4ADUA

Crystal structure of plasmodial plp synthase with bound r5p intermediate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
278
structure length
278
Chain Sequence
NDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase
total genus 96
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4aduA00
3G1XA 3GIYA 4WUIA 3TROA 2B7NA 4AH7A 3DKLA 1P0NA 3HPSA 3BARA 2FPYA 4N02A 5D37A 4Y6GA 3T7VA 4MJMA 1LLZA 3FYPA 1OX6A 4O8RA 3G3DA 3B05A 4K36A 5CPNA 4NNAA 4YLWA 2NZLA 3O05A 2IQTA 3N2MA 3W2UA 3E02A 3GDLA 3DENA 3TAKA 1H7OA 3NQ7A 4JYEA 4ZZ9A 2RKXA 1F5ZA 1I45A 2WSRA 3A5VA 3VNDA 3NDOA 3FKKA 3NPVA 4JICA 1W8SA 1MXSA 4HNVA 4IWWA 3W1NA 2OT1A 3HBLA 3KRSA 2J6XA 3CTLA 2HSAA 3BVJA 3KRUA 3THQA 1QPNA 1JCJA 3DFOA 1GVRA 1Z44A 3DKJA 2Y7FA 4JS3A 5FI8A 1WBJA 4Z0JA 1XBYA 3L0GA 2Z2UA 3FOKA 5LNRA 1I2NA 2QCEA 1GVQA 1LDCA 2CU0A 1K8ZA 1QPRA 1KFEA 5CKSA 3IEBA 3MI2A 2E68A 3LCWA 3UYCA 1OX4A 3EKZA 4GUIA 1FDJA 1W56A 1U83A 4WY0B 4UTMA 5ABTA 4K8HA 1WYIA 4LVBA 4ADSA 3P5YA 1AL8A 4IMGA 3TJXA 1YPIA 3L66A 2A2IA 2TSYA 3Q37A 4IPIA 2CZEA 4RXGA 1DQXA 3IRDA 3W1QA 5A5WA 4O1CA 1IF2A 3O07A 2QUTA 1GPWA 3B03A 3C56A 4KFOA 3GDRA 1A5BA 1JCYA 1GT8A 3NM1A 5TBOA 2WO5A 1EUNA 3DHDA 5CSRA 4GJ1A 3HF3A 3UY7A 2DZPA 4UTWA 4O15A 4N2YA 4DO5A 1L6YA 2QDGA 3QZEA 4AHPA 2WPBA 3S42A 5GVJA 4RV8A 3S1WA 3SR7A 1LCOA 1W0MA 3MI6A 1MEIA 5G4WA 1FQ0A 3DFNA 1FBAA 2A4AA 4QNEA 4IMCA 4OGZA 3KVJA 4QM1A 3I68A 2ZA3A 3KXQA 4WQ6A 2RHGA 4UUIA 1ADOA 3OVQA 3QH2A 4O0ZA 4JEQA 1CW2A 4LS0A 3O8AA 3KVMA 2I9EA 3W7IA 1L6SA 1VRDA 5FF4A 3NM3A 4IX0A 1RD5A 2WSQA 3LHVA 4JTIA 4I7VA 1YADA 1JUKA 2CWNA 1HTIA 3TC7A 4LRSA 3W84A 1OFRA 4MUZA 1WDWA 3G0XA 4MJZA 4Y9AA 1AW2A 4OE7A 4LNYA 1W5MA 4N9CA 4Q33A 1QWGA 3S0CA 2QCHA 4R53A 1XUUA 5C2XA 3W7QA 1VHNA 1S5TA 4ICNA 3GLCA 1QDSA 3LBMA 2GJNA 1F74A 2C16A 4O12A 4RLIA 2G97A 2VENA 4UTIA 1LP6A 1SO4A 3R2GA 2DU2A 3QFEA 4XTDA 3LERA 4IXXA 3ELFA 1R2TA 2Z6JA 2WV8A 4LY8A 1CX9A 1DBTA 1O5KA 6TIMA 3E0IA 5F2MA 4HPXA 4UFIA 3O15A 1QNVA 3WJSA 4BWLA 4MZ1A 1MO0A 3LRLA 1GG0A 3LCFA 3L0NA 3PR2A 5BMWA 1JCLA 3A23A 4JTEA 2R91A 2C1HA 1P5BA 3H54A 3HB9A 4FXRA 2NX1A 2Y6ZA 3BG5A 5CPOA 3P84A 4QQ3A 3ZS4A 3P62A 3TXZA 2P0OA 4QNWA 5AHFA 3QM3A 3W1LA 4JTTA 3M7WA 4JXCA 2NWRA 3M41A 2V2HA 1WX0A 2DZVA 1X1OA 3PWAA 2ZZ2A 1TQXA 3TU9A 3NL5A 3W2KA 1OG0A 4PL1A 1KTCA 4X3ZA 4ML9A 4BI5A 3RF9A 1CI1A 1LBLA 2PCQA 3S5OA 2B7PA 1L9WA 3CT7A 5K4ZA 1KW1A 1PIIA 1ZENA 1SPQA 3FJ6A 4JTJA 3KVKA 4JTLA 4M7TA 5HMSA 3M6YA 2GVLA 2YZRA 2DZSA 3EWZA 5CZSA 4CCDA 4DQWA 1EB3A 2R8WA 3O6CA 2ALDA 1ZJIA 2H90A 5DBUA 4EF9A 1KM0A 3WJWA 1XBXA 5I3KA 2PRHA 4PH6A 5CZ0A 4A2SA 5D2XA 1NSJA 4FXSA 3JR2A 3NL6A 4O50A 4FIQA 4DF0A 1TRDA 4BF9A 2QCCA 4NXKA 3W87A 2QAFA 1Q6RA 1H50A 2EF9A 3EX2A 4IQLA 1LRQA 1FY6A 2YX0A 4O1AA 4ORIA 4FEZA 1I2PA 3YPIA 1KTNA 1ONRA 5FEXA 3W1XA 1XFBA 4ZQPA 1JJKA 1Q6LA 1J2WA 5CPMA 1M7PA 4HHPA 4X2RA 1FDZA 5EL1A 4A3UA 4ADUA 3UWQA 3W7LA 3G8RA 4JIQA 3R5EA 1FCBA 5TQLA 1RR2A 3BG9A 3W7NA 1W5NA 5E1QA 3LHYA 2DP3A 4Z1CA 4N4QA 3OG3A 4EF8A 2WKJA 4U28A 3PBYA 5CZJA 4M7SA 3NQFA 2YFNA 4O54A 1WOBA 1N7KA 4POCA 2WNZA 5K2ZA 2C19A 1M5WA 1FCQA 5HR6A 2GQ8A 3P61A 4UTKA 3IGUA 4Y96A 1TRIA 3MJYA 2V0TA 3TKFA 5FF7A 1ZAIA 1OHLA 4WD0A 3N19B 3RLVA 1PCKA 1TQJA 3DXIA 3EEGA 1OFQA 1QOQA 4DBDA 1K03A 3LM7A 2FPVA 2ZA1A 4DF1A 2CFFA 3DAQA 1VGAA 4NX5A 4E2DA 3PC0A 5HUOA 1VZWA 4AHOA 3ABOA 2QCFA 1UJPA 1W5QA 2QDHA 1XCFA 2E6DA 3MWAA 1B4EA 2W0UA 3MHFA 5I3JA 4MYXA 3TV8A 2CZDA 1GYNA 3SJ3A 4GRSA 2A5HA 3M5ZA 4LS1A 4LW7A 3TSMA 1OX4B 1SW3A 1W3IA 3BK0A 5HNRA 4GUFA 4JTKA 3CU2A 1SO5A 1A50A 2NLIA 1OX5A 4JIPA 1OF8A 1W3NA 2Y7EA 4O11A 3SI9A 1SQ7A 2D73A 1JCXA 3TQ0A 5G1TA 1R2SA 4UIOA 4NX0A 4AB4A 3ABSA 2OT0A 2R14A 1GVSA 5I3FA 2GVGA 3NOEA 2E09A 2Y85A 1SFLA 1KFKA 1O5XA 5D2YA 3VE7A 3O1NA 5F4SA 4FNPA 3TNOA 3DI1A 2YGYA 2NUWA 4KFNA 1H7WA 3DFQA 1EP1A 2E6YA 3C52A 1RQBA 3KFTA 1QOPA 1F6PA 3DH7A 1XDLA 4DEFA 5E0KA 1KBIA 1XL9A 2AQWA 1QO2A 3I6RA 1OF6A 3WK3A 4UTHA 3UXAA 3EX3A 1ICQA 5KZEA 2QUVA 3ZR4A 3L68A 5HWNA 3W71A 2C3ZA 2A6LA 2QEZA 2XFWA 4GC4A 4CCCA 4O1BA 4MOZA 3DHFA 1JR1A 1H1ZA 3UPWA 4YCPA 1O95A 4BWLC 1UCWA 3O06A 3N34A 3S9YA 4LVFA 4UTTA 3T55A 3ATZA 3C2RA 3M5XA 1EWDA 4NJGA 4TMBA 3KHJA 5U4NA 2NX9A 3T4CA 3LXCA 5HJLA 1ICSA 4HT3A 4UXDA 4LUIA 4BR1A 1OYCA 5D03A 2Q8LA 4MFDA 3F4NA 3Q94A 1Z42A 2ZFAA 2ISVA 3FLUA 3HMJG 3GX9A 5D38A 1NAL1 2AAMA 4C1LA 1SU5A 4N6FA 3GZ3A 1GWJA 1XDMA 1W54A 1GYLA 1OFBA 2J9YA 2B4GA 3W7PA 3EX4A 4MZYA 4S2BA 3UQNA 4XBKA 1XXXA 3W07A 2ZTJA 2VFIA 2X2GA 4UTJA 1J5TA 3GYEA 2H8XA 1DKWA 5KMYA 1MZHA 1JQXA 1YYAA 2GVJA 1EPXA 1J4EA 5F4XA 4CNPA 3NXFA 1VCVA 1I2RA 1SW0A 4JD4A 2F84A 3L5AA 1G69A 5HUPA 2VEPA 4NJJA 3A5FA 3W83A 1Q6QA 1DJQA 2HS8A 4MZ8A 2NUXA 4UMAA 1WA3A 1YTDA 3KAOA 1O4UA 6ALDA 4PTNA 2ZRYA 2E5DA 3GNDA 4LRTA 1AMKA 1H63A 3C61A 3INPA 1SO3A 1VLWA 3M9YA 1JRBA 2B0MA 3PG8A 4MLJA 3UNDA 4R7JA 1VQTA 4MY8A 1WQ5A 3TK7A 2C18A 1Y0EA 3VCRA 1FDYA 5KZDA 3IVUA 3FS2A 2JBMA 4M19A 3SZ8A 4WOZA 2YW3A 3GNNA 5KINA 4OHQA 1GEQA 3FFSA 2Y7DA 4JNMA 3O16A 1SZEA 2DZTA 1C29A 3G22A 1FWWA 2HTMA 4S1FA 3UY8A 4I9AA 1JRCA 2GQ9A 1VYSX 1NF7A 3NGJA 2CLFA 4LC6A 4MY1A 3B0VC 5FESA 2YXGA 3L9CA 3SGUA 3IV3A 4DO6A 1TPVA 4ALDA 2X1SA 2G95A 5K9DA 3HG4A 3THAA 3IIXA 2E5BA 2VFEA 3IIVA 5K4XA 1GTHA 2ZZ1A 1JUBA 2PRLA 2FTPA 2FB3A 3LV5A 4WOQA 1I2QA 3W72A 2W79A 3OVRA 3VKJA 4AF0A 4O16A 3WK0A 3GKFA 2W6RA 3IIOA 3MMTA 3U2OA 4A29A 4NJIA 4LUJA 2H3DA 3E49A 3FIGA 4HIBA 4HPJA 3EXSA 3NO5A 4OQVA 3PS7A 4YL2A 3HG3A 1GTEA 2VELA 2VEIA 3C2VA 3M47A 5H2ZA 4AWTA 2DZWA 3JS3A 3NQ8A 1XI3A 3TFCA 2E6FA 1FXQA 3LCXA 4PL2A 2QKFA 3W75A 4QSHA 2GJLA 3IGXA 1BEUA 1TPH1 3ABQA 5FEZA 1SZNA 1IIGA 3PULA 4GUGA 3W2LA 2P1FA 1BKSA 3ZWTA 3FJLA 5D2WA 3DBPA 4DBEA 4Z1BA 4MPQA 1YDVA 3TR2A 1YXCA 2JGQA 3IGSA 4UC5A 1HO1A 3TQKA 4UMCA 3CEUA 3NG3A 3IVSA 2ZZ3A 2ZZ6A 3P67A 3CLMA 3MHUA 2YFOA 2RH9A 2AGKA 3SGZA 3CB8A 3PAJA 4MYAA 1O94A 5CPLA 3HG2A 3LCHA 4E38A 1EX5A 3HQ1A 3CEPA 2G96A 1B4KA 1W5PA 1KV5A 4NXSA 4K7YA 1QMLA 5CG7A 4O4VA 1X7FA 1H7RA 3CQ0A 4K37A 3G18A 3W7GA 4FHAA 3N2XA 3L0KA 3I7SA 3GKAA 1TPFA 3TSDA 1UUMA 3PB2A 1DOSA 1F7BA 5HULA 1W37A 3W1RA 3MYPA 1T8XA 3UWYA 4A2RA 3L5LA 4L4MA 4IPJA 3OHIA 2Y63A 3SFKA 3G1VA 4HN4A 3WJYA 2YR1A 1H1YA 4UTTC 4M6QA 4FNSA 3W7DA 1KA9F 1R46A 4FX7A 2X30A 1KFCA 2CLKA 1OVDA 3B8DA 3NPWA 4EVZA 2Q3RA 5I3GA 2E77A 5F2IA 1T99A 2CZ5A 4IUOA 2ZZ5A 3NQVA 4N9EA 5AC8A 2PRMA 4AWSA 3MHGA 4IJBA 3LBCA 3QPYA 1F73A 5G1YA 1SR9A 4O53A 1K02A 1TB3A 3G8EA 3ZWSA 1I4NA 1DHPA 2OCZA 4GUHA 3IIZA 3VI2A 3TUUA 3QF0A 3C6CA 2QCDA 3UWZA 3TX9A 2J24A 2FFCA 3S1XA 3BW2A 2OJPA 1TSIA 2J88A 3B04A 4O10A 3N73A 1FWTA 4LC8A 1PE1A 3C2EA 1ME9A 1OFAA 1T96A 2X1UA 1F2JA 3LTPA 3SECA 1AK5A 1OJXA 3MP4A 5J5DA 2PE4A 5L6UA 4O19A 3WJXA 4LVGA 3DI0A 1GVOA 5AHEA 2V2DA 1OYBA 3CM4A 4GXMA 1HG3A 2Z0IA 4PODA 2I1OA 1VS1A 1ALDA 3W23A 5CZTA 5D33A 4QITA 1IGSA 2WJZA 1WOAA 4HKPA 1VC4A 4N9BA 4JGDA 3N9RA 2P10A 3LHWA 3HOJA 5F1UA 1NF0A 1F05A 1I2OA 4HNNA 4R33A 5D05A 5F2GA 5DXXA 4UFMA 5KZMA 5AYXA 2ZRUA 1SSDA 3C2FA 2X1TA 3R12A 5SWUA 1A53A 2GUUA 5EY5A 5DLCA 2QAPA 1ME7A 1JVNA 3LXBA 1M6JA 1VCGA 2VFDA 3N3MA 3GK0A 1PHQA 1IXPA 1QAPA 5G2IA 2ZRVA 1SW7A 3W7JA 3S6DA 4QAIA 2ABBA 3PG9A 3F4WA 5I3IA 1K3UA 5G4EA 3PSVA 2QF7A 4NNCA 3N14A 2B7QA 2WSYA 1X1ZA 5TIMA 3BW3A 3P7YA 3V1PA 5HWJA 3W7MA 2QJHA 2FLIA 3DFTA 3BGJA 4LS2A 4JX4A 2EHHA 1K8YA 3DFPA 5DY2A 1K7EA 4KFPA 3QSTA 1LYXA 1PHWA 2RFGA 4YXGA 1XUZA 3S5NA 3LI0A 4O0KA 1G7VA 1UBSA 5DBTA 4FIRA 2CZFA 2X1RA 1SSGA 3L65A 5EMUA 4ADTA 3B0PA 3AJXA 1QPQA 3UD6A 4CQ8A 1LLWA 1ZHAA 3ANYA 1H5YA 1ZY9A 1YPFA 2OX1A 2VC6A 3L5MA 4WY0F 3U6WA 3I7RA 2QCMA 3RNDA 3VE9A 1DL3A 1VPXA 1DVJA 3NPUA 1R30A 3KRZA 3TA6A 4LVDA 4GWEA 5G2HA 3W6YA 2JKEA 3STGA 4K39A 7TIMA 1Q6OA 1TREA 1N8FA 3W88A 1TTPA 5HINA 2A0NA 3EWXA 5L9FA 5K7JA 3C3NA 3EWUA 3U8GA 1VLIA 4UFJA 2LLEA 3R13A 2V5BA 4P61A 4K8EA 3NL3A 2A6NA 1QO5A 4L4LA 2VEMA 4RZ4A 4IXHA 1SZGA 4NZJA 4CQAA 3G1HA 3QQ0A 1THFD 2BWGA 1KM4A 1FCVA 2CLHA 4TR9A 1PL9A 3W2NA 1FCUA 5EPDA 3NPXA 4C1KA 3EXTA 1DV7A 4RZ6A 3W3OA 1VHCA 3T40A 4AMAA 3W1MA 8TIMA 2A7RA 1ZNNA 4AF0B 2B7OA 1YDNA 1HO4A 1RZMA 4XBSA 4FNUA 4ZL1A 3TCEA 2C15A 1TV8A 1TPB1 3M1ZA 3WJZA 4HSOA 3PF3A 5AHIA 3EWYA 4LTSA 3UZJA 4YMZA 2YCEA 4GE8A 4N4PA 5FF0A 1PV8A 2O7SA 2VKZG 3RFAA 2H3BA 1KM3A 5AHLA 1S3HA 3MI3A 5AYZA 3P82A 4XQ6A 2NXIA 3PUDA 5FEWA 5KSWA 3PVFA 4DXVA 3MUXA 5DELA 4FNQA 1TJPA 1TTQA 3B06A 1S5WA 1EIXA 3CC1A 4JR5A 3USBA 1FWNA 4O1DA 3W7HA 3QRHA 3HG5A 3LX9A 5D32A 4WXYA 3NR0A 2E1DA 1W1ZA 4NZFA 3UZ5A 5DY3A 5EBUA 4ORMA 3NZ1A 1TO3A 3LV6A 3NA8A 4M5PA 2Y7GA 4AWUA 3OVPA 1OK4A 5DCEA 1FX6A 5LGZA 4OT7A 4UFKA 4UNKA 5IM51 1GQNA 2JKAA 4JTFA 1MEWA 4FX6M 1D3GA 4AVFA 2CLLA 5HWMA 1SFJA 4NUWA 1U5JA 2FB2A 3P60A 5AHMA 3LCIA 3EKLA 5FF3A 1YXDA 4QISA 5C55A 2DORA 1E51A 3GDKA 5F4WA 2BZNA 1LORA 1R2RA 1W31A 1G4EA 1TTIA 3A22A 2KZHA 4O17A 3QC3A 2XN2A 4QIUA 2V2CA 4XTIA 3C4UA 4JX6A 3E12A 1XBZA 3S5ZA 4ZQRA 4QJ1A 3EXRA 2QCDB 3MO7A 1LZOA 4LV4A 2ZA2A 1C9DA 4AAJA 3LLDA 1VR6A 4ONVA 4MLRA 2ABAA 2J9XA 3DU0A 1OFOA 2QR6A 1FWRA 4DELA 5AB3A 1TV5A 3QSRA 4YWIA 1ML1A 1NVMA 3T44A 1GOXA 5HR7A 3L2IA 3RMJA 2ZZ4A 3FKRA 2ZQ0A 3LOTA 2ISSA 5H91A 5AC6A 1Z48A 5C6MA 3PY2A 1FWSA 1O60A 4NU7A 2NXHA 5KITA 1DJNA 1LTDA 3RK8A 3EWWA 4JY9A 2QCGA 5LNVA 4FF7A 4UCGA 3STCA 2Q8ZA 3NQEA 2YSWA 3R8RA 3UWVA 1KFLA 3G24A 1FUYA 1ZAJA 5EA9A 1SO6A 1OFEA 3B0UX 1OFPA 2C6QA 3TDFA 2VFFA 3BO9A 3L21A 1K7XA 2CLEA 4JTGA 4LOCA 2WQPA 2I14A 2H8ZA 3NQMA 2YYTA 1P0KA 1FXPA 2NV2A 3IVTA 1KM5A 5F2LA 4BI7A 2YW4A 3LB0A 1WBHA 3W74A 5F1VA 3KOFA 4R34A 4Z1DA 2GQAA 2GPTA 4XUGA 1AW1A 3OIXA 3OBKA 1G7UA 3EB2A 1RQHA 5LNUA 2OMAA 1K7FA 3P8JA 3QYQA 1TMHA 2TMDA 1MSSA 2DJXA 1EWEA 3MYOA 2EGZA 4I7UA 2ZYFA 4DPPA 3TW6A 1VYRA 4MFEA 4O18A 1K8XA 4KWWA 1LRNA 3D0CA 1LOSA 5AOUA 1VJIA 3PBVA 3UWWA 1KTBA 3PM6A 4RXFA 5FEPA 3BLEA 2GOUA 3AO0A 3GDTA 2PC4A 4IMFA 4CNNA 4DO4A 3TMQA 5K9XA 4H4IA 1KV8A 1LRTA 4FB7A 1ZALA 4ZQOA 4UNLA 2QCNA 3A24A 1DORA 1DQWA 4RKAA 3GR8A 2CW6A 1JCMP 3NQAA 1TPUA 2V82A 4Q4KA 4UFHA 5G5IA 1Q45A 3V75A 2NX3A 5AHNA 2JGYA 3HGRA 3STFA 2Q3OA 5G2WA 4M6PA 1WV2A 5CSSA 3T78A 2TPSA 4AEOA 3NZRA 5KTLA 2FPTA 2ZRXA 5K9CA 2ZRZA 1EA0A 3OA3A 3GR7A 1B9BA 1V7YA 4XZ9A 2C13A 3LRMA 2V5LA 3G0UA 4HNUA 4MIMA 3G1FA 2C14A 4MKNA 1HL2A 1ICPA 2ATSA 2FQIA 3QW4B 1LOQA 1JUEA 4JYDA 1IXOA 5J5RA 2A1YA 4AHQA 1BTMA 1EEPA 3BLIA 3HPXA 3QJAA 5LZLA 2WOQA 3C0JA 2NXGA 4RJEA 3M44A 3QEZA 4U4MA 1RVGA 2TYSA 4BI6A 5BNKA 3GDMA 2Y89A 4FX8A 3PBWA 3G1DA 3W7EA 3TQVA 1AG1O 4MY9A 3NQGA 4H6KA 4O13A 3TJLA 1VCFA 3TXVA 3UXDA 4IMEA 1TTJA 1Z41A 1JULA 4UR8A 2C0AA 1SZFA 2EKCA 1G4TA 1AW5A 4FNRA 3WK2A 1TCDA 3CWOX 1R47A 4NQ1A 3NVTA 4H3DA 2WNQA 3UPBA 3BLFA 1LBFA 4UFLA 3RLUA 2CLIA 1TPWA 4K7VA 2V30A 4GUJA 1H60A 1F6KA 4GBUA 1M7OA 1QFEA 3G3MA 3FA5A 1I8JA 3W22A 3W7KA 4ZQNA 2BLEA 3G0SA 4FO4A 3L67A 1G67A 2NUYA 1IXNA 2DZUA 3ABRA 1B3OA 4LWWA 3LHZA 3CWNA 4JN6A 5K3VA 1GZGA 2CLMA 4Z0SA 5DXYA 3E96A 3BV4A 4NT0A 4JTSA 4P2VA 2BXVA 5IBXA 1TIMA 4S2CA 2R94A 1H62A 2J27A 3MBDA 4HSNA 3M5VA 1H51A 3TW7A 2ISWA 3KX6A 4E2BA 3LHUA 1JCNA 2OZ0A 2A7PA 1H7PA 5C54A 2Y88A 3CHVA 4K38A 1RV8A 4TO8A 5HQEA 3N9SA 4XKYB 5D04C 3SIZA 4WX2A 4E0CA 2A85A 4XWUA 3Q2DA 1OK6A 5EYWA 3W1TA 2NWSA 3C8FA 1UB3A 3EWBX 1NFBA 1BWKA 2ZBTA 3W7OA 2H6RA 3CIXA 1L2UA 3KVLA 4KWVA 3M16A 4X22A 3S1VA 3P81A 3S8HA 2Y61A 5A8GA 5D30A 3F1QA 4GNJA 4OBTA 4TX9A 1B57A 3LCGA 1VYPX 3MW7A 3W1UA 4A21A 1T0OA 3BW4A 3O63A 3EX1A 1ZFJA 2VFHA 3OEXA 4EWND 3UWUA 2ZZ7A 3NQ6A 4JY8A 2YPIA 5DN1A 3G1AA 3W1PA 4PFMA 4TMCA 3HPZA 1MEHA 1YTEA 2RDUA 1OABA 2VXNA 3M5YA 5MHBA 4JX5A 2BX7A 3TFXA 3W86A 1ZCOA 4JDYA 5AFDA 2VEKA 3EX6A 4EOUA 1LM1A 1TYGA 3GXPA 1KLYA 4O14A 1H7XA 3M0ZA 3NYZA 4HNTA 1YLVA 2WNNA 3P8IA 4FNTA 5LHFA 1F76A 3W76A 1GVFA 1TPEA 2ZTKA 3LCLA 3NAVA 1LOLA 5D2TA 5LHEA 2NV1A 2DZXA 5T26A 4JYFA 4LV9A 3W70A 1ME8A 3QMSA 2A21A 2Y70A 3W73A 3TAOA 1WXJA 2FIQA 3C2OA 3STEA 4WZHA 2V81A 1XC4A 3MP3A 3W7CA 1EP2A 3IIPA 1OFDA 1GG1A 4TU1A 4K6AA 2VFGA 4LT9A 4OU1A 4OWGA 4CQ9A 3HGOA 5FF2A 2RDWA 3O6YX 1N55A 3M43A 4NJHA 3WK1A 2G5WA 1TPDA 1HFBA 4JDBA 3S5YA 4RK8A 4JTHA 4YCOA 3GXNA 3NEVA 3B4UA 4DPQA 1WAUA 3HJZA 1TV7A 1S5VA 1BWLA 4CLMA 2EPHA 3W9ZA 4N6EA 2JK2A 2PURA 4OV9A 3NL2A 3P5ZA 4WY0A 4PA8A 5I3HA 3ATYA 1IXQA 3H53A 3G1YA 3BG3A 3BGGA 3F03K 3DFSA 4NNBA 4KKXA 5LGXA 4BFAA 4IX2A 4RX0A 3RU6A 3TE9A 5EKYA 1D3HA 2E5CA 3HGSA 1PCWA 4GFSA 1W5OA 5BW6A 1IIHA 3DGRA 3JRKA 4AXKA 4I7WA 3LI1A 3QMTA 4NJKA 3NNTA 2V9DA 1LBMA 2A7NA 4RCXA 3GAYA 4ZQMA 4UTWC 1TPC1 3H55A 4ZVJA 1A5SA 4IMDA 4O28A 1QR7A 3R89A 2BTMA 3I65A 3TMLA 1RQEA 3GB6A 2QUUA 3VFLA 2X16A 5BRBA 4MVAA 1YDOA 4TIMA 4CCEA 2XN1A 3P74A 3LDVA 3FEMA 2EAWA 1OYAA 2XN0A 4LVAA 4O4WA 5D2VA 3W7RA 3PUOA 5LNWA 4X9SA 2V8ZA 5BOOA 1X6UA 5AYYA 2FJKA 5DCBA 3PB0A 1G6CA 4EIVA 4UTLA 5CGQA 1JQVA 3HO8A 1YTKA 4UR7A 4LU0A 4Y8FA 2ZRWA 1V5XA 4PC8A 3G1SA 3LLFA 1KFBA 3A21A 4A22A 3HIJA 2J9ZA 2O7QA 3FYOA 1XKYA 4PEKA 3QMRA 4Z08A 5LKYA 4UTUA 1EUAA 3PUEA 5IBXC 2E6AA 3QW3A 3HGJA 4RR4A 2Z6IA 1KFJA 2F7FA 5C5YA 3SY5A 3A9IA 3I7QA 2QJGA 3NQDA 1H7NA 4B5NA 1SUXA 2ZDRA 1TJRA 3W85A 1P1XA 2HMCA 4Y90A 3TIMA 3P80A 2UV8G 2TRSA 4Q32A 3DZ1A 1NEYA 3QQ1A 3MP5A 3W2JA 5DCDA 4OV4A 3S1UA 1G4PA 1PVNA 2CLOA 3BPWA 4WXZA 3LGEA 4JTUA 4BK9A 4WJEA 4XKYA 4N9DA 1X8FA 2Z1BA 1YXYA 1QCWA 1UASA 3W1AA 1KM6A 1GJPA 3LXAA 3LRKA 3LTSA 2QJIA 5D02A 1LROA 3MBFA 4O57A 1P4CA 1Q3NA 1UUOA 3SSJA 4CNOA 1KLZA 4DF2A 1EP3A 1QPOA 4J9JA 4M6VA 5U7SA 1D9EA 1KM1A 1ZAHA 1G4SA 1W3TA 4NVTA 2HS6A 2FDSA 3TH6A 2QCLA 4PCFA 5AC7A 4W9TA 3SW6A 2RDTA 3LHTA 4ZQCA 1KBJA 4ZMGA 3TSBA 1RPXA 5D09A 3NQ2A 2Y62A 4G1KA 4D2JA 4IOTA 2YYUA 1H61A 5BMXA 1L6WA 1AL7A 5E93A 3WFAA 3PSWA 1VH7A 1XM3A 4UMBA 3GAKA 1KM2A 3GXTA 3GVGA 2ZCGA 1HUVA 3LTYA 1C8VA 3QPZA 5LSMA 5LNSA 2BSLA 1A5CA 2YDAA 3CIWA 4IGHA 3TC6A 3ZFHA 2ATMA 3E9AA 4O52A 3PBUA 5AN7A 1XBVA 1A5AA 2DJLA 2VOMA 3W2MA 4Z1AA 3Q58A 3NQCA 2JKPA 3CPRA 1PS9A 3K30A 4RZ5A 3O6DA
chains in the Genus database with same CATH superfamily
2YA0A 2Q6ZA 5FL0A 3AZRA 2OVLA 1B9ZA 2FPYA 4LF2A 2FVKA 4UR9A 4MJMA 4PMQA 1E56A 1OADA 3EOLA 3B05A 3SURA 2IQTA 4AIEA 4EPEC 2F6UA 3E02A 1TZ7A 2IXUA 1H7OA 3UA3A 4JIRA 1X39A 1I45A 2J8GA 5JBFA 1JD7A 1OY0A 3NPVA 1B3VA 1W8SA 2AL2B 2WVSA 1M1BA 4HNVA 1BXNA 1HF6A 3ITLA 2J6XA 4JQ4A 3AXHA 4FMVA 4KT2A 5FJUA 4JHZA 3ZM8A 1A80A 1QPNA 1JCJA 2ODOA 1P0EA 3U5YA 3DKJA 3V18A 1PKMA 3N29A 3DYOA 1XISA 1E43A 1XBYA 1GVQA 3ARYA 4MPKA 4HTYA 3E2VA 1KFEA 5CKSA 5AZ0A 3UYCA 3EKZA 1U83A 3CAWA 1WE5A 2ZIDA 3GG1A 4UTMA 1I1XA 3LMZA 4K8HA 4LVBA 4ADSA 2YLLA 3C0SA 4IMGA 3TJXA 5A69A 3ITCA 2XYLA 1SMAA 3URAA 1EXPA 3W0KA 2A2IA 4JL1A 5CH9A 4TTUA 2INZA 2GJPA 4IPIA 2OOFA 4RXGA 4F2BA 5D8ZA 2D23A 2CC0A 1EZWA 3O07A 3UWEA 3C56A 1XCXA 1R85A 3UFYA 1GOMA 1A5BA 1JCYA 1GT8A 2PDPA 4GI4A 5TBOA 1FWAC 2WJDA 3ANVA 5ABGA 5XINA 2QDGA 1EF2A 4AHPA 3W02A 3QN3A 1TWSA 4LCSA 1TA3A 2DIJA 1LCOA 2OOGA 1ZUAX 3NO3A 1YNPA 5EMKA 1LWHA 1FBAA 5AC5A 4LXFA 2MUCA 1EIBA 3I68A 5BOFA 2Z25A 3E0VA 3CAKA 4EKJA 4Q8MA 4O0ZA 3ZVHA 4QG6A 1CW2A 1XIBA 4AIUA 1P7TA 3K2GA 2I9EA 1VRDA 5FF4A 3NM3A 3OBAA 1RD5A 3TYBA 4I7VA 1TWIA 1YADA 1E6QM 1JUKA 3PFMA 4L64A 3G0XA 1AW2A 4OE7A 1W5MA 1UD3A 1EC9A 4Q33A 5BYWA 1H09A 2W63A 3S0CA 2QCHA 1L6FA 1JDCA 1XUUA 3AS1A 2MANA 1S5TA 2VGIA 2WQDA 3VCCA 4IJRA 1QDSA 3LBMA 3M0KA 2GJNA 3CAQA 1F74A 2W66A 4O12A 4YTQA 4YTRA 4R9OA 1E0TA 1DIKA 4KCUA 1YBQB 4CU6A 3LERA 2WBKA 1ZBWA 1R2TA 1CX9A 2PDQA 3OLGA 2NQ9A 2DQWA 3HMCA 2Z1VA 4UFIA 2J79A 4Q6JA 3N6HA 3WJSA 4RUBA 3H21A 4BWLA 3ABZA 3ZT7A 4MZ1A 1L8NA 3LRLA 4HU4A 1GG0A 2OFJA 3DESA 3A23A 2C1HA 4FXRA 2NX1A 2Y6ZA 3BG5A 3MZ2A 4XKMA 3ZS4A 2WZEA 4DJFC 1ZJHA 1G01A 4AG0A 1QNPA 3M7WA 1WX0A 4RPQA 3VNMA 1X1OA 4XBJA 2XIBA 1UWIA 3W2KA 5A6JA 4PMRA 2XIIA 3RF9A 1CI1A 2PCQA 3WSUA 3V5CA 1BSLA 1OC6A 1PIIA 1BRLA 1SPQA 4JTJA 4M7TA 1SFTA 3CL7A 1XDJA 2J7HA 1UG6A 2DZSA 5CZSA 4CCDA 4E2VA 2R8WA 3O6CA 4Q8NA 1KM0A 4IJCA 3WJWA 1XBXA 2OSWA 4A2SA 3N12A 1BQCA 1S5MA 4FP1A 4N42A 4Y2WA 3H2MA 1EGZA 4Z2HA 1GVEA 1ZBVA 3PJUA 1H50A 2EF9A 1OD0A 4KF1A 1FY6A 2YX0A 4O1AA 1T8QA 4FEZA 1KTNA 2A3BA 2D24A 2FZ9A 2A3EA 1Q6LA 5H6HA 3BAWA 1DE6A 3EDJA 1QATA 2RJGA 1V0LA 5AY7A 3GW3A 3W53A 4E3VA 1E9LA 1FCBA 4B90A 2J7CA 4K1WA 3VGDA 4OUIA 4PMDA 4MKSA 4H1ZA 4Z1CA 1W6TA 2V68A 1OCQA 2WKJA 4U28A 3PBYA 3NQFA 4ZO6A 2WNZA 1Q63A 3MKKA 4PUWA 3TWAA 5HR6A 2G3JA 2GQ8A 1OCJA 3LA4A 2HNHA 4E4UA 3DECA 1OHLA 1OT2A 5I02A 3EEGA 3FDKA 1XLBA 4C6DA 1QOQA 3LM7A 4DF1A 3QZAA 3LUTA 1AH3A 1R3SA 8XIMA 4M81A 1NM9A 3H24A 1EGMA 4B3LA 3VX1A 4KGJA 3VIJA 1E3ZA 3U2CA 1XCFA 5D9PA 5I3JA 3TV8A 4YNGA 4GRSA 4JTKA 1A50A 1OX5A 2VMFA 1W3NA 1QASA 1SQ7A 5EB8A 2CHRA 4GY0A 4F0MA 4NX0A 1OIMA 3ABSA 2R14A 1GVSA 1T6MA 1QPKA 1KFKA 3VE7A 3WQFA 4Q8PA 5F4SA 4FNPA 3DI1A 3GNPA 2YGYA 3WQ6A 3U4AA 3KFTA 1QOPA 4AD1A 1F6PA 5FJRA 5E0KA 1GKQA 4LFYA 1OF6A 1XH2A 1V02E 3VUPA 5HWNA 1IWPA 3TR9A 2VZVA 3LLXA 2GWNA 3E1F1 4MOZA 4UZSA 4F2TA 1H1ZA 3UPWA 4HGXA 4YCPA 4BWLC 3BAKA 4UTTA 1XJBA 4W85A 1P7TB 4WR3A 4GIAA 1EJ7L 1HJVA 3M5XA 3RX3A 1XINA 1AFSA 4J27A 1EZ2A 3LXCA 1GJWA 4PYSA 1W9UA 4LUIA 3BJSA 4L5ZA 4BQ4A 4HYVA 1CXEA 1TWWA 2ISVA 3FLUA 4XIAA 3N6QA 1MQPA 5G1MA 3B8SA 1RVKA 3P93A 4QLJA 3EA2A 5FD0A 4LYPA 4C6KA 2B4GA 3R94A 3AISA 4S2BA 4RV3A 3UQNA 1P6WA 3N13A 3EDFA 4DHGA 2ZTJA 5C71A 2VFIA 3AZSA 3GYEA 4LUSB 4U2YA 1DKWA 1XLEA 5A6BD 1MZHA 1BLIA 1JQXA 2GVJA 4LUTA 1JF5A 6REQA 3QY8A 4HHHA 4J4KA 4CNPA 3NSNA 5I3DA 1O1HA 2V69A 3W83A 1DJQA 1ISYA 3D3AA 1YTDA 3Q4DA 4GVIA 1O4UA 4PTNA 4D72A 3GNDA 3C61A 3INPA 1SO3A 2BBFA 4HPGA 4QDWA 1JAKA 3C0QA 2R82A 1WKFA 2BY2A 4R7JA 1VQTA 2UBPC 4WRHA 4MY8A 9CGTA 3UW6A 2C18A 1Y0EA 3VCRA 1FDYA 1XHGA 3GTXA 2WWDA 4J7RA 1GEQA 4ZTXA 1BSIA 1BRLB 4GVFA 3TN4A 3G22A 1W9XA 3LQLA 5E6YA 1F4AA 4C6QA 1EH9A 4QEEA 4LBUA 2VX6A 1NWRA 3IV3A 4L4PA 4ALDA 2G95A 3CPGA 3HG4A 3CASA 5AC4A 3THAA 3IIVA 1GTHA 2INFA 1JUBA 2OYMA 2FTPA 8CGTA 2FB3A 3W72A 3GHSA 4XO6A 3WK0A 4D6CA 5GNYA 1M01A 3RM9A 5E5CA 3V36A 1B3WA 3E49A 3FIGA 4NAEA 1K6AA 4K8GA 4PB4A 2XVLA 2VEIA 3C2VA 3M47A 3ITYA 5H2ZA 3M0IA 2DZWA 3DG3A 4AU0A 4PL2A 1V4YA 2GJLA 1Z7AA 3ABQA 1QU4A 4IG2B 4OOZA 3QBUA 1EPVA 1CGVA 1BKSA 1O6IA 4WLCA 3DBPA 4DBEA 4Z1BA 5ENLA 1I0BA 4HNLA 3IVSA 3RPTA 1AA1B 2YFOA 1P0DA 2AGKA 1AD4A 3HG2A 4E38A 3HQ1A 3CEPA 2OWCA 2G96A 1M3UA 1W5PA 1YNYA 1IV8A 2OWWA 4O4VA 3LM3A 4JKKA 1H7RA 3N18A 3W7GA 3ES8A 5M3WA 4PN2A 3WD1A 3I7SA 1TPFA 1W8GA 1CPUA 4Y8EA 2WC3A 1T8XA 1AJ0A 4QE5A 4F4RA 4IPJA 3G1VA 4C60A 3PANA 2OGJA 4UTTC 4M6QA 3W7DA 4QRNA 4B4HA 4JFVA 1UOZA 3RYSA 2VUNA 4CN6A 1OVDA 3NPWA 2Q3RA 1R3QA 1T99A 4RNJA 3H22A 5AC8A 3DG6A 5DRCA 5FL1A 2Z00A 5CSUA 5G1YA 1SR9A 3OGRA 2CLPA 2Q8XA 3G8EA 2G3NA 1I4NA 3QF0A 1WDQA 3UWZA 3I3DA 1DXFA 3RM4A 4ZCWA 3N73A 1YQ2A 1PE1A 2ACQA 3UCDA 1OFAA 1T96A 2X1UA 3MMWA 3WDHA 3K4AA 1BYAA 5J5DA 3CZ8A 1C3FA 5L6UA 4EPKA 3DI0A 5AHEA 3CQIA 1OYBA 1AJ2A 3CM4A 1HG3A 4PODA 4KIRA 3ZR6A 1DJIA 3N17A 1IGSA 1WOAA 2Z7KA 4GA8A 1IZCA 5AKQA 1NF0A 4R33A 5D05A 2EPNA 2J75A 4ATLA 5DXXA 2D69A 4UFMA 5KZMA 5ECUA 1KBKA 3U4FA 5AYXA 1AUSL 2X1TA 1ECEA 3R12A 2WKLA 5SWUA 1A53A 4AFYA 1S46A 1JVNA 4ZXLA 2Y24A 2VFDA 4PUUA 1E55A 2F2HA 4L65A 1QAPA 1SW7A 1NH6A 1UR8A 3H2FA 2OO0A 2ABBA 3PG9A 4GZJA 1CLXA 4M24A 1K3UA 1ITUA 1ZLPA 4NNCA 4GH1A 1KGUA 1FWBC 3N14A 2B7QA 1YKWA 4GQGA 2WSYA 2NQHA 2REQB 1Z6KA 4XSLA 2QJHA 5LIYX 3QXBA 5PTDA 2NQ5A 4Y9PA 5GJMA 1K7EA 3QSTA 2PC8A 1GJUA 1LYXA 3IS4A 4LUTB 2VDGA 4Z17A 1R3TA 2FHFA 3PN8A 5DMYA 1LUCA 5DBTA 2EG6A 4Q7NA 1R86A 4BQ5A 2UWFA 3AHVA 3MU7A 3L65A 4D6IA 4CEXC 3WBWA 3NQBA 1A3XA 3AHTA 1A4MA 1QPQA 4QXIA 1XC6A 4QBXA 1ZHAA 3ANYA 1H5YA 1ZY9A 1YPFA 3QV7A 3L5MA 2XHYA 3MCOA 4WY0F 3RNDA 2FYMA 1DL3A 1XD1A 3S1GA 4LVDA 3BOLA 3URBA 3SUVA 1WZMA 1LT7A 7TIMA 2WKGA 1H49A 3FEQA 3W88A 4W5UA 3M64A 3MB9A 3CZEA 2V3GA 1Q8JA 3PBGA 4DYKA 3U8GA 3G77A 2O0TA 3VNZA 1MW1A 2AOSA 4K8EA 3NL3A 1QO5A 3FGCB 1X1NA 2VEMA 4RZ4A 4IXHA 1UUQA 2C7FA 4NZJA 2GDQA 1W2PA 2BWGA 4AQLA 3W4RA 3AIRA 1H3GA 3MUCA 2RGMA 4C6LA 3W3OA 4W8AA 5HATA 4HSHA 1VHCA 1W1TA 5A2CA 8TIMA 2I5IA 4ZTYA 4PMVA 3NO1A 3WH9A 2JFEX 2C15A 1D7KA 1H0IA 1E6RA 4NAEB 3QV8A 4HSOA 4QDPA 3CUXA 5AHIA 4ZODA 4LTSA 1WB0A 3UZJA 4N4PA 4Q4PA 3VMNA 1PV8A 2VKZG 3WX7A 4H00A 3WUFA 1KM3A 4JTQA 1S3HA 3STPA 5AYZA 3P82A 4V28A 3PUDA 4FLQA 1O7AA 4ZE5A 5FEWA 1C91A 3M0XA 3W24A 1UR1A 1EIXA 3PP7A 3ALFA 2CHNA 2Z1SA 4ZSTA 2XISA 1JF6A 3R0UA 1RBLA 3LX9A 2ZX9A 4B2DA 3ARWA 4WXYA 1JYXA 3MC5A 4BEQA 3FHAA 1NOWA 3LV6A 3U0HA 4J35A 5I78A 3VOCA 3REQB 4UOZA 4GJJA 4HN8A 3OVPA 1OK4A 2PD5A 5DCEA 3ZSTA 4H9UA 4UFKA 5FOOA 1YE6A 2D0FA 1PZ0A 4UTFA 5CJMA 1MEWA 4H7CA 1RH9A 4X60A 2TODA 4DY1A 3CYJA 3KOYA 4W93A 4QISA 4YTTA 1MDLA 2QV5A 4KESA 3H7RA 4QGCA 1MQQA 1G4EA 4OBSA 4NZ3A 4DYEA 1VBUA 4JQ2A 1AVAA 4D6FA 5JBDA 3BAIA 4MB3A 2V2CA 4XTIA 1Q4NX 1CT5A 3E12A 1XBZA 2V3DA 4ZB2A 3N2TA 1D8CA 4XZBA 1PEZA 1LZOA 4LV4A 3RILA 4DZ5A 3UVIA 1CZ1A 2W91A 1UR4A 3EBVA 1HP5A 2ZA2A 2IKGA 1C9DA 3URQA 4AAJA 1T7LA 4ML4A 4NG3A 4MLRA 2J9XA 1OFOA 4QG8A 3GHUA 2XFFA 3LGGA 1WZAA 1YRRA 3TWBA 3SGGA 3AIQA 5HR7A 1JPDX 3LOTA 1IEXA 3GTNA 3BSGA 3QLDA 1KQZA 1TCMA 1UR9A 1UWRA 4UQ9A 5A95A 1ADSA 4GQBA 2I16A 3KS6A 3RK8A 1WCGA 3EWWA 4JY9A 4XVEA 5LNVA 4FF7A 4UCGA 2Z1WA 3CYVA 1DWGM 3R8RA 3B8IA 3QHNA 1ZAJA 1SO6A 1OFEA 3C5QA 1BFNA 1OM0A 3N11A 4NP7A 2C6QA 3TDFA 1XG4A 4XD6A 4JCLA 1W91A 1J2BA 1JGIA 1Y7VA 2CLEA 5I79A 4JTGA 4LOCA 2WQPA 2IKHA 1V3HA 4V1YA 3KL5A 1CGXA 1BXCA 4JPGA 1A5LC 3V3WA 3FVDA 4YN5A 1SJBA 4CGTA 5F2LA 4BI7A 2YW4A 3LB0A 4D6EA 3E0WA 3OLEA 3W74A 3LPFA 4R34A 2GPTA 2Z7GA 5DEZA 4PULA 1XYZA 4C1NA 3EB2A 2PU1A 1BVZA 5JQ9A 1GPFA 1VFUA 3MV01 3UP8A 5LNUA 2WLZA 4HK7A 1K7FA 1HJXA 2DJXA 3MYOA 2QIIA 2ZYFA 3VPLA 4PRWA 3W25A 2XVPA 3QTGA 3OLIA 5TAOA 4REQA 3IANA 3VZYA 5GJPA 1AH4A 2HXUA 4OVXA 5AOUA 3LYEA 4DRSA 2JALA 3XIMA 2BVTA 1WDPA 4RXFA 4ZO8A 1B90A 4H9MA 1K70A 3AO0A 3GDTA 4CNNA 3N2BA 3PTQA 4NKCA 4IFKA 3NZGA 5K9XA 1EO5A 3W6LA 4JTAA 3CUHA 3O2LA 1XV8A 1CIUA 2BOFX 3T81A 8XIAA 3LEPA 3VFCA 1JCMP 3NQAA 4Q4KA 4UFHA 4F40A 5CAKA 1WKYA 2FH8A 2NX3A 1G1YA 3WUEA 2ONEA 1UH2A 3STFA 1J9YA 1E9ZB 5G2WA 4M6PA 1WV2A 1Z69A 4AEOA 3NZRA 4AC7C 1XYBA 2FPTA 2ZRXA 1NWSA 3PPCA 1EX1A 1EA0A 1J0ZA 3V0TA 1V7YA 3LRMA 4HNUA 4MIMA 3G1FA 2BODX 4MKNA 1ICPA 3IARA 3B3DA 3KOXA 4JIIX 1IXOA 3PHAA 5J5RA 2PSNA 4UQDA 1BTMA 1UD2A 3S46A 2ESCA 3L7RA 1VJZA 2CHOA 7PTDA 3FJ4A 3KBWA 2FGLA 1L6GA 4U4MA 4US5A 1AMYA 1RVGA 2GUBA 1NWUA 4IF2A 4BI6A 4B4FA 3FSUA 3G1DA 2WVTA 1HX0A 4L6HA 3TJLA 3IWPA 3TYZA 2FZ8A 4PUMA 4BF5A 1PWLA 1E0XA 3UXDA 3ZOAA 4CD5A 1Q7QA 2OTDA 1KD0A 1Z41A 1JULA 2PGFA 1SZFA 3FYYA 3GG8A 5GJNA 5KZ6A 4FNRA 2Z4GA 3WK2A 1TCDA 1R47A 4NQ1A 3NVTA 3RDKA 3M7SA 1LBFA 4UFLA 3RLUA 3SM0A 2IKIA 4C90A 2V30A 3EWDA 3XISA 1F6KA 5LA0A 4GBUA 4L6OA 1Q2RA 1QFEA 3G3MA 2OODA 4I8DA 1ZGDA 4QEHA 4H41A 3DHPA 3ANUA 4X61A 1SJCA 2DZUA 3W27A 3ABRA 4LWWA 5J8LA 2GFTA 4JN6A 2CLMA 1QNSA 3AQUA 3BV4A 4NT0A 4JTSA 1TIMA 3P14A 1A5NC 1B5TA 1B1YA 2WK2A 3RIKA 2ISWA 3WQPA 2BVYA 3E0LA 4E2BA 4R85A 4I8YA 3MSRA 4Z2JA 2Y88A 1HKVA 1RLCL 4TO8A 3TYEA 3SN0A 4XKYB 2V3FA 1EYWA 4BQ3A 1IT0A 3TEVA 5CEWA 1OBAA 3U3HA 3W1TA 3FCPA 2NWSA 1UB3A 4YVPA 5EGRA 1NFBA 1VFLA 2OB3A 4QQUA 3S1VA 1OINA 1IT7A 1BKHA 2Y61A 3ZXWA 4JTDA 5A8GA 1NIUA 1WP6A 3ONBA 3OYZA 1B57A 4HHLA 3MW7A 1T0OA 3BW4A 3O63A 2YCKX 3BL3A 4GKLA 3OLDA 3EX1A 2VFHA 2PPGA 2ZX7A 3VIFA 4EWND 3TZFA 2ZWYA 1WDSA 2YPIA 3ZZ1A 4PFMA 1MEHA 2XVNA 5HXMA 3WENA 2VXNA 3APTA 1V6VA 4HU0A 4JDYA 1NOUA 3EX6A 1NFGA 4XX6A 1TYGA 3GXPA 1XPYA 4O14A 3M0ZA 3UT0A 3S47A 1OQFA 3NYZA 4PCSA 4GXWA 3HPFA 1YLVA 1XIEA 3P8IA 3PWIA 3LCLA 1LOLA 2GZXA 4OECA 5T26A 4DJEA 3TAOA 2DSVA 1WXJA 3MS8A 2DFAA 2FIQA 3ITGA 3MUY1 2FGZA 1BPLB 1EP2A 1VFMA 2WXDM 3WG6A 4K6AA 2VFGA 4OWGA 2NV9A 2RDWA 3O6YX 2E3ZA 3DERA 1NDVA 2ZC8A 4LAKA 4YS1A 4JDBA 3RUBL 4RK8A 1X38A 3B4UA 3CGTA 3HJZA 1NFPA 1S5VA 1BQGA 2EPHA 1H2JA 5JH2A 4JIHA 4N6EA 1DJYA 3NL2A 1U2YA 4NI3A 3H53A 3G1YA 4PCTA 1GQKA 3S2LA 1MI3A 1GZJA 3QGVA 4BFAA 2OU4A 4RX0A 3S5SA 2JIWA 1CNVA 2EBNA 4AXKA 3JRKA 4DZIA 4I7WA 4AZCB 4NJKA 1LBMA 3R4IA 4EWJA 3GAYA 4H83A 1E1FA 4UTWC 4ZVJA 3UZZA 1C8QA 3A3XA 5FJPA 3CAVA 3TZNA 3EYPA 3I65A 3TMLA 3SUWA 2E8ZA 5FA5A 4YYFA 1ZJBA 2XN1A 1IR1A 4XZIA 2HRWA 4HBKA 2XN0A 4O4WA 1G0CA 3W7RA 4P7LA 3PUOA 3CXOA 3P2VA 2FJKA 3PB0A 2XIJA 2R1MA 4EIVA 4HOWA 3GC4A 3HO8A 1JPIA 2ZRWA 1R3YA 3I10A 1QWKA 3A21A 4IM4A 1GK8A 1VIZA 3AZTA 1XKYA 2PDIA 4Z08A 3K4WA 5E0CA 4GABA 1T41A 4F2UA 1E72M 1EUAA 1X6LA 4BA0A 2NVDA 1XIFA 4BKNA 4LYKA 2E6AA 3ARUA 2E9BA 4RPPA 3E2QA 1QHOA 4PMOA 3CL6A 3S9IA 4NF7A 3HTWA 3WH8A 3GH5A 1QTWA 3PBMA 3TIMA 1W9PA 2E7FA 4ERIA 3JU2A 3ITOA 3WD4A 4JNZA 4QJ3B 3W2JA 4M29A 3LSBA 2FDMA 2J74A 2C71A 3VC5A 4EXQA 4RE0A 3ENLA 1X8FA 3N2CA 3H2CA 1UASA 3WLHA 1XIGA 3LPGA 3HA1A 4GX9A 2Z29A 3RMEA 1REQA 2QJIA 3MBFA 1VIWA 1Q3NA 1UUOA 2Y8UA 4CNOA 4DF2A 4LY4A 4J9JA 4M6VA 3GHTA 3CH0A 2YZ5A 4PMZA 1BXBA 3DFYA 2YJQA 3HV9A 4K68A 1KC7A 2NVCA 3SW6A 1I1WA 3SQSA 1U1UA 5CBBA 1CWYA 4ZMGA 1JG9A 2QVNA 4UZUA 5AYIA 3S2JA 2IMRA 3HZ3A 3UCQA 4G1KA 3FY1A 1V6XA 4L9ZA 2ZKMX 1L6WA 1KKRA 5BRQA 4EAMA 4OUEA 1AL7A 1PWMA 3PSWA 2DV0A 1KGWA 1JZ7A 1OZMA 1J0YA 4WVXA 4JFUA 2TAAA 2XH4A 3OTRA 5LNSA 1A5CA 2YDAA 4GIYA 5B7ZA 1V77A 3TCSA 3H2OA 2QPXA 4FLSA 4AEFA 3EKGA 2DSKA 4LNCA 2WW5A 3W2MA 4J2MA 1AQ0A 4XD5A 3GIYA 4E6MA 4WUIA 5I07A 1UP0A 3O7UA 1UKPA 3CUFA 1XW8A 4Y6GA 1PDYA 4O8RA 3K46A 4OFCA 4NL1A 5CPNA 4NNAA 1KNWA 4YLWA 2NZLA 3BZGA 2W67A 3GDLA 1HVXA 3B40A 3TAKA 3WKZA 4J40A 5JU6A 4E8GA 1GQIA 1F5ZA 3AALA 2ON3A 3NDOA 1ECQA 1Q7ZA 4PB5A 3ERPA 4DLFA 2Z28A 4IWWA 3B0YA 2OT1A 1GQJA 3KRSA 2HK1A 2HSAA 3BVJA 3D6NA 3EA1A 3GFXA 2J25A 1E1EA 4GQQA 1LL6A 1OIFA 1R9YA 1E0VA 3WLJA 1NTHA 4Z0JA 5CLTA 5LNRA 2QCEA 2ZVIA 7XIMA 1FP9A 4QCFA 4H9YA 2J13A 4I3GA 1OX4A 1UZ1A 2WB5A 4U33A 4DWDA 3TTOA 1HNYA 3OZOA 1V0MA 2VCBA 3O6AA 4AVOA 3L66A 3QGAC 4LQ1A 3NGFA 3BLDA 2HEJA 4O1CA 3WDIA 2QUTA 3E6EA 1GPWA 1P48A 3B03A 3LS9A 1DE5A 1F6YA 2OSXA 1FWJC 3DHDA 3HF3A 1SYTA 1F61A 4O1FA 4DO5A 1L6YA 4P7OA 3QZEA 2VRKA 2ZE3A 2Y8KA 3A4XA 3S42A 1VRXA 1BF6A 4TX8A 4PFHA 4CU7A 2BB0A 4W7VA 3S1WA 2Y5SA 3H70A 1MFUA 3MI6A 1U1JA 1MEIA 3T09A 1FQ0A 3WF0A 2VEGA 3KVJA 4GVHA 1HKWA 3S6TA 2BGQA 1ADOA 3QH2A 4JEQA 1VAHA 3KVMA 3PNUA 1CLVA 1L6SA 1GONA 2GYIA 4IX0A 3GC5A 4FR6A 2OXNA 4I9MA 3H4WA 2D0GA 4Q7BA 3W28A 3KCLA 1HTIA 3TC7A 4LRSA 3W84A 1OFRA 5LA1A 4MJZA 2X7VA 4LNYA 3ZLHA 3FK4A 3TYUA 4N9CA 1ITXA 3MANA 4R53A 2G8ZA 4ZO7A 5C2XA 1VHNA 1E4MM 2PDCA 4ICNA 4RLIA 2VENA 1SO4A 1RY8A 1VEPA 2WPGA 5C9UA 4UQCA 3V0SA 3QPEA 3TNBA 2WV8A 3HURA 4GPNA 2VGFA 2VZOA 3MUIA 2GGHA 4YTSA 1SJDA 4CQBA 4RDYA 1RA5A 3O15A 1QNVA 1PIFA 3L23A 3LCFA 3L0NA 4A35A 1REQB 3VKCA 1LWIA 1MQRA 4JTEA 4MHBA 2R91A 3K1DA 3VVGA 3GYCA 2VX7A 4C6EA 2P0OA 2BVDA 4LJ3A 4PCNA 5AHFA 1ODZA 3QM3A 3W1LA 1AH0A 4JXCA 2NWRA 2KAUC 1J01A 2DZVA 3UYIA 2YCLB 2WC4A 1TELA 1QOXA 2ZZ2A 1TQXA 3BLPX 3DYPA 3NL5A 3NEHA 4KS0A 4ML9A 3ZQ9A 3ZSSA 4BI5A 1LBLA 1O1ZA 4QSFA 2B7PA 1L9WA 3CT7A 3I3BA 1S2TA 3L12A 1SVDA 5E6ZA 2PBGA 1E1CA 1RXOB 2I5QA 2YZRA 3AYSA 6PTDA 3EWZA 1LG2A 4DQWA 4I6KA 1W1VA 2ALDA 4AVNA 1NJJA 5I3KA 4PH6A 1VJSA 1EJRC 1W9BM 2PDHA 1FHVA 4M8UA 1QJWA 2QCCA 4G8TA 4GCAA 1Q6RA 3EX2A 4M3PA 4E4FA 4P8UA 5BROA 1GYMA 3VNYA 5FEXA 1XFBA 2F6XA 2PD9A 5CC5A 5C70A 5HOSA 4HHPA 4X2RA 1FDZA 2PLKA 3UWQA 3W7LA 5G4HC 4V27A 3R5EA 3RG6A 4JQ1A 1RR2A 2X1IA 1W5NA 5E1QA 3SCOA 1VP5A 3VD5A 4N4QA 4PTDA 4U31A 3AIBA 4EF8A 5CZJA 4M7SA 4O54A 4GNVA 2DUXA 3U57A 2WHJA 2C19A 2ANUA 1XRTA 3TOYA 3IGUA 1JPMA 2V0TA 5CGTA 3PNZA 3E3HA 3C86A 4F0LA 1A0EA 4WD0A 5CPQA 3SN4A 3MPGA 3DXIA 1JNDA 2YA1A 3ARSA 1RA0A 1OFQA 2Q02A 1UC5A 2ZA1A 1G5AA 2PEVA 1TIWA 1TZ9A 1V79A 3ABOA 1W5QA 3VKBA 2W0UA 3PK7A 4F0KA 2CZDA 1XLCA 3M5ZA 4LS1A 1OX4B 1SW3A 1W3IA 3MSDA 5HNRA 4GUFA 4I9JA 3CU2A 1SO5A 2NLIA 4ICCX 4KEZA 4MDOA 4GCXA 1UMYA 4JIPA 3F5KA 3B8WA 4P5UA 3BAYA 5I77A 5G1TA 2X05A 1R2SA 4UIOA 4L1GA 4L80A 4DNHA 2JF6A 3EGJA 4M82A 3VNLA 1JD9A 3FXGA 3F4CA 3BURA 1V0KA 1U1HA 1SFLA 1O5XA 4MNJA 3EDEA 3TNOA 1JYNA 2NUWA 1H7WA 1TR9A 3ICJA 4AD0A 1EP1A 1RQBA 1AQMA 2POZA 4HOZA 2WNWA 1E3XA 1YIXA 1LQ0A 2D2HA 1BAGA 4XAYA 3UXAA 5CZKA 5CAHA 3BWWA 1UP3A 4P8WA 3W71A 4AD2A 3ARVA 3S4TA 5I09A 2Q09A 2XFWA 4GC4A 4LANA 4CVWA 3OIHA 3DHFA 1JR1A 1HL8A 4H2CA 1O95A 1UCWA 4LVFA 5HQMA 3MY9A 2AQOA 4MG4A 1EWDA 3BV7A 1WNOA 4WKHA 4RW3A 3VX0A 4NJGA 4H6QA 2XH7A 4DJDA 5U4NA 2NX9A 4CVUA 3MVTA 1JXKA 1ICSA 5HANA 4XO7A 4B15A 3UGVA 1NDZA 2OSYA 4O0QA 5D03A 2V5DA 4Y9NA 2QXWA 4MFDA 3KOWA 3F4NA 3Q94A 1Z42A 2OKTA 3HMJG 3E74A 5D38A 1TMQA 4N6FA 4IIBA 1XDMA 1W54A 5H8PA 1OFBA 2BOGX 3LMYA 1QW9A 3ZLGA 2EO7A 4MZYA 1XXXA 3ARRA 2X2GA 3WELA 3UCCA 3B4YA 3U7VA 1M7JA 4HZ6A 4LEQA 1VCVA 1I2RA 3L5AA 3GUWA 4DUWA 1XLMA 4JZ5A 3CNYA 2E0PA 4JN7A 2ZRYA 2E5DA 4G7FA 1H63A 1JRBA 5GNZA 4CEUC 3WQGA 5FJIA 4MLJA 4UOQA 1ZS2A 1WQ5A 5HMFA 1JPHA 3TK7A 4GGBA 3ZR5A 2B31A 3IVUA 3THDA 2JBMA 3KHDA 4YVVA 1PDZA 1UH4A 1FWFC 4WOZA 2YW3A 3BANA 3GNNA 4OHQA 2Z1KA 2Y7DA 1GHRA 1LJYA 3UZXA 1E6PA 1FWWA 4S1FA 3UY8A 1VYSX 4GBDA 3B0VC 2ICSA 4PRTA 1DJWA 2D22A 4DO6A 1TPVA 4ECLA 4J2PA 2C91A 3CHFA 3A4JA 2CBIA 5K4XA 1HKJA 2ZZ1A 3SFWA 3AI0A 1VEMA 4L1WA 4WOQA 2YBTA 2BP1A 3M46A 5E9XA 1J6OA 2W79A 4AF0A 2RDXA 4MB5A 2X0HA 1TJ2A 3TTYA 4EK7A 1XYMA 3U2OA 3VA8A 4HIBA 3EWCA 3EXSA 3HG3A 1GTEA 1POJA 3GG0A 1EO7A 1LL4A 2YL8A 3UPMA 5B7YA 1UC4A 3M07A 3KBMA 3JS3A 3NQ8A 5I06A 3N15A 4S23A 1ESWA 2XSBA 3LCXA 2QKFA 3IGXA 1IIGA 4KEVA 4UOJA 4GUGA 5I23A 3PJWA 4DN1A 4MPQA 1YDVA 1YXCA 3IGSA 3DDMA 1HO1A 3TQKA 3CEUA 2ZZ6A 3CB8A 3HQPA 1B0IA 1EX5A 1KWKA 2WM0A 3DUGA 4PTWA 4FZIA 4IQDA 1KV5A 4NXSA 1PSCA 2DZAA 4B5SA 4OOUA 2ACUA 3MSYA 4FHAA 3L0KA 3TSDA 3PB2A 2GJXA 3SCSA 5HULA 3MYPA 5CJNA 4KEMA 3WQ4A 1EC7A 4A2RA 4QAWA 3L5LA 3IJ8A 2YR1A 2Y0FA 2OEJA 4FNSA 1KA9F 2CLKA 1T40A 3U2ZA 1H41A 3P0XA 3VGGA 4EVZA 3EMQA 2E77A 1US2A 1M9HA 5F2IA 4DJDC 1JI1A 2CZ5A 1A0DA 3U2EA 5C2GA 1M7XA 4IJBA 2ZUVA 3EPOA 1F73A 1GW1A 3WY1A 3ZWSA 3PAOA 3IIZA 2BVWA 3TUUA 4B16A 3C6CA 2QCDA 5JXQA 3CZKA 4Y7EA 2HQAA 3BW2A 4WEVX 2OJPA 1TSIA 1OWQA 4O10A 9RUBA 1TV4A 3C2EA 1ME9A 1CXIA 1S2CA 3LTPA 3MP4A 2PE4A 3S3GA 2IQDA 3WQCA 2P88A 2XG9A 4MB4A 1TFVA 1ALDA 2ACSA 2BY0A 4HKPA 4N9BA 3N9RA 2NT1A 2W4XA 4JHOA 1V6UA 4HNNA 1UD6A 2GLKA 5XIMA 2QW5A 4Q6XA 1DIDA 3CHCA 3VM5A 1SSDA 3N1AA 3C2FA 3GTHA 1A4LA 2AQVA 3K8KA 5EY5A 4OJYA 1QI4A 3KUMA 3A4AA 4KRUA 3RX2A 2WMFA 3N3MA 1XIIA 5HQLA 4MSSA 1DP0A 1FWDC 5IFPA 2BGNE 2QF7A 2VM8A 3GXIA 1YW1A 4GISA 3NYDA 3NZPA 3RRAA 1AQFA 4X63A 2IPWA 4GYJA 1X1ZA 4QR6A 3V1PA 1BGAA 4LS2A 5DY2A 4KFPA 3EDKA 1PHWA 1PJ9A 1XUZA 5A6KA 3LI0A 4O0KA 1G7VA 5C8BB 1PX8A 1ISVA 1RHCA 1RSCA 2CZFA 3MT1A 1FWCC 4B3ZA 3GD6A 2YXXA 2G50A 4YHGA 3WBAA 2PWUA 3B0PA 1YX1A 3AJXA 5BZAA 1A0CA 2O55A 4CQ8A 1PZ2A 2VC6A 4DM2A 3VE9A 4G2DA 1R30A 2JKEA 4B5XA 4Q4OA 4U5IA 4GYPA 1TTPA 3VNJA 2PWHA 3GU1A 2A0NA 3K4DA 2BOEX 1UMLA 2WZHA 1XLAA 3C3NA 2VOTA 3AMLA 4G7EB 1VLIA 2LLEA 1TKKA 1FKXA 3GIQA 3BOFA 2A6NA 4XVDA 3B8TA 4L4LA 1SZGA 1GGOA 3BLKA 1THFD 1FFRA 2IPJA 1PL9A 3G6MA 1FCUA 4FS9A 3GS6A 1UBPC 3NPXA 2WM1A 3UGRA 4C1KA 1E4IA 3OU8A 4L9YA 2HISA 2WMKA 4RZ6A 3L4YA 1PYFA 4WDTA 2PCEA 3W1MA 3MMDA 3AMGA 1QNQA 1ZNNA 4AF0B 1RY0A 4FXJA 2PUZA 4XBSA 2PF0A 2V38A 2WZIA 4RE2A 2B81A 3V4BA 1KR0A 1O66A 3PZ9A 3AWNA 3EWYA 2YCEA 3T8LA 2O7SA 4HMNA 3PZVA 3RFAA 2VI0A 1F3EA 1H4PA 5AHLA 3MI3A 4XQ6A 5KSWA 3PVFA 4DXVA 3MUXA 4FNQA 1TJPA 3F2DA 4WK9A 3JW7A 1UJQA 1XLKA 4GH3A 3W7HA 4DWSA 3SUUA 3HG5A 4D71A 2OQLA 3CZJA 1WDDA 1HGWA 1W17A 2E1DA 2WMHA 5EBUA 3NZ1A 2DW7A 4I5RA 2Y7GA 2C1GA 3ZYZA 3GDBA 5LIWX 2G41A 4MKVA 1IEVA 1FX6A 4KCWA 4S3GA 4UNKA 2VURA 1V3LA 1EHNA 2WMJA 2JKAA 4XUYA 1E6XM 2BG5A 4FX6M 3VK5A 2CLLA 4DJFD 1NY1A 1HQTA 2FB2A 1ODUA 3P60A 1DJXA 5AHMA 2AKZA 1RCQA 3LCIA 2V5CA 3EKLA 2QPSA 5FF3A 1XLGA 4AWEA 5C55A 3OZYA 1E51A 4V1XA 5BXRA 1RJRA 2FZMA 5F4WA 2BZNA 5ABFA 1LORA 3LY0A 1A49A 1PPIA 1ZQ5A 4MWAE 1TTIA 1EF3A 3UBPC 3QC3A 4QIUA 2CERA 4I9TA 5FKYA 1VENA 2R1LA 3S5ZA 4XZHA 4ZQRA 4KERA 5A94A 2QCDB 3MO7A 4EAYA 2XINA 3C2YA 4S3BA 4AIOA 2XPKA 3VIGA 2OQYA 2OLAA 3DCPA 3HQNA 4ONVA 1S1RA 1KXVA 4LAMA 1UKTA 1MW2A 3OG2A 5H8MA 2EXOA 5AB3A 1FWHC 1ML1A 1UA3A 1NVMA 3TW9A 3MUZ1 3L2IA 1E9IA 2ZZ4A 3CH9A 2JIEA 4F9DA 1X98A 5BOEA 2CETA 2XSAA 5H91A 3MMUA 2XWEA 2PTXA 1Z48A 2FVLA 3RAOA 4LCQA 5HPCA 1RCXB 4ZB5A 4NU7A 2AAAA 1QT1A 2HK0A 4URIA 5DRIA 3B9DA 3WMLA 3UG8A 2GSHA 3NQEA 4GQ0A 3TTQA 2YSWA 3RM8A 3WQ8A 3G24A 5EA9A 4HNOA 3OB8A 4EE9A 4XAPA 4J3TA 3H26A 3PPFA 4GYPC 2HWGA 1DIOA 4ACYA 1FRBA 3L4WA 2YCJA 5KETA 1P0KA 5CBJA 4LALA 3FNDA 3KOFA 4DVOA 4Z1DA 1XD0A 4GI9A 2PZ0A 3VOHA 1QUMA 3BSMA 3P8JA 3QYQA 4RL3A 2EGZA 2QLYA 4I7UA 4DPPA 3TW6A 1JFHA 1VBHA 4C5YA 1MUWA 3AU2A 2E67A 2YCIX 4J3VA 4O18A 4IGMA 4KWWA 3QR1A 1PXGA 1LRNA 3D0CA 3GFZA 1EQPA 1ISWA 1LOSA 2R1PA 3PBVA 2E9LA 3UWWA 1KTBA 1MWOA 4G5DA 3FW6A 5FEPA 3BLEA 2FZBA 5BU6A 4IMFA 1ONXA 2R24A 2BHZA 4DO4A 1KV8A 3OPSA 4FB7A 1OGSA 2UY5A 3UXKA 1QI5A 3M0MA 5HJXA 1ZALA 4ZQOA 3QOMA 2Y5JA 3KTXA 3ZJ7A 1XRVA 1DORA 1E15A 5DQPA 4TUFA 4RKAA 2CW6A 3U7BA 3ZJKA 2OGYA 3PTMA 1XWYA 3TLQA 4QX4A 4JQ3A 3V75A 2JGYA 1S39A 2ZOXA 1FFQA 4DWSC 3I3EA 2Q3OA 5LA2A 4QFUA 2FTYA 4XD4A 5CSSA 1IYXA 2VHLA 3T78A 3VC6A 4XZNX 2PA6A 2ZRZA 4EP8C 3ECQA 1OCNA 3OA3A 4JIEA 3UJRA 2EPLX 2WLYA 4XZ9A 4GKTA 3ZJ8A 3WLLA 2ATSA 3GU9A 3T8QA 1S2WA 1VEOA 1FA2A 3VIOA 1J5SA 4AHQA 3AS3A 1E71M 3QJAA 7REQA 4HZ8A 1P6BA 4F66A 3H2NA 5LZLA 2WOQA 4Z1YA 1UIOA 1V51A 2OR2A 2DSWA 5I24A 2HE8A 4PUNA 1RUSA 1KWGA 2TYSA 4M6UA 3KE0A 3KP1A 4HJFA 4FX8A 1DWIM 3W7EA 5DX7A 4GY7A 1AG1O 3NQGA 5CC6A 4H6KA 3H2EA 4O13A 1CXKA 1MVYA 4B5TA 4IMEA 4A4AA 3IJQA 3UEQA 2C0AA 3ZO9A 3KBVA 3SCRA 2BHUA 1G4TA 2HVMA 1YE4A 1D8WA 2CYGA 4O1EA 2WHKA 1PX3A 4G6CA 4HK6A 1OC7A 3SQMA 3ZIZA 4GD0A 4DUXA 3BLFA 5E9AA 1TPWA 4K7VA 1H60A 1CEOA 4FA3A 4U10A 3G6LA 3W22A 3W7KA 3G0SA 3HFTA 4FO4A 4H8HA 2NUYA 3EMCA 1MMFA 1HJQA 4N0RA 1OSEA 3V0UA 3VIKA 1MZRA 3CWNA 2CPUA 2PGRA 3GE7A 4JTRA 3S9ZA 3BQ6A 4H6EA 3E96A 2CIPA 1C90A 2BXVA 3PTDA 3HPAA 1W3JA 3VU2A 3N25A 3VKAA 1H62A 2ZVRA 4CN4A 1O12A 4HSNA 4W7WA 3P3BA 3IJ7A 1Q66A 3D5HA 4YYCA 1H7PA 4KMQA 5HPOA 2EPOA 1XLLA 4JFSA 5HQEA 3N9SA 3SIZA 1XYFA 4KIEA 3RU8X 1RPKA 4Q4MA 4U5KA 1KO0A 5EYWA 3UJSA 4WJXA 3EWBX 4TVCA 1EQCA 1PAMA 4HMDA 2H6RA 3CIXA 1L2UA 4X22A 3GM8A 1IWAA 4H9VA 1JPKA 2D3LA 3F1QA 4Y9OA 2PDMA 1SMDA 2DW6A 4A21A 4X0NA 2A3HA 2NSOA 4IH3A 3OEXA 3L4XA 3UWUA 4JY8A 3NOYA 4IIHA 2HDJA 3EOOA 1V3IA 1NU5A 1ZCOA 1MXGA 1R7AA 4FOUA 2PWEA 1RK6A 1H7XA 5MKGA 3WN6A 1WKDA 1YEYA 1E5NA 2HCVA 3AYRA 2WNNA 5LHFA 3O3RA 3VM7A 1F76A 4EACA 5AECA 2FKPA 1PBGA 3NDYA 4W4QA 2NV1A 1KB3A 1US3A 3QMSA 2XM1A 2Y70A 2F9RA 3G5EA 4H9XA 3C2OA 1W3LA 2DQXA 2V81A 3CJPA 3IIPA 2DVUA 3N2OA 3QKEA 2D1ZA 5FF2A 1V6TA 3WK1A 3NZQA 1HFBA 1GVIA 3QOKA 3AOFA 3MKCA 4M1BA 4YCOA 2J78A 1BWLA 4R27A 4CLMA 3RN6A 3W9ZA 2DDXA 4OV9A 3II1A 4WY0A 5I3HA 4ROQA 3A12A 1UZDA 2VWSA 4ACZA 3H4XA 1B3XA 4IX2A 1J96A 1TJ0A 4XZMX 1LG1A 4Z2LA 1IWBA 5CG0A 1UIPA 3HGSA 5BW6A 1IIHA 1N82A 4D8LA 4C91A 3LI1A 2V9DA 5IDZA 4AYSA 4W88A 1TPC1 1EDTA 2X40A 4MNLA 1U33A 4B5VA 1A5SA 3AIEA 4O28A 3KW3A 3AS2A 2HZGA 3LN3A 4CD7A 1RQEA 3GB6A 3VFLA 4A8RA 5JIPA 4MVAA 4TIMA 1IEQA 3WLOA 1PX4A 3FEMA 3ARQA 2IS7A 1OYAA 4LVAA 3UG5A 3KS5A 2FH6A 4GC3A 5FSEC 2D2JA 1OGBA 5BOOA 5AYYA 5DCBA 3SRHA 1G6CA 5CGQA 2DH2A 1YTKA 2ZICA 4LU0A 1KCLA 2WSPA 1V5XA 3CMJA 1C9WA 5BCAA 1GOWA 1W3HA 4A22A 1K9TA 2O7QA 4PEKA 4AW7A 5LKYA 4UTUA 1H1NA 1QBBA 4CD4A 3R11A 1B3ZA 3WLRA 2GVYA 4RR4A 1V3JA 2Z6IA 1KFJA 1CXFA 5C5YA 3KWSA 3I7QA 2QJGA 3NQDA 3T08A 4B5NA 1TJRA 4ASTA 1P1XA 3IJDA 3WF1A 1W1YA 2TRSA 2UV8G 3CV1A 1TA3B 4H8UA 4Q32A 2DVXA 1F8MA 1NEYA 3QQ1A 3KBJA 4IIFA 2A3LA 5DCDA 4OV4A 4JTUA 4BK9A 3GTIA 4XIMA 4ZO9A 4WJEA 2VJXA 3ZVHB 3KZPA 2AMXA 2EQDA 3CZLA 3W1AA 4G56A 1KM6A 3TOPA 2X2YA 3LRKA 3LTSA 2RJHA 5D02A 1GCYA 3SSJA 1QPOA 4U2ZA 4OKDA 4U3CA 2PWDA 3TN3A 3WF3A 2HS6A 2FDSA 5AC7A 3T4WA 4W9TA 2RDTA 4GGHA 3AWOA 1M04A 5D09A 4BHYA 4D2JA 1C8YA 1H5VA 5DANA 2YYUA 1H61A 1YMYA 5HMEA 5BMXA 3IAPA 3WQDA 5E93A 3WFAA 1SR0A 2WMIA 3CUGA 3GAKA 1CYGA 3VDBA 1KM2A 3FVMA 3GVGA 4WCJA 2ZCGA 4MNKA 1HUVA 2BSLA 2GVEA 2OYLA 1L0PA 5EMYA 1HKMA 1U22A 2X0SA 1J18A 3PBUA 4NZ4A 1XBVA 1A5AA 3Q58A 2Z27A 4RZ5A 3G1XA 1XLHA 3AS0A 3TROA 3RCNA 3DKLA 3BARA 1OEPA 3T7VA 1LLZA 1FWIC 2J8FA 3LGDA 3FYPA 3SBFA 1XQKA 1OX6A 3G3DA 3ABXA 3WQWA 5A8MA 4GZEA 5MKGB 3N2MA 3AMCA 2J7GA 2ZXBA 3DENA 5JMUA 2E4TA 3NQ7A 4JYEA 3VDHA 3BQ5A 3VNDA 3FKKA 1JXJA 5A8QA 4ZOAA 3ARTA 4JICA 3UA4A 1R5YA 2Y2WA 5A6LA 2ZXQA 3W1NA 3KRUA 3THQA 5DF0A 3DFOA 1W1A1 1GVRA 2Y7FA 4JS3A 3QLLA 4P7QA 5FI8A 1WBJA 3WLTA 2QQ6A 3L0GA 2Z2UA 3VOIA 1K8ZA 1QPRA 1ZTVA 3IEBA 1UD4A 4O8AA 3LCWA 3AMDA 4QTGA 3SY1A 1FDJA 2BFGA 1W56A 4L1XA 4WY0B 3K8MA 3FHQA 2R9RA 5ABTA 2NSXA 4ACZB 2QMJA 3P5YA 3IUIA 1AL8A 4ZOBA 7ENLA 2WCAA 1WUEA 1YPIA 4PBFA 1LLOA 1UROA 1EKOA 2TSYA 1NDWA 3AXXA 1DQXA 4WGHA 4MJ2A 3WLIA 3W1QA 1IF2A 3VOFA 3GR4A 2YBUA 1GUVA 4KFOA 1A5KC 3GHRA 3L4ZA 3W37A 1ZSXA 1S1PA 3NM1A 2P8CA 3WZ0E 2WO5A 4PR4A 5CSRA 4Y9MA 3WLKX 4GJ1A 1US0A 3D3FA 2DZPA 4N2YA 1AODA 3ITXA 4L56A 1PUDA 3W38A 5GVJA 4RV8A 3SN1A 1W1PA 1W0MA 4AX7A 3WH5A 1Q7MA 3RCMA 3PPHA 3NSMA 2A4AA 1UWUA 3AYTA 4OGZA 1PYMA 4QM1A 4FPSA 2ZA3A 3BDKA 2RHGA 4S3AA 3OVQA 4C6IA 4LS0A 3O8AA 3W7IA 3NFUA 2SFPA 4Q8WA 1GQLA 5HK4A 2PDLA 4JTIA 4XZWA 2WSKA 2JF7A 1HN1A 4NIRA 4JN8A 4PMNA 1GW9A 4MUZA 3WNLA 1WDWA 3MWCA 4UQBA 1S2VA 1E73M 1QWGA 3WFLA 2PDJA 2PDUA 3BZJA 4S3EA 1TUFA 3BAXA 3ORWA 2C16A 3BLOA 4UTIA 1LP6A 4WDXA 2DU2A 3GRIA 4IXXA 2NW0A 2Z6JA 4X2PA 1DBTA 2YDSA 3BMWA 3CLWA 2FVMA 2H9AA 3E0IA 4HPXA 1Q65A 1Q6FA 4A3HA 3APGA 1MO0A 4L61A 1EGVA 3H54A 1E0UA 4JOMA 5CPOA 2IQ0A 3IK2A 3P62A 1R9ZA 3TXZA 4H9TA 1XGZA 1SFSA 1IZKA 1MUMA 4JTTA 1Y65A 1Q6GA 3M41A 3MDUA 2PF8A 4WKFA 2NQLA 3TU9A 1XRFA 4WSHA 4X0VA 1RCOB 3F4VA 5K4ZA 3DHUA 3IGHX 1YPXA 4B2DD 4JTLA 5HMSA 6REQB 3M6YA 2ZUMA 2GVLA 3LNPA 1EB3A 1CECA 1CXLA 2V5JA 5DBUA 4C6CA 1HP4A 4Q4QA 1JZ4A 5D2XA 2OYKA 4FXSA 3NL6A 4DF0A 5FACA 1TRDA 2QIWA 3WLNA 2BXYA 2R6OA 4BF9A 2AL2A 3W87A 1PO9A 1W9VA 2QAFA 3BCJA 1KKOA 5EMLA 3P6LA 4R3UA 3CO8A 3USZA 5CGMA 1I2PA 1ONRA 2QJNA 1HGYA 3KZSA 1J2WA 3E2RA 1CB2A 1BVNP 3PTKA 2XGIA 5EL1A 4C6NA 4ADUA 2PLJA 3G8RA 1CGUA 4QLLA 1Z89A 4FR1A 4J1OA 5TQLA 3BG9A 3W7NA 2X09A 3LHYA 3VKDA 2ZC1A 3OG3A 3CQJA 3OGSA 2YFNA 1WOBA 2E40A 1RJQA 1M5WA 3P61A 4UTKA 1TRIA 3R25A 3MJYA 1DJHA 1ZAIA 5C7HA 2IKJA 3RLVA 5HNNA 3VOGA 3QY6A 3GWQA 2QS8A 2PTZA 1K9EA 2FPVA 2X7WA 2CFFA 3DAQA 1VGAA 1E4LA 2VVSA 4IHCA 4E2DA 4BY3A 5HUOA 1FP8A 1VZWA 1CLKA 2WJEA 4D6GA 3EPNA 1GKRA 4R5EA 1F8IA 2E6DA 3MWAA 1B4EA 3MHFA 4MYXA 3RX4A 3V16A 1GYNA 3SJ3A 4DM1A 4LW7A 4MAZA 3L2MA 1PZ3A 3LZ5A 1F9CA 4H04A 1A3WA 4UWMA 4QCEA 2D73A 3FSTA 3TQ0A 5D4YA 4GMEA 4MWAA 4DXXA 4AB4A 2Y5EA 3I4KA 5XIAA 2GVGA 3NOEA 2E09A 4RDWA 2Y85A 3O1NA 1JI2A 2X42A 4HK5A 1HZYA 4HU3A 2G0WA 4KFNA 4YTUA 1CTNA 5HDRA 2NT0A 3NXLA 3C52A 3KL0A 2IUZA 2OELA 3DH7A 1XDLA 1OG6A 3A47A 3W29A 3CWHA 1QO2A 3I6RA 1OT1A 2VQTA 3WK3A 4EXAA 2VP8A 1ICQA 1AZ2A 3JZEA 1WKEA 2VUYA 4ERAA 4KQNA 2QMKA 5HJYA 1JGMA 2RAGA 1FWEC 4A8LA 4BS0A 4S3FA 1Q6EA 3O06A 3N34A 3ZMRA 3T55A 4W8LA 2J66A 3ATZA 3C2RA 2XJ7A 1S2UA 4AUBA 1UR0A 4TMBA 2YDQA 1NELA 3T4CA 3SY8A 5HJLA 2EPKX 3W82A 2G4FA 1Q6CA 4HT3A 1OYCA 3BE7A 3L4TA 5IDIA 2Q8LA 3GVWA 2QUMA 2ZFAA 3G1RA 2CKRA 3GX9A 1K4HA 1SU5A 1GWJA 1R3WA 1GYLA 2J9YA 3U48A 3W7PA 3EX4A 1ENUA 2VR2A 3WYZA 4UTJA 1J5TA 2H8XA 2H9AB 5KMYA 3QZ6A 1BWVA 4TVDA 1HT6A 1YYAA 3L4UA 3T07A 4N7QA 2QVHA 1QK2A 2PP0A 1EJXC 1V6WA 2HPMA 1BYDA 4JD4A 2F84A 5HUPA 2VEPA 3UR7A 1RJPA 3A5FA 1Q6QA 2HS8A 4GZIA 4MZ8A 4J28A 2NUXA 1WA3A 4HYWA 6ALDA 1R9XA 1AMKA 3B9NA 1VLWA 3UNDA 4US5D 4DB7A 3TTEA 3FS2A 4M19A 1Z32X 3GNRA 3B9OA 4FLRA 1ZB5A 5KINA 3WNPA 1JEZA 3M6DA 1C29A 3GC2A 2HTMA 2I57A 4PMXA 4AZGA 3AUJA 3NGJA 1LUCB 3W01A 1R6WA 2VR5A 4MY1A 5F7UA 5FESA 2VQUA 4Z2KA 5A6SA 2X1SA 2CESA 3V1HA 2QF8A 4W87A 3IIXA 3S6OA 5A8PA 1UZHA 3LV5A 4HP5A 4NI8A 2QGHA 4RDZA 3E5PA 4GX8A 2XWDA 1HJUA 3VKJA 1Q5MA 1UPMB 2E9MA 2W6RA 3GKFA 4DXKA 2CKSA 3IIOA 4NAFA 4NRRA 4D8AA 3MMTA 3QGKC 4PMUA 4A29A 5A2BA 2H3DA 1S5NA 3WF2A 4HPJA 3NO5A 4OQVA 3QQWA 4AWTA 1XI3A 3TFCA 2E6FA 2IPGA 2W62A 2PWGA 4QSHA 1BEUA 4JL2A 1SZNA 4MWAC 3V5OA 2PDWA 3W2LA 2P1FA 4QE4A 4EX4A 1EXBA 3ZWTA 1Z3NA 5D2WA 4TXEA 2JEQA 2EG7A 3TR2A 4UC5A 4UMCA 3IUHA 3NG3A 3CLMA 3MHUA 3SGZA 5TF0A 3N4EA 3PAJA 4MYAA 4PGLA 5CPLA 2WWCA 1B4KA 1VFHA 3FAXA 1QMLA 5AYBA 3A4WA 3R0DA 4PRRA 1X7FA 2GOKA 2PP3A 3IK4A 4GACA 3CQ0A 4TV6A 2Z24A 3AXKA 3N2XA 4NZ5A 3GKAA 2PTYA 1UUMA 4RE4A 1DOSA 2XVKA 2OZTA 3W1RA 3MCNA 4D1JA 3ID7A 3TC3A 3UWYA 3F7JA 2P76A 5C9RA 2G3IA 1BGGA 3OHIA 1DYSA 1H11A 4HN4A 3WJYA 1K8CA 5BXSA 1H1YA 1QNOA 5M03A 3C8NA 3VMOA 4DI9A 4MWAB 4IUOA 2CZVA 3NQVA 4N9EA 5EBAA 2PDFA 4AWSA 4FAMA 3MHGA 2HXTA 2DY3A 3LBCA 2QNEA 4AY1A 3QPYA 2VD9A 4US6A 1K02A 3JZUA 2YXOA 4XZLX 4GUHA 1UPPA 1B30A 4DJED 1MNZA 2YL9A 2WMGA 3R8GA 1BG4A 3S1XA 3MO4A 1QRQA 2J88A 3B8UA 3WL1A 4EXBA 4Z2IA 3AIWA 1F2JA 2J62A 1TMLA 4AZBA 1AK5A 1OJXA 4O19A 4LVGA 4QJ5B 1MFVA 2V2DA 4GXMA 1A3HA 2I1OA 4LUSA 3W23A 5D33A 4QITA 1VC4A 3VOJA 4JGDA 5F1UA 1F05A 3HM7A 2ADAA