4RDZA

Crystal structure of vmolac in p64 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
314
Chain Sequence
b'GMVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
total genus 123
structure length 314
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdzA00
4GY1A 2BB0A 2WJDA 4V1XA 4H9ZA 4CNUA 3MJMA 1QXLA 3E0FA 4XAFA 3UPMA 5LXXA 1EF2A 4HA0A 4IFKA 3B40A 4ERGA 1YBQB 4G7EA 1UMLA 4I6VA 3PANA 2ICSA 4CNTA 3E3HA 2PLMA 3MVIA 3IPWA 1GKRA 4LALA 1PTAA 2QS8A 4HJWA 2Z27A 3NQBA 3F2BA 3RN6A 4H9VA 3PAOA 4AC7C 1A4LA 4PCNA 2PGFA 4XAGA 4IQJA 1PO9A 1RJQA 2Z2AA 3MSRA 4H9YA 4H01A 4IH3A 1KRBC 3PNZA 4KEUA 1EJTC 1RA5A 1YBQA 4WVXA 3TN6A 1XGEA 2RAGA 3HTWA 4J2MA 1EJUC 4HK5A 4J35A 5A6TC 4PCPA 1EJVC 3MTWA 4C6KA 1PSCA 3F4DA 3R0DA 4G2DA 4KIRA 1A5OC 2HBXA 2Z25A 2WJFA 3E38A 4KETA 3GU9A 3GG7A 2D2JA 4NI8A 4GZ7A 4H9MA 3T8LA 1EJXC 3B0XA 3K5XA 2Z4GA 3C86A 2HPIA 4IG2A 1FWGC 3IACA 4EPDC 1J6OA 1XWYA 2W9MA 3A4JA 1UBPC 3LS9A 5FSEC 4IGMA 1J79A 2UBPC 4GXWA 4ICMA 4L9XA 1M7JA 1WXZA 4V1YA 4GY0A 2QT3A 1A5NC 2E1WA 3G77A 4IFRA 1POJA 1K70A 2Z29A 4R7WA 3F4CA 4I6KA 3S2LA 3URQA 4KQNA 1A5KC 2XIOA 3CJPA 1RK5A 3T81A 1NFGA 2DVXA 1HZYA 4IF2A 1WXYA 1K1DA 3NURA 3ID7A 4OFCA 1GKQA 3NEHA 3O7UA 4LCQA 3E74A 4YIWA 1FWEC 4ERIA 2GZXA 4M51A 4DNMA 1XRFA 4C6QA 1BF6A 3OOQA 4KEZA 4LAKA 3URAA 4LANA 4C6LA 2AMXA 3O0FA 1P6CA 4C65A 3E0LA 1FWDC 3GRIA 3ICJA 4CQCA 2FTYA 1UIPA 3S2NA 4MUPA 3JZEA 4LCRA 2YB1A 2P53A 4XD5A 3F2DA 2R1MA 1R9YA 2CZVA 4PE8A 1RA0A 1R9ZA 4QTGA 4NG3A 4B92A 2OB3A 4C6IA 3AUOA 3FDKA 1POKA 2FFIA 2O4MA 1ITUA 4E3TA 4LCSA 5G4HC 4NP7A 4GC3A 1EJRC 5FSDC 3URBA 4J5NA 1RJRA 1RAKA 4QSFA 3LY0A 1V4YA 4RDZA 4IG2B 1R9XA 2Z28A 3GTFA 3IARA 4DZHA 3TNBA 1P1MA 2O4QA 4GBDA 3LSCA 1W1IE 2OQLA 2PUZA 1EYWA 4IFOA 1O5RA 1ADDA 1EJSC 1V51A 3PNUA 3LGGA 1E9YB 3QGAC 4XAZA 1V7AA 3EWCA 3OODA 4QRNA 2DVUA 1KRMA 1RJPA 3MDWA 3OU8A 3TN3A 1J6PA 4DYKA 4GY7A 3IJ6A 4QS5A 2QVNA 1PB0A 3IRSA 2WJEA 2Y1HA 4EPBC 2YB4A 4DLFA 3TN5A 4D8LA 4F0RA 1M65A 3DUGA 1KRAC 2AQOA 3F2CA 3GTIA 1EZ2A 3AU2A 4RDWA 3EGJA 4BY3A 1ONWA 3DCPA 3S4TA 4LEFA 4RDVA 4WHBA 1ITQA 4KESA 2FTWA 4QROA 3LGDA 4H9TA 3IV8A 2D2HA 4DO7A 3UF9A 2UZ9A 1A4MA 2AQVA 4XAYA 2KAUC 2OGJA 3ITCA 1M68A 1YRRA 3WZ0E 1FWJC 1NDYA 4L6DA 1JGMA 2OODA 2I9UA 1E9ZB 3HPAA 1YMYA 1FKXA 2HQAA 1O12A 4XD4A 3WYZA 3QY6A 3TN4A 4INFA 4DLMA 2ANUA 3LA4A 1VFLA 4H9XA 5E5CA 4LAOA 5HMDA 3QGKC 4EPEC 1GKPA 3SO7A 3QY7A 4CNSA 2VC7A 2GWNA 4AQLA 2VR2A 4GX9A 2Z26A 4BJHA 2OOFA 4RDYA 1FWBC 4KEVA 2WM1A 3S2JA 3ORWA 4HK7A 2QPXA 4EPKA 4C6JA 4CQDA 1FWAC 3KM8A 2ADAA 4B90A 3ISIX 3GTHA 1FWHC 1KRCC 2E25A 2VM8A 1NDZA 1A5LC 2R1LA 3GUWA 3MVTA 2Q01A 4C6FA 3CAKA 4C6OA 2YZ5A 4B3ZA 3RYSA 3A3XA 4H9UA 2HNHA 3E2VA 4ZSTA 5AKQA 3K4WA 2EG6A 3MDUA 1FWCC 2VHLA 4KF1A 2D2GA 3OQEA 1RK6A 1YNYA 4GOAA 4PBFA 2Q09A 1YIXA 2G3FA 4DI9A 2EG7A 1A5MC 1I0BA 4LAMA 4Z42C 2FVKA 2YXOA 2GSEA 3D6NA 3GIQA 4H00A 4R88A 3S2MA 4HK6A 2PGRA 4DZIA 1NDWA 4LH8A 2Z24A 3RHGA 4C6CA 4CQBA 3N2CA 1FWIC 4GX8A 3AU6A 2HPMA 4XD3A 4P5UA 3SFWA 3OJGA 4C6PA 4DI8A 3WMLA 1KCXA 2PAJA 1QW7A 3UR5A 4RE0A 4C6EA 4ERAA 4RZBA 1XRTA 3T1GA 2I5GA 4XD6A 3FDGA 1ONXA 2BGNE 3V7PA 4UBPC 2A3LA 4JOMA 2EG8A 3PBMA 3LNPA 1V77A 3K2GA 2Z00A 4C60A 3MKVA 5HMFA 3DC8A 4DIAA 3FEQA 3MPGA 4F0SA 1NDVA 2GWGA 4IGNA 3OVGA 3B0YA 2IMRA 4GYFA 4C6BA 1V79A 4LFYA 4C5YA 2GOKA 4C5ZA 3LU2A 4R85A 4GK8A 4KERA 2DVTA 4QS6A 5CH9A 2VC5A 3EWDA 1UIOA 4B91A 2P50A 4F0LA 3QY8A 1IE7C 3GU1A 4C6MA 3IGHX 1FWFC 4BKNA 2R1PA 1ZZMA 3UBPC 2Z2BA 3URNA 4IFKB 1J5SA 2HBVA 1FKWA 1K6WA 3GIPA 4C6NA 4G7EB 1S3TC 2R1NA 4CEUC 2ZC1A 2VUNA 1P6BA 2F6KA 1EJWC 4PBEA 1DPMA 4WGXA 3RCMA 4C6DA 4TQTA 3BE7A 4EP8C 1I0DA 2R1KA 3HM7A 4ZSUA 2Z7GA 3GTXA 2FVMA 4CEXC 5HMEA 3UR2A 3GU2A 3CS2A 4UB9A 3LSBA 3A3WA
chains in the Genus database with same CATH superfamily
4V1XA 4CNUA 4HHLA 2VC9A 4JNZA 2CHNA 3EDEA 1X1ZA 3GBEA 4E2BA 3SM0A 1BD0A 3ARPA 1EIBA 3B40A 3OW1A 4F3HA 4I6VA 1GVYA 5I7GA 2E3ZA 1M04A 3LRLA 4ZQRA 2HMCA 3BO9A 1GKRA 2FZMA 1JDEA 3CQJA 4OT7A 1QVBA 4OZOA 4J3ZA 3NQBA 4W93A 3VZZA 4AC7C 1OK4A 1J0YA 2B31A 4DELA 1GVOA 3ABOA 3IGXA 1XPYA 3W1PA 5EMYA 3VUPA 5EBAA 3UXDA 4DUXA 4TXEA 2FHBA 3P14A 2VP8A 2VCAA 3WQDA 1B1YA 2ZXAA 3GR4A 5C2CA 3HF3A 2PEVA 3E38A 3LHVA 3RR4A 3P84A 4A3YA 3B0XA 4MJ2A 4EWND 3U57A 2W62A 3A47A 1A47A 4EXBA 3HG4A 2CHRA 3WLQA 1XKJA 1SMDA 4N6EA 4RL3A 4DF0A 3CO4A 2QF8A 3G77A 5BWFA 1F73A 1EL3A 3CAQA 4JFUA 5FJRA 1NFGA 2ZDRA 1TZ7A 3AALA 1GKQA 2BLEA 2WCSA 1LDCA 4AFYA 4M3PA 5I3GA 2FYMA 3EB4A 4ASTA 1UB3A 2ZZ1A 5DELA 3GR8A 2DSZA 2F61A 3LDVA 5F2GA 4QBXA 4O8AA 3EPNA 1HJVA 1QI5A 1R3RA 3AYRA 4LC6A 4DJDC 4Y9OA 2ZRUA 1FHUA 3EMCA 1UHVA 1MI3A 2BXVA 3H8AA 1NELA 4NHVA 5HA7A 1DOSA 4DNHA 4IISA 1FWDC 4MUZA 1GWJA 1WZAA 4XBSA 3OBAA 4MNMA 1R85A 4JYEA 3C61A 5J5DA 1E40A 3S5OA 5I03A 4Z2LA 3VTRA 4BQ4A 1FP8A 3ZSSA 3N73A 4I7UA 3FV9A 1DJYA 2CKRA 3ABXA 2FH8A 4I9MA 2Y62A 3TX9A 2FGBA 3GTFA 4AISA 3CZJA 4OTKA 2GLKA 1IXQA 3EWWA 3WDJA 3TTYA 4XBKA 5A95A 2FDMA 4NJGA 3EWCA 4Q7BA 3AIEA 2G3IA 3LMZA 3W28A 3K30A 2CITA 1DXEA 2PLCA 1N2VA 2Y4SA 4GZJA 3H2MA 1RQBA 1HXJA 4QS5A 1PKNA 1V0NA 1ECEA 1CGWA 3DC0A 2ZX8A 5E1QA 4A21A 1QPOA 2NUWA 3QBUA 3U7BA 4F4RA 5JUVA 3EMQA 2QYGA 4IMAA 4ALDA 2VX4A 3GTIA 3M7SA 2PDGA 3KRUA 1V08A 2D2OA 6ENLA 1K77A 2XG9A 3CL6A 3ZR4A 3E2QA 3CTLA 4H9TA 4L64A 1F76A 4BEQA 2AKMA 2GGJA 1DXIA 4CLMA 1TZZA 1UOKA 1FWJC 2ZUVA 3Q58A 1QW9A 1UASA 4J3TA 4RNHA 3VC6A 4OHQA 4HNCA 1Q8AA 4IIEA 4LVAA 5CGMA 4LPCA 2UWFA 3VD4A 1JR1A 3I3EA 2J66A 4O0QA 4AF0B 1ICSA 2NQJA 3OA5A 3B8WA 3M0HA 4RNJA 1GYMA 1W8SA 3AHYA 2RDTA 1F8MA 2GL5A 3OEXA 4CQDA 3KM8A 1QUMA 2DQWA 1Q6CA 2CWNA 3W2NA 1IXPA 1XRSA 2E25A 1W1A1 2Q01A 5CJNA 1FOBA 4AZ6A 1UD3A 4H9UA 4BQ3A 3HMJG 4ZENA 4AF0A 4MWAB 5AKQA 1WKEA 3IK4A 3B97A 2PE4A 2VHLA 4GOAA 1KM1A 1YIXA 4XIMA 3LCXA 1IZJA 4UTJA 4CVWA 3ZIZA 4F0KA 3CM4A 3RU8X 2ZOXA 1GT8A 2ISVA 3PBVA 5AFDA 3TJIA 1BWLA 2XZ9A 2HS6A 2WMIB 1FP9A 3MMWA 3U2EA 2HPMA 1K7FA 4GG9A 3SFWA 4U4MA 1XIGA 2HXUA 1WBHA 5EGRA 2WK2A 1ZJHA 4HOWA 4MWAA 4C6EA 2HJPA 1MZRA 1XHGA 3VIPA 2VOMA 1Q63A 3N18A 4QQUA 4H6EA 1LLZA 1V77A 3RU6A 1V3KA 1JRCA 3ARTA 3TWBA 2WMIA 4WJ8A 3A9BA 3MKKA 1HKJA 4GUFA 4ZA0A 3GWQA 3S2CA 3WLOA 1E43A 1PTDA 2PTWA 1TWZA 6A3HA 3AIVA 2VVNA 2E9MA 4PMNA 5DT7A 4B91A 1DBTA 2WVTA 3NSMA 3A21A 1IR1A 3P81A 3RX3A 3QQ0A 5A8GA 4G7FA 2R1PA 2Z2BA 3EB2A 2NVDA 4S3CA 2GUUA 2VUNA 1AQ0A 3IV3A 3WNNA 4S3DA 3FLUA 2PF0A 3BCFA 4GLEA 3STFA 3COTA 2PWHA 3WX7A 3W7GA 1I0DA 2B0MA 4GUJA 4ZO6A 5CPNA 4AHPA 3JZUA 2PDBA 3GU2A 4ECLA 1OC7A 1RPKA 2QIWA 1GVRA 5E09A 1HKMA 3NQ8A 3UPMA 1PZ1A 2C91A 2YCLA 4K6AA 1DWIM 5HINA 1EF2A 2ZWYA 4ERGA 2VFHA 3VIKA 3CYVA 4CNTA 1JDCA 1PYMA 3AROA 3LLDA 2WWCA 1DJHA 1IXOA 2ZQ0A 3MQTA 1PTAA 3YPIA 1N8IA 4AWSA 1JXKA 4Q7IA 3T55A 3F2BA 1LBLA 4NAFA 2I14A 3OVPA 3UU0A 1CGYA 7CGTA 4YCPA 3FJ6A 1JAEA 1A50A 1PS9A 1KGXA 1D2KA 4PMXA 3ZJKA 1MWOA 5DY2A 1RUSA 3U48A 3W26A 1EO7A 3PWIA 1S5TA 2ZZ7A 2DZBA 1XLGA 3MC5A 1AJZA 1KLZA 2GUYA 5F2IA 5A2AA 5E6YA 4IG2A 1HJSA 4LUSB 3S1VA 4WGHA 2XVPA 4M8UA 2DT3A 1VC4A 3WY1A 4JTQA 4UMBA 3VOCA 1YE6A 2I9EA 2NQ9A 3EYPA 4RZ5A 2VRJA 3BANA 2P3ZA 3TYUA 4AXKA 1KO0A 5MF5A 4HCDA 4R7WA 4WQ6A 1VPXA 1W32A 3I65A 3VNIA 4FALA 1KM4A 2DH3A 4IF2A 3STCA 2Z1WA 4N9CA 1YKWA 5T26A 4Q8TA 4A22A 1MW2A 1HFBA 1TWWA 4S2CA 3M0MA 1W9DM 3GG1A 2EJAA 3NXLA 1G5AA 4G5DA 1HVXA 2NT0A 3WL1A 5ABFB 4D72A 1HNYA 1AMKA 4JTJA 4EIVA 1L8PA 3E0LA 2CWXA 4MUPA 1CYGA 4DZAA 1UKPA 3O15A 4QTGA 1RP9A 2PTDA 3AUOA 2NQHA 5C9ZA 5IBXA 1TPB1 5G4HC 1KFLA 1NEYA 3S42A 1E51A 3BLDA 3W6LA 5ABFA 2DT2A 2PODA 4JKLA 1B54A 4NX0A 3H12A 4WSKA 3O6AA 4W85A 4D6DA 1W3JA 2X42A 3FXYA 1TREA 3VI2A 4GGHA 3PZGA 1K9TA 4JX6A 3SFKA 1G6CA 3OZOA 3VGFA 3L0GA 2I57A 4RNFA 3GDLA 4Q8UA 2W5FA 3UZ5A 2OYMA 4MMWA 1VEMA 4UQ9A 4WDXA 3HMCA 4S3FA 3WQWA 1VEPA 3VM5A 2NVAA 2A3BA 5LGXA 1DL3A 2QAPA 4DPQA 3WKZA 2WBGA 1P4CA 2FMOA 1DTUA 4B5WA 1EPVA 1JG9A 1H7RA 1M65A 4AZIA 2V5LA 2BSLA 4JQ2A 4AAJA 2WYSA 1LM1A 3SCOA 2J9YA 3NTYA 3MSGA 3QZAA 1ITXA 5LNRA 2QAFA 4JCMA 1SO3A 5I24A 3F03K 4N6FA 3DYPA 3RJYA 3NA8A 1XD1A 1ADOA 2BY3A 5C8BB 1LBMA 3UPBA 3H2OA 1JDFA 2C15A 2JGQA 1IEIA 1SYTA 3NQ7A 4GZIA 4L6DA 4GNKB 4ZR8A 3KDOA 4Q4PA 2QCHA 2QCFA 3H2NA 4IJRA 3EPOA 1M7PA 2WPGA 3KX6A 3NGJA 4I9TA 2CKSA 1K4GA 2X2GA 2ODOA 2TRSA 1K7EA 2XFYA 1W1PA 5EU9A 2ACUA 1Q2SA 4X0NA 2PRLA 1NTHA 3QMSA 4KFOA 3EDJA 1ESWA 1EBHA 2KX9A 1G4PA 3QKZA 3APTA 4RNIA 2O55A 1FWHC 5A6KA 3AIUA 4L6HA 2NT1A 1EIXA 3GDRA 3AC0A 1FDJA 3WF3A 2X41A 4GQ0A 3DECA 4XZNX 1C92A 5LNSA 2CCRA 6PTDA 3BSMA 5E9XA 4OECA 2DY3A 2VD9A 2EHHA 1CB7B 2F2HA 4PMDA 1TIWA 1LUCB 3ZR6A 4QE5A 2PDWA 3AI0A 5D2WA 3OIXA 3KWSA 4PTWA 4FOJA 3GO2A 4JIPA 4JFSA 1XBVA 1U1HA 3AXMA 3GXNA 1KCXA 2J77A 1YNQA 3KZPA 1BRLB 1AH0A 3GVVA 2VFDA 5CZTA 3SUTA 5KZMA 3WCZA 3VILA 3SY1A 3T1GA 1XV8A 3KBWA 1ZALA 3PM6A 2VZTA 1LUCA 1QPNA 4F0SA 1C3FA 1OF8A 4YTSA 3W85A 2X8RA 3GHTA 4UQEA 3TOYA 1E1CB 3G1HA 4N9BA 1SM9A 4LY8A 5B7ZA 1BRLA 1OCNA 4QS6A 5EFDA 1J5TA 1UUMA 1W0MA 3P6LA 1UKTA 1QO2A 3CZKA 4IICA 3SQSA 2C13A 1GHRA 2INEA 1GPFA 3R0KA 3UBPC 3URNA 4NY2A 4GH1A 1DP0A 4HU4A 5A6BD 1XSKA 4TTUA 2AGTA 3DFTA 5JXQA 1E1CA 3R5EA 4WY0F 4RV8A 1QAPA 4KCVA 3S1WA 1RZMA 2V0TA 3O1NA 1UUQA 3B0VC 4A8LA 1DTNA 4DJDA 4N42A 1XFCA 4Y9PA 1KR1A 3LRKA 2PC4A 1TPFA 3VIMA 5D2TA 1JULA 4AD1A 5ABHA 3OLIA 1XCXA 1CGVA 3VMOA 4P8WA 4LALA 1J2BA 2CLFA 1WX0A 2PI6A 1J01A 1D3CA 2QV5A 1OHLA 3LCGA 3PAOA 1QPQA 4TX9A 2HVOA 3OBKA 3QOMA 1RA5A 1LCOA 1XQKA 3P82A 4XTDA 1SFSA 3HTWA 2HWGA 2VR5A 3MTWA 5JQ9A 4LXFA 4L1WA 3F4DA 3CWOX 1R5YA 3TZFA 1SFLA 2XSAA 3WG6A 5DMLA 4Q22A 3GG7A 4YWSA 1UMYA 4ZQOA 3MCMA 4AUBA 1I60A 2Z4GA 3EEGA 2A7NA 1B4EA 1UW9A 4PMJA 1OFBA 4LBSA 5A3HA 3VIFA 4YXGA 3D3FA 1XR2A 4CD8A 1H11A 2OEKA 4R9XA 1J79A 4S3AA 3M0JA 2PDIA 4ICMA 3WLJA 3CHVA 1OFQA 4PCSA 5A8PA 3WLTA 4JFWA 1Q13A 1A5NC 2E1WA 2PU1A 1KQZA 1PL9A 4O15A 2X0SA 4JN7A 1ZUAX 2EPNA 2Y5EA 4LEQA 3T2OA 5AHLA 4KRUA 4YTQA 3ZWSA 2FLIA 5BU6A 1K1DA 5DQPA 3ID7A 1MW3A 1UCWA 2CPUA 5B7YA 3PS7A 1A5AA 2JEQA 1UH3A 1VLWA 3OZPA 3HQPA 3K13A 1UQZA 3RK8A 5FIPA 4FLOA 4C6LA 2AMXA 4XZHA 2QKFA 3WH5A 3LCFA 1SSGA 2AMGA 3KRBA 1ZB5A 3QLDA 3RCYA 1G4EA 5HR7A 4A2SA 1W9PA 3JZEA 4ML9A 3BGGA 4MGGA 3EA3A 3GSMA 3IGSA 3QOKA 5A2CA 4PUMA 3ZS4A 4K37A 2CLHA 1A3XA 1OADA 4KMQA 3TYDA 1R3YA 2QMKA 1HTIA 4NP7A 3WQCA 3GNXA 4ZQPA 2DIEA 2JGYA 3HG5A 4D6GA 2VR4A 3ARYA 2FFCA 5TBOA 3NQMA 1ONEA 4S38A 1KGWA 3H70A 4XSLA 2Y7EA 3P3BA 1LQ0A 2YYUA 1CXLA 3A4AA 3QFEA 1N7KA 4IFOA 4EK7A 1CWYA 1V51A 3H4WA 4PTMA 3WJXA 5HXMA 1AW2A 1EGVA 1Y5VA 5I2UA 4LYRA 4B3LA 3R4IA 3KWXA 4NT0A 3H24A 1XUUA 2QCLA 5LIXX 4AX7A 1ZFJA 3S5ZA 4WLCA 4US5A 1A80A 3NDZA 1R3SA 3UJSA 3DXIA 3DI0A 5LNWA 4IUOA 1EZ2A 2GQ3A 2V30A 5H1WA 4GACA 4UOQA 4IUGA 2OMAA 3WQ5A 3HURA 3SCTA 3BH4A 3KL5A 4CD5A 1P0EA 4U2ZA 1YDNA 5F1VA 1JGMA 1E9ZB 3HPAA 3CU2A 2CLMA 1FQ0A 3UESA 3M6DA 3VIJA 5G2IA 3RCNA 4IX0A 3KLKA 5BXRA 1XYLA 8XIAA 1KCKA 3TQ0A 4ZXLA 2WM1A 4FS9A 2YZRA 2JK2A 4PUWA 2OCZA 4ZO7A 1SJCA 1HJXA 2ISFA 1G1YA 4WJEA 2OKTA 1SSDA 1HKVA 5AC7A 4RXFA 5AYBA 1HUVA 1GG1A 4IQLA 3M0XA 4C6OA 3RYSA 3LHWA 5U4NA 2WVSA 4HYVA 1YPIA 3VX1A 3S1UA 2P3EA 3DFPA 5G2WA 1NH6A 1ZP3A 2BS9A 2EG7A 3MMTA 1DJXA 3N2TA 5HBFA 3B9OA 2YXOA 2GSEA 2WANA 2Y7FA 4O17A 3W2UA 1OYAA 3WNMA 4B9YA 4K38A 5CSSA 4NZ1A 2E28A 1YNPA 4LS2A 4IWWA 2Z24A 2CLLA 4BZYA 2XVKA 2C6QA 3OJGA 2W0UA 3RLHA 5LGZA 2OLHA 5CKSA 2W6RA 4F40A 5D32A 3E02A 1V3LA 1IHIA 1Z8AA 4B16A 2OEMA 4M29A 3GHSA 4J3SA 1ONXA 2IQ0A 4X3ZA 4I9AA 1JQVA 3LXAA 1XL9A 2IPJA 3NCOA 4YPJA 2P76A 4KWWA 3B0YA 3SI9A 1PEZA 3GXPA 2A5HA 2D24A 4L4MA 2ZRXA 3TTOA 2C79A 2QZRA 2OYLA 1LLOA 2Q3RA 3S9IA 2VC5A 3TH6A 1AUSL 3SCWA 2ATMA 4L80A 5D37A 4M82A 3W82A 1V6WA 5G2HA 4G1NA 2NV9A 4HHHA 4OBTA 1KFCA 1WDWA 2A7PA 2GQAA 1D3GA 1T41A 1H5YA 1I4NA 3RMJA 5G1YA 1XBXA 3OLGA 3P0WA 2R1KA 3HM7A 1X8FA 1E6QM 5CSRA 3TU9A 1OX6A 3P61A 4KW2A 5AHFA 3W1QA 4QDPA 3QV9A 1HKIA 3H7UA 4QITA 3B8UA 4MJMA 5I09A 2Q8ZA 1V6YA 1OB0A 2OELA 2NV1A 3B04A 3EOLA 2VFGA 3UYCA 4WUIA 4H2HA 3QF0A 4ZB5A 1UR2A 1S1RA 4Y7EA 2WMFA 3LGEA 4MNJA 3VGHA 4A3RA 3GDMA 5HQEA 4S39A 1VYPX 3FKRA 3HG3A 2J27A 1KR0A 3UT0A 4B5TA 2E5CA 1HL8A 4UTHA 4JTAA 4QGCA 3TCEA 4UOZA 2ZUSA 4IJCA 3USBA 3SURA 3UD6A 2OX1A 1ODUA 5A6TC 2YA2A 3LI1A 2R9RA 1EH9A 5HUOA 1M53A 3KHDA 2XIIA 2DZAA 4M1BA 2QUUA 3BTNA 4H9MA 4DWSC 3S0CA 3K5XA 1KM6A 5CGTA 1ZTVA 3IACA 3TK7A 2GVJA 1CXFA 3LS9A 2BXYA 3CUZA 3GHRA 1OT2A 4J28A 2CZEA 1TG7A 1XS2A 1QNQA 3RM9A 2CNCA 5C2GA 4HNLA 1QDSA 5E93A 4IIFA 4DUOA 1V02A 4GY0A 1EPXA 4JFTA 3O9NA 2HISA 3AIRA 2XUCA 1ICQA 2GPTA 4IX2A 1VEOA 3NFUA 1US0A 3CL7A 2QDGA 4URIA 3SGGA 1PBGA 4HPXA 1DXFA 2D23A 1AQFA 1R46A 1FWEC 5AYIA 3APYA 3TYAA 3WDPP 1BF6A 1DQXA 2D1ZA 3FYPA 3WQ8A 2VCCA 1P6CA 1Q66A 2XM1A 4LJ3A 1SZNA 4DPPA 3UGRA 1J12A 3VINA 5DCBA 3KTCA 2YB1A 4P7OA 1FWTA 3NDYA 1LYXA 1DJQA 3NQAA 2EQDA 1FHDA 3CZLA 3D3AA 4DAFA 4AZGA 2O4MA 4GINA 3THCA 2WZHA 3EWUA 3EX6A 4Y8EA 5FJTA 1XQLA 3ONBA 3WLLA 3LY0A 1V0MA 2C18A 1JI2A 3TNBA 2QJGA 1BXNA 2O4QA 4G9PA 4UNKA 3TYBA 5EMKA 3OP2A 2OSXA 1YDVA 3CUFA 3CQKA 3N2BA 5M2FX 1E9YB 3EWXA 1AD4A 3M0KA 5I5RA 4NKCA 3A22A 3VIIA 2Q8XA 2TPSA 2DFAA 4Y96A 4ICCX 4WSJA 1XG4A 4R34A 4F9JA 4ZQCA 4XZWA 3H22A 5CGQA 3DX5A 3C3UA 4ENLA 2QVNA 3LLFA 7XIMA 3PTKA 3CQHA 3FJNA 3SIZA 2BHUA 2W27A 1D7FA 1ZGDA 1LJYA 3R43A 4PMQA 1OG6A 3AU2A 3CLWA 4GPNA 2GSHA 2DT0A 4ZFMA 4O13A 1O1HA 3BLLA 3IJDA 4C7GA 4LEFA 4WHBA 3I6RA 1RLDA 2V5BA 1KCZA 1IF2A 2E5BA 4W8LA 5CC3A 3ITTA 4IXHA 5KITA 2ZADA 3KEHA 5BW6A 1IEVA 2KAUC 2J6VA 4M1RA 3W7MA 9RUBA 2CERA 2I16A 2ZA3A 1PWMA 4PL1A 2D0GA 4FAMA 2HQAA 3W73A 4KIEA 3UW6A 5BNKA 4DY1A 3N2MA 4KGLA 4CU7A 3K46A 5E5CA 1DE6A 4EPEC 5J04A 1FCBA 3LHTA 3UPWA 3C5QA 3G8RA 2VZUA 3M4HA 1CLKA 3THUA 3ARUA 4GYPC 4EPKA 2O9OA 4GH3A 2NZLA 3DU0A 3QN3A 4O1DA 5LIKX 4FEZA 4O4VA 4W7WA 1WKFA 1ZL1A 2XWDA 1JD9A 4DJFD 3N4AA 1UBSA 1EKOA 4NJJA 5EMMA 1S46A 2OZ8A 2YKKA 3EX1A 2ZUWA 4ZSTA 2J8GA 3GXMA 3KBVA 3P93A 1YNYA 4P7QA 2QR6A 2A79A 3TQVA 1LLWA 2XHYA 4PULA 4JEQA 3GW0A 5LHEA 3PAJA 1EWEA 4H00A 4IJBA 3IWPA 3L12A 3H53A 4MG4A 4UR9A 1J0ZA 4CN6A 4V15A 1WKDA 4DZIA 1F6PA 2F38A 2WJZA 3PFRA 3N2CA 5HNNA 1UYQA 3V1PA 5K9CA 2NX3A 5BRQA 2EJ1A 7TAAA 4MPQA 2YL5A 1Q6LA 3XINA 4LS1A 1OQFA 3UY7A 4LVFA 3H4XA 3I6TA 1XRTA 2G41A 4U5IA 3SRHA 3ARVA 4UBPC 1HP5A 2A3LA 1EEPA 4AIBA 3GYCA 1WZLA 4NYYA 4HZMA 4C60A 3DC8A 1TELA 4AW7A 1GHSA 4H04A 1H7WA 1M7XA 3UJRA 4MFEA 4LVGA 1PUDA 4MLJA 4XO6A 3GG0A 4EXQA 2RFGA 4LB4A 3OVQA 3B8DA 2WHKA 1WA3A 2W66A 3G1FA 2JKEA 1J9YA 4FSAA 2DZWA 4AZBA 2E6FA 4O14A 5D9PA 4V33A 4AY7A 2L5HA 4K68A 4WCJA 4QQ3A 5C9WA 4DQWA 3PWAA 2WM0A 1E0XA 1SZEA 1YXDA 5H8MA 3HPZA 4C6MA 2INZA 1L9WA 1J5SA 1WB0A 1NF0A 2R1NA 1LRTA 3H7RA 4IPIA 3TA9A 4WGXA 4IP5A 4C6DA 2CC0A 2I5QA 4GQQA 5AECA 2GSJA 2CXEA 2WZMA 2Z7GA 1WO2A 3LB0A 4B5UA 1BVWA 1PIIA 1MDLA 2ZRZA 3CS2A 4GISA 1RQEA 3W2KA 1U5HA 1MW0A 5K2ZA 3A3HA 4MTVA 1TPDA 4AYGA 3IAQA 2ZRYA 3TKFA 2WKGA 2QF7A 2X40A 1LG2A 3TTEA 1JYNA 1TV4A 3E6EA 4H1ZA 1PTGA 5E70A 3AFBA 5LA2A 3UG8A 4RE4A 4FNSA 3BDKA 3G1SA 5AZ1A 2NSXA 5F2LA 3W72A 4ICNA 1GVEA 2DUXA 2AL2B 2V9DA 1VIWA 3B8TA 1A4LA 4GJJA 4HOZA 2Z2AA 2P0OA 3BG3A 3BV7A 2WVUA 2ACSA 3FYOA 1W3HA 3PUOA 2PDHA 4J2MA 1EJUC 4J35A 1ZRQA 3BCDA 4E8CA 2OU4A 5DRIA 2MNRA 1A5OC 3UXAA 2E67A 4H6QA 3BZJA 3GU9A 3W7LA 2AL2A 2G3MA 3VAVA 2VDHA 1AL8A 4LT9A 4LUIA 3WEMA 1GNXA 3BQ6A 5FSEC 2ZKMX 3NQVA 1LOSA 1I75A 3QM3A 4N7QA 3A4WA 4R5EA 3RF9A 3GNNA 4NVTA 5AZ0A 4UZSA 2Z29A 3F4CA 3URQA 1PE1A 1UP2A 4LF1A 3BOFA 2V5CA 2ZYFA 4NUWA 1G7VA 3ZMRA 4PUUA 4K3ZA 4LCQA 1M6JA 3V4BA 4L56A 4YIWA 2GZXA 2Z1SA 4LX4A 1F3WA 4NZ3A 1JL8A 1UROA 4HNUA 4UR7A 5DMNA 1BSIA 3GRIA 2P10A 2R1MA 4WKHA 4HKPA 1R9ZA 3ARSA 2DEPA 3I7RA 4NNCA 4FIRA 5ABEA 5E0KA 3FDKA 3WLRA 2PP1A 5EFFA 3ITYA 2H8ZA 3TE9A 4YYCA 5KZ6A 2WSQA 2E8YA 3N34A 8CGTA 2IKGA 3PB0A 5EMJA 5H6HA 4QXIA 4FB7A 8RUCA 1DWGM 3AS3A 1XINA 4JICA 1ZBVA 4C90A 1QW8A 3LV6A 1P1MA 3DERA 3V0TA 5JH1A 1J96A 3L2MA 3TC3A 4QISA 3LSCA 1JCTA 3S47A 4HSHA 5FEZA 5CPSA 2OX4A 3FYYA 3N11A 3ITVA 1ME8A 1UR0A 4GHRA 4WIWA 3UA4A 4Q4RA 3VK5A 2DVUA 4AVFA 6CGTA 3IJ7A 4GIRA 4N4PA 1B90A 3OU8A 1RD5A 2E40A 3NG3A 1VP5A 3MYPA 1Q6FA 1TTIA 4NAEB 2CW6A 4EPBC 4NIRA 3T78A 1U1UA 3B05A 1TWIA 1S2WA 2XYLA 3GYEA 2JBMA 3WUEA 3ZT7A 2WZTA 4NZ5A 5CPOA 3FY1A 3SW6A 4RDWA 4WDUA 4GUGA 2DJXA 5AHEA 3DBPA 2Y85A 2J47A 1TB3A 4F0MA 1S2CA 1W1ZA 3IUHA 1Z7AA 4AD2A 3GW3A 4NAEA 1XIEA 4KWUA 4JTKA 1QK0A 3CT7A 4IPNB 2W3ZA 3DYOA 2H6RA 3BPWA 2V2HA 4OIFA 1X7FA 1VBGA 3V18A 3LA4A 1PHWA 5HMDA 2QXWA 4AVNA 2UY5A 4QCEA 3A5VA 4GX9A 4X60A 3O07A 1YQ2A 2FQIA 3DOPA 3P5YA 4MYAA 4AX6A 1U30A 2WHLA 4GCAA 1B0IA 3VNKA 3TNOA 1A5LC 1DIDA 3AXXA 2X05A 3L2IA 1K03A 1H50A 1OFRA 3VIGA 3GB6A 1QI2A 4IMFA 3CIVA 5D33A 3W7CA 2XFFA 1VRDA 3KVLA 4RV3A 1ZNNA 1HP4A 5G4EA 1OM0A 4QX4A 3RO8A 4MADA 4L4LA 2PBOA 1KV8A 3T8QA 3D6NA 1H5VA 1XJBA 1UWIA 3OHMB 2GGEA 4TVUA 1SZGA 3H2FA 1MQRA 5TIMA 2V8ZA 3W1MA 4ZZ9A 3BVJA 1L6GA 1OFAA 2DQXA 3W7RA 4Q8OA 4P5UA 4B5VA 2P1FA 4FLSA 4J4KA 3NSXA 1QW7A 1KLYA 2BGQA 2GVYA 2WC4A 4RE0A 5XINA 1OFEA 2ZX7A 2JKAA 1P0NA 1OINA 3NEVA 1QNOA 3AOFA 3KOXA 1V0KA 3W1TA 1VFMA 2BWGA 3K2GA 1S5WA 2Z00A 5C7VA 4US6A 3FEQA 1GG0A 3QV7A 3G1VA 4P7NA 1W3KA 4C6BA 1E15A 3ZZ1A 3RUBL 1X1OA 2GOKA 1OWQA 5AOUA 3PUEA 3W6MA 1AJ2A 1PKMA 1AZ2A 3TSBA 2PRHA 3GFZA 3D5HA 5LZLA 3OGSA 2AQWA 1ZBKA 4GIYA 3MBDA 1XH0A 4BKNA 3WF1A 2BVTA 3RXZA 1QCWA 3EPMA 3AQUA 3BE7A 2QUNA 2GVEA 2HEJA 3MMUA 4ZSUA 1HJQA 1L0PA 1W5QA 2ZUMA 4WOZA 1XLKA 4N9EA 3VGGA 1H3GA 3TW6A 4QNEA 1E71M 2GYIA 2WHJA 4RZ6A 5A8NA 1JXJA 1T0OA 4GRSA 2J75A 1YLVA 1KW1A 1CCWB 5DBTA 3WMCA 1LOLA 4CCZA 4NZ4A 3M9YA 4AZ7A 1JEZA 1L6WA 5HK4A 5GQBA 3WD3A 3W7EA 2WMKA 1PIFA 4GFIA 2VMFA 1P6WA 4CCDA 4REQB 4NI3A 1O66A 1O5KA 3E2SA 4TV5A 3VKCA 3E1F1 4PCNA 4IQJA 4CQ9A 3MUXA 4H9YA 4L65A 1TWSA 3ZT5A 5KETA 1TPC1 3LN3A 3TN6A 3O05A 1TV3A 2RAGA 4MZYA 4HK5A 3H21A 4E3VA 1H49A 3EB3A 1EUNA 1PYFA 1S39A 4HNOA 4REQA 5LSMA 1VF8A 1H1NA 1IGWA 3KW3A 5CQ1A 4BF9A 5CC7A 4U31A 4UC5A 2YPIA 4QE1A 1VCFA 1Q4WA 2NX9A 3LYEA 1UWQA 4NJKA 3ATYA 4Y90A 2F6UA 4AIUA 4X22A 3GXFA 1POJA 3LENA 3TLQA 1KXQA 4QSHA 2IPWA 3B0UX 3Q2DA 2TAAA 4M6UA 3CV1A 3L4XA 1KQYA 4ZEPA 1CGUA 2FB3A 3DFOA 2TMDA 4WJXA 3DESA 4CU6A 1ZAJA 2VDIA 4UTFA 3G1RA 4GNJA 4IGSA 3WD4A 4WF7A 1V03A 3LRMA 1LTDA 4FXRA 4QLJA 4ES4A 3MYOA 4QE4A 5HPOA 3BAJA 4RJEA 4OE7A 3CZGA 4XD5A 1OD8A 2WC7A 4NG3A 1ZJAA 1RQHA 1HJUA 4PH6A 1KBLA 5FJUA 1LOQA 1TA3B 4GC3A 4QEHA 3OG2A 2G0WA 2A6NA 3ANUA 1B4KA 4J7RA 3HGJA 4O1CA 4XKMA 3THDA 4I90A 4OGZA 1XLIA 5FAGA 1T8XA 1KV5A 4GI4A 1VYRA 2OQLA 3M5ZA 3I6EA 4S1FA 3EXSA 3SGUA 2PDYA 1ISVA 4JFVA 4L61A 3BJSA 4G1KA 1PX3A 1UH2A 4YVXA 1Q6EA 3ELFA 3GD6A 3R8HA 3FFSA 3VXGA 1N8WA 2WV8A 2XN2A 1OK6A 3NJ3A 3KZSA 3RDKA 3WO8A 1KBIA 1M1BA 3N4EA 9XIMA 3OYXA 3P67A 4PEKA 1M41A 1OVDA 5DANA 4AHQA 1KRAC 4N9DA 5AHNA 4HZ6A 1H1ZA 2PSNA 1OZMA 1OFOA 3SECA 1U1JA 2I7GA 1B31A 1IWPA 2P8BA 4HSNA 5CLWA 3C4UA 3ARRA 4C7FA 1W56A 2XIJA 4DJED 3ABQA 4LBUA 3HU7A 3LERA 1FWNA 4BWLA 1DQWA 3CQ0A 3IV8A 3QZEA 4NZFA 3QSRA 5JVLA 4HU8A 4XAYA 3RX2A 2XH4A 4XUGA 3BSGA 3ZSTA 1BAGA 1I2PA 1H0IA 4P61A 5A8MA 1SVDA 3CIXA 4XQ6A 4YCOA 3QR1A 1BGGA 3L68A 5D02A 3WD0A 4WXYA 4ADTA 4RZ4A 1CLXA 1HKWA 3SO7A 5DMMA 3U5YA 4FIQA 4O52A 4LOCA 1CBGA 2ZXDA 4AVOA 3DKLA 2J9XA 2MANA 1G69A 3LUTA 3GC2A 4EE9A 4Q8VA 1QO5A 5A6LA 1TIMA 3QKEA 4M81A 4ATWA 2O9TA 2NX1A 2VM8A 3T42A 4AD3A 1JZ8A 4M80A 1BLIA 2YA0A 3UYIA 3KS6A 1QTWA 4DM2A 3RILA 3QW4B 3A3XA 4S3JA 1M3UA 1V3HA 1KTNA 4J40A 4B15A 4LVBA 1SU5A 4CUCA 3G8EA 4YLWA 3MZ2A 2F2KA 5BROA 5M17A 1ZBWA 3UZZA 3GH7A 3E49A 2WC3A 1FH9A 4ZOAA 2CLEA 4JX4A 2G3NA 4QJ1A 3UEQA 3C2OA 4NNAA 2E1DA 2I56A 3MV01 5D03A 2ON3A 3E5BA 2D0FA 3WMLA 1FTXA 3UWWA 3VNMA 4QNWA 4CN4A 3EX4A 1EGZA 3W7JA 1X98A 2PWGA 4H4IA 1XLLA 4XD6A 4Q8NA 1R47A 1T7LA 3HGOA 2F7FA 2JF7A 2X0YA 3B8VA 1C91A 4ROQA 1N55A 3W02A 3ITLA 2DP3A 3AXHA 1I45A 4NU7A 5HDRA 3S9ZA 4IGHA 1FCVA 2QCEA 4LFYA 2XFWA 4A8NA 1E6XM 4GKLA 4XVDA 3V3WA 5KZDA 3W6YA 3QVQA 3AMDA 1KM2A 1V3JA 4RE3A 3HA1A 4EAMA 4LYQA 5PTDA 1BWVA 3N1AA 5DMYA 4MAVA 4XX6A 3VZXA 4O50A 4JN6A 3PBUA 1S3TC 4CEUC 5I78A 1ISWA 1EA0A 4QLLA 4PTVA 3EDFA 4EP8C 4MY8A 1PCKA 3NR0A 5AVNA 4P8XA 4UB9A 1E0VA 2WMJA 4S2BA 2BB0A 3WF4A 3R8RA 5K9DA 1OYCA 3B8SA 4AEEA 1W8GA 4F2BA 1E4IA 1QNPA 3VDHA 1AA1B 3W1LA 1VYSX 1H62A 2PDKA 2PTYA 3KHJA 3TUUA 3UVIA 4CD6A 1JUKA 3KCJA 4FNPA 4I3GA 2BV9A 5TNVA 3MVIA 1WXJA 4NXSA 2FB2A 2PB1A 1B3ZA 3WFLA 5D9MA 5FF2A 4ZQNA 1SGJA 2DORA 4XWUA 2DZUA 4UFJA 1YTEA 2PF8A 3GKFA 2OLAA 3MHFA 4W5ZA 3M44A 1EF3A 1JPHA 5AC6A 4AXNA 1WOBA 2O7QA 4Z1DA 3NM3A 3VA8A 2HBXA 2RH9A 1JUBA 1HQTA 4AH7A 3LCLA 4JPGA 1A5BA 2PDUA 3GFYA 1FRBA 1Q6DA 3K4AA 4CGTA 3B9NA 3CMFA 1TJ0A 3WK3A 4I9JA 5IDZA 1S2UA 4YU1A 4L9XA 5FEXA 1E3XA 1KTBA 5M5DA 2V38A 2D22A 4CN1A 1XYMA 3ZJ7A 1R6WA 3V75A 3DYMA 4WOQA 1WXYA 2CLKA 4LU0A 4H6RA 1MW1A 1OC6A 1W9VA 4NYUA 4M51A 3VFLA 4E4FA 3W1AA 3RMEA 2VFEA 3ZM8A 1TV7A 1TX2A 4M6VA 3TMLA 4N4QA 2J88A 4HNVA 1OBAA 4I5UA 1GOMA 3V0SA 7TIMA 2XVLA 1C93A 3REQB 2RDWA 2YXXA 1V6TA 8TIMA 1HX0A 1CXEA 4XAPA 2CZFA 4HMDA 1XDMA 4I8YA 3ZVHB 2DIKA 1LROA 4DXKA 2FFIA 1YPXA 3EEZA 3OZMA 1VFUA 4E3TA 1SMAA 3HJZA 4AWUA 4E2VA 4E0CA 5FSDC 3C0JA 4GGBA 4C7DA 1QOPA 2DUZA 3REQA 2C71A 4QSFA 1KWKA 1SO6A 4RW3A 1V4YA 3PY2A 3IIOA 3CASA 4DZHA 5CG0A 5K7JA 2Q02A 3UQNA 5D4YA 1EJSC 3ZVHA 2QCGA 3D0CA 1TMHA 3HV8A 3T2QA 4D8AA 1YEYA 3P7YA 1UD6A 2QJIA 3CK5A 3TLLA 3UP8A 5G1MA 3NWRA 1ONRA 3AHVA 4Z2JA 2P0IA 1YDOA 1NWTA 3TJXA 3GXIA 4NILA 3UWZA 5IRPA 5EKYA 1DWFM 4AZ5A 1W17A 2WMHA 3ABSA 3W70A 6REQB 3FA4A 4CU8A 3P80A 3VKAA 3QYQA 1JZ5A 2FTWA 1I1XA 3AJ7A 4ZE4A 3KCOA 3S5SA 1JPIA 3VDGA 1CDGA 4LQ1A 4AEOA 2OJPA 4UNIA 3AIWA 1UR8A 3R8GA 3UERA 3MMDA 1B3OA 4IP7A 4UWMA 1NWRA 4PR4A 1TQXA 1E6ZA 2VC7A 1RD6A 1JCMP 4JXCA 3L21A 4XK2A 1H4PA 1B30A 4LV9A 1Q7QA 5B80A 4X61A 3CV7A 4NRRA 1G4TA 2G50A 2IQTA 1XFBA 1GOQA 3T7VA 3UR8A 3OBEA 4UTWA 1FA2A 1TE1A 1BYCA 4W88A 2VRQA 2OG9A 2WW5A 3W38A 1RCQA 3GM8A 2VGFA 5D38A 5BXTA 1FX6A 4M24A 3U4AA 2GQ9A 3N4FA 4JYDA 5H8UA 3RAOA 2WZIA 1IIHA 4DXVA 3VNJA 4PRRA 4N0RA 3RIKA 4D71A 5DLCA 4X2RA 1SFTA 2WO5A 4CQAA 2FZDA 4O16A 4OVXA 2ABAA 2XVNA 3RM8A 5AYXA 2ZRVA 1F07A 3D47A 1AMYA 2OLSA 4FR6A 3SY5A 3FVMA 5JIWA 3SJNA 3WK0A 4ACYA 1KWGA 3IIZA 3AIQA 1JPDX 3SCQA 3UXIA 4FXSA 1BTCA 1BWKA 2OEJA 1WDPA 2EG8A 3SDOA 3CQIA 4HQVA 2AOSA 2G8ZA 1Z9AA 4IGNA 2P88A 3WH7A 3L4VA 3IVTA 4RXGA 5HQLA 1EHNA 4MDPA 1V79A 1KFEA 3FOKA 2WCGA 1J8VA 1Q6RA 2INFA 4YVVA 4J3VA 4FK9A 2VT0A 3CV2A 3MSYA 2FH6A 1F74A 3FEMA 1GOWA 1WUFA 1EDGA 1YADA 1B57A 4E8GA 4AZCB 4PMZA 1UZ1A 1MSSA 4HGXA 4PRWA 4JQAA 1DJIA 3OG3A 2HS8A 3UWUA 3EMZA 4W9TA 1EJWC 4PBEA 3NZ1A 2WKLA 1XIIA 4NL1A 3HBLA 2GUBA 2WBKA 1KBBA 5DRCA 2PP0A 2XN1A 4YHGA 3UR2A 4BS0A 5LXEA 1X96A 3CUIA 4HA1A 3S6DA 4GY1A 4H9ZA 3NQFA 5LIUX 4LNCA 4OUIA 3A64A 3NNTA 2FZ8A 4AZCA 3G5EA 3AIBA 4GABA 5LXXA 4EF8A 2ZRWA 3OGRA 1ZAIA 3KOWA 2C0AA 3ZR5A 3BLPX 3LZ5A 4FF5A 3TA6A 1PHQA 3T0AA 3T6CA 3TP4A 4UFIA 2QLYA 3MWCA 1OCQA 2CEQA 3K8KA 4GVFA 3GAYA 1CGXA 2Z27A 2Z1BA 4NJIA 2VEKA 3WQVA 3KXQA 3RO6A 5D2YA 2R91A 2JEPA 3QJAA 3WH9A 4BQ5A 3MSRA 3GDBA 4L4PA 1TRIA 4K8EA 3KBSA 3W7PA 5J8LA 1M01A 3QQ1A 4YWIA 3ARZA 1GQLA 4MZ8A 3U5UA 4YN5A 4GO9A 3WK1A 2PGWA 3R0DA 4PN2A 4Y2WA 3BW4A 1ALDA 3PBGA 3ABRA 3K1GA 2BODX 3WQ4A 7A3HA 5BMWA 1Y5XA 4XG1A 1JUEA 5AC8A 4EPDC 1TFVA 2YX0A 3EOEA 3IRDA 4MIMA 1MMFA 2CBVA 4IGMA 4K8HA 2XIBA 4TVCA 3MO4A 4BA0A 3C2YA 2O92A 1PX4A 1O6IA 2WWDA 4RPQA 5M1TA 1GOXA 3S2LA 1A5KC 1JQXA 2ZE3A 2ZDSA 3BQ5A 1M7OA 1PVNA 3SAZA 5AHIA 5GNZA 2E9BA 5C6MA 1K8CA 4GQGA 4YNGA 4L9ZA 4ZB2A 4JNMA 1R2SA 4GIAA 4IIHA 3OOQA 4C1KA 1GTHA 4KEZA 3O63A 4LAKA 3G18A 3W22A 3T4CA 4B5SA 1TYGA 3KBNA 3W9ZA 5D9NA 1XISA 1UJQA 4PFHA 1VB9A 4RPPA 2Z7KA 4TTGA 1R86A 4IOTA 3L0KA 2NQ5A 4PE8A 1RA0A 1VHCA 3O0KA 3MA8A 3OLDA 3W4RA 6ALDA 1OF6A 2BTMA 4LAUA 4E2OA 2BNJA 2BFGA 5BYWA 1O94A 3V1HA 3F4NA 4JNYA 3GK0A 3URBA 4HYRA 1EA9C 3KFTA 3UWQA 1JDDA 3CUHA 3W2MA 3C3NA 1KKOA 2WVVB 1CW2A 2PTZA 2PUZA 3KE0A 3VOFA 1P0KA 3S5NA 4O1FA 4QEEA 3FA5A 4H2CA 4O12A 4QRNA 1N8FA 2HNEA 1W37A 3HQOA 3NDOA 4WKFA 2YW3A 4DBSA 2WAGA 1RBOB 1L6YA 1QHZA 1AK5A 3S6TA 3W7HA 1MUMA 4U10A 4DUWA 1F4AA 1TJRA 1V6XA 5E0FA 3W01A 1XP3A 3VOJA 2PDQA 2ALRA 2VZSA 3FHAA 2WVVA 1JZ6A 4B2DD 4JBRA 4JIIX 5I77A 2Y8VA 7REQB 5BOOA 2V68A 1I6NA 4OKDA 4TX6A 3W7KA 4BY3A 2RUSA 3APGA 1F05A 3UETA 4NZJA 3S4TA 3HGRA 4KKXA 3LPGA 3WUGA 4I7VA 5CJ5A 8XIMA 2B7OA 3SCUA 1BKHA 4DO7A 1F3TA 4KT2A 2UZ9A 4MKSA 1X6UA 3CL8A 2OGJA 1FDZA 3DHUA 1BYAA 3WZ0E 3WBWA 1XBYA 1FCQA 3SBFA 3BLKA 2VC6A 2WB5A 3HB9A 4EACA 7REQA 1QI4A 4GD0A 2A3CA 3QY6A 4ZL1A 1V3IA 5KSWA 1F8IA 3S5YA 4PUDA 5I23A 3N3MA 4LTSA 4JIQA 2JIWA 4L1GA 2OOFA 3PPHA 1JIBA 4RDYA 1FWBC 4F2UA 4O54A 1NQKA 4OBSA 3P8JA 3ZLFA 2W91A 3DKJA 3U3HA 1JCXA 3CWNA 1OYBA 1KRCC 4PC8A 4OV4A 5K4ZA 4MAZA 2FVLA 3EWYA 1XG3A 3UJFA 3NVTA 3MDUA 1FY6A 2BX7A 1NAL1 5MHBA 2QDDA 1MXGA 2Q09A 3VNDA 4DI9A 2Y24A 1HVQA 4LUYA 1LWIA 4LAMA 1OIFA 4TVDA 4MB5A 2HVNA 1WZKA 3S2MA 3W7NA 1WYIA 2XTKA 3RHGA 1VENA 4GX8A 1VCGA 3TFXA 4PUNA 5I0DA 1RR2A 4F2TA 3GTNA 3JUGA 2VYOA 4HNNA 5REQB 4JY9A 1ZLPA 1DE5A 3W7IA 2XISA 1CI1A 4MZ1A 3TJLA 5AN7A 1Q7ZA 3PBMA 1DV7A 3LNPA 3VKDA 2FPTA 2WZEA 4GXPA 1GPWA 1TPH1 4CNPA 5C9XA 1H60A 2CIPA 2ABBA 2FPVA 3WN6A 3RPDA 4C5YA 1TE6A 1TV2A 3NZPA 3W2JA 3LZ3A 3NQGA 3P62A 2FIQA 4DO5A 3VCRA 2QCDB 3GDKA 1S3HA 3MCOA 2PMQA 1THFD 3LBCA 4PUJA 1FWFC 2HROA 2PDNA 1ZZMA 2R82A 2WSKA 5F2MA 3BAXA 4UTTA 1WDSA 4LUSA 3LG3A 3UWYA 1NU5A 2F6KA 4PTDA 2EXOA 5CCZA 4PRTA 3PULA 3CXOA 1GJUA 4FR1A 4M6QA 2VXNA 3BW2A 5ECUA 1BTMA 4U5KA 2JKPA 3WIJA 2BOGX 3LV5A 1FXPA 2HE8A 3MKCA 1R3QA 2JF6A 1TWDA 1C29A 3OVRA 3L4YA 3P0XA 3N17A 3PZIA 3OB8A 4P7RA 3GKAA 3CUJA 1HKKA 1SW7A 1K8XA 5EMUA 5BRPA 3W53A 2EKGA 3FCPA 4LY4A 3O8AA 5FF0A 3MY9A 3NZQA 1W3TA 4KEUA 3W25A 1XGEA 5I3KA 1EC8A 3E0WA 3WNOA 1OX5A 3M16A 3LLXA 4DJFC 2R14A 2NUYA 4Z0SA 4HZ7A 3GIYA 5ABTA 4R27A 1EJXC 1XSJA 1J4EA 2HPIA 4M7SA 1GGOA 3H6OA 2GOUA 3XIMA 1E5JA 3CZEA 1UH4A 2OQHA 2OZ3A 2VKZG 1W2VA 2HK1A 4F48A 4A3QA 1IIGA 3BAWA 1JNEA 2ZX9A 3OQ8A 4PB3A 3I3BA 4H7ZA 4Q32A 3PC0A 4FOUA 2C7FA 2XIOA 3SRKA 1KXTA 1Z89A 4FNTA 2DVXA 4XSMA 1RALA 5FJPA 4KWVA 3W23A 1R3VA 5CC6A 1UD4A 3WJYA 4IPLA 3JR2A 4RKAA 3O7UA 1W31A 4DB7A 1MNSA 1J0JA 1JYWA 1BG9A 2YL6A 2GDVA 1XIHA 3FAWA 1CT5A 2ZBTA 3WQFA 3BC9A 1LL7A 3WQOA 3KLLA 4IQEA 5IOBA 5BRBA 2H9AB 3ME3A 2FTYA 2EKCA 3QPEA 5KMYA 1O5XA 3T4WA 2X7WA 5FL1A 3WLHA 4D1JA 3SQLA 3VZYA 4JY8A 1GCYA 3CB8A 3J7HA 3N19B 3H2CA 3C8NA 4C1LA 4WKAA 1A49A 1RBAA 2WKJA 3KBJA 3FJLA 4N02A 1BFNA 1TCMA 1YE4A 2BOEX 2G95A 1RJRA 4WRHA 4MVAA 1T8QA 2H9AA 4MWAC 2BG5A 1PXGA 3AYTA 2Z28A 2XH7A 1VJIA 5I02A 3O2LA 3V5CA 1MXSA 4HIBA 4MJZA 1BHGA 1AVAA 1G94A 3VM7A 3LGGA 5RUBA 4PTNA 3QGAC 2Y8UA 3CH0A 2ZZ5A 4FP1A 1T99A 5DY3A 4ACZB 2XWEA 3ENLA 4D2JA 3EX2A 1XIDA 4F66A 3QC0A 4DYKA 3AXIA 4A2RA 1I1WA 3QPYA 2J7EA 3IUIA 3AHTA 3GUGA 1E72M 2VGIA 2YSWA 1Q6QA 4D8LA 2ZCGA 4JX5A 1FFQA 3F2CA 3V0UA 1PCWA 1WDQA 3G3DA 4Q33A 1QT1A 4LC8A 4HMCA 4CVUA 2BXZA 2Z6JA 4LUTB 1A0EA 4YJ5A 4XZ9A 4ACZA 2XPKA 1ITQA 4ONVA 4NASA 1B3XA 4FNRA 3QMRA 1XCWA 1E0WA 4ZQMA 3N9RA 4HA3A 1TCDA 1P1XA 1SW3A 2R6OA 3QSTA 3ONCA 3T08A 3ZJ8A 2OODA 1DJGA 1E70M 1O12A 2GVLA 3WYZA 4TR9A 3TN4A 4INFA 5FCZA 2C0HA 3FHQA 1UKSA 2YL9A 4LUTA 4IMGA 2YCEA 1FH8A 4GQRA 4CNSA 3F7JA 3P5ZA 4AD4A 3E0VA 1A0CA 1UA7A 3I68A 2OWCA 1YW1A 2NXGA 5CBIA 1R3WA 2PPGA 1NOFA 3L7RA 3O6CA 4O4WA 5FKYA 1FHLA 4S3KA 1F7BA 3CEUA 5E6ZA 4OQVA 1MNZA 1K8ZA 4PUKA 5HAOA 3WNPA 3BXWA 3CH9A 1BQCA 2AAAA 3ZO9A 3IIPA 1UZHA 4IHCA 3STEA 1I0BA 2SFPA 3CAWA 4H7CA 5IXEA 2POZA 5D2VA 4KPLA 1HJWA 4MY9A 3Q67A 4ZGYA 1ELSA 3ZVIA 4C6CA 1BGAA 4CD4A 3GBDA 2YLAA 4XD3A 1RCXB 3VC5A 3LOTA 4W7UA 3BSHA 3VNZA 3ITOA 1UUOA 1Y8BA 3M0VA 5HATA 4BF7A 3OGVA 1XYCA 1UR3M 1G01A 2ZTJA 3BW3A 5A8QA 3TQKA 1VPYA 2FJKA 3NUKA 3A12A 2V2CA 1O4UA 3BLIA 5M3WA 2DZTA 3QHOA 3I4KA 3P8IA 4GK8A 1W5NA 4JDYA 3W74A 5LIYX 3WH6A 4W8BA 4DF2A 1F5ZA 3CLMA 5LYRA 4K7YA 1LZOA 2HDJA 1PWLA 1TKKA 1QI0A 1GEQA 3QY8A 4BI7A 4E2DA 3K8MA 3VD5A 1CXHA 2JIEA 1H09A 5D8ZA 3FS2A 3LM3A 2RKXA 4UTKA 2HBVA 2Z2UA 1QWKA 3NSNA 3GZAA 4V27A 3SUUA 4EOUA 3HFYA 3S1XA 2OFJA 1E55A 4IIGA 1XW8A 4UR8A 5HMEA 1J93A 1HO4A 3QR0A 3PFMA 3LSBA 3E2RA 4TX8A 5LIWX 2ZE0A 2IS7A 3Q94A 1TX0A 2QMJA 4X9SA 1Y7VA 3PJTA 5CZKA 3N13A 4PUEA 3KBMA 3VMPA 1PPIA 1D8CA 1R7AA 3E3HA 4IM4A 1K02A 2J7BA 3VUSA 3IAPA 2PGEA 2VQTA 1S38A 4S3GA 6XIMA 1MO0A 3QV8A 1RJQA 4J27A 2GGIA 2YFOA 4H01A 4PSPA 1D7KA 3PNZA 4ZMGA 1EJTC 3O6DA 1A0DA 3B06A 2PWVA 4PMRA 2J24A 4AU0A 4BF5A 1P0DA 1KA9F 4FO4A 3HPXA 1J0IA 1UZ4A 4DWDA 4NI8A 1S2VA 3LCIA 3C86A 4YL2A 1P5BA 2QUVA 2YDAA 4R33A 4E4PA 3QH2A 2OO6A 4X63A 1U2YA 4UXDA 2UV8G 3AAMA 3WNKA 4J3UA 5BCAA 1DJWA 1M7JA 3VOGA 1TPEA 2PDPA 2XU2A 2DUAA 4Z08A 4JDBA 3KVMA 1K70A 2J62A 1RV8A 2OKOA 4U33A 3MI2A 4UTMA 3ITXA 1SR0A 3TV8A 1MVYA 2VURA 1EC9A 3RLUA 1Q7MA 1QWGA 1V7YA 1PX8A 2J7DA 4Y6GA 3QC3A 1E4MM 3V16A 4DNMA 2QV4A 5HJYA 4HPGA 2YJQA 2ASHA 4XB3A 4Q4KA 5C7HA 1CPUA 2BOFX 3BAKA 3O0FA 4GMEA 4TO8A 2Z1KA 4EXAA 4CQCA 3S2NA 1DYSA 5KTLA 1IYXA 3OLEA 2DDXA 2CZVA 4EAYA 5AB3A 4UIOA 4GA8A 1N82A 3TDFA 1CLVA 1KD0A 4TMCA 4IP4A 4A3HA 1J10A 3QV6A 2VEIA 1VJSA 4HNTA 3KOZA 1C8VA 3KOYA 3O06A 4JGDA 5FJJA 1OX4B 4MB4A 2BVDA 1B5TA 3V36A 4Q4OA 4YTUA 3BCJA 3SCNA 4YVPA 3RITA 1DJNA 1EYWA 4GVGA 4HD5A 2ZWZA 2H90A 4LS0A 2OT0A 1LP6A 4Q8MA 5HANA 3MBFA 1LWJA 3G6LA 1RJPA 4DXXA 2XIQA 3MHUA 1R30A 4KRZA 2ONEA 2XGBA 4D6JA 1Q5MA 3A6OA 1OX4A 5CC5A 3IRSA 2QW5A 1U83A 3H7VA 3C8FA 3Q45A 5HULA 4UQDA 2AQOA 1Z3NA 2LLEA 3CHFA 1H7OA 5TQLA 4CCEA 3W37A 3WENA 1A3WA 4O11A 2OPJA 2Y70A 1ONWA 1NJJA 3H2AA 1XYBA 5DFAA 2V5JA 4FOKA 3NYDA 3W1UA 1F2JA 5CEWA 1W9UA 3TR9A 1PKYA 4JTGA 3MW7A 3QMTA 1OJXA 1M68A 1YRRA 3SCSA 3PBYA 4D8ZA 3KAOA 4EKJA 3FSTA 4I8DA 3G0SA 5CSYA 1U33A 2YLLA 1PZ2A 4U3AA 1PKLA 3M7WA 4B4HA 4ZVJA 3UXLA 3GS6A 3I7QA 5D9OA 3KP1A 5FA5A 3WJZA 4ZTYA 2DW7A 2YBUA 4AQLA 1L2QA 1VBHA 3G3MA 1XLEA 4W84A 1L2UA 4H3DA 3M5YA 1I9CB 3AUJA 1MEWA 3ORWA 4HK7A 1E4LA 1J2WA 1W3IA 1H0GA 4KWSA 4JIHA 4MKNA 5A6SA 4JQ4A 4RE2A 3DN5A 3GTHA 5HWMA 3DBNA 3R94A 1O7AA 3NYZA 1RVKA 3USZA 1EQCA 2GJNA 4BI5A 3H23A 4CCCA 2HNHA 3ZJ6A 4JTDA 4KF1A 1R2TA 3OQEA 3QXBA 5L6UA 3GH4A 1GW1A 3C0SA 3QRHA 2PDJA 1MQQA 3MANA 4Z42C 3WF0A 2OTDA 1Y0EA 4ZOEA 3N25A 3AS0A 2C1IA 1NDWA 4IPJA 2H8XA 1DJZA 1GOKA 1MUCA 3TZNA 1IT8A 4GQBA 3RX4A 2PAJA 3WDQA 5T9CE 1TV5A 1UD8A 2OT1A 1JYVA 4BK9A 1QNRA 4JOMA 2ACQA 1EUAA 4FA3A 2IKHA 3LTSA 4JTFA 4W87A 4DJFA 1EP3A 1H41A 1U5VA 3RJXA 4Q4MA 4HJFA 3KP0A 2DVTA 3RG6A 1W9BM 2GGHA 1R38A 5AYZA 2HXTA 1KBKA 1XH2A 1WDRA 2P50A 2OZ0A 1Q65A 3GU1A 5E0CA 1EO5A 3PTMA 3LHYA 3HOJA 5HWNA 4UUIA 4G7EB 3BJTA 3ZFHA 3LCWA 3ANYA 1RVGA 3T05A 4HCLA 3LK6A 3MSDA 4ATDA 1M5WA 4DO4A 2BASA 4K8GA 5EY5A 4DJEC 3WUBA 1TPWA 4IIBA 4D9PA 2DZSA 1XXXA 4PMUA 1W5PA 5DCDA 4XAFA 3M6YA 3U2ZA 1GTEA 3VPLA 1TTJA 2BVYA 4G7EA 2WSYA 4AMCA 1VLIA 2EPMX 1XIBA 3U2CA 3WNLA 4GWEA 2OO0A 4ZO8A 7ODCA 2VD8A 5FF4A 3WQEA 2QS8A 3RN6A 3QZ6A 3EOUA 4JIEA 4XAGA 3EWZA 3T0BA 2V82A 3R0UA 3OA3A 1KFKA 1E1FA 1OABA 2WLZA 3PB2A 2QUTA 1SW0A 2A3HA 3GY1A 2TYSA 4PCPA 3W87A 4RR4A 2HCVA 3UZXA 3GVRA 5ENLA 5C70A 1A53A 4FNQA 3C2EA 3M43A 3TIMA 2ZUNA 1I2NA 4LYKA 3OIHA 1TMLA 2PA6A 2E5DA 3WQGA 5I3IA 5A5WA 3C0QA 2YA1A 4HMEA 5FAJA 2DW6A 1AJ0A 3SCVA 1WXZA 3G6MA 2ZA1A 1A5UA 3HQ1A 2J74A 1P43A 5IFTA 2CZDA 2YCLB 5BZAA 4JKKA 3NPUA 3O6YX 1TPVA 3NURA 3G1DA 4XZBA 5E9AA 3TSMA 3CMGA 2ZZ4A 3PZ9A 1UJPA 4Q3MA 4DM1A 1UR1A 3LBOA 4H8VA 4MNKA 1XRFA 4QG9A 5FACA 4B9ZA 5LA1A 3URAA 3CC1A 4LANA 1NSJA 4JHOA 1XX1A 4BI6A 4FXJA 4QFUA 4NAFB 3N6HA 3UWVA 3DGBA 1QI3A 3RGTA 1XC6A 5H8PA 1UIPA 5BWAA 4LCRA 3DZ1A 3C2VA 1Z32X 3HIJA 3LM7A 5DO8A 1HG3A 3SIMA 1JFHA 2WOQA 4GO8A 3CB3A 2V2DA 4HMNA 2QHAA 1X39A 2VWSA 4RK8A 2BY2A 2W79A 3ALGA 2VENA 3EOOA 1WUEA 2CU0A 2PP3A 2Z6IA 4IG2B 1EC7A 1EXPA 3K1DA 3EKGA 3QW3A 2OWXA 1RLCL 2X2YA 1VFTA 3G2GA 1C9DA 3F4VA 3T0TA 1NFBA 5CZ0A 4JS3A 3OODA 1AFSA 4QG6A 4UCFA 3EKLA 2ZICA 2YCIX 1X38A 3OZYA 3IJ6A 3W86A 1WE5A 2DZVA 3TSDA 1EQPA 1F61A 2C8NA 3BUVA 5I3JA 1JPKA 2TSYA 4HA4A 1VKFA 3AWOA 1W54A 5CBBA 3UGVA 3N12A 1PJ9A 4KFPA 1G4SA 4D6IA 2AL1A 3LPFA 5GNXA 4AIEA 2JQXA 1UWUA 1EXBA 1XLDA 3CBWA 1XDLA 3BV4A 3TYCA 5BMXA 5DT5A 1E6PA 1TMQA 2VJXA 1H7NA 5CZJA 4JQ1A 3L66A 4IZGA 2QGYA 3HGSA 3LX9A 2F8QA 1K3UA 1XLJA 1UPMB 1WDDA 4QG8A 3TAOA 1JDAA 4MWAD 4AZHA 1O95A 3PWGA 1Z6KA 1GOIA 4L6OA 4NRSA 1UKOA 3S3GA 3AISA 1OIMA 4OUEA 1QOQA 3BMWA 3MZNA 4IQDA 1SZFA 1V6VA 5I00A 3CAKA 4XZLX 3HV9A 4UFKA 4Z1BA 1JAKA 3E2VA 2ZZ2A 2J7FA 4M0XA 5DXYA 1OZQA 1CENA 2WNQA 3S1GA 3JS3A 1GYNA 2DT1A 1UC5A 3GFXA 1MYRA 5G4WA 4GUIA 3T2PA 2VCBA 5AY7A 1TUFA 4AB4A 1EGMA 3W27A 1Z48A 2W63A 1BPLB 3TC6A 1FWIC 3M41A 1IT7A 2J78A 1JJKA 1K9DA 1Q45A 1XLCA 1NQ6A 2A85A 3PHAA 3BMXA 4RLIA 5LA0A 1T5AA 1ISZA 5LNVA 1Z42A 2E8ZA 3MV11 3V7PA 3TEVA 1BF2A 1T40A 3ARQA 3VE7A 1XLBA 3DIPA 3EOSA 4W89A 4U3CA 4DIAA 4F79A 5CPTA 4MDOA 4PBGA 3C56A 3NPVA 5EMLA 1MEHA 2BVWA 3MB9A 3MUAA 3DFNA 3FSUA 2ZC8A 1K7XA 5SWUA 5HNRA 2V69A 3SR7A 3B03A 1LF1A 4FI4A 4WR3A 3VD7A 3UNTA 4HBKA 3F1QA 2EBNA 2QULA 2WXDM 1SZRA 4R9OA 3T0CA 2YFNA 3H54A 3V35A 1H63A 1BVZA 1MUWA 3DHFA 3CZ8A 1LRNA 1WV2A 1IWBA 2FVMA 3G0UA 5C9RA 3T9PA 4YYFA 4N2YA 1SR9A 3WLIA 3VKJA 4JTTA 1GONA 2VFIA 4F8XA 1GQKA 5C54A 3GNDA 1QXLA 5G1TA 2IXUA 3AYVA 3M46A 3Q37A 6TIMA 2ZUUA 1XGZA 2C14A 1QRQA 1W1B1 4DEFA 3VDAA 3BL3A 3FIGA 3OO2A 1MRQA 2EPHA 4D6FA 2CLPA 2WQDA 2NV2A 3ERPA 4O18A 3P60A 3EAUA 4B5NA 2Y6ZA 4M56A 3T44A 4NXKA 2PC8A 4Y9NA 5F4XA 3QEZA 1TR9A 1R87A 2WCAA 3CO8A 2QCNA 2NWSA 3I4EA 1KRBC 3C52A 4QJ5B 5FESA 3VIHA 1R0MA 1SJDA 3DI1A 1DQUA 2VTFA 3RFAA 4DRSA 5K3VA 3LQGA 1GJWA 2X1SA 3NM1A 3FJ4A 1W1VA 3N2XA 3WJWA 3VGDA 3QGVA 4KIRA 4IXXA 1SFJA 4HN8A 3GC4A 3AS1A 1JVNA 2WJFA 3DFHA 2D2JA 3NPWA 9XIAA 2F84A 3RM4A 3W24A 5FD0A 3G1XA 3NZGA 1E6NA 1J6OA 1XWYA 1G0CA 1UBPC 3L4UA 1YTKA 2YW4A 1PIGA 1E5NA 2J9ZA 4XV0A 3MUIA 5JU6A 3H4GA 3HPFA 3DEQA 4S23A 3BICA 3SZ8A 4U28A 5HUPA 3AZSA 4IFRA 1OEPA 3CYJA 3W07A 3W88A 1D8WA 3W76A 4KBXA 4I6KA 1JPMA 3PTDA 1T6MA 4W8AA 1OY0A 3VOIA 1XLMA 4O28A 5DX7A 2C1GA 3FW6A 3NL5A 4CNNA 1DIKA 4OFCA 1QHPA 2QGHA 1P0BA 3NEHA 3CIWA 4H41A 1O68A 1TTPA 1SQ7A 3TFCA 4D1IA 4FLRA 4HYWA 3KTXA 4UMCA 4YTRA 1XBZA 1IQ8A 2FTPA 3JRKA 4GI6A 1D3HA 4ZO9A 3F2DA 1VPQA 4HHPA 5FL0A 3M64A 4QJ3B 5FF3A 3EXRA 1POKA 3GH5A 1V5XA 2ZX5A 1IT0A 3UXKA 1ITUA 2WNNA 5DN1A 2ZUTA 3IANA 1TVLA 1GUVA 1EJRC 1XD0A 4JQ3A 1VBJA 1GZGA 4JN8A 1B3WA 1QPRA 4LGXA 1R9XA 3IARA 4AIOA 3TXZA 1LORA 4TUFA 2B7QA 1R2RA 2OWWA 3E96A 3POHA 2R94A 1DVJA 1UKQA 1DIEA 2DSUA 5AYYA 2XZ7A 2HTMA 4CNOA 3E0IA 4JHZA 1I8JA 1W9XA 3WDHA 4DWSB 4MF4A 3LEPA 5HJXA 1TTQA 2DJLA 2QQ6A 2YB4A 1XICA 1RP8A 4ROPA 4DLFA 2NWRA 2XVGA 3U8GA 3GHUA 1GQJA 3GVGA 4C1NB 1SO5A 3U4FA 3B0PA 4GCXA 4UTIA 4BEUA 1LG1A 1B9BA 3PJUA 2IKJA 3UZWA 5H2ZA 3DCPA 1CB2A 2XJ7A 4OOUA 1C7SA 4JKMA 2QJNA 4BR1A 3UF9A 4DWSA 3ZXWA 2X7VA 3WLMA 3QHNA 2X30A 2A21A 2Y89A 3HZ3A 2B7NA 4MSSA 1A5CA 2HV5A 4V2XA 3L4TA 3EX3A 2I9UA 5CPMA 4C1NA 2G96A 1YMYA 4HVXA 1NP2A 5K4XA 4XD4A 1GK8A 2G5WA 1EDQA 2X1RA 1W2PA 3PZQA 3KCLA 4LAOA 4OJYA 3LXCA 1F6KA 2X1TA 4HB7A 2VR2A 4DX3A 4GC4A 4P7LA 1TJPA 2Y0FA 5M03A 4TV6A 5C9UA 4HPJA 3O3RA 3VCCA 4JR5A 3UWEA 3H55A 2ISDA 1QNSA 3TTQA 4GJIA 1SO4A 1OD0A 2OSYA 3FA3A 2QUMA 2EO7A 4YHEA 2IPFA 5GJPA 4JEJA 4H19A 5H91A 1UR9A 2YZ5A 4DJEA 2J8FA 2IW0A 3L4WA 2D3LA 3K4WA 1FWCC 5LNUA 4QDMA 4QIUA 4HHMA 3W2LA 2FVKA 1MXDA 1W5OA 2YBVA 3WLKX 4QDWA 4UQCA 2NSOA 3TJ4A 3BLEA 4WY0B 3R7MA 5A2BA 2PGRA 1XKYA 4IMDA 1W91A 4XUYA 1DWHM 4XO7A 1AL7A 2E68A 2YDQA 4ZB0A 4C6PA 2EAWA 4DI8A 1E9IA 3C0LA 2PS2A 1CTNA 4MKVA 2EEXA 3PSVA 1T96A 3AICA 2FZ9A 4M6PA 4OBRA 5D2XA 3L5LA 3V5OA 3FDGA 1ODZA 1GZJA 1H7PA 2YCKX 3MCNA 3LD5A 2B7PA 4WY0A 4L4OA 2DSVA 3CV6A 3MPGA 4DJDD 3PTQA 1C7TA 2NLIA 3SGZA 5AC5A 1IR2A 1X6LA 2PWDA 1J11A 2DZXA 2WPBA 5JIPA 4FX8A 5DXXA 2POTA 3GNOA 2E0PA 3MUCA 2QNEA 3RRXA 4M5PA 4W86A 5CH9A 1XI3A 3PZUA 4GVHA 2JE8A 1OFPA 1VS1A 4J2PA 3AHZA 3V5FA 4JTSA 3PZNA 5KEZA 2X0HA 2FZBA 3DHDA 1MZHA 3AMKA 1UG6A 2YR1A 1FKWA 2PWUA 1GVSA 4PB5A 3BOXA 3JW7A 1S5VA 1P6BA 4CKQA 3RCMA 5A6JA 4H8UA 3GDTA 2RGLA 1L6SA 3OPSA 3O16A 3N04A 3GTXA 3IJIA 1HL9A 4AHOA 3KL3A 3R10A 3BLOA 3N2OA 2WJDA 2J8TA 1UD5A 3K8LA 4LW7A 1BEUA 2VEMA 4GYKA 1B9ZA 5GJNA 4H83A 3T0DA 5AC4A 1K9FA 1UMLA 1OFDA 2X09A 2ICSA 1F3XA 5DBUA 2G4FA 2BGSA 1XIJA 2PRMA 4Q4SA 3TOPA 1H51A 4GYPA 3VKBA 5A69A 1Q2RA 4JTUA 3NL3A 9CGTA 3AYSA 5CBJA 1UOZA 2D20A 5U7SA 4E8DA 3ZOAA 3W83A 5J5RA 4IH3A 5I07A 2CYGA 3W71A 3GNRA 4A35A 1EHAA 2J79A 3PK7A 4LWWA 3ATZA 1H1YA 5A94A 3UZJA 1TA3A 1PSCA 1RY0A 3UR7A 3UFYA 2VEFA 2Z25A 1ZAHA 2FMNA 4GZ7A 3L65A 1L6FA 2PFHA 4IIDA 3W1NA 1VGAA 1KXVA 2W9MA 5CJMA 2ISWA 1NOWA 5HNUA 3SCPA 4ZTXA 2CBJA 1US3A 3TYZA 4MLRA 2W61A 3EA2A 2QT3A 1C9WA 2FZNA 2PCEA 2C3ZA 4UFLA 2WSPA 2B4GA 4FX6M 4H8NA 1FWSA 4A8RA 3AMGA 1W6TA 2WSRA 2PCQA 1JCNA 4L7ZA 2B81A 5JBDA 5A8OA 3I3DA 2O9RA 5I3FA 1ZS2A 4ERIA 4R7OA 1QMLA 2PDFA 3ZLHA 1P48A 2A2IA 1ZP4A 3WQPA 1NM9A 4PCFA 1ISXA 1Q3NA 3UG3A 1ML1A 3BMVA 4DBDA 1KM5A 4LSBA 1EYEA 1E6SM 4LBRA 3ICJA 3VD3A 3SRFA 4GVIA 4JL1A 5K9XA 5XIAA 2RJHA 1EB3A 3MS8A 1F3EA 4R7JA 1VHNA 3IJQA 1Q8JA 1KM3A 4US5D 2G4JA 3TCSA 2Z0IA 2Q3OA 1SUXA 5F4SA 4AWTA 1A5SA 5L9FA 4UFHA 2R24A 2GJPA 4LCSA 2PLJA 2FGZA 3IS4A 3IVUA 1PV8A 1GVQA 4AD0A 2YL8A 3MJYA 1VFOA 1RAKA 3U6WA 1E0TA 2E7FA 2I17A 4RDZA 4K7VA 1JGIA 1PDZA 2QJJA 3AO0A 1QU4A 3M1ZA 4K39A 2YXGA 2WLYA 4MYXA 3PG8A 4UFMA 4DN1A 1ADDA 3GG8A 2HZGA 1YXYA 3NQEA 1FHVA 2OR2A 3NOEA 2WQPA 1UC4A 4XAZA 4CD7A 1V7AA 4XZIA 3N29A 4YTTA 2X1IA 3N14A 2OGYA 2RDXA 3LI0A 1AZ1A 3BAIA 4U2YA 3TN3A 2WMGA 4JYFA 4FXFA 4QP0A 4IL2A 2JFEX 1V3MA 2WJEA 1FH7A 3ES8A 5CPLA 3ECQA 2YGYA 1C8YA 1Q6GA 4PGLA 3DFYA 1OSEA 4NZCA 4F0RA 1RH9A 2VEPA 2O56A 3ARWA 3BOLA 5I79A 4B3KA 3S83A 1RXOB 4Z1YA 2V67A 4RDVA 1NWSA 2GDUA 2GJRA 2FGLA 4PCTA 1VFSA 5GJMA 3FXGA 3LGDA 2W67A 3NVDA 4K36A 4TU1A 3P74A 4HU3A 4UMAA 1VH7A 3GQYA 1E0UA 1Q4NX 1Z69A 3L67A 4MY1A 4I5XA 2KZHA 3T40A 4JTRA 4BFAA 3QTGA 5F1UA 3UJEA 3PN8A 3QLLA 5D09A 3WLSA 3WFAA 5TF0A 1VFLA 4M19A 3QGKC 3EA1A 5MKGB 1JCJA 1AD1A 2E9LA 2GWNA 3ABZA 3JVAA 3W75A 1G7UA 2Z26A 3SJ3A 1TO3A 1ENUA 4O10A 2PDXA 3PVFA 1IWAA 3NQDA 3FNDA 3BGJA 1FWAC 4BCEA 1MFVA 4KGJA 5HPCA 3B3DA 4WSHA 3GUWA 3MVTA 1F9CA 1KKRA 4C6FA 1TSIA 5I3DA 4WD0A 4KFNA 1OC5A 2VNCA 5MKGA 2EG6A 2ISSA 3F5LA 3WDIA 2EPOA 1VBUA 3CT2A 3N6JA 2NW0A 2V5KA 1JZ4A 1S1PA 4R88A 4WDTA 3WFZA 1LL6A 4IPPA 2XGIA 7ENLA 1CX9A 3QPZA 1PZ3A 1V6UA 4WDWA 2ZVIA 2DSWA 5GNYA 2Y8KA 3II1A 6TAAA 2PZ0A 4MNLA 5F7UA 2PD5A 3L4ZA 3SUWA 3VYLA 4PMOA 1PZ0A 4DZ5A 1JCYA 1PDYA 1DHKA 5GVJA 1KNWA 2BGNE 2EGZA 5I06A 2NQZA 4HSOA 1KCLA 3SSJA 1QOXA 4ORMA 1BYBA 4TOQA 4M7TA 2V81A 4KCWA 2DV0A 2V3FA 5HWJA 4H8HA 4UNLA 1ISYA 2DGAA 1ME9A 3GLCA 4JTHA 2PDMA 3WMBA 3EWDA 3VE9A 3NZRA 3PF3A 3A24A 5EBUA 4A4AA 2V6AA 1IE7C 3QTPA 1L8NA 3NL2A 1W1TA 2H3DA 1R3TA 3GIPA 2NQLA 3DENA 2E6AA 1QJWA 3BURA 2E6YA 3MHGA 2PLKA 3LBMA 2D69A 3WH8A 3AHXA 1Y65A 3IIVA 1K9EA 5F4WA 4CEXC 1X1NA 5T8GA 1FUYA 2HRWA 2YCJA 2G37A 1ZY9A 4X0VA 3UJ2A 1J0KA 3MJMA 3E0FA 1J18A 1OCJA 4XISA 1YBQB 1S2AA 5T9BG 4FPSA 3PANA 2ATSA 4JIRA 2PLMA 4HCHA 3IPWA 1FVPA 3LPOA 1Z41A 3WK2A 2VL4A 3W7DA 5DEZA 5FEWA 3VGBA 2J7GA 4GXMA 4EVZA 4H9VA 3CUGA 3M0YA 5FEPA 1RPXA 1PO9A 4DO6A 3WUFA 3NO3A 5IHSA 1BXBA 3NO1A 4GBUA 1V93A 2VX5A 1YBQA 1V8EA 3SUVA 2OOGA 3WLPA 1BQGA 3SEPA 1XIMA 4JTIA 1EJVC 4C6KA 4MB3A 5EYWA 2UY4A 4Z17A 4H6KA 1M9HA 4AD5A 3CUXA 4BWLC 1IEXA 2BHYA 3LHUA 4O1AA 3SN4A 3UCCA 3F5JA 2VZOA 4MWAE 2VFFA 3G24A 3ZT6A 1ZJBA 4H7VA 2GJLA 3VKKA 2UBPC 3ZQ9A 3IJLA 1C8XA 3R12A 4JHMA 3S6OA 4C91A 2P8CA 1DWAM 2ZXQA 3WBAA 1VRXA 3NPXA 3VCNA 1ECQA 5BXPA 1FXQA 3OYZA 1RK5A 4DHGA 1NWUA 4MM1A 2VZVA 3EDKA 2EPLX 5IDIA 2Y63A 5I3HA 2D0HA 5EB8A 1UP0A 4WK9A 3HN3A 1XPGA 3W3OA 4I5RA 4ZOBA 4C6QA 4UCGA 1TZ9A 4I7WA 1D9EA 1FDYA 2YYTA 4PYSA 6REQA 2DH2A 3SCRA 4NSBA 1ZBCA 3QYSA 3SN1A 2ESCA 2EPKX 4HP5A 4LV4A 4HTBA 4TIMA 1E3ZA 3EXTA 5IFPA 2P53A 3ITGA 3STGA 5ECVA 6XIAA 4PODA 2VDGA 3LCHA 1FFRA 1B2YA 1K6AA 3KDNA 3PPGA 4B92A 3A4XA 4C6IA 2O9PA 4YS1A 1UP3A 3DFQA 4XBJA 3WF2A 3KVKA 2IUZA 1DIOA 3VDCA 3NQ6A 1ZCOA 2GGGA 1DKWA 3G22A 3GE7A 2GK1B 3L9CA 5EL1A 1EOMA 4D6HA 3NQ2A 1UQYA 3CHEA 4FHAA 3AMCA 4GI8A 1CECA 1JFXA 3ZWTA 1GVIA 5JBFA 1K8YA 1XLAA 2NLYA 3WBXA 3PNUA 2AAMA 3IJ8A 5A1AA 2ZA2A 3WMSA 3HJEA 3ZLGA 2QIIA 4P8UA 3PUDA 4ZBCA 4ZE5A 3MU7A 2VX7A 4G8TA 3MWAA 4PSRA 3THQA 3N9KA 5C2XA 4X2PA 2GK1A 5XIMA 1X97A 2Y1HA 3IGUA 1EX1A 3TAKA 4JTCA 1HO1A 3IJ9A 3TN5A 3THAA 3B8IA 2WNWA 4AY8A 2XFRA 2DSKA 1YPFA 2V3GA 1JD7A 4PFMA 2Q8LA 1UR4A 4Z2KA 1SJAA 4L5ZA 1OG0A 4O1BA 2NXHA 3VVGA 2PBGA 2FJUB 4XZMX 3CNYA 2HE5A 1LBFA 2F9RA 2J25A 1IXNA 3ITCA 5FI8A 1EEXA 3TQPA 3VD9A 1I2QA 1VAHA 5FJIA 1M03A 4JZ5A 1X7IA 1G9HA 1LL4A 4QM1A 2CBUA 1XCFA 2QDHA 1XH1A 2GQ8A 3PJWA 3TW7A 5KZEA 1XUZA 1WAUA 3BGAA 3TTSA 1HW6A 3A9IA 2VEGA 1PAMA 1O60A 4A8IA 5C5YA 2AKZA 3B4UA 3BZGA 3M47A 4LNYA 1BKSA 2XSXA 4B2DA 1HIZA 5FOOA 3C2FA 2VWTA 1B3VA 4GJ1A