1DE5A

L-rhamnose isomerase
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
417
structure length
417
Chain Sequence
TTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 153
structure length 417
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1de5A00
1A0CA 1DXIA 3IUHA 3UVAA 4DVOA 1XIFA 1XLJA 3AYTA 1OADA 3KWSA 2XISA 5EMKA 1XIMA 4HHLA 1YX1A 1S5NA 2GUBA 1XIDA 1XLHA 2HK1A 2HCVA 2GVEA 3DBNA 3CNYA 3ITTA 3M0HA 4QDWA 4ZB0A 1DIEA 4Q7IA 1QT1A 4XSLA 4YTQA 4XISA 2NQHA 4GLEA 1BXCA 5XINA 3UXIA 4OVXA 3IUDA 2QUNA 3FVMA 3U3HA 1XLMA 4QEHA 4ZBCA 5J8LA 2X7WA 1XLAA 4EAYA 7XIMA 4W4QA 9XIMA 2XINA 3ITLA 3KBJA 1XLGA 1XICA 2GYIA 4YTUA 3KCJA 5XIMA 2I57A 1I6NA 1XLIA 2QULA 3N4AA 3M0MA 4KW2A 2X7VA 1XLKA 4US6A 4XIMA 3UU0A 3XISA 3M0XA 4QE1A 4A8LA 4E3VA 3KBVA 2Q02A 3VYLA 4XIAA 1QUMA 1BXBA 1XYAA 4YTRA 3VNIA 1GW9A 3KCLA 3M0YA 3VNJA 2G0WA 1XLFA 4XSMA 4DUOA 3OBEA 3C0LA 3LMZA 1XLLA 3CQKA 3M0VA 4YTTA 3TC3A 3DX5A 8XIAA 1XLCA 1XIEA 3KBMA 1K77A 3KBWA 8XIMA 1A0EA 3QC0A 1D8WA 1XYCA 2XIMA 4ZB5A 1MNZA 3BZGA 4GJIA 3AALA 5I7GA 5C9ZA 3IUIA 4HGXA 4YTSA 5B80A 4X63A 4G56A 2G4JA 3KBSA 4X61A 3BWWA 1XIIA 3M0LA 5AVNA 4A8IA 3UA4A 3L23A 6XIMA 1XISA 2GLKA 2QW5A 1CLKA 1QTWA 3AAMA 3QZAA 3KTCA 3CWHA 1O1HA 3QYSA 4LNCA 3KBNA 3ITYA 3P6LA 4XKMA 4X60A 4ZB2A 5B7ZA 4K1GA 4PFHA 2ZDSA 3VNKA 5AVHA 3NGFA 3AYVA 3XIMA 5H1WA 1A0DA 2I56A 1XIBA 3JU2A 3UA3A 1XIGA 3CQIA 3ITOA 3C0SA 4HNOA 5EMMA 3ITXA 1XIHA 2HK0A 5XIAA 3C0QA 1DIDA 3KCOA 1XP3A 2ZVRA 4GJJA 2OU4A 4QDPA 5EMJA 6XIAA 9XIAA 4EACA 2QUMA 4HHMA 4A8NA 4K3ZA 4QE5A 4J4KA 3WQOA 1XIJA 5TNVA 2J6VA 1XYLA 1TZ9A 1XYMA 4QEEA 1DE6A 5FA5A 3CQHA 3U0HA 3BZJA 1MUWA 1S5MA 3ITVA 3VNLA 3GNXA 1XINA 3P14A 4QE4A 3BDKA 2NQJA 5B7YA 2NQ9A 5H6HA 4PGLA 3CQJA 1XLBA 1XLDA 3XINA 1I60A 3BANA 4GQBA 1XLEA 1DE5A 5EMLA 1XYBA 3QXBA 3TVAA 4A8RA 3VNMA
chains in the Genus database with same CATH superfamily
3GR7A 3NOEA 3POHA 3EDDA 2WQDA 4U10A 1R3RA 1DIEA 4PSRA 1IEWA 2GOUA 2F2HA 1P48A 5CPQA 3BL3A 1OFQA 1REQB 2EPMX 1DJGA 2HE5A 3KCJA 4Y9PA 3O3RA 1PJ9A 3WLPA 2WNZA 2DJXA 4LALA 1UC4A 3D3AA 3LGDA 2D0GA 4ACZB 1MDLA 4HA0A 4D6JA 1ZB5A 1K9EA 2O4QA 4AZGA 1ME7A 2ZRUA 1C8QA 3VABA 4B5UA 3VMNA 4HCLA 3UZZA 3KBSA 4BI6A 2GK1B 2VC7A 1CENA 5FF3A 4FXSA 3LOTA 3C3UA 3EOUA 1V5XA 5AYYA 4PMJA 2H3DA 3TC7A 4PR4A 2XH0A 3AHTA 3UY8A 3W1TA 2W5FA 3TLQA 4H1ZA 4W8AA 4IF2A 1EDQA 3GDLA 1CB2A 3N19B 1ZJHA 3LCWA 4OKDA 3BLPX 5C55A 2ODOA 4HK6A 1VB9A 1XGEA 1VCGA 1EZWA 4HTYA 4QG8A 1HKIA 4G7FA 2XPKA 3WFAA 1F5ZA 3W7IA 4EX4A 1UKOA 4JL2A 2G3FA 3RM8A 3P93A 2FIQA 4I3GA 5F2IA 4RNIA 3T0TA 1ZFJA 4HNVA 1CZ1A 1OADA 1T41A 4HHLA 2BZNA 1UROA 5ABEA 1YKWA 2VGFA 1QT1A 3DHDA 3N4FA 3UXIA 1M41A 2V63A 2H9AA 3K30A 3LCHA 5DMYA 2FPVA 1O5KA 1JUBA 4HZ8A 1Y65A 3G1VA 2J79A 3UXDA 4J3SA 3M41A 1L6WA 5KEZA 4WXZA 3BV7A 3F5JA 3STFA 1FUYA 3HA1A 4DXXA 4Q4KA 1SR9A 3K1DA 3B4YA 4FNUA 2HRWA 8RUCA 2HNEA 1XCWA 3CH0A 2C79A 5DO8A 3EX6A 1FH8A 1EOKA 1E0VA 3FFSA 2XFYA 4FPSA 4WR3A 1JCJA 2FB3A 4ENLA 3AAMA 3H2CA 2HS8A 4M19A 4IJRA 3AIBA 4DRSA 4U5KA 4WXYA 1PSCA 2WMHA 3C52A 1V0KA 1CIUA 4DAFA 1UR0A 3XIMA 4GY7A 1YIXA 3PTDA 2PTZA 2YIHA 3U8GA 4CD7A 3UR2A 4HNTA 4QM1A 1JZ4A 3SCPA 2Z28A 1R85A 3WDRA 1HO1A 2PU1A 1GVRA 2A3EA 5DMMA 4CLMA 3GNXA 1S2CA 1XBYA 2Z1VA 2ZXBA 4C1LA 1JPMA 3KHJA 2F8QA 4PFMA 2VT0A 1FWRA 4LAZA 4AB4A 3L4ZA 4BQ3A 5AZ0A 1YTEA 4AXNA 3AS1A 1G6CA 2WM1A 3BG9A 3CUHA 4NNCA 4CNPA 2XUCA 3CV2A 5HWMA 3W0KA 3SCRA 3LHVA 1XGDA 7ENLA 1DWJM 5BWFA 2Z1XA 2PRHA 3MWAA 3MPGA 1PVNA 3TZFA 1E73M 4NL1A 2DUZA 1TVNA 1FY6A 2NQLA 3E2RA 1A5BA 1XC4A 5KZEA 3OOQA 4GCAA 6REQB 4IMGA 3NQBA 4FEZA 5F2MA 1W91A 1G67A 1W1ZA 4P8WA 2ZRZA 1ICPA 1JCNA 1VLIA 3STEA 2BY2A 4R88A 1E6PA 1LG1A 4TVDA 4FP1A 2O9OA 1EA9C 1JUKA 4NAFA 1W8GA 4QAIA 4KWWA 3SFKA 1UCWA 2NVAA 1JYVA 1QPOA 1R87A 2AAAA 1HF6A 4K3ZA 3TH6A 4YWSA 4IG2A 2QCDA 4O0KA 1ZCCA 1BWKA 2XJ7A 1W6TA 3WF1A 5K4ZA 1LRNA 3GD6A 4BF9A 1F07A 1FTXA 2BODX 3KFTA 4MWAD 2TRSA 5CSRA 3KWXA 4O4WA 2HBVA 3ALFA 1K8ZA 4US5D 4LJ3A 2X1SA 3KLLA 3K8LA 2VWTA 3RR1A 3CGTA 1BXCA 2D0HA 4DM1A 2A21A 3HG4A 2FPYA 3FAWA 1I2QA 3A9BA 3N4EA 3OTRA 3C2EA 1HVXA 3M0XA 4RPPA 2V69A 3H2EA 4IFKB 1N8IA 2V5BA 4LXFA 4AFYA 2OYMA 3WK2A 1WDWA 2WM0A 4PUJA 3SZ8A 3C0JA 4RZBA 5LIKX 3O7UA 3UZJA 4C60A 4PBGA 4C6LA 2UY3A 3IIXA 2VR4A 1AK5A 3DXIA 1F76A 4YTSA 2QGYA 3GBDA 3TYAA 3ZLHA 1AG1O 1RD6A 4ZXOA 4NRRA 3ABQA 3ITCA 1QPRA 1ONEA 2DZBA 3BCDA 1J6OA 3HPZA 1BQGA 3PAJA 2WPGA 4B92A 3LQLA 2WYSA 4JX4A 3B9NA 3MSRA 2ZVRA 1BLIA 3G77A 1OK4A 3Q65A 5JVLA 3JW7A 1JI1A 1S38A 3SRFA 3U0HA 4XZHA 2OGYA 4E0CA 2EXOA 3R11A 5I3IA 5LGXA 2XDFA 4RZ6A 5M1TA 1R8LA 3WH7A 1LTDA 1MQQA 1BGGA 2PZNA 3GYEA 3QEZA 3V1PA 4NJJA 3WO8A 3R89A 5ABFB 3VXGA 3OB8A 1Q2SA 2W9MA 1ZNNA 1OY0A 3RLHA 2ZQ0A 3FXYA 4W5ZA 4XKYA 4A3UA 3WQ8A 1P0KA 4M6UA 3CIXA 1MEIA 4P8VA 1UWUA 3I10A 3KCLA 3IJ7A 4Q6XA 1UWTA 4PUWA 3DOPA 4KFNA 3L5LA 4AIOA 4XSMA 1SPQA 1XSIA 3VE9A 4ADTA 5LIWX 1UBPC 1JFXA 3AZRA 3W2JA 4IGMA 2C0AA 3NL3A 1AQHA 3TN3A 2AQOA 1U33A 3ZR6A 3WQ6A 2QHAA 5C70A 4OBSA 1YPXA 1AL7A 1PPIA 3UJFA 2FQIA 1OCNA 4KRTA 3O6AA 1E40A 3HFYA 2G8ZA 2C14A 1XSKA 1VGAA 4AHPA 3BSGA 4WLCA 2QJHA 3TYZA 1Q3NA 3QHOA 3W1PA 1VEMA 1SFTA 2DVTA 1QR7A 1Q65A 3CMJA 1JIBA 2O55A 2FHBA 3TYDA 2BVYA 3EA1A 4XVEA 5HR7A 4IL0A 1H63A 5AKQA 2J62A 5KZ6A 4WVXA 3NYDA 3A3XA 4I6KA 5HJXA 1NWUA 1J11A 1JCXA 4QG9A 3SBFA 4R53A 3CEPA 1XIMA 3GTIA 3LBMA 1IQ8A 1UD5A 1KM3A 2RHGA 3RGTA 2ALRA 1XRVA 3CAQA 5IDIA 2CWNA 4IGSA 2NQ5A 3GUWA 4GMEA 1BRLA 4O52A 4TTGA 4DHGA 1EHAA 1PUDA 1FWCC 2CIPA 3LTSA 4FZIA 2A6NA 1B31A 3II1A 1KO0A 3GNOA 1TJ0A 4IMCA 4MJ2A 1OF6A 4J28A 5A2AA 2OCZA 4AD1A 5G2IA 2EG6A 3TTOA 3JS3A 1QI2A 3UW6A 4ZB5A 2ZUWA 3SUSA 1M03A 1NFGA 1S2AA 2TAAA 3ARXA 5D33A 3AHYA 2MANA 1GONA 3CHVA 2NWSA 1LORA 1FVPA 3G2GA 3WDQA 3VNZA 5DBTA 3BSMA 5IFTA 1KFWA 2CETA 2C0HA 5AVHA 1FDJA 4EXAA 3I7SA 5A8PA 2V3DA 1XX1A 2WZTA 3ZO9A 2R6OA 4RDZA 1UPPA 3T07A 3H7RA 4QSFA 1KRCC 3M0JA 3WQGA 1H1ZA 5JBFA 2SFPA 1Q6OA 4KFOA 1CGVA 2H9AB 3W6LA 3UETA 4LC6A 4MPQA 1G4PA 2H6RA 4MY8A 1EEXA 3PTQA 4O17A 5FJJA 1J6PA 3R25A 5GPRA 3UVAA 5JIWA 1ZHAA 5H2ZA 3ME3A 1FWJC 4GG9A 4N2YA 2J9ZA 4PEEA 4UFMA 3THQA 3OIXA 5FF2A 8TIMA 3L4UA 5CC7A 3LV6A 2ZA3A 4PUUA 1DTUA 2OZ8A 4DO7A 3T8LA 2E28A 2PC4A 4AEFA 4IJBA 1UP2A 1I45A 3DHUA 1DWFM 4FS9A 3RRXA 5I07A 1ICQA 3OU8A 1RSCA 3LTPA 3EOSA 4Q8VA 1G01A 1CDGA 4B9YA 2GVGA 2FKPA 2PCQA 3BCFA 3GNRA 4JN7A 2CFFA 4FOUA 5FIPA 1AW1A 2VEMA 1FHVA 1XBVA 2ZUUA 1ZBWA 4JAWA 4PCFA 1EGVA 1GHRA 2J7CA 2DQXA 1UUQA 3OJGA 2FYMA 4LPCA 3C2VA 4IM4A 1XL9A 2DZWA 5FOOA 1XQLA 4S3EA 4AH7A 4LS2A 5CZTA 1S2WA 4FXRA 3WEZA 2G95A 3G0UA 1GYLA 4O1AA 3NDOA 5LGZA 5DEZA 4HT3A 4Q22A 2JKEA 2RGMA 3C61A 1HTIA 3P61A 5E70A 1ZCOA 1J5SA 1JRCA 1SUXA 4NX5A 4A3QA 5EU9A 1X38A 4GINA 1UWQA 3W7JA 4ACYA 3OW1A 1QI5A 2B7PA 3MY9A 1KM5A 3KTXA 3FVMA 4MAVA 4ERGA 4GUHA 4D8ZA 2QJGA 3ATYA 1TJRA 3GU2A 1WZLA 4LVBA 3TZNA 4ZO6A 4JDYA 5HXMA 1QOXA 1GPWA 5DXYA 2CPUA 5FACA 2IS7A 3AMKA 2C1IA 4I9JA 3RIKA 4O54A 2FHCA 1T6MA 2Z27A 3IUIA 3QZEA 4NAFB 3VTRA 1LYXA 4L4MA 1ZZMA 1UB3A 3CT2A 6A3HA 1SFJA 4G7EB 1H49A 2A6LA 1LUCB 2Z1KA 4PH6A 2FH6A 3EPNA 3P0WA 5JUVA 4E6MA 3CUZA 1OVDA 4Q8MA 2WZHA 1EGZA 4UNKA 1O5RA 4MF4A 3SCNA 3W7NA 1RA5A 1QNVA 3TN4A 3WJSA 1P1MA 4MUPA 3CIWA 3SQLA 3THDA 3QTPA 2BTMA 5F1VA 4PC8A 4DJDD 4GIEA 3VNDA 3NEVA 4C65A 1I8JA 3MMTA 2UY5A 4ZEPA 4K68A 3GXIA 2YL6A 6TIMA 1XXXA 3DBNA 3QR1A 2RDUA 4HCHA 8CGTA 2FMOA 1ZBKA 4OVXA 1OF8A 1FA2A 2X41A 1K6AA 2WOQA 4Y9MA 2I57A 3FK4A 3CYVA 3DYMA 1ITXA 1OIMA 3M64A 5JMUA 4GHRA 2VD8A 3PB0A 3CHFA 3VNJA 1OG6A 2PD5A 2BVWA 1SR0A 3QYQA 1KCKA 4EF9A 3PZUA 1J0IA 1F8IA 4WHBA 3KOFA 3CXOA 1NFPA 4PB4A 3SCVA 3WY1A 4JQ2A 3ABZA 4C6JA 4AY1A 5A6MA 4BI7A 3CQ0A 4AMAA 3V0SA 4UTIA 5FSDC 1E6XM 1ME8A 5EMMA 4EXQA 5CPNA 5C9WA 1B54A 3THUA 1QWGA 2XM1A 1QATA 1RR2A 2GSJA 1J79A 5MKGA 3MCMA 3W37A 4R7JA 3WX7A 4AX6A 1RCXB 2CLIA 4RR4A 3MWCA 4XKYB 2PMQA 1HX0A 1DE5A 3WUFA 2PF8A 3CMFA 1A0CA 2FZ9A 2VTFA 3IIOA 1XLJA 1GQKA 3HJZA 4JQ4A 3S4TA 2B0MA 2HCVA 4IT1A 3WUBA 1JD9A 4W85A 4RUBA 1QAPA 4TX8A 2D22A 2MUCA 5C0QA 4HMEA 1JPDX 4QCEA 2P8BA 2ZWYA 4YTUA 3FGCA 3G1YA 3W74A 4LV4A 4J7RA 5BRPA 4H9VA 3EXSA 3NCOA 4Z2KA 2WNQA 2ZUSA 2YB4A 4WQ6A 3NDZA 1S1PA 4MKSA 3CQKA 4KWSA 4JD4A 4WJXA 2GPTA 1DTNA 3E5PA 4FOJA 3QSTA 3RPTA 2PRLA 1DJIA 3DBPA 3NA8A 1UH2A 4G56A 3SAZA 3GAYA 3GQYA 4DUXA 3G1RA 4FLQA 4EAMA 4DO6A 1GQLA 4F0SA 3CASA 3NUKA 1TTPA 4H9TA 1UOZA 2J6XA 3QBUA 3VNKA 4CNUA 1RQEA 1CLVA 1JI2A 4GZ7A 3FDKA 3WFZA 1K9FA 1M04A 3KXQA 9XIAA 3WD2A 2F9RA 2YW3A 2OR2A 4KESA 4PGLA 4GPNA 2I5IA 4D72A 1BRLB 5D9PA 3ZR5A 5LNSA 3WNKA 3VGDA 1WO2A 1J0HA 1A5LC 4XG1A 2WSRA 4DNHA 3FLUA 3NVDA 1JDCA 2VZUA 3NTYA 2YJQA 2PU0A 4TU1A 3NO5A 5D05A 3TTQA 2C91A 5FJPA 4KW2A 5E0KA 2BMBA 2W92A 2E4TA 3C2RA 4POCA 4H04A 3QOKA 3CT7A 3CHEA 3B0YA 1MWOA 3K1GA 3EWYA 4UOQA 2FGBA 5M2FX 3WD3A 3UWVA 4O53A 4RE3A 2PB1A 5FF4A 5FEXA 2E6AA 3L0NA 1J0ZA 2V82A 2QJMA 4GJ1A 2GLKA 1BYDA 3FXGA 5CPMA 4GFSA 3VIFA 5LA1A 2ZE3A 2FPTA 3SM0A 3NNTA 3ITXA 4KCUA 3CZKA 1S2TA 1NH6A 1LF1A 1OFEA 5EPDA 4DAIA 1AMKA 1HFBA 3A21A 4X9YA 4S3AA 3G1FA 4FO4A 1KM4A 1HN1A 3BOXA 1CEOA 5LXEA 5HWJA 1QW7A 2VEIA 3HPSA 2Y4SA 3EKGA 2GL5A 1CT5A 3PPFA 1W3LA 4AMCA 2X05A 4HD5A 2YL5A 2ABAA 1YX1A 1KC7A 3S1UA 4I7VA 2A3BA 1PX4A 3NZQA 1LOQA 4K8EA 4XD3A 2EKCA 4ZQNA 1XLGA 3GTXA 1EJWC 5PTDA 1JCMP 1GCYA 4XIMA 3WLTA 3N6QA 3NM1A 1VYSX 5BRBA 4WCJA 4WJEA 3OBEA 3EMZA 4DJDC 1DYSA 4ZL1A 2A1YA 5I3JA 1VYRA 4C6MA 2WJEA 2VZOA 1DIOA 4JBRA 1IGSA 3OVQA 3COTA 1YDYA 1AZ1A 3T0BA 1SJDA 2FFIA 3QH2A 4IMDA 3LNMA 1CLKA 1OT1A 2G5WA 3W2KA 4JTTA 1TMHA 3T4CA 5B7ZA 2D2JA 2HNHA 3LHTA 3S5ZA 2VX7A 3MP5A 4RLIA 4DZ5A 4U2ZA 4JTJA 3QLDA 2NV1A 4S23A 4WDXA 4NP7A 1PKLA 1R7AA 2OKTA 3AQUA 4NUWA 4DF0A 1PV8A 3E9AA 1WDRA 1XPGA 3VGEA 3VAVA 1V8EA 5AY7A 3VZXA 1TO3A 4Y9NA 3WJWA 4H9XA 3BO9A 4X0VA 2HS6A 1RZMA 2FDMA 5I78A 1DJHA 3TU9A 4PL2A 1K8XA 2V9DA 1OGGA 4LUJA 2PDMA 1UH3A 3CO8A 4DUOA 4E2OA 3AYTA 3IRSA 5HMSA 1KWKA 1VP5A 3A6OA 3MVTA 2NSOA 4X9SA 3AMCA 4D1IA 3A24A 3FVDA 4Q4MA 1B3VA 2NT0A 3GXDA 3DFNA 4UTWC 1XGZA 1VHCA 2EQDA 2PGWA 4PTWA 1GW1A 4A8LA 1M01A 2PTXA 3ZVHA 3STPA 5SWUA 3PJUA 4CD8A 1OYAA 4LAMA 4IFRA 1K9DA 3LMZA 2Z24A 2E09A 1PXGA 1G4EA 4O18A 3HTWA 2WCAA 3QC0A 1XD1A 4P61A 5HQEA 1UKPA 4G1NA 3SEPA 5BU9A 2E6DA 1XIIA 1B3ZA 3E3HA 3HPFA 4S3GA 1LWIA 2FTYA 4LF2A 1UR8A 4KCVA 5D38A 1LOLA 3W82A 4D6HA 1A3WA 3GR4A 3K4WA 4CNNA 1UR2A 5CGTA 1V51A 1WZKA 1NOUA 4NYUA 2HVMA 3AIQA 3EDJA 1QNPA 3LN3A 4S3FA 2NUYA 4ZODA 4AYGA 5M5DA 3WUGA 1TE1A 3PBVA 3UD6A 2I9UA 2DV0A 4UFLA 2POZA 2PDWA 1DWGM 3MBDA 4S3KA 2FTPA 5A2BA 1LLZA 3FN9A 2J88A 1MRAA 1GKRA 1T99A 2GOKA 4EVZA 1EBHA 3QHNA 3UJ2A 3UCDA 4UB9A 3DG7A 4PTNA 4FR1A 3A3HA 2D69A 2WLZA 2NXIA 1VIWA 1UPMB 4WGXA 5IHSA 2FFCA 3CB8A 2WWDA 1KKOA 1XICA 1ELSA 2ZADA 3KLKA 1BWVA 3CV7A 4GACA 4KETA 4GI4A 4RNHA 4HSNA 3IVTA 2BXYA 4ONVA 4L6DA 4CVUA 5KZMA 2WHLA 5C9UA 1TTIA 2NVCA 3AIVA 3SCSA 4C6PA 5C7HA 2ZUNA 1A0EA 3WFLA 1DV7A 5I3DA 5A6KA 2V5DA 4MNMA 3B9OA 3GIPA 2CBIA 5JQ9A 3W7OA 3Q4DA 4WOQA 3KUMA 3PF3A 5MKGB 4WUIA 3PZOA 4GYKA 3MJMA 5DCEA 2WSKA 4YPJA 3RPMA 1XIBA 2YFNA 4PEKA 1ZBVA 1WDSA 3EMQA 4W7VA 7ODCA 1WV2A 4QDPA 5DXXA 3NQGA 1YNPA 2VRKA 1YMYA 1TWIA 1LCOA 2VX6A 4XB3A 3WDPP 1ENUA 2P50A 2QPXA 4AEOA 2H3BA 2JGYA 3Q45A 4Q3MA 1EJXC 4GUIA 3UWZA 3OZPA 3D3FA 1U22A 3FGCB 1F6YA 1VD6A 4O28A 3EGJA 3NPUA 1US3A 1K4GA 2DW7A 3NQEA 3UR5A 1H0GA 4LU0A 5F4SA 4GOAA 4B2DA 5HANA 1RK6A 1UD3A 2IPJA 3EAUA 3A47A 1QCWA 1PKNA 2P76A 1UJQA 3TYBA 3F4VA 3LM3A 1W1YA 3PZ9A 1MUCA 4PMZA 3VA8A 3ENLA 3QHMA 3W76A 3TUUA 1W9PA 4EANA 3ZWSA 4NT0A 3TX9A 4JNZA 1JYXA 4NZ4A 1PL9A 1MDRA 1HL8A 4UTUA 4JTDA 4F3HA 3GWQA 3PJWA 1P6WA 2W62A 1JAEA 5C9XA 3DKJA 3AJ7A 2J78A 3T2PA 4CN4A 5EMYA 4CQDA 1NQKA 1ALDA 1EUAA 2F6KA 3FJ4A 5EGRA 5F2GA 1UQYA 4H7VA 1TJ2A 2DQWA 2ISWA 3OBKA 1VBUA 3UWQA 4LF1A 2IPGA 4DZIA 4HSOA 1H09A 1B3OA 4GC4A 4FLOA 2POTA 4DUWA 2VUNA 5D37A 5XIAA 4GJJA 2PUZA 3UXKA 2VI0A 4O19A 1R46A 2RDXA 1XIJA 3VGFA 3VVGA 1E9LA 4AU0A 3ANUA 5G2HA 3H23A 4DELA 1ZAHA 3LRMA 5ABHA 4ASTA 3R0DA 2Z6IA 3VKCA 2CC0A 1BKHA 5BYWA 2DSUA 5EMKA 9CGTA 1QOPA 3LGEA 3IWPA 1KBIA 4YYCA 2Q8LA 3IGXA 2CLMA 1SMAA 3CAKA 3T55A 1L6YA 5G4EA 3UPMA 2DT3A 3QC3A 1BKSA 5CBIA 3GHUA 4LFYA 4RXGA 1I6NA 3B0VC 2YLAA 2EJ1A 4KRUA 4D6CA 5DCBA 4C1NA 1E43A 1J93A 1W8SA 2C71A 3IEBA 4AHQA 3UJRA 3QV7A 4DO5A 4KIRA 4LYPA 3AALA 1V6YA 1QPQA 1IEQA 2XM2A 3DI0A 2JGQA 5CG7A 3N17A 1H61A 7A3HA 3ITYA 5J5RA 1GEQA 3W72A 3HPXA 1H50A 3B9DA 3M6YA 1UWAA 2EPHA 1BXNA 3W1RA 3OVRA 3P74A 4JTQA 4DYEA 1OYBA 4UTMA 3SY5A 4XD6A 4AW7A 3C2YA 2PFHA 2ZZ5A 3N9SA 3SN4A 3KL0A 3QW3A 5G4HC 3WQ5A 3EDFA 3LDVA 3DG6A 3IRDA 3ITVA 3URQA 4W93A 3P14A 2O92A 4S1FA 4TMCA 3MDWA 2DT2A 3A23A 3PK7A 3QY7A 2UY2A 2QCNA 3ARPA 4OGZA 2XIBA 2HEJA 5FCZA 5HOSA 3ELFA 5ECVA 4PB3A 4YN5A 1OB0A 1XJBA 1JCLA 1TB3A 4O10A 1KGUA 4XQ6A 5HUPA 1EEPA 2PLMA 4E4UA 1QW9A 1V6XA 5AOUA 4ICNA 5U4NA 2WANA 5AC5A 3MDUA 4V33A 3PFMA 1Q6DA 2WKGA 1JZ3A 3RK8A 5AC4A 3M44A 4HHPA 2YL8A 5E9XA 2KAUC 5CSYA 3ZJKA 4AF0A 1MQPA 2BY1A 2ZA1A 4DYJA 1WQ5A 2C3ZA 4DBWA 1TPB1 5AC8A 1L0PA 4M6PA 3HU7A 1EQCA 1H51A 2QCGA 4R9OA 4MDPA 4S3JA 2WMKA 2WNWA 1V7YA 3QLLA 1I4NA 4O1DA 4M3PA 4JXCA 5D30A 2PURA 1H1NA 1Y5VA 3KCOA 1AD1A 1ITUA 3I6EA 3MA8A 4B16A 6XIAA 1E51A 3O07A 1PBGA 3GXNA 1SZFA 2ANUA 3LHZA 4JY9A 2QV4A 1TIMA 3V35A 2REQA 4L7ZA 4KCWA 3FYPA 1NELA 1ISXA 4Q4RA 3QJAA 1A5NC 4M0XA 3KZSA 2XSAA 4QTGA 4L4LA 3ZVHB 4PCNA 1PAMA 4UNIA 1BGAA 4IQJA 3E0LA 1XRSA 2WPBA 4C5YA 2ACRA 4KWUA 2XH7A 3VIHA 3G6MA 3O6CA 3JRKA 5CXPA 4MLRA 1X7IA 4NNAA 1Z3NA 1E4NA 1NQ6A 3H6OA 5ECUA 4QJ5B 3HGSA 4DJED 3MANA 3SQSA 4ORIA 1P43A 4EE9A 3GR8A 2RJHA 3KBWA 1RCQA 2VFHA 1A5OC 4JN6A 1UWRA 1AUSL 3EBVA 4RKAA 3MW7A 4AD0A 3B8DA 1B0IA 3DFHA 1V02E 4RXFA 1JZ8A 2C19A 2P3EA 1YXYA 2ZOXA 5DQPA 3VINA 3A64A 4I8DA 2RUSA 1AZ2A 2V5LA 4AAJA 2B81A 4F0LA 3IJ6A 4HTBA 1A0DA 2VEPA 4IPNB 3FV9A 4AC1X 2QPUA 3W1NA 5CC5A 4MPKA 3B03A 3GTFA 3RM9A 3H4GA 1IXNA 1KFEA 1XS2A 2YW4A 4WX2A 1CX9A 2XFFA 4AUBA 5I2UA 2W6RA 4FNTA 4PSPA 2OX1A 4RL3A 4QIUA 4FR6A 4BA0A 1EJTC 4FX6M 1VR6A 5FEZA 4U3AA 3N2OA 4V2XA 2HTMA 3TVAA 1SYTA 3VNMA 1A3HA 2RH9A 3IUHA 4FX7A 4ALDA 4DZHA 1LLOA 2QUTA 4Y9OA 2X40A 1AJ0A 1XD0A 2VDIA 1UR9A 1BAGA 1M7XA 2YKKA 4C7FA 4MNKA 4LOCA 3Q94A 5A5WA 1JF5A 1MO0A 1XC6A 1C8VA 3AIEA 3DZ1A 4LB3A 3BE7A 3BOLA 4NZ5A 1HT6A 4YTRA 3VNIA 1VF8A 2PDGA 4CNTA 1JFHA 1OZQA 2BX7A 3TTSA 1JUEA 2NSXA 3SY1A 3RF9A 5G2WA 3U2CA 1J12A 4QGCA 4LX4A 1E4IA 1UJPA 3AYSA 4S3BA 3FSTA 4PBEA 2R91A 5C9ZA 1K8CA 1F3XA 4HNCA 1SW3A 2OLHA 4HOZA 4JQ1A 1LBLA 5FJUA 3TTYA 2DGAA 3WNNA 3WLIA 5CZJA 3LQGA 2P88A 1HJUA 3TLLA 1J2WA 3BGJA 3OGRA 4L9ZA 1I1XA 2EBNA 3NPWA 3C0SA 1M3UA 3C0QA 4B3ZA 1P0NA 4TX6A 1ZJIA 3KP1A 3G1XA 3UCCA 3R0KA 3S5NA 3KVJA 2BVDA 1EZ2A 3NQVA 1W9VA 3T09A 1ISYA 1P1XA 3QMSA 1EP1A 5T8GA 1A5MC 1TIWA 3O6YX 3GG8A 4Y8FA 2JALA 3W28A 1Z7AA 2HJPA 4PTMA 1HJVA 2J7DA 3GW0A 3WNOA 1PIIA 1YBQA 3IS4A 5CKSA 3D0CA 4MYAA 3TN6A 1KFBA 4V1XA 2E7FA 3B4UA 4UR8A 4DF1A 1WKYA 3WMBA 5BXPA 4LBRA 5JIPA 3CTLA 5CBBA 3BVJA 2O9RA 3LCXA 2YPIA 3LCIA 5C54A 3FKRA 2WHKA 1JCYA 2C15A 3TDFA 4YLWA 1UD4A 1BPLB 1UR1A 1DQWA 1E9YB 4XZ9A 1V3KA 5EY5A 3RN6A 3W1LA 3VOCA 4M6VA 3R0UA 4D8AA 4JNMA 3LS9A 3M0LA 1H3GA 4PCPA 1LDCA 3UT0A 1ML1A 5C6MA 1J2BA 3WELA 4MSSA 2VKZG 3LPPA 4TO8A 2OZTA 3ZZ1A 1O12A 5KSWA 1G1YA 1TPH1 5I24A 3MMDA 3VMPA 2EO7A 2V5JA 4OV4A 3KX6A 4EACA 5IM51 1WDDA 2VEKA 1O5XA 1O68A 2ZX8A 1HUVA 1BF6A 3RU8X 1QMLA 2CXEA 3R4IA 4MMWA 4Z2HA 1L8NA 1QDSA 3QMRA 3WK3A 2NQJA 2FLIA 2PBOA 3QZ6A 3NYZA 1A5SA 1FHLA 3DI1A 4F8XA 4GIRA 1NOFA 4C1KA 2XG9A 2DVUA 4JTLA 1ONWA 1XDJA 4HP5A 5REQB 1P5BA 4JOMA 4QHRA 2WZEA 2E0PA 1XLMA 1RALA 3ARYA 2X2GA 3PBUA 4AWEA 3OPSA 3W1UA 2P5NA 3VIIA 1QUMA 1KCXA 1K7EA 1GG0A 4ML9A 3ZXWA 1UR4A 3NSXA 2QIIA 2Q8XA 4ZR8A 1LWHA 3MYPA 3V0TA 5H8PA 3DX5A 5LHEA 5D8WA 1QNSA 5A6JA 1QOQA 3T78A 2FVMA 3LLXA 3NL2A 2VCBA 4JN8A 2ZZ6A 3L4WA 3N13A 4AWTA 4V15A 2PWEA 2C6QA 1KLYA 1GK8A 3TTEA 3NO3A 2W91A 4J3ZA 3RMEA 3L66A 4RX0A 4H2CA 4DJEC 3S1GA 3GVRA 4HPHA 3PPGA 1NY1A 4RE2A 3SIMA 1ZP4A 5FA5A 3WF3A 2CZDA 1E1CA 3LBOA 3AI0A 1CYGA 1JRBA 1SM9A 2VC5A 3W7QA 3O0FA 1THFD 1DIKA 3BGGA 4JTUA 4B91A 1OABA 2GFTA 4KERA 5H1WA 3UVIA 4DQWA 3NSNA 2AGKA 5I6SA 1IIGA 1FDYA 5I79A 4LYQA 4J3XA 3R43A 1HKKA 3WMCA 1AQMA 2QUNA 4QROA 4AF0B 3LLFA 1ZAJA 4HU3A 3N4AA 3DENA 4MKVA 2XHYA 4DY1A 4CCZA 3W1MA 4J5NA 2DSVA 4MY1A 1EO5A 3BG3A 1M53A 2I5GA 2PLCA 3RO6A 3RX4A 4MNLA 3FA3A 3W29A 1XLLA 5H8UA 3RJXA 3OYXA 1H60A 4Z2GA 1VJIA 3S83A 1KBKA 4D9PA 2Q01A 3K8MA 2Q71A 4JFSA 2ACQA 2Z1WA 2D0FA 6XIMA 2QAFA 3TOPA 2A2IA 1JCTA 1EWEA 2REQB 4S38A 3W73A 3HMCA 2WQPA 1TZ7A 1H41A 3WLQA 3NPVA 1GT8A 3L4TA 3SN0A 5IBXA 5D09A 3M9YA 1EO7A 1F05A 2EPNA 3O16A 3C5QA 2X16A 4KMQA 4MLJA 1BD0A 2PDUA 2F6UA 3THAA 3U7BA 4J3WA 4QDMA 1Z69A 2QV5A 3W7EA 3INPA 3B04A 3M43A 1JZ6A 1LWJA 2VOTA 4H9YA 2ATSA 3GNDA 1H0IA 2VYOA 4JIRA 3WENA 4PA8A 3N6HA 4WD0A 1W1TA 1PZ1A 3FCPA 4Q4SA 4KQNA 1IT0A 3VO0A 2Y8UA 2PP1A 1W37A 3M0HA 1QWKA 4AIUA 1KTBA 1XCXA 3ANVA 5DY3A 3VIKA 3SFWA 2Y7DA 4XV0A 3BJSA 4UCFA 4U31A 4U4MA 3CB3A 3FW6A 3R10A 4MYXA 2AMXA 3W9ZA 1BXBA 1GZJA 3IIVA 4FLSA 2PTDA 4L1GA 3W3OA 3RPDA 4Y9AA 4HMNA 1TWDA 1LROA 1XG4A 5AZ1A 1B3XA 3AZSA 3WBWA 4LVFA 2XIMA 4A3YA 4BI5A 1KGWA 3NQ6A 5HJYA 2CBJA 4UFKA 3N73A 1TVLA 4DI9A 2VCCA 4I9TA 5F1UA 3IVSA 3M4HA 2P10A 2PZ0A 1ADOA 2BOFX 3NQ7A 4R27A 1X1NA 3CTTA 4UOZA 3E5BA 2NUWA 4O1FA 1PS9A 3WQWA 1JGIA 3E2SA 5FJIA 3S1WA 1GEHA 4GX9A 4Q33A 2RJGA 1H7OA 5CPSA 3AU2A 2QDEA 1WKDA 5I77A 1YNYA 3BDKA 3LRKA 1VBRA 3O6DA 2FH8A 5C2CA 2FZMA 1LM1A 2WCSA 3H2OA 4A8RA 3NR0A 4PCTA 1S5TA 2BDQA 2GQ3A 2ZRVA 3ZFHA 4HSHA 3AYRA 3PP7A 5AC7A 1RH9A 5HNTA 1V6WA 3BMWA 3GYCA 2CLLA 5D32A 4QG6A 5AN7A 2QMJA 2Z26A 1H2JA 3G0XA 4XAGA 3VC5A 1XPYA 3HGRA 3HV9A 2O4MA 4UUIA 1R2SA 4E5TA 5LXXA 4ZTXA 1UG6A 4UQAA 2XIIA 1XH0A 3AJXA 3H2MA 3B8WA 1AJ2A 1FWGC 3S2NA 1VRDA 5CSUA 1ICSA 2CEQA 4AVOA 1EJRC 1FHDA 3PFRA 4DEFA 3EMCA 4GE8A 3FDGA 3WLLA 4NG3A 3S5OA 4EKJA 1K7FA 2CERA 4ZO9A 4QS5A 4I9MA 4JTRA 1RPXA 4BFAA 1OD8A 1BQCA 5F7UA 1O1ZA 1TTJA 4MZ8A 4OBRA 5AYXA 5DCDA 1SQ7A 2Z2UA 1FHUA 4DX3A 2GWGA 2NLIA 2PS2A 2CZVA 3R8RA 5IBXC 2BGSA 1YBQB 3OYZA 4CQ9A 3PTKA 1VYPX 5GJMA 1US2A 3GUGA 4YYFA 3GNNA 1I60A 1NDWA 4L4OA 3OQEA 4MB3A 4Y96A 5D2XA 1NVMA 1NWRA 1Q7QA 4BZYA 3E2QA 2E9MA 3RCYA 3SB0A 4IMAA 5G5IA 4ZB0A 5CGQA 3PUDA 4P2VA 3KVMA 1PX3A 2PLKA 1LL6A 4NU7A 4DXVA 3M5XA 2BOEX 3FJLA 7TIMA 4YCOA 3RX3A 3AU6A 4L80A 1GKQA 1XH2A 2R1MA 2OKOA 3KHDA 1UW9A 4G5DA 3MC5A 4F66A 3HQOA 2VFGA 4HOXA 1TTQA 3W26A 3MYOA 3N2CA 4EPKA 4DWSA 4EPDC 2IW0A 3FSUA 4NZFA 4IMFA 2J47A 2G37A 5KITA 4YS1A 3W38A 1UMLA 2DY3A 3JUGA 4NQ1A 3VNYA 3PS7A 2OELA 4OECA 1TCMA 1Z8AA 3RU6A 1GJUA 5U7SA 1TV7A 1Q6LA 4C6NA 3EX3A 3EDKA 1XI3A 3PSWA 4HCDA 2ZA2A 3GW3A 4NY2A 2QEZA 3KL5A 1KM2A 1EDTA 3VX0A 2W0UA 1BTMA 5TNVA 3ZT5A 1D9EA 4L6HA 3BZJA 3QVQA 4GVFA 4ERAA 2YSWA 2XVKA 7TAAA 1CLXA 3TQ0A 1OHLA 4L9YA 3SW6A 3GVGA 4PYSA 4MAZA 2GJNA 1W1B1 1HXJA 1B5TA 3MP3A 3FYYA 4HNNA 4QQUA 3DAQA 4N7QA 4Z2JA 3S5SA 5IOBA 2WC3A 3GY1A 1W1VA 2E40A 2WBGA 1IZKA 2Y70A 4ZMGA 4E8GA 2QJJA 1FWAC 3VDAA 4R85A 3DHPA 4C6DA 3A22A 1OC6A 1WKFA 4LS0A 3S8HA 4E2VA 4JCMA 1G7VA 3AS2A 1UR3M 3KRSA 4G9PA 3C86A 3NAVA 4X3ZA 4C90A 1OFAA 2IQTA 4FNPA 5TBOA 3KRUA 1CGWA 2G41A 4PUNA 1XBXA 4B3LA 1E6SM 1JAKA 1E1CB 1I0DA 1X8CA 3FY1A 2VEGA 3O2LA 3S2JA 5E1QA 1R9YA 1BVNP 1TPEA 2E9LA 3E74A 4B15A 3KOWA 4JKLA 3WBAA 3AHVA 3CHDA 1PTGA 2QUMA 3FEQA 4YL2A 1MW0A 3UYIA 5IHRA 3BG5A 3PZNA 3TAKA 4EPBC 3BW4A 1XYLA 3PWIA 5TD4A 5I5RA 1FH9A 3SR7A 3O1NA 3OVGA 3TIMA 4H6EA 3AMLA 2O7QA 3SCWA 5A94A 4L6OA 1TRDA 2IKGA 4M7SA 1PIFA 3WQPA 4XZNX 5EBAA 3AO0A 2XN1A 1AA1B 2NQZA 3RJYA 5KZDA 2ZDRA 3UG8A 3M6DA 3UR7A 2G97A 3KBJA 2PDLA 3UR8A 1W2PA 3MUY1 2PTWA 5K9CA 3KVKA 1HJQA 5AECA 4U5IA 4H9MA 2KZHA 2PDCA 5LIUX 3VCRA 4MADA 3U2OA 1XFBA 2VFDA 3SGGA 6CGTA 1V3LA 4LVGA 3B05A 5EA9A 4ICCX 4CVWA 3TOYA 1VBHA 2CBUA 4DXKA 3KS6A 4H41A 1BEUA 3MUAA 2J7FA 4LCSA 5D9OA 3G3DA 3W84A 4XZLX 3SRHA 3L0KA 2GJLA 4DB7A 4KRZA 4PODA 2V8ZA 4S3DA 2WBKA 5D2WA 3E96A 2HVOA 4DI8A 5CAHA 3GG7A 1SSGA 3WNMA 3KM8A 4C5ZA 2OO0A 4GYJA 1LP6A 4JYDA 1RBOB 1NJJA 4J3UA 2Y63A 2VC9A 2L5HA 4D6FA 3WH5A 2HISA 1P0BA 2OQLA 1IEIA 2CLEA 3G8RA 1LRQA 4XBKA 3UJSA 5HNUA 3S9IA 1XW8A 4PULA 4IGHA 4JQAA 2XISA 2YL9A 1R2RA 1W54A 4KGLA 4CGTA 4QDWA 1RJPA 2IKIA 4WSHA 1FCVA 4R5EA 4XK2A 1AH4A 3H55A 2DZSA 3W00A 4UZUA 1GZ1A 1LOSA 2PDFA 5EYWA 1UA7A 4JTCA 3B8IA 1HP5A 4NI3A 3UU0A 4UTKA 1R3SA 2ZRYA 3APTA 2Z2AA 5JBEA 2WKJA 2ISVA 1J0JA 1E3XA 3W23A 1HKWA 3WJXA 3SCTA 3D6NA 3IJIA 1Q6CA 1K02A 4DZAA 3AWNA 4PUKA 1MEWA 1ZJAA 3WF2A 1C8YA 1V77A 3M0ZA 5TAOA 1Z6KA 8A3HA 1K9TA 4JDBA 4AD4A 3CZJA 4XBSA 3DFPA 1GJWA 4H7ZA 3UA4A 4Z17A 3S46A 1OC7A 3D47A 3GDBA 2Z29A 3GO2A 4UMAA 3DFSA 1TJPA 4XAZA 4JYEA 3YPIA 3NPXA 2PWHA 3FHAA 4H6RA 3OODA 2ABBA 5DY2A 4HNOA 2HXUA 3WD4A 4F40A 4BWLC 1ZRQA 2HWGA 2QIWA 2EKGA 5F4WA 3VD4A 1US0A 4GXMA 2D3NA 3L7RA 2Q3OA 1KM6A 1MUWA 4WY0A 3URNA 1UKQA 3OBAA 3VNLA 4IIBA 5C2XA 2YGYA 5DBUA 3CUIA 4XAPA 3A4AA 1OQFA 5BRQA 3EOEA 3HN3A 2ZYFA 4ATDA 3R5EA 4PMRA 4TXEA 1OGSA 3VD9A 4BF7A 3TWAA 1O5QA 3WQFA 4ATLA 1Q6RA 2QDGA 4B5SA 2YCEA 3BAXA 2GVJA 1JEZA 7XIMA 3ITLA 1KBJA 3ARWA 3TR9A 4JTKA 1XLKA 1H7RA 2J13A 3WD0A 1HL9A 2VGGA 4GVGA 3F2CA 1WAUA 1TA3A 4WDTA 3V75A 1G9HA 1GYNA 2PCEA 4O1BA 1PYMA 4BR1A 5IFPA 3TONA 3PBWA 5I7GA 3VFLA 1R38A 5BROA 2G3NA 4Z2IA 2G4JA 3MO7A 1FCQA 2V67A 4V27A 4N9BA 3BAIA 3EXTA 2HE8A 1XISA 1QTWA 4CD4A 4E38A 3BAYA 1X1OA 3GC4A 4C7GA 3MSDA 4QSHA 1R3YA 3T05A 4CQBA 3B0UX 2V3GA 4R33A 5A2CA 3C8FA 3BAJA 3E49A 4NIRA 5E5CA 3LXCA 1D8CA 3A13A 3OG3A 4IP4A 5I3GA 3BK0A 1OJXA 1AH3A 1GGOA 2ISFA 5AYBA 4RCXA 3T9PA 3I68A 2QXWA 4LCQA 1ZL1A 3DC8A 4H2HA 6ALDA 2FJKA 1GTHA 2XZ9A 2PI6A 1C91A 1DP0A 4Q6JA 4Q8PA 2O56A 4KH2A 2GQAA 3W88A 5C2GA 3CO4A 3R94A 4M8UA 4QP0A 4JFVA 2O0TA 3M16A 4DWSB 4XISA 4GXPA 1DOSA 5LHFA 1G94A 3PUGA 1M6JA 1EBGA 3H24A 2G50A 4MB5A 3E0WA 4D2JA 1UZ1A 3ZIZA 1B30A 1HNYA 1X7FA 3C0LA 4JR5A 3MS8A 3N14A 1HGWA 4LUYA 4Q32A 4PE8A 1KFLA 4RDYA 3C2OA 3SCUA 5FL0A 2VCAA 1PZ0A 1YTDA 2ZZ2A 1WCGA 4AQLA 2P3ZA 3A4JA 4LV9A 1UYQA 4Z0JA 1PTDA 3C56A 4NHVA 3WQDA 4DWDA 1SZRA 4PCSA 2J9YA 1EC8A 2CXGA 4NZCA 4IQEA 3KRZA 4CN6A 2QZRA 3K46A 5D2YA 4AHOA 4ZENA 1G7UA 4YHEA 2YDAA 5GJNA 5C7VA 4ZOBA 4YWIA 3M46A 3L67A 2BY0A 3NVTA 1SZGA 4CQAA 4CN1A 1NTHA 3CM4A 4LVDA 2HPIA 3PZQA 3GHRA 4EPEC 3NEHA 4L64A 1PCKA 5ENLA 3RYSA 3R6IA 1LT8A 5HULA 4CU7A 2Y61A 4DJFD 4QFUA 3AXMA 3ZMRA 4IL2A 4GI6A 2JF7A 2FZNA 2YA2A 1ZP3A 3MI2A 2ZIDA 4EWND 1TV4A 4GUJA 4BEUA 2YOCA 3O63A 1JZ2A 4GWEA 1FQ0A 2W3ZA 4P8XA 3UF9A 1TV3A 1SO3A 4LUTA 3UNTA 1GVYA 1L8PA 5BMWA 5BW6A 3PN8A 4FF5A 5D9MA 1C7TA 5CPOA 3ARUA 5I00A 4YU1A 5B80A 3ID7A 3KW3A 5K7JA 3C8NA 4RV8A 3HZ3A 1W0MA 4E8DA 1VQTA 4YVPA 3QZAA 3D5HA 2GGGA 1CB7B 3AMDA 2WJZA 3TEVA 3N25A 2EJAA 3ZJ6A 4MZ1A 4HU0A 4IP7A 2PF0A 3WUEA 2E67A 3H8AA 1XIGA 3BLIA 4HZMA 1XP3A 4XZMX 3R2GA 4AZCA 2Q8ZA 3I3DA 2ZX7A 5BXTA 4W89A 3LK6A 3B9AA 3VD5A 2WXDM 2OLSA 1XG3A 3NQCA 4EWJA 1DJWA 3EWUA 5BMXA 4CU8A 4HKPA 5C5YA 5AHIA 4B90A 2ZC1A 5FEPA 1Q6EA 3DEQA 2GGJA 3P60A 1F2JA 1YPIA 1TJ1A 3WJYA 4GH1A 1O60A 1RUSA 5EFDA 4R3UA 3CBWA 1SJCA 4WOZA 4XSLA 3HQ1A 4Q8OA 4S2BA 4MWAA 5FSEC 1GNXA 5KMYA 2QT3A 3VU2A 2CZEA 2XINA 3WQEA 4US5A 3CUFA 4CQ8A 2XN0A 3NZ1A 4XO7A 2DW6A 1XRFA 4F79A 4LRSA 1R6WA 2PDIA 1KGXA 1S5WA 4IMEA 3N04A 4HBKA 1TG7A 4RNFA 4M80A 2YXXA 2ZXAA 1RAKA 1JULA 3GC2A 3GLCA 1XH1A 2QLYA 3H22A 3GG1A 2PA6A 3P80A 3KTCA 2VFEA 3TMQA 5LNWA 3W7KA 1SFLA 3ALGA 1DWHM 2EF9A 3DGRA 3N18A 3ANYA 1EF2A 1JQXA 2R1KA 5AHLA 3OP2A 3W75A 4GIYA 2PBGA 4S39A 3T4WA 3UERA 1RK5A 3VM7A 3OHMB 3O15A 5LYRA 1RP9A 1XLBA 4N42A 3RCNA 3EWWA 2FJUB 3U57A 3I6TA 4NJHA 4BEQA 1GWJA 4C6OA 1Q63A 4IXHA 4YTQA 3AIRA 2IPWA 3IVUA 4GXWA 2X1IA 5FAJA 1PEZA 3F7JA 1NP0A 1XUZA 3P5YA 3WLKX 2Y88A 4ZQOA 4JTEA 4DPQA 3M7WA 1TR9A 3B8TA 3G1SA 1DXEA 2AL2A 4A29A 4C6BA 1MRQA 3LLDA 4UFIA 4UQEA 3TYCA 1P6CA 2QMKA 2DZPA 3KBMA 3MJYA 2XVPA 3S2LA 4BHYA 1PKMA 4DO4A 4F4RA 3ES8A 2YYTA 1FCBA 2OT0A 1EF3A 1HGYA 1KQZA 4WY0B 3V4BA 1Q45A 2JEQA 3IIPA 1XYFA 3KEHA 3LMYA 2DT1A 4HPGA 2P0IA 4L56A 4XWUA 1IHIA 4HHMA 4WSKA 2QDDA 2PGEA 4HNLA 5GNYA 2WSYA 2UY4A 4ACZA 2ZFAA 1J5TA 2C18A 5CC6A 1S5VA 4I90A 4Z08A 3U2ZA 1CBGA 3W2MA 3WK1A 5A1AA 1QO5A 1ZAIA 4M1BA 1VEPA 3QXBA 1FWEC 1JPKA 3P2VA 5TQLA 1JVNA 3TQKA 3KZPA 4JIEA 2YDQA 1F73A 2JE8A 1VFOA 1TA3B 4A6GA 1RV8A 4XTIA 3QR0A 3HO8A 4MWAC 4ECLA 1MXDA 1Y5WA 4W7UA 2W66A 2I14A 2ISDA 5M17A 3M0MA 4OOUA 3LUTA 4BS0A 3N29A 1MEHA 1EC7A 4AWUA 3LB0A 1V3JA 1X6NA 4NX0A 1TQXA 1XYZA 4PUDA 1W5MA 3AICA 1XDLA 1DBTA 1PHWA 3GIQA 4YVVA 5CLWA 2NX1A 1E9IA 1VC4A 1I2PA 1RVKA 4HN4A 4YNGA 4DJFC 1ECQA 3IANA 4QNWA 4ZSTA 1FRBA 2YDRA 2F84A 3EX4A 1TFVA 5I02A 4I5XA 4JZ5A 3QRHA 2Y0FA 5C71A 3WBEA 3N9RA 3PSVA 3SQMA 4B4HA 3UEQA 4LT9A 4R7WA 1T5AA 3PAOA 2VMFA 3UWYA 2GGHA 1A50A 4IOTA 3C4UA 3B97A 4EXBA 1QHZA 3HV8A 3HG3A 1NOWA 4OWGA 3K4DA 1U5HA 4WZHA 3MI3A 3CZEA 2RDTA 1W3TA 1B4EA 1EGMA 4MUZA 3QMTA 1JXKA 2VZVA 4J1OA 2ON3A 1BSLA 1B4KA 2FMNA 2X0HA 3TWBA 3AIWA 1AMYA 1V0NA 3ARVA 4F0RA 4ICMA 5DMLA 3N2MA 1X97A 4J2MA 4ZXLA 4UFHA 4AD5A 1BYAA 3GSMA 1XM3A 3CNYA 3BC9A 2ADAA 1R7OA 1VJSA 5HJLA 3IUDA 1JPIA 5J8LA 2YZRA 3G24A 1CXIA 2VRQA 5HWNA 2BHYA 5HPOA 3OIHA 4CUCA 1UASA 2PDJA 4JFTA 5ABTA 2IQDA 4IG2B 3U5UA 2QCDB 4XVDA 3SURA 2CW6A 2PDPA 2C16A 4QXIA 3RMJA 2F2KA 1EYEA 2V2HA 1XYCA 4PMDA 1HQTA 1EL3A 1ADSA 4IFOA 5AHFA 1WDPA 3QY6A 5AVNA 1CCWB 3KBNA 4M5PA 1MZRA 3VE7A 2XFWA 5HQMA 4GQGA 4AY8A 3VFCA 3QGAC 4L5ZA 3ITOA 1E1EA 3L0GA 3PNUA 3NXFA 1A5KC 1F7BA 4GVHA 1OFBA 3PJTA 2IKHA 2QJIA 3IAQA 1NWTA 1D7KA 1VRXA 3N9KA 1VS1A 3OQ8A 1OFOA 4UCGA 2PRMA 4GY1A 4MVAA 2VM8A 1TPDA 2CLKA 3G6LA 1AD4A 3XINA 4AISA 1WXZA 4WF7A 3DFOA 6REQA 3ZWTA 1FP8A 4DBEA 3LZ5A 1A3XA 2I16A 4LUTB 2YYUA 1GOXA 4FNSA 4HVXA 3QGVA 4H8NA 3JZEA 2QNEA 1W1A1 1UZ4A 3KBVA 1FX6A 3H54A 3M0YA 4CCDA 1TV8A 5D03A 4FNQA 4BQ5A 3NQFA 2GSHA 5DX7A 2TPSA 4FXJA 3KVLA 2J4GA 1F8MA 3CPUA 2RDWA 3I65A 1EKOA 1ZGDA 3PZVA 2QF7A 4AZCB 5LA0A 2VEFA 4XX6A 4GO8A 2DPEA 2XIJA 1O1HA 1S39A 4OOZA 1W3JA 4GGBA 2PDQA 2VJXA 3PG8A 4GISA 4KKXA 1J0YA 1V08A 3GDTA 1OT2A 4JX6A 3VDBA 3CL8A 3FNDA 4IUGA 4QE5A 4XD5A 4IFKA 4AZ5A 3KAOA 3U4AA 2Y85A 2VHLA 2Y5JA 4TVUA 1ZALA 3PJXA 1QW8A 4DUVA 2WKLA 2YCJA 4OE7A 2Y1HA 3E02A 3FOKA 3VGHA 4K36A 4N4QA 2V6AA 4GYPC 2Z1BA 4G2DA 4C6CA 1KXTA 3SUUA 2OWXA 3BJTA 1X98A 4A05A 3GM8A 4JTSA 4MNJA 1XLHA 3AXXA 3R13A 4Y6GA 4DJDA 2Z7KA 2JKAA 4ZQRA 1NU5A 4NILA 1PZ2A 2ICSA 5T9BG 5I23A 3GKFA 3LCLA 2JF6A 4P7LA 2BY3A 2XVNA 5BOFA 3W1XA 3BMVA 2DZVA 4MG4A 3FIGA 1R9XA 3VOHA 3IGUA 3TE9A 2UBPC 2E3ZA 3STCA 1D3GA 1DQXA 1S2VA 4O0QA 3PZMA 1W3KA 2G3JA 3QV8A 4UMCA 2FB2A 4F48A 2QCLA 3USZA 5GNZA 4OUIA 4GQRA 3V16A 2VDGA 4KT2A 3EWXA 4K39A 3T2QA 3HG5A 1OFDA 2A3AA 1TR1A 1GOMA 1WZMA 4LAKA 4NYYA 4O1EA 2XWDA 1QVBA 4JTGA 2OWWA 3T6CA 1K70A 1QI4A 1C29A 3HBLA 3W2UA 1E5NA 3L68A 3OLGA 1M9HA 2QCMA 3LRLA 4WDWA 4QE4A 3H21A 4HA4A 4UTWA 3BOFA 3APYA 1W31A 2CHOA 1H5YA 2OXNA 2E5DA 3EA2A 2AL2B 3PY2A 1FKXA 2HK1A 5HATA 2A5HA 4QCFA 2R1LA 2ZX5A 1NARA 1EX5A 3DHFA 1CI1A 4TR9A 3GVVA 1IEVA 2G3MA 1Z42A 1LZOA 3S9ZA 1PCWA 3N6JA 1M1BA 4UTTA 1XKJA 3GFYA 4FAMA 1E6RA 5J04A 1EP3A 1LQ2A 3ABRA 2W79A 2INZA 4FF7A 4WGHA 2Q09A 4WEVX 3W6YA 1XLCA 1CPUA 1QJWA 1D3CA 1MMFA 4A22A 4BY3A 4C6IA 3QW4B 2WHJA 3AHXA 2DIEA 1S46A 4IPPA 2F6XA 4L65A 4X22A 4MHBA 1GQJA 1K7XA 2J7BA 5HR6A 3W7DA 1JPHA 3KE0A 1TUXA 2UV8G 3S6TA 3VKBA 2VXNA 1YEYA 2V0TA 3L2IA 3T2OA 2DSKA 4DPPA 2PPGA 4B5WA 2Z4GA 4XUGA 3EB2A 3RG6A 3SY8A 2V3EA 3BLEA 2O7SA 3ZVIA 2WCGA 1GTEA 2ACUA 2ZZ3A 2YCLA 3NXLA 5AC6A 4LEFA 3WK0A 3P0XA 1BF2A 3P62A 4GCXA 1L2QA 4FX8A 4XD4A 1CECA 1NDVA 4NZ1A 1VBGA 3CMGA 4LWWA 3NGJA 3IAPA 4QJ4B 3R1ZA 2HDJA 4U3CA 1YDOA 1BYCA 4EAYA 4LBUA 2W67A 4FLRA 4B5VA 1GPFA 2YBTA 1SO4A 2OEKA 1PO9A 3B8UA 1S2UA 2DFAA 2QF8A 3EKZA 3H70A 3RLUA 2X1TA 4LQ1A 1YRRA 4MFEA 2DH3A 4N6FA 4LRTA 1MVYA 1UP0A 2GQ9A 2EEXA 3WEMA 1C92A 3ZJ8A 5HINA 3QM3A 5D9NA 8XIAA 1GYMA 3HF3A 3TSDA 1P0DA 1VCFA 4RZ4A 4FA3A 1CTNA 1XF0A 3E1F1 4JY8A 3K13A 2PSNA 4FMVA 1C3FA 3P8JA 2YXGA 1MQRA 1ISWA 4Q7NA 3ZQ9A 3EDEA 2BLEA 3QYSA 4PL1A 3MSYA 4XKMA 5HQLA 5JH1A 4KPLA 3OLDA 3WLJA 1NEYA 2VO5A 3B8VA 3RRAA 4Q8TA 2GVYA 3UESA 2HVNA 2BVTA 3VOFA 3LG3A 2NW0A 3H2AA 3BAKA 3TW6A 1ITCA 1RLDA 3MTWA 2XFRA 3WQCA 1J18A 1DHPA 1QO2A 2EGZA 1W5QA 3GXMA 3LU2A 4AY7A 1UC5A 1LL7A 4AVFA 3QQWA 3SUTA 4C91A 1DXIA 2FVLA 1UZHA 3B40A 2XZ7A 3PBMA 3CC1A 1OIFA 3ONCA 1PWMA 2NQHA 2YFOA 4OBTA 3T08A 1FXPA 1KM1A 5E09A 1M7PA 1M7JA 1OX5A 4MIMA 1DWIM 5KETA 4UTTC 3DIPA 2AGTA 1E9ZB 4AX7A 4EK7A 1FWNA 1IXPA 1G5AA 1VENA 2YB1A 5IRPA 4I5RA 3RCMA 2ASHA 1GVEA 2DT0A 5BXSA 3OEXA 1YNQA 3SSJA 5GQBA 3FYOA 5DT5A 3CHCA 4GC3A 1LRTA 4QRNA 2NX9A 3T1GA 3W2LA 4GNVA 2V81A 3OGVA 3TYUA 4L61A 4YMZA 4ADSA 4J2PA 1A49A 2A3HA 1O7AA 4H19A 4L1WA 1NWSA 5LNVA 2VFFA 3DYOA 2PDHA 1TVPA 4ERIA 1UMYA 1OM0A 4ES4A 4GNJA 3SECA 3NOYA 5HA7A 4FXFA 4ZCWA 2OSXA 3GAKA 3AC0A 1GHSA 4MJ4A 4A8NA 4XUYA 1NDYA 2GJXA 2PGFA 3DU0A 3OZMA 4W87A 1SZNA 5M3WA 2I7GA 2J24A 4HPJA 5BNKA 2NQ9A 1TWWA 3GE7A 1POJA 1KLZA 1EXBA 3WLSA 2PDYA 2GUBA 4G7EA 1UKTA 4N6EA 2GVEA 3H12A 1LUCA 2PAJA 3PPCA 3U3HA 2O9PA 3IJ9A 9XIMA 4CNSA 2CZFA 3FKKA 4O13A 2KX9A 4LSBA 2Z7GA 5A3HA 5CZKA 3MSGA 2NT1A 3UZXA 3VKAA 1L6FA 5A6SA 2D20A 3TN5A 4P8UA 5HMFA 4LUSA 3WLNA 4MB4A 3WDHA 1H7NA 2Y5SA 4OFCA 2CWXA 4N9EA 4Z1DA 3VI2A 3PVFA 1UD8A 2OEJA 1OINA 2P8CA 4IIHA 1VFLA 1GVIA 1O4UA 3F4NA 3HIJA 5FAGA 2CKRA 1S1RA 3TXVA 2OMAA 1AJZA 1TX0A 3P3BA 3SGUA 2ZZ1A 4ZVJA 3MZ2A 1VIZA 3KOYA 1EPVA 4PZVA 3BSHA 1RLCL 1ZSXA 2QQ6A 4ZOCA 3A12A 3NSMA 2CITA 3A5VA 4GQBA 4B5XA 4Q8NA 1MFUA 3W87A 5H91A 5H8MA 1CXFA 3WH9A 1KQYA 5FJRA 4FB7A 2XSXA 3GC5A 1H7PA 4K1WA 1FWBC 2W4XA 2O9TA 4H8VA 4NVTA 5A6AA 1CW2A 2HQAA 3ARZA 4RK8A 3GDKA 4UC5A 3WQ4A 1EIBA 1R0MA 1OWQA 2EG7A 5HK4A 5C9RA 3ARQA 1VZWA 2VELA 3GHSA 4F0HA 1N8FA 4FSAA 2DUXA 5G1TA 3EEZA 3U9IA 2PDKA 1VPYA 2DORA 5CQ1A 4HZ6A 1NAL1 3VUSA 4YJ5A 1UP3A 1A5CA 4LNCA 4W5UA 5C8BB 3BCJA 4BQ2A 5A69A 1FCUA 2JBMA 2I9EA 3ABXA 3NFUA 4KF1A 2VR2A 4KEZA 3AS3A 1OX4A 1Q4NX 1O6IA 3NDYA 4RZ5A 3SJ3A 4GIAA 3UG5A 4KWVA 4Q7BA 1G4SA 4K2SA 2PTYA 3QGKC 3URAA 3NZPA 1EWDA 3E12A 1VEOA 3BH4A 1ODUA 2H90A 1F3EA 2PEVA 4W7WA 1XYMA 3LXAA 1OZMA 1I9CB 4RNJA 5FL1A 1POKA 5G1YA 2J8TA 3TV8A 1KFJA 2GJRA 3QSRA 5IDZA 1BHGA 1KFKA 4AXKA 2R8WA 3DERA 3GG0A 2YDSA 1FFQA 3L21A 3TROA 3J7HA 1F9CA 3CZLA 3G0SA 3EPOA 1YQ2A 3BURA 4RE4A 3WQVA 2CLFA 2ZX6A 2WMGA 1JQVA 1KTCA 1X8FA 3QPEA 1ONRA 2ZVIA 2EAWA 3MHFA 3BLOA 4H8UA 2EHHA 2YXOA 3Q58A 3WG6A 4OQVA 2ZX9A 3WDIA 1VFFA 4M6QA 2Z25A 1X1ZA 3IJ8A 1TV2A 4GA8A 2J7GA 3WZ0E 2AMGA 5CZ0A 1W3NA 2ZRXA 3E0FA 8XIMA 4HA3A 1PWLA 4HU4A 2OQHA 2INFA 3RO8A 3LI0A 4GJIA 5E0FA 4X2RA 2Y89A 3EX1A 3CV1A 4N02A 4ILSA 1SU5A 4P7RA 3ZT6A 3AXHA 1DPMA 3KDNA 3S47A 3FS2A 4NRSA 4W8BA 3UPBA 4E4PA 2YCLB 3AYVA 1Q2RA 2CBVA 3T40A 1XIHA 3CWOX 3MV01 1OC5A 4GH3A 3OVPA 1UIOA 3LD5A 2GUYA 3TFCA 3VGBA 3FEMA 4J4KA 5DMNA 4UTLA 3PULA 1XKYA 2Q6ZA 1B2YA 4UQCA 4QBXA 3E0VA 3TSMA 4ZGYA 2RFGA 2ZZ7A 3HG2A 7REQA 3TK7A 4H7CA 1IGWA 5CC3A 4H00A 2YLLA 2V2CA 3KWSA 4I8YA 1E71M 1XFCA 4LTSA 4O57A 2W27A 2HPMA 4HN8A 2F7FA 5XINA 3MUZ1 1ZTVA 2J7EA 2WV8A 1E6QM 4MY9A 1XLIA 3R7MA 1BWLA 4F0MA 4PB5A 3E2VA 1PDZA 3GNPA 4MDOA 1SSDA 1YHTA 4L1XA 1KXVA 4Q4QA 4GY0A 4I7WA 4PTXA 3UCQA 3ZSTA 2H8XA 3GFZA 3G1HA 3G1DA 2X0SA 5L9FA 3VOGA 4MM1A 4X61A 2ZTJA 2D2HA 2Z1SA 3G5EA 1R3QA 4BKNA 1QU4A 2ZXQA 2CLPA 3P6LA 1RBLA 4LVAA 4O11A 2NLYA 4K8GA 2OFJA 1AODA 3ES7A 3LERA 3ZT7A 2OTDA 3LPGA 1JR1A 1A53A 4UR9A 4WY0F 2E9BA 3P81A 3GVQA 1MZHA 1GVQA 1L6GA 3DG3A 3L2LA 2VVSA 2G4FA 2X2YA 3CQHA 3DGBA 3S42A 2OVLA 4W86A 2GDVA 1H5VA 5I3FA 2A3CA 4DN1A 5EMLA 3Q2DA 3BAWA 3LI1A 3MV11 4GX8A 4Q8QA 2CCRA 2J74A 3GZ3A 3NM3A 4YVXA 3LZ3A 3W7CA 4LYRA 3ITTA 3F03K 4OIFA 2D23A 1V7AA 4CCEA 4JL1A 1AL8A 2CLHA 3FA5A 1RP8A 3AHZA 3AXKA 3A4WA 4O16A 1FDZA 3QY8A 1V0MA 4W4QA 4KWOA 3GH5A 3UY7A 3IV8A 4TTUA 3KL3A 1KNWA 3I3EA 3SCQA 2OGJA 2DH2A 3WH8A 3QKZA 3EWDA 1T8QA 3CK5A 5DRIA 1O95A 2ZKMX 4ZFMA 1SMDA 2F38A 1TUFA 5JH2A 5JBDA 2PWGA 4HHHA 2GJXB 5AFDA 1CGTA 1C90A 1XBZA 2Y7FA 3GBEA 4I7UA 4QLJA 3V5CA 5AHMA 3LCGA 3MVIA 7PTDA 3NQAA 3VOJA 1KXQA 1W9BM 2OU4A 4EOUA 3LYEA 4XAFA 4AYSA 3NQ2A 3WLRA 2WLYA 2Y62A 1GJPA 4JGDA 2VX4A 3PZTA 5DN1A 2P53A 3LHUA 3CH9A 4NASA 4HQVA 5H6HA 3MT1A 5E9AA 3PC0A 1YYAA 2QGHA 3U48A 2WJDA 4JKMA 3PBYA 4I9AA 3TC6A 1DJQA 4IIEA 3UZWA 2AL1A 4C6FA 1YDVA 2XIQA 4A3RA 4LUSB 1WOBA 5T26A 1AFSA 1B3YA 1FFRA 4OTKA 5FESA 4R7OA 4GD0A 3MKVA 4W8LA 4E3VA 1UD2A 3WL0A 3S6OA 4JPGA 3TW9A 3VDGA 5FF7A 3V36A 1E1FA 4A2RA 1N8WA 1PIGA 4PMUA 1CXEA 1Z48A 5G4WA 4G6CA 2BBFA 3TC3A 2VX5A 2RKXA 5FF0A 3T0DA 4JNYA 2NXHA 3BZGA 3MCOA 5K4XA 1MNSA 2PP3A 3RNDA 1C9WA 3SRKA 3CWNA 5AHNA 2ZCGA 4DJEA 3R58A 4Q4OA 1Q13A 5BOEA 3B06A 5A8GA 1EPXA 2MNRA 3AUOA 4MGGA 2TMDA 4C7DA 3DYPA 4UNLA 2A3LA 1JD7A 3VCCA 2CKSA 4UR7A 4AIBA 1LQ0A 2VFIA 3WJZA 1IV8A 4E4FA 5LNUA 1W1PA 4G8TA 3LPOA 5EMJA 4B5TA 1EJ7L 1ZLPA 4HB7A 1FWIC 3VOIA 2PWUA 3N1AA 3TR2A 1TZ9A 5E0CA 3DC0A 1DHKA 3BUVA 1U83A 3QFWA 3W4RA 1OGBA 2VWSA 1OCQA 3ITGA 4PBFA 3P67A 3WNPA 4GUFA 3W27A 1H62A 1QPKA 3CUXA 3PWAA 4H83A 4GZJA 4TOQA 1PX8A 4IGNA 3WH6A 1DXFA 1WKEA 1H4PA 1ISVA 2CU0A 3QPZA 2OSWA 1XQKA 2ESCA 1K3UA 4GYFA 1L9WA 3KRBA 4LH8A 1KWGA 3MHGA 4US6A 1ZY9A 1LG2A 4B5NA 3VZYA 3RILA 1E56A 3BJFA 5CJMA 3E6EA 1GOOA 5I3KA 3W7HA 1ZQ5A 4NKCA 2I17A 1I1WA 1UWSA 4HYVA 3TFXA 3GHTA 1M5WA 5A6TC 2QVHA 1OX4B 3O8AA 2V5KA 1KR0A 3NO1A 2C7FA 4GZIA 2HMCA 4O8AA 1HKJA 3L4XA 3H2FA 3SCOA 1Z89A 1TPC1 2ZC8A 4IUOA 3USBA 1EP2A 4GNKB 1XV8A 4U28A 2YCIX 3UGVA 1JL8A 2PDNA 3BV4A 3P8IA 4IPIA 3JU2A 4F0KA 4Z1CA 3L9CA 4N9CA 4NZJA 1DIDA 1JG9A 3NG3A 4HIBA 4C1NB 1ESWA 2D3LA 3IIZA 3EWBX 4KS0A 3WSUA 1JDEA 1B1YA 1RQBA 3GK0A 1K03A 1OCBA 2FZDA 2B7NA 4XZBA 3PNZA 1Q8JA 2I5QA 1WZAA 1YXDA 2GQ8A 6ENLA 1XLEA 1DWAM 4H8HA 1H11A 5RUBA 3W2NA 3GZAA 3GXFA 1IR2A 3RUBL 3F4WA 2JFEX 3ICJA 4GK8A 4Q7IA 1F61A 1Z9AA 1FWHC 1S3HA 2E6FA 3JVAA 3O9NA 4K8HA 3KOZA 3B3DA 3S1VA 2GDQA 3NIYA 1JNDA 5GNXA 3CJPA 2G0WA 4EP8C 1IZJA 3PANA 2R9RA 2BGNE 3MU7A 3CPRA 3PUOA 4O4VA 4IJCA 1L6SA 4LY8A 4RDVA 2DJLA 1Z41A 1M7OA 5F2LA 1MNZA 2PP0A 2V38A 3EB3A 2VNCA 3PZIA 1VFSA 1W5NA 1Q85A 4JS3A 4M1RA 3H7VA 3MB9A 4H6QA 4D6DA 3OO2A 3GH4A 2BWGA 3B8SA 2BNJA 1D2KA 3BLDA 1HW6A 3TW7A 7REQB 3RITA 3OA3A 4Y90A 4MFDA 4E3TA 5K3VA 2QPSA 3TKFA 1GG1A 4Q8UA 1IT7A 2FZ8A 1FH7A 1RBAA 2NXGA 2PWVA 2RAGA 1YLVA 1P4CA 2D1ZA 4PMVA 1Y5XA 4XTDA 1SW7A 1M65A 4CD5A 2X09A 4ZO8A 3F1QA 1NDZA 3S1XA 4ZSUA 1WNOA 1YW1A 3HB9A 4A4AA 2J25A 1JDDA 1JJKA 1U1JA 3SI9A 3N3MA 4OV9A 1ITQA 1QNOA 4D8LA 2BHZA 2X7WA 2Z2BA 4UXDA 3UXLA 5DT7A 3BPWA 2H8ZA 1T96A 3SUWA 4M7TA 3VYLA 4GUGA 2WVTA 1EXPA 3TNBA 1JDAA 3UZYA 2V2DA 2OPJA 2P1FA 1E55A 1TMQA 3CZGA 1UIPA 4TX9A 3WMLA 4ZA0A 3TJLA 1A5UA 2WO5A 1VH7A 1MSSA 2BV9A 3BLLA 3ZSSA 1MXGA 2WVSA 1R3WA 2D2OA 3L2MA 2WC7A 4U2YA 2QR6A 3NL5A 2ATMA 1HJWA 4OUEA 3HOJA 4ZQMA 2DIKA 1F3WA 1A4MA 4MJZA 3Q37A 1V3HA 1W32A 2QAPA 3CLWA 3FX4A 2Y7EA 3CIVA 4YIWA 3OZOA 2G3IA 5FI8A 3GDMA 1DORA 3EOLA 1OX6A 3U5YA 4O15A 1K1DA 3GXPA 1DQUA 4K7VA 3HGJA 1Q6FA 1JZ7A 5AYZA 1VJZA 1GQNA 2AQVA 5MHBA 2XWEA 2VQTA 3MUXA 3EA3A 3T8QA 1Q66A 4JICA 1E70M 4NZ3A 3CYJA 3CPGA 1QK2A 1CXKA 1G69A 2VGIA 2VURA 1Q6GA 3CL7A 1QK0A 4XO6A 1WUFA 2XGIA 4LGXA 4PRWA 4LEQA 1R47A 1CXLA 3W81A 1PTAA 1K77A 3TJ4A 3QQ1A 2OJPA 4OHQA 3WD1A 3VDHA 4UQDA 1AQ0A 2WWCA 4EF8A 1WAWA 4F9JA 3GVWA 4WK9A 4REQA 3APGA 1BVWA 1XWYA 3RM4A 5AHEA 1HVQA 2Y7GA 3WL1A 1R3TA 1EC9A 2JIWA 2ACSA 1W2VA 3NQDA 4AZ7A 2IMRA 3QV6A 2OOFA 2ZZ4A 1Q7ZA 2CLOA 4QLKA 3KOXA 3BICA 2QUUA 5HBFA 3WQOA 1WDQA 3DCPA 4ZFCA 3MMUA 2X42A 3V18A 2DZXA 4J9JA 1IWAA 4B2DD 2OSYA 1EB3A 1P6BA 4NJGA 4LYKA 4CNOA 5DF0A 3CQJA 1Y0EA 2PLJA 3QKEA 4ZQCA 5HAOA 3BMXA 5BWAA 2TSYA 2R1NA 1ZPTA 3GFXA 4CQCA 1FWDC 1UA3A 2ZUMA 1KA9F 4JFWA 1VBJA 2B31A 3MHUA 2BASA 4FI4A 1AVAA 3M1ZA 3TCEA 5A8OA 1IWBA 2XYLA 1KBBA 2E8ZA 4UWMA 4KGJA 3TA9A 3W7PA 2Y6ZA 3LSBA 1IXQA 1RHCA 4E2BA 3IACA 3VK5A 4ZQPA 1HP4A 3IJLA 3D46A 1KBLA 1EYWA 3S3GA 3REQA 4ZOEA 3WNLA 2NZLA 4HJWA 4LAOA 1GVOA 3C3NA 2PDBA 3DESA 2ZDSA 1FWSA 3STGA 3UG4A 1TWZA 1NIUA 3V3WA 4E8CA 5HMDA 3CQIA 1R9ZA 2QCHA 1TSIA 2GSEA 4GFIA 2BB0A 1CWYA 4INFA 1B90A 3SGZA 5EBUA 3TP4A 4NF7A 1GVFA 2J8GA 3S5YA 4JHZA 4IPLA 3FAXA 3S9YA 4M82A 3V1HA 3F5LA 4GKLA 2E6YA 5LZLA 5DLCA 4UMBA 4D1JA 4G1KA 2XSBA 2WJFA 4L9XA 2Q3RA 1E4LA 1UBSA 1XIDA 3ARSA 4X0NA 1TELA 1TKKA 3I3BA 4K38A 1KRAC 1YTKA 4ZBCA 2CHRA 1JDFA 1X39A 3BLKA 2OYKA 1O94A 1F6PA 1ADDA 3ARRA 2WSPA 3DECA 1PDYA 2CZ5A 3W53A 5D2TA 4Z42C 2ZXDA 3W7MA 4KEUA 4YTTA 1VKFA 1KXHA 1DL3A 3HMJG 1OCJA 5CPTA 1K4HA 1PE1A 3NZGA 3RR4A 5TF0A 3F4CA 3PB2A 4WKFA 3WBXA 4MJMA 3GTNA 3L23A 3K4AA 4U33A 3QTGA 4IQDA 4TVCA 3BTNA 1U30A 1WPCA 3V7PA 1ONXA 2OG9A 4M29A 1N55A 1WX0A 2E68A 5LSMA 4O8RA 4PMOA 1P7TA 2NX3A 3IV3A 1KD0A 4AC7C 3GB6A 1BYBA 4M56A 2AKMA 4TUFA 1NP2A 3T0CA 3OGSA 2E1WA 5K9DA 2XIOA 3S2MA 4Q8WA 4QNEA 3SIZA 1H7WA 2YA1A 4MWAE 1XLDA 1A80A 1FWFC 1DJNA 4HYWA 2ZE0A 3ZJ7A 3BANA 1YDNA 1TCDA 2XGZA 1V3IA 1T7LA 4H9ZA 2QJNA 3SSZA 5HNRA 1S5NA 2IXVA 2DZAA 3F2BA 2C1GA 3AMGA 4JCLA 5LIXX 4DBDA 1EJSC 1KRMA 1YE6A 1ME9A 1LJYA 2UZ9A 3M0IA 4LB4A 3THCA 1FOBA 1XSJA 1OK6A 5K2ZA 3UA3A 2BOGX 3R12A 1DVJA 2A79A 2TODA 3MKKA 3W01A 1KCLA 1XCFA 3ORWA 3N2XA 4TV6A 5BZAA 3WKZA 3G8EA 1NF7A 2FZBA 2WZMA 3PR2A 3V0UA 4D6IA 2HV5A 1GVSA 3IK2A 3G18A 2EPOA 4BWLA 3TQPA 2EG8A 4JFUA 3URBA 4C6QA 1SO5A 1WXYA 1RJRA 2Y8KA 2YCKX 2INEA 4GI9A 3WIJA 5CAKA 5HDRA 5REQA 1X6LA 2GGEA 1D7FA 3NQMA 3N34A 1B9BA 2DUAA 3FJ6A 1VFHA 1R2TA 1SVDA 4N4PA 2Z00A 1UUOA 3LV5A 3W85A 1B9ZA 1IWPA 2XVLA 1WOAA 5DANA 2W61A 5I0DA 3E0IA 4FALA 3WBYA 3TNOA 2OT1A 2WMJA 4ROQA 1N2VA 5KTLA 2VZTA 3ZOAA 2XTKA 2D24A 4ZOAA 3NURA 4WRHA 1UOKA 4IX2A 3W02A 4AWSA 2PDXA 1SFSA 1QASA 2PD9A 4M24A 3K2GA 4GQQA 1TPFA 1VFMA 3VX1A 4IIGA 3EOOA 4MKNA 2VC6A 5LA2A 3ZR4A 3M5VA 5F4XA 3N12A 3I7QA 2E8YA 1QNQA 2Y2WA 3EKLA 1ZUAX 2VP8A 1CGUA 2Q02A 2QKFA 3RXZA 1BG9A 1V03A 4RE0A 5DRCA 3RDKA 4HPXA 4QS6A 1I0BA 4O14A 1X96A 3SDOA 1Q6QA 3BW2A 5I06A 1BFNA 1XHGA 1KCZA 3W1QA 4QQ3A 3O0KA 2WMIA 4X63A 4H3DA 5L6UA 4QLLA 1SW0A 1BTCA 4LY4A 4F2TA 1YXCA 2R82A 3RLGA 1RPKA 3DN5A 2VZSA 2CHNA 4OJYA 5EB8A 2BSLA 4AEEA 5LNRA 1OG0A 4DBUA 4HU8A 3EEGA 1OBAA 1CNVA 4HMCA 1FBAA 1F74A 6PTDA 3C2FA 5CPLA 5I09A 1ODZA 1N7KA 2OB3A 5FKYA 3N3TA 1ZS2A 4JX5A 3VPLA 5DELA 1JF6A 2IUZA 2FVKA 3TCSA 1S5MA 3V5OA 2NWRA 3WF0A 2PC8A 4IQLA 2FGLA 3MQTA 1V79A 1QBBA 3SUVA 1VPXA 1XUUA 4WKAA 4QISA 2AQWA 2E1DA 1E0WA 3OG2A 1L2UA 2C13A 5CGMA 3CAWA 3PG9A 2WAGA 2DIJA 3VILA 1WBJA 1RY8A 1IXOA 4O50A 4CD6A 1AW5A 3UPWA 4GBUA 3PWGA 4GVIA 4DIAA 1QHOA 2JIEA 4LUIA 2GYIA 2TYSA 4P7NA 3H53A 2HZGA 3SN1A 2J75A 4FOKA 4IP5A 4REQB 1HJXA 4AD3A 3MMWA 5TIMA 4J35A 1WP6A 5HUOA 3W22A 2ZBTA 1GORA 4J3VA 4UOJA 1OYCA 4IPJA 4KIEA 3MUIA 1EIXA 4AZHA 2VUYA 2BFGA 1SGJA 2D73A 2UWFA 1LL4A 3UGRA 2BS9A 3GIYA 4PUMA 1G4TA 2QW5A 4IISA 2YBVA 3JZUA 2NV9A 5E93A 3MI6A 1EDGA 2WNNA 1C9DA 3A3WA 1HKMA 1E5JA 1YE4A 1EJVC 1Q5MA 4GGHA 2C8NA 4XAYA 3L5MA 1H1YA 5CG0A 1KW1A 4ZZ9A 2B7QA 4UZSA 1S3TC 3R79A 2DEPA 2ONEA 3VZZA 3PPHA 2DSZA 4Z1AA 3MCNA 1IEXA 4AIEA 3G3MA 2Y5EA 1TX2A 3VKJA 4MTVA 3T44A 2Z0IA 5CSSA 1MW3A 4JTFA 5ABGA 1ZU8A 4H4IA 2WC4A 3CEUA 1J10A 1ZJBA 1V6UA 1TMLA 3UXAA 2VD9A 4PRRA 1KM0A 3U4FA 2J7HA 1IE7C 3OZYA 1GOKA 4DVOA 3GU9A 5HPCA 1X6UA 3H4WA 4CKQA 1WXJA 3VIPA 5A6BD 1E0TA 1IIHA 3CAVA 3WMSA 3AFBA 3QR3A 5HMEA 3REQB 3VKDA 1W9DM 5XIMA 2HSAA 2PGRA 2ZRWA 4TIMA 4EIVA 4H01A 2VR5A 1JZ5A 1IF2A 4K7YA 1V4YA 3LGGA 2A7NA 3VIMA 1MW2A 1QFEA 2B4GA 3UWEA 4ROPA 4B3KA 3DDMA 5E6ZA 4FIQA 1W5PA 1Y8BA 3ZLGA 4UBPC 3LM7A 3VC6A 4R34A 2Y8VA 1E6NA 2BXZA 3CWHA 3HPAA 3LHWA 1SZEA 4X60A 1DJYA 2IKJA 1I75A 1J9YA 4DLFA 1UD6A 1W3HA 2A4AA 3W7RA 3WCZA 3FJNA 3KDOA 3MZNA 3KP0A 4Z1YA 3VIOA 2QVNA 1IT8A 2FHFA 2OZ0A 4F2BA 5BOOA 2DSWA 1KB3A 1T40A 3G22A 4IIFA 1MW1A 1ECEA 4OT7A 3LX9A 3AUJA 2FTWA 3TJXA 3S0CA 5AYIA 4UTHA 5LKYA 1EQPA 1TZZA 4UIOA 2GWNA 3GXTA 3W7GA 1EHNA 3MP4A 3SADA 3ECQA 1OD0A 3EYPA 3BXWA 2BHUA 3QN3A 1GUVA 1QI0A 4HJFA 3ARTA 3L5AA 4FNRA 4NXSA 4LW7A 2AAMA 1UUMA 1SO6A 4F9DA 3B9EA 3QFEA 2QULA 3HURA 2ISSA 4PMXA 4QX4A 2GZXA 4LS1A 3CZ8A 2OQYA 2E77A 4YXGA 4E2DA 3VDCA 1E15A 4XZIA 1XIEA 1TE6A 1SJAA 1Q7MA 2PWFA 3QPYA 1D8WA 3WF4A 3MO4A 2B7OA 2E5BA 4HYRA 5BU6A 1P7TB 5CLTA 3LPFA 5CCZA 1FWWA 1Z32X 4URIA 4UFJA 3AXIA 2QCFA 3RHGA 1WYIA 2NV2A 3T81A 1AQFA 3VD3A 2A7RA 5A6BA 2VENA 3WDJA 5K9XA 1QPNA 1RCOB 2OO6A 4NNBA 5J5DA 2F61A 4NI8A 3F5KA 4W84A 1O66A 2WVVA 3DKLA 1PB0A 1SJBA 2JEPA 5A8MA 5MF5A 2CESA 3RAOA 2V68A 3ZS4A 1TPVA 3AWOA 1V3MA 2HXTA 4O1CA 3IJDA 4PMNA 5D2VA 3UQNA 3VIJA 1GZGA 1W56A 4Z1BA 1N82A 1PZ3A 2WHMA 3M47A 2A0NA 1GOQA 4D6GA 3HQPA 4BCEA 3ONBA 1UHVA 3TMLA 3LCFA 4X2PA 1Y7VA 2BG5A 4GZEA 3VKKA 3I7RA 1YADA 4I6VA 3EPMA 1V6TA 1ZBCA 3OHIA 5EL1A 4ZE5A 2IPFA 1GW9A 3CUGA 3TSBA 2DZTA 1Z44A 1U5VA 3R8HA 4C6EA 2WMFA 1LBFA 1UQZA