4RDZA

Crystal structure of vmolac in p64 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
314
Chain Sequence
GMVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
molecule keywords Parathion hydrolase
total genus 123
structure length 314
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdzA00
2HBVA 3T1GA 4GOAA 4RDYA 1R9ZA 3LSCA 2Z29A 4H9YA 1O5RA 1RJPA 3TNBA 1FWJC 1A5NC 4QROA 4R7WA 3KM8A 1XRFA 4G7EB 1UMLA 4QRNA 3IARA 4I6VA 4J35A 4C6NA 3F2BA 2HNHA 3GUWA 4H9VA 3OODA 4V1YA 1GKQA 1YIXA 3WYZA 1EJXC 3FDGA 4WGXA 1RA0A 4EP8C 4BJHA 1FWFC 4IFOA 3UR5A 1O12A 4C5ZA 2I5GA 2CZVA 2WJDA 4F0RA 3NEHA 4KQNA 4OFCA 2YB4A 3WZ0E 1V7AA 5A6TC 3SFWA 3AUOA 2Z7GA 3DCPA 4NG3A 4C6CA 4ERAA 1POKA 4HK5A 1PSCA 3O7UA 3T81A 4RZBA 2GOKA 2IMRA 4LALA 1P6CA 2ICSA 1FKXA 1EYWA 4GY7A 4DIAA 2WJFA 1NDZA 4C6MA 3URQA 4H9ZA 4CNTA 5HMFA 1BF6A 2WM1A 4KERA 2KAUC 2R1NA 2E25A 3K5XA 2EG6A 1V77A 5G4HC 1EF2A 4GYFA 4B90A 1J5SA 3HPAA 1EZ2A 3S4TA 4DYKA 3QY8A 4IGMA 2OODA 1ADDA 1ZZMA 4ZSUA 4KEZA 2Z4GA 2AMXA 2VM8A 3T8LA 3ID7A 3OOQA 1YNYA 3O0FA 4IGNA 4XAYA 4LAKA 4PBEA 1FWDC 4DO7A 4IH3A 4C6JA 2Y1HA 4GY1A 2F6KA 4HK6A 2R1PA 1YRRA 4I6KA 3E3HA 1V51A 4NP7A 3TN3A 1NDWA 3OQEA 3PBMA 4C6DA 1W1IE 2O4QA 4JOMA 3JZEA 2D2GA 2P50A 2WJEA 4IFRA 4NI8A 3AU6A 1V79A 4XAFA 2DVXA 3K2GA 3S2LA 4CQBA 4LAOA 3IRSA 2Q01A 3EGJA 4AC7C 3CAKA 2FVKA 1A5MC 3OVGA 4C6IA 4E3TA 3V7PA 2VHLA 4Z42C 2OB3A 1XGEA 4LAMA 2W9MA 3MDUA 2Z2BA 2EG7A 4GX8A 5FSEC 2GSEA 3B40A 3MPGA 3CJPA 2GZXA 2PGFA 2DVUA 3IACA 1R9YA 1KCXA 4C6PA 3LA4A 4IG2B 3UR2A 2YXOA 4D8LA 2E1WA 1KRAC 4TQTA 1EJUC 1WXZA 2VC5A 4C6BA 4KESA 4WVXA 3E0FA 1A4LA 3TN5A 2VR2A 4H00A 3RYSA 3F4DA 2GWGA 4HK7A 4IFKB 3GTIA 4P5UA 3TN4A 3DC8A 2QVNA 2OQLA 1RJQA 1K6WA 1EJRC 4IQJA 3LNPA 4DLMA 2XIOA 3E74A 4EPBC 3B0XA 3MVTA 2ANUA 2A3LA 4DZIA 2Z26A 1FWHC 2R1LA 3EWDA 3NURA 1EJWC 2OOFA 3LS9A 1PTAA 4R85A 5LXXA 2RAGA 3S2NA 4ERGA 1XRTA 3D6NA 1ITQA 4UBPC 4DI9A 4PCNA 3PANA 1GKRA 2Z2AA 4L6DA 4LH8A 4GXWA 4F0LA 3DUGA 2OGJA 2YZ5A 4XAGA 4C65A 4C6FA 1M68A 4UB9A 2GWNA 3URBA 3URNA 3S2MA 2R1KA 4LFYA 4G7EA 3RN6A 3GIPA 2Z25A 1YMYA 2QT3A 1J6OA 3LGDA 4H9XA 4QSFA 4GX9A 1ONXA 3FDKA 4CEXC 3UPMA 1FWGC 4QS6A 1RA5A 3LGGA 4KETA 1FWBC 1RK6A 4QS5A 4CQDA 4LCQA 4XD4A 3NQBA 1QW7A 2I9UA 5CH9A 4CQCA 4GZ7A 1A4MA 5FSDC 1IE7C 1EJSC 4C6LA 2O4MA 3N2CA 3OU8A 3S2JA 4B92A 4XAZA 1RAKA 1YBQB 4H9TA 4CNUA 4DLFA 2PAJA 1QXLA 3WMLA 3GTFA 2AQVA 4GK8A 3LU2A 2QS8A 3ITCA 1UIPA 3UBPC 2UBPC 2Z24A 4GBDA 4PBFA 1POJA 1M7JA 4RDVA 4H01A 1V4YA 2PGRA 3A3XA 2YB1A 1P6BA 3BE7A 2BB0A 2DVTA 1E9ZB 3GTXA 4C5YA 1M65A 4HJWA 2FFIA 4MUPA 5E5CA 4DZHA 4ERIA 3SO7A 5HMDA 1NDYA 1ONWA 2UZ9A 3OJGA 1WXYA 2VUNA 3GTHA 4B3ZA 3EWCA 4YIWA 4RE0A 3C86A 2FVMA 3QGAC 1EJVC 1FWCC 4PCPA 3GRIA 3ORWA 2FTWA 4DNMA 4GC3A 3QGKC 1ITUA 2EG8A 2ADAA 1K70A 4RDWA 3PNZA 4ZSTA 1KRMA 1NDVA 4XD6A 2HPIA 4F0SA 4KF1A 4LCRA 1A5OC 2QPXA 3MVIA 1K1DA 4C6QA 1PB0A 4LEFA 4H9UA 1NFGA 4RDZA 1XWYA 3MTWA 3E38A 4EPDC 3B0YA 2PLMA 3TN6A 3GIQA 4M51A 3F2CA 2AQOA 2Z27A 4WHBA 3RCMA 3ICJA 2HPMA 2PUZA 1VFLA 3LSBA 4BY3A 4DI8A 3FEQA 3CS2A 4INFA 4H9MA 2R1MA 4J2MA 1S3TC 4R88A 4L9XA 4GY0A 3MKVA 1KRCC 3R0DA 3PNUA 2Z00A 1RK5A 5HMEA 4AQLA 1EJTC 2D2HA 3A3WA 3F4CA 4C6KA 2G3FA 1JGMA 3IJ6A 4XD5A 2Q09A 3HTWA 1YBQA 1J79A 4LCSA 3GG7A 1FWEC 2HQAA 4IG2A 2FTYA 2P53A 4EPEC 3IGHX 1DPMA 3MDWA 4KEVA 4J5NA 4QTGA 3LY0A 4IF2A 1PO9A 4G2DA 3PAOA 1FWIC 1GKPA 3GU9A 1E9YB 3ISIX 2D2JA 2Z28A 4BKNA 3URAA 3G77A 4V1XA 4ICMA 3GU1A 2ZC1A 1J6PA 4CEUC 3K4WA 3E0LA 3RHGA 1I0BA 3GU2A 4KIRA 3QY7A 2BGNE 3MJMA 3AU2A 4CNSA 4KEUA 4C6OA 1R9XA 1HZYA 3A4JA 3UF9A 4PE8A 4HA0A 2VC7A 3IPWA 1I0DA 1FWAC 3F2DA 4B91A 3QY6A 1P1MA 4IFKA 5AKQA 1UIOA 1RJRA 1FKWA 4C6EA 3MSRA 3HM7A 4XD3A 1KRBC 4LANA 1A5LC 2HBXA 1UBPC 4EPKA 3IV8A 4C60A 1A5KC 3E2VA
chains in the Genus database with same CATH superfamily
3BK0A 2ZWYA 4RDYA 1PDYA 3RX4A 2Y8KA 4IL2A 4YHEA 3HGRA 4KS0A 1L6WA 1F6YA 4W9TA 3OZMA 1GYNA 5I23A 3BDKA 2DQXA 4H8UA 3VKAA 4UR7A 3WLHA 3BARA 1C3FA 1TIMA 1EJXC 3BPWA 2JQXA 3W76A 3BMVA 1OT1A 3W2JA 4KW2A 3CWNA 3BQ5A 4C5ZA 3FYYA 3UWUA 4M56A 3RRAA 2G3IA 4ZA0A 2Z7GA 4E8GA 3KWSA 5C2GA 3P2VA 3BW3A 1WAUA 4YHGA 2EQDA 4AIOA 3VTRA 5H8MA 2C1HA 3BURA 1JDCA 2JALA 4O16A 1EC9A 3MKKA 3WEZA 3WQGA 3KBJA 3T8LA 1PZ1A 3HIJA 1DE5A 1UW9A 2O0TA 2RGLA 1S5NA 3W9ZA 4O8AA 3BO9A 1B0IA 1W3NA 4DO6A 5IFPA 3WLMA 2NSOA 2GUYA 3H4GA 3KRUA 3HPSA 4YU1A 3EWYA 1W1IE 5HXMA 3TA9A 3R8RA 5K3VA 4CGTA 2YA0A 4CVUA 2PB1A 2WJEA 4JIHA 4IFRA 4NI8A 2XFFA 2JE8A 3VD5A 2DVXA 3P82A 1WDWA 4CQBA 3AXXA 4UTIA 1B5TA 5HINA 1PV8A 2V3EA 3LERA 3G3MA 3UWQA 4XTDA 3PZTA 2A3CA 4UIOA 3EBVA 1SSDA 2OQYA 4ZQNA 1SQ7A 4TVCA 3ITTA 4B5WA 3CWOX 1MDLA 2PF0A 3NQFA 4IP4A 3TLQA 2EG7A 5FSEC 1XD0A 2ON3A 1A80A 3AAMA 4Q7NA 4EXBA 1YXYA 3JVAA 4S3JA 1KB3A 3BICA 1F8MA 1XG4A 2WZTA 4IG2B 5C71A 4H2CA 2W63A 4JDYA 2E1WA 4TQTA 4Z2KA 3VM7A 3W6MA 4C6BA 2VD8A 2ZUVA 2V38A 3KP0A 2FH8A 1I2QA 4FNSA 3TN5A 4A22A 1RY8A 2X2GA 2TYSA 5K2ZA 5KEZA 1QHOA 2H90A 5HJXA 1IWBA 1XSJA 1K03A 3EWZA 3WL0A 4JTLA 4LU0A 3E74A 1G9HA 1ZALA 4PSRA 4KIEA 3N29A 3NNTA 3W0KA 3EMQA 4C91A 5XIAA 1KFCA 3G8RA 1E0TA 3NURA 3MYOA 4XZIA 4AY1A 2ZA3A 4CUCA 3K8MA 1J0HA 1ITQA 4AWEA 5D32A 1DWFM 2PD9A 2VRJA 2YYUA 4GUGA 4L6OA 5D2XA 4ZODA 5C55A 3BLLA 5I79A 3AJ7A 4MPKA 2WKJA 1VJIA 3VIOA 3TTEA 3WDRA 5PTDA 4C6FA 4WJEA 1OGSA 2GWNA 3AXKA 4KFNA 4KCVA 3UFYA 2BFGA 2ZICA 3D47A 3P61A 4LFYA 6XIMA 4DXXA 2VEPA 1XLKA 2OKTA 2J79A 2WBGA 5ECVA 3C2FA 1RZMA 1TWSA 4ML4A 3B3DA 1V02A 3GC4A 2GOUA 1TJ0A 2OG9A 4DWSC 3GS6A 4XBSA 2VVSA 5CG7A 5GQBA 2ACRA 3L66A 3A23A 3WQ6A 3KL5A 4JD4A 1AW5A 3AXIA 1LLZA 5EFDA 3AISA 1R3QA 4GABA 1AJ0A 2AQWA 3ARYA 3S2JA 2EPMX 1EDTA 2VWSA 4M81A 3W00A 3KAOA 4XG1A 1TJ2A 4UOJA 3GTFA 5HULA 2DFAA 4EK7A 2GVYA 1KXQA 3GTXA 2IQTA 2WMGA 1W3TA 4M7SA 3VIKA 2JIWA 4UWMA 4AHQA 2UZ9A 4BF5A 1JZ3A 5A6MA 3VNKA 3LUTA 1OB0A 2XVGA 1E4LA 2C7FA 1UB3A 2HEJA 5I6SA 4K1WA 4GI4A 3KZSA 2NQJA 1GHSA 1E55A 1VKFA 3UWEA 4I8YA 1ZLPA 1XBYA 4MNLA 3W1NA 2WKGA 3GC2A 3O63A 3MVIA 4HJFA 1MEWA 2OX4A 1PIFA 4QQ3A 4TMBA 4ZBCA 2QCNA 4ZQPA 3BQ6A 3CGTA 4MNJA 3IJQA 1IGWA 4DBSA 3CHVA 5DMMA 1W9BM 2PUZA 3FEQA 1K4HA 4HU4A 4AZCA 1MSSA 4INFA 1JF5A 1ICQA 1TUXA 4US5D 4AF0B 3KHJA 4WRHA 3OA3A 4GY0A 1W5OA 3WUFA 2XFYA 3L0GA 3CZLA 4RNHA 3G24A 2ZTJA 5DXYA 4D9PA 2UWFA 2DSZA 4R5EA 3DI0A 3USZA 4WF7A 1Y5VA 1IEQA 4MDPA 4W89A 1D9EA 1KFLA 1G5AA 1VEOA 1TJPA 3G77A 1VPXA 1X39A 4FMVA 5I24A 2RDTA 4JICA 1I0BA 3QY7A 1XPGA 1TE1A 2INEA 1QPRA 3GZ3A 3RR1A 1TVPA 4E2VA 5I00A 1HZYA 4MJMA 5FF2A 2VCBA 5EPDA 4CNNA 1VBRA 3TSDA 3LRMA 1JFXA 2ZX5A 4WZHA 2CLMA 4Y9OA 1RXOB 3QHNA 5FIPA 1K7EA 2XH2A 4FLSA 3I3DA 1LL6A 1XINA 3QN3A 2I1OA 1KRBC 4IUOA 4HNOA 3VOFA 3BLPX 5DO8A 1ELSA 2J7BA 1S5WA 1QU4A 1VD6A 3NQVA 5BXSA 3WJXA 5CC3A 3E96A 3WBXA 4Z1CA 3LSCA 3MSDA 4M8UA 1TSIA 1MEIA 4BK9A 1WNOA 1XG3A 2QUMA 2XM1A 2DUXA 4R7WA 3LHYA 3M5YA 7CGTA 2GVEA 4TMCA 1QOQA 4IMAA 3WH6A 3FXYA 1B3OA 3WMCA 1EBHA 3UY7A 4K38A 3RMJA 2WCSA 2TPSA 4CN1A 4BJHA 4S39A 3UR5A 4Q8QA 4D6EA 1ZJHA 3WLPA 4UR9A 3EDDA 4AHOA 2Y0FA 3B0UX 4GUIA 4R27A 3KCOA 1E0XA 1A50A 3L9CA 3U2CA 3DYPA 4ALDA 1G7VA 1KGWA 3EPMA 1V77A 1FVPA 3TSBA 3RCNA 1DTUA 3WLLA 3TYBA 5MKGA 2D3LA 2FDMA 1FUYA 2OVLA 2CLLA 2FZ8A 1OX4A 1EO7A 3JR2A 2GGEA 3TJLA 3GKAA 4F2UA 4NILA 1HJWA 3C2VA 1GCYA 1W3IA 1JUKA 4V33A 3N11A 3WUEA 3MI6A 2OT0A 3M5XA 5HQMA 3N04A 4FIQA 4UTWC 4ZO8A 2BY2A 3IRSA 3QXBA 1BYAA 1LRQA 3VX0A 1TTJA 3WJZA 1PL9A 5LA0A 2PBOA 1ME8A 2GUUA 4C6IA 5FEXA 4A3HA 1W9UA 3U7BA 3V7PA 1ZCOA 2WSQA 4L80A 4MJZA 9XIMA 2Z2UA 3VGEA 1NY1A 4LBSA 5AN7A 2XVPA 4FO4A 2Z2BA 3NPXA 1GOIA 4JTCA 4YWIA 3QSRA 4TOQA 2D1ZA 3RJYA 1OIMA 1CXLA 1TA3A 5M3WA 1TQJA 1BVWA 4O19A 4DZAA 3W86A 1KRAC 3O07A 4Y96A 5HOSA 2VC5A 3TU9A 1KTBA 4PTVA 4ENLA 2OJPA 3E0FA 1BVNP 4KRTA 4EXQA 3DYMA 2GL5A 3TFCA 2MNRA 4WKFA 3GZAA 3V4BA 1JDAA 1MNSA 3VYLA 4FIRA 3LNPA 4KCTA 5A6AA 1FH8A 3T2QA 2E7FA 3UPBA 2Q8ZA 2BGSA 3U6WA 4UTFA 5G1YA 1XQKA 1L8PA 1GVEA 5E9AA 1E4IA 3T2PA 2G0WA 4DI9A 4JZ5A 1LG2A 2CHNA 4OHQA 4X60A 4KRUA 3ZWSA 5HR7A 4RE3A 3DUGA 4ZO6A 3Q2DA 4Y6GA 4C65A 3BC9A 1Q2RA 1RHCA 3FIGA 5F7UA 5CKSA 3N9SA 1XX1A 5CJMA 4HIBA 4P8XA 3FDKA 2PMQA 1XH2A 3R10A 1TO3A 2Q71A 2QV4A 2PTWA 4ZFMA 1MQRA 1FHVA 1L8NA 3NG3A 1V6TA 1H4PA 4G56A 3KFTA 1LDCA 3TV8A 2REQA 5AHFA 4WDWA 2C0HA 3NGFA 5DRCA 1SO6A 4C6LA 4M29A 3SQMA 3OU8A 1R3YA 1UR1A 1YPFA 1H1YA 3B04A 1FXQA 1TB3A 4WXYA 3MMWA 2O9PA 1XH0A 5EY5A 2X7VA 1ME9A 4WX2A 1M7JA 2CETA 3H55A 4PMXA 5F4WA 2V9DA 1B9ZA 2YJQA 4FOUA 1DJQA 1VIWA 5EGRA 2QUVA 4GBUA 3DHUA 4OBRA 2W6RA 3C0LA 4YCOA 5D8ZA 3BAJA 3CIXA 4OIFA 5M1TA 4R9XA 1CEOA 3CZEA 2YL6A 2GJNA 1QVBA 4ICNA 4GI6A 2VEGA 2BDQA 3PUEA 5F1UA 4AWTA 2A4AA 2PF8A 4WJXA 1RCQA 2EG8A 1AQMA 1TA3B 4W4QA 4B5TA 2FFCA 5HNTA 1VCGA 1V6XA 3NSXA 2GSHA 3ARZA 1AD4A 4PRTA 2QPXA 5ABFA 3E49A 3TQVA 2X09A 1NFGA 1PAMA 4LBUA 2YL9A 3UG5A 2X7WA 3I4EA 2HRWA 3MTWA 4TX8A 4V28A 3GIQA 3P0XA 3PR2A 3WDPP 4FX8A 4ADSA 4R53A 1EJ7L 3VU2A 3ICJA 1X8FA 4Q22A 3PWGA 3DERA 3HF3A 3PUOA 2QCDA 4FPSA 4B2DD 3DFQA 2OSYA 5EFFA 2YGYA 1ADSA 1DIEA 3VIHA 2JKPA 3A22A 3R11A 1XUUA 5HMEA 3W7LA 1BEUA 5DRIA 4LUSB 1KFKA 4JPGA 3TC6A 4K36A 3EOOA 5BWAA 3UZWA 1F7BA 3AWNA 4EOUA 2DPEA 1H5YA 2PDNA 2HWGA 3LB0A 2VOMA 3P62A 1QHPA 2OEMA 3N4AA 2ZC1A 5DCDA 2CU0A 3DDMA 3NQGA 4FZIA 3FKKA 4IIFA 4QISA 2B7OA 2BGNE 2VI0A 2IPGA 1JPMA 4DY1A 3BUVA 4GVGA 1EPXA 4HN4A 3P84A 1J12A 3C52A 5GJMA 1LROA 3WQDA 4JDBA 2ABAA 3UR8A 1VHNA 3M7WA 3ZJKA 2ZXAA 4HZ6A 1CECA 3E2QA 4CD8A 2XIBA 3PPGA 2J13A 1SZFA 2BHYA 3SGUA 1Z6KA 2PC8A 4WY0B 2W91A 3LPOA 4A21A 3L23A 3PWAA 4YWSA 4YN5A 4AD2A 2YCJA 2ALDA 4ML9A 5IBXC 1MDRA 4R34A 3GFYA 2YDSA 1OINA 3EX1A 3KBSA 3R43A 1XICA 3WJSA 1UZHA 3O6YX 4E5TA 6REQB 3ZR6A 1LM1A 2VVNA 4H9VA 1H0GA 3LXCA 4XKYA 1YDOA 4YTQA 3IVUA 3FDGA 4DB7A 1DTNA 1W2VA 1HW6A 3CO8A 4G1KA 1N55A 3CMFA 3NOEA 3T09A 1KC7A 2W5FA 1H0IA 3N2BA 3WZ0E 5K7JA 3R12A 1TMQA 4ZTYA 3CPGA 2BY3A 4DWSB 1NQKA 5AHNA 1XUZA 2OYKA 1M1BA 1DQXA 1S1RA 3TW7A 1XLEA 1BSLA 1IQ8A 4H8VA 3UEQA 2BXYA 2H9AB 3T0AA 1UC5A 3IEBA 2VX7A 2CPUA 1O94A 3ITVA 4IICA 1G4TA 3U5YA 3BAIA 3N34A 4ATDA 4LV9A 4E6MA 4AXKA 3PZOA 1Z9AA 1NFPA 1OX5A 1GOOA 3C6CA 4RR4A 1QNVA 3I7RA 1OHLA 1TV8A 2JK2A 2R1PA 2EPNA 1K8CA 1PIGA 2YXXA 4HNNA 1V51A 1XLCA 4UQCA 5E93A 3PBMA 1CCWB 3EX4A 1LOSA 4TO8A 3RLVA 1J8VA 3W1LA 1K9FA 1ZRQA 3PG8A 4A3RA 4XBJA 3UXIA 3GE7A 1B1YA 1UR4A 5D38A 4Q8PA 3I65A 5I5RA 2Q3OA 3VGFA 3IVTA 1PWLA 2O56A 3HJZA 1C29A 3V18A 4HNVA 3AICA 3CUHA 3GO2A 4GWEA 4O18A 2OYLA 4EKJA 3P14A 2GSEA 4HMNA 3VO0A 3UZZA 5DBTA 3AIBA 3MUXA 4OVXA 3DHPA 3ARSA 3AQUA 3WKZA 2C14A 1LBMA 1W91A 3FGCA 1OBAA 3N2TA 4WDTA 3NAVA 3HV9A 1J11A 1C9WA 4IPIA 3U3HA 3SAZA 3BG5A 4O13A 4CD5A 1AMYA 2CLPA 2F2HA 2VR2A 2REQB 4MJ2A 4A6GA 4WEVX 3TN4A 3DC8A 3CBWA 4JTEA 3MQTA 2OQLA 1BRLA 4IL0A 1W1B1 4H8HA 3ATZA 3NM1A 3VNDA 4QCEA 1O95A 5CPQA 3TSMA 3CLWA 3EB3A 1XIHA 4GD0A 4UNKA 1MQPA 3A13A 2CYGA 3ABXA 1GJPA 2WNNA 3EWDA 2OOFA 4NJHA 2WZMA 3KUMA 4US6A 1UP3A 1P7TB 3DFHA 1TR9A 1QJWA 4BA0A 2RDXA 2DIEA 1QK0A 3TQKA 1V0KA 4QE1A 4H04A 1H7RA 1LBLA 4PZVA 2IW0A 5BOOA 1DIKA 1TJ1A 1EIBA 4NZ5A 1VCVA 1SZGA 1CGTA 2DSKA 4RPPA 1DL3A 3ARPA 1UPPA 4AZGA 5CC5A 5AY7A 1TVNA 3RRXA 4GGHA 1CGYA 3HPZA 3T0TA 4AG0A 1YTKA 1ALDA 3QM3A 1FWGC 3L4UA 1RA5A 4G8TA 3W23A 2YCEA 2XWEA 1EFZA 2FGZA 2VFFA 1QPOA 2ABBA 2Y85A 4PODA 2VRKA 3SN4A 4CQCA 5BU6A 1UH2A 1KFBA 3CEUA 1A0CA 3P81A 4KT2A 4UR8A 1LZOA 5CSUA 8TIMA 5AC5A 3LU2A 2PC4A 3W1UA 3WQOA 2G4FA 4LF2A 4JR5A 2Z0IA 1EXPA 4L5ZA 1OFOA 3E02A 4HA3A 3K8LA 3SY5A 4GYJA 2BGQA 2XPKA 4CNPA 3GM8A 1P0EA 3OVRA 1BTMA 5HMDA 1VFSA 4JQAA 3GTHA 3CB3A 4HGXA 3UCQA 3WNMA 2VURA 4B3ZA 4MY9A 1OK6A 2DQWA 3P6LA 2FVMA 1FWCC 5DMNA 1S2VA 1RP8A 3N4EA 2Y61A 4UUIA 5IRPA 4JCLA 4YTRA 3THUA 1T8XA 1ZQ5A 3LLFA 4JIPA 1GQLA 1UR2A 2WOQA 3F4VA 4IX2A 3WK1A 3REQA 3RM9A 4XD6A 3WF1A 1NEYA 4Z1AA 4MOZA 1A5OC 2XN0A 3N2XA 3O16A 3CZKA 2ZRZA 1JF6A 4ZQMA 1YE4A 3M0HA 4AZBA 2OO0A 1C8QA 4JQ2A 3SZ8A 5ABGA 4RE4A 4Q4SA 5A8MA 1HUVA 4WY0A 4D72A 3RCMA 3P7YA 1SMAA 1BVZA 1Q6GA 2R1MA 3BLIA 1GVOA 2QDGA 3MV11 1DBTA 4OT7A 5DMYA 2PPGA 3FVMA 3MKVA 1C9DA 1UHVA 2P5NA 5BCAA 1RK5A 3BANA 1WZMA 4AQLA 3KBNA 2Q02A 2YX0A 5I02A 3PPFA 1E40A 3TOPA 3VE7A 1JDFA 3T42A 3UPWA 3WN6A 5KMYA 3CPUA 3ZSTA 1B54A 1E9YB 1PHWA 4D1IA 4YTUA 1X7FA 3WUBA 2VENA 1HT6A 4CNSA 2J9ZA 3P67A 2NX9A 1F6PA 2VC7A 4KCUA 4FOKA 2J74A 3TTQA 3IJ7A 1L6SA 3FA3A 3NTYA 2XVLA 1A0EA 4Q4QA 4XSLA 2QUNA 3TR9A 1THFD 1V6VA 4I5XA 5BOEA 5BXPA 5JUVA 3I6EA 1OD8A 1D7KA 1GVFA 3CV7A 4LANA 3W7CA 1SM9A 2Y7FA 3SEPA 2WMIB 2ZIDA 5E09A 3TW6A 3TK7A 1BXNA 2BLEA 1B57A 4LS1A 5DQPA 3L12A 2FQIA 3CUZA 2HTMA 4JTUA 1C91A 1KD0A 3A64A 3WDQA 1GEHA 3VGGA 1XRFA 4LYRA 1UUMA 1KQZA 1XI3A 4V1YA 3F7JA 3VAVA 1QI0A 3RG6A 3AHYA 4M1RA 1X98A 1Q4NX 3ANUA 4X2RA 1MO0A 3F1QA 3PAJA 5BOFA 4K68A 3SJ3A 4F0KA 2WJDA 4JTQA 2DZXA 3WQPA 2DT1A 2FDSA 1YPIA 2OEKA 3UU0A 1JD7A 2VR5A 4P7RA 2JBMA 4NZ3A 1S5MA 4GHRA 4DIAA 1OQFA 1IEXA 4AVFA 1BF6A 1FCBA 2AMGA 2YYTA 4S3DA 4NIRA 2E25A 3V36A 1E4NA 3TYUA 5G4HC 3WEOA 3WDHA 3QY8A 3LXAA 1W1PA 4W7UA 1WOBA 3RM4A 3FA5A 4PSPA 3TIMA 1MZHA 1EC8A 1DHPA 3LCIA 1WKYA 3WD4A 4IGNA 2PDFA 3ARRA 3P3BA 1M03A 3W2UA 4IH3A 3VGDA 4FOJA 3V5FA 5FF7A 3MBFA 4AZHA 4GUFA 1UCWA 3AZSA 3W82A 4ZO9A 5A2BA 4DUWA 4LB3A 2UY2A 3I3BA 4NT0A 4WSHA 4D6DA 4GQQA 1QNQA 2QNEA 4LXFA 2WWDA 2ZQ0A 3GIYA 4XSMA 1BKHA 3B4UA 3GW3A 1J0JA 4PFHA 1I9CB 3M43A 2XZ9A 2F6UA 3UVIA 3UYCA 2OB3A 3W7GA 3VE9A 4PYSA 4Q7BA 3Q94A 1OFDA 3QPZA 2QCDB 2C79A 1U83A 5AFDA 1BGGA 3SQSA 1LLOA 4EXAA 3GBEA 3TTSA 4HMEA 4L4MA 4B3KA 3RPDA 2CZEA 1R2SA 4LYPA 3PTKA 1KM1A 3QFWA 2CIPA 5AHEA 2NX1A 1EJUC 4KKXA 2QDEA 1HVQA 4H00A 2OMAA 2POZA 2C6QA 2W79A 3KVMA 3PJUA 2OX1A 5HQLA 3W7JA 1J10A 1VR6A 2WHKA 1RV8A 1A53A 4XZLX 4EPBC 3MVTA 4N6FA 1GHRA 4AUBA 2QMJA 5MHBA 1GJWA 2A3LA 2Y7EA 4E4PA 1O5KA 2GVJA 4ZMGA 1CBGA 1GKRA 3TX9A 1J96A 3GQYA 4LH8A 3I10A 1FY6A 3BSGA 3LCGA 3RMEA 2Y5JA 4OBTA 2QJGA 1ZCCA 4FNRA 3SECA 3SCRA 2R9RA 5HJLA 1ZBWA 2VZTA 3BLOA 3OLEA 1G4PA 1ML1A 4OE7A 3HU7A 1SW0A 4IMEA 5A6LA 3N2OA 2FYMA 3UPMA 4UOQA 4Y8FA 1JPHA 4KETA 2OZTA 2ZKMX 4KGJA 3MWCA 1CDGA 4AD3A 3FAWA 3ABRA 5CH9A 4JFSA 3QVQA 5F2LA 2O4MA 2FZBA 3DEQA 3KLLA 3FNDA 1SU5A 3EOLA 1I1XA 2CLKA 4GK8A 4RKAA 3GXPA 5AHMA 4U3CA 3BV4A 3LTYA 3W27A 3LQLA 4ZCWA 1V4YA 3HB9A 1NIUA 4W86A 1RQHA 1VBGA 2Z6IA 1E9ZB 1UUOA 2FFIA 4YVVA 3WK3A 3QSTA 2PDMA 2AL2B 3TCSA 4FP1A 1JL8A 1GOQA 5D09A 3HG5A 4O1FA 3E2SA 3W73A 3QGVA 4GCAA 3DFOA 1DYSA 2OZ3A 5KINA 1OK4A 3MCOA 3HG2A 1QBAA 1WQ5A 1MFUA 2E6YA 5D4YA 3PNZA 1VENA 1VPQA 3ZJ8A 3ZMRA 1BGAA 1G1YA 1T0OA 1YYAA 3S0CA 5G2HA 4LEFA 4G6CA 4JIEA 5CBBA 4S3CA 3FXGA 2PDBA 1HVXA 3BLDA 1HKWA 1XLJA 3W88A 1P0BA 2E6DA 3DKJA 3EEGA 4V2XA 3RLGA 3T6CA 3G1FA 4HNTA 4U4MA 2WYSA 2XIJA 3BJSA 4U5IA 4M3PA 2QF8A 5LXEA 2NVDA 1JCYA 5HDRA 3JRKA 4HU3A 4OKDA 5DF0A 1W17A 3ITGA 2DEPA 4PCTA 1O7AA 3TROA 4UFJA 4Y9NA 1GPFA 2Z00A 3OHMB 5CCZA 8RUCA 3H2NA 2O9RA 4LSBA 3SSZA 1YKWA 3FJNA 3MSYA 1YBQA 3EOUA 1JJKA 3FAXA 4MF4A 1FWRA 3XINA 2YL5A 1PO9A 4GLEA 3D46A 3PVFA 4RV3A 1PIIA 3PK7A 4TR9A 1VBHA 4BQ5A 4K1GA 4HTBA 3HBLA 1OCBA 3E0LA 1V3MA 4HPXA 1EUNA 2TRSA 1UD4A 1TREA 3Q45A 5C5YA 1HTIA 3FOKA 2BSLA 1X6LA 5HPOA 2FZNA 1A3XA 3BGJA 1TV7A 4R7JA 1H11A 3WD1A 1E6RA 3VIGA 3ZT5A 4J3SA 2WC4A 3QV9A 2OKOA 1OFBA 1S2UA 1XBZA 3LZ5A 2DZTA 3K4AA 5AB3A 3UZJA 2NSXA 1H63A 3ES8A 4DBWA 3OIXA 1WKDA 4ZE4A 5A1AA 2F9RA 2R24A 1YXCA 2BHZA 1FRBA 1HKVA 5EL1A 1HG3A 2NQLA 3QHMA 3B9EA 2X16A 2DT2A 4K7YA 4M6UA 1VFFA 4M82A 1IXPA 1XYAA 1GKQA 4QAIA 3RU8X 3SUVA 3WYZA 5I3HA 2PURA 3ZT6A 1FWFC 4JXCA 1FQ0A 1XLBA 2CZ5A 2I5GA 3HO8A 1CZ1A 1SJBA 3FY1A 3HQPA 4IIDA 4PMRA 5CXPA 4F0RA 5LNSA 4OFCA 4HPNA 1POKA 2C0AA 3UGVA 3T81A 2GOKA 1A5BA 1P6CA 3CHCA 1KM5A 2XJ7A 2ICSA 1EYWA 2DV0A 4I3GA 4A8RA 1KKOA 1PX3A 3W26A 1N7KA 4ZTXA 1Q6FA 1UPMB 3MO4A 4GNVA 3MP3A 5JVLA 1JCNA 3THQA 4H3DA 3APGA 4BS0A 3HGOA 4XAYA 1S2CA 1H60A 4YMZA 1XGZA 1N82A 4UCGA 2C18A 2JKEA 2C91A 2VGBA 1VQTA 1L2UA 2FGLA 5F4XA 3DG3A 2DZWA 3VDGA 1OF6A 2FHFA 3WG6A 1NDWA 5D03A 1EX5A 2FZ9A 3KTCA 3VUSA 3W1QA 2XZ7A 5A6JA 3W1XA 3G1YA 4UQDA 4QEEA 4HPGA 4H6KA 3CQKA 4QDPA 4AC7C 3CAKA 4DF2A 2G8ZA 2XU2A 1NJJA 4JHZA 4ZZ9A 3H2CA 2WXDM 3S47A 3WQEA 3CC1A 3MP5A 3T0CA 1HFBA 4LEQA 4X2PA 4JIIX 3RAOA 2V3GA 2HE5A 2J27A 4XQ6A 4ACZB 3N9RA 3M47A 3ZVIA 2ZVIA 4IQLA 4PGLA 3UR2A 3H23A 1EOMA 2WZIA 3VIJA 2GGIA 3STGA 5TD4A 1H1NA 5CC6A 3VGHA 4WXZA 3NO3A 1XLMA 4NX0A 3C61A 2FKPA 4TTUA 2VZOA 2X0YA 3ABSA 3EA2A 3IIXA 1W9XA 1Z32X 2ZFAA 3WIJA 1W1VA 4AWSA 4DO5A 1ZENA 3LBCA 2C1IA 1IR2A 1F05A 3D6NA 5BRPA 2UY5A 4UFHA 4RZ6A 6ENLA 6CGTA 1UASA 4DWDA 1JPKA 1HKIA 1E5JA 1TPEA 3WNNA 4UB9A 1WOAA 3GNDA 2VX6A 2FIQA 3NVTA 1WX0A 2NUWA 4NZCA 1MUMA 3AMGA 4PA8A 1PBGA 3RR4A 4OV4A 3UJ2A 1EDQA 1JCLA 3KRSA 4IZGA 4AY7A 1FCVA 1O4UA 3H26A 3RJXA 3MMTA 3OEXA 3CUIA 4E2DA 3A9IA 5FSDC 3UCCA 3QMSA 4POCA 2E28A 3EXSA 2VGFA 3NVDA 3THCA 3B97A 3M16A 2PBGA 2CC0A 1AZ1A 3UBPC 1HKMA 4GBDA 4ECLA 4F2BA 4EWJA 2D23A 4W87A 1TPVA 3BTNA 3ME3A 1GVIA 1KGUA 2QJIA 3R5EA 3WLQA 3BG9A 3S5SA 4B4HA 2PRMA 2P8CA 4EWND 4HOWA 1NF7A 4CQAA 1W1ZA 2FZMA 1PKNA 1B3VA 1P0NA 3I6TA 3QGAC 4GJJA 3NQCA 4ACZA 1M7PA 4GC3A 1G6CA 4DBEA 1Y8BA 1XSKA 1TV3A 1KO0A 2BY0A 4ZSTA 4IX0A 3V5CA 1TX0A 2J75A 1UROA 1BD0A 3KCJA 5TQLA 2AKZA 3G1RA 1AL8A 2WANA 2CWXA 3RU6A 5FKYA 1FBAA 2WC3A 2YDRA 3A5VA 2WVVB 1TZ9A 4HOXA 4D8AA 3G18A 4ROQA 1OFEA 1DOSA 5HUPA 1FX6A 1E1FA 3TJ4A 3U2OA 3G1HA 2OWCA 4LUTA 4AIEA 4BY3A 4Q32A 1V3KA 4O50A 4UTTC 1O6IA 1S3TC 4NL1A 3QV7A 2F84A 3SURA 4HMCA 1UR0A 2ACUA 3NDZA 4H1ZA 5K9CA 2RGMA 3B05A 5CAHA 1AD1A 3ONCA 3BAKA 4X9YA 4LGXA 1Q45A 4UCFA 4X22A 1YDVA 3XISA 2P53A 4PCFA 4NNAA 3WLSA 4A8LA 4AD5A 4GFSA 3QQ1A 2VX4A 4JN8A 2ZYFA 2CITA 3TYAA 1ZBVA 5CSYA 4ICMA 3IIOA 1NU5A 3BLEA 1V0LA 3RHGA 1LORA 3MJMA 7TIMA 1D8CA 3PTQA 3CV1A 1ZBCA 2RJHA 4YTTA 1Q5MA 2WMJA 4RXGA 2J77A 4XZWA 2W92A 2DZUA 4DBDA 1JDDA 4IQDA 3R6IA 3TC7A 4HT3A 3A24A 5HR6A 2QMKA 4MG4A 1JUBA 3A4WA 1TX2A 1Q66A 2PZ0A 5E0KA 3MSRA 4JS3A 4XD3A 2HS6A 3VINA 4PC8A 2G50A 3KHDA 2HBVA 1Z69A 3TKFA 3A47A 2C3ZA 3AMDA 4O1CA 2ZE3A 2ZBTA 1O5RA 4Z2GA 1RQEA 1B9BA 2GQAA 1A5NC 3Q4DA 5G1TA 3U2EA 3GUWA 3Q37A 4LOCA 4YXGA 1V03A 4GQBA 2YL8A 5B80A 1GZJA 3L4ZA 2ZA1A 3W7PA 2QAFA 2DZAA 3GHRA 3TOYA 3W7DA 2WW5A 3ZS4A 3GKFA 4LC6A 4QR6A 3NEHA 1YPXA 2YB4A 1V7AA 5IHRA 2HV5A 3SFWA 2XFWA 1YTEA 5U4NA 1KBKA 3H70A 4YLWA 1JAKA 1NDZA 3PZQA 3ELFA 3VC5A 4DJED 2KAUC 3K5XA 1DJWA 2HK1A 3NZPA 3GVRA 1WDRA 3EDEA 1EF2A 2H3BA 2PI6A 4F9DA 4HU8A 4NKCA 2Z4GA 3WF0A 3A4XA 1M41A 3PUDA 1OG0A 1AW2A 1UKPA 4YL2A 1Q7ZA 2J9XA 5CZJA 1TYGA 1XIGA 5HNRA 1YHTA 2X1TA 4PTXA 2I5QA 3GG1A 3R7MA 4I6KA 2ODOA 4HPHA 4WSJA 2X0HA 4MWAA 3UW6A 1W56A 2P50A 3QV8A 5I78A 4X3ZA 3S2LA 3S46A 2A79A 3TYCA 4MB5A 2OYMA 1F3EA 1DV7A 8XIMA 2PDUA 3M41A 1T41A 5G4EA 1IF2A 2PDJA 3KX6A 3OVGA 3RK8A 3MWAA 1WXJA 3O6AA 2BP1A 1ECQA 3GLCA 5I06A 4DM1A 3IIPA 2AAMA 5D2VA 3CU2A 2ZRYA 4GX8A 1V3IA 1AK5A 4LUIA 1A3HA 1C92A 2XTKA 2V5LA 3DFNA 1CLXA 1KCXA 4ZQRA 4FNQA 3V0SA 2P88A 2YCIX 3LV5A 2VNCA 3IUDA 3GH5A 3ONBA 2GPTA 2WCGA 4RW3A 4PTNA 3M64A 1X96A 4NAEB 2BY1A 3BGGA 2J24A 5JU6A 1GQNA 1ICSA 3EKGA 5CG0A 3LTSA 3CO4A 4E4UA 3DN5A 3GG8A 2D73A 3S9ZA 3H22A 2E9BA 1Y5WA 2OEJA 4JNYA 5A3HA 4DZIA 2R8WA 4CD7A 4LV4A 3LCFA 3LYEA 4R85A 2MUCA 3TAOA 2PWUA 3GG0A 3S2NA 4ERGA 1XRTA 3CAVA 3LPFA 3H21A 2NZLA 3AHTA 1QNRA 4GXWA 1XSIA 2F7FA 1NP0A 2OWWA 4JYEA 5HMSA 4R3UA 3E0VA 4XIAA 2ACSA 1GYMA 4HYRA 1YXDA 3RN6A 3DKLA 3GNRA 3LGDA 4CCEA 4NUWA 2TAAA 4WLCA 3VI2A 1F6KA 1W6TA 1MVYA 2CHOA 4QAWA 5HQEA 1HX0A 1RK6A 5AC6A 3FSTA 4I5RA 2YA2A 4W84A 4JFUA 4AAJA 4XD4A 3NWRA 2X1RA 3NQBA 3LPPA 1VCFA 3W38A 1XHGA 1IWAA 2OFJA 4IPPA 4YCPA 1YBQB 2HZGA 4H9TA 4EACA 1K7FA 1R7AA 2DU2A 2W67A 2CKRA 3M46A 2GJXB 3WQVA 4QQUA 1JPDX 3WD2A 2PLKA 4JEQA 3TWBA 4O8RA 4ZFCA 4C5YA 3V1HA 4GIRA 2V5DA 3ARQA 1AA1B 5A8GA 3SUSA 1ZL1A 1O60A 4AYSA 4K6AA 1LT7A 2HVOA 3HA1A 4YPJA 3OJGA 1EYEA 2V2DA 1J0ZA 1E0WA 1VEPA 5BZAA 1I8JA 1VC4A 3ZLGA 3DBNA 1H62A 4F9JA 1XCWA 2A21A 4IP5A 2LLEA 4UC5A 3LCHA 3QR1A 2FMOA 2PLCA 3P8JA 1M7OA 2ZRXA 4LNYA 3WJWA 4NVTA 5BROA 4QG8A 2Q8XA 3KRZA 1MW1A 3PZUA 1FP9A 3HMJG 3OB8A 4QJ5B 4H7CA 2OLAA 1JIBA 1DJGA 4EPDC 1OZQA 4WDUA 4MHBA 5TBOA 5C7HA 2NV9A 4J3XA 2J7FA 1BWLA 1XM3A 3AMKA 3CNYA 3LSBA 1R5YA 1V3LA 5D9NA 4B15A 4I7VA 1CGWA 4L64A 3VOGA 1D3HA 1T5AA 3LNMA 2TSYA 3D3FA 1EIXA 4MLJA 1XKJA 4RNIA 5HWMA 1Q4WA 4ZB2A 4ZXLA 4NJKA 4I7WA 2G3FA 2E0PA 3W71A 3T7VA 4LCSA 4IG2A 4YVPA 1QNOA 4EPEC 3MDWA 3MMDA 2J8TA 3EOSA 3H7RA 4D8ZA 3UJFA 4G2DA 4Z17A 4NHVA 3GUGA 5BNKA 2XSAA 1EP1A 1EF3A 1PTGA 1TR1A 3EMZA 3H4XA 1TVLA 3URAA 2E40A 4GPNA 4KH2A 1N8WA 4KIRA 2G3JA 4DJDA 1KW1A 5JH2A 1K6AA 3LENA 3EB4A 4J7RA 3QF0A 1MMFA 1N2VA 4C7DA 3CZGA 2I56A 1Q6DA 1CW2A 1F73A 1KBJA 1UIOA 1JEZA 5FJJA 3E12A 5BYWA 2X42A 3HM7A 5J04A 4NJIA 4C60A 4HZ8A 1AFSA 3O9NA 2GVGA 3T78A 4FX6M 3VCNA 1YLVA 4PUEA 1YQ2A 3HOJA 3VZXA 3POHA 3ZR5A 4AC1X 3RPTA 4Q4MA 3TMQA 2J7CA 5I2UA 3TMLA 4EP8C 3BVJA 4H6RA 1K9EA 2BVYA 1O12A 1Q85A 2PU0A 4N9EA 1AQHA 1VEMA 1VBUA 1WDPA 2VGGA 2E5DA 3ALFA 5A6TC 4J3WA 3SGZA 2EJ1A 1SZNA 3M7SA 4LALA 4JL2A 3SRFA 1XIBA 4WQ6A 1WZKA 4ICCX 1KXTA 3P0WA 4O11A 2PTZA 2XHYA 1W1TA 2PTDA 1SYTA 1I60A 2R1NA 1E1EA 2GGHA 3B03A 2CW6A 4QE4A 1RPKA 3GTNA 1QOPA 4IGMA 5C7VA 1HQTA 4KWWA 2BASA 4NXKA 3T8QA 3PSWA 2O7SA 4XV0A 2V2HA 4F66A 1UP2A 3G6MA 4PRWA 2CLEA 2NV1A 4NNBA 1GGOA 1OIFA 3E3HA 4NP7A 4CU7A 4U10A 2CLOA 5REQB 4AISA 1TIWA 3MBDA 3MO7A 5DLCA 4MGGA 2WO5A 2I57A 3TXZA 2ZRWA 4LYQA 4RPQA 2EEXA 5J5RA 3NZ1A 3BOXA 3VDCA 4HQVA 2A7PA 1SMDA 1HKKA 3JZUA 2J9YA 1OC6A 3BL3A 4GCXA 4N42A 3TNOA 1MFVA 4QNEA 1A49A 3MCNA 3IGUA 4GZJA 1IT7A 2QCFA 4QGCA 2NX3A 3OGRA 1GOWA 1W8GA 1Z89A 4L61A 4Q3MA 3HZ3A 3QBUA 4HA4A 2HE8A 4NAFB 3GK0A 1PYFA 3R8HA 2GK1B 2XH0A 3QYQA 2QF7A 1VIZA 1KBLA 1UYQA 1S46A 4QM1A 1OJXA 2RDUA 4HCHA 1JVNA 1MWOA 3NO1A 3O0KA 3AS0A 2HDJA 4OBSA 4DWSD 3IIVA 3NL3A 1EPVA 4K3ZA 4S3EA 2ZC8A 1EJWC 1PTAA 1EGZA 3PFRA 4N0RA 3BG3A 1ZB5A 3BOLA 5GNXA 1AJZA 5F4SA 5AHLA 1XIDA 4F0LA 3QKEA 3M0MA 2VEIA 3NEVA 4B9ZA 2YZ5A 4LY4A 3A5FA 3I3EA 3S2MA 2R1KA 5A6BA 5IFTA 4WGHA 3OHIA 3L5AA 4FLOA 1YMYA 4XB3A 2QGHA 2XG9A 3LD5A 2FJKA 2PDPA 3EA1A 1NWUA 3F5LA 1QASA 4ES4A 3LEPA 3F5JA 2A85A 1VZWA 4Q4KA 4DJDD 3QMTA 4AZ7A 5XINA 1US2A 4U3AA 4M6VA 2CFFA 3VFLA 2WHLA 1PXGA 1DJYA 2PAJA 2WMKA 4YNGA 2QUUA 6TAAA 2YLLA 2NWSA 4PBFA 3WDIA 1EOKA 3GDMA 3OYXA 4PEKA 2WLYA 1G0CA 2PLJA 3FA4A 4MUPA 1CXHA 2E9MA 3TA6A 4RZ5A 2GJPA 3LLXA 4S38A 5DELA 4Z0JA 1WXYA 2J7DA 4RE0A 5AZ1A 1YNPA 5IOBA 2D0HA 4PCPA 4KFPA 7A3HA 5FJRA 4DBUA 1E73M 3N73A 2ADAA 4LBRA 5FEWA 4JY9A 5JBDA 1CWYA 2B4GA 3AMCA 1Q6EA 4KF1A 1K8YA 3UQNA 4LCRA 4J28A 3U5UA 1I4NA 2OR2A 2VQTA 1X8CA 3CTTA 4NY2A 5FF0A 2FH6A 4UTMA 1E1CA 2VKZG 2WVVA 3QHOA 5ENLA 3VNMA 3AI0A 4FXJA 3OYZA 2Y7GA 3W1TA 3SCSA 2W4XA 1ZJAA 3TONA 2AOSA 3RX3A 3GNPA 3SRDA 4MZYA 1RLCL 1U1JA 2E67A 3C2OA 4NYUA 3F4CA 1AW1A 1JGMA 3MI3A 1L2QA 2FTPA 1PUDA 4UQ9A 1UQZA 1LCOA 2NLIA 2DSUA 3SCOA 4OOUA 4QTGA 1XL9A 5C6MA 2DDXA 1VP5A 3L4TA 2P1FA 3O15A 3CWHA 4AZ5A 1DHKA 4DUOA 3W07A 2ZX8A 2BXZA 2CKSA 4HSHA 3AU2A 4TV5A 3W74A 1AH4A 1JUEA 4PE8A 2IKJA 2X1IA 1FWAC 4IPJA 4J9JA 1WDDA 2WB5A 3CYJA 1DP0A 1TZ7A 4ZENA 3QLLA 2QJNA 3OZPA 4UZSA 4HHHA 5JXQA 3TZNA 3KL0A 2XIMA 4MSSA 4S3FA 3L21A 4O10A 1EL3A 2IQDA 3T1GA 2YDQA 3N4FA 5I77A 5A8OA 3WX7A 2Z29A 1OX6A 3WH7A 3H4WA 4TXEA 1LQ2A 4O1AA 4ZXOA 4CNOA 1MW3A 1NOUA 3BJFA 1GQIA 1S38A 3CL6A 4H4IA 1JZ7A 2P76A 3NPVA 3C3UA 2VEMA 1O68A 3W7HA 2OGYA 4B5XA 1VH7A 2EPKX 4Y9AA 4W93A 4L4LA 4ROPA 4NG3A 2OTDA 1IZKA 4RZBA 3W72A 2YPIA 4C6MA 2WVUA 2VP8A 4KERA 3W85A 4DF1A 4UZUA 1ZTVA 1F8IA 2QIWA 3K4DA 4HCDA 5CBJA 3GXMA 1IGSA 1GOXA 3EPOA 5D2WA 1DWJM 4O1BA 2PWEA 5C9WA 4ZE5A 3LV6A 2BHUA 4KEMA 2E4TA 3SRKA 4KWSA 3UESA 6A3HA 4I9AA 3O05A 2XGBA 4ILSA 4PL2A 4FXSA 2PTYA 4NU7A 1XLHA 1Z41A 4IHCA 4M24A 1WAWA 1GYLA 3B06A 3SUUA 1IT0A 3TN3A 3VIFA 4M0XA 3CMJA 2BNJA 3W81A 1R86A 1XPYA 2PA6A 1E0VA 3IK2A 1WA3A 1RD5A 2ISFA 4AB4A 1EGVA 2WSPA 2J25A 1XV8A 5FJUA 4Y9MA 1R0MA 3A21A 5H1WA 4JTRA 2OZ8A 3MUAA 3CQJA 3PN8A 4PTDA 4TU1A 3VK5A 5JMUA 3SCPA 3RF9A 1ONEA 1XYBA 4JBRA 3L5LA 1OFAA 6REQA 3KWXA 4LAMA 5HWJA 4XVDA 1SZEA 1OYCA 4I7UA 3N2MA 4R7OA 4Z2HA 3E5PA 1RP9A 4A3QA 1HJUA 1REQB 3RILA 1ZAIA 3B9NA 5IHSA 4JHMA 3FLUA 3RDKA 1OABA 2W61A 3QOKA 4O4WA 4DJFA 4BZYA 2IXUA 3OGSA 4AWUA 3TJXA 2V6AA 3STPA 4YTSA 2R82A 3WDJA 4Q8UA 1EEPA 3C8NA 3NUKA 3VKBA 3OGVA 1EX1A 4WJ8A 2DORA 4ADTA 1ISZA 2RAGA 1Q6RA 4QCFA 4DYEA 4UBPC 3E0WA 4WR3A 4BEQA 1HGWA 5EYWA 1H41A 1ENUA 4MWAE 4HNLA 4FF7A 3EB2A 1VFTA 2PGEA 3GH4A 4L1GA 4MADA 5H6HA 3CUGA 4U2YA 5EMJA 4G7EA 1UZ4A 3GIPA 4PUDA 2ZA2A 4JYFA 4TVUA 5AYIA 3N18A 4W85A 1WO2A 4N9BA 5TIMA 2VZSA 2ZUSA 4PUNA 3W53A 4QS5A 2I5IA 5T26A 1QW7A 4H7ZA 4JL1A 4JTHA 4FB7A 3SB0A 4PBGA 2JKAA 3N2CA 1I6NA 2PS2A 3LCXA 4F40A 1TJRA 4MB1A 3HQOA 3GC5A 1KCZA 5BRQA 3RCYA 1VYRA 3FV9A 1VYPX 3V35A 3W2MA 4AW7A 2DH2A 1K77A 3VILA 3R0KA 1GONA 4PTMA 1M65A 3TZFA 1HKJA 3PP7A 2PU1A 1Q8JA 3PF3A 4NX5A 4GKLA 3WNOA 3KE0A 3VKCA 1F4AA 3EX2A 2O9TA 4QNWA 4KWVA 2IPJA 3G0SA 5DXXA 4PL1A 2FPTA 2YW4A 3GRIA 1NWSA 3TE9A 3S1UA 3FCPA 1PKYA 4PMDA 3UT0A 4O52A 4DPQA 3W37A 3AIVA 1ITUA 4ZQOA 3UXDA 4PB4A 1XIFA 3CL8A 2V68A 1B4EA 5EBUA 3KDOA 1KM0A 5HAOA 1UKSA 2HPIA 1PZ0A 4DJFC 3S6TA 4H9UA 1E6ZA 4GQGA 3A3HA 4RDZA 1JGIA 4NF7A 2GQ3A 3EYPA 3WNKA 3GNOA 1UWQA 5J8LA 1DQUA 5CZKA 3UVAA 1UG6A 5D33A 3TQPA 2AQOA 1HJQA 4MNMA 4L9ZA 2CBUA 2ZDRA 3AUJA 3O06A 4M6PA 1ZU8A 5DCBA 4DJDC 2Y88A 2HXUA 4Y9PA 3AIRA 4MVAA 5ABEA 2Q09A 3NZQA 1J79A 5CSRA 2HQAA 5U7SA 2O7QA 4D6JA 1FWIC 3DFSA 5CGMA 4NNCA 3ISIX 3KZPA 2WSRA 3WMSA 3FYPA 3ZJ7A 2ZZ5A 1BAGA 3B8DA 3NQEA 1VLWA 3KTXA 1H50A 2ZOXA 5M17A 1U1UA 3EX3A 4KCWA 3MSGA 4DRSA 3SGGA 3PUGA 3AJXA 4UTKA 1ISXA 1M04A 4A2SA 4LPCA 2HSAA 4LUTB 1RJRA 1GG1A 1V93A 3NR0A 5MKGB 1R3VA 4GOAA 5CPLA 1C8VA 3LZ3A 5C0QA 5FACA 3V0TA 1QNPA 1UA3A 3N6HA 3PZGA 2VFDA 4F0HA 1W3JA 1PX8A 3AROA 4EVZA 5FI8A 3TNBA 2HK0A 1S2AA 3GWQA 3ENLA 1BQGA 3F2BA 2E8ZA 5FOOA 2WQPA 2V3DA 2C13A 3QJAA 1ZPTA 4CCZA 4PR4A 3KOXA 3WFAA 3F03K 3TYDA 2NVCA 1PTDA 1CI1A 4FI4A 3BZJA 5HMFA 3F4NA 1AH0A 4XUGA 4QJ1A 4OZOA 1CXIA 4W5ZA 1QT1A 3F5KA 1LWIA 2CXEA 1WE5A 1EZ2A 3HPAA 4BCEA 1AQ0A 3QPYA 1B3WA 3O2LA 2IXVA 3ID7A 4GUJA 2NQZA 3CHFA 1ITCA 4D6CA 4NZFA 3TC3A 1RUSA 5REQA 2G37A 1E3ZA 3IV3A 1U5VA 3L0NA 5T91A 3VOJA 1LWHA 4JKMA 3OZYA 4MTVA 1I2PA 3OQEA 1O1HA 3NQMA 2J47A 2VJXA 2D2GA 3ZVHB 4IMFA 3CH0A 5IBXA 1B4KA 2DW6A 3ZLHA 5GPRA 3EGJA 1UH4A 4DELA 3HGJA 1X7IA 2WMHA 2A6LA 1XLAA 2VR4A 1EA9C 3SR7A 3M5VA 1IWPA 1AH3A 4MY8A 3L68A 1PYMA 4B4FA 4JEJA 3POCA 3GNXA 3OLIA 3DIPA 2ZZ1A 3ABZA 3N19B 1UUQA 1RCXB 1KBBA 4NZ1A 1NWTA 4XX6A 4DAIA 1GVYA 3KVLA 5A2CA 4D8LA 3NDOA 3DU0A 3LCWA 4HHLA 4A3YA 2IUZA 3ES7A 3ARWA 3M0LA 1HJXA 2C15A 2GWGA 2GVLA 1F3TA 4HZ7A 1WYIA 1K6WA 5C70A 3IJLA 3SCWA 4M5PA 3V16A 3S6DA 3G1XA 2ACQA 1L0PA 3B0XA 3S5ZA 1LWJA 3AS2A 4F79A 3DHDA 5LHEA 4GQ0A 4EANA 1VFMA 1V0NA 2A0NA 5CGQA 3LS9A 5LXXA 1OYAA 3VCRA 1OCQA 1H5VA 2J7GA 1FDYA 1AVAA 1OF8A 2CWNA 3VNLA 1J0KA 1J0YA 2WM0A 1EKOA 1OC5A 3AZTA 4AVOA 1PEZA 5DFAA 2GJXA 3WFLA 4A35A 1AG1O 3TW9A 2GYIA 1A5SA 1RLDA 4GX9A 3ALGA 3MA8A 2RUSA 3NQ6A 2PDCA 1U33A 2WSYA 1X6NA 2VT0A 4AF0A 4JQ1A 1KQYA 1ZGDA 1TWWA 3TJIA 1N8IA 4O1EA 1SR9A 2WVTA 2I9UA 3WBYA 1A4MA 2NT1A 1IE7C 3NL5A 2H3DA 2PRHA 1DE6A 1F2JA 4DVOA 2YOCA 1U5HA 2BTMA 4CNUA 4HTYA 4DLFA 3MB9A 3I7QA 1V7YA 4OECA 1DXIA 1BF2A 4HOZA 5LSMA 4PMJA 2SFPA 1XFBA 3FS2A 2BX7A 1IHIA 4E38A 1DIDA 4DZHA 3CK5A 1W3HA 3DZ1A 4PULA 2WCAA 2DJLA 3LTPA 1GTHA 4D6IA 5KZEA 3AXMA 4GZEA 2FVLA 3S9IA 3U57A 2VUNA 5I09A 2RDWA 4Q4RA 2G3MA 1QNSA 3C86A 3B9OA 3MYPA 1HIZA 2QHAA 4H41A 4QE5A 1Y5XA 4MKSA 1TPDA 4P7LA 1NOWA 2W66A 1EZWA 1MXGA 1ZJBA 5LNUA 3WNLA 1KLZA 2Z7KA 2B7PA 2G95A 3EWWA 3W7RA 2POTA 1VLIA 2YBVA 3R13A 4XVEA 1U30A 1Q6CA 1ZP3A 1GNXA 4FXFA 4XKYB 9RUBA 1PWMA 3F2CA 5I3DA 4UMBA 3L4VA 2X1UA 2AAAA 1HF6A 4ZOCA 2EBNA 2D0FA 4B2DA 2CERA 3CS2A 1W31A 2YIHA 2OSWA 3VD9A 3M6DA 2A2IA 1BQCA 3EA3A 4WY0F 1QTWA 4L6HA 4Y7EA 5BWFA 4AZCB 4GQRA 1CT5A 4BR1A 3G1AA 1WBHA 1K7XA 4HZMA 2A3EA 3A3WA 8XIAA 3GX9A 5E0FA 4UQAA 3W7KA 2B7QA 3RXZA 1H7OA 3MUIA 1QK2A 5LNRA 1DPMA 4NJJA 4KEVA 3WSUA 5LIXX 2P10A 1SFSA 3VPLA 1V6UA 3IAPA 3HFTA 2D2JA 1EBGA 4V1XA 3H8AA 1CLKA 3GU1A 1J6PA 5I3KA 4ZEPA 1GPWA 5TNVA 4DN1A 3C56A 1MXDA 1HL8A 4IQEA 4QIUA 4UTTA 2B31A 1WCGA 4HA0A 1JCMP 3R1ZA 2AL2A 2NT0A 4B91A 3B0VC 1U5JA 2QDHA 4Q33A 1TWIA 4N6EA 3KVKA 2JEPA 1FKWA 4DO4A 3ZXWA 2HBXA 3G8EA 1TWDA 2AL1A 2FHCA 1EC7A 4UFMA 3VKDA 3OLDA 1ITXA 4XAPA 4NRSA 4PTWA 1CLVA 4QX4A 1MXSA 1OC7A 4G7EB 3WBAA 3K1DA 6ALDA 2A1YA 1XS2A 1Y0EA 4I6VA 1DXFA 2HNHA 2NQHA 2PDGA 3GVWA 2B0MA 1RPXA 2NWRA 4S3AA 3WL1A 4WGXA 1J4EA 3VNJA 4A8IA 5AYBA 2V67A 3CHDA 3AS1A 3P93A 4JTSA 3FW6A 3GB6A 3DFTA 4AYGA 2Y8UA 3MUY1 3QR3A 5CZSA 5TF0A 2WK2A 4GY7A 1XKYA 4JTFA 2NW0A 3ZQ9A 1MRAA 4KMQA 3P5ZA 1BRLB 3WBEA 1JRCA 3VFCA 3FKRA 3ZLFA 2QGYA 3PJWA 1D8WA 3RUBL 1EGMA 1P0KA 3R2GA 4UFIA 4WKHA 1ZZMA 4HU0A 4ZSUA 2JGQA 3B8UA 2KX9A 2HS8A 3W6LA 1DJHA 1QPNA 4FNPA 3ZYZA 4PBEA 3MV01 4GY1A 3MHFA 1E3XA 3BAWA 3CV6A 3GXTA 5H2ZA 3APYA 1NSJA 3V1PA 4QHRA 5AC7A 3NO5A 4O17A 4IJRA 4AEFA 3JZEA 3DFYA 3VIIA 3GAYA 4REQA 1M53A 2DGAA 7PTDA 4AMAA 3SI9A 1RVGA 1BSIA 4GNJA 4DXVA 4C1NA 3LM3A 5HNUA 1A5MC 2VYOA 3UG3A 4A05A 4ASTA 3CPRA 3B8VA 4GJIA 4P7OA 3SUWA 1EUAA 2B7NA 3UWWA 4UFLA 2W9MA 5A8NA 1XCFA 4N9CA 3SRHA 3HURA 1MEHA 2QLYA 3LI0A 4GNKB 3II1A 1R9YA 2YSWA 1JZ2A 2X1SA 5CGTA 1DVJA 1X1NA 4NSBA 1KBIA 4CD6A 2ESCA 3WLJA 2J7EA 3BMXA 3WLKX 2A3HA 1PVNA 1TPUA 2BZNA 2XWDA 2D2OA 2Z6JA 3VM5A 4P5UA 2YBUA 2Y62A 3EKZA 1E9LA 4W88A 4DLMA 4I90A 4Q4PA 3MHGA 3UNDA 2D24A 4V15A 1QPKA 2D0GA 1JXJA 1DWGM 1E6SM 1B90A 1BPLB 4JX5A 4JX4A 5F2GA 3AFBA 5E9XA 3JS3A 4PCNA 4GIAA 2Z2AA 3EOEA 3LQGA 4A3UA 4ZL1A 5K4XA 1F61A 3MHUA 1UJPA 2B81A 4MY1A 3CT2A 1XJBA 3K13A 4DM2A 1ZAHA 3WLTA 2WAGA 3U4FA 2QT3A 4H9XA 1GT8A 4ZVJA 3HPXA 2XH7A 4IPLA 2YCLA 2YA1A 1QOXA 1OEPA 1GW1A 4ATLA 1CPUA 3QQWA 2ZUUA 3NSMA 4MM1A 4Q8MA 5DANA 3WD3A 3JW7A 4O57A 3DXIA 2PDLA 4XAZA 2DH3A 1RAKA 1R2TA 5GNYA 4D2JA 2PP3A 3SIZA 4UFKA 1CB2A 1IEWA 2AQVA 1KWKA 5AHIA 2QV5A 5JBFA 3STCA 1GTEA 2DUZA 2WNZA 4E2BA 1I1WA 1YEYA 1JCJA 1UZ1A 1RY0A 4J40A 3QTPA 1UWTA 4E8CA 1GOMA 3W22A 3QLDA 2I14A 4NAEA 2X8RA 3VD3A 3GR7A 3SIMA 2JIEA 4JQ3A 3ARVA 3M4HA 4JTKA 3EWCA 5C2XA 1LQ0A 1UKTA 1EJVC 4JTTA 2H8ZA 5CPMA 5EMLA 4Q4OA 1W9DM 2VEFA 3WMBA 3H24A 1B31A 1LRTA 1H09A 3CQHA 4F8XA 3AYVA 3QKZA 5F2MA 4RDWA 3CV2A 2ONEA 1NDVA 4PB3A 4IT1A 1F07A 1J01A 2VZUA 1PB0A 2ISDA 3T05A 2BODX 3H54A 5FJIA 3M0ZA 2DZVA 3C4UA 5FAGA 2NXGA 3T2OA 3AO0A 1LP6A 4UTUA 3G1VA 4PMVA 4XKMA 3A4AA 1CB7B 4WHBA 1FFQA 5FJPA 4M6QA 4YYCA 4DI8A 2DT3A 5EMKA 3PULA 4H9MA 2QDDA 1JZ4A 4LY8A 3K8KA 3M44A 5FJOA 3FJLA 2J66A 5LA2A 2J4GA 3WF2A 4IIBA 2BOGX 4TIMA 3UNTA 1E70M 4FXRA 2XYLA 3LHTA 1TPB1 5BU9A 1L6YA 1GEQA 2FPVA 4QLLA 5C9ZA 3I6RA 5JIPA 4IWWA 5I3FA 3OLGA 5AOUA 1SJCA 2IQ0A 2BVTA 5D2YA 3LGEA 1WUFA 5G2WA 1DEDA 2D22A 1KA9F 1ZP4A 3NJ3A 1W3LA 5DBUA 5HWNA 2NVAA 2UY3A 4RW5A 3W7EA 1NVMA 3A9BA 1DJZA 3VIMA 2CHRA 1H1ZA 3KLKA 4EE9A 2E77A 2VO5A 3SM0A 1JI2A 3ZVHA 2XSBA 3N3MA 1KFJA 4EPKA 3LMYA 1IV8A 1G67A 1P5BA 1FDJA 1UR8A 1IXNA 2YCLB 1XC6A 4Q8NA 5G5IA 4MB4A 4WIWA 3T08A 1FWJC 3M0XA 1KFEA 3SN0A 1IZJA 1JYNA 2F8QA 4QG9A 3O3RA 5E1QA 1FWNA 3GY1A 3TDFA 4MNKA 3OODA 1ISYA 4IP7A 4AIBA 4JKLA 1ME7A 4P7NA 2IKIA 3I4KA 2DIJA 1PX4A 2OZ0A 3T9PA 3NXFA 1KGXA 1XR2A 4F48A 1BHGA 2QZRA 3WK2A 3PS7A 4OV9A 1S39A 1W8SA 1D2KA 3DC0A 4ATWA 1RH9A 1TWZA 2Y2WA 2ISWA 3B8WA 1GG0A 4RCXA 3W2NA 2VDHA 1MUWA 3ERPA 1TPWA 3NQ2A 3FHAA 4H9ZA 4RXFA 3VVGA 1MNZA 1W0MA 1N8FA 4C1LA 3PJTA 1QCWA 1OGGA 1WB0A 3RX2A 1RD6A 1LUCB 1TRIA 4UXDA 4NRRA 1ADDA 2FGBA 4KEZA 1ONRA 2V2CA 1AL7A 3L2LA 1VFOA 4OUIA 1QDSA 3OG3A 5E0CA 1F3XA 3MUZ1 1LTDA 4JTAA 4K39A 1X6UA 3RLUA 3S8HA 3S1WA 1R30A 4FALA 1W9VA 4MDOA 4Z1YA 3B8SA 1A5CA 2HNEA 4XZ9A 3W29A 1Z48A 4J3VA 3NXLA 3ZOAA 4BWLC 3VMNA 2OT1A 3SJNA 2GDUA 4LF1A 2ZZ2A 3NA8A 5H8PA 3H2AA 2FVKA 2YLAA 4NJGA 2VFEA 4AD0A 2VFIA 4YJ5A 3ZO9A 3F4WA 4FLQA 2NQ5A 4L1WA 4KGLA 1VRXA 2DVUA 1P6WA 1EXBA 1Z3NA 3NCOA 2WLZA 1CXKA 5DY3A 3VMOA 1ODZA 1WZAA 3AIQA 2I9EA 3ZT7A 3RM8A 2GJLA 4O53A 4JNMA 1UWRA 3W7IA 2ISVA 2QIIA 4AXNA 4J4KA 4HCLA 4MPQA 5GJNA 1Q65A 3CB8A 4J2PA 4F0MA 1HJVA 1DWIM 2XVKA 4U31A 5BRBA 1EJRC 4U5KA 4C7GA 4AD1A 1RALA 3L0KA 2XDFA 3BCFA 1SZRA 3EX6A 4AEOA 3W2LA 3C2RA 1TCDA 3KBMA 4LVBA 2IPWA 4Z0SA 4E4FA 1AMKA 4IUGA 4O0KA 3PJXA 1BYDA 3V3WA 3LRLA 3G6LA 2YCKX 3VDBA 4NXSA 3PANA 3V75A 3T44A 3W7QA 5KSWA 1M68A 4XZHA 3URNA 1UH3A 1J6OA 1XRSA 2EPLX 1UKOA 2VC6A 2VCAA 4EAYA 3EZ4A 2PWFA 2EGZA 1H3GA 3CUXA 5FCZA 4U28A 3WH9A 3D3AA 4QP0A 1BG9A 5AVNA 4MYXA 5AECA 1R47A 3IJ9A 2D3NA 2G5WA 1O1ZA 4OWGA 2GSJA 5EA9A 4IGHA 3P80A 1RQBA 2P0OA 3BJTA 3WUGA 3H7VA 3WMLA 3T0DA 3NQAA 3OA5A 4S2BA 2V82A 4H01A 5A95A 5LIKX 2JF6A 4HVXA 1W37A 2DSVA 3GHUA 5E5CA 2E5BA 2WHJA 3CQ0A 4PCSA 1U1HA 1G01A 3W1RA 1SO3A 1TUFA 4P8WA 2XINA 1PE1A 2NLYA 2WPBA 1CX9A 3T55A 1KM2A 4GI9A 4KWOA 2PZNA 2GGJA 4UOZA 2O55A 1R7OA 2C8NA 1J93A 5AC8A 3C5QA 1OFRA 1UR3M 2BVWA 1BWVA 2R6OA 3DESA 3MP4A 3STEA 4B9YA 3DHFA 4AD4A 2XGZA 3GR4A 2GQ8A 1XDLA 1Q6QA 1JR1A 1KRMA 3MCMA 4P8UA 1W5NA 4CCDA 1UA7A 1EB3A 3ECQA 2ZZ6A 5FL0A 4IISA 4OJYA 3EKLA 4JFVA 3B0YA 2WNQA 1G94A 2XSXA 3UCDA 2GK1A 4K7VA 4Q8TA 3UP8A 3IRDA 1BG4A 3GYEA 1P43A 4R88A 3PWIA 3GXFA 1GVQA 3CUFA 4PUJA 2Q8LA 4B5UA 4Z2IA 4MB3A 2X41A 4JY8A 1EJTC 1RR2A 2Y6ZA 3IJ6A 1I75A 4XD5A 3CXOA 4BFAA 2OLSA 2ZUTA 3EWBX 3GFZA 3CAQA 1LUCA 1M3UA 1H49A 2YR1A 3CTLA 1FP8A 5CZ0A 2C71A 1NAL1 3GAKA 4Q8WA 1IXQA 3VKKA 3WENA 4EF9A 2JFEX 2Z1SA 4W5UA 1GZ1A 1TZZA 2MANA 4WSKA 1HJSA 4Z2JA 1VPYA 3BAXA 2VQUA 1R9XA 1LOQA 1JYVA 3TXVA 5KZ6A 1TMLA 4JIRA 3F2DA 5LA1A 3HMCA 5I3GA 1UZDA 3AYSA 1TQXA 3QR0A 2PD5A 1JQVA 4L4OA 4DXKA 3BSMA 4J3UA 1BTCA 5BW6A 2BG5A 4E3VA 2QKFA 4B3LA 3Q58A 4UTHA 3K1GA 3S42A 1HO4A 3LHWA 1GK8A 1A47A 3IAQA 1X1OA 4CU6A 1W5PA 2Z1BA 1Y7VA 1EDGA 1R3RA 4DPPA 4OQVA 2W62A 4RZ4A 4BF7A 4QDWA 5ABFB 3U9IA 4LC8A 4GISA 2YW3A 3ABQA 3KM8A 3NPWA 1OZMA 3QC0A 4C6NA 1SO4A 4LW7A 4UTJA 5AC4A 3FEMA 4O0QA 2HVMA 4U33A 5T9BG 1RA0A 2XGIA 1B3XA 2CZVA 4KQNA 3PC0A 4ERAA 2PEVA 4C6CA 2IMRA 1JZ5A 1XLGA 4WOZA 1FH9A 1FKXA 1P48A 3I7SA 1R8LA 4KWUA 1XYLA 3IJ8A 1OADA 2WM1A 1HP5A 3W1AA 2PDKA 5G4WA 5C54A 2VRQA 2P0IA 3WQWA 3LOTA 1TFVA 3MW7A 4FEZA 1R85A 2V8ZA 2KZHA 2NUXA 3P5YA 3UZYA 1OSEA 4DJEC 4JGDA 4M80A 2VFGA 2PP0A 1YNYA 4FR1A 4GI8A 3KBVA 4LYKA 1S3HA 1O66A 1QMLA 1J18A 2DZPA 4C6JA 1XYFA 4GRSA 2ZTKA 3OP2A 5LYRA 1AJ2A 4HK6A 3W70A 3R89A 1GJUA 2FZDA 3EAUA 2E6FA 3H53A 4GYPC 2O4QA 1HL2A 5KTLA 4XK2A 1ODUA 1QR7A 1YDYA 3KL3A 3VABA 4C1NB 1TPC1 1SSGA 3VIPA 1FFRA 1KM4A 2GUBA 2D20A 5H8UA 3VZZA 1FOBA 3H12A 1S2TA 1WZLA 4QLKA 5IM51 1DXEA 4Q7IA 5A8QA 3THAA 3ITLA 4A4AA 2XIIA 4LS2A 1QBBA 3RO6A 1Q7MA 3MPGA 5LHFA 3CL7A 2PGFA 2Y24A 1JYWA 3CMGA 3EPNA 1GQJA 4LUJA 4LUYA 2OXNA 5AYYA 1MI3A 1W1A1 2VL4A 2X30A 3QQ0A 5D30A 3ARTA 3JU2A 3RIKA 4AU0A 4J27A 5BMWA 4X9SA 1XBVA 4HK7A 3DG6A 3S2CA 3UXLA 4JNZA 1EHAA 1PZ3A 4HSOA 3NM3A 2QCEA 1JG9A 4H2HA 2V30A 3WK0A 2YBTA 5RUBA 5FD0A 2P8BA 3GDTA 4W7WA 2F6XA 2Z26A 2R1LA 4YS1A 1KM3A 2QEZA 4GVIA 3N13A 1C90A 2WQDA 3VXGA 5DY2A 3ARUA 4L6DA 5D2TA 4QFUA 3U48A 1H7NA 3UWVA 1M6JA 2DUAA 4JTJA 2RJGA 2IKHA 3CM4A 3TWAA 1TV5A 3W4RA 3L4YA 4GIYA 3G0UA 4TX6A 2OO6A 2DJXA 5I3IA 3MANA 3WBWA 1D7FA 7TAAA 4XBKA 2FLIA 1ONXA 1CGXA 1KTCA 2YZRA 4FR6A 2J62A 4DX3A 1DORA 1T99A 4TX9A 4QS6A 4UTWA 1FWTA 3G2GA 3I68A 2RKXA 1H7XA 3ZIZA 2CBJA 3UZXA 1QUMA 4LCQA 4FLRA 2VTFA 3IIZA 1CGVA 3KVJA 2G41A 4XISA 3Q67A 4K37A 2FB3A 3VDAA 3BV7A 1ADOA 4IM4A 4NZ4A 4CCCA 3S5OA 3LM7A 1T7LA 4AFYA 2CZDA 3CEPA 1DKWA 3AMLA 4X63A 7XIMA 4L7ZA 1GVSA 1TPH1 3HN3A 3PZIA 3ITCA 3TUUA 1UMYA 1ZAJA 4A2RA 1YX1A 5HATA 3W7OA 4UMAA 1FHUA 3QZAA 1H2JA 2VEKA 1P6BA 4N02A 4I8DA 7ODCA 4B5NA 1RSCA 2NUYA 4K8HA 3VOCA 3ZZ1A 4ERIA 3SO7A 2Y8VA 2Y5SA 3PZVA 4BI5A 3GW0A 2X05A 1V3HA 3M0YA 3IS4A 2VWTA 4JTGA 3ZWTA 1SGJA 2X2YA 4MJ4A 5F2IA 2WZHA 3T4WA 1GOKA 3TFXA 1E9IA 4HYVA 2FTWA 3LPGA 2FB2A 3N9KA 2H9AA 1UD8A 4RLIA 3WJYA 1UOKA 1R3SA 3W1MA 3VCCA 2INFA 1Q2SA 2QUTA 2YFNA 3E2RA 1FH7A 1YW1A 4GGBA 4RL3A 4XUYA 1B3ZA 2EKGA 1CXFA 4MIMA 4ZB0A 3NQDA 2E09A 1XQLA 3CIVA 2W27A 2OOGA 4MAZA 2O92A 3WCZA 3S5NA 5FAJA 2HPMA 4B5SA 2PDHA 1B2YA 4X0NA 3SUTA 3IUHA 2ZX7A 1XW8A 3CYVA 1UP0A 4MMWA 4CD4A 2ZXDA 2CEQA 1KCLA 8A3HA 1W9PA 3AOFA 1XYMA 2WJZA 3GVQA 3GVGA 2D2HA 1PCWA 1JFHA 4X0VA 3Q65A 1JNDA 4DHGA 3AHVA 3GG7A 4GUHA 4BI6A 1H51A 3BSHA 1HP4A 3KOFA 1F5ZA 4J5NA 3C3NA 3WO8A 2E6AA 1OM0A 5FL1A 1GKPA 5SWUA 3GU9A 3N15A 5A6SA 3GSMA 3T0BA 1R87A 4R9OA 2Z1KA 3SQLA 1C7SA 9CGTA 5GNZA 3GU2A 3EEZA 4AEEA 3WLRA 2CNCA 4ZR8A 3A4JA 3UF9A 3IPWA 1F76A 3WH5A 1TG7A 4V27A 3GDKA 1LRNA 4H8NA 2BV9A 5MF5A 1WKFA 3W7NA 3SCVA 3NZRA 4W7VA 3IV8A 1HL9A 3NQ7A 1PS9A 4D6FA 3MI2A 3PPCA 1JCTA 3O8AA 1MYRA 4H9YA 4WKAA 1LQAA 3NDYA 4A8NA 1RJPA 2HMCA 2J7HA 3W84A 2JGYA 5XIMA 2ZXQA 4J35A 1KNWA 5G1MA 3G1DA 4I5UA 3TR2A 3KOYA 4NASA 4GXPA 1XRVA 1B3YA 1SPQA 1QI5A 2I17A 3QRHA 2PDIA 3UJRA 5E6ZA 4A29A 3PTMA 3WNPA 2F2KA 1NP2A 1VJZA 3DCPA 1UD3A 4PMOA 1PSCA 3O7UA 4PUUA 5A5WA 3DOPA 1IZCA 3HG3A 3RNDA 3PZ9A 3URQA 3PSVA 2CLIA 3EDFA 4N4PA 4CNTA 3LXBA 3QMRA 1NFBA 3TLLA 4AZIA 1OFQA 1LL7A 4DYKA 4C1KA 3OBKA 4K8EA 1VAHA 5ECUA 4RJEA 4HSNA 1XD1A 3HV8A 3LX9A 6PTDA 4DO7A 5I03A 3BH4A 2WHMA 2GJRA 1YDNA 1YRRA 2UY4A 5E6YA 3AC0A 5IXEA 3N14A 4D1JA 4MFDA 5KZDA 3GFXA 1EP3A 2NXHA 4H6EA 5HPCA 1FDZA 1BFNA 4J3TA 1KXVA 1XH1A 3NL6A 3M1ZA 3FSUA 3IK4A 3L2MA 5AYXA 3N6QA 1IIGA 2EF9A 4HNCA 3AIWA 3L65A 3S6OA 4FHAA 2VOTA 3LN3A 1J9YA 1WDQA 2F38A 3TQ0A 3BW4A 1VYSX 4AVNA 4QEHA 1G69A 2HJPA 3PBGA 4E3TA 3H2MA 3GDRA 3P8IA 3IJIA 1KR1A 3KRBA 1E1CB 1ISWA 1C8YA 4XWUA 1EWEA 3INPA 4JCMA 1QATA 3ANYA 1TKKA 4HMDA 3WF3A 4YYFA 2HCVA 1HN1A 2QCLA 3KBWA 5LIWX 3TTYA 3MS8A 3CZ8A 2QCHA 5CPSA 1FTXA 3W2KA 4JAWA 3IJDA 2FHBA 3SW6A 4ORMA 3S1VA 2Z1VA 4FSAA 4GJ1A 4EF8A 1RJQA 2P3EA 3UY8A 4L4PA 4IQJA 3N1AA 2VELA 5LIYX 2ZRUA 4O14A 4WDXA 4N4QA 1CXEA 2CESA 2XN2A 1CGUA 4LQ1A 1LOLA 5D9OA 6TIMA 3SSJA 4O54A 3PB2A 4LNCA 2Q6ZA 3OBEA 1EQCA 3HJEA 3PB0A 4GINA 2PCEA 3LBMA 4BI7A 1J2WA 2XFRA 5DX7A 3PFMA 5EBAA 1GUVA 1HNYA 3TCEA 1MRQA 3GDBA 5H91A 4WUIA 2RHGA 1WPCA 1SVDA 2OGJA 4XAGA 4UTLA 4OUEA 2A5HA 1MZRA 2PWDA 5CC7A 1LBFA 4Y2WA 3UJEA 3AIUA 1QI3A 1KM6A 2VZVA 1SFLA 2DW7A 3GXNA 1TELA 4ZQCA 2Y5EA 3CHEA 3D5HA 3WD0A 4CEXC 1FWWA 1FWSA 1KR0A 5I7GA 4HNUA 1FWBC 1WBJA 4HPJA 4MWAC 4CQDA 7ENLA 2BMBA 3CQIA 3C0QA 1G7UA 5FF3A 3L2IA 3H2OA 4D71A 1W54A 1UWSA 1QXLA 2UBPC 2Z24A 5GJPA 4HHPA 1E6NA 4WK9A 2PGRA 1AQFA 2YB1A 1WUEA 4JHOA 5K9XA 2DZBA 5DCEA 1OCJA 1DQWA 4N7QA 2QCGA 2QPUA 1R46A 4GKTA 4AZ6A 4XO6A 4PUMA 4EAMA 1NDYA 1ONWA 4UNIA 3CLMA 4PRRA 4YIWA 2ASHA 4AH7A 1S5TA 4TVDA 3GXDA 2I16A 3DGBA 3FVDA 5CPTA 4QITA 1OD0A 3VNIA 5HK4A 1SJDA 4F0SA 2QYGA 1HO1A 3KXQA 4C6QA 4P8VA 3RLHA 2VX5A 3MZNA 2RFGA 2INZA 2XUCA 2R14A 4Q8OA 4S3KA 3E38A 3DENA 4L65A 2A3AA 2R91A 2PLMA 1W1YA 3TN6A 5C9RA 2ZX9A 3S83A 4GA8A 4ZOEA 1ZUAX 3R25A 1VHCA 4PMZA 1OVDA 1KRCC 3R0DA 3V5OA 1ZS2A 2PDYA 4X61A 4C6KA 2VD9A 5AZ0A 5CZTA 3RGTA 3R79A 3EWUA 4LRTA 3DI1A 1V08A 3PPHA 5FJTA 5LZLA 5EMYA 3FFSA 5LNVA 3LY0A 1S2WA 2WMFA 3QH2A 2E9LA 2PRLA 3K46A 1M5WA 4BKNA 2Z28A 3T4CA 1NWRA 4CEUC 2FJUB 1A3WA 1VGAA 1V6WA 1JRBA 3C2EA 5I0DA 4C6OA 2IPFA 2AGKA 3HPFA 2W0UA 1G4EA 2PSNA 1F74A 4U2ZA 3AHXA 1UR9A 5AKQA 4D6HA 2QR6A 4LTSA 2AGTA 1A5LC 3S1GA 1REQA 5A94A 2DSWA 2DP3A 3E2VA 2IKGA 2J6VA 4LVFA 4CQ8A 1K8XA 1ZBKA 3ARXA 3OIHA 2P3ZA 1DWAM 4DUXA 1R6WA 1K8ZA 1UKQA 3DG7A 1E43A 4IIHA 4GYKA 4PUKA 2J6XA 1QW9A 4PN2A 3WLNA 2ZE0A 2D69A 2PODA 1LT8A 1SW7A 1YIXA 5CQ1A 3RPMA 3W87A 1GVRA 2TODA 3IWPA 3HGSA 1ISVA 5LGXA 1V8EA 4OGZA 2ZCGA 5M5DA 3HQ1A 4GG9A 1TCMA 4HK5A 4MKVA 3UERA 5JIWA 7REQB 3MU7A 1UWUA 4NI3A 4B16A 4DJEA 3PZMA 2EXOA 5CBIA 1RCOB 2ZWZA 3GH7A 1FA2A 4CVWA 4GYFA 3S4TA 5B7ZA 3CAWA 3AZRA 1PCKA 4O1DA 1VFUA 4I9JA 5C8BB 2ZZ4A 2V63A 4DQWA 1LJYA 3U0HA 1P7TA 4GH1A 4LAKA 3SN1A 3VGBA 1FWDC 1ZFJA 3UA3A 5K9DA 4FNTA 3KW3A 1XGDA 5D9MA 1OX4B 3BMWA 2VCCA 2E68A 1K4GA 4IXXA 1ICPA 2ZVRA 1RVKA 1E6PA 1Q7QA 2ATMA 3R4IA 1W5MA 4LX4A 5J5DA 4IXHA 4C6DA 3TH6A 4JOMA 1YE6A 1MW0A 1QI2A 4QXIA 2DT0A 1OT2A 4LAOA 3KOZA 2ZZ7A 4PMNA 4ZOBA 4O28A 2Q01A 4JQ4A 1KTNA 4BQ4A 3FX4A 3MKCA 1BXBA 1E6XM 4LT9A 4LAZA 2VHLA 3QOMA 4EIVA 4NQ1A 3BXWA 1HGYA 1T8QA 2WBKA 3ZJ6A 1OY0A 2QCMA 4MYAA 2GZXA 1QWKA 1KWGA 1BYBA 2OCZA 4DYJA 2HVNA 4UQBA 3S3GA 4C6PA 3VA8A 3LA4A 1UBSA 2QULA 2V0TA 3G5EA 2YXOA 2WV8A 1F9CA 3LHUA 2ZUMA 2G3NA 4G7FA 1VJSA 3PBWA 3B4YA 4CKQA 1IXOA 3SY8A 3RYSA 1TRDA 1V6YA 2VDIA 3MJYA 3MMUA 2WSKA 1QRQA 2QVNA 1L9WA 3P60A 4C90A 5M03A 3EWXA 4LWWA 5AVHA 4PEEA 4LAUA 3J7HA 3K30A 4US5A 4MFEA 5JQ9A 4NYYA 3DFPA 1XISA 4BHYA 1IYXA 2WKLA 3VOIA 3LLDA 3KDNA 3GBDA 2V5BA 2C1GA 1DIOA 1KKRA 2Y4SA 3N25A 2E3ZA 4ZB5A 5HNNA 3UGRA 5CJ5A 1Z8AA 3OVQA 2Z25A 2VDGA 4QSFA 1EP2A 2ZADA 4RK8A 4W8AA 3GDLA 2EKCA 4GXMA 4FA3A 3HQNA 2EJAA 3H2FA 2PGWA 3H2EA 3LGGA 2EAWA 5I07A 3M6YA 1E15A