1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
1DXIA 3AAMA 1OADA 4GQBA 4Q7IA 3M0LA 2G0WA 4X63A 2XIMA 5AVHA 3KCLA 3KWSA 3M0YA 4OVXA 1DIEA 3IUIA 3KCJA 3VNMA 2QW5A 3BWWA 2QUMA 2XINA 6XIMA 1XYLA 1XISA 3KBSA 1XLEA 3DBNA 3LMZA 3U3HA 3ITVA 3FVMA 1QTWA 2QUNA 4X60A 4A8NA 3QZAA 4DUOA 3XIMA 3VYLA 3QC0A 3M0HA 1MUWA 3KBJA 1A0CA 4ZBCA 4ZB0A 5XIMA 4GJJA 9XIMA 4QE1A 4KW2A 5H6HA 2I57A 4HHLA 4A8LA 1XIBA 2NQ9A 1BXBA 2GUBA 4PGLA 1XLIA 3CQKA 5J8LA 5B7ZA 2G4JA 3KBMA 3IUDA 1XIIA 4YTRA 5EMKA 4HGXA 3U0HA 4ZB5A 1XLHA 1S5NA 2OU4A 1DE6A 3ITOA 3C0SA 5AVNA 1O1HA 1XIMA 2GVEA 3BZJA 3NGFA 3TVAA 3OBEA 2X7WA 1DIDA 3M0VA 3VNKA 5H1WA 8XIMA 3KCOA 4X61A 1XICA 2GYIA 5XINA 4ZB2A 4K3ZA 4QEEA 4YTSA 1XLLA 2ZDSA 1XLDA 1D8WA 1I60A 4YTQA 3BDKA 2HCVA 4DVOA 4EAYA 1XLBA 1XYCA 4XSLA 2XISA 3P6LA 1QT1A 6XIAA 3CQJA 1A0EA 3QXBA 3BZGA 3XINA 1A0DA 1XIGA 3QYSA 5TNVA 8XIAA 1XYAA 1XYMA 4GJIA 4E3VA 2HK0A 3AALA 1XINA 3CQHA 4HNOA 4J4KA 4PFHA 2ZVRA 3BANA 1XLGA 4QE5A 5EMLA 3TC3A 1I6NA 3XISA 3CWHA 4XISA 2X7VA 3ITLA 9XIAA 5C9ZA 4K1GA 5FA5A 4A8RA 4A8IA 3KBVA 1S5MA 3P14A 1XIHA 4XIMA 3KTCA 5EMMA 7XIMA 5I7GA 4US6A 3UVAA 1TZ9A 3DX5A 4G56A 3M0XA 4XSMA 2Q02A 2GLKA 2NQJA 1XIDA 4XKMA 3CNYA 3C0QA 4LNCA 3VNJA 1GW9A 3WQOA 4EACA 3UXIA 3ITTA 3AYTA 1XIJA 1XLFA 4YTTA 3UU0A 4QDWA 1YX1A 4W4QA 1MNZA 4GLEA 3N4AA 4QE4A 3UA3A 1BXCA 1XLJA 3L23A 1XLAA 5EMJA 3M0MA 4YTUA 2NQHA 4XIAA 3ITXA 3KBNA 3VNIA 2I56A 4QDPA 5B7YA 3AYVA 1K77A 1XLKA 3KBWA 1QUMA 5B80A 1XLCA 1XLMA 1XIFA 3ITYA 3IUHA 4HHMA 1XYBA 1DE5A 3GNXA 3CQIA 3VNLA 1CLKA 4QEHA 2HK1A 3UA4A 5XIAA 3C0LA 1XIEA 3JU2A 2J6VA 1XP3A 2QULA
chains in the Genus database with same CATH superfamily
5F4WA 2X1RA 2HE8A 1SMDA 4JIHA 1M3UA 5CZJA 1HQTA 3WZ0E 2A21A 1JPIA 2O4MA 2ZUTA 4EPKA 5LGXA 3UZXA 1T7LA 2BHZA 2WZTA 3ITGA 4RDZA 3GVRA 4MFEA 4KBXA 3QW4B 3FXYA 5FKYA 4MSSA 1OFRA 1AVAA 3SADA 1PZ0A 3AMKA 3GW0A 3JR2A 5CKSA 5G1TA 3V5OA 4CN4A 1I2OA 1DTNA 3RAOA 5A94A 4ZMGA 3QV9A 4N9DA 4UTIA 4CUCA 2VYOA 1G01A 1TPEA 1CPUA 3AJ7A 4R7WA 3W7PA 2PWFA 3PZQA 3V1PA 1QNSA 2XVLA 2HK0A 2PP3A 1GEQA 3PZGA 4H9TA 1LLZA 7XIMA 2V82A 3GDKA 3EPMA 4D6EA 4US6A 3QR0A 1HJUA 2OKTA 3M0ZA 3W1TA 2OJPA 4YL2A 1E56A 5REQB 4XZMX 4ZO6A 3W7CA 5PTDA 5GNXA 3RRAA 1F6KA 5I23A 3HGJA 4JTRA 3LCHA 3L23A 4HJWA 2QF7A 5TD4A 3T9PA 1EJVC 1RXOB 3DFTA 4F79A 4WKFA 3ITYA 1XRFA 5CC6A 2WCGA 5LYRA 2J6VA 2VELA 2ZX5A 1FH7A 3H54A 1CW2A 2WLZA 1PYFA 3KRUA 2RFGA 3UNDA 1L8PA 5FF7A 5AC7A 2HISA 5D4YA 4LUSB 4YYCA 1N82A 4KIEA 4F2BA 4HU8A 4DUOA 3TQVA 2H3DA 5AHNA 2C71A 3IV8A 1BXBA 1AH0A 1RLDA 2Y62A 1QCWA 1H7XA 1YPFA 5C8BB 1R0MA 3LZ3A 1RVGA 4P61A 4IPLA 1A5KC 4UFIA 4CCCA 3W9ZA 1VENA 2XDFA 3THUA 2OB3A 4O50A 3K1GA 1H63A 2RUSA 4F0SA 3L2MA 3UJ2A 2VDGA 3D46A 3TYAA 3N15A 3Q2DA 2I5IA 1I2QA 1W91A 3VIFA 3E0FA 1W5PA 9XIAA 3LEPA 1P6WA 1RJPA 4WGHA 3AWNA 2CEQA 1OC5A 1A5OC 3S5OA 1V0NA 5C2GA 1OX6A 4LOCA 5ABGA 1TREA 3WSUA 4GLEA 5FF3A 1YTDA 2ESCA 1SO4A 4I9JA 2WM0A 3TC6A 1F4HA 2HJPA 2ZUUA 3QGKC 4LB4A 3RPDA 1V3LA 3OA5A 3G8EA 3F4NA 4OHQA 3MBDA 3BG3A 3FOKA 4IX2A 2WMKA 1VPXA 4A35A 1ZU8A 2P88A 4IPJA 1ZY9A 1XUZA 3LCWA 1PEZA 4JY9A 2PWUA 4Q4MA 3KLLA 4J2MA 5CBBA 2G3MA 4C91A 4PMRA 4Y96A 4C1LA 3IS4A 4O28A 4GINA 1V6YA 2OELA 5F1VA 3N14A 2Y7GA 3T55A 2PCEA 3PB0A 5I09A 1IT7A 1ODZA 3NL6A 1DPMA 5CPQA 1ZS2A 2XN2A 3H2MA 2YBUA 4Q4OA 3JZUA 1TV5A 4K39A 4V27A 1XKYA 1EF2A 2WC7A 1F6PA 2QJJA 1EH9A 1G7UA 2OQYA 4I8DA 2JGQA 3DI1A 5BZAA 3NNTA 4NX0A 3PSVA 3VINA 2EQDA 2NQZA 1NAL1 3H26A 2QVHA 2NXHA 1Z41A 2QJIA 3N4EA 2JGYA 4OWGA 5A8PA 3M7SA 3K8LA 4PRRA 4J3SA 1UASA 4AF0B 5EMJA 4E6MA 2VFHA 2Z26A 4TX9A 2J7EA 4PFMA 4JQAA 1JXJA 3CQIA 4UR8A 3EDDA 3LM3A 2AAMA 3AIRA 2IW0A 1Z7AA 2TAAA 2VEMA 3AC0A 1HL2A 4U28A 1Q6EA 4O18A 3ZSSA 5ABHA 1IZCA 3WLKX 4QJ1A 3M16A 4JIQA 5BWAA 1OFPA 4BJHA 2QDDA 4O1CA 2OGYA 1JNEA 1PKNA 5LIWX 1JF5A 2J9XA 2XH0A 3PG9A 3G0SA 3NQAA 2PDHA 1B3XA 1JPKA 1WP6A 4QM1A 1H7NA 4BI5A 4HNUA 1BTMA 4K3ZA 4LRTA 4KIRA 1B30A 4RW3A 3NL2A 3TW7A 4F66A 1L6SA 5FSDC 1Q6RA 1ZCOA 4BS0A 3N3MA 3Q65A 4A4AA 1NY1A 2Z2BA 4QISA 2C15A 5EU9A 4GYJA 3MUXA 4N2YA 4F48A 3N17A 2PTDA 3C4UA 1ECEA 3VNJA 1ADSA 2G3FA 1XLFA 3GBEA 3F03K 3MCOA 4Y6GA 4XIAA 3KBNA 3C2EA 3PJWA 1RJRA 3E5BA 4AD1A 2BXVA 3KOFA 3WD0A 3TFXA 4OUIA 3USBA 1PDZA 1SO6A 3M0LA 3AUJA 5FJJA 3WL1A 4OV9A 3EMCA 3PZOA 2ALRA 2PDKA 2YCEA 4PUMA 1IEXA 2Z2UA 5FSEC 3KRZA 4WF7A 1E15A 1ZL1A 1JEZA 5KMYA 3QW3A 3OG2A 4AEEA 4KWUA 3HGRA 4BY3A 5G5IA 3CAVA 4L61A 3IAQA 1PSCA 3VGGA 3WK3A 4NYYA 5GNZA 3EOUA 1P7TA 3FYYA 4KEVA 7REQA 2XVKA 1A3XA 3HO8A 2X30A 5LNRA 3N18A 4XZWA 3MZNA 1LQAA 3V0SA 1QFEA 3ES7A 1NQKA 3JZEA 2B4GA 2YOCA 1RQEA 1EPXA 3TW6A 2XIQA 2Z1BA 3VZYA 1H1NA 3P60A 4NZFA 5D30A 3NYZA 3PPHA 3UCCA 4B92A 3IWPA 4H9UA 5E6ZA 5HUOA 3GTNA 2ZBTA 3EXRA 2YYUA 1WKDA 5LA1A 4XSMA 1TUXA 2QCFA 2NQJA 1QPOA 1AMYA 1EJRC 2V63A 4MY8A 1US3A 4G7EB 5HINA 2OX1A 5A2CA 1L6GA 3M0MA 3T4CA 4ILSA 3AZSA 2ACQA 1EHAA 3BV4A 3QHNA 3RX4A 5C6MA 3N2TA 2PTZA 1XKJA 4O12A 2ZYFA 7ENLA 5EMUA 2R24A 2A85A 4IQLA 2QULA 3NO3A 2QUTA 3FN9A 4GQBA 4DWSD 1HGYA 1R38A 4KEZA 5BMWA 1IGSA 4AD5A 1HVXA 4XKYB 4H6KA 3NDYA 1R3QA 4HA1A 3ZJKA 4B2DD 1BEUA 2Z7KA 1OWQA 4WY0A 3K4AA 5IFPA 2VEIA 3OGSA 4NU7A 1FWIC 3TOPA 4F2UA 3QR1A 4EF8A 3LGEA 4MYXA 5DMMA 4RXFA 3D0CA 5BRQA 1JI1A 3TK7A 3GHUA 4UFKA 3W7DA 3P0WA 4X9YA 4R88A 1J2BA 2WWDA 2ISSA 4M6UA 3OOQA 4QJ5B 5HNTA 4ZOCA 1X7FA 1K6WA 4NAEA 3RLUA 3SQLA 2NX3A 2Z25A 1NF7A 2D2GA 1DORA 2QUVA 4DYJA 4ICNA 3B8WA 1ZFJA 2ABAA 1E3XA 1XH2A 1VHCA 3QH2A 1UKOA 3R10A 4JIIX 4GY7A 3GUGA 4NY2A 1J01A 1S5MA 3NQ6A 3WNKA 4M6PA 3BCJA 3WQPA 1KR1A 1H3GA 1WZKA 1EEPA 5HULA 3WD3A 8TIMA 4Q7NA 3SUTA 5C9XA 1AK5A 1SFSA 3AMDA 4AIOA 3ITXA 2BP1A 1VEPA 2J25A 1GUVA 2IMRA 4Q4RA 2EBNA 2OEKA 4K8GA 1M9HA 4E2DA 3NZQA 3BMXA 4ZCWA 3A23A 1B9ZA 1QDSA 5T8GA 1OVDA 1GG1A 1W3LA 3PTDA 3F4VA 2X16A 1V6UA 4XZBA 4YCOA 3NOEA 4OGZA 2OR2A 1LUCA 2CLHA 3HQOA 2OZ3A 4CLMA 1ZBKA 5DXXA 3O8AA 4PTVA 4Z42C 3GC4A 4B3ZA 4DYEA 2X40A 4DO6A 3P8JA 2QLYA 4FX6M 2R1MA 2VL4A 3GU1A 4O16A 4UUIA 4J3WA 3VAVA 1PYMA 3VMOA 2WHMA 5CXPA 2QJHA 5HA7A 1TR9A 1UW9A 1UP0A 2FGLA 4KPLA 4LUTA 4H01A 4O11A 3REQA 4HN4A 2CXGA 2A3BA 1Q4WA 3MP5A 3VIMA 3M41A 1F2JA 1W5NA 4XWUA 1RA0A 1W3IA 4D6IA 3PPGA 2Z7GA 5AHMA 5GQBA 3A3WA 1I2RA 1R9ZA 2D3LA 5I3HA 1EL3A 4P7RA 5H91A 4JTTA 5DMYA 3LTSA 3T0BA 3GZ3A 2PP0A 4H9ZA 1LZOA 1V93A 2GJXB 4HHHA 5FJIA 1PVNA 1HKJA 1WNOA 3C0QA 1MEHA 1HN1A 1YEYA 2OEJA 2VEGA 3WLPA 4RZBA 3IIXA 4HPJA 4CU6A 3P93A 3I6TA 3ZT7A 4R27A 4O10A 3QV8A 3POHA 1XLCA 3O15A 4AX6A 2G4FA 4JQ2A 3TONA 2CYGA 3LERA 3HMJG 1OADA 3DN5A 1VD6A 2QAFA 3F2DA 3R1ZA 4FXRA 4LSBA 4OUEA 4YPJA 2SFPA 1U5HA 4K68A 4FPSA 5DRCA 3G1SA 4KW2A 4BQ5A 1XFCA 4DAFA 1J0JA 1AQMA 1F73A 1A50A 5J5RA 4MPQA 2DY3A 6TIMA 4DZHA 1Z44A 1IR2A 3BJSA 5EMKA 1H1ZA 1VBUA 1XLHA 3BZJA 1PV8A 2ZX8A 3DYPA 5D8WA 3FEQA 3NPXA 7TIMA 1QWKA 4E38A 1K9DA 1U1UA 1XCWA 3NM1A 3TYUA 3WK1A 2JF7A 3RJXA 2E40A 2AAAA 2DUZA 1IT8A 3MHGA 4IJBA 3IJLA 1L0PA 2EKGA 3LBOA 1TPVA 2WM1A 4HNOA 2G3JA 2WMGA 5C9ZA 3VK5A 2OYMA 1HZYA 2PEVA 1XIHA 4JHOA 4J5NA 5CLWA 5LSMA 1G4PA 2Q02A 3EKZA 2FTPA 3NDZA 3KFTA 3ZFHA 2PC8A 4KETA 2NX1A 4E2BA 2W67A 3DG6A 1JZ7A 2F6KA 1DWAM 2ATMA 3TYBA 3DXIA 2DGAA 1A5UA 4E4UA 3STFA 3C8FA 1EKOA 3HB9A 1OYCA 3PWGA 1OBAA 3A47A 3AQUA 4F3HA 4J7RA 3H55A 3CLWA 3QQ1A 5A6KA 2Y2WA 1REQB 3LMZA 3FVMA 3LBCA 1IT0A 9CGTA 4WIWA 2YDRA 3EWBX 4LQ1A 1CX9A 4MB1A 2GUUA 1FDYA 1MW1A 5E0FA 3ZR6A 2GJLA 4K7YA 2WNZA 1QPNA 3P8IA 1CXFA 3EKGA 3AHZA 2CETA 1XX1A 3BW3A 3GD6A 4NIRA 4RZ4A 3STGA 1ZP4A 1NJJA 3PTQA 1O5XA 3EX6A 3TN5A 3UWYA 1OYBA 3PWIA 3PBGA 1H5YA 5KZEA 2VFIA 3N2MA 4MNMA 4J4KA 3N04A 2GK1A 1Q6DA 1ENUA 1X6NA 2BWGA 3MU7A 4DUXA 1YMYA 4ZE5A 4LJ3A 4C6PA 1WXJA 4O53A 3QZEA 4UTJA 2E4TA 2PDWA 3TSMA 5IHRA 4O8RA 3WELA 1HGWA 4WVXA 2CLLA 1RD5A 4MZ1A 3GNRA 2I56A 3ARSA 3H2OA 4IIFA 3HOJA 1QW7A 2GWGA 3M0JA 3QC0A 2C8NA 1LJYA 2ZZ1A 4B5NA 3AAMA 1QPQA 3EA3A 2E7FA 2WPBA 4GKTA 2YCLA 4B5VA 3W7OA 4HCHA 5A2AA 3NDOA 1UG6A 4W93A 5GVJA 5D2YA 4ZQMA 1F3XA 4JDYA 4N42A 6ENLA 1Q8JA 1XSKA 1XGEA 5JQ9A 2HVNA 1V7YA 1ME9A 3LXCA 2OYKA 4Y8EA 1UP3A 2ZZ7A 3ZVIA 3KWXA 3RLGA 4J9JA 3STPA 4YTRA 1DWGM 3W26A 1B90A 1SO5A 3GR7A 2OQLA 1KRAC 2LLEA 3HM7A 3N4FA 4L6OA 1MNSA 5HMFA 3E2VA 3EDFA 1DVJA 4LBSA 4IGSA 4NJGA 2DEPA 1WOAA 2XPKA 3A5VA 4I5XA 4MUZA 3EWDA 3SY1A 2OSWA 4GRSA 4YWIA 1H60A 3CQHA 4Q7BA 4C5ZA 3WH6A 3UXLA 2W5FA 2WSQA 5HR7A 1T6MA 4GVIA 3APGA 1JIBA 4HNVA 1HIZA 3R13A 3FK4A 1OF6A 1H41A 4RW5A 1TG7A 3TJLA 1Y0EA 2ZFAA 3HFYA 4GQ0A 1TX0A 3P7YA 2IQDA 3B9AA 3UBPC 1RHCA 4QQ3A 3DC0A 4V1YA 3PBVA 2GVGA 4F0HA 5FESA 3A4AA 5DQPA 4IIGA 3OYZA 4HOXA 3VD9A 4LX4A 4C7GA 2J7DA 3FA3A 1VBGA 5K2ZA 5U7SA 4WSHA 1IZKA 1H2JA 1UUOA 3VIKA 3TXVA 1HL8A 1E5NA 1HXJA 1R3TA 1ZJAA 3IEBA 4X3ZA 4IMAA 4MWAD 4MYAA 1WKEA 3G0XA 3CYJA 2ZRVA 4QITA 3CO4A 1MZHA 3BC9A 1S5NA 4ICMA 3VA8A 3W1LA 3ITOA 4Q8PA 4Z1DA 1EGZA 1O1HA 3KL5A 1ZJBA 4GH3A 2VZSA 5H1WA 2OO0A 4LH8A 4Z17A 3AIQA 3W84A 3C5QA 1FWWA 1US0A 2A6LA 4OJYA 2Y8VA 1W17A 4FF7A 2WMJA 3URNA 4WCJA 3F7JA 1EGVA 1YLVA 1TVLA 1FXQA 4TO8A 3A24A 3E5PA 1NFGA 3UVIA 1T96A 4KWOA 3CL6A 1ME8A 4FX7A 4KH2A 3CUXA 4O54A 2EAWA 4C6EA 4JQ1A 5C9RA 3E1F1 1JDFA 1LROA 4H8HA 3QR3A 4FK9A 7PTDA 4IHCA 4QSHA 6PTDA 2WNNA 3H7VA 3QEZA 1KFJA 4HBKA 4JBRA 3NQFA 3T1GA 3M1ZA 4ZOEA 1V6XA 3CZJA 1TE1A 2W61A 1IGWA 1ZP3A 4LBUA 2F84A 1RZMA 1XLEA 4NZ4A 3PFMA 4GC4A 4WDTA 1GG0A 1Z32X 4Z0SA 4C65A 3PPCA 1E40A 3O7UA 3CK5A 1JUEA 4HPHA 3LY0A 2GFTA 5FAJA 3A3HA 1QJWA 1UCWA 1EP2A 1XFBA 2E6FA 4NVTA 3B4YA 4XK2A 3LHWA 1U1HA 2D2OA 2HNEA 3B05A 4F0RA 2O9RA 2XGIA 4FS9A 1VBHA 3S2LA 3M5YA 2WZHA 3SB0A 1J0ZA 1JYXA 3KZSA 3W25A 4FOJA 1A0EA 1FKWA 3F5KA 2Z1VA 4TOQA 4I6KA 3ABXA 3BANA 3T42A 1UD4A 4US5D 5FA5A 3W1RA 3VIPA 4JTFA 3WUGA 3GTIA 3NWRA 2D2HA 1DWFM 3FCPA 2W4XA 2V3GA 3VD7A 1SM9A 3E3HA 4O57A 3GC2A 4LYQA 2PD5A 5T26A 3VE9A 1EIXA 5A6SA 1ZAJA 5AYXA 2H9AA 2L5HA 1GPWA 3HTWA 1WKFA 2WPGA 2Y4SA 4U5KA 1GZJA 5DEZA 5M3WA 3E0VA 1B3ZA 4N4PA 2CKRA 4XZNX 4L9ZA 1OEPA 5DO8A 2CWXA 1TX2A 4JN7A 3U48A 4GUGA 2Z1WA 1CGTA 1GVYA 1SJDA 4MFDA 4QSFA 1GQKA 1GONA 4XO6A 4HU4A 3M5XA 5TAOA 4AX7A 3QSRA 2E25A 3ZT6A 2B31A 2QXWA 2GUBA 4XD4A 3H4WA 1NDZA 2IKIA 1VIWA 2HNHA 4DXKA 5GNYA 3ONCA 5CG0A 2J9YA 4NNCA 1JPMA 4WJ8A 3M0VA 1XUUA 4MTVA 1FH8A 4IF2A 5CPMA 3T40A 2FVMA 3GFYA 1TV4A 1JDEA 3FJ6A 3QKZA 3SY8A 2R1LA 1RH9A 1VFLA 3LHUA 2HPMA 3E0WA 2E6DA 1SZFA 3KVKA 3WF4A 2DSVA 1WYIA 5TQLA 6REQA 4HZ6A 4ML9A 4PEKA 4GUIA 4ZTXA 4ZSTA 3PG8A 1JZ4A 1KFCA 3QV7A 2ZQ0A 3A21A 2HQAA 3DECA 5F4SA 3UU0A 4CGTA 4EWND 1P0BA 2WO5A 4ADUA 4GGBA 4WOQA 4YVVA 2XN1A 1XYBA 2FHCA 3KUMA 2W27A 1CLXA 5K3VA 4JTCA 4DUWA 1P0NA 1B3OA 3GVGA 3VFCA 1R3WA 1EYWA 1FFRA 2G96A 3T09A 2UY5A 3QZAA 1E6RA 1FVPA 3W75A 1B2YA 3R0DA 4KEMA 4EAMA 5HDRA 2Y7FA 4QR6A 1Z9AA 4H2CA 3APTA 1NTHA 3LM7A 1XWYA 5E9AA 2GJNA 1CXHA 2EHHA 3TJXA 3OPSA 2AGKA 5JVLA 3MUCA 3FY1A 3S6OA 2NV2A 3F4DA 4NI8A 1MSSA 3RO6A 1PKMA 4ZQOA 1BXNA 4GCXA 4HZ7A 4PH6A 3RG6A 8XIAA 5K4ZA 4LBRA 2NX9A 4XB3A 1P7TB 3LPGA 1AMKA 2D0HA 7REQB 4DI9A 4F0MA 3N29A 1OCNA 1QI2A 4P7OA 3HGSA 4FNUA 4DWDA 2V67A 1GJPA 4AISA 3GB6A 1SYTA 4DUVA 3N6HA 5CJNA 2I1OA 3C3NA 3GAYA 4KWSA 1OK6A 3UP8A 1MWOA 4DI8A 1T41A 4M56A 2GGGA 5I2UA 4MADA 1NWSA 4NRSA 3T08A 1O66A 4X63A 4AAJA 1RP9A 1LP6A 1OYAA 2CNCA 3A9BA 1JULA 2V2CA 3BWWA 2QUMA 4H4IA 4MLRA 2WLYA 2AL2A 4AYGA 1FWBC 1RP8A 1FKXA 3W1XA 4LCQA 1UBPC 3ZSTA 1ZRQA 1UKSA 3BG9A 4AZ6A 3LSCA 5B7ZA 1Z48A 1QI3A 4LYKA 2B0MA 1UC5A 2Y5SA 1LYXA 4HNNA 3VDCA 4JNZA 1DE6A 2XVPA 3L67A 4DJFD 3EX3A 1DIDA 3M7WA 3WQ8A 4CNUA 2D22A 2QUUA 4GI9A 4K37A 5C2CA 4WY0B 2BY3A 4BEUA 3Q67A 1E1EA 3T07A 4P2VA 4UR9A 4YYFA 2A3LA 3VIJA 5C70A 1SFTA 3KDNA 3BG5A 2ZZ5A 1RY8A 3P84A 2PRHA 1W6TA 4PFHA 3PC0A 1V5XA 5AYYA 1EGMA 2X7VA 3G3DA 1NELA 4A8IA 2YXXA 3NTYA 1IIHA 2ASHA 2ATSA 1KCZA 4NAEB 3AIUA 3E96A 5FL1A 4AYSA 5G1YA 4KFPA 5MF5A 1ISZA 1UA7A 2VI0A 4A2RA 2NXGA 4HVXA 4QDPA 1F05A 3AISA 3KBWA 4URIA 3GH4A 3W7QA 2P76A 2WKGA 4LCSA 1BSLA 4OBSA 3W72A 3LUTA 3LV6A 1KLZA 3O63A 2XHYA 1ISXA 5LNUA 3K2GA 4WZHA 1KCXA 5ABFA 3CH0A 1JYVA 3W70A 3RO8A 3GX9A 2J24A 3IK4A 1H7RA 4HPGA 2BVWA 3WLRA 4ZBCA 1UZHA 3KBJA 2Q8XA 2I57A 3L7RA 3OLGA 1NF0A 1EBGA 3RYSA 3FHAA 1LLWA 1R6WA 2PU0A 5HNNA 1IQ8A 1XYZA 2ISFA 4M7SA 1B0IA 2VZVA 3OBEA 1EA9C 4FX8A 2DP3A 1QI0A 2JEPA 1XBVA 3T0CA 3WJZA 4MM1A 3SCTA 1LUCB 3R5EA 3QXBA 3XINA 2ZE3A 4ECLA 5I03A 3TYEA 1XYMA 3R7MA 2PD9A 3KRBA 2BS9A 1Y8BA 2C0HA 4PMZA 2DVUA 3EXSA 1W31A 3GXTA 3PAJA 2YPIA 1OC7A 5FIPA 3TUUA 5FJRA 5DY3A 4XX6A 1NP0A 4NASA 4IPNB 4LUTB 3LD5A 3REQB 1HG3A 1VRXA 2VFDA 3KM8A 1PWLA 2REQA 3KZPA 1Q6OA 3VXGA 3MYOA 4IFRA 1JZ5A 1VFTA 3CJPA 4R85A 2HS8A 2HVMA 4JN6A 1Z69A 4UMAA 5A6MA 5KITA 4BI7A 3H70A 5E6YA 1HJXA 2P5NA 1QR7A 4IH3A 2PDIA 3TNBA 4M82A 4QHRA 3GFXA 1VJZA 4YN5A 3KDOA 3V5FA 4D6DA 4Z2HA 4U4MA 1DJQA 3VUSA 1V8EA 3SURA 2OT0A 3VOGA 1OFBA 2PZNA 1PTGA 4DX3A 4B16A 1KM4A 3HQPA 1Q6CA 3LTYA 2NQ5A 4LAMA 4Y7EA 1XIMA 3GXNA 5AN7A 2WZEA 3KOWA 3TTQA 1DYSA 2VD9A 3W74A 2WVVA 2FTYA 1Y5WA 3S1GA 3LS9A 4XO7A 3U2OA 3ZLGA 3LGDA 4BF5A 3QLDA 2J8GA 4JTLA 3XISA 3M44A 3GDTA 1Y5XA 2VRKA 4XZLX 3B8DA 4FNQA 3GXFA 3IPWA 1QXLA 4L4LA 1KNWA 1XPGA 3MJYA 2OWWA 3SUUA 1KFBA 8A3HA 1H62A 2GL5A 1H51A 4W7WA 4JICA 4QE4A 3GIPA 2BODX 3O1NA 3PS7A 3BSHA 2NVCA 5I3FA 1E71M 1HKWA 3W24A 2PWHA 2QHAA 2Z6IA 5EY5A 4N4QA 4AC1X 2XIIA 2XFYA 4FOKA 2IPWA 3LI0A 2G0WA 2JKAA 1MRAA 3K1DA 5HQMA 3W00A 5M17A 3EDEA 3T8LA 4S3JA 3UPWA 4XUYA 2GQ9A 1V3HA 3TROA 4O0KA 3ABOA 2Z6JA 3C61A 1BD0A 1HTIA 5BOEA 4JTDA 3N2XA 1UWUA 3ME3A 4PL2A 2YW3A 2G4JA 4X2RA 1J4EA 3MANA 5AZ0A 2A2IA 4LXFA 2BB0A 4I9TA 1CECA 3TQ0A 1JYWA 2W3ZA 2YA2A 2ANUA 3FKKA 4UTWA 2ZRWA 3SN4A 4TVDA 5JIWA 3B03A 2A7NA 4PMQA 2Y63A 4G1NA 3FKRA 4A05A 3O06A 5D09A 4I5RA 4OT7A 4LY4A 3FA5A 1QPRA 4Z2IA 5F2GA 2EJ1A 4GCAA 3GM8A 1JAKA 3PP7A 1JZ2A 4XD6A 1HKVA 3U6WA 1TO3A 4GFSA 3T2QA 4OOUA 3EPNA 1L2UA 1XGDA 3VGDA 1FWJC 5AYBA 4JR5A 3KVMA 1UPMB 2XN0A 3JS3A 3M5ZA 3MMTA 4JTUA 5AHFA 4UNLA 4YTTA 2WW5A 2WQPA 4RLIA 3QOMA 2J7CA 2GK1B 4OFCA 2X0SA 3N2OA 4HMCA 2NXIA 3W1PA 3CAKA 4Q4SA 3LRMA 5L9FA 1R87A 2GDUA 5E70A 4RPPA 3T7VA 5HWMA 1J2WA 3NSXA 4JTGA 2WHJA 3AU6A 4QLLA 3KOZA 3LA4A 1OQFA 3W27A 2V2HA 2CCRA 1SFLA 1JGIA 3HPXA 3T0DA 4WSKA 4JIEA 1C7TA 5GJPA 3OZOA 4K8EA 5C0QA 2YCLB 1UJQA 2B7PA 4ORMA 2VQUA 1OG0A 3S0CA 4YIWA 1SW0A 3LHYA 4ZOBA 3WQ4A 1T0OA 2ZA3A 3AWOA 4KMQA 4DXVA 4WSJA 1TTJA 3VGBA 1VFUA 1IEVA 3N1AA 4LYRA 3EGJA 4E3VA 3VIHA 3S6TA 3PN8A 4Q4PA 1KRCC 3PAOA 1PHQA 1WZAA 2Z27A 2CFFA 5JBDA 2V3FA 1CYGA 5JBFA 2QCEA 2Q01A 3SCSA 2ZZ2A 1H4PA 5A8MA 3PFRA 2FB2A 2A1YA 3RK8A 1TB3A 3IVUA 1AW5A 1VLWA 4L5ZA 4GVGA 5FJTA 1C93A 5FD0A 2X0YA 3OBAA 1TJ0A 2QMKA 3L66A 1ZJIA 3RMEA 3UWEA 4Y9PA 3N9SA 3S46A 3LV5A 2IS7A 2ZKMX 1ZGDA 1P0DA 3W6MA 2XU2A 3C3UA 4O15A 4M6VA 3TR9A 4LVDA 3W73A 3BJTA 4PTMA 3P61A 3L4TA 3AROA 1LWHA 2I9UA 1YIXA 1X1NA 1V03A 1B4KA 3TU9A 3AYSA 4UNIA 4ZXOA 1TV3A 3WUFA 2FZNA 1G4TA 2P0IA 3U0HA 4Z2GA 2DUAA 4GA8A 1Q2RA 1TZZA 4TV5A 4ROPA 1HF6A 3BVJA 1MVYA 3G1XA 1ESWA 2BVTA 1QHOA 3WH5A 2O56A 5AYIA 4FSAA 1GYMA 3U2EA 1L9WA 3QYSA 4GJIA 3ZJ7A 1E51A 4D2JA 3IGXA 3MKKA 2EPHA 1I6NA 2OFJA 4M1RA 1WAUA 3VO0A 4JIRA 1GOKA 3AS3A 1PKLA 1PIFA 3GDRA 4DO4A 3BLIA 4C6DA 3RCYA 3O2LA 1EO5A 2ZE0A 1SFJA 2QIIA 4AMCA 5KZMA 1SR9A 1GQIA 1VFSA 3N4AA 2VOTA 2FJKA 3DYMA 3N13A 1BWKA 1EP1A 1UR0A 2YYTA 1P0EA 5G2HA 4GYPA 3TE9A 4FR6A 3AI0A 1S2VA 1ZUAX 3GNXA 3ZR5A 2YSWA 4UQDA 3KHDA 3AXIA 1EX5A 2NSXA 3II1A 4ASTA 4IX0A 2D0FA 4AZCA 1Q6GA 2P53A 5D2TA 2YL5A 2OZ8A 3ABZA 3A4JA 4H7VA 4D6FA 2XTKA 1N55A 1PX8A 1GHRA 2BASA 4UXDA 4RE0A 4O8AA 2E28A 4JEJA 1XIIA 4BR1A 1PX3A 4HPXA 3WUEA 4HK5A 2XGBA 1ZBCA 2ACRA 1SUXA 1OK4A 1XICA 3NQDA 5D03A 1VLIA 2VMFA 2E8ZA 2PWGA 2R14A 3G77A 1J18A 1WDDA 1PX4A 5HJXA 1E72M 5DBTA 1OSEA 3W7MA 2A3EA 5LHEA 5DT7A 1PIIA 4J28A 4DBWA 1RSCA 4IP5A 4JHZA 3DCPA 4CQCA 1FWGC 3V36A 4P7NA 4HSOA 3DENA 3WDPP 1OC6A 1V6VA 3WNOA 2DZVA 4R34A 1DBTA 4OU1A 3C86A 4UTFA 3BPWA 3HMCA 2B7NA 3VI2A 1PZ2A 4P8WA 5LXEA 3C2RA 3RN6A 1XCFA 3CMJA 1C90A 3NZGA 4AUBA 3SCUA 4UQ9A 4NG3A 4Y90A 2PDNA 1QOXA 2DIKA 3EX2A 2CIPA 2CLIA 2GGHA 4F2TA 1GJUA 1RK5A 3B9OA 1U5JA 1YE6A 4C6KA 4BHYA 2H9AB 3GXPA 2AQWA 1YDNA 3ZYZA 4MAZA 1XSIA 3EYPA 2I16A 4IISA 1KFKA 3UGVA 4EIVA 1R30A 2JK2A 1AQHA 1OHLA 1LL6A 1RAKA 3DFOA 1VJIA 4CD7A 2VX5A 1I60A 2W79A 3MDWA 3TSBA 1Z42A 3SFKA 1XYCA 1ADOA 3BSGA 3LCFA 1JUKA 4GI4A 3HPZA 1TJPA 3WNNA 4PEEA 2YL8A 4TX6A 4ZO9A 2ZUMA 1YHTA 3CAQA 3UZ5A 5M2FX 1FUYA 1J9YA 4UNKA 4W88A 1H0IA 3GWQA 2H90A 1Z6KA 2C7FA 2D69A 3IAPA 4JKLA 3WBYA 2J8FA 4XBSA 2ZTKA 1P1MA 3GW3A 4KFOA 1TPC1 4B4FA 1HKIA 1J79A 1OY0A 2PF0A 4KRTA 3VCNA 3R2GA 3LRKA 1W3HA 2J7HA 3T05A 4FIQA 3ZQ9A 1XSJA 1BXCA 3FS2A 4Q8WA 4NHVA 3ARRA 1TJRA 2GWNA 6REQB 3GSMA 1E6XM 2V38A 3VNLA 1JPHA 2ZICA 1HT6A 2VRQA 5A8OA 4JD4A 3VIIA 2FKPA 4H1ZA 3G8RA 3OJGA 1XRVA 1D7FA 4M29A 4RR4A 3SCQA 1T99A 4RXGA 2WSYA 2OVLA 1SGJA 3G1AA 4I90A 4PGLA 1I9CB 2VX4A 1YDYA 4O1DA 2BFGA 2DZTA 4YVXA 5IDIA 4B5XA 4M7TA 5D9OA 1S2CA 3BLOA 1JGMA 4PYSA 2XUCA 3TSDA 1R85A 1XLLA 5FJUA 4ZO8A 4PL1A 1CLVA 3QY7A 1VEOA 4GX9A 3ARZA 1H50A 3E0IA 5AY7A 2DH3A 4DJEA 4WXYA 3U2CA 2INEA 2ODOA 1XG3A 5C7VA 3DAQA 1UJPA 4GHRA 2VDHA 2QKFA 3CWHA 3URAA 1EFZA 1I1WA 3UPMA 2XWEA 2V5DA 1GKQA 5D32A 3RPTA 1UWIA 1VYRA 2JKPA 3L12A 2HE5A 4HYVA 1DJYA 3D3AA 5E1QA 3OVRA 4RKAA 4LVFA 3G2GA 3LMYA 1E6SM 5AC6A 3BLLA 1G4SA 4N9CA 4AH7A 3RUBL 3LB0A 3W1QA 4F8XA 5CLTA 1WBHA 3NQ8A 2QT3A 4GIAA 1R3YA 3UG8A 3E6EA 3MI3A 3CUIA 3UA4A 2NSOA 5G2IA 3LLFA 4B5UA 1XYFA 1MDRA 1UD8A 4LANA 3O16A 4QNWA 2EG7A 2V5JA 3KWSA 4KFNA 1OCQA 4O4WA 5BXTA 1NH6A 3VNMA 1XF0A 2QW5A 5LA0A 1W32A 2BXZA 2OMAA 3UYCA 1G1YA 2PRMA 3AFBA 1GVQA 2WMIA 3W85A 3V1HA 1W0MA 4IMEA 3HBLA 1K6AA 3IUDA 2F9RA 5FI8A 4R7OA 5CSUA 3W1NA 4Z2KA 1G69A 3B0PA 4RK8A 3CWOX 1E0UA 2BHUA 2GVEA 3GYEA 1ITQA 4HD5A 3I3BA 1V3JA 4JFSA 4QX4A 3CUJA 5XINA 4X9SA 3W7NA 2AL2B 3CAWA 1W1ZA 3S2MA 1E4LA 1AQ0A 2Z4GA 4MG4A 1GPFA 4YS1A 2DZPA 2V81A 4RNJA 1F76A 1Q7ZA 2OQHA 2OGJA 3GR8A 3MI6A 4CVWA 5KZDA 1J11A 3VVGA 2A5HA 3WUBA 3DZ1A 3CHEA 2O9TA 2X1IA 1W9DM 2C3ZA 1CXKA 3C52A 1CEOA 2V6AA 5DN1A 4EOUA 3QOKA 1TIMA 4QDWA 3TEVA 1UWQA 1YDVA 2HRWA 5I0DA 4JYDA 4G2DA 2CBJA 3GG0A 4JHMA 4ATDA 4MKVA 5E0CA 3ATYA 2BXYA 3WQVA 1OINA 1DIKA 2FVLA 3U4AA 1E6NA 3MTWA 2I5QA 4O0QA 3NAVA 2WK2A 2YDSA 2POTA 3PJTA 4JTJA 1RD6A 2RAGA 1IWBA 3SSZA 1K70A 3HGOA 5EMYA 4NZ5A 2H8ZA 3W86A 1H1YA 3P0XA 2UY4A 4XV0A 4LAUA 3D47A 1UWAA 3URBA 1EQCA 4U3CA 3BJFA 3I7QA 4UTWC 4DNHA 1BQGA 3BOFA 4MWAE 5ABFB 1HJQA 1MUMA 1AQFA 1S5VA 1VBRA 3T81A 1OABA 1U83A 2WZIA 2BHYA 2Z29A 3WBXA 1CGYA 3QV6A 2B7OA 5JH2A 2DZSA 3U8GA 5D2XA 3P62A 4UTLA 3WCZA 1XDJA 1NOWA 2ZVRA 2PDQA 3DHDA 6TAAA 4GNKB 3ZLHA 4PSRA 1EHNA 1W5QA 3L2LA 4HK6A 5JUVA 4QRNA 4E2OA 3MPGA 3S47A 4K2SA 5FAGA 3UWWA 1SZEA 3IJ6A 2DT1A 1L8NA 2OWCA 4GNVA 4IJRA 3NIYA 4I3GA 5FEWA 4LF1A 3AYVA 3K8KA 4DO5A 3PZVA 1KFLA 1ZBVA 1PBGA 1I45A 3G6LA 3GRIA 1AL8A 3AIEA 4K38A 1KCKA 5BRBA 3LOTA 3STCA 3WG6A 2XINA 3PZNA 3ZWTA 1S5TA 3QFWA 2REQB 3E38A 3VKJA 1YNQA 4S1FA 2X1UA 5A8NA 1XIBA 5A8GA 3HG4A 3AIVA 1FWCC 1EOMA 2O4QA 4MHBA 4AVNA 4JCLA 4PMUA 4A29A 2A79A 2PDMA 1ISYA 2GSJA 3A64A 1JFHA 2QGHA 3MC5A 1G7VA 3RFAA 4M0XA 2YX0A 1U33A 2ZUSA 3GIQA 4Q4KA 3DG3A 3GY1A 5FF2A 3BK0A 4WX2A 2XGZA 1R9YA 1BVZA 1W54A 2CW6A 2BVDA 5GPRA 3AIBA 4E4FA 2X1SA 1QNPA 3K13A 4Z08A 3WQ6A 4BK9A 2WVVB 4TIMA 1O6IA 3KOXA 4RZ6A 1I0BA 2FZMA 3UQNA 4QCEA 4GBUA 2VNCA 1VKFA 1DWJM 3H6OA 4GBDA 4ZZ9A 3T2OA 3JU2A 1Q2SA 1W5MA 4PSPA 1IR1A 5BXRA 3STEA 2CU0A 2Y0FA 1KWGA 3W6LA 2F8QA 2CLKA 2F6UA 2PC4A 4FNRA 3NQVA 4KWWA 2E5BA 4FZIA 4AIUA 3IJ9A 3PBMA 4M8UA 4BF9A 3SUWA 3UNTA 4Z2JA 4ZQPA 3DFYA 2PLKA 4ZEPA 1O5QA 2FIQA 2FH6A 1BGAA 3W22A 3R8HA 4LEQA 2ZCGA 4ZE4A 2PZ0A 3DHUA 5A69A 2I14A 2HV5A 3CZLA 2VTFA 2E8YA 3CXOA 1BYBA 1EWEA 2VFEA 2YJQA 1DIOA 1C3FA 1KFWA 2BOFX 2G5WA 1AODA 1VGAA 5TNVA 4IXXA 2G50A 2EO7A 4IQJA 2NVAA 3L5AA 5A6JA 4PTDA 4HZMA 4EXBA 4AEFA 2VZOA 4AHOA 4GISA 3RGTA 2XFWA 2VGGA 3FJNA 3WD4A 2VC7A 3WNMA 3UXKA 3RLHA 5D38A 3VNZA 1AD4A 2NWRA 4XAZA 4DJDC 2GDVA 4GYPC 4OIFA 4C1NA 4O14A 2NQLA 3I4EA 1KKRA 5HBFA 1MQQA 1LORA 1OIMA 3T2PA 4DIAA 4Z1CA 3ARYA 1VFFA 3CV7A 1PE1A 3NXFA 1V3MA 4YWSA 4FLOA 3PB2A 1QRQA 4IOTA 2B7QA 1AJZA 2I17A 1C91A 3AYRA 1R9XA 3KVLA 3N9KA 4GKLA 3GS6A 1LWIA 4N9EA 5JMUA 2PDJA 1FDJA 1A5SA 3JVAA 3GTHA 3A13A 3VGFA 4ZTYA 2NV1A 4IT1A 2GOUA 2VEPA 4YNGA 3B04A 1QAPA 2HXUA 3W07A 3OEXA 1DEDA 3MY9A 5L6UA 1KRMA 3NVTA 2VM8A 1UR8A 3H2EA 6XIAA 5I78A 2AMGA 4JTQA 4OKDA 3FSTA 2RDTA 2PDYA 4IUOA 4HQVA 3ZMRA 4BCEA 1KD0A 1NDVA 1XINA 4AVOA 5A1AA 5F2LA 3O9NA 3AU2A 2UV8G 3KEHA 1UR3M 3ANYA 2VHLA 3TAOA 2Z2AA 4JKMA 4PRWA 2D24A 2A3CA 4H9MA 1B1YA 2PDLA 3O3RA 3WQOA 4I5UA 2X0HA 1XLAA 4ACZB 4MVAA 4TR9A 1JUBA 2ICSA 2O9OA 4JPGA 3CMGA 1XIFA 2IQTA 4PB4A 3KE0A 2XFRA 2NW0A 3SEPA 1BAGA 2INZA 3WL0A 1JCTA 1SMAA 4EE9A 3WBEA 4Z0JA 1P6CA 3EWCA 2IKHA 1R3VA 4GJJA 1QNOA 2E6AA 4H6RA 4AZ5A 1E6QM 1XM3A 1NWRA 4GUJA 4EANA 1GOWA 3PUDA 2C6QA 5C54A 3NGFA 4HOZA 1UMYA 3MVTA 3BQ6A 2PTXA 1Q63A 3H24A 4DM2A 1XBZA 1RPKA 3U7VA 3K46A 4K8HA 1UB3A 4LY8A 4X22A 3V75A 2F7FA 2FPYA 2VVNA 1EO7A 3THDA 2VX7A 3IGHX 4UMCA 3WJXA 2FZBA 2HPIA 3L0GA 3NSMA 1VPYA 5ECVA 1J6PA 1SW3A 4RE3A 1OZQA 2IPGA 3VE7A 3QKEA 3W7JA 3QZ6A 4HSHA 4Y9MA 1POJA 1WXZA 4IWWA 5A6LA 3DYOA 4JNMA 4AZHA 2QS8A 1W3JA 3G1FA 1G4EA 3FX4A 4D6CA 2DH2A 3UXIA 4BQ4A 1P0KA 1V08A 4IZGA 4CKQA 4LWWA 3IJDA 2G95A 1VBJA 1HO1A 5K9XA 1OIFA 1XPYA 3S1VA 4ZL1A 3LCGA 4HCDA 5FEPA 4XZIA 1AH3A 1DXIA 4RNFA 3BTNA 2VR2A 3IRSA 3L4WA 4NUWA 1TPB1 2E9LA 2Q8ZA 3TYCA 8CGTA 1MW3A 4ZFCA 2XH2A 1SR0A 4GO8A 1FCBA 3I7RA 2QYGA 2D20A 1I75A 3OODA 2NT0A 2CESA 4O1AA 9XIMA 3W28A 1KKOA 2A3AA 4M51A 1X8FA 2FMNA 4PB5A 1NP2A 4W84A 3AHYA 5BW6A 3FIGA 3PNZA 4IL2A 3EOEA 4INFA 1MFVA 2OXNA 4DB7A 3HURA 1OCBA 3CUHA 4DN1A 4AZCB 4I8YA 3QHOA 4S3DA 2O7QA 4DJEC 2J7GA 5K9DA 5KTLA 1E73M 4JNYA 2WC3A 4PB3A 1FWTA 1LRNA 4KQNA 1EBHA 2QNEA 3Q4DA 3WDRA 1EWDA 4RDVA 1PZ1A 3A12A 4PUKA 4GZ7A 4KT2A 3NZPA 1TUFA 5CAKA 1UWRA 3W02A 3POCA 1EC9A 4BFAA 1C8XA 3JW7A 3WDQA 1WQ5A 4XVDA 2DQXA 4XKMA 3BMVA 3N3TA 3EEZA 5LKYA 1EEXA 4YMZA 3D5HA 1EB3A 4GGHA 4DF0A 4WOZA 1IEIA 3CL7A 1A3HA 2VO5A 4MNKA 4I6VA 1TRDA 3WENA 1JNDA 1YADA 2P1FA 4B3KA 2R8WA 1J12A 4DWSA 2PMQA 1W2PA 4LS1A 1B57A 4NILA 3GVWA 1N8IA 1BQCA 5EL1A 1DKWA 1BG4A 4C60A 2DFAA 4NKCA 1F07A 3U7BA 1OM0A 4A3HA 4KCWA 1QPKA 3JUGA 4DLFA 5A6BA 2PI6A 2C0AA 3RLVA 1LM1A 4PMDA 3B8UA 1TTIA 3SCWA 3OU8A 1P4CA 3AALA 4QQUA 5TBOA 1I8JA 3CU2A 5A8QA 3LTPA 4MB5A 4BA0A 2ZX9A 3CUGA 3A5FA 3NL5A 4GZJA 3GQYA 1TZ9A 5IOBA 3WQFA 1G9HA 4CNNA 5FL0A 4WRHA 1B3VA 2J66A 2FZDA 1KXHA 1TWDA 4A2SA 1T40A 2IXVA 5AHIA 3ELFA 2Y85A 2WSPA 1W9UA 2OYLA 3NR0A 4QJ3B 3TN4A 3R4IA 3RITA 3TTEA 3UF9A 4NZJA 3DFPA 4Q8TA 3BW2A 3P2VA 2QDHA 2E67A 4NF7A 1ZJHA 1PXGA 3PVFA 1A5MC 2VC6A 3O0FA 3WH9A 3AS1A 3TN3A 1PKYA 1M41A 3PM6A 3TNOA 3VZZA 2CBIA 2E09A 4LEFA 3UGRA 3AMGA 1US2A 3ARQA 4QE1A 1IWAA 4PCNA 1UA3A 4IMDA 2NUWA 1UPPA 2WV8A 3CPRA 6A3HA 3TLQA 4RPQA 3UW6A 2E0PA 3ES8A 2ISWA 2VFGA 3MCMA 4MY1A 1FRBA 1R7OA 4QGCA 4RCXA 3BLFA 2C13A 4M24A 3MDUA 3W23A 3BZGA 1R2SA 1EJTC 2QF8A 5CBJA 5HAOA 3TV8A 1TPH1 4Q8QA 5ENLA 1HKKA 3SBFA 3IIVA 1BYDA 1W8SA 3CB3A 4B5SA 1F4AA 2YBVA 4L80A 4PBFA 3H2FA 3MMWA 4BEQA 4C6IA 4ZGYA 3WLIA 2YDQA 3UZJA 5H8PA 3THAA 4NJIA 5HQLA 3LCXA 4HTYA 1XIJA 4B5WA 2TYSA 4O19A 4GXPA 1L6YA 4REQA 3NQ7A 5I3DA 3SFWA 3ARPA 1P1XA 1IEWA 1S3HA 1N8FA 1UOZA 2WB5A 3QJAA 1KRBC 1DQWA 5LXXA 4HHMA 3BXWA 2GJRA 1E9YB 1YXYA 1BPLB 4QEHA 3LGGA 1H11A 4FMVA 4CD6A 2CZDA 2RDWA 4DJDD 4MJ4A 1E70M 4HYRA 3EX1A 3A22A 2NUYA 3THQA 4BWLA 2VEFA 4DZ5A 4QDMA 1K7FA 5LNSA 3VCCA 3H12A 1RBAA 2OOFA 4KRZA 1XW8A 2P3EA 3BOXA 3IJ7A 3BV7A 3W81A 1EZ2A 1ALDA 4X61A 1UKTA 1UOKA 1ONEA 3E0LA 2Y24A 4GACA 3UWUA 4HIBA 4PMOA 1QOPA 3WEZA 2HZGA 4D8LA 1A80A 1HP5A 4E4PA 4O17A 4N6FA 2PA6A 2X2GA 3VIGA 1JL8A 1U1JA 1P43A 1CNVA 5DELA 1HNYA 2QCNA 2FB3A 3GH7A 3IVSA 2V68A 3GNPA 1GK8A 3UVAA 4H8NA 4XG1A 4HMEA 2EG8A 3QMSA 3VD4A 3WEMA 3GH5A 2D73A 1AA1B 2XSAA 3OVPA 3BLKA 1ZALA 4UTKA 5DCEA 3IGSA 4JCMA 3W2UA 3SI9A 3SECA 1ITCA 3CIWA 3P67A 2INFA 3PZMA 2V5CA 4TV6A 2EG6A 3H8AA 4OZOA 4B15A 1DJWA 2VXNA 4W89A 3E02A 3EPOA 1TMHA 4ERIA 4WY0F 2CZVA 4F40A 2ACSA 2RDUA 3CV1A 3WQWA 4J3UA 4A8LA 2I7GA 2VCCA 4PMYA 1DHPA 2WYSA 5MKGA 3OLIA 1BWVA 2E5DA 3QGVA 2F61A 4TVUA 1CTNA 3VKDA 3ATZA 1CENA 1K02A 3WMBA 2YGYA 1MRQA 2GYIA 2PE4A 1JDCA 5I02A 2OKOA 1BF6A 1K8YA 3CZKA 4UCGA 2BNJA 4B9YA 4EAYA 2FHBA 1UC4A 2V5LA 4E2VA 1TQJA 2TMDA 1XYAA 4FEZA 1UMLA 4FXSA 4O1EA 1AH4A 4GK8A 2DORA 1W37A 5LNVA 3GNNA 2QJGA 2YL6A 5C2XA 1TZ7A 2GUYA 3RCMA 1ZPTA 3ORWA 3M47A 3CNYA 2YB1A 4GYFA 3MUIA 1TVNA 1FCQA 2VWSA 1UUMA 1O5RA 3DESA 2Y7EA 5CJ5A 1R5YA 1Q65A 2OPJA 4HP5A 4XQ6A 3ENLA 3Q37A 1DJXA 3VGHA 3MSGA 2DSUA 3RR1A 4AZBA 4EPDC 2ABBA 4CEUC 4NZCA 4Q8VA 5EBAA 2QQ6A 3BW4A 2G3IA 1KGUA 4C7FA 1TCDA 3OLEA 1TA3A 3G22A 3WFAA 4H83A 4IFOA 4P8UA 3AHXA 1FWSA 2DZWA 1CIUA 3MI2A 5E5CA 3PUGA 3VYLA 3HF3A 2CITA 3BAJA 1X38A 1CT5A 3F5LA 2C18A 4GNJA 1UIPA 3BH4A 1EOKA 5EB8A 4AD3A 4R53A 2CLPA 3V7PA 5BRPA 4IXHA 4Q6XA 4DBUA 3C0JA 3OW1A 2YDAA 2WVSA 3SQMA 3QPYA 2C79A 2GGJA 5HMEA 3QPEA 2PF8A 2ZZ4A 4IIBA 1E9ZB 2XISA 1KGXA 2XZ9A 1C29A 1GHSA 3EWUA 1EC7A 1G5AA 3SO7A 3B8SA 4BQ2A 5HATA 4UR7A 1LDCA 4GC3A 4PRTA 2DJLA 1AUSL 3M5VA 5AHLA 5HUPA 1JCMP 2YFOA 4OOZA 3CT2A 4XD5A 1I2PA 1ONRA 4CQ8A 1D9EA 2Y1HA 1S38A 1WKYA 1XIDA 2UWFA 3B9NA 3B0VC 2EPKX 1JD7A 3QSTA 3I68A 3W7RA 1W3NA 4IMFA 3EEGA 2AL1A 3R58A 3DKLA 3UPBA 3UWVA 1C92A 4XZHA 4GPNA 3HN3A 4LV9A 3SCOA 3RIKA 2PDBA 1J0HA 1O4UA 5I3JA 3VC6A 3VC5A 1UWSA 3GE7A 3S5YA 2ISVA 4L9YA 1TJ2A 3O6DA 1LQ0A 3DBNA 4QLJA 4HA4A 4MWAA 4MGGA 1XRSA 5H6HA 1CDGA 1KM5A 3COTA 5FJPA 3DIPA 4C6LA 4MOZA 4WDWA 1FX6A 3MMUA 9RUBA 5AVNA 4M6QA 2WCSA 4LNYA 1RBOB 1EUNA 3BMWA 3KHJA 4XBKA 3UETA 2HMCA 2Z24A 4EKJA 3CTLA 1FOBA 1Q6QA 1DXFA 3BE7A 1QT1A 1DQXA 1UROA 3R0UA 4DYKA 4L7ZA 3UERA 2Z0IA 2VOMA 3TWBA 1C8YA 2KZHA 4C5YA 3B97A 3WF1A 5DT5A 5EMLA 2E3ZA 3TC3A 1OG6A 1OX5A 1S2UA 3LG3A 3TJ4A 2ZXAA 4WK9A 4LTSA 1QASA 2EGZA 4CD8A 3B3DA 3Q45A 3LBMA 2J8TA 3E12A 4KCVA 1O94A 4L1WA 1M7XA 4C90A 1M7JA 3TQPA 1WBJA 2FPTA 4H7CA 2PLCA 4RJEA 1YW1A 3H7RA 1RCQA 1NARA 1OGSA 4IGHA 3ZLFA 1JJKA 2HDJA 3KL3A 3ITCA 3L0KA 3WYZA 4LC6A 3HU7A 3MVIA 4TMBA 4C1NB 1VFHA 1W9XA 1BTCA 4JQ4A 1UWTA 3P5YA 3CMFA 4HN8A 2R1NA 2CZEA 3N19B 3LYEA 3W1AA 4S3BA 2FMOA 4JS3A 1O95A 3OYXA 4CNOA 3UD6A 1GYNA 3PZUA 3ECQA 4JL1A 4PTNA 1V0KA 3OHIA 2CBUA 1JI2A 4G8TA 2GGEA 3MWCA 5AC8A 1FA2A 1ODUA 4X2PA 4L1XA 1H0GA 1HJSA 3TQKA 1MEWA 1R3RA 1T5AA 3C2YA 3URQA 4PCFA 2C16A 3ZT5A 4JN8A 2V3EA 3PULA 2F6XA 4J3ZA 1KV5A 1IE7C 3WF3A 4NRRA 3VDAA 3H4GA 1GOIA 3K4WA 4US5A 2RDXA 4JX4A 5JBEA 2RKXA 3QQ0A 1UZ4A 4PUDA 3W7IA 3QTPA 3B0UX 3MYPA 1AD1A 1EP3A 1F3TA 2WHKA 4W87A 2YLAA 4IJCA 2VUYA 5BNKA 4ZR8A 5C7HA 4GWEA 2ACUA 4AXNA 2P0OA 4DWSC 3CBWA 4AB4A 2FFCA 4XVEA 1UR4A 4JDBA 4ATLA 2W0UA 1GYLA 1IEQA 3PJUA 1D3GA 5AVHA 1GZGA 3MO7A 4P8VA 3ZIZA 4CU7A 3GDLA 1XV8A 2OO6A 3OHMB 1WDRA 4LF2A 5HPOA 4FI4A 5IXEA 3S2CA 2J47A 3KTSA 4N02A 1F9CA 3MS8A 2YXGA 3R11A 3EWWA 4C6NA 3AJXA 3B9EA 4U33A 1HX0A 3C6CA 1KBJA 3R94A 4IPPA 2GQ3A 3VZXA 2X2YA 4MB4A 1VS1A 2WSRA 1J93A 1K9EA 4ZO7A 1S2AA 1WX0A 4FR1A 3VOIA 1B5TA 3EBVA 4I7WA 3BQ5A 2VENA 2TODA 1AW1A 3GYCA 2R94A 3OGRA 3DUGA 5BU9A 2CHNA 1NDWA 1KM6A 2CLFA 3ZVHA 1WPCA 3A9IA 4DLMA 4TUFA 1JRBA 3LLDA 2PURA 3UG3A 3W4RA 3WH8A 4NYUA 1X6UA 4MKNA 3WEOA 3FEMA 4AIBA 3UYIA 3MW7A 1DP0A 4DPQA 4WEVX 3AXKA 2WWCA 5C5YA 2C91A 4TU1A 4DQWA 2VP8A 1MQRA 3W38A 4KERA 3CHFA 3HG3A 1WV2A 4C6MA 5B7YA 4FA3A 2VEKA 4E8GA 4JFVA 5CG7A 1UUQA 2BBFA 3GDBA 4S3FA 5A3HA 1LCOA 2E1WA 3UJFA 4AMAA 3DERA 1PS9A 2DSKA 3ZZ1A 4ORIA 4HYWA 3W1MA 4PCPA 1S5WA 2PDPA 3TH6A 3WLOA 4IIDA 2AKMA 2XVNA 2P3ZA 1WO2A 3TYDA 2X05A 1TTQA 4UTTA 1ISWA 2DW7A 4MPKA 4P7LA 4IPIA 3G1YA 1QNVA 3IJIA 4HGXA 1TWIA 5HJYA 4OBTA 1GQJA 1WDSA 1KM1A 3QMTA 2RJHA 1RV8A 4PCSA 2G37A 4TMCA 5I06A 2X09A 1OCJA 3C2FA 3BLDA 4DF1A 1NEYA 3N9RA 4PUUA 1JPDX 1TR1A 3FDGA 1LOSA 1Q4NX 4P7QA 1C7SA 1F3WA 2RGMA 3Q58A 3K5XA 1MYRA 3OQEA 4J3VA 1ZHAA 1PJ9A 3ITLA 4EPBC 3G1HA 4MJMA 1PDYA 2D1ZA 1OZMA 1JFXA 3ZOAA 1UH2A 4GOAA 1SQ7A 2KX9A 1AJ0A 2PDFA 1VFMA 3U5UA 3HV8A 1Q7MA 1F74A 3INPA 5G1MA 1IXNA 4O1FA 4WD0A 1K9TA 1WUEA 2D2JA 3BGJA 3P82A 4DZAA 1J6OA 2DIJA 5CZSA 1KTCA 5FF0A 3M0IA 2J9ZA 2WAGA 2Y8KA 4GVFA 3NA8A 3S2NA 3PPFA 1CGVA 3SRHA 4BWLC 4NAFA 1B9BA 5AC4A 1YBQA 3N6QA 3NYDA 4IQDA 4DY1A 3S1XA 3AS2A 2GGIA 1YPIA 5D02A 1GVEA 4PTXA 1RVKA 3KLKA 1ZSXA 4QJ4B 2A0NA 4DWSB 4ZQCA 1Y7VA 3TR2A 2X7WA 2XG9A 3FFSA 4TXEA 2PLJA 4DJFA 3R43A 2Y88A 1M5WA 1Q5MA 2Q3OA 2V5KA 3HV9A 2ISDA 4RE4A 2Y8UA 4GVHA 2GQ8A 3UJEA 4Q22A 3QN3A 5EFFA 1W3KA 1KM2A 2BV9A 4WQ6A 1M03A 4UFLA 4PUWA 3C2VA 3GHTA 3CZGA 2BMBA 3VMPA 4FOUA 3THCA 3KS6A 3PUEA 4R9OA 1D7KA 3S83A 1A47A 1LBFA 3MT1A 3FLUA 2OLAA 1KM0A 3F5JA 1D8CA 3W01A 3ITTA 2WMHA 1PTDA 3ERPA 2VC9A 2FJUB 1K4HA 3HPSA 5HQEA 4QG6A 2J7FA 1K77A 1M6JA 3WLMA 1VZWA 1S2TA 1E1FA 3ABQA 4NI3A 2QIWA 4O0ZA 1QW9A 3IIOA 3GAKA 3UY7A 3JRKA 3KAOA 3T4WA 2RH9A 3VKCA 2XVGA 5H8MA 3AXHA 4LW7A 1XYLA 3TAKA 2EPLX 3AHTA 5IFTA 1U5VA 3SIZA 3PHAA 3TJIA 4J27A 4UBPC 3ZR4A 4AW7A 2H8XA 2QZRA 7TAAA 3BAKA 4ENLA 3BSMA 3H23A 2QCMA 1R86A 1NFPA 5IDZA 1GVSA 3RU6A 2PAJA 1U22A 3QC3A 3WJWA 3ANUA 2VX6A 3WMLA 2JIWA 1KBBA 3ABRA 2E1DA 4B91A 4RX0A 3V3WA 1FDZA 1MXGA 3WX7A 1E1CA 2CXEA 3R89A 2DZUA 2V8ZA 4YXGA 1FHLA 3MP4A 5H2ZA 4ZENA 4AD0A 1YXCA 5K4XA 1NOUA 3P3BA 2E68A 2AGTA 4C7DA 1WDQA 2OSXA 3G6MA 1ML1A 4L4MA 1LLOA 3SZ8A 2ZRYA 2IKJA 4E0CA 3OIHA 1UH3A 1R8LA 2HS6A 4YTUA 3S9ZA 1HFBA 3LHVA 1P48A 3C0LA 2VWTA 4M3PA 3SRDA 1XP3A 3TLLA 4D8AA 4LGXA 3CUZA 3NQ2A 4PA8A 1IXPA 2IPJA 5C71A 3QHMA 4H6QA 4REQB 4CNSA 5U4NA 3SGZA 3HQNA 3FA4A 2W91A 3AXXA 4W85A 1NVMA 4K7VA 5EKYA 2H6RA 3ZM8A 1B54A 4MDOA 1ICPA 3CO8A 1K03A 1E5JA 4A22A 5CC5A 1TMLA 2J27A 4OBRA 1CCWB 3N34A 3WDJA 4RE2A 3BGGA 4YHGA 5EFDA 3VILA 1IYXA 3PBYA 2HXTA 3UZZA 2HCVA 1WAWA 3S42A 5DMNA 4KGJA 4PR4A 5BU6A 2VFFA 1XIGA 1YTEA 5I5RA 5TIMA 4GYKA 4M81A 2QGYA 3W83A 1CXIA 3W82A 2RJGA 4TQTA 4HJFA 3VM7A 3W6YA 3CUFA 2V30A 4H2HA 3L5MA 4MIMA 1W9PA 2XYLA 2YIHA 4CCEA 3FV9A 4AVFA 4MZ8A 3EAUA 3I3DA 4FLRA 3GKAA 3GU2A 1BVNP 4AZIA 1MMFA 3O05A 3N2CA 1D3HA 1KGWA 2G3NA 2XWDA 4HHPA 2NQHA 3RHGA 1SZNA 4GIRA 1M7PA 3CH9A 3EDJA 1LBMA 3LENA 1NDYA 3QM3A 1RALA 3NQEA 3WQGA 2WXDM 5M03A 4WDXA 1GQLA 3KCLA 1DWIM 2ZRUA 1LOLA 3RPMA 1YDOA 3P5ZA 4MWAC 3KCJA 3WLJA 1XD0A 1CXLA 6XIMA 3KBSA 4S3GA 4GI6A 4GI8A 4B3LA 2C1HA 4LAKA 3T0AA 3VX1A 3F2CA 3MHUA 4A6GA 1LTDA 1VB9A 1YNYA 1UBSA 4NZ3A 3LSBA 4GH1A 1KBLA 4JEQA 3GC5A 4QTGA 5LA2A 5E09A 4LC8A 5K9CA 3GNDA 5CJMA 4QIUA 5IM51 2CZ5A 3LCIA 2PBOA 4GXMA 3CHDA 2R6OA 4QEEA 2ALDA 1IXOA 1O60A 5TF0A 4IFKA 4OQVA 2UZ9A 1XC4A 1L6WA 5AFDA 5MKGB 2DZAA 4PE8A 1FWFC 3MSDA 2JFEX 2QPSA 3AMLA 3HZ3A 4PZVA 3SN0A 3TDFA 2A6NA 4Q8OA 5A6BD 2ZZ6A 1W56A 1YQ2A 5CPNA 2JBMA 3SJ3A 2J74A 5CZ0A 5T9BG 3HPAA 4HZ8A 2Z1KA 1PPIA 5LIYX 4TVCA 1OD0A 1UD6A 2ZWZA 1CBGA 4RUBA 3V35A 3WLNA 4UQEA 3CEUA 2J88A 4QXIA 2ZVIA 3BL3A 4FHAA 1P6BA 1GZ1A 4Y8FA 3UA3A 1ONXA 1V79A 3OBKA 1GVOA 1M53A 1E4MM 4N6EA 1QUMA 4X0NA 1MW2A 3B06A 2J62A 3TN6A 4MDPA 4GABA 1XI3A 1V51A 2OODA 2GVLA 2XIMA 3R8RA 4C6JA 1UZDA 2BGNE 4AFYA 3FGCA 3XIMA 2X42A 1TJ1A 4D8ZA 4NJJA 1WDPA 4BZYA 1V3KA 3NURA 4HMNA 1EIBA 1L6FA 2GVJA 3TTOA 5I6SA 1DV7A 4PUNA 4CQ9A 3SUVA 3UR8A 3CS2A 1JD9A 1TA3B 4S3CA 3F4WA 4B4HA 2BOGX 1YPXA 4YTSA 4D71A 3IACA 1RCXB 3EWZA 3TCEA 5I00A 3WBWA 3HA1A 2FDMA 4XSLA 5BROA 5A6AA 4YCPA 4WKAA 3Q94A 2ZWYA 2OCZA 1X8CA 3GG8A 4GQRA 4HB7A 3ALFA 5E9XA 2C1GA 5DF0A 5C9UA 2YW4A 3USZA 2YZRA 5RUBA 3N2BA 2ZRZA 1JXKA 3EWXA 4PMVA 1ECQA 3CB8A 4JTKA 2W62A 3MBFA 5FACA 2V69A 4CD5A 3KP0A 3AYTA 3FYOA 2D0GA 4ZODA 3S5ZA 1OFAA 1XLMA 2PTYA 4AQLA 4UMBA 2DSZA 1LRTA 3VU2A 1CLKA 3FJ4A 1ME7A 1TELA 2E9MA 4UTMA 3UJSA 4GUHA 1A53A 1VYPX 2CERA 3HFTA 2YKKA 1WB0A 2QMJA 1K4GA 1H09A 4NT0A 4DBSA 1TV8A 3DKJA 3TW9A 1TKKA 4GIYA 4KCUA 3LI1A 2NVDA 3ARXA 2QUNA 2WANA 4XTDA 4XUGA 2A7RA 3WBAA 2PDUA 5AKQA 5HPCA 3D3FA 4S2CA 1CWYA 3GK0A 5G4WA 3R12A 3KRSA 1W1TA 2J78A 2OT1A 3T44A 1PAMA 3MV11 3UXAA 3A4XA 5FEXA 3B40A 3BAXA 4H9XA 4MWAB 2EEXA 3TMLA 5CC3A 4HMDA 1D3CA 4M19A 4LS2A 1Y65A 4JTHA 2YB4A 3DFHA 3I4KA 1NSJA 3FDKA 1ICQA 1BYAA 2VURA 3CEPA 2GJPA 4W7UA 1QBBA 3TP4A 3MUAA 4D72A 3L65A 4Y9AA 2E6YA 4KCTA 3F4CA 2BTMA 1PHWA 2WHLA 3MB9A 1LWJA 3AZRA 3G3MA 5G4EA 2X1TA 5BXSA 3OZYA 3VIOA 3L21A 3WF2A 1X1ZA 4W5UA 3QVQA 4PMJA 3T78A 4EXQA 1H61A 5GJMA 3SCNA 3SCPA 5A95A 2BSLA 1UH4A 3NJ3A 1MW0A 3H4XA 3UZYA 3DFSA 1JQVA 3RM9A 1FP9A 4BI6A 4UTTC 3MCNA 1CGUA 1TSIA 1EJSC 4L56A 3IJQA 1QI5A 2QV4A 4UFJA 3RMJA 1JZ6A 2QPUA 3GR4A 2PGRA 3WN6A 2Y7DA 3QQWA 4KGLA 3CZEA 3W0KA 4ZB5A 3AO0A 1KCLA 1WCGA 1EJWC 3ANVA 3NM3A 3TVAA 4G5DA 4L6DA 1U30A 4MF4A 4OE7A 2WQDA 2VVSA 4ML4A 3UR2A 4HKPA 4GZEA 2OG9A 3C56A 3EWYA 1K8XA 2CLEA 2ZOXA 1Q7QA 1S46A 3H21A 4Y9NA 3NGJA 3LPPA 4PBGA 3WH7A 4DBEA 1BLIA 1XLGA 1E55A 1V77A 1C8QA 3MSYA 5KEZA 3NQBA 1Z8AA 3U5YA 1BKHA 1I4NA 2BOEX 4MJ2A 5DFAA 2PBGA 3B4UA 1HKMA 1FH9A 5LIUX 4S3KA 1YXDA 1YRRA 1JG9A 2VT0A 4EF9A 4BKNA 5I3GA 3ZWSA 5JU6A 1PTAA 3IUHA 4XAFA 4IMCA 1NWUA 2DT2A 5XIAA 3WY1A 1SJBA 1OF8A 1K7EA 1LT8A 5CQ1A 2ZZ3A 2EKCA 3K4DA 2WJEA 3GNOA 4UIOA 2J75A 1LQ2A 3M6YA 3RILA 3NOYA 1JQXA 4JX6A 3IVTA 4AY8A 1CZ1A 3QGAC 1NWTA 3CHVA 4J1OA 6CGTA 5CZTA 4A8NA 1EX1A 5HJLA 2QCDA 1BVWA 3I7SA 4HCLA 1PZ3A 3ZJ8A 2R82A 3O6YX 4J2PA 4ZFMA 1OD8A 1ZQ5A 4ALDA 3OQ8A 1FHDA 1Q8AA 4HU0A 3QF0A 2NUXA 4DJFC 3O6AA 1E0XA 4LALA 4IM4A 1O12A 3LCLA 2VCAA 1PUDA 2YBTA 1QATA 3GVQA 1RA5A 1S1PA 2J79A 3N73A 3WDIA 4PMXA 1SJAA 2EF9A 1QK2A 3G24A 1ZAHA 4D6JA 4HNLA 1R46A 2ZDRA 1X98A 5D04C 5AOUA 5SWUA 4YLWA 4MB3A 3ID7A 3GXMA 1NQ6A 4P5UA 3DI0A 1F7BA 4ZSUA 8RUCA 3G5EA 2PUZA 1AW2A 3DFNA 3DX5A 2PS2A 1BYCA 3A6OA 1A5BA 1RJQA 3GTFA 1VCFA 3IANA 4F9JA 3I65A 1JDAA 4HNTA 3M46A 3W3OA 3SR7A 3U4FA 3ZVHB 2VCBA 3TWAA 2XM2A 3I10A 4C6CA 3GO2A 1JVNA 2QCHA 1QNQA 4UWMA 3GG1A 1QK0A 7ODCA 2CKSA 4TTGA 2ZXBA 3GVVA 1OX4A 3S8HA 4A3RA 3L0NA 3CIXA 3RR4A 2F2HA 3DC8A 2OX4A 4QAIA 1MUWA 1KWKA 4U5IA 3EXTA 4EXAA 4WLCA 1TPUA 2IXUA 3K8MA 1FWDC 4EP8C 4ACYA 2TPSA 2VZTA 2FVKA 2KAUC 5CH9A 3T6CA 1HJVA 1M7OA 1SW7A 1V02E 1KV8A 4MMWA 4ADSA 1EPVA 3RRXA 3CPUA 5C55A 4MZYA 1W1B1 5ABTA 3V18A 4AD4A 5FF4A 3EMZA 2PWEA 4UOZA 4IIEA 1YE4A 1Q6LA 4POCA 4L9XA 4DELA 2R9RA 1MXDA 2ZIDA 2GLKA 2DU2A 4LNCA 3TA6A 2QDGA 2WSKA 4JYEA 5CAHA 1VH7A 2W63A 3CL8A 3QRHA 4NL1A 1QW8A 5B80A 5CC7A 1BFNA 3SY5A 4KWVA 4O4VA 4JTIA 4LB3A 2GSHA 1XBXA 2OEMA 4FNTA 1E6ZA 1F5ZA 3EOLA 4L4PA 3MO4A 5AHEA 3DHPA 4H8VA 2BVYA 1LG2A 2ZX6A 4R33A 2WMFA 3WLHA 2I5GA 4RNHA 2FPVA 3SW6A 4G1KA 3YPIA 4GQGA 1EA0A 3E9AA 1HW6A 1SO3A 3VTRA 2PSNA 4NNBA 2QDEA 3EKLA 4QG8A 1TMQA 3VKKA 1UIOA 1XHGA 3MKCA 1HUVA 3RX2A 3A3XA 4NAFB 2ZUNA 3W53A 1MZRA 1YBQB 2YR1A 1XR2A 5T91A 1GORA 3BURA 4Z2LA 5KETA 1DXEA 5F2IA 5BMXA 4I9MA 3VGEA 2J7BA 3DOPA 3UWZA 1A5AA 2VGBA 3NO5A 4OV4A 3RM4A 5D37A 1D2KA 1R47A 1G94A 1RBLA 1W5OA 4QS6A 4S3AA 3BLPX 1MXSA 1W1A1 4RNIA 3LDVA 3ZJ6A 4GJ1A 4EACA 1MQPA 4ICCX 1SU5A 3VDHA 4UQBA 3BUVA 5KINA 1FWEC 2OSYA 1EDTA 4HTBA 5I77A 2B81A 3E74A 1XLKA 4UB9A 3UCDA 5IBXA 1UR9A 1GOMA 3E2QA 3S1UA 3I6RA 1ZLPA 1KB3A 4DHGA 1MFUA 4JTEA 1FQ0A 1QO2A 4FO4A 3S4TA 2DPEA 3HG5A 3KOYA 3UG5A 3GG7A 4Q32A 4PULA 3WMCA 2VC5A 1XD1A 2UY2A 2PGFA 5JXQA 1TV2A 4N7QA 3PANA 2NQ9A 1GVIA 1XLIA 1Q6FA 2OLSA 1WXYA 1R2RA 3MA8A 2IKGA 3FNDA 1O1ZA 5HNUA 4HOWA 3CTTA 1VHNA 2J77A 3MMDA 1YTKA 3TZFA 4DAIA 2CPUA 3IARA 3GUWA 4JGDA 4XAGA 2C14A 3SRKA 2HBVA 4CQBA 5K7JA 5I79A 3VOJA 2ZTJA 3R79A 3V4BA 3K30A 4C6FA 3LN3A 3DFQA 1TTPA 3UR5A 1SJCA 1TWSA 2XIJA 4GUFA 1X96A 2WNQA 2ZA2A 1BSIA 3S3GA 1MEIA 5HK4A 1GNXA 1LL4A 4LRSA 2YXOA 4Q4QA 1W1YA 1MI3A 3VDGA 2PTWA 1E1CB 1IIGA 4NX5A 1UQZA 1XDLA 3VD5A 1ZTVA 3KX6A 3M4HA 3SJNA 2BG5A 2E5CA 4QFUA 4DZIA 2CHRA 2VRJA 1W9BM 1EXBA 5HNRA 3B8IA 2J13A 3R25A 4PCTA 3PBUA 1JCXA 3WLLA 4QG9A 4JYFA 1C8VA 1TE6A 2P10A 2XIBA 4QS5A 1NIUA 3S5NA 3GIYA 2ZADA 5D8ZA 2DJXA 3GXDA 4FALA 4GIEA 2VUNA 3L68A 3DBPA 1UKPA 3NCOA 2GSEA 1RUSA 4LYPA 4FB7A 3CQKA 1SZRA 5D9PA 1THFD 3DGBA 3ALGA 5DRIA 3C0SA 2PGWA 2ZXQA 1W1IE 1RQBA 2G8ZA 5CBIA 5HR6A 4AC7C 1KW1A 3PR2A 1Y5VA 1O5KA 4JOMA 5KZ6A 3B9DA 1PWMA 4C6BA 1UYQA 1RR2A 3W2JA 4HA0A 2DUXA 3IIPA 4FP1A 4S23A 5H8UA 4CN1A 3NSNA 2QCLA 2WC4A 2NV9A 2DQWA 4UTHA 5M1TA 3KBVA 3N11A 3W88A 5EMMA 3PWAA 4J3XA 3SGUA 3PZ9A 1N8WA 1ICSA 4GY0A 4FXFA 1FWNA 1KBKA 5EA9A 1XL9A 1W8GA 3N12A 3BCFA 1U2YA 1KLYA 2YA1A 1WDWA 1UHVA 4D6HA 1K7XA 4B9ZA 5HWJA 3EB3A 2OZ0A 2PWDA 4BQ3A 1CXEA 1FP8A 1AFSA 5CPSA 1GTEA 4DXXA 3NVDA 2Y5EA 1E0TA 3EA1A 3UCQA 3WK0A 3L4ZA 2WBKA 4HT3A 3P74A 4J3TA 1ADDA 3PUOA 3NPWA 3HIJA 5CPOA 3V0UA 1FWAC 2BY2A 1LF1A 4HPNA 3ABSA 4Q33A 4ZQRA 2QAPA 5F2MA 3OG3A 4Q8UA 1VEMA 1F6YA 4GE8A 2WKLA 3PK7A 1Q3NA 3VNKA 2FZ9A 4WR3A 4QCFA 1DL3A 3HQ1A 4YTQA 4QAWA 1TV7A 3OTRA 3NZRA 3FYPA 2DVXA 4L4OA 3PZTA 2P8BA 3VFLA 3VOFA 1BG9A 3CLMA 1J8VA 2V0TA 3M6DA 1DTUA 1BWLA 1TVPA 4WKHA 4FLSA 2QR6A 3MV01 1CI1A 1K1DA 1GOQA 4XIMA 4LUJA 1GEHA 1HL9A 4UFMA 3R8GA 2O9PA 1TIWA 3LNPA 1VP5A 1SVDA 1ISVA 4IFKB 4A3QA 4CCDA 1JZ3A 3DEQA 4CNTA 4CQAA 2VGFA 4OTKA 4U10A 2ZUVA 3WQEA 2A4AA 4O13A 4XTIA 3GZAA 1H7WA 1EDGA 1W3TA 2VGIA 4QLKA 3NQMA 1RY0A 4F0LA 1GGOA 3ISIX 4CVUA 2VZUA 4IG2A 2PDXA 3PTKA 4Q7IA 3F2BA 3J7HA 3OGVA 4H7ZA 1KO0A 4C6QA 3M43A 3M07A 4Z1BA 4Q3MA 1BGGA 4R5EA 5FOOA 1FWRA 4UQCA 4LPCA 2GOKA 2HSAA 4H6EA 1GTHA 7CGTA 5CGMA 3SN1A 1QI4A 1XH0A 2R1KA 1EYEA 4J40A 2ZUWA 2IPFA 2DW6A 2ADAA 2V3DA 5AYZA 4Q8MA 3NQCA 4R3UA 3GU9A 4E8DA 3AXMA 1WA3A 1CGXA 1F8IA 1R2TA 2QCCA 3T0TA 4IL0A 4LCRA 3FGCB 1E0WA 1VQTA 4ES4A 3OO2A 3UXDA 1D8WA 3OVQA 1XXXA 1VRDA 4Y2WA 1AZ2A 2VQTA 1X1OA 2IQ0A 2Z00A 2HWGA 1ELSA 3VCRA 4V1XA 3A4WA 1G0CA 1ITUA 2JF6A 1DJGA 4F4RA 1VC4A 5D9NA 3TTSA 3WFZA 4GY1A 1VFOA 1CGWA 1VCVA 3LXBA 4FNPA 1B3WA 1M1BA 4H9YA 3W71A 1F8MA 4FLQA 5HMDA 3V0TA 3EZ4A 4IP7A 1JCLA 2YL9A 1DWHM 4D6GA 4DRSA 3PZIA 2BGSA 2OTDA 1J96A 4IUGA 1T8XA 4PUJA 5EBUA 3TKFA 1OT1A 4HK7A 5CGTA 2C19A 1SZGA 4E8CA 3W7KA 3KW3A 4C6OA 3RU8X 5E0KA 1GQNA 4IICA 5D9MA 3LU2A 4PTWA 2WOQA 3EOSA 2BLEA 4MKSA 4FF5A 4ZXLA 1QMLA 3TCSA 5HWNA 3M0HA 1M01A 1VJSA 1UQYA 2Y6ZA 2MANA 4XD3A 3PTMA 2OU4A 4WJEA 5ECUA 3HPFA 1QOQA 3SRFA 1J0IA 3NG3A 4MLJA 5BOFA 4FAMA 1KXTA 3NEHA 1SSGA 3H2NA 3W2MA 3OA3A 3AMCA 3TIMA 3VUPA 2TRSA 2Z1SA 1UP2A 3KXQA 3ARVA 4V33A 3AIWA 3LX9A 4RDWA 4KEUA 3KTCA 3EB2A 3CIVA 4KF1A 1E9IA 2IUZA 1G67A 3G1RA 3WFLA 3WNLA 2QEZA 1KXVA 4Q8NA 1X7IA 1UZ1A 4G9PA 3CV6A 2NT1A 4EWJA 3BO9A 4U31A 3N6JA 4PODA 1XS2A 4XAYA 3UY8A 4HNCA 3NPVA 3E2RA 3W87A 4WJXA 1BF2A 2GDQA 4AWTA 2WZMA 1ZB5A 3UR7A 4LVBA 1QTWA 1BKSA 1I2NA 1ITXA 5E93A 2YFNA 4GFIA 1ZNNA 4W8LA 3IRDA 3LNMA 1EF3A 4QBXA 1ZCCA 1TRIA 5MHBA 1K8ZA 2POZA 2PFHA 2NWSA 4AHPA 5DCDA 2JE8A 3KCOA 2OWXA 1J0YA 3UZWA 3L5LA 3BDKA 3CASA 1EZWA 2W92A 2HVOA 2X41A 3VOHA 1BRLA 3P6LA 5A2BA 3FW6A 2FQIA 1GOXA 2G41A 1H5VA 1WE5A 2BGQA 4M5PA 4JFUA 1PCKA 3BGAA 1LT7A 1Q85A 1RCOB 3ZS4A 4IMGA 1QHPA 2DT3A 4WXZA 1SSDA 1JR1A 1IF2A 2AOSA 1GKRA 2Z28A 3VNIA 1OGGA 3TTYA 2JEQA 3GHRA 1DE5A 3M64A 2PCQA 2WVUA 4MJZA 1F3EA 1LG1A 3BLEA 3UFYA 3WF0A 3VDBA 4ZQNA 1GKPA 1POKA 1UD2A 2FH8A 4UFHA 1GJWA 4NJKA 2A3HA 1CB2A 2ZX7A 2YCIX 5DX7A 5XIMA 3RNDA 4UOQA 3R6IA 1PL9A 4L1GA 1ZAIA 4YVPA 1Z3NA 3CV2A 4Y9OA 1Q66A 5M5DA 3WJYA 1E3ZA 1DJHA 1T8QA 2BZNA 1E6PA 3NO1A 2YA0A 2QCDB 3ARWA 2G97A 1JCYA 1OGBA 3W2KA 1KBIA 5REQA 1FXPA 4WHBA 1JRCA 4UCFA 3MKVA 3LXAA 4GX8A 3FJLA 4W86A 4GXWA 1IZJA 2EPNA 1J0KA 4QE5A 1EC8A 1ZBWA 2JKEA 3B0XA 4KESA 1TQXA 3MUY1 4YHEA 3E2SA 1TPDA 1DJZA 4O52A 1S2WA 3AHVA 2Q09A 1GW9A 1DHKA 5DMLA 1QBAA 5IBXC 1S3TC 4LUSA 2D3NA 3TC7A 2EPMX 4ACZA 4I7VA 3O6CA 4RL3A 4PBEA 3L4XA 1GW1A 4AY1A 1M04A 3WQCA 3O0KA 3TXZA 2Y61A 4AD2A 3KP1A 3HG2A 3O07A 5CEWA 1XBYA 3FHQA 1F61A 2Z1XA 2F38A 3W7LA 5JH1A 2XJ7A 4A3UA 4QNEA 2PU1A 3VKAA 5LHFA 4IP4A 1A0CA 3NEVA 3R0KA 4DM1A 3CT7A 3L4UA 1FCUA 3CQ0A 4B5TA 1Z89A 2VJXA 5D33A 4EX4A 4MNJA 2P50A 2BX7A 4LT9A 5EGRA 1UD5A 5DBUA 1OX4B 3WK2A 2FGZA 1X97A 1S39A 3RF9A 4AHQA 2ZDSA 1AL7A 2FLIA 1RQHA 4H00A 4AWUA 1JF6A 1XLBA 5DY2A 4JAWA 1H49A 1QU4A 1V6WA 1DJNA 3EMQA 3UT0A 1KTNA 2AMXA 5G2WA 4K36A 3TFCA 1TWZA 4K1GA 4ZA0A 2YLLA 3WDHA 3LQLA 4AZGA 1E43A 1FTXA 3G0UA 2NZLA 2H3BA 5BWFA 3ARTA 5AECA 1V3IA 1HVQA 1TFVA 4UQAA 3W1UA 1AZ1A 5G4HC 3AICA 4GMEA 5LNWA 3GFZA 1JDDA 4B2DA 4LAOA 2GVYA 4H9VA 3MP3A 4JKKA 5CSYA 1LL7A 3BOLA 3ARUA 4L64A 4ZOAA 2Q3RA 3G1VA 2VDIA 2X8RA 1WZLA 4G6CA 4FIRA 1DIEA 2D23A 3QLLA 3IUIA 3CYVA 4N9BA 1IHIA 3VPLA 3RDKA 4RV8A 4DJDA 5HXMA 3ITVA 1P5BA 3LPOA 1QWGA 1RLCL 1KM3A 4MNLA 3LRLA 1EQPA 3W2LA 1RK6A 5J8LA 2RGLA 2PPGA 5KSWA 4AU0A 1GT8A 5I3KA 1PB0A 1IXQA 2UY3A 5A6TC 4CD4A 4UOJA 3RX3A 3BICA 1DOSA 3IK2