4ADUA

Crystal structure of plasmodial plp synthase with bound r5p intermediate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
278
structure length
278
Chain Sequence
NDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
total genus 96
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4aduA00
3H54A 3TUUA 3GK0A 1VR6A 3VNDA 1UCWA 5A8GA 3HG4A 1SO6A 3MMTA 3LRKA 4JTIA 5AFDA 5F4SA 1BTMA 3L0GA 1L6WA 2GJNA 1QOQA 2RKXA 2DZPA 1A5AA 3NM3A 3G1XA 3YPIA 1H1ZA 1VGAA 4AEOA 1VRDA 1WXJA 5HWNA 2R8WA 3GDMA 5F4XA 3W1PA 2GQ8A 3ELFA 1KM2A 3M16A 1MXSA 5FF3A 4IGHA 4L4LA 1F73A 5G4EA 4CQ8A 3M47A 4UXDA 5F2GA 3RMJA 5AN7A 3INPA 1J5TA 3ZR4A 1I2QA 1W5QA 4TMCA 4LUJA 1WAUA 4JTHA 1KFLA 1FQ0A 1B3OA 1FWWA 1WQ5A 4MJMA 5CPMA 1QAPA 2G5WA 4PH6A 1IXOA 2C14A 1JQXA 4XTDA 5LHFA 1LBLA 3E12A 3M5YA 5H2ZA 3S6DA 3TC6A 3LDVA 4DEFA 1XL9A 1YXDA 4O0KA 4YL2A 2Y89A 4MY8A 1TTPA 3VE9A 4AWUA 5LZLA 4N6EA 3G1FA 5HUOA 3CEPA 4JTJA 2VENA 3IVUA 4C1LA 6TIMA 1ZAJA 3O6DA 1LROA 1VLWA 1XBYA 4M5PA 4UFLA 3F03K 3NM1A 3NQGA 1T0OA 4N9EA 2A2IA 4Z1AA 1DJQA 2ZA1A 1VCFA 3MYPA 3G0UA 4BI6A 3OA3A 3QZEA 4TO8A 4MPQA 2CZDA 2QUTA 1A5BA 3BLEA 4RKAA 4K6AA 1QO5A 5EYWA 1H7XA 3O6YX 1B9BA 2JKPA 2W6RA 1VCVA 3W1QA 2R14A 1EIXA 1PCWA 4FIRA 4NJJA 1F6KA 1IIGA 5EA9A 2ZTJA 2QJIA 2B0MA 1OFQA 3A24A 4M19A 2A7RA 3TAOA 1R2RA 3NL5A 1NVMA 3P84A 4Y6GA 3BVJA 4LVAA 3NA8A 2YGYA 1W5OA 1LBFA 4Z08A 3S1UA 5LNSA 3OHIA 2OJPA 3JR2A 3DFOA 5G1YA 1KM5A 2ZZ1A 3NQAA 4R34A 4MUZA 2A85A 4N4QA 3W87A 2ABAA 3NZRA 3W1RA 3RF9A 4Y8FA 4UUIA 1ICPA 4BF9A 5AHEA 1TQJA 3HIJA 3CTLA 1KTNA 4WJEA 3KRUA 4LVFA 5D04C 2PE4A 2EPHA 1WV2A 2XN0A 2AGKA 2YFOA 2YCEA 5C2XA 2C19A 3U2OA 1W5NA 2OZ0A 4WQ6A 5TBOA 1LBMA 4M7SA 3TMLA 2NXHA 1GOXA 2E5DA 3SI9A 2BSLA 2DZSA 5K9CA 1GG0A 3WJSA 4I7UA 4WOZA 1L6SA 4KFOA 2Z6IA 3WK2A 1A53A 4DO4A 3C2FA 3DAQA 3QYQA 5K9DA 4MKNA 3EWBX 3CPRA 3O63A 4U4MA 4EVZA 3TSMA 1Z48A 1XCFA 3M44A 4AAJA 4J9JA 1QMLA 4UTJA 1TV5A 4O1DA 2YW4A 4LVGA 1VPXA 4Y90A 3HBLA 4TR9A 2PRHA 5D05A 3I68A 3TJLA 3S5YA 4K38A 1I4NA 1S3HA 3W88A 2YYTA 4UTHA 4IMFA 1TRDA 3W7GA 3W7CA 4UMCA 3IIVA 5U4NA 3UWVA 4QQ3A 3HMJG 6ALDA 1QR7A 3UWYA 2ZRVA 1ONRA 3KAOA 1Q3NA 3B05A 2GOUA 2QCEA 4ORIA 3DFTA 3W73A 2V2CA 5D02A 3TA6A 3EX1A 3M1ZA 4NZJA 3EWYA 3UQNA 1FDYA 1N7KA 3A21A 4JY9A 1KA9F 3W76A 4AF0A 2C18A 3P7YA 3PUOA 4GUHA 4WXYA 3IGUA 4MY1A 5D37A 5EKYA 3OIXA 3EEGA 1G4TA 4JXCA 1P0KA 3H53A 2HSAA 3P60A 4HPJA 4N6FA 3C2RA 5D32A 3V1PA 5HR6A 3BK0A 5LNWA 2BXVA 3UY7A 4OU1A 1FWNA 3D0CA 3IRDA 4YWIA 2ZYFA 3E49A 1V5XA 3LGEA 5AHFA 4K39A 5AOUA 2X1SA 3BG3A 3DFQA 4ADSA 3RK8A 3CU2A 5LSMA 4JTTA 1WA3A 2H8XA 3WJYA 1LCOA 1TQXA 1ME8A 5F2MA 4OV9A 2B7OA 1CI1A 1AK5A 3UPWA 5CGQA 5HWJA 1FXPA 4X3ZA 5HINA 4IMEA 3B0UX 1RPXA 2I14A 1JCJA 4JTKA 2E09A 1UUOA 2VFDA 3R13A 4Z1BA 2BWGA 1KM3A 3PSVA 3SW6A 3DFPA 3MBFA 2Q8ZA 1N8FA 2PURA 3LXBA 1W3TA 3MBDA 1SPQA 5CG7A 4LS0A 3BLIA 1Q6LA 2Y61A 2WNQA 3G0SA 1I2PA 5AYYA 3MP4A 3O16A 5J5DA 3UXDA 3DH7A 4ZQMA 2RDUA 2EF9A 2WKJA 4I7VA 3S9YA 4B5NA 1LRNA 4ALDA 3TXZA 1NAL1 4PODA 5HNRA 1YTKA 3EX4A 2A6NA 4IX0A 2ZZ7A 3TK7A 3VKJA 3PM6A 1UUMA 4DF2A 3W7IA 1JUKA 1K02A 4GE8A 4OV4A 1I45A 2J27A 5E0KA 3EWXA 1KM0A 3Q2DA 5DBUA 2C15A 1E51A 4XWUA 2OX1A 3O15A 3ABRA 5L9FA 1XM3A 2A7NA 4CNNA 1TSIA 3QC3A 1IXQA 2C6QA 2VFFA 3G24A 1LZOA 3LX9A 1XBZA 2ZRZA 4KKXA 5F1VA 3JS3A 3QMTA 3DU0A 2EHHA 4MLJA 1Z44A 4NXSA 5I3FA 3L67A 1G4SA 3NZ1A 5F4WA 1VCGA 2E6AA 5G1TA 2TPSA 4W9TA 1OFBA 4TX9A 1OYCA 3W1AA 3STEA 4UTIA 5EBUA 4AF0B 3TKFA 3LTYA 1U83A 2CLOA 2BZNA 4JIQA 4O1AA 3EXSA 3T78A 3W7OA 1W1ZA 3OG3A 1KV5A 1Q6RA 4AHPA 3C61A 1V7YA 3THQA 3LCFA 3DI1A 1EUAA 3LCIA 4OHQA 4JYDA 1FDZA 2NZLA 1QPOA 3DFNA 3CHVA 4FHAA 3SGZA 5C6MA 4GXMA 1WBJA 3OVQA 5A5WA 5BRBA 1FUYA 3LOTA 2B4GA 3PWAA 3AJXA 5CZ0A 3L2IA 4S1FA 2QUUA 4LNYA 2DZTA 4HKPA 1W3IA 4LW7A 4PFMA 1SW7A 3WJWA 3NPXA 2CLEA 1YXYA 1CW2A 2E5CA 3F4NA 3H55A 3MI2A 2O7QA 4O13A 1GEQA 3MJYA 4KWWA 4HSNA 3PS7A 1OYBA 4A2RA 1W54A 4HIBA 4ML9A 4UTMA 1N55A 1R46A 1VYPX 2FLIA 5HR7A 2Y88A 4O1CA 1LOQA 2J9XA 4LU0A 3C2VA 4JDYA 3IIOA 3RFAA 1FBAA 1EP3A 3W7KA 1H7RA 3I6RA 4IJBA 2QEZA 3CT7A 1WDWA 1IGSA 1ICSA 1AW2A 1ZJIA 1OF8A 3LHUA 4IMDA 1TPDA 5DCBA 3CIXA 3VCRA 3B8DA 4PCFA 3W1LA 4BI7A 4D2JA 2ISSA 1F05A 1TPH1 4RLIA 2O7SA 3R89A 1GYNA 3NXFA 3P8IA 2QJGA 5AHMA 3USBA 3S5ZA 4O0ZA 4AHOA 2X30A 4LS1A 5K4ZA 5EMUA 1OYAA 4UCGA 1LOSA 1XDLA 2V81A 5D30A 2NWRA 3NAVA 3TC7A 1AMKA 1ZY9A 1TO3A 4AHQA 3C8FA 2HMCA 2YSWA 1D3HA 4BWLC 2Y63A 3P74A 3DI0A 4OE7A 4I7WA 3WJXA 3QMSA 3N14A 3VE7A 1R2SA 4UIOA 1KV8A 5AB3A 4X22A 2Z6JA 2E1DA 2GVJA 2ALDA 3EX6A 3S42A 2YPIA 1FY6A 1FCVA 1LORA 4BWLA 4RV8A 3EKLA 1O4UA 1M7PA 3LXCA 3DBPA 3BW3A 4LC6A 3TXVA 1KFKA 3MI6A 3C6CA 5DELA 3UYCA 3TFXA 1DKWA 1JQVA 3DKLA 1TRIA 3QPZA 5EL1A 1L9WA 1JRCA 3T4CA 5BMXA 3SIZA 5FF4A 3W85A 5D2XA 3N2MA 2H3BA 1YDVA 4O17A 3GB6A 4O8RA 4RZ5A 1UJPA 3DENA 2Y7DA 2B7PA 5BMWA 3E96A 3IGXA 1G6CA 1JVNA 2ZRWA 1OK6A 2WJZA 1SW0A 3FFSA 1ME7A 3L68A 4UTUA 3HO8A 2ZZ2A 3WK1A 2A5HA 5TIMA 5ABTA 1ZHAA 1X7FA 3CWNA 4O16A 4DO5A 5LNVA 2CLLA 3NO5A 4FIQA 4LTSA 1C8VA 3M9YA 4GUGA 3DKJA 1GTHA 1YPFA 1NSJA 5EY5A 2WO5A 4JYEA 3M7WA 3TDFA 3W2UA 4Y9AA 5DY3A 3GAYA 4N2YA 3W2LA 1DBTA 2CFFA 4Q4KA 3HGOA 4KFPA 1B4KA 3IGSA 4HNUA 1Q6QA 3DXIA 4UTKA 1XUUA 3W1TA 1LLZA 1MEIA 3FYOA 5D2WA 2A0NA 2J24A 1YDNA 2CU0A 1JCMP 1R47A 1BWKA 2G97A 2TRSA 1L6YA 5DBTA 3PBWA 4DPPA 2ZRXA 3HQ1A 1SQ7A 1OX4B 3LCGA 3LI1A 3W2MA 1YTEA 1S5TA 2QCHA 1K7EA 1YYAA 2R91A 2G96A 3GDTA 4WX2A 3QH2A 4TIMA 2ZBTA 5HJLA 5AC7A 1H1YA 2WSYA 1SFLA 3L66A 3P80A 1SSGA 1UBSA 3W83A 5DLCA 3TR2A 2QCNA 3MHFA 3NR0A 1PIIA 3IVSA 4O12A 4JX4A 1FCQA 3W6YA 3TU9A 1O5KA 3W7HA 5CZSA 3TW7A 1RR2A 5C55A 3LLFA 1H50A 5FEZA 3SR7A 3ZWTA 1GWJA 3G3MA 4GNJA 4K36A 2AQWA 1OX6A 1EPXA 2FB2A 2H90A 1HG3A 1HTIA 1OF6A 3LHVA 1AL7A 2WOQA 4R33A 4K7VA 5H91A 4ZMGA 5KINA 4CLMA 3W84A 1SU5A 1FCBA 4A29A 4ORMA 3PY2A 2UV8G 2GVLA 4N9CA 4UR7A 2RFGA 4HSOA 1OABA 2DORA 1SO3A 4XZ9A 3W70A 4UFHA 3S5NA 4Y96A 1SW3A 1MZHA 3W7LA 3O8AA 3KFTA 1SZFA 2NXIA 4O1BA 1H62A 1TV7A 3N73A 4Z1DA 4E2BA 4FXSA 1GT8A 4HPXA 3GR7A 1GVFA 4POCA 3PBUA 2NLIA 3ABOA 1TJPA 3R2GA 5HULA 3I7SA 2NUXA 2Y85A 2VFGA 3KX6A 1DORA 4JX5A 4HHPA 1TYGA 5U7SA 3OBKA 3IIPA 3PSWA 4ZVJA 1W56A 5LKYA 2DZXA 2PRLA 1VZWA 4FF7A 2DZVA 4X9SA 3W1XA 3NNTA 3BGJA 2VEIA 1Y0EA 1O60A 3BG9A 2Z0IA 4JIPA 4UFIA 3ZFHA 2CZ5A 1F6PA 2QF7A 3UXAA 1WX0A 2GUUA 3TJXA 3TIMA 1Z42A 2WNZA 2QCDA 2AAMA 5K2ZA 3G1YA 2FTPA 4MOZA 4UNKA 4LVBA 1PHWA 2C16A 3O06A 3P5ZA 3NPVA 4MYAA 3W1MA 2V2HA 5MHBA 3BV4A 3W9ZA 4DXVA 3FKRA 3PR2A 4MFDA 3UY8A 4LVDA 3BARA 2GVGA 5AYZA 2IQTA 2Q3OA 1JCLA 4MLRA 3JRKA 1W8SA 2WPBA 4CCCA 2KZHA 4OBTA 1SZGA 2NV1A 4YXGA 1XFBA 1XC4A 3C4UA 5CKSA 5D2VA 1QPRA 3CC1A 3MHUA 4DPQA 4JEQA 4YMZA 1LOLA 5FI8A 1TJRA 1NFBA 3W22A 5C5YA 3HJZA 1QNVA 4NNBA 3DZ1A 4CCEA 2ZRYA 4HN4A 3W2JA 3HGSA 3FS2A 4JYFA 2RHGA 1TPVA 1H7NA 4JR5A 4O53A 1G69A 1M6JA 1DV7A 2CWNA 3E0IA 5KZDA 2NXGA 3C2OA 4NNCA 3TQVA 3UWQA 5K4XA 1TIMA 2YX0A 4XBSA 2P0OA 2EKCA 1TTJA 3QW4B 2QCLA 3GKAA 5BOOA 4FNTA 1VQTA 3L5AA 3T40A 4LT9A 1KTCA 1TPUA 1R30A 1XUZA 1D3GA 3DHDA 3NPWA 4XBKA 3GDRA 3ANYA 4BK9A 1EUNA 1T8XA 2J9ZA 2LLEA 3R12A 4DF1A 1G7VA 3L21A 4PA8A 1GTEA 4NX5A 1GVOA 5KSWA 4JNMA 4Z0JA 1KBIA 3TSBA 4TU1A 3SJ3A 2RH9A 2I1OA 3W7PA 3RNDA 1JRBA 4ZL1A 3MO7A 5L6UA 2ZA2A 2C0AA 5KITA 1YLVA 2FPTA 3NOEA 3TE9A 1TPFA 5D03A 1GVSA 2Y70A 3T55A 3VI2A 5K9XA 2FPVA 5E93A 4FNRA 3CWOX 2QUVA 4GRSA 3HOJA 5KTLA 4M6VA 2J6XA 1MO0A 2Z1BA 1X1ZA 4S2CA 4MFEA 1K8YA 5CPNA 2W79A 3LBCA 3M43A 4YLWA 4C1KA 1VS1A 2PRMA 2QJHA 1FDJA 4QITA 3B0PA 3NQMA 3KVLA 2E6DA 3HPZA 3EB2A 1A50A 2FFCA 1W5MA 4WD0A 5BNKA 4RJEA 1IF2A 3L9CA 2CW6A 3B03A 3LCHA 4A21A 2ZFAA 1W31A 1YPIA 4UR8A 3GIYA 1ZCOA 5DN1A 3LERA 1AG1O 1DVJA 5DXYA 2GPTA 4LC8A 2Y62A 5CZTA 3NL2A 1H7OA 4O57A 4MYXA 1O5XA 4AWTA 3LRMA 4NT0A 3ZS4A 1TV8A 1RQHA 4O50A 1VHNA 4XTIA 3HGRA 3NQFA 5F1UA 3DGRA 4LWWA 1GVRA 3KHJA 1JULA 3CIWA 1RD5A 4BFAA 1LYXA 3C3NA 1LRTA 1OK4A 1VJIA 2VEMA 3NQCA 2Q8LA 1VHCA 3G0XA 3W74A 1UASA 2VXNA 3M5ZA 4JD4A 2A21A 3FJ6A 1PHQA 2QR6A 4O18A 1L2UA 3OVRA 2A7PA 1GPWA 3S5OA 4X2RA 1H60A 3SGUA 3W7RA 2C13A 2ATSA 3S8HA 2E77A 2DZUA 2VEKA 4WY0A 2BX7A 3PUEA 3LTSA 1DL3A 4BI5A 3KVKA 5D2YA 1IXNA 3TNOA 4JTSA 5G5IA 1DOSA 1ZALA 1NF7A 3KRZA 4R7JA 3G18A 3SSJA 1T99A 1P4CA 4QM1A 2Y7GA 1PL9A 3TW6A 3NYZA 2FIQA 3KVMA 2QCMA 5E1QA 5LHEA 4I9AA 2H8ZA 4K8EA 1O94A 1QPNA 2B7NA 4ONVA 4UTLA 2HTMA 2TMDA 3EWZA 2VELA 4P2VA 1WOBA 1F2JA 3LTPA 4FNSA 3NVTA 1O95A 2NV2A 1C9DA 2FDSA 4XKYA 1TPB1 3N3MA 2NUWA 1AW1A 3TAKA 2XN1A 4GBUA 1ML1A 4AWSA 1TTIA 3EKZA 4O4VA 3NQVA 1F7BA 4L4MA 3GYEA 4O52A 3BGGA 3P67A 3EX3A 1JCYA 3BG5A 1RQEA 3NEVA 1K8XA 4JX6A 4N9DA 5FF7A 3EWUA 5G2IA 3GZ3A 3G3DA 3S1XA 5AHIA 1OFRA 1ZFJA 3BO9A 3FEMA 3QQ1A 4JTUA 2E68A 3QW3A 1BKSA 3BW4A 3PF3A 1M5WA 5CPOA 1K7FA 2QAFA 3GAKA 3QPYA 4FX6M 3RU6A 2V30A 2JBMA 2RDWA 5DCDA 2OT1A 3G1SA 2V9DA 4UFJA 4NJKA 3NQEA 3QEZA 4DQWA 2X2GA 5G2HA 1FWTA 4DBEA 3PB2A 2WSRA 4XQ6A 3B06A 2ABBA 2YDAA 3SY5A 4PEKA 3TFCA 1LTDA 5CSSA 3GX9A 3W7QA 1EEPA 1K03A 3GR8A 1SZEA 5I3HA 5FESA 5AC8A 3P5YA 1ZENA 1P0NA 2QCCA 2J9YA 4IUOA 1MEWA 4E0CA 1IIHA 2DJLA 4WOQA 2A4AA 5KZMA 3RLVA 1VYSX 3CLMA 3QQ0A 2JGYA 8TIMA 2YR1A 1VLIA 2GQ9A 1AL8A 3NL3A 2VC6A 5KZEA 5HUPA 1DHPA 4IWWA 1G7UA 1P1XA 1MEHA 4HNNA 2JKAA 1H63A 3NQ2A 1A5SA 3PBYA 4K37A 4MY9A 1KLYA 3NGJA 2X1UA 3PB0A 3PULA 1BWLA 3ZWSA 2E5BA 2E6YA 3MYOA 3NQ6A 3OEXA 1HO4A 3FKKA 3CB8A 3N9RA 3EXTA 1KFJA 4WY0B 5FEWA 1HFBA 1VC4A 3W23A 1RQBA 5FF0A 3TROA 5CZJA 1RV8A 5I3JA 3L5MA 4CNOA 2ZRUA 3KOFA 4CNPA 2C1HA 4GUJA 1OVDA 1WYIA 1OFDA 3MHGA 3VFLA 1KW1A 2NX3A 3HGJA 3WK0A 2I9EA 3PG9A 2X1RA 4O15A 1EWEA 4TMBA 4O14A 5F2IA 4Z1CA 1QOPA 3MWAA 1X8FA 3PAJA 3P62A 3W1UA 4ZQNA 3M6YA 4FNPA 4DBDA 2QCGA 1LRQA 5SWUA 2WQPA 3UWZA 1RVGA 1IXPA 4RK8A 4RXGA 4XUGA 4MZ1A 1DQWA 3W2NA 4XKYB 4H4IA 2PCQA 2R94A 3KRSA 1ZNNA 4K7YA 1SZNA 2Q3RA 2ZDRA 3QSTA 4O11A 3GDLA 3N9SA 1SO4A 4ICNA 2HS8A 2DU2A 4UFKA 2VOMA 2DP3A 1ICQA 2TYSA 3LCLA 3L5LA 1F5ZA 3TQKA 2CLKA 3CM4A 3QM3A 5BW6A 5C54A 1H51A 4JDBA 3ATZA 3W2KA 4Z0SA 1D9EA 1G4PA 4N02A 3LB0A 3M0ZA 3G1AA 1EB3A 2ZA3A 2Y6ZA 2FQIA 2ZTKA 4IMCA 3UD6A 3STFA 3W7MA 1KFBA 4PC8A 1ZAIA 5IM51 3TV8A 3IEBA 1DQXA 3R5EA 3QF0A 1S5WA 3PUDA 4IXHA 4EIVA 3NL6A 4MZYA 3A9IA 5I3IA 2V2DA 1JCNA 2Z2UA 3MW7A 3LHZA 2OCZA 1XXXA 1OFOA 4ZQRA 5LNRA 2CLIA 4O19A 4RZ6A 2VKZG 4RZ4A 4H3DA 5AHLA 1HL2A 4A2SA 2ISVA 4CCDA 2G95A 3NQDA 1EWDA 1FWRA 1UB3A 4JN6A 1PE1A 2QDHA 3Q58A 4FNUA 2QAPA 3RLUA 3HG5A 4GJ1A 1H5YA 3U8GA 3TCEA 2V5LA 3MP3A 4M7TA 3ATYA 4MZ8A 4U28A 1YTDA 1FXQA 5CSRA 2VFIA 4ZZ9A 3TSDA 3C2EA 4K8HA 3M5XA 3DHFA 3M5VA 1H61A 3STGA 1KM1A 1PV8A 3LRLA 2NX9A 3LV5A 1CX9A 3NQ8A 4PL1A 4IOTA 1QCWA 3PVFA 5DXXA 4UMAA 4WY0F 1AW5A 3GXTA 4QJ1A 4ADTA 4EF9A 1LDCA 4LS2A 2A1YA 4UTTC 3CQ0A 1LP6A 3GXNA 4PL2A 2F84A 2OMAA 4DELA 1JR1A 3UWUA 1X6UA 4JY8A 1SO5A 3O1NA 1R2TA 1T96A 3FLUA 3P81A 3I7RA 4NNAA 3UWWA 4EOUA 1TCDA 4GFSA 4ADUA 3S1WA 4FB7A 4YCPA 3O6CA 4HNVA 2V5BA 4IMGA 4A3UA 4UTTA 2DJXA 2X16A 2V82A 3G1DA 3B04A 1W0MA 4H6KA 4UTWC 3HG3A 4GUIA 1TPWA 1KM6A 3W1NA 1H7WA 3MI3A 2ZZ6A 3SECA 4WUIA 3M41A 1LLWA 4UMBA 4UFMA 3KVJA 4RCXA 5HQEA 1F74A 2OT0A 4UTWA 4JTLA 3GNDA 5FEXA 2HS6A 3G8EA 4QISA 3CEUA 3LM7A 5D09A 5D33A 1GYLA 4RXFA 4G1KA 2WNNA 3ABQA 3F4WA 4KWVA 2A6LA 4CQAA 3HB9A 5D2TA 3STCA 4NX0A 2CZFA 3FOKA 4HT3A 3FIGA 3P8JA 1SR9A 1B4EA 1MSSA 2C3ZA 1QO2A 1DJNA 3MUXA 3UZJA 1I8JA 1ALDA 3F1QA 1GJPA 2H3DA 2YZRA 2ZCGA 3LCXA 3W07A 4OQVA 4AVFA 2EGZA 1YADA 3IIZA 2X1TA 4GWEA 2H6RA 2VEPA 1OFAA 3I7QA 4S2BA 2YW3A 1Q6OA 4LUIA 1FCUA 2FB3A 4FX7A 5K7JA 3EXRA 2CZEA 3B0VC 5TQLA 3W72A 1EP1A 2WV8A 1KLZA 3L0NA 3FJLA 4LRTA 2V0TA 1TB3A 3UNDA 4R53A 3A5VA 3LHWA 2Y7EA 2BTMA 3LXAA 2JGQA 4HNTA 1F76A 3W7JA 5IBXC 5I3GA 3OVPA 4EF8A 1TPEA 3G22A 5F2LA 3W71A 7TIMA 2GQAA 1XDMA 4NUWA 1VYRA 1JUBA 1KBJA 3EWWA 2NWSA 2ISWA 3S1VA 2JK2A 3QSRA 4ZQOA 3LHTA 3TX9A 1JCXA 4N9BA 5IBXA 1A5CA 2QKFA 3T7VA 3V75A 4GUFA 1KM4A 5CPLA 1ADOA 3TH6A 1I2RA 2TSYA 4FEZA 1VH7A 3HF3A 3BW2A 2ZZ3A 2ZQ0A 3L0KA 4LV9A 2B7QA 3O07A 3IVTA 1WOAA 1X1OA 3NG3A 4P61A 3HG2A 4O4WA 4DF0A 2Y7FA 4YCOA 4NQ1A 4QIUA 5K3VA 4EWND 3ABSA 4QAIA 5LGXA 3P82A 4JS3A 1SSDA 2JKEA 1PCKA 4Q32A 4E2DA 4BR1A 2XN2A 3QFEA 5KMYA 4AMAA 3GXPA 2P10A 1Z41A 3PBVA 4IQLA 3DFSA 1KFEA 1KFCA 3GNNA 4AB4A 1NF0A 3MP5A 1QFEA 3NQ7A 2P1FA 1I2OA 4RX0A 3N34A 1W5PA 1K3UA 3W3OA 1SFJA 3TMQA 2XFWA 1I2NA 3UPBA 1NEYA 4ZQPA 4LY8A 4NXKA 1Q45A 2QCDB 5GVJA 3UZ5A 2F7FA 3GLCA 1HUVA 2ZZ4A 2CLMA 3SZ8A 1KTBA 1PS9A 1J2WA 4GC4A 4DO6A 1GQNA 1JUEA 5DCEA 5FF2A 1JJKA 4O10A 2D73A 1GG1A 1TTQA 2PC4A 4OGZA 4Q33A 2YXGA 5T26A 3THAA 4IPJA 3WJZA 3GKFA 1TREA 4M6QA 1FX6A 3QJAA 2NX1A 3LCWA 1QDSA 4NVTA 3S0CA 3NDOA 1W37A 4O28A 3LI0A 4WXZA 1SUXA 1W3NA 3N2XA 4ZQCA 3G8RA 4AXKA 3W7EA 2ATMA 2QCFA 2FPYA 1YXCA 3A22A 1G67A 3EX2A 3G1HA 5AYXA 1OX5A 5I3KA 4JTFA 2V8ZA 5EPDA 1QWGA 3W7NA 1P5BA 3U6WA 3FA5A 4M6PA 4MJZA 1ME9A 3IV3A 1OJXA 1ZAHA 3I65A 2J88A 3E02A 1HO1A 4NJIA 1TPC1 1LM1A 3W75A 4JTGA 3N19B 4E38A 4FXRA 1XKYA 1M7OA 3GVGA 2GJLA 1EX5A 1J4EA 2FJKA 3KXQA 3W7DA 3AO0A 1G4EA 5G4WA 3B4UA 4QSHA 5AC6A 3W86A 3C56A 4FO4A 1YDOA 2EAWA 3O05A 5G2WA 3QMRA 3HPSA 1B57A 3Q37A 3PC0A 3Q94A 4NJGA 4LOCA 5AHNA 4QNWA 3LBMA 3IIXA 3K30A 1K7XA 4A22A 4NZFA 4CQ9A 4IXXA 1EA0A 4N4PA 1RZMA 3E9AA 3SFKA 1C29A 4AH7A 4UNLA 3HPXA 3WFAA 1OFPA 2CLHA 3NPUA 1TMHA 2YFNA 3GDKA 5HWMA 4NU7A 5LGZA 4OWGA 1PVNA 1OX4A 3R8RA 4PTNA 1H7PA 4LV4A 1EP2A 1K8ZA 4JGDA 2RDTA 3C0JA 1S5VA 2E6FA 2VFEA 1QPQA 2ZZ5A 1OG0A 1OFEA 3PG8A 2QDGA 1XBXA 4IX2A 3LV6A 5DY2A 5LNUA 2YYUA 3TQ0A 1GZGA 3BLFA 4MVAA 3QRHA 4WZHA 1XI3A 4RR4A 1FWSA 3G1VA 4IPIA 4JICA 4MIMA 2NUYA 2VFHA 4QNEA 3LHYA 4O54A 3T44A 5D38A 1GVQA 3A5FA 1WBHA 3P61A 3BPWA 3A23A 2DZWA 1XBVA 2CLFA 1U5JA 4FX8A 4OT7A 3FYPA 4UC5A 4FNQA 4JTEA 1THFD 4NJHA 5J5RA 2BLEA 3L65A 3LLDA 3WK3A 2W0UA 5FEPA 1OHLA 5HMSA 2WSQA 4LRSA 4KFNA 1BEUA 3C52A
chains in the Genus database with same CATH superfamily
3H54A 4M51A 3TUUA 4LCRA 1MZRA 1VR6A 1WUFA 3AYRA 1CZ1A 5A8GA 1SO6A 5F4SA 4WF7A 4CU7A 3M0HA 3SRHA 3L0GA 2GJNA 3BZGA 4CNTA 4XX6A 1HKIA 3W26A 1H1NA 4XB3A 4ZO7A 1QASA 3ANUA 4UOQA 3UG8A 5H8MA 2R8WA 3GDMA 4J3XA 4DUWA 2W9MA 3VGDA 3M16A 1IEIA 5FF3A 3WEZA 4TOQA 1F73A 3AICA 3M47A 3DEQA 2QVNA 3ZR4A 5BWAA 4Z2KA 4FZIA 1I2QA 3VO0A 4ES4A 5GJPA 2VD8A 3VXGA 1FWWA 5CPMA 1RK5A 2WC3A 5FIPA 2C14A 3GZAA 1PZ2A 4GQGA 4U10A 3V4BA 5LHFA 1LBLA 1KRCC 3M5YA 3PTMA 3ZT6A 3WLOA 2PWEA 4O0KA 3H7RA 2WMFA 4KRZA 4MY8A 3K13A 1J01A 1QNOA 3G1FA 5HUOA 4H00A 3V18A 2ACSA 3IVUA 2X41A 4GY0A 2XSXA 1ZAJA 2PF0A 4L6DA 1RAKA 1E9YB 2F61A 4YVVA 1DWAM 1VLWA 2VJXA 5HJXA 4UFLA 3NM1A 1B5TA 2A2IA 1VFMA 3FAXA 2ZWYA 4L4PA 1KCKA 4CQCA 4JTDA 3G0UA 3QZEA 3T2OA 1ZP3A 3GR4A 1MI3A 3P3BA 3MMWA 2Z28A 4RKAA 1AJZA 4K6AA 3POHA 5T9CE 3BLPX 1UIPA 4ZE5A 3IANA 1B9BA 1GOWA 3S6TA 2D22A 1QRQA 4JIRA 2EO7A 3BLKA 5XIMA 1OWQA 2OPJA 1J0YA 4NJJA 1IEWA 3TYUA 1R0MA 2VD9A 3BJTA 4HD5A 2XM2A 3H2CA 2NVDA 4M19A 1OFQA 3NL5A 3CUFA 1EQCA 1TVLA 3DFHA 3NA8A 1KR1A 1UA3A 3BJFA 1XGZA 3NYDA 4F0RA 2OJPA 1QHOA 3JR2A 3JZEA 2A85A 2ABAA 1U22A 3WDQA 1KB3A 3GW0A 3WH7A 3EOLA 4BF9A 1ICPA 5AVHA 3CTLA 3STPA 5D04C 3WBWA 2EPHA 1J96A 5JU6A 2O9OA 1LUCA 2YCEA 1XH2A 4Q4RA 3U2OA 4GACA 1XLMA 4M7SA 4LYKA 2E5DA 4L9XA 4DUXA 5K9CA 2BSLA 2DZSA 3RM8A 3V16A 3WBXA 3WJSA 4I7UA 1RLCL 3WK2A 1XYAA 4B4FA 3DAQA 3QLLA 4PRTA 3AMKA 1TJ1A 3CPRA 3TSMA 1Z48A 2VDHA 1XCFA 2WVVB 1DIDA 2G4JA 1S5MA 4MAVA 3APYA 4UTJA 4MNJA 4DJED 3A12A 3VAVA 1WKEA 5A6BA 1DIOA 3S5YA 1E15A 3UERA 4K38A 4A8LA 3VNLA 1Z6KA 2WKLA 3UWVA 3VIGA 3KBSA 2BHYA 2ZRVA 5EBAA 3B05A 2QCEA 3W73A 5HPOA 3BMXA 3TA6A 2UBPC 4QE5A 2YKKA 4NZJA 5CGMA 3A47A 3EWYA 1XLJA 1KCLA 5J04A 3A21A 2PBGA 4PULA 4QCFA 2C18A 3P7YA 4D6JA 4GUHA 4WXYA 5KEZA 5E0FA 1LL4A 2WAGA 5D37A 1SJDA 3OIXA 4GX8A 1Z8AA 4DIAA 1DXIA 4JNYA 3B9AA 3BK0A 3WUEA 3UY7A 1RUSA 1A0DA 2PD9A 5T9BG 2ZYFA 3PJXA 3DFQA 4WRHA 2PDBA 5LSMA 2H8XA 3WJYA 3N18A 3AIQA 4J3TA 1H49A 1QHZA 2VR4A 4OV9A 1Q6DA 2PGRA 3WF4A 4XVDA 2GJXA 2E1WA 2QDEA 4X3ZA 1AQ0A 1J0JA 2X2YA 4FK9A 3I3DA 3VKBA 1UUOA 3EOEA 4Z1BA 3PSVA 3QTPA 3DFPA 4FMVA 3SJNA 1IEVA 2WHJA 5JBDA 2UY3A 3AI0A 1XIDA 4CGTA 3MBDA 1GW9A 4HTYA 4ZOEA 1J6PA 4PCSA 2Y61A 3WH6A 4QXIA 2JEPA 4FALA 1E1CA 4YTQA 3ARPA 3B8UA 3O16A 5BYWA 5FJOA 4M6UA 2PDWA 4ZQMA 2VVSA 3Q4DA 3S9YA 1XJBA 2O56A 3WG6A 3AHVA 1NAL1 4XAPA 5HNRA 3NOYA 2ZZ7A 3CZLA 2IPJA 4GO8A 4TTUA 1PIFA 3LK6A 3D3FA 1VBGA 4J28A 1K02A 4GE8A 1AZ2A 1US2A 5A8NA 2J27A 3FW6A 1KM0A 3Q2DA 2C15A 1E51A 2FYMA 3O15A 3ABRA 2PGFA 4ZOCA 1U5HA 1DXEA 1A5MC 1TSIA 2Z7KA 1PWMA 3U2EA 4DI8A 1BRLB 3OO2A 4A3RA 3N6JA 3LX9A 5ABEA 3IACA 1SJBA 3BAIA 1V7AA 3DU0A 4AIOA 2BB0A 1MMFA 4YWSA 3DC0A 3L67A 4AVOA 2P8CA 4BY3A 5CC5A 1VCGA 3ZVHA 2KX9A 2E6AA 5G1TA 4W9TA 2G41A 3W1AA 3STEA 4LF2A 3TKFA 4Q4OA 1IE7C 2BZNA 2FMOA 4O1AA 3T78A 4QGCA 2BGNE 1PX8A 3OG2A 1Q6RA 3C61A 1BHGA 1V7YA 3THQA 3LCFA 3D5HA 1EUAA 3LCIA 1KQYA 2PDGA 1XINA 1XIHA 2X0HA 1FDZA 3DFNA 3SGZA 3SRDA 1R3SA 5C6MA 3Q67A 4P8WA 3OVQA 4C7FA 3LOTA 1KXTA 5EFFA 5CGTA 2BMBA 3QC0A 4LNYA 2PLKA 1W3IA 2D24A 1GK8A 1TV3A 4MPKA 1SW7A 2OB3A 3WJWA 3NPXA 4HOZA 3SCWA 3B9NA 4D72A 3ARYA 2RUSA 3F4NA 4KEMA 2REQB 2BASA 3VCCA 3MI2A 4O13A 2D0HA 1SMDA 1GEQA 2ZADA 4PB3A 1JYNA 3I3EA 4NAEB 4IMAA 4HYRA 2IMRA 3OLDA 4F0SA 1W54A 4CEXC 2G4FA 4HIBA 1N55A 1VYPX 4KEVA 7PTDA 3LSCA 3C2VA 3IIOA 1DWGM 1IYXA 4URIA 1AQHA 5FJPA 5A2AA 3CT7A 2OEKA 1WDWA 1AFSA 2VGGA 4PZVA 1YDYA 3HJEA 3VCRA 3B9EA 2F6UA 4PCFA 5C2CA 2BY3A 5A8MA 2BP1A 4HMEA 1F05A 1TPH1 1UROA 2V3GA 2ZUVA 3T2QA 3EB4A 5GNYA 3P8IA 2QJGA 4O0ZA 5T91A 1XCXA 2CITA 2IW0A 5EMUA 2V81A 3I10A 1J2BA 2HNHA 1TO3A 5IRPA 2VCAA 2YSWA 1E6SM 2I17A 3P74A 3M7SA 3H7VA 3WJXA 3VE7A 3BOXA 4A3HA 4UIOA 3U5YA 1KV8A 4Z2HA 5AB3A 2HBVA 2GVJA 1XQKA 1FCVA 2GYIA 1FWDC 1NELA 1M7PA 3DBPA 3REQA 2X42A 5DELA 2XINA 1U5VA 3T4CA 1BD0A 1WO2A 3R8GA 2Z27A 4TX8A 4EPKA 5FF4A 3BDKA 3N2MA 5D2XA 1PDZA 4H83A 1KRMA 1YDVA 3UG4A 1ZL1A 5BXSA 1UJPA 4GYPA 4V1YA 3UVIA 1V3IA 1W9XA 1YX1A 4DAIA 1HT6A 1OK6A 3FFSA 4W5UA 1ME7A 3L68A 4UTUA 2FHCA 2IPGA 3WK1A 1UC5A 2YA0A 1ONWA 3BC9A 4L1GA 4MGGA 3CWNA 4DO5A 4LCQA 2CLLA 5HBFA 1DJWA 1UR1A 3O2LA 1IZJA 2NQ5A 4GUGA 2AQVA 3DKJA 4FI4A 1M1BA 1YPFA 2WO5A 4EANA 2HEJA 3GH4A 3TDFA 3W2UA 4N2YA 3UWEA 4C91A 2IQ0A 2DSVA 2VZUA 4HNUA 2ANUA 5AC5A 1XUUA 3VGFA 4FLQA 1FFQA 2VX6A 3T0AA 1G1YA 5EGRA 3DG6A 1DE6A 2A0NA 2EBNA 1ONXA 5DBTA 1GQIA 3BQ5A 1OX4B 4I9JA 3NSMA 3VM5A 1K9DA 4XSMA 5EMYA 1OIMA 1YYAA 5A6AA 1F4HA 1KXQA 1UQZA 1QXLA 3QH2A 1A5LC 4O8AA 4MM1A 5AC7A 1UD5A 4Q4PA 1DJYA 1RH9A 4PUNA 4IG2A 4Z1YA 3MHFA 3IVSA 1FCQA 1O5KA 3FK4A 5CZSA 3TW7A 2VUNA 2GSHA 3LLFA 5FEZA 3SR7A 4DZ5A 4DXKA 2AQWA 1OX6A 2FB2A 2WZEA 2Q6ZA 1ADDA 1R9XA 1UD4A 3MUZ1 1AL7A 1W32A 1UOZA 1Z89A 1WZKA 3AUOA 1L8NA 1XS2A 4N9CA 1XD0A 4I6KA 4MWAD 2ZUWA 2DORA 2BBFA 4XZ9A 3IPWA 4HZ7A 4UFHA 4UCFA 4ZOAA 1TWSA 3IJ7A 1RXOB 1H62A 2POZA 3IV8A 1GT8A 4HPXA 1Y7VA 4POCA 1TJPA 1V79A 3RM9A 1ITCA 4MAZA 1TELA 2R1KA 2NUXA 1Y5VA 4ZFCA 1K70A 4JEJA 3R94A 5CJ5A 2VFGA 3V5FA 1DORA 2PPGA 5H8PA 1RA0A 3IIPA 4DJDA 1W56A 4PCNA 2DZXA 2A3AA 2OR2A 4H9TA 2W3ZA 3NNTA 1I1WA 5HXMA 2QHAA 3W6MA 2R6OA 3HZ3A 3N2TA 1A4MA 3KTSA 4HTBA 4GGHA 3VFCA 1ZUAX 3WQCA 3TJXA 1LQAA 1RSCA 4H9YA 2AAMA 4J27A 4MOZA 3RCMA 4UNKA 1P1MA 2A3CA 2OEMA 4LVBA 1VJSA 3CHEA 2WK2A 3BV4A 2HXTA 1TZZA 2PZ0A 2Z25A 4OECA 3UY8A 4DXVA 2I5GA 3KTXA 3QZ6A 3CPUA 3ZZ1A 5FL0A 2Q3OA 1JCLA 4MLRA 3JRKA 1W8SA 2WPBA 4CCCA 3UXKA 3IJLA 1SZGA 2GGHA 4AZBA 2CLPA 4LAOA 4YXGA 2E28A 4I6VA 4QFUA 3RRAA 3MHUA 4C90A 4FF5A 1LOLA 1ZSXA 3W22A 5C5YA 1B2YA 1VPQA 2UWFA 1BTCA 4CCEA 2ZRYA 4HN4A 2HDJA 3W2JA 3XINA 5I24A 3KCJA 4JYFA 4O53A 4N7QA 4F0LA 1ISVA 5LA2A 3QR0A 3UWQA 2CYGA 5K4XA 1TIMA 2IXVA 1P48A 2PLMA 1C92A 1EHAA 3GKAA 3L4TA 1WDDA 1LWIA 2P8BA 1VQTA 1D3GA 1VAHA 3ANYA 3QN3A 1EDGA 1JD9A 3UR5A 3HPAA 4CCZA 2J9ZA 3GFYA 1J0KA 3RX4A 1G7VA 3L21A 5C71A 4PTMA 1NY1A 3RAOA 1WP6A 4OOUA 4NHVA 3TSBA 4LAZA 3H2OA 1LWHA 2I1OA 3RNDA 4IISA 2BXZA 3RCNA 3SURA 1EGMA 2ZA2A 4FXFA 2C0AA 2X0SA 1HKMA 3WLLA 3EPOA 2Y70A 3CUXA 1E5NA 4EE9A 3T55A 4S3FA 3B0YA 2FPVA 1REQB 1QK0A 2J6XA 1X1ZA 5ABFB 3A6OA 3LBCA 4GJIA 4WGXA 1U2YA 2PRMA 2QJHA 1FDJA 3ORWA 3Q65A 1QVBA 1E4LA 1H4PA 3VC5A 4C6NA 3ARTA 4GC3A 4XAYA 3L9CA 4DJEC 2HPMA 2MUCA 2ZFAA 4U2ZA 1XGDA 2BOEX 4UR8A 1QK2A 2Z00A 3LERA 1HVQA 2GPTA 3KBJA 3VD4A 1JG9A 4NAFB 2BVYA 4O57A 3LYEA 2J7EA 4QSFA 1V6TA 4XTIA 3NQFA 5F1UA 1GVRA 3KHJA 1WKDA 2DIEA 1M3UA 4BFAA 1BKHA 1OK4A 3PJUA 1HXJA 3PZQA 3VUSA 1GZJA 4C5YA 5DT7A 1RALA 4CUCA 4O18A 1L2UA 1NP0A 2PDJA 4RE2A 4EK7A 4I90A 3W7RA 2GFTA 3PUEA 3ZSSA 1UKQA 1R86A 2R82A 4JQ1A 5D2YA 2CHOA 1SR0A 4TTGA 2OO6A 1ZALA 1NF7A 2GZXA 3G18A 5EMKA 1T99A 3UP8A 2Y7GA 4JBRA 4HMNA 2FIQA 5E1QA 1XSKA 1GVYA 4K8EA 1O94A 2B7NA 3NIYA 1V8EA 4UTLA 3LSBA 5I2UA 2QV5A 4OOZA 5FL1A 3NVTA 3CIVA 5REQB 3RM4A 1C9DA 2FDSA 4QR6A 4I5XA 2XN1A 3QYSA 3QR1A 1S3TC 4GBUA 4U3AA 3N17A 3CZKA 1CEOA 5GPRA 1EJUC 2GJXB 4JN7A 3P67A 3EX3A 1JCYA 3UR2A 4S38A 2A3LA 3NEVA 1K8XA 4JX6A 1CECA 5FF7A 4FSAA 2INEA 2QIIA 3S1XA 2WM0A 4NYUA 3FEMA 3QQ1A 5FJUA 4C6JA 3PF3A 1OQFA 4FX6M 4GNVA 1NTHA 2JBMA 2OT1A 5CZKA 3G1SA 4A8NA 4JFUA 4JHMA 4KWUA 2CIPA 5G2HA 3TZFA 1XLCA 4HOWA 4DBEA 2XHYA 2EKGA 4LEQA 1OC5A 4HB7A 3WLKX 4MNLA 4GIAA 3KZSA 1E4NA 3P5YA 1E0VA 2W91A 4IUOA 4O1FA 2OQLA 1R6WA 2DJLA 3CL7A 5KZMA 1EGVA 3SQLA 2E7FA 3BOLA 4NKCA 4OVXA 3NL3A 4Z42C 5KZEA 3N11A 3GH5A 1G7UA 1MW1A 2W27A 3V0SA 4A3YA 3NQ2A 1R9ZA 3HMCA 4MY9A 3HN3A 3ZWSA 2E5BA 2E6YA 3WNPA 3H4GA 3NQ6A 4S23A 3PHAA 3FKKA 3UJ2A 3CB8A 3EXTA 3MTWA 3T9PA 3E3HA 3W23A 2WZMA 4IUGA 3AAMA 1RQBA 2WSPA 4P7RA 3TROA 1XHGA 2D20A 3VKKA 2EPKX 3L5MA 2E25A 2ZRUA 2BXYA 3KOFA 4CNPA 1OVDA 3VNMA 4V2XA 1EFZA 3PZ9A 1RCXB 3WO8A 3XISA 5A6SA 5D4YA 1R3WA 1WZAA 3A13A 2VM8A 4O14A 2QGYA 5TD4A 4DJFC 4DYEA 4ZQNA 3M6YA 4IQEA 2EQDA 3NZGA 4FNPA 4DBDA 2QCGA 1TUXA 5A6BD 4W87A 1RVGA 3UWZA 4M8UA 3ITTA 1JPIA 3GVQA 1RVKA 5A69A 3KS5A 4H4IA 1DPMA 2R94A 4NL1A 1SZNA 1JGMA 3CUJA 2ZDRA 4O11A 3N9SA 2YIHA 4IFKA 3WMLA 4DBUA 2JEQA 3T0DA 2TYSA 3LCLA 3SN0A 4AQLA 2AL1A 1ZJHA 1OIFA 4PE8A 3ATZA 2Z24A 3WQ8A 5DFAA 4N02A 1ISYA 3LB0A 2J7GA 3G1AA 1EB3A 3IUDA 5BXTA 2FQIA 4IMCA 3UD6A 4UZSA 3STFA 3OP2A 1PXGA 4B91A 3VDBA 3IEBA 4ZB5A 3PTQA 3PUDA 4IXHA 1WUEA 2EPNA 4MZYA 1PX4A 4XG1A 4NZ3A 1CENA 2ZE3A 3GTFA 2HCVA 4KWSA 3R11A 4ML4A 4HCDA 3RU8X 1QWKA 1FWRA 1UB3A 3GS6A 1JD7A 3GY1A 2X8RA 3WQGA 2OOGA 1ODZA 3RLUA 3U8GA 1M65A 4M7TA 1C8XA 4DI9A 4AYGA 1DXFA 5CAKA 5CSRA 4NG3A 3KL3A 4KCTA 3C2EA 2Z1WA 3DHFA 3M5VA 1PYMA 3STGA 1MRAA 3R0KA 2XGZA 4IOTA 3PVFA 2PODA 4UMAA 4QJ1A 4E6MA 1LDCA 3CHCA 4LS2A 4UTTC 3CQ0A 3GXNA 4LGXA 4GHRA 4PL2A 2DIJA 1J0ZA 4K3ZA 4JY8A 1P0EA 3FLUA 3LPOA 4C6QA 2HWGA 4ZGYA 4FB7A 1E1EA 1KCXA 2Y1HA 1I6NA 3QV6A 2YZ5A 4IMGA 2X16A 3CO8A 1Z7AA 1W0MA 4H6KA 1NFPA 1W2PA 1A3XA 5BWFA 1E73M 3HG3A 2IPFA 1YNPA 4XUYA 2E67A 4I5UA 1AQMA 3V3WA 2PTXA 2ZE0A 3M41A 1LLWA 2V5CA 4MDOA 4GMEA 4ECLA 4UFMA 1YBQA 4UTWA 4AC1X 3OZPA 3GNDA 4PBGA 5FEXA 2HS6A 1BSIA 4QISA 3LM7A 4YS1A 4RXFA 3NUKA 2WNNA 3ABQA 2A6LA 2NQJA 5JIWA 3WL0A 4NX0A 3A9BA 3FOKA 3ZJKA 3P8JA 1EJSC 3ARUA 1EGZA 3MUXA 3UZJA 1R8LA 1L6FA 3F1QA 3VD7A 5F7UA 3WQ4A 2YZRA 3LCXA 5EMLA 1EJVC 3IS4A 3W07A 3AS0A 3IIZA 1YADA 2X1TA 4GWEA 2H6RA 3UCQA 1V6UA 1CGUA 3ITLA 4ZOBA 3LZ3A 1JPDX 4I9MA 3AWNA 4W85A 1PZ1A 1JF6A 1EXPA 5TQLA 3W72A 1SFSA 3NQBA 1Q6EA 2Y8UA 4IG2B 3FJLA 1GKPA 3BAJA 1XPGA 2V0TA 3UNDA 2W4XA 3LHWA 1Q65A 4MWAC 1EF2A 1OD0A 2Z7GA 2DH2A 4V28A 3OVPA 4EF8A 1TPEA 3TVAA 2NQ9A 1XLAA 1XDMA 1VYRA 4D71A 1GUVA 2J25A 4ZO9A 4PTVA 1EF3A 1NDWA 1G5AA 1OG6A 3IGHX 5IBXA 1A5CA 3T7VA 1TV2A 1KM4A 3C2YA 4H6RA 1UZHA 2ZOXA 3V0TA 3TH6A 3EGJA 1I2RA 3UW6A 5A8OA 4GPNA 3VZZA 1VH7A 3BCFA 4LV9A 5CG0A 4P7OA 5A2CA 2DVTA 4H9UA 2YA1A 1S2TA 3HG2A 4O4WA 4YCOA 2WHLA 3UZWA 5K3VA 5FAGA 4QAIA 3ABSA 4C60A 3P82A 1CGTA 2JKEA 1PCKA 3PZVA 4LBSA 4Q32A 2DDXA 2XN2A 3QFEA 4AMAA 2P10A 3TYCA 4IQLA 1E0WA 1KFEA 2IKIA 4AB4A 4HNLA 1NF0A 2WLZA 1UR9A 1QFEA 2XYLA 3TNBA 5C7VA 4HP5A 4U5IA 5H6HA 1SFJA 2C71A 1I2NA 4S3CA 4PUMA 5GNZA 4B5TA 4DVOA 4BZYA 2W92A 4AMCA 4NXKA 3AIRA 5J8LA 5GVJA 1EH9A 3UZ5A 3CXOA 2XIIA 1HUVA 2WMIB 4KRTA 1VEOA 3SZ8A 3HTWA 4RE3A 4I8DA 4YNGA 3B3DA 1ZBCA 4H6QA 3SY1A 4Q33A 3THAA 4IPJA 4M6QA 3TCSA 3LCWA 4NVTA 2VTFA 3NDOA 4G1NA 4ACZB 4WIWA 3B0XA 3LI0A 3KCOA 1QPKA 3BSGA 3HU7A 3N2XA 5HPCA 4PMNA 3W7EA 4GI9A 2ATMA 3WUFA 5AECA 4P8XA 1G67A 4Y2WA 1JYWA 1PYFA 3F5KA 1OX5A 4JTFA 3DG3A 5EPDA 1QWGA 3NURA 1P5BA 3U6WA 3D46A 3MCNA 4MJZA 1XRTA 4Y9MA 1ME9A 5E9AA 5G4HC 1HO1A 4PTDA 3W75A 4E38A 1XKYA 1TWZA 2FJKA 2VWTA 2NV9A 3W7DA 3AO0A 1G4EA 5G4WA 4QSHA 1ECQA 3W86A 3DBNA 3AIVA 1PO9A 5G2WA 1MUWA 1V0LA 1IT0A 2VHLA 1B57A 3Q37A 5D9OA 3EDFA 3B97A 1BYAA 3LBMA 3IIXA 1Z9AA 3K30A 5LIWX 4A22A 1VBRA 4NZFA 1EA0A 3E9AA 3BOFA 3SFKA 2QXWA 4KWOA 5C9UA 5D9PA 3HPXA 1TR1A 3WFAA 1OFPA 2CLHA 3NPUA 2FGLA 3GDKA 2YL9A 5HWMA 4H8HA 4NU7A 5LGZA 4DXXA 3R8RA 3TEVA 1NH6A 4P7LA 1S5VA 1YKWA 2P50A 3R0DA 3RO6A 4LALA 5I23A 1GONA 3PG8A 3WNLA 4UNIA 4IX2A 1ZPTA 2Q01A 4J4KA 5LNUA 3BLFA 3BLDA 4MVAA 4LUTB 4WZHA 1XI3A 4RR4A 1FWSA 3CMFA 3K4WA 3H2EA 3WNOA 2XU2A 2NUYA 3WDRA 1ZS2A 3LHYA 3T44A 2PWUA 4B2DA 1GVQA 3MUY1 1WBHA 4LPCA 2DZWA 4S3DA 3D3AA 4OT7A 3FYPA 1HKJA 4RV3A 1PBGA 5J5RA 2PDFA 3RILA 3M0MA 3MO4A 4ICMA 4AD0A 3WK3A 1KXHA 4OUIA 1P0BA 2YLLA 4LRSA 1JZ8A 4KFNA 2UY5A 3C52A 5K9XA 1KNWA 4ZCWA 1K6AA 5I5RA 3VNDA 4AYSA 2A3BA 3MMTA 3HA1A 2OZ3A 5AFDA 1BTMA 1JDAA 4QJ3B 3KOYA 3OYXA 2RKXA 1EKOA 1UR2A 2DZPA 1A5AA 1DYSA 1BSLA 1P6CA 4LYRA 1H1ZA 2J4GA 3K1GA 4AEOA 1VRDA 5LYRA 3W1PA 5F4XA 2AQOA 1WDPA 3B40A 4GCXA 4L4LA 4DJDD 3E0FA 3KOWA 3GHTA 4M80A 4UXDA 1QW9A 3RMJA 1PWLA 1UG6A 2WHMA 3EB3A 3HFYA 4JTHA 1KFLA 1FQ0A 1B3OA 2XVGA 4PH6A 4WLCA 1IXOA 2ZVIA 3RLHA 2ON3A 3PZGA 4L64A 3WQDA 4JIHA 2GOKA 2ISDA 4XD3A 4YL2A 4R9OA 2Y89A 1E0XA 1TTPA 4AWUA 5LZLA 3CEPA 2J66A 4JTJA 2QUMA 1HZYA 3O6DA 1LROA 1XBYA 1QT1A 4H9XA 3F03K 3NQGA 3BQ6A 5M17A 2Y4SA 4Z1AA 5CC3A 2XH0A 5DO8A 4YTSA 1X38A 4BI6A 4M29A 1Q8AA 3BLEA 1DWHM 1NOWA 2WPGA 5EYWA 4HPNA 4Q8PA 3PPHA 2QDDA 1VCVA 3SRFA 2C1IA 5JIPA 1W3LA 3S2CA 1PCWA 1LL6A 5FSDC 3VC6A 4QBXA 5EA9A 2ZTJA 1F6YA 4AWEA 3A24A 1R2RA 2OWCA 2PWVA 1DJXA 2D2OA 3FA3A 1SGJA 4MJ4A 1WB0A 2Z1KA 3KUMA 4YTUA 3BVJA 1E72M 1LBFA 1NDZA 3S1UA 2D3NA 1UWRA 4AUBA 1KM5A 4R34A 3OLEA 4J35A 3O3RA 5HOSA 1IT7A 3W1RA 1GJWA 2IKGA 3RF9A 4UUIA 3N4AA 4C6CA 2PWHA 3HIJA 4MHBA 1IR2A 5PTDA 1KTNA 4J3UA 3KRUA 4IFOA 4EKJA 1WV2A 2XN0A 2EJ1A 2AGKA 1B0IA 5IFPA 5TBOA 4YYCA 4IZGA 3M0IA 1GOXA 3SI9A 2C7FA 1CXEA 2XH7A 1HJUA 1B3WA 1XKJA 4E3TA 1E6PA 3BMVA 3QYQA 3ARVA 3SRKA 3W53A 4U4MA 4ENLA 3WDJA 4EXBA 2PGEA 2DZAA 4DM1A 5E9XA 3BZJA 1F3EA 3NXLA 3IJ6A 1E9ZB 3HBLA 4TR9A 2PRHA 5D05A 4OFCA 3I68A 3TJLA 4FPSA 3DC8A 3URQA 1I4NA 2BY0A 2PDQA 4REQB 4UTHA 4IMFA 3AC0A 4GKLA 1UWIA 5U4NA 1V3MA 2XGIA 4H1ZA 1A49A 6ALDA 4DB7A 2XZ9A 1RK6A 1ONRA 3KAOA 1Q3NA 4PB4A 2GOUA 4H9MA 4XZBA 4FAMA 1S38A 1UR3M 3ZM8A 3UQNA 1N7KA 3ZYZA 4QJ4B 1E6ZA 4Z17A 4AF0A 1FWAC 3PUOA 3CO4A 4WJ8A 2CWXA 3IGUA 5HAOA 4MY1A 3EEGA 1G4TA 1J93A 4JXCA 1P0KA 3H53A 2ESCA 4MDPA 4UOJA 8CGTA 5LIKX 3C2RA 5D32A 2FZMA 5HR6A 3WH5A 3ZJ6A 1C8YA 3SCPA 3U57A 3IRDA 4H8NA 1HGYA 3RR4A 3WF1A 5B7ZA 1IWPA 4ADSA 3VNIA 1E55A 3G1RA 5E70A 1WA3A 1TR9A 4CNSA 1XICA 1TQXA 4LB3A 5F2MA 2QF8A 4QEEA 2B7OA 1CI1A 4S3BA 1V02E 3UPWA 5CGQA 1QJWA 4F3HA 4KCUA 4E4PA 1JNDA 5HWJA 3A4WA 1RPXA 2I14A 1JCJA 3T0BA 2E09A 4X0VA 2VFDA 3EMQA 3KM8A 3SW6A 3KTCA 5GJMA 3ABXA 3MBFA 2Q8ZA 3ZXWA 2GGGA 3LXBA 4JAWA 3H7UA 1SPQA 3UFYA 3BWWA 4V15A 1TX2A 2WNQA 1XCWA 2Z29A 3MDUA 3UXDA 3WLIA 3R79A 1VIZA 4MWAE 3WNKA 4QLJA 4B5NA 3K5XA 1RJRA 3QY7A 1YTKA 3EX4A 2A6NA 4IX0A 1KGUA 1GKRA 3BAXA 3SEPA 3TN3A 2D0FA 3H70A 1UJQA 2AMXA 1UUMA 2EXOA 1JUKA 4BJHA 1VFSA 1UR8A 3GXIA 3UXIA 5E0KA 4IIGA 4NASA 3MDWA 2OX1A 1IWBA 1XM3A 3TN6A 1A4LA 2J13A 4CNNA 2BNJA 2XIBA 2J62A 1UW9A 4R27A 5BXPA 1IXQA 4LUSB 1XBZA 5B7YA 4KKXA 3JS3A 3QMTA 1M03A 3TYEA 3SCRA 2EHHA 4L6HA 1Z44A 5FSEC 4WKAA 5F4WA 2JE8A 3FDKA 1FWBC 4QE4A 4Q3MA 1OFBA 5IFTA 2W62A 4UTIA 4IGNA 1WKYA 2RDXA 1U83A 4JIQA 3W7OA 3OG3A 5A1AA 1KV5A 2QV4A 4AHPA 3BJSA 3RDKA 2AKZA 4QCEA 1UR4A 2NZLA 1QPOA 3BGAA 4FHAA 1XC6A 1ZBWA 1XRVA 4GXMA 1WBJA 3POCA 2BVTA 4ZEPA 3RX2A 2J78A 1SFTA 1KBBA 3AJXA 5CZ0A 3L2IA 1PZ0A 2V3EA 2V63A 3SDOA 4AW7A 4HKPA 3WLRA 2L5HA 4JCLA 1NARA 1I0BA 2Y0FA 2WBKA 2E5CA 2OO0A 3H55A 1CXLA 3WBEA 3KL0A 2ACQA 4BKNA 4HSNA 3PS7A 4DX3A 1EYEA 1GZ1A 1PB0A 1OYBA 2ZUNA 2WNWA 4UTMA 5HR7A 4JDYA 3RFAA 2ZUUA 3W7KA 3MS8A 1PIGA 4PSPA 1IGSA 1AW2A 1ZJIA 1TUFA 3LHUA 2FVMA 4IQDA 1IQ8A 1TPDA 4H41A 3LPGA 3W1LA 1EJRC 4AZGA 2ISSA 3R89A 5A8QA 3NXFA 7REQB 1UMYA 3ITXA 1J18A 3N6HA 3GVRA 1JCTA 5AHMA 2WQDA 4QP0A 2X30A 4AHOA 2J74A 5K4ZA 1OYAA 1XDLA 4Q4QA 2NWRA 1ZY9A 5C70A 5HNUA 4IGSA 1EPVA 1D3HA 4EWJA 1MQRA 4OE7A 3EEZA 4I7WA 1J12A 1OADA 3N14A 1TCMA 5BOFA 3KLKA 1D7FA 3EX6A 3ICJA 1LORA 2XGBA 1UYQA 2INFA 4GVIA 3KP0A 5CH9A 1L9WA 2IQDA 4GYPC 1JRCA 1PKYA 5BMXA 2IXUA 2XDFA 4Q22A 2QS8A 3W85A 2W67A 4C1NB 4BHYA 4B4HA 3M0LA 1V6YA 8XIAA 1QI4A 3A4JA 2P88A 4LEFA 1NQ6A 1NQKA 3CQIA 4LAUA 2X09A 2WJZA 3ITCA 3N25A 2XIMA 1HF6A 1JL8A 1VENA 1ZHAA 3TP4A 3AU6A 1A5OC 2R1PA 4O16A 3NO5A 4CN6A 4FIQA 3IJ8A 3M9YA 4GH1A 4DM2A 4AZIA 1XR2A 4JYEA 1F9CA 1GOKA 1DBTA 3WCZA 1B4KA 1ZU8A 1Q6QA 3DXIA 1XIIA 3R1ZA 3CV6A 3FDGA 5CBJA 1LLZA 1UP2A 3UPMA 2G97A 3CNYA 4NZ4A 3WH9A 1UH2A 1I0DA 3HQ1A 3M0XA 2OEJA 1DQUA 3W2MA 3WLMA 1EYWA 1B9ZA 1S5TA 4JOMA 2WSKA 3QHOA 4M1BA 4JQ2A 3RG6A 1K7EA 2R91A 1R3TA 2JIWA 4TIMA 5HJLA 1SFLA 4Q4SA 5TAOA 5A94A 3F4VA 3PZNA 3L66A 3P80A 3OODA 3W83A 4MF4A 3TR2A 3PNUA 3OBAA 2QCNA 4O12A 4JX4A 3TU9A 3WY1A 5C55A 3AIWA 4IPLA 1GWJA 2YBVA 3CAKA 1WAWA 1HTIA 4R33A 6PTDA 5H91A 3H12A 4ZMGA 1UZDA 4CLMA 3WF2A 1FCBA 4A29A 4ORMA 4AZHA 4R7OA 4DBWA 3LMYA 1KCZA 2PTDA 4GH3A 4HSOA 1OABA 5ABGA 4AFYA 3N04A 2FTWA 1SO3A 1GVIA 5I03A 3S5NA 2D2JA 3O8AA 2NXIA 2D0GA 2CXGA 3L7RA 4Z1DA 1CYGA 1GVFA 3PBUA 2NLIA 1PSCA 3ABOA 1FHUA 4DJDC 3I7SA 1M01A 3AXXA 1X8CA 1XSIA 1XYMA 4HNCA 4D6DA 2Y85A 1HJQA 2VGIA 3WLTA 4JFTA 5U7SA 5LA0A 3PSWA 1Q6GA 4JQ4A 1Q5MA 3EOSA 5LKYA 1S46A 1CBGA 4FF7A 1D8WA 2DPEA 1E6XM 1OINA 5M1TA 3U2CA 3UCCA 1U1JA 3U2ZA 2Z4GA 1WX0A 2GUUA 3LD5A 4XZNX 2O92A 3MUAA 1Z42A 4NF7A 3DESA 2P3ZA 3IJIA 2WNZA 2QCDA 3GNOA 4RNIA 1YRRA 4QROA 2VCCA 6XIMA 4HHLA 3O06A 3NPVA 2W63A 2V2HA 3W1MA 3W9ZA 3FKRA 3PR2A 1VB9A 4MFDA 4PTXA 2DFAA 1NFGA 3MKKA 1TZ9A 1WDSA 3WQFA 1GORA 1EZWA 1DTUA 3LA4A 3SN1A 4P7QA 4HOXA 2VX7A 2MNRA 5FCZA 2PGWA 5FA5A 3T2PA 1XFBA 1XIEA 1XC4A 1EBGA 5CKSA 1QPRA 4WDWA 2V3FA 3CC1A 4YTRA 4JEQA 3N9KA 2FHFA 1NFBA 4IHCA 4G7EA 3HJZA 4LY4A 4AZ6A 1N8IA 3FS2A 4HSHA 1ITXA 3OIHA 4CD5A 3W25A 4Q8UA 1H7NA 4JR5A 5A6TC 2YCLA 3BAWA 2NXGA 3C2OA 4NNCA 4JZ5A 4XBSA 1DIKA 3L4ZA 1TTJA 3COTA 4FNTA 3VK5A 2VVNA 4DUOA 3L12A 1KTCA 4JN8A 2GVYA 1R30A 3NPWA 4XBKA 1VP5A 1V3JA 1EUNA 1XV8A 1BFNA 4F66A 2DV0A 3SCQA 2G37A 5ECUA 4PA8A 1HQTA 4JIIX 4NX5A 1GVOA 5KSWA 4LQ1A 4JNMA 2VWSA 4B3LA 4INFA 1PX3A 2DUZA 4LJ3A 1W91A 3IUHA 5E0CA 4RDZA 3WMCA 3CAQA 1YLVA 3W24A 1TJ0A 5FJIA 3WEOA 5JH1A 2ZICA 1ZCCA 4FNRA 3CWOX 3P0XA 4GRSA 3ITGA 4HZMA 3HOJA 2CESA 4M6VA 1XLKA 3CTTA 4R9XA 1XPYA 4UQ9A 1K8YA 5CPNA 3T0TA 3M43A 2VX4A 4GVHA 4GYJA 3HQPA 1TV4A 3ZLGA 4QITA 3NQMA 3VTRA 2CPUA 2E6DA 3HPZA 3U7VA 4QTGA 1KWKA 2BVWA 1KRBC 4RJEA 3ALFA 3LN3A 1DP0A 3P2VA 2TAAA 3H22A 2WW5A 1UUQA 1YPIA 1MDRA 3GIYA 5M2FX 4KIEA 3H21A 5DXYA 4LC8A 4C6KA 4B2DD 3S46A 5LXEA 1O5XA 1W1B1 3LRMA 1UQYA 5M5DA 3ITYA 1WDRA 3R8HA 4BQ2A 3HGRA 1EC7A 2YL5A 3DGRA 3O6AA 3BANA 1YIXA 2Z1SA 3AYVA 3OVGA 3APTA 3CIWA 1RD5A 1HN1A 1LRTA 2VEMA 3UJFA 3QV7A 3M5ZA 4W84A 3CL8A 3FJ6A 3CUIA 4ZBCA 1PHQA 1WXYA 3VM7A 2C0HA 5AYIA 2A7PA 4MKSA 1GPWA 3S5OA 4M0XA 4X2RA 1H60A 4W5ZA 4A8IA 3LENA 3T1GA 3OJGA 3S8HA 3LTSA 4M81A 2E8YA 1CB7B 1TA3A 1JI2A 4IQJA 4IPNB 1QBBA 1X96A 3MV01 3TNOA 4JTSA 3W82A 4ZODA 3FGCA 3CT2A 1LWJA 2DSZA 3SSJA 4XAGA 4IP5A 3TW6A 3NYZA 3KVMA 5HMDA 3D6NA 2H8ZA 4HU4A 3EWZA 4JCMA 2PD5A 3VIMA 1WOBA 2E9BA 1F2JA 4FNSA 3FV9A 1UHVA 2P0IA 2OG9A 1JZ5A 2QUNA 4XKYA 3N3MA 2ZKMX 2YCJA 3A3WA 3TAKA 1VF8A 3SAZA 3NQVA 3FY1A 5JMUA 3GYEA 3BGGA 3IAQA 3WKZA 1F3TA 6REQA 3T0CA 1G0CA 1AUSL 3BG5A 1RQEA 1EXBA 3EWUA 4J2MA 5G2IA 1OCQA 3E2SA 5AHIA 1FHLA 1BG9A 2VR2A 4JTUA 2F6KA 3QW3A 4WSHA 2XG9A 1RD6A 1K7FA 3RU6A 2J8FA 2V30A 5DCDA 3TLLA 1YHTA 1DWIM 4M24A 4NJKA 5D9NA 1E1FA 4AU0A 1RCOB 4RL3A 3QEZA 4GG9A 1XLIA 4IF2A 1GQLA 3PB2A 2YDRA 3M0JA 1Q4NX 5BXRA 2UZ9A 4CU8A 2PWFA 2OGYA 5FESA 5AC8A 3BSHA 4PMYA 3ISIX 1P0NA 1V77A 1IWAA 3T6CA 1LJYA 1BVNP 4P8UA 3UJEA 5LIXX 5A6MA 2A4AA 1VYSX 1K1DA 2JGYA 3RR1A 3TTSA 2VC6A 5HUPA 4UQDA 3H2MA 3GIQA 4IWWA 1Q63A 1B3ZA 2D23A 4FLSA 1BYBA 1MEHA 4X0NA 4HNNA 1H63A 1A5SA 3PBYA 1E9IA 7TAAA 3NGJA 3H2NA 3PULA 4GVGA 3OEXA 1LL7A 2O0TA 4DNMA 2Y24A 5MKGA 1HKWA 4WY0B 5FEWA 4F9JA 1KKOA 5FF0A 2UY4A 2YOCA 5CZJA 1UWQA 5T8GA 2A79A 4RDVA 2OZTA 2HXUA 5C9RA 1OFDA 2FGBA 3WK0A 3WSUA 2EG7A 2I9EA 1BQCA 1J10A 3TZNA 4Z1CA 1QOPA 2Q02A 4GY7A 3ZT5A 1X8FA 2VCBA 1ISWA 3W1UA 1XYCA 3WF0A 2VP8A 1LRQA 2WQPA 2CHNA 1IXPA 4RK8A 4XUGA 3GFZA 3SADA 3W2NA 2DQWA 2QPUA 3O9NA 3KRSA 5E6YA 3QSTA 1WCGA 3GDLA 3VX0A 8XIMA 2DU2A 4NY2A 1V3HA 3ARWA 3OHMB 3FXGA 1F5ZA 3UXLA 5BW6A 1H51A 1EJWC 4L65A 3W2KA 3VMNA 2J8TA 1CGVA 1J5SA 2PSNA 3G5EA 2D2HA 2Y6ZA 2ZDSA 2ZTKA 2WMKA 4D6IA 1ZAIA 1MWOA 4HQVA 4H8VA 3S5SA 3TV8A 1RBLA 4L80A 2HV5A 3ENLA 3QF0A 2RGMA 1H2JA 4EIVA 1DE5A 3A4AA 2C79A 2VRJA 3MW7A 5CCZA 2OCZA 3L23A 3WD0A 2CLIA 4IP7A 4B5WA 4B5XA 3GFXA 1X1NA 4HU0A 2FZNA 5AHLA 1WDQA 4V33A 3DX5A 2V5DA 3B9OA 1HL2A 2J77A 3SUWA 1PE1A 4Y8EA 3TYDA 1H5YA 2CXEA 1F8IA 3MP3A 4DZIA 4MZ8A 2QJMA 1QATA 1Q8JA 1YTDA 4M3PA 3TSDA 1ZP4A 3E2QA 1J9YA 2DT3A 1KM1A 2NX9A 3CHFA 3LV5A 1AD4A 1CX9A 4PL1A 4A8RA 2WMJA 2GDUA 1AW5A 3GXTA 4EF9A 5B80A 1LP6A 2DUXA 2F84A 4DELA 5A8PA 3JW7A 1X6UA 3EOOA 3O1NA 3AMCA 4IJRA 3PUGA 3UWWA 4KGLA 2OODA 2QVHA 1NWRA 4DWDA 4EOUA 4O0QA 3S1WA 1TVNA 3GSMA 1P43A 1DHKA 3F2BA 4UTWC 3W81A 2ZZ6A 3SECA 1W3KA 4F2TA 1XISA 3DECA 1F74A 2OT0A 1KGXA 4JTLA 3WMSA 2BVDA 3G8EA 1Y65A 5D09A 3NZQA 5D33A 1GYLA 4G1KA 1EBHA 3OW1A 3F4WA 4RW5A 3HB9A 2ZUSA 4GCAA 1J0HA 4JKLA 2OZ8A 1A47A 4C6DA 2PCEA 3PWGA 2FVKA 3ARXA 2H3DA 3PNZA 3VOCA 4OQVA 1NWSA 4RNHA 4J40A 2VEPA 1OFAA 4S2BA 5CXPA 2P3EA 4AEFA 2YW3A 4B5VA 4KERA 4NI3A 4DWSA 3LNPA 5HANA 2FB3A 1VJZA 3B0VC 3EPNA 3VGGA 1EP1A 1TFVA 2WHKA 3BLLA 3MSGA 4W8BA 2EJAA 4Y9PA 1TB3A 4KH2A 4R53A 3LS9A 2BG5A 2PU1A 3OZMA 2F8QA 4ERAA 2XUCA 1UKSA 2WWDA 5IBXC 3VGHA 1CXHA 1HJSA 4Q7NA 3G22A 3W71A 4M1RA 3P93A 1JUBA 2ADAA 3GC4A 3QSRA 4ZQOA 3DHPA 4N9BA 3U7BA 2FZ8A 3HV9A 2FTYA 4GUFA 1M41A 3XIMA 3VMPA 1MNZA 4TV6A 3RGTA 1GHSA 2EPOA 4FEZA 3VKDA 4HNOA 4W7VA 3HF3A 2ZZ3A 3L0KA 4AD1A 2B7QA 2VZVA 2WCAA 3O07A 3W38A 2PDLA 3E2RA 1X1OA 4P61A 4DYKA 2Y7FA 4NQ1A 5LGXA 4AISA 4IP4A 2OXNA 4JS3A 4AZ7A 1SSDA 1NOFA 3LBOA 2ZX8A 3UA4A 4BR1A 4PUKA 4GKTA 3DFSA 3P14A 1KFWA 1W5PA 1K3UA 1MUMA 2F2HA 2GK1B 2XFWA 3UPBA 1NEYA 4ZQPA 3AZRA 3WN6A 3WL1A 1W3HA 4EP8C 2QCDB 3UR8A 1JAEA 2F7FA 2WMHA 3L4WA 2CLMA 4GIYA 2WJDA 1TE6A 3QOKA 3GXMA 4GC4A 3B8IA 1US3A 3GU1A 1GQNA 1JUEA 1X6NA 5FF2A 1C93A 3DIPA 3OB8A 4JL2A 4OGZA 3GNRA 1WKFA 1TREA 3GKFA 4XVEA 4B92A 3VPLA 1XIGA 4AVNA 4O28A 2I7GA 2NT1A 4Q8TA 3MCMA 4WXZA 1W3NA 3VD5A 1JFXA 3WLNA 4L61A 3ZLHA 3A22A 2BOFX 1VIWA 3WH8A 3VIIA 4KIRA 1XLDA 3EX2A 2D69A 3TTYA 4G7EB 3W7NA 1A3WA 4XZWA 4M6PA 1BVZA 1OSEA 5I07A 1ZAHA 2OSWA 3AROA 3E02A 3GHUA 4TQTA 2PDNA 2VI0A 3WYZA 3TR9A 1LM1A 3LGDA 4JTGA 3PPGA 3KXQA 3MJMA 3IARA 4I8YA 1X97A 1LT7A 3VOGA 3HPSA 5CLTA 1K77A 3QHNA 1UD8A 1A5UA 1BQGA 1EL3A 1ITQA 3PP7A 1EHNA 3RPMA 4H01A 3UBPC 1RZMA 3S1GA 4MWAB 3GXFA 3MSYA 1R3VA 4OWGA 4PEEA 4EXQA 3S47A 4DJFD 4PTNA 2BV9A 4L9ZA 2DSWA 1EP2A 3NSNA 3VIOA 3M0YA 2ZZ5A 1QI5A 3N4EA 3PZOA 3BTNA 4FP1A 7ENLA 3LV6A 2GUBA 3E5PA 4L56A 1MXDA 3QRHA 2YL6A 3VABA 1YMYA 3G1VA 1CLVA 1MXGA 4MIMA 1XYBA 1EDQA 1L2QA 3A5FA 4A05A 3GTHA 5RUBA 4DLMA 1XBVA 2CLFA 5A6KA 1U5JA 4UC5A 4FNQA 1OC7A 1THFD 4HK5A 4NJHA 1ZLPA 4L6OA 2D2GA 2OKOA 1U30A 3AHYA 1YE6A 2XVNA 2E3ZA 4WDXA 2FHBA 1KO0A 3N15A 1OT2A 5FEPA 3TW9A 5HMSA 2WSQA 1E40A 1LF1A 1K9EA 3R10A 2OQYA 1UCWA 1S39A 2XVLA 3LRKA 4JFWA 4JTIA 4U3CA 1E6NA 1QOQA 2IPWA 1RJPA 2VZSA 1BVWA 1FH7A 1WXJA 2BFGA 4MB4A 1C8QA 2GQ8A 3ELFA 1HP5A 4QRNA 1MXSA 1B1YA 3BURA 2QNEA 3K46A 4LBRA 1PTGA 5G4EA 4CQ8A 3TYZA 3UT0A 5F2GA 5AN7A 3INPA 1J5TA 3ME3A 3FGCB 2WVVA 4P8VA 4ZSUA 2FDMA 3VIHA 1W5QA 2Y8VA 3SO7A 4MJMA 3A64A 2G5WA 1Y5XA 4A6GA 2CKSA 4IJCA 4UQBA 3WQVA 4XTDA 3CASA 3E12A 2OFJA 3S6DA 4PMJA 4DEFA 1W1YA 1M53A 2O9PA 3GHSA 5BOEA 1EEXA 3WNNA 4N6EA 1OZMA 3NZPA 4MJ2A 1KBKA 6TIMA 4Q6XA 4YHGA 4UBPC 1R9YA 3WQPA 3WEMA 4M5PA 3CZGA 4N9EA 1A3HA 4OJYA 3PFRA 4DY1A 2XWEA 1VCFA 4H7VA 1HJWA 3AMDA 4G2DA 2QUTA 1UH3A 1A5BA 1QO5A 4M82A 1W3JA 1H7XA 3ONCA 2JKPA 3DHUA 5LXXA 2W6RA 2VZTA 4AZCB 2R14A 1AQFA 4CKQA 1EIXA 4FIRA 4KETA 2A3HA 1F6KA 3PK7A 4YYFA 4HYVA 1O1HA 5FJRA 1E4MM 2B0MA 3UNTA 2F9RA 1GOIA 4S3AA 1PAMA 4HHHA 4LVAA 1W5OA 4HN8A 2PDHA 3OQEA 4Z08A 1XD1A 3SFWA 5LNSA 2YLAA 3OHIA 5G1YA 3NGFA 3NQAA 4QDMA 1XDJA 3AXIA 1K4GA 3W87A 1JXKA 3NZRA 2CC0A 3C86A 2Y5JA 2OELA 1GCYA 5AHEA 3GBDA 4OKDA 2VUYA 2DVUA 5XINA 1XF0A 2Z1VA 2YFOA 4B90A 3KP1A 3FA4A 3M0VA 5C2XA 2C19A 1W5NA 3VNJA 4WQ6A 1QNRA 4Y7EA 4D8AA 3QGAC 3TMLA 2HVMA 1T8QA 4UR9A 1EOMA 1GG0A 5IHRA 3WQEA 3CMJA 1L6SA 4KFOA 4PRRA 1A53A 1TZ7A 2FH8A 1FHDA 5K9DA 4MKNA 4OUEA 3VYLA 1CLKA 4Q8OA 2I5IA 4ROPA 4AAJA 4J9JA 3ARQA 1VPYA 2R9RA 3CLWA 3LLXA 9XIAA 4O1DA 1L8PA 2DQXA 3GU2A 2YW4A 4LVGA 1VPXA 2XM1A 4RW3A 1FA2A 3NSXA 1GYMA 3H24A 5I00A 5DRCA 3W88A 1S3HA 3G77A 2YYTA 1H5VA 4YVPA 3V0UA 3O7UA 4XD5A 1BRLA 1TRDA 3W7GA 3W7CA 5AY7A 3LG3A 3HMJG 4PFHA 3KDOA 5EU9A 1QR7A 3UWYA 3FJ4A 2V2CA 2DGAA 5D02A 3EX1A 3M1ZA 3B8WA 4ZTYA 3DYMA 1KA9F 4D8ZA 3W76A 2R1MA 1C3FA 1GPFA 5C2GA 2GDQA 1ITUA 4UTFA 2PDYA 2PP1A 3P60A 4N6FA 3NVDA 3V1PA 1B31A 4PMZA 2BXVA 4OU1A 1FWNA 4J3SA 4YWIA 3E49A 4ZXOA 3RLGA 5AOUA 2VEFA 3BG3A 4H04A 2PC8A 2AKMA 3CU2A 3RK8A 3VA8A 4R5EA 4JTTA 5CC6A 3NWRA 3AFBA 3UG5A 5I7GA 2QMKA 1AK5A 3ERPA 2REQA 1FXPA 4P5UA 3B0UX 4JTKA 1FTXA 4FLRA 1S2AA 1O6IA 1N8WA 4F48A 3R13A 2BWGA 1KM3A 1IZCA 1XIBA 4XD4A 2PURA 2Q09A 3KBVA 1W3TA 3D47A 4PCTA 5CG7A 1LUCB 4LS0A 3BLIA 4HYWA 1Q6LA 1B3VA 3MKCA 3NJ3A 2OTDA 1NWTA 3VIPA 3DH7A 1JGIA 2EF9A 3UZYA 3OLGA 4NI8A 1LRNA 3H23A 2ZIDA 4H9ZA 4YJ5A 3TXZA 2DUAA 1IV8A 4PODA 3H6OA 3TK7A 2OU4A 4CVWA 3VKJA 4TV5A 4DF2A 3WDPP 3CHDA 1TJ2A 3S9IA 4OV4A 1JYVA 3AOFA 1UP0A 3EWXA 4PSRA 3R7MA 3KOZA 4IL0A 4KF1A 5L9FA 1PJ9A 1K6WA 3QC3A 2Y2WA 3AS2A 4PMUA 3N2CA 4YHEA 2VFFA 4EAMA 1LZOA 4GLEA 2ZRZA 1GOQA 1M7JA 2HJPA 3GYCA 3PFMA 1P0DA 2JF7A 4MLJA 5I3FA 3J7HA 1G4SA 3W0KA 3PANA 1C9WA 1W9DM 1RCQA 4TX9A 3GDBA 5EBUA 2WM1A 1RLDA 3CQJA 3TOYA 3QHMA 1FH9A 4PR4A 1MQPA 3EXSA 4GD0A 3A3XA 2WJFA 3KHDA 5AZ0A 5LIUX 4IPPA 5A6JA 3CHVA 5AZ1A 1U1HA 4US5A 3QFWA 5BRBA 1JPMA 5JVLA 1ZGDA 1FUYA 5ABHA 4XO7A 5JBEA 3VMOA 3K8LA 3PWAA 2I5QA 2QUUA 4B5SA 4LW7A 1R3QA 3T07A 1QBAA 3T09A 5CJMA 3ZJ8A 3VOFA 5I06A 1W9VA 2O7QA 4GQQA 4H6EA 2ZXQA 4KWWA 3W6LA 1KKRA 3ZOAA 1XLLA 2Y88A 3DUGA 4O1CA 2J9XA 1EP3A 4IJBA 2QEZA 4FOKA 3OZOA 3LGGA 1ICSA 1OF8A 3TTOA 4G8TA 4IMDA 3CIXA 1E1CB 2CEQA 2PDCA 2AL2A 2ZVRA 4HA1A 4PCPA 3RPTA 3BAYA 1S2UA 3R0UA 1H0GA 4FXJA 3AZTA 3GH7A 3M6DA 4XZLX 4X61A 3S5ZA 2OQHA 5HK4A 3WQOA 1LOSA 3TC7A 1V0MA 3C8FA 2HMCA 4KCWA 3V5OA 1QUMA 3KOXA 3K8KA 1IR1A 3QMSA 4PMQA 1OBAA 1R2SA 1BXBA 3ABZA 4MMWA 2E1DA 1CCWB 4GIEA 4R7WA 3S42A 1UD3A 2YPIA 4BWLA 3II1A 3NO3A 2ZC8A 2G0WA 3EKLA 1O4UA 3KZPA 4PB5A 1KFKA 2GVEA 1A80A 4KS0A 1GOMA 3UYCA 4J3ZA 1DKWA 5EL1A 1TRIA 2V5JA 1W6TA 3ZSTA 2H3BA 2G3NA 3ZVHB 4O17A 2YA2A 4RZ5A 3BE7A 3DENA 4GY1A 3LY0A 5BMWA 2ISFA 3SUUA 1G6CA 3VUPA 2ZRWA 1E3ZA 1SW0A 1XLGA 1Q2RA 4Q8NA 3GU9A 2A5HA 5ABTA 3U9IA 1X7FA 5LNVA 1XH1A 4LTSA 1Q6FA 1C8VA 3ZLFA 1C7SA 4DZAA 6ENLA 1NSJA 5EY5A 3VD3A 3MQTA 3MB9A 5DY3A 3GAYA 2ZWZA 4LNCA 4ATDA 4U5KA 4KFPA 3UGRA 2O9TA 4UTKA 2QMJA 3FYOA 1MEIA 3W1TA 1I75A 5D2WA 3T05A 2J24A 1YDNA 2CU0A 1JCMP 1R47A 5AVNA 1BWKA 3MKVA 4IM4A 2ZRXA 5CJNA 3LCGA 3LI1A 2R1NA 4PUDA 1YTEA 1W9PA 1U33A 2QCHA 4WX2A 3GDTA 4EACA 1W2VA 4GVFA 5FD0A 3DOPA 4DWSD 3C8NA 4OBSA 1SSGA 5E09A 2QW5A 5DLCA 4E4UA 1B90A 4GBDA 1AJ2A 3W6YA 1ZBKA 1RPKA 1H50A 3ZWTA 4W8LA 4GNJA 4K36A 1ZBVA 1EPXA 2H90A 1HG3A 1TE1A 2WBGA 5DEZA 3ECQA 4ZB0A 4HVXA 4W86A 4K7VA 1XIMA 2BGSA 1YQ2A 1ADSA 4MKVA 1SU5A 2I9UA 3PY2A 2UV8G 2RFGA 4E5TA 1Q7ZA 4F79A 4D6CA 4BA0A 2Z2AA 3W70A 4ZENA 2I16A 1MZHA 2HK1A 4KQNA 3W7LA 4KGJA 1QTWA 3KFTA 4K8GA 4PRWA 4GI6A 1REQA 4O1BA 5DANA 3N73A 2JQXA 4E2BA 3H26A 4H7CA 2V69A 3EA3A 3GR7A 4CEUC 5ABFA 4ERIA 3R2GA 2G50A 3R6IA 5C9XA 4U2YA 1FHVA 2P76A 2DW6A 4HHPA 3OBKA 1QI0A 1UWAA 4ZVJA 3VKCA 4Y9NA 3REQB 2OSYA 1VZWA 1HKVA 2DZVA 3W1XA 1PTAA 4DAFA 1PTDA 4LCSA 2VEIA 1Y0EA 3H2AA 2AMGA 4LYPA 4JIPA 1SYTA 3CZEA 1F6PA 2QF7A 4E8DA 4ROQA 2YXOA 4NAFA 2QZRA 3TIMA 4ZXLA 2YBUA 4IFRA 3CAWA 2VC5A 1SMAA 1TX0A 2E9MA 3G1YA 2FTPA 3NEHA 4DYJA 1MUCA 1JZ3A 2C16A 1JI1A