1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-RHAMNOSE ISOMERASE
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
4PGLA 5EMMA 3BANA 1BXCA 1XLDA 1S5NA 4XKMA 1S5MA 3DX5A 2HK1A 1XP3A 1XIDA 3KBSA 1QUMA 4HNOA 1I6NA 2ZVRA 2XINA 3NGFA 1OADA 2G4JA 1XLFA 2QULA 3DBNA 4LNCA 4QEEA 5FA5A 3KBVA 3C0QA 3UXIA 3VNKA 4X61A 3ITXA 3M0VA 4X63A 2G0WA 2GVEA 3QYSA 4XIAA 2XISA 2OU4A 6XIAA 9XIMA 1YX1A 5H1WA 4GJJA 3ITOA 4PFHA 1QTWA 4XISA 3UU0A 3VNMA 3U0HA 1DIEA 3AAMA 3WQOA 5C9ZA 4EAYA 4DUOA 1BXBA 3N4AA 3ITVA 4W4QA 4A8NA 4ZB5A 1XLKA 4J4KA 3BDKA 1XLIA 4HHMA 4QE4A 4QE5A 1MNZA 5AVNA 1XLLA 1XIIA 3P14A 5TNVA 4ZB0A 1XIHA 3CQJA 3ITLA 4ZB2A 5AVHA 3M0YA 3FVMA 1A0EA 1QT1A 3KBWA 2NQ9A 2ZDSA 1DIDA 3U3HA 4X60A 1XLJA 3P6LA 4QEHA 4Q7IA 3VNIA 9XIAA 3LMZA 5XINA 4HHLA 4A8LA 5XIAA 3CQHA 3VNLA 4YTRA 3L23A 4G56A 3ITTA 1XIBA 2QW5A 1GW9A 4HGXA 2HCVA 5J8LA 1XYMA 3IUHA 5I7GA 5B7YA 3AYVA 4KW2A 1XIJA 4QDPA 4XSLA 3XIMA 3ITYA 1TZ9A 1XLGA 2X7WA 4QDWA 1XLHA 4QE1A 3M0LA 8XIMA 5B7ZA 3UVAA 3KBMA 1CLKA 1XISA 4YTQA 2XIMA 2HK0A 5B80A 4A8RA 1XLAA 3JU2A 1XLMA 3KTCA 2NQHA 1XYCA 4GQBA 5H6HA 4ZBCA 2X7VA 1DE5A 1XLBA 4XSMA 3TVAA 1DE6A 2I57A 4YTUA 3UA3A 3KCLA 4YTSA 1A0CA 1XIGA 1XIFA 3KWSA 3BZGA 1XYBA 4DVOA 3XINA 1XYAA 4EACA 1K77A 3M0MA 3UA4A 3GNXA 3QZAA 1DXIA 3VNJA 3M0XA 3VYLA 2GLKA 4A8IA 4GLEA 3BZJA 1XIEA 3BWWA 3KCOA 6XIMA 1D8WA 1XINA 4US6A 3XISA 3KBNA 3QXBA 4K3ZA 3TC3A 8XIAA 1XIMA 7XIMA 2QUMA 3KBJA 3CNYA 1I60A 4E3VA 3CWHA 1XLCA 3CQIA 3IUIA 3KCJA 2GUBA 3AALA 3AYTA 3C0LA 3OBEA 5EMKA 5EMJA 4OVXA 4YTTA 1O1HA 1XYLA 1A0DA 2Q02A 2J6VA 2I56A 2GYIA 3QC0A 4GJIA 4XIMA 5EMLA 4K1GA 1XLEA 2QUNA 1XICA 3C0SA 1MUWA 2NQJA 3CQKA 3M0HA 5XIMA 3IUDA
chains in the Genus database with same CATH superfamily
2VFGA 1RD5A 2XH0A 3MI6A 3VD7A 4BEQA 2QR6A 3I6TA 4LH8A 2VDGA 2Z7KA 2VOTA 1TMLA 1P43A 4GXMA 3F4VA 2JGQA 3DEQA 3WJXA 3MHUA 3G2GA 2V5BA 2R82A 1BG4A 3P93A 3RN6A 3CL6A 1RAKA 3FOKA 1X8FA 4J5NA 4B5VA 4GZ7A 2P50A 3EGJA 4P61A 2OSYA 4DBDA 2DSVA 2PDXA 3V36A 4HSHA 2UY3A 1A4LA 1DTNA 5EL1A 3BLFA 3M0JA 2V2DA 3BLLA 3BLDA 4F2UA 4FOJA 4QSHA 1HVQA 4PULA 5FCZA 4QLJA 5AHMA 5HDRA 4EPEC 3G1SA 4GJ1A 4E2OA 4ZO6A 5JU6A 3U2EA 3PZOA 4HHPA 1R9YA 3FDKA 3QZ6A 3IJLA 2DZSA 2J9ZA 4Z17A 2F6KA 3O6YX 1UOZA 4FX7A 1KXQA 2PDNA 4IFRA 1E6XM 4LVGA 3FA4A 5K4ZA 1YLVA 3I68A 3P5ZA 4H00A 4G7EA 3LTSA 1PWMA 4NZ4A 4AD4A 1VH7A 3OB8A 4OVXA 3CWOX 4V33A 3RLHA 1DQUA 1PBGA 4L80A 4R3UA 1P0BA 1IR1A 1VFOA 4L6OA 1YTEA 4E38A 3TYUA 3KW3A 3A4XA 2ALDA 3PB0A 2A5HA 1P6BA 2GVGA 1YDYA 2HK1A 1TCDA 1K03A 2WLZA 4X61A 2OEMA 1R3TA 1GOIA 3WDJA 3VIPA 3NQEA 1SJDA 5E6ZA 1NWRA 4H7CA 2VZTA 4ACZB 4L5ZA 4B2DA 3KVMA 2ZX6A 2E25A 1FDZA 3SUVA 2HPIA 3BAKA 4RCXA 2DORA 1G4EA 3WBAA 4WJ8A 1AZ2A 2EPMX 3TONA 4BF5A 5HJLA 2ZZ4A 4AYSA 2D3LA 4EP8C 2YR1A 3DXIA 4QDPA 1XUZA 2D69A 3B0VC 5D2YA 3MMWA 2PDUA 5JBEA 1TWSA 3UVAA 3WK1A 1YXYA 1LG2A 1V6WA 4BF7A 4ZOAA 3RX2A 2HWGA 4M6VA 5FJUA 5DMLA 1NQ6A 3DFQA 1K7EA 3FIGA 2BP1A 3UESA 3L65A 1US3A 2BY0A 3ONBA 5D2VA 4ZL1A 1J18A 2VX4A 4QISA 4BQ5A 2GYIA 1Q6OA 4DXXA 3F2DA 2QUNA 2W62A 3HFTA 1QRQA 3CQKA 1PSCA 3RIKA 1G01A 1TR9A 4XZMX 1IIGA 3G5EA 1XH1A 1Q3NA 3THQA 2UY2A 1ZCCA 3DUGA 4F9JA 2WM0A 4GG9A 2I5QA 4XISA 2OWCA 5G4EA 4S3KA 4FLSA 4EAYA 3SGZA 2ASHA 1WBHA 1W3JA 4IXXA 1E9IA 4DYJA 1CENA 4XAZA 4Q8QA 3NOEA 1RBOB 3MBDA 4AWUA 1GZJA 1W3NA 1AG1O 1B57A 1SSDA 2FFIA 4IQJA 1BYCA 2TMDA 1OFPA 1C3FA 4MGGA 4HPHA 3VNDA 3MUIA 3QY8A 3MC5A 1VBGA 1SZRA 3QM3A 4GZIA 4J28A 4KESA 1HL8A 4B5SA 2YOCA 2BSLA 5FF0A 4J3WA 4QP0A 2WSQA 3A9BA 3P80A 2DQXA 1S5TA 2XGZA 1DQWA 5K9XA 3Q37A 4O13A 4JIEA 3T81A 3ATYA 3TAOA 2PWDA 2VFEA 2QVHA 1D8WA 3LXCA 4DXKA 4LX4A 1PDYA 4IP7A 1F07A 1YADA 3CYJA 1I45A 3RPMA 4C65A 4NZ1A 2R91A 2P53A 2WQPA 3RG6A 2PDLA 2FPTA 5C9XA 2BX7A 1Q5MA 3LENA 3VFLA 4LCRA 3WUEA 4G6CA 1XC4A 3N2CA 2I14A 3GIYA 4KIEA 1TYGA 1OADA 3FJ6A 3WLMA 1L8PA 1HJXA 3BAXA 4KMQA 5C5YA 4GACA 1UD5A 1JZ6A 4RW3A 4QG8A 3ARSA 1DIEA 3TAKA 3WF3A 2GVYA 2OEKA 4IGSA 2WOQA 4NAEA 1TPVA 2DW6A 3S2LA 1GGOA 1XDMA 4F8XA 1OT2A 2CKSA 2ZYFA 3QV9A 1E9ZB 4DRSA 3PSWA 1BAGA 4OUEA 2DH3A 5XIAA 3W28A 4C1KA 1RPXA 3OVRA 3ZJKA 1OBAA 3EOEA 5F4SA 3GAYA 5T9BG 3PPHA 1E6SM 3W81A 3NG3A 4ICCX 2X09A 2HK0A 4GIEA 5G4WA 2WCGA 3ES8A 3PAOA 2WWCA 4IJBA 5DCEA 1NOFA 3G8RA 4A8IA 3QHNA 4PTXA 4JFTA 4LPCA 4QAIA 2VNCA 1KFJA 5D2TA 3QY7A 3H23A 2CETA 2IMRA 2X30A 4PL2A 1GVFA 1DWHM 3DYPA 3MTWA 3UR7A 1NP2A 3B8TA 1AMKA 3W7GA 1EIXA 3EEGA 3ICJA 4PGLA 1S2UA 4GOAA 3FDGA 4UBPC 1L6SA 4GFSA 4QDMA 2VRQA 2OT1A 3QYSA 2W6RA 5DMYA 2XZ9A 3UWQA 4WDTA 4GISA 2O7QA 2UWFA 5G2IA 3VIHA 4J4KA 2HDJA 3H8AA 4K39A 2ZCGA 3LHWA 2D2GA 2G4FA 1E55A 4OTKA 2OSXA 3NQ8A 1H7PA 3I6RA 3WLTA 2FJKA 3NQDA 4F2TA 1Z6KA 1TSIA 3RJYA 1GJUA 4WVXA 3ZSTA 1PYMA 4QG6A 2IQTA 1NFPA 5HMEA 5HPOA 5E6YA 3ZWSA 5CJMA 1HKIA 1RLCL 1VF8A 2QGHA 4F0SA 4Z0JA 1V0MA 3L5LA 2YSWA 2E3ZA 6REQA 5MKGB 1K1DA 3KOXA 2ZRYA 1J0YA 3JS3A 3DI1A 4B15A 5A6AA 1EB3A 3QGVA 3CHCA 1VR6A 4Y9NA 3P82A 4FOKA 1C9DA 1JL8A 1G67A 1W9PA 4UFMA 3HJZA 4NSBA 1FCVA 1ADSA 2X1UA 3THCA 3AO0A 3DFOA 3ALFA 1ZRQA 3BMXA 4U10A 3GTXA 4GCAA 1D3CA 4N9CA 1EDTA 3PVFA 5E5CA 2BOFX 3PWGA 5A6BD 1W37A 4NXKA 4WOZA 4O15A 1SZFA 5ABGA 4IIEA 3STGA 4JQ2A 2PRLA 4P8WA 1J2WA 1FCBA 3IANA 2F2HA 4RK8A 3SAZA 4MWAE 1TV8A 4MLRA 1KRMA 3FLUA 3OG3A 1QCWA 2Q8LA 1NSJA 5ECUA 2V30A 2HE5A 2Y6ZA 2QJHA 3TA9A 2VURA 4ZOBA 2GSHA 1H7OA 4MJ4A 2WW5A 3NZQA 4KGLA 2ZUWA 4C6DA 1HG3A 3IS4A 4P7QA 1OYBA 2OOGA 5K9CA 4JEJA 1TELA 5LNRA 3PAJA 4AHQA 4FNPA 3W1TA 3VAVA 3TYBA 2JF7A 2C91A 2Z28A 5JH1A 1RJQA 3HGRA 3MKVA 2BFGA 3NDZA 2NQ5A 4BQ2A 4NRRA 4QX4A 2WHKA 2C6QA 2V5LA 2O4MA 5FJOA 1VFHA 4KRTA 4X0VA 1E0TA 4L4MA 1XI3A 5F4WA 3TW7A 3AALA 3QEZA 3G1AA 5DANA 3CWNA 1MNSA 4LEFA 4N42A 4PMOA 2L5HA 4DEFA 3LRMA 3LSBA 1FWEC 2FHFA 4AHOA 3ZVIA 3PBVA 1Q7QA 1WDDA 1R7OA 3O7UA 1OWQA 4YWIA 2OJPA 2YIHA 5BXPA 3WQOA 1FDJA 3FCPA 4F40A 3GTIA 1RSCA 3CHVA 1ALDA 1EC9A 2VC6A 1AFSA 2PZ0A 3UCCA 1QVBA 3RPTA 5FD0A 3VPLA 4REQB 1WKYA 2WHJA 3P8JA 4H7VA 4M56A 1ZAIA 3AXHA 1KM6A 3I3DA 3IGSA 4AZ5A 1LQ2A 1NELA 3I4EA 1VP5A 2QLYA 5J8LA 3WH8A 4OBRA 3BARA 4JTLA 1W9UA 5F1VA 4CQ8A 3MP3A 4R34A 1XCXA 4C6OA 4ZODA 1UW9A 1E51A 3DU0A 4C1NA 4AC1X 4FR6A 3E1F1 5CZKA 2ZC8A 3E0LA 4AC7C 2BHYA 5JH2A 1TIMA 3LOTA 2RJHA 3N3TA 4PFMA 3WD4A 3BWWA 4D8ZA 4F66A 5CBJA 3EWUA 1MXDA 1PHQA 3T0DA 4PBGA 3TIMA 3C0LA 1FY6A 2D2HA 4TMBA 2CHNA 3W7RA 4DWSC 1XG3A 2I56A 2GPTA 1EOKA 3OA3A 1FH9A 3T6CA 2IUZA 4FNTA 5REQA 3IIVA 3W86A 3GIPA 1A5OC 2JK2A 3RLVA 4YCOA 3S83A 3KOWA 5A95A 3NGFA 3CUJA 5LIYX 2OO6A 1VZWA 4QGCA 3WBEA 1PVNA 4FSAA 2O9TA 3O6DA 4O53A 3VFCA 4ERGA 4UXDA 4B4FA 1EPVA 1CECA 4R85A 4PTNA 3AICA 1J0HA 2WQDA 2CESA 3T0CA 1JZ3A 2XN2A 3V5FA 1PCKA 1UC5A 1EPXA 3HG2A 1NF7A 4N02A 5CC5A 1GHSA 4O11A 4CU7A 4HU0A 1W6TA 2HCVA 4ATWA 5K9DA 1GZ1A 1TWIA 2ESCA 3CTLA 5I6SA 1XD0A 1XLHA 4ZGYA 1T8XA 4G8TA 4L1XA 3IJ7A 1SMAA 3M1ZA 1TQJA 4DPQA 5H6HA 2FQIA 3IV8A 1DE6A 1XCFA 2XIIA 3W7HA 1MZRA 2HROA 4HCDA 4NZJA 4RNJA 4CQCA 3C2RA 3WUFA 2PD9A 3GVWA 4TR9A 1S2WA 3R13A 1EGMA 4I9JA 3IWPA 3PUDA 4Z1DA 5HMSA 3CM4A 3UZWA 5ABFB 3TN6A 4Y6GA 3SUTA 4DB7A 2NUXA 3R58A 5I3GA 5BXTA 2BMBA 1KWKA 3TW9A 1Z89A 5FESA 3TX9A 1W5NA 4HNOA 1RXOB 5I07A 3D3AA 3ITXA 3UP8A 4YWSA 3VCNA 6XIAA 5HQLA 4NUWA 2PP0A 4G9PA 1Q6RA 3LQLA 3VIFA 2DJXA 3RNDA 5I24A 4ES4A 3T0AA 1BPLB 5J5RA 1AQFA 2YZRA 1V3HA 4IWWA 3F5LA 4GI4A 2BOEX 3AXKA 2X0SA 4MKVA 1JDFA 3PBUA 4RNHA 2FB3A 2ANUA 2VZSA 5HUPA 1ZFJA 2IKIA 5LNSA 1QBAA 2WJEA 3H12A 3ZIZA 2INEA 2XH7A 1E1CA 1EJ7L 3QJAA 2ZXDA 4DNHA 1W17A 2VXNA 3QHOA 1UP2A 5FKYA 3KLKA 1U33A 1GWJA 1ZTVA 4JICA 1ADDA 1T6MA 5D32A 4EK7A 1IR2A 1PXGA 4EF8A 1LROA 3ZR5A 1Q13A 2OKOA 4Q8NA 5I03A 3UA3A 1U83A 2CKRA 4XVEA 4J40A 1XYAA 2PC8A 4KCVA 1WB0A 2PWFA 1ZP4A 3APTA 2LLEA 3CB3A 2HTMA 3AS3A 2FJUB 3LTPA 4K7VA 3GVVA 4P2VA 5D2WA 3DHDA 4M6PA 3L5MA 3AIUA 3GDTA 4WQ6A 3B03A 1ZALA 5DCBA 3UD6A 3R2GA 4DJDA 1MFVA 2Y7DA 2VENA 4LS0A 3CEPA 2HRWA 1JPDX 5BMWA 4FP1A 2PTZA 4FEZA 1QOPA 5DXYA 2F6XA 2V5CA 4H2HA 3L9CA 2ISFA 2WSYA 2ZDRA 4UFLA 1AD4A 2JIWA 4L9XA 4AVOA 2J66A 5F2MA 1PUDA 2OKTA 3VNMA 1Y5WA 5A94A 4JN8A 3PB2A 1S5VA 1RP9A 3VIMA 4Q6XA 1JYWA 1GQIA 3R8RA 3UERA 4GCXA 1I2QA 1E6PA 2V3FA 4HK6A 3DHPA 1UJPA 3Q65A 1PZ1A 3S1GA 3LMZA 3O6CA 3LCFA 2DIKA 2A4AA 2Q6ZA 4CD7A 3PS7A 3BJTA 3UQNA 1HJVA 1OF6A 1ICQA 4DWSD 4GQGA 1S2VA 3C8FA 3KDNA 1ONRA 5FEPA 3G0SA 3LNMA 1H61A 3FYOA 3M0MA 1Q45A 4FLOA 3NVDA 3RR1A 1PIFA 4LB4A 1FH7A 3TC3A 1B4EA 2YYUA 3G1HA 3GDMA 3L0KA 4LOCA 3HFYA 4MJ2A 3O0KA 4F4RA 1EYEA 1Z69A 5A6KA 3NQMA 1UPMB 1ICSA 1XW8A 4RR4A 4MADA 1WZKA 3SRKA 2R14A 2VDIA 3LRLA 1WCGA 3HU7A 3PY2A 4F0RA 1X1NA 2JQXA 2X1RA 1JPMA 1IWBA 4NJHA 5E9AA 1C7TA 1J96A 4GUJA 1LCOA 5GPRA 2YGYA 4GY1A 2B0MA 3VC5A 4PMDA 2XFWA 4GVIA 4FR1A 1G69A 5PTDA 4O18A 1SFSA 2YCLB 4LNYA 1HJWA 3GIQA 3IPWA 4PUNA 1TWWA 3LY0A 1B2YA 2VT0A 1OFRA 4U2ZA 4PCSA 1X6LA 4LAKA 4ZQRA 1X1ZA 4FF5A 2FGLA 4AEOA 1AQHA 1RY8A 4Y9AA 4NJKA 2JALA 4CQDA 2OWXA 1JCTA 3KWXA 5C0QA 2WM1A 3KL0A 3K46A 2YA2A 2W3ZA 3BLIA 4A3QA 1XYMA 2A85A 3R0UA 3SN4A 3I10A 2GQ9A 1EXBA 2YYTA 3G1XA 3W9ZA 3STPA 4NZ3A 2NVCA 1UMYA 4AY1A 1PIGA 1CLXA 4REQA 2WLYA 9RUBA 3NPUA 1R47A 1IWPA 4LFYA 4UR9A 4JGDA 1EQPA 4KBXA 5FEZA 3WEZA 3W85A 3JZUA 1IT8A 1DP0A 3WQEA 2E6DA 3U48A 1DORA 1RBAA 1WYIA 2H90A 2ZUUA 2NVDA 3FFSA 3TTEA 4WLCA 2WMHA 4PMQA 2GVJA 4JD4A 3C0SA 5I09A 2YFOA 4ZXOA 3WQPA 2XWEA 3TOYA 3K2GA 1DVJA 5CZJA 2XINA 4Z1AA 2G8ZA 4OE7A 2P1FA 3OGVA 4FIQA 2FTWA 5LA2A 1QHZA 2QZRA 6TAAA 2YFNA 1KFBA 3VIGA 3ITVA 1KTNA 1UUMA 1FVPA 4LS2A 4HNVA 3HJEA 3BK0A 1K8CA 4ILSA 3UGRA 1TPWA 3IAPA 1I0DA 1KGXA 4NRSA 5KINA 4QEHA 3W6LA 2J25A 3W01A 4RE0A 1ZP3A 1XXXA 3WQGA 3C52A 1XX1A 4XZ9A 4Q7BA 5B7YA 3KVJA 5DRIA 5BYWA 2Y2WA 1IGSA 1VD6A 4CKQA 1M3UA 1QI4A 5T26A 1WX0A 4TTUA 1F05A 4R9XA 3TVAA 3TNBA 3WKZA 2E8YA 3GDKA 3N19B 3CL7A 5D9OA 3RRXA 3T07A 1XF0A 4CNSA 1PL9A 4PRRA 4IJRA 3M5YA 1K77A 3R8GA 4R7JA 2GVLA 2XIJA 1BVNP 1S1PA 4NVTA 3LV6A 1D3HA 4S3CA 1ZPTA 3MHFA 2VEPA 3IK2A 4CQBA 5A6SA 4J3TA 4HCHA 2Y1HA 1TPDA 5KSWA 2DSUA 3HO8A 3AROA 2V69A 2BY1A 2PF8A 3SM0A 2GK1A 4JX5A 3E5PA 1U22A 3VZZA 4YN5A 4LVDA 4KEZA 3AHVA 3NO5A 3GFXA 4UMAA 2PBGA 3TZFA 1LLZA 4ZOEA 4C90A 1Y7VA 2Y7GA 1JCLA 1ZAJA 4HNCA 3KL3A 4NF7A 5IM51 5CC7A 3GXDA 5DT5A 4CLMA 3J7HA 1GT8A 4JTFA 1TV5A 3IVSA 5CBBA 1GJPA 3AHZA 1R85A 4Q7IA 3U4AA 3SRHA 2XN1A 3BQ6A 3SGUA 4BFAA 1OFQA 2G3MA 1PZ3A 1VIWA 3P81A 4DYKA 1I75A 5E09A 4TOQA 1XDJA 4L6DA 3WD3A 2VVSA 1V0NA 3W6YA 3MHGA 3ABXA 3QQWA 4BJHA 1UUQA 3ANYA 5HQEA 4IIBA 3V18A 5AHEA 1DOSA 2C19A 3AMCA 4UOJA 5I3IA 5AHFA 1V02A 3NCOA 1US0A 2OX1A 1DJZA 3LRKA 2WNNA 1LJYA 2NWSA 2FHBA 3P74A 1VYSX 4JTJA 4PMRA 1FHVA 5HJYA 1OFOA 2UY4A 4O1EA 4IMEA 4QQ3A 1XKYA 1NY1A 4CEXC 1XBZA 3SQMA 4H8HA 4YVVA 1OD0A 2GVEA 3W7OA 3UNTA 3URNA 3HF3A 1AUSL 1TKKA 2GWNA 4XD4A 2ZUVA 2F84A 5A1AA 2ZX8A 4J27A 4J7RA 4H6QA 4JCMA 3TE9A 1V7YA 5A8QA 1KV8A 4IGMA 4XK2A 2CLHA 2Y62A 5GNZA 1J0ZA 3QLDA 1JCXA 3HG3A 1FWDC 5FSEC 3WDHA 3AIQA 3GFZA 1XIBA 4CGTA 2P3ZA 1OT1A 4NZCA 4H8NA 4N6EA 2PA6A 4WY0F 2HS8A 3T55A 1TX0A 3TC6A 2Q3RA 1HP4A 1BD0A 3T40A 1ZBVA 2V6AA 3DGRA 3F4NA 4GNJA 5B80A 2KAUC 2YZ5A 4TX6A 4XWUA 4YTUA 1WE5A 1XYBA 1W3LA 1ZBWA 2BXVA 5CZTA 2CXGA 3MV01 3GY1A 3XISA 1AD1A 3W7IA 3WQ6A 3M4HA 3WZ0E 2I7GA 1GG1A 1LT8A 4AMCA 4MWAD 4S3EA 1XLCA 1M04A 5FJRA 4GUGA 4MY8A 3ZJ8A 4JTAA 4TU1A 3U2CA 1RA0A 2YL9A 1CCWB 4E6MA 2E6YA 3FKKA 1B9BA 1N55A 1JNEA 2NXGA 3O15A 3HPXA 3M41A 3CU2A 1A5BA 4B5WA 3P7YA 2PTWA 4JFWA 3WEOA 1E4NA 2TRSA 4B3KA 2DT3A 3ZYZA 3LMYA 1G4TA 3DFYA 4YYCA 1UBPC 3PHAA 4PSPA 1WZLA 1Q7MA 4IQEA 3ID7A 4DWSB 3D0CA 4OOZA 3EEZA 2O56A 2ZADA 4DJFD 2J7FA 1L9WA 2YW4A 3C2VA 1E0UA 2VP8A 3H2MA 2VI0A 4IMGA 3TOPA 3CQHA 1R2RA 2C1IA 5T8GA 3T8LA 3SIMA 3MUZ1 2PDKA 5G2HA 4HN8A 4JAWA 1L2UA 4PR4A 1IZCA 4HJWA 4QDWA 2QUUA 3UFYA 3TW6A 1QNQA 2PDWA 1XJBA 3WF4A 4IT1A 3TMLA 4CCDA 2QCFA 3T44A 2I57A 4PCNA 3GH4A 4C6LA 2QQ6A 1PKMA 2ZBTA 3PZIA 2EG6A 1BF2A 3PANA 5A8PA 1JI1A 7XIMA 1XSIA 3W72A 4YVPA 1OC5A 3CQIA 4N0RA 1TWDA 4YTTA 5H8MA 1D9EA 2ZIDA 3MW7A 1WP6A 2Q02A 1TV4A 1J5TA 2GJXA 3FXGA 3V0UA 2WMGA 3NSXA 2AGKA 4XZNX 3A21A 3CT7A 4TXEA 2XPKA 1HF6A 1A5LC 1IYXA 3GWQA 2FZ9A 3Q4DA 2CBVA 4O14A 3TP4A 3ZQ9A 3QBUA 2Z26A 1EGZA 4MY1A 3ZR4A 3EWWA 3IK4A 2QPUA 2CLEA 2I9EA 5CBIA 1RV8A 4KPLA 3O6AA 3CH9A 4HNNA 2QJJA 4Y96A 4UFJA 3WBYA 2ZX7A 3NFUA 4JKLA 3BCDA 2ZXAA 4JTUA 1WOAA 4O0QA 3ZO9A 1DJNA 1RLDA 1B54A 1YE6A 4QE1A 3OVGA 3T8QA 4OWGA 1XFCA 1M65A 2WNWA 3KVLA 3WFAA 1YMYA 4LUTB 3WD1A 4GKTA 1GUVA 1PX8A 4EXQA 3OLDA 3VNJA 4GYFA 4W84A 2W5FA 3TCSA 2YBVA 4RZ6A 3T0TA 4NYUA 4KFNA 3L4TA 1EQCA 3DHUA 2E77A 1BVZA 4JTDA 1AJZA 4K37A 1A49A 4RDYA 3BO9A 1WNOA 4GZJA 4J35A 2ZXQA 3EB4A 1MW1A 3NQVA 1C29A 2CIPA 3DG6A 4AY8A 2GL5A 1OGBA 2G37A 3LX9A 2B81A 3H7UA 3GKFA 3NIYA 1EIBA 1EEXA 3GBDA 1GCYA 1J93A 4MLJA 2WPGA 2RGMA 5DY2A 1H1YA 1J0IA 3TA6A 3T7VA 4QLLA 3COTA 3U7VA 3SCTA 4LY4A 1TFVA 1TJ0A 4ZB2A 4HZ8A 3G0UA 3TR2A 5A6LA 2OGYA 4IMAA 2GDUA 2J7DA 3CV6A 3FJ4A 5A8GA 3W7LA 3C61A 5A6TC 1UROA 3ITYA 4XZWA 5HNNA 3QFEA 4UFIA 4ZE5A 5IRPA 1MI3A 2OEJA 2ZKMX 4OJYA 5C2XA 4ZTXA 4A3HA 1JDCA 1ZJAA 3TN4A 4D72A 1NEYA 3NPVA 1VC4A 5G2WA 1HL2A 3C86A 1J10A 5MHBA 5DMMA 2X05A 1AQMA 3PZVA 4HYWA 2A2IA 1DV7A 2BVDA 3KBJA 4X2PA 1KM0A 2DW7A 3VD9A 3ISIX 2VCAA 2J6VA 3CUIA 3QY6A 3TFXA 5HOSA 2IQDA 1XR2A 3MDUA 4WKAA 4Y9MA 3PZMA 1QPOA 1QUMA 1UASA 4RL3A 3JUGA 2AOSA 1U5JA 4MYAA 3WH7A 3WFLA 4O50A 1YW1A 2GZXA 3AIVA 4C6QA 2WJZA 4B5TA 5JIPA 4DWDA 1M53A 1LLWA 2HXTA 4NX0A 3WQCA 3EDFA 3CO4A 2GJPA 3QV6A 4NILA 2JKPA 1I1XA 3B9DA 1NJJA 3I65A 4LBUA 2DZBA 3PPGA 5D38A 1TJRA 2HQAA 5D2XA 1F3EA 3WFZA 5C9UA 2JEPA 2QV4A 3LXAA 5TIMA 2P0IA 4WD0A 3H26A 3KDOA 4F3HA 3CT2A 1E6QM 2WZMA 1NARA 4ADTA 3E0FA 3A13A 5HINA 5HQMA 2VELA 4HU4A 4N7QA 2CITA 2DVXA 3OVQA 1GTHA 1DJYA 4UZUA 3HQNA 3EB3A 2A3EA 4Q8PA 3AFBA 2WVUA 3R5EA 4Y8FA 1UD4A 2F8QA 3S5OA 4UNLA 4A3UA 3TJ4A 3V16A 3IIZA 4RJEA 4PRTA 1SFLA 1DKWA 4RZBA 4IP5A 4AWSA 2G3NA 1R3VA 5D04C 3NL6A 2J13A 4FAMA 1UR9A 3GB6A 3N9KA 2IXVA 3W22A 1E1FA 4XIMA 1KR1A 4HVXA 1XICA 4IF2A 1CXFA 1X7FA 3GZAA 4GQRA 1VCGA 3O63A 3RU8X 2WAGA 2OFJA 4TVUA 5ABFA 4Q8OA 5FA5A 2H9AA 3O06A 2Y8VA 3POCA 1OX5A 3UJRA 4ACZA 1C91A 1BHGA 2ZXBA 1YTKA 1Q7ZA 1A5KC 4ZENA 2CXEA 3SEPA 5CXPA 1QR7A 1XLIA 2EPOA 1W9XA 1WA3A 3BSHA 1A4MA 3LPPA 4FNSA 3BTNA 3GVRA 5AN7A 3M43A 3PZ9A 2WC4A 1F7BA 2ZRWA 3CLMA 3BOLA 4ASTA 1OCJA 1VPXA 1UR0A 3PJXA 1UQZA 4CN6A 1GVEA 4JY9A 1SO5A 2OPJA 2W91A 4DNMA 4L4LA 4MKNA 5C6MA 2G3FA 4K1WA 1VCVA 3EWCA 4E3TA 4D6IA 1Q6LA 3CIXA 4ML4A 1NIUA 1Q8JA 1SPQA 1UR4A 1TREA 3TTYA 2OYLA 3N3MA 3RM8A 4C91A 5CH9A 3EMZA 1F5ZA 3QSRA 4CQ9A 1UA3A 1D7KA 3S46A 2P88A 5U7SA 4UFKA 1XS2A 3NZGA 4FZIA 6ALDA 3BV4A 2Q01A 4M7SA 1RCQA 1F2JA 3P0WA 4Q4OA 4FA3A 3WQ8A 3TSBA 4P8XA 3CXOA 3LHVA 1OFEA 2DT1A 3SGGA 4GYKA 5TF0A 3SCRA 4JTGA 3URBA 1MRAA 1L6YA 4WSHA 4MZYA 2WJFA 2J62A 3B9NA 4AZBA 3OOQA 1OFAA 1EJTC 2Y89A 3MYPA 3Q58A 4KCTA 5C54A 1O94A 4IHCA 1JUKA 3CMJA 2ZQ0A 5CPTA 2GQ3A 2FIQA 4PC8A 1X97A 5LXEA 1EUNA 3CTTA 2CZFA 4LRSA 3LBMA 3LCWA 5J04A 4BK9A 4HSOA 3IRDA 3A22A 4C6BA 2RUSA 3EAUA 4GYJA 2FMNA 1KQZA 1UKTA 3G24A 3KVKA 4INFA 3ES7A 4GVHA 3RO6A 2WSPA 1ZHAA 4ZBCA 5LSMA 3QMSA 1A0CA 3SDOA 1OX4B 3VUSA 1BYBA 2QJNA 1XINA 4HYVA 4YPJA 3WK2A 3PZGA 1IXQA 1ICPA 3MB9A 3L7RA 1EA0A 1KCKA 1I4NA 5BWAA 2I5GA 5C9WA 4N2YA 2J78A 4FLRA 1WDPA 1US2A 2ZZ5A 4YLWA 3R4IA 4WXYA 5FJIA 3L4XA 4M51A 1TMHA 2OYMA 3GK0A 3RJXA 3S2JA 4JTSA 4F0KA 4LSBA 3V0TA 3REQA 4PUJA 3L4YA 3NURA 1EOMA 1GVQA 4I8YA 5DN1A 4PFHA 1H51A 5HR7A 1XGDA 3VTRA 3FAXA 2XH4A 5D05A 2OOFA 5CLWA 4YU1A 3L66A 1VEOA 1FHLA 3P14A 1O5QA 1UA7A 4AX7A 2GDQA 2Q71A 1PWLA 1DEDA 4Q32A 2YCIX 4XVDA 3UCQA 6A3HA 2H8XA 3GG0A 4DM2A 4H9VA 4ORIA 3GXTA 3VO0A 2IPGA 1EWDA 3O1NA 2QGYA 2J79A 4U2YA 2A7NA 1TZZA 1UJQA 3E2SA 3WH5A 4UTMA 5EA9A 3VDAA 1BYAA 4M6QA 3WO8A 4M81A 2OLHA 3LB0A 1C8XA 1JPHA 2FVKA 1V3JA 3WNNA 2WV8A 4LT9A 2EPHA 2VQTA 4PB4A 4LVFA 5D03A 2RH9A 1DYSA 3QZAA 4CCCA 1FWRA 2DZWA 1TG7A 4PBFA 5D02A 1TWZA 3APYA 4JQ1A 2V82A 3H2NA 3AYTA 3PZNA 3PPFA 2NQLA 5EB8A 2YL6A 4PTDA 3GDBA 3NQGA 3WCZA 2WCSA 3NEVA 4RNFA 3BQ5A 2F61A 3POHA 4U3AA 4BI6A 3GSMA 1EH9A 3SBFA 3ZVHA 1V7AA 3GYEA 4MB1A 4J3UA 4MOZA 2CZEA 2HNHA 2HSAA 2V5KA 3ZXWA 1WZMA 2IKGA 3CHDA 3HQOA 4Y7EA 2VUYA 3W76A 1O4UA 4PB3A 5D8ZA 2VGGA 4NJIA 1S2TA 5TNVA 3L4ZA 1E5NA 3MUCA 3WLNA 3E12A 2YCEA 3H2OA 4D6GA 4AG0A 1YNPA 4UCFA 1PX4A 2ZRZA 4BHYA 3DECA 2C13A 3RK8A 4WF7A 1XIJA 4RZ4A 2ZOXA 5CAKA 3F5KA 4H6EA 1JDAA 2VX7A 4XSMA 1R30A 5A69A 3R6IA 4M1BA 5BOEA 2OQYA 4FK9A 4IGNA 3NGJA 2VHLA 5HBFA 4HK7A 4FLQA 2J7GA 4UUIA 2DVUA 3SW6A 2KX9A 1PTDA 1EFZA 1W3TA 1XWYA 4UQBA 2H3DA 1TV2A 3VGDA 3WQWA 5BROA 4C6IA 1TR1A 1YXDA 3I6EA 3AZTA 3P61A 2CFFA 3PC0A 4XKMA 3IAQA 5IBXC 2IKJA 4RLIA 3ABQA 1LQAA 3KS6A 4PUDA 1WXJA 4GUFA 5JVLA 3GC5A 4GPNA 4JR5A 4PMUA 1E4LA 2NX3A 4PODA 3RM9A 1MVYA 2INFA 3B8SA 2WK2A 3V3WA 4DBUA 1UKQA 1R5YA 2E1WA 1XG4A 4IL2A 1LTDA 3LHTA 1A0EA 3ZLGA 4HTYA 1FX6A 1KBBA 1UC4A 4LVAA 5G1TA 4HHLA 1DQXA 1VLIA 3W1RA 2V2CA 4US5A 2PDPA 3PFRA 2NUWA 4IFKA 3B8WA 1KW1A 3STCA 3N6QA 1V51A 4W7VA 1XUUA 3U9IA 4OBSA 2EJAA 3VGEA 5H8PA 3KRSA 1E3ZA 3TSMA 1E56A 4DVOA 3C2OA 5F7UA 1DXEA 4X9SA 2BWGA 2GLKA 3UJ2A 4GGHA 3SCUA 3WNKA 5TAOA 1HGWA 5HWJA 4NAFA 3S4TA 1VGAA 3GG7A 5ECVA 3VMOA 4R9OA 4R7WA 3OZPA 1Q4NX 2BOGX 3OG2A 1RCXB 3AHTA 3QC3A 4LJ3A 1ML1A 4I9TA 2OZTA 3Q45A 1CTNA 1WO2A 2NQJA 3CGTA 4LUSB 4WJEA 3A4AA 4YVXA 1UP3A 2ZRXA 5BCAA 5FL0A 2WANA 5JXQA 2ZVRA 1N2VA 1LF1A 1V79A 3KBVA 3KOFA 4AZCA 4G5DA 4G7EB 7TIMA 3CZJA 3LLDA 5I0DA 2NX1A 2D73A 1QWGA 2VGIA 3E0VA 4F48A 4A29A 4GX8A 2EPNA 1QPQA 5TD4A 3QGKC 4I6VA 2ACRA 4OKDA 1F73A 1AA1B 2V81A 3U3HA 4G2DA 4TX8A 3DENA 3DBPA 2XVLA 3LXBA 3ITTA 3WY1A 1PAMA 4EVZA 3AI0A 1RQHA 2NSXA 2NUYA 2GUUA 4GMEA 4Z0SA 1REQA 3OLGA 4KF1A 4CD5A 1EKOA 2AAAA 3U7BA 1JYVA 1W1TA 2D24A 3MDWA 1J01A 2CLFA 3CQ0A 4QJ3B 3T78A 3PWIA 1KD0A 2ABAA 2DT2A 4J2MA 1K70A 4TO8A 3ORWA 2WMFA 3S9ZA 5C7HA 4OECA 1QI3A 4RW5A 3WYZA 2ZE3A 4HB7A 3NOYA 3B04A 3K8MA 2VWSA 3UWZA 3EB2A 3N4EA 1QI2A 5T91A 3WUBA 3DFHA 1S2AA 3T9PA 3D6NA 4PMNA 4AIBA 4D6FA 3K8KA 3IJQA 2OX4A 1QK0A 3S2NA 3II1A 2MUCA 2BGQA 1OY0A 4C6PA 1OJXA 3DESA 3QR3A 5AC7A 1SM9A 3CAVA 4PBEA 4CCEA 4UB9A 3WENA 1B3VA 4GHRA 2NV9A 4JBRA 3M5VA 3HA1A 4P5UA 1DIDA 1OCNA 1Z8AA 1GQNA 1PPIA 1LL6A 4IH3A 1Q85A 3EA2A 4QS5A 2B7NA 1AH0A 3F4DA 1MDRA 2AAMA 1FWAC 4S3JA 1JQVA 1NFGA 1CGUA 4UQEA 4XKYB 4GIAA 1QNVA 2GOKA 2VEGA 3BH4A 2R6OA 3CO8A 2R1PA 3M6YA 4JIRA 4QFUA 2Q09A 1A5UA 1JD9A 2YCLA 2WZTA 4QTGA 3KBNA 1H4PA 5LNVA 3GO2A 3VIKA 4HIBA 4W87A 1OZMA 4CVWA 1AJ2A 2AMGA 1YPIA 3E74A 4Q3MA 3PNUA 1V3LA 3HQ1A 2V68A 1K8XA 1PV8A 1V3MA 3S1UA 1GPFA 3H7VA 1GOXA 1W5MA 3ZZ1A 1ITUA 2G4JA 1XM3A 3ZOAA 5M5DA 1TB3A 3ARRA 2DV0A 1MEIA 5D30A 4BS0A 2HXUA 1QTWA 4NZ5A 1FXPA 1SU5A 1MZHA 5CJ5A 3KHDA 5LGXA 4W5UA 4AW7A 1G0CA 2E5CA 2ON3A 2CLKA 5CPMA 5EY5A 5HANA 4GI8A 1G7VA 4GK8A 1OQFA 2C1HA 4A8LA 1I8JA 1X8CA 3MWAA 2FZ8A 5HATA 4LYKA 4DO4A 3R10A 8TIMA 3VNZA 2YDRA 4TMCA 1JYNA 4DQWA 3GR8A 1TVPA 3S5SA 3GVQA 4MNLA 3NPWA 3CJPA 5AFDA 1S3TC 3UJSA 3CUZA 4OFCA 5RUBA 3BJSA 4IPJA 3LGEA 3PFMA 3WQ4A 3L21A 1RZMA 1LUCA 3TWBA 1D8CA 1U1JA 1R3WA 3FKRA 3ZLHA 2Y70A 4WEVX 4JCLA 2A7PA 4KRUA 4RNIA 3VDHA 1JD7A 2XVGA 1K9DA 1LWHA 1W5QA 1OB0A 3SY5A 1B3WA 2H9AB 3WLIA 3NL3A 2EJ1A 5E9XA 3GNDA 4JYDA 1BXCA 3E02A 3G1DA 1XP3A 2VM8A 1GORA 3KOZA 1ZGDA 5AYIA 3UXIA 1TPH1 2QT3A 5EKYA 3LHZA 2QHAA 3SZ8A 3W74A 4MTVA 1J79A 2JEQA 1KM3A 1FKXA 1O5KA 3RR4A 4P8VA 4DZIA 2WMIA 2ODOA 3EWZA 3N11A 4DF1A 4QE4A 1W5OA 2WVTA 3GC4A 1G4PA 3SCWA 2A1YA 2GWGA 3L4WA 1LWIA 4AZIA 4Z08A 3UWEA 2POZA 3W2UA 2AKZA 4GC4A 3TTOA 3URQA 3SR7A 1CXIA 4Q33A 3W70A 1TRIA 3EOUA 3RILA 1BF6A 2RKXA 1QNRA 1EXPA 4FI4A 1HL9A 1Y5XA 4H19A 5D9PA 3KWSA 2E9LA 5I77A 4AF0B 1R38A 3M0XA 3MCOA 2ABBA 4R88A 1WDQA 3B05A 1CNVA 1LBFA 5BW6A 5I3FA 3PR2A 1IIHA 3SQLA 4GYPC 3BGJA 3CIVA 3BAIA 5C2GA 2R1MA 4GI9A 4NASA 4S2CA 1V77A 1P0KA 3WLHA 1E5JA 3HPFA 4ONVA 4PZVA 4WIWA 3R12A 2CHOA 4O52A 5MKGA 1G6CA 4E2VA 4H4IA 1JZ2A 2VR2A 2JF6A 4JFUA 3EBVA 4ZQPA 1EJSC 3GS6A 4JFSA 4MM1A 1K8ZA 4AZ6A 3IGHX 3CLWA 4NAFB 1R86A 4L64A 1E1EA 1UIOA 4UMCA 3G1RA 3N25A 3M46A 1KV5A 3AJXA 4O1FA 3W7EA 2UY5A 1O5XA 1P1MA 3A23A 4LAZA 4A6GA 4HD5A 3DKLA 3QMTA 3MI2A 3VDCA 2XFYA 3MUAA 2AQOA 3GW3A 1IQ8A 4JTHA 3GHUA 3ARTA 1KQYA 3UCDA 2FHCA 5KZDA 1UBSA 2Y5EA 3PTKA 1IT0A 5EMUA 2Y5JA 4JTKA 2OLSA 2XFRA 3ITCA 3EDDA 2AL2B 3XIMA 1S2CA 1Q4WA 1FQ0A 2D23A 2BLEA 1EX1A 3DZ1A 4DY1A 1I2RA 4IMCA 4LCQA 3KTCA 5D8WA 1SJAA 4UQCA 2XVPA 4AISA 4XZHA 4PTMA 3R8HA 3MT1A 3P5YA 3ZM8A 4NI8A 2OVLA 1TO3A 4J3XA 4K3ZA 2BGSA 1H5VA 3VMNA 3UZZA 1ITQA 1B30A 3SRDA 1KB3A 3N34A 3SUUA 5EMJA 1KLYA 1IEXA 4UTWA 1BWLA 5IXEA 4O1AA 3R0KA 2HBVA 1UKOA 1ZENA 2CBIA 1P48A 1GVRA 1S5NA 3NEHA 4GRSA 1SSGA 2Z6JA 3W3OA 2WMIB 1JCNA 3VNKA 4HA3A 2XISA 1HTIA 3WJWA 4RPPA 1YX1A 2HNEA 9XIMA 4PUUA 3M16A 3W6MA 3EKLA 2HMCA 2YA0A 5KZEA 2VFHA 3AOFA 3B8IA 3VGGA 2YB4A 1I9CB 4R7OA 1FWNA 2WBKA 2VCBA 3M44A 3YPIA 2GK1B 4IXHA 4GIYA 3KBWA 5FIPA 5F4XA 1XD1A 1KM2A 5HUOA 4O12A 4AVNA 3PZUA 1GTEA 1Q6FA 3TEVA 1K7FA 4ERIA 2O0TA 1FDYA 1KM1A 2CNCA 4TV6A 2D3NA 4EXBA 3NA8A 4HNUA 3W2NA 5B7ZA 2UBPC 1D3GA 1UCWA 1KCXA 3BLOA 1XYCA 4DJDD 3RCMA 1KWGA 1OGSA 3B4UA 3AJ7A 4U3CA 2BTMA 3Q94A 4NZFA 3NPXA 3BOXA 1M6JA 1W3KA 4A2RA 4I7UA 3GQYA 2VDHA 3PBGA 4AD1A 4W5ZA 5LZLA 4EPKA 1WKFA 5G4HC 4ZVJA 4ML9A 1ZZMA 4H9TA 2J8TA 1FOBA 4UTWC 4EIVA 1EBHA 1CYGA 3BSMA 5EMMA 1XSJA 1DWIM 3IJ8A 1FXQA 2NT0A 1L6GA 1XLFA 5FEWA 4DXVA 4QJ4B 4FALA 2VFFA 1PX3A 1GOOA 3KAOA 2GGJA 3AMDA 3I7SA 1FRBA 5CSRA 3GE7A 4HPGA 4I7WA 3GH7A 4IJCA 3SECA 3LQGA 4C6CA 3LDVA 1QAPA 1DPMA 1H7RA 2QDDA 2PWHA 5DY3A 3M7SA 2AMXA 4MSSA 5AVHA 3BSGA 2VEKA 4Q4MA 4PUKA 1SZGA 1UMLA 4IM4A 3KEHA 5BWFA 2CLOA 3AMGA 3GG1A 4ZO9A 2YXGA 5A5WA 3NL2A 1KKRA 3SFWA 1EP1A 4MZ8A 3VXGA 4WDWA 1ZU8A 2C71A 3FHQA 3HBLA 1EHAA 2WC7A 2BV9A 1IGWA 4XAGA 3DYMA 1CDGA 4W7UA 3CV7A 4DN1A 2ZZ7A 4XD3A 3MVIA 4MNMA 4JX4A 3LNPA 3C0JA 4H9UA 1RP8A 2YDQA 5D9NA 7A3HA 2PWVA 1TTJA 1XHGA 3F5JA 4IG2A 3ARVA 1TV3A 3ME3A 1SW7A 1MUWA 3HURA 1JIBA 2YXXA 1T99A 4PSRA 4M29A 3VKCA 4GO9A 1M68A 4AH7A 1VEMA 2XIQA 2PTYA 3W0KA 2FDSA 3G3MA 3REQB 5IDIA 4AVFA 1S1RA 3RCYA 4K8EA 1OF8A 4K2SA 3EYPA 3IEBA 1W1A1 3G1VA 3R43A 1SFJA 3W24A 1N8IA 3VM5A 4L4OA 1NWUA 2XFFA 3CZGA 1ZNNA 1ME8A 4MUPA 1Q6QA 4GINA 4GBUA 3WBXA 1EJXC 4PMJA 4S39A 1LG1A 3GFYA 4ERAA 2REQA 1QATA 3AS1A 5D37A 2VC7A 3GDLA 2DIJA 4HKPA 1XRSA 5CGQA 2DT0A 1TRDA 3OP2A 1N7KA 3MV11 1ONWA 2XIOA 2IKHA 1UUOA 2GDVA 3VMPA 1NFBA 3EZ4A 2V8ZA 3MO7A 4BI7A 1GVSA 4RXFA 2FGZA 4E4UA 5DXXA 4HMCA 3KRBA 1Z42A 3ABZA 1Q8AA 3WLPA 4NJJA 1ME9A 2IPWA 3MP5A 3IIOA 3PP7A 3I3EA 3DX5A 2VFDA 3VU2A 3WD2A 4L1GA 3S5ZA 3B97A 3AS0A 3MKKA 4YS1A 1MUCA 4ROPA 4CD6A 3WNLA 1GYMA 3FNDA 4HOZA 4C7FA 5MF5A 2XHYA 3AXIA 2QCCA 2HVNA 3TU9A 1SW3A 3QW4B 2WMKA 3W71A 1W2VA 2NV1A 5AYZA 2QJIA 2VZVA 1F61A 1PHWA 4GA8A 1BG9A 4H8UA 4IQDA 2FH8A 1YE4A 1YIXA 4D6EA 3VIJA 1SJCA 2Y5SA 3G22A 3P8IA 2X0YA 3VKJA 4KCWA 4OUIA 4YCPA 3LCGA 3VM7A 1K3UA 3WF0A 2XM2A 1MW3A 3LZ3A 3EMQA 2BASA 4CU6A 3GUGA 1RA5A 1FWWA 3TN5A 5AC5A 1P0EA 4WDXA 4DZAA 4RPQA 2X2GA 2RFGA 1A5NC 5EMYA 1POJA 3CZEA 1HKKA 4DJEC 4IMFA 3ZWTA 1L2QA 4IX2A 4UTTC 4B5UA 1ZL1A 5IHRA 5D33A 3E96A 1JRBA 3PTQA 3U5UA 4S23A 4PL1A 1G7UA 5I79A 2O9OA 4BA0A 2PU0A 3L2LA 2OB3A 4GH1A 1BFNA 2PC4A 4GD0A 3CUGA 1W3IA 3ERPA 3FAWA 4UNIA 4AD2A 2TPSA 3H54A 4V28A 4QCFA 4B5XA 1BXBA 1FCQA 2R9RA 3W38A 1X7IA 5LIKX 5EPDA 3GG8A 4Z2HA 3FHAA 3WD0A 4ACYA 1FP9A 2HVMA 3EKGA 1RJRA 4IUGA 4ATDA 4LRTA 3GLCA 3BG3A 3WDRA 5C71A 4HPJA 4OZOA 2Y8UA 4JKMA 2PEVA 5DT7A 4B5NA 1YTDA 3TQPA 3RLGA 1FUYA 2Z1WA 5FJJA 4JX6A 2H3BA 2GFTA 1E15A 3DG3A 2QCHA 2NQHA 4D8AA 1UD3A 3B0PA 3KCLA 4CU8A 2VD9A 5K4XA 2QCDB 4YHGA 5A2BA 1ISWA 1W1VA 3EA3A 1ONXA 1HO1A 3GW0A 1QMLA 4WKHA 3I3BA 4MB4A 1B3OA 1UZDA 1WOBA 2KZHA 3WNPA 2VL4A 2Y61A 2VTFA 5HNRA 4AIOA 4ZMGA 4ZSUA 1OFDA 2I9UA 1FFRA 3EA1A 1G5AA 2EKCA 1AW1A 1SMDA 2PZNA 8CGTA 3VA8A 3LCIA 1EL3A 4DO7A 4YXGA 2VWTA 1J5SA 3ZS4A 2TYSA 1BEUA 2GGIA 3OIXA 4IICA 1CXLA 3STFA 3FN9A 3GXIA 2XZ7A 3SURA 5AVNA 1KC7A 1Y5VA 3NQFA 2Y85A 3QR1A 2A3AA 1IEVA 1UB3A 2VR5A 3M64A 1CI1A 2D2OA 3RX4A 2VOMA 3VKBA 1EDGA 1YPFA 1B3XA 1UKSA 5M3WA 1XRTA 1A80A 2D0GA 5D4YA 2CYGA 3EX2A 1PKYA 1DXFA 2JBMA 2Z6IA 3D46A 2CHRA 1MEWA 4CNOA 7TAAA 1NOWA 3A6OA 1Z9AA 1O60A 1DIOA 4EF9A 1V3IA 1XISA 3DAQA 2RDTA 4HYRA 4NY2A 3UG8A 1R3SA 2V0TA 3OHIA 2X7VA 4L61A 3RX3A 1CGVA 1TCMA 1YKWA 3UG4A 3XINA 3QYQA 1ECEA 3V1HA 2AGTA 4LBRA 5HNUA 1TV7A 3VCRA 2XSBA 1R9ZA 2C14A 3KTXA 5CGTA 6ENLA 4L7ZA 4D1JA 3K1GA 5FL1A 1KFKA 3HV8A 1H5YA 1PS9A 4WJXA 1CGTA 2XUCA 4F79A 1UIPA 2WSKA 4QNWA 4O0KA 3V1PA 5LIUX 4X22A 2R94A 2YBUA 3UWVA 3WJZA 1Q6CA 1TPB1 1YNYA 3LI0A 3UY7A 4M19A 2CZVA 3W1UA 3TYZA 2J77A 2OT0A 2WNQA 1QHPA 3PSVA 4A8NA 4ZXLA 1W8GA 4IX0A 2IXUA 2PDBA 2PTDA 1W91A 5KEZA 1HJUA 1QO2A 2C79A 3PJWA 2QCMA 4PCPA 1UR3M 3CK5A 3M0YA 2OCZA 3ZFHA 3FVMA 3LCXA 2WHMA 1V3KA 2E7FA 1LBLA 4A05A 2QV5A 3CEUA 1E9YB 4KEVA 4TX9A 1W2PA 1PTGA 3KFTA 1NDVA 4K8HA 3BOFA 1NU5A 5FI8A 3UG5A 3GNPA 4FB7A 1XBYA 2XGBA 3CH0A 2IS7A 3G8EA 4B16A 5A8NA 1HO4A 1EJUC 2Z00A 3CUHA 3SY1A 1N82A 4AEFA 3MQTA 3AIEA 5FJPA 4AD0A 3UEQA 2GJNA 4GWEA 1KFCA 3RXZA 2J47A 1KTCA 2WVSA 1ENUA 2REQB 5M1TA 5I02A 3PPCA 2QAPA 3GH5A 4E3VA 2Y7EA 3DFPA 2WXDM 6CGTA 1E6RA 2ZRVA 1DJIA 1O1HA 4KIRA 3S1XA 4JTEA 4YNGA 2ZUSA 1JQXA 3CV2A 3SUSA 1O7AA 2FPVA 1Y65A 1ZS2A 3R7MA 1O66A 4GVFA 3B9OA 1BWVA 3T09A 5LNWA 1GVIA 5ABTA 5GQBA 4JL2A 3INPA 2G0WA 4CUCA 3OYXA 2CLMA 1ISVA 4MJZA 5A8MA 4LUJA 3WDPP 3P84A 4CD4A 1E71M 4MFDA 4BF9A 4QRNA 5CPQA 4M24A 2OQLA 3MSRA 5C70A 2VC5A 3WMLA 3CC1A 2BNJA 1EGVA 3PTDA 3TXZA 1EJWC 2BXZA 2Y63A 4QM1A 1GQLA 4O8RA 2FKPA 1DWFM 2PCEA 3A12A 2J7EA 4Z2LA 2H8ZA 3W1NA 3EKZA 1R87A 7REQA 4WRHA 3O0FA 2PF0A 3EDEA 4OV4A 3VCCA 2BVTA 4H1ZA 3MSDA 4C1NB 2Y88A 3DI0A 1PJ9A 4JQ4A 1G94A 4M82A 1O1ZA 3H53A 4HPNA 2ZVIA 4JZ5A 2Z2AA 3W7KA 3WMBA 1LRTA 1YHTA 3QTGA 5M03A 3WLRA 5IFPA 1A50A 1I2NA 2IQ0A 4R53A 4D8LA 1LL7A 2QUMA 2VQUA 3SADA 4JKKA 3TR9A 1UWSA 3S6OA 1AK5A 2E67A 3BGAA 3FA5A 3UBPC 1XPGA 1KRAC 1ODZA 3S5YA 2PWGA 5CG7A 1WUFA 4Z2GA 1TA3A 1AH3A 4RV8A 1OEPA 1H49A 5XIMA 3VD5A 3QGAC 3SY8A 4Q6JA 1VJZA 1JPIA 2MANA 3AIRA 2PWEA 4BQ4A 2QULA 2V38A 4H7ZA 3LUTA 2W9MA 3EOOA 4U28A 1BTCA 1JGIA 2HJPA 1EO7A 2ZX5A 2DDXA 1I1WA 3VKKA 1Q2SA 4EPDC 3N2MA 5DRCA 3F03K 5CPLA 4GGBA 2C8NA 2C18A 4FXFA 1XLLA 4CNTA 3CQJA 4MZ1A 1LL4A 3TCEA 1GEHA 3ABSA 4POCA 2PMQA 4X60A 5AB3A 4C6EA 3PN8A 3WLQA 4CCZA 3GYCA 1GVYA 4Y2WA 1F6KA 4IOTA 4XV0A 3U6WA 3W37A 1S46A 3ZT6A 2ZE0A 1YPXA 4QNEA 2PP1A 3RLUA 3NQ7A 1BSLA 2PPGA 1N8WA 1OCQA 3PJUA 4Q7NA 3L0GA 4OBTA 4PCTA 1OX4A 2Q8XA 4MB3A 1QXLA 2INZA 1IF2A 2DU2A 3LGGA 2YDAA 1C92A 3LEPA 3H2FA 4GLEA 4J3VA 2RDWA 4YJ5A 1JCJA 3QQ1A 2YX0A 2ATSA 3G18A 4PUWA 1AH4A 4MWAC 4W86A 4JDBA 3IJDA 3P0XA 5I06A 3QMRA 3VZYA 4LYQA 4QR6A 2YKKA 3R94A 3UPBA 3VABA 4NIRA 3RM4A 4NX5A 5H2ZA 3MUY1 3WN6A 4DELA 3WUGA 3GU9A 4WGHA 1XIDA 3KBSA 2PCQA 4RE4A 7CGTA 1UG6A 1W0MA 4J9JA 4OOUA 4X3ZA 1TJPA 1JZ4A 1E3XA 1NOUA 3TDFA 2VFIA 3WJSA 2EGZA 1VFTA 1BXNA 3NXFA 5SWUA 4TQTA 2I16A 3L4VA 4Q8WA 4B91A 1LT7A 3PK7A 1H11A 1QNOA 3O2LA 4KWVA 5HNTA 3AUOA 2V9DA 1ZBCA 3N6JA 1U30A 1E1CB 3OIHA 2VMFA 4F2BA 3MSGA 2OGJA 2YJQA 1GVOA 3W53A 5HPCA 2PDIA 1ZQ5A 3N14A 1FWIC 4K36A 4CVUA 1CXEA 2DY3A 2GQ8A 1JZ7A 1SO4A 3UT0A 1V5XA 3UA4A 1W1PA 4JTIA 4EXAA 1CGXA 1SGJA 1VFLA 1TPC1 1VYRA 2W92A 4AXKA 4UOZA 3WJYA 1KRCC 2OELA 2DEPA 2PGRA 4IISA 4S1FA 1MQQA 3NZRA 1XYLA 3TKFA 1A0DA 4GNVA 4AEEA 1KNWA 1ISXA 1OX6A 4QG9A 3BANA 2QYGA 2QDGA 1JDEA 3W82A 3LPFA 1TPUA 3MO4A 5BU6A 1KA9F 4I5XA 2PDGA 2GOUA 1BGAA 1WDSA 3HOJA 2FDMA 3ZT5A 2WVVA 1EP2A 4QS6A 2JKAA 3L2IA 1GONA 1H7XA 3BAWA 4NHVA 1ZBKA 4MJMA 4PMZA 4TV5A 5G1YA 1IXPA 4NAEB 2JFEX 1ODUA 2PS2A 3HGSA 5DEZA 3RFAA 2A6NA 1E6NA 1XGEA 3VI2A 5REQB 4W8AA 2PLMA 3L23A 3BG9A 4OT7A 3OQEA 3VDGA 4OIFA 1GEQA 3M07A 1CB2A 4DI9A 4HNTA 1AQ0A 1BGGA 3GXNA 2XVNA 3WMCA 2OLAA 4O17A 1IXOA 1XL9A 1POKA 1PZ2A 2JIEA 2WCAA 1U5VA 4IGHA 3AUJA 1P0NA 4GVGA 5D09A 4FNRA 3OPSA 4ZQNA 2FLIA 3LG3A 3LZ5A 2C1GA 1SYTA 4PYSA 4JIHA 5JMUA 4J3SA 4LC8A 2HS6A 3E2QA 4YIWA 1VKFA 4KFOA 3SCPA 4Y90A 4MMWA 1VHNA 1EC8A 5I5RA 1VIZA 1EC7A 3AISA 4DO5A 3NQAA 3QH2A 4DJFC 4WCJA 1S38A 1XYFA 4FXSA 1FFQA 1P1XA 2OSWA 4ENLA 4NNCA 4RZ5A 1MQPA 4LANA 3H7RA 1VJSA 4HSNA 3UZJA 2J4GA 1DJQA 4W4QA 1V03A 3UG3A 3LBCA 2A21A 4NG3A 1EJRC 2G96A 2HV5A 1TQXA 5E0KA 2D1ZA 3THUA 1XDLA 3KM8A 2GGGA 2B7PA 3E0IA 1M7OA 4I9MA 4MB5A 4HA0A 4AX6A 5HWMA 3FK4A 4MVAA 1WXZA 4ZOCA 2I1OA 5XINA 3MPGA 4DJED 3TTQA 2ADAA 3VD3A 5I3DA 2JKEA 1AVAA 2NXIA 5JQ9A 1JEZA 4O1CA 2RGLA 5TQLA 5IDZA 1XCWA 1KRBC 1WBJA 4DF2A 5ABEA 2HEJA 2BHUA 1VPQA 3W00A 3NXLA 5I78A 1UPPA 4B3LA 4GH3A 7REQB 4DZHA 4N9DA 1E4MM 2XGIA 3MUXA 3A64A 2EO7A 3CHEA 3FV9A 3QN3A 4EOUA 3O05A 4I5RA 3GR4A 1XIMA 4H9MA 4FPSA 3EXSA 3D47A 3AMLA 2E40A 4QIUA 1FBAA 4ROQA 1XBVA 3RGTA 3CPGA 3O8AA 3LLFA 1TIWA 2X8RA 3KZPA 2PLJA 3K4AA 3OGSA 5H91A 1GPWA 1U2YA 1QW8A 3AZRA 1EZWA 5CSYA 4Q4RA 4E2BA 5I3KA 2A79A 4W93A 2Z2BA 4CNNA 3QZEA 1V93A 5H1WA 1P4CA 2J8FA 2WWDA 3LA4A 4IIGA 3TJXA 3H55A 2A3BA 4MG4A 3VIOA 3SB0A 1OZQA 1H0GA 5FF7A 2ACUA 1OCBA 1I2OA 1F8MA 2JE8A 4ZO7A 5AZ1A 2FVLA 3EPOA 4QBXA 3NDYA 4XUGA 3LERA 1EZ2A 3DG7A 3ARUA 2P5NA 4PN2A 2SFPA 1EDQA 3ITGA 4Q22A 1HW6A 4C1LA 1GW9A 5LYRA 2IPJA 2XSXA 3V35A 4ADUA 5T9CE 2XVKA 4IP4A 3TYAA 3W7PA 2EG7A 3LBOA 1QPRA 1GJWA 1VFSA 2E9BA 4QSFA 2PRMA 1JXKA 1CLKA 3W27A 3UZ5A 2XIMA 3W07A 3DH7A 3L2MA 2CW6A 4XZBA 3AC0A 1KM4A 3MU7A 4AQLA 1ZY9A 3EX4A 4N9BA 5U4NA 1KCZA 1TE1A 2PU1A 5AZ0A 4UTHA 3GRIA 1ITXA 2VRKA 1DBTA 4A4AA 1JPKA 1CXHA 4PUMA 2V2HA 3VOHA 1W1YA 4YHEA 3B8VA 3OTRA 4LYRA 4O54A 4NNBA 5F1UA 2UZ9A 1C7SA 5GJPA 2CLPA 3NTYA 2QJMA 3MBFA 3SJNA 2GSJA 4KEUA 1E0WA 1UH2A 3C3UA 4LS1A 3FEQA 3O9NA 3M7WA 4ZO8A 1I0BA 4JIQA 3S9IA 4IZGA 2P76A 3WQFA 3CMGA 1BVWA 4G7FA 3NVTA 3PJTA 3VK5A 1J0JA 1O95A 5CSUA 3GXMA 3E9AA 3M47A 1QOXA 4ATLA 3BE7A 2VX6A 3GTHA 5HAOA 4CD8A 5G1MA 1FKWA 3ARXA 3IJ6A 1T7LA 4D71A 3IUHA 1OYAA 1TVNA 2J9XA 3KP0A 5LA0A 3H2EA 4P7LA 1OABA 1Q66A 1EF2A 3WLJA 3TC7A 4HZMA 2FTPA 2H6RA 5DLCA 3U8GA 3BAYA 3IIXA 3K1DA 4AD3A 2WZIA 3HGOA 2ZUTA 3GR7A 5I00A 3KRUA 5BXRA 4H9ZA 4JIPA 4S38A 4JN7A 3S5NA 3CPUA 3GTNA 4LU0A 3DHFA 3HZ3A 1GOKA 4NL1A 4RUBA 3UPMA 7ODCA 5L6UA 4UTKA 1C93A 5KITA 1BKHA 1W9DM 1HN1A 4ZCWA 3TQ0A 2EF9A 1EO5A 4CNPA 4EWND 1JFXA 3IUDA 4FX8A 1LRNA 2QJGA 3FSUA 1B0IA 4YL2A 1HZYA 3C0QA 1CGYA 1EEPA 2G3IA 3QPZA 3AZSA 1GK8A 1HT6A 4MNKA 3W88A 4O1BA 4W88A 1GG0A 3LCHA 1B3ZA 4H01A 1UD2A 3GDRA 3IACA 3WLKX 5C9ZA 5A6MA 2FPYA 4U31A 5E93A 1XLKA 2O9RA 2D22A 4PTWA 1HNYA 3WH6A 1VS1A 2NVAA 3UPWA 3DC8A 5EBAA 1WAWA 4N9EA 3TNOA 5DQPA 3KHJA 4NXSA 3VOJA 1VHCA 4YTRA 4UTFA 4Q8TA 3OLEA 4UIOA 3L5AA 1QOQA 2OO0A 2YCKX 2HE8A 3C6CA 1VBJA 1J6PA 2CWXA 3NR0A 1LUCB 3EX1A 2PGFA 1WPCA 4HA1A 3GC2A 1TPFA 2ACQA 3MS8A 2WKGA 4HPXA 3T42A 4MWAB 3TQVA 1PDZA 4GXWA 3BLPX 1KGWA 3CWHA 1FWSA 4LF1A 1S3HA 3U4FA 3TSDA 1OC6A 3IVTA 1C9WA 3QR0A 5EMLA 5AYXA 2D2JA 4ZB0A 4FF7A 4A2SA 1E70M 4C6MA 2OZ3A 2XU2A 4GYPA 4AU0A 1GOWA 2YW3A 3VOFA 4JTRA 4XIAA 3RRAA 1EF3A 1ESWA 5IFTA 5EYWA 1WV2A 2XYLA 2VZOA 1P7TA 4YMZA 4DUOA 4AD5A 1E72M 1ZJHA 1VYPX 2YL5A 3BV7A 4QE5A 4M6UA 4J2PA 1UQYA 2J27A 1BYDA 3N2XA 3GXPA 1PE1A 1CWYA 1KBJA 1NH6A 3E2VA 3VZXA 2AQVA 4QROA 3VGBA 4L4PA 4F0LA 2QIWA 5C9RA 3W25A 4IIDA 1XFBA 4DAIA 4HGXA 1QBBA 3HIJA 3KP1A 1PIIA 4LUSA 5DX7A 2QKFA 1L0PA 1FCUA 4XO6A 1AW5A 3U57A 1KBKA 2A3HA 2CZ5A 5IBXA 3C3NA 3QTPA 4IPLA 3OLIA 3VIIA 3W75A 1K6WA 3OZYA 2E4TA 1TA3B 1P6WA 4Q4SA 4NJGA 3BMWA 1U1HA 3SCVA 3TN3A 2J24A 5A3HA 2AL2A 3UY8A 3B9AA 5GNXA 3B0XA 4GJIA 1H7WA 1NDYA 3NJ3A 2ISWA 4WR3A 5DFAA 3AHXA 3G3DA 1P0DA 1S5MA 3FXYA 1TJ1A 1ZSXA 4HA4A 3T05A 4W7WA 1R3QA 4DJFA 5I3HA 9CGTA 1EHNA 3UZXA 3UVIA 2Z24A 4K6AA 5KETA 4S3GA 4UQDA 3U0HA 1QHOA 5K2ZA 2P10A 3ARPA 2BVYA 1VBUA 2W66A 4KWSA 1YXCA 4B90A 1PEZA 1MNZA 1C8QA 2BG5A 1XYZA 1YRRA 3AXXA 1HIZA 1KCLA 2CBJA 4O16A 3OODA 1W8SA 3F7JA 3QLLA 2QS8A 2XDFA 4LV9A 5A2AA 4JS3A 5F2LA 2B7OA 4GQ0A 3TUUA 1ITCA 3DC0A 3HGJA 1YDNA 3HG4A 2VYOA 4WGXA 2V5JA 3M0LA 2QAFA 3CZLA 1MXSA 4UTIA 5F2IA 2Z1BA 1H1NA 2GSEA 5JUVA 4PE8A 4YTSA 1V6VA 4MDPA 4UZSA 3FGCB 3ANUA 1V4YA 1XIGA 1W9BM 3QQ0A 4J1OA 3M9YA 1H60A 1T0OA 1ZCOA 3CZ8A 1NVMA 3U5YA 1K6AA 1LOQA 3MMDA 3M0ZA 1HXJA 3WIJA 1LP6A 1MFUA 4H04A 2DSKA 1AL8A 2P8BA 1RBLA 4WX2A 5EMKA 1JZ8A 5I23A 2PODA 4L6HA 2ZWYA 4QLKA 1XPYA 1LORA 1HKMA 2EPKX 4XZIA 2RDUA 2I17A 2X16A 3VINA 3KZSA 2X41A 4XG1A 2BVWA 3H70A 1OYCA 1R2TA 3SN0A 5HJXA 2FZBA 3ZLFA 3DFNA 1YDVA 1XQLA 5K7JA 4KWWA 3SO7A 4UTUA 1CB7B 3MSYA 2VX5A 2F9RA 1F74A 4RKAA 3TH6A 3H4WA 4HU3A 1SQ7A 3UWUA 5KZMA 3THDA 1CEOA 1XRFA 3DOPA 3SIZA 3EWBX 5A6JA 4JHMA 4PMVA 2B31A 3GNNA 2J74A 4RX0A 5G5IA 4W89A 4IMDA 3L0NA 1RD6A 4DPPA 2E5DA 8XIMA 1PCWA 2D20A 5C2CA 4AAJA 4I6KA 3NQ6A 2W27A 3KOYA 4JXCA 3CYVA 1E9LA 2DP3A 1OD8A 3ARWA 1JF6A 1FWFC 4DWSA 4OU1A 2PD5A 4AIEA 2QCGA 5H8UA 1F4AA 3UYCA 3VGFA 4PRWA 3QRHA 1JUEA 2PDYA 3F2BA 5BRQA 4HMEA 1TX2A 4UQ9A 2E9MA 1XV8A 6PTDA 1DL3A 4LUYA 3EMCA 4ORMA 3W7CA 5LA1A 2DZAA 4LV4A 1A3WA 1XLDA 3EWDA 1NDWA 3N2OA 3G6MA 4W8LA 1THFD 3B0YA 4O4WA 1UR2A 3ELFA 3MYOA 3K4DA 2V3EA 4C7DA 1B4KA 3W1QA 1EWEA 1MW0A 1V0LA 2VRJA 4M1RA 4KS0A 4WUIA 5AYBA 4A21A 2HISA 2BGNE 3LV5A 3MCNA 3WNMA 4UTJA 2FB2A 1JUBA 1XLJA 4M5PA 3P6LA 2GJXB 3KL5A 9XIAA 3B8DA 1GKQA 3C56A 4S3DA 3WK3A 3UETA 1UHVA 3FEMA 3CV1A 3FGCA 1LOSA 2BS9A 3LS9A 3OW1A 4DHGA 5I7GA 4KW2A 1IV8A 4MNJA 4A3RA 3OA5A 3A4JA 1GYNA 2VZUA 3MKCA 5ENLA 2PLKA 2CCRA 1QK2A 4LCSA 4UNKA 1XLAA 4HMNA 3TYCA 6XIMA 4NKCA 3ZMRA 4H6RA 3FX4A 4D6JA 2OMAA 2PTXA 3WEMA 1XKJA 1GYLA 2X2YA 2E6AA 2YLLA 3LSCA 1ZLPA 4TVCA 4GXPA 3A3WA 3S1VA 1ECQA 2W67A 4ZFMA 2Y4SA 2C0HA 1RK6A 2I5IA 1MUMA 4GABA 1OIMA 4FX6M 3QW3A 2WNZA 4JHOA 1OVDA 4EANA 1DWJM 1ISYA 4H3DA 4RE3A 3GXFA 4GE8A 4P7NA 2YL8A 4JQAA 1PKNA 4HMDA 2OZ0A 4CN1A 1LOLA 8A3HA 1R3RA 2BHZA 3G6LA 3T2OA 3EOLA 4Q4KA 3CAWA 2WJDA 2NLYA 3HPZA 1EX5A 2CU0A 1W54A 1RVKA 3BGGA 1M9HA 4DUWA 3OVPA 4EX4A 1SFTA 1E73M 2QVNA 4ALDA 3IGUA 1TTQA 2YBTA 4WY0B 2ZDSA 4PTVA 1RY0A 3M6DA 1W32A 5AY7A 3AWOA 5AHLA 3JVAA 4HNLA 4ZQOA 1BLIA 2J9YA 2QW5A 3L67A 5GNYA 3NSNA 2NW0A 4LAMA 5DMNA 3HPAA 3OBAA 1XGZA 3WLSA 2C7FA 3AU6A 4AFYA 3APGA 3FJNA 3QF0A 2O55A 3FJLA 3SSZA 3GX9A 2PRHA 4HN4A 2Z27A 3ARYA 2G3JA 3EX6A 1XIFA 3GKAA 2VJXA 4ICNA 4GC3A 3GNXA 3L4UA 3MI3A 2ZZ6A 3WQ5A 3FA3A 1KLZA 1IZKA 3CNYA 3H21A 4LF2A 5FJTA 3OU8A 3F1QA 3TJIA 1ELSA 3BC9A 4QJ1A 4K1GA 1X38A 1NP0A 2NV2A 4KEMA 4U5IA 3FSTA 2A7RA 3W1PA 5FF2A 2ZC1A 5C55A 3UF9A 3ONCA 2NX9A 4P7RA 2RAGA 1NAL1 4H8VA 3NNTA 4ZB5A 4JTCA 1AODA 2VGBA 1CBGA 2FYMA 3WLOA 1XIIA 3S9YA 1PB0A 4C5ZA 5CQ1A 3B0UX 2ZZ3A 1KBIA 3M5XA 5KMYA 5CC6A 1RQEA 4G56A 2GUYA 4LUIA 1XBXA 3S6TA 3KRZA 2QIIA 1N8FA 5DELA 3PZTA 1LWJA 3SJ3A 4JIIX 4WXZA 2CZDA 3E2RA 4KRZA 3UR5A 1C8VA 1WQ5A 4V1XA 3UJFA 2B4GA 1VCFA 2VD8A 1U1UA 3UJEA 3CMFA 1JF5A 4LY8A 4NT0A 3CZKA 3W83A 2XH2A 4ECLA 1D2KA 1CIUA 3ZSSA 2EXOA 1MQRA 2XG9A 1VFMA 5GVJA 2QUTA 4PMXA 3PUGA 3K5XA 2ZZ1A 4ZZ9A 2HZGA 5HMDA 4LVBA 5CGMA 4P7OA 1JDDA 1IEIA 3MVTA 1MO0A 3NQ2A 4KT2A 3MJYA 4S3FA 3N17A 1RHCA 3CIWA 4AF0A 1RJPA 1GQKA 4JOMA 2PGWA 2PGEA 4DUVA 3NQCA 1F6PA 2GQAA 4DAFA 2Y8KA 5FSDC 1R46A 4HCLA 3VE9A 3BL3A 4M3PA 1XQKA 3BW4A 3R89A 1FWBC 1ZUAX 2JGYA 1JFHA 3B9EA 2P3EA 2DSWA 2Q3OA 4AWEA 5CSSA 4KH2A 3N9RA 2GGEA 1CT5A 3S2CA 2XJ7A 6TIMA 3TMQA 5BRPA 1C8YA 3LYEA 1V0KA 4KFPA 2OXNA 4XTDA 4F0MA 1H3GA 4LWWA 1KXTA 1VPYA 2ICSA 3W73A 1RALA 2V67A 4CQAA 1BQCA 4DIAA 1XRVA 1KM5A 1J6OA 3MCMA 4EE9A 5HR6A 2QCNA 4GX9A 1F76A 1DE5A 2XTKA 4HTBA 4DJEA 1A47A 1TTPA 3VYLA 2ALRA 3VOGA 3PM6A 3LPOA 2PBOA 4QQUA 4KQNA 4MDOA 3SRFA 3A3HA 4O0ZA 3PF3A 3UXLA 4O57A 4AUBA 2VEIA 4WSKA 2R8WA 1HVXA 2YDSA 1DJGA 3WQVA 1QASA 4Z2KA 3W2LA 3UXKA 3RHGA 1IT7A 3E5BA 3QHMA 2EBNA 3LLXA 1JULA 2J6XA 1V8EA 1B90A 1JR1A 1UKPA 3LCLA 4XAPA 3H24A 2PDFA 2R1LA 3WH9A 3RAOA 3TK7A 3KLLA 2DZXA 1UZ4A 2P8CA 4LAOA 1GW1A 2A3CA 1VEPA 5DCDA 1WAUA 2EAWA 2W61A 1V08A 4B2DD 4ICMA 3GZ3A 3N2BA 4E4FA 2CWNA 3QOKA 2QXWA 3MJMA 3BICA 3AXMA 1TVLA 4WKFA 2W63A 3SSJA 4R5EA 3USZA 4D6HA 3N04A 1G9HA 5AC6A 2ZRUA 3QKEA 4G1NA 1QPNA 1Z32X 1Q63A 1B3YA 1TTIA 1QWKA 4PB5A 2VKZG 4UR8A 2FVMA 5DF0A 4BZYA 4MWAA 3EX3A 5LHEA 2Y0FA 4PEEA 1IHIA 1MXGA 2XSAA 5KZ6A 3PBYA 3W1XA 3ATZA 4AB4A 2VEMA 1BKSA 4FS9A 1E40A 1LQ0A 1UH4A 5J5DA 5E1QA 3LK6A 3N1AA 2QDHA 3JZEA 3ANVA 1FH8A 1HKVA 1RQBA 2G5WA 3A3XA 2GUBA 3S8HA 2E6FA 4R33A 3TLLA 2G97A 1GHRA 5C7VA 3SN1A 3TFCA 3TYDA 3T1GA 4GKLA 3VUPA 1YBQA 2NT1A 4AIUA 1J11A 2DUZA 1IWAA 2WB5A 1OK6A 4XZLX 2VR4A 5AOUA 1NF0A 4IPNB 3NO1A 4FIRA 5LIXX 3R25A 4BQ3A 3UU0A 1EA9C 3DGBA 3N4AA 4B4HA 2J7CA 1JCYA 2PDHA 2DH2A 3GM8A 1FWCC 1AL7A 3CB8A 1XIHA 3ITLA 2DUAA 5FF3A 1OG0A 2WZEA 3QV7A 3A47A 5F2GA 2PUZA 4KWUA 3HMCA 4JFVA 4GUIA 1CLVA 1VAHA 1M5WA 2CLLA 2CLIA 1BWKA 4HQVA 1M7PA 2X7WA 5CCZA 4UTLA 3GD6A 3DIPA 2G95A 3AS2A 4FOUA 3D3FA 3P67A 4DI8A 1TZ7A 1XLBA 3URAA 1J4EA 1WZAA 1F3WA 3LN3A 4DF0A 3DKJA 3HM7A 2BXYA 4JYEA 1V6YA 3PWAA 2WZHA 2IPFA 3NZPA 2BODX 3K13A 4JN6A 5E0FA 3W2KA 3N9SA 3NM1A 1LZOA 1X96A 2J75A 4DJDC 4RXGA 1D7FA 1GKRA 1HJQA 2X1IA 3K30A 3QC0A 3GVGA 1PYFA 5CAHA 4C60A 2DZTA 1KFWA 3E38A 3RU6A 3HPSA 4UR7A 2OTDA 1NWSA 1R6WA 5CZ0A 2OU4A 2CBUA 4GJJA 3DN5A 1IEWA 1K9TA 5LKYA 5BOFA 4GY0A 4W85A 3H2CA 1CXKA 3EPNA 3SCOA 5DBTA 3GAKA 1SUXA 2ONEA 4NYYA 3DFSA 4V27A 1XSKA 3EDKA 1H7NA 4JNZA 4MAZA 4KWOA 3PBWA 3IJIA 1H1ZA 3VNLA 3W26A 4JEQA 1FWJC 2BDQA 2OODA 1HX0A 2QF7A 4QCEA 3NYDA 4LBSA 5JBFA 2DFAA 4A3YA 2FZDA 4DM1A 1Z3NA 1MW2A 1TUXA 5BNKA 2QUVA 1SO6A 5CJNA 4AMAA 1M7JA 2PE4A 2AKMA 3OQ8A 3W2JA 2TAAA 4HZ6A 2OZ8A 3DCPA 3BUVA 2Z25A 3SCQA 3WF1A 4MIMA 4A22A 1JRCA 3A5FA 2UV8G 1W31A 1RH9A 3BMVA 3FYPA 1DJWA 1B1YA 3FW6A 2EPLX 5HK4A 4JY8A 1IXNA 1E6ZA 3CAQA 2PLCA 4I5UA 3H6OA 3I7QA 5BU9A 3UXAA 3WX7A 1ADOA 4C6KA 1Z41A 1ZJBA 5JBDA 4HP5A 5E0CA 1OFBA 2W4XA 3HG5A 3M0IA 2ZX9A 1PZ0A 1UR1A 2WKLA 4JYFA 4K38A 5M17A 1KFLA 3VC6A 5LIWX 4IFOA 4IQLA 4DBEA 1UP0A 2X1TA 4XUYA 4IUOA 3W29A 3PUOA 4WHBA 3PZQA 3W7NA 4B9YA 1H41A 2WO5A 1K7XA 1KR0A 1H63A 4EPBC 3VNIA 1FHUA 1H50A 2Z1SA 1XH2A 4L65A 4OHQA 1QU4A 3C5QA 4XSLA 4DUXA 2G41A 2ISVA 2BY3A 3EXTA 2BBFA 3AQUA 2DZVA 3S3GA 4JNYA 4NQ1A 3VNYA 2CPUA 4GFIA 2V3GA 4XKYA 4IPPA 1GQJA 2RHGA 4IL0A 4E0CA 4C6FA 3KTSA 2EQDA 1UWIA 3PG8A 3SQSA 3V4BA 2EG8A 3TROA 1QI0A 1OK4A 4L56A 1KXVA 3V5CA 4C6JA 3FS2A 2WKJA 2NWRA 4GIRA 1FWGC 5A6BA 1JXJA 1KXHA 1NWTA 3TJLA 4R27A 5BOOA 1QPKA 4HZ7A 1ZB5A 3AIWA 2QMJA 4A35A 2E68A 2GJLA 3WL0A 3S1WA 1OG6A 3ARQA 5DBUA 1T96A 5EFDA 4S2BA 1NTHA 3Q2DA 4HU8A 1GZGA 3A24A 4Q4PA 1CX9A 1VRXA 1Z48A 3W02A 2DGAA 1S5WA 1RPKA 1LYXA 4TUFA 1RUSA 2WC3A 2E0PA 3P2VA 4DLMA 3HQPA 3H22A 4HT3A 1HQTA 2D0HA 1G1YA 3T2QA 3P60A 3HTWA 2QDEA 4KETA 3WLLA 2O4QA 2X40A 4ZFCA 4GZEA 3MWCA 2QPSA 3OEXA 4NU7A 3W7MA 4H9XA 5CEWA 4D2JA 3KBMA 2YA1A 4P8UA 1F8IA 4YTQA 4D6CA 4A8RA 1TPEA 3IIPA 4C5YA 1M7XA 1KFEA 2DZUA 2RDXA 2WHLA 2ZTJA 3CHFA 4AZ7A 5EFFA 1IZJA 4JPGA 4US6A 1FP8A 3T4CA 3IGXA 8XIAA 4EKJA 1Y0EA 4WOQA 3RYSA 5DO8A 3IUIA 3KCJA 3OBEA 4NNAA 1JGMA 4M80A 3N12A 3T08A 2VUNA 4G1KA 1Q2RA 4PEKA 3ARZA 1SW0A 1S39A 4Q8VA 1QJWA 1REQB 5FACA 3V75A 1A5CA 2TSYA 3L12A 2F6UA 1YYAA 3P62A 3NL5A 4MPKA 1I6NA 3OZMA 3E6EA 1QI5A 3RO8A 2WVVB 1MSSA 3VOIA 2PSNA 1JZ5A 2XWDA 1YBQB 2QPXA 2VEFA 1Z44A 3OO2A 1KTBA 4E2DA 4Z1YA 2Z1VA 3TWAA 1X6NA 3OYZA 3BG5A 3MANA 4H6KA 4L9ZA 4AYGA 1X1OA 3S0CA 4GO8A 5HXMA 1AW2A 4U33A 4XB3A 3GHRA 1EBGA 1RCOB 3P3BA 3AYVA 1EP3A 1JG9A 2P0OA 4HBKA 3VILA 4DBWA 4DLFA 1O6IA 4MKSA 4AZGA 4GY7A 3ABOA 3Q67A 5JIWA 5CPOA 1RR2A 3AWNA 4MFEA 2HPMA 2QCDA 4AZCB 1DJHA 4F0HA 3JW7A 3PTMA 1WDWA 1XIEA 1FHDA 5LGZA 4O1DA 4CN4A 1V6TA 1R2SA 1A53A 4JNMA 2AQWA 1JI2A 3C2EA 1K9FA 4HJFA 2NQZA 2AL1A 1W5PA 4Y8EA 4MUZA 2FZNA 3PG9A 3WK0A 2PDMA 3RMEA 2R24A 3RCNA 3GU2A 1GKPA 2Q8ZA 1H2JA 1QDSA 3VE7A 3MZNA 4D6DA 2Z29A 1UD6A 1FTXA 4NP7A 3ALGA 2POTA 3NDOA 1V6XA 1J2BA 3RDKA 3ZVHB 4QEEA 1W1B1 1E4IA 3W1MA 4XBJA 2QCLA 4QXIA 1FWTA 1DHPA 3U2OA 3CUXA 1T5AA 2PP3A 3BLEA 3GU1A 4UQAA 1TUFA 5E70A 3DERA 3LD5A 2X0HA 3MMUA 3BXWA 3T4WA 2GJRA 2O7SA 4XD5A 4X0NA 1EJVC 4BY3A 3LHUA 3TV8A 1P6CA 3BJFA 4FMVA 3QV8A 2Y24A 3TZNA 4BCEA 1KBLA 3EWXA 4LAUA 1JAKA 1OHLA 2C0AA 2J88A 4GQQA 5AC4A 3JU2A 4GQBA 2E1DA 1MWOA 4KGJA 3M5ZA 4JTTA 4MAVA 4RDZA 5FEXA 4B92A 5LXXA 1NM9A 3IRSA 4H83A 4PMYA 3BCJA 2NXHA 4XAYA 3EXRA 4LUTA 4FXRA 4I7VA 3W1AA 3W87A 3QXBA 3G1YA 1T8QA 2BB0A 4H9YA 1JYXA 3RITA 2PURA 3BPWA 2QNEA 3ENLA 4XBKA 5BZAA 1X39A 3QVQA 3NWRA 2BY2A 3HB9A 1IEQA 3EDJA 2Z0IA 4Z1CA 2WMJA 1HFBA 3QKZA 2A6LA 2R1KA 4LNCA 3GHSA 3BURA 4X63A 1G4SA 2W79A 4WSJA 3WMSA 1CPUA 1L6WA 2NZLA 4ZQCA 2FMOA 2RJGA 1DTUA 1A5MC 4RDVA 4N4QA 2YB1A 3DFTA 3OZOA 2X1SA 1HJSA 4TTGA 3RUBL 1UWQA 2OG9A 4N6FA 3F4WA 3S6DA