3EB4A

Voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
327
Chain Sequence
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cortisone dissociates the Shaker family K+ channels from their beta subunits.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, oxidoreductase
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 123
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3eb4A00
1Q5MA 4XK2A 3CAVA 3M0IA 3C3UA 2I16A 5AZ1A 2INZA 3R6IA 4HMNA 2HE8A 4RPQA 1EKOA 2HVOA 2ACUA 1PZ1A 3LNMA 4XZNX 2R24A 2IKJA 3O3RA 4JTCA 3V36A 5M2FX 4FZIA 1AH3A 2NVCA 3LQLA 4OTKA 4DBSA 3CASA 1PWMA 2ISFA 5LIYX 4IGSA 4PUUA 3UP8A 2P5NA 2PDHA 3GHRA 3UYIA 2PDIA 3D3FA 5LIKX 3M4HA 3GHSA 4PMJA 1X96A 1ZUAX 3F7JA 1XF0A 3CMFA 3O0KA 4JTAA 4ASTA 2PDWA 3WBWA 1J96A 3LD5A 3NTYA 4PRTA 1A80A 2HE5A 1AFSA 3V35A 1T41A 4JTQA 2I17A 2ACSA 4FA3A 4ZFCA 2HDJA 4JQ3A 4QX4A 1S2CA 3ONBA 3ERPA 4LBRA 1EL3A 4F40A 4YS1A 1AZ2A 2PEVA 3Q65A 4JTRA 2VDGA 2PDCA 1AH4A 2PDNA 1ZGDA 4YVVA 4I5XA 3EAUA 1AZ1A 3RX4A 3V0UA 3R58A 2PZNA 1RY8A 1IHIA 3WG6A 2CLPA 2BGSA 3UZXA 4XAPA 4JQAA 4YVXA 3BUVA 4XZIA 4GIEA 1Z9AA 3CAQA 1S1RA 1FRBA 1MI3A 4WDTA 2PDYA 5LIXX 3G5EA 4YU1A 2IKIA 4JQ1A 3BCJA 2HEJA 3S3GA 2ACRA 2PDBA 4L1WA 4YVPA 3UZWA 3R94A 4FALA 2R9RA 5HNUA 3FJNA 4GA8A 2FZ9A 4EXAA 5DANA 2WZMA 1X98A 1YNQA 3B3DA 1RALA 3H7RA 2IQ0A 4MHBA 4PRRA 3EB4A 2NVDA 5LIWX 1LQAA 1XGDA 2IQDA 2IPJA 3RX2A 2FGBA 2F2KA 4QBXA 3LN3A 4R9OA 3H7UA 4Q7BA 4IJCA 4WRHA 4JIIX 2J8TA 1R38A 1Z3NA 2HVNA 4HBKA 4IJRA 4DBUA 3UZZA 4XO7A 5LIUX 4Q3MA 3BURA 2DUXA 3R43A 5HNTA 2ACQA 3N2TA 2DV0A 3KRBA 1M9HA 1YNPA 4L1XA 1Z8AA 4JIRA 3UZYA 1PWLA 1VBJA 2PDUA 3T42A 2PDKA 5C7HA 4WDXA 1T40A 4LB4A 2PDPA 4WEVX 1MZRA 1MRQA 1PZ0A 2BGQA 2PD9A 2IKGA 3WBYA 1RY0A 4DBWA 4GACA 4LBSA 3LENA 2ALRA 3UGRA 4XZHA 2FZBA 4QR6A 4PR4A 1ADSA 2PFHA 5KETA 2INEA 4XZLX 4WDUA 2FZDA 3QKZA 4JQ4A 2FZ8A 1UR3M 4GQGA 2PF8A 2PDGA 5HA7A 3EB3A 1QWKA 4WDWA 4AUBA 3WBXA 3LZ3A 3UFYA 4NKCA 1LWIA 3LEPA 1X97A 1K8CA 2PDXA 4LAZA 4LAUA 1YE6A 2IPWA 1OG6A 2BP1A 2PD5A 1IEIA 1S1PA 3MB9A 2IKHA 3V0SA 4DZ5A 3WCZA 3GUGA 3DOPA 4XZMX 1ZSXA 4WGHA 1HW6A 2IS7A 3CV6A 1ZQ5A 2PDMA 1AH0A 1Q13A 3COTA 4GABA 4ICCX 1S2AA 2PDQA 1EF3A 3P2VA 3UWEA 1VP5A 1PYFA 1Z89A 3M64A 3DN5A 3ONCA 2IPGA 2PDFA 4H8NA 3UG8A 2WZTA 4GQ0A 3CV7A 4XO6A 2PDLA 4PUWA 5JH2A 3LQGA 1QRQA 3R8HA 4FAMA 1US0A 2HV5A 4G5DA 2A79A 3GHTA 1YE4A 4XVEA 3LUTA 3BV7A 1HQTA 3FX4A 2FVLA 2QXWA 3LBOA 4H7CA 3V0TA 5JH1A 3GHUA 4LB3A 3N6QA 4QXIA 2F38A 3G1RA 3VXGA 1EXBA 4XVDA 2DUZA 4JIHA 4JTDA 2IPFA 1C9WA 2PDJA 2C91A 3Q67A 1SM9A 3R8GA 1GVEA 3U2CA 2AGTA 4GCAA 3RX3A 3R7MA 5AZ0A 4EXBA 3H4GA 3LZ5A 1JEZA 3MC5A 1XJBA 4JQ2A
chains in the Genus database with same CATH superfamily
2BODX 3GDKA 3PS7A 5HATA 1ODZA 1BSIA 1VCFA 1BEUA 4C65A 3LCHA 3MBDA 2Q01A 5FSDC 3SGUA 4QFUA 3RR1A 2XISA 4WXZA 1POKA 3WFLA 2PCEA 3EOLA 3HPXA 5D04C 4LANA 1F05A 4GVHA 4ADTA 3TW7A 4H8UA 3UY7A 3WUEA 4YWIA 4C5ZA 3V36A 1TPC1 3QMSA 1XD1A 1PTAA 4OTKA 3B4YA 1V02A 2ZUVA 4MADA 1Z44A 1GEQA 1X1NA 3O07A 3UG5A 4BF5A 1GPWA 3S0CA 3T4CA 4M24A 3LSBA 1B1YA 3UP8A 4HZMA 2WMFA 4M80A 3GE7A 1VFLA 3QZEA 3RYSA 1AVAA 1UR2A 3PWIA 1IEQA 4FB7A 2FQIA 1QOXA 1ZUAX 1Q6RA 3S1GA 3ZT7A 2BNJA 4GXWA 4ZB5A 3EKGA 1PJ9A 1G5AA 3SCPA 3ARQA 3GR7A 3PUDA 4H04A 2D2OA 3VAVA 3DHFA 4D2JA 1B3XA 5H2ZA 3B0PA 1JXKA 3L4WA 2VJXA 2YDRA 4RUBA 1QTWA 9CGTA 4HNLA 4PTVA 4IT1A 2F2HA 2GPTA 3E2SA 3CUFA 2JFEX 2QPUA 4MM1A 4IIGA 1H1ZA 1A5SA 1RJQA 1HVXA 3CL7A 3U5UA 5BOOA 2C6QA 1AZ1A 1UD8A 8XIMA 5HNRA 2XWEA 1I9CB 3PZVA 1ZP4A 3WL0A 4HCDA 3PTKA 1MMFA 1QOQA 4ZBCA 3PVFA 4WY0A 4L9YA 2RDWA 3GRIA 3CAQA 1MI3A 1QNSA 3NPVA 4FXFA 3OVRA 1XISA 3G5EA 4JTSA 1UR9A 2ZA2A 1E56A 3MO4A 4JGDA 1UR0A 4AD4A 2PPGA 2PLKA 3URQA 4BR1A 2Q02A 1M7PA 3QGVA 2PDBA 3W71A 1L6YA 5CAKA 3UCDA 3SCUA 2YCKX 2I56A 1HJWA 4UR9A 4PUKA 4RDZA 1TV8A 4GA8A 1FWTA 4A05A 4O8RA 4D6FA 2Z27A 1A5LC 3GDRA 3BZJA 2NQ9A 4PCSA 1OIFA 1TJ1A 1TREA 1F73A 1CT5A 2VEFA 4GYFA 4OJYA 4UTJA 1FTXA 2CLHA 3KVJA 4L80A 1XGDA 2JKAA 2X09A 4X22A 2ZE3A 2X1IA 5LSMA 4HNOA 1TTJA 1XYFA 3N2XA 1VFSA 4J5NA 2VWSA 1C7SA 4QBXA 2CHNA 3H6OA 2Q8LA 1WNOA 1CLXA 3F5KA 3CL8A 3STFA 1UC4A 2J7CA 1FWBC 3N1AA 3H2MA 1V0LA 3G1XA 3BW4A 1UASA 1LUCB 1V3IA 4GE8A 3DI0A 4PMUA 4DO6A 4GBUA 4KH2A 3BAJA 1P0KA 3E2VA 2XIMA 4HPNA 5LKYA 2DDXA 5L9FA 1E51A 2WHMA 3CQ0A 1W1PA 1EGZA 3CAWA 3VKKA 3ZVHA 2J7FA 4PB3A 4EPEC 5TNVA 2BVDA 4OIFA 5I3IA 2BB0A 3EWYA 4MAZA 1KLYA 2J78A 2QIWA 2WMIB 3NQ6A 4WSHA 5FI8A 3AIEA 3MS8A 3RCMA 3BK0A 1KFEA 1I1XA 2X0SA 2ABBA 3FV9A 2QJMA 2EJ1A 3K8LA 1E15A 1G7VA 4JQ4A 2GSJA 1M04A 3W1MA 2VEPA 1D3CA 3TTYA 3W9ZA 1W1B1 2NLIA 4IPJA 4D8LA 3NG3A 3LZ3A 2HPMA 1IEXA 1VQTA 2BXZA 3CZ8A 3H26A 2ZQ0A 4RNHA 4GI6A 3L5AA 2P53A 4EAMA 5HQEA 3NYZA 3WH8A 4ZSUA 3E96A 2Q8ZA 4PA8A 3ZMRA 1H11A 2DEPA 3CIWA 5G2WA 2CHRA 4YWSA 4NXKA 4WY0F 5CSSA 1XLMA 1Q13A 4GABA 4Z1DA 2A21A 5GVJA 5A6LA 4DO7A 4HIBA 1FWSA 1WUFA 4X3ZA 1TJRA 1IZKA 1P7TA 4Q4PA 2PZ0A 4GFSA 2J79A 1N8WA 3FYYA 4EP8C 3OVQA 3UEQA 1O66A 4IIFA 1OFAA 2BG5A 4IPNB 2X8RA 3MUAA 4RLIA 5A6AA 4NVTA 4UZUA 1YNYA 4UMCA 2E5CA 4L9XA 3TQ0A 4GYPA 1QWGA 1US0A 2HV5A 1J01A 1QHPA 3WD3A 3AHZA 1YE4A 1M41A 2DSWA 3K4WA 2LLEA 3QPEA 3HGJA 2GVJA 4RNIA 2FYMA 3KBWA 4H41A 2C79A 2YDAA 3M9YA 3BOXA 1Y65A 1BRLB 4LB3A 4E5TA 2WQDA 3L4TA 1JPDX 2ZUTA 1XLHA 4HP5A 1MEIA 3VCNA 4XVDA 2IPFA 3L65A 1F74A 2G97A 5SWUA 1SM9A 2DW7A 3QW3A 1XIDA 4PSRA 2J66A 3NQAA 2DZPA 2PURA 3GUWA 1CXFA 1H50A 2G5WA 5I79A 4AX6A 1D8WA 3SGZA 2FH8A 4LNYA 4REQA 4C6FA 1UIOA 1XICA 2O7QA 4EX4A 1RCXB 4AWEA 3KBMA 3EDKA 3VFCA 2QYGA 3SQSA 3I7SA 5A2BA 2R24A 3POCA 4ATWA 1U83A 4F48A 5I23A 5D02A 2H8XA 4NILA 3ES7A 4V1XA 4HHLA 1D9EA 4XD6A 1JPHA 1AH3A 3VGFA 1QFEA 5IBXA 4ZQRA 1O1ZA 4DBSA 1PWMA 1GORA 1GOKA 4PMRA 2PWFA 1SO3A 3FHAA 2PWHA 1BXBA 4W89A 2P5NA 5D2XA 3GHRA 5C5YA 3IJLA 1Q65A 1NDZA 3OHIA 4J27A 4O1BA 4IP5A 2PDIA 2V2CA 1XIIA 4UBPC 3HQNA 3UJEA 1NOUA 5D9PA 5KTLA 5A8GA 2XFWA 3FSTA 2CZDA 3RGTA 3VIMA 2ZRYA 4ASTA 4OQVA 3BZGA 2OCZA 1ZENA 2QMKA 3CIVA 2G41A 3O6DA 4DX3A 4YTRA 3TVAA 4CN4A 3QJAA 1US2A 2QKFA 3AIBA 4HHMA 3T0AA 3BCDA 5BRBA 4JQ3A 1W2VA 4MJ4A 4OU1A 4AD0A 2AMGA 1DORA 1PZ3A 3LDVA 2AGKA 2AL2B 4BWLA 2Y6ZA 4DO4A 1NDVA 1PTGA 2AL2A 3EA2A 3PSVA 2W27A 2WHLA 1KRAC 2ZDRA 1WV2A 3W1AA 4RE0A 1EGMA 3N12A 4R33A 1MZHA 2VOTA 2FDMA 1F4AA 2QJGA 4XZIA 1GVOA 1WZAA 3BL3A 2XWDA 1Z9AA 2YCJA 2EQDA 4Z2KA 3W7PA 3WLTA 3TA9A 3ARUA 2PDYA 2JF6A 1XKYA 1SZFA 2C13A 2WCGA 3N6HA 1NEYA 3DZ1A 3PWAA 2JBMA 2ACRA 4OBSA 1EP2A 4GX8A 5CGMA 1FOBA 3GZ3A 2NWSA 2DVXA 1TFVA 1X8FA 2WVUA 4MDPA 1GKPA 1HKMA 3H7RA 4WK9A 5C9XA 3SJNA 3FEQA 1N8FA 4DZIA 4H9UA 4XAZA 2NVDA 5LIWX 1LQAA 4J40A 1F3TA 4UQDA 2IPJA 3HFTA 3LHVA 2XJ7A 3VD4A 4M1BA 4UFMA 4C6JA 4HNUA 7TIMA 3HPZA 1AQHA 3AROA 2DIEA 4DWSC 4PULA 4HSOA 4C1NA 3CEPA 1LRTA 3LNPA 1I6NA 2OKOA 3BURA 1QDSA 3CQJA 4QS6A 3ICJA 3TJ4A 2ZX5A 3I7RA 3AIWA 3GAKA 2ACQA 3WMSA 3N2TA 1ONRA 4LS1A 3HMJG 4DLFA 2CLEA 4C6PA 3MV11 1W3TA 2BTMA 3IVUA 3KTXA 5DFAA 1F4HA 2F61A 3W3OA 3PAOA 4ERGA 4NAFA 3UZYA 3C2OA 3NQMA 5KITA 1QUMA 3UU0A 3WF3A 2X42A 3A13A 3F4DA 4QJ1A 2WJEA 4NI3A 3U48A 1EA9C 4JCLA 2FVKA 3U6WA 3CTTA 3U57A 3ZVIA 1K8YA 2BLEA 4DB7A 1TTPA 4ZOCA 5DBUA 1K4HA 1VYRA 1GOMA 5HBFA 2NQZA 2GVGA 5KETA 3II1A 2O92A 3RMEA 3HBLA 5CGQA 1RVGA 4A3UA 1CXEA 4HYRA 3FIGA 1Q6EA 2HBXA 5FJPA 3SSJA 4ZO9A 2RGLA 4M6UA 2FZMA 4ALDA 3W2NA 4JTGA 3O63A 4AUBA 3DYPA 4Z2IA 1LWIA 4IMEA 4UTTC 1X97A 4DPQA 4WHBA 3LERA 2I5GA 3UG3A 4F9JA 1PTDA 1ZBVA 3UZJA 2IKHA 2VFFA 5A6SA 5LNUA 1K9TA 4NJGA 2A6LA 2QCEA 3T7VA 3DOPA 4MY8A 2YBUA 5EFFA 4C6KA 4B5NA 1YIXA 4YCOA 3GVRA 4MYAA 1AH0A 2VI0A 4Z17A 4C6CA 4DVOA 1JZ8A 2DGAA 3EA1A 3U0HA 1NWRA 2HK1A 4C7FA 2HROA 1ZU8A 1AMKA 4Z1AA 1EO5A 2V2HA 3RLVA 3BC9A 4C6EA 2GGEA 3T44A 4CQ8A 4H8NA 1BQCA 2WZTA 4URIA 1W3JA 2VDHA 2WVVB 1X1ZA 3RG6A 1YX1A 3J7HA 4E38A 1UWSA 1QRQA 3AYTA 1ODUA 2V81A 3RLUA 2J74A 5DBTA 1DXEA 4UIOA 4Q8PA 1ZCOA 2QXWA 1DQUA 1ELSA 5I06A 3V5CA 2BHYA 3V0TA 1KTNA 5JXQA 4PEKA 3LPGA 2JGYA 3VOHA 3ATYA 4JTLA 3BLLA 1ADOA 4XD3A 3F2BA 4G9PA 3LXCA 1Y5XA 4WLCA 5FF7A 1M3UA 1TUFA 2G50A 5HMEA 2O0TA 4EF9A 1VCGA 3E2RA 1OX4B 3STGA 4US5D 1KR0A 4HTBA 2PLJA 4UNIA 4DXKA 4DIAA 3FAWA 3LZ5A 4DJDC 3MC5A 3NZQA 2PA6A 2I16A 1EHAA 3I3BA 1H41A 3B9OA 5G1TA 1H60A 2ZZ6A 3ZS4A 1P43A 1VR6A 2HE8A 4DZAA 1R3RA 1E9LA 4IIHA 4QLJA 4ZMGA 4LYQA 4G1NA 1R2TA 3PZGA 3WFAA 1RHCA 4JTCA 1Q3NA 3CIXA 4O15A 4S3JA 3I10A 3MDWA 3LY0A 4IP4A 2O9PA 1JI2A 1QNQA 1OC5A 4EANA 1T7LA 1DOSA 1R87A 2H9AB 5LIKX 3VX1A 4GWEA 5DLCA 1KGUA 4WY0B 1AODA 2VRJA 2W5FA 4DI9A 3N29A 2QCGA 3OYZA 3C2YA 2VFGA 4UOJA 1B30A 2ESCA 1UZ4A 1J96A 5H8MA 4YNGA 1JDEA 1FUYA 1DQXA 2VMFA 5HWNA 3BQ5A 1KC7A 2HZGA 3GC4A 5I00A 2VM8A 1R3QA 2YL9A 4F9DA 2CXEA 2VR4A 3NDZA 2NX3A 4AIEA 3AFBA 2YSWA 3NL2A 5FJRA 4UTWC 2QCCA 1EX1A 3FXGA 1AZ2A 1UR8A 1W9BM 4HA0A 1S2WA 2WMGA 4JN7A 1QCWA 1VS1A 2B81A 2PB1A 4E6MA 4YVVA 3CWHA 4JTEA 1TB3A 3KLLA 1JYWA 3M0MA 1UH4A 4HNVA 2OT0A 1RY8A 5BYWA 2YB1A 2FTWA 1A0DA 3NQEA 2ATSA 4V33A 3FGCB 1AA1B 3UERA 3VE7A 4JY8A 1NARA 4HA1A 3W7IA 3KFTA 3MKKA 5IHRA 3NSMA 2VCBA 4FX7A 1OBAA 4IL0A 3TWBA 2GVEA 4AC7C 4FEZA 3BICA 3SO7A 2D20A 1B90A 2J9YA 3S83A 3UZWA 3G0UA 1XLAA 4LUYA 3ARPA 1D7KA 3AZRA 2VFIA 4NAEA 3GX9A 3QY8A 3DKLA 4FNSA 2PUZA 4LEFA 3GFZA 1XBZA 4X60A 3OLIA 1UD5A 2HMCA 3STEA 1NSJA 3VFLA 4HZ7A 3MUZ1 2ZWZA 3QF0A 4ZCWA 1SR0A 3WD2A 4KERA 4JNZA 1X7IA 2ZUSA 2DT1A 3W7NA 4WUIA 2F2KA 3QZAA 4K39A 4QDMA 3GXFA 3TCSA 2X40A 1JRCA 1M53A 2C16A 3MSRA 3G1DA 4CU8A 3IAPA 2YCLA 1BQGA 2JIEA 3WDPP 4L5ZA 2ANUA 2Y2WA 3N11A 3VKBA 3GIQA 4GFIA 3VGGA 7CGTA 2ZZ1A 3UY8A 3TWAA 1QK0A 3BANA 2GVLA 3DYMA 1MDRA 3N2MA 1V0NA 2DZBA 1TRIA 3JZUA 3VK5A 3EB2A 3AAMA 1PWLA 3STCA 1VBJA 1ZFJA 1J0IA 5JBFA 1L9WA 4Q4MA 2VXNA 4WDXA 3VD7A 4Y2WA 1FBAA 4EPDC 1PAMA 1PL9A 2UY2A 1CB2A 3NO3A 4KGLA 4AF0A 4BJHA 3THQA 1B3OA 3IIXA 4ILSA 5D8WA 5D9NA 3VDBA 2F6UA 1WAUA 2J47A 4UCGA 2FB2A 8TIMA 1XIFA 3EB3A 3FLUA 4FLOA 4AZHA 4DZHA 1H5YA 5HPCA 2C15A 4PB5A 1EJUC 4RX0A 4JOMA 4LY4A 4ACZA 3ISIX 4J3VA 3KEHA 3GS6A 3QBUA 2DVUA 5LZLA 1R9YA 1TTIA 4AWSA 1IT7A 1GYMA 1XRFA 3WJZA 3I3EA 5EB8A 4DZ5A 3W07A 3LPPA 2X16A 3AI0A 5A2CA 3RIKA 1WUEA 3W29A 1E6PA 2WWCA 1F9CA 1K9EA 3ABSA 1B54A 1ZJBA 1XPYA 3HU7A 3CK5A 2OPJA 4IFKB 3DFOA 5E9XA 2G95A 1EPVA 1W5NA 1AK5A 4CNOA 4NZ5A 3UQNA 3KHDA 2VEIA 3EWUA 2WNQA 1X8CA 5CZKA 1KWKA 3MCMA 1BVNP 3VKJA 5T9CE 3VIKA 2NW0A 2XGIA 1JZ7A 3HV8A 5C2CA 4D6JA 1J8VA 3W1LA 2OB3A 1KD0A 3M7SA 2EG7A 2E25A 3VZXA 2QDEA 4Y6GA 4L64A 1E3ZA 4UQBA 5D2VA 3KOYA 2CCRA 3C0LA 1UUQA 1UIPA 1VBUA 3WLOA 3VGDA 2VQUA 3O6YX 3W2JA 4EXQA 1IF2A 3GXPA 3RRXA 1BXCA 4IICA 1DJXA 3W6MA 1VFFA 4W8LA 3C4UA 1YHTA 2AGTA 3RX3A 5HOSA 1DJGA 1GVFA 3LCIA 2X0HA 3ZLGA 2FMNA 4QLLA 3P5ZA 3CAVA 5ABFB 1W9UA 4UZSA 3ARWA 1MO0A 1XPGA 3UWUA 2VD9A 3GH4A 1MXGA 4IG2B 1A3WA 3LX9A 2E0PA 3EA3A 4NX0A 4QJ4B 4Q7NA 4QNEA 1A49A 3AXIA 3GIPA 5D09A 1BG9A 4P7LA 6REQB 1XYBA 2QCMA 3VZYA 3SN0A 1P6WA 5DO8A 2J88A 1GZGA 4TUFA 1R7OA 1MXSA 2WVVA 2VCCA 3C61A 3T09A 1S39A 4AD3A 2JEQA 5AC6A 3TOYA 4UTUA 4B3LA 4PCTA 1UWQA 2ZXDA 4S39A 4CN6A 4XTIA 4PCNA 1DTNA 3L0KA 2XZ9A 3RPTA 4HU0A 2WJFA 3WBWA 4OUIA 2Y63A 1NAL1 4E8CA 1PX4A 1FY6A 2XN2A 2J62A 2DZVA 4DWSA 3ZOAA 2I17A 3GC5A 4TOQA 4IQJA 4FXRA 3AOFA 4AZ7A 3WLQA 3AWNA 1JJKA 1FH7A 3BLKA 3ONBA 5IFPA 2ZVRA 3GLCA 2PEVA 3Q65A 1Q6QA 2ZOXA 4M5PA 1CGYA 3KRSA 5FAJA 2PWUA 2OWWA 1AH4A 1QI5A 5DRCA 4CQBA 3VDHA 5CBBA 1RBAA 3G1VA 1MEWA 4LF1A 3C8NA 2PI6A 3B8SA 2XTKA 3V0UA 4MOZA 1HL8A 3SSZA 2RH9A 4MWAD 4I7UA 4UMBA 3L2IA 4QM1A 3IEBA 5CPOA 5AYIA 1HKJA 3DI1A 4IL2A 5EMLA 3GDLA 2E5BA 2P0OA 3EWXA 1JCXA 1HP5A 3VE9A 2DT2A 2QT3A 3VMNA 4JQ1A 3BAXA 4LC8A 3LHTA 1C9DA 4GCXA 1KTCA 3DEQA 3VA8A 4A3RA 1KM0A 4Y9MA 1MYRA 5CZSA 4Q8WA 1SUXA 4KESA 1CGVA 3IIOA 4KWUA 2DIJA 3T40A 4JPGA 4CUCA 1LL7A 1FKWA 5CPLA 4D6EA 4EIVA 2DH3A 3HG5A 5A8OA 2PWGA 2FMOA 4IG2A 4G7EB 4IFRA 1ZBKA 3WDQA 3FJLA 3QQWA 4ZO6A 5LGXA 1OINA 4GZJA 4JNYA 4US5A 4LEQA 1HT6A 1Q85A 4HD5A 1B4KA 1D3GA 3E6EA 2HVNA 1JYNA 3BG9A 3DG7A 3MA8A 2CBVA 2A4AA 7REQA 1T5AA 2Z6JA 3SI9A 2Z2AA 3SRHA 4L61A 5BOFA 1XW8A 4AWUA 2R1KA 1MUWA 1I0DA 1OJXA 3LRLA 4O53A 1ADDA 3SUUA 4K2SA 5J04A 3P74A 4J4KA 1PDYA 1Q45A 4IF2A 5L6UA 3E5PA 1PCWA 2OGYA 3HQPA 1XV8A 4A2RA 1C7TA 1FWEC 2C7FA 1OY0A 4EACA 3WNPA 1RY0A 3W6YA 3AMLA 4DBWA 2BY0A 3UGVA 2FB3A 2RAGA 3M0XA 1ZP3A 2JF7A 1SMDA 7XIMA 1JUBA 1Q8JA 3UXKA 3LG3A 4FNTA 1QK2A 3FEMA 5FA5A 2GJPA 3DHUA 2OSYA 2OX1A 5REQB 1XDJA 5LA1A 1LT7A 2FGLA 1NOWA 3D0CA 3VYLA 1PYMA 4MFEA 2NSOA 4MZYA 4NUWA 3TDFA 2Z2BA 1YE6A 2NXIA 1DIKA 2XU2A 5HANA 4AG0A 1E6SM 1AQFA 1KCLA 3NZRA 2QF7A 4N9EA 1E6NA 1AD1A 4HN4A 4UMAA 4HQVA 3VIIA 1KXVA 1KCXA 3ZLHA 4IGMA 2RDTA 1RK5A 2ZRZA 1DP0A 4S2BA 4TX6A 3NM1A 1VJIA 1DXFA 2WSPA 2YIHA 1XC6A 2V30A 3SUSA 2QUTA 2R82A 1TV4A 3INPA 1TQJA 2J75A 3H2OA 3I4KA 4OE7A 4XAFA 2PGFA 1VB9A 3M0JA 3M64A 4XKMA 1W9DM 4W84A 5D30A 1K9FA 3B9AA 1B9ZA 5H6HA 1JD7A 3C56A 3MP3A 5CG7A 1WKDA 1XIMA 5DY2A 4LVAA 2GJRA 4GJIA 1J2WA 3V16A 3BTNA 3MV01 2YXGA 3LHUA 1R3WA 4JFTA 3M07A 5CSUA 3NL3A 1IR1A 1LQ0A 2V5LA 3WLHA 5A3HA 5FKYA 3A9BA 3LBOA 1ZHAA 1XH0A 4L4PA 4P7RA 2J8GA 3UWZA 2OYKA 3KRZA 2G3JA 1PCKA 2F9RA 1XIJA 3VOJA 1R3TA 1S2UA 3G1RA 4JIQA 4ZQMA 3R13A 1N7KA 3EKLA 1TJ0A 1EWEA 3RO6A 1LG1A 4AY8A 2ZKMX 1LBMA 2QJNA 2V5KA 1PSCA 1RBLA 3WY1A 2EG8A 3DFQA 3R7MA 3VX0A 1WE5A 2VGFA 3TUUA 3CM4A 4J3ZA 3CBWA 3I7QA 3AS3A 4ZTXA 4GIAA 4GK8A 1E40A 3H23A 2QIIA 2A3CA 3CLWA 4AXKA 4HVXA 1BKSA 3NJ3A 1BRLA 2Q3OA 3R6IA 4JTJA 1MSSA 5LXXA 3IGUA 3U7VA 2Z1VA 1IIGA 3GBDA 3SY1A 3PBMA 2QDDA 4H2CA 5K4XA 2Z7KA 2J9ZA 3B0VC 1XIBA 4DXXA 2FDSA 1J18A 2VKZG 1S46A 1SJCA 4KEVA 1YBQA 5C2GA 3WEOA 4R53A 4LUJA 4YYFA 3MT1A 4PUUA 4HOXA 1SO4A 3LM3A 1IZJA 2DQXA 1XG3A 2FH6A 3HA1A 3CHCA 4UTWA 1EIBA 4PUMA 4F2TA 3HMCA 5J8LA 3BGGA 3OTRA 2R14A 5T26A 3W88A 5CPQA 4O4WA 3OGRA 1XP3A 2B7PA 3EX2A 2VX4A 1NVMA 4LAOA 3THAA 4B5WA 3W7JA 1PKMA 5CZTA 2YLAA 1DIDA 1A80A 1F3EA 1A5BA 1R30A 2O4QA 3ALFA 3IS4A 4KGJA 3IIVA 2GQAA 1TPB1 1E6XM 1JDCA 4ZFCA 4JR5A 4Z2HA 3W1UA 5BXTA 1P1XA 1XGZA 2B4GA 2P88A 2QR6A 3NSXA 4YS1A 4H8HA 3WH6A 4XBKA 3ITXA 3G0XA 4O12A 4JFWA 2EPNA 2PDCA 3GFXA 3S42A 9RUBA 3CB8A 1SJBA 1QNPA 2ZA1A 3WNOA 1EO7A 3A23A 3TZNA 2J7EA 4Q4QA 3I6RA 2NUYA 2CZVA 3EWDA 2VX6A 1ICQA 1TV3A 3BMXA 4A8LA 3HTWA 3NPWA 3NQDA 1BPLB 3AHTA 4PL1A 2ICSA 2VC6A 1HTIA 2J77A 4FHAA 3W28A 1KFWA 3IJDA 1N55A 1W3KA 3ARRA 1XM3A 2CC0A 2NQJA 5AOUA 1B4EA 3NXFA 3UESA 3ZR6A 2QUVA 2FZ9A 2BVTA 2PCQA 2OGJA 3IAQA 4K8EA 1GWJA 2YB4A 2RHGA 3REQB 3HQOA 4M19A 1JG9A 2MUCA 4LY8A 1S5NA 2Y7DA 3RLGA 1VENA 2P76A 1LRNA 4AEFA 2GLKA 4DAIA 4PODA 1O6IA 3UNTA 1CGUA 1VPXA 4ZE5A 3LN3A 1QI4A 5EGRA 3VVGA 4K38A 5JVLA 2P8CA 1XYAA 3VDCA 2VDIA 3RFAA 1GQJA 2CLMA 4DY1A 2HISA 3T0TA 4LALA 1KM2A 2WM1A 2WJZA 1KXTA 2GDVA 3GU2A 4CGTA 1G4SA 3MJMA 5F2IA 1R7AA 2V2DA 3LA4A 4MYXA 1XLKA 4UOQA 1LG2A 3FVMA 5BZAA 2BS9A 4L1XA 5CLTA 4M0XA 4BI6A 3HPAA 4CNUA 2WNNA 3LCLA 4B90A 3O15A 2I9EA 2VUYA 2FHFA 3EWWA 3F2DA 3OHMB 2GGIA 4HA3A 2WV8A 3E74A 4FR1A 1THFD 1P6CA 1PEZA 2IKGA 2ZX7A 3ZXWA 4MTVA 5G1MA 4LBSA 3MI2A 1QHZA 4ZA0A 1HL2A 4XZHA 4GQBA 2CLOA 3HQ1A 3CAKA 3ARZA 1GOIA 4LCSA 1V7AA 2PFHA 1G6CA 1A47A 1KBIA 4M7TA 3QXBA 1GVSA 4FP1A 4RV3A 1W54A 2I5IA 1WZMA 5JIWA 2D69A 2BXYA 4O13A 2I57A 3AU2A 4GZIA 2PWEA 3WBXA 1PX8A 5KZMA 4B5TA 4HU4A 3G77A 4V2XA 3Q2DA 4NKCA 3GYCA 3LEPA 4D71A 4JBRA 3L2LA 3CYVA 4O19A 3GXIA 4JCMA 3TNBA 1OT2A 1QXLA 2ZX9A 4LAUA 1FWIC 1P5BA 1VBGA 4Y9AA 3TLQA 3P14A 4H9MA 4FNQA 3LLDA 3V18A 3NSNA 1ZBCA 4Z2GA 2ZIDA 3QY6A 3TMLA 3AS1A 1DWHM 1XYLA 2E77A 1RUSA 2PDMA 4HT3A 5ABEA 1UBPC 3SFWA 1EHNA 1C8VA 3W75A 2HXTA 1OC6A 4P8WA 2WAGA 1W32A 3L0GA 2PDQA 1GOQA 1SMAA 2ZBTA 2V38A 1VP5A 1PBGA 4KWOA 2VQTA 1M6JA 1IXNA 3KVMA 4ZL1A 3GAYA 3H55A 4UR8A 1J0YA 5HUPA 1NJJA 8RUCA 3K13A 5EBAA 2GFTA 3THCA 2CITA 5JH2A 1G9HA 4NNCA 5CG0A 2XGBA 1EJ7L 4J3SA 3LXBA 1W91A 4GJJA 5ABTA 1Z42A 3BV7A 3L0NA 3FX4A 3EEGA 3M0LA 4GVIA 5AECA 4CD4A 3WQGA 4K7YA 4CU6A 3S1XA 4CQAA 1RQEA 5CZJA 1OF6A 3WLIA 4RDVA 3C2EA 1OX4A 2PP3A 4DWDA 1CW2A 3DGBA 4M51A 1KGXA 1ISYA 4UTMA 2ATMA 3W01A 1TJPA 3R0UA 3PTDA 3VINA 4JTDA 3OBAA 4QS5A 2UZ9A 3U7BA 3N3TA 3OYXA 2GOUA 4AZ6A 1TQXA 3F4CA 3S47A 3OIHA 2GK1B 2XFYA 4EXBA 2Y5JA 4C6OA 4CD6A 4Q8NA 4ZQCA 5GNZA 5BU6A 1VEPA 5AZ1A 2MNRA 2EPHA 3MO7A 1R0MA 2YYUA 3M41A 1JZ5A 2CWXA 3ARYA 1GCYA 3FA5A 4P2VA 4RE3A 3TJIA 4Z42C 4AZIA 1FA2A 4M82A 4GI4A 4AX7A 5D33A 4A21A 4HJFA 2X0YA 3GQYA 3TXZA 3P93A 4LUTA 3FN9A 1OFQA 1SFJA 1H2JA 4MUPA 4GKTA 3V75A 3SY8A 3M46A 1TPUA 2WPBA 3VO0A 3QQ0A 1NF7A 1EDGA 3CMFA 2VGGA 2WVSA 3UR7A 1E9IA 3O0KA 4BQ4A 4JTAA 3F2CA 3N17A 3CB3A 1UD4A 3GC2A 5IBXC 3R4IA 1BGAA 4F3HA 4F8XA 4X9SA 1YADA 4W7WA 3EPNA 1REQB 3N2BA 4JTQA 2V3EA 2Z00A 3WH7A 1UWIA 3SIMA 4Q8VA 1OFDA 2ZE0A 3OG2A 1KM6A 4UFKA 4MJ2A 2OOGA 3TMQA 1L6GA 3SUWA 4F40A 1AJ0A 4H7ZA 3CJPA 2FVMA 2R8WA 2QUNA 3T07A 3OBKA 3WD1A 5AC4A 4LNCA 4DBEA 3IGHX 3DECA 5JBDA 4XIAA 1EDQA 2CHOA 4PTXA 4ZQPA 1KNWA 1DBTA 3PULA 5J5DA 3KL0A 3FKKA 1ITUA 2TPSA 4ZXOA 2J27A 1FRBA 1Q8AA 3CZKA 5CQ1A 2Y8VA 1GW1A 3MUCA 2OELA 1OFEA 4YTQA 5FOOA 1R85A 2WC3A 4RNFA 4QHRA 4KIEA 5T91A 3BAKA 4QQ3A 2RKXA 4J3XA 1RPKA 1HKVA 1X39A 5HNUA 1CLVA 1GVQA 3VNMA 1T8XA 4O10A 4Y8EA 1XINA 4PZVA 3FFSA 4FLRA 3ZFHA 2ZWYA 3BJSA 4HPHA 4QG6A 2WKGA 2C1GA 2OLHA 4MGGA 2Z1XA 5C8BB 4A8RA 3QEZA 3BLIA 1RP9A 3N13A 2TRSA 3WELA 3NVDA 1KRBC 3LMZA 3HOJA 2IQDA 3CHEA 3NNTA 3G6MA 2ALDA 1XXXA 2VNCA 1W1IE 3EKZA 1JZ6A 5EBUA 1SU5A 4GRSA 4DQWA 4DNMA 2X2GA 4JD4A 3NWRA 4UNLA 3WUFA 4RR4A 2WCSA 4NIRA 5TQLA 1GJWA 1DHKA 1QJWA 3FVDA 3QOKA 4Q8TA 3RJXA 3CU2A 3CUXA 2ZUMA 3TR2A 5HNTA 2EXOA 1I0BA 4Z0JA 1I2OA 4CVWA 4MWAC 2ZZ4A 3TKFA 2IQTA 1Z8AA 1ME8A 1Q6GA 4JIRA 1D2KA 1KRMA 2KZHA 1TA3A 1CENA 3KXQA 3W24A 2X7VA 4JHZA 4CVUA 3KLKA 1L6FA 3W25A 4GY1A 4PUJA 2GJXB 3GTHA 3P60A 1XR2A 3MMWA 2QPXA 1MNSA 3HZ3A 1H7PA 4JDBA 1JULA 2GQ8A 3RDKA 4DAFA 4JXCA 2YDQA 3GYEA 4ZGYA 4HZ8A 2DUAA 4JYEA 1W3HA 1WQ5A 3EEZA 2HBVA 2P0IA 4LBUA 3GY1A 3GR4A 4LUIA 1OB0A 3CQKA 2VVSA 3BAWA 3VIPA 3PHAA 1UQYA 1OABA 2IXUA 3W74A 5I03A 4GINA 3QMTA 3GD6A 2YFNA 1PHQA 2OZTA 3G3DA 6TIMA 2QVHA 2DJXA 3NIYA 3KRUA 3IUIA 5E6YA 4ZSTA 3CWNA 3O0FA 3VC6A 1L8NA 3H4XA 3KS6A 4F0SA 1K7EA 2J6VA 1Z41A 1EDTA 1MW2A 2YBVA 4KFNA 3PM6A 2VEKA 2R1MA 5KZEA 3W22A 4J1OA 2C8NA 4ICNA 4OUEA 1YXDA 2VURA 3APYA 2XH0A 2ADAA 1FFRA 1E0VA 4GMEA 1YPFA 4XZMX 3A24A 5FF3A 1EJVC 2IS7A 1VAHA 1WPCA 3UXDA 5EYWA 4KBXA 1UROA 1XLIA 4OBTA 4ICCX 3PZIA 1UKSA 3O8AA 1W31A 1YBQB 5D38A 4JFUA 4WKHA 3W86A 2OTDA 3SQLA 1TCMA 3SFKA 3PUOA 3H4WA 4MWAB 1RD6A 3ZSSA 1OM0A 2E9BA 3R8RA 1W6TA 3CPGA 3AMGA 3DIPA 3ITVA 3QYSA 4H7VA 3P8IA 4JKMA 3TYZA 5ABGA 2GSEA 2Z1KA 1OC7A 3GKAA 2BY1A 1SGJA 5AVHA 3GHTA 3WJSA 3LUTA 4PFHA 2E3ZA 4JN6A 3PZUA 3TW6A 2WZIA 1T96A 3BOFA 2DP3A 4NP7A 4KW2A 4PMNA 4A29A 3B04A 1EXBA 5LA0A 3VD5A 3F1QA 4AEEA 4MUZA 3I68A 1UD2A 5B7YA 3QH2A 7A3HA 3GW3A 2GJNA 1XIHA 3W00A 3O16A 3Q37A 4RZ4A 1VEOA 1I4NA 3EPOA 2ISVA 3QMRA 4JQ2A 4FO4A 1GG1A 3K1DA 5F2MA 1K02A 2O9OA 3AALA 3VNZA 2INZA 4FXSA 1ZY9A 3W4RA 3ARTA 3BXWA 4PMZA 2XHYA 4RPQA 3K5XA 2RJHA 1FWWA 5I3JA 1S38A 1ZJAA 5DCDA 3IJ8A 1TE1A 2XVGA 5FSEC 3WD4A 3AJXA 2IMRA 3AHYA 1GVYA 1GT8A 2QV4A 4R88A 4I5RA 5DY3A 4QIUA 1EUNA 1R2SA 4CCDA 2ISFA 4C7GA 2BSLA 3F5JA 4LX4A 2R91A 3BARA 1OYBA 4X0NA 1YW1A 3TNOA 3URNA 3S46A 2VGBA 4WX2A 2CU0A 1SJAA 3PP7A 3K1GA 3QKEA 4LVBA 4HU3A 3QV9A 2ZUNA 4LYRA 4PRTA 4DF0A 4S3CA 4N9DA 4LT9A 4LSBA 3E0LA 6CGTA 1LORA 1OCQA 2TODA 1E5NA 4MY1A 4IGNA 4QG9A 4YIWA 5DMMA 2V82A 3PNZA 1JAKA 3UCQA 4DI8A 1CWYA 4C5YA 4FNRA 3V4BA 1BSLA 3TH6A 2VR5A 4DLMA 1BF6A 1QI0A 3M5YA 4BEUA 4PH6A 3HG3A 4GYJA 3CMJA 1TWIA 2I7GA 4LC6A 4Y9OA 4NJJA 2OWCA 5K7JA 1LT8A 3R0DA 3OW1A 2WM0A 5LNWA 1GOOA 1S5VA 4I5UA 3PC0A 4BQ2A 4IIDA 1TYGA 2BASA 2F6KA 2YPIA 1BTCA 3Q94A 1XQKA 4GXMA 4BK9A 3LLFA 3VIOA 1UP0A 4M6QA 1JR1A 1K9DA 3NFUA 3MZ2A 1NP0A 3BJTA 1NM9A 1WO2A 4V1YA 3S5SA 4N02A 1ONXA 2QCNA 4AZ5A 5K4ZA 2NXGA 2XN1A 5DANA 4DJFD 1BGGA 1OK6A 5HJXA 3MANA 2GVYA 4G6CA 4XD4A 4P61A 4GUJA 3TXVA 3W76A 1JDFA 1E5JA 4NNBA 3BVJA 4ZO8A 1F3XA 2XSXA 3ITOA 4N6FA 5HWMA 4NZJA 3THDA 1XGEA 2XFFA 1NIUA 1JNEA 3N6JA 1MFUA 1H61A 4LF2A 4AQLA 2EO7A 2RGMA 1QI3A 2DH2A 5F2LA 3XIMA 2E28A 1UZDA 4HBKA 3TFXA 3N19B 4H4IA 1CX9A 3CLMA 1HVQA 4IXXA 4ZENA 2D24A 2JQXA 1SR9A 4C60A 4WIWA 3KBJA 3EDDA 5EL1A 1DTUA 3AXKA 1UPPA 2BMBA 3AICA 1OFPA 3MTWA 6PTDA 3U5YA 5H8PA 3ES8A 3BSGA 5CZ0A 2GDQA 1U5JA 5A6JA 3LOTA 3P0WA 5TBOA 4LU0A 2WNZA 1O7AA 4AZCB 2OU4A 3DFTA 2OWXA 3N4AA 4M7SA 3NYDA 1DKWA 5XINA 3PR2A 4GGHA 5D2YA 1L0PA 4BF7A 3CHDA 3UGRA 2XIOA 4P8XA 2VFHA 2NUXA 5AY7A 3BCFA 4PCFA 1AW1A 4H83A 6XIMA 1OK4A 3QKZA 1WXJA 1T8QA 4HMEA 1QI2A 3TV8A 3JVAA 1A0CA 1JCJA 2D3LA 4OHQA 2QQ6A 5BWAA 1LM1A 3N9SA 1GK8A 4A35A 3L68A 1W8GA 4PRWA 3UA3A 4DWSB 3P80A 3W84A 3MDUA 1LOSA 3EDEA 5MKGB 3W7DA 3W7GA 3C0QA 1E1EA 1EC7A 4YTUA 1XYMA 5CPMA 3MI6A 4WJXA 2VFEA 4L6HA 4ZQNA 3TAKA 1W9PA 3NQ7A 3W6LA 3N9RA 3WF1A 4MB5A 1ISZA 2J7HA 3WQ6A 3ELFA 1TKKA 6XIAA 1J0HA 2QUMA 2Z2UA 4WGHA 1DWIM 4H2HA 3A3WA 1PKYA 4E2VA 3MP4A 2R1LA 2DSUA 2WHKA 2ZXBA 3EX4A 4IQDA 3VIJA 3B4UA 4AHPA 3ECQA 3VIGA 2A3HA 3SJ3A 1OF8A 3N34A 1H7WA 2DT3A 4Y90A 3CTLA 1WDPA 3GXMA 4YYCA 4H9YA 2HJPA 3M6DA 4HCHA 4DJDD 1BWKA 3GNXA 3JZEA 2ZRVA 5HWJA 3H70A 2Y5SA 4P5UA 3W72A 1QPKA 1E1CA 2A7PA 2DT0A 1V79A 2FVLA 3MKVA 3EZ4A 4F0RA 4AY1A 5E1QA 3WMLA 5LGZA 2Y88A 4DUOA 4K1GA 3HGOA 3USBA 1IZCA 4O0QA 1EP3A 3GWQA 3Q67A 3R8GA 4E4FA 3CNYA 3U2EA 1GVEA 1EGVA 1Y7VA 1XBYA 3EDJA 4IZGA 1K1DA 4IFOA 4ZXLA 1VJZA 1OGSA 3GNDA 3VMOA 1JCNA 3T55A 1L8PA 1XYZA 4K7VA 4MLRA 1ZPTA 3C6CA 4O14A 2C0AA 1NFPA 3AUOA 1PZ1A 1SW0A 5HINA 3S2JA 3LNMA 2AQVA 3VIHA 5AHFA 3O3RA 1EA0A 4B16A 4OWGA 4GIRA 4IFKA 2YW4A 3W0KA 1KXHA 1BYBA 5CBIA 4A8IA 2ODOA 5CSRA 1VIWA 4UTIA 1P4CA 3GO2A 3UR8A 2ZTKA 1O60A 4GY7A 5CKSA 3KM8A 5C2XA 5LXEA 4BS0A 4IIBA 1K7XA 4O28A 3NQ8A 4U5IA 4GUHA 1O95A 1BWVA 3T4WA 1XLLA 2V0TA 3N18A 5M17A 5MKGA 4W85A 4B5UA 3CZGA 3NZ1A 1V6YA 2RUSA 1A5CA 3ABXA 3VMPA 4FS9A 2DVTA 1E72M 4DJEA 2OSXA 3OQEA 4IXHA 3QV7A 1UB3A 1LLWA 1OCJA 1NP2A 4JS3A 1UC5A 2DSVA 3ENLA 4C1KA 2HXUA 4FA3A 1G94A 1VRXA 1YDVA 3WDIA 4FLQA 2CKSA 3S2NA 1YRRA 3CHFA 2XGZA 4RJEA 5DRIA 5E9AA 4LRSA 1H7NA 4GYKA 5BXPA 3A5FA 3WK2A 5G4HC 3W2MA 3FYOA 3SRKA 3EOEA 4JFVA 4GXPA 4UTFA 2ZZ7A 2QNEA 4XG1A 3QPZA 1AL7A 1CGTA 4NZ1A 2BGSA 1OX6A 2DZUA 1YDNA 3G22A 3CUHA 4MJZA 3LCWA 1IT0A 3H24A 2NQLA 3CH0A 2ZVIA 2NUWA 4HGXA 5A8NA 1VFUA 3AWOA 1HNYA 1XI3A 1A5KC 3BQ6A 4J3UA 1NU5A 4N4QA 3AYRA 1UKQA 1TZ9A 1CXHA 1XLGA 5DN1A 4AIUA 1EZWA 1CBGA 4HYVA 4JL1A 2UBPC 5U7SA 1QNOA 2F8QA 5I6SA 2QF8A 2PGWA 4U4MA 3WLNA 4HOWA 4NY2A 1H7XA 3TQKA 3MKCA 1J0KA 3SCWA 2NLYA 3TYEA 1XLJA 5HXMA 5CGTA 1GOXA 1CTNA 2FGBA 1QASA 3MUIA 3VC5A 3OA3A 1JZ2A 3OU8A 3H7VA 5HPOA 1VLIA 3QOMA 3IGSA 2J8TA 1JGIA 3F4NA 3BMWA 3WQOA 1B3WA 4EE9A 4IJRA 1V51A 3TE9A 1GKRA 3LLXA 4B5XA 5HJLA 4M1RA 1JF6A 3KOWA 1T99A 1SSGA 1KTBA 1EC9A 3R43A 3T0BA 3SRFA 3OLDA 3RCNA 4JTIA 4ADSA 5D32A 4WOQA 5D2WA 4HSNA 1YNPA 3M0YA 3KBVA 4DUVA 1RR2A 1VHNA 1VRDA 1Q7MA 4PBEA 4N4PA 5C9RA 1RVKA 2CBJA 4PBGA 1DQWA 3GDBA 3T42A 4XKYB 4GUFA 2FPTA 3KCLA 2Z4GA 2OR2A 1KKRA 2W91A 3CHVA 2W62A 4QAWA 4ROQA 5C9UA 3VPLA 4S3FA 1IR2A 1E3XA 5A69A 1WX0A 4O50A 1E0XA 3K46A 4ICMA 4NRRA 2BGQA 4GVGA 1ISVA 4CNNA 3CL6A 3LENA 3RM9A 5A8QA 4K36A 3NXLA 2PLMA 4C6BA 4P8VA 2Q8XA 1QMLA 1JZ4A 2CIPA 4KRTA 1XH2A 1CDGA 2BGNE 2HQAA 5CC6A 1I2NA 3H8AA 5BRPA 3N4EA 4DHGA 4RV8A 3B8IA 1QOPA 4CLMA 4I9MA 4QE4A 1PIIA 1K8CA 4OGZA 4XZ9A 5DT5A 4JEJA 1OG6A 2Q71A 2YA0A 3AMKA 2YBTA 3MB9A 1HFBA 1B5TA 1UKTA 1R5YA 4B92A 3WZ0E 3ZWSA 2GYIA 5LNSA 2B7QA 1SZEA 2XIQA 3P6LA 1K6WA 2J7BA 5T8GA 4GZ7A 1TMQA 2W3ZA 2J25A 2XH7A 4KKXA 4CEUC 3B0UX 2WSYA 4YJ5A 3ANVA 2W79A 2IXVA 3OVPA 3I6TA 1UWAA 7ODCA 1EBGA 1WDRA 4YPJA 1LDCA 1QVBA 3LGGA 3TSMA 3IK2A 3QTGA 2DORA 1I60A 3A4WA 1O12A 1WCGA 1ZS2A 4WXYA 4C6DA 3F4WA 3MSYA 1A5NC 3A3HA 3ALGA 4LGXA 2HSAA 1EX5A 4FAMA 4G5DA 1EJTC 3ITTA 1P1MA 7REQB 1R6WA 1HQTA 2W92A 4CD7A 3TYDA 4JTHA 2Z1SA 3GVVA 3W7LA 2X05A 1NOFA 5JQ9A 1M7JA 4ZQOA 1U33A 2XIIA 4OZOA 4H9XA 3CXOA 3NEVA 5HULA 1FDYA 1UUOA 3PNUA 5EFDA 4RXFA 2WHJA 5DXYA 1W9VA 1OADA 3WH5A 2C0HA 1VZWA 2E8ZA 3IVSA 4UWMA 1I8JA 1MW0A 3TIMA 4B15A 1R8LA 3W87A 3C52A 3LHYA 2RDUA 1F5ZA 4MF4A 1KR1A 3KTCA 1ZNNA 4H19A 3VNJA 3B9NA 2DPEA 2V3FA 3LBCA 3VGBA 1DV7A 3OO2A 4UTHA 2HNHA 4DEFA 4CNPA 4PUEA 1R3SA 1DEDA 1EKOA 3K30A 1E4MM 2HVOA 4DJED 3GU9A 3D6NA 1KFBA 2J24A 4AZBA 4FOKA 1Z6KA 3HJEA 5FL1A 4L4LA 2QCDB 4UR7A 5M2FX 4YTTA 1B0IA 3ZZ1A 1H0IA 2AL1A 3RCYA 3CASA 1EPXA 3PF3A 3FS2A 2I1OA 2W4XA 3O6AA 3A4XA 3H2EA 4IGSA 1W9XA 3H2AA 1HF6A 2D0HA 3M0HA 1XCFA 3VCCA 4QJ5B 4XWUA 4GUIA 4LWWA 3PB2A 4AIOA 3F7JA 1S5TA 3S9YA 3HJZA 2FTPA 3QFWA 4LV9A 4KQNA 5FD0A 3LD5A 3QR0A 4KF1A 4XUGA 3DX5A 3L21A 1HJVA 1TG7A 3WLMA 2E40A 2BHUA 1IWAA 3M5XA 4LS0A 1OQFA 2J9XA 1G0CA 1K7FA 1K8ZA 1E0WA 4G7FA 2XPKA 4WJ8A 3CGTA 1XRTA 1C90A 1ZZMA 3MHUA 4QX4A 5JIPA 1XG4A 3WO8A 3LPFA 3NCOA 2JKEA 3B9EA 2Q3RA 5FJIA 4MB1A 1DJNA 2WZHA 6TAAA 4Z2LA 4YCPA 1W1TA 2B0MA 1TSIA 4KCUA 4LCRA 3PK7A 3N15A 2H8ZA 2AAMA 4D9PA 3AISA 1TE6A 2E1DA 1W17A 3MBFA 3WG6A 3BUVA 2ISDA 2OXNA 5DX7A 1Q4NX 1S1RA 1ZAJA 3JS3A 2HPIA 4XZWA 2NQHA 4LAMA 4DO5A 1V6TA 5CC3A 3VI2A 3OP2A 4YU1A 3UPBA 4W4QA 1WA3A 5K2ZA 5A6TC 1CI1A 4U2YA 3MVTA 2Z1BA 3QGAC 3RK8A 5DCBA 1YMYA 3VD3A 4D72A 1QPRA 2P8BA 4AYSA 2VC5A 2YLLA 3OZPA 3OLGA 4IPPA 1IXOA 1DIEA 1VFTA 3EOOA 4U31A 4E2OA 3O05A 2E9MA 3ABOA 3B3DA 3WMCA 3N9KA 4NSBA 1CGXA 2YZ5A 3MW7A 3BE7A 1V93A 3PZOA 1V5XA 1FH9A 3SEPA 2R94A 2OJPA 2W6RA 5E09A 1V6WA 2ZRWA 1EEPA 4UB9A 3L4XA 4LCQA 3A9IA 5FJOA 5K3VA 2SFPA 1C3FA 3H7UA 4MY9A 4U2ZA 2WKJA 1R38A 3RRAA 2NSXA 2IUZA 1K6AA 5CAHA 5CJNA 3P3BA 2YL8A 3CQIA 1E1CB 5I3GA 4AHOA 1VC4A 4Z1BA 4XB3A 1US3A 2WYSA 5HQLA 2Z28A 2UV8G 3TC7A 3KVLA 3A4AA 4QP0A 2JGQA 3OA5A 4GNVA 3S2CA 3HO8A 3FGCA 3UXLA 3NPUA 3N2OA 1M9HA 3CQHA 3W2UA 3PBVA 1FQ0A 3MI3A 4AVOA 2GUYA 3QFEA 1PO9A 2CPUA 5BW6A 1CNVA 4YLWA 4GI8A 2ZC1A 4NJHA 4LXFA 1RJPA 4DUWA 6A3HA 2PDPA 3G1SA 4OKDA 5HDRA 4OVXA 3GVQA 3LI1A 3DESA 1W5MA 4GACA 4Q22A 4HB7A 1EJSC 2A3BA 4KRUA 3KL5A 4ADUA 2FZBA 2PE4A 1SZNA 1ITXA 3GFYA 2E6FA 4ZB0A 3TTOA 4ECLA 3L4UA 5EY5A 1UWTA 4BF9A 5D2TA 2PDGA 2Y8KA 4AFYA 3JUGA 3UWYA 3LSCA 2E7FA 2VC7A 3UFYA 2WOQA 4I3GA 4W93A 3JR2A 1O1HA 3WLKX 1B3YA 4JIPA 3PPHA 1FVPA 1QPOA 2PD5A 2ZCGA 1S1PA 1R3VA 5TIMA 3QY7A 3UJFA 1HKKA 3WCZA 3SQMA 1PZ2A 4KFPA 3ITGA 4DELA 1AMYA 4O1AA 4N7QA 1V3KA 1V3MA 1L2QA 1IQ8A 2VP8A 2G3IA 3S6TA 3RR4A 5CEWA 4QEHA 2YFOA 1AUSL 1UP2A 4L1GA 3SCOA 3UWEA 1XUUA 3BPWA 4KCWA 1MNZA 2A3EA 3ONCA 4XD5A 4B9ZA 3PFRA 1HO4A 1ZRQA 3K8KA 2D22A 1FHUA 3VCRA 3T9PA 1G1YA 3CV7A 1NFGA 4UCFA 1KQYA 1OG0A 1SFTA 3MYPA 1MWOA 1DVJA 3VU2A 1V03A 3LXAA 1TV2A 3R8HA 3P84A 2RFGA 4YHEA 3FCPA 1ZB5A 4PTMA 5CLWA 4AW7A 2V5JA 2YCLB 3IJIA 5AHEA 4DBDA 4Q6JA 1XLBA 1LL6A 5I02A 1DPMA 3OBEA 4H7CA 2NVAA 4MIMA 4EKJA 2FZNA 3IIPA 1E70M 3PJTA 4CQCA 1JPMA 1A4LA 1HG3A 3LTSA 1VLWA 1GPFA 4HPXA 5PTDA 1X6UA 3K2GA 3HFYA 3OGSA 1NWSA 4HCLA 1LRQA 3KOFA 1YLVA 2PDJA 3DKJA 3B8VA 4I6KA 3SZ8A 3V1HA 3OGVA 1MVYA 3U2CA 5A6BD 2QGHA 5AZ0A 4M8UA 1XRSA 1JZ3A 3M0ZA 4DWSD 5EA9A 3GKFA 3WFZA 2WSQA 3KOXA 1R46A 2WVTA 2PTYA 2UY5A 3WQ8A 4A3HA 1Q6CA 3VGHA 2QGYA 4NF7A 5DF0A 1KV5A 2ACUA 3NA8A 3B05A 1XQLA 3B8UA 1YTEA 3PZ9A 3PZTA 3TJLA 3QHOA 4C7DA 1KV8A 4EVZA 1POJA 3RXZA 1TWSA 4F0HA 3LQLA 4E8GA 3A47A 1LROA 3ABZA 4PMVA 1UR4A 3ZT5A 2NWRA 1LTDA 1B31A 4AWTA 2YL5A 2NQ5A 4IMGA 4J2PA 2PDHA 2Y24A 4Z08A 1W1VA 4FSAA 4PMYA 5CXPA 1MRAA 4K6AA 3QSTA 2VHLA 3QSRA 4AMCA 3GVGA 4F2UA 4QSHA 4GH1A 3FY1A 4TV5A 5BXRA 1WKYA 3AS2A 3QM3A 1CGWA 1ZJIA 4R7WA 2BOEX 2Z7GA 4AD1A 3O7UA 4NL1A 4JYDA 3GU1A 5FIPA 4D6GA 3LS9A 2GJXA 3UR2A 1XLEA 4S3KA 2D1ZA 1KRCC 4V28A 4BI7A 3SIZA 4C6LA 4RW3A 1C93A 3GW0A 1GVRA 2FKPA 4JICA 2TSYA 3H21A 1BHGA 5I3KA 4AD5A 1KFLA 3ARXA 2MANA 5F7UA 4YHGA 3AYVA 2GWGA 4FLSA 5A6BA 3HGRA 3IV3A 2CLPA 1IEWA 1H1NA 4YVXA 4MJMA 2Y5EA 2BDQA 3TN4A 3N73A 4C90A 3K8MA 2ZX6A 5REQA 3U3HA 2CYGA 5IHSA 4C1NB 1MFVA 1YDOA 4YXGA 1GTEA 4D1IA 2JK2A 1ZL1A 4W7UA 3BOLA 5KZDA 2AKMA 5FEZA 4K68A 1HJXA 4MZ8A 4RDWA 1E6QM 3KP0A 4D6HA 2YDSA 1DJQA 2QULA 3FJNA 1UMYA 3T05A 3TSDA 2OO0A 1FWCC 4C6IA 1XKJA 2X1RA 2PTDA 2CESA 2VGIA 1H51A 2J7GA 1DIOA 1L2UA 2AOSA 3PJUA 2EGZA 5A1AA 5DT7A 1H7RA 4R9XA 3RX2A 3FK4A 3VM5A 5BWFA 3UG4A 4QNWA 1NDWA 4N9BA 4IISA 4Z1YA 1Z3NA 1TPH1 2OYLA 4DBUA 2VL4A 2OX4A 3EYPA 2JKPA 3SUTA 3R11A 3AC0A 4KT2A 4KWWA 1ENUA 1RD5A 4M56A 5C9ZA 3KRBA 5C7VA 1RLCL 3F5LA 4IUOA 2F7FA 2QDGA 3MSDA 2FIQA 4BKNA 4GX9A 3TYAA 2BY2A 2XFRA 3EXSA 3AO0A 1CXLA 4O54A 1EOMA 2OYMA 4MFDA 1UKOA 3WEZA 3UPWA 3PZNA 2VEMA 4BA0A 3BGJA 1WXYA 4XISA 2X30A 4ORMA 5F1UA 4MLJA 4ONVA 1EYEA 1TPDA 2FFIA 4K1WA 4MWAA 1I2PA 3B06A 2V3DA 3QR3A 5RUBA 1U30A 1QO2A 2OEKA 4NRSA 2EPMX 2FZ8A 3WN6A 5HA7A 3ZJ6A 5A95A 3UNDA 1PIGA 3VTRA 4Y9NA 4NYYA 3QV6A 4D6IA 1S2VA 4NXSA 1XHGA 4LV4A 4GQRA 2IPWA 4DJDA 1TWZA 1FKXA 3H12A 2D3NA 1X1OA 4S23A 1BYAA 2YCIX 4NZ3A 1ICSA 1BYDA 5LYRA 3TYUA 3CO4A 4O11A 4RZBA 3GXDA 1J2BA 3SCNA 3DUGA 4IOTA 2YJQA 1NELA 2H3DA 5CJ5A 1RBOB 1ZQ5A 4E3TA 1GHSA 1LBFA 1OGGA 5LHEA 1S2AA 1TZ7A 1UP3A 1NQ6A 4CD8A 1F6YA 4I8YA 1KKOA 2X41A 3S5OA 5GNXA 3EX6A 4NJIA 1OT1A 3KOZA 4O16A 3DN5A 4AYGA 3XINA 3CT7A 3LHWA 5IDZA 1KFKA 3B0XA 3CPRA 4QGCA 2PDFA 3D5HA 2CZFA 3LHZA 1VH7A 3UF9A 2V6AA 2E8YA 4XAYA 2OEJA 1GQIA 4OV9A 1DWJM 3LI0A 1RCQA 5M3WA 2GUBA 3OVGA 2PWVA 2QCDA 3O6CA 4ZVJA 4U10A 3SW6A 1IEVA 5FAGA 2V5BA 2QVNA 4D8ZA 1CB7B 3N2CA 3GNPA 4DN1A 2E9LA 1RAKA 3IV8A 1CIUA 4I9TA 3I6EA 4M6PA 3ARSA 4JX4A 3E0WA 3G8EA 4WGXA 4AIBA 3BO9A 3TYCA 1UKPA 1TA3B 2WZEA 3VABA 1A0EA 1JQXA 3VOFA 4PTNA 4O0KA 1P48A 2H3BA 4DYKA 2Z0IA 2XUCA 1TV5A 3G24A 4IH3A 1RLDA 3GTFA 5AHIA 3WD0A 2D2HA 3VUSA 2BBFA 3DHPA 4XK2A 5F4WA 5G4EA 2R6OA 2YA2A 4ZEPA 3HGSA 4WR3A 1NWUA 4ZODA 1W37A 3L4ZA 1TVLA 2GGHA 2R1PA 2TAAA 4L56A 1R86A 2XVKA 1WDSA 4RPPA 3VOCA 2WBGA 5IFTA 1WZLA 3U8GA 3LGDA 1VIZA 1E9YB 3AYSA 3REQA 1EH9A 4ZO7A 2Y85A 5D9OA 1QW7A 4GISA 4PMQA 2CLFA 4XAGA 4W9TA 3AZSA 3KHJA 2O4MA 4XBJA 1HGWA 3ARVA 2WO5A 4UXDA 2TYSA 5KZ6A 2CLKA 4Q4OA 4A3YA 3GHSA 1XF0A 1FCBA 5C54A 3S2LA 1JAEA 1KCZA 3POHA 3NZGA 4B5VA 4WOZA 4CCCA 2GZXA 1SZGA 3NTYA 1RA5A 3UA4A 1GGOA 2Z26A 1YQ2A 2FGZA 2CNCA 2VCAA 1UOZA 5I77A 2WMIA 3RM4A 1AQ0A 1TTQA 3NZPA 4MNLA 4HK7A 1C29A 5E70A 3T0DA 4IGHA 4JTRA 2WBKA 3L2MA 2V3GA 3KDOA 3EMCA 2BWGA 4PUNA 2EG6A 3EX3A 1XLFA 3NDYA 6ALDA 4O1CA 3WKZA 1TPFA 3UYCA 1FHLA 3HPFA 5BU9A 4MWAE 1IHIA 4FR6A 3TN5A 1LBLA 2ZUUA 3UVAA 3NQGA 1LF1A 1O5QA 3U2OA 4HTYA 3AHVA 3B9DA 4JFSA 4AHQA 2WSRA 1BLIA 1OFOA 2HEJA 1EEXA 3TQVA 4YVPA 2ZRXA 5T9BG 4XQ6A 2R9RA 3PPCA 4MDOA 3EMZA 1OEPA 3HF3A 1OWQA 1HXJA 3B03A 1E55A 1UWUA 3DGRA 4QQUA 2Y61A 1JUKA 4W8BA 1LOLA 2L5HA 4TV6A 1IWPA 3LBMA 3W70A 2C71A 4ATLA 1U5HA 3W2KA 3NOEA 4R9OA 3FDGA 2Z1WA 3H22A 3VKDA 4KRZA 3KZSA 1DJYA 2Y7FA 3WQ5A 2PBOA 4IMFA 4B9YA 4XTDA 4O52A 5FESA 4XO7A 1UMLA 1FWHC 3NGFA 2DUXA 4LYKA 1A5AA 3UJSA 3SCSA 1T6MA 1Q2RA 2OSWA 2DV0A 4MPKA 5FEPA 4JY9A 1VBHA 1RH9A 3BW3A 1GYLA 1OCNA 3IPWA 3U9IA 3MMTA 2XH4A 3UD6A 1UZ1A 4Q7IA 4B2DD 4X2RA 4TTGA 1T40A 4H6KA 3W26A 4FIRA 2WJDA 3MMDA 2CEQA 3UXIA 5AYXA 3IUDA 4POCA 3TONA 4FNUA 4INFA 4J9JA 4GOAA 3ZJKA 3URAA 3VNIA 1Z69A 2H6RA 5ENLA 3DG6A 3BLFA 2ZADA 2EF9A 3T08A 4FF5A 4XSLA 1QWKA 3WX7A 4ROPA 5TD4A 4O18A 3AQUA 1DWFM 1ISXA 2PDXA 4RZ5A 1WKEA 3APGA 1ML1A 1JCYA 4NYUA 3LCFA 5AKQA 2A5HA 4WQ6A 1UCWA 4NZCA 1P0EA 3KS5A 4YTSA 3VNKA 4N42A 3S9ZA 4TVUA 1Y8BA 3T81A 2GQ9A 4GJ1A 1MXDA 5CC5A 3N14A 3M5ZA 1W56A 3H53A 2BZNA 1CLKA 4KS0A 1ZAHA 2VZUA 4QTGA 3NDOA 3GNOA 3TA6A 1QNRA 3LV6A 2H90A 4J35A 3G1FA 2PS2A 3A5VA 3PAJA 4LVDA 5DQPA 2HNEA 4L7ZA 4O17A 3SDOA 2VRQA 1FP8A 4OOZA 2QZRA 3TTQA 3OZYA 1AL8A 3AIVA 3H2CA 2G4JA 4I8DA 4KWSA 3VOIA 4CQ9A 4WKAA 3E9AA 1HJSA 3UG8A 4F0MA 4PTDA 2G4FA 2WMKA 2JIWA 1KBJA 4Q33A 2BHZA 3AXMA 3CPUA 5G2HA 4IMAA 3S6OA 1F7BA 3SURA 3KDNA 3DG3A 1PS9A 3WBAA 6ENLA 4XZBA 5EMJA 4FPSA 2A79A 1DJIA 5FF4A 4XVEA 4RDYA 1KM1A 5AHLA 1TR1A 1SYTA 1JCLA 3W7RA 3UVIA 2YX0A 1KGWA 5D9MA 3ORWA 5A6KA 3I3DA 2FHCA 4FI4A 5CBJA 4W86A 1K70A 1KFJA 2REQA 4ERIA 2OODA 1AQMA 3W82A 2F38A 3QLDA 3I65A 4JIHA 2XYLA 1DJHA 1BG4A 4CQDA 3A64A 1A53A 2VZOA 4WD0A 2G96A 3G2GA 1LWHA 4U28A 5B7ZA 2POTA 3AXXA 3T1GA 4MKNA 3VDGA 2X7WA 3GG8A 3ANYA 1H1YA 3W7QA 4RNJA 3WNNA 4ZE4A 1TZZA 4M29A 1HX0A 3LV5A 4H00A 1UH2A 1LOQA 2BVYA 4RE2A 2HK0A 3VNYA 4QDPA 1GNXA 4L4MA 2A6NA 3TSBA 3BLEA 4Y8FA 4J28A 2BXVA 2Y4SA 2E6YA 3M47A 1U5VA 2G8ZA 5GJMA 2INFA 1EOKA 2J13A 3N04A 3DCPA 3WQ4A 3FXYA 4EWND 4GC4A 3FSUA 2EPLX 4Q4RA 4S1FA 5K9CA 4DUXA 5XIAA 5KEZA 4K37A 2CXGA 3P5YA 1J5SA 4F2BA 3UW6A 4AY7A 3D3FA 1ITQA 1ZLPA 5C0QA 3MVIA 1XH1A 1X6NA 2Y62A 1QHOA 1TMHA 2XIBA 3W37A 1Z7AA 1SQ7A 2W0UA 2CFFA 1C92A 3E0IA 3UWWA 2O9RA 2C3ZA 4KEZA 2I14A 3BW2A 1ZCCA 2EJAA 4JNMA 2QJHA 4XUYA 1L6WA 1A5MC 3C8FA 3QHMA 3RN6A 3OODA 3IWPA 5D37A 3FKRA 4AF0B 4H9ZA 3T8LA 2ACSA 2C19A 1H4PA 3CWOX 3G1YA 4UFIA 4Q8MA 4HMCA 3CUJA 1NH6A 3W2LA 1OGBA 5BCAA 1XDMA 1QW9A 1A3HA 3C5QA 4L4OA 1VF8A 4PTWA 1WDDA 3CZEA 3N4FA 1W1ZA 4B5SA 4JX5A 2QS8A 3CZJA 1A5OC 1GOWA 1HZYA 2A1YA 3EAUA 4QSFA 4PGLA 3QYQA 3R79A 4TXEA 2QJJA 1E4NA 2PZNA 2CLLA 1QBAA 2YXXA 4JQAA 2B31A 2V9DA 3WH9A 5K9XA 1LWJA 3DENA 1YXYA 1Y5VA 2V67A 4WDTA 5JUVA 3SN1A 5I3FA 3APTA 3B40A 3AXHA 4G2DA 1JCTA 5AC8A 4K3ZA 1JI1A 2C14A 2NV1A 3SR7A 4MMWA 3FDKA 3W1QA 3RF9A 1VFMA 4NZ4A 4HKPA 4EXAA 1J6OA 4S3EA 1E6RA 3W73A 4Z1CA 3ID7A 4P7OA 3GXTA 3NQCA 4H6EA 1L6SA 4E8DA 3KVKA 3WK3A 4QG8A 3MU7A 3NPXA 4DM2A 4S2CA 1WBHA 2WMJA 1EJWC 3RMJA 3S5ZA 1JXJA 3GH5A 4LW7A 4DXVA 5I0DA 1Z48A 1A5UA 3QLLA 1Q7QA 5D03A 4Q3MA 5LIUX 3QHNA 4EAYA 1AW2A 4BY3A 3DFNA 4I7WA 2D0FA 1OIMA 4BWLC 3GG0A 1VEMA 8CGTA 1K8XA 3L4YA 1M68A 3RNDA 4RW5A 1K3UA 4QCFA 4XIMA 4UQ9A 5F2GA 1GZ1A 3W1RA 3TZFA 5FF0A 2OOFA 1BKHA 1RCOB 1CZ1A 5I3HA 4J2MA 1AG1O 4H6RA 1MRQA 1PZ0A 4HHHA 3VM7A 3QRHA 4B4HA 2P1FA 2BFGA 5IOBA 5KINA 3UBPC 3EBVA 3BLDA 3MCOA 4O1DA 2ZX8A 3C0SA 1EJXC 1EQCA 4J3WA 4PN2A 4XSMA 1V3LA 2ZFAA 5HMSA 3QQ1A 3W27A 1R9ZA 3WSUA 3CUGA 2Y8UA 1I75A 4S3AA 2WK2A 3DBNA 4UQAA 5AYBA 4WDWA 4CNTA 3W85A 2POZA 3FW6A 1M03A 3FYPA 3WDJA 1N82A 2ZICA 3W7OA 1LP6A 1WZKA 4LAZA 2AQWA 1GJPA 2WQPA 3IJQA 1G67A 3GNNA 3DFHA 1VPQA 4H3DA 4ZB2A 2BP1A 2FJUB 4U3CA 1NWTA 4GKLA 5C6MA 1UA7A 2DZWA 3V0SA 4JN8A 1H5VA 1BVWA 3GK0A 3E0FA 1AD4A 3ZVHB 1ECEA 1UD3A 1HW6A 1ZALA 2VZTA 4PSPA 1FXPA 3H54A 1J11A 1XD0A 3FNDA 4F4RA 1D7FA 3CV1A 2ZA3A 3CH9A 4UOZA 1TIWA 4BHYA 1TRDA 2O7SA 3RU8X 1V0MA 4EPBC 2ZXQA 3FA3A 1XS2A 4HYWA 4IM4A 4MNJA 2V5CA 3G6LA 1XFCA 3ME3A 3QVQA 4R5EA 3AU6A 3DH7A 3TP4A 3P7YA 1V4YA 3TW9A 4TMCA 1GJUA 5EU9A 2ISSA 1V6VA 1HO1A 4LOCA 4GH3A 3R89A 1LLOA 5EMYA 1Z32X 4S38A 1F2JA 1DWAM 2A3AA 4OV4A 3K4DA 2PMQA 5M03A 5CPTA 1O5XA 2OT1A 3F4VA 1RK6A 5FL0A 9XIMA 1MDLA 2EAWA 5G2IA 1CYGA 3M6YA 3MHFA 3KCOA 2NXHA 2D2GA 1Q4WA 4AAJA 3WJYA 1EJRC 1V6XA 3WQDA 1JL8A 2CERA 2NV9A 4G7EA 3AMDA 5LNRA 3H2FA 1UOKA 3W1PA 7PTDA 2WMHA 1BAGA 4IX0A 4UNKA 3NOYA 3BJFA 5E0KA 3WENA 1VGAA 4N9CA 3CUIA 3AIUA 3B8TA 2A0NA 3CUZA 3TYBA 1D8CA 4F79A 4C1LA 1O5KA 4S3DA 4PE8A 2WLZA 2YKKA 3EXRA 2VZVA 3TC3A 2YL6A 4C6NA 3BLPX 1ALDA 4B3KA 2YXOA 2Y1HA 3GNRA 2UY4A 3O9NA 1P0DA 2FLIA 3O06A 4HK5A 2WSKA 3ZJ7A 1KLZA 4DM1A 1OZMA 3LPOA 4FIQA 4HNTA 1UJPA 3IGXA 1IYXA 1V08A 2XN0A 4CCEA 4E2BA 1VFOA 2X1TA 4NHVA 3QC3A 1Y5WA 1FDJA 5AHNA 3MSGA 5ECUA 3FAXA 5E0CA 1FCVA 4OOUA 2FPYA 3CEUA 1Q2SA 1Q6OA 5DELA 4HJWA 1M7XA 4M6VA 1YXCA 3IRDA 3WDHA 4G1KA 4R27A 4IMCA 3WF2A 1D3HA 1U1HA 4GBDA 5ECVA 3TROA 2HRWA 3P62A 1W1YA 3WYZA 5J5RA 4DPPA 1RJRA 4KWVA 1JFHA 3A21A 3TR9A 1EP1A 2PTXA 4FK9A 2QPSA 4LBRA 4O0ZA 2OZ8A 1JNDA 2VDGA 2YW3A 3FJ4A 3GDMA 3SCTA 4BCEA 3EPMA 3M44A 4KFOA 2EHHA 1GYNA 2QUUA 3BLOA 1F8MA 1E0TA 3R58A 1SO6A 4CKQA 3U4FA 3RHGA 4HZ6A 4XAPA 4DYEA 3E12A 6REQA 2Z25A 4TR9A 2EKCA 4GO8A 3W7HA 4GNJA 1ONEA 4KEUA 4Q6XA 4GPNA 5D8ZA 5LIXX 1E73M 4JZ5A 1U1JA 3ZIZA 3DAQA 4UC5A 4KPLA 2XIJA 3TK7A 3BCJA 3LGEA 4MNKA 2CW6A 2FFCA 5CH9A 2Z24A 4LPCA 1I2RA 1GQLA 3HG2A 2D0GA 3BMVA 2HWGA 3W1TA 4LVFA 4JEQA 1UQZA 5FCZA 1RQBA 2ABAA 1YNQA 2CBIA 3IJ9A 1JQVA 3PZQA 2OQLA 5FJUA 2NX9A 2PAJA 4P7QA 4L6OA 1M65A 2ZXAA 4PRRA 1XSJA 3W53A 2Y7EA 3TAOA 4NAEB 2A7NA 5E93A 4CD5A 1MUCA 4LH8A 1PDZA 3HG4A 2EPOA 3QZ6A 2A7RA 1UA3A 5AFDA 4FMVA 4PMDA 1NDYA 1UD6A 2CWNA 2VR2A 3W1NA 3C0JA 4L65A 1XLCA 1QT1A 2PRLA 1NF0A 3V1PA 3PANA 4QCEA 1U2YA 1F6PA 4EPKA 3MUY1 1UW9A 4PEEA 5ABHA 5FEWA 1PB0A 1Q7ZA 5FEXA 1KBBA 1IWBA 3WNMA 4A22A 3LTYA 3MP5A 3BV4A 3GG1A 3PUEA 3ZO9A 1EYWA 1RP8A 1VFHA 4PFMA 1EZ2A 4Q4KA 3PUGA 2VWTA 4TMBA 4WEVX 4CN1A 3CV2A 4UFHA 2QJIA 4B2DA 3S5YA 3KUMA 1P6BA 1MEHA 1KM4A 5CC7A 5H8UA 1O94A 2OZ0A 1JRBA 3WLPA 1W0MA 1AJ2A 1XSKA 1OX5A 1ME7A 3SADA 4RXGA 3WUBA 5TAOA 4HU8A 1V7YA 3QTPA 2OFJA 1TPVA 4GQGA 5HAOA 1ICPA 3WQPA 5K9DA 4V27A 1YYAA 1W8SA 1OSEA 1XIEA 2VUNA 3QPYA 2YZRA 3S1VA 4QROA 1HN1A 3L9CA 1RV8A 3NURA 1P0BA 1IV8A 2YA1A 1DWGM 4TIMA 4LS2A 2BVWA 3DDMA 1SFSA 2QCHA 2DSKA 3RO8A 2O55A 3P8JA 1S5MA 3SGGA 3S4TA 3W7KA 4LUTB 4FX6M 5I78A 3HN3A 4HNNA 1A50A 1FH8A 1V3JA 3GUGA 2OLAA 1WOBA 3IIZA 1R2RA 2G37A 3PBUA 1ESWA 4L9ZA 3WLLA 2QW5A 4QLKA 1WB0A 1LCOA 1GW9A 3NUKA 2PP1A 3E5BA 4A4AA 1HJQA 3P2VA 2E67A 5D4YA 5CJMA 1XRVA 2YGYA 3IK4A 1U1UA 1ITCA 4S3BA 2V63A 4J7RA 2IPGA 2ONEA 3L4VA 3M43A 1JF5A 5H91A 1SSDA 2QCFA 4XO6A 2PLCA 3VILA 1TX0A 2OVLA 3FHQA 5D05A 4Z0SA 4H6QA 4MG4A 5FJJA 3LQGA 3R1ZA 3PWGA 1Q6DA 1XL9A 5I24A 2W9MA 3C2FA 2XVLA 3UT0A 3G1HA 3OQ8A 1GEHA 4TVDA 4B4FA 1W3IA 4JL2A 1FFQA 5A6MA 4DJEC 2VD8A 2QMJA 3E38A 3N3MA 3LM7A 3LYEA 3N6QA 4QXIA 3VXGA 4LVGA 1XUZA 4RK8A 3MCNA 3OLEA 4WSKA 4ERAA 1DXIA 3B0YA 4JTFA 3BG3A 2C91A 2ZRUA 1FXQA 3GH7A 1TV7A 3MYOA 1X7FA 1E71M 2QAPA 1U22A 1OFRA 5LNVA 1SPQA 1TMLA 2O56A 2VX7A 3ZLFA 3H4GA 3P81A 3QW4B 1PIFA 1JEZA 1IGSA 2E5DA 1M7OA 1VKFA 4E4PA 3A22A 3C3UA 2HCVA 2E09A 3W1XA 3MWAA 5AYZA 8A3HA 2E68A 2J6XA 1J93A 2RJGA 5DCEA 1DJZA 1S3TC 3IACA 3ZWTA 1WDQA 4BEQA 2PODA 4D8AA 3Q45A 1EQPA 4W7VA 3RM8A 1JFXA 4IQEA 3EWBX 1P7TB 1UHVA 1V77A 4TTUA 1QBBA 4QRNA 1CCWB 1FHVA 2OLSA 2NVCA 2V8ZA 2G3NA 4PCPA 3C2RA 5EMKA 4GD0A 1J0JA 2XH2A 2PBGA 3CYJA 5BNKA 1KW1A 1W2PA 4O1EA 1HKIA 3PN8A 3IJ7A 1RZMA 3KCJA 1XFBA 3BAYA 2GDUA 3RAOA 4WF7A 4PMJA 4HHPA 3TN6A 1J4EA 4NJKA 1BWLA 1CECA 4OT7A 1RA0A 3MZNA 3U2ZA 2C18A 3ZR4A 1C91A 3D47A 1FX6A 2VO5A 3SECA 2HE5A 3CZLA 3BWWA 3G18A 3NR0A 4JIEA 3V35A 3AIQA 1MUMA 2DIKA 2PU0A 3S1WA 2BOFX 4QEEA 3E02A 1KXQA 1S2CA 1S5WA 3VZZA 3YPIA 1EL3A 4O1FA 2H9AA 1XCXA 1BD0A 3ZR5A 4QAIA 5IXEA 3K4AA 4WKFA 1JPKA 2PDNA 3HV9A 2PF0A 2VELA 2Y70A 4HPGA 3PB0A 2E4TA 4NAFB 4O57A 5BRQA 4AZGA 1WKFA 4F0KA 4A2SA 2DW6A 4AU0A 1QO5A 5DEZA 2YYTA 3SB0A 1TJ2A 3NQFA 3UWVA 3DERA 2OQYA 2O9TA 3N25A 3WQCA 1UG6A 3DFSA 4GZEA 5A5WA 3MMUA 1FWJC 3LRKA 1H62A 4F0LA 1KCKA 2J8FA 3DFPA 4ATDA 1BTMA 2ZZ2A 3U4AA 4IJBA 3R25A 4L1WA 4XKYA 3LB0A 4FALA 3TX9A 2OQHA 5HUOA 3HIJA 4I9AA 4UTTA 2DZAA 4RE4A 5BOEA 4QE1A 1RALA 4Z2JA 2IQ0A 5G1YA 3OB8A 5HR6A 2GUUA 2REQB 4A6GA 2FTYA 4K8GA 4NQ1A 4QDWA 5AC5A 2XINA 1VCVA 5HMDA 4IJCA 4JIIX 2BV9A 2PTZA 3P0XA 4S3GA 1PKNA 3V5OA 4JTUA 3W02A 3RU6A 4IPIA 4LAKA 2C1IA 2QDHA 1XDLA 4ES4A 1OCBA 2X1UA 1UYQA 4WSJA 3JRKA 1OYAA 2R1NA 4W5ZA 3L12A 2GOKA 1MQRA 2B7OA 2PP0A 1SW7A 1TELA 2X2YA 4EOUA 3CT2A 3WJXA 3ZSTA 5E6ZA 1QPQA 4JHOA 4IUGA 3VD9A 4JDYA 1F3WA 5C55A 3WL1A 4LB4A 1MZRA 1UBSA 3VKCA 1QW8A 2PD9A 4MPQA 3NGJA 3EWCA 1ZTVA 2XVPA 3R0KA 3PY2A 1GKQA 5EMMA 3A4JA 4H8VA 1XCWA 5EKYA 4WDUA 1EC8A 4K8HA 1H3GA 4UTKA 2P50A 3RLHA 4W5UA 1I2QA 4X63A 1JYVA 5MF5A 5IRPA 1JCMP 4X0VA 2G0WA 3S2MA 4U33A 5GNYA 5BXSA 1BXNA 1GQNA 1WAWA 3KP1A 2GWNA 1QPNA 2WLYA 2XSAA 1QU4A 2WPGA 2E6DA 1XWYA 3KE0A 1CEOA 3E49A 4XBSA 4OBRA 3ZJ8A 3Q58A 3KTSA 1B3ZA 1K4GA 5A2AA 1XYCA 4NX5A 3BSMA 3WQVA 3HURA 3EX1A 1IEIA 3P67A 5FACA 1BVZA 3MWCA 5GJPA 3NQBA 3LTPA 3WNKA 2ZUWA 4ML4A 4Q32A 1ZSXA 5I07A 3UZ5A 2W67A 4V15A 2TMDA 3PTMA 1V02E 1XX1A 3C3NA 1KBKA 1ZAIA 2QCLA 3COTA 1Q66A 3HPSA 1LJYA 4UTLA 1X6LA 3G8RA 2XG9A 1VYSX 4KCTA 3IARA 3WJWA 1XLDA 4FOUA 4XX6A 2NT1A 1PYFA 4X9YA 1Z89A 4FOJA 1W3LA 1GVIA 5TF0A 3DYOA 2OMAA 3TN3A 3UETA 3VKAA 1E0UA 4TO8A 4W8AA 4ZZ9A 2CZ5A 3LCGA 2AMXA 4GQ0A 1DL3A 5U4NA 4TQTA 1I45A 1LL4A 4PUWA 3IJ6A 3WMBA 3E1F1 1NQKA 4HNCA 4FX8A 3PBWA 3WQFA 3T2PA 1PUDA 3GXNA 4GO9A 2I5QA 4DJFA 3RITA 5MHBA 5DMLA 1B9BA 1IT8A 4FF7A 2OEMA 5KMYA 1JVNA 3V3WA 4G56A 3L5LA 4I7VA 1QR7A 1W1A1 2BX7A 3MUXA 3SCRA 4IMDA 4DNHA 1XBVA 4AVFA 1UH3A 3WF0A 3NQVA 2HTMA 5AB3A 5F4SA 3KL3A 4Q8UA 2W66A 3R10A 4IQLA 2DUZA 1W5PA 1DYSA 3W7CA 1OYCA 3WNLA 3VNDA 2ZYFA 2VX5A 4E3VA 1LUCA 1J5TA 1G4TA 1WYIA 4LTSA 4LUSA 2JE8A 2J7DA 5ABFA 4TU1A 2D73A 1XJBA 2VVNA 4C6MA 3DC0A 2Z6IA 1EIXA 3M0IA 3NL5A 3AS0A 4KMQA 3AMCA 1FCQA 2ISWA 1H49A 3DC8A 3PTQA 1PX3A 1OD8A 1EBHA 1B57A 3G3MA 3NVTA 3QN3A 3XISA 1SW3A 1WP6A 4XZNX 1SVDA 4HMDA 4W87A 3UR5A 2KAUC 3UWQA 1GUVA 4AH7A 2XDFA 2CETA 4AB4A 3WQWA 5A8PA 3GBEA 4FZIA 1BF2A 2EKGA 4ZOEA 4LQ1A 1F07A 4JAWA 3D3AA 4U3AA 5LIYX 3EGJA 3WLSA 3BAIA 3QGKC 4L6DA 4IX2A 1YKWA 1QAPA 2NT0A 3NO5A 3UYIA 5AHMA 2VRKA 3M4HA 3S8HA 4JYFA 3T2OA 3TLLA 1FWGC 3EOUA 4PUDA 4O8AA 2V5DA 3P61A 4BZYA 3AUJA