4RDZA

Crystal structure of vmolac in p64 space group
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
315
structure length
314
Chain Sequence
b'GMVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
molecule tags Hydrolase
source organism Vulcanisaeta moutnovskia
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
total genus 123
structure length 314
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdzA00
2AQVA 3S2JA 4LFYA 3IACA 1UIPA 1A4LA 3PANA 1FWHC 3OVGA 1RA5A 4QS6A 2CZVA 3EWCA 1BF6A 4LCQA 1KRAC 1YRRA 4QTGA 1J5SA 2Z28A 4H9YA 3GG7A 1FWGC 4B92A 1EJVC 1P6BA 4OFCA 1A5KC 4PBFA 4C6BA 3RCMA 1A4MA 3MSRA 4I6VA 2OQLA 4EP8C 1GKRA 4KIRA 1XWYA 2AMXA 3IJ6A 4KERA 4C6DA 4QSFA 3RHGA 3QY8A 3LSCA 3FDGA 3PNZA 3E0LA 3SFWA 3LU2A 1RK6A 1W1IE 2WM1A 4C5YA 2DVXA 5FSDC 4IG2B 3D6NA 1GKPA 4INFA 1ONWA 2DVTA 1R9ZA 3N2CA 4Z42C 3B0XA 4G7EA 2O4QA 4H01A 3S2NA 2YXOA 2QPXA 5AKQA 2UZ9A 4F0RA 3F2CA 3V7PA 1M65A 3IRSA 1R9YA 2IMRA 1IE7C 4KESA 4IG2A 3LGGA 4LANA 2Z00A 2AQOA 4QS5A 4KETA 3GU2A 4GY0A 3S2LA 3E0FA 4C60A 3URBA 4IFOA 2VC7A 4L9XA 3GIPA 4PE8A 1XGEA 4IH3A 1FKXA 3MPGA 4IGNA 1O5RA 3URAA 2HNHA 1EJXC 3NQBA 4IFRA 3K5XA 4IQJA 3BE7A 1NDWA 3DC8A 3A4JA 4C5ZA 3B40A 2R1PA 1POKA 1ITUA 1FWEC 4DNMA 2A3LA 4YIWA 2YZ5A 1J6OA 2OOFA 4J5NA 1XRFA 1P6CA 1K6WA 4GXWA 3GTIA 1KCXA 1FWDC 1DPMA 2BGNE 2Q01A 2PAJA 1ITQA 1V77A 4DZIA 1E9ZB 2FTYA 2OGJA 2WJDA 1RAKA 2Z29A 3LNPA 3F4CA 4PBEA 3CS2A 4IFKA 3SO7A 2OB3A 3UF9A 2GZXA 3TNBA 2ICSA 2Z7GA 3FDKA 5A6TC 4G7EB 4M51A 4C6IA 4LAMA 3NEHA 2F6KA 2D2JA 2Z2BA 2Z4GA 2BB0A 4C65A 1O12A 3MDWA 4TQTA 2YB4A 3UR5A 4GY1A 4V1XA 4IF2A 3F4DA 1RA0A 4HK7A 4MUPA 4LCRA 2VUNA 4XD5A 4ERAA 2UBPC 1HZYA 4NG3A 2Z25A 4H9ZA 4F0SA 3OOQA 4I6KA 3AU6A 4GOAA 4R7WA 3PNUA 1A5NC 3QGAC 4GK8A 4QROA 4ZSUA 4KQNA 3K4WA 4EPKA 4GY7A 4GX9A 5G4HC 2QS8A 3ORWA 2HBVA 4G2DA 3WYZA 3AUOA 3QY6A 3B0YA 4PCNA 1R9XA 3S2MA 4C6LA 1EJWC 4HA0A 3MDUA 5E5CA 2R1NA 4XD4A 4ERIA 4H9XA 4P5UA 3PBMA 4XAZA 4BKNA 1FKWA 3E3HA 1I0BA 2FVKA 1UMLA 3LA4A 4IFKB 4QRNA 2HBXA 3LS9A 2EG6A 4XAGA 3FEQA 4DIAA 3WMLA 2VM8A 3QY7A 3MJMA 1POJA 3HM7A 2Z26A 1FWBC 2R1KA 4DI8A 3GU9A 4AQLA 1K70A 4C6CA 3T8LA 1EF2A 4CQDA 4B3ZA 3IV8A 5FSEC 1V7AA 1QW7A 3ID7A 3UR2A 1V51A 4L6DA 3A3WA 4DO7A 2Q09A 2PGRA 1QXLA 2O4MA 4C6JA 2ZC1A 4C6PA 4F0LA 3E38A 3LGDA 3QGKC 4RDYA 3GU1A 1FWFC 1EJUC 4GZ7A 1EYWA 3WZ0E 3C86A 4NI8A 2WJEA 4JOMA 4H9VA 3A3XA 1S3TC 3URQA 2GSEA 4UB9A 4RE0A 3EGJA 3ICJA 1PSCA 2Z2AA 4H9TA 3EWDA 4ICMA 3G77A 1A5MC 1FWCC 1NDYA 1XRTA 3TN5A 1GKQA 1ZZMA 2QT3A 4KEZA 4LALA 4C6NA 4IGMA 1FWIC 4EPEC 4CQBA 5HMFA 3TN4A 4C6OA 1RK5A 1P1MA 4LCSA 2D2GA 3JZEA 4D8LA 3TN3A 4GYFA 4LAKA 1M68A 4J2MA 2VC5A 1FWAC 3T81A 3HPAA 3E74A 4XD6A 4H9MA 2E1WA 3E2VA 3OU8A 3IGHX 1ONXA 1M7JA 4H9UA 3OQEA 4CNTA 3MVTA 4WHBA 3IARA 1YIXA 4CNSA 2OODA 2PLMA 3PAOA 2R1LA 4J35A 4C6QA 2P50A 1YMYA 4HK5A 4XD3A 3LY0A 4DI9A 3MVIA 1PB0A 4DLFA 4CEUC 3UPMA 1PO9A 4ZSTA 3KM8A 3DCPA 1EJTC 3ISIX 2FFIA 2GWNA 5LXXA 1UIOA 2KAUC 4LEFA 2Y1HA 4UBPC 4LAOA 3GUWA 1V4YA 1UBPC 3ITCA 4H00A 3GIQA 2QVNA 1RJQA 4GC3A 2FVMA 2R1MA 4RDWA 3OODA 2YB1A 4HJWA 2HQAA 5HMDA 4EPBC 3R0DA 4RZBA 2DVUA 4B91A 3MKVA 3S4TA 4KEVA 3UBPC 1A5OC 1KRCC 2PGFA 4WVXA 2XIOA 2E25A 3IPWA 4C6FA 5HMEA 1I0DA 2VHLA 4HK6A 4XAFA 2ADAA 3F2DA 1JGMA 1EZ2A 3GRIA 4DLMA 2EG7A 2VR2A 3DUGA 3RYSA 3AU2A 2GOKA 4C6MA 3CAKA 1KRMA 3T1GA 4NP7A 3GTHA 4C6KA 3GTXA 4EPDC 4LH8A 4DYKA 4ERGA 1VFLA 2W9MA 1NDZA 3MTWA 4CNUA 1WXZA 2EG8A 4RDVA 4PCPA 2FTWA 4E3TA 4KEUA 2Z24A 1V79A 1E9YB 2I9UA 2G3FA 3GTFA 3RN6A 3NURA 4RDZA 3HTWA 3LSBA 1K1DA 2HPIA 1NFGA 4BY3A 1J79A 4XAYA 1RJRA 1KRBC 3URNA 2GWGA 1ADDA 5CH9A 3CJPA 2RAGA 1PTAA 2WJFA 3K2GA 4CEXC 4DZHA 3F2BA 4KF1A 2ANUA 2PUZA 4C6EA 1A5LC 4GBDA 1EJRC 1RJPA 3O0FA 2HPMA 1YNYA 4GX8A 1WXYA 2P53A 4V1YA 4CQCA 1YBQA 3OJGA 4AC7C 2I5GA 4R85A 3TN6A 1YBQB 4R88A 1FWJC 4B90A 1J6PA 4BJHA 4WGXA 3O7UA 2D2HA 1NDVA 2Z27A 1EJSC
chains in the Genus database with same CATH superfamily
1UIPA 4LBSA 1G0CA 3M16A 4JEJA 2CWXA 3OVGA 2RH9A 3UGVA 3AHTA 1DP0A 1JXJA 3DHUA 2PU0A 3TV8A 1YRRA 4DXVA 3C2FA 3VDGA 2VYOA 1AH0A 1V5XA 1JRBA 5A6BD 3W86A 1LUCB 4GCXA 4AWEA 1EPXA 1FWGC 1SQ7A 1GVIA 4PTWA 3A4WA 3HO8A 1SR9A 1UP2A 1FCUA 1KW1A 1R38A 5HMSA 1OX5A 5K9XA 1U5JA 4MOZA 3E0LA 3KP0A 1NJJA 3ATYA 1ECQA 3MO7A 1XLIA 1EX5A 2QPSA 4RK8A 3DGBA 3N2CA 2NV9A 2FTPA 3BH4A 3FOKA 3PJWA 4ZVJA 2QUTA 4F0RA 1F5ZA 4J28A 4H7CA 2ZWZA 4J9JA 3AS0A 4MLJA 3NM1A 5FJOA 5B7YA 4B3LA 3E0FA 4ECLA 3ZWSA 1FKXA 1JZ5A 4BF7A 3VD3A 1TV5A 2J9YA 4QR6A 1E73M 3AJ7A 1YNQA 1QBAA 2AL1A 2XGBA 4ZB2A 3KRSA 2J8TA 1MMFA 3A4JA 4XVEA 1LWHA 3FYPA 1E15A 5BWFA 5I3GA 3UJEA 3I6TA 3IVSA 2ZADA 1QHPA 5A5WA 1V3IA 2REQB 1PUDA 1K9EA 1V08A 1H7WA 1LRNA 2ZZ3A 1XD1A 1G1YA 3SO7A 2EPHA 4L9YA 4O11A 4GRSA 3VNJA 4PMJA 1S2UA 3S1GA 4G7EB 3APYA 3IIOA 1OCNA 4F9DA 1CB2A 3OG3A 3OZYA 5FJIA 5KSWA 2NV2A 4DJED 4Q4MA 5AYXA 2CU0A 3UPBA 4EF9A 5KEZA 1GJWA 1WKYA 3V0UA 3L0KA 1UKTA 4WZHA 3U7BA 4GE8A 4YS1A 2YZRA 1FP9A 3RIKA 3DKJA 5HNUA 1DWAM 2QCNA 5FEPA 1TV2A 4GK8A 1X38A 3K4WA 5G4HC 3AYTA 1H7OA 4CU7A 1CYGA 3VCNA 4G2DA 4KWVA 1IEQA 1UWUA 5IFTA 4O4WA 3K1DA 3H2EA 3QY6A 2Y6ZA 1KBLA 1XR2A 1B9BA 3S5ZA 4GH3A 2Q02A 1BQCA 1DWHM 3TYCA 1WDDA 3PG8A 3WUGA 4MTVA 4C1KA 4E2OA 6ALDA 2EG6A 4Q4PA 4MJZA 5JBEA 5LIKX 1FWBC 4M6UA 1Z89A 2WW5A 3N6QA 4MSSA 4D6GA 2GJNA 4W89A 2FZMA 4OBTA 4BI7A 4HQVA 1NELA 1W9BM 3THCA 1T0OA 1TE6A 3A9IA 3MUCA 1BXBA 3E5BA 4ZO9A 3GWQA 4C6JA 5H1WA 5F4SA 2JIWA 2WLZA 1LQ2A 4IT1A 3B8VA 2WYSA 1TWIA 2RHGA 1TPFA 2XWDA 2VRJA 4JQ2A 1E40A 1P6WA 1S3TC 3URQA 2CZ5A 5CEWA 3QW4B 3S5YA 1VPQA 1JI1A 4FIQA 3LTYA 3AYSA 4XTDA 4GQ0A 4PYSA 5E9AA 3PBYA 4LUIA 4CQAA 1DJYA 1GKQA 2PD5A 2YDAA 4PCSA 2E40A 2PRHA 1YQ2A 2XSBA 3DH7A 3I4EA 4MDPA 3JZEA 3PB0A 1YTEA 3DG3A 3W1PA 4XO7A 4D6EA 2QYGA 4GYFA 4LAKA 4I8DA 1E0UA 1NWUA 4CU8A 5IFPA 2J7DA 1KBIA 2VR4A 4ZO8A 1ZFJA 1IXOA 4JNYA 4NZJA 1TIWA 4IQDA 1VBHA 4M0XA 5LIYX 1LZOA 2C7FA 2XFFA 2WZEA 3RMJA 1KKRA 2VTFA 3M7WA 4C6QA 1AZ1A 3LBMA 1ZGDA 4GPNA 1RVGA 1WB0A 1ZUAX 5DQPA 4AFYA 3P0WA 1TV3A 2YCJA 2OJPA 1VJIA 2YPIA 1XIDA 3ITXA 3UY7A 3W2NA 1WV2A 3SURA 3LERA 4Y9OA 1ZJAA 4B5XA 2A6NA 1B1YA 4JAWA 1XINA 3E02A 4WY0A 5H8UA 3B06A 3UD6A 3BAKA 1XI3A 2V6AA 1VLWA 2XSXA 4I5XA 5JUVA 2CBVA 3PB2A 3WUEA 4WVXA 1YKWA 4KRTA 4L1GA 1I45A 3RJYA 1DEDA 2ALDA 5EPDA 1LYXA 3LN3A 3RYSA 3BAWA 2JGYA 1UUQA 2H90A 3WLTA 4Z1YA 1QW9A 2HJPA 1DJHA 1LG2A 4O1FA 4HNLA 1JCNA 2HV5A 2AL2A 4M6PA 2VX6A 3F5LA 1DTUA 1KO0A 3G3MA 4EAMA 4XIMA 1JPIA 1TUXA 4QCFA 3E5PA 5I06A 3W7GA 3M07A 1HGWA 3VD7A 3NURA 4DJFA 3CLWA 1UR4A 1VB9A 1NFGA 4E8CA 3W72A 4FMVA 1OIMA 2J7CA 2WCAA 5JBFA 2E3ZA 1LOSA 2XWEA 2GWGA 3UJ2A 1JPKA 4S3FA 2WJFA 1XQLA 1ZJHA 2V3FA 5M03A 2ZZ2A 3G1VA 4OU1A 1R7OA 1SMAA 4O57A 2VWSA 4KFPA 2PDPA 2DZVA 1W3KA 3CZJA 5AC8A 3OIHA 2ZDRA 4RV8A 1YNPA 3HGSA 2C1IA 3WQ6A 5H8PA 5IRPA 2J62A 1ONRA 3EXSA 1FWHC 5D32A 2O7SA 4QLLA 4FXSA 5JIPA 1BF6A 3KL5A 1WPCA 1J5SA 1HVXA 3MCOA 5AHLA 2Z28A 5AHNA 3BURA 5XINA 1EJVC 1OJXA 1OADA 3C8NA 4JTQA 3HFYA 3EAUA 3QR0A 5EFFA 5DLCA 1K8CA 3NPVA 1OIFA 3WH7A 5JMUA 1Y5VA 5AVNA 4LUJA 3WELA 4NNAA 4L6HA 2E9MA 4NAFB 2PDYA 2BGQA 5BNKA 2WM1A 3I7RA 2DP3A 3RX3A 2V30A 4NYYA 4INFA 1B3WA 1V7YA 3WNNA 3AXHA 3M0JA 3S5SA 2FMOA 1GHRA 2B81A 4DM2A 3SCPA 1M65A 1W1VA 5FAJA 4IX2A 4PTXA 4TR9A 4AB4A 4Q7IA 7REQA 3NZRA 2AQOA 2VO5A 1X8CA 4QAIA 1J0ZA 3S2LA 2V5LA 3VD4A 4L1WA 1E55A 3URAA 3S46A 3UCQA 1KLZA 1S5VA 2CLHA 3BL3A 4BI5A 3LPFA 1WO2A 3CH9A 3ABZA 4KWSA 3RG6A 4CCZA 3QKEA 1XLJA 3EMCA 2WZIA 1DPMA 4MHBA 3CQHA 4H7ZA 3UWYA 1QASA 1XX1A 3HV8A 4AZGA 2X1UA 2Z29A 4UNIA 5LNRA 4PBEA 1Q85A 1LL4A 1N2VA 5U7SA 1PCWA 3CV2A 3UA4A 1V6YA 3CL8A 4RLIA 3AUJA 4IGHA 1SSDA 2ISFA 4M6VA 4JIIX 3UY8A 5AC7A 2ZC8A 5JXQA 3NO1A 1E1EA 3UXDA 4FLOA 3ZSSA 2JK2A 3UR8A 2DY3A 5A6KA 3SN1A 3NQ6A 1CTNA 3MW7A 4JFVA 2Y70A 3U4AA 1RZMA 4QG6A 1IQ8A 3W26A 1IHIA 1JIBA 1J5TA 4GY7A 3T07A 4MZ8A 5E0CA 2G97A 4DO4A 2VC6A 1JULA 2TSYA 4C6LA 2IKGA 3V1PA 5IHSA 1U5VA 1KD0A 2GUBA 3DI1A 3GR7A 3PBMA 4FALA 5CJMA 3E3HA 5FACA 5M3WA 1IZJA 1TPC1 3FHQA 4PUUA 2BP1A 4Z1AA 4RL3A 3QC0A 1FUYA 3AXIA 1KTBA 4DIAA 2HEJA 1KWGA 3WK1A 3TR9A 1D3CA 3W7RA 3R7MA 4QQ3A 2QIWA 1R2SA 3H22A 3SIZA 4ATWA 4AD0A 2EXOA 1ITCA 3LHZA 1U33A 3VOHA 1PBGA 5HATA 4O0ZA 1IT7A 3ITVA 3CZEA 1VR6A 5REQA 2OSWA 1OD8A 1X6LA 2A4AA 4GFIA 4FLQA 3BLEA 2VNCA 4MUZA 5EBAA 2IXVA 5CPMA 3DECA 4Q8WA 1H7NA 5A69A 3S1WA 2YL6A 2ZUWA 2V3DA 3K8MA 3J7HA 3GR8A 4TV6A 4H6QA 4M29A 4JQ4A 1N8WA 4UCGA 3OPSA 2FZBA 3P7YA 2VVNA 4NIRA 3EWDA 2PC8A 4YVVA 4JIHA 2C0AA 4CN4A 1FH8A 4IP5A 3WLNA 1JFHA 4LYKA 1NFPA 4XBJA 4JQ1A 2BXZA 2ZUVA 1XHGA 4WJXA 1UR2A 3VO0A 4M1RA 4RPPA 4OECA 3BGAA 3GAYA 2VC5A 3IGUA 5EGRA 1YDVA 3W1RA 2BBFA 4NHVA 3E6EA 3OEXA 4LY8A 4DXXA 2D69A 3OU8A 2BHUA 2E6DA 2VQTA 4Y8FA 3ARPA 3MV11 2DPEA 1JNEA 3R4IA 2CZEA 1BF2A 8XIMA 3WDQA 5HDRA 4H04A 5F4XA 3QM3A 4A3HA 3KOXA 1ESWA 3KOYA 1TWDA 3WLIA 1R8LA 4GNKB 4J3ZA 5SWUA 4P2VA 2GGEA 2V63A 3BV7A 4FI4A 3WLHA 3MSYA 1RJQA 3CPRA 5C7HA 2FVMA 3VIKA 3TXZA 1NP2A 3VKKA 4O54A 2OT0A 1LWIA 1LORA 3R94A 4I5UA 3TNOA 3G1DA 1VCGA 4HTBA 1X7IA 2WBKA 3PBUA 4UFIA 2CLMA 1UG6A 4PL1A 4F40A 3VOJA 3ZJ7A 4S3GA 2OEJA 4EXQA 1HVQA 1TPB1 1FDZA 1PAMA 3M0LA 3A4AA 5CPNA 2QQ6A 3R13A 2CFFA 2GQ9A 3OHMB 4JKLA 1ECEA 3WDJA 4WOZA 3ZVHB 2WCSA 2PWHA 4RDZA 3P14A 3EDFA 1TZ9A 3EB2A 1HIZA 3P74A 3SQLA 3W7HA 3BMVA 1B90A 1KRBC 9XIMA 2ZX6A 2MUCA 2PWDA 3QEZA 3CJPA 4CN1A 4Y7EA 2AMGA 3CHDA 2UY5A 3IEBA 5F4WA 1WQ5A 1RJPA 1XG4A 3RR1A 3AHYA 4GH1A 4MWAD 1AZ2A 1EOKA 1BYCA 5F1UA 3NCOA 4GYKA 4CLMA 5HWMA 3NQVA 3ECQA 1UASA 3WMSA 4WGXA 1GCYA 1BD0A 5DEZA 1GNXA 5JH2A 1XDJA 2FGZA 3H7UA 2WHKA 4UQ9A 2VEPA 3ARWA 4GKLA 3TLQA 4QS6A 3NL2A 1W3JA 5RUBA 3W83A 1YXCA 1YE4A 4DUWA 4GI4A 4WLCA 2PU1A 4HOZA 2BXVA 3TYEA 1NF0A 1YPFA 2QKFA 2NXIA 3L23A 4I6VA 4ZQCA 2XHYA 3CHEA 4C6DA 3LSCA 2E7FA 2QMJA 1EC8A 3LHYA 4J3UA 1PJ9A 4W5UA 4GIAA 1U1UA 3NQMA 4ZOCA 1E1CB 4M82A 2CBUA 1GKPA 1W0MA 1W5NA 4J3XA 3SCVA 1LLOA 4CD8A 3S2NA 3W38A 4PMYA 2G3IA 2Y7DA 4WKHA 3F2CA 2OKTA 2JFEX 3MUAA 4RCXA 4Q8UA 4NAEB 2PA6A 3AWNA 4QS5A 2ISSA 3C0SA 3H4WA 1Y5XA 4H19A 3NFUA 4QITA 1WA3A 4OQVA 4RUBA 2FFCA 1K4GA 1SO5A 5AHFA 4IIDA 1LM1A 1EJXC 1ZRQA 3G6MA 1M7XA 4AYSA 3BE7A 3IK4A 4WRHA 3FK4A 3C3UA 2X0YA 3MHGA 3AS1A 1CECA 1FWEC 4DNMA 4H4IA 4AHOA 1F8IA 5CBIA 3ZSTA 1KCXA 5KZEA 2O7QA 3NWRA 1OFDA 1XSIA 4XSLA 2SFPA 4RE3A 3VMPA 3OBKA 1OC7A 3UW6A 4UNKA 5HK4A 3SUWA 5AHIA 2IQ0A 4TX6A 2BG5A 5CAKA 4JNZA 3IIZA 3W1XA 3VX0A 2BVWA 3S8HA 5AYYA 2Z4GA 1FHUA 4U10A 3W28A 1K6AA 1Q2SA 5FESA 1GWJA 2G3NA 3AS2A 3KAOA 4QISA 4AVOA 4TVCA 1Z48A 2BX7A 4DVOA 2QS8A 1M7PA 4QNWA 3VGEA 1YXYA 3A13A 2HBVA 4FOJA 1TTIA 3EDJA 5CJ5A 1U2YA 1ZAIA 1CGYA 3HMJG 2INZA 3C56A 2DZXA 1IXNA 3NR0A 1QI4A 3G8EA 5HNTA 4XAZA 3R2GA 5T9CE 4DBWA 2C13A 4Z2LA 1AQMA 4Q4OA 2J7GA 4EX4A 5H8MA 2ZUNA 4KRZA 4CQDA 1LT8A 1AL8A 4UOQA 3SFKA 4X0NA 4JQ3A 4N4QA 1QXLA 1OFAA 2VT0A 4F0LA 4U2ZA 1E4IA 3V35A 3U5UA 1C9WA 1RCQA 1XL9A 4GZ7A 2J6VA 2GYIA 3BCJA 1G94A 1OGBA 1IGWA 4H9VA 1KM5A 5BRPA 5DN1A 3CIXA 3EWZA 5G1YA 1MZRA 1ITXA 3ARQA 2HWGA 4KEMA 4AZ6A 4WXZA 3DFSA 1ZZMA 2NX3A 3RRXA 4IGMA 3EWYA 1ELSA 1ZJIA 5CGMA 2NQJA 1V6VA 3L0GA 3VX1A 4Q7BA 5AC4A 2I5IA 2PPGA 5I0DA 3BLPX 3VFLA 3CT7A 1W8SA 4B16A 4IPPA 5JVLA 5G1TA 2ZBTA 2D0GA 1ONXA 1MQPA 2XH2A 3P0XA 2BLEA 4AIEA 1WDWA 3N17A 4X2RA 2XU2A 1VFFA 2FB3A 3BXWA 3N2MA 4QJ3B 3ALGA 4LS1A 3Q58A 2PDNA 4JN6A 1UWRA 2QHAA 1KLYA 3B8IA 2FFIA 5TQLA 4G1NA 2OLSA 5HJLA 3B0UX 3R0KA 3CTLA 2EKCA 2XGIA 5EYWA 2RDXA 1C8QA 1VYPX 4OKDA 4A8LA 5HPOA 4B91A 5DRCA 3MMDA 1A5OC 2D0FA 1SO6A 2J25A 4IGSA 4G9PA 4C6FA 5I6SA 2EPLX 3NGJA 1SUXA 3EDEA 3GVQA 4XAFA 4PMQA 1DL3A 3O07A 1EZWA 1UHVA 4PMZA 1KXTA 4DNHA 4C6MA 2BY2A 2WV8A 1CGTA 5J5DA 3DC0A 1VFUA 4XZHA 3A47A 3G3DA 2BHYA 3V3WA 1KQZA 3USZA 1U22A 1PIFA 3PWGA 2QCGA 5FD0A 4S38A 3UXIA 3BVJA 1V79A 4UOZA 2ZA2A 2BNJA 3PZ9A 1J79A 2H8ZA 3STCA 2WVTA 3W37A 3URNA 3U6WA 1GGOA 1OQFA 3F2BA 1DXEA 2QCDB 1M41A 4HSNA 1UW9A 5M1TA 4IUGA 2X8RA 4R53A 1WXYA 5DCEA 1XSJA 4QIUA 3P67A 1MXDA 4XZ9A 4IWWA 1TIMA 4LJ3A 1G01A 1H5YA 1ZAHA 3V4BA 4HNUA 2VEFA 4AWSA 4JTHA 1EP2A 2AQVA 2WSQA 4XVDA 2AGKA 3AIWA 4EWJA 4K36A 4LFYA 3S2JA 1XGZA 3VXGA 1ZNNA 1I2QA 4AUBA 2CZVA 2QLYA 2NLIA 2ZDSA 4PMOA 4R33A 3EWWA 3WLPA 4CUCA 5AC6A 3SCWA 1C9DA 5REQB 1LG1A 3TONA 3M47A 3TW6A 5HR7A 2NVCA 4GJ1A 4PCTA 4NXKA 1UKSA 4QSFA 3V5OA 3UYIA 1T6MA 3HF3A 4IPLA 3SGGA 4DBEA 1MDLA 4QG8A 1K8ZA 5AYBA 3Q4DA 4C90A 1OM0A 4E8DA 3THAA 3T0CA 3WF2A 3OZMA 2C19A 3Q67A 4KWOA 3V36A 1U5HA 1TCDA 5I00A 3GNRA 3W7OA 4CQ8A 4UQEA 3GXPA 4DWDA 2ZOXA 3DN5A 4ZCWA 3AS3A 2YGYA 4PMDA 1QUMA 4GABA 2YA2A 2UV8G 4LANA 2Z00A 3MY9A 2E0PA 3M0HA 1F73A 1W31A 2FMNA 3N25A 2VGBA 2I14A 3UXAA 1HJSA 4QXIA 2OLHA 1W17A 4RE2A 3OO2A 4U3AA 1A53A 1CCWB 1DE5A 2FHFA 1NDWA 4FPSA 4GO9A 2VURA 1UYQA 4I5RA 2XM1A 3WQCA 1ALDA 3PHAA 3EDKA 1SW3A 1EO5A 3PN8A 1NWTA 2J7EA 2Q01A 5D30A 3FEMA 5HQLA 1J12A 5FF3A 3GHRA 4KFNA 2OEKA 3B9EA 1WX0A 2ICSA 1P43A 3MWCA 5A6TC 4MADA 3W73A 1K4HA 4ORMA 3SY8A 1EA0A 1X1OA 3A22A 5C6MA 4GQBA 1WCGA 3A21A 5D9PA 4CQ9A 2Q71A 2ZRVA 4GY1A 2VMFA 1G5AA 2XGZA 3INPA 1CGUA 1LOQA 3WQDA 4Y90A 2UBPC 3HU7A 4UTJA 2QZRA 1P1XA 4QJ1A 1DKWA 4L4OA 2WC4A 4RXGA 3FSTA 3ZIZA 4XKYA 2OT1A 2PDCA 2XFYA 3MUY1 2WC3A 3VVGA 2W0UA 2V5CA 1JD7A 4PUEA 5I09A 7XIMA 4HPXA 1A0EA 2YL8A 3W07A 3PAJA 1TO3A 1VFMA 2HBXA 1Q63A 3N9KA 3T7VA 3DAQA 3VGDA 1JVNA 3QQWA 1VJSA 4YMZA 3C0QA 3O05A 4AMAA 4DZ5A 1JDDA 4NKCA 4K7YA 3GU9A 4AQLA 4UTTA 1MWOA 2ZE0A 4ZMGA 2PODA 2WNZA 3S47A 4J3SA 3C61A 3DHFA 3IV8A 1QWGA 1VYSX 3W24A 3PPFA 4I7WA 1UJPA 1UJQA 5D9MA 1J96A 2YW4A 3M0IA 2C91A 1YYAA 1VIZA 2NUWA 3PWIA 1O1HA 1J18A 3BICA 1SZNA 1D8CA 2Z1XA 4GQGA 2WAGA 3E38A 2NW0A 3THUA 2VEIA 2E5BA 3NZ1A 1LRQA 2V82A 2PF0A 1J9YA 5IBXA 2TMDA 2VFIA 1GTEA 4FOKA 3AICA 5I2UA 3A3XA 1BGAA 4H2HA 1RD5A 3KVKA 3HPXA 1V6TA 3NOYA 2XN0A 2D20A 4OV9A 3OGRA 2A5HA 1R46A 3CC1A 5L9FA 4C6NA 1EGVA 1W1TA 3HURA 1XICA 3VILA 1VEOA 1QI3A 1A5CA 1Q4NX 1W5PA 3BCDA 3W7EA 4A21A 4J2PA 2PTWA 5E1QA 2FHCA 4QNEA 4JD4A 5I78A 1CLXA 2CHNA 4GZJA 1XW8A 1H11A 5FJJA 4ML4A 1M7JA 4HKPA 2W92A 4HHPA 1QHZA 3H2AA 2QGYA 1YX1A 3L4UA 3B4UA 2PWUA 2VFHA 1ZALA 1EL3A 4PUKA 4HK5A 3AMDA 3NQAA 2BOEX 5CLTA 3VFCA 2VX4A 4AG0A 2NT0A 3DCPA 2WKLA 4NJKA 4DPQA 4HYWA 1CI1A 1RPXA 3OVQA 3O15A 4W88A 2QR6A 1JZ3A 2ESCA 2R82A 3ARTA 4N02A 3AAMA 5C71A 3OODA 4HJWA 4GI9A 2JF6A 1BRLB 1S38A 3OB8A 4W9TA 2OU4A 2PGFA 4ATLA 2XIOA 5K4XA 2QJHA 1P0KA 4H1ZA 3I68A 4UC5A 1G67A 3OVPA 4KRUA 2PLKA 1I2NA 3OHIA 4O8AA 1F4HA 3R1ZA 2VFGA 4NP7A 4DQWA 1RH9A 5ABFA 2W9MA 4ACYA 4M6QA 3AHVA 2GDVA 2WNWA 2CLLA 4LTSA 3U2CA 4N2YA 1QMLA 1H1ZA 4I90A 3RAOA 2VZUA 3ZVHA 5BMXA 1JZ7A 4YWIA 1VEMA 4LB4A 4FHAA 3W6YA 1WP6A 3M0VA 1QI2A 3LDVA 2GPTA 5BRBA 5AVHA 2J66A 3WQ5A 3IUDA 3RDKA 3HG3A 5EMMA 2HPMA 1OD0A 3FJLA 2WMJA 3AHZA 5D05A 1YTKA 2PDBA 1MFVA 1ISVA 2X05A 3IJ8A 3DX5A 6REQA 5BXTA 3QYQA 1KWKA 2O92A 2DT1A 3VGBA 1RUSA 2J77A 1X1NA 3LHWA 2DUAA 4JTGA 3U3HA 1YPIA 4FO4A 4F0MA 2QULA 3PWAA 4ZO6A 4LCQA 1DJZA 2D3LA 1H61A 4XUYA 3HN3A 3GY1A 5JIWA 6XIAA 1XIMA 3WNLA 3R8GA 4RPQA 2OZ0A 1FVPA 1A4MA 4UTWC 2Z0IA 3IJ6A 2YXXA 4IIGA 3ZM8A 4TUFA 3PNZA 1FWRA 4BF9A 1K9FA 1RK6A 3N9SA 3QOMA 4O8RA 4JGDA 1YE6A 4O50A 1NU5A 5EL1A 1L9WA 4S3DA 1TA3B 3WQ8A 1QI0A 1JCJA 1YHTA 1B3ZA 1VGAA 5FL1A 3KX6A 3S9IA 5M5DA 5EKYA 1VD6A 3HQPA 3MSDA 5BOOA 1BWVA 2XG9A 1R9YA 4IG2A 2QF7A 2ZIDA 3CWOX 3RX4A 2V81A 4C60A 1UOKA 4ACZB 1OYBA 1JZ8A 3WQFA 1FDJA 2OX4A 2CETA 3UG8A 3GNPA 4RW5A 4IFRA 5G4EA 1QPKA 3K5XA 2XVNA 4IOTA 3LYEA 4O16A 4B9ZA 8XIAA 5DCDA 1XH2A 3HGOA 1ITUA 3VOIA 1J0YA 5DMNA 2W6RA 2YZ5A 1L8NA 4IP7A 4IJRA 4M7SA 1K6WA 3NXLA 1A5BA 4L80A 1KFCA 3UT0A 3U2OA 4GYPA 1TX2A 1ITQA 1ZP3A 4AAJA 1E9ZB 4DWSB 3BLKA 1C92A 3ABSA 3RNDA 1IT8A 2OELA 4HU4A 3WQ4A 1SO4A 1C8VA 1A5AA 2AL2B 3PTDA 1BTMA 3BCFA 3CUFA 5FKYA 4FNUA 2PWVA 1A0DA 4PODA 1FH9A 2P0IA 4DY1A 5FI8A 5A6SA 4JFUA 1LROA 2XVLA 1HTIA 2G4FA 1S2WA 1IEXA 3N19B 4QSHA 5DCBA 1XLGA 2VGGA 3EX6A 1PZ1A 4H9ZA 2VZOA 1CXKA 3TFXA 1EDQA 3RITA 6XIMA 3DHDA 4JR5A 1UR9A 1E4MM 3WNPA 1SR0A 3OLIA 4YTQA 2L5HA 3A23A 4Y9MA 2E09A 2V5BA 1GYNA 3WYZA 3K4DA 4HYRA 2QJIA 4PCNA 2Y4SA 1M53A 1R9XA 4P7QA 3WFLA 5HR6A 2WANA 1GZJA 4IL0A 3AMGA 1P5BA 4TU1A 2WNNA 2C3ZA 3G1XA 3GNNA 4QRNA 3GE7A 3B8UA 2O56A 5C70A 3KEHA 3O0KA 3M43A 3Q2DA 2VP8A 4XQ6A 1E0VA 1ZL1A 1XF0A 4XBKA 3WBYA 4FZIA 3HM7A 3SY1A 2VOMA 3MI3A 3NJ3A 1OF6A 1IR1A 2E6AA 2QUMA 1DYSA 4QDWA 4X63A 1O66A 4B3ZA 1O6IA 1RQEA 4UMBA 4Y6GA 3LENA 2NLYA 3N14A 2QJGA 3A3WA 3Q45A 3DG6A 4AH7A 6TAAA 4GHRA 4D6FA 5F2IA 3UZXA 3VKDA 3PZVA 2WM0A 1XRSA 2ZZ1A 2GDQA 3JVAA 1BVNP 1NOFA 1KM3A 3ZQ9A 4B5WA 1GVSA 4LC8A 5DXYA 3QGKC 3UCCA 1MEIA 1XGDA 2PDJA 2VI0A 2R14A 3XIMA 4QP0A 2WBGA 4BQ4A 3C5QA 2PFHA 2YXGA 1DQWA 3M6YA 3F1QA 3G77A 4ZTXA 4REQB 3VCRA 3IGSA 4CNOA 1BSIA 4XZBA 4UFKA 3DKLA 4AX6A 1FOBA 4NUWA 3W7JA 2WK2A 2YCLB 5FJRA 1XIFA 3DOPA 1Q6RA 4HOXA 2BASA 3HPSA 2C16A 3WJSA 5F7UA 4IJCA 4H9UA 3OQEA 2DIJA 3H2MA 4RNJA 3LV5A 4LW7A 4ZBCA 2IKIA 4BHYA 2R1LA 5GVJA 4LBRA 4MF4A 2OFJA 1RY0A 1E72M 3EX2A 4ZSTA 3KM8A 3PSWA 4S23A 4IPIA 1EJTC 4UTIA 4P61A 1V4YA 3HQ1A 2DZBA 2J7FA 4ZQNA 1SM9A 1WOBA 2GQ8A 1GPFA 1QO2A 1JQXA 2GUUA 1E4LA 4X3ZA 1V02E 1PX3A 4XB3A 3AIRA 4WIWA 1PHQA 2G95A 2ZUTA 2EPNA 1QJWA 3P84A 3NYDA 1VYRA 1A47A 2I17A 4AU0A 4FLRA 2VWTA 1MUMA 2OYMA 1XBYA 5BZAA 3VD5A 4JYDA 2QCEA 5D8WA 2CLOA 1HKJA 3NG3A 1JCTA 2XIQA 3GTHA 4J7RA 1I2PA 4PSRA 1RQBA 1KV5A 3VIIA 3I7QA 3HZ3A 4TVUA 4FAMA 3SI9A 3LZ3A 4A6GA 4US5A 4AD3A 1O60A 2F7FA 4M3PA 5CZTA 4H83A 1FFRA 2CC0A 4JIQA 1RBLA 4Q6XA 4AWTA 1ZY9A 1OFEA 2QCDA 1K9TA 3CYJA 5G4WA 2PDQA 3FSUA 3TFCA 5D02A 2FJUB 5C9RA 4A2RA 1WDQA 4MJMA 4K1WA 3VMOA 3TN6A 1JG9A 1LDCA 1OFRA 4M24A 3S6OA 2IPWA 4O1BA 2GGGA 2XINA 3B8WA 3ZOAA 3W3OA 4CGTA 1A4LA 1H4PA 2VX7A 4KIEA 2BY1A 1TR9A 3GXMA 4FNPA 1RPKA 3WJWA 3BLLA 3PUEA 4NU7A 5K7JA 5AFDA 1A5KC 4C6BA 3KVJA 3M0XA 2ZRXA 1KM4A 3TQPA 4Q8VA 2E6FA 3C2OA 3VD9A 1ZBKA 4TO8A 4IJBA 2VFFA 3VIGA 5FJPA 1UA3A 2WB5A 1VFTA 4LOCA 2VXNA 2BY0A 4PMNA 4PUMA 4JTIA 4FK9A 4PTDA 4G7EA 3DIPA 2CXEA 4Q4RA 5AKQA 5CC7A 3COTA 1N8IA 3V7PA 3ZJKA 1TX0A 2Z1BA 4ZOAA 3LGGA 1A5UA 4MNMA 4PUNA 1TJ1A 3WMBA 3M41A 2Z6JA 4L9XA 1KXHA 4HPHA 1XGEA 5CSSA 1DBTA 1MRQA 1C91A 1XSKA 1E0XA 2Z1SA 2WMFA 3QYSA 7ODCA 3W23A 1F76A 5JBDA 1E6ZA 1AFSA 5ABTA 4GKTA 2WPGA 1A3HA 4S3CA 1OC6A 5EMUA 2A3LA 1B4KA 4WR3A 1EBHA 1PKNA 2X0HA 3GTIA 1KGWA 3W2KA 3CIVA 4YTSA 4D1IA 4E8GA 4CU6A 1EP1A 3B4YA 1BGGA 1XPYA 5CSUA 1VCFA 1UA7A 1Q6FA 1F74A 4JKMA 3RPTA 4M1BA 4A8RA 2GZXA 1L6GA 1D3GA 2VRQA 1TZZA 3LMYA 3PJTA 2YDRA 2C1GA 1D8WA 3VINA 4N7QA 2Z2BA 3UWWA 4B5TA 1ADSA 1WZKA 5LNSA 2OQYA 3V5FA 2HTMA 2RUSA 1MW1A 2B7NA 4L61A 1EQPA 3QV9A 5I3FA 1TJ0A 3M5VA 4AY8A 1IXPA 3AOFA 3BW4A 3M44A 1Q65A 1IYXA 3PNUA 1M3UA 3BLDA 1TA3A 2VFEA 5A8MA 4QEHA 3MC5A 2R94A 5LNWA 5U4NA 4W7VA 3WEZA 3EOEA 2A79A 3EPMA 1FA2A 4AY1A 1OYAA 1D9EA 4XD4A 2BVTA 4GIEA 4H8HA 5J04A 2QDEA 2YJQA 4B2DD 4TVDA 3GH5A 3LPOA 3A4XA 1I0BA 3GXFA 4DRSA 2QAPA 4S3KA 2AKMA 2E5CA 2PSNA 3PJXA 2BTMA 1X6NA 4ZA0A 1PTDA 1XKYA 3MP3A 1H51A 2Y63A 4DI8A 5A6JA 3QHNA 5BOFA 4DWSC 2FH6A 3W1QA 1UWIA 4PULA 5FF4A 2DUXA 3S3GA 2CEQA 4D9PA 2O9PA 1V3LA 1W91A 4L6DA 2EPOA 1K3UA 4DJFC 3Q94A 3LX9A 1V3HA 3THQA 4YWSA 3FA4A 1PX4A 1W2PA 4JTEA 2VUYA 1SW7A 3LGDA 3H26A 7TAAA 4J3WA 4RDYA 1TREA 1JPDX 2G4JA 1HL8A 1UROA 3ARRA 3I6EA 4KWWA 6CGTA 3QOKA 1DOSA 3L4VA 2Y7GA 1B9ZA 2XJ7A 2ZQ0A 4K3ZA 1QRQA 2CYGA 4N9EA 3CUXA 4MMWA 4DAIA 3V16A 4CKQA 1IWBA 4UTUA 3NEVA 2VKZG 4GIYA 2GK1B 4J2MA 3E2QA 2FHBA 4OTKA 4E4PA 2QF8A 3RCYA 3GBDA 2G96A 3ONCA 3DFNA 2W63A 4F9JA 3H54A 1M01A 2NVDA 2HVMA 3B8DA 4UFHA 1BRLA 3W7PA 3LXCA 3R8HA 4D6IA 4DLFA 3TW7A 2QDGA 3ITLA 4PB3A 2X40A 5I3DA 5F1VA 1XXXA 4CD4A 4C7GA 1EX1A 3AIBA 2FH8A 3N1AA 3FGCB 1CXHA 3GUWA 2ZA3A 1EKOA 2DJLA 3BOLA 3DXIA 3FS2A 3L4YA 4UQCA 5HULA 4W85A 3E0IA 1LJYA 1UH3A 2ZCGA 5DMLA 3TA9A 4Y9AA 3KTSA 1G4EA 3IPWA 1UP3A 1NM9A 3UJRA 3WDRA 2EG7A 4LXFA 5FEZA 1BAGA 3M0KA 1CXLA 1XFCA 3BZGA 3L9CA 1R6WA 2WSRA 4L7ZA 4Z17A 4M19A 4RKAA 3PS7A 1REQA 1NOUA 4MAVA 4PCPA 2XH0A 4JTAA 1BWKA 1IEIA 2XZ9A 3IIXA 3DEQA 3G5EA 4EF8A 2ATSA 1J0IA 2G37A 4DHGA 5BXRA 4BY3A 1NOWA 2ZZ4A 3T4CA 1GJPA 1FBAA 3CWNA 1MUWA 3G0UA 1UQYA 3SRHA 1SO3A 4QEEA 4JX5A 2HROA 1BYBA 4GBDA 1W9DM 5T91A 3CPGA 1WKFA 3ZXWA 3G1AA 2B7PA 5HJYA 1PVNA 2Z1WA 1KBBA 1AG1O 3BAIA 3BAJA 1J6PA 3I3EA 1HKWA 2BS9A 3L2IA 4MY9A 4MWAA 3OGSA 4I8YA 2CKRA 4GQRA 4W5ZA 2D1ZA 1N82A 1TMHA 4CD7A 4ZFCA 4F2UA 4PUJA 5T8GA 4L4PA 3TR2A 3BW3A 3LQGA 2QJMA 1RVKA 4H9YA 3PZTA 2Y5JA 3UETA 1IZCA 5GJPA 4LV4A 2QCHA 4OFCA 4HN4A 2PDXA 3O63A 1GKRA 1LLWA 1B5TA 1XWYA 3GDRA 1VLIA 3UERA 1QOXA 3UJFA 3LCLA 1ZU8A 4ALDA 3NIYA 2VZVA 4UZUA 5G5IA 3GFYA 4FR1A 2J88A 4C5YA 5FSDC 3A5FA 3GDKA 3POHA 3LV6A 1HKMA 4Q22A 3LRMA 3TAOA 2UZ9A 5CKSA 3SSJA 4UQDA 2VRKA 2DT2A 5M17A 3V0SA 3AC0A 2P76A 3BG9A 3ARSA 1GVEA 2CPUA 1Z9AA 4WD0A 2HISA 4Y9NA 4AZIA 3BGJA 3SECA 3JZUA 3GDLA 1OX4B 1LQ0A 4HZMA 4E5TA 3LMZA 3NQBA 2YLLA 8TIMA 3T40A 1I1WA 3LXBA 1FHDA 2R1PA 4L6OA 3F5JA 4H6EA 3UWZA 3PULA 1TJPA 4YIWA 2X2GA 4MIMA 3SRDA 1R3RA 1EBGA 3FV9A 1EPVA 3QQ1A 1ZB5A 3DERA 1UC5A 2V9DA 1JF5A 1VRXA 1UZ1A 2QAFA 3UF9A 4HCDA 3AIUA 1KNWA 1UR1A 1H1NA 2OO0A 4LAMA 2JKAA 5DT5A 4YHGA 1E6QM 5DMMA 4O0KA 4N6FA 5AN7A 5CPQA 3FW6A 4D1JA 1MYRA 1GZGA 2GLKA 1CXIA 4BWLC 5CQ1A 1IR2A 2XISA 4F4RA 4MUPA 2X1RA 2PMQA 1C8YA 3CHFA 3BAXA 5I3KA 1HZYA 3MBDA 4YYFA 4IMGA 1UB3A 3NZGA 1E4NA 4O53A 5I77A 5B7ZA 3DENA 1A5NC 3QGAC 1YDOA 4UWMA 2VD8A 1W56A 3ES7A 3FLUA 1JZ2A 1OYCA 2QXWA 3KBJA 1LTDA 1PKMA 2ACRA 3MCNA 1JDFA 3VGGA 4J40A 1K7EA 4LVFA 3WLSA 3R25A 1FKWA 4F8XA 1DJIA 4AMCA 2J24A 4P7OA 4QE4A 2DZSA 3CYVA 1F61A 2PWFA 2E8ZA 3TEVA 4JHZA 2OSXA 2YCIX 4HHHA 1JR1A 1DVJA 5AYZA 3WY1A 3N13A 1VP5A 4Q4QA 3WMLA 1UPPA 3S42A 4EOUA 3B03A 1AA1B 3GLCA 1KM1A 4WDXA 3GFZA 1G69A 3CV6A 3BMXA 2D73A 1XC6A 3S1XA 2X41A 1QAPA 4O10A 1XISA 1JD9A 2PDFA 4PEEA 5BWAA 1V02A 3ZR5A 2Q8LA 3L68A 3LCIA 4DO7A 1RHCA 4ZXOA 3WF0A 3W7QA 4C6PA 1TVNA 7ENLA 1H0IA 3CUZA 4ZENA 2VCCA 4CVUA 1TELA 4EAYA 4IHCA 3WZ0E 1FXQA 3MKCA 3N4FA 2D23A 1TV4A 1Q45A 4J3TA 3W01A 4DYJA 4ZQOA 3HQNA 1YDYA 2IPJA 2V5DA 5MKGA 4M81A 3PUOA 1ONEA 3AYRA 1JDAA 1QT1A 1BFNA 4JIEA 1GOMA 2TRSA 1K8YA 3B8SA 3A5VA 4HA1A 3C3NA 5HAOA 5C54A 2GSHA 4IM4A 5M2FX 1K8XA 1LBLA 4XKMA 1M68A 1YLVA 1FWAC 3L2MA 4N4PA 2HVNA 4EKJA 4HNCA 4ZOEA 1GUVA 1DJNA 4Z2KA 1HG3A 4RZ6A 1HJQA 1ZBWA 1HNYA 2DUZA 4CNTA 3MV01 2ZRZA 3PZOA 4UZSA 3VKAA 1HJUA 5D4YA 3DFPA 3PAOA 2A6LA 3ZO9A 3W1LA 4XX6A 2CLKA 3MVIA 1JDCA 1FP8A 1Z3NA 4MZYA 4MAZA 4I7VA 4MM1A 3I6RA 4A8IA 5DRIA 1F6KA 3H24A 1ENUA 3ZYZA 3FAXA 3OTRA 2KAUC 3SCTA 4GI6A 4RZ4A 4LY4A 1UBPC 3ITCA 4H00A 1ZJBA 1EGZA 3SM0A 1UZDA 2YL9A 4RX0A 1TMQA 1UR8A 1XYBA 3KBMA 3DG7A 3QTGA 4JHMA 2IQTA 3G1RA 1ZQ5A 4JICA 5MF5A 3C2EA 3GBEA 2PCQA 2FZDA 1JGMA 3GRIA 4QFUA 3EOLA 1BVWA 4IXXA 4IMAA 4MB1A 3GYCA 3AIQA 3STEA 4CN6A 2C1HA 1Z69A 3EDDA 1GOIA 1TWZA 4L1XA 3PZMA 3WQVA 3QBUA 4Q3MA 1X97A 1Z42A 1E3ZA 3ITOA 2W4XA 1NWSA 1FWWA 2J79A 1XCFA 3DYOA 1KM0A 1J0JA 3CAWA 1E9YB 2WJZA 1VBRA 2BVYA 3P81A 3GXNA 4JCMA 1WBJA 2A7NA 3EX4A 4NX0A 3S83A 3RO6A 4MY8A 1Q66A 4AZCB 2VDIA 3AXMA 1XKJA 4LRSA 3OLGA 1OY0A 4I3GA 2VGIA 1C7TA 1X1ZA 4Q4SA 5TBOA 3GVGA 4GX8A 2DU2A 4AW7A 2XFWA 3UWEA 2BODX 4BA0A 2YBVA 5HUPA 1AMKA 4GGBA 3WQOA 5DXXA 4A4AA 3ZMRA 3W2LA 2Y0FA 1S1RA 3CASA 2PP1A 4YHEA 4AVFA 1CB7B 3GNXA 4OBSA 3WBEA 3IACA 5FJUA 1H5VA 3ABRA 3BSGA 3EPNA 1MSSA 1XYFA 4HZ6A 3R79A 4JTCA 1D7KA 1VHNA 4O12A 4ES4A 4MKVA 5D38A 2X16A 4IL2A 2NQZA 4Y9PA 5DMYA 3FGCA 2QUUA 3WSUA 1H60A 4WY0F 4E2BA 2WWCA 1CIUA 3NTYA 4Q8NA 4ZOBA 3O1NA 1K03A 4Q32A 2AMXA 5LGXA 5I3JA 5KITA 3OZPA 3FDGA 2JGQA 3WQPA 4BQ2A 4GNJA 4KPLA 3AHXA 2ZZ5A 4HNNA 1E51A 5IBXC 3GDMA 2WLYA 4H8UA 1XDLA 4JIRA 2DVTA 5EMYA 3P5YA 2ZVRA 3QMTA 1XYMA 3GO2A 2YXOA 3SCRA 2QPXA 1DXIA 3G0SA 5AY7A 2PDIA 3E12A 4JKKA 7A3HA 3IRSA 1I6NA 1X7FA 1QDSA 3RLUA 1VJZA 3POCA 3EBVA 3GB6A 4HU8A 3PZQA 3QFEA 3BQ6A 5CSYA 3W70A 3TSDA 5FAGA 3TLLA 3WL0A 1W3TA 3CHVA 5CZKA 2OLAA 2Q8XA 2NXGA 2PRLA 2BVDA 2V5JA 1PKLA 3IK2A 3TK7A 4HU3A 2NUYA 5A8NA 1O5QA 4J5NA 3MMWA 2D3NA 3TWBA 2C14A 2WKJA 2E9LA 4HMEA 1XQKA 1R3WA 2CESA 1V77A 3LNMA 3A6OA 1B3VA 2OGJA 3PZIA 1Z41A 3SUUA 4DF2A 3G1SA 5HUOA 4JIPA 4HD5A 5A8GA 5BROA 3AMCA 5LSMA 3N2BA 1R3VA 1NARA 5HWJA 1T41A 2J13A 2F6KA 1EB3A 5AZ0A 3F4VA 2J9ZA 5XIMA 1V0KA 1Y5WA 4ZQRA 2WZTA 3IIPA 1BG9A 3A24A 2FIQA 4TQTA 3W76A 3WBAA 3VIFA 4PBGA 1AJ0A 1TQJA 3KBWA 3QHMA 5HINA 4U5IA 2ASHA 3G1FA 4AD5A 4F0SA 3W2UA 4GOAA 4R7WA 1CENA 3L4ZA 3EA3A 3O06A 1KCKA 3TTSA 2J9XA 1FTXA 2NWSA 4QHRA 2DW6A 4K38A 1H41A 1XH1A 1OGGA 1GZ1A 3WH5A 1XYZA 3ABQA 1LF1A 1Y0EA 5HNRA 4I7UA 3ME3A 3LHVA 1MDRA 1UBSA 3H8AA 1FXPA 4UTHA 4KWUA 4UTMA 4GINA 2EPMX 4YTTA 3P8IA 5EY5A 3QY7A 3NQ2A 4NYUA 1XJBA 3WD4A 5CPLA 1K70A 4C6CA 1EF2A 4MYXA 3TYUA 1UD3A 3KCJA 3IUIA 5CC3A 3LQLA 3TJIA 1LBMA 2NQLA 4JS3A 3UR2A 3W29A 1V51A 4B2DA 5CPSA 3BG5A 2ZX7A 4B9YA 2O55A 2E28A 3VIJA 2XYLA 2YR1A 1W5QA 4IUOA 1OK6A 3S1UA 3KWXA 1QNRA 3L67A 4NI8A 1C93A 4JOMA 1ZBVA 2I16A 4A3UA 3FA5A 1Q2RA 3ICJA 3TZNA 1NP0A 3UVAA 4GIRA 4H3DA 2ABBA 1MXSA 1GT8A 2VZTA 4G5DA 4KEZA 4LUTA 2WPBA 4UTLA 3ZJ8A 1EF3A 5HMFA 5I7GA 3GM8A 2PTDA 4C7FA 5CJNA 3P5ZA 5E6ZA 3USBA 3RUBL 1LBFA 2DSKA 3L4WA 2ZUSA 4PL2A 4TX9A 3W1AA 4ONVA 4ZODA 1VS1A 1CLKA 1AMYA 3WF4A 3K1GA 5AHMA 4MJ2A 5LZLA 3LRKA 2JF7A 1E43A 1GYMA 4IMCA 2OODA 4W93A 3SEPA 2W5FA 3CV7A 2J8FA 4ZB0A 4I9TA 5IDIA 3UPMA 4DJDA 4UR9A 4KCUA 2Y1HA 2YA1A 4FNSA 2WZMA 4UTWA 1FCBA 2V67A 4WX2A 5A95A 4Z1CA 1ZTVA 4W7UA 1BYAA 3TTYA 3E2RA 4X9SA 4TOQA 5ECUA 3CWHA 3DESA 3M0ZA 1JDEA 4IIEA 1ME9A 5E70A 3H2OA 3S4TA 5HOSA 1RALA 4MGGA 4KEVA 3UBPC 3HG5A 1AW5A 1QU4A 6A3HA 4HK6A 2MNRA 3F2DA 2FB2A 1XLDA 1BPLB 1QNOA 2YIHA 4JY9A 2H9AB 3KBSA 3TCSA 2QEZA 5BXPA 1H7XA 2O9RA 3DFQA 4AEFA 1TR1A 3JW7A 2WMKA 2ZA1A 3OLDA 3MP5A 4PFMA 2RJHA 3C0JA 4MLRA 4DYKA 2EO7A 5D2YA 2BDQA 1NDZA 4OBRA 3MYPA 4D72A 4N9BA 4E3TA 4QDMA 3GTFA 1WZMA 3GVWA 1KFBA 4UNLA 3WLKX 5D2XA 1P0BA 1KXQA 4M5PA 3NQEA 2I57A 1I75A 5LA2A 4PUDA 4DZHA 1E1CA 1TPUA 2X42A 3KTXA 3BOXA 4NZ1A 4ZGYA 4B3KA 2ISVA 3BPWA 4WKFA 4EE9A 4R88A 4ZQMA 4B90A 4KFOA 4H6KA 2ZZ6A 5CGTA 2W62A 4LAUA 3BSMA 5E9XA 2DFAA 1EJSC 3ZT7A 3KBVA 4UFJA 1F3TA 4JFSA 3VPLA 4O15A 1KRAC 1I2RA 4AXKA 2OWCA 3V1HA 4QTGA 1EXBA 3RM9A 1FHLA 3W75A 5C9UA 2GJXB 4B92A 3QLLA 3KP1A 2ATMA 4KH2A 3KZPA 2E8YA 3N29A 4KERA 4R7JA 1XLHA 3SFWA 3TOYA 2ZFAA 3AALA 3AWOA 2DVXA 3RPDA 3C0LA 3IAQA 3MUZ1 3SQMA 4Z42C 2A21A 1AD4A 1J10A 1S3HA 4ZTYA 3CXOA 1IIHA 1TVLA 3GC4A 3AMLA 3GKFA 4NZFA 1IE7C 3RLGA 4GVHA 5E0FA 4FNQA 3KW3A 2Y61A 3F03K 2VC7A 3V5CA 3CB3A 3DFTA 1ME8A 1O5XA 4HSHA 4IGNA 4HPGA 1P48A 2Z1VA 3WDHA 2YYUA 2DZWA 4GCAA 1QPRA 1L6WA 3RGTA 3VMNA 4ZEPA 2RDTA 2VC9A 4LVBA 1J6OA 1XV8A 1XRFA 1P6CA 4E0CA 1AW2A 2BMBA 1J11A 1R85A 1BYDA 3NNTA 3MMUA 3VC5A 3L12A 4GUFA 2HVOA 3BJSA 4HNTA 4LWWA 2QUNA 1GTHA 2BHZA 4I9JA 5DFAA 2DIEA 1VH7A 2ZX5A 3M4HA 4LBUA 4F2BA 3IIVA 2Y89A 4MFDA 3E0WA 4F66A 1SZGA 3TSBA 2BV9A 4NJHA 4JN7A 4HJFA 2E6YA 4XTIA 5KMYA 4MYAA 4DX3A 1IIGA 1QATA 2PGWA 4FLSA 4ZO7A 3TTOA 3VZXA 2DIKA 3NUKA 1J2BA 2PDMA 4D8ZA 3VM5A 3STGA 4ZSUA 4GUJA 4GX9A 1MFUA 3MMTA 1U1HA 3W1UA 1JUKA 3NDOA 3G2GA 4EXBA 4JTUA 3N11A 4RV3A 1ZBCA 1AW1A 2Z1KA 4ADSA 3TE9A 2CIPA 1EJWC 3OA3A 2O0TA 3QPEA 2R1NA 5CBJA 1RCOB 4WKAA 4P5UA 5T26A 3MZ2A 3T55A 2FVKA 3PP7A 1DHPA 4GZEA 1UMLA 1LL7A 1UD6A 3N6HA 1JFXA 3L4TA 1GEQA 3FEQA 2PD9A 3KS5A 5BU9A 1OINA 4MNKA 4NQ1A 1P0NA 1ICPA 3VNYA 2J4GA 2IXUA 3JRKA 3QLDA 1IV8A 4HPJA 4LYPA 1ME7A 1R2TA 4N9CA 4AIBA 3C2VA 1PHWA 3O6CA 3S9ZA 1OX4A 1OCJA 3U5YA 3ZR6A 3OLEA 2PP3A 1CBGA 3S6TA 3RF9A 3GU1A 4AZHA 2QCMA 1PX8A 2ZRYA 4HHMA 3TIMA 4LPCA 2GJLA 3AFBA 3VNIA 3T9PA 3CL6A 2VDGA 2XN2A 2Y85A 4HB7A 1C29A 1GG0A 4KKXA 4Z1DA 1HF6A 3CV1A 1N55A 1G9HA 4H9TA 3RM4A 3UR7A 2C6QA 1NDYA 3S6DA 1SZRA 1FWNA 1FWIC 1VIWA 3N18A 3SIMA 5JQ9A 3DHPA 1QO5A 2P10A 4LCSA 2FGLA 3KHDA 3U4FA 3IJ9A 2B7QA 4LEQA 1D7FA 5K4ZA 4F79A 2A7PA 5EMJA 3T81A 3PBGA 5A6AA 3F5KA 4XD6A 2IS7A 4HMNA 3LOTA 3ARYA 2YSWA 2DORA 3MVTA 2Z2UA 2I9EA 3PVFA 4WHBA 1YIXA 4CNSA 3TTQA 1DHKA 4B4FA 1GQKA 4A29A 2OYKA 3KRZA 1OC5A 3LBOA 1AQHA 1R87A 2V69A 1V3KA 5A8OA 3EA2A 2VDHA 1PWMA 3C2RA 4RR4A 2OCZA 1H1YA 3EWUA 3E0VA 1J0KA 4U5KA 2Y8UA 2ZRUA 2WC7A 4NJGA 3R0DA 4RZBA 3PC0A 3LRLA 5A94A 4FSAA 5HMEA 1I0DA 3DI0A 3GYEA 1R0MA 2P8CA 4XZLX 1KQYA 3LHTA 4DLMA 1OCQA 3DUGA 2DZAA 3GW3A 3UFYA 1HW6A 4NZ4A 1V8EA 5K2ZA 1UD8A 5CPTA 3L5LA 3MJYA 4DWSA 3MANA 2ZZ7A 4HMDA 1R3TA 2F2HA 2QPUA 2DH2A 3R43A 4JTSA 1YXDA 5HXMA 2NT1A 2OXNA 1WXZA 2Y8VA 1RSCA 1W6TA 4AY7A 5C55A 1FH7A 4W8AA 5A2BA 5D8ZA 1GOWA 4ADUA 2NSXA 3LSBA 3MO4A 1UR3M 1VBUA 4XAYA 2XVKA 4TIMA 2XTKA 1PTAA 5XIAA 1HFBA 3H2NA 4LV9A 1KR0A 4KF1A 3CBWA 2PUZA 4WEVX 5KETA 5ABFB 2V3GA 2FVLA 4MWAB 3NDZA 1V3JA 2E9BA 1H3GA 3WH9A 4DN1A 2PBGA 4P7RA 3WLRA 3SCSA 3WDPP 3CT2A 2D2HA 1R30A 4TMBA 4R7OA 3ABOA 3U8GA 2EF9A 4PCFA 2F84A 4FR6A 1GQNA 3NPUA 1U30A 3NXFA 2IPGA 3FVMA 5HWNA 1T96A 2VVSA 4PBFA 2YCEA 3VKJA 1VZWA 2E5DA 2G8ZA 1A0CA 3GHUA 3T2OA 4UTTC 4LC6A 3M64A 3KCOA 3BGGA 4HMCA 3GC5A 1W32A 1DXFA 1W9VA 4NILA 5AOUA 4X22A 2WVUA 3VK5A 2XIBA 3HG4A 1MRAA 4IIHA 4EWND 1V93A 1ZP4A 4POCA 1R47A 2UY4A 4N42A 1KBKA 4R34A 4GVGA 1QK2A 1ODUA 2IMRA 2POTA 4Q8QA 4KT2A 2PTZA 5KTLA 4CD6A 2YW3A 3HPZA 5AHEA 1PYFA 3TOPA 1IEVA 3UG4A 5CC5A 2HNHA 4AIOA 1UD5A 3IJIA 1GOOA 3RLHA 1MZHA 3ATZA 4KCTA 1HJXA 4N0RA 5G2IA 3VTRA 4HOWA 4HYVA 2OOFA 4O18A 3EZ4A 3RK8A 4IPJA 3VDCA 3FKRA 1M5WA 2CCRA 2PAJA 3UWUA 3PFRA 5EMLA 2FTYA 3NZPA 3P62A 3CZ8A 3MU7A 1WAWA 1VF8A 1XYCA 4PTVA 2Z7GA 3FDKA 2WHJA 1TPWA 4E4UA 4OZOA 1FDYA 4C6IA 3AIEA 3NEHA 4ZB5A 3TQ0A 4XBSA 1HL2A 1TSIA 2DSVA 5GQBA 3WO8A 3EMZA 2INFA 4V1XA 1MW0A 4IF2A 2H9AA 3WBXA 1PEZA 8RUCA 3PG9A 2QW5A 2BZNA 3GIYA 1SU5A 3M5YA 2DW7A 3FN9A 1H62A 1C8XA 4GUHA 2AAAA 1RCXB 1DQUA 2JE8A 3ENLA 1ADOA 5IXEA 1LLZA 2VL4A 5FIPA 4IMEA 4M80A 1DWGM 2RGLA 1G6CA 1KR1A 1XDMA 1OEPA 1HN1A 2VGFA 2PWGA 4BKNA 3LTSA 3Q65A 1XIBA 4AZBA 4UFMA 3DFOA 3HB9A 2OTDA 3HA1A 4EK7A 4AVNA 3ZLFA 1ZAJA 3AMKA 5LHFA 2ONEA 4HA4A 3W84A 3PPGA 4L65A 2DH3A 1JCYA 4B5SA 1HKVA 1TPDA 2RDUA 3QV7A 4JTJA 1V0NA 4QDPA 3WL1A 3RU6A 3E9AA 1AUSL 1OG6A 1CT5A 4BK9A 1VQTA 4HP5A 1NSJA 1W1ZA 1UWTA 3VI2A 4CCCA 9XIAA 3S9YA 5FA5A 5KZDA 2FPTA 1JEZA 3PTQA 4Q4KA 4GVFA 1W8GA 3FA3A 3II1A 1JYXA 1MEWA 3O6AA 3LM3A 1MEHA 4IQEA 3NVDA 4XUGA 4UB9A 1MO0A 1V3MA 2WZHA 2R24A 3PTMA 3M5XA 4MJ4A 3NSNA 4AD2A 4F0KA 5BOEA 3AXKA 3K4AA 1F6YA 5FEXA 1A5MC 4L64A 4EPEC 1M6JA 2HE8A 1OFOA 1NVMA 1P1MA 1SFJA 4D8LA 1F3WA 4UIOA 1H09A 3UJSA 4QG9A 3UWVA 3AXXA 2PF8A 5HBFA 2V68A 3TZFA 3FKKA 3OBEA 5A3HA 3BLFA 3GUGA 3CU2A 1CXFA 3WD0A 3W9ZA 2YCKX 1OBAA 1F3EA 4M7TA 3MP4A 4KGLA 4DYEA 4M56A 4PA8A 3L5AA 4HNOA 4YVXA 1XIHA 4DI9A 1HO1A 2RGMA 3L0NA 4CEUC 1KCZA 1GW1A 4MKSA 3TVAA 1B3OA 1E9IA 1PO9A 3DDMA 4DM1A 3BC9A 2GVEA 5J8LA 3K8LA 1EHAA 3GK0A 3FHAA 3FX4A 1BSLA 4K8HA 2EGZA 3W7LA 4DF0A 2FYMA 1JCXA 1EGMA 3JS3A 4LAZA 3GH4A 5HA7A 2HQAA 1Q3NA 2A3AA 3UXKA 3KS6A 3SW6A 2HK1A 4D6CA 1QTWA 1FFQA 1ZPTA 2E1DA 3VNLA 3BG3A 4P7LA 5DF0A 3VKCA 1CNVA 1QNVA 1GYLA 1B2YA 3DBPA 3T1GA 3UZZA 4IXHA 3KWSA 1DIDA 3RU8X 2A7RA 3ANYA 4Y2WA 3KOZA 4UMCA 3T8QA 1XG3A 4LH8A 1QNSA 4CNUA 4GGHA 4HU0A 2FTWA 3MA8A 1JYWA 2G3FA 4YJ5A 1US3A 5LNVA 3I4KA 3EOUA 5ECVA 3RX2A 3M7SA 4LS0A 2OGYA 1O1ZA 1QVBA 3WLLA 2CWNA 2RAGA 3D46A 5DBTA 4PGLA 5D9NA 4X9YA 4O14A 2Y24A 1WZLA 2NQ9A 1TUFA 3NL6A 1SZFA 3MYOA 3KFTA 2POZA 2UY2A 1AQFA 4PMRA 3TH6A 3ARXA 1SMDA 2Q6ZA 3GG1A 1L2QA 4OIFA 4CCDA 3O7UA 2G3MA 3CZKA 4LRTA 2E68A 5G2HA 3TTEA 3GVVA 4JTLA 3PANA 1DJGA 4LUSB 1RA5A 4G7FA 3LXAA 3W85A 2PC4A 1JUEA 4U33A 1GK8A 4MFEA 4NF7A 4LSBA 2HXTA 4V33A 1CLVA 4UUIA 3KZSA 1Q7MA 3BMWA 3VIOA 3GG7A 1DQXA 2CITA 3EKGA 1LUCA 3WFAA 3MSRA 3BDKA 2E67A 4KIRA 3FIGA 2YCLA 3N6JA 4FXFA 1Z6KA 1OWQA 5D2TA 1P0EA 4OHQA 3VDHA 2DT3A 1PPIA 3DZ1A 3TC7A 1B3YA 3LPPA 3QXBA 3D6NA 3N2XA 5TF0A 2PBOA 1X96A 1ONWA 4O4VA 1W9PA 2NV1A 2WOQA 1RP8A 4AZ5A 1B4EA 2VENA 3UGRA 4NSBA 2VJXA 2XIMA 2OYLA 4PE8A 2PZ0A 1OCBA 1V0LA 3M0YA 1AH3A 2ZVIA 4OV4A 1O4UA 4MNJA 2XVPA 3KCLA 4J3VA 4YCPA 3S0CA 4A3QA 1MXGA 3W71A 3C4UA 1GVFA 4FXRA 4GWEA 2W67A 2QNEA 4X61A 4I9AA 3OBAA 3N12A 3T08A 3FVDA 4AZCA 4S1FA 2BGNE 4D71A 1OHLA 4W7WA 1OFPA 3BWWA 2NX9A 4IFKA 3VGHA 1LWJA 3SJ3A 4M51A 3BZJA 5DT7A 1HT6A 2JBMA 1DIOA 2EEXA 4JL2A 4K7VA 1WDSA 3SCNA 1T40A 1GHSA 4BCEA 4CNPA 1TJRA 5HQEA 1C90A 2BB0A 2V3EA 3SAZA 1O12A 3WF3A 3MWAA 1Q6DA 1CX9A 2WWDA 4HK7A 1GOKA 5EB8A 5FF0A 4PRWA 3C8FA 4LCRA 4QQUA 1G4SA 4G1KA 2AQWA 2TYSA 3Q37A 5C9ZA 1HJVA 3OOQA 3LLFA 3FY1A 4F0HA 3SUSA 2X7WA 3L7RA 2OEMA 3SCUA 3BAYA 2ZXBA 2OZ3A 1GVYA 1FWSA 4Z0SA 3BK0A 4BS0A 5BCAA 1D2KA 1IWPA 4IIFA 3MDUA 4MZ1A 4JDBA 2HK0A 4ZE5A 3MI2A 1U1JA 3AZSA 2E77A 3LS9A 5C2XA 2OVLA 2CKSA 4E2VA 3OYZA 1XYLA 2CZDA 1ZENA 5TAOA 1POJA 3TROA 2PEVA 5B80A 3I65A 1S46A 3H70A 4BF5A 2QCFA 4NNCA 3IAPA 5CLWA 3HMCA 3G1YA 1SFTA 1F9CA 4G6CA 3NOEA 2GGIA 2QDHA 1JUBA 1XCWA 1EJUC 2VEGA 5DANA 1TV8A 3MUXA 4BEQA 3A3HA 5TIMA 5AECA 4TV5A 2GSEA 4DO5A 3V0TA 2ODOA 2KX9A 2GVLA 3SR7A 1WKDA 4FNRA 2F9RA 2CHOA 1TCMA 3ITYA 1A3XA 1NWRA 1W5OA 4HPNA 4CQBA 3LTPA 1RK5A 3CQ0A 3NGFA 1QHOA 3TN3A 1KB3A 4O52A 5J5RA 5EBUA 3HG2A 6TIMA 4P8UA 5FEWA 4NX5A 4QLKA 3XINA 4F3HA 1TPVA 4CNNA 2QIIA 5I07A 4GUIA 2GFTA 4H6RA 1Q7ZA 2V38A 4J35A 1OF8A 2REQA 1B57A 5LA1A 3O8AA 2EKGA 1PZ2A 1Z44A 3KXQA 2BFGA 1QPNA 2BSLA 4DJEA 1WXJA 4WGHA 3JUGA 4HSOA 4ROPA 5E0KA 4FA3A 3CB8A 3GNDA 2YB1A 3CUJA 4W86A 5HMDA 4C91A 5LXEA 1B30A 2YKKA 1P7TA 3GR4A 3K13A 4C1LA 2TPSA 3CM4A 1W3NA 1VCVA 4LQ1A 3H12A 2E25A 4JNMA 4PRRA 1UWQA 1GJUA 1IWAA 2DGAA 2ADAA 1XD0A 3N4AA 3TMQA 1RLCL 3R58A 4K8GA 1VEPA 2QCLA 2C71A 4DJDC 1T8XA 4PB5A 2HE5A 3GTXA 4W8BA 1L6FA 3MTWA 1JI2A 3FYYA 1DIKA 4HHLA 4DUXA 3I10A 4JXCA 3VE7A 3QR3A 4GG9A 2B4GA 3VIHA 2GL5A 1OB0A 4P7NA 3PK7A 1RJRA 1B54A 4QBXA 3W88A 1R3SA 1XLFA 2QV5A 3QGVA 4BFAA 2W79A 2PDWA 5I24A 4JFTA 1S5WA 3UNDA 4OVXA 1HQTA 2H3DA 2A85A 3LI0A 2R6OA 3MQTA 1AJ2A 3LCHA 1TRIA 2RKXA 2QMKA 2QUVA 3THDA 1T99A 4XO6A 1AVAA 1R2RA 3B0VC 1DJWA 4MVAA 2EAWA 4AIUA 4QGCA 1FWJC 1TMLA 2W27A 4GJJA 2WSYA 5I79A 3W2JA 4LVGA 2FPYA 1EDGA 5C0QA 1QR7A 3ZJ6A 3AISA 3UZJA 3RPMA 1KFWA 1UPMB 4IQLA 4AF0B 3GDTA 4UR8A 3P60A 4W87A 4Z2JA 4XKYB 4RNIA 3IVUA 3PF3A 3TC6A 3AQUA 4HBKA 3VZZA 3KVLA 1PIGA 1EH9A 3U2ZA 1MW2A 2Y62A 3QY8A 3EOSA 4FEZA 5I3HA 1TRDA 3OW1A 1SYTA 3LU2A 1EIXA 1X8FA 1W1IE 4JHOA 3W22A 4IG2B 3LM7A 3WLQA 1UKQA 3NL3A 2BOGX 3LCWA 4GO8A 4GQQA 2CLFA 3LLDA 4DXKA 5BW6A 4H01A 3FXGA 2F61A 1DWIM 4PTNA 1RD6A 1W37A 3OA5A 2XZ7A 5KZMA 3P61A 4AYGA 4LUSA 2Y7EA 2FJKA 2WQPA 3FNDA 3T09A 1O5KA 3C6CA 1W1YA 4OJYA 1Q8JA 5LA0A 3WG6A 4J4KA 2UY3A 1I8JA 4XZIA 1ZS2A 4IQJA 4WQ6A 1Q13A 3B40A 3FCPA 1EYEA 4TMCA 4WSJA 1I4NA 6ENLA 4JTRA 4L4LA 3MBFA 1EA9C 3FJ6A 1G4PA 1OSEA 3M1ZA 3WN6A 1KKOA 7PTDA 3S5NA 4DBDA 1RAKA 2WVVB 1R3QA 3CQKA 1GG1A 5CPOA 2JALA 3LEPA 4A05A 3VCCA 4GFSA 1L6SA 3EXTA 3ZZ1A 4RW3A 2XIJA 5D2WA 3LCXA 3REQA 3W4RA 1ISZA 1FY6A 1QPOA 4JX6A 2IUZA 4KCWA 7REQB 4YTRA 3UR5A 3KTCA 3IJ7A 3CUIA 2VUNA 3DYMA 3NSXA 2NSOA 1B3XA 2O9TA 2HCVA 1ZHAA 2YBTA 4B5VA 3AU6A 5D37A 9RUBA 3SRKA 1E71M 3QFWA 1QNPA 3IANA 4B15A 2HXUA 3S2MA 4S3BA 3QRHA 4MKNA 4HA0A 1Z8AA 5E5CA 3SB0A 4K37A 3WJZA 4ZQPA 1RQHA 4IFKB 1S5TA 4NZ3A 1M1BA 1Y65A 1TKKA 1CDGA 2A3BA 1W54A 1BEUA 2UWFA 3TYAA 1BG4A 2GQ3A 2GVGA 3EXRA 3D47A 3CZGA 4LS2A 2J8GA 2FZ8A 3UYCA 2XVGA 2F8QA 3EYPA 1WZAA 4GI8A 3CUHA 1AK5A 4HCHA 5F2LA 3ID7A 3IS4A 5GNZA 1XC4A 4E4FA 1HJWA 2O4MA 1SJAA 2V8ZA 2W91A 2RJGA 3OZOA 4JY8A 4JQAA 1FWFC 4LUYA 3WD1A 2INEA 4PUWA 4AHPA 3N4EA 4XAPA 2WJEA 2QCCA 1UD2A 1O95A 1WE5A 3T6CA 4RE0A 3T2PA 4K1GA 4W84A 3OIXA 1PSCA 3I7SA 3BV4A 4R27A 2I5QA 5D03A 1FWCC 5AZ1A 3P93A 2QT3A 4YL2A 3VUPA 1FWTA 4C6OA 3L66A 2PB1A 4Q6JA 3EKLA 1DWFM 3WKZA 4L56A 3TKFA 5C2CA 3LGEA 4LNCA 1GQIA 4IP4A 3D0CA 4YLWA 4REQA 3C2YA 4K68A 2GOUA 1XLCA 1OZQA 2OO6A 2E1WA 3H2CA 1XIEA 3GQYA 1E6XM 1M04A 2FZNA 1FX6A 3OVRA 4S3AA 1YMYA 4MDOA 2Y2WA 3UG3A 1PB0A 4GXPA 3GH7A 3VNDA 4QX4A 3SN0A 3AI0A 4E38A 1UIOA 2R9RA 3MKKA 3NQ8A 3P3BA 4I9MA 4UBPC 1KV8A 4O1AA 1EEPA 1K77A 5BXSA 2XH4A 4YTUA 2WMGA 3D5HA 3B9NA 4A22A 2MANA 2XIIA 1JYNA 4GC3A 2R1MA 2ISDA 1A3WA 3IWPA 2FQIA 1ZCCA 4C7DA 3NPWA 1KTNA 3WBWA 4CVWA 1AJZA 1TE1A 3EEGA 1FCQA 4DBUA 1UR0A 2DDXA 3R8RA 4NRSA 4US5D 3UPWA 1KRCC 1O7AA 3QW3A 3W82A 1S5NA 4F2TA 2WMIA 3CPUA 1TWWA 4FP1A 1Q6QA 4NZ5A 3VABA 4D6HA 4JTKA 4ZE4A 1F2JA 1EEXA 3U57A 5FF2A 4QE5A 1KM2A 3PBVA 4FX8A 3E96A 2CLEA 3MS8A 3LCFA 4GVIA 1UWAA 5A8QA 4MNLA 1KFLA 2EG8A 3T42A 3B04A 2VOTA 4FX6M 3QH2A 1IEWA 4UR7A 1PTGA 3F4NA 4OOUA 1KM6A 3UZ5A 4RE4A 2H8XA 1EC7A 1KGXA 1PDZA 2PDGA 4UTKA 3P8JA 2A2IA 3QC3A 3WMCA 4ILSA 4XZMX 3UEQA 2QDDA 3WENA 1CGVA 2F38A 3GX9A 4V2XA 2ANUA 4C6EA 1JAKA 4A3RA 4NRRA 1LCOA 1T7LA 4PH6A 5CGQA 3ZVIA 1JCLA 4CQCA 4A3YA 3NL5A 3R89A 3STFA 3B9DA 4OUIA 2ZE3A 2NUXA 5CZ0A 5CAHA 3PJUA 1TYGA 2ZICA 2DJXA 4QJ4B 1XLAA 4AWUA 1NDVA 2Z27A 4MPKA 2RFGA 4B5NA 1P4CA 1HO4A 3CMGA 2WKGA 3SJNA 5AB3A 4Z0JA 2WHLA 3KLKA 1XUUA 1CPUA 2XUCA 5DBUA 2RDWA 3H21A 3MSGA 1E3XA 3NYZA 1J4EA 4JTDA 4B5UA 2P1FA 1GEHA 4WUIA 1TTPA 3EX1A 4EP8C 2X1SA 5BU6A 1R86A 3QZEA 3GHTA 4PSPA 1W1A1 3S2CA 4AHQA 2PDHA 4R9OA 4HZ7A 3PM6A 3BTNA 3B9OA 5EA9A 3IJLA 1WNOA 3QHOA 4D2JA 3TU9A 3KOWA 2DEPA 2GJXA 1OGSA 2AOSA 3GVRA 1VC4A 3MCMA 3QV6A 1HP5A 1UP0A 3VM7A 4LU0A 1ICSA 3H7RA 1FCVA 1DJXA 4PC8A 4G8TA 4G56A 2J27A 1F8MA 3QZ6A 1JQVA 3N3TA 5DY3A 1YDNA 2HZGA 4Q8TA 3WUBA 3CUGA 4GY0A 3KVMA 4IFOA 1PIIA 4O17A 2ZX8A 4IH3A 1UC4A 1XBVA 1MQRA 1EIBA 2DQWA 3L5MA 3SGZA 3DC8A 4C5ZA 4U28A 2ZTJA 3AZTA 1POKA 1Q6LA 3NVTA 3PBWA 3CHCA 3NAVA 4K6AA 3ELFA 4FXJA 2GDUA 1FWDC 3EPOA 1OT2A 1AODA 4CCEA 4GLEA 3RO8A 2WJDA 3GDBA 3LK6A 4NAEA 4M8UA 3LNPA 2G50A 3REQB 1WKEA 4AEOA 1Q6CA 3G22A 1Q7QA 1M7OA 5ABHA 2JIEA 3WNKA 3LB0A 3ZLHA 3EEZA 4EVZA 1DORA 4E2DA 2B31A 2CNCA 3FFSA 3W7MA 4GZIA 4FB7A 2YL5A 1X39A 4C65A 4XWUA 3ZWTA 2A0NA 5A2CA 2OZ8A 2WO5A 3P80A 4OGZA 3N2TA 4DF1A 3YPIA 5I3IA 1MUCA 1E56A 3CMJA 2HS6A 1QK0A 3QZAA 4NG3A 2HMCA 5D04C 2G0WA 2ZXDA 1FQ0A 5C2GA 3LBCA 4BI6A 2HS8A 3P6LA 4KQNA 3GG8A 1XBXA 1ODZA 3R6IA 1R5YA 3TXVA 3L4XA 4LVDA 3BJTA 3GS6A 1PV8A 3M46A 4GXMA 3KE0A 2VCBA 3B0YA 2ISWA 1KBJA 2PTXA 3W1TA 4D8AA 4IMDA 3W1MA 2X1IA 3T0DA 3BQ5A 3G18A 3KDOA 2CHRA 4JN8A 1H0GA 9CGTA 1W9UA 3WUFA 4L4MA 4ASTA 3WCZA 4JBRA 4ORIA 2X1TA 2OOGA 3SRFA 3WQGA 3HQOA 3CL7A 4DWSD 2Z26A 2GUYA 2YX0A 1V0MA 4A35A 4KBXA 3STPA 3TSMA 4QCEA 5LYRA 3BJFA 2Q09A 3LUTA 5I23A 3TW9A 5K9CA 2EBNA 2FLIA 1ISYA 4GYPC 3R5EA 3H7VA 3PR2A 3C86A 3R10A 1B0IA 2GGHA 2OQHA 3QSTA 1QOPA 3VZYA 3BLIA 3KOFA 3EGJA 3LLXA 1F6PA 3TP4A 4JDYA 2Z2AA 1GOXA 3WEOA 3BANA 4MB4A 1E6PA 2Y5SA 2FDMA 4YN5A 2OWWA 5HANA 4Z08A 1TTQA 2ABAA 3TYBA 3W2MA 2ZWYA 1E0TA 2XPKA 2DSZA 4PEKA 2D24A 3E74A 3O6DA 4WOQA 4H9MA 1EUNA 1T5AA 3E2VA 1JJKA 5CZJA 4LGXA 2WMIB 1QNQA 3IARA 1GOQA 3VGFA 1FRBA 2D0HA 2PLMA 1OZMA 1UMYA 1A5SA 3SUVA 3CO4A 1UCWA 4LX4A 2YFNA 4XD3A 3K46A 5BYWA 1SFSA 2ACQA 3NSMA 4FS9A 4YXGA 3T0TA 1NQ6A 5FL0A 4LAOA 3RM8A 1KXVA 3U48A 4WXYA 3QR1A 4XZWA 2Y7FA 3CQIA 4JZ5A 3VOFA 2PI6A 2DSWA 2X30A 4UMAA 2GSJA 4W4QA 2P88A 4RNHA 1PZ3A 1VBJA 3MKVA 3ZS4A 3BLOA 3EX3A 1SGJA 1EP3A 4IX0A 5C9XA 4ATDA 1BXNA 3TYDA 5D2VA 3VNZA 1LQAA 1XFBA 3QPYA 4HVXA 4S2CA 3VNKA 1W9XA 2DZUA 1EFZA 3BARA 3JR2A 1DV7A 3U0HA 2GOKA 3N9RA 1Z32X 2V2DA 2CW6A 4HCLA 3CAKA 5AC5A 1J2WA 4DPPA 1PL9A 5K3VA 1EWEA 3EWXA 2G5WA 5LIUX 4C6KA 4LNYA 4EPDC 2OZTA 3NQGA 1NAL1 1RV8A 1TQXA 3QJAA 5GNXA 2J75A 2I9UA 3G1HA 1YTDA 4PZVA 2VX5A 3VYLA 4OT7A 3EOOA 4KGJA 4QJ5B 2PURA 4ZR8A 3PPCA 4GD0A 1FHVA 3NA8A 1N8FA 1H50A 3T4WA 2HSAA 3CQJA 3WD2A 1VENA 4DEFA 3U2EA 3O0FA 3CLMA 1G4TA 3SQSA 4V1YA 3OQ8A 1YBQA 4AC7C 3NO3A 4EIVA 2LLEA 4X60A 5A6LA 2EHHA 4BJHA 3SDOA 3B97A 2CLIA 1NF7A 3M9YA 4BR1A 1L6YA 4QLJA 4Y8EA 1TJ2A 1BXCA 3ITTA 5LIXX 5K9DA 2AGTA 2J7BA 4WSKA 4WJEA 2QV4A 4O0QA 2Y88A 1J8VA 4X0VA 5I02A 4PFHA 3GTNA 4AXNA 2R8WA 2PGEA 1RXOB 2PCEA 1DJQA 1BQGA 1XLMA 3ANUA 2FGBA 4P8XA 2V0TA 4V15A 1O94A 2F6XA 5ABEA 3CAVA 5CG0A 1C3FA 1OX6A 2WMHA 4PRTA 3CEPA 3M6DA 2DQXA 3M5ZA 1VKFA 4TXEA 3GFXA 3D3AA 3RXZA 3VDAA 2JQXA 3CK5A 1WBHA 3MHUA 3ZT6A 2V5KA 1NFBA 4P8WA 4U3CA 1BTCA 1AL7A 4US6A 4S39A 3CZLA 3LG3A 2JEPA 8CGTA 2XN1A 3TWAA 2A1YA 2Z6IA 4RZ5A 3RLVA 2Y8KA 3GXIA 1IGSA 4Z2HA 4DELA 3O2LA 4RJEA 1PS9A 2F2KA 3MT1A 2XH7A 3RFAA 3WF1A 4DJDD 4IIBA 1RBOB 2J47A 3B9AA 4GXWA 2OX1A 3MZNA 4DB7A 1H2JA 5EU9A 4J1OA 2WSKA 3WLOA 3AYVA 2OB3A 3N3MA 1TPEA 3FAWA 3TNBA 2GVYA 1JNDA 4PTMA 3JU2A 3CIWA 3GXDA 3TA6A 3KL0A 3UCDA 2OR2A 1CEOA 1JYVA 2OWXA 3TDFA 1ISXA 2P3EA 3GKAA 1JGIA 1PXGA 4AEEA 2KZHA 3TMLA 5CSRA 3BO9A 3SCQA 5IM51 1SJBA 4JTTA 3MI6A 4BEUA 4K39A 4QROA 3WQWA 1UOZA 3ORWA 3WDIA 1I2OA 2ACSA 3RCNA 1PWLA 1TPH1 3RJXA 4FNTA 4A2SA 3KRUA 3W6LA 5A1AA 1CW2A 4S3EA 4DZAA 1EDTA 1QOQA 1SSGA 4H9XA 4JL1A 3N73A 3A12A 3LPGA 1VFSA 3PZUA 5E6YA 2NQHA 1PCKA 3VA8A 1JL8A 4NT0A 1PYMA 2FDSA 3ZR4A 4IPNB 3H23A 3VE9A 2ZKMX 2IKHA 5C9WA 2X0SA 4R3UA 2Y5EA 1HKKA 5FSEC 1QW7A 1E1FA 3EWBX 3QV8A 1SJDA 2A3HA 3PZGA 1LL6A 3IV3A 4ACZA 1VFOA 1KCLA 4JTFA 5D9OA 2IPFA 1EYWA 3H4XA 3APTA 2CLPA 3OGVA 3CO8A 4PN2A 3HFTA