1LWIA

3-alpha-hydroxysteroid/dihydrodiol dehydrogenase from rattus norvegicus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
311
structure length
305
Chain Sequence
MDSISLRVALNDGNFIPVLGFGTTVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase complexed with NADP+.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
total genus 111
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1996-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lwiA00
4XVDA 3CASA 2PDWA 2ISFA 1M9HA 2PDJA 2P5NA 1US0A 4JTAA 3GHRA 4H7CA 3C3UA 3O3RA 3LUTA 4HMNA 1S1RA 2FZ8A 2HVNA 1QWKA 1PZ0A 2PZNA 1Z9AA 1ZSXA 3R43A 4JIIX 5HNTA 3V0UA 2IKGA 5LIWX 3H4GA 3N2TA 4LBRA 1RALA 4XZMX 4RPQA 4QX4A 3ONCA 3KRBA 1ZGDA 1LWIA 4ASTA 2PDMA 3WBWA 1C9WA 4DBSA 3GUGA 5C7HA 2WZTA 1Z8AA 4XZHA 5AZ0A 4WDTA 1LQAA 4GCAA 3RX2A 3WG6A 1T40A 4JQ4A 4YS1A 2IPFA 3LNMA 3MC5A 2PDFA 2IPJA 4JIHA 2HV5A 2BGSA 1J96A 1K8CA 4AUBA 1VBJA 4JQ2A 2FZDA 1X98A 2PEVA 1IEIA 3D3FA 3T42A 4LBSA 1FRBA 3R6IA 2FVLA 4IJCA 3P2VA 2ACUA 1MI3A 1VP5A 1AH4A 3UZXA 2A79A 3COTA 3V35A 3UZYA 4ICCX 1PZ1A 1XGDA 4PR4A 3QKZA 4QXIA 5HNUA 1IHIA 4WDXA 4G5DA 4DZ5A 2PDPA 4F40A 3M4HA 2PDYA 3V0SA 2I17A 3O0KA 1EXBA 5M2FX 4IJRA 4GQ0A 3DN5A 1YE4A 3R8HA 3CV6A 4Q7BA 3ERPA 2PDUA 2DV0A 4PRRA 2PDIA 3WBXA 2PDBA 4Q3MA 1T41A 1Q5MA 2PDXA 2VDGA 4H8NA 2IPGA 1Z89A 3UYIA 4YVPA 2C91A 4YVVA 1MRQA 4WGHA 3UG8A 3GHTA 2DUZA 1X96A 1XJBA 3BCJA 2DUXA 3WCZA 4IGSA 2PD9A 3Q67A 4XVEA 1ZUAX 4L1WA 2PFHA 3LENA 1XF0A 1RY0A 2PF8A 4FALA 5LIKX 2PD5A 3G1RA 3GHUA 3FJNA 2ACQA 4PUUA 2BGQA 4PRTA 2INZA 3H7UA 3LD5A 3MB9A 4XK2A 4NKCA 4ZFCA 2PDQA 4FAMA 3UZWA 2PDLA 3LN3A 1OG6A 4WRHA 3V0TA 5KETA 1Q13A 4GACA 2PDKA 4GIEA 1AH3A 4PMJA 3CAVA 1S2CA 1QRQA 1YE6A 3BUVA 5JH2A 1S1PA 3GHSA 4PUWA 3S3GA 1X97A 3EAUA 2CLPA 1ADSA 3WBYA 3DOPA 4XZLX 4OTKA 2HVOA 4XO6A 4JIRA 4JTQA 4GQGA 3V36A 4LAZA 2AGTA 3EB3A 4EXAA 2HE5A 2IKJA 1YNQA 1ZQ5A 3R58A 3CMFA 4JTDA 2R9RA 4HBKA 2HDJA 3BURA 1MZRA 3U2CA 3RX4A 4QR6A 3LZ3A 3F7JA 2FGBA 3LEPA 3R94A 4I5XA 5HA7A 1AZ1A 4L1XA 4WDWA 3R8GA 4XZIA 1PYFA 3N6QA 1EF3A 2PDNA 4LAUA 4JTRA 4JQ1A 4JQAA 3Q65A 2FZBA 1RY8A 3BV7A 1YNPA 3UGRA 4XZNX 2NVDA 2F2KA 3LQGA 3EB4A 2ACSA 5DANA 2PDCA 2IKHA 3R7MA 3LZ5A 1AFSA 3NTYA 4WEVX 4JQ3A 1AZ2A 2PDGA 2WZMA 4EXBA 1EL3A 4YU1A 4XO7A 2IKIA 3UFYA 4GABA 3FX4A 4FZIA 1S2AA 1JEZA 4LB4A 4MHBA 5LIXX 3UZZA 4FA3A 4JTCA 1HQTA 2INEA 2IQDA 1SM9A 2J8TA 2HE8A 4QBXA 3RX3A 4DBUA 2IPWA 1AH0A 5LIUX 4R9OA 3B3DA 4XAPA 2HEJA 3CV7A 3LBOA 2F38A 1UR3M 3ONBA 1A80A 2R24A 3UP8A 5JH1A 5AZ1A 2BP1A 3H7RA 2IQ0A 1Z3NA 2ALRA 3CAQA 3M64A 2FZ9A 1R38A 2IS7A 1EKOA 2I16A 2PDHA 4GA8A 3G5EA 4YVXA 1PWMA 3UWEA 1PWLA 4LB3A 4WDUA 1GVEA 1HW6A 2ACRA 5LIYX 2QXWA 4DBWA 3VXGA 3M0IA 2NVCA 3LQLA
chains in the Genus database with same CATH superfamily
2W27A 4Q4KA 1KFCA 1H1YA 2VHLA 4JXCA 4RE3A 4UWMA 4IMCA 4PTWA 3W7NA 1E9IA 4BQ5A 2XWDA 3LM3A 2HK0A 1A4MA 2PRHA 2B7NA 4UZUA 5A8GA 4Q7IA 5PTDA 3W3OA 3IIPA 2YGYA 4LWWA 2G3MA 2VGBA 1UP3A 5F2IA 2ZUTA 4DWSC 1UCWA 3GK0A 1LRNA 3KBWA 3N9RA 1Z32X 2IKGA 4IPLA 1CTNA 5LIWX 1NDWA 3WX7A 2X1IA 1FH7A 1UH4A 3GVVA 1BVZA 1TZ7A 4K6AA 4DELA 1W8SA 1E0WA 2WQPA 4LUSB 1SO4A 1NOUA 4HK6A 4UTLA 3PPHA 1XH0A 3PS7A 1SR0A 2I9EA 2HMCA 3TDFA 2I5QA 3ABSA 5FAJA 3PZNA 4GYFA 2OYLA 3RK8A 3NQ8A 5I07A 1FVPA 5FI8A 4LEFA 1RBOB 3LOTA 1T40A 4UTJA 3TJIA 4YS1A 1CXFA 1LLZA 2V5LA 1RQHA 3KTCA 3M16A 2DSVA 3E0WA 1V7YA 1H5VA 2ZUVA 3IANA 5BYWA 4NUWA 2CEQA 1XYAA 3WK2A 4RDYA 1W31A 3E38A 3DERA 1XUUA 1QNPA 2ZRZA 3D3FA 2J88A 2OWCA 1R3RA 1EO5A 3CUJA 1BYDA 1FRBA 4HSNA 5D2XA 3SJNA 3HG3A 5HUOA 3SGGA 2OODA 1TZ9A 1PKMA 3M46A 3ZLFA 4PMVA 3WD3A 2DZWA 2ZVIA 2WKLA 3COTA 2FLIA 1GONA 4LEQA 1R7OA 4Q8TA 3UZYA 4N2YA 3VKDA 1LCOA 4TOQA 1CXIA 4WSKA 1IZJA 1O1ZA 3L21A 1BF2A 4ZR8A 3DBPA 1NWRA 4DBDA 1W54A 1BKSA 3W85A 3N29A 3O0KA 3QM3A 3SY8A 1X8FA 2DIJA 1H11A 1JL8A 4GD0A 2W91A 4J3SA 3C0LA 1KTBA 2GYIA 5MKGA 1A5UA 1YXDA 1ZY9A 3KLKA 1FKWA 4PN2A 3VTRA 3WBXA 1LJYA 3J7HA 1Q5MA 2PDXA 3OHIA 4FF5A 4M0XA 5XINA 3N19B 3GU2A 3O6AA 4YCOA 3H7VA 1JNEA 4IGSA 4HZ7A 1KM6A 5FSDC 1JNDA 2V5BA 3CO4A 2ZKMX 8RUCA 1M53A 1ZUAX 2OWWA 1DJWA 3WL1A 3MYPA 4JTKA 2E40A 1XF0A 4J2MA 3EWZA 1CGYA 5DX7A 1ADOA 5E0KA 1AQMA 4O8RA 2EAWA 4I9TA 2D2JA 3QTGA 4K8HA 3ARPA 2ZDSA 1XBZA 4ZO8A 4OOZA 2YXGA 3E2QA 4AD1A 1IT0A 1H1NA 5DCEA 1U1HA 2J62A 5A6KA 1NQ6A 2X7VA 2HISA 4JOMA 2J13A 1OX6A 1OF6A 3H26A 3GR7A 4BR1A 1CBGA 1EWDA 4IGHA 4C6CA 1GG1A 1J11A 4FLSA 3ZJ6A 1WAUA 1G67A 3GVWA 5F2GA 3WD4A 3B9EA 4LUTA 3SB0A 4HNOA 1RVGA 6TAAA 3U7BA 3OLDA 4EXAA 3EDDA 1YNQA 3K8KA 2AQOA 3IV8A 4QE5A 5D2TA 5BCAA 2CKRA 1W5QA 5CZSA 1BXCA 2PMQA 3TZNA 1SR9A 4RE0A 2ZUNA 1V51A 4IP7A 1XH1A 4US5D 3F1QA 3C2RA 2AL2B 3HJEA 4JIEA 1GVRA 2GL5A 1NF0A 4KWUA 4TX8A 2GJPA 2VWSA 3QMRA 3EKLA 4JTLA 4YTQA 4XZ9A 1E3XA 4XZWA 1IZCA 2J7CA 5F4SA 4U3CA 3NTYA 3ZT7A 3EWXA 4PE8A 2E1WA 1UPPA 2WLYA 5FEZA 4DLMA 4B2DA 1YW1A 4EF8A 1MRAA 1F76A 3NYDA 3NL5A 1K70A 1UASA 2CW6A 4XD6A 1A3XA 2HROA 1E0TA 2VZUA 3NCOA 1HJVA 4QBXA 1H49A 1RCOB 3AHYA 4ZL1A 3VIJA 4V2XA 5I03A 3CT7A 4FXJA 3APTA 3NPUA 2F38A 4IPPA 3VDBA 2PLKA 3QN3A 2EO7A 4KERA 3ATYA 3MCMA 5CBBA 2IQ0A 1PB0A 5I24A 3HGOA 1BVNP 1UJQA 3STCA 2P0OA 7TIMA 1J8VA 1V7AA 4QS5A 1OINA 3FYPA 1N8IA 4CUCA 2OZ0A 3VYLA 4MMWA 4GMEA 3QZ6A 2WMJA 1FTXA 4Q8PA 1CNVA 4WKAA 1GNXA 1J93A 3EEGA 1WZKA 4AIOA 1EGZA 1UOZA 5G1TA 3PWAA 1PV8A 1MXSA 2X0SA 3W6YA 2P76A 1W5NA 2R14A 4LQ1A 2RGLA 2IQTA 4O16A 3SUUA 2WJEA 1S38A 1M04A 1XLDA 1JULA 5DMMA 3WN6A 2FJUB 4UNKA 3SADA 3W1TA 1RPXA 3NG3A 4K36A 3AXXA 3GYEA 4GIYA 1GKQA 5HDRA 3S2CA 3A4AA 5BMXA 3QLDA 3VOJA 5LGXA 3EOLA 5D2WA 3RYSA 4QG8A 1CB2A 4LYRA 1FXQA 1GVSA 4AD4A 3IGUA 3KOYA 1OFAA 2ESCA 3BOLA 4CD7A 1O1HA 3ARQA 2V2DA 3G77A 1HL2A 2HXTA 4MWAC 4AY8A 2YZRA 1VLWA 1JPMA 1MDRA 4IMAA 2J7GA 3WY1A 1U2YA 2DIKA 2XGBA 1F3TA 3LNMA 3TC6A 4M1BA 5EPDA 3WLOA 1Q4WA 1V3JA 4LCSA 4O1BA 6XIMA 1SJDA 3ABXA 3A4XA 2GZXA 3DH7A 4OBTA 1LWJA 3V1PA 3SRHA 3HG4A 3LPPA 1IIGA 4LAKA 1ZP4A 2VUYA 3P93A 4GZIA 3FGCB 2KZHA 1HKKA 1RLCL 4HQVA 3NL6A 3SIZA 6ENLA 4CNOA 4A4AA 1NARA 3EPMA 1V03A 2QJJA 2VEIA 4LYPA 4GXMA 2H8XA 3B03A 4QXIA 4MKNA 4Q6XA 1X6LA 2IUZA 3LPOA 4XTDA 3W7MA 3TFXA 4F40A 2G96A 3LHTA 1KRCC 4OWGA 1DPMA 3CWNA 4IJRA 5BXRA 4PH6A 1UZHA 4GXWA 5CC3A 1Y5VA 4EE9A 4TVCA 3U5UA 2EBNA 1WCGA 4X2RA 3T08A 3RGTA 5CPQA 3R79A 5BMWA 3S4TA 2XIOA 3CV6A 1LLWA 2Q8LA 3EWUA 4R7OA 4RNHA 3KTSA 3KFTA 3ERPA 3T40A 4YIWA 3UXLA 3ITVA 3LSBA 3T4WA 1P43A 4J40A 2J66A 1DJYA 4BKNA 2E28A 3ATZA 1NOFA 1W2PA 3PZGA 1BVWA 1IXQA 2O9TA 3MQTA 1GQNA 1XJBA 3H21A 4UB9A 4JFTA 3ZJ7A 4IISA 4UFIA 4L1WA 3C52A 4ICNA 1E56A 3HPXA 1EYEA 1W3TA 3KZPA 2O92A 1LL6A 3CPUA 2P3ZA 3IS4A 4Q8OA 1QPNA 3GSMA 3GDLA 5CZKA 3W07A 4F9DA 1Q6CA 3SRKA 1MW3A 2INZA 1LRTA 1QATA 2WHMA 1GJWA 3BAWA 1G01A 3TNOA 4YTUA 5A8MA 3QRHA 3TYBA 2A3LA 2WW5A 3W9ZA 3I7SA 5KETA 1Q13A 5J5DA 4GACA 4N7QA 3GDBA 3WLHA 3LLFA 4NZFA 3DECA 1XC6A 3DGRA 3P0WA 3E0IA 1RH9A 1GZGA 1ZTVA 1TPFA 4ROQA 4L1GA 4FI4A 4MIMA 2DVUA 1V6XA 1WB0A 5CBIA 3DOPA 3GTNA 4XTIA 1IEQA 4B5WA 3RM8A 1UWUA 3F2BA 5BOEA 4GIRA 4I8YA 1FCQA 1K6AA 4BF9A 4NJKA 2YPIA 3GH4A 4D1JA 3W1MA 1C8VA 2HDJA 1B9ZA 3VIOA 1QMLA 1EX1A 1RZMA 4MNLA 4AZIA 2PC8A 1ZBWA 4H9YA 4PMNA 4O4VA 2R91A 1SJAA 1LYXA 3VIKA 5K7JA 1KRAC 3BH4A 3L68A 4B3KA 2HJPA 4AZ5A 1IXOA 7A3HA 5LHFA 4FX6M 3ES8A 3N1AA 2ZX7A 2CBJA 3RUBL 4BFAA 4WGXA 4CQCA 2VL4A 1XIHA 4JEJA 3G1XA 4Q8WA 1K6WA 3ARUA 3TZFA 1X6NA 5DRIA 4WY0F 4BQ4A 5DY3A 2ZRUA 1BG9A 3PB0A 2VGIA 2F6XA 3EA1A 1KB3A 3P81A 1JEZA 2Z1WA 3LERA 3QQ1A 3VFCA 3FYOA 2X40A 3CV1A 4FNQA 4O10A 3SCSA 3HPSA 4F79A 2E6AA 4KRZA 5BRQA 1KC7A 5I3IA 1NU5A 3KUMA 2OTDA 3NO1A 1JYXA 1UR8A 3NGJA 3OB8A 2RDXA 3AHTA 3PBGA 1JUEA 4JIPA 3HPFA 3AMGA 4DUXA 1JCJA 2FZ9A 4LOCA 4JTIA 3S5OA 3GY1A 1EDTA 1Q63A 1UWSA 3SSZA 4L6OA 3QR1A 2AQVA 3HQPA 1P5BA 1U30A 4GQRA 4JS3A 1GVEA 4EPDC 1HW6A 2ZXAA 1GOKA 1BG4A 4D6GA 3EDKA 4DBWA 2YDRA 3LXCA 4AIEA 4BA0A 2OVLA 2P0IA 5GNXA 4HA1A 2P5NA 3IJ9A 3H2AA 3SCWA 2VO5A 3Q2DA 1JUKA 5HANA 4NNAA 3C3UA 1SZGA 1OGGA 4Q8QA 3R8RA 4ADUA 4JFSA 2QHAA 3WEZA 1DV7A 3H6OA 3MUCA 2OT1A 1JYNA 1F8MA 1TWSA 1W1IE 1Z7AA 2J74A 3TYZA 3OVGA 4KFNA 3L0KA 3HO8A 3VOGA 4DBSA 2RKXA 2GVEA 4C91A 2ZXBA 2Y5EA 2OOFA 2ZX6A 1R5YA 2XIIA 2I14A 3BCDA 3MDUA 5AZ0A 4L64A 2ZVRA 4PTDA 4GKTA 5E9XA 4Y7EA 3OQEA 2VRQA 1OCQA 1WDRA 4OZOA 3MC5A 4AD0A 4F0MA 2XISA 2VRJA 3LV5A 2ZZ4A 3GXIA 3NM1A 1B57A 4NZ3A 3UR5A 5FESA 3KE0A 1ML1A 4AUBA 4ACYA 3HB9A 2WMIA 1M65A 2BVWA 2IXUA 4AFYA 4XBSA 3POHA 1VYRA 2ADAA 3K30A 2VGGA 3R6IA 5MHBA 4B5TA 2G3NA 3Q58A 1DQXA 4ZQRA 1Q2RA 1MI3A 4EP8C 3UXIA 2EPHA 4MNMA 3MV11 2QGHA 1QR7A 2NX3A 4G9PA 1TVPA 1XLLA 4JKKA 3NZ1A 5AECA 4ZB5A 3QFEA 4DJDD 1TMQA 1EJUC 1EP3A 2Y70A 2YXXA 1T96A 3GIYA 3RR4A 1UMYA 3GVGA 4AY7A 3R10A 4GI8A 4J4KA 1M3UA 2OKOA 3CMGA 3RU6A 4MFEA 4OKDA 1GOOA 3L4UA 2VX7A 2QPSA 5IBXA 2DT0A 3AICA 3AZRA 2FHFA 3TR9A 3W7CA 1Y8BA 4D9PA 3ITXA 2CBUA 1QW7A 4LAMA 1SMAA 2W9MA 2XH2A 4Q3MA 1VD6A 3M5YA 5EFFA 3T4CA 1DJXA 4QISA 4Q8NA 4XAFA 4L61A 3WDRA 2Y6ZA 4ORMA 2ABAA 4JTEA 4U33A 4Z2IA 2J79A 1Y0EA 7REQA 1XINA 2QGYA 3TYCA 4CKQA 3PFRA 2WMFA 2D22A 4HB7A 2BV9A 1FWEC 3TWBA 1JQXA 3HOJA 2VQTA 1TJ1A 2QDHA 3FVMA 3MP4A 4M56A 3GHUA 4QP0A 1UWQA 3FJNA 1H62A 4P8UA 3CUHA 4DYJA 4HMDA 3PBYA 1MZHA 3OIXA 1Q6FA 5ECUA 1OWQA 1J6PA 3W1UA 3I6RA 1CXKA 3AXIA 3PNZA 3TYEA 4RK8A 1FWRA 1SJBA 1QNOA 2WCAA 1WDWA 1IGWA 5AYXA 3RJXA 1A5MC 5FACA 4E38A 3BLLA 2VCBA 2X16A 3OZYA 3IGHX 1O68A 3GNRA 2XM2A 5J04A 2CZ5A 4H9ZA 3BUVA 3KWSA 2RH9A 1I2PA 1I2OA 2VOTA 3MKKA 3GZAA 2P3EA 3MWCA 3ECQA 3PJTA 4RDZA 1CW2A 2CLPA 4IQLA 4L9YA 3XISA 3OJGA 3MSYA 4RZ4A 2OJPA 2VJXA 2GWGA 1YTEA 1UUQA 2B81A 2IKJA 1OCNA 1PHQA 2ZA3A 4MY1A 5AYBA 3IVSA 1THFD 3CB3A 4B9YA 3QR0A 3CMFA 4PBGA 4UOJA 1B3WA 4AWUA 4Q4RA 3WLLA 3GR4A 4BWLC 4K1GA 5CAHA 1UR4A 3LEPA 2PB1A 1XLFA 4ZVJA 5D2VA 2QDGA 1AZ1A 1IIHA 4WDWA 3R8GA 4XZIA 2ZXQA 4IL0A 3BE7A 3DKJA 4MJZA 2YYUA 4G7EA 4LPCA 2GJLA 1A5BA 4NNBA 1J5SA 3K13A 3BLDA 1RV8A 5HK4A 1DTUA 3LI1A 3AIWA 1QFEA 3FIGA 1J0KA 1UIPA 1WE5A 2J9XA 3HPAA 3N04A 2PRLA 1W8GA 3LHZA 1UW9A 4KWOA 4W4QA 3VNJA 2ACSA 4P7OA 4UZSA 3TXVA 1W1B1 1VFTA 2QJMA 2HZGA 3GNXA 3ARTA 4H01A 3QY6A 5C71A 4MWAB 3N12A 3NQCA 1UD5A 4RNIA 3UFYA 2HK1A 5DT5A 1DHPA 2OR2A 4NF7A 4GO9A 3HFYA 1KM2A 1HKVA 2INEA 2IQDA 2JGQA 2V5CA 2FTPA 1OABA 5A8NA 2BODX 2Y7GA 3RX3A 4AYGA 3VUPA 4DWSD 1XLKA 4JNMA 1ONEA 4XSLA 4AC1X 1ADDA 2PTXA 2EPNA 2H9AB 3DFTA 1TZZA 3LBOA 2MANA 3DU0A 4LVDA 3ONBA 1EDQA 2X05A 5HPCA 5D2YA 2DIEA 4NAFA 1UR1A 1E3ZA 2WO5A 3PBMA 1MUMA 4FXFA 2Z1XA 2V81A 2D23A 3SCOA 2YFOA 1UKQA 4I6KA 3W7HA 3IEBA 1KFJA 3TMLA 3DX5A 4KCTA 4DYEA 1D9EA 1P6WA 3RM4A 1EZ2A 1H0IA 2ICSA 2DZTA 3AMCA 3NO3A 1TFVA 3ARYA 3E96A 3G3MA 3MSRA 4RDVA 2WNZA 3VD4A 3NR0A 4K7VA 4HHLA 1M9HA 3FV9A 4IIDA 4LS1A 2VP8A 3UPMA 1ODZA 1VJIA 3MI6A 4GNJA 1VHNA 4OE7A 4K8EA 1EJ7L 4POCA 3L65A 2XIQA 2Y7DA 3LPFA 4TMCA 3DFOA 4AZ7A 1XUZA 2VWTA 5AVNA 5IFTA 3QGAC 1IE7C 2XN0A 1E4LA 4QJ3B 1OC5A 1J01A 4X0VA 2ALDA 3PULA 3TA6A 3QPEA 3TX9A 3ZLHA 2OYMA 2E4TA 5A6JA 4RNFA 1KM3A 2JKEA 3PZVA 1PSCA 4GPNA 1TO3A 1I8JA 2ZUWA 3L5MA 3LX9A 3TWAA 4GYPC 4XZHA 3AIRA 1R9XA 4QFUA 4BQ3A 1VEOA 1M6JA 2PDFA 5K2ZA 3Q37A 5GJPA 4K1WA 2X42A 8CGTA 4Q32A 1TX2A 4D6DA 3WQPA 4JX4A 2X2GA 4LFYA 1NFBA 3KX6A 2R6OA 2PEVA 2YLAA 1BHGA 1HNYA 3OZOA 3O06A 3G0UA 1PAMA 5DXYA 2QNEA 3CYJA 4ZO7A 1VP5A 1G4SA 1P1MA 1KRBC 2PU1A 5I3JA 3FLUA 4HYWA 4S2BA 4GGBA 4JHMA 3VUSA 1TYGA 3MW7A 3CH0A 1TPB1 2ODOA 3QPZA 3W22A 3CL8A 3EX4A 1VENA 2PDPA 3AWOA 4GKLA 2PDYA 2I17A 2FYMA 1OC6A 1GQLA 1W1ZA 4GOAA 1U33A 4IH3A 3QMTA 3USZA 1I6NA 3B8TA 2QCGA 4Q8MA 2YCLB 1FDZA 4RZBA 4C6IA 2DV0A 4R7WA 3K46A 4Q4QA 5CGTA 4ZO9A 4O0KA 2ZE3A 3CTLA 2PGRA 4H6RA 2OO6A 1R46A 3GIPA 1J18A 1XG4A 4DI8A 2BSLA 2C14A 3GHTA 1VPXA 1PL9A 3CZLA 1E1CB 4AWTA 2ZCGA 3F2CA 4K38A 2GSEA 2WNNA 5FD0A 3WYZA 4IMFA 3IPWA 3LTSA 3NIYA 4W93A 1GCYA 5CQ1A 5TNVA 2YW3A 4J3TA 4C6MA 1KCLA 1CLVA 4I9MA 4HGXA 5E0FA 5JXQA 1JAEA 2JBMA 4KKXA 2C15A 3UNTA 3W6MA 5DCBA 3M0KA 2BGQA 5JQ9A 4V1XA 4UQCA 4PFHA 1ZZMA 1IQ8A 3LD5A 1FCVA 2EKGA 3WQFA 1UP2A 2BLEA 2BOGX 1CECA 3TTSA 2RUSA 4E2DA 2VM8A 3KZSA 2ZTJA 4FOKA 1TX0A 4UC5A 3W1AA 2PDLA 2QYGA 4JL1A 3R0UA 2QCNA 4GUHA 4TV6A 2W5FA 3NOEA 2YDQA 1EJWC 1QUMA 2FGLA 3M0LA 1L6FA 4KEUA 2PTYA 3PJUA 2J9ZA 2XM1A 3CUZA 5L6UA 4FK9A 3SURA 3EMZA 5CZ0A 4GUIA 5E6ZA 3P62A 3CUFA 3IK2A 3NDZA 4LX4A 1SYTA 3B0YA 1LOSA 3BZJA 1OX5A 1HZYA 3OBEA 2GGHA 3QR3A 3MZNA 3IUHA 5EMMA 3H23A 1OK4A 4IX0A 4MAZA 1J0ZA 4B5SA 4BJHA 1JF5A 3CGTA 4TUFA 5F4XA 4CNTA 3EXRA 3HURA 1TUXA 1QPKA 2ZADA 2A2IA 3AOFA 3HBLA 1V5XA 1OB0A 4N02A 2HBVA 3W28A 2NXHA 3QHNA 4GYJA 5EBAA 3TE9A 1PEZA 3UVAA 1V77A 2EJAA 3N3TA 1YHTA 4H3DA 3V1HA 3PF3A 4F9JA 1FWNA 4M19A 3ZWSA 2UY2A 2WV8A 3FYYA 5CG7A 1WDQA 3EWCA 3FDGA 5DANA 2EEXA 4NP7A 3KVJA 3R7MA 1A5SA 1V6WA 2EHHA 2PS2A 5I3KA 3T8QA 3ZYZA 1OF8A 2DW6A 4FZIA 4UTTA 2VC9A 1W6TA 2CLOA 1E15A 3P82A 4A22A 3KDNA 1HQTA 4MG4A 2WZHA 3ZOAA 3O8AA 1B3ZA 3RPTA 3R0KA 4WR3A 3EMQA 7REQB 4YXGA 1W1VA 1K9FA 4ERAA 1DP0A 3AC0A 2V67A 4HJFA 1XRFA 4QNEA 2XVKA 1H7PA 2ZOXA 1UQZA 5KINA 3POCA 1KXHA 2TYSA 5A2CA 4AWEA 4AISA 3W7IA 4UNLA 5IXEA 3H2NA 1VLIA 3W7PA 3F4VA 1JXJA 3N2CA 5A6TC 1TV2A 3BAYA 2QAFA 1R38A 1U22A 1YRRA 4C6EA 3LBMA 3SI9A 3C8NA 4LB3A 4F2TA 3RILA 4DYKA 4NIRA 1A5AA 4CU7A 3RFAA 3RRXA 5CKSA 4FSAA 5A6LA 3VOFA 4P7LA 4QJ1A 1OFBA 3QV7A 4HHMA 1LUCB 4HZ6A 3UWUA 3ELFA 4IMGA 3WD1A 2Y89A 1HKIA 2WPBA 4ZCWA 2J7DA 4P8WA 3CHCA 1L8PA 1PIFA 1LDCA 1XXXA 3UQNA 3UU0A 4D8ZA 4H7CA 2NQLA 4QCEA 4HYVA 1MEWA 3BSMA 5FL1A 3TAOA 4TV5A 1HVQA 3DG3A 2ZUSA 5MF5A 3ZT6A 2YR1A 2GVJA 5AHFA 3MMWA 1SUXA 5HATA 4WKHA 4KS0A 2Z24A 2VFHA 1RALA 1MQRA 5DT7A 1Q7MA 3HA1A 3S47A 2QJGA 1NP2A 5CBJA 3A12A 4D6EA 5C7HA 3QVQA 3DENA 2H6RA 3F4DA 3TN5A 3GG0A 1UUOA 3TN4A 4Z2KA 3GAYA 3U7VA 3VGDA 2WC4A 1H7RA 3GU1A 1DHKA 3APGA 4MDOA 2DPEA 4H8UA 4DJFD 1I45A 1B54A 1EPXA 5C2XA 2C13A 3WNMA 1OEPA 3WJSA 2JKAA 3N3MA 2R1KA 3SN0A 4DPQA 4JX6A 3GH7A 4UR7A 3SECA 1HXJA 2P88A 2ZA1A 4IFKB 1EF2A 1ITUA 4WD0A 1XPGA 1TE6A 1TQXA 3D47A 1ZAHA 1NWUA 3KWXA 2DSUA 1CXHA 3P2VA 4L80A 1WA3A 1XRTA 3LCIA 3MJMA 2FTWA 2Y61A 4B16A 3BCFA 2BNJA 2YXOA 1GPFA 1JYWA 2G3FA 1FWHC 1TTPA 5HNUA 2CXEA 3K5XA 2QUMA 3W7RA 1FUYA 4HCLA 2XUCA 1KM1A 4DM2A 3WDQA 5M2FX 1DYSA 4FNUA 3H24A 4L56A 2PGWA 4NYYA 1LROA 1YDNA 2QCDB 5FEWA 2YCJA 3BGGA 2OCZA 4NI8A 3H2FA 3A21A 4AHQA 3GTIA 1V6TA 2XVPA 5DF0A 3JU2A 2I1OA 1KV8A 3AS2A 1E5JA 3YPIA 5JBEA 1GW9A 3P5ZA 4AU0A 3ITYA 2BFGA 4MY9A 1SFTA 3KL5A 2QEZA 3RLUA 4NVTA 3UCDA 1WKEA 4O28A 4NRRA 3TYDA 1TPVA 1X96A 2V38A 2D0FA 3C2VA 4TX9A 4F66A 3I7QA 5LNWA 4BCEA 1KXTA 4R33A 3VIIA 1H4PA 5ABTA 3MT1A 1BFNA 4IWWA 3UJFA 3F5KA 2FDSA 3E49A 1I4NA 3HGJA 3AMDA 2GVYA 2G37A 1LLOA 5H8MA 3G1RA 3NDYA 4D6JA 4PSRA 2XN1A 3N18A 3SW6A 1XBYA 3GNPA 3SM0A 2JIWA 3L0GA 3CK5A 3S1VA 4ZO6A 2D0GA 3TSBA 4M51A 2F84A 3Q94A 4GLEA 5HNNA 3WQDA 3RLVA 1QOQA 2Z25A 1W5PA 1QXLA 4MB1A 3VNLA 1U5HA 1VR6A 3RDKA 4PUNA 1E6NA 1QTWA 4H9MA 2WHJA 1T8XA 2A6LA 3OGVA 5K9DA 4CVWA 1HJUA 2V9DA 1RA0A 3UG4A 4CQ9A 4CD8A 4B15A 1V6VA 3CAWA 5D4YA 2CHOA 3FA4A 4IIEA 5KITA 3O16A 3MTWA 4XO6A 1S5VA 2PWGA 3ZR5A 2PU0A 4Y8FA 3MU7A 3EB2A 3OHMB 4D1IA 2HS6A 1UMLA 1B9BA 2O55A 4HHHA 4UCFA 1N8WA 1E6XM 4LV4A 2RDWA 1Q6DA 1R7AA 4QR6A 3LZ3A 4REQB 2VOMA 1WDDA 5HUPA 4GISA 1JQVA 3AUOA 2NUYA 4MWAE 3TN3A 4DJDA 2POTA 2CBVA 4LAUA 1MUWA 2ZRVA 4R3UA 2JEPA 4QEEA 1H1ZA 4Y9MA 3NOYA 2O4MA 3LQGA 3CM4A 5C6MA 5J8LA 3UG3A 1XD0A 1C93A 1FA2A 3QMSA 3OG2A 5AC4A 1S3HA 3P3BA 1XIEA 2YW4A 4UR8A 1W0MA 3CTTA 4OECA 2P1FA 1XCWA 2XIJA 1DXIA 3VD9A 1NDVA 3AS3A 3WBAA 1NM9A 1JCTA 1XRSA 1YKWA 4S3FA 4S39A 1K9DA 2J6XA 4DY1A 1G94A 4PL1A 3VIFA 1MQQA 4CQAA 4BWLA 3WQVA 3UR8A 3W23A 2OSXA 3TJXA 2WHLA 3PZUA 2CZDA 1US2A 3R0DA 3NAVA 5I3HA 5AZ1A 1E6PA 1RCXB 4IUGA 3G24A 1QI0A 2DUAA 2LLEA 4R9XA 2E8YA 3U4AA 2VR4A 5REQB 3KP0A 2BG5A 1SSGA 2Y88A 2BHZA 1PTAA 4EWJA 3B4UA 5DLCA 1ISXA 1RLDA 1VJSA 3E2RA 2X8RA 4I3GA 1HX0A 1WOAA 2VD9A 1C9DA 4IQJA 3VIMA 5AC6A 5E70A 4ZB2A 4AZCA 4HOWA 4CCCA 1LM1A 3CIXA 3UYCA 4MB5A 3SUSA 1XLBA 3GKFA 3PUGA 4DWSB 3M43A 4JFWA 1KBIA 3BAKA 1U5JA 1HP5A 4S3EA 1X38A 4JN7A 1MEIA 4NI3A 3PG8A 5I5RA 4TU1A 1QNVA 3M5VA 5A1AA 1MFVA 1QT1A 3DG7A 3K4DA 3AI0A 2W66A 1JZ5A 2QPXA 3DKLA 4JIIX 1B4EA 2QKFA 2VCCA 3FSTA 1TJ0A 3UNDA 4ZSUA 2QJNA 2E9LA 3VDCA 5D9MA 1EEPA 2J77A 2ASHA 2QF8A 1UWAA 2ZX5A 3W72A 2JQXA 3F4NA 3QV8A 4PMYA 5H91A 3VCNA 1LF1A 2AL1A 3KW3A 3VIGA 1XIMA 2CHNA 4H4IA 1LT7A 1WUEA 1R85A 4OBRA 2OZ8A 4GCAA 4C6QA 3WG6A 3V5OA 5I77A 4ZSTA 3QV9A 3RM9A 2WK2A 2QIWA 1TWWA 4ZTXA 1FKXA 4MZ1A 4HSOA 3E74A 1E0VA 4GJ1A 3UR7A 4REQA 4CCZA 3HPZA 3NFUA 4U5IA 4WSHA 3A9IA 1V3HA 4FLQA 1EP2A 2E5CA 4N42A 4IJCA 1US3A 4DUOA 3BXWA 4KWWA 3CLMA 1VPYA 2DJLA 1NEYA 1IGSA 3JZUA 4PR4A 4TX6A 2WOQA 3CUXA 1E1EA 3KBVA 3M0YA 4MB4A 3TYAA 4DWSA 2HS8A 8XIAA 3WD0A 4RW3A 2PF0A 4H6QA 3G8EA 1W9BM 4WDXA 3RLGA 4P61A 3BW2A 7ENLA 2VNCA 3DI0A 3KLLA 1Z41A 1H3GA 2WJFA 2C8NA 3DN5A 3BG3A 9XIMA 2MUCA 5GQBA 4BY3A 3OIHA 3G1AA 2Y8VA 2XZ9A 4NZ5A 5A2BA 1W5OA 4UQDA 2ZTKA 1H7WA 2QJIA 4J35A 4E0CA 1OFRA 2WZIA 4Q7BA 5IFPA 2PWFA 3KBSA 1QHOA 1VRDA 1MYRA 3VA8A 4BI5A 4Q6JA 3WF4A 5LA0A 2GVLA 2XFRA 2WCGA 5A69A 4KRUA 3S9ZA 3M7WA 3VGBA 4ZTYA 4JZ5A 1R2TA 1XDLA 3TR2A 3QC3A 1VBGA 4YVVA 2JFEX 4IMDA 1UZDA 3CUIA 1GVOA 4LC6A 1OFOA 3FA3A 5KSWA 1B0IA 3Q67A 5HJLA 2UWFA 5ABHA 3WMCA 4O14A 3VM5A 5C70A 1AQ0A 2PGEA 5A6AA 3QZAA 1TCMA 3R2GA 4FALA 1J5TA 4WXYA 1CDGA 4GG9A 4C6LA 3E3HA 1JZ4A 3VX0A 5HJYA 3AHVA 2V3GA 2C1IA 2DT2A 4JY8A 4XK2A 4US5A 4Y96A 5I2UA 2VFDA 4RL3A 4ONVA 5D8ZA 3CJPA 3W7GA 5FJTA 3NA8A 1OX4B 4A3YA 4RPPA 3UW6A 2Z1BA 2WYSA 1EGVA 1AH3A 2J6VA 3RNDA 3N25A 1AUSL 1WUFA 1RSCA 1S2CA 3WJXA 4WX2A 4RKAA 3DI1A 5AHMA 3WLJA 4TXEA 3CUGA 4JTHA 1QI2A 4C6FA 1S1PA 1DBTA 1G1YA 3SRFA 3UGVA 2OWXA 5KZMA 1O7AA 1OIMA 3V16A 3CQKA 1IZKA 1JI2A 2GQ9A 3NZPA 1D3GA 3E2SA 4C5YA 1LTDA 2P8CA 4JTDA 3LGGA 1CT5A 4Z1DA 3S46A 2DT1A 2D2HA 3AIEA 1FWSA 1X7IA 1YXYA 2C19A 1TA3B 3R94A 1KFBA 3U0HA 1VJZA 2WB5A 4PTXA 3ZVHB 4O17A 4NZCA 2I56A 1YBQB 3ME3A 2XSBA 4LNCA 3VZXA 4KF1A 2DW7A 1LOLA 5AC7A 2V5DA 1DWJM 1XR2A 3ITTA 3AIUA 2F7FA 2PURA 5C5YA 3URBA 4W88A 4L9XA 4O0QA 4XSMA 4YHEA 2J7HA 3GXTA 1JRCA 2GSJA 2GJXB 4W86A 2X41A 3CL7A 5I6SA 4E8DA 4G7FA 3ZXWA 3D5HA 3A13A 3UVIA 4C7FA 1KGXA 4QIUA 5I23A 2QJHA 1JDCA 5HOSA 5F1UA 1KFKA 1S2AA 3IACA 1YTDA 3BLEA 4YJ5A 4W5ZA 1ZFJA 4N4QA 2FMOA 3CZKA 3B04A 2V63A 4MB3A 4W85A 1HFBA 4Y8EA 4ZOCA 2XGIA 3VKBA 3VDAA 4W8BA 5ABFB 2XFWA 3DXIA 1LG1A 3LMZA 1CGTA 2YA2A 4FXRA 3W7EA 4QM1A 2PPGA 1KD0A 2RDTA 4AEEA 1A5NC 1YMYA 1IXPA 2W0UA 2E9MA 5M03A 2C71A 2J8GA 5AHNA 5CLWA 1BD0A 3H7RA 3THDA 1Z44A 3ENLA 3NSMA 1PO9A 1HG3A 3BOXA 4GVHA 4LY8A 3QV6A 3WK1A 3ZLGA 1R3QA 4C1NB 3OZMA 3RG6A 4LUJA 1S2VA 3VGFA 4FR1A 1S2UA 1P0DA 4CNNA 2TRSA 2BVTA 4XKYA 5HMFA 2HVMA 4AD3A 5C9ZA 3EOUA 3RIKA 3B06A 4HK7A 1K9EA 4C1LA 2Z2UA 1ITXA 4HYRA 4UFMA 3WLIA 3JUGA 2DSKA 3A6OA 1XFCA 3TUUA 3UY8A 3ZSSA 1UD3A 1RA5A 1R6WA 4JTAA 3S2LA 3DYOA 3L2MA 1IF2A 4JBRA 1XWYA 2E3ZA 3O3RA 3LUTA 1E6QM 2DEPA 3LS9A 3G0SA 2A0NA 1G4EA 2XG9A 1Y5WA 1QW8A 2W79A 3CEUA 4LYKA 2GQAA 1W3JA 2EG6A 2G50A 8A3HA 2NW0A 3W1PA 2Y7FA 1F8IA 4FO4A 5G4EA 4HCHA 1TJPA 1KNWA 2EGZA 2C16A 4O11A 2BY3A 4LVBA 4HNNA 2VR5A 3GXNA 3LM7A 3K8MA 3IIOA 3C2EA 1EZWA 3MUY1 5CJ5A 3KP1A 2DZBA 2E6DA 5BWFA 3ITGA 4GUJA 1G9HA 4WDTA 3RX2A 4B2DD 2ZWZA 2VZTA 3P80A 1GJPA 3QYQA 5G2WA 3G18A 3V5FA 4JIHA 4ZBCA 2PAJA 4DZHA 4IIGA 1X98A 4W8LA 2ZZ2A 1B4KA 3TQVA 3FHAA 3QTPA 1UH3A 2DVXA 1FWJC 3DFYA 3L12A 5FJIA 1J2BA 1SMDA 2GUBA 4HKPA 4W7WA 3T0CA 1P7TA 5CSYA 5E5CA 1C3FA 3PZ9A 3CQ0A 1F07A 1S2TA 4KWVA 2W63A 2X1RA 2EPOA 2VTFA 5AB3A 3GDMA 2VMFA 1IHIA 3M44A 2B7PA 2UV8G 4B4FA 2NLYA 2CXGA 4W89A 4IIFA 4BEUA 1BRLB 4A3UA 1YTKA 3R89A 3TJ4A 1TELA 5HQLA 1G7UA 3FY1A 5SWUA 5DQPA 4X0NA 2QUNA 3WUBA 3VILA 1D3HA 4XIAA 2HPMA 1ME8A 4EAMA 1NDZA 1F3WA 4KWSA 3GFXA 3IUDA 1WKYA 3D3AA 1JDEA 3NXLA 4IGMA 3R11A 3KL3A 3OLEA 1HJWA 4DEFA 1VIZA 3TMQA 2VC6A 1ZAIA 4UTWA 3P14A 3MP5A 4Z17A 1N55A 3QQ0A 1XLGA 2GSHA 1JZ7A 4A29A 1KGWA 2WSQA 4GVGA 4J2PA 2FFCA 4Y9NA 1EC8A 3A4WA 2A21A 4E2VA 1DL3A 1ME7A 5EMUA 4Z0SA 4UIOA 4XV0A 3A64A 3IJ7A 1JYVA 1VCVA 5K3VA 2Q71A 1TA3A 3H22A 4OUIA 1UBPC 3ALGA 3I68A 4HOXA 3ZR4A 1RY0A 3CZGA 4QLKA 3KRZA 1UIOA 4BF5A 2ATMA 5HPOA 7XIMA 3TV8A 3GG8A 4EOUA 3MPGA 3TTYA 3A3WA 1X6UA 5HWNA 3ID7A 5JMUA 3A22A 4Q4MA 3L2LA 1XH2A 2WWCA 3SSJA 1E72M 2OEKA 4R27A 4WF7A 2QCFA 1X1ZA 3AYSA 1RQEA 3W71A 4ATLA 4FNPA 2F61A 3FEQA 1OZQA 1H5YA 4GIEA 3W83A 3BANA 2PWUA 4JICA 1K3UA 1KBLA 1CGWA 5BNKA 1YE6A 1UC4A 4S1FA 9RUBA 4H9VA 4LV9A 2XTKA 1UJPA 2ISDA 3GFZA 5MKGB 3GRIA 5D9NA 1R3YA 4AAJA 3GXPA 2YFNA 2HVOA 3O05A 4PBFA 2E09A 1G6CA 3EOSA 2NLIA 4LAZA 3EB3A 1OJXA 3BW4A 2WVVA 4DIAA 4JNYA 1ZQ5A 2CERA 3O6DA 4CNPA 1CYGA 3II1A 1L6GA 3A5VA 3ORWA 2YL8A 3CH9A 2JE8A 2VKZG 1XIBA 1ME9A 1VB9A 3TN6A 1PX3A 3NQGA 2PDNA 3W75A 2X09A 1H0GA 1YLVA 1VKFA 1DXEA 2BZNA 2DU2A 4Q8VA 4I7WA 5CAKA 3S9IA 2OYKA 4XZBA 1RJRA 1VF8A 1CZ1A 2Y5SA 3TJLA 3AISA 3C5QA 5C55A 5KZEA 5HULA 4J3WA 4LBUA 3UWVA 3BG9A 3MVIA 3HN3A 4FA3A 2Z7GA 4GBDA 4E8CA 2WC3A 3WLTA 3W84A 4A8NA 3K1DA 4XAGA 1EJTC 4M6VA 4M80A 1A53A 3QW3A 1T7LA 3JVAA 2Q3RA 2XHYA 3O7UA 5CC6A 1Q66A 1EC7A 5DY2A 1EPVA 5DN1A 2GGIA 1YNYA 1EX5A 2H3DA 1OM0A 4ZXLA 4MZ8A 5AOUA 1OK6A 1NSJA 3P8JA 1W3LA 2R24A 3NQBA 3K4WA 2VELA 3FGCA 1OFQA 3VKKA 2Q8ZA 3TNBA 2UY3A 1AJ0A 3AQUA 3D6NA 2J7FA 3WNPA 1LBLA 1GUVA 3CAKA 1IYXA 4J9JA 3L0NA 4QSHA 3OODA 3K4AA 2QCHA 4IG2A 5E1QA 3VIHA 3MMTA 1GZ1A 3MBDA 2R1LA 3U3HA 3TTOA 1EHAA 2BVDA 5G1YA 3LCLA 1E9ZB 1EOMA 3MO7A 1ZALA 3WL0A 3CIVA 4QEHA 1XD1A 3C56A 3L2IA 4GBUA 3QY8A 2PGFA 1OT1A 3CASA 4A2RA 1V0LA 2OSWA 5GVJA 3LV6A 3F03K 3FHQA 3S6OA 3W82A 4PSPA 1MNSA 4A3QA 4GC4A 4J3XA 1I60A 2VXNA 3WNLA 4IX2A 4LUIA 1V6YA 3EA3A 3WK3A 1TVNA 3NM3A 1UZ4A 4R34A 1EDGA 5CPTA 2ZX9A 1ZSXA 1AD1A 1G7VA 4ACZB 2QCMA 4XZMX 4QG6A 4RPQA 1PE1A 4QX4A 3W7OA 4M81A 4CN1A 1LWIA 2CIPA 4M7SA 4EPBC 4DX3A 2WKGA 3KCLA 5TQLA 3N17A 2R1PA 4UMBA 4NXSA 4QNWA 4CD6A 1I2NA 4GI4A 4LANA 3GO2A 4LRSA 3SDOA 2QAPA 2NSXA 4DAIA 3NQVA 4L7ZA 1GTEA 3KBJA 1GG0A 4QLJA 5KTLA 2VUNA 2Z26A 5BRBA 4X3ZA 2Y24A 3WFLA 4GNKB 3W2LA 1K8CA 3S5ZA 1KTCA 3FFSA 5REQA 4XG1A 5BU9A 5CEWA 4LGXA 1GQKA 4YCPA 3VD3A 1FOBA 3CHEA 3RO8A 5BROA 3O0FA 1UB3A 1LQ2A 3AZSA 4UMAA 2ACUA 1W9UA 3TTEA 3H12A 5JIPA 1IWPA 3UZXA 1YPFA 1EJXC 4R88A 3WNNA 5CC7A 4LC8A 3AYRA 3EYPA 1N8FA 4ICMA 4MZYA 4IPNB 1POJA 2E9BA 3GTHA 2G3IA 3W2JA 1K8XA 1F3XA 4MGGA 5AHEA 1H61A 5I09A 1P6BA 1WO2A 2DP3A 4KQNA 1GVYA 1GW1A 2BWGA 3SQSA 4KBXA 3QF0A 1S2WA 1YE4A 2QLYA 3EGJA 4NYUA 3U4FA 2SFPA 4XIMA 3MWAA 1OIFA 2PWDA 3ABZA 2J47A 1TV8A 2ZE0A 4AQLA 1W37A 3GAKA 3ITCA 2ZZ3A 4ECLA 3S2JA 3NSXA 4LY4A 2GGGA 2XSXA 1E71M 2HXUA 3BLFA 3WLMA 2OEMA 5HWJA 1Z48A 3B8DA 1WKFA 3GFYA 4QITA 4CVUA 3PB2A 1FDJA 1C7SA 4LVGA 3B40A 3ZFHA 1MRQA 2R8WA 1EJRC 3RMJA 1ODUA 4GINA 4S23A 2QF7A 4EAYA 4KGJA 1OC7A 4NJIA 4F0KA 5M17A 4ZE4A 3DYPA 1QWGA 4DJDC 4C90A 4C1KA 3W4RA 1O4UA 2YCLA 2XZ7A 4M3PA 1XLAA 3FAWA 4AVOA 1HGYA 4Q22A 4LVAA 3QH2A 1J79A 4C6JA 1AQFA 4PTNA 3W1NA 1A0EA 1N82A 3VAVA 1R3WA 4F2UA 3DFSA 3MB9A 4MKSA 3KVKA 4ERIA 4WXZA 3N2BA 3B0VC 1GJUA 2CFFA 3OP2A 4MJ4A 3UZ5A 2GGEA 1OYCA 3O1NA 3PAJA 1XLHA 4O18A 2QVHA 3B97A 4O52A 1ZU8A 3WQEA 3CXOA 4PB3A 3VINA 5M3WA 1Q6QA 4UFLA 3ARWA 4OT7A 2ISWA 3ARRA 5C8BB 3WBYA 1K7FA 3AIBA 2I5IA 3T0TA 3BW3A 4KETA 3PNUA 1T6MA 4GY7A 5DBTA 3LYEA 3GC2A 4XQ6A 4ATWA 3C2YA 1KBKA 1JVNA 2YCKX 4O15A 1P7TB 4CGTA 3UESA 1YPXA 3TVAA 1RP8A 2ZX8A 1KCZA 2IW0A 4DXVA 2NT1A 2O9PA 2WM1A 3AWNA 6PTDA 4IL2A 2WVUA 1HO4A 1PDZA 3A23A 1EOKA 4Z1BA 4GWEA 3VZYA 1FWAC 2X1SA 4S3DA 1NP0A 4U2ZA 1FHUA 3W00A 1Q2SA 3RCNA 1EEXA 5DXXA 5DELA 3VOHA 4C1NA 2F2KA 2R1NA 3VNKA 1MVYA 2J7EA 4PYSA 2R82A 3VCRA 5DO8A 5IHRA 4DJFA 1TTJA 4B5VA 4HPHA 1FH8A 5GPRA 2A7RA 3VDHA 2WZMA 1O66A 3HGSA 4L6HA 4XO7A 1Y5XA 2ZZ5A 3TAKA 5LNUA 1J10A 1R9ZA 3W26A 4MHBA 4WLCA 2WANA 3W81A 3VNYA 2J8TA 4KCVA 4DO7A 1E0XA 5H2ZA 2PA6A 5BOOA 4IIHA 3E0FA 1O12A 3CT2A 2HEJA 3I10A 3CV7A 2XSAA 3B0UX 3TSMA 1Q6RA 3PFMA 3BQ5A 5LXXA 4UUIA 2OG9A 4NZ1A 4C6PA 2V2CA 1V0MA 1Z3NA 1XIDA 4AX6A 1VPQA 1F2JA 4YTRA 4CQDA 3M64A 2GVGA 5HJXA 2OXNA 1BYCA 1NELA 4GA8A 1ZENA 1EUAA 3AU2A 4IGNA 4YYCA 1EHNA 2G8ZA 3DHDA 4EACA 5LIYX 4EIVA 1ISWA 4KEMA 4PULA 1KQZA 4FNRA 7ODCA 3CBWA 5EYWA 4K7YA 4I7VA 3NQAA 4UFJA 4H9TA 4OU1A 1E40A 2GDVA 3DEQA 2ONEA 3EX6A 4DUVA 1EB3A 1VAHA 3FCPA 5HNRA 2PDJA 3BLPX 1GOIA 3G6MA 4XBJA 4JEQA 1GGOA 1O5KA 2VX6A 5A5WA 2WM0A 2VDIA 4NJHA 1V02E 4LYQA 1C7TA 1PZ0A 1PVNA 3MMUA 1LZOA 1AW1A 3PC0A 1J4EA 1RR2A 5HNTA 3ARXA 2W6RA 1BXBA 3TC7A 3E12A 3SZ8A 1PKNA 1IR2A 2VFEA 1S46A 2VENA 1DJHA 1M7PA 3ICJA 3M6DA 5AHIA 4JD4A 3UD6A 1GT8A 1O95A 3E9AA 4O4WA 1SO3A 2ABBA 1NH6A 3LHVA 2ZRWA 5CJNA 2O9OA 2WZTA 2VFIA 1B3YA 5A94A 2OO0A 1ICPA 3UWWA 3UA4A 2ZC1A 2DSWA 1ONXA 2FJKA 4JQ4A 1EFZA 1D7KA 5EGRA 3FKKA 1A4LA 1HVXA 4NZJA 5FIPA 5DEZA 4HZ8A 1OQFA 2CNCA 3STPA 1QNRA 1QPOA 2HV5A 5C0QA 5AC5A 5LSMA 1J96A 2CLEA 1FWBC 1OCBA 4QHRA 3THCA 1BGAA 3AXMA 2FZDA 4GZEA 1D3CA 4E8GA 4JTFA 4PUKA 4Y2WA 5A6BA 2FVLA 2BTMA 2RDUA 1BTCA 1TPDA 2NXIA 4MKVA 1Q6EA 3B8VA 1HP4A 5FJOA 1K4HA 1F5ZA 2YA1A 3MZ2A 1P4CA 5CJMA 4OIFA 2V3DA 2QV4A 4U4MA 4JPGA 1XGDA 4ZFMA 3VNDA 1F6YA 3KAOA 3WDHA 3ARSA 2A6NA 3SEPA 4HU3A 3AXKA 3MI3A 3T2QA 2E6FA 3V0SA 4TR9A 3SR7A 1EXBA 3I65A 3SCNA 3VZZA 1AA1B 1NF7A 3M0VA 3SCUA 3UETA 1VQTA 4X9SA 4DLFA 4DZIA 1UD6A 3IVTA 4ZQOA 5FJJA 3GDKA 3L67A 2PDUA 3B9DA 4GH3A 1H41A 3DDMA 5TBOA 5XIMA 1YYAA 2G5WA 4H7ZA 2PDIA 3MCNA 1NDYA 2YB4A 3OBKA 3PJXA 2EQDA 2Z6IA 2DVTA 3WDPP 4IQEA 1XISA 1ECQA 4LCRA 4J7RA 4AD5A 1FCUA 1QNQA 1XDJA 3HMJG 5BWAA 3GTXA 2BX7A 4FF7A 3P67A 1BQGA 3ZMRA 1XSJA 4H2HA 4PODA 5AKQA 5LNRA 3LENA 1YPIA 1GZJA 3WD2A 3VGEA 1KQYA 1UHVA 2D69A 2QMJA 4RZ5A 4GFSA 3HQOA 4IIBA 4DAFA 1L6WA 1DOSA 1BWVA 4TIMA 3SO7A 5HAOA 4GZ7A 3LY0A 4BS0A 2X30A 1KM5A 4DBEA 1EGMA 4ZFCA 1KA9F 3V75A 3EDFA 3LN3A 5HQMA 1Q6OA 2W61A 4C5ZA 2BY1A 3H4WA 4HNUA 3G6LA 5FL0A 3IUIA 3EWWA 1LG2A 4GE8A 4ML9A 4AXKA 3HV8A 2VEGA 1M5WA 3AIVA 1JZ2A 3BV4A 4PUWA 4C6KA 5IM51 2NUXA 1ADSA 4E4PA 3OO2A 1BGGA 5XIAA 3C0JA 3KM8A 8TIMA 3O9NA 3AZTA 2L5HA 2ZWYA 2NSOA 1QI3A 4HBKA 2OLHA 2VYOA 3RX4A 1KFWA 4Z1AA 3IARA 4K37A 3HU7A 2GJRA 3IJ8A 7PTDA 3SY1A 4GYKA 1FHDA 5KZ6A 3M0HA 3N6QA 4F0RA 4JHOA 1WZAA 1R3VA 1M41A 3MA8A 3TW7A 2DDXA 5E0CA 3VMOA 3N9KA 4WY0A 3EXSA 2NVDA 3PK7A 5EU9A 1W5MA 5C2CA 3BAXA 2D2GA 3HG5A 4L9ZA 4S3JA 2IKHA 3FW6A 1F74A 4S3KA 2XFYA 4XB3A 1QNSA 3T44A 2P10A 5JUVA 2VURA 4TO8A 3PPCA 4V1YA 3JS3A 2HTMA 2F8QA 2QDDA 4H6EA 1SZFA 5CC5A 3M41A 4B5NA 1XG3A 2OEJA 2WSYA 4AZBA 4HOZA 1QPRA 2FPVA 3C2FA 4GGHA 1GOQA 4Q4OA 2HE8A 1IEWA 4KPLA 3NGFA 2QDEA 1AH0A 2CWXA 1JUBA 1PTDA 4O19A 4HU8A 3OVQA 3GX9A 3U2OA 3WLNA 4F0HA 4H04A 2DFAA 1EBGA 3GR8A 5K9XA 2Z00A 1A80A 1Z69A 1XPYA 2P50A 4RX0A 4RR4A 2I9UA 4WOQA 1C8YA 3R4IA 2WJZA 3AYTA 2F6UA 3BJFA 2RAGA 3PAOA 2CZFA 4XUYA 1LL7A 2VDHA 4JL2A 3LRMA 4QQUA 3RXZA 1W9DM 3DBNA 1QO5A 2RFGA 2EPKX 1TPEA 3BGJA 1IEXA 3QPYA 4LCQA 4YVXA 5F2LA 2NQ5A 4O1DA 2OGJA 2WVVB 4ES4A 1DJNA 3SCTA 4AZ6A 4JYDA 1JJKA 2CESA 3M0MA 3KHDA 1W3HA 3EPOA 5ABFA 2NVCA 3IIZA 3MO4A 3WENA 1NVMA 1UOKA 4I9AA 2DZPA 4UTMA 4OBSA 3W74A 1Q8AA 4BHYA 4DJFC 1PCKA 2VC7A 4AX7A 4PMOA 3CPRA 5A2AA 4CN6A 5CPNA 2WMKA 2C7FA 1KLYA 1WX0A 5D03A 5CSSA 3RR1A 1UZ1A 2FZ8A 1U5VA 4URIA 2PWHA 4UTUA 2GJXA 3P61A 4IHCA 5FF7A 2C79A 1E4IA 9CGTA 4HNCA 2BB0A 3STGA 1XQLA 3W70A 1PS9A 3I7RA 2POZA 2XH0A 3BMVA 4NJJA 4O50A 4WUIA 4DF1A 2GUUA 3N34A 1V8EA 1C8XA 1C29A 1XIIA 2INFA 4M24A 2E7FA 1U1UA 4FNSA 3TQ0A 3P60A 2FHCA 3QBUA 3GUGA 3ZQ9A 1MWOA 1VIWA 4MNJA 1KGUA 5JVLA 1U83A 4UTWC 4NXKA 1LOQA 1Q3NA 2TSYA 2BXZA 2PE4A 2PODA 4A2SA 3T05A 2BXVA 1NQKA 1MSSA 2ZZ6A 5E93A 4F2BA 1KXVA 3B0PA 2O7QA 4KT2A 1M01A 3SN1A 2R1MA 1QJWA 3CHVA 4HNLA 4E3VA 3QSTA 5C9UA 1VBJA 4PEEA 4PCSA 1PKYA 1ZBKA 5IOBA 1EJSC 1Q65A 2C0HA 5DMYA 3G3DA 3MUZ1 4JFUA 5FF4A 4CNSA 1E51A 4IFOA 1UG6A 4ZQPA 4HTYA 4C6OA 1JI1A 5TD4A 4NHVA 2A85A 2BMBA 4M8UA 3OTRA 4QAWA 2B0MA 5A3HA 3T9PA 3M5ZA 3QW4B 1VFUA 4GNVA 5I3FA 2ZFAA 3IGXA 4WSJA 2Y7EA 2P53A 3SY5A 1PZ1A 3NL3A 1FBAA 4UFHA 3WUEA 2PLMA 1OX4A 4JKLA 3M9YA 4XAYA 1XBVA 4PZVA 3WF3A 4LF2A 3EX1A 1XYCA 3UXDA 1XYFA 3GYCA 3LI0A 6CGTA 4P7QA 4GQ0A 4AH7A 4BK9A 3V5CA 1UWRA 1H7XA 3R8HA 4M6QA 2Z1SA 1BLIA 3O6YX 4RJEA 4C6NA 3DGBA 3LPGA 3QXBA 3UT0A 4I7UA 1PUDA 2VI0A 1IT8A 4Q8UA 1DJGA 4KIRA 1RHCA 3EX2A 3LNPA 1W2VA 2YCEA 3MYOA 3S1XA 3VU2A 1K7XA 5F4WA 5AFDA 2PDBA 4MVAA 1ALDA 2UZ9A 5CGMA 4N9DA 5LA2A 3VC6A 2CLLA 4CEXC 2E67A 4HPXA 4Z1CA 1SZRA 4G1KA 2PP3A 1KM4A 2QUUA 1ECEA 1UWIA 5FSEC 3DFQA 4MLJA 2JIEA 3ABRA 1PJ9A 1E6ZA 2OMAA 3VOCA 2FMNA 3MUXA 2PCQA 2AAMA 1CGVA 3BK0A 3DZ1A 2OGYA 3W1QA 3BG5A 2F6KA 4HN8A 3PN8A 5G1MA 2G41A 2VD8A 2XU2A 1A3WA 1VFMA 3R12A 4FNTA 4PUUA 4FX8A 3QHMA 5IDZA 2YL9A 1WXZA 1HJXA 5JU6A 2E0PA 1G4TA 1AODA 2OPJA 5D02A 3KBNA 3OW1A 5TIMA 2I5GA 3UZWA 1H7NA 3G1VA 5I7GA 1OG6A 4WRHA 1TR1A 3W01A 4D72A 1XSIA 2PLJA 3NYZA 2OFJA 2RGMA 4US6A 2D24A 4O1AA 1OFEA 2V69A 1DQWA 1EIXA 1XGZA 3MKCA 3PY2A 1J2WA 3GHSA 1ITCA 3PWIA 4AHPA 3C6CA 2E6YA 1E9YB 2W3ZA 1MFUA 4W87A 3AMKA 3MHFA 2VZOA 1I0DA 3AXHA 3MHUA 1FX6A 2HE5A 2VT0A 3R58A 2E68A 4X63A 4HA0A 2R9RA 3MUAA 4B92A 4GVFA 3WMSA 5JBDA 4HD5A 4F48A 3BTNA 4U31A 4MNKA 5FJUA 1FHVA 4DNHA 1G69A 1PYFA 6XIAA 3WH5A 4AIBA 4OHQA 3BJSA 4UTHA 3JW7A 2OU4A 1RXOB 2V5JA 5C9RA 3PJWA 4MPKA 3N4FA 3LXBA 3C86A 6REQB 4JQ1A 4J3UA 3VC5A 4BZYA 3M0JA 1BSIA 4C6DA 4GX9A 2O0TA 1E5NA 4HU0A 2BBFA 1K77A 1V4YA 2Z7KA 3DC8A 3UBPC 5C54A 3S1UA 2WHKA 4FPSA 1AFSA 2D3NA 3BARA 3ARVA 1L6YA 4DJEC 4D8LA 1XFBA 4YU1A 1TREA 3KOFA 4DF2A 3RHGA 2XINA 2IKIA 4GABA 2NXGA 1Q7QA 4N0RA 2CZVA 3U8GA 3ZJKA 1JPDX 3TCEA 5LIXX 1JCNA 4MDPA 1SM9A 1KLZA 4IM4A 2GDQA 1YDYA 5AYIA 1SSDA 4F0LA 1P0NA 3TP4A 1GORA 1HKWA 3VX1A 4XAPA 3MDWA 3CS2A 4ZMGA 3GG1A 3O15A 1QVBA 1K7EA 4E2BA 4PUEA 1TPWA 3T78A 1E43A 3CHFA 2G97A 3XIMA 3GM8A 3AU6A 2G0WA 4TTUA 3UCCA 2NQHA 4U5KA 2NWSA 4HPGA 3G5EA 4QG9A 4HA3A 1G0CA 1JD7A 1OYAA 1XDMA 3M7SA 1DEDA 1K9TA 1XLEA 4MWAA 3BZGA 3W02A 3WQWA 1W91A 3N6HA 1WDSA 3NJ3A 1ITQA 6TIMA 1XGEA 2BS9A 3WH6A 1M7XA 1VFOA 1XKJA 4IT1A 4PC8A 4ZOAA 3T7VA 2PDWA 3W76A 5EFDA 1QDSA 3ANVA 3TXZA 1UR0A 1HL9A 1KBBA 3SUWA 4MYAA 2WVSA 3GHRA 1PZ3A 3KBMA 3PZIA 4LS0A 1V0KA 3ISIX 2G4FA 3M6YA 2DY3A 3H54A 3PZTA 1LRQA 1H51A 2HVNA 1QWKA 3UXKA 4NL1A 3WZ0E 1BWLA 1Z9AA 3VM7A 1TRDA 4CU6A 4L4OA 2C6QA 1TUFA 1MEHA 1CGXA 3LB0A 4JN8A 4JTSA 3WJZA 4ERGA 1BPLB 3T09A 1PX8A 2E5BA 3UWZA 2NQZA 2FQIA 5EBUA 4GQQA 4U2YA 3EZ4A 1QK0A 4H9UA 4J27A 4AY1A 2VX5A 3NEHA 2ZZ7A 3SRDA 1R0MA 1Z8AA 3DG6A 2R94A 3VO0A 4DI9A 3O2LA 3S2NA 3WUFA 3QSRA 3SFKA 4HNVA 4AWSA 1VYSX 4HMEA 1AQHA 2Q8XA 1GTHA 3DFHA 1TV7A 2DJXA 4OOUA 4J1OA 2PI6A 4IG2B 1M03A 2GQ8A 2WSRA 5RUBA 4LH8A 1KV5A 4IQDA 1PKLA 4HHPA 1L2QA 5FAGA 1J0IA 3W25A 2VEMA 1P0EA 1V08A 1UKTA 3N9SA 3WJYA 2XDFA 6REQA 1W9XA 4JYEA 2DZSA 4DO6A 1NWTA 5F2MA 2IMRA 3EDEA 2WQDA 1EYWA 2FHBA 2FZNA 4PFMA 4FOJA 4RDWA 1JF6A 3QHOA 4RLIA 1ZBVA 1UR2A 1TIWA 3W37A 4JN6A 4R7JA 3UR2A 4DZ5A 2ZC8A 5HWMA 1JGMA 4UMCA 4Z08A 2PC4A 2CHRA 1Q4NX 2PBGA 4ZODA 1ZCCA 3V4BA 2VEPA 3W7DA 1XSKA 3MHGA 1XBXA 2BHYA 4AD2A 3QGVA 3LHWA 2CCRA 3OVRA 1UWTA 4Q4SA 1UPMB 2OX1A 1E6RA 2PWEA 4JCLA 3V18A 1BSLA 4GQBA 4FB7A 5D09A 4QS6A 3AROA 2PWVA 2G4JA 3HIJA 5FJRA 5G4HC 3RN6A 2XVNA 3A3XA 4NT0A 4CCEA 1MQPA 4AHOA 3KRSA 2QIIA 4NRSA 3UG8A 3QQWA 5T9CE 4FR6A 2Z2BA 3FJLA 2PTWA 4UR9A 3P8IA 2PD9A 4GI6A 5T91A 1EUNA 4Z1YA 3GNOA 3QEZA 4DXKA 3BAIA 3G1YA 1P6CA 5HR7A 4UCGA 1SZEA 1BKHA 1C8QA 5TAOA 3IIVA 5LIKX 4PMZA 4KCUA 1MMFA 1IV8A 4JFVA 3DCPA 3NQEA 4XKMA 4B91A 4ZXOA 4JTUA 4MUZA 2VFGA 1E4MM 4OVXA 4AW7A 2HQAA 2X0HA 3ANUA 1HIZA 3NNTA 4AG0A 1EBHA 2ATSA 3TSDA 5KMYA 1U1JA 4B9ZA 1JPIA 1LT8A 2PDQA 4IZGA 4RV3A 4FHAA 5LHEA 5E9AA 3WNOA 2VC5A 3Q4DA 4B4HA 3GW3A 2WC7A 1Q8JA 1UROA 4NY2A 5H1WA 2WMHA 5K4XA 3C3NA 3QJAA 2DZVA 4PBEA 4G56A 2OLSA 3LCFA 3CWHA 4HJWA 3W88A 4F8XA 2FH8A 4KESA 1TE1A 2QQ6A 3S3GA 1X97A 5AHLA 1Q7ZA 1KFEA 1DQUA 4Z2GA 3U2ZA 1VRXA 1C91A 3WMBA 2FTYA 5CCZA 4B5UA 3BSHA 5AYZA 3BURA 1MZRA 3PZMA 3U2CA 4WJEA 1X8CA 2KX9A 4XISA 1DWGM 1XM3A 3NQ2A 4JDYA 4ZZ9A 3HQNA 3SCVA 4HP5A 5CG0A 2QUVA 4UQEA 2CU0A 1PBGA 4TTGA 4H8VA 4I9JA 1SU5A 3PTQA 4NNCA 1VGAA 3KCOA 1JXKA 3TOYA 3I4EA 3IJQA 4P8XA 3L7RA 3H2MA 3LLXA 5K4ZA 1IR1A 4IFKA 3MANA 1PHWA 5KZDA 4E6MA 3ZZ1A 3TQPA 1AZ2A 1XCXA 1JD9A 3NDOA 1RP9A 1EO7A 1L8NA 1N7KA 4MPQA 4XAZA 3L4VA 3NZQA 3L23A 4DO5A 3UZZA 2WJDA 2CITA 1D2KA 4LU0A 2QPUA 2ZICA 1B3XA 4AXNA 4Z2HA 1ZPTA 4DBUA 2IPWA 2BOFX 4W8AA 1BWKA 4MLRA 3BWWA 3LA4A 2J9YA 3MSDA 3SN4A 1O5QA 2PTZA 2DH2A 1TJRA 2UY4A 4LVFA 4W84A 3UP8A 5JH1A 3GE7A 1KWGA 3RCMA 1GVIA 3I6TA 2Y2WA 3CAQA 1SO6A 3P7YA 3EOOA 1F73A 4LTSA 4WHBA 4I5RA 4JTTA 2HPIA 4EK7A 3TW6A 1A5LC 2XH4A 1JDFA 1WYIA 3UWEA 2CETA 1YIXA 1FHLA 1YXCA 3PPFA 3CEPA 4D2JA 1K03A 4MYXA 3CQIA 3HMCA 2DQXA 4YWSA 1QHPA 1DWAM 3ZSTA 3PSVA 2XGZA 4PEKA 3GKAA 4XVDA 1EC9A 3BGAA 1K1DA 4PL2A 3VD5A 4W5UA 4X9YA 1EA9C 4XD4A 3VABA 3GXFA 2VVSA 4L4MA 3LBCA 1R9YA 3CQJA 4LRTA 4NAEB 4AF0B 2EPLX 2O7SA 3UG5A 3GVQA 3M0XA 4NU7A 3FDKA 3FVDA 5LNSA 4JCMA 3KTXA 3LLDA 2VFFA 3NVTA 2NUWA 3PWGA 3T2PA 5K9CA 3TC3A 3UEQA 1OVDA 3N2TA 1RAKA 4WKFA 2VVNA 1UKSA 2EKCA 3W2KA 3NVDA 1ZCOA 1MO0A 4J3VA 1DORA 3KRBA 4IF2A 1P1XA 4IICA 4G7EB 3FK4A 3LK6A 3MCOA 3FN9A 1DWHM 2YA0A 3FEMA 3CV2A 1L6SA 1TMHA 1WP6A 1O5XA 1OT2A 3U48A 3LCGA 4FS9A 4DN1A 2JF6A 2Z28A 3B8UA 1RK6A 3T81A 4AMAA 3S2MA 3VD7A 3EBVA 2Y5JA 5A8QA 1JIBA 3PSWA 3IWPA 4O1FA 3WFAA 4X22A 2B4GA 3SUTA 4M1RA 1VC4A 4NILA 1UH2A 4A8IA 4ACZA 4KFOA 3MVTA 1AJ2A 2Z6JA 5T9BG 1TRIA 1MXGA 2NQ9A 4O53A 5E09A 4LW7A 1WKDA 1XYLA 1VBRA 2BY2A 4LT9A 4WY0B 4BEQA 3DIPA 2A79A 3SCPA 4IXHA 1NAL1 2J78A 4LUSA 1TQJA 3GU9A 3BOFA 3QC0A 1W56A 4ICCX 3KDOA 2V6AA 1S3TC 4YWIA 1SW0A 1KWKA 2B31A 1TPUA 4G5DA 4YN5A 1B90A 1ZRQA 1RD6A 3AYVA 5BRPA 2QMKA 3SGUA 2AOSA 3ITOA 3PHAA 3FA5A 1MXDA 4P8VA 4OQVA 4R53A 1JCXA 3TROA 3ZVIA 2B7OA 4NAFB 3I6EA 1S39A 2QULA 3OQ8A 4NASA 2YYTA 2VDGA 4KGLA 4H8NA 1EIBA 3KOWA 1Z89A 4N6EA 4UQ9A 4FOUA 4KH2A 4YVPA 1QK2A 5ABGA 1Y7VA 1YBQA 4PTVA 1DJZA 4GIAA 5BZAA 1DIOA 1JFXA 3BCJA 5CLTA 2WNWA 1W3NA 2FFIA 4A6GA 8XIMA 4HVXA 1IWAA 3LU2A 2A4AA 1AK5A 2PFHA 3THQA 2W4XA 5LGZA 4M6UA 3M0ZA 4TMBA 3IVUA 3LXAA 3L9CA 5G2HA 3UERA 1RJPA 1XHGA 3SBFA 4FP1A 1GYMA 1HF6A 3N6JA 1KCKA 5U7SA 1YADA 1FCBA 4CN4A 5D32A 3LHUA 4ZE5A 1BRLA 4IP5A 4PRTA 3N2OA 4QJ4B 3M1ZA 3NQMA 4PRWA 1SZNA 3BL3A 1X39A 3GNDA 3L4WA 3B9AA 1W32A 1V79A 4QDPA 4WK9A 3V0TA 2O56A 1BYAA 3KRUA 3RITA 3GIQA 1XLIA 4MOZA 2JALA 1JG9A 3M47A 2IXVA 2Z0IA 1BYBA 1B3VA 3PBVA 1HJSA 4QGCA 4LAOA 4FX7A 3C61A 1JCMP 4N4PA 4YMZA 4W9TA 3REQB 3UJ2A 5L9FA 3WDJA 1XL9A 2QS8A 1GKPA 3P6LA 2H8ZA 5B80A 4P5UA 2FIQA 5HQEA 3NXFA 2VRKA 4NX5A 3VCCA 2WCSA 1GYNA 2RJHA 2TPSA 4FIRA 1S5MA 3E6EA 2AAAA 6ALDA 2OQLA 3CQHA 4YNGA 4WOZA 5LA1A 1T8QA 4IFRA 1SW3A 2C18A 4I5XA 2C3ZA 3EKGA 1NY1A 3FJ4A 3NEVA 3G0XA 1MNZA 1L2UA 3H8AA 3TLQA 1IT7A 1D8CA 2FZBA 4TVDA 1QBBA 1XIGA 3C4UA 2CLKA 3G2GA 5IRPA 3KS6A 2QW5A 4INFA 1PXGA 1SFSA 4YLWA 4OV4A 3G1FA 4BQ2A 3EA2A 1PDYA 2D2OA 3B8SA 3UPBA 4UTFA 3GXMA 1MUCA 1D8WA 1ZAJA 2EF9A 4L4LA 4O13A 5I3DA 4EVZA 3SUVA 3W27A 1ZNNA 3WLPA 4LNYA 3L4XA 3AFBA 4X2PA 3UWQA 5ECVA 3EX3A 4L5ZA 3INPA 5G4WA 3CIWA 1A0DA 3U2EA 3CU2A 3VFLA 1CIUA 3MS8A 2WSKA 1W9VA 3EPNA 2Y8KA 3NSNA 2GQ3A 3BLIA 1EXPA 3TA9A 3E0LA 3GNNA 1H60A 1K02A 3F4CA 3NO5A 3SQMA 2V2HA 3PANA 2PDHA 3LG3A 3TTQA 3L66A 1JDAA 1ZJAA 2QXWA 5HMSA 4DJEA 1CPUA 1RD5A 2QR6A 1UC5A 1ZHAA 2DZAA 4R85A 3H70A 1M7OA 4LS2A 4ML4A 2REQA 4UXDA 3A24A 4F4RA 2RHGA 3RPDA 1MDLA 4PB4A 5BXTA 2Z29A 3IAQA 4G6CA 2ISFA 3WQ6A 3NPWA 1R3TA 2X7WA 4K2SA 3IJDA 3T6CA 5B7YA 3RF9A 3I4KA 4UTIA 4ZB0A 3SGZA 4O57A 3URQA 4DZAA 1BTMA 1KKOA 1QHZA 3BJTA 2ISSA 1JFHA 5FF2A 1DE5A 4DHGA 4D6HA 3PTMA 5AYYA 4ZENA 1VEPA 1B1YA 4LJ3A 2BDQA 5I02A 3K2GA 3AHZA 1JZ8A 3CLWA 1R3SA 1KW1A 3W87A 2QT3A 2J7BA 1XYZA 3NZRA 3PUDA 4E4FA 5CPOA 1JDDA 4L4PA 3CO8A 2C1GA 2WMGA 4DXXA 4ASTA 4IOTA 5I00A 2FKPA 1RPKA 2J27A 3VKAA 1WZMA 4PB5A 3U5YA 1EJVC 4PCPA 3H2OA 3FOKA 5EMKA 1LQ0A 4S3GA 3WBEA 1AW5A 4K8GA 1MW0A 5TF0A 3W24A 3MJYA 1SW7A 1TJ2A 2YB1A 1KM0A 3A4JA 4L65A 1AMKA 1ISYA 1SQ7A 4B3LA 1OSEA 2OZTA 1GWJA 1WNOA 2DGAA 1V3KA 1ZS2A 2QZRA 2FVMA 4M82A 4W7VA 4S3BA 4BI7A 3NQFA 4K39A 4DQWA 4E4UA 2NZLA 2Y62A 1AH4A 4H9XA 4ORIA 2H3BA 3VDGA 3ALFA 4PTMA 2WBKA 2ZUUA 1FWGC 3GUWA 4WIWA 4MUPA 4JYFA 4DM1A 4ZQCA 2V30A 1FP9A 3DHUA 5D33A 3ZM8A 1WV2A 3TH6A 4EPEC 1QU4A 3FNDA 2KAUC 1ZL1A 1RQBA 3N73A 1UBSA 4Z2JA 1ICSA 4WJXA 5FF3A 1YDOA 2A3AA 1AVAA 3OA5A 4D6IA 1JRBA 3RU8X 3BLOA 4F0SA 2AMXA 1Q6GA 4J28A 1NJJA 3ZR6A 1DIKA 1O94A 4AMCA 3DUGA 1WDPA 3B8IA 3THUA 4PRRA 3PVFA 1ZJHA 2P8BA 3BMWA 1FWTA 1CLXA 2BASA 3WDIA 4ZOBA 4AEFA 2C91A 1WXJA 3W29A 4A3HA 2FDMA 3PZQA 3ZJ8A 2WSPA 4O1CA 1OG0A 2E25A 3AJXA 4QRNA 5T26A 2E77A 4XVEA 3GW0A 3STFA 3S42A 4WCJA 4XX6A 4H19A 4AVFA 3FSUA 4S38A 3WF1A 5C9XA 2TMDA 2BGNE 1TWZA 4ZEPA 5BW6A 3AAMA 3T07A 2XFFA 1I2RA 1OCJA 5EKYA 4ATDA 3GLCA 2WNQA 3SJ3A 4H1ZA 3UPWA 3W1LA 3EMCA 3EDJA 3B05A 5HR6A 3I3DA 3W1RA 1ZBCA 2VCAA 2JKPA 1XLJA 3LRKA 2G95A 1F61A 2AL2A 2OSYA 2CZEA 2JEQA 2PBOA 1NTHA 4JNZA 4A05A 2HCVA 3DYMA 1QRQA 3USBA 5H8PA 1UKOA 4ZOEA 2OZ3A 4AB4A 4Y9PA 1WQ5A 5ENLA 1XQKA 4K3ZA 2NVAA 3U6WA 3W7JA 3TCSA 4HA4A 9XIAA 3S5SA 2ZZ1A 3WH9A 3VMPA 3B9NA 2EXOA 1DKWA 3MBFA 5FCZA 5F7UA 2GDUA 3MUIA 1CWYA 4EF9A 3N4EA 1JCLA 1X1NA 5C7VA 3GTFA 1RVKA 4GY1A 2PCEA 1ICQA 5A95A 2OQHA 2YIHA 4H8HA 3F7JA 3GDTA 2ZYFA 3KS5A 4L1XA 3PZOA 3KXQA 2CPUA 2YJQA 3LSCA 2W67A 3A9BA 2VEKA 3TW9A 2W62A 2FH6A 3E5PA 3OPSA 4U10A 1YNPA 1XIFA 3VKCA 3VGGA 1VBUA 2X0YA 3UJRA 2D0HA 2CLHA 3LMYA 5E6YA 1P48A 2PDCA 1R30A 3ZO9A 1GOWA 1V93A 3KOXA 4EX4A 1OGSA 4EXBA 1E55A 1DTNA 4AZGA 4H83A 3FX4A 3UJSA 2E8ZA 2TAAA 2FPYA 1KRMA 3LCXA 4LB4A 2OB3A 1GOXA 1FDYA 2BY0A 1E73M 4RUBA 1VS1A 4NX0A 5H8UA 3ZIZA 3T0DA 1F6KA 4GY0A 4DWDA 3WEOA 5LIUX 4R9OA 3B3DA 4H41A 2DORA 3BPWA 4CCDA 1ISZA 3C0QA 1JR1A 4MADA 3PTDA 1J0HA 4B3ZA 3TFCA 3P0XA 3HF3A 2YDAA 1S5WA 1AL8A 5EMLA 3KL0A 1WZLA 5D05A 2D1ZA 1DXFA 1GQJA 1LL4A 3NQ6A 2ACRA 1XYBA 1REQB 1WBHA 1TVLA 4EKJA 4A8LA 3W7LA 1NWSA 4CNUA 1VCGA 3GDRA 2NT0A 5J5RA 3E0VA 4ADSA 5I3GA 3GWQA 1S5NA 2BVYA 3HGRA 3ABOA 1P0BA 2DQWA 1US0A 1I1XA 1H63A 4HT3A 2FB2A 2QUTA 1TTQA 4HMNA 1S1RA 4CQ8A 3OYXA 3W2MA 4CD5A 1NFPA 3S9YA 2UY5A 3EEZA 3NPXA 3WQ4A 3AS1A 3MY9A 2ZRYA 1J0YA 1KR1A 4Q4PA 4GO8A 3H4XA 1FFQA 3N4AA 4HN4A 1LP6A 4OUEA 2GFTA 5D38A 1F7BA 3UJEA 2D3LA 2A5HA 4GJJA 1VH7A 1ZGDA 5EMJA 3W7KA 5AY7A 2AQWA 1UUMA 2OX4A 2PDMA 2W92A 3WBWA 3BAJA 3IAPA 4NJGA 5LYRA 3RO6A 4AEOA 2PSNA 2Y8UA 2I7GA 3C0SA 4QE4A 2CKSA 4UNIA 4MF4A 4E5TA 1P0KA 1NIUA 3TKFA 4YTTA 2BHUA 3VNMA 3LRLA 2IPJA 5FOOA 3UWYA 2F9RA 4YYFA 3STEA 4CQBA 3JR2A 1V3IA 2BGSA 3QOKA 3N15A 1CB7B 1A0CA 2YOCA 3H2CA 5CPMA 1IEIA 3EWBX 4PCFA 4R5EA 2PLCA 3A47A 2YBVA 2BOEX 1W1TA 3OBAA 4GXPA 5HINA 4Y90A 1AW2A 2HBXA 1GK8A 1MW1A 5B7ZA 4HK5A 1TWDA 1GQIA 1UD2A 2XVLA 3S6DA 3OLIA 4YHGA 3CNYA 3PUEA 4F3HA 3BVJA 4KIEA 2Y0FA 3O07A 2A7PA 3S1GA 3GB6A 3OA3A 3M4HA 1E1CA 3QOMA 2REQB 2O4QA 2CWNA 2ANUA 4PUDA 2PUZA 4KCWA 2A3CA 3JZEA 3L5LA 1XKYA 3THAA 1A49A 2WZEA 1ZJBA 2J75A 1M68A 4GX8A 3NWRA 4H6KA 3T55A 1R86A 3G1HA 2CBIA 4EANA 1LWHA 2XN2A 4L6DA 1UD8A 2TODA 1FXPA 2Y63A 4X60A 4DPPA 2DT3A 3BDKA 3B0XA 2WMIB 3WJWA 2EG8A 1BEUA 1YEYA 2CC0A 2IPGA 4WZHA 4RNJA 2YX0A 1FWWA 3UYIA 1PCWA 4ROPA 4JIQA 1XV8A 2DZXA 2Q09A 2Y1HA 4A35A 3FJ6A 3R13A 3CZEA 5FJPA 3EKZA 5D9PA 4AVNA 1UD4A 1SFJA 4KEZA 4XBKA 3IJ6A 4WVXA 2V3EA 2J8FA 3UXAA 7TAAA 4UTKA 1OZMA 2V5KA 3AMLA 1REQA 4QQ3A 5A6MA 3PTKA 2ACQA 5F1VA 4ZA0A 2V8ZA 3K8LA 1RUSA 1OFDA 3H7UA 3DFNA 1ENUA 1I0BA 1UA3A 1GYLA 2J25A 3VI2A 3BC9A 4ZGYA 1V02A 1W1YA 4GK8A 1O60A 1I9CB 3L4TA 4M29A 2WPGA 3GVRA 3W86A 2PTDA 3G22A 2DSZA 2WLZA 3CPGA 4GHRA 4C65A 3WKZA 1EA0A 1FY6A 3GQYA 1JGIA 4O54A 1UR9A 3UCQA 2B7QA 4M5PA 5JH2A 1OFPA 3RJYA 1S5TA 4ZQMA 3PBUA 2FPTA 3UA3A 2I57A 4UTTC 5I79A 2E5DA 4GQGA 3V36A 1JPHA 3BMXA 5HXMA 1QPQA 4CEUC 1BAGA 4UQBA 5BXSA 4YTSA 4CD4A 1VFSA 3IJIA 1UA7A 1CLKA 4O8AA 3UY7A 1TSIA 5IDIA 1RJQA 4KEVA 3W6LA 4X61A 2YBUA 1FQ0A 1TV3A 2AKZA 1RK5A 2FGBA 1Z6KA 1J6OA 4XD5A 1LUCA 1A5CA 5CH9A 2XWEA 4P7RA 3E2VA 1EF3A 1RCQA 4MY8A 1GKRA 4XWUA 5KEZA 3L5AA 4I90A 1QOPA 2GLKA 3WSUA 4N9CA 1W9PA 3Q45A 1A5KC 3P84A 3W2UA 3SQLA 3MKVA 4IPJA 5CGQA 3EWYA 4WEVX 3BICA 1R2SA 1IWBA 4JQ3A 5G2IA 5CSUA 2ZBTA 1EL3A 4I5UA 4NG3A 3E5BA 3BO9A 1ZJIA 4MFDA 1J9YA 1DWIM 1XC4A 3G1SA 1CI1A 3VK5A 3QYSA 4HIBA 2JK2A 1EWEA 2QV5A 1R87A 3GC4A 1DWFM 2YBTA 3SCQA 2HWGA 5DCDA 1XIJA 3WH8A 1H7OA 4OV9A 4RE4A 3N13A 4N9EA 1OGBA 4IP4A 4KMQA 4QCFA 3OG3A 3WIJA 3VNIA 4RXFA 5AN7A 2BP1A 2WWDA 1E1FA 2A7NA 3SCRA 3URAA 2AGKA 4NSBA 4PCNA 1R8LA 1PWLA 1Q6LA 3W7QA 1B31A 4GYPA 4WDUA 1HGWA 3KVMA 1GPWA 4JR5A 2OELA 1OD8A 4KRTA 4QLLA 1V6UA 1E4NA 2GOUA 2PP1A 4DVOA 3VXGA 4C7GA 3M0IA 1O5RA 1GEQA 1ZP3A 4EPKA 1PIIA 3BQ6A 4PCTA 1TB3A 3L4ZA 3HQ1A 3LTYA 1W3KA 3DHPA 3O63A 2FZMA 4D6FA 1EQCA 2HRWA 4RW5A 5FEXA 1WOBA 5A6BD 1E6SM 3ZWTA 3JRKA 3VE7A 4LXFA 3REQA 2PZNA 4UQAA 3I3BA 2VZSA 2RJGA 3S5YA 1GHSA 4QTGA 1W17A 3H4GA 1WBJA 2QVNA 2ZUMA 4GUGA 4M7TA 4ADTA 1PIGA 4H2CA