3W7LA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-075
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-075
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7lA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7lA01
1H7XA 4UIOA 3AJXA 1YTDA 5HWMA 1XBVA 1OFOA 5CPMA 2JKAA 3F03K 1W37A 5TIMA 1LZOA 2TRSA 3NAVA 4XWUA 3FYPA 4BWLC 1OFQA 3MMTA 1KFJA 1KFCA 1AMKA 4JXCA 4E0CA 4E2DA 3W9ZA 3TROA 3QYQA 1A5BA 3W71A 2R91A 4CQAA 2XFWA 1I2PA 3S5NA 5D33A 2CFFA 3BO9A 4RLIA 3DFQA 3ANYA 1H7NA 3EWYA 1K02A 2CU0A 3THAA 2DP3A 1ZAIA 3M5VA 3TQ0A 2QCLA 2FFCA 5FESA 1FBAA 1A53A 2DZTA 5DXYA 3H54A 4K36A 2TPSA 3FLUA 3DHDA 1OF8A 1GG1A 3OA3A 4K39A 3UZJA 4FX6M 4AWTA 2B4GA 2C13A 3T78A 3B05A 2G97A 4Q32A 5CKSA 4O4VA 1YXDA 3KVKA 1G7UA 4RKAA 1W56A 1KTBA 3LCGA 1F5ZA 1S5VA 4ICNA 2R94A 1ZFJA 4O1BA 1OX4A 4WJEA 1OX6A 4IWWA 3WK1A 3O15A 3S1WA 3WK0A 3QM3A 4FNUA 4NJKA 2C6QA 5EL1A 3HOJA 3RNDA 1B4KA 2ZTJA 5C6MA 3W1RA 4O12A 3L0KA 4JIQA 1XBYA 3NDOA 5G4EA 1UB3A 4NJHA 5FI8A 1FWWA 2YYUA 5FEPA 4JY9A 4MYAA 2VFEA 2NUYA 2O7QA 3S6DA 1LOQA 4LT9A 4BI7A 1WA3A 1AW5A 1UBSA 2Q8LA 4DBDA 3O06A 3B4UA 3GDKA 1F7BA 2P10A 4LV9A 3RMJA 4DXVA 1TV5A 4RJEA 3DAQA 5D38A 4I9AA 3M16A 1IXPA 3PVFA 4OHQA 2Y7FA 4JTEA 1ICPA 1W5MA 3M5ZA 4LVDA 1YADA 3HG5A 1I2NA 3TU9A 4HNVA 3TQVA 3N34A 3N2XA 3ATYA 4LRSA 3BLFA 3E02A 3E12A 2Y63A 4AXKA 1AK5A 1QPOA 5D2VA 4EF9A 3MW7A 2NXHA 4D2JA 5DCEA 2WOQA 3E9AA 5D2WA 3W7MA 4XKYB 5J5RA 1IGSA 5FEXA 4Z1AA 2B7NA 4MJZA 1GQNA 3C8FA 3HPZA 2QCCA 5K3VA 4N9DA 1OFBA 4UTUA 4A22A 3LV6A 4MY9A 2FDSA 2Y85A 2ZQ0A 3VE7A 2FLIA 5F2MA 4X9SA 3T40A 5CSRA 2Y7EA 3LI1A 1K7EA 3U8GA 4IXXA 1LBLA 2NLIA 2NUWA 2NV2A 3MHFA 1QOPA 5I3KA 3IGXA 1U83A 1KM2A 3W7GA 4JICA 2H90A 3W2NA 3IVSA 5DELA 5LKYA 3L0GA 3ZR4A 1VH7A 4GUHA 4PL2A 5TBOA 4EWND 1TPWA 1GEQA 3UWZA 5AC7A 4A29A 5U7SA 2UV8G 4X22A 1TPUA 3N19B 5SWUA 5F2IA 2J9XA 5DY3A 1NEYA 3ABQA 1SO6A 3HF3A 2DZVA 3W3OA 4W9TA 4LUIA 4GWEA 3A9IA 5D02A 4GUFA 1TB3A 3NZ1A 3W2JA 2X30A 3I6RA 2V30A 2E68A 4EVZA 4JYFA 3P5YA 3H53A 2OCZA 2QJIA 2JKPA 2V2DA 2GJLA 4FXRA 3F1QA 4O19A 1XBXA 2VENA 3G1XA 4N9CA 2YR1A 2YFOA 2Q3RA 3TUUA 2C1HA 2C14A 2ZTKA 4OWGA 3CPRA 1ALDA 3MI3A 4N9BA 3EWBX 4MY8A 1PS9A 3G3DA 2C18A 1XKYA 3G1FA 2RDUA 1FQ0A 1RPXA 3QEZA 2V0TA 3G1AA 4LS0A 1TTJA 4IMDA 3L66A 5AOUA 3HB9A 1WBJA 4RXFA 3LHYA 5HR6A 4FNSA 3M0ZA 2H8XA 3K30A 4O1CA 2V2HA 1U5JA 5KZEA 4MLJA 4RZ6A 1JCLA 1ZAJA 4RK8A 1VLWA 1DKWA 1O5KA 3P8IA 3PSVA 5F4SA 3N3MA 2WQPA 1GVSA 1TSIA 3WJYA 2BSLA 1ADOA 4DO4A 4AHPA 5K4XA 3WJSA 3W84A 4UMAA 2E77A 1OFRA 4PC8A 4JTJA 4MY1A 1F74A 3UY8A 1Q6OA 3CIWA 4JX4A 5G2IA 5AYZA 1JUEA 2B0MA 4K37A 5AHEA 5FF4A 5L6UA 1Q6LA 1SZGA 3WJXA 3GXNA 2ZZ1A 2ZFAA 3LHUA 3D0CA 1J5TA 4JTSA 5AYXA 4HNTA 3LCXA 4UFMA 4EIVA 1OFDA 3G22A 3IIOA 4IJBA 1L9WA 3G0XA 3W1MA 4RR4A 3BPWA 3DZ1A 1RQHA 2VEMA 4KFNA 4O0KA 2ZA3A 1X6UA 4IPJA 4PCFA 1WAUA 1V7YA 4NZJA 5FEZA 3LGEA 4IXHA 3L2IA 5CSSA 3SR7A 3O6YX 1LP6A 2QCHA 3ZWTA 2FPVA 3WFAA 5LNSA 5BW6A 3W1LA 4LVAA 1T99A 1DQWA 2QUUA 3NGJA 2D73A 1ZENA 2Y88A 3SJ3A 4NJGA 4X2RA 2VEIA 4EOUA 5K7JA 4TMCA 2HTMA 3WK2A 5D09A 4OE7A 4I7VA 4KWWA 2ZZ2A 3P74A 1G69A 3HO8A 3GNDA 1OYBA 2TYSA 2GJNA 4LRTA 4KWVA 3HMJG 3B8DA 4LOCA 4MVAA 1LLWA 4MFEA 3STFA 1AL7A 1AG1O 2GVGA 1TIMA 3NO5A 3VKJA 1JJKA 3W88A 5MHBA 4NT0A 5DCBA 2ZRYA 4HSNA 5I3GA 4O52A 3KFTA 2V81A 3GK0A 5HJLA 4PA8A 4IGHA 5BMXA 3QMRA 4BI5A 3C0JA 4UTWC 1AL8A 1VCGA 1OX5A 1FCBA 1TQJA 4UMCA 3DFPA 4UTTA 2E6AA 1ME9A 3L67A 5CGQA 3OVQA 2OT0A 2PE4A 5C54A 1OYAA 5HNRA 3Q37A 5H2ZA 1SSDA 4BWLA 3GDTA 2ZCGA 4KFPA 3PR2A 3SZ8A 4R53A 4JD4A 4Y8FA 3MUXA 3S5OA 4UR8A 2RFGA 4Z1DA 2J9ZA 3CTLA 3GAKA 1N8FA 3GDRA 1VZWA 2E5DA 1KBJA 1LOLA 1WOBA 4AF0B 5EA9A 2FQIA 3W7NA 4YWIA 1TTIA 2EF9A 2RHGA 3W7OA 1E51A 1VGAA 3KVLA 4LY8A 3S5ZA 3S1XA 4UFIA 3HGRA 4LUJA 3W2UA 5A8GA 4JTGA 1KLYA 3QW4B 4UCGA 3AO0A 4H6KA 4UNKA 2DZWA 5KMYA 3R89A 3NQFA 5I3JA 3W1XA 5GVJA 3W2MA 1GJPA 5DLCA 3W1UA 1EP2A 1N7KA 4XBSA 2CLKA 1MEIA 3STCA 2X1SA 2ZRVA 3B03A 3W2LA 1KM3A 3LCIA 3HGSA 1VC4A 4JTFA 2OT1A 2ZZ7A 1A5AA 1VCVA 1T8XA 3MJYA 4MOZA 4POCA 1QPNA 1K8ZA 3TC7A 2VEPA 1TPVA 4NX0A 3UWYA 1FWNA 4BF9A 3P8JA 4QIUA 3LBMA 3LLDA 4O15A 1M7PA 1AW1A 1JQXA 2W79A 3I65A 4PEKA 1VRDA 4K6AA 1TPFA 4M6QA 1SFLA 3G1DA 5IBXA 3TFXA 1GT8A 4MIMA 1GYLA 2NX3A 4JTHA 3EXTA 4MUZA 3IIPA 3LCWA 1IF2A 5H91A 1FY6A 1WYIA 1I45A 2YZRA 3NM3A 1SZEA 5AYYA 2ZZ6A 3W7PA 1KV5A 2J27A 1ZNNA 1HG3A 1NF7A 3W23A 2RDWA 1JR1A 1DL3A 3LXCA 3W7EA 3FKRA 4AWSA 2Z6JA 2V9DA 1XFBA 1M6JA 3QSTA 1X1ZA 4N02A 4HPJA 1O60A 3W73A 1FXPA 2WNZA 1JCYA 3TIMA 3N9SA 3CWNA 1ME7A 5AHLA 2DZSA 3PBYA 1QNVA 4ZQMA 3MP5A 1TJPA 5FEWA 2BLEA 5I3IA 4K7VA 2GQ9A 4ORIA 4YLWA 3UWWA 5AC8A 2JKEA 3GDLA 4U4MA 3JR2A 3LHTA 4UTTC 3T55A 3P62A 2A4AA 3ZFHA 1OK4A 3DGRA 4M5PA 3SSJA 4QJ1A 1K8XA 5D2YA 3OG3A 4K8HA 1WOAA 1PCKA 4O13A 4NU7A 3I7SA 3C2RA 5D37A 3RU6A 3FJ6A 3NPWA 2J6XA 4LC6A 3BK0A 4P2VA 3OBKA 3QH2A 1JUBA 4E2BA 2ZRXA 4QSHA 1H7OA 1WV2A 1JRBA 1PIIA 4IMCA 1TV7A 2QCEA 2CZ5A 2PRLA 1DVJA 3PB0A 4OQVA 4AHOA 1S3HA 4C1LA 5DXXA 1GTHA 1T96A 1TPC1 2GQAA 2NUXA 3TR2A 3HGJA 1UCWA 2A7RA 4QQ3A 4LVGA 4O1AA 3TSDA 4LV4A 2GVJA 4MLRA 3QQ1A 4O53A 3FA5A 2ISVA 3BARA 3V1PA 5D2TA 4JGDA 4X3ZA 1KTNA 2A21A 4LVBA 1NAL1 4PODA 1GZGA 4I7UA 4WY0B 2EHHA 3NQGA 5EKYA 2CZDA 1ML1A 2QCFA 3TMLA 3GXPA 3TK7A 1W5NA 4LS2A 3ABOA 4JIPA 4JEQA 2ZA2A 4UMBA 1TJRA 2FJKA 4GNJA 4DO5A 1TTPA 3DFTA 5G1YA 1FDJA 1TV8A 2OJPA 2QJGA 3EX6A 1ICQA 2VFGA 3TE9A 4UTIA 5KITA 4QM1A 2VXNA 3A24A 1Z48A 1G4PA 5AHMA 1L6SA 3BG5A 4GUGA 4O11A 1ZHAA 1H7WA 1NF0A 4O14A 3EX4A 3GVGA 5LZLA 1DJNA 1F2JA 3TXZA 2Y6ZA 3M47A 2VFFA 3FKKA 5F4XA 1S5TA 1YTKA 1FUYA 3VNDA 2A85A 3CQ0A 4A21A 1OABA 2QUVA 3S42A 3DU0A 3UZ5A 1VHCA 1W5PA 4RZ5A 3UXDA 3W87A 3UD6A 3F4NA 5AB3A 4MFDA 4Y96A 5IBXC 2FIQA 5LHFA 1GG0A 1H60A 1TCDA 3GR7A 2XN0A 3MI2A 4JTKA 1I8JA 5HUPA 3B04A 3NQMA 1OFPA 3W86A 3KAOA 3KVMA 3A5FA 3PAJA 4CCEA 5KZMA 1QPQA 4M7TA 5KZDA 2W6RA 2IQTA 4ZQRA 1DORA 3LB0A 3BW2A 1HUVA 1SZNA 1WBHA 1IXNA 1VCFA 4RZ4A 3NQ6A 2WKJA 4GE8A 3M43A 1YXCA 1AW2A 1FWSA 4RXGA 1JCMP 3EWWA 4R34A 3W75A 1VJIA 4NQ1A 5CPLA 1LCOA 3RLUA 4UC5A 4AB4A 4QISA 3M5XA 3W7JA 3CB8A 4YMZA 1LROA 3IRDA 1W31A 3G1SA 2VFDA 1W5QA 3L5MA 3MBFA 3PG9A 3Q58A 3FS2A 1LYXA 1LLZA 5C5YA 2WSYA 1TPB1 5LNUA 1JCNA 3WK3A 5DBUA 2QR6A 4UNLA 2Q8ZA 3W7QA 3W7HA 3QMTA 1TO3A 3Q94A 1GVQA 4CNNA 1Z41A 4UTLA 2TMDA 4CLMA 1GOXA 3BGJA 3HG4A 1R30A 2CLOA 1X1OA 5LHEA 1GTEA 1FDYA 2ZRUA 2I14A 2I9EA 2WJZA 3O05A 1VHNA 1F76A 4FIQA 4HIBA 2ZRWA 5BNKA 1XL9A 2OZ0A 3GYEA 3P81A 2ISSA 2BZNA 1K7XA 4WQ6A 4JDBA 4IUOA 2V8ZA 3W1NA 1W3IA 5AHFA 1H62A 2PRMA 1GVRA 1JUKA 3C6CA 3C56A 2HS8A 4NNAA 1KA9F 1ME8A 3G1VA 2ZZ3A 4UTWA 1R47A 3LCFA 3TQKA 2WV8A 5G2WA 5BOOA 1K03A 3OVPA 4LNYA 1LDCA 2X1RA 4GJ1A 4GC4A 1CX9A 3EX2A 5A5WA 3QMSA 1SO4A 5EMUA 4NNBA 1PL9A 4IMEA 1BWLA 5U4NA 3UQNA 1SQ7A 3BV4A 5CZ0A 5LGZA 3SIZA 2V5BA 4GRSA 3R5EA 3W7KA 3PG8A 3EX1A 3GLCA 4NVTA 1PV8A 1GVFA 3DXIA 2PCQA 4QNWA 3IEBA 4WXYA 2ZYFA 1ICSA 2JBMA 1H5YA 4O4WA 2A6LA 1LRQA 1P0NA 3FJLA 4Z0SA 4TMBA 1DOSA 5FF3A 1IIGA 1VQTA 3O16A 3E49A 5LSMA 1LRNA 3P60A 3KXQA 3PB2A 5K9XA 3W2KA 3PULA 2RKXA 3KX6A 3RLVA 2NZLA 3G18A 3GR8A 4I7WA 1J4EA 2J24A 2R8WA 3IGUA 3NR0A 4AWUA 1Y0EA 1M7OA 3FIGA 3HGOA 5AN7A 2YW4A 4P61A 1A5CA 2EPHA 2PC4A 3TV8A 5DBTA 3RFAA 5LNWA 4N6EA 4N9EA 1LBMA 4U28A 4ZVJA 4XTIA 3N14A 1TTQA 2E6DA 4PL1A 1K7FA 2NXGA 2E1DA 3B0UX 2H3BA 3NVTA 4HT3A 2E5BA 1GVOA 5G1TA 4R7JA 3DFOA 3G0SA 4WOZA 3SY5A 1X8FA 2Y62A 2QAFA 4HPXA 4DPQA 1GYNA 3LI0A 3HPSA 3PS7A 5LNVA 4UUIA 3NM1A 4JX6A 3PF3A 4Y6GA 2KZHA 5LNRA 3QPZA 2ZDRA 2YDAA 2JK2A 3IIZA 2AGKA 3MWAA 1D3GA 3L5AA 4BK9A 4N4QA 2JGQA 4NNCA 4AH7A 4IX0A 3STGA 4IQLA 2CLFA 4FO4A 2YSWA 3N2MA 2Y70A 5HR7A 4HN4A 3FFSA 1R46A 1Q6RA 1VYPX 1OX4B 4JTUA 3FEMA 4Y90A 5HQEA 3CC1A 2CLEA 4RV8A 5EY5A 4UTMA 4DO6A 3GZ3A 3S8HA 1DQXA 3P84A 2E6FA 2Y61A 2BX7A 1KW1A 1FCVA 1H63A 3CHVA 3C2FA 4GBUA 1O94A 3TJLA 1XC4A 2PRHA 1QFEA 3O6DA 4J9JA 1T0OA 3EEGA 1TPDA 3GKAA 1C29A 1LBFA 3Q2DA 1YTEA 1SW7A 3VI2A 3A21A 3KHJA 3LHZA 1VYRA 3OIXA 2A7PA 4WUIA 4TU1A 5HWJA 3DH7A 4UFKA 3W74A 4AAJA 3PM6A 2WNQA 3NL6A 1P5BA 3GB6A 4Q33A 3S9YA 1UUOA 1FXQA 1XCFA 4FNRA 3P7YA 2QCNA 3SGUA 4Y9AA 1JCXA 3SGZA 1H7PA 2X2GA 2ZBTA 3QFEA 3G8EA 4FEZA 1B57A 3EWUA 5BRBA 2GPTA 1W3NA 3T44A 1LOSA 1FDZA 4DF1A 4GUJA 1KFKA 3DKLA 4M6PA 2OX1A 3NL2A 3MO7A 1NSJA 3PC0A 2DORA 4NUWA 5D04C 6ALDA 4M7SA 1ZALA 3LRKA 3C4UA 4O18A 3KOFA 2VFIA 3MYPA 3O6CA 2Y7GA 2G95A 5EBUA 3A22A 2Z2UA 2YW3A 3JS3A 4NJIA 4E38A 3TNOA 1QR7A 1I2QA 1NVMA 4NZFA 4B5NA 3JRKA 3NYZA 4LS1A 4OBTA 1MXSA 3W72A 3P82A 4AEOA 4BI6A 1R2SA 4JTLA 3ABSA 2VKZG 1LORA 3GXTA 2ATSA 2RDTA 3FYOA 5ABTA 4MZ8A 1B9BA 4XKYA 1B3OA 2C0AA 4GXMA 3TKFA 1OFAA 4Z0JA 4IOTA 1SUXA 1G4TA 4EF8A 2EKCA 1QWGA 2GOUA 2I1OA 3UWVA 1P0KA 1O5XA 1TRIA 3R8RA 3NQ8A 4MZ1A 1XUZA 3YPIA 2J88A 1TYGA 3QC3A 1RQEA 2H6RA 4WD0A 1ZCOA 2ZZ4A 1MEWA 2E5CA 3MHGA 1OG0A 1R2TA 4FNTA 4TIMA 4AHQA 5FF0A 2NX1A 4RCXA 3N73A 3SI9A 2BTMA 2FB2A 2B7QA 1JULA 1W0MA 3M9YA 4ZQOA 3LOTA 4JR5A 4CNPA 4TX9A 4UTJA 2NXIA 3LCHA 5C2XA 1EB3A 3UY7A 3TX9A 1Q6QA 2C15A 5L9FA 3OEXA 4CQ8A 1EP1A 3O63A 3NPVA 4O8RA 1I2RA 1TMHA 5TQLA 2FTPA 4LTSA 4XUGA 2VOMA 3L0NA 3W22A 1D3HA 3MI6A 3GKFA 4O28A 3MP4A 3P67A 3THQA 5LGXA 3LX9A 2Z6IA 4YXGA 1PHWA 3HG2A 2GUUA 1H7RA 1QOQA 2ALDA 2C16A 1CI1A 3DBPA 3BLIA 3TW7A 2AQWA 4ZQCA 5AFDA 3C3NA 1YPFA 4L4MA 1SR9A 1QDSA 1H1YA 2P0OA 4PTNA 4LVFA 2NWSA 5HWNA 1TPEA 3RK8A 3O8AA 4LC8A 4H4IA 4JS3A 5DN1A 5I3FA 3LTYA 5F1VA 1WQ5A 3NPUA 3HPXA 3B0VC 2E6YA 3EXRA 4Z08A 3TJXA 4UXDA 1S5WA 2GQ8A 2Y89A 3TW6A 2P1FA 4IMGA 3STEA 2FB3A 3W85A 3TCEA 3NL3A 1P1XA 2B7PA 3S0CA 5F2GA 1I2OA 3NNTA 4O50A 3P61A 1KM5A 1N55A 3M41A 4UR7A 3W76A 1TRDA 1QO5A 3TXVA 2RH9A 1HTIA 2VFHA 3G24A 3NQDA 4MJMA 3CEUA 1CW2A 3C2EA 3QZEA 4O57A 3BG3A 4MZYA 3W1TA 3NQ7A 3HJZA 3NA8A 3E96A 4DQWA 4CQ9A 1OHLA 5E0KA 4JTIA 4MPQA 3UWUA 4FX8A 3ABRA 2V2CA 3PUDA 3DHFA 1P4CA 1YPIA 2ZRZA 2A6NA 1Q45A 1K3UA 3DFNA 3EKZA 1UUMA 5HULA 3SW6A 1DJQA 1LRTA 3L21A 5E1QA 4JN6A 4WOQA 1F05A 2DJLA 1G4EA 1KM4A 1MZHA 2O7SA 1XBZA 4N2YA 4ZQPA 1XDLA 1BKSA 3L5LA 4LU0A 4AVFA 3LV5A 3NOEA 5G2HA 3EWZA 2DZPA 1KM0A 5F4WA 1SSGA 3EX3A 3GIYA 2R14A 4FB7A 3GNNA 1L6WA 1JQVA 2ATMA 3UXAA 1HO1A 1W3TA 5K4ZA 3VFLA 1KFBA 1UJPA 1C8VA 5D03A 3LXBA 1PCWA 4CCCA 5F1UA 3C61A 5CG7A 3IIXA 3LERA 3LHWA 3G1YA 5IM51 4WXZA 1FX6A 3QRHA 5FF2A 1FCUA 5AHNA 1W5OA 3S1VA 4FHAA 3DENA 6TIMA 4OU1A 3EB2A 3M5YA 2A0NA 3W7RA 4OV4A 1WDWA 3HBLA 1HO4A 1JCJA 4UTKA 3PUOA 3PY2A 2HMCA 5FF7A 1DHPA 1RV8A 3IVUA 3W1QA 1EUNA 3C2VA 2F84A 3CIXA 4FXSA 3LM7A 3VE9A 3G0UA 3DI0A 2WSRA 1YDOA 4ALDA 1NFBA 3W7IA 1W1ZA 4GUIA 1WX0A 5KSWA 1IIHA 4PFMA 5HINA 4AF0A 3NG3A 5K9CA 2CZFA 3R2GA 1SO3A 2DJXA 4DF0A 2ZA1A 4ZMGA 2E09A 3NQCA 3TH6A 3R13A 1FWRA 1SO5A 3OHIA 4Z1CA 3QQ0A 5KINA 4ML9A 5J5DA 2CZEA 4AMAA 1BWKA 3I7RA 2EGZA 1SPQA 3LCLA 3MBDA 2G96A 1GPWA 2DZXA 4A3UA 1IXQA 1H1ZA 4JYDA 4BR1A 5D2XA 3EXSA 5DY2A 5CZSA 4C1KA 3U2OA 1M5WA 1QCWA 1OJXA 2Y7DA 4HKPA 4JX5A 2QAPA 4FF7A 4PH6A 1OK6A 4TO8A 3G8RA 3V75A 3R12A 3UYCA 5AC6A 2Q3OA 1O4UA 4HNUA 4K8EA 2ISWA 2ABAA 4XQ6A 4ZL1A 3TA6A 1Z42A 2QCDA 1PE1A 3TDFA 4RX0A 4DBEA 3BGGA 2FPYA 2G5WA 2PURA 2NWRA 1EUAA 3U6WA 1Q3NA 1QAPA 3TSBA 4M19A 2JGYA 3O1NA 1YLVA 5E93A 5G5IA 3TC6A 4ADUA 1V5XA 4O17A 3PBUA 5D05A 3HQ1A 1O95A 1LTDA 2LLEA 4ADTA 3VCRA 3EKLA 3H55A 2C3ZA 5EPDA 3KRUA 2W0UA 2B7OA 2CLIA 2YYTA 3C2OA 4Q4KA 1KM6A 3RF9A 3QF0A 1FWTA 4Z1BA 3LHVA 1EPXA 1TQXA 4BFAA 4JYEA 1EEPA 2YPIA 2AAMA 4TR9A 3MHUA 1OF6A 1PVNA 2VELA 1VR6A 3ELFA 1MSSA 1OYCA 1TPH1 3TAKA 3W7LA 4MKNA 4DEFA 4KFOA 5D32A 3NQVA 5I3HA 1J2WA 3DFSA 3G3MA 3QPYA 3MYOA 2YX0A 2BXVA 5DCDA 3P5ZA 1UASA 3BVJA 4NXSA 3GX9A 3S1UA 3IGSA 1THFD 4O0ZA 2ZZ5A 2A5HA 3TFCA 4OV9A 3IIVA 4FX7A 2DU2A 3PUEA 2A2IA 2A1YA 1YXYA 4HSOA 4A2RA 1WXJA 4HHPA 3BG9A 4XZ9A 3GAYA 2CLHA 3C52A 3LTPA 3NZRA 1SW0A 4OT7A 3CEPA 5CPNA 1EWDA 4GFSA 4K38A 4N6FA 1QMLA 1QPRA 4UFJA 2Z0IA 2TSYA 2QF7A 3INPA 1XDMA 1F73A 1A5SA 1ONRA 5EYWA 3WJWA 2QCGA 2NX9A 4K7YA 3N9RA 3TAOA 3UPWA 2WO5A 4S2CA 4DELA 1EX5A 3ZS4A 4O1DA 1W54A 4JTTA 1VS1A 1KM1A 3MP3A 4LW7A 1B4EA 3HIJA 1R2RA 1G4SA 2H8ZA 1EP3A 4XBKA 5K2ZA 3LBCA 2Z1BA 1ZJIA 3P80A 4WY0A 1D9EA 3SFKA 1G6CA 3LRLA 3LDVA 1EIXA 2DZUA 1GWJA 3CT7A 2EAWA 3A5VA 2CW6A 1A50A 3HG3A 4IMFA 2VC6A 1G67A 2QKFA 3M44A 3T7VA 3USBA 8TIMA 3W7DA 4UFLA 4FIRA 1C9DA 3FOKA 1K8YA 5CZTA 1KFLA 3PBVA 2QJHA 4O54A 1H61A 4UFHA 3CU2A 4ZQNA 2F7FA 4ORMA 3PSWA 3L9CA 3DKJA 5D30A 3OVRA 3M7WA 3TMQA 3KRZA 3W7CA 3ZWSA 3I7QA 4IX2A 3CLMA 1RVGA 1KBIA 4S1FA 2QEZA 1F6KA 3O07A 4WZHA 4CNOA 2YFNA 1X7FA 4NJJA 1RR2A 5AHIA 2YCEA 3QW3A 4S2BA 3SECA 2J9YA 2ABBA 4O16A 5CZJA 1DV7A 2QDHA 4YCOA 1RZMA 5K9DA 2QCMA 2QDGA 4DPPA 3LRMA 3KRSA 1VYSX 1IXOA 3CWOX 2CWNA 1XUUA 1L2UA 4G1KA 3ATZA 2WNNA 3W70A 1I4NA 1DBTA 3F4WA 2HS6A 4UTHA 1PHQA 3NQAA 1XXXA 4NX5A 3WJZA 4HNNA 1F6PA 1LM1A 2NV1A 1G7VA 1SZFA 2HSAA 1SFJA 4YCPA 1ZAHA 1KLZA 4FNQA 4JNMA 3QJAA 1SU5A 1XM3A 4R33A 4M6VA 1BTMA 2X1TA 2A7NA 2OMAA 2BWGA 4IPIA 4MYXA 1KV8A 1RD5A 3CM4A 3W07A 1OVDA 3L65A 3IVTA 4O10A 4ADSA 3B0PA 4CCDA 1SW3A 1JVNA 2CLMA 3BW3A 4JY8A 2V82A 4WX2A 1KTCA 1EWEA 1FCQA 1JRCA 2C19A 3E0IA 3QSRA 5T26A 3W83A 4XTDA 4FNPA 3BLEA 1YDNA 1HL2A 1Z44A 1RQBA 4ONVA 3NQ2A 3NQEA 3M1ZA 2QCDB 1MO0A 1H51A 3BW4A 3UPBA 3PWAA 5BMWA 3NL5A 3W1PA 4NXKA 2GVLA 2XN1A 3NPXA 2QUTA 4WY0F 1YDVA 4QITA 3LXAA 4N4PA 2XN2A 1YYAA 3L68A 3I68A 1KFEA 3LLFA 3TSMA 1HFBA 4YL2A 3KVJA 1VLIA 2X1UA 1TREA 5HUOA 2CLLA 3DI1A 7TIMA 1L6YA 4H3DA 2H3DA 3IV3A 4JDYA 1ZY9A 3UWQA 2VEKA 2WSQA 4A2SA 1EA0A 3G1HA 3UNDA 4KKXA 3W1AA 2FPTA 3W6YA 4OGZA 5G4WA 1BEUA 4L4LA 5HMSA 2V5LA 4QAIA 3A23A 3GDMA 4LWWA 3PBWA 1XI3A 2YGYA 3B06A 3EWXA 2YXGA 3LTSA 5KTLA 3M6YA 3NEVA 1QO2A 5C55A 1W8SA 1H50A 2X16A 5F2LA 2WPBA 1VPXA 3S5YA 4QNEA 1MEHA 3NXFA 1OFEA 4ZZ9A 4DF2A 3T4CA 5CPOA
chains in the Genus database with same CATH superfamily
1H7XA 1YTDA 3GTXA 1OFOA 5CPMA 3G5EA 4IIBA 1LZOA 2TRSA 1PEZA 4ERGA 5DX7A 4BWLC 3MCNA 1P6WA 3GU1A 3LZ5A 1KFJA 1ZP4A 1KFCA 4JXCA 2XHYA 5CZKA 1S39A 4OIFA 3E2SA 1XD1A 3UG4A 1WCGA 3PJUA 4L6OA 1HJXA 2R91A 3R7MA 4H8HA 3TLLA 2VCAA 1H5VA 4RNFA 5JBFA 4B4FA 1H7NA 5D8ZA 2CU0A 1D7FA 3M5VA 2Z25A 3TQ0A 3DEQA 2QCLA 1FBAA 4C7DA 3CUFA 4K36A 3CUZA 4GISA 3KL5A 4XD4A 2HK1A 1Z8AA 5CJMA 2OKOA 2XYLA 1JIBA 4Y2WA 2B4GA 4J5NA 3KTSA 3T78A 2QS8A 2EJ1A 3KVKA 1G7UA 1V6UA 1EHAA 3LCGA 1P48A 3MSDA 1F5ZA 3QKZA 2CZVA 1S5VA 3ABXA 2VGGA 2JE8A 1EL3A 3GTHA 1EGZA 2FHCA 3OP2A 4H8UA 1CB7B 1EJRC 1W3KA 4O12A 3ARWA 5A69A 2BHUA 4ZEPA 3L0KA 3QV6A 1XBYA 2OPJA 5G4EA 2YYUA 5EFFA 4QS5A 3KEHA 2VFEA 2NUYA 3HV9A 3M0HA 4BI7A 4PZVA 4WDWA 3CV2A 1QJWA 3PTMA 3GDKA 3DYPA 1DE6A 3MTWA 4OOZA 4XVEA 1J93A 4RJEA 3MMWA 4I8DA 3DAQA 5D38A 3JW7A 4JTEA 4HCLA 1W5MA 3OA5A 4LAKA 3LYEA 1RCQA 4GNKB 1R3QA 1XQLA 3VIJA 3E02A 1CLVA 4HOZA 1OSEA 1HKKA 5DCEA 5D2WA 4QS6A 3W7MA 4GKTA 1MRQA 2WLYA 5FEXA 1PDZA 3GXDA 3KBJA 3V16A 3DN5A 3PTQA 1GQNA 1E15A 5C9UA 3IV8A 2HROA 1QI5A 2ZQ0A 3VE7A 1YW1A 2QPSA 5IRPA 3VTRA 4RW5A 1BFNA 3LI1A 1TZ9A 2OYLA 3WQPA 1W1A1 2NV2A 3PFRA 3O7UA 5I23A 4UZUA 4JICA 1VH7A 4PL2A 1N8WA 1TPWA 3A47A 3H6OA 3UWZA 3N12A 3C0LA 3U2EA 3E2VA 1AQFA 3RJXA 2WBKA 5SWUA 4EPDC 4EPEC 2J9XA 1TWWA 3HF3A 3OVGA 1DWAM 2ZUWA 3BQ5A 5CAHA 5D02A 1TB3A 3PZGA 3W2JA 3W01A 2X30A 4EVZA 5DT5A 4C6CA 3H53A 3K46A 2VM8A 4H9YA 2J77A 3SQSA 4HTBA 1XBXA 4HU8A 5CH9A 1ESWA 2FGZA 2YFOA 2Q3RA 2C1HA 3VAVA 4DJFD 1BKHA 1ALDA 4YS1A 5DRCA 2PC8A 1S2UA 3WLKX 4MY8A 1PS9A 3VKBA 2GUBA 2C18A 3G1FA 4WGHA 4XZIA 4W88A 3G1AA 4KIEA 4LS0A 5AOUA 2EJAA 2KX9A 3QGKC 5FL0A 2V2HA 1U5JA 2BNJA 3V1HA 6XIAA 2A3HA 3H7RA 5BXTA 3P8IA 5F4SA 4B3ZA 3R43A 1GVSA 1WE5A 4Q8MA 2YLAA 1LLOA 2ZX8A 5K4XA 1EOMA 2E77A 1OFRA 3SURA 4JTJA 4MY1A 1F74A 3ES7A 3UY8A 3U7BA 3P14A 2WK2A 5T9BG 1Q6OA 3CIWA 4JX4A 5AYZA 5CPTA 3KHDA 5L6UA 1W9UA 2ZFAA 4QTGA 2P53A 4UQEA 1ODUA 2R1LA 3EPNA 1LQ2A 1TV3A 4GX9A 3G22A 3IIOA 4FA3A 1L9WA 3W1MA 2G3IA 2JF6A 3DZ1A 2VEMA 1LG1A 3BAIA 2PDXA 3NGFA 4FXFA 1FH8A 4IP4A 4PCFA 2BHZA 4C6FA 3ZWTA 2QCHA 2JIWA 2WVSA 3W1LA 1F8IA 4ZTYA 1DQWA 3C2YA 5A6AA 5GJMA 3PBMA 5K7JA 4TMCA 1FKWA 3WK2A 4OE7A 2QPUA 1JF5A 2ZZ2A 4JNZA 2QF8A 4A8IA 3HO8A 1OYBA 4IHCA 3AZTA 4LOCA 1LLWA 3CAKA 1L6GA 2GVGA 1AG1O 4CEXC 3NO5A 3VKJA 3W88A 4JN8A 7ENLA 5FJRA 4O52A 3BAYA 5JVLA 2W91A 1RUSA 4PA8A 4Q8PA 1OINA 1N82A 1PB0A 4UTWC 1AL8A 4WIWA 1VCGA 1FCBA 3ARZA 4UMCA 4UTTA 3A3HA 1DTUA 2BFGA 1V79A 4IFRA 1D8CA 3OVQA 5C54A 1LG2A 2FTYA 4ZFCA 4B16A 4JD4A 4Y8FA 1GQJA 4P7RA 1G1YA 3GNXA 1CT5A 2PMQA 3CV7A 3POCA 1N8FA 2CNCA 4K1WA 3WFLA 3QY6A 3R79A 2V6AA 5EA9A 1A0CA 4YWIA 1IT0A 1TTIA 1L6FA 3W7OA 2ZVIA 4Q4QA 3KM8A 3CO4A 1I60A 3GC5A 4LUJA 3S9ZA 1BF2A 3T2PA 3KCJA 3NURA 3QW4B 1DXEA 3VNZA 3F2BA 1KO0A 3TN6A 3NQFA 1XR2A 2WC7A 3H26A 5I3JA 1BWVA 2CBJA 4KERA 2AQVA 3WD0A 1U5VA 4C6MA 3W1UA 1EP2A 3DX5A 3GH5A 4S3CA 1CGWA 3MS8A 4LUTA 1MEIA 2X1SA 4MG4A 4G7EA 1EF2A 1VC4A 4TVCA 3S83A 4JTFA 4J3UA 1A5AA 3ISIX 4JHZA 4MOZA 4N7QA 3GVRA 3TC7A 2OO6A 3I3DA 3AU6A 3ZVHA 3A12A 3AS1A 1UH4A 4KETA 5AC5A 4GNVA 1M7PA 1AW1A 3L4XA 3T1GA 1NY1A 4LFYA 3LM3A 1O5RA 1VRDA 1XIMA 1SFLA 3G1DA 3WF1A 4US5A 4REQA 3MT1A 4MUZA 3BWWA 3EXTA 3FV9A 3LCWA 5H91A 1CWYA 3I6EA 1H2JA 4S3BA 3Q67A 4D6EA 2J27A 1HG3A 2RDWA 4FOUA 1EXBA 3LXCA 1EJVC 3W7EA 3FKRA 1REQB 4AWSA 2V9DA 4UQ9A 4C5ZA 4IGSA 1O60A 3W73A 2WNZA 5JH1A 3N9SA 3FXYA 1S5MA 4PYSA 5AHLA 1JZ4A 4IGNA 3TYAA 2BLEA 2QGYA 4YLWA 3TTOA 5AC8A 2JKEA 1OWQA 2BXYA 4HU0A 1EIBA 4NYYA 3WENA 1HXJA 4QJ1A 3OG3A 4K8HA 2UY4A 1BG9A 5CC5A 4O13A 3C2RA 2WMFA 2I5QA 4PTWA 1SGJA 2FHFA 3OBKA 3QH2A 1JUBA 3S5SA 2ZRXA 2GVYA 4I90A 4RDWA 3TZFA 1WV2A 4EPKA 3UR8A 4US5D 4IMCA 1BSLA 2PWHA 3UERA 9XIMA 3MO4A 2CZ5A 3TN4A 4YTTA 1S3HA 2Y24A 1GTHA 5ABGA 3HGJA 1UCWA 1UC5A 3IARA 4QQ3A 2P88A 4O53A 5ENLA 3BARA 3GQYA 2DT1A 1DYSA 3LMZA 3VMOA 1BSIA 4G5DA 3VZXA 2J7EA 1HKWA 3GU2A 5IDZA 4EANA 3KOYA 1FRBA 4A35A 2PEVA 3GXPA 4BA0A 5CJ5A 4LS2A 1CLXA 2ZX7A 1J96A 3F2CA 4UMBA 3GTFA 4Q8TA 3VIPA 2QJGA 4IT1A 4H9XA 4P7QA 2VFGA 3HZ3A 3W02A 2VC7A 5A2AA 1BXBA 5AHMA 1R3VA 3BG5A 1ZHAA 1US2A 1H7WA 4O14A 1QATA 3I3BA 1F2JA 1T41A 2Q09A 2NVDA 1KR1A 3H2CA 5LIUX 5F4XA 4XAFA 1VIZA 1FUYA 2BOGX 1GW1A 3OU8A 3VNDA 1PKLA 4HZ6A 2X41A 4LBRA 4YYFA 3S42A 2J7HA 4RZ5A 1W5PA 4HNLA 4TV5A 1RJPA 3CZEA 4IFKA 5AB3A 2FIQA 4GQQA 1GG0A 3RPDA 2J7BA 1ITCA 5BZAA 1RAKA 3EDDA 1TCDA 1XRVA 4JTKA 1I8JA 1JI1A 4Y9OA 5HDRA 4AD0A 4L5ZA 3RMEA 4CCEA 1UA7A 1GK8A 4ZQRA 3T4WA 3GVWA 1UR1A 4HA4A 5I5RA 1TR9A 4RZ4A 5C2CA 3HTWA 2CHRA 1YXCA 1HQTA 3EWWA 3N2TA 5D9MA 3RLUA 4UC5A 4XIAA 5D9OA 4AB4A 3CB8A 2GGGA 3IRDA 5A1AA 1W31A 1ZTVA 1JI2A 5GPRA 1TE6A 3BLDA 3Q58A 1UQZA 1XQKA 5C5YA 4YN5A 1JCNA 3G6LA 2QQ6A 3L7RA 4QEHA 1B3YA 2Z7KA 3W7HA 1C3FA 3QMTA 3Q94A 3AYRA 1Z41A 1XINA 5FJUA 2ZUMA 2PGWA 1X1OA 4KS0A 3VGBA 4LUTB 4V1YA 2I9EA 1TX2A 3LPFA 3COTA 3GW0A 2W62A 1F76A 3UZYA 4HIBA 4PRTA 1XL9A 2OZ0A 3GYEA 4PRWA 2BZNA 4JKMA 1R3RA 4WQ6A 1YX1A 1M1BA 5AHFA 1GVRA 1FWDC 1KA9F 3RM8A 3N6JA 5H8MA 4LY4A 3CQKA 4FS9A 1TV2A 4C6QA 3OHMB 2VT0A 2F61A 2P50A 1HIZA 4GJ1A 1VB9A 1RK6A 1FVPA 4GC4A 3ITGA 1RLCL 4IMEA 4B9ZA 2E28A 3UQNA 2Z4GA 4GPNA 3BV4A 1XH1A 3W7KA 3PG8A 1Q7MA 3TZNA 4ZODA 3K8MA 3KOXA 3DXIA 2PCQA 2XIBA 4CU7A 1WKFA 1QHPA 1F3XA 2JBMA 4O4WA 2PZ0A 1U1UA 4Z0SA 4TMBA 1T8QA 4GQBA 1HL9A 3GXFA 3ZJKA 3QTPA 5LSMA 4C90A 2VL4A 3P60A 3RYSA 5LIYX 3KX6A 4Z2LA 4A05A 3WDIA 2HBXA 4KCWA 3L2LA 4GJIA 4W89A 1RP8A 4F40A 3KL3A 4YVXA 3W6MA 1HW6A 2CKRA 3TV8A 5DBTA 3RFAA 3KUMA 2A79A 3PAOA 3JVAA 5HMDA 2E6DA 3E74A 2X0YA 2J62A 2OGYA 4PL1A 4KEVA 2NXGA 2BOEX 2H3BA 3NVTA 2E5BA 4Q22A 2PDLA 5BYWA 5C2GA 3DFOA 4PTDA 2V3EA 7A3HA 1H4PA 2VP8A 4K68A 1GYNA 4Q6JA 1FWCC 2V5KA 4JX6A 1YPXA 4H6EA 2ZDRA 1V6VA 4XZMX 3MWAA 3PPGA 4BK9A 4N4QA 3VD3A 1AUSL 4IQLA 3AIUA 3OGVA 4DJFC 2Q02A 1KRAC 1DWHM 4LB3A 5FSDC 2Y70A 4W8BA 1ZRQA 3RX4A 1VYPX 2VYOA 3THUA 1ZJBA 4GH1A 1WUEA 4H19A 5HQEA 4E8GA 3DECA 4UTMA 3A3WA 1D8WA 2E6FA 2GSJA 1H63A 2FTWA 2XGBA 3O6DA 3S2LA 4J9JA 3EEGA 1TPDA 3AIQA 2O9TA 1YTEA 1SW7A 2A7PA 4WUIA 4TU1A 3GW3A 5HWJA 3DH7A 1JYVA 4UFKA 1LF1A 4H01A 1B1YA 4IFKB 4Q33A 2WCGA 1P5BA 3R25A 3S9YA 4XISA 3UXLA 3FJNA 2PD5A 4ZB0A 3PTKA 5JMUA 1E0TA 4Q8VA 2ZBTA 4MKVA 3CHCA 5E9AA 1LOSA 1W17A 5E0CA 1FDZA 1KFKA 4Q4SA 3NL2A 3PC0A 1XPGA 4HOWA 3C4UA 3N1AA 4CQCA 3URQA 3MYPA 2Y7GA 2F38A 2R1PA 3JS3A 4W85A 4WR3A 2GYIA 4E38A 3RPMA 4PUEA 3K1GA 4ENLA 3M46A 4UB9A 4B5NA 4WKAA 3JRKA 1B30A 3W72A 4JTLA 2PDPA 1QW9A 3F2DA 3GXTA 4XKYA 4ZOBA 2NV9A 3TKFA 1OFAA 4Z0JA 3ZVIA 7ODCA 3VIFA 2EKCA 2I1OA 1OB0A 2VGIA 1K77A 3NQ8A 4MZ1A 1VJZA 1TYGA 5AKQA 1ZCOA 2ZZ4A 5FD0A 3VOJA 3MHGA 4BJHA 4FNTA 4TIMA 1FHLA 4GIEA 1RBLA 1Y65A 3SI9A 1UUQA 3L23A 2QVNA 3M9YA 6XIMA 2ZUVA 3CK5A 3BQ6A 3VGEA 3WQFA 3WDRA 4AIBA 4D1JA 3F5LA 3LSBA 3R0UA 3II1A 1UR8A 3KBMA 4XUYA 3OEXA 3HPAA 4CQ8A 4O8RA 1KRMA 2G3MA 2PTWA 1O7AA 3VUSA 4LTSA 1V77A 1GKPA 5CBJA 1TZZA 2EPMX 3ZO9A 5FCZA 1OEPA 1PHWA 4ZTXA 1UR0A 1VFSA 5GNXA 3QLDA 1PBGA 2ALDA 2C16A 2Q8XA 4RDYA 5FJJA 4L4MA 1SR9A 1QDSA 3ZLFA 3A4AA 4RUBA 4ZO6A 2G4JA 2A3AA 1E1FA 2RUSA 3NJ3A 1DJHA 5I3FA 1WQ5A 1CIUA 2BB0A 1VEOA 3EXRA 3TJXA 4UXDA 3MWCA 1S5WA 3D3FA 2P1FA 2ZWZA 4IMGA 2FB3A 3WYZA 2ZC8A 4P7NA 1P1XA 1JZ5A 3OTRA 1N55A 3W76A 4AZCA 1CGYA 1A5NC 4Q3MA 1PZ0A 2VFHA 3A4XA 1OD0A 1CW2A 2WB5A 4J35A 3G77A 3BICA 4O57A 4DZAA 3NQ7A 3HJZA 3UCDA 4DQWA 4AVNA 4CQ9A 1OHLA 1PDYA 4Q8UA 4CD7A 1J12A 4AIOA 1YPIA 3BLLA 3WQ5A 4MAVA 1Q45A 4J3TA 3DFNA 3PUGA 3R8GA 3OIHA 1W1TA 3WH8A 1F05A 3SRDA 2O7SA 1TMQA 1XDLA 1YEYA 2DDXA 2QZRA 1BKSA 4J27A 3LV5A 3NOEA 3EWZA 4C6BA 2DZPA 5A8MA 5F4WA 4JQ3A 2GK1B 5GJPA 1GJUA 1QNSA 1VFLA 3EEZA 2ATMA 3UXAA 1Q8AA 1UWIA 2PBOA 3VFLA 4OOUA 5FSEC 3I10A 2PB1A 1Q6CA 3LXBA 2AAAA 1IWBA 3KS5A 5IM51 4WXZA 1FX6A 5AHNA 3RHGA 5ABEA 2FMOA 3DENA 4MHBA 6TIMA 3EB2A 1WDQA 4DJEA 3HBLA 1EBGA 1JCJA 3U7VA 3PY2A 4NAEB 2CETA 3W1QA 1EUNA 4LQ1A 1PXGA 3B8WA 1EZ2A 5FJPA 1KC7A 4ZXLA 1NFBA 1W1ZA 2XIJA 4GUIA 2WMGA 4ICCX 5DMYA 4PFMA 4DJDA 4XSLA 5HINA 4W93A 3WNPA 5LXEA 1S2AA 4WKHA 1C90A 1SO5A 2W27A 2IPWA 1E70M 1YBQA 2WZEA 5J5DA 1JDCA 4AMAA 8RUCA 2JQXA 4NI8A 1VBHA 2PTZA 1UH2A 3SUUA 2VC9A 3D47A 3NZPA 4XZHA 4BR1A 4DZ5A 4A8NA 5D2XA 2D22A 5DY2A 1W91A 1OJXA 4HKPA 4CQBA 1K6WA 2QAPA 4PH6A 4TO8A 3UYCA 2NQ5A 4JCMA 1JPDX 1IE7C 1F61A 1RHCA 4PUNA 3WF3A 3NZQA 4XQ6A 4A4AA 1YNYA 1PE1A 3TDFA 3BGGA 2FPYA 2NWRA 1EUAA 1QAPA 3VCNA 4J3ZA 4ATDA 3O1NA 4CNSA 5G5IA 1KGXA 1W3LA 4LAMA 4L6HA 3HQ1A 4I6KA 1LTDA 2BY2A 3EKLA 2OSYA 3SCVA 1PZ3A 4IICA 4H7ZA 4DHGA 3LGDA 3BOXA 1ZGDA 4CVWA 3KRUA 3HV8A 3WLQA 4QLJA 3C2OA 4Q4KA 1KM6A 4Z1BA 1GOWA 2IXVA 2DEPA 4CN1A 2A3LA 3B8TA 2PP1A 4PCPA 4AW7A 2QHAA 3WUGA 1OYCA 2VR5A 1TPH1 2Z28A 4DX3A 3GUWA 3W7LA 3TQPA 1CXHA 4DEFA 2VX5A 5FJOA 1W2VA 1J2WA 1A80A 3ZT6A 2YX0A 5CLWA 2IQDA 2J4GA 4NXSA 3GX9A 3DBNA 3B9NA 3IGSA 1XPYA 2PDUA 3TFCA 2DT2A 4OV9A 4HK7A 1RSCA 3B40A 3T8LA 3PUEA 4PMZA 1I9CB 2GQ3A 4HSOA 4HHPA 2Z1KA 4XZ9A 3GAYA 3LTPA 5I3DA 1M65A 2ZX6A 3H7UA 4RZBA 1QPRA 3WQOA 4UFJA 2Z2BA 1X6LA 2QF7A 1A5UA 1F73A 1XW8A 3UZZA 3WLSA 2QLYA 3BCJA 3EZ4A 4H6RA 2DSUA 4FP1A 1UOZA 1A5MC 1XLCA 3L4WA 2WO5A 4JTQA 1CNVA 1HJQA 4O1DA 3GG7A 3N11A 4OTKA 4F0LA 4JTTA 1E4MM 1R2RA 3VOGA 1TCMA 5K2ZA 4GIYA 1OGBA 2Y2WA 1XLHA 3QR1A 3M6DA 2FZ9A 2DUAA 1JXJA 1G6CA 3LDVA 3BC9A 4F66A 1QW7A 1JXKA 4N0RA 3S6OA 2W66A 1UWUA 4LYKA 4L9XA 3THDA 4PBFA 3B8VA 1CEOA 3W7DA 3WDJA 3UYIA 6REQA 5CEWA 1GVYA 1BVNP 2PWDA 4NZCA 4HU4A 4X0NA 1ZBWA 4UFHA 1Y5XA 4ZQNA 5A95A 1XYBA 4DBSA 3L9CA 3GG8A 4KW2A 3T08A 3KRZA 2YA0A 4GVHA 2DSVA 1R9XA 4TTUA 3WLPA 2YXOA 3B9DA 4AZGA 3RR4A 3CLMA 4S1FA 4TVUA 1UR9A 3O07A 4GY1A 1TA3B 4A8LA 3SCUA 4EKJA 1RR2A 1ZSXA 3EB3A 3UEQA 2CBVA 3H24A 3QW3A 1GHRA 5HQMA 4JL2A 1QXLA 1UR3M 1DV7A 2QDHA 4U33A 1RZMA 4YCOA 2GJXA 3KRSA 3VKDA 4IPPA 1QASA 2BV9A 1EC9A 1DBTA 2HS6A 3NQAA 4PSRA 3PNUA 1QPKA 4NX5A 4HNNA 4YVPA 4XV0A 1G7VA 1MDRA 1TVPA 4YCPA 3S2CA 1KLZA 3CTTA 3TYZA 3PZMA 2XINA 1E0XA 3N15A 3DGBA 4M6VA 4IPIA 1KV8A 1YBQB 2J8TA 1OVDA 3IVTA 4J3WA 2REQB 2E0PA 1GONA 1XLLA 4CCDA 1JVNA 2D69A 2BBFA 2PP0A 3CO8A 1EGVA 4JY8A 2DZBA 1JRCA 3WD2A 3TOYA 2NT0A 1I75A 4YVVA 4UR9A 2VHLA 4HOXA 3N29A 1YDNA 1PTGA 3FAWA 4ONVA 5I00A 1W9XA 3Q65A 5BMWA 1YDYA 3NL5A 4Q4OA 2E25A 4JHOA 3NSXA 1EF3A 3TVAA 1YYAA 1UQYA 3WLHA 3KVJA 3EOEA 2X1UA 2H3DA 3IV3A 2OWWA 4GQRA 3UWQA 1XRFA 2WSQA 4X9YA 1XSJA 4KKXA 3W38A 1IEXA 1BXCA 1JDFA 3EWXA 3LTSA 1QRQA 4LAZA 4R7WA 1W8SA 4IG2B 4MNLA 4ZA0A 1DHKA 2WPBA 1VPXA 1MEHA 2XVKA 1KQZA 3T4CA 5CPOA 4PMYA 3DFHA 3K4AA 1SVDA 2YL9A 5HWMA 1XBVA 1JNEA 1XYMA 3F03K 3CAVA 1W37A 1V02E 4MB1A 3NAVA 4XWUA 3GM8A 1QNOA 3MMTA 3AZRA 1VFMA 1ZLPA 3QV8A 3ID7A 1E55A 3KBNA 3SN0A 4QE4A 3GR4A 3W9ZA 3TROA 3QYQA 3IAPA 4F79A 4G8TA 2NVCA 2XFWA 3S5NA 5HK4A 1HP5A 5D33A 5M3WA 4RLIA 3WLRA 3DFQA 4DXXA 1NDVA 5M17A 3S2MA 4AU0A 2AL1A 1I0DA 2FVMA 2DP3A 5ECUA 4DZHA 4C65A 5DXYA 1A4LA 3QZAA 4LAOA 3FLUA 3DHDA 1OF8A 1GG1A 3BL3A 4FPSA 4PUWA 4DN1A 4FX6M 1J18A 2E9BA 4AWTA 1V7AA 4CNTA 4RKAA 3U2ZA 4KWSA 2FZNA 1W56A 4YIWA 1VRXA 2R94A 4ICNA 3IK2A 2OSXA 4O1BA 3VD7A 4WJEA 2QIIA 1XIEA 1J0KA 3HQNA 1R3WA 1J10A 4FNUA 4I8YA 4NJKA 3WH5A 3SRFA 2BS9A 4Q4MA 4Q7BA 1B4KA 2ZTJA 5C6MA 2P5NA 2VZSA 5CGMA 5EMMA 4I5XA 2WANA 4GI6A 4JIQA 1V3MA 1E6SM 3NDOA 1ISZA 3TCSA 1FWWA 5FEPA 3SEPA 4XZWA 2C8NA 4ZO8A 4B5SA 4LEQA 4GYPC 3TW9A 3MB9A 3S6DA 1LOQA 4LT9A 4C6IA 1WA3A 1DEDA 1UYQA 3H2EA 3MZ2A 4DBDA 1F7BA 4W87A 4K8GA 1JZ7A 1GJWA 1TV5A 3URBA 5PTDA 4XD3A 1C8XA 1MQRA 3APYA 3M16A 5IFTA 2F2KA 4WDTA 3LMYA 2ASHA 3M5ZA 3KBVA 3TU9A 2VCBA 3TQVA 3N34A 1R38A 4LRSA 3IJLA 3BLFA 3E12A 1YE4A 3BLKA 3M0KA 2NXHA 2FFIA 5J5RA 1XLKA 1XGZA 1R85A 1OZMA 1FHDA 2XU2A 2GGIA 1MNZA 1Q4NX 4LBSA 2WPGA 2ZX9A 1BD0A 4N9DA 1Y7VA 2BODX 4A22A 3LV6A 4MY9A 3SM0A 1IEVA 3CZGA 3NIYA 2NQZA 3NDYA 3ITLA 1XIDA 2VRKA 5CSRA 2Y7EA 4C6OA 1CECA 1LBLA 1UWTA 4PMRA 5I3KA 4KMQA 2ZICA 3VNJA 1U83A 3IVSA 5DELA 5LKYA 3ZR4A 4GUHA 5DFAA 1JYNA 1GCYA 5TBOA 3RR1A 4EWND 3MKVA 4JTDA 1KXTA 3UZWA 4D72A 4U2ZA 2ZOXA 3VNMA 3FY1A 2GUYA 4FR1A 5AC7A 3EWCA 5U7SA 2AL2A 4XX6A 2PBGA 3DHUA 3VX1A 4GUFA 3VIMA 1NWTA 2V30A 1GW9A 2OCZA 2QJIA 3MPGA 3IJ9A 2GJLA 4AXNA 2OEKA 3VZZA 1RVKA 4AISA 4N9CA 2CBIA 1H41A 3WLTA 2C14A 5KEZA 2ZTKA 4OWGA 3CPRA 2HEJA 3WL1A 1Z89A 4Y8EA 2VOTA 3G3DA 3B9OA 4R9XA 4QQUA 1RPXA 5DT7A 4AIEA 1EYWA 3VC5A 4QEEA 5I78A 2QW5A 2I16A 2JEQA 3LHYA 5C9WA 3M0ZA 4O1CA 2WSPA 1NDYA 3Q4DA 4P7OA 4U3CA 3WNOA 3UW6A 2WW5A 4DO7A 1L8NA 3SY8A 4EXBA 2WQPA 1TSIA 3NDZA 2BSLA 1ADOA 3BSMA 1NWUA 4JFWA 4PB4A 2BGSA 2VGBA 4IIGA 3C86A 4H2HA 4ATWA 1E3XA 1W1YA 1C7TA 5LA2A 4IQDA 4B3LA 1JUEA 2YCIX 1T7LA 4LNCA 3LHUA 3D0CA 3AXMA 2JIEA 5AYXA 4LJ3A 3CHDA 4HNTA 2WVVB 4UFMA 4DY1A 3DDMA 1XYFA 2DW6A 4JKLA 4XIMA 4O0KA 3EOLA 2ZA3A 3UCCA 5E9XA 2FYMA 2QNEA 4GCAA 3B8IA 4JIEA 1QHOA 2FGBA 4IPJA 3AHTA 4NZJA 2IW0A 2QMKA 1MWOA 2FPVA 5CSYA 1AD1A 3NGJA 2D73A 2Y88A 3KTCA 4NJGA 2VEIA 4PTMA 2Y5EA 2INEA 2WZMA 4WLCA 4CN4A 2IKHA 4QAWA 4HGXA 2TYSA 3B8DA 4MFEA 2CEQA 4IMAA 1JJKA 4R7OA 3VGHA 4NT0A 1SR0A 5DCBA 2ZRYA 5I3GA 2PDJA 3LNMA 3KFTA 2C71A 2V81A 5I0DA 1GGOA 4BHYA 5BMXA 4C6NA 3QMRA 4BI5A 5LXXA 3C0JA 1VPYA 1OX5A 4WCJA 1EPVA 4AX6A 1ME9A 5CGQA 5REQB 2PE4A 3OQ8A 2FKPA 1OYAA 5DRIA 4BWLA 2YA2A 2E8YA 3KZSA 2ZCGA 4KFPA 3SZ8A 5EMLA 1O66A 4R53A 3MUXA 1Z32X 3UJFA 4G2DA 4FXJA 2ICSA 3CUHA 4HBKA 4Z1DA 4F2BA 3GDRA 3IJIA 4L1WA 2E5DA 2PWGA 4QBXA 3W25A 5G1MA 1LOLA 1WOBA 3IJ6A 4S3KA 1ITQA 4RL3A 4JEJA 4G56A 2EF9A 2RHGA 2EQDA 3KVLA 3S5ZA 2HWGA 2PWVA 4U5IA 1UH3A 4W4QA 4UFIA 3RM4A 2JALA 3HU7A 1X6NA 1W9BM 2VUYA 4MM1A 3AO0A 4H6KA 1XIHA 2INFA 1OG6A 3H23A 4FZIA 1WB0A 1UWSA 4XZLX 1IGWA 5KMYA 1Z6KA 4P5UA 2DVTA 1YQ2A 3CNYA 1N7KA 5DLCA 3H8AA 2QV5A 1V3KA 4NIRA 3B03A 3W2LA 2OELA 2WWCA 1KM3A 1PYFA 3LCIA 3ONCA 3HGSA 3NOYA 2CXGA 2ZE0A 2WZTA 4G6CA 5IHSA 2OT1A 4U2YA 1VCVA 2W5FA 3W6LA 4GY7A 2XG9A 1FWNA 2EBNA 4BF9A 4JOMA 4QE1A 2OQHA 3ARQA 4GK8A 2GJRA 3ITVA 4KEUA 3LLDA 4O15A 3HN3A 3E0WA 3I65A 3MCOA 3KBWA 4PEKA 1J6OA 2PI6A 3PPCA 4M6QA 5TAOA 3AIRA 4KEMA 4MIMA 4GA8A 1GYLA 2ZKMX 3CAWA 1FWHC 3AXXA 4MMWA 3NM3A 3BAKA 4LGXA 5AYYA 3W7PA 1ZNNA 4QHRA 1EBHA 5CG0A 2WMIA 1JAKA 1X1ZA 4N02A 1P0DA 2ACQA 3TIMA 1ME7A 3VDGA 1XIBA 4ZQMA 3MP5A 5FEWA 4JQAA 5I3IA 3KOWA 2GQ9A 4ORIA 5HNNA 3GXMA 3GDLA 4U4MA 3JR2A 3CGTA 4UTTC 3CZJA 4PUKA 3SSJA 3AMLA 3KZPA 2PDGA 3QLLA 5I07A 2CYGA 1S1PA 4KGLA 1XLMA 3RU6A 2QV4A 2J6XA 4LC6A 1S2WA 4MB5A 4BY3A 3BTNA 3FGCA 4HNOA 4JIIX 4QSHA 1H7OA 3OZMA 3UVIA 1JRBA 4F8XA 4GG9A 4PUUA 1J2BA 4HA3A 1DVJA 3VNKA 1HKVA 2YA1A 5G4HC 1QVBA 3CHFA 1SJAA 1TPC1 3NCOA 2NUXA 4LVGA 2J79A 4LV4A 2GVJA 4MLRA 3UJ2A 3QQ1A 4B4HA 4AC7C 2Q6ZA 3B9AA 3U0HA 3V1PA 5D2TA 3GDBA 4KCUA 1CTNA 1KTNA 2XPKA 1NAL1 4PODA 4WY0B 3NQGA 4L4PA 1HKIA 1KCLA 5AYIA 3TK7A 3ABOA 3AHYA 3HJEA 4X63A 1S1RA 2FJKA 5G1YA 2OJPA 1ICQA 2ACUA 2CITA 2WSKA 3NXLA 5KITA 4QRNA 3A24A 5E0FA 3CL6A 4O11A 4B5XA 1NF0A 3MA8A 2RJGA 1DJNA 1NQ6A 4LUYA 4B5VA 1JZ8A 3W37A 1DJIA 3VIKA 1M7XA 2YDRA 9CGTA 4H00A 3A6OA 5ABFA 3ES8A 4NZ4A 3N6QA 1JFHA 5HXMA 3WQ6A 4LXFA 2A85A 3CQ0A 4A21A 3U57A 2DIEA 1UD4A 3BGAA 2WMJA 2Z29A 1POJA 3ARUA 5LHFA 1JDAA 3ZJ8A 1XIIA 4EXAA 3GR7A 1A0EA 1UIOA 2R1NA 4C6JA 5B7ZA 3APGA 3ENLA 4QE5A 3CV1A 3W86A 4NI3A 3PN8A 3PAJA 3KE0A 2NT1A 1QPQA 4Y7EA 4PGLA 2W6RA 3QHMA 4S38A 2IQTA 4KRTA 1DORA 1O1ZA 1HJSA 3BW2A 1HUVA 1SZNA 1WBHA 1XFCA 1AFSA 4GE8A 2W92A 1AW2A 1FWSA 2YL6A 3WIJA 4R34A 1VJIA 5CPLA 5JU6A 1Q6EA 4ZXOA 4FAMA 3W7JA 4YMZA 3SGGA 1LROA 2F6UA 3G1SA 3H12A 4H9MA 3SQMA 2DIJA 3L5MA 2DVXA 1FOBA 1LT8A 3FS2A 1LYXA 1LLZA 2WSYA 1TPB1 1QHZA 3WK3A 4FLSA 2PDNA 2QR6A 3W7QA 5TF0A 1AZ1A 3E5BA 1TUFA 4CNNA 3T42A 1BYAA 4CLMA 4MNKA 3B0YA 4HN8A 2FH6A 1R30A 1E9YB 5LHEA 1GTEA 4BQ5A 3O05A 3VA8A 1OCQA 4MJ4A 2QUNA 4FIQA 3I4EA 4DWSA 2ZRWA 2WKLA 3RPTA 2ISSA 4GO8A 4IUOA 5HQLA 2V8ZA 3B97A 1IEQA 3FCPA 2VD9A 1JUKA 3S46A 2HS8A 3VU2A 5M5DA 5AZ1A 3M0JA 3DC0A 3EA3A 1OCJA 4UTWA 5GNZA 1E5JA 2HE8A 2PA6A 3TQKA 5BOOA 3P0WA 1UOKA 1JAEA 4LNYA 1LDCA 3GNRA 2X1RA 4J2PA 1CGXA 3AXHA 2J6VA 1CX9A 1IEWA 2UWFA 4JPGA 3STPA 1BWLA 5CZ0A 4LUSB 1P43A 2EXOA 3EX1A 3TOPA 4Z2JA 2R1KA 4NVTA 3POHA 1QW8A 1PV8A 2D24A 1O68A 1OC6A 1E43A 1LRQA 1VAHA 2PODA 3PJXA 3SRKA 1IIGA 2G50A 1X38A 3HQPA 4GI4A 1JNDA 1LRNA 3KXQA 4K1GA 3W2KA 4IL2A 3PULA 1Q4WA 2RKXA 3RLVA 2NZLA 3G18A 2I5GA 1GVEA 3LZ3A 2R8WA 3NR0A 4AWUA 1WZMA 1Y0EA 3UR2A 1M7OA 3FIGA 3HGOA 1A5CA 1VEMA 4A3RA 4M82A 5LNWA 1E1CA 1VFOA 4ZVJA 2ADAA 4ZE4A 2Z7GA 4U31A 3EDJA 1MYRA 2VR4A 3FN9A 3D6NA 1K7FA 4LX4A 3WQVA 3VIOA 2E1DA 3B0UX 1VD6A 3GHTA 3OODA 1GVOA 4WOZA 3CT2A 1X8FA 4PMJA 1WDDA 1R86A 3PZIA 3HPSA 3PS7A 4TV6A 1TFVA 3NM1A 3PF3A 4Y6GA 2KZHA 2YDAA 4I9TA 2AGKA 2XFYA 4NNCA 3STGA 3K4WA 3BOLA 4ZR8A 3N2MA 2R6OA 4HN4A 1LQ0A 1R46A 1BYBA 1Q6RA 1OX4B 4MDPA 1W3HA 4JTUA 3FEMA 3CC1A 1W1IE 3P84A 2Y61A 2BX7A 1PIFA 2W63A 1FCVA 1ISVA 3WO8A 4LYQA 2W4XA 1O94A 1XC4A 2Z24A 3IRSA 1ADSA 3NSNA 4ATLA 5ABFB 2PUZA 3GKAA 2HPIA 1LBFA 1NDZA 4LEFA 3T2OA 2OEJA 4PRRA 1P0BA 4CEUC 3PHAA 4NZ1A 1UUOA 1XCFA 3TWAA 3P7YA 1PYMA 1H7PA 4ACZB 1Q2SA 2PD9A 1FHUA 1B57A 2J75A 3T44A 3V5CA 4DF1A 4DWDA 4DB7A 6ALDA 1XYZA 2PDKA 4L80A 1V8EA 5MF5A 3S9IA 3L4VA 2ZC1A 1R6WA 2VFIA 2HISA 2VQTA 2YW3A 1OD8A 1F4HA 4V15A 1NVMA 1KXHA 3TTEA 4NZFA 4D6FA 1IV8A 4AEOA 1ZQ5A 3AWOA 2VKZG 2XTKA 4MWAC 1HZYA 3FYOA 1BRLB 1GZJA 4XO7A 2BGQA 1DP0A 1BQGA 2YOCA 3A4JA 1G4TA 1QWGA 3R8RA 3QC3A 2X7VA 1Q13A 1RQEA 3GBEA 4XD5A 1G94A 1ONEA 3SAZA 2E5CA 2HXUA 2WZHA 4ROPA 1VPQA 1WNOA 2GSEA 4RCXA 1XV8A 4XZNX 9XIAA 2FB2A 1R3TA 1R7OA 2NVAA 1JULA 1W0MA 1QBAA 3GD6A 4JR5A 4CNPA 4TX9A 4QSFA 2NXIA 1J9YA 3RX3A 3LCHA 5C2XA 1EB3A 2IKGA 3OPSA 4FF5A 4Y9MA 4ZENA 3TX9A 3QHOA 3GFZA 5L9FA 3GY1A 1EP1A 3AS0A 2Z2AA 1XX1A 3O63A 4EE9A 5TQLA 2FTPA 3MDUA 3MI6A 2VZUA 2Y1HA 4O28A 3MP4A 3BLPX 4D8AA 2Z6IA 1G0CA 2ZE3A 5GNYA 4YXGA 3DERA 3HG2A 1CB2A 2RAGA 4U3AA 1HJWA 4L65A 1J0ZA 3TYEA 1CI1A 3DBPA 5HPCA 4L4OA 4B15A 3C3NA 3EMZA 1H1YA 2P0OA 3N17A 4PTNA 3NFUA 1NELA 1OIMA 1PZ2A 1TPEA 4C6KA 1OBAA 1M41A 4ML4A 1RXOB 6A3HA 4JS3A 5F1VA 4LYPA 1DPMA 1VF8A 3HPXA 2E6YA 3FAXA 3MV01 4JQ2A 3RCYA 1M9HA 4Z08A 4UCFA 1VFFA 3RCNA 1AJ2A 3UGVA 2PDHA 1OGGA 4EAYA 2HBVA 1E1CB 2RGLA 5EMKA 3S0CA 1AA1B 3AYVA 1I2OA 2VVNA 1OC7A 3KBSA 3CYJA 4GLEA 1KR0A 1HTIA 4CUCA 4J4KA 3G24A 3NQDA 1R3SA 3C2EA 3QZEA 1D2KA 3TTSA 2HXTA 2BMBA 4MZYA 3BDKA 3N6HA 2OSWA 4PBGA 1J6PA 3PWGA 1H09A 5E0KA 4JTIA 1A4MA 3UWUA 4WEVX 2XM1A 4E4UA 4GXPA 5EMYA 2Z1VA 2V3DA 5C9XA 2HNHA 1TV4A 1NH6A 3L21A 5E1QA 2DW7A 1G4EA 3ITOA 1YNQA 1KM4A 1MZHA 3UA3A 5D9NA 4DBWA 1CXFA 1FP9A 4LU0A 4AVFA 1PSCA 4OUIA 1XISA 2F6KA 4JTAA 4JQ4A 1ZS2A 4C5YA 1SSGA 2POZA 3GNNA 1W9VA 3SIMA 2J78A 5D03A 2DT3A 3MDWA 3N25A 3R1ZA 5F1UA 5LYRA 4D8LA 3C61A 1Q65A 5CPSA 2HVMA 3LERA 1YKWA 3EMQA 3G1YA 3QRHA 4F2UA 3BV7A 1F9CA 1FCUA 1W5OA 2D3LA 4OBSA 3OBAA 2CESA 2A0NA 3W7RA 4S3AA 1WDWA 1HO4A 5BRPA 1RV8A 3IVUA 3KDOA 2OOGA 2VQUA 3WMSA 4GBDA 3C2VA 2YCJA 3CIXA 4FXSA 5LIXX 3LM7A 3G0UA 3GHRA 1VP5A 1E6NA 1HJVA 2WSRA 6CGTA 3BJSA 4IIHA 4HSHA 2YJQA 4XG1A 3EYPA 2E1WA 1IIHA 1OCBA 2PGFA 2FGLA 5K9CA 3MUZ1 2QYGA 1RBAA 2OWXA 2UY3A 2PDFA 4PUMA 3NQCA 1NWSA 4W5ZA 3WLLA 3GRIA 3GC4A 1FWRA 3OHIA 3V36A 3GU9A 1V08A 3BAJA 2XSBA 4H2CA 2W3ZA 5MKGA 1BGAA 1BWKA 3I7RA 4DJFA 2VWSA 3QHNA 3MBDA 2XIOA 4GVIA 4UOZA 4A3UA 2PU0A 1H1ZA 4JL1A 1PX4A 3CBWA 3BE7A 2DPEA 3U2OA 3FHQA 4JX5A 2G3JA 4FF7A 2R82A 3VNYA 2JFEX 1A0DA 3AIVA 3R12A 5AC6A 2X09A 3UG5A 3TTQA 4K8EA 1DXFA 2ISWA 2FZMA 5B80A 4EAMA 7CGTA 4ZL1A 4J2MA 3GFYA 3OZYA 1UMYA 3U6WA 3TSBA 4GQGA 2DUXA 2FJUB 3G6MA 5E93A 4D6GA 4DUOA 1K8CA 5T8GA 1SMDA 2B81A 2LLEA 4D9PA 1O1HA 3ZOAA 4ADTA 3C0QA 3K2GA 2XGIA 5LIWX 3DC8A 5EPDA 1ECEA 2PSNA 4R88A 2F2HA 2MNRA 3VILA 3UNTA 3PTDA 4FK9A 4DM1A 3WCZA 3LHVA 1KNWA 1TQXA 1MFVA 1UWAA 3CB3A 2YPIA 1GZ1A 4HPGA 1K6AA 4TR9A 3MHUA 1OF6A 3TYUA 1PVNA 1REQA 2VZOA 2HZGA 1VR6A 1AH4A 1WPCA 3LS9A 1BYCA 1E9ZB 3V5FA 5EU9A 3AIWA 2VX7A 5D32A 3NQVA 1HX0A 1LWIA 3G3MA 3QPYA 3MYOA 2ZUUA 1VFTA 2BXVA 3SCPA 1KCZA 2MUCA 1WP6A 3ARSA 5HATA 2FZBA 3LU2A 1KWGA 2ZDSA 4GQ0A 4CNUA 1THFD 4OVXA 1K9DA 2A5HA 4FX7A 3U9IA 3GH4A 1YXYA 8XIAA 3M0XA 4A2RA 2XSXA 2YLLA 3BMVA 4OT7A 3L4ZA 5CPNA 1EWDA 3DUGA 1QMLA 4DJDC 1UWQA 3ALFA 1E56A 2CXEA 1A5SA 2HCVA 1UKOA 1PWMA 5BXSA 1LQAA 1QI4A 1ZU8A 2QCGA 4M29A 2NX9A 3L4YA 4L61A 3ZS4A 1W54A 2ZIDA 4M0XA 4LW7A 1B4EA 1G4SA 2H8ZA 1ZCCA 1EP3A 2E3ZA 3LBCA 2Z1BA 3P80A 3VNLA 1JDEA 1D7KA 2V3FA 4NF7A 4RNIA 3LRLA 3WELA 3MMDA 1EIXA 4RDZA 1J11A 3UXIA 4YTSA 3FHAA 1G67A 3M44A 3T7VA 3ABZA 4M56A 5C9RA 1VENA 2OVLA 2PTYA 3WQCA 3AZSA 1POKA 3JU2A 3L2MA 4IGMA 2QJHA 1H61A 2DH2A 3CU2A 4PUDA 3J7HA 3D3AA 1V02A 4ORMA 3N04A 4GYKA 2ZUSA 2C79A 2OZ8A 2YBTA 3RGTA 2XIMA 3DIPA 5EFDA 3I7QA 5AY7A 2D0HA 1RVGA 3OQEA 4R3UA 2ZWYA 1KBIA 3KWSA 2DZAA 1Q6FA 3BZGA 3DG7A 5CGTA 1X7FA 2WVUA 3ECQA 1UA3A 3VGFA 4S2BA 3SECA 2J9YA 5CZJA 4AX7A 3FSUA 3RUBL 3LRMA 3RAOA 1B3XA 1IXOA 5IXEA 3CWOX 1K9TA 1ZBCA 2WHMA 2PDCA 3ATZA 2WNNA 1EX1A 3CQJA 1XXXA 3F4VA 2AOSA 5DMNA 4UQDA 3WJZA 1MNSA 1F6PA 1LM1A 4L1GA 1SZFA 4LAUA 3ERPA 1XLEA 5BWAA 1QNQA 3QR3A 1E73M 4R33A 2A7NA 4OZOA 2BWGA 4MYXA 3RIKA 2PLCA 3WNLA 1EYEA 5MKGB 2PGEA 1BGGA 2O4QA 3H7VA 4ADSA 3B0PA 3MJMA 4CD6A 3O6AA 1SW3A 4MWAE 3WD4A 3MCMA 2NSXA 5A6LA 5I79A 1QTWA 3E0IA 3A64A 3BSHA 2NQ9A 2Z1SA 3M64A 1NWRA 4FNPA 3SSZA 2ZXAA 1TMLA 3NQ2A 2IS7A 2QXWA 3OO2A 4D8ZA 3UPBA 2BY1A 4J1OA 2G4FA 1DWJM 3F5KA 2YCLB 3FJ4A 4NRRA 4NXKA 2D0GA 2XN1A 2PDBA 4IJCA 4PB5A 3WD1A 1R5YA 1TREA 4C1NA 1E71M 4TX8A 4ZB2A 3BSGA 7PTDA 1EDGA 2TODA 3NTYA 1TE1A 2D23A 4A2SA 3UNDA 1UD6A 4OGZA 5G4WA 4L4LA 4QAIA 3A23A 3MUIA 1XC6A 3H22A 3N9KA 1XI3A 4PULA 1CPUA 1R3YA 5ECVA 4FMVA 4AZIA 4JBRA 3WDHA 2X16A 5HMEA 3S5YA 2BOFX 4ZZ9A 4DF2A 1AJZA 5LA1A 3AJXA 2V38A 3W24A 2JKAA 2R1MA 4YHEA 3NZGA 3IK4A 1TELA 3SADA 4HJFA 1W32A 2GGEA 2E40A 3PPHA 4IJRA 5DQPA 4D1IA 1B3VA 1YIXA 4MJ2A 4AY7A 1CCWB 1BXNA 1UKSA 3ARRA 1A5BA 2DH3A 3SO7A 4B2DD 3GC2A 2W61A 3IUIA 4CQAA 1I2PA 3FEQA 5DO8A 3BO9A 3WSUA 1J0YA 3ANYA 3SCQA 3AFBA 3THAA 1ZAIA 4ROQA 4HYWA 2Z27A 3RN6A 1HF6A 2FFCA 5CQ1A 3W53A 2IPJA 3H54A 4PR4A 2TPSA 3KP1A 1PZ1A 5FJTA 3CUXA 1PWLA 4B91A 4K39A 2F9RA 2PGRA 2C13A 1YXDA 1WO2A 4H83A 4P8VA 2X0SA 4IQJA 1OX6A 3VABA 3O15A 3UF9A 2CERA 2D2OA 3MSRA 3WK0A 3QM3A 2WZIA 1F3EA 3QV7A 2PWFA 4TXEA 2C6QA 3HOJA 4QG9A 3W1RA 1P7TB 3ANVA 1C8YA 3VMNA 4LCRA 1XLFA 2Y8UA 4JY9A 3ZR5A 4J3VA 3MMUA 5M03A 3KDNA 2O7QA 1TVLA 1UW9A 1JZ6A 1UBSA 2Q8LA 3WUFA 5JIWA 4MNJA 1YMYA 4QLKA 2L5HA 1DJZA 2P10A 4LV9A 3GUGA 3RMJA 4DXVA 4Q8OA 4YU1A 1IZCA 3OYZA 3NWRA 4GIRA 4QJ3B 4HMNA 4JNYA 1VBGA 3PVFA 1H0IA 2XH7A 2Y7FA 4OHQA 1ICPA 4LVDA 1YADA 1I2NA 2OR2A 4DYEA 4H1ZA 1F4AA 3ATYA 4DRSA 2Y63A 2GDQA 5D2VA 3MW7A 4IQEA 1GEHA 5IFPA 3A9BA 5HA7A 3UESA 2Q01A 4NYUA 4Z1AA 2B7NA 2DGAA 3MVTA 4BEUA 1XG3A 2O9OA 3C8FA 3TC3A 3HPZA 5A6SA 2QCCA 1A5LC 5K3VA 3FVDA 1OFBA 4UTUA 3VOFA 4TX6A 2Y85A 2WXDM 4X9SA 3AU2A 4EXQA 3T40A 3S47A 1QI2A 2ZUNA 4U10A 2NLIA 3MHFA 1QOPA 1KRCC 3WLIA 3W7GA 2GJPA 2H90A 3W2NA 3L0GA 5HBFA 7REQB 1IZKA 4Z17A 4A29A 4D6DA 4PTXA 5HJYA 1S3TC 1TPUA 3N19B 5F2IA 2HQAA 2PWEA 2WMHA 1NEYA 3LG3A 3ABQA 1SO6A 4PTVA 2DZVA 3W3OA 4W9TA 3CMFA 4GWEA 3A9IA 5E5CA 3NZ1A 3I6RA 1KBBA 2E68A 1CZ1A 1OIFA 2RJHA 4W7VA 1M3UA 1TUXA 3T0BA 4C1NB 3F1QA 2VENA 1B54A 2O0TA 3IJQA 3G1XA 2FHBA 2YR1A 3GWQA 2IKJA 3MI3A 4N9BA 3KWXA 3BH4A 3VXGA 1XKYA 2QMJA 4V27A 4RPQA 4AZ5A 3VKCA 3HB9A 1GOKA 4RXFA 2YL8A 4FNSA 3DESA 2H8XA 3K30A 3M0YA 2GWNA 3MANA 3LSCA 1J0IA 1JCLA 3JZEA 4RK8A 5BROA 1DKWA 1JYWA 5C8BB 4C7GA 1OZQA 2DSZA 3D46A 3QFWA 4DO4A 3U4AA 4AHPA 5E70A 2IKIA 5IDIA 1HVQA 1AZ2A 1ZP3A 3WY1A 5A6KA 2YBUA 5G2IA 2B0MA 4K37A 5FF4A 1FHVA 3WJXA 3GXNA 2XIQA 2YB1A 1U5HA 4JTSA 2V5JA 4MADA 3LCXA 2OWCA 2DQWA 4BQ3A 1V3HA 4NP7A 1EJWC 1P0EA 4RR4A 3BPWA 2V5DA 2OLHA 3DYMA 4G7FA 1XLAA 5E6YA 1UKQA 5C70A 4KGJA 3CS2A 1B0IA 1XCWA 1WAUA 1V7YA 1R9ZA 3LGEA 4IXHA 3L2IA 3SR7A 1W1VA 3WFAA 3U4FA 5BW6A 3SJ3A 2QUUA 4E3VA 1A3WA 1ZENA 4EOUA 3C3UA 2XWDA 5DMMA 5D09A 3T9PA 4I7VA 3LD5A 3P74A 1RCXB 4GD0A 3GNDA 1LL4A 2GJNA 2HVNA 4LRTA 2OTDA 1PKYA 1TIMA 2WKGA 2GK1A 2XVNA 5MHBA 4HSNA 4RE0A 1YNPA 1NM9A 5HJLA 2V5CA 3VDAA 1KKOA 3CHEA 1EKOA 4AG0A 1CGUA 3DFPA 3K13A 5CSUA 2OT0A 2VCCA 2H9AB 1BYDA 3Q37A 2VDHA 2QDDA 2VEGA 4KF1A 1Z7AA 1SSDA 1DWIM 1FH7A 1W9DM 5H2ZA 4WF7A 4IM4A 3BCFA 3CUGA 1XWYA 4DBUA 2WCAA 3RM9A 4UR8A 2RFGA 2J9ZA 4NAEA 3CTLA 2HVOA 1XF0A 1ODZA 1UJQA 3O2LA 4AF0B 3AHVA 3W7NA 2HRWA 4MTVA 1XH2A 4F0RA 4LY8A 4UQBA 3ALGA 4R27A 4KH2A 2OEMA 3AS3A 1V6YA 1KLYA 1CGVA 3AMDA 2UZ9A 1LWHA 4UCGA 3EMCA 1W3JA 4E5TA 4CU6A 6ENLA 3R89A 5A6BA 2C7FA 3E0VA 4AWEA 3W1XA 2E8ZA 3W2MA 5GVJA 3GNOA 1GJPA 1Q6GA 4HPNA 3ARYA 5T9CE 3E6EA 3EPMA 3IACA 2ZRVA 5JUVA 2QJMA 3S2JA 5KETA 4GGHA 3MUY1 3DYOA 3SCTA 4YYCA 2YCKX 3UU0A 1K8ZA 3UWYA 4NX0A 2FVLA 3OB8A 3P8JA 1J0HA 1US0A 4PEEA 1AD4A 4FOJA 4GYPA 2W79A 4QLLA 3KRBA 4K6AA 1TPFA 3SRHA 4JFSA 1RJQA 2BP1A 2OG9A 5IBXA 2NX3A 4ASTA 4JTHA 3UGRA 5BWFA 5E09A 3AC0A 4AD2A 2EEXA 2YZRA 3H2OA 1SZEA 2ZZ6A 1ONXA 3HA1A 1NF7A 1DL3A 2WM0A 5C71A 2OZ3A 4A3HA 5A6BD 1XD0A 4QCFA 3I4KA 4WSKA 4XBJA 1XFBA 5AVNA 1ENUA 1FXPA 3T0TA 2PDIA 3CWNA 2XVPA 3PBYA 1QNVA 4D6JA 4XO6A 4HCDA 3REQA 5I02A 3UWWA 1HGYA 4YNGA 3LHTA 3T0CA 3P62A 3EDKA 1OK4A 2D2JA 5CXPA 1K4GA 3UG3A 3JZUA 1WOAA 4H8VA 1PCKA 3IS4A 1J01A 2NQJA 4NU7A 3I7SA 1RA0A 3RO8A 1K9FA 5D37A 3BK0A 4P2VA 4E2BA 1LUCA 1ONWA 3O0FA 4DLFA 3GH7A 4ECLA 2CWXA 3T81A 3N4FA 3ZXWA 1N8IA 1MW2A 2I56A 2QCEA 3GVQA 3IWPA 2PRLA 1Z9AA 3PB0A 5FJIA 4C1LA 5DXXA 4WDXA 4O1AA 3TSDA 3MKCA 2P3ZA 3FA5A 2ISVA 1E72M 4CVUA 4Q4PA 3CYVA 4JGDA 3R4IA 2A21A 1E3ZA 1V6XA 1GZGA 2ZXQA 2W67A 5EKYA 2QCFA 2FVKA 3TMLA 1W5NA 4JIPA 3A13A 4JEQA 1GQIA 4GNJA 4DO5A 2J74A 4CCZA 1C7SA 3UZXA 3EX6A 3TNBA 3TE9A 3WQEA 4E4FA 1H49A 4QM1A 4H9VA 3WH7A 1Z48A 1G4PA 4X61A 4B5WA 3GVGA 2D3NA 3P3BA 5LZLA 1TKKA 4F9DA 3TXZA 1ECQA 4PN2A 2Y6ZA 4PB3A 2VFFA 4AYSA 4QCEA 1QU4A 1S5TA 3T0DA 1E9LA 3WQ4A 1OABA 4ZSTA 3DU0A 1Q8JA 1VHCA 2ESCA 3ITTA 3UXDA 2WJFA 3W87A 4B5TA 3W00A 1YHTA 1FWAC 3PZQA 4AD3A 4GO9A 1CBGA 1Q6DA 1UZ4A 3GVVA 3CPGA 4GVGA 3MKKA 3B04A 1OFPA 4M80A 3KVMA 2OLSA 1TA3A 4M81A 1RLDA 4CU8A 1JDDA 4H8NA 3SCOA 2VC5A 3UJEA 3NQ6A 4NAFB 2OOFA 3M43A 4RXGA 1JCMP 3WUEA 1LT7A 2GL5A 3W75A 2X1IA 2CKSA 1LCOA 2W9MA 4E4PA 2OFJA 3M5XA 2XFRA 3MV11 3GNPA 1U30A 4C6LA 3HMCA 1RY8A 3PG9A 2Y4SA 4JTCA 5LNUA 3LA4A 4DXKA 5DBUA 3WBYA 2CBUA 5B7YA 1GVQA 4UTLA 4YTUA 2TMDA 4C6DA 1BVWA 1GOXA 2WQDA 2REQA 2FDMA 1DWGM 3CH9A 3HG4A 4XSMA 2Y8KA 2ZRUA 1FDYA 2WJZA 3TJ4A 1VHNA 3N4AA 3WEMA 4JFVA 5AECA 3ZMRA 2G0WA 3D5HA 3T2QA 2UBPC 3RRXA 3RO6A 4ILSA 1H62A 2PRMA 3BMWA 1XGDA 3C56A 4NNAA 1ME8A 3AQUA 3EWDA 3VGDA 3G1VA 3EA1A 1R47A 3LCFA 1ADDA 2WV8A 5G2WA 4AVOA 4EACA 2O55A 1JPKA 4Y9PA 5A5WA 4IPLA 3QMSA 1SO4A 5EMUA 4NNBA 4L56A 1DTNA 5U4NA 1SQ7A 4ES4A 4GRSA 1R7AA 4D6HA 3O0KA 1TR1A 2QDEA 3O9NA 1HJUA 1DJYA 3FSTA 4WXYA 1ICSA 3G2GA 1E6QM 3FJLA 1DOSA 1Y5WA 3ANUA 5FF3A 1ZUAX 1V0KA 3REQB 2OU4A 4ZO9A 4CD5A 2WMKA 8CGTA 1ISYA