2W62A 3KOXA 3GUWA 4XVEA 3CEPA 1RVGA 3UPBA 1PYMA 3QHNA 1DTUA 3WQGA 4CLMA 1XQKA 3QRHA 1AUSL 3FA4A 2WOQA 3ZWTA 4JGDA 4H7ZA 3KDNA 4UTKA 1H7XA 2PZ0A 5AOUA 4V1YA 7ENLA 5LNUA 1OGSA 2ZRYA 5D9MA 1BTMA 2HMCA 1JPKA 3DGRA 4B2DD 4E2OA 3V4BA 5CH9A 4A8IA 4AMCA 4ZOAA 2PF0A 4TU1A 3W29A 3HO8A 2DV0A 3OODA 1PBGA 1QASA 4WR3A 4L6HA 4MB5A 1CB2A 3WMLA 2V5DA 3G1DA 4QITA 2X0SA 2AMXA 3IANA 4Q8MA 1TTQA 1XFBA 1O6IA 1AL7A 5B7YA 3K13A 4GUHA 3HB9A 2PU0A 3CWHA 2OG9A 3PC0A 5HJLA 4PMOA 3GYEA 4U5IA 1HIZA 5E0KA 3IJ7A 2C19A 4B3LA 1TX2A 1W0MA 3DEQA 1YDYA 4N9CA 5KINA 4HN4A 2OYKA 3L5MA 4LAZA 3CEUA 1DHPA 3QPYA 3XIMA 3KHDA 2PLCA 3IK4A 4UQAA 3ABSA 1Y0EA 3SCTA 3KRBA 2B7NA 2XINA 2J6XA 2WZIA 4RNJA 1RLCL 3UZYA 2A3EA 4GC3A 4GJ1A 4JIQA 2VENA 3ARWA 3PP7A 1PZ1A 4DAIA 4KETA 5HWNA 5HAOA 4LX4A 2TSYA 1G4EA 4H8NA 1VYSX 2VX7A 1E9YB 1V6WA 5ECUA 1TV5A 1Y7VA 1KBIA 4W89A 3R6IA 5C9UA 5KZEA 3BXWA 4HIBA 1M7XA 3PTDA 4Q7NA 3S8HA 2P88A 4HHHA 1KR0A 4TTGA 5C2CA 3AXXA 1TE1A 3R89A 2QPUA 2OQHA 4IL0A 1M9HA 3AYTA 3TWAA 1WYIA 4OHQA 3R10A 2RGLA 1WXZA 3WLRA 1EX1A 4HNVA 1DWJM 3FCPA 3ZOAA 1I2QA 4RV3A 3URAA 3CIXA 5H6HA 2PCQA 3NCOA 3C2FA 4QDPA 5CSRA 4IF2A 1HX0A 4M7TA 2I1OA 5DMMA 4YTUA 3GR4A 2V30A 5A69A 1BEUA 1W1B1 3MI6A 4MF4A 2A3BA 3W7CA 4OZOA 3U2OA 4AAJA 3OVRA 4WDUA 1PTDA 3BLFA 3OVPA 2OT0A 3PZOA 1PB0A 2RJHA 3PWIA 4XZMX 2W67A 2ON3A 1V77A 2OPJA 2NT0A 4NHVA 1OGGA 4JTAA 4OTKA 3A24A 2PF8A 2E6FA 1IWBA 3PZMA 3ARPA 4I8DA 1AL8A 2ZTJA 2ZVIA 3D0CA 1F8MA 3U7VA 2GJLA 5GNXA 1K6AA 2GVEA 3PZQA 4GO9A 4PFHA 1FKXA 1U1HA 4HT3A 4D72A 3PBVA 4C6EA 1IEXA 1ZSXA 1UPMB 3N34A 2HRWA 4M1RA 4QM1A 1WDRA 4PMYA 3PUEA 2ISVA 1TTJA 2CC0A 1BVZA 1E6PA 1SO4A 3OHMB 1EUAA 4E2BA 1GQIA 2VWTA 3VIGA 2C79A 2ZQ0A 5JXQA 1E6XM 2F8QA 3GTFA 3B04A 4JKKA 3HQOA 1W5MA 4OOZA 4EE9A 3SY5A 2YA0A 4YU1A 3A3WA 2PTWA 3GTNA 3M0LA 2YLAA 3ZJ7A 4MKSA 5A8PA 4C7FA 2QV5A 2ZA1A 3EB4A 5HBFA 3ONCA 1B2YA 4WY0B 5I3GA 4ASTA 2XTKA 2WXDM 2YCIX 3H21A 1EP2A 1TZZA 4H7VA 2OX4A 4JIRA 1VCVA 4GIAA 3LGGA 3T08A 2QLYA 2OTDA 3QVQA 3AU2A 6REQB 2DFAA 4Z2HA 4JBRA 4GABA 1PWLA 1FWBC 4R88A 5I2UA 4OJYA 4W5ZA 4US5D 3H7UA 4LEFA 4QBXA 3A5VA 4Z08A 3E0FA 3KBWA 1LORA 1YQ2A 5A2BA 4LVBA 1BKSA 5LXEA 5M1TA 4GISA 3TA9A 4JNZA 5HJXA 1GPFA 1W3HA 4UOJA 3WMSA 1RBLA 3RXZA 3IVSA 1NELA 4RZBA 4MNKA 4GBDA 1UCWA 3WJYA 2XGZA 1AFSA 3EGJA 4BK9A 1R9ZA 3LHUA 4LUIA 1XC4A 1LL7A 2YBVA 1R7AA 4RE4A 1EIBA 3O6AA 1QI4A 1KRAC 4N0RA 1KKRA 1LRTA 1V3JA 3NSMA 2VVNA 3GDTA 4MY9A 2Q6ZA 1GK8A 3NQVA 5H2ZA 1LP6A 1DWIM 3GK0A 4H8UA 3NG3A 1FWNA 3ABRA 3T07A 4Z2JA 1WQ5A 4L1WA 5K3VA 3KS6A 1I1WA 4UTFA 4Z0SA 3Q37A 1KM4A 1PYFA 5CKSA 1YNPA 5L9FA 4G56A 1V3IA 3TYBA 2A79A 2ZXQA 2YL9A 1S5VA 4NF7A 2OLHA 3N29A 1TSIA 3LZ5A 4J3WA 3ZMRA 3H2OA 5HATA 3K30A 2E5DA 1VFFA 3UFYA 4MMWA 1OC5A 4PUDA 3CV6A 3HG5A 2R1LA 1RUSA 4K6AA 3C0QA 2CZFA 1B3YA 3AS2A 1J8VA 1JDFA 3I4EA 3D3FA 3AMCA 2W3ZA 4JOMA 3W1UA 2EPLX 4JTIA 3IUHA 3TYUA 4LOCA 1ICQA 2QCCA 3WF4A 2PE4A 4WX2A 3TTOA 1KTNA 3M0MA 3JZUA 4ZA0A 4ERAA 4FXRA 1QR7A 4O16A 3WQDA 4KRUA 2FHFA 1ITQA 1E71M 3URNA 5JH2A 1K8XA 1J4EA 4PGLA 1IXNA 2FGLA 2KZHA 6ENLA 2Y62A 3VGDA 1V08A 3P5YA 1FXQA 1TV2A 5LA1A 3EAUA 1JDEA 1MVYA 1OX6A 1TTPA 1J79A 2E9BA 5CLTA 4PUUA 2IKJA 5I03A 2GVJA 2OLAA 2GQAA 2HROA 2I57A 2WZMA 3PWAA 5JBEA 1QRQA 5HK4A 3SN1A 4V33A 1GOWA 3P84A 1A80A 5LNVA 3KTSA 5BNKA 3O0KA 1H7PA 4G2DA 3V0TA 8TIMA 1JRBA 1Z7AA 1ISVA 3K4WA 1QPRA 3N9RA 5C9RA 3CQ0A 2JFEX 4QJ5B 2C0HA 1FOBA 1SPQA 3BSGA 5ABHA 1L8PA 3STFA 2E4TA 2VO5A 2GL5A 3MSDA 3THAA 3OBEA 4FB7A 2ZWYA 3VINA 1M7OA 2VDHA 3BOLA 4FNPA 3HG2A 4HMCA 1SMAA 1FQ0A 3HV9A 3ITVA 1H0GA 1ZCCA 6CGTA 4DELA 3QEZA 1A5UA 4XTDA 4XZBA 2Y85A 1IZJA 1XIIA 3AHZA 1FUYA 1Y65A 3TU9A 2I5GA 2QVHA 3PNZA 1LJYA 1UH3A 2OZ8A 5CGTA 4ZO9A 2BHYA 4MZ8A 3UXKA 1H51A 1W17A 4OBSA 5CPQA 1F3WA 2J75A 3WD0A 3THUA 1V79A 1R2TA 4IUOA 3A12A 4LUTA 3R13A 1KNWA 3SCWA 2XGIA 3LBMA 3G8EA 1XSKA 5F7UA 2ATSA 1OIFA 1W8SA 2Z00A 4AISA 1XYBA 2XN1A 3RO8A 1FHUA 2DPEA 3SFKA 1JPMA 4D2JA 3RF9A 3O6CA 1NQ6A 2BASA 5A1AA 3G18A 2DSUA 3KBNA 2WCAA 1PE1A 2VZSA 1A49A 3UXDA 2WB5A 5TAOA 2NUWA 3FJ4A 3IIVA 2E6AA 4H9TA 4QE4A 2J9YA 1GG0A 5BRQA 2OSWA 3OU8A 2NQJA 1YLVA 2EAWA 5IRPA 2CLPA 2ZIDA 3JZEA 1K70A 1PHQA 4F79A 2DZSA 2B7QA 1Z42A 2NUXA 4GNVA 4KQNA 3LLFA 5A6AA 3QJAA 2AL2A 2ISWA 1PKMA 5CG0A 3TTQA 3F5KA 2YKKA 5AC4A 3CHCA 3CZJA 3GU9A 3NQDA 1VRDA 4LY4A 4GE8A 1ZUAX 1BGGA 4J4KA 1Q6LA 3AHXA 1LWHA 3BDKA 3NQ2A 1GVRA 3LOTA 1Q8JA 2PPGA 3GHSA 1XLJA 2I7GA 3PZVA 3TK7A 1E9IA 3LCWA 1DJGA 1IWAA 3QN3A 4HCDA 1X7FA 3HGJA 3APTA 2ZRZA 4K7VA 1EPVA 4EVZA 2QMKA 2Z6JA 3TIMA 4XD5A 4Q8TA 2WCGA 1PTGA 3GUGA 4X22A 2AOSA 4CD8A 4OVXA 3PULA 2VD9A 2OZ0A 4CUCA 3GU1A 3CL7A 1UKOA 2R1KA 2NV2A 5LGXA 1GVEA 3WDHA 1LZOA 5JMUA 1ISWA 4HHMA 3A4XA 3ZXWA 1RR2A 5IDIA 3UJRA 3LA4A 5GJNA 5HPOA 1N8WA 9RUBA 3CC1A 2V0TA 4DYJA 1QPQA 1MQPA 5LIUX 3CWOX 1SSDA 3CLWA 1C29A 1FWFC 1RJQA 2FTYA 5DCBA 3EX3A 4MB4A 2PDNA 1DWAM 1DWHM 2DQXA 2WNWA 3UWZA 3EDDA 4C6MA 2PDHA 3JVAA 1JULA 1NF0A 1G4PA 1M5WA 4ZSUA 4ES4A 4KKXA 1H62A 4XBKA 1VCGA 3N6HA 4HNLA 3U8GA 1V02A 4QS5A 4CU6A 1JNEA 4M82A 4Z17A 1SO3A 4M80A 4JKLA 5LYRA 1S1PA 3MMDA 2FTWA 3WELA 3PPGA 2WPBA 3W38A 5IBXC 4DJDD 5I3IA 4RDZA 4QRNA 3O16A 1SSGA 3CWNA 1NDYA 3EKGA 1V5XA 2PDCA 5AHNA 4W5UA 3NQFA 1WDQA 3BV7A 1S5WA 2FB2A 4NYUA 3V0UA 4WSJA 3TN3A 1XYMA 5AZ1A 4GFSA 3OZYA 3RUBL 1AA1B 1ME7A 2CHNA 2VQUA 3OZMA 5JU6A 2YDRA 1W6TA 3IGSA 3EXSA 2Z1XA 3KE0A 4IMAA 1I60A 3BLLA 3WBXA 5CBJA 2Z24A 4J3SA 2X8RA 3MJYA 1XCWA 4O0ZA 2C71A 3RK8A 3LSBA 1KC7A 6TIMA 1M65A 1MZRA 4AVNA 5FJRA 3PBGA 4YXGA 2JBMA 3P67A 3DENA 2GJXA 2CXGA 2PP1A 3TN5A 3ARYA 3WLIA 3F2CA 4J27A 3E74A 4PMUA 2GGHA 1CXIA 1V6XA 1KCZA 3HTWA 1W3NA 3LRLA 1VH7A 2WVVB 4YWSA 1Z3NA 1OX5A 3D3AA 3IIPA 1M7JA 1K02A 2YXXA 3LPPA 1FWJC 3WN6A 4QX4A 4AB4A 4F66A 3EKLA 1VENA 1UR9A 3UWWA 3WF0A 1E1CA 4RE3A 2HVMA 4XO7A 1EEXA 3AIEA 5JUVA 5EMKA 4WGXA 1FH7A 5BWFA 3DC8A 3PTQA 2OZ3A 1EWEA 3NXLA 8RUCA 4IMDA 3QQ0A 2ABAA 4ZO7A 2R91A 5E93A 3UWEA 1RZMA 1GYMA 5I0DA 3NYZA 1V0KA 5GVJA 4O1DA 3ZJ6A 4HNCA 3VM5A 1A3HA 3QSRA 4JYFA 1VYPX 3NO1A 2DW7A 4RX0A 4PMJA 4AD1A 1VBRA 2VR4A 1TPUA 4TO8A 5H1WA 3H7VA 3R25A 3FN9A 2POTA 4DNMA 4W7WA 3W6LA 3SIMA 4BKNA 1Q6QA 2AAAA 3POCA 3T0TA 2F6UA 2J8TA 1B30A 4PUEA 1R6WA 3V0SA 4XK2A 3CHDA 3HPAA 2QCHA 3V3WA 1UW9A 4PFMA 2Q02A 4RPQA 3DHDA 2P3ZA 1R3TA 4HK7A 1SJBA 2WZHA 3CUFA 3DAQA 4P7QA 4M29A 3A64A 3Q2DA 1WZKA 2DZXA 4GIRA 5AY7A 1OM0A 4NZ4A 1MO0A 2TYSA 3RX2A 3W01A 2J7HA 2VXNA 3HFYA 5KTLA 4O10A 5CQ1A 3IJDA 1GQLA 4PCNA 3W1PA 2WMFA 1A0DA 3L4XA 3P80A 3GNRA 2PDPA 3S1GA 1TR9A 4J7RA 2CZVA 5BOOA 4FR1A 1D3HA 3TW6A 2WHJA 1HJUA 5AC6A 1JXJA 4KT2A 4NU7A 2IXVA 4NJIA 3VOHA 1TPH1 1FWEC 3UGRA 4AEOA 3EOSA 3PB2A 4MY1A 4MZYA 5GJPA 4O13A 2BTMA 2QF7A 4H9XA 3T0BA 4AZGA 2OJPA 1S1RA 3UWUA 1X98A 2J77A 1P5BA 4L65A 5LKYA 1DTNA 3WK1A 1KXTA 2F6KA 2JGQA 2FHBA 4IIFA 1FWCC 1S2VA 1GKRA 3R43A 1TE6A 3WJZA 3E0LA 3B4YA 1WKFA 2UY5A 3HQNA 4K39A 1YPIA 4C90A 1OT2A 4I6VA 2YCLB 3FX4A 3BUVA 4CCEA 5HANA 1E9ZB 2O9PA 4JY8A 5CJNA 3HIJA 3NM1A 4UXDA 1NWTA 2BOFX 4C5YA 4PUJA 1B3VA 2EGZA 2HPIA 2XVPA 2Z7KA 1UWIA 2QR6A 1KV8A 3EX2A 4O18A 3OG2A 4XSMA 3IV8A 3E2RA 5KEZA 5HULA 2PP3A 4DNHA 3W26A 4QTGA 4AD5A 2Q71A 3CZKA 1E6NA 4AFYA 4H8VA 2O9OA 3OHIA 4Y2WA 2PDQA 2WCSA 4Z0JA 4AIBA 2BZNA 1TWSA 2ZZ1A 1KKOA 1H1NA 3GFZA 1I2PA 4NKCA 2BXZA 4H6RA 1Q5MA 5DF0A 3WQ8A 3PN8A 2HZGA 5HQEA 4AX6A 1VFLA 3S6TA 2E67A 4K8EA 4HJFA 2HV5A 1K6WA 2WM1A 3BMWA 1OHLA 3U4AA 1YPXA 4AD0A 3N3MA 4XKYA 1B3XA 1RCQA 1W3IA 1QK2A 2BG5A 1ZGDA 5K2ZA 3EX4A 3WBWA 2I14A 3BQ6A 2DDXA 3IVTA 4RE2A 4M19A 1MFVA 3KL5A 5LNWA 3VDHA 1UWRA 4OKDA 1PX3A 3OYZA 3IUDA 4W8BA 1H4PA 1N2VA 3VOIA 4QEEA 1C91A 3TOYA 3W02A 2F84A 3VNJA 5I24A 4P5UA 5IBXA 3A3XA 3K1GA 4FXJA 2A21A 1E0WA 1GJUA 3HFTA 3SECA 4ZXLA 4GFIA 1W54A 1OEPA 3O3RA 2YDAA 5DO8A 1S3TC 2QUVA 4LXFA 7TAAA 1EGMA 4JHMA 1AQ0A 3LV5A 5ECVA 4GXWA 2CKRA 1RA5A 3F1QA 2NLYA 4O1FA 4MZ1A 5AHIA 1SJCA 1D8CA 3B3DA 4HZMA 2VEPA 5GPRA 2P1FA 8XIMA 3HPXA 3T2PA 1KFCA 1PPIA 3HMJG 1A4LA 5IHRA 3M0VA 1EJTC 4D8AA 2Z7GA 3WK0A 2Q09A 3RNDA 1J01A 1W3LA 3G6LA 4ZB5A 4L1XA 1F4AA 1HP4A 1TMLA 1ITUA 3MO7A 2P0OA 2O92A 3CAVA 2FYMA 1L2UA 4HTYA 3N2TA 4DQWA 1K3UA 4HCLA 4NQ1A 2CU0A 2VEMA 4PEEA 1P0BA 1UC4A 2XSAA 5I78A 3KOZA 4Z2KA 1PVNA 2V63A 1L2QA 1VFHA 3EDFA 3W07A 2Y88A 4R5EA 1PAMA 4UUIA 2BY1A 3UWQA 3BWWA 4S3DA 3N12A 2TAAA 1XYLA 1QDSA 3AHYA 4AQLA 2Y5EA 5AYZA 4F0KA 1GVFA 4NNCA 2GSEA 3FJLA 3RMEA 1A5OC 1SJDA 1WOBA 3TOPA 4ZEPA 2WLZA 3EB2A 1YXDA 1O5KA 3BK0A 1BPLB 5D38A 1H7WA 1UKSA 3NQ6A 1ITXA 4PH6A 4V27A 1VFUA 3P5ZA 4MJ2A 5AECA 5DY2A 3MANA 4QDMA 3WO8A 3QV9A 1E5JA 3I68A 3L66A 3A9IA 3GVVA 2ZUUA 3C0LA 3G0UA 4DWSC 2X1SA 4JN7A 5KZMA 2VRQA 3W7PA 4JTKA 4CVWA 3THQA 1TPDA 2H9AA 4MPQA 1JF6A 3SUVA 4Q8UA 4L7ZA 3W7JA 5I3FA 2E77A 2NV1A 3GSMA 3BJFA 3RX4A 2Y63A 3XISA 1QWKA 2D1ZA 3DZ1A 3T1GA 5HQMA 2PTDA 3NXFA 4Q4QA 1ONRA 4HPJA 4AMAA 5ABTA 4MWAE 3WQ5A 2CLHA 3W1MA 2Q3OA 4BR1A 3CHEA 1PX8A 2TMDA 2VFDA 5HUPA 2BVDA 4UTHA 3GM8A 2NUYA 3AMGA 4ZVJA 1KFKA 5DT5A 1C8YA 1H7NA 4FO4A 1RY0A 3GR8A 3CHVA 2DT2A 3VXGA 1XUUA 3BOFA 3IJ8A 4R53A 3GNNA 1XLKA 3AIBA 1WBJA 4HPHA 3KOFA 3AUOA 1ENUA 4LB3A 1WX0A 2FPVA 5I6SA 3TQ0A 4CN6A 4O15A 1CGXA 2GJPA 1K4HA 3AYSA 3NR0A 2OR2A 2BMBA 3G1SA 4QE1A 4HOWA 1KFLA 3TR9A 1JZ8A 1GVQA 3PF3A 5DRCA 2AKZA 5AHLA 4F0HA 3JU2A 3WBAA 3TW7A 1J0HA 4RDVA 3AFBA 3E0WA 1KBKA 3BSMA 3WDQA 1ODZA 2VC5A 3S2MA 3G5EA 3TYAA 5CSYA 5CPTA 3SUWA 3W1AA 1F6KA 3UPMA 4UOZA 2JE8A 1TWIA 1S5NA 3M0ZA 1L6SA 1HL8A 3L5LA 2PI6A 1XBZA 4BI6A 1XG4A 1XUZA 5D9NA 3S3GA 4UTJA 1ADOA 5C6MA 1IIGA 3NZ1A 2NXGA 3W76A 3I3BA 4GO8A 4WKAA 2D0HA 2CLIA 3P2VA 1M7PA 2PDWA 3CS2A 3IRSA 5DANA 2G5WA 4EF8A 4EACA 1DL3A 3MP4A 3B9NA 2GPTA 3C61A 1G6CA 1ZFJA 5G4WA 2G96A 4BF7A 1J12A 4BA0A 2O7QA 2R9RA 3G1AA 2X7WA 3IJLA 4B9YA 1IT7A 1BYBA 4HA1A 4IXXA 3DECA 3RDKA 4S1FA 3B8TA 1W1VA 3NVTA 3IVUA 4XZNX 3I6TA 4FXSA 3VOJA 3OYXA 5FF7A 4GPNA 2X1UA 4ZE5A 1LLOA 1TMHA 3ARVA 1JG9A 2VGGA 1J0JA 1K77A 4YVVA 2AQWA 3S42A 1A4MA 4D6CA 1D9EA 1OFRA 2VR2A 1PIGA 2QAPA 1CGWA 2Y7EA 4JCLA 4QEHA 4PB3A 3H24A 3AO0A 3QOKA 4LNCA 2OZTA 3W22A 3W37A 4LYPA 3M46A 3LGDA 4J5NA 2RKXA 4GACA 4X63A 1UHVA 2WBKA 3AROA 5M5DA 4MWAD 1ICPA 3T0DA 2VZVA 1X8CA 1BRLB 2WSPA 1UIOA 4GG9A 1S2AA 3DFQA 2F38A 3V5OA 2GSHA 1VYRA 1H3GA 3FYPA 3RRAA 1RJPA 1L6WA 3NURA 4A21A 3SJ3A 4LUYA 1FWTA 7REQA 4EP8C 3F4VA 1KFJA 5M03A 4AWTA 1EJ7L 1XPYA 1DV7A 3VDAA 1K7XA 4I9MA 3OGRA 4O4WA 3CJPA 1YXCA 3WUBA 4UFJA 2WANA 2HS8A 3BLEA 4K36A 2VC7A 1OABA 3LXAA 2J7BA 5ABFA 1EQPA 1BQCA 3EMZA 4UQDA 4R33A 4OUIA 2NWRA 2WV8A 2ZVRA 4B5XA 2Y7DA 4HCHA 1MYRA 2D73A 2FH6A 1FHLA 1V6UA 4V2XA 1OYCA 4NILA 1Y8BA 2P5NA 3I3EA 4DZHA 4CEXC 3U0HA 3EOLA 1YIXA 3SIZA 3WEOA 1BWLA 1HTIA 3U5UA 3HPFA 1F3EA 1XXXA 2WZEA 1WB0A 4WEVX 2WAGA 1K4GA 1L6FA 4ZENA 4Y96A 3DESA 4NG3A 2R24A 1PZ3A 3YPIA 3IGHX 3ME3A 1CYGA 3VU2A 3S5YA 3T4WA 4WSKA 5LHEA 4GVGA 3E38A 2DIKA 3M64A 4LT9A 4A05A 3N6JA 3NQMA 3PFMA 3M4HA 3B05A 5BRBA 3PJXA 3MUZ1 3WQ4A 4JPGA 1GZGA 3DG3A 4DWSA 4D8LA 3KFTA 1J2BA 1C9DA 3SAZA 2V5LA 3IUIA 4XX6A 3I3DA 4C5ZA 3NSXA 4L9YA 3RCYA 5JBDA 4DF1A 4O8RA 4AZIA 2V3FA 4ACZA 4PCTA 1HP5A 2W6RA 4PBEA 4WHBA 3TYCA 3GDBA 4EXBA 4W8LA 4D6GA 4AIOA 4QAIA 4M6UA 1D8WA 3CUXA 1TFVA 1FP8A 4RCXA 4TX9A 4U3CA 2CIPA 3A6OA 1JFXA 2Y61A 5J5DA 5FI8A 2KX9A 3EEZA 2DORA 2X05A 4K1WA 2CBIA 3H70A 5LA0A 3DX5A 1QW9A 2CNCA 4JN6A 3VDCA 4IPJA 4H2CA 3ITCA 5HDRA 5LZLA 5C9WA 5K9CA 2WVTA 3UU0A 2XVNA 1EOMA 1TYGA 3E5PA 1XJBA 1WOAA 3MCNA 1UP3A 4U10A 5FF0A 4XD4A 2A1YA 4NUWA 3VNKA 4RNHA 3HM7A 5DMNA 2Y5SA 3SN0A 2B7OA 4PUWA 3ITTA 4C6FA 2H8XA 4MLJA 2W92A 1W1PA 4CQ8A 3HJEA 3PB0A 4DYKA 1DIEA 2FKPA 3W1QA 4XQ6A 5ABGA 4AZ5A 4IL2A 5F4XA 2GUYA 2BGNE 3E0IA 4XWUA 4GYFA 2XG9A 2B4GA 1FWSA 5LHFA 1X38A 4S39A 2QV4A 4CNSA 1R87A 1IHIA 3FAWA 1K8CA 4Q8NA 3WEZA 5BXRA 4WJ8A 3FYYA 1EGVA 5BWAA 3GG7A 3THDA 4GQBA 1KRCC 2BLEA 3E2QA 5CJ5A 1HQTA 3CHFA 4XBSA 3LTPA 4MGGA 3C86A 3WQVA 4IMGA 1I2NA 1SGJA 4KIRA 4Q7BA 2QW5A 2GDVA 1E0UA 5H91A 2VCAA 2FZNA 3FNDA 1KM6A 5CAHA 5EYWA 4IMCA 2ZICA 5DY3A 3E5BA 4H2HA 1CZ1A 3AMKA 3CMGA 2PDLA 4NP7A 2J8GA 3ITYA 3L4ZA 4OU1A 5REQA 4FK9A 1IWPA 3KLLA 2QKFA 2DZWA 1E3ZA 4J9JA 3G8RA 3FGCA 2I9EA 1K9FA 4A3QA 3BO9A 3FYOA 3SGUA 1T6MA 2NWSA 1QI2A 1AQMA 3TKFA 4KCWA 3RYSA 4LV9A 3LB0A 3PZNA 3EPMA 1T40A 3WNOA 2X2GA 4R3UA 3R12A 3U2ZA 1VS1A 4EKJA 4RPPA 1DQXA 2J88A 1DJZA 3ZYZA 1VAHA 3AXIA 3S6OA 2HSAA 1SW7A 4HN8A 1GEHA 2VL4A 4H04A 1NU5A 3II1A 1BF6A 3F4CA 1NJJA 4WJEA 3BAWA 3VKJA 5AN7A 4ZFMA 1TV4A 2G4FA 3COTA 4H00A 3VIJA 2PC4A 3HF3A 2NSXA 4F40A 1J5SA 5I09A 1RK6A 3FS2A 4HKPA 3WL1A 2QS8A 3O07A 2D0GA 1VFSA 3VIPA 1EZWA 4ML4A 3LU2A 1Q6DA 1K7EA 4L4PA 1IXPA 4YJ5A 2CLOA 2D69A 3NQBA 3MUXA 3MVIA 3EWCA 1WKDA 3PBUA 1WO2A 3T05A 4UMAA 4W87A 3C3NA 3W74A 4O19A 3VCCA 1JDCA 3QFEA 1W1TA 4BEUA 4LS2A 4DF2A 3DN5A 2PDBA 3NQ7A 3BGJA 1CCWB 3N3TA 1KA9F 3TXZA 2YL8A 1S3HA 4GQGA 5IFPA 3GDLA 2ATMA 1JI1A 3DFOA 3S5NA 1IIHA 4N4QA 3AMLA 1VEOA 3ENLA 2WVSA 4S2BA 1JZ3A 2VC6A 1KRMA 7ODCA 4C6KA 1C7SA 1WDWA 3LEPA 4P8XA 3RG6A 1UR4A 4RZ6A 1P43A 3MCOA 1XICA 2E1DA 3TAOA 1DJNA 1H7RA 2WLYA 3H7RA 2DEPA 1RPKA 5E9XA 3WL0A 4UZUA 3C8NA 1ZL1A 1QOXA 3TP4A 1G69A 2HS6A 1H61A 1YHTA 1OK6A 4EWND 2WMJA 2P8CA 3W27A 1QI0A 1ONXA 3E12A 1S46A 1ZCOA 4B92A 2P50A 1X1ZA 4PN2A 4QISA 3VIMA 2ANUA 4HYWA 4ACYA 4GYPC 4M8UA 3L0KA 4UFIA 4RJEA 2BGSA 4PTNA 1XV8A 2HBVA 3DG6A 2PWUA 3IARA 3UY8A 3O06A 2GUBA 1XIBA 4B5SA 4GUIA 2EHHA 5EMJA 1TRDA 2C1IA 4YVPA 2VDGA 3N2OA 2YL5A 5HXMA 3MWAA 4HMNA 2VX6A 3LX9A 1F07A 2FPTA 1OGBA 2EF9A 2G37A 1UJQA 3L7RA 2YYUA 3SY1A 4GVHA 1E1EA 7TIMA 3H53A 1QAPA 2PWHA 2R8WA 4PB5A 2XN2A 6XIAA 2ACQA 3ERPA 1TJ0A 2VUNA 1VHCA 2J47A 2G95A 3TJIA 4DJFC 1FDJA 5LSMA 3CZLA 3PZGA 4O50A 4AXNA 4PUNA 3UA3A 3DFNA 3O0FA 3RILA 1TPC1 1XLIA 2VRJA 4D8ZA 2XSBA 3M7SA 1GONA 3UW6A 2RDWA 4U3AA 3VMOA 2ZDSA 4RZ4A 4LNYA 5BXTA 4D9PA 2XYLA 3SQSA 3QGAC 2XGBA 5G1YA 3HQPA 4QCFA 4FS9A 1OYBA 4QG6A 4GVIA 4M81A 2ZUWA 4MWAB 3GLCA 3ZT6A 3WH7A 4DI9A 1F9CA 4JIEA 3O6YX 4CNUA 1B4EA 4NAEA 2OXNA 4QLKA 2E40A 3PWGA 4H6QA 1EC8A 2OSXA 2HVOA 4JD4A 4F4RA 4HA3A 5G1MA 1EXPA 3PS7A 3LMZA 1EGZA 2NQHA 3FAXA 1JQXA 4UFLA 2VEIA 1BXBA 5BROA 2W91A 2E7FA 1IXOA 2G3NA 4C1NB 4C6PA 2W0UA 1NWRA 1IYXA 3S1VA 1GW1A 2V67A 4KPLA 4DWSD 1XDLA 2WJEA 1HUVA 4DM2A 3VIIA 3SUSA 4ORMA 3RRXA 2UBPC 1E73M 3BH4A 1EJUC 4L80A 3L4WA 3LGEA 4JX6A 4UBPC 2CKSA 2DSWA 5FJTA 3KVLA 1XLMA 2GJNA 1AODA 2NQ9A 1SZEA 3WK3A 2VC9A 2ADAA 1DJIA 1W5OA 2O0TA 5AHFA 1Q45A 4AIEA 3L23A 4IMEA 1MI3A 2GWNA 3PG9A 2QUMA 2XJ7A 4MYXA 2VNCA 1NIUA 3N17A 3PK7A 3R0DA 2J62A 1I45A 3GKAA 2YSWA 5CG7A 1BWVA 4B4HA 2QEZA 3GHRA 3MCMA 1IGWA 4U31A 3B4UA 3SUUA 3GVWA 4MIMA 1QI5A 1XIFA 4P7OA 4YCOA 4LCSA 4S23A 3CMFA 2UV8G 1JCTA 2Q8XA 5FD0A 4LAUA 1HVXA 4DBEA 3WLTA 3PR2A 3DFHA 3PG8A 3FY1A 2WJZA 4RDYA 5FF2A 1RK5A 1MEIA 1BXCA 2WNNA 1WP6A 3DYMA 1U1UA 4GJIA 4CVUA 4NAFB 1TZ9A 1U30A 4TUFA 3AICA 4EK7A 3TV8A 3AHVA 2ACUA 2YBUA 1QW7A 2DH2A 1XDJA 3RR4A 4A3YA 1KLZA 3OQ8A 3VA8A 1F2JA 3PUDA 4JIPA 4FAMA 5A6KA 4QCEA 2CERA 1EIXA 5FJUA 2EG7A 2ACSA 2A3CA 3DBPA 3AUJA 3RITA 3BG9A 3OLIA 1E4LA 5IFTA 2GYIA 3R1ZA 3L9CA 1LG2A 3OLGA 4PMZA 3HQ1A 1GYLA 1PZ2A 2J7EA 3WQFA 5T9BG 4N42A 1Q6FA 4LSBA 1XRSA 4C6LA 1C9WA 1GGOA 5KMYA 2X0YA 5BZAA 3KWSA 4GYPA 3PY2A 2VX4A 4JX5A 2CZDA 1E9LA 4J28A 3N2BA 3KAOA 2WSKA 3K2GA 2ZXDA 5G1TA 1UH2A 2BY2A 5F1VA 1HO1A 1HJQA 2YCKX 4NL1A 2WWCA 3LCXA 1O12A 1TV3A 1NARA 3ZSSA 3B0XA 3U4FA 3NEVA 3OGSA 1HJVA 4JFVA 1ZHAA 1REQA 3O8AA 4Z1AA 5E1QA 3B06A 4TXEA 1DOSA 2PDFA 3VDBA 3N9SA 2ZE0A 2VFFA 5A3HA 4JL2A 4D6FA 1SO6A 3ZFHA 1S38A 3DH7A 3W2JA 1EH9A 3W25A 2CWNA 1R9YA 4IIDA 2HTMA 3QHMA 1ECEA 2OEJA 1TPEA 2C18A 2INZA 4CQCA 1YE6A 2QT3A 4FNUA 1SZRA 3C0JA 4JYDA 3VD5A 4F2TA 3E2VA 4TX6A 4OECA 1XDMA 3CO4A 4XD6A 3CZGA 9XIAA 1REQB 3PUGA 4DJFA 5J04A 1QBBA 3BLIA 3BLPX 2WMIA 1LQ0A 3FA3A 2E25A 3WLLA 3CASA 2DT1A 2QDGA 3PANA 3WH6A 4MB3A 1F7BA 2OCZA 4IPNB 4J3TA 2H3DA 1JCLA 3ZT7A 4UMCA 4ZQRA 1L8NA 4PRRA 4Z2GA 2XM2A 4AHQA 1T8QA 4KIEA 4I90A 3CNYA 1T5AA 2R1NA 3AIWA 1ZNNA 4GI9A 3W75A 3P3BA 4LB4A 2HK1A 1BD0A 3EOEA 1KGUA 3BQ5A 1OBAA 2QPXA 3NQ8A 2GK1A 2YFOA 3W1TA 1A5BA 3S83A 5SWUA 2AQVA 1RD5A 4JIHA 3REQB 1DJYA 3QKEA 1NFGA 3WNKA 1WXYA 1JR1A 3PBMA 3GNDA 1R3WA 2J24A 4OGZA 3GW0A 4JQ2A 4EX4A 2BNJA 1CECA 2Y5JA 5HNUA 1OT1A 5CSSA 3G22A 3IJ9A 1QT1A 1J9YA 2JKEA 1M04A 1LUCB 5A2CA 3VTRA 1ADSA 4G7EB 4C6OA 5CEWA 4QSFA 3AZSA 4JTDA 4MYAA 1FDYA 1JPDX 2Y24A 1I2RA 2CBUA 4CU8A 3MSGA 1GVOA 1VBGA 1ZS2A 2OELA 1CGVA 3H2CA 2G41A 2ZCGA 4UR8A 3ZLFA 4HPXA 3GNPA 3NO3A 2QUTA 2Z1KA 3ZVHA 4J2MA 1KM5A 3LHYA 4QG9A 2A7NA 3W1RA 1ZPTA 1RQHA 2RGMA 1IV8A 1KFWA 2CLMA 2YOCA 4W88A 4ZOEA 3NM3A 1GCYA 1DJHA 4KRZA 3ATZA 3LCGA 4R7JA 9CGTA 2DZBA 3R11A 3UEQA 4I9TA 2C91A 2R6OA 2VWSA 2ZUSA 1QI3A 4TVDA 3SGGA 3B0YA 3NZGA 4ZFCA 3APYA 2G97A 3TC7A 3TQVA 3CH0A 3VABA 3FV9A 3C0SA 5AYXA 3SY8A 1OB0A 2BBFA 4JKMA 4CEUC 1TTIA 1QXLA 1L9WA 3RJXA 3CBWA 1C92A 5HR7A 2QCDB 3LRKA 5EKYA 1UJPA 3SURA 4NZFA 3KBMA 5CC6A 1VJSA 4ADTA 4D6JA 3NAVA 3LY0A 1XIHA 3S0CA 4F2BA 3W7LA 1P6CA 4E8GA 3CH9A 4S38A 4OV4A 3W53A 4QXIA 1W5PA 2V38A 1TWDA 2NLIA 4JTJA 4WDTA 3AZRA 4QFUA 2QDEA 7PTDA 3WKZA 2BXYA 5BRPA 1G7UA 4PMDA 3G1XA 4S3FA 4J3ZA 2ZYFA 3WNNA 4AZBA 2WMKA 3CUIA 3W88A 1NAL1 3T2QA 4I6KA 1HF6A 1QTWA 3TJ4A 3LENA 2EXOA 4DF0A 4JS3A 2L5HA 4LF1A 1Y5XA 2XFFA 1JUEA 4M5PA 3GQYA 1XR2A 3W2KA 4L5ZA 5H8MA 5DBUA 1FWGC 2C8NA 1KXHA 1XH2A 2QCMA 3CB8A 1RQEA 1XLDA 2INFA 3F2DA 3HA1A 4FNQA 3ZT5A 4W4QA 4E6MA 3FSUA 5CZKA 1QPOA 1NY1A 3RLHA 2DZUA 4GY1A 5JH1A 3ABZA 4WGHA 3C6CA 5C71A 2WSYA 1KBJA 3ALGA 4LC6A 3W84A 2J66A 4JTLA 4E8CA 3B03A 3DXIA 2QCGA 3LDVA 3R0UA 5IDZA 2CEQA 3NPVA 3T2OA 3MDWA 3L0NA 2X41A 4AWUA 3IACA 4W7UA 1MW1A 3M5ZA 5L6UA 3VX0A 3BG5A 1ZJAA 1TCDA 2FVKA 1XIDA 3QYSA 1KFEA 1YE4A 2HE8A 3RU6A 4GZ7A 1UMLA 2B7PA 2RDXA 3QZ6A 3MUAA 1TA3A 3NZPA 2JQXA 3G1VA 4A3RA 3MHUA 2XH4A 1J5TA 3QR3A 5A6BA 2KAUC 1VFOA 3UWYA 1IT0A 4QLLA 2DGAA 1KO0A 3AIRA 3QTGA 4ZL1A 4B5TA 4XZLX 2C7FA 2IKGA 3LPOA 1O94A 3WLJA 3OVQA 1MUMA 4GY7A 5D09A 1G1YA 3BJSA 3P8IA 4R85A 2QJMA 2W66A 3WLPA 1Q65A 1S5TA 3M7WA 2ZC1A 1I4NA 4Y8EA 2PDXA 4HZ7A 1TA3B 3ANUA 4ZXOA 4D1JA 3UR7A 2ABBA 4PB4A 2P0IA 4A35A 2Y2WA 3MI3A 4LUJA 1A0CA 1ICSA 1R30A 8XIAA 2UY3A 1KQYA 3NIYA 2FDSA 1DE6A 3G1YA 1O7AA 2XISA 3NSNA 1FWIC 2GGGA 4AWEA 2BVYA 2DY3A 2PRHA 1G5AA 5DMYA 1OX4A 5JVLA 1GNXA 1U33A 2RAGA 4KGJA 1V0NA 4HU8A 1BAGA 1MWOA 5A6MA 1CT5A 3LCIA 3VAVA 2DT3A 4BF9A 2PODA 1E5NA 1CX9A 3SUTA 1PKLA 4NJGA 2HNHA 5K7JA 1VRXA 2QJGA 1JCJA 1F05A 4XTIA 3BURA 1R3SA 5T26A 1XP3A 3BPWA 5JIWA 3NDYA 4QROA 4E3TA 4LUSB 2PEVA 4WLCA 1OX4B 1PWMA 4RNFA 2X1IA 5D8ZA 1W31A 3AC0A 5A6TC 5FEXA 1FCQA 3Q67A 3EDEA 1PIIA 3SI9A 2DSVA 4IP7A 4NJHA 2Y4SA 1OIMA 1E4MM 1B31A 4GX8A 2P53A 2PLMA 3LS9A 1SFSA 4FX7A 5M17A 2J8FA 1DBTA 3ICJA 2WMGA 1EUNA 1CNVA 5CZSA 7CGTA 4W84A 5J5RA 3T09A 3UQNA 4FLOA 1WBHA 3KZSA 3S1WA 2FDMA 3MVTA 3UJ2A 2QPSA 1R86A 3G0SA 4NSBA 1TVPA 4P7NA 4AD3A 1EF3A 2RFGA 5FEWA 1F5ZA 3TLLA 2I5IA 5HQLA 1XFCA 2FJKA 4DZ5A 4GH3A 3OO2A 3BJTA 1GVYA 1NOUA 4EPBC 2FHCA 4GUFA 4JFWA 2V81A 3SW6A 1XI3A 5M3WA 1NEYA 2C1GA 4TMBA 2Y89A 1UBPC 3J7HA 2WZTA 2FZ9A 4DJFD 3AWOA 4MNMA 4J40A 1QHZA 1BSLA 1H41A 4HMEA 3PJWA 1H49A 2WC4A 1EFZA 1FA2A 4DY1A 4O1BA 1QPNA 1F6YA 1UQYA 4XUYA 2NVDA 1UOKA 3V75A 3CQIA 2V9DA 4Z1YA 5CBBA 3MHGA 3RLGA 1YMYA 2VX5A 3B9AA 3O6DA 4A8LA 4GI8A 3W9ZA 3W82A 3KX6A 4A8NA 3TSMA 3NEHA 3N15A 4EOUA 1ISYA 2CPUA 5KSWA 2SFPA 2O4MA 3KBJA 1FKWA 4TMCA 2WQDA 4ATWA 1DIDA 4Y9PA 1MFUA 1R38A 2OMAA 4WY0A 3BZJA 4PRTA 3PM6A 2VKZG 1Z48A 2XN0A 3P8JA 4CCCA 2O9TA 3LCHA 3QKZA 5D9OA 3VZXA 3IJIA 4PMXA 4JXCA 2Z29A 3EWBX 3RGTA 4BWLC 1FCBA 5B7ZA 6REQA 5E0FA 2X09A 3FHQA 2J6VA 1KWKA 2YL6A 1RP8A 3DIPA 1XLEA 1DWFM 1MUWA 3LHWA 4QJ3B 3H54A 3KVJA 1JI2A 1PS9A 5C7HA 4PZVA 4AZCB 5HMDA 2WK2A 4Q4MA 1OFBA 1LOSA 2QVNA 4N6EA 3CK5A 3EWDA 3CYVA 3A5FA 2RH9A 1XX1A 1W1A1 1W9BM 3F4WA 4P8WA 3JUGA 1FFQA 5D4YA 4M24A 4CNPA 1WUFA 2HVNA 3MYPA 2PTXA 3QYQA 1PDZA 4M1BA 1OCNA 2QJJA 5A6SA 1IF2A 2FGZA 4FOJA 3W24A 1RCOB 3TXVA 1XIGA 3VC6A 2WKGA 3AIQA 3VE9A 1CLKA 1CWYA 3PBYA 4ZB2A 3V16A 4L1GA 4TX8A 3WH5A 4Q4PA 5HR6A 3SZ8A 4I5XA 3A4JA 3CUGA 4JHOA 4U2YA 1P0NA 1ME9A 4Q4OA 3VC5A 3LM7A 4DO5A 3UT0A 4CGTA 4YLWA 4BS0A 3BMXA 4GA8A 1HKWA 1XCXA 3SRHA 3LYEA 3QQWA 1XBYA 2ZUVA 4TV5A 2Z27A 2UZ9A 3MP5A 3T0CA 4H6KA 1EA9C 1G0CA 3WDPP 3D6NA 2XUCA 3FK4A 1PHWA 3M47A 2V82A 1JPIA 5EMYA 3AJ7A 4KGLA 3A22A 3DHPA 4GNJA 4MOZA 1PZ0A 4XAZA 4ZO6A 3R58A 3WY1A 1YW1A 3G2GA 4GD0A 5XINA 3CT2A 2JF7A 1OFQA 2C16A 3WLMA 1X1OA 2XVLA 1KCLA 1O1HA 3GXIA 3MUY1 3R94A 2D0FA 3M1ZA 1NWSA 2EJ1A 2B0MA 1QOPA 1JCNA 1RPXA 3A47A 3EXRA 3AIUA 2REQB 2EG6A 2OGJA 2DZPA 2VM8A 4GYKA 1Y5WA 2V2DA 1TJ2A 2PURA 1XLFA 3HPSA 1LG1A 4L6DA 2VVSA 1RSCA 5CZTA 4IFRA 1EP1A 3WQOA 3ARSA 2IW0A 1JUKA 3GC2A 2Z26A 4Y90A 3W6MA 3QW3A 3VVGA 4GUJA 1Q7QA 4MSSA 5FEZA 1LL6A 4AYGA 4DB7A 3ABXA 1US0A 1OVDA 5CPOA 1D7FA 3AZTA 3CU2A 3IK2A 2YX0A 2Z1VA 3SRFA 3KRZA 4C1LA 4LC8A 3O9NA 3SDOA 3PVFA 3I65A 4K37A 2XDFA 2Z6IA 4IIBA 3ZLHA 2VEGA 5D02A 3T81A 4JCMA 5A8MA 1VBHA 1P48A 3I7RA 2FGBA 3P82A 1JGIA 1G67A 2ICSA 3NQGA 1J6PA 3CO8A 3B8SA 4H83A 2PWDA 4QHRA 4W8AA 1UB3A 2Y70A 1S39A 4C6BA 2X30A 1E70M 5I02A 1GKPA 3WCZA 4AF0B 5XIAA 1JF5A 4FI4A 2D3NA 2VURA 2ZWZA 4K8GA 4AVOA 1UR8A 4ZQMA 2Z25A 3QOMA 4KCUA 3Q65A 5GNZA 5A6BD 1S2TA 1FHVA 3DC0A 3VOCA 4URIA 3CUHA 3MDUA 1ITCA 1EBGA 3WD3A 1SQ7A 2QDHA 2RDUA 1VPYA 1XCFA 1Q8AA 3KTXA 4XG1A 3M16A 4Z1DA 5F1UA 4PCFA 4FF7A 3EDKA 1BVWA 3WDIA 3T55A 1AW2A 3LLDA 3ONBA 2X16A 5A2AA 3KXQA 4KWUA 1UWQA 3FFSA 3QV7A 1US3A 1XLGA 3OIXA 4J3UA 2GOUA 3KW3A 2GDUA 5FEPA 2R82A 1RD6A 4DUXA 2WO5A 1ZTVA 3S5SA 4F3HA 2PRLA 1BQGA 3AIVA 3FKRA 3EX6A 4YN5A 1B1YA 4CQDA 1KRBC 3UZZA 3TFXA 2D2JA 3E0VA 4TOQA 3I6RA 4ZR8A 1C3FA 1SVDA 2A5HA 1OD8A 5I06A 3GIQA 4E38A 7XIMA 4J2PA 3V18A 1CIUA 2W9MA 3E2SA 3TC6A 1E51A 1HKMA 3GC5A 2A3AA 2BSLA 5C9XA 4DBUA 4DWDA 6PTDA 5HWJA 4BWLA 1U83A 4H9ZA 1P1XA 3C2VA 3LNPA 1HN1A 1NH6A 3VPLA 4JTEA 3AXMA 3RO6A 1LL4A 3W7OA 3GWQA 3UCCA 3EOUA 3UD6A 2IQDA 3W7DA 2AMGA 4AD2A 1LLWA 3UESA 4R9XA 4H41A 2PRMA 1P7TB 1XBVA 1N7KA 3WD1A 1ESWA 4C1KA 3VNIA 3PPHA 4X2RA 4XIAA 1AQHA 1PO9A 1A3WA 4U28A 3ES7A 4XZHA 4L4LA 3TAKA 3CB3A 5AFDA 1FCVA 1MXGA 1QO2A 2ZUMA 4H8HA 3L21A 3L2LA 3UY7A 4FA3A 1QK0A 4GGHA 5CCZA 2W61A 5RUBA 3M5XA 1XRVA 1EWDA 2WC7A 4P8UA 2VGFA 1ELSA 2G3MA 4NVTA 3TQKA 4FR6A 5CGMA 4IQEA 1XGEA 4NASA 4H9MA 1AH0A 5TF0A 2ZC8A 3ALFA 3A21A 3SSZA 4XV0A 1RBAA 5A8GA 3W23A 2A2IA 5HMEA 2V5JA 3NGFA 4K68A 3FOKA 4HNNA 2PGWA 2GOKA 3NDOA 1MQRA 3GXNA 2GQ8A 4M3PA 3SQLA 2QGYA 5FSDC 4D71A 3U3HA 3N14A 3TCEA 4XISA 3EMCA 4WRHA 4CQAA 2WHLA 4X9SA 1B0IA 1K8ZA 1R3QA 4TVUA 1AJ2A 4I7UA 1H11A 3PTKA 3QQ1A 4MVAA 5HNNA 4N9DA 4ZO8A 1WDDA 3MUCA 4DUVA 5FL0A 1K9DA 1QHPA 4JFTA 1E1FA 4J35A 4QNWA 2B31A 3W3OA 3W86A 5D05A 4K7YA 3W7NA 2XIQA 1D7KA 5AVHA 4NRRA 3DFYA 4KEMA 4Z2IA 1GOKA 2NXIA 3NDZA 3UXIA 1YBQB 5C54A 2WPGA 3GW3A 3WNPA 1OY0A 3QPZA 5F2IA 1YDOA 1RALA 2C1HA 4Y9OA 3W00A 3WF1A 4GIYA 3CPRA 1JZ7A 3KUMA 4S3CA 4N4PA 2VGIA 5EMLA 2EPMX 1G4TA 3KL3A 1GOQA 1Z32X 4ROPA 3FDGA 5C5YA 4UQ9A 2D2OA 4JQ1A 4E2VA 5AYBA 2ZXBA 1XYCA 5G2HA 4ALDA 4C6QA 3TSDA 1F6PA 5T91A 1J2WA 3AS0A 4L4MA 4IG2B 2DUXA 3AYRA 1SM9A 1GZ1A 3PHAA 4AC1X 1WZLA 3VIFA 1V3KA 3D46A 4I7WA 5BYWA 3AXHA 3N2CA 4GC4A 4A2SA 2V5CA 2E8ZA 2DIEA 1UD6A 3W28A 2AGKA 2YPIA 4AY7A 1GTHA 1W2VA 3TMLA 1OZMA 3MP3A 1TV8A 3BW2A 4I5RA 4B9ZA 4IMFA 1KV5A 3SCVA 1PDYA 4IQLA 1A5KC 4GY0A 4UTLA 1UKQA 4A2RA 1A3XA 2DU2A 3VGEA 3CMJA 1XKYA 2XH2A 1QPKA 1VFTA 2C0AA 1AD4A 4ZQPA 4QQ3A 2CZ5A 1TV7A 5CSUA 1TVLA 2WVVA 1Z6KA 3ZZ1A 1KQZA 2RDTA 3SR7A 1E40A 1FY6A 5LIKX 4HPGA 1ZJIA 3ELFA 3H26A 1ML1A 1JEZA 2ZA2A 3CIWA 1ODUA 3LXCA 1HKIA 3K46A 3MKKA 5C70A 1MRAA 3R8RA 2FJUB 1P4CA 1TO3A 2F6XA 5IXEA 3GO2A 3A23A 1UR1A 1XSIA 4LJ3A 1Q7ZA 2EPHA 1NVMA 1Q6CA 2QF8A 2YW4A 3W7GA 1SFTA 1WZAA 2EPNA 3OLDA 3QR0A 1DJWA 5BOEA 5LA2A 4D6DA 4B5NA 1TJRA 1PKNA 1JCMP 2DJXA 4F0SA 1NDVA 1UR3M 1R2RA 1O1ZA 1TJ1A 3PUOA 5G2IA 3MBFA 1YTEA 2Z4GA 2VFEA 3LPGA 4H6EA 4ZCWA 4XAPA 2AL1A 1I0BA 4NZCA 1U5HA 4YYFA 5D2TA 2LLEA 1BWKA 3TW9A 1OSEA 4IWWA 2V2HA 3KOYA 3AJXA 1OWQA 1JAEA 4W7VA 3W87A 2CWXA 4JR5A 2MANA 4OBTA 4Q8OA 3GS6A 1R0MA 5CPNA 3M0IA 1AJ0A 1U22A 3ARUA 3LERA 4I7VA 2PWVA 4A8RA 1VEPA 1H09A 3NPXA 4FHAA 3KOWA 4KCTA 1Z8AA 5I07A 1XIMA 1YTDA 5KZ6A 3GG1A 1EXBA 1CLXA 1SZNA 3P0WA 5HUOA 3W83A 3OTRA 4MJZA 4G7FA 4ZQNA 1VF8A 4N02A 4QAWA 1JQVA 4BF5A 2ZA3A 1OG6A 4ATDA 3F4NA 3H2MA 3ANVA 1RJRA 2E68A 4HA4A 3C2YA 3B97A 3G24A 2OQLA 3EWZA 1UBSA 3B9DA 3VNZA 3W1LA 1XGDA 4UC5A 2A6LA 2YZRA 1LBMA 4XZWA 5TIMA 3E6EA 3HBLA 4LBSA 1TWZA 2JIWA 2XVKA 5LNRA 2YCLA 1ZAHA 3MQTA 1EO5A 1MSSA 2BB0A 1V03A 3CIVA 1E4IA 4PMRA 4Z2LA 1XHGA 1WDSA 2PCEA 3V7PA 4UQCA 4LEQA 3ZR6A 3ITOA 1JIBA 1XG3A 1IR1A 1VCFA 3BL3A 3P93A 1BYDA 1W3JA 2IPWA 4DJDC 3XINA 3L4TA 1FDZA 1LOQA 1Z9AA 4E4PA 3WLKX 1DPMA 4LAKA 3T6CA 4XBJA 1QOQA 2CITA 1EHAA 4MLRA 1GT8A 3GG8A 2XH0A 3GHTA 3QTPA 4DIAA 1WA3A 1GJWA 3M0HA 1XM3A 3RLUA 4HHLA 4C7DA 5D33A 5FSEC 5FESA 3QMRA 2X7VA 1UROA 1CXLA 1UWSA 4AX7A 4O14A 3KP0A 4LVGA 9XIMA 1UD8A 3DDMA 4GZEA 2HBXA 1OQFA 1CENA 1JVNA 4ZTYA 2G3FA 4ATLA 3TTYA 4YWIA 4FX6M 1JDAA 5DBTA 1V6VA 5EMUA 1X96A 5D03A 5I77A 4B5UA 3P0XA 2DVUA 4GK8A 4ZSTA 2EPKX 2DZVA 2O4QA 2YYTA 4LALA 5I3KA 4KW2A 1HFBA 4YHEA 1O5RA 1V3MA 3AALA 5EBAA 1I6NA 1VFMA 1F74A 2D2HA 3L4VA 4L4OA 2ZDRA 1UUMA 4NX0A 5F2LA 1R3YA 4CD5A 5CC7A 4Q7IA 2F2KA 2VZTA 1OCBA 2GVGA 2OX1A 3FEMA 4LWWA 4GUGA 4AWSA 3LNMA 5MKGA 3H4GA 5BMWA 1T96A 2OWXA 3SO7A 4DHGA 5FCZA 1V02E 4U5KA 4UWMA 3S47A 4HYVA 3UG8A 4AYSA 1SU5A 4BFAA 4X61A 3IJ6A 4XUGA 4B5WA 1DORA 2EG8A 2J7FA 3C4UA 3WX7A 3VUPA 2D3LA 4JN8A 1H50A 2Q8LA 2G3JA 3IS4A 2Q01A 2JKAA 3V5FA 3DYPA 5MKGB 1EJWC 4QGCA 1FHDA 3W72A 1GHRA 5LIYX 1UOZA 3W7QA 4DXVA 3GU2A 2CLLA 2J7GA 3Q45A 1W9PA 2BV9A 3UR8A 4JIIX 1K9TA 3RHGA 3UR2A 3NA8A 3B8DA 1PKYA 5BOFA 4MADA 1YDVA 5C0QA 1GWJA 4KEZA 3DBNA 3MTWA 5I3JA 1P1MA 2HISA 5T8GA 1I2OA 1EBHA 3L68A 1OFOA 3E02A 3ZO9A 4BI7A 2FLIA 2OKTA 1YX1A 1Q6GA 5A95A 3EDJA 4N9BA 3U2EA 4X0NA 1HKJA 3UNTA 2VZUA 5A8NA 1W5QA 4RKAA 1DIOA 4C60A 3UWVA 5CC3A 1AVAA 4EWJA 3ARQA 4LVFA 1H1YA 4LANA 1UA3A 4WXZA 3VZYA 3TTSA 4NZJA 1TCMA 3VKKA 4CN1A 3QHOA 4NNBA 4Q4RA 2XFWA 3R0KA 1R3RA 3H4WA 1XS2A 4IXHA 3RCNA 2Z2UA 3EPNA 2P76A 2GGEA 3U2CA 4PRWA 5FF4A 2PMQA 1E6ZA 2OVLA 5CPLA 1H2JA 4AEEA 1H5VA 2G8ZA 4A3UA 3O05A 1I1XA 4ECLA 3WQ6A 3APGA 4M51A 1JRCA 1QW8