3EB4A

Voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
327
Chain Sequence
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Cortisone dissociates the Shaker family K+ channels from their beta subunits.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, oxidoreductase
total genus 123
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3eb4A00
4WDWA 4FZIA 3B3DA 3LEPA 4JIHA 4IGSA 3LENA 1XJBA 1MRQA 4XZLX 1YE4A 4JTCA 2IPWA 4QXIA 2IKIA 3CAQA 3N6QA 2ISFA 1ADSA 3RX2A 3U2CA 1RY0A 3Q65A 2IKHA 1R38A 3LZ5A 2DUZA 3BCJA 3G1RA 3H7RA 2PD5A 2IPFA 2P5NA 2AGTA 1IHIA 5HNUA 3O0KA 2INZA 1LQAA 4L1XA 4HMNA 1VP5A 4AUBA 4WDXA 4NKCA 5AZ0A 4FAMA 1GVEA 1EF3A 3RX3A 2CLPA 5JH1A 4JTRA 3FJNA 3T42A 3MC5A 1EXBA 4PMJA 3P2VA 3R58A 2ACRA 4GA8A 2PDWA 3V0TA 4QR6A 1EKOA 4JTAA 5DANA 4YS1A 2FZ9A 1C9WA 4ZFCA 1J96A 4OTKA 3WBWA 3NTYA 2PDPA 4XK2A 2INEA 3BUVA 1K8CA 2I16A 3BURA 4XVEA 2PDNA 3RX4A 3LZ3A 4JIRA 1HQTA 1S1PA 4DBUA 4XZMX 4XZHA 3GHSA 2IPJA 3CASA 2F38A 4GIEA 3V35A 3UZXA 4F40A 5LIKX 4FALA 1X97A 3N2TA 2ALRA 4QX4A 3EAUA 3LQGA 5HNTA 1S2CA 3WCZA 4DBSA 2F2KA 2ACUA 5M2FX 1HW6A 5LIYX 3S3GA 3ONBA 5AZ1A 1XF0A 2BGSA 3V0UA 3DN5A 4YVPA 1VBJA 2BGQA 2BP1A 4ASTA 2IS7A 1IEIA 2HVNA 4IJRA 4JTQA 1JEZA 3GHUA 1FRBA 3UGRA 4YU1A 3FX4A 1QWKA 2IKGA 2WZMA 4LAUA 3LBOA 1ZQ5A 3UZYA 3F7JA 4XAPA 2PDFA 2FZBA 4LAZA 1Z9AA 3WG6A 1Z89A 3Q67A 1AH4A 1Q5MA 2PDLA 2PDIA 3LQLA 2PF8A 2NVDA 4FA3A 2HE8A 1MI3A 2I17A 3GHTA 2HE5A 4JQ3A 4XZNX 4GQGA 1PZ0A 3M4HA 2NVCA 4HBKA 4XO7A 3CV6A 1X96A 3R94A 1SM9A 4JQ2A 3H7UA 1ZUAX 4GQ0A 1PYFA 2IQDA 2HDJA 3M0IA 3LD5A 3VXGA 2DV0A 4WEVX 4IJCA 1YNPA 3R6IA 2QXWA 2HEJA 2C91A 2PDQA 1XGDA 2PDUA 3UG8A 4MHBA 3GUGA 1PZ1A 3V0SA 2PZNA 4LB3A 3CV7A 4DBWA 2PDJA 5LIWX 3H4GA 3LN3A 4WDUA 3WBYA 4DZ5A 4XZIA 4QBXA 3EB3A 1A80A 2IQ0A 4PUUA 2FZ8A 1LWIA 3R7MA 4PRTA 3UFYA 1AZ1A 3V36A 4JQ1A 2PDMA 1YE6A 3UP8A 4Q7BA 1AZ2A 4JQAA 4JQ4A 3UZZA 3M64A 4EXBA 1PWLA 1UR3M 4I5XA 1EL3A 4LBRA 1X98A 3UWEA 3KRBA 4ICCX 1ZGDA 3CMFA 3LUTA 4PRRA 1T41A 1US0A 1YNQA 3EB4A 3COTA 3ERPA 5HA7A 4WDTA 3DOPA 1QRQA 4XVDA 3UYIA 1MZRA 5JH2A 4L1WA 3C3UA 2FGBA 1S2AA 2PDHA 3UZWA 2R24A 2R9RA 4LBSA 3QKZA 2PDCA 4H8NA 2HV5A 2PDGA 2PDXA 1AFSA 4H7CA 2VDGA 1AH0A 2DUXA 4GABA 2PEVA 3R8HA 2ACSA 4JIIX 4WRHA 1OG6A 2PDBA 4XO6A 4EXAA 3BV7A 3CAVA 3O3RA 2HVOA 4G5DA 3GHRA 2FZDA 2IPGA 4WGHA 3WBXA 5LIXX 3ONCA 4LB4A 1RALA 1RY8A 1S1RA 1Z8AA 4YVVA 1Q13A 3G5EA 2J8TA 3R43A 1Z3NA 4GACA 4R9OA 2WZTA 4Q3MA 3R8GA 4GCAA 2PDKA 1T40A 4YVXA 1ZSXA 4PUWA 4PR4A 5C7HA 2PDYA 4RPQA 1M9HA 2A79A 3LNMA 2ACQA 2PD9A 2PFHA 1AH3A 5LIUX 3MB9A 1PWMA 5KETA 4JTDA 3D3FA 2IKJA 2FVLA
chains in the Genus database with same CATH superfamily
2XHYA 1GW9A 2XN2A 4JTUA 3XINA 2GQ3A 2FDMA 2G3FA 4J3TA 2VFFA 3B8WA 3U8GA 4IGSA 3A9IA 1N7KA 4YNGA 1F74A 2GLKA 4FHAA 2YFNA 4LVAA 3B0UX 3BAKA 1BYDA 1CIUA 3Q45A 4R33A 2IKHA 4LVGA 1VBGA 3LTYA 3GVRA 3ZJ6A 3SCUA 4CU7A 3WD1A 2PC4A 2NLYA 3W71A 2ZOXA 3II1A 3HU7A 1R85A 3ITCA 4O0KA 5CAHA 1FX6A 1W0MA 1GVIA 4L1XA 4QJ1A 4HMNA 1VP5A 1YPFA 2XUCA 1OYCA 3SY1A 4W4QA 5CJ5A 1TREA 3DI1A 1TQJA 4AH7A 5DCBA 1F6YA 5M3WA 4D6DA 2D2JA 4RCXA 4YL2A 4C6BA 2D69A 3JZUA 2P10A 3HQ1A 2HZGA 3OBKA 4OOZA 6XIMA 3CNYA 4O0ZA 1E9ZB 1QNSA 5HQLA 4J3UA 5F2LA 3W83A 2VQUA 1R86A 4JOMA 1E43A 3TFXA 3W1QA 3W00A 1JYNA 3T40A 5D9NA 4JKLA 3UZ5A 5IDZA 3S5YA 2D0GA 1LBFA 1OC7A 5KZMA 1KWKA 3TSDA 3PANA 5FF2A 3I3EA 1VHNA 2FB2A 3NCOA 3O8AA 4FR1A 2W6RA 3HJZA 3M5YA 3WQVA 4O4WA 4F8XA 3E5BA 4I9MA 3WEZA 2JGYA 1RSCA 1S3TC 5FF3A 5E6ZA 3STFA 3AISA 3MZ2A 4K37A 4KMQA 1JGIA 2QUUA 2X41A 4WHBA 4ZOEA 1DTNA 3BLPX 1I4NA 3QV6A 1QK2A 1G0CA 1JUBA 3W4RA 2ISWA 3W7PA 3TQKA 4XKMA 3ZLGA 3A5VA 3MSRA 4GY1A 2QCEA 4HN8A 4X0VA 2XFRA 1SO6A 2RJHA 2VFEA 3EWXA 3OGSA 5BCAA 5I24A 1LOQA 1JRCA 2IS7A 5DY2A 4FK9A 1E5JA 4OECA 3SCWA 3SSZA 1CT5A 1YX1A 2QIWA 1RJRA 3E96A 1NU5A 2PU0A 1R3TA 3BW2A 4HSOA 3UZYA 3OLEA 3DFNA 5LNVA 1O5KA 4MYXA 2ZA3A 1AH4A 1VFLA 3Q67A 4HK6A 1KBIA 1F2JA 3GB6A 1QHZA 4EPKA 3WNNA 4F9DA 4WOQA 1NF0A 1JFHA 2BVDA 2HE5A 1HJUA 4WY0F 3GTIA 4R5EA 5D38A 2NX1A 2GDVA 3PUOA 1CCWB 2KX9A 1L2QA 3NXFA 1JF5A 3SB0A 2DVXA 3VX0A 4IJCA 1H2JA 2Z2UA 2BASA 3ARYA 5CBBA 1SZNA 2V68A 1XYFA 3S1XA 2XSAA 1LLZA 2I1OA 3RJXA 4M6QA 3AS3A 1PZ1A 1LQ2A 2E5DA 3CV7A 4H3DA 3F4NA 1B3WA 1TV2A 4H6EA 8TIMA 1MQRA 3S5SA 3SN1A 4AHOA 2D20A 4RDZA 2C8NA 3GNPA 4S2BA 5A5WA 1QUMA 1E1CB 4AF0B 2VR5A 3LI1A 4GZ7A 4XAFA 5DN1A 3LLFA 5E5CA 1XBZA 4MFDA 2YZ5A 2PLJA 3E2RA 4AEOA 2C6QA 4AIEA 3M64A 4AVNA 4DX3A 3BE7A 2VURA 1BGGA 3T55A 1L0PA 4HN4A 1B30A 2HISA 4PTXA 4EK7A 3CAKA 1ICQA 2J47A 1RAKA 4HKPA 8CGTA 5TBOA 4IG2B 3W70A 3W73A 1FUYA 4S3DA 2Y7EA 3K30A 1XP3A 3LSBA 1UWAA 4KERA 2BFGA 3MHFA 1A4MA 4HA1A 3WD2A 3L2IA 3SO7A 2PDHA 4WKAA 1LZOA 4ROQA 2QGYA 1TVLA 2HV5A 5I23A 3TYZA 4FNQA 2PS2A 4H7CA 2I7GA 3ORWA 3P62A 3SGUA 3CL8A 2GVEA 4JFUA 3DZ1A 1RCQA 4ERIA 2RUSA 4GKTA 2QJGA 2GJXB 1CGVA 2WJDA 4REQA 4A6GA 4RE2A 1XRTA 3KW3A 3ZXWA 1SJAA 1QO5A 2WXDM 4NHVA 4PEKA 1R3VA 3TK7A 2OXNA 2P0OA 4QM1A 3T2QA 5JQ9A 1EUAA 4Z1YA 2YCEA 1OIFA 4ZTYA 4WJXA 4IX0A 3TC7A 1B3ZA 1XPYA 3CPUA 3ZM8A 1V6UA 1SFTA 2ISDA 3WUFA 2Y8KA 8XIMA 1R8LA 4XD5A 4E38A 4DJFD 4S2CA 5XIMA 3VCCA 1CZ1A 4UQDA 2VFDA 1RPKA 3WMBA 3DIPA 4IP5A 2WB5A 4EKJA 3MQTA 1HJVA 3S1UA 4W9TA 2OCZA 5F1VA 1VEMA 1J4EA 2GOKA 4U5KA 3FK4A 4XBJA 5AKQA 4JHOA 1XC4A 1MFVA 3W7HA 3MB9A 3WQFA 1H50A 3RILA 3LRKA 5I09A 3CV2A 1FCUA 4HNNA 1YEYA 1Q2SA 1W3TA 1SPQA 3AU6A 1ML1A 5FEXA 4GVFA 4DUOA 3Q4DA 3THUA 3LEPA 1W9DM 1RBOB 2XIMA 2ZRVA 2CLEA 3T81A 3KS5A 4E8GA 1AQ0A 1FH7A 4PBGA 3U0HA 3ARVA 4AD5A 3W7KA 3LZ5A 3OG3A 3ZIZA 1GOIA 3SCVA 3UYCA 1PKNA 1E9YB 5D32A 1W1ZA 2GPTA 4PA8A 2NVAA 2PBGA 2Z7GA 4QEHA 1M01A 3BJTA 1QI3A 3L0NA 3LTPA 4JD4A 3PZTA 1BWLA 1JFXA 1V3JA 4RZBA 5JU6A 1ZP4A 1HG3A 1LL4A 3FHQA 4AMAA 5BXSA 1KM6A 4UR8A 4XV0A 2ZE3A 3GH7A 4IQDA 1OZQA 1R3SA 2YDQA 3WQOA 3QHMA 4GZEA 4FAMA 3BSMA 3TN4A 1ZHAA 4S3GA 1HKMA 3IRSA 4B92A 2E5CA 2XN1A 1GQNA 4C6DA 3BL3A 3EPOA 2UY3A 2OT1A 2H8XA 1W3IA 3AC0A 1AW2A 5KTLA 1VRDA 1O6IA 2ZZ2A 2PDWA 3IJIA 2VGBA 1XSJA 3A4AA 3M41A 4O16A 2QDHA 2UY4A 2RDTA 1VLWA 3SECA 1PO9A 1W5PA 3HV8A 5GQBA 2V81A 3USZA 2RAGA 3T8QA 2OYMA 2YW4A 3TA6A 4D6IA 1U1UA 2ZWYA 2V5CA 2WW5A 1JXJA 2FPYA 5KZ6A 1W8GA 4V28A 5DELA 2ZXQA 3GHSA 2IPJA 4M8UA 3S9YA 5F2MA 4IFKB 3W1TA 5LIKX 1MNSA 4AD2A 3VM7A 3TC3A 4NY2A 2ALRA 2HK1A 5GJPA 3EAUA 4C6CA 2GVLA 4WCJA 4MB3A 4OJYA 3BZGA 4H7VA 3KDNA 3IV8A 2VGGA 1TA3B 3IVUA 1OINA 4NZ5A 1AODA 1HL8A 1E6NA 1RBLA 3C8NA 2CBUA 5I77A 4AEFA 1EDGA 3NPWA 2VC6A 4UTUA 2Y2WA 3TWBA 4BF5A 3NO3A 1OFQA 1V7AA 4CD5A 3MV01 2B7PA 1GGOA 6REQB 1Q63A 1RVGA 1QASA 3DENA 2OYKA 3WIJA 1QWKA 5FOOA 1D7FA 1E6XM 2JIWA 3GFXA 5A8GA 1MVYA 3U4FA 4AC7C 4FLRA 4HU4A 2X09A 1DWIM 4LAZA 4IPPA 1I2OA 4JTKA 3GE7A 3E5PA 2FGLA 4OBSA 1YMYA 2G3NA 3SRDA 2WZEA 2PAJA 3VVGA 1S3HA 3A64A 1UKSA 1XBXA 3M0KA 5D05A 5ABHA 1XYBA 2A3AA 3PNUA 1Q8JA 2BG5A 2HQAA 4KBXA 4GQ0A 1PYFA 3VAVA 2IQDA 3LD5A 3FOKA 2AKZA 1EJSC 1TV5A 4JBRA 4Z1AA 4Y9MA 4TIMA 2HXTA 3QR0A 4E5TA 2ZA1A 2R1PA 2YB1A 4Z1BA 4GI8A 2X7WA 2G50A 3MYOA 1TMHA 2WHJA 4RPPA 2CZVA 2WMKA 3W82A 4DLMA 2FZ8A 1NDZA 1J0KA 1WUFA 3PWAA 4YTTA 1XKJA 2EG6A 3MI2A 4P8WA 3OODA 4ACYA 3NVDA 3PUGA 1XM3A 1LRTA 1HKKA 2QJNA 3P8IA 1FBAA 3AIVA 4B3KA 3LCIA 4DRSA 4UTKA 1A53A 3KRBA 5DCEA 3VGDA 4M81A 5C0QA 1EX1A 2XWEA 4DUXA 1WDQA 4IPNB 3WJWA 1HVQA 5F4XA 2VL4A 3BOXA 2QJIA 4WDTA 1RD6A 4PMXA 3UG5A 7CGTA 3DX5A 3EX1A 3LPGA 2Y62A 4DJDD 3VDAA 3U5YA 4BEQA 1KGUA 2PDXA 2EGZA 5TIMA 4LNYA 1FTXA 5DT7A 1AH0A 4QITA 4ML4A 2LLEA 1M41A 1HTIA 3B9DA 4N0RA 1JNDA 5EMUA 4L6OA 3R0UA 3AAMA 4PUDA 1JZ8A 1VJIA 4P7LA 3GNRA 4NF7A 3TJLA 3CZKA 1ICPA 3URQA 1Z6KA 4UFIA 4G5DA 3QLLA 4WGHA 2J75A 3AO0A 3S2CA 2WSQA 2DUAA 2PGWA 1QATA 1R2RA 3DXIA 3WJXA 1TPVA 1Z32X 1TJRA 1GW1A 3KFTA 2FHBA 3ANUA 2RDUA 4PFHA 1SW7A 1Z3NA 3BOLA 1KR1A 1Z42A 5EBUA 4EE9A 3WJYA 2EKCA 3CMJA 3W1RA 2OEMA 5EU9A 2Q71A 1ONEA 2PSNA 4I8DA 1A3WA 3VM5A 1UD4A 1I60A 4C1KA 3BG3A 2WKLA 4N9DA 4DF0A 2QKFA 5LIUX 3EGJA 2VDIA 4FXJA 1DWAM 3AIRA 4DWSC 4L9YA 2XZ9A 3GDBA 4MWAB 3ARWA 1IZJA 3P5ZA 4MUZA 4FOKA 3MANA 2WWDA 4GHRA 3UXLA 4JL1A 1PIFA 4E8DA 5HR7A 3PJUA 2VKZG 2GUUA 3G1SA 5I3IA 1YE4A 3RRAA 1UIPA 3WL0A 1OG0A 4EX4A 5H8PA 3TONA 1IV8A 1QK0A 2Y4SA 4U3CA 4HD5A 1XG3A 1GJWA 1THFD 1FDJA 1X39A 2NQJA 4L56A 2OX1A 1RV8A 1XX1A 2Z2BA 1IHIA 1SUXA 2OG9A 1JZ2A 3IJ7A 2VENA 4QCEA 3CPGA 3A3WA 3UWYA 4GI9A 2NQLA 5FAJA 3QSRA 5FJUA 3AZTA 3VINA 3S9IA 1O1ZA 1Z41A 4Y9NA 1YXYA 3RHGA 3W76A 1VPXA 4GUIA 3RAOA 5HPCA 3ZLHA 1Q4NX 4MJMA 4DPPA 3VC5A 3OJGA 4TTGA 3L4XA 1XC6A 2YL5A 3I4EA 1HFBA 3P2VA 2VEPA 5LSMA 3IVSA 2ACRA 2YOCA 3ISIX 2YJQA 1RHCA 2WSYA 4A3UA 2J9ZA 3AHXA 1MXSA 1ZY9A 3QR3A 4BF9A 2WHKA 4C60A 4ZFCA 2J24A 4AAJA 5AYIA 3G1DA 5AYXA 5C70A 1AA1B 5JBDA 1WQ5A 1K8CA 1C8YA 3W3OA 4HNTA 2J7CA 3BURA 5CZKA 5D9MA 2PP1A 2WM0A 1PAMA 4UQAA 2NXGA 4MJZA 4YPJA 4HMCA 4FX8A 1TA3A 1XCXA 3L2LA 2Z1VA 5AYYA 2MUCA 1OGSA 4LRTA 1UD5A 5FJJA 1REQB 3B0VC 3MUAA 3WJZA 5A6TC 2ALDA 2FPTA 2YB4A 1EHNA 1J0YA 5FSDC 1W6TA 4QP0A 5LIYX 3M0LA 6REQA 3W1XA 1NH6A 1L6SA 3LERA 5RUBA 2W63A 5A6JA 5CC7A 3GYEA 3G3MA 3TEVA 3DDMA 5AHFA 5HMEA 4B5XA 1EEXA 2HJPA 1BPLB 3TR2A 3MV11 4EPDC 3PTQA 3F1QA 4B5TA 3N2XA 1HJQA 3QGAC 4JY9A 1L6FA 4CQDA 3AU2A 2ZWZA 3AXHA 3U2ZA 5GPRA 4YYFA 1H4PA 3LCWA 3WG6A 1JYXA 3CYVA 1E0VA 1WYIA 5LKYA 3IS4A 1GHRA 3UR5A 2HE8A 3AS2A 1J18A 1B4EA 2GJRA 1TTJA 1OWQA 4JX4A 1ISVA 1CECA 2Y5EA 3MUXA 1P6BA 3NSMA 1DWFM 2DIJA 2BOEX 4HBKA 1OCQA 4NVTA 3WQDA 1E70M 1O12A 1EJWC 2B7QA 3TLQA 5BRBA 3IPWA 3R6IA 4IMAA 3AJXA 3ARRA 1EWDA 4FXRA 3FJLA 1XGDA 3GU2A 3M9YA 1PB0A 3OLIA 4IL2A 5LA0A 1TCDA 4UQ9A 1QPNA 4O1CA 4MAVA 2WMGA 3T4CA 4AMCA 3KE0A 3PBVA 1HT6A 3LGDA 4HNCA 1V02E 4A3YA 1RZMA 4S3KA 4NRSA 1FFQA 1FWDC 4DWSA 3O07A 5AN7A 3QRHA 2PWGA 4LWWA 1O60A 4ORIA 3KEHA 3UP8A 1RK5A 4H41A 4HNVA 5E09A 4HPNA 4J3WA 1FWAC 4IMFA 4L4MA 3ARPA 1EX5A 2A5HA 4A3HA 3OHIA 1LM1A 2PLKA 1ICSA 4XG1A 3CMFA 1KXQA 3HPFA 4HOXA 1WA3A 1US0A 5FCZA 3BICA 3MCOA 5A6LA 3L7RA 4ROPA 2R24A 3OYZA 4R9XA 2ADAA 4NAFB 1HKWA 4LJ3A 3DG3A 3UVIA 3A12A 2BS9A 1TZZA 1XSKA 3WFZA 4G7FA 4LGXA 4F0HA 4RE0A 1W9PA 3KOFA 1UH2A 4FEZA 3RGTA 4POCA 5BYWA 4UUIA 1XQLA 3BV7A 1O94A 1TB3A 1V5XA 1VRXA 4CNUA 3KHJA 3BDKA 4E3TA 4JTIA 1VHCA 1YBQA 4Q4OA 1MNZA 3FIGA 1VJZA 4MSSA 1R30A 3MDWA 1A5NC 1W91A 2OSYA 3N34A 2EXOA 3CT7A 1GZ1A 4E2DA 3B8VA 3R0KA 1BVWA 1F07A 2CBJA 1QPKA 4CNSA 3GNDA 3N6HA 2XTKA 3OQ8A 4KWSA 1MMFA 2PDKA 5A8NA 3P84A 4MADA 3LBMA 4PTNA 4IHCA 4Q8QA 1KFCA 3NYZA 4HNOA 2QW5A 1DJHA 3UD6A 2A79A 2PD9A 5D8WA 1WKFA 2QPSA 4UNIA 4H7ZA 4QLLA 3RMJA 1BG4A 2PPGA 3W7IA 3M5ZA 3CLMA 3WLLA 1OF8A 1A5CA 4MNKA 3YPIA 1EYEA 3LXCA 1RXOB 3LHUA 2BSLA 4R88A 3SUVA 1JDCA 4DF1A 2QHAA 4K7YA 3FAWA 1FWFC 2NQ9A 3V1HA 4B4FA 2OODA 5DBUA 4JTHA 1PCKA 1FHDA 1RH9A 5IFTA 2NUYA 4RV8A 4B5NA 4XSMA 1WUEA 4E2VA 1E6QM 4PUEA 3EA3A 2CLMA 2B7NA 2EBNA 4YHEA 3R8RA 1O5QA 2BZNA 1EA0A 4L64A 1JCMP 3VDGA 1S5TA 1NOUA 3EEZA 3BK0A 3WDRA 2D2GA 2XSXA 2I5IA 2O92A 3EKZA 3LA4A 3RJYA 3SRHA 3RNDA 1TJPA 1SZRA 1ME8A 1J6PA 4OE7A 2OJPA 2VNCA 3F2DA 1KB3A 1UKOA 1GWJA 1VEPA 3DBNA 4C7GA 4CKQA 4IGNA 1JL8A 1CTNA 4J3ZA 2I14A 3UY8A 3CUIA 4D6FA 4UMCA 2Z1KA 3N04A 3OEXA 3URAA 5FJOA 4PMJA 4C6PA 5CZTA 3QGKC 3W7NA 4G1NA 5GJNA 5LXXA 4CCDA 1YADA 1EKOA 3HG5A 3HQNA 4JTAA 3WK0A 2OEKA 5CCZA 4CNPA 4CCEA 4M3PA 3S5OA 1WDRA 4GRSA 2G96A 3G0SA 3OGVA 4B2DD 1S2VA 3NEVA 3NQBA 3KVKA 1LBMA 3EZ4A 3QHNA 1ONWA 3GSMA 2FJUB 4JZ5A 1S1PA 1UH3A 4ZVJA 3NGFA 4XZHA 1B9BA 1KQYA 4CN1A 4P2VA 3V35A 2NT1A 3TKFA 4ZE4A 3B0XA 1KRCC 3VNIA 4H9TA 4A05A 2TYSA 1SZFA 2E28A 2QJMA 5K2ZA 4FALA 2OOGA 3FDGA 3TQ0A 4KIRA 3GDTA 3T1GA 2OOFA 2PP3A 4YMZA 1P1XA 2FPVA 2VFHA 3T2OA 3PZOA 3BGAA 2YYTA 2IUZA 4J2MA 3TA9A 3M7SA 3FA3A 4BS0A 3P6LA 2Q09A 2BP1A 4L4LA 1VBUA 4KIEA 2HVNA 2HNEA 2XIIA 5HMFA 4NQ1A 2YLAA 4JNYA 5IRPA 1DJNA 4J7RA 4Y6GA 5CPMA 3L4TA 4JTJA 4B5VA 1MQQA 4LAUA 4HHMA 1UOZA 1Z9AA 1Q5MA 4H9YA 3RG6A 3OZYA 4ZB0A 3KP0A 3LQLA 4GNKB 2ATMA 1LLOA 1Q45A 1QNQA 1L9WA 3AYTA 1C90A 4UQBA 4AWTA 4MVAA 2GYIA 3KOYA 2IXUA 4PTDA 3WLTA 4P7NA 3TR9A 1SM9A 2RJGA 1MW3A 4FLOA 2ZRYA 3AMCA 4AEEA 4Q8PA 1TQXA 3QYSA 3HO8A 1WB0A 2QXWA 3AYVA 1NWRA 1AL8A 2PDQA 5A3HA 3DHUA 3UY7A 5CPQA 2FFIA 1XUUA 5EFDA 4C6JA 3BARA 5EGRA 1IT8A 4B91A 4H8UA 4NJHA 4K36A 2WANA 4DZ5A 1FWIC 4C65A 4H1ZA 5DEZA 1Y5WA 3H2AA 1LWIA 1E72M 2P0IA 1OBAA 3SN0A 3HPXA 4DN1A 1CB2A 3M0MA 4TO8A 5ABFA 4H8VA 1M7XA 4Q7BA 4AX6A 3GXPA 4IUGA 2OB3A 2TPSA 3KCJA 4CD4A 5K9XA 2HNHA 1F3EA 4QROA 3S0CA 1VBRA 2X1IA 5C8BB 4N2YA 3ABSA 1B3OA 2PP0A 4AISA 1M53A 5K4ZA 1U30A 1G01A 4W84A 2PWHA 2WC4A 3DBPA 1TPC1 3VIHA 5CGMA 3CWOX 3RLUA 1TCMA 2PDCA 3O63A 5H6HA 1KKRA 4KFOA 3ZR6A 1V02A 1NEYA 1MYRA 3QY6A 1S2UA 3OHMB 4J4KA 4EF8A 3W38A 2CU0A 3UQNA 4GQBA 1K02A 1GPFA 4J9JA 2B81A 4MZ1A 2RHGA 2J88A 1UKPA 2XGZA 3N9SA 1W1B1 4HYWA 5HULA 3S9ZA 1OFRA 2DT0A 3REQA 2VX4A 3QZAA 5I3KA 5BOEA 3T0CA 2Z0IA 1GVQA 1B5TA 1R7OA 1TO3A 2D0HA 1KW1A 5G5IA 4Y9PA 4Z1CA 3R13A 5LIXX 2VR2A 4LU0A 3BAIA 5TNVA 4GUFA 3QR1A 2YL8A 5EMYA 5CSYA 4ERGA 1BEUA 4ZBCA 2NV2A 5JMUA 4GACA 4R9OA 3IIVA 4NXKA 2BLEA 2OKTA 2RDWA 5LNSA 1L8PA 3VUPA 1LWJA 1T40A 4QS6A 4B16A 1M9HA 1E3ZA 3IUIA 1QT1A 1ITUA 2D3LA 4IFOA 1DP0A 2PFHA 5A1AA 2R6OA 2WOQA 1KM0A 4US5A 3NOEA 3POHA 4RNFA 1HKJA 4IQLA 3STEA 3FAXA 4KWWA 3VE9A 3EX4A 3W7DA 4CCCA 4V1YA 3VD4A 3T44A 1M6JA 3THAA 1A3HA 1Q6GA 5AFDA 3W74A 4RZ4A 1XS2A 4JIHA 3GYCA 4C1NB 2V3FA 1G69A 3R79A 1ZBKA 3EX6A 2W5FA 4ATDA 1JZ5A 4NRRA 1V77A 2ZX5A 1CXIA 1W2PA 2G5WA 1YQ2A 3QF0A 3WH9A 1C7TA 2UY5A 4IISA 1CXHA 3VKAA 3L5LA 3GG0A 4ZCWA 3W2LA 1EBHA 4JTSA 5GJMA 1NVMA 1XR2A 2WPGA 4X60A 4H9VA 2C1GA 4JTLA 4DM1A 4C1LA 3HPAA 3RU6A 1LORA 3BMVA 2V2CA 3W7OA 1H3GA 1EJRC 1A5AA 3HJEA 1AJ2A 4KCUA 4BF7A 1DXFA 4R85A 1EF3A 3B4UA 3M7WA 3HF3A 4CNNA 3RX3A 2EJ1A 2GUYA 5G2IA 2PGFA 3AUJA 2HBVA 1ZL1A 3HFTA 4CQ9A 1CGYA 5I00A 3EPMA 2QQ6A 1R7AA 5AOUA 2JF7A 2XM1A 2G37A 5T9BG 2W92A 1PTGA 3IIXA 2ZXBA 3JUGA 2OO0A 3B06A 3B9OA 4ZQOA 1PDYA 1KLZA 4JPGA 1LP6A 2HXUA 3P0WA 1H60A 3BZJA 3UEQA 3TQVA 3LRMA 5EMLA 4UOJA 5HR6A 3BOFA 3LXAA 3R1ZA 2O55A 5I3GA 1AMKA 1B57A 4NJKA 3WH6A 1U1HA 4M82A 1VFMA 3OG2A 1SYTA 3LLDA 2ZRUA 1KBLA 1E40A 5G1YA 4E4PA 3UZXA 3NA8A 1SFSA 2QPXA 2YR1A 2ZYFA 3PS7A 1ADOA 3SCQA 2ZCGA 4AIOA 4JAWA 1QI2A 1X97A 3KRSA 4G8TA 3BLLA 3N2TA 1IQ8A 1BWVA 1F8IA 4WOZA 3VIFA 2NT0A 5FEWA 4H9ZA 3GXDA 1XRFA 4O12A 4UNKA 1F7BA 4Q4KA 2ACUA 1XF0A 1TV7A 1H61A 5GNZA 5D04C 3MMDA 2GVJA 1XLGA 2D0FA 5D2YA 3VILA 4I5RA 4N9BA 4GUHA 3O6DA 3U3HA 2VEMA 4U28A 4CD7A 4ZO9A 1PSCA 4UTTC 3ITLA 2DVUA 4M19A 1GQKA 1VFHA 3OLDA 1P4CA 4DHGA 4RJEA 2QZRA 4A3QA 5KITA 1JZ4A 4HPJA 5BWAA 4UNLA 4W8BA 3RPDA 4H19A 4GFIA 4M7TA 3UA4A 5A2AA 4RW5A 4C91A 4CVWA 1ZAJA 5ECVA 4DIAA 4KFPA 3TTOA 1W3NA 3TVAA 2VEFA 5DO8A 3W7EA 1RLDA 3F5KA 1TTQA 3T0DA 3KVMA 3ZJKA 2FQIA 2QPUA 4IIEA 1W1PA 1EC8A 5CSUA 3FA5A 3F4WA 3DG6A 1AW1A 5FIPA 2V5JA 2E1WA 4DYEA 2NV1A 3LTSA 5FD0A 1E1FA 4AX7A 3N2OA 3NM3A 3A22A 2WCGA 3AHYA 2B0MA 5HDRA 4BK9A 4LYRA 3VZYA 2WBKA 2V2HA 3BQ6A 4DBWA 5BOOA 2PDJA 4PMZA 3OP2A 3WBYA 5CPNA 3W2MA 2YBUA 5HXMA 1C29A 1QW7A 2J8FA 4NJIA 4HA3A 2HTMA 2F84A 4JNZA 2WHMA 4WQ6A 4K8GA 3W23A 2QV5A 3W6MA 2R1NA 1JD7A 1F3WA 1X38A 3A3XA 1P7TA 4AZ6A 4HHPA 2QCFA 1B90A 4PC8A 5D9OA 3IEBA 4JN6A 4AVOA 2V69A 2ZTJA 4HQVA 2P3EA 3OYXA 1PZ2A 2E7FA 2VR4A 2Z1XA 4WR3A 3LUTA 5G1MA 1AVAA 3GNXA 3O15A 3EWWA 4W89A 4JYFA 1W9XA 2PTXA 3H53A 3IIOA 1O4UA 3E6EA 1QWGA 5LNUA 3UYIA 1JAEA 2ZKMX 2TODA 1FA2A 1ZJBA 5TAOA 4CQ8A 4NAEB 4AYGA 4K2SA 4U31A 3LK6A 3P7YA 3R8HA 4UMAA 3N14A 5CPLA 1B3YA 2PDBA 3FGCB 2F2HA 2Z2AA 3HGJA 4JKKA 5HJXA 3P81A 7TAAA 2WSRA 5TQLA 2DY3A 4KEUA 5IDIA 3L4ZA 1KM5A 2W79A 1B1YA 4GPNA 4JDBA 3WD3A 3CM4A 3IANA 1IEXA 2H9AB 5C6MA 2JFEX 6XIAA 3OLGA 5G4EA 3ID7A 2HVOA 2J78A 2YXOA 3G24A 3WBXA 2BXYA 1BLIA 2PWVA 3C2YA 4F0MA 4AB4A 3TYCA 1KFKA 4WJ8A 2XVLA 2JKEA 3W2UA 1RALA 4PRWA 1RY8A 1HGWA 3LSCA 2RFGA 4B9ZA 3S83A 1J2WA 4E4FA 2Y1HA 3SUWA 3EOEA 3TYAA 3FS2A 5MKGB 4GCAA 1UCWA 4CNOA 3VOGA 3FEQA 1KTNA 1ZSXA 4H2HA 4M6PA 2E6FA 1L8NA 1VCFA 2HBXA 4WXZA 4J3XA 3LHWA 3SURA 4XSLA 2PLMA 3FXGA 1CGUA 4C1NA 1ZZMA 2ZRZA 4JHZA 3W72A 3QFEA 3C2OA 3TU9A 1H41A 1UUQA 2G3MA 4XD6A 2PB1A 3MKCA 3GU9A 3KWXA 2BY0A 1ZENA 4GG9A 3C5QA 3B3DA 1OVDA 1W1IE 1S5WA 4IGMA 1PIGA 2EJAA 1XPGA 1T7LA 2A3HA 3WDHA 4PMUA 2IKIA 1SQ7A 1ZJIA 1QHOA 3IGSA 3GQYA 3WQ6A 3OTRA 1RBAA 4KGJA 1V0LA 4NU7A 2PD5A 4N42A 4Q4MA 3W7MA 2E9BA 2ZQ0A 3WLNA 5AVHA 2OPJA 1JGMA 2E6YA 4UTTA 3WMCA 4IWWA 4NX5A 1LQAA 1QDSA 2O0TA 1UZ4A 3WO8A 3WF2A 3N18A 2A3CA 1O1HA 2X1RA 3A4JA 1UH4A 3NFUA 3DHFA 1UR2A 1DJYA 1H7WA 2R82A 3GC5A 2CLPA 3NNTA 1YNYA 3UZJA 2PI6A 4ZR8A 1UW9A 2CBVA 2OVLA 3QBUA 1JDEA 3ATZA 1A5KC 1M65A 3V0TA 3VTRA 4M7SA 9XIAA 2O7QA 6TIMA 2FGZA 2YYUA 4KCVA 2ABBA 3TCEA 3NR0A 3ABQA 4Q8WA 3CIXA 4PBFA 1N8IA 1OK6A 2INEA 1Q6QA 1XRVA 2WZIA 1Q7ZA 5IBXA 4LYQA 2I16A 3VNMA 3LZ3A 1K6AA 3GO2A 4NX0A 1Q4WA 4GOAA 4U2ZA 3MP5A 3IAQA 5EB8A 1P43A 3VMNA 3P74A 4P61A 2NX9A 3G1VA 2VZOA 3VZXA 5KINA 1FOBA 3UVAA 1S5VA 2TRSA 1K9TA 3E2QA 1A0CA 4WKHA 1GKPA 4MOZA 1B2YA 2DZUA 2HSAA 3LGEA 3LQGA 3NO5A 3RYSA 3QY8A 4UTWC 1F6KA 2DP3A 2Q02A 1VH7A 1ZCCA 3ZT6A 3SCTA 3DN5A 4C6KA 2VC7A 1FXQA 3SQLA 2Q6ZA 1OT2A 3ARSA 1F05A 4CVUA 2HCVA 5LA2A 1XH1A 3W25A 4QHRA 4NASA 1KGWA 1DWJM 1UA3A 3G2GA 4LANA 1XLJA 3WDJA 4NZ3A 2MANA 4RKAA 3GXIA 3GHUA 5C71A 1CPUA 1NWTA 3IWPA 1G4SA 2QDDA 3GG7A 4PZVA 4NI3A 5LGXA 1VAHA 4E8CA 1TVNA 2VRQA 2J25A 3RM9A 4AU0A 4G2DA 4C6MA 1S5NA 3UJFA 3GAKA 3WLQA 1U33A 4LC6A 4H00A 4DJFA 1MI3A 4I90A 1NDWA 2I17A 4LVDA 1GG0A 2BGNE 3A23A 1GEQA 5CPSA 1R3YA 1FWSA 1IWAA 3BQ5A 1KC7A 4QSFA 1PZ0A 1NY1A 2VZVA 3OIXA 3CUGA 1VYRA 1ZTVA 4H83A 1H1YA 4QDPA 3VXGA 4FP1A 4D71A 1TG7A 1S2TA 5BOFA 4Z2HA 2JIEA 1XXXA 5GNXA 1XFBA 3FCPA 1EO7A 1GYNA 4Y9AA 4LB3A 1BXBA 4ZFMA 3W7CA 5C7VA 2DEPA 1V93A 1M1BA 4XZIA 2J74A 4QBXA 3ITYA 1C91A 4JFWA 3W88A 2NXIA 1V7YA 4I7WA 1W1A1 4ES4A 3GWQA 1V4YA 3UR2A 1JQXA 2DSKA 3WZ0E 3UWZA 3N4FA 3UFYA 2V5KA 3IJ9A 3TSMA 2WMJA 2WCAA 4Z0JA 3VOIA 2P53A 4FF5A 3BMXA 3UZZA 4UFJA 1DJZA 4H04A 2EPLX 1EL3A 1NWSA 3VDHA 1GCYA 2V5BA 4TMCA 1A5UA 4GBDA 4LAMA 4LS2A 2XH7A 3ZWTA 4NAEA 1WAUA 4LX4A 1V08A 1AJZA 4GXWA 5CJNA 4AYSA 1E0UA 3SUUA 2BB0A 1T41A 4B4HA 2A7RA 4HOZA 1T0OA 3GTXA 3COTA 3ERPA 3IGUA 1DIKA 1I0DA 1DJQA 4MAZA 5REQB 3FGCA 4PTWA 5CBIA 2GZXA 4Z17A 4GXPA 2A0NA 2RDXA 5I7GA 5C55A 2H9AA 5H91A 3L23A 3WQWA 3LI0A 1HNYA 4DXVA 2Z7KA 2PWDA 4GABA 3LB0A 2UZ9A 4UIOA 2FYMA 1IEQA 1GT8A 1VGAA 1YDNA 3CB3A 3CQHA 2ZX6A 4QJ3B 4TV5A 2V5LA 2WQDA 2CWNA 2C0HA 2G0WA 3FA4A 3CUFA 4YCOA 4M1RA 3V1PA 4Y90A 5MKGA 1TX0A 3NQGA 3H6OA 1UWUA 2YLLA 5FJTA 2FIQA 3WLRA 4IMEA 3H24A 5I0DA 2KAUC 4UMBA 4TVUA 3QW3A 1GZJA 1Q6LA 2J8TA 3CWNA 3H23A 3VDCA 5AY7A 1C3FA 3GXFA 3ZOAA 1DE5A 1XLFA 1RLCL 3E74A 1DOSA 4I9JA 3WK1A 1JF6A 4PR4A 5C7HA 1J0ZA 2F9RA 3P14A 4AY1A 3KUMA 3L65A 3EDJA 2O4MA 2NWRA 2J7DA 2VDHA 3KTXA 4IZGA 1P6WA 1YLVA 3MTWA 2F61A 1NARA 4JTDA 4JY8A 4LCRA 3G22A 4Z42C 3CS2A 3NZQA 3NO1A 3MWCA 4OBRA 1NWUA 3VA8A 5J5DA 4G7EB 2BVTA 5AHLA 3WK2A 4E4UA 3ZMRA 2E9MA 3DFYA 3WLJA 4UTWA 5A6MA 2V3DA 5A8OA 4CQCA 3EWYA 5DMYA 3JZEA 1EC9A 2ISFA 2DZBA 1ADSA 4QE4A 1OIMA 1EUNA 2C79A 1FP8A 2BHYA 4GC4A 5EA9A 1FWEC 3W7GA 1E6ZA 2J62A 4BI6A 4JCMA 4DLFA 1VZWA 3G0XA 3ARQA 1XIGA 4KPLA 3VI2A 1IF2A 1KFLA 3MJMA 4K39A 4LUSA 3CAWA 3EXRA 3JVAA 3GDMA 3C52A 4BQ3A 1DL3A 3H4WA 4BWLA 3SCOA 4K6AA 4TVDA 1LWHA 3GBEA 4HYVA 4WIWA 1QW9A 2W62A 3BJSA 5EL1A 2QDGA 3W02A 1E71M 1WXJA 3WEOA 2OU4A 3DFPA 1ELSA 5ABEA 1BKHA 3T42A 4F0RA 1LG2A 3UCQA 4NZCA 1FHUA 1JCLA 1KXTA 4OUEA 1W2VA 3ARXA 2WVUA 4JFTA 5DRIA 1J10A 3U4AA 3O1NA 2GK1B 5EMKA 3I3BA 3PPCA 4R7OA 3WELA 4S3EA 1M3UA 4F3HA 3L4VA 3VD3A 4IPLA 3LOTA 2G97A 3IRDA 2ZC1A 2WNQA 1US3A 4MY9A 3L5AA 4N4QA 4JIRA 5BRQA 3JS3A 3UJSA 4J3VA 5D9PA 2WWCA 2ZRWA 1MW1A 2VUNA 3KZSA 3W28A 3VD9A 1C8VA 3VX1A 4W87A 3UW6A 4ATWA 3WKZA 5JXQA 3PSVA 3NQMA 4R7JA 2REQA 3E0WA 4KRUA 5I06A 1GORA 4ZA0A 2OKOA 3ANYA 4DO7A 4OGZA 3LMYA 5HNTA 3QV7A 4DJDA 2VX7A 3ENLA 3C86A 4X61A 1A0DA 2H90A 3THQA 4DZIA 2FMOA 1KGXA 2V3EA 1ONRA 1JXKA 2JE8A 1FWJC 3BGGA 4H6RA 1BF6A 4EPEC 4EAMA 1PUDA 1NELA 2P8CA 3N15A 3CK5A 4IIHA 3CH9A 4ASTA 3MMWA 2OX4A 2VRJA 4UR9A 1IIHA 4BR1A 1PHQA 4HNUA 2OT0A 4YU1A 1BVNP 1ZQ5A 4GGHA 2BHUA 3WLMA 4ZXOA 4XAPA 5AC7A 2E6DA 5C2GA 2A3EA 2SFPA 1BSIA 2PDIA 3N3MA 3GVGA 4UBPC 2W61A 3QC3A 1GQIA 4IJBA 4MTVA 5KZEA 3G1YA 2Z26A 3UCDA 4ONVA 4RDYA 4HCHA 4HYRA 3LDVA 2G41A 3ZLFA 3VNZA 3CHFA 3LM7A 1YDVA 3N4EA 2JEQA 1W37A 5H1WA 1XSIA 3EDFA 1NM9A 1XLCA 1UIOA 1PCWA 2ZUWA 3GLCA 4KEZA 3W0KA 4WEVX 3ATYA 2D23A 3SFKA 3K2GA 2HEJA 4LAOA 1TWSA 4AZ5A 2BV9A 4MHBA 1PEZA 3GW0A 4GX8A 4DBDA 3WDIA 4MZYA 3IARA 1GEHA 3L4UA 3G1FA 4TTUA 2PGEA 2CWXA 3G18A 1P5BA 4M29A 5CJMA 3H4GA 2QS8A 3V7PA 3VIMA 3TLLA 4O14A 1MDRA 1LT8A 3ZVHB 3BSGA 2Z25A 4PUUA 2WAGA 3O06A 2EQDA 1YRRA 5IHSA 1EQCA 2YKKA 1HN1A 3T05A 4C5ZA 3GFZA 4EXBA 5HNRA 3WL1A 1TV3A 5C9RA 3S8HA 4O17A 1EOMA 4LBRA 3G8EA 3FKKA 4FB7A 4YTUA 1XD0A 4O52A 1P0DA 4JICA 2X05A 3W6LA 1DEDA 2YIHA 4FNRA 3NIYA 3LXBA 1H51A 1E4IA 1YNQA 1GOXA 2Z00A 4KEVA 3LS9A 1QRQA 3INPA 3WQCA 1VQTA 1ONXA 3E38A 1MZRA 2A21A 3LCGA 4Z1DA 1NFBA 2ZX8A 3VKBA 5LHFA 1W3KA 2X16A 4JNMA 1GONA 2VDGA 4CQAA 3VGFA 1OG6A 1PV8A 1Q6RA 5DF0A 4ALDA 1V3MA 2NSOA 1ODZA 1IR2A 4KGLA 3K1DA 3A13A 3CAVA 2F6KA 4YXGA 3NDYA 4IF2A 5CLWA 3VNLA 1UKTA 3GXTA 3GH4A 3CPRA 4MPQA 3F2BA 4L61A 2PZ0A 1XIFA 3NPXA 5JIPA 3GNNA 4FI4A 2P88A 1MZHA 2UY2A 3QV8A 2VWTA 3LHTA 2E6AA 3VPLA 3AFBA 3ONCA 3M0HA 3G1AA 3E0FA 4Y8EA 3S1VA 4BI7A 4I7UA 2ON3A 1TPH1 5F1UA 4YWSA 2W91A 2YA1A 1CI1A 3PVFA 1PX8A 2RH9A 2RGLA 1JULA 4G7EA 1J93A 1BYAA 5FEPA 5DRCA 3GIPA 1VJSA 3MP4A 5B7ZA 4JN8A 1F6PA 3GDRA 3P61A 2E67A 1PWMA 3Q58A 1UWSA 3FEMA 4V27A 4L9XA 1QU4A 1UQZA 3W7RA 4QAIA 2OGYA 4WDWA 3TQPA 3NM1A 1J0HA 1K1DA 5I3JA 2CZ5A 3SJNA 3QMTA 3CO8A 4QLJA 3GU1A 3D5HA 1A47A 3ME3A 4TX8A 2XFFA 3W1LA 1WAWA 5IFPA 2E1DA 1TRDA 4LUYA 4HZ6A 3CHCA 3H7RA 1Q66A 3NQVA 3N9RA 4GKLA 3NWRA 3GXNA 3PC0A 2P76A 2Z27A 1OX6A 2EAWA 4Q8UA 1XCFA 2J4GA 1Z69A 3GIQA 3K4WA 3TW6A 4NP7A 4GYPA 4LAKA 1QJWA 1BTCA 2YA2A 4K3ZA 2AKMA 4GINA 3B9AA 2Y5SA 4GI4A 3B9NA 1JD9A 3C8FA 4ZEPA 2VM8A 3VCRA 3WENA 1YXCA 3BCFA 4JFVA 3T2PA 4H01A 1TE1A 3VDBA 2GK1A 1ALDA 2CLIA 4NZJA 1HL2A 3SBFA 1CEOA 1R6WA 1H09A 4ZB2A 1S5MA 2EG7A 4RDWA 1OFBA 4JKMA 3H4XA 3HTWA 4A3RA 4KRZA 3CH0A 4DY1A 2XIBA 3W85A 4YS1A 2FZ9A 1JDAA 1UWRA 4GYJA 1V51A 1CLKA 4QQ3A 3WBWA 3G1XA 3B8SA 1ZPTA 5G4HC 3E12A 2XH2A 3KS6A 4QRNA 1KBBA 1I2RA 1K70A 1TWZA 2F7FA 3QXBA 4P7QA 2C18A 3M0VA 4XZMX 5T8GA 2OZ3A 4CQBA 5EYWA 5D2TA 3CASA 3L67A 3U57A 3AYSA 4I3GA 4NILA 2X40A 2PTDA 3KOXA 2E0PA 3DYPA 3B40A 1OGGA 1BYCA 4YIWA 4O19A 4AZ7A 4JTGA 1M04A 2V3GA 3QW4B 3AIWA 4LPCA 3C2FA 1K7XA 4CN6A 4OFCA 4OIFA 1ESWA 4F4RA 1ISWA 2XVKA 3LLXA 3P82A 3NPUA 4IFRA 4DWSD 1LQ0A 1VBJA 5CAKA 1UWTA 2Q3RA 1HZYA 1RQEA 2FTWA 2WKJA 2CZEA 3PJTA 1C7SA 2OEJA 2WZMA 2OQLA 1UWIA 3PTKA 3NQ7A 2GGGA 4O1BA 4KFNA 2O9PA 2QCNA 1X1NA 3RXZA 1JJKA 4GE8A 4DYJA 3MO7A 3NL5A 4WSKA 1MO0A 4IGHA 4X22A 3V5FA 2NVDA 2D2HA 5HWNA 3KOZA 3B8DA 5A6BA 2QNEA 1YPXA 2QVHA 2DQXA 1J0JA 1DIOA 8RUCA 3P60A 1QOPA 2GOUA 4XO7A 5ENLA 1WZAA 4HJWA 4NZ4A 4KEMA 3QZ6A 5GVJA 5H2ZA 1E0TA 2ODOA 2GJLA 4O54A 1OYAA 3ZVHA 4XB3A 4CEUC 1TPEA 5KSWA 1ZBCA 3MYPA 1OFEA 3SGZA 3WF1A 4W8AA 3VFCA 2POTA 3AJ7A 4D9PA 3UXKA 2CITA 1KR0A 2VVSA 3IJLA 1QVBA 1V0MA 1XIMA 4C6NA 3T4WA 1Q3NA 3WLHA 3LN3A 4WDUA 4EIVA 1QNRA 4E0CA 3EMQA 5C2CA 3T07A 3RU8X 1LL7A 3S4TA 4KESA 1FWNA 3MPGA 2ZX9A 3APYA 4G1KA 3P80A 4PRTA 4O8AA 1G7VA 3P5YA 5FF7A 1JYWA 4S3FA 2VGIA 3O6YX 1MUCA 2CIPA 3VNYA 3PFRA 3CLWA 4CUCA 2P1FA 2ZBTA 4GCXA 4ADUA 3M07A 3KCLA 3U2EA 3M0XA 2XIJA 5U4NA 4ICCX 4O1DA 4O18A 3GXMA 1UOKA 3VIKA 1SSDA 4GK8A 1E9LA 3N17A 4A8NA 3UXIA 4DZHA 2ZZ6A 2BBFA 4PFMA 3LPFA 5FESA 2Z6JA 3MT1A 1RCXB 1LRNA 2ZVRA 4XVDA 4PUMA 1EJVC 4H8NA 4FPSA 4A35A 3ABOA 3WEMA 1QR7A 4DVOA 3UXDA 3M16A 4UQCA 1BRLB 1E55A 3MKKA 4XO6A 1UBPC 5CC6A 1EJTC 1BAGA 1E6PA 3DESA 8XIAA 4GYFA 4TR9A 3U6WA 1TTIA 2H8ZA 4UFHA 2F6XA 3GH5A 3DFHA 1CXEA 1UD2A 1U22A 1BHGA 5J8LA 2CLOA 1E4NA 4D1JA 4QIUA 1OX4B 5CPOA 5E9XA 2PCEA 1X7IA 2NSXA 3VD5A 1L2UA 4L9ZA 1D9EA 3B0PA 2D24A 3OO2A 1A5LC 2XM2A 1SFJA 2VFIA 3A4XA 2DT2A 5FL0A 2ZUNA 5EFFA 2JBMA 1XQKA 1PJ9A 2CESA 1H5YA 3HM7A 3TP4A 4FNPA 3GZAA 2BY2A 4NIRA 3W1NA 2DZXA 3VIIA 2DZWA 3PHAA 2NWSA 4I9AA 1R0MA 3BCDA 3BGJA 3APTA 3VKCA 4FIRA 5E93A 2HROA 2BNJA 2J9YA 1IEVA 1KM3A 3VOHA 1NF7A 4MGGA 2CW6A 3G8RA 3WQ4A 1S39A 2FDSA 4BJHA 5M03A 2UV8G 3JR2A 5L6UA 2EPKX 2OWXA 1UR4A 1V6TA 2A6NA 3EXTA 1LF1A 1GKRA 5I3DA 3CZEA 5HBFA 3CAQA 3N6QA 3LHYA 4J2PA 1XI3A 1ZP3A 3GBDA 4BEUA 2ATSA 1OF6A 2X2GA 2DUZA 2XISA 5TF0A 3G1RA 4PB5A 3CL6A 1VLIA 2IPFA 1POJA 1VC4A 4PMQA 3E1F1 3Q2DA 2QUNA 3O0KA 3PWGA 1TJ2A 2INZA 4U5IA 1BTMA 2WHLA 3I68A 2FMNA 4LUIA 3ES8A 3IIPA 2JK2A 4CNTA 2DSUA 3PN8A 1KQZA 1LCOA 4WF7A 2BVYA 4NKCA 5AZ0A 1PTAA 3OGRA 3VNKA 1GVEA 1UG6A 1E56A 6ALDA 1YTDA 4B3ZA 2AL2B 3CIVA 5K9CA 1I45A 3EDEA 3T0TA 4ZTXA 2JALA 3HB9A 1AQHA 1BQCA 2CERA 1XIIA 2AL1A 3QMSA 3VKJA 3EB2A 1H7PA 3PZGA 1IZKA 1XDJA 2CZDA 1QPRA 3EYPA 3WF4A 4OTKA 3SCPA 1JDFA 1EQPA 2ZZ3A 1NOFA 3PZIA 4K38A 4Q32A 1IYXA 4O1EA 5A8PA 3MI6A 2BY1A 4B9YA 1P0NA 3RX4A 3KM8A 5ECUA 1V6VA 1E1CA 4IH3A 4AF0A 2B7OA 1HO1A 1A49A 4UZUA 2BOFX 3KLLA 3H55A 3H70A 4AXKA 3W29A 3SIMA 4Q4RA 3POCA 3WQEA 4D6JA 4ZE5A 3O7UA 4LEQA 4PTMA 5AHNA 3BW4A 2C7FA 4OVXA 3E2VA 1XYAA 4IG2A 4W93A 2HS8A 3R0DA 4OUIA 4BHYA 4Q4QA 1FH8A 3NJ3A 4LNCA 2Y88A 2CXGA 4NYUA 3S5NA 1N8WA 5ABGA 1RR2A 3B03A 4HGXA 2BGQA 2PU1A 1XWYA 2QCDB 3CEPA 3TFCA 4X9SA 4BQ5A 3PZQA 3WH8A 4MPKA 2VFGA 3SCNA 2VZUA 4JTQA 5G1TA 1GPWA 5HQEA 3LPPA 1KCZA 3UGRA 3ZWSA 1VFSA 3WFLA 4BKNA 2VXNA 2QMKA 3IVTA 1TUFA 1E0XA 3BG9A 2GJXA 2PF0A 1XICA 1NFGA 4WUIA 4IMGA 4MWAE 1BKSA 1OJXA 4CU8A 3AXMA 3AMGA 4BQ4A 2CBIA 3TAOA 2PTWA 2C0AA 3O05A 2E9LA 1W31A 4KCWA 3HFYA 3QOKA 5HUOA 4I7VA 1WXYA 2PUZA 3N4AA 4JQ2A 4PCNA 4MNLA 1JPIA 2BODX 1GYMA 3UR7A 3C2VA 3EWUA 1Z7AA 4MJ4A 4DO4A 1V03A 4J40A 3RFAA 2C91A 4QQUA 1W1VA 4A22A 1W9UA 4LQ1A 3GR7A 3RUBL 4GNVA 4ZSUA 1FHVA 1VFOA 3PG8A 1EWEA 1FCBA 5HOSA 3GG1A 5DBTA 4QG9A 1TPWA 1D8CA 1KO0A 2ZICA 1W3LA 3GVVA 2IQ0A 3B9EA 3STPA 3WX7A 4Q7IA 1OYBA 1P48A 4N4PA 4EPBC 1CXKA 5CKSA 3V36A 4H6KA 3PBWA 5F2IA 4OU1A 1K8ZA 1VIWA 3A5FA 4R53A 5HMSA 3PBGA 3MSYA 2QF7A 1QBBA 2X2YA 4JXCA 3V16A 3BWWA 4V15A 4D6HA 3U9IA 3PPHA 3V75A 4AZGA 2C13A 3RO8A 1IXNA 3PM6A 4AC1X 4US5D 4DXXA 3BVJA 3ITOA 1UPMB 3L4YA 3EB4A 3WSUA 1VD6A 1PS9A 1OB0A 1BRLA 2NX3A 1S46A 3K46A 1HXJA 1N8FA 2ISSA 4YN5A 3TV8A 4QNWA 1NSJA 1QOXA 4H9MA 2DSWA 1FKXA 1OX4A 1KRAC 4QSHA 3MY9A 4U2YA 1ZRQA 4BQ2A 5BXTA 2GQ8A 3SRKA 4V33A 2PCQA 1Z48A 1X7FA 2DJXA 6A3HA 4PH6A 3V4BA 1LROA 1W17A 1OZMA 3UG3A 2MNRA 1JAKA 4GIRA 4D6CA 3ARZA 4LB4A 3V18A 3M5XA 2OSXA 1HVXA 3D0CA 4JR5A 3H2NA 1IGSA 2X7VA 4QEEA 2PTZA 4DAIA 4Q6JA 4IFKA 3K8MA 5JVLA 2AAMA 4YVXA 3BMWA 4MWAC 4C6FA 9RUBA 3RPMA 2WVTA 1E6SM 1UROA 3G0UA 5BMXA 2PWEA 3SY8A 2J7GA 1XLMA 4F79A 5KETA 2IKJA 1Q8AA 4HPXA 1UA7A 1CW2A 1V3IA 5EMJA 3GG8A 5JUVA 1HIZA 3KLKA 4Y9OA 4GI6A 1XINA 3QTPA 3UWQA 1FQ0A 4QXIA 3C61A 2AOSA 2O4QA 2GGIA 1JQVA 3L5MA 3PTMA 1XV8A 1SGJA 1W5MA 2EPHA 4XX6A 3EMZA 2G3IA 3GC4A 2P5NA 5AYBA 3AIBA 3BLKA 3GR8A 2CHRA 2OZ8A 4PGLA 4MDOA 4LVBA 2C1IA 1IR1A 1ZFJA 3I6TA 3QGVA 1OX5A 4GY0A 2WMHA 3DFSA 2WPBA 3W75A 2QJHA 3FXYA 4D72A 1B9ZA 1H5VA 4MYAA 4GZIA 1VCGA 2WC7A 3L9CA 3W2JA 2DZSA 4QLKA 2Z1SA 4DJEC 2ZE0A 5DMNA 2V30A 3CZGA 1EBGA 1WX0A 4EF9A 4RUBA 4Y7EA 4XUYA 3IJDA 4EWND 4MUPA 3T7VA 4FF7A 4WSHA 4YJ5A 1K9EA 1W56A 2BHZA 4REQB 5DANA 3C0JA 1K7FA 1QPQA 4C6LA 1B4KA 2E5BA 3I7RA 2NUWA 5C9WA 2C16A 4XK2A 4NNCA 1WDPA 2VUYA 3CEUA 3AHTA 4MNMA 1B0IA 2YXGA 4IP4A 5D02A 4DUVA 3MS8A 4XZ9A 1KLYA 3NSXA 4OZOA 3LMZA 1D3GA 4ZQMA 2J6XA 3URNA 3KVJA 3PSWA 3AROA 3RO6A 3W84A 1NDVA 4PSPA 4QE1A 3ZJ8A 3PNZA 4ZZ9A 1FFRA 2XIQA 4G9PA 1TZ9A 1BWKA 4QGCA 2VYOA 5CG7A 5HANA 3RPTA 1KTBA 2QCDA 5HQMA 2XVPA 2Q8LA 3UR8A 4P8VA 4MIMA 3ES7A 3ONBA 4GO9A 1T96A 3TXZA 3WLOA 5LA1A 3TYBA 3OBEA 5FA5A 4F0SA 3KXQA 4O8RA 3UPWA 1TJ0A 1VKFA 1FP9A 3MCMA 2ZXAA 1CGWA 3SQSA 3PP7A 4N7QA 3HOJA 4MF4A 3HV9A 1WO2A 5HMDA 2ZXDA 3WF0A 4UTFA 2YW3A 1I9CB 4L4PA 1DJXA 5EY5A 1VPQA 3FY1A 4XKYB 1MFUA 1SJCA 1U1JA 1YYAA 3PTDA 4LS1A 3BAJA 3I7SA 4JEQA 4LRSA 5E6YA 1YTEA 3EX3A 3TTEA 2WSKA 1XRSA 3CHEA 5K4XA 1DIEA 1ISYA 1JR1A 1TV8A 4TV6A 3AIUA 2E8YA 4IUOA 1ZAIA 3M47A 4DBEA 1KBKA 1O5XA 3VMPA 4GQGA 1TSIA 3EWDA 3BAXA 5BNKA 4INFA 1K03A 1DWGM 2OR2A 3DFQA 4N9CA 3L21A 1P1MA 4X9YA 5HK4A 3WLSA 1XIDA 3NDOA 2DZAA 4A8LA 2VX5A 4X63A 4PCTA 5K9DA 3N73A 3U5UA 4C5YA 1UP2A 4PMNA 4HB7A 5J04A 2PDUA 1LBLA 4CD8A 3WLIA 3EPNA 3E0VA 2A4AA 3MKVA 4MWAA 3USBA 1JIBA 1RQHA 4JYEA 1D7KA 4XZWA 1FDYA 1GNXA 5FJPA 1FY6A 1P0BA 2X0SA 2AQOA 3TYUA 4OKDA 3OZPA 3WH7A 1HF6A 2YBTA 4ILSA 3DH7A 4JQAA 1AD1A 2EPOA 5AB3A 3EMCA 4ZQRA 1J01A 3EOUA 1NQKA 1BQGA 4IXXA 1W8SA 3GKAA 3KWSA 2CLHA 1FWGC 3W27A 2V67A 4RNJA 3MUZ1 2O56A 4F48A 1MEIA 1E3XA 5D03A 1TX2A 3ZZ1A 4AY8A 2R9RA 3OPSA 2BXVA 1T5AA 3ZYZA 5HNNA 5HWJA 2ZIDA 2QCGA 5FJIA 2AAAA 3H12A 1SO5A 2PEVA 1O66A 2E09A 4EXAA 1Y65A 4A29A 4W7UA 3H54A 2QJJA 4N02A 4DJEA 4DNMA 1A0EA 1WKEA 5HAOA 1J8VA 3VGHA 4BFAA 4UQEA 1P6CA 3GHRA 4W7WA 2R1MA 1OHLA 1H1NA 1VFFA 4P7RA 3H21A 3URBA 1XHGA 2Q01A 1EYWA 7ENLA 3B8TA 3KTSA 4LBUA 2XU2A 2W27A 4NXSA 3SR7A 1LL6A 1KFEA 3W7QA 4GNJA 3G3DA 3DECA 1TPFA 4IIDA 4XAGA 1R2TA 1REQA 4O50A 1AH3A 2CKRA 4HTBA 4MB1A 3LNPA 5H8MA 4RZ5A 1KCLA 1H0GA 3D3FA 3WDPP 1WBJA 3QTGA 4I6KA 5I5RA 1ZB5A 1Q7MA 1PDZA 4WSJA 1MEWA 1CWYA 1Q65A 2J7FA 5E9AA 3ITVA 3PULA 4B15A 1AUSL 1JI2A 1JDDA 2O9RA 1MUMA 5D8ZA 2WMIB 4NNAA 1GK8A 1SJDA 1XLKA 1AJ0A 3P67A 4W8LA 4ERAA 4TUFA 2YSWA 4CN4A 1NP0A 3WNPA 3LYEA 4ADTA 3PJXA 3S6DA 3CHDA 4IIGA 3VZZA 1FCVA 1I6NA 1H11A 1NJJA 5DT5A 2EPMX 3GUWA 2YDAA 2Z6IA 3CZ8A 4XIMA 2Y61A 3WNLA 3VNJA 3EDDA 3ZR5A 1U83A 3WLPA 4JDYA 3KP1A 5G4WA 1C93A 2VOMA 3OU8A 3GKFA 3IGXA 1LRQA 3B04A 4XZBA 3KBJA 4A8RA 3GTHA 3GR4A 3S46A 2VELA 7TIMA 2XH0A 1KBJA 2Z29A 3GTNA 2Z4GA 1A5BA 3BO9A 3PAOA 1SFLA 3R58A 1TIWA 4GA8A 3NL6A 1A50A 2XZ7A 2R8WA 4KT2A 4JFSA 4O57A 1M7JA 4ZSTA 1I2PA 3DYMA 3UJRA 1HP4A 4E2OA 3E0IA 3TSBA 2PBOA 2C1HA 1UR9A 5FAGA 2NQHA 1XLHA 3PZVA 5AC4A 1DQUA 1M03A 5F4SA 3NZPA 4DNHA 1R3RA 4DELA 2WSPA 4LOCA 3PZ9A 4WKFA 2F38A 1XDMA 3PF3A 1ZBVA 5BU6A 1CXLA 3WF3A 3WD4A 2HVMA 1V0KA 1W32A 1DXIA 2NLIA 2GGEA 2VC5A 2FTYA 5F7UA 2PRMA 3STGA 2EF9A 3DUGA 3GY1A 3F2CA 1QI5A 5AYZA 3TUUA 1KD0A 3ALFA 4PUNA 5DFAA 1YDOA 4HOWA 4YCPA 4QTGA 1G9HA 4XKYA 1UD3A 4NAFA 3VNDA 3LHVA 3PBUA 1R9XA 3FYYA 5T26A 1Y0EA 3AOFA 2WNWA 3T08A 1TUXA 4JEJA 2J7BA 3FVDA 3WN6A 1FRBA 5F2GA 1PYMA 4Q6XA 3F5JA 1PKLA 2DDXA 3EWCA 2G4FA 1RK6A 1HJSA 2D3NA 2OFJA 2BTMA 3THCA 1MXGA 5AHMA 2P50A 2FHFA 1BXCA 1VPYA 3HZ3A 3SAZA 3UF9A 3EDKA 3GHTA 2NV9A 3W26A 4Q22A 2Y7DA 3FYPA 1RP9A 3JU2A 3MVIA 2V63A 4UCFA 4HP5A 4X0NA 3MWAA 4I6VA 1WDSA 1R3QA 3M4HA 4FXSA 1V6WA 3HPSA 3R94A 4PUKA 4M5PA 1YKWA 3VOFA 4OV9A 1G7UA 4HTYA 4QNEA 4PL2A 3XIMA 3HG2A 3KX6A 1D3HA 1FKWA 1TJ1A 4PCSA 2Z28A 4DAFA 1EPXA 3GUGA 3RK8A 3S1WA 4AWEA 1QOQA 2ABAA 1KV8A 3U2OA 2QYGA 1XLDA 3WUEA 4LVFA 3GTFA 2GSJA 2OZ0A 3PK7A 1A80A 3AYRA 3CUHA 3ITTA 3T78A 1L6WA 3WUGA 2QLYA 3QQ0A 1ME7A 3MDUA 1GOQA 2PURA 3DKJA 3K8KA 2ZUUA 5CZ0A 3GM8A 1IT7A 1GOMA 3UWUA 1BD0A 1OD0A 2JGQA 1G5AA 2POZA 4G56A 4IPIA 4OBTA 2JKPA 4S3JA 4ZO8A 1Q6CA 3WY1A 1H7XA 1ZGDA 2XGBA 3K5XA 5A2BA 4GZJA 4GH3A 3UU0A 4DQWA 1MW0A 3S2LA 4LXFA 4RZ6A 4CEXC 4MZ8A 4TMBA 4HT3A 4S1FA 4LF1A 3IUHA 3ZS4A 1XGZA 5D09A 4F66A 4L1WA 1XYMA 1CX9A 4JYDA 3QN3A 7PTDA 3TNBA 3TN5A 3PB2A 4KWUA 1OFOA 2AQWA 3A6OA 4XWUA 1G67A 2QAPA 3KL3A 2FVMA 3A24A 4MJ2A 4EACA 3FV9A 3Q37A 8A3HA 2PLCA 3AICA 1W54A 2DT1A 3QOMA 2O7SA 9CGTA 4BZYA 1OY0A 3OVRA 3LU2A 4DYKA 2FZDA 4LUJA 4C6EA 4V2XA 3O2LA 1P0KA 1QHPA 4GUGA 4HNLA 4N9EA 5HINA 1SVDA 2NZLA 2PA6A 3W2KA 1RVKA 1TV4A 2ASHA 3SJ3A 2CEQA 4PMVA 3WNMA 3M46A 3G5EA 1TWWA 1YXDA 2VRKA 1GJUA 4W5ZA 3BJFA 1A5MC 1ZCOA 1UASA 1G4EA 3SY5A 2X42A 1OM0A 1PVNA 3L0GA 3GFYA 4WY0B 3EEGA 2YBVA 1J11A 4CU6A 1UD6A 1H7RA 1HP5A 3CQ0A 5I78A 3LBCA 1UMYA 4UTIA 2G3JA 4L4OA 1T8XA 2VWSA 5A94A 1EP1A 2L5HA 2PWFA 2A7PA 1B31A 2CFFA 3GRIA 2WMIA 3ZFHA 2DQWA 5G2WA 5JBEA 1WNOA 1ECQA 3OVGA 3HBLA 4GMEA 1GQLA 2CHOA 4DWSB 4XZLX 2IPWA 4JTTA 3R25A 1W5NA 1WOBA 3VUSA 1W9BM 2R14A 3RX2A 4BI5A 1RY0A 3ANVA 3SQMA 2VX6A 3EA2A 1M7PA 2E68A 1TVPA 2DGAA 2VEIA 3BC9A 4PULA 2PODA 4MDPA 1FWTA 4AWUA 1AQFA 4WZHA 3TW9A 3SIZA 1FWRA 1CENA 1CLXA 3N6JA 4R3UA 1UB3A 1HO4A 2DZPA 1W3JA 3S2MA 2XN0A 2Z24A 3MUIA 2YA0A 3D47A 3M1ZA 4I8YA 1ECEA 3LV5A 1TELA 1UMLA 3A4WA 3AQUA 5HJLA 1OSEA 1WXZA 1PL9A 3EKLA 4ZOAA 1GTHA 3HMJG 1HX0A 2GL5A 1J12A 3FJNA 3SW6A 1KNWA 4Q8NA 1F9CA 1KM1A 1MXDA 2HPMA 1K3UA 2BXZA 2ZUMA 5IHRA 2GJPA 3CGTA 1Q7QA 2HRWA 1YBQB 4WVXA 1C9WA 1GOWA 4U10A 3CTTA 2G8ZA 1DHPA 1GJPA 1FHLA 1R47A 4ACZB 3RCMA 1J79A 3O16A 2VTFA 1PBGA 2A3BA 3E9AA 5XIAA 1MRAA 4XVEA 4URIA 3OIHA 2Y0FA 5IBXC 4NUWA 3VE7A 2X0YA 1HQTA 2X1TA 2VEGA 2PE4A 1IXPA 4GIEA 4CCZA 2DW7A 1JPKA 4RE3A 5J5RA 1JYVA 1BSLA 4L7ZA 3F4DA 3V5CA 2J7EA 3MP3A 4GVIA 3ITGA 2C71A 4JIEA 3PPFA 1S2CA 4Q8TA 4WX2A 3WCZA 1LOSA 4W7VA 4XAZA 3IJ8A 3M6YA 2F2KA 1LYXA 3DHDA 4LEFA 1GZGA 5D37A 5AZ1A 1WV2A 2WNNA 1EB3A 3BANA 3PB0A 1UYQA 1D2KA 2VGFA 1OT1A 3DHPA 3TOPA 4PUJA 2JKAA 4LCQA 3D6NA 3R10A 2GDQA 2A2IA 4DO5A 3ICJA 1GUVA 3LCLA 1EDTA 2VP8A 4HSNA 4IJRA 3L4WA 4PMDA 4W88A 7XIMA 3EX2A 1P0EA 3NXLA 3TC6A 1UC5A 1B54A 1TFVA 3BLEA 1OCBA 3K1GA 1JI1A 1QI4A 1V8EA 1JCJA 1KFWA 4M80A 1Z89A 2PDLA 4MY1A 1SZGA 1HUVA 1L6GA 4XIAA 1SU5A 3QMRA 2ZZ4A 4X2PA 5CQ1A 5FL1A 5AVNA 4D8ZA 2CC0A 3CT2A 5I2UA 2Y24A 3WBAA 4DJFC 3NZ1A 4G6CA 1QNPA 4GVGA 3IK2A 1KWGA 1XBYA 5I02A 3O6CA 3TJIA 3TMQA 1R46A 3CV6A 4MKSA 1IXQA 2NQ5A 4OHQA 1TYGA 2HDJA 1OEPA 3NQ6A 1X8FA 1YNPA 1EPVA 4FR6A 1EP2A 4F0KA 4R27A 2AGKA 3MMTA 3TE9A 4DO6A 1UP3A 3QZEA 1I0BA 4B3LA 3V0SA 1F4AA 4GD0A 2XVNA 4M51A 4IIFA 4NYYA 1E4LA 1XYCA 4LY4A 1AL7A 3NQEA 3QH2A 2YDSA 4TX6A 3KBVA 3G1HA 4K1WA 3F4VA 4AVFA 3E02A 2I5QA 1LUCB 1W1TA 5C2XA 1Y7VA 2V82A 1OADA 1Y5XA 2WCSA 5DMLA 4ZQCA 2FFCA 2J13A 2ZZ1A 3A9BA 4WXYA 4O1AA 3LCHA 5LHEA 4XD3A 4Y96A 1F8MA 3UBPC 1UUOA 2Y8VA 3KRUA 1SO3A 5E1QA 3QYQA 3N29A 5CLTA 1ZALA 1XG4A 1DORA 3THDA 4LS0A 1BXNA 3S6OA 3VOCA 5A8MA 1E6RA 1ME9A 1S2AA 1TTPA 1X6LA 4LCSA 3R4IA 3B8UA 4RV3A 1DBTA 2YL6A 1ZS2A 2ISVA 4NL1A 3T0AA 1EDQA 1RJPA 3TIMA 3MCNA 1VEOA 3NYDA 2F8QA 2WM1A 3QKEA 4O10A 3C2RA 3VYLA 1R2SA 4P5UA 3RR1A 2XG9A 4JX5A 1NP2A 2DSZA 4GWEA 3FN9A 3IGHX 3RRXA 4ICNA 3ZR4A 1AG1O 1XYLA 1DE6A 3AIQA 1DJWA 2XVGA 5I3FA 1I1XA 2VHLA 3RR4A 1UJQA 2QIIA 4XQ6A 1LOLA 2AMGA 1VFTA 5IXEA 4GLEA 2YCLB 3KZPA 1WKDA 4YVVA 4WY0A 3SRFA 3ZT7A 4TVCA 3TAKA 1BGAA 1H7NA 1K4GA 4YYCA 1UQYA 4FX6M 3AALA 3W87A 1RA0A 2HPIA 1SJBA 3MUY1 1X6NA 3FSTA 6PTDA 3SEPA 2WQPA 3LX9A 3G6LA 2YCJA 1L6YA 2WKGA 2PDYA 3K13A 4RPQA 2QCMA 3MHGA 3HQOA 5D33A 1JZ7A 4ECLA 4D8LA 1KM2A 1EA9C 2V6AA 2CHNA 3QFWA 3IAPA 3H26A 4FXFA 4O11A 1F4HA 2H3DA 1DWHM 2JQXA 4FZIA 4IQEA 1XIBA 1S38A 1Q2RA 2WVVB 4JHMA 3AWNA 2A7NA 5A95A 1EGZA 1MRQA 4JTCA 5ABFB 5HJYA 2EG8A 1Y8BA 3NQCA 1TE6A 2VJXA 3Q65A 1R38A 4OT7A 3PY2A 4DZAA 2UBPC 1XYZA 4LALA 4LY8A 2X30A 5HUPA 1RJQA 4KWOA 1BF2A 3CV1A 1EHAA 4RXFA 2EEXA 2QT3A 3E49A 4QJ4B 2VO5A 4UTHA 1VF8A 1WP6A 1ZNNA 1ISZA 1SSGA 2C19A 4AUBA 4FOUA 2CYGA 4D1IA 3QM3A 1MUWA 1DYSA 4BWLC 4ZXLA 4Q8OA 2DVTA 4C90A 2PTYA 4HMDA 2Y5JA 1Y5VA 4KW2A 4S3BA 2GVGA 2OLAA 3FKRA 4M6UA 4GJ1A 1TWDA 2BX7A 4A2SA 2OLHA 3P0XA 4J27A 4ADSA 3NL3A 3ELFA 1KRMA 3SN4A 3W6YA 3SCRA 2CPUA 3QY7A 3DI0A 4ACZA 4NJGA 5D2XA 3E0LA 3GVQA 4MB4A 2TAAA 5JBFA 2YCIX 4J3SA 5D4YA 4WJEA 3FW6A 4XBKA 3REQB 3W7JA 1SMAA 5IM51 2CLLA 4GGBA 5M5DA 3NQAA 4DM2A 3QC0A 3TW7A 3LM3A 4L6DA 5A6BD 3W37A 2PDPA 1VYPX 2Z1BA 4Q8VA 2OMAA 3BAWA 2VCAA 3EBVA 2WVSA 3KTCA 1JZ3A 1OFDA 3DAQA 4L1GA 1EIXA 3NZRA 1C8QA 2XPKA 4LV4A 1LDCA 4ATLA 2WV8A 3PFMA 5DQPA 3NQ8A 4I5UA 3FJ6A 5CSRA 3CHVA 4F40A 3BH4A 1EGMA 4MLRA 4B90A 3WQ8A 2XFWA 4UB9A 1CGXA 4LC8A 1JRBA 5A2CA 3EOOA 4QX4A 3BW3A 3TMLA 1IGWA 1SO4A 3H2MA 1XIHA 4O0QA 2WC3A 5FEZA 2ONEA 4DJDC 2FTPA 3VU2A 3V0UA 3W22A 4PMOA 3M43A 1LLWA 4ENLA 1C8XA 4Z0SA 1XKYA 3SUSA 4A4AA 1KV5A 2OELA 1DJIA 3G77A 1NQ6A 1YTKA 3QPEA 1U5JA 3V5OA 1GOKA 4B5SA 4FX7A 3WD0A 1SR9A 4PMRA 4F9JA 3GNOA 5EBAA 3WDQA 2IKGA 3OVPA 3VC6A 4RW3A 1KTCA 4B5UA 1E73M 2B31A 3SSJA 4EOUA 3QLDA 3F4CA 1ITQA 4JTEA 5M17A 2J6VA 3JW7A 1GVFA 1K4HA 4GYKA 1TIMA 4FA3A 4QAWA 2XGIA 4OWGA 2Y7GA 1EJXC 2J9XA 2PGRA 1LT7A 1O68A 4AZHA 3LCFA 2ZUVA 3UPMA 5FKYA 4X3ZA 4TU1A 1GTEA 4RXGA 3UT0A 1X96A 3BLIA 3RLGA 4AY7A 2AMXA 1XLEA 3H7UA 5HWMA 3CIWA 3VIGA 3M0IA 3QQ1A 1BYBA 3KDOA 2XDFA 2AQVA 4K8EA 3KCOA 3RCYA 1DVJA 1F3XA 2RGMA 1PPIA 1LUCA 1ZJHA 1Q6OA 5LZLA 3P8JA 1KXHA 5LIWX 5E70A 1J5TA 1V0NA 5E0CA 5ABTA 2E77A 3CUJA 1GHSA 1UR8A 1GVRA 1US2A 2ZUSA 2HK0A 2YPIA 1IZCA 4PTVA 4HVXA 1YE6A 3WMLA 3DC0A 1WKYA 4WD0A 5M1TA 4UTMA 4P7OA 4GIAA 3VIOA 4HK7A 1YW1A 4IXHA 4DXKA 1SR0A 3GC2A 3IACA 1XDLA 3CUXA 2YZRA 5D30A 4PCPA 4AD1A 4H9UA 4PE8A 1QNOA 1PHWA 4I9TA 3L12A 1SW0A 3NEHA 5B80A 1KA9F 4Z2KA 3NL2A 1E0WA 3DGRA 3KAOA 5T9CE 1HL9A 3K4AA 1EOKA 3UZWA 3J7HA 3LCXA 7A3HA 4PEEA 4N6FA 1PTDA 2QMJA 1VS1A 2QCHA 3CC1A 3TYEA 3APGA 3PBYA 1NAL1 1ZU8A 1NOWA 2ZVIA 4TX9A 5TD4A 3T0BA 3F03K 4O15A 1G94A 1XUZA 4MMWA 3UJ2A 2EPNA 4ZGYA 2QUTA 1Q6DA 4UC5A 3W86A 2YCLA 4PMYA 3CTLA 4QG6A 3MJYA 1E4MM 1NDYA 1QW8A 4GJJA 3C56A 1XD1A 1PZ3A 3MVTA 1ODUA 3VKKA 5MF5A 1G4PA 4HIBA 3MBFA 2VVNA 2PRHA 4O4VA 2VOTA 5A6SA 3GW3A 1WPCA 3MZNA 3UPBA 4U3AA 4DI8A 2FJKA 1GG1A 1DQXA 1RD5A 1FWHC 3W9ZA 5C5YA 1TZ7A 3R8GA 1M68A 5CC5A 3SFWA 4GQQA 2NQZA 3NDZA 5CGQA 1UP0A 4UOQA 4GH1A 4PYSA 4NT0A 1FWBC 2ACQA 1AD4A 2Y89A 2WVVA 4Y2WA 2W66A 1GOOA 4IPJA 2Y63A 3MA8A 4H2CA 1CXFA 4NZ1A 4FNTA 2CETA 1R3WA 1U5HA 5KEZA 4EXQA 4QS5A 2NW0A 4F0LA 5AHIA 5JIWA 3JRKA 4UZSA 2IXVA 2DFAA 3WQPA 4MKVA 4R7WA 2VD8A 3WYZA 2GGHA 4W85A 1XJBA 4GQRA 5D2WA 1P7TB 3ABRA 4GC3A 5BMWA 2OWCA 2D22A 3S1GA 2CKSA 3WQGA 4AZIA 3OZOA 3CQJA 3TOYA 3T6CA 4Z2IA 3AXKA 1X1ZA 2DT3A 2D1ZA 4LFYA 3AS0A 4HHHA 3B05A 3NZGA 2FB3A 2A1YA 2TMDA 3W1AA 1M7OA 2DU2A 1K7EA 2FVKA 3UESA 2VI0A 2EO7A 3RDKA 4GYPC 1IT0A 4PSRA 4WDXA 3TTSA 2W3ZA 2TSYA 5F4WA 3VK5A 3HPZA 4QE5A 1N2VA 4U4MA 3AMKA 1SMDA 3IIZA 2DJLA 1VR6A 4DWDA 4P8UA 3AXIA 3L66A 1Q6FA 1EXBA 2XINA 4AIBA 3EA1A 2X1SA 4UFKA 3IUDA 5FI8A 2XIOA 1UR0A 4NZFA 4QR6A 1AW5A 1CLVA 2DIKA 5H8UA 3SZ8A 2CLKA 3FSUA 3VCNA 1KXVA 1UJPA 3IJ6A 4A21A 3FHAA 1H63A 4A2RA 4IP7A 1J96A 4KRTA 4LYPA 1BG9A 2WLYA 4F2UA 1G6CA 4XD4A 4DPQA 1JZ6A 3OOQA 2PMQA 2QCLA 3I6EA 3BSHA 1HKVA 3BUVA 3HMCA 1EF2A 3R5EA 1B3XA 4QFUA 6CGTA 3GK0A 4Q33A 1K8XA 3AS1A 3OW1A 4WGXA 3CZLA 3KHDA 3C2EA 5EMMA 2BOGX 1XGEA 4FMVA 2CCRA 3PBMA 1B3VA 1EH9A 4EWJA 2ZTKA 2A3LA 4NI8A 1EZWA 4O1FA 1QAPA 4Q7NA 3BPWA 2FLIA 4QG8A 4K68A 5BRPA 2I9UA 3RITA 3LHZA 3RMEA 1Z44A 4E3VA 1IXOA 3MHUA 7REQB 1HW6A 3MBDA 3S3GA 1JPHA 3W1UA 2BGSA 2XH4A 5REQA 3A21A 3SGGA 3TWAA 1FWCC 2DH2A 4AWSA 1YIXA 3ZO9A 2GWGA 2CZFA 4UXDA 3QSTA 1TPUA 1FCQA 3R12A 4S3CA 3ITXA 5DX7A 3AI0A 4IL0A 2VZSA 5C9UA 2GDUA 1R87A 2Y8UA 2Y7FA 1J5SA 2WJFA 1WZLA 5SWUA 6ENLA 4LUTB 3GZ3A 3F7JA 1DV7A 4YLWA 3W01A 1DKWA 3M6DA 3ALGA 3UNDA 1XIJA 1IEWA 5T91A 3NVTA 2PF8A 4E2BA 4GY7A 1ZBWA 4L5ZA 4HZ8A 1EXPA 2GGJA 1X8CA 1EC7A 3NURA 3O6AA 4IICA 1PX3A 4K8HA 1I2NA 4IIBA 4HPGA 1QO2A 2NVCA 2GUBA 3I3DA 3BXWA 3BG5A 4KQNA 2RKXA 4JTFA 2DV0A 2ZDSA 1FWWA 4RNHA 3BLFA 4IT1A 3M44A 2DIEA 4AQLA 2HS6A 4HU8A 4W5UA 3BLDA 1NFPA 4IMDA 4KS0A 2PZNA 3LV6A 4D2JA 1EO5A 3NSNA 1F76A 3DC8A 1J2BA 1G1YA 2J7HA 3TJXA 4R34A 4TQTA 5AC5A 1WZKA 3W2NA 1GVOA 1T99A 3ECQA 4MY8A 3ZT5A 1T6MA 3VGEA 3CQKA 1SW3A 3BTNA 1I1WA 1KM4A 4GO8A 5I79A 3C0QA 4L65A 1MSSA 3T09A 4AD3A 1GKQA 1AK5A 1JG9A 3GVWA 3UWEA 1DJGA 1D8WA 2V5DA 4HK5A 2ZFAA 3KBSA 1XH2A 4RE4A 3I6RA 4TOQA 3H2OA 3MU7A 2FZNA 1KCXA 2Y6ZA 3FFSA 4PRRA 4NG3A 4JS3A 3W1PA 3MW7A 4AFYA 4LW7A 5K7JA 2R1KA 3C3UA 2FGBA 4OQVA 2J79A 1Q6EA 3I10A 2CXEA 4LBSA 1K77A 1EP3A 3CWHA 1EIBA 3TDFA 1BVZA 4QDMA 3HG4A 3WFAA 2OWWA 4JIIX 1H0IA 3DKLA 1R9ZA 4JIPA 2EHHA 1H49A 2ESCA 1JCYA 3AXXA 3IK4A 5CZJA 4F2BA 1OABA 3TX9A 4Q4SA 1YHTA 1XLLA 2OQHA 3L0KA 4RX0A 1J9YA 2R1LA 1DPMA 2DZVA 1RUSA 3WK3A 1XBVA 3PAJA 5LNWA 4LTSA 3GS6A 1PX4A 2WJEA 4IMCA 4MFEA 3SDOA 1Z8AA 4WK9A 3OZMA 3QPZA 5HPOA 4PCFA 4RK8A 3CYJA 2BDQA 1A3XA 1JCNA 5IOBA 4Q3MA 2GVYA 4ZO7A 1WDDA 4XTIA 3CUZA 1TMQA 1AMYA 4GJIA 3HGOA 3TN6A 3EOLA 1C9DA 4PUWA 1V3HA 1W5OA 3MI3A 3LNMA 4YHGA 1VFUA 3FVMA 1EGVA 2X1UA 4HHLA 1IWBA 2WMFA 2J77A 3RIKA 2OSWA 3FDKA 3Q94A 3IJQA 4ORMA 2A85A 2BY3A 3C3NA 5EKYA 3IV3A 4CLMA 4QJ5B 4FLSA 2X0HA 1M5WA 4B5WA 4HU0A 1UZ1A 2JEPA 2ICSA 2VT0A 1A4LA 3KVLA 2QDEA 4U33A 2A6LA 2I56A 4S23A 3AUOA 5AC6A 3LG3A 3U2CA 2P8BA 1EZ2A 4C7FA 4M1BA 2XJ7A 3DGBA 3W07A 4IX2A 4O13A 3RLVA 5CG0A 2QVNA 2AGTA 2ZA2A 1FDZA 5G2HA 3TNOA 1QPOA 1ZAHA 2DW6A 5HNUA 2W9MA 5EPDA 3DFTA 3C0LA 3W53A 1FXPA 3M0ZA 5AC8A 3H22A 5BW6A 3O0FA 4US6A 3NUKA 1LG1A 1S2WA 4S39A 5AHEA 3PG9A 3K4DA 4BY3A 1MW2A 4DI9A 2OYLA 2QULA 2QEZA 2Y70A 1CBGA 1MDLA 3HA1A 5JH1A 4JTRA 3CXOA 3I65A <