3CPUA

Subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Subsite mapping of the human pancreatic alpha-amylase active site through structural, kinetic, and mutagenesis techniques.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cpuA01
4FNPA 1VFMA 3AHTA 3VILA 3WQVA 2PB1A 3W6MA 4TVDA 5BCAA 2ZUTA 3SUTA 1CPUA 2FYVA 2UY2A 1JZ5A 4AMXA 3AYSA 2G41A 2VO5A 4GPNA 3A21A 2CCRA 2YIHA 3ARSA 4QLKA 1OB0A 5M17A 2GJXB 3NUKA 2VUYA 3K1DA 4QDMA 4CU8A 1KQYA 1SMAA 2E3ZA 4DO5A 4JFSA 2ZOXA 2XG9A 1W3HA 4JCLA 1CXLA 4JFVA 1V0LA 4A4AA 3W24A 4AZ7A 3DYOA 1SMDA 2J75A 3HZ3A 1QW8A 4NX0A 4FF5A 1W3JA 4IPNB 3S5ZA 4YN5A 3TTSA 2PWHA 1J12A 2Y8KA 2UY5A 2YL9A 5C70A 4XB3A 4P7OA 1TQUA 4RE2A 4F9JA 5E6ZA 3VD5A 1OSEA 1E40A 3B9EA 2J7EA 4IPLA 1CGUA 2BFGA 1HXKA 4MPKA 2O9PA 5AY7A 2YLAA 2QPUA 1BYBA 1CLVA 3NSMA 1CENA 2YBUA 3NSNA 4IM4A 1JAKA 1UD8A 3AHYA 2E40A 3CMGA 5CGMA 4CD6A 1GNXA 3N04A 1WZAA 1GHRA 3AMGA 3WY2A 3LRLA 1CXEA 3PHAA 3VGHA 3CBWA 4HU8A 3L4YA 3LXBA 4JL2A 2DIJA 2GJXA 1KGXA 4HP5A 4F79A 2WMJA 3AIBA 2WB5A 3CC1A 4S3KA 3EJQA 3M6DA 4U31A 3DDGA 3VD9A 3AFBA 1ZBVA 2D3LA 5BRQA 5EMYA 4MAZA 5E09A 3BAJA 1JXKA 4HTYA 1LWJA 2WKLA 3GH7A 1X6NA 2WW5A 3AXXA 4X0NA 4LGXA 2WMKA 3RJYA 3L2MA 2XUCA 1QI5A 3WENA 2BNJA 4WF7A 1K9FA 3A4XA 1E4MM 3RM8A 5I24A 5BRPA 3AMCA 3OLIA 4HU0A 3K8LA 4QCFA 4JFUA 1MQPA 4NZFA 1W1PA 4D71A 5BWFA 4P7RA 1JDAA 5A6BA 1FFQA 4X0VA 2J7BA 3OLGA 2BY3A 4CUCA 4V2XA 3QR3A 1FOBA 2W4XA 4AXNA 2DSVA 3S6TA 5A6LA 4UFLA 6A3HA 1RH9A 4W7VA 2ZICA 3IAQA 1HF6A 4F8XA 3IJ8A 3VIGA 3WSUA 3WUBA 1V6YA 1JI2A 1EHNA 4CN4A 3GM8A 3IK2A 4W87A 3BSGA 4NSBA 3K4DA 4EK7A 3THCA 1OT2A 1UD6A 1CIUA 5D9NA 1CEOA 4WJXA 2OSWA 5HPOA 1LG2A 3IANA 5GNXA 3W38A 2YKKA 1GUVA 3WN6A 1FH9A 3ZOAA 5C71A 1MW0A 3N17A 1XH2A 4PMYA 4RE4A 2NT0A 4A3HA 2DGAA 3AS0A 2VVSA 1QI2A 1SYTA 1BTCA 1XYZA 3ZR6A 2BHYA 1WNOA 1PX8A 2OYMA 1UR9A 5FL0A 4NRRA 5A1AA 1ZB5A 1UWRA 1OGGA 3N12A 2EACA 5A69A 2EABA 1O7AA 1HIZA 4AYSA 1OWQA 4QAWA 1C8XA 4U5KA 2VVNA 2WLYA 1HP4A 4HA4A 3T08A 1XCWA 1AQHA 4DWSB 2F1BA 4OBRA 2DH2A 2ZX9A 3D51A 5E0CA 2FHBA 2FHCA 2QMJA 2VX6A 2E8YA 4J7RA 4PMDA 3SUSA 2EJ1A 5JBFA 3KZSA 4Z2KA 4DO4A 5I6SA 3GH5A 2BXZA 1CNVA 1JNDA 4PMOA 2Y5EA 2GUYA 4QLLA 1NOWA 3WDHA 4MJ2A 2YDRA 1UKOA 2CHOA 3WNLA 4HMEA 2CYGA 2W5FA 3W29A 2J7CA 1LLOA 4NRSA 2VCAA 2YA2A 1VFOA 4FNUA 3PZ9A 1V3MA 2VT0A 7A3HA 3SCPA 3DC0A 3VMOA 3WNOA 3TONA 1GVYA 4DUXA 5DEZA 1BLIA 3KLLA 2BVYA 2F8QA 4CKQA 1E3XA 2W91A 3GBEA 1JGIA 1EDGA 4FNQA 4GI8A 3AIQA 4W7UA 2F61A 1TFVA 3AMLA 1I1XA 3CZJA 2ZXAA 5CSYA 2A3AA 4F9DA 3K4AA 2WXDM 3VD7A 1H0IA 5D4YA 1J0KA 1VAHA 1UWTA 4DWSA 1TA3B 2D2OA 3CZLA 3DYMA 2J74A 4CCEA 3K8MA 3NDZA 4W8BA 2ZXQA 4URIA 2DSZA 1V3LA 1ZBKA 5ABFB 4ACYA 4E4PA 4GZIA 1O7DC 1B30A 3NDYA 4MJ4A 2ZX8A 4WKHA 6TAAA 3A6OA 3GBDA 1W3LA 3AS2A 3GXPA 1V3IA 2Y8VA 2FHFA 1G94A 3IJ7A 4Z2GA 3VM5A 3CH9A 3B9AA 2OWCA 2DT3A 2CXGA 4ZENA 1IV8A 1VIWA 4PRWA 3D3AA 3EJTA 1WDSA 1R7OA 4PYSA 1J01A 4XZBA 4U3CA 3WQ5A 4K68A 1L8NA 2WCSA 2C7FA 3AIUA 4AD2A 4WKAA 3QGVA 1A47A 4OJYA 2VQTA 1R86A 5I78A 1V3HA 3DYPA 1R75A 1E43A 3BMVA 3VINA 4TXEA 1UKQA 1JF5A 2WZIA 3CZNA 4CVWA 3F4VA 1E72M 3MV11 2VZTA 1KTCA 1QW9A 1UUQA 2XVNA 4AZBA 1RP9A 1UR8A 1TA3A 5CSUA 4V27A 1ITXA 1QNPA 2J7HA 3D4ZA 3ZSSA 4NZJA 5I2UA 3W0KA 1HKKA 1XH1A 1HXJA 1NM9A 7CGTA 1W2VA 3AI0A 5ABFA 5IHRA 1QX1A 3BC9A 1J0YA 4JL1A 1HN1A 2Y4SA 5CLTA 3W4RA 1VENA 2GJRA 1BGGA 1XHGA 3VPLA 3WQ6A 1KXTA 1MWOA 3VGEA 3RO8A 1C7TA 3WUGA 2VRJA 3RIKA 1MFUA 2RGMA 3VGFA 4E2OA 1J18A 2XPKA 1ISXA 1GOWA 3OLDA 3ZJ6A 3MU7A 5M03A 2ZWZA 1VFFA 1TQVA 1XYFA 1J0HA 2A3HA 1GHSA 3CUIA 1VEOA 3WQ4A 1MXDA 3WH9A 4MB1A 4U5IA 2WHKA 2CPUA 2XM2A 3W6LA 1NP0A 3ARYA 7TAAA 2XWDA 5HPCA 4HA1A 2XSAA 2X09A 1PJ9A 3BAXA 1ISWA 4AD3A 4HOZA 1VRXA 1WB0A 3EJSA 1LJYA 5DFAA 1US3A 1V02A 5GQBA 2WC3A 3LPFA 3RM9A 2WLZA 3OBAA 5ECUA 1KXQA 3RCNA 1OT1A 4PN2A 4FNTA 2ZUSA 1JD9A 3WFZA 2OYKA 4HOXA 2VURA 2PC8A 2W61A 4B3LA 2X0HA 1UZ1A 1Q6FA 3EJPA 3NSXA 1GOOA 1DWHM 4UFIA 3CTTA 1J10A 4MB3A 2DQXA 4BS0A 2XN0A 4HZ8A 3W81A 1ZS2A 1WE5A 3CZEA 2WVUA 3DX0A 3PZOA 4JKMA 5AC4A 1UWIA 3CHDA 3MV01 5BXPA 3PTMA 4DUWA 2CERA 2OWXA 4AD1A 4KGJA 2NT1A 4XUYA 3ARQA 3W27A 2C8NA 2UY3A 3GYCA 3RILA 2VZSA 4KGLA 1D7FA 3VGDA 4D6EA 1XSJA 3QHNA 3F5JA 2EPOA 1K9EA 2O92A 4W5UA 1HL8A 1P6WA 4JZ5A 1VJSA 4FLOA 1T0OA 5ABGA 3MUIA 2D20A 4CU7A 2V38A 4ACZB 1EDTA 1OGSA 3NYDA 1Z32X 5HXMA 1GOIA 2VTFA 1PS3A 1UOKA 3WY3A 4KMQA 1E6SM 2Q8XA 3MMWA 1JYXA 1QI0A 4P7QA 3ZT6A 1US2A 1MW2A 2JFEX 1AMYA 4DO6A 3WMCA 3WH6A 4M1RA 1PBGA 4TX8A 5FL1A 2EPKX 2EPLX 3VIMA 3FAWA 4PMUA 2YL5A 3VIIA 2CIPA 5IFPA 1HJUA 2D73A 3EMQA 1W9UA 3EMCA 3I3BA 2ESCA 1FHLA 1Q6GA 1LL7A 1NARA 1B3VA 4AZCB 1BYCA 4UOJA 3PZIA 1E0WA 4HMCA 3AIWA 1FA2A 1KGWA 2XGBA 5ABEA 3WDQA 1G5AA 2G3IA 3ARZA 4ACZA 5I79A 3N1AA 1KR1A 1DWGM 1NWTA 4W8LA 4FNRA 3FW6A 4OUEA 4UZUA 1UA3A 1OD0A 3CGTA 3U57A 1QI4A 2YA0A 1LL4A 3A3HA 5JIPA 3SCQA 4AC1X 2VCBA 3HG2A 3VVGA 4U33A 3T2QA 4FLQA 3H55A 2A3CA 4JIEA 3AXHA 4BF7A 3VDBA 2F2HA 1W3KA 4TVCA 3N9KA 3KWXA 1UQZA 2PBOA 2YOCA 3BGAA 3AROA 5I77A 1W9VA 1B90A 1X1NA 1NOUA 1KGUA 3HG3A 4AEFA 4C7DA 2PWFA 4GI9A 2OSXA 4YPJA 4GZJA 4ML4A 1H41A 5E9AA 3CHEA 2JF7A 1HX0A 2J8GA 1E6PA 2YDQA 1LL6A 3THDA 1BG9A 2CETA 1W1YA 3GNRA 1JZ4A 4AMCA 2DSUA 2F1AA 1EQPA 1HJQA 1G01A 2VRQA 2D0GA 1LWHA 1H0GA 4PEEA 3ARWA 4ZE4A 1L0PA 4N0RA 4AIOA 3WDRA 3QHOA 2VL4A 3LMYA 1UD5A 1E6NA 4J27A 4W8AA 3HJEA 3VIPA 2WYSA 3RMEA 1N82A 3T2PA 2GFTA 4BQ3A 4GINA 3WNPA 2D3NA 2YJQA 1B3XA 3ZSTA 3MUY1 1PX3A 2CKSA 1UA7A 1UD4A 3W37A 2WPGA 2BV9A 3F5LA 3A22A 4RL3A 1RP8A 1CXKA 4GXPA 5EFFA 1BF2A 5BXRA 4RE3A 1JD7A 3ARRA 1V02E 4PSRA 1EHAA 2EPMX 1E1FA 1W32A 2X2HA 5A6MA 4GZEA 3LRMA 3EDJA 2J47A 3U7BA 3MSDA 2Y24A 1HJWA 1ZBCA 1TZ7A 2PWDA 2WCGA 1J0ZA 2X0YA 4EANA 1GORA 5EBAA 1R7AA 4AWEA 1GPFA 1BVZA 5CPTA 5LYRA 4D6DA 2J77A 1WZMA 3T2OA 1S46A 5IDIA 3MMDA 1EIBA 2AAAA 3D5HA 3WH5A 1VFUA 3PZTA 1E0XA 3B8SA 2J62A 3VDHA 5CPSA 1O6IA 1V03A 1V3KA 2G4FA 3WFLA 3VX1A 4UOZA 2CESA 2XSBA 1UWQA 1UD2A 2WANA 2ZWYA 4LXFA 3PN8A 4QFUA 1KB3A 3VKKA 4UZSA 1E6XM 5E0FA 1ITCA 3AZTA 5A3HA 3H53A 1HKIA 3MUAA 2J8FA 4OIFA 3B9DA 3OZPA 3VSVA 2WVTA 5A95A 1CGWA 3WL0A 2BHUA 3VNZA 3CZSA 4U2ZA 1HNYA 4CCCA 1E55A 2A3EA 3AMKA 1EA9C 4S3JA 3AIEA 1KCLA 4D6HA 2VNCA 1CZ1A 3APGA 3VUPA 5LA0A 3BH4A 3CUFA 4AW7A 4AD4A 3UEQA 1UKPA 4KWUA 4NI3A 3GNPA 1ESWA 3WNMA 4AD0A 1V0NA 3UETA 3VSUA 2XYLA 2PWGA 1GQIA 4M80A 3SEPA 3WD0A 3WNKA 3CHFA 3SIMA 4PCSA 2W92A 4WKFA 3WD3A 1FH8A 3AHXA 4GO9A 1E5JA 1LG1A 4D1JA 4UQBA 5HNNA 4IUGA 2O9TA 3F5KA 5EFDA 2G3NA 2YLLA 2VX7A 3VD3A 2VMFA 4CD7A 1I75A 1OINA 1BPLB 1X6LA 3AOFA 3U5UA 1QNQA 2CEQA 1XRVA 3WEZA 2CKRA 5CZKA 1PAMA 3WL1A 1C3FA 5EB8A 3KL5A 2J79A 3AHVA 1KBBA 3RJXA 1A3HA 2PF0A 3WMSA 3VTRA 3GXDA 2FH6A 3DHPA 1XSKA 1SR0A 1UHVA 2AOSA 1HJVA 2WHMA 2O9OA 1HVXA 3BAWA 2DIEA 1M03A 2VJXA 1DHKA 1MYRA 4AZIA 1LQ0A 1JZ7A 3S5YA 4BCEA 3CUJA 5FIPA 4MNLA 4UFHA 2VQUA 1B0IA 1PEZA 1V0KA 4A3YA 1KWGA 1RPKA 1JXJA 3L4TA 3CUHA 3DECA 4LX4A 1JIBA 1JDCA 2D0HA 3FHAA 4KH2A 2YBTA 4U3AA 4CD5A 4JKLA 3PZUA 3SCSA 4JAWA 3RDKA 1EOKA 2BXYA 3BCDA 3CPUA 1GOQA 2OWWA 4AMWA 3ZJ8A 2PBGA 4HA3A 3WUEA 1ECEA 3WNNA 3SCWA 3D52A 3L4UA 3BVVA 3BUIA 3FHQA 2BY1A 3ARUA 3O6AA 2XN1A 4BQ5A 1OM0A 1H49A 4P8UA 2WHJA 3VU2A 2GSJA 4HZ6A 1JZ2A 4M8UA 3EDDA 1E5NA 2WHLA 3OIHA 4W84A 1W9DM 1HVQA 3TV8A 1QHOA 4M81A 1XSIA 2ZUMA 4H8UA 5A6AA 2VX4A 1BVNP 1ISYA 5JUVA 5A6KA 2DDXA 3I3EA 2DSWA 3FNDA 3AISA 4JHOA 2JE8A 1V6VA 1D3CA 3N18A 4UQCA 1E15A 3WH8A 2XM1A 1WCGA 1MVYA 1TQSA 1EGZA 3EYPA 1TUXA 5KZ6A 3AQUA 1WO2A 1CECA 4PMRA 1GONA 2DT0A 1C8YA 4J3XA 1OIFA 1NQ6A 5A6BD 1CXIA 4MB4A 1CTNA 4D72A 4WIWA 1GOKA 3OLEA 4UOQA 4W85A 1BFNA 2DH3A 4ZFMA 4W5ZA 3VSTA 3N11A 5E70A 2WK2A 1B3ZA 1HKMA 4L4PA 3HG4A 4UNIA 3AIRA 1HJXA 1UR4A 3BVWA 4TOQA 4B9YA 1C7SA 2WC4A 3CIVA 1G1YA 4J3SA 3WDJA 3HMCA 3AZSA 3ARVA 2D23A 1MXGA 4UFKA 4TTGA 2EADA 4AD5A 2HISA 2J78A 3M7SA 5AC5A 2WZHA 2FE0A 2XIIA 1HP5A 1DP0A 3EMZA 1FFRA 4V28A 1KCKA 2XGIA 3I3DA 1JZ3A 3SCRA 1VF8A 4AZHA 4UFMA 4PUEA 1WDRA 1U2YA 1V08A 2OLHA 1BQCA 2VR4A 1UD3A 2E4TA 1V0MA 1Q6DA 3WF2A 1JNEA 5HOSA 4KRUA 1E73M 5I5RA 3T09A 2E9MA 1JDDA 1TR1A 3IJ9A 1PIFA 4BZYA 4OGZA 2QLYA 5CLWA 3KL0A 1PZ2A 1IT0A 2V3FA 3DHUA 2W63A 2XJ7A 4P7LA 3GNOA 3BUQA 2BY0A 1UH2A 5DMYA 3VMPA 3AJ7A 1W91A 2WMIB 3MSGA 1B2YA 1KQZA 1CXFA 1OD8A 4Z2IA 2NW0A 1R33A 3VIJA 1CGTA 2BHZA 1ZJAA 3WMBA 1ZU8A 4WLCA 3ZO9A 4EE9A 4GQQA 2W67A 4OOUA 1ISZA 2D22A 4W86A 2G3MA 4P7NA 2QV4A 2DT2A 3WKZA 1AVAA 2XHYA 4PBGA 4ZEPA 2YFOA 4CGTA 1E1EA 2YFNA 1SZNA 3WY4A 1MFVA 1E9LA 1NH6A 2F7QA 1QOXA 3TA9A 2FH8A 1NWUA 6CGTA 3ZR5A 4CU6A 2QMKA 3VIKA 3SCVA 2IGTA 2DEPA 3M07A 4E8DA 1OIMA 3DX4A 4J3TA 5CG0A 5I23A 3RM4A 1BG4A 4PMVA 1GVIA 1QWUA 3UG5A 3AIVA 3ZJKA 1UKTA 3GXFA 2WSPA 5A8OA 1QHPA 1JFXA 4PTWA 1R85A 2IXVA 3ZT7A 5A2AA 2CBJA 1QWNA 3ECQA 4F66A 2WMIA 3PZVA 1W1TA 4YHGA 1KWKA 1JAEA 3D4YA 2VX5A 3DX1A 1J9YA 2C0HA 2VZOA 4TUFA 4B16A 4H04A 2EPNA 1CGVA 2PWEA 1GJWA 1TCMA 4P8WA 4YHEA 3GXNA 1XD0A 2F7PA 5HBFA 2JEQA 4CN6A 4AIUA 2X2IA 2X05A 4PMQA 3CZ8A 3N15A 1B1YA 2GJPA 5DT5A 4OBSA 1QNSA 3SUUA 4B15A 4E8CA 2FGZA 2XN2A 1LF1A 2DPEA 2GDUA 1UYQA 5A2CA 4MADA 2WZEA 3SUVA 3UR8A 1E71M 2VOTA 5F7UA 1MQQA 4W88A 1UR0A 2WBGA 4DWSC 3W25A 3WDIA 3PZNA 4BA0A 1UKSA 4PMZA 3UERA 1W9XA 3G6MA 4HZ7A 5A8MA 5CXPA 1KFWA 3OA5A 3MUZ1 4XV0A 1GQKA 3BXWA 3MANA 4HPGA 4R27A 5E6YA 4C7FA 2YA1A 3TOPA 5A94A 3WBEA 3L2LA 1UWSA 2J4GA 1V6WA 4XZWA 3BAIA 2VRKA 4WSKA 2WAGA 2TAAA 2AMGA 1R34A 2CBIA 4D6JA 1DEDA 3NJ3A 4UCFA 3WY1A 3TTYA 3QOMA 1ODUA 3RPMA 1CGXA 3MI6A 4AZCA 2ZUNA 4TTUA 3ALFA 3SCOA 4EAMA 3SCTA 2CHNA 3A47A 4B9ZA 4JFWA 4GO8A 1NOFA 1OGBA 2WWDA 5IXEA 3GDBA 4GI6A 4W7WA 3TP4A 1ISVA 4PMXA 2WMFA 2XFYA 3W26A 1QBBA 4P8XA 2X2JA 4JHZA 1J11A 1H11A 1UH3A 3WELA 3O2LA 3H54A 4PTMA 1QPKA 1QVBA 1HL9A 3VMNA 1E3ZA 4TVUA 1HWWA 1U30A 1JG9A 1ZL1A 4R5EA 3ARPA 1C8QA 2V5DA 1V3JA 2ZXDA 1E4LA 5CGTA 5I0DA 1W1VA 4Q22A 2WCAA 2UY4A 1Q6EA 3HU7A 3VOCA 4H8HA 3ZJ7A 1MW3A 2ZUVA 5I3DA 1R46A 2OW7A 3L4VA 5M3WA 3A24A 5GPRA 1GJUA 1W9PA 4BQ4A 1EXPA 3MS8A 3AICA 1QHZA 4OOZA 1AQ0A 4L4OA 1MW1A 2YL8A 5D8ZA 2WVVB 1Q4NX 1WDQA 4FK9A 5ABHA 3IAPA 3GTNA 3M46A 5LA1A 3W28A 3KEHA 3EJUA 2ZXBA 1R8LA 2XVPA 3FAXA 2RGLA 2YL6A 3UCQA 2XVLA 3BSHA 3BUBA 3WD2A 4CCDA 1CXHA 1HTYA 5JBEA 1JI1A 1GQJA 2XVKA 4ZXOA 1PZ3A 2ZX5A 2ALWA 4UFJA 4BQ2A 3VDCA 1C91A 1K9DA 1M01A 1QNOA 1RD6A 4H8VA 1GZJA 1H09A 5A6SA 3U7VA 1HT6A 4CN1A 1KTBA 4UR9A 2QPSA 1Y7VA 3OGRA 4AZ6A 2FGLA 3S2CA 1VEPA 3AYRA 4M56A 1E0VA 1WDPA 3PZMA 4H2CA 1EO7A 1KXHA 3NCOA 2XIBA 4MAVA 5D9PA 1GCYA 4JCMA 2WVVA 3BUPA 3WQWA 3DX2A 2YDSA 1E70M 3T0BA 3ZT5A 2W62A 3VNYA 1XCXA 1DWJM 4D6CA 3SCNA 2V3GA 4QP0A 1R87A 8A3HA 1W9BM 3SURA 1UR1A 1H2JA 3J7HA 2QF8A 3ZMRA 3LPPA 4D6IA 2WVSA 1QI3A 3A5VA 5A8QA 3WF4A 2CBUA 3LPGA 4H41A 3HG5A 2X1IA 1XV8A 3BVXA 5DT7A 1JF6A 1XH0A 1TQTA 3FN9A 4LQ1A 4ZE5A 1NP2A 1BGAA 3G6LA 4GKLA 3DX3A 4OZOA 4WK9A 3GH4A 4CD8A 4PMNA 4JFTA 3WDPP 3MMUA 4PTXA 4U2YA 2G3JA 4C7GA 1KXVA 1VEMA 5CPQA 5IFTA 4LYQA 1MQRA 3FY1A 2XFRA 1VBRA 4Q7NA 2Z1KA 1GW1A 5D9OA 3LXCA 2VR5A 3QHMA 4M82A 4JKKA 1JZ8A 2JEPA 3BAYA 1TVPA 2VZVA 2UWFA 3L4XA 1J0JA 5DO8A 3BCFA 1E4IA 2JIEA 3L4WA 2VC9A 3UG4A 1UR2A 2BVDA 1OCQA 3OGVA 2E0PA 3SCUA 1EOMA 4PTVA 1QNRA 1EH9A 2V5CA 3WD4A 3W53A 3PTQA 4P8VA 1NWRA 1JL8A 1JZ6A 2EXOA 4IISA 4D6GA 1GOMA 5A8PA 1UZ4A 2DSKA 3CO4A 4LYPA 2WNWA 3GXMA 1EQCA 4ATLA 2A3BA 2BVTA 3FXYA 2IXUA 1DTUA 3VIOA 2ZUWA 1TQWA 1WPCA 2VCCA 1AQMA 4GIAA 1H4PA 5M5DA 3VD4A 1BHGA 4XX6A 4M24A 1E6ZA 2ZX6A 2VZUA 3CHCA 4Z2LA 4W89A 3CZKA 4LPCA 1J0IA 1UG6A 4HMDA 4NZCA 2OW6A 2WMHA 4MNJA 2HVMA 4KRTA 3WBAA 3MKKA 3OB8A 3VX0A 2EAEA 2QHAA 1UQYA 2CBVA 3KL3A 3AZRA 3VO0A 1WKYA 4PCTA 1FH7A 1JYVA 3W82A 4ZXLA 2F7RA 3WUFA 2D0FA 4AYGA 4MDOA 3POHA 3VIHA 2D24A 4D6FA 2E9BA 1WZKA 1JYWA 2X8RA 3CZGA 1HJSA 1W2PA 4H7VA 4FLRA 4M29A 4HOWA 1VJZA 3NIYA 3WH7A 1FHDA 1JFHA 5A2BA 3EDEA 1K9TA 3K8KA 2ZX7A 1Q6CA 1TVNA 3KE0A 2FDMA 3POCA 1QBAA 4Y7EA 4D1IA 4AZ5A 1H1NA 3AHZA 3O9NA 4UQEA 1BAGA 2J25A 1B9ZA 2MANA 3OGSA 5E1QA 4QCEA 5BROA 2GK1B 4WSJA 5BXTA 1V6XA 3MO4A 1YQ2A 4DM1A 1VB9A 2WSKA 3IGUA 3WEOA 3PBGA 4PUDA 3A4AA 2J7FA 1PPIA 5AYBA 1KBKA 4CVUA 2CNCA 5FCZA 2JF6A 3A23A 3AS3A 1OBAA 3BVUA 4GQRA 1UASA 1M04A 3BLKA 4OKDA 5GNZA 1CBGA 3AS1A 3PZGA 3ZM8A 2EBNA 8CGTA 5CQ1A 2XFFA 1DWFM 2B31A 2WWCA 3VIFA 5C8BB 1BYAA 3OG2A 4X9YA 1FP8A 3EBVA 1B3YA 1TMQA 1G9HA 2J7DA 2D1ZA 3E1F1 2IUZA 2WM0A 1CYGA 1B3WA 4EKJA 1SFSA 4Z2HA 1UWUA 1BSIA 3AMDA 3DDFA 1R47A 3T0DA 1I1WA 5D9MA 1CDGA 1K6AA 2ZUUA 4J3VA 4FMVA 3BMWA 5DF0A 4CD4A 3PZQA 1EO5A 1F4AA 1VBUA 1B31A 4NXSA 2O9RA 1F4HA 3N13A 2GK1A 1CWYA 1WZLA 2BS9A 2BY2A 1IZKA 3BAKA 3GXTA 1M53A 4AY1A 2NSXA 4MTVA 1KR0A 1H3GA 4J28A 3BVTA 1XGZA 1CGYA 2X2YA 3CLWA 3AXIA 1U33A 3L4ZA 1XC6A 1V6UA 1CLXA 3U5YA 4AEEA 2EEXA 1FP9A 3LPOA 5CJ5A 5BYWA 3GXIA 2PI6A 1XD1A 5FKYA 1PX4A 2GVYA 3II1A 1WP6A 5D8WA 2V3EA 4NXKA 4UQ9A 1UH4A 4Z2JA 3D50A 3VGGA 3ARTA 5HDRA 5KEZA 1DWIM 1WAWA 3WF0A 3GZAA 4LYRA 3CV5A 3UESA 2ZE0A 2DT1A 1E6RA 1NWSA 2CITA 5TD4A 5A6JA 5BXSA 4J3UA 5JIWA 1GQLA 5FD0A 3WF1A 3OZOA 3EDFA 2VI0A 4UQAA 2G8ZA 3VM7A 4ATWA 1EDQA 4FNSA 2JALA 3WF3A 3ALGA 1TG7A 3T0AA 4UQDA 3ZQ9A 9CGTA 1M7XA 1IZJA 2V3DA 1G0CA 2F18A 3UG3A 2E9LA 1DWAM 2Z1SA 2WBKA 4QLJA 3EDKA 2JIWA 3ZIZA 4NF7A 4DWSD 3VDAA 1ODZA 4AISA 3WEMA 3TTQA 1ZJBA 4AIEA 3VGBA 3HN3A 4DM2A 5JBDA 2EQDA 3TTOA 1C90A 2F7OA 4AZGA 4ATDA 1E6QM 3BUDA 1D2KA 3ARXA 1HKJA 4UTFA 1JYNA 5AYIA 1H5VA 3CMJA 4MDPA 1E56A 2WKGA 3BLBA 1YHTA 3WQ8A 2J7GA 5A8NA 2W66A 1E4NA 4W93A 1C93A 2OSYA 4FLSA 2GDVA 3A4WA 4MNKA 5LA2A 4MNMA 2ZIDA 1PIGA 3JUGA 3EJRA 3WIJA 5IHSA 4PSPA 4HPHA 2OYLA 1ZBWA 1TE1A 3BLPX 3LRKA 4J3WA 5GNYA 3LX9A 1BYDA 2XVGA 2WC7A 3QOKA 2XTKA 4MB5A 3SUWA 3UR7A 4DUVA 3LXAA 4TX6A 1C92A 3WD1A 4B3KA 5FOOA 3K46A 3PTKA 4N42A 2E8ZA 2Y2WA 3CUGA 2EO7A 2XWEA 2WMGA 3KLKA
chains in the Genus database with same CATH superfamily
4NN5B 4TUJB 4K36A 5F9WB 2FIKB 5D2LA 3P67A 2VO5A 4GPNA 3RO6A 2QNEA 2YIHA 4XMLH 1AZZC 2BSCA 2FGWH 2GJXB 4XPBH 4J5VA 1TZGH 2ZOXA 4PRDB 1T5KA 5EC1B 1OOAA 3LHWA 3QPEA 1XSOA 1W3JA 1XR2A 1OXYA 3S97C 3EWYA 4IT1A 1H0DA 5BNXD 2OMBA 4PLJD 2W9MA 2FK9A 3BJLA 1U8KB 3LCHA 4LSQL 3ERPA 3LI1A 4CD6A 3WY2A 4F7MB 3MV8B 3IUHA 2ZBTA 2VJ8A 7REQB 4JTTA 1GZPB 2PTDA 2IAMC 5ENLA 3MV7E 1NJJA 3E49A 4YHYB 4XAPA 1NAMA 4L6HA 4RWHA 3DRQA 5DSCA 3SDAD 3WIHL 2OEKA 4PJBE 1RERA 1AJ2A 2DL2A 4TNWK 1KY6A 3LQMA 3A4XA 3EJZD 4P3DB 2VYOA 1U4EA 3PPFA 4NFBA 1PDKA 3H2QA 5BV7B 1VBHA 5C7HA 4UDUB 4XNAA 4UANA 4RFEA 5D7HA 4YSOA 1HF6A 4N1CA 2VLRD 4Z7IA 3X14B 3BGGA 5D02A 2NW3A 3THCA 4X4YB 1AMKA 5J6HA 1U22A 1RMFL 2P49B 3PQYB 2VXSL 1RSCA 3N17A 4M7ZC 2DGAA 2KYIA 3HTLX 1DTNA 2BOFX 2NWRA 3ZR6A 2Z0BA 4DXKA 3V8OA 5DHYA 3G6DH 5JDJA 1KTLA 4ETQB 4X6FA 3QUML 3LS9A 2NNRA 3HV9A 2NUTB 4Y8AA 2IPUK 2WWOA 1Q38A 3THQA 2YQ3A 4DWSB 1OGTA 2DH2A 3LZPA 4TNEA 1INDL 2FFIA 5GS1C 4MJJA 4QD2E 3SQMA 1AO7D 2LW3A 3NTYA 1XGPA 5DJXA 4APQA 4X98B 4ERIA 1A4JA 1M42A 3W29A 3EO0B 1P0NA 1ZLPA 3GLAA 1THCA 4AC4A 3ARDD 1REIA 5ABZA 3FT4B 3GC3A 1L9SA 2WXNA 1K4DA 3T8XA 1H0IA 3T1FA 4MS6A 1K1DA 5LGXA 1D7BA 4FX8A 4UOW0 4BK5C 3F5WB 4P2QD 3OTRA 1W72B 5HGDB 3I6GA 2QZ5A 1A0CA 1A1OB 3VM5A 1X38A 1WG3A 3CH9A 2LU5A 1BDYA 4Z7NE 1VIWA 3NVTA 3EA3A 2F7IA 3PWPD 2OCCB 5AYQA 2XY2A 4PJ5A 3EOLA 4KI5D 3VOHA 3WJYA 1R7OA 4XZBA 5BRBA 1KY7A 3M0YA 5I78A 1V3HA 3DYPA 1UVQB 4BK4A 1XLLA 1EZUA 2Q0ZX 4ZSTA 3VINA 2MNRA 3HE7B 1L6WA 4IG2B 3T6CA 1JXFA 2BNQD 3MZNA 3IGAA 3ZSSA 2NNAA 5J13C 5EA9A 4XC1L 1DVSA 1KNOB 3AI0A 4WGWB 4JJ5B 4JHAL 5KS9A 1SFJA 1ZLVK 1ZA3A 1T04B 2ICCA 4Q4QA 5L2KB 2VABB 1UA6L 3MV8E 4MA1C 2WBJD 4RAUB 3MU7A 1M7IA 2CDGB 1SW0A 4XO7A 3L5HA 3ROLA 4JKNA 3QXDA 2I5YL 1IIGA 3OJMB 2BP8A 3BZ4A 5HJ3A 4YDJA 4J6IA 1SUHA 1VESA 2F19L 4ZL1A 2VXVL 2LU4A 4K3HA 4H6KA 3B0PA 1US3A 2FTYA 3RM9A 4A22A 5DZ9A 4AVFA 4HOXA 4QXUL 1MSPA 2VURA 2L8AA 3IXTB 3BUYB 2W61A 5DJAA 4B3LA 1T0NB 4O8AA 2OZ4L 4KW2A 1AIFB 2X30A 4MB3A 2XN0A 4ZMXA 4GBDA 1PBYA 5DJCB 2DQ6A 3ZIMA 8XIMA 2FT6A 5JUEL 3FIGA 2RIKA 2CERA 3P9MB 3B2MA 3O2WH 5C9UA 1K8XA 2M83A 4Y2DD 2VAAA 5MEOB 1TJPA 3GYCA 4KJWC 4KZDL 2MOVA 4Y1SA 2EXYD 3NABL 2V17H 4U4IA 4PCYA 1MFNA 1SN5A 2D20A 1LBLA 1JV5A 5HXMA 2IKJA 2J21A 4MJ5B 3H4XA 2FDSA 4TUOA 3LGEA 1IM3A 4P06A 4TX8A 2BSLA 1ZT4B 2EPKX 4AYEC 2ACUA 1TJHH 1RZGA 5ACZA 3QUXB 1GVOA 3DUUA 4BHUI 3BW4A 2RDTA 1QEWB 5CIPH 4K7FB 3N0AA 3TT3L 5H8DA 5DCCA 3UTPD 2GTQA 5GRZA 2HWZL 1G6RL 4M6OH 2BTMA 3QUZA 4P2RA 2F54E 1E0WA 1S2CA 1IBFA 1R0MA 3I6TA 4J9JA 3KGRA 3IDIA 1LT7A 4FR1A 5ETUB 4HT3A 3BPOC 2PZ0A 3A3HA 5T9BG 4AC1X 2R0LL 5I1IL 4H19A 5CUSL 4U33A 1UEYA 4IU3B 3KBHE 2H8PB 1OY0A 2L4OA 3H2AA 1KGUA 5D1QE 3MO1B 3SDXF 4QTIH 5E9AA 1GZGA 5HATA 4Z7UB 4LSTL 1HJQA 2DQWA 2VRQA 1OHZA 4WW1A 3G04A 4DZ8B 4IGMA 4JFDD 4ZE4A 1WFUA 4NPKA 1UROA 1LEGB 1VFBA 5E1AA 1HNGA 1TIMA 2PW1A 3QBTB 4O8RA 1IKFL 1AUSL 5AW9B 4LVEA 3ZSTA 1TFHA 1UA7A 1U5JA 5I82A 3T6QC 4RZBA 5CC7A 3T0VA 3F5LA 3A22A 4TQEL 3PWJA 1GL4B 2AKMA 1BIHA 4NJAL 1VBJA 1H61A 1V02E 4US5D 4LNRA 1W32A 4PA8A 2VGFA 4GZEA 1CLZL 3TBSB 3NPSB 5JIHA 4A37A 3PL6B 2A6KA 4QEGA 3LNEA 3FTZA 1YN6A 2BVPA 4JLRB 3ARGC 4NUWA 3TYBA 1W5NA 1GPFA 2Q86B 3BRDA 2DVTA 2YW3A 3R06A 4JFFD 3WH5A 1D5XB 3VABA 1FHGA 4EOWL 4RRPG 2QPXA 3KBVA 1N5AA 3OOQA 4XP4H 2NOYA 4WD0A 3W5NA 1BZOA 4DRSA 4JM2A 4P05A 4JIQA 3NEXA 1P53A 2FX9L 3FGCB 3Q48A 3TVMA 2C4FU 5B1CA 3G5YB 4XBPA 5C0FA 3DXAA 2A3EA 2XJKA 3WQPA 3QJHB 5BNKA 4WKXA 5KZDA 4EUPG 1Z0MA 3R4DA 4NI3A 4XCFL 3WNKA 4BDVB 5E6UB 3TA4D 1UB6B 3N9GL 5D7SL 5DRWA 1LG1A 3IE9A 2O9TA 4PW3A 2QVMA 3RNQA 5I0YA 1KIUA 5EB9A 2QQNH 5I6KA 4HUMB 5DYOA 4GB9A 2XRAL 1GZHC 1PY4A 1BQHG 1PIIA 1PAMA 1YN7A 3IN2A 1KCWA 3CVHB 1A6AA 1MWAB 1C3FA 1DE6A 3FKKA 2FQFA 5BXFB 5FYJH 4WUKL 1FNGA 1ZPLA 1NFAA 3CQ0A 4O57A 3NWRA 4ICXA 4MMZB 2CLVB 1BOYA 1B0GA 5DMLA 2WAHA 2QCNA 4DIAA 4BKLA 5E4AA 4QSHA 5DU7A 3GGWA 2X2GA 2HT2D 5FJIA 3V16A 4WI7A 3N44B 4DGVH 3N14A 3M0MA 2YAHA 3GSUA 3BCDA 1DDHB 4E5TA 1I1YB 2NTFA 4MAUL 1TFPA 2XN1A 4P8UA 1U8IA 4BFIB 2EE2A 2GSJA 3GDRA 1IEBA 4HQQH 2ESVA 4UWMA 2WHLA 1SGKA 3MROB 1DJZA 5PCYA 5KG9B 4K23L 4FQPA 3FNDA 4JHOA 3GINA 1MY7A 3WH8A 2AF2A 1XGYH 3BE7A 4GRSA 4B6ZA 2CO7A 1XO8A 4OLXH 1XICA 4Z7UE 3GI9L 4OZIA 5E99L 5HHPB 2CRYA 1XWYA 1Q9KB 3HG4A 5EU5B 3T8QA 3CBJB 3GBLA 3CIVA 2HS8A 1TX0A 3C08L 4ALAC 4GX8A 5H2ZA 3DVNB 2RB8A 3E02A 2HWGA 1Z3GL 1HS6A 1KJMA 1KCKA 5F70A 1YMMA 1E4KC 2W59A 3F7YA 3VG9B 5DWPA 2TRSA 4MD0A 3Q4DA 3W2KA 4TV3A 3BLOA 2DZTA 1M6OB 5CSRA 2P10A 5C0CA 5IW1A 4F7PB 3BYTA 2PDLA 1QJWA 2YN3A 3RTLA 5GS2H 5AHLA 3BH8A 3R7QA 2VL5B 4G8FB 3ARFC 4GW4A 1R33A 2NW0A 4XBJA 3VIJA 2BHZA 1JPTL 4WLCA 1BECA 4YHZL 3ATFA 1YEJL 1MEXH 4IGBC 4N7QA 3PHOA 3RWCB 2YHGA 1CU4L 4K3GA 2ZNXA 1MUCA 3LKQA 1MSSA 4ONOA 1JPSH 3V0WH 3MKVA 4PMVA 3EGSB 2R23B 4FADA 5FUCE 2AQWA 2E9WA 2PPAA 2WSPA 4R5VA 3FQTB 4AQOA 4WK4B 3LCGA 3D4YA 4QRTA 3DX1A 3MJMA 4H04A 1TCMA 3IJHA 3KJ6H 1CDUA 2X05A 3F85A 5DT5A 5C0QA 2YN5A 1Q1JH 3LEXA 5D7KD 3TWAA 2XN2A 2Z31B 2PODA 2KKQA 2GDUA 3T07A 1ADQH 5F7UA 4XZ4A 3HPXA 4I4WB 3U3HA 3O6LL 1SOKA 4S2SA 4F37F 4PMZA 1W9XA 4OI8A 1TTBA 4L48A 4JTCA 1JCMP 1J79A 1BKSA 2HPIA 2OZ3A 5B8CC 1IT9H 5GISL 5CEZE 3O1NA 4KNUA 5ECGA 5CCJA 1BZ9B 1QRNB 2CBIA 1IR1A 3WY1A 4EN3D 2E1DA 3RJDA 3T81A 2UY7B 1S7XA 3IFPA 2B16A 5C6PB 1I4FB 4R8WL 3NFSH 1A3LL 4PMXA 1TJMA 1FC2D 1UH3A 3FN3A 4JN2B 4ERSL 1QSVA 4XODA 3FONA 4FAAB 3MOQA 5B3JE 1NFBA 4HVXA 1DLHA 3NBNA 3HMJG 1JG9A 1RQBA 3EBAA 4FXKA 5XIMA 2EEBA 3CSTA 4I5RA 1I3RA 5GPRA 1S5HB 3B2VL 3MS8A 2Z93B 1MNUL 3ML9A 1KXQE 4LE8A 5I6NA 2NXZC 1BAWA 4F80A 3E96A 1R8LA 4JFYB 3FUFA 2JB6B 2ZJSH 2AQOA 5CD5C 4JX0A 4GG6F 2H0FA 1LP9B 2NY7H 1GQJA 4JTEA 4RA3A 4HC1H 5EUKB 5F3HB 1K9DA 2VWEC 5KVEE 2NUWA 1H09A 4G6KH 3FSVA 5IT2L 3BWAB 1XTLA 3SJVA 1AE6L 3VWKC 3QG7L 1WDDA 3COTA 3LKOA 2F0CA 2UVFA 3RKPA 1PDYA 3S36L 4GD0A 3BOXA 1M7UA 5TE4L 4DELA 5B39B 2YDSA 2KDGA 5DQPA 4P8QA 3QCVH 3IDJA 4Y5VA 4MY9A 1DWJM 2LAGB 3ZDWA 3A5VA 5HUOA 2X1IA 3BVXA 2BLEA 3NVQA 3BFQG 4EDWH 3FN9A 2PU1A 5TF1H 4OGAD 4GKLA 4JFTA 4OQTH 2PDXA 3VGAB 2OMZA 4TUUA 4C7GA 3RWJB 4PJHB 4KX7A 1BQSA 4IRJD 5SWQB 2DQUH 2R29A 1ML0A 4ZFZA 5B4MC 5FDWA 4P4RA 2V33A 3L4WA 1TV4A 1TREA 1RZKC 4ZX6A 5C0GA 3IT8D 2A77L 3WS3A 1A3XA 3AXLB 5H8UA 1TPVA 2YPLE 4LRSA 3VFUB 3KP1A 1XH3A 4GKTA 4GXVH 2IXUA 3VIOA 2WXIA 3CHQA 2JIXD 5FV2A 1ZRUA 1EXBA 4WI4A 1Y5WA 4QHMB 4XRCA 4IX2A 2WQPA 1FZMB 4HF5L 3NFUA 5DI8B 4P2VA 4AKQA 2AXJA 1F4WH 1G67A 4L8CB 5IEKA 1AYRA 3QDMB 3HC2A 3PV7A 3B4UA 3CFCH 3F6LA 4JPSA 1M3UA 2MKLC 3OG6B 4LL1A 5TQ2H 1I1AB 4B5SA 2H9GB 1IGFL 1AI1L 2EKSA 4ZFOL 4WKZA 1P4LB 1N5YH 1NGQL 4ZYKB 2P8LB 1F3JA 4OLVL 5CMAA 4FMKA 1W3TA 2V2WB 3WI9A 3UAEA 2P7TB 4KRNA 1H3XA 3QC0A 2ZP0T 4FXLA 1O12A 2WP3T 1YEGL 5DGRA 5JHDD 5DJ2B 1FP8A 3B05A 3EBVA 3UTTE 1G9HA 4IMFA 2J7DA 5B1JA 4ZG1A 2WM0A 2IUZA 3BJSA 1ZLWH 4J35A 3SO5A 4QCIA 5F1IB 1VCVA 4J3VA 4UTBH 5K1VA 4DSYA 1NDVA 1ONQB 3N13A 3D06A 5HYJB 5T8GA 1LP9E 2QAFA 2NY5C 4YVUA 3OKLB 5AVUB 1NEZG 4JY4B 1XUZA 4PHXA 1RVKA 4U3HA 3P4OA 2ORBH 1F3XA 1RULH 4DP7X 4FXJA 3ILEA 3N73A 2HE5A 3WKML 3H21A 5LIUX 4RMVA 3QCTL 1WBJA 4Y2WA 3WF0A 3FB8B 5AC7A 3VWJB 5DN1A 5MENA 2X1UA 4MSSA 3VRJB 2DQIL 3CDGA 5KSVA 3GMMA 4M7KH 5ADPL 3UJIL 5F7NC 1YDVA 4ONFH 4UQDA 1F74A 4JRYB 4IJ3C 3PE9A 3UG3A 2E9LA 2PCYA 1DWAM 3KLDA 1F0LA 5E2UH 2P5WD 2PP7A 4LUTA 3VDAA 3O3EB 3MRCB 4M7LH 2CJUH 5F7EL 5JXAH 5EOQL 4AZGA 4ATDA 5G2HA 1DQDL 3GMPA 2PGRA 1JTTA 9XIMA 1JYNA 2CW6A 2PP1A 4JYDA 3IU3B 4CADA 1E56A 2WKGA 1DUZA 5EU4B 5D1ZA 3V95A 4PJHE 3II2A 2VMJA 4H8QA 4EPBC 5ID1B 3KBSA 3TU6A 1PIGA 3TEZA 2ENQA 4NI8A 2TSYA 4DBDA 2IH3A 4M61B 4AVKA 4A6YL 3C8NA 5TFSH 3CDYA 2WPBA 4WFFE 3OYZA 4NKIL 5EWIH 1MEHA 5JPMA 3GX9A 4G42A 4HBCH 1JZ5A 2RDUA 1PL9A 5B7MA 3F6IA 1YHPA 2XBZA 4P04A 3B8YA 3DYOA 3N6JA 3GIVA 1SOSA 2WZ6A 3GG0A 5HJDA 2J66A 3QDME 1HHGA 3BN9D 1XDJA 5EIQA 1J1XH 1X1OA 4G9DA 1CC3A 3A3XA 4H9XA 3MW7A 3AREB 3G1VA 2AXGA 3UZZA 5B38A 1DN2A 3DMMC 2QS8A 2YD4A 4Z23A 3DO4A 1XAKA 1G9MH 4NGHH 4WWKA 1WK0A 1Z44A 4NCDA 4BUQA 4BF9A 3IJ6A 3RK8A 4JO3L 2FJGB 4X0NA 5EORH 1MREL 2CM5A 2POTA 1E4MM 3MJ8B 5AHNA 3ZRCC 3E3HA 1W0VA 1U3HC 3MR9A 4P23B 1FWFC 4JFOA 5B1BB 1J5HA 2N4IA 4HFWA 4WI8A 3KPQB 4RAVA 4XI5C 2HPTA 3W2NA 5E5RB 2XXCB 2VKZG 4E9VA 5A6LA 4Y96A 4JPWH 5G4HC 4JO1H 3SYCA 1I9RL 2CRMA 1A7NL 3S3PA 1OW0C 4D0DA 4DEFA 4WV1B 5HYJE 4UTWA 3UTSD 1N0LB 2ZCGA 1PAZA 2G0KA 1MFEL 4WO4A 4S2CA 1FH9A 1SXAA 2YSSA 4RE4A 3WJWA 2VVSA 1PO9A 1QSED 4AI7A 2BHYA 3BWWA 4ERGA 3RJOA 4IMKA 1KF9B 1DVUA 3MX0B 3C6LA 4QAWA 1C8XA 3S4SG 1DQKA 3VU1A 4N6QA 4TXVB 2DYPD 4Q56A 4I5BA 3GUTA 4NC1E 4TV6A 3BWUC 1G69A 5M1TA 1PLCA 3QJVB 3UZVB 4ZMVA 2PTTA 2J8UB 3LPWA 3GW3A 2OV0A 3ULUD 1UM5L 3S9YA 3V0JA 3DFSA 1OM3L 1YNTB 1LLOA 1VRSA 1ZANH 3T77A 4AITA 3SCPA 5K9OB 3EB3A 5AVQB 2IS7A 3TA3C 4MQ7A 3CSPA 3WSQL 4FA8A 3S1GA 3WK3A 1B9BA 3QLDA 4FNQA 4GI8A 5DD6A 2H0EA 4C83A 1QOPA 5A7BA 4B2DD 2PP0A 1TA3B 3I9GL 3TSDA 1AHKA 3PWNA 5KVGL 1BVWA 1JNLH 3MUGA 5KYUB 4U3SB 4WEMB 4U1MB 4Z7VE 1O7DC 4MJ4A 4I1PA 2ISFA 1EA0A 5FECA 3L5AA 4PUJA 1Q0YL 1EGJH 2C0AA 1FAIH 4N2LA 4WY0A 4DJFA 2Z8SA 3GPEA 4OHQA 5EA0H 2J9XA 4OZ4B 5DMMA 1CW2A 4ZVJA 1ZV5A 4UV4H 4XZNX 2GOKA 3QEHA 2EUWA 5GZOC 2JQMA 5AFDA 1IE4A 2VQTA 2KERA 3ULVH 4RDQF 3KPOB 2E3VA 1W8EA 3CL8A 2J24A 2V2XB 4JTIA 1LEKA 1T1ZA 3TBTB 3W0WA 3D4ZA 2J7HA 4LVDA 4L29B 4EXBA 4ABVA 4CQ9A 2R1MA 1VLXA 4C4KO 2VP8A 4EI5C 4Q6KA 5AZEH 2IKIA 5CLTA 2C9SA 2HN7B 4FFYA 2Y07L 5AWNL 1V79A 1ZPTA 3WUGA 4LDCA 3VQMA 2XPKA 1MAKA 4TVPE 5AW6B 1GOWA 4QHLA 4WHTB 3RDTA 5HHQB 1SJEA 4MJIB 4X9BA 2A3HA 1NDTA 2AQQA 5F7LB 2FB4L 4GC3A 4AQ8C 4GG8B 1K8YA 4GG6A 3KYAA 1ISWA 4OE7A 4B92A 3FJTA 4AENA 4LCWB 1OT1A 4PN2A 1JD9A 2PC8A 3FQWB 2PKDA 1Q6FA 1K70A 3UZQA 4N8VA 4AVIA 3P5YA 2OJZH 3UFYA 2OO6A 3JUYA 2EICA 1WEJH 2XQYA 4GBXA 3D25A 3VFTA 3MRJA 3BFWA 3V5HA 4K5LA 1X5XA 1GOHA 4W9HC 1KFEA 4E9QA 1OWWA 6PCYA 2UV3A 1I8AA 2W5PA 1WFIA 3HI1A 2HLFC 4MGGA 3KPMA 3UAJC 5DRIA 1K9EA 4UUJB 1IAIL 2CK0L 1T0OA 4NHVA 5ICUA 3DARA 4DZHA 2VTFA 1MJ7L 1PS3A 3LKSA 5IJKA 1QK2A 2YS4A 4IPPA 3U6WA 4AVJA 4CQDA 1ZDSA 4LGSB 1MCFA 3RZCA 4U7MA 5EUOF 2ODHA 2J1YA 1HCVA 3NP4A 4PMUA 5IFPA 3Q01A 3AAMA 2H47C 1K8IA 5AALA 1CD0A 2J8UE 3A0OA 4G1NA 3IV8A 3PBMA 1JNJA 2MCMA 4PV8B 3VXRB 1OTSD 2YXOA 3GM0A 1EDYA 5D6DA 2IAND 4F0LA 1HZYA 3DOHA 2UXGA 4YDVB 4ACZA 3SKJL 3F4WA 3R1ZA 2A38A 1ZEAH 3AG1B 2VXQA 4MAYA 4TTDD 4HIJB 3CYJA 3OAUH 1T5WA 5JIPA 3AU2A 5HGHB 3AU6A 4BF7A 2YUXA 3BGAA 2X70A 5I77A 1B90A 1QPOA 2IKGA 2EDRA 1H6UA 4GHRA 1BOGB 5I1HH 2CETA 1W1YA 2OQYA 1JUEA 4HGWB 4KKNA 3FCPA 1LWHA 5C6WH 2BSBA 1Q6QA 3UPBA 4KT2A 1OFQA 3ABSA 1J05A 4XX1E 5FJTA 1E6NA 4H0LC 2V2DA 1N8IA 4FABH 1TPXB 2DUZA 4XZIA 2X41A 1F1AA 4KO6A 2MOGA 5F93C 2JSFA 2BOCA 2QGYA 2FZBA 4H6QA 4LWWA 4JAMB 4PI0A 4AG4L 2ARJA 3NCYP 4N0CD 2EPMX 1HL2A 4DF2A 1E1FA 4QF1B 1FRBA 2OA9A 5EU7E 3OA3A 5CO1A 5J12C 1GORA 1GC1L 1WCBB 2D3JA 2NQDA 4FZ8H 1S46A 3WKQA 2AAAA 4FXGA 1FV1A 2NMSA 3MRNB 4KHXL 2P47B 3MLZH 2HXAA 1RZIB 2ZWYA 5FYLH 4X5RA 4DEPB 5FS5A 3V4PH 1E6XM 5DVOA 3L0NA 1BD2A 5FAJA 1O94A 1JE6A 3QRGH 4O02A 3RA7L 3FRPB 3WL0A 4UAOC 4OU1A 2QCFA 1KIRA 1Z9LA 2IIJA 1PCKA 3ZXAC 4D0BA 3SPVA 4X8JA 2ZP8A 3WNMA 1TZ8A 1ZSXA 3IJSA 5CZRA 3RIAF 1A1MA 5GRWA 3WO3B 4XG1A 2JKIS 4DETA 4LS0A 1RSFA 2CZNA 1OD7A 3BVNB 1NDYA 3G5VB 4YZFF 1YYML 1YLBB 2B9AA 1I85A 1VACA 3ARBA 3ZE0E 1XRVA 3SPJA 5TDPA 3G5XB 4E42B 1K6WA 1ZT7B 3ENEA 2Z4QB 4K6AA 4I3RH 5A3IC 2UYLB 2PUZA 1BFOB 5F7HA 2YXGA 2HUEA 4WJKB 2YEZB 1W1IE 2O9OA 3DI2B 3UDWA 1NMBL 1P4BH 1A4BA 4G7VH 5CILH 1MYRA 4AZIA 1LQ0A 5FIPA 5IKCA 1B0IA 4EZKA 1HGWA 2QADC 1BXVA 3TZVD 1QNIA 4LUJA 1MAMH 1F8IA 2D0HA 3VXRE 2NV9A 4G82A 2XDFA 1WFTA 1R2TA 3RDKA 3CPUA 4PUBL 3SCWA 2LLNA 3CIQA 3BVVA 3BUIA 1X5HA 5BRZD 5ICXB 3CQKA 3G6JA 1RLDA 2YAFA 1Z0NA 4R33A 1XSIA 4Y5XB 4A66A 5J57B 2F38A 3C4UA 2QULA 3MPCA 5IB2B 2KLTA 2EZ0C 1RUAL 4DVRH 3QIBA 1DQJB 2CUAA 3BQ6A 3MV7B 3O45B 1ZHBA 4N0FA 4I0CC 4HIIA 3GB6A 3WJZA 3BKML 4NPYA 3WJLC 2WMPA 2IQ9L 5IJVB 2WTRA 3OQ3B 1PXGA 4ZMQA 3O3UN 4HH9B 3STCA 3APFA 5EBMB 2OT0A 1Y0EA 3IDYC 3T6ZA 5AKQA 4MA8L 3X3GL 3QNXA 1A7QH 4OJAA 1FX6A 2XGIA 2JKRM 3GJFB 2UY6A 3V5CA 4K0OA 4Q6XA 3DHMA 3ZLFA 3FTUA 5C6MA 1DJWA 5DK0A 3STLA 5GS0C 3KWTA 3V4LA 3DHUA 4PRAB 4WVRA 3BUQA 3OKNA 4LOUD 4RQQA 1B2YA 3VI2A 3D1MC 1I3VA 3O6FA 3GS0A 3B8UA 3DOSA 3OR7B 4OFKA 2F8IA 3MNZB 1FFOA 5L2JA 3GSNB 2VLKE 3GC4A 1A6PA 2I17A 4RDYA 2J71A 4KVPA 4U1IA 4IS6B 3PFUA 3I10A 2YFNA 4JG9A 1B4EA 2J4WH 3L3OB 4BINA 6CGTA 3BT2L 1UCBL 3GFYA 1WBZB 2IGTA 5JHAA 2BVQA 4WWOA 3M07A 5I3GA 2KZWA 3OKKB 3K74B 4N22A 3MYPA 3RM4A 3NYKA 1GVIA 1O9ZA 1W72H 3SE8L 5IWLA 2B1AH 5A8OA 1QHPA 3DKLA 3NGBC 2EIEA 3PWUA 1YY9C 2WMIA 3LM3A 1EJXC 4HCHA 3LD8C 2DQHH 1QFUH 4CMMA 4KK9D 1PKQA 2O4QA 4KKQA 4APQC 2RGSA 4XP5H 5JQ9A 1D6VL 4TUFA 3PWIA 1GSKA 3KWWA 5I02A 4TQIA 1RQ5A 2VDKL 3QI9B 4MZ2A 2FGZA 4IRSC 3RHGA 3RBGA 2WZEA 4Q8NA 1ZE3C 1Q66A 4PGLA 4PEKA 3EFOA 3O4LA 3Q1SH 1GPOL 3STBA 4HZ7A 2C13A 4Y16C 1I7RA 1LHZA 4Z7NB 3VQLA 5E6YA 3VXOB 3TVAA 1OAKL 3NT0A 4DKEL 1ZCOA 5I6PA 1KA9F 3PS7A 4XTRD 4YLWA 2NWSA 3H24A 3GJEA 3E2SA 4AZCA 5H8PA 1GGCH 3WIAA 3U4KA 3AY4A 1OF2B 4KCWA 4OZFH 5JNYB 5K9CA 4HJUA 5IV2A 1R5IA 4U49A 4LVAA 1IWAA 5F3FA 4PTMA 4TN9A 4LKCB 2FYYA 1E28B 4R26L 1CBVH 1R46A 1B0WA 1YEKH 2RH0A 1GJUA 3BJFA 4JGMA 5CFAA 3WG7B 3S5LA 4S0HA 4MWAE 3GJFK 3N9RA 2WLLB 3HPZA 5CGYD 3GTNA 4Y4FD 1NLDL 2V5LA 3FAXA 4ZODA 3NSCA 2ALDA 1LO4L 4WVXA 3QF0A 4U6YB 2Z6JA 3BG3A 4NKOB 1DUYB 1KDIA 2MRYA 3T42A 4CNSA 1EZVX 1K2DB 2O6EA 4X6EB 4XNQA 1S7WB 4YXHL 4XO8A 4QRFA 3GZQA 4GK8A 1YMYA 3B0VC 5L8JB 1FPTH 3VXUD 3Q8BA 4HIXH 5FF2A 4OFDA 3GDLA 1DEEB 4ZMTA 4V11A 3BUTA 3RLSA 1NKOA 1FA4A 4ALAL 4O17A 1JHKH 3DX2A 3QK0A 5C09B 2ZYRA 5B1AB 3M1BB 4M6VA 3TPUA 1W9BM 1KCRL 3TMQA 4ISVA 4G9FE 2A7PA 2CBUA 4ODHL 2HRHA 2X1SA 4H9VA 3C5JA 4M5YL 1X5LA 4C5YA 2OJEA 4I6KA 3EX1A 4MMXB 5IFAH 1MCOH 4JANA 5GGTA 3S2MA 2FBRA 1PZUB 4GAJH 1VBRA 3LXCA 4M82A 1TVPA 3V6OC 1FL6B 4EXAA 1TTIA 1MUJA 3K1KC 2EAWA 3MTWA 3N2XA 3FF8A 1JZ6A 2F54B 4D6GA 1GOMA 3UO8B 2PLCA 1Q0EA 3RR1A 1LE5A 5D96C 4G83A 1WPCA 3CVIH 3P3YA 1AQMA 5FAAA 3ZPDA 2EIDA 1B3OA 5CINH 2PXYA 2AZUA 4Z7OB 1KIPA 4I77L 1ZHAA 3ZQWA 4KRTA 1OKEA 3C52A 2QVTA 2GYIA 4EJ1C 1UQYA 5E08L 4X60A 5D1QB 5JPNC 3W82A 2VDOL 2IADA 4JPIA 2CPCA 4FXSA 2E9BA 3UIYA 2I32A 3O4OB 1B0RA 5LAPA 3UYCA 1A3QA 1XIFA 5FYJD 1IC4H 3PNRB 4FB7A 2ZZ4A 1IAII 2X4NB 2Z3FA 3HCVA 2X1QA 2CLPA 4L1GA 5BROA 1TB3A 1OM9A 4P3CH 2H0JA 1M7DA 2D2GA 3WJJC 2X6MA 5TE6H 2X4UB 4UT9A 2G5WA 1M9WA 3OPSA 3GBMH 3EFFB 3UR5A 5INCA 5HP5A 1KJ2B 4ODUB 1Y6MR 2B9BA 3Q6GH 4MNHB 2NVAA 3E1F1 3NCYS 2G4GA 3RGVB 4HLZG 3CG8A 4H9MA 2Q6WB 2EVJA 5D9MA 4N86A 2ENJA 4FMVA 3GB7A 1EO5A 3B1UA 4UT7L 4FD0A 3I2CL 1UWGL 4N9GA 4JPVH 1F4HA 3V52H 1YUHB 5CJOL 3ITGA 1IGJA 3QUYD 1XB8A 4M5ZL 2VITB 3ZRFC 3QJZA 3R0UA 4KTEH 1XISA 2ZYHA 3NDOA 4NNXB 2FTWA 3MA7B 4JM2C 2OXHB 4KU1A 5BYWA 3QTGA 5F7YC 3HHSA 1NC4D 1P0KA 2F7FA 1F90H 4GSUA 2ZKYA 1S3RA 1WS8A 2YDAA 2DWDA 4PV9A 1EEYA 3MLSL 3QIUD 1EEZB 1LUCA 3SGJC 5JOFA 3VW3L 5FD0A 3PP3K 1EZLA 4E5XG 1YMHB 1D5IL 3VXMA 2DTSA 3OV6A 3US1A 5C09E 1T41A 1S3TC 3FVMA 1ZIAA 3ZQ9A 1T2JA 4QKTA 1IZJA 5LBSH 2E4FA 1AW5A 4J8QA 2G9HA 2MQ3A 5KYWB 5ID0A 4PRIA 3EA1A 2EEAA 3WEMA 3NQ2A 3TTQA 3CFUA 1XLIA 1E1CA 4JKPH 3TTOA 3EYOB 3LD5A 2YWYA 1WAEA 2K45A 3CJJA 1H5VA 4JQIH 4ZMOA 3QXBA 4Q14A 3BSZA 3PJXA 5LA2A 2YK1L 2G75A 1XDLA 2QR0A 1YPZA 3M5VA 3NQCA 2CKBL 2DWEB 1DFBH 4MB5A 3LXAA 3Q1EA 3V0DA 3B3IA 4NNPH 4N42A 2QQLH 3DROA 4Z7QF 4ZS6D 1RZKL 1ZHLA 5E7BA 5BCAA 4BWTA 3BP4A 3LZRA 3O2VH 3VNMA 2YXWA 4Z7OE 4IGSA 2P5ED 3WLTA 1AD9B 3H7BB 4OCXL 3HN5A 3HPAA 5A8GA 1UWYA 3TA6A 1Q9WB 5HHOB 5D9SB 4P7OA 1SY6A 4RE2A 5IB5B 3BT0A 3B9EA 2HMID 5RUBA 1P5UB 3MT1A 1XM3A 2YLAA 1BYBA 4MS8D 1F5WA 1XXDC 3GIZL 5AW4B 5D55A 3UJSA 4Y8EA 5C0BE 4R84A 3ZWTA 4Z78A 3UAFA 4OQVA 5D09A 2K6WA 1VIZA 3LU2A 4LVOB 2WMJA 1D5RA 4HT1L 2XZCH 4M03A 4YWGH 3MBEB 1KB9J 5E9NA 2ADGB 3S42A 4HTYA 4IDLA 1I3GL 3ZTNL 5IM51 4NWTL 2ZZ5A 3NQVA 1K9FA 2W65B 4HCDA 3AMCA 3TBYA 3ZYJA 2PN5A 1CICD 1MQPA 2VH5H 2OI9C 1ECYA 3ME0B 5DVPA 4WTZA 2VDRH 3PAJA 1ME9A 4ZQCA 3BD3A 3FU6A 2BY3A 3BL3A 2P4AB 3P1VA 6A3HA 5KSWA 4LHUD 2CGYA 1KB5L 3QH2A 3M9YA 1B9KA 1A50A 3HLAB 5CSGA 5F4XA 7PTDA 4OGYL 5IVOA 4NSBA 3K4DA 1XYAA 43C9B 3UGRA 3LZ5A 4PY7A 1KN4H 4GP5B 2AQTA 2KMWA 3AS0A 3AZUA 1UWFA 5DQDL 1E2VA 3PGFL 1XF2B 1OGGA 3R0KA 1T5XB 3GNNA 1R9YA 4HPOL 5HJYA 1UMLA 2WLYA 2O4EA 3AT8A 1P0EA 4AWSA 2ZG3A 4HA4A 4GFTB 1U41A 1Z6KA 2VELA 2QMJA 3W7JA 2CMRL 4DO4A 1JNDA 3WN5B 4XO3A 3WDHA 3F4NA 3EYUL 4MLIA 5JZ7C 4YBHA 1QLEB 2AGTA 4G6JH 2X2UA 2O5XH 4FNUA 2D7MA 3S34H 3CDZB 3GSVB 3UXLA 3TONA 4NAEB 1BFVL 4HIHB 4CILA 1BLIA 4M4PA 2W91A 3ZE1F 1JGIA 3LCXA 4WW2F 2QVFB 1TYGA 1Y6KR 1ZVHA 4EWJA 3AABA 3UYOD 5GGRB 4Y4KA 3SOBL 4YHKL 1WBYB 3RPDA 4IOSD 2HRLA 3N9SA 4N2IA 2DSZA 3EHBD 1VYSX 3NQKA 4DOHE 3GXPA 3MOAH 2NY0C 4PTTA 3BZEB 4WDIA 4ZENA 1NCTA 1GKPA 3CHPA 1ETZA 4AD2A 5KAQG 2VM4A 4FR6A 1JVLA 4QOKE 4HWBL 1XL6A 3KYMB 2OR8A 4Y2OB 1JF5A 5LSMA 1ZHNB 3F4VA 2BODX 4XAGA 3O6YX 1AKJA 1OX4B 2VENA 1RP9A 1U58A 5HJGA 3LRGA 5HHOE 1FGVH 4FXKC 2FKPA 2NSOA 4G6FD 1W2VA 5ABFA 2IOMA 1NDMA 4JL1A 4IBZA 5FKPA 1TSRA 2VXTL 3DX6B 4BH7B 4V1DB 4UM9A 5L6UA 1ISXA 2TODA 3GY1A 4MDIB 2CO2A 2X7LA 5IRPA 2WBWB 2YD5A 3NOEA 1RA5A 4GT0A 1H7RA 5CBIA 3WH9A 5KSUA 1JERA 1NWPA 3VAVA 2B7QA 2WHKA 2PETA 1BX2B 1BQUA 2X09A 4AK2A 3IWPA 3TLQA 1GGUA 1Y5XA 2TSBA 2ZKHH 3ITXA 3LPFA 3L5WB 1HCFX 4FHJA 3OZLA 3G3MA 4ELDA 2WLNA 1JR1A 2ZOKA 4OKVA 3WUWG 1EWHA 3GVRA 2Z91A 3NQMA 1CYWA 1ZTXL 3FS9A 1MG3C 2DWTA 1G7MB 2C1OB 1B4KA 2H3NA 4Y5VC 2CCVA 5DLMH 2F6KA 4HZLA 2WZ0A 2OKTA 3CHDA 1OB1B 1ZGLA 4DUWA 2W81C 1GXEA 3MNWB 3QJRB 2HTLD 5I1EL 5KVGE 4QNEA 2WLHA 2VC5A 3MNVA 1INQB 1XCQA 1IC7H 2O92A 3V1PA 4LEOA 5LHFA 3T6XA 3O41A 5I6XB 3HBLA 4MNQB 1XKYA 1BRLA 3WH6A 2YPLB 4K3EL 4F8OA 5AYXA 2GTWB 1OX5A 4KOBA 1GPWA 3HZYB 6XIAA 4TLTA 2G5RA 2WXOA 5FYKU 1QSFD 2CCWA 3OVPA 1DBML 1Q6GA 1BYCA 5E94B 4NP7A 4O51A 1TU2B 1WJ3A 3EYFA 3SDYL 4J6RL 4AQ1B 3VDGA 1QUPA 5I09A 2Z26A 3LNGA 1E30A 1G5AA 4M6MH 3GHEL 5I79A 4FNRA 3AB0C 2IQAB 4F48A 3BGFC 4S0SD 3H55A 5MERB 3VDBA 1P7QB 5HGAA 5I8CB 2CIKA 1YEEL 5HSFA 2X4OA 1NCDH 1WUZA 4C7DA 4LRTA 3AVEA 2OSXA 3H4WA 3W87A 1AR1D 5T1DL 3QPYA 1BG9A 5DO2D 1BXNA 1LNUA 1H0GA 4PEEA 4A2MA 4N2OA 3N40F 2V5TA 4J27A 1OAYL 4HU3A 4R90L 1BAFL 5IJCC 4YXGA 3V4VL 2KPNA 2FO4A 3L3DA 1AH3A 3UTTB 2KBGA 1VPOH 9RUBA 2X9XA 1FZOB 1RP8A 3STGA 1TELA 5B1JC 1K3ZA 2BVEA 2OZ8A 3OKMA 4DP9X 5LVEA 2EVIA 4IU2A 3NEVA 1TZ7A 1VFAB 3SDCD 2FPTA 4V1DE 4NU7A 3ESMA 3WFBH 3MLRL 4HXAL 2Q1EA 4ZFGH 2ZUQB 4HDIA 1RH8A 3NG5A 7PCYA 4Z3JA 2M2DA 3HFMH 1TZIA 3MMDA 2YAMA 3JWDH 5C0NC 3AU1B 3XINA 3SBPA 4XOEA 3NPXA 5DURB 3UJ2A 4XWOD 2WIIA 3KNBA 4P5TD 4KTDL 4WJEA 1TYEB 3WL9B 4S3GA 3L17A 5I66B 2X12A 4PE8A 3MJ7A 3K0YA 1VYPX 3FUHA 2XTLA 3PB0A 2GSGA 1KLGA 1NCBL 1S2UA 3F1QA 2G5BA 3H6JA 4ZAKC 4YDMA 3L0GA 3FNKA 3P82A 3PDGA 2X9WA 1KGCE 5E6IA 1I1CA 4OCRL 4CD7A 1JPHA 2XX1A 3L5LA 1KENL 1YYLL 2DU2A 1F1DA 1CGSH 1LP6A 1TTRA 3MUJA 3GK8L 1JUFB 3WMSA 4DFIA 5AYYA 3O3AB 2A0NA 4MNQE 3KYKH 4U7SA 1B54A 4NVTA 3T3MF 3WYZA 1DHKA 3S5YA 4YDNA 1FTXA 5I74C 4FTVA 5JPMC 4QRQA 3BP7B 3IVKA 3LDBB 3V6ZB 4NP4H 3CFKB 5SWZE 2APWA 4ZCWA 5EMJA 5DZVA 1MRDH 3PY9A 2R2HB 5F1VA 4MNGA 1F73A 4PRHE 4GGBA 2PBGA 4HKBB 3WUEA 4M8VA 1GYVA 4FOJA 3DOPA 2VCOA 4PGBA 4KNQA 3O3DB 1V5JA 4Z6AT 4LSVH 3ITOA 2W0PA 4NNYA 4YO0A 4CDGC 3QUGA 1YC7A 1YXYA 4XN5A 4H7ZA 5GHWH 3BKYH 4F8TA 5F71A 2AJZB 4ZXBB 3SDXA 1NQKA 5EO1A 1EGZA 1OG6A 5KZ6A 5E9DB 4Y4HB 4FHBD 5C9WA 3W11D 2G2PA 3GI8H 1EV2E 3H6AA 4PP1C 1Y8BA 4ODSL 2DH3A 1SZGA 1DCEA 4J39A 4G6AD 2A9AA 4O58H 1TPWA 1BA9A 3BD4A 2WC4A 4M62L 1KCSL 4ANUA 1DE4B 2V9DA 1CX9A 5AW7B 3NN8A 3HMXH 5LIXX 2AXWA 2ZONA 3ULVD 1O1ZA 1I8KB 3N6QA 3OBKA 3GC2A 5C9JB 4N8VG 3HE6A 3FU3A 1BQCA 1CG9A 2WNNA 1V0MA 2IVFC 1A6WL 1VR6A 4F7KA 4HWNA 3S48A 2W07B 1JCXA 4FQXA 4WEUD 4JTRA 3KL0A 4IJBA 2W63A 3NQ8A 3GNOA 4TMCA 5FF6A 5LG6A 4WJG3 4UTWC 1UH2A 5PAZA 4A7GF 3DFPA 3C87A 3UIZA 4PR5B 4X4KA 3OG4B 1PLAA 1HDMB 2P43B 4OOUA 4LLYB 3TW6A 3AWFA 5AVWB 5LNSA 3FFSA 1OTUC 5J11C 2R82A 4OD1H 2FMOA 1E1EA 2NZ1A 3II3A 3WY4A 4JY6A 3RU8L 3TV3L 2FBOJ 4K3DL 4WFHE 5I5JA 4HJFA 3C6LC 4H8WH 1X1ZA 5BS0D 4PJGF 4HGMA 3E0WA 2VLJD 4BUHA 4NQDA 1OC5A 1S3KH 3W74A 3DX8A 2YQGA 3QO1A 4PRPE 1P6FA 5F2MA 4D9PA 3L5XL 4FFZH 2J8TA 5HJXA 1UKTA 3GMLA 5FO9B 2O0TA 4FG0A 1EC9A 1M1XB 3I6SA 1S9WB 3VFWA 4DESA 3G18A 4L0YA 4DGWC 3MRGA 4BE5A 4KJYB 4Z95L 1OHLA 2R0ZL 4E9TA 4ZI8A 3DX5A 2HVKA 4GNKB 4KEUA 3BIAX 3ATDA 3PDOA 4PMFA 2HFTA 4OBSA 5F9JA 1QNSA 3GMQA 2QFPA 4N90E 3FO1B 1RUPH 4L8SB 3ENLA 2UBPC 4J4PA 3ECBA 2O30A 3E9TA 4IOIA 3MRPA 4C6FA 2VM9A 1W56A 1SZEA 3FC8A 4I87A 1I8JA 4Z7VB 3TH3T 4L5FL 4WW2A 3WDIA 3KPPA 4BA0A 4CNIA 2IPGA 4DN3L 3NQ7A 1RZ8A 3DGDA 3LB6C 3H0TB 5DJDB 1QT1A 2V2TA 2ZZUT 1GQKA 4QTFA 3L68A 3TOPA 2XWCA 2OL3A 1SVDA 4DJFC 2J5WA 2PO6D 1FWBC 5D4IA 1JGUH 1CLYL 4D0CA 2QV2A 1LO2H 4HHAB 2Z2UA 1KKRA 2EDKA 1KCUH 2GK0A 4LDOB 3X11A 4NNCA 5IFJB 2X4RB 5ISZD 2WWDA 5IXEA 4GI6A 4KO9A 3KH3A 4GRLB 4OJCA 1PLGL 1CK0H 3ZLQC 3FXGA 1QBBA 5D7IE 2ISWA 3SPCA 4HETA 5HY9B 3QQ9D 3FB5A 1O7VA 1TPH1 4MCZB 2BDNL 1PKLA 1VYRA 5HINA 3U9IA 1RV6X 1QFOA 1E4LA 1OCNA 4X6CF 2VN5A 4HX1B 5FUOH 2HBVA 5E9DE 3QUMB 3UO1H 4KWWA 3ISIX 2YD8A 1PZ5B 3ZL4H 4APXA 2L7JA 5ABHA 5DWUL 2PS2A 3D85A 4ZUTB 4UTLA 4JZJB 1W1A1 4NN6C 1NCCL 1YJDH 3MC0A 3P62A 4FG6D 3P61A 1LROA 4N8CH 5TNVA 4K9EH 1U1HA 2UX6A 5IROD 1Q7QA 3SQRA 3U7VA 5EDSA 4RGMB 3X1BA 2L7UA 5HI4D 2Q3XA 3MLYH 1TEYA 2FGLA 1ZAHA 1PHQA 3TJEH 3JS3A 1A5FH 4X0KA 4LLVB 1RUMH 4ADJA 3OHXC 1YDYA 4BZ2A 4GBXC 4QSFA 2PFHA 1XQ4A 4Q9RL 2YD3A 4KHTL 1I7UB 1H15B 3DGCR 2G0LA 4LY4A 1DVFD 2A0LC 4F58L 3J7HA 4JW3A 3EZJB 3NQGA 2WVSA 4LAKA 5GS0L 1XYMA 3HNSL 2BSTB 5CKSA 4GMTL 3P73A 2Q6ZA 4OZOA 4WK9A 4Q4OA 5EU9A 3UTZA 2XZAL 3SGKA 1JCJA 3THML 2BNRA 3VTAA 2QKIB 4Q7NA 2HK0A 4DP0X 3RZCC 7XIMA 3L4XA 3MCYA 1J0JA 2VDML 2OMVB 4XBGA 3CVCA 5C07B 3RL1B 1KLYA 4GISA 3UC0H 1ZVYA 2B7PA 1I9JL 3ML8A 4IF2A 1T83C 1PTAA 1LBMA 4IJRA 5A8PA 4A2RA 4UU9B 3D0VB 2CHZA 4GIAA 3VFMB 2DJLA 3QYNA 5EF0A 4KZEH 3GU9A 4LSRH 3OAZK 1OK4A 4JEQA 1E6OL 4XNDA 3HG0A 4LPCA 1ESOA 3B5GA 4CJ1A 1NPUA 2QHLA 3JVFC 2HVMA 1FWIC 4A2FA 1BW8A 1BBJA 4H1LH 2VFGA 2EAEA 3KPSE 1JSYA 3URNA 4HUWB 3UTQB 1GYUA 4XC3L 2BPBA 3R5EA 1E7UA 1FYTA 3B0YA 1GW6A 2EECA 3V0TA 3NZUA 4ANXA 4ZSOE 3VIHA 2D24A 1C08B 3MCG1 2OMTB 2ATMA 4X4XB 1UIPA 5EEVA 6REQB 4NIYE 4MA3B 2COQA 3N6YA 3UXDA 4O1FA 2OKOA 3GRWL 1TVNA 2GQ8A 3QEQB 4Y7EA 4D1IA 3AHZA 2B0SL 4FQ2L 4PN6A 1RHHA 2W60A 4WI6A 2NV2A 3T1GA 4PWHA 3E2VA 3LQAC 4P9HH 2PLJA 5IQOA 4FYRA 5EU6B 2X4QA 4N2HA 5FCZA 5FGBA 3TYUA 1J8HD 2AL2B 1J5IA 4OKDA 1UQSA 3PZGA 2EBNA 3V4UL 1ZVSA 5JMRA 4NUGL 2HNEA 2HKFL 4Q8PA 1R3RA 5LJYH 3EOBB 2BMKB 4V1YA 3W7LA 3WO8A 2Q71A 1R47A 2CU0A 5MHSE 3E0LA 1I1WA 2RH9A 4FQHB 5JW3L 5C08D 4HUXA 3L2IA 4H4IA 1WZLA 1EXGA 1MIML 4JM4L 3XISA 1DKWA 5C0AE 1JZGA 2J88L 2NSXA 4FXGC 4GE8A 4AH2B 1G6RB 1V7NL 3ZYZA 1XLJA 3IFOB 2A9BA 3L23A 5AB0A 4FQCH 1A1NA 2CXKA 4RFNC 1IEIA 2EYRB 4KK6C 1UH4A 2NSQA 3F3HA 3E80A 2FX7L 2NQ9A 4Z9KB 3JYCA 1DSFH 5T1KA 2DT1A 1MCNA 5SWSD 1WBXA 2I14A 2JGYA 4HAKA 5FC9A 3CQIA 2L0DA 3NL6A 4WDUA 3BIBX 3ZVHB 4OF7A 3LA4A 5EC2A 1WV2A 1M7XA 3EG9A 4LANA 1OCRB 1ADOA 3ZUNC 2JIWA 4DWSD 3ZE0B 4RZCA 3W7OA 1U8PB 1DANU 2L04A 4A2LA 2MWCA 1D2KA 4KDTC 1HKJA 5T3XL 1MHEA 5DLCA 1DJQA 5D7LD 2J7GA 5A8NA 1N7ML 1IAOA 5BO1H 2ANUA 3JUGA 3UDWC 3TO4A 4XN8A 3TSBA 1EIXA 4XHJC 4X83A 3LZFH 1WAAE 3BV7A 3M43A 5C07E 3W1QA 4PYGA 3CFJB 1A5KC 2Z8VC 2WC7A 1S7SA 3FQ2A 3B9KD 4PJXB 2EO7A 4LCIL 3ECVA 1ORQB 4FNPA 4O28A 1G5GA 1X7QB 1F4YL 3ISYA 4XT1C 1ROCA 3S9ZA 3VI3F 2G41A 4IOTA 3RQ3A 3A21A 4GKZA 3P54A 3UH8A 3L4CA 4A4AA 5KN5B 3GUGA 2J75A 3B97A 4ZS7H 1EAPB 4P46A 4HCRL 1XZ0A 2EH7H 1VBGA 1MI5D 1X4YA 2BCKB 2R1WB 4Y9PA 3I6KA 4G8IB 1KRAC 1RKRA 1ZCCA 3OJDB 3EO9L 4TQTA 3RF9A 3KHJA 5L4JA 2CHXA 3DO7B 1TRIA 3QARA 1MHCB 1CD8A 1M7OA 1AD0A 1RFDH 1RA0A 1OPOA 4F0KA 1QUNB 4YHIA 4LTSA 3C5ZD 2IQTA 3GTVA 4F79A 1W15A 5L2KD 1EHLH 3QEQE 1IHIA 3RRAA 2WWMC 2NQLA 1MFBL 4U31A 2IGFL 4YCOA 3BRGC 3QIWD 5J8OA 4P5UA 1X6NA 5EU6E 4N4YB 3TBVB 4JTJA 1ZV9A 4WTQA 4MDJB 3LIZL 5E2WL 1TR7A 4YX2L 1QI5A 4KVNH 4LVFA 2HH0L 3DGGB 2X53A 3ZVIA 4QCFA 4JFUA 1BXCA 3MODH 3DX7A 3MMEA 3Q6FB 4X6BA 2GITB 2DLGA 3SN1A 5I8EA 5T1LB 1G4RA 2INEA 3S6TA 3SBFA 3O8XC 3EPMA 5D2NB 2GIXA 1S2WA 4A8LA 5IMMB 4YBLC 4BF5A 2VLKB 3EGXA 5EH1A 4LLWA 4GCAA 3LRSB 1AKPA 2X42A 3N2CA 3BO8A 3L1OH 4PJDB 4A7GA 1A8JH 4MHHI 2NY3B 1XJBA 3CHVA 1TCRA 4LBAA 2J6EA 4ECNA 5IY5B 3NIGE 3SCMC 4HSOA 5I76A 2GJ6A 3NZGA 1E8ZA 5CSZA 3QBUA 2GFBA 1OK8A 1GEHA 1A9VA 3BEVB 3TIDA 4CBZA 5AFAA 3NFPA 4PJGA 4GJJA 4G6MH 1AQHA 2YYUA 5FAGA 2MFNA 4NNAA 4OBRA 5MP6L 4XAZA 3E7JA 4G5ZH 5GZNC 3UF9A 2E8YA 3TH4T 1XF4A 4CSPA 5CZVL 5HVWA 3KZSA 4WUUA 4JFEB 5I6SA 3NQEA 3RIFK 1UKOA 1PV8A 5L0QC 1J87A 5DXXA 1E5YA 3VMOA 1TTAA 4HCFA 1A7RH 2CO6B 4YXLL 1LM8V 5F72S 4W4OC 4LARL 1XF0A 1VH7A 5D2TA 2F61A 3NQBA 3GIYA 3RX3A 4PVMA 3PUCA 2J43A 1OG0A 2PW2A 3L65A 3HZMA 1HKLH 4KV5E 3T0EA 3HI5H 4J3BA 5C0DB 3SQBB 1JPFA 3QSRA 1FQ0A 5I0WA 4YVVA 3GBDA 3ZDYB 4PJXE 5CAYB 2XOTA 2DT3A 1PF3A 3GTXA 1KXTB 1SEQL 2JI2A 2H2PD 3O63A 1B4LA 2X88A 3AY4C 4HHHA 4U3CA 2XZ9A 3TQVA 5ECJE 4NZ4A 1BZ8A 2IFFH 3V1HA 5I8KH 3VTTA 1UKQA 3MCOA 3MV11 5BV7H 1QW9A 3R11A 3RAOA 2IWGA 1OSPH 4IHBA 1WLHA 4HWEH 3FQUA 4NO2B 2ASHA 1HKKA 3SYAA 1HXJA 4GAGH 7CGTA 1U8MB 2PDIA 4GW5A 1ACYL 2XA8H 4MWAB 4AM0B 4F2ME 1UYWL 2W95A 3HUJF 2CA3A 4N5ED 5BW6A 2Y5JA 4X6CA 5DZNA 4IEFA 1L9RA 2HJLA 4RDVA 3N1MC 3D39D 3BOVA 4GXFA 3CFDB 2FZNA 1GHSA 1FQ9C 3PL6D 3WQ4A 5HR7A 1XIWB 1J6OA 3W7PA 2HG0A 5IF0B 5BZAA 2VERA 4RMTA 3GSMA 5AZ1A 2DBLH 3BQUA 1S9XB 2XSAA 3W23A 1NC2A 1S2TA 2WQSA 1KGYE 4KK8D 4U1NB 3OBAA 1RVFL 1CFTA 2NSMA 4PS4L 1A9BA 5SX4I 2P28B 4NZRH 1UZ1A 1URZA 2QVNA 2PCEA 1J5SA 2E6FA 1KFCA 4MQXC 3WD5L 5C0EB 4G9FB 5D2NE 5C6TH 1AGFB 1WE5A 1PL3A 3MRHB 5D71H 3MV9D 1U95A 2WVUA 4YSCA 2AANA 3J27A 3RWHA 5D2WA 4ZO6A 5LGJB 1HG3A 5HHME 3ARQA 5J1TC 4FQIL 5DMKB 2DM2A 4PJDE 4CW1A 1D7FA 1T1XB 3FSAA 3B1TA 4NZUL 8TIMA 1Q65A 5BMWA 1Z9SA 4O2EA 2HXUA 3MFFB 1IKOP 1E27B 2V38A 2IQDA 35C8L 3UOAB 3D4GA 3JU2A 2J1XA 1H9DA 3T4YA 2I9LA 4KMQA 1XCTA 1DANT 3P2DA 2JKXA 1YTEA 1R24B 1K02A 2Y2TA 5FL1A 1CIDA 4B95C 2CIPA 1DIKA 1OARL 2QCMA 1EGVA 4LCYA 1B6UA 1Z7JA 2ACSA 2MPAL 2ZADA 4JFEE 1WOBA 2ESCA 3NDYE 1FHLA 1F41A 1NARA 2R9HD 4XPTL 4EACA 3S88H 3OJGA 1ADWA 2UZYB 3MDWA 1ZK9A 4PS8A 2NX5A 2VMDA 1RJRA 2PXYC 5JO5A 1KR1A 1V5XA 4C6LA 2KQMA 2I5GA 3G1XA 4UTIA 4EF8A 2XIMA 1JF1B 3QNZA 1KJ2H 2AQRA 3MAWA 2VQ1B 3QWOB 4QQUA 1NBCA 2PBOA 3OKDA 4JCWA 3RLGA 4LZKA 3HG3A 4LRNH 3SGDH 4OGXH 4AY0A 3ZDYE 4JR9L 5ICYA 2WSRA 1WWAX 1HX0A 4MCMA 1WAPA 5IQ9B 3BUVA 1U92B 3K6DA 3W00A 3BLLA 1XIHA 4W8AA 2HFGH 2P44B 4GY7A 1FFPA 3F2DA 4AEIL 4HJ0C 4E9XA 1K8DA 4GINA 3CV6A 3ASWA 5DJ8A 3BISA 3WLSA 3LZNA 3MJ9H 4A39A 4ZPVB 3CV2A 4R7DA 3HG1A 2Q7YB 2Q02A 5A2IH 1QK0A 3QWQB 2IALA 2IH8A 1EUUA 1GTHA 4KRPB 2V67A 4ELKA 3ZN6A 2WCGA