4JTRA

Akr1c2 complex with ibuprofen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the AKR1C family
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtrA00
3WBYA 3R8HA 4PRTA 3ONCA 1HQTA 4G5DA 1HW6A 1Q13A 3GHTA 2IS7A 4WDTA 1QWKA 4DBSA 4XO6A 3UG8A 2ISFA 3GHUA 3H7UA 1X98A 4EXBA 2ACRA 1Z9AA 3FX4A 2P5NA 1R38A 3H4GA 2PDPA 4QX4A 1C9WA 4JIRA 2PDKA 1AFSA 3UZYA 4ICCX 1Z8AA 3LQLA 5LIUX 2BGQA 1EKOA 4YS1A 3EB3A 2IQDA 4FALA 1UR3M 4WGHA 4XAPA 3C3UA 3D3FA 1ZUAX 1IHIA 3MC5A 3V36A 1GVEA 2PDWA 2PDLA 3LNMA 3N2TA 1PWLA 3V35A 3WG6A 5LIXX 4QR6A 2C91A 4WDUA 4YU1A 4MHBA 3GHSA 1MZRA 3CV7A 4WRHA 3GUGA 4I5XA 3M4HA 4L1WA 2IPGA 4JQ3A 2HE5A 2FZBA 4XZLX 3R58A 2IQ0A 2AGTA 1AZ1A 1S1RA 2I17A 4LB3A 4PR4A 2A79A 4EXAA 2PZNA 3RX4A 3R43A 2ACSA 4GQGA 5C7HA 4JIIX 2BGSA 3WCZA 4FA3A 4LBRA 4XZHA 4H7CA 4PMJA 1YE4A 4JTCA 2WZMA 1XJBA 1EL3A 1LQAA 1J96A 3UZXA 1Z89A 1K8CA 2INZA 3M64A 2NVDA 1AH3A 1S1PA 2DUXA 1PYFA 3F7JA 3LBOA 2PDIA 2HEJA 3DOPA 3GHRA 4H8NA 2PDXA 3O0KA 3V0UA 2PD5A 3UP8A 2IKGA 4FAMA 3LZ5A 3BURA 4XZIA 2VDGA 3R94A 1RALA 3EB4A 3G5EA 3V0TA 5AZ1A 2IPJA 3ONBA 2ALRA 3UYIA 3T42A 2DV0A 3DN5A 4FZIA 4JTDA 1OG6A 2PEVA 4YVXA 2PF8A 2J8TA 5M2FX 1ADSA 4GIEA 4IJCA 3KRBA 4LBSA 5AZ0A 4LB4A 3U2CA 1LWIA 4WDWA 1AZ2A 4XK2A 1IEIA 3R7MA 2FVLA 3G1RA 4GQ0A 2FZ8A 2R24A 5DANA 4XZMX 4JQAA 3BCJA 4F40A 1VP5A 3Q67A 2FGBA 3UWEA 4DBUA 4AUBA 2PD9A 1ZQ5A 3O3RA 4R9OA 1ZSXA 5LIYX 1YNPA 4DBWA 4WDXA 1YE6A 5KETA 5HNUA 5LIWX 2F38A 3B3DA 1T40A 3WBXA 3CV6A 4LAZA 1XF0A 1RY8A 3LENA 3UGRA 2HV5A 1US0A 2FZDA 1AH0A 5JH2A 4Q3MA 4NKCA 1PZ0A 4L1XA 4Q7BA 4JTQA 4GACA 3WBWA 4GA8A 4QBXA 2QXWA 1Z3NA 3CAVA 2WZTA 2PDFA 2IKIA 2HE8A 2PDUA 3LN3A 2PFHA 2HVOA 1SM9A 3LD5A 4JQ1A 2PDGA 1FRBA 2IKHA 4YVVA 4DZ5A 2PDBA 3COTA 1RY0A 2IPWA 3M0IA 2FZ9A 1X96A 4XZNX 3UZWA 3BUVA 5HA7A 3ERPA 1S2AA 2PDQA 1MI3A 4XVEA 1AH4A 1YNQA 3CMFA 3CASA 3P2VA 3R6IA 3UFYA 3VXGA 4HMNA 3FJNA 1M9HA 1PWMA 2BP1A 2PDYA 4JTAA 2INEA 2R9RA 3NTYA 2DUZA 3RX3A 4XVDA 3RX2A 1VBJA 3CAQA 1A80A 3QKZA 1EXBA 3MB9A 2I16A 2IPFA 3LQGA 4PUWA 4OTKA 1T41A 3N6QA 2HDJA 4ZFCA 4QXIA 3LEPA 3S3GA 5LIKX 2PDCA 4PUUA 3H7RA 3R8GA 1X97A 4PRRA 2PDHA 2HVNA 1S2CA 4YVPA 1EF3A 4GCAA 4RPQA 5JH1A 4IJRA 2NVCA 1JEZA 2PDNA 3EAUA 3V0SA 3Q65A 4ASTA 4JQ2A 2ACQA 4GABA 3LZ3A 2CLPA 3UZZA 1PZ1A 3BV7A 1XGDA 5HNTA 2IKJA 2PDMA 1QRQA 1ZGDA 4JTRA 4WEVX 4JQ4A 4JIHA 4XO7A 4LAUA 4HBKA 2F2KA 3LUTA 2PDJA 4IGSA 1MRQA 2ACUA 1Q5MA
chains in the Genus database with same CATH superfamily
3GC2A 3TTQA 3CWHA 4LS0A 1XLFA 3E96A 5C7VA 5A2AA 5E0CA 4PTXA 4MJ4A 2JIWA 4AZBA 1XFBA 3SY5A 3PSVA 3C2YA 3NUKA 2NZLA 1MFUA 3PR2A 3F2DA 1H7PA 2CLKA 2G97A 5DLCA 3EOEA 4PE8A 4J35A 4REQA 3BJFA 3S5SA 1KGUA 3HBLA 2O0TA 3FX4A 4Q4KA 3VIMA 2QCCA 1PIIA 1C9WA 1HUVA 1BXBA 1GCYA 4WGHA 1ADDA 3SUVA 4AD4A 2CKSA 3C3UA 2ISDA 1KV5A 4WXYA 1KQZA 2ZX5A 3M5ZA 1ME8A 2WJZA 3NQDA 5MF5A 2BGNE 5DMMA 1FY6A 2ZRYA 3DGBA 2X09A 4H9XA 1QO5A 4NJIA 2ZRWA 3GE7A 4JYFA 3T08A 4DF1A 4NNCA 8RUCA 5A2BA 1J93A 1O95A 1HFBA 2IPGA 2BXZA 1CW2A 2WC3A 4C6LA 4FK9A 1E55A 2EKCA 3NQBA 4UTTC 5I6SA 2I17A 1AQMA 1H60A 4KH2A 1B0IA 3DYOA 3BZJA 1W2PA 5HNRA 1TIMA 4JIIX 1KTNA 5AC7A 4XZHA 5FL1A 2E9BA 3O8AA 3MUXA 5I07A 1LL6A 3UJFA 3HQNA 4E0CA 2XFRA 5F4SA 4UTTA 4IMDA 4ZO8A 4YMZA 1TV7A 3EX6A 5C2XA 2J4GA 1K9EA 4HNVA 2BDQA 1VYSX 2R1LA 1AH3A 3M0HA 5C9UA 3ANVA 1JG9A 1PYFA 4I9JA 1NOFA 3WD0A 3DOPA 1OF6A 3N2OA 4DI9A 1XLMA 2QUVA 5K4ZA 4FX6M 4OWGA 2Y61A 3GTIA 2QVNA 1WDDA 3AXXA 2OZ8A 4AIEA 2ZDRA 1E9YB 3WH7A 4D8LA 4INFA 2KAUC 2D20A 4C7FA 2GFTA 3L12A 4LY4A 4N9CA 1W5QA 3NVTA 4C6MA 3NQ2A 1OG0A 3SUUA 3S4TA 2XFFA 3GNDA 4IJCA 3C2OA 4DM1A 4JBRA 2WW5A 1CTNA 2NX1A 3GUWA 3B8IA 3CLWA 2XN2A 4JTKA 1JZ6A 4H19A 5D37A 3QW4B 2Y7EA 3KE0A 3WUGA 1FWHC 3PZOA 3WD3A 3WEMA 4GQ0A 3JS3A 4EANA 4JL2A 2ZZ6A 1TPH1 4ZOCA 2CBUA 1VP5A 2HS8A 3KM8A 2CKRA 1R2SA 5IFPA 1CGTA 3ZXWA 4JFSA 4NJGA 3TVAA 1EZWA 5LIWX 3T78A 1LRNA 4QEEA 1T40A 5A8QA 1W5MA 3KX6A 1NJJA 3MI6A 3GTNA 4LY8A 3LCLA 3LOTA 1XLIA 1QW9A 3KL3A 4Q3MA 1C9DA 4TIMA 1W3HA 5CPOA 3HGOA 2I14A 3M5YA 1ENUA 4HPJA 4DPPA 1UQYA 4JTQA 2X2YA 3VILA 5J5DA 2J27A 1L6GA 5AC5A 4DZIA 4AZIA 3N4EA 1VBHA 3VNDA 3B06A 3VD9A 2IKIA 2XFYA 1O66A 2QGHA 3H8AA 4FS9A 3TYBA 1UKSA 3STGA 3L4ZA 4B4FA 2EAWA 4F4RA 2O4MA 5FJOA 1GZJA 3W86A 2BS9A 2PDBA 4FLRA 1HJXA 4N42A 1HTIA 4HYVA 5GQBA 3NOEA 1Z41A 3T8QA 2ZXQA 2Z1BA 1PYMA 1A47A 1NWSA 2DW6A 1UKPA 3UY8A 2YDRA 4C6BA 2ZCGA 4LT9A 1TPB1 2F2HA 2W63A 1LF1A 5DY2A 2PRMA 5J5RA 1TV2A 1XICA 2PWVA 2GLKA 3R6IA 3MVTA 1RA0A 3LI0A 1BXNA 3IJ8A 2PDYA 4JTAA 1FWNA 1BRLB 3U2ZA 4EK7A 2JKAA 5D9OA 3AIEA 4JX6A 3ZVHB 4R7WA 2DVXA 3WF0A 3KLKA 2BHZA 2OFJA 4N9DA 2XH7A 3PAOA 2I16A 1CZ1A 3LQGA 1M6JA 3G0SA 4JICA 4LPCA 5TQLA 4X22A 1VBUA 3O1NA 3WMCA 4PUUA 3T2PA 3M0MA 1XYMA 5CBJA 4DJED 3QYQA 4LF1A 2E6YA 1S5VA 1HO1A 3DFNA 3F5JA 1H1ZA 2BVTA 7A3HA 1G4TA 1ZBWA 3AI0A 4CCCA 5M03A 4QM1A 1XSIA 2QAFA 4HVXA 2QJGA 2P88A 3MV11 3DCPA 1GKQA 1HF6A 3NXLA 5H6HA 4BI7A 3ITVA 1TWDA 4P7LA 3KCOA 2W5FA 4J2MA 4QE4A 3CZLA 4RZ4A 2D22A 1QPRA 4IMEA 1FWBC 2VR2A 2Q09A 4IGSA 2IQTA 3NFUA 2E7FA 3F5KA 1VKFA 1E9ZB 2ZRXA 4ADTA 1UZDA 1SFJA 4IISA 3TTOA 4NRRA 3RU8X 3WH8A 1BYDA 2C3ZA 1JVNA 4IT1A 3A9IA 3S1VA 2P76A 1JPKA 3W7CA 1BHGA 1GEHA 1Z9AA 3BQ5A 4Q4PA 4QEHA 1F5ZA 4MY1A 4EPEC 3GDTA 3HV8A 3NIYA 3GYEA 2G3NA 1KR1A 1IEXA 1R3VA 4PSPA 2OXNA 1O5QA 5D2XA 3UZYA 3QVQA 3SY1A 3LQLA 4XG1A 2FIQA 3HGRA 3ZVIA 4GRSA 3EB3A 2FGZA 2HBXA 3C86A 3SQLA 5AHLA 2VEMA 3ENLA 4D2JA 2XVNA 5T8GA 2BOGX 2BSLA 4FXRA 1JRBA 3K13A 4CQ9A 1TZ9A 1BRLA 1MO0A 3W3OA 3ZVHA 2GVEA 3DHUA 2W9MA 3MCNA 3T0TA 1LLZA 1PE1A 2NV2A 1EPVA 4D6GA 4ATWA 4OOZA 1NTHA 4PN2A 4XZLX 3U7BA 3R58A 3BAIA 1CGVA 5ECVA 1GQLA 3NGJA 3IPWA 3DC0A 4JKLA 2Z2AA 4HZMA 1F4AA 4W85A 2PU1A 3R43A 3CIXA 1N82A 4HZ7A 1UQZA 3SEPA 4GX8A 3BMVA 2B7PA 1KBLA 2Y8UA 5CZJA 3L0NA 4O0KA 2NXIA 1XM3A 4Z1AA 1DE5A 2Y8KA 1M01A 4PC8A 3F2BA 1IEWA 3F7JA 4F0KA 1KW1A 1UWSA 2HEJA 1GOKA 1XIMA 2NT0A 1V3KA 3NCOA 2YPIA 4GY1A 4W84A 5CSRA 4WJEA 3LZ5A 3ZJ6A 4LOCA 1BSIA 4HPHA 1CI1A 1P1MA 3L21A 3T42A 4QAWA 3W37A 1W54A 4BFAA 3BZGA 1OQFA 3VIHA 2HTMA 4IG2B 4YWIA 4LBSA 3WLNA 4NT0A 4GI6A 2A3CA 3LRKA 1BFNA 3WNMA 1MDLA 4GH3A 1HP4A 1K03A 4WDWA 3WQ5A 3BC9A 5A5WA 2B81A 3LLDA 4NZ5A 1W1B1 4PBFA 4QISA 4GC3A 4ICMA 5DEZA 3KZSA 4QCEA 2NLYA 3UWEA 4DBUA 4QAIA 3VA8A 3O3RA 4MB5A 4MJ2A 2DQWA 3LBCA 2OQHA 1M53A 1JCJA 1K9FA 2X0HA 3LCHA 2EG8A 3BVJA 3G0UA 1C93A 3BAWA 4BI6A 4GBDA 2PLMA 1CNVA 3B8TA 3HOJA 1EDGA 3CV6A 1XF0A 1BTMA 1I75A 1EH9A 4XZBA 2CLIA 3RLVA 4AU0A 5I78A 4NQ1A 5BOFA 2QCFA 2NQJA 1KD0A 1KLZA 4ILSA 4I7UA 4IP7A 3FSUA 3VKJA 1ZJIA 4L64A 4U2YA 4HIBA 3S6TA 1WZAA 3A64A 3NYZA 3MQTA 4WY0F 4QJ1A 5EMKA 3BLDA 1PCWA 2C1HA 3VIJA 4FX8A 4JFTA 2NVAA 1D8WA 3WX7A 2VFGA 3CZ8A 3JRKA 1SMAA 3THDA 4ATLA 2YJQA 4WLCA 3TCSA 5I3DA 2CEQA 1R8LA 2F7FA 3CBWA 2HVOA 3LD5A 4R3UA 3VGFA 4IIEA 4CNOA 2IKHA 2YCIX 3R1ZA 1JPIA 1U22A 3M6DA 4DZ5A 1SZFA 1RY0A 1Y7VA 1LOQA 1ZL1A 4BWLA 4XAYA 3ZYZA 3MKVA 2C15A 5AFDA 3RUBL 5BZAA 5DFAA 1E4MM 1C8VA 3QW3A 5F2MA 3WLKX 1KM4A 2V3GA 1T7LA 2ZZ4A 5AN7A 1XLKA 3N2MA 2VGIA 1U1HA 3W74A 1QK2A 3GDLA 3SCSA 4R85A 3L7RA 3VXGA 3TTYA 4O12A 3QN3A 4NZ1A 3BANA 5XIAA 2DIKA 3NTYA 2DUZA 4H9UA 5K7JA 5GNXA 3NPVA 1N2VA 2EG6A 3VNMA 1F3TA 4G9PA 3NL5A 2IPFA 2X42A 4JIPA 1JI1A 1FKWA 1M1BA 1GG0A 1W0MA 3RMEA 4QFUA 4OZOA 2FFIA 3QPYA 4B16A 4GYPC 4H7VA 4PRRA 2D2HA 3ARTA 4AY8A 3U4AA 3PG8A 3ZZ1A 1JR1A 1LRQA 1V79A 4ZTYA 4IL0A 4DBDA 4C6NA 1VFTA 4OE7A 3PUDA 1N8WA 1DV7A 2WMIB 1OT2A 4OIFA 3PNZA 1UASA 2CIPA 1EA9C 4DO5A 1TWSA 3C4UA 2DZBA 1VB9A 2H3DA 3CWNA 2YDAA 2CBIA 1L6WA 5DRIA 1W6TA 4MDOA 1F74A 2HSAA 4GYPA 3FLUA 3PANA 3R0UA 3ZM8A 4MNLA 3Q58A 2GWGA 3A3HA 4XD5A 1ZRQA 1JZ7A 4XAFA 4ROQA 1YXCA 1TFVA 3OBEA 4H9ZA 1QOPA 4GXWA 2O7SA 4GJJA 4C6CA 1S39A 3R8HA 4PRTA 1CT5A 3UBPC 4AY1A 4JDBA 3IJIA 1U1JA 5C55A 1A5LC 4V2XA 4IFKB 4GYFA 3TAKA 2VEGA 3GO2A 3AROA 3O06A 4OFCA 4AWEA 1WP6A 1B30A 3RYSA 4HCLA 4IMCA 2AQWA 3N29A 3AQUA 5BMWA 2PP1A 4ZZ9A 4IMGA 4Q8UA 4CCEA 1VFLA 3VD3A 1MDRA 2GK1B 5RUBA 3VMPA 4WXZA 5FF7A 4LGXA 1B9ZA 2NQZA 4PFMA 1KBJA 3RLUA 3TQKA 1VFFA 3MANA 1TPWA 1NF7A 1UR0A 1V93A 3OIXA 2WCAA 1Q4WA 5KEZA 4Y6GA 4KFNA 2E67A 3W1AA 3C2RA 3BSHA 1XG3A 3O16A 5G1MA 2IXUA 2PDLA 3LHTA 4IM4A 2UWFA 3ISIX 3QSRA 3N2TA 1J18A 1V6VA 1VC4A 4MWAB 4Y9OA 3TR2A 3IVSA 2VZUA 1DIKA 5BXTA 2R6OA 1UYQA 2F6XA 3ECQA 3UZJA 2HE5A 4IIBA 3NGFA 5BRQA 2XUCA 3LLXA 1PHQA 4PB5A 4WSHA 1K9DA 3E6EA 4ZSTA 3GIQA 2F61A 1KBKA 4B5TA 2ACSA 3OPSA 3MYPA 3G3MA 2WMIA 3WJSA 5HJYA 1FHLA 2QJJA 1UWAA 1DJIA 2NLIA 1W17A 3IAPA 5AHIA 1Q45A 3IANA 1V0KA 3RFAA 5I3FA 1VHCA 4UBPC 4HJFA 3W84A 1VYPX 1E4IA 3LMZA 1V6YA 2Z1SA 2QUUA 1UD8A 1R3RA 1NDZA 3U8GA 2NT1A 1CWYA 4OUIA 3U4FA 3RCNA 4CKQA 3LBMA 3UVIA 5FCZA 3LXCA 4EF9A 1WZLA 3G5EA 3W1UA 4NJHA 1GVQA 3CT7A 1DE6A 1J4EA 4QITA 3ZSTA 3NURA 2NUWA 2DGAA 4NSBA 2VGGA 3CLMA 4WCJA 2J8TA 4PCTA 1NWTA 2PA6A 3BGJA 1GGOA 4FXSA 1NFBA 4GKLA 4F0MA 5AZ0A 3CB3A 1XXXA 4FLQA 2EJAA 3U2CA 1Q85A 3OYZA 2GK1A 3W85A 1JYWA 3EX3A 3ARVA 3BOLA 3DH7A 1JXKA 3AMCA 1B3OA 1WUFA 2O9TA 3KUMA 2YLAA 2FB2A 5IXEA 3A12A 3NQMA 3EOOA 4RZBA 2XSXA 2VYOA 1JAEA 3KBVA 4DXVA 1OHLA 3DKJA 4R9OA 1M03A 4ACZB 3MUIA 5DN1A 4AEEA 1ISZA 2OQLA 4NVTA 4IQLA 3WQ6A 4MWAA 1SZNA 2FFCA 3OYXA 4H83A 5CEWA 2OZ3A 3L2LA 3B8WA 3NQGA 1RY8A 3Q37A 5PTDA 2E77A 4CEXC 3NR0A 4ML4A 3DIPA 1AK5A 2PLCA 4GD0A 3STEA 2WANA 1DJHA 3RRAA 2ASHA 1T96A 2Y7FA 1HJUA 2CU0A 4U28A 4GIRA 3LERA 4EWND 1K8XA 1NEYA 1UC4A 4GA8A 3SN1A 2OT0A 4JZ5A 1FCVA 3EOUA 4AIBA 3RGTA 1DWJM 1F3WA 3TQVA 4O17A 2P53A 3MZ2A 4LVGA 3OVRA 2PFHA 1UZ1A 3CMJA 3UCDA 3ITXA 1LT8A 1IIHA 2YIHA 4FSAA 3E2SA 3IIOA 4E2DA 3H2AA 4ZA0A 5CBBA 1K3UA 2OPJA 3K4DA 1BYAA 2ON3A 4PUMA 3B4YA 2PI6A 5EGRA 3GSMA 3DHFA 3UGVA 1JZ8A 4KKXA 3BAKA 3S9ZA 2YXXA 3L65A 4OUEA 2JKPA 2VC6A 1RZMA 4XVEA 3GNOA 4J2PA 4B5VA 3AYTA 7XIMA 1MW2A 3LMYA 5E6YA 2D69A 2V2CA 2YCEA 1LZOA 3A5VA 4R5EA 1MZHA 3FVDA 3W83A 2INEA 2W62A 3VIOA 1JYVA 3W75A 2VX4A 2XSAA 3CHEA 1PTAA 4D6EA 3IIZA 3CAQA 5CJMA 3RCMA 4ZVJA 1AL8A 5JIWA 2PLJA 2EQDA 1NWRA 5HANA 3LV6A 5LIKX 1XP3A 4X2PA 4AX6A 3HG4A 2BOFX 4IX2A 3ZQ9A 3M44A 1P0NA 3FW6A 1R9ZA 2H8ZA 3B4UA 3VZXA 4AEOA 5H1WA 4IJRA 4ACZA 3BW3A 4NI3A 1GPFA 4A29A 3VPLA 4UTFA 1H5YA 4WY0B 4ASTA 4D8ZA 2RDXA 4DRSA 2A3BA 3G18A 2VFFA 3OZYA 2CZ5A 3N2XA 1TPEA 2CLPA 3DYMA 1BTCA 4OBRA 4B5NA 3N4AA 1MQPA 4CQBA 4MSSA 3Q45A 3IEBA 3EYPA 3SRHA 2J62A 4NAFB 1ZP3A 4GUIA 1UR9A 5BWAA 2GGHA 5LZLA 4JY8A 3DHDA 3K8KA 1MRQA 4AD2A 1GOOA 1Q5MA 1F8MA 4IGHA 3TWBA 1KM1A 5A6SA 4UTUA 5FSEC 3EA3A 1EJRC 4DUOA 1EP2A 2HK1A 1UMYA 1OC6A 2VJXA 3VKKA 1GZGA 1I2OA 1OCJA 4LV9A 3D3AA 3TOYA 1IEQA 3IUDA 1A53A 2PZ0A 1R9XA 1DQUA 5CAKA 1TVPA 4EXBA 3N19B 2VKZG 4UNIA 1S5WA 1DXIA 2D3LA 2NXGA 1Q6OA 3ID7A 1X39A 1K9TA 1R38A 2G96A 3VD7A 1SYTA 4CNUA 1XR2A 5GVJA 3W2JA 1EKOA 1H5VA 1V03A 4YS1A 4CU7A 2IQDA 3B8VA 4TVDA 1GOXA 3VNZA 3WJWA 5A6AA 4JDYA 3W22A 3L5MA 4E3TA 4EE9A 3TC7A 1XIGA 1ZUAX 2YFNA 2J7HA 4HJWA 4NX5A 1J0JA 5JBFA 1W3TA 2PDWA 4L61A 1NY1A 3EDJA 4XKYB 1EZ2A 3S9YA 4EP8C 4DVOA 2GGEA 2GVYA 2ATSA 3AIVA 1MQQA 4JN7A 3PG9A 3VMOA 1Q6FA 4MY8A 1MZRA 4JEQA 4L9ZA 3IJQA 3GW3A 4E2OA 4UR8A 5F4WA 4DWDA 1QBBA 5M5DA 4PZVA 1REQA 1WOAA 2HXTA 4Z2HA 2AGTA 1F73A 2FPVA 5CLWA 2XM2A 3PJXA 1YXYA 2Z24A 3L2MA 3NDZA 3BPWA 3U2EA 3FVMA 4K36A 3I65A 4WY0A 3PZUA 4ATDA 1XJBA 2CLMA 4QJ5B 1EL3A 2WMFA 2Y0FA 4G7EB 3UZXA 3NO1A 2INZA 5HPOA 3UF9A 4US5D 2XGIA 4BI5A 1EC8A 3QH2A 1XRTA 4RUBA 3HZ3A 1PX4A 1R30A 4NAFA 2ZZ3A 1W9DM 4DI8A 3G1DA 3VKAA 3QQ1A 5FJUA 1MRAA 1OZQA 2XH2A 9XIMA 1H49A 2QS8A 3TMQA 1XDJA 1DKWA 1KO0A 2Q8ZA 4X60A 3K1GA 3OQ8A 1U30A 1P1XA 1NDWA 5A6MA 1RALA 3CL6A 3CUGA 4ZMGA 3BLKA 1WAWA 4XD3A 3LPGA 2FLIA 2FQIA 3CAKA 3CH0A 4GZJA 3L68A 3VM5A 4Z0SA 3S42A 4R88A 2CLHA 4HYWA 3MY9A 1YLVA 3IWPA 2B31A 2VRQA 2WM0A 3K4AA 4RDYA 1UWIA 2RAGA 1XLAA 3FJ4A 3RO6A 1TTIA 1HG3A 1SW7A 4JTIA 4IIGA 1XLEA 1LT7A 1LG1A 3HFTA 1CXFA 4EOUA 5CSSA 4WSKA 3WJZA 5BCAA 2WHJA 4LAKA 1PEZA 2EPHA 2G3IA 2WJFA 3QHNA 3BCJA 3SGGA 2C19A 4HB7A 4HK7A 2DSVA 3CH9A 3TW6A 2WV8A 4I3GA 3M16A 2BFGA 2V5CA 3PZ9A 3UCQA 4BJHA 2VQUA 4XKYA 3TQPA 1A5NC 3MJMA 3S5OA 1A0DA 1G7VA 5F2GA 2CCRA 2CHNA 1EHAA 1EJVC 3RPDA 1WXJA 3MMTA 1TREA 1J0ZA 2HV5A 5C9XA 1YDOA 4IPLA 1ZZMA 2PGEA 3AJ7A 2WHKA 1PZ0A 4JTLA 3IGUA 1XPGA 6PTDA 3TKFA 1FWWA 4PMVA 4E5TA 1W9XA 4AF0A 2J9YA 4QBXA 4WD0A 1AL7A 1IEVA 2DH3A 2YX0A 4TV6A 3KTCA 3AXIA 2PCEA 5HUPA 3LK6A 4O1BA 3BCFA 4G7EA 1M7JA 3CTTA 2VZSA 3IRSA 3C61A 4JN6A 3VOFA 1I6NA 4PMDA 3JUGA 3T2QA 4JNMA 1QNOA 4JQ1A 2DW7A 4XWUA 1KFBA 2Z6JA 5AYYA 4W87A 6TIMA 1A0CA 4Y9PA 3C56A 5C5YA 4NASA 3G1HA 1N8IA 3UXDA 4S3JA 1A4LA 3WLQA 3U5YA 4BZYA 3N18A 4GINA 4W93A 2J7EA 2DP3A 3ZO9A 4IUGA 3HB9A 1EUAA 4BCEA 4F48A 1VJSA 1BYBA 1JZ4A 2GJLA 1S2AA 1FHUA 3V18A 1JCYA 1XBXA 4RV8A 3H26A 1EOKA 1E4NA 3G1AA 3LV5A 3G8EA 3RLHA 5TNVA 3QSTA 3WNNA 1BF6A 4WOQA 2V2HA 3O05A 3AHTA 4UMCA 2CZEA 2W66A 3FJNA 4JX4A 4A05A 2G3FA 2QHAA 3FXGA 1LLOA 5FEWA 3H24A 4CU8A 3BAXA 1UJPA 4TX6A 2P1FA 3RX2A 1OIMA 4V15A 4AD1A 4DQWA 2QV5A 4LXFA 4CQAA 4Q7NA 4OTKA 4C6JA 4ZENA 3I3EA 3LEPA 1J2BA 1D3HA 2PDCA 1GORA 4RXGA 2E8YA 3O07A 4Z1YA 3G1SA 3VVGA 3NPXA 3FJLA 3SM0A 3WBAA 1QO2A 4X9YA 1CXLA 5K3VA 1R47A 1GQNA 2J78A 3QJAA 4NJKA 4NNAA 2G3JA 1JDFA 1K6WA 1RBLA 3TH6A 3A13A 4OECA 4AVOA 1TX2A 1PZ1A 3BL3A 4L65A 1UJQA 1UHVA 1GQJA 3CUJA 4AXNA 5HNTA 4N6EA 3H22A 2GQ9A 5B80A 4KWWA 4CD4A 1IV8A 1PX3A 3KVMA 3TN6A 3GU1A 4JKKA 4J5NA 1CB2A 3RPTA 4GE8A 1OFPA 4R53A 3DFHA 1ISXA 3OZMA 3PJWA 4EAMA 1A5SA 5AVNA 4CU6A 2HJPA 1Y0EA 4S38A 3HFYA 4GJIA 3BMWA 4PH6A 1KGWA 3CPRA 3UWQA 4LWWA 3GXPA 3WQGA 4I9TA 4CNTA 3LPFA 1XCXA 2OU4A 1SFLA 1CIUA 4F3HA 4HTYA 4GC4A 1QUMA 4UTWC 1PVNA 1B9BA 3DFQA 3PULA 1LQ2A 4H6QA 3P60A 3C8NA 3H4GA 4PUJA 4JIRA 4O4WA 2YDSA 1OCQA 1IZCA 1UR8A 3TNOA 3L67A 2BGQA 5A6BD 3U6WA 1VFHA 1YPXA 4C91A 3UJRA 3L4UA 1GVOA 3FYYA 3ARQA 1F8IA 3A4WA 4AB4A 2QEZA 3P62A 3EWUA 1QI4A 1K02A 4V33A 1HKMA 4CLMA 4KCWA 3PTKA 4H6EA 4C6QA 3VDBA 4EVZA 4F0RA 1EWEA 3KVKA 5AYBA 3LM7A 3SN0A 3W7GA 5CC7A 4YCPA 3H2NA 3CV7A 3H2FA 3T7VA 2CLLA 4Q8QA 1WBJA 7TIMA 1O68A 5I09A 2Y5JA 1A5UA 3A5FA 2OX1A 4EIVA 2YOCA 2XM1A 3A4XA 1DJWA 5C7HA 1HGWA 3WNOA 2WBGA 5FJRA 2CITA 3GX9A 1LQAA 3KS5A 3UG4A 5G5IA 4E4FA 2VZOA 3VIFA 1UD4A 4QS6A 4NP7A 5KZEA 1T8XA 1HXJA 1P6WA 2PDIA 1OX5A 5HQLA 4E3VA 5I3GA 5B7YA 1XLGA 3AJXA 3H6OA 2QMJA 4JHMA 4O1EA 4X2RA 1EEPA 3W7MA 3ITGA 4GXPA 4GVIA 5HOSA 1K70A 1C29A 3MP5A 1HVQA 3MYOA 2CW6A 3AHXA 1XIBA 5D33A 2ALRA 2HNHA 2RDTA 3AUJA 4PEKA 1Q2RA 4WJXA 2ZQ0A 3KXQA 1BVZA 4MKVA 2Z28A 4BS0A 1YXDA 4Q32A 3MPGA 3LDVA 3WQDA 1OFOA 1EGZA 4WHBA 1ISWA 4A6GA 5EKYA 1T5AA 4C1LA 3L4TA 1UUMA 1AG1O 2P8BA 1PPIA 2UBPC 2OSYA 4XBJA 3CTLA 1XH2A 4UCGA 3QTGA 2DZSA 3NG3A 1Z69A 4KGLA 2PTXA 2GDVA 3MSYA 1Q6CA 3OTRA 1NU5A 2J25A 2EF9A 1RVGA 3STCA 4OHQA 3MS8A 2Y2WA 1RLCL 2XHYA 4EKJA 3OP2A 2EKGA 3TYDA 1W1VA 3EWDA 3PTDA 3R5EA 6XIMA 1JI2A 4WDXA 1SFTA 4ZEPA 1MUMA 3PNUA 2YCKX 3NDOA 2VXNA 3IACA 3LYEA 3WBXA 5DY3A 4W7VA 1F61A 4ZODA 1Q7ZA 3M07A 2FZDA 2I56A 1AH0A 1CYGA 4C6OA 2VRKA 1LRTA 4GNJA 4D6DA 3SADA 4GVGA 4Q7BA 4GACA 4H2HA 1RR2A 3EGJA 3DG3A 4Y7EA 2XIMA 4LTSA 3N17A 4M6PA 3NL2A 1JD7A 2P0OA 1GK8A 1LROA 4UTHA 2A0NA 3P0WA 4OV9A 1VENA 4FF5A 4LH8A 2A85A 3W24A 1JF6A 2V82A 3SZ8A 4HU8A 1H61A 4XZNX 2QF7A 3RMJA 2JGYA 4QLLA 2WNZA 4TTUA 2B7OA 4H9YA 1QPNA 2OR2A 2P8CA 2WJDA 4L4MA 1AH4A 3WLRA 2X1IA 3W28A 5C9WA 3ALGA 2BY2A 3K2GA 1KXHA 1VEOA 5LGXA 4WJ8A 3Q4DA 2FPYA 2YB1A 1V08A 1XH0A 3RPMA 3GB6A 4D6JA 3AS0A 1WDPA 1EDTA 3HIJA 1C91A 1BVNP 4P8VA 4RK8A 1NH6A 1QPOA 3CO8A 4Q8NA 1E0TA 2VL4A 2ISSA 1S5TA 1POJA 1HL8A 1GOIA 1XUZA 2PWUA 1O1HA 4PMZA 1E1FA 4Z08A 4QNEA 2PDHA 3CEUA 2NSOA 3ZT7A 1JPDX 3W82A 3HG2A 4P61A 3CZJA 3W29A 2FJUB 6REQB 2AKZA 3T8LA 1JEZA 2E4TA 2BHUA 4HMDA 3ITOA 1F2JA 2WZHA 4AHQA 3H70A 3MU7A 4PTNA 3A21A 4ROPA 4B3LA 2OWCA 4UNKA 3SCVA 3M1ZA 1SZGA 3MO7A 3UZZA 3O6YX 5BU9A 1BQGA 3TV8A 3SCWA 3BV7A 4UTKA 3G8RA 3VX1A 1NVMA 2X40A 1RJRA 2EPKX 3E9AA 2BHYA 1IXNA 1QRQA 3IK2A 3L9CA 1G69A 3W7EA 1TUXA 4GLEA 1F3EA 5EA9A 3T0CA 2CERA 1P0DA 1CLKA 5IFTA 3WEOA 2A5HA 4CUCA 2CHRA 4BQ3A 1XISA 4LRTA 2PTYA 4S3DA 1M41A 5LHFA 2WYSA 4P2VA 3QHOA 5G4WA 1YIXA 4UFHA 4LFYA 1S2WA 1IYXA 1WKDA 4F9JA 4K8GA 4W5UA 1R7OA 3HPSA 4L6OA 2O55A 3GHUA 4H01A 3GY1A 3AOFA 3K5XA 3O6AA 1ZAJA 1GVIA 2VO5A 4UZSA 2YGYA 2CLOA 1MXGA 1XYFA 2REQB 1ONEA 4BQ5A 3FKRA 1ME9A 3IJDA 6TAAA 2O4QA 4IMFA 1FA2A 4JIQA 4AY7A 4AW7A 3W7HA 2NWSA 3T9PA 1KR0A 2B0MA 4V27A 3N11A 3HN3A 1NFGA 2PRHA 1XRSA 4L5ZA 5FJPA 5DELA 1KFLA 4CN4A 1RXOB 3EKLA 4NZFA 4PMRA 5DXXA 1LBMA 1GHSA 5AC8A 4H8HA 1I2RA 2OEMA 2PWGA 3G24A 5CZTA 3U9IA 3W7IA 3L0GA 4MHBA 5FF3A 4PULA 1LL7A 1DWIM 2QJIA 1FH7A 1MSSA 4JL1A 2D3NA 1BGGA 4ZGYA 1AZ1A 1B3XA 2YYTA 2RFGA 3RX4A 1G4SA 4CCZA 2CWNA 6REQA 3B9AA 1B57A 3P14A 4Z2JA 3MUAA 5CXPA 1YE4A 3GIYA 3JW7A 1FWSA 4X9SA 4HNTA 1P43A 2W61A 1PTDA 4PUNA 5DCBA 2FGLA 1FWRA 4URIA 3TOPA 3MWCA 4O0QA 4FR6A 1UD3A 4BA0A 2NUYA 3LHZA 3LTYA 1NIUA 1RV8A 4C6KA 3O6DA 4W8BA 4FAMA 1UP0A 4W7UA 1YBQB 5CKSA 2QDHA 5CH9A 3SUTA 1AODA 4UQAA 4XKMA 2XVLA 3ZT5A 1X7IA 4IPNB 5M2FX 2BLEA 2DZWA 2V69A 2MANA 1WAUA 3BDKA 3TTEA 4I7VA 2AQOA 3STFA 5T26A 4LB4A 2REQA 4M80A 3R79A 2WVVB 1UA7A 3PBVA 4OBTA 1Q6LA 2ZXAA 2FVLA 1GKRA 2OMAA 2GGJA 3TW7A 3BLOA 4F40A 2G37A 4JEJA 1HKJA 5FEXA 4QHRA 1KCKA 2FGBA 3MW7A 1IT7A 1QTWA 1ZQ5A 3M5XA 4YHEA 3B9OA 5SWUA 2YL5A 1RVKA 4O14A 1GOWA 1NQKA 1BQCA 2QGYA 2Z1KA 4HNOA 1OFBA 3DYPA 1TZZA 2CZVA 4JTHA 3FNDA 3OHIA 3GNPA 3VIKA 1UKQA 3GNXA 1S3HA 4KPLA 3WMLA 5KZ6A 4LAZA 3QMRA 4ZQOA 3BJSA 2J47A 4JHOA 1DXEA 3FSTA 5DCDA 3SI9A 4MNKA 1XYCA 4U10A 4QIUA 4XX6A 4ZR8A 4DAIA 2IUZA 1E43A 1EGVA 4IPPA 3G1YA 3W6MA 1GJUA 1CX9A 2YLLA 2PTWA 1V7AA 5AHEA 3DBPA 3SECA 4KEZA 3UU0A 4U5KA 4Y2WA 1V3LA 3LGEA 4GIYA 3E0FA 2ZA2A 4JR5A 3XIMA 3M6YA 2ADAA 3D5HA 3QZ6A 3QFWA 3C0QA 5XIMA 4H1ZA 4LYPA 3QYSA 3G0XA 1KA9F 2Z2UA 4NXSA 3LN3A 3IGSA 3DX5A 4YWSA 5BYWA 4AAJA 4M5PA 1G01A 1EO7A 1LORA 2DZTA 3SFWA 3GG1A 2PRLA 3NL6A 3TTSA 2HRWA 3QXBA 3KOFA 1TA3B 2MNRA 5D8ZA 1YBQA 5C2GA 3EWWA 1HKKA 4N9EA 5LNRA 2QDDA 3VDAA 4LUSA 5CG7A 2V63A 3DFPA 2DEPA 3NQAA 4K38A 1FP8A 2YXOA 3EDDA 5HAOA 4ECLA 2XG9A 3C2VA 4LF2A 5DT7A 2QYGA 4QGCA 2FMNA 3F4CA 5D30A 1PWMA 3VKBA 3M0VA 1RP9A 1R87A 4ICNA 3K8MA 5E93A 1ZENA 1ZPTA 7CGTA 2WVVA 4XVDA 4UC5A 4P8WA 4LC8A 3WDHA 2HCVA 1A80A 3HG3A 4UFIA 4PUWA 3GVVA 3HMJG 3KWSA 2ZTKA 5C6MA 4F0SA 2J13A 3N13A 4NY2A 4E8DA 3WUFA 3KBMA 1EGMA 4Z0JA 4GI4A 3VE9A 2JFEX 3TDFA 1XC4A 4CNSA 4Q6JA 4H6RA 3LHVA 2X0YA 3V0SA 1NOUA 4O50A 4TVCA 5IBXC 5GJMA 5FJIA 4OJYA 1TPFA 2ZBTA 4FOJA 5EU9A 1VFSA 1OC7A 4QRNA 2VC9A 5B7ZA 5CQ1A 2QCLA 4PA8A 1KTBA 2PDMA 3URAA 2ZYFA 1W1ZA 1GQIA 3O15A 2WZEA 3G6MA 1GUVA 4WOZA 4Z17A 4L80A 4GCXA 3TLQA 5IBXA 2KZHA 2OO0A 2YW3A 2I1OA 4DJEC 4G5DA 4AQLA 4UWMA 4IFOA 4Z42C 2WXDM 3FHQA 1W1PA 4D6HA 4H7ZA 3P84A 1TJ0A 5LHEA 4FNTA 1O12A 2WNQA 4DJEA 1TA3A 2O9PA 3ZOAA 2VDHA 4QX4A 1XSJA 2E9MA 3AHZA 1N55A 3DG7A 5EBAA 3TYUA 1O5KA 1T99A 2QPXA 2VD8A 4JTSA 4NF7A 3KAOA 3VZZA 1YQ2A 1E51A 1DWAM 3AWNA 3CC1A 4JXCA 3A6OA 2YA0A 3PTQA 5CJ5A 2D2OA 2QR6A 3CZKA 2ZZ7A 2NSXA 1BVWA 2WVUA 3E0IA 3UEQA 4KEMA 2DFAA 4J40A 4YU1A 3URBA 3OODA 3K46A 3AU6A 3VK5A 3BE7A 5TBOA 3M4HA 5G1YA 1P6CA 3P61A 2WZIA 4L6DA 3DECA 5J04A 2FZBA 2H9AB 3U48A 1BG4A 3URQA 4EXAA 3ZS4A 4RCXA 1A5AA 2E40A 3UT0A 1DOSA 3S0CA 5EBUA 1RCXB 1ZTVA 4LBRA 3W1RA 4H7CA 4O57A 2PCQA 3CZGA 4W7WA 5BXSA 6ENLA 3SCUA 3V5FA 3FK4A 3UXIA 4HZ8A 4HHHA 1EDQA 3S6DA 1CPUA 3LHUA 3WYZA 2X2GA 3V0UA 4HA0A 3GTXA 1JUEA 4UTIA 4XUGA 1GJWA 2J77A 5G2WA 2XWDA 1J10A 4KERA 4DO7A 3ZR5A 4ZO6A 1QFEA 1TJRA 1XHGA 2WWCA 1A3XA 3B03A 1AQHA 4HHPA 1GNXA 4XAZA 1RSCA 3SR7A 4GJ1A 3W7LA 2OLAA 2UY5A 1XIIA 3W1MA 1C8QA 1FWAC 3SIZA 4L9YA 5AKQA 4J3VA 1VFMA 3N3TA 1XBYA 3M0KA 3KOXA 3W1NA 1F9CA 4FPSA 1F07A 4F8XA 5DANA 1C7SA 1W5OA 2NV9A 3S1GA 2NUXA 2ZVIA 3M9YA 3XINA 1H0GA 2ZZ1A 3ZLGA 3VIGA 4DM2A 3THAA 1KBBA 5LIYX 5IHSA 1ECQA 4UFKA 2ONEA 3ES7A 1A5CA 4UIOA 1QXLA 3OLEA 3R25A 5EFFA 2CBJA 2WMHA 1RH9A 5CC6A 2RGMA 2VVNA 3SURA 1OM0A 2WKGA 1NARA 2BXYA 3WBEA 4M81A 1WCGA 1KM0A 1QW7A 2E5BA 3RM8A 4X61A 4ZO7A 1PIGA 3ZWTA 1TJPA 3UJ2A 5U7SA 4IL2A 4N2YA 4AISA 2D2JA 4IMAA 1TIWA 3EXTA 4AFYA 2PDFA 1D7KA 2RJHA 4GQBA 3VGHA 1QNRA 4Q8VA 4Y8EA 3S46A 5DQPA 2RDUA 2XIQA 2PDGA 1AJ2A 3GH5A 3QQ0A 5E1QA 4BQ4A 1BD0A 1EC7A 4UNLA 1W31A 1CCWB 3CS2A 3L23A 3PSWA 1MW0A 1I2NA 4HSOA 2WCGA 4MLRA 3RR1A 1PIFA 3L2IA 2ZX6A 3OB8A 1X96A 1Z7AA 3PY2A 1WB0A 1UWQA 4WIWA 3BUVA 4L7ZA 1P5BA 5HA7A 3AS3A 3KBWA 1TR1A 1YEYA 1JDDA 3LSCA 5C9ZA 4DB7A 1EP3A 2Y7DA 4ZXOA 5AHFA 4ERGA 6ALDA 3W7OA 1UBPC 3QY6A 2Y62A 5L6UA 3VUSA 1C7TA 4K1WA 5KMYA 1NP0A 1B90A 2R82A 4RR4A 1M65A 2X05A 4IHCA 4RNIA 3UQNA 4KRUA 4UOJA 1JPHA 2XDFA 2ZUSA 3W6YA 4G1KA 3AIRA 3D6NA 2FZNA 4N7QA 1KM6A 3C2FA 1UIOA 3UERA 2DZUA 2NQHA 5HJXA 2QIIA 2WSKA 4DNHA 2Z26A 3R8GA 1BKHA 2Z1WA 2FDSA 3WJXA 1S2CA 1ZFJA 2PMQA 3UETA 1JZ3A 1ML1A 3RRXA 4DBEA 4MADA 4NL1A 1X8FA 3WD2A 4Q4OA 5IDIA 2V67A 4AZ6A 4GABA 3QGAC 3B0VC 1VPQA 3WY1A 1TB3A 3WDIA 3CV1A 4PTVA 1WNOA 4FX7A 2XPKA 4W4QA 3VNLA 3TU9A 4WSJA 1R7AA 2ZUUA 4HBKA 5EMLA 2RUSA 3T81A 1VD6A 4MOZA 3GXMA 3ORWA 3RNDA 3QGKC 4OVXA 1YMYA 3NZRA 4GZEA 4GHRA 1XIEA 1G1YA 1JCLA 4LAOA 3SFKA 1QPQA 5HWNA 2YW4A 2VX6A 5I03A 3BG3A 1J11A 3H55A 4Q8WA 3G22A 4GQRA 2R14A 2AAMA 1EJ7L 1QNQA 3B0PA 1ZS2A 1LWHA 2AGKA 2GVLA 2PDPA 3KWXA 2DUAA 3BLIA 1VFUA 4RE4A 5LIUX 1B2YA 5LGZA 4JTGA 4J1OA 4LYKA 3ZR6A 3FFSA 4MLJA 2W92A 2QJNA 2ZZ2A 1UH3A 1OADA 2XN1A 4F79A 3CUXA 1R85A 3APTA 3MC5A 3DFYA 3E12A 3M46A 1E71M 5FAGA 4FXJA 3KP0A 4H2CA 4K6AA 1VCVA 2JQXA 4M0XA 2W27A 1DWHM 3NPWA 1P7TB 3NZQA 4LC6A 3VDHA 4W5ZA 3G77A 2DSUA 3F4VA 1I8JA 2CPUA 2C18A 3BLEA 3DFOA 4KEUA 1CGXA 2O56A 3M0XA 2QCHA 5EL1A 3P0XA 4TU1A 2Y63A 5I24A 5I0DA 1TG7A 1A3WA 3OW1A 3UNTA 4MNJA 4A3QA 1KB3A 1BWVA 1V6TA 2ZC1A 1W1IE 3SJNA 4O0ZA 4ZE4A 2XVGA 3NEHA 3N15A 3P80A 5FI8A 2Y85A 1K8CA 3AU2A 3OU8A 4TX8A 1IR2A 1TJ1A 2YZ5A 1JUKA 3PB2A 2BX7A 3OBAA 4LEQA 1LG2A 2G41A 4IOTA 1TZ7A 3TYZA 4LUYA 5JQ9A 1YW1A 1XYAA 4AZGA 1KCLA 1EJWC 2VP8A 4DUVA 2PD5A 3UXLA 3PFMA 1IIGA 2NV1A 1KXQA 1J0HA 1XKYA 4IH3A 4KIEA 4I9MA 3R11A 1RBOB 1A5OC 1JQVA 1PJ9A 3N6JA 2Q8XA 4RNHA 4MB1A 2X1SA 3U5UA 3A3WA 3LU2A 2NWRA 5DCEA 4O1FA 5D9NA 1A50A 3TMLA 3MP4A 4NZ4A 1I60A 4MMWA 4NNBA 4D8AA 2ZXDA 1XRFA 1VBRA 4C6PA 2E6DA 2BVYA 4IP5A 3CQJA 2PWEA 1RA5A 3NJ3A 1LWIA 2V68A 1AZ2A 4EXQA 1ESWA 2XVKA 2FKPA 1XYBA 1VH7A 4MZ8A 4PBEA 1XRVA 1OIFA 1IXQA 4JTFA 1VS1A 4N6FA 3QBUA 5M17A 1ITUA 3BK0A 3QMSA 1R86A 2DZXA 2QW5A 1J01A 5JBDA 3CEPA 3QFEA 2ZKMX 2DT2A 4R34A 4XISA 3SRKA 4PMOA 4O4VA 3LB0A 4JFWA 2V5BA 1VPXA 3GLCA 3KVJA 2DZVA 3CIVA 4PRWA 3WQFA 1P7TA 2YCJA 4YXGA 2A4AA 3SRDA 1AQFA 2QCDB 4GNKB 3KCLA 2X7VA 3EA2A 3PBUA 4E8CA 4IUOA 4PSRA 1SMDA 3B0UX 3I6TA 3DENA 2B4GA 3UR5A 3LLFA 1E0WA 4Y9AA 1VFOA 4ZQPA 3VD4A 1N8FA 3EKGA 4ZBCA 4F9DA 1X1NA 3THUA 4DXKA 1UR2A 1WQ5A 3KHDA 3F4WA 2A7PA 4QSFA 2VR5A 3S2MA 5A8NA 4RDZA 3WFLA 2DH2A 4YL2A 5I3KA 4FNUA 1FBAA 1JJKA 4HA1A 4KWUA 4JPGA 4TV5A 2VGFA 2GJPA 1RQEA 2IPWA 4JGDA 3WLPA 3T4WA 4IJBA 1L6FA 2VEKA 4MB4A 5DBTA 1HL9A 1YKWA 3E2VA 3A24A 3LSBA 3UNDA 4HTBA 3QC0A 3VMNA 1KKOA 3UCCA 2PDQA 5CBIA 3CMFA 2E0PA 1KKRA 4EPBC 4KW2A 1X6NA 5KINA 1FDYA 1SJAA 5FD0A 1MUCA 3W71A 4AEFA 4NXKA 3QOKA 4CQCA 1IZJA 3M7SA 1PXGA 3CXOA 3IS4A 3DAQA 4RNJA 4GGHA 1Z48A 1TE6A 3SSJA 3PPGA 3I68A 5T91A 3R89A 5DXYA 1FQ0A 3PZQA 3V1PA 3MSGA 4QXIA 4MKSA 3S3GA 3PJTA 5LNSA 4HSHA 2EBNA 1KBIA 1XGEA 1CEOA 4B4HA 3WSUA 3R8RA 2H3BA 1XC6A 2P3ZA 3HPZA 3EWYA 5C70A 1R6WA 3LZ3A 2GDQA 1FWTA 1WKEA 1EF2A 2QCDA 3FAWA 3NNTA 1XGDA 4YYFA 3PS7A 3SDOA 5BROA 5KZDA 4GNVA 1R0MA 2QAPA 4DWSB 4A8NA 1K8ZA 4IQDA 3QV8A 4UQDA 5M1TA 3ABOA 4P8XA 2V30A 4ZSUA 1I1XA 1PX8A 2D0FA 4ACYA 1TUFA 3E49A 2VM8A 5HXMA 2HISA 4AD3A 5K9CA 4TMCA 3PP7A 1Q2SA 4DBSA 2V5DA 1OYAA 3MDWA 3WQ8A 1E1CB 3J7HA 3CL8A 3EEGA 2CYGA 4AIUA 3SBFA 1TMHA 3BLLA 1Z44A 3ATYA 3IARA 1UH4A 2P3EA 2BXVA 4IPIA 4NG3A 1IT8A 1CXIA 2Z25A 3NO5A 4NZCA 1FWEC 4QG8A 4S3EA 2XZ9A 3TJ4A 3GR4A 3NO3A 1YNYA 2G4JA 3QQWA 4XTIA 2POTA 5HR6A 1PSCA 3H7VA 4FALA 4FLOA 3LG3A 4HCDA 1QHZA 2ZUMA 3REQB 1QT1A 1YRRA 4LVAA 2JF7A 3CHFA 3ZLHA 3QF0A 2JEQA 3KL5A 1IHIA 4P7QA 1PUDA 2AL2B 4M24A 4AH7A 3KOWA 5CPMA 4QLJA 1EWDA 2XSBA 1O5XA 1WDQA 8CGTA 1Q63A 3P3BA 3VC5A 3ARXA 1XPYA 5HNNA 2J79A 1ZHAA 4DYKA 3LY0A 2OOGA 1BXCA 4GYJA 1FWDC 3ES8A 3RK8A 3UPWA 3GAKA 3U0HA 1S1RA 1W8GA 1DWGM 2Q3RA 4Y8FA 1XLCA 1X1ZA 2XINA 1V6UA 5F7UA 5K2ZA 3HG5A 3R4IA 1ME7A 1MWOA 4DWSC 5JMUA 1YTKA 4JTCA 4N0RA 1X6LA 1EHNA 5LKYA 1VBGA 4KRZA 3M64A 2WOQA 3MZNA 1US2A 5FACA 5HMDA 2DIEA 3HTWA 1HT6A 4J3UA 5JUVA 1KWKA 3KZPA 4H8NA 4L1GA 3BGGA 4BWLC 4DWSA 5FF0A 2Z1XA 2VEPA 4H9TA 1ZJHA 2F6UA 2IKGA 4B2DA 4W88A 2PUZA 3R94A 1W5NA 5A6TC 4KMQA 3TJLA 4B92A 4CN1A 3IVUA 3ME3A 4GVFA 3UWWA 5AZ1A 5BU6A 1EJXC 3B8UA 4KBXA 3RM4A 2FTWA 1OG6A 1OT1A 3BAYA 3CYJA 2PF8A 1E1CA 1OSEA 4JTEA 4QE5A 3JR2A 3B0XA 4JS3A 2EPLX 1DHKA 1R3YA 1ALDA 5CPSA 2QJHA 2FVMA 1EFZA 4GH1A 2C16A 2E5CA 3SY8A 3CUZA 4NILA 2Z4GA 2YCLB 3ICJA 3GWQA 4US5A 1IEIA 4IG2A 1KGXA 5HMFA 3VKDA 2FHFA 6XIAA 5C9RA 1DJNA 3REQA 2G50A 1ICQA 3E38A 4HQVA 4ZB5A 2XU2A 4GI9A 2J7BA 3E1F1 2R91A 4AUBA 1A49A 3HGJA 2AL2A 2WMKA 2WC7A 3A9BA 4PYSA 1EUNA 2GQ8A 3GKAA 4Q8OA 2VOMA 4WUIA 1PKLA 1V3MA 3KL0A 4OBSA 1GPWA 2HWGA 5CAHA 4UQ9A 2XYLA 3ZJKA 3VC6A 1KRCC 4G56A 1POKA 2ZX9A 5REQB 1TWWA 2DT3A 3G1XA 1D8CA 1GTHA 1PZ2A 3SAZA 1PO9A 3VU2A 3AAMA 2PP0A 4I7WA 4KCTA 3ABSA 2WB5A 1Z3NA 5HDRA 1UOZA 4FNPA 1DIEA 3EZ4A 1B3YA 1E6RA 3T09A 1RPKA 1WKYA 3DERA 2A3AA 1YDVA 3FAXA 3VI2A 2BODX 1E0VA 2VUYA 2Z0IA 2GJNA 3QHMA 5A6JA 1MEIA 2Z00A 3NM3A 3VIIA 1KM2A 4B3KA 1JNDA 3MMWA 4TUFA 1JDCA 4FLSA 4ORMA 3V1HA 1OABA 1UR1A 1Y65A 3II1A 1KFKA 3PHAA 5C8BB 2Z27A 1DQWA 1OB0A 3CUIA 1OBAA 3SCQA 1YPFA 3P2VA 1AW5A 4K2SA 5G2HA 1AW2A 1RBAA 4B5UA 4ZQNA 4AZ5A 1M9HA 1H63A 3FV9A 1FKXA 2BP1A 4ZOEA 1EC9A 3ANYA 3ABXA 3TQ0A 1CGWA 5CJNA 1J6OA 4ZFMA 3WF1A 2YCLA 1QI2A 4S23A 1JQXA 2PC8A 3P5ZA 3FS2A 3UVAA 3RM9A 4L6HA 1I0BA 4B15A 2PE4A 2DZPA 4WGXA 4D1JA 2PODA 1M68A 3H7RA 3TE9A 3WO8A 2HVNA 2ZUNA 5D2YA 4GCAA 3VIPA 3ITTA 5DF0A 4PTWA 1T6MA 3UR8A 5D9MA 2VCBA 4AYGA 5K9XA 1QHPA 2PDNA 2X41A 4DJDD 3IJ6A 3T40A 2ZZ5A 3NQCA 1IF2A 1ZAIA 2EGZA 3WFAA 4LALA 4DN1A 2OB3A 1PL9A 4B91A 3LCXA 4F2BA 4E2BA 3QR3A 3KP1A 3INPA 4O8AA 4QDPA 2V9DA 4K1GA 4QE1A 1ZAHA 1EBGA 3QY8A 2IKJA 2A1YA 3CJPA 5REQA 5TIMA 3RR4A 1V8EA 1JF5A 5JXQA 1MUWA 1TV8A 3R13A 1F3XA 1EJUC 3H12A 5E09A 5CPQA 2ACUA 4LYQA 3TX9A 4UFMA 3HMCA 2VX5A 2ZWZA 4FIRA 4XQ6A 3VCCA 1DPMA 1J9YA 2A6NA 1XD0A 5GNZA 4M82A 1Z42A 2IS7A 1XINA 2P10A 3RCYA 4CVUA 1X6UA 3H21A 3ARYA 1AD1A 1VLIA 1ZU8A 2ISFA 2AMXA 4MZ1A 1JYNA 3ITLA 4BK9A 4M7TA 2VRJA 1K4GA 1K7FA 4IF2A 1AW1A 4HYRA 5U4NA 3RDKA 4IFKA 3TJIA 3S2LA 3KDOA 1OCBA 1XQLA 1MMFA 1DJGA 3FYPA 2FZMA 2TSYA 1JPMA 4MZYA 3NQFA 3WLTA 2DT1A 1UR4A 2GYIA 3GVWA 4OV4A 4MF4A 4XSLA 4KQNA 1Z8AA 3KEHA 1E0XA 1Y5XA 3VZYA 2GZXA 4X3ZA 1UC5A 3DHPA 1LP6A 1UMLA 3MTWA 1PZ3A 3AS2A 1C8XA 1HZYA 1VIWA 1HL2A 3GDBA 1NAL1 4MWAC 2EHHA 2E1DA 1F6YA 3AFBA 3LTSA 3D46A 1H2JA 4GPNA 1VLWA 4D6IA 3WG6A 3ZWSA 1QNPA 1QVBA 1OINA 3I4KA 4PMNA 3LCIA 4AYSA 3I3BA 2BV9A 3W26A 3B05A 2X1RA 4MFDA 4GY0A 2PP3A 2QIWA 3GXIA 1TSIA 3WLJA 4AVFA 2YL9A 3KHJA 4CVWA 1MEWA 4RW3A 1H62A 3VD5A 4UOQA 3OHMB 1XSKA 3ARZA 1SW0A 1W9VA 2J6VA 2Z2BA 4G8TA 4AMCA 3MVIA 1WDWA 2WZMA 1EO5A 5BXRA 3GD6A 1FWIC 2QMKA 2HVMA 2VC5A 3QPEA 3ABQA 5A6BA 3PUGA 4X63A 2YSWA 4Q8TA 2FH8A 4LW7A 4UQEA 4YTQA 2L5HA 1E9IA 3WQEA 2EJ1A 4EF8A 2W79A 2PDXA 5AYXA 3L4YA 1QPKA 3T0BA 1R3WA 1ZBKA 3GKFA 3UP8A 2QCGA 3K4WA 3V16A 3W2LA 7TAAA 5BOOA 1NWUA 4A21A 5IDZA 4MUZA 5A8OA 3MMUA 1V02A 1UWRA 4AWUA 1MEHA 3U2OA 3NZGA 4C90A 2RGLA 1E6SM 1YTDA 4H9MA 3DN5A 4CGTA 4FZIA 4PFHA 9CGTA 1W1A1 3DDMA 4GUGA 4IIFA 4K68A 3IK4A 5DBUA 2HMCA 3WDPP 4ZCWA 1E15A 2J6XA 2PU0A 2J7DA 3CWOX 1KM3A 3CB8A 1XIJA 1EXPA 1SQ7A 2XVPA 4DF2A 3H4XA 4BF5A 3NVDA 4XZMX 2DVUA 1CENA 5E9XA 3TW9A 4S1FA 4JQAA 1Q3NA 3OOQA 3FGCB 3VOCA 4UFJA 1QMLA 4JKMA 3P8IA 3CQKA 2ALDA 1WZKA 3L4WA 3GR7A 3MBFA 1TO3A 3FEQA 1W37A 5FEPA 4R7JA 5FF2A 5HINA 1V51A 4NJJA 4LVBA 1FFRA 3B04A 3W4RA 3BG5A 3LGDA 1K6AA 5EFDA 2OQYA 1U5JA 3UG3A 3PK7A 1YHTA 3UGRA 2VFIA 4K7VA 4PL2A 1R2RA 2PGRA 1IGSA 2PWFA 2WQDA 4YLWA 1XI3A 3HM7A 3B97A 4H6KA 5I3JA 3OO2A 4GWEA 4YTTA 4HSNA 5BNKA 4C6DA 2CBVA 3G1FA 2NQ5A 5I3IA 4EACA 3UWZA 4M1RA 3P82A 1TWIA 1W3LA 4CNPA 3P67A 4A3HA 1THFD 3EDFA 2CESA 1V3IA 2JALA 2PDUA 1CXKA 1WXZA 3NQ8A 2VGBA 1H7NA 4ADSA 4LS1A 3VGGA 2HZGA 4LRSA 3I10A 2D0GA 4FNSA 2HXUA 1PDZA 2YL6A 1OD0A 1OFAA 5F1UA 2Y5EA 1E9LA 4RDWA 3VO0A 1Q6QA 3UWYA 4UR9A 2P50A 1ADOA 1D3GA 4U4MA 1Z6KA 1E0UA 1MNZA 1MQRA 2OKTA 2GL5A 3CHVA 4UTLA 1LWJA 1DJQA 1DYSA 4UQCA 4HMNA 3CHDA 2CFFA 4DJFD 4F2UA 4WKHA 2DSKA 3BOXA 2R1NA 4NHVA 1X8CA 1UZ4A 2Y5SA 3APYA 1E6PA 2E28A 3KBJA 1HKIA 2FPTA 3M43A 3DXIA 1WPCA 5CPLA 3W23A 2INFA 4O53A 3H53A 4XD6A 5I23A 4HKPA 3VTRA 5G2IA 2HDJA 3IV8A 3PZTA 4D72A 2ZIDA 3FGCA 3LHYA 3AS1A 3U7VA 1H4PA 2O9OA 1XKJA 3WK1A 3HV9A 2B7QA 4LUJA 3E0WA 3WENA 4UTMA 2ZXBA 3LRMA 1TR9A 3EWZA 2NVCA 3KOZA 1H09A 2BNJA 2A3LA 2A21A 1UWUA 4MDPA 3EWCA 4YNGA 1IT0A 2R94A 4JQ2A 3AIQA 4PBGA 1W2VA 4NZJA 5FJTA 4G6CA 2XGBA 4DUWA 4RXFA 4MGGA 4TX9A 2ZUTA 2E68A 1W91A 4I6KA 1S5NA 2Q02A 4FNQA 4XV0A 5HR7A 3CQIA 3H2OA 2PS2A 7REQB 4LAUA 1E5JA 1E3ZA 4KRTA 1F05A 3AXHA 1ZLPA 1KV8A 2V2DA 3SCRA 3VNYA 4PEEA 3W81A 4D71A 3PZIA 3ZT6A 4PUDA 2GWNA 1QATA 1OZMA 1RP8A 5I2UA 1ZALA 3LCFA 2WMJA 3RXZA 3FKKA 3W00A 5LNWA 1AVAA 3A22A 3PPCA 3L5AA 2VFEA 3ALFA 1FFQA 3APGA 5DO8A 2WLYA 1ZCOA 3KVLA 1LOLA 5GNYA 2D24A 1JGIA 4BQ2A 1F7BA 3GR8A 2YDQA 1H1YA 3E2QA 4MYAA 1I9CB 3IJLA 1KRMA 4H3DA 1UH2A 3CZEA 3S5ZA 4W86A 5A8MA 5A2CA 3W2MA 1KQYA 3NXFA 2EXOA 2W0UA 2ZRZA 5F2IA 5HATA 4CCDA 1JGMA 2W4XA 1LLWA 2POZA 3N25A 1PKNA 3EPMA 3V35A 2XISA 1VPYA 2PB1A 1Q65A 4HA3A 3EX2A 1EPXA 4KEVA 2VZTA 2QLYA 1C8YA 5F1VA 3GFZA 2V5JA 5D38A 1XBVA 8XIMA 1WX0A 4LNCA 4JCMA 4HHLA 3LPPA 1Q66A 4HGXA 2I5QA 4AX7A 1HNYA 1JRCA 1QNSA 4M6QA 2DORA 3GK0A 3N2CA 1IGWA 4AWTA 4FA3A 3GVRA 3P8JA 4I8DA 2FTPA 4U33A 3P5YA 3PZMA 2V3DA 2ANUA 4J27A 2QPUA 2GOKA 1Z89A 3H54A 3VCRA 1UBSA 1ZCCA 3VOGA 2VFHA 5ABEA 2NVDA 3PPFA 3WKZA 5BWFA 1QAPA 4AWSA 3WNKA 4L9XA 3GHRA 1G9HA 4UOZA 1UROA 7REQA 2EPMX 7ODCA 1RPXA 4EWJA 4KWSA 4M56A 3WH9A 5E5CA 2F84A 2OLSA 4GX9A 4H4IA 1FP9A 1Q7MA 3GFYA 5I02A 4PCPA 1DJZA 3E74A 3G1VA 1CXHA 3V0TA 5D04C 1GTEA 3FN9A 3UYIA 2VEIA 4IIDA 3EKZA 2C0AA 1ZY9A 1U2YA 2WNNA 3S47A 5I5RA 1OGSA 3GC4A 3RG6A 1RHCA 3AMDA 3TXVA 3KRBA 2Y6ZA 2HK0A 1O4UA 2X16A 3PFRA 4CEUC 1FVPA 3F5LA 3MI3A 1XIFA 3HO8A 1KTCA 3WK2A 4IQJA 1VYRA 3QTPA 1E4LA 4HK5A 4U2ZA 2XTKA 2R24A 3RILA 5D32A 4Q8MA 5H8PA 5DMNA 2ZWYA 4UQBA 3Q67A 3PBWA 5FEZA 2X1TA 1XX1A 4YTRA 3IV3A 1H7OA 3CPGA 1TTPA 2J7FA 2DDXA 2BZNA 1HJSA 3V75A 1IWBA 1YE6A 2OG9A 1QNVA 5EMMA 4RE2A 2F38A 3B3DA 4JOMA 1LYXA 3OLGA 2ZX7A 5MHBA 1WDRA 3AALA 3LENA 4C6EA 3MP3A 4EPDC 2Z6IA 2I9UA 3VCNA 3ZIZA 3FXYA 3DBNA 2CLEA 2WK2A 4L1XA 2RKXA 3AIBA 2LLEA 4M29A 2GSHA 5KITA 1PCKA 3BSGA 3NL3A 1C92A 2ZRUA 3QV6A 2FYMA 3SN4A 3QR0A 1UPMB 4QCFA 4RKAA 3AICA 2DIJA 4B90A 1RQHA 2WZTA 4DO4A 1TMLA 1O94A 4HA4A 4LAMA 4A3RA 2HQAA 3WN6A 1DL3A 1FUYA 4MUPA 4GZ7A 1US3A 4ZOBA 4Z1CA 1FRBA 3OGRA 4JNZA 1BPLB 3QLDA 2WJEA 3T4CA 2OEKA 2VUNA 5BRBA 1E3XA 2BBFA 1OFEA 3VGEA 3NA8A 3GNRA 4AD0A 4KETA 3M0IA 2DZAA 2WWDA 1KLYA 1OFDA 4HPGA 3LPOA 2D73A 4HZ6A 4LJ3A 2O7QA 2G3MA 2E8ZA 4O11A 1T0OA 1FH9A 2I57A 3NPUA 3KW3A 1IE7C 4XTDA 1H7XA 4Y9NA 4XIMA 3RN6A 1L8PA 3PWAA 3TJXA 3OG2A 5MKGB 2VCCA 4AC7C 2GVGA 3UFYA 3W2KA 1DVJA 3DKLA 3O7UA 3WH5A 1ZB5A 3HPXA 1J6PA 3UXKA 4GYKA 3BXWA 1XDMA 2QCEA 3MCMA 3W1XA 4PUKA 1ZP4A 4TOQA 4WVXA 3TSMA 3QKZA 2QUTA 1TVLA 1ISYA 1VRDA 1E1EA 3LRLA 4DEFA 3WEZA 2ATMA 5FA5A 4Q33A 1A0EA 1UB3A 4F0HA 3ATZA 3KTSA 4M1BA 4FR1A 3WLIA 5FSDC 3NWRA 1R5YA 1LUCB 2X30A 4LSBA 3L4XA 2GGIA 2FB3A 2A3EA 2BTMA 1B1YA 2BVDA 1HJQA 1OFRA 1X1OA 1S46A 3IUHA 4JTJA 1L0PA 1EIBA 2VD9A 3N9SA 2I5GA 4JFVA 4XZWA 4PCNA 4QROA 1ITCA 1CGYA 1W1TA 2TPSA 4I6VA 4K8HA 1P48A 3LX9A 1ZGDA 3S83A 2VZVA 2CLFA 1U1UA 4XO7A 5LA1A 2ZDSA 4IQEA 3SCNA 4HNUA 1RQBA 4A22A 1LL4A 1RCQA 2X0SA 2MUCA 4TTGA 1OX6A 4HHMA 1TJ2A 3WBYA 2XIJA 4UMBA 3NQ7A 2JGQA 1Y5VA 3QLLA 3F1QA 2E6AA 3PZNA 5A3HA 3WD4A 2YYUA 3BLFA 2G4FA 2I5IA 4WR3A 4W9TA 4J3SA 4IFRA 4A3UA 3H7UA 5A6KA 1DIOA 3U3HA 3BGAA 2D2GA 3GM8A 5DRCA 4YHGA 2EG7A 1QCWA 5IOBA 5D8WA 1AA1B 1L2UA 2BB0A 2OLHA 5AYIA 4P7NA 3PZVA 4JYDA 1SZRA 3MHFA 2Q6ZA 3HPAA 3I6RA 3ZFHA 3QR1A 3HF3A 2E25A 2OZ0A 5MKGA 1AD4A 3D3FA 3EPNA 3W53A 5ABHA 1XUUA 3GIPA 1GOQA 1JDEA 3F03K 5HQMA 4FEZA 4JFUA 4D1IA 4GISA 3S5NA 1B4EA 1E5NA 3ARRA 3B8DA 4GFIA 3V36A 3NZPA 3W88A 3A3XA 2BG5A 1AJ0A 2PWHA 3NAVA 3B9NA 2ZA3A 5AYZA 3EEZA 1M04A 3VDGA 3WLOA 4OGZA 1M3UA 2YL8A 2Y70A 3GNNA 4G2DA 4GQQA 4R7OA 1J0KA 4YCOA 3SQSA 4LCQA 3HPFA 4FI4A 3W25A 4A8RA 2H6RA 3UR7A 1LQ0A 4JTUA 5FF4A 4C1NB 4Q22A 3SSZA 1N7KA 2OEJA 1XIDA 2C13A 1LUCA 1VIZA 3OVPA 1FX6A 1F76A 1WOBA 3UZ5A 4U5IA 4ZB2A 2FTYA 4QQ3A 2V8ZA 4PL1A 3PC0A 3T05A 1XYLA 2BY0A 3TLLA 3E2RA 3WLHA 1DHPA 4LYRA 3PWGA 4NI8A 4Q4RA 1XWYA 3LCGA 3S6OA 1RD5A 3QC3A 5HWJA 4QJ3B 1H41A 2RDWA 5I3HA 2A7NA 4JY9A 1GVYA 1ELSA 2BVWA 3BURA 5T9BG 3MWAA 3GTHA 5LA0A 4PUEA 3WQWA 3WLSA 3T0DA 4D9PA 4I5RA 4JTDA 3CO4A 1V0MA 2WHMA 4WZHA 4YVXA 3W7DA 3VKCA 4HOZA 3OGVA 1ODZA 3RAOA 4UCFA 1H1NA 3JZUA 2XIIA 3WQVA 1QK0A 3MUZ1 3TA6A 3FOKA 5LSMA 4RNFA 2YA2A 2BOEX 4XSMA 3WLLA 3QV7A 2CWXA 1Q6EA 4C65A 2VHLA 1KCXA 2ISWA 3V5OA 3IUIA 4N4PA 3WK3A 4Y96A 3WF3A 3BV4A 3WK0A 3RJXA 1KXTA 1WKFA 1PV8A 4L4LA 2JEPA 3SQMA 3WNPA 5DMYA 3H23A 4DBWA 3IIXA 5KETA 4XBKA 4ZOAA 1MYRA 4JD4A 2UV8G 5EY5A 3CQHA 1T8QA 4KT2A 5KSWA 2NQ9A 2FHBA 3C52A 1TQJA 2EPOA 1KFEA 1US0A 2C1GA 4MKNA 4S2BA 3ARPA 2FVKA 1KWGA 1QI5A 2I9EA 2ABAA 4O28A 1PAMA 3QPZA 3NQVA 4C1NA 3VDCA 1L6YA 4A4AA 2QXWA 1CB7B 2HBVA 1AMYA 4Q4SA 4J3ZA 3VUPA 3ITYA 1KNWA 3HU7A 1JCNA 2XIBA 3CPUA 3T0AA 3MDUA 3YPIA 2OWXA 3C8FA 4TO8A 3C2EA 5I7GA 2QUNA 3JVAA 1YTEA 6A3HA 1NDVA 1O7AA 3H2CA 1TE1A 3KBNA 4V1YA 3DUGA 1JCMP 2WO5A 5LXXA 3N9RA 1DQXA 1OWQA 4KIRA 1F6KA 4K7YA 1B31A 1EOMA 2J8GA 3MSRA 3RJYA 1TCMA 3UZWA 1ZNNA 2DPEA 1KFJA 4CNNA 3T2OA 2J7GA 1UUQA 3N2BA 3BAJA 4MAVA 2G8ZA 1WA3A 3GDKA 4GZIA 1GYMA 3W7NA 2JBMA 3PPHA 1HP5A 1G0CA 3MMDA 4I5UA 3KLLA 3KFTA 5EMJA 2R1KA 3EMZA 3UYCA 3O6CA 1H11A 2R9RA 3VOJA 4YN5A 1D2KA 4B5SA 1EX1A 4P7RA 3VINA 3GXNA 1NF0A 1O1ZA 4L4PA 1SW3A 1TTQA 3SGZA 3FA5A 1FHDA 1LM1A 3RO8A 2IXVA 2FHCA 1JDAA 2QZRA 3TZFA 1WXYA 4MJZA 1HJVA 3GC5A 4UFLA 2R1MA 3M0LA 1X97A 1XL9A 5ECUA 4FNRA 3EMQA 5TF0A 1GVFA 2PLKA 3GH7A 5ENLA 1OK6A 5ABFB 1XV8A 4JHZA 1H51A 5LYRA 2TAAA 1MXSA 5E0FA 5G4EA 5H2ZA 4AZHA 1Q8AA 3M0YA 4FXFA 3H2MA 4O18A 4XBSA 3W2NA 4C5YA 3N6HA 3HURA 5BMXA 1EQPA 4MFEA 3DFTA 3GAYA 3ZJ8A 4FP1A 3GQYA 2J8FA 4JTRA 5AHNA 1K4HA 1I2PA 1K1DA 3PF3A 4YYCA 1GYLA 2A2IA 1P0BA 1JCXA 3CUFA 5HMEA 1J5TA 3EXSA 3GU2A 4UZUA 3PM6A 4S2CA 1OF8A 1GG1A 1UUOA 2NQLA 2ZICA 5D4YA 3VFLA 4O15A 4ENLA 2WCSA 3AYVA 4RL3A 4XO6A 1QOQA 3DG6A 3ELFA 4ZTXA 1NELA 1DEDA 4C5ZA 1ZJAA 1X98A 3TSDA 4GK8A 1HVXA 1UD5A 1D3CA 4XZ9A 2C79A 5AC4A 3N14A 1PBGA 2OVLA 5LA2A 2ZFAA 4LS2A 4HNCA 1DTNA 2ZE0A 2PTDA 4HNNA 1EA0A 4IWWA 2OYMA 3GDRA 4XIAA 5KTLA 1IWPA 4XAPA 4HMEA 3IGHX 4NZ3A 5LXEA 3QV9A 4G7FA 3AMGA 3TFCA 1HIZA 3W1QA 3AYSA 4RPPA 3PBGA 2XH0A 5JIPA 3ZJ7A 2TODA 1OJXA 3LNMA 1FH8A 2J66A 1G4PA 1TRDA 1REQB 1XFCA 5EPDA 4J3WA 2C91A 3QMTA 4L4OA 2IW0A 4ZL1A 1KRAC 3GUGA 4I5XA 1EX5A 4HU0A 1OD8A 3W7KA 1L2QA 3TN3A 4E4PA 1EIXA 1TELA 3ZMRA 2ZUWA 2VC7A 1XIHA 4LB3A 2A79A 1UW9A 2PZNA 2WPBA 4GQGA 1ICSA 2JK2A 5H8MA 2BGSA 5ABFA 4R33A 3T6CA 3OZOA 3T07A 4TQTA 1V3HA 1B3VA 4ZB0A 4K37A 4BHYA 4I8YA 3VABA 4G1NA 2Z29A 4Q4QA 1TWZA 1O60A 2OYKA 1S1PA 4S3AA 1W3KA 5I00A 3N73A 4FHAA 3BJTA 3LBOA 4GMEA 4RZ6A 1QOXA 1JFHA 2WC4A 1OVDA 2V3EA 3VGDA 1XQKA 1I2QA 1BSLA 3MUCA 3R12A 1PKMA 3F4NA 4ZXLA 3PUOA 3BCDA 1IXPA 2W3ZA 3KTXA 3TP4A 4HMCA 3FDKA 3M7WA 3ONBA 1QI0A 2PWDA 3ITCA 3OQEA 2DV0A 1Q6GA 3N34A 5AY7A 1BEUA 2PURA 3FJ6A 3UY7A 1QJWA 4GIAA 2VELA 4CQ8A 3W07A 3HJEA 3MUY1 5I77A 1RAKA 4MG4A 5D2WA 3IGXA 4J9JA 1H7RA 4ML9A 3SUSA 2OOFA 3WL1A 3KS6A 2JIEA 2J7CA 2PSNA 2B7NA 2Z7KA 3S2JA 1JUBA 1WYIA 1SPQA 4DWSD 3N4FA 4LNYA 2ABBA 1W32A 2C7FA 2AKMA 1IWAA 1M7OA 4JYEA 4DELA 4B2DD 5AOUA 2H8XA 2GOUA 3AZRA 5HULA 1JZ2A 2XN0A 2XZ7A 3GZ3A 1ODUA 4W8LA 1TV3A 2DJXA 3VOIA 3ZSSA 3I4EA 2AQVA 2PD9A 4AMAA 3UA4A 2QV4A 3SGUA 3MT1A 1GHRA 2OYLA 1XYZA 3RF9A 5J8LA 3GBDA 2GUUA 3BWWA 1ZBCA 3W01A 3CMGA 4POCA 3UW6A 3E5BA 3LTPA 4IIHA 4GI8A 3C0SA 3OLDA 1JXJA 4AF0B 5CGTA 1U33A 3W0KA 3IAQA 4LEFA 2GDUA 1XGZA 3JU2A 3H2EA 1B3ZA 2OSWA 4CD5A 4CD7A 1BKSA 3UG5A 2SFPA 3OBKA 3KRSA 4QNWA 5DT5A 1IZKA 1FHVA 2QVHA 2V38A 4PMUA 2HE8A 4LX4A 3MHGA 4ZQCA 3SJ3A 3W02A 8TIMA 3WMSA 2YB4A 1OX4B 1CGUA 3CYVA 3M0JA 8XIAA 4RLIA 4NIRA 5D2VA 2QNEA 2E9LA 3E02A 1QU4A 3W9ZA 4MPQA 4C1KA 3THQA 4IXXA 1LTDA 2WKLA 1ITQA 1K7XA 4DAFA 1AJZA 3CGTA 4P8UA 3W6LA 1GKPA 1MNSA 1V7YA 4A8IA 4AZCB 3W72A 4AD5A 3HQPA 3ERPA 3MJYA 2AL1A 3QY7A 4R9XA 3LHWA 3CUHA 3EDKA 3S1XA 3PUEA 2ZRVA 4LVFA 2V3FA 1E72M 2VTFA 5D2TA 3GW0A 3U57A 4MIMA 3W76A 1WDSA 3GRIA 4H8UA 3RX3A 4DNMA 1FDZA 1M7PA 2Y88A 4HPXA 1XCWA 1TX0A 2RHGA 1GYNA 3MB9A 3OGSA 5LNVA 4O16A 2ZTJA 2BASA 4Q6XA 4A2SA 1J0YA 4DXXA 3TXZA 3BQ6A 1E6XM 2CC0A 2IMRA 3WQ4A 3W38A 3TYEA 3MA8A 1G94A 1WE5A 9RUBA 4RPQA 4WX2A 1JD9A 2Q3OA 1W3JA 1Q4NX 4DIAA 1EJTC 3EAUA 1EYWA 1UG6A 1OC5A 3GH4A 5BW6A 2ACQA 4H9VA 2QCNA 1J5SA 1EQCA 1HGYA 3WJYA 4C7DA 3W1TA 2AOSA 3Q94A 3CHCA 3EWXA 4O8RA 3WDRA 3MSDA 3AYRA 3R10A 2V5KA 3WIJA 2Z7GA 3TWAA 1TMQA 4KFOA 4JTTA 1RCOB 1LJYA 5FESA 1J79A 3O0FA 5CC3A 2HS6A 3VGBA 1XW8A 3NOYA 3P81A 3VOHA 4O19A 2QULA 1TCDA 1UOKA 4DHGA 3Q2DA 2PF0A 3ONCA 3UJEA 3EDEA 1HQTA 4OKDA 4B9ZA 1NFPA 1FXQA 1G7UA 3FDGA 1OX4A 2GJXB 1Q13A 5AHMA 3CQ0A 1GZ1A 1DIDA 3B0YA 5IRPA 2NW0A 3UG8A 3IIPA 4JCLA 5BOEA 2YBTA 3A47A 2VWTA 4PB4A 5C71A 5HJLA 1UWTA 1TKKA 3AMKA 4MNMA 2JE8A 4AZCA 4O1DA 1W8SA 1WV2A 2PDKA 3TA9A 3VNJA 3WL0A 3IRDA 1XD1A 1ECEA 3GBEA 4V28A 1UR3M 3LA4A 3IJ9A 3N1AA 4HD5A 2H90A 1CXEA 1EEXA 3MI2A 4LV4A 3UD6A 2YFOA 1GVRA 4Q4MA 1UA3A 2GJRA 1OGGA 2A7RA 3EBVA 3T1GA 2EO7A 2UY3A 3W27A 3PWIA 1Q6DA 5EMUA 4GO8A 1VF8A 4GUHA 1GVEA 3S9IA 1Y5WA 1P6BA 1NP2A 3W1LA 2OZTA 2QT3A 1L6SA 2P0IA 2CXGA 3TYAA 5LIXX 1DTUA 3S2CA 1XLHA 2DSZA 2J75A 3SW6A 4N4QA 4QS5A 4WRHA 3MKKA 5EMYA 1E70M 4L1WA 3EX4A 1LCOA 3OEXA 4PTDA 1XLBA 1UKOA 1A5MC 5ABGA 3HJZA 1UD6A 1OEPA 3GFXA 2J88A 2ZUVA 3TK7A 2BY1A 3EOSA 4NRSA 3F2CA 1Q8JA 2FJKA 1UIPA 3W2UA 1BGAA 3K30A 1TVNA 3WCZA 4PMJA 2V0TA 2EPNA 3P6LA 4GGBA 2H9AA 3CT2A 2Y7GA 1NOWA 2DU2A 1RK5A 3E0VA 2YZRA 4ZE5A 3GXTA 2DUXA 1QDSA 3THCA 3GVGA 4YIWA 2D23A 1OYCA 1VAHA 2ZC8A 1UKTA 3LM3A 1I4NA 1OK4A 4MB3A 1FWGC 5GPRA 1AMKA 5LNUA 4GBUA 2TYSA 2PPGA 1QASA 9XIAA 4RJEA 2QQ6A 4XZIA 1UD2A 7ENLA 4MWAD 1ICPA 3POHA 5CPNA 4H04A 4DZAA 1IQ8A 4KCUA 3USZA 2GJXA 2OWWA 3CU2A 3ANUA 4WKAA 4EAYA 1GEQA 4J28A 1WBHA 1FCUA 1A5BA 4GIEA 5FJJA 3PVFA 1XCFA 1VRXA 4CD8A 5A1AA 4FIQA 1DBTA 4K8EA 2YR1A 2ZADA 3DI1A 2RH9A 2V81A 4UTWA 4FOUA 4GXMA 3M41A 1KFCA 4XK2A 5KZMA 3R7MA 2GUYA 4CQDA 1XG4A 4PMXA 1RK6A 2TRSA 3W70A 3UESA 2Z1VA 5AB3A 1B54A 3B9EA 4PODA 1WO2A 2G0WA 4KESA 5C0QA 4Q8PA 3OJGA 4HU3A 1ZSXA 4HOXA 1OGBA 5IM51 5HUOA 1LBFA 3WFZA 1E6QM 1R2TA 1SSDA 2YBVA 5HMSA 4U3AA 3B40A 2OJPA 3KBSA 3C3NA 3P93A 4MJMA 3AXMA 4C6IA 4GG9A 4Y90A 4DYEA 4ZQMA 2GQAA 2QDGA 3TROA 1IR1A 1W9UA 2WBKA 4TXEA 4K39A 3FCPA 2VI0A 3R0KA 4LANA 4R27A 3QEZA 4KF1A 3WBWA 3NM1A 4M8UA 4D6CA 4B9YA 3WQOA 4YJ5A 3DU0A 5FIPA 2VOTA 2G95A 3CM4A 1ITXA 1YX1A 5E6ZA 5D05A 2XFWA 3WH6A 5E0KA 4HPNA 4AIOA 1S2UA 4TVUA 2O92A 1SM9A 1VEMA 1RLDA 4M6VA 1G5AA 2CETA 3VFCA 3OA3A 1LOSA 2A6LA 1TPDA 3UWVA 4AG0A 5ABTA 1FDJA 3PAJA 3BW4A 3O9NA 1VGAA 3BSMA 3NSXA 1W9BM 5C2CA 3B9DA 3TZNA 5F4XA 3VAVA 3WUEA 1SO4A 2GPTA 3F4DA 1DWFM 2FH6A 4B3ZA 5G1TA 2J9ZA 4ONVA 4N02A 4JN8A 1SGJA 1TRIA 3IVTA 2W67A 2DT0A 3TAOA 5GJPA 1S2TA 4A35A 1BWKA 1G67A 5EB8A 4P7OA 3AIUA 2VDIA 5HQEA 3LXAA 5D02A 4QQUA 4DYJA 5BXPA 1VBJA 1JL8A 1P0KA 3QRHA 1M7XA 2NX9A 4IX0A 4Z2LA 5AECA 1A5KC 1RJQA 3KOYA 1R46A 3N6QA 3AUOA 5A8PA 5GJNA 1SO5A 3DEQA 3L66A 5CSYA 3W87A 2QKFA 2Q01A 4FB7A 1K77A 4YVPA 1EF3A 5E70A 3TR9A 1KXVA 5JH1A 1XH1A 4MWAE 1S38A 1HJWA 3C0JA 3STPA 4QSHA 3Q65A 3BLPX 4S3KA 3D47A 1VR6A 4UMAA 3AC0A 1HN1A 1XS2A 2C0HA 2C1IA 1C90A 1EP1A 1YDYA 4KWVA 1U5HA 2ZOXA 2WHLA 4O10A 2BMBA 3IIVA 2CZDA 4WEVX 3WELA 3EA1A 3EMCA 4QJ4B 3AISA 4BY3A 4BEQA 4DX3A 4IGNA 4Z2KA 4U31A 3TSBA 5E9AA 3V3WA 3ZLFA 3AIWA 1DJYA 3E3HA 1GW9A 1TPC1 4Z2IA 4DJDC 3LCWA 4N9BA 6CGTA 4H41A 7PTDA 4KCVA 2WPGA 1V02E 5DMLA 3A23A 4QDWA 4WDTA 1SJDA 4F0LA 1SO3A 3TC3A 1ISVA 1V77A 4LCSA 5CSUA 4E2VA 2WVTA 4XD4A 2ACRA 2HROA 1CECA 1OFQA 2QCMA 1CBGA 5L9FA 1ONXA 2AAAA 2CXEA 1OYBA 2UY4A 2VVSA 5M3WA 3PTMA 4DJDA 3N3MA 3KDNA 4ALDA 2DQXA 4HP5A