3W7LA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-075
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-075
rcsb
source organism Trypanosoma cruzi
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7lA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7lA01
1QPNA 1F5ZA 2JGQA 1OYBA 4W9TA 2G95A 4LU0A 4NJHA 2H90A 1JCLA 1M7PA 4O16A 3BGJA 2Y7DA 2QF7A 4NXKA 4N6FA 1S5WA 5AC7A 5IBXA 3NM3A 4PEKA 2ZA3A 5D09A 3HBLA 3W86A 3CHVA 3L2IA 3HO8A 4Y9AA 2CLFA 3TQ0A 1AL7A 5H91A 3NNTA 2X30A 4XWUA 1DJNA 3IVTA 4FIRA 2FB3A 1UUMA 3W7LA 2Z6JA 2ABBA 3DKLA 3GXPA 4UTKA 3NPVA 1TV7A 3PUEA 1OYAA 3GXTA 2TSYA 2X1RA 2Q8LA 1LRQA 1TRIA 3I68A 3NXFA 3DZ1A 1A5AA 3LM7A 1O5XA 3MWAA 5DN1A 1IIGA 4PC8A 1SQ7A 5BOOA 5C55A 3WK1A 1GTEA 1W3IA 3G1XA 4LTSA 1VC4A 2GUUA 4JNMA 3MYOA 2F84A 3NM1A 3O06A 1B3OA 2ZZ5A 3W1LA 1B4KA 3TAOA 3M5ZA 1GYLA 1XXXA 3L68A 3UWQA 1TRDA 1M6JA 4OGZA 1OK4A 2DZTA 3LHUA 3L67A 2W79A 1XDLA 3HJZA 3U2OA 1EWEA 4K7YA 1O60A 2WSYA 4O50A 3EX6A 3F03K 3RMJA 2YW4A 4IMCA 3QMTA 2CLLA 3UWYA 2QUUA 2X1SA 3BVJA 2WSRA 4JTFA 4NQ1A 4O18A 5F4WA 1W5OA 3IGSA 1JCMP 1GVQA 3EWXA 2NWSA 1TTIA 3KOFA 3G1DA 1TPDA 2QAFA 1QDSA 2X1TA 5K4XA 4ZQRA 3TMLA 1QCWA 3QC3A 4HSNA 4KFOA 3E49A 3V75A 1QO5A 2E09A 1UBSA 3BW4A 3HGJA 4K8HA 3DENA 4MYXA 3WJZA 3ABQA 4NJGA 3UWVA 3IV3A 3CEPA 2C1HA 1IXOA 1K7FA 3MHUA 4MY8A 1WQ5A 4XBSA 1XKYA 3W7RA 3FLUA 1A50A 1PHWA 3W85A 1BTMA 1FWTA 1TIMA 5FF3A 4DBDA 2Y85A 3PR2A 4I7VA 3NQ7A 3M16A 3B06A 4NNAA 1M7OA 2CW6A 4LC8A 2JK2A 4OBTA 1IF2A 5AYZA 2ZTJA 3C2OA 3ZS4A 1YDNA 3C0JA 3UXDA 3LV6A 3JRKA 3FJ6A 5DY2A 3LCHA 3PVFA 3E12A 4G1KA 1I2RA 5G4WA 1A5BA 2EPHA 4OWGA 5LZLA 2NXHA 1WX0A 2V8ZA 3PSVA 4UUIA 1B57A 3O15A 5MHBA 1HO4A 1VCVA 1TQXA 1L6WA 4AHPA 2FLIA 4GE8A 4UTWA 3NL2A 3WJYA 1H62A 1FXQA 3S1XA 2YDAA 3TC6A 1FBAA 1FQ0A 1WYIA 1YTEA 1QNVA 3G8RA 3QJAA 4JTUA 4HSOA 2VEKA 5CZ0A 1MEWA 1XCFA 3TK7A 4OE7A 4L4LA 2DZXA 3C56A 1UJPA 1LORA 4UIOA 3TSDA 2GOUA 1TTQA 3PUDA 2W0UA 3HMJG 3NA8A 4GC4A 2XN0A 2CFFA 2E5CA 1KBIA 2Y70A 1JQVA 4O0KA 1K8YA 3SSJA 2EHHA 1A53A 1TQJA 3EX4A 1NFBA 4JYDA 4NXSA 4FF7A 1UCWA 2YGYA 2BSLA 1GYNA 3G1YA 1G4PA 2FQIA 4O13A 3HPZA 4Z1DA 1NF0A 4DBEA 4POCA 2TRSA 5DELA 2C18A 1HTIA 3W7NA 1GPWA 1F7BA 3A5FA 2C15A 2ISSA 3NQ6A 1FWNA 1UUOA 5CSRA 1XBYA 2NUYA 2IQTA 2E5DA 4JX5A 2VFHA 1YPFA 1OFEA 3LDVA 2ZRXA 2GQAA 4JGDA 3W1TA 1H50A 3EB2A 4A3UA 1T99A 1FY6A 4QQ3A 5U4NA 3LCWA 2WO5A 1DQXA 1N8FA 2FB2A 2RDUA 1W3TA 3GX9A 1M5WA 3WJXA 2PRLA 5AYYA 3NL5A 1TSIA 1WXJA 5HWJA 3W07A 1H60A 3VNDA 2A7PA 1JCJA 2E1DA 3RU6A 3L21A 2Y6ZA 3CPRA 1ZENA 3L5AA 2NV1A 4IUOA 3T40A 3T55A 1PCKA 2W6RA 1A5CA 1P4CA 1GVSA 3M9YA 4J9JA 3S5YA 1ML1A 3R13A 1DOSA 3DH7A 4RLIA 1LCOA 5DBUA 4IMGA 3CC1A 3HG4A 4HIBA 3P81A 4BFAA 2PRHA 1OFBA 2CU0A 4UCGA 5CPMA 2FFCA 1ZAIA 1KLYA 4UNLA 1XUUA 4S2CA 3S8HA 4O14A 4AB4A 5FF0A 1ICSA 1DV7A 4OQVA 3M41A 2J27A 3VFLA 1AL8A 1TCDA 4GWEA 3UD6A 5CKSA 2ZZ3A 3G3DA 4N9BA 3IIXA 3UPBA 3UY7A 1FCBA 1AW1A 4FX7A 1W3NA 3TKFA 3TC7A 2TPSA 1AMKA 3UZ5A 2X16A 3R5EA 2ZBTA 4GFSA 4RXFA 2Z0IA 4LT9A 3PBYA 3GXNA 1IXNA 2DZWA 3HB9A 4GUIA 4EWND 3W75A 4TO8A 5DCDA 3O8AA 3LB0A 2HS6A 5EBUA 3W3OA 2CZDA 1L2UA 2WNZA 2NUWA 4Z0JA 3GDKA 4ORIA 1P0NA 5EL1A 1EA0A 2HTMA 2DZPA 1SUXA 1WDWA 3FOKA 5F2GA 1VZWA 4JX4A 4CCEA 4O17A 2P10A 3W1UA 1IXQA 1FWWA 4K37A 3INPA 3WJSA 4CNPA 4HPXA 3F4NA 2Y89A 3C8FA 1R2RA 3SECA 4CQAA 4RZ5A 3G8EA 4E0CA 1OG0A 3C6CA 1LYXA 1L6SA 1VJIA 4FNSA 5G2WA 2TYSA 2C6QA 3EX1A 1NAL1 4O12A 3EWBX 1J5TA 1GVOA 4PH6A 2A4AA 2VFIA 1FWRA 1I2NA 3LHTA 1F2JA 3NZRA 1W5PA 2KZHA 3OVRA 2Y88A 4RR4A 3OVQA 3SFKA 4E2BA 3LHYA 3HPSA 2OT0A 3P82A 2FDSA 5FEPA 5D2WA 4LS2A 3NQEA 3QW4B 1SW3A 4ALDA 4MPQA 4CQ8A 4MVAA 2QAPA 4OHQA 1NSJA 5F1UA 4Y8FA 3QM3A 3LX9A 1VCFA 1XBVA 4QISA 3LOTA 3CQ0A 4A22A 2ALDA 1OFAA 1TPUA 2JKEA 3EKLA 5C5YA 4IJBA 1KFLA 4DEFA 3B0PA 4IOTA 1DBTA 1LOSA 3QPYA 4FO4A 1FUYA 4M7TA 4JTKA 1O95A 2V30A 2VFDA 3W76A 3MYPA 2YX0A 5I3GA 2E6YA 3P84A 2QCLA 3H53A 2GJLA 3U8GA 2FPVA 3TH6A 4DPPA 3PS7A 4ZL1A 1SR9A 2YW3A 3IRDA 3DFNA 3W2UA 3W1NA 1H7PA 3HF3A 1E51A 4RV8A 5K9XA 3W1RA 5I3IA 3IGUA 1OX4A 1P1XA 1T0OA 1EX5A 3M43A 3P60A 2Y7FA 4UTTC 1NF7A 3EXRA 3W7KA 5A5WA 1CI1A 3TAKA 3A9IA 1S5TA 2NXIA 1FX6A 1WAUA 4GUFA 1TPFA 4QAIA 4MYAA 5CSSA 2H8ZA 1H7OA 5A8GA 1KLZA 1VCGA 4Z0SA 5HNRA 3PB2A 1KTBA 1SZNA 4XTIA 2FPYA 1FDYA 1Z48A 1JCYA 4JR5A 2WSQA 3FYPA 1B9BA 2CLOA 4H6KA 5TIMA 3VKJA 1K7XA 1OFDA 4JTEA 4BF9A 2QR6A 3MBFA 4AMAA 4HNNA 2ISVA 1SZFA 2RH9A 4CNOA 4ZQNA 5CGQA 3RFAA 1LBFA 1JRBA 3TJLA 1O5KA 3PM6A 3L0NA 4O54A 3DI0A 1EIXA 1XFBA 4YLWA 2B7OA 3W7HA 3C4UA 3QRHA 5D2XA 5AYXA 4JD4A 1I45A 1OFOA 1YADA 1RPXA 4LRSA 3W6YA 3W7QA 2QCDB 4Q33A 3GLCA 1PVNA 3NL3A 3BG5A 5L9FA 3C52A 3PG8A 3LCXA 1JJKA 4DELA 4DPQA 4K36A 3N14A 2C19A 5DCBA 4BI5A 1H61A 1LLZA 3TDFA 4MY9A 4E2DA 2V82A 3IIZA 1DKWA 5CPOA 1ZNNA 3O6DA 3LCIA 3NZ1A 4DO5A 4ZZ9A 2DORA 3GKAA 3W2JA 3LHWA 3UZJA 1SFJA 3GR8A 3Q37A 2Y63A 3DFSA 5K9CA 3QW3A 3MBDA 5D33A 3DU0A 1Z41A 5D32A 3EWUA 1KFKA 4TX9A 2NUXA 4ZQMA 2E6DA 1VYRA 4BWLC 3UWZA 3MHFA 1KFCA 2OZ0A 4C1LA 4LVAA 5EKYA 3OBKA 3G1AA 1AK5A 3FIGA 4ZMGA 2XN1A 1OF6A 3MO7A 3HG3A 2X1UA 1F6PA 2QJHA 1N55A 4XZ9A 1ZALA 2B0MA 5AHMA 3NAVA 4IXXA 1V7YA 3QYQA 4Q32A 2BZNA 4FX8A 1SZGA 2Q8ZA 3BLEA 4LV9A 2Z6IA 5G2IA 1QFEA 4AF0A 3CTLA 3LERA 3PBUA 4RZ6A 2C0AA 4RXGA 1P0KA 4NZJA 1DHPA 1SW7A 3N9RA 1K7EA 2OX1A 3W7DA 3OG3A 3L0KA 3KVLA 5KZDA 3LV5A 3OIXA 3M47A 4HT3A 1SW0A 3PF3A 3S5OA 5HJLA 4MZ8A 1Q3NA 3B0UX 5F4XA 1O4UA 2FTPA 3TR2A 1VPXA 5G2HA 1Y0EA 1LDCA 2NZLA 4MJMA 3B04A 3GNDA 1TYGA 3G1SA 1G7VA 2NV2A 5K7JA 1X1ZA 1VH7A 3L65A 1H5YA 2PCQA 4BK9A 4XBKA 2H6RA 3W7CA 4RK8A 3BLIA 3MHGA 3VE7A 2DZVA 1ZAJA 3GK0A 4MZYA 2Y7GA 4XKYA 3T44A 4IXHA 4DO4A 3W71A 3PUOA 3W2KA 1K3UA 3GR7A 5DXYA 1MEIA 4GUHA 2VELA 5HWNA 1C29A 4OT7A 1F74A 4GXMA 4YXGA 3FS2A 4FNPA 2ABAA 1HFBA 1X7FA 3LTSA 3ATYA 4HNTA 1JR1A 5LNUA 2FJKA 4HNUA 4CQ9A 3M44A 1QR7A 1SSDA 1EEPA 3P8JA 6ALDA 5BMWA 1XBXA 3HOJA 2CZFA 4ZQPA 4RZ4A 4WQ6A 4O52A 1H7RA 1VS1A 3B03A 4U28A 2YR1A 4H4IA 3IIPA 3TSMA 3T78A 1CX9A 4IMFA 2ZRVA 2JGYA 4QM1A 3V1PA 3SZ8A 2BLEA 3NPUA 2QCMA 4NNCA 1I8JA 5AHIA 4IWWA 4FXRA 5EMUA 1QPQA 4NT0A 2Z1BA 4BI7A 3BG3A 3JR2A 1EUNA 3N2MA 4AH7A 3AO0A 4CCDA 4N9EA 1HG3A 1SFLA 1VQTA 1QMLA 4QIUA 2Z2UA 1W1ZA 5T26A 1IIHA 1GOXA 2ZYFA 3A5VA 3OHIA 3NG3A 2O7QA 4KFNA 5FEXA 3JS3A 4LW7A 3ABOA 4UFKA 2G5WA 1XC4A 1SO4A 5BMXA 1QPOA 3I7RA 4ZQOA 1EP1A 5LHFA 2EGZA 4Z1BA 5IBXC 4DF1A 1KFBA 3B8DA 4S2BA 2ISWA 1SO6A 5F2LA 3DKJA 3P5ZA 2ZFAA 2GVLA 1D3GA 4EIVA 1WA3A 3W72A 4UR7A 2DZSA 2ATMA 3W7MA 1QAPA 4WOZA 3TIMA 5FEZA 4UFHA 5KZEA 1LM1A 1W5QA 3EXTA 5K2ZA 3IIOA 4KWVA 3O6YX 1EUAA 1OF8A 3QPZA 3GB6A 4FNRA 2NXGA 1J2WA 4UC5A 5E0KA 2YYUA 4JX6A 5EYWA 1R2SA 4XTDA 4GNJA 3GZ3A 2G97A 1VGAA 4JDBA 1TB3A 5FI8A 3CB8A 4XQ6A 4JICA 4EVZA 5J5DA 5D02A 4A29A 2B4GA 3MMTA 3EWZA 3N2XA 5F2IA 1LBMA 1LOQA 1P5BA 2NX1A 4UTTA 4AXKA 1ZCOA 1TREA 1KM5A 4NVTA 5D38A 3AJXA 3OVPA 2WKJA 2QJGA 4AHOA 4A21A 4PA8A 4R7JA 1DQWA 3HGSA 4MKNA 2EKCA 2F7FA 4IPIA 3GAYA 2GQ8A 3G0XA 3GDMA 5F4SA 1AW5A 4CNNA 5LNSA 5D05A 4UFMA 4UFJA 2J9XA 4QITA 3QQ1A 5DLCA 3SJ3A 3DHFA 5DXXA 2G96A 1JRCA 1XBZA 1U5JA 5CPLA 3P80A 3M7WA 1G6CA 3CM4A 3VE9A 4UTLA 3F4WA 3TU9A 3M5VA 4GUJA 3BK0A 3CWNA 4UTJA 2E6AA 3ATZA 4I7UA 1TPWA 1W8SA 3N9SA 1QPRA 1W31A 3STFA 4JTJA 5BRBA 4GRSA 2CWNA 3ABRA 2WNNA 3W7OA 4DF0A 4QNEA 4TR9A 1THFD 3GVGA 4L4MA 3C2VA 4DQWA 2CLKA 3QZEA 4N4QA 1GVRA 3WFAA 3NQVA 4K7VA 3BLFA 2YFNA 4MY1A 3E0IA 1ADOA 3N19B 1IGSA 1H63A 4N6EA 6TIMA 3UQNA 4PODA 1KFEA 5LGZA 4LNYA 2I1OA 3DFTA 3S1VA 5HWMA 4YL2A 3NQMA 4EF8A 5KMYA 3W7PA 1X6UA 4FIQA 2VC6A 4WXYA 7TIMA 3PULA 4EOUA 4WY0B 3TXVA 3PBWA 5CG7A 3TE9A 1EPXA 2VFFA 1SU5A 3W1PA 4PTNA 3L0GA 3HIJA 4IMDA 5SWUA 4PL1A 4UTWC 4JN6A 3NQDA 2VOMA 1YDVA 3NVTA 4ZVJA 5LHEA 4JTLA 1GZGA 1Q45A 4LWWA 3T7VA 2WPBA 5D2TA 5K9DA 3NR0A 1GG0A 4NX0A 3LCFA 4JIPA 4O53A 4Z1AA 1JUKA 2YZRA 3PAJA 5LNWA 3W2NA 1BWKA 1D9EA 3DBPA 3G1VA 3RLVA 3W1QA 2ZRYA 2CLEA 5HR7A 1WBHA 3LBCA 3NQCA 1FCVA 5LNVA 1ZHAA 2VEMA 2WOQA 1H1YA 5L6UA 5K4ZA 1J4EA 3SGZA 1KM1A 4IGHA 3THAA 3MJYA 1KM2A 1K8ZA 2A7RA 4U4MA 4DO6A 1H51A 3NQGA 3VCRA 3DFPA 1W0MA 1YYAA 5LKYA 3UPWA 2I14A 4K38A 4JY8A 4RCXA 5TQLA 3S6DA 4ICNA 1R47A 2QCNA 2QKFA 1BWLA 2ZZ6A 1FDJA 2A6LA 3DHDA 1EB3A 1KA9F 5G1YA 1KM0A 2A2IA 1SSGA 1JCXA 3NDOA 4KFPA 1XL9A 2QUTA 4WZHA 4FNQA 3WK3A 3MP4A 3W84A 3ZFHA 1DL3A 3W1AA 1LRNA 1ZAHA 2Y62A 3GDRA 3LBMA 1BEUA 3QF0A 4O57A 3WK0A 3W23A 2CZEA 1I2QA 5E1QA 4TMCA 4LVBA 1ZFJA 3EWYA 2EAWA 3E96A 1S5VA 3H54A 1GJPA 1PV8A 3MP5A 4NX5A 2YYTA 4Z08A 4TMBA 4FEZA 3LGEA 2V0TA 1KTCA 3QFEA 4QSHA 4ADTA 2QCEA 1R30A 1SO5A 2DJXA 5IM51 3TFXA 3U6WA 5C6MA 4DF2A 2A1YA 4Y6GA 4WX2A 2NWRA 5FF7A 2ZA2A 4HHPA 5D04C 1LZOA 5D2VA 4X22A 3S1UA 4N02A 2RKXA 2RHGA 2J6XA 2R8WA 5H2ZA 3O07A 2GVJA 3A22A 3R12A 3STEA 3S1WA 5HMSA 4I9AA 3P8IA 3TMQA 4M7SA 1ME9A 1Q6OA 3P74A 4NJJA 1ICPA 3CU2A 3KX6A 1S3HA 3G0UA 3EX3A 2E77A 3NQAA 3RNDA 3FYOA 3NEVA 3LXCA 3DAQA 4JXCA 3SGUA 2QDHA 2Q3OA 1ALDA 2VENA 4JYEA 2RFGA 5I3FA 1VHNA 5KTLA 1I2OA 3PY2A 5AC6A 1QOPA 3QEZA 3C2EA 4JTSA 3BARA 3HGOA 3QSRA 3KXQA 2Y61A 3LXAA 4N2YA 2QCFA 4MOZA 4YCPA 4LS0A 1KV5A 3FA5A 5I3HA 4AWUA 1F76A 5AHEA 2V9DA 2YFOA 2ZRWA 1YXYA 3EEGA 3NPWA 5G5IA 4AAJA 3PB0A 3LCGA 3W2LA 3FKRA 4TU1A 4NU7A 4X2RA 4UTIA 2HSAA 3A24A 1T8XA 4WUIA 3IIVA 5CPNA 3FEMA 4A2RA 3UWUA 1W56A 3NGJA 4B5NA 1DVJA 2RDTA 3WJWA 1GQNA 3R8RA 3OEXA 5C2XA 1Z44A 2OT1A 3D0CA 5E93A 2NX3A 3RF9A 3STCA 4GUGA 3VI2A 5FEWA 2XN2A 1PIIA 1OFQA 5BNKA 2H3DA 1LOLA 4N9DA 1U83A 1EP3A 2JBMA 4D2JA 4LOCA 1GTHA 1C8VA 1OK6A 4JDYA 1ICQA 2BWGA 1TJRA 2ZA1A 5HINA 3TV8A 1RQHA 3C2FA 3QQ0A 3LI0A 5LSMA 2CLMA 4ML9A 4UMCA 1KBJA 4O10A 2QCCA 1D3HA 3CEUA 1G4EA 3QMSA 4R33A 2CLIA 1O94A 2R94A 2WV8A 4AHQA 3PSWA 3H55A 1HL2A 1PCWA 4E38A 2FPTA 4UFLA 3RK8A 3LRKA 3UYCA 1FCQA 2BTMA 3I6RA 3LXBA 3Q94A 4GJ1A 4LY8A 1KFJA 1TPVA 1YLVA 5HUPA 3KVJA 1L6YA 1GEQA 2VFGA 3NQ2A 4UMBA 5CZTA 1N7KA 3W87A 3TQKA 3GKFA 3OA3A 2J9ZA 3T4CA 4O1CA 3C3NA 2ZRZA 1KTNA 5FF4A 3G1HA 1VYPX 3YPIA 3N73A 1WBJA 5AHFA 2I9EA 3FKKA 1UB3A 3I65A 4QJ1A 2Y7EA 4ADUA 3W7EA 4M19A 2YXGA 4MLJA 3W83A 1QO2A 1G4SA 3Q58A 4N4PA 4UTHA 3NPXA 3ABSA 1PE1A 5ABTA 3LRLA 3MI3A 2R91A 1JUEA 2WQPA 3L66A 1RQBA 1W5NA 1VRDA 3BGGA 4M6VA 3UNDA 4NZFA 4KKXA 2V81A 2PRMA 3CT7A 3L5LA 1LBLA 2H3BA 3LLFA 2HS8A 3EKZA 4M6PA 4S1FA 3ANYA 2OCZA 1LROA 4O11A 2BX7A 4C1KA 2A0NA 3TQVA 4MUZA 4MJZA 4HPJA 3KFTA 4UFIA 3MI6A 1C9DA 1G67A 4OU1A 5AN7A 2C14A 1G7UA 1TV8A 3W1XA 4ZQCA 3A21A 4P2VA 1QOQA 1RZMA 4MZ1A 4ONVA 2A5HA 2VEPA 3P7YA 4FXSA 2ZQ0A 2OMAA 1G69A 3TA6A 1OX5A 2OJPA 1RQEA 5KINA 4H3DA 2QCDA 4CCCA 2VEIA 4O1BA 1SO3A 1VHCA 1ZJIA 2WNQA 4MIMA 1PHQA 1QWGA 2VXNA 4WY0F 3W22A 4IX0A 3LTYA 1ONRA 3W88A 2GQ9A 3PWAA 3NL6A 2A85A 1AG1O 3M5YA 3PG9A 2LLEA 5DY3A 4LVFA 3IGXA 4JEQA 2ZZ7A 1GWJA 4WJEA 4UTMA 1W5MA 4OV9A 1F73A 1FXPA 3DI1A 1H7WA 4XUGA 3PBVA 1Q6QA 3G22A 4O8RA 2ZDRA 4IX2A 3NQ8A 3LLDA 1TTPA 1FCUA 2GPTA 2V5LA 5HULA 4O0ZA 3IEBA 2UV8G 4UMAA 1VLIA 3NQFA 1OX6A 5AC8A 4FNTA 4WD0A 1MO0A 4Q4KA 5EY5A 1RD5A 2ZCGA 3P62A 1CW2A 1XUZA 1OYCA 5CZSA 2WJZA 2B7NA 5DCEA 4JYFA 5D37A 3ZWSA 4NJKA 2J88A 3FJLA 4FNUA 3TUUA 3W74A 2O7SA 4LVDA 5HQEA 3BW3A 1H7NA 1EP2A 2Q3RA 3CIXA 3HG2A 5J5RA 1KV8A 4LC6A 3W70A 1R46A 1OABA 2ZZ4A 3TCEA 2P0OA 3GAKA 3R89A 3BPWA 4NJIA 1JQXA 1K8XA 3E9AA 4RJEA 3USBA 1TPEA 1Z42A 1AW2A 1YXDA 4HN4A 4CLMA 1XI3A 5AB3A 4P61A 4AEOA 4WXZA 5AHNA 2NLIA 4K6AA 1HUVA 1OFRA 2A7NA 3MI2A 2QEZA 3S42A 1NEYA 3IVUA 1F05A 1X1OA 4M5PA 2PE4A 1HO1A 2TMDA 4JTHA 1VR6A 3G24A 2AQWA 4WOQA 2E68A 3EWWA 3B0VC 3KRZA 1XDMA 4FHAA 1TJPA 4BI6A 3NYZA 4HNVA 1MZHA 4AWSA 3SR7A 4UTUA 3C61A 2XFWA 1MXSA 1MSSA 3I7QA 4HKPA 2EF9A 4MFEA 3M0ZA 2C13A 3DFOA 3SI9A 5I3JA 3SIZA 5EA9A 3KVKA 3GDTA 4O19A 1K03A 3A23A 2FIQA 2GVGA 4MFDA 3TX9A 3TNOA 1T96A 2QUVA 4N9CA 4IQLA 5D2YA 1YPIA 1X8FA 3PC0A 5EPDA 1XM3A 5BW6A 3Q2DA 4A2SA 3M6YA 3MUXA 3I7SA 4UNKA 3W7JA 3LHZA 2VKZG 1H1ZA 2B7QA 1WOAA 3C2RA 4YWIA 3UXAA 4AVFA 1OX4B 3KAOA 1TPB1 4AWTA 1GVFA 3R2GA 5TBOA 1BKSA 3FFSA 4EF9A 3O1NA 3TXZA 2B7PA 4ORMA 4JIQA 1NVMA 2V2HA 3BG9A 8TIMA 1YTKA 1Q6RA 3W2MA 1KM3A 4I7WA 4O15A 5HR6A 1SPQA 1ZY9A 4RKAA 3N34A 5AOUA 4O28A 2AGKA 4GBUA 1H7XA 1VYSX 3O6CA 3CIWA 3DFQA 1ME7A 3UY8A 3O05A 4O4WA 1JCNA 2J9YA 3BO9A 4R34A 4JTTA 3M1ZA 2A6NA 1W37A 2GJNA 5G1TA 3UWWA 3W1MA 1IXPA 2QCGA 2YCEA 1TO3A 3W9ZA 3ELFA 1B4EA 3G1FA 3QH2A 4OV4A 3G18A 3W7GA 2HMCA 4MLRA 4O1AA 3S5ZA 3S9YA 2D73A 4JTIA 1JVNA 3KVMA 3P5YA 2JKAA 1SZEA 3HGRA 2YSWA 1RVGA 2DZUA 1PL9A 3LI1A 4JTGA 2H8XA 3TW6A 3O63A 2ZRUA 3KRSA 5FF2A 4PL2A 2QDGA 2C16A 3W73A 3KHJA 2A21A 3BW2A 5U7SA 4X9SA 1GG1A 4BWLA 3EX2A 4IMEA 1LLWA 4M6QA 4FB7A 4FX6M 1LP6A 1MEHA 3EXSA 5F2MA 2X2GA 1TMHA 4JY9A 3O16A 3P61A 4NUWA 3HG5A 4K39A 2ZZ1A 4O1DA 3GDLA 1L9WA 1PS9A 5LNRA 3G3MA 3WK2A 4TIMA 1WV2A 3HQ1A 3QMRA 1V5XA 4Y96A 2PURA 2VFEA 4Z1CA 4LS1A 2YPIA 3ZR4A 1GT8A 4LV4A 3DXIA 3K30A 4BR1A 3TROA 3SY5A 3STGA 3TSBA 3KRUA 1VLWA 2RDWA 4IPJA 2CZ5A 3CLMA 3CWOX 5F1VA 2V2DA 1OJXA 5LGXA 2J24A 1UASA 1LTDA 1KM6A 3HPXA 3IVSA 1OVDA 4PCFA 5HUOA 4KWWA 3GNNA 3B4UA 5C54A 1KM4A 2V2CA 1G4TA 5D03A 2C3ZA 5I3KA 1LRTA 1WOBA 5CZJA 3SW6A 3RLUA 3NOEA 3GIYA 4AF0B 5K3VA 5D30A 4UR8A 1JULA 1A5SA 3QSTA 1OFPA 1FDZA 2NX9A 3THQA 2E5BA 4K8EA 3N3MA 3LHVA 4R53A 1Q6LA 1W54A 4X3ZA 4LUJA 5FESA 1JUBA 4DXVA 1I2PA 4YCOA 1TTJA 2BXVA 4QNWA 3MW7A 4UXDA 3MP3A 4LRTA 2QJIA 5AFDA 3TFCA 1TV5A 4LVGA 3P67A 4PFMA 2R14A 1DORA 5KZMA 3L9CA 5KSWA 4NNBA 1RV8A 1DJQA 4Y90A 5GVJA 1TPH1 3LTPA 3W7IA 5KITA 3BV4A 1RR2A 3ZWTA 2E6FA 4ADSA 2ZTKA 1F6KA 1TPC1 2ATSA 1YXCA 2CLHA 4XKYB 5G4EA 3M5XA 3S5NA 1YDOA 2DP3A 3GYEA 5AHLA 2QCHA 2V5BA 3LRMA 1YTDA 5DBTA 4YMZA 1ME8A 1I4NA 2DU2A 2DJLA 3TJXA 1K02A 1R2TA 3B05A 2ZZ2A 2AAMA 4O4VA 2JKPA 4LUIA 3F1QA 3E02A 2P1FA 4RX0A 1OHLA 2PC4A 4WY0A 1FWSA 1EWDA 3G0SA 3S0CA 3NO5A 1KW1A 3L5MA 4JS3A 3DGRA 3LCLA 3TW7A
chains in the Genus database with same CATH superfamily
2C8NA 2HDJA 3KBVA 4X2PA 2WHKA 2OKOA 1R87A 1OYBA 2F61A 4LU0A 3MVIA 4NJHA 4AZBA 2PF8A 3OYZA 4OVXA 3GUGA 1M7PA 4WKAA 3GVVA 4O16A 2QF7A 4NXKA 1EBGA 1SFSA 5IBXA 1G01A 2WMJA 4ES4A 1FWBC 3RU8X 4ECLA 1ZJAA 3AYVA 3TQ0A 2W63A 3P6LA 1HVXA 3WNMA 4CNTA 1NH6A 4XWUA 4WDUA 2VEFA 3WH9A 3KBWA 1KXHA 3IVTA 2OG9A 4FIRA 1UUMA 4M8UA 5TAOA 3GXPA 1XLIA 3QXBA 3WELA 3H7RA 3PUEA 3T2OA 4U3AA 4PUEA 3WBAA 1LRQA 4PSRA 1G94A 4AIEA 3FY1A 4XD4A 3MWAA 4WCJA 3TYAA 3G2GA 1IIGA 2R1LA 3URQA 3H8AA 4ZODA 3LM3A 3M5ZA 1ISWA 4I8DA 4JTAA 4PMNA 1M6JA 3VNLA 3KS6A 4DXKA 3ARXA 1CGVA 1NP2A 1XDLA 3AWOA 1R3SA 4K7YA 3F2CA 4PUWA 1MXDA 4NZ5A 3SDOA 2CHNA 1QT1A 2WCAA 4C6DA 3UWYA 3XISA 2X1SA 4F9DA 2EKGA 2RDXA 1K9EA 4H41A 3PNUA 5C70A 3EWXA 4F79A 3AIEA 2DZAA 1TTIA 3G1DA 3IACA 3NSXA 4X60A 5ABFB 5HAOA 2HISA 1Z8AA 2GUBA 3TMLA 3GG8A 4DUOA 2BGNE 4JKMA 1S1PA 4MYXA 3ARPA 2BY2A 3T09A 4C6BA 1RBLA 1IXOA 4RE2A 2OVLA 1C8YA 3H21A 4LYQA 1BTMA 1SVDA 1AMYA 4I7VA 4GO9A 3VGGA 4LC8A 2JK2A 2VD8A 2WC3A 1DIKA 2ZTJA 4H8VA 3C0JA 4E2VA 3BTNA 2CIPA 4I5XA 3UR2A 1A5BA 2ASHA 3LLXA 2QV4A 2XH4A 3GG7A 3PSVA 2VTFA 5MHBA 1HO4A 3JW7A 1TQXA 4PBEA 1L6WA 4AHPA 1XKJA 4WK9A 1CXIA 4A8LA 2D0FA 4XO7A 3EBVA 1H62A 1FXQA 3T8QA 3S1XA 1FBAA 5CPQA 2IXUA 1QNVA 3UG5A 1JYNA 4I8YA 4JTUA 1UKSA 4HSOA 2VEKA 3WMCA 3QBUA 4PUKA 1XCFA 4M24A 3TK7A 4F0MA 1QI0A 5HMEA 3LMZA 1XLBA 1CB2A 4LYRA 2CFFA 4NASA 2AMXA 3OZPA 3U9IA 4MGGA 1K8YA 2EHHA 5CAKA 4ZOEA 4EK7A 3VX0A 3R6IA 4B16A 1MQQA 4NXSA 4NF7A 6TAAA 2YGYA 1XSKA 2XM2A 1E70M 3VMPA 1KO0A 2ZICA 1UBPC 4AZCA 2YDSA 4D9PA 2TRSA 1S5NA 2C18A 3L2MA 5EMJA 3KTCA 5JH1A 1GPWA 3A5FA 2C15A 1EGVA 3LUTA 1UUOA 1XBYA 2CITA 1W1PA 3DCPA 4ZO8A 1TMQA 3CGTA 4Q4QA 3LDVA 1LG2A 3DG7A 3W1TA 5I78A 1H50A 2ESCA 1FY6A 2D3LA 2GWNA 4IFKA 3AJ7A 3LCWA 2WO5A 2CPUA 2FB2A 3S4TA 3GX9A 1XRTA 1RHCA 3EOSA 4Y2WA 1XH2A 1E5JA 2B31A 1WXJA 4PYSA 1GGOA 2BVYA 5HWJA 1H60A 1BQCA 2A7PA 4QFUA 1SMAA 1QJWA 1FWCC 3H22A 3L21A 3M0IA 2NV1A 1E56A 4C6PA 4PTMA 3T40A 4C5YA 4MDOA 3QHMA 2PDQA 1UP3A 2Y8VA 3WF3A 4J9JA 5A2CA 1XH1A 4Y8EA 5DBUA 3S9ZA 3V1HA 2PS2A 3PWIA 1HKKA 2AMGA 1FWEC 1NJJA 3L4YA 2DIEA 4GY7A 1DXIA 3S8HA 3M41A 3KBMA 2J27A 1G1YA 3SFWA 1AL8A 3VFLA 3G3DA 4N9BA 4YYFA 4GG9A 1IR1A 1UWTA 5HA7A 4UQCA 4GCAA 4GY0A 1AW1A 5DMLA 3KUMA 5HJXA 3TC7A 2TPSA 3USZA 4B92A 1GKRA 3BSGA 1JCTA 1F61A 2VZSA 2OU4A 1AMKA 3UZ5A 4HA0A 4P8UA 4RXFA 4LT9A 2DZWA 3HB9A 4PTXA 4PSPA 3O0FA 3W75A 2VX7A 1ISVA 3O8AA 2HS6A 4HK6A 1ISXA 1QBBA 3W26A 2Z1XA 2IPJA 4Q8TA 2DZPA 3N4EA 3FOKA 3LENA 3WD4A 1QTWA 3SGGA 3PZOA 1IXQA 1FWWA 1V08A 4DVOA 3REQB 4KGJA 3RXZA 4S3JA 4WR3A 4GI6A 4IG2B 3VOFA 3GTIA 3T0TA 3TEVA 4H6EA 3W4RA 3EX1A 1TZZA 3LPOA 4GCXA 1U5HA 1F2JA 3WYZA 3SUWA 1A80A 3OVQA 3GU9A 4OOZA 2YOCA 4F0LA 3UJ2A 3P82A 2FDSA 1H0GA 2ZVRA 5G1MA 1YNQA 2VWSA 4CQ8A 3M46A 5FD0A 5F1UA 4S3EA 4Y8FA 3PZGA 1TV3A 1QU4A 2R6OA 2V5DA 3GG0A 2QYGA 3HFYA 2FZNA 1UP0A 3P3BA 1FFRA 2OGYA 4Q6JA 2GWGA 1OFAA 4UWMA 3MSGA 4GK8A 4DEFA 4S3GA 2R9RA 1M1BA 3AC0A 3B8WA 4IOTA 1ZRQA 1HN1A 3MYPA 5I3GA 2E6YA 3P84A 2QCLA 4OECA 2AGTA 4X9YA 3WLJA 7A3HA 4RNIA 1TV2A 3PS7A 1RUSA 3IRDA 2GJXA 3W2UA 3IARA 3W1NA 4C65A 1E51A 1CT5A 3DX5A 1UPMB 3KL0A 4XSLA 4FOUA 1OX4A 1P1XA 2Y7FA 1NF7A 4IIBA 4DJDA 2OEJA 3DG3A 1IR2A 2ZUWA 1CI1A 3DERA 2PWHA 4MYAA 1EBHA 2H8ZA 5A8GA 3FEQA 3FVDA 3U2EA 2BOFX 3ITCA 3B97A 4XTIA 1ZBVA 4CKQA 1M68A 1M65A 1JCYA 3KOXA 3FNDA 2HEJA 4JR5A 2CLOA 3VKJA 1OFDA 1RPKA 4BF9A 4M0XA 5I2UA 4HNNA 1SZFA 4CU7A 2RH9A 4Z2JA 3TJLA 1CZ1A 3PM6A 4O54A 5JH2A 6REQA 1EIXA 4NYYA 4AC7C 1XFBA 3C3UA 5AYXA 5D2XA 2J7GA 1RJRA 4FOJA 4IL0A 3DC8A 4TXEA 1YADA 3HQNA 1UKPA 2EPOA 3W7QA 2INZA 1M9HA 1R9YA 4H9UA 3BG5A 3C52A 3LCXA 3IJ6A 1GW1A 3JVAA 2W92A 3UG8A 2D69A 1EXBA 1H61A 2VRKA 3QC0A 3UZZA 1LLZA 1VFUA 2XFFA 3TDFA 4E2DA 1HT6A 4GABA 3IGHX 2OWXA 5CPOA 3ARWA 3KCOA 4IPLA 3VZZA 2RGLA 4AYGA 4PE8A 2V68A 2YBVA 1J01A 2Y63A 2HE5A 5TNVA 2ADAA 1XHGA 1Z41A 4J40A 1KFKA 1LUCB 4UB9A 4HPHA 1TWSA 2E6DA 4LSBA 2WC4A 3AMLA 3BMXA 4UQDA 4BWLC 4KH2A 3UWZA 1V93A 3MHFA 1W9BM 4LVAA 3M7SA 5EKYA 3WH5A 2CZVA 2ZUMA 1AK5A 2Y5EA 4QP0A 3VMOA 2XN1A 3MO7A 3HG3A 2QJHA 4XZ9A 2QUNA 1Z69A 2DSUA 1ZALA 2OO0A 3KLLA 1M03A 3H26A 4DXXA 4Q7BA 1V0KA 3QYQA 2BZNA 2Q8ZA 3UERA 5A8MA 1X97A 3VD9A 3UJSA 1T5AA 2WJEA 4DYJA 2CEQA 4AF0A 1XQKA 2IXVA 1EJWC 2C0AA 4NZJA 3UYIA 1AQ0A 2XH0A 1SW7A 2DPEA 1J10A 3N9RA 2YA2A 2A3AA 5HJYA 3B9DA 4LYPA 5KZDA 4D8AA 3VYLA 3M47A 1SW0A 4LANA 3T08A 1O4UA 4QE4A 2FTPA 1VPXA 5G2HA 5JQ9A 1LDCA 1R85A 3GR4A 3A13A 3G1SA 1XWYA 4K3ZA 3UCCA 2PTZA 4FI4A 4F2BA 1TJ2A 4BK9A 4XBKA 3W7CA 1ECEA 3VE7A 4REQA 3TTOA 2Y7GA 3T44A 5MKGB 3D3FA 4BKNA 3W2KA 3BMWA 4R27A 3LY0A 5HWNA 4Z2KA 3CPGA 5C8BB 1XW8A 1PYMA 3RJXA 4YXGA 1TWIA 2ABAA 3ITXA 1X7FA 1E3XA 3ATYA 4HYWA 3L4VA 3R79A 2FJKA 4JNZA 7PTDA 1QR7A 3R7MA 1XBXA 5A6AA 3L4ZA 3LK6A 4WQ6A 4O52A 1VS1A 4MWAD 2YR1A 3T6CA 1OQFA 4H4IA 3IIPA 3WNPA 5IOBA 3LSCA 3TSMA 1CX9A 1EEXA 1O7AA 2HVOA 4QM1A 4HZ6A 3SZ8A 2BLEA 1ZQ5A 2QCMA 3U2CA 3TC3A 4NNCA 5AHIA 3MPGA 1AVAA 5JU6A 2D3NA 2CCRA 4A35A 4L6OA 1VEMA 3DBNA 4TVCA 1HG3A 1I0DA 4JQ3A 5A2AA 1HGWA 3IUHA 4W8AA 2J8FA 3WNNA 1XRFA 2Z2UA 4LBSA 1P6CA 4ZR8A 2Y2WA 3CAQA 5T26A 3QR3A 2OGJA 1L6FA 5FEXA 1E5NA 4LW7A 1FKXA 1MQPA 3ZM8A 1OB0A 1SO4A 1MUCA 3GH7A 4ZQOA 1EP1A 5LHFA 5IBXC 4DF1A 3UA3A 4B9ZA 2ISWA 1QHOA 2ZFAA 4EIVA 1WA3A 3LEPA 3W72A 3QOKA 4UR7A 2DZSA 3LSBA 5GNXA 1QAPA 1KWKA 4FP1A 1LM1A 1OADA 2Z00A 2Y1HA 4I5UA 1S39A 3LA4A 1X7IA 1XIMA 1EUAA 3PTDA 1OF8A 4FNRA 3BC9A 4BZYA 3NFUA 4XTDA 3PHAA 1LL4A 2YA0A 1EC8A 1TR1A 3VAVA 1VGAA 3V5CA 1XLMA 1XLKA 4AX7A 4A29A 1FWGC 1PTAA 3EWZA 4YTQA 4XD6A 7XIMA 1LOQA 4L80A 4UTTA 1TREA 4NVTA 1IGWA 3AJXA 1XICA 2X7WA 5ABFA 4AHOA 4A21A 2HV5A 2EKCA 4IPIA 3OQEA 1HKJA 1AW5A 5D05A 4UFJA 5EGRA 3QQ1A 5DLCA 2OWWA 3BCJA 5DXXA 4Q8MA 3GRIA 1JRCA 2W61A 3TR9A 3N2CA 5BU9A 4GVIA 1LT8A 3M5VA 2Z2AA 3A4WA 5I3DA 2E6AA 3ATZA 1TPWA 1GOOA 3O6AA 2Y24A 1CGXA 1GKPA 3MMUA 1TMLA 5BOEA 3W7OA 4B3ZA 2PWEA 5T8GA 1V8EA 4N4QA 1YPXA 4K7VA 4H00A 2YFNA 1OT1A 4MY1A 3RGTA 4E4UA 4M82A 4EWJA 1H63A 6TIMA 3LQGA 4PODA 1KFEA 3LPGA 4D8ZA 5IFTA 3PFMA 2BY3A 2QPUA 3NQMA 3VPLA 3SCWA 1XCXA 5BRPA 2E7FA 2VC6A 2FH6A 3RLHA 5BWFA 3PBWA 4BHYA 1EPXA 3WUFA 4RNFA 3FA4A 3HIJA 4LF1A 3UGVA 4GJJA 4UBPC 3NOYA 3WF4A 1GZGA 1Q45A 4J1OA 1JF6A 3VU2A 2E1WA 5K9DA 3QKEA 3MUAA 3QR0A 3OU8A 4J4KA 4XG1A 3WBYA 1BWKA 3EOEA 3W1QA 4F40A 3TYDA 3O9NA 3U0HA 3QY6A 2WOQA 3ALGA 2UWFA 4ROQA 4JL1A 1KM1A 4IGHA 4WIWA 2XG9A 1AODA 1HJXA 3DFPA 1YYAA 5FJJA 3UPWA 4C6QA 4JY8A 1ONEA 3BWWA 1N82A 5JIWA 1JZ7A 4V15A 4NZCA 1C7SA 3VNJA 3E0FA 2FZBA 4W84A 1EB3A 1W1YA 2DSWA 1JCXA 4L9YA 4KFPA 3MUIA 2QUTA 3W84A 1RH9A 3LBMA 3SADA 1BEUA 4WGXA 5AVNA 3OIHA 3Q67A 1E4MM 3NSMA 3H54A 1S5VA 3R58A 3ZJ7A 3EWDA 2P5NA 4ACYA 3V3WA 2PI6A 3MP5A 1GORA 2CETA 4FEZA 5GJNA 1UC5A 3LGEA 2P88A 3ONCA 3LBOA 3U4AA 2QCEA 4HK5A 1V02E 1AA1B 3SBFA 2DJXA 4LBUA 5IM51 3TZFA 4Y6GA 5AY7A 1X8CA 3CHDA 1JNEA 5D04C 1UPPA 4TX8A 4X22A 4ATLA 3V7PA 4PMDA 4XBJA 2RHGA 2BP1A 3A22A 3R12A 4GI8A 1DJGA 3R94A 2KX9A 1SJDA 3TMQA 4M7SA 3CU2A 1AQFA 5LIUX 1S3HA 3NQAA 4CNUA 3RNDA 2XYLA 2D20A 3SGUA 4JXCA 4HB7A 2GUYA 4KRUA 1PIGA 2QPXA 2VENA 1I1XA 1B2YA 4JYEA 2ZUUA 3T0BA 5I3FA 3FYYA 1VHNA 5KTLA 3GBEA 1SM9A 3QEZA 4LH8A 4IIHA 2GVYA 2VI0A 3QSRA 2FYMA 1V77A 3KXQA 1UA3A 4N2YA 3O2LA 3QVQA 4MOZA 3EZ4A 4CD6A 4PUDA 1F76A 2V9DA 3EEGA 1YXYA 4Z2IA 3VIIA 4M56A 3NPWA 3OJGA 1EYWA 3LCGA 4HTYA 2WMFA 2YB4A 2VJXA 4OFCA 3REQA 1SJAA 4PRRA 4X2RA 4AISA 3IJIA 2OWCA 1L0PA 4A2RA 4E2OA 2E25A 4IG2A 2QMKA 3VOGA 2P76A 1B3ZA 4KWSA 1GQNA 3R8RA 1TE1A 3ARTA 3D0CA 1DYSA 1JYXA 3IK2A 5CLTA 2PMQA 4GYPA 3ITVA 5FEWA 3S47A 1EJSC 2H3DA 2I56A 1VFTA 1SZRA 3C0LA 4DWSD 1C8VA 1O1ZA 3V18A 1W9PA 3QQ0A 2BB0A 3LI0A 2CKSA 5A6BD 3AMDA 4B2DD 4ZFMA 5XIMA 3AWNA 4UMCA 1HP5A 1BYBA 4D8LA 3AIRA 4BEQA 2R94A 3MJMA 5PTDA 4AHQA 3PSWA 1OY0A 2FPTA 4UFLA 4Q4SA 1FCQA 2BTMA 4GJ1A 2ZX5A 4B5XA 4LAKA 3UVAA 4DAFA 1TPVA 2BODX 1GEQA 3AS2A 3KBJA 3PZMA 1DE5A 3GKFA 3R8GA 1VFMA 1FHUA 3C3NA 3G1HA 1VYPX 1TE6A 3ERPA 1WBJA 2I9EA 1OC5A 4ADUA 1U30A 2VRJA 4M19A 2VCAA 2VZTA 4MLJA 3W83A 4Q7NA 2R1KA 1G4SA 4N4PA 4XZIA 4P5UA 2QULA 4LUYA 8CGTA 2GGEA 3BAYA 1OEPA 1RQBA 4MWAE 4UZUA 1W5NA 1BVNP 1PB0A 4YVVA 3S3GA 4KERA 2W66A 2F2HA 4E6MA 4EXAA 2I7GA 1UOKA 4NZFA 3OZMA 2V81A 2FTYA 1CDGA 1CGWA 3GNOA 2H3BA 2GGHA 2Q09A 4W87A 3EKZA 3NZPA 1UKQA 1EYEA 1H4PA 3B9EA 5C0QA 4O11A 4EKJA 4M81A 1C8XA 4MUZA 3A6OA 2J75A 4DJDC 4OU1A 2C14A 4PMVA 4M3PA 1X96A 3UW6A 4W86A 4J27A 5EMMA 4GQGA 4EAMA 3IJLA 2OMAA 1RQEA 3FDGA 5H8PA 5T91A 2WMGA 3VGDA 4MIMA 1US3A 2MUCA 1HZYA 1QW7A 2A85A 3PG9A 3GXDA 3L2LA 2ZZ7A 5D8WA 2BVWA 1F73A 1ISZA 4FXFA 1H7WA 4XUGA 4AUBA 4O8RA 1TX2A 4KESA 2DGAA 2HBXA 2V5LA 5HULA 2FVMA 1VIWA 4C7FA 2QW5A 4MJ4A 3NQFA 5LA1A 3FGCB 4FNTA 4WD0A 4LAOA 5EY5A 1P7TB 1RD5A 2ZCGA 3SRKA 5DCEA 2B7NA 3ZSSA 5M3WA 3W74A 3TTYA 1LUCA 5HQEA 3BW3A 4GVGA 1EP2A 4GQQA 2W27A 5GPRA 3UGRA 4A4AA 4I9JA 3WLNA 4OUIA 4JL2A 1CIUA 2PDIA 2P0OA 5I77A 2Y8KA 3EWCA 3M0HA 4GIRA 4GZEA 1HGYA 3PZUA 4KCTA 2X2YA 1W2VA 4F0KA 3ES7A 3VIHA 1AW2A 3NZQA 1P0BA 3R11A 4B9YA 4NHVA 2WW5A 2O4MA 1BF6A 1HUVA 2RJHA 3IVUA 3SN0A 4M5PA 5C9WA 1HO1A 1ZGDA 2GQ3A 4CQDA 4WOQA 3B0VC 1XDMA 1FH7A 4MG4A 1AJ0A 1TJPA 1DQUA 3AYSA 1MZHA 2A3EA 3SR7A 2ZDSA 1KD0A 1MXSA 1MSSA 1S2TA 2X09A 3QLLA 2XIJA 2EF9A 4NKCA 4IJRA 3V0UA 3SI9A 3SIZA 1JZ4A 2OQHA 5JVLA 3KVKA 4O19A 4ZE4A 4PCTA 2FIQA 4AD4A 1T96A 3PBMA 4ZBCA 1GVYA 4C6LA 2VC9A 4RDWA 2BS9A 3MY9A 3PC0A 5EPDA 1XM3A 4QXIA 3GVWA 2EBNA 3BICA 3VNIA 5MKGA 3EA2A 1NDYA 4Q8UA 5HQLA 2RAGA 4RE0A 1H1ZA 2B7QA 4YWIA 3BLKA 2J78A 2XINA 3KAOA 1DWFM 1UR4A 2QLYA 1LQAA 3TW9A 1OSEA 1GVFA 3R2GA 1RCOB 4ACZB 4H8HA 4ORMA 4CN4A 4JIQA 4KF1A 4XD3A 1YTKA 3MT1A 1F9CA 3THCA 5HR6A 4O15A 1L8NA 4YYCA 4LB3A 2OZTA 5AOUA 4B4HA 1EHNA 1H7XA 3N9KA 3O05A 3I10A 4O4WA 1HW6A 2O0TA 2ICSA 1W37A 3W1MA 1MUMA 3W9ZA 1HJUA 3G1FA 3W7GA 4GI9A 4MLRA 1BSLA 4JTIA 3P5YA 2X0YA 3KWSA 1HJQA 1SZEA 1NWTA 2NW0A 3K5XA 2YSWA 1FH9A 4JTGA 5E6YA 2VUNA 5FF2A 2YDRA 3W73A 4L9XA 4G9PA 5U7SA 4HCLA 3TZNA 3CO4A 3EX2A 2AAAA 2GFTA 4S38A 4FX6M 1R86A 1MEHA 5F2MA 2X2GA 1Z6KA 3EMZA 3P61A 4QRNA 2VZVA 1HKIA 4K39A 3WN6A 4PMYA 6ENLA 4YTRA 3H7UA 1L9WA 4TIMA 1AJZA 3HQ1A 2D0HA 1V5XA 5T9BG 2VFEA 1AD4A 4WDXA 4HJWA 3G6MA 1HP4A 1GT8A 3DXIA 2XSAA 3STGA 1VLWA 2RDWA 3CLMA 4QG9A 4A8NA 3ITGA 3CO8A 2J24A 1R6WA 4QS6A 5A6BA 3QZ6A 1LTDA 1KM6A 4GVFA 1XIJA 3GNNA 3B4UA 1T7LA 5C54A 1KM4A 2J4GA 1LRTA 3VZXA 1X38A 3VUSA 2WNWA 1J0HA 1A5SA 3S1GA 1DWIM 1FDZA 2NX9A 4K8EA 3N3MA 4JQ4A 3KHDA 1W54A 4X3ZA 2X05A 2V3DA 1JGIA 3L4UA 1I2PA 1TTJA 4N7QA 4QNWA 3MW7A 2C7FA 2X8RA 4AWEA 1JDCA 1EDTA 2WJDA 3M0XA 2E28A 4PFMA 3SAZA 1XIDA 1JDDA 3G5EA 4J3SA 1AQHA 5HMFA 5KSWA 3AU2A 3Q45A 3II1A 5A8PA 4W89A 3BV4A 4LUSB 1JZ3A 2Z1KA 4RDZA 3ZWTA 4ADSA 1OIMA 2VYOA 5IDZA 4R88A 3SSZA 1NFPA 3VGBA 2ATSA 1YXCA 2CLHA 4RPPA 1KCXA 4XKYB 5DRCA 5G4EA 4HGXA 4NI3A 1MQRA 1FWHC 1KR1A 4G2DA 5C7HA 3LRMA 1YW1A 5DBTA 3WQOA 4PB3A 1ME8A 1UH3A 5CBIA 2DU2A 3CUHA 3UXLA 4FLRA 5EU9A 3B05A 4R85A 2ZZ2A 2PDFA 2P1FA 4MB5A 3GHUA 5GNZA 4BQ5A 1EWDA 3G0SA 3WD1A 2HQAA 4IFOA 3L5MA 2NQ9A 1GYMA 4MNJA 1GHRA 3IS4A 4YVXA 1K4HA 3U3HA 3WQWA 1ADSA 2PU0A 1E6SM 2QHAA 4PR4A 1S5WA 3JZEA 1Q7MA 1BAGA 4P7RA 4PEKA 5FJTA 1ENUA 1Q85A 3HO8A 3VIGA 2FZDA 4W5ZA 2AL2B 1XCWA 2GDQA 5H91A 3N13A 3EPOA 1RK6A 1DJNA 1V0LA 4HMDA 3UESA 3W7LA 2Z6JA 2ABBA 1U5VA 4CGTA 1N8IA 3NPVA 5FOOA 1XJBA 1OYAA 3GXTA 1FH8A 3PFRA 2JF6A 3UP8A 4WF7A 2VQUA 2VOTA 3CH9A 3I68A 4J5NA 4C6NA 1A5AA 5M2FX 4PC8A 2DY3A 5BOOA 1GTEA 1OD8A 4FA3A 1ITXA 3G1XA 1XD1A 1VC4A 4JNMA 2F84A 3O06A 2ZZ5A 4KCWA 3I4KA 5FKYA 3TAOA 3SO7A 3SCSA 4HU0A 1GYLA 1XXXA 1WDRA 4WKFA 3S2JA 1RAKA 2DZTA 4JHOA 4UTFA 2J8GA 3U2OA 4QCFA 1EWEA 1LF1A 3AXIA 4XZMX 2WSYA 3EX6A 4QJ5B 4IQJA 3T05A 3ANVA 4Q4RA 3QMTA 2HPMA 4AXNA 5C2GA 2QUUA 2WZTA 1CXLA 4RE4A 4YTSA 4Q6XA 1FOBA 4O18A 1NWRA 5F4WA 4A3QA 1UP2A 1JCMP 1AJ2A 1IYXA 1ZJHA 3B9AA 2I5QA 3KOFA 1QDSA 3GW0A 3SQSA 1BVZA 1QCWA 1REQB 3QC3A 3V75A 4DBSA 1UBSA 3BW4A 3V5FA 4K8HA 4WVXA 3TN6A 2OQYA 3ABQA 1PZ3A 3UVIA 1V03A 3IV3A 2C1HA 1VENA 2PCEA 3W7RA 1A50A 1PHWA 9XIMA 2XGIA 1FWTA 5FF3A 5A6KA 2Y85A 3NQ7A 1W3HA 5CC6A 1EC9A 3C0QA 3B06A 2BASA 2IQ0A 4OBTA 3C2YA 4WGHA 1IF2A 1P1MA 2YCLB 4RPQA 4WSHA 1YDNA 2XIIA 1R0MA 1W9XA 1XYAA 3JRKA 1FP8A 4FLSA 3SIMA 3LCHA 1JXJA 2NXHA 4JBRA 2V8ZA 2GGJA 3MSYA 2HNEA 2PU1A 3CAVA 2WWCA 5E70A 4GE8A 4UTWA 3BJFA 4QLKA 1ZZMA 1WYIA 1DHKA 3QJAA 1TCMA 1XLJA 5M17A 4DBUA 4OE7A 2C1GA 3FSTA 1UMYA 1TTQA 3PUDA 1AH4A 2W0UA 3HMJG 3NA8A 3UZYA 1HX0A 1KBIA 3E6EA 2Y70A 1JQVA 4H19A 4QTGA 4PMUA 3UJEA 3EX4A 4JYDA 4HCHA 2PLKA 4PFHA 2BSLA 1KWGA 3OA5A 4O13A 1PEZA 2YL6A 4GIEA 4GH1A 3W27A 4O8AA 2W91A 4JTCA 3A3HA 1F7BA 4QR6A 3WY1A 3M0VA 5LXXA 5CSRA 2NUYA 2IQTA 3A47A 4D6HA 2PTDA 1OFEA 2GQAA 3WNKA 3W29A 3EA1A 5FA5A 1IEXA 5U4NA 1N8FA 1W3TA 1IT8A 2J66A 4Q8QA 4EPBC 1A0EA 4PCNA 4US5A 1TSIA 4CD5A 2ACSA 2VCCA 3W07A 3RDKA 1KXTA 3VNDA 1KBBA 3QFWA 4HA4A 3VNMA 4DZIA 2ZUTA 1W3KA 2E1DA 3ABZA 2ZKMX 2Y6ZA 3CPRA 1ZENA 1V51A 1M3UA 3OGRA 4F2TA 1PCKA 1UC4A 1A5OC 1P4CA 3S5YA 2BMBA 4RLIA 4B5SA 4W85A 3GU2A 4IMGA 4DHGA 3WEOA 3HG4A 3GC4A 4S23A 1OFBA 4UCGA 1KLYA 4UNLA 1OT2A 4S2CA 5AVHA 4Z1YA 1DV7A 3UT0A 4A3HA 4TX6A 4HVXA 4GWEA 1IWPA 5JIPA 4INFA 5CKSA 3IIXA 4XZWA 4QDMA 3UY7A 5IFPA 5LA0A 4FX7A 1YHTA 3KW3A 1V3LA 3E5BA 3AU6A 2XWDA 2QZRA 1DJXA 3R5EA 2ZBTA 4GFSA 2Z0IA 2F6KA 4V1YA 4P7LA 4GUIA 4ZXLA 2DVTA 1H3GA 4LB4A 5C2CA 3I3EA 5CLWA 3MANA 1RY0A 3CMJA 2YA1A 5EBUA 2CZDA 1L2UA 4IQDA 4DN1A 3I4EA 2NUWA 4ORIA 3AOFA 4KEUA 1EA0A 2HTMA 3H4WA 3CUIA 1SUXA 1CCWB 1TJ1A 3EOUA 5F2GA 4CCEA 1E6RA 4H7ZA 1P7TA 5CJ5A 1V3KA 3WJSA 4CNPA 3F4NA 1OC6A 1MFVA 4I6VA 2Y89A 3C8FA 2GK1B 4IGSA 2PTXA 3S6OA 1E6ZA 1EJRC 2XSXA 4J28A 3G8EA 1LYXA 3WNOA 1L6SA 2PLJA 2C6QA 1NAL1 3DOPA 2E8ZA 1RSCA 4C5ZA 5BXPA 4HU4A 3RM9A 4C60A 1W9DM 4RW3A 4V27A 4GNKB 4Q4MA 2Y88A 3F7JA 2J74A 3HPSA 4KGLA 2WZEA 2OT0A 4LQ1A 4ML4A 4LEFA 4LS2A 3NQEA 3EOOA 1HKMA 4ALDA 4MPQA 2QAPA 3GTXA 4MM1A 2JIWA 1LWJA 3QLDA 3T2QA 3QM3A 4FF5A 5LXEA 2XUCA 3CQ0A 2VDIA 1B3XA 3V5OA 1JZ5A 2VGGA 1VPYA 1X6LA 2KAUC 2P8BA 4ZSUA 3G77A 1LOSA 4FO4A 3OYXA 4M7TA 4JTKA 4AY7A 1O95A 3PJWA 1IEIA 1ZJBA 4MNLA 4HNOA 4UQBA 3WIJA 2G0WA 1E9LA 2FPVA 3TH6A 3TN5A 5E9XA 1UOZA 1UYQA 1PKMA 5FJIA 4KS0A 5K9XA 3W1RA 3K1GA 4MF4A 5I3IA 4XUYA 3P60A 3APTA 3QV8A 3W7KA 2DZBA 4C7GA 4J3VA 3MKVA 3PTMA 2AKMA 3TAKA 1JI2A 3A9IA 4ACZA 2QMJA 4DB7A 5CSSA 1H7OA 4Z0SA 3GO2A 2W62A 5HNRA 3PB2A 4EXQA 3GW3A 1SZNA 1Z48A 2WJFA 3P0XA 2PP0A 1MYRA 1KQZA 1X1NA 1QNOA 2XFYA 3FYPA 4H6KA 3KP0A 5TIMA 3W38A 2QR6A 3MBFA 3DUGA 3IV8A 4ZQNA 1R7OA 3KLKA 4PMRA 3RFAA 3DI0A 1EXPA 3W7HA 1ECQA 3C4UA 5D9MA 1W8GA 2AL1A 4ZEPA 4E8GA 1OFOA 1RPXA 4JFTA 1Q7QA 3IJ7A 5BZAA 2QCDB 3GLCA 1PVNA 3LU2A 5L9FA 1CPUA 1JJKA 1D3CA 1TELA 4K36A 3N14A 4DELA 2OLAA 3ZJ6A 4HNLA 4LAZA 3U48A 2C19A 1Z32X 2F6XA 3VOHA 2EPNA 3SUSA 4MY9A 1QI3A 3BJSA 1R7AA 1PIFA 3DDMA 1OM0A 2PWGA 1ZNNA 3TJIA 3LCIA 4QE1A 4Z2GA 4DO5A 3B9OA 4DUWA 1A3HA 2QIIA 4C91A 1SFJA 4AQLA 1BPLB 4JOMA 4M6UA 5D33A 2XVLA 4UCFA 3VNYA 2PWFA 3SY8A 2VVSA 2R1MA 4U10A 4H83A 4JHZA 2JEQA 1GJWA 4LY4A 2PGWA 5EB8A 3OBKA 1XINA 2POZA 4LCRA 3FIGA 4ZMGA 1UKOA 4MAVA 2X1UA 4I90A 1N55A 1T40A 4IMAA 3BZGA 4H9TA 2OLSA 1ZBKA 3WQVA 1OWQA 3NAVA 4JHMA 3W6LA 4IXXA 4MPKA 4Q32A 4FALA 2E40A 1FRBA 5DT5A 1V0MA 2DUXA 1QFEA 3WLIA 3VDCA 3FJNA 4QHRA 2OYKA 4RXGA 1GOMA 1DHPA 3IJ8A 2R1PA 4DJFA 5IRPA 1J5SA 5FCZA 3B0YA 3CS2A 1P0EA 3QPEA 1IZKA 4DNMA 4HT3A 3VOIA 1QASA 5F4XA 4J3UA 3D6NA 1Y0EA 2NZLA 4MJMA 1KRCC 1Z3NA 4RDYA 4EPKA 1WPCA 3ZVHB 3NGFA 1GPFA 5K7JA 1X1ZA 2AOSA 3L65A 4LUSA 5AYBA 2H6RA 3BLIA 3AZRA 2DZVA 1ZAJA 2IKHA 5G4HC 1XRVA 2GSJA 3GZAA 4XKYA 1GOWA 4ZTYA 3W71A 3PUOA 5DANA 5I09A 3GHSA 3R25A 5H6HA 2VELA 1JDEA 3KCJA 2ZE0A 3HURA 1K9TA 1F74A 1R3RA 4I9MA 2CXEA 3WG6A 5FACA 4FNPA 3MCOA 4H7VA 4MADA 4A3YA 2VDGA 4X61A 1WUFA 3IAPA 3VKBA 4CQ9A 2DSKA 3M44A 1WZKA 1SSDA 3P8JA 3HOJA 4ZQPA 4ZSTA 2WM0A 1H7RA 5H8MA 4U28A 1L6GA 1EOMA 1JNDA 3OBEA 3N17A 3T78A 2QJNA 4IMFA 4HTBA 3RRAA 4C90A 2HE8A 4MHBA 3P2VA 1R5YA 3PN8A 2P3EA 4NT0A 3BG3A 3RYSA 2FHFA 3JR2A 4RUBA 1XLEA 1SFLA 2AL2A 1VQTA 1QK0A 4QIUA 1CLVA 1MNZA 1FHLA 4KEVA 1IIHA 1GOXA 2ZYFA 3A5VA 2VEGA 5D4YA 1C9WA 4KFNA 8XIMA 1XGEA 3DYMA 4QAWA 3AXHA 5BMXA 3UZWA 3GNRA 3OBAA 4G6CA 4R3UA 3GG1A 2EGZA 4Z1BA 2FGZA 5HMDA 1DP0A 2VT0A 4Q22A 1TWZA 4S2BA 2XGZA 1A3XA 3CYVA 3VUPA 2GVLA 3ZT7A 1PZ0A 1UD6A 1ZU8A 4G7EB 1SFTA 1F8MA 4NZ3A 4ZO7A 1NQKA 1CWYA 3RM4A 3W7MA 3DFHA 2VR4A 3WF2A 3APGA 5KZEA 1W5QA 3IIOA 4I9TA 2HJPA 4NZ1A 1QWKA 2YXXA 4IPNB 1U1HA 4KWVA 5E0KA 1TIWA 1KKRA 1Q13A 1E0UA 1R2SA 2OFJA 4DNHA 1CXHA 4U5KA 3MSRA 4D6EA 3VD4A 4P8VA 1TB3A 5FI8A 4EVZA 5D02A 2B4GA 2QIWA 5F2IA 3R0DA 4DIAA 1M01A 3OODA 2XDFA 2PDCA 1F3XA 2V3GA 1LBMA 4AXKA 2WKJA 2XIQA 3OW1A 2Q02A 4MKNA 4C1NB 1REQA 3AS3A 3G0XA 4PB4A 1G0CA 5LNSA 3WF1A 1KBKA 4OBSA 1DTUA 5DMYA 5B7ZA 1E0XA 1E1CB 3SJ3A 4R7OA 1Q2SA 2G96A 2IPFA 3WD2A 1XIEA 4HMEA 5D9PA 1G6CA 3SURA 4UTLA 3F4WA 3TU9A 2XGBA 3CUXA 4GUJA 3BK0A 3CWNA 2YCLA 1GCYA 3ZIZA 3E2VA 3S2NA 1W31A 1KGXA 1UH2A 3STFA 6PTDA 2CWNA 3ZYZA 3ABRA 4DF0A 4CVWA 3VNKA 3EDKA 5M03A 3WLPA 3BH4A 2EO7A 3NQVA 3BLFA 1EX1A 2XWEA 4N6EA 1B3YA 4K2SA 5LGZA 4JIHA 1UD5A 7REQB 3S1VA 1HJSA 3N4AA 3VMNA 4FZIA 2DW7A 4WXYA 1S2UA 1V4YA 4G7FA 4HOZA 2VFFA 1KGUA 4PTNA 3L0GA 4UTWC 4JN6A 3PUGA 4NL1A 3NQDA 5IDIA 2WVSA 4YN5A 4ZVJA 5A8NA 2C0HA 2VL4A 4LWWA 2WPBA 3IJDA 1V0NA 2Z24A 1POKA 1MI3A 4JIPA 4GXPA 1Q8AA 3MQTA 1JUKA 3BAKA 3V36A 5ABGA 2RJGA 4US6A 1IV8A 2CLEA 5HR7A 1C93A 3LBCA 3NQCA 1FCVA 2E0PA 2O9RA 3LZ3A 5LNVA 3WKZA 1NELA 4AVNA 1VP5A 3F5LA 1YMYA 1YE4A 3THAA 1K8ZA 4IIDA 1H51A 3NQGA 3BZJA 3ES8A 3QTPA 1W0MA 2YBTA 1POJA 4GIAA 4K38A 3WNLA 3S6DA 1CEOA 3W37A 2J7EA 1LL7A 3VK5A 2ZZ6A 2AQVA 1TUFA 3DHDA 5I07A 5LIXX 1J2BA 4JFUA 1KA9F 1SSGA 4GYKA 4WZHA 3WK3A 3G6LA 2J7DA 1LL6A 2X0HA 3QF0A 3MC5A 3BOFA 3WK0A 1FWDC 5LIWX 1UG6A 2PTYA 4QE5A 3W23A 2CZEA 1DIEA 2QV5A 2GJPA 3EWYA 1OGGA 1LQ0A 4PUUA 1SR0A 2F38A 1PV8A 1VBGA 4NX5A 1XG4A 2YYTA 2ISDA 4TMBA 4H01A 1KTCA 1F4HA 5I5RA 3UJRA 2V67A 4NP7A 5I79A 1EC7A 3U6WA 5C6MA 1J0ZA 3XINA 4JAWA 2NWRA 3UR7A 4F2UA 3F5KA 3DYPA 2XJ7A 5H2ZA 3O07A 4W5UA 1VFLA 2WVUA 4I9AA 3M0KA 5CG0A 1ICPA 3EX3A 2E77A 2DFAA 3FYOA 1JF5A 3DAQA 3LXCA 5ECUA 2QDHA 2ZX8A 4KMQA 3RX2A 1NFGA 1WKFA 4PCPA 3TTEA 1K9FA 1EKOA 2VX5A 2BVTA 5CC3A 1I2OA 3PY2A 1QOPA 3C2EA 3HGOA 3PTQA 3ZJ8A 3CNYA 2QCFA 4LS0A 1KV5A 1LJYA 5AHEA 5F7UA 2YFOA 4IL2A 4IP5A 3WL0A 2HZGA 3CV1A 5FSEC 1SJBA 4NU7A 2HSAA 3A24A 3KRBA 4WUIA 5CPNA 2PZ0A 2GK1A 2VC7A 2RUSA 3SRHA 1BXNA 2RDTA 3WJWA 4GA8A 4HBKA 1VFOA 1RJQA 5E93A 2NX3A 1UH4A 3STCA 3VI2A 3AFBA 1VIZA 1TWDA 1PIIA 2HK1A 5BNKA 1NARA 4N9DA 1EP3A 4D2JA 3GH4A 1OK6A 4Y9PA 4QJ4B 3K4AA 2ZA1A 2DDXA 2BXZA 3C2FA 2CLMA 4ML9A 1HIZA 1CXEA 4UNIA 2HBVA 1D3HA 1SGJA 3CEUA 1XF0A 3H55A 5E0FA 3UJFA 4BS0A 3UYCA 4L6DA 3LXBA 3B8IA 1N8WA 4FS9A 1FWAC 3D47A 4AU0A 1VRXA 1PJ9A 5HUPA 1L6YA 1VAHA 3V16A 3NQ2A 4UMBA 1N7KA 3TQKA 3OA3A 2WPGA 4LAMA 3URAA 2ZRZA 4WSKA 1W32A 3VIKA 3N73A 3YPIA 5AHFA 1OD0A 1UB3A 2GGGA 1QHZA 3VIFA 2Y7EA 3AS0A 3H2EA 3AALA 3SUUA 2ZXDA 2YXGA 1P48A 1QO2A 4UTHA 1A5MC 1V6WA 1QW8A 3FAXA 5ABTA 4DJDD 3L4XA 1JUEA 2F9RA 2XM1A 2WQPA 3L66A 3VFCA 2J7BA 3UNDA 1E73M 2QQ6A 4GISA 2YJQA 5E5CA 4ERIA 1KB3A 2Q01A 3L5LA 4TTGA 1LBLA 4AZ5A 2HS8A 5XIAA 3ANYA 2ANUA 1Y5XA 1V79A 2BX7A 3T0AA 2E3ZA 4C1KA 1PTDA 4XZBA 4HPJA 4QBXA 4UFIA 2D1ZA 4FAMA 4C6MA 3LZ5A 4YHEA 1G67A 3NCOA 1FTXA 1TV8A 3A21A 4P2VA 2HVNA 1RZMA 4JFVA 1EGZA 2F2KA 4IT1A 4ATDA 1ZBWA 2OSWA 1CTNA 4IUGA 2OJPA 5KINA 3VILA 2FZ8A 4XAFA 2QCDA 1XG3A 2VEIA 3KTSA 1QPKA 1SO3A 2WNQA 1QWGA 2VXNA 3IRSA 3AROA 2NVCA 3W88A 2GQ9A 3PWAA 1CGTA 3GSMA 3N1AA 5DY3A 4LVFA 1W3LA 4JEQA 4IICA 2VM8A 1W5MA 4LAUA 3DI1A 1FXPA 2ZWZA 4PMOA 3ARZA 5C71A 3BAJA 1QNRA 2QXWA 1A49A 2FTWA 4KBXA 4XAGA 4PUNA 3O0KA 2GDVA 1E9YB 2J77A 1GZ1A 3PBGA 2DUAA 1CW2A 3EEZA 4JYFA 3TYUA 4NJKA 1PDYA 2J88A 5I7GA 2XHYA 4LCSA 1H7NA 2Q3RA 1S2WA 3HG2A 4YHGA 2W4XA 1ADDA 2INFA 3W70A 3TCEA 5KZ6A 1CBGA 3OB8A 3H6OA 2O55A 2W3ZA 2Y8UA 2Z2BA 1K4GA 4B3KA 3WH7A 1K8XA 3BLLA 1DJWA 3E9AA 4RJEA 2GOKA 3WLMA 2G3MA 4HNCA 2VZOA 4BJHA 3GQYA 2WXDM 4HN4A 5AB3A 4JIRA 3QV6A 1M53A 1XLGA 4P61A 1D2KA 2OO6A 3K8KA 4WXZA 1O6IA 4FLOA 1VFSA 1K77A 4L64A 2A7NA 1RCQA 3BLPX 1X1OA 3MU7A 4TV6A 2NQ5A 1UR2A 4FHAA 2ZUNA 4MDPA 1A47A 4AWSA 4HOWA 4UTUA 3I7QA 1GQLA 3CV2A 2GDUA 3V35A 3DFOA 4GZ7A 5I3JA 1QHPA 3GDTA 3ZVHA 2J25A 3BCFA 3TX9A 1KKOA 2DH3A 3P93A 1ESWA 1UZDA 4MUPA 2QUVA 3VVGA 4DJFC 1A5UA 4LXFA 4IIFA 2P3ZA 4NRRA 3AIVA 4D1IA 2A3HA 4I3GA 3I7SA 3W7JA 1ITQA 4XIMA 1WOAA 4AVFA 2IKIA 4AWTA 3A64A 2IKGA 4EF9A 4MB1A 2B7PA 3W24A 2MNRA 3BG9A 3HPAA 8TIMA 2G4JA 2FJUB 4H8UA 3W2MA 4I7WA 3FXYA 4FR6A 1E0TA 4GPNA 4RKAA 3N34A 4OKDA 3B40A 4Y9OA 1BRLB 1VYSX 3CIWA 3N04A 5BXTA 5TD4A 1VFHA 2XZ9A 2WKLA 2A6NA 1KC7A 2Q71A 3AICA 5G1TA 3UWWA 4S3FA 1IXPA 2QCGA 3DEQA 2YCEA 2HVMA 3ELFA 1B4EA 3G18A 1JPDX 2HMCA 3RLGA 3S5ZA 3N4FA 3R43A 2X7VA 3GTFA 4XAYA 4M1BA 1DPMA 2RGMA 3HM7A 3TW6A 4DM1A 3O63A 3MCMA 1WO2A 4PL2A 2C16A 3QGAC 1US2A 3B4YA 3BW2A 2VGIA 3KTXA 4JN8A 4P7QA 4P8WA 4IMEA 4DX3A 2TAAA 5GNYA 3EB4A 3ZVIA 3RJYA 1Q65A 4FR1A 2ZZ1A 2V5KA 4G7EA 3AXKA 3G3MA 2E9BA 1WV2A 3CZLA 1O5QA 2NVDA 4UQEA 4Y96A 3KE0A 2O4QA 3CZGA 8RUCA 3AIQA 2YPIA 1JAKA 1IQ8A 3K30A 3TROA 3TSBA 3TVAA 1BLIA 4IPJA 3CWOX 2V2DA 3WQFA 1GOKA 4KRZA 3BANA 2PLMA 4HOXA 3IVSA 1J0YA 1OVDA 2EJAA 5HUOA 1XLDA 4KWWA 4ZXOA 1E0VA 1G4TA 5I3KA 1WNOA 2J7CA 5CZJA 4AD5A 1RVKA 3T1GA 1TV4A 2JALA 3RLUA 1JPKA 1X39A 5DX7A 4UR8A 1J0IA 4X0VA 2E5BA 3ENLA 3BOXA 4C1NA 4JFSA 1JYVA 4B4FA 3GFYA 4WEVX 4R53A 1Q6LA 4OZOA 3RX4A 3G1RA 4NAFB 5CC5A 3F5JA 2GGIA 1JUBA 1E1CA 4BCEA 1XDJA 4ZGYA 2ZE3A 3FVMA 4F8XA 4AEEA 3P67A 3L9CA 4PRWA 4Y90A 4LNCA 1JXKA 3AQUA 3CZKA 1RR2A 2Q6ZA 3C0SA 3MMWA 3OVGA 3M0LA 4ZOCA 3GUWA 3M5XA 3CAWA 2DSVA 3WLTA 5AHLA 2V5BA 3OG2A 1YTDA 3DHPA 1I4NA 2R24A 4DZAA 3TJXA 2W67A 7REQA 1ITCA 3WLOA 3W82A 3E0LA 3N2OA 3C86A 1H49A 1R38A 2PC4A 5HK4A 4I5RA 1KW1A 1A3WA 5GJMA 3B0XA 1M41A 1FKWA 3BL3A 2OYMA 1KNWA 3RO8A 2ZWYA 1GQIA 1QPNA 5I6SA 5I0DA 4IP4A 4W9TA 2H90A 4DLFA 1JCLA 3ID7A 1XIBA 3RHGA 3W86A 1QNPA 4GGBA 5LIYX 3AISA 1RP9A 2HCVA 4Y9AA 2CLFA 3M64A 1NP0A 3NNTA 2X30A 1X98A 1XQLA 4RDVA 1AUSL 2NV9A 2VP8A 5CJNA 2FB3A 5AZ0A 4S3KA 3DKLA 5JBDA 4GO8A 2A3LA 1EFZA 5CXPA 4DZ5A 4D71A 3VM7A 2TSYA 3TOYA 1E6PA 3EMCA 4KW2A 1DXFA 4TVUA 3NXFA 3DZ1A 2JE8A 3LM7A 5DN1A 1SJCA 1SQ7A 5A3HA 1W1VA 1IEVA 1KXVA 2VQTA 1W3IA 3AXMA 2GUUA 3MYOA 3NM1A 1B3OA 3W1LA 2QT3A 1R3WA 1TRDA 1B5TA 3L67A 2W79A 3R4IA 5D9NA 2VX4A 5BWAA 3L12A 4GIYA 2E67A 2UZ9A 4IMCA 3BVJA 4NQ1A 5C7VA 4O0QA 3FN9A 4A6GA 3AIWA 2I17A 2NWSA 3E2RA 4JN7A 1FHDA 1TPDA 4HYRA 3WMLA 2J47A 4O1EA 1J12A 4KFOA 2E09A 4ZENA 3DENA 3WJZA 2WK2A 4NJGA 3UWVA 1K7FA 4GFIA 4XV0A 4XBSA 1XKYA 3FLUA 1E0WA 1TIMA 4DBDA 1VPQA 3PR2A 2J7FA 4OIFA 1QI2A 3M16A 3CHFA 4NNAA 3M07A 3WH8A 3WBWA 3UR8A 3ZS4A 2G8ZA 4S3DA 2Z1WA 4XZLX 1W9UA 5ECVA 2GZXA 5DY2A 2XZ7A 3E12A 4ZB2A 3CK5A 4G1KA 5G4WA 2EPHA 5LZLA 4TV5A 2OELA 2W9MA 3V4BA 1B57A 4M51A 1E15A 4L4PA 1XFCA 2FLIA 1E4NA 1RBOB 3TC6A 1YTEA 1WDPA 5E0CA 5CZ0A 4Q4OA 1IT0A 4L4LA 3WQ5A 1UJPA 1LORA 4UIOA 3TSDA 4XZHA 3V0TA 2GOUA 2HRWA 2V6AA 2PD5A 4GKTA 3L4TA 2E5CA 1WKDA 3JUGA 5C9UA 2E8YA 3PPFA 1A53A 3UFYA 2XU2A 5EMKA 5DMMA 1Q8JA 1TQJA 1HL9A 4HYVA 3WFZA 1U1JA 3WDRA 1YNYA 5HANA 3G1YA 1G4PA 4Q3MA 4RZBA 1YKWA 3SUTA 4Z1DA 3CUJA 3EKGA 1LLOA 2REQB 4WKHA 4POCA 5DELA 3H2MA 2BOEX 1HTIA 5AC5A 3W7NA 3NQ6A 1UW9A 1KGWA 3MUY1 2E5DA 1VJZA 5XINA 4JX5A 2VFHA 1YPFA 1B90A 2WMKA 2ZRXA 3MO4A 5GQBA 3EB2A 4A3UA 1T99A 5DEZA 4LUTB 1IZCA 1KFWA 1DQXA 3TTSA 1M5WA 3VIJA 5I00A 4IISA 1XLAA 2PRLA 1MDRA 5AYYA 1J11A 4ZTXA 1K6AA 3N11A 2J62A 1DTNA 4CNSA 1JCJA 2BXYA 5BYWA 3L5AA 4W7UA 3T55A 4G1NA 4V2XA 3TN4A 1A5CA 1UROA 3M9YA 3HV9A 3QYSA 4RL3A 3R13A 1T41A 1XH0A 3DH7A 1ODUA 3GC2A 3LNPA 3H23A 2FZ9A 1XYZA 4UQAA 3P81A 4X0NA 4BFAA 4W8LA 2CU0A 3RX3A 2WBKA 5CPMA 2DVXA 5BOFA 4O14A 5FF0A 2FKPA 5AYIA 3UD6A 1B9ZA 3SEPA 1W3NA 3TKFA 1TKKA 2BVDA 2X16A 5J8LA 4CD7A 1GHSA 1A5KC 1OC7A 1RA0A 2ALRA 4EWND 3AUOA 5DCDA 1EDGA 4TQTA 2FGLA 3D3AA 1MWOA 2O9TA 3H2AA 2NVAA 2WNZA 1RK5A 3RG6A 4YTTA 1IZJA 1GZJA 1MMFA 5EL1A 1YE6A 3H4XA 2WZIA 3UG3A 4B91A 1BG9A 1VZWA 3N6HA 4JX4A 4GBDA 3N29A 3CHCA 1D7KA 3N6JA 3W1UA 2AQOA 1DXEA 4K37A 4QROA 3RMEA 1R2RA 2Z1SA 3SECA 4RZ5A 2XIBA 1OG0A 3C6CA 1IT7A 3E2SA 1IWAA 4FNSA 4O12A 3EWBX 1J5TA 1GVOA 2GSEA 2A4AA 2VFIA 4QDWA 5C9XA 1MW3A 3SCOA 4PULA 1W5PA 2KZHA 3RRXA 3T0CA 4C6FA 5B7YA 4H2HA 1J79A 4E2BA 2I5IA 5FEPA 2IS7A 2O9OA 3EGJA 2V3FA 3QW4B 3KZPA 3K1DA 2C1IA 4MVAA 2WANA 2BV9A 4GX8A 2PZNA 3F2BA 4H9YA 1XBVA 2YZ5A 4QISA 2EPMX 4G5DA 1TPUA 3VDBA 5C5YA 4AD2A 4S3AA 1QRQA 1EJ7L 1S1RA 3QPYA 1XV8A 1FUYA 4ILSA 3SM0A 2VFDA 2HK0A 3AYRA 3U8GA 3SQMA 2XIMA 2V63A 2P8CA 4BF5A 1SR9A 2YW3A 4AIBA 2FMOA 3DFNA 1WXZA 2V5JA 2WMIB 3GTHA 3IGUA 1JDFA 5DF0A 5FIPA 2VUYA 3EXRA 4K8GA 4Y7EA 1S5TA 4QG6A 1WAUA 1TPFA 3QN3A 4QAIA 1B3WA 3FAWA 1KLZA 4ZO6A 2Z26A 1KTBA 3GNXA 2FPYA 1FDYA 1BRLA 2BHUA 2PDLA 4V28A 3I6TA 2YCIX 1B9BA 3WH6A 1F3EA 2VURA 3N2TA 3GWQA 4AMAA 2PWDA 4H7CA 4HHHA 1JPIA 1LBFA 1O5KA 4OTKA 1TA3B 1R8LA 2B7OA 3QRHA 6XIAA 4LRSA 3ZOAA 2OEKA 3KL5A 3TA9A 3WBXA 1QOXA 1BYAA 5DCBA 4BI5A 5CZKA 4JIIX 2V82A 3IIZA 4PRTA 1Q63A 4GY1A 3O6DA 1V7AA 3NZ1A 3FV9A 3GKAA 3MS8A 1A0CA 2VO5A 3URNA 3UZJA 3AXXA 3Q37A 4A3RA 1FHVA 3WQPA 3MBDA 4R9XA 5D32A 4F4RA 3ONBA 3EWUA 2X42A 4TX9A 4LYKA 4D6DA 2PTWA 3VXGA 3OZYA 4LX4A 2WHMA 4GH3A 2VDHA 1KFCA 2OZ0A 4CN6A 3ZO9A 4C1LA 3LG3A 4Z17A 3N2BA 3G1AA 4TVDA 1H1NA 2FHBA 1LT7A 2YBUA 3M4HA 1OF6A 4MTVA 4H04A 3PZIA 1I1WA 3APYA 2B0MA 4U33A 4FX8A 4JEJA 1SZGA 4UR9A 2D2JA 1CB7B 3BLEA 3DC0A 4LV9A 3N15A 1XIFA 5G2IA 3CTLA 3LERA 2BBFA 4ICCX 5CPTA 1OZMA 1OCQA 1OG6A 5I06A 3DECA 4DJEA 4FMVA 1K7EA 4V33A 4NAFA 3W7DA 3OG3A 5DFAA 1ZBCA 1JZ2A 4B90A 2GJRA 3QZAA 5M5DA 3V0SA 3S5OA 2NQLA 4MZ8A 1Q3NA 3B0UX 3D46A 3B04A 3GS6A 1TYGA 4CUCA 2POTA 2ZXQA 1EZWA 2NV2A 2VC5A 4DLMA 1Q6DA 1AZ2A 2WBGA 3ORWA 2ZUVA 1BQGA 1H5YA 2PCQA 5A94A 4S3CA 4RK8A 3GYCA 3MHGA 1NWUA 4MZYA 3U7VA 2OYLA 3I6EA 1UQZA 3VCCA 2XTKA 4DO4A 1JZ8A 2YL8A 3WUGA 1MEIA 2I9UA 4AC1X 5AC4A 2G3IA 2QVHA 4OT7A 3FS2A 1I75A 2WQDA 3LTSA 5CEWA 2Z4GA 4HNTA 3VCNA 1DE6A 1JR1A 2WSPA 5LNUA 4KPLA 3FW6A 3ITYA 6ALDA 5LIKX 5BMWA 3BV7A 4YWSA 3AHVA 4ENLA 3QV9A 3B03A 3KWXA 3FX4A 3CL7A 2GLKA 3DYOA 3RM8A 2ZRVA 3WLKX 1GOIA 3V1PA 3FA3A 2IMRA 3NPUA 1I8JA 1GNXA 3OGVA 4Q8PA 3TNBA 1QPQA 2J7HA 1JZ6A 3OLIA 3WMBA 3OQ8A 4AH7A 1J8VA 2A79A 3N25A 3ECQA 4N9EA 3VKAA 4CCZA 4XSMA 1WE5A 3ZXWA 1H2JA 3L4WA 1W1ZA 2VGBA 5FJUA 2QGYA 2JF7A 1NIUA 2O7QA 3JS3A 4E8CA 4UFKA 4HQVA 1QPOA 3OZOA 5RUBA 4GJIA 4H8NA 2WB5A 1KFBA 4LJ3A 1HL8A 2CXGA 4PCSA 5F2LA 4RNHA 2NSXA 1D3GA 2PWUA 3UF9A 6A3HA 1RJPA 1UWSA 2ATMA 1CECA 1QATA 4WOZA 3CQJA 1F3WA 3TIMA 3SCQA 5FL0A 4B15A 5K2ZA 3O6YX 3WSUA 1UR0A 2PA6A 4JPGA 2NXGA 3R10A 3TYEA 1J2WA 4UC5A 1Q7ZA 1VJSA 2YYUA 1UD8A 5EYWA