3W7LA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-075
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-075
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7lA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7lA01
1PHQA 4UFHA 5G4WA 5FEWA 5FESA 4O0ZA 4AEOA 1SR9A 2JKPA 4JD4A 1YYAA 3TMLA 1TJPA 1OFDA 3CTLA 4ZQOA 1WXJA 1P1XA 4MLJA 3G3MA 3UWVA 4JR5A 3TXVA 2YW3A 3CEPA 4MFEA 4OV9A 1X1ZA 4ZQRA 4N9EA 4XBSA 3EXSA 3C52A 3N9RA 4CNPA 4CCCA 3G1AA 3W83A 4LV9A 5I3FA 4FIRA 2ZRVA 4R33A 4MFDA 5D2WA 3W85A 3G18A 3M6YA 1G4TA 4EOUA 4JTKA 1B4EA 3UPBA 4DO4A 1EP2A 4I7WA 5D37A 3S8HA 1LYXA 3MO7A 4Y8FA 2ZRUA 4UC5A 1AL8A 1GZGA 3M5VA 1W54A 4JTSA 5KINA 2EF9A 3M9YA 4MYAA 1GVQA 4G1KA 3G1FA 3QRHA 4IGHA 5EA9A 3QW3A 5KSWA 4LNYA 3GX9A 2VFDA 1XCFA 2WNNA 4JYDA 3WJZA 5DY3A 4GBUA 1H7RA 2JBMA 3SECA 4DPQA 4JIPA 3DI1A 2YFNA 2BX7A 1KV5A 2PURA 2ZZ5A 3TE9A 1LZOA 1ICSA 1J2WA 1ZAJA 1HL2A 4GUFA 1JULA 2X2GA 4UMAA 2VEKA 2ISSA 1TO3A 2C13A 3L65A 2A5HA 4FO4A 1OX4A 3G0SA 3MI2A 3KFTA 5CPNA 2CLEA 2WQPA 4OWGA 1K8ZA 3MWAA 1FUYA 2I9EA 2ZA1A 3LRLA 4RXFA 2GJLA 2NXHA 4K37A 2X1UA 1M7OA 1ZY9A 3C61A 4NQ1A 3PSVA 2V30A 4EWND 2ZRYA 4PTNA 3Q2DA 5AHIA 1JUEA 1Y0EA 3NPWA 4GUJA 5AB3A 3I7RA 3TSMA 5EY5A 1XUZA 3TC7A 2Y63A 3C2VA 1R46A 5FF7A 1FBAA 3R89A 3BK0A 3NAVA 1W5OA 1KBJA 5CZTA 2ZDRA 4FXSA 1UUMA 4IMFA 3GDMA 3W7IA 4HNUA 3NZ1A 1Q45A 1TPUA 3W1NA 5DY2A 5I3JA 3HJZA 1NSJA 2FIQA 1CW2A 3UWYA 3PC0A 4XKYB 4A2SA 4IJBA 2NWSA 2W0UA 1O4UA 1DKWA 2CLIA 2Y89A 3IEBA 1VH7A 4WXZA 4LRTA 3EWWA 1F76A 1GOXA 3EX1A 2ZZ1A 2GVLA 1GPWA 3EXRA 5BMXA 2Y7GA 4K7VA 4FNQA 4FF7A 1DBTA 1SFLA 2WNZA 3G1YA 2NXIA 3HO8A 5BMWA 3STFA 1VHNA 1VRDA 5AHEA 5FEPA 3EKLA 5L6UA 1G7UA 2YGYA 1KW1A 2C19A 3BO9A 3TC6A 4BI5A 3S5YA 4EF9A 1ADOA 4GUHA 3DHDA 3W7HA 1MXSA 1W5NA 1PL9A 4JTTA 5AYXA 2R91A 3T40A 3B8DA 3PR2A 4LT9A 2VELA 4NNAA 3W9ZA 2E6AA 4KFNA 3D0CA 5C55A 3P82A 4RZ5A 5C54A 2H8XA 2QAPA 3V75A 3C3NA 4IQLA 4WQ6A 2FFCA 3FKRA 2JGYA 4IMEA 1LRNA 1YTKA 3STCA 1VHCA 5AHMA 4JX6A 2ZZ2A 5LHEA 1GT8A 3N14A 1JCNA 2E6YA 4P2VA 4O54A 1Q6OA 3QH2A 3CPRA 3DKJA 5D03A 1LTDA 3W7RA 2B4GA 3NO5A 5G2WA 1JR1A 1OHLA 5CPOA 1VC4A 3NG3A 3LERA 4RXGA 4XZ9A 5K9CA 1KM2A 2E77A 1OX4B 4K38A 3NR0A 1FCBA 1D9EA 4N9CA 3TFCA 4MKNA 4RX0A 5U4NA 4LW7A 1IF2A 4Z1BA 1IIHA 1EUNA 1PS9A 1YTEA 1XXXA 2CZDA 3DKLA 3HPSA 3B04A 4AHOA 2V5BA 3HOJA 3WJXA 3VE7A 3L66A 3FFSA 3GXPA 1XL9A 2E5DA 3R5EA 1W3TA 1R2SA 3NL2A 4UFJA 3P84A 1JQXA 3V1PA 2A0NA 1FY6A 1K7XA 3Q37A 1KTNA 3A21A 4AVFA 5D2YA 3UY7A 3TJLA 3AJXA 1SPQA 1DQWA 2QCCA 5E1QA 1OK4A 2ZZ3A 2ZA2A 1KV8A 3C2EA 3A5FA 3GR8A 3NZRA 3O6YX 1TTPA 4MLRA 1OJXA 3MJYA 4AH7A 3W74A 1F05A 5DELA 1A50A 4UTTA 3SIZA 4MYXA 3I7QA 3NPUA 4XTDA 4HPXA 1T99A 5G2IA 1KTBA 3E0IA 4ZMGA 4GWEA 4N02A 1F5ZA 2YYUA 3MUXA 5IBXA 4YCPA 1WA3A 1AW1A 3EWZA 4FNPA 2QJHA 3ZS4A 1SW3A 1I2OA 3W2UA 1KFCA 3PBVA 4FNSA 3CIWA 1L6YA 4BFAA 4AXKA 3KVKA 1OX5A 1VGAA 2W6RA 2YSWA 1JCXA 3W75A 4LVGA 1FWTA 1H7XA 2EKCA 3DFPA 4QITA 3CHVA 4QM1A 3W23A 2Q3RA 3HIJA 1BEUA 1RR2A 3TX9A 4O57A 2VFGA 4QIUA 2Y88A 1EA0A 3N73A 4X3ZA 4MY9A 2BXVA 1SW0A 3EWUA 4WOZA 3GR7A 5D38A 2WSYA 5BW6A 3LHWA 1FWWA 5LSMA 1AL7A 1XI3A 2NX9A 4DF1A 2NXGA 4Q4KA 2B7QA 4BF9A 2CLFA 1LM1A 4MY8A 1FWSA 4O18A 4PL2A 3N3MA 4O15A 3G1XA 2OMAA 4DQWA 3MP4A 3N34A 1QDSA 1TPB1 3UYCA 1FDZA 4NZFA 3TQVA 1FX6A 3TQKA 4PC8A 3W1RA 4MVAA 3O16A 3B05A 3O15A 4Q33A 1IXNA 3NQEA 4CNOA 3VI2A 1VR6A 2EHHA 3MMTA 3W3OA 2H90A 3HGJA 2QAFA 4Q32A 4LTSA 5MHBA 1GWJA 3HG5A 1PHWA 1I2RA 4IUOA 5I3IA 1H61A 4JTIA 4LOCA 1F6PA 1B57A 3DAQA 3PVFA 3CU2A 1GQNA 1W5QA 3CC1A 1JCMP 2CLLA 3NYZA 1RQHA 1GVRA 2DU2A 3W7MA 4QNWA 2JKEA 1YDOA 2ZQ0A 2RDUA 1MEHA 3NXFA 1WDWA 1H7PA 2XN0A 1R2RA 4UTJA 3WJWA 1HO4A 2JKAA 1LBLA 1IXQA 4NXKA 4CNNA 1VZWA 3Q58A 4PEKA 4FEZA 3NQ7A 1G69A 3L5AA 2NUXA 2FDSA 4HT3A 1K03A 2ZTKA 1OK6A 3JR2A 3LTSA 4S2BA 1MO0A 3TXZA 2E1DA 2XN1A 3EWYA 1I45A 1J4EA 2XN2A 1Q6LA 2BLEA 2GPTA 3S1XA 2TMDA 3W7LA 5F4XA 1YPIA 2H6RA 3OVPA 4BWLC 2EAWA 1M6JA 2FJKA 1TPC1 4JEQA 1KTCA 4OGZA 4M6VA 3WFAA 4HIBA 4M19A 3FYOA 4Z1CA 3IRDA 1DQXA 1EP3A 3GLCA 1KM6A 4MZ8A 4GC4A 5D02A 2Y7FA 3INPA 2Z6JA 3UZJA 1ZENA 3W72A 2P1FA 1WYIA 3UNDA 4ALDA 5HR7A 4Z1AA 1SZNA 1K7FA 1NF7A 3MHFA 2YCEA 3BPWA 1XFBA 2A6LA 4M7TA 5HJLA 2HTMA 2W79A 5E0KA 3W84A 2QCHA 3A24A 4R34A 3LHZA 4K36A 1I2PA 3QYQA 5K4XA 1OFOA 4JTJA 4I9AA 4LVDA 4ORMA 5TIMA 1ALDA 3EXTA 1VYSX 5C5YA 1G4PA 2P10A 4CQ9A 3QMRA 3QEZA 3PWAA 3KXQA 3LTYA 4FX7A 1H50A 3LHVA 3NPVA 4WXYA 3BG3A 3EX4A 3FJ6A 5LNRA 3RLUA 2YPIA 3HPXA 3BARA 5LNVA 1NF0A 2G96A 4QSHA 2E6DA 1QO2A 3SSJA 3FLUA 3STEA 4L4MA 3W2KA 3G1VA 1K3UA 3M0ZA 3B0UX 3DBPA 1JVNA 4JTEA 3O63A 3TR2A 1NEYA 3FA5A 3IIZA 3NVTA 1TQJA 1O60A 3BW2A 1L2UA 1NFBA 4E2BA 1G6CA 5ABTA 1IXPA 4KWVA 3W6YA 2V2HA 3OG3A 3P67A 4S2CA 2C1HA 4GRSA 1KA9F 5J5DA 4AF0B 1EEPA 3W1LA 1KFKA 1W5MA 3DFQA 3TNOA 3SI9A 2YDAA 1IIGA 2CZEA 3THQA 1KBIA 3DGRA 3CB8A 4HPJA 1OVDA 5K4ZA 4UTIA 3DFOA 2VOMA 5AC8A 3PB2A 4IX2A 1D3GA 2WV8A 4ZQNA 4A3UA 3H54A 4AWTA 1LLWA 4KWWA 5LNWA 5F2GA 3TMQA 3VKJA 2WKJA 1YPFA 4XWUA 1JUBA 3NL6A 3O05A 4IPIA 1N8FA 4CCDA 2DJXA 3MW7A 3E9AA 1QAPA 2OT0A 5HULA 1KM1A 1RPXA 1PIIA 1DV7A 1AK5A 2Z1BA 3G22A 1VQTA 4K6AA 4Z0JA 4JIQA 4JGDA 1H7NA 3C2OA 1KFJA 2Q8ZA 1LBFA 4N4PA 4DF2A 1YTDA 1EPXA 2Q8LA 1VYRA 2Z0IA 1SZGA 3FYPA 5DCEA 1OFQA 3ATZA 1M7PA 3BLFA 4KFOA 3U6WA 1W1ZA 3O6DA 3PUEA 3LHUA 3LHYA 1S3HA 4N9DA 1WOBA 2DZTA 4PH6A 4UMBA 1OFRA 4ICNA 2C16A 2PRLA 2GUUA 3P81A 3I68A 5D30A 3ZFHA 2ZBTA 2DJLA 1JUKA 4AB4A 4HNVA 2BTMA 4LV4A 1LDCA 2CW6A 4KKXA 1QO5A 1ME7A 2C18A 2O7SA 1TPEA 4LVBA 3LI1A 4OBTA 3FKKA 2J27A 5E93A 1X1OA 3W7KA 3TFXA 3M7WA 4UTKA 3I6RA 2HSAA 4NNBA 3P80A 3E49A 1H63A 4O28A 1MEWA 4ADTA 5J5RA 1KFBA 2CLKA 3PUDA 3HPZA 5I3GA 3UD6A 2H3BA 1WV2A 4FB7A 4IXHA 1YDVA 3CIXA 3CT7A 4TMCA 5DXYA 3STGA 1TRIA 3BV4A 3UWUA 4PFMA 3PS7A 4EIVA 2DZPA 4IOTA 5AHLA 3MHUA 2DZXA 3IIVA 2VFHA 4GE8A 4OQVA 1P0NA 4BI7A 2RH9A 1XBZA 5EYWA 4NT0A 1O94A 3P5YA 3O8AA 4M6PA 1TYGA 1ONRA 1WX0A 4JICA 3UWWA 3L0NA 3L5MA 4O50A 2X30A 5BOOA 3S9YA 2WNQA 3TAKA 2NV1A 3WJYA 3MYPA 3G8RA 4RR4A 1VJIA 5AHFA 3HG4A 3UWQA 2RFGA 3LLFA 3MBDA 4IMCA 3PUOA 4PL1A 4RV8A 2YXGA 3W7PA 1R47A 5SWUA 4RZ4A 5K7JA 2ZZ6A 1ZAIA 1SSDA 3FS2A 3RNDA 4HSOA 3U8GA 4RCXA 5FF0A 2A1YA 1HO1A 1ML1A 4FNRA 1TIMA 2QR6A 3KVMA 4IPJA 3W1UA 1AW2A 1FWNA 1WBJA 2Y70A 3OA3A 5KZDA 4NUWA 1RQBA 3NPXA 3TSBA 2WSRA 5HUPA 4C1KA 4O0KA 4MIMA 3ELFA 4R7JA 3L5LA 1X6UA 2V0TA 5CZJA 4CLMA 2HS6A 4RLIA 1TPH1 1VCFA 4JYFA 1ME9A 3EB2A 3E12A 1JRBA 2GVGA 5G4EA 4WY0A 3NDOA 4UUIA 1SUXA 1WQ5A 1TV5A 4PA8A 2FPTA 3HF3A 1YXYA 3OHIA 4IMDA 5A8GA 3S42A 1YXCA 2DZVA 3KVLA 3QSRA 3T78A 3IGSA 3HGRA 1H5YA 3HG3A 3OIXA 5CSSA 1LP6A 3LDVA 3NL3A 4UTLA 1P4CA 4YMZA 1A5BA 3W2JA 4D2JA 3G1HA 2PC4A 1GYLA 1MEIA 2GQ8A 1W3NA 4LS2A 3UXAA 3TUUA 1AMKA 3M5YA 2OZ0A 3TSDA 2XFWA 3M16A 2OJPA 2ATSA 1K8YA 2V82A 3ABOA 5BRBA 3B0VC 2ZZ4A 4MUZA 3BGJA 2ZTJA 1A5SA 3LX9A 3ZWTA 2Y7DA 3ABSA 1SZEA 3W2NA 2WO5A 2NUYA 1UUOA 5F2IA 3A5VA 3DENA 4LS0A 1I4NA 2J9XA 3PM6A 4NJHA 3LGEA 1ZFJA 1VPXA 1FXQA 1TTQA 4Z08A 1GG0A 3MI6A 3BW4A 4O10A 1FCUA 4JTUA 2QJGA 3UZ5A 1EX5A 4WY0F 3GVGA 1ZJIA 3TK7A 1C8VA 1PCWA 1C29A 2QKFA 2X16A 3O6CA 1B9BA 4GJ1A 2AAMA 4P61A 1GTEA 4N6FA 3THAA 1KFLA 1LORA 2FPVA 1EWDA 3VFLA 3NQGA 1ZALA 1T0OA 3PSWA 3TQ0A 2VC6A 3GIYA 2A6NA 1K8XA 3N9SA 4O4WA 4U4MA 4W9TA 4DXVA 3BGGA 3YPIA 4XUGA 1OF6A 4GNJA 5D2VA 4AHPA 5LNUA 2ALDA 4JDYA 2TYSA 3KHJA 3G0XA 4FXRA 4JYEA 5D05A 5FEXA 4O13A 4RZ6A 3M43A 4UIOA 3NQ8A 4IXXA 4WD0A 4Z1DA 3FOKA 1CX9A 1VLWA 4UXDA 3B06A 4AAJA 5CPLA 3FEMA 2VXNA 3GXNA 3Q94A 1SO6A 3LCHA 2G95A 3MBFA 1B4KA 2I1OA 4ADUA 3BG5A 4ONVA 3NQFA 2WJZA 2E68A 2QCDA 2FQIA 3S5ZA 5DN1A 3MP5A 3O06A 3KAOA 4LVFA 2A7NA 4UFLA 2YYTA 3TA6A 4UTWC 1QWGA 1BWKA 3W2MA 2H8ZA 4UTHA 2V8ZA 3BLIA 1H7WA 4LS1A 3PY2A 3P62A 4TU1A 5EKYA 3MYOA 3U2OA 4QJ1A 3MP3A 5FI8A 3W87A 4H4IA 2VFEA 2NUWA 3GAYA 3ANYA 1TB3A 1LOQA 2YZRA 4UFKA 5U7SA 1Z44A 4O16A 1W56A 2OT1A 3NA8A 1SO4A 1ZNNA 2CFFA 7TIMA 2F84A 3QC3A 2ZCGA 1DJQA 5DXXA 1G7VA 4HSNA 4O4VA 1IGSA 1JCYA 3CM4A 5TQLA 4L4LA 4DO6A 1FCVA 5F2MA 1TMHA 5D33A 1T8XA 3W22A 3EWBX 1LROA 3F4WA 1QPOA 5IM51 4O1DA 4O1CA 3N19B 1NAL1 5LGXA 4O1AA 3GDLA 5F1VA 2QF7A 3LI0A 1LLZA 2E5CA 1Q3NA 1S5WA 3OBKA 2H3DA 1R30A 4O8RA 2LLEA 1U83A 4O1BA 1OFAA 3KVJA 3DZ1A 3HBLA 4N9BA 1PVNA 1WBHA 2YX0A 1V5XA 4TO8A 5G1TA 3C4UA 2WOQA 3S6DA 5D2XA 4H3DA 4OHQA 1YXDA 3A23A 3HG2A 1EUAA 2GVJA 4UTMA 1RVGA 3W7NA 3KOFA 1L6WA 1K02A 1GG1A 4WJEA 3P8JA 1THFD 3LCFA 1TPDA 3EX6A 5I3KA 3UQNA 1N7KA 2J9YA 4HKPA 2C15A 4ML9A 2RDWA 3PBYA 1H62A 1TCDA 1YDNA 1ZHAA 2V81A 4LU0A 4O17A 3RFAA 3S5NA 2GOUA 2FB3A 4A21A 2I14A 1VCVA 4M7SA 1I2QA 4Y96A 1TRDA 2ISVA 2V9DA 4Y6GA 2B7PA 3UWZA 4E0CA 1GTHA 3NQMA 3IIOA 5LGZA 4JDBA 1HTIA 1LOSA 3LCIA 3G1DA 4O53A 2QCDB 3EEGA 4S1FA 5G2HA 4ORIA 3W7EA 2UV8G 2DORA 3W1XA 3UXDA 5CZSA 3W76A 2NX1A 1SU5A 3KRUA 3LCWA 2E6FA 1Z41A 5LKYA 3MHGA 1QPQA 1NVMA 4UCGA 1ZCOA 3PG8A 4UR8A 5TBOA 2GQ9A 5AYYA 1ICQA 1PE1A 3HQ1A 4NXSA 1W3IA 2JGQA 4YWIA 4PODA 1AG1O 1MSSA 3OEXA 2QCMA 1J5TA 4A29A 3IIPA 1QPRA 3G1SA 5D2TA 3L68A 1JCLA 3W70A 1EB3A 5FF3A 4ADSA 3USBA 1OG0A 3S1VA 2O7QA 1SQ7A 4XTIA 2PRHA 1DL3A 3MI3A 4YCOA 4BWLA 5CZ0A 4XBKA 3FIGA 5D32A 2QCLA 1XKYA 1I2NA 3JS3A 4FIQA 1UCWA 3I65A 4J9JA 1PV8A 4XKYA 1GVSA 3W1QA 1KM0A 2DP3A 3DXIA 3GXTA 4K8EA 3C56A 2BSLA 4EF8A 2C14A 3GKAA 2X1SA 3GAKA 5FF2A 2QUTA 4AWUA 4LUIA 2A21A 2QDGA 3IVTA 4MZ1A 2P0OA 1XDLA 4JN6A 4DBDA 3NL5A 3DFSA 3TKFA 1ICPA 2A2IA 2ZRZA 5H91A 3SR7A 3P60A 4YXGA 3W1TA 1VLIA 3NQCA 2X1TA 3TAOA 5D09A 1HG3A 1GEQA 1SW7A 4MJZA 1LRTA 1F2JA 3G0UA 3I7SA 3IV3A 5C6MA 3NGJA 3LXBA 4BR1A 3B4UA 3F1QA 2TPSA 4BK9A 2C6QA 3LCLA 4GXMA 1K7EA 4CQAA 3O07A 4KFPA 2ZRXA 2ABBA 4NJIA 5FF4A 5HWMA 1I8JA 5H2ZA 4DO5A 3LB0A 5CKSA 1H1ZA 2YR1A 4K39A 4EVZA 2Y6ZA 5HWJA 4DELA 2AGKA 6ALDA 2VFFA 5K2ZA 4A22A 3B03A 5D04C 3M1ZA 2QCEA 4NU7A 1JJKA 1F7BA 1OYAA 4B5NA 5I3HA 3T55A 3NM3A 6TIMA 4IX0A 3T44A 3TCEA 4N4QA 2J88A 1GYNA 4RKAA 2TSYA 3C6CA 2ZZ7A 4FNTA 5HQEA 4A2RA 1KLZA 4K8HA 4M5PA 4DPPA 4E2DA 1ME8A 1RD5A 2NX3A 4MZYA 5EPDA 1Z48A 4FNUA 5AOUA 3S0CA 2QEZA 2B0MA 3EX3A 3L2IA 3IVSA 3L0KA 2QUVA 1HUVA 1DVJA 2QDHA 3LHTA 5HWNA 1XBVA 4MJMA 1Z42A 1EWEA 2VEPA 3CLMA 1O5XA 3W2LA 1H1YA 1OFPA 3IVUA 4YL2A 1DJNA 5DBTA 5EL1A 1Q6RA 2X1RA 2J6XA 3C0JA 5LNSA 4GUGA 1RZMA 4O19A 2YW4A 2V5LA 3C2FA 1L6SA 3PULA 4RJEA 3GNNA 4IMGA 1XC4A 3WK3A 4TIMA 2NV2A 3WJSA 1XBXA 3QJAA 3TIMA 2BWGA 2B7NA 5HR6A 1A53A 3NNTA 4UFMA 1KM3A 2RDTA 4HNNA 2CLMA 2VEMA 3VCRA 1OABA 1B3OA 1TSIA 2CZFA 5AHNA 1W0MA 4NZJA 1UJPA 3QZEA 2PRMA 4O11A 2CWNA 3IIXA 3TDFA 5HUOA 1DORA 2CLOA 3PB0A 5LHFA 1UBSA 1AW5A 1U5JA 4UTTC 1BKSA 3TW7A 4RK8A 2FTPA 1X8FA 2NZLA 1M5WA 4GFSA 4NJGA 4R53A 3F03K 3QMTA 1P5BA 3QQ1A 3T7VA 4FX6M 1SO3A 4HHPA 3NQVA 2JK2A 3GNDA 4AWSA 5CGQA 1JQVA 4C1LA 4PCFA 5F4WA 1TTJA 3NM1A 5IBXC 1OX6A 2FB2A 3M44A 3NOEA 4JX5A 1W31A 4OE7A 3NEVA 2ABAA 1QCWA 4ZL1A 1VS1A 3N2XA 3W7JA 5CG7A 2V2CA 4ZVJA 1G4SA 1XUUA 4NNCA 2J9ZA 1F6KA 4UFIA 2FLIA 3PG9A 3DH7A 5A5WA 5AYZA 3ZWSA 1W37A 2ZRWA 1GVFA 4CCEA 2A4AA 1H7OA 3LTPA 2ZYFA 1GVOA 3WK0A 3BVJA 3W71A 1EP1A 1SSGA 2HMCA 4NJKA 3WK2A 4JX4A 2PCQA 1E51A 3LV6A 1S5TA 1SFJA 4LY8A 3DFTA 2R94A 3M47A 4LUJA 3RU6A 2RHGA 5DBUA 2QCNA 2NWRA 2A7RA 1GJPA 4Y90A 4OV4A 1TQXA 4NJJA 3TH6A 1FWRA 3KX6A 3BG9A 1D3HA 4UR7A 3KRSA 3W73A 4LVAA 2E09A 3UY8A 2OX1A 4TR9A 1KM4A 2ATMA 3ZR4A 3HMJG 2DZUA 3NQ6A 1KLYA 3GDRA 4NX0A 1H60A 3L21A 2Y85A 5AN7A 2R14A 4JTFA 4JNMA 4POCA 1XBYA 3LOTA 4GUIA 4ZZ9A 3SY5A 4LRSA 3W7OA 3ABQA 2ISWA 5DCDA 3SJ3A 3GKFA 4TMBA 4WUIA 5EMUA 5KITA 4JXCA 3H55A 3SFKA 3HGOA 4Y9AA 8TIMA 1TPWA 3W1MA 3P61A 3PBWA 4HNTA 2DZWA 1W8SA 5AC6A 4LC8A 3RF9A 3NQ2A 1JCJA 1X7FA 3DHFA 4YLWA 3S1UA 1O95A 4AHQA 2V2DA 2IQTA 1MZHA 3S1WA 1JRCA 1QFEA 2G5WA 3QPZA 1G67A 1TTIA 2C0AA 5K9XA 4JTGA 3QW4B 3M41A 4X22A 3AO0A 3VE9A 4M6QA 3TV8A 3DFNA 1WAUA 1FXPA 1OF8A 1LRQA 3LCXA 2VEIA 1KM5A 4O12A 5HMSA 3B0PA 1CI1A 1F74A 3A9IA 4N6EA 5HINA 1FDYA 1UASA 1FCQA 3LRKA 3R8RA 3P5ZA 3QSTA 4UTUA 3LM7A 4OU1A 4O52A 3W7QA 1OFEA 4FHAA 3GK0A 4K7YA 3CWNA 3L67A 3DU0A 2Z2UA 4AMAA 3K30A 2ZA3A 3N2MA 3QPYA 5DLCA 5DCBA 3W07A 4MPQA 3L9CA 4WX2A 3SZ8A 1TPVA 4WZHA 1VCGA 3EKZA 2VENA 1L9WA 3L0GA 5F1UA 3GYEA 4MOZA 5F4SA 3CEUA 5G1YA 3HB9A 5HNRA 5GVJA 1DHPA 1WOAA 1A5CA 2BZNA 5CSRA 3E02A 4WY0B 2GQAA 1VYPX 4O14A 2Y62A 3TJXA 3ATYA 1IXOA 3VNDA 1P0KA 3EWXA 1Q6QA 3LV5A 3QFEA 3LBCA 5BNKA 3BLEA 3LXCA 3PAJA 4H6KA 4DF0A 1G4EA 2QJIA 3IGXA 3LRMA 2WPBA 1SO5A 1BWLA 4OT7A 5KTLA 3W86A 4QQ3A 5KZEA 4LWWA 1RV8A 5L9FA 4ZQMA 2WSQA 4WOQA 3GDKA 5EBUA 3NQDA 3KRZA 1TREA 2NLIA 4I7VA 3UPWA 1LBMA 2G97A 3S5OA 3LLDA 1T96A 5CPMA 3W7GA 3P7YA 4Z0SA 2FPYA 3FJLA 1YADA 2Y7EA 3QM3A 2QUUA 2R8WA 3F4NA 1QPNA 3P74A 4N2YA 3W1PA 2E5BA 2CLHA 5G5IA 4BI6A 3JRKA 1XM3A 2PE4A 1OYBA 5C2XA 2Y61A 2AQWA 3SW6A 1DOSA 3LBMA 3QMSA 4AF0A 1EIXA 3R13A 4CQ8A 3H53A 4ZQCA 3G24A 3G3DA 2VFIA 5AC7A 2D73A 1H51A 2EGZA 2CU0A 4E38A 3RK8A 1XDMA 2B7OA 3CQ0A 4U28A 2HS8A 4TX9A 2ZFAA 5K9DA 1V7YA 3E96A 5F2LA 3M5XA 3GDTA 2RKXA 4IWWA 3P8IA 3W1AA 1F73A 2EPHA 3EX2A 3IGUA 3HGSA 1SZFA 2VKZG 1A5AA 3BW3A 3QQ0A 1OFBA 1PCKA 1QMLA 3C2RA 2KZHA 1RQEA 2YFOA 3W7CA 3TROA 1N55A 2C3ZA 3LXAA 1O5KA 3RMJA 3TW6A 2GJNA 4I7UA 3DI0A 2Z6IA 4FX8A 3PF3A 4X2RA 4UMCA 4NVTA 3OVRA 3TU9A 3GZ3A 1BTMA 1TJRA 1FDJA 4QNEA 2QCGA 3T4CA 4JTLA 1LOLA 1R2TA 1KFEA 4UNLA 3WK1A 4MY1A 4UNKA 3LCGA 3NQAA 1QOPA 1OYCA 5K3VA 2A85A 4QAIA 1W5PA 1C9DA 4UTWA 1TV7A 4JY9A 5T26A 5AFDA 3W88A 4ZQPA 5KZMA 2A7PA 5FEZA 4JS3A 1S5VA 4XQ6A 4DBEA 4JY8A 3C8FA 4HN4A 5KMYA 3G8EA 2TRSA 3OVQA 1YLVA 1FQ0A 3O1NA 4LC6A 1QR7A 1ZAHA 4JTHA 4X9SA 2DZSA 2J24A 3R12A 3RLVA 3GB6A 1LCOA 1UB3A 3CWOX 2QCFA 3W7DA 1QNVA 4NX5A 5LZLA 2Q3OA 2OCZA 3R2GA 2CZ5A 3A22A 1TV8A 4QISA 1QOQA 3QF0A 3M5ZA 3SGUA 1TPFA 1HFBA 3ABRA 4DEFA 2F7FA 3SGZA 3PBUA
chains in the Genus database with same CATH superfamily
4C6LA 4UFHA 3ITOA 3P0WA 4H6EA 4JD4A 1YYAA 3W27A 3TMLA 5AZ0A 3DG7A 5G1MA 5JVLA 4ZQOA 4HPNA 1X6NA 2W67A 3G3MA 4HA4A 1VFUA 2PDFA 3VIIA 1S2UA 4MFEA 2OB3A 3ID7A 1U5HA 4ZQRA 2QNEA 3CQKA 3EXSA 1XX1A 3VILA 4PN2A 3G1AA 4QR6A 3K1GA 1LQ0A 2ZRVA 3QYSA 3QPEA 2J7DA 4DZHA 1YDYA 1L0PA 3G18A 4AD4A 4HJFA 1PX8A 4EOUA 4DO4A 4REQA 4I7WA 3E2VA 1HKKA 1LYXA 1QNQA 3ITLA 4C91A 1IE7C 1X97A 1GZGA 1CWYA 1G9HA 3ZVHB 4MB1A 1E6NA 5KINA 2D0FA 4IFRA 2EF9A 3WLQA 4IGHA 4W7VA 1ESWA 5HNUA 2PODA 1XCFA 4WDWA 3VIOA 1GNXA 1A3WA 2QULA 4AZ6A 3AXKA 3FDKA 1E15A 5DY3A 2JBMA 4QEHA 3FDGA 1R3TA 3SY1A 5B7ZA 1B90A 2ZZ5A 1D7FA 1W3KA 4LCQA 4CD8A 2VGBA 1ZAJA 4F48A 1HL2A 2C1GA 1R9ZA 3B9NA 2RUSA 1J6PA 4AIEA 2BVTA 3G0SA 2PS2A 4CEXC 4M56A 4FR6A 5CPNA 4GI8A 3RCNA 2CLEA 3VINA 2E9BA 1V3KA 2VM8A 3CB3A 3ANUA 3LRLA 3AI0A 2GJLA 1YX1A 1FP9A 4NQ1A 4AYGA 3MO4A 1TIWA 3T0DA 3PSVA 5HOSA 2WVUA 3WQ4A 4WGXA 2F6XA 3PPFA 5AB3A 3THDA 2Z1KA 1NARA 1WAWA 3I7RA 1AQHA 1DWGM 3TC7A 3C2VA 3M0JA 4ZR8A 1RUSA 4AZCB 1FBAA 2C8NA 4C5YA 3SCOA 3BK0A 3WEZA 2DIKA 3PK7A 4C6OA 1NDZA 1OC5A 2XIOA 2ZXAA 3VOFA 4IIHA 1UP3A 3T2QA 4HNUA 3NZ1A 3W1NA 3HJZA 1CW2A 1L8NA 1VJSA 4XKYB 4GX9A 2FJUB 5H1WA 3DC0A 2NWSA 2W0UA 2DIJA 3IEBA 3EOOA 4WXZA 4LRTA 3EWWA 3EX1A 3DYOA 3PZMA 2ZZ1A 3AMKA 3ANVA 4K7VA 5AY7A 3AS3A 2WNZA 2DVTA 3ARRA 1MMFA 3HO8A 2PDKA 5FJJA 3EKLA 1LWJA 1G7UA 5ABEA 1OBAA 4TVDA 3TC6A 3BO9A 4DUWA 3DHDA 2WQDA 3CMGA 4CNUA 3B8DA 3PR2A 4OIFA 3KWSA 3AHZA 1AJ2A 3T08A 1TWWA 3P82A 1C9WA 1DJZA 1PTGA 3V75A 2XVNA 3WQEA 2D3NA 3MUCA 1RVKA 4WQ6A 3FKRA 3UXLA 2JGYA 3B8VA 1EZWA 3L4XA 3STCA 1UZ4A 3BOFA 5LHEA 1NOFA 3S2JA 3FCPA 3VIJA 3W7RA 4HK5A 3GNPA 3KP0A 1VC4A 3NG3A 3B8IA 1V0KA 4RXGA 2QPSA 4H7VA 1KM2A 4X2PA 3H22A 1FCBA 1QHOA 3C5QA 1XLCA 1R5YA 4XAPA 4MKNA 2BG5A 3V5CA 3J7HA 6A3HA 3URBA 1XLEA 1O5RA 1XXXA 3RILA 2VX5A 2V5BA 3IJ7A 4H9UA 4PGLA 1TMLA 3GXPA 4PTXA 2E5DA 4AMCA 2JEPA 4UFJA 1LL7A 2A0NA 1K7XA 2H9AB 3Q37A 3A21A 1XYFA 3UY7A 5CBIA 3MMWA 1JPIA 5E1QA 4OOZA 3MZNA 2ZA2A 3TLLA 1KV8A 5H8UA 2WM1A 3O6YX 1UBPC 3W74A 1GK8A 2WMHA 3SIZA 4MYXA 3N15A 3NPUA 5CSYA 4L80A 1EFZA 4Q4QA 5HMEA 2WSKA 2J8TA 2YKKA 3ITYA 3NZGA 1KTBA 4GWEA 5M1TA 1ZL1A 4UQ9A 1CNVA 4K2SA 1P1MA 3SN0A 2QJHA 3ZS4A 1I2OA 3FK4A 1BAGA 3KBWA 9XIMA 4NAEB 1WZLA 3LN3A 4B4FA 1ITQA 1JCXA 1FWTA 3B3DA 3PUGA 3U48A 3W23A 4MDOA 2WCSA 5EFDA 1UOKA 2NV9A 2C91A 1RXOB 3TX9A 3AROA 4I8YA 4YYFA 2VFGA 1XH2A 2Y88A 3I3BA 3I6TA 1CXHA 1A0EA 4WOZA 1HKVA 1CGTA 4WJXA 1TG7A 5A95A 3CV2A 1OZQA 5A2BA 4Q4KA 3VPLA 4FF5A 4MAZA 3T2PA 2V63A 4W8BA 1FWSA 3VKCA 4O18A 1ZTVA 4H04A 4O15A 3VZYA 4DQWA 1MW2A 3N34A 5HK4A 1TPB1 3GG1A 3TQVA 4LAUA 3B05A 2HVOA 4D8ZA 3MDUA 5CC3A 1UQZA 1IXNA 3HMCA 3VI2A 3L4ZA 3F2CA 2C71A 3W3OA 2W27A 2XINA 1QNSA 3HGJA 4PBFA 1J96A 1J0JA 3KBMA 2WNWA 2XUCA 2ZWZA 3WQ8A 1ZZMA 2JQXA 5I3IA 1H61A 1EYWA 4JTIA 9RUBA 1F6PA 5FJIA 1UH4A 3AIVA 4S3KA 3T81A 5CEWA 3PVFA 1IGWA 3OVGA 3M0VA 4DZIA 3SO7A 4EXQA 2CLLA 1R7AA 1K4GA 4TXEA 2DU2A 1TV4A 4QNWA 4NSBA 2POTA 2VD9A 2X40A 4DJED 1BVZA 1MYRA 3CAKA 1YBQA 1WDWA 2XN0A 5AC4A 1R2RA 4OECA 1LBLA 4NHVA 4NXKA 4PEKA 1VZWA 2YBUA 4FEZA 1KRAC 3L5AA 2Z1VA 2X09A 4UWMA 2NUXA 3C2YA 2J7HA 3GW3A 2QHAA 3LTSA 1MO0A 5E5CA 1B30A 2XN1A 8XIAA 2XN2A 1Q6LA 2BLEA 1XV8A 4XO7A 2ALRA 3V5FA 5F4XA 1KGXA 3USZA 2QV4A 4GZJA 1KTCA 5IXEA 4HIBA 2XH4A 4M19A 4Z1CA 2EBNA 3BOXA 1DQXA 1EP3A 1KM6A 4H8VA 1JXKA 5D02A 3INPA 4HZ6A 3NUKA 3UZJA 1I1XA 5I3DA 1E55A 2GGIA 3UNDA 1FH9A 3P14A 4DI9A 2D24A 3URNA 2E9LA 4XIAA 3A4AA 1W9DM 3WEMA 2A6LA 3EAUA 1DWFM 3EWDA 4R34A 3LPOA 1XSJA 1TE1A 2NSOA 1I2PA 3QYQA 4NYUA 4KEUA 4LVDA 1OCBA 4ORMA 4HK6A 1JFHA 3GH4A 4PUJA 2FMOA 3UR2A 2YDSA 3QEZA 2OKOA 1E6RA 3BG3A 4WXYA 4G7EA 2VHLA 3EX4A 2HJPA 3HPXA 3VKBA 3VGGA 1FWFC 2G96A 1XC6A 3STEA 3G1VA 1K3UA 3M0ZA 2PLKA 3B0UX 2BFGA 3HV8A 2Y8VA 4ZXLA 1E0UA 1WDRA 3O63A 1Q6FA 1NFBA 1NTHA 4E2BA 3BANA 1Z69A 1VBUA 3W6YA 2HNEA 3P67A 1VPYA 3O0FA 4JN7A 1F4AA 3U0HA 2C1HA 4GRSA 3DGBA 3AXIA 5E6YA 3QGKC 1KFKA 2IUZA 2YCKX 1XIHA 4XO6A 2W91A 4JQ4A 2YDAA 1UWQA 1KBIA 3DFOA 2VOMA 4BEQA 3WY1A 4CVWA 5AC8A 5FL1A 4KIRA 2J7FA 1S3TC 1B3YA 1D3GA 5ABFA 2WV8A 3LU2A 2F6KA 3M4HA 5LNWA 3GO2A 2PF0A 4C6NA 3TMQA 3VKJA 1JDFA 3O05A 1KM1A 2UY3A 4C6QA 1DV7A 3CWHA 1JFXA 4B5TA 4JQAA 4PULA 1EZ2A 1JIBA 4KMQA 2W3ZA 5B80A 2DQXA 3L12A 1KFJA 3N17A 2WXDM 1EKOA 1YTDA 2PDPA 5EMLA 4IHCA 2F9RA 4HYWA 4QROA 1OFQA 1B5TA 4U2ZA 1OB0A 1W1IE 2DZTA 1UWSA 2PDHA 3VGBA 2PRLA 3KZSA 1UG6A 2J47A 3B9AA 3AYVA 5CC7A 4DJDC 4CD6A 3EYPA 4UTFA 2ZXQA 4LV4A 2GLKA 1QW7A 3DDMA 4KKXA 3V5OA 2O7SA 1TPEA 1DJYA 3GWQA 2Y0FA 3LI1A 4OBTA 4Q4PA 3FKKA 3VD5A 4UTKA 4NNBA 1AMYA 3P80A 1HZYA 3E49A 1GCYA 3H8AA 3PUDA 5MF5A 4IJCA 1AJ0A 3UD6A 2WM0A 4W7WA 3I3EA 2PGEA 3SQMA 3CT7A 1UP0A 2C0HA 1H4PA 4KRTA 1BXCA 4PFMA 3PS7A 2WANA 2DZPA 5AHLA 3TTOA 4QDMA 3MHUA 2VNCA 1IWBA 4BI7A 4FMVA 1DJGA 3MC5A 1XBZA 1O94A 3AUOA 4M6PA 3T42A 4JOMA 1WX0A 4O50A 4X0VA 1QUMA 3SIMA 4UB9A 3GH5A 5BOOA 3GNXA 2NV1A 1VJIA 1V3JA 1XYAA 1YKWA 3SRKA 3LLFA 1PJ9A 2J66A 3S4TA 3IJIA 2ZC1A 4WLCA 1R47A 5SWUA 4QGCA 4RZ4A 5K7JA 2E0PA 5C9XA 3FS2A 4UQCA 4RCXA 2A1YA 3WEOA 1ML1A 4FNRA 4NP7A 1FKXA 4O1FA 3OA3A 3THUA 1A5UA 1RQBA 4Z2GA 2WSRA 5HUPA 1UD5A 1QRQA 1RJPA 3VD9A 1TR9A 4XZBA 3VGDA 4CLMA 1VCFA 4JYFA 4IG2A 4URIA 1A4MA 2GVGA 1MUMA 3IUDA 4PA8A 1KC7A 3HF3A 5HQMA 3S42A 3QSRA 3T78A 2ICSA 3OIXA 3VMNA 5CJMA 3SUSA 1NIUA 2CWXA 1P4CA 2D1ZA 4OOUA 3HFTA 1J79A 4RE2A 3PBMA 4MF4A 4QTGA 3WLMA 2OJPA 5TAOA 2V82A 2GGGA 3DN5A 4O1EA 3B0VC 2FZBA 2ZZ4A 3GUGA 2ZKMX 2Y7DA 3FHQA 1SZEA 2WYSA 2WO5A 4PUNA 1JG9A 2XWEA 3A5VA 3VNZA 1DTUA 2MUCA 3PM6A 3E2QA 4NJHA 2INEA 3VX1A 1VPXA 2PP1A 4O10A 1L8PA 1RK5A 4E4UA 3ECQA 2DW7A 1PKLA 3UZ5A 2YL8A 1AD4A 1EX5A 1US2A 3TK7A 2BASA 3H2OA 2QKFA 3KTCA 2AAMA 4P61A 1L6FA 2E8YA 1LORA 3NQGA 1HKWA 1YE6A 5I00A 1CBGA 1MQPA 1SFSA 5D9NA 1T0OA 4MADA 2A6NA 3N9SA 1PTAA 4XIMA 4W9TA 4DXVA 3RO8A 1E6QM 4GNJA 1NY1A 1MQRA 3UG3A 5LNUA 4LANA 2TYSA 3KHJA 5FEXA 4O13A 4W87A 3N3TA 4IXXA 6CGTA 4DRSA 1FWIC 4OTKA 1UUQA 3VK5A 1Q5MA 3T0TA 2WZIA 4JHMA 2Q8XA 3PWIA 1US3A 3KTXA 2I1OA 3BG5A 4WSHA 1NWUA 3NQFA 2KX9A 2FQIA 3S5ZA 4C7FA 2NQ9A 1NU5A 2VDHA 3LGDA 2YYTA 4HHMA 4ZFMA 1RJQA 4LF1A 5D8WA 4L6HA 3MTWA 2H8ZA 4G7FA 4I9JA 3CQHA 1T6MA 2QPUA 3MYOA 3GNRA 1VP5A 5FI8A 4J3WA 3COTA 2NT0A 2E9MA 2E25A 4XG1A 3WD2A 1Q8JA 1Z44A 4ZB2A 2F6UA 1JZ3A 1W56A 3NA8A 2CITA 3EB3A 5DMLA 1W1YA 4U5IA 1Q2SA 4B5SA 1G94A 1QW8A 3U9IA 2WLYA 3BV7A 1DJQA 1HGWA 1XIIA 1G7VA 4HSNA 4JQ3A 4MSSA 4PMDA 5DXXA 1Q13A 3WDHA 2GSEA 3TYCA 4PUMA 4L4LA 3WYZA 1FCVA 3W38A 3M7SA 1POJA 5D33A 2O9OA 2VCCA 4O1CA 4O1AA 3P6LA 5F1VA 4US5D 3QZ6A 3LI0A 4I6VA 1LLZA 2E5CA 4TV6A 1A3XA 1S5WA 1EBGA 1SJCA 3CAWA 1J0YA 1R30A 4O8RA 2LLEA 2XSAA 5CAHA 1O66A 3ARTA 2ONEA 4HTYA 3DZ1A 4IPLA 3QV9A 2YX0A 1V5XA 4TO8A 2DQWA 1GKQA 1EQPA 3KS5A 5D2XA 3ITGA 4DJDD 4N7QA 1YXDA 3A23A 1TWDA 2Z4GA 4JFUA 3DFHA 2QGHA 3KP1A 2WHLA 1EUAA 2GVJA 3NOYA 4UTMA 3W7NA 3KOFA 1L6WA 2BMBA 3ARVA 4NAFA 1VFTA 3LQGA 3NYDA 4WHBA 5I3KA 3H2FA 3UQNA 4HKPA 2C15A 4ML9A 3PBYA 3ME3A 3NXLA 1ZHAA 1YDNA 1JZ7A 4O17A 3RFAA 4GD0A 2GOUA 2FB3A 3URQA 2V9DA 4HMDA 4DO7A 1NP2A 4E0CA 3E6EA 3IIOA 5I77A 7ODCA 1OGBA 3IS4A 3GY1A 1R9XA 3MDWA 4GACA 1F3TA 3LCIA 4O53A 1JAKA 1XD0A 3KRUA 1Z41A 5REQA 1Q63A 1DE5A 1MW3A 3MHGA 3E38A 1FWCC 1JF5A 3PG8A 5CBBA 4UR8A 5TBOA 1JDAA 4YVPA 3HQ1A 1RBLA 2VO5A 1M65A 4YWIA 2WPGA 3RGTA 4Q7IA 3APGA 2QCMA 5CLTA 4A29A 1CYGA 1QPRA 3G1SA 1JCLA 3USBA 1HT6A 4ZO6A 2O7QA 1FWGC 2EKGA 4MNKA 3DG6A 2GYIA 2QCLA 1VJZA 3JS3A 4MWAD 2ZWYA 1WDSA 1PV8A 3GXTA 3W1QA 1KM0A 2DP3A 3DXIA 2VR2A 2XM2A 4ZEPA 4P7NA 4S39A 2BP1A 4AWUA 4J2MA 2QDGA 3N9KA 4MZ1A 4AW7A 1XDLA 1FWJC 3PZNA 3P60A 3QVQA 3OYZA 3VCCA 3GG7A 4YXGA 3ERPA 4L9YA 3SRFA 1U30A 1YPXA 3PWGA 1FH8A 2AL1A 1GEQA 1E0WA 4WDUA 4CQDA 1LRTA 1F2JA 3OLIA 4PR4A 4BR1A 2HEJA 1CXLA 1GQLA 4GXMA 3NEHA 4CQAA 4KFPA 2ZRXA 4NRRA 4ZO7A 3ICJA 4PUWA 3RM9A 3LB0A 2YR1A 4CU6A 3VYLA 3PPGA 1QXLA 2G0WA 2AGKA 5CC6A 5C7HA 5D04C 4HU4A 3CH9A 1W2PA 1F7BA 3PNZA 1M01A 2X2YA 2I56A 1BQCA 3T44A 1OC7A 3TCEA 4G7EB 1GVEA 2J88A 2TSYA 5HQEA 3EWCA 1KLZA 4K8HA 4M5PA 4KEMA 1ME8A 4PMRA 2NX3A 4DY1A 1UD3A 4H9XA 3GG8A 2QEZA 3SCQA 3E74A 4GVIA 3IVSA 3MWCA 4QJ3B 2Z29A 4ILSA 3AYSA 1HUVA 1ZGDA 4H83A 2QDHA 2PZ0A 4NZ1A 3QBUA 4M1BA 2D0HA 3CLMA 2QVHA 1OINA 1UD4A 3IVUA 1E6XM 5DBTA 4DNMA 1UWRA 2GZXA 3ARZA 5GJMA 3MU7A 3P93A 3CZLA 4D6GA 4N42A 3GNNA 3W53A 3UYIA 2VVSA 3P0XA 4DJEA 1ZBKA 3I4EA 1LG2A 1PX3A 4HBKA 5HR6A 3BWWA 1KCKA 3M0XA 4UFMA 1KM3A 4HNNA 2CLMA 3VCRA 3H70A 1B3OA 5AHNA 5IOBA 4NZJA 4JAWA 3ZR5A 2BV9A 4O11A 2CWNA 3TDFA 5HUOA 4MB4A 1LL6A 1JPKA 1V0MA 4JZ5A 1BKSA 1UR0A 3TW7A 4GA8A 1M5WA 5A6BD 3QMTA 3W0KA 2J78A 3CUIA 4QLJA 3NQVA 3GNDA 2OG9A 4TUFA 5AYIA 3KLLA 1H41A 1XG3A 1JQVA 4PCFA 5F4WA 1PTDA 4M6UA 5HDRA 4QJ5B 1GJUA 1QCWA 2FVKA 3N2XA 3L2MA 2Y5JA 5GPRA 1XUUA 5CJNA 5JBFA 3MSYA 4DWSC 5A5WA 4HCLA 2ZYFA 4NJKA 4JX4A 1OIMA 3LV6A 4W85A 3OP2A 1R85A 4F9DA 4KS0A 3DFTA 3AHXA 3GBDA 3RU6A 1R6WA 4XAZA 1GJPA 3VUPA 1IWPA 4Z2LA 2VOTA 4NJJA 1FWRA 1KRMA 4IJRA 4LVAA 4FR1A 1H5VA 2E09A 4TR9A 1KM4A 1IR2A 1HNYA 1ZBVA 3VOGA 3HMJG 3HA1A 3NQ6A 4GMEA 4X60A 4BJHA 1NQKA 4R85A 4JTFA 4Q6JA 4POCA 3MJMA 1XBYA 3LOTA 3KTSA 4WKAA 4GUIA 1C7TA 2ISWA 1UYQA 4DUOA 1Y5XA 3SJ3A 2XZ7A 4WUIA 4H41A 3TN5A 3URAA 5KITA 4GKTA 2XISA 4Y9AA 3GFYA 3UZXA 4HNTA 1W8SA 4W84A 2A79A 5HQLA 3DHFA 3R0UA 2J6VA 3S1UA 1O95A 3JW7A 4MNJA 4PRTA 3S1WA 1JRCA 3V7PA 4RDZA 3ARUA 3V16A 1FFRA 3QW4B 3AO0A 1XYCA 1X7IA 2VZSA 3VE9A 3TV8A 4MPKA 1WAUA 7CGTA 4L1WA 1OF8A 1DXIA 3PN8A 3R79A 5FKYA 1LT7A 1V4YA 3AHYA 3C86A 2HISA 1F74A 1FCQA 2HE5A 3GXIA 2WMKA 4H01A 4IM4A 1WZKA 3R8RA 2VURA 4DWSA 3W7QA 1QWKA 4P7QA 1OFEA 3GK0A 4K7YA 3CWNA 4J3UA 2CYGA 1AH3A 1UMYA 4Q7BA 3K30A 1WB0A 4JCLA 4A4AA 2WC7A 4HNCA 2WHJA 3L9CA 4LEFA 3SZ8A 3L4TA 4AZIA 3QV6A 4HPGA 3TONA 3GYEA 3L4WA 5F4SA 4GVGA 3CEUA 3GD6A 5G1YA 4E2OA 4IG2B 1A5NC 2DH2A 5CSRA 2Y2WA 3ATYA 2E67A 4A3QA 2R24A 3EWXA 4NASA 1M68A 2PB1A 3LSBA 3M46A 3BLEA 2PTYA 1BYBA 3R1ZA 1M41A 1V03A 3W86A 4GY1A 3ZIZA 3AS1A 2VWTA 2CNCA 2WSQA 4NG3A 4QS6A 3OBEA 3NQDA 1TREA 2GL5A 2NLIA 4I7VA 3R10A 3S5OA 3LLDA 4TX6A 1JNEA 3W7GA 2FPYA 3FNDA 3GHSA 1YADA 1U22A 2EG6A 2R8WA 3F4NA 3SM0A 1QPNA 2E5BA 5G5IA 1E5NA 5C2XA 3SW6A 4AF0A 3KS6A 5F7UA 1XINA 1SMAA 3G24A 3CO4A 2D73A 2YB4A 2J62A 1WE5A 1SGJA 2EGZA 5DANA 4IFKA 2MNRA 3CQ0A 3APTA 4V2XA 5K9DA 1V6WA 3AIRA 1F73A 3WNMA 2CKRA 3IGUA 4R9OA 2QF8A 3WLLA 3GXMA 1GQKA 4HSHA 3QQ0A 4U3CA 3C2RA 2KZHA 1RQEA 2YFOA 2JF6A 1TCMA 3LXAA 1X1NA 3O9NA 2VCBA 2ZUVA 3DI0A 2Z6IA 4IL2A 2WKGA 3PF3A 5ENLA 3UW6A 2ZUNA 1FP8A 4QNEA 2ZX8A 4R5EA 4JTLA 2A3BA 2F2HA 1R2TA 3EEZA 2OZ8A 3LCGA 5ECVA 5GJNA 4GQQA 3TZNA 1EDQA 1W5PA 1C9DA 5T26A 5AFDA 2A7PA 5FEZA 1S5VA 1K4HA 3MB9A 1JL8A 2HPIA 3G8EA 1J10A 4EP8C 4L9XA 2YLLA 3MY9A 2FHCA 3O1NA 4LC6A 3ZVIA 3GVRA 3RLVA 1HKMA 1LCOA 3B8WA 1NM9A 3PZTA 5EBAA 2V69A 4DYKA 1RCQA 3M5ZA 3SGUA 3ABRA 4YWSA 2F7FA 2OO0A 5DT5A 4AEOA 3VOHA 4L6OA 1EX1A 5LIYX 1TJPA 1VFHA 1OFDA 4WK9A 1ISYA 2OXNA 1A0CA 2OZTA 3UWVA 2HRWA 4PYSA 1W3LA 1ZSXA 4XD6A 2OWWA 1I0BA 4N9EA 2HXTA 2V3FA 3AXHA 4CNPA 5I3FA 4PRRA 4FIRA 4LSBA 4R33A 2HV5A 2J13A 1C90A 1NQ6A 2BGSA 3OQEA 2BY0A 3BICA 1R86A 4JTKA 5IRPA 2UWFA 1YNPA 1W6TA 1KQYA 2FGBA 1ADSA 3HQOA 2CPUA 4UC5A 3BC9A 3M5VA 1W54A 4J28A 4MYAA 4G1KA 2X42A 4IUGA 3TCSA 3QRHA 5KSWA 3MMUA 3KE0A 3QW3A 5IHRA 3GX9A 2VFDA 5M03A 5A6AA 4NAFB 5HA7A 1EXPA 4BA0A 4D6FA 5FCZA 4LX4A 3DI1A 3U4FA 3TE9A 5AVHA 2JE8A 1J2WA 4R7OA 1TFVA 4RNJA 1JPDX 4CNSA 4UMAA 2A3AA 4FSAA 4W8AA 5T8GA 2C13A 3TNBA 2XDFA 2A5HA 1PWLA 1VFLA 4FO4A 1OX4A 3POCA 3MI2A 4CU8A 3UG5A 1K8ZA 1FFQA 2PDMA 2XSXA 4AEFA 2OGYA 4RXFA 4K37A 4HP5A 4NYYA 1W1TA 5FJOA 4HU3A 1VF8A 3RLHA 2XIJA 2V30A 3Q2DA 4KRUA 1NFPA 1JUEA 1XKJA 4GUJA 4V1YA 3TSMA 1XRTA 5EY5A 2ZVIA 4YN5A 2Y63A 3CHDA 4GQBA 3BLPX 1R46A 3R89A 3LLXA 3R0KA 1B3VA 5CZTA 4FS9A 1FWEC 4F79A 2RJGA 1UUMA 3FW6A 4IMFA 3BJFA 4OUIA 3W7IA 1Q45A 5I3JA 1NSJA 4IPPA 3RN6A 2Q02A 3VNMA 2J7CA 2CLIA 4K68A 2Y89A 5HPOA 1VH7A 3H7UA 5DEZA 4LCRA 1GPWA 1T7LA 3CUGA 4DN1A 1REQA 4FNQA 1DBTA 2IS7A 3MKKA 1VHNA 5AHEA 1M04A 5L6UA 3S5YA 4EF9A 2C7FA 4US5A 4GUHA 3WBEA 3W7HA 1MXSA 1W5NA 1PL9A 2PC8A 2IPWA 1XHGA 2R91A 1VFOA 3I4KA 2XWDA 3W9ZA 2E6AA 3ZLFA 1EF2A 2R1LA 4IQLA 1XLMA 3MV11 4LB3A 4IMEA 1LRNA 1YTKA 3W37A 1VHCA 3MA8A 4JX6A 3BAXA 1E71M 5C71A 1GT8A 1U5VA 1DJWA 3N14A 1JCNA 4IH3A 3DHPA 1Q6OA 1O1ZA 4KPLA 4NRSA 1LTDA 1E9LA 1TX0A 2B4GA 3EA2A 3BAKA 3LERA 4IICA 2CKSA 4H8NA 1OADA 3UF9A 3NR0A 1UR4A 3E2SA 3A3HA 4JKMA 3TFCA 4RX0A 3WLIA 5HAOA 4LW7A 4Z1BA 4KESA 1IIHA 1PS9A 4HCDA 2CZDA 3HPSA 3WJXA 4HN8A 3L66A 1XL9A 2RGMA 4I3GA 4JTRA 3VOIA 1FY6A 3AU2A 1FVPA 5D2YA 3QTGA 3TJLA 1DQWA 2ZZ3A 1G5AA 3A5FA 1K9DA 1MXDA 3MJYA 1GVYA 3U4AA 1V0LA 5DELA 1A50A 1XYZA 3FSUA 1CLVA 4F40A 3F2BA 5I23A 4PSRA 3I7QA 4G9PA 3PZVA 4LH8A 1K6AA 3R8GA 7A3HA 3BQ5A 1R87A 3DYMA 2P8CA 2D0GA 4AVNA 4GXPA 4MWAA 3H7VA 3DCPA 4JHZA 3SSZA 3UXIA 1H49A 3AHTA 5IBXA 2QXWA 4YCPA 1BSIA 1V3MA 3W01A 1SW3A 2E4TA 4FNSA 1TA3A 1L6YA 4EPDC 1TMQA 4AXKA 3KVKA 1OX5A 1EA9C 1E4IA 1CEOA 4Q4MA 5GNYA 2DVXA 5CPQA 1H7XA 2EKCA 4QITA 3CHVA 4QM1A 2X0YA 3WMSA 4QE4A 3W02A 4CEUC 4LGXA 2F61A 3CUZA 1U1UA 2V67A 1B0IA 4E3VA 2XFRA 2JIWA 3OHMB 5BW6A 3LHWA 5LSMA 4DF1A 1IT0A 2BXZA 2NXGA 3WBYA 2B31A 2DY3A 5FJRA 2CC0A 4CCZA 3IGHX 8XIMA 2OMAA 4ZCWA 2GSJA 4NY2A 3UYCA 1FDZA 3GFZA 3TQKA 5DMMA 4MVAA 5E6ZA 3GFXA 5HMFA 2BS9A 1VR6A 2EHHA 2QAFA 3HG5A 1PHWA 2YXXA 1LF1A 3A64A 4BZYA 4L4PA 1X8CA 4QBXA 2QGYA 3UGRA 2VZOA 4D72A 4LYQA 4U2YA 3CH0A 2DSWA 4GK8A 4B5WA 1W5QA 1MNZA 1JCMP 5MKGB 3NYZA 3SCNA 2PGRA 1RQHA 1GVRA 3W7MA 1GOOA 3EPMA 2CESA 3S6OA 1GEHA 1F8IA 2GWGA 3NFUA 1ZPTA 3VGHA 3EDFA 4BF5A 4HNOA 3WJWA 1HO4A 3CO8A 2JKAA 3NQ7A 1S38A 3OQ8A 1K03A 3CZEA 4C1NA 1OK6A 2OQLA 3MCOA 3LPGA 2GJXB 1VPQA 2BOGX 1I45A 1J4EA 2VZUA 5I78A 3RPMA 2P50A 2GPTA 2Z28A 1YPIA 4BWLC 1M6JA 1ADDA 5ABHA 2PWHA 4DWSB 1A5MC 5C9RA 1VIZA 4M6VA 4F66A 3GM8A 3FYOA 4ZOBA 3IRDA 5XINA 3E5BA 4AZ5A 2Z1WA 3GLCA 4GC4A 3MT1A 2Y7FA 1EXBA 2XZ9A 2Z6JA 1ZENA 3IRSA 2P1FA 1WYIA 3MUY1 1YW1A 7ENLA 1BD0A 1K7FA 1NF7A 3MHFA 3UJRA 1XFBA 3T0AA 4QJ4B 1P6WA 3WUEA 1RLCL 3NIYA 3LHZA 4K36A 3LD5A 3KCLA 2EPMX 1J11A 2ZE3A 1JYXA 3P2VA 4JTJA 5CC5A 3EXTA 5BXPA 4Q22A 2PD5A 2P10A 5AYBA 4CQ9A 3QMRA 3VM5A 2BNJA 1AODA 3LTYA 2ANUA 1XDJA 3LHVA 3NPVA 4JNYA 1RY8A 2R6OA 1NDWA 3ZJ7A 2WVTA 5AZ1A 2PTZA 1IQ8A 3SSJA 2VRKA 2Z2BA 2VGFA 4Y8EA 5FA5A 3LM3A 1SJDA 3GUWA 2FGZA 3NVTA 1TQJA 1L2UA 3VOCA 2OQYA 2ZUSA 4CD5A 2JIEA 4G56A 3TTYA 2IKJA 1LUCB 2XPKA 4KWVA 3BZJA 2V2HA 3ZO9A 4E8CA 4AF0B 2F2KA 4L56A 3G2GA 1W5MA 3CV6A 4B5VA 4MMWA 3SI9A 4F2TA 1ONXA 1W1PA 1EDGA 2CZEA 4HU0A 3DGRA 1YRRA 2VR4A 1ISWA 3RRXA 3ONCA 5BOFA 3PB2A 2DT1A 4IX2A 1IWAA 4ZQNA 4A3UA 1UR1A 1H09A 1LLWA 4KWWA 1NOUA 3ZT7A 2VX4A 4B5UA 1VD6A 3GTIA 1JD7A 1P6CA 1OT2A 4RPQA 4HOZA 1N8FA 1XLFA 4CCDA 1BYAA 3MW7A 3UESA 1X98A 1PIIA 1J93A 1DXEA 4ZOEA 1AK5A 2Z1BA 3G22A 2PSNA 2NVDA 4JGDA 1P43A 1LBFA 1ONEA 1R38A 3LSCA 4DF2A 3LK6A 3UR5A 1VYRA 3DYPA 4S3EA 1SZGA 2WC3A 1HJWA 2OR2A 1XIEA 3EDEA 4BEUA 3QC0A 4KFOA 1W1ZA 3O6DA 2NSXA 3LHUA 3LHYA 4N9DA 4NZ5A 1EC8A 2C16A 3QTPA 1WDQA 3EMQA 3AQUA 3ZFHA 2DJLA 4ZSTA 1UR8A 4G2DA 4E5TA 4U33A 2J27A 4HK7A 3TFXA 3M7WA 3I6RA 3TLQA 3WUGA 1H63A 1MEWA 2FTYA 3O7UA 1KFBA 1S1PA 3WBXA 5I3GA 5FIPA 3OLDA 2H3BA 4B4HA 4KEZA 3CIXA 4YVXA 4JIEA 3SCRA 1VFSA 4XSMA 3PFMA 4TMCA 1W9VA 5DXYA 1OM0A 4C65A 3BV4A 4NZCA 4XD3A 2BVDA 2VFHA 4GE8A 1P0NA 3LBOA 2YL6A 3PJXA 5EYWA 4NT0A 1FHDA 4JN8A 1KR1A 5CZKA 4W5UA 4BQ3A 1S39A 5DFAA 5J8LA 4AX6A 2X30A 2XGIA 4M29A 3S47A 2PTDA 2WNQA 4GNVA 4RW5A 5BCAA 4K1WA 2XSBA 1ZRQA 3IJDA 4E8GA 3WBWA 3MBDA 2D69A 3PUOA 4GC3A 4BKNA 3W7PA 1AQMA 4H19A 2JFEX 3RNDA 3U8GA 5FF0A 4QCEA 1HO1A 1TIMA 2QR6A 3N13A 1GKPA 3W6MA 2PDUA 1OGGA 1WBJA 2Y70A 3E5PA 3VIPA 3EMCA 1PKYA 4FLSA 3TSBA 1XIJA 4C1KA 4MIMA 3ELFA 1GORA 2V0TA 1UA7A 3ONBA 1TPH1 1CXKA 5D4YA 1JRBA 2HPMA 3FXYA 3NDOA 3VNYA 1SUXA 2GJPA 1XLIA 4UOZA 2V5CA 2FPTA 5A8GA 4IMDA 1YXCA 3IGSA 3WZ0E 3HGRA 1QPKA 3CQJA 3K4DA 5GJPA 2WB5A 3E0VA 5JIWA 5I03A 3UVIA 1LP6A 1ZBCA 3NL3A 4UTLA 4YMZA 1W3NA 4LS2A 3UERA 3BOLA 4ZE4A 1E0VA 1D8WA 5DT7A 3SGGA 1A5KC 1MZRA 1OT1A 3BMWA 3ZWTA 4PMYA 2HNHA 1OGSA 5GNXA 5HMDA 1O12A 4CD4A 3MCNA 4LS0A 5DMYA 2QV5A 2VGIA 1TTQA 4Z08A 3OTRA 1GZ1A 3NGFA 1FCUA 1UWIA 4GQ0A 2O0TA 2R1KA 5M17A 1XH1A 2OSYA 4GJJA 4JQ2A 3SRHA 2QJGA 3V36A 1EOKA 1ZJIA 4DXKA 1PCWA 1C29A 4GJ1A 3TJ4A 3VFLA 1EWDA 4LF2A 3HPAA 3TA9A 4PFHA 5A69A 3PTQA 4E6MA 2FH6A 3HPFA 3RX4A 1EHAA 1LQ2A 3ZM8A 3SEPA 4XUGA 2V3GA 3PPHA 2V5KA 2FZ9A 2Z1XA 5C9ZA 5D05A 1GQJA 1WNOA 3QR1A 1DP0A 2JALA 1XLAA 1VFFA 5I6SA 6PTDA 1CECA 3EGJA 4XISA 4AC7C 3GXNA 3Q94A 1X96A 3LCHA 1IYXA 3SCVA 4D6CA 2ZDSA 3QR0A 5XIMA 1PEZA 2E68A 4PMXA 4LVFA 4J3ZA 5BROA 4EKJA 1AFSA 2A7NA 1KBKA 1UD6A 4UTWC 1P0BA 2QJNA 4J4KA 1W17A 1SJBA 3JU2A 2HK0A 4UTHA 1AVAA 3WL1A 2YB1A 2X1IA 2ZXBA 4LS1A 4Y7EA 5EKYA 4AY1A 3U2EA 3FXGA 4IIDA 2V6AA 1NDYA 3R4IA 4ENLA 1OIFA 4ECLA 4H4IA 4DB7A 3ANYA 1TB3A 1YIXA 3FJ4A 4TVUA 3UCQA 4Z2JA 4LBSA 4Q4SA 4HA3A 2OT1A 1BLIA 2WVVB 3A13A 3KDNA 2RDXA 1JF6A 4EANA 1IGSA 1JCYA 3CM4A 4XD4A 4LUTA 4DO6A 1CGYA 2D22A 3UG4A 5F2MA 1TMHA 1PDZA 4YTRA 2I9UA 4DJFA 1T8XA 1J9YA 3W22A 1LROA 3UZYA 4IISA 1QPOA 4DAIA 2X7WA 4O1DA 4H7CA 1AUSL 4YNGA 1NAL1 4QX4A 1Q6DA 2EQDA 3TN3A 2P53A 1N8WA 1TA3B 3ZJKA 3VGEA 1XPGA 4Q6XA 1Q3NA 4L64A 1I9CB 1M03A 1OFAA 4GVHA 4U3AA 1SR0A 5EU9A 5BU9A 4XAFA 4N9BA 3AMLA 3S6DA 3UP8A 3VIKA 1IZJA 3H2EA 4S3FA 2DV0A 3R11A 2ZX5A 1RVGA 2W9MA 3I10A 3PFRA 5CGTA 1MRAA 3LCFA 1TJ1A 1XG4A 1TPDA 4H9TA 4ZB0A 2GDVA 1YMYA 1H62A 5T9CE 3S5NA 1H0GA 3OBAA 1I2QA 4P7LA 2ISVA 2VZVA 4GGHA 3D6NA 3T05A 3NQMA 3WIJA 2BGNE 1AH4A 3NDYA 3G1DA 2QCDB 3EEGA 1HL9A 4ORIA 3W1XA 2XTKA 2PEVA 4C6FA 1SVDA 1TUXA 2NX1A 1SU5A 4JL1A 2G37A 3LCWA 1RY0A 5LKYA 4H6RA 3GH7A 3LA4A 3AZSA 1E1FA 3HN3A 4UCGA 4ML4A 1LWHA 1XRVA 4LY4A 2ADAA 1ITCA 1ICQA 4NXSA 1UC5A 1W3IA 1J2BA 2WMFA 3AIUA 4GISA 1MSSA 4QXIA 3EB4A 3WDQA 3W70A 1EB3A 5FF3A 4ADSA 3CBWA 4XAGA 1E73M 3AU6A 8CGTA 3WNNA 3WQDA 2YLAA 2VZTA 2PUZA 4D71A 5D32A 4PBEA 1JPHA 1XKYA 4RE0A 1I2NA 4M51A 1TJ2A 1XP3A 4RUBA 3N12A 1GVSA 3ARYA 3C56A 1MW0A 3N11A 4GYPA 3GAKA 2BVWA 5FF2A 4L7ZA 2A21A 3EDJA 5FAGA 2P0OA 3NSMA 4DBDA 3A4JA 3NL5A 3RU8X 2A2IA 2WSPA 3CASA 1Y5WA 4D6EA 4BQ4A 1QI2A 3KHDA 3NCOA 1EJTC 1E43A 4G5DA 1HG3A 1Q8AA 4Q3MA 1R0MA 1V93A 4GX8A 4RNHA 4RPPA 3I7SA 3IV3A 5C6MA 3LXBA 3F1QA 3LCLA 4KBXA 1K7EA 2XFYA 9CGTA 4NJIA 5HWMA 5H2ZA 1P6BA 3H6OA 3HJEA 4DO5A 1H1ZA 5LYRA 3TN6A 4K39A 3MVTA 2Y6ZA 2VFFA 5K2ZA 1CENA 4A22A 3B03A 1UKOA 2QCEA 2FVMA 2ZUUA 1OYAA 1MQQA 3VOJA 4D8AA 3T55A 3NM3A 6TIMA 5IDZA 1HJXA 3C6CA 2ZZ7A 4AZ7A 2IKGA 2UY4A 4OFCA 1V3LA 4DPPA 5A8QA 5EPDA 1Z48A 4H6QA 5AOUA 3S0CA 2HVMA 1K9TA 2IPJA 1XLBA 3EX3A 5C7VA 4P8XA 1GONA 1QBBA 1XH0A 3L0KA 3OJGA 1XBVA 4MJMA 1B31A 1B2YA 1W1B1 3W2LA 1H1YA 1OFPA 1RK6A 3WD0A 4I9TA 1DHKA 2X1RA 5I5RA 2J6XA 1TZZA 4H2CA 3GVVA 4PUKA 3TWAA 1ZJHA 3DIPA 1A5OC 1ITUA 1UZDA 2PDYA 1L6SA 4M81A 4RJEA 3N4FA 2VX7A 5LA2A 5A8OA 2E40A 4Q8PA 1KCXA 1XC4A 4GI9A 3EZ4A 4TIMA 2NV2A 4FZIA 3T4WA 1N82A 2QQ6A 3RM8A 3VGFA 1XBXA 3TIMA 1GZJA 1ZJBA 3W25A 6REQA 2B7NA 1A53A 4OVXA 3WELA 2PFHA 1XRSA 1QT1A 2CZFA 4J35A 1UJPA 5EMMA 3QZEA 3WQ6A 2CLOA 3PB0A 3N2BA 3H24A 1AW5A 2WHMA 3RDKA 3SB0A 1X8FA 4NJGA 1C93A 3F03K 5JXQA 3QQ1A 4FX6M 4YJ5A 2DUAA 1EC9A 3MUZ1 1XIBA 1KRCC 4C1LA 3S1GA 3NM1A 3B4YA 4H9YA 2FB2A 3M44A 3NOEA 4J5NA 2FVLA 2WMIA 4JX5A 1W31A 3CPGA 3WUBA 2ABAA 1Q6GA 1UC4A 1XJBA 5E9AA 3AMGA 4ZVJA 4P8WA 1P0EA 4NNCA 2J9ZA 1F6KA 2AKMA 3AHVA 1XLJA 3GXFA 3PG9A 1W37A 1W2VA 2ZRWA 5AVNA 1SMDA 4AD2A 1EDTA 2A4AA 3WK0A 3W71A 1E3XA 1EP1A 1OEPA 2HMCA 3VDAA 3WK2A 2R1PA 4QG8A 1S5TA 1SFJA 1UKTA 5CAKA 2VVNA 2R94A 3WFZA 2EJ1A 2QPXA 3M6DA 2A7RA 3AWNA 3LUTA 1Z7AA 1ZBWA 3LMYA 2J75A 3QOMA 1V79A 3KX6A 4WDXA 1XQLA 4UR7A 1RPKA 2ACSA 3KRSA 3UY8A 2OX1A 2ATMA 3B8SA 2RAGA 1VRXA 3MPGA 1KLYA 3ZZ1A 2YCLB 4IGMA 3GDRA 1H60A 2X0HA 3E0WA 3L21A 1JZ5A 1S2VA 2DSZA 4JNMA 4XBJA 3SY5A 1PKMA 4LRSA 4TMBA 5EMUA 3H55A 3OZYA 1IT8A 3BTNA 5LIUX 2GQ3A 4LC8A 4P7RA 2J7BA 2VCAA 1JCJA 1JYWA 1MZHA 4QFUA 2ZX9A 3QPZA 1G67A 3QZAA 3TTQA 1LL4A 2CXEA 2XH0A 3ES7A 4B90A 1OG6A 4JTGA 3ZSTA 1XLHA 2ZXDA 3LPPA 1ZS2A 4YU1A 1LRQA 1R3VA 4ACZA 4O12A 5HMSA 5CG0A 1CI1A 4N6EA 3A9IA 5G4HC 5HINA 2NQ5A 1FDYA 4OUEA 3CXOA 1KBBA 1BPLB 4P5UA 1MFUA 5E9XA 3L67A 2XH2A 4KWSA 1GJWA 3CUJA 2ZA3A 3QPYA 2HBVA 5DCBA 1DJXA 1LG1A 2ON3A 1TPVA 3TTEA 1W9UA 2VENA 2Q01A 3L0GA 1KXQA 2J77A 2OZ3A 5KEZA 5GVJA 3SY8A 2YA2A 5LIKX 2BZNA 1GHSA 3B97A 1VYPX 4RNFA 1KWKA 4S3CA 4CN4A 2PGFA 4JPGA 3VNDA 2QYGA 3MZ2A 3LV5A 3QFEA 1JPMA 4C6MA 3LBCA 2GGEA 4FAMA 2ZE0A 4L5ZA 5D8ZA 2WPBA 1SO5A 1BWLA 3V18A 1BG4A 5FACA 3D3AA 3CYJA 2VL4A 3NZQA 5I09A 1FHLA 3NJ3A 1I6NA 4GCAA 3KRZA 3S2MA 3NWRA 3MQTA 5LIWX 5CPMA 4Z0SA 5LA1A 4GLEA 1XICA 3QM3A 4BCEA 4FXJA 2WMJA 3W1PA 2PU0A 2CLHA 3F5JA 3JRKA 4XZIA 4HZMA 1A3HA 4PMUA 5XIAA 3LBMA 3QMSA 1EIXA 4YS1A 3H53A 4ZQCA 1JDEA 2ZUTA 3H26A 1H51A 1TVPA 1E70M 2VMFA 3RK8A 4W5ZA 4LUSA 2B7OA 2HS8A 4PCNA 1BYCA 3F2DA 4C6DA 2RKXA 3S46A 3ALFA 2AQVA 4IWWA 3P8IA 4XZNX 2EPHA 2WWDA 4IIGA 1A5AA 1KXTA 1HQTA 5CJ5A 3LG3A 4GIRA 4B16A 4A35A 5BWAA 3ZVHA 1KWGA 4F2BA 1O5KA 3GC4A 3ISIX 4GIYA 3WNKA 3RMJA 3TW6A 4I7UA 4PMVA 3TU9A 4AZHA 3GZ3A 1ISVA 1J6OA 1BTMA 1UH2A 3T4CA 4U5KA 3KWXA 3WH9A 4MY1A 3KW3A 5CH9A 1OYCA 5K3VA 3MKVA 4NKCA 4JY9A 4JEJA 4ZQPA 5KZMA 1RA5A 3C8FA 4LPCA 4Q4OA 2XVKA 4U31A 1FQ0A 4ZTYA 1H3GA 4HHHA 1A0DA 4M8UA 1QU4A 1TJ0A 4MUPA 4JTHA 4X9SA 4ASTA 5FOOA 2DZSA 1DXFA 2J24A 3R12A 4XZWA 4D1IA 1UB3A 4CKQA 2QS8A 1VIWA 2QCFA 3W7DA 1QNVA 4NX5A 1FWBC 4LALA 2Q3OA 1HX0A 3RPTA 2CZ5A 2WVSA 3A22A 1TV8A 3AFBA 4ZXOA 3QGVA 2UY2A 4EAYA 4J1OA 1K70A 1HFBA 4I6KA 2Z7KA 1S2CA 1TKKA 5FESA 5G4WA 4JIHA 1VBJA 3QFWA 3ARQA 1HIZA 1E3ZA 3FSTA 3GU9A 3B9EA 5D9MA 2WZHA 1WXJA 2UZ9A 5H8PA 2O9PA 1P1XA 3F5LA 1FHVA 2J7GA 4JR5A 5A6MA 2YW3A 3CEPA 3APYA 1A47A 2OQHA 2OYKA 1X1ZA 4Q8OA 4GYKA 4KT2A 3A4WA 2YIHA 3C52A 3PNUA 3N9RA 5EFFA 4CN6A 3BMVA 2OPJA 4WKFA 3O6AA 1EC7A 2CBUA 3M6YA 2CBVA 1BRLA 3UPBA 4D6DA 1OWQA 3U7VA 3HZ3A 5D37A 3S8HA 3PZOA 1CLKA 1JGIA 4Y8FA 2PDNA 1CGVA 3WQOA 4HMCA 3BQ6A 3MSGA 2AMXA 3M9YA 1GVQA 2O9RA 4IT1A 3PZUA 4ICCX 3G1FA 3QY6A 5EA9A 5JIPA 3V3WA 4IPNB 1SFTA 2WNNA 4Q8QA 4R27A 1BQGA 2ZADA 4JYDA 3WJZA 3IACA 2PDXA 3LMZA 4DPQA 3E0FA 4JIPA 1ITXA 1QHPA 3CYVA 4XX6A 1LZOA 2DSKA 4AWEA 2BOEX 3T0BA 4GUFA 1WKYA 2C1IA 1JULA 2X2GA 2VP8A 4M3PA 3V1HA 2VEKA 1TO3A 4Y9OA 4AX7A 4GIEA 2HE8A 3QGAC 4IGSA 3PTMA 1E9IA 3KBNA 3KFTA 3UXKA 3GNOA 2BOFX 2HDJA 1BFNA 4HA1A 5C2GA 3PBGA 1RLDA 2ZICA 2DT3A 3WUFA 1PZ1A 4GY0A 2X1UA 4H7ZA 4LFYA 4EPBC 1ZY9A 3AXXA 3ITVA 4IFOA 4EWND 1ZP4A 4J3SA 3H7RA 4LBRA 4Z2IA 4I5UA 4PTNA 5CPTA 2IPGA 2PGWA 5AHIA 4BS0A 2H9AA 3E1F1 4MWAE 1XUZA 4B3ZA 4L1XA 5H8MA 5JUVA 1YHTA 5FF7A 3IANA 1V3HA 1T41A 3NAVA 1W5OA 4OKDA 3UZZA 1RCXB 2FTWA 1BGGA 3BE7A 4Q8VA 2ZDRA 4FXSA 2GUYA 4F0LA 1DYSA 3T1GA 5TF0A 2FIQA 3Q45A 3PC0A 4A2SA 4LAOA 1DKWA 2Q71A 2CCRA 3BLDA 1GOXA 3EXRA 1GOWA 3G77A 1F6YA 2PLMA 2Y7GA 2FZMA 4FF7A 1SFLA 2AQOA 3T8LA 3I3DA 2FDMA 2G8ZA 5FEPA 4REQB 1GOIA 1M9HA 1ZB5A 2YGYA 3ZYZA 2C19A 2OOFA 1ADOA 2VQUA 4K1GA 4NAEA 4QP0A 3FVDA 4S3BA 3K8LA 2Z00A 3NSNA 4NNAA 1GW1A 4DYEA 3D0CA 5C55A 4RZ5A 5C54A 3IAQA 2H8XA 3NDZA 1IT7A 3AS2A 4YPJA 1B9ZA 5AHMA 2E6YA 4P2VA 1E1CA 4NF7A 2DT0A 3QH2A 3N04A 3IV8A 1I75A 3DKJA 4JFSA 4GO8A 4HJWA 1UP2A 4BF7A 2HBXA 5G2WA 3BZGA 8RUCA 2E77A 2GSHA 3QQWA 1Q6CA 1V6YA 4E2VA 1D9EA 4N9CA 4WVXA 3RHGA 1EUNA 3QV8A 4DBSA 3DKLA 3B04A 3HOJA 3VE7A 3NL2A 1JQXA 2XFFA 3VUSA 4AVFA 4Q8MA 3AJXA 1FA2A 2QCCA 5FJTA 1OK4A 4BHYA 3SRDA 1XCWA 3C2EA 3GR8A 3NZRA 4GVFA 2D3LA 2GDQA 3F4CA 4PTWA 5CBJA 1OJXA 4FOKA 1DWHM 4AH7A 4KWOA 3ES8A 4IIFA 4UTTA 5C8BB 3BMXA 4J27A 4KIEA 2REQA 4HPXA 4LBUA 3W00A 5BXSA 4IGNA 4CGTA 4N02A 1F5ZA 1HW6A 5BWFA 2YYUA 3MUXA 1WA3A 1AW1A 3EWZA 3QLDA 4FNPA 4ZODA 1KKOA 2QLYA 4A8RA 3AJ7A 3UU0A 1XQKA 3N4AA 4BFAA 4KRZA 1VGAA 2YSWA 3AUJA 4GYFA 1BF2A 3EBVA 4IQJA 3SQSA 3DFPA 4HCHA 2YDRA 2Q3RA 3HIJA 2X7VA 1BEUA 1EJRC 4O57A 2WMIB 1EOMA 4QIUA 3PP7A 3N73A 2OU4A 2AL2A 2BXVA 1UPMB 1SW0A 3GR7A 4C7GA 2Z2AA 2YA1A 3POHA 4AIUA 4ZSUA 3CK5A 4S3AA 4GABA 3WQWA 2AGTA 1LM1A 1ZJAA 3MV01 1VKFA 2NW0A 3UR7A 4PL2A 3N3MA 1GPFA 2L5HA 3MP4A 1QDSA 4NZFA 3AIBA 4F0MA 3PTKA 3O15A 1RBOB 1Y7VA 3TYDA 4CNOA 3AZTA 3MMTA 2FZ8A 3IJ8A 2INZA 3G6LA 3EPNA 3WENA 3OO2A 4ZOCA 1NFGA 4LTSA 3ARWA 3OODA 1JD9A 1DWJM 1I2RA 2DVUA 3IPWA 4IUOA 4F0KA 3IUHA 1CGWA 1EJXC 1KKRA 1GQNA 3CC1A 2WBKA 2PWFA 1J12A 4H9ZA 2I5QA 1B3WA 1C3FA 3LY0A 3SADA 3AISA 3JUGA 2JKEA 4Q8UA 1YDOA 2ZQ0A 1MEHA 3NXFA 1WKFA 4F2UA 3VCNA 1H7PA 4C6EA 4LEQA 4RL3A 4CNNA 4H00A 3HQPA 4IP7A 5HXMA 4HT3A 2ZTKA 3JR2A 4S2BA 1RSCA 3VIFA 1EJUC 3TXZA 3WX7A 3N2TA 2E1DA 3RPDA 3MMDA 1E0XA 3EWYA 3JZEA 4FLQA 1UROA 2GWNA 4ACZB 1C8XA 3GG0A 1EF3A 1DEDA 1PSCA 3W7LA 2G3NA 4QEEA 1TPC1 3PHAA 2DEPA 4OGZA 3WO8A 4GOAA 1UKQA 2PDJA 2BY1A 3K8MA 4HZ8A 3WNLA 1EEXA 3WH8A 3DC8A 5B7YA 4BY3A 3UNTA 4DLFA 3STPA 1J0KA 4ALDA 4Z1AA 1SZNA 1TZ7A 5GQBA 4S38A 3BPWA 1LJYA 2YCIX 4M7TA 3SN4A 2HTMA 3SUUA 4B3KA 5E0KA 3OB8A 4GBDA 4WRHA 1ENUA 4ZOAA 4HZ7A 1OFOA 5A6KA 1IR1A 2VT0A 2ZX7A 1XSKA 5TIMA 1ALDA 3M0YA 5C5YA 1F4HA 3GBEA 1MDRA 4GFIA 4B91A 3UFYA 3PWAA 1HJSA 1H50A 3Q67A 3FJ6A 3LNPA 3VDGA 3RLUA 2YZ5A 5LNVA 1NF0A 4LJ3A 2OLAA 3SUTA 4QSHA 4GZEA 3FLUA 4X0NA 3WN6A 3AALA 1BSLA 4XZLX 1KCZA 3B8UA 3TQPA 2PWGA 1XIFA 4A8NA 1NEYA 3FA5A 1NWRA 1W1VA 1MUCA 4Q8NA 5JH2A 1G6CA 1IEXA 2R1MA 3HFYA 3RUBL 3M07A 3OW1A 3OG3A 1LT8A 3H2NA 1QI3A 2PI6A 4UZUA 2HVNA 1KA9F 4MM1A 4AC1X 1EEPA 3W1LA 1ECQA 1YBQB 2P0IA 3M64A 4R88A 1AQ0A 3FHAA 4LUSB 4LQ1A 3SUWA 4HPJA 5K4ZA 4UTIA 3ARPA 4WKHA 2OVLA 3UJEA 3AIQA 4EK7A 1CGXA 4E4FA 1X38A 4AWTA 3B0XA 3RRAA 3GC2A 2GVEA 1HP4A 2WC4A 2BGQA 1J18A 1V6XA 1W9XA 2OYMA 1YPFA 5EMYA 1V3IA 2G4FA 4DJEC 4IPIA 1CGUA 3ZT6A 1QAPA 4V28A 2PD9A 5HULA 4PCSA 5ABGA 1PKNA 3GTFA 4ZA0A 1CB2A 3V0SA 1KCLA 1VQTA 4K6AA 2GOKA 4JIQA 1W32A 1U33A 3C2OA 3CUHA 1MWOA 5C9UA 2POZA 1I1WA 4N4PA 3CLWA 4EWJA 2GFTA 1EPXA 3H21A 3D5HA 2QW5A 3GIQA 2OODA 4M24A 1L6GA 1I0DA 3AICA 1WDPA 2BB0A 3A47A 3OLGA 1DE6A 4ZTXA 1QNOA 2PAJA 1TE6A 3KM8A 3P81A 4W7UA 3LYEA 2DDXA 5HJXA 4AUBA 4HPHA 2BODX 2BTMA 2CW6A 1QO5A 2C18A 4HOXA 1K1DA 4L1GA 4QAWA 1X1OA 3W7KA 3NZPA 2HSAA 4O28A 1JYNA 2HZGA 4PEEA 3BAJA 1WV2A 2B81A 4I8DA 2PDIA 3KOZA 1YDVA 3CHFA 2X05A 2E28A 2EJAA 4ZENA 4JBRA 3STGA 4P7OA 4EX4A 3UWUA 2GK1A 4EIVA 3RYSA 1E0TA 3IIVA 4S23A 1E56A 4B2DD 1BRLB 2PMQA 1PB0A 3VMOA 3WBAA 2OELA 1B3ZA 5ABFB 4CD7A 3P5YA 4HNLA 1GGOA 2OLHA 1TYGA 5HANA 1ONRA 4JICA 2VDGA 2VI0A 3IJQA 4GPNA 1KGWA 3WMCA 3TAKA 4RW3A 3MYPA 1KXHA 4RR4A 2WJFA 5AHFA 3LENA 3UWQA 1UWUA 1E6PA 4IMCA 3TZFA 1Y65A 2XU2A 1BTCA 2HWGA 2J8GA 1QVBA 1ZAIA 1SSDA 4HSOA 3UG8A 1EPVA 2VUYA 1HXJA 3IARA 1YNQA 1MI3A 4I5XA 2Z7GA 3KVMA 4IPJA 1ONWA 4W86A 1HVQA 2FZNA 2VRQA 1AW2A 1FWNA 3R0DA 2X41A 5KZDA 3REQA 1PWMA 3NPXA 3WD4A 3IWPA 1BWVA 1W8GA 1O1HA 4R7JA