3EB4A

Voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
327
Chain Sequence
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Cortisone dissociates the Shaker family K+ channels from their beta subunits.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, oxidoreductase
total genus 123
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3eb4A00
2HE5A 5HNTA 2PDXA 4JTQA 1JEZA 1AFSA 3EAUA 2INZA 4PRTA 3WBWA 4G5DA 2FZDA 3LEPA 5LIYX 4JQ3A 2R24A 1S1RA 4GACA 2ACRA 3MB9A 2F2KA 4IGSA 4GA8A 3GHRA 1RY0A 3LN3A 1X97A 4JQAA 5LIXX 4ZFCA 1YNQA 4WDUA 4FAMA 4FALA 1VBJA 1X98A 5KETA 4EXBA 4L1XA 4L1WA 4NKCA 1AH0A 1S1PA 3Q65A 4YU1A 3O3RA 3GHTA 3CAVA 5LIKX 2PF8A 3P2VA 2HV5A 2P5NA 4JTCA 3RX4A 1VP5A 2PDGA 1LQAA 1UR3M 3LBOA 3LNMA 4LB4A 2R9RA 2AGTA 3T42A 3UFYA 3RX3A 1FRBA 1QRQA 3UWEA 3CMFA 2ACQA 4PUUA 1AH4A 2IS7A 4JTAA 2PDFA 3ERPA 4YVXA 3CV7A 4JQ2A 3H4GA 2IKGA 2FGBA 1M9HA 5AZ1A 3RX2A 4QBXA 1YE6A 2IQDA 1X96A 4PMJA 3V0UA 3B3DA 4XK2A 2IPFA 2PDPA 2WZTA 3CV6A 3DN5A 5C7HA 5AZ0A 4LAUA 4XAPA 2F38A 3S3GA 4XO7A 4ICCX 5HNUA 4HBKA 1YNPA 2A79A 1Z8AA 3GHUA 4JIHA 1ZUAX 4WEVX 4JQ1A 4XZHA 4GIEA 1MI3A 4ASTA 2PDBA 1RALA 3H7RA 3GHSA 3QKZA 2FZBA 3V0TA 4DZ5A 4YVVA 4JIRA 3ONCA 4LBSA 4JIIX 3WCZA 2PDQA 3M64A 2IPWA 3O0KA 4YS1A 4XZLX 3G5EA 2HVOA 2DV0A 4FZIA 2IKIA 2HVNA 3BURA 1GVEA 3M4HA 4XZMX 3CASA 1PZ0A 2FZ9A 3R7MA 3LQGA 1IHIA 4XZIA 2BGSA 2J8TA 4EXAA 1C9WA 4WDXA 2ALRA 2PD5A 2PZNA 1PWLA 3KRBA 1EL3A 2FVLA 3LUTA 3Q67A 1MRQA 3GUGA 4IJRA 1A80A 3UP8A 2PDWA 4DBSA 2IPGA 3N2TA 2C91A 1R38A 2IPJA 2DUZA 3LZ3A 2ISFA 2PDNA 4GABA 4WDTA 1IEIA 1PWMA 3R43A 3M0IA 2NVCA 5JH2A 3N6QA 3UGRA 1K8CA 4JTDA 5JH1A 4GCAA 3COTA 3DOPA 4LAZA 2PDMA 4IJCA 4F40A 4GQ0A 4H7CA 5LIWX 4FA3A 4HMNA 2VDGA 4QXIA 3BV7A 2BGQA 3LD5A 1Q5MA 1HW6A 3UZZA 1PYFA 1S2AA 2INEA 3R94A 3FJNA 4OTKA 3C3UA 2PFHA 2PD9A 2IKHA 4XZNX 1YE4A 1XJBA 3LQLA 2HEJA 3UYIA 3H7UA 2NVDA 1Q13A 2IQ0A 2BP1A 4I5XA 4R9OA 2ACSA 4LBRA 4QR6A 3R8GA 3R8HA 3MC5A 3UZXA 1US0A 2ACUA 2PEVA 3BUVA 1RY8A 3VXGA 4GQGA 4RPQA 1T41A 1Z3NA 2PDJA 3V36A 2PDKA 3EB4A 1ZSXA 2FZ8A 2PDUA 4JTRA 4JQ4A 4QX4A 1ZGDA 1S2CA 1EKOA 3BCJA 1T40A 3LZ5A 2I17A 4WRHA 1Z9AA 1ADSA 3UZWA 2HE8A 4YVPA 3FX4A 4DBUA 3G1RA 4AUBA 4WDWA 4XVEA 2IKJA 4Q7BA 3D3FA 1AZ2A 3UZYA 1XF0A 2I16A 4LB3A 4PUWA 1QWKA 1AZ1A 3R58A 2WZMA 1SM9A 1EF3A 2CLPA 3V35A 5HA7A 2DUXA 1OG6A 3CAQA 4XVDA 5LIUX 1ZQ5A 2QXWA 3U2CA 4PR4A 4H8NA 4WGHA 4DBWA 1EXBA 1PZ1A 3LENA 2PDHA 1MZRA 3R6IA 4Q3MA 1AH3A 4MHBA 2PDLA 3EB3A 3ONBA 5M2FX 2PDCA 3WBYA 4PRRA 1Z89A 1LWIA 3WG6A 5DANA 2HDJA 3NTYA 3V0SA 1J96A 1XGDA 2PDYA 3UG8A 3F7JA 4XO6A 1HQTA 2PDIA 3WBXA
chains in the Genus database with same CATH superfamily
5BCAA 4H6KA 4W8AA 3ZZ1A 2AQOA 1FWHC 5KTLA 4NJIA 5CZJA 4QRNA 1HKIA 3IJ9A 4Z2HA 1R3SA 4IGMA 1EYEA 3TZFA 4NI3A 3HJZA 1UWIA 4FAMA 4QLKA 4LVBA 4HYVA 3ES8A 3K8LA 3UPBA 3L0KA 2Z2AA 1WA3A 4Q33A 1YNYA 4IMCA 2WSRA 2DIJA 2OYMA 2J13A 4ZE4A 3LM7A 3UWVA 4YU1A 1E6NA 2FGZA 4HPHA 1O68A 5GNYA 4ENLA 1K6WA 1JDAA 2A3HA 5H6HA 4E8CA 4IH3A 3BK0A 4KS0A 4DELA 1SW0A 3T42A 1NVMA 1HTIA 3RX3A 4DYKA 3CIWA 3BSMA 5EBUA 4NILA 1A3HA 1C3FA 1WDSA 2ACQA 2GOKA 3NURA 1XD0A 4PUJA 3SEPA 1TVLA 2XH7A 4LC8A 3SN4A 4JQ2A 2QS8A 3UR7A 1EXPA 3NQCA 3VNZA 1SW7A 1LF1A 4AYSA 3MI2A 3UCQA 2IQDA 3V0UA 2VTFA 3WUGA 1KB3A 3WMLA 4L61A 4LAUA 2F38A 4J3TA 3TZNA 1FA2A 4XO7A 4QG6A 4B5XA 1RR2A 2OLAA 3UJSA 4RW3A 1B1YA 3GHUA 3W83A 1FHLA 4WEVX 4KEVA 3V18A 3U6WA 5EMYA 3H2NA 5HJYA 2ZA3A 2POZA 3PWIA 4Q6JA 3EXSA 3MQTA 5L9FA 2XGBA 2EHHA 2R1PA 2VX6A 1J9YA 1F7BA 1OFAA 4HSOA 1VYSX 3F4WA 1TV4A 5BXPA 4IMEA 1HJWA 1FDZA 5A6SA 1HJSA 3W1NA 2V30A 1NAL1 3KRUA 1NJJA 1POJA 3WNKA 1JD9A 3ZFHA 1S2VA 3M1ZA 4XZLX 3MWAA 5HK4A 1W1VA 1BHGA 2FB3A 3RPMA 3PSWA 3D6NA 1GVEA 5D37A 1A5BA 4HZ8A 2ZWYA 3CEPA 1UWUA 3PZOA 3NPXA 3GDBA 1DJQA 1NDWA 1DKWA 1VBUA 4PUEA 3RK8A 4DWSD 4QCFA 4CCCA 3RO8A 1EWEA 2F6XA 1JCNA 1TIWA 1AQMA 5LXXA 3GDLA 1L8PA 2DJXA 5BU9A 1DTUA 5CBJA 3BLPX 4QAWA 3PTKA 1XS2A 2D69A 3KRZA 3BAXA 4PMVA 3N2OA 1LDCA 5EPDA 1ZP3A 3ZVHA 3GKAA 1HL2A 1LORA 3TR2A 2PRMA 1D3GA 4H9YA 1O5RA 4H83A 1UCWA 4JTKA 3ARUA 3TFXA 2WJDA 1M7JA 1CW2A 4O18A 3OGVA 2VWTA 1EJTC 3CUZA 1BSIA 1EHNA 3N9RA 1ELSA 3VFLA 2F84A 4AWTA 1DBTA 2FTYA 5CEWA 1GVOA 2VFDA 3WDRA 2YCIX 3AHVA 4B3ZA 3UZ5A 4Q8WA 3BGJA 2GQ8A 2TODA 4KFPA 1J0HA 1LQ2A 2YLAA 3UG5A 4HZ6A 2E8YA 5E6YA 3P81A 1SO3A 3KVMA 3GW3A 1MXSA 4AU0A 4TUFA 4UOJA 4Q4SA 4LAMA 3FHAA 5DFAA 3PY2A 4NX5A 4X3ZA 3VNDA 3CT7A 2CKSA 1CCWB 1ADDA 3R8HA 1KV5A 4QROA 3S1XA 2PEVA 1R2RA 5I3IA 1J8VA 1ICPA 4INFA 1TREA 5C2XA 4AZCB 5FEXA 3AZRA 4GQGA 1S3HA 3WDJA 3SSZA 1A5SA 1XLIA 3S2NA 1YHTA 1R3RA 3WJYA 4C7GA 3PFRA 4XIAA 5I3KA 3DFSA 2FZ8A 4C6MA 4QE5A 2D24A 4JQ4A 1R3WA 3S2MA 1RVKA 1XQLA 1EQCA 4RZBA 2BMBA 4IUGA 4MMWA 1OIMA 4UR9A 2WWCA 4A29A 4F2UA 4GQQA 3O06A 3DC8A 1PV8A 1JI2A 4AWSA 3QZAA 2EKGA 3UT0A 4IPJA 3S83A 3EZ4A 2CWXA 3J7HA 2DPEA 3S4TA 4C1LA 1JCLA 4IPPA 3ZR5A 1XLHA 1E72M 3C86A 3P74A 4DHGA 5F2MA 2CHRA 2VQUA 4LB3A 4Y9NA 4B90A 4KMQA 1GORA 1J11A 3M7SA 4WY0F 3LPOA 1PCKA 3ZR4A 5CBBA 4CD5A 3AROA 3WEZA 4CCZA 1R87A 4G56A 5EA9A 3LMZA 3RCNA 1BKHA 3LI0A 3QYSA 2QDGA 1TCMA 4HHHA 1HNYA 4Y9MA 2WHMA 2QXWA 1EJRC 7TAAA 3S47A 4H8NA 1ZRQA 4ZO6A 4FPSA 2Y24A 1JFHA 1E1FA 2BGNE 3LENA 1E6SM 3A4JA 4EOUA 1L2UA 3AHYA 4FXSA 3GWQA 2BVWA 2WNNA 1O1HA 4HSNA 1WNOA 3EYPA 4XD5A 3DGBA 1BYCA 4H6QA 1KA9F 2YIHA 5FL1A 4RXGA 5FF2A 4HU0A 3A5FA 2OPJA 1UKSA 1M41A 3UEQA 1VIWA 3TA9A 1Q6RA 1E0XA 4BWLA 2VELA 2NXHA 1QBAA 2VMFA 1AFSA 2DT3A 3TC6A 4QQUA 1KCLA 5EMJA 3M5ZA 4GUJA 4A3QA 3ZT7A 1HG3A 3S9ZA 1PTGA 5LA1A 4FNQA 3LNPA 1N7KA 4CN1A 1V77A 3K5XA 5A95A 3TA6A 3W1XA 3BMVA 1DE6A 3VUSA 4PYSA 5A2BA 4EXBA 4C90A 4KEUA 3IJIA 5HQLA 4UQBA 2XDFA 1VH7A 3R1ZA 3CQHA 4L4PA 5D30A 4NKCA 5A6KA 1MW3A 3BLLA 2UY4A 4AQLA 3L4TA 2AL1A 3OJGA 7XIMA 1UD4A 2ZYFA 3MVIA 3BO9A 1WAUA 2ZXBA 1VEMA 4DBEA 2C1GA 1XLEA 1XLBA 5IDZA 1LJYA 3RJYA 2QCDA 5A5WA 1UR4A 3ITGA 3TJLA 3QKEA 5K2ZA 1I9CB 4PTDA 4DIAA 3AIBA 3RLUA 4YNGA 2OVLA 3IUHA 4GI9A 1TTQA 5HWJA 3K46A 1W8GA 3W24A 5LXEA 5EFFA 1QAPA 3EXRA 1BVWA 2QUVA 1KM3A 2QPSA 7TIMA 2E28A 1TA3A 2Z4GA 4MY9A 1P0KA 3NSXA 3ZS4A 1E4LA 4MNJA 4DWSA 4MJZA 1V3LA 1EJUC 3TNBA 4GIEA 2VR5A 5K7JA 3WF2A 5AHLA 3THDA 3KVKA 1NF0A 2FZBA 1I2QA 1E4MM 3C2FA 4BK9A 1U30A 3TSMA 4NUWA 2WHJA 4FX7A 2Y8KA 2DSZA 3W72A 2HS8A 3S8HA 1JF5A 5CPMA 4CNOA 3O0KA 2CXEA 1ISZA 1XRTA 1X1OA 2P0IA 4WOZA 4P8WA 4NT0A 3ARYA 3GXTA 3OLEA 7PTDA 2RHGA 3AXXA 4UUIA 1GTHA 5C54A 2HVNA 1I2NA 4L7ZA 4XZBA 3C52A 2QT3A 2PP1A 5T91A 1J4EA 3VU2A 3FY1A 4V1XA 2FZ9A 1G94A 3OBAA 2QGHA 1DJGA 2PD5A 1OK4A 5CGTA 4XV0A 2E25A 3QMRA 4PMYA 2B0MA 4N42A 2H6RA 3EGJA 1EGMA 5DRIA 1CBGA 1M65A 2X40A 4D6CA 2CCRA 4AEFA 1UH4A 4B5NA 3FYYA 3O6CA 3ITXA 3ZJ6A 5HMSA 1MW0A 1TUXA 2VVNA 3QC3A 4MAVA 3PBWA 4FI4A 3MMWA 3QYQA 1MUWA 2J74A 2FZNA 3GR8A 3ZM8A 2V9DA 2IUZA 1TYGA 4KEMA 4LQ1A 5LIWX 4O4WA 1HKVA 1JI1A 3M44A 3TDFA 2Z28A 3DBPA 2XG9A 1IT8A 4C1NB 1XHGA 4QP0A 2C6QA 2QUTA 2VDGA 3LXBA 2WMHA 4WX2A 1UKQA 3UZZA 1UB3A 3TAOA 2QAFA 4V2XA 4OGZA 3PZVA 3QV6A 4J28A 1XLCA 4MLJA 5DT7A 1QI3A 4DJED 2ATSA 1JNEA 2QPUA 4A6GA 1LUCB 3QBUA 3P80A 2HEJA 3N2MA 3H7UA 3FAWA 3KW3A 3MO4A 1RZMA 4GVGA 5HJLA 2Y85A 5BXSA 1B3VA 3HA1A 3N18A 4UNLA 3GYEA 1DJZA 2JKPA 3V1PA 1AD4A 4HHLA 4C7DA 3UR5A 4NAEA 1NWTA 3W1MA 3MC5A 1UC5A 3BQ5A 3TSBA 1DORA 3UXKA 1Z32X 2XIJA 1OFDA 3FIGA 4MVAA 2G4JA 5HR7A 1Z3NA 5E9AA 4AX6A 1NFBA 1N8IA 1ZSXA 5IXEA 1L6FA 5TIMA 4ZZ9A 2NQJA 1ISWA 2QCCA 3W7LA 4RDWA 1H1NA 3S6DA 2A1YA 3LZ5A 1GQLA 4HB7A 4JIQA 1M3UA 4QTGA 1GVFA 3KBMA 3GH5A 1EJSC 4QDMA 2BVYA 1GT8A 1T8QA 3AJ7A 3L21A 4AUBA 2AGKA 2BVDA 3LSBA 4HPGA 1S2UA 5C5YA 4R88A 1JCMP 5G1TA 3PZQA 4XKYB 3UZYA 3EEGA 3PAOA 4ZQNA 2G0WA 1WDWA 1XP3A 1HO1A 3G1YA 4AIBA 1QBBA 1GHSA 1QNOA 3GVQA 2DZUA 1JPIA 4LGXA 2X1SA 2F6UA 4R85A 4IIEA 4RDVA 3GTHA 1RLDA 1XDJA 3BAJA 3GSMA 4GJ1A 4OIFA 2ALDA 4W85A 3E38A 1OHLA 1XW8A 1IEVA 3NGJA 3RM8A 2GVGA 3U2CA 3GH4A 1I1XA 2DDXA 3REQA 4D1IA 4YN5A 1KCKA 2D22A 1R7AA 3AC0A 1MZRA 1LZOA 2DZXA 3VC5A 1NOUA 4Y6GA 3L4WA 1LBLA 3HB9A 2EF9A 4JIPA 2HBVA 4O13A 3OU8A 4P8VA 3BJSA 2I57A 4O53A 4ERIA 1RP8A 4MM1A 4J9JA 4WKFA 1KBJA 2OB3A 3H8AA 3UVIA 3HGRA 3VZXA 2OTDA 2XVPA 3RLGA 4O1FA 3IPWA 3NDOA 4JTFA 3SB0A 3H26A 2A7PA 1HVXA 5HR6A 3MBFA 3TYZA 3F5LA 2DZPA 2CKRA 3DERA 2OO0A 1DP0A 4IX0A 4OKDA 4H8HA 4C6OA 3CMJA 3MWCA 2DQXA 1XRVA 2RDXA 3IVSA 4YTRA 1O60A 4K1WA 5LZLA 3E3HA 2FHFA 3QEZA 3B0XA 2WMIA 2J6VA 1H7RA 3ZMRA 4UR7A 3BOLA 3F4VA 3W76A 1KXVA 4DVOA 6PTDA 4DUWA 2BOFX 2CBUA 1OFRA 3SUUA 5F4SA 5LIKX 3TN5A 5EL1A 5CC7A 3SECA 2O9PA 4E8DA 5A6BD 4JTCA 3VK5A 1C93A 1LQAA 2Q09A 2PBOA 3QXBA 5AHFA 1CNVA 1HGYA 2HQAA 5H8UA 1EGZA 3UFYA 7CGTA 5ECUA 3GNDA 5KZMA 4BHYA 2BY1A 4MB1A 4PUUA 3G6LA 3T0TA 3L4ZA 4PN2A 1LQ0A 4E5TA 1I1WA 4BI7A 4HU3A 1K9DA 4W5ZA 3PAJA 3DFYA 2Y7GA 1H1YA 3UNTA 3W82A 4QBXA 1YE6A 4HMDA 3UJ2A 4JBRA 1FHDA 3S1GA 4I5RA 4UQ9A 1RQEA 4DUVA 2ANUA 5C7HA 1V3JA 3CEUA 3IVTA 3UCDA 4PB3A 4HBKA 2WBKA 1KKRA 1XCFA 4JXCA 5E6ZA 2VC5A 2VGIA 4M5PA 1ZUAX 4NSBA 5A6LA 4DBDA 6REQA 2GVLA 1KCXA 3NGFA 4Z1CA 4NQ1A 1R7OA 3N15A 4YWIA 3USBA 5TNVA 3G1AA 5REQB 1GNXA 4H1ZA 1DTNA 4IIHA 2VEFA 1GYNA 3V5OA 4WXZA 3W1LA 4GIRA 3LX9A 1VYPX 2VR4A 1RPKA 3EWYA 1S5TA 1TPUA 4EE9A 3AMDA 3VD3A 4KIEA 2V5CA 1UD8A 2BY3A 3M41A 3MYPA 4ILSA 4U28A 3WFLA 5KZEA 4DJFC 4G7EB 3VKKA 4UTKA 3CO4A 5D8ZA 2AMGA 2XPKA 2EPMX 1B54A 3OYZA 3R7MA 2V2DA 4REQB 2PGEA 1R2SA 3DYMA 3VM7A 3VCRA 1F4AA 2YXGA 3DFNA 4UOZA 1W9BM 4ZGYA 3VNLA 5D9PA 1RJRA 1KFLA 3IARA 4MF4A 4DJEA 1QNQA 1QI5A 4N9BA 3AZSA 1WYIA 3N04A 2BOGX 1R46A 4TMBA 3A3HA 3WUFA 4AH7A 4GXPA 3G18A 5D2WA 2HRWA 4GABA 1TMQA 3B4YA 8XIAA 4CD4A 2QVNA 1VR6A 2C79A 1UP3A 4A3RA 3WQFA 4FXFA 2CLLA 2CHNA 1D9EA 2E9LA 1FWDC 3I4EA 3NQ8A 2V5JA 1OG0A 2DP3A 5HJXA 1MFUA 1YADA 1UMLA 4I9AA 3ITOA 3LHTA 3M07A 3TC7A 1XLLA 4H9UA 2GGJA 3IVUA 4OHQA 5HWMA 4AVFA 2PB1A 3W7PA 1H5YA 5DELA 1MUMA 4O1BA 4DUOA 2DQWA 2Z0IA 2PP0A 3LQLA 2OEJA 3JR2A 1F07A 1B3WA 5I03A 1Q3NA 5AY7A 1S46A 5I23A 3STGA 5I3HA 3GNNA 3UXDA 1P4CA 3E9AA 1UIPA 4NP7A 2HPIA 1EOKA 1F61A 4MB4A 1US2A 3HPFA 3VOIA 1SU5A 1OC5A 2QMJA 4JTEA 1OINA 1ICQA 3ABRA 4HCHA 4I7WA 2GJXA 1N82A 2PDJA 1PX3A 1H1ZA 4V27A 2A2IA 2X30A 1UP0A 3PUEA 3QLDA 5CAKA 4PB4A 5C7VA 1ZCCA 2J9XA 1EKOA 5A3HA 3MZ2A 2WMJA 2EQDA 1NQ6A 1AW1A 1VFHA 2EG6A 2Y5SA 3RU6A 3W00A 1CECA 3POCA 4IP5A 3V4BA 4NZ4A 2GSHA 3AS0A 3GTIA 2YYUA 2GZXA 1OFEA 3EB2A 1R86A 3EWCA 1E0TA 3PZIA 2NXGA 1OC7A 4X0VA 1W2VA 3QQWA 2ZTKA 1P1MA 2QDHA 1QI4A 3W6YA 1VFLA 4I8DA 1QWKA 3U5YA 2HMCA 3E0WA 1MEIA 3AIQA 1TZ9A 3WMSA 3VDGA 4KETA 2WSPA 3QGKC 4HPNA 5TBOA 4PFHA 3VI2A 2WZEA 1GQIA 1ZFJA 3CUFA 2WV8A 1JYNA 2HVMA 3MMDA 4XZWA 5CSRA 2YA1A 3SM0A 3WMCA 1UQYA 4FHAA 3PK7A 3WLNA 3SRDA 2PDHA 2Z1KA 5I2UA 3EA1A 1W1ZA 3E2QA 4LC6A 1NP0A 3NM3A 1W37A 2CXGA 2TSYA 3CPGA 4RX0A 3W88A 5FJRA 3IAPA 4HKPA 5C0QA 5A6BA 2X1RA 4H8VA 1W2PA 3OHMB 2W0UA 1V7AA 1AODA 3GBDA 5CQ1A 4HPXA 3G1SA 5AN7A 4J5NA 3NTYA 4O8RA 1O5KA 1BG9A 3S5SA 3VZYA 1E56A 3C3UA 2E09A 1XBZA 3WBXA 3D0CA 3OIXA 2XTKA 3ITYA 1G01A 5DXYA 3EAUA 3CHCA 3E02A 5TD4A 2HCVA 3N3TA 2JF7A 1A0EA 4J40A 3RCYA 4QISA 4YTTA 4O54A 3RN6A 5CZTA 4D8LA 3U4AA 2DT0A 3PJUA 1UZ4A 8RUCA 3M9YA 3W84A 2XGIA 5FJPA 4U33A 1KLYA 4MGGA 4JX4A 2GL5A 3TC3A 4LUTA 3T2OA 3MTWA 2NUWA 2QPXA 1W8SA 4UQDA 5D04C 2YL5A 4B4FA 1H2JA 1XIFA 3ZYZA 2P5NA 3N4FA 4A35A 4BF7A 3SCTA 1YBQB 1ZHAA 3IGUA 1QMLA 2VO5A 5HQMA 2Y5EA 3GU1A 4H04A 2J9ZA 3HTWA 1OD8A 1B4KA 4PSPA 3KTSA 4AHOA 4O0QA 3KDOA 4GY1A 4WGXA 2Y7DA 1OK6A 3I6TA 2IMRA 1Z48A 4LVFA 2JALA 5DQPA 1HVQA 2E67A 5TF0A 1YMYA 1EO7A 5FEWA 2CZVA 1D7KA 1XLJA 1LOLA 3B3DA 3L5AA 1NWSA 4DAFA 2OEKA 3TW7A 4B5WA 1V93A 1DWIM 2PTYA 1GOXA 1V6YA 4OECA 2VZOA 2X42A 2BLEA 2QNEA 2Z24A 5HPCA 1Q66A 4D6EA 3ANUA 3QFWA 1MI3A 1UPPA 2PDBA 2OSYA 4PB5A 2RH9A 4HNVA 1A5MC 4KWOA 5BNKA 4PCSA 5FSEC 2Y4SA 3STEA 4JIIX 3SGGA 4AD3A 3ES7A 1HKWA 1EHAA 2V3EA 1X39A 2BX7A 3GZAA 3I6RA 1QO5A 3CMGA 5CSSA 3P67A 1JDCA 2EPKX 4R9XA 3TYUA 3ARPA 4M29A 3G5EA 4RV3A 2W61A 3HZ3A 4HMEA 3URQA 4GLEA 2HROA 2PGRA 2RKXA 2Z25A 2QKFA 3TNOA 3VGGA 3K1DA 1O95A 2QEZA 4PRWA 4DNMA 1BWLA 2YZRA 3C3NA 1PZ3A 1TZ7A 1XDLA 1W91A 1GOIA 3FSTA 3QMTA 2ALRA 1FWBC 1QJWA 2PZNA 5A8MA 3UQNA 4WSJA 4BQ2A 3MY9A 1JZ7A 2XH0A 5HOSA 3BCFA 4EIVA 3ABSA 1W9PA 3SUWA 3PBGA 5B7YA 3IUIA 1E9LA 3BCDA 4FS9A 4LAOA 2C91A 2BG5A 4XAYA 1AVAA 4JX6A 4N9CA 5F1UA 3ANYA 2IXUA 5J5RA 3UU0A 3VIHA 3WFZA 4C1KA 1SPQA 3KOYA 2WC4A 2WLYA 3DOPA 3PJXA 1U5VA 3OVRA 4WZHA 1UOKA 3W2MA 4EXQA 1X38A 2Y1HA 1UC4A 3DZ1A 3W22A 3VIOA 5BZAA 4DI8A 1R5YA 4QXIA 1V3HA 4C6JA 3GTNA 1BWVA 3USZA 4LVGA 2JIWA 5C70A 2I5GA 4TVUA 4QEEA 2Z00A 1RH9A 2DW6A 4CCDA 4KRZA 2XN2A 1E40A 3PPCA 3U5UA 3HIJA 5CJ5A 3PUGA 5B7ZA 4HCLA 2UY5A 5D8WA 3DHPA 3DUGA 1JPDX 3LHVA 2IKHA 4FOUA 1GJPA 3QSTA 4LCRA 3HQOA 4JYEA 5LGXA 3NQ6A 3OEXA 4CD7A 1AK5A 3FAXA 4CU8A 3POHA 3G8RA 1SW3A 5I3DA 4AF0A 2X1TA 1FXPA 4G8TA 3PWGA 5H91A 5J8LA 1FWSA 4GUHA 3STCA 4Q22A 3WNPA 1TUFA 1FWEC 1WQ5A 4X60A 3OP2A 1EDQA 2NX1A 1OX5A 2Q3RA 3GXPA 3IJ8A 4H41A 2J79A 1A5UA 1N2VA 2PDUA 3IUDA 3TSDA 3E2RA 3GU2A 5BMXA 4GWEA 3LPFA 5HMDA 3FGCB 1FWNA 3W2KA 3NZPA 2OU4A 5JU6A 1UUMA 1CB7B 2OKOA 5CZSA 1W5OA 2J24A 4AISA 3RILA 2DZVA 3B40A 1B2YA 1W3KA 4LEQA 1IYXA 2FJKA 3M0MA 4NG3A 3CU2A 3MJYA 4Q4KA 5I7GA 2EJAA 3Q58A 3H55A 1XD1A 4UR8A 1VEOA 1I45A 1R85A 3WLMA 1CTNA 2J77A 3DCPA 3BGGA 5AC5A 4BJHA 1J5SA 3GFZA 4GBDA 3E0FA 5BOFA 2E1WA 3C6CA 2YXOA 3QW4B 3CIXA 3HQNA 1TWZA 1Q4WA 3W1PA 4DF0A 3WLLA 2C71A 3FA5A 3JZUA 3VIFA 2C1IA 4AWEA 1D2KA 5I09A 4FSAA 1LBMA 2DT2A 3ICJA 3E12A 3LLXA 4MPQA 1FCQA 1QTWA 4NY2A 1PKLA 1IXPA 3W7MA 4JDYA 3SQMA 4GCXA 1WKFA 4PMDA 4B5TA 1JXJA 1EZ2A 1UWQA 4H6RA 1NIUA 4HCDA 1RCXB 4NHVA 1FTXA 3WD3A 4JICA 1TZZA 2Y89A 3FYPA 3GXFA 3PJWA 2O7SA 2PWGA 1PZ1A 3GZ3A 1UR8A 3P8JA 3ZJKA 1ESWA 3E0LA 4PTXA 1E55A 4WF7A 3DAQA 3EB3A 2H8ZA 3OHIA 4WK9A 4ROPA 4I9TA 2X2GA 1PVNA 1FHVA 5LHEA 1OIFA 3S2CA 3PVFA 3BLFA 2X8RA 1D8CA 4JAWA 4M1BA 4Z0SA 4R3UA 1XGEA 1DXEA 4TXEA 4ZCWA 1FWWA 3MA8A 2GGGA 3OLDA 2R24A 4YHGA 2FVKA 1GQNA 3W2LA 1FOBA 1DEDA 3TJXA 2YBUA 4AZBA 2E3ZA 2QZRA 3LCFA 1CLKA 3O16A 2GSEA 3CB8A 4YCPA 1VBJA 3SCUA 1XG4A 4GISA 4UCGA 1WXJA 3TONA 3A64A 4DO5A 1UYQA 3V5FA 2J9YA 3FEQA 3IWPA 1LCOA 1S1PA 4HN8A 4JR5A 4MJMA 1YTEA 1FQ0A 2YSWA 4C6PA 4LB4A 3GE7A 3VFCA 1TB3A 4CVWA 4HVXA 1JRCA 1W9DM 5B80A 2IS7A 3HGSA 3TYBA 4IFKB 1BYAA 1EJ7L 1KRAC 2EG8A 3R2GA 2J66A 5AZ1A 2ZXDA 1KFBA 2QJHA 1RK5A 2OGJA 4CN6A 4PH6A 3GDRA 3CZJA 4XAPA 3W0KA 4LT9A 3R8RA 3S3GA 1JGMA 1SMDA 3P7YA 4HTYA 4MFDA 3VKBA 1FFRA 3W9ZA 4GO8A 4MB5A 1RALA 1UR2A 2ZRUA 1WKDA 2A7NA 2ZOXA 1UROA 4QAIA 1KFCA 3MZNA 4DZIA 1XRSA 3A23A 1LM1A 4WOQA 4DI9A 2OZ8A 4DF2A 1FDYA 4JKKA 4MY8A 3B03A 1E1CB 4QE1A 5D2VA 3VC6A 2YOCA 4MWAE 3RPDA 2VX4A 1EPXA 1GZGA 1OFQA 1OCQA 4C5YA 4RZ6A 3VOGA 5CJNA 2ISWA 3KOFA 4LXFA 2DSVA 4EXAA 1FH7A 2YCLA 4UTFA 3WH9A 4HOZA 1AMKA 1TWWA 4UTWA 2NQ9A 3GVWA 2Y8UA 5H2ZA 2WJEA 2IPGA 2BB0A 1FHUA 3HG2A 4TQTA 4UFMA 3LZ3A 3PB0A 2W3ZA 4J35A 2E9MA 2G96A 4HYWA 3DEQA 5D9OA 4TR9A 1QW7A 1O4UA 3T8LA 1DIKA 4Y96A 3L23A 4IIBA 2R1KA 2OQHA 4O57A 1TKKA 4PMNA 4HNOA 1GOQA 3V5CA 1LG1A 3TVAA 3DIPA 3F5JA 2ABBA 3GO2A 4HSHA 1BRLB 3TQVA 4Q8PA 3HPZA 1Q5MA 4JFWA 1CIUA 1HW6A 4JHZA 1WV2A 3DX5A 4LY8A 2D0FA 2E6DA 4JTIA 1RSCA 5K4ZA 1SR9A 2J25A 4I3GA 4Q4MA 4UIOA 1BXBA 3RM9A 2Q6ZA 5D2XA 1KWKA 1H3GA 4Y8FA 4MJ2A 2NUXA 4E4FA 2ZA1A 4F3HA 1QASA 4QITA 2I5IA 3UJRA 5MKGB 1RV8A 5BOOA 4TV5A 3WF0A 2AKMA 1YTDA 1EGVA 5D02A 1W5MA 3O2LA 4LALA 1WAWA 5EMMA 1WZKA 3U57A 3P0XA 4PSRA 4EPDC 2JEPA 3WY1A 1O5XA 5RUBA 3MDWA 4BWLC 2FPTA 2ACUA 2ZDSA 3NEVA 4C6LA 2WMKA 3RXZA 3T09A 3B8SA 3NR0A 4MZ8A 4PZVA 2XIIA 3SN0A 4CLMA 2HZGA 3B8TA 3KL5A 1OX4B 2P76A 4FNPA 3B4UA 3UZJA 4YWSA 2X41A 1HF6A 2EPNA 2PC8A 5GJMA 4CQ8A 4JTRA 1QNVA 4MYXA 4AD5A 1PB0A 2GUBA 3UG3A 4F0SA 1TPC1 4WKHA 3KLKA 2C13A 4MWAD 3MHGA 2QCLA 3DG7A 2WZHA 3EEZA 4WJ8A 1OD0A 2CBJA 1XX1A 5C9WA 1XL9A 4IIGA 1H09A 2WJFA 1GUVA 3L0GA 1J0KA 2HE8A 3WQ4A 3EDDA 3QY6A 3EPMA 2ATMA 3BAWA 3XISA 2PSNA 3G6MA 2WBGA 2HK0A 1V4YA 2C19A 5HWNA 4LSBA 4NL1A 4WXYA 3L2MA 4D8ZA 4L6DA 1AJZA 1UZ1A 1KBLA 8CGTA 2CLPA 4NZ3A 4E6MA 2F61A 3ZWTA 2WVVB 3P60A 5LA2A 3V35A 1ENUA 3LV5A 1B3XA 2XGZA 3TROA 3ZSSA 4TO8A 1ZQ5A 1Q85A 4FIQA 3P3BA 3PB2A 4DWSC 3O0FA 3TYAA 3TW9A 5G1MA 3BE7A 1S5VA 2YFOA 3ZLFA 2GWNA 3R6IA 4MHBA 3SFKA 3ZVIA 5M17A 1H5VA 2Y6ZA 3WD2A 5IOBA 5AC4A 3U7BA 4AD2A 3B8UA 3PBVA 1DWJM 1BYBA 1L6YA 3P61A 3CT2A 5AHNA 4BR1A 2WK2A 1JNDA 1PIGA 1HQTA 1TR9A 2R8WA 2EBNA 5D09A 4IL0A 4UQAA 1CLXA 4ZQMA 1WKYA 1XCWA 4Z1YA 4RW5A 4ATDA 3MB9A 1JR1A 4F0RA 2A3LA 3BLDA 3CHFA 2OQLA 3P62A 4WHBA 3TH6A 4M6VA 3LRLA 5LIXX 5AVNA 3RLHA 3I6EA 3PG8A 3GXDA 5A6AA 3QQ0A 3SCRA 3IK4A 5F2GA 1WO2A 2A0NA 4MUZA 1CXIA 2PF8A 1IT7A 4O4VA 2BNJA 3RR4A 3EOLA 3MKCA 3G1DA 3VOHA 4NU7A 2OSXA 1G7UA 1JPHA 2P50A 3VX1A 1IEWA 4ZQOA 3PC0A 2Q8LA 4JIEA 3SCNA 1A5NC 1JUKA 4YVXA 1X6UA 2PWHA 1SZFA 1K70A 4I6KA 2IKGA 5BRBA 1H7NA 2YW3A 4I90A 4MDPA 2J88A 3W29A 4PMQA 4IICA 2NV1A 4GRSA 3O7UA 5F4XA 3QGAC 3CUJA 5DN1A 3T4WA 4HA1A 4RV8A 3VINA 3KTXA 2CU0A 5AYYA 4JL1A 1W5NA 1XYZA 3LV6A 1TV5A 1SZGA 4B2DA 3ABOA 3MHUA 1GZJA 1WBHA 2XH2A 3LGDA 4PULA 3NM1A 3KCJA 1QXLA 3CPRA 3V0TA 4PC8A 3NXLA 1GZ1A 1TO3A 2WC3A 1R47A 3QY7A 3CUXA 3AU6A 1U2YA 2Q3OA 4XAGA 2Y88A 1Q7MA 5T26A 4G2DA 1K7EA 2ZZ2A 3UJEA 3DG3A 2ZXAA 3T08A 2Z2BA 1P0EA 4R53A 5C9UA 1H60A 4A4AA 1B4EA 1OJXA 1XLFA 3NG3A 3L4XA 1BVNP 3R25A 4MJ4A 2C0HA 3OQEA 1QW9A 5JIPA 1VZWA 3W7IA 4DN1A 1E6ZA 1QNSA 2B31A 1JCYA 1KRCC 3ARVA 1MRQA 4N2YA 1HUVA 4Z0JA 1DIOA 4U10A 3DFPA 2D20A 3IK2A 2NQHA 3F03K 1UUQA 3SGUA 1PWMA 1KLZA 2XU2A 3R43A 1H50A 3GH7A 4FXJA 3FEMA 1R8LA 3MBDA 1BKSA 1DHPA 3COTA 2PDMA 1HO4A 1X6NA 4PUNA 3S1UA 3WDQA 1UPMB 3H2FA 4Q8MA 3AWOA 3OQ8A 2NQZA 2PWDA 2VDHA 4OBRA 4HMNA 2C3ZA 5MF5A 5JVLA 1PAMA 2WPBA 1EEXA 3SY1A 1K02A 2CLIA 5KMYA 2OSWA 2DGAA 5CPSA 3PZ9A 1OADA 3N13A 4F2BA 3R94A 3P14A 2GJLA 3F5KA 2INFA 1MZHA 3LGEA 2SFPA 5DT5A 1JZ5A 4OTKA 4D2JA 4KH2A 3GUWA 2WM1A 4PEEA 2VOMA 2PFHA 3UR8A 4MWAA 2QMKA 4ZO9A 2ZZ4A 1J6OA 3VAVA 2CFFA 2O9OA 3UCCA 3ORWA 4H9ZA 3CZKA 1QATA 2E77A 2OT1A 2R1NA 2G3IA 2VNCA 2W62A 2ZTJA 2KAUC 3GXIA 1AW5A 5ABEA 4NF7A 2O4QA 3F1QA 2V63A 3UPWA 3EWBX 3VCCA 2GUYA 5G2WA 3RG6A 1US0A 1DJYA 3CBWA 4HU8A 4ERGA 2NSXA 1P6WA 2RJHA 2VEKA 5CCZA 2QVHA 2OG9A 3WNLA 3V36A 1PTDA 4C1NA 3MI3A 4E3TA 2XFRA 1IZKA 5A94A 4GE8A 1GPFA 2FQIA 3PZTA 1YDNA 1L6GA 3ELFA 3T4CA 1Y65A 2VFFA 4WRHA 1Z9AA 4F0KA 3WF3A 4A3HA 1OYAA 1WP6A 2NUYA 3WNOA 3GW0A 4IZGA 5DMNA 1UA3A 4D6DA 4GIYA 5CC6A 5F2LA 1BGAA 3GVRA 1SZEA 1JZ2A 4F8XA 4XVEA 4ZOCA 1JAKA 3D3AA 1AL7A 2UBPC 3WLIA 1XF0A 3VMOA 2I16A 4O12A 4ATWA 4O0ZA 3C56A 4IGHA 1PX8A 4S1FA 5FD0A 3MUAA 3THUA 3RITA 2ZVIA 4AD4A 4IT1A 3AICA 2OZ3A 4OT7A 5JQ9A 4ZA0A 4KGJA 3W7NA 3WUEA 4FLRA 4X2PA 1US3A 2RJGA 4PEKA 1CX9A 2Z7GA 3GRIA 1V3MA 4O16A 1OCBA 1UJQA 1HXJA 3GM8A 3GFXA 2V6AA 3ARWA 3WBAA 4F0HA 2ZBTA 1UWRA 4W7WA 2V0TA 4IQLA 2ZZ3A 4AZIA 1GGOA 3ONBA 4XG1A 5F2IA 2PDCA 3OBEA 5AHMA 1Z89A 3BSGA 3H2AA 1I2OA 5DANA 1WDDA 4L1GA 1JCTA 1VIZA 1E3XA 3QR3A 1QPKA 2DH2A 3R11A 1ZP4A 2VFIA 1X6LA 4ICMA 1FH8A 4Y90A 3EPOA 4C5ZA 5M5DA 3EDJA 2PUZA 3LCGA 2QJJA 3ENLA 2VR2A 2PGFA 1TV7A 3LEPA 4DPQA 5D03A 3NO3A 4LTSA 5G2HA 4ALDA 4F2TA 3LOTA 3VD4A 3QLLA 1CXFA 2V81A 2C1HA 3TTOA 2UY2A 4XIMA 3APTA 4P7QA 4L1XA 4YHEA 3RGTA 3T78A 5C55A 4DJEC 5LNUA 1I2PA 1KBKA 3SAZA 2VZUA 2PGWA 3P2VA 4ZOBA 2IW0A 4J3UA 2PDGA 1J79A 3LERA 3H22A 1IR2A 3SJ3A 1O12A 3R0DA 1QU4A 2AGTA 1G69A 3K30A 5I0DA 3FA4A 1YLVA 3QV9A 1UIOA 4UTMA 5IHSA 4JTAA 4PL1A 3S5NA 1E6PA 4YL2A 5LSMA 3OGRA 4HHPA 3MW7A 1QK2A 4UMBA 5I3JA 3B9EA 3C5QA 4L4MA 1ONXA 3FLUA 2XYLA 2PP3A 3AXKA 4Q4OA 1V5XA 3MSYA 3S5ZA 5HATA 1W3TA 2OO6A 2WCAA 3DN5A 3Q94A 4JOMA 4C7FA 1JZ6A 3DHDA 4IP4A 4NZJA 2PURA 3M6YA 4I9MA 4WD0A 3N4EA 1Z8AA 4QJ3B 1B90A 2FVMA 4JIHA 4B9ZA 1EX1A 1TWIA 4JHMA 2D2JA 3U4FA 3QPZA 1KQYA 3H4XA 3MJMA 3C0SA 2YFNA 1BXNA 4NASA 4FNRA 4GYKA 1R3TA 4GUFA 2AL2A 1T99A 1W1TA 5AOUA 3N2CA 1XQKA 2XWEA 1CPUA 2EO7A 4IHCA 1MQPA 3KEHA 2C15A 1Z6KA 3BSHA 4GH1A 3PG9A 1W31A 3C61A 4YTUA 4KRTA 3BG5A 3VOJA 2G97A 4P61A 3INPA 3GLCA 3VD9A 1W0MA 4GYFA 4A8NA 4B3LA 5I77A 3GIPA 3W07A 3BURA 3VILA 3M4HA 3WL0A 5AYZA 3T0DA 3PWAA 2X0YA 3THQA 3TYCA 1PE1A 2VXNA 4RDYA 3B9AA 2ONEA 2PE4A 2C7FA 2FDSA 2VGBA 2WQPA 3NIYA 3UWUA 3A6OA 4KERA 3TWBA 2J7BA 3RHGA 1B3OA 4DJDD 1DJIA 1UD5A 2DJLA 2XVGA 3QC0A 2REQA 3TCSA 2CYGA 3YPIA 3ZWSA 3OGSA 1KW1A 3LG3A 1B9ZA 1R38A 5REQA 4GXWA 2PWVA 3VE7A 3CUGA 2ZXQA 2O4MA 2Y8VA 3QR1A 2C18A 2PLKA 3DKJA 1NOWA 3NQEA 3N6QA 4KWVA 4UZSA 1QWGA 4JX5A 5JH1A 2EAWA 5CPQA 1EA0A 1W9VA 4LAZA 2I56A 4R34A 1JQVA 3M0VA 3K8MA 1UWAA 4E4PA 1ECEA 4F40A 1I0DA 1FBAA 4BQ5A 2I9EA 1JZ3A 4MIMA 4CN4A 2GUUA 5JBFA 2F2HA 4AY7A 3BOFA 4G7EA 5CGQA 5K3VA 1IXOA 3M5YA 1C8QA 4HU4A 3TQPA 4RDZA 3FDGA 2INEA 2OJPA 2OEMA 2QCMA 2VQTA 4REQA 5DCEA 3SRHA 1JGIA 3FJNA 2QJNA 4XKMA 1KXHA 3I10A 4H2HA 2D0GA 4AW7A 4OJYA 5KZ6A 1E9YB 3CL8A 2R1LA 2VKZG 3PNZA 4F79A 2VI0A 4HT3A 3UYIA 4N4QA 1JZ4A 1VHCA 3UGVA 5U4NA 1ZBVA 3F4CA 3UXIA 3LHZA 2E6FA 4G1NA 4YLWA 3HMCA 2VFHA 2FTPA 2MANA 4AAJA 2VD8A 1M01A 3WH5A 1KCZA 3HGOA 4IOTA 4X61A 1ME7A 3U0HA 3WK0A 1UZHA 1RLCL 4O1DA 3BUVA 1M1BA 2B7NA 3VXGA 2CNCA 2XSXA 3HG3A 3D5HA 4UNKA 1LROA 1XWYA 3SCWA 1YRRA 3EB4A 2X2YA 1OBAA 2HNHA 2BSLA 2YXXA 4HNUA 2PMQA 2Y70A 1SO5A 1PX4A 1XV8A 3PPGA 4J1OA 3VA8A 5FI8A 4O0KA 5DMMA 1RQBA 6TIMA 5FJUA 4NI8A 4PFMA 1FCVA 1WXYA 1MDRA 2BOEX 1OF8A 2ZICA 4DWDA 3QHNA 3QZEA 3NQVA 2FTWA 2YGYA 2VZTA 1CXHA 5C2GA 2CITA 1TTIA 3B0PA 4H4IA 1R30A 3WFAA 2O0TA 4S38A 1AZ2A 1VJIA 1NFGA 2YB4A 2BXZA 4M56A 5A6MA 1ECQA 2Z6IA 1F2JA 3EOSA 3TQ0A 2NW0A 4GUGA 3PP7A 1KXTA 4RLIA 4MNLA 3MMUA 3W85A 1ZY9A 1V6TA 1DPMA 2B81A 4HZ7A 1XFBA 4Q8TA 1OG6A 4A2SA 3FVMA 3G1XA 3A4AA 3MKVA 4HD5A 4F0LA 2XFFA 4MY1A 2YKKA 3RYSA 3E0VA 1BF2A 3VD7A 4E8GA 3MO7A 3SCOA 1F3WA 3TN4A 4JFVA 4WGHA 1RCQA 1EFZA 4EF9A 4E3VA 3ZLHA 3LY0A 1YIXA 2VX7A 3W74A 3WN6A 4CD8A 1UBPC 2DUAA 3EMCA 5AKQA 2ZX6A 1OGGA 1L2QA 1YPIA 1ZAHA 3CC1A 1NDZA 2BBFA 3DFOA 4LUYA 1C29A 3KX6A 2E6YA 2YL9A 5FF3A 1VFSA 4M7SA 4QS5A 4XQ6A 3T0CA 4AIEA 3IAQA 1VYRA 3ANVA 1YXDA 2NZLA 2PDIA 2HE5A 3W1AA 4CQDA 1DWFM 4JTQA 1EH9A 4TMCA 4Z2GA 4ZVJA 3CHVA 4RKAA 3EWUA 3SJNA 3RLVA 1IR1A 4QS6A 4UOQA 1XC4A 1G7VA 4UFIA 3VPLA 4WR3A 3PBMA 1NP2A 4WDUA 4FALA 3GNXA 2O56A 5ECVA 2WPGA 3N1AA 3UA3A 3GG8A 1XRFA 3P5ZA 1B5TA 2W9MA 1XIMA 4IG2B 4CD6A 5HMFA 3GHTA 3QY8A 3UYCA 2J27A 1HJUA 4AZGA 1TJPA 3GS6A 4HNCA 4QCEA 3GIQA 1J0IA 3R10A 4OV9A 1XSJA 4CVUA 3ERPA 3L67A 3IJQA 4JFUA 1AQ0A 4ZENA 1DOSA 5TAOA 1CGXA 1QOXA 1B3YA 3PN8A 5DBTA 7ENLA 2OZTA 1KWGA 2PU1A 3WYZA 4EPKA 4XK2A 2EG7A 4BS0A 2HSAA 3EWWA 4BA0A 5EGRA 4KW2A 2JK2A 4D72A 3CZ8A 3H12A 3W7EA 2QJGA 4OQVA 4FF5A 5E1QA 4DJDA 2Q01A 4P7OA 4IPIA 5FSDC 5C8BB 1V3KA 1KM5A 2QCHA 4HN4A 3RF9A 2FJUB 2CW6A 3FXGA 3FKRA 3FCPA 1BG4A 4N9DA 1W1YA 3U2EA 1U83A 3UF9A 4PCPA 4ORMA 4H9TA 1CXLA 1EB3A 3CLWA 4KF1A 5CKSA 1XLDA 2IPWA 4QSHA 5C71A 4F4RA 1F4HA 2V8ZA 4YMZA 1OT1A 3M0JA 3H6OA 5LA0A 2HS6A 2FB2A 1TV3A 3FHQA 5KINA 3EWXA 4QJ5B 2DZTA 4QNWA 3IV3A 3GG1A 1QPOA 5A8GA 2PS2A 5CPNA 2BXVA 4U2YA 1TCDA 1ZBWA 2GQAA 4YJ5A 3W37A 4GYPA 3CV2A 4MZ1A 1FP8A 3KRBA 3PNUA 3NO1A 3KBVA 2V2HA 4IFRA 3NSMA 4Q8OA 5E0FA 1OCJA 1QUMA 2DSWA 3TYDA 5DCDA 1TQJA 2OX1A 1IXNA 1RQHA 1FWGC 2P8CA 1REQB 3LRMA 4JTDA 5A6JA 1THFD 1EC8A 1KXQA 6CGTA 1A3XA 1XLAA 1QW8A 2EPLX 4LV9A 2W6RA 1MDLA 5CJMA 3WDPP 3OO2A 1V02E 1SR0A 1QR7A 3TCEA 1UR0A 4WY0A 4C6FA 2WSKA 3DI1A 4BCEA 3A24A 4ZQRA 2Y62A 3E2VA 5FCZA 3I7RA 1BD0A 5K4XA 3LD5A 4RE2A 4CEUC 3GDMA 3VNIA 4Y7EA 4S3AA 1NH6A 1QOQA 3LCXA 4YPJA 4YTQA 4BKNA 2J7DA 1N8FA 2ON3A 3SR7A 2W92A 4K7YA 2XIQA 1GPWA 1WKEA 4UFJA 3FW6A 1F9CA 3ZR6A 3DDMA 1E1EA 1XJBA 3C0QA 2OR2A 4GGHA 4M51A 1WXZA 4I5XA 4OU1A 3SCSA 4BEQA 1EWDA 7ODCA 3F2DA 2E7FA 3CS2A 4JN7A 3N3MA 2FKPA 3FSUA 1YTKA 3QW3A 1EX5A 3FXYA 2OYKA 5AFDA 4QHRA 1MO0A 1ALDA 5FL0A 2G37A 2GJNA 4XSLA 2AKZA 1NF7A 1ML1A 2YA0A 4LV4A 1E3ZA 3RRXA 4KBXA 4R27A 3MMTA 5E70A 4L5ZA 3EDEA 2UZ9A 4LYPA 5D05A 2L5HA 3AHZA 2ZZ6A 4UMCA 3O63A 3FV9A 1EJWC 3AFBA 2RUSA 3BW3A 4QLJA 1ZGDA 1YW1A 3T1GA 3M7WA 4GKLA 3BGAA 3FKKA 5BWAA 3CIVA 3N9SA 3VIMA 2R82A 2ODOA 4L9YA 3MCNA 5HINA 5H1WA 1QPRA 3VD5A 2WVUA 1V08A 3CQKA 2FH6A 3W7CA 1HP5A 5ABHA 3B0YA 4LX4A 1K6AA 4KWSA 3CHDA 4H19A 3KBNA 1JFXA 2O92A 4YXGA 2UWFA 2WMFA 4F9JA 3L4VA 4CKQA 1GYLA 3M16A 4MKSA 5DY3A 1UA7A 4DX3A 2GJXB 4JTUA 1AUSL 4X22A 3R58A 4NNBA 2VL4A 1LLZA 4UZUA 3VNYA 3B0UX 1A5AA 5G1YA 3H7VA 4FK9A 4CNPA 4FXRA 3A3WA 5BRQA 4QLLA 1RAKA 4L9XA 3PBYA 1FX6A 3BJFA 4Q8UA 3BLKA 3QV8A 3GAYA 3KE0A 1RA5A 3TW6A 4UBPC 3MV01 4PCTA 3GK0A 4MB3A 4GUIA 5A8OA 1PO9A 2KX9A 3WQ6A 9XIAA 2H9AB 1GOMA 4S3JA 2XJ7A 3O1NA 1TG7A 2XVNA 1K7XA 4D6HA 3B8VA 1B31A 1CENA 3BXWA 4AXKA 1TX2A 4H01A 2EPOA 4D6IA 2VDIA 3TLLA 3F7JA 5G4EA 1KBIA 2JKEA 1NU5A 4U4MA 2PODA 1JEZA 3L2LA 4H3DA 1W3NA 4RNIA 2INZA 4PRTA 3HPAA 3I4KA 1TE1A 3MSDA 3BWWA 2FZDA 3KBJA 2J8FA 5HBFA 4KPLA 4PCFA 3NOYA 4RZ4A 4W89A 4KFOA 7REQB 4MKNA 4GA8A 1XYMA 1SSDA 5K9DA 2JEQA 4ZFCA 1JYVA 1BLIA 4LUSB 4A8IA 3C2OA 1BQGA 3NDZA 4UTWC 1SFLA 4G1KA 1WDRA 1YXYA 1E5JA 4S39A 1FVPA 2QCEA 1KM4A 3QOKA 1KRMA 1WDPA 3EOEA 2FGLA 4O10A 1UR3M 1CGYA 4QFUA 2R9RA 4IUOA 2GDQA 2Z7KA 3DGRA 5G4HC 1G1YA 1EJVC 3DHUA 4J3WA 1PL9A 2V67A 1W32A 2R94A 4Z2IA 3G3MA 3PUDA 4GVFA 3AAMA 1YYAA 1NY1A 1TJ1A 1VPXA 3URNA 4WVXA 1Q8JA 4WLCA 3KHDA 2YR1A 1XC6A 3RX2A 4L65A 4HTBA 3TQKA 3AMCA 3T2QA 3LXAA 2IPFA 2PDPA 3OYXA 1Y5XA 4OBSA 3E5BA 1MWOA 1M03A 2G4FA 4XZHA 3GVVA 5XINA 1JD7A 3LYEA 3QR0A 2JGYA 2OOFA 2J4GA 5LKYA 1XR2A 3W3OA 1UW9A 1E71M 3DFTA 2OLSA 1CYGA 1E70M 3NZRA 4AB4A 1PS9A 2X16A 4YVVA 1Q6EA 1VLWA 2I1OA 5FEZA 4M24A 2J7HA 2JBMA 2A3AA 4H6EA 5LGZA 2OT0A 2VUNA 4B16A 2JKAA 2W5FA 2G3MA 4GGBA 1UP2A 3W1RA 1LWJA 3GDTA 1J18A 4N02A 4CEXC 1V7YA 1E5NA 1UG6A 4B91A 3WD4A 1WB0A 3JZEA 3A12A 2GSJA 2FHCA 2CLHA 1K7FA 1TR1A 3WF4A 5A6TC 1PWLA 4US6A 3CL7A 4NJKA 1B9BA 2J75A 4JN8A 4ADSA 4NX0A 1VKFA 4CQ9A 1YKWA 3SUSA 1POKA 3VIJA 1BFNA 2DUZA 4RJEA 4KCUA 1J01A 2ISFA 4WDTA 1V6VA 7A3HA 4XBSA 1GOOA 2QIWA 1G5AA 4W8LA 3FA3A 3CM4A 2BDQA 4ECLA 5HUOA 1E1CA 3UY8A 1M7PA 2G50A 3O05A 3N34A 3QGVA 3EX2A 2J62A 1R3VA 4WIWA 3G22A 5AHEA 3SQSA 2GDUA 1C8XA 4P7LA 1DQXA 2DZWA 1VBGA 2CLEA 2F9RA 5JBEA 6ENLA 1SGJA 2VRJA 5E0CA 5EKYA 2ICSA 3LCHA 4XUGA 3NZGA 1SVDA 3WLSA 1GVRA 1HZYA 4GJJA 3QQ1A 2ZUVA 1V6XA 1DQWA 4B3KA 4FLOA 1H61A 1J5TA 4ZO7A 1ODUA 1K9TA 1SJCA 3KWSA 1F5ZA 4OWGA 1TPVA 3RPTA 1EBHA 4U3AA 2CC0A 4J4KA 1GKQA 3FJ4A 3AMKA 3II1A 4W88A 3IJ6A 1H7WA 3IV8A 1QVBA 3KP1A 3EX6A 2WM0A 1G9HA 1O66A 3OB8A 3SGZA 5G4WA 4LS0A 1F3EA 4JFSA 2ZRYA 4E4UA 3BG3A 4NXSA 3B97A 4H9MA 1OYCA 3O07A 1A47A 4ZB2A 4YCOA 3G1HA 4G9PA 1T0OA 1MRAA 3UXAA 2H3BA 1GVSA 3N19B 3NL3A 3TOYA 1FH9A 4DM2A 2I17A 3P5YA 1V02A 1OB0A 3AYVA 4HK5A 4JKMA 5A2CA 4LH8A 3WQDA 1ZJAA 3SZ8A 3CTLA 4AF0B 2CLKA 1EJXC 4WDWA 1U22A 4J2PA 4Q7BA 3W71A 2DU2A 1RCOB 3RU8X 4ZO8A 1QK0A 2VCAA 4C65A 3WF1A 1TJ0A 1ISYA 2Y7EA 4MUPA 3WLTA 2RDWA 2NLYA 2WZMA 3QN3A 1ADOA 3RJXA 1SM9A 1KM6A 2D23A 1LRQA 1W1A1 4D71A 4LOCA 1B3ZA 1OX4A 1KTCA 3B8WA 3N9KA 3HFTA 2A6NA 1ME9A 1FDJA 4UXDA 5FJIA 3E2SA 2DUXA 4ZQCA 3STFA 2VZVA 1E43A 3H24A 3HMJG 2HXUA 1JULA 4LYRA 4Y8EA 3HG4A 1IQ8A 3UWQA 1IIHA 3VGFA 4AVNA 5HMEA 2BWGA 3W1TA 3G0XA 3VZZA 2PWUA 4IQJA 1QNRA 3BTNA 3CQIA 4C91A 2VGGA 2WHKA 4U31A 1KR0A 4W86A 1T96A 1DV7A 1LWIA 3U2ZA 3ZQ9A 2XFYA 4F48A 2QUNA 4NAFA 4C6KA 4DLFA 1L9WA 1P7TB 4CU6A 2AOSA 3N6HA 3SQLA 3KOZA 4HNTA 4CNSA 1BYDA 1VFOA 3QM3A 4CNTA 1DWGM 3AIUA 2X1IA 5HNTA 4E2DA 1IT0A 2OELA 1TJRA 2WVVA 3VO0A 4US5D 4DEFA 3TX9A 5CSUA 5CH9A 2ACRA 1FUYA 2PA6A 1A3WA 1Q8AA 2QJMA 4A05A 2MUCA 1XINA 3S46A 3QF0A 1UR1A 1Q6GA 1PHQA 3QMSA 4P7RA 4O8AA 4QDPA 2WSQA 1A5KC 3SFWA 1DXIA 5KEZA 2WW5A 4O52A 1R9XA 2R14A 5FACA 1ZBKA 1TVPA 4B5SA 1FWJC 5AC7A 4EK7A 1D8WA 3BMXA 3LBOA 5HXMA 3BMWA 1PHWA 3LDVA 3RRAA 4O17A 3UWEA 3TKFA 4MFEA 4O1EA 1VB9A 2VWSA 3HG5A 5KITA 1VBHA 2DEPA 2A21A 4JD4A 1VC4A 1VFMA 5D2TA 3EXTA 3NPUA 3MPGA 2W66A 4JTTA 3E49A 1R0MA 3A13A 3CV6A 2V38A 3RDKA 3NQAA 4C60A 4RL3A 4ICCX 1L6SA 5F7UA 3KS6A 3WL1A 3WJSA 2A79A 3KP0A 2RAGA 3EOUA 5M1TA 4MWAC 1CWYA 4Y9PA 2DORA 4P7NA 1M5WA 2CZFA 2R91A 1Z41A 4S3FA 4GY0A 4W5UA 1JDDA 1KTBA 1XH2A 2AQVA 4TX6A 3O6AA 4M8UA 2WVSA 2VM8A 2YB1A 1A4LA 5IRPA 4NIRA 3NZQA 3OA5A 4YS1A 2PLMA 4RUBA 5DX7A 2G8ZA 2O9RA 2P10A 2ZKMX 1L6WA 3C0LA 1DIEA 4HYRA 1ZAJA 3AS2A 4UCFA 1FWIC 1S5MA 3FFSA 3S9IA 3WDIA 1Y0EA 3LQGA 1E4IA 2J8TA 4WDXA 1SFJA 4Q4QA 3R5EA 5BMWA 2ZX7A 3LLDA 3MCOA 2DZSA 3MS8A 1EL3A 1Q6CA 3Q67A 3LTSA 4GI8A 1E51A 2ESCA 1XIGA 4A3UA 4AG0A 2V3FA 1GW1A 2QJIA 3VGDA 2IPJA 3AISA 2X0HA 2PDNA 1FKWA 3LCIA 1IEIA 2QIIA 4M81A 3M0IA 3UGRA 3TEVA 5SWUA 1F8IA 3CWOX 1AG1O 1O1ZA 3BARA 1TFVA 5CZ0A 4ZMGA 1HL8A 2ZUTA 2FHBA 3TJIA 1W17A 4O14A 4I8YA 5LNWA 1AMYA 1XUUA 3G3DA 1SFSA 3LM3A 4IMFA 3BJTA 4KQNA 4JNMA 4J3ZA 3TYEA 1IZJA 1RPXA 3D47A 1XIDA 3CUIA 2VC6A 4B4HA 3VDBA 2YCLB 3STPA 3A21A 3W7KA 2GFTA 1UD3A 5E09A 1S3TC 1LYXA 1JL8A 4XZ9A 5EYWA 2ISSA 1YPFA 1H4PA 1IF2A 1UWTA 1UKTA 1W9UA 3VKJA 2PD9A 4GBUA 4XZNX 3WK3A 4FNUA 5A8QA 2GOUA 3PPHA 4RE0A 1PIFA 4ML4A 8A3HA 4IM4A 1JF6A 4A2RA 3P6LA 2ZC1A 3UXLA 3R12A 1LT8A 1ZPTA 4HK6A 4RCXA 5LNVA 1Q63A 3AXIA 2XVKA 3APYA 2Q8XA 1RY8A 2QCGA 3VUPA 3WIJA 4RPQA 4BY3A 4DZHA 4O1AA 3IEBA 4OUIA 4K2SA 3L7RA 1EEPA 5FF7A 4XBJA 4FB7A 4GX9A 4AIUA 3AYSA 2QF7A 2E5DA 1U33A 1UH3A 2YA2A 1BEUA 3V16A 3BCJA 4RXFA 4J27A 4L4LA 3RMJA 1JPKA 4WSHA 2CPUA 5FJTA 3B04A 3ISIX 5I07A 4K39A 1Q4NX 1UWSA 3U2OA 2EXOA 3F2CA 4ZODA 5GNXA 2VENA 3HV9A 4M19A 4QG8A 2WKJA 2YX0A 3WDHA 1MEHA 1EUNA 1GG1A 4M0XA 5A1AA 2GJPA 1QI0A 3WJZA 3MANA 1NWUA 4DXKA 2YCEA 4DF1A 5CPTA 3URAA 3TJ4A 5AECA 4AD0A 1QPQA 5BXRA 3AUJA 1K8XA 1YEYA 2YDQA 3P8IA 1T6MA 5HA7A 4US5A 4HMCA 3ZLGA 3EWZA 4ZTXA 1W54A 5EFDA 4MNMA 1J12A 4NZCA 4PR4A 2VZSA 5D33A 3RNDA 1EUAA 2ZZ7A 4DBWA 3VIPA 3EX1A 4WQ6A 1JUEA 2V69A 4UTLA 1EDGA 1XIBA 4IL2A 3BAIA 5CG7A 1HT6A 4S3GA 2RDUA 1KO0A 3BLEA 1PCWA 1TMLA 2XFWA 4BQ4A 2FPVA 1KR1A 3LRKA 3NFUA 3CXOA 3AYTA 1VJZA 2J7GA 1EOMA 2WYSA 1XGDA 2ZDRA 3L0NA 3DI0A 3GNPA 4GZEA 3HBLA 4I9JA 4QGCA 2GQ9A 4POCA 3U48A 4MZYA 3CQJA 4JDBA 2QQ6A 4FX8A 4PMOA 4DYJA 4UQEA 2XM2A 2O9TA 1O7AA 4GACA 2QYGA 2OODA 4IGSA 1NTHA 4O28A 3IIZA 4IXHA 4K68A 5M03A 1GHRA 1RBLA 5ABFB 1YNQA 1SJBA 4K6AA 4W4QA 4YIWA 5KETA 1VPQA 4F9DA 1GK8A 1A53A 1S2TA 3ITLA 1AH0A 3OLIA 1OFBA 3GR4A 2V82A 2YL6A 3O3RA 1EO5A 4Z17A 1O94A 1GVQA 2KZHA 2W63A 2HV5A 5HPOA 4IIDA 4ACZB 1HGWA 1IV8A 3LNMA 2W67A 1Q2SA 2GPTA 4AYGA 1Q45A 4DM1A 3APGA 2WSYA 3VYLA 3H70A 1HX0A 5HAOA 1RA0A 2UY3A 3WLPA 5AC6A 3VX0A 3HM7A 2C16A 4W9TA 2FIQA 1H0IA 4LS1A 1P43A 4F66A 1M9HA 3KUMA 1EQPA 3UWZA 3B8IA 3M0YA 3VNJA 1NOFA 1XKYA 3Q2DA 3S6TA 3WQ8A 3KAOA 2QW5A 1EA9C 3VVGA 1MQRA 2DSKA 1W1B1 4PBGA 1C91A 4EWND 2ZX9A 1V0MA 2GDVA 3DYOA 3KHJA 2A3EA 3UA4A 4O15A 1GW9A 2TMDA 3WQ5A 4ASTA 3WMBA 3H7RA 1SZNA 4DRSA 3NAVA 3LCLA 3GB6A 4ZB0A 4DY1A 4D6GA 3CYJA 4QIUA 4CU7A 2AQWA 2ISVA 4K3ZA 4ROQA 5D9NA 3TE9A 2HVOA 4LNYA 5TQLA 2XHYA 3W23A 4EPBC 4N9EA 1KRBC 4FZIA 2CLOA 5K9CA 2Y2WA 3WQGA 4HJWA 1T5AA 4GXMA 4EACA 3GNOA 4UFLA 2V5DA 1C8YA 1Z44A 1A50A 1HN1A 3LU2A 4DO7A 3SY5A 1LRTA 3VDHA 1KGXA 3AHTA 5H8PA 2A3CA 2E5CA 4DBSA 3N2TA 4U5IA 2O55A 2A4AA 4A3YA 4JCLA 2OOGA 5E93A 4GNVA 3KWXA 3V7PA 5I3GA 3W73A 2XZ7A 5IFTA 2XN1A 3CH9A 3L68A 1RHCA 2VUYA 4GINA 1GEHA 1Q6DA 4D6JA 4J2MA 1H7PA 1VF8A 1UZDA 4LFYA 3TTEA 1QCWA 3OVGA 1GJUA 2J47A 3ZSTA 5EU9A 2WNWA 1TPEA 1F74A 1TX0A 4Y9AA 2VRKA 1E15A 4G6CA 3LCWA 3NPWA 1X7IA 1E9ZB 3TU9A 1W5QA 3HOJA 1JCXA 3IIVA 3THCA 3FS2A 1LOSA 3AJXA 3OIHA 2B7PA 3DBNA 2CWNA 2BASA 2IQ0A 1UHVA 1XI3A 1PYMA 3DG6A 3MP5A 1DWAM 1ZENA 2NXIA 4OUEA 4AZ5A 1E9IA 3LGGA 1ME8A 1FKXA 1LOQA 3H21A 1XISA 4KEZA 5MHBA 2XSBA 1ICSA 3PZNA 3XIMA 5AYIA 5JXQA 2ZRWA 3VIIA 3LTPA 2GQ3A 3HU7A 3RM4A 1XYCA 1I60A 3IJ7A 3UBPC 1LL7A 3W26A 1GONA 3L2IA 1Q6OA 4IJBA 4UTUA 4MWAB 5FF0A 2QDEA 2WKLA 4L64A 3OODA 2D2HA 1XXXA 1J0ZA 4HIBA 5DY2A 1EZWA 4QJ1A 3UZWA 2Z29A 4QJ4B 4IISA 3GC2A 2QUMA 4EF8A 3GQYA 2ZX5A 1FCBA 1DHKA 4JL2A 5BU6A 4Q8VA 2YCKX 2GK1A 4UNIA 4QM1A 5C9XA 4PUWA 4ONVA 4V1YA 3GIYA 4L9ZA 1LT7A 3GFYA 2CZDA 1U1JA 4ADUA 4RPPA 5IBXA 3T0BA 3MP3A 1EP1A 1RBOB 1ISXA 2OX4A 3EDKA 3KXQA 4ZQPA 3CAQA 3IRSA 2GLKA 4MKVA 2BV9A 3AYRA 3B9NA 3VMPA 1YX1A 2HPMA 4BF9A 3VCNA 2HK1A 2E4TA 4GQBA 1P1XA 3IIOA 4DJDC 5I24A 2P8BA 5IDIA 3ZIZA 4H7ZA 3WUBA 1TV2A 2VEPA 4AY1A 3UERA 1QI2A 2QCNA 4X0NA 4MDOA 5F4WA 2NV2A 3NWRA 4S3BA 2PZ0A 4GY7A 2RFGA 5EMKA 4UTTA 4FMVA 2CIPA 4KT2A 2PDYA 4S3DA 4JN6A 1SFTA 4PGLA 5IHRA 3W38A 4OBTA 5A69A 4XO6A 1JRBA 2PDXA 1JCJA 1UUOA 4PMZA 1SYTA 3N17A 3QVQA 4QG9A 3ABQA 4KWWA 3BZGA 1JJKA 1JYXA 1S1RA 3TAKA 5JUVA 2QLYA 3ZOAA 4IMDA 1Y7VA 3GHRA 3WD1A 4W7UA 4AMCA 3AS1A 4GYPC 2WWDA 3MSRA 3ARXA 4NZ5A 1H0GA 3PTDA 3T2PA 3AU2A 3S2LA 4L4OA 5HUPA 2V3DA 1XICA 4IGNA 3RX4A 1K4GA 1CT5A 3AALA 1OM0A 1A49A 4K38A 1QHZA 9RUBA 1W5PA 1T8XA 4ZEPA 3IIXA 4BQ3A 1FRBA 2B7QA 3W27A 1E6QM 4LRSA 3OZYA 1XIHA 1JYWA 3NDYA 1ZS2A 3K4WA 2HWGA 1F05A 2XIBA 1IWPA 4NJHA 1K8ZA 3U8GA 3LI1A 1UQZA 5PTDA 4GMEA 2NQ5A 1WZMA 3QSRA 1RJPA 1OYBA 2WZTA 1B57A 3T07A 4QDWA 5AZ0A 3N6JA 1M7OA 1GKPA 3QTGA 4B5VA 3ITVA 2OGYA 2GGIA 3I7SA 2Z26A 4K8GA 2VX5A 2E0PA 3EA3A 4E2BA 3KLLA 2D1ZA 4DXXA 3SN1A 1WX0A 4XUYA 4WJXA 3OZPA 4IG2A 1VAHA 4FNTA 1C9DA 4LUJA 4PTMA 3NJ3A 1TPWA 4JIRA 5I5RA 2Y61A 4JYFA 3NL6A 4H8UA 4LBSA 4UFKA 1TPDA 2DVUA 2NT0A 3FDKA 1FWCC 4Q4PA 4JS3A 2X09A 4P2VA 4RR4A 2VEMA 5E0KA 3TXZA 1BGGA 3EOOA 4GH3A 3VOFA 3ZJ7A 4HOXA 3MUZ1 4LAKA 1W56A 1XDMA 3LK6A 4N7QA 3AS3A 3CNYA 5AYXA 3HO8A 1OGSA 3BH4A 1R6WA 1IWAA 3W53A 4L56A 1RD5A 4LUIA 1ZB5A 3BAYA 3FNDA 4PTNA 1G4EA 5ABTA 4PCNA 4GZIA 2D3LA 2FVLA 3W7GA 3WH6A 3I7QA 5CC5A 2AL2B 4C6CA 3UP8A 4OOUA 1P48A 4LBUA 4LF1A 3G1FA 1FWTA 4I7UA 5T9CE 4ZL1A 1A5CA 1WCGA 4GI4A 4C6BA 4UTJA 3IS4A 4CQAA 3AO0A 1HKMA 3DENA 3VKCA 2GGHA 4GNKB 5CXPA 3RIKA 3K13A 3ARSA 4IJCA 4IXXA 3DC0A 3NPVA 2ADAA 1VLIA 1IE7C 4ZSUA 4H2CA 4X63A 3TMLA 4AZCA 3L5LA 4DAIA 1CDGA 3M5VA 4KCVA 3M0XA 3H23A 1XYBA 4FNSA 3QH2A 4J3VA 4LY4A 5H8MA 2VURA 3NEHA 1S2AA 4GC3A 2B7OA 4AC1X 2NT1A 4GHRA 3P0WA 2REQB 1MEWA 2YDRA 3WH8A 3KFTA 3SSJA 1H63A 4IPLA 2BHZA 1AA1B 1Q13A 2DVXA 1J2BA 4EVZA 4U5KA 5KZDA 4Z2LA 4XAFA 2DY3A 2ACSA 5FAJA 3HFYA 1REQA 3MHFA 3HQPA 1TSIA 4QR6A 2VEGA 3T9PA 1U5HA 1OFOA 1JG9A 2ZX8A 2J7FA 4UMAA 1ONEA 1FY6A 4M82A 2OQYA 2ASHA 3UZXA 3EBVA 1Q2RA 3R79A 3WSUA 1LP6A 2GJRA 1KFWA 1KFJA 3H54A 3NQMA 3W70A 3CL6A 3ARRA 3L65A 1IWBA 1J0YA 2OWCA 5FAGA 1HFBA 3SDOA 3DH7A 4QX4A 1C7TA 3TXVA 3ZT6A 2VCBA 5D32A 2OCZA 1T40A 1E6RA 1A4MA 3NVTA 1WUEA 4HOWA 5BW6A 1E6XM 4TTUA 3DXIA 1GVYA 3M47A 3MUY1 3TTYA 3R13A 3CUHA 4DLMA 1TRDA 2PLJA 5HNNA 3GG7A 3S2JA 1EYWA 1ZAIA 1H11A 3A47A 4HP5A 4C6EA 3SRFA 4EX4A 1U5JA 2E1DA 3T8QA 3UETA 1TQXA 4GKTA 3BICA 4AZ7A 2FPYA 4C6DA 5A8PA 4PUMA 4ACYA 1DWHM 5M3WA 3WJWA 1JZ8A 3S1WA 1Q65A 1K9EA 3ITTA 2FFCA 2A6LA 3JW7A 4AC7C 3MYOA 4QSFA 5IFPA 3T44A 4Z42C 2WVTA 5LIUX 1RUSA 1C8VA 3K4DA 2YL8A 2XUCA 4ZOAA 3GAKA 3SBFA 3EMZA 1VS1A 2PTZA 6ALDA 4Y2WA 4M6UA 4GZ7A 3B9OA 1GOKA 2PBGA 3H53A 2FFIA 3G8EA 5CLTA 4TVCA 3CQ0A 4AHQA 5DBUA 4AHPA 3ZXWA 4BEUA 1W3JA 4UC5A 3E5PA 3WEOA 2P53A 1OQFA 5M2FX 3SIZA 1XSKA 3DKLA 1ITUA 2FLIA 4ORIA 1AQFA 4TX9A 2DT1A 2G3NA 2XINA 3V0SA 3VNMA 3WQCA 3GG0A 1RD6A 4U2ZA 4OOZA 3A9IA 2CBIA 5FEPA 3XINA 2VHLA 1VRDA 3Q4DA 5HULA 5FOOA 2NV9A 1Z69A 4AZ6A 3WBWA 4PUKA 3QOMA 3SCQA 5LIYX 4X9YA 3MI6A 1JAEA 1ONWA 2F2KA 2WOQA 1B30A 3KL3A 4Z2KA 1PKNA 3C4UA 5HQEA 3QFEA 2NSOA 3EX3A 1XH1A 1X98A 3QJAA 1NDVA 2OXNA 4JY8A 1Y8BA 3WELA 2ZFAA 1OX6A 2FH8A 4FX6M 5D4YA 3EKLA 3W7JA 3GY1A 1F76A 2H9AA 1UR9A 3G24A 3W28A 1TWDA 1EIXA 2EJ1A 3CZGA 5EMUA 3IJLA 3CAVA 4UTIA 2HBXA 1ZJBA 4LVAA 2FZMA 1PEZA 1LG2A 2QV5A 1M04A 3O9NA 3KBSA 4J3XA 2QR6A 5CSYA 1VD6A 3UY7A 5E9XA 2BHUA 4ZE5A 4XTDA 1FCUA 2Z2UA 3Q37A 2IQTA 4XD4A 4B15A 3MV11 2AAAA 5DMLA 3CK5A 3NL5A 2Q02A 4OFCA 1GCYA 3SURA 2G95A 2WLZA 2Y63A 4S3CA 7REQA 2E8ZA 2OMAA 3IANA 3UPMA 3N2BA 2Y0FA 4JTGA 3WNMA 1OY0A 3CV1A 1YNPA 4I7VA 3I3DA 2X05A 4IMAA 2QGYA 4LUSA 1KFEA 3H2CA 4JQ1A 4GK8A 1VCVA 4GC4A 1NELA 3MCMA 1QOPA 3EKGA 2PTDA 3QKZA 4UWMA 2PTXA 3K1GA 4O1CA 2Q71A 3HPSA 2V2CA 2Z1BA 3ZVHB 1E0WA 4TVDA 2HISA 3WD0A 5ENLA 1KC7A 1XLMA 1K8YA 2PDQA 1A5LC 3HN3A 3M64A 3EKZA 4CCEA 1JDFA 3TTSA 1T7LA 2CZ5A 4PODA 3O6DA 3NQGA 4A21A 1RK6A 3HURA 1DYSA 1CGWA 1PZ0A 2WQDA 3NQBA 1MNZA 1X8CA 3F4NA 2VFEA 1S38A 1H41A 3MVTA 1XYFA 4K37A 1D3HA 4AXNA 2C0AA 3SRKA 1Y5WA 1RXOB 4FOJA 1JVNA 3GBEA 3WLJA 1AD1A 1JXKA 4LEFA 1H7XA 3JVAA 1E4NA 4DB7A 1G67A 2DH3A 1SQ7A 4UQCA 3KOXA 1LUCA 4TIMA 2ZZ1A 3HPXA 3NL2A 5J5DA 3M0ZA 3CPUA 2R1MA 2NVCA 3R0KA 4CUCA 5JH2A 3QPEA 1K8CA 3BC9A 3T05A 4GCAA 2VYOA 3FJLA 1I0BA 3E74A 4EPEC 1W3HA 1BVZA 2ZQ0A 4H7CA 1SZRA 4C6NA 5DMYA 1V03A 3OBKA 4XX6A 2R6OA 2V3GA 3DFHA 3W6LA 2BGQA 1RVGA 1AL8A 3GD6A 2DIEA 1PYFA 1XBYA 2PF0A 4GNJA 2BODX 2X7WA 4FF7A 4NXKA 3W7RA 4JY9A 4URIA 2D2GA 4KKXA 2EPHA 4LF2A 1PUDA 4MOZA 4QQ3A 1PBGA 4IIFA 1GTEA 1LWHA 3NYDA 5EB8A 3NYZA 3C2VA 3S0CA 3CTTA 1PSCA 3KL0A 1UKPA 4QEHA 4L6HA 3AI0A 2WCGA 4OVXA 2WAGA 3OPSA 4JTLA 4WKAA 2VC9A 4XKYA 3OG2A 4WY0B 3T55A 4N6EA 4HA0A 4TU1A 3BDKA 2YDSA 2PWEA 3CJPA 3KRSA 3WQWA 3MKKA 1FP9A 1QPNA 2VT0A 3T6CA 5CPOA 4F0MA 2B4GA 2F8QA 2G3FA 4KGLA 4KIRA 4Q6XA 5DCBA 5CG0A 3HJEA 3HF3A 3AUOA 3G2GA 3DESA 1P0BA 5FF4A 5FKYA 1F6YA 2POTA 1GKRA 2TAAA 4U3CA 1C92A 4YVPA 2G41A 3DU0A 3ECQA 3CWHA 4NYUA 9CGTA 1E73M 1K1DA 2W27A 3N73A 1BQCA 4KRUA 2YCJA 3L9CA 5JBDA 3ME3A 1AZ1A 3N4AA 2V5LA 3A22A 3E96A 3T40A 4BZYA 2JF6A 3VDAA 4EWJA 5GNZA 3LBCA 5L6UA 3PSVA 3NOEA 4PMUA 2PLCA 3G0UA 3VTRA 3WLOA 1AW2A 2LLEA 1VCGA 2OFJA 4R33A 4B5UA 2J6XA 2CLMA 1F8MA 3AOFA 1F3TA 2ZUWA 3PHAA 5LHFA 3ID7A 1XM3A 1N55A 1KFKA 4TV6A 4XISA 2YJQA 1V6WA 1XCXA 4PBEA 2H3DA 3OW1A 4MYAA 3T7VA 3TN3A 1AH3A 4M7TA 5J04A 2JIEA 2ZIDA 3V1HA 3N11A 2YBTA 1IEXA 3PF3A 2OYLA 4PRRA 2Y5JA 4UFHA 3IJDA 4GX8A 3L66A 2G5WA 2QULA 5BOEA 2CERA 1L0PA 5FESA 3EX4A 1PKMA 3PZGA 1U1HA 2QCDB 3VMNA 2ZRVA 1KTNA 1G4TA 1V79A 4LU0A 4DQWA 1UKOA 2DZAA 1OGBA 2GVYA 1MMFA 2PI6A 2V68A 4JGDA 2CHOA 2I5QA 1ZJIA 4N0RA 4EP8C 1UMYA 1TA3B 5LNSA 1SO4A 4ZSTA 2YZ5A 3BQ6A 4JYDA 3KS5A 1X97A 3CWNA 3CAKA 1R9ZA 1I4NA 2WCSA 4DWSB 4ZXOA 4HPJA 2BXYA 2PTWA 4H9XA 3OTRA 2Z27A 4L1WA 1I75A 3N25A 4RE4A 5GVJA 5BRPA 4WSKA 5C9RA 3GU9A 4FLQA 1HIZA 3NA8A 3E1F1 4HHMA 5AB3A 1HL9A 3KBWA 2YW4A 3WJXA 3LHWA 5BYWA 1JPMA 4MAZA 3TWAA 1BAGA 4XD3A 2YLLA 3TUUA 3AIRA 2ZC8A 1J2WA 1P7TA 3CB3A 4MSSA 3WBEA 5CZKA 4XWUA 4HNLA 3CMFA 1V0NA 4IWWA 5XIAA 3A3XA 3K2GA 3H4GA 4XD6A 1ZU8A 4B92A 4EANA 3OG3A 3HQ1A 1VPYA 3PZMA 1XLKA 1X96A 2HNEA 4JEQA 3W87A 3MU7A 1QO2A 3GX9A 4KCTA 3PM6A 2E68A 1KNWA 2G3JA 3BL3A 1JIBA 2RDTA 3UWWA 2NQLA 2F7FA 3MDUA 3SCPA 6TAAA 2PWFA 1LTDA 4GPNA 4IX2A 1EDTA 1M6JA 1OFPA 2J8GA 3L4YA 3WQPA 3PANA 4W93A 3BPWA 2QF8A 2QCFA 3E0IA 3ABXA 4NNCA 4DZ5A 1MW1A 2FMOA 3ARQA 3UR2A 1KBBA 4DPPA 2Z6JA 3UG4A 4LJ3A 3TIMA 3A4WA 1BSLA 1PJ9A 4M1RA 3K4AA 1VCFA 3L4UA 4PUDA 4Z1DA 1YDVA 4NJGA 4PTWA 3SCVA 4N6FA 3OZOA 3C2EA 3UWYA 1M53A 3IIPA 3WQVA 2NWSA 3LPGA 5FJOA 3URBA 1IHIA 1AQHA 1V51A 3VABA 4FR1A 4UB9A 2ISDA 1G4PA 3CO8A 5DF0A 4DYEA 3L12A 1H49A 3IGHX 3LUTA 4I5UA 2PU0A 1ONRA 4IJRA 1DVJA 1Z42A 2YDAA 4BFAA 3ZJ8A 3SW6A 1Q6FA 3TP4A 5FIPA 2BY2A 2ZA2A 3ARTA 4L80A 3A5VA 2RGMA 1TV8A 1CLVA 3JUGA 4NAEB 4RK8A 1TELA 3C2RA 1ZL1A 2ZUNA 1KM2A 3FYOA 3VKAA 4S2CA 3C2YA 3NZ1A 4Z08A 4AVOA 4EKJA 1OABA 4WJEA 1XKJA 3R89A 3P84A 1DJHA 4TX8A 1AJ2A 1V8EA 4E2VA 3T0AA 1WOBA 3VGHA 2ZE3A 1V3IA 1GOWA 3DECA 2J78A 4HA3A 3AMLA 1WZLA 1OEPA 4CNNA 5CC3A 1TWSA 4PMRA 4Y9OA 1GEQA 1MSSA 1F73A 3M6DA 2NVDA 4NZ1A 5AYBA 2ABAA 2BP1A 1AJ0A 2E9BA 3OOQA 3PUOA 1EF2A 5D38A 4GFSA 3Q45A 4J3SA 1KV8A 2DW7A 3ALFA 1ISVA 3W6MA 2ZE0A 1RJQA 3R8GA 2PPGA 2RGLA 3TV8A 4NJJA 5ABGA 3FN9A 1P0NA 2JGQA 4O11A 1FWRA 8XIMA 1JQXA 2TYSA 1MFVA 1LLOA 5GJPA 3VM5A 4ML9A 4NYYA 3M43A 1NSJA 3P82A 4D6FA 2XN0A 4D8AA 3G0SA 2WANA 3O8AA 3PBUA 2ZADA 1V0KA 4PMXA 3WH7A 5I3FA 2BFGA 1UJPA 2AAMA 3UJFA 4B2DD 3R0UA 3REQB 3NQFA 4DZAA 4Q7IA 1WE5A 3ATZA 1QHPA 3B9DA 2NX3A 1J93A 2IXVA 1EIBA 1IEQA 3WQOA 2ZCGA 4K8HA 1X1ZA 2Z1XA 4PBFA 3O6YX 1GQJA 4JZ5A 1Q7QA 1OCNA 3VIGA 3W2NA 2XIMA 3LXCA 4RNFA 1UD6A 2WNZA 1HKJA 4IPNB 4M6PA 3D3FA 1K4HA 1R3QA 1YXCA 3AWNA 3S6OA 1TTJA 3VOCA 1MW2A 1WPCA 1YPXA 4P5UA 1OSEA 2JFEX 2E6AA 3KM8A 2NVAA 2CEQA 3BANA 4XTIA 3PS7A 1H62A 5I78A 4HQVA 4DJFD 3GDKA 3S5OA 1VQTA 1DL3A 1HJVA 2A85A 1SUXA 1R3YA 2E40A 3R4IA 1S5NA 1X1NA 2WMIB 1EBGA 4MPKA 1LBFA 4RNJA 1O6IA 1F6PA 1OVDA 5JIWA 2WKGA 1W3IA 2EEXA 4W7VA 2UV8G 1BTMA 4AIOA 4ICNA 4V28A 4JTHA 4ADTA 3AQUA 5K9XA 3KVLA 4S3KA 5G2IA 3EA2A 1RP9A 3BW2A 5G5IA 4XBKA 3TLQA 4ERAA 2HDJA 1YBQA 2OZ0A 3U3HA 1FXQA 3PULA 4C6IA 1LL6A 3M0HA 2GVEA 1VFFA 4K7VA 2DVTA 1MUCA 1G0CA 1VEPA 2GVJA 2DFAA 2XM1A 3ITCA 4Z1AA 1NM9A 1BWKA 3ALGA 5GQBA 3W4RA 5F1VA 1SSGA 3NNTA 1A5OC 2P3EA 1HJXA 1DQUA 3VE9A 3PTMA 4L6OA 3B05A 4RNHA 4AWUA 1RY0A 3LN3A 4JQAA 4A8RA 1Z7AA 1BXCA 1ZCOA 1MXDA 3BG9A 5E5CA 4BI5A 2CLFA 3LTYA 3NQDA 3RCMA 6REQB 1Y5VA 4DUXA 4YYFA 2VVSA <