3ONBA

Bond breakage and relocation of a covalently bound bromine of idd594 in a complex with har t113a mutant after extensive radiation dose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Radiation damage reveals promising interaction position
pubmed doi rcsb
total genus 102
structure length 311
sequence length 311
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3onbA00
2IKJA 5HNUA 1K8CA 2PDJA 3WBWA 3CAVA 2PDWA 2BP1A 4AUBA 2BGSA 2FVLA 5AZ0A 1MI3A 2IPFA 1EL3A 2I16A 4PMJA 2I17A 1R38A 5AZ1A 4PUUA 4JTDA 1XGDA 2HEJA 4XAPA 5LIXX 1AH4A 2NVCA 3FJNA 2R9RA 4WDWA 4PR4A 4XO6A 4R9OA 4DBSA 3WBXA 2DUZA 4XVDA 1MZRA 3BUVA 1OG6A 4XK2A 1QRQA 1UR3M 5KETA 3H7RA 4PRRA 2IKIA 2WZTA 1MRQA 3C3UA 1VBJA 3Q67A 1YE4A 2BGQA 3UYIA 3FX4A 1C9WA 1X96A 1ADSA 3V0TA 2PEVA 3R6IA 1M9HA 1EF3A 3WBYA 3H7UA 5HNTA 1S1RA 3BV7A 3RX2A 4QR6A 3R8GA 1US0A 2HVNA 4GA8A 4JQ2A 3VXGA 3GHUA 3F7JA 2ACQA 1RY8A 3R7MA 3R43A 4QBXA 2PDLA 2HE8A 1ZSXA 3V0SA 2FZDA 4JTAA 2AGTA 4GQGA 2HDJA 2PDQA 4HMNA 5DANA 2ISFA 3N2TA 3UG8A 4Q7BA 5C7HA 3BCJA 3UZYA 2WZMA 2CLPA 4ICCX 4PRTA 4XO7A 1ZGDA 4FAMA 3M64A 4F40A 2IPJA 3CAQA 2IS7A 3G1RA 4YS1A 2J8TA 2FZ8A 2PDKA 1QWKA 3NTYA 4XZNX 4LBRA 3P2VA 2ACSA 2FGBA 2F38A 3COTA 2PDUA 3LUTA 4EXAA 3RX3A 3UGRA 4EXBA 4WDTA 4H8NA 2HVOA 3DOPA 3UZXA 3GHRA 3UZWA 1S2CA 3LBOA 3S3GA 4Q3MA 1XF0A 3WG6A 4RPQA 2INEA 3LQLA 4YVPA 1PYFA 1VP5A 4LAZA 1Z8AA 1Z89A 4NKCA 3LEPA 3T42A 4IGSA 4JQAA 3N6QA 2DV0A 3LD5A 4WRHA 1RY0A 1SM9A 1T40A 3G5EA 4YVVA 3GHSA 3R58A 2HE5A 4DBWA 2IPWA 4YU1A 3LENA 4WGHA 4ZFCA 5M2FX 4MHBA 1XJBA 1RALA 3GHTA 1X98A 4OTKA 1JEZA 3O0KA 2PF8A 1AH3A 4LB4A 3EB3A 3M4HA 1LQAA 5LIKX 2HV5A 4JQ4A 1GVEA 1AZ2A 3H4GA 1J96A 1PZ1A 1T41A 2ACUA 4QXIA 1Q5MA 2IPGA 1HQTA 3Q65A 1YNPA 4FALA 1S1PA 2DUXA 1YNQA 3LNMA 3ONBA 4PUWA 2IKGA 3RX4A 3LN3A 4WEVX 1IEIA 3MB9A 2IKHA 4JTRA 1S2AA 4DZ5A 2PDGA 3KRBA 2PDFA 4JIIX 4H7CA 3UWEA 3GUGA 4XZHA 1FRBA 2IQDA 1ZUAX 3ONCA 2ALRA 3D3FA 4JIRA 1LWIA 2PDXA 2PDCA 2PDMA 3O3RA 3BURA 3UP8A 4JTQA 3MC5A 2PZNA 3DN5A 5HA7A 4GABA 3EB4A 4L1WA 1X97A 2INZA 4XVEA 4GIEA 3B3DA 3ERPA 1Z9AA 3V0UA 4WDXA 3UZZA 4GCAA 4LB3A 4XZLX 2P5NA 3QKZA 2FZ9A 2PDPA 1AFSA 5LIYX 4LAUA 4JQ3A 1ZQ5A 2VDGA 5JH2A 3CASA 1AZ1A 4GQ0A 1IHIA 1PZ0A 5JH1A 1Q13A 3V36A 4DBUA 1YE6A 4LBSA 2PDNA 2IQ0A 4WDUA 4JTCA 3CV7A 1EXBA 3LQGA 2PD9A 4QX4A 3EAUA 2ACRA 3CMFA 2PFHA 2R24A 3R8HA 1Z3NA 3R94A 2A79A 4XZMX 1A80A 1HW6A 2NVDA 4XZIA 3LZ5A 3CV6A 5LIWX 2PD5A 1PWLA 1PWMA 4JIHA 3V35A 4HBKA 2PDIA 4IJCA 2FZBA 4ASTA 3WCZA 2PDYA 4I5XA 4FZIA 2PDHA 3LZ3A 4G5DA 4GACA 4L1XA 3M0IA 3U2CA 2F2KA 3UFYA 2PDBA 4YVXA 4FA3A 2QXWA 5LIUX 1AH0A 4JQ1A 1EKOA 4IJRA 2C91A
chains in the Genus database with same CATH superfamily
1T8QA 4XSLA 1HKVA 4JX6A 4AISA 8TIMA 5CSSA 5AZ0A 3TCEA 1MI3A 4JICA 1C9DA 1PDZA 3NCOA 2I17A 3F5KA 5KZEA 2PP3A 3UJRA 3W72A 1NARA 4F66A 5LIXX 4JXCA 3D0CA 3DCPA 5G4EA 4UTTC 4WDWA 3LERA 4ONVA 3MUXA 4Z2LA 2X09A 3GTHA 4LUSA 1OHLA 3SFKA 1KR1A 4NJIA 2NQJA 2GQAA 4Y9AA 5EL1A 3LSCA 1MRQA 3VIKA 4O57A 4MG4A 1M9HA 4IIGA 1RV8A 2VL4A 5T8GA 5DY2A 2ZX5A 2Q3OA 1FH8A 3VOJA 3AJXA 4Q4SA 3B8IA 3PB0A 3ECQA 2REQB 2CYGA 1GYLA 3KBWA 5IDZA 1AW1A 4P7NA 3AS0A 1I6NA 1B3VA 5DFAA 4J5NA 1UWRA 2PLJA 3GM8A 2PDLA 3DEQA 2AGTA 1VENA 1H2JA 3WH9A 4DYJA 4BF7A 3QMSA 3RFAA 1D8CA 4BFAA 4GYKA 1OABA 1QPKA 2QULA 1ZP3A 3NL3A 2VOTA 1Z69A 3MCNA 4TMBA 3R4IA 3AXMA 2YXXA 2Q09A 2PCQA 7TIMA 2RDTA 1J0ZA 5LGXA 2QCDA 1CLXA 4C6BA 4F40A 2WVSA 1L8PA 2IS7A 1MXSA 1LT8A 2JEQA 4RZBA 3FJ4A 5JBFA 3UZJA 2VD9A 4QE5A 3VD4A 3NTYA 3TNBA 1XISA 1KD0A 4LNCA 2VZOA 4LBRA 1UPMB 1PXGA 3NXFA 2RDUA 3NQAA 2PWDA 3E74A 3WF1A 4HPXA 4I6VA 1CI1A 4HIBA 4GIAA 2ZRXA 5FJRA 4RZ4A 2DDXA 2DT3A 4GQQA 2P53A 1NOWA 5EMUA 4O1BA 1VBRA 2ZZ5A 5CGTA 3S5NA 3G3DA 1W1PA 1SJCA 4E8GA 3MP3A 3WMBA 2ZUTA 4D6IA 3RITA 4QISA 1BAGA 1M53A 3S2JA 4DNHA 4AHPA 1N7KA 3JU2A 1M04A 2H3DA 4I7VA 4L5ZA 4EKJA 4IXXA 4LC8A 1W37A 1ICSA 3N34A 3NO1A 3LXCA 3EWCA 3I4EA 4JCLA 2TPSA 1H7NA 4YWSA 3T0TA 4IM4A 3ORWA 1DWHM 3LMYA 1GOOA 3STFA 2AL2A 2O55A 3CGTA 2G3NA 2UZ9A 1LQAA 2OX4A 2G3MA 1JYWA 1LT7A 2QIIA 3PUDA 2Z7KA 2HTMA 1DE6A 3GDBA 3OIHA 1LG2A 2J78A 1E71M 1YQ2A 1FA2A 3LHZA 3TR2A 2ZXDA 3WLKX 4LGXA 4HCLA 3ONBA 1W1ZA 2VFGA 1SW0A 4Q33A 3LGEA 3OHIA 3G1VA 1OK4A 1A5AA 3R2GA 1ZJHA 4HD5A 3KP0A 5A2AA 4D1IA 1ZUAX 2ALDA 4X0VA 4DXKA 1E4IA 3BPWA 1HTIA 1EUAA 2B0MA 4UZSA 3C2VA 1NDWA 3VNYA 2X1RA 4PSPA 2EAWA 1QR7A 3MANA 3HN3A 1L2QA 4RNHA 3EWUA 3W7QA 3M7SA 3B0XA 3M43A 1XBVA 2NVAA 3BGGA 1ML1A 3EDEA 1L9WA 1OD8A 4L7ZA 4PC8A 5J8LA 1R87A 5KMYA 5E0FA 5IRPA 1FWAC 2YXGA 3PZIA 3L4UA 4L4PA 1GQJA 2W0UA 3C2YA 1E9IA 3O8AA 1YE6A 4WSHA 1IEXA 5A6MA 3WDRA 4LBSA 2ZZ4A 2FHBA 1PZ2A 3ZS4A 1CXIA 1FWBC 5G1TA 1EBGA 2QCEA 1XIIA 4HA1A 3WLRA 1XP3A 5IXEA 3VIJA 4DIAA 2GK1B 2QCLA 1TJ1A 3ITVA 1WQ5A 1XIGA 1LBMA 3PUGA 3KRZA 3FYOA 1IXPA 1QXLA 2CWNA 5M1TA 3ARVA 2H90A 1K7FA 3W7HA 4NUWA 1ZPTA 4Z17A 2IUZA 2QCCA 2Z6IA 5BRPA 1MUMA 1H1ZA 3VDHA 3LZ3A 1XYZA 2VFDA 1O66A 4CCEA 1QW9A 1VCVA 4KCVA 4UOZA 2ZXAA 1US3A 3MVIA 4MB3A 2BMBA 1UROA 3PPHA 3B4UA 1IEQA 1GVYA 1JCTA 1CENA 4WY0B 2C0HA 4AG0A 2EG7A 2NUYA 3SY8A 4DI9A 4GY0A 1SMAA 1K6AA 1FH9A 1OX4B 4GZIA 5D9OA 4A3HA 4QG6A 4EE9A 4ATLA 2EPNA 3KHJA 2X2YA 3I4KA 1OC6A 1J5SA 3EDKA 4A29A 3ATYA 1TWWA 2DGAA 5DO8A 4HN8A 4EXQA 2HXTA 1WZLA 3RR4A 2CC0A 3N15A 3POCA 5ECVA 4DZIA 3W6LA 4ZOBA 4GJ1A 4QNEA 4K3ZA 1C29A 3TK7A 2W63A 3ZOAA 3JVAA 3M46A 3Q67A 1LBFA 1AG1O 1XBXA 1O4UA 4GNVA 4I5UA 4Q6XA 2DZSA 5CSUA 1H3GA 3STPA 3CMGA 5FESA 3WBYA 2Z29A 3NGFA 3GX9A 4M6VA 3CL7A 3CUFA 1NM9A 4Y96A 3E2QA 1CLKA 1EIXA 1S1RA 3WMSA 3EX6A 4XTDA 2OYKA 2PGWA 2WKLA 2AMXA 3FA5A 4JNYA 2QGYA 1NIUA 2BVTA 2VOMA 4QR6A 5U7SA 3LS9A 4M0XA 3UCDA 1XWYA 1J11A 4C5ZA 2ODOA 2GJXA 2WLZA 1RPKA 3AMGA 3SUTA 4IX0A 2R91A 1ONXA 2ACQA 1EEPA 4CLMA 1NH6A 1F4AA 4RCXA 2D69A 1V7YA 2AAMA 2XVPA 3W22A 4PTWA 1VCFA 3TDFA 5DANA 2DSZA 3P0WA 5IBXA 2BS9A 2V68A 1JAKA 4H4IA 4GI9A 4RL3A 3W7CA 5IHSA 2R14A 1TPB1 2ISVA 1CTNA 4J7RA 4WOQA 5AECA 4YTUA 2PF0A 2WNZA 3IK2A 4FAMA 3L12A 1H63A 3HPFA 4FPSA 4PYSA 2QCGA 3APGA 4OWGA 2GWGA 4L61A 2V3DA 4PSRA 1DWAM 4N0RA 3QM3A 3VCRA 4HHLA 1XXXA 3BMVA 4DHGA 3S1UA 2HBVA 4JEQA 5DXXA 4MYXA 3PTQA 1SR0A 4GXPA 4QE4A 1SFTA 3H12A 4U3AA 2O4QA 4X2PA 4AF0A 2HS8A 2G95A 1JCJA 3BCDA 3NPWA 1WDDA 4NJHA 2W6RA 4PULA 1V6YA 4AX6A 1PJ9A 2PWGA 1MVYA 1F5ZA 2INEA 1XYMA 3Q45A 2J4GA 2R1KA 2PAJA 2QJGA 2QR6A 3LCGA 2YCEA 1EP3A 2A21A 2VZTA 3ZWTA 5DCBA 3BSGA 3AYVA 5K3VA 5HATA 2ZX7A 3GYCA 4E4UA 2YZ5A 4EF9A 3C8NA 4KIRA 5BXTA 4WRHA 3UWVA 1VEOA 3BICA 5LNWA 9XIAA 2VC6A 3CBWA 3CT7A 1WZKA 2HPMA 3VCNA 4NJKA 3ZJ8A 3ARWA 4N4PA 2CLOA 3T4CA 1SUXA 3VI2A 3GDTA 3UA3A 3OGRA 2ASHA 3LTPA 4HJWA 3QOMA 2QHAA 2WSYA 1KFEA 1B30A 4U2YA 4ZTXA 4B5VA 3E0LA 3IGUA 4PBEA 3SCOA 3MKCA 1XINA 3DG7A 3IJQA 4LUYA 4Q4RA 4JCMA 1IGWA 4LF2A 3AFBA 1V6XA 5A6SA 1W0MA 3PSVA 5T26A 1YXYA 4NJJA 1AW2A 1M7PA 2BY3A 3AHVA 3SCUA 4BA0A 1PIFA 3TJXA 4JHOA 3WLPA 2FB2A 2GGGA 4L64A 3UWUA 3BLIA 3GS6A 4B2DA 2HPIA 2AKMA 2WK2A 3GB6A 4AD0A 1IEIA 3TA9A 1XGEA 2PB1A 1M1BA 1QNSA 4GI4A 2PDFA 3VKDA 5G1MA 3L4TA 2VP8A 1C8QA 4F9DA 1HJQA 1BTCA 3NEHA 1HL9A 4RE2A 1W5PA 4P8XA 3N13A 4KKXA 1UIOA 3W6YA 5AB3A 1G4SA 1LQ2A 1VYSX 3A47A 3UXAA 1SO3A 4J3ZA 4DO6A 3G8EA 4ZO6A 1RCXB 1E5JA 4WOZA 2V5CA 1W1TA 2INZA 3AI0A 3CLWA 1W3HA 4EPKA 2PC8A 2V5KA 4HNLA 2Z0IA 3ZQ9A 3LHTA 4HPGA 2WCAA 1B4EA 1RAKA 1VPXA 3F4CA 1H62A 5A2BA 2GJXB 4S2BA 4R34A 4K1WA 1XLIA 1TA3A 2EPLX 4LFYA 4QJ3B 2RKXA 2CXEA 4UC5A 2ON3A 4URIA 3VOFA 4FNSA 1W3LA 4GY7A 2WMIB 1YPFA 3CO8A 3GE7A 4GVFA 3BGJA 4WDUA 1VEMA 4JTEA 1VJIA 1TO3A 3FYPA 2WW5A 2YCLB 2VVSA 2WMHA 1OFBA 2CHNA 3VNLA 3T81A 3R8RA 4BKNA 2VFHA 1LQ0A 3VDGA 3DESA 1KXHA 3L2LA 3I6EA 2R6OA 2G4JA 2FQIA 4ZO7A 1JPDX 2YXOA 3QW3A 3G8RA 4DPQA 3SR7A 4FSAA 3VE7A 1ME9A 4W5UA 4QFUA 2W79A 4IIBA 2DSKA 4K1GA 3RPMA 3WCZA 4TX6A 3JUGA 4XKYB 2OKOA 1JPKA 3P8IA 4L1XA 4O0KA 4MY9A 3W2KA 1DJWA 4HOXA 3GC2A 4O19A 3NQGA 3ITXA 4PMVA 3U3HA 4K39A 4KWOA 1YTDA 3NQMA 3VGBA 3LHUA 3GDRA 4DWSD 1ZAHA 3CPGA 1CB7B 4A2SA 3TTEA 1MW0A 1ZHAA 4ATDA 2BOGX 3LCHA 2WQPA 3BW3A 3M0JA 4NX5A 4HNTA 4MZYA 3RDKA 5DMMA 2J66A 2NXIA 1NY1A 3VIHA 3A5FA 4S3KA 1NWUA 2A6NA 4X3ZA 1U33A 3RK8A 5CLTA 4IFKA 3WUBA 5CC7A 1VFOA 3GVQA 4PR4A 4NZFA 2Q02A 3WBXA 2DUZA 4ZO8A 2P10A 4XK2A 1PB0A 4IZGA 1ZNNA 4QCFA 1E0WA 3GSMA 3IJ9A 4AIBA 4N7QA 3AZSA 4HSHA 3EZ4A 3S5YA 1SR9A 1NSJA 1M7JA 4QS5A 1LOQA 3JS3A 4UUIA 3VDAA 4IMEA 3VDCA 2QDEA 1EPXA 1JXKA 4EP8C 3RR1A 1X6UA 3U48A 3AJ7A 3GAKA 9XIMA 4UR9A 1YNYA 3V5OA 2HVNA 1VF8A 5FD0A 1QTWA 3W7GA 3W86A 4W89A 1WXJA 3GNNA 5HMFA 2NXHA 1EJVC 3VM7A 3LRMA 2ZZ6A 2G37A 2QCHA 1EWDA 4XZ9A 1Z42A 1KLYA 2D3LA 1A3WA 1R85A 4O28A 1SJBA 3IGXA 2V3GA 2YA1A 2EBNA 3GTNA 1MQQA 2CESA 1WKEA 1XIBA 1TTQA 2XFFA 4WCJA 1DYSA 3LRLA 4RW5A 2OQLA 1C7SA 2CBUA 2IPJA 2Q71A 2TYSA 3S5SA 3DFSA 4XZNX 3U0HA 4MIMA 5GVJA 4WZHA 2X41A 3WFZA 2V5LA 1MUCA 2ACSA 2C1HA 1H0IA 1XRSA 1EX1A 2WJZA 3V1HA 3W25A 3TWAA 4MFDA 1NWRA 1W1YA 4JNMA 5GNYA 4MGGA 4REQB 3OA3A 4D2JA 3R11A 2QUTA 1W3JA 5FJIA 2D24A 1T6MA 3HGRA 4O13A 3KTXA 5FACA 2PA6A 3TMQA 3TFCA 3RU6A 2BOFX 1O5XA 4JFWA 1AVAA 4O11A 4MNLA 2WAGA 4XD5A 1PHWA 3PBWA 1I60A 4CQCA 3P14A 2F6KA 3A24A 2CFFA 3LD5A 3CEUA 4KWVA 1DL3A 3N2MA 3G5EA 4U5KA 5CPQA 4W9TA 4ZZ9A 4H6RA 2RDWA 3FHAA 3SN1A 3LLFA 5AFDA 3BW2A 2YDAA 4LH8A 4F4RA 4AZHA 4IG2B 1NWSA 3PS7A 4W4QA 2IW0A 5BZAA 4GVIA 3M6DA 3HTWA 5M2FX 4MHBA 5C55A 3PUOA 4KESA 2QCFA 1X98A 1EA9C 3RMJA 3P7YA 4GK8A 1JIBA 4NYUA 4GUGA 3MVTA 4IP7A 2FHFA 3H2FA 4S3FA 1JPIA 3GH7A 1V3MA 3EDFA 1P0NA 3BWWA 1I8JA 3C3NA 2VRKA 2QAFA 3TE9A 2FPYA 1HVXA 2WVUA 3G2GA 5LNRA 5REQA 3NUKA 2V2HA 5TBOA 4JDBA 1QASA 2Y61A 2L5HA 1R2TA 1XS2A 2FKPA 3LNMA 4PGLA 1G67A 4ENLA 3VC6A 5I3KA 3KOXA 1JZ6A 3GVWA 3WF3A 4G7EB 4WGXA 4DZ5A 2VUYA 4U5IA 3V4BA 3SCSA 1KA9F 3T7VA 2VXNA 4HYVA 1OFPA 3LLXA 5CBIA 3NQFA 3WKZA 2DORA 1F6YA 4DUWA 1EJXC 4Y9OA 1DHPA 3VD5A 4QSHA 3AMCA 4X2RA 2VEGA 2PZNA 1PPIA 1RA0A 3WJWA 4HGXA 3R5EA 4HU0A 5AHIA 3SZ8A 3KZSA 4KT2A 4Q7NA 4GX9A 4ACYA 1WDQA 4LUTB 3KVLA 1DV7A 4ZODA 4ZQRA 1KV8A 3F5LA 4LAUA 4MJZA 1UKTA 1QK0A 2OO0A 2VJXA 3KL3A 4L56A 2XSAA 1UBPC 3GXPA 4YL2A 3BJSA 4F3HA 1PO9A 5J5DA 1R7OA 3CZJA 1MW1A 4PE8A 4Q4PA 1ME8A 1AK5A 2F2HA 1IQ8A 4HU4A 3H24A 3A3HA 1RHCA 1PKNA 3SSZA 1FP9A 3M9YA 2QDHA 1V3KA 3URBA 3CPUA 4GI6A 3SCRA 2C7FA 2WSRA 3QV7A 1ICPA 4QX4A 4H9TA 3CQIA 5D38A 5JUVA 3AS1A 3KAOA 5D9MA 4FIQA 3H21A 3B4YA 4HQVA 4PL2A 1BSLA 1Z3NA 2YFNA 1QI5A 5DBUA 1EWEA 2PD5A 1VFUA 3S1WA 1OZQA 2XVGA 1JF5A 3C0SA 2PDIA 2ZADA 1O5RA 4KW2A 4ASTA 2E9BA 3PR2A 2ESCA 5AYZA 1MXDA 2VX5A 3AO0A 4IFKB 4LX4A 1N55A 3MZ2A 4WK9A 3GDKA 4YXGA 1TUFA 1Q6CA 3EX4A 1K4GA 3WLLA 5C5YA 1WKFA 1HJWA 4IJRA 3THUA 3QY8A 2FFCA 3MI6A 2QEZA 2J9YA 1IXNA 2Q6ZA 2X40A 1CXFA 2G8ZA 1XQLA 2FVLA 5CZTA 1SPQA 3TAKA 5D37A 2CBVA 2WCSA 2ZBTA 1R38A 4YNGA 5CZJA 4BWLC 3RCYA 3IEBA 3HGJA 5EB8A 2NVCA 4M51A 1Y5XA 1LOLA 1XDJA 4ZBCA 2R9RA 4HKPA 2XH7A 1UD6A 2VGBA 3R0DA 2ZTJA 2VQTA 1F61A 2CLMA 1E40A 3GW3A 1E1FA 5DMNA 1K9FA 1E9LA 5AC6A 1TWZA 2O56A 3LY0A 5KETA 9CGTA 4C90A 3SUSA 4F8XA 1GJPA 4GUFA 5EFFA 1LUCA 4OV4A 4F48A 2OGJA 3NZRA 1TIMA 3EOLA 2H8XA 1XBZA 7XIMA 4UTMA 1L6FA 5JIPA 4IPNB 3GNXA 5EMJA 4ZR8A 1JULA 2PTDA 2TODA 1OFAA 4NQ1A 4O18A 5CBJA 3BG3A 3GRIA 2O9PA 4U2ZA 2G41A 2BDQA 3EPNA 4K7VA 4DYKA 2HISA 2XFRA 3G1AA 1I2OA 3B9AA 3CZGA 3L4XA 4Q8WA 3G0XA 5L9FA 4JQ2A 1MFUA 4NJGA 4NSBA 3GHUA 1RK5A 4KWWA 1FWEC 3W85A 1ONWA 4BI6A 5HR7A 3ZSSA 3WD0A 4WLCA 2FZDA 3FK4A 4GQGA 1I2PA 3UGVA 4XKMA 2HDJA 4HMNA 1IT0A 1ZCCA 4UQDA 4HB7A 4C6NA 1KFJA 1EDTA 1F3TA 3KX6A 3WH6A 5BMXA 4B5XA 1C90A 1S5VA 4PUKA 4MWAB 3VC5A 4CNOA 1H7PA 3K5XA 1TPFA 5FF7A 1QOPA 5AHEA 3EDJA 1UCWA 1ELSA 1KCZA 1NP2A 2QZRA 4Q8PA 3UWWA 4KS0A 2VMFA 2X1UA 1W8GA 3HV8A 1TQJA 1L6SA 3FEMA 3T9PA 1QPQA 3P2VA 2BY1A 4ZENA 1B1YA 4ZQNA 3DC0A 3N9RA 2F38A 4CU8A 3TN5A 4J40A 1KC7A 2X1TA 1XIJA 2VURA 1EH9A 4H8NA 2F61A 3D3AA 3FFSA 4JTSA 5A6JA 3GHRA 1I0BA 4LAMA 4JX5A 1E4NA 3QHNA 3ZLHA 3H7VA 4Q7IA 2PLKA 3UQNA 1CECA 1V6VA 1ITUA 1AL8A 1PYFA 4C1NB 1QDSA 3DG6A 1J93A 3PTMA 4ML4A 1A4MA 3BG9A 3H55A 2HXUA 3EX2A 4LUSB 1GOIA 1XDLA 5LHEA 3IWPA 2QCNA 4M81A 3WNOA 1QWGA 4GZEA 1RY0A 2V0TA 4AD2A 1TPC1 3SI9A 2A5HA 2X1SA 4I9AA 1F6KA 3P93A 4EWJA 4HSNA 2CZFA 1JPHA 2J47A 3NAVA 1RH9A 1GPWA 5C2CA 2C16A 3VX1A 4HNCA 1LG1A 4CQBA 1LL4A 1FY6A 3VNZA 4OVXA 3ZLGA 3WY1A 3T40A 4KH2A 3Q2DA 3QFEA 3HPXA 4HA0A 4DWDA 3E5PA 2HV5A 3A4JA 1A5BA 3UG5A 5ABFA 2VFFA 2O7SA 2FGLA 4BY3A 3ATZA 2MNRA 4QG8A 5M3WA 5CSYA 2POZA 1H50A 2GUYA 1JI2A 1SFJA 4GE8A 4LCSA 4Y9NA 4TOQA 3LPFA 1A5LC 1UC5A 1VJZA 1PVNA 3W53A 2C15A 3UBPC 2WJEA 3EMQA 3O06A 2VGFA 3TTOA 3P62A 2F6XA 2VR5A 2XN1A 4NHVA 3IANA 4H7CA 1NELA 1P1MA 2WBGA 4B3ZA 1G7VA 1OFEA 4MAZA 2Z27A 3TC7A 1IF2A 2QKFA 2YCKX 9RUBA 3LGGA 1K77A 3TQKA 2PDMA 1YRRA 3TVAA 4KGJA 3UP8A 1B90A 3O16A 3SCQA 1PAMA 3W7PA 4DWSA 1TZZA 4UFHA 3WMLA 1E1CB 3BLFA 1S2TA 3SGUA 2BTMA 1UD3A 2C3ZA 2OEKA 3KBSA 3MWAA 3KL5A 1UBSA 4W88A 4Y6GA 4XIAA 3K2GA 1WOAA 3ZIZA 1UWAA 2WNQA 3F1QA 4D6EA 3W7DA 3WL0A 4XZLX 4US6A 1AFSA 5LIYX 4PB3A 4N2YA 3ZVHB 3CB3A 3IK4A 3LB0A 3NNTA 3S5OA 1D3HA 1V03A 5CGQA 3AAMA 1MQRA 3MQTA 1J12A 1C3FA 1DTNA 3WLQA 5A6LA 5LA0A 5BW6A 2ZZ7A 2W3ZA 1MWOA 1RD6A 4UTLA 1PIIA 2PP1A 2HK0A 3FGCA 3AIEA 4HOWA 4PCFA 3GXTA 4FXFA 3NZGA 1GEHA 1BTMA 3R8HA 2UY2A 2E6YA 3A5VA 1CGVA 3CV6A 1X1OA 3WLMA 4E6MA 1J4EA 4JKLA 3UXDA 3S9IA 1J0HA 4K7YA 3NA8A 2XFYA 2PDYA 5FF0A 2X0YA 2W5FA 1UP2A 5GNZA 5EMLA 4Z2KA 1QATA 3PPFA 4YVXA 5F4XA 4G1NA 4H7VA 4LW7A 1YMYA 3B0UX 2OKTA 3G18A 1VHNA 3GW0A 1K03A 3MW7A 4J4KA 3G77A 4X22A 3VFLA 4Q22A 2FHCA 3OG3A 3L5AA 5E6ZA 4FO4A 4CNPA 2PE4A 4DBEA 1TIWA 3WH7A 3DHFA 3WUEA 1HP4A 4B9ZA 5TQLA 3SDOA 3B04A 2HEJA 4WXZA 4Y2WA 4FNTA 2W27A 3L7RA 2VEIA 2G3JA 1RJPA 3NL5A 3IIPA 4XO6A 1RBAA 1YDYA 3SJNA 1MZRA 1ZFJA 5HNNA 3O2LA 1VRDA 4FP1A 3BG5A 2GJLA 4LRSA 1LRNA 3SEPA 1BWKA 3UR7A 5LA2A 4S3GA 1V77A 3TYZA 5CZ0A 4ORIA 4MSSA 1IZKA 1E73M 3DU0A 4G2DA 3W28A 3TEVA 2Q3RA 3RX2A 2J8GA 5C0QA 1DWFM 3HPAA 3SECA 4JY9A 5FL1A 1US0A 2ISDA 3WDJA 5D2XA 4AIOA 1TVNA 2H6RA 5A8MA 1KM2A 1H5VA 1OY0A 2B7OA 2HE8A 3H22A 3POHA 2WC3A 2DVTA 2PDQA 4G1KA 2CHRA 4S3JA 2RH9A 2YL5A 3S9ZA 3ITGA 4INFA 5CPSA 1TVPA 1VPYA 4IWWA 1ZTVA 3WELA 3QSRA 4JDYA 4GLEA 2OT1A 2NT0A 3APTA 3E0IA 4IL0A 1JFHA 2YA0A 3WIJA 1F2JA 3C2FA 3TIMA 3P6LA 2E1WA 3ITLA 1JI1A 1UD5A 2GSJA 5LNVA 1ENUA 2XVKA 3QZ6A 1PTAA 3UVIA 4PCPA 3ENLA 3WNLA 1FHVA 2DU2A 1DJXA 4A21A 2CIPA 4NZ3A 3IIVA 2JIWA 1U83A 4OHQA 4KETA 1W91A 3IARA 3BSMA 3MS8A 5I7GA 4KGLA 1H1NA 4HMEA 2YDRA 4DI8A 3ABXA 2FVMA 2E28A 2YDQA 3GG0A 3GFYA 3IIZA 1UUQA 4AVNA 1NDYA 3LNPA 1U1UA 4I7UA 1BXNA 4JNZA 3OJGA 3OYXA 5EMKA 5DBTA 2OYMA 1P4CA 2PU0A 1R86A 4JTLA 2ZC8A 5JQ9A 2C19A 3GHSA 4QTGA 3BMWA 3N1AA 4DBWA 3TU9A 2I5QA 3K1GA 2PWHA 2IPWA 3V1PA 5DY3A 1BG4A 4YU1A 1AJZA 3CPRA 4GGHA 5A3HA 3E6EA 2BHYA 3AIWA 1T99A 1E6QM 2QYGA 3MTWA 5K9XA 4D8ZA 3MV01 3OHMB 1YXDA 2PBOA 3H4XA 4A3UA 3W1XA 4MNJA 2F7FA 1L6WA 4C91A 4S3CA 1GOQA 3FY1A 3INPA 4D8LA 3AXXA 1PV8A 4W5ZA 3UY7A 4W86A 3KZPA 1FCUA 3OP2A 3H70A 1K7XA 1ITCA 3BL3A 3RIKA 4IF2A 1KFCA 3LXAA 1W2VA 4QIUA 3MB9A 2WMIA 2VENA 2V69A 4CNUA 3C52A 3KUMA 4JIIX 5E9AA 2VM8A 2WC7A 2BXVA 2VZVA 2NQ9A 3MDWA 5DXYA 2ZA2A 3TYBA 2B7PA 2YA2A 5DLCA 5AOUA 1E1EA 3CB8A 3D3FA 3PP7A 4JIRA 2PDXA 5LNUA 2J75A 4AB4A 2ZUSA 3WNPA 2JE8A 1SW3A 3PTDA 1B54A 1ZJBA 1KWKA 1F76A 2J7GA 4C6CA 1JYVA 3T0CA 1TV4A 3EB4A 2HZGA 3B3DA 2DZBA 3LPPA 1OT1A 3K4WA 1UUMA 3GK0A 3PWIA 1XYCA 1JVNA 2PZ0A 2ZFAA 3FJLA 4DO5A 2XIOA 3NOYA 5I07A 2PWUA 4L80A 4B5UA 1EGZA 3IVUA 4NRRA 2JKAA 6TIMA 2QS8A 3QH2A 4C6LA 3PVFA 3N19B 5HWNA 5JH1A 4CQ9A 5KZ6A 1Q13A 2BFGA 1RXOB 4JYDA 3E1F1 4RZ5A 1VKFA 3UWQA 5G1YA 3W2MA 2MUCA 4NF7A 3NIYA 4JTCA 5HPCA 4CCCA 4FXRA 3EKGA 1N2VA 1IIGA 2WBKA 3W01A 1TVLA 4KFNA 4RNFA 2R24A 2CKSA 2XZ7A 3LM3A 3R94A 1YBQB 3EXSA 3CAKA 1CZ1A 3HFTA 2OR2A 4Z2HA 3UESA 1ADOA 3VKJA 4AAJA 4WQ6A 3L66A 3ITYA 1XIDA 1Y7VA 2A3BA 1W1A1 4MFEA 1J18A 3PZQA 1M68A 2Y70A 1X8FA 4O52A 4HYRA 5BXRA 1UZ4A 3QZEA 2OELA 6TAAA 1VBGA 3CO4A 3T05A 3CIVA 4FEZA 2P8CA 4FA3A 1C93A 4S1FA 3OZPA 3QEZA 3ZXWA 3G6LA 3G0UA 1FP8A 5FF3A 4WXYA 5FKYA 4FR6A 4XUYA 3WN6A 3R12A 3TA6A 4B2DD 2DIKA 1UMYA 4JY8A 4PMJA 1VFSA 1HL2A 1SZRA 4UQ9A 5C2XA 4GI8A 1HX0A 3TP4A 3QQ1A 2YCIX 3FJNA 4CD6A 1R30A 1PZ3A 3HBLA 3AIQA 3C5QA 4I90A 2QMKA 2PODA 1DIDA 4YYCA 3BW4A 3NZQA 4AD1A 1Q7ZA 4OOUA 3SCNA 2VR4A 3N3TA 3SQLA 1XLFA 3EOUA 3SCPA 4IPIA 4M82A 1XG3A 3DC8A 2YCJA 4V1YA 3CLMA 1UZHA 3RCMA 2PEVA 1IEWA 1QHOA 5K7JA 1XPGA 2Z1VA 4NAEB 3WLIA 3SBFA 3B8VA 5H1WA 1S3HA 1I2NA 3OA5A 3BZGA 2YFOA 4A3YA 4GQRA 2O7QA 2AQOA 3QR3A 1TRDA 3WZ0E 3PZUA 3WQ5A 2DZPA 4S38A 2VX7A 2XN0A 1WZMA 4D6GA 4XIMA 5F1UA 3N9KA 3URNA 4QDPA 1FWSA 4LTSA 5CJNA 1BYAA 3I65A 4DVOA 4Q8NA 2UY3A 3EWDA 2O9TA 3UZYA 2O4MA 5HJLA 1RJQA 4Q8TA 4EACA 1P0EA 3UXKA 4E3VA 2Y7GA 1GQLA 3HJEA 1GTEA 3K8MA 5A6AA 1WYIA 2CETA 3K4AA 3V3WA 3QXBA 4UFIA 4YS1A 2OMAA 2X1IA 3NPVA 1B4KA 3M1ZA 3IACA 4PFMA 1PE1A 3ICJA 1E70M 5HNRA 3IGHX 5C54A 3DFQA 3VTRA 5L6UA 2WPBA 2C18A 4O8RA 4AF0B 2WQDA 1AA1B 1TFVA 4AWSA 2HVOA 3PB2A 1JZ2A 1EDGA 1VH7A 4WSKA 2VEPA 3UZWA 5I3GA 3U2ZA 1RBLA 2XGZA 4UWMA 1HGWA 3NDOA 3TSMA 3AMDA 1J0JA 4F0RA 3CWNA 2XGIA 4DXVA 1GWJA 3E2RA 4X60A 4MJ2A 4NNBA 4A2RA 4XQ6A 1XSKA 2QAPA 3LEPA 2GJRA 4AC1X 1QT1A 1GVQA 3VYLA 4LYRA 4AVOA 3N6QA 2FDMA 2WHMA 1T8XA 4UXDA 2ZC1A 3NWRA 3GQYA 1UW9A 3OGVA 3MBDA 2A0NA 3SCWA 1WKDA 1RVKA 2OODA 1MW2A 3AUJA 3EWWA 1VFMA 2VD8A 3EA3A 3GNDA 5CSRA 3HO8A 3IJIA 3OVGA 1HUVA 3B9NA 4JTKA 1XC6A 5A8QA 3VIOA 3IIXA 1FWDC 1DEDA 5D02A 3O0KA 1VFLA 3EB3A 2OWWA 1AD4A 1CGYA 4PBFA 5LIKX 2ZXBA 1GVEA 1ZBKA 3P5ZA 2DZAA 3BV4A 3MP5A 4C6JA 2OWCA 1TKKA 2ATSA 2YPIA 3SUUA 1G69A 3VKAA 3WK2A 5B80A 1VAHA 2GQ8A 3MO4A 4YYFA 4IUOA 3WF2A 1KLZA 3KDNA 2FTYA 4PH6A 4QHRA 3VVGA 4W8AA 3HJZA 3L9CA 2DQWA 3T4WA 4PUWA 5EBUA 4H8HA 1PTDA 4N6FA 1E15A 4LYPA 5HMDA 4AEFA 4JTRA 5FCZA 1K8YA 3HA1A 5DMYA 1LRTA 1M01A 4EX4A 4BQ3A 2DJLA 4S3EA 1XLGA 3LA4A 3TV8A 2WZHA 5FEPA 5H2ZA 2CBIA 4XBJA 4R7WA 2PRLA 2ZIDA 3BURA 3ABZA 4XZBA 2VEMA 1JZ5A 4DZHA 4OGZA 2UV8G 3A9BA 1BF2A 2ONEA 2QF7A 4LYQA 4WY0F 1HJSA 2YX0A 2D2HA 3LHVA 2I56A 1A50A 2A4AA 2XFWA 1TR1A 3VGHA 4PN2A 3DHPA 5AN7A 3SB0A 3T8QA 1H4PA 1HVQA 3DKJA 1XD1A 4ERGA 5HULA 1H61A 1E0TA 2Y7DA 3C86A 1PEZA 4V27A 4LCRA 1DQWA 3GXMA 1DJQA 2JF7A 1QPOA 3PY2A 3L4YA 4M5PA 4HMDA 2X2GA 2PGRA 1FBAA 3WJXA 1P5BA 3W1NA 3CWOX 3CH9A 8CGTA 1DORA 3I7RA 4F2UA 5I3DA 1NOFA 3PBYA 5C70A 3ABSA 1KM0A 4US5D 4MVAA 3KRSA 4JS3A 3CMFA 3QYSA 2QV4A 5FSEC 4JKKA 1WXZA 1G6CA 5HAOA 3ARUA 3UYCA 3UVAA 3VGDA 4GG9A 4EOUA 1E43A 2QCDB 5LXEA 1W3NA 2ZCGA 3BAIA 4LT9A 4Q4QA 3O15A 2O9RA 3G1DA 2R1PA 4FZIA 4RV8A 1FWFC 3H8AA 3OW1A 2Z1WA 1HKMA 3SRDA 6XIMA 1KTCA 4Y9MA 2F2KA 2AKZA 4LNYA 4IUGA 4H01A 3WL1A 3EWZA 1J0IA 2DZTA 3HURA 1DQXA 3N9SA 4RE3A 1IXQA 4HP5A 4TTUA 3R79A 1TX2A 4ORMA 2NUXA 3II1A 3HPSA 3VMOA 1GG1A 1RP9A 2BGSA 1U1HA 5BOFA 2EJ1A 4LU0A 1M6JA 3UZ5A 1G4PA 4HMCA 4MUZA 2I5GA 3K30A 1R3VA 3ARRA 2RGLA 3ARSA 2B7NA 4CN4A 1FUYA 4E2OA 4AD3A 4J1OA 4I7WA 1F3EA 1AJ0A 2W91A 3JRKA 3G3MA 4QDWA 4H9MA 4CN1A 1KFBA 1UKQA 3E9AA 4P8WA 1G5AA 1Q4WA 3UCCA 4L4MA 2CZVA 4QROA 1C8XA 4B9YA 3ALGA 1F3WA 1L0PA 3CYVA 2GVLA 1D3GA 4FX6M 1DPMA 2DFAA 3H7RA 2HRWA 2WZTA 3I7SA 1XFCA 3C3UA 1JD7A 3GU1A 3S46A 4WF7A 1VBJA 3RLVA 1SVDA 3L65A 2WYSA 1P6CA 5HUPA 3KOWA 1KWGA 4LY4A 3P84A 5MF5A 1H7RA 4H2CA 3HPZA 1WAWA 3FHQA 4OJYA 3F2BA 4OFCA 5I5RA 1ISWA 3ARXA 1W5MA 1KBKA 3ZFHA 2XIJA 2ZVIA 1HZYA 3W2JA 1Q7QA 4E8DA 4GYJA 4HT3A 4UTUA 1CYGA 1W17A 5JBEA 5FJPA 1FDYA 4NG3A 3GZAA 2ZX6A 1UC4A 1EJRC 1FCBA 3M5XA 4GH3A 1UD2A 4EPDC 1R9YA 2CWXA 4D6DA 1ZSXA 2XHYA 2ZUUA 1I0DA 4X63A 1L2UA 4GYPA 4FLQA 2JIEA 4AD4A 1E0VA 1OZMA 4LRTA 1EJUC 4GFSA 5JBDA 1V0KA 5LHFA 2E68A 2CLEA 4IIHA 3TQVA 4F2BA 4TUFA 3L5LA 5DRCA 3WO8A 2AGKA 1YW1A 2J8TA 3TLLA 4G7EA 4AWEA 1XDMA 3V5FA 3AUOA 1JDAA 3LGDA 4M1RA 3GBDA 5CC3A 4S23A 4PL1A 1GGOA 1TE6A 3IAQA 2X0SA 2WM0A 3GZ3A 3PSWA 3FLUA 4C6KA 4O1EA 3THCA 1K02A 1J6PA 4REQA 4MPQA 2QUVA 2YL8A 3G1SA 1R3WA 1H09A 4YVPA 3SY5A 3T55A 3GH5A 4HHMA 3CWHA 4RNIA 2OSYA 5U4NA 2ZICA 3MJMA 3BAKA 4RJEA 3QYQA 3DBNA 4O4VA 1BEUA 3DECA 4JQAA 3CZLA 2YGYA 1SM9A 3RF9A 5HOSA 3NDZA 1XLAA 1PYMA 4IGMA 1DWGM 4LPCA 4AHOA 3HG3A 1VIZA 4H1ZA 2ZDRA 2XN2A 4UQBA 2QJNA 3E2VA 5FEXA 3ZYZA 4P5UA 4D72A 2PU1A 1GK8A 3J7HA 2PP0A 4DUVA 4ZFMA 3OYZA 2V5JA 3VIMA 3WLNA 1T7LA 1E3ZA 4MLJA 1UJQA 2Z1SA 1J10A 1UMLA 4ZL1A 2PWFA 3DX5A 3EXRA 4JIEA 3WD2A 4BQ4A 2V6AA 1MNSA 2VZSA 3WNNA 4KEZA 2FYMA 1L6GA 4DWSC 5C7VA 3M0XA 2QUNA 4G7FA 2D73A 3E0VA 1POKA 1IWBA 3REQB 2GGEA 3RYSA 4XAFA 4RE4A 2X30A 2FPVA 1M41A 1JXJA 4B3LA 1IR2A 4XAZA 4OE7A 4DJEC 1KRAC 1W5NA 4ADSA 1EJWC 3CJPA 3ZT7A 4CQAA 1BSIA 4WX2A 3UPBA 4OIFA 1TPDA 2E3ZA 5HA7A 2GQ3A 2CCRA 2O92A 1YPXA 2VR2A 4MZ8A 1TMLA 1A5KC 1OM0A 4PB4A 3VE9A 3CH0A 1FXPA 4Z2JA 4GJJA 3KS5A 1UA3A 3OZMA 3QKZA 5I06A 4Z08A 1QI0A 3PULA 4K38A 1XKJA 1V08A 2EO7A 3CUGA 4RLIA 5I78A 3AYSA 1IHIA 4CEXC 2P8BA 1DJIA 5T9CE 4FX8A 2W92A 1EC9A 3NURA 2Z25A 4J3WA 4M6QA 4PFHA 1UQZA 3T6CA 2GFTA 3KVMA 3MV11 2ABAA 1S38A 3TONA 4GO9A 3ZO9A 2ZX8A 1OEPA 1UH2A 1LF1A 2PFHA 4DX3A 1IR1A 3PUEA 4IQJA 3AIRA 3W83A 4AY1A 2NWRA 1UYQA 1Q6RA 2PUZA 4HPHA 3UU0A 1OK6A 3GKAA 4GNKB 3FN9A 1QOQA 3UJFA 1DTUA 4NXSA 1K8ZA 4IQEA 1ODUA 3PHAA 3CV1A 3KWXA 5LA1A 3N2BA 3QVQA 4I5XA 2CPUA 3U2CA 4QLLA 2V38A 1CWYA 4KEMA 3C4UA 5FSDC 4TV6A 2C8NA 2A3EA 3TWBA 2QXWA 1R3SA 3IRDA 4IFOA 1TMHA 3SY1A 4IT1A 2PC4A 2J7EA 3HF3A 4LSBA 3BSHA 5C71A 1XCXA 3QBUA 3L5MA 4AUBA 4DF2A 5G5IA 3U2EA 1WNOA 1PCWA 1Q6OA 5IDIA 2IPFA 1EL3A 3EWBX 1UH3A 1TZ9A 1O7AA 4XD3A 3LV6A 3BQ6A 1PSCA 4KWUA 1W5OA 2ZZ2A 1VS1A 4V15A 1AL7A 1KM3A 1A5UA 4LVFA 4AH7A 5AVHA 1GZGA 6REQA 4ADTA 3AZTA 2BBFA 4GPNA 1ECQA 1Y65A 3ITOA 5D2TA 1IZJA 1EEXA 2Y4SA 1CXEA 3GYEA 4DAIA 3UYIA 5C2GA 1C9WA 5B7YA 4JTTA 3W73A 2PLMA 3GFXA 3V0TA 4YTRA 1VBHA 4WSJA 2FPTA 3DGRA 3MUZ1 2DZUA 4QCEA 4RX0A 1R3QA 1XHGA 3M0ZA 4BQ5A 3IPWA 2ZUWA 5I3JA 4P7RA 2E0PA 3UNDA 3T2PA 4GXMA 3S2CA 2OCZA 4NXKA 4JYFA 1QMLA 2PI6A 4R85A 4UOQA 3BZJA 3QPZA 1GEQA 3JR2A 4BHYA 3KBMA 1Z6KA 1XLJA 3L67A 3NGJA 3UXIA 3P74A 3MHUA 3N2TA 1XKYA 3FIGA 3MUY1 3SSJA 2IXVA 3QZAA 2I7GA 4M6UA 3W7NA 3TSDA 4X9SA 2CLPA 2CBJA 1SFSA 3O6DA 3GVVA 2BZNA 2BVWA 5FJTA 1BGAA 2DT1A 1GTHA 4KRZA 1VQTA 1XPYA 1RK6A 2R8WA 2Y5EA 1DJGA 3PJXA 2J74A 1W1VA 1U2YA 4AYGA 1W32A 4EAYA 3R25A 1QPNA 1BG9A 1QHPA 4B15A 1Q8JA 3ARZA 3TW9A 3IUHA 5T9BG 4EXAA 3QV8A 1IE7C 1J6OA 3THAA 3WEZA 2Z28A 1JYNA 4JGDA 4AMCA 2DUAA 1Q6DA 1S2CA 3ZJKA 1SMDA 1VCGA 1T5AA 2Z1BA 3RM8A 3OEXA 3W1UA 4IIEA 2X7WA 5C6MA 5HQEA 3W23A 1GKQA 4LAZA 4R33A 3QV6A 2JGYA 2XH2A 3H53A 3EPOA 4C6MA 3HQPA 2NQLA 3E3HA 1YTKA 1KM5A 4XV0A 1EUNA 1HXJA 1P0BA 3KEHA 1EO5A 3O0FA 3M0HA 4N9CA 1YXCA 2VDIA 1XYAA 2XINA 2F8QA 1WO2A 4YVVA 3BAJA 1D7FA 3EMZA 2WSQA 1RA5A 5F2IA 7REQB 2G3FA 1N8IA 3W70A 3R89A 4L6HA 4GISA 4AZ5A 3VM5A 5EY5A 3BLOA 3ZT5A 3RN6A 4O0QA 4UMBA 1NFPA 3VOGA 2DEPA 1GG0A 1NEYA 1E6SM 4H9XA 4QSFA 3RMEA 1O1HA 1KB3A 1TREA 3FSTA 1GUVA 2SFPA 1A5CA 3CZKA 3CHCA 3A21A 5GNXA 5E1QA 3VMPA 2ACUA 3M0LA 4YCOA 4U4MA 2DSWA 5C9ZA 2QGHA 4WVXA 1S1PA 4HCDA 1KM1A 3L0KA 3VZXA 4HZMA 2MANA 2VNCA 1FOBA 4GBDA 3QOKA 2IKHA 1GKRA 3TJIA 1SZFA 1F7BA 3HQ1A 2G96A 4JYEA 2WMFA 5KZDA 1R6WA 3U57A 3FGCB 5EBAA 4IQLA 2PTWA 2NV2A 4H9VA 2Z1XA 1ZBWA 1B0IA 3HU7A 3VILA 4KRUA 2E6DA 1X6NA 1FWTA 3N2XA 2PGFA 2J6XA 1KNWA 4GABA 4L1WA 3T0DA 1WUFA 3LTYA 5EFDA 1RSCA 1KCLA 2JKPA 1QNPA 4YLWA 1JD9A 1UWSA 3U5UA 1QI4A 1ZB5A 1BYBA 4LB3A 2P5NA 2WPGA 4PMXA 3UEQA 3CASA 7ENLA 1SFLA 3B40A 1A0DA 1AJ2A 3V36A 1MDLA 3GTFA 4D8AA 3VIIA 3VKKA 2VCBA 2VUNA 1NWTA 3ZR4A 1GJWA 3IRSA 3CV7A 3GH4A 4ATWA 5JU6A 4YCPA 2VZUA 4TXEA 1MO0A 4FOUA 3DG3A 1FWWA 5I24A 3LV5A 3KWSA 4WKHA 1ZS2A 6A3HA 3KVKA 2B31A 4QG9A 1QK2A 3FNDA 1DOSA 3VIFA 3M41A 1NAL1 3IIOA 3W07A 2NX9A 4OBRA 2OPJA 4R9XA 4HBKA 3VGEA 4DRSA 3A9IA 2FZBA 3IJLA 5C9WA 4FF5A 3CK5A 4AEOA 2W62A 5E6YA 1SW7A 3CHEA 2ZE3A 4BWLA 5CAHA 1TWSA 3MUCA 4I5RA 3B8TA 4UTJA 4AY8A 5BOOA 2BV9A 1AH0A 2EKCA 3HQOA 2YCLA 2E4TA 3L0GA 3MU7A 3G22A 3GG7A 4FIRA 2DQXA 4I8DA 3TOPA 2DSVA 3LK6A 1EYEA 5LNSA 2VC5A 1V02E 3GKFA 1BPLB 3ZMRA 3HGOA 2RJGA 2GOKA 2WZIA 2BSLA 1E1CA 1EX5A 4HNOA 4AFYA 1QNVA 2R1LA 1CGUA 3VUSA 1MZHA 5HWMA 4AX7A 4ZOCA 1U5JA 3WQFA 1OG6A 2ZRWA 3FKKA 3RLGA 1X1ZA 3WBEA 1PTGA 4E2BA 3WEOA 4V2XA 3XISA 3NL2A 1NVMA 5D2WA 3IV8A 3TX9A 2Z6JA 3PAOA 3G1HA 3R6IA 1WUEA 3CL8A 4UIOA 1LBLA 1BKHA 4ECLA 3GD6A 3H7UA 4TVDA 2OZ8A 3W24A 4C6PA 1OCJA 1JZ8A 1XCWA 2XZ9A 2GVYA 4W8LA 1U30A 3HG4A 3HOJA 3RRAA 1CGTA 1T0OA 3YPIA 4DEFA 4QBXA 1UJPA 4JFVA 3V0SA 2QQ6A 2PURA 5CPOA 2YYUA 2BASA 3CUJA 3CUHA 2D0GA 2NWSA 2A2IA 2OFJA 3T2OA 1XLKA 1O94A 4M6PA 3MUAA 4B4FA 3W0KA 3OQ8A 4QS6A 4XISA 2OEMA 3A4XA 1VJSA 2PDKA 1QWKA 1QAPA 1PUDA 3NFUA 4FOJA 1ODZA 4DWSB 3N17A 1A53A 4IOTA 3MSDA 4NU7A 4YMZA 1EIBA 2V3FA 3O05A 5BXSA 3RO8A 3GAYA 5A2CA 3RHGA 4B5SA 2P3ZA 2ZUNA 3A3WA 1SU5A 1NTHA 3RXZA 3R10A 1QBBA 3BOFA 1E0UA 2A7RA 3W1QA 3GR8A 3OVQA 4H9ZA 1IWPA 3EWXA 1I4NA 1KRBC 1Y5WA 4LEQA 1DKWA 4L9YA 4IJBA 3H6OA 2P0OA 1Q2SA 2EKGA 1ECEA 3DFYA 4NKCA 5AHFA 1TTIA 1QI2A 3CHFA 3V75A 3WH8A 2YLLA 2J7FA 1BQGA 5LGZA 2DV0A 1O60A 1WPCA 1TV8A 5LYRA 1W1B1 4HNNA 2Y7EA 2BVDA 1A47A 2OG9A 2A7PA 3THQA 2OXNA 4O1FA 2QVNA 3TN4A 4BI7A 4NZCA 5CJMA 4LUTA 5DF0A 1NOUA 5AYIA 3W74A 2WB5A 1MUWA 1OG0A 4KCWA 3R0KA 1EOKA 3C0JA 1EHAA 4F0MA 3S8HA 3MPGA 2F6UA 2C6QA 4KBXA 3RU8X 4PEKA 4OV9A 4QEHA 3OIXA 4MWAC 2WZEA 3UR8A 4I3GA 2OLAA 3PZ9A 1O6IA 5AC4A 2WV8A 3ALFA 1W6TA 4RK8A 1XR2A 2D20A 1REQA 1AODA 1Z48A 1QO2A 3SRFA 3ARYA 4GH1A 4Q4MA 2NV9A 2J9ZA 4MKSA 3EB2A 3FKRA 4AU0A 1SSDA 4A3RA 4G9PA 1O12A 1I45A 5I03A 4OZOA 5CAKA 2WVVB 1HIZA 4XZHA 1AMYA 4BF9A 1ICQA 4O0ZA 1F05A 4B3KA 3FW6A 1Y0EA 1FCQA 2X0HA 4GINA 2WWCA 3MC5A 4TTGA 1G0CA 1QCWA 2TAAA 3WLOA 3H2NA 4RDZA 3N04A 3EGJA 3V5CA 4Z0JA 2H9AA 4FNRA 3C2OA 4HTYA 2CLFA 4OUEA 1AQFA 4Y8EA 1XGZA 4JN6A 6PTDA 1RCOB 4PUJA 1TPVA 5BYWA 1SYTA 4JQ3A 2A1YA 5JH2A 1HL8A 3IJ6A 1PZ0A 1W9DM 4ZXLA 2WHKA 1S5MA 3CIXA 4TVUA 1TPEA 2D2JA 4EVZA 1DXIA 1W8SA 4EWND 3VD3A 1JRCA 3TR9A 1KFWA 3WFLA 3W82A 3CTLA 3LQGA 2PD9A 3NSNA 3EOOA 3EAUA 4QAWA 4C6DA 4IP4A 1JCLA 1GT8A 2D3NA 1QNQA 4W7WA 2QPUA 3B06A 3AXIA 3QV9A 1TTJA 3APYA 2REQA 4IFRA 3W7OA 1DIEA 3KL0A 3H2CA 4ROQA 3FA4A 1I2QA 4J3UA 7PTDA 5B7ZA 5FI8A 3CQJA 4JIHA 1NDZA 5MHBA 1MEWA 1FWHC 3B8SA 4JIQA 5D32A 4S2CA 3HV9A 2BHZA 2W66A 1IYXA 1OIFA 2CEQA 4G5DA 2YYTA 3PBUA 3LPGA 3UWYA 3GG8A 4JFUA 4Q4KA 4LY8A 3ABOA 3KOYA 4MADA 3ZVHA 1W3TA 3B97A 3THDA 2XUCA 2VTFA 1K7EA 2J6VA 3VNMA 5HNUA 1JDEA 4DF0A 3CAVA 1ZLPA 3SADA 2OGYA 4JX4A 3WF0A 1MFVA 1GVRA 2FLIA 3STGA 4AD5A 3W1PA 4OBSA 1G7UA 3LHWA 4R5EA 3QHMA 1LORA 2E7FA 4JTDA 4OOZA 1XGDA 1HJVA 4JKMA 1R2RA 4GBUA 4ZQOA 4RDVA 4E4FA 4J3TA 2GUUA 1UR9A 3D5HA 5F7UA 3EEZA 3BUVA 2VRJA 2XIBA 3ARPA 1V93A 4HZ7A 1E9ZB 3IV3A 3I3EA 1LP6A 2J8FA 1QRQA 1GCYA 4PRRA 6ENLA 5GJMA 1TV7A 1QBAA 3TW7A 2BGQA 1Y8BA 1JQXA 1EQPA 3WUGA 3SIMA 3M5ZA 3BARA 5CBBA 3KVJA 4LAOA 3SIZA 1F4HA 1FWIC 5CKSA 5HNTA 1XIHA 1SO4A 1ALDA 4ILSA 4H8VA 2EXOA 4Y7EA 5D8ZA 4XZWA 2XVLA 1U5VA 3WJSA 1JUBA 4ICMA 3PJUA 4IMAA 2QCMA 1JR1A 2XTKA 1OCNA 2G0WA 1GQIA 3BLKA 4HU3A 4HNUA 5HINA 3VKBA 4QEEA 4YIWA 3HMJG 3F7JA 1PBGA 2GK1A 5D33A 3ISIX 2QJJA 3WQOA 3DYOA 2NUWA 4ICNA 4GGBA 4JTAA 2J24A 2Z7GA 2JGQA 2GL5A 3QW4B 3ARQA 4PTMA 4HPJA 5MKGB 2QUMA 1NP0A 1JRBA 1UUOA 3GUWA 2VQUA 2E6FA 3PZTA 3QMTA 1UOZA 5AYXA 3MHGA 4CEUC 1CIUA 2HNHA 1XIMA 4FLRA 2ZUMA 4XO7A 1ZGDA 1NQKA 1Q66A 2H3BA 4WR3A 4CVWA 2Y8KA 1LJYA 3ZT6A 5BCAA 1MNZA 2FZ8A 5TIMA 3TXVA 4PTNA 3PZGA 4C1NA 4AEEA 3PTKA 4MNMA 3UPWA 2BHUA 4EPEC 4FX7A 1IXOA 3LUTA 3VABA 2E8ZA 5DMLA 4C5YA 4EXBA 4WDTA 2WKGA 5K9CA 1KKOA 5EU9A 1XX1A 3UZXA 5FJUA 2V63A 3VNJA 3AU6A 1EGVA 1PIGA 1OQFA 2OQHA 1E6PA 3VOHA 1EA0A 2RAGA 2OSWA 3QQWA 4AQLA 1W1IE 1D7KA 3KLLA 5FEWA 5HJYA 1VLWA 1FDZA 3CXOA 4R27A 4F2TA 3N4AA 3C61A 3WQVA 2QLYA 4U3CA 1JCYA 4L9XA 3W7LA 1GNXA 1SQ7A 3PG8A 1X8CA 3EBVA 1WDSA 1P0KA 1GQNA 1FQ0A 1JFXA 3SUWA 3NQ2A 2ZYFA 3MSYA 7CGTA 1K1DA 3T07A 3VNKA 1G4EA 3MMDA 1O1ZA 2EPOA 3C2EA 1JGMA 2FH8A 1B9ZA 3NZPA 3GXDA 1B9BA 4WGHA 1HKJA 1CCWB 3GHTA 2E8YA 3DERA 2Y62A 3N2CA 1US2A 1JEZA 4KWSA 4AZIA 1EO7A 4Q32A 2XPKA 4QGCA 1VHCA 4D6JA 2H9AB 4C1LA 1SGJA 2I1OA 8RUCA 1UH4A 5AKQA 2WHLA 2YBTA 2VCAA 3H4GA 1J96A 1ZENA 5CC5A 4DJEA 1PZ1A 3VZYA 1OCQA 2JBMA 1ZCOA 4QXIA 3H2OA 1YDOA 1S2VA 4J28A 2IPGA 4PA8A 3L68A 4J3SA 4QJ4B 4GZ7A 6ALDA 4Y9PA 3SQSA 4S3DA 4QM1A 4GOAA 1YNQA 1XM3A 3L2IA 1XBYA 4UZUA 2IKGA 2FZNA 1TPUA 4C7DA 3TNOA 4BCEA 1VYRA 4MF4A 2ZTKA 3KBVA 4JAWA 1Z44A 3ZR5A 4ERIA 1EXPA 4NVTA 1O5QA 4LAKA 1FRBA 2PTXA 2FJUB 3TQPA 4JEJA 4JHZA 4ZXOA 4KCUA 3O3RA 4ZE4A 4KEVA 2ZWZA 4MPKA 4EANA 1E4MM 3MKKA 1UKOA 4UTTA 3W4RA 3N73A 1GVFA 3TUUA 1WXYA 4DYEA 3W87A 1Q6EA 2EQDA 3S6TA 1H41A 2QJHA 4UTWC 1UG6A 4M7SA 3AICA 3MCMA 5I79A 5DQPA 5A6TC 4ZOAA 2GLKA 4GRSA 5HMSA 1POJA 3B0VC 3SW6A 4GC4A 4POCA 1ZQ5A 2C79A 3P3BA 3PWGA 4R53A 1EHNA 4WY0A 5KINA 2YOCA 2TRSA 2ZX9A 4N9BA 3MMWA 2BX7A 2JQXA 3UT0A 5D09A 3W7JA 4PODA 4PCNA 4JOMA 3PBGA 1NDVA 2OOFA 3U8GA 1FFQA 1QNRA 4N4QA 3VD7A 1CNVA 2CU0A 3H2AA 4LALA 3NYZA 1DWJM 2Z2BA 2GDVA 3AYRA 1UB3A 2GJNA 3FYYA 3G6MA 3LG3A 2WSKA 4TVCA 1KO0A 2J77A 3QTPA 1RCQA 3T8LA 3W29A 3RPDA 4HVXA 5I6SA 2A79A 4JTJA 3EYPA 4XZIA 3LZ5A 4F9JA 1TELA 4LJ3A 4NZJA 1PWLA 3V35A 1Q85A 4FXSA 3DYMA 2OVLA 1UWTA 2B4GA 5ABGA 1ONEA 3IVSA 4UNLA 3VK5A 5GJNA 1AW5A 2HSAA 4E5TA 3QPYA 1VFHA 4LEFA 1B3OA 3P67A 4KERA 1PX8A 4K2SA 1RLCL 1XCFA 3DFPA 3UFYA 2WM1A 4Z1CA 3IUIA 5CXPA 2R94A 4XSMA 1GHRA 4O54A 5DT7A 5GJPA 3OOQA 3RAOA 2P50A 2DT2A 4H00A 2PS2A 4GC3A 1XD0A 4GUJA 1F3XA 2BY0A 1HF6A 3C6CA 4G6CA 3WX7A 2I16A 4GXWA 1XW8A 3HMCA 4FNPA 2UY5A 2CZEA 1V0LA 4EF8A 3TMLA 1TWIA 2NT1A 3MHFA 3JZEA 3FXGA 3GR7A 3WFAA 4F0HA 2C0AA 3PBMA 3ABRA 3AALA 4XAPA 1B31A 4W8BA 4W87A 4MY8A 4GKLA 2KAUC 4NT0A 1UASA 4N42A 1W31A 2ZRVA 1KGUA 4UFMA 4GZJA 4DBSA 5KEZA 3GTXA 4O14A 4W93A 1M7XA 8XIMA 1P7TA 3PJTA 4DB7A 1HJUA 3N12A 4FR1A 1IZCA 1NFGA 2D1ZA 1TQXA 5CPNA 3PWAA 2FMNA 4NAFB 3HM7A 1EC7A 3OLDA 1E9YB 1DIOA 2GPTA 1HO1A 3S2NA 1QW8A 2ZRZA 1DWIM 5C9XA 3K8LA 1CBGA 2I9EA 3N18A 4PRWA 3NZ1A 3NJ3A 4HN4A 1UD4A 1EBHA 4H9UA 2Y85A 2PSNA 1TSIA 4GA8A 4EK7A 5CG7A 5HK4A 4CQ8A 4MJ4A 1OWQA 1QFEA 4BK9A 5A8NA 1RY8A 3R7MA 1OX4A 4H6KA 1PKLA 2Y8VA 5A95A 4PMZA 3VMNA 4TQTA 1X7FA 4AZ6A 3WQPA 4Q7BA 1JDFA 4MKNA 4W85A 2Y6ZA 3AMKA 2WNWA 5F4SA 3KP1A 4EIVA 1OF6A 1GZJA 3VPLA 3BH4A 1O5KA 2Y5JA 1OINA 2BNJA 8XIAA 3SN4A 3CQ0A 3TTSA 2WJDA 3OG2A 1G4TA 5TAOA 1UR0A 1CXKA 3G1RA 2P88A 4H3DA 4NZ5A 2BLEA 1RQHA 1KM4A 3KOZA 4ZQMA 1KRMA 5AYBA 3O6CA 2FTWA 2D2OA 2ZRYA 4HJFA 1JJKA 3T0AA 4R7OA 2CLKA 3RJYA 4LVGA 4QDMA 1LDCA 4D6CA 2ZVRA 5IBXC 1SO5A 5A8GA 2PDUA 3QMRA 1JL8A 4XBKA 1MEHA 4WD0A 2VRQA 2XGBA 5E93A 1WOBA 4J9JA 3DOPA 1UD8A 1OBAA 3AXKA 4JZ5A 3ZJ7A 1X1NA 4QQUA 3HB9A 5AY7A 3NDYA 3WDIA 3WLSA 1BVNP 1W9BM 5M17A 1B57A 4MB1A 3WF4A 2X16A 4JL2A 3M0KA 5KZMA 1Z8AA 4A4AA 3L4WA 1QUMA 1JYXA 1G1YA 3UETA 4CD4A 4UMCA 2Y7FA 2Y1HA 4KQNA 3BOXA 3VNIA 4GUIA 4KEUA 2DPEA 2HNEA 2VWSA 1E0XA 1P1XA 3ANVA 1THFD 2V2CA 1M3UA 3LENA 1HN1A 3NVTA 3NSMA 4AZ7A 3LM7A 4ADUA 3V18A 3O63A 1F6PA 4IICA 3MO7A 2WVVA 4GX8A 2BB0A 4ALDA 1A5NC 1AH3A 3FDKA 4LB4A 1O95A 1JUEA 1F74A 5KSWA 4I9MA 1IEVA 2CXGA 2GGHA 2J79A 4DM2A 3CIWA 3CQKA 4Y90A 5ECUA 5EMYA 4LBUA 1V3HA 6CGTA 1FDJA 3W00A 4PZVA 4ES4A 1ZZMA 2PTZA 3B0YA 2I14A 3PNZA 4UR8A 3BTNA 5IFPA 4J35A 5AVNA 1KBIA 3VUPA 5HMEA 4WJEA 1LWHA 3WQWA 3LN3A 1VYPX 1XYFA 2I57A 3A23A 2CERA 3T1GA 4LWWA 2ATMA 2E09A 1ADDA 3T44A 3AHTA 3HQNA 3LCLA 4ZQCA 3ONCA 4M29A 4YPJA 3GTIA 3C0LA 3TC6A 3IS4A 3FS2A 4OT7A 2XWDA 4P61A 3AS2A 4FK9A 2WMJA 2Q8LA 1MQPA 2QT3A 3IUDA 4XWUA 2CZ5A 2QPXA 2X7VA 4FXJA 2VVNA 4FLOA 4S3BA 1VRXA 3NQ8A 3P80A 3DDMA 2OU4A 3LU2A 5H6HA 4J3XA 4OECA 5HUOA 3CS2A 1DXEA 5GPRA 3E49A 4KPLA 2PDPA 4LV9A 5HXMA 4ZO9A 3BLEA 1AZ1A 3AMLA 3SM0A 3ZLFA 4JHMA 3GO2A 4BJHA 3LBMA 1Q6LA 2OLHA 4TX9A 4RE0A 4DELA 4WUIA 3DI1A 1V8EA 2F84A 4C7FA 2G4FA 3BE7A 2KX9A 1R9XA 2DZWA 1B2YA 4JTIA 3ITCA 4IMDA 2Q8XA 3WDPP 1JUKA 4C6FA 3DFTA 2ABBA 3GIPA 3BAYA 4GVGA 1KW1A 1EP1A 1VB9A 1R47A 2Z1KA 4LC6A 3WEMA 2NVDA 2ZKMX 3SN0A 5CZSA 3T09A 3W71A 1P7TB 2Q8ZA 4XTIA 1KXQA 1CEOA 1QHZA 1HJXA 3GLCA 4W7VA 3O6AA 1BHGA 2PDHA 3ES8A 5HPOA 5FAJA 3RJXA 1YKWA 1J9YA 4GACA 5D05A 3MYOA 1UR2A 3DZ1A 5CPMA 1QJWA 1WDPA 4LQ1A 3H4WA 4BEQA 4MB5A 4ZEPA 2A6LA 5CGMA 1JCNA 2ZWYA 4JQ1A 4ML9A 1JDCA 3P81A 2YL9A 2C91A 3LYEA 3AHXA 2IKJA 2F9RA 1RPXA 2CLIA 3GFZA 4R88A 1Q6FA 2FGZA 4Y8FA 3E2SA 3TN6A 2R1NA 4FOKA 5HANA 5FEZA 5AHNA 2PTYA 4BZYA 4MMWA 1V4YA 2GYIA 3I6TA 1EPVA 2XIIA 1ME7A 2NW0A 4HA4A 4UBPC 4G56A 1OFRA 4K36A 1F07A 4PUUA 4NY2A 5M5DA 2WJFA 3L2MA 3DKLA 4QLJA 2PWVA 4BEUA 2I5IA 4NZ1A 4C6QA 5CC6A 3F4VA 1S2WA 3CHDA 3CHVA 3EX3A 1TTPA 1ISZA 3AXHA 1W3IA 3JZUA 3FJ6A 5BOEA 5K9DA 1K70A 3I3DA 2WVTA 5IM51 1W2PA 3RO6A 4NZ4A 3NQBA 3OBEA 2V5DA 4GQBA 1FKXA 1ZJAA 1TZ7A 5JXQA 3B0PA 3HFYA 2PWEA 1XICA 1FKWA 3PPGA 4DXXA 2EPKX 3OPSA 4LF1A 3TJ4A 1XYLA 4PUEA 2YZRA 3EXTA 3BLPX 3GBEA 3QN3A 5GQBA 1VC4A 4NNAA 2OOGA 1T96A 4PUMA 2B7QA 4B91A 3UWZA 4JPGA 5ENLA 4RKAA 2UWFA 1XH1A 2Z2AA 3L4ZA 4AW7A 3DXIA 2JKEA 3RG6A 3M0VA 3UPMA 4NX0A 4IXHA 4TMCA 3S42A 3OLEA 3C2RA 3FVMA 2Y8UA 3F2CA 4CNSA 4NIRA 1DIKA 3TOYA 1GHSA 3S9YA 1HP5A 4C65A 4LVDA 3LI0A 3P82A 2GDUA 4DBDA 3LI1A 3W1AA 3S6OA 1E4LA 5CQ1A 5AC8A 5I3IA 1BVWA 1GOMA 8A3HA 4QRNA 3W84A 1TB3A 2Z00A 1B3ZA 2YW3A 3ANYA 3RX3A 1REQB 3ZR6A 1OADA 1S39A 2VEKA 2VDHA 3WQDA 1MW3A 3V7PA 4NASA 3LBOA 2NQHA 5DX7A 4GWEA 1GVIA 3PZMA 3W2UA 1VEPA 3SFWA 3LQLA 2AQWA 4JTUA 3WBAA 3QHOA 1Z89A 3OODA 1WZAA 3ABQA 1XLMA 1TMQA 3E12A 1U5HA 3OZYA 2J88A 1KCKA 1YYAA 1DVJA 3GXFA 3EKLA 1YLVA 5AC5A 1MEIA 3MI3A 4ACZB 4HZ8A 1ESWA 3MYPA 5F2LA 1D3CA 3KS6A 1ITXA 1GVSA 1R3RA 1XQKA 2WWDA 4GJIA 1XJBA 2OB3A 1E5NA 2JALA 5D2YA 1BLIA 1GOWA 2OLSA 3MUIA 5CPLA 4GFIA 3TYEA 1XYBA 2AQVA 3U9IA 4JQ4A 1GQKA 2V82A 2OQYA 1B3WA 5HJXA 1GPFA 3SGGA 2E5DA 2XJ7A 4CVUA 4AC7C 1LL6A 1Q5MA 4Q6JA 4DJDD 3TH6A 1YNPA 3KBJA 1KRCC 3FXYA 4AXNA 3I10A 3CQHA 4D6HA 4M1BA 1ZRQA 4AIUA 2CLHA 3EEGA 1S2AA 1OC7A 3KRBA 4I9TA 3CZEA 1YBQA 1K6WA 1QNOA 3N25A 1UWUA 1HG3A 3WD3A 4OUIA 2IQDA 5AHMA 1W3KA 3GDMA 4QLKA 5FA5A 4UTWA 5BU9A 2YIHA 2ALRA 1M7OA 3QC0A 2XWEA 5HQMA 3O7UA 1XFBA 3KXQA 1GKPA 1XLEA 4PTVA 1KQZA 3W27A 1FVPA 3RCNA 4XVEA 4LUJA 3RM4A 2BXYA 3ERPA 4I6KA 2VI0A 4UFKA 4RZ6A 3W02A 1FTXA 2E9LA 3PZNA 3V0UA 2YW4A 4MDPA 1WBJA 1JNDA 4MWAE 4WDXA 3VGFA 3NO3A 1XH0A 1FHLA 3KRUA 4ZMGA 2VKZG 3UJSA 2TSYA 3HG2A 1UR8A 1V6WA 3SCVA 2OTDA 2V8ZA 1QVBA 3UJEA 2A3CA 1VIWA 1Q3NA 4NRSA 3W3OA 2AMGA 1OGSA 1TJ2A 1UA7A 2GDQA 2YBVA 3MSRA 3QR0A 1LWJA 1KBJA 3BXWA 2OZ3A 1ZBVA 1FX6A 3BO9A 2CHOA 3G0SA 2KZHA 4WKFA 5E0CA 4K6AA 4DO4A 2XSXA 3QSTA 4FNQA 1FWJC 4HK7A 3FAWA 4O10A 3VO0A 2OZTA 5LZLA 3BK0A 1UP0A 2WHJA 5I00A 5LIWX 3IJDA 3W26A 5FJOA 2V67A 2ZDSA 2HMCA 2W4XA 1TCMA 2VHLA 4HCHA 5C9UA 1J0YA 2AOSA 2QDGA 1XH2A 1K9TA 1AUSL 4CUCA 1AQHA 3GU2A 1CDGA 2NV1A 5H8MA 1AD1A 1XLDA 3PBVA 2W61A 3CEPA 4NILA 3U4FA 1TA3B 3GNRA 3WBWA 3PF3A 1TWDA 4E0CA 4FF7A 1XV8A 3IJ7A 1H7WA 2DIJA 3PK7A 3MDUA 4MOZA 4B16A 4GVHA 3H2EA 4KMQA 1JZ3A 4CD8A 5JIWA 3M16A 1EFZA 4ACZA 3AZRA 4DZAA 3QY7A 4NP7A 1DJYA 3KCLA 2BGNE 4A05A 4YTTA 1EJ7L 1VBUA 4Z1DA 2XH0A 2PBGA 4IISA 3ID7A 5FJJA 1WE5A 4KCTA 3TFXA 3JW7A 4RXGA 4O15A 3WJZA 4ZOEA 4K8EA 1V3LA 3CUXA 1EF3A 1HNYA 1I1WA 1LTDA 2GSHA 3LRKA 1TR9A 3E38A 2PGEA 2R82A 2QPSA 3DHUA 1DJZA 5A69A 1PKMA 3EKZA 1I1XA 4RDWA 3UY8A 4A8LA 3NSXA 1X38A 4GKTA 1QI3A 2IMRA 2E5BA 1ZJIA 2Q01A 3CYJA 3U5YA 5KTLA 2DSUA 3WQ4A 1D8WA 1EGMA 4O1CA 4C6OA 1F8MA 4DM1A 5A6BA 3LCIA 2C1GA 3MA8A 4LUIA 2OSXA 2JK2A 1A5OC 5C7HA 5ABFB 3DHDA 2CNCA 2VX4A 1HKIA 5TF0A 3S4TA 2WZMA 3UW6A 3S83A 5H8PA 4K68A 4IIFA 1V3JA 2GSEA 1TJPA 4DF1A 5XIAA 3LBCA 2WMKA 3GG1A 1NF0A 1MSSA 2XIMA 4DN1A 4L9ZA 1LLWA 1JF6A 1WV2A 4LS2A 1YEYA 5CG0A 3TN3A 2GVEA 1OGBA 3U2OA 2YLAA 4O50A 2A3LA 4A8NA 3QKEA 4RR4A 3TTYA 3DFHA 1E6XM 4UQCA 5I2UA 4HU8A 3Q58A 4UTIA 1W54A 3FA3A 3T2QA 1Q2RA 2GVJA 1N8WA 2CW6A 3VCCA 4HA3A 3FEQA 4WKAA 3ITTA 1AQMA 2I9UA 1MDRA 1VP5A 3CZ8A 2EG6A 3AIVA 2WO5A 3SQMA 1X7IA 2GOUA 4CU7A 2OT0A 3TC3A 4WJXA 3WDHA 2XU2A 2XSBA 3VIPA 1EYWA 2FDSA 1J5TA 1RR2A 2EHHA 2Z24A 1T40A 2PCEA 4NNCA 1FHUA 5I0DA 2HE5A 3QFWA 4FMVA 1CXHA 1JG9A 3B8WA 3QF0A 5A6BD 2X42A 1YIXA 3GU9A 3NYDA 3PFRA 2X8RA 1OFQA 4JN7A 4QNWA 1SZNA 4E2VA 4QITA 3WQGA 3NQEA 4TU1A 3BCFA 2VEFA 2YR1A 3FV9A 4EPBC 3XIMA 2QIWA 4FLSA 3LDVA 2E25A 2VGGA 2YJQA 1BRLB 3FDGA 5FF2A 4OU1A 1AZ2A 4H8UA 1T41A 2C1IA 2V5BA 2ZOXA 4D1JA 3S1VA 1TV3A 3L23A 1BYDA 3Q65A 1KFKA 2DH2A 4ZA0A 3PC0A 3W2LA 2VGIA 4YHGA 3DAQA 3MKVA 2EEXA 3RX4A 1H5YA 3D46A 5BWFA 3S47A 1XLHA 4WEVX 5D03A 1OT2A 3W1RA 1KQYA 4JFTA 2VYOA 1YTEA 2OYLA 4RV3A 1DJNA 4FI4A 2RFGA 1UP3A 3TW6A 3BJTA 4AZCB 3AWOA 4KIEA 2NXGA 1KKRA 4M56A 1L6YA 7TAAA 3USBA 4WHBA 3H23A 4CGTA 1R3TA 3GUGA 1LWIA 1JZ7A 1J0KA 4MY1A 4WIWA 4JN8A 1KGXA 1MMFA 3U7VA 2ZUVA 4ZSUA 2DH3A 3OB8A 2BXZA 4PMYA 2BWGA 3A4WA 2Y63A 2EF9A 2NQ5A 2Z4GA 1VR6A 4X0NA 4M24A 3UG3A 3LX9A 1Z9AA 1I9CB 1RJRA 4NI8A 1XLBA 1KTNA 4LCQA 3UZZA 3AHZA 3M5VA 1ZP4A 4GQ0A 3I68A 1ITQA 1ZU8A 2QW5A 2X05A 1V6TA 1K8XA 3RLUA 1A0EA 2BG5A 2IQTA 3NR0A 2P1FA 1Q65A 1W9VA 2RHGA 1G01A 5DT5A 5FF4A 3MT1A 4UQEA 3GDLA 3SRKA 1FWNA 1ZBCA 1NQ6A 4MAVA 3VKCA 4I8YA 4RXFA 2NSOA 3DI0A 2FFIA 3B8DA 4AWUA 4Z1BA 1EDQA 5JVLA 3G1YA 1K4HA 4P8VA 2E67A 1GZ1A 5A8OA 3C0QA 5K4XA 3W9ZA 1JZ4A 6REQB 3WH5A 1HT6A 1V02A 1IT8A 3B9EA 3S6DA 4Z42C 2R1MA 1YDVA 1S5WA 1GOXA 1GYNA 1C8YA 2CITA 3QGKC 5I23A 3W6MA 1CXLA 2PDBA 3MBFA 1EQCA 4A35A 1ISXA 1O68A 3AYTA 2DT0A 1TX0A 1C8VA 2W9MA 2ZXQA 4TIMA 2ISWA 4NL1A 2DW7A 1BYCA 2HS6A 4GHRA 1K8CA 3UCQA 2PDWA 1XLCA 2W67A 2YKKA 4JBRA 1EOMA 3E0FA 4IX2A 3CT2A 4KFOA 3K4DA 1CW2A 4IPPA 2D0HA 2XISA 1X39A 5EYWA 1JPMA 3CU2A 3KM8A 5AZ1A 1KBLA 4MB4A 4J2PA 5DCDA 3NQVA 1P6WA 1J2BA 1E3XA 1V3IA 4M19A 1AH4A 5A6KA 1PS9A 4U10A 4Z2GA 5HR6A 4B5WA 2QV5A 4E2DA 3PZVA 1YPIA 1W9UA 4L6OA 1G9HA 1A0CA 2QVHA 2G50A 1WX0A 3VX0A 3WMCA 4Q8QA 1VPQA 1KTBA 1RLDA 1UR3M 3SCTA 4H19A 1YE4A 2YDSA 4O12A 3D6NA 3TYUA 2Y2WA 4DJFC 3QTGA 2RUSA 1X96A 4PEEA 3VOIA 3AU2A 2ZZ1A 2BY2A 3GC5A 4HHPA 1V5XA 1HKWA 1KBBA 3ARTA 4F0LA 1EJSC 3BV7A 2NQZA 2VX6A 3N14A 1KFLA 5ABTA 3N3MA 1KXVA 2E9MA 4JIPA 2YBUA 4J3VA 4CD7A 3R0UA 2JFEX 2FH6A 3UG4A 1RP8A 1A49A 2YSWA 1EB3A 3WNKA 3ME3A 2WNNA 3EPMA 4LANA 3EA2A 1NFBA 4L1GA 4H2HA 2TMDA 4DUXA 2PPGA 5EA9A 4QQ3A 1CGXA 4YTSA 4P7QA 1HO4A 1V6UA 2C71A 3N6HA 1WKYA 3BQ5A 3F2DA 5CJ5A 3DYPA 1V79A 3WUFA 3BCJA 3M0MA 3TLQA 1OD0A 1BGGA 2VFIA 1JCXA 6XIAA 2AAAA 1BRLA 5MKGA 4RDYA 2G3IA 3KDOA 3LLDA 1CPUA 1W9XA 4AVFA 4JL1A 3K13A 1F73A 2A3HA 1B3XA 1XIEA 2B81A 4DPPA 3CTTA 3AQUA 1J01A 3A22A 4N02A 1VZWA 4IG2A 3B03A 3R13A 1J2WA 1WP6A 5F4WA 2EPHA 3GIQA 4X9YA 4IGHA 3B9OA 3G24A 4D9PA 4MZ1A 2VELA 1ZAJA 4ZB2A 2XM1A 1AMKA 1QU4A 4Q4OA 3NQ7A 3NXLA 4QAIA 2VCCA 5A1AA 3P0XA 4HSOA 2PMQA 2Y88A 3DFOA 3DENA 4O4WA 3MWCA 1GJUA 3DGBA 1E6ZA 1XF0A 4M8UA 5D2VA 4HOZA 4RPQA 2RGMA 4AY7A 1YX1A 4N6EA 3KLKA 3LHYA 4TR9A 1UIPA 1Z41A 4AZBA 3LOTA 1OFDA 2FZMA 3WD4A 3KTSA 3TCSA 4LS0A 3QQ0A 3T42A 3BANA 4IGSA 2ADAA 3F4DA 3NM1A 5G2HA 4GY1A 1N8FA 5RUBA 3FCPA 5K4ZA 3W75A 4V1XA 4DJFA 2BOEX 3R58A 5I3HA 3NQ6A 2HK1A 4IPJA 3WQEA 3SRHA 4C7GA 1LYXA 1KR0A 4ZFCA 3NEVA 3U7BA 3UXLA 3B05A 4XAYA 1LOSA 2HJPA 1LLZA 1IIHA 2GGIA 3OU8A 4MJMA 1H11A 3VDBA 4TV5A 1LLOA 3GVRA 1DJHA 3OQEA 2J7BA 1G94A 3A12A 1FWRA 4CCDA 4O1AA 3UF9A 3RNDA 1KCXA 3DFNA 3H2MA 2ZZ3A 3KTCA 3NL6A 1OIMA 4CD5A 4D6FA 1OYBA 4GCXA 1U1JA 3IVTA 2ICSA 4IMGA 4CU6A 4XBSA 3LCWA 1ZALA 1F8IA 3RUBL 1SJAA 1Q6QA 1LUCB 3AOFA 2EG8A 4AMAA 3TSBA 1J8VA 1F9CA 1QW7A 4IGNA 3URQA 5CZKA 5I09A 1ISYA 3HZ3A 2GZXA 4PCTA 2Y89A 1XRTA 2QMJA 3ELFA 4XD6A 2FTPA 4B90A 4ERAA 1C92A 2VT0A 3E5BA 2J7CA 1IT7A 3UR2A 4HZ6A 3VNDA 1GW9A 3ZJ6A 3R1ZA 3WD1A 4GNJA 5J04A 3PN8A 3OLGA 4QJ5B 1TRIA 3V16A 1IV8A 2V9DA 2PRHA 3DUGA 1OC5A 4A8IA 4DQWA 4LS1A 7ODCA 4GIRA 4GCAA 2P3EA 4BF5A 3NPUA 1K9DA 2XM2A 3F5JA 1PDYA 4LVAA 5EGRA 3SO7A 3T08A 3PZOA 3S1XA 2O9OA 3F4NA 1H7OA 4XG1A 4MWAA 1SZGA 4HNVA 3BLDA 4DBUA 1UZ1A 1BQCA 1NF7A 5C8BB 4AIEA 4UMAA 1OSEA 3SJ3A 3RRXA 3L0NA 2P76A 2VC9A 4E38A 1VD6A 4AXKA 3WLHA 2ACRA 2JF6A 1FH7A 3O1NA 1SO6A 3WK0A 1B5TA 1XRVA 3OGSA 1KV5A 1OGGA 2WOQA 3T78A 4XZMX 2QDDA 5F2MA 3PM6A 4XD4A 3WLJA 3SUVA 1LL7A 4IL2A 4XKYA 4DJDA 1ZY9A 4IJCA 4YHEA 4PMNA 1W56A 2CZDA 3W7EA 1ZAIA 2J7HA 1XRFA 4Z1AA 3GC4A 4F0KA 3M0IA 1TG7A 3FOKA 1OX5A 4DJDC 1EZ2A 1HFBA 4MKVA 1XSJA 5LIUX 4DY1A 5IFTA 1TJ0A 5DEZA 2G5WA 3A6OA 4Q8MA 3BJFA 4M7TA 4M80A 1H51A 1XLLA 1YADA 4H6EA 2PDJA 4S3AA 5BROA 1CX9A 4DUOA 3AC0A 4F79A 2RDXA 1P43A 3F4WA 1I2RA 3EDDA 5LKYA 3VD9A 3H54A 1BWVA 1OJXA 1NJJA 1A5SA 1R8LA 3MZNA 4P2VA 4Z0SA 2DJXA 4Z1YA 2J27A 4AWTA 1WAUA 1EF2A 3WDQA 5D30A 2D22A 1D9EA 4A3QA 3QY6A 1DXFA 3KFTA 5HQLA 3VIGA 2ISSA 1PL9A 3O9NA 4RUBA 1E6NA 3P61A 3GXNA 1EJTC 4O53A 1Y5VA 2PRMA 3AROA 4N9DA 3AWNA 5XINA 1JQVA 3UR5A 2IKIA 5KITA 2XG9A 5CH9A 1H60A 1YHTA 3FX4A 5CPTA 3TZFA 3NO5A 4MNKA 4UCFA 4CCZA 1TV2A 4H83A 4FB7A 3KOFA 3QRHA 4BS0A 4NAEA