1LWIA

3-alpha-hydroxysteroid/dihydrodiol dehydrogenase from rattus norvegicus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
311
structure length
305
Chain Sequence
b'MDSISLRVALNDGNFIPVLGFGTTVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
publication title Structure of 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase complexed with NADP+.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 111
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1996-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lwiA00
1RY8A 2IQ0A 3FJNA 1X98A 4XZMX 4H7CA 3UGRA 2PDYA 1Q13A 2HEJA 1ADSA 4XZNX 1MRQA 4QBXA 1J96A 1S1RA 1OG6A 5LIKX 4GA8A 2HV5A 2FVLA 4GABA 3GHTA 2VDGA 4XK2A 2F2KA 1Z89A 1YE6A 4ASTA 2PDLA 2P5NA 2QXWA 3R6IA 1R38A 3UFYA 2A79A 4DZ5A 4PUWA 2FZ9A 4LB4A 4H8NA 3WBXA 1AH4A 1S2CA 1A80A 1XGDA 1Z3NA 4AUBA 3EB4A 3LUTA 1QWKA 4WEVX 4PRRA 3LQLA 1Z8AA 5LIXX 1YNPA 1AH0A 4IJRA 4JTQA 3CV6A 4LBSA 4L1XA 2PDPA 4LBRA 4PRTA 2PDCA 1LWIA 2ACSA 3LBOA 1VP5A 4WRHA 5LIYX 1S1PA 3R94A 4HBKA 3H4GA 3P2VA 1JEZA 2ACUA 4YVPA 2PDFA 4GQ0A 3DOPA 4G5DA 3EAUA 4L1WA 1ZUAX 1EKOA 3WG6A 2PDNA 2ISFA 4MHBA 2PDBA 2FGBA 3R8GA 1GVEA 3GUGA 3V36A 4XVEA 5LIUX 3RX3A 2PDQA 2DV0A 4XZLX 2IKGA 4GACA 3CASA 2BGSA 3UZWA 2AGTA 2WZTA 4FA3A 4JIRA 2IPWA 4LAUA 3V0SA 3F7JA 4PUUA 4Q7BA 2PEVA 3VXGA 1ZGDA 2HVNA 3R8HA 3N2TA 3T42A 1C9WA 2PDJA 1VBJA 4XZHA 1XF0A 5HNUA 5C7HA 3UWEA 2HVOA 4XO6A 4JTAA 4JTDA 4YS1A 3UZXA 4JIIX 4DBUA 2PDGA 1S2AA 2F38A 1QRQA 3CAVA 2ALRA 1PYFA 1YNQA 1IEIA 2IKJA 2PF8A 1PZ0A 1RY0A 4YVXA 3DN5A 1PWLA 5DANA 4WDWA 5HA7A 2BP1A 1X96A 4JTRA 1EXBA 3ONBA 1SM9A 4Q3MA 1Q5MA 2FZDA 2J8TA 3M4HA 1T40A 1AZ1A 4QXIA 5JH1A 3MC5A 3KRBA 2CLPA 1HQTA 4LB3A 4ICCX 3UG8A 4EXBA 2PD9A 2PDKA 1MZRA 2HE5A 1YE4A 1K8CA 2IPFA 2NVCA 3LEPA 4EXAA 3M64A 2HE8A 3H7UA 3QKZA 2PDHA 4JQAA 4JTCA 3V35A 3N6QA 3U2CA 3G1RA 2PD5A 4GCAA 1AZ2A 4XZIA 4RPQA 2BGQA 3O3RA 1UR3M 2HDJA 4ZFCA 3B3DA 3UZZA 2WZMA 4FZIA 1PZ1A 1EF3A 2IPGA 3V0TA 3WCZA 1ZSXA 2IKHA 3GHUA 2DUXA 4GIEA 2PZNA 4PMJA 4YVVA 3LZ3A 4JQ1A 4YU1A 4WDXA 2ACRA 3LD5A 4IGSA 1X97A 3BCJA 2PDUA 4XO7A 1HW6A 3ERPA 3R7MA 1ZQ5A 4FALA 1M9HA 1AH3A 3O0KA 2PDIA 1RALA 2IKIA 3GHSA 1Z9AA 3NTYA 3Q65A 3EB3A 4LAZA 1FRBA 5AZ0A 2INEA 3GHRA 3LNMA 4F40A 2IS7A 2NVDA 3C3UA 3D3FA 3CAQA 2R24A 4XAPA 3RX2A 5M2FX 3LN3A 3FX4A 3BV7A 4DBWA 4OTKA 4WGHA 2IPJA 2FZBA 2I17A 4R9OA 2I16A 2PDXA 2INZA 4GQGA 2PFHA 3Q67A 5KETA 1PWMA 1XJBA 4NKCA 3BURA 2R9RA 5JH2A 2ACQA 5HNTA 4QR6A 2DUZA 4DBSA 3WBWA 3H7RA 3R58A 4XVDA 3ONCA 1IHIA 2FZ8A 3M0IA 4JQ4A 3LZ5A 1MI3A 3UZYA 3WBYA 2PDMA 5AZ1A 4JQ3A 3CMFA 3LQGA 2C91A 4WDTA 3MB9A 2PDWA 1T41A 3RX4A 3COTA 4JIHA 3G5EA 4IJCA 4HMNA 4WDUA 4QX4A 3CV7A 4PR4A 3R43A 1US0A 3UYIA 4FAMA 3BUVA 1EL3A 3LENA 3S3GA 1LQAA 1AFSA 4I5XA 4JQ2A 3V0UA 2IQDA 3UP8A 5LIWX
chains in the Genus database with same CATH superfamily
3MCMA 2FLIA 3N15A 3FJNA 3BGAA 1W3LA 4GGHA 3NA8A 4B5NA 3RLHA 3NQGA 1OF6A 1Q13A 1QNPA 4DZHA 3EEGA 3E3HA 4XISA 3KVKA 1BYCA 2WC4A 3S1VA 3PZ9A 5FF0A 3W6MA 1BHGA 1TFVA 1EZWA 2OODA 1R3VA 2YLAA 3E5PA 1FX6A 3B9NA 4HYVA 3S47A 3CZJA 2ZZ1A 3P84A 4CQ9A 5L6UA 3WLOA 3DDMA 4NHVA 1R38A 2NLIA 1A5UA 3DBPA 1W1YA 2BVDA 3AMCA 1OHLA 3VIKA 1VLWA 3UXDA 2D2JA 3SZ8A 4GIRA 3C56A 1GOMA 2Q71A 2GSHA 3H55A 1XWYA 3KZSA 3RO8A 4C6MA 4E4PA 2YBTA 1WOBA 3QTGA 1JG9A 1KM4A 2OQYA 1JD7A 3HQOA 2C71A 3SDOA 1PTDA 3H53A 3G3DA 3JU2A 4XKYB 2DT1A 2G3MA 1O5RA 3LQLA 2DZSA 3C4UA 3NJ3A 2YFOA 1I2QA 4LBSA 3P93A 3WZ0E 3RYSA 1B2YA 5A94A 4NJKA 1TJRA 4JY9A 1V77A 1XLEA 2I57A 4ZQRA 4HA4A 3L68A 1X6UA 2XPKA 1QI3A 1F05A 1CLXA 4A3YA 3TK7A 4O0QA 1TMHA 2PWHA 1QATA 4NP7A 3TJ4A 2J7FA 1TPEA 4W5UA 3GU9A 1XBVA 3WDPP 2C3ZA 2VOMA 1QAPA 4DQWA 5DT7A 3NL6A 1LCOA 3NG3A 5K7JA 3BTNA 3W7KA 4C91A 2OEMA 4GVHA 5HPOA 3JW7A 3WLKX 3G6LA 1PKNA 4IGNA 2W27A 1VFLA 4DAIA 4S3GA 5I79A 3CLWA 3MA8A 4Q8MA 5CZJA 3VIJA 2QPUA 1VBJA 4QLJA 2C1HA 1W6TA 5K9XA 4F0HA 5H91A 4JNYA 4XO6A 4HJWA 4K2SA 3A24A 1AJ2A 1MYRA 3FDKA 1FVPA 3NL5A 5KZ6A 4ERAA 2HCVA 2A7RA 3QGAC 3HTWA 5AHNA 3ZT5A 3BAYA 4ZEPA 1PZ0A 2VEIA 4L6HA 5HJLA 1XLMA 3WDHA 1ME9A 1L6SA 4MPQA 4JTRA 3SQLA 2X16A 1TV4A 2E9MA 3RMEA 3ZMRA 2EPLX 2XFRA 1FWTA 6XIMA 2Z2UA 3GTHA 2J8TA 4LW7A 5LA2A 3AU6A 3SQMA 5AVHA 3LCHA 4P8UA 4F2BA 3S9IA 3V5OA 2JGQA 4M7SA 4ICNA 3AIQA 5JU6A 2XIQA 3CQIA 3W72A 2B0MA 4KFPA 3D5HA 4P7OA 4CQDA 1BLIA 1FCUA 2YCLA 4CNSA 1E56A 2O9TA 4JQAA 1C8YA 2VEPA 1GTHA 3V35A 1EUAA 5C9UA 1UP0A 3F4CA 3IJ9A 3LTSA 4XZIA 5D2XA 1KKRA 3BG9A 3WLPA 1KR1A 4R7WA 3ES7A 1PAMA 1BPLB 1OYBA 2E8YA 2AL2A 2V38A 3ZIZA 4FXSA 1A5NC 4F2TA 3N2BA 1EQPA 1REQB 3PS7A 5GJPA 1TJPA 3IJ8A 3TN6A 3EX4A 4LY4A 3HOJA 3OLDA 3VO0A 2ZYFA 3MV01 1WAWA 3U5UA 5AHIA 4U10A 1V0KA 1VQTA 3VI2A 1F76A 3T4CA 1H62A 4HHLA 3QC0A 4JTEA 3VDBA 3T0CA 1XLHA 2POZA 1UD6A 1R2RA 1A0EA 3AMKA 2ZRYA 4OBSA 1NQKA 3VIHA 4K68A 2IKIA 3VA8A 3PSWA 3IUDA 1KM1A 1PIFA 2JEQA 1XIFA 2E6DA 1NP0A 2XM2A 1A5CA 4N9DA 1JZ3A 3LI0A 2W62A 3T2OA 4O0ZA 4H9TA 1A4MA 2DQXA 3MKKA 4W7WA 1UUMA 3KCLA 1B30A 5M2FX 4LFYA 1SJCA 3BZJA 1RBOB 3OG3A 2FZBA 1BEUA 1PO9A 2ZFAA 4A2RA 1DJQA 1KCXA 4UWMA 1FWSA 2H90A 3S2CA 1CWYA 3BURA 3W2MA 5C6MA 4O54A 3ZO9A 4HPXA 2ZZ7A 4QR6A 4H2CA 3MI6A 1Q6DA 2BOEX 2R94A 2OWXA 1XFCA 2FJUB 1CNVA 1GONA 2RFGA 2XH0A 1WDDA 4CLMA 4PE8A 3MKVA 3FSTA 1CTNA 4JTIA 5HPCA 1LROA 3TQPA 3AYTA 2XINA 1XIMA 1K03A 1Q4NX 3T9PA 2V5BA 3PJUA 4AIUA 2PDMA 3IWPA 1UIOA 1TTPA 1ZAIA 3NQCA 4XD3A 1L6FA 1T41A 2X0SA 2O4MA 3AXMA 1MUMA 2FPTA 3QW3A 1H7RA 4I7WA 3H2NA 3II1A 1D8WA 3AALA 6XIAA 2AMGA 3HPFA 2HJPA 1LJYA 2NX1A 2B7NA 1QOPA 1OT1A 5E70A 4QJ3B 1ZP3A 4C1LA 1HO1A 3AIVA 1DL3A 1YKWA 3SCVA 3DGRA 5I06A 4B9YA 5BZAA 2EKCA 3CYVA 4WXZA 4FS9A 4DAFA 1J0JA 5DMNA 3SW6A 3IK4A 3PUEA 1XGEA 1TMQA 4ZMGA 3H21A 1L0PA 3I7SA 3WQCA 1EO5A 2W3ZA 1H2JA 4MAZA 5M03A 1OGBA 3MYOA 4HHPA 4M51A 1FHVA 4S2CA 4NAEA 1TRDA 2VX4A 2WNZA 3PVFA 1EJXC 1ZBCA 2FZ9A 5E6YA 3TQKA 3U2EA 2I5GA 4PN2A 5J5DA 3KZPA 1FY6A 1WA3A 3K46A 1P1XA 5GNXA 4BEQA 3TH6A 3ARZA 2NUWA 3PTDA 3WK3A 2QUUA 3S2MA 4A3RA 4M6PA 2BDQA 4K38A 1Z3NA 3MUAA 2Y1HA 1P6BA 2VX5A 3AUJA 3CV6A 1UR9A 4N9EA 1NY1A 1X7IA 1NDYA 5LNRA 2AQWA 3VILA 4QFUA 2J7CA 4KCTA 3ARPA 2YL5A 1AUSL 4H6KA 1GYNA 2GGHA 3H12A 2NV2A 3C2OA 4AZGA 2XH7A 3AISA 4G7EA 4AZCA 1WZKA 3WO8A 3PPCA 4IQLA 4F79A 3BV4A 4L6OA 4HU0A 3SCRA 4O10A 3AUOA 1YMYA 2EG6A 4MKNA 3EAUA 1VF8A 1NWSA 3WG6A 4GUFA 4MHBA 3FHAA 3HMJG 1IXOA 2J4GA 1W9PA 4MB4A 4FB7A 4UQBA 3MQTA 1GZGA 3QMRA 1DE6A 1RVKA 3PFRA 4JL1A 1G94A 2ZQ0A 3T2PA 1TWDA 1XCWA 2DZPA 2FTYA 3UZWA 4YYCA 3N3TA 4KFOA 5AVNA 1GORA 3NVTA 5CZSA 3VD4A 1ZGDA 4NF7A 3M7WA 4WOQA 1C9WA 4PTMA 2ICSA 1JCLA 4Y96A 5C7HA 1JZ5A 4XAFA 3I4EA 3RO6A 1QO2A 5AOUA 3DUGA 3W1MA 3HN3A 4Z2JA 4IF2A 3GO2A 1ZFJA 3S6TA 1W31A 5CCZA 1DWIM 1QRQA 4WCJA 3CAVA 1JF6A 4PL1A 5DXYA 1A5SA 4ZE5A 1NEYA 4KEMA 1FWIC 1BQGA 3EEZA 4S3EA 3N6HA 2PF0A 4JTJA 1CGYA 3EOUA 4HCHA 1KFWA 3R13A 2I14A 3URBA 2QJNA 4DJFA 2OSWA 4D9PA 4H6RA 4MG4A 5CLWA 6PTDA 4YPJA 4JKKA 2P76A 2E25A 1AZ1A 3UWVA 1GEHA 4YIWA 3O1NA 3GSMA 4JYEA 5I02A 2QDGA 8A3HA 2EAWA 3G24A 2XN1A 3QV7A 4QLLA 1W3IA 3T1GA 3TOYA 1J0HA 2ABBA 1FP9A 2CERA 2XIIA 3AXXA 3N13A 3W84A 2J9ZA 1Q4WA 3TAKA 4J28A 3KBVA 3CT7A 3DHPA 2Y8KA 4S23A 3HF3A 4KQNA 2G3NA 4O4WA 4DF1A 4UTHA 4H9UA 5D30A 2VZTA 1ZHAA 3VKCA 4D6CA 3AMGA 1XRTA 2E40A 4GY0A 1WAUA 1SGJA 1E6RA 1Q2RA 3KL0A 1ZJBA 4AZBA 4I6VA 1HN1A 2HXTA 5T9CE 4ZFMA 3B3DA 3UR5A 2ISDA 3N9KA 1J4EA 3TNOA 4MWAD 3UQNA 4HHMA 4MWAB 1BG4A 3F5JA 4AISA 1ZSXA 5AYIA 3QOKA 1KV5A 4C1NA 2F2HA 4YVVA 2QCDA 3B4UA 3GIQA 4FPSA 4MNKA 7CGTA 4JQ1A 2EJ1A 4QG8A 3H26A 3B8UA 3DFQA 1ZLPA 4GFIA 3BQ6A 2VR4A 1VPXA 1EPVA 2AKZA 1CB7B 1UA7A 4P61A 1E3XA 2YB1A 5J8LA 1QPRA 5KSWA 2HS6A 1E1EA 4C6NA 2EPKX 1YDYA 2EXOA 1XXXA 4QQUA 1ZJHA 2UWFA 3EB3A 4NI3A 4NT0A 1LG2A 1SSDA 3WEZA 3P80A 3ARRA 3NGJA 1IR2A 2V5DA 1CZ1A 3QKEA 4JYDA 4V1XA 3BLEA 4TVCA 1EJVC 1X1NA 4DBWA 5CBBA 1EP2A 2IPJA 4JTFA 4K3ZA 3RN6A 2RJGA 4LUSA 1SW3A 3G2GA 3AHVA 3G18A 3U0HA 1H0IA 3LXAA 3N4EA 4AH7A 1IT0A 3TN4A 4BKNA 3BL3A 1W91A 1UUOA 2ZX5A 2VC7A 5D9MA 1TPWA 3LCWA 1AQHA 1EQCA 1NDVA 1ADOA 1L6YA 2PCEA 4AEOA 2HPIA 1XYMA 6TIMA 4JQ4A 2IQTA 3F4DA 3MWAA 3P74A 2QT3A 2A2IA 4HPNA 1CXKA 1TPFA 2GVLA 1PTAA 4R85A 1F6PA 1BYDA 5HOSA 3COTA 4FXRA 3G5EA 1R3TA 5A2AA 3VFLA 3ZYZA 1F8IA 1HL2A 2VMFA 1U5HA 1DXIA 3EMQA 3G1FA 6ALDA 3G1DA 1AW1A 3W23A 1RVGA 2RH9A 1OC5A 2NT0A 4HNOA 1R3SA 1W1B1 3A5VA 3CHVA 3EKGA 1OC6A 1GOWA 1SZNA 5DCBA 4O18A 5KZEA 4O57A 5G4EA 1W1A1 4FF7A 5FAGA 4PTVA 1G9HA 4F3HA 3DX5A 4MYXA 1PIIA 1HP5A 4WY0B 2ZUTA 1OJXA 1G4TA 3GD6A 3CUFA 3S1WA 3TR2A 6ENLA 2F2KA 4UQDA 4KKXA 5I5RA 4ADTA 3R6IA 4FX8A 1I2PA 3VOGA 2CIPA 5TIMA 1POKA 4XD6A 1RA0A 4TTUA 9XIAA 4C7GA 2WM0A 4BQ4A 4U31A 3LHWA 4B15A 1MRAA 4GO8A 4NASA 3BMVA 1C3FA 3QZEA 5DEZA 2CHRA 2Y70A 3STFA 4Q4QA 4P7NA 1AH4A 1Q7MA 3C6CA 3R11A 5BXTA 1OX4B 5IHSA 3VIGA 3PB2A 4HU8A 1FWHC 1BRLA 4ZQMA 5G1YA 4U5IA 3SUTA 1X39A 1LRTA 3B05A 1TPC1 2V2CA 1V08A 3CT2A 3CL7A 4GVGA 2VZVA 4DO4A 1E0TA 3RM9A 1OGSA 4PTWA 4TMBA 1TTQA 4KERA 3NQ6A 3A3WA 1FCVA 3I10A 1XIEA 4OE7A 4GXWA 4BI6A 7TIMA 3W76A 3N18A 3AS2A 4XUYA 3G1VA 2PDFA 4UR7A 2QPXA 2J7DA 4LNCA 3HJZA 1W37A 1KFKA 4PTXA 4PUNA 1UQYA 1AL7A 1Q6QA 4DJDC 1WUFA 3LLFA 4XVEA 5LIUX 3W02A 2CBVA 1EGZA 4MOZA 1R9ZA 1ZCOA 4O8RA 4M8UA 1PL9A 4Z2IA 4JIRA 3CHCA 3BPWA 1KRAC 2H8XA 5JVLA 5DELA 3UVAA 4MY1A 5ABFA 5C0QA 3M1ZA 3OG2A 2J6VA 2PDJA 3OEXA 3NAVA 1ZPTA 3NDYA 3URQA 1BYAA 4HNUA 3LGGA 2GVJA 4NJIA 5FJIA 4A05A 1H61A 3WQ5A 3QFEA 3MVIA 3ZWTA 2Y5EA 1MNZA 2ABAA 3M41A 2OLSA 3L4YA 3Q94A 1IEIA 3EXSA 4PMVA 2WQPA 3N2CA 3WBAA 4AWTA 4DB7A 3NQ8A 2PPGA 4YVXA 3LS9A 3DN5A 1YLVA 1NFBA 1CECA 3P0WA 1HZYA 1XL9A 2VP8A 4X0NA 4Y6GA 3NM1A 4K7VA 1MEWA 2XUCA 2ZXQA 3VPLA 1AK5A 3ZOAA 1QW9A 3TN5A 2WMIB 2D1ZA 1FCQA 1JCNA 3MC5A 3EA3A 5FL1A 2VFGA 3QV8A 1X8FA 1CLKA 2RDWA 2XG9A 3S5YA 1AMYA 3LG3A 3WK2A 3F4NA 3KWSA 5REQB 1EJUC 4JX4A 1WZMA 3WIJA 4AIEA 3MUIA 1YE4A 2WLZA 2FMNA 4FLOA 3S9YA 3IV3A 3QOMA 1LUCB 3W7GA 2IPFA 2VR5A 4W88A 3FAWA 5CGMA 5D2YA 3KLLA 2QCFA 4A3UA 1GKRA 4E2DA 1ZBVA 4PFHA 2CZFA 1TSIA 2VDHA 4M7TA 3PR2A 2XU2A 2BZNA 3VDGA 4P8VA 3ELFA 5C54A 1YPFA 1J9YA 1BKSA 1EBGA 3KM8A 1R2SA 3K4WA 1UOKA 3VC6A 5HANA 3WF2A 2ZOXA 4A3QA 2HRWA 4IGSA 3R0DA 5C9RA 1ECEA 5A3HA 4DYKA 2PWUA 4AC1X 4AWUA 4HD5A 5D03A 2EF9A 1Z48A 1JDCA 1NWTA 1QUMA 4HCDA 4GYPA 2NV9A 3WUEA 2G3IA 4ZB5A 5G2IA 2PWEA 3TX9A 3UR8A 3HZ3A 4CQBA 1EDTA 3FYOA 4IM4A 4NAFB 3DHDA 4PUJA 5A95A 1S46A 4X22A 4H2HA 3HBLA 2FVMA 2OX4A 1GOXA 1W56A 4RE4A 5A6BD 1H7WA 1LBMA 4ZVJA 4FR6A 5DF0A 2CYGA 3ITYA 5AHFA 5KINA 1VFOA 5DMLA 3TOPA 4DYEA 2PFHA 3GR8A 4HSNA 4GYFA 4QG6A 3VGGA 2G37A 5HNTA 3TTOA 2DSVA 1R30A 4FX7A 2VELA 3R12A 2X7VA 1LBLA 4P7LA 1VEMA 1K02A 1M1BA 5DXXA 5I24A 2FVKA 2VC5A 4E3TA 1PKMA 4ZODA 3UEQA 2HTMA 2PTYA 2FZ8A 3M0IA 4DXXA 3O8AA 2QUNA 1FFQA 3F2BA 3WBYA 4QDPA 3W27A 4GX9A 2NSOA 1KFLA 4L9ZA 4WDTA 3MB9A 2ALDA 3HG4A 3NQDA 2XN2A 1EIBA 5JUVA 3T0BA 1F74A 4GNJA 4Y90A 2GL5A 3FCPA 1UKOA 1IEQA 2V69A 4GXPA 4XD5A 1F3EA 1R2TA 3GZAA 2Z1KA 1W1ZA 6REQB 3O6DA 3ZT7A 3CH9A 3VUSA 3B8VA 5CZ0A 1LF1A 3E38A 1QDSA 1MVYA 2XIMA 3CZEA 4PSPA 1SJAA 4EAMA 1W1PA 2PDYA 4BHYA 1EO7A 4B3KA 4LGXA 5CLTA 4NZ4A 3DBNA 2GJPA 3OJGA 4DJFD 4FK9A 4AU0A 4W93A 4I90A 1UA3A 2OQHA 2HV5A 4GABA 1IXNA 2OPJA 1J8VA 2PDLA 3KBSA 3VNKA 3M47A 4QP0A 2QXWA 1IXQA 4FO4A 2NWSA 3CMJA 2NSXA 4PUWA 2WVTA 4EE9A 3USBA 3PHAA 3PP7A 3MJMA 1IEWA 1VCGA 4QG9A 2Q02A 4YWIA 1DJXA 4HNNA 1QHPA 3CQHA 5DBTA 3VZYA 3W3OA 2GK1B 1JI2A 4Y8EA 1GVOA 2HISA 1V7YA 1Z8AA 4JTLA 1X7FA 3UWQA 3VOCA 2ZA1A 3OODA 4MADA 1M7XA 4JFSA 5I6SA 3C2FA 1A0DA 2W79A 1G69A 4PMRA 3NZPA 4DXVA 2J7GA 3GDTA 4WRHA 1FUYA 2H8ZA 3S46A 3P2VA 5EA9A 1UKQA 2A3CA 2OO6A 4N4PA 4R27A 2XDFA 3I68A 2VCBA 1GQLA 1KGXA 1R3YA 3Q45A 3NEHA 2DY3A 1YXYA 1XIIA 5FJUA 1NTHA 1VJIA 3CZ8A 1Q8AA 3LSCA 4LF2A 4ADSA 3NZ1A 4MJZA 4G9PA 3A12A 3W1RA 3U5YA 2OO0A 2DVTA 3CNYA 4XZLX 4A35A 1XDJA 4F0RA 4P7QA 3CGTA 5ABEA 3F7JA 4PUUA 3JR2A 4Q7BA 1GGOA 4O4VA 1CB2A 2VCAA 3W85A 4OBTA 4PMOA 3BH4A 4KESA 4KRZA 4AC7C 4QAWA 3VGFA 3AICA 2D24A 2INFA 1ONXA 1ZZMA 1QNSA 3AS1A 4DWSD 1PPIA 3EOLA 2I5IA 3VYLA 2E77A 4DWSB 1EP1A 2WV8A 3QFWA 4CVWA 1OFOA 4JTDA 3AOFA 3GX9A 3MMUA 4AD1A 1A3WA 1GJPA 4GK8A 2IXUA 3OZMA 1RLDA 3K13A 3W01A 3ZM8A 4NNAA 3WJWA 4RZ6A 4GUHA 2MNRA 1GJWA 2FH8A 1DPMA 3K8KA 1L9WA 3GB6A 2Z2AA 1YBQA 1RCQA 3RIKA 1TA3A 3BAIA 5U7SA 5D32A 1PS9A 4IG2B 2YYUA 2ZWZA 3TJXA 4L4MA 3WLLA 3OVRA 3MSRA 3ONBA 2P1FA 3H4WA 2VI0A 1M7JA 1W1TA 2VFIA 2QJMA 3T2QA 2FZDA 3UWWA 1S38A 1G0CA 5ABTA 3RAOA 4CU7A 5C9XA 3STEA 4DNMA 2P8BA 3OIHA 8RUCA 3RUBL 4ICCX 3SGUA 1I8JA 1US3A 3UPWA 2PD9A 2O55A 1V6VA 3GTXA 1VJSA 4ACZA 2J27A 2YFNA 3FDGA 2VUYA 1LM1A 1N8FA 3N6QA 4EPBC 1OINA 3H2AA 4MZ1A 2DZUA 2Y0FA 3B9OA 3LM3A 3N12A 3NUKA 1H11A 4GC3A 3TZNA 1K8XA 3P5ZA 2I9EA 3NPWA 3NR0A 2YX0A 3L67A 5D9NA 1P0DA 4MM1A 4BCEA 2H3DA 3H4XA 4U5KA 3N34A 4PMZA 1LZOA 4Z1CA 1Q6LA 4QISA 1O4UA 5HJXA 1GVQA 2CWNA 4Q8VA 3PAJA 2PP0A 2XH4A 2FHCA 1EDGA 2Z0IA 1I60A 2Y8UA 5CSSA 2C6QA 1OF8A 3VMPA 1JULA 1QW7A 1RBLA 4I9TA 5HNNA 1A5AA 3CWNA 3VNJA 1H5YA 1ZNNA 4FLSA 4KH2A 3AU2A 4R7OA 2HK0A 1AH3A 3LHVA 2HS8A 4D6EA 3NQFA 2XVNA 2WHLA 1RAKA 2JQXA 1EHAA 3IUHA 2J47A 3EDFA 3TMQA 1RR2A 4DWDA 5IFPA 4LAZA 4YCOA 1TREA 3LXBA 1UD3A 1IWBA 1TUFA 2IS7A 1JUBA 3OBKA 1BXBA 4K8EA 1UB3A 2R24A 3WK0A 4GC4A 2O92A 2GGIA 1OX6A 4AF0A 1HJVA 4PUDA 5ENLA 2O56A 2ZX9A 3QHNA 4R9OA 3E9AA 1YX1A 2PDXA 3W28A 5AYYA 3DYMA 3VDCA 3WMCA 4A8IA 1E6XM 4E8GA 3GC2A 5BRQA 4Q8WA 5J04A 1XLDA 4C6JA 1A53A 3DG7A 2WNNA 2YB4A 2NX9A 1EOMA 3SRHA 2D2GA 5HQEA 3WFAA 3P67A 3ABSA 1ONRA 5FF2A 1H5VA 5A5WA 1GCYA 3AC0A 3DEQA 1NF0A 1QCWA 1W2PA 1U5JA 1Q6EA 2Z7GA 2QUMA 4OHQA 3S2LA 4AZIA 1WXZA 4AXNA 3B8WA 1LOQA 2ONEA 3W29A 4JHMA 4S3DA 2ON3A 1XX1A 2C8NA 4QIUA 1G4EA 4NXKA 4EANA 4TQTA 4P8XA 1FWCC 4J9JA 4L6DA 1D8CA 4IIEA 4GISA 2DT3A 4HPGA 3O6YX 4W85A 3EYPA 4Q8UA 2VQTA 3G0SA 2F61A 1PHQA 3W1NA 3OVGA 3Q4DA 4KGJA 1QPKA 2A21A 3FKKA 4CN6A 4JFTA 2Y4SA 2E5BA 3WF4A 1IQ8A 3WD2A 1YW1A 1S1RA 4ERGA 1LYXA 1TJ2A 4D6FA 4H9XA 2VGFA 1E9YB 4DJDA 3GHTA 3G1HA 2PAJA 2YCIX 4YLWA 1KWGA 5XIAA 1FWWA 3R2GA 3A64A 3EWYA 4KEUA 1WKYA 1KRMA 3PB0A 1OFBA 1DOSA 4O15A 4M29A 4V27A 3QMTA 2ZVRA 3RU6A 3MW7A 4TVUA 3T05A 1FCBA 4RNJA 2CWXA 4S3JA 1MWOA 1RXOB 2E3ZA 4MDPA 3I3BA 2FTWA 5M17A 1EGMA 3QPZA 1TVPA 1FDJA 4RDZA 1P0BA 5MKGB 5CPQA 1PHWA 3A4WA 3GRIA 1RV8A 4MKVA 3RFAA 1FH8A 2BG5A 2ZC1A 3L7RA 4UXDA 2OGJA 5M3WA 4ZSTA 4HNCA 1XLAA 4GVIA 3MANA 1Q6CA 4Z42C 4AVFA 2WSKA 1QI5A 3B8IA 1JIBA 1A3XA 1EWEA 4UNKA 1UC4A 1I0DA 1XV8A 3TC7A 2FDMA 4L4LA 4HK7A 1EA9C 3UR7A 4WKHA 3MUZ1 4YL2A 4Z2LA 1UR1A 1NFPA 2NV1A 1DP0A 1S2UA 3A6OA 2NQJA 3TCEA 2HWGA 1GW1A 3M0MA 1C7SA 2XIOA 1TR1A 4H41A 4GACA 1P43A 1PVNA 4HOZA 5LHEA 1M7PA 1MEIA 2W6RA 2OWCA 5A69A 4LAUA 3AHTA 2NXHA 3UG5A 3EB2A 5HBFA 3ITLA 1GOOA 4QDMA 5EMKA 3PAOA 1S5TA 4RUBA 4I8YA 2H6RA 2WVUA 1POJA 4B9ZA 2BX7A 3PJWA 3TC6A 1D7FA 4Q4OA 1J11A 2CLHA 3BE7A 4S3KA 2PDGA 3M5YA 1BGAA 2A7NA 4JN8A 1X38A 3DESA 3NOYA 2X7WA 4LVBA 4POCA 4YHEA 3RRAA 1P5BA 4L61A 3UG4A 3LCGA 2PWVA 1EZ2A 1VYRA 3K5XA 2D23A 5I3HA 3HG5A 1VFFA 3W7IA 2CZDA 2CLLA 3W2KA 4RW3A 3G1YA 5D37A 4IUOA 3R79A 4Z1YA 3MYPA 1GW9A 3CIVA 3MT1A 4QXIA 3B0VC 1B3YA 3DHUA 3GC4A 4RW5A 2VOTA 2X8RA 1PZ2A 2CLPA 4ZOBA 3JUGA 4NXSA 2QGHA 3TYZA 1AQMA 3ALFA 3BICA 1DWGM 2PDKA 1OZMA 4QGCA 5CG7A 1QHZA 1KFCA 3MMWA 4HYRA 1K9EA 1QOQA 4N9CA 1TE6A 3QMSA 7XIMA 4GNVA 1HKVA 1QOXA 2Z4GA 4L1GA 4CU8A 4ZB0A 1JQXA 1NIUA 4GCAA 1IE7C 1V6YA 4IPIA 2HSAA 4D1JA 1NOWA 2J9XA 1TV8A 4ZO6A 3O3RA 1Y0EA 3MCNA 4X9SA 1ICSA 1WDWA 5LZLA 4HSOA 3MPGA 2OB3A 3AMDA 1XDLA 4LSBA 1UWAA 2J8FA 5HK4A 2Z29A 3WCZA 3WLMA 4L80A 1SFTA 2R1PA 4IP7A 4PMJA 3ABOA 2REQA 4U2ZA 1XI3A 3UXLA 3W37A 3VZZA 3LD5A 5T9BG 3TQ0A 5FJRA 4HJFA 2ZUWA 2ISVA 2DT0A 3PBMA 1TIWA 1SFJA 5D2TA 3ITTA 3B8SA 2O7QA 4MB1A 3KHDA 3UT0A 2OXNA 4PEKA 1UR4A 4L65A 4REQA 4DI8A 4D6DA 1SO6A 4O1BA 3QSRA 2E9BA 3I65A 3WQVA 1ZTVA 1W0MA 1E73M 4ZOEA 2QV5A 1XYAA 1GUVA 3GZ3A 3TQVA 2A7PA 1TR9A 1XR2A 4HSHA 4UB9A 3KW3A 1LL7A 2E6YA 3EWCA 2J7EA 3FX4A 2WHMA 4F9JA 3RM8A 3H23A 1UWQA 2I17A 1ZL1A 4J1OA 4KWWA 4AHQA 4NYYA 4LBUA 3FVDA 2EKGA 4JKLA 1XJBA 1O68A 4FIRA 1XLGA 3RNDA 1HP4A 3B06A 3GNPA 5LXXA 3E12A 5DO8A 1TWWA 4LY8A 3PZQA 4GJIA 3VNMA 1CI1A 3U2OA 2DFAA 2DVUA 1EDQA 5FJTA 4HIBA 3PSVA 3UZYA 4J3SA 5IRPA 5AZ1A 4S3AA 4JQ3A 4RDWA 2V67A 4E8DA 3GXDA 3OHMB 3EWDA 4AD4A 2V30A 2PODA 3OQ8A 4LF1A 5AECA 1GTEA 4MUZA 4N0RA 4PUEA 1JCTA 3RJYA 4AX6A 1XBXA 1M41A 3LCIA 4HMNA 2I1OA 3G1SA 4MWAC 4WDUA 3VGEA 3N17A 1NP2A 4GI4A 1XUZA 3LENA 3UR2A 3MJYA 1WP6A 2X1IA 4XIMA 2J74A 4I5XA 1VBUA 2PU1A 1CW2A 4UQ9A 3ABXA 3W2JA 4PYSA 3CZGA 1ESWA 1XBYA 1XH0A 3T08A 4J5NA 3WUBA 2XH2A 3QVQA 1JGMA 1W3KA 1N82A 4OQVA 5LHFA 4XZNX 1MRQA 1YDOA 4B3LA 4N7QA 3WNLA 3WH6A 2YKKA 3M44A 3W9ZA 4DLMA 1LT8A 3WMLA 2RDUA 3BJFA 2V3DA 1UCWA 1EJRC 5DQPA 1SW0A 4PZVA 1U1UA 1E4IA 1O5XA 4Y7EA 4TIMA 4H3DA 2CU0A 4DO7A 2FGZA 3CUZA 3VD5A 1Q45A 1OZQA 2ZWYA 2J25A 1TWSA 1BSIA 4PBFA 2OKOA 3E2SA 3NDOA 4YCPA 4L64A 2P53A 4IQEA 4N6FA 2AQOA 4WEVX 3V75A 3GVWA 3MUXA 4UFJA 4B5SA 5E09A 3RR1A 5C2CA 4ZQPA 1UR8A 4LC8A 2UY3A 4EPKA 3E0LA 1KQYA 1SFSA 2A3LA 4WUIA 3ANVA 3XIMA 4YTSA 1JPIA 2CNCA 4IQJA 2BXVA 3IIXA 3UJFA 3CV1A 2VR2A 3PUDA 3V7PA 3W24A 1K7XA 1QK2A 4HA1A 1CLVA 3GY1A 3SCWA 3EOEA 3CU2A 4XKYA 2WJDA 1US2A 5KZMA 3FEMA 1JFHA 4GHRA 2BOGX 4JCMA 1G1YA 1EWDA 2OYMA 4UUIA 4R5EA 1SO5A 1O6IA 1GQJA 2VD9A 3PZOA 1W9VA 3ATYA 1AQFA 4IPJA 4JCLA 1MSSA 2VVNA 4U28A 2V6AA 2J88A 4KWOA 2IKGA 1W5PA 4J3VA 3NZGA 3SSJA 4GINA 1EUNA 3ZZ1A 2QNEA 2J66A 4RNIA 4D6JA 3WNKA 4Q6XA 2HVNA 3O63A 3T42A 2QIWA 4GBUA 5U4NA 4C6KA 4PH6A 2VFDA 2F6XA 1TJ0A 1UASA 3VVGA 1UZ4A 2CKSA 4JBRA 4YS1A 1VCVA 5F7UA 3FY1A 2AQVA 5LA0A 4HB7A 1DXFA 3IIZA 1EFZA 3R4IA 1F4AA 3VD9A 3H2EA 1PYFA 1U83A 4HQVA 5EMLA 3UESA 1ONEA 3HV8A 1RY0A 3WH9A 1S5NA 5ECUA 1V03A 1V5XA 5HA7A 3P82A 2HROA 1SUXA 1V51A 1XIBA 3WMSA 4PB4A 4HMCA 2E7FA 4JS3A 3CUXA 2W91A 1UPPA 5BWFA 3EPOA 2X1RA 3GS6A 1PEZA 3KRBA 1ZS2A 3OOQA 3Q58A 1JF5A 4CEXC 1J12A 1RJQA 4PA8A 4XB3A 2JALA 3MP3A 3M7SA 2HE5A 5BW6A 2GDVA 3QBUA 2NVCA 3SN1A 3M64A 4DVOA 1TO3A 2PDHA 3ISIX 4HMEA 4EWND 5BWAA 3W7EA 4AZ7A 4QLKA 5H8PA 4GUIA 4GVFA 4MLJA 2VUNA 3CEUA 3VOIA 4KIEA 2ZADA 3WYZA 3S0CA 1PTGA 2EPNA 5HXMA 3S2NA 2AAAA 3P60A 1MFVA 3W86A 3FV9A 3QZ6A 3W38A 2Y5SA 1E43A 5EKYA 4NU7A 1BXNA 4NUWA 1WDRA 2BLEA 3LZ3A 4U2YA 3TC3A 3U7BA 4J35A 2WAGA 2FGLA 1NM9A 3BO9A 2E8ZA 3W7CA 4HA0A 4OOUA 4UBPC 5CXPA 5T91A 2X2YA 3D46A 3KEHA 3O6CA 3BAKA 4ZSUA 4X63A 3G1XA 2OCZA 2QMKA 3OGSA 5K4ZA 1V3KA 5HINA 3O06A 4EOUA 1R3QA 1SR0A 3VGBA 3OGVA 1E3ZA 1JUKA 5D09A 1C8VA 3FS2A 1REQA 5A8GA 4F2UA 1XLBA 1EC9A 3DH7A 1KM5A 4P5UA 1JRCA 3NTYA 2ZE0A 3WX7A 4NX0A 2FH6A 4KT2A 3S9ZA 5K2ZA 2DEPA 1FRBA 4LS1A 2PSNA 2WM1A 1ITQA 3LNMA 4F40A 2VEKA 1IZKA 3SIMA 5GPRA 3CQJA 3EMCA 4E2VA 4HN4A 3G3MA 3DI0A 3CS2A 2C16A 2WZIA 4Q32A 4H19A 4YJ5A 3OZPA 1R5YA 5B7YA 2I16A 1HTIA 5LA1A 2YOCA 2R91A 4C6EA 1TPVA 1XYCA 1S2VA 2DDXA 1OADA 4S3BA 2J75A 4IMGA 1ECQA 4KETA 1XM3A 3KDOA 2GGEA 4GYKA 3D3AA 3LPGA 4O1DA 3M0JA 4H9VA 2BY3A 1E0UA 3T81A 3P14A 3VCNA 5B7ZA 2GDUA 2OFJA 5BXRA 4AZHA 4GCXA 1LOSA 1AD4A 3KX6A 5F4WA 2WZEA 2DU2A 3GVRA 4IMAA 3GE7A 2WNQA 3GUWA 3FXGA 4DX3A 3ES8A 3WSUA 3SUVA 4XKMA 2Y85A 3ZQ9A 2CEQA 4ERIA 3DKLA 3OIXA 3CB3A 2ZUMA 3V0UA 1TUXA 1W3JA 3E49A 1J6PA 3A9IA 4RE0A 1RY8A 1N8IA 4YMZA 1FWEC 5RUBA 1YRRA 1XIDA 1X98A 1D9EA 3L2IA 4JTHA 3V5FA 4N4QA 1ADSA 3W7DA 3GC5A 5E9XA 3DYPA 4W5ZA 1AJZA 2V5KA 5LNSA 3NPUA 1KR0A 1BF2A 1HO4A 1BWKA 3OP2A 2GZXA 2YZ5A 4MWAE 4J3ZA 3IVSA 1YE6A 4OWGA 4A8LA 3IANA 2HQAA 4KWVA 3QSTA 3NCOA 4IMFA 3OA5A 1HKKA 3DFOA 3W82A 1JYVA 1GK8A 1OCJA 2QDEA 3H8AA 4JL2A 3AYVA 1NFGA 4UOJA 5E1QA 1EJSC 3TYUA 1HJUA 5BOFA 4BF5A 2XVGA 3CZKA 1RP9A 3OLIA 4L4PA 3MUY1 2Y6ZA 1A3HA 1Q7ZA 5B80A 4LXFA 1F61A 4I5RA 2VD8A 3T44A 4IPPA 1J18A 1IR1A 1FWRA 3MDUA 2DZBA 3GYCA 2ZZ6A 2PDCA 7ODCA 3TE9A 1JAEA 4BI5A 4LYPA 4NSBA 4S38A 3R94A 3KL3A 5DMMA 1A0CA 2OZ3A 3AIWA 1GVFA 3RG6A 1V3IA 4G5DA 3ZR6A 1XRVA 3IGXA 4DZIA 2Y7EA 4M56A 2ISFA 3R1ZA 3W87A 3QW4B 1K6AA 3WD4A 3GUGA 9CGTA 3SCQA 3SY5A 3RX3A 1LWHA 1Y7VA 4RL3A 5CSRA 2VKZG 3PZUA 2E1DA 1J5SA 3IRDA 2CZVA 3GDKA 4NZ5A 2FFCA 3GYEA 3KCOA 3VXGA 3SB0A 1JI1A 1T5AA 4BWLC 3CIXA 2C1IA 3JRKA 1F07A 2V2HA 4XAYA 2QCMA 4JNMA 4O1CA 4JEQA 3TN3A 3W1TA 4DBEA 5F1VA 5CH9A 2D3NA 4H8VA 3LTYA 4FR1A 2PI6A 3P8IA 3WH8A 1DEDA 2D2OA 1H7NA 2D0FA 3LBCA 2XM1A 2D0GA 3KFTA 3WLRA 3NDZA 1GNXA 1RQEA 3FFSA 1R3RA 2NQZA 3GDBA 4UFKA 5E9AA 5CQ1A 5BMWA 1AQ0A 4GZ7A 4H04A 1T99A 3PUGA 3NO1A 1QNRA 3GXTA 5I7GA 3UJEA 4TX9A 4NNCA 4Z17A 3S8HA 1OFQA 1YXCA 2WVVB 4O1FA 3MMDA 2O4QA 3IVTA 4ML9A 1F9CA 3UNDA 3A47A 4PUMA 1ZAJA 3KOFA 2WANA 5CPSA 4NY2A 4ONVA 1QJWA 3U2CA 1H51A 3G8EA 3VOFA 2QDDA 4ML4A 3V1PA 3KE0A 4PFMA 1AJ0A 3GG7A 1CENA 3M43A 2XYLA 4Y9OA 4O12A 2X2GA 2ZX8A 4XG1A 5CC6A 3QY6A 3KRUA 4G8TA 1SR9A 5HULA 3VE7A 4E3VA 1DYSA 5FI8A 4J2MA 2X40A 3UPMA 1PUDA 2WBGA 4JTGA 1LORA 4GIEA 2Z27A 2ISWA 3FVMA 1MDRA 1SPQA 1E5NA 3GNNA 4I3GA 4WDXA 4C65A 1A5OC 4MLRA 4C1KA 2G4JA 4XZ9A 3BLKA 3UXKA 3SJNA 3TSDA 4DWSC 2PLJA 2YBVA 4JFUA 3ZSSA 3M07A 2WLYA 2W9MA 4AD0A 3WLIA 4QHRA 2PDIA 3VGHA 4MWAA 1S39A 2G96A 3SM0A 2PP1A 3T6CA 2KX9A 1W5OA 4JTSA 2CHNA 3HQNA 2A3BA 4LCSA 2DSWA 1PBGA 2W92A 1HKJA 3WD0A 4QE4A 4RDVA 5BU9A 1OYCA 1RK5A 4R88A 2YL6A 3EXTA 4DM1A 4IX0A 3I7RA 3TTQA 4WHBA 3OA3A 1YEYA 1H1ZA 5FIPA 3GR7A 2G41A 1DHPA 2ZRZA 3EX3A 4PTDA 3OVQA 1AODA 4YTRA 1UWUA 4W89A 4D71A 1GPWA 3M5VA 2JFEX 3GVQA 2TSYA 2R9RA 3U2ZA 3PM6A 3VD3A 3I6EA 2GLKA 3L4XA 3NYZA 1IXPA 2Z7KA 4FI4A 3W2UA 2AAMA 3RRXA 2Y24A 3ONCA 3GLCA 2XTKA 4ROQA 2NZLA 3FGCB 4GXMA 4PODA 4KWSA 3STPA 3VC5A 1ZP4A 3CO8A 4S3FA 3O15A 3MU7A 4LC6A 2VENA 3BARA 1BWVA 3WEMA 2A4AA 2PDWA 2EO7A 1K77A 2CXGA 1JR1A 2DW6A 2Z26A 4E5TA 3SECA 2ZVIA 1W1VA 4GI9A 4GE8A 3K8MA 4RZ4A 1WBHA 3GW3A 1KCKA 4JHOA 4PR4A 2V9DA 4E4FA 5LGZA 3BUVA 3ARTA 4UR9A 4GQRA 3APYA 1PDZA 2Y2WA 3UP8A 3W7JA 4C6PA 4RZ5A 1CYGA 2YIHA 1FH7A 4KIRA 1CXHA 4IMDA 1MXDA 3M5ZA 3C8FA 4F8XA 3EMZA 3T07A 3UCDA 4AEFA 1UWSA 3GAKA 4HZ6A 1DXEA 2WW5A 4TMCA 4IFOA 3S5ZA 4A2SA 4AD5A 4IIFA 5FA5A 4UMAA 3BW4A 3MTWA 4MMWA 3ARSA 4ZO9A 5A2BA 3GG1A 4RXGA 4KCWA 3UY7A 5LNVA 3GTNA 3V18A 3LHTA 3KDNA 1SFLA 2P0IA 2ZUNA 3FAXA 3REQA 5EPDA 3SN4A 2Z28A 3YPIA 3THUA 4Y9MA 4W4QA 5EMUA 2C15A 5AC7A 3CIWA 3WK1A 4WY0A 3SFKA 1V93A 1GYMA 1QXLA 3ANYA 4H8UA 1QWKA 3BJSA 1CXIA 1SJBA 1H7PA 1WYIA 1OD8A 4J3WA 4PRTA 5CPNA 1LWIA 3GDMA 2QF8A 3MI3A 3QC3A 5LIYX 1FA2A 2OKTA 3PTMA 3B0XA 2ZRWA 1JXJA 5AKQA 2V5LA 3TFXA 5CSYA 1OX4A 3DFHA 1MO0A 1PCWA 1ML1A 4D8LA 1XKYA 4I8DA 3N19B 1Q6GA 2XHYA 1TJ1A 1QASA 1ICQA 1EJWC 2Z25A 2ATMA 3WBEA 2V3GA 3TU9A 3VM7A 3UERA 5A6LA 4DPPA 1MXSA 3W2LA 1BWLA 1ZCCA 1UZHA 3BDKA 4UNLA 3FEQA 2DH3A 1THFD 3ARWA 2FPYA 3T78A 1F6KA 2GQ9A 3SUSA 2WMGA 4ORIA 3UWEA 1QNQA 2Q8XA 4JTAA 3MHGA 4W9TA 4KS0A 1SMAA 1KRCC 4QNWA 2YA0A 1RLCL 3LM7A 2F38A 1I75A 1T6MA 4OT7A 7TAAA 2ALRA 3TYDA 1F5ZA 4G1NA 1I2RA 1CX9A 2E68A 5BRPA 3BG3A 4FOUA 3CUHA 2R82A 2WHJA 4GY7A 4QAIA 2BV9A 4NI8A 1I2NA 1KRBC 4HZMA 2OSXA 2BVTA 4XTDA 2W4XA 4NZ1A 1KGWA 1JDDA 1KNWA 3PPGA 4QJ5B 5LKYA 5JH1A 3A4AA 3CPRA 1TCMA 5JBDA 1QI2A 3W53A 5JIPA 4GG9A 5DN1A 2Z1XA 3VDHA 3O05A 4NJHA 3TEVA 4KGLA 4XX6A 4LCRA 3PJTA 1IT8A 3LEPA 1YDNA 3AWNA 5AHEA 2O9RA 1VFTA 4FMVA 2WK2A 4HYWA 3G1RA 3VIMA 2WMIA 2Y62A 4QQ3A 5CC3A 1OK4A 1ZJIA 1E6QM 2BHZA 4WY0F 5CPMA 4R33A 3A4JA 4ZFCA 2YR1A 4GYPC 5AHLA 1SVDA 5REQA 1LUCA 3V0TA 1XPYA 3UXIA 6CGTA 4W86A 4LT9A 4WOZA 5JBEA 3ZS4A 3OZYA 3MV11 2WXDM 3N9RA 4QJ1A 3S6OA 3WY1A 3NEVA 3U7VA 2UBPC 4GH3A 4AB4A 2P8CA 3L23A 4K37A 3GTIA 3OO2A 2DT2A 3LK6A 2TPSA 2UY4A 3WQDA 4JYFA 4FALA 4EF9A 3O0KA 4Y8FA 5K4XA 3WJYA 4IFKB 2Y63A 4O52A 4UTLA 5D8WA 4LEQA 2TRSA 3Q65A 2RKXA 1M7OA 5FSDC 1QMLA 1IWPA 4JX5A 1GEQA 4H6EA 1QW8A 5TAOA 2QUVA 2FB2A 4ZOAA 1GQNA 3WJZA 3SO7A 2QR6A 2XFYA 2VJXA 5G1MA 3TONA 5XIMA 2JE8A 4BF7A 2CKRA 5LXEA 1WXYA 5I3DA 2ZZ5A 2OEJA 4GNKB 3IUIA 1BXCA 1MQRA 4NAFA 2EPHA 5LNUA 5JH2A 3N2OA 3KVLA 1QBBA 4NL1A 3CUIA 4HK5A 3P62A 1K9DA 2HVMA 3GDLA 1AMKA 3E02A 2QEZA 5DT5A 4OV9A 3FJLA 3UJ2A 2QUTA 3I3DA 5A6BA 3TZFA 5AC6A 3LZ5A 1EIXA 4S1FA 3QZAA 3U3HA 3QM3A 3K4AA 1SZGA 5T8GA 1T8QA 3KVMA 4F0MA 3OTRA 4QSFA 4FOJA 2CLKA 2XWDA 3G77A 1F3XA 1UWRA 2XGBA 4O8AA 4LQ1A 4TR9A 3AQUA 4O14A 2CZ5A 2X05A 3TYEA 3VOJA 2WSRA 2BY2A 4YWSA 2OZ0A 4UMCA 1RHCA 1TB3A 3ARVA 2IQDA 3MUCA 2BNJA 3BGGA 3VK5A 1IGWA 3PZNA 2R6OA 5LIWX 3VGDA 3B97A 2BXYA 5KMYA 1NWRA 2Z1SA 4EACA 1V4YA 4NNBA 2JEPA 2DIJA 1EOKA 3GH7A 4M1RA 4UFHA 1UWTA 4LVAA 1W2VA 2G97A 2FVLA 2YW3A 1B9BA 2VDGA 1XLFA 6REQA 1EA0A 2ZZ2A 3BLFA 3VNLA 1V6TA 4JNZA 2I56A 1Q63A 4HTBA 1K6WA 3M0HA 5I77A 4H8NA 2WCSA 5FEZA 1H4PA 1UROA 2XSXA 2AMXA 5D2VA 4GKLA 4IL2A 4BA0A 3ITVA 2QJJA 3HPSA 4BWLA 1C9DA 3LHUA 2VL4A 3MP5A 1RPKA 5CJMA 3W1XA 3JZUA 4ZTXA 3FA4A 4K7YA 1QNOA 3UVIA 1HJXA 2HNHA 4JTUA 5ABGA 2CLMA 4GIYA 4L1XA 1LRNA 3NL3A 3WEOA 2WC3A 2OYLA 2F9RA 4I6KA 1OSEA 3EKLA 3HJEA 1TPH1 1VP5A 2V8ZA 5C2GA 2WJFA 4KRUA 2VWSA 1TVNA 3H4GA 2CBJA 2ZUSA 2YBUA 3QY8A 2GK1A 3N2MA 1O1HA 3XINA 3W7QA 2YW4A 4ZZ9A 4PB5A 4OJYA 3ITGA 1VZWA 3P7YA 2Y7DA 4DXKA 1LLOA 3QLLA 3KTCA 3WNMA 3ZWSA 1CGUA 3RF9A 4W7VA 1E0VA 2VXNA 4DN1A 1YTEA 4HMDA 4B3ZA 4MB3A 4KCVA 2QAPA 3FNDA 3AXHA 4BF9A 3SCUA 1H7XA 1VJZA 2GOKA 4XSLA 1RD5A 5BOEA 1I1WA 1DIEA 3MZ2A 5D02A 5FAJA 1JZ2A 2PEVA 5BCAA 1C90A 1J0IA 4A8NA 3VKBA 1Q6RA 1QR7A 1P1MA 3IAQA 3T40A 4AY1A 1GWJA 4GKTA 5HDRA 3BCDA 1ME8A 2HVOA 1UH3A 6A3HA 3BG5A 3RITA 2NW0A 4MVAA 1KC7A 1K3UA 4RKAA 2YXGA 2ZUVA 4DELA 1MUCA 3OW1A 3UXAA 5HATA 1UR2A 1VRXA 3N04A 4GBDA 3W7OA 2ATSA 7A3HA 4HNVA 3ZJKA 3UZJA 2OVLA 4AVNA 4WSJA 3S83A 4IIBA 4MFDA 3PN8A 4I9AA 4J27A 1JNEA 3AXKA 1Y5VA 3G0XA 3TAOA 1QTWA 2FMOA 4DWSA 3LHYA 4MNMA 1VGAA 3QY7A 2EEXA 3PK7A 3LRLA 2D22A 2D69A 5AYXA 3L0KA 4RV8A 4GFSA 4IFRA 2ZZ3A 3IIPA 5EBAA 3DFSA 4LB3A 1M5WA 1WUEA 1E71M 1FWNA 2D73A 4V15A 1JUEA 3QQWA 1NELA 4JAWA 4NZJA 4XZBA 1R8LA 4IG2A 4ZO7A 2VEFA 1CIUA 2OR2A 1XIHA 2YGYA 3EDEA 3HPAA 3NXFA 1D2KA 4JTCA 3DG6A 2PU0A 1XLJA 1XCFA 3LGEA 4GZEA 1CGXA 4Q8TA 1CGWA 3CTLA 4RPQA 5CJ5A 3WJXA 3K8LA 2BSLA 4U33A 4FZIA 1ITUA 3AO0A 2WCAA 2PB1A 3GHUA 8XIAA 3OGRA 3IGHX 2Y8VA 1X1ZA 1JXKA 4YU1A 4BFAA 3C2VA 1VAHA 4LYKA 3MY9A 5A8OA 1WKEA 4Q4MA 3B04A 5I78A 2LLEA 4QSHA 5DY2A 1VFMA 4J4KA 1HW6A 1S5WA 3L5AA 4US6A 3LDVA 2ZBTA 3EX6A 3IIVA 4EAYA 1JPKA 3N9SA 1XISA 1TX0A 1FQ0A 4OVXA 3M16A 4IMEA 2HK1A 3N4AA 1DKWA 1CT5A 1M3UA 1AD1A 3G8RA 1M68A 2POTA 5A1AA 2E67A 2RGMA 1GYLA 4MFEA 4U3AA 1OYAA 1TCDA 4GWEA 3W7PA 4E0CA 3UW6A 3GFZA 3WLNA 1SO4A 4F48A 3GHRA 3L4VA 3P6LA 4ZENA 3UGVA 2XN0A 3D3FA 4HZ7A 1J79A 4WK9A 2I9UA 2OT0A 3L4TA 3LN3A 4R7JA 1J6OA 2WKGA 2PTXA 4OECA 4EPEC 4WX2A 3BLOA 1XYZA 1XYLA 4PTNA 5BYWA 2VC6A 1DV7A 1SMDA 5HMFA 1E1CB 3SRFA 1NWUA 3WNPA 3INPA 5HUPA 4Q33A 3SIZA 5CZTA 4UTWA 1VIWA 3F4WA 3VKDA 3A13A 4C90A 4JICA 1KXQA 1FDZA 2DGAA 1VKFA 1NJJA 2PTWA 1XKJA 1P6WA 3LX9A 1WOAA 1YPIA 1TPUA 1JZ7A 1EJ7L 3ZLFA 1XLIA 3LQGA 4I7VA 3F4VA 1XYBA 3TA6A 4DJED 4HN8A 4H9ZA 1TV7A 1VYSX 3RLUA 4XSMA 3D6NA 1W5NA 1BQCA 1CXFA 4AAJA 4HT3A 2R14A 1M03A 4JQ2A 4K8GA 3S5NA 4WKAA 1K8YA 2Y5JA 4AIOA 3S2JA 3MWCA 4OBRA 1MQQA 2OJPA 2SFPA 4W8LA 1M65A 1WDQA 1AL8A 1FKXA 2P3EA 4FXFA 3ZVHB 2JGYA 1HKMA 4QBXA 4WF7A 3QV9A 3VIOA 4GA8A 4KEVA 4BS0A 4AEEA 4XK2A 1XC6A 1V02E 1Z89A 1V6UA 8CGTA 2VTFA 4U4MA 1JPDX 2J13A 4DZ5A 1NOFA 1VS1A 4H1ZA 4LB4A 1A5KC 3PBUA 5EL1A 2CLFA 1EYWA 1QBAA 4IH3A 3VZXA 1J0ZA 4NG3A 4DRSA 1J2WA 1GT8A 1WBJA 3PNUA 2J24A 1E0WA 3W70A 5TBOA 3H2CA 1DJGA 2FZNA 1MDLA 1XH1A 2X41A 4LVDA 7REQB 3A3XA 4PRRA 5HWNA 3KLKA 5AFDA 2B81A 3LPFA 2C7FA 3DECA 3VNZA 4KRTA 5E5CA 5H8UA 3O0FA 2Q3OA 3R8RA 5LSMA 4Z0SA 4PMUA 2YPIA 1B3WA 4AX7A 3LBOA 3AFBA 3W74A 1I9CB 1TV3A 1JEZA 2ACUA 5AYBA 3N1AA 4MY8A 5FJOA 4X61A 8TIMA 2GJNA 3UYCA 4GYJA 4BZYA 2Q8LA 4HCLA 4ZQOA 4V2XA 5MKGA 1G01A 2X42A 5EFDA 4B5UA 3R8GA 1B3ZA 1H1YA 4E6MA 3K1DA 5FEXA 4C6QA 3GNOA 5H6HA 4HHHA 4IX2A 4LTSA 1XRFA 1JYNA 1PXGA 3TNBA 1BVZA 4M24A 1H60A 4TX6A 5A6TC 4HVXA 3CASA 2BGSA 4AMAA 4FA3A 5CGTA 1Q85A 3FA5A 1M04A 4K39A 2JKEA 3C61A 1HJWA 1NDWA 3VM5A 2BTMA 3LPOA 4MDOA 1Z42A 3PWGA 4IHCA 3GFXA 1NQ6A 4JY8A 1LWJA 2XVLA 4LUYA 2VRKA 4PUKA 3NOEA 5EMJA 2VURA 1EC7A 1H41A 4LUTB 4RJEA 5F4SA 4C5YA 4UZUA 3MBDA 1KBKA 4XBJA 2PTDA 1C7TA 8XIMA 4PULA 1U22A 3IAPA 4ALDA 3EWUA 1RJRA 2OQLA 4O1EA 3TTEA 3QH2A 3DC8A 5D8ZA 4IPLA 3KOWA 3ZR5A 1R46A 3B8TA 2CETA 5DANA 3TW7A 3LCLA 4DEFA 4AHOA 3KVJA 1F6YA 2CC0A 2TAAA 2PGWA 1XW8A 3C3NA 1SM9A 1VRDA 4CNPA 4Q3MA 4FP1A 1OX5A 1ZRQA 3N25A 1JGIA 1KBJA 3RK8A 4K1GA 3EWWA 3IK2A 4MNLA 2DPEA 1V6WA 1BSLA 3DFPA 2HBVA 3NWRA 4LAOA 4BQ5A 3OLEA 4IL0A 4D6HA 3PBVA 3ID7A 1JCYA 3IGUA 3IVUA 3WUFA 1BYBA 4L56A 2QYGA 3HGOA 4PB3A 4Z08A 5I2UA 2DW7A 1YADA 2FTPA 3POCA 1UKPA 3DHFA 3OHIA 3SCSA 3P81A 2J62A 4HTYA 2A0NA 3SRKA 1MW0A 4C6LA 5G2HA 4OUEA 1SZRA 1R9XA 4GI8A 4LYQA 2YLLA 4TUFA 3RR4A 1PZ1A 1KFJA 4DI9A 1VB9A 3PBYA 2NUXA 9XIMA 2C0HA 1Z44A 1B4EA 3P3BA 4CNUA 2QV4A 4XIAA 3NQVA 4GD0A 2F6UA 3AIRA 3TSMA 3CPUA 1E55A 3ITXA 4WJ8A 4GO9A 4IMCA 5HJYA 1U5VA 1X97A 4TVDA 5I23A 1ZB5A 3SCPA 2XVPA 1GG1A 2GJLA 5LNWA 1EXPA 1X8CA 3APGA 4WXYA 2OWWA 5AY7A 1HT6A 3E6EA 2VYOA 1TVLA 1ZQ5A 3EOOA 5XINA 1EHNA 4UMBA 1WV2A 3NQ2A 3H2FA 1N2VA 1V02A 3M5XA 1K7EA 2Y89A 1GZ1A 2B31A 3CB8A 3LBMA 3STCA 2NXIA 1ITCA 4NZ3A 3PG9A 2F8QA 1UIPA 5AZ0A 2INEA 3LCFA 3USZA 4U3CA 3Q2DA 3LHZA 4O16A 3BAWA 4MAVA 3ITOA 3EGJA 3LYEA 1DWHM 5EU9A 1IGSA 1RPXA 1O94A 3EBVA 3FJ6A 1HKIA 3EPMA 3VCCA 4DM2A 1G5AA 2GGGA 2IUZA 3TP4A 5I3IA 1E70M 2YXXA 4FNRA 3T8LA 3WUGA 2V68A 3KOZA 3B40A 3OB8A 1ADDA 1WDPA 3FW6A 4AY7A 2ZICA 1XS2A 4OGZA 3KS6A 4YNGA 3QPEA 2PURA 2PLMA 3BLIA 4UQAA 1WE5A 3H7RA 1MZHA 1SU5A 2H9AB 3BQ5A 1YIXA 4ZB2A 3AZSA 3IJLA 1WB0A 1VHNA 1D7KA 2JF6A 3VKJA 3TVAA 4PMDA 3PNZA 3ALGA 1UP2A 4OZOA 1IEXA 3VABA 1XLKA 5K9CA 1M6JA 2WBKA 3EZ4A 2BXZA 3EPNA 4KEZA 3TUUA 1ZALA 3MVTA 3S3GA 4MJ2A 3URNA 4UIOA 3TCSA 3QR0A 3S5SA 4IGMA 2E5CA 1EX1A 1M01A 5D9PA 1OFEA 4GOAA 4FNPA 4FNQA 3SQSA 4J2PA 3QHMA 5DCDA 4AD2A 3VNDA 3AIEA 1KFEA 3L66A 1ODUA 3FOKA 3UGRA 4LANA 4OUIA 2HNEA 3WH7A 4FXJA 3W6YA 3KTSA 3GR4A 2WQDA 5HR7A 1J96A 1OG6A 1E15A 2R1MA 2WO5A 2VZOA 4IT1A 1AG1O 4ZQCA 4AZ5A 4ASTA 1UD4A 2Q3RA 3ZR4A 2JIEA 1TQJA 3C86A 3QGVA 3UFYA 1JPMA 3THAA 3AZTA 2YDSA 4Q8QA 4GY1A 3JS3A 1UC5A 3B03A 2GJXB 3I6RA 4GRSA 5CPTA 5HR6A 2HZGA 4UFMA 1UD8A 4C6IA 4CKQA 3AYSA 3GKAA 4OV4A 1R85A 1KA9F 3M0YA 5EBUA 5EGRA 1BF6A 1C8QA 4B92A 3TDFA 4EVZA 2J79A 1LQ0A 2WWDA 3GH4A 3OVPA 2XJ7A 2PDPA 3WNOA 2J7BA 3Q37A 4US5D 2CZEA 4ICMA 3DFNA 3L5MA 3VKAA 4LS0A 3M9YA 3QLDA 5CEWA 3K4DA 1D3GA 4GJJA 2W61A 5A6MA 4HBKA 3NXLA 2VEMA 3WDIA 1UW9A 3FA3A 2PP3A 3BMXA 4UTTC 2VEGA 2QCNA 4AFYA 3UCCA 4D8AA 1KW1A 1WDSA 2FGBA 1I45A 3MP4A 4XAZA 3CMGA 1P0NA 3NSXA 1FKWA 4HOWA 2DORA 2W63A 2CBUA 2DV0A 2EG7A 3CHDA 3N4FA 1XYFA 4YN5A 4G1KA 3V16A 3V0SA 1X1OA 2PBOA 4ROPA 4DUWA 3TYCA 1HFBA 2A3AA 1B54A 4XV0A 4DO6A 3LTPA 4IZGA 4AWEA 1HNYA 4R34A 1YHTA 1ISWA 2GVEA 2VCCA 3U4AA 1OEPA 1G67A 5F2IA 1JCJA 1XLCA 2GYIA 1RH9A 4XD4A 4HA3A 4OOZA 4BQ2A 4NJGA 1FXQA 3VKKA 1DJZA 2OZTA 4DBUA 1A5LC 4RLIA 5D33A 1ZBKA 4PRWA 3CQKA 4M6UA 3B8DA 3PPHA 3QXBA 4P8WA 4O50A 1GJUA 2EPOA 2IKJA 1OCBA 2DIEA 3VIPA 4Q4KA 2PC4A 1OCQA 3PULA 4XBKA 4K8HA 3KCJA 2BP1A 1LP6A 4PMNA 3PFMA 2J78A 4LALA 4UCFA 1T7LA 4NZCA 2FPVA 2X1TA 1GG0A 1Q5MA 3MHFA 3KTXA 3M4HA 3UBPC 2GWNA 2RAGA 3E0FA 3AI0A 3BMWA 5DCEA 2QCCA 3QQ1A 4ENLA 2QDHA 1UG6A 1VEOA 3U6WA 4W7UA 3GU2A 3A3HA 5FEWA 3LLXA 1FHDA 3SGZA 1P7TB 3W7LA 4RNFA 4XBSA 4LWWA 3WQGA 3H7UA 2DZTA 4B5VA 4Q8NA 1GQIA 1K4HA 4IICA 1C93A 1V7AA 5IDZA 3QRHA 3RXZA 2KZHA 2V82A 1F73A 2PD5A 4LAMA 3F2DA 1Q7QA 2ZXBA 2F84A 1UR3M 4Z1DA 1VHCA 2JF7A 3UZZA 2WZMA 3AAMA 1NOUA 1GOIA 2VGGA 4MNJA 3UCQA 3QQ0A 3T55A 2PZNA 4EIVA 3S42A 5F1UA 1L8NA 5AC5A 1J0YA 3GTFA 3P8JA 3C5QA 1JJKA 4LX4A 3FSUA 4URIA 2JBMA 4G6CA 1V0NA 2DH2A 3CPGA 3QYSA 2E6AA 2NQ9A 1K70A 3RMJA 4CVUA 4JPGA 3WL1A 2NWRA 5AHMA 3UNTA 3TXVA 2VZSA 3B0PA 4BJHA 3VNYA 2R1NA 3ENLA 2VFEA 4C7DA 1V3JA 3EDJA 4UQCA 3LY0A 3GK0A 2Y61A 3NPXA 1QPQA 1RCOB 4GUJA 1U2YA 3D0CA 1R86A 1R87A 5GVJA 1O12A 3KBMA 3W71A 1SZFA 1XINA 3BC9A 3SAZA 2INZA 4UTFA 2HMCA 2PGRA 2E6FA 1GOQA 4PGLA 1KGUA 3CC1A 4A6GA 1ENUA 4C5ZA 3VOHA 2B7PA 3CZLA 4QNEA 2Z00A 5I07A 1OD0A 1PKLA 2CBIA 2J8GA 3HB9A 1GVSA 3HQPA 3WBWA 5C70A 3FKRA 1FBAA 4LCQA 4O17A 2JKAA 1VPQA 3VMNA 2XVKA 3I6TA 5IM51 1Z41A 5EFFA 5I0DA 1BVNP 3W75A 4M81A 4GZJA 1OY0A 1FWBC 4JXCA 1QI4A 5C8BB 2UZ9A 3PTQA 2WC7A 3ZJ8A 1K1DA 1MW1A 4M80A 3R89A 3IIOA 1L8PA 1Q65A 5FSEC 1DIDA 3EA1A 3CV7A 1ELSA 1TYGA 2P50A 4JDYA 5FOOA 4FAMA 2TODA 2P10A 3BJTA 1V0LA 3DXIA 5DY3A 1TWZA 7PTDA 4D2JA 1X6NA 5PTDA 1JCMP 3CV2A 4QS6A 1QU4A 2FHFA 4QCEA 3U8GA 4Y2WA 1W9DM 2PUZA 2BY1A 2QKFA 5K3VA 2ADAA 4JOMA 2YL9A 4NX5A 1WNOA 4LJ3A 4IUGA 2G3FA 1JL8A 3W7NA 3QV6A 2P88A 2PGEA 5E6ZA 1WZLA 1VEPA 1UR0A 4Q4SA 3F5KA 5IBXA 4DUOA 5H8MA 4Z2HA 3E2VA 4B5TA 3WD3A 1Y5XA 4HU4A 2AOSA 4YHGA 1B0IA 3AS0A 5TD4A 1P0EA 3H2OA 2PBGA 4MSSA 3CLMA 3M46A 3DGBA 4BY3A 4AWSA 1PX4A 2A3HA 3B0YA 4G7FA 3RILA 1G4PA 1KCLA 3HG3A 3BCFA 4AUBA 5C2XA 3V4BA 1XC4A 2J77A 3LUTA 3WQ8A 3BVJA 2X0YA 3C8NA 1W17A 2WMKA 4NZFA 4GGBA 4A4AA 5EMMA 1HKWA 4IJRA 4MUPA 3AS3A 4IGHA 4Q8OA 4HK6A 3KHJA 1KTBA 4LBRA 3L0GA 1B57A 1H0GA 3UPBA 3IV8A 2GQ3A 2TYSA 2ACSA 1PCKA 3TV8A 2XZ7A 1DIOA 1R7AA 5KITA 2WOQA 2W0UA 3EX2A 4X3ZA 4S39A 4IP4A 3DKJA 3ABQA 4WZHA 4E2OA 2RDTA 1CDGA 5JBFA 2PLCA 2PRLA 2V81A 3LERA 4UZSA 3H24A 3KOXA 3L21A 2XSAA 1KWKA 1JYWA 1XGZA 1C91A 2DZWA 4FNTA 3VE9A 4AZ6A 4S3CA 3D47A 5JQ9A 4X9YA 4CQ8A 3CJPA 1OFPA 3L4UA 1OBAA 1CBGA 1E72M 2NQLA 3ECQA 2WZHA 4Z1BA 2FIQA 1F4HA 3VIIA 4JR5A 2YCEA 4CN4A 4ATDA 2X1UA 2GFTA 2Z6JA 1ONWA 1FTXA 3REQB 4QDWA 2VT0A 3K30A 3N73A 2QCLA 3LB0A 4UC5A 4V33A 4XZHA 5GJNA 1J5TA 1XF0A 5HNUA 2QW5A 4WJEA 1DIKA 5IHRA 5G5IA 4CQAA 1TTIA 4GZIA 3UETA 4TX8A 1VBRA 1LG1A 5HWMA 1TELA 3QGKC 3W1LA 1PZ3A 3PY2A 3RLVA 2BMBA 3VAVA 2E4TA 3UZXA 1DTNA 3KWXA 2DJXA 1S2TA 3EWBX 4XAGA 1JQVA 3WF0A 2XFFA 2VZUA 2ZE3A 1LT7A 3EA2A 2QGYA 1TWIA 1JPHA 4F9DA 1ALDA 3GNXA 4GIAA 4ZR8A 1KM3A 5C55A 1XD1A 2YCLB 3ABZA 4C6FA 1QPNA 4WLCA 3SCOA 3SRDA 3ATZA 3TW6A 5CBIA 1JCXA 4ES4A 3U48A 4CD4A 2E9LA 2RUSA 2OX1A 1T40A 3WQWA 4H4IA 3B4YA 4R53A 1ZAHA 5A6SA 1U1HA 4W8BA 3P5YA 3TWAA 3PPFA 4D6GA 2AL2B 4JGDA 4IIDA 1TV2A 2QQ6A 5CPOA 2QULA 3RCMA 4AIBA 4EXAA 3G0UA 4V1YA 2GSJA 2FJKA 3H7VA 3OYXA 4IP5A 4KCUA 4AQLA 2J7HA 1XIJA 4ORMA 2OSYA 1OABA 3FYYA 1HL8A 1LL6A 2BGQA 3KBJA 5FD0A 3PTKA 2WVVA 2GQAA 1EF3A 2V3FA 1MW3A 3NM3A 3TR9A 5EB8A 3DZ1A 1J2BA 4OIFA 1JVNA 5C5YA 2V5JA 1JFXA 5BOOA 3KL5A 4F0SA 3L2LA 3MO4A 1P4CA 4NQ1A 3U9IA 2PDUA 1VD6A 3NO5A 2EHHA 1DTUA 4LUJA 3CH0A 2WSPA 1E9LA 1B90A 1DJYA 1G4SA 3IPWA 1I0BA 1EEPA 4ZXOA 1O1ZA 1LLWA 1TZ9A 5J5RA 1RUSA 5F4XA 5ABHA 1VPYA 3CM4A 4UTIA 2GVYA 3L12A 1Z9AA 1CXEA 2P0OA 1UOZA 4IJBA 2Z6IA 3LXCA 4GUGA 3S6DA 5D04C 1OVDA 1F7BA 4DLFA 4GMEA 3HIJA 1XSIA 2C79A 5C7VA 4XAPA 1SZEA 1YTDA 3CEPA 3PBWA 4RR4A 1N55A 1E4LA 1Z32X 3THCA 4MPKA 3STGA 3DFYA 4LV9A 3OQEA 3PC0A 1HGYA 3TJLA 2CLIA 1O66A 5GNYA 3W1PA 2DUZA 2W5FA 3TYAA 1UKTA 3O2LA 5HQMA 4QRNA 1BGGA 3EDDA 2OOFA 1DQUA 4IISA 4YYFA 4DBSA 4H8HA 3R58A 1IZJA 3HGJA 1E5JA 5TQLA 3FJ4A 1LBFA 4HP5A 5C9ZA 4LOCA 2A85A 3C2EA 1I2OA 1U1JA 3CMFA 1XQLA 2ODOA 3G22A 4HNLA 2QLYA 5JXQA 3WQPA 1VFHA 1OGGA 3OBAA 4DY1A 3RU8X 3O16A 1MW2A 2X30A 1A5BA 4NJJA 1XICA 3EXRA 1K4GA 3L9CA 3TROA 2YCKX 4LPCA 1NSJA 1KBBA 2V0TA 3UYIA 1EL3A 4BI7A 4JN6A 1GQKA 3KS5A 3M0VA 3FGCA 4TU1A 4NAEB 4H9YA 3EWXA 4J3TA 4P2VA 5FEPA 7ENLA 3BW2A 1HIZA 1VC4A 4UTTA 4AHPA 5MHBA 4PSRA 4AY8A 2NUYA 2VFFA 2PWGA 2YL8A 4IQDA 1FWGC 2XIJA 4G2DA 3CL8A 1XG4A 3HFTA 3B9AA 5LIKX 3MSYA 1UBSA 1KBIA 3T0DA 4AG0A 3QN3A 1WCGA 1A47A 1A49A 4NILA 2CPUA 4QM1A 4GLEA 3H22A 3RCYA 1PE1A 3GNRA 3W1AA 3GVGA 3W25A 3IACA 5E0CA 3SY1A 3F03K 4ZBCA 4M6QA 4MJMA 1IT7A 2EBNA 1J93A 3ARQA 4G7EB 4AZCB 1S2CA 2PGFA 3DIPA 1T0OA 1OWQA 2QVNA 5E0FA 5LIXX 4JTQA 1FP8A 2Z2BA 3LMZA 3WD1A 1B9ZA 3NNTA 4UCGA 3O7UA 1VENA 4DO5A 3HQ1A 2O9OA 4GI6A 4HU3A 4UFIA 3K1GA 4TV6A 3FXYA 4ZGYA 2QJIA 4MJ4A 3KP1A 3VTRA 3ZJ7A 3LRMA 4ATLA 5AN7A 3NSNA 2XGZA 2YSWA 4L1WA 1GZJA 4W87A 2GQ8A 4DJEC 1EP3A 1PB0A 3AJ7A 2PDBA 3SEPA 1Q2SA 2NXGA 1XP3A 2Z1BA 1GVEA 4JZ5A 3W81A 2OOGA 4O28A 4EWJA 2VNCA 3NGFA 3RLGA 1U33A 4IXHA 4I9MA 4ZXLA 4FF5A 2DZXA 3EKZA 4PEEA 2VHLA 1EGVA 3N2TA 3EX1A 1RD6A 5TNVA 1S2WA 2Q8ZA 4WJXA 1FWAC 1D3CA 4LNYA 4JFVA 1VFSA 2IMRA 5GNZA 2A3EA 3A5FA 4F0KA 4CGTA 4MIMA 3WDJA 3CHEA 4CCZA 1A50A 3VFCA 3THDA 4IPNB 2FFIA 3LNPA 3C2YA 3PANA 3M0XA 1B1YA 1XCXA 1Q8JA 3ARUA 1LQ2A 1V79A 4LEFA 3GKFA 2XZ9A 2B7QA 2X09A 1DWAM 4OKDA 1X96A 3NQEA 5BXPA 1L2QA 4JIPA 1UBPC 5CGQA 5IFTA 1VFUA 5A6KA 3BW3A 3ABRA 5F2MA 1EH9A 4CU6A 2XFWA 3SGGA 4MKSA 1UD2A 3SUUA 2AKMA 1GHRA 5AC4A 2RDXA 2PWFA 3A9BA 4M82A 4KF1A 1BG9A 1PYMA 2MUCA 3UG8A 3AHYA 1UJPA 3M6DA 1RK6A 3NQAA 3AMLA 4R3UA 2O9PA 2C13A 3JZEA 2QCHA 4M19A 1K8CA 1EEXA 2WVSA 1FWFC 4UTJA 4C1NB 2HE8A 2QCDB 2B7OA 1C8XA 1P0KA 4FSAA 3GBDA 4ZQNA 4LV4A 2GPTA 4UTUA 3BSHA 2DVXA 3KBNA 4ZTYA 3W1QA 1RP8A 2XGIA 4H9MA 2NQ5A 4A21A 1E1FA 2BHUA 1QI0A 3L4WA 3LGDA 1KTNA 3L65A 3UZ5A 3WLJA 2XWEA 5BROA 3UD6A 2IPGA 3NYDA 4PC8A 2OT1A 1T8XA 1OM0A 3I4KA 4Y9PA 4F0LA 3SBFA 1HJSA 3W0KA 3IJ7A 2HPMA 3IRSA 5GJMA 4EXQA 3TJIA 4H7ZA 2VRJA 1PDYA 1I1XA 3R5EA 1UZ1A 1XG3A 1S3TC 4XO7A 4NIRA 1DVJA 4W84A 4QE5A 3T0AA 4E8CA 1ICPA 2YCJA 2ZTKA 4DBDA 4LVFA 3HO8A 5A8PA 2IW0A 2I7GA 4F4RA 1Q6FA 4LUSB 2Q6ZA 1Y65A 3QHOA 2FHBA 5A6AA 4JKMA 2VC9A 3WQEA 4L9XA 1KCZA 1V3LA 4QJ4B 4Z2GA 2AGKA 1Q3NA 4X0VA 4LUIA 1QFEA 4Z1AA 1JZ4A 3DU0A 3HFYA 2NVDA 2NQHA 1MUWA 2CLOA 3C2RA 3RX2A 3OYZA 1ISZA 2G4FA 4K1WA 1DHKA 4E38A 1XPGA 3SI9A 2UY2A 1E6SM 2Z1WA 4Z2KA 3AYRA 2XIBA 2G8ZA 4IFKA 3Q67A 3TKFA 1EC8A 1PWMA 4LH8A 3HG2A 4R9XA 1KBLA 2PMQA 2R1KA 3IJ6A 5DMYA 1AVAA 3HV9A 2FZMA 3PG8A 3LI1A 4DZAA 3HA1A 2ZX6A 1SYTA 4GPNA 2Y7GA 1BD0A 3CL6A 3NZRA 1JRBA 1E9ZB 2G3JA 2ZRXA 3PZIA 1IHIA 2WPBA 4EK7A 1UKSA 2YDAA 3IGSA 5HWJA 1ODZA 3UG3A 4ATWA 4B2DA 3F1QA 3UA4A 6TAAA 4V28A 2ISSA 3APTA 3THQA 3VD7A 3AWOA 3AHZA 1F3WA 1UQZA 3CBWA 1F8MA 5JMUA 1W9XA 1CCWB 1MEHA 3N3MA 3TYBA 2OMAA 5E0KA 3TLLA 4J3XA 1HG3A 2CITA 3AROA 4B90A 3E96A 3LV5A 5A8QA 3QR3A 2OELA 4DUXA 2P3ZA 1RQBA 4LRSA 1BKHA 3V5CA 2UY5A 2CLEA 3NSMA 3RGTA 3SSZA 4J3UA 3M0LA 3H70A 4TO8A 3R0UA 4ILSA 3AHXA 5BXSA 5I00A 4MYAA 3SR7A 1WKDA 1B31A 2WMHA 4H7CA 2GSEA 2DIKA 2HBXA 3T4WA 1KXHA 1OCNA 2DSZA 2DSUA 1KLYA 3HPXA 5CBJA 4I9JA 1FHLA 4RXFA 4JEJA 2NX3A 1E6ZA 1E4NA 2WHKA 2DZVA 1BRLB 2P5NA 3CQ0A 3BOFA 3BSGA 1H49A 4X60A 1UMLA 4XWUA 3RPMA 1UD5A 1GPFA 2ZKMX 3LA4A 3ZLHA 4FEZA 1JDFA 4H01A 3KP0A 1UH2A 3ZJ6A 4KW2A 3FN9A 4B4HA 2PRMA 4C6DA 4FHAA 1EPXA 4CD6A 5D2WA 1H50A 2ZCGA 4GJ1A 1LDCA 1IWAA 4QE1A 2G95A 1JAKA 4DHGA 3WN6A 3HGRA 3RHGA 1TZ7A 3W07A 4RE3A 3UJSA 4O53A 3OBEA 1H63A 4Q7NA 3H2MA 3PF3A 4FNUA 3W2NA 3NIYA 1G7VA 5ABFB 1SSGA 1ZUAX 4X2PA 2ANUA 5F2GA 1CGTA 3B0UX 1Y8BA 3JVAA 2PDNA 1M53A 4B5WA 4YTTA 3EDKA 5EYWA 4JFWA 5FESA 2TMDA 3CUJA 3SCNA 2H3BA 3TFCA 2PDQA 1QPOA 1GHSA 2YA2A 5MF5A 3MDWA 2AGTA 4ECLA 2WCGA 3LRKA 3MBFA 1MXGA 3NQ7A 5IXEA 3TTYA 4TTGA 2E0PA 3LCXA 3RPDA 5G2WA 1FWDC 1PX3A 3TTSA 3PZGA 2GUUA 3WQOA 4O1AA 4C6OA 4W8AA 4UNIA 2ZRVA 4MB5A 3W83A 4Y9NA 2VRQA 1O60A 4J7RA 3VNIA 2E28A 2CW6A 3POHA 2PE4A 2E09A 1R3WA 5DX7A 3WDRA 1L2UA 1ZJAA 3TW9A 2A5HA 4JIIX 1JYXA 1S2AA 4UTMA 5CAHA 2PA6A 4NRSA 2FB3A 4NRRA 3GXIA 3W7MA 1YNQA 2WJZA 3CXOA 4PBEA 1XRSA 2PF8A 2OLHA 1WX0A 3C0LA 4N2YA 4ZO8A 3W26A 3PUOA 4M6VA 1EXBA 2BHYA 4XUGA 4RNHA 2RJHA 1UMYA 3FLUA 5BMXA 1PIGA 1J01A 5DFAA 3E74A 2BVWA 1TZZA 1OFAA 1HQTA 1NDZA 2UV8G 5AC8A 2ZA3A 1GVRA 1OK6A 1PSCA 1MZRA 1XSKA 1W5MA 3BZGA 2YA1A 2NT1A 4Q22A 4CN1A 2C0AA 4Q4PA 4J40A 3TA9A 1RJPA 4N02A 4RCXA 3L0NA 1TRIA 1W9BM 4UFLA 5F2LA 4M1BA 1B4KA 2PWDA 4HPJA 4AXKA 1U30A 1MQPA 5SWUA 3GXNA 4PBGA 1DORA 3W7RA 4QTGA 3GH5A 2OGYA 2ZC8A 3C0JA 2B4GA 3CO4A 5A6JA 3UWYA 1BFNA 4N42A 3OU8A 3S5OA 3PBGA 2DUXA 4P7RA 3WH5A 3S1UA 1E0XA 3UU0A 1AW2A 2GJRA 4FOKA 2W67A 1XQKA 4RE2A 1FH9A 2VGIA 1R9YA 3SADA 1R0MA 3W22A 1IEVA 1OIFA 4D6IA 1XBZA 3SCTA 1M9HA 4CD5A 5I3FA 1CEOA 2PTZA 2BFGA 1PJ9A 5CZKA 4FIQA 3GHSA 4HKPA 2XSBA 3WFLA 5ECVA 3QR1A 4CD8A 3CAWA 3N14A 4UTWC 1N7KA 3T7VA 2GWGA 1YYAA 1T96A 1IV8A 3CAQA 2ZA2A 3BK0A 3HURA 3VUPA 1TV5A 4TOQA 4OTKA 2VDIA 2QZRA 2DUAA 5EMYA 1A4LA 3MHUA 2I5QA 1VBHA 2VVSA 3KOYA 4DIAA 4D1IA 3KAOA 5KETA 2GVGA 2AL1A 4NKCA 2ACQA 2BASA 3KRSA 3VDAA 4C6CA 2WKJA 3WNNA 1XHGA 2YJQA 3SFWA 4EKJA 3ME3A 2BVYA 3KUMA 1DJIA 5IDIA 2FKPA 3S4TA 3H6OA 1TPDA 3W88A 4TV5A 3ANUA 1YXDA 2JK2A 1BTMA 2ZDRA 5DRIA 5DRCA 3G6MA 5D05A 4MF4A 2C91A 1E1CA 1E6NA 1AW5A 2WMFA 3M0ZA 1CXLA 1V3MA 5CJNA 1LRQA 4H6QA 5AYZA 3VIFA 3MS8A 4RDYA 1Y5WA 4RPPA 1W5QA 1FXPA 2WYSA 1US0A 3IS4A 4OU1A 2D2HA 4ZA0A 1AFSA 4WD0A 3E0IA 2CXEA 2W66A 4IXXA 5G4HC 3WJSA 1Z6KA 1GVIA 3A23A 4A8RA 3ZT6A 4CCCA 2FQIA 1W54A 4XZMX 4X2RA 1NARA 2RHGA 4DJEA 3DERA 1EX5A 3CAKA 4GH1A 4O19A 1ZBWA 4HNTA 1J10A 2OYKA 1QK0A 3ZLGA 3W6LA 5CSUA 2EQDA 5C9WA 1XD0A 3FK4A 1E6PA 3MMTA 1TQXA 2DQWA 1E40A 4PL2A 2PC8A 3DFTA 2C18A 1EF2A 2ZXAA 3NURA 1ITXA 3DENA 1KD0A 4AW7A 1C92A 3C52A 4LU0A 3WBXA 4KPLA 3IJQA 5M5DA 2CFFA 4JX6A 1XLLA 2V3EA 1S3HA 2Z1VA 4HGXA