1LWIA

3-alpha-hydroxysteroid/dihydrodiol dehydrogenase from rattus norvegicus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
311
structure length
305
Chain Sequence
MDSISLRVALNDGNFIPVLGFGTTVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
publication title Structure of 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase complexed with NADP+.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 111
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1996-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lwiA00
4NKCA 3F7JA 3GHUA 4LBRA 1QWKA 1ZQ5A 4OTKA 4LB4A 4JIRA 2WZMA 1Z9AA 2PDBA 3LN3A 1PYFA 2PDYA 3H7UA 1XF0A 3MB9A 1YNQA 4ASTA 2PDPA 3CAVA 2F38A 3V0TA 5HNUA 3CAQA 2HEJA 4ZFCA 5M2FX 3R43A 2INZA 4DBSA 3O0KA 1AFSA 2FZ9A 4HBKA 4XZHA 3ONCA 4FA3A 4QR6A 4DBWA 2BP1A 1FRBA 2PDFA 4YVPA 4JQ4A 4XVDA 3GHSA 3WG6A 2PZNA 2BGSA 3EB4A 1ZGDA 2IPWA 3NTYA 4ICCX 4YVXA 2ACQA 2INEA 2IPFA 2HVNA 4IJRA 4JIIX 2PDQA 1Z8AA 3VXGA 2HVOA 4JQ3A 1S2AA 3V35A 2HE8A 2FGBA 3DOPA 2FVLA 4PUWA 2PF8A 1XGDA 4PRTA 1X96A 2PDKA 2F2KA 3C3UA 3R58A 1JEZA 4H8NA 2P5NA 4XZIA 3LNMA 4LAZA 3BCJA 3WCZA 5LIWX 3GUGA 1EXBA 1VBJA 1MRQA 3LD5A 5AZ1A 4MHBA 4EXAA 1XJBA 2DUZA 3G1RA 1PWLA 4PUUA 3Q67A 4I5XA 2NVDA 4RPQA 3EAUA 2IKIA 2ACUA 3GHRA 3ONBA 2PDMA 1MZRA 1ADSA 4JQAA 3WBWA 2PDHA 3S3GA 4YVVA 1YE4A 2IKGA 3DN5A 3GHTA 3MC5A 2IS7A 3FX4A 2ALRA 2PDXA 1Z89A 4LAUA 3UFYA 3RX2A 3LBOA 4AUBA 4DZ5A 2PDUA 3H7RA 4XZMX 2IPJA 2PDJA 5DANA 2J8TA 3R8GA 1GVEA 4G5DA 4LBSA 5JH1A 2IQ0A 1PWMA 4JQ2A 4GQGA 3LZ3A 5JH2A 3UWEA 4JQ1A 1X98A 4DBUA 3T42A 1C9WA 2BGQA 3LENA 2ACRA 5LIKX 2IKJA 4GCAA 3LUTA 1Z3NA 2DV0A 3R6IA 4JTCA 1RY8A 3D3FA 3UYIA 4QXIA 4LB3A 2A79A 2R24A 2HE5A 2CLPA 3R94A 3CASA 1OG6A 1MI3A 3CV6A 1ZUAX 2PDCA 3B3DA 3P2VA 1PZ1A 4R9OA 1IHIA 2QXWA 3COTA 3M4HA 4IJCA 3U2CA 5AZ0A 3LZ5A 4WDUA 3WBXA 2PDGA 1Q5MA 3CMFA 2IPGA 4WEVX 4JTDA 1US0A 1HQTA 4JTAA 1HW6A 1VP5A 1IEIA 4JIHA 3UZXA 3N6QA 3UZZA 1RY0A 3LEPA 1T41A 3UG8A 3Q65A 2IKHA 4F40A 1T40A 2C91A 3BURA 4JTQA 1A80A 2ISFA 3LQLA 4QX4A 2FZDA 2R9RA 3UGRA 1YNPA 3FJNA 4EXBA 4XO7A 4XZNX 2FZBA 4WDXA 4PR4A 4Q7BA 1Q13A 4XZLX 4XVEA 3UP8A 1PZ0A 3ERPA 2PD9A 4IGSA 1EF3A 4XO6A 3M0IA 2PFHA 4JTRA 1R38A 4L1XA 3BV7A 3UZYA 3G5EA 1AH0A 4GQ0A 4WDTA 4XK2A 1M9HA 1AH3A 4HMNA 4GIEA 1RALA 3V0SA 3R8HA 2FZ8A 3CV7A 2I16A 4FALA 3UZWA 4QBXA 3RX3A 5HA7A 2PD5A 2WZTA 4L1WA 2ACSA 4FZIA 3V0UA 4YS1A 4WRHA 1QRQA 2AGTA 4FAMA 1LWIA 4YU1A 1LQAA 1S2CA 1AH4A 1X97A 2HV5A 3RX4A 3KRBA 5C7HA 3H4GA 3V36A 1YE6A 4Q3MA 5LIXX 4GACA 2PEVA 4PMJA 2PDNA 3R7MA 3O3RA 3LQGA 4PRRA 1S1RA 5LIUX 4GABA 5HNTA 4H7CA 2I17A 2PDLA 3BUVA 4WGHA 1EL3A 4GA8A 1UR3M 1AZ2A 2PDWA 3WBYA 5KETA 3EB3A 4XAPA 1ZSXA 2HDJA 1K8CA 2NVCA 1AZ1A 3N2TA 3M64A 2PDIA 5LIYX 1S1PA 4WDWA 1EKOA 1J96A 2DUXA 3QKZA 1SM9A 2VDGA 2IQDA
chains in the Genus database with same CATH superfamily
3BK0A 1UWTA 2ON3A 1DQWA 1KXVA 4O53A 4GINA 4IG2B 2QCEA 3QVQA 4MJ2A 1OADA 2PDBA 3ARPA 1XLFA 2PTYA 4P5UA 1TV3A 3S5YA 1ZL1A 5M17A 2I7GA 1D9EA 2J4GA 1YBQA 2DIJA 3M7SA 3EA2A 4JYFA 2JGYA 3B9AA 3UXLA 3GIQA 2GWNA 3U6WA 4I5UA 4AIUA 3VAVA 3G1YA 4LUIA 1JR1A 1UWSA 1D8WA 4JTTA 3L0GA 4ATDA 5A6JA 3PWAA 3KCLA 3RLUA 1PAMA 3PN8A 3EX4A 4HSOA 5HUOA 3IIXA 1FHUA 3CO8A 4DJFC 1QR7A 1P0NA 3D5HA 3VXGA 2HE8A 4UZUA 3QBUA 3SQMA 2PF8A 4UC5A 1LLOA 2CHNA 1F73A 4ZFMA 3ISIX 8A3HA 1H7OA 1XLGA 2NSOA 2QCHA 1XLIA 5CSSA 3TXZA 4PZVA 1IT8A 4PB3A 2WKJA 2L5HA 4GNVA 2A1YA 4KCWA 2QCGA 3OBAA 1XX1A 4O8RA 1NWUA 4IISA 3WCZA 3WNLA 3PZUA 1EXBA 4EF8A 4BZYA 5FIPA 1GHSA 4MLRA 1JPIA 4MHBA 2D1ZA 3H23A 4Q6XA 3TYBA 4MNLA 1OB0A 3ZYZA 1GTEA 4WKAA 2QCDB 2VFIA 4S3KA 1V3HA 4NILA 1DQXA 1W56A 2J6XA 2F9RA 1QK0A 2HISA 4LQ1A 1TWDA 3ITVA 1OX4B 5EYWA 4MLJA 2GVEA 2JE8A 3W73A 5F2GA 3IS4A 3W1RA 1KC7A 5D32A 2WJEA 2QLYA 3KOFA 3EDDA 3RX2A 3LBOA 3PF3A 4N4QA 4DZ5A 4HCHA 2REQA 4A3QA 2O7QA 1BXNA 3UWQA 2Y7DA 3AZRA 2IPJA 1W9BM 3MT1A 4KBXA 3ZO9A 1L2UA 3OB8A 3CQIA 2Y4SA 2FFCA 4JQ2A 2TODA 4GQGA 1XFCA 5JH2A 1VJZA 1KFJA 1ADOA 3PVFA 2IXVA 4DBUA 1F9CA 1E40A 3EWWA 1Q45A 3R11A 4H2CA 2HROA 1I0BA 3AICA 4BWLC 1KV8A 2QUVA 3SQLA 4NAFA 2GL5A 3GS6A 1FUYA 3LOTA 1TIWA 2QJMA 3D3FA 3PJTA 3EKGA 3VGEA 2IXUA 3CZLA 4A35A 1PDYA 2GLKA 4K38A 5GNYA 2QYGA 2XJ7A 1TMQA 1HP5A 3O6AA 4LANA 4QFUA 2ZA3A 2WSRA 3XISA 2PDCA 2AL1A 5HWNA 1RJRA 3KE0A 4ZA0A 2VENA 3ABXA 1W2PA 1BYDA 5AY7A 1E0XA 2BXVA 2I5GA 2E67A 3LZ5A 1JYXA 3O6YX 1VENA 4RV3A 4WDUA 3B8TA 3NPVA 4M1BA 3TV8A 4P8UA 3E0VA 3OLGA 3CGTA 1GYLA 3QV9A 4TMCA 3UWYA 1JXJA 4ACZB 4RZBA 1OQFA 3EX6A 3PPFA 3G1HA 4AZIA 4IXXA 3VIGA 4DY1A 3RYSA 1XR2A 4AFYA 3VNJA 3QGKC 4C6PA 4Y2WA 5E5CA 3A13A 5K9XA 4M6PA 2OWWA 4F40A 5M03A 1YMYA 2G4JA 3FYOA 4CNPA 5A95A 2YYTA 1SJCA 1HKIA 3O05A 1OFBA 2HS6A 1XSIA 4CN4A 3NQDA 2OT1A 3TC6A 1P1XA 3WD0A 3WZ0E 4P8XA 4CD7A 1T7LA 2BX7A 3UYCA 3T0AA 2XU2A 4PR4A 3MUIA 1US3A 3C52A 4Q32A 1H63A 4C5YA 4C6KA 4PUKA 1YPXA 2QMJA 3TOPA 2OG9A 3UP8A 2WVVB 1XYAA 4B3ZA 3EBVA 3CZJA 4ZOEA 3LGEA 3P7YA 3MYOA 3WNNA 2D2GA 2V2DA 3NZ1A 3TMLA 4V1XA 2CHOA 2ZX8A 1AH3A 3CIVA 4E6MA 1K4GA 4W7WA 3NO1A 4GIEA 4WZHA 3CPGA 1XLAA 5BXTA 1X6NA 2F61A 3TN3A 3RR1A 4I8DA 3MI6A 4DB7A 3LCLA 4X3ZA 1L2QA 3AHXA 4PTNA 1M7OA 4WD0A 5BCAA 1V77A 1WUFA 1KXTA 5BOOA 3L4UA 4JY8A 3NXFA 3LRMA 2XPKA 2PS2A 2YCKX 4K8HA 2ACSA 2IQTA 3DFYA 2OQYA 3FEMA 5AKQA 2B7QA 4GE8A 4YU1A 4ORIA 3G1FA 1DIKA 3UQNA 1KM5A 4HNTA 4MADA 2Y0FA 1QAPA 2PEVA 2MUCA 2J25A 2BDQA 1PS9A 3LQGA 1S3TC 3LRKA 1RCQA 3FLUA 1RHCA 1LF1A 3JR2A 1U33A 4FX8A 3CS2A 4D72A 4FNUA 1VCVA 2VCAA 1O12A 4K8GA 3W26A 1UR3M 1XIDA 4XAPA 3N2CA 1TJ0A 1FCUA 1GQKA 3DYOA 3NQCA 5M3WA 2Z2BA 1NFBA 6REQA 3M5VA 1KBIA 4OBSA 5HULA 3MSDA 3PY2A 1S1PA 5EU9A 2HWGA 4GNJA 1JCMP 3OQEA 2HS8A 3EPMA 4ZE5A 2XTKA 2NQZA 1JPHA 3QHNA 4WY0A 3H4XA 3LV6A 3W9ZA 4LALA 3CEUA 2WZMA 3VKCA 1M3UA 4MTVA 3LN3A 3SB0A 4O1AA 5KSWA 4S1FA 4U10A 1YQ2A 2F38A 5HNNA 2CKRA 5BRQA 1H2JA 1RQBA 2HMCA 1JF6A 4ZBCA 2FZ9A 4M56A 3FS2A 4R3UA 3ONCA 4GGHA 4QR6A 3URQA 2X2YA 5I09A 4MZ8A 5CC7A 5F7UA 1IIHA 5FCZA 3N25A 3VUPA 1Q66A 1LOSA 3MANA 3VM7A 4C6FA 4E3TA 2D69A 2XIQA 3V75A 1KTNA 4D6JA 3NGFA 4WSKA 1JCJA 3UT0A 4HCLA 3UZ5A 1MDLA 4HB7A 2E9BA 1CZ1A 1RP9A 3KM8A 4J7RA 1HKVA 3QQ1A 3HURA 3DC0A 3BQ6A 2JF6A 4JKLA 4RUBA 5A8MA 3DOPA 4UR9A 4PUWA 3DKJA 4DI9A 5LGXA 2X1RA 1M03A 1X96A 3T0DA 1F74A 4MUPA 2OX4A 3GU1A 3GNNA 4IQEA 3C3UA 7A3HA 3QMTA 1V51A 2E68A 1PCWA 2ZXDA 5G2IA 1EX5A 1D7FA 2C8NA 5E70A 3AHYA 3DFQA 3KEHA 1JNDA 2AOSA 4J28A 1QI4A 1VBJA 4C7DA 4NUWA 5CSYA 4U5IA 3GU2A 3UF9A 3QJAA 3AS2A 1PE1A 4FX6M 1FVPA 4GJ1A 2W6RA 1H5YA 4CNSA 1XGEA 3MBFA 4RE2A 4MF4A 1PYMA 1GEQA 2VQTA 4V33A 6PTDA 3CL7A 3DDMA 5KITA 1TPEA 3TN6A 1PBGA 3O16A 5HJLA 4C6DA 2TMDA 3QZ6A 1CI1A 3RU8X 1EOMA 5FOOA 2CW6A 4N9CA 2CLKA 3JW7A 4CQ8A 5I24A 4C7GA 3AUJA 4HCDA 4WCJA 4TX8A 1Z7AA 3IV8A 3U9IA 1FKWA 1TV7A 3QW4B 3WL1A 2EXOA 3TK7A 4G5DA 3BSGA 1IEQA 3O6CA 2QVNA 4H9TA 4AWUA 4GVIA 4ZR8A 3WF2A 3PZOA 4Z2LA 4ZSUA 3U4FA 2OSYA 4GCAA 1UYQA 4FNTA 4OVXA 4GZIA 4RZ5A 1E9ZB 1UH4A 3ARTA 3OZYA 1TUFA 4JTCA 1RQEA 5DN1A 1B1YA 4NZFA 4WJ8A 1MNSA 2A3BA 3LLDA 3WQFA 4DYEA 1R3QA 3TA9A 4M80A 2X0YA 1X8FA 2WXDM 3BV4A 3N17A 1UOZA 4BQ2A 1K7XA 1E0WA 3BQ5A 4K37A 4OUEA 2PTXA 5REQA 2O56A 4IIGA 2J79A 1XHGA 3MMUA 1RVGA 3NJ3A 1XBZA 3QFWA 1KW1A 2NSXA 1K9FA 1XC4A 5JU6A 1Y7VA 3TA6A 4L65A 4Q33A 3WELA 3GR8A 3W00A 1GPFA 2Q01A 2PGWA 2WW5A 3W76A 3IUHA 3FDGA 4W8AA 4GGBA 2DZPA 4TMBA 4KKXA 1ZB5A 4S3DA 4S2BA 2CBIA 3H53A 2QAFA 3OG3A 4JX5A 1CWYA 4ONVA 1V6UA 4NZJA 2G96A 2VFHA 3VOJA 3U0HA 1VJSA 3WQ5A 1IYXA 3DBPA 1CX9A 3EWBX 4OQVA 3QGAC 3W2KA 3OZMA 3WF0A 2ZCGA 3AXHA 3M47A 5MKGA 4UIOA 3W1TA 4W7UA 4B3LA 4E2VA 4YJ5A 3FHAA 4TU1A 1XLKA 3V16A 3CH9A 2UV8G 1E55A 3UVIA 4JX6A 2O9TA 1N8FA 3HGRA 4IFOA 3MO7A 3R8HA 5BU6A 3VIHA 5HXMA 2E6DA 3WH5A 3KCOA 3PB0A 7REQB 5HK4A 3W23A 4XUYA 3OVRA 3T9PA 1BTMA 1BXCA 1XGZA 2HVMA 3S1GA 3UWZA 4H00A 2EPLX 2G50A 4AF0B 1TWZA 4UFIA 1G94A 1J0YA 1DL3A 2BHYA 1GTHA 4PTWA 4H04A 1WKEA 2QAPA 2G95A 3GKAA 3KUMA 1DJQA 3GR7A 3E5BA 1OIMA 3WLSA 4MAVA 1U5JA 2EPHA 4FAMA 2Z27A 4DXXA 4KFNA 2C15A 1UP0A 3S9ZA 1S2UA 4EPEC 4N7QA 4AYSA 1KBJA 1W8SA 3VNDA 3APYA 3AU6A 1RPXA 3BMWA 4GACA 1AQMA 1GKRA 3AFBA 1F76A 4NNAA 3W4RA 3ALFA 2YL5A 1JZ3A 1B4KA 3R7MA 2WLYA 3I4EA 1UZDA 3BOLA 3MP5A 3BH4A 2EG8A 3KOZA 1EEXA 2VI0A 1L6GA 4DYKA 2EG7A 3B0YA 1H0IA 3NQ7A 3AALA 2FHFA 3AIBA 4AMAA 4FIRA 4PULA 2HK1A 4DLFA 1PIFA 1R7AA 1GQJA 4US6A 3K1GA 3L4WA 3QKZA 1H51A 3VDAA 3W7PA 1C8YA 1NEYA 1RA0A 1WCGA 3BW3A 3F7JA 4G7FA 1EJUC 1QPOA 4G8TA 5KEZA 2H3BA 3ANUA 3ITTA 4ROQA 1O5QA 4H9UA 3WMSA 1CW2A 1P0KA 1TJ2A 2QPUA 3OIHA 3RGTA 2NV1A 4QS5A 1A3WA 3PTQA 5FAGA 4QEHA 2C19A 1KR1A 2XGBA 3NSMA 2E8ZA 4AVNA 4FA3A 1U5VA 2GGEA 2DVXA 1EZ2A 5DEZA 4HYWA 4ZQNA 3SY1A 2C6QA 2PDFA 3BVJA 5A8GA 3CUXA 2E25A 2HSAA 1W3NA 1SR9A 2X30A 5DELA 3TYCA 5FSDC 5D2XA 1POJA 2Y8KA 3QXBA 5IM51 4YVXA 2Z6IA 2ACQA 3O6DA 1UC4A 2W63A 4NVTA 5ABFA 1OIFA 3UA4A 4AZ7A 6A3HA 4L4MA 2TAAA 2CITA 2PCQA 3GW3A 3BGAA 4XAFA 1OFRA 3ARYA 2CLEA 1NAL1 2POTA 3UW6A 1EBGA 4CQ9A 2DT1A 4PMUA 5TIMA 5G2HA 2EBNA 4MNJA 2D22A 3CEPA 1JULA 2F6UA 2ZZ1A 1VFTA 5A94A 1XUUA 5KINA 4Q7NA 1MMFA 4CNOA 3HFTA 5HPOA 2EG6A 3DFOA 3BPWA 5I3IA 5LNVA 1P6WA 3S4TA 3GO2A 2OGJA 1IR2A 2OMAA 3LI0A 2BY3A 3DCPA 3IARA 4DF2A 1HJXA 3U7VA 2PDHA 3S3GA 4PCPA 4YVVA 1OSEA 4XAZA 1YE4A 3GXTA 2E6AA 3MC5A 4QITA 1KM0A 4H6QA 2ALRA 4PA8A 3UD6A 1XS2A 5I03A 1SFLA 1IGSA 1PIIA 4RE3A 3ZVHB 5FJUA 3BLOA 3OP2A 1PUDA 4UTWA 1B0IA 3H4WA 1AQFA 3NL6A 5K9CA 4DO4A 2WNWA 4LUTB 4LBSA 3SFWA 4MY1A 4L4OA 2GGIA 1WAUA 3DFNA 4D1IA 2P76A 1X98A 4JTSA 4XD3A 4H2HA 5A1AA 4CKQA 4ZOAA 3S9YA 4DN1A 3JS3A 2YA2A 3FYYA 1FTXA 3GH7A 2WVTA 1QMLA 4GCXA 3FKRA 5M5DA 4XKMA 2DSVA 3DFPA 1CGYA 2BHZA 4FS9A 4ML4A 4Y7EA 4YTSA 4HKPA 2UY2A 1H41A 1XUZA 4P8VA 1X6UA 2CU0A 3AJ7A 5CZKA 3SGUA 3ZZ1A 4E4PA 4AZ5A 5LNUA 2J7CA 5LXXA 3CHFA 4IT1A 3SGZA 3C2VA 4RDYA 1CGUA 3NEVA 4H9ZA 5MF5A 2Y5JA 3V5CA 3GXIA 5IOBA 2BOGX 1VS1A 4UB9A 3WK0A 3S5OA 3GK0A 1AL8A 1W31A 2DZWA 4HPGA 3LB0A 4JTDA 1TVNA 4ZZ9A 1PXGA 3RM4A 2ZRYA 2QCMA 3I6RA 4D9PA 2YLLA 3TQVA 1PX4A 4AXKA 4LCRA 4LVBA 3DIPA 3HG5A 4OE7A 1VRXA 1IZJA 1R87A 3PZMA 2ZIDA 1JCLA 2E9MA 3VIIA 1BGAA 3UZZA 5HMSA 3PAOA 3FSTA 1BXBA 1YBQB 4AY7A 3S1XA 3O07A 5I78A 6ENLA 5C9UA 2ISFA 1I4NA 4MGGA 4DJED 1XYBA 4UTLA 2X05A 3CMJA 1DXFA 4UTMA 4M29A 4XZNX 4NHVA 3PHAA 1JZ4A 3VNIA 1R2RA 4O1DA 3W6LA 1UD3A 2VP8A 3AMCA 5G4WA 4JTFA 3S42A 4X0NA 4WQ6A 3APGA 1YYAA 3AXKA 4AW7A 4JTGA 1MW1A 4AHPA 3W2MA 3WLRA 3ERPA 1CBGA 3HOJA 1ZFJA 2ONEA 3E3HA 4DUXA 1XIFA 2O9PA 3ABSA 3SRFA 3EOOA 4S3JA 4L1XA 1MYRA 2PODA 1ISXA 4CVUA 5A6BD 3TFXA 4HA0A 3M0JA 2CPUA 1UP3A 2RAGA 1BQCA 1YKWA 4GIAA 1LORA 3NQ6A 4NNCA 5CPMA 3RLGA 3DGRA 1FXQA 1DJHA 1KRCC 1FWAC 2V69A 1A4LA 4KFOA 2VUYA 3T0CA 3NNTA 4Q4SA 1SYTA 2XH4A 3PZVA 3FJLA 2D3NA 1PIGA 3OZOA 4BHYA 2ALDA 2WM1A 4H9YA 4WJXA 1XP3A 2Y6ZA 4H41A 4W8BA 5EPDA 4MZ1A 3B0UX 1OZQA 3VE9A 3LV5A 3CYVA 1SJDA 3KL0A 4GD0A 2Y7GA 1WXZA 2YR1A 1S1RA 2OLHA 3EOUA 1C92A 4XAGA 2I17A 4NY2A 4D71A 2QGYA 3P14A 2P88A 1OCNA 3OPSA 3NOYA 3GDKA 4Z0SA 3WLQA 2ZICA 1AZ1A 1P48A 2Z7GA 2REQB 5FEWA 3TJLA 1EPVA 4PB4A 1WDDA 1J96A 3OHMB 5I3KA 2NUXA 2DSZA 1KRBC 1CLXA 3SGGA 3T81A 1DWAM 4M1RA 1G7UA 4MWAE 1DIDA 4XAYA 1AD1A 5GJNA 1RVKA 1O60A 1UIPA 4DXKA 2J9YA 2R14A 4PFMA 4AHQA 2XGIA 3Q58A 4NXSA 4A8NA 3KTCA 4UUIA 4W86A 3EZ4A 4Z1CA 3W1QA 1B2YA 3R12A 1GUVA 3LG3A 3WLNA 4MSSA 1BWVA 2V3GA 4NAFB 3HG4A 4HMCA 1ZP3A 3TTEA 4M8UA 4PUNA 2WVSA 4E2BA 1M7JA 2PGEA 1J2BA 3N6HA 3RNDA 4O1EA 3SUWA 5CPQA 4JL1A 1VRDA 1XYCA 2AQWA 2WC3A 4W84A 3G18A 2G37A 5D02A 1H7XA 2QGHA 3I7QA 2JALA 2PZNA 3LTPA 1EF2A 1TZ7A 3FV9A 4CEUC 4WX2A 5FKYA 3MQTA 4DJEC 1JQVA 4A05A 1Y5WA 5J5DA 3E6EA 3RILA 4IIEA 3CU2A 3EB2A 2GQ3A 3DZ1A 2E8YA 4V28A 1H4PA 3SADA 4PMVA 1VFLA 1B30A 3W7DA 1E0TA 3KLKA 3M0MA 4XUGA 1XLJA 4H8NA 3UPWA 1X1OA 3WF3A 3O06A 3LCHA 4ADUA 2Y63A 3MI2A 3VGHA 3VKAA 1MDRA 2ISVA 4AX6A 3LD5A 3E38A 3CJPA 4OGZA 3ARVA 4B91A 4PUUA 2HNHA 4P7LA 1EP1A 1RCOB 3OLEA 5FD0A 3HM7A 5FJIA 4WOZA 4H4IA 4RZ4A 3CTTA 4UQAA 4KEMA 1W0MA 1OT2A 4LAMA 3GHRA 4YTRA 3T1GA 4K3ZA 3PTKA 3QM3A 3DEQA 3OYXA 3PFMA 1PKYA 1GVOA 1Z6KA 1KGUA 1X1NA 5CPTA 3ZSSA 4B5TA 1QASA 1PJ9A 2VT0A 2ZZ4A 3NCOA 5CBJA 1BG9A 3EWUA 1XD1A 4BFAA 1R3SA 4REQA 2NZLA 4MUZA 3L68A 1C90A 2G5WA 1VFSA 1DJGA 4Y6GA 4JNMA 3H7RA 5CPSA 3ID7A 4XZWA 2V5CA 3NQAA 3JZEA 4GXMA 2AQOA 1XLCA 4U3CA 5TF0A 3GG7A 1IZCA 2O9RA 1XIGA 5HMFA 4YN5A 4GNKB 1JF5A 4A3YA 4JOMA 2WQPA 1KFBA 1LJYA 4C90A 4UQEA 2ZX5A 2YL8A 5TBOA 1JDDA 4IQJA 1IE7C 1TJPA 3SBFA 3NZRA 1AQ0A 4HU0A 3R6IA 2GOKA 4RW3A 3LCXA 3G0UA 3H22A 3LM3A 3OGSA 1LG1A 3FAXA 2ZWZA 4D8ZA 3HQNA 3IVTA 4IMGA 1RQHA 4E4UA 3W7GA 1MEIA 3CQJA 5TD4A 5G4EA 3GG8A 1JFHA 1GKPA 1R5YA 3SSZA 3TYZA 4PYSA 1OGBA 1E6PA 3B9DA 3COTA 3QHOA 4UNIA 3UETA 1ZCOA 2W92A 3QFEA 4QTGA 3WBXA 4AZ6A 3ENLA 2WMIA 3W74A 2CLFA 2WPGA 3U5UA 5C2GA 4O1BA 3VDHA 2BHUA 1LQ0A 2BNJA 3WBEA 3J7HA 4CUCA 3M0HA 1A5NC 3UXDA 2OVLA 3CUHA 1UW9A 1NARA 4X2RA 3CHCA 1KCLA 4QJ4B 5EBAA 4QG8A 4UZSA 4ECLA 3KTXA 3CIXA 3KVMA 1MRAA 3GD6A 3W6MA 4NT0A 3LTSA 3UG8A 3B0VC 4IMFA 4X9YA 1ODZA 1T40A 3BARA 4QSHA 5A69A 4GY7A 1EUNA 5FF4A 2WSQA 1W5NA 3LQLA 5DBTA 2J8FA 5AVNA 5J04A 2D2HA 4X61A 2PBOA 2WHMA 3LYEA 4KCUA 4AEFA 3BO9A 4XO7A 3EMCA 1UKQA 3TUUA 3OEXA 4B16A 2W66A 1C7TA 4NSBA 4YTQA 4O4WA 5IDIA 3S6DA 1HVXA 3FEQA 1XIIA 4Q8TA 3BW2A 1KQYA 1A3HA 1PZ0A 2X7VA 1MQPA 4H8UA 5DF0A 1R9YA 3VPLA 1EF3A 1FFRA 2WM0A 2XWEA 2GQAA 5RUBA 1ZLPA 5HR7A 1DJIA 1AODA 4ZB0A 3E12A 1W5OA 4YWIA 3N9RA 4ZB2A 2JKPA 2C16A 3O9NA 4QBXA 4PB5A 4D6CA 2A7RA 3KX6A 4JTHA 4GI4A 5FACA 1US2A 3KRSA 2VVNA 2B31A 2ODOA 1XPYA 4PTMA 1QPRA 4HJWA 1LROA 4DAIA 3LA4A 2VWSA 2BOFX 4Z0JA 2WBKA 3SUVA 3MCOA 2QF8A 2AGTA 3ABOA 3CB3A 4B92A 4GBUA 1S2CA 3WJSA 1AH4A 2IMRA 5XINA 3REQA 4HZ7A 4A29A 5AYXA 2HV5A 3POHA 3NZPA 4KGJA 1R8LA 5ECVA 2WWDA 2C14A 5LIXX 5IDZA 4HPJA 5DY2A 4MPKA 5GPRA 3TR9A 4GYFA 2XISA 2I14A 5LNWA 3VD7A 1JRCA 5HMDA 4JHOA 4HU8A 2CLMA 1LG2A 2PDLA 5D2VA 1XL9A 3ARWA 5E6ZA 3SCRA 2Y5EA 3AYRA 2Y8UA 4HHMA 2GWGA 1UC5A 3M64A 3WEMA 3IUIA 4BQ3A 4Y9AA 4AZBA 1UJQA 4DWSD 5IFTA 3DUGA 3I3BA 5DCEA 4ZCWA 4UQ9A 3SCNA 3PJUA 3DU0A 4QISA 3VGFA 3L4YA 2NUWA 3M07A 1GZGA 1QU4A 4IZGA 2ISWA 4H7VA 2OSXA 5KMYA 2CFFA 3VCCA 1Y5XA 2OLAA 2IUZA 3N34A 2RUSA 3CAVA 1M41A 2ZRVA 2Z1XA 5A6AA 4RXFA 2PPGA 3RRXA 2YCJA 1NSJA 4W5ZA 1UZ1A 1VFHA 1A0DA 3D47A 4ZTXA 5LA2A 3S9IA 4N9EA 4DBWA 4HMDA 2ZC1A 1HO1A 3Q2DA 4U28A 3KVLA 4IPLA 1ESWA 3KP0A 3HQPA 3ORWA 1Q6QA 3R4IA 1BAGA 4IMDA 4IG2A 1Q63A 5A6MA 3NTYA 2FDMA 3SCWA 4ICCX 3INPA 4QLKA 4CU6A 3TROA 5G5IA 3AS1A 1BWKA 3PZNA 1QJWA 4F0RA 3BZGA 4UFKA 1Q2RA 2WV8A 4AEOA 5I77A 4OUIA 2FVLA 1WP6A 4QDWA 3EX2A 2C7FA 5AVHA 3OU8A 4QNEA 2RDXA 2O4QA 1TPVA 2DIEA 2AMXA 1CGWA 2NQ5A 1JEZA 3MWCA 2YZRA 4S38A 2BS9A 4IL2A 1LRTA 3BAJA 4M19A 2B7OA 1X6LA 1LUCA 1JIBA 4M6VA 1XLEA 1Q2SA 1FWEC 4M7TA 3PB2A 4EE9A 1KCKA 2JGQA 2VRJA 4CD6A 2RHGA 2GGHA 1EO7A 2Y5SA 2DZUA 2YCLB 3C2RA 4EPDC 5LNRA 1QUMA 1DWHM 4M51A 3H2AA 3O8AA 3WJZA 2ABBA 2Z24A 1BVWA 3RJXA 2YGYA 2BVDA 3WQCA 4GH3A 4XBJA 4I7WA 2PWUA 2XWDA 3ALGA 1O1ZA 4K36A 2Z2UA 3P6LA 4HN4A 2O7SA 3W75A 4P8WA 1I2RA 4D6FA 1LRNA 5BNKA 5D03A 1I60A 2DH2A 1I6NA 1I2OA 2QCDA 4AZGA 1V0KA 2C0AA 2XFYA 1C91A 4F79A 1H7WA 3S5SA 4AUBA 1GYNA 2V68A 5FEZA 2Y89A 7XIMA 1OX4A 3TH6A 2X16A 3HU7A 3BG3A 4OOZA 1FWDC 1PWMA 1DKWA 4LH8A 4AWEA 1UR1A 4D1JA 2FHCA 2H8XA 2DSUA 4UOJA 1B3XA 1ONWA 3H54A 4GVGA 3EKZA 1B3WA 1QNOA 1OFQA 3LU2A 3PZTA 4MDOA 3OTRA 4W5UA 5BOFA 1V6TA 1S3HA 1V0NA 2DW6A 1VCFA 1YPFA 2VZUA 2JKAA 4ZEPA 3VD5A 3ZJKA 5GVJA 2VYOA 1UBSA 3AMGA 4OZOA 6ALDA 1EQCA 1W3HA 1XBXA 4ZO6A 3ZT6A 3MCMA 3UY7A 2YDSA 2VOMA 4AXNA 5DCDA 1U2YA 4KMQA 2ZXBA 3IUDA 4QHRA 5CG0A 1EOKA 1XYFA 3FCPA 1OZMA 4UCFA 3SM0A 1IIGA 2ZKMX 4L9YA 4NYUA 3UZXA 2JIEA 4AX7A 3UERA 4ATWA 2RJHA 3JUGA 3VUSA 2XZ7A 4M6QA 1MW0A 1CEOA 3FGCA 2A3LA 3M1ZA 1WA3A 1XIBA 1SR0A 4PH6A 2BODX 1ME8A 2C91A 1EC8A 3GR4A 3P81A 4GMEA 3STCA 3S2JA 3LBCA 2PSNA 2OJPA 4BWLA 3EX3A 4O17A 1HJUA 5FJPA 3GU9A 1A5AA 1BTCA 5DY3A 1BVNP 3IGHX 1RLDA 4NP7A 4JY9A 3QOMA 5C5YA 4H8HA 3U57A 2CKSA 1RAKA 2PD9A 5HNRA 1WE5A 5ABFB 2Y88A 3NSXA 1VEOA 4B2DA 1MFUA 5CCZA 4E5TA 1TRIA 1OC6A 4HMNA 4M6UA 4K7VA 3T08A 4MKVA 1VLIA 4U4MA 3GDBA 3PULA 3THAA 3FW6A 2O9OA 1QCWA 4W88A 3W81A 5BWFA 2J62A 1E51A 4DRSA 2HXUA 3GAKA 3W70A 5ABTA 1VEMA 2Y1HA 4K8EA 4XSLA 2ZUUA 4WVXA 4PE8A 2POZA 4IUOA 3AWOA 4WRHA 1XXXA 1HX0A 1OFAA 1QI3A 4JPGA 1JI1A 4PTVA 3E0FA 1BSIA 1Q6DA 4GI9A 3B8SA 3MCNA 4K6AA 3C0JA 4D6HA 4DM1A 4LF1A 5C7HA 3FJ6A 4NI3A 4JFTA 5DX7A 2XIIA 5H6HA 4RXGA 1H62A 3RXZA 3GSMA 3TIMA 3SY8A 4QNWA 1MQRA 1MEHA 5L6UA 4JFUA 1AZ2A 4RNFA 3W37A 4WIWA 4J2PA 1R86A 2ABAA 4KFPA 1PPIA 3W7IA 3GDLA 2ADAA 4AVOA 1LCOA 4B9YA 5FA5A 2YL9A 4GY0A 1LOQA 1B90A 1LDCA 3PBUA 3N18A 3L7RA 2X7WA 4B4FA 3NVTA 4NNBA 1F3TA 2ZWYA 3GHUA 1EDTA 2R8WA 1QTWA 1F8IA 3TYUA 4L6DA 3P80A 1O95A 1E9LA 4H19A 3K1DA 3C56A 2PDPA 3T07A 4W87A 2FKPA 2OYKA 4GUIA 5M2FX 3C0SA 3NIYA 1TV8A 2YDRA 1J6OA 1FDJA 4XZHA 3F2DA 5AYYA 1EBHA 3S46A 4HZ6A 3PZGA 3LI1A 4PEKA 3VTRA 1HL9A 5C0QA 2B81A 4LTSA 3DHDA 1XIHA 3NQ8A 4UXDA 1QO2A 3G1AA 8XIMA 9XIAA 2VURA 2ZZ5A 5LA1A 2IPFA 3GXFA 4GFSA 4B5XA 1HVQA 3QV6A 1P0EA 3SI9A 2C3ZA 1Z44A 4N6EA 3TJXA 2HNEA 1RV8A 3GFZA 4DF1A 3Q94A 4JR5A 4I9AA 5A2CA 2E1DA 5HINA 3MMTA 1T5AA 2GJNA 1GORA 3FA3A 4QS6A 3PUOA 1AVAA 1CB7B 3GIPA 3OBEA 5C54A 4NXKA 3LNMA 1SPQA 1GG1A 3V3WA 4NX0A 4GKLA 5I3HA 4Q7IA 1MRQA 3F2BA 1TPWA 2FH8A 5AZ1A 4EXAA 4LJ3A 4OT7A 2VDIA 1XV8A 2VVSA 4NJKA 3OGVA 3EA3A 2AMGA 2YOCA 3WD4A 4H1ZA 3I65A 3VMNA 5D9OA 4HPHA 1LZOA 4GRSA 3LK6A 2CZDA 3GE7A 2IKIA 1YTDA 4DYJA 3M43A 3UJ2A 1RXOB 4TQTA 1UKSA 2FPVA 5EA9A 3IJ8A 2ZA1A 1HIZA 4ZMGA 4DO7A 3SCPA 3PUGA 2GFTA 2VEFA 1A5SA 4Y8FA 4E38A 1RH9A 5CPOA 3R1ZA 1WQ5A 5HWJA 1PCKA 1GVSA 2GYIA 1JL8A 3AC0A 1ENUA 4RZ6A 3UFYA 4EXQA 4RKAA 2H3DA 3ECQA 1C3FA 1QOQA 4IOTA 3W7QA 4J1OA 5AHFA 4QCEA 4GYJA 1FDZA 4Y8EA 5C7VA 4BI5A 4AHOA 3PPGA 3LTYA 4L1GA 1IWPA 2CBUA 3LRLA 1SSGA 4QROA 4UOQA 2QJGA 2BY1A 1NU5A 4LVAA 2ZOXA 4FNRA 5FL1A 3M7WA 3GG0A 1B3OA 3ITCA 4J3ZA 2NXHA 2E5CA 4GIRA 3ZMRA 3P0XA 3KS5A 3LUTA 2NQ9A 3HG2A 4Q8QA 4HNCA 1DBTA 3CBWA 1K02A 3B97A 4EK7A 4W93A 2YCEA 3H2MA 2ZRUA 2NXIA 4MWAB 3UXIA 4GKTA 3C3NA 4BKNA 4GUHA 3CASA 4CCDA 1MXSA 3CV6A 3EA1A 1WKFA 1SMDA 4H83A 3P2VA 3NR0A 3CAWA 3ATYA 3H6OA 3F4NA 4AG0A 2UY3A 2VXNA 2PP3A 4DZHA 3MU7A 4GXWA 3WLHA 4E4FA 3SRKA 3KXQA 3V1HA 1YHTA 3F1QA 3WJXA 2WBGA 2V67A 1BVZA 4CCEA 1SSDA 3F4DA 4CQAA 3PZ9A 3STPA 2PTDA 1J2WA 3CM4A 1IXNA 3R10A 4HU3A 4AMCA 3AMDA 3STFA 5D2WA 1BHGA 1HW6A 1C8VA 2FFIA 2OT0A 1SZEA 3LM7A 3DFTA 1YXDA 4S3CA 4O54A 4IMAA 4CQDA 3WNOA 3STGA 3WF4A 1KBBA 4XZ9A 5HMEA 2J7HA 3LMZA 4LV4A 2Y70A 4P7RA 3I4KA 3SW6A 5G1MA 4UTTA 3BANA 3SJ3A 2B0MA 5FEXA 4EXBA 4AISA 1BKHA 4JTJA 3GAYA 3LLXA 2G3IA 4O10A 4FPSA 3OLDA 5DT5A 1H7NA 4HD5A 1Q13A 2QEZA 2E40A 5GNXA 1NVMA 2BTMA 3K4AA 3VZXA 4D6IA 3RM8A 1OINA 3MUY1 4EPBC 4D8LA 4TTUA 2QJIA 2XFRA 4IGSA 2WMFA 3TW9A 5B7YA 3LERA 1CXFA 4ZTYA 4MY9A 5FJJA 3E74A 5T9CE 3G5EA 1RLCL 4GQ0A 4JFVA 3W7NA 4MB1A 3G2GA 4KWUA 1W17A 1D3HA 1JUEA 1XRFA 1F4AA 2W91A 4DELA 5EMUA 1EDQA 4FALA 4FIQA 1TE1A 4RL3A 2WJDA 3TOYA 3RX3A 1TMLA 2CLIA 2AAAA 4NL1A 2NX3A 1JAEA 1Q6GA 4MVAA 3IJ6A 2ZUVA 3KDOA 4U3AA 4RDVA 3W6YA 4IMCA 1H49A 1CGVA 3CUGA 3IGUA 4LF2A 1F8MA 1E6QM 2BXYA 1V7YA 2GUYA 1N7KA 2PWHA 3AU2A 3MHFA 1XICA 1WDRA 5CXPA 3R13A 4GUJA 4JFWA 4QLLA 2PC8A 4H01A 2X09A 2O4MA 1TV2A 1TFVA 4IQDA 1K3UA 1UR4A 4IIDA 3DG3A 4Q8NA 4QG9A 1LWJA 4PMYA 1JYVA 4MKSA 1R3TA 2E5DA 3AIEA 2CWXA 2VEPA 4DEFA 4J5NA 3IJLA 5E9XA 2FJKA 1KFCA 2V2HA 2Y2WA 4KRTA 4L4LA 1FCBA 3OYZA 3MO4A 1A3XA 5D2YA 4REQB 3HJZA 4E8GA 1JI2A 1XLDA 2A3CA 2Z1BA 2P10A 4KH2A 4JYDA 1I2QA 3ATZA 1XCFA 4V15A 1R9ZA 3B9EA 1Q6EA 3N13A 4Y9NA 3A22A 3PBVA 4W7VA 4C65A 4RNJA 4A3RA 2FLIA 2WMKA 3MB9A 5AECA 1G6CA 4FEZA 1SJBA 1UWRA 4H6KA 3CAQA 3IGXA 4O16A 5BYWA 4R7WA 1ZBWA 5CBIA 5BROA 2YJQA 5CZSA 2WHLA 4E3VA 4DO6A 3L66A 3VIPA 3TXVA 3DHFA 5M1TA 3HMJG 2OXNA 3S2MA 3A64A 3QGVA 2VZTA 2GDUA 3ZJ6A 3UY8A 3LBMA 3NURA 1ZGDA 4JNZA 1UIOA 3FKKA 4C6CA 3POCA 4K68A 4JIIX 1N82A 2PZ0A 3NWRA 1TKKA 1AQHA 4JQ3A 5CBBA 1KM1A 5LHFA 3WIJA 1J11A 1KLYA 4PL1A 2WMIB 2DJLA 1J10A 2CC0A 3B0PA 3BLFA 2I9EA 4A3HA 5FAJA 1GEHA 4YLWA 4FXSA 4TVCA 2CBJA 3DECA 3GUGA 3CT7A 1Q7MA 5CG7A 3IJ9A 4CNUA 1ZY9A 4IIFA 3A3HA 1GT8A 1UD2A 1LLZA 5I2UA 3GVGA 3WUFA 1QW7A 1AMKA 4I5XA 4IPIA 4ILSA 1LL4A 2XIJA 3Q4DA 1WBHA 2ESCA 3PTDA 3SAZA 1QI2A 4QE5A 3IAQA 3BOFA 3LXAA 3QRHA 1HKJA 3MV11 3GXNA 5LHEA 3GQYA 4E2OA 1TWIA 4Z42C 3DN5A 1O7AA 3AYTA 1MXGA 2PTZA 3FX4A 3N29A 3AIUA 2ZX7A 3GC5A 5D8ZA 1R3VA 1JZ8A 4PTDA 2VX4A 1IGWA 1VFOA 3QV7A 2OOGA 1RBLA 4DJFD 3SFKA 3TSBA 1YLVA 1V0MA 1A5MC 2PDJA 2XVKA 2GDVA 1K8YA 3L5MA 1REQB 3ARZA 1NF0A 1WZMA 3APTA 3I3DA 1R47A 4FXFA 4C6OA 3W82A 2YBVA 3UJFA 4P7NA 2NLIA 4XQ6A 1EJSC 1W5QA 4KWVA 3H2NA 3C8FA 4NYYA 3REQB 4DWDA 4FB7A 3UYIA 5AYIA 4AVFA 1DWGM 1RP8A 3ZQ9A 4LUTA 4AD3A 4XTDA 1S38A 2FZNA 4GUFA 3IK4A 3N15A 1E72M 1ADDA 2ZX6A 3ES7A 4PCFA 1QATA 3GRIA 4XD4A 4C6JA 5SWUA 1KXHA 4FX7A 4X63A 4LAKA 2OGYA 1DJNA 3QYSA 1L6YA 2ZVIA 3BAIA 3WMCA 1FWBC 3WLLA 3DXIA 2VCBA 2W5FA 1IEXA 2QIWA 1K6WA 5BXSA 2P0OA 2RDWA 3V4BA 4H7ZA 3SIZA 3W2NA 3DENA 2FQIA 4OV4A 3DYMA 1J8VA 1S5NA 1VP5A 2GJLA 2NX9A 1OD0A 3NL5A 2DZVA 4S39A 2DPEA 2YZ5A 4ZENA 2V5DA 4KS0A 1T41A 5FJOA 2IKHA 4M3PA 3GBEA 2GSHA 2PLCA 3GZAA 3E2SA 2OODA 3BW4A 2G97A 2YW4A 1HJVA 4MB3A 4WF7A 5T91A 3H21A 3VNKA 1JZ6A 3SN1A 3CLWA 5E93A 1HL2A 2BSLA 5I3FA 2C1GA 4PMNA 3GXMA 3UVAA 4LVGA 1EDGA 4ZGYA 1OYCA 4XVEA 5C8BB 5DXYA 2V5LA 3WLTA 3SRDA 5CZ0A 4ZVJA 5J5RA 5AN7A 2QPSA 3XIMA 2NQLA 1W9PA 3M0IA 6TAAA 2WSYA 3HG3A 3F2CA 3FN9A 1EHNA 4GQBA 1AH0A 4HK5A 2OB3A 2ZADA 4A2SA 4Z2GA 1UR2A 1RALA 1AJZA 1T8QA 4QP0A 4CLMA 3LXBA 1W9UA 3DHPA 3IIPA 4IX2A 2OEMA 1ZU8A 3A47A 3W53A 2DZAA 3NA8A 4XB3A 4IUGA 4N6FA 3WNMA 2J88A 3NQEA 1LUCB 4Y9OA 1W8GA 3NQGA 5T9BG 4WXZA 4C6EA 2J9ZA 3L9CA 2WMHA 3VO0A 3PNZA 3VNYA 4D6GA 2EAWA 3WF1A 3SUUA 1DJWA 3HTWA 3IJQA 4F9DA 5C6MA 1UD6A 1KGWA 3LHVA 4QAWA 4F66A 4JBRA 3WX7A 1NELA 4M5PA 2QJHA 3KL3A 3HIJA 4LCQA 1L9WA 1VPXA 3VA8A 2XZ9A 3C86A 4DF0A 3QR3A 9CGTA 1C9DA 2Z1SA 1WZAA 4LNCA 1HGWA 3FHQA 1AK5A 1JNEA 3VABA 2V9DA 4HPXA 2DT0A 2PU1A 5U4NA 2D23A 2XN2A 2WMJA 1PSCA 4WGHA 2EEXA 2WCAA 1JG9A 2GQ8A 4HNNA 3TLLA 5BOEA 3LS9A 4GYPA 1KWGA 1ZBCA 4PODA 3UG4A 4LS0A 3BJFA 1ALDA 3NO5A 1ISZA 1R2SA 5FJTA 2YXXA 3EYPA 6TIMA 3ITXA 2DUXA 3LHYA 5JBEA 3IJDA 5D04C 2VO5A 4OKDA 3GBDA 1THFD 1TELA 1RD5A 1VFMA 3SO7A 2ZA2A 3TN5A 5FF3A 2BZNA 1E4LA 2I5QA 2XN1A 3ZXWA 5HNUA 1KA9F 4FR6A 4AD1A 3BLLA 2CBVA 5FF0A 1V0LA 3KZPA 4LY4A 3W7JA 1AFSA 4HBKA 1TJRA 1V02A 2FGZA 3AROA 3OO2A 2VGBA 2Z1VA 1AD4A 1GOXA 3TTQA 4R88A 4JQ4A 3ZJ8A 1YEYA 2A3EA 4RLIA 3EB4A 1NWTA 2P1FA 5GJMA 1RJQA 3GVVA 3G22A 3E2VA 1R85A 2W67A 1KTCA 2YLAA 4CD8A 2ZDSA 5DRIA 1ZJIA 3M44A 5JUVA 3GXPA 1GK8A 2J6VA 1Q6RA 3VOIA 3N04A 4LUJA 3WLJA 3SIMA 3P82A 3C4UA 3R58A 4Q4OA 3N9KA 4LX4A 1JCNA 2W62A 2XSXA 4E8DA 3WEOA 2D3LA 1V3KA 1EYWA 3H26A 3FGCB 1EQPA 2E77A 3JZUA 2XFWA 1H60A 4F48A 3PBWA 3B05A 1D3GA 3IJIA 5H8UA 3WSUA 2V5JA 1H3GA 3RCNA 2EPNA 1JDCA 1I1XA 4G1NA 1I8JA 3L2IA 1UWUA 4NZCA 3KOXA 1ADSA 3C6CA 3WBWA 1SFSA 3OVGA 1E56A 2G3FA 4ZO8A 1Q8AA 1M6JA 1ZAIA 3GW0A 3HQ1A 3M9YA 5A8NA 5JIWA 1UQZA 2Z6JA 3B06A 1HZYA 4DJEA 2B7NA 4IXHA 1GOMA 1OFDA 2J78A 1WKYA 1FQ0A 3ARSA 1B4EA 3WQ6A 3L4VA 3THDA 3N6JA 3EEZA 3NZQA 2WHJA 3R8GA 2IQ0A 3VKKA 1JDAA 2QKFA 4C1NA 1F5ZA 2FMOA 4JQ1A 4O52A 4LGXA 4X2PA 1KTBA 4TX6A 3MY9A 2WMGA 2ACRA 2DSWA 1BG4A 1OF8A 1UBPC 1ZAJA 1OF6A 4MYXA 3W7EA 3KHJA 3OOQA 1HKWA 5AYBA 3O15A 3UNDA 5A6BA 1UCWA 3BTNA 1Z3NA 4UTWC 4LRTA 4IWWA 1CT5A 4JTIA 2NUYA 3RCYA 1JUBA 4QXIA 1X7FA 1GOWA 1E1CA 3F4VA 1FP8A 3ANVA 1E6RA 2CLPA 4R7OA 2WNNA 1TPFA 3C0QA 4LC8A 4F0LA 2Q71A 4F2UA 3FIGA 3VDGA 2J8GA 1JAKA 4P7OA 1FP9A 2NQHA 1XFBA 2WO5A 4LUYA 4PCTA 1B3YA 2YYUA 1GHRA 3P61A 3UEQA 3EWDA 1XLMA 3NPXA 3MBDA 3KOWA 3MWAA 4IP7A 2EPMX 2WSPA 1EYEA 4BY3A 1XISA 3L12A 4LUSB 1OM0A 4TO8A 4JIPA 4K1WA 4J3SA 1K1DA 3UPMA 4O1FA 1IEIA 3PZQA 4MIMA 5A6SA 4ZB5A 3ME3A 5BXPA 1PX3A 3VVGA 3N6QA 4KW2A 5DFAA 3W1PA 5HANA 1LQ2A 2W3ZA 4B5WA 1P7TA 1F3WA 1G0CA 4H3DA 4BF5A 1PZ3A 4LXFA 1KKOA 1YNPA 1PHWA 1LT8A 5D9MA 1H5VA 2BOEX 4TUFA 4FOUA 1S5MA 5AC6A 1Q6CA 1JGMA 3W1LA 4QJ5B 4ALDA 4CEXC 3F4CA 3H7VA 1SZGA 1W1IE 3E0WA 3PJWA 1K7FA 3LCGA 4HNVA 3N14A 3M0XA 4TXEA 2C71A 2H6RA 3UG3A 1TRDA 4UFHA 1YPIA 4EX4A 4XTIA 3E5PA 4X22A 2IW0A 3HV9A 4I8YA 2RDTA 1EJ7L 4PMOA 2HK0A 5JBFA 3DAQA 2QCLA 3QN3A 3E0LA 3FOKA 3T0TA 2X8RA 3CMGA 2FGLA 5I02A 4UTFA 4ROPA 1IV8A 3FYPA 4J3WA 2XG9A 3T0BA 4D6DA 1A0EA 3NEHA 3PTMA 5AHEA 3UCDA 3HO8A 5TQLA 1J5TA 3FDKA 4FZIA 3AIWA 1NOUA 4YS1A 4I7VA 4MJ4A 4GZ7A 4F2TA 2GVJA 4NI8A 2BBFA 5EY5A 5BWAA 2CLLA 4ZL1A 1X97A 4HA1A 4RDWA 1VIZA 4NJJA 3PFRA 3BMVA 1JD7A 2X1IA 1GCYA 4V1YA 3G1XA 3N4EA 4Q4KA 4UBPC 4PMJA 4RX0A 4NAEB 2A6NA 4WKHA 4FMVA 3M16A 4WOQA 4BCEA 1UHVA 3VI2A 3EXRA 3KVJA 1ZSXA 3CQ0A 2NVCA 3IRSA 2V3EA 4L80A 3PR2A 3K8KA 1DHPA 2KAUC 4MZYA 2IQDA 3NZGA 1XPGA 4OV9A 3LHWA 1J12A 1JCXA 4CGTA 3KOYA 3TLQA 1QWKA 1ZQ5A 3U5YA 1EPXA 2VRKA 4LRSA 2OO6A 3O2LA 3H7UA 1LBFA 1GZJA 1TV4A 3UWWA 1PB0A 1KCZA 5H8MA 3SURA 2H9AB 2XH7A 4GX9A 2O0TA 2ZRZA 3R43A 5EMYA 3WDQA 2NLYA 3P3BA 2A5HA 1GQNA 3BLEA 3W1UA 3A5FA 5LKYA 1KB3A 3WJYA 4EKJA 4ZOCA 3CO4A 5AHIA 1GONA 3ZLGA 2QR6A 4TOQA 4AD4A 1FWTA 1OBAA 4V27A 3N3TA 3TSDA 1WXJA 3TZNA 1H0GA 4XD5A 1OJXA 3DGBA 5DMNA 3SUTA 4ATLA 7TIMA 2BXZA 5JQ9A 1XQLA 3U4AA 2INEA 1YXCA 3M0YA 4IJRA 4F8XA 2QW5A 1WBJA 4MB5A 4UNLA 2HVOA 1TB3A 3C2FA 1BYBA 3VDCA 4MAZA 3MKCA 2FGBA 1L8NA 2J66A 1LP6A 4L4PA 4LPCA 1MZHA 5AOUA 3CLMA 4ZOBA 3WMLA 3CV1A 3S5ZA 2PDKA 3H70A 5CGTA 3IGSA 2F7FA 1XDLA 5K4XA 2J74A 3L65A 3CUJA 3G0SA 3NXLA 3AYVA 4XZIA 4UQDA 2ZUSA 3WD1A 3IVSA 1Q6OA 2VX5A 1V8EA 4UCGA 2D0GA 2V82A 3OVPA 5KZMA 2HBVA 4YWSA 1HGYA 3S1WA 2GPTA 3C8NA 3G1VA 5LYRA 2NXGA 1SO5A 2WJZA 4R7JA 3W88A 4C6NA 3PK7A 4S3GA 3C61A 2XM2A 2G3JA 5G2WA 3EWCA 2G3NA 2X1TA 1Q4WA 1E4NA 5GQBA 3N2MA 1I2NA 3VKDA 3S0CA 3L0KA 4J3VA 3IWPA 5IHSA 3SEPA 1M5WA 4UFJA 2ATSA 3S47A 2VD9A 4I3GA 5HBFA 2IS7A 4IHCA 5U7SA 1EWEA 2R91A 1NFPA 2YCLA 3CWOX 1GQLA 4IGMA 1W5PA 3ZLFA 1P43A 3KP1A 4X9SA 1EA9C 2PF0A 2PUZA 1W1TA 2PDUA 4MNKA 5CJNA 4ERIA 2WVUA 4HJFA 1XBVA 1DJYA 2J8TA 4DPQA 1FFQA 3YPIA 5D05A 1EJRC 4CCCA 1JJKA 3RPDA 4L6OA 2YIHA 1E5NA 1UKOA 3U8GA 4HTBA 1T8XA 1UWIA 4DX3A 2X2GA 4KWSA 1ISWA 1FCQA 1PKLA 5FL0A 4OBTA 1QW9A 1TPUA 2Q3RA 3QZAA 2VGGA 4GJJA 1OFEA 1K6AA 2Q8ZA 3W24A 4RJEA 2YW3A 1CGXA 3K30A 4LEFA 3R94A 5BRPA 3VNMA 3GFXA 4GFIA 1RZMA 1ZUAX 4RE4A 2QDHA 1ZPTA 3VE7A 1DXIA 3PS7A 2OTDA 4JIQA 4BA0A 3WFZA 4BJHA 3I68A 4M24A 1M68A 4U2YA 3QEZA 1UR8A 1EA0A 2YFOA 4IJBA 1J0KA 1OEPA 5HQMA 3MMWA 4QQUA 4L6HA 3EDJA 3MHUA 2FYMA 3BJSA 2CHRA 4RNIA 3G77A 4GQRA 4GC3A 1NDVA 1XRTA 5L9FA 2VQUA 1VB9A 4ZQCA 1AA1B 3QMSA 4X0VA 1YTKA 4DWSA 3CHDA 2C1HA 3GFYA 2VCCA 3BURA 3W7LA 5FEPA 4JTQA 2FZDA 4KESA 1XIMA 3NDOA 3N4FA 1J4EA 3TAOA 3LPOA 2UZ9A 1EZWA 2V5KA 2DZSA 1G7VA 3ITYA 4JYEA 2YDAA 4RNHA 4A3UA 4LS1A 1N8WA 3CYJA 5CQ1A 3AAMA 3QPYA 4Y90A 4MKNA 3W1XA 1T96A 3W1AA 1DYSA 3WLIA 2WLZA 1EH9A 3VD3A 1ME7A 1K77A 1UKTA 4LWWA 5DQPA 1Q65A 1K9DA 3UA3A 1M7XA 2I16A 3VX1A 1S2VA 2R94A 1W1A1 5IRPA 4NIRA 5LNSA 6CGTA 2FTPA 4ZO7A 3UNTA 4R9XA 1FKXA 2P8CA 2V8ZA 3MVTA 2YFNA 4QIUA 2VR2A 4MFDA 4NZ3A 1PDZA 2J7BA 1DWIM 1LWIA 1GVYA 3I3EA 5CKSA 3D3AA 3C5QA 3MI3A 4XSMA 3HPXA 4QJ3B 3V36A 1W9DM 5C9ZA 4O13A 5BMWA 2PDNA 1JPDX 3SCTA 4M0XA 2VWTA 3STEA 4JTEA 2XVNA 1KFWA 4JICA 4YTUA 2ZUTA 1FWRA 4EF9A 3A4WA 4GHRA 5A8PA 3P8IA 2PDWA 1FWCC 3M0LA 4MJMA 4WHBA 5B80A 4HGXA 3N2TA 3VMOA 2X1UA 1QPKA 2I9UA 4XBKA 3EOLA 4G2DA 4AQLA 2C1IA 2VRQA 2VNCA 4POCA 2Z1WA 5H1WA 3GLCA 1IT0A 3ZR5A 3E02A 3T05A 3CZEA 4N42A 4ENLA 4INFA 4JEJA 3UGVA 2W4XA 2YL6A 4OTKA 5IBXA 3FNDA 1SZFA 1GZ1A 3N11A 4F4RA 1X39A 5KZ6A 1VYSX 2DVUA 4A22A 1CPUA 2X41A 1TCMA 1TVLA 3V0TA 3SR7A 3B4UA 3L67A 3P8JA 3TX9A 2VX7A 3L21A 2YXOA 5CZJA 2I1OA 4NJHA 4C6BA 2V6AA 3GIYA 1FRBA 4C60A 2GOUA 2PP1A 1YW1A 2NV2A 4G9PA 1VCGA 2E3ZA 2A7NA 1CXIA 3B8UA 5AFDA 4ZQOA 1NJJA 2J7GA 3GTFA 1UR0A 4L7ZA 5JVLA 1K8XA 2PWFA 4DQWA 2QULA 1W3IA 2UY5A 1EHAA 4HMEA 1S2AA 4O1CA 2XGZA 3BC9A 5LGZA 3UJEA 2EF9A 5CLTA 3OIXA 4TTGA 4OECA 3I7SA 5E9AA 2YKKA 4KWOA 3GY1A 5I3JA 2V38A 1MFVA 1MUWA 1OCJA 3PPCA 5D09A 4HHLA 3QY7A 2GUUA 4J3TA 4NU7A 2DT2A 1HF6A 1QPQA 4KERA 5LIWX 3K8LA 1W3TA 1N55A 4CN6A 1HJQA 2R1PA 3SN4A 4BI7A 4RK8A 3SSJA 1UB3A 4AU0A 4KIRA 4EP8C 4US5A 1ZJBA 4R33A 1RCXB 2EPOA 4Z1DA 1QNVA 4JTUA 1M1BA 5K9DA 1TWSA 5AC8A 5CJ5A 2DORA 4AD5A 2RJGA 1ICPA 2WQDA 4GOAA 3RF9A 3SCVA 4F0HA 7TAAA 4JDBA 3H2EA 2BV9A 1JCTA 4LAUA 3ICJA 2CESA 1TTIA 1W1PA 3E49A 2E09A 4J4KA 2XH2A 4JXCA 3ABRA 1XDMA 5HDRA 3OODA 2Z00A 3M6YA 3HPSA 4OBRA 1TJ1A 5EL1A 4B2DD 3NGJA 3EX1A 3TNOA 2OYMA 1S5WA 4EPKA 3UR8A 1WV2A 5JH1A 2Y85A 1HO4A 3RFAA 1HG3A 4NX5A 3WQ4A 5LIKX 5I0DA 2AQVA 1PEZA 1LL7A 2FHBA 1OHLA 1Q6LA 1HTIA 3TTOA 3ARUA 1V93A 2ZRWA 3AMLA 4HHHA 5FF7A 4C6MA 2YB1A 2XINA 4B3KA 3N1AA 3RLHA 2BY2A 2P53A 3VINA 2R24A 2HE5A 1E70M 5LSMA 2PB1A 5HWMA 2CERA 1OG6A 4EAYA 1RBOB 1YADA 1W6TA 4G1KA 3WDPP 1IHIA 3W7CA 2GUBA 3OLIA 1O1HA 4I9JA 1YRRA 3M4HA 2HRWA 3LHUA 3VD9A 5AZ0A 4UNKA 3T8QA 3S1VA 2XHYA 4M7SA 4CVWA 2XVLA 4JN8A 4MWAA 2TSYA 5F1VA 5I3DA 1JCYA 3GH5A 5DMMA 1J18A 2V0TA 3RHGA 3G1DA 1V6YA 3M5XA 1PZ2A 3WH6A 5T26A 1F6YA 1KBKA 2OLSA 3FVMA 2Z2AA 3B8WA 1TPH1 1RY0A 4L5ZA 3GVRA 2JQXA 4BEQA 2ANUA 4DZIA 4O12A 4WJEA 3R0UA 1OD8A 3TP4A 3EKLA 4NJIA 3WQWA 3W3OA 1GJUA 2ZE0A 2R9RA 5CSRA 4QGCA 4K1GA 1W1VA 1SO3A 1ML1A 5CEWA 4S23A 1QNSA 3QQWA 1KNWA 1VQTA 3WDHA 4HYRA 4WDXA 2DZTA 1YDYA 2JIWA 3FXGA 1HKKA 5D9PA 1IR1A 3BAXA 3PSVA 2FPYA 1TG7A 1R38A 3A4XA 1ZZMA 2QUUA 2ZQ0A 1S39A 3BV7A 3URNA 1QOXA 2ATMA 4XK2A 3QY8A 1MXDA 2CIPA 1GPWA 3VKJA 3BCDA 4EAMA 3ZIZA 3W29A 2D73A 1AW5A 3AOFA 1TA3A 3OG2A 1A47A 4PGLA 3W7OA 1V02E 1WX0A 2XSBA 3CL6A 3EMQA 4KQNA 2OKTA 2VFEA 1BD0A 5B7ZA 3VOHA 3OVQA 3HPZA 3BSHA 2ZZ2A 4HSNA 3BLPX 3CPRA 3RX4A 2YBUA 3FAWA 5CC6A 3WBAA 1KFKA 5EMLA 1XH1A 4Q3MA 4GYKA 4L61A 2AKZA 2QS8A 1K9EA 2O92A 4IM4A 2DT3A 4NZ4A 4J2MA 1UP2A 3II1A 1O5KA 4MFEA 3NAVA 3HMCA 3EWXA 3QPZA 1MNZA 1TYGA 3EPNA 3WDJA 3P5ZA 2OSWA 5EBUA 4Q4RA 4IMEA 2NW0A 3NG3A 1DE5A 3L5LA 1HKMA 3SECA 4CNTA 3VIJA 1EKOA 3A4AA 4TX9A 3VX0A 3DKLA 3TCSA 3R5EA 4IFRA 4NKCA 4UFMA 3ITLA 1I2PA 4FLSA 3G1SA 4C1NB 3G24A 3EWYA 4V2XA 3UESA 1OC7A 1OK4A 4ASTA 1TTPA 2VR5A 4RCXA 1UMYA 4BR1A 3VC6A 1WYIA 1ZRQA 1EC7A 1KLZA 1RPKA 3CUZA 2BFGA 1E1CB 3HPFA 2R82A 5D2TA 3H55A 4LYPA 3U2OA 5GJPA 4XVDA 1DQUA 4XG1A 4KPLA 3UXAA 4P61A 3AXXA 1OT1A 4J27A 4C6QA 1DIEA 2ISDA 2PDQA 1G4EA 4EVZA 1E43A 1FA2A 2VEGA 1QHZA 3AIQA 5IHRA 4HOWA 5I5RA 4AB4A 4JNYA 3MVIA 1HXJA 2Q02A 5C70A 4N0RA 4PMXA 2VGIA 4GUGA 4JGDA 3W7MA 3GYEA 1O5RA 5C9WA 3LXCA 4JD4A 1ICQA 3PC0A 4PSPA 3WMBA 3MPGA 4IGHA 4XD6A 1AL7A 1H61A 3W87A 3MYPA 5CJMA 3RPTA 1A49A 3WO8A 4Y9MA 1GVFA 5AHMA 3W86A 2VGFA 3QSRA 1RA5A 2WHKA 3D0CA 2J7EA 1P7TB 1S2WA 3HZ3A 2G3MA 1GQIA 1MW3A 2Q3OA 1QO5A 2P0IA 4JL2A 4XKYB 3SUSA 2X1SA 4GX8A 3ONBA 3DI1A 3KW3A 3TSMA 1XSKA 3HPAA 3HA1A 1CIUA 4DJDA 1UMLA 1X1ZA 2FDSA 4DUOA 1YDNA 4F9JA 3RDKA 2CNCA 2IKGA 2F84A 4HP5A 2V5BA 3GHTA 4UTUA 1WO2A 1ZAHA 4RPPA 3M5YA 4HZ8A 1FWSA 2PDXA 4C1LA 4E2DA 3IANA 1HN1A 3QV8A 4C5ZA 4GVHA 3E0IA 2EPKX 2J27A 1JUKA 5ECUA 1IT7A 2QCFA 5G1YA 2XDFA 3F5LA 3T8LA 3VCRA 1QBAA 2BG5A 1FHDA 1SZNA 5A6LA 4RE0A 3LY0A 5DANA 3OZPA 3R89A 2CZVA 1H7PA 5DMYA 3PM6A 1L8PA 1FBAA 5C9RA 2D24A 4KCTA 1BQGA 8RUCA 4RW5A 2V30A 1RJPA 4TV5A 1JYNA 1NY1A 1BFNA 2ZTJA 1SFTA 3T09A 3SJNA 3MHGA 1LBLA 1UA3A 1VFFA 4PBEA 2UY4A 1TX2A 2A4AA 2GK1A 3PWGA 4Q4MA 1TPC1 2Y7FA 4H9XA 3SRHA 4ICNA 1OCQA 2R6OA 1VLWA 1REQA 4PFHA 3BLIA 2V3DA 1QHOA 2YA0A 2OU4A 3KLLA 3LDVA 4O14A 4XBSA 1W1YA 2JEQA 3WL0A 3IIVA 1YDOA 1EO5A 3R79A 4XIMA 5CAHA 5JBDA 2QUNA 3KBVA 2VEMA 1E9IA 4R34A 1FXPA 1XSJA 4AIOA 4WK9A 1E0UA 1SW3A 1LWHA 4YNGA 2PBGA 1AJ2A 4ZQPA 1W3KA 3ZFHA 2TYSA 3TFCA 3MDWA 2GVGA 1JDFA 3RITA 3GTHA 3QR1A 3NPWA 4LYKA 1LRQA 5BU9A 1L6FA 5IXEA 3DESA 1TZ9A 3OA5A 4DHGA 1A80A 4EANA 1R6WA 2C13A 4TR9A 1XIEA 5K7JA 1CDGA 4HA3A 2PCEA 1NDYA 3K13A 2DU2A 1EIXA 3B03A 1CXLA 2WWCA 1E9YB 2FTWA 2PMQA 4Q8MA 2KX9A 4B9ZA 1E1EA 2W79A 1YXYA 2VUNA 1YTEA 4Q7BA 3MSYA 2R1LA 3FSUA 2E4TA 4W8LA 4BF7A 1Q7QA 2CETA 5C71A 4K39A 5I06A 3AMKA 4JEQA 1XQKA 2Y8VA 3FJ4A 4KCVA 4QCFA 4C1KA 3UG5A 4UTTC 1EFZA 2FVMA 3DFHA 1TTQA 3TYEA 1FHVA 3CK5A 3CV7A 5LZLA 3UU0A 1Q85A 1E15A 3LLFA 4J40A 3S6TA 3MZ2A 4CD4A 2QUTA 1VIWA 2VFGA 1CXHA 2MNRA 2D2JA 1OYBA 4ADSA 3TNBA 4FI4A 1XKJA 5GNZA 1R2TA 3W27A 3K2GA 3F03K 3BJTA 4I5RA 4WKFA 3T2PA 1UROA 1VHNA 2AGKA 3W25A 2BVTA 4UMCA 3WDRA 4GJIA 4GZEA 5KZDA 5CGMA 3N2XA 1E73M 4BI6A 1QW8A 1EEPA 1ISYA 3RLVA 2P8BA 1Q3NA 1IXPA 1OCBA 3UCCA 4DUWA 4AY1A 1A5CA 4UWMA 3DX5A 1R46A 4FLRA 3THUA 5K4ZA 4H7CA 1L6WA 2PP0A 3BUVA 4YYCA 1CCWB 1KR0A 3UJSA 5FESA 3CWHA 2DFAA 5EGRA 1OY0A 3H8AA 1RBAA 3B4YA 2EJAA 5HUPA 3O63A 1POKA 3CIWA 3THCA 3PG9A 4HNUA 2W27A 2Y61A 2ZBTA 5E0KA 1W5MA 3CTLA 4LBRA 1QNRA 4JIRA 5IFPA 1F6KA 2A7PA 4J35A 1GVQA 4R27A 4ZXOA 1GYMA 3MKVA 2BMBA 1BRLB 4IGNA 1F3EA 4DJFA 4MNMA 1L6SA 4TIMA 2DY3A 3O0KA 3B0XA 3BSMA 3WLOA 4TVUA 4H8VA 1JGIA 1QXLA 2HBXA 3VFCA 1F61A 5CPNA 2A85A 3VMPA 2WOQA 2PA6A 1EJVC 2W61A 3G8EA 3S6OA 2WNQA 3D46A 3S2NA 1AG1O 2OZ3A 3CAKA 4FXRA 3QOKA 3RU6A 2HVNA 3DI0A 4UTHA 3W2UA 3AIVA 4M82A 3QSTA 5DO8A 4JHZA 4A6GA 3CUFA 2PWDA 3VIFA 3BOXA 1OC5A 3NM3A 3QHMA 2PGRA 2QPXA 1TX0A 2WC7A 4Q8WA 2FPTA 4KRZA 4JTKA 3VOFA 3W1NA 3T2QA 1VYPX 3U2ZA 2QZRA 2G8ZA 1HJSA 2CZ5A 2WCGA 2OOFA 3T4WA 1LTDA 3O1NA 2RFGA 4K2SA 2OEJA 5F2IA 3A24A 3GVQA 1V3IA 2Y62A 4Z2KA 3TYDA 1QNQA 2WSKA 4Z2IA 4N9BA 1IEWA 4DWSB 3RRAA 1H7RA 2HXTA 3Q67A 4FNPA 1V4YA 4HHPA 3WEZA 2HQAA 4MPQA 2F2HA 3EAUA 5CSUA 2ACUA 3L5AA 3VZZA 1UH3A 4PRWA 3PJXA 3N2BA 5AB3A 1SQ7A 1G01A 4MG4A 1KWKA 2GSEA 1T0OA 2WKGA 2NWSA 1UUOA 3IPWA 3MSRA 3RJYA 3PZIA 1PHQA 4MY8A 1D2KA 2J7FA 5D33A 3A3XA 3LPPA 3WUGA 1UG6A 3K8MA 1DPMA 1SW0A 1N8IA 1SGJA 1JPMA 4XWUA 4QRNA 3VGDA 4LS2A 4ZODA 4XZMX 1GOKA 3VILA 3GKFA 4YHGA 3KZSA 2W0UA 3TW6A 4FNSA 4PUDA 4YIWA 2YBTA 3VGBA 1C9WA 1ZJAA 5A6KA 2ZFAA 2B7PA 3EPOA 4ERGA 1F4HA 3CXOA 4JS3A 2DV0A 2J75A 1KM3A 1UH2A 2A0NA 3WQVA 1K8ZA 3B9OA 4EACA 1ONXA 3P74A 1ZHAA 5ABHA 4DUVA 3I6EA 2ISSA 3PWIA 1A50A 3HJEA 4A21A 4DO5A 1C93A 2Q6ZA 2CCRA 1IEVA 3ITOA 3AQUA 5FJRA 5EMKA 3UZJA 1Q8JA 4H9VA 3PBGA 1GNXA 3AISA 1PZ1A 4G56A 4O0QA 2QDGA 1IZKA 3MP4A 2E5BA 1KM2A 3LMYA 1V3JA 5AHLA 4CQCA 1BGGA 3PP7A 3WUEA 1O66A 1KRMA 1K9TA 1MUCA 2OZ8A 2QT3A 1CECA 4WEVX 1L0PA 3P0WA 3A12A 1TSIA 2OEKA 2DUAA 1TZZA 3BXWA 1FH9A 3H2FA 3LCIA 2HPMA 2F6XA 4LBUA 3E96A 1VPQA 1Z48A 3QTGA 1ZTVA 2XM1A 4DBEA 1QHPA 3A5VA 1ECQA 1FOBA 4NZ5A 2D0HA 2NWRA 4GK8A 1U1HA 3WDIA 1DTNA 1BWLA 3E2QA 1FWWA 1KRAC 3VNZA 1JZ5A 2GVYA 3W85A 1SO6A 1YNYA 4DXVA 5HAOA 4FP1A 4QX4A 4QDMA 3UGRA 4LUSA 4GZJA 3BGJA 1RSCA 1S5TA 3SY5A 1KM6A 1XH2A 3NUKA 5E09A 3TKFA 3SQSA 3N4AA 1UJPA 2FZBA 1KKRA 1P0BA 1M53A 1U5HA 4N4PA 2Y24A 4HQVA 7ENLA 2EGZA 2PU0A 3QQ0A 3GVWA 4AZCA 3ZLHA 1AW2A 3U7BA 1FCVA 1QK2A 5CPLA 2X0HA 3NQBA 1UUQA 4RR4A 1O6IA 4W9TA 2BWGA 4KETA 3C2OA 4LEQA 2EHHA 1V79A 5CAKA 3NQFA 1MWOA 1K4HA 3WH9A 1E3XA 3EXSA 4AC7C 4ZE4A 3URBA 4JCMA 2QCCA 2R1NA 2LLEA 3USBA 3R25A 2WZTA 2FH6A 3GXDA 1V08A 1X8CA 1NWRA 4HTYA 3PBMA 2E9LA 3MUXA 3CPUA 5XIAA 1RUSA 3C0LA 3QR0A 1E0VA 3KBNA 1JRBA 1LQAA 1SVDA 1PVNA 1EXPA 4B90A 2HCVA 3KRBA 5F1UA 4QSFA 3W7KA 3ZT7A 1P6CA 1Z32X 1PTDA 5EFFA 3T4CA 4E8CA 3BAWA 4ZQRA 1VH7A 2C79A 2PTWA 4Z1YA 2QHAA 4IL0A 2OWCA 1UWAA 4IX0A 1HP4A 3NPUA 1CLKA 3W01A 3MV01 3AXMA 3BL3A 3ZWSA 3T78A 3WBYA 2R1MA 1A5OC 2VEKA 3CZKA 2INFA 1K8CA 4U33A 1WKDA 3U2EA 1F6PA 1E5JA 1PL9A 2VM8A 4NJGA 4WDWA 3QW3A 4GIYA 2XYLA 3WFAA 3AJXA 1DE6A 4NAEA 1FWFC 1FWNA 3L23A 3QTPA 1VAHA 2NX1A 4FOJA 3GNPA 4QEEA 7PTDA 2PDYA 4IIBA 4PEEA 1LM1A 2RDUA 2ZUMA 4GYPC 3WN6A 2J7DA 1IXQA 1TTJA 3U3HA 4D2JA 2A21A 3PSWA 4DBSA 3GNOA 3T40A 3TQ0A 1OWQA 2OQLA 4OHQA 4MM1A 3DERA 3IACA 3W1MA 1C29A 2PRHA 3NYZA 2BP1A 4JIEA 3TJIA 1KD0A 2G0WA 4QAIA 3N9SA 1A5KC 3TWBA 3W02A 1U1UA 2BGSA 4QLJA 3WD3A 4PCSA 3D6NA 4Z17A 3W84A 4XV0A 2DVTA 2P3EA 2H9AA 3P93A 5KTLA 2DSKA 2WC4A 1Q7ZA 8TIMA 2ZRXA 1Y0EA 5D38A 3V35A 3KHDA 4B4HA 1XGDA 3VD4A 1I1WA 3GYCA 1CTNA 2DW7A 4DLMA 2GJXA 2FMNA 1C8XA 2Z0IA 4FNQA 2QIIA 3B8DA 4LAOA 2OELA 5DBUA 4Y9PA 1ZALA 2GQ9A 4YPJA 3WK3A 1KQZA 1XYLA 1FWHC 1ISVA 4PC8A 4O8AA 4L64A 3G1RA 2H90A 1FDYA 4WR3A 4YHEA 3QF0A 4PN2A 4OIFA 3RAOA 4HK7A 1EGZA 4KGLA 3QMRA 2E6FA 4IF2A 3WUBA 1XRVA 3QLLA 3QYQA 1MZRA 3IVUA 4JQAA 3VFLA 3VU2A 2SFPA 3EGJA 3W83A 1ZP4A 2OYLA 5D4YA 1B31A 1XD0A 5EFDA 3W7RA 3MS8A 3S2LA 3CL8A 1TR1A 2Z25A 4UQBA 4ADTA 3N19B 4JZ5A 3KBWA 2JKEA 1W32A 4DPPA 2CXEA 1ITQA 1J0JA 2ZXAA 2XIMA 1A53A 2DQWA 2VOTA 3NO3A 2NT0A 1GVEA 1TA3B 4KT2A 3TR2A 3HGOA 3SCOA 1H1NA 1XRSA 3UR2A 1XCWA 3TC3A 3GTIA 3LENA 3MJMA 1F2JA 2IKJA 5DCBA 6XIAA 3EDKA 2I56A 3WH7A 4GO9A 5C2CA 2PLMA 1XW8A 3EDFA 3TN4A 4JFSA 2Z4GA 4LY8A 2WNZA 3TYAA 1N2VA 3OA3A 4R53A 4Q8VA 1GOQA 1TMHA 2QJNA 3GB6A 2X0SA 5AC5A 3SN0A 1VYRA 4LVFA 4WGXA 4ERAA 3B3DA 4YYFA 4S3AA 3AHVA 4FXJA 2F6KA 1VHCA 2QXWA 1DXEA 4YXGA 4GY1A 1HFBA 3A4JA 5A6TC 4Q8UA 4XZBA 3PUDA 1K7EA 1TO3A 5I7GA 4X60A 2IPGA 1QVBA 5TAOA 2ZYFA 1EP2A 5CZTA 3EXTA 3MKKA 4N02A 2QV4A 4JTAA 3E1F1 3R0DA 3G0XA 4I9TA 1KFLA 4ZO9A 3NL3A 1E3ZA 5J8LA 2XIOA 3DC8A 4AZHA 4KEVA 3AYSA 1NQKA 2OCZA 4IFKA 3WQEA 4UR7A 2D20A 1VBGA 3ABZA 4QE1A 5I07A 2CLOA 4GVFA 1OGSA 3L0NA 1NP2A 2OQHA 4NQ1A 4I7UA 4L9ZA 4UTIA 3KDNA 4O4VA 5I6SA 3Q37A 4IPPA 1B57A 3JVAA 1V6WA 4BK9A 1V5XA 1ZENA 1VPYA 3GTNA 4NG3A 1QOPA 3GG1A 2QF7A 3LSBA 3A21A 2GGJA 3R8RA 1IF2A 2VMFA 1G69A 1K70A 1VD6A 3KVKA 4LSBA 1C8QA 3AO0A 2PFHA 2RH9A 3T55A 3M46A 2J13A 3B8IA 4KF1A 5DT7A 2C0HA 1M9HA 2J47A 3GNRA 1OX6A 4ML9A 5F4WA 1FWIC 3H2OA 2FZ8A 5AYZA 3MW7A 4EOUA 3K4DA 4AEEA 2OPJA 3AXIA 7CGTA 1A5LC 1WDPA 3NQMA 2V3FA 1MUMA 1XCXA 3LHZA 2PD5A 3W7HA 3A3WA 2CEQA 3RM9A 1BEUA 2VFFA 1Y65A 1SU5A 2XH0A 5CLWA 1HNYA 1ELSA 1GOIA 1TQJA 1PTAA 3BMXA 1EB3A 6REQB 5D8WA 3BZJA 1JZ2A 2HZGA 3W71A 2JF7A 1FH8A 4J3XA 1F7BA 4AY8A 4YCOA 4GXPA 1P4CA 2HPIA 4PUMA 4P2VA 3O3RA 4PMRA 4GABA 4WY0B 1WNOA 5K3VA 4NRSA 2QCNA 5A8OA 2ZZ7A 1UD5A 4PBFA 4GA8A 1IXOA 2EQDA 1XYMA 2HJPA 2HDJA 1BSLA 1GW9A 3QH2A 1G9HA 4MOZA 2AL2A 3ZJ7A 5I3GA 4KWWA 3R0KA 4PSRA 2A3AA 1E71M 1FY6A 1TIMA 3GDRA 1SM9A 4D6EA 5F4SA 1LT7A 4AIBA 3WD2A 2YCIX 4LB4A 3TQPA 4PL2A 2WKLA 4JKMA 1Z9AA 1PYFA 1LLWA 2VELA 4NASA 1J6PA 3I7RA 2TRSA 2HEJA 5BRBA 2VEIA 4FOKA 2INZA 2GK1B 3ELFA 2B4GA 2UWFA 1UKPA 1UPMB 2P3ZA 1WDSA 3ZT5A 3TZFA 2XFFA 1SO4A 3GH4A 3QC3A 2VC7A 6XIMA 1KBLA 4LW7A 2Q09A 2QNEA 3BG9A 4QM1A 3EOEA 4DNMA 8XIAA 1UOKA 3VKBA 3V5FA 5DXXA 1HT6A 3WK2A 4EWND 5H2ZA 1GGOA 2H8ZA 1UZHA 2QMKA 3TJ4A 3B8VA 1J93A 2DP3A 3GDTA 2VL4A 3QKEA 4QJ1A 1G4PA 1O4UA 4O28A 3FVDA 1E6NA 3NDYA 1P1MA 1W37A 4WLCA 1UUMA 3AHZA 4FF7A 4FLOA 1P0DA 2ZX9A 5JMUA 1CXEA 4HOZA 3MMDA 1E6ZA 4HSHA 5LXEA 1UPPA 1Z42A 2FB3A 4UTJA 3QY6A 4BEUA 2PAJA 3RN6A 1JVNA 3NVDA 2VZOA 1W9VA 1W2VA 1XWYA 4NRRA 2G41A 4O11A 4AIEA 2TPSA 1FX6A 1XJBA 1QFEA 1PWLA 2FZMA 3KRZA 1XLHA 4GLEA 4GH1A 2BVWA 2YB4A 4FF5A 4J9JA 2NVDA 3MUZ1 4RPQA 2YX0A 3G6MA 1TREA 3N2OA 1DJXA 4G7EA 4IIHA 2YSWA 4JKKA 2PDMA 2J77A 1VF8A 4B5SA 3WENA 1YX1A 4GC4A 1PX8A 3TAKA 5EMJA 1J5SA 1Z89A 4HA4A 2PLKA 2VC6A 1PV8A 3BDKA 2RGLA 2WZEA 4FO4A 1WZKA 2X42A 3LPFA 4B5VA 4IPNB 2DJXA 3HF3A 4Q4PA 3VGGA 1CNVA 3FK4A 3XINA 1I0DA 1XKYA 3UBPC 1DTUA 1TE6A 3ARQA 2OZTA 1H09A 3WLKX 1W54A 4F0KA 3S8HA 4Z08A 1WDQA 1NOWA 3GDMA 3KL5A 1CXKA 3I10A 2BGQA 3TU9A 3L4TA 3HN3A 4F0SA 1VGAA 2Z28A 1I45A 5ABGA 5REQB 5AHNA 3GX9A 3O7UA 2EO7A 5A8QA 3FFSA 1JFXA 1IQ8A 3P5YA 4WUIA 4KIEA 5CGQA 2J24A 4DIAA 1DWJM 2DZBA 3EEGA 1E4MM 1W1ZA 1V03A 1AUSL 3MZNA 1U30A 3ZS4A 4AAJA 1AW1A 4RDZA 1G4SA 1KM4A 1EWDA 2PURA 1A5BA 1W3LA 3MA8A 2ZTKA 5EB8A 4HVXA 3LCWA 3H12A 1FWJC 3U2CA 3KRUA 1OG0A 1G5AA 3WK1A 2VD8A 2PDGA 4Z2JA 3AS3A 3CMFA 4XISA 5AC4A 2UBPC 3M41A 3PBYA 3R2GA 2BB0A 4DZAA 4AD2A 1TQXA 1TCDA 3KBJA 3NQ2A 1EX1A 4FHAA 1LL6A 3RO6A 2KZHA 5MHBA 5MKGB 4A2RA 1UD8A 3K46A 1UZ4A 2PWEA 5JIPA 3MSGA 3HQOA 3WQDA 4H6RA 1ZNNA 4F2BA 2NQJA 1Z41A 2X40A 3GNXA 2QQ6A 4GPNA 3FJNA 2Z29A 3A6OA 1R0MA 4WXYA 1WXYA 4ORMA 1MVYA 2ZVRA 1YIXA 3M6DA 3OQ8A 5E0FA 3VDBA 3BLDA 2ZC8A 1EJXC 2VJXA 1ZS2A 4GQQA 3WQOA 3TVAA 3USZA 3KWXA 3T2OA 3RG6A 3L4ZA 4DWSC 3PPHA 4JTRA 5HQEA 4CQBA 3LHTA 3RK8A 1J0HA 3ABQA 1OGGA 3DG6A 1SZRA 3PNUA 1KGXA 2RKXA 5G1TA 2OR2A 4JTLA 3V0SA 5XIMA 1Q4NX 2VKZG 1ECEA 3EWZA 4O15A 5HOSA 3ZR4A 1NTHA 3NFUA 1KCXA 3N3MA 2W9MA 1EGMA 4DI8A 3ZR6A 3F4WA 4PUEA 1X7IA 3G3MA 3V5OA 5HA7A 1SFJA 1NDWA 1GOOA 1VBHA 3UCQA 1E6SM 4O19A 3V0UA 4KRUA 1HUVA 3O0FA 3IV3A 3HBLA 1QRQA 4FLQA 1UR9A 4TV6A 3KBMA 2PRMA 4WY0F 1QNPA 1PO9A 1J9YA 5A2BA 5BXRA 4BF9A 4Z1AA 4US5D 1NH6A 3WJWA 3IK2A 1XH0A 3M0ZA 1W9XA 3GM8A 2Q8LA 5HNTA 1V6XA 4U5KA 3TWAA 1WZLA 5DLCA 4CCZA 1ONEA 4BS0A 2GGGA 3WQGA 3KAOA 1V7AA 1U1JA 5KETA 4I90A 2R1KA 2ZUWA 4HU4A 2CZFA 4DBDA 4P7QA 4OFCA 5LIYX 5F2MA 3L2LA 4C7FA 4IPJA 3FA5A 4H9MA 1BPLB 1SUXA 1U83A 4LOCA 4PUJA 4ZSTA 3KWSA 4HIBA 3GNDA 2ZZ3A 1O68A 3W28A 1R3WA 4WSHA 4ACZA 4YL2A 3THQA 1DWFM 2QDDA 3QC0A 1D8CA 1VBUA 2WZIA 1BKSA 1YNQA 5D30A 1OX5A