4RDZA

Crystal structure of vmolac in p64 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
314
Chain Sequence
GMVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Parathion hydrolase
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
total genus 123
structure length 314
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdzA00
1YMYA 2O4MA 3LA4A 4J5NA 3JZEA 3URNA 2VM8A 4YIWA 4EPBC 3NQBA 4C6NA 3URQA 2HBXA 4XAFA 3RCMA 4LCSA 2GWNA 4IQJA 3GU1A 2WJEA 1YBQB 1M65A 3DUGA 4ERIA 4H9YA 4KERA 3MKVA 1W1IE 2I5GA 3IRSA 1V51A 4GY7A 2RAGA 4C6EA 3PBMA 3IJ6A 3N2CA 2GZXA 3LS9A 4HA0A 4C6OA 2VHLA 3B0YA 4QROA 4ZSUA 2QVNA 2I9UA 4IG2A 3URAA 4M51A 1HZYA 3GU2A 3AUOA 4GXWA 4J35A 3MJMA 4RZBA 3NURA 1S3TC 4NP7A 3AU6A 4C6MA 1FWJC 4DI9A 1ITUA 1QW7A 4PCNA 4C65A 3S2MA 2WJFA 1ITQA 2PGRA 4IFKB 4LEFA 2P53A 3FDKA 1RJPA 3GTXA 3DCPA 1KRCC 4B3ZA 4DYKA 3GIPA 4KEZA 1FWGC 5G4HC 3IPWA 3UF9A 4CQDA 3GG7A 4C6CA 3IV8A 1ADDA 5FSDC 4WGXA 4DO7A 4C6FA 1FWHC 4L9XA 3ID7A 4GC3A 3TN5A 3OODA 2R1MA 4PBEA 4Z42C 3BE7A 2HPIA 3MDUA 4B91A 4UBPC 4DI8A 1EYWA 2Z27A 4GBDA 3LNPA 4HK7A 1QXLA 1YNYA 1FKXA 4F0RA 4B90A 4CQBA 1BF6A 2PLMA 1ONXA 4QSFA 4BKNA 3MPGA 2BB0A 1POKA 4NI8A 1RA5A 3GTHA 4LAOA 4XD6A 4LAKA 2ICSA 2XIOA 3E3HA 3GTFA 3ITCA 4IFOA 3UPMA 4GX8A 4KESA 1J6PA 1ONWA 4DZHA 1V77A 1EJSC 3QY6A 2WJDA 3MDWA 1EJVC 4H9MA 1RK6A 2HNHA 2UZ9A 1P1MA 3GU9A 3S2JA 4ICMA 1RJQA 4KQNA 4MUPA 4HJWA 3GUWA 2HQAA 1O12A 3T1GA 5AKQA 3B0XA 1KCXA 2AQVA 1A5MC 3A3WA 3F2CA 4GYFA 2E25A 2YZ5A 3OVGA 4OFCA 3G77A 3UBPC 3WYZA 1NFGA 1UIPA 4ERAA 1KRAC 2AQOA 4XAGA 3RN6A 3QGKC 2FVKA 4KEUA 1GKQA 3CJPA 4H00A 4E3TA 2D2JA 3QY7A 1YBQA 5FSEC 3FEQA 2AMXA 3S2NA 4QRNA 1GKRA 1NDYA 3OQEA 2BGNE 2ANUA 1O5RA 4C6DA 1A5OC 3CS2A 4KEVA 3LY0A 1FWEC 3EWCA 2EG8A 3O7UA 2D2HA 4QS5A 3MVIA 1PB0A 1XRFA 1FWAC 4XAZA 1RK5A 1M68A 4PE8A 2GSEA 3MSRA 4LH8A 1A5LC 4C6JA 1K1DA 4H9TA 4DIAA 4H9ZA 4EPEC 5A6TC 3O0FA 3C86A 1E9ZB 1P6BA 3IACA 5LXXA 3RHGA 4L6DA 1YIXA 2FTYA 3KM8A 4RE0A 4LFYA 3EWDA 3PANA 3LGDA 3IGHX 4IG2B 3RYSA 2Y1HA 4RDZA 1R9XA 2GOKA 4I6VA 1KRBC 2DVUA 1NDWA 4IH3A 1J5SA 4JOMA 3PAOA 1FWCC 4GY0A 3T8LA 3ICJA 1A4MA 2QPXA 3GTIA 4QTGA 1IE7C 2R1LA 2YB4A 4INFA 1V79A 2Z00A 2PUZA 4LCQA 2Z25A 2EG6A 4EP8C 3OU8A 4CQCA 4I6KA 2PGFA 4NG3A 4EPKA 3OOQA 1FKWA 2CZVA 3UR5A 2DVTA 1FWFC 3CAKA 3GRIA 3K2GA 4C6PA 4GY1A 3WMLA 1EJXC 2VC7A 4RDVA 3TN6A 3HPAA 4C6KA 3OJGA 1KRMA 3LSBA 4CEXC 1XGEA 2Z28A 2R1PA 1VFLA 2PAJA 3IARA 1P6CA 3MVTA 4BY3A 4C6BA 4C6IA 3WZ0E 4H01A 3F4DA 1FWDC 1RA0A 2OODA 2ADAA 4TQTA 3EGJA 3HM7A 1FWIC 1PO9A 1FWBC 2Z4GA 2R1NA 1I0DA 1K6WA 4IF2A 3K5XA 4F0SA 3QGAC 1YRRA 3NEHA 1R9ZA 4G7EB 3E0LA 2YXOA 4G2DA 3SO7A 4DNMA 3URBA 2OOFA 2O4QA 4GZ7A 1A5NC 2R1KA 1PTAA 4C5ZA 4EPDC 3AU2A 3ORWA 4IFRA 4DLMA 4CEUC 4C6LA 2UBPC 4WVXA 4B92A 2WM1A 2HBVA 2Z2AA 2FTWA 1NDVA 5HMEA 2ZC1A 3UR2A 1E9YB 4LAMA 4RDYA 4CNUA 4XD3A 4R85A 4IFKA 1UIOA 1POJA 1UMLA 3GIQA 4V1XA 2P50A 4KETA 4LALA 5HMFA 2W9MA 3R0DA 3QY8A 1WXZA 3S2LA 3PNUA 2GWGA 4RDWA 3V7PA 4C6QA 3TN3A 3E74A 1V7AA 4AC7C 2OB3A 3K4WA 4XAYA 2Q09A 1A4LA 3FDGA 2Z2BA 4LANA 1K70A 4KF1A 1I0BA 3A3XA 3D6NA 1XWYA 2Z24A 3T81A 4HK6A 1UBPC 4DLFA 2YB1A 3B40A 3F4CA 4HK5A 4DZIA 2QT3A 4H9XA 3F2DA 2Z26A 1GKPA 4WHBA 2VR2A 2DVXA 2D2GA 5E5CA 4C60A 4XD5A 1NDZA 1R9YA 2IMRA 1RAKA 4R88A 2VC5A 3E0FA 1ZZMA 4ZSTA 3ISIX 3DC8A 3S4TA 1M7JA 2Z29A 3HTWA 1EZ2A 2G3FA 4CNSA 2Z7GA 2HPMA 2EG7A 3TNBA 3TN4A 4PBFA 4PCPA 4H9UA 4H9VA 4KIRA 4UB9A 3LU2A 4IGMA 4AQLA 2QS8A 1EF2A 1EJTC 1EJRC 1XRTA 1JGMA 2OQLA 1WXYA 2OGJA 4D8LA 3LGGA 1A5KC 4C5YA 4GOAA 1EJWC 1EJUC 2F6KA 4BJHA 2FVMA 4J2MA 4V1YA 3E38A 4F0LA 4GK8A 4LCRA 1RJRA 2A3LA 2E1WA 2VUNA 3LSCA 2FFIA 5HMDA 3A4JA 2Q01A 4CNTA 4IGNA 4P5UA 5CH9A 1J79A 3E2VA 4G7EA 2KAUC 1J6OA 3PNZA 3MTWA 4QS6A 1V4YA 1DPMA 4ERGA 1PSCA 3F2BA 3SFWA 4GX9A 4XD4A 4R7WA
chains in the Genus database with same CATH superfamily
4KPLA 2HE5A 1FXPA 1MMFA 2HDJA 4Q3MA 3EWUA 4C6NA 3HG2A 4AWEA 3CMJA 3I6EA 3PUOA 1KV8A 1UC5A 3TYUA 1R0MA 4F66A 2RGMA 4K36A 3H2EA 2C18A 1TTIA 1V0MA 1R47A 2INFA 2YXXA 3DUGA 2XWEA 5AC4A 3HG5A 5D9MA 1DKWA 1LQ2A 1PWMA 1ZJHA 2C91A 3IRSA 5FEPA 2W63A 1CGWA 4PUEA 2DIJA 1J2BA 4FALA 1IT0A 1I2PA 1FHLA 3W27A 4Z2GA 3OGVA 4W85A 4NI3A 3WLMA 1V03A 3ZLGA 3M41A 4Q4OA 4Q33A 3U5YA 4QDMA 4HHLA 2QCFA 4F8XA 4ZMGA 4XIMA 4AHQA 3WIJA 1KRCC 5DXXA 4FF5A 2AOSA 3GIPA 3WH5A 4GZEA 4WKHA 1JCLA 1A47A 4CD6A 5FSDC 1XDMA 3QZAA 4ATLA 2IKHA 2VL4A 4PBEA 3FV9A 1M7XA 2V5DA 2XYLA 3QC0A 3DI0A 7TIMA 3TONA 4ZQNA 5D2YA 2OPJA 5F2LA 5EBAA 2WSPA 3CBWA 3TH6A 4PMYA 3N2BA 4LAOA 2HEJA 2VFDA 3GTFA 4JTCA 1ML1A 4GX8A 5KZ6A 2Z1SA 1NF7A 3K1GA 3V1PA 3WD0A 5JBDA 3UCCA 3LV6A 2Q6ZA 4C7FA 4LPCA 1PL9A 1WA3A 3ZXWA 4GCAA 3VX0A 2XZ7A 4ICMA 3I3BA 1L0PA 4ROPA 1OQFA 4A8IA 2ZZ7A 1W1B1 4WF7A 1EC8A 1EDQA 1PKMA 3U8GA 3A24A 3AXMA 4AD0A 3BG5A 1LRNA 1FH7A 4BQ4A 5I00A 3RLGA 4L4LA 1H5VA 2PTZA 1RP8A 5A94A 3CLMA 1WDQA 4NJJA 4A3RA 3S2NA 1S39A 3VX1A 3NM3A 4L5ZA 3TW6A 4NHVA 5HJLA 1A80A 1QO5A 3ABSA 5DF0A 1K8ZA 2XN0A 1BVWA 2QMKA 3KBNA 3PBVA 3T2OA 3ITXA 4A8LA 4LH8A 1GYLA 5DX7A 3VD7A 3VGGA 1K7FA 4Z1CA 4EPEC 3S6TA 8XIAA 2PRHA 3BW3A 3RHGA 3G18A 2EBNA 4OUIA 2NX9A 3U9IA 3MSGA 2WCSA 3QPEA 4NZ1A 9XIMA 1XS2A 3SCOA 4HZ8A 3W85A 5FJTA 5A8GA 5LXEA 1PHQA 3I3DA 3LRLA 2BY1A 2CFFA 4IH3A 1YXYA 3W01A 6TIMA 3WH8A 4YNGA 2P10A 5HJXA 2O92A 2WLZA 5T9BG 4H2HA 2DH3A 4CNOA 2Z25A 4E4PA 3AZRA 4DWDA 5C2CA 1X6LA 4URIA 4L56A 3GRIA 1VCVA 3HF3A 4U10A 5CC7A 3OHIA 2VXNA 2YDRA 5CSSA 3TN6A 1V6VA 2UWFA 3GNRA 3LCGA 3OJGA 5F7UA 4LUYA 2POTA 3NDOA 3RLHA 3LHUA 4WKFA 1VFLA 1IIHA 3OBKA 2QIIA 3U5UA 3QQ1A 1N8FA 5A6SA 1AD4A 2YA0A 3V3WA 3VU2A 2YDSA 4FR6A 5M5DA 3TTQA 4O15A 3LPPA 6PTDA 1UKTA 3WQWA 3SQSA 3HM7A 3CQIA 1KBJA 4DJFA 4LTSA 9CGTA 4UR9A 3SN4A 3QGAC 3WELA 2DZVA 1SFSA 1B3VA 1EXBA 4B5WA 3LMYA 4HMEA 1EO7A 2OO6A 1SFJA 1ZU8A 3MI6A 4Z1DA 4DJEC 4YVXA 4QX4A 1WZKA 3FJNA 2Y7DA 3TOPA 3R8RA 1OD0A 4B92A 2WZEA 4PA8A 3EDFA 3GYCA 4LUTB 4LAMA 4HU8A 1V02A 4QITA 4AVNA 4IP4A 5HQMA 3CAWA 3W1AA 4UFIA 1PDYA 3GIQA 3HG4A 4KETA 3M5VA 2OT0A 5JH2A 4IP5A 4GFIA 2C0HA 3K13A 3PZIA 1PZ1A 1O94A 2Q09A 3NJ3A 1VYRA 3DU0A 5BXRA 3TMLA 4JR5A 3M07A 2BS9A 1NVMA 1B2YA 3D6NA 5CZSA 2Z24A 2DSVA 2AAAA 5BOOA 1T5AA 3F4CA 4JNZA 5AECA 3I65A 1ITCA 4OZOA 1B9BA 1NEYA 2AGKA 4MZ1A 4ZSTA 3GG1A 1GVFA 1LOLA 1UD4A 3AIQA 3HTWA 1EZ2A 4HHPA 1XIJA 1PZ0A 2PRMA 3QOMA 3LU2A 4IGMA 7ENLA 1GYNA 2OU4A 1PHWA 1Q66A 3VKDA 4AEEA 3DFHA 1SPQA 3MS8A 4M1BA 3VXGA 4E3VA 2OSXA 2AL1A 2JQXA 2V3FA 4LYPA 2FH6A 2IQDA 2ZIDA 3LOTA 1V6YA 4WSKA 3VE9A 3N2OA 3SRKA 1D2KA 1ADSA 3AMDA 4DF0A 1GORA 3M5XA 2JE8A 1L6YA 2E5BA 5LGZA 1XLGA 1HP4A 3QM3A 3ZVHB 1GWJA 1JCMP 2I57A 1ZRQA 2BVYA 5CBBA 3C8NA 2OZ3A 2V5LA 2WO5A 3WL1A 1H0GA 1FUYA 2VP8A 2Y8UA 4NT0A 3VOJA 3DGRA 3EOOA 4K1WA 3KRUA 1N7KA 3UFYA 2VDHA 4UNIA 5LIKX 3S5OA 3PF3A 2G96A 2QUVA 3SY1A 2RDWA 1XQLA 1DJZA 4P7QA 2VFFA 1D7FA 3WSUA 5HPCA 3DOPA 3UWYA 4LYKA 4TV6A 4GABA 3N2CA 5A6LA 1JCTA 1W0MA 2W79A 3MUCA 3TMQA 2NV1A 2E09A 1HZYA 2PWVA 3AUOA 3KUMA 3AU6A 3EMQA 3AIUA 5G2WA 3R2GA 2VEMA 1VH7A 4C65A 3OO2A 4GBUA 3W7GA 4REQB 2YCIX 1J11A 1RJPA 1AUSL 4JQ4A 1LDCA 1Q4NX 2Z1BA 2X1RA 1AODA 4DN1A 1AW5A 2HJPA 3O0KA 4DJEA 3GAKA 3JRKA 3ID7A 3VGHA 4GXPA 4K3ZA 3CNYA 3CHCA 1JFXA 1FVPA 2A3EA 4KFPA 2W3ZA 1Z69A 4FLQA 4M1RA 1QXLA 2GQ3A 3L66A 3LUTA 3PWIA 1R3QA 4Y90A 1XBZA 1PAMA 1S5TA 3VAVA 4OGZA 2VD9A 2BB0A 3RU6A 1UW9A 1GEHA 4QSHA 3TR9A 4G1KA 1MUMA 4D6HA 3KS5A 2QJHA 2WV8A 1V77A 3PZQA 1MO0A 2HNHA 5D9OA 4N4QA 3AAMA 5K4XA 2PDMA 4QR6A 1GTHA 2WQDA 4B9YA 1K6AA 2C16A 4HYVA 3LCHA 3OEXA 1QAPA 4MFEA 3KP0A 1CBGA 1E9LA 1QATA 1ICPA 2F2HA 4OUEA 5JIPA 1J4EA 5C6MA 3FN9A 3IAPA 4S38A 3QY7A 2PBGA 3C61A 3PPFA 3F03K 4NILA 3E6EA 2NQLA 3MHUA 2YYTA 4PUUA 2WHLA 1AQHA 3PBWA 1S2TA 4MWAD 5AOUA 1FWAC 2Q3OA 3PPGA 1A5LC 4C6JA 1WDSA 3CAVA 4H9ZA 2ZUVA 4TVUA 5DMNA 4LVDA 3WH9A 5IRPA 1R5YA 4L6DA 6A3HA 1SW7A 5EMKA 4Z2JA 2FTYA 1PTGA 4O0KA 1MUCA 4IG2B 3A21A 1YYAA 1CNVA 3DESA 1XLLA 1HW6A 1HVQA 2C15A 3GR7A 3EAUA 1QI2A 1P0BA 1MDRA 2H9AB 3A23A 4RNIA 5HOSA 1XLHA 3TWAA 3HMJG 2QDDA 2J8TA 4MY8A 1QOQA 1GZGA 4EAMA 3NSNA 1QCWA 1XFBA 2Y5EA 3L2IA 2Z00A 1BGAA 4ZO6A 3G2GA 3M0VA 1DP0A 1SQ7A 5CKSA 1RZMA 1R87A 1Z3NA 3OOQA 2VRQA 1EXPA 1UUQA 3UR5A 1YXDA 2FGLA 4IQLA 1FHDA 3L0GA 4MHBA 4C6PA 1O95A 1KM0A 3TCEA 3EPMA 2X30A 4J9JA 1BPLB 4DM2A 3EMCA 3K8LA 4MWAC 1OVDA 3MKCA 2GYIA 4H01A 2E40A 4GVHA 3EKLA 2CHRA 2OSWA 2VFEA 4BR1A 3OG3A 3C0QA 5A8OA 3KVKA 4HZ7A 3VKAA 1PX3A 1FFRA 1F3TA 1WZLA 4WOQA 3SO7A 3DN5A 3BAKA 4E5TA 1P48A 1X8CA 4Q8PA 3BGGA 2HV5A 4AFYA 4C6LA 5D04C 5LIWX 4JTKA 2PWFA 4BEUA 3NL3A 3UR2A 4PFHA 4ORMA 1UMYA 3NZQA 3WLSA 2Y8VA 4RNFA 5AHMA 4D8AA 3LM3A 2F84A 4MTVA 4LV4A 4IT1A 4RDWA 2HS6A 1ZP4A 1HT6A 2J77A 2NQ5A 2X1TA 3FDGA 3I3EA 3MSYA 2ZZ6A 1XWYA 4DLFA 1OZMA 3B40A 3S46A 5KZEA 5EYWA 4JHMA 3SADA 3CQKA 2X0SA 1C9WA 4Y6GA 3ARQA 4JTAA 2C14A 3W1MA 5AC8A 3UZWA 4LRSA 3T07A 3TNBA 1QOPA 1WZMA 2OT1A 3S83A 3WMSA 5XINA 3O15A 3TWBA 4JQ3A 2QS8A 2Q71A 3NVTA 2QQ6A 3DKLA 4ZL1A 2B7PA 4RW5A 4QJ3B 4FLOA 4S3CA 5LZLA 3QTPA 2JF7A 5I3IA 4GOAA 1I45A 4BJHA 3AICA 1W5OA 4D72A 4F0LA 1C3FA 1RXOB 5B80A 4XZNX 2E1WA 3E5BA 1ZFJA 1F05A 1OZQA 3TYEA 1AJ0A 3AMGA 3ABQA 3E0WA 1Z32X 3T42A 3NFUA 5CH9A 3GG8A 2VEGA 3FIGA 2YR1A 1XYBA 3CUJA 4JIIX 4MGGA 4IL2A 5LNUA 1OIFA 3IGXA 3GDLA 5C8BB 1JZ2A 4IPNB 3RDKA 1UROA 5AC6A 3S47A 1G4SA 2DW6A 4OBTA 3GBDA 4HU0A 2DT3A 1K8YA 1A3HA 3WD3A 4IGHA 4DRSA 2OYLA 3KAOA 4GY7A 3SCTA 5I5RA 2NQHA 4UZSA 2XM1A 3IJ6A 3TAKA 5CGTA 1Z42A 1GT8A 1E55A 3P2VA 3WUEA 4CCDA 4MWAA 3L0NA 3B0YA 1CCWB 3ARVA 4FP1A 1PCKA 3KVMA 2CBJA 2YPIA 4NP7A 3CGTA 4N9EA 3EXRA 3IANA 4FIQA 2J4GA 3FDKA 4PB3A 2RDUA 2VX7A 3WLTA 3IGSA 3MMWA 3REQA 2X7VA 4GINA 2EJAA 3NQ6A 5MKGA 1KC7A 4GMEA 5HQLA 3QV8A 4UQAA 3B03A 3VVGA 2ZADA 4RW3A 2EPHA 2DORA 1PJ9A 3ENLA 3G1YA 3RU8X 4L1WA 3VIFA 2VT0A 4QSFA 4BKNA 3WLNA 4MOZA 3U2OA 2YLAA 5I03A 4NXSA 1CEOA 1I8JA 5EB8A 1VHCA 4LBRA 4IFOA 5CQ1A 3AS3A 5A2CA 4HVXA 4Z2LA 4E4FA 2X1UA 1JZ5A 4EK7A 3I7QA 2BVDA 2ZA2A 3O07A 1UOKA 1FWNA 3B4YA 3VDGA 3MZ2A 6XIMA 3VKBA 3GVRA 2CLOA 4LW7A 5EMYA 3SUVA 4ERAA 3UJFA 3CT7A 4GUJA 2XTKA 1EZWA 1YADA 3GQYA 2VENA 3HGRA 2Y0FA 3CTLA 3OIXA 1HJVA 1HUVA 5CJMA 3FEQA 4F79A 3TXVA 1PYMA 3EZ4A 1KA9F 6TAAA 5C9RA 3ONBA 1W32A 3SSJA 1E3XA 5H6HA 3ZT7A 2Y61A 4C6DA 1TV3A 3MW7A 1IR2A 3UZXA 2DPEA 1EGZA 4MFDA 3MKKA 4WCJA 3EWCA 2OZTA 1KCKA 3QRHA 3VOGA 3FHQA 4NQ1A 1GVOA 3HB9A 2VQUA 3IACA 2ZUSA 1JDEA 4LFYA 3L4XA 4XX6A 2PTXA 3ITGA 2Y1HA 3UJEA 4UQEA 2BHUA 2VTFA 3CIWA 4KRTA 4LS1A 4N42A 1H51A 1IQ8A 2Y62A 3B0PA 4MJ2A 1DJWA 4PMDA 1K9FA 1V3LA 2XJ7A 1E6ZA 1OHLA 3M16A 3T08A 3I68A 3EDDA 3TUUA 4NIRA 2R1LA 2YB4A 1HX0A 1G7UA 4UMBA 3M0YA 3TDFA 1MEHA 4H1ZA 3TU9A 3S5ZA 2INEA 1VRDA 3W87A 2Y8KA 5AC5A 1R6WA 3CAKA 3Q94A 3FJLA 4W8LA 4WSHA 2XPKA 1EJXC 4H7ZA 1IV8A 4JYEA 1JVNA 3OA3A 1MWOA 2Y63A 2BZNA 3PTKA 3OHMB 4PMVA 4J2PA 3POCA 1OEPA 2P3ZA 1OG0A 3NZGA 3TZFA 1JJKA 2NV9A 1XG4A 4ZA0A 1EA0A 3B8DA 2ZZ4A 1XLIA 2WKGA 5C55A 1GK8A 1J0IA 3AQUA 1JCXA 1TA3A 3S1XA 5CLWA 3UWVA 3ANYA 4GO9A 1JZ8A 2VX5A 3FSUA 1A5NC 1PTAA 4LV9A 3HURA 4CD8A 3ORWA 5HK4A 3KLLA 4WVXA 1M7OA 4G56A 4NRRA 1OC6A 3QR0A 3CUZA 3PAJA 3ZFHA 2XGZA 4MG4A 4GH1A 5D03A 1MZRA 2GQ8A 3U4FA 5FJPA 1ICQA 4M6UA 3FVDA 1XSIA 2C1IA 3V5FA 4M7SA 3AOFA 3WQ4A 3W2JA 1TUFA 1PIFA 2OQHA 4K68A 5IM51 4YLWA 3EWWA 1H49A 4DHGA 3CMGA 2YB1A 1ZPTA 1TMHA 3TTYA 2HZGA 2HVNA 1W9XA 2C1HA 3N19B 3PWGA 1ODUA 4JFWA 3VZYA 4IMEA 2VC6A 3P82A 1J9YA 1U1HA 1NP0A 2P1FA 1VBJA 3STGA 2C0AA 2HISA 2Z7GA 4HOXA 3WEOA 1AL8A 1FWSA 2O9OA 3UJSA 4RJEA 1RD5A 4FX6M 3WNMA 3W2UA 3A9IA 3EEGA 3S3GA 1EJRC 3PFRA 1JGMA 3MBDA 1NF0A 1NFPA 5A95A 2P0IA 4JTQA 1A5KC 2G41A 2XVGA 2IXUA 1EJWC 4O16A 2Y85A 1XLBA 5DN1A 3VCNA 3TW7A 4J2MA 3E38A 4LCRA 3P74A 4WXYA 5BRPA 2DFAA 3LRKA 3LSCA 3VKKA 5HMDA 4YVVA 2CW6A 1F6PA 5IBXC 2FGBA 3LCXA 1TO3A 2TYSA 4KCUA 4WZHA 1TZ9A 1NWUA 3UWQA 1J6OA 3W75A 2DJXA 1H5YA 3P8JA 1E71M 3MTWA 3UJ2A 2ZVIA 5D8ZA 1XCXA 2VM8A 4W88A 1OFDA 2E0PA 3NQBA 1B9ZA 2Y89A 4W9TA 3T9PA 3UWZA 4UTLA 2BMBA 3VNMA 3WJYA 6XIAA 2GWNA 3K46A 4IQJA 3T8QA 4RNHA 3PBUA 3NSMA 2XZ9A 1AG1O 3WJZA 4ERIA 4PR4A 5BCAA 1W1IE 1XSJA 3B04A 2ON3A 3G3MA 5EPDA 2PDPA 1DWGM 2GUUA 4CU6A 5JH1A 1HTIA 2G50A 1X1NA 1DQUA 2OWCA 4NAEA 3CPUA 4GVFA 2VJXA 3HQOA 3N13A 3LENA 2JGYA 2NXHA 1S3TC 3TNOA 1WOAA 1ITUA 4XZLX 2E6YA 4IFKB 1IZKA 2P53A 3TC6A 1B5TA 4UTWC 3VUSA 3WFAA 4Z0SA 2XM2A 4S3FA 1XSKA 1W1YA 1GQIA 4W7WA 2HVOA 4NX0A 2J75A 3TR2A 1Q6CA 4GUGA 1HKVA 1YNPA 3AJXA 1KXTA 3MDUA 1BSIA 3H12A 2IXVA 4DI8A 4Q32A 1MEIA 3Q2DA 4FXRA 1E4MM 2BXVA 4FA3A 4GKLA 1P0NA 1R38A 4JIPA 1OABA 1L6FA 1LYXA 3NGFA 3R43A 3ARSA 3BANA 3OLIA 3GW0A 1R2TA 1JEZA 3VGEA 3IIXA 1RQHA 4W5UA 4OQVA 5CPMA 2BNJA 1F76A 1J93A 3PSWA 4D6DA 4DZHA 1RLCL 3MDWA 1GPFA 4EE9A 4C7DA 1E6XM 5LA2A 1I60A 4MUPA 2BBFA 2TMDA 5LNSA 1EA9C 3S6DA 3OYXA 1GGOA 1ELSA 1WKEA 1XI3A 3HO8A 1NFGA 4XZHA 2PS2A 4JHZA 1RCQA 3LTSA 1TPEA 3W6MA 4AZ7A 4LYQA 3JZUA 3VD9A 3MV11 1VF8A 5LNRA 4QLKA 1A5OC 4CVWA 4GH3A 1EB3A 5BYWA 3W1NA 3IJQA 3LI0A 2D2HA 4JFTA 1UZ4A 3MVIA 3JR2A 5DQPA 4A05A 4HPXA 3H2FA 5IBXA 1KM4A 5CZJA 4GNKB 4MNJA 1DYSA 2J7FA 3EWYA 3THQA 3PVFA 2GVEA 4MNLA 3WY1A 2NVCA 3RXZA 4HP5A 5FEXA 5DBUA 1Q2RA 3GKFA 4MVAA 1EL3A 1IGSA 1BWKA 3MC5A 2PDLA 3AHTA 4XVEA 1JPHA 1TPB1 7REQB 5TIMA 1R7OA 2GGGA 4GYJA 2HCVA 4GI4A 4HNOA 3HJEA 4I5RA 4PCFA 3UNTA 1FA2A 4BZYA 3V4BA 1P6WA 1RY0A 4AY1A 3B9NA 3DC0A 2BY2A 2D1ZA 1F5ZA 1V79A 2GOUA 3WUGA 3CZ8A 3LCIA 1FWTA 2PGFA 2QJMA 4BCEA 4ZOAA 3V16A 4B5TA 4UTWA 5A8NA 4Y7EA 1KFLA 1KO0A 2B31A 1O4UA 2H8ZA 1T0OA 4CEXC 1LBFA 3EEZA 3VGFA 3NYDA 2HTMA 5KSWA 2R1PA 4UUIA 2VGGA 3W2NA 4G9PA 4ZTXA 2YZRA 2PDXA 3M6YA 3PUGA 1B31A 4O28A 4LXFA 1W37A 3F7JA 3OIHA 1K6WA 2ZUTA 3UG8A 5DMMA 1UKSA 4WKAA 7XIMA 5EMLA 2A6LA 1RVGA 1A3WA 5FD0A 1PX8A 4AD5A 4ACYA 3PTDA 1LWHA 2J66A 4UTIA 3NQMA 4JN8A 3QH2A 4CUCA 2HBVA 1EPVA 4ZB5A 4S3GA 3CYJA 2NWSA 3G0XA 1J10A 1T96A 1XQKA 5BXTA 1QPKA 3TLQA 4QLLA 5HNTA 1AD1A 1EC9A 4W87A 4AH7A 1FCQA 1O5KA 3SB0A 2PURA 2V5BA 1Q65A 4M80A 3NPWA 3SCSA 2OZ0A 1BTCA 1G1YA 3AS1A 3MUY1 2BY0A 3NM1A 1MRAA 3B8WA 4OVXA 3T2PA 4IPLA 4KWSA 5FJOA 4HK5A 4AYGA 3KBMA 2E6FA 4QQUA 4GUIA 8CGTA 2IKJA 3ZR6A 1XM3A 4PRRA 1CGYA 1VBHA 1UD3A 1VB9A 3E0FA 5AN7A 4O8RA 3O63A 5BOFA 3D5HA 4FF7A 2OWWA 2DUZA 1RLDA 1UPMB 4CU7A 4WQ6A 1OB0A 1S3HA 4H9UA 2QAFA 4H9VA 4TIMA 1Y5XA 3ZJ6A 3EPOA 1ZHAA 2J27A 3IS4A 4MLJA 1OGGA 3WENA 1EJTC 2PLCA 5GNYA 1K4HA 2QV4A 3TAOA 3PPHA 1DORA 1WXYA 3VFLA 4RK8A 5K4ZA 1UG6A 4Z1YA 3C2VA 1G0CA 1DBTA 2FVMA 1R30A 1JZ7A 2OFJA 2WSKA 1JDAA 2YOCA 3C2FA 2GJPA 1VBUA 3ZJ8A 5K2ZA 1DPMA 4ERGA 3TCSA 4PTNA 1C29A 4AVOA 1RQBA 1YMYA 3VIOA 4JIEA 3QKEA 1JFHA 2PTYA 1LG2A 3BLDA 4PMZA 5AY7A 1OWQA 4LQ1A 3ABOA 1OK6A 3M1ZA 1TE6A 4AMCA 2FDMA 5F2GA 5CPTA 3MP3A 4S3EA 4G6CA 1K8CA 2DJLA 2ZC8A 4GJ1A 3C3NA 2J8FA 4JAWA 2PLJA 3GVWA 1C8XA 2HNEA 3WF2A 1HKWA 4GD0A 1KW1A 4V28A 2VHLA 2ZXAA 5FACA 4YL2A 3HIJA 1WXJA 4J35A 3IK2A 4JEJA 3NQEA 4LC8A 3OQ8A 3MO7A 5FJUA 1OCQA 1ZUAX 4B3ZA 4B15A 1MW0A 4RKAA 1H7RA 4GPNA 5FF7A 1N82A 5FAGA 1GOKA 2CWXA 2PE4A 3G1RA 3G8RA 3DKJA 2PP3A 2QCEA 5ABTA 4Y8FA 2I14A 2CLMA 3DHUA 3PUDA 2YA2A 4HK7A 4M6PA 1GNXA 3KL5A 3QOKA 4L4OA 1CGXA 1TR1A 4QISA 1TIWA 3UG3A 1A5SA 1KWKA 2GVJA 2V5JA 2VVSA 4JIRA 5BMXA 2GGIA 1TPWA 1GVSA 3M0IA 2DEPA 2YCLA 2V82A 3MI2A 3V1HA 2WWDA 3ZVHA 5AHNA 4UTJA 2WWCA 2D24A 4KQNA 2P5NA 4B5VA 2A3HA 2V38A 2XIIA 3G1XA 1I6NA 4IL0A 1I75A 1K9TA 2O55A 2YCJA 3VMOA 4L1XA 2V8ZA 4ENLA 1MW1A 4X61A 4NNCA 3P14A 4BI7A 2QNEA 3NO3A 1REQB 3QSTA 4E3TA 4Z2HA 2XGIA 4UIOA 4XSMA 4IXHA 1RPXA 3SQLA 3ZZ1A 4JIQA 5CAHA 1VRXA 1GKRA 1PPIA 3CYVA 3CWHA 5H8MA 3AUJA 3CS2A 3M9YA 2MUCA 1VQTA 4J3WA 3U48A 4Y9PA 3VI2A 3D46A 3H7RA 2WPBA 1JQVA 2BOFX 3FA5A 2A85A 2PCEA 4AZCB 5CZ0A 3GG0A 3W88A 1RK5A 4E2OA 3VIIA 4U31A 3ES8A 2EPKX 3WMBA 1FDZA 1XYCA 3BMVA 3C86A 2BVTA 3M6DA 3SRFA 1ZP3A 1MW3A 4GISA 2EPLX 2AGTA 4K1GA 1H7XA 3BLPX 3UW6A 1VGAA 1KRBC 2DV0A 1OT1A 3OB8A 1NARA 2DZUA 2R82A 4O1EA 1V02E 1FHUA 2X16A 3WQPA 3HFYA 3MWAA 4DPQA 2WBGA 2E5CA 1IHIA 1YX1A 1QHOA 2QPXA 4IMFA 4MAVA 4HCHA 3LTPA 4GG9A 2OMAA 1HKMA 3GW3A 3VILA 2GJNA 3VIKA 4OV9A 2QJJA 2X41A 1SU5A 4W89A 3GFYA 1LL4A 3BLKA 1E4IA 1TKKA 2ZZ2A 4X60A 1OY0A 4AXNA 1LLZA 3P80A 3NL2A 4I5UA 3EDJA 3FAXA 4NAFB 3TJIA 3L4UA 4LYRA 1KM2A 5E0KA 3LXCA 2WAGA 4MJ4A 4Z1AA 1ITXA 3U4AA 1QT1A 3CWNA 4Z2KA 3L5LA 1IT7A 1CLVA 4UFMA 3E2QA 3WUBA 3IRDA 3TEVA 1YRRA 3IJ9A 3WBXA 1G4EA 4YS1A 1ISZA 3N9RA 1QPQA 2WANA 3DI1A 2WHMA 1GQJA 3L23A 3GHTA 3Q65A 5H1WA 2R9RA 3DZ1A 4MB1A 1EX1A 5C9ZA 1JPMA 4FNUA 4UNKA 3WQ6A 4AZIA 3B8TA 1JQXA 4ML9A 3KHDA 3H6OA 2FTWA 2O9TA 3K8KA 5J5DA 5HMEA 4E2BA 5FA5A 1TPUA 3NQAA 2PFHA 3RF9A 4RDYA 4LNCA 3H70A 1EYEA 7TAAA 5A2BA 2F7FA 3R25A 4ZFCA 2OG9A 4YTRA 2NT0A 1OX6A 2W5FA 1PCWA 4H3DA 4LALA 3V18A 1J12A 4CCZA 3ZQ9A 3O6AA 3WQVA 1V7AA 2PWUA 1V3KA 4XAYA 4AG0A 3AHXA 3MI3A 5DMYA 1ZB5A 1P7TA 5M17A 3W38A 2Y6ZA 5GQBA 4GC4A 1LL6A 4DF2A 1GKPA 3WL0A 1IEXA 4F0KA 1XUZA 4AX6A 4XD5A 5DANA 1R9YA 4R88A 4J3SA 3WQ8A 1IXQA 3ZSTA 2XU2A 2ZRYA 1O1HA 1RPKA 2ESCA 2DSUA 5D33A 5BWAA 2VZVA 1FCVA 1UUMA 2G4JA 1B3OA 1CLXA 1S2CA 1AFSA 4AB4A 4ECLA 3LGGA 3V5CA 1GG1A 3LBCA 4L6HA 4XZWA 4K8EA 1UKQA 1JNEA 1JRCA 2OJPA 3BLLA 5M1TA 4RZ6A 2A3LA 2FLIA 2ZRXA 1UR9A 3M5YA 3FFSA 2GK1B 1G67A 3CUHA 1P4CA 3GXIA 2WB5A 4PEEA 4UFLA 1A49A 4WX2A 3KCOA 4IMDA 1XF0A 3STFA 3IIOA 2NUWA 2KAUC 3PNZA 5AHEA 1IIGA 3K4AA 1BAGA 3VNZA 4HZ6A 3W9ZA 3GWQA 3APGA 2I5IA 1BYCA 4O11A 2HBXA 2J8GA 3QZ6A 1LCOA 4I9JA 1NP2A 1M6JA 3M0KA 3GDBA 3GVVA 3FKRA 2WNWA 4IIEA 2WJEA 3C0SA 4QG6A 4LWWA 4AIBA 3V0TA 1U30A 3N6QA 7ODCA 3LLDA 4H9YA 5BU9A 3H7VA 4UZUA 3KCLA 3BV4A 5LNWA 1QR7A 4HA0A 5DT7A 3WQ5A 1EHAA 4Y9AA 3SGGA 3R8HA 1J01A 3NURA 4KBXA 4IQEA 4FHAA 4F9DA 3UP8A 1RCOB 4LEFA 3WDIA 4EF8A 1JAKA 3V36A 4O53A 3NTYA 2OLAA 4IPIA 2YCEA 2QDGA 3IPWA 5D2WA 1QTWA 4ZQOA 1XYZA 1J18A 2QJGA 3TYBA 3LCLA 1V5XA 2W92A 1JCNA 1V0NA 1ZS2A 1GOXA 5T26A 3UPWA 4O57A 1KKRA 3G3DA 4HB7A 1QASA 4KGJA 3TV8A 1SUXA 5J5RA 2QMJA 4PMJA 2D0HA 3AMLA 4CQBA 3M0LA 3B9AA 3DHPA 3PZ9A 4MZYA 4Q8UA 1GOIA 5MF5A 4I90A 2OVLA 4AZ6A 2J88A 4MB4A 2H3DA 5BWFA 1AH4A 4JTUA 3KEHA 1XLDA 4DO5A 3W1LA 3G1AA 1SZEA 3S2JA 1VEPA 4OV4A 2PTWA 1QHZA 1U2YA 5A6MA 4FXSA 3FK4A 2XFFA 3AFBA 2AQOA 4LBSA 5A5WA 3QGKC 2FVKA 1W2VA 3SI9A 4OWGA 1P0KA 4IX0A 3ZS4A 2DT1A 4AYSA 1MYRA 1XICA 3FS2A 4XKMA 2D2JA 3ABXA 5FSEC 3AWNA 1OC5A 1EQCA 1VS1A 4KWUA 4A3YA 2DGAA 3IUIA 1MQPA 1C8YA 5ECVA 2BGNE 1NTHA 3HV8A 4EKJA 2A6NA 3E5PA 3GB6A 1UWRA 1VYPX 4NL1A 3QPYA 3LY0A 1TPH1 2ZX7A 1H3GA 1R2RA 2GSEA 1R3RA 2PWGA 3M0XA 4D6EA 1K1DA 2GQ9A 4H9TA 3T0BA 4TMBA 3CV6A 1TV4A 1TR9A 1PX4A 2X42A 5AYYA 1T41A 1UCWA 2OOGA 1JCYA 1CDGA 3PANA 3ZJKA 2XISA 1VZWA 4ZQMA 3VOCA 3IAQA 1EIXA 3II1A 2VGBA 2CYGA 3TIMA 4EWND 1JD9A 1VJIA 3GFZA 3AXIA 2D22A 1M5WA 1NDWA 4U4MA 1K77A 1IEWA 3REQB 2BXYA 2OCZA 2QGYA 4N4PA 3LX9A 4JX5A 1UH3A 3QW3A 4PMXA 1RBAA 4MJZA 5LKYA 1VLIA 2PUZA 4FK9A 1MZHA 1CXIA 2XH4A 1IWAA 4P8XA 2GGJA 1E1CA 1XC4A 3K2GA 3AS0A 2X0YA 2I16A 2E4TA 1B3ZA 3PM6A 4UWMA 3VMPA 3MVTA 4BY3A 4H04A 1YE4A 3QTGA 4Q4RA 1XBVA 2ACUA 1L8PA 3O2LA 4CNNA 1ISWA 2FMOA 2C1GA 4ES4A 1ZNNA 3CHFA 2Q8ZA 3MYPA 2ZUWA 1Q13A 5TD4A 1UWQA 4TV5A 3URBA 3GLCA 5JXQA 4Q4KA 1Y8BA 1OYCA 3PR2A 3NXFA 3GNOA 4IJBA 3PZNA 4HNVA 1EP2A 1G4PA 8TIMA 4O17A 3TSBA 1UD2A 5IOBA 2PDJA 2WZMA 1W3IA 2FJUB 1B57A 1OFOA 4O1BA 5CJNA 1W2PA 8A3HA 3R0DA 3LHYA 2NWRA 2TSYA 4GYKA 4NXKA 2WVUA 1MEWA 5C9XA 1MDLA 1K70A 3QMRA 2V81A 4KF1A 4CN6A 5XIAA 1GHSA 2J6VA 4DBUA 3W7DA 4WHBA 2DVXA 2OEMA 5E5CA 1YPIA 4ZODA 1F7BA 1OM0A 1Q7MA 1RAKA 4E2VA 4MWAE 2ZQ0A 3H2AA 1LRTA 1LT7A 2X09A 2A79A 5DCEA 2PBOA 4XBSA 3S5SA 4MLRA 1FX6A 3VPLA 1EIBA 1IXPA 4GQBA 3SSZA 3BSMA 1OFQA 3R4IA 2DT0A 3TSDA 1QFEA 2OQLA 3NWRA 4JKLA 4X63A 3T40A 4OT7A 3WJWA 1QK2A 2GSHA 5AHFA 1EJUC 1NM9A 3G1FA 3HQPA 3TK7A 5C54A 3WNKA 1VBRA 2ZTJA 3NUKA 4KWWA 3WDQA 1XLFA 4B5UA 3EWXA 3BW4A 1QNPA 2J25A 3A4JA 1UR8A 4PB5A 1OBAA 4CNTA 1N55A 2ATMA 3AYRA 2YYUA 3L4VA 3P61A 4ML4A 5ABGA 3BV7A 9RUBA 1PSCA 3SFWA 4PMQA 5ECUA 4A35A 3VA8A 4WY0B 3CIXA 1FWWA 1KXVA 3ITLA 4AY8A 4XAFA 2QV5A 1F9CA 1KLYA 1J0JA 2DUXA 5D2VA 1OX4B 3VTRA 1TA3B 2V2HA 3GFXA 3EBVA 1XBXA 3KFTA 5LHEA 1XFCA 1CWYA 3T6CA 2ATSA 4RR4A 4UOQA 3L2MA 2GZXA 3CHDA 3EWBX 3WBEA 4ZSUA 3ARPA 3SURA 1QNRA 5K3VA 3P81A 5EBUA 4HD5A 7A3HA 4BF5A 4DI9A 1W3TA 1ITQA 2Y70A 4UFJA 1BG4A 3HBLA 3O6DA 3B9OA 5A1AA 5B7ZA 3S1GA 4LVFA 5DRCA 4C6CA 1XGZA 3PC0A 4WDUA 2QPUA 3OBEA 4C6FA 4QAIA 1D9EA 1W3KA 2R1MA 2ZXDA 4MZ8A 2IKGA 4I8YA 3LNPA 4QE4A 4N6EA 4H8VA 3VOIA 5EMJA 2VKZG 2PCQA 1ONRA 5G2IA 1XC6A 1OFEA 2CHNA 1U5VA 3DGBA 1TZ7A 3HZ3A 4FX8A 1TWWA 5EGRA 2ZRUA 3L4TA 1EQPA 4CD4A 2DZSA 1NJJA 3GTHA 1V3HA 4CCEA 2XIOA 3DFPA 3E3HA 5A69A 3ITCA 2PC8A 3GDTA 1HKKA 1XL9A 4O1DA 1QUMA 5H8PA 4O8AA 4PUJA 1OF6A 1KM1A 4PTDA 3T1GA 1XYAA 3P67A 1TUXA 2AQVA 3ALGA 4DJDD 2XSXA 1ECQA 4TX6A 2YW3A 3TZNA 3R13A 1US0A 1UWTA 1VCGA 1ZJAA 2EQDA 3EA2A 4P8VA 1TMLA 4ZCWA 3W3OA 3CL7A 3RLUA 3DHDA 2DQWA 4KRZA 2CBUA 2VRKA 1DWIM 1CI1A 3KW3A 2VYOA 1VCFA 1E9IA 2W0UA 1FWEC 4H2CA 3TQVA 3EDKA 4D6FA 2WLYA 4JY8A 4QE1A 3CPRA 1KLZA 3NDZA 3N6HA 1OYBA 1H11A 3PBGA 5A8PA 1DE5A 4RE4A 3NA8A 3EOSA 2WVSA 3V5OA 1B4EA 4HQVA 3W02A 2WXDM 1FRBA 2ZXBA 2JIWA 5T8GA 3WF3A 1YTDA 2GOKA 4L4MA 1Y65A 3PTMA 4WD0A 3M0MA 4MDPA 3T2QA 3TYCA 4M82A 3UU0A 4DJDC 5I3FA 2X8RA 5EFDA 4AUBA 1IF2A 3ICJA 4HNLA 5DT5A 3W53A 4QE5A 1VFSA 1B0IA 1O68A 4RLIA 2WCAA 5DCBA 2C19A 3AIVA 3VNDA 1X96A 1Q6LA 3L67A 4EP8C 3BURA 3PZVA 3L21A 1W17A 4I9TA 1FWFC 1TWIA 3ARTA 1H2JA 1DTNA 4NX5A 4LY8A 1WZAA 3LSBA 1R7AA 3M4HA 2DDXA 3LLXA 1F6YA 3STPA 1P6CA 3PSVA 3WZ0E 2HSAA 1GYMA 3DX5A 5HUPA 3S2CA 1RA0A 5HWMA 5A6KA 3LQLA 1I2RA 4B5SA 1FWBC 3CMFA 1VFFA 1I0DA 2PC4A 1A5CA 1S2WA 4B5NA 3SY5A 4G7EB 3E0LA 4DJFD 1JPIA 1XLJA 2ISDA 1W9UA 3CK5A 3PJXA 1VFUA 3PUEA 2JF6A 3WNLA 2I1OA 2E77A 1V3MA 1UR0A 2V67A 1JZ4A 1IZCA 2PODA 1FDYA 2GFTA 1NY1A 3LDVA 3LG3A 4H83A 5I6SA 3UT0A 3LN3A 1I2QA 1Q6RA 4AIEA 4H6KA 1TWSA 4R85A 1G5AA 5EL1A 1O6IA 3KXQA 3MCOA 5HBFA 3O3RA 4TVCA 5IDIA 1B1YA 1V0KA 3LI1A 1E72M 1C92A 3LLFA 2F2KA 3WMCA 2RFGA 2X2YA 4MPQA 4WY0F 4IUGA 4OBRA 3QC3A 3SUSA 3ITOA 3E74A 3NZ1A 1PXGA 1CIUA 5C5YA 1GCYA 3N29A 2YCKX 4Q7BA 5RUBA 1JUBA 1WOBA 7REQA 3Q4DA 4HA1A 4DZIA 3KWXA 3P93A 1R3WA 4AU0A 3OBAA 1Z7AA 2WCGA 4C60A 4NVTA 4JTFA 1TG7A 1NDZA 2I17A 2WSRA 2IMRA 1KBKA 3QSRA 1R8LA 3UGRA 2V63A 5M2FX 3SUWA 2VFIA 3C8FA 2FTPA 1OFBA 2VEPA 1KGXA 3TN4A 3GR4A 8XIMA 2Z7KA 4PCPA 3WJSA 4DJFC 2FZMA 1E0UA 2GUYA 1LBLA 3HPZA 3N3TA 4LEQA 3MT1A 4IZGA 4X22A 4EWJA 1XIMA 4CVUA 4ZOEA 1M1BA 4GXMA 3BJSA 4UFKA 1ONEA 3MP5A 2PA6A 3G0SA 2VZUA 2QCDB 1CB7B 4YTQA 2R14A 3UZYA 1XIDA 3WDJA 3CEUA 3ABZA 3BJFA 1LLOA 3SCPA 3AC0A 1LM1A 4DUOA 2WMJA 4DJDA 3LERA 3QKZA 3E96A 3GC5A 4W7VA 2PEVA 4NNBA 1K3UA 4P8WA 4XD4A 3B05A 3SGZA 1D3GA 5E1QA 1BHGA 4ONVA 5BW6A 3WD1A 1OFPA 3KDOA 4YTUA 1JPDX 1GQKA 2G8ZA 3UWWA 1EKOA 1EX5A 2GGHA 1ZTVA 3A64A 1W1VA 4N9DA 2VR4A 1O5XA 2Y7GA 4E8DA 2FB3A 4NZJA 1TQJA 4GGHA 3RM8A 6CGTA 3XISA 1V51A 3W73A 4LAZA 3UVAA 1DE6A 1C7TA 5HNRA 4XVDA 1B54A 5CC5A 4L61A 2BLEA 3BLEA 3UYIA 1QNOA 4V15A 7CGTA 4R27A 3L5AA 1P0DA 1CXHA 1Q8JA 4D2JA 2FZ9A 4A4AA 1JPKA 4MKSA 1ZBCA 1ZBVA 2G3JA 3HQNA 4DYKA 1JDFA 2YJQA 5AC7A 1FWGC 2UY5A 2W27A 4W5ZA 3GG7A 3NNTA 1KFEA 5BZAA 4HA3A 3T78A 4PCTA 4GCXA 1MRQA 4IJRA 5AYIA 1E1FA 4DJED 3P6LA 2HPIA 4WDXA 4ICCX 3LGEA 1XIEA 3BCDA 1KTNA 5I7GA 4IJCA 1BFNA 3WBYA 4TR9A 4F0RA 3LEPA 4B90A 3CL6A 2XVLA 5LIYX 2E9BA 2VGIA 1ZAIA 1QRQA 1E6RA 4QJ4B 1KBBA 3WD4A 3CB3A 1DJHA 1R3TA 1JCJA 4O52A 4MM1A 4LF1A 3COTA 4FS9A 4HCDA 4KESA 4X2RA 4PBGA 4OKDA 2WJDA 4GI9A 2CKRA 3AHYA 3ANUA 2PMQA 1EJVC 3IUDA 3WQFA 4H6EA 3H22A 3LD5A 3GU9A 3A5VA 4HJWA 2DZPA 1H1ZA 1TV7A 3A3WA 2C71A 2CXGA 2YZ5A 3RO6A 3RGTA 4W7UA 3L4WA 2PDYA 1Q6EA 1WDRA 3FA4A 4I3GA 3RN6A 3BOLA 1T8XA 4RZ4A 2CESA 2VEFA 1IT8A 4X9SA 3T7VA 2J79A 1K4GA 5U4NA 1DHPA 1V3IA 4PRTA 4PUKA 1OG6A 4FMVA 3EX6A 3OQEA 5AHLA 3GHRA 2GGEA 3J7HA 1MUWA 3WKZA 2EPOA 1SFLA 4AD2A 1VEMA 1SZFA 4AAJA 2BWGA 4JN7A 4WSJA 3AZSA 4XAZA 1QWGA 2Z6JA 1BXCA 5HDRA 2OXNA 1V0LA 3A4XA 4L7ZA 1NSJA 5BU6A 1ZCCA 2FHCA 2EPMX 4UCGA 1O66A 3UZJA 1U33A 1Z41A 4YJ5A 2YKKA 3VNYA 3IGHX 1Q6DA 4XG1A 3SZ8A 1OCNA 3W22A 3F4NA 2QCNA 3QF0A 4BF7A 1J0HA 1ODZA 2YBUA 4R34A 3PAOA 2DUAA 1NOUA 3DYMA 2ZUMA 1VAHA 2HRWA 2WYSA 3M44A 4IHCA 4ZEPA 3Q45A 3GHUA 3S1UA 2ZX9A 3B8VA 3N2MA 1UQZA 4IPJA 1W56A 3BICA 1UA7A 4EPKA 1MFUA 1Q7ZA 2A2IA 1FKWA 4YTSA 4M0XA 5TBOA 3JS3A 4PEKA 1KBIA 2ABBA 3LNMA 3Q67A 2JBMA 2YIHA 3UETA 2WMIA 2IUZA 2E5DA 3AHZA 3PP7A 3UERA 4XQ6A 3VNIA 4JBRA 2YXGA 4LB3A 4ADSA 1KFJA 4AX7A 1Y7VA 5HAOA 3NQCA 1B90A 2E3ZA 1UD8A 2YCLB 1KM3A 5C2XA 4H8NA 4N9BA 3EGJA 1REQA 2YDQA 1AVAA 2WK2A 5I3DA 1XIIA 1EP1A 5C9WA 3DG7A 4ZOCA 2WMGA 3I6RA 3NDYA 1BXNA 2X1SA 2BGSA 1SFTA 1WE5A 1M04A 2J78A 4NZ5A 3DFNA 1C93A 3W7CA 4M24A 4KW2A 4Q6XA 5E0CA 5HNUA 2WM1A 1XRSA 2TRSA 4AZCA 1GHRA 2AAMA 3C4UA 2XN1A 1WAUA 4YTTA 3KRSA 3E2RA 3HJZA 3A6OA 4MY9A 3W86A 5LNVA 2J24A 1XH2A 3E02A 1POJA 2Q3RA 1JR1A 3S0CA 3N04A 5G1MA 2R6OA 5J8LA 2GWGA 1AH3A 4AC7C 2QJIA 1HL8A 4PUWA 1A5BA 2HMCA 5CBJA 1I1WA 2XFYA 3A3XA 2PD9A 4M3PA 1DWAM 4RPQA 4HK6A 2TPSA 3NZPA 1YDOA 4JFVA 4KMQA 3F2DA 4P2VA 2XFRA 3ATYA 3QQWA 4IX2A 2JEPA 3WLOA 2GVLA 2EXOA 3U2ZA 2VC5A 4FEZA 4FAMA 3DC8A 4JL2A 1WNOA 5CSRA 1AW1A 1AH0A 2Z29A 3QHMA 4AWUA 4J7RA 4HMDA 4PBFA 4BS0A 1N2VA 1XPYA 3ARWA 4D8ZA 4A6GA 4NAFA 3O06A 3DXIA 2W61A 5J04A 1ZLPA 3CQJA 1X7IA 2OLHA 1LOQA 5CPQA 1UZDA 3O16A 1KFBA 4H41A 1GVIA 3THAA 3UZZA 3H4XA 2C8NA 4W84A 4HT3A 4DPPA 3A12A 5D05A 2PDHA 5LA0A 2YL9A 3N2TA 1EWEA 3SIMA 2JEQA 5REQA 1J79A 3S5YA 1MVYA 2GVGA 3BW2A 2GQAA 4IIFA 1GQNA 2GDUA 3H4GA 3IJ8A 3BC9A 3W1RA 6REQA 5JBFA 3N2XA 3Q37A 1CXFA 4IGSA 4IUOA 3RRXA 4POCA 4AEFA 3NO1A 3MKVA 4ZQPA 2RAGA 4AZBA 1GVQA 2FFCA 1E40A 5BXSA 3WQDA 3MWCA 1LJYA 2ISFA 4GIEA 4HN8A 4YWIA 4UTMA 2QVNA 2QKFA 3MJMA 3SJ3A 4L9YA 2NT1A 4X9YA 4J3VA 3RM4A 4OECA 5D9NA 4Y9MA 3BG3A 3T05A 3CWOX 3GTXA 4G8TA 2CZFA 2V3DA 4O14A 4MNMA 2EJ1A 2WVTA 1H60A 2CNCA 1RUSA 4MPKA 1RQEA 4AZGA 4HBKA 4GJIA 3U3HA 4US5A 1CGUA 4LUJA 1P7TB 4O50A 1UH4A 1FY6A 3M46A 2BP1A 3RMEA 3OTRA 1EOKA 1U5HA 2PPGA 4YN5A 2PSNA 3PTQA 3UNDA 5LHFA 1YNYA 2A7PA 2Y5SA 4GI6A 4Z17A 3USBA 1YLVA 1Z44A 1TRDA 3FA3A 1TJ0A 2CC0A 2QW5A 2V9DA 1ZBKA 1HJSA 1ME8A 3BJTA 3QR3A 2CHOA 1HIZA 1JRBA 2BOGX 5IFTA 3AXXA 1SO5A 2YBTA 1P1XA 2BHZA 5M03A 1YPFA 2GK1A 2O0TA 5C7HA 3UA3A 3TQ0A 3H2OA 3P5YA 4JTLA 5AYBA 4GLEA 2WM0A 3WNNA 3OVPA 2E9LA 3Q58A 5AKQA 1Y5WA 3EX3A 4ZE5A 4WJXA 1J0YA 1A5MC 3F2CA 1TVLA 3W7LA 2OX1A 1JDCA 4G5DA 2C13A 3CUIA 1EC7A 1KRAC 1XPGA 4N9CA 2JK2A 2ZA1A 2B7QA 3F4WA 4KEUA 4OIFA 2H3BA 2H6RA 3NQ7A 3NQ2A 1GJUA 3MUIA 4H00A 4LBUA 2Q8XA 4EIVA 3WLKX 5KEZA 4NASA 1E5JA 4UXDA 1US2A 1TPC1 2A3CA 4JYDA 3DFQA 1ISXA 3W1TA 1J0ZA 4UTHA 3VINA 3M43A 5IFPA 3OA5A 1TTPA 3QV6A 3ITYA 1GOMA 4MYXA 1LUCA 4J3UA 3NQVA 3GXPA 3F4VA 2G3MA 3CXOA 3I10A 3QEZA 4QLJA 1RP9A 4BK9A 4JDYA 1MSSA 1X7FA 4PMOA 3LTYA 4QHRA 1VP5A 2BXZA 2P3EA 3EX4A 4AISA 4GNJA 5EA9A 4PTVA 4CD5A 2FMNA 3LYEA 1R9XA 1OYAA 1W8SA 4MSSA 3TW9A 4GNVA 4RPPA 2ZE0A 3W82A 3W0KA 2GDVA 3DERA 3WO8A 2KX9A 3VOHA 3LBMA 1JZ3A 4JOMA 1E5NA 3W7EA 1WAWA 4LVAA 1GTEA 3O8AA 1PKYA 1ISVA 1ZAJA 3HOJA 2WNQA 5IHSA 2ZWZA 1HKJA 5ABFB 2QAPA 1FXQA 2OTDA 3AIRA 4PN2A 4LU0A 2EG6A 4B9ZA 2J9XA 1HJUA 1MXDA 2OQYA 3FNDA 1F8IA 1EDGA 3CZKA 2XINA 1K9DA 3LV5A 2ZVRA 3BOFA 1F2JA 3C2YA 3IEBA 4XUYA 1LRQA 1ICSA 4JXCA 2WMKA 3FJ6A 2J7BA 1AMKA 2YGYA 5A8MA 4YYFA 4S3KA 4DZ5A 4JTRA 5I77A 1B4KA 3G1DA 1FWDC 2PZ0A 3TXZA 4NZFA 3U2EA 4IISA 4PC8A 1FWIC 2Z4GA 2EGZA 1FWRA 1RV8A 1CGVA 1AA1B 5FEZA 2C3ZA 1OIMA 2C7FA 3CO4A 3QV7A 4XV0A 1R9ZA 3R94A 3TJLA 3LK6A 4IIHA 4Y2WA 4N02A 2YXOA 1RR2A 3SCQA 2X7WA 3KWSA 3HGSA 4JCLA 1AL7A 3H55A 2R1KA 4WR3A 2NUXA 3WF1A 1RSCA 3LPGA 1DWFM 4D6CA 3HN3A 3SR7A 1K8XA 2OYMA 1LQ0A 3N14A 4AIUA 2G4FA 4TTGA 5AVHA 3CZEA 1J2WA 2CCRA 3WD2A 1S5VA 3EB2A 3UCQA 3W25A 1WUEA 4NZ3A 3VD5A 2CLFA 3V7PA 3MANA 3WX7A 3NOEA 1BWLA 4UTUA 4DZAA 3FOKA 2CETA 2BFGA 1A4LA 2VCAA 4NF7A 3T0AA 5I3KA 1TJ1A 1LT8A 3GDKA 3FYPA 4B3KA 1E6SM 4H9XA 5D37A 3EA1A 2SFPA 2FJKA 1X1OA 1E0WA 9XIAA 4I9AA 3RFAA 2YLLA 1XBYA 3GNXA 5CSYA 2EO7A 1OFAA 1V93A 5D9PA 2O9PA 4QJ5B 3N17A 2CLHA 2NW0A 2ODOA 3BWWA 4JTJA 5DEZA 4CKQA 3DFOA 2OGJA 2PGEA 1UD6A 3W6YA 4GJJA 2CLKA 1E15A 4LNYA 2UY2A 3EOEA 2A7RA 4E4UA 4A2RA 1E1CB 2YL5A 2NX3A 5FJIA 4AWTA 2CWNA 1YNQA 5I0DA 1CXEA 2FKPA 4QEHA 3TX9A 3E49A 4HZMA 3BG9A 1NOFA 1V4YA 4LS2A 4A3UA 3W76A 3JZEA 3URNA 4H4IA 1DXIA 4D6JA 3W26A 3OGSA 4WK9A 2REQA 2PZNA 4P7LA 2GJLA 2JKAA 1LWJA 4LCSA 1UBSA 1H62A 5DFAA 2WMFA 3PPCA 4BHYA 1QWKA 1BKSA 3R0KA 3T0CA 2WZHA 2PWHA 5GNXA 3DFTA 3OW1A 2PP1A 4JQAA 4UR8A 4TXEA 2J7CA 4JTGA 2PP0A 3HGJA 3POHA 1VENA 3DIPA 1UKPA 4NJKA 2RDXA 4QROA 2A3BA 2QUNA 2WVVB 4RZBA 3AO0A 2HS8A 3L2LA 5KITA 3QFWA 3RNDA 3SQMA 2PGRA 1TPFA 1H41A 2VWTA 3ZJ7A 1R86A 1DHKA 3AXHA 4S2CA 1A3XA 3IV8A 1C91A 1WBHA 1AQ0A 1W5PA 4DO7A 2P8CA 1F4AA 3TN5A 5HATA 2PLKA 3B0UX 3N6JA 5LIUX 5JU6A 3E2SA 2IQ0A 3W7NA 4W93A 1QBAA 2J62A 1BKHA 1SO3A 2NVAA 2R8WA 2Z0IA 3WK1A 1BD0A 1KCZA 2G0WA 5DO8A 3K30A 1JDDA 3GDRA 1ONXA 2FPTA 2CZDA 1U83A 1POKA 2UV8G 2AQWA 4NJGA 4XD6A 4XO6A 4FOUA 1F73A 3QVQA 2D2OA 1IEQA 5FF2A 3CHEA 4HYRA 5TNVA 3PZTA 3EWZA 3ONCA 1RK6A 3H4WA 2A21A 1CXLA 1EPXA 3KOZA 4KRUA 1M01A 1VFTA 3AZTA 1EUNA 3K8MA 3WQOA 5TAOA 4W8AA 4WY0A 2X40A 3C52A 4W86A 1JF5A 4XAGA 1Q63A 3RILA 4O18A 3KL3A 3W4RA 4S3JA 5HPOA 3VMNA 4BQ2A 4IPPA 5A8QA 4GI8A 1OX4A 4QDWA 3C6CA 1AJZA 4JNMA 4WUIA 4KWVA 3FGCA 2QCHA 3UY8A 3N11A 2WOQA 3UEQA 4TUFA 4N2YA 1E1EA 1FP8A 3ZT5A 4JTIA 4WDTA 3HPXA 3R79A 3WCZA 3PB2A 4JQ1A 4FNTA 3ZLHA 2BVWA 4HGXA 4GIRA 4DXKA 4JQ2A 5EMMA 1H1YA 5KMYA 3K1DA 3KBVA 4PZVA 4CQAA 2D3LA 5IHRA 3R8GA 3MCMA 1TIMA 3MUZ1 4RE0A 3AYTA 1QBBA 3OZYA 3WN6A 4WJEA 1V08A 4WXZA 2QXWA 4UOJA 1SW0A 4MIMA 3QXBA 3EYPA 4Q4MA 3N9KA 1JXKA 4QBXA 3UXIA 3MJYA 1J5SA 3VD3A 3PWAA 3S9IA 4Q8QA 6ENLA 3I4EA 1OF8A 3AIEA 4DWSB 2F38A 2D0GA 3FY1A 3RMJA 3PZGA 5EKYA 3R11A 3G22A 1IE7C 3QHOA 1V6TA 5CPOA 2QF8A 1NAL1 4CQCA 4I6KA 5ENLA 3NQFA 2ZRWA 1IYXA 1CT5A 1UZ1A 2CBIA 2ZUNA 4EACA 4ZO7A 3QGVA 3MCNA 4X0VA 5DY3A 2VURA 1WDWA 4ASTA 1EBHA 3W7OA 3ALFA 1TX2A 4H8UA 1FTXA 1A5UA 1SSGA 1PS9A 1GZJA 3P3BA 2A7NA 2Z1XA 4YCPA 2PWEA 5JIWA 3UG4A 4PB4A 3N4FA 4TQTA 5K9XA 3UXKA 4F48A 1XRVA 2ZKMX 3C2OA 4IWWA 1RCXB 4RXFA 4JNYA 4NYYA 3LHZA 4ILSA 3SCUA 5G2HA 1S5MA 4H6RA 2QEZA 1QNVA 1H7NA 2DZXA 3VNKA 3TA9A 2H8XA 2ZCGA 1R85A 1DJIA 2W62A 3W1QA 3DENA 2BOEX 3AYSA 3QHNA 3UY7A 2QF7A 3G1SA 3DDMA 3F1QA 2P50A 2VCBA 5HMFA 1DJNA 2ZTKA 3S2LA 4JGDA 1AZ1A 4L4PA 1DJQA 5E70A 2DZWA 4LANA 3RUBL 2E67A 4B2DD 1HN1A 3ECQA 4QG9A 3UESA 4PH6A 5FKYA 2G97A 5F4XA 3QJAA 1UWUA 1V3JA 1AQFA 1HGWA 1O7AA 2D2GA 4A2SA 4FNQA 4XZBA 4K38A 3PJWA 4XTDA 3OLEA 4S3DA 3W7HA 3PHAA 4PUMA 4M6VA 3P84A 5E6ZA 3LQGA 5G1TA 2G3FA 5KZMA 4CLMA 2EG7A 1QPOA 4PMNA 3OG2A 4UB9A 3CHVA 5CC3A 1IEVA 4Q22A 3BXWA 5DRIA 1XRTA 1GJPA 1SJAA 3QLDA 3ZIZA 2H90A 4Q8NA 3C2EA 4FR1A 5DBTA 2XSBA 2DSZA 5H2ZA 2NQZA 4CN1A 1GQLA 3DEQA 1HF6A 3B8IA 3LZ3A 4V1YA 1RJRA 1WBJA 1C90A 3O6CA 5FEWA 3EMZA 2Q01A 3GK0A 2PDBA 4JX6A 4G7EA 4QQ3A 3QV9A 4ROQA 2ZFAA 1SJDA 2Y88A 1E6NA 3SUUA 4R7WA 1E4NA 1UJQA 3VO0A 4DF1A 2EHHA 4R33A 2J7GA 3NVDA 3CO8A 4HNNA 2VX4A 1PUDA 4RCXA 4E2DA 2FIQA 3DFSA 4M8UA 2YFNA 5I2UA 1SZNA 3GNNA 1YPXA 2DSWA 3QMTA 4HSNA 3TC3A 4OE7A 3BAWA 4V2XA 3QZEA 1YTKA 2CBVA 1XLMA 1GVEA 3GC2A 1PZ2A 2FYMA 2BODX 4JX4A 3B9DA 1QNSA 2I9UA 4GXWA 5F4SA 4DXVA 1JD7A 1KM6A 1BXBA 1W5MA 2QDHA 2ZRZA 5XIMA 2E6AA 3EOUA 1QW7A 4N7QA 4PCNA 3I7SA 1BYBA 1PWLA 1FBAA 4PRWA 5HQEA 4ZBCA 3MQTA 4CQDA 5A6AA 3W83A 1W3NA 3WDHA 4C7GA 2BHYA 1P43A 5GVJA 1Z48A 1L2QA 2A4AA 4UQ9A 3CQ0A 2Z27A 2V5KA 3SCVA 3TFCA 1BQCA 5FI8A 2CZEA 2B7NA 3SBFA 1VEOA 3EKZA 4PODA 3BAYA 2P88A 3P0WA 5AYZA 2XIBA 3ZLFA 2CEQA 3MB9A 3W81A 2QCDA 3KZPA 4PUDA 4LVGA 2VC9A 1J6PA 4N0RA 2B0MA 4FOJA 3N9SA 4NY2A 1W8GA 2I56A 3AMKA 1GW9A 4LUIA 2BGQA 1DJGA 3CH9A 4AHPA 3R1ZA 3GY1A 4F0MA 1WP6A 4GQGA 5I02A 3DYPA 5CGQA 3WYZA 1F8MA 2TODA 4JEQA 5FIPA 1X97A 1I9CB 1MW2A 1GKQA 1DQWA 4GA8A 1ZJIA 3PBYA 1XIFA 3GXNA 4QRNA 1W3LA 2HK1A 2D20A 3TE9A 2ANUA 3OP2A 1CECA 1F3EA 2G3NA 4GIAA 1NWTA 1N8IA 1XG3A 4KEVA 4TVDA 3UWUA 2F61A 1M7PA 1BLIA 2EG8A 3O7UA 5HWNA 4KKXA 3EA3A 3IGUA 4Q8OA 4KIEA 4GQQA 3SECA 5HULA 5CC6A 1I1XA 5HUOA 1ADOA 4L65A 2PD5A 3W1XA 1UD5A 3VM5A 4WDWA 2XIJA 4R3UA 3GVQA 1TELA 4AXKA 1TPVA 3GZ3A 3GUGA 4XZ9A 4B2DA 4R53A 4D6IA 3GVGA 4DBSA 3KE0A 2V5CA 1WV2A 3KCJA 2J9ZA 1UP2A 4ZO8A 2GJXA 4XBJA 1YDYA 3NOYA 1H61A 2OR2A 3W1UA 1R3YA 2MNRA 5LIXX 3H24A 1K03A 1F3WA 2R24A 2XUCA 4INFA 4QGCA 3LXBA 2XSAA 5FL0A 1KTCA 1BSLA 2ISSA 1UOZA 3W7QA 3M5ZA 4KCWA 1SMDA 4L1GA 4MKNA 1J0KA 3UR7A 1PYFA 1HVXA 3TTEA 1KGWA 2Y7EA 3UD6A 4D71A 4GY1A 4JYFA 4UFHA 4HHHA 3WMLA 4RDVA 3HPAA 1F07A 4DQWA 1TQXA 4YCOA 1TVNA 1E0VA 4FNSA 3CASA 4M19A 2PGWA 4PYSA 2ZZ1A 5K9CA 5CPSA 2YL6A 1THFD 1K9EA 2WC7A 1ME9A 3BAXA 1F3XA 4AWSA 4AIOA 4EOUA 2ISVA 3QW4B 4JPGA 4ZFMA 3ERPA 4EF9A 1ZL1A 2C79A 3IWPA 3ZVIA 2PU1A 4CU8A 4DNMA 2YX0A 4X3ZA 4JTHA 2PDGA 1JYNA 1VIZA 4PULA 1HP5A 1CW2A 5E9AA 1XW8A 1BYAA 4F2TA 1M3UA 1WKFA 4D9PA 5FL1A 1MI3A 2NVDA 1XYFA 1CTNA 2GSJA 3M7SA 4IP7A 2G37A 5HR7A 1XHGA 1S2AA 3RK8A 4Y9NA 3BLOA 1K02A 4IMAA 2HROA 1F74A 2BV9A 1NIUA 1NH6A 1BYDA 1GVRA 1W5QA 2Z2BA 3A4AA 3CPGA 1Q85A 4GKTA 1UBPC 4DX3A 2QT3A 4LX4A 1OT2A 1I4NA 1UB3A 3KZSA 3O1NA 1E51A 3THUA 1G94A 4FNPA 5HMSA 5PTDA 2V69A 4HN4A 3NGJA 1PIIA 3IK4A 3CZJA 5FAJA 3VD4A 4CNSA 3VDBA 5I06A 5TF0A 1Q6GA 1R3SA 1X8FA 4KIRA 2ZOXA 3GXTA 5BRQA 4UC5A 1DVJA 3CEPA 1BWVA 1VC4A 1YKWA 3HFTA 3W7JA 4RE3A 1KBLA 4E8GA 4HA4A 1JAEA 4U2YA 3LMZA 1UWAA 2YBVA 4HHMA 4AHOA 3W07A 1VFOA 1PEZA 2WMIB 1ZY9A 2QCLA 3PS7A 3WUFA 4UQBA 2LLEA 3DHFA 4LJ3A 2RKXA 4J5NA 1UJPA 4YIWA 3WF4A 4EPBC 4XK2A 2FVLA 3N73A 4X0NA 3JW7A 3RCMA 1AJ2A 1RVKA 2QZRA 3PJTA 3H53A 2WC4A 1M65A 1SR9A 3F5JA 4ZTYA 1QO2A 4J3ZA 3WEMA 1JYXA 4LOCA 1WKYA 3VKCA 3FXGA 1E56A 1H7PA 3THCA 2VEKA 4ZQCA 4R9OA 4JN6A 5DELA 3AMCA 3MHGA 2B81A 1L8NA 2RDTA 1YDNA 4XTIA 4M51A 2XH0A 2E8YA 3GD6A 1XGDA 4PUNA 1FWJC 2XVPA 4PTMA 1SM9A 5A3HA 4L80A 3BDKA 5U7SA 3TA6A 3N34A 2AL2B 2D23A 5CBIA 4BA0A 4DBDA 4E0CA 1U5JA 1KFKA 2RUSA 5L9FA 1M9HA 1X1ZA 3BQ6A 3ITTA 4MAZA 5LGXA 1Q6OA 1EEXA 3HGOA 1EOMA 4NJHA 3SUTA 4GC3A 4JICA 1KV5A 3BE7A 3UWEA 4CGTA 4FPSA 1TFVA 1TWDA 3NPVA 1GPWA 4UBPC 4IICA 2GJRA 3NQDA 3L9CA 2A0NA 3LHVA 2IPGA 1TVPA 2XWDA 5EFFA 3GH5A 3U7VA 1S5WA 2D0FA 1GEQA 5G1YA 3R89A 3MPGA 1T40A 1LTDA 4J27A 4NI8A 4GRSA 3W84A 4FO4A 4QG8A 2NXGA 3NG3A 5CSUA 4JCMA 1V8EA 2V30A 5I78A 3GZAA 3RJYA 1FCBA 4KFOA 3QY6A 1EJSC 1KQZA 4H9MA 1XYLA 5H91A 4R7OA 1RJQA 2PDUA 3PY2A 2HQAA 3C5QA 5HJYA 2Y5JA 3CZGA 3NXLA 5AVNA 1FOBA 3CZLA 5F1VA 2A3AA 2VD8A 3QR1A 1ALDA 1UIPA 4D6GA 1GOOA 1CXKA 2JKPA 3H7UA 3CJPA 5REQB 3T44A 4AW7A 2CPUA 1YTEA 5SWUA 5I09A 1PKLA 4EANA 3TOYA 4WOZA 1O5RA 3RAOA 3WF0A 6REQB 1G6CA 1Q7QA 4YWSA 1JUEA 4IMGA 2G3IA 1UZHA 4QS5A 4HMNA 4O1CA 1XCWA 5FF0A 5D2XA 1M68A 2RJGA 4AZHA 3WH7A 3IJ7A 2PDNA 2EKCA 1BEUA 4EXAA 4MF4A 4CQ8A 3EPNA 5L6UA 3VABA 3G24A 1TZZA 3MO4A 3LPOA 1X98A 4ADTA 1L6WA 3RYSA 2XVNA 3CH0A 1LG1A 4GE8A 3SCWA 3N1AA 5E6YA 4IM4A 5CEWA 2JIEA 3OLGA 4OOUA 3RO8A 3NIYA 2OWXA 2FHBA 1VHNA 3H2NA 1Z8AA 3KBSA 2E1DA 3GNDA 4GY0A 1EP3A 1VIWA 2B7OA 2DIKA 3FKKA 3HV9A 4RUBA 4MJMA 4YXGA 1TMQA 2ZZ3A 1DV7A 4J28A 3GTIA 2BTMA 3G1VA 1X38A 3VC6A 5C70A 1Q4WA 3N12A 4U5KA 4LCQA 3UXAA 3B8SA 4HIBA 3SFKA 1LLWA 1D8CA 2OZ8A 1MQQA 2BX7A 2WMHA 3QMSA 1GVYA 1LL7A 3O6YX 1JI1A 4AC1X 4XKYA 1S2UA 2Z28A 1JZ6A 4ACZA 4JTSA 1P0EA 2QULA 1W31A 1WYIA 3BAIA 4DAIA 3ZM8A 1V6WA 3M0HA 1OGSA 3GIYA 1W9PA 2F8QA 3OYZA 4TOQA 2QYGA 2V0TA 1TE1A 4DUWA 3KOFA 1HGYA 2PB1A 1JG9A 3GBEA 3PG9A 2G5WA 5C7VA 1XR2A 2DZTA 1BRLA 1QDSA 3AALA 4AY7A 5CAKA 1JYVA 3APTA 4FLSA 2OOFA 2W4XA 4J3TA 2X0HA 5D38A 1A0EA 4QEEA 2GDQA 3L0KA 3LZ5A 3NZRA 1PBGA 1NU5A 4IFRA 1I2NA 4DLMA 2UBPC 4OOZA 1VPYA 4B3LA 1DWJM 3D3AA 4S1FA 3LHTA 4GWEA 1XKJA 3GH7A 5GJPA 4BFAA 1KD0A 3N15A 1UIOA 4QM1A 4TMCA 5ABHA 3WLHA 4F0HA 4A3QA 1PDZA 2CZ5A 2W9MA 3INPA 2E7FA 3AI0A 1LORA 1WXZA 2UY3A 2E68A 4EXQA 1ZALA 3BOXA 3OPSA 3WK3A 1R2SA 3K4WA 1LUCB 2BSLA 1QJWA 1UYQA 3P7YA 2HXUA 5K9DA 4KCTA 4MADA 1I0BA 4EAYA 5HXMA 3KTSA 3CB8A 3U6WA 1RD6A 1GOWA 5C0QA 4P7OA 3B9EA 4V33A 4O4WA 3UZ5A 2DZAA 2XH7A 3IIPA 3ZR5A 3ARYA 3WBWA 5ABFA 1TREA 3SEPA 3NL6A 4KWOA 3UA4A 2NZLA 1KCLA 4S3AA 1UR2A 2NV2A 2OLSA 2JFEX 3AWOA 5I07A 2PDCA 4JL1A 3IVSA 4PFMA 3GXMA 4AF0A 2FZBA 1Q6QA 4K7VA 1S1PA 2Z1WA 1FP9A 3NCOA 1W54A 3RPDA 3SDOA 3N3MA 2VDIA 4BQ3A 3GXDA 4M81A 1W6TA 4DUXA 3BTNA 1V7YA 3AJ7A 3V0SA 4YU1A 1T99A 1U1JA 1JIBA 1VFHA 4LUSB 2J47A 4M56A 5C71A 1W9VA 4M6QA 1VYSX 4O54A 2ZXQA 3VM7A 1IGWA 2YL8A 2NXIA 5A6JA 4N6FA 4S39A 1W5NA 4JFUA 1VBGA 3UR8A 3S1WA 4O1FA 3SRDA 4J4KA 4G7FA 1RALA 1YBQB 3WDPP 1NELA 3VFCA 3BPWA 2PF0A 5KINA 4ADUA 3WFLA 1TTQA 2ALRA 3PBMA 3AROA 4FNRA 4K2SA 1PZ3A 3UXLA 2BDQA 4C6OA 3FEMA 1R3VA 1XDLA 3GU2A 2PI6A 4RV8A 4GUFA 4C6MA 4V27A 2WJFA 5K7JA 3WQCA 4A8RA 2XIMA 4GZJA 4Z1BA 4DY1A 3NQ8A 4IIGA 1LROA 4BI5A 5CG0A 1U22A 5E09A 1W1ZA 2ZX5A 2PRLA 3FHAA 4J1OA 3CUFA 2VGFA 4PMRA 2NQJA 3OODA 4GQRA 4DWSD 3RLVA 1ME7A 1AMYA 4U33A 1GZ1A 3WLIA 1ESWA 1BVZA 4PL2A 2FZNA 1OADA 4GBDA 1FH8A 1UWIA 3MBFA 3PZOA 3STEA 1UKOA 1HO4A 1XH1A 3L4YA 1FHVA 2W67A 3KVJA 4GACA 1BF6A 4PSRA 5EY5A 3V35A 4GVGA 2JALA 1IWBA 4C1NA 1EGVA 4UCFA 4Q4PA 4F2BA 1XLEA 2CLLA 3TYZA 1A50A 3TROA 1PVNA 1E3ZA 4ZGYA 3D3FA 4YPJA 2VELA 3UPMA 3R0UA 3ITVA 3GXFA 2JKEA 4QNWA 2E28A 4PTXA 1TV8A 2XHYA 1KCXA 2HK0A 4UNLA 4UR7A 4ALDA 4AD4A 4TX8A 3G77A 2INZA 3UBPC 2XIQA 2Z2UA 1H0IA 3BARA 3O9NA 3RX2A 3WEZA 2ZX8A 1EEPA 3PK7A 5D02A 2ISWA 5DXYA 2DH2A 2ZDSA 1WDDA 2HXTA 4MB3A 2AKMA 5GJMA 3RPTA 4DWSC 1QW9A 2REQB 4Y8EA 4K8GA 4NU7A 2QIWA 3WK2A 4ZQRA 1OC7A 2WVVA 1QI3A 5IDZA 4HU3A 2WBKA 2NX1A 4RL3A 3WH6A 4YYCA 3MSRA 1XD0A 2GPTA 2L5HA 3FJ4A 1QHPA 1UPPA 4Q4QA 4DELA 1E9ZB 2FB2A 4MY1A 1AK5A 3KRZA 4E6MA 1KM5A 3RCYA 3RG6A 2VVNA 2ZX6A 1R46A 2WSYA 4XSLA 4YHGA 3GTNA 5HINA 4B4HA 5DY2A 2DVUA 1RBLA 3S8HA 4PTWA 4QDPA 1WDPA 4HSOA 1J8VA 4JIHA 2VFGA 3VIGA 5FESA 1DXFA 1AZ2A 2OEJA 2WNNA 3TYAA 4AMAA 1NFBA 1XINA 4QCFA 1OD8A 2W6RA 4DB7A 3C2RA 4FX7A 4CCCA 3PN8A 5T91A 2D73A 3W2LA 4DAFA 5H8UA 1S2VA 1B30A 1WB0A 4OBSA 2X2GA 4Q6JA 1A0CA 5EU9A 1H7OA 1L2UA 5B7YA 1HO1A 1Q8AA 2OELA 4P61A 3WBAA 2VC7A 2QVHA 5D8WA 2POZA 1SR0A 1DIOA 4Y96A 2FDSA 1XLCA 4BQ5A 1F61A 3AISA 4FI4A 4CQ9A 4AD3A 2ADAA 1I2OA 1PO9A 2R1NA 4IF2A 2WHJA 3WNPA 4KH2A 3FCPA 3DG6A 2FHFA 3R12A 3AXKA 3A9BA 3M64A 4E8CA 3W23A 4G2DA 1S38A 1WPCA 3U57A 4KFNA 3IIZA 1LBMA 1SO6A 3RX3A 4WEVX 4C5ZA 4JHOA 3QYQA 3GM8A 3BCJA 2Z2AA 1SSDA 4LSBA 4RE2A 4DNHA 5HA7A 4K6AA 4CNUA 1W1A1 3FYYA 1E70M 2ASHA 2VCCA 3FGCB 1D8WA 3WQGA 1XIBA 3FW6A 2ZBTA 3VKJA 5CJ5A 1M53A 3TFXA 1LQAA 1W1TA 2V68A 3R7MA 3O05A 5HR6A 4YVPA 2EKGA 4WLCA 2WHKA 5F1UA 3T4WA 3VZXA 3NQGA 3C3UA 1P5BA 4H7VA 2IW0A 3WK0A 5GNZA 3IVTA 3F5KA 4U28A 4WRHA 3MY9A 1E0XA 3EX2A 3W7IA 4DWSA 4WGHA 3UXDA 1JI2A 3WLRA 3B8UA 1TRIA 1ZZMA 1T7LA 4UOZA 5FOOA 1CB2A 2DIEA 2XGBA 2D69A 4UTTC 3E0VA 2YA1A 1H4PA 5I3GA 4ATWA 2A5HA 1KR0A 4IQDA 2ZWYA 3LM7A 1TJPA 1UA3A 5I24A 7PTDA 4QXIA 3IJIA 1FFQA 4XAPA 1NWRA 4C5YA 5A6BD 3LRMA 1H7WA 3BCFA 2YSWA 4GK8A 3TP4A 2FGZA 2VNCA 2VUNA 2VZTA 4HOWA 1EO5A 3PG8A 2DP3A 3ZR4A 1LOSA 3KL0A 5LA1A 3T0TA 3SGUA 1JUKA 4ZZ9A 1MFVA 4A29A 5I79A 3PZMA 4DM1A 1CYGA 4GX9A 3B06A 3ZT6A 4MB5A 1GG0A 3LA4A 3THDA 3VIHA 3CLWA 3URQA 2ZA3A 4Q4SA 3V0UA 2O7SA 3GAYA 1KKOA 4Y9OA 2PDWA 1ZJBA 2G95A 5BNKA 5EMUA 3CM4A 3SCRA 1LZOA 1EWDA 5ABEA 1LWIA 1B3YA 1BG9A 3T55A 1EFZA 1XV8A 3MHFA 3N4AA 4HPNA 4HYWA 1IZJA 5FJJA 3U0HA 4M29A 4NKCA 4JDBA 3TQPA 3AS2A 3BL3A 3L12A 4NNAA 2P76A 3DCPA 1E4LA 2O9RA 3T0DA 4KEZA 1XCFA 4U5IA 1HG3A 3BSGA 1DIEA 4KCVA 1HJXA 3B0VC 3NPUA 4ZR8A 5LSMA 4LGXA 2O56A 1FCUA 3LCFA 5FF3A 4S3BA 4U2ZA 4TO8A 3WNOA 1QPNA 3A4WA 4FSAA 1FKXA 5BXPA 2IQTA 2RJHA 2RH9A 4P8UA 2PLMA 3PULA 1US3A 3VIJA 2QDEA 4QP0A 4HCLA 2VMFA 4BWLC 1B3XA 1M41A 3CL8A 2QGHA 4EX4A 3CV7A 3G6MA 4FOKA 4ZB0A 3TC7A 3VYLA 4I7UA 2IPJA 1P1MA 4KGLA 4OTKA 3SJNA 3ZMRA 1PIGA 1AW2A 3TVAA 3HPSA 2R91A 4L64A 3I7RA 3U7BA 4GYFA 3ZYZA 3OVGA 1PTDA 1W1PA 2F6UA 4HPHA 4UQCA 3ZSSA 1ECEA 1IXNA 2J74A 1TJRA 2ZZ5A 3ARZA 3GS6A 4MMWA 4H19A 1OGBA 5BRBA 4UTTA 3W7PA 4LRTA 3RJXA 1J5TA 1IEIA 4LUTA 2P8BA 2XN2A 2ZYFA 3IJLA 2AMXA 1H1NA 2WW5A 3HA1A 2XDFA 1JNDA 4FB7A 3QYSA 2QHAA 1OX5A 4I5XA 3MMTA 4LY4A 3MYOA 3A5FA 4DEFA 1TYGA 2I7GA 2Q02A 3B4UA 3SM0A 4TTUA 2DZBA 1UQYA 4NUWA 2GVYA 4GGBA 2W66A 4J3XA 3H26A 3RX4A 2I9EA 1CZ1A 4JY9A 1OSEA 3PFMA 1XIGA 4A8NA 1VD6A 5LYRA 3A22A 4DIAA 5A6TC 4B16A 1P6BA 1B3WA 2J6XA 4JZ5A 1W3HA 4UMAA 5FJRA 3KM8A 3EWDA 2QCGA 4HMCA 4H7CA 3OVQA 4Q8MA 3UQNA 4ZENA 3QFEA 5IXEA 1BTMA 4RDZA 4QIUA 1QI4A 3W71A 1DWHM 2F9RA 2PU0A 5AB3A 3ZWSA 2CU0A 4MKVA 4YMZA 4ZO9A 1FWCC 1N8WA 3FLUA 1HNYA 3JVAA 4Z2IA 3T8LA 3CV2A 5DMLA 3FXYA 1SO4A 5KETA 4PSPA 1G9HA 4GZIA 1EUAA 4QTGA 3UPBA 1DQXA 3WJXA 3P8IA 3VGBA 3NEVA 1MNZA 1TCMA 1KXQA 4HSHA 4O19A 3G5EA