4JTRA

Akr1c2 complex with ibuprofen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
KYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C2
publication title Structural basis of NSAID selectivity for the AKR1C family
rcsb
source organism Homo sapiens
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtrA00
4XO7A 2PDXA 1LQAA 2FZ9A 3R7MA 3V35A 3WBXA 1LWIA 1QWKA 4L1XA 1YNPA 1XJBA 1ZQ5A 3UWEA 3UZZA 2IPWA 4GACA 2BGSA 3CAQA 4NKCA 1A80A 4WDUA 4WDXA 4GA8A 1Z3NA 4LB3A 4WDWA 3V0SA 4WDTA 1C9WA 4PUUA 2WZMA 5LIXX 2PDJA 3LN3A 3FJNA 2IQ0A 4XZNX 1EF3A 4JIIX 3C3UA 2PDIA 2ALRA 3LQLA 3H4GA 4XZLX 1AH4A 1VBJA 3ERPA 3LD5A 5HA7A 1T40A 3UP8A 4EXBA 1T41A 2IPJA 4JTDA 4HMNA 4EXAA 2A79A 1AZ1A 2J8TA 4AUBA 3R6IA 1MRQA 4JQ2A 4L1WA 3F7JA 2PDQA 3LQGA 3BV7A 4MHBA 4R9OA 4XO6A 1S2AA 1XGDA 4QXIA 2WZTA 3EB3A 3GHUA 3M0IA 2FGBA 1AZ2A 3ONCA 4XVEA 5HNUA 2PDBA 4JQ3A 2IKHA 3QKZA 2IPFA 1MZRA 4JQAA 3BURA 2PDWA 1RY0A 3T42A 3V36A 1US0A 2PD5A 3FX4A 3M4HA 4JQ4A 3RX4A 3LUTA 3WCZA 4I5XA 1RALA 4QX4A 4WEVX 4ASTA 2PDLA 1Z9AA 3COTA 3P2VA 1VP5A 4FZIA 3DN5A 3KRBA 2R24A 2C91A 3WBYA 5AZ1A 4DBSA 4F40A 3CMFA 4JTRA 3R43A 3R58A 3Q65A 2IKIA 2NVDA 3H7UA 4H7CA 4Q3MA 3GHTA 1Q13A 3LZ5A 3O3RA 4JTAA 5DANA 3RX2A 2DUZA 1S1PA 4RPQA 3CASA 3H7RA 2PDHA 4IJRA 4OTKA 1S1RA 4ICCX 3CV7A 2PD9A 3ONBA 5M2FX 3GHRA 2PDPA 4JTQA 2CLPA 1OG6A 5KETA 3UZXA 1SM9A 2PDUA 3BUVA 3B3DA 3UG8A 5C7HA 2HVNA 4QR6A 2PEVA 5AZ0A 3CV6A 1ZUAX 2ACSA 2FZDA 3EB4A 4YU1A 3U2CA 2ACQA 5JH2A 1RY8A 3DOPA 1EL3A 4QBXA 4GQ0A 3UZYA 1IHIA 4XZHA 2P5NA 3VXGA 2HDJA 1PWMA 1JEZA 4Q7BA 2ISFA 4YS1A 3R94A 4G5DA 3O0KA 3MB9A 2DV0A 1AH3A 1AFSA 1Q5MA 4JIRA 2I16A 4LAZA 4GCAA 4GQGA 2PZNA 4DBWA 3R8HA 1AH0A 3UYIA 1R38A 2BGQA 1XF0A 3CAVA 4LAUA 2ACRA 4DZ5A 1S2CA 4YVPA 1PYFA 1YE4A 4LBSA 4XVDA 4PRTA 1IEIA 3RX3A 1X96A 2BP1A 5LIYX 3M64A 5LIUX 3GUGA 1MI3A 1ADSA 2IS7A 3BCJA 1HQTA 2DUXA 1UR3M 4DBUA 2HE5A 1EXBA 3LEPA 4LBRA 3GHSA 4IJCA 5LIKX 2F2KA 1X97A 1J96A 1GVEA 1PZ1A 3N6QA 3R8GA 4PUWA 4XZMX 2HVOA 3MC5A 2FVLA 1FRBA 2QXWA 4PRRA 2VDGA 2F38A 3V0TA 1QRQA 3S3GA 3UFYA 2IKGA 1ZSXA 4XZIA 2IPGA 1Z8AA 4GABA 2NVCA 2PDMA 3LENA 4H8NA 2HEJA 5JH1A 4IGSA 2IQDA 5HNTA 3LNMA 2AGTA 3LZ3A 2INEA 4GIEA 4JIHA 4FAMA 4JTCA 2PDYA 1ZGDA 2PDFA 2PFHA 1K8CA 3D3FA 1PWLA 2PDKA 4FA3A 4JQ1A 2INZA 2HV5A 4FALA 3N2TA 1YE6A 1EKOA 1HW6A 1YNQA 2FZBA 4PMJA 2PF8A 3Q67A 4ZFCA 4HBKA 2I17A 3G1RA 3UZWA 4LB4A 2R9RA 3LBOA 1M9HA 2FZ8A 3V0UA 4WGHA 1X98A 3EAUA 2IKJA 4PR4A 2PDCA 4WRHA 3NTYA 3WBWA 4XK2A 3G5EA 2ACUA 4YVVA 3WG6A 1PZ0A 2PDNA 4YVXA 4XAPA 2HE8A 5LIWX 1Z89A 2PDGA 3UGRA
chains in the Genus database with same CATH superfamily
1P7TA 4XO7A 3OEXA 2FMOA 3PPCA 4HJFA 1P43A 5KZ6A 1E6SM 1OCJA 3SIZA 4HZ8A 4AYGA 5E70A 4AWTA 1Q6CA 2HBXA 1GG1A 3RLGA 4HA0A 1XYBA 3K46A 3AAMA 1HO1A 3FY1A 3RDKA 1WBJA 3FYPA 4KCTA 1P0KA 2IPWA 2QCCA 3OBKA 1N82A 1TSIA 3SIMA 2G5WA 4AZBA 3V0SA 3C86A 2WMJA 3SUWA 1BXCA 1V7AA 2Q8ZA 4H7ZA 4NZFA 1E40A 3GDMA 3C3UA 1ZZMA 1PE1A 3SGUA 4EAMA 3DG7A 3A24A 1WKEA 1G5AA 3C2EA 4OT7A 3SBFA 5CGTA 3WYZA 3VM5A 3RPTA 4L6HA 1V6XA 2F6XA 5F2MA 2DW7A 4U2ZA 3TTOA 3BW2A 3UR5A 3A64A 1E6QM 1TUFA 2VJXA 4IPJA 4EPDC 2BOGX 4C6JA 4HYVA 1W9DM 1XWYA 2CZEA 3R6IA 1AA1B 3S42A 3RFAA 2VWSA 2XFYA 4U28A 4HTYA 4LYPA 1W9XA 2PWGA 1G9HA 2HK0A 2NX3A 2VEKA 2I1OA 3GHUA 1HKIA 3PZUA 1W56A 5I03A 2QCHA 2FH8A 2C0AA 4O14A 2E6YA 3TW6A 1CXKA 2DZBA 3M0XA 2EJAA 2J9YA 3P3BA 4UTWA 4DJFA 3STPA 1JCLA 5AHNA 4J9JA 4DIAA 3WLIA 3O05A 4E8GA 1DJNA 3GVRA 1UD8A 4LVAA 2NZLA 1LOQA 2P76A 5HPOA 3KE0A 3M4HA 1HJSA 4L4PA 3NVTA 4V2XA 1RPKA 1BKHA 4UTMA 1RA0A 1UOZA 3O1NA 2YYTA 1U2YA 4MUPA 3CZ8A 5CBBA 1E1CB 2R24A 2ZYFA 3LBMA 5DELA 4R7OA 1QNRA 1RBLA 1RBAA 1QI3A 5CPLA 1FWJC 1OC6A 1Y0EA 3VO0A 3THDA 1LG2A 4F9JA 5BOFA 4DZAA 3BAXA 1UR9A 3ZLHA 3THAA 1MXGA 1DQUA 3UETA 1XRTA 2GVYA 4Z2KA 2VFEA 3VOJA 1DKWA 1PTGA 4HU8A 3MBDA 2OO6A 3LRKA 3TWAA 5M2FX 3GU9A 1BFNA 1FWHC 4UC5A 4Q8MA 3GDRA 5HINA 3QH2A 2W3ZA 3P5YA 3QHMA 4KCWA 3VKJA 5HQLA 1PZ2A 4QDPA 7A3HA 2B81A 3WDQA 3PZIA 5CBIA 3OG3A 3U2ZA 5FCZA 3VGGA 1TYGA 3EB4A 4IICA 3O06A 1JNDA 1TJ2A 3B9AA 4XAZA 4C6NA 2EPHA 1YADA 1F61A 4A8NA 1XICA 5JIPA 2WC3A 3L4TA 3CQHA 4H8UA 3AI0A 1UWIA 1XSJA 3F5LA 1IGSA 4GISA 4LYRA 2E28A 3IUHA 3DKLA 5KZEA 3CHCA 2V5KA 1A3WA 3CO8A 4JIRA 1U30A 5DEZA 1M41A 4CD8A 2JF6A 1B90A 1DWHM 4IIBA 4WSKA 4PTWA 1YW1A 2W61A 4IFRA 1A5KC 2C19A 3QY8A 2OG9A 3NZ1A 2QCFA 4J35A 1UKOA 4S3DA 1TX2A 4I6KA 2WWCA 3LCHA 3WH7A 3CAWA 2GDUA 3DIPA 3G0XA 4C1KA 4DJFD 4KFNA 5I2UA 5KZDA 4DJEC 3WQPA 5LZLA 3GUGA 4LAMA 4P7LA 4U31A 3WO8A 4ZQNA 4EX4A 3VC6A 3TN4A 1HZYA 4UTTC 1W3TA 3NO1A 1JCXA 4IJCA 1LF1A 1OY0A 1SMDA 1H1NA 2XM1A 1H09A 3U7VA 3VKAA 3CLWA 4H6KA 1NP0A 4RKAA 4C65A 2FH6A 3ZT5A 2PC8A 1LUCB 2X8RA 5AKQA 4ZQPA 5FL0A 1QRQA 4M29A 1MEHA 4KERA 2I5IA 4IH3A 2J25A 1CGVA 4HIBA 2OGJA 4RPPA 3PBMA 3B06A 1YMYA 1VCGA 2PTDA 4IGSA 2JKPA 3V75A 5AHLA 3BLFA 4WF7A 3FLUA 1DHKA 3AISA 2DVTA 2OLSA 1K8CA 5AYYA 1FXPA 2E68A 2C7FA 2INZA 1OX4B 8TIMA 3H7VA 2X7VA 4IGHA 1KFJA 4QROA 4ROQA 3KUMA 4LV4A 1H60A 4RNJA 3HPXA 4P8VA 4HBKA 3HQNA 1F3XA 3W88A 1YTDA 4IF2A 4F0KA 1ZFJA 2FVMA 3MO4A 2R1NA 2PDCA 1D3GA 1XCWA 4UTUA 3P60A 5FEWA 4GJIA 4XK2A 3NL3A 3VNZA 4MNMA 4OV9A 2AQWA 2OWWA 5H8PA 1R8LA 1EO7A 2DZUA 3N6HA 4YIWA 2ZXDA 2PWUA 1FWSA 3UVAA 4LRTA 4DAFA 1XKJA 3L0NA 3N4AA 1UR0A 1UUQA 4NNCA 1P5BA 1XYLA 2C8NA 4K7VA 2EHHA 3NYZA 4TMCA 4H8HA 3GNOA 2DQXA 2BVWA 3PBUA 4JTHA 3GIYA 1TV8A 3XISA 1BRLB 5JVLA 3AUOA 2YXOA 1W6TA 3ZVHA 1W8SA 4GACA 4QSHA 6REQB 4BR1A 2BG5A 2PGFA 2F6UA 4HU3A 4NKCA 3P82A 4WDXA 2XH7A 1QJWA 2HS6A 2VOTA 4PUUA 5DBUA 1HL8A 3N11A 3PC0A 4IL2A 5HQMA 1GG0A 3E1F1 4JKMA 2OQYA 5DY2A 1OCBA 3LQLA 3ERPA 3HGSA 4RE3A 5CPSA 1LYXA 1S2UA 4DELA 2ZZ7A 5GQBA 4QS5A 3B04A 1ZHAA 4HNVA 3UP8A 4P5UA 4LANA 2ZXBA 2IPJA 4JTDA 2BLEA 2R1MA 3R0DA 3L4ZA 2QF8A 4EANA 4IPPA 1XGDA 4TX8A 3AFBA 5CZSA 2YDQA 4JN7A 4ZMGA 5I79A 4Q4OA 4CU6A 5FAJA 3AQUA 2QEZA 3BAWA 1XYFA 3LLXA 1UWSA 1DJXA 1CEOA 2E40A 4W7VA 3BOFA 4GH3A 2W0UA 4QJ1A 1A4MA 1TTQA 3OGVA 3BH4A 2NV2A 2DDXA 5BXRA 3LPFA 4IIFA 1AL7A 4XISA 3HV8A 5H2ZA 4WCJA 2VC9A 1ITQA 3P8IA 1ZL1A 3ITVA 3M5YA 4GUGA 2PDLA 4G56A 4YWIA 4P8WA 1H7XA 4FZIA 3RIKA 3DN5A 1TB3A 2FHCA 4DB7A 3KRBA 2C1HA 2Y7DA 3PUGA 1OEPA 3L2MA 2J88A 3WLTA 6XIMA 3GM8A 4F40A 2RJHA 3HM7A 2EG6A 5FACA 2A4AA 2FPVA 4ALDA 1DJQA 2VT0A 3Q65A 3RK8A 1VKFA 4D6FA 1VFLA 4NG3A 5GPRA 1Q13A 3E5PA 4A29A 5TBOA 3RX2A 3APYA 1KKOA 3OQ8A 1GKQA 3LXAA 1WDPA 1S1RA 3JW7A 2CKRA 4ORMA 4UBPC 1TJ0A 5D04C 1ZBWA 3KX6A 1KM1A 3FYOA 1RVGA 3U5UA 4M6QA 2D3LA 1RLDA 3MKKA 3UU0A 4NUWA 3VX1A 5FEZA 1VLIA 1OYBA 4YL2A 2W27A 3QKEA 4ZTYA 2A3HA 5KETA 1ONEA 3GTNA 3TSMA 1EZ2A 1EJSC 1M03A 3FYYA 4WY0A 2C1GA 3AWOA 4Q6JA 3PANA 1P0NA 3GVQA 1JL8A 4GYJA 3M7WA 5A6TC 3MCOA 3UQNA 1V5XA 4TR9A 4R5EA 1IHIA 2Z25A 4XZHA 2TSYA 5A8GA 4LVGA 2H6RA 4Q7BA 5DF0A 1QBAA 4C6FA 5DFAA 3UJSA 1GW9A 1IQ8A 5CBJA 4H01A 3SCSA 3OZOA 4A3HA 1F5ZA 5IDIA 1DWIM 3S1XA 1V51A 3ALGA 2YL6A 5CLWA 1H1YA 2PWVA 3L4VA 4IIDA 3R8HA 1AH0A 1FWAC 4S1FA 4A8RA 4NAFA 4PB4A 1B3VA 5A6SA 1SJAA 3CAVA 3BLLA 4QQUA 2PS2A 4LT9A 1MW1A 3WQ6A 5HULA 1TPWA 2OLHA 3FFSA 1PDYA 2W63A 2NUWA 1O60A 5CG7A 4Z2LA 1F05A 3IEBA 3K1GA 1VR6A 1VFFA 1OCNA 3MHFA 1B31A 2CLLA 4R85A 1IIHA 3U6WA 4JFWA 3ANYA 1JZ2A 1HL9A 2YL9A 3QSRA 4MAVA 5CPQA 1GKRA 1KM5A 4XBSA 4LBRA 2CHNA 2O9TA 2WMKA 1EPVA 2JGYA 2HRWA 1U5HA 4MPQA 3TQVA 3VE7A 2VCBA 5KMYA 1XIGA 4JX5A 3UCCA 3W22A 3PWGA 3ABQA 3B40A 1KV8A 1NDZA 3N6JA 4IG2B 2F38A 1A3XA 2CFFA 2E25A 1OYAA 2VQTA 4O8RA 1PVNA 3D46A 3CT2A 2PU1A 3VX0A 3UA3A 4E38A 4GY1A 4L6DA 1EGVA 2V30A 1QAPA 4DUWA 3BO9A 1OC5A 3IS4A 4XD4A 3V1HA 1CGXA 4INFA 4D6IA 3CUHA 2AGTA 4NYUA 5BNKA 2J66A 4GCXA 4O1AA 4NIRA 1Q6QA 1Q45A 1R46A 3KOZA 3CPGA 4NJGA 3PPHA 3F2BA 2DUAA 3UZJA 3WQGA 3N2TA 4TVUA 1BTCA 5IXEA 2FJKA 2XINA 2PI6A 3C2OA 4ORIA 3GXTA 3KHDA 5I6SA 3LBOA 1M9HA 2ABBA 4ZOBA 3BZJA 3AHZA 3TJLA 2D1ZA 3BSMA 5F4XA 3L5AA 5A6MA 4K3ZA 2QIWA 2XWDA 5G2WA 2ACUA 1E9LA 5U4NA 1KBLA 1IT8A 3PBWA 1P0EA 5A6KA 1UD2A 4JTUA 5CC5A 3I3BA 3SJ3A 1F7BA 3H2CA 1XBYA 5LIWX 1Z89A 4Q4MA 3VGFA 3MYOA 1Q65A 1K9EA 1LQAA 4YMZA 3GD6A 2MANA 1AL8A 2XH2A 3E38A 1IV8A 1Z69A 3NXFA 1I0BA 3WENA 4L1XA 3SADA 1UWAA 3PTMA 1LLWA 3MV01 4NNBA 1PX3A 4KRZA 1QWGA 1Q4WA 4MY1A 5D8ZA 3GTXA 3G1YA 3UWEA 2AOSA 1OT1A 1IXQA 1A5NC 3MWCA 1OFDA 3WLJA 3ZT7A 1SJBA 4XTIA 5F2IA 1M7PA 1NDWA 2QJHA 4HT3A 1GUVA 5CPNA 4JX6A 1TVNA 1XFCA 3W7DA 2UBPC 5H1WA 5GJMA 3AS2A 3FSTA 4HSNA 4AH7A 3WD3A 4NASA 3GO2A 4QG8A 1F6KA 2AMGA 1O5QA 2X40A 3PF3A 6PTDA 4PEKA 3QLLA 3M43A 4AFYA 1EA0A 2BTMA 2FDMA 2WQPA 3MHGA 3TQKA 4DZHA 4HGXA 3IGXA 4ONVA 2CBUA 4HMNA 1AZ1A 1ADDA 2W67A 1UA7A 2GUBA 3P5ZA 1OGGA 4W5UA 3VMNA 2WZEA 2Y63A 2A7PA 5BOOA 3CC1A 5U7SA 1E0XA 2BNJA 2WZTA 2YL8A 3ITCA 4FMVA 3WEZA 4K8EA 4MB3A 3SCTA 2C13A 2FGBA 2VEPA 4XVEA 4W4QA 4XAYA 4XIMA 3A3WA 1PCKA 1M7JA 2P8BA 4LF1A 1MW0A 4GI6A 2XM2A 3UR7A 4EF8A 5E6ZA 2GK1B 3CO4A 3BURA 4B5TA 3J7HA 2E67A 3GNXA 4PMXA 5I77A 4HHLA 1WDQA 2CWXA 1CIUA 4GQRA 4UOZA 4DXKA 1R0MA 3CH9A 4HPJA 3HPZA 3VOGA 2PUZA 2V3EA 4W84A 2VP8A 4H83A 1Z9AA 3COTA 4ACZB 1C91A 1E5JA 3RM8A 1F8MA 3NEVA 3M0HA 1JCMP 2DT0A 5K7JA 1CGUA 4DBSA 4IUOA 1VYRA 4FNRA 2Y2WA 4OHQA 4AB4A 4RNIA 3F2CA 1W3NA 3H12A 4K68A 5G2HA 3EKZA 1KFEA 3QV8A 2POZA 1D7FA 2WC4A 1GOKA 4IFOA 3W76A 2XVLA 4DYEA 5BOEA 1VAHA 4X63A 1TCDA 1V0LA 2XU2A 1DJWA 5I3GA 2J13A 4N6FA 1RH9A 3C2YA 4DBDA 5EMYA 5E6YA 3NOEA 3W81A 4B4HA 4NX0A 1V8EA 4RX0A 3CHVA 3VD5A 1JGMA 3FEQA 4IM4A 2OO0A 1FHVA 4UFIA 3PBVA 2VGBA 4JTQA 1TVPA 1TMLA 1GZGA 1Q6EA 4JKLA 4YTTA 4ZFMA 2GSHA 5FF7A 3E5BA 3LCXA 4LQ1A 2C1IA 3MDWA 5RUBA 1XG4A 4CD5A 3W1UA 3GB6A 4FF7A 4P61A 2ACQA 2Z1XA 5J5DA 4FNUA 5D05A 4P7NA 4PL2A 4WKHA 1JF6A 1QW8A 3HFTA 4FOKA 2PWDA 2XSAA 4GJJA 5HWMA 2E1WA 1VIWA 4QNEA 2WSKA 4RE4A 4JFUA 4WOZA 3BL3A 1JAKA 1JPMA 4Y7EA 4DWDA 3H53A 1EJUC 4PYSA 2VC7A 5CCZA 4AX6A 2GVLA 1DHPA 3WEMA 1NEYA 3VC5A 3TLQA 1TR1A 1TQJA 3WK1A 4F0HA 4C6IA 3W82A 4PMDA 1R38A 1OG0A 3QZAA 1MQRA 4AQLA 1A5LC 1FWEC 2VDIA 3UR8A 4HVXA 4JYEA 5FAGA 4DYKA 2WCAA 4LUIA 3N1AA 1TRIA 4HNTA 2FB3A 4CNTA 1YTEA 3RX3A 1NOFA 3FDKA 1SU5A 1OF8A 2Z7GA 4NAEB 3R13A 4MWAA 1BXBA 5IM51 2YCIX 1NJJA 1OVDA 1OZMA 2ZQ0A 1KR1A 3ENLA 3NPUA 4MUZA 4US6A 3OOQA 3W27A 2ZCGA 2A85A 1I2RA 1GOOA 3TCSA 4G7EB 3R89A 4RCXA 3EX3A 1VPYA 2NUYA 4TIMA 4JFSA 5J5RA 4LRSA 4NZ3A 1QO5A 3LV6A 3NFUA 3MS8A 2YYUA 2VR4A 1RVKA 3I4EA 1S5NA 3FCPA 3SN4A 1SW0A 1IEXA 4A21A 3MZNA 1ESWA 2ZDRA 2IUZA 4YCOA 1ZSXA 3GSMA 1SZNA 1EFZA 1Q8JA 4GXWA 2HEJA 5JH1A 3W7QA 1GOMA 4AG0A 3RRXA 2R1LA 1FCBA 3AXMA 2WKJA 2QLYA 4JQ1A 2V81A 1J0JA 2AAMA 4CNOA 4HU4A 1XSIA 4Q32A 1ZCOA 4V1YA 3RM9A 1OB0A 3CQ0A 2HXTA 1U5VA 3FDGA 1PIFA 2E77A 3V5CA 3AU2A 1Z42A 1MW3A 2IKJA 2E6FA 1IT0A 3GRIA 4MMWA 1W3JA 4A22A 4DWSA 2D3NA 2WZIA 4ZOAA 1B4KA 1S5VA 3WLLA 1CYGA 2DZXA 3E0VA 3OO2A 4LVBA 3GKAA 1RJQA 4AIBA 2A1YA 4AIOA 3TNBA 4QNWA 4F66A 3BQ5A 3BSGA 1FHDA 3LM3A 2ZZ1A 1NY1A 2NXGA 1PCWA 4MF4A 3GR8A 4PMNA 3U48A 4QJ5B 5BZAA 3UGRA 4GX8A 1H11A 4ZL1A 1SO6A 2XIOA 1V4YA 1PKNA 2C15A 2JIEA 3DI0A 4Q33A 1Y8BA 3NG3A 4O0QA 1IXPA 3CBWA 5A5WA 2VQUA 1VJSA 1JNEA 2OODA 2W91A 1A49A 2EPMX 5HJLA 5G4EA 3MZ2A 4ZR8A 2KAUC 3UXAA 2VHLA 3OBAA 3PG9A 3TX9A 1LTDA 3VDCA 1TPDA 2D0FA 3THQA 3QV6A 4IUGA 1U22A 3GXFA 1T8XA 3QBUA 3UXDA 2ZZ4A 4LJ3A 3AYSA 4C90A 4Q22A 4CQCA 4J3ZA 3T1GA 4MWAD 3SUVA 3QR0A 1V08A 2WZMA 3HA1A 1O66A 5I3JA 2EKGA 1GVRA 3ZSTA 4UFLA 2NQLA 5J8LA 2PLMA 3QSTA 2A0NA 4JHOA 3PTQA 1WDDA 3WD4A 4D6GA 3APTA 3N2OA 4F0LA 1JCTA 4UCFA 1T40A 2EF9A 3Q37A 1ZPTA 3W00A 1KM2A 1BWVA 3IJ7A 1ITCA 2P3EA 4FF5A 5EFFA 1S3HA 3ES8A 4JQ2A 3HMCA 3F7JA 4L1WA 2G0WA 1F4AA 1EH9A 3GQYA 3WUFA 5AVHA 4F4RA 2NXHA 4MHBA 2YCEA 4DN1A 4M6PA 1I2NA 3BK0A 4QXIA 3CYJA 1L6SA 2Z24A 4IP5A 3N2BA 4V15A 1TZ9A 4WD0A 2NSOA 3FJLA 2Y61A 2CWNA 3BLKA 5D03A 2CLFA 3TH6A 5BXSA 2Y5SA 1ZAHA 4CNUA 4YYCA 3O0FA 1VFTA 2OZ3A 4H1ZA 1BPLB 2BY2A 3DGBA 3MJMA 4HCDA 4S3AA 1W32A 4AC1X 4DF0A 3P0XA 3WIJA 1E4NA 1JYNA 1W0MA 2ZRUA 5TAOA 4DWSD 3SCWA 4ZODA 4GXMA 4US5A 4GQBA 2P0IA 4KIRA 1H41A 4MZ8A 1GKPA 1J12A 1EHAA 1V3IA 3SRKA 2DP3A 2GJXB 3OLIA 3L0GA 1EC7A 2UY4A 1BTMA 3VNKA 3ITOA 3TYEA 1JPDX 4PTXA 1NFPA 1NQKA 1GZ1A 1E1CA 3LZ5A 3NZPA 2J7GA 1DVJA 3VGDA 3FKRA 1Q7MA 2CW6A 3BAIA 3EWZA 2CNCA 4OTKA 3CV7A 1UP2A 1TMQA 3UEQA 3UWQA 1UR1A 1CXEA 1WKYA 3DFHA 4O4VA 3VOFA 4WVXA 2ZUUA 3PZQA 1LBFA 3HJZA 1W5QA 3PY2A 4GIYA 4ZQOA 1HP5A 2CHOA 1TA3B 1KRAC 3DC0A 4ZB5A 3OTRA 2QF7A 5CAHA 1JQVA 3PJTA 4HMEA 2ACSA 4AVFA 3OP2A 1GYMA 3PB0A 3GYEA 3PNZA 1A5CA 3CK5A 1EQPA 1RY8A 1KBIA 2VR2A 1KCZA 1XX1A 2WJFA 1JZ5A 1W1IE 1TUXA 4K38A 2P5NA 4HPNA 4GGHA 2NWSA 3U8GA 1PWMA 3BGGA 1FDJA 4IGNA 4JIQA 5FESA 1A0CA 1WZKA 2QJMA 5ENLA 1E9YB 1JUKA 3QY7A 1UBSA 3WH9A 3MHUA 3ABOA 3MB9A 1JFXA 4L4LA 2X0SA 4AY8A 2PRLA 3GG7A 1Y7VA 2ZX7A 3LCLA 3WF1A 1C93A 1I4NA 3BMWA 4O1FA 3VIFA 1UD4A 1JPIA 2WK2A 5EKYA 2CC0A 2D0GA 4XSLA 1C8VA 3GWQA 4JEJA 2BP1A 5LIYX 4C6EA 5LIUX 3TSBA 3I7QA 3WKZA 3VIOA 4GOAA 3BZGA 4AXNA 3AXIA 1FOBA 1KLZA 3K8MA 3N9SA 3AIWA 3FA4A 3QTGA 4US5D 4M6UA 3QLDA 1MNZA 3T2QA 2VURA 1FWNA 1DORA 3SURA 2AGKA 4IPIA 2OEKA 2HSAA 3V7PA 4PRRA 1CXLA 3ABZA 4U5KA 5KZMA 1OABA 3S47A 7REQB 1GZJA 2J74A 3L65A 2A3EA 3Q58A 4UNIA 1TWDA 1Z8AA 5DX7A 4GLEA 1SFLA 3WL1A 2L5HA 3QW4B 4DO7A 3BG3A 2DIEA 5HNTA 2CIPA 4R3UA 3UNTA 1LUCA 4JTJA 4RDWA 4QEEA 3G0UA 4JTCA 3HG3A 4ZBCA 1NIUA 4MJMA 2J9XA 5KINA 1XLJA 5CZTA 1ALDA 4CEXC 3GKFA 3RU6A 3UNDA 1PKYA 1YE6A 4AZCB 3TFCA 4YCPA 5LNUA 3NM1A 1UMYA 2Y0FA 2JGQA 2PTYA 3TDFA 3TN6A 1G4SA 4BEUA 1IEQA 1OX4A 1RSCA 1HL2A 1BWKA 2QZRA 3QR3A 4E3VA 1K3UA 4HSHA 3SB0A 3NDOA 4G9PA 1G1YA 3T78A 5ECUA 2RDUA 4MYXA 1O6IA 1GK8A 1BF2A 3OIHA 1E5NA 1HJVA 5A6AA 4CNNA 3IUIA 5CPOA 4OGZA 1D3CA 3R0UA 2ZIDA 1XLAA 1FX6A 4I8DA 5CKSA 4EK7A 3DZ1A 1QVBA 3TJIA 1WNOA 5ECVA 2D2JA 1EP3A 3EZ4A 2J7EA 4J27A 4O1EA 4BHYA 1AMKA 3R2GA 5AC4A 3NXLA 4TVCA 1A0EA 1CDGA 1W1PA 3K5XA 3NGFA 1YNPA 5EL1A 4GUHA 2BB0A 1BGGA 1K7FA 1A5MC 3CLMA 1XKYA 1O5KA 3TU9A 4PCSA 2NV9A 1T5AA 4KEMA 4JCMA 4GA8A 2VZTA 1ISZA 3S1GA 5IFPA 1BRLA 2QDDA 1B2YA 1TPFA 3WJWA 3CWHA 4HPHA 4PCNA 1H50A 2GGJA 2YBVA 5DCBA 6REQA 3HV9A 4M80A 1JXKA 4GRSA 3D5HA 3AS0A 3VE9A 1DE6A 4ZB0A 1YYAA 1RJRA 4UOQA 5L6UA 3AMKA 2FIQA 2OMAA 4EAYA 2ZZ6A 3HZ3A 4F0SA 1ZAJA 1E15A 4ERGA 4LCQA 1FA2A 5E0CA 4PB3A 1DBTA 1B4EA 2WO5A 2EG7A 2J8TA 1X6NA 3EWXA 1Y65A 1MW2A 3FV9A 2OKTA 1OK4A 1KLYA 3W37A 3GVWA 5JBEA 1XG3A 3HURA 1NU5A 3TTQA 3WH6A 2VEMA 1NFGA 2V69A 1OSEA 3UF9A 4GYFA 4AD5A 4XD3A 4A6GA 2DT2A 3BAKA 3O6DA 3VK5A 1AZ2A 3TQ0A 3L66A 3UWWA 5A2CA 3M0JA 3S5YA 1R6WA 3C4UA 3POCA 4JQAA 3BJFA 3N17A 4ADSA 1ME7A 3A22A 1KFLA 3WQDA 1NH6A 3WNOA 1ZP3A 4AEOA 3PG8A 1UQZA 1HKJA 1HXJA 2FHFA 3NPWA 1T6MA 2V6AA 3K8KA 2QMKA 3P2VA 4UTWC 3CPUA 2D2OA 4GX9A 3AIVA 3DFSA 4D1IA 3DU0A 2FYMA 4L4OA 4L56A 4C5YA 1A53A 3V5FA 1OYCA 1VGAA 1DIDA 1CGTA 4J3TA 1A4LA 2ZX8A 3N04A 3UBPC 4DI8A 1A5UA 3S9ZA 3ZXWA 4R33A 3KP0A 2Q8LA 3RRAA 2IKIA 3FXYA 1OIMA 4I7VA 4MDPA 3F4CA 3O7UA 2WVTA 4UTIA 2P10A 3DDMA 4WKFA 4Q8TA 3T9PA 2WMIB 5DANA 1O12A 3GNRA 1JIBA 4FIRA 2W9MA 2Z27A 5C6MA 3L4XA 4PZVA 3GHRA 1D2KA 1HG3A 3EDKA 1EDQA 3SSJA 3CUZA 3I65A 2FKPA 4O28A 3FIGA 1XISA 2BS9A 1UKQA 1SM9A 3PZMA 3TXVA 3KTCA 4O19A 4B3ZA 4WSHA 4CN1A 3D6NA 1D8WA 4JN6A 2WM1A 1I8JA 2ZUTA 2B7NA 3DOPA 1H0GA 4LGXA 3L7RA 3L68A 3UZYA 3ZJ7A 1UZ1A 3QFEA 4PSPA 4WX2A 2HDJA 4Z2GA 4X0NA 4X61A 4AZ5A 4C6BA 4ACYA 3G8EA 1WZAA 4QG6A 5FA5A 2GGIA 2OTDA 4Z1DA 3KOXA 2GQ8A 1IEVA 1F8IA 4H9UA 2WJZA 1UMLA 4K1WA 3TC6A 3UVIA 1UKSA 4Z0JA 4BQ3A 4FB7A 1IE7C 3S1WA 1Y5XA 2PZNA 4KH2A 3I7SA 4Y96A 2H3DA 3F03K 3PNUA 2BGQA 4QLKA 1POKA 4ZXLA 2YW3A 4LAUA 5EPDA 4DZ5A 3B8VA 4DNMA 1S2CA 3CHEA 4C1NB 2VRKA 3IIZA 3PZNA 3MUCA 1I6NA 4IPNB 3THCA 3VGBA 4FP1A 4N9DA 3PTKA 1V6UA 2DUXA 2OX1A 5SWUA 1P1MA 3GNPA 4NJHA 1DXFA 2UV8G 2PTZA 1JDEA 3GHSA 4XAFA 3MU7A 4P7RA 1RQBA 1WO2A 3PULA 3UWZA 1TJRA 1UUMA 2HVMA 4ILSA 1GYLA 4LWWA 1TV2A 1ZY9A 2QUMA 1G6CA 3M6DA 1E9ZB 1R2TA 4QP0A 1J0ZA 1EWEA 1V3KA 2YA2A 1VBRA 1UZ4A 3W1PA 4E0CA 4L65A 3VKKA 3CWNA 1KCKA 3WD0A 2NVCA 4LC8A 5DMMA 3R1ZA 1JYXA 3Q94A 2Z29A 3S8HA 4IG2A 3POHA 3H2EA 4RUBA 2PDYA 3CWOX 1K4GA 1EXPA 3SFWA 4QCFA 4XQ6A 3R8RA 1YX1A 1BYBA 2C71A 3I6RA 2X2YA 5CG0A 2D23A 3H55A 3EB2A 3G1RA 1V0NA 2R9RA 2FZ8A 5DMNA 3EA2A 1KWGA 5TNVA 1LROA 2FQIA 1WCGA 3BPWA 3QMRA 5BXPA 2DQWA 3W2KA 4O54A 3T8LA 1GOWA 2Z2UA 3A47A 3HO8A 3OB8A 1EJRC 4IGMA 4N7QA 3VI2A 4MFEA 2CXEA 4ENLA 1LRTA 3H70A 2G95A 1PZ0A 1TPB1 1GHRA 3W07A 2I5GA 3IV8A 3QMSA 2XUCA 4RZ5A 3UJEA 2HE8A 4XBKA 3QPZA 2XWEA 1T8QA 2QJJA 1GEQA 2BASA 4O11A 2FPTA 5D2WA 1W3LA 2YIHA 4F79A 3LCWA 3L21A 5BWFA 1Q3NA 3PAOA 1FH9A 2WLZA 1RA5A 3XIMA 1HKVA 3GG1A 4AZ6A 2VX4A 4Q7IA 1I9CB 5IRPA 4J3WA 2Z4GA 3TLLA 2D22A 2R91A 3LU2A 1M01A 2QVNA 3IPWA 3SRHA 4F2TA 5BU6A 3QRHA 3RMJA 3KFTA 4MY9A 4CCEA 3NQBA 3GR7A 3OJGA 2G3FA 2NW0A 4BA0A 1P0DA 2R14A 3N15A 3ATZA 1G01A 2XGBA 1I2PA 3EXRA 4H4IA 1QUMA 1B3XA 4GFSA 4WDTA 3BCFA 3LN3A 3VZYA 4JS3A 4XZNX 2HZGA 2I57A 2GFTA 3L23A 3SCQA 3DG6A 1XBVA 1E73M 4WXYA 3N34A 3LD5A 1MRAA 2VEGA 3U5YA 3CEUA 1EDTA 3D47A 4X0VA 3BXWA 4XWUA 3TTYA 1KM3A 1DWAM 3T40A 2PSNA 2E0PA 3URNA 1GVOA 2CBJA 1UC4A 2BSLA 5BMWA 3UW6A 3TC3A 3W2NA 1TTPA 1RD5A 3T0DA 1J79A 4CUCA 1S2AA 3M9YA 4NXSA 1AQ0A 2ZX9A 3PBYA 3TZNA 1EC9A 1V02E 2VELA 3LGDA 1JCNA 2Y7GA 4UXDA 2QHAA 1E3ZA 3U4AA 3DESA 3V3WA 3ONCA 2C3ZA 1TCMA 4HHPA 4W93A 1MFUA 3QC3A 4WOQA 1BKSA 2G3MA 4RNHA 2J7BA 1IIGA 4OOZA 3NUKA 4PTVA 5DBTA 1VIZA 2R1PA 1CXFA 3FX4A 2VCCA 3F4WA 1YXDA 2I5QA 1K6WA 4W89A 1Z32X 3BAJA 3P0WA 4JNMA 1CCWB 2ZUMA 2TYSA 4Q8PA 3SRFA 2GK1A 3NR0A 2XGZA 2VGFA 5HR6A 2PBOA 3QC0A 3WBYA 3CAKA 1ONXA 4ZSTA 1TPUA 3CMFA 2FB2A 4RDZA 4NI8A 4GVIA 3QV9A 1VEMA 3AHVA 3RAOA 1PUDA 2NVDA 4ACZA 1DIOA 3HF3A 4I5UA 4D2JA 4K2SA 1SUXA 4YTSA 4OBRA 3II1A 3CUJA 3NYDA 4L9XA 2VCAA 4BZYA 1DTUA 1FXQA 4JN8A 1XIDA 2BY3A 1RBOB 3DHUA 3YPIA 4LALA 4GUIA 3QY6A 1W1TA 4NJIA 4MVAA 4LY8A 1BVZA 5I3IA 3BWWA 1MEWA 4LNCA 3VNYA 3WL0A 2OB3A 5DXXA 1MQQA 5DCEA 2CLKA 4HOWA 1E0TA 2PDUA 3BUVA 4NQ1A 1OFOA 5HANA 4LW7A 3GIQA 4JIEA 1N7KA 2PTWA 3W29A 3O63A 1J4EA 3NWRA 1VFHA 3BG5A 3NJ3A 5JH2A 3NIYA 3SO7A 3CZJA 1G94A 5FEPA 4R27A 2F61A 3ME3A 4GI8A 1VF8A 1E4MM 3LB0A 4TOQA 4V1XA 4EE9A 2OEMA 4MWAE 1LDCA 5I0DA 3TR9A 3VOCA 1EBHA 4IFKB 4WUIA 2ODOA 1GPFA 1CENA 4DLFA 4TV6A 2DV0A 1XFBA 5FF4A 3URAA 4RV8A 1NF0A 2G97A 1PX8A 1J10A 4JXCA 4GD0A 4NX5A 1H3GA 3W1RA 4Q4PA 1V6VA 1R7AA 2B7PA 1RXOB 1R3QA 2WHMA 1K77A 3R0KA 1OF6A 3MUY1 3WQ8A 2UZ9A 4KIEA 2WMGA 3HQ1A 3CIXA 2JALA 2PLCA 5CZKA 1V0KA 5HJXA 1W2PA 4PRTA 1X39A 2WM0A 3FOKA 1CI1A 4JGDA 2QDEA 3BGAA 1VENA 4C6LA 2A5HA 2OELA 1AD1A 4ICNA 1CBGA 2XIJA 4X2PA 3F4DA 1HQTA 4UTHA 3ABRA 4O15A 1QK0A 3LEPA 2ZKMX 3MYPA 3L2IA 3QPEA 1LQ0A 2Y7EA 1GVIA 4NAEA 3WLNA 4RR4A 8RUCA 3LRLA 2FVKA 4AU0A 3T0CA 1HIZA 1FRBA 3LXBA 3STCA 1GQJA 4GY7A 2VDGA 3WDIA 2J4GA 2VL4A 1GPWA 4RZ6A 2BVDA 4IMEA 5E5CA 5CGQA 3EOUA 4WLCA 4NZJA 5LA0A 3KHJA 4G7EA 2WMFA 1PV8A 4NYYA 4GABA 2PF0A 5K4XA 3ISIX 2EXOA 3KM8A 3S9YA 3N13A 4KWOA 1TMHA 4GIEA 2GPTA 3FSUA 2PDFA 4R9XA 5C9RA 2OYLA 3WUEA 2OX4A 5AN7A 4W7WA 5LNVA 4DPPA 3LI0A 3TZFA 4FALA 1CX9A 2W5FA 7TIMA 3ARPA 3EA1A 1XL9A 1XUZA 3Q67A 2G3NA 1DXIA 3UZWA 3MBFA 4O8AA 3VIGA 3AZTA 5G5IA 3WNMA 5K9CA 2ZXQA 3WBWA 5BYWA 1J8VA 4M0XA 3W7IA 4LXFA 4YVVA 1RHCA 2X1RA 4X9YA 2GWNA 4GGBA 4PFMA 2HCVA 3R11A 1ZP4A 1US2A 3TN5A 2DIKA 4K6AA 1QASA 2VVNA 2GJPA 2C6QA 5FF2A 4O13A 2QDHA 3O07A 1UP3A 3SSZA 1G69A 4MG4A 1N8FA 3V35A 1OIFA 1FVPA 1HJQA 3TV8A 3KTSA 1QWKA 3I4KA 2Q8XA 1XI3A 1GORA 1F2JA 1Q8AA 1EJTC 2RDXA 4Q4SA 1F76A 3BLPX 3S5OA 2BOFX 3KS5A 2FMNA 2BGNE 4ECLA 3PP7A 3ABSA 4DNHA 4WDUA 1FKXA 1Z3NA 4QIUA 5LSMA 1QNPA 4GUFA 1C9WA 2H8ZA 3HQPA 1HGWA 4LNYA 3OPSA 2PCQA 1ADOA 2WKLA 4LOCA 2RGMA 4M5PA 3CQJA 4U33A 2XN0A 1K03A 2YKKA 4LYKA 4QTGA 2PDIA 4YTUA 1OFPA 4BF7A 1AH4A 3E3HA 7ODCA 2ON3A 1EJWC 1ICSA 4O0KA 4NZ4A 2WBGA 3U57A 3N18A 1KXVA 2ZADA 5EMMA 4EWJA 4MAZA 2A6NA 3T0BA 3FS2A 3H54A 3TA6A 3A9IA 3M1ZA 3U0HA 3PUEA 4LPCA 4JTFA 3EEZA 2PWHA 6TIMA 2PDQA 2YCKX 3BICA 3RO6A 3E49A 4DUVA 1GQIA 4GYKA 3IK2A 1XYMA 5GNZA 1LWHA 1EQCA 1M5WA 3DFNA 4GIAA 3I68A 3A4JA 1KRMA 3KAOA 3H4XA 3BC9A 2OOFA 4PUJA 1Q7QA 3A5VA 1U83A 3LV5A 3A4XA 4C6DA 2ZA2A 4A3YA 4HYWA 1UROA 3VYLA 2DH2A 3RPDA 4ZE5A 4IHCA 3HG2A 2OCZA 4E4PA 4R7WA 2ZWYA 3WQ5A 1TWWA 3GNNA 4I9JA 4S3EA 1Q2SA 4JQ4A 1TX0A 2VGGA 1XR2A 3LUTA 5CJNA 3M07A 1CT5A 2BVTA 4AAJA 4A05A 3RO8A 4CCZA 1YHTA 4H9YA 1AW2A 4N9BA 1VP5A 2BXVA 1XPGA 5FI8A 1TIWA 3GH7A 1XLKA 3AO0A 4LS1A 4OVXA 2YCLB 3GFYA 3UPWA 4NI3A 7PTDA 4FLRA 3ITXA 4JDBA 2CYGA 2OLAA 1MUCA 6ENLA 1XIHA 3TYZA 2P0OA 1QXLA 3AJ7A 3ITGA 2O0TA 3W2MA 3H7UA 2ZTJA 2ZX6A 1W17A 4DUOA 4RW3A 2GJXA 2A6LA 4JNZA 1J01A 6TAAA 2WHKA 4E8CA 3L4WA 2QW5A 3PAJA 3W86A 1TFVA 5LHEA 3LXCA 4GC3A 2W66A 4KWWA 2P1FA 3BOXA 4ZB2A 3WNKA 3EPNA 3TONA 1XLLA 5E93A 4KCVA 4RW5A 3W2LA 6ALDA 2GYIA 5BCAA 3VD4A 2WHLA 3JUGA 5GNYA 5HNNA 2WNQA 1MQPA 1RK6A 4WK9A 4KWSA 3G24A 2DFAA 5E1QA 3VKDA 1THFD 5FJJA 3EXSA 1CTNA 2AKZA 4HMCA 4A4AA 2HK1A 4JICA 5DO8A 5LNSA 2EPOA 5HAOA 2NWRA 1TA3A 5MKGB 3QR1A 3WY1A 3EMCA 1UJQA 3B9OA 2F2HA 4HB7A 1G4PA 3WLPA 4EVZA 3EA3A 4AC7C 3AYRA 4MKNA 4KEUA 3MMWA 3R94A 3HFYA 1P6CA 3SM0A 4MIMA 1TIMA 2GJLA 4IIEA 3S2MA 1I75A 3S2LA 1VJIA 5EMUA 1TJ1A 1HKWA 4KEVA 5FL1A 3UYIA 3KBJA 3PJWA 3P7YA 3QEZA 1E6PA 4CD4A 1PO9A 3K4AA 4C6CA 1QFEA 3ZLFA 1IEIA 1H2JA 4RL3A 3GVGA 3W7KA 1J2WA 3TOPA 3W1AA 1FWGC 5EBAA 4BCEA 3E2SA 1UR3M 5MHBA 2CU0A 3CIWA 2QS8A 2YZRA 3KW3A 3RLUA 3DYMA 3R8GA 2QJNA 3CQIA 4MWAC 2HVOA 1F3EA 2FLIA 3ITLA 2J24A 3M47A 4A8IA 4BI7A 3USBA 3B0XA 2YB1A 5C9WA 3ARXA 5A8PA 2BMBA 3W6LA 2IPGA 2BX7A 4S3JA 3IGHX 2Y88A 3SCOA 2RDTA 3XINA 1XM3A 1HKKA 4J3VA 3WLMA 4B5WA 1SO4A 1TPH1 3IJDA 3LZ3A 5B7YA 1XLFA 3AYTA 3FN9A 1TV7A 4DM2A 7REQA 1KGUA 2Y85A 5D9OA 4RZ4A 2HV5A 2NV1A 4I7UA 3SUUA 3OLGA 4C7GA 3GC5A 2GOUA 2ABAA 2REQB 3NSMA 2OVLA 1BF6A 1RQEA 3NGJA 4WGHA 3IGSA 4Z2IA 4D8AA 4AW7A 3IJ8A 3DUGA 3K30A 3AMDA 3MUIA 4URIA 4J2MA 3KLLA 3WZ0E 3OVRA 4AZCA 5JIWA 4OZOA 2OQLA 4V33A 4QSFA 4J1OA 4OUEA 2GQAA 4FOUA 4PN2A 1FDYA 5HMFA 4GWEA 3G18A 2GQ3A 4UTLA 1R85A 3WLQA 4M81A 8A3HA 4YVXA 2PU0A 2VXNA 4XAPA 1WE5A 1IXNA 1K6AA 4ZOCA 4DWSC 1BHGA 2G4JA 3JZUA 1R2RA 1R3WA 3ID7A 4EXQA 1H62A 3MPGA 4AISA 1PDZA 4CN4A 1EWDA 3NDZA 8XIMA 1Z7AA 3I3DA 4GI9A 3T0TA 4QE1A 1XC4A 3TVAA 3ZR6A 3BAYA 2VFFA 1Z6KA 4HHHA 4IMAA 1H7PA 4W9TA 1VC4A 4ERIA 1J0YA 2PLKA 3HOJA 3CT7A 3RILA 1E1EA 1XQLA 2OGYA 4I8YA 3WMBA 3WUBA 3MT1A 3TYBA 3WQ4A 1PPIA 4JTTA 4OECA 2YL5A 5T91A 3MI6A 4JIIX 3LHTA 2FTPA 4OV4A 1VD6A 4HZ6A 1DJHA 5LKYA 2DT3A 3RJXA 3W72A 3TR2A 3KLKA 4LVFA 5AHMA 3UG3A 2FDSA 3QOMA 5BRPA 2BVYA 1ECEA 4K8HA 3KCLA 4Y9MA 4GKTA 3OU8A 2QYGA 3TN3A 2P50A 4KMQA 3LTPA 1KQZA 2HBVA 1RZMA 3UA4A 5EFDA 3WF0A 1DWGM 4WJEA 4Z1YA 3BV7A 5AHFA 1EIBA 1TPC1 2JEQA 1W9UA 4FS9A 3S2CA 4S3FA 1UJPA 1RP8A 2ZOXA 1XP3A 4AHOA 4MM1A 5XIAA 1J0IA 3WBAA 1XGZA 3OG2A 4JQ3A 4ZVJA 1SPQA 4UFHA 2LLEA 4L9YA 3OVGA 4IOTA 3ARUA 3TIMA 1KCXA 1XDLA 1QDSA 3VCRA 1UCWA 3PPFA 2NXIA 4QG9A 1CNVA 3M7SA 1ZRQA 3ARVA 4JHZA 1TPVA 2VZSA 4HMDA 1KGXA 3KVLA 1XRVA 1SO3A 4BQ5A 4A2SA 1F6PA 2ZE0A 4N02A 3R43A 1LRQA 5HOSA 2X1IA 3VAVA 3M0LA 2TMDA 3E96A 9CGTA 5BMXA 3GHTA 3PPGA 4GNVA 1A50A 4NZCA 4XZWA 1J9YA 3AYVA 4H8VA 1H4PA 1EO5A 1XIJA 4AD4A 1V93A 2QVHA 4BQ4A 4X22A 3M5ZA 3T2PA 4OQVA 3S6TA 5CSRA 1PBGA 3FW6A 4NU7A 4TQTA 2WMIA 2ZTKA 3G1VA 3PSVA 2CLPA 3CIVA 3QF0A 3VKBA 4H9ZA 3OVQA 3UG8A 3IK4A 4Z2HA 8CGTA 5AZ0A 1D3HA 1ZUAX 1WPCA 2FZDA 3WN6A 1WP6A 1ZBVA 3U2CA 3O6AA 4Y2WA 1QPOA 3MMDA 4L1GA 2ZX5A 4PODA 4AY7A 4UQ9A 1ZAIA 4DAIA 1E6ZA 1RD6A 4UNKA 1DXEA 3WNLA 1QPNA 1IR2A 3LMZA 1JF5A 4YS1A 3TE9A 5C55A 4WXZA 4XD5A 5C2XA 3WJZA 2V0TA 3C2RA 2R1KA 3W7OA 3S6OA 1XCXA 2QUTA 4LAZA 3KS6A 5TD4A 2D24A 5TQLA 4JL2A 3FVDA 4MGGA 1NELA 1XSKA 3ECQA 4B5VA 2QJIA 3U2EA 4NP7A 3QZEA 3FHQA 3GZAA 5A8MA 2ACRA 3M5VA 2QCLA 3U3HA 4MY8A 1DEDA 1YE4A 1UHVA 2E6AA 4J4KA 4PC8A 4EF9A 2GVGA 2Y1HA 4H9MA 4D6CA 2RKXA 4DQWA 1GOQA 1FWWA 3LCFA 3PN8A 3BJSA 3BCJA 5AY7A 3RHGA 1SVDA 4GYPC 3M0VA 4XUYA 1EA9C 2A3AA 3W7NA 4IXHA 1B9ZA 1IGWA 4C1NA 3LGEA 3P62A 1W8GA 4Z1CA 1J96A 1FWTA 4M51A 1SMAA 2PGEA 5HK4A 4W8AA 4H19A 4XZMX 2RJGA 4C7DA 3H8AA 1CB7B 2QXWA 4Q6XA 5DY3A 3WF4A 1SYTA 1HUVA 3UFYA 3KRSA 4U3AA 4F48A 1UUOA 5I00A 3IV3A 2X1SA 3WD2A 4AD2A 3OBEA 3AOFA 3L5LA 2IQDA 2VUNA 1KQYA 4QITA 3RR1A 1ZJAA 1QNSA 1DQXA 1E6NA 1JDFA 1F3TA 3N73A 4NNAA 2PDKA 2Q01A 3IVSA 1NVMA 1VEOA 1FKWA 3LK6A 5M5DA 3TW7A 1BYAA 2OT1A 1JZ8A 1LM1A 1Q6GA 3OVPA 1Z48A 1IZKA 2IMRA 3BGJA 3V0UA 4DRSA 1EUNA 5C2GA 3SRDA 3DFQA 3HGJA 3F4VA 2WNNA 5K9XA 3W74A 1JYWA 3JR2A 2HNHA 3P67A 1BXNA 1GT8A 1B30A 2BY1A 4IPLA 1XUUA 3WK0A 3PB2A 1M68A 5FJRA 1J93A 2Y6ZA 3RXZA 3DEQA 1PB0A 2E4TA 3LI1A 2J7FA 1XQKA 4IP7A 3W24A 4MB5A 1EEXA 1V0MA 2HS8A 3WBXA 3B0PA 3HMJG 5BU9A 3BLDA 4OUIA 2WCGA 3F1QA 1KNWA 1W91A 4GVHA 3C6CA 3W7HA 5FJOA 4BI5A 4KT2A 3HPSA 2Q71A 3CMJA 4N6EA 5DMLA 3W87A 3UWYA 4GC4A 1JZ4A 1NTHA 1G7VA 3SW6A 1WOBA 3PUOA 5H8MA 4JPGA 3NZQA 2BODX 3I3EA 4WGXA 3MDUA 3MTWA 1VFMA 3C0LA 1UA3A 4DO5A 1NOUA 2MNRA 3GDTA 2ZWZA 2CZFA 4MNJA 3AROA 5FOOA 2AAAA 3IJLA 1K9FA 4BQ2A 2DZTA 3GDBA 4N0RA 4DX3A 3ES7A 1VH7A 3R25A 2VR5A 1IZCA 3HPAA 3TYAA 5CAKA 4Y9PA 4BKNA 3V5OA 2OJPA 5LXEA 5FSEC 1CB2A 1EOMA 2VX6A 5A8NA 1UP0A 4KRUA 1Z41A 2WZHA 2XVNA 4YHGA 2PE4A 2VMFA 3LQGA 1FWRA 1B3ZA 1GTEA 3NSXA 4KS0A 3DFOA 2NSXA 3RG6A 3KCOA 4HK6A 4PCPA 2OKOA 1JRCA 5FEXA 4C6KA 3WD1A 1IR1A 5F7UA 1FBAA 4QM1A 2XTKA 3ZOAA 4L5ZA 3GC4A 3EGJA 2OYMA 4YN5A 2ZA1A 4ZQCA 1GJWA 2UY2A 3ZYZA 4H9XA 1RY0A 1XXXA 2FJUB 3T42A 4PMVA 3LS9A 3SQMA 3HBLA 4O52A 1QK2A 3OLDA 1VPXA 1UASA 2XVGA 2HTMA 4PMRA 5HQEA 4ZTXA 1U1JA 3CMGA 1SJDA 2J62A 3SY5A 3UR2A 2JEPA 2OYKA 1SGJA 3JU2A 1HVQA 1R9XA 4RXFA 4J40A 3WLHA 4XZ9A 1X7FA 4XTDA 3GK0A 3IANA 2QDGA 1O7AA 3KCJA 2P8CA 4GINA 4HN4A 2B31A 3URQA 4TX9A 4GQQA 3BE7A 1OFEA 2J78A 4QFUA 1KC7A 3BLOA 4H04A 1XH0A 4AD1A 1YXCA 3FGCB 5HDRA 2VC6A 3C52A 4L7ZA 3N3MA 4O1BA 5LYRA 2O9RA 3WDHA 2PDHA 1LJYA 5JMUA 1ECQA 4ICCX 2X1UA 2QUNA 3G6MA 1ME9A 3A4WA 3FVMA 4H6RA 1MWOA 2NT0A 2CLHA 1C8YA 4PRWA 2Z28A 2V5CA 3W84A 1KWKA 2OZ0A 4Q8OA 2BOEX 2DH3A 3WNPA 1AQMA 1PXGA 3VFCA 3CU2A 3S2JA 2Y8VA 2OQHA 3GG8A 4P7OA 4AHPA 3G3MA 3WSUA 2WAGA 3HGRA 1TZZA 3GAKA 1GNXA 2B0MA 1SSGA 3GUWA 4QBXA 4J2PA 4I3GA 4DZIA 5LNWA 1EX1A 1GCYA 3SAZA 4QDMA 4E3TA 3A23A 2DSWA 3GY1A 4ZZ9A 2IQTA 3CH0A 3DYOA 3W7CA 3LHYA 1XYZA 3DXIA 2RDWA 3TROA 4WJXA 5CGMA 3D3AA 5IHRA 3IARA 4BWLA 1XS2A 4GZEA 2P88A 4GHRA 2UY5A 3KZSA 1Q6RA 1AH3A 2I16A 3OYXA 4LUTB 4R53A 4LUYA 2G41A 3ATYA 1W3KA 1BSLA 3UGVA 4EKJA 3RCMA 3A3XA 1EDGA 4IFKA 1J6OA 4U5IA 3D0CA 1TREA 4PMUA 1JRBA 4B5SA 1VRXA 1UOKA 1X6LA 1JULA 3P81A 3M44A 4M7TA 2WSQA 4QAWA 3LHUA 3PWAA 3CL7A 3KZPA 3VD7A 1MI3A 4N9EA 1V3LA 3SCRA 1VRDA 3KRZA 4DBUA 1PX4A 1I1WA 3KBMA 3CUGA 3ARQA 4Y90A 2F2KA 3G1AA 2I7GA 3H24A 3KOWA 1FFRA 1RCQA 2DVXA 2GUYA 2HNEA 3NQ2A 3W1QA 4LU0A 3W3OA 1L6YA 2O7QA 5JBDA 4XD6A 3V0TA 3GBEA 1V3MA 2XIBA 4AX7A 2IKGA 4YTQA 5GVJA 1YDNA 3ZT6A 3RITA 1QPKA 3DHFA 5M03A 4HYRA 3TK7A 1L2UA 4Q7NA 1PS9A 1G4EA 4YYFA 6XIAA 1M04A 4QEHA 1WYIA 2QV5A 2BDQA 1W31A 2ZRZA 1SZFA 4ZXOA 3KBSA 1W3HA 5EMKA 3TFXA 3NEHA 3T81A 4WQ6A 4HCHA 4QE4A 4CD6A 4S39A 3C0JA 3STEA 1HW6A 3H2AA 4PUEA 4PMJA 1JPKA 1UH3A 2PF8A 4ZFCA 1KB3A 2GGGA 1QI5A 3VIKA 4PMQA 5IOBA 3ZJ6A 3AHTA 1W1YA 2CCRA 4J3SA 2YGYA 4GKLA 3PZOA 2QPSA 4LY4A 2DSKA 2NQHA 5G1TA 3CHDA 1KXTA 4PGLA 3U2OA 2J7DA 1CECA 4I7WA 3SEPA 3GAYA 3SQLA 3W71A 5F4SA 3O8AA 5K4ZA 1XIIA 1BG4A 1B54A 3W7JA 4JAWA 4L9ZA 5KTLA 4K37A 4AWUA 3N4EA 2O4QA 1B3OA 5TF0A 3MCNA 1X38A 1E0WA 2D2GA 4S3CA 1Q63A 2Z26A 1A5BA 1OCQA 2XHYA 2VZVA 3STGA 2PBGA 4AZ7A 5I3FA 2TAAA 4J28A 1W9BM 2ZXAA 1V02A 2Y7FA 5I5RA 3UZZA 1UKTA 3IUDA 1EOKA 4LTSA 5LGZA 1EEPA 4PMYA 3ARYA 1A80A 4HHMA 3T07A 3RPMA 1YDOA 1OK6A 2QULA 1DJGA 2OZ8A 4UR8A 2CHRA 1FHUA 1EHNA 2PDJA 3OHIA 4OU1A 3FJNA 5G1MA 2E5CA 3DENA 5TIMA 1EB3A 3PM6A 5D33A 2V2CA 3IGUA 4PCFA 2WSPA 2ALRA 4XZLX 4UMCA 3W02A 1UR4A 4NRRA 5AC7A 3EMQA 1UC5A 2CLEA 2XH0A 2JK2A 3DCPA 2RUSA 4FNSA 3KL0A 3N2XA 5A8OA 3RYSA 4GO9A 4ATWA 2E7FA 4H6EA 1M6JA 3N14A 5AHIA 1EP1A 3VDGA 5FD0A 1BWLA 2HPMA 3IIOA 4L6OA 2ZA3A 1E56A 1DQWA 3VPLA 1E70M 1KM4A 1QBBA 1AW1A 4Z42C 1PKMA 3P8JA 4LFYA 1U1UA 3EYPA 1KW1A 4NVTA 4ZEPA 1YDVA 3L5MA 3M0IA 3T2OA 3ZVIA 2QR6A 3S46A 3I6EA 2DIJA 4M56A 4WZHA 5HNUA 3NVDA 1AUSL 1RJPA 4PB5A 4PH6A 5C71A 1JZ7A 2ZVIA 1V6WA 4PA8A 4RE2A 2NUXA 4Y8EA 1US0A 4O50A 3RN6A 3BMVA 1TWSA 1YNYA 3QQ1A 1OD8A 4POCA 4C7FA 3WCZA 4I5XA 3I6TA 4UTKA 2V38A 3B4YA 4CQBA 3DFTA 4S38A 4H2HA 3SR7A 1GOIA 1HGYA 1F73A 1BQGA 4EWND 4A2RA 2Q09A 1XYAA 3GNDA 2W79A 3FJ6A 3MP5A 2XIMA 4B4FA 2NX1A 3LTYA 2YCJA 3EOOA 3KBNA 2YCLA 1HJUA 4F0RA 2YW4A 3WF2A 4MADA 3UXLA 3WELA 3CUFA 2G50A 1TWIA 2NLIA 2PODA 1YPFA 5D9MA 4IMDA 1EBGA 4GVFA 1H7WA 3F5KA 1J18A 1W9PA 4REQB 2TRSA 1QPRA 5D37A 3UJRA 3A21A 1FFQA 3IWPA 3G8RA 1CLKA 5D2VA 4OFCA 4IMCA 4EOUA 4JNYA 2Q02A 3CJPA 4DLMA 4JYFA 1WX0A 3LERA 1PZ3A 1JDCA 5J04A 3AJXA 3WQEA 3GE7A 3LSBA 1ISXA 1GQNA 1Q6LA 5DN1A 3VUPA 2DSUA 4KETA 2EKCA 4DYJA 3TMQA 1GQKA 4A35A 3OYZA 4GNJA 2ISFA 1XLHA 4Q8VA 1UH4A 4CU8A 3ZJKA 1XLIA 2XN1A 3MVIA 4EPKA 1N8WA 3HQOA 4IQJA 1GVFA 5DRIA 3B4UA 5MKGA 3BMXA 4FXRA 2XG9A 1VFUA 3MWAA 4UMAA 4DBWA 1NWTA 4O1CA 3QGAC 1REQB 2D20A 3N12A 4S3KA 4OJYA 1POJA 1XF0A 3VDAA 5DLCA 3W23A 3W53A 4ATDA 3AU6A 2FZNA 3W1LA 3ZS4A 3DAQA 5PTDA 3W7MA 4DEFA 4RDVA 3G6LA 3M64A 4OBTA 1FWFC 4QISA 3RUBL 3LG3A 3SJNA 3MANA 4ADUA 3AC0A 5LIKX 1GVQA 1ZNNA 1RQHA 1TVLA 2FFIA 5EMJA 2Q3OA 5FF0A 2Y5JA 1QI2A 3OQEA 4XUGA 1Q7ZA 3CS2A 1M53A 2R6OA 3EWWA 2FVLA 1VBHA 2I9EA 3UWUA 2YFNA 2VO5A 3S3GA 3UCQA 2E1DA 1H7NA 4JR5A 3ZJ8A 3SFKA 1SR0A 2J6XA 3HJEA 2CZDA 3KVJA 4J3UA 4D1JA 3PZGA 4FX6M 4XIAA 2GZXA 1XC6A 3JS3A 1BYDA 1RPXA 2INEA 4FAMA 3GYCA 1OFBA 1PWLA 5REQB 2VNCA 1CXHA 3MUXA 1ZU8A 3HIJA 4L61A 4QLLA 5B80A 7CGTA 1VHCA 1VHNA 5D02A 4IQEA 3WJYA 1EP2A 3NOYA 3W7RA 4UR9A 4UUIA 4PUKA 2ASHA 3H4WA 2PTXA 2I17A 3VA8A 2YR1A 1FP8A 3EWYA 4NJKA 5JXQA 4IT1A 1NP2A 4XKMA 4ZSUA 1WZMA 1GJUA 4G1NA 1N8IA 3G1DA 1JQXA 3WQFA 1E4LA 5A6JA 2PRHA 1O95A 3FAXA 2A3CA 3EKLA 1QHOA 1FHLA 1W54A 2REQA 1L6FA 3MW7A 2DSVA 1NARA 2CPUA 4FLQA 1R87A 2NLYA 3VIMA 1XHGA 3EMZA 2PDNA 3AZRA 1DWFM 2GJNA 2GDQA 1S5WA 1RUSA 2PDXA 3MV11 3LTSA 3GTHA 4DPQA 4JTEA 1YXYA 2PZ0A 4KWUA 1XLMA 1F4HA 1G67A 3KBWA 1MDLA 1MEIA 2QT3A 2F6KA 5KEZA 1PYMA 3LPPA 3CZLA 2EQDA 4S2CA 3HPFA 4B5UA 3S9IA 1XJBA 3CZEA 4IIGA 3IAQA 3NQ6A 1OM0A 2PURA 2BZNA 2WCSA 3FAWA 4PEEA 1JZ3A 3IJQA 4NSBA 1DJYA 1L6WA 3PVFA 1V77A 3WDPP 2QGYA 1H7OA 1O1HA 1LP6A 1TQXA 3B9EA 3UESA 1FTXA 3ZSSA 2XISA 1J5TA 1KCLA 1R5YA 1ODUA 1NDVA 1MFVA 4GMEA 2C79A 1CW2A 3TSDA 4XZBA 3H21A 7TAAA 5GJPA 2WBKA 5AC6A 3KDOA 1DYSA 1QOQA 1KM6A 3C5QA 3URBA 3LNPA 3S83A 3HGOA 1T96A 4IX0A 2YLLA 3O6YX 3MI2A 5FJIA 4FEZA 4QJ3B 3VCNA 5JQ9A 1OFRA 5I78A 3W7EA 1AQHA 3ARSA 3FA5A 5B7ZA 2V3GA 4R9OA 1GGOA 3QGVA 5D4YA 3KTXA 4E2DA 1V03A 3KDNA 3EB3A 4D72A 1K9TA 3CEPA 3GZ3A 4KGJA 2V5LA 1ICQA 2EAWA 3ZR4A 4NXKA 5HBFA 3VFLA 1JDAA 3N2CA 2O92A 3QN3A 1L6GA 2WKGA 3A13A 4AXKA 2IPFA 2VGIA 5A69A 4FNTA 1MMFA 1DL3A 1TJPA 4ZO8A 2Y62A 5A8QA 3V36A 1U33A 3GU2A 1QO2A 3RX4A 3G1XA 2X1TA 3CV1A 1K7XA 2CKSA 3CTLA 4GYPA 1VPQA 1RALA 4QX4A 2X16A 3EBVA 4HQVA 2CLIA 4WJ8A 4ASTA 1IWBA 3ORWA 4Z08A 3QVQA 2FHBA 3MA8A 4UWMA 4R7JA 1BQCA 5HUPA 2C91A 1NFBA 4KRTA 3IJ9A 2OWXA 1PHQA 3Q4DA 4IMGA 1O5XA 1C7SA 4HN8A 4O0ZA 4IZGA 3CPRA 3M0MA 4LBUA 4B91A 5C7VA 5IBXC 3NQCA 4JOMA 1XH2A 3O3RA 4Z2JA 1GW1A 1JD7A 3CASA 3SUSA 4DO4A 1LL6A 2OSWA 1XPYA 2EGZA 3E2QA 2Y8UA 2E9MA 3NPVA 4H6QA 2YLAA 4IL0A 2PDPA 2INFA 2DEPA 3QTPA 3VINA 4HPGA 3W0KA 1E4IA 4UB9A 1E1FA 1JYVA 3NO3A 1GVSA 3PR2A 4XG1A 3UZXA 4MKVA 5C7HA 4F8XA 3CV6A 2B7QA 1C7TA 5EMLA 4Q4QA 1CPUA 5HMEA 4HA1A 4GZJA 4DJDA 4HOZA 1LBMA 2GWGA 1EJXC 4GQ0A 2ATSA 4LS2A 4AIEA 3HN3A 2XN2A 3UXKA 3NQAA 1UG6A 4FLSA 3B8TA 2VDHA 1J5SA 5M1TA 1LT8A 2J8FA 3N9RA 1K9DA 3KEHA 5H91A 1XDMA 4WKAA 1OINA 3EX2A 1V3HA 3V1PA 4TTUA 2SFPA 1DIEA 1JJKA 3W1XA 2DW6A 1QMLA 1WZLA 3ITYA 3SY8A 3PZVA 2QIIA 4WSJA 2VUYA 2F8QA 4FI4A 1OWQA 4GNKB 4XVDA 4G6CA 2ESCA 1UZHA 5FJTA 4OBSA 5L9FA 2WB5A 4KF1A 1M65A 1Y5WA 3IIXA 2PWEA 2DVUA 1DP0A 1HT6A 4HA4A 3WQWA 4WHBA 1E0UA 3UPBA 4PL1A 3A12A 1S5MA 4YPJA 3ZZ1A 3NZRA 2WJDA 3B9DA 3T8QA 3EEGA 3MC5A 4AZIA 2VFHA 2W4XA 1QOPA 4E5TA 4C6PA 1R2SA 3QYSA 2PMQA 3RU8X 1VBUA 2XVPA 1XLDA 4Z1BA 3W7GA 4HNNA 2VEFA 2GLKA 4TU1A 2E6DA 4JHMA 1ZCCA 1OZQA 4YHEA 4QAIA 1LOLA 3PK7A 1MSSA 3NO5A 2NVAA 4K7YA 4QCEA 5CSYA 3ZWSA 1EYWA 2WJEA 3SCNA 4YXGA 1K7EA 2VM8A 3E6EA 1RK5A 1OQFA 3BTNA 3OW1A 1W5OA 1AW5A 2FZBA 4HU0A 3LBCA 1Y5VA 1MO0A 1W5MA 2YDSA 5LGXA 6A3HA 3TNOA 2QCGA 3S6DA 1AJZA 3TQPA 3E0LA 1S3TC 3CB8A 2AMXA 1UIPA 2PAJA 2OR2A 5CZJA 4BI6A 1ZJIA 3AHXA 4IP4A 4MLJA 1QI0A 4DJDD 2FTWA 3UYCA 3DHPA 5M3WA 4K8GA 4W86A 3PZ9A 2O9OA 4HA3A 1WUEA 4AYSA 2PA6A 4U2YA 3REQB 1YKWA 3SN1A 2ZZ2A 1KO0A 4UFMA 3L0KA 4LUSB 4JTLA 1PTAA 2GSEA 4AD3A 4L80A 4BJHA 1MNSA 5T9BG 4Z0SA 1SW3A 2FZ9A 2PRMA 1JPHA 1VEPA 3DX5A 2V2DA 1XD1A 4O4WA 2XYLA 5EY5A 1ME8A 4O1DA 3IVUA 5AHEA 1FWCC 4O57A 1AVAA 4IX2A 3OIXA 1LWJA 2H9AB 3EDEA 3L67A 3FXGA 3GTFA 2OOGA 3DERA 3KWXA 2A3LA 1FWIC 3UCDA 3G2GA 2BGSA 1W1A1 2G3IA 4KGLA 1UW9A 1YRRA 4JDYA 3H2NA 2ISWA 4WDWA 2VYOA 3MSRA 1QW7A 2YA0A 5FKYA 2X41A 4QHRA 2CBVA 3F5JA 2WWDA 5C9XA 1W5PA 1ONWA 2WVVB 5HR7A 1S2TA 1GOXA 5D38A 2XZ7A 3H2MA 3W83A 5HMDA 1YPXA 3H4GA 2GSJA 2QCNA 4G1KA 5BXTA 4MFDA 3LY0A 4FHAA 1EPXA 4DI9A 1T41A 4H41A 4PFHA 1MRQA 1H63A 1KBBA 3RNDA 2ZFAA 1DWJM 4UFKA 3LHZA 3SN0A 2AQOA 1BYCA 3ZWTA 1FH8A 3L4UA 1XIFA 3KRUA 1NWUA 1C8XA 4FNPA 4Y9NA 3DI1A 4JKKA 1PL9A 4A3QA 2G3JA 1J11A 3TOYA 4QDWA 1NWSA 4E2VA 3CL8A 5E9AA 4XV0A 2J7HA 1HF6A 4D6DA 3VD9A 3QQ0A 2YFOA 1QATA 3MP4A 1XLGA 1QNQA 2VD9A 5C9ZA 1OT2A 2ZE3A 2CETA 1CZ1A 1A5AA 1JR1A 1WUFA 3UG5A 4FPSA 4GE8A 3TYUA 1OC7A 2ONEA 1C8QA 1TKKA 3NURA 3VOIA 1R86A 3VD3A 1E3XA 3GX9A 1SZEA 3JRKA 3R58A 4B9ZA 3T6CA 5AFDA 5CC7A 1BLIA 2J8GA 4CQ9A 3AICA 1G7UA 4CCDA 1KFCA 1TELA 4E6MA 2D73A 1LQ2A 3KOYA 4TO8A 4W5ZA 9XIMA 3DECA 1I1XA 2DUZA 2ZRYA 3WFZA 5DT7A 2QPXA 4UOJA 3ONBA 3N2MA 3RR4A 1JZ6A 1IZJA 1KBJA 3W7LA 2J27A 1EGMA 3LM7A 3GC2A 3FGCA 1US3A 1KTBA 5CQ1A 4L64A 5CC3A 4MJ2A 2OT0A 3B3DA 1GJPA 2HVNA 2PEVA 1WXJA 3W01A 1FWDC 3TEVA 4BF5A 1Q66A 2Z2AA 1QW9A 3M6YA 3AXHA 4LSBA 4JL1A 4ADTA 3LMYA 3WF3A 4X3ZA 1F9CA 4B3KA 1OX5A 1JEZA 1ZBCA 3TUUA 2HWGA 1KBKA 1KFKA 3LCIA 3NQFA 1XBXA 4W85A 2VRJA 2IW0A 4M19A 3UY8A 4N2YA 3AXKA 1XV8A 2VZOA 2GUUA 3HU7A 5HNRA 3B8WA 3VNIA 4PTNA 4D8ZA 3NA8A 5A3HA 5BWAA 4RE0A 3VIJA 3KWSA 1B3WA 1B5TA 5FJUA 1PYFA 4FX8A 3OA3A 4LUTA 3NQ7A 3P74A 3K2GA 2C18A 2ZUWA 4CQ8A 1OGBA 3T7VA 1A5OC 5LA1A 1XDJA 3QFWA 2YOCA 3CHFA 3UWVA 1LLZA 1ODZA 3BARA 1W2VA 4WY0F 4N4PA 1O4UA 2E3ZA 3CQKA 3IACA 4U3CA 5D30A 1U5JA 4RV3A 2QJGA 2YDRA 3T09A 1GVEA 5FIPA 3ZLGA 1E0VA 3CL6A 1DOSA 5AYBA 4W88A 4NY2A 4AZGA 4I9TA 1TE6A 1KRBC 1MXDA 5T9CE 2V68A 2XVKA 4TVDA 4QE5A 4I9MA 3MP3A 3K1DA 3OGRA 2E8YA 3MMUA 2J79A 3PSWA 4B5XA 3LENA 2Y4SA 2WPGA 4LVDA 1FCVA 3E0IA 2G37A 3OODA 3TTSA 4ZE4A 4XBJA 4AY1A 1XYCA 1ZGDA 2Q6ZA 3E0WA 1WBHA 1KR0A 1X1OA 1X1ZA 1FCQA 2BXZA 5HATA 3NQDA 2Z1WA 3BG9A 3V4BA 4PUNA 1XW8A 2DT1A 3SCUA 1J6PA 1M7OA 3LHWA 5LHFA 3NQVA 4R34A 4G2DA 2WHJA 3AIQA 3OZYA 4RJEA 4ROPA 1SQ7A 4KW2A 3CV2A 3NTYA 4ERAA 4MB1A 2FGLA 3EWCA 1RCXB 2DGAA 4M7SA 3PUDA 3I10A 4PTMA 5C70A 3EOSA 5D2XA 1V3JA 3CXOA 1JFHA 4YLWA 3O2LA 1EF2A 1LOSA 4FIQA 4G8TA 3DBPA 2B4GA 4GUJA 1XBZA 3F4NA 3OZMA 3R7MA 4X9SA 3AIRA 4MZ1A 3R12A 3W6MA 3SZ8A 3W25A 4PULA 3DGRA 5BRQA 2F7FA 4JTIA 3SCPA 3FEMA 2QAFA 1U1HA 4M6VA 1ISWA 2B7OA 3E74A 3N9KA 5I3DA 1KD0A 1OFAA 4M1RA 4ML4A 1ZQ5A 4B16A 4B92A 4LEQA 1O68A 1S5TA 4CU7A 4O53A 3HB9A 3CAQA 4EIVA 3UPMA 2WNZA 4GFIA 5AC5A 4KWVA 4AWEA 4HK5A 1FUYA 2I9UA 1Q6DA 5ABEA 3MVTA 2QQ6A 4ZCWA 1PEZA 3CM4A 3PFMA 4M1BA 5D32A 2ZC1A 5CLTA 1C3FA 1VBJA 4BF9A 2CXGA 2Q3RA 2PCEA 3EX4A 4XAGA 2BHYA 4D6JA 3O9NA 3VDHA 5CZ0A 2PPGA 2A79A 3VIPA 5G4WA 1R47A 4LAKA 4JTGA 4Q8WA 3MSYA 1MVYA 2AL2B 4TMBA 4AMCA 1A0DA 1I2OA 2V3FA 5EBUA 5C5YA 1QU4A 1FCUA 4KFOA 2XH4A 3PJXA 2GGEA 1FY6A 1WKDA 3S0CA 4DVOA 2V9DA 5DRCA 4FO4A 4W7UA 2PDWA 3K13A 1VQTA 4NF7A 2VI0A 1K8YA 2YA1A 3M5XA 1ZTVA 3GXIA 2ZDSA 2Z7KA 3NNTA 1L8PA 2GDVA 3BOLA 3LDVA 3W2UA 4GBDA 3WBEA 3VUSA 1ISVA 3AMGA 2A7NA 2DJXA 3R79A 4JFTA 2VEIA 3WQOA 2CLMA 4PBFA 2YDAA 2FTYA 5H8UA 2C14A 1WV2A 4HNCA 5AYXA 4PTDA 3ZIZA 1S2WA 3FA3A 2ANUA 1WXYA 1HJWA 3CZGA 2CBIA 4Q8NA 3SI9A 2BWGA 3W75A 4AIUA 3WLSA 3GXDA 4Q3MA 1WB0A 3C0QA 4HNUA 3S5NA 1MUMA 1WQ5A 4JTAA 4UFJA 3GVVA 3VTRA 2VENA 1UH2A 4LCSA 4LCRA 3LA4A 1AD4A 4EPEC 4JY9A 1H61A 2V5JA 4TX6A 2BHUA 3E2VA 2GGHA 4MDOA 1OJXA 5ABFB 2R94A 1XLCA 4HP5A 4UNLA 3W6YA 4DO6A 2OPJA 1TTJA 3OHMB 3T4WA 4X60A 5E09A 4QR6A 5G2IA 4DBEA 4REQA 2ZRWA 3B9NA 1DJIA 5C2CA 4A3UA 4CCCA 1DTNA 5A2AA 3TWBA 1LRNA 4YU1A 1F74A 3W85A 4E8DA 3T44A 1EL3A 2ISVA 4MNKA 5IFTA 4XX6A 4BK9A 3WQCA 1E51A 3KXQA 1UR2A 1EJ7L 1VYPX 3QV7A 1UWTA 3G1SA 2Z0IA 5D9NA 4MKSA 4JD4A 3H26A 3RM4A 4S3GA 3GW3A 1B9BA 1UQYA 4W8BA 4JFVA 2WPBA 4AEEA 5HJYA 3BV4A 5FJPA 4GZ7A 1AQFA 3AS3A 3BLEA 5I02A 4D6EA 4DJEA 4CLMA 3SCVA 4XKYB 4H3DA 4CVUA 2QCDB 4O10A 4TXEA 1MXSA 3DH7A 2HJPA 4LUJA 4BWLC 3W7PA 4UTTA 4LC6A 2OXNA 4P8XA 4M3PA 2X0HA 3GDKA 1O1ZA 1ZS2A 4FXSA 2OU4A 4B2DA 3GFXA 5BRBA 2OEJA 5HUOA 3AXXA 1REQA 4RZBA 2X0YA 3B8UA 4GXPA 1KRCC 1ZALA 1ADSA 4GIRA 3IRSA 4FOJA 1TTIA 3LRMA 2OFJA 4N4QA 9XIAA 4RLIA 1UWUA 1W9VA 2WQDA 5F2GA 1HN1A 4PUMA 1FDZA 4PMOA 1PZ1A 3GLCA 3ARWA 3NCOA 2QCMA 2QUVA 1W1VA 1G0CA 2JKAA 1WAUA 4QJ4B 3IIVA 1B0IA 2X7WA 1VCFA 2ZRXA 5K2ZA 3GFZA 3AIUA 1M3UA 3GXPA 2EBNA 3B0VC 3C2FA 3PWIA 4H8NA 2WOQA 1C29A 3T08A 2XFWA 3QXBA 2DZVA 2TODA 4DHGA 3Q2DA 5A94A 3H23A 2PFHA 3D3FA 4MSSA 4IJBA 3WLRA 2TPSA 1VB9A 3SDOA 2H8XA 3AUJA 1C9DA 3SQSA 1W1ZA 4BEQA 3O6CA 3W1TA 1EKOA 1H49A 2HXUA 3S5ZA 4FR6A 4PE8A 4Y6GA 5CC6A 1YBQB 1UIOA 5D2YA 1UB3A 1RLCL 2GJRA 3CNYA 4UQDA 1A47A 2XJ7A 4AF0B 1YQ2A 3TKFA 5REQA 3RF9A 2VD8A 4PR4A 3GG0A 2F84A 4ZO9A 2CLOA 3SGZA 3VABA 1C92A 4Q8UA 1P7TB 3TC7A 3IVTA 4J3XA 3VGHA 4D9PA 2XPKA 1TV5A 1HTIA 4C1LA 3B03A 4DY1A 4NZ1A 3WH8A 2ZBTA 4UQBA 4UQAA 1P4CA 5AOUA 4IQLA 3UJFA 5C8BB 2O55A 1BD0A 4J7RA 4JZ5A 2PB1A 4FLOA 3ARTA 1P1XA 2BV9A 8XIAA 1X6UA 2BHZA 4IQDA 4ZQRA 4IISA 4DJED 4AWSA 2O7SA 3S4TA 5IBXA 1D8CA 4YTRA 3BDKA 1I60A 4EPBC 5ABTA 1BVWA 1X1NA 4R88A 1H5VA 1JXJA 3O16A 3ELFA 4B2DD 3DFYA 3B0UX 1UPPA 1B3YA 1PAMA 1SFTA 2GQ9A 3WMSA 3HG5A 5I09A 1H0IA 1SW7A 3VOHA 1QPQA 2CZVA 2C0HA 1PIGA 4GBUA 3DFPA 1LLOA 5F4WA 3BQ6A 3MSGA 4GG9A 4M82A 4O12A 3W70A 4B3LA 1ICPA 3LLDA 1W1B1 1KFBA 1J0HA 3LOTA 3WLKX 1W3IA 5FSDC 3WNNA 3T4CA 3EWBX 4UTFA 1E6RA 1R7OA 4O17A 3NM3A 1EX5A 5KSWA 1QR7A 3ABXA 2VTFA 1XD0A 4EXAA 1GTHA 4H7VA 4AZHA 4DXXA 2O56A 4KKXA 3WFAA 4E4FA 3E02A 2P53A 1MDRA 3SUTA 1NF7A 4JCLA 4XO6A 3TAKA 4AMAA 4I5RA 1KM0A 3EOLA 2PP0A 4MNLA 4P7QA 9RUBA 1R3SA 1DV7A 2BXYA 2HROA 3TCEA 1O5RA 1D7KA 2NT1A 4JTKA 3G22A 3N3TA 2E5BA 3WMCA 1SSDA 2PDBA 3QKZA 3HTWA 1L8NA 1PIIA 1R3YA 3NQMA 3UY7A 3WUGA 4UZUA 2A3BA 1HJXA 1ENUA 4K36A 1ITXA 3KVKA 1W5NA 2H3BA 5DQPA 1IT7A 1T99A 1MZHA 1V79A 2Y5EA 5CH9A 3FK4A 3H6OA 3NQEA 5AYZA 3G3DA 1KXHA 3GW0A 4BFAA 1JUEA 4KEZA 2E5DA 1A3HA 3IAPA 3UD6A 1K4HA 2KZHA 3N29A 4HSOA 3QMTA 3BW3A 4HJWA 4Y9OA 5DXYA 1QHZA 1NM9A 4FXFA 5I3HA 3IJ6A 3B0YA 2DU2A 2G96A 3EDJA 4S23A 2EPNA 3SECA 2E8ZA 4RPQA 3S1VA 4IJRA 4HTBA 1SFJA 2ZVRA 4D6HA 3CGTA 4O18A 3WJXA 2WV8A 4O16A 1OG6A 3B05A 4E2BA 4PMZA 4ZENA 4Z1AA 2PGWA 3AALA 3GDLA 2GVJA 3BVJA 4IMFA 3RLHA 2QKFA 4HPXA 4KPLA 5CEWA 3VXGA 2X30A 5IDZA 4ZQMA 4CQDA 1BGAA 3GTIA 3AIEA 3WDJA 5CPMA 1UD5A 2OSYA 3STFA 3O0KA 1TRDA 1QOXA 4CNSA 1WXZA 3P93A 3ZR5A 1AK5A 4M8UA 4CD7A 3T0AA 3AS1A 4OKDA 4GQGA 3U7BA 1XINA 4WIWA 1EJVC 2R8WA 2X05A 3VMOA 2V82A 3L12A 3DYPA 4FXJA 5I06A 3F2DA 3FNDA 2RGLA 1UPMB 4MOZA 2W92A 5DT5A 5HWNA 1ZJBA 1S38A 4DJFC 4YVPA 4F0MA 5EB8A 3UXIA 4DUXA 2EO7A 4L4MA 4GY0A 4K1GA 1UWQA 3TYDA 4F2BA 1SO5A 2BFGA 4MJ4A 4PUDA 2VX5A 5ABHA 1Z44A 2Y70A 5BROA 2UWFA 1TR9A 1X97A 2YJQA 3CTTA 1TG7A 2P3ZA 3GIPA 2ZUSA 3MO7A 4NZ5A 4F9DA 3SY1A 1RV8A 3UZ5A 6CGTA 2NQ5A 2QV4A 5T8GA 2I56A 2Z6IA 4DM1A 1TO3A 3FHAA 4Y9AA 1E43A 1HVXA 1VCVA 3MY9A 4XZIA 1GYNA 3A3HA 2DY3A 3H2OA 5F1VA 2FGZA 5HWJA 3LSCA 3R5EA 3LNMA 3VVGA 3RJYA 4IIHA 2AL1A 3NL6A 3NQ8A 1K02A 4LF2A 1KFWA 3KOFA 2YBTA 1E6XM 1GWJA 4UQEA 3TAOA 2O9PA 1I0DA 3H2FA 4H9TA 3P61A 3LGGA 5D09A 1KTNA 1YNQA 3TW9A 1CLXA 2WANA 2VZUA 3EDDA 3BCDA 3P84A 5LXXA 4ES4A 3VIIA 2VFGA 1RAKA 1X98A 1XLEA 2YSWA 1NAL1 5I23A 3ARZA 1ONRA 2WVUA 1MUWA 3G5EA 3LPOA 4CEUC 2J7CA 1EIXA 3GH4A 2XSXA 1F3WA 4MB4A 4ML9A 3WG6A 1HNYA 1DE5A 3VDBA 2Z00A 3VZZA 3I7RA 4TTGA 1TV4A 5D8WA 2CZ5A 5FF3A 5AVNA 1LL7A 1XIEA 2PWFA 3CYVA 2PDGA 5EYWA 3RCYA 4Z17A 5A2BA 5DMYA 3KVMA 5E0FA 3ZVHB 4XB3A 5ABGA 3M0YA 2GVEA 4P8UA 3REQA 4OOUA 3NSNA 3QOKA 5C54A 3MCMA 1KKRA 3V18A 3WEOA 2YXGA 3A5FA 4LUSA 1IF2A 4NT0A 2ICSA 5H6HA 2V5DA 2VX7A 4CNPA 4ZGYA 1JI2A 1UD6A 3ZFHA 2CESA 2Z1VA 3N25A 3OLEA 3VILA 1QTWA 2JIWA 3BSHA 1LG1A 2DZWA