4HGXA

Crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
268
Chain Sequence
MNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
molecule keywords Xylose isomerase domain containing protein
total genus 84
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4hgxA00
2I56A 3IUDA 1DIEA 1OADA 2QW5A 1XLAA 7XIMA 1A0DA 3NGFA 3AALA 3KBMA 3BDKA 1XLDA 1BXCA 4YTRA 3UU0A 3VNIA 1XLLA 5EMJA 5J8LA 4X60A 3CQKA 3OBEA 2QUMA 2GVEA 3TVAA 3UXIA 4A8RA 2X7VA 3VNLA 3LMZA 4GQBA 4DVOA 1A0EA 4W4QA 1XIIA 9XIAA 5FA5A 1XIDA 3CQIA 3CQHA 1XINA 3ITOA 3IUHA 3BWWA 4GJIA 4ZB5A 1DE5A 5AVHA 1MNZA 3BZGA 2QULA 3GNXA 3KCLA 4QE5A 1K77A 1XLBA 3M0MA 5H1WA 1DIDA 3QYSA 5XINA 1XICA 2Q02A 4QDWA 1O1HA 1XLGA 2X7WA 4A8LA 3IUIA 1S5NA 2G4JA 3VNJA 3ITVA 3DX5A 3ITTA 3KBWA 5EMKA 4GLEA 1XP3A 4PGLA 1QTWA 2GYIA 3AYVA 3CQJA 3C0QA 4EAYA 4YTTA 5XIAA 1XIJA 4HHMA 4YTSA 3UA4A 5H6HA 3ITXA 4QDPA 1I6NA 3KBNA 4HHLA 4XIMA 1XIHA 4ZB2A 1XIGA 4A8IA 4GJJA 6XIAA 1XLIA 2XINA 3KWSA 1XLMA 3QZAA 1XLCA 4XISA 4A8NA 2ZVRA 4QEEA 1S5MA 2NQHA 3P6LA 1GW9A 1XISA 2GLKA 1XYAA 1XLHA 4Q7IA 5C9ZA 1QUMA 2HCVA 1CLKA 3VNMA 3KTCA 4XSLA 3QXBA 4K3ZA 3N4AA 5EMMA 3XINA 1XIMA 2XIMA 3ITLA 4XKMA 2HK1A 1XIEA 9XIMA 3M0HA 5TNVA 3AYTA 4EACA 1XLEA 3QC0A 1QT1A 5B80A 2GUBA 4HNOA 3M0LA 4YTUA 3BZJA 5XIMA 4US6A 2J6VA 3VNKA 8XIMA 3KBVA 5B7YA 3TC3A 2I57A 4X61A 1XLJA 3WQOA 3KBJA 2NQ9A 4G56A 1XYCA 3CNYA 4K1GA 1I60A 4QE1A 3CWHA 1MUWA 4J4KA 4YTQA 5AVNA 3DBNA 6XIMA 3M0XA 5B7ZA 3BANA 4X63A 8XIAA 4OVXA 4XIAA 3P14A 1XYLA 4HGXA 4XSMA 3KCJA 1TZ9A 1YX1A 2HK0A 3C0SA 2OU4A 3U3HA 1XLKA 3M0YA 1A0CA 4KW2A 3JU2A 3ITYA 4LNCA 3VYLA 1XIFA 3KBSA 1DXIA 3M0VA 4PFHA 3AAMA 3C0LA 4E3VA 3XIMA 3U0HA 4QE4A 2G0WA 1XIBA 3KCOA 3UVAA 5EMLA 3UA3A 3L23A 2XISA 2ZDSA 4ZBCA 2NQJA 4QEHA 3FVMA 1DE6A 5I7GA 2QUNA 1D8WA 3XISA 4DUOA 1XLFA 1BXBA 1XYMA 4ZB0A 1XYBA
chains in the Genus database with same CATH superfamily
1HL8A 4DWSD 2YL5A 3U48A 5DEZA 3WLNA 1OGGA 3EEGA 4V1XA 3OHMB 1A0EA 3IGSA 9XIAA 5FA5A 2O9TA 2GJRA 3ITOA 4JTRA 2PCQA 3GXMA 5HUPA 1ISZA 5K2ZA 1W1A1 3M0JA 2GWNA 3MHGA 3OVPA 1AODA 5DANA 5DBTA 3W74A 4CLMA 5I09A 3ES8A 3MKVA 1E6PA 1VLWA 3W7OA 3EWCA 5C5YA 1XX1A 1FVPA 1JUKA 1HO4A 3QH2A 2VCBA 3TU9A 4LOCA 3CT7A 3LPPA 3NZGA 5J04A 4QITA 4JGDA 4DM1A 4FX8A 3ITLA 2OPJA 1SZNA 1VBHA 5GPRA 3P8JA 3MKCA 1UP0A 4F4RA 1QW8A 1XL9A 1W5NA 1W5PA 1UH4A 4GCAA 4JFVA 2VEPA 1TTQA 3N15A 2CZFA 3DG3A 1RCQA 1EUAA 2TSYA 3EX3A 4S3GA 4GXMA 3G1VA 1GKQA 3GG7A 1IZJA 5CPQA 1JCXA 2A3BA 1ECEA 3ID7A 4L7ZA 2VDHA 1UZHA 3DFSA 5EMUA 2ODOA 1MXDA 2EKGA 3H55A 3WNLA 4QJ3B 3R89A 3B0UX 1WO2A 1XRTA 1TTJA 3VE7A 3W1XA 2ZOXA 1H1NA 4PEKA 2UY2A 4WKAA 4ENLA 3B3DA 1JDEA 4K36A 4R5EA 3EWUA 1Q13A 1FCUA 3W7LA 2AQWA 1GW9A 2BV9A 1EA9C 2ZZ3A 4RE4A 4Z2HA 1X6UA 3A9BA 4DWSA 4UMBA 1H7WA 1GG1A 3PNUA 4MDOA 1YBQB 5ABEA 3N3TA 5DLCA 3DYMA 3I6RA 3CV1A 2WVSA 3SADA 3UZJA 4PCTA 5BZAA 4G2DA 1VAHA 3LTSA 1JCNA 2PGWA 4IXHA 3C0SA 3ABZA 2YXOA 4PUUA 1B3ZA 2V3GA 2C91A 4ERIA 4X3ZA 3SB0A 2REQB 3SIMA 1OYBA 3G24A 1H51A 3FVMA 3M43A 5DMYA 1Q6DA 5ABFA 5CJMA 4CD6A 5F2IA 4HHPA 5AYYA 3SCPA 2Q3OA 2BOFX 2V5LA 4N42A 1OCBA 4ZE5A 2Q09A 2GVEA 1PDZA 3UXIA 1KA9F 3KM8A 1JQXA 3VOIA 1R9XA 1SJDA 1NP0A 1GEHA 3L66A 4LYQA 3VC5A 3LI1A 4YNGA 1E43A 1A4MA 3MP4A 1HJSA 4QQ3A 3TC6A 4PL1A 5XIAA 1W3TA 2NVCA 1HTIA 2I5IA 1KM6A 2R14A 4OUIA 4GBUA 4KGJA 1S3HA 3CL8A 3PULA 1PKLA 3VVGA 1UWSA 2V3DA 4QROA 1GZGA 3GAKA 2XWDA 1EP2A 1LF1A 3BLEA 4EIVA 1DXFA 1P0EA 3F03K 1I2OA 4JXCA 4PRRA 3GFYA 5TNVA 2CYGA 3HGJA 1JNEA 3GVVA 3TDFA 1IEWA 2Z1SA 1WKDA 4ACZB 3PZOA 5T8GA 1LLOA 2NLIA 3CEUA 4G56A 3EB4A 1S2TA 3UESA 4GD0A 2FVMA 4MMWA 3N2TA 4ZOAA 3P8IA 2F9RA 1C8QA 1NWRA 1VPXA 1F4HA 4LNYA 3NOYA 3DKJA 4ZE4A 3O16A 4IIEA 1EJRC 3MUY1 1ML1A 1Q2SA 1WPCA 3ZVHB 4MWAD 4AZCA 2J75A 3WMBA 4FXFA 2RAGA 2R1KA 3EEZA 5HA7A 4MYAA 3GG1A 2AMXA 4MNKA 4I7WA 2WWDA 2RUSA 3H2MA 3IRDA 4ZENA 1U5VA 1KRAC 4HK5A 5BRQA 1KM0A 1TUFA 1K77A 3VA8A 3LPOA 5IDIA 2AQVA 4F2UA 2WZHA 1S1RA 3LCGA 1OFPA 1XCWA 4WGXA 2Z0IA 1FRBA 2ISDA 1CLVA 2XGBA 2I1OA 1TX0A 1B2YA 2CEQA 2WNQA 2PGEA 4F0MA 1Q6EA 5EFDA 4O0KA 3AUJA 3I3BA 4KPLA 1EJSC 1K7EA 1IIHA 3MZ2A 3IV8A 1XIEA 2JKPA 1ZTVA 3AMKA 1IIGA 4CU6A 4FLSA 3M7WA 2QYGA 1RCOB 4XVEA 3CUXA 3DC8A 3ZMRA 3GNNA 2CW6A 1S39A 5LIXX 3FXGA 3A6OA 1XDLA 1T5AA 1CGUA 3N17A 1SFSA 2CKRA 4RW3A 4IJCA 5H8PA 1R6WA 1H50A 4JTFA 4DELA 3HG2A 1JRBA 3L65A 3UD6A 1D8WA 1PYMA 4LB4A 2PWHA 1TR1A 2XTKA 3LRKA 4ZOCA 5CJ5A 1VYSX 1OX5A 1C8YA 1WKEA 3CV6A 2QAPA 3T1GA 3W2JA 1R46A 2IKHA 3S1UA 2ZADA 1P5BA 3QGVA 1IGWA 4EX4A 3P5ZA 4XAFA 3I10A 4RNHA 2WB5A 3DU0A 4ZL1A 1EHAA 4L9YA 1R85A 4PR4A 4MWAA 1TPFA 3E2QA 3SN4A 3W7JA 2XINA 3TJLA 3DESA 4UXDA 1TIMA 5A6TC 1N8FA 1JYXA 4CUCA 2D73A 1JYVA 3WQDA 2J74A 3HQNA 5BU6A 3NYZA 2CLHA 1ZJHA 2H90A 2QDEA 3GY1A 3ZXWA 2DVUA 1PTAA 3WQ6A 1US2A 1QPOA 3CZEA 5A6MA 4XZ9A 1CGYA 4YTQA 3UWZA 3WUEA 1KFEA 2OWCA 3LERA 3AUOA 1T7LA 1XSKA 2VRQA 5D02A 3LB0A 3R1ZA 1THFD 4C7GA 1UH3A 4S3JA 3WUGA 3NCOA 3W53A 5T91A 4DX3A 1IEVA 4XG1A 4WJ8A 5TAOA 2WOQA 2OT0A 3OBKA 2WSKA 1DQUA 3TYZA 4R7JA 5H8MA 3ANVA 4B2DA 3KOXA 1SO3A 3C56A 3AXHA 4PBFA 3MUIA 5D8ZA 1Q6FA 3SUSA 3YPIA 1RP8A 5LA2A 4LUTA 3SRFA 3C8NA 3GVQA 1TPDA 5C9XA 5JXQA 3QMTA 3H2CA 5FOOA 3UZXA 2ISVA 1SFJA 4YTTA 2Z1KA 1E5JA 4UTWA 2XH4A 2V68A 2P8BA 1L2UA 1HXJA 4H9TA 3THUA 2PBOA 3TH6A 3EOLA 1P43A 5FL1A 1PSCA 4GX8A 3W85A 4YVPA 4Q7IA 4QIUA 2CFFA 2DT2A 2NZLA 3PTQA 4G9PA 4XKMA 1S1PA 3HURA 5A8MA 1EWDA 3GG0A 1F61A 2R91A 4IP7A 1T8QA 1DP0A 3W1QA 4L4LA 4KFOA 2XN2A 2I14A 1SSDA 4PUDA 4PCNA 2E67A 4AISA 3RIKA 3CYJA 3VZXA 4ERGA 1ICPA 3TYCA 2ZRVA 4J27A 1NH6A 3AS3A 4C6BA 5I3KA 1W1B1 1T96A 2OEMA 2Y7EA 1J8VA 4W9TA 4A8RA 3G0SA 4GKLA 3GZ3A 3FSTA 3SGZA 3USZA 4LAKA 2G3JA 1FY6A 1E9YB 1QNOA 2IKIA 3SQLA 3RJXA 3PY2A 4J3ZA 1JFXA 3AS0A 5FL0A 4CD7A 1MUCA 2PSNA 3KP1A 3M5XA 1CXLA 2NW0A 3MMWA 1JCLA 3FAXA 2CESA 3ZSSA 5DY2A 3CWOX 5DY3A 3I7SA 4QLKA 2Q8XA 1DWFM 1JI2A 1O6IA 2D2JA 2YX0A 3C86A 3WQGA 1HKWA 3AU2A 4US5D 3VD5A 1A50A 4A3QA 1GQJA 5AZ0A 2RDTA 3GD6A 3N6HA 2Y6ZA 1HVQA 1KKRA 3VIMA 1X38A 1A5MC 1LTDA 2FTWA 2FB2A 3RMJA 4QG9A 3W1LA 4C1KA 1FHDA 3NPWA 1BWLA 3D46A 4MY8A 5I5RA 1R5YA 4Q4RA 3W01A 4WDTA 3RFAA 2WNZA 1ONRA 3GFZA 1UOZA 3F4VA 1Q4NX 4GY7A 1W8SA 4K39A 4ZQPA 4ADUA 4AAJA 2OXNA 1KM3A 1TCDA 2DDXA 3WLJA 4XWUA 4UQDA 1TPH1 4F0LA 2Y8UA 3P81A 3WLKX 3EDFA 1WQ5A 2Y63A 4DBDA 3QTPA 5C2XA 4DBWA 2XGZA 3BSMA 3GUWA 4ZO6A 1GPFA 3DFPA 4XZLX 3BDKA 4BKNA 2FGBA 2A7PA 3TN3A 2E1WA 4WSKA 2ZRUA 5FJIA 1FDJA 1FXQA 6PTDA 5E70A 4PSPA 4PCSA 1UUMA 3W2LA 2VGFA 3QR3A 2EKCA 3GDTA 3UWUA 4ZQNA 5JH2A 3ITVA 4F0KA 2X40A 4GLEA 1D7KA 4I7VA 4I6VA 3ATYA 2WZMA 1JD7A 3GNRA 2VFFA 4P8VA 5JU6A 2NUWA 3TYAA 4M5PA 1K70A 5BYWA 1XLMA 4O0ZA 4LWWA 2C6QA 4WKFA 3WH6A 2O9PA 3B97A 2CZVA 4UTHA 2O4QA 5AC8A 4BHYA 4NU7A 4M8UA 2YFNA 5K9DA 1HIZA 2YCJA 1FWRA 3L4TA 4GNJA 2L5HA 4YYFA 1HJXA 3FYOA 3ABQA 3KBJA 3LSCA 2VGIA 2NQ9A 1O1ZA 4RE2A 3R8RA 3QQWA 1FXPA 4S1FA 3UVIA 4I90A 1XXXA 5B7ZA 3ANYA 3ARTA 3L9CA 4UQCA 4TXEA 4OZOA 3EWYA 4GE8A 3GBEA 3BK0A 4B15A 5U4NA 1W37A 4F0HA 5LHEA 1XC4A 4IQEA 1X1NA 3LGEA 1VH7A 2NV9A 4IL0A 5FSEC 1W9PA 1HT6A 2B4GA 2OWWA 3S3GA 4HTYA 4IUOA 3CHFA 4Q4KA 1WDQA 4XAYA 3VNIA 1WZKA 4XD5A 1BTCA 3U7VA 1GZJA 4LUIA 2DPEA 1M41A 3S6TA 3W2KA 4LY4A 1I8JA 4CEXC 1MVYA 4U3CA 4GC4A 2FVKA 1W5MA 3PSWA 3UJ2A 4EVZA 4AD1A 3QYSA 2I5QA 2QKFA 1ZQ5A 1R86A 3BAWA 3LXCA 4PMJA 2Y88A 3SIZA 4H19A 4JN6A 1OFBA 4MADA 2DSZA 4PMRA 4P2VA 4F9JA 1RPXA 1YW1A 3D3AA 3KRZA 1HKJA 4NX0A 2P3ZA 5A6BD 3CPRA 3S5NA 5EYWA 5DELA 2G41A 3TR9A 4C6NA 4NILA 1KLZA 2ZFAA 1PWMA 2TAAA 4IM4A 1GQKA 1KCXA 2ZZ2A 1TYGA 4DJFC 1M03A 2XFYA 5TQLA 5HNNA 1I60A 2ZKMX 3UERA 3VNYA 1DXEA 4EWND 2AMGA 1N7KA 4GYKA 3VABA 4NI8A 1FWHC 4UQAA 2HMCA 3NZPA 1TB3A 3ARRA 3GWQA 1W5QA 1NM9A 3NVTA 2YR1A 2WSQA 1LP6A 7XIMA 4GI8A 1H09A 3LBOA 1JZ4A 1Q85A 1PX4A 5I03A 4A22A 2C16A 4X60A 3I65A 3VKJA 3WO8A 2YBUA 3VNLA 5BXPA 3FFSA 4EWJA 4TTUA 1T8XA 4NG3A 1XIDA 4QDMA 4Y9MA 4V27A 3LV5A 4IPLA 1I0BA 1J4EA 2YIHA 4BR1A 1PUDA 1FTXA 2YL6A 4V33A 1YBQA 1UD4A 1WXZA 4QLLA 1GOOA 3SN1A 2ZA1A 5JVLA 1XFCA 2BHUA 4MWAC 3WDJA 3F1QA 3WCZA 1XW8A 2DZBA 1OK6A 3QY7A 2WV8A 2OO0A 1XLCA 1W1PA 1GVFA 2YDSA 3KW3A 1Y5XA 4YWSA 1L9WA 3MI6A 3ALFA 1AL7A 4WY0F 4S3FA 1A3XA 3TEVA 3UYIA 3KZPA 4OECA 3A24A 2HNHA 3LQGA 1I1WA 1L8PA 3KBVA 4RLIA 4PTMA 1SUXA 2Q6ZA 5BMWA 3HPFA 2X1SA 1J0HA 4NVTA 1QNQA 2YCIX 1TPB1 5CBJA 4DUWA 2FGLA 3TROA 1WAUA 3DCPA 3CHEA 2JKEA 4XK2A 2XM1A 1A0CA 5AECA 2RHGA 4OT7A 2R1MA 2Z29A 4J3VA 4EF8A 3IJ7A 3VK5A 4MYXA 1LYXA 2P50A 1AD4A 3AROA 4N2YA 2Y5JA 2GOKA 1LT7A 1ZCOA 2EQDA 4Q4SA 1TVNA 4JHZA 4YPJA 2ICSA 5E93A 1HL9A 3JZEA 4FF5A 4XZBA 1W91A 3BMXA 2ZX6A 3W00A 2X1IA 5M2FX 2H9AB 1G7UA 1MUMA 1VEPA 4XKYA 2E09A 2VYOA 3EMQA 1Z42A 3P5YA 2AKZA 3AJ7A 4LRSA 3KOZA 4MAVA 4P7OA 4HHHA 1OCQA 1OZMA 1A5NC 1Q66A 1R7AA 8TIMA 3C6CA 3RO6A 4A05A 4FHAA 3DECA 3SUUA 2E5DA 1WKYA 4W5ZA 1S5MA 2DIJA 5D4YA 1VEMA 4QX4A 3ANUA 5DRIA 3L2MA 3GDLA 1IEIA 3RF9A 3FAWA 3S2NA 4DIAA 2XYLA 4AEFA 3DERA 4W7WA 4B5NA 1DWJM 5BOFA 1W31A 2E9BA 1O66A 1U1UA 4CQ8A 3A4AA 4JN7A 5HUOA 2WJFA 3LLDA 5E1QA 1E73M 2VWTA 1HJVA 1ZENA 3VD3A 3FK4A 3KBSA 1L0PA 4Z2IA 3EXTA 1AQHA 3DENA 4TUFA 1J5SA 4NRRA 2YJQA 2BSLA 2WSRA 3L4XA 3NQMA 3O0FA 3L0NA 3AQUA 4W89A 1HNYA 2BMBA 5LYRA 4KWWA 1F3TA 5FEWA 3GHUA 4CCEA 4Q8TA 1S38A 3RK8A 1V6XA 3LM7A 3EWBX 3WQCA 5JUVA 4PUJA 3W38A 3VDCA 2CIPA 1WDWA 4RNFA 1O1HA 3WF2A 1K6AA 1V6TA 3H22A 3IJIA 4W8LA 4ILSA 4GGBA 3ZWSA 4HYRA 2YCEA 1XUUA 1LWIA 1UR8A 4A29A 4LVBA 2VFIA 1QOXA 4LVAA 1M7OA 1PIGA 1CXKA 4K3ZA 3B9NA 4JIRA 3GBDA 2IPJA 1LL7A 4TIMA 3NVDA 1SO4A 3CV2A 5FF4A 4EACA 3M0LA 2WVVA 4US6A 1ME7A 1WZLA 1G0CA 4NJKA 2WM1A 2BVYA 1TQJA 2PDCA 4RZ4A 2CKSA 2E25A 3AIWA 4I5RA 3UY7A 1MEIA 2GGGA 1PTGA 2ZZ7A 3WSUA 3TFXA 1J11A 5MHBA 3S2LA 3HTWA 2P5NA 4FX6M 4LGXA 4CNOA 4IT1A 3PWAA 4WRHA 4GX9A 3OLIA 4H41A 2WMJA 3EDDA 3TWBA 2E28A 4W8BA 4I7UA 5HK4A 3S9YA 2C19A 3MCNA 3U57A 3PBUA 2QJGA 2HDJA 5IDZA 5F1VA 2VFDA 1V3JA 2I5GA 2CLPA 3U7BA 2D0GA 3R6IA 4C6KA 2DGAA 1UR4A 4JFSA 4FAMA 5BW6A 4L6HA 1RR2A 1CLKA 1NDVA 1KFCA 3NXFA 1UP2A 2Y0FA 1QO5A 1N8WA 4B92A 3PG9A 2CLOA 4IIFA 5G4WA 4CNUA 2GUBA 3CPGA 5G1MA 3U9IA 5CC3A 4W7VA 5EFFA 3V16A 2DFAA 3C2RA 1YE6A 1LUCA 4JDYA 5LIKX 5FESA 4AVFA 1TQXA 1FHLA 4XAGA 4TQTA 2B7QA 5LHFA 1TWIA 4JIQA 1V0NA 2PRMA 2XH2A 2LLEA 5HQLA 3NG3A 5FJOA 4MNJA 1P7TB 3W81A 2W62A 3OPSA 3S2JA 1TO3A 3TTYA 2O56A 3H24A 3EAUA 4WVXA 1E0TA 2PFHA 2QDGA 3VMNA 2BTMA 3VIKA 4O4VA 2W67A 3OZPA 2V5BA 3POCA 2PDLA 3PJWA 4DQWA 4N6FA 1KBBA 4B4HA 1EGVA 4JFTA 3BLIA 3FJLA 4A6GA 3HO8A 4B5XA 2R24A 1C8XA 1RJQA 4FS9A 4FF7A 4J5NA 1V0MA 7ENLA 1QNRA 1IYXA 3CLWA 1R2SA 3WBXA 3NPUA 2WC3A 2R82A 3EPNA 1KGUA 5FEZA 3H2AA 1DKWA 4HP5A 1B31A 3V0UA 2P1FA 1TSIA 1DQXA 2AKMA 3BTNA 3FDGA 3REQB 3F4WA 1HF6A 2PGRA 3EMZA 3LHUA 1KM2A 3TSDA 4QCEA 3LY0A 2G8ZA 2Z2UA 1CIUA 1B30A 3N6QA 1BVZA 3GK0A 4C91A 3N04A 1RY8A 2CLLA 3C4UA 3W9ZA 3CAKA 3K8MA 5D05A 3PWGA 5CBIA 1KTNA 1UBPC 2OR2A 3B8DA 2CBIA 3R94A 1TPVA 3M0VA 3LN3A 1MXSA 4CNPA 3C52A 5C55A 4L9XA 4M51A 4DO4A 3S83A 1VCGA 3P74A 1YEYA 4G1NA 4GWEA 3ZFHA 1H5YA 1E9ZB 2WKJA 1KTBA 3LCLA 3T09A 5BXSA 4HN8A 1BRLB 1I1XA 4RR4A 1SGJA 5BCAA 1BTMA 2HROA 5C7VA 3VD9A 1V08A 5IHSA 4UFMA 3RCNA 3W72A 3CQJA 1GOMA 1FDZA 5AZ1A 4E3TA 1TV7A 1B5TA 3FKKA 3H2EA 4IPIA 4G5DA 1IV8A 1R3TA 4TTGA 5LGXA 1QJWA 5CGQA 1LL6A 2RJHA 4K2SA 4C6CA 4QG8A 8RUCA 3WJWA 3OP2A 3ZIZA 2QJNA 3OG3A 1XBYA 1P4CA 4Z2LA 1BXNA 4ZA0A 3E2SA 1EH9A 1JPKA 4OUEA 2PBGA 3WLMA 1JGIA 3D6NA 1UD3A 5AHFA 3GXDA 3F5LA 1VFLA 1SFTA 1IT0A 3CC1A 2Z1BA 5K9CA 1W56A 4U2ZA 3C2YA 3SCOA 3B8VA 5D9NA 4DZAA 4BQ3A 4AWEA 4O8AA 3TJIA 4MSSA 1JI1A 3GH7A 1A0DA 3EOEA 3ALGA 2JE8A 3SCUA 1XSIA 4KGLA 2Z24A 3CQKA 1Q63A 3QKEA 1XFBA 4S2CA 4ZFMA 4QQUA 4MTVA 1TJPA 2J79A 1MRQA 3U4FA 4AZCB 1OFDA 4HYVA 1LBFA 1MW1A 3N9KA 4ZQMA 2G96A 5HWJA 1ONXA 3H4XA 1WX0A 4IIGA 4JTUA 4AW7A 3IIVA 2VCAA 1F6YA 5I2UA 4F48A 5LSMA 3GC5A 2C7FA 1KXQA 4PUNA 1Z44A 3CT2A 2VEFA 1FHVA 3ZT7A 3FYYA 1FCQA 2NQHA 2GVJA 1F9CA 4WD0A 4HSHA 5I3HA 2J13A 2E7FA 2V9DA 1TPUA 2WJDA 2R9RA 3FV9A 3VDGA 3PPCA 3M07A 3UETA 1RD5A 3MMUA 3NQFA 5I3FA 3HG4A 1EDGA 3R12A 4H7CA 3QLDA 1K3UA 4ZXOA 4CCDA 1QVBA 1RALA 4JFUA 3S46A 2DJXA 2PLKA 4F3HA 3DEQA 1QO2A 1J6OA 4GCXA 4NAEA 3A3XA 1UBSA 3AJXA 2J4GA 3HM7A 3RAOA 4J4KA 4ZTYA 2IXUA 4UNLA 1M53A 5A8NA 5REQB 5LNWA 2HS6A 4KQNA 3GO2A 1EKOA 2RGLA 4YN5A 3VDHA 2ZX9A 3NQAA 4XVDA 2GK1B 3AYRA 2PDHA 3VIHA 5CZSA 1O60A 4QSHA 3UPBA 2IXVA 2QPXA 3WBWA 4QSFA 2QW5A 4FR6A 4HU3A 3NGFA 1EJTC 4LALA 1GT8A 1OY0A 3NAVA 2VM8A 4JFWA 1Q8JA 4NZFA 3SSJA 4W88A 4PMXA 1V02A 3ZJ6A 2XSAA 5FF2A 1ZCCA 3N3MA 2EBNA 3LCFA 1O12A 1VFOA 2XHYA 3JRKA 5EMKA 2X2GA 3AYVA 4YCPA 4XUYA 3QGKC 4O28A 2PCEA 3QMRA 4N02A 2H6RA 4PB4A 3V75A 4AHQA 2O55A 5FAGA 2XPKA 1LLZA 2WVUA 2QJMA 2NWRA 3I7QA 3S1GA 1OIFA 3FGCB 3VNZA 5AN7A 3PZIA 1KQZA 4OQVA 2DW7A 4F0RA 1VRDA 3LUTA 1EOKA 4O18A 1EJWC 3OOQA 3LYEA 2H3DA 1OX4A 1CXHA 2B7NA 1OSEA 3M1ZA 3KHJA 4RZ5A 4KT2A 3MYOA 2BVDA 3VPLA 3V5OA 4UFIA 4JOMA 3HQPA 5HR6A 4IISA 3HB9A 1EGMA 5KITA 3S9ZA 3SM0A 3TC7A 1ITUA 1X8CA 3BW2A 4UTMA 1S2CA 3FLUA 1B54A 3AIQA 3ZQ9A 4Y90A 1GPWA 4UWMA 3GHRA 3LRMA 4GUIA 4HK6A 2XIJA 2ACRA 4H1ZA 4AIEA 3KTXA 3WK0A 3RR4A 2CCRA 4YVVA 3PG8A 1DIOA 5GNYA 3W1RA 3BOLA 3FJNA 1N2VA 2WHJA 3UA4A 3RG6A 2F6XA 3VO0A 3S5YA 1OCJA 2GWGA 3BGAA 2YB4A 3LZ5A 4QP0A 4NI3A 5A1AA 5HWMA 3KRSA 3LQLA 1IT7A 3DYPA 1SO5A 1XH0A 2HNEA 1MQPA 1EJXC 2J6XA 4XBKA 3B4YA 5AHIA 4P7NA 3S9IA 3GDKA 4ZTXA 3AMGA 1E1FA 3MPGA 1R87A 2R1PA 4PTXA 2EPHA 4NJHA 4R3UA 4JN8A 3RU6A 3WYZA 6XIMA 1CGXA 4M1BA 2Q8LA 3NR0A 3F2DA 3RILA 4W93A 4XAZA 1KBLA 4AIOA 4JIIX 4JHOA 1K8ZA 1TRDA 3XIMA 3ISIX 2X2YA 3MO7A 3T0CA 1TWSA 1UKPA 1R3WA 1LG2A 5E9XA 3UJEA 3EBVA 1WBHA 2EF9A 1FWIC 4PYSA 3W71A 2F2HA 1BPLB 4MIMA 3MWAA 1H63A 3RR1A 3TVAA 1MRAA 3GG8A 3SO7A 3NQ8A 3PZ9A 1NQKA 1C29A 3IJ6A 4NAEB 3G8RA 1YLVA 1J2BA 2QQ6A 3GNXA 3N2BA 4JEQA 5SWUA 4O19A 2J7FA 3W2MA 3CMGA 3VMOA 4REQA 3CQ0A 5I77A 4PGLA 4CGTA 1UKQA 2J25A 4Z0JA 1UQZA 2XIIA 1U5HA 4A4AA 1EJVC 5JIWA 1PKYA 4AMCA 4QJ5B 3QKZA 1E6ZA 3GW3A 1QHOA 3LDVA 4XTDA 3CL6A 2VGGA 1Q5MA 1JZ8A 3B4UA 5G4EA 3W7RA 4JQAA 4UTLA 4Q7BA 3VIFA 3T7VA 4HNOA 1FFQA 3W24A 3PANA 3S6DA 3WQEA 3U5YA 4U5IA 4LB3A 4HD5A 4QJ4B 3QTGA 5C9RA 3EOUA 1UWTA 4H9YA 2Z25A 3S5ZA 1NFBA 2CXGA 2WMIB 5AOUA 5ENLA 3EXRA 4MJZA 5IXEA 1IHIA 4E8CA 1R9ZA 4O50A 4IMDA 4JKLA 1IXOA 3L4VA 4HA1A 1VF8A 3W83A 2VJXA 3CMJA 4LBUA 2J78A 4ZFCA 1D2KA 1J93A 1AH0A 2VZTA 3AHYA 3TSBA 4GZEA 4WQ6A 1NF7A 4AYSA 3DXIA 2OSWA 3M6YA 2D24A 2DU2A 1Z89A 3AIBA 5DXXA 1C9DA 1OIMA 4LANA 1KBIA 1HW6A 1XSJA 2V63A 4ICMA 1A5LC 1A47A 4CNNA 4Q8MA 3SJNA 5CH9A 4C90A 4GI6A 1OFAA 2FPYA 4A8LA 1C7SA 1ZBWA 4JY9A 2V5DA 3IGXA 3OB8A 4HHMA 3V36A 1BGGA 2ZE0A 3HBLA 2DZAA 3MCOA 5I3IA 3HPSA 1CWYA 2J88A 3SI9A 1VJZA 3UF9A 4KWVA 4ALDA 3QRHA 1UWQA 1ZRQA 4JTDA 5C9ZA 1H7XA 3NFUA 4BWLA 3S5OA 3HG3A 3GIYA 2D22A 3V1HA 4UTFA 3URBA 2GDQA 3BLLA 2X1RA 1M65A 3C61A 5C71A 3IV3A 1UZ1A 4GQRA 1GW1A 3RX3A 3PF3A 4FA3A 1DBTA 3TSMA 4ZODA 2YDRA 3W70A 1Y8BA 1QK0A 5H91A 3A4JA 5K3VA 5FACA 2F2KA 1AUSL 1ZY9A 2I9EA 4XO6A 1WNOA 3LHZA 4GGHA 2DUXA 3VGFA 1Q45A 3PTDA 2E8YA 1YIXA 3DFYA 4H9XA 1K9TA 1GORA 2WMHA 1BXBA 4F66A 4H8VA 1XPGA 3QSTA 1SQ7A 2X16A 3PZNA 2DSWA 1A5UA 3BLPX 2YZRA 1EQCA 1U33A 4IHCA 5EMJA 1YNPA 4QR6A 2EJAA 3PAJA 4W4QA 3H7VA 3EX6A 4NL1A 5U7SA 4DAIA 4DY1A 3MMDA 3R43A 4S3DA 2J9ZA 2P8CA 1XLGA 1NF0A 1UWRA 3C0QA 3DZ1A 2PDPA 3GTNA 2OGJA 2DH3A 4FNTA 1JNDA 1OX6A 2C79A 1O94A 1F8MA 2FPTA 3QZAA 3P0WA 3JUGA 2XWEA 4JTQA 2GLKA 1XYAA 2QCEA 2P0IA 4C7FA 1JDCA 2NV2A 1H4PA 4FMVA 2JALA 4NF7A 3V35A 4F0SA 6REQA 2INZA 1LBLA 2BZNA 3QC0A 4J7RA 3RYSA 2BY2A 4UOZA 5CLTA 1EBGA 1J12A 4PE8A 1OYAA 1CI1A 5LA1A 3W22A 1RUSA 4K37A 4RV8A 3DBNA 3RXZA 4AHPA 4M3PA 3B9AA 3C5QA 3F4CA 3TA9A 3DFHA 4JPGA 3COTA 4PMQA 2Y85A 3STPA 4UCFA 3UZWA 4AVNA 1KRCC 3RX4A 4JZ5A 4O53A 2JGQA 3DI0A 1SZGA 1QWGA 1ADOA 3PFMA 3PUGA 2EAWA 2JIEA 3SECA 4BZYA 1XC6A 3TFCA 4QE5A 4AWSA 1LQ2A 4FXJA 4GISA 4WSJA 4Y9AA 3G1FA 3NL6A 2HVNA 4IL2A 4NJGA 2V8ZA 3WFAA 5AC5A 4FK9A 1QAPA 2X1UA 3M16A 3PM6A 2IW0A 4JD4A 5JBFA 4NJJA 2ZVRA 1C92A 5KTLA 4IQDA 2RFGA 2BY1A 4ECLA 2VKZG 1IT8A 4PEEA 3PPHA 4Y9NA 1B0IA 1TV4A 4B4FA 3GS6A 4MFDA 1VIWA 3IK2A 4UFHA 3W7PA 1E4LA 3LZ3A 3KVMA 4I3GA 1HFBA 3K5XA 4WUIA 3VUSA 4ZCWA 3WJXA 4D1IA 3T0TA 3OG2A 1GTHA 3M46A 3BLKA 3PAOA 2OYKA 1AL8A 2CNCA 3UWQA 1IXPA 8XIAA 2CBUA 3EXSA 3LXBA 5CJNA 3CH0A 4QAIA 1S46A 4AZ5A 4E3VA 4Q22A 4HZ6A 2XU2A 4HA4A 4LEQA 3BG5A 4AYGA 3BSHA 3AIVA 2CZ5A 3VGHA 5I7GA 4DWSC 1TMQA 2HQAA 3H6OA 3OVQA 4DBSA 4GUFA 2VP8A 3RLGA 1NAL1 3NYDA 1XYFA 1XI3A 4A3HA 3F5JA 3IAPA 3HPAA 1ZHAA 3PJXA 2H9AA 4WKHA 3WNPA 2DZVA 2PLJA 3M0MA 4HB7A 4IICA 1VPYA 4H9UA 5RUBA 1YTDA 4C6FA 4PTVA 1E1CA 3THQA 5PTDA 3KBNA 3QEZA 4O14A 1OVDA 2YFOA 4A8NA 3W7DA 1AJ2A 3O6YX 1XISA 3BARA 3VCNA 2HVMA 4AUBA 4HK7A 3DAQA 3G0UA 5D2VA 1XRFA 1IXNA 1MDLA 2GSHA 2CPUA 3SBFA 3Q65A 5CPMA 4B9YA 1K03A 3WUFA 4B2DD 3G2GA 5B7YA 3L0GA 1ZBCA 1JJKA 1L6FA 3AFBA 3BLDA 1QPRA 3AZRA 4HPHA 3WLTA 3O1NA 3SCRA 1OBAA 3P2VA 1EQPA 1EJUC 1M7XA 1HP4A 1AQFA 4C5ZA 1GVOA 2OGYA 3W7EA 2E3ZA 2C3ZA 3TW7A 4PTNA 3UZYA 2ALRA 3MY9A 2EJ1A 1QOQA 4AFYA 3N18A 5A8PA 1KO0A 3QQ1A 3ZJ7A 4KIEA 2VRJA 4MY9A 2OMAA 1Y5VA 4AD2A 4O1EA 3SCWA 1XLLA 2YBTA 5DCDA 4AU0A 4G6CA 2QCLA 3HPXA 3T8QA 1EWEA 3Q67A 3THCA 2PTDA 2XVKA 4CNSA 4Z2KA 3GHSA 3RCMA 3O63A 4KKXA 2CERA 2J62A 1GVEA 1JF6A 1PZ3A 3LENA 2A79A 4DJED 1LBMA 3R11A 4GK8A 3LU2A 3WJYA 4UNKA 3STEA 3SR7A 4UFKA 1XLHA 1XDJA 3G22A 3KTCA 3H2NA 1CXEA 2GJXB 5AKQA 5LKYA 1OF6A 4LY8A 2G5WA 4H7VA 5ABHA 3GM8A 3NWRA 2A85A 3OVGA 3NM3A 1OGSA 1YXYA 4AY7A 4H6QA 3G3MA 3LS9A 3BE7A 2PDGA 3IAQA 3E38A 4OV9A 3V7PA 3A12A 3M0XA 4B5TA 3UPMA 5D2WA 1R0MA 3TV8A 5JH1A 2VURA 3TQVA 3A22A 3K8KA 1KM4A 5F2GA 1K8CA 4DBUA 1VHNA 3VINA 3WLRA 4AXKA 1UA3A 3VGDA 2HXUA 2PS2A 4M19A 3R0DA 3GIPA 4IJRA 3WBEA 2A5HA 2BOEX 2W79A 2PODA 2O92A 2WCSA 5HATA 2DZXA 5JBEA 1KCKA 4O1DA 5A8GA 3GR4A 1P6CA 3E3HA 4ZZ9A 5CZJA 2OO6A 4WCJA 1TPEA 1MMFA 1O4UA 3S8HA 5KEZA 3R0UA 4FNSA 3W7IA 2WKLA 4RE3A 2GVGA 4AB4A 4XZIA 4O10A 4EXAA 1AVAA 5AC4A 3ATZA 4E4FA 1XIHA 2Z1XA 2ZUMA 1RQBA 2WANA 3OZMA 2E1DA 3I3EA 1SZEA 5M1TA 4WOZA 3M5ZA 4NQ1A 1JCTA 2WNWA 3UQNA 1E3XA 1B9ZA 1UHVA 2ZRXA 5FIPA 2XIMA 1E6SM 4DBEA 2A4AA 2C18A 5F4SA 1LJYA 4IIBA 2H3BA 2X41A 3U2ZA 3M6DA 3VOHA 3ZWTA 3NL2A 3MUZ1 3TOPA 5A94A 4EKJA 5LIWX 2BGQA 4FXSA 3GLCA 2EGZA 1MFUA 1QATA 4L4MA 4LX4A 1E1CB 2DIKA 2GGIA 3WZ0E 1A5OC 1JQVA 2PURA 3ONCA 3C0LA 1WOAA 3T05A 3STFA 4DWDA 2PDIA 3DDMA 5KZMA 3FDKA 1Z3NA 2HWGA 3B0XA 1W2VA 3FW6A 1NDZA 4GOAA 3W1PA 4Z08A 4IIDA 3UR2A 2FH8A 3CLMA 4DPPA 3IVUA 3AU6A 5IBXA 3ZJ8A 4DEFA 1LORA 2VC7A 4N6EA 1EB3A 3PBGA 4EPDC 4MJ2A 4N7QA 4LCRA 2J7HA 2Q02A 3SY5A 4Z1DA 2R94A 4OKDA 3SCNA 3FKRA 2YL9A 3OEXA 3BAKA 2PD9A 1VBGA 2POZA 2Y2WA 3WH5A 1E6RA 2VEIA 3KZSA 1FKWA 1RHCA 4OTKA 3RITA 4A8IA 1QI0A 1HL2A 1REQB 1LZOA 2DVTA 2W66A 1AFSA 1RSCA 3EKZA 2OTDA 1DWHM 1H49A 4GO8A 5CPTA 4C6PA 4CVUA 1W0MA 4REQB 3A5FA 1DJIA 3UPWA 4N9EA 4JY8A 4MWAB 4E8GA 1A3HA 1PXGA 3GFXA 3W1TA 5I3DA 3CNYA 4UFLA 1H0IA 4C65A 3TNBA 2OYMA 3O06A 5I6SA 1JFHA 4LU0A 4X63A 5EBUA 4W86A 4GIEA 5A6SA 2WZIA 3MDUA 4TMCA 2UY5A 3B8UA 3W1AA 3THDA 3E0WA 3U0HA 1BYAA 1TIWA 4BQ5A 1V3MA 2KAUC 3L5MA 2V5JA 3VKCA 3T40A 5HBFA 4LXFA 3UR7A 4OIFA 4Z1YA 5T9BG 3PTKA 2VX7A 5LNRA 4GKTA 3QHNA 1PVNA 1C7TA 5J8LA 4BI6A 1O5XA 1JZ2A 4Z17A 3OZYA 1WXJA 1AQMA 3V0TA 1IXQA 3M0IA 1ZNNA 2V38A 1V93A 4HBKA 4O13A 2E40A 4I9TA 3CHVA 3PSVA 5CG0A 2XFWA 1WB0A 2ZRWA 3VD7A 5XINA 2PP3A 5BRPA 2PDUA 2J27A 3CBWA 4EAYA 4JCLA 2VELA 1S2AA 3QMSA 1E56A 3KS6A 1PZ1A 1QASA 4HHLA 3F2CA 2A7NA 4Z42C 5C9UA 3N14A 3V3WA 5F1UA 4MDPA 2EPOA 1S5WA 1Q6CA 3CZGA 4MLRA 4Z1AA 4RDWA 3SDOA 3GC4A 2DIEA 3IIZA 3PC0A 2VFHA 2PP1A 3UNDA 2JFEX 2WAGA 2GJXA 1XLEA 3NQ6A 1QT1A 4U5KA 5TF0A 3O9NA 3G1AA 1ISWA 2GDUA 3B0YA 4GVGA 4M24A 4AIUA 2HSAA 4GRSA 1J79A 1AJ0A 3O2LA 4QISA 5FAJA 2Z2AA 3VCCA 1MO0A 3SY8A 4DF2A 1E0UA 1Z8AA 5FJUA 1WZAA 3I6TA 3BCJA 3H53A 1XD1A 3LCHA 3DHPA 1QMLA 5GVJA 3L21A 4LAUA 2PLCA 3CGTA 1QRQA 3FHAA 2UZ9A 2SFPA 4KEMA 1YHTA 5GJNA 4F8XA 1MW0A 5HOSA 7TIMA 4OFCA 5G2IA 1ODZA 4IFOA 3FYPA 1GQNA 2GGEA 1UR0A 2NVDA 1EX1A 1FP8A 5FKYA 1VBRA 2OZ0A 1XHGA 1BVWA 4ZR8A 1P6WA 2TYSA 2A6LA 2O7QA 3ENLA 2BFGA 3W6MA 2WLYA 3ZVIA 3DX5A 1YNYA 5ECVA 1SW0A 2QT3A 4ROQA 4AZ7A 2X30A 4HZ8A 2VEMA 1I6NA 7CGTA 2HTMA 1BEUA 2ZTJA 1GJWA 4O52A 4PRTA 2FHBA 1PKNA 1RBLA 4IUGA 1JULA 1PIIA 4JX4A 3B8IA 5CSSA 3WQ8A 3TA6A 1LQAA 2OLHA 5IRPA 4S3EA 1ITCA 2FB3A 4AZIA 2OZ3A 1F8IA 2VHLA 3WFZA 2QCDB 1E55A 2PDQA 5M3WA 3GU2A 1C8VA 3WLPA 3VI2A 2ZWYA 3ZJKA 1H3GA 4MF4A 4D6HA 4W87A 3MC5A 1CX9A 1YDNA 4HCHA 5C7HA 1GQIA 1OABA 2HBVA 4W8AA 4ZSUA 3QFEA 2WK2A 4TVUA 3O3RA 3H54A 3TJXA 2R1NA 2X0YA 1FX6A 2OODA 3IVSA 3L68A 2YA2A 4JYFA 4FEZA 3O0KA 3WK2A 3UJSA 4UTJA 3EA1A 2W91A 3OLEA 3IARA 3R58A 4NT0A 2FIQA 3L2LA 4IJBA 2HRWA 4U33A 2PWUA 4KWSA 3GTFA 5HNUA 8A3HA 4LF2A 4E2OA 3T6CA 2W92A 1SJAA 1V3LA 4WXZA 1CEOA 5A2CA 1XINA 1TE6A 2GK1A 3TN6A 3PJTA 1FA2A 4EXBA 3A9IA 2WZEA 1OQFA 3B05A 3OO2A 4QS6A 1T41A 4DJEA 5FI8A 3NEVA 4LVDA 2ZX8A 3WY1A 1S2UA 3GNOA 1QXLA 4JR5A 3TR2A 4D2JA 4PRWA 1ADDA 3CPUA 5CGTA 4C7DA 1E9IA 1TVPA 1EPXA 4J9JA 3IJDA 1QNSA 2XZ9A 1LOSA 3R79A 3O6DA 1J18A 3E5PA 2X05A 1MQRA 3FN9A 3KWXA 3BURA 2GQ3A 4QE1A 1TKKA 1PL9A 4NUWA 1OHLA 3AMCA 4MPKA 3AXKA 4XSMA 3T55A 3AZSA 1DV7A 1CNVA 3LHYA 4AMAA 4ORMA 2ZRYA 2Z00A 3VC6A 3TX9A 3SN0A 4UB9A 2V3EA 3DI1A 5CLWA 4KCVA 4R7WA 4GFSA 3DBPA 5EMLA 1GYLA 2XISA 3LHTA 4M6UA 1X97A 1XYBA 2VFEA 4AWTA 4PUKA 4GVHA 2ABAA 1RZMA 4R7OA 3GUGA 4CN1A 1FP9A 1C3FA 1K4HA 1PE1A 4IWWA 4ZVJA 4DYKA 1XPYA 2Y62A 1R3SA 3GVGA 5BMXA 4GI4A 2WLZA 3L7RA 2CC0A 3WNOA 3IGHX 5CKSA 4CQCA 1PB0A 4DYEA 3ZVHA 1KD0A 3M0KA 2ZXAA 5GQBA 2XG9A 3WLIA 1GKRA 4F79A 1GJPA 4UTWC 4E0CA 1WAWA 4E6MA 3VNMA 2HV5A 1RLCL 4JQ2A 5D04C 1NU5A 5KMYA 3P93A 3G1SA 2OYLA 1EIBA 3G1HA 5ECUA 3ES7A 3D5HA 1WDSA 3DOPA 1P0BA 2BVTA 3BVJA 3L4WA 3CWHA 4M7TA 3EWXA 1P1XA 2Q8ZA 3IIPA 3HMJG 4PZVA 3QF0A 1OT1A 4O1FA 1I4NA 4DZ5A 3SUVA 2OOGA 1RVGA 1SFLA 4B3KA 3WMLA 4GJ1A 2V5CA 3KCOA 5J5RA 1OM0A 2ZC8A 4Q6JA 3WDPP 5BU9A 1QHPA 2I56A 1VFUA 3AWOA 2KZHA 2XSXA 4FI4A 1UW9A 5HJLA 1TA3A 4O1CA 4PUEA 3VIIA 4IX2A 3T0BA 1XJBA 2EHHA 1VC4A 3CQHA 1IWBA 3BV7A 2JF7A 2MUCA 4I5UA 1BLIA 1CB7B 2WJEA 4L4OA 4H4IA 1NOFA 3MS8A 1ICSA 2HVOA 3GAYA 3T08A 3WFLA 4ACZA 1OFEA 1Q7ZA 2TRSA 1G94A 4LUSB 3ITCA 1JPMA 3IEBA 2XJ7A 2PDBA 1FCBA 1QK2A 3UG8A 4RE0A 4WHBA 3KX6A 2UY4A 2XGIA 1KRMA 1F3XA 3LV6A 3Q58A 4X22A 1HJQA 5DT5A 4G7FA 3CHDA 2QCDA 2YCLA 2D3NA 2FDSA 1MEWA 2ZA3A 4K68A 1YPFA 4NXKA 2JGYA 5BROA 4I9MA 2Z7KA 2Y8KA 1WV2A 4XZNX 2YYUA 1FWBC 4IFKA 4NASA 5GNXA 4Y9PA 1RCXB 3NIYA 1XV8A 3DFQA 3MUXA 1P0DA 3PZMA 2F6KA 3NQCA 4P8UA 4ATWA 4Q4PA 3CU2A 5CBBA 1LM1A 4PC8A 4HNCA 4WJEA 4KEUA 5HMSA 4C6IA 3NO5A 4V28A 1BKHA 3K8LA 2PDFA 3TUUA 4HMEA 3E0FA 5FJJA 3P61A 1DTNA 4L80A 4KMQA 4N9BA 2YCKX 2Z6JA 4I9JA 4AD5A 1ONWA 1VYRA 2G3MA 4YIWA 3OBAA 3AC0A 3W87A 3S2CA 2Y61A 4WR3A 1H2JA 4M0XA 2F6UA 4MNMA 5JMUA 4LS1A 1W9XA 3B9DA 3OU8A 3EDEA 3E2RA 2J7CA 4O12A 5MF5A 4IQLA 1FUYA 1PBGA 4FSAA 5A3HA 3TQPA 1TV3A 4V15A 3KP0A 4JQ4A 4HNTA 2YLAA 2QIWA 3E02A 4FPSA 4MKSA 5IFPA 1B1YA 4HCDA 2A21A 3FNDA 5CSUA 3RLUA 4DM2A 3GNDA 1P0KA 2FFIA 1DL3A 1GGOA 4FB7A 2TPSA 1E71M 3K30A 2ONEA 2FPVA 2NUYA 5C9WA 3QFWA 2BWGA 2HK0A 4KEVA 4IIHA 1TMHA 2Y24A 3WLHA 1Z32X 3ITYA 2PU0A 3AI0A 2WHMA 1UB3A 2XDFA 1A5SA 1ZL1A 1IZCA 1GJUA 4BQ2A 3EZ4A 2DP3A 3CM4A 4NZ4A 1A80A 2QUVA 5A5WA 4D6IA 4ZB0A 1V03A 2E68A 2V69A 2OCZA 3PBMA 1XS2A 1UKTA 4NKCA 3UGVA 4RDVA 3HU7A 2V2DA 3W7NA 5J5DA 4E4PA 3SUTA 4L1GA 3EKGA 1W3HA 2AGKA 4G7EA 4IMAA 3LOTA 3PR2A 2GFTA 5H8UA 3UT0A 1E4MM 4XD6A 2ZUUA 4MKNA 4GUHA 1G9HA 1EC9A 1ME8A 4GINA 1G4SA 1HZYA 3POHA 3TJ4A 4Q8NA 3NQBA 1GOIA 1IE7C 5A2AA 4EPEC 1TA3B 4D6GA 2UY3A 4OBRA 4A3UA 3GR8A 2NLYA 1CLXA 1VFHA 1SR0A 5D9OA 1UUQA 1N8IA 3TLLA 3A3WA 2VDIA 1QPKA 3PNZA 2WJZA 4S2BA 2BDQA 3EDKA 5L6UA 1I75A 5XIMA 3ZR5A 3KDOA 2INEA 2WPGA 3T42A 4W5UA 1EO7A 1AK5A 3SGGA 1J2WA 2I9UA 4LEFA 3WQVA 4ZEPA 3H4GA 4PMYA 3GXFA 1AH4A 3E5BA 1WUEA 3HIJA 2G3FA 3WLLA 1L2QA 3LHWA 3EB3A 4MKVA 4A21A 4Q8VA 2ZDSA 1PEZA 2VGBA 1XCXA 1KNWA 3GIQA 3MZNA 1AG1O 3FOKA 5G1TA 1A53A 3VOGA 4WIWA 3OBEA 2CETA 2ZA2A 1QBAA 4AXNA 4H7ZA 4A3YA 1YYAA 2C71A 5CQ1A 3WD2A 3DHFA 1LLWA 3QV6A 5FEXA 1UZDA 5D38A 4NNAA 2VO5A 5GJPA 3Q45A 4C6JA 1I2QA 4AF0B 2A1YA 4HT3A 4UNIA 3P84A 1US3A 5LIYX 4PA8A 4DRSA 1VFTA 1DWGM 5KSWA 1ALDA 4QGCA 2Z2BA 2CLMA 4PFMA 3DHDA 4LCQA 1T40A 3CAVA 3BMVA 2C1IA 4HU8A 3H26A 3M9YA 4YTUA 2P76A 3QZ6A 8XIMA 4D6FA 3MDWA 1KFBA 1CT5A 3HGRA 3QPZA 5C2GA 1RD6A 1VQTA 4AY8A 5CZTA 1XYLA 2PP0A 3FVDA 3J7HA 2VX4A 3MMTA 1XH2A 2PDMA 4ML9A 1H7OA 3U2EA 4Q33A 4RPQA 4FNPA 2B31A 2PB1A 3UFYA 3EPOA 1OCNA 1VFMA 3SRHA 2JKAA 4D6JA 4HYWA 1BGAA 2TODA 4ZOEA 2QVHA 4W84A 1B4EA 4PTWA 1EYEA 4OJYA 2GUYA 1MSSA 2X7VA 3OODA 3D47A 4J2MA 1UP3A 3WEMA 2PC8A 1VFSA 3VM7A 3Q2DA 1LG1A 4HKPA 3NSMA 1JDDA 4O15A 3W84A 3K1GA 1SMAA 3HG5A 3SCQA 2NV1A 4URIA 1F73A 4XBJA 3AHZA 1JL8A 3TTSA 1DYSA 3GHTA 3A4XA 1LDCA 1KBJA 4UMAA 1BSLA 4CEUC 1HKKA 1VJSA 3HZ3A 1HJUA 5ABTA 3V4BA 3CZ8A 3XINA 5CPNA 1W3LA 1W3NA 4S3CA 4J28A 4XZWA 3GXNA 4I6KA 1OFOA 2Z27A 5I00A 4RDYA 1DJWA 4MHBA 4C6OA 2CBVA 1BG4A 3WD0A 1GG0A 2X0SA 2QCCA 4MJMA 1R3VA 3L4UA 1JPIA 4XZHA 3MW7A 1JCMP 1SU5A 3QY6A 4QCFA 3N6JA 1ICQA 4ZQCA 1CTNA 4M1RA 4GA8A 2W27A 5E6ZA 1ISYA 1GYNA 5AC7A 4OGZA 4RV3A 3L23A 2QUNA 5DX7A 1TV5A 1ZBKA 3AMDA 2PE4A 3KE0A 4FP1A 1BXCA 1UG6A 2FZNA 2XVGA 5HANA 1UR3M 3ZT5A 3EWZA 3G1YA 1OC6A 8CGTA 2WKGA 3BWWA 3LTYA 1MNZA 3QGAC 2HJPA 1NSJA 2A7RA 1NIUA 2A3CA 4O0QA 2XH0A 2I7GA 3OA5A 3ARVA 1HUVA 3LCXA 4XV0A 1CCWB 3WF4A 4QJ1A 4FIRA 4GACA 1O7AA 1W1YA 4OU1A 1HQTA 1L6WA 1AZ2A 4NZCA 2W9MA 3MP3A 1GOWA 4KRUA 1G5AA 3QXBA 4E38A 5CZKA 3W2NA 1UD2A 3WD4A 3HV8A 4B3ZA 3OW1A 2B81A 1KTCA 4TU1A 3FY1A 4FR1A 4OBTA 4GNKB 2BGSA 3CIXA 3VOJA 3NURA 3NXLA 3VNKA 2ZQ0A 1ONEA 3PBWA 1LOLA 4GY0A 5AHNA 4Y6GA 4ADSA 1GUVA 4FLQA 4TVCA 2CWNA 1Q65A 4XO7A 2Y5EA 3RLVA 3CIWA 1RY0A 3SQSA 1TZ9A 4NNCA 4JTSA 2PTYA 2NT0A 3ORWA 2ANUA 3OGRA 5D2XA 4ZQOA 3CV7A 1I9CB 5I78A 4GNVA 4L1XA 4NXSA 1EO5A 1W5OA 3DGRA 1UASA 3G1XA 3KHDA 5G5IA 3KBMA 4DF1A 1J0JA 2OEJA 2CHNA 3SUWA 2GZXA 2PLMA 1JDFA 2NX9A 4M6VA 5FCZA 1H7RA 2D2HA 5CGMA 2A3HA 4N0RA 4B5VA 3B40A 3T2OA 2JIWA 3PHAA 4XB3A 2QVNA 3LLFA 3UGRA 1F74A 4PTDA 4LUTB 3U2OA 4HOXA 5FD0A 4UC5A 3H23A 3LI0A 3MI2A 1YPXA 3R13A 3KL3A 3BCFA 1RP9A 3QOKA 5AB3A 5CAHA 3O7UA 1ME9A 4S23A 1V6YA 2AL2B 5D37A 3NZRA 3W7HA 3M0HA 4LC6A 1E6NA 2PDWA 5LNVA 3G6LA 5KINA 3WK1A 2ZUVA 1B9BA 3TCSA 1KR0A 1W1VA 3ECQA 1ENUA 3W7QA 4W85A 4O11A 2GPTA 3MP5A 4JTIA 1KB3A 3SCVA 3URNA 1G4TA 3ARWA 4PH6A 2J8GA 2VZVA 3T44A 2YA1A 4LRTA 5GJMA 1DXIA 4DJEC 1Z7AA 4TMBA 3T4WA 1MZHA 2NQJA 1YDYA 2DZSA 4ATLA 4X9SA 1HG3A 1VB9A 3ARUA 1GOKA 1VR6A 4QFUA 4QRNA 3DG7A 3WEOA 4IFRA 3K2GA 3WD1A 4YTRA 1ZPTA 4PSRA 3USBA 1LROA 4TX6A 2F7FA 1ZS2A 5F2MA 3UZZA 5I0DA 4P61A 4JNYA 5E0FA 2V81A 3TYBA 3WDRA 3AS2A 5M17A 3MHFA 4K1WA 2H8XA 2EG7A 3EKLA 5F4XA 2D3LA 2ZVIA 3W02A 1XKJA 2Z6IA 2TMDA 1H1YA 1HGYA 4IPNB 1NFGA 2H8ZA 1XP3A 3QR0A 4D71A 3NQGA 3MVTA 1VLIA 4J3TA 3B03A 3G5EA 2QF7A 3VKAA 4AQLA 2RDUA 3G77A 4PBEA 3MSRA 1BYDA 3F2BA 2NXHA 4NZ1A 3E74A 4YHGA 3W27A 4N9CA 4WY0A 3P67A 1PAMA 1J0IA 2ZCGA 1DORA 2NT1A 1EEXA 1ZP4A 3GXTA 1JXJA 2MNRA 1BHGA 3UCCA 2P88A 1R3YA 3CTTA 3DGBA 4U28A 2A3LA 2FDMA 5A6KA 3BANA 1GVSA 1MI3A 3FIGA 1NEYA 1IF2A 1TRIA 1TV2A 4C6LA 1HX0A 3UG5A 2IKGA 3C2VA 1YTEA 1W54A 3G1DA 1HJWA 3IS4A 1EEPA 1V8EA 4HU4A 3MB9A 1T0OA 2WC4A 2ZIDA 4XX6A 1LWJA 1DEDA 1DIKA 3RM4A 2BODX 4PB3A 4RKAA 3TZFA 2PU1A 3KOWA 1FH9A 2ZXDA 3MBFA 2FYMA 3LMZA 5FJTA 4DO5A 4M81A 3IUHA 1FWEC 4R34A 1UIOA 2OKTA 3G3DA 3F5KA 1X6LA 5H1WA 3CASA 1DIDA 4J1OA 2ADAA 4HPXA 1OD0A 4XQ6A 4ATDA 4FNQA 3OYZA 4UZUA 1RJRA 2A6NA 4LW7A 2VCCA 3C0JA 1GYMA 4DLMA 4UTTA 2CLIA 1MXGA 4ACYA 4BQ4A 3LBMA 4UIOA 2FMOA 1TPWA 2FVLA 5K7JA 2FKPA 3GDMA 1EXBA 3S1WA 1G4PA 4Y2WA 1Q7MA 3ZYZA 3IGUA 1O95A 3GZAA 3EOOA 4E8DA 3HJEA 1UIPA 4O1BA 3LEPA 4H8HA 4MPQA 3S42A 4AG0A 4X61A 1M7JA 1TFVA 3R4IA 3OIHA 1RK5A 1OINA 2GQ8A 5D8WA 3FCPA 4H2HA 2VTFA 3KFTA 2PRHA 4GBDA 4BF5A 4HU0A 1CENA 1U5JA 3G8EA 4WSHA 1YE4A 4KWUA 3PJUA 3BGJA 2GL5A 2V3FA 3AO0A 3WL1A 2WHKA 5REQA 4WEVX 4I9AA 1E6XM 1RQEA 3JVAA 1TWZA 3NZQA 3N2CA 1G4EA 1IZKA 5IFTA 3UCDA 1GOQA 1VKFA 3H70A 5JBDA 1JF5A 2QGHA 2HXTA 3PN8A 2PC4A 2FLIA 1NFPA 4TVDA 3S4TA 1X7FA 3W82A 2PPGA 4KF1A 4EE9A 3AIEA 1UWAA 4LVGA 4RK8A 2G3NA 2J47A 2C1HA 3N2MA 3QV9A 4GC3A 3P3BA 2OJPA 2ATMA 1UH2A 3NM1A 1POKA 5LA0A 2CLFA 3BSGA 3QPYA 3O07A 3NSNA 1PV8A 3QHMA 2VZOA 4JHMA 3PZGA 3VAVA 4N4QA 2GSJA 4TX9A 3N73A 3ICJA 4GQGA 2G4FA 2RKXA 1VBJA 3WH7A 3WDIA 1GHRA 3DFOA 4P8WA 2VR2A 4WLCA 4LCSA 4U10A 2O7SA 3M4HA 5DFAA 2QDHA 5AY7A 3B9EA 4NAFA 3SFKA 3W7GA 4LQ1A 3VGBA 3E0VA 1CGVA 4UUIA 2Q71A 4H8NA 1XBXA 1XGDA 1ZAHA 2FMNA 4DO6A 3MSDA 4O57A 4OOUA 2VWSA 4LNCA 1S5VA 4WGHA 1EDTA 1IWPA 3ZLGA 3UWEA 1OK4A 3AZTA 1WDDA 1RQHA 3GC2A 2VI0A 2QCNA 4NP7A 4RXFA 2C0HA 2KX9A 2PUZA 3G1RA 5I79A 4M7SA 3REQA 3CUZA 3EA2A 2XH7A 2X1TA 3TP4A 3MV11 5AHEA 2CWXA 4WF7A 4ICNA 3PTMA 3B8TA 1FH8A 2XUCA 1YQ2A 3L4YA 2ZICA 4AIBA 4HNUA 4ONVA 3A3HA 1EGZA 4IX0A 4EPBC 3GH5A 2BB0A 1AQ0A 3W76A 1QI2A 6TAAA 3WQPA 1BYBA 1RV8A 4O4WA 1WCGA 1H41A 4JEJA 4BF9A 3V5FA 5FF7A 1E4IA 3K4AA 4KFPA 2XVLA 1Z6KA 2CXEA 2J7GA 1VD6A 1H7NA 9RUBA 4JYDA 1UQYA 5D33A 4NY2A 4B90A 1ZLPA 4UFJA 3VCRA 1RBOB 2RH9A 1WDRA 3AYTA 3W73A 1KWKA 2W6RA 5FJRA 4INFA 4KFNA 4A2RA 1P6BA 3EX4A 1W1TA 1GKPA 1ZUAX 1I2NA 1M01A 2WCGA 1XRSA 1ZJBA 2WW5A 5HWNA 3UWYA 1W9BM 2D23A 4Y8FA 5D09A 1XIFA 1BWKA 1UROA 3UZ5A 4LAZA 1Y5WA 4B5WA 4NYUA 2P10A 1LRNA 4ZBCA 2VEKA 5D2YA 1VCFA 1W2PA 2ALDA 1R3QA 4B91A 3K1DA 1ESWA 1XLFA 2DT3A 1K7FA 3LPGA 4PBGA 3IWPA 3VOCA 1DOSA 3VOFA 1KXHA 3HGSA 2WMKA 3VGEA 3KAOA 4ADTA 4D6DA 3UJFA 4PB5A 4RCXA 1DE5A 1BF6A 2V2CA 3KCLA 4GQQA 4PCPA 3ME3A 3EA3A 3GSMA 2BNJA 5JIPA 4QDWA 1W6TA 4RX0A 1VPQA 2F61A 2G50A 1FWWA 4AVOA 4US5A 1ZJIA 4EP8C 3PWIA 4N9DA 4LPCA 5CC5A 1BG9A 2CBJA 5I24A 4JTJA 1CXIA 1KRBC 3E96A 5D30A 1FWJC 1BAGA 4D8LA 3H2OA 2FZDA 5CPOA 3PUEA 4X0VA 2HK1A 4P5UA 1SYTA 4FNUA 5AYXA 3U8GA 2WWCA 4R53A 1ZZMA 4DJFD 4IMFA 2HZGA 2FGZA 4HPNA 4QTGA 3SFWA 3W7CA 3NDYA 1YRRA 2QR6A 1TX2A 5I3GA 2NXIA 4PFHA 1XR2A 2CITA 3CO8A 4H01A 4YYCA 3K46A 5EU9A 3TCEA 1DTUA 1NP2A 4CCCA 3DN5A 2GOUA 1W9DM 5C70A 1M9HA 1UD5A 4B3LA 2ACSA 5HPOA 1ADSA 1CXFA 3VKBA 5DN1A 1F05A 3I4KA 2PWGA 4K6AA 3ZSTA 2ZZ1A 1SZRA 1K6WA 4MB3A 4PMOA 4DXKA 5HMDA 2ZUSA 3BXWA 2DORA 3WELA 4DVOA 1XD0A 3IRSA 3BLFA 1LRQA 2OQYA 3HOJA 4GHRA 4HZMA 4MZ8A 1WKFA 1XLBA 1G6CA 4L64A 1RLDA 2XFFA 3VNJA 3ITTA 2J8FA 1G69A 4IGHA 4UOQA 3F4NA 5AHLA 2I16A 4UZSA 2PTXA 5DCBA 3HV9A 3ITXA 1FH7A 3KS5A 3WENA 1Y7VA 4YWIA 2FH6A 4RUBA 2W61A 4JTHA 4TR9A 2GSEA 5A6AA 3M5VA 1Q6LA 4QHRA 3WH9A 3VZYA 5EY5A 4WZHA 2YPIA 2OKOA 2AL1A 1UC5A 4EANA 1E9LA 3R5EA 2XN0A 1OC7A 2IMRA 3P0XA 3L5AA 2OFJA 4CKQA 4XAPA 4H83A 1OFRA 1CW2A 5TD4A 1IR2A 2C0AA 4KCUA 4RXGA 3I6EA 1X1OA 2RDXA 1BVNP 5DT7A 3ERPA 1NWTA 4BS0A 1WOBA 2OZ8A 4LV9A 1PKMA 3FEMA 4DUVA 5CG7A 2X09A 4NNBA 5TIMA 4QXIA 2DT1A 1F6KA 4D8ZA 2E8ZA 2OG9A 2FTYA 2ZBTA 1QI4A 1WXYA 1P48A 1PYFA 2W0UA 2WO5A 3BW4A 1FOBA 5DF0A 5LZLA 4JQ3A 4CD8A 3LGDA 3VTRA 3SURA 4LYRA 1JPHA 1M7PA 1SW7A 3WDHA 5G1YA 4GIYA 3GB6A 4Y9OA 2E6FA 3NJ3A 1YXDA 4H9VA 1TTIA 1H62A 5DXYA 1QI5A 2Z4GA 4CD4A 3EYPA 5HXMA 2JEPA 4ZO7A 2WM0A 3TLQA 1R9YA 4WDWA 1B57A 1BF2A 2GJNA 3HMCA 2GGJA 1F2JA 2WBKA 4F40A 4PUMA 3N29A 2VUNA 4DUXA 3LNPA 4L6OA 1KV8A 4RL3A 1TZ7A 2PWDA 2UV8G 1CPUA 2JK2A 3JS3A 2BX7A 1K7XA 1OX4B 2D2GA 1ISVA 3B04A 1X98A 1SO6A 2IKJA 2V2HA 1I45A 2V30A 3T8LA 4P7QA 1XWYA 3UBPC 7TAAA 3AS1A 3T0AA 4HIBA 1E70M 3AWNA 4X9YA 4AC7C 3W7KA 2CHOA 4WXYA 1U30A 4YHEA 3OTRA 2JF6A 2ZXQA 4CQDA 3CZLA 3STGA 4KH2A 4LVFA 4DLFA 3H2FA 3WLQA 2D1ZA 4AX7A 4JCMA 1RPKA 3A64A 2WZTA 2J9XA 1V77A 2PDXA 4E4UA 5A2BA 2BXYA 2WYSA 1XBVA 5AYZA 2VZUA 3TYDA 1KXTA 4EF9A 4XBSA 1E5NA 1VIZA 4HOWA 4GIRA 3OGVA 4E5TA 1G1YA 1OB0A 3OLGA 4DHGA 1FHUA 3MU7A 3KXQA 5D32A 1SMDA 3TNOA 3VGGA 4V2XA 1QR7A 1DJGA 3P6LA 2XFRA 2OLSA 1VJIA 1M68A 1KCZA 3JR2A 4F9DA 1B3VA 4QAWA 1C9WA 4JTEA 1NWUA 3GVWA 2D2OA 3I3DA 4AZHA 5C2CA 1V02E 3ARZA 3PFRA 1L6YA 1PCKA 4S39A 3QZEA 4Z1CA 2YZ5A 3HPZA 3SGUA 7REQB 2FFCA 3OLDA 3FEQA 1AJZA 3GYCA 1KM1A 2EEXA 2Y70A 1LL4A 1SSGA 2Z26A 3WBYA 4JS3A 4XD3A 2ZTKA 4UQBA 4QE4A 3TAOA 1QW9A 4UCGA 1Z9AA 3OGSA 1W9UA 5FEPA 2NVAA 1CYGA 1R2RA 2EO7A 1T6MA 4FNRA 3FXYA 4H3DA 2A3AA 4XD4A 2DV0A 4DF0A 1KLYA 2OX4A 3WJZA 1Q8AA 1F3EA 4DN1A 3THAA 3T0DA 3PB0A 4Q32A 2BASA 3S0CA 2CZEA 3W26A 2YSWA 3R7MA 5GNZA 3R8GA 3BLOA 5A8QA 2G97A 2RJGA 2BY3A 3P82A 1JCJA 4LBSA 3GDRA 3AXXA 4MFEA 1E40A 1MQQA 1VFFA 4NIRA 2DH2A 3V5CA 3LRLA 1I2RA 1B3WA 1WE5A 3N4FA 2IPGA 5HMEA 4MG4A 2QEZA 3PZUA 3N4AA 5EMMA 2AOSA 1AD1A 3M7SA 4IPPA 2A2IA 1D9EA 2Y5SA 3H4WA 4HA3A 1IR1A 4CN4A 4QNEA 1NWSA 1KC7A 2DZPA 1MFVA 2QDDA 5BNKA 1S3TC 3LD5A 3S6OA 1X39A 3UY8A 2NUXA 3PB2A 4MAZA 2WSPA 3SZ8A 2DY3A 1XLKA 2BOGX 5CC6A 3RCYA 1MDRA 1U22A 2PZNA 1JUBA 3M41A 2G0WA 5LIUX 1OT2A 3CAQA 1VENA 2Q3RA 2EPLX 3O6CA 5K9XA 1NQ6A 3B06A 3GXIA 4FO4A 3GU1A 4HN4A 3TYUA 2BHZA 4O54A 4C60A 1EDQA 3CK5A 1J9YA 4ZO8A 5EMYA 1EF2A 1YDVA 1NDWA 1CBGA 4M82A 1Z41A 1S5TA 4MWAE 1PCWA 2YKKA 3QLLA 4ERAA 3JW7A 1TTPA 1FWSA 4GYPC 2EG6A 2QJHA 3GE7A 2Y8VA 2GGHA 4K38A 1TJ1A 4C6MA 1XIJA 2OWXA 3BG9A 3KWSA 3NNTA 4QEEA 5BWFA 4ZQRA 4MZYA 2V6AA 4CU8A 3SJ3A 1E0XA 1K02A 4DPQA 3VM5A 4UBPC 2HBXA 3UXKA 1L8NA 3T81A 1GQLA 1XG4A 2E0PA 3GX9A 4HPGA 3QM3A 1EZWA 1DPMA 1LQ0A 3G18A 4R9OA 3EDJA 1K8YA 3TWAA 3RMEA 1QHZA 1UWIA 3VX0A 4GVFA 2FZBA 4CU7A 2OSYA 3BUVA 3HA1A 4GABA 1EA0A 2ZE3A 1TE1A 3ARYA 4AD3A 2OB3A 1VZWA 1BD0A 2QF8A 4IMGA 5HULA 1XQLA 1QOPA 3RUBL 3IUDA 1FFRA 2WCAA 4P8XA 3N13A 1O5KA 4F2TA 2OQLA 4BJHA 1H0GA 2X0HA 3E0LA 5IM51 2DQXA 4NZ3A 1EP1A 3IPWA 3UW6A 3VIJA 4Q8QA 4XZMX 4ZB5A 2VX5A 5AVHA 4Q4MA 1AZ1A 4ROPA 3K4WA 3ABRA 3OVRA 4LYKA 2UWFA 2BBFA 1V6VA 4PMDA 4OOZA 1S5NA 3SRKA 4YS1A 4M6QA 1PX3A 4RNJA 2ZUWA 3SW6A 1OC5A 3H8AA 1D3CA 5TBOA 5DMLA 5LXEA 2Y7DA 1FDYA 4XISA 3FA5A 1BYCA 3DG6A 3RDKA 1JDAA 2BS9A 3ZLFA 4Q4OA 1QUMA 2QZRA 3VZZA 3WF3A 2PDJA 3MUCA 9XIMA 3TE9A 3N12A 2F84A 4D9PA 3FHQA 5KZEA 1E15A 1XH1A 3APGA 2E9LA 1H7PA 1HGWA 1L6GA 3TXVA 2E6YA 4JTCA 3I68A 2D20A 5EB8A 4P7LA 3WDQA 1Q6OA 1NARA 4LUYA 1PS9A 3P14A 3HFYA 2PWEA 1J96A 4F2BA 2WNNA 1BWVA 3QVQA 4GXPA 3KVJA 3KOYA 1M1BA 1X7IA 3MYPA 3NUKA 4DUOA 3G0XA 1HN1A 1A5KC 1GHSA 3U4AA 2ATSA 5HPCA 3TTQA 3UU0A 3QQ0A 3P80A 4MB1A 1KGXA 4KBXA 3MSGA 3UXLA 1SM9A 3ARQA 4LBRA 1A4LA 2A0NA 4JTKA 2ISSA 3FA4A 3BGGA 4LH8A 3HN3A 2QCHA 3MTWA 6REQB 1D3GA 1DJHA 1QI3A 1OF8A 1ZFJA 4BY3A 2P3EA 1O68A 1DJZA 4L5ZA 3GTHA 4HSOA 2FZMA 4HJWA 3OHIA 2XZ7A 3CIVA 1EYWA 1JGMA 1NOWA 2OX1A 2AGTA 4DO7A 1RK6A 3DHUA 3ZLHA 5CPSA 1I2PA 4KETA 3NPVA 3GDBA 1GEQA 4X2PA 3TMQA 4RJEA 3VDAA 1PHQA 3UXDA 3HFTA 4BFAA 3VUPA 1JG9A 3EOSA 2FQIA 2ZRZA 3URAA 4MJ4A 2YXXA 3CWNA 1R7OA 5FJPA 1KCLA 4PULA 3C2FA 4NJIA 2V5KA 4XIAA 3ZR4A 6A3HA 1JRCA 2OU4A 2QV4A 3TOYA 3A21A 2PEVA 4I8YA 5LNUA 4A35A 3WJSA 1XYZA 3TQKA 1EPVA 4MB4A 2G3IA 3CH9A 1U1HA 4UOJA 1R2TA 3V0SA 3NQDA 1DIEA 1LCOA 3ONBA 3UNTA 1FWAC 3DC0A 1OG0A 1OGBA 4EOUA 4BA0A 2VNCA 4D6EA 3N34A 5KETA 4D72A 1GVQA 1GZ1A 3VFCA 3WG6A 4TV5A 1QNPA 4H6EA 3O05A 5HJXA 3TAKA 2OZTA 1TV8A 4K7VA 1EHNA 3AHXA 3TN5A 1K4GA 5C6MA 2RDWA 1WUFA 3L5LA 4ORIA 6CGTA 2NQZA 3KVKA 5EKYA 3W29A 2IQDA 2DZUA 2AQOA 1PHWA 1VS1A 4RDZA 1TVLA 4JX6A 3RO8A 4IZGA 1U2YA 4B16A 3QBUA 4PMVA 4WOQA 5I3JA 2QUTA 2ACQA 3PPGA 1PIFA 1U83A 1HVXA 1SVDA 4R88A 4K1GA 4L9ZA 2WQDA 2NWSA 4H8UA 2V0TA 2X42A 1C90A 1KFKA 2YLLA 3JU2A 1QU4A 1CDGA 3MCMA 3KL0A 2QMKA 4IGSA 1UCWA 1R30A 1TR9A 2CZDA 1IEXA 3UA3A 4AEOA 3BPWA 9CGTA 4UQEA 4AF0A 4RW5A 2DEPA 3CUJA 2YBVA 2ZZ6A 2B7PA 3RM8A 3WQFA 1SZFA 1KGWA 1B3XA 2V67A 3ARPA 1ODUA 5D9MA 4U31A 1IQ8A 4NHVA 1TWDA 4GYFA 3GRIA 4L6DA 3VMPA 3T78A 1XG3A 2QULA 3GKFA 4CN6A 1LUCB 1ZP3A 3PZTA 1YNQA 3TXZA 2X7WA 3RRXA 4AEEA 4Q8OA 3BICA 4NZJA 1S2VA 2BGNE 3BAJA 4M29A 1Z69A 4JNMA 3TW9A 1YTKA 1GK8A 2C1GA 3CO4A 4CQ9A 2OSXA 2PDKA 1OZQA 3L12A 1JD9A 3NQ7A 3LNMA 1A49A 3C2OA 4JKKA 3C3NA 3OQEA 3DIPA 5BXTA 5CCZA 4FX7A 2HCVA 2C15A 4JL1A 4TX8A 4BI5A 4MOZA 1AH3A 2EPMX 3RRAA 2Y89A 1AW1A 1ITXA 2J6VA 3SCTA 1AMKA 1J0YA 1Q2RA 2WC7A 5BXRA 1GVYA 3EB2A 5E6YA 1CECA 1LOQA 2VVNA 1E0WA 4GY1A 1HO1A 3NEHA 2NSXA 5CSRA 1YX1A 3VKKA 3RJYA 2VOMA 4N4PA 2VDGA 1JIBA 3MUAA 3UCQA 2DJLA 1L6SA 3R8HA 3R25A 4QEHA 4QS5A 5DRCA 3CL7A 1XYMA 3GH4A 1NTHA 1F3WA 5A6JA 4HQVA 2AAMA 4DYJA 1YPIA 1PDYA 1XLDA 3WUBA 3VE9A 2QNEA 2ZXBA 3NL3A 5HAOA 4XKYB 2W63A 3QYQA 2IS7A 2PDYA 4CQAA 3MBDA 4PUWA 1R3RA 2Z1WA 3BZGA 5AYBA 1J5TA 1JZ6A 1EUNA 5LNSA 1A5CA 3QSRA 3ZZ1A 2G4JA 4BEUA 1XRVA 3VFLA 1H61A 1E4NA 4O16A 1RXOB 1H5VA 2VUYA 4BK9A 4B9ZA 5M5DA 5H6HA 3WQ4A 5T9CE 4GVIA 4B5SA 3B0VC 3NA8A 4ZB2A 3VD4A 2DT0A 2HISA 1FWTA 4CCZA 4NZ5A 4TOQA 1W1IE 5DQPA 4Q3MA 3BW3A 4NSBA 4GUJA 3STCA 3LGGA 5MKGB 3HQOA 3VX1A 1M04A 1HP5A 3LK6A 1E3ZA 3ABSA 1UD6A 2PZ0A 4NAFB 1J01A 2ZYFA 3NGJA 1Y65A 4GUGA 2O4MA 4KCWA 2X8RA 3W6LA 1MUWA 1TWWA 4OVXA 3U3HA 1EBHA 1H11A 2E6AA 4S3BA 1KR1A 1VYPX 4L61A 4XTIA 3RPTA 3S47A 4QM1A 1REQA 1XGZA 2E6DA 3V18A 1UYQA 3RN6A 3ARXA 1DE6A 4DXVA 2QPSA 2J8TA 5AYIA 3B8SA 3WKZA 2VD8A 3IANA 2DQWA 3D3FA 4LV4A 3BJFA 3WLSA 3AXIA 2GQAA 4IP5A 1K9FA 2DZTA 3C3UA 1LT8A 4DXXA 4HPJA 1XICA 1V7YA 1TELA 1XDMA 4Z0SA 3IJ9A 1AW5A 5KZ6A 2IPFA 4D1JA 4O17A 2INFA 5C0QA 2ESCA 1KFLA 4BEQA 4KRZA 3PZQA 3T2PA 3W0KA 3CEPA 4GH3A 1D3HA 2WVVB 1JEZA 2QHAA 6ALDA 3M0ZA 3APTA 1DJYA 4J2PA 4AX6A 2B0MA 1DWIM 1B3OA 1US0A 2BXVA 2PWVA 3II1A 4OV4A 1XCFA 3UYCA 1XYCA 3VIGA 2J7DA 3EMCA 2EG8A 3NPXA 5AVNA 4I8DA 3BOXA 3E49A 3SEPA 3TTOA 4MY1A 3LM3A 4IGMA 4LAMA 5AHMA 4WX2A 5IBXC 4MNLA 3WQ5A 3IIXA 4JYEA 4J3SA 1ZALA 3WQWA 2QJIA 1O5RA 3HJZA 1HKIA 3PK7A 3MWCA 3MA8A 2XIOA 3ZS4A 3XISA 1JYWA 3I7RA 3N1AA 3CTLA 1OADA 4UMCA 1UUOA 3A5VA 4AWUA 2BVWA 4AH7A 3O15A 2XM2A 2J7BA 5D9PA 3BCDA 1V3IA 2QXWA 4YJ5A 2Z7GA 3W1NA 2DUAA 4FOUA 1MWOA 4DWSB 3IUIA 3JZUA 1UR1A 4DJDD 1JYNA 2VC6A 2WPBA 4IH3A 3LA4A 5DO8A 5FF3A 3KEHA 3OYXA 4XIMA 6TIMA 5BOOA 1WA3A 4L56A 4DAFA 1BSIA 2ZX5A 3M5YA 5LXXA 2YB1A 3ARSA 4B5UA 1DQWA 3NQEA 3QC3A 4JICA 4GG9A 4UTIA 2CLEA 2IQ0A 3L4ZA 1W3JA 3U2CA 5M03A 5BWAA 5CEWA 1E0VA 2REQA 3U6WA 2I57A 4O8RA 1KV5A 4GYPA 4GZ7A 1YXCA 3URQA 3N4EA 3NO1A 4U2YA 3ABXA 2OEKA 4HMDA 2POTA 1NY1A 3D0CA 2YCLB 3FA3A 3SSZA 4O1AA 5G2HA 4EAMA 4IP4A 1ECQA 3KLKA 3EWDA 1X6NA 2O9OA 3ABOA 5E9AA 2D69A 4WJXA 3WN6A 5ABFB 4BCEA 4GFIA 5IHRA 4D6CA 3H21A 3E0IA 3PBYA 5I02A 4HNVA 3WX7A 3AMLA 1M5WA 1DWAM 3RNDA 2PF8A 4IMCA 4KERA 4KESA 1TPC1 1W9VA 4ZSTA 5F7UA 1F5ZA 1N82A 5CC7A 2QJJA 2WVTA 2Q01A 3TQ0A 3PPFA 5D2TA 1JAKA 4ZXLA 1DHPA 1XIGA 4DI8A 1UA7A 1QBBA 4ZMGA 1PZ2A 3O6AA 1EC7A 4E2VA 1ZU8A 1F6PA 2R1LA 5HNRA 4XSLA 4R33A 1VBUA 2DZWA 2E5CA 3AIUA 3MANA 2P0OA 2JBMA 3QJAA 1V3KA 3BJTA 3HGOA 3PP7A 1XLJA 5I06A 3NTYA 1PJ9A 2DSUA 3PUOA 2YGYA 2F38A 2IPWA 3LX9A 4HGXA 1WBJA 4H2CA 4DNMA 3Q4DA 3KCJA 1JR1A 2VL4A 4GXWA 2OOFA 3DH7A 3IK4A 3W1MA 1BRLA 1E72M 3AXMA 1P7TA 2RGMA 1BKSA 3AHTA 2PWFA 2GJLA 1Q4WA 3AOFA 5G2WA 2JQXA 3DKLA 1ZB5A 1M3UA 2QLYA 2C14A 2QUMA 3BAIA 5C8BB 2HPIA 2VQUA 1TMLA 1XM3A 3VIOA 2FZ8A 1Q7QA 2Y7GA 4E2DA 4UTTC 1LRTA 2ISFA 3TZNA 3CB3A 2BY0A 3PVFA 3I4EA 3WD3A 3W25A 2EPKX 2XVNA 1WZMA 3S1VA 3GXPA 4G7EB 4JTAA 5DMMA 3WF1A 4JQ1A 3LCIA 4J3WA 1W32A 7PTDA 1GWJA 4JTLA 3WH8A 1QFEA 4JKMA 2F8QA 1P0NA 3BO9A 3R10A 5A69A 3LMYA 3QPEA 4EPKA 2PTZA 4K7YA 4EK7A 1CB2A 3W28A 4EXQA 1ITQA 1V6UA 1FWFC 1LWHA 1EJ7L 3NO3A 2ON3A 1PX8A 3FSUA 3IIOA 3W3OA 1CZ1A 2BP1A 3W07A 2EPNA 4HA0A 4KIRA 2XN1A 3SRDA 3OIXA 1NJJA 4C6EA 2J77A 3CUFA 3UR8A 2VXNA 4DJDA 1FWNA 2DVXA 2FZ9A 4OHQA 3SCSA 1HKVA 2NXGA 4IMEA 4E2BA 2BXZA 4LJ3A 4CD5A 4I5XA 4PN2A 1V5XA 4U3AA 3OA3A 3WIJA 5ABGA 3LPFA 2QV5A 3N19B 1DJXA 3BAYA 3B0PA 1XLAA 3W37A 4CQBA 3AALA 1EC8A 5HDRA 1NOUA 4M6PA 5C54A 2QMJA 5EA9A 3LCWA 3UG4A 2DW6A 2W3ZA 2VC9A 4NRSA 1UKOA 3RU8X 2B7OA 3DYOA 1TG7A 2XIBA 4OE7A 2R6OA 7A3HA 4IG2A 2QS8A 4OBSA 1POJA 3N25A 3W23A 2OVLA 2WBGA 2BLEA 2ZZ5A 3C2EA 4NX5A 3IVTA 3QV7A 1G67A 3RX2A 3N2XA 3L0KA 3WEZA 3RLHA 4BF7A 3KTSA 3TTEA 1TZZA 4JBRA 1TJRA 2VEGA 3ZR6A 3A47A 4H00A 4KCTA 3T9PA 3UXAA 3IJQA 3KDNA 5F2LA 4RPPA 1ELSA 4G8TA 2NSOA 5CSYA 4MZ1A 3LTPA 1T99A 4UTKA 4AHOA 5B80A 4L65A 1K1DA 3NQ2A 3R2GA 4LC8A 2Y1HA 3TONA 3ITGA 3RPDA 1AMYA 2VX6A 4HNLA 1UMLA 3CMFA 4LFYA 1RAKA 4C1NB 2VR5A 1M6JA 3U5UA 3M64A 4KW2A 3VYLA 5A8OA 1Y0EA 1V79A 4UTUA 3BQ5A 1D8CA 4J3UA 1UR2A 1UKSA 3KLLA 1CGTA 1EZ2A 1KKOA 2YA0A 1EX5A 2PRLA 3EX2A 4K8GA 3EWWA 4X2RA 3R0KA 4DI9A 4POCA 3W1UA 1RA5A 2W5FA 3F4DA 5BRBA 1FWGC 3LLXA 3CYVA 1XIIA 3KVLA 1S2WA 1QW7A 3P62A 1DHKA 4Y7EA 1B3YA 1DJNA 3W75A 3MQTA 4PMZA 2NQLA 4HMNA 3GTIA 5G4HC 2WXDM 4TV6A 2J66A 2GYIA 2VRKA 4UR8A 5FSDC 4YTSA 3LBCA 3EX1A 1V0KA 1DJQA 1RJPA 5E0CA 4GJJA 1YMYA 5DMNA 1XF0A 3V1PA 2UBPC 2XSBA