4ADUA

Crystal structure of plasmodial plp synthase with bound r5p intermediate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
278
structure length
278
Chain Sequence
b'NDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase
total genus 96
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4aduA00
4XTIA 3WJXA 4OQVA 4XBSA 2J9ZA 3ABQA 5D33A 5E0KA 5IBXA 4X9SA 4AVFA 4M19A 3QC3A 3TFXA 3DFPA 2VOMA 2GOUA 1QAPA 2E6FA 3DU0A 1GTEA 4LU0A 1HUVA 3S5OA 1FUYA 2NXGA 5K9CA 5IM51 5A5WA 3W70A 4N4QA 4GBUA 2QCCA 3DH7A 1UJPA 2J9YA 4O10A 4JR5A 4Z08A 5LGZA 2B0MA 3G8EA 1ALDA 2EPHA 2ZA3A 3CWNA 3KVLA 2YFNA 2WNZA 4HT3A 1X6UA 3LCFA 3BW3A 5HMSA 4OGZA 1MSSA 1P0KA 3F4WA 3QH2A 1GPWA 3LB0A 3L5LA 3RFAA 4UFMA 1VRDA 1PE1A 3BLIA 1EWEA 4OWGA 3WJYA 3QMSA 3PUEA 1H7XA 2ZRXA 2NXIA 3EX6A 1DJQA 5KINA 5CPOA 2OCZA 3UPBA 5DBTA 3NQMA 1DORA 4ZVJA 1K8ZA 1XXXA 2A1YA 3W87A 1XKYA 4WOQA 4IMFA 4KFPA 1CW2A 1DBTA 3GX9A 4JY9A 3FA5A 4OBTA 1TV8A 3BG9A 1SFJA 2YXGA 2CLKA 1TTQA 3GNDA 5AYZA 1FY6A 3IGSA 3UPWA 2A5HA 3QPZA 1D9EA 1SPQA 3KHJA 5DXYA 1EB3A 1Q6LA 3GDLA 3T78A 4L4LA 4E2DA 3PVFA 3QMTA 4R34A 4LVAA 1WQ5A 2FB2A 4FIRA 4M6VA 3W23A 4LS2A 5EMUA 1O5XA 4FNUA 3EWWA 3NQFA 1GQNA 4AAJA 1G6CA 2B7OA 3KVJA 3NAVA 2A7RA 2ZQ0A 1PCKA 1TPB1 1X8FA 4A29A 2JGYA 2Z2UA 3E49A 1R30A 4O52A 3LLFA 4NNBA 3LTYA 1XFBA 3O1NA 4ONVA 3NA8A 4UTIA 4BK9A 1O60A 1G4SA 3NL2A 1ME8A 2QJIA 4BI6A 2BTMA 1KA9F 1L6YA 3W1XA 2E5CA 3UZJA 3PM6A 1U5JA 4JIPA 5FEXA 3NG3A 3IIVA 4JTGA 3FEMA 1JCMP 1JVNA 3L0GA 3H53A 2F84A 3QJAA 3PUDA 5AHMA 2BX7A 2G97A 1D3GA 3H54A 2G96A 4NNCA 1PIIA 5AHEA 4OU1A 3NM1A 2VFHA 3PY2A 1H7PA 2E1DA 4K8HA 2Q8LA 3A21A 2ISWA 1SZNA 3THAA 3BARA 1GZGA 1VQTA 4KFNA 4IJBA 1SUXA 3R8RA 4U28A 1FCBA 5K4XA 3PWAA 1QWGA 2Y61A 3EXSA 5FF4A 3LCWA 4RJEA 4JXCA 5CSSA 1KBJA 4LS1A 2NLIA 1YDNA 5CZ0A 1F05A 3S5NA 1CX9A 2ZBTA 1GVQA 1EUAA 4JX4A 3GB6A 5F2MA 2J27A 2VFGA 1PHWA 4WOZA 3WJSA 3MI3A 1WXJA 2DP3A 1K3UA 4XWUA 3TQKA 3W7CA 3G1DA 3UWYA 2CLMA 1GTHA 4O11A 3B06A 3BW2A 1DOSA 1UUOA 4O15A 4MY9A 4DPPA 2RFGA 4ZZ9A 1SW0A 4GUIA 1OFRA 1VR6A 3NGJA 3GR7A 3GNNA 4JDBA 4AEOA 1EEPA 5AFDA 1LZOA 3O63A 1YADA 2P0OA 4FEZA 4XKYB 4LRTA 3P62A 4MYXA 4WY0B 2Z0IA 4QITA 2WNNA 4UR8A 3GVGA 3FFSA 4YWIA 4A2RA 1OK6A 1VZWA 2DU2A 1KM6A 4JYDA 5CZJA 3WK2A 1ZNNA 5EBUA 1RZMA 3EX3A 3KFTA 3FYOA 2YW4A 3OIXA 4BWLC 1KBIA 1BEUA 3B0UX 1F7BA 1I2PA 4K6AA 3ABOA 1Q6RA 3GDRA 4FX7A 3LI0A 1M5WA 3GAYA 1GEQA 1NSJA 2X1RA 4PH6A 2YGYA 3W1TA 4DF0A 4O28A 1FXQA 1YLVA 2YYUA 1WA3A 1FCVA 2B4GA 4NNAA 4M5PA 4PTNA 3TSMA 3ELFA 4MLJA 3UWQA 1W5MA 2D73A 5I3FA 1Q45A 4LNYA 3LRKA 1BTMA 3TQVA 1R46A 3DENA 1NF0A 2VEPA 5G1YA 2NX1A 3LCLA 3IGXA 3G1SA 4ZQCA 2YSWA 4O54A 4JTTA 5K2ZA 5U7SA 3M41A 4M7SA 1IXNA 1I2OA 4LUIA 4WQ6A 3S1XA 3N2XA 3BW4A 3USBA 3NQ2A 1LOLA 2QEZA 5E93A 5J5RA 1ZHAA 4JTUA 1GVOA 3DKJA 3CT7A 3IV3A 4FB7A 3EX2A 1KLZA 2XN1A 3PSWA 5BRBA 3W7JA 4FNQA 1NFBA 1S5TA 3A24A 4CQ8A 3IIZA 1AW2A 3KRZA 1FX6A 2C19A 1D3HA 3GXPA 4DELA 4N6EA 2AAMA 1XM3A 1OG0A 1WAUA 4GUJA 2Y7FA 3CTLA 4JTEA 1O94A 1C29A 2FPTA 5DXXA 1ICSA 2YDAA 2ALDA 1WOAA 3L65A 1B57A 1QDSA 3CIWA 3P67A 4LUJA 3UXDA 4U4MA 3V75A 2RKXA 2QCHA 3EEGA 1ME7A 4K39A 1JCLA 4JD4A 3MJYA 1OX6A 1LBFA 4P2VA 1HL2A 1XBYA 3MHFA 2GVGA 5EYWA 2AGKA 4DF2A 2J6XA 1WDWA 4JYEA 3YPIA 2FPYA 1G69A 4MUZA 3HGSA 3FYPA 2H8ZA 2Q3OA 3P80A 2A6LA 3C6CA 2CWNA 4CQAA 3ZR4A 1XC4A 2Q8ZA 2QKFA 3HPZA 1QPRA 4YLWA 3C2RA 1OX4A 2V81A 4ZMGA 4C1LA 5EA9A 3BO9A 2H3DA 3TK7A 3W74A 2V0TA 2ZRWA 4NJJA 2RHGA 3PBVA 4MZ8A 3CQ0A 2WNQA 2X2GA 4AH7A 1JRCA 5CPLA 1SQ7A 3QRHA 3NQ7A 1GJPA 1SW7A 3W71A 3F4NA 2Y70A 3GDKA 1VGAA 1TYGA 4W9TA 4RX0A 3TUUA 4LVGA 3ZWSA 3UD6A 3W7RA 2CZDA 3ZWTA 4YCOA 1V5XA 3TW7A 1TPWA 4Y90A 4NJGA 3HPXA 3LI1A 4JTIA 1TMHA 4R33A 4UTKA 4IPJA 2XFWA 1SZGA 3OHIA 3N34A 2HS8A 4NT0A 4DPQA 3MBFA 2QCLA 4FXRA 3PAJA 2V5LA 1VHCA 4ADSA 3BLFA 3N9RA 4IXHA 1XL9A 5MHBA 1KM2A 3L68A 2YW3A 3GKAA 3LTPA 5FF0A 2ABAA 5I3KA 3W1PA 4B5NA 4IMCA 2TPSA 1H7NA 2ZTKA 2IQTA 1F74A 3W1NA 3G0XA 3LXCA 1AMKA 5BMXA 1H7OA 2ZFAA 3O07A 3TV8A 3QPYA 2BWGA 1Z44A 2B7PA 3W1MA 1VH7A 2TRSA 4FO4A 4BF9A 4JIQA 2CLLA 1LCOA 2Y62A 1I45A 1AW5A 1HTIA 1FDYA 1ICPA 3R5EA 3GYEA 4GFSA 3NOEA 3M43A 4LS0A 3TXVA 4GJ1A 3SW6A 2X1UA 4O1DA 1AL7A 2QDHA 3B05A 4JEQA 4JTJA 4MY8A 2A7NA 4FX8A 1RQEA 2QUTA 3W2KA 4PODA 2ATSA 3N2MA 3UY8A 1SZFA 3PUOA 3MYPA 2HSAA 3IIOA 3TA6A 4FF7A 2QJHA 3LHZA 5GVJA 4HNNA 3M5ZA 2CW6A 3PG8A 2DZTA 2QJGA 1NAL1 5BNKA 2VELA 4GWEA 5HR7A 3TW6A 3FS2A 3TIMA 2CZEA 1KW1A 3VCRA 3BLEA 4LC6A 3N19B 3CWOX 3VKJA 3CC1A 1KM3A 3E9AA 2OT0A 3LDVA 1W0MA 3IRDA 3KXQA 1AL8A 1KFLA 3C56A 2GVLA 2WOQA 1J4EA 1BWKA 4H6KA 3DFOA 2OZ0A 3IIPA 3HBLA 1F6PA 4NJKA 4UNLA 5IBXC 3W1LA 3P5YA 3P8JA 3GXTA 2WPBA 3LXAA 2UV8G 3TJXA 4UTTA 2YCEA 2YX0A 3M47A 3DGRA 4RXGA 3IVUA 1LDCA 3GLCA 4O14A 1UUMA 1N55A 3OVPA 1VHNA 3W72A 2YR1A 2X1TA 3M6YA 1UB3A 1Q6OA 4MJMA 3EKZA 1A50A 3BGJA 1W5QA 4CNPA 4UFKA 2R8WA 3P82A 4X2RA 4FXSA 3W73A 3N14A 3SECA 2ZZ4A 1OK4A 3T55A 5AC7A 5LNWA 4IWWA 5ABTA 2WKJA 1TTIA 1RR2A 1W8SA 1YTDA 4QM1A 3PS7A 1H1ZA 1SW3A 4K36A 4GXMA 2LLEA 1W5NA 1QR7A 2C15A 2ZRYA 1K7XA 3OG3A 4ICNA 3T4CA 1XBZA 5K4ZA 5KZMA 1S3HA 4JICA 5BW6A 4N2YA 1IIHA 2NUXA 2YZRA 5HINA 3NQEA 1I4NA 1FDJA 2QCNA 4FNPA 4Z0JA 1VS1A 3C8FA 1AG1O 1IGSA 1TIMA 1KM4A 3NQGA 4FHAA 3AO0A 5LNVA 2VXNA 3TX9A 2H3BA 3LGEA 4O57A 1TJPA 3NPXA 3W1AA 1GG0A 4HNTA 1EP3A 3OVQA 4AF0B 1QCWA 2ABBA 3MWAA 3MBDA 3UWZA 1W3NA 4NVTA 4ZL1A 3NL3A 1GVFA 1AK5A 4R7JA 1GG1A 1E51A 1J5TA 3SGUA 3IVSA 1H5YA 3CLMA 1JR1A 4LVFA 2E77A 3W7NA 1N8FA 3CHVA 3G22A 1GOXA 4DO5A 1T96A 1OFBA 2WSYA 1H1YA 2NUWA 2I9EA 4CCDA 5L6UA 1IXPA 3MHGA 1ZJIA 5D02A 3M44A 5D32A 4TO8A 5KMYA 3O6CA 4IX0A 4O16A 1QMLA 3OEXA 4ADTA 3HG3A 1LRQA 1SO6A 3C3NA 5F4XA 3H55A 2FFCA 4UNKA 4EVZA 3PB0A 4BI5A 4OV4A 1TQXA 5D30A 1YXDA 1VJIA 5U4NA 3TC7A 1Z42A 2ZTJA 3S42A 3LERA 5LZLA 3W2MA 1I8JA 3LRMA 3LRLA 3T40A 1RD5A 3HQ1A 4G1KA 3UZ5A 4C1KA 3M0ZA 3NQVA 3PG9A 1W1ZA 2QF7A 1TQJA 4MPQA 2NX9A 4XZ9A 2H6RA 3MO7A 2A7PA 1ONRA 2Y89A 3EWZA 1A5AA 4UTWA 3WJWA 3KVKA 3NVTA 4HSNA 5KTLA 5DY2A 3M5YA 3NQCA 1B4EA 4M6PA 3W3OA 3W2UA 3JS3A 4WY0F 3C2VA 1BKSA 1WX0A 2QCDA 2VFIA 4Y96A 2DORA 3HF3A 4S2BA 1H7WA 3W22A 3LHWA 1ZAIA 3RK8A 3D0CA 2XN2A 4UR7A 5F2IA 3W86A 4NZJA 4JN6A 3IEBA 3A5FA 4JTHA 3STCA 5K3VA 3NQDA 4POCA 1OX5A 3G1YA 1TPFA 4OT7A 1FWWA 3ATYA 2E6AA 4IQLA 3MUXA 4UMBA 3TSBA 5C5YA 1VC4A 5EKYA 1J2WA 2CU0A 4ZQOA 3DI0A 2I1OA 3I68A 4UTLA 4FNTA 5EL1A 3C4UA 1F76A 4HHPA 3W9ZA 1H51A 2ZZ1A 5A8GA 1PV8A 1H60A 4DBDA 2FTPA 4QQ3A 4Y9AA 1TO3A 1F73A 5J5DA 3ABSA 1QO5A 1K02A 3HGOA 1LRTA 2CFFA 1LLWA 1P0NA 3E12A 4LW7A 5C54A 1IXQA 1JCJA 3TFCA 2GVJA 3TJLA 4UXDA 3OBKA 2V5BA 3TAKA 3B03A 3TSDA 1VCGA 4N9BA 2V9DA 1OFAA 4JTKA 2FLIA 4M6QA 4UMAA 4MFDA 1K03A 1O4UA 3QW3A 4O18A 5DY3A 2QAPA 4JS3A 3CIXA 2OT1A 4AWSA 4IMGA 4NX5A 4MJZA 4DO6A 2VFDA 8TIMA 5CZSA 1NF7A 5FF2A 1G4EA 2Y7DA 4QNEA 5KZDA 1SSDA 2BZNA 4O0ZA 3NXFA 3W7MA 3FKRA 2X16A 1MEHA 4MLRA 1A53A 2EF9A 4NUWA 1RV8A 4FIQA 4DQWA 3NYZA 3SY5A 3LBCA 1LORA 3I6RA 3W7QA 3NL6A 4IOTA 2HMCA 3TMQA 3E96A 3LLDA 4GUHA 1SZEA 4O4WA 1I2NA 3OA3A 1PL9A 2DZWA 3O6DA 5D2WA 5CGQA 3QW4B 4BWLA 3HG4A 3SI9A 2RDWA 1M6JA 1HO1A 2YYTA 3F03K 1QNVA 2CLEA 3KAOA 1K7FA 2ZRUA 3IGUA 3NZ1A 3M7WA 3HG2A 5G2IA 3A23A 4UCGA 3S5ZA 3O05A 5HQEA 4HNUA 4Z1CA 5EPDA 2A6NA 3FKKA 4IXXA 3QMRA 4O1CA 2XN0A 1FWTA 4JX6A 4Z1AA 4N9DA 1MXSA 1YYAA 5FI8A 2E6YA 1WOBA 3ANYA 2B7QA 3G1HA 5DELA 3CEPA 2C18A 4MZYA 4LT9A 3P5ZA 4RV8A 4QNWA 1LOSA 4WZHA 5AHFA 1W37A 6TIMA 1HG3A 2Y88A 3QSRA 3MP5A 5F2LA 1K8XA 1P5BA 4O1BA 4CQ9A 3O6YX 2A21A 3CU2A 5CPMA 4ZQNA 3UNDA 1XI3A 2R14A 1FXPA 3DHFA 2GUUA 4MVAA 4A22A 1ZAJA 5LGXA 4KWVA 1TRDA 1YTKA 1HO4A 1JUBA 5AYXA 1FWNA 3BVJA 3G24A 4QISA 1KFKA 2WO5A 3G8RA 4X22A 5DN1A 1ZAHA 2CLOA 2Y7EA 2Z6IA 4K7YA 4M7TA 3UQNA 5G4WA 1Z41A 2PE4A 2ZRVA 3N73A 4RLIA 2YPIA 4I7WA 1IF2A 4OV9A 3PSVA 1TSIA 3R2GA 4AB4A 5CZTA 1ZY9A 2ZDRA 3MI6A 3W84A 5DLCA 4IGHA 3S8HA 4ADUA 5D05A 3GDTA 4LOCA 1OFPA 1W31A 3W7HA 4WX2A 2NV1A 4S1FA 2VEKA 4ORMA 1V7YA 3B4UA 5FF7A 3PULA 4WJEA 3EB2A 4WXYA 3U2OA 2VEIA 1JCYA 1FWSA 3W07A 3W76A 2A0NA 3GR8A 2W0UA 3HJZA 3SFKA 5FF3A 4R53A 2J88A 3R13A 3Q2DA 3TMLA 4TMBA 2GJLA 5HUOA 5D2YA 4XKYA 4TU1A 4YMZA 5BOOA 1TPVA 1K8YA 2TYSA 5D2VA 5LNUA 2NXHA 4UMCA 4Y6GA 1W5PA 3GZ3A 3GXNA 2BLEA 3JR2A 4O8RA 5DCDA 4WY0A 5LNRA 2HTMA 4RK8A 2Y7GA 3R12A 4OHQA 2X30A 5T26A 5TIMA 3RLUA 4N02A 3L2IA 1W56A 4P61A 3PC0A 4RZ5A 2CLIA 5HWJA 4LWWA 2FQIA 1M7PA 3QEZA 4N6FA 2W79A 1S5VA 1S5WA 1T8XA 2C6QA 1G4PA 4GRSA 1H7RA 4O17A 2BSLA 3OVRA 1DL3A 3L0NA 3FJ6A 2DJXA 4PL1A 1THFD 2NWRA 1IIGA 2AQWA 3P8IA 2PURA 4NQ1A 4WUIA 1XBXA 3QSTA 4AHQA 1PVNA 1DVJA 3S9YA 1GWJA 2J24A 3G18A 5D03A 3W75A 3HPSA 4CCCA 1XUZA 1O5KA 1YDOA 1GYLA 4DO4A 4AWTA 2OMAA 1VLIA 5C55A 2ZZ5A 3LCXA 3W7LA 4AHOA 3KRSA 4JDYA 4NXSA 5HUPA 4O0KA 3G3MA 1TJRA 3I65A 1MEIA 1JCXA 3C2EA 1G7UA 4HPXA 4NX0A 5DCBA 4DXVA 3UWUA 3BK0A 4JY8A 3SJ3A 3V1PA 3G1XA 2J9XA 3W7IA 2DZXA 2JKEA 1OFQA 3L66A 1DHPA 5D2TA 3W2LA 4Z1BA 4QIUA 5K7JA 1L9WA 1F2JA 4X3ZA 4DBEA 5F4SA 4KFOA 5D09A 3TKFA 3B0PA 4LVDA 1PHQA 1RVGA 3S1UA 1KV5A 2JK2A 1NEYA 3NDOA 4O53A 3NR0A 1MZHA 2ZZ3A 2PRMA 5TBOA 3CB8A 1OJXA 2JBMA 3W83A 5DBUA 4LRSA 2KZHA 3QYQA 5AHLA 5AHNA 1ML1A 2V2HA 1H50A 4PCFA 3TCEA 1QO2A 2Z6JA 1LOQA 1OFOA 3A5VA 3CPRA 1YPIA 4QAIA 3LHYA 4JTLA 4I7UA 2JGQA 5DCEA 3INPA 5I3JA 3FIGA 3S6DA 1PS9A 4ML9A 3FOKA 5HWMA 1ZALA 3P81A 5EY5A 4ALDA 2V82A 3S1VA 1VPXA 3NM3A 1TCDA 1KFCA 4O50A 4Y8FA 2NWSA 3Q94A 5KITA 4JTFA 2EAWA 1EP1A 2FB3A 4ZQMA 1XUUA 4JNMA 1F5ZA 3LBMA 4CCEA 2DZSA 3A22A 1LROA 4HPJA 3G1AA 3N9SA 1DQWA 1FDZA 4IMEA 1W54A 5AB3A 4XTDA 4N9CA 5D38A 5C6MA 3W6YA 4EIVA 3PF3A 1VYRA 5FESA 5D2XA 5KZEA 1JJKA 4H4IA 3DXIA 4PC8A 4RR4A 3TE9A 1UASA 1N7KA 3T7VA 5HJLA 3S5YA 3ZFHA 2V30A 3E02A 3GAKA 5C2XA 3KOFA 2O7QA 2VC6A 3LX9A 3STFA 2B7NA 3LCIA 3P61A 4UTJA 4O13A 1L6SA 2RDUA 2W6RA 3LOTA 3P74A 4RXFA 3NPUA 2PC4A 1TV7A 1EIXA 3UXAA 1OYCA 3EWXA 4NJIA 3W7KA 5I3IA 5LHFA 1U83A 4ORIA 5F1UA 1MO0A 5G5IA 3LHTA 3EWYA 2PRLA 4NZFA 3TROA 3G0UA 1A5CA 1UBSA 4Q4KA 5HWNA 1VLWA 4UFLA 1GT8A 2VKZG 4WD0A 1VYSX 3VI2A 3O8AA 3C0JA 4UTUA 3BGGA 1Y0EA 1WBHA 4TIMA 4I7VA 4IUOA 2QCEA 4S2CA 4MYAA 3WJZA 2VENA 4KWWA 3T44A 3FLUA 2CLFA 3Q37A 3VFLA 1T0OA 1DJNA 3AJXA 4ZQRA 1W3TA 1I2RA 3L5MA 4XQ6A 3ZS4A 2WSQA 3M16A 1PCWA 1T99A 2PRHA 3LHUA 2OX1A 3O06A 5AC6A 5G1TA 3K30A 4UTWC 3C52A 1BWLA 5L9FA 3NPVA 1R47A 1XDLA 3LTSA 4MY1A 1GVRA 4IX2A 1OFEA 3SR7A 4I9AA 2ZCGA 2ATMA 1X1OA 1F6KA 1JQXA 1TPC1 1TTPA 3E0IA 4UFJA 1ME9A 4IMDA 4E2BA 5I3HA 3L21A 4CNNA 5I3GA 5FEWA 2TSYA 1JCNA 3DFTA 3TC6A 1SU5A 4MZ1A 2CZ5A 3P7YA 3MMTA 2EKCA 3EWBX 5H91A 5D37A 2VFEA 3LCHA 2A2IA 1EA0A 2CZFA 5H2ZA 3TR2A 4TMCA 3SSJA 5AC8A 3HGJA 3KRUA 3LV6A 2QUVA 3G1FA 1SO4A 3M1ZA 1JRBA 3PB2A 2Y85A 3GK0A 2F7FA 2HS6A 4TR9A 3THQA 3DKLA 1ADOA 2WJZA 2Q3RA 2PCQA 2DZVA 3NPWA 2E5BA 1A5BA 4DF1A 1JQVA 3DHDA 1G4TA 1MEWA 1SO3A 2EHHA 1C8VA 1LTDA 5F4WA 2X1SA 3NQ8A 3MP4A 1L6WA 4MIMA 3A9IA 1R2TA 4XBKA 1VYPX 3GDMA 1OX4B 1WYIA 2WV8A 3RU6A 5LHEA 4RZ4A 2E09A 1FCQA 3EXTA 4JTSA 1H63A 1YPFA 3G3DA 1DKWA 3NNTA 4OE7A 1RQHA 1LBMA 1R2SA 2JKAA 3BG3A 3IVTA 4HNVA 2ZRZA 3W1RA 1IXOA 3P60A 1QPNA 3RMJA 3TXZA 4MFEA 4O19A 3DBPA 3EWUA 4AXKA 5FEPA 2OJPA 2RDTA 1O95A 4YCPA 3C61A 4HN4A 1RQBA 1FBAA 3BV4A 2C1HA 1W5OA 3BPWA 1RPXA 3I7SA 1P1XA 1KFEA 1XDMA 4D2JA 3S1WA 5K9DA 3ABRA 4YXGA 1OVDA 4L4MA 3DZ1A 2ZA2A 4CLMA 1XBVA 1YTEA 4QSHA 3QQ1A 3TH6A 7TIMA 5HULA 1LM1A 1DQXA 2QAFA 3C2OA 1KM1A 1TREA 2EGZA 2GQ8A 2V2DA 2BXVA 2FJKA 3MHUA 4LTSA 4CNOA 4AWUA 2V8ZA 3KVMA 3TDFA 3LHVA 3QM3A 3STEA 2C16A 5K9XA 3F1QA 3N3MA 3HMJG 1LP6A 3RF9A 1KFJA 3CM4A 4AF0A 3L0KA 3MYOA 4K38A 3DI1A 5BMWA 2FDSA 4NXKA 4UC5A 2C14A 5LKYA 1TV5A 2QCGA 2Z1BA 3NO5A 2ISVA 4E0CA 1VCFA 5CPNA 4DEFA 3M5XA 3FJLA 1JUEA 4BR1A 3CEUA 1A5SA 2VEMA 4PFMA 5LSMA 4PA8A 1LRNA 4LY8A 4QJ1A 4YL2A 3SZ8A 1DV7A 1YDVA 4N9EA 1Q6QA 1KTNA 1VCVA 5F2GA 4JGDA 2NX3A 3TQ0A 4RCXA 1XCFA 1UCWA 2NUYA 1JUKA 1ZENA 2P10A 2Y6ZA 3I7QA 3HOJA 4NJHA 3RLVA 4AMAA 3B04A 3EX4A 3HO8A 4KKXA 3QFEA 4K8EA 1CI1A 1KTBA 1QFEA 1B9BA 2GQAA 3B0VC 4EF8A 3C2FA 3W7DA 3WK3A 4K7VA 1KFBA 4Q32A 3GIYA 1KLYA 2R91A 3KX6A 1SO5A 1OYBA 2QCMA 2QR6A 4UFHA 1KM0A 1NVMA 2ZYFA 3W7OA 3MI2A 3JRKA 2P1FA 4XUGA 3U8GA 3VNDA 1OHLA 2QCFA 4AHPA 3QF0A 3W2NA 3PBWA 4MKNA 4E38A 4TX9A 4BI7A 4A2SA 3HIJA 4UUIA 3G0SA 4J9JA 4LV4A 1ICQA 1H62A 1B4KA 2C13A 3QQ0A 2I14A 2QDGA 2NV2A 3DFQA 3ATZA 2TMDA 4A3UA 3W88A 4FNSA 3W7GA 3EX1A 2V2CA 1I2QA 4GC4A 1TPEA 2A4AA 1C9DA 1ZCOA 3UYCA 3SGZA 4RZ6A 1Q3NA 1W3IA 2ZZ2A 3DFSA 3QZEA 4LVBA 4LV9A 1KV8A 3S0CA 6ALDA 2RH9A 1Z48A 4HIBA 1WBJA 3WK0A 3UWWA 3GKFA 3W7PA 1OFDA 5G2HA 3I7RA 4PL2A 5AYYA 1EUNA 1P4CA 1SR9A 4Z1DA 3SIZA 3PBUA 1KM5A 4N4PA 2CLHA 3Q58A 4JX5A 5CG7A 1LBLA 1WV2A 3W7EA 1X1ZA 3O15A 4GNJA 1L2UA 3L5AA 2NZLA 3PR2A 1JULA 3NL5A 2GQ9A 3UY7A 3MP3A 2C0AA 3NQ6A 2C3ZA 3P84A 2DZPA 2ISSA 3W1UA 5E1QA 3L67A 1LLZA 1GVSA 5G4EA 3HGRA 4NU7A 2E68A 2DZUA 2ZZ7A 3R89A 4EOUA 1FQ0A 1SFLA 4HKPA 1YXCA 2H8XA 3TAOA 1FWRA 3M5VA 3HG5A 4A21A 1LYXA 2GPTA 3DFNA 1AW1A 1OF8A 1OF6A 4O4VA 1ZFJA 3TNOA 5D04C 1TRIA 3TU9A 5KSWA 5AHIA 3W2JA 1X7FA 5HNRA 1QPQA 2E5DA 1TPUA 4PEKA 4ZQPA 3DAQA 2WQPA 3O16A 4MOZA 1TPH1 1EP2A 5CKSA 3W1QA 1SSGA 5FEZA 2E6DA 1HFBA 2G5WA 2O7SA 3NQAA 1G7VA 1EX5A 4HSOA 5G2WA 3UWVA 3LXBA 5SWUA 4K37A 4Z0SA 1EWDA 2QUUA 4H3DA 3VE7A 1B3OA 1H61A 4WXZA 2FPVA 4O12A 3PBYA 5TQLA 1QPOA 3HB9A 4RKAA 3IIXA 3W85A 4UFIA 3WK1A 4JYFA 3LCGA 1M7OA 1TPDA 3L9CA 1EPXA 3M9YA 1OABA 2R94A 3WFAA 5AOUA 4EWND 3EKLA 2GJNA 4LC8A 4Q33A 5AN7A 1FCUA 2WSRA 5CSRA 2FIQA 2QCDB 5HR6A 2G95A 1TB3A 1TTJA 3LV5A 4BFAA 1QOPA 4GUGA 3RNDA 1QOQA 1YXYA 3NZRA 5F1VA 2A85A 1KTCA 2ZZ6A 3VE9A 2Y63A 3LM7A 4O1AA 3STGA 4IPIA 5LNSA 1OYAA 4UTTC 4EF9A 4UIOA 2YFOA 2JKPA 1K7EA 3B8DA 2H90A 3BG5A 4UTHA 3MW7A 2DJLA 1G67A 4GE8A 3G1VA 3U6WA 3EXRA 3NEVA 1R2RA 4UTMA 2ZA1A 1GYNA 2VFFA 4GUFA 4FX6M 4FNRA
chains in the Genus database with same CATH superfamily
3DYPA 1BYAA 2YOCA 4M19A 2DUAA 3MUY1 4ASTA 3HM7A 4PCPA 1L2QA 1QAPA 5IFPA 3H4WA 1HUVA 1JEZA 2PWVA 2QDDA 2YL8A 5A5WA 3IV8A 3RGTA 5ECVA 4GBUA 3CUFA 4H9XA 1GQJA 2P53A 4IIBA 1UJPA 5LGZA 4PN2A 3WL0A 1LLOA 2EPHA 3OLDA 2YFNA 4PFHA 1X6UA 4OGZA 1P0KA 1GPWA 1E6SM 1O1HA 3MZNA 3L5LA 3TWBA 4OWGA 1EWEA 1V51A 4H8VA 2WHMA 3QMSA 5JH1A 1W2VA 3SRKA 4MWAE 1KCXA 2ZRXA 1W9PA 3R0DA 1NDVA 2GJRA 3ARZA 3L12A 5DBTA 2VGBA 3NQMA 1B2YA 1DORA 8RUCA 2PDHA 4PRRA 4GJIA 1DIDA 4IMFA 3QKEA 3ZVHB 5HJYA 1XYZA 4Q6XA 2YXGA 2CLKA 5AYZA 1GQIA 1OC7A 3IGSA 1UH2A 1GGOA 3UPWA 3GBEA 4GD0A 3SQMA 1DJZA 2GOKA 1EB3A 3SCSA 1RJPA 3T78A 1QI3A 4Q3MA 3I4EA 3IUDA 4XV0A 3QMTA 4ZO6A 2WZMA 1A49A 4D9PA 2OO0A 4FIRA 4M6VA 5G1MA 4E4PA 3OW1A 3R94A 4Q4RA 3HA1A 1NOFA 1PXGA 4GPNA 3DG7A 2BG5A 4AAJA 1G6CA 1MRQA 3KVJA 1MFUA 3OLIA 2ZQ0A 1PCKA 1TPB1 2JGYA 1RJRA 1HKMA 1R30A 3G6LA 2PDQA 5E6YA 4ONVA 4PMVA 4UTIA 4BK9A 1O60A 4V1XA 3TC3A 3CJPA 1X1NA 3UNTA 3VGGA 2INEA 1OGSA 1KA9F 3ITGA 2DGAA 2WJDA 3IUHA 4IIGA 1X96A 1A5MC 2PWUA 2VQTA 1B1YA 3PUDA 1C93A 5AHMA 1D3GA 2J8GA 4NAEB 1PIIA 3GIQA 3NM1A 3WQCA 1ODZA 1XFCA 5LIKX 3THAA 1PYMA 1PUDA 3IANA 2OKOA 4KFNA 3WD1A 2WJFA 2HPMA 3WDQA 1JG9A 4U28A 1FCBA 4LFYA 4KMQA 1XC6A 1QWGA 2Y61A 1EGZA 5FF4A 2QT3A 4ZA0A 3N25A 1K9EA 1ZBWA 5CJNA 2EXOA 5FAGA 1X7IA 1K77A 4LGXA 1F05A 1NELA 2DPEA 2W61A 2R9RA 1GVQA 1Q66A 2O9PA 4WOZA 4XAZA 1K3UA 5FJPA 3W7CA 1W1PA 2BV9A 3B06A 1YRRA 2QXWA 2JEPA 5GJPA 3JZUA 1UUOA 3T8LA 5C9RA 4G56A 1I75A 3FXGA 1OFRA 2P88A 5HA7A 3DESA 3ZMRA 5DRIA 1EEPA 1ADSA 1YADA 4FEZA 4XKYB 2CWXA 3UJ2A 1EO7A 3BOFA 4MYXA 4QITA 4UR8A 3GVGA 3UU0A 3ZR5A 1T41A 3V5FA 3QR1A 2DU2A 1YIXA 1L6GA 3MB9A 4JYDA 3GHUA 3WK2A 1RZMA 3KFTA 3OIXA 3ITVA 1C9WA 5FA5A 3B0UX 4JFTA 4K6AA 3LPPA 4OUEA 4DYJA 1E1CA 4FX7A 4FZIA 1GEQA 4OZOA 4PH6A 1RLCL 1A4LA 4O28A 2HQAA 3K5XA 1FCVA 4NNAA 1ITXA 4CQBA 4M5PA 4PTNA 3TSMA 3WN6A 5HPCA 3ELFA 4XAFA 3VNJA 1W5MA 2WVTA 1BTMA 2WXDM 4IGNA 4L1XA 5G1YA 1ZBCA 1W1IE 2E40A 1QT1A 1FHVA 4O54A 4QDMA 5JMUA 3S1XA 3IS4A 2ZUUA 5FJTA 5E93A 2E67A 4JTUA 3CT7A 1O68A 4FB7A 5AC5A 2JQXA 2NVCA 4WK9A 5BRBA 4Y9PA 2J8FA 1ZS2A 3W26A 3W7JA 2BMBA 1NFBA 3IJDA 3CUXA 2PWGA 3QOKA 5EU9A 1AW2A 1FX6A 1UP3A 1XSIA 1KGUA 2INZA 1D3HA 4A8NA 3VOFA 3PFMA 4N6EA 3E0FA 1JPDX 4AD0A 1OCNA 3EMQA 3QLLA 1O94A 1PKMA 4S39A 2FPTA 3QY8A 3VIFA 2YDAA 1UIOA 2PDYA 3SCVA 5HPOA 6XIAA 4XB3A 2OZ8A 5H8PA 1B3XA 4QRNA 3UXDA 4U4MA 3EDKA 3EEGA 1ME7A 2IS7A 3SUTA 4QROA 3MJYA 2WVVB 4LAKA 3CQKA 1LBFA 3ISIX 1WDDA 1HL2A 3SRDA 1DJIA 2F2HA 3WD3A 4U2YA 4DF2A 4AW7A 5DMMA 2W63A 1UKSA 3HGSA 2Q3OA 2OLHA 5FAJA 1XLDA 3B9EA 3E5PA 4CQAA 3OBEA 3MJMA 2OSWA 3MSDA 4I8DA 1EJ7L 1M7JA 1REQA 3U4FA 4XD5A 3TK7A 3PBVA 4MZ8A 4L56A 2OZ3A 3CQ0A 1UBPC 2WNQA 2X2GA 2EPLX 5CPLA 4AH7A 1Q7QA 1SQ7A 3T2QA 3NQ7A 1GJPA 3EA3A 1VGAA 4GVGA 1JDEA 2E28A 2OB3A 1UR2A 1KRMA 4HA1A 4KEZA 5CBBA 3TUUA 2P50A 1V0LA 3QY6A 4DAIA 5H6HA 4AZBA 3QHMA 3HQNA 5C9XA 4YCOA 3D3FA 1TPWA 4GCXA 4JTIA 4R33A 4UTKA 1HL8A 2V67A 3B8TA 4IPJA 4W8AA 3PTMA 4HHLA 4NT0A 3SB0A 3PAJA 3BSHA 3JU2A 3LMZA 2WBKA 1XL9A 3JZEA 4J3TA 3U2ZA 2ABAA 2EQDA 3WNPA 2ZTKA 2IQTA 3G0XA 1AMKA 3LXCA 2FVKA 1Z44A 4I5XA 4JTQA 4C6JA 1VH7A 3WLKX 2QDEA 1AW5A 1UKOA 2HISA 2J78A 2FGZA 1POJA 2IPGA 3E74A 4O1DA 4CD8A 3LPOA 1AQ0A 1HNYA 1RQEA 2QJNA 1BG9A 1S39A 2QUTA 1RA5A 4PODA 1A5UA 4GYPA 4KWSA 3UCCA 1Y65A 1MNSA 4IF2A 4KESA 3IIOA 2PDLA 1R87A 2C0HA 2QJHA 4B3KA 3HPAA 4E2OA 3PBMA 2CW6A 4NZ3A 3PG8A 1E3XA 4KRUA 1NAL1 1MNZA 2CZEA 3H2CA 4P8XA 3LA4A 1KM3A 1LJYA 1QW9A 1W0MA 1BFNA 4H6RA 2CHOA 4A3YA 2WOQA 5EGRA 2C1IA 3H12A 1V3IA 4I90A 4H6KA 2OZ0A 1F6PA 1Q65A 8XIAA 3VIIA 1TJ1A 2IPFA 1LG2A 3A13A 4HB7A 4UNLA 1QASA 1ENUA 3UXLA 3E2SA 4ZO8A 3GU1A 1S2UA 3L2LA 2YCEA 2XGBA 2ZIDA 3P0XA 5GQBA 4C60A 4RXGA 4AY7A 3OVPA 3LZ5A 2YR1A 1UB3A 4MJMA 1J79A 4CNPA 4U5IA 2F61A 5KEZA 3ONBA 1IR2A 4WRHA 4DRSA 1RR2A 4QM1A 3PS7A 4K36A 3TA9A 1QW7A 2LLEA 1W5NA 2OFJA 1OD0A 2ZRYA 2ZC8A 2PZ0A 3T2OA 3GTIA 4K8GA 4B15A 2VR4A 5K4ZA 5KZMA 4JICA 5BW6A 4N2YA 3GZAA 1IIHA 2NUXA 1ISYA 4NZCA 1NM9A 1A0DA 2J66A 4TV5A 1EX1A 3M0LA 1YDYA 1KM4A 3DC0A 3NQGA 1TG7A 2FHFA 1XH1A 3W1AA 4JIIX 4C6QA 5DQPA 2ABBA 1UR8A 3B97A 1E1CB 1V6YA 3NL3A 4NZ5A 4R7JA 1GG1A 2FYMA 3AROA 3AALA 2XH4A 3AIQA 3HPFA 4LVFA 3KWSA 1S5NA 1VFMA 2PDIA 1N8FA 4PTDA 3VMOA 4DO5A 3VCNA 3U7VA 4DJDC 1MQPA 1IXPA 2AGTA 1ZJIA 5D02A 5D32A 4IX0A 4O16A 4ADTA 3N2CA 3HG3A 2FTYA 3AZTA 1SO6A 1RA0A 3H55A 1OWQA 2ONEA 4UNKA 2EEXA 4OV4A 3ARWA 4S38A 1QW8A 1EC8A 1YXDA 1Z42A 2EPKX 3AUOA 3UETA 5LZLA 9CGTA 4NYYA 3LY0A 4BJHA 3A9BA 1DXFA 2HVMA 4NRRA 3FAXA 4OIFA 1TQJA 2NX9A 3SCWA 3OP2A 3K4WA 2A7PA 4AD4A 3NVTA 4E5TA 1KR0A 3VMPA 1PAMA 1E0VA 3W3OA 3JS3A 4WY0F 4PTMA 3B4YA 3M0MA 3ZJKA 2ACQA 2VFIA 3OGSA 1S1RA 4S2BA 3AHYA 3BCJA 3W22A 4C91A 4CCZA 3N6QA 3R58A 5D9OA 3STCA 5K3VA 1CTNA 3IJIA 4ZEPA 3S6TA 1FWGC 1TPFA 3G1YA 4OT7A 3ATYA 3S47A 4ZQOA 2I1OA 1UKTA 3ZT5A 1E5JA 1QVBA 1IWBA 3BL3A 3C4UA 2PCEA 3CPUA 2CHNA 4DBDA 2A3CA 2FTPA 3BLOA 1TO3A 1UJQA 3RMEA 1A0CA 3KTCA 2Z27A 5CSYA 4PGLA 1JPIA 1JL8A 1LRTA 1ITCA 2OSYA 1IXQA 3EDJA 3TFCA 2GVJA 3TJLA 5I00A 3TAKA 1S38A 1XIBA 2VX5A 4JTKA 4MTVA 1GEHA 1K03A 2OZTA 4EKJA 5T9CE 3E0LA 3QW3A 1BWVA 2OT1A 1FOBA 4MJZA 2VGFA 4Y9OA 2VFDA 8TIMA 3AICA 2IKJA 5FF2A 1G4EA 1OCJA 3WUEA 4AIUA 1SSDA 4BEUA 3F5JA 4QLKA 1D2KA 1OG6A 5CJMA 3ECQA 2XSXA 4UWMA 1SFTA 2XVPA 4XVEA 3UZYA 1J93A 1JD9A 1RV8A 2Q71A 4DQWA 1IEQA 4XZMX 3LBCA 4CN1A 3WF4A 1LORA 3WBXA 3RJXA 1Q2RA 4P8VA 1HP5A 2R1PA 4FA3A 1PL9A 2DZWA 4AY8A 1BTCA 4F2UA 1EJXC 4A8RA 4E3TA 3FVMA 1HO1A 4ZSUA 5ABFB 3ES8A 3NZ1A 3USZA 4UCGA 2PGFA 3O05A 1ZLPA 4C6CA 3UFYA 4Z1CA 2QMJA 2WK2A 3MANA 2A6NA 4IXXA 4HOWA 4AEEA 4JX6A 1XYLA 4Z1AA 1MXSA 1R0MA 5A3HA 1A3XA 2E6YA 3ANYA 2D69A 3AUJA 2XU2A 3G1HA 3OYXA 2C18A 3GUGA 4RV8A 3P5ZA 4QNWA 1LOSA 5AHFA 4C7FA 6TIMA 2Y88A 4ROQA 5F2LA 4H01A 3VNYA 4CQ9A 3O6YX 4OFCA 5CPMA 3GRIA 4ZQNA 4S3FA 1F4HA 3LSCA 2R14A 1QWKA 2GUUA 4RE0A 1ZAJA 1TRDA 3SN0A 3OIHA 4YVPA 3KL5A 2QVNA 3AC0A 1HO4A 1QTWA 4X22A 5DN1A 2CLOA 3VX1A 1Z41A 1B3YA 5A8QA 2J7GA 3HFTA 3MSRA 1XLEA 3PSVA 4JN7A 1X6NA 1ZY9A 4EPKA 3MI6A 5DLCA 4ADUA 1IT7A 2QGYA 4MAVA 3N15A 2ISDA 4HZMA 3EOEA 1W31A 3W7HA 1UWQA 1TUXA 4S1FA 2VEKA 5DEZA 2VR5A 4BKNA 1XIFA 4WJEA 4QTGA 9RUBA 4ZTXA 3U2OA 2W27A 1R7OA 1EHAA 1WDPA 2WQDA 3W07A 1XD1A 3OA5A 2G3FA 2W0UA 3HJZA 2ZVRA 2QYGA 5LIYX 3PNUA 4R53A 2J88A 3Q2DA 4W89A 3TMLA 4MNLA 2V5DA 4IG2A 4QJ5B 4D8ZA 5LNUA 2YBVA 4UMCA 1W5PA 3VVGA 2G8ZA 3WDJA 4HNLA 3H8AA 3B9OA 4NL1A 4GX8A 1TWZA 4LBSA 2DUXA 1OT1A 3RLUA 4N02A 1W56A 1FA2A 4WIWA 2VCBA 1M7PA 1OEPA 5DT5A 4JQ1A 2KX9A 4PMDA 1RXOB 3VNZA 2G3MA 3TONA 1VEMA 2FKPA 1G4PA 3ITCA 4GRSA 5I78A 4O17A 2PLJA 3OVRA 3RR4A 3GXIA 3PANA 2J6VA 4U2ZA 1DL3A 3L0NA 2NV9A 3PPHA 4DZIA 4PL1A 1IEVA 1IIGA 2AQWA 2VZSA 3KOXA 3GH4A 4ZBCA 1DVJA 3S9YA 1GWJA 1A5LC 3BURA 3G18A 5D03A 4R27A 3B0YA 1Q2SA 4TUFA 3HPSA 4CCCA 1E0UA 4G9PA 1ECEA 3APGA 4J5NA 4DO4A 3VD5A 1VLIA 1C91A 4IFKA 3W7LA 2X2YA 2AKZA 4M81A 1LG1A 1KD0A 3OQEA 4NXSA 5EB8A 4O0KA 3SUWA 1MEIA 2C79A 1JCXA 1PB0A 4HPXA 4JKLA 4Y9NA 4JY8A 3SJ3A 3W7IA 3GVWA 4MWAB 4R88A 3L66A 5D2TA 1EPVA 3W2LA 1QK2A 4Z1BA 1JNEA 1L9WA 1F2JA 2D2OA 1RPKA 4DBEA 4BQ4A 5D09A 2ZUTA 1RVGA 1G94A 2JK2A 3AIRA 1GQLA 3NDYA 2WKGA 3W83A 1Q6CA 5DBUA 1PDYA 5AHLA 4WGHA 4PCFA 3TCEA 2Z6JA 1LOQA 3CPRA 1YPIA 4JTLA 4I7UA 1H3GA 4KQNA 5DFAA 1PS9A 1YQ2A 2ZXBA 3SN1A 3C0SA 3P81A 2Z1SA 3NM3A 1KFCA 3PTDA 2EAWA 1HN1A 1F8IA 3LGDA 3O6AA 3SQSA 3N9SA 3DDMA 4JTAA 4IMEA 5AB3A 3T0TA 4N9CA 5D38A 3Q45A 4EIVA 3PF3A 1VYRA 4RDZA 4RNJA 5D2XA 2ODOA 4WF7A 4N42A 3CQHA 1ZP3A 3WD0A 4RR4A 3AHXA 1UASA 4IZGA 4C6DA 1RY0A 5HJLA 3ZFHA 5JXQA 5IRPA 5I2UA 1E43A 1MUCA 1L6SA 2W6RA 2QF8A 4X9YA 1XPYA 3LOTA 3TYCA 3IJ8A 1JYNA 3II1A 4H2CA 4A3RA 3NPUA 4HCHA 4PMQA 3UXAA 1OYCA 3W7KA 4HPHA 2O4QA 1U83A 3UT0A 1ZQ5A 2HBXA 4GVHA 5F1UA 5A6SA 1MO0A 4RPPA 4S3GA 3G0UA 1A5CA 1QBAA 4Q4KA 1W3HA 3B8IA 1VLWA 1E70M 1R9ZA 5MF5A 1ZU8A 3T0DA 4WD0A 1LL7A 3C0JA 1ECQA 4UTUA 3BGGA 1DTNA 3RN6A 5IFTA 4I7VA 4W8LA 3OTRA 3WJZA 2FDMA 4KWWA 2V3GA 3OJGA 2FHBA 4W87A 3AJXA 4ZQRA 1W3TA 4HSHA 1I2RA 3WYZA 1P48A 4LJ3A 4V2XA 4IFOA 2UZ9A 4HBKA 1T99A 2PRHA 3KE0A 3O06A 5G1TA 3R8HA 4W88A 3CV6A 3MUIA 3NPVA 2IQ0A 4DIAA 1UR0A 4HQVA 1I1WA 1TPC1 2NW0A 2QVHA 5FL0A 3WQEA 1V6WA 3L21A 4NI3A 5M17A 4PB3A 2TSYA 2CKSA 3TC6A 2V69A 1DYSA 1QHPA 4P8WA 2CZ5A 3PP7A 1MQQA 2CC0A 2C71A 3MMTA 3WBAA 2VMFA 4V15A 5HOSA 2EKCA 3EWBX 2VFEA 4AD2A 3LCHA 1B90A 1Y7VA 3S3GA 2XFFA 2A2IA 3TR2A 2F8QA 5A8PA 5TF0A 1P1MA 2CNCA 3KRUA 1TA3A 3MV01 1SO4A 1NIUA 3PB2A 3GK0A 4CEUC 1CCWB 1C7TA 5I02A 4RNIA 1XDJA 4MKSA 2Q3RA 3A4JA 2MANA 1PIGA 4WR3A 4TQTA 3QLDA 1MEWA 2EHHA 5ABEA 1NWTA 2PGEA 4MIMA 1MUMA 3DERA 1NOUA 2MUCA 4DUWA 4Z2KA 2YCKX 3GDMA 1ONEA 3CMFA 1OX4B 1WYIA 2WV8A 2JF7A 4RZ4A 1JPKA 3MSYA 4JTSA 3KL3A 3G3DA 3NNTA 1TZ7A 4YTQA 1EIBA 2YA0A 4DXXA 3P60A 4CEXC 4QJ4B 2YL6A 3SRHA 4HN8A 1RQBA 2OPJA 4GZ7A 3PTQA 1IE7C 3VOGA 1O5RA 1XDMA 4IG2B 2OYMA 4JCLA 4AYSA 5LA2A 4XKMA 4CLMA 2YXXA 2Y24A 3R43A 4PE8A 1LM1A 1V77A 4QDWA 4Q6JA 3RRXA 2QW5A 3MHUA 3AMKA 4GYFA 1VPYA 2V8ZA 4Q8UA 4CVUA 3KVMA 4EK7A 3EWCA 2FTWA 4IJCA 5JBDA 1LQ2A 1I0BA 3PPFA 4ACZA 3UCDA 3T0CA 5K9XA 3F1QA 3SURA 3N3MA 1ONXA 3RF9A 3L0KA 3MYOA 3N2BA 3VD4A 1OIMA 4E0CA 4ZXOA 2ZVIA 3BJTA 3M5XA 4DEFA 3C8NA 3UA4A 1US2A 1JUEA 3CEUA 3NIYA 3CAVA 1LRNA 4QJ1A 3LU2A 3SZ8A 1DV7A 2V5KA 1IT0A 1SYTA 1YDVA 3LUTA 4ZXLA 4LXFA 4N9EA 1KTNA 1UROA 3Q67A 4JGDA 2NX3A 1OINA 3H2NA 1IZCA 3TQ0A 2G37A 4RCXA 4FS9A 1H0GA 2ZX5A 1BYCA 4IFKB 5HJXA 3RLVA 1W1YA 1CB7B 3EX4A 3H23A 4KGJA 4D6EA 3C2FA 3W7DA 4KS0A 4J35A 4F0RA 2I7GA 1UWAA 1E73M 1NVMA 1IEWA 1U5VA 3JRKA 4UZSA 1E15A 3KBWA 3NZQA 3U8GA 3M07A 4AU0A 4BI7A 3HIJA 1YW1A 3BMXA 4J9JA 1Z6KA 1JGMA 1P6BA 4ERGA 4U33A 1CXIA 2TMDA 1XP3A 3W7GA 1W1TA 1Y5XA 1QI4A 2V2CA 1K4GA 4PB5A 1TPEA 1H4PA 1C9DA 1ZCOA 2OQHA 3P6LA 1JFXA 3S2LA 1TZ9A 1ZJAA 2HV5A 3S0CA 3TR9A 6ALDA 3WFLA 1Z48A 3VIHA 4YPJA 1UQYA 1WBJA 2G50A 3WK0A 1FH9A 3K1GA 4ZOCA 2GGIA 5G2HA 3GC5A 3A4WA 1EUNA 3SIZA 3PBUA 1OY0A 1SVDA 2CLHA 1XGDA 5ABGA 5DMNA 1V0MA 3RU8X 4MSSA 4E8CA 1X1ZA 1M04A 3E2VA 4GNJA 3GNRA 1QOXA 4A05A 3N04A 2NZLA 4LALA 4U31A 3RXZA 1JULA 2GQ9A 1TIWA 3S1GA 4QFUA 3WLPA 2DW6A 2WPGA 2PDWA 1H41A 2C0AA 2D3NA 3NQ6A 4JQ2A 1KB3A 3IAPA 4KWUA 5TNVA 3AIWA 3HGRA 3I3EA 4MDOA 2ZZ7A 3R89A 1DIOA 1FQ0A 1SFLA 4HKPA 4FF5A 1YXCA 3TAOA 4J7RA 3BJFA 3HG5A 4A21A 5D8ZA 5A8MA 4O4VA 3WLIA 1BXCA 3S6OA 2Z2BA 5D04C 3TU9A 3KDOA 2Y8KA 3TYEA 3WY1A 3B8UA 2WQPA 3O16A 1I1XA 4GX9A 1EP2A 4GYPC 4PTVA 3WMLA 5FEZA 4BY3A 1Q13A 1AVAA 3ZM8A 2O7SA 1E40A 1K6AA 1V7AA 5G2WA 3SDOA 3W0KA 2GYIA 5SWUA 4GO9A 4HJWA 1GUVA 2D2GA 4WXZA 3MKKA 1AQFA 4FLOA 3EOSA 5TQLA 4DXKA 1V03A 1QPOA 2DZBA 3HB9A 1TWDA 4M1BA 1IGWA 1V3LA 1UR9A 4MG4A 3LCGA 3L9CA 3WFAA 3WX7A 1SFSA 1NY1A 4EAYA 4E3VA 2X40A 1ITUA 3MU7A 2ZX9A 4PBGA 2G95A 3ALGA 3PZ9A 1TMQA 4C90A 1KBKA 3VE9A 3LM7A 2WZHA 2WSKA 3STGA 3WL1A 1J0IA 1G0CA 1OYAA 1UC5A 2VUYA 3OQ8A 3VC6A 1K7EA 3B8DA 1KGWA 1W3LA 3R8GA 3G1VA 4PEEA 3FGCA 3OU8A 4B92A 3SUUA 1R2RA 3N4FA 4KPLA 1VFTA 1GYNA 2X0HA 3GHSA 3ARVA 5CAHA 3RIKA 3AYVA 1Y5WA 2PLKA 3WJXA 4XBSA 4EACA 5D33A 4X9SA 3QFWA 4GYKA 4C6OA 3DFPA 4QS6A 3DU0A 3VUPA 2PWDA 4LU0A 3S5OA 1M1BA 3ARTA 4A8IA 1A3HA 4D6IA 3W70A 4HHHA 4C7DA 2HROA 3THCA 2J9YA 4PMRA 1TE6A 3IPWA 3S2JA 1IHIA 2B0MA 2ZA3A 3CWNA 4RE3A 4CKQA 3SN4A 4B9YA 2PGRA 5IXEA 3VKDA 2WNZA 3WQDA 5IDZA 2GUYA 4L61A 3QH2A 3LB0A 2ZUWA 3D47A 1PE1A 3QY7A 1K9TA 2RGMA 1LT8A 3EX6A 1DJQA 5KINA 3AS1A 1DQUA 5FJIA 3QKZA 4F2BA 3WDRA 1K8ZA 1XXXA 1WXYA 4XVDA 4KFPA 2RUSA 1CXKA 1XIIA 4QCFA 1DXEA 2OEMA 3FA5A 3W00A 3BG9A 2VURA 4F9DA 1FY6A 4TX6A 3K8KA 1SGJA 3KHJA 5DXYA 3EYPA 3FSTA 3LSBA 4L4LA 4E2DA 3T0AA 3PVFA 2MNRA 4DZHA 1S2CA 2FB2A 1PO9A 1IYXA 3A3HA 4LF1A 4CUCA 1VBGA 2YZ5A 3WQVA 3QTPA 1DHKA 3NQFA 1UKQA 1ZUAX 3VIOA 1MFVA 1GQNA 1P6CA 5CZKA 3NAVA 1Q4WA 4D8LA 1X8FA 4A29A 4O52A 5BXSA 3LLFA 1OC6A 1XFBA 4Q4MA 2PWEA 3PHAA 3UG8A 2WMIA 5REQA 2QJIA 4NI8A 4BI6A 4GNVA 2DH3A 2BTMA 4I6KA 1L6YA 5DRCA 4D6FA 2E5CA 4XZLX 4MGGA 1EGVA 3CLWA 4FP1A 5FEXA 3IIVA 3FEMA 1JCMP 1JVNA 1JZ8A 3H53A 1W9UA 2F84A 2G97A 2BXZA 3DFHA 2G96A 2VZTA 3HN3A 3PY2A 2E1DA 2ISWA 5C9UA 3GM8A 3ARUA 3BARA 3S46A 3WDIA 3DN5A 4IJBA 4ZOAA 3GS6A 1SJAA 4PULA 3PWAA 5GNYA 4BQ5A 1D7FA 1FKXA 3IAQA 3WD4A 2AQOA 2Q09A 3MTWA 4IICA 4DO7A 2W3ZA 1YDNA 5CZ0A 3VA8A 2VD8A 3S5NA 3E0VA 2DVTA 5D8WA 1EUAA 1TX0A 1ZP4A 1TKKA 2CYGA 2XGIA 1PHWA 4F40A 3WJSA 4E8GA 1WXJA 5G4HC 3G1DA 4HOZA 1L6FA 1XLFA 4ZTYA 3S4TA 4DUOA 4AMCA 3WLQA 3QOMA 3SUVA 3CAWA 4BQ2A 1D3CA 3V18A 4JDBA 5AFDA 1J0YA 3O63A 2P0OA 4AZCB 4LAMA 1EJVC 2DQWA 3AHZA 4LRTA 2Y4SA 1CIUA 3P62A 4WY0B 2Z0IA 1XRFA 1TFVA 3CUZA 2HNHA 1HVXA 4YWIA 3URBA 1OK6A 1UWRA 2BOFX 1WKFA 3CWHA 3V5OA 3AYRA 5CZJA 3VGHA 3A3WA 5EBUA 1Q7MA 5C9WA 3EX3A 4IJRA 3A4XA 2POZA 3ZLGA 2OR2A 3ZLHA 4YNGA 3NDZA 1I2PA 3A3XA 1Q6RA 2WNWA 2C1GA 3HV8A 3GAYA 3TOPA 4UQEA 4DF0A 5TAOA 1JPHA 1XIMA 6A3HA 3CZKA 2XH2A 1YLVA 2EBNA 2D73A 2F38A 4AX7A 1OCBA 4B5TA 5E0CA 5DO8A 2NSOA 1R46A 1NF0A 3LCLA 4JTRA 2BXYA 4CU8A 5K2ZA 4PUMA 3M41A 1XCWA 4L9ZA 4LUIA 3BW4A 3D3AA 2HDJA 1ZHAA 3WDPP 1KRAC 3UVIA 3PPCA 4PBEA 2Z24A 4IT1A 5CGTA 2GGEA 3DKJA 3IV3A 3HU7A 9XIAA 1KLZA 3M64A 3PSWA 4FNQA 4W7UA 1S5TA 1CLVA 4CQ8A 1BAGA 4RNHA 3I6TA 3KRZA 4KEUA 2G4FA 2WBGA 1YNPA 4DELA 4GI4A 4RDWA 2AAMA 2PTWA 1XM3A 1BXNA 2E0PA 1OG0A 1XICA 1F61A 2Y7FA 3CTLA 4JTEA 4H7VA 3EZ4A 4FK9A 3U9IA 1WZKA 4TVUA 1ICSA 2DW7A 1WOAA 3K4DA 4Q7NA 4DUXA 1QDSA 3V75A 2GVEA 2RKXA 1V3KA 4K39A 3FGCB 3LMYA 4YYCA 4L64A 4ATLA 5CC7A 2CPUA 3CAQA 4REQA 5EYWA 5I24A 3A47A 1WDWA 2W4XA 4JYEA 1FVPA 3FYPA 2H8ZA 2A6LA 1XIGA 1UOZA 4NIRA 1E1FA 1Q6EA 3FV9A 2E1WA 1C8XA 1J5SA 1QPRA 4YLWA 7ENLA 1Z89A 3H6OA 3VAVA 5EA9A 1U33A 3IUIA 3ME3A 1CT5A 2JIEA 3W74A 2X7VA 1R3QA 4KETA 1P0EA 2OOGA 1QNSA 4GYJA 4IHCA 3GDKA 3GTNA 2W91A 2W67A 3V5CA 1MRAA 4W9TA 5DX7A 2NSXA 1NOWA 3WNOA 2BS9A 2E4TA 1R3WA 3TP4A 3VIMA 3KLLA 3T2PA 4GXPA 1FTXA 3ZWTA 1UA7A 4A3QA 5EFDA 3FSUA 3TW7A 4E6MA 4QSFA 4Y90A 3HPXA 3T42A 1TMHA 1M3UA 3H21A 7CGTA 3VFCA 3ORWA 4DPQA 3MBFA 4PMJA 3OHMB 2V5LA 4ADSA 3WF3A 1CGYA 5EBAA 3U0HA 3PZIA 1M53A 2VDGA 1IT8A 3AYTA 4OOZA 2YW3A 5I3KA 5HMEA 1H7NA 4DM2A 3EA1A 3ARYA 1NJJA 3O07A 3TV8A 1BYDA 2BWGA 2B7PA 1QATA 3W1MA 3KS6A 2TRSA 2CLLA 1LCOA 2A3HA 1I45A 4V1YA 4S3AA 3T9PA 4KW2A 1HTIA 4PTXA 3GYEA 3RPTA 1J0KA 2W92A 3CUJA 2X1UA 1AL7A 2QDHA 3LNMA 1BRLB 4JEQA 2W66A 1AFSA 4FX8A 4CNUA 3H24A 3W2KA 1YPXA 2ZXQA 4L6HA 3UY8A 4AZ6A 4B3LA 1SZFA 3REQB 3CUIA 1HJUA 4L6DA 3MT1A 2HSAA 4HMCA 1JI2A 2ZUMA 3LHZA 5GVJA 1Q7ZA 4HNNA 2OO6A 3EGJA 1FRBA 2YKKA 1MXGA 1XR2A 2CLPA 2QJGA 1NQ6A 1CWYA 4GWEA 1TVLA 3FS2A 3TW6A 3SADA 3TIMA 1EO5A 4WKAA 3VCRA 3BLEA 3CWOX 3WLMA 3E9AA 3IRDA 4GHRA 1KFLA 3C56A 3DEQA 3W81A 2XDFA 5MKGB 3DFOA 3IIPA 4G8TA 3HBLA 3AIUA 4H7CA 3E3HA 4D1IA 2WZEA 5IBXC 4UB9A 2PWHA 4JIHA 4DBSA 1GNXA 3GXTA 1XRVA 2WPBA 3L4TA 3LXAA 4L9YA 3TJ4A 3M47A 4ZO9A 2P0IA 1LDCA 1EBGA 4EXQA 1N55A 4CD4A 1VHNA 3W72A 2X1TA 1PKLA 1Q6OA 3EKZA 1A50A 1W5QA 3E5BA 2R8WA 4HZ8A 4X2RA 4FXSA 3SECA 4JEJA 5AC7A 1H0IA 4HK7A 4IWWA 1ZGDA 3EMCA 1FWAC 1H1ZA 4UQDA 4F0HA 2G3JA 1QR7A 3HQOA 2C15A 4F2TA 4NHVA 3FX4A 2A3AA 4XO6A 1J0JA 4GQBA 2VEFA 4F9JA 3T4CA 1UH3A 3UWEA 4M8UA 1UPPA 3VINA 1I4NA 3SGGA 4FLSA 7XIMA 1FDJA 5XINA 3TW9A 4Z0JA 4WLCA 4AC1X 3CMGA 1YE6A 2ZE3A 4FOJA 1OC5A 3VM5A 4HYWA 3AO0A 5LNVA 1UC4A 2VXNA 3UESA 3TX9A 5IHRA 2ZWYA 2OYLA 3NPXA 4Y8EA 5CC3A 1XYBA 1GG0A 1Q63A 4AF0B 2CXEA 3MWAA 5A2CA 3UWZA 3SY1A 1W3NA 4ZL1A 3UF9A 4QLLA 1H2JA 3BAJA 3MDUA 5CPTA 1HKKA 3WLNA 1N8IA 2TODA 1E51A 4G1NA 1H5YA 3MCNA 3B8SA 3IARA 2AL2B 1P7TB 4QS5A 1FHLA 2F6UA 5A2AA 3CHVA 4HMEA 4H04A 1T96A 3WUBA 1QNQA 3P2VA 2HPIA 4CCDA 5L6UA 5B7ZA 4CN4A 2BHZA 3LPFA 1XWYA 4Z2HA 4TO8A 1QMLA 1R9XA 4C65A 1S2VA 1TWWA 2CITA 1A5NC 5F4XA 1XGZA 4F0KA 4DX3A 2VCAA 4JTDA 4LUSB 1F6YA 2XJ7A 5C7VA 4S3DA 2D2JA 1Q6DA 3S42A 1ISWA 3VGDA 2V68A 1K4HA 3HQ1A 4G1KA 3UZ5A 2J25A 1W1ZA 4XZ9A 3VDHA 5IHSA 3MO7A 2XIJA 3FYYA 3EWZA 3WJWA 3KVKA 4LBUA 4HSNA 1Z9AA 1F3XA 3HQPA 3UXKA 4M6PA 4E8DA 4QE4A 4JFSA 5IOBA 2Y5EA 2YDQA 3BE7A 4ENLA 1JZ5A 1BXBA 2UY3A 1I60A 3LHWA 1DJHA 3A4AA 3EOUA 3ARPA 2XN2A 5AY7A 4NZJA 4JN6A 3IEBA 4JTHA 1PPIA 2WMJA 2Z1KA 3CS2A 1M03A 2E6AA 3MUXA 1IEIA 4HNOA 2EPNA 2QQ6A 1J2WA 3KS5A 4DZAA 3GNPA 2CBIA 4FNTA 4EXAA 5A8GA 1PV8A 1AH4A 1H60A 1VFFA 1DEDA 3CYVA 4QQ3A 3GU9A 2OGJA 4GJJA 5J5DA 4Q8QA 1IZKA 5HMDA 2CFFA 3AMGA 2WWDA 2XINA 3S2CA 2GSJA 4UXDA 1JAEA 2V5BA 1J9YA 3B03A 2NVAA 1VCGA 2GGJA 3VPLA 1JFHA 4NAFB 4IPNB 1OFAA 7REQB 1O4UA 2WC4A 4O18A 5DY3A 3PAOA 1UUQA 7PTDA 2QAPA 4HOXA 4IMGA 4NX5A 3GG0A 4DO6A 1R8LA 5CZSA 1NF7A 2OTDA 1KC7A 4O0ZA 2E9MA 3BCDA 1AJ2A 3H2OA 4YVVA 5JBEA 4XSMA 2NQLA 3W7MA 1FFRA 3FKRA 2X16A 3OYZA 1V02E 4MLRA 4QP0A 2L5HA 5AKQA 2PP1A 4FIQA 3NYZA 1X6LA 1XISA 5E9AA 3ZVHA 4ZFMA 3I6RA 2G41A 3W7QA 2FH8A 3E96A 4GUHA 1WDQA 3BSGA 3OA3A 4BF7A 5GNXA 2NQ5A 2PDJA 3LZ3A 3HG4A 4MB5A 2Z1VA 2PP3A 2OWXA 1Z3NA 1JAKA 2ZRUA 3ZIZA 3HG2A 5G2IA 2GL5A 5HQEA 3GU2A 1KGXA 4H6EA 2Z4GA 3SCUA 4IMAA 2QPXA 3QMRA 4MADA 2HK1A 4O1CA 2XN0A 1QNRA 4UOZA 3DYOA 5C71A 1WOBA 5DELA 4DNMA 4LT9A 2CIPA 2VWTA 5HNNA 3EMZA 3T05A 1K8XA 1P5BA 4O1BA 4MHBA 3POHA 4LH8A 4M0XA 4CQCA 3IACA 3GNOA 2WMFA 2BDQA 3BZJA 4Q4OA 3GW3A 2PC8A 4ZGYA 4NSBA 4KWVA 4J1OA 3BDKA 1RSCA 1YTKA 5CPSA 1XIJA 4AUBA 1E0XA 4GMEA 4QISA 2WO5A 3KZPA 3UQNA 3FA4A 3PJXA 4GIAA 2PE4A 3MUCA 2ZRVA 3N73A 5D4YA 5BOEA 1F4AA 2YPIA 4I7WA 1UPMB 4O8AA 4A3HA 1TSIA 3R2GA 4AB4A 5I07A 5KETA 5CZTA 1OB0A 4HA0A 4PRWA 4IGHA 1PYFA 1RP9A 5D05A 3GDTA 4LOCA 2EJ1A 3B0XA 2NV1A 3UA3A 1M68A 1ZJBA 1V7YA 4BA0A 1BLIA 5FF7A 4R9OA 5A6AA 3VD9A 4YHEA 4PUNA 2D2HA 4IL2A 1FWDC 2G4JA 4WXYA 1ODUA 1EDGA 1ISVA 2VEIA 1XYAA 3WF1A 2PDGA 1JCYA 2EG7A 3RPDA 3GR8A 2RJGA 1ONWA 5FF3A 3F5KA 4IIDA 2B31A 5HUOA 1VD6A 4XKYA 4TU1A 1K8YA 2NXHA 1TVPA 4Y6GA 3G5EA 3GZ3A 3GXNA 2FZMA 5LNRA 1W9VA 2NVDA 4J2PA 2YA2A 4DN1A 1QK0A 5T26A 5TIMA 1S3TC 2QJJA 3PC0A 4IGMA 5HWJA 4J3WA 3QGKC 2FQIA 3QEZA 2VRJA 3TTYA 4N6FA 4UQCA 2PAJA 3RLGA 2W79A 1S5WA 4FOUA 1T8XA 2FJUB 2ADAA 3BXWA 5BRPA 1H7RA 2HRWA 3FJ6A 4NQ1A 3EDDA 3PPGA 1XBXA 4AHQA 1RY8A 3DGBA 4B3ZA 3O2LA 3NOYA 1XUZA 2A3LA 4YWSA 1O5KA 5CC5A 4AWTA 2OMAA 4MM1A 5HQLA 4QBXA 1F3EA 2VI0A 3UBPC 4H9MA 4JDYA 3G3MA 5CGMA 1TR9A 3W01A 4DXVA 5A6MA 4AZGA 2O9OA 5BWFA 3G1XA 2J9XA 1XV8A 4OUIA 2AMXA 1OFQA 2PI6A 1DIEA 1R5YA 2GWNA 1V4YA 4H41A 1W9DM 2GSEA 5BYWA 1PHQA 1KQYA 3NURA 3OLEA 3NDOA 4PCSA 1MZHA 3CIVA 2PRMA 1OJXA 4H7ZA 4LRSA 2DSKA 1F3TA 1U30A 3QYQA 2V2HA 4GXWA 1CGWA 2BGSA 2V38A 3WH7A 1QO2A 1Q8AA 3A5VA 3C3UA 4HMDA 1JNDA 4WSKA 3H7UA 4QAIA 2QJMA 2JGQA 4MB3A 5DCEA 2WVVA 3INPA 3FIGA 2VC5A 4PMOA 4H1ZA 5HWMA 3ZYZA 2V82A 5M2FX 2XFYA 4O50A 2NWSA 3Q94A 2XPKA 3EDEA 4IQJA 2FB3A 4ZQMA 1C7SA 2DZSA 3A22A 4Q4SA 2SFPA 3EWDA 4HNCA 1FDZA 4XTDA 4ZB0A 3QHNA 3W6YA 3U5UA 2ZUNA 3V3WA 1E6ZA 5A2BA 4KRTA 1A4MA 3S9ZA 2YB1A 3BLPX 2V30A 3E02A 4WDUA 3KOFA 3M4HA 4YYFA 3HV9A 1WZLA 1JYXA 2REQB 1EA9C 2VC6A 2EO7A 4GIYA 3LCIA 4O13A 3SCQA 1H49A 3G6MA 2WZIA 4RXFA 2PC4A 1TV7A 4Q4PA 1XRTA 3EWXA 3WLRA 4ECLA 3GNXA 3DHUA 5I3IA 1W6TA 4ORIA 2J13A 5G5IA 2DSUA 3EWYA 2PRLA 1GOMA 1QNOA 2BP1A 1CYGA 2E9BA 1XH0A 3ZSSA 1H5VA 3EPNA 4QHRA 3VI2A 4JQ3A 1Y0EA 5CEWA 1WBHA 4RDYA 4S2CA 2D0HA 2ESCA 5I23A 4MYAA 3AXIA 3T44A 4B9ZA 3FLUA 2DQXA 3Q37A 1DJNA 1ITQA 3QTGA 3TWAA 4HTBA 1E4IA 2WSQA 4FXJA 4C1NB 5AC6A 3K30A 4UTWC 1GZJA 3LTSA 3F7JA 4MY1A 3CHEA 4IX2A 5BXRA 3MVIA 1NH6A 2ATMA 1ZB5A 1X1OA 1JQXA 1JDDA 4UFJA 2QZRA 4S3CA 1E5NA 3DFTA 1JCNA 4G7FA 1A3WA 4DI8A 1SU5A 2O92A 1CLXA 2PDPA 1M9HA 3NWRA 4L65A 4KIEA 1LWIA 3UXIA 5D37A 3T1GA 4I5UA 2X05A 3CZJA 3LK6A 3HGJA 3LV6A 1GOIA 1XLKA 2QUVA 3G1FA 3BOXA 5KZ6A 1OQFA 2Y85A 3O7UA 2F7FA 2HS6A 3THQA 4KT2A 1VJSA 1OGGA 1ADOA 2PCQA 4EE9A 1HJWA 3NPWA 2E5BA 1JQVA 3DHDA 1G4TA 3TZFA 4I3GA 3GDBA 4PMUA 3NQ8A 1FP9A 3L4YA 1L6WA 1TV3A 4XBKA 1B3WA 1YMYA 5LHEA 3RU6A 3QXBA 1MW3A 4FMVA 2E09A 3EXTA 1KXHA 1H63A 4OE7A 1RQHA 1LBMA 4HNVA 3WCZA 2ZRZA 1GVEA 3KCOA 3TXZA 2GUBA 4YVXA 2PDUA 2D24A 4JL2A 4MFEA 3UGVA 2YL5A 3SCTA 3KP1A 3WNMA 2OJPA 3UZZA 2RDTA 1O95A 3C61A 1RPXA 1P1XA 5K9DA 2J7BA 1W91A 1BVZA 1OVDA 4GI8A 1S46A 3HMCA 1XBVA 1YTEA 2HVNA 2YCJA 2PTYA 3OZOA 5HULA 5C2CA 1DQXA 3I3BA 2QAFA 1KM1A 4GISA 6XIMA 1UD8A 4YIWA 2GQ8A 2BXVA 4GQRA 2FJKA 1HL9A 4BZYA 1R3RA 4HJFA 2YDRA 3TDFA 1JZ3A 1HIZA 2KAUC 3STEA 3TJIA 3AISA 3B3DA 3HMJG 1E9ZB 1KFJA 3NEHA 4QE1A 1DPMA 1F9CA 4IPLA 4NXKA 1QJWA 1TV5A 2D0GA 1VP5A 4OOUA 1VCFA 4R3UA 3CUHA 3TYAA 3FJLA 4BR1A 1NWSA 1L8PA 1HJXA 5RUBA 3VKKA 1RK5A 1TMLA 1Q6QA 2WLZA 2WYSA 2YCLB 4PUWA 3V36A 3PZNA 1XCFA 1TX2A 2NUYA 4Z2LA 3TYDA 3B8VA 2AOSA 2Y6ZA 4NJHA 4AMAA 3GO2A 3D5HA 1NWRA 2QGHA 3N4AA 1D8CA 1JZ4A 3WD2A 1UD3A 3QFEA 4S23A 3SJNA 1POKA 4K8EA 1KTBA 5I6SA 1DP0A 1QFEA 4WSHA 1XLHA 1GW1A 2Y2WA 1XYMA 3N2TA 1KFBA 5FJRA 3BCFA 3VZYA 1KLYA 1E56A 2QCMA 4HU3A 2XSBA 3ITYA 2ZYFA 2P1FA 3QF0A 2Z7KA 4MKNA 4E38A 1TWIA 1AD4A 1XCXA 1XLBA 3M0HA 2C13A 2J7CA 2QDGA 2OKTA 3ATZA 1QU4A 2ZX6A 4NY2A 4KRZA 4M1RA 1LUCA 1I2QA 2A4AA 3H2AA 2PDNA 3SGZA 1BF2A 1Q3NA 5CBIA 2ZZ2A 4C6KA 1K9DA 3QZEA 1KV8A 3AMDA 3W02A 2RH9A 3KUMA 4HIBA 3RR1A 3UWWA 3BSMA 3QHOA 3BANA 2GDUA 1KM5A 3OGRA 4ICMA 1S2WA 4LBRA 4QEHA 4PMNA 3RRAA 1VPQA 3W7EA 1L2UA 1GZ1A 2O4MA 4CNTA 5JH2A 2OG9A 3NL5A 1JZ7A 4AXNA 3BICA 3J7HA 3MP3A 3UY7A 2J79A 3AS3A 1Z32X 3P84A 4EPBC 4H9UA 2OEJA 5E1QA 4PR4A 2FZNA 5F7UA 2IKIA 5BROA 4NU7A 3TN3A 2QULA 4MB1A 3GXDA 1JIBA 1OF8A 1OF6A 5CLTA 1JCTA 4WJXA 2ZXDA 1O1ZA 3TYZA 3UJFA 1TRIA 3UJRA 5KSWA 2YXOA 5AHIA 3W2JA 5HNRA 1QPQA 4ZQPA 1PSCA 4Q7BA 4GIRA 1OBAA 1TPH1 1Z7AA 3W1QA 2XZ9A 4HP5A 4PTWA 2G5WA 4LEQA 4Y7EA 2J4GA 5ABFA 5M3WA 1XGEA 4XAPA 1GJUA 3R0KA 1EWDA 1NTHA 3PBYA 1W9XA 3IJ6A 3T6CA 1NARA 3SCRA 4RKAA 4JZ5A 4YTSA 3W85A 3WK1A 1M7OA 2PBOA 1TPDA 2R94A 1TV4A 2I17A 2VGIA 3RITA 5GNZA 4LEFA 4H19A 5ENLA 3P93A 2GWGA 2C7FA 3ANVA 2QCDB 2HE8A 1TTJA 3MMDA 1QOPA 3QN3A 2A85A 2PS2A 2Y63A 4IIEA 4O1AA 5CXPA 1LL4A 1KBLA 3WFZA 2PTDA 3ANUA 3FA3A 3RILA 1RCQA 3TVAA 4UTHA 3VNLA 3LGGA 1PZ0A 5DMYA 1JGIA 1K6WA 3N13A 3U48A 4IQEA 3W6MA 3QGVA 1A0EA 4US5A 5T8GA 3OZPA 4XTIA 1GK8A 1XINA 2J9ZA 5E0KA 4EX4A 4XD4A 3STPA 4GVFA 1XG4A 1CB2A 1EJRC 3OVGA 3FHAA 2E6FA 3WBWA 1GTEA 1PTGA 4WKFA 1FUYA 2NXGA 4Q8TA 1J8VA 5AZ1A 4IM4A 2DSWA 2QCCA 4RW3A 1N2VA 1YNQA 4GQ0A 4O10A 3MDWA 3KVLA 4XX6A 5FL1A 1T7LA 3LCFA 3BW3A 5HMSA 3ONCA 3L2MA 2DVXA 1VRDA 3BLIA 3MZ2A 3WJYA 4WVXA 2ZOXA 1I9CB 3CMJA 3PUEA 4LY4A 1PWLA 1H7XA 3WSUA 3M0KA 1HJSA 2OCZA 1CXEA 3NYDA 1XW8A 3GXMA 4GI6A 4ZVJA 2WHKA 4GVIA 3W87A 4J3SA 1XKYA 2O9RA 3I10A 1RP8A 4JY9A 1A5KC 3CT2A 3EB4A 1TV8A 1US0A 2VZUA 1XYCA 4AZ7A 4GOAA 3ZLFA 4LUTB 2GLKA 3SM0A 3GNDA 1RBAA 1YKWA 1D9EA 2PU0A 1Q6LA 5BU9A 4M80A 2IKHA 4US5D 2XIBA 4ZOEA 4NRSA 4LVAA 5C8BB 1V6TA 4LS2A 1O5XA 2WVUA 3LPGA 1XJBA 3PFRA 4TTUA 1DE5A 4GCAA 2ZE0A 2B7OA 3SCPA 4MMWA 2A7RA 3E49A 3VABA 4NNBA 4ZB5A 3O1NA 3NA8A 4IIHA 1G4SA 2CERA 3NL2A 1E0TA 4R9XA 4AIEA 3UZJA 3PM6A 1U5JA 4JIPA 3R79A 3NG3A 4JTGA 1EEXA 3L0GA 4MWAA 3QJAA 2BX7A 1ADDA 2VDHA 3HTWA 4GBDA 2ZDSA 4CU6A 1W1VA 5E0FA 2VFHA 4K8HA 2Q8LA 2I57A 2WSPA 2VM8A 1VQTA 6CGTA 1JXKA 4Q8NA 3R8RA 4PCNA 1YX1A 5K4XA 1LUCB 4M3PA 2WW5A 2XIIA 1YBQB 4NYUA 3LCWA 4GZJA 5CSSA 5C0QA 2PFHA 4LS1A 4FSAA 5CJ5A 2EG6A 1IZJA 2R1KA 4UBPC 4JX4A 3GB6A 4J2MA 1ESWA 4ERIA 3MI3A 1Q8JA 2DP3A 4XWUA 3TQKA 5I79A 2DVUA 3UWYA 1B9ZA 1GTHA 4O11A 4RNFA 5FJUA 1DOSA 2VX4A 3V0TA 1GHRA 3WEOA 2ALRA 3SUSA 4DPPA 1SW0A 3SRFA 1SMAA 4DHGA 3R4IA 5FCZA 1LZOA 1PZ2A 1GCYA 4U3AA 3FFSA 4A2RA 3GQYA 1VZWA 4TVCA 4MB4A 4XBJA 1JDAA 1VAHA 3LQLA 3UG3A 4MWAD 2YW4A 3S83A 5GJMA 2ZICA 4GK8A 3ABOA 3LG3A 2PA6A 1UZ1A 3LI0A 1M5WA 2X1RA 1EDQA 2YGYA 3W1TA 1RBLA 1F07A 2PMQA 2HXTA 1UOKA 5I03A 2YYUA 4GGBA 1C3FA 2B4GA 3UWQA 3GVQA 4I9TA 1PWMA 1QHOA 2IXUA 2D22A 3R11A 3G1SA 1TJ0A 5LXEA 4UOJA 4GY7A 4JTTA 4ZFCA 3QZAA 1XD0A 3RM8A 4M7SA 1IXNA 1I2OA 2OLAA 4WQ6A 3N2XA 3USBA 2V3EA 2WAGA 1DTUA 4C6FA 4UZUA 4KEVA 5I3DA 1GVOA 3H22A 1GOOA 1ZBKA 2XN1A 1EHNA 1PIFA 2UY4A 2XYLA 3A24A 4HMNA 2C19A 1AQMA 1SJDA 3CASA 4X63A 1EBHA 3S9IA 2RAGA 4H8HA 4ERAA 1WAUA 1XYFA 4GUJA 1C29A 4ZB2A 4XAGA 4K68A 4J28A 2ALDA 2X41A 2IXVA 2Z29A 3W24A 4LCQA 1KCKA 1RD6A 3LENA 5C2GA 4WHBA 4Z17A 3MUZ1 1XRSA 3CL6A 7A3HA 1OX6A 2FZBA 1S1PA 2OVLA 4NZ4A 2POTA 1VB9A 2GVGA 4WDXA 6ENLA 3BH4A 3IK2A 6REQB 1M65A 2J6XA 3WELA 5D9MA 3YPIA 1G69A 4MUZA 1VRXA 3WQFA 3RHGA 1CDGA 4U3CA 4AZIA 3C6CA 3ZR4A 3SSZA 3I3DA 2BVTA 3WKZA 2QKFA 4PZVA 1OX4A 1JI1A 2V81A 3UZWA 3BO9A 2H3DA 4NILA 4P7LA 1T40A 4G5DA 2YBUA 2V0TA 3PZMA 1UA3A 4EPDC 5A95A 1IWAA 5BXTA 4EXBA 4HTYA 1A5OC 4M56A 1JRCA 1GHSA 1J6PA 3W71A 3F4NA 1OT2A 4S3BA 4ROPA 1M7XA 1WUFA 2G3IA 1CXFA 4LVGA 3UD6A 3GIPA 1X98A 4B16A 3W7RA 2CZDA 2XIMA 3CV7A 1WAWA 4J3ZA 4RZBA 3KOWA 3LI1A 4ICCX 3G2GA 1SZGA 3RG6A 3N34A 2HS8A 4DWSA 2QCLA 4FXRA 1VHCA 3BLFA 1FWFC 4IXHA 5MHBA 1KM2A 3L68A 3WLJA 1XIDA 3GKAA 1T5AA 5FF0A 3W1PA 4B5NA 3EAUA 4IMCA 4HK6A 1NU5A 2TPSA 3Q65A 3R10A 4TV6A 1C92A 3P14A 1F74A 1GYMA 1NFGA 1XS2A 2BOEX 5BMXA 3AU6A 1UH4A 2IUZA 2ZFAA 1GONA 3M0IA 4FO4A 4B4HA 4BF9A 4JIQA 3ZXWA 1FDYA 2IMRA 3FCPA 3R5EA 3NOEA 3OGVA 3M43A 3TXVA 4GJ1A 2WWCA 4F79A 1E6RA 3SW6A 3UGRA 2EKGA 2A7NA 5FIPA 5I7GA 2WC3A 1XLIA 3I6EA 1EYWA 3GXFA 3N2MA 5LIXX 3LM3A 3PUOA 3OO2A 3F5LA 3W53A 3BQ6A 3TA6A 5I77A 2PPGA 4IUGA 4ZR8A 4KBXA 2Z1WA 4JCMA 2NQZA 2OSXA 1G5AA 2VELA 4Q8OA 1KW1A 3QZ6A 3KCJA 3TLQA 3N19B 4GH3A 1OCQA 3VKJA 3CC1A 3QC0A 5J8LA 2OT0A 3KXQA 4QR6A 3NTYA 2GVLA 1J4EA 4DWSD 3MO4A 1UWSA 1EQCA 4WJ8A 4AVNA 1J18A 1EJTC 3ICJA 3AMLA 3M0XA 4B90A 3P8JA 1G1YA 4P7RA 3TJXA 4G6CA 2VVSA 4UTTA 2D0FA 4K3ZA 3VDAA 3DGRA 3E2QA 3BGAA 3F2DA 4J3XA 3IVUA 3EKGA 4FALA 1D8WA 3KRBA 3W73A 3N14A 3U57A 1OK4A 3T55A 4XISA 1U1HA 1R38A 2BFGA 5ABTA 1W8SA 4QQUA 4GXMA 4JL1A 1IWPA 3UZXA 3VOIA 4XAYA 1RVKA 1G9HA 4H9ZA 1A80A 3W82A 3NQEA 4JBRA 2PBGA 2FZ9A 1CGXA 2VQUA 1CXLA 4FNPA 4GKLA 3KW3A 1ZBVA 2GGHA 2H3BA 3QR0A 4L1WA 2O55A 3L7RA 1TJPA 3EDFA 3ZOAA 4HNTA 1EH9A 3OVQA 5CC6A 1UR4A 3WQGA 4LPCA 1FH8A 3MBDA 4LANA 4NVTA 3UYIA 1GVFA 1H09A 1ISZA 4YS1A 1J5TA 4JOMA 3SGUA 3IVSA 1M41A 3CLMA 1DIKA 1JR1A 1S2AA 3WMBA 3W7NA 3NZPA 2JALA 2ACUA 2ASHA 1GOXA 1OFBA 2WSYA 2H9AB 1H1NA 2I9EA 3O3RA 4WKHA 3MHGA 4H9TA 3O6CA 3U2CA 4B5VA 2VD9A 4EVZA 1E9IA 1TQXA 5D30A 4FR6A 1VJIA 1CPUA 5U4NA 6TAAA 3WLSA 3W2MA 1I8JA 3T40A 3R7MA 3IRSA 3HZ3A 3WUGA 4MKVA 4KEMA 2DT0A 2X42A 4MPQA 4QEEA 2H6RA 5KTLA 5DY2A 3CV2A 3CTTA 3NQCA 1B4EA 3W2UA 3C2VA 3WF0A 5BXPA 3W28A 3HF3A 5JIWA 4E2VA 1ZAIA 3D0CA 2ZKMX 2Y5JA 3TZNA 2NLYA 3DFYA 4UR7A 3W86A 4FOKA 5DANA 3NQDA 5CAKA 1OX5A 1B3VA 1N82A 1TELA 5EMJA 1X97A 2Z00A 4O1FA 4UTLA 3TTOA 4LYPA 1CLKA 5EL1A 5M1TA 2V3DA 3CH0A 3W9ZA 2ZZ1A 4GO8A 3TLLA 4Y9AA 2VT0A 2INFA 1AZ2A 5HNTA 2GJXB 5GPRA 5IDIA 1GOKA 1QO5A 1K02A 1LLWA 1P0NA 4LW7A 5T91A 3T08A 3RO6A 4US6A 2DT1A 4U10A 2EJAA 4RPQA 3TSDA 3TTSA 4QG6A 1XQLA 3F4CA 4AZHA 4N9BA 2NT0A 5JQ9A 2DZAA 3QPEA 2V9DA 2FLIA 4UMAA 1V08A 2D1ZA 3CHFA 4EWJA 1FWHC 1V6XA 1X39A 2PD9A 3U2EA 1E0WA 2Y7DA 1PX8A 3S2MA 4DWSB 1E3ZA