4JTRA

Akr1c2 complex with ibuprofen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the AKR1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtrA00
3GHRA 1VBJA 2IPGA 2WZTA 1EKOA 1XGDA 3LUTA 1RY8A 4G5DA 4I5XA 2PD5A 4GIEA 3CASA 1J96A 2R24A 4PRTA 5AZ1A 2PD9A 4PR4A 4L1XA 5HA7A 4XZHA 4WGHA 1Q13A 2FZ9A 2PDMA 1EL3A 4JTDA 3LBOA 3BUVA 4XK2A 3ONCA 3WBWA 3R7MA 3B3DA 4HMNA 4QX4A 3ONBA 1AZ1A 4IJCA 2ACQA 3EB4A 4XZNX 4OTKA 2I17A 1K8CA 1LWIA 1US0A 3GHUA 3R8GA 2HE5A 5JH1A 2PDUA 5AZ0A 4EXAA 4IJRA 3UZZA 1UR3M 2IPFA 3LEPA 4FAMA 2IKIA 3CMFA 3V0SA 2PDLA 5LIXX 3T42A 1S2AA 3O0KA 3UFYA 2IKJA 2NVCA 1AH0A 1RY0A 3UZWA 3MB9A 3R6IA 4JQ4A 4LAZA 1IHIA 3CV6A 3V0UA 3FJNA 1YE4A 4PRRA 2C91A 4XO7A 4EXBA 1AH3A 5M2FX 1PZ0A 4DBSA 4ASTA 1ZUAX 2PFHA 3QKZA 2PDBA 4Q3MA 5HNUA 2HDJA 4YVXA 3M64A 1ZQ5A 3GHSA 2FZ8A 2PDKA 3LENA 4JTCA 5LIYX 1LQAA 3LNMA 2DUXA 3G1RA 3NTYA 4JQ2A 4JIHA 4LBSA 4L1WA 5DANA 3RX4A 2HVNA 3DN5A 3UP8A 3C3UA 3GHTA 4LB3A 1RALA 2NVDA 4DBWA 2AGTA 4GA8A 4XVDA 1SM9A 4WDTA 3WBYA 2PDCA 3GUGA 3LZ5A 4XZMX 4GACA 3LZ3A 2PDWA 2HEJA 1YE6A 2FZBA 4RPQA 4WDXA 2PEVA 3M0IA 4AUBA 2I16A 2PDPA 3UZXA 2BGQA 5LIUX 3G5EA 4GQ0A 3BURA 1XJBA 3F7JA 2PDHA 4XZIA 1EXBA 5LIWX 3N2TA 1M9HA 3LN3A 3M4HA 4F40A 4JTQA 1PYFA 2ACUA 2J8TA 4JTRA 4HBKA 4QBXA 3COTA 2IKGA 5JH2A 4QXIA 4FALA 3WG6A 3VXGA 2FVLA 4ZFCA 4WRHA 3R43A 4NKCA 4GABA 4XVEA 2IQDA 3R94A 1PWLA 1QWKA 4WDWA 4YVPA 3R8HA 4JQ3A 1AH4A 2PDQA 1GVEA 4GCAA 2PDGA 1MZRA 4Q7BA 2FGBA 2PDXA 3Q67A 4LB4A 3S3GA 4JTAA 3Q65A 4YS1A 3CAQA 4XAPA 1Z9AA 1R38A 4H7CA 3H7UA 3D3FA 3KRBA 2IPJA 3LD5A 5LIKX 1T41A 3R58A 1HW6A 2PF8A 3EB3A 2F2KA 3BV7A 1MRQA 2F38A 1HQTA 2VDGA 1AZ2A 1IEIA 2IS7A 3U2CA 4XO6A 2HE8A 3RX2A 1JEZA 1AFSA 4WEVX 2PDNA 2WZMA 1PWMA 1X96A 2DUZA 3RX3A 3WCZA 1VP5A 3V0TA 3WBXA 1C9WA 1Z3NA 2IPWA 3UGRA 4DZ5A 3H7RA 1XF0A 4LAUA 2PDIA 2BP1A 1MI3A 2IQ0A 3LQGA 1X97A 4R9OA 1S2CA 4XZLX 5KETA 1QRQA 1X98A 2HV5A 2R9RA 2QXWA 5HNTA 2ALRA 3LQLA 3H4GA 4FZIA 1ZGDA 4ICCX 4JQ1A 1ADSA 2ACSA 3UWEA 2INEA 3ERPA 3UYIA 3UZYA 2IKHA 1S1RA 2INZA 1YNPA 4LBRA 3CAVA 2ISFA 1A80A 3MC5A 4YU1A 3UG8A 3DOPA 1ZSXA 2PDJA 1T40A 4DBUA 4PMJA 4GQGA 2P5NA 3EAUA 5C7HA 2FZDA 3BCJA 1S1PA 3FX4A 3V35A 4WDUA 3O3RA 4MHBA 4PUUA 1OG6A 2CLPA 2ACRA 2HVOA 4H8NA 2A79A 2PDFA 4PUWA 1YNQA 4JQAA 4IGSA 1Z8AA 2DV0A 2BGSA 4JIRA 3V36A 1PZ1A 1Q5MA 3P2VA 2PZNA 4YVVA 4FA3A 3N6QA 2PDYA 4JIIX 1Z89A 1EF3A 3CV7A 4QR6A 1FRBA
chains in the Genus database with same CATH superfamily
2VMFA 3P61A 4IF2A 1IGSA 3JZEA 3GUWA 3MKKA 2QUTA 4HPJA 4Y90A 1TPDA 1CGUA 5GNYA 2CLMA 4BR1A 1JAEA 1XCXA 1DWHM 3UJSA 4XUGA 1ZZMA 3VNJA 2I14A 1GQNA 4GINA 4Q4RA 1Z42A 1X1ZA 5DY2A 4MJZA 1ISZA 3WK0A 3N6HA 4AZBA 1G69A 1LLWA 1A4LA 1X7FA 4AAJA 3LG3A 4J40A 5DMLA 2VENA 3EMZA 4ADUA 4A3UA 2AMGA 3QVQA 5K9CA 3E5PA 3M0LA 1PCWA 1P6WA 3G6MA 2ACQA 3UJFA 2QPSA 4UQCA 2HE5A 1KFKA 1W9PA 3W7JA 1YDYA 3AHXA 1LZOA 1KGWA 1KNWA 3OEXA 2Z25A 5K2ZA 2WMHA 3L4VA 4A35A 1GOKA 1JUKA 1K7XA 1OC6A 3TN5A 1UA7A 3A64A 4FXJA 4JTFA 2OGJA 2OSWA 3O0KA 1D8CA 3UFYA 4A2RA 3AIRA 1E0XA 1WNOA 4JDBA 1KM4A 3UZWA 3R6IA 4JQ4A 4ZGYA 5E1QA 4RNJA 4IFOA 2WHMA 4QISA 1DIKA 1VPQA 8CGTA 2E28A 4X22A 1GJPA 4FNPA 1EGMA 1EDQA 3DENA 3TR9A 2GWGA 1E1FA 3GXIA 1FA2A 5B7YA 1O95A 1MW1A 3M64A 1JNDA 4OFCA 4UQDA 4JFTA 4DUXA 2EGZA 5IBXC 2VX4A 5AYBA 4MAZA 1TPEA 3P5ZA 3SAZA 1Z41A 3NSXA 5E6ZA 1S2UA 1BSLA 2NVDA 2GDVA 5HUOA 4Q4QA 4RV8A 1RAKA 3BVJA 5LNSA 2XVLA 1OX4B 4YWSA 1WUEA 3G0SA 1B54A 3WBYA 1JRBA 1GOIA 1TV2A 3A4WA 3PZMA 2V2DA 1UH3A 1BWVA 3WELA 3WEMA 4A8NA 4RPQA 5A5WA 1H7RA 2YL6A 1WDSA 4W7UA 3NPUA 1Q6FA 2G3JA 2PCQA 2INFA 2CLKA 2BX7A 3IJ8A 3SY1A 1EJ7L 1QAPA 1HJXA 1W31A 5BROA 4AD0A 3UNDA 2WCSA 3EWWA 4WXZA 1UWAA 1UASA 2VKZG 3BXWA 5MHBA 1FCUA 2QKFA 2D24A 5LYRA 2OT1A 3N29A 3AMGA 2FJUB 2X8RA 5E0FA 4TV6A 4LGXA 1H51A 4WRHA 4JXCA 1WQ5A 3R12A 1YHTA 1D2KA 2KAUC 4WHBA 2PC8A 3W7GA 5HOSA 1V5XA 5EMLA 3NG3A 3RK8A 2E77A 3MUXA 1X8FA 3MBFA 4JFUA 4IIDA 4HNUA 2NZLA 3UWUA 2BVWA 4AMCA 1PBGA 2XIQA 1QW9A 1E3XA 3W7MA 1XCFA 2YYTA 5CSRA 1VD6A 9XIMA 3KRBA 4G7EB 2IPJA 3MWAA 4YTUA 4DXVA 1VGAA 4NJIA 4Q4KA 4CNPA 1YEYA 1OM0A 4R85A 3EWZA 3PTMA 2WNWA 1G67A 1HQTA 3POHA 1E6QM 3SQLA 2PRMA 4X61A 3W2UA 3WLSA 1EA9C 2PSNA 3NOEA 3WD1A 1SJDA 4R5EA 2HE8A 3W29A 3P8IA 5JBFA 3HQOA 1S5NA 3GTHA 3DHUA 2Z1XA 1XRVA 5FJUA 2HS8A 4QJ1A 4CKQA 4MWAD 2YCIX 2J13A 3BH4A 3HB9A 5DCDA 4AXNA 2R1PA 3OZOA 3ZT5A 3CUJA 1Y5XA 4GG9A 3QLLA 4V27A 4NI8A 1JVNA 1W37A 3DI1A 4JICA 3RU6A 2GQ9A 4HNOA 3M7SA 4C6FA 5E0KA 3SCTA 4A6GA 4LTSA 3QV7A 3G1AA 3GU1A 2VI0A 3H21A 1J12A 3ZFHA 1LM1A 3BLKA 1SJBA 5A8NA 4Q8UA 5I09A 2Z4GA 2P3ZA 2DVXA 1X1NA 4GMEA 1KKOA 4XX6A 4OUIA 4QLKA 4EXQA 4UTTA 3ABQA 3A4JA 5D33A 3NJ3A 4Q8OA 2P50A 3W1TA 1GK8A 5BNKA 1VFUA 4ROPA 1RCXB 4O4WA 3S47A 4JFWA 3FEMA 2WMIA 5FCZA 1UP0A 2YCEA 3C6CA 3L0GA 2DZXA 1F05A 2DGAA 1W3JA 4J27A 2D0GA 2WHKA 3GVRA 1MEHA 3MHGA 1R0MA 4PMJA 3RLVA 1UWSA 5BRQA 4BZYA 3KCOA 3VYLA 3LLFA 2E5CA 4WD0A 2UZ9A 5HMDA 2J9XA 4AWEA 4PFMA 3FX4A 1SW7A 1HT6A 1NVMA 3C8NA 1WKEA 2OG9A 4JIEA 1BQCA 4EPEC 3STFA 1W1VA 2WHLA 2CLPA 4ZZ9A 3LHVA 1OFBA 4QJ3B 5HPOA 1WZKA 2XSBA 2A5HA 2VT0A 1K02A 4PBFA 1ESWA 1GTHA 4Q6JA 1KR1A 3TLQA 4JOMA 1G0CA 3RMJA 4HYWA 1D3CA 4IX0A 3OZMA 2PZNA 4RE0A 4DX3A 4PTMA 4GBDA 5C9RA 3CL6A 1TPB1 3ZQ9A 4HU4A 3UWWA 7CGTA 4QNWA 1VBJA 4BI5A 2Z1BA 4UFMA 5D2YA 3IGSA 3M6DA 4GI8A 2GUYA 2VC9A 4XZ9A 4M51A 2OODA 2R24A 1V08A 5GNZA 1LTDA 1Z7AA 1UH2A 5CLTA 3QQ0A 5I3FA 4XZHA 1TRDA 4IHCA 3RCNA 1TREA 1UWUA 5D8ZA 3IUDA 5E09A 2NV2A 3DC8A 2VZUA 1H7OA 1LORA 1FY6A 4KERA 4PSPA 1SQ7A 4LVFA 5C7VA 1E43A 4HSNA 5I7GA 2ZUTA 1I2QA 5AVHA 5TQLA 1IT7A 5GQBA 4EOUA 2WVSA 1LL7A 5EMYA 1J2BA 5LNWA 4KWUA 1LWIA 2WQPA 1KCLA 4B90A 5K9DA 1CGVA 4HGXA 3ARPA 1NWUA 1X6UA 3UZZA 4F4RA 3E3HA 3OHMB 3OPSA 1OIFA 1E9YB 3TMQA 5ABFA 8A3HA 1TYGA 2NSOA 2ZX6A 1GKQA 2HROA 3P93A 2IKJA 1KM2A 5LHFA 1KQZA 2Z1VA 3PJXA 1GJWA 3P0WA 1BVWA 5IDIA 2QUVA 4GXPA 1E6NA 3W53A 1M1BA 3DKLA 3BLOA 2YFNA 3WJYA 4M81A 5MKGA 5G4EA 3GVGA 1TUFA 4K8HA 4S3KA 5TF0A 1JYVA 2ZRYA 4DBSA 4MGGA 3GH7A 3L9CA 1O94A 2YZRA 4NHVA 3RFAA 2QT3A 3NEVA 4FLQA 2DT3A 2L5HA 3GHSA 2MUCA 3VIFA 4Q32A 1KCKA 4PB3A 5I3JA 1ECEA 3A3HA 1PKNA 1FCQA 3MA8A 1WP6A 4RZ4A 4NZ3A 4QTGA 4GHRA 3R89A 3W70A 2B31A 2Y2WA 3IGHX 3O7UA 2V81A 5IFTA 4QQUA 1YDNA 4MYXA 1ICSA 4LS1A 2BODX 1TMHA 2POZA 5FACA 4RZBA 2ZUSA 2YCLB 1GJUA 4S23A 2I9UA 4ICNA 4RX0A 2NQLA 4KT2A 1XDLA 1MNZA 2E1DA 4AISA 2QDGA 4HOWA 3VE7A 2HS6A 4UOZA 3CLMA 1XLLA 3W7KA 1XPGA 5KZEA 4PCFA 5C8BB 1LG2A 4LVBA 1VAHA 4NJJA 3NURA 1L6GA 1YKWA 4HPXA 4UR8A 3HZ3A 3NQBA 3TLLA 3L7RA 1RPXA 4NZJA 1TZ9A 3H4WA 2F61A 2J77A 2D3NA 1EXBA 3H55A 1VIZA 2DH3A 4XBSA 1CBGA 3RNDA 3CUFA 4NVTA 2HBXA 3CPRA 3BOXA 2DZBA 2A6LA 3TC3A 1DJXA 1TTQA 4J3XA 4QXIA 4NAFB 2E9BA 9CGTA 3OLDA 4NKCA 1BG4A 4FLRA 5I3DA 3KL5A 2DEPA 3LPGA 1X39A 1AL7A 2ZFAA 3NFUA 1O6IA 4M19A 2DPEA 3TR2A 4X2RA 3DFQA 2VJXA 2D0HA 1WDWA 4LYKA 5FI8A 5A94A 2PDQA 3IIZA 1EIXA 4GVGA 3AIWA 2ZDSA 1Q6DA 3VNDA 3S3GA 4JTAA 2DW7A 1R9ZA 1JRCA 3ALGA 4MSSA 3B0UX 2VZTA 2QLYA 3MCMA 4NL1A 3LD5A 3GR8A 4EVZA 4J3ZA 5FJJA 2PP3A 3QH2A 3BMVA 4W7WA 4O52A 3ZJ6A 3NIYA 2PF8A 3F2CA 2Y7DA 1KXTA 1QCWA 3A22A 4YN5A 3SUTA 3PVFA 2DJLA 2Z2BA 3W7IA 4FO4A 4IJBA 1DWAM 1ZJIA 2OOFA 2VDGA 1A47A 3GYEA 3CLWA 3EOSA 3I7RA 4IQLA 1H5VA 4XD4A 3U2ZA 4H04A 2OXNA 4G56A 1NFPA 5A8PA 3GBEA 1W56A 1X96A 4M0XA 3C2YA 1Q7ZA 5TBOA 4UTMA 3EWUA 5TAOA 4AZCB 4GX8A 4FHAA 1LUCB 5GJNA 3TYBA 1VFTA 3OGVA 5D30A 1H1YA 1ZL1A 4Y9AA 2O7QA 1SMAA 4LAUA 3R25A 3GXFA 2Q02A 4H9VA 3A5VA 4UMBA 3ZOAA 4CQDA 4C1KA 1QK2A 4TMCA 1P0EA 3V1PA 4DJEA 3WQOA 3MSRA 3O6CA 3BGAA 1RD6A 1IWBA 3RGTA 5HNTA 4LRTA 2J7DA 2DSVA 1A0CA 1I60A 1WBJA 2PPGA 1DIEA 1B31A 2DY3A 3DFNA 1THFD 4ICCX 1ADSA 3NXLA 1NP2A 2PLCA 3VU2A 1J11A 3CIXA 1KFBA 4F2BA 2VP8A 4F9JA 5AECA 3GC5A 5CKSA 5HBFA 3PBUA 3EOEA 2NUYA 3ZLHA 1PJ9A 3WD3A 1ISYA 4BI6A 4GZ7A 5HWJA 3O2LA 1P6CA 1XLBA 3K8KA 2VGFA 2XFWA 1KXVA 3UWZA 3BLDA 4L7ZA 1HUVA 5DBTA 3W7EA 3AHVA 4E4PA 2OZ0A 3P6LA 3SO7A 3T8QA 1IXPA 4O8RA 3ITYA 3B04A 4ZOAA 1RQEA 3CZKA 3W72A 3WLJA 5C6MA 3ATYA 1TA3B 1NDZA 4LYQA 3SY5A 3N9KA 1OG6A 2YGYA 2WK2A 2ZZ1A 3EYPA 1XFCA 1H41A 5DO8A 1JQXA 3WQ5A 5F2GA 3H8AA 1JUEA 3YPIA 4MUPA 3V7PA 4PUWA 4JQAA 1P5BA 3SRHA 3VOFA 3P2VA 3GC2A 1SJCA 3UNTA 4G7FA 4IIFA 3THUA 4YVVA 1F6YA 4CU7A 4ZTXA 4FA3A 4UTFA 1TJPA 2OZ3A 2ZIDA 2H9AA 3Q2DA 4H9UA 1CENA 2VC7A 1US2A 1V8EA 3ZT6A 1F3TA 2G8ZA 5AHLA 2GGEA 1Q6RA 4JTLA 1AQFA 4GYPA 5IOBA 2QPXA 3VIHA 3UJEA 3FY1A 2GK1A 1OCQA 2JQXA 1XW8A 3SSZA 2FVMA 3SCPA 4Z2GA 3TCSA 3ONCA 2OWCA 2VL4A 1OY0A 1V77A 1MFVA 2X0HA 1H7PA 1H49A 5FF0A 2CZEA 3CEPA 2WZIA 2J9YA 1OYAA 3DYMA 3GRIA 2X2GA 1E5NA 4LYRA 2NXGA 2ZTKA 3WBAA 1GQJA 5HUPA 1Q4NX 4EXAA 2Z6IA 5KMYA 4IJRA 3PB0A 3NPVA 3CUXA 1JZ2A 4PGLA 2D2OA 5XIAA 1IXOA 3CWOX 3M47A 4FIRA 2BGNE 1EOMA 3TUUA 1XGZA 1R46A 4W7VA 1GORA 5D8WA 2W5FA 1JCNA 2NT0A 3BK0A 4BQ4A 2WPBA 1CXLA 5AC5A 3B97A 3THAA 2YW3A 7TAAA 4AF0A 1VRXA 4V28A 2WO5A 4NZ1A 3QKZA 1XR2A 4C6OA 1V0KA 2OO0A 4IGMA 1M7JA 2ZXQA 3WUFA 4IXHA 2CBJA 3LENA 4IMAA 3H22A 1XPYA 1NP0A 3LNMA 1JPIA 2QCLA 3B06A 3QGVA 3P5YA 1BAGA 3GFXA 1DYSA 4C65A 3NQDA 5H8UA 3MCNA 4NZ5A 3QW4B 2J25A 3QZ6A 1ZP4A 4KFOA 1US3A 2AGTA 1PHQA 4NJGA 1EO7A 2Y62A 1K7FA 5JUVA 3KVMA 2OMAA 1A3HA 2B7PA 3LSCA 1Q45A 2H6RA 4HP5A 2ABAA 4HMCA 3EX3A 2R14A 3VAVA 1JPMA 3UG3A 3OVQA 2WVTA 2D73A 2H3BA 5U4NA 1NM9A 4U3AA 1GUVA 3OLEA 4N6FA 2Y5EA 3M5YA 5F2IA 4DB7A 3LHYA 3M1ZA 3TROA 4ROQA 4LC8A 3R4IA 2LLEA 1YLVA 1XI3A 3LN3A 3E5BA 1BEUA 3EOOA 4BQ3A 1PYFA 2RDTA 4UBPC 3AIEA 4NZFA 1E3ZA 3NOYA 3TCEA 1TE1A 1RVGA 1LBMA 3R43A 5FJPA 2V38A 4NJKA 2VD9A 3W1NA 1A49A 3NZGA 3I3BA 3C0SA 1FQ0A 2HWGA 1KBJA 4B5SA 1QI4A 1TWSA 2FGBA 3AMKA 2PDXA 3Q67A 3QGKC 4UTKA 2I1OA 5E5CA 3BOLA 3S1XA 3Q65A 1ZENA 1R38A 1Q6CA 2DZTA 2CCRA 2C71A 3WLQA 3PWGA 4AZ5A 3BOFA 2OQYA 2F2KA 2O55A 2R1LA 2WC7A 3FA3A 4I7VA 3QR3A 4YYCA 1R2TA 1OC5A 3B9DA 1KD0A 1S2WA 2O56A 2XH4A 2ZXDA 1WKFA 3NM3A 1OT1A 4PSRA 4N4PA 3BW2A 4UFHA 4N9BA 2W66A 5BOFA 4WEVX 3IJ6A 2IUZA 1TJ0A 5G5IA 3F4VA 3RX3A 3HFYA 1R2RA 4U31A 1TG7A 4H9ZA 1Z3NA 4X3ZA 4DWSA 1A5CA 4X9YA 1IXQA 2BY0A 1QR7A 4A3HA 1MI3A 3F5LA 5KITA 2IQ0A 1TMQA 1X97A 1XP3A 4DWDA 1KM5A 3GAYA 4NNBA 2QXWA 3B0YA 4B9YA 5ECVA 3LBMA 4YHEA 4PE8A 5CGMA 2YBUA 2ZWYA 4ZO6A 2RHGA 4O4VA 2X2YA 3FSTA 4HHHA 1XKJA 3VGFA 4D6IA 3Q4DA 1TWIA 2PZ0A 3JRKA 4UZUA 2JKPA 3C0JA 2INZA 3IJ9A 3PN8A 3CAVA 4MWAC 2ZADA 2AL2A 3MZNA 3S5YA 2QF7A 1S5TA 1HGYA 1UZ1A 1TPVA 2OQHA 3UZJA 4MDPA 2YCJA 4LF2A 1ME7A 2RH9A 5EBAA 2DFAA 4GRSA 3SGGA 4FF7A 4GC4A 1O1ZA 2NT1A 4GYJA 1JZ5A 1GPWA 3DCPA 3N3TA 4WDUA 4J7RA 3CM4A 5A8GA 5KTLA 5HANA 1DJZA 1PO9A 4LSBA 1NOUA 2ISDA 4Q8TA 1CGWA 2ZOXA 2ACRA 1DP0A 3BJTA 1KWKA 3BLIA 5LKYA 3S6DA 4LF1A 2OT0A 5I02A 4UTHA 2PU0A 3K1DA 1G01A 4GVFA 3S9IA 4LAMA 5A8QA 2O9PA 3NSNA 1VPXA 1NQ6A 1K4GA 2YDQA 3WLLA 2E1WA 3TYUA 2V3DA 3AJ7A 2XGIA 4LVAA 3LCXA 1GG0A 3ES7A 4NXSA 3WJZA 1HF6A 1KXHA 2YYUA 4DRSA 2BTMA 3AYRA 3QMTA 3HG2A 3LHZA 1UD2A 3AIBA 5DMMA 4GO8A 2ZZ5A 3ARQA 5FKYA 1JL8A 1ADDA 1GVFA 3DGBA 2YPIA 4RNIA 4P7NA 5HA7A 4MNMA 2WMFA 3N73A 4H4IA 1RJQA 3S6OA 4RE2A 1DHKA 4IIGA 2JIEA 3KWXA 4JTDA 4YTTA 1B9ZA 3MWCA 4OBSA 4HZ7A 2PWEA 1OFOA 3R7MA 1X6NA 3E2SA 2VFHA 3BGJA 1F8IA 3BLPX 3TNOA 1FUYA 4OIFA 3CQIA 4ZTYA 3ENLA 1HKIA 5JBEA 1OQFA 4HTYA 4RE3A 5HMSA 1S2AA 3GO2A 1ITUA 1EUAA 1CLKA 1JAKA 1I1XA 3PZGA 1AD4A 3W82A 4KFPA 4TU1A 4PULA 1A0EA 4XKYB 3OVPA 4CGTA 4DUOA 1UR9A 3OB8A 4LEFA 3P80A 1DBTA 4UCFA 1U1HA 1ZUAX 4ZO7A 4C1NB 3VKKA 2DSZA 4RDYA 3CT7A 2CHRA 3IJDA 3H53A 3WF3A 2TPSA 8XIMA 4ACZB 3VUPA 3E0WA 3MI3A 1IYXA 4I9AA 3HU7A 3WENA 3HBLA 3B03A 3G1RA 3TMLA 2E6FA 1UQZA 3DN5A 4XUYA 3C3NA 4MWAE 1RALA 4DBWA 3H2NA 5CAKA 2FTPA 1J79A 2RGLA 5CBBA 3VKBA 3JS3A 3UCCA 3NQEA 3MO4A 1H63A 1F4HA 1Q4WA 1LP6A 6REQB 2HEJA 1J0JA 4DEFA 3WQ4A 1K8XA 3W2KA 4DPQA 3ITXA 5CJ5A 4DN1A 4US5A 2J7GA 2WB5A 1PE1A 2FH8A 1ZB5A 2BZNA 2NWSA 1XISA 5CZ0A 4Y8EA 4IIBA 5D2TA 4R33A 4ZCWA 4GVIA 2CIPA 4IPJA 4EACA 1XC4A 2WNZA 3QY7A 3SJNA 2JEQA 2Z1SA 5EKYA 3SQMA 4CEXC 1RJPA 2OPJA 2OSXA 3TTSA 4QCFA 2VRQA 3PZTA 3L23A 4HBKA 3CBWA 5FF7A 3MUY1 1HIZA 4MJ4A 1GVIA 3VIOA 5FL0A 5CPMA 4FALA 4HA0A 1QI0A 1WYIA 1XYFA 4AHOA 3PTDA 5CEWA 1E4LA 4GABA 1XIJA 3QOKA 2IQDA 3M0KA 4X0VA 4MUZA 1PWLA 2Y5SA 4DAFA 5FSDC 1UBPC 3IAQA 3U48A 2WLZA 4B5XA 5I3IA 4GH3A 1TCMA 4MKSA 4AB4A 1ICPA 2ASHA 3VIGA 2GQAA 4Q8MA 5DF0A 2G3MA 3DHPA 1E4IA 1OABA 3CHCA 5BXPA 4S3AA 3URNA 4S39A 3WH5A 4FLOA 3CMJA 1A5MC 4H9TA 2DVUA 1K8ZA 4WSJA 4AEOA 1L0PA 1IF2A 4B4HA 4KMQA 4UTLA 1KM3A 1C92A 3PANA 3A21A 1C7SA 1XYAA 5F4XA 3T44A 1NSJA 3L0KA 4C5YA 2OVLA 3L68A 5HWNA 4AIUA 3H23A 2XIMA 5ENLA 4QEHA 3RR4A 2A1YA 1M7XA 1QXLA 2X7WA 2NQJA 1K6AA 3WBXA 2QEZA 3H7RA 1DXEA 5AVNA 2FPVA 3FA5A 1RK6A 2PF0A 3L4UA 1UA3A 5BW6A 4GBUA 5HK4A 2GZXA 1J93A 3K46A 3LQGA 1E40A 3R11A 2CPUA 4IMGA 2YA2A 3D0CA 3B0VC 4XZWA 3ZYZA 3ZT7A 5DFAA 4O16A 4A2SA 1BGGA 4DO7A 5FEWA 3S9YA 4NI3A 4JL1A 4HZ6A 1P4CA 3NXFA 4HU8A 4O13A 4UWMA 3O9NA 5G1TA 3NO1A 4M24A 1PIGA 3MP5A 1UROA 8XIAA 3TONA 3UYIA 2G50A 3ZVHA 2PTDA 3UZYA 4MM1A 4XAZA 3FXYA 2XINA 4QS5A 5BWFA 1YNPA 6ALDA 2P1FA 3VOJA 3UD6A 4YU1A 2QIIA 5A95A 4P7OA 5IBXA 1O1HA 2EHHA 4Z2KA 3C0QA 5F1UA 2PMQA 4EK7A 3OHIA 2J9ZA 3JUGA 3SCWA 4Q8QA 5C71A 3NQAA 3U2OA 3ITLA 2HMCA 1UMLA 2WJFA 3GKAA 2FZDA 3T81A 2QDHA 1J0ZA 3C2FA 3T0BA 3CIVA 3IK2A 4JFVA 4CD8A 4F9DA 3HMCA 4J3WA 1TE6A 3FVMA 4NUWA 3FHQA 4PUDA 5C0QA 5I79A 4FX6M 3FJ6A 4H8NA 4UTTC 1X7IA 2FFIA 4P7LA 3KP1A 2W92A 5AC6A 1XGEA 5DN1A 3DU0A 1PZ1A 2FKPA 4E8DA 4MG4A 1F76A 4R7OA 5ABTA 3W1XA 5AHEA 3NEHA 3RMEA 3WQEA 4EX4A 3A23A 3RJXA 3G1HA 1I2NA 5AC7A 1CGYA 4D8ZA 4MFDA 2B7QA 4TX8A 3CUHA 5BRBA 3SN4A 3VGDA 3CZJA 1PTDA 5GVJA 1BVNP 1B90A 1ITQA 1V93A 3PPCA 2NVAA 2OTDA 4QHRA 4XBJA 1XUUA 3WH6A 1CLXA 4OGZA 3KBMA 2XVNA 4L61A 4IUGA 4Y9NA 4HT3A 3ELFA 1YNYA 3BW3A 1NIUA 1WZMA 1UKOA 4O1AA 4BJHA 4DO4A 2YXXA 2QCNA 2CKRA 1OGSA 2V5KA 1DKWA 3UVAA 2PGFA 1ITCA 2B7NA 4FXFA 2WSPA 4FI4A 3WKZA 4HSHA 2I17A 4S3GA 4NJHA 1VBRA 4PMQA 5AZ0A 3SIMA 4IPIA 3ZZ1A 2Z2AA 3I4KA 3EX6A 1E1CA 2W79A 3V0SA 4GUHA 4LPCA 2VFGA 4CVWA 4LS0A 5CGTA 4Z0SA 3W7QA 3LY0A 3ARVA 1N8IA 3N6JA 3ZLGA 1VBUA 2I5QA 3E96A 1GOMA 4LCSA 1TV4A 3R79A 5LA0A 4GUIA 2WMJA 3KW3A 2A85A 2W0UA 4K36A 2DQWA 5CG0A 4US6A 1SFLA 3VGGA 2EPNA 1EEXA 5CSYA 1MQRA 3MSYA 1XRFA 5HPCA 5BZAA 1WDPA 1YTDA 2PDKA 1AL8A 5ABGA 3WLPA 3VOHA 1V6YA 3RILA 3S2LA 1BGAA 2VWSA 5IHRA 4P2VA 4V15A 1NDWA 1O5QA 1F7BA 3W87A 1UOZA 2XIIA 1POJA 1PB0A 2A2IA 2A7NA 2YSWA 3WYZA 1ME8A 4XVDA 5H91A 2XWDA 4WDTA 1JR1A 1AW5A 1F4AA 3LZ5A 1FHVA 3R5EA 3SUSA 3U2EA 3I6EA 2OOGA 3ITTA 3ZSSA 3ABOA 5T91A 3BANA 1TFVA 5CBJA 4LAKA 1Q3NA 1BYCA 4MADA 1VJZA 1Y65A 4US5D 4CUCA 2QV5A 1W6TA 5G4WA 3DESA 5CPTA 4B9ZA 3GFZA 3WH8A 3F2DA 4CD7A 1BTMA 3TVAA 4A8IA 1EF2A 4JGDA 2J7BA 3TSDA 2ZX5A 2G3FA 2ODOA 3KDNA 3QY6A 1LQ0A 3HG5A 3LXBA 4LUSA 5JH2A 3G1DA 4KF1A 3PY2A 3VXGA 1DTNA 5I5RA 3EZ4A 3M07A 4M1BA 5JIPA 3CJPA 3STPA 1DTUA 3O6DA 4PBGA 1SGJA 3UQNA 3R94A 5BU6A 3K4AA 4YVPA 3QHNA 1XINA 2IW0A 2BXZA 4AD2A 2Z7GA 4X60A 4S3EA 2G37A 1VF8A 3B0XA 3F1QA 2HK0A 4ES4A 2XU2A 3U9IA 1XLIA 1Z9AA 3E0LA 9XIAA 4RCXA 1YADA 3LHUA 2B0MA 3AHYA 4B4FA 2OEJA 3LERA 2XGZA 2ZX7A 1FWGC 1YDOA 2V3GA 3WMSA 3ARRA 1O7AA 2YL9A 3KCLA 1XH0A 1KV8A 3WLHA 4QITA 1DIOA 4E2BA 1QOQA 3VILA 3WF2A 4LQ1A 1XRTA 3B8IA 4MNKA 1YRRA 4O17A 4B3ZA 4F8XA 2E4TA 1W5NA 1J10A 2QZRA 4JY8A 3V0TA 3NO5A 2QAPA 2V2CA 3VGBA 5JXQA 4OV4A 3N17A 3WK2A 1XLDA 1S5MA 3BQ6A 3EGJA 3SGZA 3GH4A 3FYOA 1U22A 3SJ3A 3RO6A 5REQA 1XRSA 4D6JA 2QHAA 4RDVA 3TSBA 1G7UA 1X98A 3VDBA 2HJPA 5BCAA 1GYLA 5K7JA 4CD6A 2Z27A 5HNRA 1XC6A 2GVGA 3E49A 2C13A 3E2QA 1OHLA 2OEKA 2E6AA 3VKJA 3CU2A 4PMYA 3S5ZA 1EDTA 3DFPA 1A80A 1LROA 3UPBA 3VNYA 3Q94A 4IMDA 1PX8A 2J78A 1ZSXA 1L6FA 3GH5A 1CZ1A 3CGTA 4W89A 4RW3A 1T40A 3C2EA 1JYNA 4DJDD 5BYWA 3D3AA 3I6TA 1QJWA 4W93A 1RV8A 1W2PA 5EBUA 2VQUA 5FEPA 2P8CA 4HK7A 3KL3A 4WK9A 3L2LA 3AICA 3MZ2A 1UB3A 2PURA 3UW6A 4IUOA 1KGUA 4S1FA 4HB7A 3SUWA 3OIHA 4HPHA 1JFXA 4V1XA 1CT5A 4DJEC 2ZYFA 5A6AA 2ADAA 3LMYA 1TELA 4TTGA 1ZAJA 3ITVA 3WNNA 1EJXC 1PV8A 4YJ5A 4KWSA 2YJQA 4DYJA 4PCSA 5A6BA 2PUZA 4L9YA 5IRPA 4F0SA 3PM6A 1KFEA 5ABFB 1EYWA 2W67A 1UHVA 2JEPA 5HDRA 3VNMA 4AZ6A 4MY8A 3C2OA 4PMDA 3DFYA 3NZRA 3KTCA 4ZEPA 4O1FA 2FFCA 2Y89A 1XH2A 2E09A 1UC5A 2VZVA 3N6QA 2VD8A 3N4AA 5DMNA 3S1VA 1RCOB 3WJXA 2E25A 2WM0A 3R13A 2PWFA 5CPSA 3LI1A 4LXFA 2P0IA 1XGDA 3BAKA 1IR2A 2BASA 1TIMA 1FBAA 1QUMA 4TVDA 1K3UA 3LS9A 1JPDX 4GJ1A 3FHAA 3T08A 2GVLA 1Q13A 2QJNA 1ONRA 4CCZA 2PDMA 4BF5A 1Y0EA 1AW1A 3ARZA 1MRAA 1VENA 4AWUA 1WPCA 3LPOA 3MBDA 3OG3A 1LLZA 4QX4A 1K03A 3DI0A 1RZMA 3EDFA 3TYDA 3B8VA 4PMXA 4CNSA 1KTNA 2FHFA 1ISWA 2DW6A 1C9DA 2PB1A 3CWNA 1UR3M 3BCFA 2CYGA 3BG3A 4JFSA 4AD5A 2PDLA 4CCDA 2XN1A 4CNNA 5HXMA 4JTKA 3WEOA 3V4BA 3T0DA 3H2FA 4GYPC 4O14A 4A4AA 4R53A 3H2OA 2PAJA 4PEEA 5HINA 1ZAIA 5E9XA 1RP8A 4DO6A 3N25A 5M2FX 1S46A 4PUNA 2BBFA 3KOYA 1JZ7A 4BHYA 5IDZA 2G0WA 4W8BA 4A21A 3N2OA 3KX6A 4I5UA 4FB7A 2W27A 3VIJA 4Q4SA 3WQGA 3EX2A 3ORWA 4I8YA 3VO0A 4WY0A 3RITA 3KHJA 3OZYA 1ZJHA 6XIAA 1JI1A 1V51A 5CGQA 5DANA 1AQMA 3THCA 1CW2A 1MXDA 3TXVA 1I2PA 3C3UA 1H50A 1FKWA 3BG5A 3QYSA 2D0FA 1TX2A 7PTDA 4RR4A 3PC0A 4LVDA 1KQYA 2YW4A 3U5YA 2A3EA 3GDRA 4ZXLA 4LUJA 1DIDA 4D6FA 1FDJA 2I16A 4XD5A 3DGRA 3AWOA 3IARA 1A3WA 1UZ4A 3MYPA 4OWGA 3MP4A 3GIQA 4KPLA 1J0YA 4F79A 3HMJG 4AIEA 1Y7VA 1MW0A 3M4HA 2I57A 3GLCA 4EE9A 1KB3A 4DYKA 4O50A 4HOXA 1JCJA 2ZRWA 3APTA 3BLFA 3O6YX 2WC3A 1ONXA 1VH7A 2CC0A 3CH0A 1EPXA 1QHOA 3GVWA 3L0NA 1B30A 2VTFA 4IP4A 3W7DA 3RN6A 1Z69A 1TQXA 3LLDA 1UD5A 4NYYA 4WDWA 2DZVA 3L5LA 1CYGA 1EPVA 3USZA 2E40A 1D3GA 2RFGA 3CB3A 3VCRA 3VCCA 1QNSA 1B3XA 4BWLA 3S2CA 1UR1A 1FX6A 1P0KA 1D3HA 1SO4A 4FIQA 1UCWA 4D72A 3D3FA 3GIPA 2VVNA 4XIAA 4TV5A 1MRQA 2F38A 1TV3A 2GDQA 4LW7A 3MMWA 3SCSA 1FVPA 4JYEA 1VZWA 4W88A 4H9MA 3N04A 5LNUA 1C8XA 2PP0A 4NF7A 1XIFA 1JEZA 4HPGA 5DCBA 3KOXA 3PNUA 2QDDA 1M41A 3XISA 1OF8A 4ATLA 4Z2JA 3TZNA 2DIJA 1KRAC 4IIEA 1MDLA 2NSXA 1ZLPA 3GW3A 2D3LA 3JR2A 1LLOA 5EL1A 3WH9A 3Q37A 4YTSA 1DJGA 4D6EA 5F1VA 2NW0A 5H2ZA 3EEZA 3M0VA 1CNVA 1UP2A 1VEOA 3UXKA 4IQJA 1ECQA 4KWOA 5DXXA 4D1JA 3IANA 1V3LA 3AXMA 2XIBA 1H7WA 5FJRA 4K3ZA 1F6PA 4O8AA 3LXAA 1TVPA 1BF2A 4GKTA 3SZ8A 1MMFA 2G4JA 1GWJA 1DEDA 5CQ1A 4IM4A 4DNMA 4POCA 1QPNA 2VGBA 2ISFA 3S0CA 1I2RA 4L4LA 4DZIA 4IWWA 1XBXA 3B8TA 3VFLA 2QF8A 4P61A 3L65A 1NWRA 4IPPA 4DWSC 3ZMRA 4DM2A 1NEYA 3O15A 3CIWA 3WDQA 3FDKA 5C7HA 3STEA 2HNHA 2GPTA 1A5AA 3B8DA 5FJTA 3AYTA 3TQVA 4UMCA 1EYEA 2NQZA 5C2XA 4BF7A 2G96A 3G8RA 4DO5A 3S2NA 3VC6A 4KRTA 4V1YA 2VHLA 4IISA 2C6QA 3TC6A 1R8LA 1BKHA 2I9EA 4B5TA 4IGSA 1FWJC 3LK6A 3V36A 4CD5A 3PPGA 3CYJA 4GQQA 4KEVA 4K37A 4HVXA 4AD4A 3IIOA 4ATDA 4AC7C 1FRBA 2CZDA 3G1VA 3TA6A 4DPPA 3AXKA 4G5DA 3R0KA 4I5XA 3NAVA 3RAOA 2DJXA 3SRKA 2G5WA 3A9IA 4O11A 1IT8A 4AU0A 4QG8A 1FWCC 3WD4A 1K6WA 2OZ8A 1DXFA 5IM51 4L9ZA 3GXNA 3MV01 4H83A 3FA4A 4Q8VA 1U30A 4JS3A 3INPA 2J62A 2BWGA 3AFBA 2ZA1A 4KESA 2QCGA 2GJLA 1PCKA 4I90A 2H3DA 1TPFA 3IVTA 3SFKA 4N2YA 4G7EA 4BCEA 1J0HA 1SZNA 7TIMA 2PDUA 5BU9A 2CXEA 3W9ZA 1GTEA 1T6MA 2FDMA 2I7GA 3LA4A 3L2IA 3K4DA 1XSJA 4D6HA 5AHIA 1Q8AA 3EPOA 4IMFA 1SO3A 2Y7GA 3MB9A 4H6QA 4GC3A 3WDIA 2ZE0A 3QJAA 3LRKA 2PTZA 2ISVA 1HJWA 4LALA 4GIYA 1M04A 1YE4A 4GY7A 4KH2A 3RPMA 5A6LA 3LCHA 2ZVRA 3H6OA 3KLKA 1GW1A 3URBA 4HD5A 4XIMA 3AIVA 3AROA 3BSGA 4UMAA 2WWDA 3GVVA 3TX9A 4JKLA 1W9XA 2WBKA 4YLWA 3SI9A 1IZKA 4Z0JA 2WMGA 5FA5A 2BSLA 3N2CA 4ENLA 4LNCA 2X41A 3ZS4A 2R1NA 3D5HA 2V5BA 4GQRA 3N12A 3VDCA 4B2DA 1ZJBA 3MT1A 2XN0A 2C0HA 3FS2A 3SCRA 1OIMA 4QJ5B 3UPMA 3B4UA 4LB3A 4CQAA 3STGA 2JKAA 4S38A 2DVTA 3LMZA 4A22A 4WZHA 1E0UA 4JY9A 2HTMA 2PDCA 4RXGA 1RCQA 4RNFA 1UWQA 4GACA 1XYZA 2Z0IA 4UUIA 1W9UA 4JHMA 3NQGA 5BRPA 2WAGA 1H0IA 1YPXA 3PWIA 2QNEA 2BVTA 1FXPA 1EZWA 4ZQNA 4UTJA 3BURA 3N13A 1CWYA 4C6MA 4F2TA 3UWQA 5LIWX 1AQHA 2QMJA 4QLJA 1EXPA 4OHQA 4INFA 1JI2A 2EPHA 4F40A 3F4CA 1EWDA 5BOEA 4QBXA 2ZC8A 5F2LA 3COTA 2TAAA 5AFDA 1JD9A 3GTFA 1XLAA 3TQKA 3IV8A 2CEQA 2YOCA 1ZFJA 4Y7EA 4N9DA 4OVXA 1J2WA 1QDSA 1XLFA 3BSHA 2J47A 4IL0A 3PFRA 2RKXA 4U33A 5DX7A 4C1LA 4GISA 2SFPA 2XVPA 2Y4SA 5A8MA 4MKVA 3M43A 2BB0A 4GNVA 1J01A 1UPMB 1OCNA 5EMJA 1LCOA 2D2JA 3CS2A 2CXGA 5K4ZA 4ERAA 2HQAA 4B3LA 4D8LA 1RBOB 1G5AA 2WQDA 3HGOA 4JX4A 4QNEA 3V16A 2BDQA 1UMYA 4E5TA 1KRBC 4GUGA 2ZX8A 1F61A 2A6NA 4QAIA 3VCNA 3VMPA 1BXCA 2P0OA 4G6CA 3O06A 2DQXA 3UR7A 1V79A 1NOFA 2Q01A 3W07A 3SBFA 3KE0A 4RPPA 3EBVA 2CW6A 4AZGA 4TQTA 1QK0A 5A2AA 1HJVA 2ZBTA 1VFLA 3SFWA 1EHAA 4ZQMA 2GJXB 1XYLA 2GJRA 3T0AA 1WXYA 1IGWA 1Q6GA 4AVFA 1V6XA 4D9PA 1H11A 5D03A 2BP1A 2J6XA 3QC0A 5HWMA 4MTVA 1BRLB 2FIQA 1YXYA 2BOFX 2VFDA 4RL3A 2VX7A 3ANUA 5AYZA 1HJUA 2E9MA 1P7TB 3E2VA 3LSBA 1V6UA 3A3XA 3VIMA 2XFFA 3WD0A 4DUVA 5D9PA 1S2VA 1V3HA 3EB2A 3HURA 5EB8A 4MZ1A 4AHPA 1ONEA 1JXKA 3TZFA 3OO2A 2W61A 4M80A 2GLKA 2BHUA 2VX5A 1LDCA 3BL3A 4KEUA 5M5DA 2J7EA 4DBUA 1QHPA 3W7LA 4AHQA 5AB3A 5IHSA 2OLSA 2Z7KA 4J9JA 1XIHA 3ATZA 3ZR5A 4IIHA 4PTNA 1BFNA 4MJMA 3BTNA 5DQPA 1UUQA 5I00A 2NUXA 3C56A 3VDAA 2V82A 3P7YA 3T2OA 3MUZ1 3U0HA 2VX6A 4A29A 4LH8A 5GNXA 4RV3A 3QHOA 4M6VA 3A24A 3E1F1 2HSAA 2F7FA 4UTUA 4IPNB 1RQBA 4HQVA 3QPEA 1MUMA 4JCLA 2Q3RA 3OBKA 3OYXA 2BMBA 3WFLA 4WXYA 4URIA 3CH9A 1LL4A 1TVLA 1XD0A 1NJJA 2QR6A 3HF3A 1IV8A 3GZAA 1H3GA 3UXAA 1EKOA 4OBRA 4GLEA 2NXIA 4NAFA 4DUWA 1J8VA 1GKRA 4OU1A 4DBEA 1BHGA 4ZQRA 2OYLA 3GD6A 4DJFA 3SCOA 1EP3A 3IRSA 1WKYA 2EKGA 1UD6A 3GR4A 3GNNA 4AYSA 2PLKA 3G1SA 3EWYA 3XINA 1U5VA 3EMQA 4W9TA 3S2MA 3W7RA 3QKEA 2XH0A 3RU8X 1S5VA 2TYSA 1OFQA 1W3KA 4NT0A 4MZYA 1NDVA 1YYAA 4IX2A 4LUYA 3W1LA 4NRSA 4OE7A 5AHNA 2F2HA 1MQQA 1G94A 4WJ8A 4ZO8A 3LEPA 1BG9A 1SSGA 4CD4A 2Z29A 2RJGA 3IUIA 3QR1A 1I9CB 1R7AA 4CCEA 4DI9A 3MQTA 3W24A 2CETA 1AK5A 5FD0A 3CAKA 3K30A 3VMOA 3TEVA 5TIMA 5I3KA 4O18A 4BKNA 4O15A 4NIRA 4LOCA 1TKKA 1LUCA 5LA1A 3E38A 4EXBA 3FOKA 4PUMA 4UC5A 3PPFA 4QE4A 3ZLFA 2YLLA 3BV4A 4GY1A 1NAL1 4M6QA 4AY7A 5ABHA 4KGJA 4K1GA 2J6VA 3I3EA 1KRCC 4REQB 2ZKMX 8TIMA 3T9PA 1C29A 2PWUA 3F4DA 4PC8A 5LIYX 4IH3A 2DUXA 1W3TA 2W91A 3NQVA 3NTYA 4NAEB 2VFIA 2AOSA 1ZHAA 1SU5A 3RX4A 4M1RA 3T0TA 2DP3A 3QLDA 1YX1A 4B2DD 3SQSA 1OYBA 1GOWA 3GHTA 3GG1A 1ITXA 1WOBA 2XUCA 2V8ZA 4XTDA 3ZO9A 4L6HA 3A13A 1OC7A 3QOMA 2XYLA 3QSRA 3UJRA 2J74A 3QW3A 2NLYA 3C86A 5DRCA 5A6SA 2EPKX 2BVDA 4O53A 4OT7A 5M3WA 3B8SA 3FGCB 1XBZA 2A3HA 4ERGA 1WKDA 3BLEA 2TSYA 2D22A 4GQ0A 4PUKA 4Q22A 1ZAHA 3KBNA 1TPH1 1TA3A 4DLFA 4R88A 4MLJA 1MQPA 1UKPA 2XVGA 2VQTA 4K8EA 4JTTA 2V5LA 3AJXA 4HYVA 4ZL1A 1C8YA 4IFRA 4K8GA 1OEPA 2CBIA 2ZXBA 4LX4A 3UR5A 4IFKB 4ZXOA 2Z00A 1V0LA 1QI2A 2FDSA 2FVLA 3I3DA 1J9YA 3DKJA 3CUZA 1QBAA 4CNUA 3S2JA 3V18A 3DYOA 3L67A 2VCCA 1UW9A 4PZVA 4XVEA 1XLCA 4Q8NA 1UJPA 1Y8BA 1QNQA 3M5VA 1H1NA 3VNLA 3HPXA 3FYYA 1T8QA 3R10A 3ES8A 4C7DA 4HA4A 4Q7BA 5DEZA 2PRHA 3TXZA 3AS1A 3SCQA 1YXDA 3ZVHB 3KS6A 1V0MA 3A4XA 3CAQA 3VX1A 2XM1A 1FH9A 2HVMA 1TPUA 3V5FA 1CI1A 1P43A 4P7RA 1RUSA 4D1IA 2VEGA 2Y63A 1SZEA 4GVHA 1EO5A 1R9XA 2FB2A 3G77A 4FOUA 4GPNA 3LB0A 3UWYA 3FV9A 1TB3A 1CGTA 3RXZA 1M03A 2AQVA 1GVOA 3IK4A 2CLOA 1L6WA 3RX2A 5D9MA 2ZUUA 3PR2A 2CFFA 1BSIA 4C6DA 1CB7B 5LNVA 2ZZ6A 4WF7A 1JDFA 3C61A 5E9AA 4OBTA 3NL6A 4Z1BA 2NQ9A 1OX6A 2CLFA 4UOQA 1EC8A 2EG7A 3VNZA 4DQWA 1U1UA 2WKJA 1F5ZA 3BLLA 1FWIC 3B9AA 1EJTC 3CV1A 1QRQA 1R47A 3EDKA 3WIJA 1TR9A 3B0PA 1AMKA 3OBAA 4UCGA 4NX0A 3TDFA 2QV4A 5JVLA 1KCZA 2FZMA 1B4EA 1K77A 1A3XA 2QGYA 3M41A 4Q8PA 4LU0A 3TTYA 1PKYA 1E0WA 1CXHA 4RE4A 5AYYA 1WXZA 1QNVA 4FOJA 1OZMA 3RDKA 2GSJA 3EMCA 4LBRA 4FP1A 4H7ZA 2QIWA 2QYGA 2E6DA 5DT5A 3S9ZA 3B40A 1BLIA 2YDAA 2Z28A 5G2HA 4XD3A 4PMZA 1DV7A 4IPLA 2ZDRA 2PRLA 1REQB 2P5NA 5I23A 1A5NC 4PH6A 5K3VA 1R3TA 5ABEA 2FLIA 4LY4A 4C60A 2QJJA 2WWCA 5EY5A 1TPWA 4MHBA 3U3HA 2EBNA 4AVOA 4HSOA 3L21A 3WUGA 2Z6JA 3LGGA 1E6XM 2E3ZA 1E1CB 1M65A 3N11A 1G4PA 4MZ8A 3G8EA 4ECLA 2A4AA 1RLDA 4IICA 1GVQA 3GYCA 1HTIA 3AOFA 4IGNA 3BC9A 2O9OA 2HNEA 1G4TA 4H9XA 2XIJA 3HGRA 5EYWA 4Z17A 4GGBA 4KEZA 2FTYA 5I0DA 1B3YA 2O9TA 4AWTA 5LGZA 2R1MA 2GVYA 4WKHA 2WVVB 2X1SA 4QR6A 2O92A 2GGJA 1KFCA 1BXNA 4IOTA 3BE7A 2IPGA 2WZTA 2UV8G 4YWIA 3LUTA 1V02A 3WK1A 4LNYA 4GIEA 1L6SA 1ICQA 3KRSA 1OYCA 1VEMA 4A3QA 3FXGA 4TMBA 1J4EA 1CIUA 2R1KA 3TA9A 1W1B1 2VEFA 2ZRZA 3LTPA 1BVZA 1V0NA 2XGBA 4EP8C 4P8VA 1W1TA 4DJFD 3OJGA 4XK2A 3DBPA 5JQ9A 3DAQA 1W2VA 2OYKA 3LPFA 1DL3A 3TYAA 1EJVC 1GVSA 3QYQA 3OYZA 2QCEA 1JNEA 4O12A 1Q6OA 3TFCA 3U7BA 4OTKA 4LAOA 1FHLA 1NF7A 1V3KA 2XHYA 4GXWA 2VEPA 1JZ4A 3LX9A 2Y61A 2HXTA 4AYGA 5AYIA 3W7OA 3ABRA 4TX6A 5C9WA 3GIYA 2WZHA 3L5MA 3H2AA 3RM8A 4NQ1A 3MMDA 1G9HA 1MDRA 3LGEA 4AEEA 1IIGA 3EWBX 4ML9A 1E9IA 4K7YA 3WFAA 4I3GA 5D9NA 4F48A 2R8WA 3KCJA 4OKDA 3OW1A 3ME3A 3PNZA 1EBHA 4KW2A 5G2WA 3EA3A 3S5SA 1TJ1A 1TZ7A 2VCAA 3QQWA 2D23A 2ZQ0A 3EXTA 4AX6A 4PRRA 2EJAA 2CLHA 2X7VA 3TP4A 4UTIA 4GXMA 3BAXA 3AS2A 4ASTA 3VFCA 3OIXA 1SZFA 4GI4A 2V5JA 4JD4A 5HATA 4MNLA 3NWRA 1OJXA 1YBQB 1RQHA 3H2EA 3OOQA 1ZQ5A 1MO0A 1NOWA 4GCXA 1Q8JA 3W85A 3GG8A 5KINA 4U3CA 1EA0A 1QOPA 4HNLA 4GO9A 1V3JA 5EPDA 3PAOA 3QHMA 2JK2A 3EOLA 4HNVA 1U83A 3BCDA 3GG7A 1R7OA 4FOKA 3KZSA 3U4AA 4GYKA 8RUCA 3UP8A 3KS5A 3ZSTA 4BY3A 4J28A 4D71A 4HCDA 4BI7A 1ZP3A 4TIMA 3CNYA 2J4GA 2X42A 1H0GA 5ECUA 4B5NA 4UQBA 5AKQA 2JE8A 4DXKA 3REQB 3T2QA 5M03A 3MY9A 1E73M 1W9BM 4TVUA 3W7HA 2PTYA 3QN3A 3DC0A 1ZS2A 1KM1A 3MPGA 1F3XA 3W2JA 1UD4A 1W5PA 4Y9PA 4KWVA 3ZIZA 3H70A 3N2TA 2JALA 1K70A 5CLWA 3NL5A 2C14A 5A3HA 3BGGA 2YB4A 3QXBA 4MB1A 1NY1A 3KEHA 4YL2A 5DMYA 3AI0A 3DX5A 4JEJA 2PODA 3VD7A 3BG9A 1OF6A 1TR1A 4IGHA 3ABSA 4QSFA 4QE1A 2BV9A 4XB3A 5FF2A 2EG8A 3GU9A 1CEOA 2Y8KA 3W6MA 1PKMA 1I75A 1SPQA 4V2XA 5FL1A 4C6EA 4H7VA 1OK6A 2NV9A 1HO1A 1KCXA 5D37A 1M5WA 1XLGA 4QRNA 1UH4A 1LOQA 3TTQA 4C6NA 4C6QA 1K9TA 1JCXA 1W54A 3I68A 4Q33A 3F5KA 3GDTA 1WB0A 4PEKA 4RDZA 1D7KA 3TFXA 3CO4A 4FXSA 4DLMA 3U6WA 1VYSX 1WA3A 5CJMA 5J8LA 3TYCA 4Q4OA 3HQPA 4KETA 3WLMA 2WKGA 1O5XA 3GAKA 1S2TA 3DFHA 3H2MA 1V6WA 3MDUA 3NZQA 2VELA 2F84A 1SMDA 1U33A 7REQB 4B92A 4IZGA 2IS7A 3HPFA 1LT7A 3CUGA 3NVTA 5TD4A 4UOJA 1A50A 1XYBA 4LUTB 5JU6A 1AFSA 2W9MA 2JBMA 4M7SA 3WF0A 1R3YA 2WZMA 1PWMA 3ECQA 2PGWA 2JFEX 4GYFA 4ZBCA 3LDVA 3WCZA 1C9WA 4DZ5A 3W6LA 1IEWA 1IQ8A 2QUUA 4JAWA 4TOQA 4GKLA 1GZJA 1VCFA 4BWLC 2H8ZA 5KETA 1UZDA 1QPQA 2R9RA 3BAJA 4P8XA 2UY3A 3H4GA 3MMTA 3DFSA 1GYMA 1PXGA 1B4KA 4XKYA 1PZ2A 1O4UA 2OYMA 3GXMA 3RM9A 4LV4A 4ZQOA 1TX0A 2RGMA 4C1NA 3KOWA 4UZSA 1MNSA 4D2JA 5G1MA 1U5JA 2HRWA 1FXQA 3VNIA 1N82A 4OQVA 3NL2A 1DJNA 1R3WA 1N55A 5LXXA 3P0XA 5DT7A 3VVGA 2J7CA 4OOUA 3W73A 3L66A 2ALDA 3PSWA 1X38A 2QCMA 1LWHA 2YBVA 3KHDA 3CYVA 1RXOB 1FFRA 3PK7A 3AU6A 3LGDA 3S83A 3S1GA 4DF2A 2C3ZA 3W7NA 4PL1A 3F03K 3HV9A 4QS6A 2PC4A 1OWQA 4M5PA 5HQMA 5D09A 1FWAC 1W9DM 1HL9A 6REQA 4PFHA 2GOKA 3CL8A 4NX5A 2F6KA 2ZWZA 2DV0A 1XIBA 1C8QA 2NX3A 1IWPA 3FFSA 3VIPA 3ZR4A 4KWWA 3GW0A 2V0TA 3GDMA 2XZ9A 4HA1A 3A47A 4MB4A 1XSIA 3UXIA 3HM7A 1HO4A 1NFBA 3FDGA 3AYSA 2OU4A 3GXTA 4AD1A 2PD5A 2X09A 3IGXA 3LTSA 3PS7A 2DT1A 4HCHA 4ZQPA 3MHFA 1GG1A 3ABZA 2DSKA 4K2SA 4WKAA 5JBDA 3EA1A 2E7FA 2RJHA 4U5IA 4IP5A 1EL3A 3APYA 4QDPA 4JN7A 3UYCA 5B80A 3GG0A 2C79A 2ANUA 1P0BA 3KBVA 4DF0A 3TKFA 4GH1A 4ALDA 3OQ8A 1M3UA 3SCUA 1J5SA 3M9YA 3GS6A 4QGCA 1AQ0A 4W84A 4IJCA 3ARTA 3DG6A 1EOKA 4LUIA 1US0A 4Q4PA 3OU8A 3GHUA 1QTWA 4KGLA 1EGVA 2BXVA 3AUJA 3PB2A 4Z2HA 4JTJA 3PZVA 3PUDA 4Z1DA 2BLEA 3EKLA 3B9OA 4RZ6A 5SWUA 3HG4A 3KBJA 1Q7MA 2VRKA 5HMEA 2ABBA 3W00A 4JTHA 3A5FA 4EKJA 3BICA 3QPYA 2Q8LA 3V0UA 1XLKA 1XD1A 6PTDA 1OADA 2H90A 5FSEC 5PTDA 1HVXA 1PSCA 2PFHA 2BXYA 4J35A 3O63A 1FWTA 2ZX9A 3DYPA 4P8UA 4P5UA 4NZ4A 2AGKA 4HK6A 3UA4A 4S2CA 4W85A 4K6AA 4KIEA 2ZUWA 1C91A 3PUEA 2OB3A 3WQ8A 3TQ0A 1Y5WA 3WMCA 3CPGA 3N3MA 4OJYA 1GOXA 1ODZA 5CPOA 4FNTA 1W5MA 3EDJA 4BEQA 3PZNA 2XJ7A 2QCDA 4MYAA 2VGIA 4GA8A 1VJIA 3FNDA 1CLVA 2VOTA 4UTWC 1ZCOA 2WC4A 3OA3A 2Y0FA 3SECA 1A53A 3FCPA 4XZMX 1ZBVA 4Q7NA 1ISXA 3PTQA 1EIBA 2PDWA 1A5OC 3U8GA 1HZYA 5D9OA 3A3WA 4EPKA 1FP8A 2FTWA 3W1AA 3K1GA 4Z1AA 4WQ6A 2XM2A 4C6IA 3UZXA 2BGQA 4F0HA 1DOSA 3W1MA 3CHDA 4A3YA 4J2PA 2PWGA 3HQ1A 4F2UA 3EKGA 1I0DA 3E0IA 3W01A 3QR0A 2ACUA 4MB3A 1IEXA 1YPIA 2J8TA 5T9CE 3EXRA 5CSUA 2DT2A 4IXXA 1P1XA 1HKWA 5I07A 4O10A 4GJIA 4ZR8A 3TJ4A 1R30A 3ARYA 2WJEA 2J27A 3PULA 1YPFA 4GI9A 1M7PA 3QRHA 2WJDA 3PSVA 5JIWA 1GT8A 3WSUA 1H2JA 3VX0A 3R8HA 1X1OA 2GUUA 1AH4A 2Z24A 1J0IA 1RJRA 4GOAA 2NV1A 2GGIA 5FESA 1SW3A 4F0KA 2JF6A 1UUOA 3GVQA 1JDCA 1EFZA 3NDZA 3H7UA 5CC6A 1C90A 5AC4A 4TX9A 3CB8A 3V3WA 3CZEA 3WMLA 1MWOA 3C8FA 2PGEA 3DUGA 5I03A 3WNMA 1M7OA 5AHMA 2AQOA 5FIPA 1XX1A 2Z1WA 5CZJA 2TMDA 4ATWA 1YQ2A 2B81A 3N2XA 1Z6KA 1KM0A 4DZAA 3EX4A 2C1IA 3CHEA 3WF4A 1JPKA 2O9RA 3UXDA 4M56A 1SO5A 3ZJKA 5IFPA 1EJSC 2PP1A 3SN1A 3H26A 4O0QA 3UGRA 4JDYA 2VUNA 2VR2A 4JTEA 4ZOCA 1OG0A 3W75A 1KA9F 1AG1O 1LWJA 2QULA 2O0TA 4V33A 3GDKA 2DZUA 4S3FA 2W4XA 3QSTA 2V5CA 3UVIA 3OA5A 1XYMA 2DIKA 4ADSA 1BWKA 1POKA 3ANVA 2TODA 1PDYA 2VEIA 4ZQCA 4FZIA 1UWTA 2Y1HA 4QJ4B 4L6DA 3G3MA 2CITA 1J6OA 3VKCA 2FGLA 4KFNA 2ZUVA 1WBHA 1TV7A 1S1RA 3N19B 5A8OA 3SDOA 1MEWA 4NU7A 2TRSA 5C5YA 3LOTA 3TW7A 2IXUA 4PUEA 2BVYA 4RLIA 1OGGA 1SR9A 5CC3A 3EAUA 2Q09A 1FHUA 4QG9A 3HJEA 3OGRA 4PL2A 5BWAA 1XH1A 3M44A 3A9BA 1NF0A 4G1NA 4A8RA 4PB4A 4GE8A 1AVAA 3WQFA 1JZ8A 3EDEA 2QQ6A 1K9FA 5DXYA 1QPKA 3U5UA 3FVDA 3CEUA 2Y7EA 1OBAA 1E56A 2Y6ZA 5BOOA 2HVOA 3KRZA 2A79A 3WUEA 3ZWTA 4IMEA 2QUMA 3W2NA 3FLUA 1YNQA 1JGMA 3LM3A 4JIRA 4JHOA 1H1ZA 3RLHA 1M53A 3MUIA 1SW0A 5H8PA 1KTBA 2Z2UA 1W3LA 4HTBA 1C8VA 3RUBL 2ZZ3A 1BPLB 3P74A 5AHFA 1MZHA 1O66A 4WSHA 1TCDA 3G0UA 1BD0A 3VD3A 3NYDA 4QP0A 1I0BA 2RAGA 1XSKA 3IGUA 1L2QA 3FW6A 4UFIA 3WLTA 5LXEA 3CASA 1ZJAA 1EGZA 3DH7A 2ATSA 4PR4A 2QW5A 3F4NA 1MFUA 2J75A 2XSXA 3VD4A 2WJZA 3RRAA 4DNHA 1JG9A 2P76A 3QBUA 2H8XA 2WHJA 1AMYA 1DWJM 2QPUA 3LBOA 1XDJA 4G8TA 1JYWA 1FWWA 2WBGA 3WBWA 3NQ6A 3OVGA 5MF5A 3LU2A 2J88A 4MWAB 3IVSA 2HISA 2BNJA 3UBPC 5H6HA 2FVKA 5D4YA 2PTWA 5CG7A 5E93A 3PG9A 2QCCA 2VWTA 3LV6A 4JIQA 4S3CA 4UR7A 3LM7A 2FPTA 2GGHA 4YNGA 3DBNA 4XAYA 2VR4A 1RY0A 2VUYA 1IHIA 1TZZA 1S38A 3CV6A 3BPWA 1AODA 3FKKA 4DJFC 2OKTA 3N18A 1L8PA 1UD3A 3VKAA 4ONVA 1OVDA 1ODUA 4K68A 4O1EA 1XIMA 2RDXA 4JN8A 3CK5A 3PFMA 4FNQA 1F07A 1H5YA 1Q63A 5HAOA 2D20A 3GNOA 3GK0A 1OD0A 2DIEA 4BA0A 3S1UA 4HZ8A 4JTCA 1FKXA 1R3SA 1KO0A 3R8RA 1F73A 5J5DA 1A5BA 1MW2A 5CAHA 3HA1A 1RH9A 4X9SA 2VVSA 2EPMX 1JGIA 2PWVA 1J18A 4FNUA 1OINA 4M6UA 4TVCA 1XV8A 3CTLA 3PZQA 5CC7A 1PKLA 1RVKA 3L4XA 2E8ZA 2PWHA 1SFTA 1F3EA 2BOGX 2G41A 2X0YA 1SM9A 4AZ7A 3NCOA 1XDMA 3GNXA 3GUGA 3IS4A 4C6KA 2FMOA 4QAWA 1K7EA 1YE6A 3UESA 2YB1A 2Y24A 4UQAA 1UKQA 3M0IA 4B5UA 1SO6A 1KBBA 3HFTA 2PDPA 3SR7A 1WO2A 2ZZ2A 1NH6A 4W5ZA 4A05A 1WDDA 3PJWA 2PDHA 4IG2A 1EP2A 1OD8A 3EKZA 4MLRA 5A2CA 3EWXA 4BFAA 3OVRA 1GCYA 2Q6ZA 5EMMA 4GIAA 2C1HA 1LG1A 2C19A 1F74A 4CNOA 1UPPA 1KRMA 4AG0A 4Q8WA 1FP9A 1GPFA 3AISA 3SEPA 4E3TA 4AQLA 3LHWA 2VZOA 4XSMA 2ZTJA 4KCWA 1VB9A 3BSMA 4Y9MA 4DJDA 2WKLA 1VYRA 2XISA 5C9UA 3PJUA 1IZCA 2E67A 4DIAA 1EH9A 1UKSA 2PDGA 3GZ3A 3TOYA 3L4TA 1NTHA 1ZCCA 4JZ5A 4LEQA 3VUSA 3VZXA 3IIVA 4BK9A 1PHWA 2J8FA 4EWND 3AXXA 4J1OA 3EA2A 1G4SA 3BV7A 2XDFA 1TQJA 2Y85A 1UIPA 4YPJA 3TW6A 4ACYA 1D7FA 1HGWA 3WN6A 5A6KA 3GU2A 1DWIM 3NL3A 1RLCL 4XO6A 1I1WA 1UOKA 3HPAA 3I10A 1QASA 4C5ZA 2CHNA 5DELA 2PDNA 1R86A 4DBDA 2CLLA 3EDDA 4EANA 1I6NA 5D2WA 4M29A 1R3VA 3H54A 3NSMA 4OZOA 1VFFA 2EQDA 1XS2A 1QNPA 1XF0A 4M82A 1DVJA 3QMRA 5HULA 4JYDA 4L1GA 4Y6GA 2PDIA 3F2BA 3DG3A 3CV2A 1S2CA 4XV0A 3HIJA 3MI2A 3G1YA 3CXOA 1SVDA 3APGA 2QVNA 1SUXA 4L6OA 2VYOA 3OTRA 4HYRA 2XIOA 3VK5A 1J5TA 3PP7A 1VFOA 5AOUA 1S5WA 4JX6A 3R1ZA 3ANYA 2WMKA 3M0ZA 1GHSA 3ERPA 1NWSA 1QU4A 2IKHA 2FGZA 5XINA 3P3BA 3DOPA 3AAMA 5FJOA 2YXGA 4AFYA 1XIIA 1JCLA 4KS0A 5CSSA 4I6VA 1XLEA 2V68A 4NZCA 2AKMA 3DECA 4NRRA 1OCJA 2VR5A 1XG4A 4ZFMA 3PF3A 2AAAA 3IWPA 3GB6A 2V67A 3O3RA 3LNPA 1UQYA 3UY7A 1KKRA 2EG6A 5D2VA 4IP7A 3QC3A 4ZA0A 3VM7A 3UETA 4CQ8A 5I3HA 1B3ZA 3CZ8A 3JU2A 3P82A 4H01A 5I3GA 3WNKA 2PDFA 1PS9A 1F8MA 2BGSA 3MTWA 1Q65A 4AWSA 3MUAA 2HXUA 4PCNA 3TIMA 1TTIA 2WSQA 2D2HA 4FLSA 1CPUA 1Q85A 4LV9A 3M5ZA 4BF9A 2UY4A 5T8GA 3D47A 4KCUA 1UBSA 3GHRA 5G2IA 1PPIA 2WNQA 1SFSA 2DZSA 2FB3A 5CZTA 1R9YA 4C91A 5AZ1A 2PD9A 1YTKA 3U7VA 2E6YA 1XL9A 5LZLA 3H7VA 5FAJA 3KL0A 4B5WA 4GZJA 4IMCA 3AS3A 2A7RA 3UA3A 3W76A 2BY1A 1U2YA 5EFFA 5G4HC 1L2UA 3TTOA 3S6TA 4R27A 1H09A 1JZ6A 4QM1A 1W3NA 1DWFM 1RR2A 4JTUA 4AY1A 4QROA 3AYVA 1WOAA 1E55A 1ZY9A 3FAXA 1TWWA 4FEZA 5A69A 4I7WA 3R8GA 2GFTA 2WANA 2OGYA 3G18A 5HR7A 2IPFA 3BJFA 4FAMA 3TK7A 4E2VA 2IKIA 1EUNA 1PL9A 2IXVA 3CMFA 4S3BA 2WNNA 3T42A 1TJ2A 1CXFA 3W6YA 4HHMA 3S42A 5KZMA 4TO8A 3RHGA 2NVCA 1QNOA 3NVDA 4K1WA 3DFTA 2BY3A 4H9YA 2YKKA 4LAZA 4Y96A 4AMAA 3K5XA 4EIVA 2BFGA 3HN3A 3N2BA 3E0FA 3SCVA 2QJHA 3PUOA 3CL7A 1E70M 1AH3A 4XBKA 4KCTA 4PTDA 3WL0A 1PZ0A 1I45A 2REQA 2V2HA 4N7QA 1S39A 2F6XA 1FOBA 3TJLA 3G22A 5HMFA 2PDBA 2Y7FA 3O6AA 3MU7A 3SN0A 3ID7A 4C6JA 3E74A 5BXTA 2HDJA 2IQTA 1DQWA 3DHDA 2C7FA 5AYXA 4DY1A 1V4YA 1UUMA 2WMIB 1HXJA 1IEQA 4NNCA 1W1YA 3M0MA 3TN4A 3VOIA 3BJSA 3S8HA 1FWSA 3UCQA 3ZM8A 2WV8A 3W02A 1LJYA 3CUIA 4R3UA 2V9DA 1E5JA 2CU0A 5HR6A 4N42A 3F5JA 2A0NA 2EXOA 4Z1YA 4NSBA 3NYZA 5C54A 3CHVA 2BY2A 1P0NA 4ZMGA 3LZ3A 1LF1A 2E0PA 2G3NA 1Z32X 3MJYA 1GOQA 4FR1A 3SB0A 3ARUA 3E02A 2V3FA 3G3DA 4MIMA 2DZPA 1ISVA 3B8WA 1JPHA 3IJQA 3K4WA 3G5EA 3GNDA 2QJIA 2CZFA 1TO3A 5E0CA 3L5AA 1XQLA 4PBEA 4O54A 1ONWA 3GR7A 4FK9A 4MB5A 3WDHA 2GVJA 4ILSA 4PMUA 2J8GA 3DFOA 3NPXA 4JTRA 4AD3A 1IEVA 4CLMA 3D46A 2ZCGA 1V6TA 3OP2A 1HL2A 3PWAA 1Z44A 3ARWA 4DZHA 2FHCA 2VC5A 3MCOA 1E6SM 1VEPA 4PTXA 4IL2A 1JUBA 3ZJ8A 1KBLA 4Y9OA 4MFEA 3DG7A 3W1QA 4JIPA 4PMRA 4TUFA 4XG1A 4GK8A 5K4XA 1WE5A 2PLMA 3P8JA 4GNKB 4L56A 1HKJA 2A3CA 2GQ3A 4J2MA 3VNKA 4LBUA 4XAPA 2OELA 4WGXA 2WSKA 4AZHA 5T26A 3KFTA 4DF1A 3C2RA 1BTCA 1E71M 1HW6A 5M1TA 4EAYA 3H2CA 1QW8A 4H8HA 3LBCA 4L9XA 6ENLA 4CNTA 2HZGA 4CQBA 1W1A1 4ZSTA 1UYQA 9RUBA 1MSSA 4I9TA 3GM8A 1KLZA 3U2CA 3GY1A 3GTNA 2ZUNA 5HQLA 1DJQA 2V6AA 5C2CA 2YR1A 1A5LC 2O4QA 1XLHA 3EX1A 5A6TC 4U4MA 4ZB0A 1VP5A 1EB3A 4AY8A 5MKGB 1OCBA 4BQ2A 5D38A 1LOSA 1FWBC 4L64A 1KFJA 4UFLA 3LYEA 4FS9A 3I6RA 1V02E 3TN3A 1KFWA 2VDIA 4E8GA 4H2CA 5K9XA 1KXQA 2GGGA 4Z1CA 4XZLX 2PS2A 1JCMP 4WX2A 2QS8A 1JCTA 1CGXA 3BDKA 4RK8A 3IVUA 2YL8A 1LQ2A 4MKNA 2VZSA 1NARA 4XISA 4QQ3A 1LRTA 1EBGA 1MUWA 3SCNA 3N2MA 3UJ2A 3OBEA 2OKOA 4JQ1A 4RDWA 4E38A 3C0LA 2WCGA 3W0KA 4WR3A 2V63A 2CZVA 2OCZA 3XIMA 4IQDA 3W27A 4CEUC 2Y88A 4GD0A 4C6BA 3JW7A 2OO6A 3H24A 4JTGA 4QSHA 1AJ2A 1QT1A 3MC5A 2NQ5A 4E4UA 3KBSA 3BARA 4E4FA 3MMUA 1V03A 4OUEA 3RG6A 3F4WA 4MNJA 3CTTA 3BCJA 4EAMA 1G4EA 1T0OA 5CH9A 2FPYA 2FQIA 4QFUA 2OQLA 2OJPA 3MI6A 5A1AA 2IMRA 3EXSA 2WSYA 1C7TA 4W5UA 1IT0A 4B3KA 5CPNA 1IXNA 3GKFA 3EPMA 1EEPA 2YA1A 4E3VA 2OWWA 4AVNA 2WSRA 1E0TA 4RXFA 2BG5A 1F3WA 1CECA 1QVBA 3CMGA 3LCGA 4R7JA 1YIXA 4H6EA 4MAVA 3QZAA 2OZTA 4MMWA 3M16A 2EKCA 3TOPA 2ZVIA 2R94A 1X6LA 4MOZA 1E9ZB 1MEIA 3IACA 4PODA 3IV3A 1Z89A 3R2GA 4PCPA 3CAWA 3OLGA 3L4ZA 1EF3A 2NWRA 3RR1A 3CV7A 3SY8A 4ORIA 3KWSA 1N7KA 3UCDA 1B3OA 2JF7A 1RBAA 5JMUA 3AWNA 3STCA 4GNJA 2X16A 4JYFA 1LOLA 4PB5A 2WLYA 7ENLA 2JIWA 1XIGA 4P8WA 4G2DA 4WGHA 3UU0A 4ADTA 3WQVA 3ITGA 2EO7A 4DJED 4U10A 3BUVA 1OFPA 4LVGA 3AZRA 2YA0A 1UJQA 5I24A 5KEZA 2I5IA 4CN1A 2VC6A 3ZR6A 3AHZA 3HOJA 1FDYA 2Y70A 3GDBA 3N4EA 3L4WA 1N8FA 1L6YA 4XZNX 2EEXA 1K8CA 3CC1A 2D69A 1DE5A 3NGFA 1DORA 3ZVIA 1Q2SA 1HKVA 2CBVA 2R6OA 3M0YA 1DQUA 5JH1A 1KLYA 2R91A 1KTCA 3V1HA 3KVKA 1R6WA 2NXHA 1JFHA 1P6BA 5TNVA 5AY7A 3ARXA 2YCKX 1OSEA 3KZPA 1P1MA 3AIQA 2YL5A 4KQNA 4QG6A 4AIBA 4YYFA 4HMDA 3PJTA 4FX8A 3T8LA 1XIDA 3AQUA 1UR2A 1W17A 1OFEA 3T78A 3W1UA 2GJXA 2C91A 3PBGA 4P7QA 4XO7A 2ZA2A 3SURA 4QIUA 1VFMA 1E51A 3BAYA 3T05A 4H2HA 5LNRA 2FHBA 3TH6A 1K1DA 2W6RA 4HZMA 1BRLA 3WDRA 3POCA 1P7TA 1R2SA 4JQ2A 2QJMA 1TVNA 3O07A 4L1WA 4NILA 4DM1A 2NX1A 2QUNA 4LFYA 3CPUA 5C55A 2GWNA 4AH7A 3P14A 1JJKA 3T40A 5F4WA 3SUVA 3I4EA 4W4QA 3DIPA 1W3IA 1M6JA 2Q8ZA 1ELSA 4GGHA 3AO0A 3MJMA 3PBWA 1E6RA 1IR1A 4WOQA 1FFQA 1AJ0A 1BKSA 1EC7A 1UC4A 2FYMA 4H6KA 3TAKA 4AUBA 4O28A 4MPQA 1PX3A 1PIIA 3V75A 3W37A 5LIUX 3FSUA 4L65A 4I6KA 3BW4A 4UQEA 1VCGA 3QFWA 1EC9A 1VKFA 3MYOA 4R7WA 1M9HA 2H9AB 4QDMA 1Q6QA 5J04A 3DXIA 4AXKA 5I06A 2EF9A 1QPOA 2VXNA 5I78A 4S3DA 5D04C 5T9BG 3I7QA 1JQVA 4ML4A 1R3QA 4DXXA 3M5XA 4ZFCA 1XM3A 4J5NA 3WNLA 3TN6A 3KTXA 3W1RA 2GK1B 1WUFA 2PI6A 1OFAA 2E9LA 4CN6A 1WZAA 5FOOA 4MVAA 2VDHA 4AZIA 3LHTA 3TJXA 1QO5A 1H7XA 4LB4A 2A3AA 4E8CA 4YS1A 1FWDC 4B91A 4A8LA 1B0IA 1HG3A 3WNPA 3N34A 1OX4A 4BQ5A 1CXKA 1T41A 1DWGM 3NQ8A 3USBA 3EB3A 3WLKX 1GVRA 1T5AA 1WDQA 4FPSA 2CWXA 3WQPA 1AZ2A 1CXIA 4YTQA 5D32A 1EZ2A 1OB0A 2WVUA 3O8AA 4RKAA 4EWJA 3AMCA 3SW6A 4DAIA 2YDRA 4I8DA 3FAWA 1WCGA 3MO7A 4AF0B 1CX9A 1Y5VA 3R0UA 3SM0A 1PDZA 3V5CA 4UNIA 2ICSA 3WL1A 1QNRA 2BHYA 3M7WA 1PIFA 1XLMA 2VEMA 3VD9A 3UG4A 2HK1A 1KFLA 4GUFA 1R5YA 3B05A 4W87A 2X05A 4UNLA 1HX0A 1NWTA 1A5UA 4WIWA 3W28A 2HBVA 5A2BA 4JKKA 1PTGA 1ZGDA 1UKTA 3IRDA 2FH6A 4E2DA 2PLJA 1W3HA 5DCEA 3WQCA 2INEA 3W38A 3C2VA 3MV11 3VPLA 3W25A 5E6YA 3CWHA 2X1UA 3KXQA 4GJJA 4REQA 3WQWA 3LCFA 3ICJA 5BXSA 3BAWA 2GL5A 1GHRA 3N9RA 5EMUA 1ZTVA 3TE9A 4M8UA 1JDDA 4NAEA 1XBVA 4TXEA 4FR6A 4PUJA 3FJLA 4JBRA 4UTWA 1FDZA 1E15A 4U5KA 5CXPA 4B15A 1S1PA 2WZEA 4LC6A 3GBDA 3K13A 4L4OA 3KVJA 5BMWA 3ITOA 1YDVA 4GI6A 2PBGA 3W84A 2ZE3A 4GX9A 3N4FA 1PUDA 1V7YA 4L4PA 4KKXA 4JEQA 3A6OA 4NYUA 3NDYA 3FGCA 3RLUA 4DI8A 3U4FA 1N2VA 1MYRA 3MP3A 1LBLA 3MUCA 2DU2A 3MW7A 1EP1A 3P84A 4RJEA 1FWNA 1GONA 1GVYA 3OGSA 3E2RA 4HIBA 3I7SA 1R85A 1DJWA 3QV8A 2E68A 1RA5A 5LSMA 1WDRA 1QOXA 4HK5A 4CQCA 4H8VA 3HQNA 2Y8VA 4IFKA 5EMKA 1DHPA 4DWSD 5FAGA 4PRTA 1EHNA 2F6UA 1Q6LA 3BMWA 4RUBA 4L1XA 4MY9A 4N4QA 1U1JA 1XKYA 3AIUA 4K39A 2JGQA 4DVOA 4HCLA 3VTRA 3MSGA 2I56A 3VIIA 3WNOA 4H41A 1FWHC 4ZOBA 1QW7A 2JGYA 5HNNA 1PVNA 4QE5A 1K8YA 4FSAA 2WPGA 3W2LA 2RUSA 5A6JA 1QBBA 3ONBA 2QCDB 4H19A 2POTA 3VABA 1RBLA 1NDYA 1R87A 4JX5A 1E72M 4Q4MA 2GYIA 3KDOA 3NGJA 2GUBA 2C16A 4DWSB 2PE4A 1I4NA 4Q6XA 1FWEC 3UXLA 3TC7A 2Q3OA 2DH2A 4YXGA 1FTXA 3LV5A 3BQ5A 3VM5A 4WJEA 4NASA 2A7PA 4AIOA 4O19A 4JR5A 1AH0A 3N14A 4G9PA 3NDOA 3AXIA 1W0MA 1FWFC 3PHAA 1ME9A 4ZENA 5CC5A 4JHZA 2DORA 5GJMA 3R0DA 3AZSA 3GFYA 6CGTA 4Z2IA 4XAGA 2D1ZA 1Q2RA 4FXRA 4ZE5A 3P81A 3W4RA 2XH7A 4LJ3A 4C6CA 1KW1A 5HNUA 1SZRA 1ALDA 3S5NA 5DY3A 1EDGA 3KLLA 1M68A 2XG9A 3WLOA 2FZ8A 3K2GA 5F4SA 1T99A 5AN7A 2AL2B 3H12A 4D6DA 2VFEA 3N15A 4H6RA 1B1YA 2E5DA 4ZVJA 3PG8A 1OFDA 4W8AA 4JIHA 1WZLA 5HQEA 1GZ1A 3GNRA 1MW3A 3FJ4A 3W22A 1HKMA 3RYSA 4NG3A 2P88A 1DQXA 1ZNNA 1S3TC 3MVIA 3K8LA 2CESA 3CZLA 1XBYA 4MY1A 1JIBA 4U2ZA 1BF6A 2ATMA 4CN4A 2W62A 2FZBA 2GSEA 2UY5A 4WDXA 3AU2A 4HU0A 1REQA 3IJ7A 3V5OA 4XQ6A 3HJZA 1T7LA 1TWDA 1W32A 3RF9A 1RPKA 4JTSA 4FMVA 5D05A 3NUKA 1I8JA 3HV8A 2ZZ7A 1VLIA 5EFDA 1WX0A 1SFJA 3RO8A 3WLRA 2RDWA 2GVEA 2WW5A 4PA8A 1EX1A 1GKPA 1JDAA 3KM8A 1HJQA 3TSMA 4H1ZA 3AMDA 3L2MA 2F8QA 3AXHA 1O5KA 4RW5A 3QV6A 1C3FA 3S1WA 5FEXA 4HJWA 3G6LA 1PZ3A 4H3DA 3MKCA 3TTEA 1FWRA 2OR2A 4HN8A 4N9EA 4CCCA 2QCHA 5I2UA 4C7GA 3AMLA 3NQ7A 4FF5A 1LT8A 2AMXA 3T6CA 2WVVA 1UIOA 1OT2A 4J3SA 1KC7A 5AC8A 2OEMA 3ALFA 3NZ1A 3QZEA 4J4KA 4M7TA 1KBKA 2OLHA 4H7CA 3PPHA 3TAOA 5LGXA 1LL6A 2YCLA 1A0DA 1E0VA 5CZKA 4H8UA 4UIOA 5CPLA 1GYNA 1Q6EA 2ZRXA 1HVQA 2CLIA 1TV5A 2ZZ4A 3EEGA 3P60A 6XIMA 3URAA 3T1GA 1V7AA 1VS1A 4PMOA 3QMSA 1IEIA 2ON3A 3CQ0A 5BXRA 1DJHA 5XIMA 4UXDA 2VCBA 2CHOA 1TTPA 1EX5A 3DZ1A 2P53A 4KRZA 3THDA 1G1YA 4S3JA 5EGRA 2HPMA 4KBXA 4DJDC 3IUHA 3LI0A 2IPWA 3MKVA 3QFEA 2I5GA 2VRJA 1TTJA 2V5DA 2FMNA 2OLAA 2X1IA 3B9EA 4UB9A 4WVXA 1ENUA 3NR0A 3VD5A 2V3EA 2XTKA 1HFBA 5HJYA 3TYEA 1GZGA 3FEQA 3EPNA 1TRIA 2RDUA 1GEHA 3PZ9A 1VFSA 2VO5A 2JKEA 1Z48A 3NNTA 5D02A 5CPQA 1B5TA 3LQLA 3EOUA 1I2OA 4GWEA 3NQ2A 1GW9A 2BS9A 3NM1A 3RCMA 4FNSA 1E4NA 1V6VA 4QDWA 2PA6A 2OWXA 4EF8A 3WZ0E 3CQJA 3SGUA 3ISIX 1YBQA 4Y8FA 2ZC1A 1UR0A 3U57A 3UEQA 4E2OA 2DZWA 3E12A 5CBIA 3GX9A 1E1EA 1DPMA 2VM8A 1VCVA 5CJNA 2AAMA 3QQ1A 1A4MA 5CZSA 4CVUA 4O0KA 3GC4A 2X40A 3VZYA 2V69A 3WEZA 3K8MA 1VRDA 1G6CA 4RZ5A 3RJYA 2QDEA 3QPZA 2GQ8A 4CQ9A 1XXXA 1BYDA 2FZNA 3D6NA 4R34A 1CTNA 4PYSA 4AZCA 3WY1A 3T4WA 1X8CA 1CXEA 3NA8A 4GZEA 1ZBCA 1SYTA 3BMXA 3VZZA 1PAMA 3REQA 3TJIA 4Y2WA 2ISWA 4JN6A 3B8UA 3BWWA 1FCBA 2J7HA 3OQEA 1NQKA 1Q5MA 2YFOA 3GXDA 3THQA 5H1WA 3WH7A 1WAUA 3TNBA 3VDGA 3TWAA 4E6MA 4Z2LA 2ONEA 3TQPA 3AS0A 1SZGA 3M0JA 3IPWA 2EPOA 4HHPA 3G1XA 4YCPA 5DLCA 4GY0A 4PRWA 4AC1X 2G4FA 3BZGA 5GPRA 1IE7C 3G0XA 6A3HA 3VMNA 4WY0F 2VFFA 4XKMA 1QI5A 2XZ7A 4U28A 1RSCA 1D9EA 3DEQA 4WSKA 1VHCA 4N0RA 1N8WA 2O4MA