3EB4A

Voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
327
Chain Sequence
b'MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Cortisone dissociates the Shaker family K+ channels from their beta subunits.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, oxidoreductase
total genus 123
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3eb4A00
4QR6A 2I16A 3R8HA 2IPGA 2WZTA 4WDWA 2ALRA 1GVEA 2HEJA 1XF0A 1JEZA 1X96A 5HA7A 1PZ1A 1S2CA 4H7CA 3FJNA 3BURA 4DBSA 1YE4A 4PMJA 5HNTA 2HDJA 3WG6A 2HVNA 3COTA 3LZ3A 4WRHA 3P2VA 2WZMA 3QKZA 3O0KA 4LAUA 3R6IA 1ZGDA 4JIHA 4JTCA 2BGSA 2F2KA 3WBYA 3V0UA 2DUZA 4YVXA 1OG6A 2PDHA 3WBWA 4XZMX 2HE8A 2R9RA 4PUWA 4IJCA 4GIEA 1PYFA 2IPJA 1Q5MA 2INZA 1QWKA 2PDJA 4XK2A 1QRQA 4Q7BA 3DOPA 4FA3A 1J96A 4XVEA 2HE5A 3UFYA 4XAPA 4GQGA 1K8CA 4XZIA 4RPQA 4QXIA 4LB4A 1YNQA 3S3GA 2IQ0A 4JQ1A 2PDBA 4DBUA 4AUBA 2BP1A 3WCZA 4I5XA 1HW6A 4JTRA 4YU1A 3CASA 4GACA 1VBJA 1PZ0A 1C9WA 1M9HA 3R58A 3UZYA 1HQTA 2PDQA 3UG8A 4MHBA 2FGBA 3LQGA 1MRQA 1PWMA 3LNMA 3D3FA 4JQAA 2CLPA 3CMFA 4HMNA 3UP8A 3LEPA 2PDWA 2QXWA 2PDKA 1IEIA 4JQ3A 2ACUA 3GHUA 3UZXA 3CV7A 1EF3A 5JH2A 3Q65A 3LD5A 1AFSA 4QX4A 4IJRA 4EXAA 2FZ9A 4PUUA 4DBWA 4GCAA 4PR4A 2A79A 4NKCA 4LAZA 3R43A 3ONBA 1UR3M 4JTDA 4YVPA 4L1XA 1IHIA 4H8NA 2I17A 3H4GA 2R24A 3LN3A 2FZDA 1ZQ5A 1T40A 3ERPA 2IKJA 1T41A 1US0A 1ZSXA 4R9OA 3F7JA 3LZ5A 4EXBA 1ADSA 2HVOA 4JIIX 1RALA 1AH3A 3M4HA 3G1RA 4ICCX 4OTKA 5LIXX 4JTQA 2INEA 4FALA 1S1PA 3BUVA 1ZUAX 2PEVA 2ISFA 2PDYA 1EKOA 4PRRA 4PRTA 4Q3MA 2PDIA 2PDPA 4XO6A 3ONCA 1EL3A 1AZ2A 2ACRA 3N2TA 5M2FX 3C3UA 2HV5A 3Q67A 4JQ4A 2NVCA 4DZ5A 3H7UA 2IQDA 3LUTA 3KRBA 2PZNA 4XO7A 1RY0A 4QBXA 2VDGA 3DN5A 3R8GA 3H7RA 2C91A 1AZ1A 4XZHA 1XGDA 2PFHA 2IS7A 4LB3A 2J8TA 2PDNA 1RY8A 3V0SA 4GA8A 4XVDA 4L1WA 3RX4A 3M0IA 4JIRA 3LENA 2BGQA 3GHSA 2DUXA 3VXGA 2AGTA 1VP5A 1Z8AA 1MZRA 4FZIA 2NVDA 1EXBA 5DANA 4WDXA 2ACSA 4HBKA 3CAVA 3GUGA 4WDUA 5KETA 2PD5A 4WEVX 3N6QA 2PDGA 4JQ2A 1S1RA 5JH1A 2ACQA 1X98A 1LQAA 3G5EA 3CAQA 3EB4A 1X97A 1PWLA 3GHTA 2F38A 4YS1A 5LIWX 4YVVA 3LBOA 2PDLA 3V36A 3UGRA 5AZ1A 1SM9A 4JTAA 2PDXA 2PF8A 2PDMA 1YE6A 1Z9AA 4LBRA 3NTYA 5HNUA 3WBXA 4GABA 3BV7A 3V0TA 3BCJA 1XJBA 1LWIA 1FRBA 3GHRA 3MB9A 4XZLX 2IPFA 3B3DA 3UWEA 2PDFA 4GQ0A 1Z89A 5AZ0A 4FAMA 5LIKX 4F40A 2PD9A 3T42A 1AH0A 3U2CA 3V35A 4IGSA 4LBSA 4ZFCA 2DV0A 3CV6A 3M64A 2IKHA 1A80A 1YNPA 3EAUA 3MC5A 2IPWA 1Q13A 2IKGA 2FZBA 3LQLA 3R94A 5LIYX 2FVLA 1S2AA 5LIUX 3UYIA 1MI3A 3O3RA 2FZ8A 1Z3NA 1R38A 3UZWA 4ASTA 3RX3A 2PDUA 4XZNX 2P5NA 3EB3A 2PDCA 4G5DA 3RX2A 3UZZA 1AH4A 3R7MA 4WDTA 2IKIA 4WGHA 5C7HA 3FX4A
chains in the Genus database with same CATH superfamily
3UERA 1GWJA 1LLOA 1OY0A 2BXYA 3F5KA 3CH0A 1JPDX 1XF0A 1FKWA 5GNXA 3SQMA 4OGZA 1QK2A 2YXOA 1V3KA 3FFSA 4W9TA 2FPTA 2VM8A 1JCJA 2CBUA 3QV7A 1R2RA 5HNTA 4NT0A 1R3TA 1OK4A 2YIHA 1W3JA 3NG3A 1J6OA 3TTYA 1SFJA 1FWNA 2HWGA 2FH6A 3C3NA 4E2DA 4W8AA 2PB1A 3MDWA 4S3DA 1PX3A 1A5NC 4ZENA 4WK9A 4GI8A 1XI3A 4H6QA 4CQDA 4PUWA 1ZP3A 4AIEA 2DSKA 2Y89A 3CQKA 4ES4A 2JIWA 4JXCA 4LOCA 1TFVA 3W85A 1JRBA 3QLLA 3C0SA 3TYCA 4A3RA 3H70A 4IG2B 2WNNA 3U8GA 4ICMA 4JIEA 4OVXA 1M7PA 5A94A 1PJ9A 3CNYA 4JX5A 3TJLA 1RLCL 1OCQA 5G4WA 1VZWA 3IJ9A 4W7UA 3EWCA 2Q6ZA 2EKGA 4LUYA 1JGIA 4JQ1A 4UOZA 4AWTA 2WC7A 1R3WA 4DBEA 1XUZA 1MW3A 3WCZA 4FS9A 1G01A 4TO8A 4OU1A 4UFJA 3HV8A 3M0KA 4WF7A 1U5HA 4Z0JA 4EPBC 3UWYA 4IMCA 4AB4A 3GVQA 3CIXA 1L6YA 2PDQA 3R0DA 3T44A 1CWYA 4OT7A 2Z1KA 3O2LA 3Q58A 5F2IA 1XLJA 4F66A 3N4AA 1XDMA 1F6PA 1IF2A 1ENUA 3G3DA 1VR6A 3NQCA 1IZCA 2I9UA 1BVZA 5BRPA 4DAIA 1V7AA 2ZX6A 1M53A 4PTWA 4BS0A 1UROA 2QLYA 2VR5A 3KRUA 3OYXA 1BKSA 1LWJA 4DF0A 5BZAA 2WJFA 2NQLA 3GXFA 4PFHA 2P1FA 4PUUA 3QY6A 2C14A 4IP4A 5M3WA 1UIPA 3AZTA 3R43A 2H3BA 2WPGA 6REQB 4QE5A 4X2PA 2QDHA 3OPSA 3BVJA 3IGSA 3LN3A 3LTPA 4RKAA 4BWLA 1OF6A 3CL6A 1AUSL 3P8IA 4YNGA 3H22A 4EX4A 1XYZA 2J79A 3HTWA 3A23A 1F4AA 1R30A 2F84A 3CHCA 3ZXWA 4BKNA 1EFZA 4G8TA 4B90A 4ZQNA 2PURA 2ZTJA 4NASA 1IQ8A 3TXVA 2HVOA 1V0KA 3WNNA 2PTYA 2CBJA 6CGTA 2BDQA 1HNYA 4QCFA 2A7RA 5AVNA 3W7GA 2C7FA 4N6FA 1XLDA 1K4HA 1AW5A 2V82A 4AC1X 1GPFA 5EKYA 2X40A 3WH9A 1O94A 4M51A 4RDYA 4Y6GA 4PSRA 4UTKA 3HGSA 4PEKA 3KS5A 4ROQA 3THUA 4DUWA 1ZY9A 3PBGA 1BG9A 4JFUA 4HHMA 1VC4A 4S38A 1VQTA 5IHRA 2ZZ6A 3VMPA 2DZPA 2NXHA 3R89A 1W5MA 1GZ1A 5DMMA 1V02E 3EDEA 1QO5A 2HVMA 1O12A 1UUMA 4V15A 1B31A 4GD0A 4G7FA 3E0VA 1WZAA 1VP5A 2NZLA 3W1TA 4F0KA 5C2GA 7A3HA 4DO6A 1KTCA 3IIZA 5BMWA 4HBKA 3NSMA 4YTUA 1FWEC 2YCLB 2H9AA 5A8GA 5K2ZA 3QOMA 4ZQOA 3C86A 3A9IA 3ABQA 3ITOA 3AYRA 4F48A 3NO3A 5BOOA 1KRMA 5LNSA 4DF2A 4WY0F 3MV11 3RLUA 2HSAA 2ZRWA 4MJZA 4NAFA 5FD0A 2CLLA 3VNYA 1OWQA 2FZMA 4HIBA 3LBOA 1TUXA 2DFAA 2Y7FA 4ZO7A 4BWLC 3LTSA 2Z6IA 1KXVA 4TOQA 3GVGA 2PF8A 5EMYA 3EXTA 3NTYA 3W1UA 1NQ6A 4DQWA 1L8PA 4KESA 2HBVA 3O8AA 1XJBA 1YX1A 4XZ9A 4X9YA 3KCLA 2ZA3A 3CT7A 1OFPA 4KEMA 4RXFA 3BSGA 1JFXA 4JFSA 4HTYA 1T0OA 2WB5A 1KO0A 2CZVA 2PAJA 1JQVA 4L80A 5AZ0A 1SGJA 3B8SA 5FKYA 1W8GA 3SGUA 1ZU8A 1XIJA 4RW5A 1I2OA 2YCEA 3TQ0A 3G6LA 3DAQA 3ABXA 3SJ3A 3KM8A 4A05A 1J0YA 5AYIA 1JDAA 1Q8JA 3OLIA 4TVUA 5D2YA 3SCRA 1W9DM 1PKMA 3GSMA 4DNMA 2CZEA 4NJKA 1OYAA 1S2AA 3L4WA 4B5NA 4BA0A 2CXEA 4WKAA 3MO7A 1M65A 3ARTA 4I8YA 2OYMA 3Q4DA 1DJNA 4IFKB 3U6WA 1V77A 5A6AA 4FIQA 5EMLA 3DFYA 4Z42C 1PCWA 2VFFA 1WAUA 1UR0A 3R10A 2FJUB 1VB9A 3R7MA 2DZWA 3RK8A 3LMZA 5HK4A 1GQJA 3T2PA 3UJFA 1DIOA 3CB3A 2VRKA 1KM6A 3DH7A 2A3AA 1K4GA 2ALRA 3OLEA 1X96A 1GOXA 4UZSA 4CN6A 1XD1A 3TN6A 1F7BA 4P2VA 2YW4A 1NP0A 2GJXB 3AXMA 3ABRA 1YE4A 2HMCA 4NI8A 3TYZA 1UKPA 3T0TA 4PMNA 3O0KA 4CD6A 4HK6A 1QMLA 5K9CA 1UHVA 3D5HA 4X22A 3N12A 1NIUA 4GXPA 3V0UA 3TZNA 2X30A 3EMZA 1K9FA 3ALFA 1DIEA 4MJ2A 3P60A 3RITA 3PTMA 1DXEA 1VFTA 4PCFA 3WNOA 2VI0A 4F79A 3LV6A 3GS6A 2CPUA 3WFAA 2XFRA 1E56A 3EOEA 1UC4A 3R5EA 3AFBA 2IXUA 4S3AA 3DFSA 5AFDA 2WSYA 4QAIA 4D9PA 4IIDA 3BAIA 3UWVA 3SN4A 2INFA 3CGTA 4I5XA 1JXJA 1HW6A 3RUBL 3B04A 2DT1A 5A8OA 1A4LA 1GZJA 3ZOAA 3FYYA 5XINA 4RNHA 4ML4A 4GACA 1D3CA 1I4NA 2X1IA 4I9MA 1QOQA 4OE7A 5LNRA 1E6XM 5LHEA 2D3LA 1OIFA 5DF0A 1E55A 4GBDA 2Y7DA 6PTDA 4AWSA 4WJ8A 2ZUNA 3P84A 1WA3A 2V2CA 2L5HA 3U0HA 1WDSA 4FXFA 2EJ1A 3S0CA 1HVQA 3EPMA 1R9ZA 1DVJA 3OZMA 1J18A 3QSRA 1AQ0A 3DG3A 2C19A 3C52A 1AQFA 1W8SA 1W9BM 3GYCA 5CPTA 4E8GA 3VIGA 4N02A 1XIMA 3QC3A 3ZJKA 1JYNA 3ES7A 2OOGA 3GQYA 1OFOA 3Q65A 3U4AA 3E3HA 3EOUA 4LU0A 1V0LA 4TMBA 3W28A 1GHRA 3A64A 2FH8A 1HX0A 3N3MA 4O53A 2XN2A 5HMSA 3PNUA 1B5TA 3AYSA 2FMOA 3VAVA 1EYEA 2CLEA 5HWJA 1A53A 4HNNA 1QBBA 3ERPA 4I8DA 5D9OA 2HTMA 3CMJA 2ONEA 2IW0A 4NY2A 4CNUA 5K9DA 2HXTA 3TK7A 1UWRA 3GXMA 1VH7A 4M19A 2XDFA 3T0DA 2QCHA 1VPXA 4FLSA 3LRLA 3W2KA 3TLQA 3BV4A 1S1PA 2RHGA 1PSCA 4HNTA 1TV5A 3WLIA 4FO4A 3CEUA 4YMZA 3ONCA 3VI2A 4IOTA 3ZMRA 5AYXA 1TZ9A 2DSVA 1UP2A 1GEHA 3MI2A 4MADA 4WLCA 4O57A 3W7QA 2QAPA 4LY8A 1PB0A 3PZMA 1Q6CA 2XN0A 3KE0A 1H7PA 4B15A 3GTIA 3H7RA 3PUOA 1MRAA 2WJDA 1R47A 1J9YA 3L0NA 3NGFA 1GKRA 1QHZA 3AS3A 3H12A 4YYFA 4GA8A 2O7SA 3PTQA 4C1KA 2GVYA 3NPWA 2XH2A 5KMYA 3IJQA 1WE5A 4B5UA 3VXGA 3WLPA 4ZQPA 1DHKA 4UNIA 3DCPA 1EXBA 4O1AA 3BSMA 3T8QA 3TWAA 3UETA 3RM8A 3M0YA 4CNOA 8A3HA 1QASA 1S2VA 5FAGA 4WDUA 4F0SA 1ISYA 3N9KA 4HVXA 4GC3A 2X7VA 1LM1A 2Q8XA 1TPFA 2FGZA 3GVRA 3E2VA 1GKQA 1VAHA 2Y88A 1ZTVA 2YFNA 3P14A 1UBSA 3POCA 2OU4A 4YVVA 2QPUA 1W5QA 1WXYA 1K7EA 3OA3A 4R7OA 5AZ1A 4QS5A 5BW6A 3MCOA 1LJYA 3ZS4A 3G1AA 5FOOA 4LT9A 3I68A 3RM4A 1TZ7A 1VJSA 3A12A 3T6CA 3L2IA 4O4WA 2RUSA 4O13A 4RR4A 5B7ZA 1VGAA 4B5WA 3MHUA 1TCDA 2MNRA 4M80A 4PODA 4CGTA 4XZLX 1YKWA 3UPMA 4AF0B 1J93A 1Z89A 1VFHA 3WO8A 3TSBA 4D6EA 3TROA 1ZBWA 3GVVA 4ZB0A 3M0ZA 3U2CA 1HN1A 5KEZA 3IK2A 4Q8QA 3IRSA 4UFIA 3SURA 3UESA 3GFYA 3DU0A 4LVFA 1REQB 5HMFA 1XW8A 4HU4A 1U22A 2QHAA 3TSDA 1V3MA 5LIYX 3AQUA 1W1TA 3KRZA 1A47A 3VDCA 1X7FA 4W5UA 1PDYA 2NVAA 2XWDA 2GK1A 3NM3A 2BY2A 2E09A 1MUCA 3HPAA 2EPHA 4K36A 4C6DA 3RCMA 3RX2A 3UZZA 1JXKA 1KM2A 4M8UA 4YPJA 3UY8A 1A3WA 2ZX5A 3W72A 2GSHA 1TA3A 3VILA 1XLGA 1ADOA 1NDZA 2HJPA 3S2JA 1M04A 3JW7A 3UT0A 1FCVA 4LCSA 3WLQA 2G3NA 2YPIA 2CIPA 4IX2A 1ZP4A 3S6DA 3MZNA 3VNKA 3B0UX 1DWGM 1CTNA 1UD4A 5ENLA 4GC4A 4RZ6A 2XHYA 4XD4A 3IRDA 4PMJA 1JCTA 3LZ3A 4KIRA 1XBYA 2OEJA 1ZPTA 2WVSA 3OZPA 4LTSA 3I6RA 3LOTA 1TPDA 1XINA 3DHFA 4WKFA 3UWUA 3LCFA 1HVXA 3THAA 1Q8AA 4C6NA 3G2GA 3M7SA 5A5WA 2VX7A 4HA3A 2GJPA 2A21A 2ZKMX 4MWAA 3W3OA 4EWJA 4CVUA 3VUPA 2B31A 4W8LA 4RNIA 3E5PA 5D2VA 5LSMA 2P3EA 3NZRA 4BF9A 1RAKA 1Y5VA 4Q4SA 4XD5A 5IHSA 1WUEA 3L65A 3VNIA 4TXEA 3WLHA 5B7YA 5IM51 2BASA 1B2YA 4QXIA 4LB4A 4R88A 3MO4A 1UWTA 4B91A 2DW7A 2WZIA 4C6JA 3O0FA 1VIWA 2ZDSA 3AISA 4H9MA 1E40A 4MWAD 3UBPC 3AIUA 3ME3A 1ME8A 1UB3A 1EHAA 1QI4A 2REQB 4YU1A 5H2ZA 1NY1A 4O1EA 1LQ2A 1IE7C 1NFPA 3LERA 2FTWA 4MUPA 4DLFA 3CLMA 3I10A 3L9CA 4DZHA 4HPXA 4K2SA 5EGRA 5TBOA 1EXPA 2VEKA 4UNLA 2POTA 3ZVHB 1K9EA 4TVDA 3AJXA 1TV3A 5E0KA 2QF8A 4XD3A 2CEQA 3WD4A 8TIMA 1FH7A 2RJGA 5E0CA 2VURA 8XIAA 1UKSA 1X39A 4IGHA 1Q45A 1S2TA 5E70A 2A3LA 3BLFA 4NX0A 1Q2RA 4D6DA 1EF3A 4JGDA 3TN4A 4JTFA 1FWWA 1KRCC 1XRFA 2IMRA 2Y8UA 1I0BA 4DXVA 1OD0A 1SFLA 3L0GA 5AYYA 4DPQA 4YJ5A 4ZA0A 2WC4A 5FF3A 2FJKA 3TR9A 4OV9A 4NILA 2A79A 1NWUA 3S9ZA 3EX3A 4A8NA 1XLFA 3GFZA 4LAZA 1H61A 3REQB 3VDBA 1RCXB 1W54A 3H4GA 2YR1A 3UWWA 1JIBA 3LV5A 2IKJA 3CXOA 5FA5A 5GPRA 4JPGA 3L21A 4NX5A 4MWAC 1GVQA 4IMGA 1UH2A 3RMEA 4ICNA 4L5ZA 4DBDA 2EQDA 4ZO6A 4AXKA 5LYRA 1DOSA 4UZUA 3U2EA 4C6LA 1K1DA 2OWWA 4ATWA 3ENLA 3GUWA 2QVNA 3PNZA 3P80A 3C2RA 2H3DA 3KWSA 1QWGA 2EPOA 4F0HA 4O15A 2FB2A 5EYWA 4PRTA 3FGCB 2YOCA 1V6UA 2GJXA 3W1LA 1MZHA 3AU6A 4IXHA 3PR2A 3NL2A 3KZSA 3UNTA 1G69A 1EDTA 3EDKA 4QISA 3NVDA 3BG9A 3T05A 4XO7A 1RY0A 3W6YA 4LCRA 1R7OA 2YL5A 3KL3A 2YJQA 5I2UA 4B16A 4ZMGA 1H3GA 3M46A 2JEPA 2VCBA 4LB3A 4LVBA 3L0KA 1RHCA 2PDNA 3ZSSA 2DY3A 4DUOA 2W61A 1XIDA 3OO2A 2BY0A 2FQIA 3C4UA 3L67A 2TAAA 3MS8A 2O0TA 2J62A 4G56A 1IXQA 1HT6A 2NXGA 1SUXA 3DUGA 3ARVA 2V30A 5D32A 2J27A 2V81A 1VFSA 2X1SA 3QF0A 1E6QM 3TCSA 3LS9A 3G18A 3BXWA 4X60A 4WEVX 3H2CA 3WNKA 1TKKA 3W01A 1EIXA 1BXBA 2PWGA 1ZENA 4DI8A 2ATSA 2WJEA 2XVNA 4DVOA 1PZ3A 3OP2A 5B80A 1KTNA 6XIMA 2NWRA 3NXLA 3VCNA 3PAJA 1QNQA 4NXKA 1RBOB 2NQJA 1NSJA 1UUQA 5G4EA 1RR2A 1JGMA 3ZWSA 2QCFA 4XSLA 3W2UA 3R12A 1GVOA 2ESCA 2NQHA 4F9JA 3BLDA 2E7FA 4RE4A 4V28A 1ZJIA 2C71A 3B3DA 3ORWA 3NO5A 1VRXA 3LCWA 1MVYA 2AMXA 1Q6LA 1IXNA 4O10A 3O1NA 2WMKA 3GG1A 2J7CA 4F40A 3PSWA 3QRHA 4UTUA 1FX6A 3F4WA 4O28A 1Q6EA 3GDRA 1TTQA 1TIMA 3IVSA 4O0QA 3VX0A 1UWSA 3WQOA 2DSUA 3W7JA 4QE1A 4N9CA 1A80A 4C65A 2Z6JA 3AIQA 3VKBA 3S46A 3O07A 1MEWA 5T8GA 1HKVA 3G1VA 3ECQA 4AEOA 3GD6A 4Y8EA 5F4XA 2HK0A 3WFZA 5CJNA 1QNRA 1QNOA 5G4HC 2QCEA 3W7KA 4O14A 5GQBA 3H8AA 3WUEA 4WVXA 2UWFA 4GUIA 2O7QA 2R8WA 3EB3A 3LXCA 4KEVA 2WPBA 1E4LA 3D3AA 3MKKA 2J24A 3W1NA 4W7WA 4AVFA 5BWAA 4L9YA 4YHEA 3CIVA 4JX4A 3IGUA 3DFNA 5CBIA 3NNTA 4IMDA 4Q8VA 5HUOA 1XBVA 3E12A 4RCXA 4REQB 1JEZA 4BEQA 3OA5A 5HA7A 5FJUA 1WQ5A 4IICA 2O9TA 3RU6A 4C1NA 1UD3A 4RK8A 3S2MA 4Y8FA 1A0CA 1NTHA 1H60A 3UQNA 1AQMA 4PUDA 1UOZA 3W26A 4B5XA 4JDBA 2WZMA 3NFUA 5EFFA 2C6QA 1E6SM 1XLEA 3HG4A 5DX7A 2VHLA 5AHEA 5BROA 4P8XA 3W29A 2GVGA 2BWGA 3KW3A 2EGZA 1KFBA 3VOCA 5G5IA 1ODUA 5FL0A 1NAL1 1UH3A 3MYPA 3EKZA 3ZLGA 3KVJA 4XBSA 2PDHA 3GLCA 3WBWA 1UWQA 2R9RA 3NXFA 4PUNA 3S8HA 4GHRA 1ELSA 2DORA 4JTEA 3OG2A 1G9HA 3MBFA 3THCA 1GVIA 5K9XA 4UIOA 1H63A 3BANA 2VFEA 3BZJA 3IGHX 2NWSA 1BD0A 1K8CA 1VBUA 1JPKA 3NL5A 3VNJA 4G7EB 1Q7ZA 2HS6A 3AIRA 4MDPA 5IFTA 2Y4SA 3CAWA 4H9UA 1ONEA 3WY1A 1NWSA 1A3HA 3AS0A 2VWTA 3R2GA 3WJZA 2WC3A 2XFWA 3CZGA 2XH7A 4E38A 3KP0A 3PZOA 4M0XA 1B3ZA 2P53A 4BF7A 1I45A 1VD6A 1JCXA 3W38A 2AQOA 2WANA 4HYWA 2RGMA 4M5PA 4KETA 4CKQA 4YTSA 2EAWA 3CT2A 1DWAM 5HANA 3IEBA 3WUFA 3ITYA 4V1XA 2NW0A 1H50A 4GX8A 1FWRA 4ORMA 1UD2A 5FF4A 4S3BA 4JHOA 1Z44A 4JY8A 2JBMA 5BU6A 3UG5A 5I3DA 4MLRA 3ZT5A 1XS2A 1KTBA 1NQKA 1NH6A 1E4IA 1G7VA 3AHYA 3EWBX 3ABOA 1EDGA 3EOLA 4C1LA 1UR9A 3NQVA 4HGXA 7TIMA 1XH2A 1KW1A 1O5KA 1KLYA 3FKKA 1B54A 3NQ8A 3TW9A 3KTCA 2QULA 4D6IA 2PZ0A 1UR3M 3STPA 7TAAA 3BOLA 1RBAA 3W83A 2VJXA 1KKOA 3S1WA 4KF1A 3U5UA 2QCLA 4PZVA 3MSRA 2FDMA 5KZEA 1J4EA 3NOYA 4MY9A 1Q6DA 4L7ZA 4UQEA 1NF7A 4S3JA 1R2SA 2WHJA 3VFCA 3HJZA 3GZ3A 2V0TA 3GKAA 4GWEA 3EWYA 2ZZ1A 2QYGA 1DXFA 3NO1A 2BX7A 4N0RA 3QH2A 4M82A 3JZEA 4NVTA 2VDHA 4ZQRA 2X1UA 3HF3A 4V27A 3NQDA 1GOIA 2ISFA 1R9YA 1T96A 2XSXA 2WJZA 3S83A 1OC6A 4ZB5A 3MTWA 3I7SA 3WH8A 4IIHA 1CBGA 1WB0A 3EXSA 4A22A 1RH9A 4O50A 3URAA 3DHDA 3B0VC 1UH4A 3O6CA 1TV7A 1W31A 2VYOA 3LCHA 3UA4A 1AK5A 2HV5A 4W5ZA 5A6TC 5AVHA 3LM3A 2Q71A 5BXTA 4DZ5A 3WMBA 3TDFA 1OX4A 3PJWA 3KVKA 4GK8A 4O8RA 3SUUA 2OT0A 3ELFA 1H7WA 3POHA 1NDYA 1SJBA 3SCOA 3VM7A 3MKVA 4CN1A 4NAEB 2J8FA 1OX6A 3M0IA 3DIPA 4HA1A 5A8NA 3KUMA 1TE6A 3WH7A 3GG8A 1QU4A 1M5WA 2Q8ZA 3ABZA 1R7AA 3TLLA 1XLBA 5J5RA 1TPEA 4R9XA 4FZIA 4ZOEA 1W3KA 1E3ZA 2NVDA 3EA1A 2JEQA 3WD0A 1D8WA 2BVTA 2A3BA 4HMEA 2B7OA 5KETA 5IDZA 2X0YA 1GOMA 1OC7A 3TFXA 4W87A 1EO5A 2FHFA 3F4CA 4GLEA 3WQ8A 4DI9A 8RUCA 2ZRXA 1ONRA 2PP3A 1P0BA 3BAKA 2FDSA 3EB4A 1V02A 2D73A 3CHVA 1AMYA 5TIMA 3T55A 5C55A 3UGRA 1BHGA 4FI4A 3CQHA 3ZVHA 3DYOA 1EO7A 3G24A 1E0VA 3WBXA 3ANUA 5IBXA 3BV7A 3V0TA 4WSHA 4F8XA 4H19A 4N42A 1M01A 4L4PA 1HKWA 3UWEA 1A49A 4QSHA 1EA9C 2RDUA 3WD3A 5LIKX 2ZFAA 4PEEA 5HWNA 3RNDA 1EC9A 4D1JA 1SZEA 4IISA 1AH0A 4QS6A 1HGWA 3BAJA 3QYSA 4WD0A 7ODCA 3M5YA 1J0KA 4MMWA 1E5JA 3KZPA 4ZTYA 2Z29A 4KFNA 4PTVA 3CLWA 1XYCA 7XIMA 3N34A 1A5SA 1AMKA 1RK5A 1UZ1A 1TPC1 3CL8A 2VX4A 4QJ5B 3VGHA 5GNYA 4D72A 2VZSA 3N1AA 3HGJA 3KLLA 2G97A 3MJYA 1H7NA 2Y61A 2Y63A 4X3ZA 1XFBA 1YIXA 2B7PA 1R38A 1PEZA 1A5CA 4PRWA 1RQBA 3RX3A 1CEOA 1W37A 4WGXA 1BPLB 2HK1A 3CPUA 2FFCA 4K8EA 1M1BA 1NELA 1AH4A 5CBJA 5C9XA 3RR1A 4D71A 2WQPA 3BW3A 3DG7A 1KBBA 2XFYA 1H4PA 3OB8A 1PKNA 4ADSA 1C8QA 2HEJA 4HN8A 2WLZA 1XRSA 1XPGA 4E4UA 1EUNA 2ATMA 2XIBA 3FGCA 3TA6A 1VIZA 3L2LA 3FYPA 5AN7A 3W1MA 2ANUA 4AZCB 5C9RA 1EZ2A 3S1UA 3LGDA 1ISVA 3V5CA 1ZGDA 2CC0A 3AIVA 3SRDA 1W1IE 1R3QA 1L2UA 4QIUA 4Z2HA 1QUMA 2F2KA 2PF0A 3CPRA 2PGEA 2WVUA 3QV9A 4MKSA 2NT1A 2R1MA 4P7RA 3SBFA 7PTDA 1XLAA 5EMKA 1E0XA 1WYIA 5IBXC 1JDDA 2CZDA 2GVEA 3L2MA 4YCOA 4XK2A 2F7FA 3WMCA 4XVEA 5JBEA 1JI2A 3A4JA 1DIDA 1TZZA 2VDIA 3CS2A 2HROA 4CD5A 1ME9A 4YIWA 3SQSA 2TRSA 1YTDA 1FKXA 4FHAA 3QZEA 6TIMA 2OQHA 1OIMA 3PUGA 4QJ3B 4YHGA 2PWUA 1GVSA 4RDZA 4I5RA 2OZ3A 2IUZA 3QTPA 1KWGA 3M1ZA 1IGWA 2E40A 3T1GA 1ISXA 3GIYA 3KBMA 4FR1A 1D7FA 5CZSA 1OCNA 3AU2A 2W27A 5I3JA 4H9VA 3WLTA 3AWOA 2XN1A 4IGMA 4MHBA 2NSXA 3WKZA 4Z1BA 1XYMA 2YW3A 2E0PA 3GR8A 3WQCA 3WDJA 1LWHA 5JMUA 2WMHA 3APYA 1SR9A 1FCUA 3LCGA 4KCTA 1TX2A 4MAZA 3LEPA 4KPLA 1TRDA 3TJXA 5D03A 4O17A 2UY5A 1DP0A 4UTJA 3W7RA 4NJJA 1E51A 3QR0A 5A8QA 3QV8A 3CH9A 1HL9A 4IPPA 1N2VA 4WQ6A 5DRIA 4Y9NA 3SUSA 2FZ9A 1VEMA 3L4UA 3NM1A 5DLCA 5G1TA 4PR4A 1XG4A 1B9BA 4XUGA 3NQAA 3SI9A 2J7EA 4DO4A 5G1MA 1F8MA 4RXGA 4J2MA 4U2ZA 4UR8A 4H8NA 2PWFA 2C3ZA 2XM1A 3HG3A 3N2XA 1JNDA 3ZLFA 3E0LA 4A21A 1FWGC 1ZCCA 1E70M 5I00A 4K1GA 2PU0A 4FLQA 3ID7A 3W7NA 3TOPA 2J7FA 4LW7A 3LB0A 1IZJA 1RQHA 1QPQA 4E8DA 3UD6A 3ZZ1A 3LZ5A 2FHCA 4ZVJA 2VTFA 1LORA 4NZFA 3G1RA 3JU2A 1CENA 3OIHA 2SFPA 4A2RA 3BUVA 7REQB 3AMLA 3AYVA 3QGAC 5BMXA 1E9ZB 3K2GA 1C90A 1CECA 1ONWA 2QMJA 1WO2A 2PDIA 5GJPA 2W0UA 1NDWA 5CBBA 1ZRQA 1WZMA 3H2MA 1JI1A 4JTGA 2PTDA 1NVMA 3N13A 5M2FX 3H4WA 5CGQA 2G96A 4LVDA 3V3WA 1FH8A 1A5UA 1UOKA 2VVNA 2WOQA 4KKXA 4KRTA 4JIQA 3PBMA 1MXDA 2ZRVA 3LGGA 2J7DA 2QDGA 3QY8A 4LPCA 2WSQA 2OLSA 2RJHA 3WF4A 5BRQA 1FVPA 2GYIA 1VBRA 3RCYA 3GC4A 2QJGA 3N15A 2ZC8A 3UWQA 3LPOA 4ZO8A 5IXEA 3VOHA 1MZRA 4P61A 2D2GA 1QJWA 2OKOA 4KWSA 4HA4A 2C1HA 4AX7A 3FOKA 1O6IA 4OUIA 3GTHA 3QZ6A 5CSSA 3TMLA 1ZJHA 1OBAA 1SQ7A 1GK8A 4RUBA 1DHPA 1NM9A 2W92A 3ZFHA 3PAOA 4UC5A 4QM1A 1VENA 2V8ZA 1W5OA 1TTIA 4KRZA 3G5EA 3GBDA 4J3ZA 2EPLX 3IJ7A 3C0LA 4GRSA 1MQPA 3V36A 1KKRA 2IXVA 3EDJA 1DJYA 4MDOA 2E3ZA 1V6YA 1MNZA 3T0CA 3KRSA 5A6JA 1R3YA 1JCMP 3ARQA 1A5KC 4UMBA 1XH0A 3VDGA 2WWCA 1LROA 1Y0EA 3IUDA 2RGLA 2AL2A 3GDMA 3UGVA 2ZZ5A 3RLGA 2E68A 3FNDA 3N19B 1J0JA 4H9XA 5GNZA 1PX8A 3N14A 3G1YA 2GQ9A 5FJJA 4IPIA 2B7NA 4AIUA 3RN6A 4C6PA 5D38A 1PKYA 2BHUA 5MKGB 3VGBA 1VLWA 1VFOA 1Q13A 1MW2A 1Z41A 3MJMA 1GYMA 2FZBA 3BAXA 1ME7A 3CL7A 4Q22A 1KV5A 4FNQA 3O3RA 1G5AA 3AMGA 1UKQA 4H6KA 3R0KA 3TJIA 2V67A 5IRPA 2W62A 2CNCA 5A3HA 4K3ZA 1QI2A 1KGXA 4IMAA 5HMDA 5CLWA 1ECQA 4WR3A 1EJXC 4J7RA 2Z7KA 1OCBA 4PBFA 3N4EA 1EGVA 4EVZA 1JZ8A 2JK2A 4DJDA 1M7JA 1TTJA 3OZYA 1VCVA 3I4KA 3I6TA 4L6DA 3VMOA 4JAWA 4Z1AA 4MYXA 2E1WA 2RAGA 1BSIA 4U33A 4JCLA 1LZOA 1O5XA 1N7KA 3VNDA 4S1FA 4IPLA 5U7SA 1QR7A 4UTIA 1XP3A 1CB7B 2V3FA 1YW1A 4WRHA 3WNPA 4DJDD 1I2PA 5LKYA 1PIFA 1TWWA 2JGQA 1UZ4A 1UWUA 2CHRA 2TODA 3UNDA 2A0NA 3SJNA 1FWCC 4PBEA 3WBAA 4FLRA 1DQWA 2CBIA 2J9ZA 2ZWYA 3WQEA 1T7LA 1U1HA 3VNLA 2G3IA 2H90A 4XKMA 3BMXA 4AC7C 3EA3A 4NAEA 5FF0A 5REQA 1RK6A 4BI5A 1PX4A 2XSAA 3NZQA 4DWDA 4FA3A 4PCNA 2J7BA 2JQXA 3T2QA 4GVHA 1H7RA 3AICA 5CZJA 1E9IA 4XISA 2PWEA 3G1XA 4JN8A 2V5BA 1D9EA 3W1AA 4H6EA 4PSPA 4RPQA 5A6MA 1J6PA 3WL1A 2NLYA 3OGSA 3S3GA 4UR9A 4OBTA 5G2WA 1EJSC 4AY8A 3ITVA 1O60A 3QJAA 4GY7A 4O18A 4W93A 1QW8A 3CASA 3H2NA 2O55A 2WNQA 3FW6A 3GW3A 5A6BD 3T07A 4EPKA 2WVVB 1BWLA 3EKLA 2ZA2A 2QUUA 2Z2AA 1HQTA 2FGBA 1MXGA 5HR6A 2V5LA 2PP0A 3SY5A 4DPPA 4F4RA 1OJXA 4DJDC 1TB3A 3EWZA 5D2XA 1FXPA 4DIAA 3T0BA 1IXOA 2J7GA 3TIMA 5DBTA 3LHUA 3BL3A 2OQLA 2PDWA 3VNMA 1RPKA 2C1GA 3USBA 1YHTA 2QJMA 3RO6A 4I9TA 1R9XA 4HHLA 1EJVC 1VHNA 3GY1A 1NU5A 3OVPA 1A5BA 1E6ZA 3CU2A 1TJ1A 4EXAA 1UR4A 3HZ3A 2ZRZA 4GCAA 1YTEA 5LXEA 4L56A 5CPSA 1SSGA 1KBLA 4NRSA 3USZA 4CCEA 2QW5A 1FWFC 1LG2A 2E6FA 4MF4A 4GY1A 1M7OA 4EOUA 2MUCA 2XGIA 2QNEA 4C7GA 4HZ7A 2KAUC 3IIXA 2F61A 1VFLA 3WK2A 4D1IA 3F7JA 3A3HA 3MBDA 4M1RA 2EF9A 1WOBA 1TX0A 2FYMA 2ZTKA 4LY4A 4XD6A 2GJLA 4MUZA 1TPUA 4AWEA 2CZFA 5T91A 4J2PA 3GIQA 4IIFA 3NCOA 3QLDA 1M68A 1Z32X 1QTWA 2INEA 1QAPA 5DMLA 2Y85A 4HNVA 1Q65A 3U2ZA 4UFLA 1GOOA 3O9NA 5HATA 3RIKA 4PRRA 4AD0A 2J78A 1MO0A 4Q3MA 4Q6XA 2B81A 4GG9A 3MSDA 3FA5A 2PDPA 3N73A 2NUWA 4IMFA 2R1KA 1JCYA 3EZ4A 1UC5A 3UJRA 2BBFA 2XTKA 1VEPA 3H54A 2V5DA 3HB9A 1E9LA 1SZGA 1LRNA 1QO2A 1F73A 3BMWA 2C91A 4KEZA 1JF6A 4BQ3A 4MKNA 5D37A 5K7JA 1C7TA 1V6TA 3N2BA 1E5NA 1MFUA 4NNBA 1MW1A 4XVDA 1V03A 4KWVA 4DM2A 2DZVA 2W79A 4YYCA 1RZMA 4IUGA 2QR6A 5AC6A 3SIZA 1VEOA 2AGTA 3W82A 1Z8AA 1JZ2A 4V1YA 3OVRA 5DANA 4WDXA 1X7IA 4F2UA 2JKAA 3V7PA 4U28A 5DY2A 5ABTA 5HR7A 3GO2A 3N6QA 1L6FA 2PDGA 3GE7A 2V6AA 3H53A 1BTMA 3BJFA 4ECLA 4GYFA 4XB3A 4B5SA 2WSPA 4A8IA 2QF7A 3GDTA 1J0HA 4GUFA 4GI9A 4AZ6A 4YS1A 3BK0A 3GU1A 1Q63A 1IT7A 1FA2A 2Q01A 2DIEA 4JTAA 3PG9A 4KWWA 1A0EA 4AEFA 1CW2A 1SFSA 5SWUA 3MWAA 1EA0A 1JQXA 3NZ1A 3MB9A 2Y1HA 2VEGA 3P62A 2FFIA 3AIBA 1EBHA 4GIAA 3QY7A 3UY7A 1QT1A 3PPFA 2QJJA 5HJLA 3PB0A 1SMAA 1MNSA 4LBSA 3CV6A 4TMCA 1LBLA 1EEPA 4NUWA 3WSUA 2IKHA 1LRTA 2GL5A 3SY8A 1XBZA 4JTTA 4O1FA 2H9AB 4LQ1A 1PE1A 1ICPA 1PV8A 2WMJA 4DELA 3R94A 3A21A 3W53A 1PHQA 3QYQA 1XISA 3CBWA 4GGHA 4UTTA 4WSJA 2I56A 3UXIA 1YDOA 3MU7A 5T9CE 4NJHA 3M6YA 3HPXA 1KRAC 3NA8A 2RDWA 2BHZA 2OWCA 2Y0FA 4Y90A 4X63A 4QG8A 5A2CA 4WXZA 2VENA 3HJEA 1ZZMA 3WJXA 4EANA 2YXXA 4WGHA 3F4VA 3ZO9A 2WZEA 4IXXA 4AD4A 3TVAA 1JYVA 3KBWA 3BE7A 3B06A 1GVEA 4HQVA 3WD2A 4LNCA 5FIPA 3F5JA 4IX0A 4H7CA 3AUJA 1YDVA 3CYJA 3N9RA 1MDRA 2C18A 2ZRUA 4AMCA 2WMFA 1FBAA 3NZGA 2HVNA 2WHMA 2OTDA 1J5SA 2VMFA 1B4EA 2BVWA 3ZIZA 3TYDA 1BWVA 1QCWA 1HJXA 2Y8VA 1T8QA 1BYDA 4GBUA 1EF2A 1GPWA 1U1JA 5T26A 3UYCA 3KOWA 4MJ4A 1FFQA 1IIGA 1DL3A 2GLKA 3QN3A 4XAZA 2HE8A 2Z7GA 4LJ3A 3PUDA 4E4PA 3PHAA 3F2CA 1LYXA 5HINA 3XIMA 4KS0A 1RA0A 2PDJA 4KIEA 3TTSA 3S42A 3GAKA 1MEHA 3K8MA 1WDPA 2GOUA 1PL9A 1JDEA 1M7XA 3H4XA 4CNPA 1S2WA 4CUCA 1R85A 3A5FA 5HJYA 5ABHA 4LYRA 1RBLA 4R85A 2H8XA 1JVNA 3QPEA 4V2XA 1P6WA 3PVFA 1XM3A 1GKPA 1PPIA 2YZRA 1UBPC 2A3CA 3ARSA 3WJYA 3O63A 4W89A 3TEVA 5KSWA 4JTUA 3UJSA 3SADA 4HCLA 1O5QA 1I2NA 2V5JA 4FEZA 4UTTC 2E9BA 1EHNA 4GNJA 3WF2A 1C9WA 3ZJ6A 3THDA 1NFBA 1IZKA 4DWSA 3CQ0A 4EK7A 3K4DA 3MPGA 3TR2A 3QM3A 1FH9A 1PWMA 2BMBA 5H8PA 2V68A 1UD8A 4P7OA 5CPNA 5DQPA 1TWDA 1NOFA 2E77A 3PK7A 3KL5A 4AIBA 4B4HA 2GOKA 3UP8A 4Q4RA 1IYXA 1IEVA 1PIIA 3B40A 4TX6A 2YBVA 5LNVA 3SQLA 3VE7A 3DHPA 4M3PA 3OGVA 3G1DA 2PBGA 2OCZA 4ZR8A 4CU7A 4F2TA 5LXXA 5FF2A 5TF0A 3ZYZA 1Q2SA 4MY8A 4DWSD 5D8ZA 2OKTA 1KWKA 1ECEA 3LD5A 2HXUA 2V69A 2WSKA 1KCLA 3EX4A 4J3UA 4ROPA 2OZ8A 2Y5EA 4XBKA 5M1TA 2A7NA 4GIYA 3VC5A 3W07A 3OQEA 3D0CA 3W1QA 1EJ7L 1VCGA 1BQGA 2QKFA 2WKLA 1B0IA 2OOFA 3ONBA 4GJIA 3M16A 4L1XA 2VGBA 1W1PA 1FY6A 3NYZA 5BYWA 1TPH1 4HNCA 4ZFMA 3VDAA 4UMCA 1DV7A 4NZ1A 1HXJA 2C79A 3B05A 3WJSA 3M0VA 1US0A 2QCDB 2UBPC 2R94A 1KFKA 4HKPA 3TTEA 1E9YB 4TUFA 1H5YA 4A3YA 3HO8A 3W7EA 5F2GA 1DWJM 3VZZA 3H2OA 5KTLA 3TU9A 3OJGA 5AHFA 3U48A 4KQNA 5CC7A 3VIJA 2BZNA 4OTKA 2DT3A 1NEYA 1VHCA 2BNJA 4QHRA 3KX6A 3NQFA 4IQJA 1G94A 4C91A 6XIAA 4MVAA 1JUKA 4R27A 4JICA 2OR2A 2QQ6A 2QV4A 1POJA 1RD6A 1E43A 2R91A 1X1ZA 1F3XA 3VIIA 4U31A 1D3GA 3ARYA 1TV8A 3C56A 3RCNA 1VJIA 2C0AA 7CGTA 3W7CA 1OGBA 1J79A 2OLAA 1U5VA 1HKMA 3EB2A 5ABFA 2J8GA 2VDGA 3MUZ1 3N04A 4DWSC 4M6QA 4JNZA 1XGDA 4YTRA 4I3GA 4W86A 2QCMA 1FWSA 3IS4A 4OFCA 1NOUA 3C5QA 1R5YA 3GKFA 3UZJA 2E8YA 4C5YA 3O05A 3KTXA 1UZHA 1X6NA 2W66A 1R86A 3HV9A 1HJVA 4PUJA 1PCKA 5LHFA 1GW9A 2C15A 2RFGA 2DZUA 4N4QA 3PBVA 3L5MA 1L2QA 3PFMA 2PTZA 3CAVA 1TIWA 4ORIA 2NQ9A 3H6OA 4HK5A 1FTXA 4ZZ9A 1K6WA 2C0HA 2VFHA 2ZE3A 4U5KA 3TAOA 3MUY1 4HMCA 1ALDA 1TMHA 2PC8A 2ZXDA 5AB3A 2WVVA 1P7TA 3CAQA 4FXJA 5LIWX 1BGGA 4DYJA 4UTFA 2E9LA 4Q4QA 5J5DA 1SM9A 1GQKA 2XIJA 3T09A 2WHLA 1EP3A 2DVTA 1EPVA 2YLAA 1WKYA 1GONA 1HJSA 3UG4A 3DC0A 3LYEA 4HYVA 1E73M 2QCGA 3LHTA 3N2MA 1MWOA 4CD8A 2PDFA 3C2FA 3AZRA 1FQ0A 3II1A 5TAOA 2XM2A 3CUFA 3V35A 1EDQA 2PWVA 2NX3A 3PWIA 4B9ZA 3TNBA 2QEZA 2CZ5A 1THFD 1SO5A 1P0DA 3EAUA 2X0SA 4KCUA 2IKGA 1KCZA 1OF8A 3ZVIA 2J25A 1EH9A 1K02A 4B3LA 3LCIA 2NV9A 2J74A 3WLJA 1RQEA 3PZVA 5FJIA 4A6GA 1SO4A 2R1LA 3Q2DA 3EWWA 3R11A 2PS2A 1CXKA 3RILA 2G3JA 4CD7A 4S3CA 4L6OA 4UTHA 1Q6FA 4E2OA 1YXCA 5DEZA 4CCCA 1XDLA 2OXNA 1JG9A 4M7SA 2G3FA 3CHEA 3N6JA 1CGVA 1SMDA 5CPQA 2ZZ4A 1W1YA 2V63A 3CQJA 3MCNA 3E0IA 3WF3A 4ATLA 2IPGA 4GE8A 4IL2A 4CNTA 4QQUA 3UA3A 1EJRC 3NDZA 5BOFA 4QE4A 5BOEA 3NZPA 3M0HA 4JKKA 2GQAA 1CGTA 2P8CA 1O1ZA 4M56A 1L6SA 2HS8A 2DPEA 3PULA 2OO0A 5FEPA 3COTA 4GVFA 1TSIA 3QKZA 4GQQA 2BVDA 4LAUA 3PFRA 1TE1A 3I7RA 5EU9A 4Y96A 2W3ZA 5E6ZA 4AZ7A 5HXMA 2DQXA 2G50A 3B8VA 3FA4A 1HO1A 1W3LA 2WCGA 3RYSA 1BFNA 3GFXA 1H51A 4BCEA 4DHGA 2CLHA 1DJQA 5TD4A 4XZMX 1TPWA 1OX5A 1DWHM 2Z26A 2GK1B 1P1XA 2H8ZA 1QWKA 4A8RA 3S1VA 2YX0A 1WKFA 3DOPA 1E1CA 5IDIA 1I1WA 3WENA 3CO8A 1TA3B 3TP4A 3TQKA 3RFAA 2WHKA 4Y2WA 2DVXA 4NF7A 1GW1A 2IQ0A 4WZHA 2VO5A 4P8VA 1BLIA 3NDOA 4GYPA 5D9NA 3ITGA 2BP1A 1P0KA 1BYBA 3GXTA 1BSLA 1UJQA 4DXXA 3JVAA 3CIWA 4H41A 2WLYA 3W7IA 2V38A 3IVUA 4IF2A 3LPFA 1CZ1A 5C6MA 1JAKA 2D2JA 3R13A 3GRIA 3B9EA 3FJ6A 3SN0A 1PTAA 2E28A 2W9MA 3GNNA 2GGGA 1Z42A 1E1FA 4AFYA 2EJAA 1E72M 3B03A 3W71A 5C2XA 3N9SA 2XIMA 3ZR5A 3A6OA 3SZ8A 2Y7EA 1N8IA 4W85A 3WQWA 4MWAB 2VNCA 3KDOA 2WBKA 4FOJA 4LVGA 2Z28A 1A5MC 3N2CA 3N29A 1OYBA 4JBRA 4AAJA 3GHUA 5FSDC 5JH2A 2UV8G 4XKYB 3IJDA 3IIPA 3E74A 4IIGA 3VK5A 1HP5A 1O66A 2DIKA 1PS9A 4MLJA 3JS3A 4TV6A 1UKTA 4TTUA 3FYOA 2ZX8A 1VFFA 3LCXA 1LBMA 1OT2A 3ZJ7A 1XG3A 1GYLA 2VL4A 3XINA 3BAYA 3A47A 4NI3A 1DTUA 5A8MA 5DY3A 4OZOA 1A4MA 1CX9A 3VTRA 1W3TA 3SSZA 3TWBA 3OBEA 4HZ8A 2PTXA 2YDQA 3U7VA 3TONA 3PJUA 4N6EA 1CPUA 3P7YA 1JYWA 1Q4WA 2AQVA 4LYKA 3TQPA 4K7YA 2PEVA 1OZQA 3HFYA 3SO7A 2A2IA 2OX4A 3S47A 3BLKA 4GYPC 2WBGA 4GO9A 1B3YA 3TC6A 1HTIA 3M5VA 2ZYFA 2F2HA 4FNTA 3W2JA 3EWDA 4R3UA 4PTMA 3GZAA 5FEZA 2WMGA 4UUIA 2D24A 3OVQA 1XRTA 3PY2A 1BGAA 3S5NA 1XQLA 3EMQA 4H83A 2NUXA 4PTXA 4IM4A 2ISDA 4UCGA 5KZDA 3KRBA 1KFLA 1KBJA 4OQVA 4AVOA 4A29A 4I6KA 4Q8WA 4XZHA 4XUYA 4I7UA 2P8BA 1G4EA 2VQTA 1UQYA 5HQEA 3IV3A 3E2RA 2EPNA 3CJPA 3A4AA 4GZIA 1P6BA 3C2YA 1KGUA 4HPHA 2J75A 4HOZA 4OJYA 3MP5A 2GFTA 3BTNA 1YTKA 4YTTA 4MFEA 2GWNA 3SUTA 1XFCA 3G77A 3H21A 3P5YA 2CETA 4RNJA 1F3WA 5HWMA 5JBFA 2VC6A 1RPXA 3DX5A 2XZ9A 4KH2A 1W1A1 3QW3A 1QI0A 1OYCA 3O6YX 3GB6A 3SM0A 4PL1A 2YCIX 1UP3A 1FP9A 3AIEA 4ZBCA 4CVWA 3KTSA 2PDLA 4GKLA 3SUVA 4FIRA 2BXVA 3MP4A 1OM0A 2ZBTA 3NURA 4IIEA 2QUVA 1ADDA 1WPCA 1RLDA 1DJGA 3W24A 1GQLA 3AMKA 3FXGA 5DO8A 5C9WA 1CXHA 4LAKA 3GH4A 4TX9A 5DCBA 1XIBA 1QDSA 3VOGA 1DPMA 1ZS2A 2HPMA 3QZAA 3ATYA 4FXSA 5CZKA 2EPKX 4C90A 2D69A 3VE9A 1CDGA 2YKKA 2D2HA 3C0QA 2QJHA 3WLSA 4L65A 4BF5A 3LHYA 3NVTA 1MI3A 5I77A 3ZT6A 4C60A 1UD5A 4U10A 1GT8A 1E4NA 1U5JA 3IJ6A 5AHNA 1I6NA 4FR6A 2QCDA 5I5RA 1X1NA 1X1OA 4J1OA 4QGCA 3YPIA 1DJWA 4KRUA 5F1UA 1CLXA 3NSXA 2XU2A 1TREA 1Y8BA 1DTNA 1XC6A 2XIQA 3EEGA 1TUFA 3NL3A 3OGRA 4D6HA 5I0DA 1XGEA 4NXSA 4JEJA 2A6NA 1PZ1A 3PWGA 5EA9A 1EOKA 1C8XA 3TW7A 4XTIA 2YA1A 3TYAA 1O1HA 4OKDA 1GYNA 4S2CA 1R0MA 3URQA 3VGFA 1IXPA 4MPKA 1KXHA 3R6IA 3W87A 5H6HA 2OWXA 3K8KA 3T7VA 3QMSA 1ICQA 3EYPA 5JUVA 1ZJAA 3L23A 3T40A 2VX5A 3OOQA 4GIEA 3PZUA 2EKCA 5BCAA 4L4MA 3NQMA 1WCGA 1Z69A 3NOEA 2VWSA 1W5NA 1W32A 1E6RA 3AXKA 2QZRA 4DZIA 3DGRA 4AZHA 4ZE5A 4HSOA 4NIRA 1B3WA 1BRLB 3OIXA 5CGMA 1G0CA 2YYTA 3UEQA 4DJFA 4RX0A 3UVAA 6A3HA 3PN8A 4NNAA 4RPPA 4CQBA 3ZR6A 4DM1A 4B3ZA 4F0MA 5GJMA 2D2OA 2XIOA 4PCTA 6ENLA 1C29A 4C1NB 3SFWA 1VS1A 3ANVA 2Y8KA 3H55A 2PUZA 3KVMA 3F03K 3U4FA 3AYTA 3W02A 3W70A 3N3TA 2BXZA 4DJFD 1FWJC 5CZ0A 5XIAA 1C91A 4MNKA 2CU0A 3O15A 5I23A 1MRQA 1AD1A 1GEQA 1Q3NA 4ADTA 2ASHA 3PZGA 2GGEA 3SB0A 2FPYA 1ZAIA 4Q4MA 5I3IA 3V5FA 2CLPA 5MF5A 4HMNA 3T4CA 4M81A 3G3MA 3LXAA 4PGLA 3KOXA 3W73A 3EBVA 1W56A 3CUGA 4C6OA 2F9RA 3NEVA 1NP2A 4WY0A 4X61A 3OLGA 2ZCGA 4ZQMA 4CD4A 1HL2A 2QV5A 1UQZA 3GH5A 4RL3A 2Y5JA 2I5GA 5I02A 4FX6M 4PBGA 3MCMA 1F2JA 2E4TA 2I17A 1ML1A 3QVQA 1JZ5A 1IEWA 4DO7A 2FZDA 1S38A 3NQ2A 3RGTA 2WKJA 2YDSA 2E6DA 3I4EA 1MYRA 2XYLA 3IIOA 1ZBVA 3KHDA 1FWIC 1BTCA 4R9OA 3FLUA 1LL7A 4L61A 2ZXAA 3TQVA 4I9JA 1KCKA 4JIIX 1RALA 1AH3A 3MZ2A 1RA5A 2XPKA 5PTDA 4DJFC 2A6LA 1GJUA 3DFOA 2HZGA 4IP7A 3KBJA 2WM1A 3PPHA 3WEOA 1E4MM 1FHDA 5F2MA 2ZZ2A 3DGBA 3BOFA 2JIEA 1TWIA 4XO6A 5IFPA 3MMTA 3GXDA 4JFVA 4N9BA 3PG8A 3VD4A 2E5CA 3WQDA 3LG3A 2FIQA 1V8EA 3PPCA 3UCDA 3UR2A 1BXCA 4IIBA 3A22A 3PBYA 4G6CA 5IOBA 3NJ3A 1T6MA 1QHOA 2PLCA 2J8TA 2NX1A 3GC2A 2OB3A 1L9WA 1RY8A 4R5EA 2A7PA 4LGXA 1VF8A 1VRDA 4JIRA 5HOSA 4LCQA 2BGQA 4S3KA 3S5ZA 2XVGA 2XSBA 4IQDA 3ZQ9A 1K03A 5G1YA 1I1XA 4UXDA 4GZ7A 3CWOX 1LG1A 1B1YA 1XCXA 3TC7A 4YWSA 4FOUA 3EGJA 4LXFA 3P0XA 2WWDA 3SIMA 3G0SA 4O19A 1LRQA 1KB3A 1J01A 4PB3A 2X42A 5I78A 3FAWA 3B0XA 2CERA 4H1ZA 5HAOA 3WQ4A 5JH1A 4F0LA 1Q6GA 2D22A 5E5CA 4RDVA 1QPRA 5CC5A 1X98A 2J7HA 4IL0A 1XXXA 1CGYA 4MM1A 3C2OA 2G0WA 3W1RA 4JKMA 1WZLA 3RDKA 4H9YA 2ZWZA 4AY7A 1JZ7A 1PYMA 3NQ7A 1OX4B 1TR1A 3R4IA 2G4JA 4KGLA 1EJTC 3LCLA 2RDXA 2NV2A 4LVAA 4TIMA 2PTWA 4L4OA 3PBUA 1DIKA 3BJTA 2ZVRA 4PE8A 1VBHA 1FWTA 4O16A 2ZDRA 3UPWA 3PSVA 5D9MA 3T42A 3M43A 3ARZA 3SCSA 2C16A 4LYPA 2ZRYA 4XIMA 3ANYA 4XKYA 5EFDA 4HYRA 1TPVA 4CU6A 4HJFA 4ZB2A 4P8WA 1UR1A 4EAMA 1NOWA 3BW4A 4A35A 2WAGA 1I9CB 4Z2GA 3QFWA 1FWBC 1SJCA 1V7YA 4UTWA 4QG9A 4GO8A 1TG7A 3KBSA 1SZFA 3TN5A 4LNYA 3GBEA 1HZYA 3BGGA 3MI3A 4EP8C 4ASTA 2V3EA 5KZMA 2WCSA 2EXOA 4CLMA 4PTDA 2RDTA 5D30A 4HPJA 4PUKA 4FLOA 5KZ6A 1XRVA 3CB8A 2VC9A 3D47A 2JKEA 3FVDA 5AC8A 1XBXA 4MYAA 2IKIA 4RZBA 3AWNA 3TYEA 3NDYA 4CEXC 1RD5A 1VJZA 4LUJA 1CB2A 3MVTA 3PANA 4OECA 1XKJA 3NGJA 2Z25A 3IV8A 2WZTA 4HHPA 3WF0A 1CXEA 3VVGA 4GCXA 4ZCWA 3BURA 4DBSA 2ALDA 1AW2A 1KM0A 1QW7A 3CTTA 2XFFA 3QQ1A 1EPXA 2XZ7A 3FY1A 2VEFA 2XVKA 2XWEA 3OHMB 4TTGA 2E8ZA 2CHNA 4HK7A 5G2IA 3AXXA 1KGWA 2DUZA 4YVXA 1TJ0A 2POZA 3RG6A 2G8ZA 4J5NA 5K3VA 4C6MA 4Q7BA 1K7XA 4FNSA 2CXGA 3QQWA 4K8GA 3GVWA 4P7QA 4FNUA 3UFYA 5CXPA 3GX9A 1JPMA 1V79A 2OEKA 4N9EA 2X1TA 1PHWA 1LOSA 4NG3A 3OVGA 5E09A 3C2EA 2V5CA 3PZIA 1JPIA 1W3NA 4HZMA 3E5BA 3BDKA 3UCQA 1ZJBA 2V9DA 4JTRA 5L6UA 4UTWC 3DFQA 2EO7A 3WZ0E 3E1F1 2YFOA 1XWYA 3EPNA 5MHBA 2AKMA 3G8EA 2DJXA 4O11A 4IH3A 3WQVA 1KNWA 3S6OA 2D20A 1OFQA 2WYSA 4OV4A 3VOJA 3LQGA 4WJEA 1V51A 1T5AA 4FB7A 4IGNA 4MFDA 4RJEA 1TVLA 3T0AA 1RVKA 4XBJA 3K30A 3N2OA 4ZL1A 4LAMA 2X2GA 1E15A 5D04C 3P0WA 2FVKA 3AHZA 3W22A 4L9ZA 1J8VA 4QFUA 3XISA 1HKKA 3LBMA 1K3UA 3CZEA 2I1OA 4US6A 1AQHA 3H2FA 4JTHA 4AD3A 2PLKA 3LHWA 1UG6A 3HG5A 3GDKA 3CC1A 5I06A 3FSUA 4NZ4A 2YGYA 5I3HA 2Y24A 5CZTA 2R1NA 1HKJA 2G4FA 4HCHA 4GH3A 4MG4A 4UCFA 3VOIA 3VNZA 3SECA 5ECVA 4J3TA 4AY1A 3VX1A 1H0GA 3P81A 2E6YA 2V2HA 4NU7A 2DW6A 2GSJA 3ISIX 3KXQA 4K6AA 4FF7A 4JX6A 1ZLPA 2BOFX 2Z1VA 4DY1A 1HL8A 4JTIA 3WQFA 1DE5A 3TV8A 5C7VA 2BY1A 1EUAA 4FALA 2R82A 3ITTA 5HPCA 3WF1A 4Q8UA 3V16A 2O4MA 3VGGA 1G7UA 4M24A 2WV8A 4BEUA 1WUFA 1JR1A 1AZ2A 1Y5XA 3N4FA 1W91A 1OVDA 4Q8NA 4JCMA 3WK3A 4DNHA 3AS1A 2VZVA 1Q4NX 3H7UA 3W7OA 4XX6A 1XYFA 1JDCA 3GG0A 2VELA 4DJEA 4N4PA 1TQXA 1FCBA 1AL7A 1P6CA 5CG0A 3G22A 4L1WA 1LUCB 3LK6A 3M0MA 3DKJA 4PFMA 3G1FA 2GDVA 3KEHA 1PUDA 1BRLA 3GDLA 3WN6A 3V1PA 2PODA 4JHZA 1CLVA 2ACSA 1V0MA 4K68A 5F4SA 2HPIA 4DJED 1WKEA 5A1AA 4RZ5A 2X2YA 4Q6JA 3LSCA 3LRKA 1M41A 3GNXA 1QI5A 1N82A 3P8JA 1IV8A 3LMYA 4WIWA 1WDWA 2KX9A 3O7UA 2P50A 4J28A 3PPGA 2G3MA 1B90A 3SCQA 3VD7A 4HNLA 1V3HA 1E6NA 4AZBA 2PDMA 4LBRA 3QV6A 4NL1A 4Q32A 4NZ5A 4X2RA 4HNUA 5HNUA 2YB4A 2CYGA 3JZUA 5FEWA 1FDYA 4GABA 4NYYA 3L5LA 2ZUSA 2D3NA 1KD0A 1FRBA 5I7GA 1JCNA 3FIGA 4B4FA 2IPFA 4K8HA 1KV8A 3BOXA 1EX5A 5CKSA 1EP1A 4HT3A 4ERAA 4FAMA 1PKLA 2W6RA 3VCCA 1SPQA 4H04A 3SUWA 4NHVA 5BRBA 1W9PA 3WDQA 2X0HA 1R3VA 4JL2A 1EIBA 3THQA 4KCWA 3TN3A 4PL2A 3BGAA 4KFOA 4AISA 2ZVIA 2D0GA 5D8WA 1G4PA 1F05A 1LF1A 1EP2A 4JFWA 1O95A 1D8CA 4LH8A 4EWND 1W17A 2BOEX 1M03A 1SU5A 4JNMA 3T81A 2FZ8A 1EGMA 1DBTA 1NWTA 2JE8A 2Z2BA 1E0TA 2WZHA 4DJEC 3RMJA 3B9NA 1YXDA 3FEMA 3JRKA 4Z2KA 5DXXA 4AZGA 4H7VA 5HJXA 3IIVA 2QVHA 3WH6A 3TJ4A 1RSCA 1B30A 5D02A 4DF1A 4GMEA 1ZFJA 3E96A 3QHOA 2GGJA 1K9TA 1SZRA 4GGBA 3FX4A 4XZWA 2E1DA 4H8HA 1OB0A 1NF0A 5A2BA 2AL2B 3AO0A 3H24A 2TPSA 3PF3A 5A6KA 1GJPA 3ARXA 1S2CA 4LV4A 5D2TA 4FX7A 7ENLA 2QJNA 1OSEA 4CCDA 1NWRA 3WL0A 4K7VA 1H49A 1VPYA 5ABEA 3WNLA 1B4KA 5C9UA 4ZOCA 4GXMA 4ZO9A 4MJMA 2VQUA 4JN7A 4PA8A 1K8ZA 2HQAA 3R8RA 3FDGA 3IK4A 3APGA 3VIKA 1BYAA 1IWAA 2JF6A 4IJCA 3KOFA 2PPGA 4V33A 1PYFA 4XAYA 1G67A 1OC5A 3AC0A 3DDMA 3OG3A 5DBUA 5DELA 2Q8LA 4YL2A 3UVIA 2YL9A 3GWQA 3VKCA 5LZLA 4Q7IA 3M07A 1CIUA 4PCSA 4GKTA 5EMJA 3N6HA 4XAPA 1MUMA 2FVMA 3OQ8A 2XH0A 2JFEX 1XIFA 1ZL1A 1UP0A 3TZFA 4JZ5A 4AUBA 4I6VA 3DG6A 1R8LA 1RP9A 5ABGA 4QG6A 3LBCA 5EBUA 3E0FA 4IT1A 4O54A 3ARPA 3W7PA 3GM8A 4K37A 1SO3A 2CLMA 1Q66A 4NNCA 2ZUUA 3KOZA 4E0CA 1VYPX 3W84A 3IAPA 2NSOA 3TE9A 4UOQA 4MB5A 3BQ6A 4QEEA 2J13A 4W8BA 1A50A 4OUEA 1W9UA 1GOQA 3BLOA 3VIHA 3D3FA 4Q33A 4RDWA 4Z17A 5JQ9A 5REQB 2QPSA 3SY1A 1XLMA 3DBPA 1QXLA 2OVLA 1TVNA 1W0MA 3WBEA 3K8LA 3KS6A 4MNJA 3SDOA 4PB5A 4J3VA 3WLRA 3FEQA 1QBAA 1AFSA 1H09A 1D7KA 1YADA 4IZGA 5CQ1A 3NAVA 3ZLHA 4WOZA 1VYSX 1CGUA 4W7VA 1I60A 1QNPA 3LHZA 5I6SA 4IPNB 1JZ6A 3BLEA 4QSFA 2QAFA 1P0EA 4Z08A 9XIAA 1AJ2A 2QS8A 3R0UA 3C8NA 3W9ZA 1T41A 2R1PA 1L8NA 1U2YA 4C6CA 3GIPA 3LI1A 1ONXA 4BFAA 2Y62A 1TV2A 3VKDA 3P61A 1OHLA 4EF9A 1YPXA 1W5PA 3P6LA 2Q09A 1XIGA 1TRIA 4GJJA 4OBRA 1BQCA 1GG1A 1Q6QA 3BO9A 3FA3A 1YPFA 3N11A 2AKZA 3O6AA 3W25A 1N8WA 2CWXA 2P88A 1QOPA 5I3FA 4N7QA 4Q4OA 8XIMA 2E6AA 3S1GA 1T8XA 3OEXA 3DBNA 3W7MA 1O4UA 1JULA 3DFTA 5F4WA 4H8UA 3W74A 3HPZA 4IUOA 1GOWA 4JQ4A 3HQNA 2VGIA 3VM5A 2QCNA 3ABSA 3E49A 1YEYA 4I7WA 3UW6A 1XLIA 3IANA 3MT1A 1E3XA 1A5LC 3LRMA 3LY0A 3NR0A 1B3OA 2VP8A 2VZOA 2HNHA 2QIWA 2ZUTA 2F8QA 1LL6A 1KFWA 2W5FA 1LLZA 2QUNA 1ODZA 4JN6A 1IWPA 2DUXA 1R87A 1UD6A 2G95A 3HMJG 2RKXA 2CLOA 4JD4A 3UU0A 4S3FA 3WLOA 5E6YA 2J9XA 5XIMA 2UY4A 4M7TA 2YXGA 4HOWA 4R7JA 1K77A 1H1NA 1XUUA 4MNMA 2PA6A 2I7GA 1ISWA 1HG3A 1YBQA 3D46A 1GQNA 1LQAA 4HZ6A 4QITA 2XINA 4H3DA 1XSIA 1HJWA 4PUMA 4Q4KA 3HFTA 4PN2A 2J47A 4DX3A 4J27A 4GNVA 3LNPA 2DH2A 4HD5A 1Z9AA 3CHFA 2ISSA 3MYOA 3W81A 3A4WA 2ABBA 1YLVA 1YDYA 3MANA 1J11A 4D6FA 2PP1A 4M6PA 3GNOA 3WDRA 1LWIA 4KT2A 2E5BA 3SCPA 1EX1A 3G0UA 3VIMA 4ADUA 1WOAA 3CHDA 4D8AA 3IJLA 3NWRA 2EG8A 1QFEA 4QDWA 1S3HA 2WSRA 4NYUA 1S5WA 2OMAA 4HU3A 2ZUVA 1UMYA 1Q7QA 1KQZA 2V5KA 3UJ2A 1KCXA 1WXJA 3VZXA 3H26A 3TKFA 3MC5A 5L9FA 3QMTA 1K9DA 1VPQA 3CZKA 1S2UA 4S3GA 4C6QA 3TOYA 3S4TA 1OEPA 3UYIA 2ON3A 2W67A 3U57A 3KHJA 4HOXA 4H2HA 4WXYA 2PRHA 3VINA 3UWZA 5H1WA 5U4NA 4XZNX 3MV01 1TYGA 3AXHA 1TCMA 3M0XA 1K8XA 4IG2A 1JZ4A 2VR2A 3Q94A 3LTYA 3UF9A 3BH4A 4GIRA 2ADAA 4B9YA 5A2AA 3TAKA 3I3EA 1R2TA 3EX1A 2BODX 2CW6A 3ARRA 1UASA 3FDKA 3OTRA 1V93A 5CCZA 2P0OA 4G1NA 2QGYA 1JF5A 4HB7A 2DIJA 1EYWA 3UPBA 3E38A 1X6LA 2I5IA 4ERIA 4AMAA 4LS1A 4JYFA 1HF6A 2GJNA 2WCAA 3AI0A 4NZ3A 4KMQA 3U3HA 4YXGA 3RJXA 3B8WA 4H7ZA 1RJPA 1SW7A 4HP5A 4JIHA 3Q37A 3IARA 4FX8A 1DXIA 4XSMA 3OW1A 4D8LA 3AALA 3BLPX 4HNOA 5JIPA 1WDDA 1G1YA 1I75A 2Q3RA 4UFMA 3H2EA 3QOKA 1OQFA 3TA9A 1OGGA 3NPXA 3GW0A 3B8DA 3B8UA 3CTLA 1HFBA 1Q5MA 2INZA 1PTDA 3HOJA 3SAZA 1XIHA 1LUCA 4OOZA 3WMSA 4W88A 3BCFA 3TSMA 1L0PA 3EPOA 1NDVA 1V0NA 1RVGA 2HE5A 3LM7A 3LPGA 1TJPA 3VFLA 2QUMA 5DT7A 1XCWA 4LX4A 4RE3A 4K38A 1EQPA 1EWDA 2E25A 3IPWA 1CNVA 3SR7A 2PMQA 4PMYA 3BICA 3DEQA 4M29A 1OT1A 4GISA 3TYBA 3R25A 3OBKA 2PU1A 2O4QA 3QTGA 5BXRA 5D33A 5FAJA 3PJTA 3V4BA 2OGJA 3BAWA 6REQA 2CESA 3SW6A 2GQ3A 3KP1A 3LI0A 3S1XA 2BS9A 4HU0A 3RJYA 2P76A 4NRRA 1VFUA 3FAXA 4WCJA 3I7QA 3BW2A 3QGKC 1WNOA 4GVIA 1S39A 4GYKA 2GJRA 2GGHA 2WKGA 1H62A 3BZGA 3LNMA 3NPUA 1U83A 5FL1A 1LQ0A 1VLIA 1Y5WA 1LP6A 5H8MA 4XIAA 1H0IA 4J35A 4LFYA 2QXWA 4K1WA 1AJ0A 1UWIA 4C6FA 4JQ3A 2FHBA 1FXQA 1UMLA 2PSNA 4O12A 5M03A 3GDBA 2NV1A 2EBNA 3DXIA 3GU9A 2OSXA 3S5YA 4JR5A 4J9JA 3FHAA 3FV9A 5FJTA 1KQYA 2VD8A 4J4KA 3S6TA 2CKSA 3FS2A 2Z24A 4JTSA 3G1HA 4BJHA 1UA3A 4UR7A 4IPJA 3PS7A 3FHQA 1W9VA 2ZUMA 5AOUA 2AL1A 1ITQA 2WO5A 2OYKA 2VGFA 2J4GA 1BYCA 3WK0A 4HHHA 1WKDA 2A1YA 4RV8A 2B4GA 3HQOA 2Y2WA 4DWSB 3NQGA 3TC3A 3W0KA 3W6LA 4BI7A 5HPOA 1X6UA 3WEZA 5E9AA 4LC6A 2W63A 1OFDA 3HPSA 3W23A 4BI6A 2CLKA 4J40A 1GUVA 4ICCX 4MNLA 1EQCA 2WQDA 2YCLA 1I0DA 2YBUA 3SCTA 1DJXA 2YB1A 1UPPA 1ZUAX 1QPOA 2HCVA 1UIOA 1XLHA 1RV8A 3HA1A 5EY5A 4DYKA 4MTVA 2HISA 1TWSA 4GXWA 3EMCA 5AC7A 2Z27A 1EL3A 1RJQA 1FP8A 3A24A 4O1DA 3P82A 1RCOB 1EGZA 2VC7A 4MZYA 3CZLA 4LRSA 4AW7A 2Y7GA 1H11A 3Q67A 2X1RA 4HJWA 1MDLA 5T9BG 3WLKX 3WQ6A 2IQDA 4DYEA 3WD1A 5LGZA 4Y9PA 2QCCA 1HJQA 1XICA 3SCVA 1GVYA 1FOBA 1PTGA 4UFHA 2Y70A 2DEPA 1XIIA 2QPXA 4N9DA 3SSJA 3V0SA 3W76A 4S39A 1DJHA 2CCRA 4LUTB 5DMNA 1B3XA 5AYBA 3M0LA 3MW7A 3A9BA 3DERA 2VUYA 2EPMX 3CWNA 1PDZA 3U9IA 2DZAA 2MANA 3EWXA 4H2CA 3W2MA 1IIHA 3TUUA 1CXIA 1M6JA 2YL8A 1PVNA 2I9EA 2Z0IA 3NIYA 4AHOA 1IGSA 3GUGA 2DH3A 3QC0A 4B5TA 1GGOA 2F6KA 1FCQA 3P3BA 3VO0A 3F5LA 4GUHA 2GDUA 4CNSA 1S5TA 4IFKA 1PWLA 5LA1A 4LANA 4JYEA 4PMQA 3UR5A 2ZZ7A 4MSSA 4JDYA 2F6UA 2PDXA 4MAVA 2PI6A 4Y9AA 5ABFB 2CWNA 2PRMA 3BCJA 4QAWA 4E8CA 1U30A 3VD3A 3K4WA 3LXBA 4DB7A 5D4YA 1EJWC 3VKJA 2PCEA 2D0FA 2TYSA 3TX9A 5EB8A 1JD7A 1XYLA 4R34A 1LBFA 3GXIA 1QHPA 4MKVA 1XKYA 1QATA 1BWKA 1JPHA 1CGWA 2ZUWA 3QHMA 2VFDA 2DV0A 3UXLA 2VOMA 4LC8A 1FHUA 3OZOA 4LRTA 1EOMA 1DQXA 2WVTA 4HPNA 2FB3A 3VZYA 2P10A 3M6DA 2JGYA 2WNWA 3IUIA 4LAOA 2UZ9A 5HQLA 5CC3A 4PCPA 4Q8OA 5AYZA 4DEFA 1JNEA 5AECA 2YA2A 4GY0A 4EXQA 2C13A 3CQIA 3M41A 1P7TB 2J6VA 3M7WA 3K5XA 4O8AA 5JU6A 3G6MA 5E93A 3QR3A 4EKJA 2PDCA 4G5DA 3PUEA 3N25A 3PZNA 1XSKA 4WDTA 5HQMA 2YBTA 3HURA 5I79A 3MMWA 2QJIA 1BXNA 5C7HA 4UMAA 3MHGA 2QDDA 5C0QA 3S2LA 5HUPA 3GAYA 4ZSTA 2A3EA 3OODA 4MY1A 4LS2A 5LNUA 1KFJA 3WDIA 3FJNA 4LEQA 1XLKA 4AYSA 4U3CA 2XH4A 4DZAA 4LUIA 4ZXOA 9CGTA 1VCFA 4QDPA 3EX6A 2FLIA 3MI6A 4JTCA 2PLMA 2VEIA 2OGYA 2ICSA 5EPDA 3ITXA 1I2RA 2ZADA 3QQ0A 4MZ8A 1RP8A 1LCOA 3O16A 3FKRA 1W6TA 5D2WA 3UXAA 4HN4A 1TQJA 1LDCA 2PCQA 2B0MA 1UW9A 5FF7A 3W27A 2GWGA 1QRQA 2HBXA 2NT0A 4J3WA 2TMDA 1KXQA 2FTYA 2NX9A 4F9DA 3ZT7A 2G5WA 3LGEA 4GQGA 3WELA 1YNQA 2YZ5A 1US3A 3UJEA 4DBUA 8CGTA 1AG1O 5M5DA 1GZGA 4GJ1A 1MQRA 3C2VA 3AROA 3H2AA 5DXYA 1Z48A 1N55A 4Z1DA 3SRHA 3B8IA 3LSBA 2ZC1A 3W88A 4PMDA 3C0JA 3RLVA 4ZOBA 3B97A 1IWBA 4JY9A 4EPEC 2BHYA 1IEXA 1IEQA 2J66A 2OSWA 1YRRA 4UQ9A 2WM0A 1P4CA 3VDHA 3L68A 4O1BA 4JQAA 1NARA 3CMFA 3CUIA 2A3HA 3CMGA 4HSHA 1E1CB 3BLLA 3M5ZA 2EHHA 1DJIA 4IQLA 1LOQA 2FPVA 4W4QA 1MEIA 1F76A 2GSEA 1XQKA 2X7WA 1F6KA 3HM7A 1KA9F 4YLWA 1BF6A 5CEWA 2A4AA 4RLIA 2DP3A 1XLCA 1JAEA 3G0XA 1PIGA 4UTMA 3KLKA 1W1VA 3GNPA 3LLXA 4UTLA 3PZTA 4FPSA 4WUIA 4JTDA 4YVPA 3NEHA 3WDHA 4AD5A 3WUBA 5AHLA 3VD9A 1HUVA 3SN1A 1C8VA 3PC0A 1XYBA 3K4AA 3KCJA 2R6OA 1ZQ5A 1T40A 1ITUA 4ALDA 3VU2A 3BLIA 2FZNA 3CYVA 3TCEA 1YPIA 1WAWA 2OJPA 2HRWA 1YQ2A 4F0RA 2JALA 3M9YA 1D2KA 2CKRA 1SW3A 3E6EA 2Z1XA 1P43A 1ADSA 3QFEA 3A3XA 1P1MA 2OO6A 3ARUA 4E6MA 1KLZA 3LLDA 6ALDA 1H1YA 4HA0A 1KR0A 3WMLA 1UUOA 5KINA 3GTNA 5I03A 2BB0A 1E6PA 2OELA 4FOKA 2ACRA 2FGLA 2OPJA 1S5MA 3N2TA 4CQ9A 4P8UA 4ACYA 2QMKA 3CEPA 2PGRA 1G4TA 3CUJA 3RO8A 1SR0A 3LUTA 2PZNA 4EPDC 4GQRA 3HU7A 1J0ZA 4QBXA 2XUCA 2ODOA 2VGGA 3L66A 3DN5A 2NQZA 1UKOA 2PGFA 3F4NA 3I6EA 1N8FA 2JF7A 5I09A 4KCVA 3LX9A 1CGXA 2CLIA 4AF0A 3FK4A 4L4LA 5DMYA 2OFJA 3HIJA 2PC4A 4GYJA 1O5RA 1TVPA 4RNFA 2VT0A 4B5VA 2BV9A 3DKLA 4KERA 3WH5A 4DUXA 3S9YA 4D6CA 2DT0A 1REQA 3WFLA 4JKLA 4UBPC 2QDEA 1LTDA 2OODA 4LALA 4AH7A 4IFRA 1WX0A 3A4XA 3VKKA 5KITA 4U4MA 1G6CA 2WK2A 2WNZA 2GUBA 1JRCA 4OBSA 3G1SA 3UCCA 3MWCA 5CGTA 1X97A 2J77A 5GVJA 4AZ5A 3ALGA 1SSDA 3BPWA 3FN9A 2OQYA 2O9RA 4MIMA 3RPMA 5DRCA 4CEUC 3MUCA 3A5VA 2BSLA 3W1PA 3CK5A 1QNSA 4H01A 3OLDA 3SRFA 5LA0A 3RRAA 3VOFA 4Z2IA 3T9PA 4C6EA 1Q6RA 4LYQA 4Q8TA 4A3UA 2ABAA 2PD9A 4Z2JA 1SZNA 3ZJ8A 1F3EA 2BLEA 1W1ZA 1R3SA 3PM6A 3HQPA 4PULA 3RXZA 5CPMA 2IQTA 5FACA 2B7QA 3MDUA 4AD2A 4I7VA 1LL4A 3K1GA 5C2CA 2VKZG 3OU8A 1W1B1 1PZ2A 5CG7A 1Z7AA 4AHPA 4ONVA 2I14A 4ZODA 1B57A 3UZWA 4DO5A 2E5DA 3FCPA 3MP3A 3BMVA 4UQBA 1P0NA 4GX9A 4Y9MA 2P5NA 1EC7A 2I5QA 2NLIA 1UPMB 3B9AA 3MQTA 3WEMA 3RPTA 3TFCA 4JTJA 2VZUA 3TYUA 3V5OA 2AMGA 3SEPA 3PZ9A 4AQLA 1FWAC 5C71A 1OG0A 5J04A 1XC4A 1ITXA 1Y7VA 4TQTA 4QR6A 3VIFA 5CH9A 4M1BA 3B0PA 2W4XA 2ZXBA 2PLJA 3VD5A 1JJKA 1MFVA 2XGBA 1JZ3A 1EBGA 4C6IA 3FXYA 1KC7A 4A3QA 4IHCA 5HDRA 3EX2A 3W7LA 2REQA 5BXSA 4C7DA 3AXIA 2HDJA 1W2PA 1H1ZA 3DENA 1FUYA 2HNEA 3P2VA 1EC8A 4DLMA 1RXOB 1UZDA 3V75A 4LBUA 1V3JA 1B3VA 2Z00A 1ZNNA 3CUHA 3NUKA 2BGSA 4AXNA 2D0HA 1BAGA 2ZX9A 1CI1A 3QPZA 4O0ZA 3NQEA 1HO4A 4GI4A 2IPJA 4FXRA 2CBVA 2XVLA 1GVFA 1WXZA 4LUTA 2YDAA 1CCWB 2Y6ZA 4BHYA 1DE6A 1XCFA 4H6RA 4NQ1A 1J96A 2Q02A 4PC8A 4DUVA 1W3IA 1EEXA 2FKPA 1YYAA 2VCAA 3AIWA 4XZIA 1LLWA 3RPDA 3W86A 4QQ3A 1UR2A 1KM3A 5A95A 2LLEA 3B4UA 2DZXA 4FSAA 1VYRA 2CHOA 3MUIA 4MB1A 1ZBKA 4UNKA 3REQA 3KBVA 5HNNA 3AAMA 1P48A 4PMOA 1POKA 5I3GA 1RCQA 3A3WA 3EEZA 2BTMA 4O0KA 1C7SA 1KBKA 3S2CA 1M9HA 5AHMA 1AD4A 1E0UA 3CWHA 4FMVA 4Z1YA 3UG8A 3GG7A 1JL8A 4C6BA 1MMFA 1EWEA 4XV0A 3Q45A 3KBNA 4E3VA 3EDFA 3N17A 4Z0SA 2Y5SA 4QDMA 2XVPA 1TTPA 1I8JA 3W4RA 2ZA1A 4GFIA 3ES8A 2CLFA 5I3KA 2OG9A 1ZBCA 1QVBA 5DCDA 1GTEA 4AZIA 3UZXA 4UFKA 1WBHA 1C92A 4PYSA 3RAOA 3SFKA 4GH1A 1X8FA 4A3HA 4A4AA 1KR1A 1V3LA 3KFTA 4HSNA 4TV5A 3RU8X 3C8FA 4ML9A 4IJRA 5A6LA 4MB4A 4YWIA 2Z1SA 4DAFA 3PWAA 3C61A 1TJRA 4HPGA 4LS0A 2ZXQA 1DQUA 1OABA 4AD1A 3T08A 2R14A 1IHIA 4N2YA 2R24A 5CAHA 2OZ0A 2O9OA 4Q7NA 1WDRA 3DFHA 2YLLA 3GK0A 1OFRA 4MPQA 3RR4A 2VC5A 5M17A 4Q4PA 4IWWA 3CO4A 4QEHA 4LUSB 4S23A 1MW0A 1JUBA 3IWPA 4GZEA 2Z1WA 4EXBA 4PB4A 2DT2A 1PBGA 5LIXX 3DI1A 4PMVA 3GYEA 3GNRA 3M47A 5DCEA 4BZYA 4XZBA 2I57A 2C8NA 2PDYA 3AHVA 4HMDA 3FJ4A 5CLTA 3BWWA 4OHQA 4PH6A 3PB2A 3QXBA 3EXRA 3DHUA 5AY7A 2WXDM 3GXNA 4WY0B 3MHFA 2DZBA 2GVLA 3LA4A 3URBA 1YXYA 3SCNA 5JBDA 3CM4A 3MMDA 3P5ZA 3R8GA 1K70A 4IP5A 2PFHA 2IS7A 3DECA 4KGJA 1QPKA 2PGWA 2V3GA 3LU2A 4U2YA 1K7FA 2YL6A 4LWWA 2XJ7A 2WMIB 1H41A 3LENA 4D6JA 3GHSA 4EAYA 3TW6A 1DWIM 3LLFA 4U3AA 3E2SA 4GUJA 5EL1A 1V3IA 1I2QA 4RW3A 1U1UA 3EA2A 2AQWA 5D09A 1H5VA 1XH1A 1BVWA 3QGVA 1S3TC 1XHGA 2PD5A 2VZTA 3PJXA 1S1RA 1KFEA 1SO6A 4NZJA 1JD9A 3VMNA 5E1QA 1JFHA 4R7WA 4C5ZA 1TV4A 4XQ6A 1QK0A 2F38A 4O4VA 1AVAA 2DJLA 5AHIA 1QPNA 5C9ZA 4DRSA 5EMMA 4S2BA 4WX2A 1XYAA 4RZ4A 3KVLA 3CZJA 4W84A 3S5SA 3VKAA 3ICJA 2XG9A 3M44A 4X9SA 3RF9A 1GNXA 2VFGA 3U2OA 4MOZA 5CSYA 2ZIDA 4H8VA 4P7LA 1WP6A 1Q6OA 4UQDA 3BQ5A 1E71M 3EWUA 6TAAA 4REQA 2YDRA 1E1EA 3EOOA 4CQ8A 1ISZA 4GNKB 1J2WA 1PXGA 3MMUA 1VFMA 1US2A 3QSTA 3VIPA 2ZX7A 4UQAA 3I3DA 3BARA 3AS2A 1F74A 1F5ZA 4OWGA 1KM1A 2IPWA 3FVMA 4CNNA 3KDNA 1IR1A 3LQLA 3OHIA 4WHBA 4LF2A 2OX1A 1GCYA 4KFPA 1TMQA 3ITCA 1EZWA 3M5XA 3WQGA 4LF1A 4F2BA 4C7FA 5AKQA 1K6AA 3VGDA 4D2JA 3GTXA 3FSTA 3QKEA 4ZSUA 4ZEPA 3MVIA 4QJ4B 4B2DA 3WLLA 1X8CA 1JDFA 4PUEA 4WKHA 2QGHA 3R8HA 3WK1A 4G7EA 3WLNA