4JTRA

Akr1c2 complex with ibuprofen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of NSAID selectivity for the AKR1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtrA00
5C7HA 1EF3A 2HE8A 5LIYX 1LWIA 3UYIA 3G1RA 4EXAA 3V36A 3N2TA 5KETA 3GUGA 1AFSA 1HQTA 3B3DA 4FZIA 2PDQA 4FALA 4XAPA 3ERPA 3CV7A 3WBYA 4PR4A 4WDTA 3LEPA 1ZGDA 3ONBA 3GHSA 4HMNA 3H7UA 4Q3MA 3UFYA 1PZ1A 2F2KA 2WZMA 3COTA 3V0UA 4Q7BA 2PDYA 3R43A 4WDWA 1YE4A 1ADSA 3GHRA 1MI3A 5LIUX 2IPGA 5AZ1A 3UGRA 3BV7A 3N6QA 1PYFA 5HNTA 4ASTA 4XZIA 2AGTA 3O0KA 1RY0A 4XVEA 2IPFA 4IJRA 4G5DA 2CLPA 2PDXA 3KRBA 4XO6A 3R7MA 2ISFA 2R9RA 3CV6A 1ZSXA 2I16A 2HVNA 1K8CA 2PDWA 3D3FA 1Q5MA 2IKHA 3V0SA 1S2AA 2IS7A 2PDPA 5AZ0A 1T41A 4XZMX 1OG6A 5LIWX 2FGBA 1XF0A 5LIXX 2ACRA 4XO7A 4WRHA 3C3UA 1RALA 4LAZA 4EXBA 3Q65A 2PDGA 1YNQA 1MZRA 1EXBA 4H7CA 2PDLA 1S1RA 1VBJA 4YVXA 2PDHA 1FRBA 4DBWA 1UR3M 4L1XA 4PMJA 2IQ0A 4LB4A 5LIKX 2PDNA 1T40A 2NVDA 3UZZA 3S3GA 1Z9AA 2C91A 2NVCA 4PUUA 1X98A 3LQGA 2IKIA 4JIRA 1EL3A 4JIIX 3LBOA 4PRTA 2DUZA 2A79A 3WBXA 1YNPA 1RY8A 4JTDA 3GHTA 2PD5A 4QBXA 1QRQA 4WDXA 4YS1A 2PDUA 2P5NA 3BURA 1X97A 4MHBA 4XZLX 4GA8A 4GIEA 1PWLA 2INEA 3M4HA 2ACUA 5JH2A 2PDMA 3EAUA 4XK2A 2I17A 4PUWA 3R6IA 2WZTA 4AUBA 4DBUA 1VP5A 3RX4A 2HDJA 2IKGA 1S1PA 2HV5A 3R94A 4PRRA 3Q67A 3LN3A 2FVLA 4JQ1A 3BCJA 2DUXA 3RX3A 4ICCX 1SM9A 1S2CA 4YU1A 4JTRA 4NKCA 2HE5A 1C9WA 4XVDA 1AH0A 3LZ5A 3UZYA 3H4GA 4DZ5A 5JH1A 2QXWA 3FJNA 4FAMA 1LQAA 3UG8A 5M2FX 3DOPA 4GQ0A 2FZBA 1EKOA 2VDGA 2BGSA 3FX4A 4XZNX 4JQ3A 4QX4A 1PZ0A 1PWMA 4QXIA 3LQLA 2HVOA 3LUTA 3VXGA 1XJBA 2INZA 3CAQA 3V35A 4H8NA 1AZ2A 2PDIA 3WCZA 1MRQA 3CMFA 4JQ4A 4FA3A 3EB4A 3LZ3A 2IPWA 2PDBA 4JTQA 4ZFCA 3O3RA 3UZXA 3NTYA 4IGSA 2DV0A 4HBKA 3M0IA 4LAUA 3QKZA 4JIHA 3P2VA 2ACSA 4DBSA 4OTKA 3LNMA 2ACQA 3LENA 3DN5A 2HEJA 2IQDA 4WGHA 3H7RA 1JEZA 1YE6A 3EB3A 2R24A 2PD9A 3UP8A 3WG6A 2PDFA 1GVEA 4GQGA 4L1WA 4YVVA 4XZHA 4JTAA 1AH3A 3UWEA 1IHIA 4RPQA 1ZUAX 4GABA 4GACA 3WBWA 2FZDA 3R58A 4JQ2A 2IKJA 1XGDA 4R9OA 2PDKA 2IPJA 5HA7A 3F7JA 2BP1A 3BUVA 3R8GA 1M9HA 1A80A 5DANA 4LBRA 2PDJA 3U2CA 4JQAA 4WEVX 3ONCA 2PF8A 3MC5A 4LB3A 1Z3NA 4JTCA 1IEIA 1HW6A 1R38A 3M64A 5HNUA 1Q13A 2FZ8A 4GCAA 1Z89A 4IJCA 2F38A 3G5EA 1Z8AA 1X96A 1US0A 3V0TA 2PDCA 1QWKA 4LBSA 2PFHA 1AZ1A 2ALRA 1AH4A 3LD5A 2FZ9A 2PZNA 2PEVA 3MB9A 4WDUA 3R8HA 3CAVA 4I5XA 3T42A 2J8TA 3RX2A 2BGQA 1J96A 3CASA 3UZWA 4YVPA 4F40A 1ZQ5A 3GHUA 4QR6A
chains in the Genus database with same CATH superfamily
1EO5A 1H7PA 2QJMA 1EX1A 2XVGA 2YXXA 1HJSA 5L6UA 4AYGA 3CQ0A 3HJZA 3QY8A 4JBRA 2WSKA 4GI6A 4YLWA 1BTMA 1KFBA 2C18A 3BW3A 3GYCA 1AQMA 2WHLA 3H23A 1DHKA 3ERPA 1V77A 4FMVA 3T81A 3PSWA 1EJTC 4CUCA 3W1MA 3HGSA 1ZJBA 3LCWA 2QCCA 1UH4A 3TOYA 3H7UA 4L6OA 1ECQA 1PL9A 1P6BA 1W5MA 2VVNA 3AMGA 3P3BA 4NYUA 5L9FA 3ZT7A 4MYXA 2WMFA 4W7UA 1B3XA 4D6CA 1R2TA 2PTYA 1YE4A 1ADSA 4UFIA 2X09A 1E1CB 2CHOA 5KZ6A 2DZBA 3USBA 3DFPA 3RCMA 3KP1A 2REQA 3BWWA 2XGIA 2PWDA 1O1HA 2BBFA 1Y8BA 4LY8A 4ASTA 1B4EA 3NL3A 3N34A 4WX2A 4US6A 3WF0A 4DF2A 5CC6A 4G5DA 2QZRA 5T91A 2GOUA 4XO6A 1VJZA 4GYFA 4LAOA 3OJGA 1K8CA 3D3FA 1W9XA 1Q5MA 2ZC8A 3RPDA 1M7JA 4FNSA 2D0HA 4FF5A 2QPSA 3N4AA 2JE8A 4IJBA 1PKMA 4R7OA 3MYPA 2HISA 3WF4A 2GVGA 2TSYA 2VZOA 1DIOA 1VYPX 3GBDA 1HKIA 4K68A 4ZB5A 2FJUB 2W67A 2PDGA 3BL3A 1QI5A 3BAJA 1DJGA 3LHYA 3W0KA 4DJDD 3N4FA 4YL2A 1JGIA 3G1DA 1NH6A 2C1HA 4WXZA 4AD1A 1MEWA 4YVXA 1OINA 1Q2RA 4DWSB 3H2OA 5AYYA 4CU6A 6REQA 1JDFA 1JQXA 3CZKA 2XISA 4DNHA 5LNVA 4MZ1A 4F66A 4KFOA 4PRTA 1OCQA 3TR9A 1S46A 3PVFA 3OLEA 4AZCA 1JAKA 1UKSA 4C6BA 3BLKA 3APTA 3LTPA 1G7VA 4DUVA 3KHDA 1JULA 3AUOA 2CETA 2P5NA 2YB4A 2F2HA 5C2GA 4Q8VA 3EEGA 2ZVRA 3IK4A 2A3EA 2D23A 3NQMA 1CB2A 3CUFA 1TVLA 1ZU8A 5JH2A 3P14A 4D8AA 1TWZA 3IV3A 2NUWA 5TNVA 2XIQA 3GBEA 3KFTA 1DWJM 4LT9A 2XZ7A 1DIEA 4UQDA 1LWHA 3MP5A 1FBAA 5M3WA 2NSXA 3RLHA 2ZX6A 3WUGA 4F79A 1J0YA 1XIMA 1KXHA 1NARA 5ENLA 3QQ1A 5DMYA 5LGXA 2INFA 3T44A 3SSZA 3TV8A 2MUCA 3QZ6A 3NSXA 4AIEA 4GI9A 1TTIA 1RR2A 3G24A 3QH2A 4XAGA 4Q4RA 4DZ5A 3WNMA 4MIMA 1Y5VA 1VLWA 3ARTA 4IP4A 2ZRUA 4B5VA 4FAMA 4HVXA 1MW2A 4I5UA 1ZJAA 4O1AA 5M5DA 1EGVA 3GDBA 3WLMA 2GJPA 2VX5A 3MBFA 3RXZA 1UMLA 3A6OA 5AHMA 2WVUA 2QUVA 3SIMA 3C86A 5F2GA 8RUCA 1M41A 2OGJA 1V7YA 1VJIA 4Q8TA 1YRRA 4IXXA 4PMQA 4GH3A 2R6OA 3CLWA 3HZ3A 1FVPA 4CCCA 2WJZA 3OQEA 1UD5A 1RPXA 4I9MA 4AZHA 1PAMA 1H50A 3QGKC 3B8VA 2AL1A 5H6HA 3OVGA 3LV6A 1EDGA 4LTSA 3EZ4A 4XD5A 4YHEA 3WKZA 1XIIA 3VIHA 3E0LA 2FH6A 4J27A 2IPWA 4QQUA 3O3RA 3EX3A 2X0SA 1PKNA 3M0IA 4MWAA 4PTXA 5D37A 2WNQA 2DSKA 1K8ZA 1YPFA 3N29A 3FN9A 5DMNA 4S3FA 3WF3A 4URIA 5U7SA 4A3HA 3U6WA 3B03A 4NXKA 5CZSA 2B7PA 5AC8A 2PD9A 5CG0A 2IUZA 3WG6A 2IW0A 1Q3NA 4NYYA 3P67A 1XSJA 1LTDA 1ME9A 4LC6A 2C3ZA 2PGWA 3WBWA 1A4MA 4O28A 3I6EA 1B3WA 3EOSA 4L65A 2R1LA 3N13A 3VKKA 2PUZA 1GZ1A 4OUIA 3UR5A 1M03A 4GIAA 2WBKA 3GNPA 5M03A 3PF3A 3H24A 1I2RA 1UA3A 4C6DA 1ZAIA 4WSKA 4H8UA 1VPXA 1QUMA 4D6GA 3L2LA 1HW6A 1R38A 3N14A 5LXXA 5AVHA 1H2JA 1W1TA 2W5FA 2GUYA 3W22A 2ZXBA 4IJCA 1W3TA 4JYFA 1FKXA 2Z4GA 3FEQA 3QQWA 3WQWA 4ERAA 3MKKA 3L23A 1M7OA 1RXOB 1DJWA 1EZ2A 1CWYA 1U5JA 1S5VA 3LPPA 2Z29A 1G69A 2VC7A 4NZ1A 1FWNA 4M56A 1JNEA 3BAYA 2PPGA 1E6PA 1JGMA 4CN6A 1KW1A 2OZ3A 3CASA 3VIOA 4ZCWA 3OHIA 1E6ZA 3GG0A 5A6SA 1XLKA 5HWNA 1E4IA 3CHVA 2ZDRA 4PUJA 4D6HA 3DFSA 3QSRA 3PBGA 5DX7A 1VRDA 2FVMA 4GWEA 1LCOA 2C0HA 3K1DA 4JFUA 2XH2A 4V1YA 3CQJA 3WH5A 2VENA 3HJEA 3C2FA 1R3QA 4DIAA 5G4HC 4WY0F 1SYTA 4LUJA 3N2MA 5EKYA 2ZZ6A 7PTDA 4EIVA 1I1WA 3DH7A 3AWNA 1E0VA 4F2UA 1C3FA 3GFYA 3VX0A 1OD8A 1PVNA 4G1KA 5HJLA 4IZGA 3GG1A 1NF0A 3BLDA 1B4KA 3TH6A 1J6PA 4ROQA 1Q6RA 2OTDA 1BXNA 4H6KA 1Q7ZA 5LYRA 4BA0A 1HZYA 2I7GA 1DYSA 4LX4A 2F6XA 1K9FA 2DT0A 4CEUC 2I16A 4XTIA 4DHGA 1S2UA 3REQA 1FWSA 3SQLA 1F61A 3LHTA 4JTKA 1P7TB 2WSPA 1UR0A 2Z25A 3F5JA 4IMCA 3H6OA 4GMEA 3UPBA 2OSYA 3D47A 3QRHA 5CGTA 4DO5A 4MKNA 2R1MA 3IEBA 4OT7A 3TSDA 3UWUA 4XD6A 4ATWA 1JRCA 1I0BA 1V7AA 3E74A 1JYVA 3UVAA 3P62A 3CIWA 3PBUA 2ZXAA 1VC4A 1TPH1 4EXBA 1XPGA 4K3ZA 1RP8A 1UR4A 1QOPA 1RA5A 3K2GA 4W89A 1HX0A 1EEXA 2HPIA 4IX0A 1CENA 5CSSA 1JZ4A 2J13A 4AHPA 4PMJA 4R7JA 3SUWA 2O7QA 3KVKA 4XBKA 3UZZA 2C91A 4RE3A 1SFJA 4FXSA 2Q8LA 4LS2A 3QPYA 2VEPA 5EMJA 2VFIA 4N7QA 3W76A 4H00A 5HANA 3GAYA 4N0RA 4MWAE 5K3VA 2O7SA 3V18A 1GT8A 1ITCA 1QNPA 3EOEA 5BRQA 2Z1VA 4G56A 1PHQA 3FXYA 2BWGA 5B80A 3IGHX 2CXGA 4C6IA 1KFLA 4AY7A 1JDAA 3WLPA 3C4UA 3EPMA 5D2TA 2KZHA 1WDRA 3R4IA 4PH6A 3VTRA 4XZLX 4XIAA 2H9AA 2WVVA 1FCQA 4QJ3B 3LM7A 1SUXA 1E9IA 2PA6A 5I3KA 1QT1A 2ON3A 1Q66A 3WJYA 1SMAA 2E77A 4B5NA 5CJNA 3QV8A 3W7RA 1UR2A 3WSUA 3CHDA 2AQOA 2YCEA 3L0GA 4OVXA 5BXPA 1SQ7A 2G4FA 1E4NA 3P0WA 2FVLA 1U83A 3VC6A 2R1NA 1ZZMA 1VQTA 1PKYA 2POZA 3BGGA 4O1FA 1Q6GA 4F0SA 4LCSA 3T2QA 3B0VC 5E9XA 1HP5A 2WHKA 3CHEA 4E4FA 2WCAA 1B9ZA 1W3KA 4N9EA 1CYGA 2VX4A 3KOFA 1TQJA 3LBCA 4UTUA 2VR5A 4Q4SA 1O68A 1KM3A 4QP0A 4BWLA 4DJFA 2V3FA 4UTTC 1ITQA 3QW4B 1QHZA 3AZRA 2NWSA 1YMYA 3L12A 4RDWA 1OFAA 3F4CA 8CGTA 1ZAHA 3CUHA 3DOPA 4GQ0A 2VEFA 2C1GA 4MNKA 4PCTA 3VOFA 3TTOA 2YBTA 3WFLA 2A3BA 4Z1CA 5HPOA 3B40A 3HF3A 3TTYA 4GUGA 1NP2A 1KTCA 4HJWA 4W7VA 2INZA 4N42A 4ZB2A 1AZ2A 1VFFA 3M5ZA 3K30A 4C6JA 3IUDA 4Q4PA 3SR7A 3S9IA 1GWJA 4DPPA 4IMDA 2YIHA 3ITOA 3QM3A 1AMYA 1GVYA 2E40A 4AF0A 4M0XA 3NIYA 2YBUA 2FIQA 4MF4A 3V7PA 4DAFA 5I07A 4JIHA 3CB3A 3T0TA 2OEMA 3RR1A 4Q8QA 1K6AA 5A6BD 5CBJA 2MNRA 2CHNA 2V68A 3DN5A 4EACA 3LI0A 4KEUA 1UKQA 2JBMA 3OO2A 4OOZA 3G1HA 3HG3A 1H3GA 2VMFA 1FWGC 4MLRA 4AD2A 1S5NA 2YGYA 3SRFA 1JYXA 1BKHA 2E68A 3VGDA 1KTNA 5IBXA 3L4TA 4KRUA 4JTAA 4UTWA 1OY0A 1IHIA 2XSXA 2PS2A 3S46A 3HV8A 4PGLA 4GQBA 3KOZA 5ECUA 4QG9A 4XWUA 4H8HA 3M9YA 3E3HA 3GVGA 3UXLA 4WOQA 5BZAA 3DFTA 5DXXA 3R13A 5GQBA 4IOTA 2WNZA 1CTNA 2E7FA 3TMQA 1YDVA 3WH7A 1JPDX 2PBGA 4AXNA 1Z3NA 2WLYA 3WMBA 1B30A 3LCIA 3RM9A 5C55A 1Z89A 4WJEA 4LSBA 4MFDA 4M82A 4A3QA 2Q8ZA 2VKZG 2V2HA 3CWNA 1WKDA 3LHVA 4OE7A 2Q09A 1POJA 2H6RA 4OV4A 1AH4A 1GCYA 3CPUA 2G0WA 3QZEA 4GFIA 1DEDA 3R8HA 3FIGA 4GNKB 1TPDA 4K39A 3GTIA 3SCQA 1BGGA 5XIAA 3KOYA 4CCZA 3M7WA 2GGHA 2FZNA 2XH0A 1NFPA 3QGVA 4C5ZA 3AQUA 3BZGA 3L7RA 3C5QA 2AQVA 3ARZA 2DJLA 2CXEA 3FAWA 2G3MA 3TNBA 4CVWA 4H4IA 3U2OA 5EFFA 3VIGA 1QMLA 3E6EA 3DHDA 1FWEC 3W85A 2Q3RA 4H3DA 4U2YA 2B0MA 2OCZA 4GZEA 2CZVA 1OHLA 4D1JA 2OSXA 4ZTXA 3WH9A 2DZVA 1UR9A 3PAOA 4PMUA 5A8PA 4B3KA 2IPGA 2G3FA 3M0ZA 4ILSA 1TVNA 4H2CA 3IRDA 1Q4WA 3VKAA 1CI1A 4OECA 2Y61A 3QYQA 1H0IA 5FA5A 2EG6A 3VO0A 4F0MA 2CHRA 1EC7A 4IX2A 4K2SA 3QFWA 3ZJ8A 2DVUA 2VP8A 2YDQA 1ONEA 1BYAA 3LY0A 4A05A 2E9LA 1W5PA 1CDGA 3N3MA 3T6CA 2VQTA 2FHCA 3EX2A 3SURA 2X2YA 4U31A 1FWWA 3ABZA 3MA8A 1HP4A 2FGLA 4Y8FA 3CMJA 1DORA 3TK7A 1PYMA 3EDJA 3BSHA 1UHVA 1TMQA 2ABBA 2QR6A 1VCVA 3UQNA 3C3UA 2QUNA 1TB3A 2J27A 3WMSA 2BOEX 3F4DA 1V3JA 2ZUSA 3ARVA 3FYYA 3N04A 1OX4A 2QJJA 4GD0A 1J0KA 5DRIA 4DLFA 3VD3A 3RG6A 5MKGA 1Z9AA 5AYXA 5C9XA 1VENA 5BYWA 5C70A 2JIWA 1TMHA 2HBVA 3R12A 4A6GA 3CL6A 4IG2A 4XD3A 1ODUA 4BY3A 1GQJA 1XIEA 4BF7A 2QV4A 1M1BA 2HNEA 5IDIA 3IJDA 3QMRA 2OO0A 3N19B 4QBXA 4Z1DA 4CQ8A 3B8SA 1SJCA 1U5HA 4MJMA 2CLEA 4FPSA 3THCA 1WUEA 1US3A 4B15A 4X63A 4OBTA 5GNYA 1MEHA 4Y7EA 4X0VA 4IXHA 3VK5A 3EAUA 2I17A 2BY0A 2P53A 3UWVA 1GKRA 4U3CA 4DZIA 5FACA 3S2NA 3LXBA 1E51A 3OTRA 2BLEA 2ATMA 1S1PA 3AWOA 2HV5A 3IGXA 3PY2A 4PTDA 3BLPX 4LRTA 4H9XA 3PJXA 1XYCA 4JQ1A 1BYBA 3E9AA 4WIWA 1QPRA 1L2UA 1LL7A 3FHQA 1TZZA 5F1UA 2VZTA 4PZVA 1XRTA 4NY2A 4HMDA 2P3EA 4BK9A 1OJXA 2GK1B 1PIGA 1LORA 1XGEA 3S83A 1FWAC 3AIRA 3NPVA 1W32A 5JH1A 4O1BA 2D73A 4ZODA 3T2PA 1J0IA 3P8JA 4HN4A 1O5QA 4JY9A 4HU8A 2ZTJA 5D02A 1E15A 1FOBA 4NX5A 1EKOA 1Z48A 2DY3A 4RDYA 4NJKA 4B4FA 4JOMA 3W1RA 3S1VA 1ITUA 3F03K 2GVEA 3AXKA 1VRXA 1VD6A 5I0DA 4HGXA 2W27A 2YDSA 1IGSA 3A5VA 3CC1A 4XKMA 4W86A 3KZPA 4A22A 1BRLB 4ECLA 5CXPA 3OG3A 5IHSA 4ZE5A 1E0WA 5I24A 2WC4A 3VNZA 2BHZA 3PPHA 3ZM8A 1IXOA 4MFEA 2OB3A 4GNVA 3RJYA 5HDRA 3DHUA 1Q8AA 2G97A 2YW4A 5E09A 5FCZA 4LAUA 1JFHA 1P43A 1BVZA 1GYMA 3PFRA 1JUEA 4O1CA 1TIWA 3AS2A 4O8AA 4GC3A 4UMAA 2DSZA 4CLMA 1GOQA 3C0JA 3GXMA 1JUKA 1GPWA 1Y0EA 3EWUA 4GQGA 5XIMA 1SSGA 4NI8A 1KO0A 5DMLA 4RPQA 3NFUA 4ADTA 2W91A 4I9TA 1TX0A 2P3ZA 1EJWC 2OYMA 1H11A 1ZCOA 3CZ8A 1B54A 1XC4A 2ATSA 3R5EA 4UC5A 1R8LA 3NEVA 3O6YX 3PBYA 5LA2A 4ZOBA 3GZ3A 4AVOA 5DANA 1A80A 3RM4A 4H1ZA 2PDJA 5CSUA 1BAGA 3MUCA 4GNJA 1KM4A 1TELA 2AAAA 4I8DA 5T9CE 4NG3A 1V02A 2R94A 3MPGA 2FYMA 3GIYA 1ZBCA 3FDGA 4GCAA 4H2HA 1WBJA 1HJUA 2V38A 1P0DA 1JF5A 4H9VA 1KB3A 3NQ2A 1PTGA 4ALDA 3NOYA 1H7NA 2F9RA 2RDTA 3N9SA 4ZENA 3WLTA 2B81A 1XIFA 2Z24A 3CHCA 1WAWA 3ALGA 3NDOA 3CYVA 3W24A 3LD5A 3NPWA 4LVDA 3TSBA 3T2OA 5D30A 4MB5A 1KM5A 2ZZ1A 2J8TA 2BGQA 4JKMA 3WUBA 2C6QA 2W66A 2E5DA 3GNNA 4O53A 1Z7AA 3ZFHA 3UCQA 1SJBA 3E0VA 4UQEA 3TEVA 3TFXA 3VCRA 2E09A 3N2TA 3OP2A 4NP7A 5GVJA 1HG3A 4WJ8A 3S42A 5G4WA 1ADDA 4LNCA 1TV4A 1XYZA 3S0CA 1UD8A 4AIUA 3RAOA 2PC8A 2OQLA 2QCLA 2BHYA 3C0LA 5PTDA 1PZ1A 1TUXA 3EKGA 5FJJA 4CCDA 1TPFA 5CC5A 2WCSA 4BQ3A 4LOCA 4WKHA 5DEZA 4U3AA 1FWTA 5D2WA 2NQ9A 4JXCA 1XINA 3L5LA 1C7TA 3W7GA 1HJVA 3MZNA 2Z28A 3GHRA 5A5WA 2V3DA 3VIIA 3A24A 3H2MA 3F5KA 3U8GA 3LLFA 4K1WA 4O19A 1TV3A 1PBGA 2BY1A 3BV7A 4GBDA 5CPLA 1DTUA 4XZIA 1E0UA 3WJWA 4K8HA 3VOCA 3C2RA 1EH9A 4WUIA 1C8QA 4E6MA 3QY6A 1XG3A 4J2MA 3WQFA 2HVNA 1M3UA 4IL0A 6A3HA 5LHFA 4CD6A 4F2BA 2PDWA 3ZR6A 2IKHA 5ECVA 2ABAA 1VB9A 1XIHA 4GKTA 1PX4A 4D6FA 1UD4A 5A6AA 1KR1A 1V3LA 4UTHA 5CLWA 2WK2A 4U10A 3W7PA 4QSFA 3KWXA 3RCYA 3A22A 3WF2A 2ZYFA 1E0XA 3L4YA 2DZSA 2QLYA 3BAXA 2YW3A 3FJ6A 5LIXX 3N4EA 2L5HA 2ACRA 4CGTA 1RV8A 4AD5A 5DFAA 3SRDA 2WNWA 1HVQA 2JQXA 1LJYA 3PJUA 4OV9A 1RCQA 1GQLA 2QPXA 2ALDA 3TJIA 3FS2A 4HMCA 2NV1A 4IIEA 3THUA 1UR3M 3A3WA 4GIYA 1KV5A 2IQ0A 3OW1A 3QV6A 4KRZA 4K37A 2GVJA 4B91A 1O5XA 2A21A 4HNNA 3HGRA 2POTA 3GM8A 4ZOAA 2R91A 1TR9A 3AC0A 2OEKA 1LQ2A 1A49A 3GHTA 4S3JA 5DCDA 3BANA 4WDXA 2Y5JA 1V6UA 1BQCA 1W56A 7ENLA 1QR7A 3B0YA 1DWFM 3FA4A 1IEWA 4NF7A 3D3AA 4KWVA 2Y7FA 1P0BA 2CLKA 2J79A 4HK5A 3SAZA 1XLAA 4PB4A 3SY8A 4XAZA 3FFSA 2OX1A 5AHFA 4PFHA 1R3VA 2VD9A 1QNQA 2WZTA 2DIEA 3SJ3A 3RX4A 2WAGA 1FX6A 2PGFA 1EP2A 3A4WA 4GUHA 2Z2BA 3TR2A 3CUIA 1LM1A 1DP0A 3VNLA 2BODX 2WWCA 3W38A 1PJ9A 3BOLA 2EKGA 2OT1A 2VC9A 3HG4A 3PG8A 3L4ZA 3GXNA 4GFSA 4OKDA 5DY3A 2Z6JA 2DVXA 2B7OA 3QEZA 4GYPC 3AIQA 2YJQA 2OODA 3F4NA 1A0CA 3DXIA 4QFUA 3UG8A 1E1CA 2WHJA 3DAQA 4IMFA 1QOXA 2VO5A 1X39A 3VOJA 4PYSA 3SFKA 3MUZ1 5C5YA 3OYXA 1AW1A 3VMPA 4XZNX 4G7EB 1SGJA 2CLFA 3HFTA 4Q7IA 2PSNA 3LUTA 3NVDA 5JQ9A 1UR1A 4ZOEA 1KBIA 3U48A 3ITLA 4H8NA 4JYEA 5AECA 4N6FA 3JVAA 5LNRA 4LQ1A 1JCNA 2MANA 3QBUA 2FKPA 3CV2A 4DUWA 4AZ6A 2XIJA 5FIPA 3TW9A 1XDMA 2XSBA 2V82A 3ARXA 1Z32X 3HPFA 3W02A 4DBSA 4NSBA 2Z1XA 3WJZA 4AIOA 1IWPA 1UKPA 4CCEA 2D69A 4D1IA 3UNTA 3DFQA 1NWTA 1I6NA 3WUFA 4E2VA 3NL2A 5AKQA 2ZKMX 1XD1A 4ZO7A 3GXPA 2VL4A 3TN3A 3IIZA 3KW3A 2WSYA 4W4QA 2W62A 2XYLA 3MV11 3AYSA 2VWSA 1QFEA 3CS2A 3EOOA 1EUAA 1TRIA 3HMCA 1BSLA 4IM4A 3G1YA 1TIMA 4J7RA 3OLIA 3UG5A 4MUZA 2G50A 3SFWA 3ZIZA 2WHMA 5I6SA 5I79A 1PE1A 3F7JA 3TYDA 2BP1A 4YTUA 3U57A 1RQHA 4UUIA 2RDXA 4AX6A 4IFRA 4K6AA 1S3TC 4RW5A 4H9TA 1SVDA 4NRRA 1TREA 4ERGA 2VR4A 4BFAA 1W54A 5BXTA 3SCOA 2XGBA 2BVWA 2SFPA 4U5IA 1W37A 2PLCA 1TJPA 2BMBA 4NZ3A 2F38A 3T0CA 1LQ0A 3GY1A 2YLAA 3ZMRA 5I3IA 1LZOA 3BSMA 3V0TA 3BICA 4RV8A 1UIPA 2BGNE 5C0QA 1OFRA 4I9AA 3K46A 2DH3A 1BFNA 4AZ5A 4C1LA 2E5CA 2PODA 5HULA 3C8FA 4FOUA 1RD5A 3PZ9A 1ZL1A 4P7QA 4M24A 3HV9A 1AZ1A 4X61A 3FVMA 3WH6A 5ABFB 3R89A 3MB9A 3AHTA 3NCOA 3L4UA 4XUGA 2ZC1A 3MUY1 4GH1A 1TPC1 1WYIA 2BSLA 1HUVA 3P74A 1E3XA 3KM8A 3VINA 1FH9A 1R46A 4B2DA 4NASA 2HXUA 4HMEA 3W82A 3II1A 2CLLA 4AZIA 1QASA 1JPHA 2XJ7A 3WMCA 1A5AA 3CWOX 2J9XA 3MW7A 3E5BA 4MAZA 2WC7A 1TV8A 1LBLA 1A5SA 2E67A 2PCEA 3UR2A 4PR4A 2OPJA 3G1FA 3FSUA 3DIPA 3D0CA 3TVAA 1XDLA 3MWAA 3COTA 3HM7A 2GQ9A 3POHA 3BDKA 3R79A 1Y5WA 2VGFA 1XG4A 2GQAA 3GB6A 2PP0A 4DRSA 5CEWA 3IK2A 5FL1A 1W8GA 3TZNA 3BG9A 2D2HA 4DJFD 4ADUA 2VC6A 3SO7A 3B8WA 3IACA 4YIWA 3SY1A 2DQXA 3DHFA 3SUVA 1KM2A 1IWAA 2RJGA 3NQBA 1NDYA 1OZQA 5CAHA 3KBJA 2GVLA 3IPWA 4KKXA 2Y8VA 1LBFA 2GZXA 5FD0A 3WL1A 4HCLA 2R9RA 3BMXA 1PIIA 4KH2A 3I6RA 1WXJA 4LS0A 3M43A 4JFSA 3T09A 4JPGA 3V0SA 4RPPA 1TPEA 4AD4A 5CLTA 1AQ0A 3TXVA 3MO7A 5D4YA 1GVQA 3GFZA 2QCNA 1P5BA 5K7JA 3VABA 2WLZA 1M53A 2GJNA 4TOQA 4XO7A 5A8MA 4WRHA 3NQAA 4MADA 3EWWA 4U5KA 5BWFA 3TWBA 4J3WA 4AIBA 3TTSA 1E1FA 4QJ5B 4POCA 1VBJA 2VHLA 4HSHA 4L4MA 1V8EA 2F7FA 3UZ5A 2PRMA 4W5ZA 5CC3A 1F6YA 3IJ8A 2WZHA 3HPAA 5E0CA 1T40A 3W27A 5E1QA 1QW8A 4HNOA 4Q4QA 3AO0A 1DQUA 2Y63A 4DB7A 2QMJA 3FKKA 3LQGA 4WJXA 4L6HA 4O12A 4H01A 3P61A 1TKKA 2O55A 1BQGA 2B7QA 3DEQA 3B0UX 1A47A 3I4EA 1JDDA 3F2BA 1U1HA 4G9PA 1OCJA 5DMMA 4MAVA 1ZB5A 1ISVA 3KE0A 4AD3A 1E0TA 2YLLA 4MHBA 3AMKA 5GJNA 4AWTA 3G3MA 2YL5A 5DT7A 4DAIA 5LA0A 1HO4A 5JBFA 3OPSA 1VYSX 3M44A 1JVNA 2GQ8A 5CPOA 1CW2A 1BWVA 1WZMA 2HXTA 4DBUA 3EDFA 5MF5A 3B8UA 5FF3A 4KWSA 3SN1A 3ANVA 4MJZA 1F5ZA 3Q67A 3KS6A 1K77A 4O16A 3VD5A 1KQZA 3B4UA 3QTPA 4LWWA 5CZTA 1W9UA 3BCDA 1EJUC 4XVDA 2XWEA 4JHMA 3HQ1A 3TTQA 3WQCA 4XD4A 4XKYA 2Q6ZA 2VGBA 3W70A 5CBBA 2Y1HA 5IBXC 1VHNA 1MYRA 2YCLA 5I03A 3ITTA 4HPJA 4F9DA 3BAWA 3GS6A 1GGOA 2FZBA 4C7GA 3O7UA 4TUFA 3FX4A 5LKYA 4RE2A 1MVYA 5T9BG 4QX4A 3QV9A 3EOUA 3WO8A 2HVOA 4OOUA 2DORA 1Q6EA 4JL2A 3KCLA 4UTJA 1OFQA 2YL8A 3QZAA 2XTKA 3G22A 5EMLA 1XLLA 1ZRQA 2YOCA 5KSWA 3WCZA 1NDVA 3CMGA 2BXYA 4FA3A 1YIXA 2DFAA 3N17A 2YSWA 1QU4A 1Z44A 1JZ2A 4GUJA 5FJOA 2QMKA 3B05A 4B9ZA 5D09A 1ADOA 3PUOA 5FEXA 1BG4A 4S3AA 1KGWA 1OCNA 4HA4A 1K3UA 1MWOA 2Y6ZA 3CQHA 1PHWA 3NUKA 2JEPA 5HBFA 3WQEA 1ZUAX 1XXXA 2J8FA 3TC6A 2ZZ4A 2GVYA 1BVNP 1T8QA 3LV5A 5AVNA 4LUSB 4M1BA 7REQA 3N2BA 1FHUA 1QW7A 1WQ5A 3V5FA 4CEXC 3CAKA 1RPKA 1I8JA 1P0NA 3QOMA 3RJXA 4JD4A 2RKXA 4HZ6A 1VEOA 4DZAA 1DVJA 3LPGA 1JI1A 3O6CA 5ABHA 3U2CA 1KBKA 1E55A 3UU0A 4KQNA 3MC5A 1OX4B 3L4XA 1TSIA 2A5HA 4E0CA 2Y89A 2QGHA 1X96A 3RF9A 1SO5A 5HQEA 1REQA 3GC2A 4YTTA 3NXLA 4HHMA 2VGGA 4OHQA 3AHZA 2PDCA 5EA9A 2ZOXA 1H7WA 2VUYA 2Q02A 3G77A 1IXPA 1W2VA 3VNKA 6ENLA 3HBLA 3UPMA 2YA1A 4HSNA 2F8QA 3NL5A 3R8RA 1F8IA 4BS0A 3OZPA 1DE5A 5F4WA 3CAVA 4I7WA 3IIVA 2ZZ3A 4WCJA 4GUIA 1KV8A 4UTWC 3LCGA 1GNXA 2DZPA 4GZIA 4CN1A 3HG5A 1PZ3A 2PLMA 1JD9A 1EF3A 3HQPA 2GLKA 2OVLA 3BJTA 4E2DA 1RBLA 5C54A 4PMYA 1BF6A 4FSAA 2J7HA 1EJXC 5K2ZA 1HQTA 4NRSA 1H7XA 2FDSA 4C60A 4CQAA 4YTQA 3CV7A 4U28A 2RGLA 3WQOA 1ICSA 2V2CA 4IFKA 5JU6A 3QXBA 3AMLA 3EXRA 1JUBA 4OBSA 3V0UA 4R5EA 2X1IA 4EF9A 1H63A 4TU1A 3NURA 4IQLA 3TQ0A 3R43A 3QPZA 1VCFA 4AAJA 1V3HA 1JCTA 3RO8A 4D71A 1A53A 3EEZA 3MP3A 2OMAA 4RE4A 1T6MA 2PGRA 1XBVA 2NX9A 3NQDA 4CVUA 4AEEA 4HP5A 4BCEA 1VPQA 3O0KA 1YHTA 4QROA 2RDUA 2ZRXA 1TO3A 1H0GA 1FP8A 1JF6A 3MHUA 1PO9A 1Q6LA 4QDMA 4V1XA 5HNNA 2QDDA 5IFTA 5FEWA 1YTDA 4CKQA 4AMCA 1ZSXA 4GJIA 3S1UA 3KVMA 2DQWA 1OADA 2O56A 5RUBA 1F3WA 1FY6A 4DPQA 4BF9A 3PB0A 3GU9A 3KRSA 1YTKA 2Z7GA 1E43A 4K36A 1P0KA 4XZMX 3NQVA 1UUQA 4PCFA 1BKSA 1CXLA 3V1PA 1EYEA 4EX4A 3M5VA 1XF0A 4RV3A 1R9YA 2JIEA 4LAZA 1C8XA 4MG4A 3BJSA 2DT2A 3N2OA 3W6YA 3IRSA 2YXGA 2XVKA 1G4TA 4EF8A 3VD4A 3H2CA 4NJJA 1FWBC 3LI1A 1JNDA 4A3YA 1FCBA 1TV7A 8XIAA 4J40A 4LCQA 1ICPA 2JF6A 2QUMA 1FRBA 4GO8A 2I14A 6XIAA 2PDNA 1H49A 1K9EA 1V3MA 3A13A 4X9SA 3T07A 2IKIA 4JNMA 4ZEPA 2PWGA 3GTNA 3H7VA 1GVRA 4LF2A 1PPIA 4IMAA 2Y24A 2V5JA 2YCIX 4YS1A 1YTEA 3KBMA 8TIMA 2BVTA 3FA3A 3VDAA 4OFCA 4JTEA 1UKTA 3GTXA 2OGYA 2HROA 5JXQA 1EHNA 5HAOA 1XH0A 4AC1X 1CT5A 3P6LA 2Z26A 1MXGA 3ATYA 4AUBA 2PWFA 3UR7A 2I1OA 1TRDA 2HK1A 3LPFA 1GJUA 1NVMA 4R53A 2DZTA 3R94A 3K8KA 1CZ1A 4XV0A 3GNDA 4AYSA 1J18A 1GEQA 1TPB1 3ELFA 3NDYA 3N9KA 2QIWA 2QNEA 1PX3A 3SUUA 1UWIA 4ZQRA 1ZENA 3QC3A 3H4XA 3ALFA 3TYEA 1CXHA 2G5WA 1P0EA 3RITA 3AYVA 1FP9A 3POCA 2E1DA 3O9NA 2VZUA 4AMAA 2A7PA 1VIWA 3MSYA 3WJSA 2WMKA 1FFQA 2B7NA 3EXSA 1C7SA 2E8ZA 2OKTA 4DVOA 3CQKA 5XINA 2Z7KA 1A3WA 3VGEA 1XBXA 2PRHA 4IPJA 1A5BA 4IH3A 4I90A 2BS9A 2J6XA 4MDPA 4QXIA 5AOUA 3DYPA 4PL1A 4FS9A 3VXGA 3GNRA 2R1PA 4NL1A 4D8LA 4UFJA 2NT0A 4YMZA 3ZO9A 4M1RA 4Q8PA 4KRTA 4PFMA 3TTEA 1W3HA 3RCNA 2ZRYA 1D7FA 2B31A 3IS4A 4IIFA 5M17A 3CIXA 2A4AA 4LU0A 5HPCA 1S39A 3UZXA 1EA0A 3ARUA 1NY1A 1V03A 2X8RA 3I7QA 1Q85A 3TKFA 4PN2A 3KRUA 1E4LA 1J4EA 2P8BA 4ZOCA 3HPXA 2DU2A 2WW5A 4S1FA 4P61A 5C2XA 5H8MA 1HJQA 4ZSTA 3URQA 3L21A 3P84A 1BHGA 4YVVA 1B3VA 1IXQA 2XVLA 3EWXA 4BQ5A 3PUEA 4DN1A 2FZDA 2GYIA 1UPMB 1UH2A 5EMUA 3BTNA 3NYZA 1Q65A 2IKJA 4LUIA 4BZYA 2VOMA 3QJAA 1SO4A 2F84A 1K7FA 5I09A 1KCLA 1G94A 7REQB 4XSMA 4PEKA 1EC9A 1F3TA 1KFCA 3PZUA 1BXCA 2Z2UA 1FA2A 3UG4A 5C9UA 3W7CA 3UJRA 1QNOA 3IARA 1MDLA 3W2MA 3AIBA 3GVRA 1GW1A 4B3LA 2GDUA 2CZDA 3VI2A 3M64A 3S2MA 3L0NA 1JCYA 3EWDA 2VUNA 3B9NA 3TE9A 5E6YA 3LHUA 2Z1BA 4HNUA 3IJQA 4D6EA 4ZSUA 4ENLA 4KIRA 1MXDA 3UERA 3DDMA 3SN4A 1WP6A 2FHFA 3NSNA 1A4LA 2GGIA 1O5RA 1W31A 4MNLA 3SADA 2OJPA 2PE4A 4I5RA 3Q58A 1CECA 4L9XA 4M7SA 3GZAA 1CGYA 1AODA 4QQ3A 4QR6A 1FTXA 5C7HA 4FIRA 1M7XA 4JIEA 1QHPA 3T0BA 1Z6KA 3G1RA 3SSJA 1FH7A 2UBPC 1X7FA 3U9IA 4YYCA 4N4PA 3WNKA 2HCVA 1QWGA 3RR4A 4LVBA 5HMDA 5BXRA 2PZ0A 3W1LA 1CIUA 3M16A 3VIKA 3VDHA 5A8NA 3EYPA 1HN1A 1G4SA 3WDHA 2J7DA 4LAMA 3A4XA 3BARA 1V5XA 4AWUA 3BCFA 5DT5A 2WKJA 3PWIA 3W88A 3EX6A 1SFLA 2O9OA 2A7RA 3LHZA 1K8YA 5CCZA 2X1UA 1DL3A 3SQSA 4PBEA 2FTWA 4IWWA 4ZXLA 2HWGA 5K4ZA 2ZA2A 1HGWA 4TR9A 1PDYA 1EWEA 3H26A 1RY0A 2ZX7A 4GXWA 2DDXA 2IPFA 4X2PA 1BF2A 1POKA 2IXVA 3UCCA 3UXKA 5K9XA 2BXZA 4FHAA 3M0YA 3VMNA 4B16A 2OLHA 3OIXA 1VBUA 2H9AB 2WVVB 2YFOA 1R3YA 1VJSA 4GXMA 4BQ2A 2WBGA 3GNOA 3TJ4A 4NVTA 3T0AA 4GI8A 2GGGA 3GDRA 5FF2A 1XIBA 3WQ6A 3WENA 4C6KA 2VDHA 4ERIA 3ORWA 1AL8A 2DSUA 1AVAA 5LHEA 4RZ6A 3WLKX 1R3SA 3IAPA 4AG0A 5GNZA 1ZS2A 1VEMA 1GG1A 4DO7A 2YR1A 4WZHA 3SCPA 3W6MA 4AZCB 4ROPA 2VJXA 1ZNNA 3STFA 1ML1A 4ZO6A 3DI1A 2QCGA 9XIAA 1V6YA 4W8BA 3LK6A 4XSLA 1XQKA 4DNMA 1B90A 3OVQA 4UQAA 3LOTA 2V5KA 2A6NA 3PN8A 4WSJA 3T1GA 4W5UA 2NVCA 1H60A 1Q6QA 4RW3A 4C6PA 3GKAA 1KM6A 3S4TA 2I9EA 1U22A 1OX6A 3QY7A 5HXMA 1GORA 3WBXA 2J7GA 1ITXA 1MW3A 1QXLA 1OEPA 1KXQA 3QMTA 3PULA 2Y70A 4A29A 1W1PA 2BB0A 1GOWA 4HA1A 3ZOAA 4P7LA 3TMLA 3VNJA 1JZ3A 3ITGA 4P8UA 4V2XA 3RNDA 2CWXA 4BHYA 1HL9A 3W28A 4HYWA 3REQB 5HUPA 4DY1A 4O13A 1D3CA 3S1GA 4UWMA 1GQIA 2Y2WA 5DELA 2HBXA 3ABSA 4PRRA 4GOAA 3VGFA 1XBZA 1I0DA 2C1IA 3EDEA 2J25A 1BWLA 3E2RA 1BYCA 4NKCA 3PZVA 3OLDA 3S2CA 1WDDA 5AHEA 1HL2A 3AUJA 2XIIA 2ZIDA 4FLOA 1U30A 4J5NA 1NU5A 1IQ8A 3VA8A 1B0IA 3XIMA 1R7AA 1IEVA 2BFGA 4IIDA 1UZ4A 4LUTA 1KKOA 2Y8KA 2JGQA 1GUVA 1VH7A 3FY1A 3G1SA 1MUCA 1R7OA 1TZ7A 1M01A 4UNLA 1Q6OA 3P60A 3AZTA 1PWMA 3T4WA 3MYOA 4N9CA 5I3FA 5CZJA 4RR4A 1E72M 5D8WA 4LY4A 1RJQA 4DXVA 3CIVA 3RMEA 3AXMA 2WKLA 4Z1BA 2PDIA 3MI6A 4MWAC 4KEZA 4HD5A 1QDSA 2FFCA 1MRQA 4PE8A 3AISA 4O0QA 4JN6A 4O0ZA 3W29A 1QCWA 3PM6A 1KLZA 1FUYA 3I7RA 5EL1A 3H2AA 4B3ZA 3NTYA 5E0KA 1H1NA 1ZCCA 4Y9MA 1VHCA 5C8BB 7TAAA 2XWDA 4QAIA 2PURA 4B92A 3RILA 4GC4A 2F6UA 5DLCA 1TJ1A 3TN4A 1AD4A 4RJEA 4DJFC 4O1EA 4LEQA 3K5XA 1VBHA 1DJYA 4GY7A 1J2BA 4BQ4A 2CKSA 3OGSA 1GJWA 3V5OA 4GVFA 2ODOA 3GK0A 1J79A 3A3HA 5KZMA 3TQKA 5TBOA 2XHYA 3HN3A 1W5QA 3QSTA 2IPJA 4PUMA 3BLLA 3FYPA 4O50A 5HUOA 1TCDA 3NQFA 3ONCA 3RUBL 4QIUA 2J66A 2NXHA 4DJDA 1XR2A 3VIFA 3UESA 3R0UA 3HB9A 2X05A 1HVXA 4M5PA 2X16A 2D20A 3FA5A 1OSEA 3OEXA 4PTWA 1SR9A 3LGGA 3OHMB 3LTYA 3N11A 3C2EA 2XSAA 3WFAA 4XAYA 3EX4A 1MSSA 1DOSA 3F4WA 2V69A 3WEOA 4JDYA 1UWUA 2YL6A 1EQPA 4WVXA 2G3JA 1NDWA 1IWBA 2UV8G 3ZQ9A 3SUSA 4EWJA 2PU1A 2F6KA 4YVPA 3EDKA 4GIRA 1TJRA 3FV9A 4AXKA 5GJMA 1XRSA 1DV7A 1FQ0A 1ZQ5A 5JIPA 5DF0A 2HE8A 3VDBA 2D2OA 1NFBA 4W84A 1GQNA 4Q33A 3BH4A 2RH9A 2Z6IA 1ZALA 1GZJA 1H51A 4Q6XA 1UP3A 4P7OA 2Y85A 3DBNA 4QRNA 3ARSA 1H4PA 3HGOA 2NSOA 1TQXA 4MGGA 1H1YA 4Z1YA 3A9BA 3CTTA 1J12A 3FVDA 1KR0A 1DWAM 1W91A 2PDYA 3B0XA 4S2BA 2CESA 4EKJA 3CTLA 3GYEA 2D0GA 3USZA 2EXOA 3MUIA 3HPSA 4QM1A 4XQ6A 2WJFA 1N8IA 3UGRA 2VT0A 2PLKA 3CUGA 3TQPA 4H9UA 1R5YA 1R47A 4GI4A 3MZ2A 1GKPA 3G0UA 1TX2A 4UR9A 1DWHM 4J3VA 1LWJA 2V67A 1H61A 1O94A 5FSDC 4PMXA 2AL2B 3ZS4A 1XCFA 2P0IA 1VBRA 4GK8A 4IGNA 3CQIA 1I2OA 1FHDA 1R86A 5CJMA 2NV9A 2VOTA 2ZRZA 4I9JA 5ABFA 2X0YA 7ODCA 1J0ZA 1CPUA 4CQCA 1UWQA 1FCUA 2C19A 3L4WA 1M68A 1C90A 4EXQA 1U2YA 4JTHA 4KS0A 2EQDA 3PB2A 3OYZA 4DF0A 2WQDA 2VCCA 1VEPA 4HTYA 3TAOA 4PL2A 4HCDA 4P8VA 5I2UA 3TW7A 2DIKA 1S38A 1NP0A 4DBWA 4HPXA 4L1XA 1AMKA 1D8CA 1PB0A 3G0SA 1E9LA 1X8FA 2D2JA 3PZGA 3N6JA 1W1IE 5E0FA 3MBDA 3LS9A 4LC8A 2YCKX 3E0FA 3O06A 3FLUA 4ML4A 4O52A 4X0NA 1PSCA 4FNUA 2FB2A 1JCXA 3W00A 4PBFA 1SZNA 4X60A 2V2DA 2HRWA 4EOUA 5A94A 5BMWA 3Q45A 4K7VA 1TFVA 2CITA 1HKJA 1W9DM 3E0WA 1R87A 4IPPA 4KCTA 5CKSA 3P7YA 4OUEA 3MHGA 3BE7A 1R85A 1NOUA 3TROA 3ZZ1A 1A5NC 2FB3A 3CT2A 3U4FA 2VD8A 3OA5A 1V6TA 2E6YA 1MW0A 3DGRA 3O6DA 3PBWA 4S3DA 2ADAA 2YX0A 2HJPA 1H1ZA 1SW7A 1OK6A 3T8QA 1EFZA 5I7GA 1P6WA 1NWRA 3DUGA 1XLBA 3FOKA 4NXSA 4RXFA 3WQ5A 4JTRA 3T0DA 4IFOA 1TYGA 3WUEA 2HE5A 3WEZA 1ZP3A 1THFD 4FEZA 4J3XA 2ZQ0A 1EP3A 5HATA 1M04A 1HFBA 4PB5A 1XICA 3AROA 3UBPC 3PZOA 4AHOA 2PWHA 1W6TA 2RGMA 2O92A 1OD0A 3CGTA 4IP7A 1X8CA 2ZDSA 3W7IA 2Y62A 2E8YA 4S3BA 2ZWYA 3BQ6A 1CGUA 4CNNA 3ICJA 1NQKA 2VZSA 2ZXDA 3W2JA 1GG0A 1GVSA 3ZXWA 4WD0A 2OT0A 2W61A 2FVKA 3CL7A 3AOFA 4L61A 2D1ZA 3LG3A 3OGRA 4F0RA 2WQPA 3W2LA 3DG6A 3CO4A 4D8ZA 3ME3A 3UWYA 1VBGA 4A2SA 2NT1A 4PC8A 5IM51 3OIHA 2WSRA 1W1ZA 2DH2A 1M6JA 3P82A 1DJXA 4MKVA 3TX9A 5ABGA 3VFLA 5C6MA 3U7BA 5D9MA 4L80A 1DIDA 2VURA 3GRIA 3AIVA 5E70A 1LT7A 1WDPA 4QE4A 4PRWA 4MZYA 5HK4A 2VC5A 3LENA 3TDFA 4WGHA 4Q4OA 3ITYA 3AICA 3NA8A 3N73A 3R25A 3ZJ6A 3W4RA 2WANA 1WKEA 3QKEA 2PC4A 3E5PA 2PDFA 2QF7A 2Y7DA 5H8UA 4AISA 5G2WA 4NAFB 2NQHA 3R0KA 4JHOA 1EF2A 1PDZA 3B0PA 3WK3A 2YA0A 3UWEA 4M7TA 3W7NA 2J7EA 3LBMA 3AXHA 2C79A 4QE1A 4E8CA 4JQ2A 3VOIA 3PS7A 1XGDA 5B7ZA 4DWSA 3JRKA 2NW0A 5CSRA 1TVPA 3WY1A 2PTDA 1BXBA 4EPBC 3E96A 2WM1A 3C0SA 3VM7A 1ALDA 1FDJA 3UPWA 3UXAA 2VFFA 3VC5A 3CYJA 1JZ7A 4O54A 4CD7A 4JKKA 3QF0A 1UBPC 2DT1A 3CHFA 5DXYA 3G0XA 3E2QA 4LB3A 3E0IA 1MO0A 1V0KA 3NZRA 4JTCA 1R0MA 2VRKA 3WELA 1A3HA 1HIZA 4QLLA 4Y2WA 1GHRA 1T99A 4AVNA 4MM1A 2H8ZA 4Q22A 2A0NA 3TN5A 1QPOA 2DZWA 1DJZA 5DO8A 2VI0A 1UIOA 1L6GA 2PZNA 4E38A 3IJ6A 4IMEA 2CEQA 4IP5A 3KVLA 1MDRA 1QI4A 4DM2A 2HS8A 4XZ9A 5FF7A 5JUVA 4H9YA 1XRVA 4AF0B 3MMTA 4CQDA 5DQPA 2NWRA 2P76A 1BVWA 2DPEA 2VX7A 4OZOA 3DCPA 1F07A 3NYDA 3B9OA 3A21A 3SCWA 5K9CA 1XLFA 1JIBA 1GW9A 4J9JA 2Y5SA 3W1NA 2A85A 3CZLA 1MW1A 3ZLFA 3INPA 3AYRA 3WBAA 1GVOA 3WBYA 4ONVA 1PZ2A 2OEJA 6PTDA 3ONBA 3F2CA 4QGCA 4PA8A 2F2KA 3BK0A 2WZMA 4HKPA 4LCRA 4Q7BA 3C6CA 4ZQNA 4UNIA 4A3UA 3RLVA 1WE5A 2QVHA 5LA1A 4OIFA 2Q3OA 1RVKA 3DERA 4HOWA 3LNPA 4XKYB 3MV01 1EEPA 3TWAA 3I3DA 5HOSA 4AFYA 4D6DA 1NWSA 2XPKA 3BAKA 3SB0A 2XFWA 1XCXA 3CUZA 5G2IA 2XUCA 4PMNA 3S9ZA 2X30A 4O1DA 3BLFA 4AW7A 3KRBA 2J6VA 3R2GA 3QLDA 4NNBA 4DM1A 2ZVIA 1RAKA 4BEUA 4ATLA 1GONA 2FTPA 4M6UA 4RZ5A 1ISWA 2H3BA 4S39A 4FB7A 2OZTA 5AHIA 4LYPA 4E4PA 3MANA 5D04C 4Z08A 1S2AA 4C6NA 4PUKA 1XP3A 2PDPA 1GPFA 3VPLA 4YJ5A 1TA3B 3HA1A 3AXXA 1KWGA 2ZADA 2PP3A 3WMLA 2XN0A 4OWGA 2OYLA 4PUEA 1XLGA 2GWNA 3SGZA 3AIWA 3U3HA 3MO4A 4S38A 1D3GA 1MQRA 1VFSA 3WEMA 3MUAA 4FNPA 4IPIA 2X1RA 2O9TA 2VEGA 1SPQA 4MPKA 1L6YA 4JEJA 4A35A 1RP9A 1R2SA 1DKWA 2HNHA 3ZT5A 4H6EA 2HK0A 5E93A 2NV2A 5LIKX 5DBUA 3G8RA 3HO8A 2EJ1A 3ECQA 4X9YA 2UY4A 3NM1A 2Z1KA 3PZQA 3S5ZA 3NAVA 1FKWA 4MJ2A 1EL3A 2DVTA 4E8DA 1F76A 4L4PA 4TVDA 3W75A 3NO3A 5CBIA 3B8DA 4HA3A 4H6RA 2BY3A 3IIOA 4GJ1A 4LAKA 5AHNA 3RFAA 4DBEA 3ARWA 1F7BA 4K38A 1SJDA 3VYLA 3BW2A 4MB3A 3CM4A 2H8XA 4JTUA 1EJRC 4XK2A 2JK2A 4FX7A 3NQ6A 1O5KA 1K9DA 1EOMA 4P8XA 4IUOA 2WXDM 2IKGA 4J35A 3O63A 1VFHA 3WLLA 1OZMA 4KMQA 1V02E 4ZE4A 4GPNA 1QNSA 2KAUC 1K70A 2CBVA 4DBDA 2YFNA 4J1OA 4B5XA 3TN6A 3GU2A 3IAQA 3LX9A 3RPMA 5LXEA 1JL8A 4R27A 3F5LA 1NSJA 4M80A 5AC7A 1EBGA 5D03A 3N1AA 4JTFA 4YWSA 3P8IA 2D3NA 3EA1A 5IFPA 4N9BA 1QJWA 4GINA 3BPWA 3EA3A 3JZUA 4JFVA 2HTMA 4DJEA 2VNCA 4KCVA 1O6IA 6TIMA 3ARRA 2G4JA 4NI3A 2P0OA 3DC8A 2ZX5A 2Z0IA 2TMDA 1UC4A 3UYCA 4WKAA 1K4GA 4A8NA 5I5RA 3NL6A 3KX6A 3VNDA 3IWPA 2VCBA 3P5ZA 1ZBKA 3MJYA 4R88A 1YXDA 4HHLA 5HWMA 3EB4A 1NIUA 2QUTA 3LZ3A 1KC7A 4I3GA 1VR6A 4E2BA 1SR0A 4IGSA 5CPSA 3UD6A 5J5DA 3GU1A 1G01A 1KD0A 4HOXA 4G7FA 2XFYA 4MDOA 3TUUA 1OYBA 2HEJA 4HYVA 3SW6A 3MT1A 4HPGA 1YX1A 1SSDA 1N55A 1XGZA 4RXGA 3G1XA 3PPGA 1G1YA 4L1WA 3DU0A 3MVTA 4F4RA 3M0HA 1JI2A 1LL6A 4RLIA 4EVZA 3NO1A 1PTDA 4GABA 4GACA 4HNTA 1I1XA 4HPNA 5FSEC 1XLJA 5I06A 1UPPA 1V3IA 3SDOA 1N2VA 4MWAD 5K9DA 2NUYA 2D24A 5I23A 5FL0A 3VIMA 4ZQOA 1AJZA 2V5LA 2V63A 3LHWA 2EPMX 5FF0A 5JBEA 3AAMA 4L9YA 4MY8A 2AOSA 2ZICA 2XVNA 3LLXA 4MJ4A 2CLOA 1Q13A 2ZX8A 5BWAA 5HR7A 5HMEA 1ZBVA 2BVYA 1UMYA 4HK7A 4NUWA 3UGVA 3W26A 3G5EA 4S3EA 4EPEC 2WPGA 3GG7A 1XV8A 2VEMA 1XYAA 4DJDC 5H91A 4QSHA 2V30A 2P10A 1H5YA 1Z42A 3M0VA 3TNOA 1S5MA 2OX4A 4L1GA 3UJ2A 4DXKA 1VS1A 3IJLA 5AYIA 3W1TA 1OWQA 4LV4A 1L9WA 1XM3A 5B7YA 2UY5A 1E5JA 4ATDA 4WDUA 1LF1A 4KCUA 5MHBA 3RYSA 2WV8A 1C8YA 4UXDA 4H19A 4UFLA 3ARPA 2YA2A 2BXVA 1WKYA 4EXAA 3RRAA 3W7DA 4J28A 5KETA 4Q4MA 4NAEA 4JKLA 3GKFA 4FALA 4C6CA 4IGMA 6XIMA 2AAMA 2J4GA 3ITVA 3VKBA 3UG3A 4Q3MA 4TX8A 3K8MA 2QV5A 4Z2KA 3QR3A 4KW2A 4QG8A 4UFMA 2QVNA 3VE7A 2ZUNA 5CH9A 3NGFA 3PWAA 2ISWA 4RZ4A 4LRSA 2ZCGA 5KTLA 4UMBA 3ZLHA 1TJ2A 5EU9A 1PYFA 3NQGA 5GJPA 3KCJA 4UOZA 2AGTA 3K4WA 1C9DA 2DZXA 1VYRA 1L0PA 2CLPA 3QQ0A 4EAMA 1WZLA 3VVGA 3R7MA 4UR8A 1OFDA 1DPMA 3T40A 1W17A 3C52A 3AXIA 2GJXA 3GUWA 1RCXB 3GXIA 1K4HA 1HXJA 3TYAA 3VUSA 2C13A 2IS7A 4AH7A 3RMJA 2QEZA 4B5TA 3VCCA 2VFHA 4W87A 4JN7A 4HNVA 3C3NA 4N9DA 3G6MA 4AX7A 1X7IA 4NJHA 3TYUA 1H09A 1IR1A 1XLMA 2QJHA 4LVGA 3GR4A 3BVJA 3PBMA 4QS5A 3SQMA 1CXKA 4RDVA 3BQ5A 3L4VA 4NIRA 3MMUA 4YCPA 3FSTA 6REQB 3S6OA 1ICQA 2FLIA 3BSGA 3DZ1A 1K7XA 2YYUA 1RVGA 4HNLA 2JKAA 2WO5A 3H2FA 5AC5A 2OOFA 4RZBA 1JCLA 3WZ0E 3A47A 2PAJA 4FLQA 2OZ8A 4LUSA 2CLIA 3G8EA 3WK1A 1DQXA 2CBUA 4AEOA 1AUSL 1TTPA 4C6LA 1QRQA 4CQ9A 2OWWA 4WGXA 4QE5A 2QT3A 4N02A 1FWHC 1KBBA 1FXPA 2J88A 2VEIA 1G4PA 1X97A 5IXEA 5EMKA 7CGTA 1XIGA 3I68A 2AL2A 2ZA3A 4HNCA 1LBMA 1F73A 2PDMA 4L5ZA 2ZRVA 4PUWA 3F1QA 1WOBA 2PWUA 2QULA 4GUFA 1MMFA 4NQ1A 3TP4A 1Y65A 3RM8A 1VP5A 1OVDA 1N8WA 1FWDC 1KFEA 4JCLA 3EWYA 2ZA1A 1C92A 1DWGM 5FI8A 1IYXA 4QISA 1NWUA 2G41A 4F3HA 3LM3A 4K1GA 4JNZA 2E4TA 3CNYA 1WCGA 2D22A 4LANA 5SWUA 1B5TA 2Z27A 4GQQA 1D3HA 4CU8A 4P5UA 4MLJA 3MJMA 4AZGA 1E9ZB 2FPTA 3L5AA 1PTAA 4W93A 1AG1O 4MB1A 3WNNA 3URAA 1WDSA 1KQYA 4GY0A 3R0DA 2FGZA 5CPQA 1FWCC 2YCJA 1W3NA 4DO4A 4LJ3A 2W6RA 5BU9A 1E4MM 4QG6A 2GK1A 5I02A 2WKGA 2R14A 3GR7A 3HGJA 2XGZA 3KTSA 1HKWA 4JHZA 1PX8A 3I7SA 4Z17A 1KM1A 3V35A 3VX1A 1CCWB 1RLDA 2OR2A 1LOSA 1TPVA 4J3SA 2PMQA 4DJED 1EIXA 4JQ4A 4KWWA 1QBBA 3A64A 1W9BM 3OGVA 1V6XA 1NOWA 3EMQA 3VCNA 4GO9A 2GWGA 4JTIA 1MXSA 5TF0A 4QAWA 1XW8A 4MZ8A 4FXJA 3NQ7A 2ZBTA 4MSSA 4UTMA 4UTIA 4OTKA 4LV9A 3RLUA 4KEMA 3V3WA 1I9CB 1WXYA 1YYAA 1GVFA 2ACQA 4GHRA 2IQDA 4HTBA 1YE6A 1Z69A 3EB3A 1W1YA 5CAKA 3I10A 3OODA 4TVCA 4JX6A 3UP8A 4U33A 3NG3A 3TC3A 4PB3A 1TTQA 4C5YA 4GCXA 5G1MA 4K7YA 5A2CA 3GW3A 5J8LA 4TX6A 1TWDA 3I3EA 1UCWA 4ZL1A 1HJWA 2Z2AA 4ZVJA 2VFDA 2UZ9A 3E49A 3KL5A 2E0PA 3T08A 1JYWA 2QJGA 4O57A 4E3VA 3GR8A 4A8IA 4FOJA 4RUBA 4ACZA 1OB0A 1P1XA 1EJVC 4XZBA 4IUGA 4LNYA 4YWIA 3L65A 4QNEA 4RX0A 3SECA 5HINA 3C8NA 3ABQA 4BI6A 4ICNA 1Z8AA 5JBDA 5A6MA 2D2GA 3S9YA 5T8GA 3KZSA 3B06A 4WHBA 3M5XA 1QWKA 3AS1A 3N15A 3CWHA 3PHAA 4MWAB 3DG3A 9XIMA 4C6OA 3NPXA 3APYA 2ALRA 3EWZA 4GLEA 2UY2A 5BW6A 2AQWA 5JVLA 3M0XA 4WY0B 5FF4A 5IHRA 3T42A 3RX2A 1K8XA 4UIOA 3IJ9A 3QFEA 4LPCA 2B4GA 5CZ0A 2Y88A 3MCMA 1EPXA 3P93A 2UWFA 1BTCA 4OGZA 4OJYA 2R1KA 4OU1A 3SIZA 3B3DA 2HSAA 3FJLA 4G7EA 2BZNA 1UROA 5CPNA 3BZJA 1YPIA 2KX9A 1GOIA 1NELA 4WDTA 3ID7A 2UY3A 1L8PA 4Q32A 3IVTA 3HQNA 1R30A 4LUYA 5D8ZA 2A6LA 1GHSA 1OG0A 4XTDA 4IQJA 1XKYA 4NZJA 5H2ZA 4LYRA 4M6PA 2PRLA 1LYXA 1EBHA 4A2RA 4ZMGA 5D2YA 3I4KA 3NO5A 4TV6A 1CLXA 1Z41A 1RQBA 1JZ6A 1VIZA 3VZZA 2XFFA 4NZ4A 5I78A 4L6DA 4NHVA 4MYAA 3M0MA 1MQQA 4JR5A 4LW7A 3LSCA 1FHLA 2BX7A 5AZ1A 2A2IA 4KWOA 2GL5A 5HNTA 4MVAA 2QCHA 1L6WA 4DEFA 3NR0A 3PTDA 1DTNA 2QCDA 1SU5A 4HU0A 4PMZA 2PDXA 4UCGA 4CN4A 1IEQA 4AWSA 4LBUA 4NILA 3BLEA 4CNPA 3G1VA 1X6UA 1XSIA 5F7UA 3WLQA 3WQPA 1KXVA 4LYQA 1B1YA 2J9YA 4IPLA 4Z2IA 1TWSA 1T41A 4D9PA 3WD0A 2GGEA 1YXYA 3BOXA 2OLSA 3PK7A 3GTFA 1BG9A 4Y9OA 4RNHA 1HT6A 1QPNA 3VDCA 5AFDA 3W7QA 2Z1SA 1JCJA 3CU2A 4GXPA 3DX5A 2CC0A 4RK8A 1V08A 2ONEA 1R6WA 3W7OA 1E6RA 1AJ2A 5I3JA 2QW5A 1DHPA 3JU2A 2I57A 1HNYA 5D32A 1NTHA 4KERA 2GJLA 4IHCA 2WMIA 3S3GA 2GDQA 3MTWA 4LXFA 3C56A 3KRZA 3PTMA 3T05A 4W9TA 2QCEA 3WH8A 3TCEA 5FJPA 1RY8A 1F6PA 3V16A 2EF9A 4JN8A 3MUXA 1F9CA 1B2YA 2I5QA 3UNDA 1OC7A 1E71M 3AJ7A 2CZFA 3U5YA 2ANUA 4P8WA 1WDWA 4JYDA 5FAJA 3IUIA 5BRBA 2C8NA 3KUMA 1DXFA 1EDTA 2ACUA 3IJIA 3VIPA 4EAYA 3GWQA 2XIOA 1EC8A 3W81A 1HKMA 1HTIA 1NOFA 4YCOA 3WNLA 4C1NA 4PCSA 4KCWA 2BY2A 1AA1B 4ZTYA 3WQVA 3OQ8A 3BCJA 3NZPA 3FAXA 5D38A 2BG5A 3CPRA 4TX9A 4FO4A 1JG9A 1NAL1 2V5DA 1UH3A 2C0AA 2VRQA 2W63A 3LTSA 3LZ5A 1UZDA 2PU0A 3LERA 1KXTA 2GSJA 2O9RA 4AVFA 1TE6A 3FNDA 1MUWA 1RLCL 2J9ZA 1B57A 1ECEA 4JFTA 3N18A 4MNJA 1LP6A 3OB8A 4M51A 1FFRA 2AMGA 4GY1A 5KZEA 2I56A 4H7VA 3P5YA 5A6LA 1KWKA 3UY8A 3HQOA 1YW1A 3PNUA 3G18A 2QGYA 3QR0A 5BOFA 3VIJA 4FXRA 2A3LA 4PODA 3W7JA 2ZX9A 1W9PA 3VMOA 3L67A 3EPNA 1YDYA 5HR6A 3SCRA 3ZSTA 3TYBA 1ZP4A 3FGCA 3UJSA 4LVFA 4IGHA 4NX0A 1J0JA 4DJEC 4IMGA 4V33A 4AEFA 4HQVA 3WDJA 6CGTA 3SBFA 4WY0A 1WO2A 3W2UA 2VXNA 1ZPTA 1CX9A 4HBKA 1O7AA 1V6WA 1EUNA 1ZBWA 1V4YA 3WQGA 3D6NA 4MB4A 3TIMA 4JEQA 3H54A 3V75A 4C6EA 3ZWTA 1WXZA 4HB7A 3GNXA 4S2CA 1H7OA 1XCWA 1XD0A 2NQLA 1S3HA 4KT2A 2W4XA 2J7FA 3NWRA 2DGAA 3CB8A 3THDA 3GIQA 3XISA 1REQB 4H8VA 3GAKA 4ZQCA 4O0KA 5D2XA 3TA9A 3B9AA 5AYBA 3DI0A 3BLIA 2E25A 1MRAA 4R9OA 3K13A 1F05A 5A2AA 4Z2LA 2GJRA 9RUBA 3O6AA 2AGKA 2ZE3A 3BW4A 3R8GA 4E5TA 3BXWA 1OBAA 3CL8A 3QHMA 2VM8A 3NXFA 4JQAA 1QOQA 3A9IA 3VZYA 1RCOB 4DI9A 4KGJA 1LROA 4ZO9A 3GVQA 3NQCA 4JTLA 2A7NA 3FXGA 1RBOB 1WB0A 4UQCA 2VQUA 1XLCA 3VZXA 1J93A 3CZJA 4F0KA 3Q94A 4CNSA 5CG7A 2I9UA 4YN5A 3WDIA 4AHQA 2V5BA 3I6TA 3LB0A 2VRJA 1JPMA 1XBYA 2ZUUA 1PS9A 4M3PA 3PR2A 5E5CA 5IRPA 2HPMA 5BMXA 3FHAA 4INFA 1RHCA 1K7EA 4RKAA 4AZ7A 4BI5A 2BVDA 5F4XA 3GG8A 4FR6A 3WLRA 3UZWA 4HIBA 1OCBA 1FWJC 4US5A 3GC4A 1EGMA 1QO5A 3SM0A 3GHUA 2J47A 1KRMA 4F0HA 4P2VA 3MWCA 1RD6A 4XISA 3PANA 3W1UA 2QYGA 3ES7A 3W2KA 5ABTA 2WOQA 3PTKA 4UZSA 1UWAA 3QMSA 5F1VA 3TAKA 3MDUA 3GDLA 4FR1A 4WF7A 2JKPA 5F2MA 4PMRA 1M5WA 3A23A 3GHSA 3FW6A 4HMNA 2G8ZA 4EP8C 1XX1A 3JS3A 3PBVA 4RNJA 3L2MA 1R3TA 3H21A 3EOLA 3CH0A 4IISA 1PIFA 2X41A 5A95A 3G3DA 1RZMA 3VOHA 4TTGA 4HU3A 4IPNB 5AC4A 3MKCA 7TIMA 3IIXA 1JPIA 4HT3A 4KETA 4XVEA 2RAGA 1XDJA 3MVIA 2BOFX 2XU2A 3OZOA 2PCQA 5G4EA 2ISFA 2DW7A 4A3RA 2E6DA 3W2NA 2I5GA 2EPLX 1TMLA 1OX5A 2VFGA 1KGUA 4PCPA 3DBPA 3FKRA 3OZMA 3L5MA 2RJHA 1DJNA 2PTXA 4W85A 2VR2A 4L4LA 3DENA 3LCFA 5BOEA 3C61A 4E2OA 1KNWA 4AB4A 4LVAA 1UYQA 4W8LA 1ZFJA 4CU7A 3ZVHA 3T9PA 1KFKA 4KF1A 1EGZA 4O10A 1SW0A 1FWRA 1HKVA 3PUGA 2WM0A 1UJPA 4ZGYA 3EWCA 2G3IA 2VGIA 2OZ0A 3TW6A 1GZGA 3DFNA 9CGTA 1TV5A 3DC0A 3UWZA 1A50A 4Y8EA 2XM2A 2OYKA 3LCLA 4FX8A 3WK2A 3MCNA 1YLVA 4MY9A 4FK9A 4BEQA 2NVDA 3JR2A 3CPGA 2YYTA 2JF7A 2RFGA 1X98A 1EB3A 2C71A 2WPBA 4JIIX 2P50A 1BLIA 2CIPA 4C6FA 3BG5A 1V93A 1G7UA 1S2TA 2D3LA 5CPMA 2YZRA 1KBLA 2ZUVA 3LU2A 4PBGA 2A3CA 3KCOA 2QHAA 1GK8A 4QITA 4ACYA 1XLIA 3FJ4A 2EAWA 3STCA 1AD1A 4GA8A 1XLHA 3UETA 2Q8XA 2ZWZA 3EGJA 2RDWA 3N25A 3U0HA 5FJTA 4UBPC 5T26A 1KRCC 1I60A 2HDJA 1RQEA 2FQIA 2CBJA 1VKFA 1GTHA 2VWTA 1P7TA 2VZVA 4IIHA 3RX3A 4JS3A 3VGHA 1O95A 2ZFAA 1UUOA 4UFKA 1LRQA 2CBIA 4QCEA 5ABEA 3R10A 4MUPA 4Q4KA 2VVSA 1LDCA 1BRLA 1SZGA 3TA6A 1JDEA 3UZYA 4AY8A 1YKWA 2R82A 3E38A 1LQAA 3UW6A 3GVVA 1U33A 1NJJA 5HJXA 3M6DA 4EPKA 1QO2A 3DFHA 1D2KA 3O8AA 4Q8OA 4YHGA 4X22A 3KOWA 4GVHA 1UBSA 1MUMA 5EGRA 1ONRA 4XZWA 2W9MA 4NNAA 1OYCA 5AB3A 1TPUA 4JAWA 4MMWA 1YXCA 3FCPA 4Y9PA 5HJYA 4C1NB 4TMCA 3C2VA 4ZFMA 3QW3A 4YNGA 2YDRA 3F2DA 5LZLA 3AU2A 3TLQA 3KWSA 4ICMA 2E5BA 1LG1A 2CPUA 2ASHA 3T55A 1UQZA 2PDBA 3WD3A 4WSHA 3QHNA 1EZWA 1XISA 4NNCA 3QKZA 4B9YA 2ACSA 2XINA 5CZKA 1Q6FA 2V6AA 2Y0FA 3ANUA 3ARQA 1XYFA 5GNXA 3V1HA 2Y4SA 5A8QA 2R24A 1PV8A 1A3XA 1XIDA 3EKLA 3N3TA 4H04A 1GOXA 2ISVA 4B90A 3VKJA 1GYNA 2QJIA 3GFXA 4L9ZA 2J75A 2QPUA 1NQ6A 2NX1A 4TIMA 5I77A 3WQ8A 3S5OA 4QJ4B 1UOZA 2DW6A 1SO3A 3URNA 3MHFA 2VTFA 3ITCA 2XFRA 5FJUA 4NJGA 3GVWA 5REQA 4MNMA 5EPDA 2PDKA 5HA7A 4QCFA 3DHPA 3P80A 3N9RA 3NNTA 3BUVA 3G2GA 3MU7A 3ABRA 2FMNA 3AHXA 3O05A 1IZJA 3S47A 2DSWA 4J2PA 4Y96A 2WYSA 3KAOA 3GH4A 1IF2A 2FZ8A 3KBSA 4A4AA 1WNOA 1S5WA 2GPTA 1N8FA 3VKDA 4J3ZA 5C2CA 4UR7A 3LPOA 3KTXA 1VPYA 1UASA 3MSGA 4KWUA 1YADA 5C9ZA 4BKNA 3M46A 4HU4A 4DWDA 3SCVA 2Z1WA 2PP1A 4I7UA 5J04A 1OT1A 5FEZA 3TOPA 2I5IA 3Q4DA 3AYTA 2E28A 1J96A 3B8TA 4F40A 2P88A 4H9ZA 1ELSA 3KHJA 4B2DD 3B04A 4UQBA 3VNYA 4GZ7A 3VNIA 1LWIA 1L8NA 1TZ9A 4DX3A 1OFPA 2V81A 2HQAA 3ZJ7A 3FYOA 3GUGA 4N6EA 1ISZA 4G2DA 1MFUA 3LCXA 3EX1A 3PAJA 3WLJA 2NVAA 2GGJA 2Y5EA 3AS3A 4M19A 3LYEA 2J77A 3KLKA 3U2EA 1GJPA 4NU7A 4ML9A 4I8YA 3KDNA 4S3CA 1IV8A 1MFVA 3TONA 3WL0A 3W1XA 5EMYA 3W01A 3N12A 4FX6M 4EE9A 3NDZA 5FJIA 1UUMA 5CSYA 3GXTA 3PG9A 1H41A 1GOOA 1AW2A 1ONXA 5LNWA 2E9MA 4FXFA 4V27A 1OFOA 4O15A 3H2EA 3B9DA 3DECA 3G6LA 4NAEB 3AMDA 3LGDA 4DYKA 5BU6A 2WJDA 1EQCA 3CEUA 1J9YA 3MSRA 4YTSA 3W83A 2WJEA 4FNTA 4CNTA 1QI3A 1FCVA 1NFGA 4G6CA 1CB7B 2FHBA 2WCGA 4G8TA 1A0EA 2VEKA 4YYFA 4UTLA 4ADSA 1R3RA 2EPOA 3M7SA 3MCOA 3GH7A 3CEPA 4D6JA 5HNRA 2CFFA 3Q65A 1M7PA 4JICA 1I75A 1RH9A 4CNOA 3VILA 3T7VA 1WZKA 4V15A 1EXBA 1TPWA 4RL3A 3UVIA 1QVBA 2X0HA 3RIKA 1A5MC 1S1RA 3E1F1 2GSHA 3U4AA 3EMZA 5F2IA 3ZLGA 2GUUA 1A5CA 2CYGA 2PDHA 4PTVA 5EYWA 1RBAA 3VD7A 4H7ZA 3SGGA 5C9RA 2DZUA 3HG2A 3VKCA 4GKLA 3QVQA 1JXJA 2OKOA 3E12A 2EPNA 2J7BA 1U5VA 2VX6A 3UEQA 3GXDA 2DT3A 4BWLC 3K8LA 4REQB 4PUUA 3UA4A 2NXGA 3O15A 5F2LA 4JIRA 1S5TA 2PGEA 1JDCA 3LBOA 2DUZA 1CEOA 4NJIA 3DYMA 1AQFA 4ES4A 4MPQA 3ZVHB 5TQLA 3MI2A 1I2NA 3ZT6A 1BPLB 4HZ8A 4UNKA 1G9HA 4AQLA 4LH8A 4F0LA 1MZHA 4DYJA 4GZJA 3VUPA 1JD7A 3W73A 2CZEA 4IL2A 4R3UA 3O2LA 1F4HA 4NT0A 1AQHA 1PWLA 5TD4A 2X40A 2X1TA 2E1WA 3R6IA 3WDQA 2VELA 5LGZA 1BSIA 2XIBA 3AJXA 2DSVA 3BJFA 3OZYA 3W7LA 3IUHA 4QDWA 4HSOA 1E6XM 1XYLA 3DYOA 1UWSA 2ZZ2A 4Q6JA 3LN3A 1LL4A 3H2NA 1WV2A 4EK7A 1W5OA 4YU1A 3WLHA 2OU4A 3KDOA 3D46A 2CLMA 3E02A 4LYKA 3VU2A 4FLRA 4IQDA 4XUYA 1Q2SA 1DXIA 1KGXA 4C6QA 1VF8A 1EYWA 3SGUA 3QV7A 5KITA 4DYEA 5C9WA 1BWKA 2QXWA 1DQWA 4CQBA 1E5NA 2CW6A 2OWCA 2FJKA 4TV5A 3W6LA 2GDVA 1QPQA 2E3ZA 2VDGA 4DWSD 2TYSA 1BGAA 4DELA 3AS0A 4DWSC 1OABA 1YPXA 1S2VA 2TRSA 1BYDA 1G6CA 1V79A 2NQZA 4C6MA 1A0DA 3L66A 3T8LA 3HOJA 1AW5A 4C7FA 1XJBA 3CAQA 3L9CA 3B9EA 5FKYA 3O1NA 1RA0A 2H90A 5CJ5A 3LSBA 3YPIA 4I6KA 1UA7A 1WPCA 2RHGA 1IZCA 1QI0A 4DUXA 3ITXA 1CXFA 1IR2A 4BJHA 5JIWA 3OVRA 4PTMA 1SO6A 5A6BA 4I6VA 2P8CA 2CNCA 1G0CA 3LNMA 1V0NA 4KIEA 3GX9A 2QUUA 3M0JA 2WVSA 4Q8MA 2PF0A 2X7WA 3O16A 4C65A 5A6JA 4UTTA 1KM0A 2WMJA 5KZDA 1GVEA 1OFBA 3CK5A 1GEHA 3AALA 1UG6A 2HMCA 2OLAA 3SN0A 4W7WA 3EA2A 4O14A 3R58A 3EB2A 3QTGA 3DKLA 1E6SM 1WUFA 4XBJA 3H53A 3MMWA 4LGXA 4W88A 3U2ZA 2ZUTA 1KTBA 1YBQA 2BOGX 4QLKA 3DG7A 1UZ1A 1PUDA 3BC9A 3LMYA 2R8WA 4LBRA 1XUUA 1KFJA 5KINA 3B97A 1G5AA 1VAHA 4TMBA 1GYLA 3IV8A 5HNUA 3QLLA 3F4VA 1LUCA 1F74A 1XL9A 1ZHAA 3U5UA 3H70A 3QHOA 3W53A 3UR8A 7XIMA 3WDPP 1KCZA 2TPSA 1XKJA 4HN8A 3NOEA 2G96A 3LA4A 1TG7A 2WMGA 1O1ZA 2C15A 2VDIA 3AMCA 1F3EA 4Z2HA 1IT7A 4D72A 1XSKA 2AKMA 3VGGA 3OG2A 1QBAA 1T5AA 2YPIA 2NLYA 2ISSA 3M41A 4K8GA 2Q01A 2H3DA 3S5NA 1IZKA 3CV1A 1J2WA 4EWND 3TQVA 3UYIA 3V36A 4WOZA 1G67A 1AFSA 3APGA 2TODA 4HPHA 4UQ9A 2IMRA 2A3AA 4GVIA 4GX8A 4JTGA 1I45A 1Q7MA 4FLSA 3W23A 3PJTA 3A4JA 4UMCA 2WSQA 1XI3A 4UTFA 2NUXA 4AC7C 4Z0JA 3BMVA 1J6OA 4CD4A 3MS8A 2HS6A 4WLCA 1E73M 1MI3A 1UWTA 2EHHA 4P7NA 4LFYA 1PXGA 5AHLA 1J01A 3M07A 1CNVA 1Y5XA 5FAGA 3S1WA 1U1JA 1W3LA 3QYSA 3WQDA 4DI8A 1JRBA 1U1UA 2X1SA 1UB3A 3P81A 2EGZA 4F8XA 4IJRA 1J11A 4A8RA 4GE8A 3L0KA 2QJNA 2V0TA 4Y9NA 3RDKA 2PLJA 1EA9C 3OBKA 2ZE0A 3SCNA 2IXUA 3N2XA 1ISXA 1ZJIA 3A5FA 3FK4A 2NQ5A 4E3TA 2CCRA 1OG6A 1CGVA 2G3NA 1HO1A 2O0TA 5HMFA 4JTJA 1W9VA 3VE9A 1GVIA 3OBEA 3TJXA 1UWRA 5TIMA 1MNZA 1UJQA 1W0MA 5I00A 4TTUA 1CLKA 1XC6A 4REQA 2PWEA 4PUDA 5EBUA 2A1YA 3SCUA 4H7CA 2PDLA 1GOKA 3NGJA 3TC7A 1T7LA 4U2ZA 1P48A 1E9YB 2ZZ7A 3W86A 3GC5A 4DXXA 3C2YA 3JW7A 3ENLA 2VFEA 4E8GA 3LGEA 4LB4A 2NX3A 4ZO8A 1X1NA 2X7VA 4M81A 3W7KA 1C29A 4DZHA 1KRBC 1WZAA 3PUDA 2ZTKA 3O07A 2JALA 4GVGA 1YNPA 4JTDA 4PMDA 2BNJA 4UCFA 2O9PA 3MY9A 2ICSA 3CXOA 4QNWA 2PDUA 1L2QA 4IT1A 3BURA 3AZSA 1JPKA 1EPVA 1LRTA 1KLYA 3PZNA 2W92A 3PZIA 4UFHA 4AU0A 3GW0A 1M65A 4Z42C 2XN1A 1WKFA 1W1VA 1PCWA 5EBAA 4A21A 1SMDA 1V0LA 1DJIA 2J7CA 3CUJA 3IIPA 1O12A 3Q2DA 3A3XA 3QGAC 3W1AA 4FIQA 2DUXA 5FEPA 3FGCB 2OQYA 4ICCX 1SM9A 1S2CA 3SEPA 1EXPA 4GISA 4S3GA 4JCMA 3M0LA 3OVPA 1C8VA 3MKVA 1AH0A 2XN2A 1OC5A 3KBWA 4GG9A 1RK5A 3M5YA 4PSPA 1N7KA 1Y7VA 3VM5A 5A8GA 3LXAA 3UT0A 1Q6CA 2WZIA 2J8GA 2XVPA 1QATA 4WKFA 4LF1A 3PSVA 4ORMA 3WD2A 3S8HA 5M2FX 1VGAA 1X6LA 1L6FA 1KFWA 2WMHA 3W25A 3WD1A 5DCBA 3SZ8A 1UP0A 1BD0A 1OIMA 2YCLB 1WAUA 4GYJA 3SRKA 3LQLA 1OGSA 4Y6GA 4GJJA 1R3WA 4QS6A 2JKEA 3KLLA 1XYMA 1Q63A 4UOJA 1HF6A 4CD8A 1G4EA 3GH5A 3FEMA 3RN6A 3I65A 1OC6A 1K6WA 1UOKA 4IICA 3AHVA 4UOQA 3PFMA 2PBOA 3NZGA 3W7EA 4JL1A 2DV0A 3QN3A 3ZR4A 4MOZA 3JUGA 1C91A 1J0HA 5I3DA 3W7MA 5C71A 4FNQA 1XFBA 1FHVA 4O11A 2ZZ5A 1EJSC 5JMUA 3NJ3A 2CZ5A 5LSMA 1OQFA 2J24A 1YNYA 1GQKA 5H8PA 4JTSA 3BAIA 1LLWA 2WWDA 4UZUA 4Z2GA 1XYBA 3IJ7A 3R1ZA 4F9JA 2QDEA 4JX4A 4DF1A 5CQ1A 1AL7A 4JGDA 2WB5A 4K8EA 3RO6A 2V3EA 3HFYA 1SZFA 3AU6A 2HVMA 1DXEA 3NZQA 3CLMA 3W87A 5D2VA 2GSEA 2EBNA 2FFIA 2PF8A 5A6TC 2YDAA 4PUNA 5REQB 3EWBX 3UWQA 1JQVA 1P6CA 1RJPA 4B5UA 5A2BA 2DUAA 3WNPA 3A4AA 2OELA 3QC0A 1QNVA 3LXCA 1UD6A 4M8UA 2EG7A 4OBRA 2QQ6A 3ZVIA 1K02A 1R9ZA 4ZQPA 4D2JA 3S1XA 3WD4A 4LBSA 3GXFA 3KL0A 2E6AA 1XUZA 2DEPA 2QS8A 4V28A 5DCEA 1V3KA 4O4WA 3T4CA 2XIMA 1TV2A 1B3ZA 4N2YA 4DQWA 3DFYA 5D9NA 2O4QA 3ZSSA 4NZ5A 1I4NA 1E6NA 3KBNA 4ORIA 4OQVA 2W3ZA 4HHPA 2CWNA 1UC5A 1P4CA 2QKFA 3IVSA 5F4SA 3ATZA 4RCXA 1KRAC 2J78A 5LIYX 4XBSA 3ABOA 2YKKA 2YZ5A 1E56A 1ISYA 6ALDA 3LMZA 1V51A 3SRHA 1J5SA 1LG2A 2FDMA 2FPYA 3ABXA 1TWIA 3BGJA 2PTWA 1XH2A 2BHUA 2QAPA 4AD0A 2O4MA 3LEPA 1X1ZA 4DUOA 3KVJA 2GOKA 4JIQA 2V3GA 2P1FA 3E2SA 2REQB 4C90A 2E9BA 3ISIX 4UTKA 2GUBA 4L56A 4O18A 3HIJA 1K9TA 3NQ8A 2EPHA 3W07A 2F61A 3GQYA 1JR1A 2BASA 3THAA 1SJAA 3MSDA