1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-RHAMNOSE ISOMERASE
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
3KCOA 2NQJA 1XIDA 3M0VA 3M0LA 4ZB5A 7XIMA 1XISA 2GUBA 2ZVRA 4XSMA 1XIEA 3VYLA 1XLMA 5EMMA 5FA5A 1XLFA 4ZB2A 2Q02A 1I60A 3VNMA 4Q7IA 1DE5A 1A0CA 2HCVA 2XIMA 4QDPA 5H1WA 4XIMA 3ITVA 8XIAA 5EMLA 3CNYA 4LNCA 4XKMA 3XINA 1DIDA 1DIEA 5XIAA 4QDWA 1MUWA 4X60A 3JU2A 3KTCA 1BXCA 3M0HA 1XLIA 2X7WA 3XISA 1CLKA 1D8WA 3ITTA 2X7VA 4A8NA 3AYVA 4A8RA 1K77A 3L23A 4EACA 4OVXA 3TC3A 3AALA 1I6NA 9XIMA 2HK1A 1XYAA 1XIMA 3CQIA 3IUHA 3IUDA 3CQJA 4QE5A 1XYBA 1BXBA 1A0DA 4QE1A 1XINA 1XLCA 2QUNA 3C0SA 1QTWA 2ZDSA 1XYLA 3BDKA 1XLAA 1XIFA 3M0XA 3ITYA 4YTTA 3BZJA 3P6LA 8XIMA 4DVOA 1TZ9A 4HGXA 1XYCA 1S5MA 1XLBA 4E3VA 3QZAA 4J4KA 4KW2A 1QUMA 2GVEA 2I57A 4QE4A 3QYSA 4PGLA 1MNZA 1XLLA 5H6HA 3DBNA 3XIMA 4EAYA 3U3HA 1XICA 4PFHA 4ZBCA 5XINA 3LMZA 4A8IA 3N4AA 5XIMA 3KBVA 3UA3A 1XIHA 4G56A 4QEHA 3U0HA 1O1HA 1A0EA 5EMKA 4K1GA 3OBEA 1S5NA 3M0YA 4YTUA 2QULA 1XLJA 2GYIA 3BZGA 1XLHA 4GQBA 4GJJA 2QUMA 3VNIA 3AYTA 2NQ9A 3UU0A 4X63A 3NGFA 4K3ZA 1YX1A 3CWHA 4YTQA 5EMJA 1XIJA 2G4JA 5TNVA 1OADA 3FVMA 3CQKA 5B7YA 3C0QA 3UA4A 4GLEA 2GLKA 4X61A 1XP3A 3ITXA 1DXIA 3VNJA 3KCLA 9XIAA 3M0MA 2QW5A 3ITLA 1GW9A 3KBNA 4YTSA 4W4QA 3AAMA 3KWSA 3UVAA 3WQOA 1XYMA 3QXBA 4HNOA 2G0WA 2OU4A 4GJIA 3KBJA 5C9ZA 3DX5A 3CQHA 3QC0A 3GNXA 4ZB0A 4XIAA 4YTRA 3KBWA 1XIBA 3UXIA 1QT1A 4HHLA 1XLGA 1XLKA 5AVNA 3KBSA 3BWWA 3KBMA 2NQHA 3VNLA 3ITOA 2I56A 2XISA 2HK0A 2J6VA 3BANA 2XINA 1XIGA 3VNKA 1DE6A 4XISA 3TVAA 1XLDA 5J8LA 5B7ZA 6XIMA 1XIIA 6XIAA 5AVHA 4A8LA 3IUIA 4US6A 4XSLA 3P14A 4HHMA 1XLEA 3C0LA 5I7GA 5B80A 4QEEA 4DUOA 3KCJA
chains in the Genus database with same CATH superfamily
3O0FA 1UB3A 2FH8A 3W87A 1SJCA 1ZTVA 4MM1A 3AJXA 4QDPA 1GKPA 3SCWA 2Z1SA 2ZUUA 3M0KA 3GH4A 4I8YA 5CJMA 3TQVA 3XINA 3LCGA 1BYCA 4KH2A 4DWSB 4EACA 4PA8A 3LZ3A 4FSAA 3UJFA 3WK2A 3BLOA 1JF6A 5TBOA 2W62A 4O50A 1KFJA 3CPGA 2J9ZA 3IVSA 4IP7A 4V28A 5JVLA 4E3VA 4PGLA 4PMJA 1S46A 1QPNA 3UCDA 2OLSA 1XIHA 1YW1A 3AOFA 2IKIA 4ZEPA 3IAQA 3AIWA 3WJZA 4MKVA 3SIMA 4JHZA 3NYDA 1UWIA 5AYXA 1Y5WA 4AIBA 4GISA 3QMSA 3OZMA 3CBWA 3OPSA 1J12A 3HJEA 3THUA 1P0NA 4G7EA 4X2RA 2NXGA 2WJZA 4DJDC 1XYMA 4DIAA 4E2OA 4GYFA 3UG5A 6ALDA 1OCBA 4LAMA 3NM1A 3L4UA 4DRSA 4HZ7A 4CNPA 4QFUA 4Z1BA 1SR0A 4BFAA 2IPWA 1AMYA 3KVLA 3W23A 3TYCA 7ENLA 1UZDA 3UR7A 4HNUA 1R8LA 1XIDA 4MLJA 2VEFA 2GGHA 1UD5A 2CYGA 2O9TA 4R7JA 2Z6IA 8CGTA 2V3GA 3I3EA 5AHMA 3K46A 4MB4A 3ARSA 3DZ1A 5JU6A 5BXPA 5D9NA 3O6CA 2OEMA 2ZICA 3WLRA 3A13A 2VC6A 1A49A 3C3NA 3B8WA 3GVGA 1NOFA 3FKRA 5FEWA 2GFTA 4ZOAA 3W6MA 3NQBA 5I77A 2R14A 1KM5A 4F9JA 4Q8OA 4ZO6A 4F0MA 1MNSA 3RPMA 2I5QA 1F74A 3WF2A 4DYJA 1EUAA 3GIQA 4HNNA 3AROA 3OJGA 1RR2A 4GJ1A 4J35A 1R3RA 5K9CA 3U2CA 1Y5XA 5DMMA 5EMKA 1R3SA 2HVOA 4HNLA 2IXVA 1US3A 4JTGA 3E6EA 4L65A 1Z6KA 1OGBA 3SBFA 2Y85A 3SM0A 4AXNA 3UA4A 3Q2DA 3NQ6A 1XP3A 1DIOA 1CXIA 3VGHA 2CITA 2W27A 3VC5A 4DWDA 1HKVA 3DX5A 3H21A 2ISWA 4ZXLA 3WLNA 2ACRA 4YPJA 1W6TA 3MSYA 3J7HA 2E77A 3ITOA 4ZSTA 2V30A 5G4EA 4ZVJA 2OR2A 3LHTA 4EANA 1WAUA 3TXVA 4C6IA 2G5WA 1V6TA 3FKKA 2CLLA 4FXFA 1XD0A 1GEHA 4PCSA 1SZFA 2PWGA 1RD5A 3GVVA 1W56A 1W1PA 3IJLA 2PBOA 2Y7GA 3TZFA 2YLLA 4EXBA 3AYSA 2ZDRA 2XM1A 2NLYA 4QDWA 4KKXA 5HQMA 1ELSA 4FNRA 4GC3A 4O16A 3WQWA 4Z2HA 3LPFA 3N04A 1GOQA 2VTFA 1ICSA 1RK6A 2EPOA 3G0XA 1ME9A 1H7PA 3W1TA 2WANA 3RFAA 5MKGA 4AZ7A 1UZHA 3DGBA 1E0XA 3UGVA 3CK5A 1LZOA 4ZXOA 3M5XA 2XM2A 3CH0A 1RPXA 1RXOB 5LNWA 3IGXA 3B05A 2F9RA 2A3EA 3A4XA 3BAYA 2Z28A 4FF5A 5AZ1A 3I68A 5F7UA 4D72A 3QHMA 3MSDA 4LGXA 3WYZA 3L68A 4IFRA 2ZADA 2PF8A 1QI2A 3AMCA 3L66A 2P10A 4QG6A 4CN4A 3LBCA 3PC0A 1W3HA 1J18A 5AYZA 5C9ZA 2DT2A 1UPMB 1E4LA 3V3WA 2EKGA 4KETA 3WDPP 4M8UA 3MW7A 2PDBA 1NDWA 1JPMA 4KCTA 2RDWA 1LQAA 3P14A 4IX0A 1TPH1 4NKCA 3E02A 3VUSA 1K8ZA 3QW4B 1K9EA 3P8JA 1E15A 1F07A 3WLKX 2YCKX 3W0KA 3WMSA 3ARZA 1GVYA 1DTUA 4QR6A 5BXRA 3H7VA 4IGNA 4XIMA 1PV8A 4IMDA 3JU2A 2CWNA 1SW0A 3OGVA 3CHFA 1HKKA 5FJOA 3EKZA 5ENLA 4L7ZA 1M1BA 4TVDA 3DI0A 3H2FA 5C8BB 4IXXA 4ERAA 4FLSA 1TRIA 2PWVA 5CPTA 4DZ5A 3ZR4A 1CZ1A 2XIQA 2MNRA 5D2YA 8XIMA 2VZOA 3W26A 5LNRA 4S3CA 4ATWA 5GNZA 4AHQA 1MW0A 1F7BA 1JFHA 3MBDA 4Z2IA 4RX0A 1QXLA 1XDMA 5HOSA 4S39A 4D2JA 4F2BA 3V1PA 1GHRA 1EO5A 2HRWA 3LPPA 3E12A 3GTNA 2E8YA 4ZQRA 4AQLA 3ZIZA 1S3TC 3A12A 1G5AA 1MZRA 3NPWA 1TTPA 3E0FA 3RIKA 2OX4A 3P80A 2WOQA 3TQPA 1Q6FA 2WNZA 2O9PA 4HIBA 1SR9A 4A05A 4DBDA 3NSMA 2A4AA 3KOYA 2EJ1A 3HGOA 4KT2A 3QV6A 4H83A 1FCUA 1QU4A 5TIMA 4DPPA 3LGDA 1HGWA 7REQA 1TTIA 2J24A 3R11A 2NW0A 4TTGA 1FXPA 4ICNA 4F48A 3S6OA 1W8GA 3RLVA 3V0UA 5LNSA 1EIXA 4J3TA 4HP5A 3AU2A 2EGZA 3TH6A 4H9YA 3AI0A 4YU1A 2HK1A 4PC8A 5KETA 4F2UA 3GR4A 3CQJA 4XZLX 3GXIA 4C6JA 2ZCGA 4RE3A 4ZMGA 5HR6A 3OODA 4RZ4A 2JEQA 4PUWA 4X9SA 2PODA 2QGYA 3WH7A 3UWQA 2KX9A 1MZHA 2FMOA 3O3RA 1C7SA 2I16A 1LTDA 3VIHA 4GRSA 1NFPA 4PH6A 4IQDA 3GD6A 3R43A 1FWAC 2GQ8A 1Q6GA 2W61A 4GXPA 3TW7A 1LUCA 5AKQA 4HK5A 1XPGA 3L2MA 3ARVA 3W1XA 1XSJA 2UZ9A 2CZ5A 2WHKA 2WNQA 3GX9A 4OIFA 4LYRA 4M6UA 3BGGA 2NXIA 5AHFA 4PCPA 3MUZ1 1NWRA 3UGRA 4OBRA 5AVHA 3ZFHA 3G1YA 3R10A 3T0TA 3UR5A 2V63A 2BXYA 3RK8A 4I6VA 1GPFA 1HO4A 4F9DA 4BQ3A 3V7PA 3MZNA 2J7GA 3PUDA 3QFWA 1QNVA 1XD1A 5DMLA 4FIQA 2OOGA 2P88A 3SN1A 4FIRA 3ANVA 3VD5A 2FZ8A 4Q4RA 3D3FA 2Y8VA 1H63A 1BKSA 4ADSA 1A5MC 3B8DA 2BOEX 4NXKA 4YHGA 3L0NA 1TZ9A 1W9UA 2C6QA 3BW4A 1KBJA 3W81A 2OO0A 4M19A 5H2ZA 2XIOA 4AX6A 4IGSA 4B5VA 1J10A 1Z3NA 5FSDC 1EHAA 1DWGM 1QNPA 5HBFA 2YDSA 4BWLC 4K1WA 1UPPA 2WSRA 3Q4DA 2WHMA 1POJA 2ATMA 4JEJA 3N2CA 2PCEA 4A29A 1N8IA 2XSBA 3SO7A 2P8CA 2WV8A 3AAMA 5C2CA 1XKYA 2OYLA 2PGRA 4QTGA 1R9ZA 3TIMA 3OA3A 4EOUA 4JIIX 2Y1HA 2V3EA 3C2FA 4DPQA 2Z1VA 1H5YA 4Y9OA 1N7KA 2PPGA 1T5AA 5F2MA 2WKGA 3WJSA 4QISA 3WLLA 5LSMA 3HTWA 3WNOA 3IUIA 2HXTA 1ZAHA 4NILA 4H9XA 3GVQA 1U30A 1WO2A 4LYQA 3APYA 1JF5A 2HSAA 4H7ZA 3VX0A 4HKPA 1PZ1A 1MDLA 2PDWA 3ES8A 1Q2SA 3KTCA 3TTSA 2PD9A 3WZ0E 3EPMA 3ARXA 2FB2A 4GCXA 3F1QA 4O0ZA 4QQ3A 3LXCA 3ALFA 3AS2A 3M0XA 4O4VA 5L9FA 4LW7A 3I6EA 4Y9PA 4J4KA 2A3BA 1PIFA 1EXPA 1L2QA 4GC4A 3JZEA 5FF0A 4XD4A 3WEZA 4TU1A 5DO8A 4S3AA 4N9CA 5HNNA 4B9ZA 2EAWA 3W7GA 2JF6A 2GK1B 3BTNA 4IPIA 2WMKA 4GZIA 4S2BA 1E3ZA 4OT7A 4ZA0A 3LPGA 1HP5A 2OSYA 1E6RA 4WJ8A 1X98A 2GJNA 3E2SA 1AW2A 2Z29A 3W7IA 4EPEC 1J5TA 2HS6A 4UTWC 2V2DA 3ARYA 3ZMRA 4I9MA 2D2GA 1Q6CA 3SY8A 3W7OA 1SGJA 4XSLA 3EB4A 5DY2A 4HHMA 3KEHA 3W3OA 1FH7A 3OZPA 1UD6A 4QEEA 5I3DA 4MJZA 2QT3A 5BU6A 2QCMA 4XSMA 2HNHA 1DHKA 4FALA 3K8MA 4P7QA 1ISYA 2FHCA 1E70M 3PJTA 4BKNA 4F0HA 3M0ZA 1LJYA 4M5PA 1E72M 4RZ5A 3W22A 4DUXA 5BXSA 1V3HA 4JIPA 9XIMA 3NL5A 2QPUA 1ONRA 2R24A 1WOBA 2FJUB 4LVGA 4FNQA 1KCXA 2X1RA 1GVEA 1T99A 2TAAA 4XBKA 2NZLA 1DIKA 1KCLA 1KR1A 2PP3A 2AAMA 4F0LA 4GD0A 3BG3A 1BWVA 1MMFA 3K4DA 2VX5A 1LLOA 2ZUVA 4G6CA 3GTIA 2AQVA 3CXOA 3ZSSA 4AZHA 1PWMA 4I9TA 2OTDA 4GX9A 4US5A 1TPEA 3SB0A 3EMQA 3M07A 3CGTA 4HN8A 4OQVA 1J0IA 4S2CA 4EVZA 3F5KA 1OX4A 1J9YA 5FF4A 1UKSA 4MVAA 5G1YA 1MQQA 3LLXA 1FY6A 3G1AA 1XG3A 2WCGA 3I3BA 5GVJA 1VQTA 2CERA 3FV9A 2PURA 4N6FA 1F6KA 3B4UA 1EO7A 3STPA 1UASA 1C8XA 1Y0EA 1LORA 2BG5A 4EX4A 2PB1A 3MPGA 3RM4A 2X0SA 1I60A 5IXEA 3W2KA 3O16A 4O1EA 1JR1A 4Y96A 3DAQA 3IEBA 2OWCA 1WCGA 1DIEA 3VFCA 3RR1A 4R33A 2E3ZA 3AMLA 4KEMA 3C5QA 3GR7A 4LUSA 3IIPA 3MMUA 4L9YA 1A0DA 4CD5A 4NZ5A 3LNPA 1E4MM 3TZNA 2F2HA 3W37A 3P5YA 2CW6A 4KIEA 4C60A 5HMSA 2PDHA 4RZ6A 4NU7A 1ZP4A 5KZDA 1Z69A 1O1HA 3E0IA 1ITQA 5A8OA 1ONWA 4L6OA 3H4XA 2Y24A 4YVPA 5GJMA 1GVQA 3ABXA 3D5HA 3R8GA 2C8NA 1SMDA 5G4HC 4NXSA 4Y7EA 4OTKA 2G0WA 3HPZA 3QRHA 2X0YA 6PTDA 1V0NA 3TLLA 3AHVA 2WNNA 1WUEA 3LTPA 5E0FA 4GA8A 1L6YA 3PZUA 3AWOA 5B7ZA 2BASA 1JQVA 4XUGA 2CZFA 2A1YA 1OEPA 3GYEA 3DHDA 1UKTA 1VS1A 2O9OA 3K2GA 2EKCA 1WP6A 3TMQA 2J74A 4PMRA 4Q4KA 4CNOA 1XUZA 1RP9A 1ZBKA 2I17A 3INPA 4IMEA 2PP0A 2PRHA 3N34A 1W5OA 1DXEA 2X0HA 3SUVA 4PCFA 3BAXA 2UY5A 2ZWYA 4MB3A 4DZHA 1FCBA 3L4TA 2RFGA 4QITA 5FOOA 3M1ZA 1TV8A 5IOBA 2VELA 1U1UA 3NG3A 3STCA 3TCSA 3ERPA 4GKTA 5H6HA 1E55A 3P62A 2HPMA 2EQDA 4MY1A 2Z2AA 1BPLB 4KRTA 1H60A 3MS8A 4XB3A 3TK7A 4D6JA 1PS9A 4LJ3A 3GDRA 3P84A 3EEGA 2PD5A 3NJ3A 2NT1A 4UUIA 4LAZA 5U4NA 1HZYA 3VDHA 3V75A 5TNVA 1WDSA 2P0IA 3OTRA 2GJXB 2CLOA 5HR7A 4WF7A 1JCNA 3KTSA 1V3MA 2BY1A 1Y7VA 2XH4A 1C8VA 3GDMA 4V1XA 2XUCA 3PANA 4S1FA 4LNYA 4UOZA 2F2KA 4MHBA 4P61A 3UNDA 3BLLA 1QWKA 2FVMA 1EJWC 4NT0A 3VNLA 3RRAA 4N9EA 3VKAA 5ABGA 1Z9AA 3SR7A 3MCMA 3W1NA 2QHAA 1GVOA 4GYPA 3AQUA 4C1LA 1ENUA 4ZO8A 4A21A 2E25A 3KOWA 3E5BA 3EA1A 4O19A 4EF9A 1BQGA 2GJPA 3CT7A 4C6LA 3HG4A 1QK2A 3ZZ1A 2QUTA 1E0VA 2VRKA 4OOZA 2JE8A 2WZHA 2YZ5A 4RDZA 4JAWA 1CCWB 3TSDA 2J9YA 1YPFA 3H6OA 4DF0A 3VM7A 5I06A 3GHTA 1VFOA 4WOQA 4JTKA 1EH9A 4XG1A 4LV9A 4NZJA 4OUIA 3LRKA 1VJIA 3FSUA 3ZVIA 1PTDA 1PHWA 3WELA 3WD2A 1DPMA 4NZ3A 3RO6A 5AYBA 1XLLA 3PBYA 1CECA 2QR6A 4OKDA 4OV4A 5HJXA 1L6FA 2OSXA 2QULA 2X1TA 4KESA 3WN6A 3GBEA 2RAGA 3IIZA 2BVTA 3WLTA 2DW6A 3GBDA 1VCFA 4G1NA 1BD0A 4WSKA 1N55A 4RUBA 4CNUA 2CZDA 3PB2A 5A6JA 4GGHA 3W85A 3LA4A 3DHUA 3EWBX 2XISA 3ONCA 3UPWA 1DJGA 2PDKA 1DE6A 1B3ZA 2OYMA 2VR2A 4H7VA 4YXGA 1S5VA 3BLFA 3UJEA 4L4OA 3N29A 5CQ1A 2W3ZA 3CYJA 3OQEA 4QAIA 2VOMA 4Q3MA 2G3NA 3L0GA 3P60A 3V1HA 4ZQCA 4RDVA 4TVUA 1SO6A 3WMLA 4UC5A 3CT2A 1FWFC 3K4AA 4GY1A 5I2UA 2P3ZA 3DDMA 4Z1DA 1JYNA 4MZ8A 1GORA 1EEXA 2PDUA 2OZ8A 4C6PA 3BLKA 4XUYA 1D8WA 4KCVA 1XH2A 3G5EA 3N19B 4UTKA 5I3GA 5C70A 4HZMA 3C2YA 5ABEA 5BRPA 1YQ2A 5DLCA 2AL2A 3N2XA 3NQ2A 1DXFA 3WO8A 5CPLA 1NWUA 4AZIA 1M53A 3N6QA 1ODUA 2OEKA 2Q09A 4S3EA 3EZ4A 3EMCA 1G9HA 1KM3A 3IJQA 1TMLA 4QLKA 4DM2A 1PDYA 3C2OA 3KOZA 4HMCA 1GHSA 3BV7A 3KL3A 4IJRA 5D2XA 4C6QA 2NQ9A 5DT5A 2ZOXA 4IJCA 2WMJA 3FA5A 3M5VA 2CLIA 3GHRA 2TRSA 4L61A 3T8LA 5EKYA 2ZUWA 4WOZA 2A7PA 2VT0A 3UVAA 4N7QA 3WQOA 4PMDA 2R1NA 1EC7A 2G8ZA 4DI9A 3SADA 4ZR8A 3KS6A 4GQQA 3TFXA 2VMFA 1FQ0A 2AMXA 1LT7A 1JGMA 4FOKA 1OX4B 1I4NA 2I9UA 4PMOA 2NV1A 3HQPA 1E0UA 1W3NA 1I2OA 4DI8A 3M0LA 4BEUA 1KM1A 1Q4WA 1PHQA 2RGLA 1PWLA 3FOKA 1A0CA 3NPUA 3KVMA 2BSLA 4FLRA 1GKRA 3T78A 1G4PA 1HVXA 1EL3A 2J47A 1PBGA 2QCFA 4PMVA 1JZ8A 1TV4A 3TR9A 4HMEA 5D38A 1NDYA 4HOXA 3N73A 4YMZA 4J3ZA 2PTXA 2XN0A 5IBXC 3L5LA 1JYVA 4GI4A 2RHGA 4LWWA 4JX4A 3ITGA 4BZYA 4HNTA 3BAIA 3DBPA 2HDJA 3RLGA 4AEOA 5D8WA 1FFQA 4CCCA 1A0EA 2VR4A 3A5VA 3PZNA 3GC2A 3HF3A 3OBKA 2C0HA 4DEFA 1Q13A 4AF0A 1JVNA 5EBAA 3TKFA 3TSBA 1TMHA 4UNLA 3QJAA 3C4UA 5REQB 2Y4SA 4I7UA 4YTSA 3H7UA 4M1BA 4HNOA 3N6HA 4TUFA 2P0OA 4XIAA 1C29A 1U1HA 3GG0A 4XAFA 5IHSA 3QC3A 1XRFA 4NAEB 3H23A 2OKOA 5A6LA 3GZ3A 2A7RA 4F4RA 1ODZA 3ARQA 5LIYX 1JUBA 1RUSA 1XBXA 3LI1A 4Q6XA 1E0WA 2Q8XA 1ITCA 1PSCA 3RHGA 2X2YA 1IZKA 1EGMA 2ZUMA 4IXHA 4AHPA 1MI3A 4J3VA 4LVBA 3IV8A 2RH9A 3CIWA 2VJXA 1GJWA 2Y7FA 1CB2A 3G18A 3CIXA 4CQ8A 4TMCA 2UY4A 3BUVA 4F2TA 4L1WA 4Q8MA 5BMXA 2V82A 2FIQA 4WLCA 4B3ZA 4LT9A 2YFOA 4IL2A 5F1UA 4LVFA 1FCVA 1RBOB 4IUOA 5HMDA 1PUDA 4XV0A 2PWFA 2HS8A 3S83A 4GUGA 5IM51 3I65A 5HQEA 1DKWA 3VIFA 4LY8A 4I5RA 3KZSA 4GPNA 1BTMA 4IPJA 1OK4A 4W7WA 2X1UA 5ECUA 3F5JA 4QDMA 1R6WA 3QR1A 3QMTA 5C2XA 2XN2A 2B7PA 2JALA 3CHDA 2WVVA 3GKFA 3RMJA 3WH9A 1EJXC 3DGRA 2ZA3A 5DMNA 1OYCA 3CH9A 2VFGA 5AC6A 5EFDA 2V5CA 2JIWA 4PULA 2NV9A 4E0CA 2V38A 4YL2A 2GSJA 1KCZA 1FUYA 3STGA 3WX7A 3NOEA 3VTRA 2WKLA 3KBWA 3VDGA 1B3WA 2HMCA 4ROQA 3WH6A 3RUBL 3C86A 4H7CA 4XD3A 1XLKA 2DZSA 2X09A 3MO7A 1GW1A 2XIIA 1F3XA 3CHCA 1Q7ZA 1QNRA 3PJXA 4Z2KA 1J96A 5DCEA 4J5NA 3KTXA 4M82A 5IBXA 1WZLA 3RU6A 4H3DA 4MUPA 2I9EA 4YYCA 1O7AA 3VIIA 4DLMA 5CC7A 1KGXA 2GQAA 1F6YA 1UKPA 1M68A 3PZQA 5C71A 1Q8AA 5BWAA 4DO6A 1E9IA 2HBXA 3O6DA 1EEPA 4J2PA 4BR1A 3GFXA 1PCWA 3SJ3A 3UXAA 5BOFA 1P0EA 2CETA 4Y8FA 4H9MA 4MTVA 2XZ7A 1B1YA 3KFTA 3ITCA 4QE1A 5FJJA 4NYYA 3UZ5A 1IXNA 2G97A 3NQ7A 3P8IA 3SZ8A 1H0IA 1H2JA 3OBAA 4B15A 4GUJA 1KWKA 4L9ZA 1SQ7A 5PTDA 4Q7NA 5JUVA 2ZE0A 3G0UA 3IJIA 3B06A 1W1IE 3WBXA 3CPRA 1S2TA 3CZLA 3MT1A 4X2PA 1W37A 2D73A 4J27A 4XAZA 3AXMA 3EOOA 3P2VA 4LRSA 2IKGA 4BF5A 2YL6A 2ZC1A 2FKPA 3DEQA 1ZCCA 3BMWA 3FNDA 1DV7A 4LBSA 4CCEA 3K30A 3PWIA 2D0GA 4B5SA 3R25A 5H8PA 5A95A 3FGCA 1UA7A 2Y8UA 2Y88A 4A4AA 4BQ5A 4MJMA 4GOAA 3PZ9A 3B3DA 3H2EA 2DIJA 1XC4A 3F5LA 3QKZA 2BMBA 4D1IA 1KBLA 4IFKB 4Z08A 1HG3A 4JICA 1FWDC 4GUIA 1TYGA 3GZAA 4W8LA 1K8CA 3W7NA 3BJSA 3A4JA 4WDTA 4KWVA 2E6YA 3G2GA 4UBPC 4A3UA 4QJ5B 4I9JA 1OC6A 4UTUA 3KP1A 1J0JA 4NASA 4XKMA 5CC3A 1XL9A 3S2LA 3V35A 1OHLA 3FY1A 1RBLA 4RE2A 1F73A 4EK7A 3KP0A 3BCDA 1FDJA 1DVJA 2ZA1A 3M5YA 4GE8A 1XLAA 2Z1XA 1PKLA 4O28A 3OEXA 2J13A 3NQVA 3CO8A 1NJJA 4XVEA 3CMJA 1ZS2A 3QEZA 1G6CA 4PCTA 3RDKA 3AHZA 1CX9A 4G56A 2DZAA 3NL6A 1JL8A 3LY0A 3RXZA 5F2LA 4O52A 3CS2A 5EMJA 2CBIA 1VJZA 3WLPA 1OYAA 2VX4A 3MSGA 1RQHA 3BW2A 3CWNA 1GQKA 1J0HA 1UCWA 2QS8A 4AWTA 2V3DA 2YBUA 1W3JA 5AVNA 3UERA 3V36A 5E1QA 2NWSA 2A0NA 1XIIA 2XFFA 2F38A 2R6OA 1OF8A 4HPNA 4YS1A 3TJ4A 2O4QA 4Q4PA 1XFCA 4BCEA 3QW3A 4KFPA 1ZNNA 3U4FA 4S38A 2JQXA 1QWGA 3VPLA 1EJVC 3NWRA 1XKJA 3LCXA 4S23A 3LUTA 4XK2A 4FK9A 1K7XA 4L4PA 1T0OA 3DIPA 4HD5A 4PTNA 4IX2A 3ID7A 1FHVA 5HWJA 1JPIA 3NIYA 3BZJA 7CGTA 1XRSA 1YTEA 3R79A 2VZUA 4OBTA 2ZTJA 2YYTA 4RCXA 4KW2A 5BCAA 3XIMA 2EJAA 1JZ7A 1UROA 3TW9A 1VBRA 1MFUA 1F3TA 4QNWA 3OLEA 3BZGA 2FGZA 2ZZ6A 5LZLA 3OP2A 5MKGB 5I07A 3SCQA 4X22A 1PTGA 3ITXA 4AD2A 3VE7A 1W9BM 1FDYA 4AEEA 3IJ8A 2XH2A 2H3DA 2WMGA 3BOLA 2ALRA 5ABFA 2F61A 3WLQA 3QPEA 1QJWA 1D2KA 2HK0A 3R94A 1B5TA 2O7SA 1LOQA 1K9TA 1YIXA 1Y5VA 3PWAA 1OC5A 4MWAE 4XBJA 3A9IA 2E68A 3GHSA 4B5UA 3MCNA 4GNVA 1W1B1 3SSZA 4NAEA 2QIIA 2VZVA 4U3CA 1L6SA 5JIWA 3F2CA 4HHHA 2EG7A 5RUBA 1G7UA 1HJQA 3MV01 4Z2LA 4W5UA 4IP5A 4NJIA 3SQMA 1C8YA 1AW5A 3MHUA 4GACA 3MV11 3I6TA 3TV8A 1YE4A 4HK6A 1J79A 3CAKA 5GJNA 3M7SA 3RCYA 1GZJA 1YDVA 1IEIA 4D8ZA 3U8GA 1TUFA 1YXCA 2W79A 3CZGA 5DXXA 5TF0A 5J5DA 2OOFA 2QCGA 4WQ6A 1IWPA 5CZKA 4B2DD 3U5YA 1K8XA 3B0XA 4KWUA 3PJUA 3V5OA 2VVNA 1OIMA 3WBEA 1V7AA 1CBGA 3Q37A 3FA3A 4TR9A 2HWGA 1UJPA 1IGWA 2Z00A 9XIAA 3L4WA 4FF7A 4AMAA 5CZJA 2R1LA 5I3KA 1NOWA 2CLHA 3UPMA 4P8UA 2INFA 4H9ZA 4IUGA 3BWWA 3IJ7A 2J6XA 2H8ZA 3WQ4A 1TPUA 4CD4A 4FHAA 3W53A 4WZHA 1HT6A 2DPEA 1W5MA 1V03A 3WF1A 1R30A 2BFGA 4IIHA 4JY8A 2VGFA 2C0AA 1QASA 2ZVRA 1XGZA 5BWFA 4O10A 3OG3A 4ACZB 3N9RA 5GNXA 4CNNA 2PU1A 4NNAA 3VAVA 1W9VA 4AUBA 2FHFA 3HQNA 3TYBA 4EWJA 1OIFA 4OUEA 2WVUA 3AO0A 3U6WA 3VK5A 5KSWA 4FX6M 4IHCA 3SFWA 3LV6A 3CQIA 4DY1A 1LG1A 4B5WA 5AY7A 3POHA 3S5SA 3FYPA 1OD8A 4C7FA 2CFFA 2C91A 2PZ0A 1REQA 1SZRA 3U4AA 3ANYA 4YTTA 1T8QA 3GQYA 1TSIA 3M41A 3QYSA 3HA1A 5AHNA 3PTMA 4B9YA 4Z1CA 3THCA 1XC6A 4AD4A 2OZTA 3FYOA 5LIUX 3ZR6A 1OCQA 2W0UA 1TPWA 1C9WA 3A6OA 4U5KA 5A8QA 2ASHA 5DX7A 3R13A 4FXRA 4WR3A 6TAAA 3GU1A 4U3AA 1EA0A 1JCMP 1JEZA 5EGRA 1H1NA 2G37A 4S3KA 4W8AA 2WM1A 1K7FA 2O56A 1A4MA 1EZWA 1HIZA 4GVHA 2OGYA 4LBUA 1ZALA 4Z42C 3S1WA 3T6CA 4AZCB 1CXKA 3VUPA 1XLEA 5AC5A 1RVKA 2EPMX 4URIA 5FD0A 3LBOA 3B9NA 3Q45A 3S5YA 3WL0A 2FQIA 3M44A 1IWAA 3KAOA 5E6ZA 2Y89A 3CNYA 2D24A 4GZEA 2X41A 1HKJA 2ZUSA 1GJPA 3RCMA 1B2YA 4H6EA 4HU0A 3PK7A 4HU8A 3T2QA 2UWFA 3DKLA 5AHLA 1UC4A 3RR4A 2X42A 2AL1A 4YLWA 4C1KA 4DJFC 4WXYA 4F0KA 3KL5A 4MNLA 4QE4A 1UR1A 4HPGA 3SRFA 4WKAA 1M5WA 4B4HA 5JMUA 3T1GA 1JDEA 4H2HA 5JBDA 3ARWA 4U10A 4DYKA 4LEFA 3FVMA 4D6EA 3TAKA 4PB3A 4GNKB 4ZL1A 3PB0A 2C7FA 4RNIA 4RLIA 1FHDA 3L2LA 5C6MA 2D0HA 3VD9A 3R8HA 4JIQA 4C5YA 1R0MA 4EAMA 1NH6A 5AYYA 3BO9A 3GB6A 2I56A 2J79A 4JIRA 2XU2A 3LS9A 1W1YA 3CL6A 3CUIA 3HJZA 1GOIA 3GXMA 3LZ5A 3ZLFA 2V67A 2BB0A 4QCFA 3MVIA 4LFYA 3M64A 3VOCA 2GUBA 4FOUA 4C91A 3NO1A 3AYRA 4MWAA 1BFNA 2IW0A 3QV8A 3QHOA 3S8HA 5IFTA 2ZE3A 5XIAA 2W67A 3ATZA 5KMYA 1GOWA 1BXCA 4UQCA 2BGNE 5IRPA 3NM3A 3WDJA 1TWDA 1WZKA 4ILSA 1TRDA 3P93A 2DZXA 5AC4A 1VP5A 1SFJA 1YNPA 1B31A 1PVNA 2PGFA 2FVLA 3BSGA 3C3UA 3N2OA 4Q8TA 1RPKA 3T08A 4MOZA 1VYRA 1PAMA 3VIGA 2DORA 3TNOA 7A3HA 2FGLA 3G22A 1AUSL 3LCHA 3KW3A 4QEHA 1W17A 2D69A 2GYIA 4NL1A 1IT0A 4J3WA 3FS2A 1I2NA 1MSSA 1J8VA 1EHNA 2DSVA 2ZIDA 3ES7A 1NP2A 3PUGA 2QEZA 1I2QA 3T9PA 1ME7A 1KM2A 5D37A 4QG9A 3SY1A 1D3CA 4HYRA 2IUZA 3AWNA 5E0KA 2YCJA 4UOJA 3R5EA 3WNKA 4R53A 1ICPA 1FFRA 1EP1A 1ADDA 3NQCA 2E7FA 1RQBA 4DBEA 2BS9A 4V2XA 5F1VA 3WQEA 4GIYA 4P7NA 4NJGA 1WNOA 3VNYA 1LRNA 2HROA 1FWHC 4EIVA 5E5CA 3ABQA 3PFMA 4KRUA 1YPXA 4US5D 2J66A 3TYUA 4O14A 1LWJA 5E93A 4AISA 2F6UA 3P3BA 1XLFA 1SZGA 2Q02A 3S9IA 4IIEA 1HQTA 4LOCA 4WX2A 4I3GA 2EG8A 3DFOA 3UEQA 2ZX5A 2C16A 3MUCA 1F05A 3R2GA 2W63A 1OK6A 1IGSA 4NZ4A 3V5CA 3C0SA 1D8CA 1Q4NX 4EE9A 3UBPC 3FEMA 4IL0A 3V0TA 1RCXB 4JFVA 2WNWA 5HUPA 2YCIX 4E4PA 1BWKA 1I2PA 2DZWA 4TX9A 1EFZA 1E5NA 1A5UA 3RM8A 3GG8A 2JFEX 1RV8A 1ISZA 3CV1A 5A5WA 3BC9A 3WQPA 2GVLA 4DXVA 1VPYA 3ZWSA 1MXSA 3K5XA 3T0DA 1BVWA 1ZRQA 4B5XA 3QM3A 2TSYA 1KTCA 1WZAA 5I0DA 2CU0A 4GYJA 5CC6A 1Q45A 2GPTA 2ZTKA 4QJ1A 4KGJA 4UR7A 5CBBA 1V51A 4YVVA 2DT3A 2O92A 1XCXA 3BLEA 3ZS4A 4HYWA 1GTEA 3NCOA 4YCPA 4YWIA 1FWEC 4UOQA 3N18A 1U2YA 1PB0A 3GUWA 3BE7A 1I6NA 2E9LA 4Y6GA 3FYYA 3KM8A 5A3HA 1VRDA 4M0XA 1UBPC 2PDGA 3EOEA 3GTHA 3NQ8A 3PN8A 3W7KA 1KFEA 3WEMA 1QOQA 2QF7A 5AN7A 2TYSA 3EX4A 2J8TA 4E2DA 3EWXA 3PBGA 1V08A 4JD4A 4LCRA 1U5HA 1K6AA 3EYPA 5JQ9A 4C7GA 3KLLA 3V4BA 2BVYA 3CIVA 2GWGA 4DAIA 2VEGA 5G2HA 2POZA 4DZIA 3EA3A 4JHOA 3W28A 2NWRA 2UY3A 1WXYA 1K03A 1PTAA 3ARUA 1BYAA 1QW8A 5CG7A 3K8KA 5EYWA 2BP1A 5CSYA 1WDRA 3USZA 1KLYA 3G1RA 5JH2A 3TP4A 4AD3A 3QMRA 1TQXA 3GHUA 1J6PA 3BSMA 4R27A 2YL5A 2KAUC 2XTKA 3RX3A 1UR3M 4B91A 1ZGDA 3WF4A 3A3HA 3S9ZA 2WZMA 3KUMA 3L5AA 3VKJA 3L4XA 1HXJA 2WBKA 1JZ6A 3FA4A 4FOJA 1KA9F 4TOQA 3GY1A 3VIMA 2FZBA 1TVNA 1TZZA 5M1TA 1AQFA 4GNJA 1VZWA 5M2FX 3M0HA 1M7XA 1KRBC 2BVDA 4IMCA 2YW3A 3VOIA 3AALA 4KPLA 1ZJAA 5G4WA 3SDOA 1EX1A 3NQMA 1X6NA 3HU7A 3SGUA 4B90A 4X9YA 2PRLA 3MMDA 3WFZA 2CHRA 3OW1A 5HMFA 5FF2A 4I5UA 1W3LA 3BARA 4W7UA 4H8VA 1M7OA 4IQLA 2XWEA 3P82A 4PYSA 5BOOA 1KR0A 1Q66A 2VWSA 1O1ZA 2WC4A 1UWSA 3QGVA 4ZE5A 4GYPC 5FI8A 2WSQA 2DSUA 4L56A 2D3NA 2NUYA 1DWAM 5HPOA 1XIJA 4RW5A 4O8RA 2J8GA 4CVUA 2C79A 4AU0A 1WDWA 5LIKX 1TVPA 4P8WA 4TMBA 4DXKA 4CD7A 4OGZA 3DG3A 1UBSA 4M6QA 3QYQA 4X0NA 4C6DA 2YPIA 4FNUA 3EXSA 5I5RA 1K6WA 5FESA 3IK4A 2NVAA 4ZODA 3UZYA 6XIAA 2OYKA 4DJDD 3UG3A 3UPBA 4QSFA 1GG0A 3L7RA 3ZVHA 4JIEA 1ZB5A 2ZRZA 3SGZA 1HW6A 1OINA 1OX6A 5TQLA 5FF7A 2WZIA 3SUSA 1JYXA 1W54A 3F03K 5EMLA 3T07A 1AMKA 1AA1B 3WY1A 3NUKA 3RO8A 3AHYA 5LXEA 3KOFA 1W1VA 3VCRA 1V4YA 2OZ3A 4D9PA 3WK0A 3WQ6A 1F61A 2V69A 2INEA 4LS1A 5D2VA 2PDQA 2PDXA 4ZO7A 3CUXA 1A3HA 1TV7A 1SU5A 4QG8A 3H12A 3EDKA 3BCFA 3GE7A 1E56A 1BXNA 1X96A 3VDAA 2VKZG 1NELA 3MMWA 2HISA 3LCFA 3O0KA 4LS2A 1WDDA 4PL1A 3HM7A 3A22A 2CBUA 3N4FA 3QXBA 4GVGA 3GM8A 3B40A 1KGUA 4D6CA 3H24A 4XVDA 5AB3A 1LBMA 2Y70A 3I7SA 4JIHA 3DENA 4S3DA 5A6BA 2B31A 2WYSA 1M01A 3CUZA 3AIBA 3RLHA 4BF9A 3PR2A 1UP3A 5BZAA 3U7VA 2GGJA 4XO7A 1MXDA 2VOTA 3VMPA 3FIGA 1JI2A 3CC1A 4KEZA 1IZJA 3TOPA 2XVKA 1UOZA 4XZIA 4HOWA 4BQ4A 3EX3A 2XJ7A 1FCQA 4JTUA 6REQB 4DBSA 5D2WA 4PRRA 4UCGA 2WLYA 3QPYA 2QUNA 3E0WA 1E6ZA 1EGZA 1XDJA 4MNKA 3A47A 1DWHM 3DUGA 1HL2A 5D02A 1V3LA 3EX1A 5CBIA 1SVDA 1QUMA 3I6RA 2ZZ7A 2GJLA 4BA0A 1VEOA 4O18A 3B8IA 3LENA 1KBBA 1OD0A 2Q01A 4K7VA 4JTSA 3AXKA 3KXQA 5EU9A 1DJWA 5JIPA 2W4XA 3SQLA 2ESCA 1B4EA 3KCLA 3SCSA 3NDZA 2PI6A 3PBWA 5KTLA 4OWGA 2A3AA 5KZ6A 3ZJ7A 4YVXA 2P50A 3WQGA 2L5HA 5H8UA 1OFEA 4LV4A 4JEQA 2J78A 3P74A 3WNNA 4MKNA 3MKCA 4IQJA 2E1WA 1UD2A 3C8NA 4NRRA 3W07A 3T0CA 4LANA 1LDCA 2OJPA 2Q3OA 4RE0A 3TVAA 3RU8X 1DORA 2TODA 3OZOA 4ONVA 2EPKX 2FZDA 1W0MA 1WXJA 2ZZ3A 1LYXA 3TR2A 1HL8A 1QR7A 4KS0A 3G3DA 3ECQA 2NX1A 2I5IA 3C2VA 3U2OA 4ZQOA 2QV4A 4GCAA 1F3EA 3ABOA 4JTRA 2AQOA 2PP1A 1EGVA 4HCDA 4O13A 1Q7MA 1U22A 3W01A 2QCCA 4FP1A 4UTJA 1KXVA 3SCNA 1LQ2A 1V3IA 4HMNA 3EEZA 3CZEA 3DN5A 3KS5A 5EL1A 2Z7KA 4JKKA 1T6MA 4X0VA 3UZXA 3N9KA 2Y5JA 4H01A 1F2JA 4A3HA 3NGJA 1GG1A 4UMAA 2CLKA 4O1BA 5FEXA 3WBWA 2WC7A 4E3TA 1V79A 1H7XA 4MDPA 4LPCA 4K7YA 3GWQA 4MWAB 3LEPA 4BI6A 2QJMA 3M0YA 3QGKC 3CUJA 1AZ1A 3OQ8A 1L8PA 1TJRA 4YJ5A 3UU0A 3BV4A 2O4MA 3RX2A 5MHBA 3NQDA 1R3WA 2A3LA 1IEWA 3UXLA 1A53A 1E0TA 3O06A 2DT0A 4RE4A 1SM9A 3ITLA 3KBNA 3P81A 2QIWA 2JKEA 2PSNA 2YBVA 1QI5A 1KM4A 2OLHA 4CD8A 3RN6A 3W7JA 3ZSTA 4Q32A 1JPHA 3E0LA 2BY2A 1J2WA 2NQHA 3SCPA 4AF0B 2ZUNA 4QRNA 4U5IA 3W6LA 3E2QA 3EPNA 1ZJBA 3HPSA 3OIXA 2BHUA 1G69A 3WFLA 1WDPA 4CCDA 2DZBA 1Q6RA 3TU9A 4OOUA 3OZYA 2VL4A 5I24A 4DJFD 2PDLA 2WHJA 1Z44A 5FKYA 2BWGA 3JRKA 1F8MA 4WY0F 2AKZA 1VJSA 1MXGA 4JN7A 1M65A 4H00A 1TCDA 4IMGA 3C8FA 1KFKA 4M6VA 3L4ZA 2D2HA 3KLKA 4FLQA 2NVDA 3URAA 5D33A 1JDFA 3R4IA 3W7EA 4D6GA 3CB3A 5BNKA 2I57A 3TUUA 3I10A 3SAZA 1TB3A 3WDQA 1E9ZB 2W91A 6REQA 3IPWA 1LOLA 1YDOA 3AYTA 3GXTA 2NSXA 3IGSA 4Q8VA 1Y8BA 4WVXA 4JTHA 4UB9A 2OXNA 1PX3A 4NF7A 4WD0A 1PL9A 3EOUA 4GUHA 3W1LA 3AIUA 1NU5A 1H62A 2C14A 2WVSA 2Y62A 1RA5A 3S9YA 1QAPA 2B7NA 3AS1A 3GAKA 2TMDA 3LCLA 3R8RA 1GVFA 4FXSA 3VA8A 1OX5A 1NEYA 4O1AA 3QR0A 2XZ9A 4FR1A 4ECLA 1YPIA 1H4PA 7XIMA 4FMVA 2FPTA 3R0DA 1FWCC 4AYSA 3H2OA 5AC7A 1I1XA 2XDFA 1K3UA 1ISWA 1S2WA 3VZXA 2BOFX 1GYLA 3W38A 4P7RA 4C6OA 5D2TA 5I3JA 5CSUA 3G0SA 2AKMA 2IKJA 3NZPA 1QTWA 4JFSA 5K7JA 1XUUA 4LALA 1YADA 4JCLA 4O0KA 5FAGA 4QBXA 1XYCA 3QZ6A 5DEZA 2R1PA 3S2MA 1MW1A 4CEUC 3L21A 4UQ9A 1BF6A 4HNCA 2RJGA 3MHGA 4AWEA 4QROA 4A8IA 5LA1A 3LYEA 3HMJG 3MSRA 2ZRYA 4WJEA 4QXIA 3WJWA 4GQBA 1S5WA 4M24A 1NM9A 1YDNA 1TJ2A 4FB7A 4GXMA 4XZMX 1BHGA 4UQEA 4K8GA 4W87A 3N13A 3OOQA 3CQHA 3H4GA 4AY1A 3L4VA 3NPVA 4Z0SA 1KD0A 2YSWA 1Q6DA 4J3XA 1A5OC 1QPQA 1V6UA 4JTLA 4HA4A 4MWAD 3UESA 1BRLB 4IPNB 4AAJA 2IPGA 1OFAA 3KCJA 4LUSB 2CZEA 4JTTA 1KFCA 4LB4A 2VC5A 2W92A 1F5ZA 4HZ8A 2PDMA 1XLMA 4WJXA 4D8AA 1VLWA 4IICA 1GTHA 1S39A 5H1WA 1XW8A 3WF3A 3GDKA 1DIDA 2DH2A 4OJYA 4P8XA 2G95A 4A8RA 1KNWA 5A1AA 4IISA 3TA9A 1W3IA 4LYKA 1S2UA 1JG9A 2YL8A 4ENLA 1Z7AA 1ISVA 1TWWA 3FJLA 3QLLA 4XX6A 4UTLA 4E2BA 1N2VA 2W6RA 5AZ0A 3GDBA 1UYQA 1OFRA 3THQA 2YL9A 1L6GA 3WD1A 4DWSA 2FB3A 3GUGA 4PUDA 2YJQA 1J5SA 3PPFA 3PUEA 1DXIA 1GJUA 3W7MA 2SFPA 3Q67A 4Y9AA 3O05A 1S38A 2A85A 4AD1A 3EPOA 1AJZA 1B9ZA 1O5KA 3FFSA 4RDYA 3R0UA 3B8VA 3FX4A 3CJPA 1T7LA 2YB1A 1EC8A 3S46A 4MGGA 1XBZA 1R38A 1NIUA 2OQLA 3W1AA 4KIRA 4B3KA 4I8DA 2TPSA 4GIAA 4QX4A 3EKGA 3IGUA 3GXDA 4Q22A 2GQ3A 4ACYA 4UZSA 4D71A 4E8CA 3DFSA 2PE4A 3W2NA 1SW7A 3W74A 2GGIA 4XD5A 1RY0A 1UR2A 2NQLA 3IUHA 2OZ0A 3P0XA 1QHZA 5TD4A 1KW1A 4M51A 1UQZA 1CNVA 1GZGA 1IHIA 4O0QA 3FJNA 2ZUTA 2GJXA 4ORMA 4PUNA 3E3HA 1EZ2A 2QMJA 3VDBA 5ABTA 5XINA 1BVZA 1TELA 4GWEA 2YXOA 1GOKA 2O9RA 1AK5A 5HQLA 1AVAA 2DZTA 3LPOA 2ZC8A 3OLIA 1C93A 2CHNA 5I3HA 2YCEA 4AC1X 2VRQA 3KBJA 3QLDA 5SWUA 2C1GA 3RLUA 4QGCA 5A6AA 1H7RA 1Q5MA 1L6WA 1X7IA 3CAWA 5D05A 1VLIA 1UR9A 5D32A 2FDMA 3E5PA 4UTTC 1FWBC 4AVOA 2X1IA 4DF2A 1VIWA 3GO2A 3PBMA 4JPGA 3LD5A 3LLFA 4FLOA 4WY0B 4BI5A 1I9CB 4DJED 1PKNA 3JR2A 4TIMA 1R86A 1TA3A 1ZAIA 3GIPA 5HNTA 3TQKA 5C55A 3D46A 5FF3A 1AFSA 1H61A 2J4GA 1QOXA 2X2GA 1G4EA 4IM4A 1RBAA 1XYAA 4WRHA 2DUZA 3THDA 2PWHA 1XF0A 3WCZA 2V5KA 2E5DA 5BRBA 1QNOA 3T42A 5JXQA 1XIFA 4UFJA 3P6LA 1X1NA 1BWLA 1S5MA 4NAFB 1M03A 3E0VA 2GK1A 1KTNA 2P3EA 3W75A 1H51A 4P7OA 5DRIA 3WDHA 5CAKA 4AX7A 3AUJA 3UWWA 1QHOA 3AHXA 4ZTYA 1ITUA 3ICJA 1ONXA 3S1XA 1GZ1A 4RNJA 1FWGC 4PBFA 4WDWA 3LOTA 2C13A 2YCLB 4M81A 4QQUA 1SO5A 3JVAA 4IIFA 4QCEA 1O5QA 2EG6A 3ZO9A 1RLCL 3W1MA 3PJWA 1OCJA 4JOMA 4BF7A 1NWTA 1RJPA 5FIPA 1EJUC 1RCQA 1TV5A 4Q4MA 1V8EA 3BL3A 1DJHA 2DZVA 2D23A 2ISVA 4JXCA 1B54A 5DF0A 4O57A 4UWMA 3XISA 3CV2A 1OSEA 3NPXA 4MJ2A 2YR1A 2PWEA 3C6CA 2C15A 3YPIA 2JKAA 2EHHA 2ZX8A 2IPFA 4CLMA 2VD8A 1W32A 3PAOA 4AD5A 1ECQA 2JEPA 3N14A 5I3IA 3B04A 2QJJA 3TAOA 3MDWA 4AWUA 2J7EA 3BVJA 3K1DA 4O11A 3GTFA 3WQDA 4B3LA 5GQBA 3GH7A 3TTQA 3UFYA 5I3FA 2I14A 4B92A 2QUMA 5LIWX 1TV2A 1TX0A 1HUVA 2BHYA 2Q8ZA 5L6UA 1JZ4A 5B7YA 2HVNA 5K4ZA 2HVMA 1O60A 3M0MA 1EP2A 3GVWA 4DJDA 2VCBA 4KFOA 2CLEA 2Z4GA 2CKRA 2ZRUA 5FJIA 4G2DA 1RQEA 3H2MA 3UP8A 5E0CA 1OFDA 3HGRA 3HQOA 2ZFAA 4OBSA 1GYMA 1QDSA 2YIHA 1IIHA 2D0FA 3LNMA 3ARTA 3BJTA 2B7OA 3BGAA 1WV2A 1Z89A 2WPGA 1CB7B 1VKFA 4MZ1A 4K2SA 3VZYA 4BWLA 3RJXA 3ALGA 3DFTA 5DFAA 3C2RA 1NTHA 1OYBA 3UVIA 4MDOA 3QVQA 1BRLA 2J62A 1JPDX 3K8LA 3PBVA 3OGRA 3W6YA 3WQVA 4LCQA 2DH3A 2DQXA 3H2AA 4H9UA 2VX6A 3VD3A 1TX2A 1R2RA 4NIRA 1XDLA 3TC3A 1LRTA 1FKXA 3AXIA 4UFKA 1JD9A 2WVTA 3LX9A 2V0TA 1TA3B 4W93A 5CC5A 4PMQA 1F76A 1P1MA 4L6HA 2ZBTA 5T8GA 2R1KA 4PFHA 5G5IA 1NP0A 1XYZA 3B8TA 3GS6A 3WJYA 4BY3A 5I00A 4BS0A 1SJBA 4JL1A 1J0KA 3HG5A 3CYVA 5CCZA 2QUUA 5M5DA 4UR8A 2WMIB 3LTSA 4W88A 5IHRA 4EF8A 4CCZA 1VAHA 4Q8QA 4GKLA 4C6CA 4TV5A 4O17A 2W5FA 4H8UA 3N3MA 3GXPA 4RR4A 3DYOA 1FWJC 2B4GA 1YRRA 3PTKA 3VKKA 3G1VA 4HHLA 4M3PA 3LCWA 4X3ZA 3WUEA 1H1ZA 4DHGA 1KFBA 3UR2A 3W00A 1XLDA 4FS9A 3CMGA 3HGJA 1C92A 3W82A 4TO8A 4MKSA 1VFHA 4RK8A 1FX6A 5KEZA 3TDFA 5F4SA 3IJ6A 3SURA 2VC9A 4HZ6A 2V5BA 5CG0A 3N4EA 3KRBA 4PB5A 2EF9A 1G01A 2FJKA 3IIXA 3RF9A 1WOAA 2G50A 1R7AA 4X60A 4HB7A 3E74A 1PO9A 4MZYA 4A8NA 3L23A 2XYLA 1I2RA 2WVVB 1JDAA 4AD0A 1BXBA 1VPQA 1QHPA 1XQKA 2FVKA 2XPKA 4HPHA 3FHQA 2YBTA 3T55A 3D3AA 2QDHA 4AYGA 3M16A 4LYPA 1S3HA 5BOEA 3MU7A 3QQ1A 2ABAA 2HTMA 1VBHA 1D7KA 1UR8A 1CGTA 2PMQA 1V0KA 3S5OA 3EWDA 3GXFA 3ONBA 1Q8JA 1H0GA 2DSWA 1O4UA 2NQ5A 4E4UA 4PL2A 4AIUA 3HOJA 3LBMA 1KTBA 3FJ4A 1ZJIA 1QI3A 4GXWA 4ZTXA 2VCCA 1U83A 1QI0A 1BYBA 3FXYA 1ZHAA 3A3XA 3EA2A 2CC0A 2YFNA 5HXMA 3ZJ8A 1TPVA 5BW6A 2F6KA 2CBJA 1CTNA 2BXVA 3STEA 4JTDA 1RSCA 4W9TA 1O6IA 3W83A 2POTA 1OQFA 6TIMA 1N82A 2OKTA 4NVTA 1CI1A 3DYMA 4QM1A 1TPC1 5EY5A 2DVXA 1HN1A 4JL2A 3TSMA 3NZRA 4D8LA 1ALDA 2ZZ2A 5A8GA 4LAKA 3T7VA 2XSAA 4JGDA 1PIIA 3OVPA 3BAWA 3H2CA 3BSHA 3L2IA 2IQDA 2FYMA 3PAJA 5FL1A 3EDFA 4MIMA 1GNXA 1YNYA 1NOUA 3QZAA 4CQAA 3F2DA 1V77A 1LWIA 1SUXA 3BG5A 3UA3A 4CQCA 4GG9A 2GDUA 3AJ7A 4AZ5A 3PPHA 1XS2A 1HGYA 3RPDA 3EWUA 1ITXA 1N8WA 1CWYA 5BU9A 1ZAJA 1EDGA 2OX1A 1B3OA 2AOSA 3R58A 4Y8EA 2P76A 2C19A 3JZUA 4AY8A 4BI7A 4Q6JA 1EX5A 3ME3A 4DJEA 4JX6A 1VHCA 1M3UA 3DOPA 1UUMA 1I0DA 4OECA 3NZGA 3EOSA 5C5YA 2OT1A 5DCBA 2YCLA 1WQ5A 3LQLA 4DM1A 4IMAA 1FOBA 1QCWA 5K9DA 1CGVA 3KVKA 1R85A 2QUVA 1SO4A 2WCAA 4GI6A 2IPJA 1Q6QA 3VNMA 4NI8A 3N11A 4ADUA 4FO4A 1Q2RA 4WXZA 4D6IA 2DEPA 4HSNA 3O6YX 1F3WA 3O9NA 1H11A 1MWOA 1BSIA 3G77A 2D20A 5F2GA 1VFTA 1CGWA 1DWFM 2ZXQA 1P4CA 4GZJA 4O1FA 4M29A 5AFDA 2H6RA 2V81A 2QVHA 4EP8C 1JULA 1XM3A 2FPYA 1TIMA 1FA2A 4NJHA 1R3TA 5A6MA 3LN3A 2IMRA 1W3TA 1GKQA 3UCQA 1IE7C 2V68A 3H7RA 3HPAA 1WKYA 3SI9A 2ZKMX 3GR8A 3COTA 3PF3A 1HJSA 3EMZA 2OFJA 1EQCA 4GX8A 2WSKA 3ORWA 1EA9C 3NYZA 3CTLA 1KKRA 2FPVA 2H90A 3UXIA 4JTEA 4P5UA 1W1A1 1PE1A 1UUOA 5U7SA 2V6AA 2XVNA 1THFD 3B9AA 3LHWA 1UD4A 5K9XA 1KBKA 1LRQA 3L9CA 3HN3A 4CU6A 3RJYA 1DJQA 4HU3A 2WM0A 3VGBA 2VEIA 4TXEA 3DG7A 2GOUA 1SW3A 4Y90A 2NQJA 2FGBA 4HBKA 2WSYA 4L1GA 4M6PA 3NSNA 2IS7A 3NEVA 3PHAA 3T0AA 2UBPC 4U33A 1AH3A 3IRSA 4LF1A 3RPTA 4CNTA 3QOMA 1X38A 2VWTA 4H4IA 3M9YA 1ZU8A 5ABHA 3SY5A 4NRSA 2V5DA 3CUFA 5CPMA 1UD8A 1XLCA 3WUFA 4DBUA 2V9DA 4G9PA 3TWBA 4B4FA 2OELA 4LVDA 3S1VA 5D9OA 5AC8A 3MTWA 3MZ2A 3RNDA 3HV8A 1LLZA 4YN5A 1W31A 1JRCA 3APTA 1BG9A 3KDNA 4IF2A 1VC4A 3G3MA 5LHFA 2J88A 4XKYA 1KFLA 3O2LA 3R7MA 1YE6A 3NGFA 3N25A 3OLDA 2QYGA 2EBNA 3S4TA 3CQKA 3G6MA 3QFEA 4M7TA 2GLKA 3PWGA 4YIWA 4JQ1A 2QW5A 1A3WA 1R9YA 2QNEA 3CV6A 1MYRA 2BDQA 4NAFA 4LAOA 3QC0A 2J77A 4HHPA 1PYMA 3TROA 2R82A 4HCLA 1EPXA 5T26A 3RRXA 3PP7A 1TR1A 3NXLA 3TQ0A 3UT0A 1PEZA 2VP8A 4KWWA 4CGTA 3VO0A 1JZ2A 4L5ZA 1GGOA 3G8RA 1TWSA 2WJEA 1O12A 3EWWA 3POCA 2Z25A 4ZB5A 3CEUA 4Q8UA 1W2VA 5BMWA 1E43A 1GYNA 4ZFMA 3M0IA 4H9VA 1SO3A 1B0IA 1MW3A 8XIAA 4LNCA 4GH1A 1ESWA 1BQCA 2OG9A 2VD9A 3LLDA 2A79A 1S2CA 4NYUA 3QOKA 3H8AA 2HNEA 1VEPA 5CSRA 5LHEA 4H2CA 5LA0A 4JN8A 4UQAA 5AHIA 1HJVA 1TPFA 4U2YA 3B0YA 1P6WA 1TWZA 3S5NA 3VIKA 2GSHA 1H41A 5FSEC 1JXJA 1R46A 4LC6A 1JNDA 2E0PA 3PG9A 4ZQNA 1A5NC 5A6KA 3VNIA 5K4XA 4XZBA 2CXEA 1VFUA 3GFZA 1DTNA 5LNVA 4A3RA 1PZ0A 5FJPA 3TLQA 3Q58A 4J28A 1Q63A 1DWIM 4WSHA 1OBAA 4WK9A 4F66A 4IFOA 3H53A 2V2HA 2YDQA 4C6BA 1CGUA 3TE9A 3DXIA 3WKZA 4INFA 3VIJA 1VBGA 3H22A 1D3HA 4WKFA 3AICA 3GXNA 3ZXWA 2IQTA 4H04A 1HKWA 4NI3A 1KV5A 1VPXA 3C0LA 4O1DA 1MQPA 1VGAA 3VIOA 1JAKA 2CLFA 4PMYA 3FN9A 3MJYA 4WDXA 4W7VA 1B4KA 4JZ5A 4P2VA 2BHZA 2BXZA 1YBQB 1IXPA 4AB4A 1GQNA 2GGEA 4PRTA 4OVXA 3MWCA 1C9DA 3T09A 3LXBA 3AISA 4UZUA 4G8TA 2WB5A 5F2IA 5FJTA 4N2YA 4Q4QA 5G2WA 3IK2A 3S2JA 4IG2A 5ABFB 4IP4A 1VFFA 3JW7A 1Z41A 4DJFA 2QDEA 3DCPA 1ZBVA 1N8FA 2PCQA 1R87A 5JH1A 3VVGA 3U0HA 3SRKA 3T0BA 1VRXA 4H6KA 2QAFA 1FVPA 3FXGA 3UW6A 4GFIA 4MJ4A 3GC5A 1EOMA 3VX1A 2PGEA 3WBAA 4UIOA 3USBA 3R89A 4E4FA 2JBMA 1UWUA 2REQA 3T05A 2XVLA 3CZJA 4HVXA 2VX7A 4I7WA 1IEQA 3VD4A 1XHGA 1TIWA 4J7RA 3W7PA 5D04C 1XV8A 2OLAA 2J7CA 2VDGA 1SFTA 2PGWA 3U7BA 4N6EA 1LQ0A 2VQTA 3WLJA 3PZMA 2P1FA 2DGAA 2X8RA 4NJJA 3W27A 4IT1A 1TPDA 2GVJA 4WSJA 2QGHA 2QJNA 1JQXA 4DELA 3URQA 1UW9A 3TJLA 2WZTA 3KE0A 3W2JA 4DYEA 1M04A 4CUCA 1DQXA 1CXFA 3U2EA 1FTXA 4GK8A 3NDOA 4CKQA 2XGBA 1PIGA 4ZO9A 3B9OA 5LXXA 3TTYA 4F3HA 2YB4A 4IGMA 4UTIA 2ZXDA 3N1AA 4F79A 3NFUA 1S5NA 1NF0A 1GT8A 4QJ4B 3NL2A 3TN5A 3A23A 1UIOA 1Q6OA 5CAHA 1VENA 3PTDA 3A64A 3WNPA 5DN1A 4V33A 1XRVA 5KZMA 1Z8AA 4NJKA 1E1CB 2GSEA 2VFEA 4KRZA 3HZ3A 2VFDA 4ML9A 3UETA 3VC6A 3V5FA 1HJWA 4LUTA 3W7LA 1V02A 1O95A 4AVFA 1NQKA 3KVJA 4JTJA 4GVFA 5AYIA 1KV8A 3VCCA 4FEZA 1WE5A 5HK4A 2X40A 4LSBA 4D1JA 5DBTA 4ZB2A 5I03A 4FX7A 3IIVA 5A2AA 1AJ2A 2DSKA 3NQFA 5FCZA 2RJHA 3WNLA 1W5NA 5C9XA 5DY3A 4FPSA 2FFCA 4D6DA 3RG6A 5DCDA 4DZAA 1J0ZA 3VOHA 4A2RA 1TQJA 3TJIA 3N12A 1CW2A 7PTDA 3W84A 1UA3A 4O54A 1QVBA 1W9DM 4HOZA 4LTSA 4NNBA 3VKBA 3A4WA 3A21A 5E9AA 2AGTA 4ZBCA 2GWNA 4L1XA 5G1TA 1GONA 1SFLA 1KXTA 4AZCA 3T4CA 4DWSD 3ABSA 4AHOA 3HIJA 1PX4A 1ZP3A 1U5VA 5E9XA 3QQ0A 2ADAA 5CLWA 2HBVA 3MQTA 3OYXA 2QF8A 4U31A 4XD6A 3UF9A 1QO2A 3LHUA 3NAVA 2ZA2A 1EOKA 1E9YB 1Q65A 3CLWA 1YXYA 3FDKA 4Q8PA 1AL7A 3VNKA 1DOSA 4XZNX 3QY7A 1V93A 3CU2A 4GQ0A 8TIMA 4LQ1A 4F0RA 3EAUA 4AMCA 5CZSA 4PMUA 5EMYA 1VCGA 3R0KA 3NURA 4EPDC 3A5FA 3ISIX 2OWWA 2WLZA 2PDNA 3WQ8A 2KZHA 2F84A 5FA5A 1I8JA 4WKHA 1Z48A 3ZT5A 2YDAA 1K4HA 3M47A 1ZBWA 2BX7A 1UH2A 2BVWA 1W3KA 3MCOA 3FHAA 4ZGYA 1A80A 3EDEA 1MUWA 4ZQPA 3S6TA 2PLJA 5C0QA 2X7VA 4HQVA 1YMYA 1QOPA 4IIBA 2YYUA 2WO5A 1PKMA 4ZENA 2JGQA 2J27A 3I7QA 4HK7A 1E6SM 3N2MA 5M03A 3TNBA 1XLBA 2PDCA 4HPXA 3O63A 4HNVA 1GVIA 1FHLA 3QY6A 2BV9A 1VBJA 1TG7A 1X8FA 1A4LA 1HP4A 1TPB1 5I02A 3EDJA 3PNUA 3B0UX 2WQDA 5DELA 2I7GA 2OQHA 3E96A 3U9IA 1GEQA 1BG4A 4EXAA 1M6JA 4X61A 3OO2A 1ZL1A 3WJXA 4ADTA 3MYOA 5D03A 3LHYA 4GJIA 4I90A 4C1NB 1UWRA 3E9AA 3IGHX 1RAKA 4L64A 4MPQA 2YZRA 4ZQMA 3C56A 1W1TA 3WENA 4UMCA 1FXQA 4Y2WA 2E09A 3CPUA 3WH8A 3WEOA 2QCDB 1QW9A 3WLOA 4ERGA 4JTFA 4Z2JA 4KCWA 1CXHA 3G1HA 4BEQA 3NSXA 3SFKA 4W8BA 1RCOB 1H5VA 4UXDA 1T8XA 3LM3A 2YW4A 4PEKA 2XIMA 3DERA 4QAWA 5HANA 4DWSC 3VKCA 1LP6A 1TR9A 4TV6A 5FEPA 2PF0A 1K77A 4GGBA 4JQ3A 1FDZA 4A22A 2R1MA 4LX4A 3GAYA 1JUKA 2QJGA 3QTGA 3UJ2A 3WSUA 4HCHA 4DVOA 3AS3A 4RL3A 4DO7A 5J5RA 1WX0A 1UWTA 2NT0A 2PC8A 3LRMA 2OVLA 2O55A 1ADSA 2XH7A 2CNCA 4Q8WA 1XLHA 2QJIA 3WNMA 1O94A 1OABA 1XR2A 3WD4A 5AECA 4QIUA 3IVUA 4QS6A 2BY3A 1R47A 2X05A 2WQPA 1T96A 4E5TA 1KM6A 3FSTA 3A24A 3TYAA 3UWEA 1G4TA 1NY1A 1RJQA 4PE8A 5C2GA 2DQWA 3GU9A 1W9PA 2E5BA 3CZ8A 4B5TA 3W9ZA 1US0A 2PC4A 1MEWA 2BGQA 2OODA 4GABA 2JIEA 5DRCA 4ROPA 1TVLA 4IJBA 1V6YA 1DJIA 2DJLA 2FHBA 2XG9A 4TX6A 1JZ3A 3PZOA 4RZBA 1AW1A 3F2BA 4GBUA 3CWOX 3MYPA 3TW6A 4XAGA 3FCPA 3VOFA 5EMMA 2VR5A 2ZRWA 1DE5A 3BCJA 1LLWA 1SFSA 2Z1WA 3L67A 2NSOA 1GQJA 2Q71A 3RYSA 2ZX7A 2UY2A 1TMQA 1Q7QA 1JCXA 1HF6A 3P67A 7TIMA 1FH8A 2H9AB 3BQ5A 2W66A 2I1OA 4U2ZA 2VFIA 3ZWTA 4IPPA 1K9FA 1S5TA 2GGGA 1XYLA 5HATA 2F6XA 3BURA 3EKLA 1DL3A 3ZJKA 4LU0A 4JYEA 1A47A 1K02A 3BLIA 3N3TA 2VZTA 2FFIA 5J04A 1BYDA 2DFAA 4C6EA 2NVCA 4I9AA 1WZMA 3SUUA 3RMEA 4B16A 2F8QA 1XSIA 4YYFA 3EB2A 4K3ZA 2E9MA 3PM6A 2CHOA 2YDRA 3W86A 2PDYA 1QMLA 3N2TA 1L9WA 4PCNA 1E5JA 2D1ZA 2G3JA 1CPUA 4J40A 4DJEC 2PTZA 1KBIA 1YBQA 1EDTA 3AHTA 5CH9A 3RX4A 3WG6A 3QSTA 4O53A 2WPBA 1ZCOA 3CHVA 3MWAA 3VGDA 3WMCA 2EPHA 1LL6A 3ZM8A 2EPNA 4DNMA 1YXDA 2Z6JA 3VZZA 2FLIA 1E1CA 4QLJA 3JUGA 1TUXA 3LDVA 2DY3A 3QKEA 4IG2B 4E2VA 3SN0A 5C9UA 3T2OA 4A6GA 4AG0A 1GK8A 2O7QA 4IWWA 3HG3A 3BLPX 4HSOA 3VMOA 2OQYA 2HCVA 1EF3A 3TYZA 1OY0A 4WIWA 2E28A 3UNTA 3KHJA 4R34A 1J93A 1AQMA 3EOLA 2VFHA 3IUDA 3GYCA 3WDIA 3TX9A 3FDGA 1GVRA 2J75A 1JGIA 3I3DA 3ABRA 3GU2A 5FL0A 1P6BA 4L4MA 1V6VA 1P1XA 4GIRA 4MADA 4QLLA 3MANA 4S3GA 2XSXA 2W9MA 4REQA 2NV2A 4M1RA 4K36A 1M41A 1ZBCA 4HU4A 4JQ2A 3AFBA 2P5NA 3RCNA 3SGGA 1YDYA 1YX1A 3PSWA 3EWCA 3MP4A 3I7RA 1XXXA 5CPSA 4BQ2A 1IXOA 1E3XA 4C6MA 4CNSA 3LERA 2WCSA 3UCCA 3MI6A 1LBFA 3MVTA 4PUKA 1KFWA 1VBUA 4PSPA 4A3QA 3PTQA 2XIBA 1ONEA 4PTVA 3AC0A 3KBMA 1KQZA 3HG2A 5FJRA 2XVGA 2OGJA 2J7DA 1R7OA 4A8LA 1Q3NA 2HV5A 1CGXA 3FAWA 4RPQA 3GIYA 3MA8A 3DFNA 2Z26A 4G1KA 5A6TC 4JQ4A 1I1WA 3C2EA 2PDFA 1TTQA 2QXWA 3ITVA 4NUWA 5M17A 4GO8A 4L80A 3ZJ6A 3B4YA 3HPFA 1V7YA 1WBJA 1EB3A 2WJDA 1EBHA 4IFKA 1E6PA 4TX8A 3FVDA 5LGZA 1K1DA 2VGGA 3LMYA 4MB5A 1K4GA 3S47A 1Z32X 2BGSA 4WEVX 1CIUA 4HA1A 4K39A 5HDRA 3STFA 2BTMA 4PB4A 3QH2A 1OCNA 4O4WA 2EPLX 3U3HA 1CXLA 1XH1A 4TQTA 2VM8A 4K1GA 2ZWZA 1R3QA 1RLDA 1VIZA 1ISXA 1E51A 4UNIA 1BKHA 1IYXA 1VEMA 3L5MA 2VCAA 4RW3A 4XBSA 1GCYA 3IRDA 4L4LA 2ZQ0A 2ZZ1A 4HPJA 2ON3A 1XRTA 3DC8A 2VFFA 3WLMA 3R1ZA 2ZXBA 2VURA 3SCOA 2J6VA 4IMFA 3NO5A 1XCFA 3QSRA 4A2SA 3CUHA 1IXQA 4QNEA 3AZRA 1L0PA 1NVMA 4UQDA 2OCZA 1BGAA 1W5QA 4PUEA 4H1ZA 4UFMA 4UNKA 4XAPA 3H70A 3MKVA 4JN6A 2PBGA 1KRMA 4XWUA 1V6XA 4HSHA 4HTYA 3IAPA 4UFIA 4Y9NA 2HQAA 3CL7A 3HFTA 4NZ1A 3CQ0A 1XIMA 3UY8A 3VGGA 1VD6A 3M46A 3VABA 4JS3A 3BH4A 3F4NA 3QF0A 2DUAA 4V27A 4GHRA 3W1PA 1E71M 3RGTA 2QPXA 3N9SA 4MLRA 3KX6A 4EAYA 1MEHA 1TV3A 1XX1A 1UD3A 2AAAA 4ZSUA 1OGSA 3O1NA 3NTYA 4DO5A 4UTMA 3W4RA 1VYPX 3TJXA 1ZLPA 4NHVA 3RILA 2QMKA 3WQFA 6ENLA 2Y63A 3OGSA 3T8QA 2A6LA 3UXKA 5GJPA 4LS0A 3KRZA 5BYWA 2QLYA 3I4KA 4ZOEA 4JR5A 3IARA 4CEXC 5K3VA 1G94A 1X7FA 4LUIA 2YA2A 4NP7A 5IDIA 5I09A 2A21A 3TMLA 1JFXA 3BXWA 4RDWA 3RM9A 3B97A 2VO5A 2AMGA 1XISA 2Z2UA 3M5ZA 4OE7A 4LUYA 1LCOA 1J11A 4AFYA 3W2LA 4GINA 3TFCA 2VC7A 1Y65A 1CYGA 4GQRA 3W1RA 4CVWA 3DU0A 3URBA 3AYVA 3H54A 5H91A 3T2PA 1KLZA 4AVNA 1E6NA 2VUNA 1TTJA 3W1UA 2ICSA 5LNUA 3REQB 3DI1A 1IWBA 4ICCX 3KZPA 3KWXA 2C3ZA 3PNZA 1GUVA 4C1NA 1F9CA 2NXHA 1ECEA 4MNMA 4AZBA 4HN4A 1PXGA 3LK6A 3O8AA 3LMZA 4XKYB 3CAVA 4M80A 2CBVA 4DUWA 4G7EB 3QV9A 3OA5A 1C90A 4LY4A 1NWSA 1IF2A 2G41A 3G8EA 3MUIA 3HURA 3LG3A 1R2SA 4R9XA 4V1YA 1O5XA 1SPQA 2H8XA 3CWHA 4CQBA 1LG2A 4GLEA 3D47A 4R88A 3SRDA 4FI4A 5A8PA 4E8DA 4DBWA 2EXOA 1F8IA 1LROA 2QJHA 1WYIA 2WWCA 5CZ0A 1U33A 3CAQA 1YHTA 1EJRC 3WLSA 3PSVA 2ODOA 9CGTA 2WMFA 1V0MA 1YKWA 1ZJHA 1GQIA 3BICA 1QPOA 3BANA 2MUCA 1EC9A 2PDPA 3AIQA 1US2A 2DU2A 3JS3A 3VKDA 2PWUA 5HINA 3PBUA 2NLIA 5B80A 4KWSA 2F7FA 4AW7A 3RAOA 1HL9A 5DANA 1P0KA 1XIEA 4MY9A 5T9BG 3GNPA 3LI0A 3R12A 3L4YA 4NX5A 3G6LA 1ML1A 4L9XA 1B57A 1VFLA 5D9MA 1I0BA 1OFPA 2DZUA 4UCFA 3LQGA 3E38A 1W9XA 1D3GA 3BMVA 4NZCA 3TC6A 5DBUA 1B3VA 2ABBA 2Q3RA 3SUWA 4R7WA 9RUBA 2R9RA 3LSBA 1JCTA 5I79A 4G7FA 1FWWA 1WKDA 2CLPA 1J4EA 3A4AA 1F6PA 1C8QA 2NUXA 3HO8A 3UJSA 4NG3A 1BLIA 5LIXX 1AD4A 5K2ZA 4H6RA 3MO4A 3H55A 3WQCA 2DSZA 4KCUA 2Y5EA 4HTBA 4EKJA 4HJWA 3SIZA 1EWDA 3OLGA 7TAAA 2Y8KA 1S2AA 3VNJA 1RHCA 2YGYA 2O0TA 3K1GA 3KWSA 2IQ0A 2XFRA 1HO1A 3HPXA 3MUXA 4YCOA 3GW3A 2OMAA 4EWND 3TA6A 1UUQA 2GOKA 1P7TA 1OC7A 2VRJA 2PWDA 1P48A 1FWNA 3PPGA 2WZEA 1RJRA 3W25A 5GPRA 5A69A 1YYAA 2IKHA 1EUNA 1W91A 4LF2A 2Z0IA 4IQEA 4PUMA 2V2CA 3BPWA 3K4WA 4LB3A 3WD3A 2G3FA 4U28A 3C52A 4B5NA 2Z7GA 1BVNP 5CGQA 1Q6EA 1IR1A 3VIPA 1E9LA 3AMKA 1IIGA 1IEVA 4ZFCA 1H7NA 1RZMA 4W5ZA 5FEZA 4KEVA 1A3XA 1ME8A 1WB0A 4PUUA 2RGMA 1EJSC 4AEFA 2AL2B 3GC4A 3OVGA 2CZVA 5CGTA 4UTFA 3U48A 3GKAA 3OIHA 1YLVA 3MJMA 3REQA 3FW6A 3AZSA 1DJNA 1PYFA 3OHMB 4KF1A 4H6QA 5MF5A 3TN6A 2Q8LA 4W4QA 1FBAA 2RDUA 4F0SA 1UP2A 1KKOA 4B2DA 1KQYA 1UIPA 3VOGA 3EWYA 1OFBA 3GVRA 1EWEA 1KRCC 1DQUA 2HE5A 3M4HA 4XTDA 3HFYA 3R6IA 2XINA 4UR9A 5J8LA 4UTTA 6XIMA 3PFRA 4WGXA 4N42A 4J3SA 3AMDA 4FXJA 1H09A 3NNTA 4MAZA 3WUBA 4HA3A 1A5CA 3VILA 2YA0A 1E1FA 2R91A 2J7FA 1R9XA 1X97A 3OB8A 1KGWA 4K38A 3VFLA 3M6DA 2XIJA 1WXZA 3GFYA 3IVTA 2C71A 4F40A 1D7FA 1RA0A 1U1JA 3NXFA 1AZ2A 3ANUA 1KXHA 3G1DA 2A5HA 1CEOA 1P0DA 4CN1A 2QDGA 2RDTA 2XGIA 5A8MA 5FACA 3LGGA 3N2BA 1QO5A 3SCTA 3U2ZA 4AH7A 3W76A 2BBFA 3FAXA 3NA8A 2QCHA 2WWDA 4RNFA 3DESA 2G96A 5A94A 2G4JA 4DAFA 3C0QA 2Y6ZA 1PJ9A 2PLCA 4U4MA 1UWAA 1E4NA 4RV3A 4ERIA 1IT8A 1AODA 3CV7A 1GWJA 4R7OA 1GPWA 1TO3A 2XN1A 1JCYA 3G1XA 4C6FA 3S2CA 5D4YA 3UG4A 3KOXA 2VYOA 1WA3A 6CGTA 2BODX 7ODCA 4KGLA 2VEKA 1OZQA 4XISA 3BJFA 3BG9A 1DJZA 5DQPA 3EXTA 1FWTA 4DUOA 2DDXA 1QNSA 1A5BA 4MYXA 3LU2A 3QHNA 4GY0A 1V3KA 1IR2A 3M6YA 4Q7IA 1HX0A 4MWAC 3LM7A 3EWZA 4D6HA 1EJ7L 1H1YA 3ZT6A 5KINA 4FX8A 4DF1A 1UZ4A 1W8SA 2LLEA 4XZHA 4Z2GA 3TYDA 2NQZA 2NX9A 5D30A 1JDCA 4ML4A 4C6NA 1QATA 1DJXA 4PMNA 3HBLA 1A5AA 4JCMA 1JAEA 4N4PA 3AIVA 2ZZ4A 3LHVA 3THAA 1V5XA 1AG1O 3GRIA 4Z1YA 2AQWA 3W2MA 3N4AA 1SZNA 5IFPA 1RK5A 4LH8A 5HULA 4GIEA 4YTUA 4JYDA 1P5BA 3MP5A 4PBEA 1O66A 2PU0A 3QQWA 4DX3A 2XVPA 3PVFA 1OT1A 4NSBA 4W86A 3IJ9A 4ICMA 4ZOCA 4ACZA 3UXDA 4KFNA 1R3VA 1UR0A 1Z42A 3F4WA 4ZB0A 2ZYFA 2ZX9A 1JJKA 1OF6A 6A3HA 3NVDA 4ZOBA 1VH7A 4RPPA 2VNCA 4JHMA 3E2VA 1ICQA 2A7NA 3II1A 3QTPA 1O68A 1E6QM 3LTYA 3VXGA 1I75A 4LUTB 1YTDA 4QHRA 3W7HA 4PSRA 3VE9A 3GDLA 3TTOA 1KWGA 2Q6ZA 2ZRVA 1C7TA 3KDOA 1MW2A 3W24A 4NY2A 2JF7A 2CKSA 3WFAA 1QNQA 1SMAA 2V5JA 3GK0A 4KEUA 5D8ZA 4J1OA 5HMEA 2DW7A 4XTIA 5A8NA 5A6SA 1MRQA 1UWQA 1MUMA 1CLKA 4KBXA 5KITA 3OVRA 4ORIA 1YTKA 4JKMA 4V15A 2G3MA 2E8ZA 1FWSA 3W70A 4E6MA 5EFFA 1CDGA 2X1SA 1FKWA 4HGXA 1EDQA 5GNYA 4WUIA 1MNZA 4I5XA 3Q94A 2FH6A 2QKFA 5KZEA 3KBVA 4JTAA 3S0CA 3D0CA 1QFEA 1HFBA 5DT7A 1TREA 2NX3A 1OVDA 1WAWA 1MO0A 4R5EA 4YTQA 1XGEA 4C90A 1OADA 3TONA 3C61A 1B90A 2CEQA 3S1UA 4XZ9A 1RD6A 4DUVA 5C54A 1XSKA 5REQA 1FHUA 4Q33A 3GNXA 1LL7A 3N15A 3LHZA 3S1GA 1XG4A 3QZEA 4BK9A 4S3JA 1Q85A 2ZXAA 2OSWA 3B03A 2V3FA 3LCIA 3EBVA 4US6A 4RJEA 1GOOA 5CPNA 3FGCB 5DMYA 3GTXA 3LRLA 2HEJA 1FP8A 2IXUA 3W7QA 3PS7A 4GUFA 2REQB 1NDVA 1W1ZA 4UMBA 3V18A 4K37A 2CIPA 1PZ2A 3DG6A 1XH0A 4RNHA 3EB3A 3TN4A 2Y5SA 2PZNA 5JBFA 3EGJA 1XPYA 1OT2A 1H50A 4IIGA 1G0CA 2OB3A 4GY7A 1X8CA 4QE5A 4C5ZA 3VNDA 2ACQA 5HWNA 4LBRA 2ONEA 1TWIA 3IIOA 2R94A 4OZOA 2GVEA 2YKKA 3TYEA 4GH3A 3DBNA 4XZWA 3ATYA 4Z0JA 2DIEA 3MY9A 3P7YA 1E73M 3H2NA 2DVUA 1FWIC 4N0RA 3WK1A 1C3FA 4GJJA 4ALDA 4H19A 1K9DA 3HGSA 3HMCA 3W02A 3PZGA 1R3YA 2CPUA 3W7RA 2PTDA 3N6JA 3AXXA 4JY9A 3GSMA 1LT8A 2EO7A 4Y9MA 1XBYA 1QT1A 2A2IA 3ZQ9A 1OGGA 4OV9A 1U5JA 3B0PA 5D09A 4GMEA 1EJTC 2QVNA 1EQPA 1XI3A 1D9EA 1UMYA 2HXUA 2VQUA 4W89A 3ZT7A 2QCNA 1DEDA 5AHEA 1F4HA 3SCVA 2VDHA 4C6KA 1QPKA 3URNA 3PG8A 3UYCA 3GNOA 1LBLA 1SSGA 5FAJA 4WY0A 3PZIA 4AZGA 1AQHA 3TTEA 3CM4A 1SZEA 3SN4A 2VVSA 1NDZA 1RP8A 7REQB 2CXGA 2QPSA 3E1F1 4JFWA 3ITTA 2PA6A 2AGKA 3M43A 3HB9A 3S2NA 3WD0A 4MFDA 1E6XM 1HJUA 2DUXA 3IJDA 1EPVA 4AC7C 4NNCA 5LYRA 3GNNA 3UWYA 2WHLA 2FDSA 3VINA 4DQWA 4UTWA 3GNRA 1VR6A 1ZUAX 1VCVA 1TCMA 3UJRA 4HMDA 2BLEA 3MI2A 1B3XA 2XHYA 1PCKA 2HE8A 1P7TB 3SEPA 2FZMA 1X1ZA 1XJBA 1JUEA 2CESA 2Y7EA 3NDYA 2WMHA 4GBDA 4CN6A 1M7JA 4BHYA 1UKOA 4P7LA 1M7PA 2ZZ5A 3W71A 4ASTA 3ARRA 1NAL1 3NQAA 4N9DA 2RDXA 3S3GA 4AIOA 1DJYA 4GFSA 1I45A 2E6FA 5HNRA 5G1MA 3UZWA 3GH5A 3G1FA 1H7WA 3G24A 2GUUA 1X1OA 3P5ZA 3L0KA 3IS4A 1AQ0A 3T44A 3UR8A 5DXYA 4RKAA 4FA3A 5CJ5A 2ANUA 3CZKA 1ZSXA 2ACUA 3T81A 3EDDA 4MF4A 1UC5A 4AXKA 2J8FA 4RXFA 4RV8A 5ECVA 4BJHA 3MUY1 4K8HA 1K8YA 3WLIA 4LRTA 5FJUA 3SJNA 2Y7DA 4FNTA 4QS5A 2X7WA 3QN3A 2VZSA 4EPKA 1NQ6A 1KO0A 5F4WA 1LF1A 2PTWA 5A2CA 1QK0A 1EBGA 2A6NA 4PMZA 4L6DA 3OHIA 1IT7A 4MNJA 1MUCA 4YHEA 4WHBA 3DHPA 2QDDA 3IWPA 5LA2A 3AZTA 1UOKA 2Y2WA 3NQEA 3OBEA 3P61A 4HA0A 4MSSA 1A5LC 2BOGX 2WMIA 3MC5A 3PUOA 2WXDM 1MVYA 5C7HA 2GDVA 2X30A 4JBRA 1LUCB 4MPKA 4NX0A 3O6AA 4LXFA 1EF2A 3QPZA 2J7BA 2E6AA 1IQ8A 4XO6A 1ADOA 2G4FA 5CLTA 3Q65A 4DO4A 5D9PA 1S1PA 2YOCA 2HPIA 2XWDA 4PR4A 5EMUA 1X6LA 2JK2A 1VB9A 1LL4A 1BGGA 1XLGA 1JPKA 1V02E 4G5DA 1BTCA 4UFLA 3B0VC 1FRBA 1CGYA 2G3IA 4JTIA 2Z1BA 1NARA 4E8GA 3LSCA 1EYWA 4F8XA 2GDQA 4ZCWA 2E9BA 2FTPA 4I6KA 1QPRA 2PLKA 3CB8A 3NEHA 4Q8NA 3EX6A 2ACSA 5E70A 3TOYA 4PTWA 3WK3A 1JI1A 1WKEA 1ZY9A 3VGFA 3W73A 1PKYA 3NVTA 3W2UA 4W84A 1A5KC 1QW7A 2PRMA 1XBVA 1KM0A 5BROA 1EIBA 4LAUA 4ES4A 1SSDA 2GL5A 3N17A 1OJXA 3ZR5A 2ZX6A