3EB4A

Voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
327
Chain Sequence
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, oxidoreductase
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Cortisone dissociates the Shaker family K+ channels from their beta subunits.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3eb4A00
3LEPA 2IKGA 2I16A 4GIEA 2IPFA 4JQ2A 2FVLA 1XF0A 3R94A 1SM9A 1RY8A 4ZFCA 2PDMA 3R6IA 4YVVA 3V0SA 4LBSA 3NTYA 4LBRA 5LIYX 3UYIA 3M0IA 1EF3A 4PMJA 3EAUA 2INEA 3G5EA 1X96A 1S1RA 3G1RA 2HE8A 1Q13A 4XZIA 2IKHA 1XJBA 1LWIA 1ZUAX 4XZHA 3Q65A 3UWEA 2CLPA 4XVEA 3UFYA 1YE4A 4XO7A 4EXAA 4JIIX 1AH4A 3CV6A 2BP1A 2PDXA 5LIWX 4IJCA 3LENA 3LQLA 1Z8AA 3N6QA 3ONCA 2QXWA 4JTRA 1HQTA 3FX4A 4YVPA 4LAZA 2HV5A 3UZYA 2IKJA 1EKOA 2A79A 3B3DA 3UZZA 2PDYA 1AH3A 4H7CA 2HEJA 4AUBA 1HW6A 4XVDA 1J96A 4HBKA 2WZTA 3V35A 2PDCA 2IKIA 2DV0A 4WDUA 4WEVX 4XK2A 2PDGA 3LD5A 1Z89A 2PZNA 3LZ5A 2PDKA 1PYFA 4JTDA 3BCJA 1ADSA 3H4GA 1US0A 3GHRA 2PDQA 2IQ0A 1EL3A 1VBJA 4NKCA 4LB3A 4L1WA 1ZSXA 3O3RA 3LBOA 3GHTA 3COTA 3MC5A 2ACUA 3GHUA 4DBSA 4GQGA 4DBUA 4ICCX 4FALA 4QBXA 5HNUA 4WRHA 2PDPA 4JQ1A 3FJNA 4GQ0A 2INZA 1AZ1A 2HVOA 3R43A 5AZ1A 4OTKA 4XAPA 3EB4A 3GHSA 2NVDA 1YNPA 1Q5MA 4XZMX 2PDWA 1ZGDA 1M9HA 1MRQA 4HMNA 3DOPA 1S1PA 5AZ0A 4QXIA 1S2CA 2AGTA 3WCZA 3ERPA 4JQ3A 4MHBA 4PUUA 4QX4A 2PDJA 1GVEA 4XO6A 3M64A 5M2FX 5JH1A 5KETA 2HE5A 2P5NA 3D3FA 3WBYA 5HA7A 2PEVA 3M4HA 2PFHA 4JTAA 2ACQA 1T40A 3R58A 1IHIA 3H7RA 4R9OA 1PZ1A 3LQGA 3UZXA 3RX2A 2PDUA 2BGQA 1JEZA 2ACSA 2FZ8A 4Q7BA 1X98A 4PUWA 2HVNA 2ACRA 4JQAA 1QWKA 3R7MA 3T42A 4XZNX 3WBWA 1EXBA 4I5XA 3CAQA 4ASTA 3ONBA 1MZRA 1PZ0A 3F7JA 1LQAA 2PDBA 3CAVA 4LB4A 1S2AA 1Z9AA 4YS1A 4GABA 2BGSA 3V0UA 3CASA 4WGHA 3BUVA 4PR4A 3GUGA 2FZDA 1AH0A 1MI3A 3UG8A 4WDTA 2VDGA 3H7UA 2IPWA 3VXGA 2PD5A 2WZMA 4WDWA 4YU1A 3C3UA 1C9WA 1A80A 4FA3A 3O0KA 2DUXA 4JTCA 4WDXA 4PRRA 5DANA 4JTQA 4FZIA 5LIXX 2PDNA 5HNTA 3LN3A 3UGRA 2C91A 2IPJA 2IQDA 3CV7A 1T41A 3Q67A 4L1XA 3WBXA 1YE6A 5C7HA 3KRBA 4EXBA 1IEIA 3BV7A 4F40A 4H8NA 2FZ9A 1XGDA 3WG6A 2PDIA 2I17A 3UZWA 4JIRA 1PWMA 3CMFA 4YVXA 3UP8A 2HDJA 2ISFA 1RALA 3LNMA 4LAUA 1RY0A 3RX3A 5LIUX 2PDLA 2PDHA 4GACA 5JH2A 4IJRA 3RX4A 1Z3NA 2FZBA 3V0TA 1VP5A 3S3GA 3R8HA 4PRTA 3QKZA 4IGSA 4DZ5A 3LUTA 1PWLA 3DN5A 4XZLX 1AZ2A 3N2TA 2PD9A 4GCAA 3EB3A 2J8TA 4GA8A 3MB9A 4JQ4A 1ZQ5A 4JIHA 3BURA 2NVCA 1UR3M 3U2CA 3P2VA 4QR6A 2F38A 2DUZA 1QRQA 1AFSA 3V36A 2IS7A 1R38A 1YNQA 4FAMA 4RPQA 3LZ3A 4G5DA 2PDFA 2R9RA 2R24A 2F2KA 4Q3MA 1X97A 1FRBA 2PF8A 2FGBA 1K8CA 1OG6A 2ALRA 2IPGA 3R8GA 5LIKX 4DBWA
chains in the Genus database with same CATH superfamily
1OADA 1MMFA 3LEPA 2OZTA 3AYRA 2A4AA 3THCA 1QOXA 2QV4A 5DXXA 4FF7A 3SZ8A 1EDGA 4Z1DA 2Z1SA 1XC4A 3AYSA 4A29A 3ARZA 3FCPA 4E8DA 5CPLA 5M3WA 2DU2A 3LRMA 3UR5A 4P7NA 3G1RA 4LANA 4C6DA 3TSBA 5KZDA 4H9TA 2V38A 2CWXA 4FK9A 4JN8A 3UG4A 3QC3A 4FF5A 5AC7A 4GH1A 4RZ5A 1PDYA 4D6GA 4BF5A 1EB3A 2WMJA 3BDKA 2JEQA 2NT1A 1U5JA 4AXKA 5AHFA 1D7FA 1BKHA 4AC7C 2W0UA 3O05A 2PU1A 3EWXA 1HQTA 2V63A 3S83A 9RUBA 1NWSA 4C6OA 1VS1A 1T8XA 1NSJA 2NLYA 4JBRA 2YYUA 5JIPA 3EKZA 3S1WA 1MNSA 2NXIA 1P0BA 2JE8A 4MNLA 3BW4A 3G18A 1L6WA 1R2SA 2UV8G 3R12A 4L6HA 1ICSA 4Q7IA 4JPGA 4RE3A 1HJVA 3WDJA 1WNOA 1AL7A 3BCFA 1RPXA 3H6OA 3I7QA 3U4FA 1I9CB 3ES8A 1M04A 2YDAA 3VD3A 2FIQA 3HV9A 2PDKA 4PL2A 3TYCA 3H4GA 4GINA 3MHUA 4O50A 1W3IA 1RLDA 5A95A 1SFLA 4EPBC 3UY7A 1TWIA 3AWNA 3U5YA 3GYCA 4US6A 4MZYA 1P0EA 5I2UA 1GJPA 2NQLA 3BMXA 3TWAA 4J3ZA 3GU9A 3H4XA 2W9MA 4REQB 1XCFA 4V1YA 2PLKA 3BQ5A 3PPCA 2BXVA 4XKYB 1DXFA 2INZA 1OZQA 3RN6A 1V6YA 2ONEA 3GQYA 4GPNA 3VABA 3OLGA 2Y1HA 4QGCA 1YNPA 4N6EA 4GYPA 5T8GA 4JY8A 2VR2A 4IP7A 3DOPA 5AZ0A 4O1EA 1MW3A 4EWND 5BZAA 3M44A 1G9HA 3UJRA 3KUMA 4DJDA 5AYBA 1MRAA 3CO8A 4G6CA 2D0HA 4MJZA 5L6UA 1BF6A 1SQ7A 2OT1A 3QKEA 1FWHC 3CGTA 5HA7A 3L7RA 3LSBA 4MB1A 1KBLA 2XVPA 1ZHAA 3N13A 3WF2A 2O9RA 1IHIA 1WB0A 4RW3A 2CESA 2QDHA 1R0MA 2FZ8A 3W7RA 1W1VA 4ZB0A 1OWQA 2NQZA 4Q8NA 1RD6A 5C70A 3W37A 3BLKA 1W3LA 3BV4A 1XIBA 4QE5A 3WDQA 4C5ZA 2VC7A 1WDWA 1TO3A 1XCWA 2D2JA 2GVEA 4GO9A 3WF0A 4UQDA 4RNFA 5GNZA 3FIGA 3G6MA 3Q58A 3CAQA 2HNEA 2OYKA 4ASTA 1C93A 4ZCWA 1CTNA 1E6PA 2ZXBA 4DELA 4GWEA 1PE1A 3R25A 5E1QA 1EF2A 2D1ZA 5FF0A 4PH6A 1H7XA 5IDZA 3KBNA 3H8AA 1SZRA 3GUGA 3WEOA 3WLKX 5GNXA 3HQ1A 4IGNA 1B54A 5GPRA 1WOBA 3L66A 3ISIX 3W22A 2Z27A 3WQPA 5M17A 1Z42A 4PCNA 2QVNA 2V68A 3FAWA 1GUVA 4LYQA 1A3XA 3LCWA 3GVGA 2DFAA 4FZIA 4G7EA 2C13A 3PZTA 5KITA 3QY8A 3WF1A 4DWSB 4KH2A 1SO4A 4L9XA 3B9OA 2Q3OA 4RXFA 1KCLA 3A4JA 3E02A 6REQB 4L7ZA 3S5YA 4R88A 4WHBA 4XAZA 1KM5A 5HJXA 1MWOA 3TAKA 3KRZA 3CMFA 2Y8VA 1Z6KA 3KW3A 3MMUA 1PBGA 2OO0A 1W5PA 3GX9A 5J8LA 1H0IA 3PK7A 2Y70A 2VHLA 5C9UA 1LF1A 1A50A 1RLCL 3UWWA 3ALGA 1VYRA 3G1VA 1DIOA 1L2QA 4BHYA 5MKGA 4KRTA 2CETA 1LOLA 4K38A 1VFSA 3C2YA 4Y96A 4HNLA 4JR5A 3BJTA 2YL8A 2E5BA 1OZMA 3C56A 3DGBA 2CW6A 2BB0A 3S9YA 3VPLA 3LXBA 1F3EA 3WUEA 2VP8A 1J0IA 2WKLA 4O10A 3VZYA 3KZSA 4WSJA 3UZJA 3UXKA 1OFEA 1SO6A 3VDGA 2BLEA 1TPDA 4Y2WA 1TYGA 4RNIA 5TF0A 2X1IA 2ZUNA 3HFYA 4GY0A 2G0WA 4YMZA 1FUYA 1OF8A 1IXOA 1Q63A 3RR4A 3AAMA 4Z2JA 5HBFA 2Z6JA 3LI1A 3A24A 1GHRA 4ZSTA 4ZOAA 4GI6A 4ACYA 4PN2A 1JVNA 1UWTA 4B92A 4IXHA 2YL6A 4DBWA 4R5EA 3NQ7A 3W7OA 5EFDA 3MV11 4DZIA 4A3YA 1V93A 3URNA 3PTQA 3VU2A 2VXNA 1JYXA 5I07A 3KS5A 4UFJA 4ZFCA 3BLPX 2CZEA 1CT5A 3E0FA 1CGTA 3ALFA 4ZQRA 3CHCA 3QY7A 1XD0A 4L6OA 4D6HA 1VCVA 5B7YA 3DFHA 1XRTA 4FNPA 5C6MA 4PEKA 3G0SA 1UP0A 4ZB5A 5GJPA 4AH7A 4NXKA 3JZUA 3GU2A 4GD0A 4KCWA 4GUJA 5FEWA 2YBTA 3VFCA 3M6DA 3M6YA 4GZIA 5KEZA 4IFOA 3K1DA 4GYJA 4O0QA 1A0CA 1P6BA 4IJCA 2YX0A 2QPXA 4CCEA 4QSFA 5HJLA 2D20A 1J93A 3RMJA 1LLWA 1AK5A 1KBJA 3LHYA 9XIMA 3W87A 4HPNA 2DZSA 5AYXA 1IZCA 3MDWA 3NZPA 3S2MA 4NQ1A 1GVRA 5DRCA 3B3DA 1YMYA 1XISA 4UQCA 2BOEX 4H7ZA 1RBOB 2G37A 2J7HA 3OGRA 1CGWA 4H19A 3K4WA 3GC2A 1TPFA 1J96A 2VVNA 2QCDA 4JYEA 2PDCA 3BGAA 4PYSA 4HMEA 5HUOA 2VDHA 3GZ3A 5FJUA 3LD5A 2O56A 5BWAA 3U2ZA 1V3KA 1H60A 1US0A 4GIAA 3R5EA 2YFOA 2ATSA 3A12A 1VBJA 1W2PA 1EYWA 4L1WA 1SJCA 4L4MA 2J13A 4XBKA 2GJPA 4UFLA 4DM2A 3OOQA 1SO5A 1NWTA 2WCGA 4MAVA 4LAKA 1PSCA 4H83A 2OYMA 3TK7A 4X2RA 2I9UA 3T0AA 2W6RA 4Y9MA 2BV9A 2FB2A 4GQ0A 5E5CA 3SURA 1NQ6A 3WLSA 4B5UA 3CIWA 4YHGA 3PZOA 4OV4A 1XBYA 1XUZA 3I10A 3VDHA 1LQ0A 1AD1A 2RKXA 3CAWA 4F2BA 1CNVA 2ZFAA 3KRSA 3P5ZA 5EGRA 2CLMA 2XSAA 1E0UA 3UXIA 3ITGA 1NJJA 4HKPA 2Q8ZA 3VTRA 4BI7A 3QMRA 3ARYA 3A21A 5LXXA 4IOTA 5BXTA 1B9BA 3BAJA 4ZE5A 3QHMA 4MVAA 2F6UA 1K9DA 3B9AA 4O17A 4JTEA 2WSKA 1DWFM 2Y88A 2A3BA 5IRPA 2AOSA 5CG0A 4NSBA 2HVNA 4CQ8A 3OIXA 3W88A 4C6BA 3HPXA 4BI6A 1US3A 1J0JA 2F9RA 4JTUA 3Q94A 3QW3A 4KGJA 1PX8A 1XQLA 5F4XA 4M6PA 3F5LA 4JFUA 1QHOA 3U6WA 1NY1A 2CXGA 1PZ0A 3BOFA 3M0LA 3UWQA 4UOQA 4HB7A 1G7VA 2A7NA 4DPQA 2OWXA 4LB4A 1Z9AA 3GDTA 1HP5A 2VZTA 4ZR8A 5HR7A 1VEPA 4IHCA 4DO5A 4AYSA 4A3QA 1GNXA 1EJVC 2R1MA 2OXNA 3OGSA 3TYEA 4A05A 2Y8UA 1EUAA 4MADA 1AMKA 4RNJA 5ABFA 3O6YX 1TCMA 4AZGA 2C79A 4S23A 3T0DA 2DUXA 3W7MA 2DT1A 4JTCA 3QPZA 4WDXA 3L67A 5CSSA 2FHBA 3T2QA 2VZOA 4JTQA 3AU2A 4FIQA 2XPKA 4EF8A 1Q6RA 4XUYA 2IPJA 3DEQA 4GNKB 2ZZ6A 3WBXA 4S3FA 3UWVA 5C7HA 1DWGM 3I6EA 3PNZA 4OBRA 5CGTA 3UZWA 1TWZA 4HN8A 3DHUA 3D3AA 1YYAA 4H6QA 4KKXA 4PC8A 4Q4RA 1RV8A 2P88A 3GNRA 4M7SA 3LNMA 3VOGA 3I3DA 4B5TA 1OGSA 5G2HA 1J5TA 1TR9A 3R0UA 1G4EA 3ITTA 2X05A 3BSMA 1JRCA 4I90A 2I7GA 4CCZA 1JD7A 1CB2A 3FYYA 3ZWTA 2QR6A 1X7IA 4MNJA 3ZFHA 1KD0A 3TR9A 2HNHA 1JQVA 3MB9A 4JQ4A 5K4ZA 1WKDA 5XIAA 1KRAC 3QMSA 1CENA 4QJ4B 5FOOA 1Y5WA 4UR8A 2EEXA 4H2CA 2GVJA 5LSMA 3AHXA 4G7EB 1RJQA 1D3HA 5D8ZA 1F73A 3B8IA 2GUYA 2A0NA 5G4EA 3UU0A 2CFFA 3URQA 2G3MA 3UEQA 3W0KA 2ZKMX 1ADDA 1R46A 1TJPA 3FS2A 5F4SA 5LNWA 2WC4A 4ZL1A 1ZBCA 3MPGA 1B30A 2V5CA 1J8VA 4NZFA 4KMQA 3T7VA 4W9TA 2D22A 3DG7A 4EIVA 3VZZA 5BRBA 1R9ZA 2ADAA 3ZLFA 3MKKA 1FTXA 1RSCA 3MDUA 3NR0A 4YTUA 1RA0A 3AYTA 5AC6A 3KS6A 3E2QA 4IJBA 4Z1BA 2ON3A 4I6VA 4AIBA 1VCGA 4I8YA 2XTKA 1JAEA 2EHHA 1Y5XA 1DTUA 4M6UA 2E68A 1QI5A 4D6FA 5AC4A 4W8BA 1QUMA 3SI9A 3SR7A 2W66A 3WD2A 1N8FA 2GLKA 1KCKA 3CHVA 4XG1A 1EF3A 2WVUA 2OZ8A 4NZ4A 1X96A 5HMFA 2YB4A 3W29A 3VC6A 3QGAC 1KTNA 3UESA 3P81A 2NQ5A 2Y24A 3RPTA 4B5WA 1Q6OA 3KRUA 3S9ZA 4X9SA 4NF7A 2ICSA 1PIGA 3AMCA 2CERA 3QVQA 4KEMA 1JG9A 3A4WA 4NYYA 4XAYA 1HKKA 1PTGA 1TRDA 1JYVA 2GGHA 5LKYA 4RE4A 3NM1A 2HS8A 2FMOA 4ATLA 3OPSA 4JAWA 2VFFA 1OCJA 2DVUA 2XH7A 3JVAA 4Z2HA 5CC5A 2OQHA 3BQ6A 5ENLA 3P8IA 1F4AA 4MNMA 3GAYA 2QUVA 6CGTA 2V5JA 3RR1A 2WM1A 4MAZA 2VVSA 4WUIA 4YL2A 4CVUA 3DX5A 4OE7A 3UG3A 4V28A 3N73A 2OR2A 4M56A 1JCXA 1PIFA 1JGMA 3KOFA 5CC6A 2QMKA 1KFEA 2JKPA 3GG1A 3GH4A 1JPDX 1OY0A 5JBDA 3AXXA 3LZ5A 1ML1A 3I4KA 3QYSA 3MUZ1 3I7RA 3GHRA 1V4YA 3CV2A 5GJMA 5E0CA 5JMUA 1OHLA 3BLFA 1TWSA 2WZHA 3WQ6A 4HNNA 3V75A 4N2YA 5F1VA 4NG3A 4C6LA 2P1FA 3CZ8A 2ACUA 5M03A 1ZL1A 3GHUA 4PL1A 3W00A 2V82A 3B40A 2Z7KA 1FHDA 3DBPA 3W7JA 3PJWA 2QCNA 7A3HA 4JQ1A 1FWCC 1SJBA 1DBTA 4KWSA 1EPXA 4FLSA 4W87A 4QDMA 2XIJA 4CQDA 3SCNA 4LEFA 4QS5A 5F4WA 1W0MA 1UR1A 4UC5A 1RPKA 4GUFA 4NILA 3ABZA 4QXIA 1S5MA 2AGTA 3V5FA 4IIBA 3F2DA 4QX4A 5JXQA 4M19A 1UBSA 1UP2A 2WYSA 1OD8A 5FF4A 1LT7A 4KRZA 2QCDB 3W75A 1DJXA 4PMUA 1XUUA 4R7OA 4DJEC 1BG9A 3M0JA 1O60A 3W2KA 4Z2GA 2CHNA 3E0WA 4HTBA 5IOBA 1R7AA 1DIEA 5GNYA 3VNDA 2ACQA 3OBKA 7XIMA 3M0ZA 1XRVA 1BVZA 1VFLA 3LRLA 4ZO6A 3KL3A 1KRMA 4HIBA 3TA9A 4GNVA 5F2GA 2XSBA 2DW6A 1KKOA 4PUWA 1U22A 1SZNA 1MFUA 1TVLA 3PAJA 1GT8A 4Q7NA 3W38A 5AVHA 3ZQ9A 3CL8A 3NVTA 3DECA 2EPNA 3ONBA 4MWAC 1SZGA 4HPJA 4IMGA 4AY1A 1W5QA 2OQLA 3LM7A 1LYXA 3W2MA 4PE8A 1RH9A 3S47A 1R9XA 1F8IA 1CXLA 3M7WA 3PWIA 3LTSA 3FK4A 5BU9A 2EQDA 1KXVA 3PSWA 3STEA 2G97A 2E9BA 2JIWA 3V0UA 1AJZA 3W7IA 1R47A 1TA3A 4MFEA 4HZ6A 1QOQA 1VC4A 4B4FA 4QAWA 2WBGA 1ISYA 3ZVHA 2IPWA 3B9NA 4HZMA 3N9SA 2H90A 1A80A 3NM3A 1D3CA 2RDTA 1V0KA 3K1GA 1QMLA 2REQA 4DJFC 4DVOA 1UUQA 2YOCA 3SCUA 3VIOA 3OB8A 4BR1A 1XIJA 2WB5A 7ENLA 1Z41A 3VKAA 3EWWA 1RD5A 3F4WA 2A3EA 3RRXA 1Q7ZA 5LZLA 2XH4A 3B8SA 3GW3A 4MB3A 2J75A 1DHKA 1H09A 1HL9A 2PDIA 1TREA 4K7VA 4I9TA 3VKJA 3QQ1A 4G56A 2VURA 3TW7A 1PKLA 3GVRA 3GIYA 1I6NA 4JN7A 2JIEA 3LLFA 4LSBA 3WH8A 3PR2A 1O95A 1KBKA 2V5BA 3LV6A 4RL3A 4UNKA 3QFWA 2Y7DA 2FZBA 1E4LA 2PUZA 3CZKA 2VJXA 3B8UA 4HZ8A 3DENA 4CD5A 3B4YA 1DXIA 2WOQA 4J27A 4O1FA 1OCBA 2X8RA 1SU5A 5ABFB 1KR0A 1T6MA 3N2TA 2PD9A 4L4OA 2J8TA 5EKYA 3O6CA 1EP1A 4O0ZA 3N14A 4I6KA 1ISZA 1G5AA 2VDIA 3ZJ8A 5AHMA 2VR4A 5ABTA 1QRQA 1V3IA 1XHGA 2DZWA 3CWHA 1FWIC 4GVFA 4LUTA 1GOXA 1SW3A 3VIJA 4BEQA 4PUEA 3VOCA 1S5NA 1OX4B 1LL6A 3UZ5A 1UH4A 4JTGA 2FHCA 4JTHA 3LPOA 1K8CA 1X6UA 2EG8A 1GOOA 1CBGA 3UJSA 1XLIA 4JNMA 3HB9A 2DP3A 1CI1A 2OCZA 3WQDA 4QNWA 4X63A 2PWGA 1G4SA 3CYJA 2X1RA 4KT2A 2WLYA 3OG2A 5LIYX 5JQ9A 3QMTA 4CQCA 1NU5A 4TMCA 1AD4A 3ABXA 2C8NA 3KTCA 5C54A 1EC9A 3WK2A 5I77A 1ZUAX 5EBAA 1LLOA 1W1YA 3S2JA 3S9IA 4NX0A 4C7DA 3LI0A 1RCXB 1DJWA 5CPOA 2ZZ5A 5FJRA 4E2VA 1E6XM 3V1PA 2BP1A 2ZRZA 1SSGA 2D3LA 3M07A 1BTMA 5LIWX 3BZGA 4H9XA 4Q8VA 1TR1A 3LPPA 4TTUA 4J40A 2GK1B 1H5YA 1EC7A 4DF2A 3ONCA 4M8UA 2OWCA 4V1XA 3AHTA 1I2PA 2Z4GA 1XLKA 1ME9A 2PC4A 4LAZA 2F84A 3T8QA 4UTWC 2IKJA 2A79A 2PB1A 3ZT6A 1JPIA 3WJYA 1OX5A 3N18A 1ZJHA 1L6SA 3N17A 4HBKA 2R8WA 3MUXA 2WSYA 4B5VA 2A7PA 2BDQA 3OLIA 4ZB2A 1XBXA 2VMFA 5DO8A 1BWLA 1CLXA 3W1TA 3TQVA 4CVWA 3ZYZA 3BCJA 2FPYA 1A47A 1PPIA 4H8UA 4CQBA 3C2OA 3P62A 1UH2A 1VBRA 3APTA 3ARVA 4I3GA 2GDUA 3SRHA 1JCJA 1S3HA 3NQVA 3GC4A 5I24A 4LRTA 1S39A 1KM0A 1KXHA 1M6JA 1HGWA 1V6XA 3WEMA 3KXQA 2CEQA 1GEQA 5EMKA 4IQJA 1NF0A 3U2OA 5DFAA 4UMAA 4IMCA 1WCGA 5AYYA 5FJJA 3VIPA 5AZ1A 2P0OA 4GXWA 4NZCA 1EO7A 3ZSSA 4BF7A 4DO4A 4GVGA 4F3HA 3L2IA 3CS2A 3T2PA 1PKYA 4YHEA 2ZVIA 4PUUA 5D33A 4IQEA 2OT0A 3W7PA 2WJZA 5DMLA 1POJA 4XO6A 3W71A 1XIFA 3L9CA 4PTVA 1AQMA 4CD7A 4I9JA 4WKFA 1VF8A 4MGGA 3ZT7A 2PWDA 4HNUA 1OX6A 1L6YA 3O0FA 1GG0A 3TE9A 2YIHA 3IRSA 1Y65A 3A23A 3SCWA 3WUGA 5D09A 3VNZA 3GR8A 4W88A 2R91A 1GOQA 4BJHA 1UP3A 1ISXA 4B91A 2BGQA 1B3OA 1GYMA 3K13A 3TQPA 4U31A 1WZAA 1OT2A 5A2BA 5HMEA 3A9BA 2O4QA 3I6RA 3PPHA 4JQAA 3OTRA 3VCCA 1NEYA 2B31A 2E0PA 4HK6A 4S3EA 3FLUA 2VFEA 2Q02A 4IG2A 5JUVA 3LXCA 1Z7AA 3EA1A 2YDSA 3MBFA 1OIFA 4NVTA 2PODA 3E38A 3WF4A 2E25A 5A5WA 1LRQA 4YS1A 4S3DA 3CK5A 2QMJA 3W74A 4C7FA 3KP0A 3GNXA 1YTKA 1R86A 3M41A 4QSHA 3PBMA 1UCWA 1TV7A 4PCTA 1NQKA 2HCVA 6XIMA 3SAZA 4KWWA 1UMLA 1V3JA 4RR4A 5HWJA 3ZT5A 1OFBA 3C0QA 3EXTA 3MJMA 1C91A 3PZQA 4JHMA 4Q4QA 3WNMA 3B04A 1ZCOA 2JBMA 1M65A 3WLMA 4DM1A 1DXEA 1YEYA 1GKPA 4CNPA 3UGRA 3F4VA 4MKSA 4MWAD 4YTTA 1BHGA 4QTGA 3AC0A 1H7NA 1JPMA 2PRHA 2WHKA 1E4IA 2CLHA 2JGQA 2O55A 1EHNA 1KFCA 1TB3A 1J0KA 4DJDD 1O68A 3AZRA 1ONXA 4PZVA 1K7EA 3L23A 4LUIA 2C6QA 1DJHA 3PNUA 3CL7A 3V5OA 2RDUA 2E40A 1BGAA 3TXZA 3T44A 4ZE4A 4IMDA 2OSWA 4BQ2A 5LIUX 1Q66A 5BOEA 3ANVA 4QQUA 2P3EA 4IJRA 3S5OA 1S2TA 3EWCA 1EX5A 3AXIA 4DJFD 1EUNA 3QHOA 5AOUA 3UYCA 1TA3B 2E77A 5I78A 4ERIA 1TELA 3ZVHB 3BLEA 3PS7A 3PG8A 1YRRA 2Y7EA 3HQNA 1ZBWA 1X1ZA 1ZQ5A 3W3OA 3GIPA 2G3JA 3IEBA 2OWWA 3OHIA 1XYAA 3MCNA 1OG0A 2QIIA 3GKFA 1UR3M 1OFPA 3RCYA 5XINA 1YDYA 1EOMA 4E2OA 3IVUA 1MW2A 3IIPA 3USZA 2OX1A 4GX9A 3ABOA 2CLKA 2PWVA 2VGBA 1W91A 2ZOXA 3GG7A 3UWZA 4E8CA 4ZQOA 2PGRA 1SYTA 2H3DA 2OU4A 3H7VA 1UA7A 3WLNA 3LZ3A 5C71A 2HK0A 2GVGA 3WQGA 4D1IA 2QCHA 4CD8A 1A5LC 4DZAA 3L0NA 4CN1A 1P1MA 1EOKA 2IKGA 4W93A 1XINA 1YTEA 3FYOA 1EJRC 1F6PA 4B3KA 1UKOA 5CPNA 4HQVA 2X1UA 3R94A 1WDQA 3LNPA 1VFUA 5EL1A 4URIA 1MUWA 2PDMA 2WC7A 4YVVA 1CGUA 1ONEA 5BXSA 4HU3A 3H53A 3WMBA 4O12A 4XX6A 4GFSA 3AALA 1X6LA 4HYRA 2YGYA 4BZYA 2FHFA 2J6XA 1EBGA 1DJQA 2HE8A 2ZE3A 3LTPA 4HA1A 4NASA 4MTVA 3ITLA 3FXYA 6A3HA 4M6VA 3W23A 1Q7QA 4PB4A 2J74A 2CLPA 2GDVA 4FX8A 2XM2A 1SSDA 4JIIX 1M1BA 1GW9A 2X1TA 4DX3A 1UWRA 2NX3A 1OC6A 4S2BA 3WN6A 3ICJA 3DC8A 4MOZA 5LYRA 3SO7A 4IMEA 2E1DA 2OOFA 4RDZA 3W07A 3VNLA 1T8QA 1W3KA 3I65A 1ZAJA 2CWNA 4PGLA 3L0KA 1BGGA 4RCXA 4IIHA 1MQQA 1EP3A 4ATDA 1GVFA 4XKMA 1W6TA 4RUBA 2CLIA 3PFMA 4M3PA 3KL0A 4LCQA 3DI1A 1PYMA 2D73A 4UZSA 3IGSA 1XPYA 3CEUA 1EGVA 4WD0A 1CGXA 1I0BA 1JF5A 2ZXAA 3C0LA 6TIMA 2O9PA 4H6RA 3WYZA 5I5RA 5DMNA 5DQPA 3QC0A 3FNDA 4YTRA 3L2LA 3G1AA 3MZ2A 5BRPA 2D69A 5I6SA 2OEJA 5EMJA 5CBBA 2A5HA 3W1PA 3GXFA 1JFHA 4DBUA 3DFYA 2Y5EA 1U1UA 2J4GA 1OK6A 1EIXA 1BPLB 2VEMA 3LS9A 3NEHA 5A6AA 3ZXWA 4JX6A 5A6JA 3GM8A 3KL5A 4HHPA 1E3ZA 5D4YA 1GQLA 3NPXA 1KV5A 2JEPA 2XVGA 3LPGA 4QROA 5G1MA 1JYNA 2NVDA 3TN5A 4NZ3A 2GJRA 3RCMA 1DWJM 5DT5A 1ZAHA 4A8NA 3ERPA 4E8GA 4ZVJA 1KTCA 1PJ9A 4LVAA 3A6OA 3GTNA 2PGEA 3U7BA 2V6AA 2H8ZA 2QYGA 2DW7A 4BQ5A 5KETA 2J88A 4NP7A 1M41A 4LT9A 2SFPA 2PFHA 4TVDA 1T40A 3H2EA 1ITCA 1IEWA 3TWBA 3MS8A 1PZ1A 1THFD 1I2OA 3FA3A 4DI9A 2PDUA 1VENA 3GR4A 4MUZA 4WSHA 4RV8A 4A8LA 3WZ0E 3W02A 4FIRA 4Z08A 3VGEA 3W2JA 3IVSA 4UUIA 3BAYA 2PDBA 2ZXQA 4JDYA 5H8UA 4P7RA 3NL6A 2X0HA 2G96A 5CAKA 2ZA3A 4GABA 1UWQA 3CLWA 5BRQA 2XU2A 1AH0A 3FAXA 1Z69A 3ITOA 3RLUA 1A5CA 3F4CA 4JFWA 1EIBA 1W3JA 4Y8FA 4F0KA 3MHGA 4N9BA 4CUCA 3H23A 4BWLC 2ZADA 3D46A 4O52A 1J0ZA 1OYAA 1HX0A 1AJ0A 3H26A 1TRIA 1WP6A 4JTSA 1R5YA 3RUBL 1UOKA 1T41A 3Q67A 3G3MA 1W1TA 4M0XA 1HJUA 4JYDA 3T9PA 1TJ2A 1F61A 4LVBA 4MB4A 5G2IA 9XIAA 2Y5SA 4P2VA 4Q33A 3LYEA 3MCMA 2Q09A 4Z0SA 3W1QA 3H2FA 3W6MA 2CCRA 5LNRA 4QITA 1K4HA 3B03A 1BSIA 4PCSA 4XD4A 1UD5A 4IG2B 4BKNA 3D6NA 1DQWA 3MMTA 2DZXA 4XTDA 1K6WA 5FEPA 3Q45A 1GOWA 2F7FA 4HMDA 4FLQA 3W4RA 1P0DA 1ZJBA 1JFXA 3CPGA 1FDZA 3EOOA 3ZM8A 1MDLA 1W1IE 3NL2A 1JYWA 1K03A 2HJPA 3EPMA 4PB5A 3SW6A 1NH6A 1YPIA 1RK5A 3A4XA 4MG4A 4Z1AA 4LCRA 1KWGA 2O7QA 3QZ6A 1OJXA 2NV9A 4E6MA 4DUVA 1S2VA 3M0MA 3R8RA 1ME7A 3PBYA 1JDFA 3PZVA 4ADUA 3MI6A 4JL2A 3VOJA 4B5NA 1VRDA 2GSHA 2HQAA 2G3NA 1L0PA 1QJWA 3CH9A 3NCOA 1XIDA 3LK6A 3KTSA 3N4FA 4HNTA 1B57A 2YL5A 1K9EA 2R24A 2ZVRA 1L8PA 3IJIA 3BJFA 5I79A 2OLHA 4GZJA 1WO2A 4DXXA 3L4TA 1OD0A 4WKAA 3EOSA 3DYPA 4UNLA 5DELA 3ABSA 1UWIA 1QNOA 1QI4A 4WY0A 3TXVA 4X2PA 1KFWA 2YLLA 1CCWB 1IZKA 1V7AA 3BAKA 2PRLA 3LCXA 5F2LA 1E6QM 3C2VA 4A2RA 3NG3A 4PUMA 1IT8A 4EPDC 4LBSA 1Q2RA 1LRNA 2OJPA 3H2NA 3V5CA 5BROA 3AS2A 1KM3A 3AISA 4EPKA 4C65A 3VA8A 3R11A 1DJZA 1NM9A 5DMMA 3G22A 1G7UA 3QV7A 1Q6CA 2XINA 5I3IA 4PMYA 3NEVA 2ZYFA 2IXVA 4FNTA 2NVAA 5CQ1A 4AZIA 3NQ6A 4D8ZA 4KRUA 4DXVA 4OGZA 1LM1A 4HSHA 4O1DA 2VNCA 4R34A 1JXKA 3LENA 3EXRA 2BVTA 4XD5A 1XWYA 4H1ZA 4JTJA 1DEDA 4GOAA 2G4FA 1LUCA 1HJQA 1ODUA 2BASA 3GXMA 3FX4A 2OG9A 2PWUA 2QF8A 2OMAA 4HVXA 1JZ5A 3B97A 1TJ1A 5ABHA 4FPSA 2E6YA 2QDDA 4W4QA 1W1A1 3EX6A 1FWJC 3E9AA 3AS0A 2VC5A 5BYWA 1LQ2A 1LG1A 1OGBA 2TPSA 1ZENA 4WDUA 4WEVX 4XK2A 3O07A 1EGMA 4HOZA 2PDGA 1FCBA 1M3UA 3RLGA 1I2QA 3WBEA 3KE0A 2YKKA 4EOUA 3PZMA 4X0VA 3LGDA 4OOZA 1GQKA 4M80A 4L1GA 1R2TA 3GDMA 2YBUA 2OKOA 2G5WA 2Y61A 3KVKA 4KQNA 3WMSA 3U5UA 3OA3A 1ZSXA 1ICQA 2W4XA 4EX4A 2WM0A 4HK5A 4ONVA 4AWUA 2WV8A 1TJ0A 2VD8A 3QFEA 2QW5A 2VZSA 1CW2A 2HTMA 3VGBA 1JI2A 3NQDA 2YFNA 1R8LA 2CLLA 4XQ6A 4GUHA 4W7VA 1MEWA 2X0SA 1JDDA 4QEHA 1F2JA 2HVOA 1V0LA 2QJHA 1B4KA 1EQPA 2QAFA 3BG9A 3VO0A 1XGZA 1OVDA 1WKYA 2V5KA 4MPQA 3M5VA 4H4IA 4JQ3A 3VKBA 3TDFA 3W6YA 5C9XA 4UTIA 4ZOCA 1FCVA 3MO4A 1XKYA 1R3SA 1Y7VA 3O16A 5C2XA 3NPWA 1XYMA 1V08A 4IH3A 2BY3A 1E43A 4HP5A 3U2EA 4GY1A 1NAL1 5DN1A 4HJWA 3WBYA 1K3UA 3VIKA 4US5A 4PMRA 4H9UA 2PEVA 1L9WA 4JZ5A 1TPUA 1S2WA 4NJKA 3A3XA 3TFCA 3WLTA 1O7AA 3T08A 2VL4A 2PURA 1C7TA 3NSXA 4J3SA 4JICA 1D8WA 1C8XA 3Q4DA 4NI8A 3G8EA 1XH2A 1KFKA 2ACRA 3S5SA 2YA2A 1QWKA 3N04A 3U7VA 3W84A 5AYIA 2BX7A 1Q7MA 1DHPA 1D8CA 3P3BA 2A6NA 4GGHA 1XIHA 2V2DA 1F3WA 3LDVA 3TTEA 5G5IA 1UD6A 5HMDA 4OV9A 1JZ8A 4P7QA 2PWFA 3OZMA 1E9LA 3DYMA 3PZ9A 2QF7A 3AYVA 1YTDA 2BGSA 4L9ZA 4OBSA 2DZBA 4WGHA 4XAGA 3BUVA 3I4EA 4NXSA 2JQXA 1OFQA 1TX2A 1Q65A 1UQYA 4FXFA 1FWTA 4LAMA 4WDWA 4A8IA 4UXDA 1GW1A 3NA8A 1G4TA 4MJ2A 2GSJA 4OT7A 3N2CA 2B0MA 3CXOA 3TP4A 3EOEA 1BXCA 1TPWA 3WO8A 5LIXX 1TG7A 4HCHA 5CLTA 3ITYA 2DIKA 1MZHA 4P8XA 2BOGX 3SIZA 1XP3A 3PZGA 4YWIA 4ATWA 3IACA 2R82A 4HMCA 3V3WA 4GIRA 1VYSX 4U28A 2J7FA 5HXMA 5D2YA 3SCVA 3NAVA 3LLDA 3WLPA 4JFTA 3NQCA 1W2VA 4L4PA 4GKLA 1WA3A 4CD4A 3DYOA 1PAMA 1RALA 2VFHA 3C2EA 4JDBA 1OFOA 3OVPA 4F66A 1KWKA 3H2CA 1IIHA 4Q32A 4U3AA 1K77A 3T0CA 1TPC1 4LVDA 3QZAA 3ORWA 3NSMA 3E5PA 1IEVA 4PMVA 2GGEA 3STGA 1AZ2A 5D04C 3G1FA 4UR9A 3AIRA 1QPRA 4C1NA 1F07A 2P8BA 2NVCA 4LC8A 2CHOA 4B16A 2PP0A 3NSNA 2IUZA 2VD9A 3PAOA 4I5UA 2ABBA 4NY2A 1WOAA 2WMHA 4JXCA 1H7RA 2WJEA 1QO5A 3G1YA 2VRQA 2XIIA 4KFNA 1XQKA 1N8IA 1J18A 4MPKA 3NQEA 4G5DA 1FWGC 2C16A 2O9TA 1GZGA 2E6AA 3HGSA 2KZHA 1JRBA 1N7KA 4TMBA 3WDIA 5IM51 4IX0A 4GX8A 3VCNA 5I06A 1XBVA 3AQUA 3ARQA 3ABRA 3QGKC 4Y9PA 4N6FA 4LUYA 3HGJA 4ZEPA 1E71M 2F6KA 3S46A 4RK8A 1XI3A 4K8HA 2NUYA 4JQ2A 1ZBVA 7ODCA 1J79A 3QHNA 3CWOX 1SM9A 3GNDA 3V0SA 3SN1A 5K7JA 3R79A 5HR6A 2EJ1A 1OYBA 1S5TA 4H2HA 3G2GA 3GTFA 3WQ5A 3TH6A 4PBGA 3P60A 1S1RA 1LJYA 1NDYA 3S1UA 4U4MA 4XZIA 2Y7FA 1REQA 2OGJA 2WNWA 1J0HA 2F61A 1Q4NX 2BHUA 2DGAA 2XZ9A 1ADOA 4C6CA 3E5BA 5TAOA 1XLJA 3ENLA 1AH4A 4A3UA 1SFSA 4QG9A 1E4NA 4OECA 3C0JA 2WZEA 2WNNA 1FXQA 2IW0A 2UY4A 3SGGA 1V79A 4WF7A 2QAPA 4DF1A 4IPPA 4XTIA 5HNRA 4QHRA 3PTDA 1PTDA 4DO6A 3VUSA 1E1EA 3O06A 4FLRA 2HV5A 1AG1O 3GXDA 1XLHA 3DZ1A 3BH4A 2OOGA 4QG8A 3TJXA 3UZZA 5MF5A 1TJRA 2EKCA 3GNOA 1FQ0A 1C90A 1UZHA 5IBXC 7CGTA 1QHPA 3V35A 3CPRA 3H24A 3SQMA 3ARTA 3FEMA 2R1KA 4J9JA 2CZVA 1LL4A 1HL2A 1IGSA 1MUCA 1PVNA 3DH7A 1PYFA 4C91A 3GNNA 2F8QA 3UW6A 2CKSA 3KM8A 5AN7A 4AD1A 1EP2A 1FHUA 1LBLA 2W67A 4RNHA 3EX2A 4H41A 5A6MA 3M16A 3LCFA 4J2MA 5CKSA 2XH2A 3UWUA 2UY2A 3UETA 3IUIA 2I57A 1TWDA 4HU0A 1JZ2A 4ALDA 2YZ5A 4NI3A 5KZEA 4PMNA 2ZX6A 1M7XA 3E49A 4QNEA 3R43A 1N82A 1LUCB 4W89A 3GHSA 4V15A 1VHCA 1W9VA 2EO7A 3VOIA 4X9YA 3GAKA 1M9HA 2H3BA 3QEZA 3IVTA 1J2WA 1AMYA 5U7SA 2XVLA 5D9MA 3VIGA 3M64A 4MY8A 5M2FX 5JH1A 2E7FA 1UR4A 3OJGA 4LU0A 1BTCA 3MUCA 2YW4A 4Z0JA 1CXFA 3TKFA 3C0SA 4IM4A 4WX2A 1WKFA 4ZO9A 1V3MA 1M03A 1GONA 1XGEA 4PEEA 3CHEA 1G6CA 4M51A 4UMCA 2PRMA 1E70M 3BLDA 5CZ0A 2ZRXA 3S5NA 5A69A 2XHYA 5TNVA 4B5SA 3WK0A 2WJFA 3TTQA 8XIAA 3MANA 3LSCA 5A3HA 8RUCA 4MYXA 2FDMA 4H9MA 1V3LA 4IICA 3KFTA 4POCA 4GYFA 2AKZA 1EZWA 1IR2A 1QHZA 3LV5A 1VHNA 5A6KA 2DSZA 4WR3A 1R3VA 3GE7A 3R7MA 3T42A 4WCJA 1PO9A 3JS3A 5HPOA 3NGFA 4KERA 1WAUA 3TJIA 1KBIA 1J6PA 2E09A 1LBFA 5I03A 3T8LA 3GU1A 4LX4A 2UWFA 3L5LA 3DKJA 1IV8A 2OLSA 2O9OA 1FX6A 2E6DA 3O63A 4RKAA 1JCNA 1YBQA 3WQCA 4F0SA 4BEUA 1NIUA 5HJYA 3KP1A 4F9JA 1MI3A 4MWAE 4WDTA 5REQA 1DV7A 3UVAA 1O5QA 4YTQA 1E51A 5BCAA 4PMXA 1TV5A 3A22A 5IXEA 1TV2A 1K9TA 2BSLA 4OWGA 2PLCA 3ATZA 1KO0A 3FEQA 4JIEA 4HOWA 4NAFA 4QJ3B 4EF9A 3E2RA 1Z32X 3T6CA 1VFFA 2EPHA 2VTFA 3GNPA 5FL1A 4LGXA 4L5ZA 3T05A 3CV7A 4IMAA 1VEOA 8A3HA 5EFFA 2OGYA 5K9XA 1MO0A 4WK9A 3NO5A 4IIFA 4DAFA 3RITA 4Q8UA 4Q8OA 4XWUA 1T0OA 4W84A 5BU6A 4ECLA 3MW7A 3NO3A 3ARWA 4JIRA 2ZUTA 3NZRA 4WY0F 5H8PA 4LQ1A 2XN0A 4J4KA 2WVSA 2WVTA 1QAPA 2QCFA 2FKPA 2ZUVA 3D47A 3EDJA 3OG3A 3T09A 2Z25A 5I09A 4UQEA 1OFRA 3V7PA 3HG2A 5AKQA 2X40A 4B9YA 3EWDA 4NZ5A 1V02E 1NDZA 3ES7A 1HP4A 2R6OA 5CCZA 3S3GA 3E0IA 1OBAA 3CUGA 3LUTA 1P5BA 4NJJA 2Z28A 5CXPA 4WZHA 1W9UA 3AI0A 1MW0A 4TX6A 4GCAA 4UTMA 4O4VA 1XYZA 4O57A 3PM6A 1Y5VA 2GQ3A 2HZGA 4M1BA 3J7HA 3VKDA 3RG6A 1JJKA 3RU8X 1VBGA 4QR6A 1YXCA 5DF0A 3T4CA 1LLZA 4I7VA 4W7UA 2F38A 3P80A 2OKTA 2WSRA 1LORA 3KBVA 3CU2A 3STFA 2X0YA 4DUXA 1JQXA 3N2OA 3LM3A 1AQHA 1PKNA 1XICA 2J27A 3XINA 1M7OA 1AUSL 2KX9A 1IEXA 1FRBA 4DJEA 2CITA 1NOUA 4P5UA 3HTWA 4F79A 2ALRA 3N6JA 3VILA 1UW9A 3BMVA 4AC1X 5E0FA 5J5DA 1UR8A 1F6KA 3NPUA 1E15A 1IIGA 4UMBA 2HRWA 4D6EA 1RY8A 1VD6A 4KEVA 2VWSA 1D7KA 2BTMA 1GKRA 1IXNA 1GCYA 4LAOA 1HO1A 3VNYA 3R4IA 4MY1A 1V6WA 3EX1A 3CIXA 4C6QA 4D8AA 3SGZA 2DSVA 3M1ZA 1TSIA 3CBWA 4F2TA 1KA9F 4C1NB 3FSUA 4MWAA 2BHZA 1UWAA 2FTYA 4HYVA 4XZHA 1M7JA 1UKSA 2FGZA 3VGFA 5IFPA 3F4NA 2Z7GA 1YNYA 1ZBKA 1K1DA 1A3HA 1VLWA 1WBJA 2WPGA 2GVYA 3O6DA 2C1IA 4AD5A 4MFDA 3LY0A 4JNZA 3AUJA 3SADA 3GG8A 1WDDA 1C29A 2FMNA 1LRTA 1TVPA 4V27A 4LBUA 3BVJA 3LX9A 4DJFA 3AFBA 6TAAA 2J25A 1EKOA 1FWEC 1X6NA 3N2BA 3H55A 2QCLA 4GXPA 4NNCA 1S46A 1E1FA 1WKEA 3VK5A 4AUBA 3SSZA 4XVDA 5CAHA 1QR7A 5FCZA 3LB0A 3IJ9A 3DFPA 1G67A 3G1SA 4RZ4A 5D37A 2ZZ7A 3TOYA 5G1YA 4L56A 4JTLA 4AD3A 3KHDA 4WOQA 3IANA 3O7UA 5D2XA 1O5XA 3KX6A 3M0XA 3CAKA 1V02A 2H9AA 3BK0A 5J5RA 5E9AA 4LB3A 4H7VA 5LGZA 4HSOA 4Z2LA 1CYGA 1REQB 5JU6A 4OBTA 3BAIA 3DXIA 3REQA 5TBOA 3LBOA 2R1LA 5AFDA 3QW4B 1UWSA 4GQGA 1P0NA 2B4GA 3W85A 4UZUA 1XYBA 1EBHA 3QYQA 2OELA 2BNJA 4Z17A 3TYBA 3SUSA 1F4HA 3CM4A 1ALDA 2RDWA 3MMDA 3TROA 3SBFA 4PTNA 3W1MA 2UY3A 3SY1A 3SB0A 3NDOA 3G1HA 1EEXA 3IWPA 1MRQA 4ZQPA 1XH1A 1TV4A 4S3GA 3C61A 2RHGA 4AAJA 5HAOA 3RMEA 4NAEA 4FOUA 4DY1A 1W5OA 4GBDA 2XGZA 1LP6A 2GDQA 2Y85A 2EF9A 3EA3A 2QLYA 4C90A 2NUWA 5LA1A 3GYEA 4NNAA 4J7RA 1ZTVA 1CXKA 1F76A 3CIVA 5CSYA 3QTGA 3SN4A 2DZVA 1TV3A 3CLMA 3P5YA 5EB8A 2DZUA 4X61A 4XZNX 3O1NA 1RJRA 4FP1A 2V0TA 1R3WA 3EXSA 3VYLA 2DSWA 3TC3A 3ZJ6A 4V33A 2AQWA 4Z2IA 1LQAA 1GJWA 2GQAA 2R1NA 1AW5A 4G9PA 1VJSA 4G2DA 1ISWA 1NDVA 3GC5A 3AHZA 3CASA 4MLJA 4M7TA 3P74A 1J10A 1NFBA 4C60A 4JL1A 3H7UA 3PPFA 3H12A 3FHAA 4QLKA 4U10A 3POHA 3C3UA 1PX4A 4HSNA 1XS2A 4PUNA 1AW1A 6ALDA 8XIMA 1I45A 2OPJA 4DLMA 1P6CA 1A0DA 5DANA 3V1HA 4HU8A 4UBPC 1EX1A 3UXAA 4DB7A 3W7EA 2QCCA 4UTWA 1FFRA 5T91A 1AJ2A 1YE6A 3FY1A 2PC8A 3GXNA 4QLLA 3MCOA 3TQ0A 1XBZA 3W1AA 1TE1A 4M29A 1J2BA 1HUVA 2Q6ZA 2FZ9A 1BQCA 4G1NA 4JS3A 5EU9A 2I17A 3CPUA 1G69A 4M81A 3UCQA 1FHVA 4W8LA 2D2GA 4OJYA 2Q8XA 1HVXA 3GWQA 2PCEA 3AXKA 1DOSA 1Q6FA 5FSDC 3TYDA 1LWJA 4KF1A 4DWDA 3VINA 3P82A 1E56A 1RK6A 5C8BB 2GJLA 1QNQA 3M46A 3RX4A 3F2BA 1YBQB 3GXTA 3WJWA 3ARPA 4ZOEA 3TCEA 5REQB 2YR1A 3AIWA 1D2KA 1SFTA 4QG6A 3ITXA 2G4JA 4AHOA 4Y6GA 5KMYA 2GJNA 2WW5A 1QPOA 5DEZA 4JIHA 3KTXA 5CC7A 4K8EA 2VRKA 1PKMA 1YXDA 2X2GA 2PTZA 2WKGA 4LEQA 2DVTA 4LF1A 2AMGA 5FD0A 4XV0A 6ENLA 3AHYA 2X1SA 2IMRA 3AOFA 4Y9OA 1GOIA 5A6TC 4AD4A 2QUUA 1M68A 3L4VA 1KFBA 4FNRA 3WJXA 4FR1A 3L65A 5CZSA 3S2NA 4DZHA 2ZBTA 1N2VA 5F2MA 5CJNA 4IFRA 4H8HA 4KS0A 3SCSA 3LGGA 5AC5A 1AODA 3WH7A 2DPEA 3SQSA 4MKNA 3F4DA 2ZZ3A 1XLDA 3N9KA 2OZ3A 4AVOA 1J11A 4HA0A 2D0FA 2RJGA 1KM2A 4BY3A 2P53A 2E3ZA 3WD0A 3SRFA 3RM8A 1B3XA 3U4AA 2CIPA 1U83A 3IPWA 3G3DA 1UR9A 1ZALA 4YN5A 4DBEA 1VEMA 3OODA 3EPOA 2W61A 3G0XA 3VGHA 2C1GA 3CYVA 4P8WA 4GLEA 3N9RA 2IQTA 3LHZA 4TQTA 1H1YA 2C1HA 3E2VA 1PTAA 1RP9A 3NO1A 3TA6A 3H2AA 3VD5A 4KBXA 1YXYA 5LXEA 2FGLA 2HBXA 4GGBA 3S2LA 2ZRUA 3WNKA 4K3ZA 4O54A 4CN6A 5A6BD 3T55A 3R2GA 3SGUA 4ZO7A 1DJYA 2IXUA 5FKYA 3RGTA 1Q6DA 4W8AA 2PE4A 5IHSA 1LCOA 3W2UA 2I9EA 4AWTA 3XIMA 1NVMA 1XIIA 3XISA 1C9DA 2PTXA 4AFYA 2ZRVA 1ENUA 1UYQA 3B9DA 3VDCA 1FWFC 4ICMA 2DJXA 4J3VA 5IFTA 4GI9A 3T0TA 4O53A 2QGYA 3WQFA 1XX1A 1WDSA 4JTTA 3R13A 1VJZA 1Z89A 5I00A 3L4YA 3P8JA 1EL3A 4NKCA 4CNUA 4MWAB 4IZGA 3BE7A 1OIMA 3CTTA 2XSXA 3O3RA 1EO5A 3KOWA 2HS6A 1WZKA 2FYMA 1BAGA 1XPGA 4NU7A 1S38A 4N0RA 5D30A 3T4WA 1E9YB 1TZ9A 2BOFX 1EJUC 2QJIA 2QV5A 1FHLA 5HNUA 3VKCA 1CPUA 3I3BA 5E0KA 2D2OA 3IIZA 1T5AA 4G7FA 2C0HA 3HQPA 1DORA 2XFWA 5AC8A 1GOMA 1GQIA 1IYXA 1JPKA 3GY1A 2W91A 2PDWA 3S1VA 4CCCA 1K8YA 1RXOB 2YYTA 3LTYA 1J5SA 1MVYA 5HNNA 5HMSA 3L5MA 2NV2A 3H4WA 5HQLA 1NARA 1H2JA 1UROA 3M0KA 1KLZA 4AEOA 2QUNA 7REQA 1PIIA 3EA2A 3HPFA 1JEZA 3HIJA 3LCGA 5DT7A 3HOJA 4Q6JA 4KWVA 4F0HA 3ZIZA 3TFXA 3KVLA 3NZ1A 2X41A 1EHAA 2FH6A 1KRCC 1PEZA 1VIZA 1TIMA 1X39A 4Y9NA 2WHMA 2J78A 3OZYA 4MF4A 4L9YA 5G4WA 4QAIA 5D9PA 2BWGA 2FB3A 2CLFA 2AQOA 4AW7A 1V3HA 5AHNA 3NJ3A 1MXSA 1HN1A 1RBLA 1B5TA 1TWWA 3MV01 5HANA 3ZSTA 3RAOA 3HU7A 4XB3A 1ISVA 4FXRA 4IF2A 1DL3A 2BZNA 3GH7A 4Z42C 4AXNA 1HG3A 2WCAA 2CKRA 1FWDC 4HK7A 4Z2KA 2E5DA 4WOZA 4MDOA 2DQXA 3S6OA 4DNHA 1OK4A 2D3NA 2E4TA 4KWOA 2XDFA 1A5AA 2YJQA 3OBEA 4NAEB 1UUMA 1BLIA 1UR2A 4PRRA 1VLIA 2ZX9A 1A49A 3AIEA 1H41A 3WIJA 4XZBA 4WKHA 3CZLA 4UTTC 1W37A 1EJWC 1O1HA 3E0LA 4ZSUA 3NQ2A 3GRIA 2QHAA 2FJUB 2H6RA 5MKGB 1QCWA 3PZNA 3AMLA 1IEIA 3POCA 5A94A 4UTFA 4L6DA 1WPCA 4O11A 3KVJA 4Z1YA 1DPMA 1TE6A 3UP8A 1QBBA 2A85A 2XYLA 4RPPA 1NWRA 5CPQA 4US5D 1XLCA 4OHQA 1CXEA 2WMKA 3LCLA 3R0DA 1C92A 1E6NA 2C19A 1BEUA 3W86A 4N4QA 5C0QA 1DVJA 3R8HA 6REQA 1QNSA 1O5RA 1HKMA 3V18A 4XZLX 1P43A 3EWBX 1GEHA 1XV8A 3SEPA 5LHEA 2I56A 2W79A 4NL1A 4H00A 3A13A 4LPCA 2ZZ2A 3MU7A 1PHQA 2C15A 3G6LA 2ALDA 1YKWA 1XIEA 5D38A 3IS4A 3NQGA 3TTYA 3SUVA 2J7GA 4AMCA 4TU1A 5CSUA 4N9DA 4IL0A 3CHDA 1HKIA 4RPQA 5T9BG 1TTJA 3FOKA 1VPQA 3HQOA 1WAWA 4UNIA 2F2KA 1YX1A 1DWIM 4INFA 4Q3MA 3QLDA 4HA4A 4C6EA 2JGYA 1OG6A 3MSYA 4F9DA 1WXZA 1Q4WA 2GGJA 2VQUA 1W56A 2RGLA 4B5XA 4BQ3A 4BS0A 2FVLA 5E6ZA 1FWNA 4ROQA 1SZEA 1F9CA 2ZC8A 3WLRA 2Q01A 1DE6A 4PTMA 3SM0A 4AIEA 3CHFA 1TFVA 1J6OA 2EPMX 3PZUA 1MQPA 3WH5A 3DHPA 4A3HA 1HJXA 3GTHA 5KZMA 1JDCA 1XJBA 3OW1A 1Q6QA 4IQDA 3M5YA 3WQOA 3QOMA 5T9CE 3RNDA 1YDVA 1KGUA 2P8CA 4XD3A 1YE4A 1T99A 4DQWA 3VGGA 3OVQA 2PLJA 1J4EA 4S3CA 1XG4A 4FI4A 5D05A 1XR2A 3BJSA 2DORA 3HURA 3LQLA 2C3ZA 1JUBA 2D2HA 2VEFA 4YCPA 1FWAC 4BWLA 3HZ3A 4KGLA 2Z2UA 3HGOA 2DVXA 1GOKA 2QNEA 2ABAA 4H7CA 1GGOA 3GFXA 4ORMA 1HGYA 4E3TA 2DSUA 3HGRA 2WZTA 3M9YA 2INFA 1H5VA 3PG9A 3WFZA 4R7WA 3A5FA 1QI2A 4TUFA 3YPIA 1CDGA 3CQIA 5K2ZA 4JTDA 3S1XA 3WL1A 3GBDA 2IQ0A 5DMYA 4ADSA 1YADA 3RLVA 3COTA 3VE7A 4AZCA 1PUDA 1JZ7A 1NDWA 4ICCX 1K70A 4QBXA 2Q8LA 1TKKA 1BYAA 1ZB5A 1UHVA 3LRKA 2WSQA 1ZP4A 2X2YA 2ZX7A 1GVOA 4RW5A 4QCFA 5T26A 1WZLA 5CGQA 3VX0A 1EXPA 3A4AA 1XD1A 4GO8A 2QULA 2ATMA 4KWUA 3E6EA 3WD3A 2BMBA 3B06A 3VDBA 4OQVA 2ANUA 1QASA 3OQEA 5H1WA 4IIDA 5G2WA 1QK2A 1F3XA 1S2CA 1KM1A 3BANA 3P93A 1WDRA 4ZOBA 1GORA 2ZX8A 5CGMA 1GVEA 4NX5A 4LJ3A 1NOFA 4L64A 5IDIA 1I2NA 1ZS2A 1XDJA 2WMIA 3OHMB 4PFHA 1H62A 4XSMA 3CZJA 3H7RA 3LQGA 2Z1KA 4PODA 3VD9A 1XXXA 1A3WA 2PWEA 1MEIA 5BNKA 5C9ZA 3H2OA 3EDEA 1IZJA 3QXBA 2E67A 3EYPA 4Q22A 1ITXA 1W8GA 2XVKA 2I5QA 4MNKA 3RPMA 1OB0A 3A47A 4GQQA 3H22A 3BW3A 3QR1A 1MZRA 4GVHA 2AAAA 4NYUA 4AWEA 1A5UA 3KCJA 1DYSA 1UKPA 2VCAA 3GUWA 2NW0A 4IUGA 3VIHA 4IIEA 1UR0A 3EX4A 3CNYA 3TMLA 3CMGA 5DCEA 4ADTA 3NQAA 3QTPA 2V81A 4C1LA 3AICA 3TYZA 3JRKA 3VOFA 4S38A 6XIAA 2ISVA 1KV8A 3N6HA 3EBVA 2ZZ1A 1XYCA 4IFKA 4O18A 3AIQA 3LLXA 1E55A 2YCIX 2P10A 4GHRA 4PSPA 2OEMA 2EGZA 4IIGA 1TTIA 4FA3A 1PXGA 4Q8MA 1GK8A 4QE4A 1OCQA 2EG6A 5DY3A 4H04A 3S8HA 3QQWA 3GTXA 3N19B 3UF9A 1UC4A 4K39A 1K8ZA 1JAKA 4QRNA 4LY4A 7REQB 3NDYA 3P0XA 3WH6A 1JZ4A 1AW2A 1QXLA 3EEZA 4C6KA 4C6MA 3C2FA 3THUA 1PB0A 1XGDA 1DJGA 4A21A 5L9FA 2C18A 2JF7A 2V30A 3IV8A 3HMCA 4YVXA 3S42A 4D6CA 1XIGA 3WNNA 2HDJA 4S3JA 2V3EA 4K1GA 3PN8A 1JNDA 2A1YA 1P7TA 2ZRYA 2OYLA 3NQBA 1XH0A 5BXRA 3RX3A 3K30A 3TNOA 4GACA 3B9EA 5CPTA 4E4UA 5I3FA 5H2ZA 1JPHA 3KLKA 1YDNA 2TYSA 1JGIA 2Y63A 3IJQA 1U1HA 3AZSA 3NGJA 4IXXA 2VFIA 3GDBA 1XRSA 4MIMA 3DBNA 1Z48A 4M82A 2YSWA 3PJTA 1E1CA 1RCQA 3EWYA 3ZWSA 1KQYA 4R53A 3MT1A 3GH5A 4UTUA 3RLHA 3ELFA 1XLEA 4W7WA 2QUTA 2PDFA 4GZEA 4QQ3A 7TIMA 3ANYA 1RA5A 4JIPA 4N7QA 3ZS4A 5FI8A 2J9XA 1KGWA 1QNVA 1JUKA 2J7BA 4IMFA 4MM1A 3NZQA 2CU0A 3L2MA 3CTLA 3UR8A 3THQA 1W32A 1H1NA 3PJUA 2ZA1A 4PCPA 1BSLA 1A5SA 3DHDA 3SSJA 5BWFA 1W1ZA 2PCQA 5DXYA 3B8TA 3R6IA 2VM8A 4IT1A 3ZLHA 2QDGA 4KCVA 1W9DM 1Q6EA 1Q2SA 1ZLPA 1PHWA 4DF0A 5FJOA 5LHFA 2V3DA 3FDGA 3QGVA 1A4MA 4ZQMA 4J1OA 1ICPA 4LCSA 3WSUA 4H9VA 4DI8A 2TMDA 3F5JA 3THDA 3TCSA 1EWDA 2R14A 4U33A 2WO5A 4WXZA 5CJMA 4HNOA 4IPLA 3CV6A 3UJ2A 4F48A 4UTKA 1E9ZB 8TIMA 3W28A 1SR9A 4IGMA 4YYFA 3WDHA 3FDKA 2ZRWA 1UZDA 1ZNNA 2GWNA 3A3WA 2BBFA 2YCJA 1Z8AA 3MUAA 1GPFA 4JTRA 2BHYA 3SQLA 4IL2A 1AA1B 5E09A 1V0NA 4U5IA 3AMGA 1BKSA 4H3DA 2GQ9A 4UR7A 4J3XA 4AZBA 3S4TA 3G1XA 1LDCA 2DDXA 4AZ5A 3CQKA 2W62A 5EBUA 1HKWA 3NXLA 4MMWA 3RDKA 1OC5A 1V6TA 3SCQA 4H9ZA 2HEJA 4ERGA 1P4CA 4QDPA 1FH9A 4X60A 1RZMA 4BCEA 4GK8A 1CECA 2VX5A 4D72A 1NP0A 5C9WA 1GPWA 2C14A 3EB2A 3ZR6A 1BD0A 4FXSA 2V8ZA 4YJ5A 1TPH1 1DJIA 4RLIA 2UBPC 4I9AA 2ZQ0A 4DJED 5DRIA 2XIMA 3PWAA 3QR3A 1ZZMA 3AIUA 1JCTA 3OYZA 3UR2A 3LCHA 1KXQA 4WIWA 1VCFA 5CPMA 4ZTYA 2TRSA 2VUYA 3VGDA 3E12A 2HK1A 4CNSA 4QIUA 3W2NA 3VD7A 2EPKX 2PDPA 3KHJA 4R9XA 4AD0A 3FJNA 2P3ZA 4CN4A 3EDKA 3TIMA 4Y90A 4KFPA 1C8QA 1GG1A 1W17A 1PL9A 3MO7A 2PGFA 4FX7A 3WUBA 1FP8A 2WK2A 3A9IA 2VGGA 4XZMX 3OGVA 2V2CA 3BAXA 2V2HA 4XISA 3PB0A 3GK0A 1QT1A 3TSMA 2G3IA 3NFUA 1NP2A 4Q4KA 2NX9A 3ZVIA 4TXEA 3T1GA 4CD6A 1U5VA 1RHCA 2XG9A 4ZA0A 4DNMA 3TAOA 3DFQA 3PUGA 4R7JA 5CBJA 2WXDM 3TC7A 4LALA 1TPB1 2X30A 2ZWZA 4R9OA 2ZUUA 4O0KA 5FJTA 1EJ7L 1HT6A 5LNSA 3EMQA 1T96A 4TV6A 3W53A 1B3ZA 4N9EA 1X98A 2AGKA 4C1KA 2JFEX 5AHLA 3UPWA 4JTIA 4E4FA 3F1QA 3W1XA 1UD2A 1W9XA 1KCZA 4AZCB 3LHVA 1JXJA 2V67A 5K9DA 1S5WA 1RP8A 2PP1A 3NQ8A 1R85A 2REQB 3PP7A 4HNVA 1QI3A 1S3TC 2P0IA 1BG4A 3DIPA 3EKLA 2WSPA 4JGDA 3CAVA 4GMEA 3TLQA 1B31A 3L4UA 3THAA 3URBA 3WK3A 2PA6A 2J9YA 2J9ZA 3VIMA 2VQTA 2W5FA 2WZMA 3DFOA 2F6XA 4AHPA 4GQRA 3FW6A 3SCPA 4O1BA 4YU1A 4QCEA 2YBVA 5C2GA 4YWSA 4TO8A 4Q4MA 4FB7A 1G01A 1YW1A 3WK1A 2WMIB 3P7YA 4PBFA 4C6PA 4LS1A 3LGEA 1XDMA 4W5UA 4JCLA 3OZOA 4D6DA 4RZ6A 5E9XA 3S5ZA 3LN3A 1K7XA 3K46A 3WX7A 4ROPA 3MSDA 1LTDA 2VGIA 3N2MA 1TMHA 5I3GA 2BY2A 4XSLA 2DT3A 3IJLA 2CNCA 1CGYA 3T78A 4MJ4A 3OLEA 1OM0A 2BODX 4UIOA 2XN2A 3BV7A 3QRHA 1DQUA 4GJJA 5IBXA 2WBKA 1V6VA 3RK8A 2Q3RA 5EMUA 5FSEC 3T07A 2QS8A 3DCPA 2NXGA 4S3KA 3RM9A 3IJ6A 4PMDA 4OZOA 1I0DA 3BLOA 1E0WA 1PCKA 5I3KA 1KTBA 3B8VA 1TVNA 2PDLA 4RV3A 1F3TA 3E2SA 4R85A 1JCMP 4CEUC 3PPGA 2NX1A 3LHUA 4YIWA 2WMGA 4LUTB 1FKWA 3DERA 4LTSA 1EDQA 3MUY1 5CZTA 4MUPA 1WUEA 4IFKB 3TQKA 4AVNA 2WC3A 1E73M 2JKAA 4NRSA 3OQ8A 1UPPA 2XJ7A 3D0CA 2HSAA 3D5HA 3B4UA 1LROA 1Q3NA 1UA3A 2BG5A 1GZJA 1MXDA 3KLLA 1SMAA 2QEZA 2IS7A 2VFDA 5AYZA 1R38A 1RQEA 5I0DA 4IQLA 4ILSA 3H54A 3MMWA 1W31A 2X7WA 3IJ7A 2J62A 3FVMA 3MUIA 4DWSC 4KCTA 2ZX5A 3NOYA 2FGBA 3VDAA 2QGHA 4UQAA 2NQJA 4AEFA 1BXBA 2NT0A 1P7TB 4JFVA 5DCBA 2X16A 4PMOA 2TODA 2V69A 3UGVA 2ESCA 1QPKA 2PTYA 4OVXA 4AZ6A 5EMMA 4S3BA 4EACA 1R6WA 1B9ZA 2XWEA 3PTMA 3ATYA 2ISDA 5FF2A 1OF6A 2PAJA 3IGUA 3V4BA 1IT7A 2XVNA 3UNTA 3UYIA 3CEPA 2OX4A 1OINA 3W27A 3P14A 3MBDA 2ZC1A 1L8NA 3SDOA 1W3TA 1OX4A 1PCWA 4WXYA 2J79A 1SPQA 3WUFA 5GVJA 3U3HA 5TD4A 2MANA 5CSRA 2PBGA 3MP4A 2GOKA 3TEVA 1E1CB 2R1PA 1FXPA 3U57A 4JX5A 4LXFA 3N3TA 3BSGA 1QOPA 2WPBA 2ISSA 3BG3A 4GZ7A 2PDXA 5A1AA 1UASA 1H61A 4V2XA 1KW1A 3GKAA 5HINA 2PS2A 1IQ8A 2QXWA 3MZNA 4PULA 1E72M 2Z6IA 2VX4A 3SFWA 1AVAA 5DBTA 5CJ5A 3W1RA 4HPXA 4JCMA 2BXZA 2POZA 1QPQA 1R3YA 1GTHA 3SY8A 2VYOA 3GD6A 2D24A 1MYRA 1SFJA 3OLDA 3WQ4A 1F7BA 1XLLA 4F0RA 3R89A 1UZ1A 4GH3A 4ZQCA 1P48A 3LERA 1A5MC 1YHTA 2E1WA 3AZTA 3EEGA 1ELSA 2GK1A 5H8MA 1UOZA 3HFTA 4JIQA 2PZNA 3I6TA 3GVWA 1ZU8A 1XRFA 3CL6A 3SJ3A 1N55A 2JK2A 2OFJA 4MZ1A 4Z1CA 3RM4A 3SCTA 1IWBA 1AL8A 4AWSA 4O8RA 4LOCA 4B2DD 5A8NA 1ITUA 3RRAA 3N4EA 4HGXA 2G95A 1MQRA 2DUAA 4G1KA 1RCOB 4U3CA 2JKEA 1KRBC 4WRHA 3GFYA 4MB5A 2ZTJA 3T40A 1VB9A 3U0HA 4JKKA 3TC6A 1ONWA 3UCCA 3B05A 3G0UA 4TOQA 1AZ1A 3WNLA 2ZTKA 3EB4A 2I5IA 5K3VA 4CQ9A 3WKZA 3TN3A 3TVAA 3VZXA 2FPVA 1ZGDA 4GI4A 1RBAA 2FZNA 3DDMA 5HWNA 4UCFA 1TQXA 1N8WA 2PSNA 3B0PA 3AROA 3HPAA 3UT0A 4ICNA 4C6NA 3FSTA 3APYA 4M5PA 3ZJKA 4DYEA 5A2CA 1IR1A 1VBUA 4N4PA 2P5NA 3N25A 3N29A 2Z26A 3CT7A 5LNUA 2L5HA 2J6VA 3N4AA 1XL9A 3UZXA 2GOUA 4NUWA 1EC8A 3GDLA 3IGHX 4ZQNA 3HG3A 2XM1A 3MYPA 3MVIA 3CZEA 4Q7BA 2VZVA 3W82A 4E3VA 1X7FA 4QS6A 2OLAA 5A6BA 5TIMA 1HFBA 1V8EA 1MUMA 2C7FA 5D2TA 3S0CA 4HOXA 3QSRA 3BC9A 3GW0A 3AIVA 3WBWA 1EXBA 2XFYA 4LNCA 5FAGA 3MI2A 1BVWA 4A4AA 1EDTA 3CB3A 3B8DA 4BK9A 5C7VA 1GQJA 3E74A 1C3FA 1KR1A 1WXYA 3WNOA 4EVZA 1IE7C 3DI0A 1UJPA 5C2CA 4ZFMA 2PBOA 4JY9A 3GLCA 4ES4A 4UQ9A 4S39A 1E6ZA 3MSGA 1PV8A 3MSRA 2Z0IA 1YQ2A 3BARA 2HXUA 3LA4A 3VX1A 4ACZA 4FHAA 3QV9A 1B2YA 2NV1A 2QCEA 3W81A 3KZPA 3MY9A 2PD5A 3GSMA 2NWSA 5B7ZA 2DZPA 3M5XA 4JN6A 1H7OA 4PMZA 3UWYA 1LBMA 3KBMA 5LA2A 3TN6A 3IARA 2EBNA 2WHLA 4FSAA 1SR0A 4S3AA 4ZTXA 3DFSA 3T81A 4LS0A 4OFCA 3SRDA 3TW9A 5DBUA 2PDNA 4AMAA 3E3HA 1BF2A 4QDWA 3W25A 2C91A 2GYIA 2J24A 1U1JA 1B1YA 2Y8KA 4IISA 1EPVA 4L1XA 2J7CA 1FDJA 1Q45A 4XBJA 1H49A 3AS3A 4KIEA 1GWJA 3CUIA 3ARUA 4QEEA 2A3CA 4LV4A 4F40A 4H8NA 5A6LA 1J01A 3N15A 4E5TA 3OA5A 4LY8A 3PHAA 4B3ZA 3T0BA 3VKKA 3PB2A 3I7SA 3QLLA 1EWEA 2CBVA 3W01A 3ARXA 2ISFA 3JR2A 5CPSA 3R0KA 5FACA 4LAUA 1RY0A 5BOFA 3W1UA 5K9CA 3DHFA 1GYLA 4FS9A 5KSWA 5I3JA 4WLCA 1DE5A 1ECEA 2VGFA 1OFAA 1H4PA 1POKA 4D9PA 5FEZA 3CUXA 5HOSA 5KTLA 1I4NA 1VP5A 1E5JA 4IGSA 3PTKA 3B8WA 3BTNA 4NZ1A 1WQ5A 2PP3A 2Q71A 3GVVA 2XGBA 1W8SA 3VM5A 1O12A 3UCDA 1FVPA 5I23A 4X0NA 4AG0A 5EA9A 3L4ZA 2DQWA 4GYPC 2OO6A 3W2LA 4GI8A 4B15A 1LWHA 1XKJA 3QPEA 3P2VA 4JOMA 1W9BM 1BFNA 4U5KA 4DJDC 2DUZA 1ME8A 4FR6A 3NOEA 4Q4PA 4HU4A 1FY6A 5A8PA 3GDKA 2GL5A 3EDDA 2XISA 4IX2A 2NLIA 1HTIA 1RR2A 1YNQA 3FGCA 2X09A 2WHJA 2LLEA 2VENA 3SY5A 1VQTA 3MA8A 3OYXA 4L80A 3LHWA 1K4GA 1HZYA 3TW6A 4LUJA 3PY2A 2CZFA 3IJ8A 1FWWA 1X97A 3W1NA 1W3NA 3CC1A 3VNMA 4FOJA 2I16A 2GSEA 3A5VA 1M7PA 3LG3A 3IUDA 2YCLA 1XF0A 2A6LA 1CWYA 3ARSA 3PWGA 1TTPA 1IXPA 3N12A 3NTYA 2GJXA 4C5YA 3OZPA 3WQVA 4Q8TA 4C6JA 4GC4A 1GTEA 3IRDA 3IUHA 1VFHA 2INEA 4G8TA 4GG9A 3MP3A 1DTNA 4GRSA 4WJ8A 2JF6A 1Q13A 1GVQA 1US2A 4LRSA 4YTSA 3SRKA 3BG5A 1LWIA 3IIXA 3Q65A 3UWEA 2DEPA 3L0GA 4EXAA 4CU6A 4DWSD 4AEEA 4PB3A 1FFQA 2JALA 1E6RA 3QY6A 2OB3A 4YPJA 4RX0A 3P61A 5AECA 3CZGA 3N6QA 3UA3A 2WAGA 1EA0A 1LOQA 3VVGA 4UTLA 1XG3A 3U9IA 3WFAA 4IP5A 3BGJA 1W54A 4Y9AA 2PDYA 5A2AA 2YA1A 1ECQA 2ZXDA 3ITVA 1UD4A 1FWRA 4K2SA 3DG6A 5BOOA 1EFZA 2IKIA 1E4MM 2DV0A 4FXJA 1UD3A 4QLJA 2RGMA 2PI6A 2CHRA 5HK4A 3RXZA 2OSYA 1QATA 4UOZA 5EMYA 1XCXA 3UJEA 3VNKA 1NFGA 4NRRA 1A0EA 3GZAA 1HJWA 1L2UA 1RVGA 4M6QA 5D8WA 3QN3A 1KC7A 1DP0A 3WJZA 3IK2A 3NVDA 2PMQA 1C8VA 2CLOA 4JHOA 3W7NA 1ESWA 3TZNA 3M0YA 4KW2A 1XFCA 1K02A 3WDRA 4PCFA 5JVLA 4DBSA 3VD4A 3DG3A 4FALA 1JR1A 1O5KA 3RO8A 3BWWA 4HYWA 1KNWA 1U30A 2W27A 4AVFA 2Y5JA 1QDSA 2QJNA 4P8UA 4HHHA 4JHZA 4BA0A 3HG5A 1JD9A 2W3ZA 1G4PA 5K4XA 3UQNA 2RDXA 3FKKA 4OTKA 3UXDA 1ZAIA 1UD8A 1AQFA 2YCEA 1W9PA 3M7SA 4LYRA 2XN1A 2QQ6A 1H50A 3P67A 1F05A 3BLIA 4HN4A 2GGIA 1UZ4A 1I75A 3B0YA 1UMYA 1W1B1 5BMXA 2CPUA 3MTWA 2RJHA 2ISWA 4W86A 5CZKA 4RDWA 4FNSA 3URAA 3CO4A 1K9FA 2O0TA 1QNPA 3D3FA 3KWSA 4DLFA 1ITQA 1BYCA 4GY7A 4ZXLA 1O66A 1E5NA 4RZBA 5A8OA 5E93A 5G4HC 1O94A 1V0MA 2Z1BA 4HNCA 2Y6ZA 3R58A 3WLJA 2J77A 4GUIA 3TYAA 1CB7B 3II1A 5HATA 1UH3A 3DKLA 3INPA 3PC0A 2I5GA 1VYPX 3BOXA 4GFIA 1GVYA 3WEZA 1VPYA 1WXJA 1XFBA 3WDPP 3GO2A 4CNOA 2WQPA 1E40A 3W1LA 4I5XA 5BMWA 1A5KC 3WLQA 4UQBA 1F74A 1JUEA 2GUBA 3PUOA 3F7JA 1FH8A 4LYKA 4NJIA 2BVYA 3LOTA 1B3WA 4YCOA 2OEKA 3HJEA 2AKMA 3M0HA 3WBAA 1TZZA 2CZ5A 4PUKA 1QNRA 3FJ6A 4K36A 1U33A 3G77A 2DH3A 5HQEA 2FFCA 4HHLA 5CEWA 4J35A 1UKQA 1AQ0A 2VX7A 2QIWA 2XIQA 3DUGA 3VUPA 3CH0A 1ODZA 3U48A 2YA0A 1UBPC 2QKFA 1I1XA 2VR5A 3O0KA 4MLRA 4DYJA 4XIAA 1QBAA 4YXGA 1P0KA 1LG2A 4KETA 1G94A 1KQZA 2XZ7A 2YLAA 3WY1A 2IQDA 1SJDA 5JIWA 3TLLA 4UWMA 4IUOA 2VCCA 1DWAM 2OQYA 3KRBA 2YW3A 4EXBA 4HCLA 5EYWA 1JDAA 3KOZA 3BAWA 3B0VC 3PFRA 5EPDA 1FCUA 3NQMA 3O8AA 2VZUA 2RFGA 1PWMA 2DT2A 4DRSA 2RUSA 2GZXA 1I60A 2VFGA 4W85A 3GTIA 1EYEA 1GHSA 1Y8BA 1J9YA 2V3GA 1UIPA 4XAFA 5FF3A 5I7GA 3NURA 2CLEA 2PDHA 3G24A 1CZ1A 4QM1A 1H7WA 1F6YA 1DKWA 7TAAA 4AX6A 4PFMA 3K2GA 3K5XA 3KOYA 1HKJA 1GKQA 4ORIA 1R3TA 4FO4A 4ACZB 4L4LA 4AZ7A 4HD5A 3KCOA 1SW0A 1OC7A 4PA8A 1CLKA 1UKTA 3EB3A 5H6HA 2WWDA 4JEQA 3W83A 3QM3A 2QPSA 4IP4A 3BURA 1RVKA 2FTPA 3EWZA 2EJAA 3KVMA 1R87A 3A3HA 3UPBA 4WY0B 1XIMA 3KBSA 4TR9A 4CNTA 2ZE0A 9CGTA 1JNEA 4MYAA 1EGZA 1BXNA 3HPSA 1WUFA 3LMZA 4I7WA 3UY8A 2C71A 2HXTA 3V36A 2EPOA 3AUOA 2DSKA 4F8XA 3WLIA 4FAMA 1MXGA 4P61A 1I1WA 3PULA 4NZJA 1D9EA 2Z00A 5FAJA 4NHVA 1PX3A 3OVRA 1YDOA 2AL1A 3UJFA 5HWMA 4DPPA 1VFOA 4BQ4A 2XFFA 5I3DA 4U2YA 5D9OA 2VT0A 3R8GA 2UZ9A 5LIKX 4PUJA 1YPXA 4J3TA 3H2MA 3Q2DA 1P6WA 4GIEA 3R1ZA 4PRWA 4IPIA 5FA5A 3P6LA 3AMDA 1ZPTA 5HQMA 2V5DA 3AU6A 2B7OA 5BXPA 1EZ2A 3EOUA 2FZMA 4LUSA 4ZODA 3VMNA 2CXEA 4PMJA 3HBLA 3EAUA 1X38A 1DIKA 1OEPA 1M5WA 3LXAA 1U2YA 2QPUA 5XIMA 4WQ6A 2E9MA 2IKHA 5HDRA 3Q37A 3TU9A 4JFSA 5FIPA 4XO7A 3NPVA 4C6IA 3O6AA 5AVNA 1RQHA 2O4MA 2Z2AA 4LF2A 1SO3A 1P1XA 1HXJA 2AQVA 2A3LA 4WJXA 4LW7A 3C2RA 3FGCB 2WCSA 3UERA 2VEKA 4A35A 3SN0A 4YVPA 1GQNA 3V16A 1KM6A 2HPMA 1MEHA 1UQZA 4EPEC 2VUNA 2X42A 3FKRA 4M24A 2E8ZA 2FVMA 3MHFA 4UTHA 4E4PA 4UTTA 4FX6M 4Y7EA 1UWUA 4EANA 1R2RA 3PF3A 4DN1A 5D2VA 1MSSA 2BY1A 4E38A 4AZHA 4A22A 2YCLB 3DGRA 4O8AA 7PTDA 1QK0A 1X1OA 4K6AA 2GJXB 2QCGA 3HN3A 1MFVA 2NQHA 1KKRA 1HNYA 1TV8A 1ADSA 5D32A 1OYCA 3ITCA 1YIXA 4FLOA 4LS2A 2V3FA 1ZY9A 3U8GA 1VIWA 3GHTA 3DFNA 5RUBA 2TAAA 3VFLA 1FP9A 1MDRA 1IWAA 1H7PA 3F5KA 4GUGA 3W73A 2MNRA 1YPFA 1LZOA 3O15A 2A3HA 4YLWA 4LNYA 4HPGA 2XIOA 3CT2A 5ECVA 4HT3A 1T7LA 2POTA 1KB3A 3RIKA 3IIOA 2CBIA 4HMNA 1ZJAA 1XLGA 3IAQA 4K8GA 2ZDSA 3WCZA 4MHBA 2WMFA 5J04A 1NFPA 3QJAA 4K1WA 4CU7A 3OO2A 3CUJA 3NNTA 3CQHA 6PTDA 1GVIA 4IPJA 2B7NA 4GJIA 2YZRA 1VFTA 2ZIDA 1PZ3A 1UJQA 3M4HA 3OU8A 3SFKA 4A8RA 1QW7A 2ODOA 1FDYA 5LA0A 4EAYA 5M1TA 4EE9A 3W9ZA 4O13A 5AHEA 4ML9A 5D02A 3M47A 2Z29A 3OBAA 3BSHA 3KEHA 2EAWA 3HG4A 4ML4A 5HUPA 5I02A 5LNVA 2GQ8A 3VNJA 2ZZ4A 3RCNA 3RJXA 1IT0A 2BFGA 4PBEA 4AISA 1ZP3A 1VR6A 3QSTA 4Q8QA 3HO8A 2WANA 4MY9A 1Q85A 3PZIA 4N9CA 4JX4A 1IWPA 2CZDA 1RQBA 3IIVA 4GE8A 3APGA 2VOMA 3WQ8A 1HO4A 1E6SM 2G3FA 3KAOA 4NNBA 1HKVA 4I5RA 3F2CA 1K7FA 4Q6XA 4QJ5B 3N34A 1DWHM 3UG8A 1JZ3A 3FJLA 2W92A 4D71A 3C5QA 1ZFJA 4F4RA 5ABGA 3CUHA 3LCIA 1W5NA 1CXIA 4IGHA 1R7OA 3HM7A 1TMLA 2GVLA 2NWRA 3S6TA 4LH8A 1KGXA 1ZCCA 4AHQA 3ID7A 3L12A 1FH7A 5FESA 3TUUA 1V5XA 5HNTA 3B0XA 4L65A 2GGGA 3JZEA 2NSXA 4F0LA 3AHVA 1RJPA 3VNIA 3M0VA 4FMVA 2V9DA 2O7SA 1KCXA 1VPXA 1FKXA 4RDYA 2WQDA 2FLIA 4DEFA 1FOBA 2WNQA 1KXTA 3PBGA 3WH9A 1R3RA 4J3UA 3MQTA 1NF7A 1Q6GA 2Z24A 3UR7A 3ZLGA 3EGJA 4AY8A 1OABA 1KFLA 4EK7A 2OZ0A 3FA5A 4HJFA 3JW7A 5M5DA 3TJLA 3IGXA 4ZMGA 2BS9A 3DFTA 3EPNA 4HPHA 3ZOAA 4DO7A 3NYDA 4BI5A 4DZ5A 1FWSA 3ZJ7A 3WMCA 3NWRA 4OIFA 1Q8AA 3G1DA 3EMZA 1CX9A 3NL3A 3RPDA 5BW6A 1WDPA 5LGXA 3S2CA 3ECQA 4MDPA 2Y0FA 4KFOA 2Y2WA 3NXFA 1A4LA 1XC6A 2TSYA 2QJGA 4CLMA 5A8QA 2YDRA 1NWUA 3EWUA 1TPEA 2ASHA 3GS6A 4HTYA 5CC3A 3PVFA 3WNPA 4EWJA 4GVIA 1E0TA 1ZJIA 2YXXA 3L5AA 1O1ZA 1WV2A 2RAGA 4GXMA 2Y89A 3H70A 2E9LA 1J0YA 4F2UA 1TMQA 1JCLA 4H01A 3WLHA 1CGVA 1ZRQA 3LBCA 4RE0A 5D2WA 1NOWA 3UD6A 3CUFA 4PTXA 4TIMA 1NTHA 3DC0A 2DY3A 4P8VA 2IPFA 3FN9A 3BL3A 4AIOA 4XZWA 4GKTA 1B3YA 4CEXC 3N11A 2NZLA 1HVQA 3TR2A 2VKZG 1UC5A 2DJLA 2DZTA 3EZ4A 4W5ZA 3L68A 1SMDA 4LBRA 2CBJA 4GCXA 5EMLA 3RF9A 4N42A 2ZCGA 3M0IA 2YPIA 1QW9A 1IXQA 3TMQA 3KBJA 3G5EA 2Z1XA 4EKJA 3OVGA 2YDQA 3IAPA 3CQJA 2PPGA 1OQFA 3GB6A 3RHGA 1KFJA 3WLOA 2B81A 4CKQA 3SCRA 1Z44A 1H3GA 2J66A 2OTDA 2FVKA 2FJKA 3UFYA 4S1FA 3KWXA 2VEPA 1TUFA 4IPNB 1G0CA 4HCDA 5A8MA 2VCBA 1CLVA 2ZA2A 4PSRA 3BMWA 3TONA 3GXPA 3GFZA 4U2ZA 1K8XA 4O28A