4RDZA

Crystal structure of vmolac in p64 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
314
Chain Sequence
GMVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
molecule keywords Parathion hydrolase
total genus 123
structure length 314
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdzA00
2PAJA 4L9XA 3S2NA 1WXZA 4GY0A 4J35A 1GKQA 4G2DA 2I5GA 4DYKA 1J79A 4H9YA 2Z00A 1W1IE 2FFIA 3CAKA 3S2JA 1EJVC 3GUWA 1M65A 4C60A 4PE8A 1XGEA 1O12A 1ZZMA 3WZ0E 3GTXA 5A6TC 1FWIC 1A5OC 2HQAA 1ADDA 1NDWA 5G4HC 3MKVA 3SFWA 3S4TA 1IE7C 2O4QA 1RA5A 2OB3A 3OVGA 4IG2A 1V79A 2GZXA 2D2GA 4DIAA 4HK5A 3LGGA 4KEZA 3F2DA 2R1LA 3GTFA 3QY8A 2ICSA 1KRBC 4LCRA 3ITCA 4GYFA 4GX9A 4CNTA 4EPDC 4KESA 4QRNA 4XAGA 1PO9A 1UMLA 1UIPA 4EPKA 2D2HA 4XD6A 1DPMA 3UR5A 2QS8A 2W9MA 4C6OA 4CEXC 5LXXA 2F6KA 4QS5A 4ZSUA 3IACA 4IH3A 4IFKB 4DZHA 1FWAC 1NFGA 1R9YA 2PUZA 4C6PA 2Z29A 1A4MA 2A3LA 4XAYA 2Z24A 3ISIX 4C6EA 4H9ZA 1FWHC 3T1GA 4YIWA 2VC5A 3PNZA 3MPGA 3F4DA 3DCPA 4UBPC 4QS6A 1RJRA 2BGNE 4DNMA 3E0FA 2Z2AA 1RJPA 4V1XA 4CQBA 1EJUC 3C86A 1ITUA 3EWCA 2Z2BA 4L6DA 2PLMA 3CJPA 1GKRA 2CZVA 1PB0A 2R1MA 3PBMA 3FDKA 2Z28A 4C6FA 3LSCA 1ONWA 1YRRA 3E74A 2ZC1A 3GIPA 4ERIA 2OQLA 1RA0A 4IGNA 3F2CA 4GK8A 1RK5A 3MSRA 3URNA 5HMDA 3QY7A 1A5KC 2Z27A 3MVIA 2PGRA 4C6LA 1YMYA 2R1KA 4INFA 3NEHA 1V51A 2Z4GA 3S2MA 4G7EB 2FTYA 2G3FA 4B90A 4DLFA 3ICJA 1P6BA 1FWJC 2OGJA 2UBPC 2Z7GA 3HM7A 1RJQA 2VC7A 4H9XA 3R0DA 2DVTA 4CNSA 3UBPC 4V1YA 2YB4A 4ERGA 4BJHA 4LAMA 2VM8A 3MVTA 3MDWA 3E2VA 3QGAC 1FWBC 2WJFA 2I9UA 1FWCC 3FEQA 1J5SA 2YZ5A 4H9TA 3GTHA 4IF2A 2EG7A 1A5MC 4IG2B 4JOMA 4RDYA 4GZ7A 3O7UA 4LFYA 4WVXA 3OJGA 2FTWA 2FVKA 1XRFA 3QGKC 4LAKA 4P5UA 4J2MA 4IFKA 4C6MA 4AC7C 4CEUC 4C6CA 3DC8A 4XD4A 1UBPC 4F0LA 4KERA 4XD5A 3NURA 4LCQA 4E3TA 5FSDC 3AUOA 4GXWA 1POKA 3A3WA 1VFLA 4B3ZA 4PBFA 3A4JA 4QTGA 2HPIA 2D2JA 2UZ9A 2IMRA 2P50A 2R1NA 5CH9A 3PAOA 3TNBA 1A5NC 4H9UA 3F2BA 4F0RA 4TQTA 3MJMA 4MUPA 3B40A 1EZ2A 4C5YA 2VR2A 1GKPA 3O0FA 2KAUC 3RCMA 4NP7A 2HBXA 4KQNA 4QROA 1KRCC 4HA0A 3TN6A 4CQCA 3GTIA 4CNUA 4DI9A 1A4LA 3GG7A 1FKWA 1YBQA 1EJSC 4H9MA 3QY6A 1ONXA 4IFOA 3RYSA 4G7EA 1V4YA 2GWNA 3G77A 3RN6A 3JZEA 4RDZA 1POJA 4I6KA 3T8LA 1EF2A 4UB9A 1YIXA 2YXOA 3EWDA 4NI8A 4DI8A 3UPMA 1M68A 2OOFA 4LH8A 4IQJA 1EJRC 1NDVA 3TN3A 3WMLA 4C6QA 1KRAC 4GX8A 2WJDA 2Q01A 3NQBA 4C6BA 4RDWA 4ZSTA 4Z42C 3K5XA 3E0LA 4HJWA 4CQDA 2Z26A 1FKXA 1EJXC 2QT3A 4WGXA 1E9YB 2OODA 2PGFA 4M51A 1KCXA 4F0SA 2DVUA 4PBEA 2FVMA 4BKNA 2VHLA 4C6KA 2EG8A 1PTAA 1QW7A 3GRIA 1HZYA 3LNPA 1I0DA 3UR2A 1QXLA 3DUGA 4XAZA 1XRTA 4J5NA 1P1MA 1RK6A 2Q09A 2Z25A 4H00A 5AKQA 3ID7A 3PNUA 3LY0A 4DO7A 3OODA 4KF1A 3IGHX 3IV8A 1J6PA 4C5ZA 4WHBA 4HK7A 1RAKA 4PCPA 4D8LA 2ANUA 3V7PA 2DVXA 1YNYA 4IGMA 4C6JA 4LEFA 3FDGA 3E3HA 3OU8A 1S3TC 4LCSA 3B0XA 4GY1A 4B91A 2QPXA 5E5CA 3AU2A 2Y1HA 4KIRA 2R1PA 3MDUA 3S2LA 1KRMA 3LA4A 2ADAA 4R7WA 1XWYA 3URQA 4KEUA 4KETA 3F4CA 4XAFA 3IARA 4I6VA 2HPMA 3EGJA 2E25A 2AQVA 1EJWC 3HTWA 5HMFA 4H9VA 3RHGA 3N2CA 4KEVA 3LGDA 2WJEA 3A3XA 3IRSA 4C65A 3BE7A 1UIOA 1NDZA 3OQEA 2GWGA 3MTWA 3ORWA 4LALA 1O5RA 4R85A 2HBVA 4B92A 3IPWA 4C6DA 1WXYA 4GY7A 4BY3A 4ICMA 2HNHA 2E1WA 3URBA 2P53A 2BB0A 3K2GA 1FWEC 4EPBC 3IJ6A 2EG6A 4AQLA 4EPEC 4RZBA 2RAGA 4XD3A 1V7AA 2O4MA 4IFRA 1FWFC 2GSEA 1A5LC 1V77A 4R88A 1K6WA 1FWDC 1P6CA 5HMEA 3TN4A 4C6NA 5FSEC 3CS2A 1NDYA 4OFCA 4C6IA 1JGMA 2QVNA 1PSCA 4LANA 1K70A 4PCNA 1BF6A 1YBQB 4RE0A 1M7JA 2VUNA 2XIOA 3AU6A 4LAOA 3SO7A 3LU2A 2AQOA 3B0YA 4GBDA 4DLMA 4ERAA 4GC3A 3LS9A 3D6NA 3PANA 1R9ZA 3K4WA 1ITQA 4NG3A 4DZIA 1I0BA 3GIQA 2YB1A 3TN5A 3LSBA 3WYZA 1FWGC 2GOKA 4HK6A 4QSFA 1J6OA 4H01A 1EJTC 4GOAA 1E9ZB 3E38A 1EYWA 3GU9A 3URAA 4EP8C 1R9XA 3GU1A 2AMXA 2WM1A 3OOQA 3GU2A 1K1DA 4RDVA 3KM8A 3UF9A 3T81A 3HPAA
chains in the Genus database with same CATH superfamily
4HYRA 3U3HA 1FHUA 3SURA 3V5FA 1ZB5A 2WVSA 1BAGA 3RMJA 5LSMA 3O6DA 4FOJA 4W9TA 2AAAA 4M7TA 3REQA 1RVGA 3S2JA 1XLFA 2J27A 1EJVC 4LUJA 4PE8A 3SRFA 1OINA 1U5JA 3WLLA 1XYFA 2X42A 2F38A 3ZWSA 5AC7A 1V02E 1H63A 4GO8A 4M0XA 3L4ZA 1ALDA 2WNWA 1HX0A 1TZZA 4RPPA 3Q94A 1SFTA 5TBOA 3WQFA 3D0CA 4IG2A 5HK4A 2GZXA 1VLIA 2XIIA 1EDTA 1VHCA 4TX9A 4MY1A 2CERA 4LCRA 1IF2A 5CZ0A 2Y7DA 1EX1A 3DFTA 4RXGA 2C1IA 4KWUA 5J8LA 4WOQA 3G1AA 1KLZA 3MANA 3IACA 1JDEA 1BVNP 3G24A 4J3WA 1YDVA 4HHPA 4HKPA 3UWUA 1FA2A 4US6A 3VU2A 4GNVA 2HDJA 2QCHA 4F66A 4X2PA 1YKWA 2PWVA 1UROA 2NUXA 4JNZA 3PNZA 1UA3A 4QS6A 2JK2A 4GIRA 1RQBA 4C90A 3VI2A 2UV8G 4F48A 3W0KA 2OYLA 3JVAA 4WKFA 3RPDA 3PBMA 1M7OA 3H4WA 4Z1CA 4R53A 3GNXA 2UWFA 2IW0A 3W7DA 4GFIA 2DZVA 5LNVA 1SO4A 2YDQA 3OGSA 1IEXA 4PL2A 2ZZ3A 2NXIA 1GQJA 1XLKA 5HMDA 4LVBA 1T8QA 2QDEA 4RE3A 3EPMA 1XINA 1A80A 2PGRA 4ACZA 1FVPA 3FS2A 1SJBA 4G7EB 3P74A 3PBYA 3W1LA 2YFOA 1NSJA 1H5YA 1RJQA 2P1FA 3S9YA 4AWTA 3W75A 2C6QA 3QC0A 1OK6A 4DO6A 4IIBA 3SCOA 3SQMA 3VIPA 2HK1A 3E6EA 3EB4A 4BA0A 4PMZA 5KZEA 3H6OA 1C90A 1UWAA 3MSDA 3WNOA 3JUGA 3UWVA 3GAYA 2QV4A 3WQ4A 3WLSA 5AC8A 2YYTA 2E9BA 1MVYA 1SFJA 1UBPC 2TSYA 4W85A 1E51A 3STEA 5CJNA 2X8RA 2V8ZA 1EX5A 2YCIX 1PKYA 5HJXA 5DXXA 4KWSA 4S3JA 2NQJA 5E0KA 3BAIA 3BLDA 4KMQA 1DXFA 4E3VA 1HVXA 2IMRA 2R1NA 5DN1A 5JU6A 4JIQA 3KTSA 1YXYA 3ALFA 4FLQA 1FH7A 2XISA 4O18A 3W26A 3Q67A 4MJ2A 3VA8A 1TPWA 2GJNA 1JPKA 3GW0A 3N6HA 2GJLA 1NWSA 3OPSA 1DVJA 2X1UA 1CXHA 4WZHA 3REQB 3RR4A 2QYGA 4DJFC 5G5IA 1XBXA 2G5WA 5CG0A 2Y70A 3C0SA 3RGTA 5C9WA 4XSMA 2FTPA 3RF9A 3GC5A 3G77A 4RDZA 3W3OA 1OGGA 3VIHA 1EF2A 5I3GA 3QF0A 3QR3A 3FJNA 1XLHA 4CCZA 4AMCA 4NXSA 4OHQA 4JDBA 3WJWA 5LIWX 4AWEA 4FI4A 3EWZA 3R43A 4CQDA 1X38A 1NAL1 2V2CA 5C9XA 2GGHA 2ZZ7A 3WNMA 5JQ9A 5HJYA 3PP7A 1I0DA 4A8NA 4NY2A 1HXJA 3WQGA 4XAZA 4A3RA 5G4WA 1MQQA 1UKTA 2J62A 3SRHA 5AKQA 2ZUVA 3OGVA 4G7FA 1QHZA 5TQLA 4FMVA 2E7FA 2X1IA 3ITGA 2QCNA 4HU3A 3DG6A 4NZ1A 5AZ0A 3CZ8A 3JW7A 3WMCA 2J7FA 1EB3A 1QK0A 2GJPA 2EF9A 4BI7A 1D7FA 4PH6A 2BX7A 2REQA 3B9EA 1KFEA 4GY1A 3KVJA 3P5YA 1F3EA 1E73M 4GABA 3BMVA 1QK2A 3GH4A 3M07A 2WZTA 3PTDA 4AWUA 1HL9A 4QG9A 2HPMA 3APGA 5AZ1A 3HGJA 3IUIA 1BLIA 1TELA 2WLZA 4K37A 1J0ZA 4GGBA 4U31A 1ZLPA 5HNRA 3SRKA 4HD5A 4LALA 3OEXA 2DW7A 2EXOA 3ZR4A 4BQ2A 1MO0A 1DWFM 2OYKA 1M41A 2BB0A 1LQ0A 3K1DA 1XUUA 1IWPA 2RAGA 3WG6A 4XD3A 1P48A 2BHUA 1TPDA 2YKKA 5CAHA 1S38A 1TJ1A 1QI2A 5CC5A 4JY9A 4C6NA 2HE8A 2OLHA 1SYTA 3WO8A 1TWIA 2VX6A 1YHTA 4OUEA 2QMJA 2ZA3A 2DFAA 1BYDA 1KW1A 2DSZA 4HHLA 4IMFA 3BVJA 4GC3A 4O28A 1ITQA 1JPIA 1PZ3A 3LSBA 2A6NA 3R11A 4L7ZA 8XIMA 1J6OA 1Q6OA 3AO0A 3CIXA 3PM6A 4H7CA 3URAA 1B31A 4EP8C 3GU1A 2Y0FA 3GXMA 1AMKA 3CO8A 1W3HA 1YTDA 1K1DA 2ZXDA 3B40A 3KM8A 4YHGA 4C1LA 1O6IA 3NQFA 3I6RA 3IS4A 2VUYA 2PDKA 1JXKA 2CPUA 4DUOA 3MB9A 1SVDA 2WHKA 2OZ0A 1TPB1 4ORMA 4R7JA 4AXKA 4HCLA 1TPUA 1Q8AA 4LUIA 1CW2A 1X7IA 4GQ0A 4YTQA 2X7WA 4IP7A 3PUEA 2PWUA 1V0NA 2FB2A 3NL2A 4UQEA 2ZC8A 3ITCA 2DSKA 4DZAA 3S0CA 3PZGA 3CHDA 3GVVA 3LHZA 4GIEA 3I6EA 2OLSA 9RUBA 3IVUA 2PBGA 4PMQA 2ATSA 4Q8TA 4DJED 4Q8UA 2PBOA 3R94A 2PFHA 2NQLA 3FLUA 1W6TA 1TQXA 1B9BA 3S83A 4HZ7A 1Q6GA 3IAQA 3W88A 2ODOA 4CUCA 4UQDA 1A47A 1Q2RA 4UBPC 3BLKA 2YL9A 4WJXA 3UERA 1W1TA 4NAFA 2R8WA 1QHPA 4ZQRA 2AL2A 3L65A 4UOQA 3VYLA 1OZQA 2PF8A 3UA3A 2Z28A 4C6FA 1Z8AA 3K4AA 1ONWA 2BBFA 1NFPA 4P7OA 3WUBA 5HULA 3UVIA 3CYVA 1FWWA 2PB1A 2XFWA 3CM4A 4MIMA 1GPWA 4I90A 1A5KC 1LT7A 3CZJA 3W6YA 1WX0A 1OEPA 1PTGA 4W7UA 3U4AA 1XLBA 3QW4B 3NM3A 1XD0A 5I09A 4AU0A 5I3DA 2J8GA 1XS2A 3NOYA 3ZJ7A 2XH4A 5AHLA 1JGIA 3UY8A 2DVTA 1ZBVA 2CC0A 2A3EA 1QHOA 4Y8FA 4CNOA 2WBGA 3BURA 5KEZA 4LBSA 4EOUA 5D05A 3MHFA 3DXIA 4KGLA 2OO0A 4V28A 4MVAA 5I07A 4H8VA 2WJZA 5D33A 1XLMA 3MWCA 1PXGA 1FTXA 2OX4A 3PJUA 4HMEA 4CEUC 1LL6A 2BFGA 4XD4A 3RUBL 1UH4A 5LYRA 2NUYA 2J79A 4KERA 4XD5A 1FP9A 2Z7KA 3AZTA 4LCQA 3BGAA 2CXGA 5FSDC 1C8QA 3CEPA 3LPFA 3TJIA 3A4JA 3NAVA 3KVLA 4XO7A 4WSKA 2XSXA 2WVUA 1QPKA 3VGEA 2Y88A 3TAKA 3LD5A 4MY8A 3SN4A 1IZJA 4YS1A 4OV4A 1OF6A 4JD4A 1J2WA 1TCDA 1EZWA 4Q6XA 3T78A 5BU9A 4KH2A 2V3FA 2KAUC 3OBAA 2HCVA 2PURA 4QROA 1TRDA 2WMGA 3PPCA 1VPQA 1Z41A 4GYPA 1XIFA 5HAOA 1UWQA 3LENA 3OA5A 3BARA 2OSXA 2Q3RA 4UTUA 3QMRA 4LRSA 1DIEA 1BQCA 4P7LA 5DMMA 2DY3A 1M68A 3VCRA 4S3FA 1FH8A 1O95A 4AZ5A 1VCFA 4AZIA 4O4VA 1KM3A 1OT2A 3TP4A 1H62A 3UZJA 4JTJA 2Z26A 5DCDA 1W3KA 3U7VA 1P0BA 2CKSA 5C9ZA 3BGJA 3RAOA 2EG8A 1AZ1A 3GE7A 2WKGA 3WNPA 1QXLA 2RDWA 1CB7B 2W66A 3DUGA 4XVDA 4IXHA 1P1MA 1WQ5A 1XSKA 1OY0A 3B4UA 1NIUA 1H7RA 3EKGA 4NNCA 3OODA 1Z44A 1B57A 2YA0A 3WLMA 3ITTA 3L4XA 1K7XA 5I02A 1VFSA 1C9DA 1YXDA 3HOJA 1LL7A 3ZWTA 1H60A 4Q33A 4F0MA 4RW3A 3BPWA 5K4XA 1X8CA 3NJ3A 2Y1HA 3I10A 5E93A 1WAUA 1BG4A 1V08A 2B7QA 4MUZA 4QEHA 3VD7A 3MSGA 4LS0A 1PVNA 3WJSA 1EJWC 1K6AA 2WSQA 5LZLA 3BJFA 4A2SA 5KTLA 4HSHA 4HNUA 3LGDA 4QHRA 1W2VA 4RNHA 4JZ5A 4C65A 4MF4A 4S2BA 1OJXA 5EA9A 3MTWA 2HBVA 4I7WA 4YTRA 1VJSA 3SCWA 3VOJA 4NJKA 5A6SA 4AQLA 4X22A 4EPEC 2ZWZA 3L9CA 4P8UA 1AH0A 4IISA 3IJIA 2CLHA 5C55A 2GSEA 1HT6A 3W83A 4RCXA 2WCGA 4MB3A 3OIHA 3WJYA 2WZMA 3DH7A 3SSJA 2ON3A 5GQBA 3S3GA 1AMYA 1T5AA 1B3ZA 1K7EA 1M7JA 1S5MA 2XSBA 3KCLA 2V3DA 3TTOA 4XV0A 4R27A 1KV8A 3WFZA 3FFSA 3TN5A 1ML1A 2QR6A 1XBVA 4JTRA 1IXNA 4HK6A 3N4EA 1ICSA 3BG3A 3EZ4A 3GZAA 1HUVA 1QNRA 4DZ5A 3RFAA 4I3GA 2EPLX 1CXFA 2J7BA 4ZXOA 4QDWA 2WLYA 1GZJA 3RNDA 1VYRA 2I5GA 3A3HA 5BXSA 3SB0A 1Y8BA 2UY3A 4LNCA 1K8YA 3CAKA 1EPVA 3M7SA 2A7RA 2YDSA 3HG5A 3ZXWA 3MKVA 1XH2A 4E8CA 3KZSA 4EWJA 1SSDA 3PZTA 4NQ1A 3GG1A 3HQNA 4FNTA 3SCSA 1Q4NX 5XIAA 1EEXA 2XWEA 3H4GA 4DIAA 1E4MM 3ZR6A 5DXYA 4JFUA 3VMOA 1PDZA 3L21A 1JEZA 1OX5A 4DBSA 3B8SA 3V1HA 2OO6A 4AFYA 2QCLA 3DU0A 4EPDC 2WOQA 3OW1A 4QRNA 1GWJA 1VC4A 3JRKA 1TV8A 3LLFA 4GFSA 4NRSA 1EWDA 1ZPTA 3A12A 1NFGA 3EDEA 1R9YA 3BCFA 1MEWA 3AWNA 4Z2LA 4YHEA 2HV5A 2PDJA 3ISIX 3RG6A 2Z1KA 5C2XA 4DNHA 4CD4A 2CITA 2X30A 1LP6A 2FMNA 2QZRA 3E0FA 3WN6A 4KFNA 2C13A 1XM3A 4H83A 4K8HA 4Y9NA 2PLMA 3NXLA 3W73A 3N9RA 2ZE0A 1XQLA 3GFXA 3LBCA 2V5BA 3NQ2A 4NI3A 4XWUA 3LXBA 2Q71A 4L6OA 1FUYA 1YYAA 2UY2A 2YR1A 3SZ8A 1SPQA 3N9KA 4LF1A 4JTKA 2YPIA 4MZ8A 5LIKX 2ZUUA 3IVSA 4M6PA 2FZ9A 4F4RA 1RK5A 5CLWA 4PTXA 4AIUA 1GZ1A 2ASHA 3BK0A 4ZODA 1LLOA 2BXVA 3RITA 2YA1A 3TXZA 1CENA 4HTYA 5I7GA 1TMLA 5AN7A 1A3XA 4WJ8A 3VD3A 3FXGA 3S9IA 3R0DA 4EANA 3CUGA 3ARYA 3IJ8A 4LOCA 1DTNA 4H7VA 5D03A 3VDGA 3MVTA 4GQQA 3P8IA 3G0XA 4LXFA 5LIXX 1S2TA 1X6LA 2BY0A 3U2EA 3O16A 3II1A 5FL1A 4IF2A 1PCWA 3H23A 5BW6A 4Y9AA 4AG0A 4MNLA 4XB3A 4EWND 3L23A 4HU8A 1H7OA 2BMBA 3DC8A 3S9ZA 2RGMA 5FJPA 3SCRA 3KEHA 3NURA 4DBEA 3FA4A 3N73A 3IGXA 4DN1A 1ISVA 2OWCA 4DJDA 2I17A 3FOKA 3EPNA 1CXEA 2JKAA 2YDAA 1POKA 3GB6A 3UG4A 5B7YA 4HPHA 5A6JA 4FA3A 3SSZA 2QJIA 4AX6A 2GQ8A 1XIBA 5FJIA 4OWGA 5CPTA 1A5NC 3WIJA 4HU4A 5I3FA 1V02A 1UASA 3LK6A 1QBAA 4TIMA 3HV8A 4IPJA 3ZS4A 3O0KA 4US5D 2V0TA 2V67A 4MOZA 4TV6A 4TTUA 2ABBA 2VXNA 3EA3A 3H2EA 1UR4A 4FHAA 1E55A 3R13A 3VX1A 2DUAA 3BCJA 2GSJA 3FAWA 1TX0A 1TZ7A 1N82A 4FIRA 1TO3A 4GI8A 3N2MA 2ZX8A 2ZRWA 1OVDA 3DEQA 3P84A 3SY5A 1ZALA 3T09A 4ZR8A 4JQAA 1H11A 4DBWA 4V15A 4C6QA 3W87A 2HK0A 2YZRA 4RDWA 3WFLA 1ZJHA 4DJEA 2PODA 3CUFA 3RLGA 3DFQA 3N34A 3QHOA 4QG8A 3G3DA 4MFEA 2VFDA 3EX3A 3KCJA 1XRTA 5BOFA 3DOPA 1E1CA 3TROA 1LG1A 4QAIA 1RPKA 4CN4A 1LWIA 1WKFA 2ZUNA 5TNVA 5CCZA 1ZJAA 4MWAD 3H53A 2VDGA 4J1OA 4DPPA 3BG5A 3QV9A 4XUGA 1X98A 1RXOB 4JIEA 4H6RA 2EJ1A 2PZNA 1XFBA 3MUZ1 5IXEA 1WCGA 4H8UA 1OC7A 2R1PA 1MUCA 4Y96A 1KGUA 1VLWA 1UBSA 2OR2A 2DZXA 5FCZA 2OTDA 1ITCA 4REQB 1MEIA 3M44A 3UESA 5AHIA 3OBKA 1WPCA 4H9VA 3AUJA 4MJMA 1R6WA 2DH2A 1HKVA 3MI3A 3IRSA 2VZVA 3LCLA 3BAWA 1MDRA 4UMAA 1Y5WA 1UZ4A 1VFHA 1VEMA 3LTYA 2E9LA 1E43A 4UUIA 1DBTA 2GDVA 2EGZA 4Z08A 3C8NA 4DQWA 3SJ3A 3PAJA 2Z2UA 3T0CA 4UTFA 3CAVA 4L80A 3EOSA 4FNPA 3W1NA 3E5PA 2AGTA 3TN4A 2PP1A 3ABXA 2XU2A 2DORA 3SI9A 3IJ7A 2HS6A 4C1NA 1NWRA 4GYJA 1MFVA 3TTQA 3B8WA 1H49A 1FHVA 2G3JA 3NPUA 3MA8A 4PUWA 4DZIA 5A6LA 4IP4A 3GIQA 1XYBA 4IM4A 1H0GA 3TE9A 2VRQA 1X1NA 5FIPA 1EYWA 2IUZA 3M5ZA 4FXFA 3KL0A 4RUBA 3INPA 3GU2A 4O57A 2VYOA 3NEVA 4RE2A 2SFPA 3IJLA 3KL3A 1TV2A 3GVQA 1XFCA 2Z00A 1GG1A 2C19A 1PIGA 5DMNA 3VX0A 4UFHA 4K68A 1XL9A 1AW5A 4DAIA 1UD2A 3O6AA 4U28A 1O66A 5G4HC 2QLYA 4MYAA 5F4XA 3TJLA 3BDKA 4DPQA 3HG2A 1PAMA 4W86A 1Y65A 4F2TA 4ZA0A 3F2DA 2Y89A 3L0KA 3NDYA 1B9ZA 2IKHA 3KBJA 2OWWA 4KESA 2WHMA 5KZ6A 3P3BA 4F9DA 1UMLA 3C3NA 1NEYA 3CV6A 2F6XA 1P6WA 5DRIA 3UR5A 3F1QA 1V3JA 1V93A 3SW6A 3B97A 4IIGA 4C6PA 4FEZA 1I4NA 5CBBA 1T6MA 3C2YA 1E1CB 1D3HA 5AHFA 4LUYA 1DJHA 4O1DA 1UKSA 3MI2A 3CJPA 3SCQA 2YCKX 1NOUA 1QI3A 4JKMA 1M6JA 5JBEA 1GVOA 2CZEA 3R1ZA 3U8GA 3DC0A 4CCCA 3B8IA 4GE8A 3L4UA 1GOIA 3CIVA 1JFXA 3MV11 5A6BA 1K02A 4BF5A 1CPUA 1A0EA 2R1KA 1K4GA 2DP3A 3ECQA 4INFA 3F03K 1P1XA 3WMSA 2XM1A 1CLXA 4FZIA 3EDFA 4AD5A 4NZ4A 2FTYA 4KRTA 1E72M 2D23A 1IYXA 2WO5A 4PC8A 2YB4A 2RJHA 2KX9A 2QCDB 3QGAC 3QOKA 1UZ1A 5C2GA 4P7NA 4H9TA 4WGHA 3IANA 1QI0A 2V2HA 3CLWA 5DCBA 3QFWA 1S5WA 2QF7A 2QXWA 4HPNA 2FVKA 3CAQA 3VUSA 5EBUA 2VZTA 3GVRA 4AYSA 1IZKA 3TW9A 1CI1A 3NR0A 1L2QA 3H22A 1BF2A 1LOQA 3ZJKA 1D8WA 4HZ6A 3AS1A 3G1YA 5I79A 3VMNA 1PBGA 2B0MA 2E6DA 1ICQA 4AW7A 1G5AA 2ESCA 3UYIA 2G41A 3L2IA 3LHTA 3FHQA 4W88A 4F0RA 4TQTA 3NQMA 4PUKA 4LU0A 2BLEA 2F6UA 2G37A 5I78A 3UT0A 1R87A 1V5XA 1IT0A 2Z6JA 4EAMA 3AYTA 4AIBA 4JTDA 4JNMA 5BWFA 1S2UA 5HUPA 2DGAA 5T9BG 2GGIA 3QC3A 2NWRA 5IRPA 1I1WA 1U1UA 3M0KA 4JEJA 1WOBA 3GK0A 2OOFA 4GVFA 3LUTA 3NTYA 4F2BA 4KRUA 4L9YA 2WJDA 2EQDA 3E2SA 3G1FA 4E2DA 1E6XM 4M51A 3MUY1 4IMCA 2TAAA 1TJRA 2BP1A 1GCYA 4MYXA 3UG8A 1QW7A 3THQA 2J77A 3LNPA 6REQA 2ONEA 1CXLA 2XGBA 1UQYA 5IBXA 1AFSA 2VFIA 2Q09A 4UXDA 2P76A 1CGXA 4F0KA 3HGOA 3A13A 3CZGA 4YVVA 1TWDA 1YDYA 2FMOA 1K3UA 1I60A 3BW3A 3PBUA 5H8UA 3W81A 5M5DA 3M0YA 2DT0A 3N04A 1W91A 2DVXA 4BEUA 3WDJA 1XCWA 3KP0A 5FEPA 3QRHA 2C14A 1WA3A 1DHKA 1UOZA 4RXFA 4N9DA 4D6CA 2YL6A 4XAFA 3EGJA 3XISA 2Y24A 2Y63A 2XIJA 3VILA 3BH4A 4DJFA 8XIAA 4LVDA 5I23A 3NQEA 1CTNA 2VEGA 2YXGA 4KFPA 1O5RA 3MSYA 4UFJA 4B92A 1ADSA 4G1NA 5H2ZA 2HNHA 3UZZA 1W1ZA 3VIFA 2GFTA 1FWEC 3HN3A 3EX6A 2OEMA 3A21A 3L5AA 3MW7A 1SW0A 3TAOA 3P60A 1G9HA 2I9EA 1TV3A 2D2OA 3W53A 1FWDC 4UTKA 3CXOA 4OFCA 4Q8NA 4LC8A 1SZNA 1M53A 3SUTA 5LGXA 2O7SA 2GGJA 5D2YA 1W1YA 3VNMA 1YBQB 4YU1A 4B4HA 4NYUA 1OZMA 4GZIA 1XIHA 2PDWA 2PRHA 1YX1A 2XIOA 5AC6A 2V6AA 3OVPA 1J0KA 5A6KA 3N18A 2NX1A 1WZLA 3MBDA 2J75A 3LB0A 1KM2A 4YTTA 3UGRA 4NRRA 1KFWA 1AQMA 1KR0A 2VFGA 5DBUA 1YDNA 1NY1A 3EA2A 3G0SA 1E0WA 3N19B 3DI0A 4PSRA 1RQEA 3W07A 1J79A 4N9CA 3D47A 1M65A 1W3IA 4S3BA 3EOEA 4IP5A 1BSIA 4M8UA 3TCEA 4N7QA 2H90A 5ABFA 2V5LA 4ICNA 1V0LA 1ZP4A 3W76A 4P8VA 3AMGA 5XINA 3BSHA 5MKGB 3MMTA 3OVGA 5FACA 4IX0A 3RCYA 2PWDA 7A3HA 2ZX6A 3M0IA 4Z2JA 5CC6A 4W87A 2R1LA 2XJ7A 3UPWA 1G6CA 2OQYA 4XTDA 5M17A 1JXJA 4JHOA 1QUMA 1W9PA 1EA0A 3CV2A 4NXKA 4L1GA 4JR5A 2ZXAA 3QYQA 1TJPA 1W8GA 4TTGA 3ITYA 3BOXA 1AW2A 2PUZA 3N6QA 3WK1A 2NT1A 8RUCA 4W5ZA 4EXAA 2Z1SA 2VURA 5F7UA 1E0XA 3VINA 2XSAA 4IICA 5EY5A 3I68A 4MLJA 4LYRA 5FI8A 4JTHA 4CKQA 1QO5A 3H54A 1ITUA 1KTBA 3FYOA 1OFRA 3BLLA 3H21A 2R82A 4DJDC 4XZ9A 2ZYFA 1GJPA 4ZENA 3EKZA 1XKYA 1UB3A 1D9EA 4UTHA 2ZC1A 5FOOA 4QM1A 1F9CA 3VC6A 1UQZA 3PJTA 1XIEA 1OG6A 1F3TA 2NSOA 2A6LA 3SM0A 3QY7A 4P8WA 3W7QA 2PD9A 3FKKA 1GYNA 3QW3A 3DHUA 5KZDA 4V2XA 1GEHA 2Q8XA 3L4TA 2G3FA 2XHYA 5A95A 2J7HA 4UZUA 1Q6LA 3MMWA 4JAWA 2J8FA 3E02A 2VZSA 4PZVA 1WDPA 3VIGA 2JF6A 4W5UA 5EMMA 2VDHA 3DGRA 1VKFA 4U3AA 4OBTA 5AYZA 1GW9A 5A2AA 5CBIA 2E28A 2F84A 2H9AB 4Q7BA 3RM4A 4LV9A 1W8SA 4XZIA 1A5MC 3OZMA 1EGMA 1QVBA 1IIHA 4ZQCA 3MYOA 3VGDA 3B3DA 3DX5A 5IM51 4WEVX 1L0PA 2YGYA 3AHVA 1A5AA 4NYYA 2QDGA 3BAYA 2VZUA 3IJQA 2PGWA 4M29A 3UA4A 3WBAA 4PUNA 4PBFA 1TREA 3LXAA 2ISSA 1VCVA 2YA2A 1Q6CA 1BRLA 4U33A 1E9IA 4ZO7A 1VBUA 2GUYA 2RDXA 5CJMA 4JTQA 1TTPA 3W2LA 4FOUA 4I5XA 1VD6A 2X2GA 4ZEPA 3QVQA 2NQZA 4H19A 1Q6DA 5D09A 4RPQA 3RX3A 2QDHA 2YL5A 2WK2A 3DFOA 5CJ5A 3PPFA 4H9MA 1DV7A 1EJSC 2WMKA 1IXPA 1M1BA 4IFOA 2WWDA 5E6ZA 2QQ6A 1T0OA 1RY0A 1ZU8A 3MUIA 5AY7A 3P5ZA 2EHHA 3E2RA 3UZWA 1YIXA 5IOBA 3TOYA 3TZNA 3WQ8A 1AQ0A 3TYDA 4Q8VA 3U7BA 1H09A 3M0MA 3M6DA 4ZGYA 3TR9A 3BUVA 3HV9A 2GVJA 1FDJA 1XGDA 4OECA 1EJXC 3M64A 1N8WA 3GZ3A 4F0SA 4R7OA 1QOQA 2GQAA 3B9NA 3ZVHB 1LWHA 1RALA 5I24A 1XYZA 1UHVA 3FJ6A 2G97A 4PTWA 3LYEA 1S39A 3ATYA 3PNUA 2CLKA 3ALGA 1QWGA 1S5VA 3CPRA 1Q85A 1TWWA 4Z1DA 1XICA 3COTA 1JJKA 1Q66A 1TQJA 3T4WA 1IR1A 1UD4A 1P0EA 4WHBA 1E40A 1FHDA 4Q7IA 3V7PA 4AMAA 4L65A 1ENUA 3T0AA 1V6TA 5ABHA 3AU2A 3M46A 2G0WA 5KETA 5DT7A 2YCLB 1MW3A 1S1PA 3CAWA 3IIVA 3FVMA 3L2MA 4KWWA 2PTDA 4GO9A 3EXRA 3VIJA 3TU9A 2EEXA 3N2CA 1EDQA 3G6LA 1TYGA 1RVKA 4HYVA 3T4CA 2NT0A 3HFYA 2NXGA 3KUMA 3B04A 3NFUA 2IKGA 3NQAA 1E4NA 2VQTA 2UY5A 1GZGA 3W1AA 1LBMA 1OC6A 1UMYA 4L9ZA 3W01A 1DJXA 2JBMA 3WEMA 1TTIA 4IHCA 4PMRA 2XTKA 3L5MA 3W74A 1VJZA 1FWFC 4UTTA 5HA7A 2WC4A 1OCJA 2OT0A 4LC6A 1XHGA 3LOTA 5HWMA 3KRZA 3DFSA 1JQVA 4ZOAA 3AI0A 5C2CA 4P8XA 3AU6A 5F2GA 2BV9A 1JCYA 2AQOA 1S2AA 4IGSA 3VGHA 3LS9A 3PANA 3GDMA 5K3VA 1OYAA 1JI2A 3W7GA 3ZSSA 3PHAA 1TPFA 4H6KA 2VC6A 3RJYA 5T26A 2R24A 2PDCA 1XIDA 1RD5A 1S2WA 1C8VA 1E9ZB 3P8JA 2DSWA 4CCEA 1VH7A 4GI6A 5H8PA 2WM1A 1S5TA 4RZ4A 4YYCA 1YLVA 3FJ4A 4QJ3B 3S2NA 1VEPA 3W82A 4O12A 2R94A 1ZRQA 1F61A 4WJEA 2PP0A 1MXSA 2PDGA 4FX8A 3U57A 1BD0A 1CLVA 4JYEA 1PIFA 4I7UA 3EWYA 5F1VA 4JTCA 3OYXA 1GQIA 4WY0B 2O4QA 1PL9A 3OIXA 1UD6A 5BCAA 2AMGA 3BLFA 3WF3A 1W5PA 1DWAM 1C8XA 4HMCA 3M0JA 4NZ3A 5AOUA 3KOXA 1H7WA 2DT3A 1JUBA 1FCQA 3LHWA 1E5NA 3HPZA 1XLIA 3R5EA 4PMYA 4XD6A 1PYMA 3H2FA 1OBAA 1Z48A 3UJEA 4IH3A 1VCGA 1OADA 2WQPA 4PTVA 2W67A 2INZA 3PZ9A 4IMGA 3VNKA 4O19A 4NSBA 3WLIA 3P61A 3WQ5A 1VBJA 4U2ZA 3C2OA 3MPGA 3S8HA 2EPMX 4FX6M 1ZQ5A 4WKHA 4YVXA 1K9TA 1XG3A 2ZXBA 3MUAA 2VI0A 1LWJA 1FHLA 2FGZA 4I8DA 1V3HA 1HKKA 2WCSA 1E5JA 5FF7A 5LNRA 2VRKA 1WBHA 1U5VA 3LSCA 2Y6ZA 3MHGA 2Q02A 1VS1A 3T42A 4QX4A 5IDZA 1VPYA 1B0IA 5AB3A 4O1BA 3KVKA 2WNNA 1Z7AA 1UWRA 3ZLHA 2VT0A 1G01A 1LROA 1ZFJA 4C6LA 1OFAA 4H8HA 4HP5A 3APTA 2WXDM 3CV1A 4O4WA 5H1WA 3GTNA 5D9OA 3M47A 1YEYA 2OGJA 4IMEA 2FB3A 1E6SM 1XIIA 3QZAA 1LRQA 2BVTA 3AZSA 4CCDA 5CSSA 3UJRA 1KFCA 1JAKA 3THCA 5D02A 2WC3A 2Z6IA 3EMCA 5I03A 3WEOA 5K4ZA 4ZFCA 4Q8MA 4GJ1A 1H50A 2Y7EA 5FEWA 2QJJA 5TF0A 2D69A 2BXZA 1BSLA 1UH2A 1Z3NA 1FCVA 1U1HA 3DDMA 1ELSA 3H24A 3PSWA 1BG9A 3PZMA 1ZHAA 2VKZG 5JVLA 4HOWA 2FDMA 1UG6A 2RDTA 1DWJM 2P3ZA 3WUFA 2FZDA 3T9PA 1TWSA 5D30A 1JPMA 1JL8A 3A3WA 3WNKA 3ANVA 1B1YA 3SBFA 2OXNA 1AODA 2L5HA 1JUKA 1FY6A 2LLEA 1JQXA 3O8AA 3WF2A 1W37A 4DX3A 4XIAA 2FKPA 2I16A 1Q6EA 1YPFA 1H3GA 3UCDA 5D2TA 1UZDA 2YW3A 2GJXB 5BMXA 2Y61A 4HMDA 3TN6A 2P0IA 4O10A 3VNIA 3VOHA 5C0QA 4DI9A 4E4UA 1UW9A 1W31A 4C1NB 4BWLC 4UZSA 3JZEA 3GIYA 3SN1A 4MKSA 4OV9A 4UB9A 3UVAA 5EU9A 3KBVA 4QJ1A 4NI8A 4TOQA 1KC7A 1DJGA 3R0KA 3WQDA 1PCKA 3LQLA 4BQ5A 3ARPA 1TV4A 5JUVA 5CKSA 1QU4A 1MWOA 1ZCOA 4K3ZA 4KCWA 1TUFA 2D73A 2NX9A 4PUDA 4C6KA 4EVZA 3UR2A 4JTFA 2VEKA 4X0NA 5CZSA 1DJZA 1ISZA 4J5NA 3HPXA 2ZZ4A 2XPKA 2OT1A 4TVUA 3N3TA 3W70A 3VKJA 1JF5A 3A9IA 3W2MA 3W37A 5A8GA 4ZO6A 1YNYA 4IGMA 3KBWA 2OGYA 1VFMA 3P93A 3ZT6A 2XGIA 2WBKA 2O9RA 3MDUA 2BVWA 2ADAA 3M1ZA 2OEKA 1K8CA 1JDDA 2E5CA 2Y8UA 4NX5A 3DFNA 2VOMA 3PUOA 4OZOA 4RNJA 1BPLB 3V18A 1WKEA 4KCTA 3OVRA 7TIMA 4I9MA 3LXCA 3G1HA 4AB4A 3Q58A 2INEA 2OMAA 4QNWA 3WLRA 1KKRA 2IQTA 1JD7A 4EKJA 7ODCA 3SIZA 3APYA 4BHYA 2G3NA 3CL8A 7PTDA 2GYIA 2P88A 4AIEA 3UPBA 4B9YA 4IIEA 4QLKA 3EWXA 1A5LC 3B06A 1P6CA 5HMEA 1U5HA 2HWGA 3ZYZA 3W7NA 1WDRA 1QDSA 1TRIA 4JIPA 1JZ5A 3JR2A 2W62A 1G1YA 5GNXA 4YVPA 3PWAA 1HJXA 1HJWA 1W5QA 3A4WA 3UNTA 4ERAA 4GBDA 5G4EA 3IIOA 5FJUA 1B3YA 2A85A 3G6MA 2R91A 2NQ9A 2CHRA 3W71A 3CQIA 3WLHA 4ZB2A 1JVNA 2AMXA 1VHNA 3KOYA 3T44A 1UH3A 4AHQA 1VBGA 1WDQA 2WV8A 1SO3A 3T81A 2WPBA 4GY0A 2XYLA 4GI9A 5B80A 3RR1A 2CBIA 4AD4A 2CBJA 4HA4A 3GVWA 3C61A 4QQ3A 1XYLA 1I9CB 2V2DA 2C3ZA 3RM9A 3L67A 2GJXA 3QYSA 3WZ0E 1NWUA 2HQAA 5EL1A 1Q7ZA 2ZVRA 3NSMA 2FZNA 2NQHA 3OHIA 1B3OA 1VBRA 1E9LA 3UXLA 5C7VA 2ACSA 3AC0A 3ELFA 5DANA 4WR3A 2QJNA 4HK5A 3AIWA 1LORA 1S2VA 3GH5A 1DE5A 1MRQA 1JNDA 1LLZA 3WDQA 4E8DA 1PO9A 2B4GA 1UWUA 4LNYA 2V38A 4C6OA 4YWSA 5A94A 1SMAA 3WCZA 2H8XA 4DZHA 2VEMA 3UWEA 3TFCA 5CZTA 1TJ0A 2Z24A 4NIRA 4TX8A 3A9BA 1FWHC 3FX4A 4AHPA 3W22A 3MV01 1PV8A 1R3RA 4X60A 1CXIA 3WQEA 4DNMA 5REQA 1A5BA 5GJPA 3C52A 3FSUA 1NFBA 3T6CA 3TIMA 2Z2BA 2IPFA 4LWWA 3MP4A 2EAWA 3TNOA 1PB0A 2CZFA 4UCFA 1W17A 3AALA 1R46A 4MB5A 3M0VA 3FEMA 4NJHA 2GUBA 1YRRA 2I5QA 1KBJA 1V6WA 2J74A 2X41A 3R12A 3V4BA 3V16A 1W2PA 4W8LA 4J40A 1DTUA 3TA6A 2BWGA 3NVTA 1ZAIA 1AJ2A 1KBBA 1H0IA 4PTDA 4PSPA 1F8IA 2VTFA 1US2A 3EX1A 3MZ2A 2C15A 3LMZA 3PTMA 2GQ3A 2UBPC 3R7MA 4GUJA 3WLPA 5E09A 3W00A 1FBAA 2HRWA 4JFTA 2VENA 1ONRA 5FL0A 4ERGA 4BJHA 4AZHA 3ARWA 4HGXA 2A3HA 1OCNA 2FPTA 3OG2A 1UCWA 1UOKA 5IDIA 3TONA 4AZ6A 3GY1A 2XIMA 2GSHA 3Q4DA 3NQCA 3FXYA 2ZRZA 4OT7A 1Z32X 4M1BA 4HN8A 4JY8A 1KV5A 4LYQA 4LJ3A 5G1YA 2V82A 4R9OA 4IFKA 3TC7A 5ABFB 2DZBA 3GBDA 4ZOBA 1PUDA 3N25A 5KZMA 2FPVA 4GKLA 3FHAA 3CWNA 3UU0A 3GAKA 4WLCA 2FYMA 4I7VA 1UPPA 3ARTA 1UKQA 2XGZA 1UPMB 4PGLA 3D3FA 3ZLFA 4X0VA 2W61A 2E8ZA 2D3NA 3H2NA 3PAOA 4Y6GA 3LX9A 4W89A 4UWMA 1T40A 4LGXA 3IK4A 1ITXA 1ZJBA 1A49A 2D1ZA 4WK9A 2PTXA 1GKPA 3QV7A 1PE1A 1BGGA 3AIRA 2CCRA 3QLLA 1DWIM 1XH1A 3AFBA 2NVAA 3GX9A 4BWLA 1OFPA 2DZAA 2WCAA 2VFFA 2O55A 4H6QA 3TV8A 1RPXA 4G6CA 1GQNA 3KXQA 5K9CA 1IXQA 3WK2A 4ZB0A 3OZYA 3ONCA 4JTAA 4A29A 1DEDA 3U2ZA 3NSNA 2BDQA 3ZMRA 4WCJA 3K5XA 1TE1A 1R47A 2O9OA 5FKYA 3OYZA 4MKNA 2TRSA 2H8ZA 1WO2A 4BKNA 4NZFA 2BY3A 5E0FA 4QG6A 2D0HA 2WMJA 4FXJA 2QUTA 2ZKMX 6A3HA 4U4MA 4HPJA 2FLIA 5HBFA 3NO3A 2HMCA 3R79A 4E38A 2P3EA 5EGRA 1MI3A 3IJDA 3STFA 1JZ3A 4IJBA 4LUSA 3ZIZA 4HK7A 4KWVA 4LF2A 1QOPA 3F5KA 2P0OA 4C6JA 2WHLA 4NUWA 4RX0A 3TEVA 5D2XA 4D6IA 3B0XA 3VAVA 3G3MA 4B91A 4AF0B 5D9MA 3CMJA 3CQHA 4GBUA 5GVJA 4F2UA 4I9AA 1XDLA 1XLEA 2DUXA 1J4EA 3NZQA 5B7ZA 1DYSA 1QBBA 1V8EA 2DJXA 4C91A 4L6HA 4KEVA 3A3XA 1DKWA 2J24A 1DQWA 3ORWA 4POCA 4KPLA 1QT1A 4M24A 3IPWA 4IJCA 4LVAA 3OZOA 4GY7A 3GSMA 3O06A 2WSYA 2DPEA 1JDCA 3L7RA 2EPKX 4UTWC 4EXQA 3EXSA 3ZVIA 1MZRA 3VIMA 5D4YA 4IFRA 2HTMA 5E1QA 4TR9A 5D04C 3HPFA 2QNEA 4KCVA 4HNOA 3GHRA 3GS6A 3R25A 4AD3A 1JCJA 3KW3A 1V6XA 4PUUA 3R0UA 2DUZA 4S38A 1V6UA 3DYMA 1VENA 4EK7A 2INFA 3W1TA 3TQ0A 3ARSA 1F07A 1R9ZA 3IAPA 4O1FA 4MPQA 3C56A 1R3TA 2YW4A 4K1WA 4PFHA 4DUVA 4BFAA 3HZ3A 1XC6A 4F9JA 1C3FA 3LDVA 3W4RA 2J78A 4CU6A 1VZWA 3OOQA 4AC1X 1E56A 5CPMA 4PYSA 3P80A 1XSJA 5SWUA 4O52A 3DAQA 1HJSA 2WSPA 1BYBA 2O0TA 1LLWA 2Y5JA 4GNJA 1KGWA 2FFIA 1Z89A 3PB2A 1F7BA 1QMLA 4IPNB 3RU6A 1FWIC 3N17A 1ZAJA 1KQYA 1HJUA 1U83A 3BG9A 1XI3A 5CPSA 4I9TA 4IGHA 1BRLB 4DWDA 5BU6A 4JN7A 2B81A 1V79A 3GDTA 1BKHA 3RPTA 4WIWA 2ISWA 1O60A 4RZ6A 1ZL1A 3WD2A 1J93A 3HMCA 3WQ6A 1E1EA 1B90A 4GYFA 1OFDA 5MHBA 1EA9C 5M3WA 4UQCA 1MXGA 3TUUA 3VUPA 2ZQ0A 2WKJA 4JHZA 1Q13A 3OLEA 4ZQMA 1CWYA 3BSGA 3E49A 4L4LA 1NH6A 4GXMA 2CETA 2I7GA 1TTQA 4YIWA 3RO8A 3FGCB 4O0QA 2A2IA 4YYFA 4QISA 2NX3A 4GCAA 6REQB 3MYPA 3BZJA 3C86A 4H6EA 3EWCA 3UW6A 3M0XA 2VGIA 4DELA 3ES7A 5DY3A 3TYAA 1V6VA 3TMLA 2JE8A 4ERIA 5A3HA 1T96A 3STGA 5AYBA 5EMUA 1XYMA 3KAOA 3L5LA 1AQFA 5REQB 3URNA 1KGXA 2Z27A 2V69A 1YMYA 4IQEA 3R8RA 1XC4A 1O5KA 4D6DA 2VEIA 3WLNA 4HN4A 3I7SA 4Y2WA 4ADUA 1LOLA 4UTTC 2OELA 2J7DA 3W28A 5HUOA 5CG7A 4W93A 4UOZA 1IEIA 3EMQA 5HNNA 5LHFA 4XK2A 2AL1A 2ZADA 4RV3A 3GBEA 3QSTA 3FEQA 2DSVA 2OKOA 4IG2B 4QE5A 1F74A 4D1JA 1Q45A 1HTIA 3C0LA 4GCXA 1HW6A 1N55A 1M3UA 1O1HA 1R86A 2Y8VA 1H41A 3B8DA 1DIKA 4JX5A 1WDSA 2Z0IA 1M03A 5FJRA 3SEPA 1JYWA 1KNWA 1ZBCA 6XIMA 1H7XA 4LQ1A 2D2JA 1W3NA 1SMDA 1Q6FA 3LV5A 1F4HA 2GUUA 3WF0A 1ECEA 4UFMA 4KIEA 3UWZA 2VWSA 1W9UA 5I3KA 2MUCA 3EB3A 3WFAA 5BMWA 2QCDA 3MJMA 3VZZA 3VNLA 2VR4A 3U2CA 3N12A 3UR7A 5D9NA 1N8IA 4ZO8A 4N6EA 4ICCX 1KFLA 2VEFA 3QFEA 4KQNA 4CNUA 1Q6RA 4ATLA 1A4LA 1L9WA 3CMGA 3QY6A 5D32A 4Y9MA 1AL8A 4G7EA 3RYSA 4RZ5A 1L6YA 3TZFA 2GWNA 3BC9A 1G4PA 3CL6A 3F4NA 4ACZB 4A8IA 2R9RA 1J18A 5FESA 1CB2A 5FA5A 3BO9A 1SZFA 2DT1A 5T91A 4YTUA 3TVAA 4XBSA 3C8FA 4E2VA 1TJ2A 5EMKA 3OA3A 4B5UA 4DWSB 1SSGA 1KRAC 3KLLA 2DZTA 1I75A 2C18A 4S3AA 4MM1A 3VIIA 1E9YB 1P0KA 3KOZA 2OODA 4Q4SA 2ISDA 1DJWA 4LV4A 5T9CE 3WL0A 3GRIA 2QPSA 4FR1A 5JH2A 1V6YA 1UR9A 4M5PA 1RLDA 1ADOA 4QIUA 3GH7A 3IV3A 3FW6A 2EPHA 3LY0A 3B05A 1R3QA 3WMBA 2CEQA 4DO7A 1Q7MA 4WY0A 3BJTA 1AD4A 4YXGA 3CC1A 1DP0A 1CEOA 3TCSA 1WKYA 1PPIA 1I8JA 4QLLA 1HKWA 1F3WA 2ANUA 4CQ8A 3KX6A 2QGHA 4BS0A 3CZEA 1MW1A 3EWBX 3LLXA 3RLVA 2GL5A 4LCSA 3H8AA 3BLEA 4PFMA 3M7WA 4DUXA 3EOOA 1BKSA 3DG3A 3BLOA 4UFKA 4FLSA 1JRCA 4KEUA 2ZA2A 2CHOA 2E25A 4OKDA 3TH6A 1P5BA 3QR1A 3DKJA 4HB7A 3BANA 1LT8A 3LRMA 3C0JA 4MDPA 3MZNA 1N8FA 4GMEA 3RRXA 3BE7A 2CLMA 2HSAA 3IGUA 4UCGA 1EHAA 4KW2A 3WD0A 2PDXA 4MWAC 4AAJA 4R85A 1EO5A 2NSXA 4JHMA 4ICMA 1W1PA 4OOUA 2E1WA 3BAJA 1WNOA 5CSUA 1G4TA 3K2GA 1VIZA 2VVSA 3N2OA 1UJPA 4K36A 3LHUA 5HANA 1A0CA 3AJ7A 5CC3A 3UNDA 3IUDA 4GYKA 3VNZA 1JCMP 2VD9A 3EEZA 4ZQPA 1L6WA 5BOOA 3SRDA 2FHBA 1BF6A 1LUCB 2QCFA 4AEEA 1W9VA 4W4QA 1P7TB 1GT8A 1OYBA 1JPHA 4GHRA 3POCA 5CXPA 1JZ8A 4ENLA 4B3KA 2QVHA 4R5EA 4IQDA 3NIYA 1KO0A 3CLMA 4H01A 1EP3A 1EJTC 3UCCA 3C5QA 2HXUA 2B7NA 3WKZA 3CUHA 5ABGA 1ICPA 3GDBA 5EMJA 1GJUA 4U5KA 2DZPA 3DG7A 1B4KA 2YXXA 3UF9A 2X0HA 2PC8A 1W3TA 2OWXA 1JNEA 1J96A 4O0KA 1SZGA 2C8NA 1IQ8A 3KWXA 5DBTA 1K9FA 3D46A 4O13A 3H2CA 1TV7A 4PUEA 3TQPA 3HMJG 4JICA 4JIHA 1PHQA 4GD0A 1KXQA 3MUCA 5A6TC 1KFJA 1GOKA 2NZLA 4IUGA 4E0CA 3CQJA 3TTEA 3GNNA 5DMYA 3CYJA 1RUSA 3GDLA 3FSTA 4WDTA 1ZP3A 4LUTB 3A4XA 3VGBA 2GDUA 3PFMA 4S39A 4M6QA 4Q8OA 3LGGA 2PU0A 2Z1BA 3W29A 5D8ZA 3QY8A 3WLTA 3KFTA 2XIQA 3VMPA 4Q6JA 3GR8A 3NG3A 5FF4A 2P8BA 3Q37A 4HJFA 3KDNA 1HFBA 3EWWA 3GFZA 3W1PA 4MLRA 3NWRA 3VOCA 3EPOA 3LNMA 1SU5A 1EHNA 3ITXA 1U33A 2UY4A 3VDHA 1W9XA 3QR0A 2OLAA 2Z29A 5GNZA 1V7YA 3EOLA 3GR7A 1TTJA 2VP8A 2J7EA 3OLGA 2O7QA 2CBUA 1R30A 1J2BA 4V1XA 4D6EA 3LLDA 2HZGA 1PZ2A 3RXZA 3WLKX 4NZJA 4WQ6A 2XN1A 5EFDA 4ZFMA 4AD0A 1GOWA 3ITVA 1MNSA 3HU7A 1CECA 1ZENA 1P0NA 3AIUA 3GXPA 2CIPA 4M1RA 2J9ZA 4MB1A 4Z0SA 2X40A 1OX6A 1RA0A 3MMDA 3KRSA 3OQ8A 4WOZA 4URIA 3BZGA 1BVWA 2V63A 1E6ZA 4DB7A 1A3HA 4TX6A 1V3MA 3WF1A 2PDFA 4EX4A 4GIYA 4D8AA 3N15A 4ROPA 2PEVA 3TYEA 2Z4GA 2DIKA 2AGKA 5CLTA 3S2MA 1MQRA 2X1TA 3KOWA 1G69A 4DLFA 2WZIA 3W6LA 1P6BA 3V0UA 2Z7GA 4YMZA 3HGSA 3TKFA 5C5YA 4QCFA 4QAWA 3PZQA 3ARXA 4PBGA 1BTMA 2OSYA 4YLWA 4I5RA 5J04A 4HIBA 2C0AA 1TIMA 3EA1A 4JQ1A 2A0NA 1ZNNA 4RW5A 1QCWA 1M04A 1NELA 1VYSX 1JCLA 1F2JA 5CZJA 1OG0A 2JEQA 3GG0A 4MAZA 4B16A 1KTCA 3ARQA 3K30A 4ZOEA 1VRXA 3N3MA 5I77A 1SR0A 4YPJA 3OP2A 2IPWA 1CGWA 5JBFA 4GGHA 1S46A 4ECLA 4Q22A 3ARVA 3G8EA 2ZUMA 2VX5A 4FX7A 4QTGA 3MP3A 2O9PA 5CGTA 3QN3A 1B3WA 4AZBA 1ZBWA 1UD8A 1HGWA 2C0HA 3KRBA 1GHSA 3A22A 3ZO9A 1G7UA 1GG0A 1K8ZA 2J9XA 2OVLA 5AHEA 1EZ2A 2ZZ5A 1BYCA 3ZJ6A 4E5TA 4CNNA 4FPSA 4IX2A 3HO8A 1DORA 4LTSA 1PX8A 4HA0A 5IFPA 3VD5A 3G0UA 1KM1A 3GG7A 3P2VA 1HJVA 1PHWA 4DJDD 1XIGA 5EFFA 1FXPA 4NAFB 5EBAA 3I3BA 3UWYA 3GYCA 1F8MA 2DQXA 1OABA 2OYMA 1ODUA 2RKXA 2YCEA 2FQIA 4AEFA 3QKZA 4NKCA 5JXQA 4O17A 3K8MA 4JTSA 3UPMA 3NL6A 3P0XA 1XYCA 3P7YA 5DCEA 1SW7A 4W7WA 3S5YA 2E8YA 4GXPA 4QEEA 2V5CA 4GX8A 4KWOA 1AD1A 1LBLA 2DSUA 1NP2A 3IIZA 3N2TA 5AVNA 4FS9A 3RMEA 4EF9A 3G2GA 3WNNA 4WF7A 4PBEA 1ME8A 3UG5A 1PTAA 2D22A 1FH9A 3ZT5A 4AEOA 3QV8A 3GWQA 1XLGA 5G2IA 3NCOA 2X09A 2VGGA 2QCGA 1IV8A 1A53A 1EIBA 2C1GA 1QW9A 3PPHA 3IGHX 2D20A 1FWSA 3FY1A 5BWAA 3T2PA 1TB3A 1GQKA 2VC9A 5A8MA 1XIJA 4FLRA 2ZUSA 5JH1A 4QGCA 1S3TC 3STPA 2WKLA 4BI5A 3S2LA 3AMCA 5TAOA 3URQA 4UR7A 4I6VA 3U0HA 3H7VA 3HIJA 2AQVA 4K38A 2DU2A 4OQVA 3HTWA 4O8RA 4NHVA 4NT0A 2OZ8A 3KS5A 3V36A 1VR6A 2OU4A 4O54A 1NQ6A 1XISA 3DFPA 1UIOA 2GWGA 3GLCA 2CLEA 1XDMA 3HPSA 2E0PA 1E6RA 1EGZA 3W1RA 2PWFA 3NUKA 4JTEA 3CWHA 3QMSA 4XZMX 3OLIA 4TVDA 1C7TA 4QR6A 3CHEA 3TYBA 4CN6A 3KVMA 3I3EA 2NV1A 3W2JA 2CHNA 3KS6A 4R88A 3ZVHA 3CS2A 2PDBA 3DHPA 1E3ZA 3VIOA 2QVNA 3S46A 4DRSA 4QDPA 1W54A 3G1VA 4HMNA 1UUQA 3W7KA 1E6PA 1LRNA 1YTEA 4UNIA 3T07A 3SO7A 4M82A 3USBA 1A3WA 4NG3A 4AYGA 4ZTXA 1FWGC 1XCXA 1LOSA 4QSFA 2OOGA 1NOFA 2J4GA 4GOAA 2A1YA 9CGTA 1G7VA 1R3VA 3ITLA 2HROA 3WSUA 3NQGA 4FNUA 4AY7A 3SUUA 3WNLA 4MB4A 3N4AA 1YNPA 2OG9A 5E0CA 4H4IA 2AQWA 1BXNA 1JYNA 1J0IA 4GLEA 3VOFA 4OTKA 3OBEA 3PZVA 1F6KA 4P2VA 5A6MA 1XUZA 1QR7A 3TYCA 1OX4A 2PDIA 4TXEA 3VABA 3N2BA 2RJGA 3OB8A 4JNYA 5K7JA 1J0YA 2ICSA 2OPJA 4GX9A 3KZPA 3M0HA 3DHDA 2V3GA 4BEQA 4QLJA 2D2HA 4F0HA 3W86A 4IL2A 3BWWA 3LQGA 1U2YA 2BGSA 4DAFA 4IQLA 5BYWA 3S6DA 4D8ZA 3UJ2A 3LN3A 2I1OA 3UXKA 4LSBA 1PDYA 4E2OA 2VC5A 3MC5A 3T0BA 2H9AA 4EE9A 3F4DA 3F5LA 4ACYA 3NZRA 5EMLA 3TJXA 4OVXA 1R0MA 2BHYA 1GORA 1EUNA 1EJUC 2HJPA 3BAKA 3LPPA 3EWUA 1QNPA 4JQ3A 4H7ZA 1RY8A 1Q5MA 2W3ZA 3B9OA 5G2WA 2PDLA 2E4TA 2TYSA 1GVIA 1EQCA 2PLKA 3EB2A 3OTRA 3RRAA 5CQ1A 3CGTA 3WBEA 4RJEA 4AIOA 3MSRA 1SUXA 4JL1A 4D1IA 1SFLA 5E70A 4V33A 5CC7A 3DGBA 2OX1A 3KRUA 3UG3A 1NJJA 1V51A 2HVNA 2PCQA 1B54A 3VGGA 4RE4A 4M56A 1GNXA 2PI6A 3SCTA 1EEPA 1TPH1 4JIIX 4HZ8A 3P6LA 3A5VA 4EACA 1NP0A 5JIWA 4U3CA 3QQ0A 2QUVA 4LAMA 1A5CA 2ZDRA 4B4FA 1CBGA 3V75A 4JEQA 3FKRA 8CGTA 3BV7A 3S1UA 1MEHA 2JEPA 5C7HA 1DL3A 3UP8A 3CB8A 3UYCA 2ACQA 4JOMA 3NNTA 2QMKA 3NYZA 3EKLA 5KMYA 4CN1A 4ZB5A 5HNTA 4WXZA 1GOQA 2ATMA 4Z2GA 5FF3A 6ALDA 4LAKA 4LX4A 5ENLA 2PE4A 4J2MA 3UXDA 4C6MA 4AC7C 2W79A 2PTYA 4QJ5B 3VM5A 4GUIA 4GZEA 2DDXA 4NJGA 4E3TA 5EKYA 4UFLA 1QWKA 3AYSA 3NGFA 4MNKA 2CU0A 1R2SA 2HPIA 3MMUA 4DYJA 3TOPA 3QBUA 4DEFA 1CYGA 4AHOA 3AYVA 5CGMA 1EC7A 3A47A 3L68A 4F8XA 1PKNA 4C5YA 2VR2A 3AIBA 4AZGA 5LA0A 2QJMA 1DWHM 3MKCA 3CUZA 4ZL1A 3QHMA 3ANUA 4QSHA 1DXIA 5BZAA 2A3BA 4QCEA 3LG3A 5T8GA 2NV2A 1V0KA 3AISA 1LZOA 4KKXA 2XUCA 5JBDA 4I9JA 4S1FA 1H51A 1QFEA 3T55A 5D2VA 1TZ9A 3CT7A 3FNDA 5FJJA 1FWTA 1GVEA 2VWTA 3OGRA 1XLLA 4WKAA 3W7MA 1AUSL 4FNSA 1XXXA 4WGXA 3WLJA 3P81A 2V5DA 1XX1A 2V30A 3W84A 3MO7A 4ZZ9A 4GVHA 1Y5XA 3TLLA 2RHGA 1JCTA 1W5NA 3AHXA 4BF7A 1F76A 5CSRA 1CT5A 6CGTA 1OSEA 4XUYA 3KCOA 1B4EA 1HKJA 4A22A 3V5OA 1PKMA 2EPNA 1E6QM 3ZLGA 5IHRA 5BOEA 5AC4A 2DQWA 1XYAA 4D8LA 4N4PA 2ZFAA 3VDAA 1AJZA 4DWSD 3OU8A 3J7HA 5E9XA 2XH7A 4UQAA 5E5CA 3S5NA 5D8WA 3WQOA 1I2NA 1GK8A 2QV5A 4HCHA 1KRMA 1J11A 3VKAA 3CH9A 4HSNA 1OX4B 5AVHA 4N2YA 1B3VA 4US5A 5MKGA 3B8VA 5FF2A 4K2SA 3RHGA 4JS3A 4MJZA 1O5QA 1PX3A 2YLAA 2WJEA 2NW0A 1RCXB 1JCNA 4FF5A 4S3KA 4JFSA 2QIWA 2V68A 4HNLA 4MGGA 4HZMA 2PRMA 4AZ7A 1LUCA 3VFLA 1AA1B 3IJ6A 4EXBA 3U5YA 4RZBA 1X7FA 3EXTA 1DJNA 3NM1A 2PZ0A 1ODZA 1RD6A 7REQA 4J4KA 3LCGA 3AROA 2WVVA 3GD6A 2E9MA 3QHNA 2YDRA 2XWDA 1CNVA 4W8AA 4XO6A 3TFXA 3L66A 3O6YX 4LAOA 3RJXA 3LU2A 4DLMA 3LGEA 3ABOA 3A6OA 2E77A 3LERA 2ZE3A 3AZRA 1H7NA 4GH3A 3GNOA 4HHHA 4A2RA 2J9YA 2DZWA 3ME3A 2GOKA 1V03A 3LHYA 3QM3A 4LT9A 3GQYA 5E9AA 3LV6A 2FJUB 4MWAA 4ZE4A 3PTQA 4GUFA 2YYUA 6ENLA 2YX0A 1UP2A 4J9JA 3WUEA 1A0DA 1ZGDA 4L9XA 2P5NA 4HVXA 1WXZA 2E5DA 2GDQA 3PY2A 1XRVA 2VGFA 2FZMA 4NNBA 3T7VA 4DYKA 4H9YA 4ML9A 1R7AA 1K7FA 3HQ1A 1GGOA 4NZ5A 2WVTA 4C60A 3TYUA 1XBZA 1EP1A 1O12A 1L6GA 3KTXA 3WJZA 4GPNA 2I56A 1QNSA 1RBLA 1MXDA 3SFWA 4J3XA 3W72A 4I5UA 4IOTA 5DY2A 1RA5A 3O3RA 3BQ6A 4UQBA 2R6OA 4MJ4A 3HJZA 3AHTA 4LS2A 2XZ9A 5GPRA 4DXKA 1VP5A 1VYPX 1EIXA 2IKJA 1YXCA 2PWHA 2NLYA 4CEXC 2W9MA 2F6KA 1N7KA 3DBNA 4MMWA 2G50A 5ABEA 3AHZA 3B0VC 1FWAC 4XSLA 1HF6A 2PP3A 2A3LA 3LBOA 5U7SA 2QDDA 1UWTA 1CGTA 2WMFA 5AECA 4PTNA 1VPXA 5GJNA 8A3HA 2BGNE 2E67A 4B5WA 4CQBA 2PDPA 5DO8A 1TPC1 4L56A 4QDMA 4N9EA 4FNRA 4DM1A 1MUWA 2R1MA 3V0TA 4QITA 4D6JA 1NWTA 4V27A 2DW6A 1RHCA 2XVLA 5AHNA 3GHTA 5FD0A 5FJOA 1F05A 4EAYA 1HQTA 3MP5A 2CZDA 3MWAA 1T7LA 2OEJA 3E0WA 2DZUA 3VDCA 3CUJA 3AJXA 1XV8A 3AMKA 4HTBA 2PGEA 3VC5A 3MO4A 3A23A 5AFDA 4G9PA 4PR4A 2BOEX 2AL2B 3P67A 3TA9A 1KM5A 3EDJA 5LGZA 4NAEB 4V1YA 3SY1A 4BCEA 1VAHA 4UR8A 5I5RA 3CK5A 2VZOA 3GKFA 3E2VA 1FWBC 4FP1A 2I9UA 1FWCC 3AXXA 1J5SA 1VJIA 1DJIA 4HA1A 1UP0A 3P0WA 2BSLA 3KBNA 1US0A 4YN5A 4HT3A 4GKTA 4B5NA 1HJQA 3LZ5A 1REQA 5CBJA 1AL7A 1MUMA 3QOMA 3CIWA 4GJIA 3CT2A 4J27A 5M2FX 1DJQA 1EH9A 1UR0A 4LAUA 1PEZA 3C4UA 4B3ZA 4LB4A 1L6SA 1T8XA 3B8UA 4FNQA 1YW1A 5A1AA 1OCBA 2UZ9A 3NQ7A 2PD5A 1Q7QA 4WSHA 2P50A 3NDZA 5CH9A 4Y9PA 2YCJA 5HWJA 4H9UA 3F2BA 3GR4A 4UOJA 5CAKA 3LEPA 4XKYB 2WMIB 2PPGA 3O6CA 3DKLA 2Y7FA 1B2YA 1QRQA 1PX4A 1ONXA 2GK1B 1V4YA 4O53A 4ONVA 2WW5A 3THDA 3H55A 5E6YA 1KBKA 5D2WA 5DQPA 5D37A 4DI8A 2TMDA 3PPGA 3W7OA 4JQ2A 4GG9A 4GNKB 3QQWA 4LVFA 4Z17A 2BTMA 3EBVA 7TAAA 2FIQA 2DZSA 5JIPA 1GHRA 1EKOA 1KQZA 1GTHA 4ZSTA 4Z42C 1JUEA 1FKXA 4HHMA 2GPTA 3R8GA 2PGFA 1EBGA 3GHUA 3ONBA 3AMDA 3WD1A 3R58A 1HZYA 3WQWA 4X61A 3MU7A 3ZQ9A 2A21A 2WHJA 4H2HA 2CNCA 4GA8A 4KRZA 1LDCA 1V3LA 4GVIA 4IMAA 3EAUA 3ID7A 1HP4A 3TR2A 1PZ0A 1RZMA 3VDBA 1M5WA 1I6NA 5CZKA 3IV8A 1XH0A 1KM4A 1GVSA 3U4FA 3ARRA 3UFYA 4XQ6A 2CW6A 1V0MA 4PCPA 2IKIA 5H91A 3OO2A 4LEFA 2BOFX 1JYXA 4BK9A 3S6TA 2C79A 2H6RA 3WDIA 3WLQA 4REQA 2FGLA 3N11A 3LA4A 1XBYA 3R2GA 4TU1A 3SDOA 1KM0A 5AC5A 3FVDA 4Y8EA 1UP3A 2AAMA 3IEBA 4A8RA 4Q8PA 2JQXA 4WRHA 1A5UA 1UR1A 1NF0A 1NDZA 3W1QA 4D72A 1IWAA 4GI4A 3WH8A 2XFFA 2PDHA 1WXYA 2J8TA 1P7TA 3AYRA 4AY1A 3URBA 1MFUA 2O92A 1KM6A 2EG6A 3L0NA 3TSMA 3FYYA 4LY4A 4IIFA 4N4QA 1BWVA 2O4MA 4DF0A 4ZOCA 4C6IA 4PULA 1PSCA 4LPCA 3CQ0A 2W92A 4PCNA 1RQHA 4JTLA 3B0YA 2QW5A 3R4IA 4Z1AA 1A5SA 3M0ZA 3PG9A 2PWGA 2XH2A 4PODA 3VVGA 1K4HA 4CD8A 5HPOA 1ZTVA 2WVVB 4WUIA 4B5TA 1UYQA 5I00A 2ZRYA 3ARUA 4JX6A 1Q2SA 3LBMA 2E3ZA 1FX6A 3NL3A 5I2UA 4KCUA 4HNVA 1QI5A 4ILSA 1JDAA 4LAZA 4QE4A 4K7YA 1C7SA 4ML4A 1KA9F 1W1IE 1Z9AA 4H04A 3DFHA 2QIIA 1Y0EA 5A8NA 3PWGA 1W32A 3POHA 1R7OA 3ITOA 1TVLA 2XZ7A 4M80A 4ATWA 4S23A 1VFTA 3VZYA 1E0TA 4IPIA 2W6RA 3EX2A 1IE7C 3GDRA 4GH1A 1EC9A 3LI1A 3RIKA 2GVLA 4F79A 3SCNA 4ZCWA 4BI6A 2B7OA 4JPGA 2WNZA 4BQ4A 1LRTA 2OCZA 3GTFA 2Y4SA 3GG8A 2D3LA 1XSIA 4ZXLA 2JIEA 3DENA 3YPIA 4EF8A 3BJSA 3W7RA 4E4FA 3WLOA 1UIPA 4EPKA 4CQAA 1HIZA 1TIWA 2PSNA 5LIYX 1SGJA 1B5TA 2BNJA 3N13A 4HNNA 3HBLA 2EKGA 3F5JA 2EBNA 3PVFA 2CFFA 4UTJA 1IGSA 5U4NA 1E3XA 2FHCA 4C6EA 3IIPA 3UD6A 1JRBA 4RK8A 2J88A 4MAVA 4P7RA 1RJRA 4WSJA 1YPXA 1JZ7A 3WQVA 3S1GA 2Z2AA 1RJPA 3CTTA 4UNLA 1ISWA 4HOZA 3G1DA 3O9NA 3RM8A 2VX7A 3H2OA 1WKDA 3F4VA 5DRCA 5LKYA 2A79A 3NQVA 4CD7A 2QF8A 4TMCA 1KTNA 3FDKA 1XLJA 3IJ9A 4Q7NA 1HO1A 3QPEA 5IFTA 3ZOAA 3GIPA 1KLYA 3ZFHA 4E8GA 1V3KA 3F2CA 1PWMA 3NPXA 5C6MA 2PDUA 4H8NA 3QXBA 4R9XA 2XM2A 3BQ5A 1EXBA 1K8XA 3ANYA 3GKAA 4O1CA 2J47A 3EOUA 5AYIA 2ISVA 4HBKA 1PZ1A 2OZTA 4BF9A 3BCDA 2VC7A 3ABZA 2OZ3A 3BOFA 4M19A 3UBPC 3PUDA 1X39A 3H70A 4ASTA 1H61A 4DWSC 3MDWA 5FEZA 1EGVA 3GUGA 1JYVA 3RLHA 2YZ5A 3U2OA 1Q63A 2FDSA 4ZBCA 2ACRA 4JTGA 2GVYA 3B0UX 1MNZA 3AXHA 1XJBA 4LFYA 4WVXA 3L2LA 2J13A 2FTWA 3E9AA 1YNQA 1YTKA 3MQTA 3GM8A 3E5BA 4F3HA 1GUVA 4LS1A 1TCMA 3DN5A 4S3GA 3IVTA 2ZTKA 4O11A 3T08A 1Z69A 1TPVA 2XINA 4WDWA 3RPMA 5HOSA 1F4AA 4GXWA 3XIMA 2BHZA 2J6XA 5BROA 4PEKA 1VFFA 1Z42A 4JIRA 2X0SA 2PWEA 2Y8KA 4YWIA 3SUWA 2WANA 1KXVA 4B3LA 2WSRA 3HB9A 4IIDA 4ORIA 1X97A 2C71A 4UTWA 3VE7A 1EDGA 2YFNA 3H7RA 3KLKA 4K8GA 3JU2A 4GJJA 1JFHA 1TMQA 4W8BA 1TMHA 3W6MA 3C2VA 3D3AA 3HGRA 1K77A 4JTUA 1DE6A 4HPXA 5LHEA 1OQFA 1YBQA 3UCQA 2PS2A 2ZX7A 3E12A 2A3CA 4N42A 1O68A 4OGZA 1VF8A 3WDRA 3UQNA 2ZA1A 2VCCA 1POJA 7REQB 1K9EA 4MWAB 5DFAA 4M7SA 3PJXA 2QHAA 4Y90A 4GVGA 3BOLA 4AD1A 1EJRC 1B30A 3W85A 2VO5A 3GFYA 3WMLA 3AXKA 3VPLA 4A6GA 2GJRA 2W0UA 4C6BA 3A4AA 3WK0A 5IHSA 4JX4A 1W9BM 3K1GA 4HJWA 1FWRA 4PCSA 2QEZA 5F2IA 2JFEX 2ZRUA 3GNDA 3DHFA 2FVMA 1CLKA 2ZX9A 1E4IA 3R8HA 3KP1A 1RK6A 3O63A 3NXFA 3U48A 1E4LA 4K39A 3BL3A 3AIEA 3U9IA 1TR9A 1CGYA 5HQEA 4L64A 3MI6A 3QH2A 1I2RA 1OT1A 2HS8A 3VM7A 5DLCA 4MWAE 1G94A 1EYEA 3LPOA 2E68A 2GGGA 4CGTA 2VFEA 1Q4WA 1HKMA 5ECUA 3FDGA 3GW3A 4A3YA 3CV7A 4PUJA 3LCFA 3MCOA 3SFKA 4MDOA 4QE1A 4HU0A 5GNYA 3I4KA 3M43A 4W84A 3F4CA 1R3WA 4AZCA 1IEQA 1EL3A 4AF0A 1XPGA 4YNGA 5HATA 2PCEA 4XISA 3FJLA 1GONA 3PZOA 3LCXA 1RBAA 5I0DA 3UEQA 1U30A 4NJJA 2NXHA 4XTIA 3M16A 1L8PA 1SO5A 4LUSB 3UXIA 4P61A 1C29A 4H3DA 3KWSA 3NO1A 1F6PA 2XVPA 3D5HA 4PCFA 3TC6A 4KGJA 1B3XA 1KWKA 3W27A 1V7AA 4JN8A 1NARA 5I06A 4DJEC 3LZ3A 4FIQA 1KFKA 1KXHA 3TW6A 4MNJA 3NO5A 5DF0A 1K6WA 2ACUA 5FSEC 1TUXA 2G95A 3RCNA 1UWIA 4M6VA 1JGMA 2J25A 3GXDA 4LANA 1XR2A 3CU2A 3PZIA 4C7DA 1S3HA 2IXUA 4L1WA 3SECA 4DBDA 3CH0A 1L6FA 4ZVJA 5D9PA 1WZKA 3P82A 4DBUA 2IQDA 3TSBA 1V3IA 1FWNA 1J01A 3FIGA 1D8CA 5AYXA 1FRBA 1R3SA 2KZHA 1ZS2A 2YB1A 1FCBA 2G4FA 2POZA 3O15A 4G8TA 1UR3M 3E38A 4FLOA 1HGYA 1R9XA 1JI1A 3TJ4A 1TPEA 3T8QA 3B9DA 1MQPA 1SR9A 1ZY9A 4J35A 5BXRA 3OLDA 1C91A 1TWZA 5A6BD 2E6AA 1RV8A 3T2QA 3SY8A 3IUHA 3GUWA 1VFOA 3WQCA 4PRRA 1Y5VA 1UUOA 2CKRA 2AKZA 1WP6A 2W5FA 3GTXA 3CUIA 4HNCA 2VMFA 3V5CA 4Q4MA 2WZHA 2Y5SA 4X9SA 3QJAA 4MTVA 3LTSA 4DHGA 2BASA 2RFGA 3CEUA 2V5KA 2D2GA 3HQPA 3W7CA 4QFUA 4FXSA 4KEZA 5BRBA 4X2RA 1I2OA 3GXIA 1KRBC 1GYLA 3QV6A 2REQB 1QNOA 1W3LA 3AAMA 4MHBA 3SUSA 4JFVA 4JYDA 1KFBA 2G3MA 5CGQA 2C16A 1OM0A 1DOSA 1CCWB 2O9TA 2ZZ2A 2FZ8A 4Q4PA 1GVYA 1GTEA 2F2KA 1QTWA 1A4MA 3CUXA 4ROQA 2HNEA 3KOFA 4H9ZA 2ALDA 3L12A 1OK4A 4A4AA 4ADSA 3EX4A 2FH8A 2WQDA 3I3DA 4PMNA 4PMUA 3WL1A 3NPVA 3ERPA 1MDLA 1GPFA 1RP8A 4A05A 4E4PA 2H3DA 2W63A 3FA5A 4O15A 3UY7A 1LQ2A 1Y7VA 5D38A 2CZVA 4MKVA 1P43A 3QEZA 1G4EA 2C91A 3BICA 4PMVA 2EJAA 3I65A 4A35A 2QAPA 3PULA 3GHSA 4LRTA 4XBKA 3M6YA 1KKOA 2FGBA 2BVYA 2OQLA 3TK7A 3TQVA 3M5VA 4X9YA 2BS9A 1HN1A 1EBHA 4E2BA 4QJ4B 1BWKA 4O14A 1CX9A 1JULA 4AVFA 3NEHA 2ZOXA 4WXYA 1FWJC 1HP5A 3HM7A 4JXCA 4NU7A 1H1ZA 2NWSA 4CD6A 3NZGA 3MJYA 4JN6A 4O50A 1GOOA 3C2EA 4FSAA 1R8LA 4D9PA 1PIIA 4C7GA 5AYYA 3LTPA 4PRTA 2BY2A 2Q3OA 4Z1BA 1GOXA 1HL8A 5BRPA 3S6OA 4K7VA 3XINA 5J5RA 2EG7A 4TV5A 3BV4A 5TD4A 1TV5A 1XG4A 4G56A 1S1RA 2PDQA 3OJGA 4GC4A 3SGGA 4DXVA 1J5TA 4AXNA 3M5YA 1XKJA 4N9BA 2WWCA 1RLCL 4PA8A 4TMBA 3SCPA 4C6CA 1M7XA 3PBGA 3I7QA 2YLLA 5KITA 3T40A 3PSVA 1WZAA 3QZEA 3UETA 2ZRXA 3KL5A 5CPQA 2NV9A 1BFNA 4Z0JA 2E40A 4XZWA 3G22A 1EF3A 1JF6A 2CLPA 3M9YA 2CLIA 4PMXA 5G1TA 1ESWA 4G5DA 2Q6ZA 3TYZA 1TE6A 2BGQA 3A5FA 4LYPA 3S1VA 3WDPP 1F5ZA 4BQ3A 4A3QA 4J7RA 3I7RA 3GC4A 2XFYA 3VGFA 4NASA 3M5XA 3G18A 3NQ6A 4Q4KA 6TIMA 4BZYA 3H12A 4IUOA 1YPIA 2VEPA 4HNTA 2EKCA 3THUA 4DJFD 2VCAA 2DT2A 3AS3A 4DO4A 4PEEA 3WH6A 2G8ZA 4WX2A 4XX6A 1DWGM 2BOGX 5FAJA 1LQAA 2NUWA 3STCA 3BMXA 1NDVA 1I1XA 3TN3A 4DVOA 5LA1A 4FAMA 2MANA 3VKBA 2XVKA 2BG5A 1ISXA 1J12A 2WM0A 3PWIA 3VNDA 2TODA 1WB0A 2J66A 3ATZA 4GINA 4ZTYA 1X6UA 5K2ZA 2E6FA 3WJXA 2Z25A 5AHMA 3SR7A 3W7LA 3AIQA 4LUTA 3GO2A 4HYWA 4RV8A 5H6HA 4PB5A 4QBXA 6PTDA 3UR8A 3ES8A 2VRJA 1D3GA 2ALRA 2QPXA 4CQ9A 4ES4A 5A8QA 1BWLA 3VIKA 5I6SA 2YBUA 1XWYA 2NVCA 4W7VA 3W1MA 1PS9A 1FDZA 5HMFA 3WELA 1O7AA 1IIGA 5JMUA 1OD0A 2F61A 2CZ5A 4D6GA 5DT5A 3VTRA 4FK9A 3OQEA 2Y2WA 2ZCGA 4AWSA 3USZA 4RLIA 4C6DA 1UR2A 3DI1A 4Z2HA 2F7FA 1WE5A 3F4WA 3IRDA 2P53A 3DFYA 4EPBC 4IT1A 3S5ZA 4JL2A 1RSCA 3OHMB 2VD8A 1E70M 3W25A 3RLUA 4Q4OA 4WD0A 3NA8A 3KHJA 3PN8A 4I8YA 3AOFA 3ZSTA 3E1F1 3VFCA 4IPPA 1PTDA 1OFQA 1W1B1 2IS7A 1UC4A 3PS7A 3GXNA 2BZNA 2QUUA 1J10A 3T0TA 2VUNA 1SJAA 5F1UA 3LCIA 1BTCA 1W5MA 3K8LA 1F3XA 1UKPA 5F2MA 3S2CA 3WYZA 4AVOA 1Q65A 1PYFA 3O05A 3WX7A 3ABSA 1UUMA 1XP3A 2ZIDA 2A5HA 1EPXA 1KCKA 4XG1A 3LMYA 2PAJA 1TSIA 4G2DA 4NL1A 2X1SA 3OG3A 1VFUA 1XGEA 4RKAA 1ZZMA 4N6FA 5G1MA 3NYDA 3V1PA 1BYAA 3NL5A 1A5OC 4EIVA 1IR2A 1R5YA 4R3UA 3WDHA 3VOIA 1CGUA 4Y9OA 3EEGA 2OFJA 3TX9A 1VBHA 3W7PA 4UTMA 1DQUA 3F7JA 5CEWA 4U2YA 3ZR5A 1QASA 1W9DM 1PWLA 3NQ8A 4JTIA 4B2DA 3LI0A 3O2LA 4B5VA 4XAGA 4GYPC 4H1ZA 1XGZA 3K4DA 5EYWA 3PUGA 4CD5A 1DPMA 5LXXA 1UKOA 4QS5A 2W27A 3S5SA 1WV2A 2V5JA 4U10A 2WYSA 1LCOA 5BNKA 2NQ5A 1E1FA 3L4VA 5XIMA 4JKLA 3AS2A 4WDUA 4GQRA 1W0MA 1XIMA 1IT7A 3T1GA 1JAEA 1L8NA 1JCXA 3P14A 5M03A 1NOWA 2JIWA 4QNEA 2GGEA 1HG3A 2C1HA 2RDUA 2VL4A 4ZO9A 1ONEA 3TLQA 3NGJA 4QXIA 1VRDA 1UD3A 2JKEA 3I4EA 1JIBA 1GKRA 3T2OA 3NZPA 1AH3A 5F4SA 1XD1A 1O4UA 1EWEA 3IK2A 1F73A 4PRWA 3W9ZA 3VO0A 4J3SA 4R34A 4GK8A 3DYPA 4JBRA 1E6NA 3MVIA 4GQGA 1WYIA 5IBXC 2YOCA 2CESA 2YL8A 3JS3A 3FK4A 3KHDA 1AVAA 1P4CA 3ICJA 3ZM8A 3HFTA 3IGSA 2OKTA 3W02A 3S42A 2F9RA 2Y85A 3SADA 2WPGA 1JZ4A 3V35A 1Q6QA 2NVDA 2VM8A 3IWPA 4XKYA 2D0FA 1K9DA 4GUHA 3UXAA 1AG1O 2WJFA 4MZ1A 4OJYA 3GNPA 1KCZA 2XN2A 4Q8QA 4RNIA 5HNUA 2E1DA 1BXBA 3L4YA 4UMBA 1OIFA 5LA2A 3QGKC 3A24A 3P62A 1LTDA 5C9RA 4K6AA 1JR1A 3CO4A 3W7JA 1HKIA 1VQTA 3ZZ1A 3RDKA 2IQ0A 3WH5A 3B0PA 3K8KA 3SQLA 4XZLX 3AUOA 2V9DA 5C70A 3FV9A 5HDRA 4DY1A 2PDYA 2HISA 3CHVA 3NQDA 4J3UA 1F6YA 2Z1VA 3R6IA 3PTKA 4LW7A 2XFRA 4XKMA 4MUPA 1E0VA 2QCMA 4OU1A 1H1NA 1E0UA 3BLIA 4MZYA 3C6CA 3O0FA 5A2BA 2Q8LA 5C54A 2VOTA 2HBXA 1KRCC 1TKKA 2QUMA 1ZJIA 1OYCA 4LVGA 4PB3A 3MBFA 2IPJA 4CLMA 2QCCA 4KT2A 3CNYA 1CXKA 5A2CA 2PU1A 3DECA 4JQ4A 3FA3A 2QJGA 1NU5A 4I6KA 1G0CA 3QZ6A 3ARZA 1WUEA 2HEJA