1LWIA

3-alpha-hydroxysteroid/dihydrodiol dehydrogenase from rattus norvegicus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
311
structure length
305
Chain Sequence
MDSISLRVALNDGNFIPVLGFGTTVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
publication title Structure of 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase complexed with NADP+.
pubmed doi rcsb
total genus 111
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1996-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lwiA00
4LBRA 2ACRA 4IGSA 3BURA 4DZ5A 2HV5A 1T40A 2HE5A 1R38A 1EXBA 1RY0A 4JTCA 1ZUAX 1XGDA 1AH0A 4LB4A 5LIUX 3LZ3A 2P5NA 4L1WA 3GHTA 4RPQA 4XO6A 3N6QA 2PDFA 3LUTA 2AGTA 4GQGA 2BGQA 2PDIA 1LQAA 3V0SA 3GHSA 2PDKA 2WZMA 3M0IA 5KETA 1QRQA 3UFYA 3O3RA 2IKGA 2R9RA 2FGBA 4XZMX 3WCZA 1HW6A 1ZGDA 4IJCA 4LAZA 1UR3M 1SM9A 3BCJA 5AZ1A 4QXIA 2PD5A 4IJRA 2PDBA 3P2VA 4JQ4A 5JH1A 2NVCA 4PRTA 1MI3A 4JTQA 3LQLA 3MB9A 2DV0A 4YS1A 3LEPA 1PWMA 1YE6A 1Q13A 3R8GA 4XZLX 4XZIA 3R94A 5HNUA 1YE4A 4XO7A 2HE8A 4PMJA 2NVDA 2FZ8A 2F2KA 2PDWA 4ICCX 2FZ9A 4FZIA 5HA7A 5LIKX 3U2CA 2QXWA 3LQGA 1YNPA 3D3FA 1PWLA 4GCAA 2FZBA 2R24A 4PRRA 3V36A 3C3UA 2PDLA 3CV7A 3LNMA 4QBXA 2BGSA 3F7JA 3DOPA 2IPGA 1S1PA 4DBWA 4XVEA 3R7MA 3RX3A 4G5DA 4FALA 5AZ0A 1T41A 1Z89A 3FJNA 3EB4A 3CV6A 1GVEA 1RALA 4GIEA 1Z3NA 2IKIA 3R6IA 4JIHA 3GHUA 5DANA 2HDJA 4DBUA 1MZRA 1IEIA 2VDGA 1VP5A 2INEA 1MRQA 2ACQA 2PD9A 2WZTA 3UWEA 3RX2A 3H7UA 4I5XA 4XK2A 3DN5A 3V35A 4EXBA 2DUZA 4WEVX 1XJBA 1A80A 1AH3A 2PDUA 3LN3A 3UYIA 1EL3A 4XZHA 4JTRA 2IPWA 2CLPA 2PDJA 5LIWX 3MC5A 4OTKA 3O0KA 2BP1A 4JQAA 2IPFA 4WRHA 2I17A 2PDMA 4FAMA 4MHBA 3R58A 3WBYA 4L1XA 1Q5MA 1AH4A 2PDYA 3FX4A 5LIXX 2IKHA 1XF0A 1AZ2A 4JQ3A 4HBKA 2ALRA 2F38A 4PUUA 3M64A 3CASA 2C91A 2HEJA 1QWKA 1PYFA 4Q3MA 2IQ0A 4WGHA 3UZZA 3LBOA 4YVPA 3CAVA 3WBXA 4WDXA 3G1RA 4PUWA 1Z9AA 5JH2A 5LIYX 4GA8A 4GQ0A 1AFSA 2IKJA 2IQDA 3COTA 4JIRA 2PF8A 3N2TA 4YVXA 1OG6A 3ERPA 3S3GA 3EAUA 1JEZA 2PDGA 3V0TA 1EKOA 4XVDA 4QR6A 2J8TA 1YNQA 3ONBA 3R8HA 1S2CA 4ZFCA 4XAPA 1ZSXA 2FVLA 5M2FX 4YVVA 3QKZA 1HQTA 3UZWA 1PZ1A 1ZQ5A 3BUVA 3G5EA 1EF3A 2PDQA 1S1RA 2PZNA 4WDTA 3UP8A 3LZ5A 3EB3A 3T42A 3CMFA 3UZXA 5C7HA 4LB3A 1PZ0A 3BV7A 1J96A 4WDWA 1S2AA 3CAQA 4WDUA 4GACA 4XZNX 3UGRA 2ACSA 4H8NA 1VBJA 2I16A 2ISFA 1ADSA 2PDHA 3M4HA 4YU1A 4JQ2A 3LENA 4ASTA 4LBSA 2PFHA 1FRBA 4NKCA 1X97A 3B3DA 3LD5A 4QX4A 4GABA 3R43A 2HVOA 2A79A 2PDPA 3NTYA 3GHRA 3UZYA 2DUXA 1M9HA 2FZDA 4H7CA 2ACUA 3KRBA 4PR4A 1US0A 1LWIA 1C9WA 1Z8AA 4Q7BA 3Q65A 4AUBA 3H7RA 4JIIX 2INZA 3UG8A 4JTDA 3V0UA 4F40A 4EXAA 3ONCA 4HMNA 4FA3A 1K8CA 4JQ1A 2IPJA 2PEVA 5HNTA 2PDCA 4DBSA 1RY8A 4R9OA 1X96A 3VXGA 3WBWA 2IS7A 2HVNA 1AZ1A 4LAUA 4JTAA 1IHIA 3GUGA 3H4GA 2PDXA 1X98A 3Q67A 3RX4A 2PDNA 3WG6A
chains in the Genus database with same CATH superfamily
4NP7A 4LBRA 1JCYA 4N4QA 2VD9A 1QBAA 1TTJA 1W3LA 4Q8UA 5FESA 4H01A 1HL9A 1BVWA 2PWGA 4LANA 2BDQA 3MVIA 2BHYA 4YTSA 3VAVA 2ZZ5A 2BASA 4Y8EA 3GIYA 3QV6A 3V3WA 3N2OA 3DG6A 2DIJA 3HF3A 2YDRA 4IQEA 3DDMA 2O9OA 2R8WA 3WZ0E 3IANA 1E9YB 3V7PA 2HISA 1DIDA 1IWPA 1AL7A 1AJZA 1TWDA 3EEZA 4ZOCA 4LC6A 4GMEA 1GTEA 1OX6A 1H7PA 2E6YA 4ZFMA 2PDKA 4BFAA 3MO7A 5KSWA 3LPOA 2GJRA 3W29A 3E0VA 3CT7A 1ESWA 4HNTA 2ISVA 5H6HA 3TN5A 1L9WA 1W91A 3OODA 3PP7A 1UD4A 5EMJA 5AZ1A 1B3WA 2CZ5A 4QNEA 5I3FA 3BPWA 3GQYA 5AHNA 4BF9A 4PRTA 3AIBA 2Z1KA 1PEZA 1RA0A 1QK0A 5C55A 1HL8A 1XFCA 2ZWYA 3RCNA 2FPVA 3AYVA 2DV0A 3L66A 4GC3A 3BANA 3LOTA 4MIMA 4MY9A 5BZAA 3T0TA 1KLZA 1TCDA 3E2RA 3ARUA 3ZYZA 1WX0A 4MG4A 2QV4A 3OHIA 1PXGA 3U5UA 1ZL1A 4AWSA 2J6XA 4O17A 1LLZA 3GK0A 1XV8A 3VILA 1UROA 3TIMA 4L4MA 5D32A 2X1TA 3ES8A 2FYMA 2DQWA 1BXNA 3CQ0A 1LUCB 5AYXA 1VIWA 3H24A 3GC5A 5FJOA 3TDFA 3CTTA 2X7VA 1KGUA 5BROA 3VNLA 4NSBA 2D0FA 4AQLA 4XSLA 3YPIA 1R3YA 1TMQA 3GDLA 1JGMA 1T41A 3QPEA 4GNKB 1S46A 1V3LA 3JW7A 1HGWA 1BSLA 3I6EA 1CXIA 3UYCA 1W31A 4WY0F 5A8OA 4U3AA 1G4EA 1ISZA 4JFSA 1J12A 3BQ5A 1LDCA 4K1WA 3T55A 4DBUA 3M5ZA 1MZRA 3FS2A 2YXGA 5F4XA 4H4IA 1D7FA 1RV8A 2WNZA 4HHPA 5REQA 2QCHA 1SYTA 3RX2A 4A3YA 3M16A 4Q7IA 3M46A 3EGJA 3AJXA 2DUZA 4QJ3B 5AFDA 4JHMA 5AYIA 2ZTKA 2PDUA 3S1UA 1E0TA 3B0YA 4KKXA 3TTYA 4DPPA 4H9MA 4UZUA 3BARA 2Y2WA 3G24A 3N19B 1BF6A 1ISXA 4OV9A 4Y9AA 4UTUA 5TF0A 4GPNA 1CGUA 1RQHA 2V6AA 1ZCOA 2DEPA 3MWAA 5K9DA 2ATMA 3FFSA 5JMUA 2CIPA 1XIDA 3LXCA 2CLIA 3ISIX 5IXEA 1M7XA 4JIPA 2NUYA 4TIMA 3K4DA 3I4EA 2CBVA 3VKKA 1UD2A 3LPFA 1G0CA 1GNXA 4PN2A 3SGZA 1WBHA 2QZRA 4ERAA 4BKNA 3I7QA 2CKRA 1Z9AA 1TWZA 5F4SA 2O92A 2ZE3A 4LSBA 1YBQA 2NLIA 3G0SA 1F3XA 1V08A 1DWIM 1GG1A 3N2TA 3BAXA 1KCXA 3QV8A 3AHTA 1F61A 2XM1A 4F3HA 1TR9A 4R7JA 4KERA 4Q6XA 1QCWA 2XH4A 3QM3A 3KAOA 4XVDA 3PFMA 3W24A 1KGXA 4ZO7A 2PWDA 2J8TA 3N4FA 1HKMA 2PLMA 3EX6A 1W6TA 4LCSA 1EZ2A 2DZUA 3IVTA 1YTEA 3BLLA 1E6SM 4MFEA 3UXIA 5HULA 3AZTA 3GLCA 1KBIA 3W1MA 2NWSA 3NO1A 1PIGA 4E8CA 1WA3A 2Y70A 2A7RA 1F4HA 2P8BA 4GQBA 1S2AA 3CM4A 2JEPA 3BGJA 4PRWA 4TV5A 2ABAA 4D6JA 3R13A 1MYRA 1O66A 3FHQA 1Q6LA 2ABBA 3L2LA 2GL5A 3DYOA 5CC3A 2OZ0A 3RR4A 1K1DA 3S83A 3NAVA 1J0ZA 2HNEA 2FTWA 1PO9A 1J5SA 1QI0A 5CG0A 3S1XA 4YCPA 1MUMA 3KVJA 4OV4A 1E1FA 4JYDA 2DP3A 2VURA 2IUZA 4F2UA 2HVOA 3SUVA 4AC1X 4DNMA 4MWAB 1YMYA 2VENA 3PBYA 1NFPA 1K8YA 3OVRA 2PU0A 3PTQA 1XWYA 3NDOA 4ZQRA 2ZOXA 1JRBA 2NV2A 3CO8A 3BLKA 4LUTB 4WJXA 4AVNA 4XIAA 4KWOA 1F8IA 1B5TA 5IOBA 1I6NA 2GLKA 1JCMP 2ZUWA 1OFEA 5HNTA 4JTUA 1ZZMA 2ZADA 1K8ZA 1EDQA 1X96A 1L6YA 3PZNA 3MVTA 2BZNA 3H53A 4CNTA 3TOYA 1AQ0A 2VRJA 3GZ3A 1WKDA 3Q67A 1R3VA 2A5HA 1BGGA 2W67A 4IPJA 4W4QA 2WBKA 5HPOA 3RU6A 4IGSA 2Y7GA 3VK5A 4RJEA 4O16A 3QGKC 2Q3OA 2WNWA 5D9NA 2X1UA 3VKDA 3FJ4A 1ZENA 4M81A 1KFWA 3JZEA 1XIBA 1HJQA 3FY1A 2GJXB 4KQNA 2CLLA 1P1XA 3P93A 1MW0A 4C1LA 3N6QA 3QV9A 2VZVA 3S2MA 1OFQA 1Q6FA 3DFYA 4QG9A 4X60A 3VKBA 2PP0A 1MW1A 3OQEA 1QK2A 3M0IA 1MNSA 5FJIA 3P67A 4N6EA 3W07A 5BOFA 4L9YA 2VEMA 1GUVA 3FXYA 4PCFA 4PGLA 3LCFA 1ZGDA 4IJCA 1KM0A 2ZRXA 1HP4A 2OQHA 2QMJA 1KM5A 1BXCA 2AKZA 3H2MA 3OLEA 1SR9A 2ZFAA 4BEUA 4PMYA 2B7NA 1J0IA 1GOOA 2O7SA 4DUOA 3AISA 4K6AA 3OZYA 1G94A 4UTMA 2YLLA 3TJXA 4GNVA 1F6PA 1R2TA 3M7WA 3CHVA 3RJYA 4RDZA 3B0UX 1P1MA 1RD6A 4JKMA 1CDGA 3AHVA 5HJLA 3KP0A 3RLHA 4GH3A 1LORA 3UJFA 3NEHA 2VM8A 1DJXA 1UG6A 3E5PA 3ZVHA 3EMQA 1KBBA 2D0GA 3A4AA 1K9DA 3FSTA 3EDKA 4JICA 1KM6A 1QW7A 2QXWA 3LQGA 3N14A 3ARXA 2BY2A 4JHOA 1AVAA 4NF7A 4IPPA 1OD8A 4AMCA 3BCFA 2R24A 5LA1A 4DM1A 2PDLA 5DMMA 1H5VA 4WSHA 1HZYA 1S2VA 2YDAA 5CAKA 3TUUA 3UT0A 4WY0A 3O06A 5HQLA 4CEXC 3EWDA 4DO6A 1SO3A 3O15A 3XIMA 1SW7A 4C7DA 3SCOA 3SURA 3N1AA 1Z89A 1F74A 3KEHA 1J0JA 2XIOA 1N8WA 4HNOA 5A95A 4CD7A 3MCMA 1JR1A 4IF2A 1M01A 4D6HA 1A5MC 4FI4A 4JIHA 1W8SA 4WK9A 3EDFA 4O57A 3IEBA 3CZJA 4GGHA 1OG0A 5LXXA 4GI4A 2OOGA 1UP0A 1J0HA 3GW0A 1BYAA 2WZEA 3WD3A 1QBBA 2NQZA 3M41A 2R94A 3IIZA 3RR1A 3I7SA 1KTCA 1CT5A 1LJYA 4JBRA 2HROA 2RDUA 1SVDA 1W5QA 4ZO6A 2ZRYA 1GCYA 3N2XA 1LP6A 3MCNA 2JIWA 2X1RA 4JTLA 4IIGA 2FLIA 3STGA 2FB3A 3GTFA 1KFLA 5CPSA 4Z2KA 2IMRA 5PTDA 4LUJA 3O6AA 1KBJA 5C5YA 3IJ8A 2JKEA 3VGHA 1ADOA 4NZCA 2O9PA 3MUXA 1HIZA 1AH4A 1GVRA 4ILSA 4L4OA 2CETA 2OQLA 1ZU8A 3CASA 1PDZA 1NWSA 1XYLA 2ZC1A 1VFLA 4Z1DA 4ALDA 3SBFA 2WB5A 3WNKA 1XCXA 4YVPA 1TPFA 4QE4A 2DORA 1OSEA 3F4DA 3NO5A 2PZ0A 3WK1A 4ZE5A 2WLYA 4NZ5A 3WEMA 3NZGA 3MDWA 4JTIA 1GTHA 3V75A 4CKQA 3IJ9A 3HV8A 5EY5A 2Z00A 2A0NA 1REQB 3WBAA 3L4YA 4TTGA 1OHLA 4AZ5A 1J11A 3MQTA 3FGCB 1JZ7A 3GXIA 2E9MA 3E1F1 3EOOA 2P10A 1BVZA 2PE4A 1EC9A 4HK6A 3DX5A 3TU9A 1ZFJA 1YDYA 2PTWA 2C1IA 4Y9OA 3D6NA 3SCPA 3CT2A 2XH0A 5A6TC 3LHUA 1BRLB 4B4FA 8XIMA 2GPTA 5D02A 3GXPA 4WDUA 4WR3A 4GZIA 4O19A 2YA1A 4H8NA 4HCHA 1XLCA 1B3ZA 4B5TA 4JTJA 1IT0A 3SCRA 4HIBA 2XN2A 3W1LA 3SO7A 2CZVA 1TPH1 4DF1A 5HPCA 3GDTA 2PLKA 1C7SA 4H83A 2DGAA 4DB7A 1TPWA 4WJ8A 3N6HA 3TVAA 3W7OA 1P6BA 3ZWTA 1GYMA 4O8RA 3HPXA 3W87A 2XYLA 1T0OA 1BKSA 2PDPA 3SEPA 1XYAA 3TOPA 3UY8A 1WAWA 5MKGA 1TJ0A 1LQ0A 4J4KA 2C3ZA 5GPRA 3GC2A 1UD8A 2ACUA 3PHAA 4DWSA 4RW5A 5C71A 3GAKA 4AU0A 4J3XA 3WO8A 1Q3NA 5LA0A 5IBXA 1X39A 3WLNA 3ZJKA 4BQ4A 3PZGA 3V0UA 5I23A 3L5LA 1P0NA 4U3CA 2CLEA 4A05A 1V0KA 1RZMA 1X6LA 2OVLA 4PUJA 1TSIA 1F3EA 1NSJA 1XRSA 3AXIA 4YTTA 1JG9A 5GJNA 1TE1A 4HNVA 1WKFA 1T99A 3N12A 2X2YA 1IXQA 4JD4A 1ONXA 3W84A 1CLVA 1YQ2A 4RDYA 3PWGA 1WAUA 1XLFA 1K4HA 5LGZA 3SUUA 3WQOA 1AW5A 2VX7A 2X42A 2WHMA 5DCEA 4R34A 1K9FA 4EP8C 2HV5A 2EF9A 1DJQA 1XRVA 2BOEX 2ZQ0A 1UP2A 1C8QA 1CBGA 1ZRQA 4L1WA 3GHTA 3AWOA 1DP0A 5CKSA 2GDUA 2ESCA 2UV8G 4Q8OA 4LEFA 5T9CE 3MS8A 1SO6A 2ZZ6A 1BPLB 1IIHA 3R8RA 5I3IA 4MAVA 3CZ8A 4AD3A 2YDSA 2F6KA 2E9LA 2J47A 4JKKA 4PL1A 4JR5A 1DXFA 2VX6A 4QDWA 1IZKA 4LBUA 8XIAA 4ZB5A 1ITQA 1VAHA 3SGUA 4D1IA 2J77A 1UD6A 1VCGA 2FDMA 1T8XA 3C5QA 3G1FA 3GG0A 4PCSA 2NSOA 1UKSA 1W1YA 4PYSA 3P5YA 2NVCA 3QSTA 4GRSA 1KFCA 1OT2A 4MB1A 1HJVA 4EKJA 4XAGA 1XSKA 2X16A 3BV4A 4WLCA 4WOQA 4B16A 5CBJA 3A4WA 3SUTA 3DI1A 1XYZA 4NRRA 1TR1A 3KL5A 1V8EA 1MEHA 1X6UA 1NY1A 2PDWA 4Z2IA 3HB9A 3ZIZA 4CN6A 1QNQA 3K46A 2PC4A 3DBNA 1AMYA 1UH2A 4KETA 4M7TA 5HWNA 1RVGA 4NL1A 2EG6A 4I8DA 2E6DA 3CK5A 3RYSA 4NZ1A 3OG2A 3LX9A 2QDDA 1JQXA 4DJDD 3C61A 1SU5A 3OO2A 4QBXA 3EDDA 3IIXA 4UQDA 1R3WA 3GBEA 1NF7A 3ATYA 4M56A 4JKLA 1F3WA 1MXGA 3P84A 3WQ5A 1ALDA 3WYZA 3BGGA 3P0WA 2QVHA 3N04A 3W85A 1GVYA 1J0YA 4H41A 5CLTA 3E0FA 2ZA1A 4NZ4A 1YDOA 2XIJA 3S9YA 2CLFA 3CUJA 1JZ4A 3VOCA 4LY4A 6REQA 2YBTA 1HJUA 3C2VA 3H4WA 4MB4A 4C90A 1NWRA 3ZMRA 4AD2A 3TN4A 3FAXA 3PJTA 4PBGA 5AVNA 4QRNA 1IWBA 4YWIA 1MRQA 2VOMA 4GYPA 4KGJA 1XIHA 4U5KA 3H7UA 3DN5A 2MNRA 1B4KA 5EU9A 3BMVA 4H6KA 3RM8A 5FCZA 4DEFA 4Q4RA 4AF0A 2Z1SA 3LRKA 3CWNA 4K36A 5HUOA 5E0KA 2YBVA 4CU6A 4NJHA 3IJ7A 3CUFA 1DYSA 5KITA 4JAWA 1EP1A 1TV2A 1X6NA 3HIJA 3HM7A 3PUOA 2GWNA 4O0QA 1LUCA 5GJPA 1BSIA 4LVDA 4L7ZA 2W4XA 1AD4A 1AZ2A 3AI0A 3WQ6A 1EA9C 1F5ZA 1V02A 3M64A 3PZTA 2AL2A 1GKPA 3CQKA 5J5RA 1VHCA 4HA1A 2H8ZA 3S5OA 3EB2A 4UR7A 5AYZA 2W79A 4KIEA 4WVXA 2VKZG 4AX6A 4WDXA 3GDRA 1L6FA 5CQ1A 7A3HA 1HX0A 3B8WA 3FEQA 1XLIA 4RK8A 1RQBA 4CLMA 2D23A 3G2GA 3E2VA 1TPDA 4LS1A 3W6YA 5D09A 2V82A 1P7TB 2WO5A 1LYXA 3FCPA 3EWWA 2V63A 5A8QA 1UWAA 3NL2A 4G7FA 1PVNA 4M1RA 3GU2A 3QW4B 2WHJA 3W38A 3E2SA 2E6AA 4E3VA 5DEZA 2CW6A 1PS9A 5EB8A 5A5WA 2X0SA 2A3BA 4CNPA 3EOLA 2HSAA 3QGVA 3AZSA 3TV8A 3T42A 4U10A 4MFDA 1FX6A 2ON3A 3PJUA 5AYBA 7ENLA 3TH6A 1EP3A 3TLQA 2WM1A 3MPGA 1DWGM 1N7KA 1P5BA 5CCZA 3PS7A 4GC4A 4DJDA 2NX1A 2D73A 4DJEC 4NYUA 1GEHA 3HG4A 3PULA 3KE0A 1JZ3A 2WHLA 1J01A 1E0WA 1W1B1 2QJGA 5EBUA 2J9XA 4CD5A 5EFFA 3UESA 2QCCA 4U28A 3CO4A 1DKWA 2UY2A 4AHQA 3CHDA 4NKCA 4IOTA 1TUFA 4D6DA 1TV4A 2QAFA 1BQGA 3S2CA 5A6SA 4KFPA 1VEMA 2A79A 3GSMA 2OLHA 2TSYA 4O1BA 1KA9F 5E70A 1Q4NX 4WQ6A 1S39A 4IUOA 3SM0A 2V5LA 5BMWA 3P0XA 1US0A 2EPHA 2WJZA 4K8GA 2E0PA 3VUSA 1O5QA 5E9AA 2G3JA 3LI0A 1EPXA 1JD7A 2NZLA 4K37A 1JUBA 3EDEA 4FIQA 3T4WA 1H50A 5FJPA 4XKYB 1VF8A 3WF2A 1P6WA 2EG8A 4OT7A 1MW2A 4HOXA 2HNHA 1NDYA 2RDXA 3NL3A 1JUEA 1MUWA 3LCGA 2ZUVA 4CCCA 1H7RA 2OWWA 2QUVA 1PKNA 1UR4A 2ACRA 5IHRA 3W7DA 4AIOA 4O53A 4RE4A 1V6XA 1U30A 3FYPA 5EA9A 3TWAA 4HA0A 2Y61A 3F4WA 4L6OA 2Y7EA 1ZUAX 3NO3A 4CD4A 5T91A 2XWEA 5D2XA 4V28A 2XUCA 4DI9A 2Y7FA 2V68A 4KCWA 5AHFA 2I1OA 2BGQA 3BOLA 4HP5A 1MMFA 4LGXA 4A8RA 1A5AA 2FH8A 5CPOA 3PF3A 1TJ2A 2Z7GA 1G7UA 1XQLA 4GE8A 3UD6A 3TX9A 1XG3A 2OCZA 2QIWA 2VFGA 1XKJA 2FGBA 1FH9A 3UWUA 1Q2SA 1C29A 3MYOA 4YL2A 4TO8A 3BCJA 4BA0A 1X8CA 4LALA 1XDJA 5LNUA 4LCRA 1FWSA 2PD5A 3KWSA 3N18A 3TSBA 4AWUA 3IJDA 2QF7A 3A5VA 2OPJA 4JTKA 2NUXA 1XIGA 1R3SA 4YMZA 2MANA 3VD9A 2H9AB 4BWLC 2UY5A 4ZSTA 4HB7A 4NJKA 1HN1A 3NG3A 3ZJ8A 1XX1A 4XO7A 3R0UA 3TYBA 4PMJA 4MPQA 1PV8A 2E40A 2RHGA 5DXYA 2LLEA 4M80A 3URQA 3DYPA 5C6MA 4B5VA 2EPNA 2VVNA 3KP1A 1JPKA 4BF7A 2ODOA 1A5OC 4JCLA 2FZBA 4AVFA 3IAPA 2GJXA 1FA2A 3EWUA 3UCDA 1GYLA 4NJJA 3RLVA 2J9ZA 4I8YA 5JBFA 3LCXA 4AEEA 3DECA 5CC6A 3EWXA 4FXRA 1DJGA 2PSNA 1Y5WA 4G1KA 4Y9NA 1O60A 4WSKA 4XD3A 3PR2A 2YYTA 1HO4A 3RX3A 5AZ0A 5HQEA 3EB4A 2CITA 3VD4A 2Z1XA 3GDKA 3QTGA 5DY2A 2DIEA 5FEZA 3UR2A 3AXKA 5AHIA 5IDIA 3ES7A 4YYCA 1EF2A 4I9MA 3T1GA 4Z2HA 4GLEA 1Y0EA 2ACQA 2PD9A 5ABEA 3S9IA 4W85A 3PZVA 3WLOA 1OADA 4EXBA 1TUXA 7TIMA 2W9MA 3TWBA 1N55A 4WD0A 2QLYA 4KEVA 3FHAA 4UOQA 4OTKA 4NUWA 3F5LA 3HZ3A 1M04A 1KB3A 3GM8A 3AIWA 3G0UA 4V1XA 1RLCL 1JFHA 3ZJ7A 3VABA 1WZKA 3UPBA 1XP3A 4C5ZA 3WBYA 3KM8A 3VX1A 4PMUA 1KW1A 1F2JA 1YIXA 4IFKA 1YKWA 2VNCA 4PC8A 2X41A 1RCXB 4HOWA 1KCLA 3W7PA 1ONRA 3H2FA 4KRUA 1PYFA 1TREA 4C6OA 3LBOA 1GOIA 3EX4A 4N42A 2QIIA 3OGSA 4QSHA 4C6KA 3UGVA 4GINA 1XIIA 3B0PA 3KTSA 4DXVA 2O55A 1SJCA 3ID7A 5AHEA 5K9CA 4AEFA 1XH0A 1XIJA 3T0AA 3NQ2A 3T7VA 4I6KA 4DQWA 2KAUC 4PZVA 3NQGA 1Q7ZA 3S3GA 3S5YA 4F0HA 3ZXWA 1QR7A 2E67A 1KRCC 3TQVA 1YNQA 4C6BA 1RJQA 3I10A 4GX9A 5AVHA 3L65A 2X1IA 1ZSXA 1FCBA 1W8GA 4YTRA 4WF7A 3BW4A 1RSCA 2V3GA 3GNDA 5CZJA 3FNDA 5LNWA 3BUVA 3RO6A 4CQAA 2IQTA 2CC0A 3WD0A 4WDTA 2F9RA 3EXSA 1ISWA 2A1YA 4I7WA 4OWGA 1EWDA 1Q65A 4AY8A 1H1ZA 4LB3A 3ARPA 3HFTA 2ZBTA 1T7LA 1A5BA 5HOSA 5IFPA 2H3BA 3CNYA 3WDRA 2NQLA 4XZ9A 2Y6ZA 3T40A 5C7VA 2EJAA 1DJIA 2H3DA 2PDHA 4NT0A 4E8GA 3W00A 4XZBA 3D0CA 3HFYA 3OP2A 1WUEA 4JN7A 4J3UA 1LBMA 2F61A 4GH1A 4H8UA 4NJIA 2WCSA 4GCXA 3W6MA 4GABA 2ZUUA 5E0CA 4IIDA 2VFDA 3NGJA 4HMCA 2V5KA 3R12A 4B3KA 2CXEA 1RAKA 1PTAA 4PTDA 4YHGA 4BR1A 4ZTXA 2FZDA 3O6DA 3W70A 2WSKA 3C2RA 2GVYA 5H1WA 3QYQA 4IG2B 1Z8AA 3QKEA 3TFCA 2BVTA 3U7VA 3NDZA 2YFOA 4JIIX 4W93A 2POTA 1XPYA 3USZA 1CB2A 1VCFA 1CW2A 3ZJ6A 4EXAA 1B9ZA 3OB8A 4OECA 3E74A 4JFUA 3HMJG 3M9YA 2BY3A 2NV1A 2W62A 1M5WA 2IS7A 4ZA0A 4MB5A 4GZ7A 3GUGA 3VKJA 2WLZA 5KZEA 5AHLA 3ATZA 3VO0A 5CSSA 5JUVA 5HATA 3QY6A 3UWZA 1NQKA 4O12A 4LV4A 1KBKA 2ZRWA 2QJJA 1IGWA 3H23A 2VTFA 2R1NA 3QQ0A 1XRTA 3ZM8A 3IPWA 5HAOA 4TU1A 5C9WA 3TQKA 3PG9A 3VNDA 2DZWA 4HPHA 3SFWA 2BVWA 1H11A 1QW8A 1BEUA 1XL9A 4KFNA 1WZMA 4DPQA 3LMZA 2DT1A 3M5VA 3NZ1A 1U5HA 3WX7A 3QZ6A 1I2OA 4W5UA 3BLPX 3MBFA 3EYPA 1X7IA 1UJQA 2WZMA 2ZZ2A 2GVLA 3GNRA 4AVOA 2Z1VA 1HTIA 3W86A 4NNAA 3NPXA 1JCNA 4GQRA 5BU6A 3VNJA 4DYJA 3MSDA 4P7RA 4HJWA 1JDFA 3P2VA 4D8AA 2FDSA 1EWEA 2PLJA 2EKCA 3UZJA 1D7KA 1EO5A 2ISWA 2G4FA 3VGDA 5AKQA 1ZJAA 3U9IA 2PMQA 4CQCA 1KQZA 4IICA 1R9YA 1YEYA 1XLAA 4Z2LA 2WMIB 3W7JA 4FEZA 5HA7A 4ZSUA 4Q4QA 3U2CA 1I2PA 3N9RA 1ODZA 3UWQA 1B4EA 1HKJA 3CH9A 4UTHA 4UNLA 3W53A 5EGRA 1KQYA 1LG2A 2HK0A 5T26A 3K8LA 2A7NA 6XIAA 2V67A 2O7QA 3SAZA 2HWGA 4C6QA 1S1PA 1UMLA 3REQA 3UF9A 1Z48A 2UWFA 4AB4A 3U5YA 1CECA 2D24A 3Q58A 3TQPA 2YYUA 3M0VA 4LAMA 3CMGA 4DUXA 1XICA 3FVDA 3VZZA 1EZWA 3CV6A 4RL3A 3QTPA 5HJXA 4KBXA 3UERA 3QC0A 3WDQA 3N29A 3OW1A 4R3UA 3VNMA 3RFAA 2OEMA 4RXGA 2E7FA 3ZFHA 5ENLA 3VIKA 1XLJA 4HPGA 3KX6A 2CXGA 3R79A 1TWIA 2WJEA 4MZYA 3Q45A 4BY3A 3E02A 1A0DA 1XSIA 3KVMA 3OGVA 1HNYA 1H1YA 2QCDA 3CUXA 3AOFA 5BOEA 3ANVA 3EBVA 2REQA 2IPWA 2P8CA 5DMNA 3AFBA 2DT2A 2YXOA 1L0PA 4US5D 3K8MA 3WUGA 4GUFA 1EGVA 1YADA 3FLUA 4ES4A 1KTBA 1QVBA 2E8YA 4PA8A 2WVTA 5G2IA 3ZT5A 1RHCA 4WJEA 4NXKA 4O1CA 2PDMA 4E2DA 4ML9A 2WMGA 7CGTA 4UTWC 2J7BA 1HL2A 5HMDA 4UQ9A 1OFPA 4GK8A 3WH7A 5B7ZA 2C91A 2V5CA 2VXNA 3CUGA 3CAWA 2E9BA 3WD2A 4DUWA 1S5TA 2E09A 2OLSA 2B31A 3STFA 4RNJA 2J13A 2YL9A 1H3GA 3OLIA 4OUIA 2Y1HA 5LIYX 4FF5A 3EKLA 4GQ0A 4QCFA 2HPIA 3P7YA 3RLUA 3U7BA 3W74A 3COTA 4EOUA 4LF2A 3KBSA 4N02A 1AMKA 3U4FA 1KD0A 1OG6A 3IJLA 4IUGA 3OYXA 2Y7DA 1JEZA 3GXTA 4GISA 3LNPA 4O18A 3RNDA 5CSUA 3NUKA 3W73A 4CNOA 2PTYA 1FH8A 1OZMA 1R87A 3FA4A 4DI8A 1RCOB 2VYOA 2TPSA 1UR9A 4QS5A 2OO0A 1JPDX 3VGFA 2V5DA 3WQ8A 5ABHA 1P0DA 1K77A 3QMTA 3HBLA 1XYFA 4F66A 2EXOA 3UJRA 4HHMA 6TIMA 1ECEA 2DIKA 4GVFA 1SO4A 1VFUA 4X0VA 3W7LA 1B54A 5D2YA 4Q4MA 1TVNA 1E5NA 3MV01 3B9EA 2QCFA 3AHXA 3FK4A 5D30A 5HDRA 2CERA 1O1HA 6TAAA 3R89A 2J79A 4E4FA 1EGMA 1M7PA 2BHZA 4ZZ9A 1TPVA 1UQZA 2RKXA 2VP8A 1PJ9A 3VM7A 3L4VA 4ZOAA 3C86A 3MP4A 5A69A 3W27A 2P53A 4IQLA 3B3DA 5CG7A 3H21A 2YPIA 3ALFA 3MUIA 3NTYA 4YJ5A 1QNPA 3K2GA 1W9DM 1S5VA 2BLEA 2WVVA 4S3JA 5REQB 1W3NA 1F05A 1M9HA 2J4GA 4L4LA 1OK4A 3RPDA 3S2LA 3LCLA 3BO9A 1K7EA 4AUBA 4IMDA 5FEXA 3TXVA 2VO5A 4JYEA 3S1GA 2WSPA 3G1SA 4OKDA 4A3HA 3V5OA 4HNLA 2Q09A 3RIKA 1WOAA 4EAMA 1FY6A 3TC7A 1PZ3A 1V03A 4FPSA 3GH5A 3SB0A 4QE1A 4ML4A 4S3DA 1VQTA 1B9BA 3PAJA 1ZBVA 3IUDA 3N34A 4RCXA 2W6RA 1Z41A 3CV1A 3PWIA 4EPEC 3WBEA 1R85A 3C0LA 2ZVIA 2V5JA 4DZ5A 2XFFA 4WUIA 3W28A 4HZMA 4GKLA 3H2OA 3GG7A 4QFUA 3VNYA 5IRPA 1R38A 3H55A 4QTGA 2RJHA 3CEPA 3W7CA 3QC3A 2YGYA 4GXPA 4PULA 1K03A 3M0MA 1YBQB 3G1DA 2GGEA 3SJ3A 5A1AA 2BY1A 2QR6A 4XO6A 3VGBA 2XU2A 3CIWA 5AC5A 1TV8A 1K3UA 4QG6A 3THAA 4P8UA 1VRDA 3G1VA 4DX3A 3W82A 4HYVA 3HQOA 4Z1CA 4URIA 1OY0A 2BG5A 4MWAE 5TAOA 3S6OA 9CGTA 1HJSA 3WH8A 3BDKA 1UASA 3SUSA 4AD4A 1TYGA 1UYQA 1E72M 3OVGA 4BQ3A 1UBSA 5HQMA 3M0LA 3F4CA 1L6WA 2E1WA 1OX5A 2Y85A 4HGXA 1E6PA 3LHWA 2AAMA 4JXCA 2C6QA 5DCDA 2X7WA 2XVNA 3PY2A 4J3VA 4ADSA 1PSCA 5CGQA 1V3MA 3ARYA 1XIMA 5BXSA 2JIEA 3NIYA 2ZVRA 2HS6A 1V0MA 4MWAD 4ICCX 4JFWA 2FZ9A 1L8PA 3SIMA 5BU9A 4US6A 2HS8A 4J27A 1ZP3A 3CZLA 4A3RA 1S38A 1IGSA 2C18A 1WP6A 4E2VA 3PUEA 3C56A 1E51A 3W2MA 3A3XA 4NILA 4XKMA 4JIEA 3THCA 1DJYA 2CBJA 1U1HA 5I3GA 1GZGA 4YYFA 2PWFA 3I3EA 4GIYA 3WL1A 3PB0A 3L2IA 1I4NA 4GUIA 3AMKA 3TTSA 7XIMA 3TW6A 4GY1A 2I57A 1LL4A 4OE7A 4GJ1A 5F4WA 4L80A 3CGTA 5E1QA 3AALA 2FVKA 1KWGA 1W3IA 1KFJA 3NQ7A 5CXPA 1R9XA 3P74A 4Q8WA 3TTOA 4GI6A 3TONA 5K7JA 2Z6IA 4GIEA 5CPNA 4E4UA 3L4UA 5EYWA 3L4ZA 2J7CA 3R6IA 2OEJA 3PPFA 3FA3A 3B8UA 2CBUA 5BRPA 3SRHA 2HDJA 4KH2A 4B15A 3GG8A 4L4PA 4QJ1A 1SQ7A 2QKFA 1WCGA 3WL0A 3W7NA 1MDLA 1VPQA 3QR1A 4Y2WA 5M17A 3ZS4A 4AFYA 2EAWA 4HPXA 1XJBA 4XZHA 2QV5A 2CLPA 2RUSA 2R14A 3WIJA 5G4EA 5D33A 2OSWA 4JNYA 1EJSC 4PTNA 2GQ9A 3AMGA 1B2YA 2C14A 2WVSA 1KXHA 3R4IA 5EMMA 1OK6A 3E0IA 3QY8A 1DQWA 3DI0A 1GOXA 3H2CA 2VQTA 3ABQA 4FMVA 3EX2A 3HA1A 1KTNA 3FX4A 5LIXX 1JGIA 2JBMA 4HBKA 4D6IA 2F38A 1XLMA 2AQOA 1ZJBA 4PMVA 1TWWA 1JXJA 1G4SA 1O4UA 4HYWA 4X2PA 4JTFA 4R27A 5I0DA 4LJ3A 3CQHA 3PZQA 5D8ZA 4RE3A 5BXTA 3TCSA 1DEDA 4JIRA 3BLIA 4HMDA 2PF8A 1EBGA 4YVXA 3WNMA 4IX0A 2YLAA 3UR7A 1IT7A 3DH7A 4KFOA 4UBPC 2OYLA 1VR6A 4DBDA 1N82A 4XD6A 1Q2RA 4Y6GA 1ADDA 3B8VA 4Y96A 5DMYA 2PAJA 1XISA 1A5NC 3PG8A 4O54A 4PMRA 1E4IA 4IXXA 5AOUA 4J3ZA 1U2YA 3SZ8A 3CJPA 5EMKA 4OZOA 4LPCA 1D3HA 5BW6A 3AIUA 4LUIA 4GQQA 3CPUA 4LT9A 4P8WA 3CMFA 2B7QA 4C7GA 4HD5A 2VGGA 4XUYA 2V81A 3VGGA 3STCA 2ZE0A 4S2CA 3BQ6A 5HINA 2H8XA 1VZWA 2WMJA 3OEXA 3LSCA 1NAL1 3TNBA 1J9YA 3EWCA 4WY0B 3VVGA 4Q8VA 2D2OA 1BGAA 4JQ2A 2FIQA 4DWDA 3OU8A 4CQBA 2VDIA 1AD1A 4LBSA 1JXKA 2RAGA 2BB0A 4LU0A 3TLLA 4S38A 4P61A 3VDAA 1EFZA 1PUDA 3S46A 1B3OA 3PANA 4QX4A 5I2UA 2ISSA 2Z7KA 1EBHA 4F8XA 3H7VA 3ZVIA 2VFIA 1WKYA 3OHMB 4W86A 2RH9A 2X09A 3NQVA 1WDSA 2VEKA 2WSYA 3GYCA 2IXUA 4KEZA 3UR8A 8TIMA 3EWBX 1C9WA 4LOCA 4AZHA 1KV8A 1O94A 4A6GA 3W26A 4JTDA 1O7AA 3TKFA 3NDYA 4FNQA 5FJUA 2NQJA 2CHRA 4TR9A 2VQUA 4PUEA 1YTKA 2DZXA 3CXOA 1GKRA 2V3DA 2B81A 1FHDA 3WQ4A 4NRSA 1F73A 3IIVA 3W1PA 1A0CA 4U5IA 3MKCA 5B7YA 1JCXA 3KS6A 1PCKA 2VELA 6CGTA 1RA5A 1CCWB 1W0MA 1OYAA 2PP3A 2PDNA 4E2OA 4HPNA 1W5MA 3EPOA 4P7QA 3PBWA 3QFWA 2PPGA 3E6EA 4A2RA 4LUSA 1F7BA 3LCIA 3MMWA 4O13A 2YZ5A 3CTLA 1FKWA 1TIMA 1OIFA 4XD4A 2DSWA 3KDOA 2TYSA 3W4RA 1TPUA 1XIEA 3AMCA 2QJNA 3DAQA 1UQYA 4DO7A 2G50A 1M1BA 1OC5A 3MZ2A 4MVAA 2A6LA 4A8LA 2OODA 4IL2A 3W22A 2BTMA 4AXKA 1JQVA 4NYYA 1VRXA 2GJNA 3N13A 4TUFA 2WJFA 1XPGA 4U33A 2GK1A 1PKLA 1XLGA 1NDWA 3SGGA 2OX1A 1E43A 4KF1A 1WZLA 4LV9A 4QXIA 4OIFA 3BL3A 4GUGA 4G7EA 2CU0A 4H6EA 1J6PA 3T0BA 1TVPA 5H91A 3DENA 4HU8A 3DESA 5A8MA 2ZUSA 4HK5A 4S3EA 4YS1A 3QR0A 4LC8A 3LHYA 1R46A 4EX4A 4JTGA 2ZXQA 3E0LA 5HNUA 5JIWA 3QVQA 4GXWA 4KCVA 1H7NA 2PB1A 3CZGA 3WJSA 3UG4A 4FXJA 4N9BA 1DWAM 1FCQA 3N2BA 2QGYA 3N2MA 4K7YA 3LK6A 4B5WA 1QATA 3MSRA 3ABRA 4PMOA 3MUAA 1CGYA 2FMOA 4I9AA 1Q8JA 4UTTC 3CLWA 2Y5JA 4N9EA 2WPBA 2CZFA 1R3QA 2J8GA 1XXXA 3KOYA 1OYBA 2NLYA 5MKGB 1E3XA 5GNXA 4UTIA 4DBWA 2OZ8A 3OZMA 1PAMA 4DWSB 2E5CA 5BXRA 3JS3A 1KM2A 2V30A 3KS5A 3MJYA 2FJKA 2VC9A 1W3JA 3GHUA 1JF5A 2VFEA 1JUKA 2GVEA 2XN1A 2C13A 3W76A 4NU7A 1VP5A 4KCTA 4UQAA 4QQUA 4JY9A 3OOQA 1RPKA 3B40A 3UWEA 2PGWA 3WNLA 1TE6A 3S9ZA 4DJED 4BJHA 3CH0A 1H0GA 4RPPA 1OF6A 3SDOA 2R1PA 3VDCA 3DHDA 4PBFA 4ZOBA 2PDJA 4PB5A 5CPQA 1MEWA 4DF0A 3AS0A 3RAOA 3H26A 3F5KA 1A5KC 3WH6A 3LBCA 4XQ6A 1UJPA 2JKAA 3U2EA 1VFHA 3VA8A 2HQAA 3PJXA 4Y9MA 3WLMA 2ZRZA 3WQWA 1JPHA 4UQBA 4W87A 3ME3A 2WYSA 3W1NA 2PDYA 3KZPA 1XLBA 4DZAA 5J5DA 1PIFA 3IRDA 1TELA 3ITYA 5KEZA 2DH3A 1R7AA 4M8UA 4MJ4A 5BWFA 2NW0A 3SN4A 4C6FA 2ZX6A 1GWJA 5EKYA 3AC0A 3RHGA 1LQ2A 2DT0A 4Z2JA 1TTPA 2VUYA 3NL5A 4UFLA 1Y5VA 2BY0A 3VCCA 4Q4PA 2DVTA 1EEPA 3EXRA 3FN9A 1DOSA 3FV9A 3P14A 4S23A 1GQJA 2QT3A 5I78A 3JUGA 1FWGC 4YTQA 3ARSA 2J9YA 3NSNA 4ONVA 3WJWA 2V0TA 1N8IA 4UXDA 1EGZA 4ZFCA 1G67A 1WDDA 1H1NA 5M2FX 3GU1A 1Q6QA 1EXPA 2Z2AA 4FO4A 3UZWA 3A6OA 1E0UA 4MUPA 2ZXBA 3MU7A 4C7FA 3ANYA 3AIVA 3NURA 4K39A 1K02A 4GKTA 4R9XA 3LTPA 3MP3A 4J2MA 1LWHA 5HUPA 3VD5A 2XM2A 1J96A 3N17A 3UCCA 4MSSA 3GIPA 2VR5A 1EDGA 4Q6JA 1JDAA 1UKOA 4DUVA 4GACA 4UCFA 3TE9A 2DUAA 2VHLA 3KRSA 4EPDC 1QOPA 5G1YA 4HA4A 5H2ZA 4LRSA 1BG4A 3VYLA 1S3TC 1UA3A 2VCCA 1EX1A 3A13A 4KEMA 3M7SA 2UY4A 1K6WA 2WC7A 1W2VA 3MUY1 4Q8PA 3L12A 4XBSA 2FKPA 4EPBC 4H2CA 6REQB 2W61A 2CWXA 3KBWA 3N4EA 2OOFA 4N7QA 3GHRA 2JF6A 3G1XA 3L4TA 2Y88A 3VIOA 1J0KA 1XG4A 3N4AA 2W3ZA 3PPCA 1YTDA 3M43A 4MNJA 2BBFA 4KEUA 4MZ8A 1QO2A 5F1VA 1Q6RA 1I0DA 5HMSA 4AF0B 4DJEA 3F2CA 5RUBA 4IM4A 1FBAA 1KCZA 3I6RA 3KXQA 3H2EA 1GORA 1H61A 2D3LA 3WH9A 4GJJA 3BAJA 3MT1A 2A85A 2J24A 1PBGA 4XWUA 1FOBA 2O56A 3URAA 3G1HA 4H9UA 3SN1A 3OLDA 3HJZA 4O1DA 1HFBA 5DRCA 2D3NA 2Y24A 1QNOA 2WQDA 1VYPX 2AL2B 3AS3A 3KOXA 5F2IA 1KO0A 2FQIA 4DYKA 2FFIA 2A4AA 1J2WA 4IIEA 5BXPA 1YDVA 4FX8A 2EPKX 1EXBA 1EQCA 2PTZA 5LIUX 4S3CA 2D2GA 1TV7A 3A9BA 2YL8A 2B0MA 3QV7A 8A3HA 3DCPA 4GQGA 3PN8A 3IV8A 1R0MA 2XGZA 1NARA 1X38A 1SJBA 5DXXA 4EK7A 3UPMA 4QCEA 2WZHA 4LYKA 5H8PA 1NWUA 2C1GA 4TQTA 5CJ5A 1JL8A 4FLOA 3AYSA 1UR3M 2PLCA 2JF7A 4H8HA 2FB2A 4AISA 3O6CA 1W1VA 3GVRA 1E9LA 4E3TA 1QOQA 1SSDA 4O28A 4GIAA 3TA9A 3A47A 3LRMA 4UR9A 3VX0A 4LEQA 3BAWA 2PC8A 1M68A 3GW3A 1VLIA 2GGIA 1UBPC 1RJRA 1NFBA 4ROQA 4H2HA 1RQEA 2ATSA 3T0DA 4RE0A 1GG0A 4B3ZA 3RPTA 1GJPA 3P6LA 2ZA2A 1UUMA 3UNDA 4U2YA 1U1UA 1BVNP 4NVTA 4IP7A 3VD3A 3OLGA 1OQFA 4ZL1A 2RGMA 5FEPA 5M3WA 4CD8A 3SRKA 4RNFA 4JNMA 1JF6A 1PL9A 4MGGA 3HO8A 1SUXA 2OR2A 5DO8A 3DEQA 1GJUA 4M6VA 2VCAA 3ZOAA 1K8XA 4GYJA 4IWWA 1AQFA 2I5QA 4UR8A 4QEHA 4BWLA 4HKPA 2PTXA 3R11A 2G41A 1BYBA 1CNVA 3M6YA 4RV3A 2R6OA 3MA8A 3IACA 1V51A 3WUEA 2OYMA 2QNEA 3JVAA 3LHZA 3A4XA 3QH2A 3CV2A 4FSAA 3WEZA 4NAEA 4HT3A 1EA0A 3CEUA 1YNYA 5I3KA 3P8JA 5JQ9A 3V35A 1XLKA 1U1JA 3WLHA 3W6LA 4X63A 1SFTA 1H7OA 2XIMA 2FHCA 3ARTA 4V33A 4MKVA 2VR2A 3GG1A 1HT6A 3A22A 4MJ2A 2G3NA 4LQ1A 3NQ8A 1JZ6A 4N2YA 4OU1A 5AY7A 3RCYA 4OFCA 1ZCCA 3IIOA 3PB2A 5G4WA 4DN1A 3LY0A 4HZ6A 1A4MA 1GHRA 2BODX 5BRQA 4XG1A 3N2CA 3SY8A 3TTEA 3TXZA 3V1HA 3LTYA 3LERA 1TTIA 3CBWA 3R58A 3DC0A 3VMNA 1DHPA 1QNSA 3E9AA 2BHUA 4RR4A 3D5HA 3TJ4A 4LVGA 3KRUA 1KRBC 3LLFA 2V3EA 4GY7A 5D8WA 4EACA 2V5BA 4HN8A 3C2OA 1UZ1A 2C0AA 4MTVA 3EDJA 3M0HA 1H63A 3GTNA 3VKAA 1SO5A 3GYEA 5CGTA 4PUWA 1A4LA 4JDYA 5T9BG 3U57A 4J35A 3PBGA 3OYZA 1OC6A 2F6XA 3TQ0A 4B2DD 3A9IA 1A5UA 4M3PA 1ISYA 6PTDA 3QF0A 2PDGA 3GKAA 1V7YA 4DVOA 3ONBA 2E28A 3FEMA 2AAAA 3E5BA 3KUMA 3WK3A 2XVKA 3D46A 4ATLA 3DKJA 3T8LA 3CMJA 3NZRA 2VC6A 9XIMA 1EQPA 1O1ZA 3V18A 1S1RA 4C6PA 5A6AA 3TMQA 1SMDA 4W7VA 3TSMA 4MM1A 2GSHA 5GNYA 1IT8A 1HXJA 3UZXA 5C9ZA 5JXQA 3G77A 5C7HA 1PZ0A 3EEGA 1G4PA 2BV9A 2UY3A 1X8FA 4KGLA 2A7PA 4YN5A 2Q71A 4GZEA 1AW1A 2GVJA 3GXDA 4XBJA 3RMJA 3T05A 4V1YA 5ABFA 4GI8A 1ZJHA 4BK9A 1UD5A 2VGFA 1MEIA 4S1FA 3GR4A 3H2AA 5DFAA 1M7JA 1EJXC 2XFRA 1IQ8A 4HU4A 2VGBA 4GG9A 1I60A 3AHZA 1T6MA 1L8NA 4F0KA 1XYBA 5GQBA 2PFHA 5TNVA 6ALDA 4S3KA 3VNKA 1J8VA 4RDVA 4XBKA 1BFNA 2OZTA 4W5ZA 1E1CA 3W7HA 1MVYA 2ALDA 1A0EA 4NAFA 1MZHA 5FEWA 1K9TA 5DT5A 5A2AA 5EMYA 2O9TA 1JI1A 1B3XA 3RK8A 4H7CA 4BQ2A 1WUFA 3PPGA 1BAGA 4ZO8A 3FIGA 1W5OA 3LCWA 3VIGA 3ARWA 1JNDA 3MP5A 1PTDA 4I9TA 2G0WA 4JDBA 4FA3A 4QJ5B 1FWFC 1TQJA 2L5HA 1ZY9A 3LM7A 2PDCA 3LPGA 1FP9A 1RY8A 2XHYA 4R9OA 1Y8BA 2J7FA 4LUYA 4L56A 4J40A 3RDKA 3CUZA 3XISA 1W1IE 4JTAA 2O4MA 3SI9A 3H4GA 3MV11 1X98A 1Z42A 3UXAA 4MJZA 3AQUA 5DBUA 4IFKB 2IXVA 1TRIA 1P0EA 1R7OA 3M47A 1OFBA 2EPOA 2W91A 3ITVA 4MDPA 2OYKA 1MXDA 3WJXA 1CGTA 3V5CA 2C7FA 2AMXA 2YCIX 3I68A 4X0NA 1DWJM 3IWPA 1W3KA 4JTCA 4CQ9A 4D6GA 3KVKA 5HMFA 1ENUA 3PJWA 2P5NA 4S3FA 4RPQA 1NOUA 5G2WA 2HBXA 3D47A 1XBVA 2XIQA 2AGTA 2Z2UA 5A3HA 1I8JA 5I3JA 3IJ6A 3WQEA 1KKRA 1EOMA 1UW9A 3GHSA 1NELA 3EXTA 3QXBA 4XISA 4RXFA 3RLGA 4XTDA 2PS2A 4HTYA 3PTDA 3NM3A 1NOFA 4LAZA 2ANUA 4UUIA 4DLMA 3ZR6A 1V6TA 4IJRA 5JH1A 4O11A 2O9RA 3NEVA 3A12A 1BYDA 5I24A 2I9UA 3UJEA 3B9AA 4OQVA 1FCVA 3MB9A 4MADA 4ZB2A 3CZKA 5D38A 1PB0A 3C0SA 2OWXA 4NIRA 3W1UA 3KL0A 2HBVA 2DSZA 4XZLX 4BQ5A 5LNVA 2WZIA 4ZOEA 4OUEA 1YHTA 2FZ8A 3MO4A 4Z1AA 2ZIDA 4B5XA 1LOQA 1JZ2A 5F2MA 1FWNA 3OZOA 4LVBA 1F8MA 3HTWA 4FNUA 8RUCA 4QP0A 3GVQA 4MWAC 3HOJA 4NZ3A 1CGXA 4WXYA 3T81A 3OTRA 1UOZA 3MSYA 2BGNE 3VCNA 3KOZA 1B3VA 2IPGA 2DJLA 1YPFA 2B7OA 4NY2A 4AAJA 3NPVA 4LAOA 3IIPA 2ZUTA 2ASHA 4LX4A 1E0XA 3QGAC 2HXUA 1WXJA 2A6NA 4MLJA 3CLMA 4H8VA 2VEIA 5ECVA 1VC4A 4C91A 1OFOA 1QI5A 1X7FA 1TA3B 1ZLPA 1UIOA 1IEIA 1X1NA 3MBDA 1WDQA 2WC4A 4PTXA 3WQFA 4DM2A 2G8ZA 3NPWA 4C1NA 5CSRA 4HSOA 2C19A 3V5FA 3CHFA 2EGZA 2YCKX 4QDPA 4A22A 4H7ZA 3ITXA 3S2NA 7REQA 3DG7A 1DJWA 2KX9A 4Z1YA 5LIWX 2VUNA 4NI3A 2CWNA 3VIIA 2A2IA 4DNHA 2NT0A 3ZSSA 2ZUNA 3P82A 4JQAA 3QZEA 3R1ZA 2C15A 4KRZA 3W3OA 1N8FA 1BWLA 2CLMA 4FLRA 1HG3A 4FR1A 1WYIA 1IEXA 1UR8A 5G5IA 5HNRA 5A2CA 4AZBA 1DJNA 3EMCA 1WKEA 1ITXA 1FDYA 1UCWA 1QU4A 2ALRA 1J4EA 1UUQA 2WHKA 1RBAA 3QMSA 3QSRA 5BMXA 3H22A 5DF0A 3LDVA 3N3TA 3QPZA 1KRMA 3LM3A 3POHA 1B90A 3WBXA 3L4WA 4GYKA 2OTDA 3TYDA 4EWND 1KWKA 4XUGA 2GDVA 2JGYA 4G1NA 3W7MA 1VFFA 1GVQA 1R8LA 1KNWA 4BF5A 4OHQA 3VFCA 3WLIA 2WC3A 5XIAA 4MB3A 5CH9A 3B0VC 3S5ZA 2DZTA 1KXQA 3PNZA 4QQ3A 4ZENA 4V15A 4LCQA 1SW0A 4M7SA 1MW3A 2Z1WA 4NNBA 4UTWA 1S2CA 3VGEA 2HMCA 2P3ZA 1JI2A 2CKSA 2FFCA 3P62A 4B91A 4GXMA 3N15A 4BI6A 4ERGA 2DZVA 4F0RA 2GJPA 2XN0A 3UP8A 4HQVA 4PMXA 1Y5XA 1UWQA 3VDGA 1WO2A 3APTA 2J75A 2QQ6A 1J93A 4QLKA 2VEFA 1QAPA 2FZNA 2XZ9A 1ZTVA 4CN1A 5C70A 4PMZA 3E3HA 3PUGA 3ARZA 1CLXA 3REQB 3A64A 3T9PA 5D05A 3KOWA 2ZZ1A 2GQAA 4ACZA 3W7RA 4KW2A 1UWIA 4K7VA 2YXXA 3OQ8A 4Y7EA 4YU1A 3LENA 5AC6A 2EEXA 4C6EA 4ZE4A 4QHRA 2Z4GA 1V77A 4DXKA 1GW1A 1OD0A 1I0BA 4DZIA 3NVTA 4R7WA 3KLKA 1W9XA 3FJ6A 1G01A 1CXEA 4IMAA 5ABGA 5LGXA 3OG3A 1XGEA 4KIRA 3B4UA 3CWHA 3ARQA 4Y8FA 5ECUA 1NDZA 3WLKX 3MZNA 1G5AA 2QCLA 1OWQA 3MY9A 3T0CA 2QCDB 2GSJA 3L4XA 4D71A 2REQB 3UG8A 5LHEA 1QTWA 3VUPA 4DIAA 3G8RA 3VI2A 3FVMA 4HMNA 2CEQA 4MNKA 2WSQA 4HJFA 3BZJA 4DBSA 1UR0A 1DWHM 2QGHA 5LSMA 3DFTA 1OGBA 4H1ZA 3C52A 3L2MA 4CQ8A 3WQVA 1W1TA 1V0LA 1IR2A 3RX4A 2VI0A 3WSUA 3M07A 4Q8MA 3OZPA 1WE5A 3WLQA 4JTEA 5LA2A 3K1GA 2GJLA 3WDPP 3UWWA 3W7EA 3GTXA 5E6YA 2XFYA 2VRKA 2PF0A 2Y0FA 3GO2A 3PVFA 4V2XA 2BS9A 3NQFA 4K1GA 3R5EA 3NZQA 2EJ1A 4H6QA 3M44A 3OIHA 1PHWA 3WF3A 3HGSA 5EPDA 2HPMA 4B5NA 5DT7A 2PDIA 4Q7NA 1LQAA 2V2DA 2NQHA 2VZTA 4UOJA 2RFGA 4OBRA 3HG2A 4HCDA 2E3ZA 3FXGA 5KETA 4H9YA 1O95A 3NZPA 1QRQA 3VFLA 1QI4A 3APYA 1HW6A 3S1VA 2QULA 1SM9A 1IYXA 1FKXA 1DTUA 1V4YA 1RBLA 4HU3A 2CBIA 3UBPC 2PODA 6ENLA 2BOFX 3I3BA 3WF1A 3ICJA 3RRAA 2NV9A 1F6YA 4LVAA 1RR2A 3THDA 1XD0A 2OB3A 4A8NA 4JX5A 3BW3A 2FTPA 3THUA 3AO0A 2WJDA 1EJ7L 2RDWA 3DGRA 1T96A 2TAAA 3VCRA 2EHHA 4YXGA 4GD0A 3GR7A 1NQ6A 4BS0A 2ZZ3A 3E49A 3SY5A 3TR2A 3BVJA 3L68A 2X8RA 3L9CA 1ITUA 4FZIA 4OBSA 3RUBL 4NASA 4GJIA 1LROA 5LIKX 4M1BA 3CQIA 1OGGA 4WZHA 3QRHA 4LF1A 3GXFA 1W32A 3QHNA 4WKHA 4H00A 3PNUA 3SRFA 2Z26A 4QEEA 4LNYA 4Q8QA 2AKMA 3LU2A 1Q6EA 1UC5A 3GFYA 5D04C 1VGAA 4TOQA 2CHNA 3B05A 4LH8A 2QCGA 2TODA 2WVVB 4H9TA 2VGIA 2XGIA 1CGWA 2F8QA 4J3WA 1NVMA 3WENA 1MWOA 3UPWA 4MYXA 4IGHA 4JPGA 4X61A 4G5DA 2QDEA 1UHVA 4F79A 1LT8A 5EMLA 2Z1BA 3V16A 1OT1A 4L64A 1F76A 3QW3A 1XH2A 4WOZA 5MF5A 3WLSA 1LOSA 4WCJA 1QFEA 2ZCGA 4ZCWA 4AZGA 2HJPA 4I7VA 3G1YA 1M03A 1VCVA 4E8DA 4MPKA 5I7GA 7PTDA 3LN3A 3GY1A 2BXVA 4JTRA 2RDTA 3NOYA 3BOFA 3TR9A 4W8LA 4LW7A 4AIUA 3UXLA 3L0KA 1WV2A 4AY7A 1NDVA 3WQCA 3N3MA 1PKYA 3ECQA 3B8IA 3WELA 3CC1A 4A21A 2IPFA 1RCQA 3O1NA 3QR3A 1NF0A 2J88A 4IISA 3PAOA 4IJBA 4MHBA 2NT1A 5LYRA 3IVUA 3VIJA 2O4QA 3WD1A 4GBDA 1GZJA 1ZB5A 1J5TA 2IKHA 4QLLA 5CEWA 2VEPA 4Z0JA 4B92A 1E3ZA 3AXMA 3W0KA 2CLOA 1PHQA 2HEJA 4S3GA 1K7XA 2BVYA 3UEQA 4XD5A 5M5DA 1A5LC 5FF3A 5E9XA 3G1RA 1DV7A 5JH2A 2YOCA 1AFSA 4PFHA 4U2ZA 4GX8A 4J7RA 1XD1A 1U5JA 4C65A 4CD6A 1VENA 2NX9A 3LPPA 5DY3A 1W9VA 3WH5A 4QG8A 3W2NA 2C16A 4Y9PA 4AH7A 1ML1A 4MMWA 4D6FA 4EPKA 2ICSA 2J66A 3AAMA 1NM9A 5CLWA 3ZR4A 2P3EA 2FVLA 3KWXA 5EBAA 1G4TA 3DFPA 3W72A 3W2UA 2PZNA 1U5VA 3PZMA 1B0IA 3EB3A 2WCGA 3MSGA 4TTUA 4JS3A 3TNOA 2BVDA 4TXEA 1E73M 4QITA 1ZHAA 5KMYA 2PWVA 2VZSA 2DDXA 2YJQA 5K4ZA 4DYEA 1CXHA 2ACSA 4O0KA 1E6QM 3VOIA 3IUHA 3SY1A 5JIPA 2ISFA 4BEQA 1DJHA 1I2NA 3IK4A 1E15A 3K4WA 3K4AA 4ASTA 1E4MM 3WY1A 3UXKA 3BJFA 3PZUA 3RRXA 1RUSA 3BZGA 1S2TA 3LD5A 3BLOA 2I9EA 1GONA 3I4KA 2QHAA 2V2CA 3T08A 3BSMA 4ZQCA 4X9SA 3GKFA 3UZYA 3C6CA 5M1TA 1UC4A 1M41A 4RLIA 1KBLA 4UB9A 3U2ZA 4AC7C 1EHAA 3HU7A 4L5ZA 3IGHX 3H7RA 2INZA 2POZA 1F9CA 4ZR8A 3BCDA 4IQJA 2Y8KA 3N9SA 3A23A 4IHCA 1FFRA 4PUDA 5HBFA 4XSMA 4QAWA 1GPWA 3W71A 1TFVA 4G6CA 3EMZA 4CEUC 4O1EA 5EMUA 4EF8A 1I2QA 5J04A 1CX9A 2J62A 2HVNA 1AZ1A 3TW9A 5FAGA 2INFA 4O50A 6A3HA 1B31A 4IFOA 3IGUA 3KBVA 3MMTA 4Z17A 1E4NA 1XYMA 3WG6A 2OEKA 1XUUA 3RGTA 5H8MA 1HF6A 1MNZA 1OX4A 3AZRA 1E9IA 2PCQA 2VX5A 4TVUA 4YIWA 4H9VA 1SZEA 1F6KA 5CAHA 1GQLA 3HGRA 4R33A 3HQPA 5A2BA 3W7GA 4CNUA 3LMYA 3QYSA 5CC7A 1S5WA 5I3DA 4W7UA 7ODCA 4LB4A 4R5EA 4ZQPA 1XSJA 4B3LA 1OFDA 3VOFA 4EF9A 3KRZA 2CNCA 3PBMA 3S0CA 4W89A 3WFZA 2KZHA 4B5UA 4H7VA 4Q8TA 1OCNA 4N4PA 4KWUA 3NA8A 3GNPA 2JGQA 3RJXA 1XC4A 2BXYA 3GX9A 3UFYA 3O3RA 3D3AA 1ZBWA 4AHPA 1CPUA 3I6TA 1EJUC 2YX0A 3K30A 4WHBA 1DBTA 5FA5A 3MW7A 5GJMA 4AZCA 4EVZA 1W9BM 2PWUA 1Q45A 2AGKA 4CVUA 4CVWA 1LBFA 1AK5A 4X22A 3UWYA 4FNSA 2Y8UA 3R8GA 3G6LA 4K8HA 3RM9A 1UIPA 2XGBA 3VINA 1QNRA 4NZJA 3V4BA 1A53A 5U7SA 1IXOA 3TYZA 2CLKA 3CUHA 4MNMA 3BTNA 3HGOA 1EEXA 1JYVA 1SMAA 3KVLA 3RCMA 1CGVA 3G3MA 3W2JA 2Y4SA 1FWWA 2D20A 3BJSA 4W88A 3S5SA 1POKA 2V3FA 8CGTA 1UWTA 1AJ2A 1R2SA 2BGSA 3SCNA 1XLHA 2J6VA 3WNOA 4AHOA 2Y5SA 3DOPA 3VZYA 4IXHA 4RZ6A 3KLLA 4LYPA 1P43A 2E5DA 3R7MA 4Z2GA 1Q6DA 1GOWA 3L23A 1W17A 2OELA 4EAYA 1MDRA 3TEVA 2WMKA 4D2JA 3W1TA 5BOOA 4NNCA 1Z3NA 4DHGA 1IWAA 5A6KA 5C8BB 1VS1A 1Z6KA 4UMCA 1V6YA 5DANA 4J1OA 2ZX7A 2YCLA 4AW7A 3CAKA 3T2PA 1JYXA 1G6CA 1K7FA 3WD4A 1H09A 3UY7A 2QCMA 3H12A 1MQPA 1I2RA 4UTTA 4ROPA 4C6DA 3VNZA 4FIRA 3OVQA 5ABTA 1VBRA 3HN3A 1Q7MA 4LXFA 4AMAA 1BYCA 4FOKA 3SUWA 1E40A 4LUSB 4IP4A 3QQWA 2QUUA 2AMGA 5TQLA 1XCWA 3FKRA 2J7EA 3OIXA 4UMBA 1IF2A 3CHCA 3EOUA 3LYEA 4S3AA 2I7GA 1EIBA 1ODUA 1JAKA 5HR6A 4PUUA 2YR1A 3EA2A 5C2XA 4DJFC 2TMDA 3SCWA 5HWMA 2GK1B 4DF2A 2Q6ZA 3MTWA 1EPVA 3HV9A 1Q66A 4JTTA 2ZX9A 3QBUA 2OKTA 2QUMA 3BE7A 1C93A 3UJ2A 3SSJA 1MO0A 4G7EB 3K8KA 5A6BD 1LL6A 1TA3A 4TX8A 3T44A 4PTMA 3CB3A 3O16A 3G8EA 5FIPA 1TMHA 1VFOA 3V0TA 4F2BA 1EKOA 1TIWA 3UVAA 2X0HA 1P6CA 3ZLFA 1C8XA 1NIUA 3H70A 4E5TA 3AU6A 3BJTA 2DY3A 1H0IA 1G69A 3G3DA 1EF3A 3GXMA 3URBA 3ITLA 1UWUA 5I07A 1OJXA 4PEEA 1GZ1A 3URNA 4IL0A 4DWSD 2Z24A 4AYSA 4INFA 2WSRA 3NQDA 4I3GA 4WDWA 1QPNA 3ABOA 4H6RA 2E6FA 2OMAA 3BGAA 3VPLA 1M65A 4JTHA 2OSYA 1VBJA 5AN7A 2V38A 4MKSA 1V6UA 3GIQA 2QCEA 3LV6A 4MAZA 1WOBA 3DIPA 1WQ5A 3AUJA 3M4HA 4S2BA 5HR7A 1SZGA 1XYCA 1GHSA 1BHGA 1KV5A 4RZ5A 3NGFA 1CEOA 4S3BA 2Z29A 3LLXA 4PH6A 3LCHA 1GOQA 2E8ZA 4DLFA 1E70M 3QOKA 1R47A 1TPEA 4JTSA 2D2JA 1P0BA 2X40A 2F6UA 4TX6A 2GSEA 4YWSA 1UZHA 3EX3A 1V3IA 1XRFA 3IJIA 1BTCA 1AJ0A 5JU6A 3ARVA 1O12A 3B8SA 5CSYA 1Q63A 4CUCA 3SJNA 1UZ4A 1NOWA 2XISA 3N73A 4W7WA 4K3ZA 3MUCA 2OLAA 1VJIA 3GS6A 4ZEPA 2Z2BA 4F40A 3C0QA 3Q37A 3PSVA 3T78A 4C60A 3GD6A 1LZOA 1V7AA 3KCJA 4IPLA 2J7GA 5D9MA 3QZAA 2YW4A 2X2GA 5K3VA 1XLEA 4AEOA 3ZZ1A 3WUBA 3EWYA 4OBTA 4LAUA 1S5NA 1TZ9A 2Z6JA 4HVXA 3AIQA 2XJ7A 3UA3A 3PZ9A 3BMWA 1CENA 3B9DA 4RX0A 3WMLA 2AOSA 4I5RA 4GVHA 2WBGA 4TVCA 1IEWA 2HE5A 1VJSA 3KL3A 4DO4A 3S6DA 2DQXA 3A21A 1QXLA 3GNOA 4F4RA 3QQ1A 2PI6A 3I65A 1OEPA 2G5WA 4KCUA 5G2HA 4POCA 1YX1A 3W2LA 1TCMA 3TK7A 5A6BA 4DBEA 3N6JA 3BLFA 2CZDA 2QCNA 5C9XA 1C8VA 2DJXA 1F07A 2R1KA 5FJTA 2W5FA 2A3EA 3WCZA 4FNPA 3HPFA 3SCVA 3UZ5A 1GQNA 1LOLA 1VD6A 2EPLX 1P4CA 4JQ4A 1DVJA 3MANA 1ICQA 2JK2A 5AHMA 2FJUB 2YKKA 3SIZA 5L9FA 2WM0A 3IJQA 1NP0A 4HZ7A 2VWTA 3GZAA 4AD1A 2VDHA 1FH7A 2OFJA 3CB8A 1YE4A 3S2JA 4YCOA 2NVDA 1T8QA 3EX1A 2EQDA 2F2KA 4REQA 3K5XA 1THFD 1TTQA 5A6JA 4N9CA 1EB3A 3C0JA 4J5NA 2XVGA 2P76A 3M0JA 2A3HA 1Z32X 1PX3A 3B97A 1QUMA 3QLLA 2D1ZA 5CJMA 5DLCA 1V02E 3UR5A 1PWLA 4MLRA 2JKPA 4JFTA 2XG9A 3OA3A 2C1HA 4MJMA 3ZR5A 1QHOA 4LTSA 3CV7A 3ZSTA 2DT3A 3TYAA 5D2WA 1RP9A 5D2VA 2I56A 3F7JA 3GRIA 4IPNB 5I5RA 4U31A 3SCQA 3M0KA 3GFXA 4UC5A 1JVNA 1I9CB 4JGDA 4KWSA 3RMEA 2BX7A 5DELA 4F48A 1YYAA 1JDEA 4NG3A 1AA1B 3GBDA 3DC8A 1E1EA 4XX6A 4PB3A 1DL3A 1LF1A 1PX8A 4HZ8A 3NXFA 1VEPA 1JRCA 3JZUA 4D8LA 3CZEA 1EC8A 4RV8A 3C2FA 4I5XA 4CNSA 1X1ZA 5D2TA 3T2OA 3GUWA 5J8LA 2JFEX 4WEVX 3IUIA 1TPC1 1Q6GA 3W7IA 5I06A 2YCEA 1UKPA 3LTSA 4RNHA 1EP2A 2DW7A 3RN6A 3MC5A 1XS2A 2I5GA 5FF2A 1XGZA 2VX4A 1DIKA 1HVQA 2DVXA 4IH3A 1Q6CA 4WRHA 2A21A 5FSEC 3ARRA 3PZIA 2HCVA 4YTUA 4ZGYA 3MKKA 2V8ZA 4UQCA 2BWGA 4KRTA 4L1XA 2E5BA 3BG9A 3T6CA 4AY1A 6XIMA 5C2CA 2PP1A 1O5XA 1JAEA 2CCRA 3EKGA 1MUCA 1KFEA 1RK6A 3CAVA 4HHHA 2ZRVA 4M24A 4WSJA 3MHGA 3VNIA 3STPA 2QF8A 2XPKA 5FD0A 2ZWZA 5TD4A 2ZUMA 2FMNA 3CYVA 2W66A 1Q6OA 4D6EA 1T5AA 2RGLA 2E1DA 2VR4A 3BXWA 3CUIA 1B57A 1KLYA 2IQDA 1KR1A 1VB9A 4C6CA 1IIGA 1GPFA 4A4AA 3PTMA 5HMEA 2DPEA 4US5A 1ZAHA 3B0XA 3HPZA 1E6RA 4Q8NA 4RDWA 2VFFA 2Y62A 1BD0A 2FVMA 4QISA 5CZTA 4NZFA 4L9ZA 3RF9A 4UTJA 1ZJIA 3HGJA 3R8HA 1VPYA 3BSHA 1W9UA 1DORA 2WQPA 3E96A 5C0QA 3W02A 1IR1A 5AB3A 3DHPA 3HQNA 1SR0A 4ZO9A 5A6LA 4JL1A 4EXQA 3CYJA 4E2BA 1OF8A 2AQWA 4HA3A 5D37A 1ZALA 4PBEA 3CHEA 2GQ3A 1VJZA 1HJWA 1EJRC 2WNNA 4QSFA 4E6MA 3CAQA 2WXDM 4EWJA 3SCUA 3PWAA 5FAJA 2FPTA 1TJPA 1FDZA 4GUJA 4J9JA 2I16A 4OGZA 4LY8A 3FDGA 7TAAA 3WQGA 1BQCA 1ADSA 2PBOA 1G1YA 3IARA 4L1GA 3FJLA 1ME7A 3JRKA 1JNEA 3AWNA 3GC4A 3SR7A 1W37A 1IV8A 3DHUA 3GTIA 1FXPA 3MDUA 4JEJA 1X97A 2BSLA 3E12A 4C1KA 5FL0A 1W2PA 3A3WA 3R43A 4N9DA 2NXGA 5IM51 2H6RA 1YPXA 4NAEB 4Z1BA 3NPUA 4PL2A 3EA3A 4YHEA 4HPJA 1H51A 3CWOX 3H6OA 3N11A 4UFMA 2YDQA 2F7FA 4UTFA 3GR8A 3DUGA 1YLVA 3AUOA 2PWHA 3FA5A 1VLWA 1GVFA 4Q7BA 3GDBA 2EG7A 3WN6A 3Q65A 3DG3A 1R30A 5C2GA 1PX4A 1GYNA 3OJGA 1W1A1 4IQDA 4UZSA 4M6UA 1D3CA 4G2DA 3GU9A 2ADAA 3FOKA 3KW3A 3VOJA 3BICA 4FXFA 2PEVA 3O05A 3TZFA 2C0HA 3AXXA 3N9KA 4I90A 3VXGA 1KCKA 2Z28A 4FHAA 3O8AA 4QGCA 1IHIA 1AQMA 2XFWA 5T8GA 3OVPA 2P0OA 1P48A 4GIRA 1GEQA 2OO6A 4RKAA 2VL4A 1EUAA 4NQ1A 4G56A 2YBUA 1D8WA 4LS2A 5TIMA 4AIEA 1R3RA 4RNIA 2ONEA 1RY0A 3DFHA 1OCJA 3C2EA 1QPOA 4PTWA 2P88A 2QVNA 3F5JA 2B4GA 3VIHA 2WKGA 1I45A 3LZ3A 4RZBA 4GUHA 4IIHA 5FF7A 4AIBA 2PBGA 2Q8LA 1XHGA 1IEQA 3UETA 4BZYA 1B1YA 1XCFA 2NXHA 3CQJA 4KWVA 1OFAA 4J3TA 2WKLA 3UXDA 1XH1A 2P50A 5E5CA 4GZJA 2QS8A 4JL2A 3GXNA 1A5CA 4O1FA 2EPMX 2OKOA 2IKGA 1TJ1A 1FVPA 3WFLA 4XZMX 1EUNA 1LWJA 4QNWA 1HO1A 3B9NA 4JY8A 2WOQA 4GNJA 1B3YA 3ITGA 4W8AA 3TC6A 1OCBA 1L6SA 5BRBA 4F9JA 1V3JA 1RK5A 1TV3A 5FI8A 1IZJA 1MI3A 1G7VA 3F4NA 4JTQA 4HOZA 1TO3A 4E0CA 1QWGA 4LYRA 1JYNA 2YSWA 4WXZA 4ZVJA 5F7UA 3W2KA 1YE6A 3BK0A 3UCQA 3I7RA 3R94A 1JJKA 2CHOA 5ABFB 3W37A 4NX5A 3NWRA 3THQA 2P0IA 2EKGA 4LS0A 3ITCA 4G9PA 3O6YX 2HTMA 3QLDA 5CZSA 3IV3A 3R0DA 3U8GA 2JALA 4Q4SA 4O14A 3HURA 1MFVA 1AW2A 4DRSA 1K9EA 3IRSA 1RP8A 1KM4A 4LAKA 4P8VA 3NQ6A 3NYDA 3ORWA 4GVIA 1VBUA 3T8QA 5I77A 1TJRA 1E1CB 3E0WA 3KBNA 4NAFB 3TC3A 1D9EA 1OINA 3MMDA 1D8CA 2GQ8A 4IGNA 3RM4A 1C3FA 4AZ7A 2OGJA 3WFAA 3DZ1A 3FJNA 4B4HA 1FDJA 2YZRA 1W56A 1UR1A 3G0XA 1RXOB 2UBPC 3FDKA 3MUZ1 1QPRA 3DFSA 5AECA 2FZMA 2IKIA 3OPSA 2DVUA 5DN1A 1XBZA 4IMEA 2NX3A 3S6TA 4ADUA 2VDGA 3NVDA 4MWAA 3S8HA 2XIIA 2WZTA 1IE7C 1RBOB 1ECQA 2QJIA 4XK2A 5A8GA 1U22A 3L0GA 4PUNA 3LXBA 1ZPTA 4DZHA 3R10A 1NJJA 4LUTA 2NXIA 3AYRA 5CBIA 1NFGA 1LTDA 1FHVA 1YDNA 5K2ZA 1RD5A 9RUBA 3DFOA 3MHFA 1EX5A 3EWZA 1LLWA 4B5SA 4JN8A 2XINA 1VKFA 2I14A 2ZXDA 1Q8AA 2QDHA 4UOZA 3DYMA 4HNUA 4GO8A 1VIZA 1SPQA 1ZNNA 3UG3A 1V79A 2W92A 3VE9A 1E56A 1XM3A 1H4PA 4O0ZA 3CIVA 3IGXA 1QASA 3GVGA 1QWKA 1EIXA 2QPSA 1DXIA 4MF4A 3WDJA 2J7HA 1OVDA 2VOTA 3MKVA 1VYSX 3SRDA 4ZB0A 3IK2A 1QHZA 3PBUA 1SZNA 4RZ4A 3G1AA 1XDLA 4XZWA 2O0TA 2VWSA 3PSWA 4WIWA 2VZOA 1GJWA 5B80A 1UH3A 1ZAJA 3VTRA 2YCJA 4M19A 4ZXLA 5BNKA 3W23A 4QR6A 3ABXA 3P3BA 5D03A 4ENLA 3TMLA 3SSZA 1LCOA 4FK9A 3C3NA 3EOEA 1EJVC 3GB6A 4Z0SA 3C4UA 2F2HA 1AQHA 5MHBA 4YNGA 4ATWA 3MYPA 1BXBA 1CTNA 4MY8A 1A5SA 2C71A 1FP8A 3BAKA 3U2OA 4JNZA 3KDNA 2ZICA 1V93A 1Z7AA 3UGRA 4D72A 4UTLA 4QIUA 1HKKA 4UFKA 1D3GA 3BAYA 1G9HA 3JR2A 4FOJA 2QPUA 2XSXA 1L2UA 3AJ7A 2X0YA 4AX7A 4C6LA 3VE7A 1Z69A 3IAQA 5G1TA 1A3HA 1WB0A 4JEQA 1J2BA 2J8FA 1XLDA 1FRBA 4GBUA 4Z42C 2PGFA 3NCOA 3MI3A 3NQEA 4HK7A 4GGBA 4H9XA 3P8IA 4PUKA 1QOXA 4WGXA 1NP2A 4AYGA 1H49A 4R88A 1H5YA 1SW3A 2JE8A 3EA1A 3FYOA 2V9DA 3HG5A 3UA4A 3SADA 1GKQA 5AC7A 2A3AA 5JBDA 4C1NB 4ORIA 4CQDA 2J7DA 4ZODA 7REQB 1DIEA 5CBBA 2YB4A 3G22A 4UFIA 3P80A 3APGA 1W1PA 1M3UA 3PM6A 4O4VA 2WMFA 3HPSA 2IPJA 3BH4A 4PCTA 1OC7A 4UTKA 3WJYA 1HP5A 3SW6A 1QT1A 2YIHA 4M29A 2E68A 1C7TA 1E55A 1YPIA 1V6WA 3M0YA 4FXSA 2ZYFA 3WQDA 2DW6A 3EKZA 1K6AA 3S42A 1XQKA 3W1AA 1OZQA 3L21A 1BWKA 4D9PA 4RE2A 4IFRA 5DQPA 2QAPA 1QO5A 1DQUA 3T09A 1LRTA 3L67A 3O07A 1V3HA 4IMFA 4XAYA 3WK2A 4IZGA 1V3KA 5LZLA 4O15A 2QPXA 2XIBA 1ONWA 1Z44A 2Q3RA 2VMFA 5DBTA 4IMCA 2Q8XA 3BG3A 4PTVA 2NQ9A 4JOMA 1CLKA 3TJIA 3L7RA 4UQEA 1WZAA 1YXCA 3GNNA 3RU8X 5CZKA 1WDRA 3AMLA 3LGGA 1FHLA 4DXXA 2RJGA 2VT0A 3VDBA 2DZPA 1OBAA 1IEVA 1SFSA 5I79A 3Q2DA 3OBEA 3WDHA 1E6NA 5D4YA 3WMBA 1F4AA 4FX6M 2D0HA 5HANA 1FWIC 3LSBA 3LGDA 1REQA 1JZ8A 4L9XA 4KMQA 1E0VA 1C92A 1I75A 3LRLA 1CI1A 3FGCA 1TQXA 1Q13A 4AG0A 3W88A 1TX0A 5FJJA 1J6OA 4C6MA 4GO9A 3R25A 2CLHA 3QMRA 4ACZB 4CN4A 1SFJA 1UOKA 2CZEA 2FHFA 3CIXA 3OBKA 3N25A 5H8UA 1W1ZA 4GCAA 3VKCA 5M03A 5CPMA 4DO5A 1BRLA 5E6ZA 4PRRA 3BG5A 1TV5A 2FH6A 5GNZA 4CNNA 4JIQA 5KZMA 3VMPA 4GWEA 3WQPA 5KZDA 3U48A 2QW5A 4UCGA 1BWVA 2Y5EA 4XVEA 4LYQA 1FXQA 3NM1A 3FW6A 1CB7B 1V0NA 2DFAA 4O1AA 5IDZA 1POJA 3KFTA 3NXLA 1GVEA 2VC5A 3NSXA 4W84A 3DU0A 2CYGA 3WLLA 1ZBKA 4XV0A 3LHVA 1EO7A 4JYFA 3QHOA 3AROA 4IMGA 3I3DA 3DFNA 1VYRA 2G3MA 1H62A 5G1MA 3ZLGA 1TZ7A 3W81A 1FWDC 4GY0A 3H4XA 4R53A 3PPHA 2YA0A 2E25A 1QW9A 1TPB1 3STEA 2JQXA 1Y7VA 2ISDA 4KT2A 4NX0A 3VZXA 1M53A 2QJMA 4H19A 1N2VA 4JHZA 3TAOA 1ICSA 1XI3A 4A35A 4PFMA 1HJXA 2ZKMX 3DBPA 3WLTA 4FLSA 1M7OA 3GH4A 3VOGA 3VOHA 5FL1A 1ME8A 2WAGA 4I5UA 2BNJA 2YW3A 4Q33A 4BI5A 2GUUA 4IGMA 2ZC8A 4ACYA 3OGRA 5A8NA 3WKZA 3F2BA 3B8TA 1Q5MA 3DFQA 4HN4A 4K8EA 4ZBCA 1L2QA 3ZLHA 1DXEA 5HXMA 3H54A 4I7UA 3KTXA 3A3HA 2PA6A 1CZ1A 2PRLA 4ZQOA 3K1DA 4WGHA 3MWCA 3UZZA 2DH2A 4X2RA 2HVMA 1XIFA 1CXFA 2XZ7A 1UUOA 1QDSA 2D69A 1EOKA 4GA8A 3ZT6A 2EBNA 1NH6A 1FWCC 2IKJA 3TA6A 2OSXA 3GVWA 3LBMA 1PDYA 3DXIA 5I09A 2WWCA 1E9ZB 3SQLA 4PCNA 1WDPA 3LHTA 2QYGA 1R3TA 3AHYA 4PSRA 1VFMA 3KBJA 1HKIA 2VEGA 1CXLA 3QKZA 3O9NA 4HMEA 5JBEA 2NWRA 1LRNA 1UKTA 4GOAA 1P0KA 4W8BA 2PDQA 2YB1A 1MSSA 3TYCA 4J3SA 3SCSA 3NQBA 2GYIA 4XIMA 4YLWA 5JVLA 2UZ9A 4TX9A 1JZ5A 4BI7A 3U4AA 2X30A 2MUCA 4QS6A 3L0NA 4TMBA 4V27A 3BV7A 1R6WA 2BOGX 3LGEA 1QI3A 4B9YA 4E38A 3ABSA 4DWSC 3OA5A 1QHPA 4EIVA 1DHKA 2Y89A 1O68A 3BC9A 3WNNA 5IBXC 3F4VA 3QHMA 4ZQMA 3NQCA 1PKMA 3AMDA 3ZQ9A 1KKOA 1ZS2A 2E4TA 2PU1A 4AXNA 1PYMA 1FWEC 2F84A 1BG9A 4E4PA 1MQRA 1BKHA 2WWDA 3CL6A 1D2KA 3VU2A 3LI1A 3S5NA 2V69A 4Y90A 3MCOA 1NWTA 4Q4OA 4WKFA 2G97A 4HCLA 3B4YA 9XIAA 1XINA 5I6SA 1Q4WA 4O8AA 3KRBA 4PB4A 4QLJA 1LWIA 1Q7QA 3U6WA 2OU4A 1SZRA 3TROA 4X3ZA 1JCTA 1R9ZA 4JX4A 1U83A 2VC7A 2GOKA 3ONCA 1ZAIA 3FSUA 2FGZA 2XWDA 1KFBA 4GI9A 5E09A 3QFEA 3W83A 3GVVA 4TMCA 3GNXA 3MMUA 4MYAA 2CESA 1LLOA 2WV8A 3DGBA 2XTKA 5E93A 4F0SA 3WUFA 4C5YA 3ZWSA 5DX7A 5SWUA 1QNVA 1GVOA 2XSAA 5A6MA 4A2SA 4AD0A 4Z08A 4JZ5A 1W5PA 4WX2A 1DE5A 4MDOA 1KR0A 2R1LA 1AG1O 3F2DA 1T40A 2GWGA 3L5AA 4OOZA 4B90A 1QMLA 5DCBA 1HKVA 4UIOA 1XGDA 2W63A 2G95A 2XVPA 2W27A 4HTBA 2VFHA 3S47A 3LUTA 3TP4A 3C2YA 1JIBA 5EL1A 4FS9A 3BLDA 2QUNA 1XR2A 1WBJA 3SN0A 2OQYA 2WW5A 1RVKA 4JN6A 3ENLA 1FCUA 1H41A 4AZIA 5FF4A 4K2SA 1DJZA 3E38A 1GVSA 2R9RA 2PTDA 4L6DA 1PPIA 1XUZA 1Y65A 2VZUA 3W1XA 4CU7A 3AS2A 3KHDA 1BF2A 1UD3A 1GGOA 3AXHA 3P81A 2PCEA 5CGMA 3DHFA 1QPQA 3G18A 1JULA 2WANA 2XDFA 3UWVA 1P7TA 3WLRA 2ZXAA 3ZO9A 4TV6A 4U4MA 2Y8VA 3JU2A 3LEPA 1DQXA 4AD5A 4NHVA 1OFRA 3W1RA