3ONBA

Bond breakage and relocation of a covalently bound bromine of idd594 in a complex with har t113a mutant after extensive radiation dose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Radiation damage reveals promising interaction position
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 102
structure length 311
sequence length 311
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3onbA00
2F38A 5HNUA 4XZMX 1PWLA 1R38A 2HE5A 1AZ1A 3GHSA 4IJRA 2A79A 3MB9A 3V0UA 3WG6A 5AZ1A 2FZDA 3H7UA 3COTA 1MI3A 1QRQA 2IKIA 4JTDA 3U2CA 1Z89A 4WGHA 3BUVA 4GABA 4H7CA 3R7MA 1ZSXA 2INZA 3CV6A 4JIIX 3ONBA 4XZLX 4L1XA 4JTCA 4XVEA 1LWIA 2PD5A 3R8GA 4JTRA 2NVCA 3R6IA 1EF3A 4WEVX 2IPFA 3V35A 2HVNA 4DBSA 4HBKA 2PDWA 1S1RA 1OG6A 4YVVA 2HEJA 3DN5A 2PDQA 1X96A 5AZ0A 1IHIA 3UZYA 4JQ4A 2IQDA 2CLPA 3LENA 2QXWA 5M2FX 4GACA 2HVOA 5LIYX 4Q7BA 1SM9A 2IQ0A 2ACRA 3LUTA 1X97A 2PDLA 4QBXA 1T40A 1LQAA 3RX4A 4WDUA 3O3RA 3FX4A 1M9HA 4DBUA 1XGDA 1K8CA 4EXAA 1Q5MA 2PDBA 3BCJA 3LBOA 4LB3A 4L1WA 5LIUX 4QXIA 2FVLA 1UR3M 1ZUAX 2HE8A 1PWMA 2HV5A 3FJNA 4ZFCA 4QR6A 2IPJA 2PZNA 3WBYA 4MHBA 4FALA 3UGRA 3UFYA 4PRRA 3V36A 2PDCA 4DBWA 1XJBA 3CV7A 4XO7A 2R24A 2INEA 4I5XA 2I17A 3CMFA 3WBWA 1PZ1A 4IGSA 2PFHA 3O0KA 3UYIA 4GQGA 1EKOA 2FZ9A 4YVXA 2BP1A 2PDPA 1AH4A 3QKZA 4GCAA 3EB4A 1RY8A 5HNTA 3V0SA 4LAZA 4GQ0A 4JQAA 3CAVA 4YS1A 1VBJA 4QX4A 4XZNX 4AUBA 3LQGA 1YNPA 3S3GA 5KETA 2IS7A 2PDMA 3LZ5A 1S2AA 1YE4A 4XAPA 1S2CA 2BGSA 3UZXA 1A80A 4H8NA 2PDNA 1VP5A 1AH3A 4GIEA 3WBXA 1C9WA 3D3FA 4LAUA 3F7JA 2DUXA 1AZ2A 4FAMA 1ZQ5A 3V0TA 4FZIA 2BGQA 1HW6A 4JIRA 1Q13A 3ONCA 3DOPA 2DUZA 2ACQA 4G5DA 4RPQA 2IKHA 3LZ3A 4WDWA 2IKGA 1FRBA 5DANA 4FA3A 2VDGA 3WCZA 2WZMA 3CASA 3LQLA 1PYFA 2FGBA 2I16A 2NVDA 2PD9A 3BV7A 3RX2A 3ERPA 2HDJA 4F40A 3T42A 4XO6A 2ALRA 3EAUA 1MZRA 3UZWA 2ACUA 1RALA 1XF0A 1HQTA 3KRBA 2C91A 4DZ5A 5C7HA 3UWEA 3G5EA 4WRHA 2PDKA 1AFSA 4PUUA 1Z8AA 1MRQA 4JTQA 1YNQA 2IPGA 4ASTA 3R94A 4PUWA 4OTKA 2IKJA 2FZBA 1Z9AA 3B3DA 4JIHA 3N2TA 1IEIA 2PDYA 3RX3A 1US0A 3UP8A 5LIKX 3R43A 5LIXX 3GHTA 1GVEA 3NTYA 3Q67A 5HA7A 2PDUA 4JQ1A 3C3UA 2F2KA 3G1RA 3R8HA 2PDHA 5JH1A 1QWKA 3VXGA 2R9RA 4XK2A 3LNMA 3P2VA 3EB3A 4HMNA 4Q3MA 4YVPA 4LBSA 3M0IA 4R9OA 3LN3A 2PF8A 3Q65A 3CAQA 4JQ3A 4JQ2A 1S1PA 3M4HA 3N6QA 2ACSA 1ADSA 4YU1A 3M64A 1AH0A 2WZTA 4JTAA 4ICCX 2ISFA 2PDXA 2DV0A 4EXBA 3H7RA 1J96A 3BURA 2PEVA 2P5NA 3GUGA 2PDJA 4XZIA 3H4GA 2PDFA 4PR4A 3LD5A 3LEPA 4XZHA 3UZZA 2PDGA 1JEZA 3GHUA 4GA8A 2PDIA 4XVDA 1RY0A 4PMJA 1ZGDA 1Z3NA 3UG8A 1EL3A 4NKCA 4LB4A 2J8TA 3MC5A 3R58A 4PRTA 2IPWA 1T41A 1X98A 3GHRA 1EXBA 2FZ8A 1PZ0A 4WDXA 2AGTA 5LIWX 4IJCA 4LBRA 4WDTA 1YE6A 5JH2A
chains in the Genus database with same CATH superfamily
3VOHA 1P43A 3AZSA 2EEXA 1GVSA 1YYAA 4OUEA 4IM4A 3ATYA 2V3GA 4HOWA 3IVTA 1BRLA 4CVUA 3OVGA 2RHGA 2FVMA 2J4GA 3O8AA 3E1F1 3AALA 1A4LA 3TZNA 1Y5VA 5IDIA 2FZDA 3R13A 4NJKA 4HCDA 2OT1A 4RPPA 3WKZA 3KVKA 3LI1A 4HTYA 2JF7A 1DWHM 4PEEA 1PL9A 4D71A 4QM1A 3L4TA 1QI0A 4EAMA 5AHNA 3NAVA 3WD3A 4QJ4B 3NFUA 1TVNA 1W5QA 4INFA 4XVEA 4F3HA 1UMYA 4JNZA 4O1AA 3T55A 3GKAA 4IIDA 4TU1A 1WPCA 1KM2A 4IG2B 4RDYA 1W17A 4HNOA 3V7PA 5A94A 1J6PA 1QOPA 4M8UA 5A5WA 1LL7A 2NX3A 1FCUA 1OGSA 2J6XA 1W2VA 4GMEA 3BTNA 4IP7A 2X05A 1E6SM 1ZPTA 4A21A 4R3UA 3B03A 3TYZA 1KLZA 3OBAA 2WMFA 4B5TA 1EC9A 4A8IA 1W1YA 1LJYA 4C6JA 4WGXA 4CD7A 3IJ8A 2DGAA 4XSMA 2E0PA 1K8CA 1QHOA 2TSYA 3ITXA 2PDBA 5FIPA 3AOFA 5I6SA 3P62A 2BSLA 2OVLA 3WFZA 4AZBA 4UOQA 3TCEA 2FJKA 5D9OA 3VC5A 2GK1A 4PSPA 1R30A 2CBVA 2RJGA 1UA7A 3EDFA 2J7CA 3QMSA 2TODA 4K36A 1IZCA 4S3BA 1IGWA 5EMMA 2J77A 3RLHA 4S39A 5U7SA 1I45A 3E0FA 3V36A 3WQFA 2WOQA 2HXTA 4FMVA 4Q4KA 3FS2A 1JCXA 1EH9A 2TAAA 3LGDA 2REQA 3B4YA 5DMNA 4KRUA 3BLKA 4PUEA 2BY3A 2XHYA 1LG2A 3BAJA 4ZQRA 5HMEA 2V9DA 4LFYA 3MP4A 3P6LA 2FZ9A 4Y9NA 4WQ6A 4BCEA 4GRSA 5U4NA 5BU9A 3C2FA 4L6DA 3CLMA 3SN4A 4K8GA 1F6YA 4M6QA 4Y96A 2CFFA 1B30A 4FS9A 2GJRA 2DZSA 1UMLA 3LQGA 5A6BD 1EQCA 5D9PA 5A69A 5IFTA 3IPWA 4KFPA 4GUFA 1BTCA 3AYVA 1MW3A 3S83A 3SADA 3EX1A 3DFPA 2P8CA 1UWQA 2DP3A 2RDXA 3T1GA 3LHTA 3NNTA 3DGRA 3PZOA 2FVKA 5CZKA 4PTDA 3GNNA 2O55A 3W1TA 1R0MA 4Y6GA 3QR0A 4C1NB 4FAMA 3PBGA 3VUSA 1ZQ5A 4UTIA 4XTIA 2GGIA 1XC6A 2EJ1A 2VFHA 2PPGA 1CXIA 2CEQA 1NSJA 1EJSC 3AAMA 5CGQA 4FA3A 3ZR5A 1SPQA 2GVLA 4O14A 1AQ0A 3L4WA 1IT8A 2RGMA 3UVIA 3ZOAA 1TPH1 1CBGA 5CJNA 1EWDA 4RXGA 4D6EA 2ZRVA 2WXDM 3R89A 1RD6A 2OGYA 9XIAA 4PCSA 2HWGA 1GZJA 3SFKA 4IFRA 5GNZA 1GKRA 2GGGA 4BS0A 4FNTA 1LP6A 4MIMA 2FB3A 2VZUA 1UD4A 5J8LA 1P0EA 4W85A 2WSPA 4Q8QA 1XS2A 1CDGA 1DIOA 1CGXA 5EU9A 3DFTA 4PN2A 4HSHA 2XIOA 3AZRA 4B9ZA 3KZSA 4UR9A 4PFHA 1E1CB 3TWAA 1TV4A 4XUYA 5LIKX 4F0KA 2BNJA 3A22A 3MTWA 4P8VA 5LIXX 4PMQA 2C3ZA 3GHTA 1QR7A 2GDVA 3U7BA 4DJEC 3C2EA 4PEKA 1OB0A 4CNOA 4XAYA 3W2JA 3QPEA 5I7GA 3B9AA 2VQTA 1H49A 3KVJA 1I2RA 4DN1A 4XK2A 1OM0A 1XLFA 4RNIA 3RMEA 3Q58A 4BK9A 5G2IA 4C6BA 4CNTA 3B05A 1M6JA 1OT1A 3HOJA 1EUAA 1KKOA 3H54A 3V5OA 1IWPA 4IMCA 3W1LA 4RE2A 4A4AA 1TA3A 3S5OA 1UOKA 1TX0A 2NSOA 1HL8A 4IUOA 1JULA 1FWIC 4GJIA 1EZ2A 1H50A 4PB3A 4JN8A 2WNQA 3OZPA 4LCQA 3QHMA 1KKRA 3NDYA 1VC4A 4ICCX 2HK1A 2E09A 2GL5A 2YDAA 2Z7GA 4GCXA 5HMSA 3AXIA 3GXNA 4QG9A 1K7EA 4RK8A 5CQ1A 5IHRA 1LCOA 3KTXA 5CSYA 1RK6A 4C5YA 5FJPA 4IXXA 3DYPA 2DQWA 5KEZA 3UWYA 3LD5A 2GSJA 3LCXA 2WMHA 3OVQA 3L2MA 4NZ5A 4FB7A 4I3GA 3W9ZA 3E5BA 3P0XA 3DENA 4QISA 1XL9A 1ZGDA 3I3EA 4LVGA 4DM1A 4NXKA 4YLWA 3LXCA 1UUQA 4M80A 3TH6A 1J79A 3GM8A 3B0UX 1MW0A 2WBKA 4H9YA 2FZ8A 2PGRA 3K13A 1G9HA 5L9FA 1UOZA 4WDTA 3U5YA 1TV7A 1XYMA 3H2MA 1XXXA 3GKFA 3W53A 3QGVA 4ALDA 1FWEC 3TJLA 1TZZA 4GZJA 4LUSA 3U3HA 4DF1A 1R38A 1AZ1A 2ZE3A 3OA5A 3NL5A 4HU8A 1FVPA 2G97A 3HU7A 4ZO7A 1LUCB 1AW5A 3WF3A 4KCTA 3TSDA 3P8JA 3UF9A 2XN0A 3DHFA 1DE5A 5LHFA 3NZGA 2ZVRA 1W3IA 2DVUA 3Q4DA 2G37A 1DOSA 1YQ2A 4REQB 5DT5A 2ONEA 3NPUA 1TYGA 1N8IA 3R6IA 4WEVX 2O9RA 1LWJA 1L6FA 3CT7A 1E55A 3FSTA 1HJQA 3IGSA 1HJVA 3SN0A 1LG1A 3CUGA 4FPSA 1A4MA 4RV8A 3WDRA 4DJDA 1ZBKA 3DU0A 4OKDA 1Q65A 3TTEA 2XFRA 1X97A 4M0XA 3M0JA 3VINA 3CTLA 1E1FA 2VZSA 4ATDA 2PLCA 3MKVA 5XINA 3FX4A 3DG6A 3QLDA 2OOGA 1J0KA 1FCQA 2P76A 3BWWA 5CC5A 3WQ4A 2WJEA 1GHRA 2DJLA 3W1RA 3CXOA 1R7OA 1CXKA 3PTKA 1L9WA 5DX7A 3ZVIA 1D7FA 5K4XA 3PJUA 1F3TA 4HNNA 4JYFA 4R53A 5I78A 5HANA 3WLTA 4G1KA 3PR2A 3F4CA 1H7RA 2D20A 3B8SA 4CNPA 2YL5A 1TTQA 3CL7A 1GPFA 3THCA 3PBUA 4IIGA 1GVRA 3HG3A 2BWGA 4R7WA 3CIVA 1GVYA 2CBJA 1E73M 1FDYA 3CMJA 4H9VA 3BDKA 4CUCA 4NASA 1A5BA 3M5XA 2PFHA 4CVWA 1IGSA 1R85A 1ICSA 2BFGA 3VIHA 2PC8A 3ABRA 4HHPA 3TWBA 2Y6ZA 3VCRA 4NY2A 3DCPA 3K30A 4E2DA 2XFWA 3TX9A 3MUAA 3EMZA 2ZFAA 3BE7A 1XRFA 3T4CA 2DT0A 1DHKA 1H1ZA 2DFAA 3TA9A 3C2VA 2OXNA 4OUIA 9CGTA 4CCEA 2GJPA 3B0VC 1GOKA 3F4VA 5AC7A 4WY0F 3QC3A 3CT2A 3M0VA 1SR0A 5DF0A 1WDQA 2DU2A 3UXKA 3W7DA 4JPGA 1P7TB 4FF7A 5I3GA 2WJDA 5E6ZA 3W75A 2V38A 2ZRWA 1OFBA 3PZVA 3POHA 3WNMA 1SW0A 1OVDA 1AODA 2DQXA 3S0CA 1FP9A 3CASA 2V5JA 3AJ7A 3RRXA 2Z1BA 2VT0A 1S5VA 4HNCA 4UFHA 2OQYA 1AW1A 2X0SA 2D2OA 3WMBA 2E6YA 3WD2A 2NV2A 3HG5A 3LCIA 2Z4GA 3AWOA 2ZTKA 3EA2A 3MBDA 4AY7A 3QYSA 3TQVA 2DY3A 1PZ3A 3IK4A 1H7XA 4L4OA 3IIZA 3QRHA 1DEDA 4KGJA 4BHYA 2VMFA 4PFMA 1W9PA 1VPQA 1V7YA 3B8DA 4HOZA 4ASTA 1MEHA 2ZA3A 1RBOB 2O7QA 4OT7A 3W3OA 1GTEA 3N2OA 3VIOA 2WSYA 3THDA 4JHOA 4HHMA 1CYGA 2CESA 5T9CE 1FUYA 4XQ6A 1NELA 2Y7GA 4WHBA 4GXWA 1NEYA 5JBFA 1GQLA 2X42A 3NTYA 3Q67A 3ANUA 3VGHA 5CBIA 3KRSA 2FHCA 4CN4A 3W6LA 4YTQA 3O2LA 2H6RA 1ODUA 3TV8A 3QM3A 4GY0A 3RMJA 3AZTA 2WMIA 1B54A 8CGTA 3VNMA 3VU2A 1GHSA 4Z2JA 5AYZA 2OLAA 2PWGA 3QTGA 1G5AA 1VLWA 3CUJA 4Y9MA 3QW4B 2BY1A 2VFEA 1UJQA 4MB5A 1Q8JA 1ADOA 4H9ZA 2ZE0A 2WVVB 4S38A 1DBTA 1GOQA 4UFIA 1UR8A 5BWFA 1E72M 1H60A 5C2XA 4YU1A 1NDVA 1BVZA 2V3EA 1R7AA 4RZBA 2PDXA 3EWDA 4UQBA 2EQDA 3AIVA 4DO4A 4TX8A 4AY1A 4EXQA 3XIMA 3OBEA 2EJAA 4ZR8A 1V93A 1W3TA 1VH7A 1J0HA 3W7GA 3W88A 1KBBA 1U5HA 4DWSD 3O15A 3P82A 2OTDA 4M29A 4IMGA 3PC0A 3TC7A 5IBXA 1WXJA 3MV01 5EBUA 1DYSA 1E9ZB 4IOTA 5A6BA 1JJKA 3GLCA 1VD6A 1UR1A 3DUGA 1TCDA 2YSWA 1WKEA 1PIIA 4MG4A 2HXUA 5E0CA 3AMGA 5LZLA 2F2HA 1SJCA 1E0VA 1Q6RA 2WNWA 1XLJA 2CBIA 3TYDA 4DBEA 3MB9A 4YXGA 4PCFA 1BWVA 1XIDA 4NL1A 1MYRA 2OLSA 3O6CA 1S5NA 1HKVA 5HDRA 3W24A 2QJHA 3TJIA 3WK2A 5MKGA 4LF2A 1E6RA 4D6CA 5C2GA 2E6FA 3IS4A 4JTTA 1TCMA 2EG8A 4TX6A 1EDQA 3STEA 1UUOA 1V0KA 1EBHA 3CUFA 4EPDC 3N29A 2FHFA 1IXPA 3EOUA 1TKKA 2MNRA 4AWSA 2WNNA 4HQVA 2QUMA 4Z1DA 1JQVA 3L5LA 1A5CA 2E6AA 5M2FX 1FY6A 3BGGA 4DYJA 2VFGA 3QJAA 4HKPA 2HS8A 4OBSA 3S1WA 3PNUA 3A47A 3NO5A 3UXAA 5E70A 1RQEA 2VC6A 4GZIA 3GBEA 4Y7EA 2DVTA 2DT3A 1VBHA 1TQJA 2E9MA 2OO6A 1J5TA 1M53A 5F4WA 1E5JA 1I0BA 1U22A 1RK5A 1XLEA 3BCJA 4NZJA 5DBUA 5G4HC 1QPNA 1ME7A 4KF1A 3LA4A 2HE8A 4P61A 1SSDA 3ZT5A 2VZVA 4Q8TA 1EC8A 1HP4A 2XWDA 3ICJA 2IPJA 3EBVA 1TPUA 3O9NA 4OECA 4B5NA 1M7JA 4OGZA 4UQAA 4S3JA 3M0MA 1A5LC 1SZFA 2Y7FA 4PMXA 5CZTA 1EYEA 2FTYA 2ISWA 5TQLA 3PWIA 4NT0A 1EIBA 2DIEA 1SJAA 3QQ1A 4FOKA 3IIPA 2X8RA 5GQBA 5KZMA 3TMQA 5K9DA 1DKWA 3GXDA 5A8NA 1VHNA 3GW0A 1OIMA 2ZUSA 3FEMA 3EPNA 2GDQA 1RY8A 1ZS2A 2C18A 5FAGA 4GFIA 5H2ZA 4AUBA 3TNBA 5D2WA 1C8YA 4AIBA 5FEWA 1HKJA 3G1XA 2GPTA 5AOUA 4ZFMA 3WDHA 3FOKA 3S3GA 1KD0A 3RYSA 1N2VA 4JX5A 5EBAA 3IANA 3TIMA 4JTIA 3BSGA 1YXDA 2XVGA 3GFZA 2OZ8A 1JZ6A 3RITA 4LGXA 3VGEA 3IUIA 1J18A 1DORA 3SJNA 2QUTA 4YCPA 2B7PA 3PBWA 4JHMA 3SCWA 4Z42C 3OOQA 2R1MA 2EXOA 3KFTA 3CO4A 1V3IA 3WY1A 1M1BA 1CI1A 3EPMA 5CZ0A 3T07A 3WDQA 3DOPA 2Y61A 4DO7A 1EJUC 1TWDA 5FJRA 1SZNA 4QHRA 3WELA 5CC3A 3B9EA 4EWJA 3H24A 1IWAA 1Q66A 4XBJA 2FIQA 3B04A 5JU6A 2Y0FA 3FGCA 2QCLA 4WSHA 2JF6A 4C6MA 4G7FA 3POCA 4AEEA 4MZYA 2V30A 1H61A 3ERPA 2HDJA 3C8FA 4D1JA 1QAPA 3GXFA 5G2WA 2W62A 3BZJA 1FWNA 3IJLA 3T40A 3RLVA 5FKYA 1WP6A 4HNTA 2ZX5A 3RHGA 1KFCA 2ACUA 1YPFA 1JAEA 3VCCA 4PMDA 3VD4A 1ITQA 2PRHA 2YFNA 3UWEA 1UH2A 4HSNA 1K03A 2PODA 3BAWA 1FXPA 3W4RA 4CKQA 4DLFA 4QS5A 3W7PA 4DEFA 2NUYA 3BSHA 1X7FA 3W0KA 1TPWA 2FZBA 3OJGA 4ZGYA 1FWCC 5TNVA 1JCLA 4AVNA 2VEFA 5FF4A 2G5WA 3N9RA 3L4ZA 3BJFA 2VVSA 1TPC1 4N7QA 1FWFC 3T0BA 3MYPA 2PDUA 4F0MA 4S2BA 1PUDA 2BHUA 2OB3A 4W9TA 4FHAA 1TJRA 1QWKA 1AMKA 2X40A 4G9PA 1U5JA 1SR9A 2XH0A 5FJOA 3CIWA 3L7RA 1VBGA 3P7YA 3MV11 1FH7A 4MSSA 2VKZG 4GISA 3KL5A 2YOCA 4O8RA 2BVDA 3OGRA 3GE7A 4JCLA 1OBAA 1CGVA 1M7PA 1TWZA 3G24A 3L23A 3W6MA 1W1VA 4R27A 3M64A 2XGIA 2CZ5A 4H04A 3S5ZA 2EPLX 4D6IA 2ISFA 3LK6A 2AAMA 3QW3A 1NP2A 4GXPA 3I4EA 5AHIA 5TF0A 3VUPA 3M46A 2XWEA 4AXKA 2ADAA 2RDWA 4D6GA 4QSHA 3U2EA 1IE7C 3HZ3A 4IFKB 4FXRA 1PKLA 3U4AA 5AHMA 1RY0A 1X7IA 1NARA 4K8HA 1V5XA 5C9UA 3MZNA 1AA1B 4Z1YA 3KAOA 4NG3A 1KBKA 5T8GA 1X98A 3WUBA 5IFPA 2PWFA 3BAXA 1QOXA 1JYWA 1O66A 3G6MA 2AGTA 3PJXA 3FHQA 1SU5A 3M0XA 3ZSSA 2YDQA 4ZOAA 1XH0A 4X2RA 5HULA 4R33A 3BH4A 2OMAA 2AL2B 4GXMA 4WKFA 5AYBA 3B0YA 2DSUA 3PJTA 1K9EA 1GWJA 3VVGA 1XGZA 3COTA 4IL2A 1KBIA 3E0IA 2BB0A 4BA0A 2W27A 3VOFA 1VCFA 4A3QA 2V5CA 4WGHA 2HMCA 2RKXA 1W6TA 3CV6A 3W84A 1RVKA 4A3HA 4IICA 1H4PA 1LWIA 2PD5A 3REQB 4F2UA 1DTUA 1QHPA 4DZAA 3G3MA 1QU4A 1VBRA 1LL6A 3SQMA 2PDWA 1PTDA 1G4TA 3SM0A 3SCQA 3WD1A 4NAEA 3PFMA 1K7XA 1ZZMA 4ICNA 4R7JA 4IT1A 5KITA 1NM9A 1KBJA 5G5IA 1SM9A 2A2IA 3BOLA 4QE5A 2DUAA 1E6XM 3ZXWA 2Z0IA 5JXQA 4ZEPA 1OZMA 3RX4A 4XKMA 2VFFA 4G56A 3N6HA 3VOIA 3LG3A 1GKPA 3HQOA 3O3RA 3TROA 4DBUA 1EJTC 2WC7A 1EP1A 2YXXA 2CERA 3TN4A 1K9FA 2Y5SA 3TXZA 1AQMA 1K9DA 3C8NA 1RCOB 3II1A 4LU0A 4MAVA 3AC0A 1OFRA 2FVLA 3MPGA 1ISVA 4ZFCA 4GVHA 1JZ2A 3GB6A 1MMFA 5HMDA 1YPIA 3DFYA 1QCWA 1XV8A 2QT3A 4WK9A 3E6EA 4NAFB 3GVGA 3CB3A 4NUWA 4Z17A 3NQ8A 3BCDA 1K8YA 4D8LA 4IPNB 4PMOA 5E9AA 2JBMA 3CMFA 1XYAA 5B7ZA 5HAOA 3EX2A 4JR5A 4WR3A 3S5SA 1YRRA 3JW7A 2VD9A 2JE8A 4OHQA 2XIQA 3RGTA 1EKOA 5E93A 3A24A 3N9SA 1H7PA 4TTUA 1UD6A 1NFGA 3BJTA 2WZIA 4AIUA 1IXQA 4DPPA 2PMQA 2OKOA 1T96A 1WBJA 5HJYA 3O6DA 1ZU8A 2A3BA 5DXXA 2DZWA 6TAAA 3QKEA 3NWRA 4FSAA 3AMKA 1EGVA 5AC5A 1JXKA 1EC7A 1WDDA 1E56A 1N8FA 3BLOA 1WNOA 2D2JA 5ECVA 3VI2A 3WFAA 3LCWA 3OZOA 3ABZA 4DWSA 1DJNA 1BYDA 3PAJA 2IW0A 3AIQA 3STGA 4FXJA 2JGYA 1HW6A 2YBUA 1TZ9A 1H7OA 2FGLA 4DJED 4LVBA 1XIFA 1HIZA 1UKSA 2IKHA 2QJGA 3CUIA 3E12A 4WDWA 2ZTJA 3TZFA 3KCJA 3A4AA 3DHUA 3E3HA 1EZWA 4O12A 1UW9A 4NZCA 4B5WA 3SW6A 3RX2A 1J6OA 3WDJA 4NRRA 3NXFA 3T05A 3B8IA 4FEZA 3G8EA 5EYWA 3EAUA 3LSBA 1MZRA 4X0VA 3EWXA 3EWUA 3TSMA 4H19A 5I3FA 1I2QA 1V6XA 2X1SA 3AIEA 1HQTA 2POTA 1IEQA 2NQJA 2HPIA 1B3XA 1MWOA 2HJPA 4WRHA 3ITGA 5ABHA 4GZ7A 4C1KA 4W88A 4F48A 5CPSA 4A8LA 3GS6A 2WVTA 2A1YA 1HJUA 4N02A 3NSXA 4MJMA 3BPWA 4OBTA 3AWNA 2DZPA 2PSNA 4HN4A 1SFTA 1S5MA 5E6YA 2V81A 2DZBA 3G0UA 1PTAA 1Q7MA 1UG6A 7PTDA 1CENA 1WAUA 2O9PA 5EFDA 3KEHA 1P6BA 1WZKA 2D1ZA 4N9CA 4PMYA 5I5RA 4QGCA 3T09A 3SB0A 1HVXA 2R9RA 2J24A 3W73A 2EGZA 3SQSA 3TN6A 3CS2A 3PK7A 1TRIA 2P3EA 4LVAA 2BGNE 2ZZ2A 3EOLA 3IK2A 2B7QA 1VEPA 4H01A 4EP8C 1V03A 2PWEA 2D2GA 5CPTA 4F0LA 1J2WA 3N3TA 3CWNA 3LN3A 3OU8A 1GUVA 4E4PA 4JFWA 3F5LA 4ZCWA 5CPOA 3K1DA 1T0OA 4C6KA 2WCAA 3M0ZA 3BQ5A 3WMLA 3PWGA 1ZAIA 1QNQA 5C8BB 3SN1A 3W70A 3GH5A 3IJ9A 4HJWA 2OYMA 2E7FA 1XLKA 4XWUA 1KM1A 3LXAA 4C6NA 4ES4A 1JQXA 1OFOA 4WXZA 2E40A 3I6EA 5DMLA 4H3DA 2WWCA 3WLLA 4TIMA 4WSKA 1X6NA 2YL6A 4W7UA 3C0LA 1R3TA 1PX8A 3MBFA 4G1NA 4XZ9A 3VMOA 4GKTA 4E4UA 4QROA 3EEGA 3QFWA 2PDIA 3AHYA 4LRTA 1PKNA 3WMCA 7REQB 3WF2A 4Y8EA 3RCYA 3EDKA 2QF8A 3WNLA 3U0HA 2W9MA 1C90A 3GHRA 4RNFA 1E43A 1HF6A 4FNPA 1DWFM 3H8AA 4J2PA 3OB8A 5E1QA 3SAZA 1EXBA 4WKHA 5LIWX 1OC7A 2FH6A 1F6PA 1UZDA 1DIDA 2PP3A 1QBAA 1YE6A 5JH2A 4MM1A 5AB3A 1XR2A 5D33A 3KOXA 4ML4A 4P8WA 3SI9A 3MO4A 4J2MA 2XIJA 1B4KA 5BCAA 1P0DA 4B91A 3ITOA 2VURA 1CIUA 3F2CA 2INFA 4NXSA 4UFKA 1QRQA 2IKIA 3U2CA 4L6HA 4X9YA 1TRDA 2XVKA 1XIBA 3VNIA 2ZKMX 3VNJA 2B81A 4HA4A 1GYLA 2ON3A 3GK0A 4ADUA 4MNJA 4MZ1A 3RNDA 1KM4A 4DF0A 1PBGA 2YLLA 1OWQA 3GR4A 1LOLA 1O6IA 2YXOA 4PMVA 1VFTA 1S38A 4ERGA 1CXHA 1KW1A 3OA3A 2BXYA 3WLOA 4CQBA 1IHIA 2FKPA 2PTZA 3FJLA 2IQDA 3ID7A 4GACA 3RUBL 3B97A 3NYZA 2VR5A 3WH8A 1AW2A 2AQOA 4C65A 3KUMA 3GQYA 4JDBA 1MW2A 4BI7A 3A64A 2WHKA 2D0GA 5C71A 3C4UA 2NV1A 1K8ZA 1R3SA 4WJ8A 3WIJA 4GY7A 4TO8A 1X6LA 2QGYA 1UASA 1OGBA 3S1UA 2VDIA 3WJSA 3WQ6A 1K6AA 2Z25A 1UD5A 2PTWA 3WNNA 1I4NA 5LKYA 5D2TA 3YPIA 4GY1A 3W2NA 1UJPA 1ZUAX 3WQ5A 1KFBA 4QSFA 1D3HA 1DJIA 1JDAA 3TKFA 3G3DA 1WCGA 5IBXC 4O1EA 3ZWTA 3L21A 4US5D 4MHBA 5FD0A 1NJJA 3UGRA 4WIWA 4PRRA 1HL9A 2QCMA 1BSLA 1HGYA 2F8QA 1OJXA 4ILSA 4DY1A 2CW6A 4IPIA 2JKEA 4JX6A 3EWYA 2C16A 2WYSA 4D72A 1TE6A 2A0NA 1OFAA 3LYEA 3NPWA 4MLRA 3UG5A 2BP1A 3QKZA 3WD4A 4MZ8A 4R9XA 4LAZA 4GQ0A 4I8DA 4YS1A 3UG3A 6REQA 1TPVA 4HPJA 2ZIDA 3GTIA 3GIQA 1A3XA 3ME3A 5JBDA 5EMJA 4D9PA 1ONRA 4IISA 2X2GA 2PGWA 4KEMA 5C9WA 1EUNA 5DELA 4AMAA 4S3FA 4KFOA 1QPKA 1VBUA 1VJIA 3VNZA 3NPXA 1I60A 3UJFA 3QEZA 3ZVHB 2HCVA 3E49A 3NGJA 1A53A 2IUZA 2GUBA 3MDWA 1Q13A 2IXUA 3W7NA 3ONCA 1YKWA 1V3KA 3XINA 1JYNA 4H9UA 3SRHA 3GDLA 1FRBA 1OIFA 3KTCA 5IHSA 2V0TA 2WZMA 1YIXA 2Z6IA 5AY7A 1JCTA 4IP5A 1R3YA 4FIRA 3B8TA 1LQ2A 3CZEA 3ZYZA 4BY3A 1XGEA 3APTA 2D73A 4RR4A 4AVFA 1Q8AA 5CGTA 3NL2A 3ZM8A 4NNBA 2CETA 4XG1A 2Y8VA 2Q71A 4KWUA 2WHMA 3H7VA 4W93A 2ODOA 1OZQA 1DXFA 3ISIX 3VIJA 4HZ6A 4A3RA 5A6TC 4R7OA 1WXZA 4QG8A 5FSDC 3ARUA 4QEEA 4DJFD 3A21A 3UWVA 4CEUC 2OT0A 4ZL1A 3VD9A 4GIYA 4LRSA 3UR2A 3SRKA 2EG7A 4PUWA 3LPPA 4AD5A 3NSMA 4WJXA 3LXBA 1EPVA 1KV5A 2NUWA 3KOWA 3T8QA 1HO4A 2XDFA 4AZGA 3CJPA 4AXNA 4M56A 1XI3A 3R12A 3FYOA 2NV9A 1OEPA 5FL1A 5I03A 1W37A 2XM2A 3WEMA 3CQIA 3EXSA 4W5ZA 1Z6KA 4JBRA 3A5VA 3GG1A 3WLRA 2XVNA 1S2VA 3AS0A 3LCLA 3G1RA 2ZZ3A 1HFBA 1DQWA 3VXGA 1JZ4A 1CB2A 2QVNA 5BRPA 1WBHA 4Q8NA 1UC5A 3F4WA 2XH7A 3VK5A 4QE1A 3LMZA 1EFZA 5GNXA 1JGIA 5DBTA 1MO0A 4G8TA 3QPYA 2R82A 1NU5A 1Z41A 3W1NA 4ZB0A 3BOXA 4DQWA 2GVEA 3PUGA 1O5KA 1XDJA 3PBYA 4F9JA 3KW3A 3BC9A 3ALGA 3KVLA 3ZO9A 2GQAA 2X2YA 4HT3A 3TTYA 3WJWA 3W37A 4L5ZA 2Q6ZA 3QPZA 3W1UA 3M41A 3LTPA 1XSJA 3BMWA 5LNVA 1KR0A 1KXQA 5K4ZA 1V02A 4I6VA 1BSIA 1XWYA 1QW8A 3W7HA 4GUJA 5D04C 4U3AA 3C3NA 2JKAA 4PR4A 2PDFA 5K9XA 4O1DA 3BAKA 1UA3A 3UJRA 1KM5A 2DW7A 3CEUA 4NJGA 2PU1A 1VB9A 3R11A 4PMJA 5H6HA 2WCGA 4BKNA 3IJDA 3BJSA 3N13A 2XYLA 4RV3A 1OCNA 2QGHA 2OQHA 3AROA 4KCWA 2GFTA 4WY0B 1VKFA 1OCQA 3WDPP 6A3HA 2NXGA 3LHWA 1A47A 5I07A 2KX9A 1OF6A 2EPMX 3SJ3A 2BXZA 3PPGA 1QVBA 1CCWB 2YKKA 2YW3A 3OHMB 1CLVA 1SVDA 3TSBA 4BWLA 1JPIA 3TA6A 5K7JA 5I00A 4DJEA 1WOBA 4DXXA 4GABA 3OBKA 4FX7A 3VKDA 1UWRA 2P3ZA 1JRBA 1AD1A 3E2SA 2CHNA 1KGXA 4HPNA 3HQPA 4OQVA 4MFDA 2ZVIA 2VX6A 3H22A 1VRXA 5KTLA 4C6EA 5FCZA 2WMGA 4XKYB 2HVNA 1SZGA 2C7FA 2EF9A 1EOMA 3W2UA 4E6MA 1WKFA 3LCFA 2H8ZA 3BG5A 3OG3A 4RW5A 2Y62A 3M9YA 4FXFA 5D37A 5HK4A 4Q7BA 1W91A 2DSWA 3VIGA 1T7LA 1VENA 4AC1X 1BRLB 5LGXA 4KEZA 5F1VA 5XIMA 1VFUA 1ZAHA 1S39A 4JTFA 2V2CA 1LUCA 1W2PA 4HJFA 5JUVA 4LF1A 1V79A 3IIOA 1H5YA 4H83A 4HYWA 3NO3A 1O60A 1Q5MA 3T44A 3NEVA 4G7EA 2V5LA 3R79A 2JEPA 4OBRA 1K70A 3MHUA 4RNJA 2FFIA 1EP3A 3QY8A 2HV5A 1TUFA 4DUVA 3TTQA 3VX1A 2Y8KA 2BVTA 5TIMA 2BXVA 1TQXA 4PB5A 3S1GA 2QV5A 3CH9A 1WKDA 1A5MC 3GH7A 1DWJM 3JU2A 2FTWA 3T7VA 3CV7A 5BNKA 3RDKA 2EKCA 4NYUA 3V3WA 4E2VA 1PSCA 1PZ1A 3XISA 2OR2A 5LYRA 4V2XA 3SEPA 3H23A 3LB0A 3EB4A 3ZT6A 3W2LA 3SUVA 4J9JA 2TRSA 5DRCA 2OZ0A 1VBJA 3FLUA 5AFDA 1S5TA 4JTGA 1HX0A 1WXYA 4MWAC 4GC3A 2XH4A 2DZAA 2FDSA 2GK1B 1F3WA 2WZHA 3L0NA 4EF9A 4XAPA 1Y5WA 2DZVA 5TAOA 3UZXA 2J8GA 1R2RA 4JIQA 4UB9A 2G3IA 1M41A 3GFXA 4C6IA 4PODA 1TVLA 3BLFA 1UPMB 1UP3A 1W1A1 3CQJA 4B9YA 1J4EA 1POKA 3L0GA 4JIEA 2REQB 4H6EA 4EACA 2F7FA 1H0GA 3B9DA 1E9YB 3N4EA 2ZZ1A 5AYYA 1TPB1 4G5DA 5I02A 1R87A 1GG0A 3UWUA 3WUEA 1ZHAA 3VOGA 1RP9A 4B5SA 1W5NA 2QCGA 1Z42A 1FA2A 5FJJA 6PTDA 3OVRA 3BV7A 4ZQMA 3UZ5A 1XCXA 4J3ZA 2QUNA 3QFEA 4WD0A 2GVJA 4S23A 3T42A 4HN8A 3WNOA 4U2ZA 2VEMA 1IIGA 4JDYA 2VTFA 4HA3A 3HMJG 2Z1KA 3DHDA 1GVOA 4PCPA 3AICA 4ZQNA 2WJFA 2GOUA 3FIGA 1ZTVA 1FBAA 2H90A 3CTTA 4DZ5A 1GW1A 1FDZA 4GO9A 4DYEA 6ALDA 5JBEA 3P5ZA 2IPGA 3PF3A 4YIWA 5ENLA 1IQ8A 3QV6A 1N7KA 4FLRA 4ZMGA 1Q45A 1S2WA 1YXYA 3UVAA 1QXLA 1JG9A 1PIFA 1YDNA 3ZIZA 1IEIA 3H12A 1US0A 4EPKA 3RK8A 3R0KA 2VI0A 5CPLA 2NSXA 1AK5A 1LLOA 3C61A 1WKYA 3C2OA 1SO6A 3H53A 3H26A 3UA3A 2NQ5A 2FPVA 2F2KA 4O11A 1TWIA 1L6WA 3PZ9A 5BWAA 5JMUA 5HMFA 4Z2KA 3ALFA 3DERA 1IF2A 3U7VA 2WCSA 3WYZA 2NW0A 5B80A 4C90A 3WQOA 2PF8A 3MWCA 3WBEA 4MY8A 4K1GA 4XAGA 4AIEA 3CV2A 4UOJA 1TSIA 4DWSC 1DXEA 4JQ3A 1G69A 4X22A 3VD7A 3BLEA 4F2BA 3SCRA 2OZ3A 4US5A 4RZ6A 1ADSA 3EPOA 4JHZA 3A12A 4CD8A 4J3VA 3RR4A 2DV0A 3MDUA 5CH9A 4MFEA 4B4FA 3CWOX 4E2OA 1R3RA 3KOFA 4RE3A 5K9CA 2XH2A 3AIUA 3NO1A 2PGEA 2V3DA 1SQ7A 4ACZA 4FP1A 5FF3A 3GVQA 4BEQA 4YN5A 4PMZA 1A0DA 2ZRYA 3APYA 4P2VA 4HD5A 1P5BA 3DFHA 1TX2A 4DZHA 1EL3A 7TIMA 3E2VA 1V51A 4X63A 1TA3B 4QQUA 5EKYA 3MC5A 4YTSA 1ZLPA 4OOZA 4XTDA 5C7VA 2D22A 4AZCA 3S47A 4GH1A 4IQJA 1D8CA 1NF0A 2V5KA 3ITVA 1TV3A 4GGHA 4LBRA 4C1LA 4DWDA 2QPXA 4LSBA 5EMLA 2VRQA 4MMWA 4UBPC 1EEXA 2QJMA 2NLYA 4J7RA 1GG1A 5GJPA 3M1ZA 3DAQA 4A35A 1KM3A 2WANA 1Q4WA 2G8ZA 1TPEA 5A8QA 5I2UA 1KBLA 3UCCA 2DSZA 3NDOA 1NOWA 4O50A 4AHQA 4O54A 2Y63A 4WKAA 4LYKA 2FPTA 5CAHA 2GQ3A 1EOKA 2INZA 4ZA0A 4XD5A 1L0PA 4L1XA 1XIHA 3B06A 1YEYA 5A2AA 4JTRA 4PL2A 4U5KA 2VC9A 4UCGA 3MHFA 1T5AA 1KFWA 1CLKA 1X8FA 3P5YA 1S1RA 1G6CA 3UCQA 3ARRA 4GKLA 1BEUA 1W9VA 1W3NA 1W1TA 4JTJA 5EFFA 4GNKB 1QFEA 1XLCA 3QY7A 4NSBA 2QHAA 2ZRZA 4DHGA 2HS6A 2YCLA 4LUSB 1XPYA 3PZUA 4RJEA 4QDWA 4LYPA 1GOIA 2PE4A 1RHCA 1LQAA 4QDMA 4H9XA 5HPOA 2Z2BA 1TFVA 1UYQA 1VLIA 1RCQA 4L4LA 4DO6A 3HTWA 3GU2A 3CPUA 1LF1A 3U2OA 4YHEA 1AJ0A 4ZB5A 1VQTA 1W3HA 3AXMA 3BARA 4RDVA 1KFEA 1PO9A 2VYOA 3H70A 1PKYA 3R1ZA 3R2GA 1EBGA 3BLPX 3SCOA 5DN1A 2R94A 2ZDRA 1KCZA 3UR7A 1R9XA 4CU8A 5CC7A 3OZYA 1HKWA 4AG0A 2YGYA 1Z48A 4E8DA 5E0KA 2O0TA 1I2PA 3T2PA 3HB9A 1J9YA 4UQ9A 5AYIA 3GUWA 5JQ9A 3AXHA 2JGQA 2PRLA 4E8CA 1SMAA 2OEJA 1W56A 5HNRA 1TWSA 2DSKA 4PA8A 1XYLA 5H8UA 1FXQA 4UNKA 3GNOA 4XIAA 3UY7A 3NZPA 1AH4A 3MUCA 5RUBA 2E5DA 3H2FA 4GCAA 4QIUA 1OSEA 3GTFA 1ISXA 4AD2A 2PTXA 4YYFA 1ZALA 4QCFA 4GQQA 3TW7A 4L64A 5J5DA 3TOYA 3W7CA 3BAYA 3P61A 5EMYA 5HQEA 4HU3A 3BG9A 4ACYA 4KPLA 1FWAC 1H1NA 2Q3RA 1GYMA 3B9OA 4UTFA 3H2NA 2JIEA 4S3KA 3AISA 4EAYA 2XU2A 2ZUTA 2VEGA 4OJYA 5AYXA 2BY2A 3SUUA 3T0TA 3DYOA 4LVDA 4YTTA 1PX3A 2EG6A 4D1IA 3QZEA 5KMYA 1MNSA 4N0RA 3TYUA 2E67A 3FHAA 3WENA 4WJEA 1ZBWA 2X7WA 1EJVC 4W5UA 2BGQA 5FESA 2OQLA 4HK7A 3LGEA 2XZ7A 3C0QA 1QO5A 5FEXA 4Z1BA 4H2HA 4ZQOA 4NNCA 2G50A 5F2MA 3WL0A 2ZUWA 4N9BA 3S46A 3ECQA 3OODA 2V69A 2PI6A 1DJWA 3DECA 4D8ZA 3G18A 1Z32X 1C7SA 2QUUA 4F0RA 1ZJIA 4NRSA 1MQQA 1RUSA 4H6QA 4J3SA 3VM7A 3CB8A 1XIMA 2V5DA 2V5BA 4JXCA 3SRFA 2BBFA 5HXMA 3A6OA 4O15A 3CHEA 3E0VA 4ROPA 3AFBA 1RP8A 2X0HA 2VVNA 1BXNA 4MUPA 1YNQA 4MJZA 1LQ0A 3AUOA 2GZXA 4PRWA 2YBVA 1KCKA 3RILA 5AVHA 1Q7ZA 3FKRA 3AU2A 4UTUA 3WH9A 4DM2A 4DNHA 1V3MA 3CZKA 1LRTA 3L4YA 3R43A 2WM1A 2NUXA 1S2TA 1Q6EA 2QS8A 1VFSA 1JPHA 1B4EA 1I1XA 1LRQA 3CH0A 2BHYA 1YBQA 3TONA 2I5IA 1TREA 3M44A 1UH4A 4IGHA 5HPCA 4K6AA 3KXQA 4TVUA 3S42A 3KRUA 3FN9A 4HOXA 4KERA 2Y89A 3E74A 3P84A 2WW5A 3DC0A 3EB3A 2CKSA 2WLZA 2YA0A 2J66A 1EJ7L 4V28A 5EA9A 1UZ4A 3GZAA 4XBSA 1TUXA 3ZJ8A 4GZEA 3W07A 5I09A 3AHZA 4NI3A 1A3WA 5DCBA 2F9RA 2CLOA 3UWWA 1JYXA 3E38A 4AWTA 3LLFA 1C93A 4K3ZA 4B5UA 2H9AA 4ONVA 1D2KA 3W7IA 1IT7A 4EX4A 3CK5A 1E4IA 3IAQA 4QNWA 4EXBA 2NXHA 3E0WA 2VUNA 1EX5A 3G1HA 3FVDA 3EX6A 1EHAA 3GH4A 2E25A 3C52A 3HPFA 3RG6A 1WX0A 1M3UA 1C91A 2WQPA 4FO4A 5H8MA 4OV9A 2WMIB 3MU7A 2QCEA 4XZHA 3UZZA 2XJ7A 2PDGA 2WO5A 4BEUA 2AQWA 4CQDA 2DEPA 4O13A 7XIMA 2PTYA 2C79A 3TYAA 3G0XA 4P7QA 2B4GA 4E3TA 1XIEA 3W7JA 1HP5A 2C0HA 3T78A 2ZUMA 3AYSA 1LBLA 3KP0A 3VKJA 4W89A 2XIBA 4UFMA 4ADTA 1BFNA 5D05A 3LGGA 2A7PA 3HPXA 3TUUA 5GVJA 5AHFA 3I6RA 1XYCA 2YYTA 1TMQA 4JNMA 1FHDA 4I7VA 1FH8A 5IOBA 2P88A 4K7YA 3GZ3A 1I1WA 3WO8A 3WJYA 3D47A 3GVRA 5BZAA 3T8LA 3QN3A 4I9JA 4P7NA 4A8RA 3H7UA 3LHVA 3VE9A 2R1PA 3SCPA 1MI3A 2VX7A 3OLGA 3ITLA 2UBPC 1FKXA 1XIGA 3W2KA 4NQ1A 1OABA 4O28A 2G41A 1R6WA 3R8GA 2VCAA 4MB3A 1KQZA 4PBEA 5K3VA 1EF3A 1EDGA 1V02E 1KM0A 3MO7A 1UKPA 4B5XA 1B9ZA 5D30A 1V7AA 3P80A 1ODZA 1F4AA 4ML9A 2PTDA 3I10A 4W8LA 1JGMA 1F73A 1W32A 4JFUA 4KCUA 3PBMA 3P0WA 4GO8A 2IQ0A 5JIPA 1QNOA 2ACRA 3TNOA 1RJRA 4EIVA 1P6CA 1RJQA 2OSWA 3U6WA 3CAKA 5C9ZA 1T8XA 5TD4A 4M1RA 4ZODA 2PURA 2E5CA 3RAOA 3EWCA 2PCEA 5MKGB 4RE4A 3W27A 3VOJA 3V4BA 4ZTXA 3LBOA 5C9XA 3HPSA 3TVAA 4IX2A 3KWSA 5HOSA 1GORA 4IQDA 2FPYA 5D8ZA 3FJNA 4IZGA 2C1HA 1IT0A 3FJ4A 3VKKA 2FYMA 3WK1A 4MPKA 3W1XA 5FACA 5CGMA 4NNAA 3OPSA 1RBLA 5CBBA 1TIWA 2QUVA 3N4AA 4S3EA 1K02A 2JIWA 1QO2A 3TYCA 4DX3A 2W91A 4N9EA 3VTRA 4Z1CA 1SO4A 2YXGA 3O0KA 3UYIA 4OVXA 3FAXA 4PTWA 4L4MA 1R46A 4FNSA 1FHUA 3FW6A 4LAOA 5F7UA 4RX0A 1HG3A 5HNTA 3UNDA 1O5QA 3KX6A 4BWLC 1TTIA 2XM1A 5DXYA 2QCHA 1RXOB 4XD6A 1YE4A 1TG7A 3BLDA 3F4NA 1A80A 5CJ5A 4H8NA 5BXSA 1VP5A 3NOEA 3KHDA 3AS2A 4JCMA 2VGFA 3V18A 4YHGA 4NP7A 4JZ5A 3BXWA 4OIFA 1TR9A 3AYTA 3KBSA 4PUMA 4UFJA 1ZJHA 4E3VA 2GUYA 5DCEA 1LLWA 1FWTA 1JZ3A 1TMHA 1TELA 4A2RA 1RVGA 2WC4A 5REQA 4B3LA 2J8FA 4L56A 4ZVJA 1E6QM 2G4FA 4IL0A 1ESWA 5T91A 1PYFA 3UPWA 1HNYA 2ZZ5A 1TR1A 1VFOA 2FZMA 4GLEA 1IZKA 4XB3A 1HT6A 3W76A 3BG3A 1ZNNA 3FDKA 2YDRA 1C29A 1QK2A 4KEUA 4Y8FA 1VYPX 1FWJC 1J01A 2J62A 3F03K 3UYCA 3TAOA 5C7HA 2PB1A 3S2MA 2BODX 2JQXA 4UMCA 4HP5A 4PUUA 4UMBA 3EKZA 1VJZA 3R94A 3GD6A 3TDFA 4HA0A 4F0HA 3V16A 2RGLA 3TOPA 3N2TA 1D7KA 2JEQA 5AVNA 3QMRA 4ZQPA 4MLJA 5I3HA 5LA2A 3FGCB 8TIMA 4U5IA 1FWDC 4Y9OA 1GVEA 3M0LA 5E0FA 3TJXA 3W25A 2ZX8A 4ZQCA 4UQEA 4I9AA 1BAGA 3KS6A 3WF1A 3DFQA 2PRMA 1PB0A 4J5NA 2WNZA 1FWHC 2NX9A 1PEZA 2PCQA 3M07A 3T0AA 5LXXA 1BVWA 1CZ1A 4E38A 2ZRXA 4B2DD 1CX9A 4HPXA 1RAKA 1OT2A 1XLMA 1V4YA 4W87A 3FEQA 1JPDX 3OLIA 3VD5A 2QCDA 1W8SA 2XN2A 4LY8A 1J2BA 1UPPA 2PWDA 4LT9A 3M4HA 5HR7A 2D0FA 2XVLA 4XZBA 3I4KA 3HPZA 4W8AA 3K4DA 3UXLA 3E96A 3GX9A 3RU6A 3O0FA 2VR4A 3PB0A 2UV8G 2C0AA 4RNHA 1LOQA 4UWMA 1W1ZA 4RUBA 2PEVA 4Q4PA 3I7RA 1QOQA 4NF7A 1P1XA 2P5NA 2EPKX 1T8QA 4XAFA 4JY9A 4LYQA 1LT8A 1QK0A 2ZQ0A 3THQA 4BF5A 2Q02A 4M1BA 3NQBA 3INPA 1PX4A 2BOGX 1EGZA 2GWGA 2Y70A 1OCBA 2OLHA 4O57A 1D9EA 1SYTA 2I57A 5CSSA 2GOKA 1UR0A 1ZB5A 3QBUA 4CQAA 5D9NA 2WKJA 4LBUA 5GNYA 4HVXA 2BX7A 3GR7A 5I24A 3M5VA 2O56A 1OX4A 4GHRA 4Y9AA 3KLLA 4Q8OA 1GQJA 1KGUA 1IWBA 4XZMX 3ATZA 1RQHA 4QJ1A 2GGEA 1WUEA 2NXIA 3GHSA 2NX1A 2ZZ7A 4H6RA 2J9ZA 3RJXA 4QLLA 3EDDA 1W5PA 1YMYA 3OIXA 4JTSA 4JTDA 4JN7A 1ISYA 5FEZA 4GUHA 1MW1A 3PG8A 1ZSXA 1PHQA 1XYBA 1QMLA 2JALA 2YL9A 5DFAA 5F4SA 4I7WA 2RDTA 3ZR4A 1EPXA 4FK9A 3GG7A 3WLSA 1XFCA 2OWXA 3BGJA 4HBKA 2VNCA 1JPKA 3DN5A 1Q6FA 1GJWA 1X96A 2WSQA 1B57A 3OTRA 4EPEC 4GI8A 3W1QA 2HVOA 5ECUA 4UXDA 5DLCA 3I68A 1EJWC 2R1LA 4MDOA 4MNLA 1LZOA 1HL2A 2PDLA 1ELSA 3LI0A 1BQCA 1GQKA 2FLIA 4G2DA 4MWAD 1ICQA 3DI1A 3O06A 4AIOA 3S6OA 4PZVA 4UMAA 3MYOA 3A3WA 2DDXA 4DBDA 4BJHA 4EXAA 5HWNA 4HHLA 4GIRA 3FCPA 1XH1A 5MHBA 1U1HA 4L65A 1UIPA 1F6KA 1DWIM 1OX6A 1E0TA 3OYXA 3S2LA 1NFBA 1V3HA 5PTDA 4AD0A 3CC1A 2ZX7A 4ECLA 3WZ0E 1F9CA 3S6DA 2E6DA 4PB4A 4NAEB 1HN1A 3UFYA 3EWZA 1BXBA 4B5VA 2A3LA 5FF0A 2V2DA 1JI1A 1C92A 3IRSA 4OU1A 3UWQA 3MSGA 3IUHA 4AD3A 4GH3A 4M6VA 2HBXA 3R0DA 3PPCA 1H62A 4IGSA 4JNYA 4JICA 2DZTA 1VEMA 5ABFA 3KDNA 3FXGA 3NZ1A 2G95A 4LW7A 5A6MA 3KBNA 4M81A 3M0KA 3FA5A 3CAVA 3JRKA 2AKMA 1CTNA 3VZZA 3LS9A 5KETA 2BV9A 3A13A 3ZMRA 2E68A 2ZOXA 2CHOA 3EKLA 1HO1A 3TR9A 1S2CA 4CNNA 2XUCA 2PDNA 4AVOA 4M5PA 1PDZA 3UNTA 3P93A 4H7VA 2ZC8A 2OGJA 3THAA 3F7JA 2ZXDA 1JD9A 2OSXA 4FZIA 3O63A 3HMCA 3NVTA 1XLDA 1R8LA 3QV9A 1X38A 4L4PA 4DJFC 4ZO6A 1JDDA 4N4PA 3SCSA 4DVOA 1UROA 3PUDA 3MSRA 3VNKA 3QV8A 3QY6A 5CPNA 1VF8A 5IXEA 3HIJA 1JNDA 1PZ2A 3LOTA 4F40A 4XO6A 2A6NA 4GG9A 3RLUA 1TPFA 1Q3NA 4MGGA 1P0KA 3E9AA 2WJZA 2GUUA 1V8EA 1RALA 1JIBA 2Z6JA 3ZJ6A 1BKSA 3U2ZA 5C55A 4E8GA 2GVYA 4O1BA 4DWSB 1XPGA 3BW4A 3QQ0A 2PDKA 4KWVA 1GNXA 2Z29A 3OYZA 1G67A 1XLGA 2J7DA 1V08A 4MKVA 2Y85A 2TMDA 2EO7A 1IR2A 1VPXA 1Y7VA 3PFRA 2IMRA 4X0NA 3HG4A 3U5UA 4NJJA 1R2TA 3QH2A 1A49A 4GVIA 5D8WA 1M5WA 4S1FA 3ABQA 1WO2A 3OVPA 1CLXA 3QOMA 2WSRA 1G4EA 2DJXA 3A4WA 5HA7A 4JQ1A 4NZ3A 4O1CA 2D23A 4O19A 1YADA 3G22A 5JH1A 1AQHA 1HZYA 4GIAA 1WA3A 6TIMA 2Y5EA 1WZLA 4R34A 2WMKA 3PTQA 4AWUA 3TLLA 2Z28A 1ADDA 4GQBA 2ZX9A 2G3JA 4ADSA 1ML1A 1S2UA 4R9OA 3CBWA 1JPMA 3MMWA 4N2YA 3OP2A 4E2BA 3SY5A 3E0LA 4KH2A 4RXFA 1S1PA 4FXSA 3PP7A 4IPLA 4YTUA 1UD3A 3P81A 2ACSA 3IWPA 3KS5A 1GOXA 4ENLA 1OADA 1KCLA 1RZMA 3NR0A 3VZYA 5C6MA 4L1GA 3R4IA 4LY4A 3GUGA 1JL8A 1LDCA 4YWIA 3GTNA 3UWZA 1DXIA 4O0QA 3E2QA 4XZIA 1K4HA 3DDMA 3H4GA 4TXEA 2HISA 1TIMA 3NG3A 2QIIA 2VL4A 1BXCA 4MUZA 3WNKA 4IPPA 4WSJA 3ABOA 2EBNA 3DIPA 1AUSL 1EYWA 4C5ZA 5KZEA 4DJDD 1S46A 2GGJA 2GVGA 3ENLA 4TV6A 1Z3NA 4LQ1A 4QTGA 2PP0A 2ATMA 4NKCA 1N82A 1JVNA 3P60A 2J7EA 3L9CA 1E6ZA 3VNLA 3PWAA 2IPWA 1XRSA 3CZGA 1T41A 3G1SA 3BLIA 4LPCA 2H3DA 1VGAA 5TBOA 3A3XA 4ZOCA 4DELA 8RUCA 2W6RA 2UY3A 4Q8PA 4RZ4A 1C7TA 3N11A 3PZIA 1MZHA 3MP5A 4LWWA 3S6TA 1ZBCA 4O16A 1SJDA 2F38A 5HNUA 2OSYA 3TYBA 1HKIA 5I0DA 1EQPA 2A79A 2YZ5A 3ANVA 2CXGA 3QHOA 6XIMA 1AL8A 1CXEA 4DUOA 4R85A 4ICMA 1IXNA 3KVMA 4AW7A 3WQ8A 3WQGA 3TN5A 3BZGA 3SY1A 3GC2A 4EE9A 3CZJA 1JCNA 3MCNA 2VGGA 4HA1A 2A85A 4LAKA 4TX9A 3UESA 3WF4A 4DBSA 1PIGA 4GINA 2Z27A 3G0SA 3GTXA 2I1OA 5LNWA 1RCXB 7TAAA 3UZYA 4PBGA 3LENA 4GYPA 7ENLA 2QXWA 2A4AA 2XSAA 5LIYX 4AX7A 2WKGA 4GD0A 3STFA 4O53A 4JN6A 2GLKA 4URIA 4KKXA 4X2PA 1DJGA 2QJNA 1J0YA 2ZXQA 2HNEA 1M01A 1O1HA 3UPMA 2VR2A 3N9KA 1DHPA 4X3ZA 3W71A 1G7VA 1L6SA 2CLFA 3PS7A 4O0KA 3AYRA 2E3ZA 3CHCA 1ZCOA 4RL3A 2HRWA 3HQNA 1SZEA 4AD1A 1UZHA 4LCRA 2NWRA 2PZNA 2OX4A 1XD0A 3S1XA 3WBYA 1GK8A 5AC8A 1RBAA 2PDCA 2PBOA 4Z08A 4PBFA 2NT0A 3IGUA 4UTWA 2KZHA 4IIFA 4H9MA 4GJJA 4AEFA 3CLWA 2QW5A 3VAVA 1CXFA 3SCUA 3W7RA 1TZ7A 4B2DA 4OE7A 5A6JA 1QW9A 2P0OA 4I8YA 4S3GA 2OWWA 1E71M 3VIPA 3RO6A 3H2OA 4AH7A 1BQGA 2PBGA 3C2YA 2ZXBA 3L66A 4YVXA 2J88A 3B0PA 3SO7A 3E5PA 4GYFA 3DBNA 3NDZA 3SZ8A 4GI4A 4LC8A 3VDGA 2HBVA 4FIQA 5LSMA 3D46A 3ZT7A 4O10A 2J75A 5EB8A 1YNPA 4CQCA 4YL2A 2RH9A 3A23A 3N25A 2NQ9A 2VD8A 4GUIA 1E0WA 2PDMA 1B5TA 3LZ5A 1S2AA 1E6PA 5SWUA 2AOSA 4M82A 1O4UA 3DC8A 1XCWA 4AFYA 3VGDA 2J74A 2VEKA 2YPIA 4GIEA 2X1UA 2UZ9A 3HQ1A 2A3CA 2XINA 2OJPA 1EHNA 4DRSA 4EWND 4DAFA 3U4FA 1SZRA 3V0TA 1C9DA 2YA1A 2VUYA 2J9XA 1FKWA 4JTLA 3WH6A 4MB4A 3W38A 3M0YA 3KTSA 3SCTA 4LEFA 3IJIA 2DH2A 1PXGA 1VHCA 1W5OA 1TO3A 1F5ZA 2C1GA 4Q7NA 4IX0A 1LORA 2B7NA 1NWSA 5BOEA 2WK2A 3WLQA 6REQB 2CZDA 3N15A 3G8RA 3MVIA 5CG7A 3DG7A 4YTRA 5I3DA 4WVXA 1UKTA 4UTJA 4J3WA 1SW7A 4V33A 3CQHA 3UU0A 2Z1SA 2OEMA 3EOOA 4D6DA 4ZOEA 1V77A 2QYGA 1W1IE 3H2CA 1DV7A 5A2CA 1TJ0A 1XBVA 4FNQA 3N2BA 3N04A 3OO2A 3G5EA 1U2YA 3TAKA 2ZDSA 4FLOA 2ALDA 1FDJA 1SW3A 2AAAA 2Q3OA 4AU0A 4GGBA 1OYBA 3S9IA 4DPQA 3W81A 2HSAA 2IKJA 4LOCA 4BI5A 5HWMA 5LNSA 4PTXA 2W79A 1XHGA 3BGAA 3EEZA 3LTSA 3VKAA 1JD7A 3PTDA 3GAKA 1UR9A 1YNYA 3OQEA 3TC6A 3VCNA 3C2RA 1O5RA 2A3AA 1EJRC 3S8HA 4MWAA 1KB3A 1Z69A 3IV3A 2GJNA 4BF9A 4PCTA 2WLYA 3M0IA 1PCKA 2C8NA 2XISA 1F76A 3CZ8A 4LXFA 1F4HA 4C6DA 2GWNA 1X1OA 3CAQA 1MDRA 1WV2A 1Q6GA 1KXHA 4PCNA 2QMJA 4CCZA 3LHYA 5CC6A 4LUYA 4C91A 4LTSA 1ISWA 3S2CA 1Q6LA 2F61A 1W9XA 2FMOA 5FF2A 2Z1VA 3L4UA 4GQRA 4V15A 1F7BA 2XGZA 2D24A 1K3UA 4FR1A 4JYEA 3FYYA 2C15A 1KO0A 1O1ZA 3A5FA 1U5VA 1E0XA 4MKNA 4TR9A 2TYSA 3UY8A 1KLYA 1K1DA 4KWWA 1U1JA 4QE4A 3B8VA 3FVMA 1AMYA 4CQ9A 3L5MA 3QOKA 4O4VA 3QZAA 1H41A 1NOFA 3PPFA 3CO8A 1ZBVA 1A0EA 1I75A 2JFEX 4OOUA 1V6TA 1Z44A 3D6NA 2G0WA 4QFUA 1H2JA 6ENLA 1ZFJA 3SURA 3PZNA 3B8WA 1QJWA 4IJRA 2ABBA 5CBJA 2IQTA 1E70M 2YJQA 3OLDA 1MUCA 3HBLA 4U10A 5A6KA 4QJ5B 3NQFA 4S3DA 3TQPA 4ERAA 4UTLA 3N12A 4JFTA 5G4WA 2Y8UA 4E4FA 5CCZA 1W1PA 3FJ6A 5A8GA 5AHLA 1SFSA 3ONBA 4QAWA 1OY0A 1LTDA 1P48A 3BCFA 1YTDA 2DORA 4FF5A 2ZICA 1JCMP 3FA4A 1M7OA 4UOZA 4UNIA 4AY8A 3A9BA 3VPLA 3VM5A 1AL7A 3CV1A 3G1AA 3SECA 3I3BA 5C9RA 2CZVA 4JTEA 4LUIA 1OG6A 4IMAA 2HEJA 3CL8A 2Q01A 5KINA 2PDQA 2AGKA 5CJMA 4GNVA 2E8ZA 1JRCA 3NJ3A 1Z7AA 2J47A 4JY8A 4FR6A 2HPMA 1NQ6A 2LLEA 4AD4A 2OKTA 1XKYA 1GJUA 1GOOA 3DFNA 2WQDA 1GVFA 2F84A 1VR6A 2QEZA 1DQXA 4AAJA 4LV4A 3NL3A 1WDSA 2XFYA 3L2IA 1E4LA 4C7GA 1XLAA 4KCVA 4TOQA 1WDRA 4D6HA 2VXNA 1LT7A 3URAA 4KRZA 1G1YA 3BW3A 1V6UA 4Z2GA 4DAIA 2ZWYA 1RSCA 3PSVA 1RH9A 1E3ZA 5DMYA 3T6CA 2NQHA 1WE5A 2ZUNA 4K8EA 2PWHA 1RV8A 3WJZA 4Z1AA 3MQTA 1C8QA 1YHTA 5MF5A 2CBUA 1BYCA 4J3XA 3LRMA 3HURA 5FJTA 4W86A 3PZGA 2QDHA 3CU2A 3AI0A 5FJUA 4TTGA 2G3MA 3JS3A 3IGXA 4AF0A 3VGGA 5FL0A 1MUMA 3GDKA 2HK0A 4N6EA 5CLTA 1ITCA 3O05A 1J0JA 3UETA 1V3JA 4LVFA 4Q33A 4MNMA 1KTNA 3QTPA 4L6OA 4LJ3A 4K1WA 4JTHA 2O9TA 4G7EB 3PB2A 4JQAA 1REQA 2WPGA 2HVMA 2J7HA 2Z2AA 3ZQ9A 2Q8LA 2R6OA 2DZXA 3HV9A 1ME9A 2X1TA 2XFFA 2DZUA 1QATA 4LUTA 4ZBCA 5A8MA 1VYSX 4HU0A 3APGA 3W7QA 1C9WA 1CECA 4MY1A 3KCOA 1M04A 2ZC1A 4LAUA 4PMUA 3LLXA 3DHPA 3P8IA 2J7FA 5EGRA 2GJXA 4UIOA 2O9OA 5D02A 4AZ6A 2EAWA 1T99A 1KR1A 4H8UA 4ZE4A 2EPHA 4Z0JA 1DE6A 2VEIA 3NQCA 4JS3A 2OWCA 3K2GA 4JKKA 4CN1A 1Q6QA 3WCZA 4FOUA 1DIEA 2FGBA 5FJIA 1ZP3A 2RAGA 1XDLA 4KGLA 1E9LA 2VGIA 4DI9A 4JOMA 3NSNA 3VDBA 3BW2A 3FDGA 2VFDA 4AYSA 1NFPA 3DEQA 1CGYA 1ZJBA 3G2GA 1J0IA 2QR6A 3UPBA 5BRQA 3GIYA 5J04A 2H3BA 3W1AA 1A5OC 4J3UA 1XF0A 4HNLA 4KS0A 3N4FA 5CKSA 3JZEA 5C5YA 4IH3A 4MADA 1XYFA 3CNYA 3N2CA 1C8VA 4HU4A 1DJQA 5HQLA 2E4TA 1B3VA 3ARTA 1DQUA 2FQIA 3QQWA 5H1WA 3H2EA 2PWVA 5FA5A 1E4MM 3NM3A 8A3HA 3CWHA 4QJ3B 1EDTA 4H6KA 3RX3A 3UP8A 1XC4A 4R88A 2GYIA 1IIHA 2V67A 4Q8MA 3W02A 4BR1A 3VX0A 4XV0A 3B8UA 3AXXA 3W00A 2CLHA 1D3CA 1IR1A 3AU6A 3WK3A 3CQKA 5J5RA 1OGGA 2QQ6A 3GDBA 3D3AA 4DI8A 4FLSA 4D6FA 1S5WA 2CWNA 4ATLA 3IACA 2A5HA 3WLHA 4RKAA 1X39A 3WD0A 1T6MA 3SIMA 2OYLA 5FI8A 2OELA 2BOFX 4KIEA 4US6A 3GFYA 4JKMA 1SGJA 3QGKC 4U4MA 2WAGA 1SO3A 1MXGA 4MAZA 4CNUA 2DVXA 2V8ZA 4PULA 5HQMA 4LS2A 4NX0A 1OK6A 2QJJA 3JUGA 3LERA 5D9MA 3NL6A 3CHDA 1J96A 2XPKA 3T0DA 3BQ6A 5G1YA 1LYXA 5DRIA 2RDUA 1AQFA 4ORMA 3I65A 1PPIA 2P53A 3SUTA 1F8IA 2VJXA 1ISZA 2G3FA 4LANA 3EDEA 1BLIA 4I90A 2C13A 1KM6A 4CN6A 4HYVA 3RFAA 1NVMA 3MSYA 4YPJA 1JF5A 3IUDA 2ZZ6A 4XVDA 1JZ7A 3GNPA 1BG9A 5M17A 1RQBA 4H8VA 3UJSA 1XD1A 4IIHA 1L8NA 1XSKA 1UHVA 4IG2A 1XLBA 4LB4A 4QG6A 3M47A 2PAJA 1P0BA 2I14A 2DIJA 5G1TA 1WOAA 2EHHA 3G6LA 3VNDA 4EKJA 4ZXOA 3R10A 1TB3A 4GPNA 3SCNA 3KL3A 2RUSA 1R5YA 1UD2A 1W9DM 1PDYA 2ZBTA 4L80A 1UCWA 4TUFA 4GNJA 1VCVA 3DESA 3BVJA 3SDOA 1PE1A 3ZLFA 3HF3A 2HE5A 2CYGA 1G01A 4GOAA 2WZEA 4UZUA 4ACZB 2OU4A 2VP8A 2BY0A 4QCEA 3K8MA 5L6UA 1Z89A 2X0YA 3BUVA 3NQEA 4HTBA 4BI6A 3LX9A 1B2YA 4JIIX 4XZLX 4CNSA 4C7DA 4V27A 3FA3A 1F61A 3L4XA 3PZQA 4K7VA 3PUEA 2EPOA 4NILA 4UR8A 3T2QA 1VJSA 2X1IA 2SFPA 5FEPA 2VGBA 4AZCB 3ORWA 3TN3A 5BOOA 1FCBA 5FOOA 1UP2A 1W9UA 4I9MA 4PH6A 2CLPA 3IVSA 3TP4A 1HJWA 1SFJA 1YPXA 4ZZ9A 2ANUA 4HYRA 2QCFA 1H11A 2BZNA 2B0MA 1FCVA 2GSEA 5IM51 3L4VA 1BVNP 2J7BA 2C71A 3CPRA 4QBXA 4DO5A 5DO8A 1A5KC 5D2VA 1GCYA 3WN6A 2BVWA 3ZR6A 4NIRA 3AIRA 1JDEA 1CGTA 3GY1A 4KESA 5HNNA 4M6UA 3UQNA 3LMYA 5G1MA 1HUVA 4L1WA 5LIUX 1ONXA 3DZ1A 4QXIA 4I7UA 4HZMA 1E6NA 3MI6A 4ZO8A 2QV4A 2X7VA 1I2OA 4P7OA 3L2LA 5I77A 1QASA 3N2MA 4IPJA 4FALA 1W1B1 4U31A 4HSOA 4ROQA 1BD0A 4A22A 3ABSA 3MUY1 3UG4A 1A5AA 3VGFA 1I8JA 2YCLB 1IV8A 3G1VA 4C1NA 4D6JA 2INEA 4EVZA 5A3HA 9RUBA 1CT5A 3BO9A 4QLKA 1B3YA 1N55A 3MMDA 4MTVA 4M7TA 3GXMA 4BF7A 1F3XA 4I5UA 1FH9A 1PV8A 5HUPA 1F2JA 3PULA 4JD4A 3ARYA 2PDPA 3NXLA 1LOSA 2R1NA 5CZJA 3SQLA 1E51A 2FTPA 2B31A 2XTKA 4W4QA 3CL6A 4CU7A 5CXPA 3HO8A 4B16A 3KWXA 3R25A 2ZUVA 3AMDA 4KMQA 2PS2A 4Q4OA 3NGFA 3UR5A 1R9ZA 2QJIA 2QAPA 1QBBA 8XIAA 1AH3A 3NZRA 2G96A 3GSMA 1XSIA 1H63A 2ZCGA 3WQDA 2JKPA 4I9TA 4DXKA 5A95A 4GYPC 4O52A 3MCMA 1B3OA 4PC8A 1I2NA 1JI2A 3K4WA 1E1CA 3GW3A 4RPQA 1XLLA 3WEOA 4IFOA 3LZ3A 3CM4A 2UY2A 1OFQA 2VDGA 2W3ZA 2NVDA 1OC6A 2WSKA 1ZAJA 5KZ6A 1O94A 3K46A 1AVAA 3MHGA 3T81A 3M5YA 3QGAC 1U30A 2ZUUA 5CSRA 1GVIA 3HJZA 3MANA 5DT7A 3W74A 4B15A 2PC4A 4YWSA 2ATSA 1JR1A 1XIIA 4GWEA 1TWWA 4MB1A 2IXVA 3EKGA 3ARQA 3NQVA 4Y90A 4B92A 4ZOBA 3OIHA 4EANA 1UZ1A 4CQ8A 3ARVA 4W7WA 3KDOA 5EL1A 2TPSA 4WZHA 4UTWC 1JUKA 4XIMA 4X61A 2F6KA 1E40A 2VC7A 1VYRA 2GDUA 4UC5A 5BU6A 3O07A 1GT8A 3LNPA 3JR2A 3M16A 4Z0SA 4HCHA 2Z7KA 1CW2A 3SGUA 5H8PA 2WVUA 3GDRA 3UBPC 2YCIX 1QHZA 3AJXA 2BMBA 1X8CA 1F74A 1OYCA 3G1FA 5DCDA 4HNVA 5DY2A 1GYNA 3EWWA 4XAZA 1ITXA 3NM1A 2PDHA 5I23A 1OFEA 4KWSA 3LNMA 1GW9A 3SCVA 2QULA 4GI9A 4NZFA 1XFBA 3CUZA 2QDEA 4HMNA 5D09A 4PSRA 1OD0A 2V2HA 3FSUA 1XG4A 3PG9A 4JTKA 4A2SA 3F2DA 1E9IA 2AL1A 1LBFA 3PY2A 2W63A 4IF2A 1ZCCA 2MUCA 5F4XA 4HNUA 2Z2UA 4CU6A 1UR2A 4PUKA 4U33A 4UTKA 2ZA2A 4WCJA 4JQ2A 1AJ2A 1MNZA 3WMSA 4DNMA 5CLWA 3LPGA 1GZ1A 2VC5A 1V6WA 4DXVA 3CYVA 1YDVA 1QUMA 1Q6DA 3QXBA 4JTAA 5CPMA 4IJBA 3F2BA 3IJQA 2YL8A 3WL1A 1BGGA 2ZWZA 2FB2A 2ZXAA 2XG9A 2I9UA 1F3EA 1QNVA 3W1MA 4JTUA 1TTJA 1YBQB 1H0IA 3EOSA 3F5KA 2E5BA 3GDTA 1QI4A 4DIAA 4Z2IA 3EDJA 4FNUA 4J4KA 3QC0A 4UFLA 1PJ9A 4C6OA 2W92A 1TPDA 4OWGA 1MRAA 4UQDA 3ITYA 5CG0A 4REQA 3W22A 6XIAA 4IQLA 3OGSA 3SGGA 2YIHA 4QDPA 2Z24A 1NWRA 3S9ZA 1EEPA 4XX6A 2WWDA 3DYMA 3WJXA 3WQPA 1E3XA 4MKSA 4MWAE 3M6DA 5I3JA 2H9AB 3BK0A 2YCJA 3GTHA 1JCYA 1MSSA 4MDPA 3NQDA 4V1XA 2E8YA 4F4RA 1XCFA 2QIWA 2A3HA 4H00A 1KXVA 1EA9C 1XQKA 5AN7A 2HNHA 2CZFA 2YR1A 5HINA 2B7OA 2AKZA 3W7KA 1P4CA 1JUEA 3EMQA 1EF2A 3MT1A 1IEVA 3HFYA 2VEPA 5GPRA 3RPDA 3MJMA 4H8HA 2X1RA 4IMEA 4WF7A 3A4JA 4Q4SA 4CGTA 4O0ZA 3A4XA 3O1NA 3VIFA 4ZE5A 2CPUA 1J12A 1J5SA 1EB3A 3PNZA 1H1YA 4ORIA 3T4WA 4DUXA 2NWSA 3FNDA 3TQ0A 3P67A 1MEWA 5D2XA 2KAUC 4L61A 4UCFA 4H41A 3W82A 2WMJA 5DQPA 3IVUA 3LUTA 3WLIA 4CD5A 4BFAA 4HMCA 1KTBA 4U2YA 1EIXA 1NDZA 5HJLA 4JL2A 3TW9A 4YNGA 2BG5A 3KL0A 2Y88A 2FFCA 4KBXA 1CEOA 3WQWA 2BHZA 1MDLA 1SMDA 2XGBA 3VDAA 1NF7A 3MW7A 2I5GA 2PLKA 3QF0A 3B0XA 3LBMA 1PAMA 3IJ6A 1EP2A 1UR3M 2QMKA 4UR7A 2NVAA 4GVFA 2YW4A 3URNA 1YX1A 4AMCA 3ITCA 4MOZA 2VQUA 2DH3A 3DG3A 3QSRA 5LXEA 3W6YA 1GPWA 1XISA 3SBFA 2CU0A 2UWFA 2R14A 4ZB2A 1N8WA 4PTNA 4S2CA 7A3HA 2D3NA 1MFUA 3WBWA 2O7SA 1R3QA 4JYDA 1P7TA 2BDQA 3MCOA 1THFD 3MI3A 1WUFA 2A6LA 3NQ2A 4UTTA 4O17A 4Q8UA 1NWUA 3LHUA 4JKLA 1S3TC 1FFQA 1US2A 1G4PA 3USBA 3IGHX 3V0SA 4F8XA 4K2SA 1QNSA 3NEHA 3URQA 1TJ1A 5ABGA 3UT0A 3GVVA 1C3FA 2PF0A 3WBAA 3SUSA 2O92A 3CEPA 3GU1A 1ZL1A 3QR1A 5F1UA 1OYAA 2XSXA 3KBVA 1MQRA 3OW1A 2WKLA 3EA3A 3PSWA 1XBXA 2XN1A 1E1EA 3PANA 5HBFA 3WBXA 1RD5A 2CXEA 4Q22A 5A6SA 1OHLA 3MP3A 1Q63A 5ABTA 1B3ZA 3ZSTA 3H4XA 1KA9F 4QAIA 2HZGA 4NI8A 3BANA 1A3HA 3CYJA 3SSJA 1R86A 3GVWA 5BW6A 4QP0A 2V68A 2FMNA 1FTXA 3VFCA 1ZRQA 4GVGA 5CSUA 3OZMA 1MEIA 3LQLA 1R47A 2I16A 1VZWA 2PD9A 4HMDA 3LV5A 4CD4A 3DH7A 4C7FA 1HKKA 2D0HA 1DWGM 4CLMA 1VFHA 2D2HA 1WDWA 1ALDA 3VD3A 2MANA 4C6CA 3O6YX 4IQEA 7ODCA 4GE8A 1QPQA 2ASHA 1JXJA 3SSZA 2HTMA 3P3BA 2P8BA 2C91A 4GFSA 1OC5A 3U48A 4CCCA 4AC7C 3VDCA 1AFSA 1OFDA 2H8XA 1MRQA 3K5XA 4WX2A 4JTQA 1CPUA 2VRJA 2CLKA 5IRPA 3BSMA 3VZXA 2R1KA 2WVVA 3NQGA 4IIBA 5REQB 1Z9AA 3OGVA 1NH6A 4ZSTA 5CEWA 3B3DA 1B31A 4JIHA 4JL1A 2PDYA 1TVPA 1R3WA 1XG3A 1OD8A 4O4WA 1I9CB 1RLDA 4NVTA 1YXCA 5EMUA 3PM6A 3N18A 2AQVA 4TVDA 2RFGA 4HHHA 2Y2WA 3KP1A 4H9TA 3QV7A 1K8XA 3WK0A 3UEQA 1WYIA 3P2VA 1J93A 5A8PA 1NY1A 3H4WA 4LCSA 3IEBA 1RA5A 1G0CA 2VX4A 3N19B 4GK8A 4LBSA 4LNCA 2OO0A 4C6QA 2UY5A 3HGRA 1KGWA 4KIRA 3EOEA 5I3KA 4B90A 3TLQA 3BV4A 1XP3A 1KTCA 5G2HA 4TMCA 3WLNA 3C86A 1QWGA 1U83A 4NYYA 4DJDC 3N6QA 3OG2A 5K2ZA 3DX5A 2Z00A 3RO8A 1H7NA 4K39A 1DP0A 1ZP4A 4DJFA 3BURA 5HWJA 3B40A 3LM3A 3MKKA 1MXDA 2PDJA 3W23A 1XM3A 1F07A 4WOZA 1POJA 3WDIA 1H3GA 1W31A 2YB1A 4PTMA 1KWKA 3GG8A 4RW3A 1P0NA 4ZTYA 2WM0A 3TXVA 3GHUA 4S3AA 3PHAA 3T08A 3KM8A 3NURA 3H6OA 2NQZA 4OV4A 2VCCA 3SY8A 4L9YA 2BASA 2ICSA 3WH7A 4XD4A 1SFLA 1WB0A 1US3A 4B3KA 3GWQA 4QLJA 3KBWA 2QCDB 1D8WA 3R58A 3MUXA 3LRLA 2J27A 1HVQA 1ZENA 3FK4A 2Z1XA 3WQVA 4ZO9A 2CIPA 2YA2A 1W3KA 1UKOA 4MYAA 4IJCA 3O6AA 4V1YA 3ARZA 1Y65A 3WUGA 3C56A 4F9DA 5LHEA 1UP0A 1HXJA 4PE8A 2CCRA 1XX1A 3RXZA 3STPA 3ARWA 4QNEA 1GOMA 5AZ1A 5C54A 4F66A 4FX8A 4WXYA 4KW2A 1KV8A 1Y0EA 4KFNA 3W7EA 5BOFA 1J0ZA 3UERA 1RPXA 5ABEA 3P14A 5F2IA 1JZ8A 4JTCA 3RM9A 3AHVA 3VOCA 2YLAA 2BOEX 2XIMA 3AIBA 4YCOA 3N14A 3V35A 3ZWSA 4NJIA 2E9LA 4P7RA 4KETA 1VAHA 1QI2A 3FAWA 4FOJA 2PLJA 2QF7A 1OX4B 3MKCA 2FHBA 2ZYFA 3M7WA 3GBDA 3SIZA 1KRMA 2J6VA 2E1DA 1UWAA 2CLMA 5DY3A 3TK7A 1BYBA 5HATA 2VM8A 3WX7A 4NZ4A 4Q8WA 1T40A 1OX5A 5C70A 3B9NA 4XD3A 2HQAA 1XDMA 3BAIA 3QVQA 3RN6A 1A5SA 1XGDA 3URBA 3EX4A 1AD4A 2OFJA 3MS8A 3KBMA 2WVSA 1DJZA 1QW7A 2FJUB 2EKGA 2X16A 1TV2A 1KFLA 5E5CA 3BLLA 1UBSA 4HK5A 1JDFA 2PUZA 2ZADA 4QR6A 1FFRA 5D32A 2WHJA 2YZRA 3JVAA 1WDPA 3HJEA 3HN3A 5A6LA 1UWSA 1YDYA 4PL1A 2ZZ4A 4C6FA 1K6WA 2YBTA 2VELA 3GR8A 3V1HA 3BMVA 4I5XA 4IMFA 1LLZA 3TE9A 4HPHA 3BL3A 1D3GA 1BG4A 5E9XA 1DTNA 3KOZA 3NOYA 4B3ZA 4F0SA 1PKMA 1M65A 3PVFA 3PTMA 2X41A 1VFLA 1VIZA 3IAPA 4CD6A 2VWTA 2I56A 1E15A 2Z26A 3N2XA 1XICA 4XZNX 4J27A 4AX6A 1J8VA 4Q6JA 1CGWA 2Q8XA 1XKJA 5LA0A 2BGSA 2VZTA 3GNRA 4QEHA 3ZLHA 3ZJKA 3WEZA 3DXIA 5DEZA 4FX6M 3CIXA 2QKFA 5D2YA 2QZRA 1OCJA 3QLLA 2RJHA 3NIYA 5BXTA 4NZ1A 3QMTA 1AZ2A 4HPGA 1PHWA 2WHLA 3LTYA 3V1PA 3EMCA 3D0CA 1QPOA 3WLJA 4YYCA 2ESCA 1ECQA 3MMUA 4JIRA 2YDSA 1CNVA 2WV8A 4JFVA 1BHGA 1MXSA 5ABFB 4JX4A 3WLMA 2OOFA 4Y2WA 2IKGA 2J7GA 3KZPA 3NQMA 5M03A 3ZS4A 3DKLA 3VMNA 3LDVA 2X30A 3NUKA 3HGOA 1TJ2A 1ENUA 1A5UA 5CPQA 1H51A 3AUJA 1BF6A 3W28A 3T9PA 4LNYA 1W3JA 4P8UA 1WZAA 2G4JA 4L9XA 3LCGA 1XINA 4EOUA 1R9YA 2FGZA 3VFLA 4MVAA 4IP4A 2VX5A 2VFIA 3TFCA 1Q85A 3F1QA 1LL4A 1IXOA 1XQLA 2NZLA 3CUHA 2CLLA 2E9BA 1F8MA 3IIVA 2OCZA 2OX1A 1JZ5A 3CMGA 4LALA 4K37A 2VENA 4IGNA 3AO0A 3GXIA 4J35A 5M1TA 4D8AA 3AS3A 1NDWA 4XUGA 5F2LA 1LRNA 3PZMA 4W7VA 3QSTA 1QNPA 2CZEA 3I3DA 2W4XA 3N73A 1GJPA 3NYDA 3QR3A 1B90A 1I0DA 1GEQA 3EXTA 3WLPA 4P8XA 1VRDA 1W0MA 1R3VA 2JK2A 4PUDA 3KRZA 1WAWA 4H7ZA 5EMKA 3KE0A 1P1MA 2EPNA 4IFKA 4GX8A 2VZOA 2QNEA 3MMTA 3UJEA 4IGMA 1DIKA 3A3HA 1ICPA 1VFMA 4MY9A 1E4NA 5C2CA 7CGTA 2R8WA 3WFLA 4NX5A 1XRTA 1G94A 3BICA 2OYKA 2V6AA 1AH0A 1FWBC 4QRNA 2GQ8A 3UD6A 3GU9A 2A21A 2AL2A 3QZ6A 1UD8A 1UIOA 1MVYA 4RCXA 4MPQA 3OLEA 5KZDA 3EXRA 4HZ8A 5HR6A 3AHTA 2XVPA 1SJBA 1KC7A 3ES8A 4L9ZA 4K68A 3S4TA 3VIKA 3LEPA 1JEZA 2GQ9A 4N4QA 1FWWA 4JGDA 4RE0A 2OG9A 3FXYA 1G4SA 3LBCA 3REQA 5KSWA 4I5RA 3MI2A 3W2MA 4PRTA 1H7WA 3TEVA 3MZ2A 1HJXA 1FHVA 4UTHA 2DIKA 1DVJA 4KEVA 3ANYA 4O8AA 3Q37A 1Q4NX 5T26A 1K4GA 5D03A 1KQYA 4IUGA 2WPBA 3DKJA 3LHZA 4UQCA 4A8NA 2WB5A 5A8OA 3UJ2A 3IIXA 1ITUA 1QPRA 1M03A 2V63A 2CKRA 3ELFA 3F5JA 4W84A 3WUFA 3M43A 1VS1A 2Y24A 2Y5JA 1RR2A 3VC6A 5LGZA 3I6TA 1XIJA 2BVYA 4J28A 1O12A 1CB7B 5BXRA 3G1DA 4RDWA 3R7MA 3CPGA 1ME8A 4A29A 2J13A 2A3EA 2W61A 4GC4A 1JCJA 4H4IA 3RF9A 4HK6A 2NVCA 1NAL1 3HA1A 1FWSA 3LM7A 1GKQA 2PZ0A 1LM1A 2QDGA 3PN8A 1YTEA 3VYLA 4YVVA 3W29A 1KXTA 5AZ0A 4JQ4A 3GXTA 1H5VA 9XIMA 4NAFA 1PVNA 4LEQA 4J1OA 3RPMA 5FSEC 1TJPA 5M5DA 4OFCA 3SUWA 4LAMA 1OG0A 2DW6A 1S3HA 3FFSA 2AMXA 2J9YA