3ONBA

Bond breakage and relocation of a covalently bound bromine of idd594 in a complex with har t113a mutant after extensive radiation dose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage reveals promising interaction position
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 102
structure length 311
sequence length 311
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3onbA00
2PFHA 5AZ1A 4FAMA 4IJRA 2IKIA 4XZLX 5HNTA 1QRQA 4PMJA 4FALA 4ZFCA 2ACUA 2PDKA 3LBOA 3UZYA 1Z3NA 1X96A 3H4GA 2C91A 4JQAA 2PDPA 1MRQA 2AGTA 3CAVA 5HNUA 3LD5A 3FJNA 4LB3A 4EXAA 2VDGA 4HMNA 3WBXA 4H7CA 3WG6A 2WZMA 1S2AA 4JQ1A 3WCZA 2IPGA 4LB4A 1JEZA 4OTKA 3F7JA 4QX4A 1AZ2A 5AZ0A 3CASA 1PZ1A 2DUZA 3O0KA 4PRRA 4XK2A 3T42A 3D3FA 4YVVA 2PZNA 3CAQA 4GACA 3KRBA 5LIKX 3H7RA 4YVPA 5LIXX 5JH1A 2A79A 4WDTA 2PDQA 3O3RA 1A80A 5LIYX 2PD9A 3RX4A 1QWKA 3UG8A 4PRTA 1LQAA 1AH3A 2HV5A 1Z9AA 3G5EA 1EKOA 1EL3A 3Q65A 2FZDA 3GHSA 4QBXA 1LWIA 3WBWA 2FZ9A 3LZ5A 3M0IA 4YS1A 1AZ1A 2IPFA 2BGQA 1EXBA 1YNPA 2IQ0A 2NVCA 3DN5A 1S2CA 4DBSA 4EXBA 3R8GA 1PYFA 1HQTA 4QR6A 1Z89A 4LAUA 1K8CA 4XZMX 3WBYA 4Q3MA 1US0A 4XZHA 3Q67A 4JQ2A 3GHUA 4MHBA 3LZ3A 2ACSA 2HVNA 1RY8A 1PWMA 4GQ0A 1Z8AA 3GHTA 3ONBA 3M4HA 2PEVA 1RALA 2IKGA 4WRHA 2HVOA 1AFSA 2ACRA 2HEJA 1ZSXA 2HE8A 4LBSA 3V0SA 1EF3A 3LUTA 2F2KA 4XO6A 3CMFA 1PWLA 4AUBA 3FX4A 4JQ4A 2IQDA 3BURA 4HBKA 2PDXA 3B3DA 2PF8A 4LBRA 3V0UA 3GHRA 4XVEA 4IJCA 4WGHA 4H8NA 2CLPA 4PUWA 1Q5MA 1C9WA 3UWEA 1IEIA 3ONCA 2FGBA 3UZWA 4XVDA 2P5NA 1Q13A 4WDUA 3COTA 1ZUAX 2I17A 3UYIA 4RPQA 2PDHA 4XZIA 4LAZA 1FRBA 5LIUX 2IS7A 3CV7A 1S1RA 3LNMA 1XJBA 1S1PA 3R8HA 2FZ8A 4ICCX 3DOPA 2INZA 1YE6A 1XF0A 2PDJA 2PDFA 2DV0A 4G5DA 4GCAA 4JIHA 1T40A 4XO7A 4WEVX 1YE4A 1YNQA 4R9OA 3EAUA 3EB3A 3RX2A 1MZRA 1ZQ5A 4GQGA 3R43A 1GVEA 4YVXA 3CV6A 1MI3A 2IPJA 3R6IA 2R24A 3LQGA 1OG6A 4XAPA 1PZ0A 4JQ3A 1IHIA 2BGSA 3QKZA 4JTQA 3MC5A 3M64A 1VBJA 2QXWA 2PDNA 3P2VA 4IGSA 1ADSA 3MB9A 3BV7A 4GA8A 5LIWX 4WDWA 3BUVA 2DUXA 4F40A 4JTRA 3G1RA 4JTCA 2PDLA 4JIRA 3R58A 1UR3M 4DBUA 1X97A 1SM9A 5C7HA 4Q7BA 5JH2A 2BP1A 2NVDA 4GIEA 2PDBA 2PDWA 2WZTA 4GABA 2ALRA 5M2FX 1X98A 2PDIA 2PDCA 5DANA 3GUGA 2F38A 1XGDA 2PDYA 2IKHA 4JTAA 3N2TA 2I16A 3UFYA 2HDJA 4I5XA 3V0TA 2J8TA 2PDMA 1VP5A 2PDGA 4JIIX 2FVLA 1ZGDA 4FA3A 3LEPA 5HA7A 2IKJA 1R38A 4DZ5A 4NKCA 3R94A 4L1XA 3RX3A 4PR4A 3C3UA 1J96A 3S3GA 3LN3A 4JTDA 3BCJA 4ASTA 4FZIA 4XZNX 3UGRA 2FZBA 3V36A 4QXIA 4PUUA 3LQLA 1AH0A 3R7MA 3ERPA 1HW6A 3UZXA 3V35A 4WDXA 4DBWA 3H7UA 2PD5A 3VXGA 1AH4A 3U2CA 4YU1A 5KETA 1RY0A 2HE5A 2IPWA 3LENA 3UZZA 3NTYA 3UP8A 4L1WA 2R9RA 2INEA 2ISFA 2ACQA 3N6QA 2PDUA 1M9HA 1T41A 3EB4A
chains in the Genus database with same CATH superfamily
1TVNA 4MKNA 3QV6A 3HU7A 4Z1BA 3RM4A 5AZ1A 3QV9A 3W7MA 1XICA 2DSUA 3RIKA 4M80A 5D38A 2E5DA 5GVJA 3T8QA 3CQIA 3AS3A 1GHRA 3GC4A 1E0TA 2NXHA 2P3ZA 3T40A 4WJXA 1KM0A 2YBTA 2Z2AA 3WLQA 3TQVA 3TNOA 3DI0A 4HPXA 1UPPA 1RD6A 1ZBKA 3BXWA 3OLEA 1YX1A 3QHMA 4KH2A 1M7OA 3URBA 3GNPA 2AKZA 4LT9A 3WD4A 2X0SA 1SO6A 5AY7A 5D9MA 1IT7A 1CGUA 4K8HA 2V38A 4C6QA 4HN8A 1PX8A 3NZPA 1SU5A 2C1GA 3IJLA 3H24A 3AZSA 4DO7A 1EPVA 3SECA 3VIPA 1HZYA 1FOBA 1XH1A 3OG2A 4U28A 1E43A 3LG3A 3H2AA 1Z69A 2GLKA 3F03K 5EY5A 4C6NA 3MI3A 3S2LA 1RR2A 1TA3B 2A21A 4ZB2A 1T0OA 1TJ1A 1JJKA 2DORA 1TFVA 1E6SM 5I78A 3GDRA 1XXXA 2Y7EA 3ZWSA 3UNDA 2IQ0A 1CYGA 1XRVA 3STPA 4ZO6A 4EXBA 3ZJ6A 3WMSA 1SJBA 5HBFA 3NQ7A 2W79A 3W7NA 2J8FA 1UHVA 4OIFA 1W3KA 4LC8A 4N02A 2GUUA 1UZDA 1XIBA 4AF0A 1EF2A 3WFAA 4B90A 1UD5A 2X42A 4CVWA 3SN4A 3A3HA 3BOXA 3ARPA 3NZRA 4O16A 2GGGA 1IV8A 2GWNA 2WPBA 4RNIA 2DQWA 1AW5A 1AFSA 3OBAA 1W3HA 4ZBCA 3TVAA 3UPWA 1F7BA 2BDQA 5D2XA 3AZRA 3CV2A 1ONWA 1EF3A 1AQHA 4UWMA 1TJPA 3WQ4A 3DDMA 1Q4NX 3FX4A 1GGOA 3PJWA 2WBGA 3LDVA 2QJMA 4LUSA 4DF1A 2J7FA 4XG1A 1E0VA 2WMIB 5I06A 1MW1A 2Y7FA 1YXCA 5C71A 4O52A 2BY2A 2PTWA 3P80A 1EP3A 1Q13A 2ODOA 4MWAE 1GT8A 2YCLA 3NQFA 4CEXC 3CM4A 3SRKA 5IRPA 2ZZ6A 4HGXA 2EEXA 5DCEA 4GBDA 4DJED 4UMBA 1OD0A 4L4LA 2PWDA 3H6OA 2X05A 3WF2A 1X8CA 2TAAA 4JX6A 3FSUA 5G2IA 4R85A 5CZKA 3RILA 2CITA 2GJPA 5HINA 3PB2A 2YCKX 3ORWA 4W5ZA 3QV8A 3UXLA 1OM0A 7ENLA 1AVAA 5AHNA 3T0CA 4YYFA 4NASA 1AMYA 2JF6A 2CWNA 3TYEA 2OQLA 1JCJA 4UFLA 4YWIA 3BWWA 1JF6A 2WCGA 1MFUA 1W3NA 2XFFA 3PZUA 3K5XA 4D6FA 3V3WA 3M7WA 2WC7A 4G7EB 5J5DA 1ADOA 2WSPA 1KXTA 3RM8A 1WNOA 3LQGA 1K7FA 3A22A 2L5HA 1DEDA 1RAKA 3IEBA 4NNAA 4QITA 1GW1A 3W02A 3QR1A 2FVMA 1XH0A 4BQ4A 3JZEA 4MB4A 3VKJA 1NDVA 4L61A 1QASA 2PGRA 3DKJA 3PSWA 5DMYA 4XAYA 3BAXA 1ONXA 3CEPA 4JD4A 3S5OA 2I57A 3TMLA 4QLKA 1D3HA 3PUOA 4HPNA 3RHGA 5JUVA 4WDWA 3BUVA 3IGHX 2AGKA 3CYVA 4MNMA 1QVBA 4MMWA 4QE4A 4X2PA 3ME3A 2RDXA 3O05A 5BU6A 1FWIC 4R7WA 5D30A 1DJXA 3NXFA 3OEXA 1XUZA 5HQMA 4ADUA 2OEMA 1FWWA 1WX0A 2WV8A 2X2GA 1QFEA 4L9ZA 3ZFHA 4PTNA 2WZTA 4IF2A 5H8PA 2V3GA 2WOQA 1FH7A 4L1GA 1D7FA 1XGDA 1UROA 1V6UA 3ZR6A 3GSMA 3GBEA 1V3LA 3SRFA 5CGTA 4HP5A 4GYJA 1ISYA 4EVZA 2OSYA 3AXKA 5CZ0A 2JKAA 3W1QA 3HJZA 1OB0A 1CPUA 5IHSA 2ANUA 4FF7A 3C3UA 1TV8A 4E5TA 3LN3A 1TV3A 5T26A 2JGQA 3CTLA 3MV01 3B0VC 4M19A 1O66A 4IM4A 3WQPA 2GSJA 3AHYA 1E9YB 2O4MA 1XIIA 4GKLA 2WVVA 4UMCA 2Z7GA 1S38A 1ME8A 4V2XA 1LBLA 1SUXA 2QAPA 4NJGA 4IG2B 1JFHA 1B4EA 1UBSA 1IWPA 1AK5A 1TPWA 3VD3A 3BOLA 1RVGA 3AMLA 1H7NA 1QHPA 1ME9A 2I9UA 1UR0A 2WWDA 5A2CA 3SGUA 1KFBA 2CC0A 3B06A 3U2EA 3EB4A 2V3EA 2RH9A 4LOCA 3TSBA 4YMZA 3T7VA 2AL2B 4M8UA 3N15A 1B3ZA 5EMKA 2E77A 3ZJKA 3LCFA 1UD4A 4G1KA 3NO1A 3CO4A 4MDOA 2ZVIA 2OOGA 2R91A 5L6UA 3SFWA 4K7YA 1A47A 2ISSA 3ZOAA 1B0IA 1XISA 4GC4A 4JQ1A 2HNHA 4LX4A 1CT5A 5FIPA 2VFGA 1EJWC 3VGBA 4F48A 2Z6IA 1JXJA 4C7FA 1C91A 3RM9A 1X6LA 5FF2A 1JZ2A 3ATZA 3B0PA 4L9YA 3TN4A 3CC1A 3LCGA 1XYFA 4D1IA 2YL5A 1O95A 1AD1A 1IXPA 4PUJA 4IWWA 3C0SA 3W29A 5LIXX 4B5VA 1RH9A 2G96A 2UY5A 1GG1A 4Q8MA 3SM0A 2X7VA 4LYKA 4N9CA 3U4AA 3V4BA 1YBQA 2FYMA 2J13A 5D2YA 3NSXA 3GDLA 1XLGA 3RNDA 3PHAA 4WHBA 4H8VA 5C2GA 2FZ9A 3AHZA 4B2DA 3RMJA 2R1LA 1VEPA 2A6LA 2B7PA 3AU2A 1VLIA 2NVCA 3QR3A 3UA4A 1HKVA 2VHLA 5EBUA 1PYFA 1HQTA 4AEOA 3WEZA 1XSJA 2QCMA 2XZ7A 3EKGA 1ZAHA 3SFKA 4BS0A 1NM9A 1KBIA 3ZYZA 1VPXA 4PB3A 4AB4A 3M5VA 4AY8A 5C70A 4NSBA 2X1IA 4CVUA 4DO5A 3KZPA 5DXXA 4XBSA 1IR2A 3UCCA 2ZE3A 3LXBA 1EJVC 1O6IA 4LJ3A 4B5XA 2HVNA 1NWTA 4WK9A 2NV9A 2GQ9A 3OPSA 3IV8A 1PZ3A 2DIKA 1KFWA 3JVAA 1W5PA 4HCHA 2EKCA 4KQNA 1RPXA 2QPXA 4HK6A 2QCCA 1VJZA 3WLKX 4X61A 1FWHC 1QNVA 3KRZA 1GVSA 3O6AA 4QM1A 3WNPA 2C7FA 3W7DA 3GR8A 4LAKA 2ZRWA 3P3BA 3T05A 1R87A 5FL0A 4J2PA 1BHGA 3TFCA 3B97A 2W3ZA 4HA4A 1KM1A 1M7PA 1P7TA 2WHJA 2QCNA 1H1ZA 1TPC1 3GU9A 1HJSA 5C9WA 1H60A 1NQ6A 3ZMRA 5REQA 5FI8A 3W76A 5A8NA 1BVNP 3T4WA 6ENLA 1N55A 1H5YA 3AICA 4U5IA 4LVAA 1JZ7A 1EJSC 3MZNA 1TCMA 1FWEC 1W17A 3HPAA 1UOZA 4Y9PA 3H55A 1A5UA 4I3GA 6ALDA 4H9YA 1OEPA 1V6VA 2QIWA 4L9XA 2DUAA 5DMLA 3S9IA 3TCEA 2H6RA 4M1BA 2CLFA 4XKYA 2CBUA 3C2OA 1QNOA 1TV7A 4G5DA 1EP1A 2HS8A 1SJAA 3NPVA 4DZAA 2NUWA 3VFCA 4HNLA 1YE4A 3KCJA 4BK9A 2P88A 1E51A 3TYDA 1ZQ5A 4AHOA 1OT2A 2D22A 5IOBA 3O16A 1OINA 1TMQA 3TXVA 4S2CA 1J11A 1ENUA 3LRMA 3A4WA 4GYPC 1Q6DA 2A85A 1C90A 1Z44A 4R9XA 4OECA 4LUTA 2HCVA 1C8VA 1E6XM 1UKPA 1U2YA 3VGEA 4GO8A 3WMLA 5I23A 3K4AA 1E55A 4QQ3A 3WLIA 4NAEA 1G67A 3NZQA 3M5YA 3W2UA 1FWSA 1W5QA 3H2EA 3BK0A 4UFJA 3CS2A 4L7ZA 3SGZA 3TR2A 4R5EA 4MB5A 3ZQ9A 3LLDA 3IVSA 2GJLA 4U2ZA 4B3LA 2V3FA 5FACA 1V8EA 4Q7BA 1MDRA 3HFYA 4NVTA 4IZGA 4C6KA 2WKGA 2ZZ5A 1JAKA 3SUVA 2I9EA 1UD6A 1GJUA 4DVOA 4XIMA 4GI4A 2NQHA 4IIEA 4UTKA 3VMOA 2B81A 3SUSA 4GOAA 2BVWA 1V6YA 3L68A 3OA3A 3TZNA 3NQMA 4HIBA 2WVTA 1TVLA 3LNPA 4AZIA 1Q2SA 4GVGA 3U5YA 3QM3A 1R38A 4GE8A 3IVTA 5IFTA 3GR4A 2VMFA 3I3DA 1Q7MA 4Q7NA 4DO6A 3PZGA 3M0LA 1HX0A 2FH8A 3RLVA 3ABSA 4UQCA 3MP5A 3S6TA 2ON3A 3Q58A 2YCJA 4Z08A 1WUFA 4RL3A 3BC9A 2E09A 4AZCB 4XTIA 3IRSA 1OFDA 1W9PA 4PMQA 3N73A 1P5BA 5KETA 3SQMA 3GZ3A 2IPWA 1IT0A 4FXJA 5CPTA 1OC6A 3FGCA 4JTKA 5IBXA 3M44A 1XSKA 5FKYA 4LCRA 4B16A 2FKPA 3FAXA 5AOUA 3C2FA 4AMAA 3L5AA 1TO3A 4UTIA 1YQ2A 3AXXA 4ZFCA 1CXEA 3VGFA 4FR6A 2C1IA 4JQAA 3FDKA 3ZT7A 2WLZA 3CZEA 2G0WA 3WG6A 1GW9A 5F2LA 1KC7A 3XISA 4OTKA 3LHYA 2PODA 1G7VA 4U33A 4MF4A 1TB3A 3FHAA 2WB5A 4XZBA 1J0IA 2X1UA 1NY1A 4D8AA 2FQIA 1GORA 3KRBA 1Q6EA 2CLOA 2GVYA 3BCFA 4W8LA 3AISA 3S47A 2FTPA 1EYEA 4GRSA 2NX9A 4ZFMA 4ZQMA 2NLIA 3M5XA 3HGRA 4GZIA 1NEYA 1OGGA 2YDRA 1XW8A 4C5ZA 1UA7A 5HANA 3EWWA 3B9OA 4E2VA 2AQWA 2A3AA 3WMBA 1E1CA 2FZDA 1VH7A 1LWIA 3ZT6A 2BOFX 3M0IA 1CW2A 5KTLA 1UZ1A 4DJDD 4D6IA 4GIAA 3N13A 4M6VA 1ML1A 4P8WA 4B3ZA 4LYPA 1ONRA 1E6ZA 3EEGA 1S2CA 2OCZA 5AHEA 5SWUA 4W88A 4WY0F 4F2BA 1R7OA 5C6MA 2Y5SA 3KOZA 2C8NA 4D6HA 1TPDA 4C6CA 3V16A 3H70A 3PC0A 4S3BA 2NQLA 2PWVA 3O6YX 4MY9A 1O4UA 3MSRA 5H8UA 1XRSA 3WJWA 4JL1A 1XLJA 1DVJA 5C8BB 3H4WA 2YR1A 1QBAA 1NU5A 3W7IA 4G7EA 2BY3A 4DYEA 3PTKA 2QNEA 1F4AA 1JDFA 2WWCA 3PWGA 4FLSA 1H63A 3OGVA 2HEJA 3SY5A 3IK2A 3AHXA 2XUCA 3BG9A 1DIDA 4ZQNA 4ZA0A 4KW2A 5HR7A 5FF4A 4XQ6A 2FPYA 5HJLA 3QTPA 4J35A 5F7UA 2ZFAA 4AW7A 5HWJA 1EWDA 1SFTA 3DFHA 4PUMA 2G8ZA 4CNSA 3C56A 4A6GA 2CLPA 3ONCA 1SJDA 2YSWA 4WIWA 3MUXA 1AW1A 2P5NA 3FVDA 2D2JA 2WHMA 1C93A 4DPPA 5KMYA 1J79A 4E3TA 5I3DA 1MQQA 4QE5A 4LALA 5FJOA 3O2LA 3QJAA 4PL1A 3W3OA 4E4PA 3MYPA 1QATA 4UQ9A 1OYBA 2PRMA 2P0OA 2DZSA 4C60A 4KWUA 3CV7A 3IS4A 1G7UA 5FCZA 4AD4A 3VD5A 5A6LA 2YL8A 3KTCA 3HJEA 3GU1A 4W5UA 3P5YA 1CB2A 2OYMA 1PKYA 3QV7A 3GW0A 3P93A 1JUBA 3K8KA 1XF0A 1P6BA 2X0HA 4GI6A 5HK4A 3UWZA 1OCBA 1POKA 3UY7A 3SCPA 3KEHA 3M07A 3JZUA 3MHFA 4QEEA 2BY0A 4JZ5A 4QP0A 5CAHA 1R85A 3HF3A 1S2TA 5GNYA 3EAUA 3KBMA 1IXNA 1MZRA 1UD3A 3MWCA 2JBMA 3TIMA 1KM3A 3T9PA 5RUBA 4URIA 4R3UA 1NQKA 4NUWA 3RO6A 1FXQA 1LL6A 2XFYA 1Q3NA 1S46A 4GY1A 2XU2A 2OYKA 1OG6A 2XDFA 3PPGA 3ITOA 1O60A 5ECUA 5D8WA 2CBJA 1AD4A 3CL6A 3WKZA 1IEQA 2CXGA 2HZGA 4NJHA 3BGGA 4HNNA 3BO9A 2VP8A 2WLYA 1EDGA 4YTUA 3CHEA 3W81A 2OEKA 3SN0A 2WZIA 2POTA 4P7RA 1SR9A 3FEMA 4QG8A 5CEWA 1J2BA 3GC5A 2DUXA 5A6SA 1JULA 1MFVA 4JTCA 3KL5A 4O19A 3USZA 1SM9A 5F1VA 5MHBA 2G3MA 5E6YA 3CZKA 1J0ZA 2QF7A 3L2LA 4GABA 4N9EA 3GU2A 3LB0A 3PP7A 3CWOX 3SURA 2PBGA 1XBVA 3NOEA 1BWVA 2WNWA 1S39A 2J8TA 3JUGA 2CLEA 2YIHA 2BGNE 1LOSA 2GYIA 2CU0A 2QLYA 2W0UA 2WMKA 4G1NA 2Z1WA 3N25A 4RE0A 3HQNA 4JTDA 3BCJA 4N0RA 2GJNA 3F5LA 1KKRA 3TN3A 3E96A 1TVPA 2GGHA 2OB3A 3DESA 4FPSA 3CGTA 2W61A 5HMFA 3PM6A 3BQ5A 2WMGA 3S4TA 2BHUA 2D1ZA 4MNKA 1PKNA 2BWGA 1HIZA 2QJNA 3QYSA 1ZS2A 1GKPA 4JCMA 2BV9A 4GG9A 1EX5A 4IISA 3KXQA 4MPKA 2PDUA 3S42A 1J6PA 3DEQA 5HNTA 2NZLA 3KRSA 1G5AA 4EPDC 5AVNA 2V30A 3VOIA 4AXNA 1I2QA 4AWSA 1DHPA 3HA1A 1ESWA 1Z3NA 3ARVA 4RW5A 3IRDA 2R82A 2ZXBA 2PRHA 2CZDA 3OTRA 2OEJA 2Y7DA 4S38A 2DH3A 3BGJA 2AGTA 4AC1X 3VAVA 2VR4A 1EP2A 1TV2A 3ZJ8A 4IT1A 2VRJA 3MTWA 2NXIA 4AZGA 2ZX5A 4C1NB 2PSNA 4ZE4A 4HTBA 2RDTA 5A2BA 3T09A 4K2SA 1W3JA 1KM5A 3W1TA 3T42A 2Z28A 2GL5A 4OJYA 2A7RA 1TQJA 4AVOA 2Y4SA 1W1YA 4TR9A 2H3BA 1OT1A 3VD9A 3NEVA 1DIOA 5LNVA 5LIYX 4FNTA 1L6WA 1D8WA 3EKZA 2ISDA 4PRTA 4AAJA 2HBXA 2J8GA 3PZMA 4BR1A 3HIJA 2ZX7A 3CL7A 1EKOA 1H3GA 1UCWA 1L2QA 2EPKX 3T2OA 4UTFA 4N2YA 4YHGA 2YDAA 2XTKA 4NJKA 1IIHA 4JTLA 3MVIA 2ZUMA 1KLZA 2V5DA 5AYYA 1XPGA 1XBXA 3IIPA 4Q8OA 4FI4A 1UP2A 2PWGA 1UPMB 4GJIA 1ZFJA 1ICPA 4DQWA 3WL1A 2FMOA 3PBYA 3M43A 4PUEA 2DPEA 2WYSA 4AYGA 1F2JA 2OWCA 2R8WA 1YXDA 3AJ7A 3CUIA 3UPBA 2AMGA 3C0QA 1LOQA 3W7QA 4Q32A 3C6CA 1AJZA 1X1NA 1R2RA 1IEWA 3N6HA 2YZRA 3VNMA 4XO6A 2AAAA 3CMFA 3ARQA 5E6ZA 4LVDA 1EO5A 4HU3A 3UJEA 2W63A 2NQ9A 1C8XA 3N2XA 1AW2A 5K7JA 1Q6FA 4JFWA 2Z1SA 4CQCA 4PCFA 4FR1A 1LL7A 3VIOA 1GYLA 1V7AA 4WY0A 3SIZA 8XIMA 1C92A 3NL5A 2HMCA 3C8NA 2XGBA 1DIKA 5CLTA 3IAPA 3N3TA 3P6LA 3GW3A 4DAFA 3N17A 3WNKA 1BKHA 3SSJA 1E6QM 5C9UA 5I79A 4XZIA 3W26A 1KQZA 3W6MA 4PMXA 4O4WA 1DQUA 1JAEA 4A3QA 1QI4A 1EZ2A 1JD7A 3N9RA 2ZDSA 1S2VA 3MT1A 3ARXA 1XJBA 4Q7IA 1FDYA 4P7LA 4BF9A 2V9DA 1HL9A 6CGTA 3QVQA 5DT5A 3LRLA 3ARRA 2YXOA 1LQ2A 3G22A 3OGSA 2GUYA 1CXFA 4HZ7A 2QUUA 4F3HA 4WSJA 4WEVX 1HL2A 3CZJA 4ZB5A 5KZ6A 4M5PA 2ZC1A 4M24A 3FIGA 4BWLA 3EB3A 2V5JA 3ZVIA 4IXHA 1P1XA 3F4DA 3C52A 3CV6A 2GK1B 3ENLA 2WZEA 5BMXA 4AH7A 1XX1A 2J7EA 1YYAA 3VDGA 3VILA 1VFSA 3TYAA 3CUZA 5G1MA 1O1HA 3PK7A 2R24A 2J7HA 4EKJA 1XQKA 3NM1A 1QCWA 4UTMA 2VZSA 3CZGA 3WH7A 4J27A 3EWYA 4JKMA 4O14A 4Z2HA 4QISA 3STEA 3DGBA 3TQKA 4ZQOA 1EXPA 3CIVA 4E2BA 3FA5A 3TOPA 1EC9A 3P2VA 2DSKA 1OX6A 1FHLA 4UXDA 4F2UA 3EDKA 2QCLA 4ROPA 4XWUA 2Y1HA 1F61A 4L6DA 2WBKA 2VNCA 3L66A 1UWTA 2O92A 3BGAA 4S23A 4FLRA 3OOQA 5AHLA 1OFBA 3DHFA 3IJDA 4JX4A 4C6EA 5B80A 1J2WA 3FDGA 3G1HA 1BXBA 3TE9A 1VHCA 4JDBA 4DBUA 3R11A 2R94A 3G1AA 3T2PA 4CNOA 3AXHA 3M0XA 2NWRA 4GIEA 1JQVA 3W73A 4P61A 2BX7A 4X22A 2A3LA 3FJ6A 4YIWA 3RJXA 3ZIZA 3W86A 3ABXA 4LRTA 2QGHA 2QV5A 4O17A 4JTAA 3KBVA 1FA2A 4W8AA 1X1ZA 1VC4A 1VRDA 3I6EA 4WCJA 3RDKA 5DLCA 3NWRA 4LCQA 3DFTA 3UZJA 3GTFA 2F6UA 3NDOA 1S5MA 1GKRA 4RDWA 4QS5A 1SQ7A 1OX5A 5E09A 1B1YA 4S39A 2GVGA 1OFOA 4UTWA 1H41A 3HM7A 3NAVA 3FXGA 4AY7A 1L6YA 2VEMA 1PV8A 1JD9A 3FYPA 3PR2A 3IIOA 4CQDA 1AH0A 4CNUA 3E0LA 3QMSA 3GG1A 4NT0A 1E15A 2ZICA 4WDXA 4DBWA 4LU0A 3L2MA 4WUIA 1ZJBA 5T8GA 3LM3A 5DRCA 2ZZ7A 3ARSA 3ZWTA 1JCLA 3WQ8A 2OFJA 2VZOA 4DAIA 2C14A 4HMDA 3GH7A 3VOGA 4RNJA 4MG4A 4XZLX 1GTHA 1JZ3A 3E49A 4AISA 4TMCA 1U5HA 4WQ6A 5AYIA 4B5UA 2PDPA 5GPRA 4ERGA 1SZNA 3PVFA 2B7QA 1ZBCA 1G69A 3KOXA 4HMNA 5JIPA 4WX2A 2WZMA 2PE4A 2F8QA 3WCZA 3VUSA 4TTGA 1F73A 1L0PA 3KP0A 4JY9A 1F6YA 5AN7A 3HQPA 1NTHA 3LMZA 3NQCA 3RF9A 3GUWA 1XS2A 2QMKA 1R2TA 1WOBA 4ZMGA 3MUAA 2NX3A 2ZE0A 1FBAA 5BRQA 3B04A 3V1HA 3TC6A 3QSRA 2NT1A 3S1WA 3THCA 1RHCA 2IXUA 1WKEA 4AVNA 3N9KA 2VCCA 4OHQA 2ALDA 2WHLA 5AC7A 1E1FA 2ZRZA 3PNUA 1H7XA 1H61A 4TX6A 1G6CA 1J8VA 2GJRA 3GNRA 4HSOA 3KHDA 4N4PA 3QKEA 3I3EA 4PN2A 3J7HA 4C6IA 2DIJA 1KBBA 2F84A 2XM2A 4MZYA 3GDTA 3PTQA 5CAKA 5DCBA 2J7BA 3GIQA 4DUOA 1W1IE 2R1KA 4PMRA 1SFSA 1LJYA 1VJSA 3MANA 3FN9A 3UU0A 5TD4A 1F76A 3W25A 1OK4A 3C3NA 3TEVA 2VFHA 3QLLA 1OGBA 2EG6A 3PUDA 3B8UA 1D9EA 3W2MA 2YFNA 3RITA 3OW1A 3T07A 1YIXA 3E74A 1V02A 1T6MA 2MUCA 4WSKA 2R1NA 2Y85A 4K7VA 3QQ1A 2IKGA 4PH6A 2HVOA 4G6CA 3OHIA 1ZSXA 1ODZA 3C86A 3S2MA 3AS0A 4KPLA 3WDIA 2GVLA 4K1GA 3ECQA 3GVGA 3NJ3A 2P10A 1SZEA 2XSAA 3WJYA 4HBKA 3S9YA 4LGXA 5ABEA 4XBJA 1XL9A 4ZSUA 2GOUA 1XLFA 4JNMA 4H04A 4GZJA 3VDAA 3MPGA 1Q6GA 1LRTA 4YPJA 2GQ8A 1E3ZA 4UTJA 4ZEPA 2EXOA 4IICA 3KTSA 4QROA 5CZSA 4Q8PA 1FWAC 4E8DA 2EAWA 1UC5A 2JK2A 3W7KA 4ADSA 3O63A 4EK7A 4US5A 4RK8A 1LYXA 2QV4A 3AUJA 3PF3A 1ZNNA 1S1RA 3I4EA 1J10A 1IE7C 1GCYA 2VFIA 4TTUA 1WE5A 1E9ZB 3H23A 2ZCGA 3AO0A 3L5MA 4DJEC 5DCDA 1VF8A 3VMPA 3NL2A 4JYFA 2Z2UA 5F2IA 1C3FA 1TYGA 4W8BA 1VGAA 3W7HA 1ONEA 3B8VA 1OY0A 2ATSA 2RGLA 4QJ1A 1KRAC 2E8ZA 1CENA 1B4KA 5FL1A 3LHUA 3W6YA 2NV1A 1ECQA 4GQGA 4KWOA 3ZLGA 2J78A 2XN0A 4MUZA 4OVXA 2TSYA 1AUSL 3H2FA 2REQB 1A0DA 1TTPA 1QOXA 3AWNA 4QNWA 4H7VA 1C9DA 3M0ZA 5C7VA 1QPOA 2HJPA 3MUCA 3U8GA 3W27A 1RP9A 1GVIA 3PBGA 1J5SA 3BAYA 1XLKA 4H8HA 3CHCA 3BSGA 2XINA 7TAAA 2DT0A 1PUDA 1QK2A 1DTNA 3KUMA 1V4YA 4A05A 2ZIDA 3LCXA 4E8CA 1GOWA 1PSCA 1XRTA 5DXYA 1EDTA 1A53A 3URAA 1UR2A 3KBSA 3AIEA 4ZOCA 1JCNA 3CUFA 4HNCA 3TCSA 1R2SA 5I3GA 5D05A 3CO8A 3NQEA 3SCOA 3NQ2A 1N8WA 4QE1A 1MDLA 5A6TC 5BXTA 4DNHA 3HPZA 1TIMA 1XD1A 1JFXA 1L8PA 3M0YA 1VCVA 1GQIA 4NILA 3G0UA 1X98A 3WLPA 1F3TA 2IQTA 2D20A 2HPMA 3DFYA 4DYJA 2CLLA 1CXLA 5FAJA 5LZLA 4Q8WA 3UCDA 3EDJA 4GCXA 2HDJA 2PAJA 1S3HA 2SFPA 1XM3A 1MVYA 5ABFA 1A0CA 2HTMA 3W7OA 1EUNA 2Z1VA 4KERA 1XYCA 3WQWA 2DVTA 1YPIA 1G0CA 1CXHA 4C6FA 4MNJA 5ABHA 3HGSA 1XG3A 1VFUA 4Y9OA 3WQVA 5TBOA 1O5KA 3G0XA 4L65A 4XD3A 4GH1A 3W1XA 1TTIA 2YA0A 3S9ZA 3NGJA 4DIAA 3N34A 1V51A 4NI8A 1P6CA 3AIVA 3GR7A 1K77A 1K8XA 3KLLA 5I5RA 4EAYA 5HXMA 4NX0A 4ALDA 1XFBA 1R46A 4PMZA 2CBVA 3A3WA 3GS6A 2I1OA 2ISFA 4PEEA 3ZT5A 1V0LA 3P84A 1DQWA 4JIEA 1PYMA 2PCEA 3DFOA 1LBMA 1IR1A 3PZVA 7ODCA 4RNHA 1J0YA 1V5XA 2PU0A 4PMJA 5FA5A 2CLMA 1LP6A 3H2MA 1EB3A 3QW3A 2C91A 3P7YA 4UNKA 3CAVA 3A64A 4C1KA 4EXAA 1E72M 3LGEA 4QAIA 3W7GA 4GISA 1Q63A 3UXAA 4ZB0A 2VWSA 1S5TA 2XIQA 3DH7A 4NIRA 5KZEA 3F7JA 1TUXA 3W87A 1AZ2A 3RXZA 3NDZA 3WK0A 1KXVA 4O15A 5HPOA 3MMDA 1G94A 1XGZA 3ZXWA 2QHAA 3E2VA 2QW5A 1NELA 3B8SA 1J0KA 2ZTKA 3AIWA 3S2CA 2VD8A 3GY1A 3F2CA 2VJXA 2W4XA 3GZAA 2PD9A 3M16A 3INPA 5I3JA 1UBPC 3GK0A 1O94A 4RNFA 1UUMA 1D7KA 3EWBX 4PCPA 2A3HA 3I6TA 2FFCA 4YS1A 1BPLB 1OC7A 3MV11 3SCVA 4NNBA 2OX4A 2V6AA 2BHZA 4ZQRA 2YL9A 3CEUA 3KZSA 3R8RA 4FEZA 1GTEA 1OJXA 4ORMA 4M51A 1BF6A 4CNPA 4FLOA 1EC8A 3N2CA 2PTZA 2W91A 3VFLA 1I6NA 4PMNA 4ENLA 4RXFA 2W67A 3BZJA 3A9IA 1WAWA 3BSMA 4JKKA 2A3BA 1XYMA 1K03A 3CQJA 3WJZA 3STFA 3ZSSA 3BLLA 3Q67A 2J7CA 3BZGA 1JYNA 1KCZA 2FB2A 1ZALA 5CZTA 3WZ0E 1VPQA 4TVDA 3L0KA 3IUHA 2FB3A 2YXGA 2PEVA 4IQJA 2OO6A 3I4KA 4L56A 1S2UA 5H8MA 2J9XA 3G77A 3CU2A 4H6KA 1Q8JA 3MHUA 3WFLA 3CLWA 1ZHAA 3EDEA 3VOFA 4Q8QA 2IQDA 3TX9A 1PX4A 3BQ6A 1DXIA 4PMOA 4A3RA 4GZ7A 3H22A 1QW8A 3NURA 4DJFD 5BZAA 3LI0A 1KM2A 4V1YA 3FJLA 4ES4A 2ZOXA 2PGFA 3OG3A 3W1LA 3BDKA 3AI0A 4ACYA 2CNCA 3Q94A 4YJ5A 2BFGA 4UFIA 1M04A 1KXHA 3QOMA 1TPVA 2PDHA 2EPOA 2QAFA 4OKDA 3WO8A 2O7QA 4W7UA 5CSSA 2ZC8A 3QW4B 5LIUX 2Z1XA 2VX4A 3HMJG 1XKYA 3E0WA 3I3BA 4PGLA 3OQEA 4CNNA 3N6JA 2D0HA 2FHBA 1TWIA 3DOPA 4RX0A 2E9MA 1F6KA 4B9ZA 3DFSA 4HYWA 1O5XA 3JR2A 1R3WA 2OMAA 4HSNA 1ZBWA 2VQUA 2GOKA 4MKVA 2TODA 3S6DA 1B3YA 4DBEA 4S2BA 3T81A 2OXNA 1YXYA 2VOTA 4C6DA 3KFTA 2B7NA 1K1DA 1W3IA 1WAUA 5BU9A 3QQ0A 3B9NA 1OX4A 1C8QA 5HATA 5HMDA 4S3KA 1TMLA 3DYMA 2H90A 1E5JA 2VZTA 2FZNA 3W4RA 4R7JA 1ITQA 3QGAC 4H9TA 4BZYA 2OQYA 1IHIA 3I10A 3NEHA 3CK5A 3MVTA 3ZLHA 2BGSA 1HKMA 3PZ9A 5EB8A 3W2NA 3ITCA 4HZ8A 2ZRUA 2PDNA 3VPLA 2YYUA 3VM7A 3A9BA 4XTDA 4ATDA 4BJHA 3WQGA 1CLXA 3M5ZA 1F74A 4B5WA 5LIWX 1JZ5A 4Z42C 4INFA 3GWQA 1PAMA 1U1UA 1EYWA 2QUVA 3S2JA 1OFPA 1V0MA 2Q3OA 4BHYA 2QUTA 3R79A 4OWGA 4B5NA 1E40A 4FX7A 4J3SA 4U3CA 2NVDA 1M01A 4XAFA 1PB0A 2ZDRA 4NAFA 1OABA 1EGZA 1LLOA 1LCOA 2F38A 1MXGA 2NT0A 5TQLA 2D3NA 2XGIA 2RJHA 3BJTA 1NF7A 1SJCA 1H7WA 1V3MA 3O1NA 3H7VA 5BOOA 1LLWA 3MJYA 2WJDA 3H2CA 3EWXA 4CN4A 2BOGX 2H3DA 1R3TA 5LNRA 3WUBA 1R7AA 2JEQA 3LM7A 1JPMA 5FF7A 5EPDA 4ICMA 2VEKA 4J3ZA 2CFFA 3M41A 3WY1A 5D09A 1YRRA 1HL8A 3KOFA 1C7SA 1HNYA 4P2VA 1Q65A 2YL6A 3W7EA 4JN8A 4N42A 4O1FA 3VXGA 1P48A 4PUNA 2IW0A 1MSSA 1LOLA 4Q33A 1EX1A 3RJYA 3WNLA 3TA6A 4ATWA 5F4SA 3LA4A 1XLDA 3GIPA 3PZOA 3ALGA 1T41A 1UD8A 1UW9A 1BLIA 2ZYFA 4AX7A 3UNTA 3GDKA 3P8IA 1LLZA 4JEJA 1L8NA 1UR8A 4AIEA 3RU6A 1JUEA 4E2OA 1WOAA 1M03A 3I6RA 2A4AA 4I7WA 3GNOA 6REQB 1EC7A 4E38A 5HMEA 2UV8G 1EQCA 4PTDA 1J93A 3SN1A 4M82A 1TPFA 2VFDA 4S3DA 3L4WA 3KP1A 4HMEA 3UY8A 1QNSA 1J4EA 3R2GA 3MMTA 3CASA 4HN4A 2PLMA 5HNNA 4ZODA 7XIMA 1KRMA 2XIMA 3WLOA 4I9JA 5A8PA 1QI5A 1OFRA 3IUIA 4KWWA 1KCKA 3AZTA 4CQ8A 2QIIA 2E5BA 3GXNA 5FESA 3GG0A 1JYWA 4N6EA 1AH3A 1B31A 5XINA 5CJ5A 3GHSA 3M7SA 3HV8A 5H2ZA 5F4XA 5BXSA 3BVJA 5CGQA 2J7GA 3WLRA 1P0EA 1NWRA 3EWDA 1FCVA 3SUWA 4TU1A 5KZMA 1HP5A 3MQTA 3D46A 1ITUA 2Y5JA 3KHJA 4FOUA 3DERA 4MYAA 4H1ZA 2KX9A 2FFIA 4PTMA 3F4WA 3UJSA 3CYJA 1VS1A 5BXRA 1Z89A 1XHGA 2IXVA 1KB3A 3LCLA 4DWSB 3MBFA 3WBYA 2VM8A 3HV9A 3M0VA 3QQWA 4XAGA 1A4LA 5A6BD 4XZHA 3QOKA 4GNVA 4BWLC 1T5AA 4PBEA 2J24A 1QOQA 4E0CA 1ALDA 4R27A 1VIWA 3LZ3A 5FJTA 5FJJA 3DX5A 5EBAA 2YW3A 1QPKA 2WVVB 2VD9A 3M4HA 3SRHA 4AFYA 1RALA 3NFUA 2YLLA 1Q45A 4TVUA 1NF0A 4J4KA 3U7VA 4XKYB 4LBSA 3WIJA 4ACZB 5DF0A 1XSIA 1K6AA 4A3YA 4H9VA 2OKTA 3MZ2A 4GLEA 2V82A 5CQ1A 1NARA 1G9HA 4ROQA 1IGSA 1XWYA 2XJ7A 4PUWA 1Q5MA 3KDOA 1IEIA 5K9CA 1ICQA 1H11A 2UY2A 4BF5A 2OLAA 2FGBA 1CNVA 2VVSA 4OOUA 3IVUA 1JUKA 5BW6A 4R33A 3KCLA 1TTJA 4WLCA 3PWAA 2I17A 2WM1A 4RV3A 3UJ2A 4I9TA 4LANA 4XD5A 3UYIA 5C2CA 1E71M 4GBUA 3KL3A 4U10A 4AZCA 3LLFA 4JGDA 2WNQA 2X16A 3SQSA 3WF0A 4Q8UA 2IS7A 3DBNA 2HXTA 1S3TC 1UQYA 3SB0A 5H6HA 4CN6A 1IT8A 1CZ1A 4Y2WA 3GFXA 4YTQA 3C4UA 1J6OA 5E0CA 4GK8A 2OQHA 1XLHA 1NOUA 2CCRA 1A3HA 2EQDA 3SCWA 1PS9A 2IUZA 3CJPA 4XO7A 2HNEA 3W1RA 5CPSA 1CGYA 2UY4A 1R6WA 3IJ8A 1TELA 4W87A 4IX0A 3P61A 4YYCA 2YKKA 4CU6A 4UCGA 1UMLA 1WKFA 5E0FA 3OYXA 3WH6A 3L9CA 3KL0A 4CCDA 1XLEA 3R43A 3GG8A 3CQHA 4ML9A 4GYKA 1H7OA 1W8GA 4BI6A 1H4PA 2EPMX 4HB7A 1R30A 3TN6A 3CZLA 2G5WA 3ANUA 1O12A 4MY1A 5ENLA 3B40A 4QHRA 4AQLA 4XAPA 1G4SA 1A3XA 3W82A 3VOCA 4V1XA 1T99A 1S5NA 1KXQA 2OSXA 4UTWC 3FW6A 4MTVA 3HOJA 4FK9A 1RXOB 1K70A 4O28A 1IZJA 3MYOA 4W7VA 1KCXA 4CCEA 2QCFA 1G4EA 3NQVA 3HTWA 5IDIA 4KRTA 2QCHA 3VABA 3GNNA 2XZ9A 3WD0A 3WQFA 2KAUC 2WC3A 5HJXA 1GQJA 2OZ8A 3H2NA 3GTNA 3PULA 3GG7A 4JTRA 4KGLA 4I5RA 2VR2A 3WD2A 3ZR4A 1BSLA 3G24A 4F0HA 2FPVA 1F07A 2Z2BA 3Q45A 1M68A 5T9CE 1JG9A 4XIAA 4IFKA 4EOUA 2PWUA 6REQA 5JH2A 3LS9A 3FS2A 2DZUA 2PRLA 4ZTYA 4JTSA 1TRDA 1XYZA 1OG0A 4PZVA 3AYTA 4NZ4A 1MZHA 1EGMA 5A8OA 1V6TA 3DHDA 3N2TA 4I5XA 3TYUA 3B4YA 4GUGA 3H53A 1M41A 3WL0A 1PXGA 4TO8A 3VX0A 2VDHA 2Z7KA 3E12A 3VA8A 4EXQA 2PZ0A 9XIAA 3FK4A 3MSDA 5EMUA 4DF0A 3JRKA 4IGNA 4NZJA 3SGGA 4IGMA 2A1YA 3S3GA 1CBGA 3BANA 3NM3A 4TMBA 1TPUA 4DLMA 1OK6A 4PUUA 4RXGA 3S5ZA 2A0NA 4UFHA 3ERPA 3S1XA 4O53A 4HHHA 3H7UA 1H1YA 4CN1A 1B5TA 5EYWA 3RPMA 4Y9AA 4GKTA 1E4NA 1XBYA 5A6AA 2VZUA 3FSTA 1TJRA 1XQLA 1OFAA 2VZVA 1UH2A 3MBDA 4H6RA 2HXUA 4CUCA 3TQ0A 1TR1A 3WQEA 5BOFA 1M9HA 2ZUTA 7TIMA 5FF0A 1R3VA 1E5NA 1RCQA 4AZHA 1WDDA 3CUGA 3W7LA 4TXEA 2PDKA 3LBOA 2VC7A 1UMYA 3LXCA 1TPEA 1F5ZA 5GQBA 2P1FA 3MKVA 4A22A 2Z24A 3NYZA 4Z0SA 1K6WA 4N9DA 3BOFA 2IPGA 4JN7A 4JTGA 3M6DA 1DWGM 1NFPA 3N12A 2YDSA 1Y5VA 5LHEA 1O68A 2G3FA 4OV9A 2DUZA 5TNVA 1JNDA 2NLYA 5HDRA 1G4PA 3CAQA 5A8QA 4JX5A 3C0LA 1I9CB 3K2GA 3QZEA 2E68A 3WLSA 5AHIA 3BLIA 3URNA 1JCXA 4EWJA 3PAJA 1DJIA 3IWPA 5JBEA 3SO7A 4S3FA 1XR2A 2X41A 4D6CA 2BMBA 2CKRA 5CXPA 1UWUA 3DENA 3P74A 3CWHA 5AVHA 1DQXA 1AQFA 2XH0A 3L7RA 2YX0A 1O1ZA 2BLEA 2DZVA 2G3JA 4J2MA 4A35A 2VQTA 3UD6A 1I45A 2GSEA 2BGQA 1HO4A 3MP4A 4DJEA 1HTIA 1I4NA 2J7DA 2PLJA 2CHNA 3G2GA 5FEZA 1V7YA 3ANVA 1KRBC 1D2KA 3BAJA 4UFMA 5C55A 2OOFA 1W9VA 1RCXB 4P7OA 2OODA 2PP1A 1I8JA 3OLIA 1W31A 3MUY1 4MHBA 3H8AA 3R10A 1WZLA 3KX6A 1IXOA 4J9JA 3BV4A 3OLGA 1PWMA 3PZTA 3W23A 3W37A 2D24A 2Q8XA 4GQRA 2J47A 4EE9A 3NVDA 1T8XA 4JHMA 2V5LA 4HA0A 2PTDA 1M7XA 3NL3A 1KNWA 1FQ0A 3KBJA 4MJZA 3KS5A 1GKQA 2CESA 4TQTA 4AD2A 5DN1A 2J6VA 4LAMA 1LM1A 1XIHA 1E1EA 5C54A 4H3DA 4ZENA 5FSDC 4AZBA 1WZMA 1R3QA 3AYVA 4OGZA 3CTTA 3RCMA 3U48A 1Q2RA 3BSHA 4O8AA 4HT3A 1I60A 2QJGA 2VRQA 4A29A 4QJ5B 3HG4A 1F05A 2Y61A 2J88A 1BYBA 5GJPA 4JXCA 4WGXA 2DT3A 1S1PA 1R3RA 1JVNA 4KEMA 2BOEX 3K30A 2ZX9A 3IIZA 1SW7A 2ZUVA 4OUEA 2PS2A 3IPWA 3TC3A 4MAZA 3WEOA 5FJRA 1AG1O 4Z2JA 3LV6A 1HG3A 3PNZA 3RG6A 4KCTA 4BFAA 2QCDB 4IPLA 3RMEA 1EQPA 1XP3A 4KT2A 1JPKA 3LY0A 3SQLA 4V28A 3B8DA 3CHDA 3VDCA 4UQAA 1P0KA 5FJPA 4FXRA 4DXXA 1FWDC 3R4IA 3AROA 5DY3A 5I3FA 1VEOA 2VURA 3BICA 2BB0A 2P8CA 3NOYA 1EO7A 3HB9A 3U5UA 5CH9A 1ICSA 3FHQA 2E7FA 1LWHA 3QFWA 1JDCA 3VVGA 2QXWA 2F9RA 4F0SA 4GQBA 3UW6A 3G8RA 2C0HA 4ZZ9A 4HPGA 1MMFA 3G18A 5AC8A 3TUUA 4J5NA 4IHCA 4WOQA 3SW6A 1YDNA 4O50A 2ESCA 3ALFA 1P0BA 5EFDA 2PWHA 3A21A 1LORA 3VNZA 4KEUA 4H19A 1ELSA 3W85A 3NQAA 2X09A 4J3XA 4F9JA 2E5CA 3SCSA 3GNXA 2Y6ZA 4HOWA 1QXLA 5CSYA 3WF1A 1NDWA 4NZCA 5IHRA 4X0VA 4Z1CA 3B9AA 2FHFA 2FZMA 4GVIA 4CQBA 3ZJ7A 2BP1A 4Q8TA 5ABTA 2Y62A 1ADDA 5IXEA 3GTIA 4G9PA 2CPUA 3V5CA 3E2SA 4UFKA 3E2RA 5HNRA 1HF6A 1XIFA 3SJNA 4UIOA 3EXSA 2PDCA 1YADA 4I7UA 1W5NA 3H4XA 5TIMA 3TYBA 1CGXA 1L9WA 5D2TA 3VZXA 1UUOA 3WLJA 4JEQA 3V0TA 3B8TA 2PPGA 4DM1A 2ZQ0A 4H9UA 4QLJA 3O06A 3C2RA 2FVLA 4L5ZA 1XUUA 2NQZA 5HA7A 4GJJA 3OVQA 1JGIA 5CG0A 2NVAA 4LSBA 1W1VA 5AC5A 3WJXA 1J96A 1A5CA 2DQXA 1W9XA 3BLKA 2A5HA 4L80A 5J5RA 3QF0A 4MM1A 1ZP3A 2VGIA 1QJWA 2FDMA 2F7FA 3GC2A 3MUIA 1TUFA 1J12A 4ZOEA 3PN8A 4OBTA 1B54A 4YU1A 1VZWA 4L4OA 4WZHA 3AOFA 1DJYA 3UJRA 4LYRA 4N9BA 4PFMA 3VNJA 3WF3A 4Z2IA 3VM5A 3UBPC 4GO9A 4FAMA 1H7PA 1FWTA 1Z48A 2VEFA 2TPSA 4FALA 3S5SA 1VIZA 1CX9A 3UESA 1TZ7A 3H4GA 5DMMA 4S3JA 4D1JA 3RYSA 1H2JA 2VKZG 1WPCA 2R1MA 3NPXA 3PPCA 3M6YA 4CD4A 3GXIA 2QDHA 5A1AA 4JTUA 1QNPA 3GFZA 2P53A 4FF5A 2VGGA 3CH0A 1GOOA 3EA1A 1JPIA 4IPIA 3TV8A 4YCOA 4HHPA 5HJYA 3N1AA 5MF5A 1V0NA 3R5EA 4RCXA 3LYEA 3EOUA 3W74A 3NUKA 3OIHA 3OB8A 5KSWA 4AYSA 2ZKMX 4J3WA 4QJ3B 1MQPA 1QPQA 3BE7A 4C6PA 1ZU8A 4H2HA 2A79A 4IGHA 4WDTA 4KIRA 2YGYA 3QH2A 4JNZA 1F8IA 3AC0A 2H8ZA 4C5YA 3T0DA 4AEFA 1XCFA 1QWKA 3CAKA 3OZMA 1Z9AA 2QR6A 2QUMA 4K36A 3THUA 4UTLA 1I75A 1XINA 5JBFA 3E0VA 4MAVA 1NIUA 3VINA 3SSZA 3KBNA 4Z1AA 2WSRA 1SZRA 2Y8UA 4JTIA 3RRXA 1EXBA 2FTWA 4YTRA 4HCDA 4UNLA 3QC3A 4WR3A 4F2TA 4U31A 1J0HA 2CXEA 2JFEX 3FGCB 4PMYA 5FOOA 3GH4A 1ZY9A 1XRFA 1Y5WA 3T0BA 4QR6A 2D0FA 4HU0A 4UOQA 3FNDA 2QCEA 3RUBL 3APYA 2J27A 1TIWA 4Q3MA 1QPNA 5G2HA 3MKCA 4O13A 1O7AA 5HUPA 3TH6A 5EL1A 4ZTXA 4EIVA 4MPQA 2X0YA 4MJ2A 1DTUA 3GIYA 4FNPA 4A8LA 4J40A 4GWEA 4Z2KA 2O0TA 3BLFA 4L64A 4DM2A 4MIMA 3IGXA 4GQ0A 3UR2A 2EPLX 2EGZA 3AXIA 4UZSA 2ACRA 2HE8A 4FOJA 2OYLA 4H8UA 4Q4MA 3KTXA 4J7RA 2X40A 1H62A 1B57A 2J74A 1J18A 4W93A 1CXIA 2CKSA 2PDXA 3V0UA 3GHRA 4IP7A 2V81A 4W84A 4WXYA 1KR1A 3LBCA 4RE2A 3QLDA 3MO7A 3UZWA 1YHTA 1P43A 2PURA 3K1DA 1VFMA 2C79A 1JRCA 1OC5A 3GKAA 3C2YA 4FMVA 3SEPA 4KFOA 1R9YA 4AD5A 4RPQA 4LAZA 5LNWA 1GZ1A 4OOZA 3VKDA 2OU4A 1GG0A 1RLCL 1TV5A 1BD0A 3NZ1A 1JCYA 1LUCA 4WVXA 3KE0A 4AWTA 3EX3A 1FDJA 3VDBA 2GK1A 5DEZA 1UWIA 4I8YA 1G01A 1WBJA 3H21A 3KDNA 4O57A 3SJ3A 3G6MA 5K4ZA 1OCJA 3MI2A 2FJKA 1L6FA 1KM4A 2OKOA 1FP9A 3LMYA 4KCWA 1ZL1A 5DMNA 1Z6KA 2OLHA 3L0NA 4JIHA 4Q8VA 1JZ4A 1TV4A 2VR5A 3RCYA 3NDYA 1T7LA 3T08A 1QMLA 2NSXA 5CC6A 1YNQA 4H2CA 3UXKA 5ABFB 1K7EA 3VNYA 3VTRA 2WHKA 2Y88A 4F79A 3W7JA 2TMDA 3EOLA 3W2LA 4LCSA 3STGA 4JFVA 1TR9A 4IPNB 3L4XA 3C2EA 4KRZA 1Y5XA 3L4UA 3W70A 4V33A 3PPFA 1YBQB 4OBRA 2INFA 1RP8A 1PZ0A 2I5IA 1PX3A 4X9YA 1D8CA 2WK2A 1RA0A 1QUMA 1R86A 5M03A 2R6OA 3EWUA 4HPJA 2EBNA 3BAWA 1IF2A 1KWGA 4IQEA 4IGSA 2C19A 5JQ9A 1ADSA 1TE6A 3QPYA 4S1FA 3GH5A 1WCGA 4NZ1A 4XUGA 2WANA 2V69A 3P67A 3EMZA 3EPMA 3ZSTA 4GH3A 2NQ5A 3G1RA 4JKLA 3GTXA 4K39A 4KEZA 2EG7A 2YYTA 3KS6A 4DWDA 2WJFA 2X1TA 1V77A 5IBXC 4Y6GA 2IMRA 3QC0A 1PBGA 1EIXA 4JN6A 4JS3A 5GNXA 3T8LA 3MS8A 4KEVA 2G41A 1CXKA 1EBHA 5AYBA 3NR0A 4GI9A 2XM1A 3JS3A 1FWBC 5EA9A 1W1TA 4A8NA 4L6OA 2WKJA 3TDFA 3RU8X 4AHQA 2C0AA 1SPQA 4DUVA 1VB9A 3KVMA 3BG3A 4M81A 4CCZA 4RKAA 3LSCA 4XUYA 3WDPP 1U83A 2W6RA 2DJXA 5FEXA 1JIBA 4LEQA 5HWNA 3OA5A 1Q6CA 1MO0A 2VXNA 2WQPA 2Y0FA 1ISWA 2MANA 1MWOA 3KLKA 4ADTA 4UQBA 3QPEA 4QG9A 1LRQA 4PB5A 5U7SA 3UGRA 4LS0A 2FZBA 4GFSA 3UZ5A 1ITXA 3RRAA 4ZQCA 5FSEC 5FJUA 3QMTA 1CLKA 1H09A 4FX6M 4YWSA 4ML4A 1HGYA 2BY1A 5I2UA 2A6NA 4KWSA 4UR9A 5A3HA 1XDJA 4LF2A 4POCA 4UUIA 5AC6A 1TQXA 1VFLA 3QGKC 4WKHA 3VMNA 4M1RA 1SFLA 1W0MA 4IJRA 1DKWA 3LTYA 4JNYA 1OIMA 4LFYA 3TMQA 3W1AA 2VGFA 5CLWA 3P81A 3W88A 4XZ9A 3BARA 3TSMA 3L4YA 4LYQA 1MRQA 1REQB 3CQ0A 3CH9A 3MCNA 3KCOA 1WDQA 3PBMA 3OHMB 4NQ1A 1UR9A 4C1LA 4WJEA 5G1TA 4QX4A 5H1WA 2QPUA 3KOWA 5AZ0A 1A5MC 1VCGA 1Q7QA 4PRRA 5AB3A 1GJWA 5HUOA 2DZPA 1A50A 5E5CA 1WKYA 2XIJA 5M1TA 4NYYA 2ICSA 2WW5A 5A94A 5BXPA 3ARWA 1A80A 3UGVA 1OCNA 3IJ6A 5D02A 2HPIA 3VGDA 2CW6A 2Z00A 8CGTA 4JTFA 1FP8A 1BXCA 3GM8A 3IANA 1UC4A 3BL3A 3R12A 1OF6A 3Q65A 3MY9A 1AJ2A 5CJNA 3WBWA 3RR1A 3L4ZA 5LA0A 1F3EA 3MMUA 3SI9A 3UR7A 3FAWA 2BTMA 5AECA 4ZO7A 3SIMA 3VDHA 1M65A 3AMGA 1T8QA 3N11A 4ZE5A 1VR6A 4LTSA 1E73M 4LAUA 4Q4OA 5A6KA 1K8CA 1TRIA 5I02A 5HQEA 1PEZA 4KCUA 2VFEA 4F4RA 4H6QA 3W38A 1E9IA 4EPEC 2DZWA 2HSAA 3IV3A 3KOYA 1TG7A 3MO4A 3PTDA 1LUCB 1ZCOA 1KV5A 4B15A 3HQ1A 4AC7C 3EA3A 2ACSA 4IXXA 5G2WA 3SBFA 1ODUA 5C9XA 3U0HA 3VKAA 2XIOA 3EX2A 1RJRA 2VCBA 1Z8AA 2PTXA 3P5ZA 3TSDA 4DLFA 1ECEA 2AL2A 5K4XA 4K8EA 3M9YA 4LNYA 4DY1A 4AHPA 2G3NA 4HK7A 3B05A 1BWKA 2HK0A 3LPFA 4LRSA 3TKFA 2NV2A 4D9PA 4AXKA 3S5YA 4IFOA 2VCAA 4WGHA 5GJNA 4TX9A 4E6MA 4YLWA 1DE5A 5I07A 2WSKA 2WKLA 2ADAA 4IP4A 3S46A 4LUTB 4QCFA 3PZIA 4WDUA 1VAHA 3CXOA 3TYZA 4P5UA 2GJXA 1BAGA 4DXVA 1PDZA 1EHNA 5CC7A 1ZLPA 4RZ5A 3BW3A 1XIMA 3XINA 3HGJA 1JL8A 2PBOA 4O4VA 4WY0B 3TA9A 5LA1A 4FOKA 3GDBA 1Q6OA 4G56A 4IFRA 5LGXA 4O0KA 3G3DA 2C3ZA 1OSEA 3OU8A 3NA8A 1MW2A 2QZRA 5FEPA 4KGJA 3T55A 5A6JA 4NU7A 4OUIA 3OVRA 1M5WA 5EMLA 5FEWA 3R0DA 1NH6A 3TC7A 1OYAA 2VYOA 3FVMA 1T40A 1BRLA 3QR0A 2E1WA 1C7TA 3T6CA 3CAWA 3P0XA 5CBBA 1R9XA 1XBZA 5LXEA 4R9OA 2ONEA 5D9OA 3K8LA 5CZJA 4X63A 2EG8A 2FIQA 3R89A 4X3ZA 3Q37A 1OBAA 3WQ5A 3P82A 1ISVA 4YVXA 3WDHA 1D3GA 3B9EA 1Y8BA 2P3EA 3N19B 1TZZA 3DG3A 2WCAA 2WZHA 1W9DM 3HQOA 3LK6A 7CGTA 1GONA 2G4FA 1UB3A 1US2A 4GPNA 3BTNA 3QRHA 4DEFA 4MOZA 1QTWA 1V0KA 4DUXA 4JQ3A 1EJRC 4RDVA 3NPWA 1GOIA 1A4MA 2GJXB 3OZYA 5CGMA 2QQ6A 3OZPA 4XD6A 3WLNA 3TROA 3ES8A 1RBOB 3S5NA 3MB9A 1V03A 4CU7A 1DHKA 5B7YA 2OG9A 2W9MA 4Q4SA 2DT2A 3BG5A 4PULA 3Q2DA 2OZTA 3PS7A 3TAKA 2Q02A 4NXKA 3TTSA 3EX1A 2VFFA 3P0WA 3GKFA 4DNMA 1UKSA 1MUMA 2A7PA 2XVGA 4LVFA 5C7HA 1K02A 4GX9A 2DZBA 4V15A 3ID7A 1QW7A 1N2VA 1W5MA 3ZZ1A 2ALRA 3DHPA 1KBLA 3QMRA 1W37A 1KM6A 4R88A 4BQ2A 4HKPA 1FX6A 3DAQA 1HJVA 2GQAA 2IKHA 1KD0A 4YHEA 4JDYA 5I3IA 3VE9A 4YTSA 3VNDA 2LLEA 1HKKA 1B3WA 1KWKA 3IGUA 1ISZA 4ZOAA 3UYCA 4Z1YA 1TPH1 3GAKA 3HGOA 2PWFA 1GHSA 4MDPA 3CIWA 4NKCA 3VIHA 3TTQA 2DSVA 4S3GA 2J75A 4A8IA 1VYPX 1B30A 1ZAJA 3VX1A 2CETA 5G4EA 1RLDA 3UEQA 1SZFA 1XGEA 3SCUA 3UWQA 3UQNA 3R7MA 1HW6A 4M56A 2XWEA 4QAWA 3VO0A 4I9MA 5DRIA 3WUEA 3NXLA 1OWQA 4AIBA 2RKXA 1OZMA 2XFWA 2PP0A 4HNUA 4F0RA 3LCIA 2J66A 2GSHA 4MJ4A 1BTCA 2J77A 1Z32X 3HN3A 4ORIA 2INEA 1UR1A 1ISXA 5HMSA 2QCDA 2PFHA 3CMGA 1CI1A 1LTDA 2BASA 3CZ8A 1FCBA 2RUSA 1FDZA 4K37A 1P0DA 2E3ZA 3L67A 2YCEA 3ITXA 3ITVA 4H4IA 3UXIA 1BVZA 1CGWA 2NWSA 2C1HA 3DUGA 2ZRVA 4QCEA 4MJMA 3WLLA 1B9ZA 1WKDA 3R13A 2FVKA 4MZ8A 4DYKA 5F2GA 3WSUA 1JEZA 2VVNA 3K8MA 3N9SA 4FNRA 3PTMA 4JOMA 4RJEA 5HPCA 1CECA 1A5SA 1HKWA 1Q4WA 3DC0A 1PZ1A 2BVTA 2BNJA 4BCEA 4MWAA 3D3FA 1FWNA 1FKXA 3AQUA 3GXDA 2E0PA 4YVPA 1UR4A 2E6DA 3QY6A 3AXMA 1CDGA 4P7NA 1KLYA 5BROA 3DFNA 1OD8A 4PEKA 1SW0A 1US3A 1FCQA 1Z42A 3U4FA 5LNUA 5C9ZA 3LI1A 1LL4A 3OLDA 4AZ7A 2WCSA 3AIRA 1AZ1A 2QDGA 2VO5A 1PHWA 4ZL1A 1E0XA 2YLAA 1ITCA 2ZZ2A 3OQ8A 3GBDA 3K1GA 4PODA 4V27A 3SUTA 5HR6A 3W7PA 3EWZA 1M7JA 1IQ8A 4DBSA 3R8GA 3T0TA 1FXPA 4D72A 3GXFA 4QSFA 1NOWA 1VFHA 1WZAA 2DDXA 4UCFA 4I5UA 3U9IA 2BHYA 1NSJA 4U5KA 3OIXA 4A3UA 3PUEA 1K8ZA 1NDZA 4JTEA 2WQDA 1JYVA 4RE4A 3TK7A 3U57A 1L6SA 3DZ1A 1R3SA 4E4UA 3L4TA 1DWJM 4G7FA 4AD1A 3WH9A 4JHOA 2NXGA 1KRCC 2NX1A 3UVIA 2DSZA 3QTGA 1XYLA 2YA1A 3UCQA 4DBDA 1SSGA 1Z41A 2JIWA 4MZ1A 4PFHA 2F2KA 1L2UA 3H26A 2Q09A 1E6NA 3BURA 2E9BA 1FUYA 3LHWA 4JR5A 3LU2A 4WJ8A 3WLTA 4CNTA 3B8WA 2NSOA 3C0JA 3P14A 2VUYA 3E0IA 5DT7A 1TKKA 1TX0A 6XIMA 3AWOA 4DZIA 4RR4A 4IIHA 1PVNA 2QDEA 4I6KA 2G97A 3VKKA 2X7WA 3T0AA 1TMHA 4O11A 1R5YA 2ATMA 4Q4QA 4LUJA 1PO9A 1W1B1 4OE7A 2PB1A 3CB3A 4HMCA 2ABAA 2TRSA 3B0YA 4GUIA 5KINA 1L6GA 3FYYA 4EX4A 3WDQA 4YCPA 5T9BG 1RBAA 2X1RA 4S3CA 1BWLA 2B31A 3PG8A 3E9AA 3DG6A 4LUSB 2OWWA 1O5RA 3ARYA 2D69A 1TPB1 1IYXA 4LS1A 2ZRYA 3E3HA 5J8LA 4TV6A 2RGMA 4AWEA 4PTVA 3BW2A 2JGYA 3E6EA 2G95A 3WUFA 3I65A 2MNRA 4AD0A 3SCQA 2VX6A 4JTHA 1QBBA 4XV0A 3MMWA 4Z17A 3DGRA 3LHZA 3CIXA 3S0CA 2ZUUA 5KITA 5I09A 4HK5A 2GGIA 1MW0A 2ZTJA 5A5WA 3E02A 3TW6A 2XWDA 3E2QA 4JTQA 4QSHA 3MC5A 5I03A 2JE8A 4S3AA 3MDWA 2BSLA 1PZ2A 2CYGA 1YTDA 4Q22A 4OFCA 3W7CA 2CWXA 2Y7GA 3BV7A 1FTXA 4O1AA 2ZUSA 1XFCA 5BRBA 4UZUA 3NQ6A 4XD4A 1SMDA 2BVYA 3U2OA 4DJFC 3G8EA 1SYTA 4K1WA 2PDLA 4DX3A 4W7WA 3SADA 1K9TA 2JALA 4KBXA 1U30A 2GVJA 4GIRA 4G8TA 4AIUA 1CLVA 5C9RA 1NJJA 4GYFA 4H83A 4LF1A 3A23A 1GUVA 4IOTA 5B7ZA 4BF7A 1GEQA 1E4MM 3QYQA 4NZ5A 2AL1A 4IPJA 4Q8NA 3QEZA 4NHVA 4PTWA 5A6MA 1WZKA 1XLLA 4DZ5A 3PJXA 1JZ6A 1PKLA 1XLIA 4XSLA 2BXYA 2YZ5A 3WUGA 3WD1A 2FTYA 2D3LA 4GI8A 4A4AA 2Q8ZA 6A3HA 3M0KA 1F3WA 4FZIA 3LHVA 1DWIM 5XIMA 4O0QA 3LQLA 1GQLA 2DSWA 4CEUC 2OELA 1X8FA 1PL9A 3BMXA 2X1SA 3LSBA 3VIIA 1DYSA 3U2CA 1M1BA 3AFBA 2WSQA 1MXDA 3GVQA 4RZ4A 1RY0A 2RAGA 2J9YA 1DORA 3QN3A 4XISA 4I8DA 2R9RA 2RFGA 4NZFA 4M3PA 2VTFA 3WDJA 4NZ3A 4HJWA 4NRSA 2V68A 4H9XA 3SCRA 2O9PA 4XB3A 2JQXA 3AYSA 1TCDA 1UYQA 4UMAA 4D6JA 3UZYA 1YLVA 4O1BA 4QQUA 4Y9NA 1YMYA 3Q4DA 3BLOA 2VDGA 2VI0A 4A2SA 5M17A 2TYSA 2QS8A 5JVLA 1GVYA 1XDMA 1QU4A 1GWJA 2ZA3A 4TUFA 3POHA 1B3VA 3ABZA 3HBLA 4OT7A 3O0KA 3U7BA 4I6VA 3CUHA 1KGXA 1DJHA 1XIEA 4Q6JA 4B3KA 5A95A 1YW1A 4HYVA 2PZNA 3FV9A 1WXJA 4CD7A 5LIKX 5F1UA 1J01A 3ELFA 1JI1A 4HCLA 2RDWA 2ZWZA 3TAOA 4IIDA 7REQA 3CBWA 5JH1A 4Q4KA 1RQBA 1XG4A 2CEQA 4GINA 2ZZ1A 1NOFA 3D47A 5E9XA 4FSAA 1TJ2A 1IGWA 3G5EA 3RCNA 1Q6QA 1EL3A 4NI3A 4R34A 5CG7A 2F61A 5PTDA 3W72A 3E5PA 8A3HA 4ACZA 4JYEA 4K6AA 2OX1A 2O55A 2W27A 3LZ5A 1HUVA 2YFOA 1OF8A 5AC4A 2DP3A 4C7GA 4KIEA 1IIGA 1HXJA 2XVNA 1XV8A 1P0NA 2O7SA 1OADA 2WC4A 3HG5A 3M0HA 3N2MA 1OFEA 4YXGA 1OIFA 1W56A 3A5FA 3PUGA 4XZMX 4R53A 3EOSA 1I1XA 2Y2WA 4UNIA 2Y89A 1FHDA 1ZJHA 3WNMA 1QR7A 1R9ZA 1TWZA 1Q6RA 3G6LA 4FHAA 3ZS4A 4A2RA 4FXSA 2XVLA 1FWGC 2QEZA 4W9TA 4D8LA 3UJFA 1G4TA 1EOKA 3WQDA 3QHNA 5DO8A 3LPGA 3DFQA 3MWAA 1DXEA 3CUJA 3AHVA 4U3AA 3V5FA 1J0JA 1FHVA 5C0QA 4S3EA 3HO8A 1PWLA 1DJGA 4JQ4A 2O56A 2W66A 3THQA 2QYGA 1FWFC 3B3DA 4LBRA 1PDYA 1UIOA 3TLLA 3NQBA 4H8NA 1JPDX 3V7PA 3DC8A 4DJDA 3ES7A 4GXPA 1E3XA 1C9WA 3K4WA 3R25A 4D6EA 3CHVA 4KFPA 1FWJC 2HBVA 1HKJA 4XVDA 1NP2A 2O9TA 2OWXA 7A3HA 3GNDA 3VOJA 2Y24A 1NP0A 1W8SA 5ABGA 3C61A 5FJIA 2I5QA 1W2PA 3AU6A 1SGJA 4AVFA 4LY4A 1VBUA 4PTXA 4F0KA 1UKQA 1P1MA 3QBUA 4DN1A 1VKFA 2CZEA 3L5LA 2FZ8A 1W91A 2INZA 1YE6A 2Y8KA 4UC5A 5JIWA 4EAMA 3LGGA 2P0IA 3W1PA 1V3JA 1UWSA 3DECA 3GDMA 3GLCA 4PB4A 1MRAA 3VIGA 5EMJA 4B2DD 1S5WA 2H8XA 4JPGA 5EU9A 2WAGA 3HMCA 1WB0A 1VBRA 4GGHA 4JTJA 3IJ7A 1YTKA 2YXXA 3V1PA 3FLUA 3VCNA 3TLQA 1RV8A 1MI3A 2QVHA 4ECLA 2FLIA 4XKMA 4FO4A 9RUBA 4DPQA 4H00A 3W24A 2XIBA 1V3IA 3IIXA 4HA1A 3AAMA 1I2RA 2VC9A 1W32A 3O07A 1H7RA 1HVXA 4LW7A 3QKZA 3WENA 1NFGA 3F5KA 4FNUA 4N4QA 4LBUA 3VKCA 5MKGA 3GQYA 3SY8A 3UWWA 3N4EA 4KF1A 1RBLA 5BMWA 2YA2A 2EJ1A 6PTDA 3LX9A 4M29A 2ZRXA 3ITGA 3PPHA 2WNZA 4EPBC 3UG4A 3D5HA 4YNGA 3FYOA 3AALA 1VD6A 4UQEA 3VIKA 4ICNA 1CTNA 1H49A 4CLMA 1MUCA 5LXXA 3G1VA 1KFLA 3S83A 4H6EA 4RDZA 2C6QA 3QXBA 4EF9A 4J3UA 2BXZA 2QMJA 4RW3A 1X7IA 2FGZA 4O18A 2PDWA 1A5LC 3AUOA 4Q4PA 3QY8A 1E4IA 3NCOA 4JTTA 1XLBA 3TJ4A 5E9AA 3I68A 1N8IA 2PDYA 5E1QA 3WNNA 1FH8A 2HROA 5LNSA 5G4WA 1HVQA 3BMVA 1K3UA 5IFPA 2PDMA 4GQQA 1BKSA 1C29A 2PGEA 4LVBA 4FA3A 1RVKA 4PCTA 5M3WA 2CLIA 4IG2A 2ZADA 3LTPA 5EKYA 3R94A 4WF7A 1TTQA 1BGAA 5AYXA 4UOJA 1VPYA 3XIMA 3DCPA 1SMAA 3PWIA 1N7KA 5D03A 1GOKA 1GYNA 3ZVHB 1CIUA 1UZ4A 4HNVA 1TJ0A 4BKNA 1KFJA 1J9YA 3TTOA 4XZNX 4AY1A 2NW0A 3SCNA 3THAA 5A8MA 2WO5A 1YTEA 3UZXA 2KZHA 2O9OA 3GRIA 1WBHA 1ZJIA 3GO2A 3AMDA 2ZA1A 2EHHA 3O0FA 4C90A 4HSHA 3CMJA 4IMCA 2PLKA 4E4FA 1PTGA 3UZZA 2Z0IA 4RDYA 4GVFA 4L1WA 3ITYA 4LPCA 1UH4A 2DT1A 3VI2A 1IWBA 2G50A 3BCDA 2C13A 4KCVA 4QDMA 4IMAA 3HG2A 3OBEA 1UJQA 2IKIA 4JFUA 1EUAA 3APTA 1TSIA 1GZGA 3TWAA 3WFZA 2W92A 4QTGA 1X96A 2J9ZA 3LHTA 1HJQA 2F6KA 4NP7A 3EOOA 3LD5A 4UTTA 4LB3A 4US6A 4TOQA 3WBXA 2R14A 3UPMA 5CBIA 3PANA 1S2AA 3LTSA 1MYRA 4LB4A 2GGJA 4LXFA 3A12A 3OODA 3MHGA 1MXSA 1BTMA 4WSHA 3PSVA 3WD3A 2Q6ZA 3L65A 1O5QA 1BQGA 1QNQA 3GTHA 3NIYA 4REQA 2QPSA 4C1NA 7REQB 1HJXA 2A3EA 1H51A 4F9DA 3EYPA 1SO5A 2G3IA 3M47A 3MP3A 3S2NA 2VC5A 5G1YA 5KEZA 1VBHA 4MWAD 1A5BA 1JCTA 3K4DA 1I2OA 1S5VA 5IM51 1EIBA 3T44A 2Z1BA 3OYZA 2AQOA 1XPYA 4JBRA 1JYXA 3KAOA 1F6PA 3TONA 3F4CA 5EGRA 1KFKA 2DEPA 4JCLA 2IPFA 1DIEA 1RPKA 3S6OA 2O9RA 4E8GA 1RK5A 3MSYA 1Q6LA 4GNKB 2XG9A 3UA3A 3GB6A 4NAEB 1BF2A 2A7NA 3A4XA 1GVFA 1HKIA 3QZ6A 2FGLA 2J79A 4MGGA 3W83A 2ZZ4A 5DBTA 1KW1A 3TQPA 2CHRA 1U5VA 3FA3A 5LA2A 5L9FA 3A5VA 1GVQA 1XDLA 3L0GA 4AX6A 3GHUA 2JKEA 1LQ0A 4MLJA 2AOSA 1CGTA 1UG6A 4BI7A 2V5KA 4FIRA 4I7VA 1Y0EA 3NO5A 1AQMA 1Q85A 5D32A 1UUQA 3D0CA 2VELA 4NL1A 4KFNA 1ME7A 5D2WA 4GNJA 4ZXOA 3I7SA 2DW7A 3MI6A 4KS0A 3V0SA 1UIPA 4L6HA 9XIMA 4O12A 3EXTA 3LUTA 1JPHA 1UOKA 2Q8LA 3TN5A 3EDFA 1IEXA 1OZQA 2J62A 2YB1A 3WQCA 4DI9A 1BRLB 3PB0A 2P76A 4GHRA 3UWEA 3PFMA 4IPPA 1FKWA 4D6GA 1UP0A 4KETA 4PYSA 1DXFA 2PC8A 1B3XA 1ZUAX 2AQVA 2DVUA 4JAWA 3S1VA 5BWAA 1X6NA 1QDSA 2PC4A 2PMQA 3ISIX 3TP4A 1TA3A 4A21A 1XIGA 1JDEA 4GYPA 4PE8A 3A4AA 3D6NA 1CEOA 1QK0A 3EDDA 4ICCX 3OBKA 3QSTA 2DZAA 1UKTA 1GEHA 1YEYA 2CBIA 3CQKA 1PTDA 1IXQA 4XSMA 2PDJA 3DXIA 3I7RA 1K8YA 4O0ZA 4NG3A 3A24A 4QRNA 3DFPA 1XLMA 1GPWA 4OZOA 3MA8A 3FEQA 1X1OA 2VEIA 1PKMA 4PSPA 3QGVA 3TJIA 3VNIA 1PTAA 1GVOA 3TTEA 3O9NA 3UETA 1MEIA 1X38A 3CLMA 1EBGA 3UT0A 2V2CA 4PMUA 1W1ZA 3WQOA 4ZVJA 1RJPA 3ABQA 4LV9A 2I5GA 3HPFA 4GX8A 4YN5A 3ARZA 1QO5A 3GXTA 3UWUA 3VIJA 4C7DA 1JZ8A 1HFBA 1EH9A 4Q4RA 1RSCA 3M64A 4GFIA 1JR1A 3ZR5A 1I2NA 1P4CA 2CLHA 1JRBA 4LQ1A 2BBFA 1UWQA 4E3VA 1KCLA 2OGYA 1A0EA 1E6PA 1VENA 5A8GA 7PTDA 2X30A 1VCFA 2BZNA 3NL6A 1AL8A 3GD6A 4GUHA 2ZZ3A 2Y5EA 3DG7A 3TOYA 1W54A 3R58A 3W53A 1M3UA 1H0GA 5CPNA 2YJQA 4UTTC 3ZLFA 2G4JA 1GOQA 3NSMA 4B5SA 4MB1A 3O6CA 1K9FA 3VE7A 4MY8A 2PDBA 3EWCA 1UQZA 3T78A 1XCWA 2FJUB 5M2FX 3KRUA 3W22A 2WSYA 3JU2A 3N2OA 5DANA 3CV1A 3VCCA 1V08A 3LCWA 2I16A 3UFYA 3BW4A 2GPTA 2C16A 1LG2A 2QT3A 4DZHA 2PDGA 3ARUA 1FFQA 1M6JA 2E4TA 3PZQA 3PFRA 3POCA 3LEPA 3UF9A 3WLMA 4IL0A 2I14A 3EXRA 3VK5A 3RX3A 3NO3A 4PR4A 2VX5A 2CZVA 5TF0A 1EJXC 1EHAA 4UQDA 3TTYA 2XH7A 3TU9A 1H1NA 1E6RA 3WYZA 5HULA 4K38A 8RUCA 2WXDM 4WKFA 1THFD 1DWHM 1ZENA 1QO2A 1FVPA 1VHNA 5JU6A 1B2YA 4JYDA 2PD5A 1W9BM 3O6DA 3TW7A 4L4PA 1GVRA 3IARA 3ITLA 4O1CA 1H50A 1Q7ZA 3WK3A 3VNLA 2ASHA 3UP8A 5BCAA 4BQ3A 1W6TA 2V67A 2D2OA 1GOMA 3LERA 2P8BA 1TWSA 1MQRA 4AIOA 2QJHA 4NRRA 5BWFA 9CGTA 2HS6A 4KKXA 4WOZA 4MWAB 1MNZA 5GJMA 4HPHA 4PCSA 3ITTA 1PIGA 3EA2A 3EX6A 3GXPA 1K9EA 3QZAA 1XYBA 3S1UA 2REQA 4QEHA 5HNUA 3FJNA 3FKKA 3MJMA 2V5BA 3WLHA 1KGWA 3IIVA 3CPRA 2XH2A 3W9ZA 3AIBA 4WD0A 2C18A 4K68A 2EPHA 3WMCA 3L21A 1A49A 1BG9A 4JFSA 3VU2A 3CHFA 4IUGA 1F8MA 2Q3RA 4M6UA 1VFTA 1HN1A 4GJ1A 3IJ9A 4O8RA 3G1DA 5D8ZA 4NJJA 4GACA 1DJZA 4W85A 1QI2A 3H7RA 3OO2A 2EKGA 1R0MA 1CGVA 3PBVA 1KKOA 4PC8A 1P7TB 1ZP4A 3O3RA 1RJQA 1PIIA 3G1XA 3NQGA 5CSRA 4AEEA 3EOEA 3GE7A 3GVWA 4QFUA 3UG8A 4YTTA 4NAFB 1POJA 4IIGA 3FXYA 2W5FA 1EA9C 3MCMA 1X7FA 1KGUA 1E0WA 2XFRA 3C2VA 5EFFA 1RD5A 2XVKA 4RV8A 5CPQA 2V5CA 4EANA 4UTHA 8TIMA 1UKOA 3T2QA 4Z0JA 4HHMA 3MW7A 2ISWA 3RLGA 2OT1A 4X0NA 3EGJA 5EMMA 2AMXA 1WYIA 2VT0A 3W07A 3W01A 2XYLA 1Z7AA 2VL4A 4LNCA 3AS2A 4ERAA 5LGZA 3LBMA 3LV5A 4ZCWA 1QAPA 5BYWA 3LOTA 2VOMA 4PSRA 1Y65A 4MFEA 4JQ2A 5REQB 3U6WA 3FA4A 3HURA 4LS2A 4MADA 2Z27A 2VEGA 1SZGA 1DP0A 1WO2A 2YBUA 2V2DA 1R8LA 3GHTA 3ONBA 2OLSA 4QGCA 2RDUA 4HD5A 5BOEA 3NPUA 1K7XA 4GVHA 4IFKB 3UWYA 4QIUA 4J3VA 3LLXA 4LWWA 1HGWA 2YDQA 2C71A 3PY2A 3RFAA 1QI0A 5E70A 4C6JA 3BLPX 4AUBA 2X8RA 4M6PA 2PF8A 5I3KA 3PAOA 5D9NA 3PG9A 1F4HA 3D3AA 3N04A 3KWXA 4PBGA 2E6AA 2Q71A 5D37A 1NDYA 3AJXA 1K9DA 1EEPA 3COTA 2RHGA 2QF8A 4H01A 2RJGA 2V0TA 1TWWA 3G1FA 3VZYA 1QHZA 1GK8A 4HNTA 2JF7A 3WK2A 1OHLA 2XIIA 1FRBA 1UZHA 5AHFA 1YNYA 1RQEA 1XIJA 3LNMA 1DJWA 3R8HA 2DH2A 4GMEA 2ZBTA 3VC6A 1JDDA 2CZ5A 4DJFA 4F8XA 3N14A 2PDFA 2Q01A 3O7UA 4CD8A 4MFDA 1U1HA 3QY7A 3AMCA 1XD0A 1QPRA 3GFYA 4UR7A 5D2VA 3UERA 1NWUA 4GC3A 4GXMA 3H2OA 4XZWA 1FH9A 4AG0A 1HP4A 2I7GA 4OBSA 3WN6A 3VIMA 6XIAA 3WELA 3KVKA 3BLDA 5KZDA 3VIFA 4QDWA 5A69A 1U5JA 3W00A 2HWGA 1VEMA 3TNBA 1YPXA 3F2DA 1BG4A 3BJSA 2XN1A 4C6MA 2E9LA 3R6IA 2JIEA 5FF3A 4CQAA 3SR7A 4UBPC 3ATYA 3C8FA 1XIDA 3M1ZA 1Q66A 3ABOA 1WA3A 1X6UA 3RLUA 1XCXA 2WNNA 3EBVA 4HU8A 1I1WA 4M6QA 1HT6A 2NUYA 2BODX 1EEXA 3GAYA 3GYCA 1UWAA 3SZ8A 3PJUA 1RA5A 5U4NA 4REQB 3EMQA 4HVXA 3EMCA 4QJ4B 1E1CB 2WM0A 2YOCA 3LGDA 1ZJAA 4PMVA 2D2HA 1H0IA 1B3OA 1BXNA 4D2JA 3W71A 1V3KA 1CB7B 1W3LA 3MU7A 2ZX8A 1UJPA 5EMYA 3NNTA 1HJUA 4JIPA 4JIRA 2PCQA 1UR3M 2GGEA 4Z1DA 3W2JA 1XLCA 5CCZA 4HA3A 2WMIA 2CLKA 2VRKA 4IH3A 1QI3A 3NQ8A 2ZX6A 2XGZA 4AF0B 3UWVA 3E0FA 1EGVA 3U2ZA 6TAAA 5I7GA 1KTCA 5G5IA 5JXQA 3R0KA 2R1PA 4F66A 1DV7A 4JIIX 1UASA 4HTYA 3O15A 4A3HA 3WDRA 3CT2A 4MNLA 4UOZA 2Y8VA 1V6WA 1QWGA 4H9ZA 4GY7A 2GVEA 2FH6A 3FY1A 4DWSD 1OVDA 1IWAA 5JMUA 4WKAA 5F4WA 5HAOA 3TYCA 3V36A 3WF4A 5I00A 3WEMA 2JKPA 1XC6A 4PL2A 3P60A 3V35A 3TFXA 3V75A 1ZBVA 1N82A 2AKMA 1AH4A 2VDIA 4DHGA 2D0GA 1JNEA 5K3VA 3WBEA 2OSWA 2HE5A 2VX7A 1A5KC 1AA1B 3SCTA 3SRDA 3NTYA 3LPPA 4IUOA 3SUUA 1GQKA 3KM8A 3GVVA 4XBKA 3UXDA 4H7ZA 2ACQA 5MKGB 1MW3A 1E4LA 3APGA 4PBFA 2WPGA 4X60A 2PTYA 3F4VA 4IQLA 2GZXA 3TXZA 1QW9A 1HO1A 2UY3A 3SAZA 3N29A 3O8AA 1VRXA 5IDZA 3CPUA 3S8HA 1YKWA 3EPNA 2XH4A 3NVTA 1VFFA 1VFOA 2ACUA 3K13A 1KFEA 4AD3A 2HISA 4YL2A 1UD2A 3PBWA 5AKQA 4PCNA 3UG3A 4NY2A 4B91A 1R3YA 4M7SA 3W75A 2GDVA 4H7CA 4DELA 1GJPA 1SFJA 2E1DA 2I56A 4KRUA 3C5QA 1JCMP 4QS6A 3W7RA 5CPLA 4BQ5A 1EFZA 2PA6A 3IACA 3W2KA 1BGGA 4NF7A 4DUWA 1YDOA 1JXKA 1IZKA 3WH5A 4D6DA 1FCUA 3B0UX 4KWVA 3QFEA 3L4VA 1V3HA 1YDVA 1U33A 1GYMA 3L12A 2ZUWA 2FMNA 3ARTA 3T1GA 4ONVA 3IJQA 4NXSA 4HU4A 1KFCA 1QNRA 2XISA