3ONBA

Bond breakage and relocation of a covalently bound bromine of idd594 in a complex with har t113a mutant after extensive radiation dose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Radiation damage reveals promising interaction position
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 311
sequence length 311
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3onbA00
2P5NA 4FALA 1S1PA 4LAZA 4LAUA 1EF3A 3Q67A 1LWIA 1PWLA 2IPFA 1ADSA 3LENA 2F38A 3GHSA 4GQ0A 4H8NA 3F7JA 3UZYA 1HW6A 3WBYA 5LIUX 1RY0A 3DOPA 4YS1A 3RX3A 2NVCA 4EXAA 4XVEA 3WBXA 4XVDA 2A79A 3LNMA 3WBWA 1X96A 5DANA 2HE5A 1ZQ5A 4AUBA 4GABA 1S2AA 4YVXA 1YNPA 3LBOA 3EB3A 2IKGA 2R24A 2PD5A 1RALA 4IJCA 2BGQA 3R94A 2PDLA 3LQGA 2FZDA 3FX4A 1AZ1A 2PDPA 1YNQA 3MB9A 4PMJA 4HMNA 1QRQA 1ZUAX 4JTDA 2CLPA 4FA3A 3GHUA 1EL3A 3V0SA 2WZTA 3RX2A 1J96A 3CMFA 3GHRA 3V0TA 5JH1A 4R9OA 3LQLA 1MZRA 2BGSA 4I5XA 3R43A 2PDMA 1IHIA 1AH0A 4H7CA 2PDUA 1GVEA 3LZ3A 3UFYA 1K8CA 1Z3NA 3R58A 4JTRA 4JIRA 4JTQA 2IS7A 1X98A 2INEA 2IPJA 2IQDA 2R9RA 4YVVA 3R6IA 2DV0A 1US0A 3ONCA 1EXBA 3MC5A 4XK2A 1PZ0A 3M64A 2FVLA 2FZ9A 1UR3M 1SM9A 3GUGA 4GACA 1YE6A 4QXIA 1AH4A 5LIYX 3EAUA 4MHBA 2VDGA 3UZZA 4DBWA 2PDYA 2HV5A 5KETA 3H7UA 1PZ1A 2F2KA 1YE4A 4ZFCA 3D3FA 5AZ1A 3LEPA 2IKIA 1Q5MA 2IPGA 2PDBA 1VP5A 4HBKA 4WDUA 5HNTA 2BP1A 3EB4A 4OTKA 2PDGA 4L1WA 3R8GA 5LIWX 2ACRA 4PRRA 4WDXA 5M2FX 4XZHA 1AZ2A 3UGRA 1LQAA 4Q7BA 2IKJA 1RY8A 4JQ3A 2PEVA 3NTYA 1Z89A 2PDNA 4LB4A 4WGHA 1MI3A 4GQGA 2DUZA 1HQTA 3V35A 3WG6A 1ZSXA 3UYIA 3O0KA 4RPQA 2QXWA 1PWMA 2HVOA 2FGBA 2PDIA 4WDWA 1R38A 4XAPA 4JTAA 1VBJA 1PYFA 4PRTA 4DZ5A 3CAVA 4FZIA 1C9WA 3VXGA 3BURA 1X97A 3LUTA 5HNUA 5C7HA 1QWKA 1XJBA 3ERPA 3CAQA 2INZA 4JQ4A 2ACSA 3V0UA 4F40A 3COTA 5LIXX 4JIIX 1XGDA 2FZ8A 4PUUA 2IKHA 2PDKA 3V36A 3G1RA 2PDHA 3B3DA 2PDXA 4JIHA 4QBXA 4XZLX 4QX4A 1JEZA 1Z8AA 1A80A 5LIKX 4YU1A 2IQ0A 4WRHA 4IJRA 2DUXA 1AH3A 2PDWA 2ACQA 2PD9A 1S2CA 2PFHA 4LBRA 3T42A 3H4GA 1Q13A 3R8HA 3UWEA 2I17A 3BUVA 4XO6A 3N6QA 3H7RA 3U2CA 4JQAA 3N2TA 1T40A 4NKCA 2FZBA 4DBSA 4XZIA 2PDJA 1AFSA 2AGTA 2ACUA 4LBSA 2ISFA 4GA8A 2PDQA 2HVNA 1FRBA 3G5EA 3LZ5A 1Z9AA 2PDFA 2HDJA 4WDTA 4XZMX 1ZGDA 5AZ0A 3BV7A 4JQ2A 3UG8A 4YVPA 4PR4A 4XO7A 3P2VA 3M4HA 4GCAA 1T41A 4JQ1A 1EKOA 4QR6A 5HA7A 5JH2A 2IPWA 2HEJA 4JTCA 3ONBA 2ALRA 4GIEA 4LB3A 1S1RA 4ASTA 3UZXA 2PDCA 4G5DA 4XZNX 3CV7A 4PUWA 3C3UA 2PZNA 3O3RA 3Q65A 3QKZA 3WCZA 3FJNA 3S3GA 3M0IA 3BCJA 2J8TA 3LD5A 1MRQA 4L1XA 4IGSA 3GHTA 4WEVX 3UP8A 3UZWA 2HE8A 2PF8A 3R7MA 4ICCX 1XF0A 2I16A 3LN3A 2C91A 1IEIA 2WZMA 4EXBA 3KRBA 4FAMA 4DBUA 2NVDA 3RX4A 1OG6A 3CASA 1M9HA 3CV6A 4Q3MA 3DN5A
chains in the Genus database with same CATH superfamily
5CGTA 3OZPA 2ZDRA 5AC8A 3NQGA 4DPQA 1M65A 1F3TA 4PUMA 3K4WA 1EF3A 3SY8A 1H7RA 3DBPA 1M7JA 1QNRA 3S6OA 1CWYA 1KRCC 1O5RA 3TSDA 3LGEA 3U4FA 4HA1A 3S0CA 4H6EA 1ZU8A 4R34A 3CL7A 1ZJBA 1IEVA 1GVYA 2P76A 1KRBC 5F2MA 3DOPA 3KBMA 1ZB5A 3QSRA 1RQHA 2PGRA 5IFPA 1RPXA 1GOWA 3RG6A 2BB0A 4DB7A 1BVZA 3PZMA 2HPIA 4JD4A 3EXTA 3UCDA 4IJCA 1RA5A 1LRQA 2VNCA 2Y8UA 3MPGA 3JUGA 4FLSA 4FX7A 1W5OA 3MYOA 4N4QA 1JG9A 2QW5A 5REQB 1HL9A 3ITGA 2VI0A 2A3HA 3LYEA 1UWIA 3DFHA 2FDMA 1I2RA 2VFFA 5EMJA 3H21A 5CKSA 1A5OC 3B0XA 3HFYA 2QCLA 3W6MA 3BG5A 1GHRA 1GG0A 4RV3A 3DGBA 3WLQA 3NQ2A 3NO1A 3S1WA 1A5BA 5A69A 3KDNA 5AVHA 4OFCA 4PB3A 4ZXLA 1NVMA 3L5MA 4MDPA 2P3ZA 3PZIA 5EKYA 1TFVA 4IMEA 4UNLA 4FOUA 2JKAA 5CPMA 1XIEA 2WC3A 2INEA 2FZMA 1KQYA 1Q85A 5TD4A 3ONCA 1WV2A 4JEJA 3VKDA 5E0FA 4HIBA 1CCWB 3MMWA 3WD0A 1PBGA 1XR2A 2QJMA 1E3XA 4UTLA 3E5BA 4FOJA 1B3WA 2NXIA 4LVGA 1SM9A 3UWYA 4JTSA 4DY1A 2J78A 4P2VA 1QNSA 1YE6A 2W63A 4PA8A 3MU7A 3ARPA 1W3LA 3WJWA 3AIQA 2GL5A 1HJUA 2BDQA 3N2BA 4AG0A 5I0DA 3ZIZA 2PDBA 2ZA3A 1KTCA 1XSKA 3HG3A 3NDZA 1OX5A 3EX6A 3O16A 4L1WA 3NQDA 1Z6KA 3R8GA 4Z1BA 3I7RA 4PGLA 1BD0A 1W0MA 1E9LA 5IXEA 2VZUA 3O63A 3AZTA 3DFPA 3TOPA 3R2GA 4E4UA 3VX1A 3URBA 4DUVA 2RAGA 3EEZA 5H2ZA 1OJXA 1D7KA 4S2CA 1TIWA 1XLKA 5K4XA 3H22A 1E4LA 2QUVA 3PK7A 3STPA 3DH7A 4KCWA 3WD2A 5D37A 1HQTA 2X16A 2XIIA 4QAWA 4L4LA 2EXOA 4AQLA 4GBUA 4F2BA 3UD6A 3BGGA 2E77A 2E8ZA 2HWGA 3M9YA 4U2YA 4DQWA 1UBSA 4DF0A 3HA1A 2CZFA 5T8GA 4RE0A 1F3XA 3N2XA 4FIRA 4MAZA 2OU4A 1IV8A 3LLFA 2INZA 4B91A 4AAJA 3N12A 5HINA 3H53A 3W70A 1GQKA 3SCQA 5LNRA 2FZNA 4EPDC 1VS1A 4YYCA 2VUYA 4C6OA 1XGDA 1TUFA 3ITCA 4B92A 2IKHA 4O1CA 3NZGA 5AC7A 1VFTA 1CBGA 3N9KA 4QBXA 3I3DA 1XLDA 4HK5A 4MMWA 5D8ZA 3AXHA 2PZ0A 3HMJG 1I2OA 4GPNA 3GDMA 3VGEA 4NRRA 4BY3A 3H4WA 4XO6A 3MW7A 1Y0EA 3W7GA 3GH5A 1QVBA 5G1TA 3P62A 3PPFA 4OECA 1XYMA 1YPXA 2C18A 3PZ9A 1C29A 2AGTA 2J75A 3EOUA 2GUYA 1UA7A 2PDQA 1FWNA 4K8HA 3NPVA 3T05A 3UZ5A 3LZ5A 3VOGA 1OCJA 5GQBA 4DBDA 4IP4A 1JUBA 2O9RA 3SUWA 4AEOA 1DIOA 2JEPA 3VD9A 3NM3A 5CG0A 3S9YA 1W1B1 1OSEA 4YVPA 2OO6A 3M4HA 4KFNA 1VBRA 1BGAA 2DDXA 4L64A 1FCUA 2DSKA 3IANA 1EHNA 1YDOA 1N7KA 1BXBA 3TW6A 5AECA 3Q37A 1DXFA 3PN8A 4N0RA 4IPNB 5PTDA 5I79A 3WH6A 3CV7A 4Q8VA 1LOQA 1MW0A 1DWIM 2WLZA 3VIPA 2A7NA 5AYXA 4KIEA 1KGWA 4US5A 5M5DA 1Z41A 1GOQA 1S5MA 4V15A 5G1MA 2VCCA 3U5YA 3O1NA 4C6PA 3FV9A 1OFRA 4ZOEA 4B5SA 2AMXA 4MYAA 3KBSA 5DEZA 3ZZ1A 5BXSA 4KCUA 2X1SA 3K4DA 4IIHA 4EXBA 5A8NA 3GXMA 1WKDA 2Z7KA 1GOMA 2GQAA 1DJZA 5DFAA 2VDHA 4AZCA 5A8OA 4ERGA 1W5PA 1YDVA 4LVAA 2D0HA 3HPFA 4PMQA 4P61A 2V67A 4IFOA 4U5KA 4LV4A 4YTQA 4DF2A 1ODUA 3R4IA 2W0UA 2HVMA 3CBWA 1QW9A 3QC0A 1THFD 1ADSA 1Z7AA 2R8WA 4XV0A 1VCGA 3AWNA 5DY3A 1Q8JA 1AQMA 1RBLA 3GFYA 1N55A 4BI6A 4IMCA 3RX3A 1VPQA 1V0LA 3O6CA 1RCQA 1J0YA 3GU9A 5C8BB 2Q8XA 4EX4A 2REQA 1T8XA 3THDA 1ZQ5A 4GZIA 4AUBA 3A4AA 1KKOA 3W38A 1U5VA 1IGSA 4M82A 3B8VA 3EB3A 1BLIA 2XFRA 4PTWA 4FSAA 3B9AA 1ZENA 3W7DA 4QNEA 1JZ3A 3VNDA 5CSRA 3TE9A 3D47A 3SECA 3MB9A 1HJWA 4HMNA 4RUBA 3TVAA 2QT3A 3RMEA 2DW6A 4H7VA 2VRQA 2DQXA 4ORMA 3MKCA 4YHEA 4KETA 2CLFA 4MY1A 3LI1A 2ASHA 2CKSA 5DO8A 5GNYA 3PJTA 4G7EB 2P8CA 4GIRA 3LQLA 5CEWA 4Q8MA 7TAAA 2CWNA 5IM51 2CZ5A 2J4GA 4Q6JA 4JTQA 2OOGA 3WQVA 2IQDA 1KXVA 1A49A 1XH0A 4C6FA 2WBKA 5FJTA 3C2FA 1US0A 4ZQNA 1UD6A 4REQA 1JZ7A 1ME9A 3S5YA 2CNCA 4HNVA 4GUIA 4PEKA 2G3IA 4K68A 3WEMA 1FH9A 1PZ0A 4LCQA 3T08A 4CEUC 2WCSA 1YTKA 2OGYA 4G9PA 3ZR6A 2VDGA 1GVIA 2PDYA 1C7SA 4Q8UA 4F0MA 1PHQA 1XIDA 1TTIA 1OBAA 2X1TA 2F2KA 3C2EA 3DXIA 2Z2AA 2V5JA 1FXQA 1U5HA 1R2RA 2LLEA 1QNPA 1NWSA 4QITA 1LUCA 3DEQA 2FTPA 4YWIA 5C7VA 1EPVA 5C54A 3TYDA 2NUXA 3OB8A 3S5SA 4A2RA 3ZM8A 2WM0A 3P82A 2OX1A 2PRLA 4UR9A 1EQPA 2WBGA 2PGWA 5AHEA 3V4BA 1XLJA 4WDXA 3QMTA 4J3SA 3FGCB 4IGNA 5I03A 2ATSA 3W1AA 2XGIA 1R9YA 1CGXA 2Z1SA 3V5CA 5FF7A 4Z0JA 3SURA 3AISA 4GKTA 3EWYA 1UJQA 2W92A 3N3TA 1HF6A 2Y88A 1OVDA 2GSHA 5EFFA 4UR8A 3OG3A 4YN5A 2E5DA 2VKZG 4CCDA 5FEWA 3AMCA 2PWDA 4Q6XA 5BWAA 1EP1A 2HXTA 3P60A 3NYZA 5FJIA 1JQVA 3R0DA 2WKGA 4I3GA 1QJWA 4CKQA 3S1GA 3TKFA 2C0AA 3UBPC 1IEXA 3PR2A 1JQXA 1ZRQA 1PZ3A 3MZNA 3VIOA 4PTMA 5C7HA 2RFGA 1QI0A 5CBIA 3L4TA 2UY4A 1V3KA 4GYKA 3U5UA 3QBUA 3W01A 2DVXA 3TH6A 5A6SA 1H49A 1CGVA 4FLQA 4O15A 4PBFA 3UESA 1EUNA 3V36A 2GYIA 3P0XA 3JW7A 1PAMA 3G1DA 4UBPC 1XSJA 2QJHA 1A80A 1VYPX 3QHOA 1FCVA 3SN0A 2P3EA 4WJEA 3PAJA 1A5UA 2VZOA 2E8YA 2QUTA 3LRKA 2HNEA 2PB1A 1D3GA 1QOXA 4IWWA 3OZYA 4BZYA 3QGKC 3TQKA 1F4AA 1MXSA 2BY0A 3NEHA 2OGJA 3ES8A 2NX1A 4HHLA 3H24A 1MUCA 1E3ZA 2VWSA 4POCA 2ZRXA 3HN3A 4XZIA 2R94A 4GKLA 1K70A 3GH7A 4UOJA 3W28A 1SZEA 1TV7A 2QS8A 1M53A 2EBNA 3BMWA 2RKXA 4P8WA 4XUGA 2XISA 4F9JA 3MCNA 2HXUA 1YQ2A 3NZPA 1E9YB 3IACA 4WDTA 1UH2A 3H2MA 3SJNA 4I6VA 4RCXA 3NSNA 2HS6A 4QJ3B 4NZJA 2PGFA 4W88A 4CGTA 3MVIA 2OT0A 4QLJA 4NAFA 4DYJA 3LSBA 3U3HA 3GS6A 2PWGA 4OU1A 5E93A 4KEVA 2QDDA 1U1JA 4JTCA 1LG1A 1JZ6A 5I3GA 3E3HA 3LMZA 3ONBA 3QZ6A 3N11A 1E5JA 1V3MA 2EPOA 1RLCL 3REQB 4HNOA 1KM6A 2NSOA 5GJMA 4AIBA 3G8EA 4KEMA 2G95A 3UR8A 2WMHA 3CIVA 2EEXA 3E1F1 4CQ8A 1R47A 3TDFA 1Q3NA 3IJ9A 2ZUVA 1KGUA 1KTBA 3BAWA 5F1VA 3AWOA 3IPWA 2E09A 3H2AA 1ZBKA 1CLVA 2DVTA 4ORIA 2Y85A 3IJ7A 2C14A 3UZWA 1WP6A 1E0VA 4WCJA 1W9UA 5U4NA 4QNWA 4JY9A 1J0ZA 4NUWA 4WJXA 3VCCA 1RQBA 3UU0A 3IUIA 3QTGA 3VOJA 1F3WA 1VFOA 1RQEA 3IV8A 2QQ6A 3HQ1A 4FOKA 2ZE3A 3NVDA 2PA6A 1SW7A 4QSFA 2V63A 1E1CB 4KRZA 3UF9A 3CV6A 4FS9A 4KWUA 3DG7A 3G6LA 3BL3A 3MHFA 2P5NA 4Z2JA 3AUOA 1OC7A 1HKIA 2OLHA 2EPLX 5FJJA 4LAUA 3HV8A 4C6EA 4PE8A 3GB6A 2ZDSA 5A6BA 4EPBC 3MWAA 3VO0A 3WH5A 4PODA 3BARA 4O52A 4PCFA 3F7JA 4J40A 4W8AA 2C1GA 3WBYA 3SEPA 3AS1A 1H5YA 3B9DA 3AYSA 1HXJA 2I1OA 1XRSA 4LYQA 3TYBA 3LNMA 3S1VA 3BC9A 4HHHA 4Y8FA 1VCVA 2YCJA 1GVOA 4FNSA 3WN6A 4L6DA 2IW0A 1POKA 4HPJA 4KCTA 2Y7EA 2R24A 5J5DA 1I2PA 3AICA 3FX4A 4A3YA 4YTRA 2ZFAA 2NLYA 2WMFA 4MF4A 1GZGA 1GUVA 4H9UA 2PDPA 1OT1A 1GJPA 2Q6ZA 1YNQA 4A35A 1UQZA 3TYAA 1VKFA 3PUGA 4TX8A 3AXKA 3EOLA 4ILSA 2JQXA 3QR0A 2IXUA 1QO2A 1U2YA 3FA5A 3U9IA 3Q94A 3FJ6A 1KCKA 2I56A 2UY5A 4H6QA 3EA3A 1UZ4A 3PZUA 3KOZA 5IDIA 3E49A 4H9TA 3G24A 1CZ1A 3WX7A 4D6CA 3TMQA 1DQUA 1XCFA 3AIRA 4KFPA 1AH0A 4GQQA 3SIMA 2GOKA 2CESA 2O4QA 2G0WA 1P48A 1U83A 1WAUA 3SFKA 3RM9A 1R3VA 3R6IA 4CD8A 1W31A 1U22A 1QATA 1AJZA 5REQA 4F0LA 5CPNA 3M47A 2DH2A 4J5NA 3JZEA 4DIAA 3EZ4A 3M6DA 4NAEB 4J28A 3I6TA 4E8GA 3AHXA 4ZB0A 1A5AA 4LRSA 4R7JA 1UMLA 4RJEA 3WDRA 2RUSA 4CEXC 6TIMA 4JDBA 2NVAA 3LMYA 3E74A 3L66A 3TQVA 4PMVA 2WKJA 2WVVA 5BWFA 1BTMA 1EH9A 1V0NA 3O06A 3HOJA 1PL9A 5FEZA 2YFNA 3RAOA 4TQTA 4XSLA 3WH9A 3CEPA 4MYXA 1T8QA 3GVVA 1DKWA 2G41A 3LOTA 1VFUA 4J9JA 1WDRA 3VOFA 2D3LA 2FTWA 5AC6A 7CGTA 4O4WA 1BXNA 1HIZA 4P7QA 4IXHA 4JTJA 3W86A 5HPOA 3NG3A 3FNDA 2PEVA 2RGMA 3A64A 4FO4A 5DELA 3VKJA 4HYWA 4A29A 5B80A 4DJDC 2CERA 4W8BA 3IWPA 3MP4A 1I6NA 1TJPA 3UY8A 3DFYA 1VCFA 1MWOA 2P88A 4K3ZA 4IG2A 3A4JA 1EA0A 2QYGA 4XBSA 4PRTA 1XC4A 1FWBC 3LNPA 1DBTA 3TX9A 4X60A 2X7VA 3W23A 2CHOA 5G2WA 3QPYA 2FH8A 4RNFA 2PTYA 1LM1A 3U4AA 3WK1A 4DUOA 1KFCA 1DJYA 1QPKA 3VABA 1TWWA 1XG3A 2OKOA 3EOOA 3RU8X 2BODX 1P1XA 1OGBA 4GH1A 1TVLA 4JNMA 3LBCA 2Z27A 2XN1A 4JIIX 3FN9A 3AIEA 3M0XA 2PDKA 2G3JA 4JL2A 4XIAA 4DLMA 3BMVA 2PDXA 3CWOX 5MF5A 3NL2A 4ZB2A 3F03K 3URAA 1DORA 3CZEA 4W93A 2X7WA 1Y7VA 3T4WA 3H7VA 2W66A 2DZPA 3INPA 4HQVA 4AWUA 4IGHA 2FB3A 1EP3A 4LBRA 1PPIA 4Z0SA 3I4KA 3TWAA 3IGSA 1JCLA 4UNKA 2ZX9A 4MNMA 4V2XA 4GNJA 1J11A 1V3LA 1OWQA 3ABQA 6XIAA 3PTDA 4LFYA 1F61A 4TVDA 4DHGA 3ANUA 4JX4A 4AWEA 5HMFA 1ECEA 3C3NA 4C6DA 3GW0A 4U28A 1OYBA 3F5LA 3GG7A 3C52A 3R0UA 3OG2A 5I2UA 1H51A 2C79A 2WJFA 3W07A 2OCZA 4OGZA 4PB4A 4F2TA 4MKNA 1HVXA 4DVOA 5K9CA 4AD5A 2VOMA 4AFYA 5GPRA 1Q7ZA 5FAJA 3W37A 4I90A 1NQ6A 1GG1A 3G2GA 4QR6A 4F8XA 2WSRA 4AZHA 3B8DA 3MUY1 4YTSA 6ENLA 2D24A 2HPMA 3WY1A 2ZVRA 3H2EA 2DSUA 4UFKA 3N2OA 1C90A 3MY9A 1GKRA 4GXWA 1EGMA 2VMFA 4UWMA 2BWGA 4O11A 3KP1A 3TFXA 1W37A 2V2CA 5FF3A 1Q6DA 1JXJA 3QYQA 4N9CA 4S3FA 1XUZA 3UP8A 2AL1A 5I77A 4GJIA 2EG6A 1H5VA 3K8KA 4DJDD 1PCKA 4EAYA 3IS4A 4AD3A 2FLIA 3LB0A 1EBGA 2EKCA 1XDJA 4Q3MA 3DN5A 1JFXA 3BK0A 4JNZA 1IEWA 1A3WA 1G9HA 1MXDA 4AEEA 3VKCA 3LY0A 2F6UA 2ADAA 2YL9A 4LEQA 4QQ3A 3CLMA 3ORWA 2PCQA 4KW2A 4C60A 3BG9A 1D7FA 3BAYA 3SQLA 4Y96A 4CU6A 3MSRA 5TF0A 3R0KA 4JN8A 3TCSA 2NX9A 1XHGA 3QHMA 3LG3A 3GKFA 4HK6A 3ARTA 2VC5A 1XKYA 1RXOB 4EPEC 5LGXA 5JMUA 4M6VA 1XIFA 2XVGA 5D4YA 1KV5A 2W67A 2F8QA 5IRPA 3ZVIA 1CX9A 2ZRVA 1HJQA 3CIXA 2XINA 1HKMA 2MANA 4WF7A 1NJJA 3GO2A 3GYEA 4EP8C 1H61A 3MP5A 3GKAA 2V9DA 3AXMA 2L5HA 3BAIA 4QISA 2J79A 3V0SA 2ISDA 2I5GA 3OGRA 4AY8A 2ZYFA 3ARRA 4YNGA 3GHRA 1BYBA 4L4MA 5IHSA 1B90A 5EFDA 4CNSA 3WNKA 2WYSA 4NNCA 3Q58A 4S3DA 3AYRA 4E2DA 4MIMA 5CPLA 3NWRA 1UH4A 4KWSA 5KITA 4GO8A 4IFKB 1EJRC 1P0KA 3N73A 1RVKA 1QPRA 3M07A 4GGHA 3ZLGA 2WVUA 4OV4A 4DZHA 1OF6A 2NX3A 3IGXA 4HD5A 1EXBA 2YIHA 4Z1DA 1C3FA 1W1IE 1MNSA 2YJQA 4GACA 2J77A 4DXKA 3P0WA 3P8JA 1YBQB 5FF4A 5EBUA 1EJXC 3B8WA 4G6CA 3PZQA 1W8GA 1BRLB 4O12A 2GQ8A 6A3HA 2WNWA 4HNCA 4CVUA 2X1RA 3O05A 1N8FA 2PLCA 5CSYA 4ZCWA 1RJQA 1OIMA 3S5OA 2WAGA 3WFZA 4E3VA 3PPCA 3WFLA 4QEEA 3F5KA 4C6JA 2NV9A 3GXFA 2ACRA 2J7GA 1X38A 3TN3A 1VFHA 4ROQA 8XIAA 4B9ZA 2WCAA 1LZOA 3TN5A 3TJLA 2Z1KA 1WCGA 1M1BA 3CXOA 2OPJA 3PHAA 1YMYA 2YCKX 4GZEA 8CGTA 4XD6A 2WWDA 4PFMA 3QR3A 1TZZA 4LB4A 2A7PA 3MI2A 5AC5A 3L5LA 1CXIA 4I7UA 3QPZA 1OZMA 3UA3A 3NOEA 3ZS4A 4RPQA 1X8FA 4O17A 2HVOA 3WLNA 3T2PA 4CD4A 3VDHA 3G3DA 2ABAA 3MSGA 3M0LA 4DZ5A 1I9CB 1VC4A 2EPKX 3WQDA 4ACZB 3EKLA 4TVUA 1WKEA 1X97A 3TNBA 3WNPA 3WLMA 3G1HA 3FIGA 3VOHA 1PKLA 2OSXA 1E70M 1MW2A 2HTMA 1G01A 3V18A 2W6RA 3POCA 4RZ6A 1HT6A 3ZT6A 1HJSA 4O4VA 3TN4A 4QDPA 3MT1A 1GKPA 4AZGA 1GOOA 4PUUA 1V3IA 1JPDX 1UMYA 3VNLA 1TV2A 3VCRA 1CB7B 4FXSA 2NV1A 3VNJA 3PJWA 4XWUA 3CMGA 2IQ0A 4NXKA 3ANYA 2HSAA 2QAPA 1LBMA 1VAHA 2Z25A 4UCGA 2E9BA 3M41A 1IT7A 1D8CA 1L8PA 2PD9A 4UMCA 5CZTA 1VPYA 4MWAB 2CZVA 3FHQA 1X1ZA 1ZNNA 4M1RA 2Y7GA 1UR1A 4HU8A 3APTA 4JFVA 5EMYA 2DP3A 2B4GA 3NQEA 4QEHA 4C6KA 5CPOA 4C91A 3E9AA 3KL5A 4GA8A 2G3MA 3TK7A 5J8LA 2ISSA 4AU0A 3THAA 3MUXA 4K2SA 3DC8A 3D46A 3GM8A 2WQPA 2YZ5A 1TB3A 1GVQA 4A2SA 1LWHA 5XIAA 3N6HA 2XSBA 2GDUA 2PWHA 3WMCA 4XO7A 2GK1A 1W1VA 5E70A 1HP4A 3F4WA 4I9AA 4DM1A 1UD4A 9CGTA 2PRMA 1L6YA 3W83A 3BLKA 2BY3A 5A8QA 3KBWA 3HG4A 4I6KA 4IQEA 1X8CA 4FLRA 4TTGA 2YXOA 4Z2HA 3CZGA 3GNDA 1TPVA 3VPLA 1XIGA 2E6FA 3DKJA 3NPUA 4H6KA 2FYMA 4BEQA 4RDVA 2PBGA 2PRHA 2ZRZA 3LTSA 3TSMA 1EJVC 2Y2WA 3L2LA 1I8JA 3ARQA 3XINA 3S2CA 4AEFA 4MWAC 4WEVX 2OYKA 3KWSA 4E6MA 3F4DA 3ZVHB 2WZHA 3W1QA 4AB4A 1XH1A 5GJNA 3HQNA 3CJPA 3KWXA 6REQB 4DO4A 3MTWA 3Q45A 4Q8TA 3I65A 1X6NA 2JBMA 4EACA 2CXEA 1OF8A 1E4MM 4FAMA 3RITA 2QF8A 2Z1XA 2OKTA 3BW3A 2NWSA 1KO0A 1KCXA 3PFMA 3GX9A 5BRPA 1QDSA 4AYSA 3J7HA 1HL8A 1ZP4A 1CGUA 2IPFA 3M43A 4MY8A 5KZ6A 2NQLA 3SQMA 2MUCA 3MSDA 4QP0A 2O9TA 3WL0A 3GHSA 4BFAA 4H8NA 5AVNA 1G4EA 2E25A 2GFTA 5T91A 2CXGA 3SUUA 1Y5XA 1SSGA 3CL8A 4D2JA 1TQJA 4CQDA 2GSJA 1XLCA 4H6RA 2PMQA 2VEMA 2BTMA 2Z00A 4J3TA 2D2GA 1P5BA 4ZZ9A 1HO1A 1CIUA 2Z0IA 1S2AA 4NYUA 3W7PA 1YNPA 2J25A 1F9CA 3M44A 1DE5A 1UG6A 3WQCA 3OVQA 4B5WA 1W1A1 4QS5A 4R5EA 2FVKA 1VJSA 5HUOA 5EY5A 2XVNA 1S2TA 2OO0A 4B15A 2OYMA 2IQTA 4BF7A 4E0CA 2NSXA 1LOSA 1FWTA 2AQVA 5LNVA 3TOYA 2GVYA 2O9PA 3W6YA 3N29A 5FKYA 3S4TA 4UXDA 4FHAA 5ECUA 4K37A 2PP1A 1R2TA 4L61A 4R53A 3PY2A 4UNIA 1XPGA 2QCEA 3GLCA 1KD0A 4QIUA 3T55A 4V1XA 1Z3NA 4JTRA 2E68A 2R9RA 4FB7A 4MLJA 1CXEA 4C6MA 4S23A 3PB2A 4CN1A 3KZPA 1XKJA 4PFHA 3N17A 3WNLA 2QCDA 1K9DA 4XK2A 4O1EA 2BS9A 3M64A 4AYGA 1NWUA 1GW9A 4IPLA 3WSUA 1X6UA 3OYZA 3W76A 3WIJA 1EHAA 1OHLA 3UZZA 3W1MA 2Q3RA 3VUPA 3SUTA 3GNXA 3C5QA 1IE7C 3W88A 3W71A 4MWAD 1F8MA 3WDHA 1Q5MA 2V30A 4MB4A 5HNTA 4WDUA 2YBVA 1JGMA 1ZALA 2CZEA 3BOXA 1O60A 1OB0A 1XM3A 1QK2A 3GZ3A 4W7VA 3LGDA 1SZNA 4XZWA 4QFUA 2FQIA 1KC7A 2ZRYA 3DG6A 2D0GA 1LQAA 4DI8A 3AFBA 4IL2A 3GDLA 4UTUA 1FWSA 3BO9A 3NNTA 4NAEA 3L5AA 1B0IA 2J8GA 2NQ9A 3SW6A 4CN4A 1VRXA 4JL1A 2WJEA 2A7RA 4L65A 4IUOA 1BG4A 3HGOA 4GQGA 2WMKA 3MJYA 3P74A 4F66A 5TIMA 3BLLA 1R8LA 2QEZA 1OFDA 1YX1A 3RLGA 1D9EA 4LCSA 3L65A 4QCFA 2D69A 4LALA 4K8GA 4MB3A 4NZCA 4AC7C 2X30A 4M7SA 4QSHA 4L9ZA 4I8YA 3ALGA 1J0HA 1I2NA 2DIKA 3GVWA 2DH3A 3HV9A 3T1GA 4F0RA 4GXMA 3ERPA 4DJEA 8XIMA 1ZLPA 2DUAA 2I14A 2Y63A 1NOWA 1SU5A 1EJSC 3MMDA 2ZOXA 1MFUA 2VYOA 5LIXX 3MS8A 1HGWA 4FEZA 1CLXA 1V8EA 3BXWA 3N9RA 1RHCA 2POZA 1VBHA 1ZAJA 2VEGA 1E4IA 3EEGA 1F2JA 1MEHA 4UZUA 5HAOA 1TELA 3MJMA 4DZAA 5LXEA 3SCRA 3VKKA 2GVEA 5LIKX 4J2PA 1W9VA 4OOZA 1BKSA 1W6TA 2VGGA 3OHMB 1RJPA 2H3BA 1XPYA 2V5CA 3S9IA 1WX0A 1F07A 4GWEA 2DVUA 4AH7A 1LTDA 3ARXA 3QZAA 3GYCA 4R88A 4N9EA 4UFLA 1ZPTA 3N4AA 3TU9A 4MNJA 3ELFA 1JZ5A 4LS2A 1WBJA 4K1WA 4QROA 4TX9A 4A8NA 4IIBA 4TU1A 2FZBA 5BZAA 1W5NA 1RSCA 2VD8A 4MNKA 4BI5A 1I0BA 4JFTA 5F7UA 6CGTA 3WLOA 2VRKA 4EWJA 3TTEA 3I3BA 1BVWA 5AYBA 1XL9A 3CT2A 1K8XA 4JN7A 3OW1A 1VEOA 3A6OA 3VGBA 3ABXA 3L2IA 3P81A 1UWRA 3URNA 3EDEA 1N8IA 3GNNA 1NF7A 4QDWA 5HDRA 1EKOA 4C7GA 2Y5SA 4PCNA 1R3QA 2VURA 3OEXA 3OOQA 1JDCA 3ZLFA 3RCYA 1H62A 5HXMA 3UYCA 4DN1A 1ADDA 2AMGA 2VHLA 1GZJA 4CVWA 2ALRA 4S3JA 5CQ1A 4PRWA 4O14A 2G3FA 5C9ZA 5IFTA 1JGIA 4ASTA 1OX4A 1SJAA 2EKGA 1UKOA 3TROA 1CXFA 3QKZA 3S1UA 1OM0A 2ZVIA 1QPNA 1Q65A 3PTKA 3WUFA 4UTKA 3RM8A 4PL1A 3XISA 5C0QA 1JVNA 3CZKA 1V6VA 4X3ZA 5CPTA 3HBLA 3GHTA 3B0PA 1C8XA 2QVHA 4HMDA 4PTNA 2BOEX 1GQIA 1YKWA 3HG5A 4JKLA 2CITA 1E6NA 4GYPA 1F8IA 3VIKA 3W2MA 3N18A 2ZXAA 3B8UA 4L6OA 4UCFA 3MSYA 3GBEA 4O1BA 2OJPA 2ODOA 5HATA 1HTIA 2POTA 3QSTA 4O10A 3SN1A 3HGJA 1O68A 4KS0A 3WQOA 4WZHA 3SFWA 3UG4A 1GNXA 1PEZA 3IVTA 1TQXA 3I6EA 4D8LA 1PWLA 4ADTA 3LCFA 4PCPA 3M0VA 1RH9A 1TVNA 3V7PA 2QVNA 5EMKA 5LKYA 3FYOA 2QNEA 4Q4RA 3W7HA 3QV8A 1KR0A 4CU7A 1KR1A 3WF2A 3PWGA 3IIOA 2YXXA 1CEOA 4XVDA 3WBXA 1DJWA 1SQ7A 5A1AA 1ZL1A 4XD5A 4AD2A 2FHFA 1TUXA 1OG0A 3SRHA 2QV5A 1ITUA 5A5WA 2HZGA 1TX2A 1NQKA 4I5UA 3ZJ7A 4INFA 4B5TA 2GJNA 3TAKA 1FWHC 1KQZA 3FLUA 3OA3A 4WSKA 2YBTA 2C19A 3VDCA 1I1XA 2VENA 3IJ8A 2VL4A 3W74A 2ZE0A 1DXIA 3KFTA 4HB7A 1US2A 2D20A 1XWYA 5AYZA 3OBEA 1P6BA 1TV8A 4MUPA 3WD4A 4TTUA 4I8DA 3VVGA 2OZ3A 5KZMA 3TC6A 3M5ZA 1W32A 3VM5A 5EGRA 1E51A 3USZA 2DW7A 2A3CA 2YDQA 5JH1A 1O5QA 1W8SA 3UXKA 2BGSA 3R43A 4IX2A 2QIWA 2VELA 1EFZA 4DM2A 1XX1A 2V6AA 3TA6A 3N6JA 5H8PA 3DERA 4BWLA 5C70A 3W75A 3S47A 2VP8A 4V28A 1J0KA 1A5LC 4I9MA 3GR8A 1XI3A 1K1DA 1XFCA 1FWIC 2UV8G 6PTDA 2FZ9A 2QDGA 3C8FA 5LNWA 3M0MA 3CV2A 4ZOBA 2ZZ6A 5C6MA 1E40A 2KZHA 4UTMA 5I3IA 4IHCA 3ABRA 5FIPA 3L67A 1DEDA 4LANA 2J74A 1NWRA 2O55A 3PZGA 4CCEA 5HBFA 4D6EA 2IXVA 1DP0A 4NNBA 3WUBA 3AMGA 3LEPA 1LROA 4EXQA 3QM3A 4O0ZA 4JHZA 8TIMA 1P0BA 3OQ8A 1VD6A 4IFKA 4AHOA 2PDGA 3KTSA 4AWSA 1KA9F 1QR7A 1Q6RA 4S38A 1S39A 5M2FX 3AS0A 4HNNA 2VR2A 1J0IA 3DHUA 4H83A 3NIYA 4E5TA 3PNZA 4OOUA 4JDYA 1PE1A 3BSGA 1YBQA 4AWTA 3F4NA 2I5IA 4RK8A 3P14A 1BRLA 4MWAE 4B2DA 2BXYA 3WG6A 2ZX7A 5DY2A 1ZAHA 4KWOA 1QI4A 5BU9A 4G8TA 3NL6A 4WDWA 4MJZA 3S42A 4GMEA 3STCA 3G6MA 1VBJA 1W2VA 3KM8A 4AZCB 2QZRA 2ZZ1A 3BURA 4AMAA 1WOAA 4Q4MA 1ISZA 3QV6A 5CJNA 1RVGA 5LYRA 2VDIA 5AOUA 4O1FA 3H2FA 3CQKA 3CHDA 3HURA 1UR2A 3GSMA 4ZVJA 3DCPA 1UWAA 3L4WA 3MHGA 2E67A 1VF8A 4UOZA 1GOIA 1XYAA 1W3JA 7ODCA 2OZ0A 1XCXA 3BSMA 3RILA 1NELA 4JYEA 1CXKA 3TUUA 3K46A 1TV3A 5DRIA 1YEYA 1O5KA 1PX4A 3B8IA 1B3VA 5CPSA 4M7TA 1E0UA 9XIAA 3EXSA 3KOFA 4HZ6A 1V7YA 3RO8A 3GXNA 4XZ9A 1CPUA 2REQB 2PI6A 4IJRA 2XH0A 3TQPA 3ARWA 3G22A 4HOXA 4ACZA 4X9YA 2PFHA 3SO7A 1Q7QA 1UD2A 4ZL1A 1TZ7A 3E2QA 3C56A 4KGLA 1M01A 1ME7A 3H4XA 4NT0A 1QFEA 3S6DA 1JNDA 4MFDA 2ZIDA 4LYPA 2W62A 3SBFA 4GQRA 3N2TA 4UQBA 5I24A 4NKCA 1QHZA 1FFQA 3TZNA 4YWSA 1P4CA 1ISVA 2ACUA 2FH6A 2Q3OA 4WXZA 3WBEA 4F4RA 4M6PA 4JX5A 2DY3A 2YL5A 1XGEA 3TLLA 4NRSA 4J7RA 1EJ7L 1G94A 5AZ0A 1NAL1 2W27A 4JQ2A 3UG8A 2VQUA 4IQJA 1KCLA 1O1ZA 3ARSA 2Y70A 5HQMA 5JVLA 4N42A 1SMAA 5K7JA 2WV8A 5HA7A 4MWAA 5JH2A 1QPQA 4M24A 1X7IA 4PC8A 4FXFA 1CXLA 4REQB 5TBOA 1SJDA 4A3QA 2PDCA 3EGJA 2FPTA 1A47A 3HU7A 1UR4A 3UVAA 3CL6A 1AVAA 1DHKA 1QOQA 3FJNA 4UIOA 1A3XA 3EA1A 4UQCA 3ZXWA 2J8TA 3LD5A 4X22A 2QJIA 5EMUA 1EBHA 1F73A 2ATMA 2WANA 2ZZ7A 1Q63A 3FVMA 2B7QA 2J9YA 1JF6A 3UJEA 1WZAA 2ESCA 4CD5A 2QLYA 1EF2A 2I16A 2ZUWA 1UOKA 5T26A 2V3EA 2XIJA 1BYCA 3CPGA 2UZ9A 4UTFA 1AL8A 2XGZA 4ZE5A 2DEPA 2C91A 5CJMA 3EOSA 4JPGA 4M8UA 3C86A 3FS2A 3KOXA 4GUJA 3E0WA 4PTDA 3UQNA 2W91A 3THCA 4XAYA 3GG0A 4PMOA 1M03A 1C9DA 3VIHA 4IMFA 1YDNA 2QAFA 1YLVA 3L2MA 4FXJA 3OVGA 1EQCA 3GVGA 4OVXA 5BRQA 3RK8A 3VNIA 4DNHA 3ATYA 3VDAA 4KEUA 1DQWA 1Q2SA 4IIFA 3LRLA 5FESA 3TLQA 2AGKA 4NQ1A 6REQA 3MANA 3GNOA 2ANUA 4HMCA 2XFFA 2QCCA 2F9RA 1X1OA 2J9XA 4YVXA 3SRFA 1FKWA 2PD5A 1K3UA 5CXPA 4GINA 1FWEC 3U7BA 1ZTVA 1GQNA 5EPDA 1GQLA 3TYZA 4A8IA 2VC7A 3E0LA 5ABFA 4RE2A 2DORA 4CU8A 1YPIA 1LG2A 5B7YA 2ZUTA 5A6TC 2C15A 4IUGA 3A4WA 2NWRA 3OU8A 1R3TA 1XDMA 3LDVA 3GHUA 3ID7A 3VZYA 1SO3A 2HS8A 1TPB1 3NUKA 4QE5A 3CB3A 2WZTA 1ZBVA 3T6CA 1AW2A 3SCPA 3TXVA 1EGVA 3CZ8A 4GVFA 1LT8A 3A5VA 3GZAA 3QF0A 4GISA 1T6MA 2GGJA 2AAAA 4NYYA 4KFOA 5D33A 5JBDA 3OBKA 3LU2A 2V5DA 4J4KA 1H4PA 1JPMA 1G4TA 1QW7A 1F74A 5D04C 1K8CA 3QZEA 4IF2A 5DCBA 2IS7A 4IP5A 1BGGA 4U5IA 2VZSA 3OBAA 1IR1A 3WMSA 2PTDA 1PSCA 3FW6A 1V0KA 2GJXA 1L9WA 3CTLA 3B06A 2VCBA 3HPXA 5D2TA 3TMLA 3IVUA 3MUCA 3U7VA 1T96A 3PJXA 5CZKA 1AK5A 3DAQA 4Q7NA 3UG5A 1AH4A 1J4EA 1CNVA 5LIYX 2VGIA 2GVGA 3EKZA 3U48A 1TVPA 1PKNA 2CWXA 1SSDA 3DI0A 1ZP3A 4NAFB 4EWND 1LL6A 5BOFA 4ZFCA 4NZ3A 3MI3A 3UJ2A 3E96A 4HBKA 4HA3A 2WHMA 4DEFA 4MG4A 4GGBA 4L4PA 1ICQA 4UFHA 4AD4A 1ONRA 4LUYA 3ZLHA 3OVPA 1E6SM 1I4NA 3RLHA 3QOMA 2OTDA 4Y9OA 1LDCA 1JAEA 3DFOA 5FJPA 4NNAA 5DCEA 3AJXA 1E55A 3QQWA 4E8CA 3LTPA 1K9EA 4S2BA 2WO5A 1FWGC 5AYIA 4DWDA 2AOSA 2XJ7A 2PDNA 3OQEA 3SADA 4WGHA 4ERAA 1MI3A 2DUZA 2DJLA 1ZBCA 4QS6A 3V35A 3SIZA 3VILA 4ZO8A 1FH8A 3CPUA 1QCWA 4CNOA 3K8LA 4FF5A 2VEKA 1NOFA 1P43A 1Z42A 2WW5A 4N9DA 3DZ1A 1QMLA 2YOCA 3CAVA 2PSNA 1C9WA 4ROPA 1GCYA 1O94A 1KV8A 1C8QA 2OFJA 3T0TA 2PODA 1XQKA 4LUTA 4A6GA 2B0MA 3CAQA 2X1UA 3PF3A 2BNJA 4IMDA 3WDPP 3NQ7A 1JZ2A 1RBAA 1E6QM 3AS2A 2CEQA 1H41A 1KFEA 4CNUA 4MKVA 2ZC8A 3ZSTA 3ANVA 1TG7A 2PUZA 3R89A 5CZSA 2MNRA 3M1ZA 4FNUA 1QNOA 4EF9A 1G4PA 1Y8BA 3HG2A 2BMBA 2DT0A 2XTKA 3AMLA 4LS1A 1DYSA 4RZ4A 1FHUA 3NZQA 4B4FA 1R86A 1SYTA 2Y62A 3TC3A 4DX3A 4UFJA 1A4MA 3KRSA 1UZDA 4GD0A 3E5PA 4HZ8A 4GH3A 4UTJA 5MHBA 3KRUA 3CIWA 4RNJA 2CBUA 4Q8PA 2JALA 3D0CA 1UR9A 5FF0A 4PMXA 3SCUA 2ZZ2A 3N4EA 3GAKA 3W25A 4GI8A 5CAHA 4K38A 3W29A 3LHTA 4MY9A 4B16A 4ES4A 4YMZA 2A3AA 3CHCA 2E6DA 3EWWA 4NJJA 4IMAA 4H00A 2FDSA 3FHAA 3W1LA 1S2UA 2HVNA 2VX6A 1DWHM 2Z1WA 3WDJA 2QGHA 3DFTA 3VIGA 5ABTA 4XZMX 1UIOA 3VI2A 1EDTA 4L7ZA 4JS3A 2YZRA 1AJ0A 4PR4A 1QHOA 1ITCA 3N1AA 3F1QA 4JQ1A 1RUSA 4MUZA 2GWGA 1EB3A 4O1AA 1RJRA 4A21A 4LNYA 2PCEA 4LT9A 4C6NA 3L0GA 3EPOA 3NSXA 4P8UA 3VTRA 4GIEA 5KEZA 4LB3A 4FF7A 3F4CA 1WZLA 1YDYA 3UZXA 4XZNX 1R85A 4QCEA 1S2VA 1VH7A 3GDBA 3CS2A 5U7SA 3DBNA 2XIBA 3QGVA 2BVDA 1SJBA 4LAOA 2TAAA 4WSJA 4UMBA 3CQHA 1GVSA 4E8DA 3MQTA 2DZBA 2WVVB 4R27A 4NJGA 5D9MA 5LGZA 4ML4A 4J2MA 1EEPA 1JDDA 3BZJA 4QLKA 2NT0A 1IIHA 3SUSA 2NVDA 3PTQA 1U1UA 1BPLB 7TIMA 3NXFA 1XYBA 3LI0A 4MAVA 3M0ZA 1KTNA 1JYXA 4FMVA 4Z2KA 2O0TA 3LBMA 1LBLA 3PB0A 4MNLA 1UCWA 1AD1A 1MQQA 5FACA 1B2YA 2Y0FA 2X0SA 4WY0B 5ENLA 5HWNA 4UTWC 1WXYA 4GCXA 4IG2B 3NXLA 2INFA 1QK0A 1JJKA 3DYMA 2NXHA 4P7NA 2WOQA 3L21A 3GD6A 3H70A 4CUCA 6ALDA 4GX8A 4HPXA 3O7UA 3AI0A 2UY2A 4JIPA 4W5UA 3AHZA 1GVRA 4C90A 2FGZA 2OOFA 3T2OA 4R3UA 5I78A 4M29A 4HOZA 1TCDA 3Q2DA 1SR0A 5K2ZA 4HCDA 4J3UA 3VCNA 4RR4A 5KMYA 2ZRUA 2J24A 3VIIA 3MDWA 1ZUAX 2WJDA 2Z26A 2CLPA 3P67A 4FA3A 3B9OA 5LA0A 3EMCA 3IJDA 4QGCA 3QMSA 2A2IA 4UFMA 5BXPA 2YX0A 2PLKA 5LSMA 3AALA 4RL3A 1E15A 2Y6ZA 3K5XA 1H7NA 1J96A 3CMFA 2XZ7A 4A8RA 1GKQA 1EIBA 1NP0A 4EIVA 2OWCA 1NDZA 1US3A 3B0UX 3IUHA 2Z2UA 1POJA 5H6HA 4KH2A 2Q02A 4Y2WA 3LZ3A 2OSWA 4JIEA 1W2PA 3EWDA 1X98A 4HU4A 2WXDM 4JHOA 5A6BD 5EMMA 1KXQA 5E0KA 1A53A 3JVAA 3B0VC 1XD0A 4GNKB 2PPGA 1HJXA 4A4AA 1SZRA 2OZ8A 4D8ZA 1ONXA 1CTNA 5D02A 1L6FA 1UOZA 4YJ5A 2CPUA 5AKQA 3K4AA 3SM0A 3KCJA 3DHFA 1V6XA 2R14A 2QULA 4IT1A 4IFRA 1C93A 4JCMA 3GDKA 2XPKA 4YL2A 3IJLA 3HJZA 1PZ1A 4NX0A 7REQA 3WQFA 4UOQA 3WUEA 1TJ1A 3AAMA 5IBXA 3K2GA 1BF6A 1DPMA 3DKLA 3L4VA 3UCCA 4WXYA 3SCWA 3SRKA 1H7WA 5ECVA 1FH7A 4NZ4A 4HOWA 3TN6A 3M6YA 4PRRA 1CYGA 3B05A 3S5NA 3W27A 2DZXA 1BSIA 3NZ1A 4E3TA 2XSAA 2J6VA 3E0VA 2ZC1A 7A3HA 1UR8A 2WNNA 2HBXA 1S46A 3DG3A 4DJFC 3BAJA 3KBNA 3VC5A 6XIMA 2V3FA 3WQPA 3AZSA 1HNYA 4Q8WA 3UYIA 1DIDA 3O0KA 4KIRA 3W53A 5H8UA 3VD5A 5CC6A 2YPIA 3OHIA 2H8ZA 1JNEA 2OB3A 2I9UA 2JFEX 1M6JA 3OIHA 3PSWA 5I3HA 3WH7A 5F2LA 1XIBA 2X0HA 4AVOA 1KKRA 3MA8A 3P7YA 3EX4A 5A6JA 1I0DA 1VIZA 4GVIA 1UUOA 1XINA 4TMBA 1S5NA 3E6EA 2XG9A 4M6UA 4KERA 1Z48A 3W87A 3PNUA 3UXIA 3OZOA 2P1FA 3KS6A 5D09A 3PZOA 4LYKA 3GR4A 3DGRA 5BU6A 3QMRA 3B40A 1XLHA 4RW5A 3EWZA 1BYDA 1KBLA 4Q4QA 5CPQA 4CN6A 3G77A 4JIHA 4XZLX 4X61A 4Z17A 4YU1A 3ZSSA 1JCXA 4JHMA 1DL3A 1QXLA 4UB9A 4DWSA 2J27A 3L4UA 3CH9A 5C55A 3V5FA 3EMQA 2VVSA 3PTMA 1XIJA 3HB9A 2HNHA 3CQIA 2HROA 1I2QA 4R85A 3A13A 3GRIA 3QHNA 4DO5A 1QU4A 4AF0A 3VAVA 3FXGA 3IK2A 1O4UA 4DBSA 1AFSA 2Y8KA 1PX3A 2ISFA 4LRTA 2CBVA 1ZHAA 3HO8A 4OT7A 4LBUA 1E56A 5CLTA 2PE4A 3STFA 1B9BA 1RCXB 1NWTA 3BV7A 3W7LA 1X39A 3T78A 1XLGA 1UD5A 3FSUA 2Y61A 4S3EA 2OQLA 1XYFA 2CLLA 1KM3A 3IARA 1RD5A 3CUZA 3VX0A 4LAMA 4ZO9A 1PXGA 1JYVA 1W3IA 2OEKA 2WSPA 5KTLA 1VENA 3BLDA 2DU2A 3P8IA 4F3HA 5HK4A 4P5UA 3UT0A 4RE4A 4HCHA 1R46A 1E43A 1I45A 5BCAA 1ITXA 1FKXA 2EJAA 3RCNA 1GVFA 2EHHA 1EO5A 1Q6CA 2ONEA 4MZYA 4OHQA 4GNVA 1XG4A 2J9ZA 1R7AA 1TA3A 4B3ZA 4XISA 3IRSA 3V1HA 1X6LA 3O6DA 1RK6A 2PS2A 3PPHA 3S6TA 1TWZA 4EPKA 5HOSA 3LN3A 4JYFA 4DJFD 1YW1A 3W4RA 1ISYA 1OIFA 1A5KC 3OIXA 2E3ZA 2WMIA 4I7WA 1QBAA 4DBUA 2P10A 4M80A 5CC5A 4JBRA 3GU2A 1A0EA 4HU0A 1FQ0A 3WBAA 1FUYA 4LAZA 3ABSA 1KM5A 5AN7A 1Z32X 4LJ3A 2GUBA 2OQHA 4GLEA 1U30A 4GOAA 1KXHA 3B0YA 4GJ1A 4CNNA 1KWGA 1XFBA 1UC5A 3W02A 1LRNA 5FEXA 3BLIA 4KMQA 1UP0A 3ICJA 3T8LA 3DECA 3W81A 3EPMA 3WBWA 3TJIA 2JE8A 3UGVA 2QF7A 2RDUA 1LQ0A 4KPLA 1T0OA 1V0MA 2RJHA 1VFSA 2ON3A 1TKKA 5F4XA 9XIMA 1QOPA 2DZAA 2XWDA 3FY1A 1OZQA 1GJUA 1DJHA 2Y5JA 3PC0A 1WDQA 2Z28A 4M81A 4PTVA 4MVAA 3HTWA 3RLUA 4PUEA 4PH6A 4XAGA 1FCBA 4B4HA 3BGAA 3MP3A 3W1TA 4DRSA 2QR6A 4MB5A 3W2KA 1WKYA 4U3CA 3JRKA 1A0CA 3FAXA 3TZFA 1PIFA 1PTDA 3DENA 4M3PA 3LTYA 3CZJA 4O28A 3KZSA 2ZUNA 2WK2A 3I4EA 4JTGA 4C6CA 3DHDA 3LS9A 4I5XA 5D32A 2J8FA 4Q7IA 4S3AA 1EX5A 4H7CA 4E4FA 4MM1A 3UFYA 3R58A 4WOQA 4O13A 1TSIA 1B5TA 4YVVA 2C71A 4NZ5A 1EPXA 2WCGA 3LHWA 1TYGA 4Q22A 3PBUA 3RR4A 4XG1A 4C6IA 1EXPA 1P7TA 1E1FA 3MC5A 1ZCOA 2QJGA 2FVLA 2F61A 4QTGA 1L6GA 3UETA 4GRSA 2C8NA 3GUGA 4NG3A 3AIBA 4WR3A 2OG9A 3ARVA 1JF5A 4H04A 5LHFA 4PMNA 3EAUA 1OX6A 2GK1B 3PUDA 3AYVA 3PBVA 3QW3A 1XGZA 3AO0A 1ITQA 3OTRA 1F76A 4HTYA 1F05A 3H2OA 4JFUA 2G3NA 4H8VA 4W5ZA 3S1XA 1TTQA 1E9IA 3LPGA 1S38A 2EPHA 1JPHA 1XQLA 1EO7A 4PMZA 4N02A 3WKZA 4C6BA 2BXVA 2V2DA 1UD3A 4Y90A 3LSCA 1ADOA 1BVNP 1HKWA 1LLOA 3MYPA 1AW1A 1W1YA 1DJGA 3SY5A 1W1PA 4ZQPA 2O92A 4L56A 3F2CA 2QJJA 3UEQA 4JQ3A 1YTDA 2X2YA 5FOOA 1UWQA 3TTOA 4AY1A 3PZVA 4OBTA 3HQOA 4GXPA 3DYPA 1Q2RA 4L5ZA 3BQ6A 5FJOA 4K36A 2YSWA 1OYCA 1NF0A 4MADA 3UPWA 5LZLA 2VFEA 1IZKA 1AQ0A 3G1AA 1EX1A 4WSHA 2EF9A 4O16A 3IK4A 1H1ZA 4L6HA 1UP3A 3FXYA 3PS7A 4BEUA 3RFAA 1OC5A 2P50A 1NSJA 2ACSA 3LX9A 3NL3A 5DBUA 1ML1A 4D6HA 1B4KA 4WK9A 1G5AA 1FVPA 1X1NA 3EWBX 1RD6A 1UH3A 2J7DA 2XN0A 3O2LA 3RF9A 3G1RA 4AMCA 3CAKA 2XSXA 3SSJA 3O6YX 3AJ7A 2WB5A 4QX4A 3GFZA 1K4HA 5ABEA 1PTGA 3BG3A 4F0HA 1PKMA 1KFLA 2E7FA 1AH3A 1JD9A 5I07A 4C1KA 2BZNA 3TAOA 3T42A 2ALDA 3MI6A 3H4GA 1ONEA 2F84A 4LXFA 5CSUA 3VNMA 1MW3A 1NIUA 1FTXA 4PUDA 3W1RA 3MUAA 1ONWA 1DTNA 2ZKMX 2NZLA 3H26A 1RZMA 3G1FA 1XBYA 2PDJA 1I75A 2J88A 2DJXA 9RUBA 4HGXA 1O95A 3QLDA 5A94A 1VR6A 1ICPA 3WDQA 1EYWA 1SO6A 4LUSB 4JKKA 5MKGA 2AQOA 2WPGA 4EF8A 3GG8A 1FDJA 1IWPA 3V75A 4WKAA 3LM3A 3P2VA 4W84A 4Z2IA 1WQ5A 5CH9A 3MUIA 4HA4A 3BANA 1TJRA 3NFUA 2QCFA 2IPWA 3VFLA 1FOBA 4DAFA 2OX4A 1VZWA 3A3XA 4WVXA 3GR7A 2VGBA 1VIWA 3IIXA 1JYWA 1LQ2A 4GC3A 4RDZA 2QCDB 4N6EA 2TRSA 5DMYA 3RNDA 1ECQA 1GQJA 2NW0A 4XIMA 5HJLA 1G6CA 2R1NA 3C0LA 2OZTA 3VUSA 1UUQA 1L2UA 4DO7A 4IGSA 1XV8A 4NHVA 3BW4A 4O8AA 2YR1A 3PP7A 5EL1A 4J3XA 1T7LA 1G7VA 3CUXA 3VMPA 2WZMA 1UBPC 3G0SA 4UTWA 4H9VA 3KRBA 2JKEA 3N04A 1BWLA 1QI3A 1CT5A 3GH4A 1R3WA 1QHPA 4Z1CA 2SFPA 3MV11 2DZWA 2OLAA 3C4UA 4NJHA 2Z1VA 1NFGA 3FKKA 3NJ3A 1SR9A 1PZ2A 3W22A 2CW6A 4AY7A 4EVZA 1AQHA 3WEZA 3B03A 3RPMA 1E0WA 3NPWA 1A4LA 1U1HA 5I09A 2NQJA 5JQ9A 3KAOA 1E6ZA 7ENLA 2EPNA 3VIFA 1SMDA 1V02E 1ODZA 5H1WA 4K8EA 2NVCA 2CBIA 3N25A 2BX7A 2QUMA 5DANA 1Q4WA 4B5UA 3HGRA 1R6WA 4UZSA 1KM4A 2FGLA 1AW5A 2DT3A 2QPUA 3R94A 2RDTA 2XYLA 5I02A 5GJPA 1R9ZA 4CCCA 2VM8A 1XBVA 2WSQA 5C9RA 5G5IA 2JF6A 3BLPX 5IOBA 4PMJA 4LGXA 2ZCGA 3N2CA 4JTDA 2XIOA 5M3WA 4TR9A 2BVWA 1J12A 4Q8NA 3NA8A 1FY6A 4X2PA 3BTNA 3CMJA 3O8AA 2VGFA 4LU0A 4ZODA 4WY0A 3AHTA 1WDSA 1IXQA 3EOEA 3PSVA 2G4FA 4HSHA 3W7EA 1PJ9A 5FL0A 3NAVA 4BQ3A 1LOLA 2HJPA 2EO7A 1V79A 4Y6GA 2E5CA 1C8VA 3BSHA 2J7FA 3CLWA 2XM2A 1B3OA 2ZUSA 1B30A 2H90A 4BA0A 2V68A 1JI1A 4HYVA 3CUFA 3W3OA 3U8GA 4D9PA 3S8HA 4Y8EA 5AHIA 4QHRA 3LGGA 2Z7GA 4F2UA 4FNTA 3W7OA 1VYSX 3MDUA 4N9BA 3PBMA 3T0DA 3RM4A 4HNLA 2V3GA 1F6KA 3DC0A 4WY0F 3VINA 2NLIA 2EG7A 3CHEA 5A8MA 3PG9A 1UROA 3P93A 1W1TA 4KGJA 1VHNA 3IAPA 1KM1A 5T9CE 1FWDC 4D72A 4YHGA 2BOFX 2WC4A 4GI4A 4GI9A 1UIPA 3EKGA 3GC2A 4HK7A 4DJEC 3L0KA 3OLDA 1JFHA 3L0NA 3WQ6A 5FI8A 2XHYA 4GVGA 3EWCA 2P0OA 3VNYA 1UHVA 4DJFA 1DIKA 3W85A 3BV4A 1IZCA 4JTHA 3B97A 1H0GA 3NGFA 4MLRA 1V02A 5HNRA 3TR2A 1VHCA 5BOEA 3RUBL 4IIGA 4MFEA 3PM6A 4ZXOA 2FHBA 4ZQRA 1KXTA 1OX4B 2VXNA 1IIGA 1TWDA 4UTHA 1XP3A 1VLWA 2PC8A 2EAWA 1M7PA 3M5VA 4Q7BA 2Y8VA 1CLKA 1FBAA 4E2VA 5FL1A 2VJXA 3W72A 2OYLA 2ZTJA 1HX0A 7PTDA 4GIAA 2XVLA 3LXAA 3DFQA 1DXEA 3CAWA 2BY1A 4GFSA 1EJUC 4DXVA 4J35A 5CAKA 1K4GA 2QXWA 3VU2A 1H0IA 1ME8A 1TJ2A 2R6OA 4XAPA 3PUOA 4JYDA 4C6LA 3E12A 2GUUA 3BGJA 5I3FA 1GGOA 3FDGA 5D8WA 3QY6A 1REQA 4PUNA 5M03A 4LOCA 2NQZA 3R10A 2YCLA 3DYOA 4HA0A 5BROA 3ZR4A 4KRTA 2OODA 5EBAA 2I5QA 4AHPA 2PU1A 1UKQA 1XDLA 3WMBA 2R91A 1LT7A 3K30A 2R1PA 2WSKA 3GIQA 2YA2A 4O57A 4FP1A 4BR1A 3RDKA 2C0HA 4O0KA 1VJIA 3OVRA 4CQ9A 2CHNA 3AZRA 4WOZA 1S5TA 3GVQA 4ZQMA 3QEZA 1OD0A 1B57A 1R87A 1H7PA 3R1ZA 4IXXA 3G8RA 1JEZA 4ZEPA 1P6CA 3M16A 1DHPA 1KLZA 3M0YA 1UWUA 4GY1A 4RKAA 5XIMA 5K3VA 4W86A 5A95A 1TE6A 3GIPA 1PUDA 5JBFA 4RDWA 3UWEA 5HNNA 1XUUA 4GFIA 3EMZA 3B04A 1WZMA 1X7FA 4M5PA 1G1YA 1OABA 5FJRA 4CQAA 1TREA 4D8AA 3S46A 4GYPC 1SW3A 3V5OA 1KM2A 3KLLA 3VGHA 3TFCA 4Z2GA 3K1GA 1J2BA 3CEUA 2ZZ4A 4AXKA 2GGEA 1Z9AA 3WL1A 1VGAA 3F4VA 3WK2A 2JEQA 2H6RA 1CW2A 4LVDA 2H9AA 5E09A 1BQGA 2J13A 4D1JA 1TTPA 1ZGDA 3BVJA 3QFEA 4LH8A 3STGA 4Q33A 2VTFA 5TNVA 3SCOA 3R8RA 4XUYA 5XINA 2BGNE 2X09A 5I23A 3BWWA 1UASA 4OBRA 2E0PA 4LVBA 2FIQA 4G1NA 1TRIA 4DJED 3QQ0A 1W1ZA 3T7VA 5C2CA 2ZXBA 3UJFA 1JIBA 1DOSA 1G67A 2B7PA 4C1NB 4K39A 1JRBA 3OLGA 3SUVA 3WLRA 4FX8A 2EG8A 2PZNA 3M0IA 3MBDA 1L8NA 5DF0A 4QJ1A 2J47A 4Y9AA 4WQ6A 1J0JA 3W7KA 1NOUA 3UXDA 5A3HA 2F2HA 4NI8A 4X0NA 1UKSA 1LF1A 1XS2A 1J79A 3NQMA 3VZXA 3OGVA 2YGYA 5F2IA 4JR5A 1W3TA 3TQ0A 3KEHA 3W00A 5AHFA 3G1VA 1OG6A 4J1OA 3VNZA 4TVCA 1XLIA 3MMTA 4ZTYA 1OINA 1S1PA 2F6KA 1OY0A 2QGYA 2YL6A 4OWGA 1JUKA 3NO5A 2XH2A 4Q8OA 3WK3A 3LENA 3S2MA 4J3WA 1Q66A 1DJXA 1IWBA 1MFVA 4BWLC 1W9XA 1RY0A 4L9XA 4R9XA 5RUBA 2D22A 4FLOA 5D2VA 4QJ4B 4XVEA 4A3UA 1UQYA 2PTWA 5I3KA 3B9NA 2GDVA 4JIQA 1TIMA 1H50A 3AQUA 3TSBA 1PTAA 3A9IA 3WLHA 4D6GA 1RALA 2VFIA 2XFWA 4V33A 5C2GA 1WNOA 3FKRA 4JTIA 3QFWA 5A8GA 2Z29A 3ZWTA 5A8PA 1MZHA 4CD6A 1KFBA 1QNVA 3NM1A 4NIRA 4LEFA 4AISA 4TUFA 1XIMA 2ZA2A 3MO4A 3SZ8A 3EDJA 2FFCA 2CHRA 4UMAA 2Z1BA 4OUIA 3A9BA 3KHDA 1IXNA 2O56A 1MZRA 3DESA 4PCSA 2PDMA 3IJQA 3HJEA 1VRDA 2CLIA 3OP2A 4AX7A 1SFSA 1VBGA 4JEQA 4U3AA 1Q4NX 3RJYA 2PTXA 4U31A 3EX2A 3W9ZA 4EAMA 2WHLA 4JTFA 2A3BA 1Q7MA 1DV7A 3AIVA 3FCPA 1TX0A 2V8ZA 1OD8A 3ZQ9A 2ZRWA 2QCNA 3IGHX 1E9ZB 3GAYA 1AODA 3GK0A 3KBJA 3VMOA 1KFJA 3B4UA 3QH2A 1HKJA 4O1DA 2OT1A 4AC1X 3WFAA 2X41A 2RJGA 1E0XA 3LHVA 1R30A 3MHUA 3QW4B 5AY7A 5I3DA 5EYWA 4QXIA 4Y9PA 3UERA 4MHBA 2ZQ0A 1B3ZA 5FCZA 4Q4KA 2D0FA 2Q09A 4QE4A 2GOUA 2D2HA 5FJUA 3AIUA 5E6YA 4D6DA 3SGUA 3GQYA 2IPGA 4KWVA 1LWJA 1KWKA 4I9TA 3W6LA 3ARUA 3SDOA 4UTTA 4I9JA 2JF7A 1CI1A 5CSSA 2QUNA 1JAKA 3LA4A 4BQ2A 5AC4A 5JBEA 1RBOB 3LPPA 1AZ2A 3TXZA 3ZFHA 2YYTA 3SB0A 1A5MC 3QRHA 4GZJA 3EWXA 3HIJA 3HFTA 4PB5A 4H3DA 2ZZ5A 1Z89A 1Q6LA 1KBJA 5LXXA 3VE7A 1XBZA 1MQPA 4Z1AA 3OGSA 1LRTA 3PG8A 3UCQA 4GUFA 5AHNA 2PDIA 1FWRA 3BOFA 3P80A 3SGGA 3THUA 1UPMB 3FEQA 2CLKA 2QIIA 3LK6A 5LHEA 1BG9A 2C13A 2VVNA 3KVMA 4FZIA 4ADSA 3FJLA 3CH0A 2Y89A 1WA3A 3LUTA 3UJRA 5HNUA 1OGSA 3SAZA 3AOFA 1T99A 1VBUA 3N9SA 3W7NA 2UY3A 3ALFA 2QUUA 3V0UA 3CO8A 1H7XA 1RP9A 3EYPA 3SN4A 2VX5A 1SW0A 1TTJA 1FWFC 2QCGA 4AVNA 3EPNA 3FOKA 4HMEA 3SGZA 1UUMA 3U2ZA 1ZBWA 2D1ZA 1UKTA 4JX6A 3W2UA 2AL2B 2XN2A 3C8NA 3CQJA 2R1KA 3RIKA 2WKLA 1BKHA 2ZX6A 3LCXA 3TW7A 1DQXA 1YPFA 2IMRA 1V51A 3LHUA 5GNZA 1FP9A 2V5KA 4BI7A 1SO4A 3W82A 4GK8A 5ABFB 4UQEA 1VFMA 3N6QA 2DSVA 3PANA 2GJPA 1B4EA 1DWFM 5CC3A 2PWFA 5AB3A 1OFOA 1SZGA 3WZ0E 4LBSA 1EDQA 1AG1O 2GSEA 3LLDA 3O15A 4B2DD 3FA3A 2HDJA 3W2NA 1EJTC 4LC6A 4PSRA 4WJ8A 1MDLA 4QE1A 4IICA 5CZ0A 5FF2A 4IQLA 2EPMX 1TPEA 2BG5A 1NEYA 1QUMA 5M1TA 4W7WA 4EOUA 4ECLA 1T41A 4ZB5A 3CHVA 4YTUA 4RNIA 4O8RA 4K6AA 3G1YA 3M5YA 3M0HA 4AZ6A 3HPAA 1RCOB 1J6OA 4UTIA 3GXPA 4N4PA 1O66A 5KZEA 3W7JA 4JTTA 3MWCA 1Y5VA 4OKDA 3E2VA 2GJXB 5F4SA 4ALDA 1E6RA 1FWAC 1GT8A 2RGLA 2WZIA 3O3RA 3ECQA 4LUSA 2VQTA 1TPFA 1AD4A 1WZKA 4GUGA 5BOOA 4XBJA 2X40A 1UZ1A 4HPNA 3GVRA 3TCEA 3LCWA 1U5JA 3O9NA 1UB3A 5D05A 5DMLA 2A0NA 3M7SA 3KCOA 5HR7A 3KUMA 1GTEA 2A6LA 4XSMA 2G97A 3I7SA 1H2JA 3MKKA 3N13A 3ITLA 4XD4A 3XIMA 2X8RA 1EC8A 5D9PA 2CLMA 1OCQA 1QASA 4D71A 3CM4A 3T4CA 3TWBA 3EWUA 2Z24A 3I3EA 5C71A 3IVSA 1V6UA 4Y9NA 1C7TA 3EDFA 1E71M 1TR9A 5BYWA 2YW4A 3D5HA 1SJCA 1PDZA 2V2HA 4QDMA 1JYNA 1GW1A 1WDWA 4ZGYA 5FAGA 3ITYA 4Y7EA 3NL5A 1OCBA 4RV8A 4BF5A 4XZBA 2DZVA 1KRAC 4H01A 1K6AA 4LUTB 2XVPA 1HFBA 1WUEA 1XIHA 4MPKA 1UZHA 4ZOAA 2ZICA 1AZ1A 2R1MA 4JGDA 4ONVA 4KBXA 3QKEA 1UR0A 1D3CA 3PBYA 1NY1A 4A3HA 1K7EA 3GWQA 3R79A 4TV5A 1OYAA 3KCLA 4OJYA 4XKYB 2PF0A 2YXGA 1R3YA 3GUWA 3G1XA 2VZTA 4H4IA 4H7ZA 5D38A 1FCQA 3IRDA 3UWVA 3FVDA 2NQHA 4UC5A 4AZIA 1BWVA 4B90A 5D30A 8A3HA 4B5NA 5DT7A 2GWNA 4KRUA 4DELA 3T07A 3C0SA 1DE6A 3C2VA 2PDUA 1GVEA 5HWJA 1UYQA 1VQTA 5H8MA 3FJ4A 1TMQA 4WGXA 1K77A 2VFGA 3W1UA 5HWMA 1IWAA 1XLBA 3WF1A 4DUXA 5E9XA 1CECA 4LF1A 4PUJA 3A4XA 4TX6A 4W89A 1WXZA 5I6SA 4RLIA 3IJIA 3K13A 2XFYA 2PWEA 3E38A 4L4OA 4JN6A 1WUFA 3EBVA 4DNMA 1LL7A 1R3SA 2TODA 5A6MA 3APGA 4G7FA 4GG9A 5E1QA 8RUCA 4MOZA 3WH8A 4X9SA 1XLMA 4C5ZA 3SQSA 4QG9A 4A05A 4IMGA 1LORA 4HZMA 3FDKA 3K1DA 3BICA 3VIJA 4JICA 5D2XA 5DXXA 4ERIA 1SO5A 4UUIA 1VP5A 3BCFA 3PZTA 4HHMA 1CGYA 4IH3A 3WELA 1GHSA 2W61A 3T8QA 2E1WA 2W4XA 4ZOCA 3VDGA 3WJZA 3L68A 5HMSA 2DSZA 4S3KA 2Y7FA 3GTNA 1H60A 4ICNA 5BMXA 1GTHA 1HKKA 1XIIA 1BF2A 3WLKX 4X0VA 1UA3A 1VFFA 3CTTA 2FHCA 1TV4A 2H8XA 3NO3A 3WNNA 1KB3A 3ZJKA 2ZUUA 3WQ8A 2NV2A 1BHGA 1R9XA 4C7FA 4CQBA 4WHBA 1PWMA 3HMCA 4AW7A 3ARYA 4JTAA 4LYRA 3M46A 3M0JA 1M04A 5K9DA 3W7RA 4GUHA 4AIOA 1OGGA 2QPSA 1OCNA 3LV5A 2J6XA 3VK5A 3CWNA 4HN8A 2C1IA 4I5RA 4JFSA 1CXHA 4ZO7A 4UQ9A 4Q32A 3GU1A 3CC1A 1FHLA 1H63A 4ZSUA 4MPQA 2VT0A 5E9AA 3N14A 4W7UA 1QO5A 3D6NA 1W9DM 2X1IA 3P84A 2VC6A 4B3KA 3C2YA 1TE1A 2ZX8A 2PDHA 2DQWA 5LNSA 1Z8AA 2DPEA 1MUWA 1JCYA 3N4FA 4D6JA 4HHPA 3CT7A 4H41A 1J8VA 1EOKA 3OZMA 3U0HA 3KOWA 4LCRA 2CLHA 1Q13A 3KBVA 3GIYA 5K4ZA 3FFSA 4QJ5B 1JDAA 3H7RA 3R5EA 2YW3A 1YADA 3LCIA 1JD7A 1NDYA 3LLXA 3KVJA 3L23A 5E5CA 3EA2A 3G5EA 3JU2A 1K03A 4KQNA 1VPXA 1QAPA 5K9XA 3GG1A 2DT2A 4IISA 3AYTA 4XAZA 1NARA 2V69A 4Z08A 1E72M 3HM7A 4PN2A 5G2HA 3TW9A 1S5WA 1UWTA 1JRCA 3NQBA 4GCAA 3L12A 4HPHA 2YL8A 3WJSA 3BLFA 4F0SA 2V0TA 2BV9A 1TPWA 1K8ZA 1PO9A 1K6WA 1HO4A 4H9XA 1CENA 5A2CA 2HEJA 1LJYA 4E2BA 4IOTA 4PMUA 3S2NA 1V08A 3QOKA 4TOQA 3R25A 5CBJA 2PBOA 3ARZA 3ITTA 5EB8A 1LP6A 3WF3A 1Q6FA 3C3UA 1M41A 1YXDA 3LCGA 3E2RA 3BCJA 4IPIA 1BFNA 1EWEA 2CZDA 5L6UA 4M0XA 3VFCA 2NUWA 3UXLA 3OYXA 1M7OA 4IZGA 5LNUA 2VO5A 7REQB 3QPEA 2HE8A 1EIXA 1EYEA 1OQFA 2WZEA 3BLOA 3HQPA 4OIFA 4PUKA 1BWKA 3ABOA 3H54A 2X05A 3DFSA 2V3DA 3CO4A 3NQVA 1YTEA 4LY8A 4MDOA 3TJXA 3NSMA 3TV8A 4AZBA 4MSSA 4W87A 4C1NA 3TTYA 2VFHA 1V03A 1DIEA 1KBIA 2A3LA 4AX6A 1RPKA 4QLLA 2CC0A 3G0UA 4XTIA 2VC9A 4LNCA 3BCDA 2OXNA 2G8ZA 1VEPA 1PIGA 3ME3A 4Z1YA 1JI2A 3GE7A 1P0NA 3EX1A 2X42A 4PMRA 4B5XA 1F6PA 5DLCA 4YS1A 4EXAA 3R12A 4PEEA 2A4AA 1J18A 2E6AA 1GORA 5EA9A 2VZVA 4H2HA 3I6RA 4WX2A 2O7QA 3AMDA 3NURA 1XISA 1DWGM 1FA2A 3LXBA 3BH4A 2BGQA 3KE0A 1V4YA 4JNYA 2VR4A 4GIYA 1GPWA 1KBKA 1MDRA 3ZJ6A 3A21A 2BY2A 4H19A 1B9ZA 4KWWA 3WD1A 3YPIA 4ADUA 5JIPA 2BVYA 3KTCA 3PPGA 1E5NA 3RCMA 1P1MA 1QRQA 1ISWA 4GO9A 5IBXC 2YDRA 2J7EA 4HSNA 1JUEA 5AHLA 5G4HC 2Y7DA 2HMCA 1WPCA 5DQPA 4WKHA 4UR7A 4FNPA 3B8TA 2RDWA 1WOBA 1H09A 3N34A 2XVKA 3W1NA 4AZ7A 3LCLA 4DWSB 3VOCA 4GBDA 1L6SA 4ZTXA 1CB2A 4DPPA 4LSBA 1TPC1 3DHPA 3UWQA 1DJQA 3PBGA 3PWAA 1AUSL 3M5XA 2J7CA 3IIZA 4W85A 4HSOA 4NP7A 2YCEA 1KBBA 2KX9A 2C16A 4IPPA 5DT5A 4AF0B 4RNHA 4JIRA 1A5CA 3WLJA 3GY1A 1M3UA 2IPJA 5DMNA 4IM4A 1NTHA 1FDZA 5DMMA 2P8BA 3R13A 1YNYA 1DTUA 2J66A 4FI4A 3HZ3A 3RPTA 1OFPA 1WB0A 2WLYA 2PAJA 2OLSA 3ZJ8A 1XLLA 1UR3M 3ITVA 1ZJHA 2WM1A 1DWAM 4MGGA 5D03A 5GNXA 4DBWA 5I5RA 3LPOA 2GDQA 4HT3A 2HV5A 5KETA 1R0MA 4V27A 4A22A 3MKVA 3RU6A 4H8HA 3L4XA 2BASA 3UW6A 3KTXA 1IT0A 3D3FA 3VNKA 2IKIA 1TO3A 2QCMA 1SGJA 3H23A 3CUGA 2BP1A 4DYEA 4X63A 1IR2A 3WYZA 3FYPA 3SCSA 3UR2A 3KHJA 2GJRA 4WUIA 1L0PA 2VX7A 2W79A 2ISWA 2CLEA 5LIWX 4JFWA 3VMNA 5C9UA 4JXCA 1H1YA 1KM0A 4TV6A 4GZ7A 5DN1A 3APYA 1A0DA 1UPPA 5HJXA 1J9YA 3C0QA 1J01A 1GOXA 2DIEA 4DWSC 1WE5A 2PLJA 1WYIA 4LTSA 1Y5WA 1S5VA 3A24A 1TA3B 4AD0A 4R33A 4W9TA 1UWSA 3VGFA 3RRAA 4IPJA 6TAAA 2CCRA 2FGBA 1M68A 1V6YA 4NX5A 2WMIB 5FSDC 1NDWA 2JGYA 1WDDA 3SR7A 4GVHA 2FB2A 1FXPA 4DYKA 1EZ2A 5DX7A 3MUZ1 1E6PA 3F2BA 4WIWA 3ENLA 1P0EA 5EU9A 3CGTA 1QWKA 2G50A 4XBKA 4Z42C 3VYLA 3WQGA 2FJKA 3T44A 4HNTA 1TPUA 4JQ4A 3SSZA 4XQ6A 1BYAA 1EZWA 4MZ1A 4PYSA 3COTA 3UPMA 4YYFA 4HPGA 3CB8A 4AZ5A 4S39A 4PMYA 1GPFA 3CHFA 3KS5A 3N19B 3SCNA 1QW8A 3CYVA 4KCVA 2UBPC 3B9EA 3KRZA 4L1GA 2QPXA 1OFQA 5G2IA 1FX6A 4WRHA 5D2YA 3GC4A 2Z4GA 4G7EA 2PDWA 4PBGA 3E02A 4LPCA 2IUZA 3W24A 3ZYZA 4QQUA 4BS0A 4YLWA 1V77A 4FNRA 5BW6A 4H1ZA 2ZXDA 2BHZA 4J3VA 2B7OA 4FPSA 1WKFA 3UJSA 1ZJIA 1KLYA 3ZOAA 3G3MA 3DIPA 4O19A 2QJNA 3TJ4A 2D73A 3QQ1A 1DVJA 2AL2A 4KEZA 3KL0A 1XLEA 1XLFA 2XGBA 4H9ZA 2PTZA 2YDSA 3SY1A 3EDDA 4A3RA 1Q6GA 2YCIX 3LCHA 2YFOA 5KZDA 4QG8A 3JS3A 4R7WA 3W7MA 1M5WA 3AIWA 1P7TB 1QNQA 4BCEA 4BKNA 2X0YA 4G5DA 1R3RA 5LA2A 3BE7A 3W1XA 4HVXA 3FGCA 3RN6A 3VE9A 1MRQA 1BEUA 3O6AA 5DXYA 4DWSD 3TNOA 4Q4SA 2WJZA 1W17A 1J5SA 2DZUA 4Z2LA 3R7MA 3ZR5A 5HMEA 5F1UA 3NDYA 1TV5A 1JR1A 4GY7A 1PS9A 2ZWYA 1FWWA 1PB0A 3CASA 1RP8A 4B9YA 2C3ZA 1WAWA 3TTQA 2E9LA 2XIQA 4J3ZA 1GZ1A 1WO2A 3IGUA 4HNUA 1YIXA 1W54A 2W9MA 3NQFA 3M0KA 4OV9A 2PGEA 3AMKA 2F38A 5LA1A 3C6CA 1KRMA 3V1PA 1ZCCA 4FK9A 3C61A 2BSLA 1V3HA 3BJFA 1HW6A 1IXOA 2X2GA 1BAGA 4JOMA 2BHUA 2D2JA 4D6IA 4HZ7A 1V5XA 3UG3A 1O7AA 2CYGA 1C92A 1E0TA 1Q8AA 2EQDA 2A79A 3PULA 1X96A 3HPSA 2VFDA 2YLAA 2HE5A 4HN4A 3OJGA 4ACYA 5CBBA 4N6FA 3LBOA 2PLMA 2IKGA 4NVTA 1MEWA 1IGWA 5C5YA 4GQBA 3LPFA 2PDLA 4TXEA 2WSYA 1G7UA 3WNOA 3BOLA 4TO8A 7XIMA 1GOKA 1HGYA 3USBA 1H7OA 1HVQA 1RK5A 3ZT7A 2ZBTA 3GBDA 3TONA 1LLZA 5HQLA 3QV9A 2RDXA 3MZ2A 3GDTA 3NQ8A 2OELA 1PVNA 2A1YA 3KVKA 3VD3A 1JCNA 1HJVA 4P8VA 4E38A 1EJWC 1Z69A 3UA4A 1W5QA 3H2CA 3C0JA 3CWHA 2DIJA 3T40A 2OMAA 3KW3A 3RX2A 3EXRA 2V81A 2F6XA 4BF9A 3P3BA 1Q6EA 1V7AA 3OLIA 1SVDA 4U33A 1H3GA 5DRCA 1JZ8A 1IQ8A 4YXGA 3FEMA 2E40A 3L9CA 3P5ZA 3GFXA 1GWJA 2YYUA 4ML9A 3SRDA 3K8MA 4LC8A 2GZXA 1S2WA 5KINA 1RLDA 4P7LA 3ZMRA 3REQA 4RE3A 3GNRA 1B3YA 5MKGB 3V3WA 4H2CA 5KSWA 4FXRA 1L6WA 4XKYA 5CG7A 5IDZA 1R7OA 4HU3A 1XSIA 4S1FA 1CGTA 4M1BA 3DFNA 2HK1A 1YRRA 3H7UA 2E6YA 4FX6M 2EJ1A 3RJXA 4C5YA 5D2WA 5BXRA 2G4JA 1NH6A 4LQ1A 4P7RA 5JUVA 3EB4A 5T9BG 4S3BA 1VB9A 1XRTA 4BJHA 1D8WA 1MO0A 5HQEA 1E1CA 1XYLA 2CFFA 1AMYA 1XYCA 4QG6A 5EMLA 1ICSA 4NZFA 4LUIA 4NJKA 2BHYA 2IKJA 1RY8A 3VZZA 2O4MA 2XIMA 1OFEA 3LXCA 1P0DA 4RX0A 4HJFA 3BDKA 4HYRA 3NTYA 1GYMA 4I7VA 1HKVA 2YBUA 4F9DA 3VKAA 2BBFA 1YXYA 4JKMA 1ZSXA 2BOGX 4DBEA 4ZQCA 3NGJA 4QM1A 2CIPA 2Y24A 2E4TA 2PURA 4F79A 1R38A 2Q8LA 1XRFA 3TEVA 1MVYA 1J2WA 1H1NA 1NM9A 4ZBCA 3T9PA 3WLLA 2D2OA 3TA9A 4G2DA 3H6OA 5CGMA 4ZENA 3T2QA 2GQ3A 4HTBA 3W73A 4JY8A 4DZIA 3WLTA 1UW9A 3V16A 1KW1A 3W26A 1IZJA 3A5FA 4HJWA 3A47A 4BK9A 3WUGA 4C1LA 2HCVA 3O0FA 4NU7A 2R82A 2FPYA 2Q71A 3THQA 4JAWA 1E1EA 3MMUA 4DLFA 3UR5A 3WF0A 2Q01A 2FZ8A 1SFLA 1HG3A 5HUPA 2CLOA 1GEHA 1I1WA 2AKMA 1BXCA 3DUGA 2FPVA 4AVFA 1PHWA 1OEPA 1RV8A 3W2LA 3WQ5A 3AU6A 4OUEA 5CGQA 1J5TA 2ACQA 3P5YA 3RO6A 5J04A 4LX4A 1UP2A 2C7FA 3W7IA 1MNZA 2I17A 3KDOA 1F7BA 4DJDA 4B3LA 1TWSA 1W9PA 3U2CA 4JQAA 5BMWA 4CLMA 1JCTA 2GGHA 2ICSA 2DZSA 1TCMA 3NZRA 3UXAA 3VD4A 1HZYA 3GDRA 4HCLA 4OBSA 1FRBA 2YA1A 5I00A 4GHRA 4CNTA 4AD1A 3B4YA 1V6WA 4EK7A 2XDFA 2VEIA 3LHYA 3KOYA 4LW7A 1W9BM 1EGZA 3WLPA 2XU2A 2HK0A 2QHAA 3RYSA 2A3EA 3U2OA 2VEPA 2B31A 3S2LA 2NQ5A 1W5MA 2CU0A 4TIMA 3VGDA 3BQ5A 3D3AA 3MO7A 3URQA 3WNMA 1OADA 3TC7A 1ZJAA 4ENLA 1LYXA 3F5JA 1XBXA 4GJJA 4LVFA 1CDGA 1ZFJA 2HISA 3GXDA 4S3CA 5TQLA 2A21A 3AS3A 1XW8A 3ZT5A 3F2DA 4Y9MA 3T0BA 1ZZMA 4K7VA 1S1RA 5JIWA 4A8LA 2UWFA 1EP2A 4PUWA 2OEJA 2NXGA 4XAFA 3GTFA 2AAMA 2ZADA 3Q65A 2ZX5A 3GXTA 4L1XA 3AHYA 5HULA 1AL7A 4LAKA 2AQWA 3TR9A 4M56A 3HPZA 5A2BA 1XXXA 4NY2A 3ZWSA 3OODA 1KFWA 2Z2BA 3PWIA 3CU2A 3W2JA 4HKPA 3RX4A 2JIWA 3I7QA 4M6QA 2NT1A 2DZTA 1E73M 3Q67A 3IV3A 3CPRA 1IEQA 5HPCA 2QMJA 1GJWA 3BPWA 3HF3A 2FMOA 3UZYA 5CLWA 3JZUA 1ELSA 2QKFA 3W7CA 1V3JA 1E6XM 3UPBA