4HGXA

Crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
MNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Xylose isomerase domain containing protein
publication title Crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 84
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4hgxA00
3ITOA 3QC0A 1K77A 2XIMA 3XIMA 5EMKA 4OVXA 4US6A 4ZBCA 5EMMA 1XLAA 4QEHA 4K1GA 1XLIA 3DBNA 4GLEA 1XIDA 5B7YA 1XIMA 1XLKA 1XP3A 3XISA 4XSMA 4A8NA 4YTTA 3CWHA 4QE4A 4HGXA 4PFHA 3UXIA 4G56A 2XISA 3VNLA 3DX5A 1A0EA 2G4JA 3CQHA 1XINA 4X61A 3WQOA 2NQJA 3KBMA 4EAYA 3ITLA 2NQ9A 4YTSA 4GJJA 3OBEA 4A8LA 5AVNA 3VNIA 2GYIA 2OU4A 3ITYA 3L23A 3M0YA 2ZVRA 1BXCA 3LMZA 2I57A 3M0MA 6XIMA 5I7GA 2QW5A 2HCVA 4XSLA 1XLCA 2X7VA 2GVEA 3IUHA 4QDWA 5TNVA 4YTRA 3C0LA 4GQBA 4YTUA 3VYLA 5EMLA 3CQKA 3N4AA 1DXIA 4K3ZA 4W4QA 4QDPA 3BWWA 1XYLA 3KBSA 1XLMA 4X63A 3KCJA 3M0XA 3KBNA 5B80A 3GNXA 2J6VA 1XISA 3AALA 1XIJA 3UA4A 2QULA 2NQHA 3C0SA 3U3HA 5B7ZA 3IUIA 4HNOA 5EMJA 3UVAA 5C9ZA 1MUWA 3JU2A 1XLGA 2GLKA 3BDKA 1XLDA 1YX1A 1I6NA 3BZJA 1XYAA 3KBWA 3M0LA 3M0HA 1XIHA 1S5MA 3AAMA 4PGLA 1XLJA 3XINA 1TZ9A 4E3VA 4YTQA 1XLFA 1XYBA 3KCOA 2QUMA 3AYTA 3IUDA 3ITXA 9XIMA 3KBJA 1XIEA 4X60A 1XYCA 5XIMA 2HK0A 1XIFA 1BXBA 3U0HA 2XINA 3CNYA 3AYVA 4XKMA 3TVAA 9XIAA 5J8LA 8XIMA 1XLHA 3M0VA 4LNCA 8XIAA 1MNZA 4QE1A 3TC3A 4HHMA 2G0WA 4HHLA 6XIAA 5XINA 1QT1A 1DE5A 1S5NA 3ITTA 2HK1A 4XISA 1DIDA 3BANA 3NGFA 5H6HA 2I56A 5XIAA 1XIBA 4XIMA 3BZGA 5AVHA 3P6LA 4DVOA 7XIMA 1O1HA 2X7WA 3CQJA 3ITVA 3KTCA 1GW9A 1CLKA 3UU0A 2QUNA 3CQIA 4Q7IA 5FA5A 1XLBA 5H1WA 1DIEA 3KWSA 1D8WA 1XIIA 1XICA 1XIGA 4ZB0A 3UA3A 3VNMA 2ZDSA 4QE5A 4GJIA 4KW2A 3QYSA 1OADA 1A0DA 4EACA 3QXBA 4DUOA 1XLLA 1XYMA 3KCLA 4QEEA 3VNJA 2GUBA 1QTWA 3FVMA 1A0CA 4ZB2A 3C0QA 1I60A 4XIAA 4J4KA 3VNKA 3P14A 3QZAA 4A8IA 1DE6A 4A8RA 1QUMA 3KBVA 2Q02A 4ZB5A 1XLEA
chains in the Genus database with same CATH superfamily
3GIYA 4AZHA 3KE0A 4C1KA 4I8YA 3U4FA 3UPWA 4ZTXA 2GUYA 4DBUA 1VPQA 1OVDA 5HDRA 3THQA 1TV8A 1QVBA 3NPXA 2YFOA 2B31A 3WQPA 4MVAA 4PMVA 3CH0A 2AL2A 1E1EA 3ELFA 2FQIA 2ZRXA 1JCMP 4EK7A 4CU6A 3FGCB 2QVNA 3DFSA 4Q6JA 3GBEA 2G3MA 3N14A 1A53A 1ZJBA 2PTXA 5K2ZA 4JL2A 1I1XA 4M56A 1GQKA 4PRWA 3VIIA 2VO5A 4RW5A 4M80A 3QH2A 3VM7A 4FR6A 2OSXA 3FA4A 3J7HA 5EYWA 3BDKA 3BZJA 4Q7NA 4TX9A 1M7XA 1EJVC 3TTYA 3BJFA 2OLSA 5JU6A 3KCOA 3BURA 2V30A 1POKA 3APTA 4NJHA 1CGXA 2HV5A 2PLMA 2WCGA 2NT1A 2PCQA 1XG3A 3E96A 4DO7A 2Z00A 1SW0A 1OFQA 5AHEA 5DMLA 3IJDA 3N2CA 2ZFAA 4L9XA 3NAVA 3UWUA 4I6VA 3B8TA 3MUXA 5DBUA 3P8IA 1CEOA 4Q7IA 1SZFA 1FH7A 2ZWYA 3R1ZA 2H9AA 4JHMA 3ZM8A 3BAIA 4KBXA 1A0DA 2BMBA 4HK5A 1LWJA 1KC7A 4E2DA 3NPWA 2DH2A 2UV8G 1K77A 4E38A 1C3FA 1JJKA 4I9TA 3WD1A 2CITA 2ZX9A 3KL3A 4L6HA 1V6WA 1HQTA 2C91A 3GBDA 4GXPA 3RCNA 4NKCA 4Y2WA 3XISA 1C7TA 1ML1A 4WXZA 3FFSA 1V6XA 4Z1BA 1JRCA 1ECEA 3HURA 4MIMA 1TFVA 2E9BA 1ZB5A 3DDMA 4ZOEA 2WSQA 3R79A 4UTMA 1H3GA 3THUA 1TX2A 2ON3A 1ZNNA 2CHOA 2X0YA 1IZCA 4C7DA 3BXWA 3E0FA 1EUNA 3NA8A 5A95A 4GK8A 3DFPA 3L67A 3WNKA 2GLKA 3PBYA 1I6NA 5KZEA 1BKHA 2PB1A 1H61A 4XZBA 3PULA 4LVAA 4B5TA 5TBOA 3WMBA 2ZA1A 4GH3A 5I6SA 4U5KA 1T7LA 5A6LA 4Q8PA 2YOCA 2OOFA 1E0WA 3L2LA 1QNQA 4P8XA 2ZZ6A 5CZKA 3ES8A 3UU0A 4E4PA 3SBFA 4JFTA 2DQWA 1CENA 5CPOA 2G4FA 2W92A 1ZL1A 1OADA 4HMEA 5AHFA 2DT2A 3UG3A 2XZ7A 1ZQ5A 4IP7A 2Q02A 1C7SA 1BD0A 2EJ1A 2AAAA 4GBDA 3RFAA 1TTPA 2FJUB 1S3TC 2V5LA 3N2OA 3GB6A 4JAWA 5A8OA 1TSIA 1E0XA 3UT0A 4DUVA 2OZ0A 4ML4A 4WY0A 3DFTA 3T4CA 2CC0A 1EWDA 4FNQA 4U33A 5FKYA 1QBBA 3APGA 5FSEC 3UF9A 1GG0A 1C90A 1ZAIA 4YVPA 2BNJA 2Y8UA 3C8NA 4A3QA 1PUDA 3BC9A 1EOMA 2P3EA 3OB8A 4GC3A 3W7GA 5D05A 3CO8A 1A50A 3BAYA 2QULA 1U1HA 3BV4A 1XLGA 1J0HA 3I4KA 3GXFA 4IQLA 3V0SA 1FHUA 3AHVA 4H6EA 3VD7A 2VEFA 4ZXOA 4Y9AA 4W88A 1QO5A 3VIJA 1KGWA 1WUFA 3LZ5A 4PTDA 4XO7A 3WEMA 3W2KA 4L7ZA 4D1IA 4N4PA 2GGEA 1HP4A 1VEMA 4DJDA 3LBMA 3STCA 3AZSA 4NAFB 3VIOA 4XWUA 3G1VA 1XSJA 4ZENA 5JIWA 3ZLHA 4O18A 3VD4A 1J4EA 4UTJA 3CQ0A 2HEJA 4UQ9A 4FSAA 4JTLA 2QAFA 2PDIA 3FCPA 4UR8A 1PZ2A 2ZX7A 1UR3M 2XIBA 3TSBA 1LBMA 3FAXA 5HNNA 1BTMA 2WHKA 3TKFA 3QGAC 1RCQA 3RUBL 3TN3A 4AC1X 2C3ZA 4B5SA 1O95A 4UNKA 3K4WA 2PDXA 2Y7FA 3GU1A 1F6KA 3IVSA 4NILA 2F84A 3W2LA 4LUSB 1TREA 2WSYA 5I3FA 1BXCA 2SFPA 3UYIA 3M0MA 3CMJA 1SUXA 1TYGA 1RALA 3W86A 3MP5A 3N4AA 3RR4A 2J7BA 4W4QA 4IX2A 4AFYA 3QHNA 5C9ZA 3RMEA 2VFDA 4RZBA 4LB3A 1ZALA 3CIWA 3TC6A 1FCUA 3CL7A 1I1WA 5E1QA 1CLXA 3HV9A 4PSRA 3UXLA 1BWLA 1RLCL 3MVTA 1KWGA 1SMDA 3W7QA 2EPOA 2CZEA 4HPXA 2FGBA 3P74A 3ZJ8A 4MADA 3MYOA 3E2QA 2H3DA 4LAZA 1VP5A 5D8WA 4O11A 4JOMA 1UWIA 4PUJA 2DT1A 1Z48A 3ARWA 4M1BA 3XIMA 2PURA 3M43A 1WDPA 1M5WA 1R2SA 2ABAA 4MGGA 4NIRA 3TW9A 1UKSA 1UD2A 5IOBA 2I5QA 1KLYA 1EFZA 4M82A 4TXEA 2PDQA 1N8WA 4C6CA 1W1ZA 1AW1A 4C6IA 2HMCA 3F4NA 4O8RA 2A4AA 2B7QA 4AHQA 4Q8WA 2WC3A 5DMYA 3OZMA 2VFGA 3NDOA 2JF6A 5U4NA 2NZLA 1HGWA 1FCQA 5I02A 3W07A 5A6MA 2PGRA 2FPVA 4CVUA 3W7JA 2FGLA 3D46A 5I00A 1KTNA 2ZC1A 3NQ6A 3GDMA 2NQHA 2X1TA 2NQ5A 3GDBA 1MXDA 4C1NA 3IK4A 1V3HA 5FEZA 2G95A 2XSAA 3O63A 1W9DM 3VDCA 1W5MA 1P1XA 6CGTA 1M65A 4GIRA 3L4YA 4TU1A 1FFRA 3V5OA 3MDUA 4PR4A 4CD7A 3LQLA 4DPPA 3EXTA 5DT5A 5M03A 2BOGX 2WM0A 5ENLA 4BEQA 5CC5A 3KTCA 1DL3A 3B9NA 1EJRC 3CQIA 1KLZA 4OZOA 4LB4A 5M17A 1RCOB 4E6MA 4BQ4A 4AC7C 1TUXA 3GR7A 1XQKA 4J4KA 3P14A 1Y7VA 1MQPA 3S5NA 4Y8FA 1Q6QA 4UR9A 4K7YA 3EDEA 2TMDA 1WX0A 2A3EA 3M0KA 2QMJA 1W17A 2VJXA 2UZ9A 2CZDA 4MWAE 1JQXA 2YSWA 4PMXA 1UBPC 2XFWA 3IJ7A 3M0YA 4AZCA 1QOPA 2I57A 3I3BA 4IXXA 4MNKA 3C56A 2BOEX 4DXKA 1EPVA 2XWDA 4F48A 3S5OA 4CQCA 3MWCA 2ZRWA 4AXKA 2ZZ2A 3GYEA 5A6AA 3D3AA 2YJQA 3OPSA 1AH4A 5JIPA 2P88A 3VKBA 3OBAA 1J79A 3M6DA 3O07A 3K8LA 1XS2A 1E9YB 1JFHA 3S1GA 1P5BA 3ATZA 5GPRA 4I90A 3SIMA 4M7SA 1YADA 4B5VA 4LW7A 3U9IA 2EG7A 3SQSA 4H2CA 2CKSA 3A9BA 1M7JA 2W6RA 4S3GA 2FB2A 1UUQA 3MJMA 4LEQA 1RD5A 1XDMA 4XAYA 5AOUA 4EPKA 1XH1A 7TAAA 3CIXA 3M5VA 1HJSA 1S2UA 1A3HA 2GJPA 2Y1HA 1V3IA 1VRXA 1MW0A 3SCQA 3FV9A 3VKCA 3EWDA 4M6PA 3L0NA 4OE7A 4MKSA 1Y0EA 4P8VA 5JVLA 3REQB 7TIMA 4GO9A 2XM1A 1XRSA 2PC8A 1B9BA 2BVWA 2DUZA 3V7PA 1E5JA 1O60A 5JXQA 1PIIA 4LS1A 4MHBA 2DSKA 4Q8VA 1NFGA 4O16A 3EX6A 3VPLA 2XGBA 3VUSA 2QHAA 5CEWA 2NSOA 4GI9A 3S6OA 1LBFA 1QW7A 5BU6A 3VMNA 4AH7A 2W62A 4Q7BA 1LL7A 4MJMA 2XG9A 3GR4A 3CYVA 1Z7AA 1B3OA 5HWJA 3B8WA 4FX6M 3RNDA 1UC5A 2DZAA 4BI5A 3CHDA 3T0TA 5AHMA 5BRPA 4FF7A 1HVXA 5LGZA 2QUUA 2YA2A 1MW2A 1M9HA 1U30A 4G1NA 1UHVA 3W3OA 4DJED 4DYEA 4UTKA 1CPUA 4O53A 3W53A 5HXMA 1MEWA 4NZJA 2VOTA 2Q3RA 3LK6A 3CQJA 1UIOA 5H8MA 3VIHA 3L4TA 5K3VA 2OEJA 1I2QA 3B0XA 3DZ1A 4BI7A 3UG8A 3PZNA 1LRQA 1VENA 3U2EA 3W7LA 3UJFA 1ZP4A 5KEZA 2QUTA 1LT8A 1YNYA 3O8AA 4WR3A 3A64A 4EF8A 1IXPA 2PP1A 3Q45A 3GDKA 2HVMA 1FDYA 4XAZA 3SJ3A 4QGCA 4FI4A 1KM3A 3POHA 4JQ4A 5KETA 1Y5XA 4N02A 2XN1A 5I3HA 2ZA2A 4Z42C 2E68A 3ITLA 2J13A 3L21A 2ABBA 3WDRA 4F66A 3DC0A 3UZXA 3AIRA 2RGLA 1Q2SA 4YHGA 4P8UA 3KBNA 5B80A 2I14A 3QF0A 2WO5A 3ID7A 2D2JA 4AY8A 3CV6A 1XLDA 5I06A 2OCZA 3OVGA 4GYPA 3H7UA 5DY2A 3VOCA 1WZKA 5BMXA 5D9NA 2QCMA 1UKQA 1YPIA 4CVWA 1W3JA 4XO6A 2RHGA 3W24A 4L5ZA 4MUPA 1D7FA 1DJIA 2ATMA 1TRDA 5FEPA 5DXXA 4LYRA 4V1XA 4Z2IA 4Y9OA 1R3WA 1DJWA 5LHEA 4IGMA 4Q4KA 3MV11 4KWVA 3UA3A 5HOSA 1TJRA 3CHVA 4OIFA 2PDKA 5CCZA 4ZB2A 1TMLA 4KWOA 4C6MA 1OX4A 4L61A 5DRCA 4ONVA 3LYEA 4PTWA 3PTDA 3SY8A 3H53A 3N3TA 5DMNA 5EMMA 2PDNA 3T4WA 2QYGA 2ZCGA 4XQ6A 3RX3A 3RX4A 4PMOA 4IJBA 3CJPA 5HULA 1PZ0A 4H6QA 3VX0A 2OU4A 4GWEA 4ZXLA 3K4DA 1KNWA 1RD6A 2WHMA 4ASTA 1KBIA 5LNUA 4MKNA 4IMGA 3WFAA 4X63A 1VHCA 4US5D 4H9VA 4YMZA 5G1YA 4A4AA 1K9TA 3AIUA 4GZEA 5LNWA 3U3HA 1SFSA 1I45A 3TE9A 8RUCA 2P50A 4GYJA 3NOYA 5T26A 3ZMRA 1TWDA 3RM4A 1ADDA 4IPLA 3U5UA 4O1EA 1KBJA 5D30A 3FXYA 3RPMA 4OHQA 3A23A 3U0HA 4IIEA 1PHWA 3DCPA 4C5ZA 3F5LA 3SCVA 4BF5A 3VD9A 3A21A 2PDGA 2ALRA 4DI8A 1GJPA 4AVOA 3S42A 1UWAA 4L65A 3M5ZA 4MAZA 4NL1A 5BROA 3CV2A 3AI0A 3WH9A 1NWSA 1M03A 1OFAA 5A2AA 1K1DA 4PMNA 4XD3A 4L4OA 1VJZA 3S2JA 1K02A 3LRLA 1R46A 2VD9A 2E67A 3VINA 4WEVX 4G7EB 3EWWA 4Q22A 4KWSA 3NL2A 4E4UA 2VEKA 2C19A 4NRRA 1KD0A 2VD8A 3ABRA 1AQ0A 4MWAA 2OKTA 1FWHC 5DT7A 4LANA 3TUUA 2KX9A 5REQB 3P62A 1EL3A 1OD0A 4LBSA 4HSHA 1W2VA 3PF3A 1UQYA 3SRKA 3BV7A 5IBXA 1YDYA 3H55A 2ZUSA 4GYFA 5CGTA 3PPCA 4DO5A 4DX3A 2QJIA 3UERA 3TJ4A 4GI4A 2FZBA 3W1AA 1AVAA 5AYXA 1EXBA 1MUWA 4NUWA 1ITCA 1MRAA 4BQ2A 1XRFA 3OGVA 4PMUA 1JL8A 2OVLA 1R85A 2PF8A 2X41A 3AIQA 4EP8C 4GE8A 3MWAA 5FD0A 3WDHA 3H4XA 4EWJA 5BZAA 2E4TA 2V3EA 3QV6A 3EMZA 3TSDA 4YYCA 4Q6XA 1BWVA 4L6OA 3MO4A 1W0MA 1AJZA 5CZ0A 2R6OA 2YBTA 4R34A 4TX8A 5J04A 1VZWA 2ZA3A 4L1GA 4LQ1A 3BG5A 4GJIA 1A5UA 4XD5A 3S9YA 2J77A 2ASHA 5A94A 3H7RA 1PZ1A 4KRTA 4JL1A 4UTWA 1KA9F 2NQLA 3NO1A 1LL4A 1J8VA 3W7OA 2EPNA 2WPBA 3G6MA 1FXQA 1EEXA 2Y5SA 1A5CA 4UWMA 3W85A 4EF9A 3TZFA 3NZGA 2VXNA 3Q37A 1WDDA 2E8ZA 5AYIA 3GIQA 3H2FA 1JULA 3WNLA 4JR5A 1ELSA 5FJUA 4P61A 2V2CA 4AEEA 1JCYA 5KZ6A 4RK8A 3CQKA 1M41A 4JD4A 4M29A 3GG0A 4H9UA 2OYKA 1PHQA 1GTHA 3RGTA 5CSRA 3GW3A 1VD6A 3DHPA 1E4LA 3UQNA 2RDWA 5GQBA 3W7DA 1K4HA 4GD0A 2GUUA 4E3VA 5IRPA 3W1MA 1I2PA 1CXHA 1DXEA 2VEGA 3FIGA 4DF2A 4MNLA 3VKAA 4B3ZA 3P81A 3ZO9A 1I8JA 2PA6A 1VYSX 3B9OA 1ZCOA 3OQEA 3WLPA 3R0KA 5G4EA 3M7SA 3LHVA 4UUIA 2J27A 1V4YA 4X0VA 4B9YA 2J8TA 3MT1A 2GVGA 3AIBA 1CW2A 3PZGA 3OQ8A 3OA5A 2ESCA 2CZVA 1JDFA 1HF6A 4Q32A 3TTSA 4G6CA 5C70A 4JXCA 1JPHA 3JUGA 1H41A 4KMQA 1EUAA 4REQA 2GZXA 2R94A 3P60A 1ISZA 3EB3A 3AMDA 1KM1A 1UZ4A 2PI6A 2QJMA 3LDVA 3MHUA 1LQ0A 3CWHA 1AH3A 7A3HA 2Z24A 4M7TA 2WCSA 3VU2A 1OFEA 2OODA 2Z6IA 4G5DA 5AZ0A 4C90A 3G1RA 3LPFA 3S1XA 3PC0A 2Z2UA 1CT5A 3TNOA 1VGAA 4C6QA 3TJXA 1SR0A 1Q3NA 3TDFA 3IACA 2V5KA 4CU7A 1FUYA 4QDPA 1IT7A 3R0DA 1AA1B 4J3XA 3P67A 1DJXA 4LUTA 3USZA 1B4KA 3WQ8A 3EX4A 3QY6A 1H7RA 5CJNA 4J3VA 2G96A 4ZO8A 2C0HA 3DKJA 3PFMA 4MM1A 2XIJA 4ACZA 4XD4A 4DF1A 3R11A 5LXXA 3OYXA 1R2RA 2DW7A 2GWGA 3M16A 3OLIA 3AXMA 3NZRA 1E6PA 2OO0A 4JX6A 2MNRA 3VGGA 4LX4A 4WF7A 2ATSA 1OF8A 1PO9A 3UZZA 3CB8A 2FVLA 2W66A 1E6RA 1FRBA 2A5HA 2ZZ4A 4ZQRA 4I7VA 2Y88A 1QHZA 4Q8OA 1W56A 1PPIA 5I79A 1EDGA 4HCLA 2OT0A 4K37A 4NZ3A 3BARA 1JPIA 3UWWA 3SGZA 4ECLA 1LOQA 4PCPA 1Q6OA 1Q4NX 4XZHA 4GNVA 1N8IA 2QXWA 3SB0A 3II1A 4FNRA 1EIXA 1DJQA 2A7NA 4QROA 4UFHA 4U4MA 3IUHA 2QKFA 1XV8A 3F03K 1WDWA 3ABQA 1VCFA 2CERA 4KQNA 3IPWA 4OV9A 2A0NA 3T55A 2PDJA 3T7VA 1GVRA 3W7NA 1UP3A 2Z1WA 3O2LA 3PWGA 3BSHA 4Q3MA 1MXGA 1JF5A 4PH6A 3S5YA 1FXPA 1SZRA 1GVIA 5HJYA 2PFHA 3B04A 4MFDA 4QQUA 2E9LA 1Z44A 2DSZA 1JCLA 2ISFA 5KTLA 4HOXA 1E4NA 1OC7A 4HHMA 6XIAA 3P7YA 1X8CA 4LY8A 3MP3A 5H6HA 3ICJA 4ZE4A 1J10A 3BJTA 1UQZA 6ENLA 4N9DA 3RXZA 2W79A 3NIYA 1JYNA 2INZA 5HUOA 2UY4A 4GXWA 5DCEA 1HGYA 4AD3A 2NUXA 1RBLA 3MMUA 4EACA 3KRBA 3PWIA 2WC4A 3FEMA 7ODCA 5EMUA 2P5NA 5MF5A 1W1VA 4NVTA 3VGFA 1R9YA 3WY1A 1G4EA 1SGJA 3OZOA 2WZEA 4URIA 1XRVA 1DWIM 4DPQA 5D33A 3LU2A 3FNDA 1PYMA 5C8BB 3VCCA 1RV8A 3FDKA 4JCLA 2VM8A 3AHTA 4LFYA 1IYXA 2PTYA 4IPIA 1Y8BA 3LCIA 1KR1A 2BODX 3TWAA 1J12A 3GW0A 2BOFX 2EJAA 5EY5A 2O55A 2VGBA 3V0TA 5D9MA 2Z1XA 4AD4A 4LF2A 3SUUA 2GSEA 2QCCA 3R8HA 2VENA 3DC8A 1RJRA 3EOUA 1M3UA 1TELA 1EHAA 4AQLA 3SSZA 1EX1A 1XM3A 4TVCA 4D2JA 3TOYA 1UBSA 3HGOA 2J7HA 1ICPA 4MOZA 1OFDA 4ERAA 2C13A 4Z2GA 2XGIA 5IFPA 3BLOA 4NJIA 2YIHA 5CH9A 1AFSA 3CB3A 1T8QA 1KGUA 1PKNA 3L0GA 3RHGA 1OGGA 1OHLA 4LH8A 4ZB0A 1ZBKA 3AXXA 1OK4A 3VIFA 2OT1A 5FF4A 1FP8A 1W5NA 1V77A 4PUUA 5A69A 2ZRZA 4JKKA 2O7SA 5BXPA 3LD5A 4XG1A 3FYOA 2E09A 3B4UA 1FQ0A 5FEXA 1TUFA 4E8DA 1GWJA 1PCKA 3IIVA 3WENA 4IF2A 4JTCA 3CEUA 4EAYA 2QUVA 4MDOA 2QNEA 4LGXA 3PFRA 3O16A 2XHYA 3MJYA 3SUVA 1KCZA 3CU2A 3L4WA 3K13A 3ZIZA 4GJ1A 5IDIA 3NQFA 3N6JA 2HCVA 4GY1A 4DM1A 4ZL1A 3WLNA 4QTGA 4WJXA 5T8GA 4AIEA 4B2DD 4WCJA 4WKAA 4KF1A 1Q85A 3MI2A 3T2OA 3O05A 4O17A 2Z4GA 3H2OA 2PLCA 2W4XA 3TYAA 3RU6A 1H50A 4WDTA 3GTNA 3NTYA 3ITXA 1P4CA 3RDKA 3EOEA 3BLDA 2YW4A 3QSRA 2XM2A 4IGHA 3CS2A 3N9RA 1GCYA 3ZSSA 4C91A 2POZA 3HZ3A 3CC1A 1OG6A 3AWNA 4KETA 3U48A 4HJFA 1HKJA 3WL1A 3C2EA 3RMJA 3QFWA 1NDVA 2QV4A 5F4SA 1KKOA 1NFBA 2VX6A 2G3JA 1XD0A 4WHBA 1VFTA 3FHQA 1X8FA 2IKGA 4IP4A 1QTWA 2VRKA 3VNKA 4EWND 2DIKA 1UUOA 3BWWA 4GQ0A 3AMGA 2H9AB 3CAKA 2PD5A 1W1B1 4ZFCA 3A4WA 4MLRA 1XLAA 1K7XA 1N7KA 3B8SA 1ZBCA 3Q2DA 5F4WA 1Y65A 1B3YA 5FEWA 4JIRA 2G8ZA 2HZGA 5BXRA 3UY8A 1EHNA 4AW7A 1GJWA 2J62A 1WKFA 4GKTA 4NY2A 2VDGA 4C6JA 2O9PA 1OCJA 3DUGA 1MZRA 4PB4A 2GJNA 1GONA 2XIQA 4NAFA 2DFAA 2I16A 3SR7A 1TE6A 3G1XA 4PN2A 4DJEC 1NQ6A 3T42A 4BZYA 3SEPA 4F79A 4OUIA 3IEBA 2PEVA 3S2CA 2WMIA 1WBHA 1QK2A 2OSWA 2CETA 3QHMA 5BWAA 4NZ1A 3H24A 1CIUA 1S3HA 1XLJA 2Q8XA 1XYBA 3NM3A 5PTDA 4PBEA 1HN1A 1EC9A 4D71A 4GQRA 3M5YA 4DYKA 1EDTA 2E8YA 2ISVA 4XKMA 1AJ2A 4HHLA 1OZQA 4D6FA 1VR6A 3ZLGA 4QX4A 3LPOA 3THCA 1WKEA 2VEMA 3BQ6A 3WQEA 2CFFA 1XLBA 3OGRA 1JZ7A 3A24A 1EJUC 1WNOA 2TYSA 4FOUA 4S3JA 4R85A 1JRBA 4P7RA 3S1VA 2PAJA 1VPXA 4AYSA 3KLKA 2X0HA 3MB9A 4ORMA 5HJXA 2YA1A 1GZJA 4FNUA 1RPKA 4GCXA 2INEA 1W9XA 3T0AA 5LIXX 1DKWA 1G7UA 3VDHA 2G4JA 1T41A 2E6FA 4YTSA 6ALDA 3H26A 1YPFA 3AYRA 4WOQA 1C91A 1G4PA 1AQHA 1PX8A 1JYVA 3TCSA 4XSLA 4UTUA 4FXJA 1QI3A 1YTDA 4WY0B 2GOUA 4JIQA 3K1DA 3EPMA 3EOLA 3K4AA 3TR2A 4Z2JA 3ARVA 1VH7A 3N17A 2D23A 5T9BG 2OZ3A 1CXFA 1WYIA 3TX9A 3PNUA 2DZSA 3GXDA 4PUMA 1C29A 3M0HA 1XIHA 3E2VA 2X0SA 1UR4A 4N0RA 3PG9A 3PG8A 3GNNA 3VOHA 1IV8A 2V68A 3IAPA 3ISIX 3TTQA 5GJNA 1JZ8A 4HA1A 1TV3A 1LOLA 3M5XA 3GZ3A 5XIAA 2X09A 4ROQA 3LM3A 3WEZA 1CB7B 2QUNA 4XZIA 2XVNA 2JEPA 1XIIA 2WLZA 5A6BA 1CXEA 3TXZA 4FHAA 3V1HA 2PDFA 2GSHA 4JFSA 3BOFA 4CN6A 3PUDA 2XH2A 1BXNA 3HGSA 5AC4A 3E02A 3HMJG 4DXVA 4I9JA 1BYBA 3BW4A 1E3XA 5E09A 3LXAA 3E5PA 1NDYA 1SPQA 1A0EA 1JI1A 4HZMA 1PB0A 1K8XA 1WDSA 2NX1A 2OXNA 3WJXA 3N18A 4L4PA 3CWOX 3BLFA 1G5AA 3W27A 6PTDA 3ONCA 4X22A 3GC5A 4GQBA 3H2EA 1ZBVA 1MZHA 1C8VA 2JIWA 3W1RA 1WO2A 5L9FA 3QHOA 3ARXA 1V7YA 4AZGA 1OYCA 4H6RA 4AUBA 2ACUA 3M0LA 4UFJA 4GVHA 3CBWA 5FOOA 4QS5A 4BHYA 2TPSA 4OQVA 4JDBA 1E4IA 4NJKA 1BG4A 2FVKA 2VQUA 2PTZA 4HK7A 5I3DA 3OU8A 3VIMA 3F2BA 3C5QA 2NQZA 1UWTA 4PB5A 3CL6A 3WFZA 3H2CA 3V3WA 2PE4A 3G3DA 4KT2A 4KW2A 2IS7A 3QYSA 2FZNA 3W4RA 4QM1A 1XYMA 1UKTA 1U1JA 4A3UA 1OQFA 4ZA0A 4TO8A 1LWIA 3H23A 3E2RA 1JUKA 1VFFA 1ZS2A 3B8IA 1B3XA 7PTDA 5EMKA 3RM8A 2IPWA 1DVJA 5AN7A 3OVQA 2NV1A 1EA0A 3D6NA 3LBOA 3ANUA 3VDBA 3NG3A 2DP3A 3QZ6A 3PWAA 1LUCA 1YNQA 1A5KC 2CWNA 4WSKA 1C93A 1RVGA 1HL2A 4YIWA 1ZTVA 1F73A 2FIQA 3NVTA 4K7VA 3T81A 1K9FA 4G7FA 1B1YA 1P6CA 2AKZA 5H8UA 3C0LA 5F1VA 3I7RA 3H2MA 2FHCA 4GI6A 1J93A 4JHZA 1WAUA 3O6DA 4H9ZA 1SJAA 3GTHA 3U57A 1RQHA 4WXYA 5H2ZA 4E2BA 1V0MA 1GOOA 2O9TA 3UETA 2I5IA 2V63A 4H7VA 3WLTA 4TMBA 2UY5A 2R91A 4C1NB 3VKKA 4GX9A 1TWZA 2PRHA 4NNAA 1TQJA 4LCQA 3ECQA 3SUTA 4J5NA 2BB0A 4CQ9A 3GXPA 4D8AA 1DYSA 4QQ3A 3SCRA 5JMUA 3LNMA 4UMBA 3EBVA 2HNHA 2XVGA 1MQRA 4R3UA 4NF7A 4HJWA 5GJMA 5C2XA 1FKXA 4QEHA 3NO5A 3TZNA 1R47A 4NZFA 2V3GA 1SMAA 1Z32X 5HNTA 3F1QA 2HSAA 3FSUA 3Q65A 3THDA 1XJBA 3CO4A 4K36A 1GOMA 1U33A 3N9KA 1EXPA 3B06A 1TA3A 2PGFA 4FIRA 5I09A 3N29A 1JI2A 5FL1A 1L8NA 4CCDA 1L6GA 4HYRA 4KESA 5LIYX 2VTFA 4LAUA 4IFKA 1F8IA 1QK0A 2GJLA 3DENA 3OEXA 4AZCB 1LDCA 1J5TA 4FX7A 2YCLA 3VMPA 2J66A 3FS2A 5B7ZA 1WOBA 1IZJA 2W0UA 2Z25A 2CW6A 2PMQA 3UGRA 5CQ1A 3VNZA 3R25A 3DERA 1ZAJA 1KQYA 4IPPA 2NLYA 1Q66A 4ERIA 3BK0A 4MZYA 4DIAA 1OYAA 5K9XA 3KZSA 4RLIA 1RQEA 2WC7A 4ZMGA 3EWBX 3P6LA 4V2XA 1G9HA 1WAWA 3KS6A 3S83A 2V2HA 1R7OA 4UQDA 2PDCA 1E6QM 4AU0A 1TIMA 2XVLA 1BVWA 4A3RA 3N15A 2PLJA 2Z6JA 3WKZA 3DESA 1M01A 3RIKA 4LAMA 1IIHA 3VIKA 3VKDA 3S6DA 3W7EA 3FHAA 1VCVA 3QKZA 2X1RA 2BP1A 2XJ7A 1VPYA 3DAQA 3BLIA 5EU9A 3O6AA 5J5DA 2YX0A 3UVIA 4RW3A 2QF7A 1Q63A 1GVOA 3GLCA 3EWZA 2PPGA 4NNCA 4KRZA 2VX4A 4JTSA 2PS2A 5I24A 3KOWA 3PK7A 5CG7A 2B4GA 4LBUA 2BBFA 3HB9A 4OUEA 1SO3A 5D9OA 1VC4A 3HPAA 1O12A 1ZJIA 4GGHA 1LJYA 2DDXA 3B05A 4KCVA 3OTRA 4QIUA 3FSTA 1GVYA 3FEQA 4P8WA 5HPOA 4YTQA 1XLFA 4FR1A 5F1UA 4O14A 4HCHA 1KRMA 2QCEA 1BYCA 1EYWA 1S5TA 4OV4A 4MKVA 4S3BA 3BSGA 4LS0A 1V6YA 3OJGA 3UESA 2AGKA 2CNCA 4IH3A 3UCQA 4J27A 3JZUA 2Z27A 2FTYA 4QJ4B 1NIUA 4Z17A 1H11A 1RUSA 5CPTA 1D8WA 1P6BA 3O6YX 2ZDRA 1O94A 1ISXA 2AQWA 3TN5A 4WSJA 1OZMA 4JYDA 3W0KA 2OKOA 2ZOXA 5I3IA 2Y89A 3UJRA 4ADTA 2ICSA 3L2IA 4F3HA 2CWXA 3TYDA 4B4HA 1SJCA 2EQDA 2DORA 4DJDD 1PX4A 1OCBA 2FYMA 3E6EA 4WZHA 1PIFA 1H7WA 5CZJA 1BVZA 3EGJA 1R9XA 4HZ7A 1QNPA 2C1HA 3HN3A 3IVUA 2V9DA 3KAOA 2HTMA 1W1YA 3NYZA 3ARTA 4WDUA 2VC6A 4IQEA 1QOXA 1JZ3A 1P0DA 3LLFA 4GC4A 3MANA 3ES7A 2FGZA 3C2VA 3QV8A 1IWBA 1MO0A 3BSMA 4B3KA 1B90A 4JDYA 3ZWTA 3KCJA 2NLIA 1R6WA 3AUJA 3VE9A 4MMWA 1TVPA 1JG9A 3WBEA 3GHTA 4HOWA 4O52A 4L1XA 3AJXA 1G69A 4DHGA 3XINA 4S3KA 2H3BA 3W84A 4GO8A 2VUYA 2POTA 3M64A 1O5QA 1LLWA 2QJNA 5CBIA 1X7FA 4L9ZA 5XINA 4B15A 3IWPA 1G94A 4JTTA 4OT7A 2YA0A 1EO7A 1JAKA 2CEQA 3VD5A 1TZZA 1QI2A 4UFMA 4D6DA 1KFBA 1FA2A 2WOQA 2ZADA 4HN4A 3TSMA 2WCAA 1QCWA 2ZXBA 5E0FA 4RE3A 4H4IA 3WMLA 1JUBA 3FA5A 1YDVA 1Q6GA 3OLDA 3QN3A 3GXNA 1KW1A 3E2SA 1XIDA 4A2RA 2JKEA 3RLGA 4QLLA 3CTLA 4QE4A 3UXIA 3UXKA 1BGGA 1K70A 4W5ZA 3NXFA 3LM7A 3RLHA 3UFYA 3QFEA 3BW2A 4IX0A 2F61A 5ABFA 4CN1A 3R2GA 2WMJA 4UFLA 3E12A 1VQTA 3BCFA 1B0IA 1XYZA 3LBCA 3SIZA 5BRQA 2Y4SA 2R1KA 5HWNA 1KRAC 4HNNA 4Z08A 4DZAA 1XC6A 3W81A 2J24A 3PZIA 2PLKA 1XYAA 1A4LA 5D38A 3WEOA 4X2RA 1MFVA 3UR5A 3RRXA 2WMFA 1I2RA 3N1AA 4BF7A 3BANA 2EBNA 2VFIA 1CXIA 4QJ5B 3TC7A 1ME9A 3KLLA 4RZ5A 5TQLA 2DUAA 1QASA 3PJUA 1W3TA 3FY1A 2F6KA 3HG3A 3TXVA 2GUBA 3VZZA 2R8WA 2WYSA 1QRQA 4GMEA 3GG1A 3GHSA 2DZTA 1GYNA 4PEEA 3UWVA 1THFD 3WL0A 3WBAA 1MDRA 1TCDA 3WQ5A 2VKZG 2Y6ZA 3W1UA 4GXMA 1OBAA 2E6DA 3BVJA 2VHLA 3VCNA 3MA8A 4XTDA 3L12A 3MV01 1PL9A 2AQVA 3R8GA 4UQEA 3CTTA 3A4JA 3WDJA 3TJLA 5AECA 3LHWA 1NQKA 2J9XA 4C6FA 4GY0A 3W87A 3NQEA 4MWAB 3SCNA 1N55A 1UCWA 3CT2A 1OGBA 3ITGA 4WDWA 3EPOA 5G4HC 3BAJA 1KO0A 1O6IA 1XYFA 2FHFA 3NL6A 2BS9A 4C7GA 2PWVA 1O5KA 1JYWA 3DI0A 2PGWA 4XZLX 2V81A 1CLVA 2VR4A 3B97A 4DI9A 4R7OA 4NYYA 2EEXA 4U2YA 4AB4A 2V69A 3UZYA 1UWUA 4F0MA 1DPMA 2RKXA 4K8HA 3S4TA 4B4FA 1POJA 4OOUA 2VZSA 1CZ1A 2FLIA 1KM5A 5I07A 3IJ8A 1E43A 1U83A 4LXFA 3G1SA 1XIBA 2JF7A 3P2VA 3UXDA 2OYLA 3RRAA 2VX5A 1PWMA 1VYPX 3JW7A 5GJPA 3WJWA 1N82A 3BLKA 4L64A 3U8GA 3P93A 3KL5A 5DN1A 3QLDA 4JZ5A 2AMGA 5T91A 4GQQA 2QPUA 3SCPA 5FF7A 4JKMA 1LT7A 2UBPC 1UD3A 2ACSA 4IG2A 1E3ZA 4N4QA 4OVXA 4US6A 2ADAA 5E9AA 2AAMA 2GGJA 2BSLA 1UP2A 4DUXA 1BWKA 1CTNA 1Q6CA 4Q33A 4XSMA 3UZ5A 2XSBA 4HU3A 1Z8AA 2PWHA 4FXRA 3DXIA 1RJQA 1XH0A 3N34A 2AMXA 1LZOA 1UWSA 1OJXA 3G18A 2IUZA 1EDQA 5LIUX 5DRIA 3FN9A 5BMWA 3F2DA 1JFXA 1KXQA 3KHJA 1ZENA 3RLUA 1O1ZA 2OWXA 1W3KA 3SCSA 4C1LA 2ZRUA 1W8SA 1VHNA 3MW7A 3TYUA 3FJ4A 5EMJA 3TYCA 1NSJA 3CPGA 4KIEA 1MUMA 3SQMA 1B3WA 5LA0A 3NQVA 4JN8A 1P0KA 4JKLA 1ISYA 1XYCA 1ESWA 3CL8A 2OGYA 9XIAA 2QCDA 2OJPA 1UD8A 1KFWA 4S3DA 4YWSA 1AH0A 1TV7A 3GHRA 3EEGA 5LSMA 1UKOA 4LJ3A 5FA5A 3MCOA 4IMEA 5AC6A 1GHRA 3R0UA 4JGDA 3C0QA 3MVIA 4A8RA 3BG9A 1LORA 2NSXA 3WDPP 1V51A 1FOBA 4QNEA 1GQIA 1UH2A 4ZBCA 4WJ8A 4H9TA 4ICNA 1NOFA 5FF3A 5F4XA 4MJZA 3RJYA 1G67A 1KCKA 2HDJA 1QFEA 5DX7A 3VOJA 2J9ZA 4MG4A 1XINA 4LPCA 2NQJA 4O15A 4REQB 5A3HA 1AD1A 2GGGA 5AHIA 2EKCA 3N12A 4W86A 1OYBA 1GG1A 3WD3A 1PV8A 1TVNA 5D9PA 4F2BA 2F9RA 3KUMA 3GO2A 1X1NA 3G0UA 3QGVA 3CIVA 4AXNA 2QVHA 2IQDA 2QCLA 3GDTA 2GJRA 1D9EA 4YN5A 3NQMA 4JNYA 3IRSA 3B03A 4LVDA 3OO2A 1LYXA 4W84A 3UBPC 3IVTA 1A5OC 2B81A 3AIVA 2F7FA 5C5YA 4LUTB 4EE9A 2WBKA 5A6JA 2RH9A 3A5VA 4ES4A 5M5DA 4YCPA 3PTKA 4UIOA 3UJ2A 4PMYA 1WZAA 4O0ZA 1KM6A 2HK1A 4UC5A 3EPNA 5IDZA 1J18A 1H5YA 1GT8A 4O50A 2H6RA 4ACZB 5HWMA 1E6ZA 4AY1A 4GBUA 3HPFA 3KCLA 1QI4A 2WJEA 1K7FA 3DYPA 3SQLA 4ZGYA 5HBFA 1HW6A 1ZP3A 1W1IE 4H2HA 1EB3A 1F4AA 4YYFA 3TW7A 4HTYA 3E0WA 3WD4A 5EFFA 4PMQA 3A9IA 4UXDA 3KVMA 4N2YA 3VGEA 3VVGA 3BTNA 3W2NA 3G77A 4JNMA 4CGTA 1RXOB 4R5EA 3A13A 4IP5A 4N9EA 4FOJA 4AD5A 1OC5A 1OD8A 3BMXA 3MUY1 2PRMA 3W22A 1RBAA 3TFCA 4HN8A 2AL1A 3WF1A 5CBBA 1R3YA 2D2HA 1OB0A 3ARUA 1SM9A 2ZUTA 5HQMA 3NQ8A 1RPXA 4V33A 3DG7A 3GNDA 4UTFA 1U22A 1L2QA 4Q4MA 3V18A 5H91A 3G1DA 1HIZA 4RCXA 4I3GA 1F9CA 2XN0A 1I75A 1V6UA 1XDJA 3T09A 2OG9A 4DM2A 4KIRA 3W76A 1K6WA 4UCGA 3GE7A 2CLLA 1ZZMA 4J3WA 2UY2A 1KBKA 1PKYA 4PZVA 3ZVIA 3W26A 3OIXA 4EPEC 2WMGA 3B8VA 2WMKA 2IPFA 1FWFC 3LERA 1TV4A 5FAJA 5LKYA 2WVSA 5AC7A 3MKVA 1ONXA 4I7WA 4B9ZA 4IWWA 1CXKA 3FW6A 1X38A 4BCEA 5DY3A 1NWUA 1F4HA 3NVDA 1UZ1A 4XTIA 1VFHA 2HPIA 3ENLA 2FZMA 1TTQA 2YBUA 4ACYA 3L7RA 4A22A 3THAA 1T5AA 4FNTA 4GX8A 4Y6GA 1DQUA 1LQAA 4KPLA 1JPKA 5TF0A 3GKAA 3LI1A 4UTIA 1H49A 2NV2A 3WDQA 4M1RA 4S3AA 3P80A 2DV0A 2NXHA 4FEZA 2PGEA 1HXJA 3GNXA 3PANA 1JVNA 3CZGA 5A8MA 2V8ZA 3AO0A 1PBGA 1BGAA 2ACQA 3KOFA 4FZIA 4MWAD 2KAUC 1X98A 1TVLA 1UASA 1WV2A 3LV5A 3A4AA 3G1HA 3AAMA 3GQYA 4NZCA 3WLHA 1KB3A 4TTUA 4R9XA 1EP1A 2V38A 3MPGA 1R5YA 2XVPA 3DBPA 3PSVA 4QE1A 4HNVA 4RPPA 4JTGA 2UWFA 2Z29A 5HK4A 1DJHA 1Q4WA 1ZPTA 1EGZA 1UJQA 2D2GA 4P5UA 1IIGA 2V5BA 2ZZ1A 4C6NA 2RGMA 4BJHA 3WDIA 4JN6A 3SY5A 1OC6A 5G4WA 5C55A 4GNKB 4L1WA 1Q13A 1BQGA 2C71A 4DBEA 1XBYA 4LNYA 3GRIA 3OVPA 1F3WA 5DO8A 2X1UA 3DG3A 3GXMA 5AHNA 1VF8A 3S5ZA 1B2YA 1E0TA 5HMDA 4C5YA 1OFRA 2R14A 2EO7A 4FNSA 4IL2A 4WLCA 3DFNA 4R7JA 4QR6A 2X1IA 2Q8LA 5F7UA 3WD0A 3NDZA 3UG4A 4J1OA 4AF0A 1N8FA 4I8DA 1W1A1 3WLMA 1KTBA 3CZKA 3DI1A 1QWGA 3KM8A 1PCWA 4H8UA 4LF1A 3A12A 1IXQA 1W5QA 5DXYA 5IHRA 4FXFA 5DF0A 4E5TA 3WNPA 2BXYA 3W1XA 2YXOA 3EB2A 1AUSL 1T0OA 4POCA 5LYRA 5I77A 3SRFA 2CLFA 3EKGA 1MW3A 3I6TA 2GDVA 2Z1VA 4GCAA 4ZVJA 2QT3A 3STGA 4MTVA 4M6QA 4AYGA 1V79A 1C9WA 4HZ8A 4EXAA 2VL4A 2A2IA 4LBRA 2A1YA 3ZT5A 3STFA 1R38A 1TQXA 1AL8A 4IMAA 1C8XA 3FDGA 1U5JA 1GEQA 3T0DA 3W00A 3N25A 3VIGA 4PUWA 3EMCA 3WBWA 3M0ZA 3AWOA 1VFSA 3QQ0A 1X1ZA 1QDSA 1W3HA 3KWXA 3KW3A 3ZJKA 4HU0A 1OG0A 3WLQA 4DZIA 1RLDA 1YBQA 2ANUA 3GTXA 3NYDA 1OINA 4FK9A 1RVKA 3H7VA 4AIOA 3SY1A 5DEZA 3OBEA 2C6QA 3PBMA 3A3HA 4NYUA 3W9ZA 4Z1DA 1SSGA 2IMRA 1S46A 4GQGA 1T40A 1AQFA 2XPKA 2XFYA 1QMLA 4A3HA 5JQ9A 3NCOA 1OGSA 1Q6DA 3IGUA 1SSDA 4F4RA 2VC7A 4B5NA 4DO4A 3GC4A 1V0LA 4N42A 4I5RA 1I2NA 1DIKA 1UMLA 3GR8A 4DAFA 4WOZA 1F76A 1MW1A 3EOOA 3PZVA 4ZOBA 1QPOA 5LGXA 3TMQA 3MI3A 5CLTA 2WMIB 4AMAA 3POCA 1HO1A 1UH3A 3QMRA 3QR1A 3APYA 3MBFA 4DJDC 1YE6A 2AQOA 1KTCA 1YEYA 1FHDA 4XZMX 1LL6A 4CD6A 2VVNA 4JFVA 4LSBA 4EAMA 3N4EA 4PULA 2DU2A 1A5BA 3LPGA 4RPQA 3IRDA 3AFBA 4OBRA 1XPGA 2YPIA 4GUIA 3MY9A 1TZ7A 5G1MA 3TV8A 4XKYA 4CD8A 1CNVA 2EPLX 4HNLA 5CG0A 2R1LA 1EIBA 4DZ5A 4HA0A 4HQVA 4PODA 4AZ5A 1SZGA 5B7YA 3IANA 4DWSD 2WJFA 3TQPA 5E70A 4QXIA 2UY3A 3KBMA 4F0LA 2G50A 3QQ1A 4F2UA 2E25A 3IIPA 1GYLA 3CH9A 3DHUA 3SURA 2C14A 5JBEA 1QATA 4WKFA 3CUXA 3VA8A 3EDDA 2CHNA 3KDNA 5EMLA 3WN6A 1Z3NA 4GZIA 5MKGA 9RUBA 1E9ZB 4W85A 4H01A 1IF2A 1JQVA 3VFCA 1KM0A 1DHKA 4EKJA 1NH6A 4X3ZA 4K38A 2X30A 2FKPA 4L4LA 3H4WA 4UQAA 3QKEA 2D3NA 3PZMA 2CESA 1F3EA 3MKCA 2FMOA 2EPMX 2A7RA 1JUEA 3AYVA 8XIMA 3WLIA 3CAWA 2ZXAA 3P8JA 4P7OA 2J7GA 4D6IA 4JTIA 1V5XA 2YDRA 2VZOA 3AROA 1I2OA 3OW1A 4JYFA 1CGTA 4IUGA 3SDOA 4F0KA 1HG3A 1W9VA 1W3IA 5A6KA 1IE7C 1J0ZA 3PBVA 2W27A 1BYAA 4A29A 4UQCA 3L5LA 4IFOA 1B3VA 1KV8A 2PDHA 4WQ6A 1W8GA 3ABXA 3C0JA 3ABZA 4IUOA 1SU5A 4F9DA 3IJLA 2WANA 4V28A 4FLRA 2QAPA 1R2TA 4F8XA 4UZSA 3L65A 1YXYA 3CLMA 3CMFA 3AHXA 2JGYA 3W23A 2A3HA 1BRLA 3MU7A 5EBUA 1XF0A 5FACA 1GOQA 4RUBA 1QNVA 4B16A 2GK1A 5DANA 2JIEA 5AB3A 4W8BA 1TB3A 1RK5A 2C1GA 1VBRA 1S1RA 3VTRA 3I6EA 2NUYA 3AISA 3ARYA 3HOJA 2J6XA 1VLIA 2FZ8A 3G3MA 1EGMA 3PB2A 2HXTA 3SW6A 3TIMA 4ZQPA 5KZDA 4R7WA 1SYTA 1V03A 4QCFA 1A49A 3T8QA 3N3MA 1RAKA 4DN1A 4IOTA 3PBUA 1EC7A 1F61A 1H62A 4C60A 3QM3A 1AZ1A 2YLLA 1JZ6A 4UTTA 4LNCA 4AWUA 4AG0A 4P2VA 3NPUA 3S9IA 5U7SA 2D73A 4AIBA 2KZHA 4AZIA 2XFRA 1Y5VA 2C79A 5EA9A 1ZSXA 3HQNA 2VGIA 5H1WA 5I23A 4HU8A 4RE0A 1UG6A 3T9PA 4PCSA 1HJQA 3EMQA 1LF1A 5FJRA 5CC7A 4RE2A 3CUFA 4GUHA 3SRDA 2P0IA 3KTXA 2XN2A 1QW8A 1E9LA 1D2KA 2ZICA 3DFYA 4K2SA 4MF4A 2V5CA 4JN7A 2D69A 4LUYA 2PWUA 2JALA 3C2FA 3CPUA 3N2TA 3WO8A 3RM9A 3I7SA 4HKPA 1XXXA 4Y9PA 1EF3A 3OHMB 1YDOA 5F2LA 2YL8A 3L23A 4DWDA 4FF5A 1ISVA 2CHRA 4JBRA 4XUYA 3D0CA 3AS0A 2F6UA 5GNZA 4QDWA 4Z2KA 6TIMA 4YTUA 1Q7ZA 4WD0A 2OSYA 5TIMA 2Y85A 1A5AA 3G5EA 1LUCB 4NAEA 5CAHA 4LAKA 1Q6RA 3UPBA 2J6VA 3WF2A 3M6YA 4HPGA 3PR2A 4U3CA 1OM0A 1K9EA 2P3ZA 1HJXA 2YDSA 1OEPA 4PC8A 1M53A 2XVKA 5HQEA 1E9IA 4IIHA 4PEKA 3D3FA 5HJLA 2YZRA 3GVVA 4O1DA 5CJMA 4AX6A 4U3AA 3GVWA 3H6OA 4U10A 3AUOA 2YXXA 3MSYA 4L4MA 1FBAA 2F6XA 3FOKA 3GUGA 3U2OA 4M8UA 3VNMA 1HFBA 7ENLA 3G24A 2XH0A 1L6YA 2QLYA 5E6YA 4GKLA 3EDKA 3KBVA 2EG8A 3LGDA 1A5SA 1H51A 1V6TA 2J7FA 3NQ7A 1X1OA 3QZEA 3DG6A 1V3MA 2XFFA 3NQAA 3W2MA 4NI8A 1W9PA 1PX3A 3OHIA 1BHGA 4S3CA 3AMLA 4NI3A 2YYUA 2DZWA 4XZNX 1DJNA 3HU7A 4I9MA 4DAIA 3L2MA 4BQ5A 4AMCA 1LM1A 4WKHA 3BMWA 1SW3A 3SSJA 4NT0A 3QV9A 2GVYA 4H19A 4LCRA 4B2DA 1JPMA 2QGHA 3WK1A 4LVBA 1WXZA 2DSVA 2P8BA 1TA3B 1NWTA 4PMDA 4PMRA 1HZYA 2H90A 4XVEA 1YHTA 4O12A 1W5OA 1V02A 4IFKB 4M24A 2DT0A 1LBLA 1ZUAX 1F7BA 4R9OA 1ZFJA 5E5CA 3VX1A 4TTGA 1ISWA 2BHZA 2OTDA 2IW0A 2YCLB 3AS3A 1U1UA 4G9PA 4FALA 4AIUA 3CPRA 1XLHA 1B9ZA 1EGVA 1E4MM 3BLPX 4RR4A 4DJFA 3R12A 1WBJA 3VI2A 2D24A 1UB3A 1GW9A 1CLKA 3WLSA 2PDUA 4DBWA 5ABEA 1ZCCA 5D32A 1P48A 1NU5A 3TEVA 4LTSA 2XUCA 4JX4A 3UZJA 1YMYA 3EWCA 1EEPA 3ZOAA 3MI6A 1TWSA 4GIAA 1ZLPA 4LS2A 4O28A 3S1UA 3R6IA 1HKIA 4FLQA 4KEZA 3PUEA 1DBTA 3TAKA 4RKAA 3PM6A 4I5XA 3IIOA 4HPHA 2RJGA 3LCGA 3S47A 4OKDA 3BJSA 1G4TA 5TAOA 3IGHX 3T2PA 3W37A 1E15A 4LT9A 1SO5A 4CQDA 1YE4A 4DBSA 3SCUA 1H60A 2J25A 3GK0A 2GVEA 1VBUA 2B7PA 2YBVA 2XIIA 2Z1BA 3KBSA 1I0BA 1Q5MA 3BCJA 4DQWA 3AALA 3EXSA 3GFXA 2QCFA 1YX1A 4JY8A 5JH2A 3GZAA 1JD9A 4Q8MA 4BWLA 4GYPC 4Q8QA 5BOOA 3NL3A 1E71M 4KEMA 1JR1A 3SCTA 5J8LA 3K1GA 4UNLA 3EKZA 3UR7A 3NPVA 5LHFA 2FB3A 3E38A 2HPMA 2PDPA 4KCWA 2PDWA 2Y24A 1I9CB 4DYJA 3WF3A 1VJIA 2J9YA 4IFRA 4QRNA 2G3FA 3NO3A 3SN1A 3QVQA 3PBGA 3RK8A 4N9CA 1TV2A 4DUOA 4NASA 1VFMA 1HVQA 4OECA 4K68A 3G1YA 5D37A 2WVVA 4CQBA 1QUMA 1QPQA 1YW1A 3CGTA 3MKKA 4JIPA 4AISA 5M1TA 1X97A 3WQWA 3QR0A 3QEZA 3TTOA 4KERA 3E9AA 5RUBA 2FZ9A 1K9DA 5D4YA 3VD3A 4DEFA 2DGAA 5HATA 1YQ2A 4ATWA 1Z89A 1HX0A 2VCAA 2VMFA 3OBKA 1DOSA 1CB2A 2FFIA 1XBZA 1HUVA 1WZLA 2NX3A 3VZYA 3NSXA 3CWNA 2GSJA 3UPMA 3OLGA 4C65A 3WQVA 4D6GA 5ABTA 5C6MA 4JPGA 1LROA 1H1NA 1VEOA 2Z2BA 1RP9A 4PA8A 1OFBA 1YTKA 4MJ4A 1W1TA 2Z7KA 4J3TA 4ROPA 1W31A 5JBFA 3MZNA 1NELA 3HGJA 4PCNA 3WH7A 1JXJA 2PP0A 1B3ZA 1Q65A 4XVDA 4IPJA 1O5XA 3SGGA 4C6OA 2BY3A 2DJXA 4W7UA 3GFYA 1XDLA 1E6XM 3HJZA 4H3DA 1TCMA 4H83A 4U2ZA 3TTEA 3F7JA 3NQGA 4ALDA 2W91A 3HO8A 3QTPA 1DIEA 3CUGA 3TH6A 3W6YA 2ZKMX 1XD1A 4TVDA 2GWNA 3TQKA 4BI6A 1TPDA 3T6CA 3TA6A 3F4DA 3N4FA 2CXGA 4PFMA 4YWIA 1UJPA 3SAZA 4MZ8A 4YL2A 3LLXA 1XW8A 4IQDA 3VGDA 2PUZA 1E70M 4GFSA 3URNA 3MZ2A 1IGSA 4UMAA 4DXXA 1TJ1A 1TKKA 2WNQA 1PWLA 2E40A 1W54A 3R10A 5FL0A 1HJUA 3VNDA 1TJ2A 4J2MA 3UGVA 3PZTA 2V3DA 1X7IA 1IWAA 3ALFA 3ZVHA 2DUXA 5D02A 3OG2A 2VGGA 4W9TA 4ZQOA 5BNKA 4MWAC 4KWWA 4BKNA 3QV7A 2HE5A 4MSSA 4O0QA 4LYQA 5ABFB 4BF9A 3M0XA 4WSHA 4O10A 3LA4A 3GS6A 2ZUMA 3TJIA 4MYXA 4FNPA 1P43A 3WF4A 2D0HA 4H41A 1SJDA 3OYZA 3KBWA 5CKSA 4IJRA 4PGLA 4AHPA 1GGOA 4E2OA 2BZNA 4HYWA 3DN5A 1AQMA 4KRUA 4FLOA 2YDAA 1LQ2A 3LI0A 3M7WA 2HQAA 4P7NA 2DZBA 3ZR5A 3NURA 3NGFA 1OIMA 2ZRVA 1FWIC 4A2SA 3FYPA 1O68A 4ILSA 1FWGC 4YHEA 2NVDA 4IT1A 3CLWA 3O0KA 1XUZA 1UH4A 3KRZA 2CYGA 1M68A 2D3LA 2F38A 3E0LA 3TROA 1VEPA 3C2RA 4MY1A 3RILA 3LCFA 3QTGA 2R1PA 2EG6A 2FZDA 1H5VA 6REQB 2BVTA 3K30A 4UTWC 3FJLA 2NWSA 2IPJA 1O66A 3STEA 5I3KA 3TU9A 4AVFA 4CD4A 3W7PA 1O4UA 2GVLA 2HNEA 1GYMA 3IJQA 1W2PA 3WUFA 2WSPA 5IM51 2PU0A 2Y62A 1ICQA 3LMZA 1KGXA 4UTHA 3HJEA 2DVXA 2NUWA 1DWGM 5A8GA 5D2TA 1EBHA 2TAAA 1HO4A 5FJJA 4G8TA 3KX6A 1BF6A 4S3FA 1SJBA 4IPNB 5DFAA 3SI9A 1FWRA 1TPEA 3PZUA 1FWNA 2X1SA 3H21A 4J7RA 4ADUA 5BOEA 2P8CA 2JBMA 4LUJA 2CLKA 1NY1A 3HFTA 2VGFA 4H6KA 1E73M 3ME3A 4Z0JA 1ITXA 2CLIA 2V2DA 3N2XA 2PWGA 2VURA 2HISA 5D2YA 2ONEA 4HA4A 1V0NA 3W38A 1XICA 4FXSA 4IJCA 4FP1A 1JXKA 3HPSA 4MB1A 3UJEA 3M46A 1X6LA 4TUFA 3RO8A 3ITCA 1XCXA 5I5RA 2YCJA 3I3EA 1DWAM 2WZHA 4S2BA 4AAJA 3QSTA 1J2WA 4CEXC 3PY2A 5C9WA 1XP3A 2BG5A 3CYJA 4QNWA 3BUVA 4DNHA 4NSBA 4IG2B 1I0DA 1DORA 3BAKA 3U2ZA 5I3JA 1OY0A 1V8EA 1S38A 1GQLA 5D04C 3PVFA 4PRRA 4Q8TA 1UWRA 1OX5A 2ZQ0A 1EH9A 3SGUA 4ZCWA 3VIPA 4NX0A 3VFLA 1CBGA 3VCRA 3UA4A 1A5MC 2PC4A 2PDMA 3GNRA 4JNZA 4ZFMA 4C6BA 2XIOA 5KINA 1HL8A 3AQUA 3QGKC 1S2TA 5FCZA 3YPIA 3CUZA 5EL1A 5BW6A 1PDYA 3T0BA 2HJPA 3HGRA 4QS6A 5XIMA 3MUIA 1TPB1 4IICA 5HA7A 3RF9A 2I56A 3SUWA 4Z0SA 1PZ3A 1O1HA 3ITVA 4B90A 3CUJA 1TTJA 4GUJA 2WSKA 1PKLA 3QMTA 2QCDB 1LLZA 1SZEA 4DWSC 1QO2A 2OELA 3C4UA 2I9EA 1IHIA 2BGNE 2OLAA 2GJXA 4KEVA 4HD5A 3SN0A 4RXGA 1D3GA 4PUNA 1ZRQA 1RP8A 1R86A 1XC4A 4W8AA 3IV8A 3CZEA 2VUNA 3TWBA 3BQ5A 1MXSA 1IWPA 1XUUA 4UFIA 3LNPA 2IKHA 3F5JA 3AHZA 4K1WA 2EKGA 3WSUA 2Y8VA 4IM4A 3T44A 3NUKA 1F8MA 4H1ZA 1J2BA 1K6AA 2XU2A 1FWTA 2W3ZA 1NWRA 4JTDA 1TR1A 3V75A 3UWEA 3LB0A 4M81A 2WQDA 3LRKA 2L5HA 1FDJA 4HNOA 2QGYA 4OGZA 2VC5A 1BYDA 5BRBA 2DPEA 2PP3A 4WGHA 5CPMA 4R27A 4UZUA 4AWSA 1Z41A 3O6CA 3ZLFA 3LOTA 1CGUA 3U2CA 3COTA 2PDLA 3WLLA 1SFTA 5LZLA 1WDRA 2J7DA 2VVSA 2YCIX 4TX6A 1HTIA 2CLOA 1G1YA 3IARA 4Z1AA 2X7WA 3IJ9A 5K9CA 4HNUA 3UR8A 3ZJ7A 3DECA 1IXOA 3AZTA 4J3SA 2VR5A 1EKOA 1RCXB 2FH8A 1GJUA 4AVNA 4CNNA 3S2MA 2D20A 4D8LA 1XCFA 3W7IA 3H4GA 3L66A 4IIFA 3EOSA 3AC0A 3L4XA 3BMVA 1ENUA 3UWQA 4GJJA 1NFPA 3ARSA 4CN4A 1OT2A 3GVGA 3WH5A 4JTQA 4KEUA 4GA8A 1LOSA 1TR9A 4ATLA 4MDPA 1EJSC 4D1JA 3BAXA 3GYCA 1UD4A 2Y70A 3WBXA 4AZBA 5DQPA 4BK9A 3UY7A 3CXOA 3ERPA 5EB8A 3KP0A 1C9DA 5BYWA 1PJ9A 1S2CA 4N6EA 4Z2LA 5LXEA 5D09A 3I10A 4UMCA 4WGXA 3WELA 1PEZA 3RG6A 2ZIDA 4W87A 5G2WA 1BG9A 1FWWA 3IUDA 1FVPA 4X60A 1NM9A 3CZ8A 4QAIA 3TMLA 4XD6A 3TR9A 5I0DA 2NV9A 4O0KA 2J7EA 4FIQA 2QJJA 2G97A 1TE1A 4P7QA 1JGMA 5C54A 2R1NA 2CZFA 5FJOA 1E40A 4G2DA 1GKRA 2C16A 3U7VA 2O56A 1MSSA 3C3UA 3LRMA 3P82A 5JH1A 3PB0A 3CUIA 2PSNA 2O7QA 2DZVA 3VNJA 3VAVA 1I60A 1LTDA 2WV8A 1GUVA 1MUCA 2A79A 3TONA 5LNRA 1BEUA 4H8VA 4S1FA 3B9AA 1WUEA 2IQ0A 4YS1A 3L9CA 4AWTA 1ODUA 1IR1A 1K7EA 5CGQA 3ZWSA 1J0JA 1FY6A 4A8LA 4DY1A 2W63A 2HRWA 3A4XA 4RDVA 3UCDA 4QJ3B 1NOWA 3K8KA 2BX7A 1WP6A 2QIIA 1KQZA 2F8QA 4YPJA 3DYOA 2BY0A 2OQHA 4KCTA 3GG8A 4LCSA 3C8FA 3UVAA 2VZUA 4RX0A 2CXEA 4GIEA 2PODA 1R3TA 1VJSA 2G3NA 4EXBA 4LRTA 1YKWA 3CV1A 4AHOA 1G0CA 4HHPA 1QNRA 1SW7A 4GHRA 4RV3A 4FPSA 3MTWA 3GH4A 2E1DA 1CGVA 4PMZA 2EGZA 5E0KA 3QR3A 4JTRA 1D7KA 1US0A 5CSUA 2JK2A 3L4ZA 2RFGA 4O57A 3R94A 5FF0A 3UP8A 2PRLA 2G5WA 5CC6A 2REQA 3ABSA 1TO3A 2OQLA 1JDCA 1LRNA 4E2VA 2D0GA 3HQ1A 1OCQA 3NSMA 3P84A 1ME7A 1DQXA 1V3LA 3O3RA 3PZ9A 5AFDA 2VEPA 1HJVA 4FX8A 1F2JA 4S3EA 3PNZA 3IS4A 1FH8A 1A3XA 3NSNA 3Q94A 2WM1A 5BWFA 5FF2A 2H8XA 1IR2A 1BAGA 3W75A 1A80A 3KP1A 3LSBA 1VS1A 4UR7A 1H1ZA 3W6LA 4AF0B 1RH9A 2WVTA 5FJTA 1JF6A 2WKLA 3FK4A 5HNUA 1WKDA 1TPWA 4TOQA 4E0CA 1WQ5A 3JU2A 3N11A 2ACRA 3T0CA 3HG4A 4IIDA 4E8GA 2Y61A 1V3KA 2ZWZA 1V0KA 1XFBA 2ZUNA 3T05A 1IGWA 4M6VA 4DF0A 1QHOA 4JYEA 1EZWA 3HM7A 1K8YA 7REQA 2YL9A 3TC3A 2HS8A 4NG3A 4N7QA 4KFNA 5A6TC 2CLEA 3KHDA 2Z1SA 2DQXA 4QG9A 1FKWA 4GABA 2W9MA 2VWSA 4PL2A 2CKRA 1R0MA 3I4EA 3PUOA 4LV4A 3URBA 3NZPA 4OTKA 3AICA 3UNTA 1OT1A 1GNXA 3EWUA 2ODOA 4J9JA 4K8GA 1DV7A 4BA0A 3LXBA 1AJ0A 4N6FA 3UD6A 1KRBC 3BO9A 3I65A 3PTMA 1W9BM 1VB9A 3W70A 2E7FA 1H7PA 3WH6A 1XI3A 1IQ8A 2RDUA 4ZEPA 1ZAHA 3V1PA 2NT0A 2RAGA 3IV3A 4TQTA 4WRHA 3WNOA 4O4VA 3MS8A 3MHGA 3ITYA 1YBQB 1ALDA 1BFNA 1TPC1 3A22A 1TPFA 1UZDA 1R3VA 1S2AA 4F0SA 1VBGA 4GY7A 3ZR4A 3SFKA 1AG1O 1GOKA 4K3ZA 4PL1A 1IEXA 2A3LA 5C7HA 1G01A 4EX4A 3QJAA 3EX1A 3LCXA 3SUSA 4AY7A 2ZX5A 1JCXA 2YL6A 1VCGA 1PYFA 3C3NA 4LY4A 3UEQA 1A3WA 1JZ5A 1FDZA 5CZSA 3UCCA 3NZ1A 3OA3A 5SWUA 3GHUA 3ZQ9A 3B8UA 2O4MA 2QMKA 1YPXA 1B54A 2HWGA 4J2PA 2YR1A 5K4ZA 3Q67A 3W1LA 1A5LC 2VC9A 3HG2A 4ZO7A 3HQOA 2FDSA 1Q8AA 2P1FA 3TFXA 1W37A 1K8CA 1PTDA 5FIPA 1PS9A 3MP4A 5GVJA 1ADSA 1XLLA 2WZIA 1ONWA 3CAVA 5DLCA 1QPNA 1LG1A 2VCBA 1UR1A 1L6SA 3AIWA 1J01A 3JVAA 3CV7A 3I68A 1QHPA 1EZ2A 1TPUA 3WF0A 3D47A 1VAHA 3AIEA 4XUGA 4XKYB 2Z26A 4MNMA 1JNDA 3R7MA 3VNIA 3VZXA 2WVUA 2VDIA 4CD5A 1XWYA 4QDMA 2FVMA 1B57A 1J96A 3QYQA 3JRKA 2CBIA 3NZQA 1QJWA 3BPWA 3IGSA 3R4IA 4MUZA 4LRSA 5EPDA 3HTWA 2QDHA 2YZ5A 2Q09A 5MKGB 4J3ZA 5AKQA 4GH1A 5AHLA 1W91A 4DNMA 1E0VA 4LC8A 2QPSA 5LA2A 2QR6A 3H70A 3TVAA 3N6HA 2Z1KA 2WAGA 1GTEA 3N2BA 5A8PA 1KBLA 1E1CB 2A85A 2OOGA 1S5NA 4XB3A 4WIWA 4S39A 2E77A 5BOFA 3ATYA 3UG5A 4ZODA 4HPNA 4D6HA 1XIGA 4QCEA 5HMEA 1GQNA 2VNCA 3WX7A 2Q8ZA 1VBJA 2WK2A 4XIAA 2Z28A 1TTIA 3DKLA 3W74A 3I3DA 3M0IA 3OP2A 4W93A 1FWCC 4Q4QA 2WNWA 1FHLA 5A2BA 4OU1A 1XBXA 5J5RA 3BOXA 2D1ZA 3PSWA 3RR1A 2E1WA 1NDZA 2I7GA 2Y5JA 2ZUVA 1MRQA 3AXHA 1AMYA 1MEIA 1Q7MA 2VRQA 1BRLB 1R3SA 2OGJA 4C6DA 4QISA 4Q4PA 4WX2A 1ZY9A 1B5TA 3QPZA 1QR7A 1P7TA 4F0HA 1W1PA 2ZX8A 1WXJA 2GK1B 5C7VA 3R58A 1IZKA 3ANVA 1TJ0A 3B4YA 3GSMA 2NXIA 1T8XA 2QPXA 4IMDA 4H9YA 5A1AA 4CCZA 1DJYA 1HKVA 4UQBA 2GGIA 1BF2A 5BU9A 3S2LA 4PRTA 1JGIA 3WUEA 4NJGA 2HK0A 3NM1A 1VFOA 1P6WA 1L6WA 2H8ZA 1ZJHA 1DJZA 1BSIA 4F9JA 2Y0FA 3BZGA 4D9PA 4MNJA 5HPCA 3S6TA 1VIWA 2ZTKA 2WWDA 3AJ7A 2WJDA 3W28A 2DJLA 1WE5A 4ZB5A 2PZNA 3EWYA 3OG3A 5D8ZA 4ZZ9A 1VKFA 4J28A 2QEZA 2WXDM 4N9BA 4HMCA 4Q4RA 4V27A 2D2OA 4MY9A 3K8MA 4AX7A 1PSCA 3G0XA 1QAPA 4GINA 4FA3A 4PCTA 1FX6A 1WDQA 1J9YA 4ML9A 3GDLA 3KVLA 5F2MA 2PWEA 5CJ5A 3VILA 1T96A 1H0IA 3SFWA 1SFJA 1V3JA 8CGTA 3PAOA 3VXGA 4IGNA 1Z9AA 1XGDA 1TMHA 4H00A 5C71A 2VZVA 3UR2A 2RDTA 2ZUUA 3WYZA 3H8AA 1ICSA 3WG6A 1NJJA 3SM0A 4CNSA 2JE8A 3DOPA 4EPBC 4NAEB 5KMYA 3T78A 3UXAA 4ZOCA 2Z7GA 2V6AA 4AWEA 3V5CA 3QY8A 1E51A 3SO7A 1CGYA 1XQLA 1S5VA 1GPWA 2YYTA 3GG7A 1UD5A 3INPA 1DE5A 2OX1A 3WJZA 5FESA 4F40A 3GIPA 4RZ4A 4TIMA 3DIPA 1RY8A 3H2AA 3HG5A 5CXPA 4GYKA 3W2UA 2JEQA 3A5FA 2BGQA 1EX5A 5A8NA 2ZE0A 3MUAA 4JFUA 1KFEA 5E0CA 3FVMA 1YXCA 2DEPA 4MFEA 1DXFA 4MAVA 2BFGA 3KOYA 1ONRA 2J74A 4K1GA 1IEQA 4Y9NA 2I1OA 3M07A 1AD4A 5F2IA 4B3LA 1LG2A 4LU0A 3VC5A 5AYBA 2QCHA 1REQA 3QMSA 2ISDA 5FSDC 4UB9A 4C6EA 5C2GA 1OCNA 3VK5A 3WLJA 1FWSA 1WOAA 4JICA 1M7OA 3B3DA 4DUWA 2IKJA 1QNOA 4O4WA 3OODA 5ABHA 3EEZA 5DMMA 1X6NA 3LTYA 5I2UA 4U28A 1UROA 4TV6A 1RY0A 2ZC8A 5TD4A 1XBVA 1KWKA 3QPYA 2WMHA 4GVIA 3IUIA 4I5UA 4MJ2A 2AOSA 1M1BA 2YB1A 1BVNP 3FKRA 4Q4SA 5BXSA 4K39A 4O1BA 3E74A 1BXBA 3TLLA 2HROA 4F0RA 1GVQA 4B91A 1FWEC 1Z42A 4GIYA 1UR9A 2VEIA 3M1ZA 1KM2A 3KZPA 1WKYA 5AYYA 4IMFA 3KWSA 1GW1A 5ECVA 1PIGA 2CCRA 2X8RA 1W3NA 2OZTA 1FCVA 4M0XA 4LWWA 3UW6A 4LVFA 2GQ3A 1UC4A 1SR9A 3N04A 1W32A 2W61A 5EFDA 1CI1A 2INFA 2YL5A 1F6PA 2C1IA 3T08A 4XBKA 5BXTA 2YCEA 3A6OA 1T6MA 3NEHA 4HVXA 5T9CE 4IMCA 3E0IA 2GQ8A 1UZHA 3ARZA 4HSOA 4TR9A 1HL9A 1E5NA 5LNVA 1XLMA 1OIFA 4TV5A 2IPGA 1HT6A 3TQVA 2FH6A 2OFJA 1AL7A 3QOKA 3W82A 1L6FA 1MDLA 1AW2A 1M04A 3RO6A 1DP0A 1OWQA 2YGYA 5CSSA 3VDGA 2XH4A 3LGGA 1UPPA 3GNOA 3P0XA 2HVOA 2V5DA 3UWYA 3DEQA 3F4CA 3T07A 1RSCA 3A47A 3QLLA 4C6LA 4W7VA 4PUDA 3G6LA 2OR2A 1K3UA 1DIDA 4FOKA 1PXGA 1WXYA 2NWRA 3BCDA 6A3HA 1YLVA 3BL3A 1P0EA 4R53A 4ZO9A 4IXHA 2WKJA 4NZ4A 3N2MA 2BDQA 1RA0A 3NGJA 1KV5A 1ADOA 1UOKA 3PHAA 3S2NA 2J4GA 1GHSA 1YDNA 4ZQMA 4WVXA 3URQA 2WVVB 4GISA 3MDWA 4DWSA 3NL5A 3HV8A 2QZRA 1WA3A 3M44A 4YCOA 1F5ZA 2XH7A 3LV6A 4C6KA 2DIEA 1R9ZA 3R89A 3TQ0A 3AZRA 3L5AA 2Y7EA 4XAFA 1NP0A 3URAA 5E6ZA 5M2FX 3P61A 3A3XA 4JTJA 4ICCX 4JQAA 2Q3OA 3WNMA 4MB4A 4NZ5A 2OWCA 1F3TA 3LZ3A 4MZ1A 1SVDA 3VO0A 2A7PA 5CC3A 2BXVA 4JTAA 1R87A 5DCBA 3C0SA 4OWGA 4CEUC 3ZZ1A 1DWFM 1EOKA 3S46A 2DZUA 5HMFA 3OLEA 2QUMA 4CCEA 3AYTA 6REQA 2CBJA 4OFCA 1EBGA 3A3WA 4PCFA 3NDYA 3GTFA 5HNRA 3O06A 1XG4A 1EPXA 4EPDC 1Q6LA 3W25A 1DEDA 4RNJA 2I17A 4LALA 1VBHA 4O1FA 4ZTYA 2QIWA 2WHJA 3PUGA 2C7FA 4U31A 2ALDA 1IT8A 3U5YA 4IL0A 5CAKA 3NQBA 3SCWA 3SADA 3CHEA 1EJXC 4XAGA 5DCDA 1NVMA 4DO6A 4GNJA 1EP2A 2Y63A 3GY1A 3WQFA 1ITQA 3HFYA 1CX9A 4H7CA 1IEVA 3FGCA 3DYMA 5CPSA 3WZ0E 4AZ6A 3CEPA 5D03A 4XBSA 1E1FA 4LYPA 3VNLA 2I9UA 3DFOA 3F4WA 2F2HA 2CPUA 3ARQA 1IXNA 1NAL1 1D3HA 4B5WA 3B0UX 1OF6A 2ZBTA 4WK9A 4V1YA 3TLQA 2EXOA 5AC8A 2ZZ5A 1R8LA 2E0PA 3LN3A 3ZVHB 1CXLA 3V36A 2J88A 1SZNA 4QG8A 1O5RA 1XIJA 4JEJA 2QQ6A 4JQ3A 2IXVA 5KITA 4QP0A 3KVJA 3RAOA 4JTFA 3L4UA 1JYXA 4NX5A 3L5MA 4PMJA 4L9YA 5C9XA 4XV0A 1B4EA 1N2VA 1MNZA 4Z1CA 1L2UA 1QT1A 2FTPA 2WW5A 3ORWA 2WBGA 3VE7A 1UW9A 1BLIA 4YXGA 2BY2A 4EIVA 4LV9A 4NJJA 4CKQA 3BLEA 3TN4A 3GVRA 2WHLA 1UWQA 3CZJA 4X2PA 2XZ9A 3B0VC 1DIOA 5DBTA 3GDRA 3LCWA 4U5IA 2Y2WA 1NEYA 1H7OA 1J6OA 3W7KA 4LUIA 1XIMA 4RDZA 2WPGA 1MVYA 1JD7A 5GNYA 3UNDA 4XBJA 4UTLA 3VNYA 8TIMA 3I6RA 2WB5A 1GZ1A 3WUBA 1JDDA 3LXCA 1XL9A 3W83A 2OWWA 3EDJA 1HNYA 4Y7EA 5I78A 3LTPA 2ISWA 3W7CA 3O1NA 4HIBA 3H2NA 2EF9A 5LIKX 6TAAA 1PTAA 1GVSA 1VLWA 2FPTA 3VOIA 3MSDA 2R9RA 3NXLA 4XZ9A 3KVKA 2QS8A 1TRIA 1G6CA 2EPKX 3W1QA 1Q6FA 3FXGA 4CUCA 4ATDA 2AL2B 2C8NA 3WMCA 1WPCA 2BVYA 4Q8UA 2WZMA 5BCAA 4LAOA 4Y90A 4AD2A 2VWTA 2C0AA 3MMTA 2RJHA 1UUMA 4CCCA 2WNZA 3PBWA 3VOFA 3BH4A 3U6WA 4FMVA 4WJEA 4QITA 4Y96A 3GAYA 3UWZA 4KFPA 2XGZA 2EAWA 1UMYA 4A8IA 1QPRA 1GVFA 3LPPA 2ZX6A 4INFA 2B0MA 4JTHA 4KS0A 4CQAA 1PAMA 4DJFD 1ZU8A 4RXFA 1WB0A 3W7MA 2YFNA 2J47A 2G3IA 3MBDA 1OFOA 5M3WA 1MYRA 3MUCA 1GQJA 2FTWA 4DB7A 4X61A 2NQ9A 3HPXA 2V3FA 3D5HA 2E6YA 4RV8A 3R43A 2ZVRA 2PCEA 1XRTA 3K46A 3QQWA 1ITUA 4JEQA 4YTRA 1EJTC 4PTMA 3IIXA 4S38A 1AMKA 4DJEA 1XHGA 4BS0A 3ANYA 5E9XA 1Q7QA 4PTVA 3CHCA 4AEFA 1ODZA 2Q01A 3W7HA 3WUGA 4CNOA 3W1NA 1KFLA 4RE4A 3QW3A 2ZRYA 3SCOA 3HQPA 1F74A 2J75A 1H2JA 2OLHA 3AXIA 2MANA 1FP9A 2ZTJA 3MUZ1 1TZ9A 4K8EA 4BQ3A 2QV5A 3GH7A 1UD6A 3C2YA 3Q4DA 3TN6A 2EPHA 3FJ6A 3IJ6A 4PBGA 4X9SA 4JCMA 1FWAC 1GORA 3FAWA 3FX4A 2G0WA 3NR0A 3CASA 4V15A 1DJGA 3BAWA 2O9OA 5AVHA 1XGEA 1TIWA 3MCNA 4X0NA 2BASA 2VP8A 3WK2A 4GGBA 3EA2A 4B5XA 1KXHA 2QDGA 2DVUA 5CGMA 1E6NA 2D22A 3P5ZA 5HR6A 2FMNA 5H8PA 3GX9A 1XLEA 3M0JA 1UYQA 4ZO6A 4O54A 2Q71A 4LUSA 3B9EA 1UIPA 1U5VA 2GJXB 1QNSA 3PN8A 4A8NA 3AU2A 4M51A 2CLMA 3RCMA 2JKPA 1RA5A 4HT3A 1YTEA 1OSEA 2DIJA 3LMYA 2O9RA 3F5KA 1DWHM 3NQDA 2BLEA 3U4AA 1Q45A 5I7GA 3S9ZA 2FHBA 5TNVA 4DLFA 4GVFA 1YIXA 2A21A 1EYEA 2WQPA 3LSCA 3Q58A 4HNCA 2CZ5A 2B7OA 1HKWA 1I4NA 1ME8A 2R24A 1NTHA 3DHFA 3DGBA 3W01A 5HQLA 3EA3A 1T99A 5GNXA 3DU0A 3P3BA 4KKXA 3MCMA 1YXDA 3S1WA 5CPQA 3RPTA 3AS2A 2VOMA 1Q2RA 1GVEA 4AD1A 1VIZA 1LCOA 1KCXA 2DH3A 3BICA 3EWXA 3PS7A 3PJWA 1TX0A 3CHFA 3MHFA 3C52A 3TW6A 1P0NA 2ZZ7A 4FAMA 3WK0A 1KR0A 4IHCA 3N13A 4UOQA 2XYLA 3R13A 1MNSA 1TPVA 3FYYA 3IAQA 4KCUA 1BSLA 5JBDA 1DTUA 2PZ0A 3W29A 3O15A 3RN6A 3LUTA 3KDOA 4I7UA 3MSGA 3AU6A 3WQ4A 2A3AA 5C0QA 1R7AA 4HP5A 3DBNA 4US5A 4O1CA 2ZYFA 2A6LA 4ICMA 3DH7A 4TVUA 4YTTA 3CK5A 1H63A 1S2WA 2PBOA 3CQHA 5CPNA 2MUCA 3G0SA 2OQYA 4NQ1A 4ZOAA 2QDEA 3EXRA 5FJPA 4A6GA 4CNPA 2QW5A 3KOXA 3DHDA 3HIJA 3S0CA 2E5BA 4QG6A 3FA3A 3GFZA 1JAEA 2OYMA 1XYLA 2X40A 2V82A 4DLMA 3WMSA 3E5BA 3B8DA 1OX6A 1XPYA 1V6VA 2VT0A 3E49A 3EB4A 4LYKA 3ARRA 1F6YA 9XIMA 3T8LA 2B7NA 1FH9A 4Y9MA 4GZ7A 5KSWA 1EQCA 5HINA 3VUPA 3NWRA 3E1F1 5ECUA 2Y7DA 3WLRA 1Y5WA 2QJHA 1EC8A 3GU2A 3LY0A 3EAUA 2OMAA 4M5PA 4NHVA 4A05A 4RDYA 3LHTA 3M41A 3TCEA 1TG7A 3MYPA 1PTGA 3LENA 3WK3A 3ITOA 2V5JA 4QAWA 5HAOA 4QSHA 4JX5A 2OZ8A 4HYVA 4IIGA 3PZOA 3SRHA 2PD9A 3T1GA 1GEHA 1WCGA 3BGJA 4QLKA 4YNGA 2OB3A 1HP5A 3W02A 2OX4A 1MFUA 1E72M 3HMCA 3AMCA 1WZMA 3G2GA 1Q6EA 4ZSUA 4Z2HA 4NRSA 2CBVA 3ZT6A 3NQ2A 1K8ZA 4NXKA 4ENLA 4RL3A 3USBA 1JCTA 2YCKX 1PKMA 2HXUA 3VMOA 1VRDA 2VFFA 4E3TA 1ZGDA 4W5UA 4C6PA 3FLUA 3N6QA 3RYSA 3TAOA 1AODA 2DSWA 1AW5A 3LTSA 2BY1A 1E0UA 1XIFA 2X16A 4MPKA 3CNYA 3W72A 1JDEA 2I5GA 2ZUWA 1W9UA 1KRCC 4QBXA 4O19A 2CU0A 4I6KA 3LS9A 4MY8A 4KFOA 3M9YA 2WNNA 3ZJ6A 3GU9A 3ONBA 4UBPC 3M4HA 1TWWA 4PB3A 3QXBA 2QCGA 2GQ9A 3NNTA 5EKYA 1PVNA 1MWOA 1KFJA 4W8LA 4A35A 2GPTA 2HVNA 2XIMA 3L4VA 3REQA 2CIPA 2REQB 4IZGA 1H7NA 5FAGA 3GVQA 3TNBA 1CCWB 3WNNA 1XLKA 2YW3A 2XWEA 1S39A 4HGXA 3GC2A 1W6TA 4IGSA 2HS6A 1J0KA 5AVNA 3IGXA 4YJ5A 1V02E 4FB7A 3ZT7A 4O13A 2QCNA 3DFQA 1KFCA 3EA1A 5G5IA 4J35A 3W1PA 2VR2A 1QI0A 5DELA 1DHPA 3KS5A 3SECA 1YRRA 3K5XA 4JIEA 4HNTA 2IKIA 2CBUA 2Y8KA 1FFQA 3BE7A 2W5FA 4HMNA 3V0UA 1FCBA 3KL0A 3QY7A 4RDWA 4DBDA 3BGGA 5MHBA 3WQ6A 4PYSA 3WBYA 1UR8A 4BY3A 4RJEA 1P0BA 2GQAA 3PJXA 1XSIA 4R88A 2WSRA 4UOJA 4QFUA 1G4SA 4Q4OA 3C6CA 4OBSA 2BHUA 2GVJA 1Z6KA 1ZBWA 3QOMA 1TV5A 1S5WA 1X6UA 2BWGA 1AZ2A 3H54A 1J11A 3GD6A 4XIMA 1UA7A 3WLKX 2P76A 1XCWA 7REQB 1GK8A 2HBXA 4CNUA 3AXKA 1QBAA 3DGRA 1FWDC 5A8QA 3GKFA 1ZJAA 4GRSA 4CLMA 1PDZA 4HTBA 5HANA 3BOLA 3C86A 3WQDA 2RDXA 1ECQA 3PAJA 2NVCA 2PWDA 1GOWA 1L0PA 3MQTA 1TJPA 2BV9A 1UOZA 4RNIA 1R3QA 2Z0IA 2VQTA 3NFUA 2FFCA 2XISA 1EF2A 4RZ6A 4A21A 3GNPA 4H8NA 4MYAA 4PE8A 4PSPA 1OABA 1BQCA 4WUIA 1E1CA 1M6JA 3E0VA 1DXIA 2FDMA 3KFTA 2JFEX 1LP6A 2OO6A 3KOZA 3PPHA