3CPUA

Subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Subsite mapping of the human pancreatic alpha-amylase active site through structural, kinetic, and mutagenesis techniques.
pubmed doi rcsb
source organism Homo sapiens
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cpuA01
3KE0A 2PWFA 3N04A 3BUQA 1EO7A 2WHLA 3CZNA 3OLGA 5I2UA 3WQ5A 4GQQA 2JIEA 2W91A 1QW9A 2EACA 2ZUSA 5DO8A 5ABFA 4MDPA 2WCSA 5D8ZA 3WH6A 2ZX7A 2OWCA 2DT3A 3OLEA 4M8UA 4AZBA 3AXHA 4PTVA 2YIHA 3UCQA 1NWSA 1TQWA 1TCMA 4W7VA 2GSJA 1BVNP 1HJWA 3VNYA 1XSJA 4L4OA 3WF2A 4F9JA 1KXQA 1QI3A 3ARZA 2BY2A 3L4VA 1VRXA 5AYIA 5DT7A 4PMUA 1BYCA 1HKKA 2J78A 1TFVA 3APGA 1CGTA 3EDJA 1RP8A 1DWIM 5A6LA 1R75A 1V3HA 5BROA 1B9ZA 3WDQA 5HPCA 1JFHA 1KXTA 2QV4A 1OIFA 1QWUA 4U2YA 4PMXA 4AYSA 3PTKA 1J0IA 2D73A 1PZ2A 5LYRA 1W2VA 1H0GA 3DX3A 2J77A 1C7TA 2PWDA 3II1A 2CITA 1RH9A 1E6QM 1OIMA 3WMSA 3ZM8A 3IJ7A 2WYSA 4DO6A 2IGTA 4HOWA 3A21A 3EMCA 2EPNA 3QHNA 2BY0A 4E4PA 3VPLA 4BF7A 1QNPA 2CBUA 1TR1A 3CUJA 3DX2A 5DMYA 5JBDA 3DDFA 4AMWA 1TVNA 3ARYA 2GJXB 1XC6A 4F66A 3UR8A 3VSTA 2F7OA 1V3JA 2J25A 2G3NA 2ZWZA 1BVZA 5D8WA 5E6YA 3ZJ8A 1JZ3A 1JI1A 1HF6A 2MANA 2J7DA 4CU8A 4TOQA 3WENA 1G01A 3DYOA 1BF2A 1CBGA 3O6AA 4N42A 1X6LA 2J47A 2W61A 5E09A 2J74A 1D7FA 2BY3A 4GO8A 2BY1A 2ZXBA 1LL6A 2CKRA 1QNSA 5ABFB 1GQIA 1C8YA 1RP9A 2C8NA 1G5AA 3NYDA 3BUBA 3N15A 1QHOA 3KL3A 1H09A 1PBGA 3MSGA 3EYPA 1B1YA 3VIMA 1NM9A 1XH1A 5I0DA 3A24A 3MMWA 1OGGA 3SCPA 3WL0A 1C90A 5HDRA 3K8LA 3KEHA 2D3NA 2ZXDA 3SIMA 2XWEA 2JE8A 2O9PA 1UH3A 2CPUA 3SEPA 2X0YA 3OA5A 2DIEA 4PMQA 3BAYA 3B9EA 3PZIA 3RILA 3CBWA 1ZJBA 4DO5A 1HN1A 1XGZA 3NSXA 1ZBKA 1NARA 1TG7A 5HNNA 3WNOA 3SUUA 1UWQA 3AIUA 1HL9A 1J0HA 2J8FA 4M1RA 1UHVA 3ZO9A 2VT0A 3PZNA 4FLSA 1MXGA 3GBDA 4NRSA 3RJXA 3U5YA 2WKGA 3CZEA 2BHZA 1V0KA 2PF0A 3VMNA 3D50A 4UQ9A 5D4YA 1J9YA 2JF7A 1E5JA 4EE9A 2XVKA 1K9TA 2ESCA 4H7VA 1VEOA 1TQTA 1W3KA 3W6LA 3GNPA 3WDIA 3GXTA 3L4UA 4KH2A 1CGUA 3WDRA 5AYBA 4QLLA 2YDRA 5LA0A 3ZR6A 5AC4A 2WLZA 3CLWA 1EOMA 2AMGA 1CECA 4CN6A 2EAEA 2WSKA 3LPOA 4J7RA 5E6ZA 3TTYA 1FP8A 2BHUA 1CDGA 4OBRA 3GXMA 2GJRA 2XM1A 5CPSA 2EABA 1OT1A 2CBIA 3WNPA 3IANA 3N9KA 2DT2A 1JYVA 1GW1A 2YA0A 2ZOXA 1GOWA 1UQZA 2CHOA 1I75A 1JXKA 1UWRA 3EJPA 1E70M 1JZ6A 4PCTA 5A6BD 1ISYA 1ZU8A 1UA7A 4PTXA 3WNKA 5ABGA 4GI8A 4W7WA 1O7AA 4RE3A 2F61A 4PMZA 4C7FA 4C7GA 5A6SA 1M7XA 1V6YA 1UR8A 2QPSA 1QBAA 2VL4A 3MO4A 4HU0A 2YOCA 1PIGA 4XZBA 3AS1A 1UD3A 5M5DA 1EQPA 2UY3A 3A6OA 2WMJA 3T09A 4TTGA 4WK9A 2WVUA 3RMEA 3AQUA 2VMFA 5E70A 5LA2A 1HKMA 1MW3A 1IV8A 4B9YA 4DWSC 3WY1A 1PEZA 3BAWA 4HA1A 5DEZA 1G0CA 2HISA 1BLIA 4AEEA 1JF6A 1K6AA 1TQVA 4D6CA 4J3SA 3EDEA 1HIZA 1OWQA 3CUIA 5A8OA 4Z2HA 4WJXA 2NT0A 4TX8A 3CHFA 5IHRA 1R33A 4M56A 3TONA 1CLXA 1JD9A 4XUYA 3VSUA 4W93A 1V6UA 1GORA 4F79A 3GXDA 1J0YA 1CGYA 5CPQA 4GKLA 3WMCA 4AZ6A 3CZJA 1V6XA 3ZMRA 4EAMA 1X1NA 2J8GA 3WD2A 2HVMA 4AZHA 4AW7A 4UFJA 5CXPA 1UASA 3FAXA 2WMKA 1V03A 4PMDA 1DHKA 2DSUA 1R34A 3CMGA 1AVAA 1DWJM 5GNZA 3BVVA 2WCGA 3AFBA 3M46A 1L0PA 3OGRA 2VX5A 5A6AA 2W92A 3WQ6A 2D20A 1R46A 2Y8VA 2OWXA 3CUFA 3AIEA 1VFFA 4AY1A 1G1YA 1M01A 4PBGA 5C70A 2VO5A 1KXVA 3A4AA 1NOUA 4TXEA 1E1EA 3G6LA 1G9HA 4J3VA 3GNOA 4P8XA 1R7AA 4F9DA 3IAQA 1Y7VA 3WQVA 4UR9A 1KWKA 2XWDA 1HKJA 1VENA 5A6BA 4W85A 3WY4A 1ZBVA 1WDQA 3NDZA 4PUEA 4W86A 3THCA 4F8XA 1I1XA 5A3HA 2QMKA 2XM2A 3QHMA 1JAEA 4UQEA 3AHXA 3DC0A 3RJYA 1B3WA 3L4XA 4CCEA 2XN0A 3AZSA 1B3YA 1PPIA 1B3ZA 1OGBA 3W27A 4EK7A 3HG3A 1UKQA 4JFTA 2YLAA 4CD7A 4W8AA 3B9DA 3EJRA 4UNIA 4P8UA 3BCDA 3T2OA 2WVTA 1E6NA 3F4VA 1AQHA 1AQMA 1GONA 4EANA 1WE5A 3VIOA 5A8MA 5A1AA 3GTNA 3ARVA 3K4DA 4BS0A 5D9OA 4H2CA 4Z2JA 5AY7A 2Y4SA 5A2BA 3MV01 4Z2IA 4HPHA 2D24A 4HA4A 4HMDA 4UZUA 2DQXA 2YA2A 2D1ZA 3W25A 3HZ3A 4U3AA 1OCQA 1SMAA 4UOQA 5E0CA 3AZRA 1SMDA 3VIJA 1E55A 4OZOA 4D1IA 3IJ8A 4JL1A 1TA3A 1OSEA 3BAXA 4MNMA 3VIPA 1TQSA 1DWHM 2Q8XA 3HN3A 3MSDA 2VRQA 3N18A 3RCNA 4D6JA 3NSMA 1V6VA 2EXOA 5E0FA 2WMHA 5GNYA 2VZSA 3KL5A 3TTSA 4MB3A 1DWAM 4R27A 4MADA 4M24A 2VVNA 2DSZA 4JCLA 1H4PA 3WD0A 1LG2A 1QWNA 2C0HA 1ZS2A 1E56A 1W1YA 2WANA 1SYTA 3BUPA 2VCAA 5HOSA 1HNYA 2PC8A 3WL1A 2EJ1A 2ZUUA 3DHUA 3UG5A 1VFUA 4R5EA 1ITCA 4P7RA 3T08A 1UH4A 1EOKA 4OOUA 3VGFA 3ZT5A 4P7QA 2Z1KA 3VDAA 3W82A 2DT1A 3AJ7A 1M53A 3AISA 1BYAA 4AD1A 4TTUA 4HOZA 3K4AA 3WSUA 1HP4A 4UFKA 1E0VA 4JFSA 1C3FA 1V0NA 3T0AA 4JFUA 2YFNA 4Y7EA 1HJQA 3N12A 1JNDA 2YJQA 3WQ8A 2EPLX 3OIHA 3NSNA 2F1AA 4FNPA 1GQJA 3O9NA 1NP2A 1GPFA 4IPNB 1CPUA 3LMYA 5HPOA 1NQ6A 1VB9A 2WC7A 4XB3A 2VZVA 3ZT6A 1EO5A 2QHAA 3D4YA 1QI0A 1EXPA 1A47A 3WEMA 2F7QA 3BH4A 1JZ5A 1KXHA 4B15A 1MYRA 4BQ4A 1CZ1A 4S3JA 2DH3A 2JFEX 1E3ZA 5ABEA 3BXWA 3DECA 1XV8A 4RE4A 1Q6DA 1BPLB 3QGVA 2CBJA 3VIGA 2XJ7A 3GH4A 3QOMA 1E4IA 3DYMA 1GCYA 4AZGA 2W4XA 5BXTA 2D3LA 1MW0A 4M80A 1SZNA 1W9VA 3PZGA 2DSVA 3SCRA 3PHAA 3FXYA 1TA3B 2Y5EA 4V28A 2WZIA 3OLIA 1DP0A 2X05A 4JCMA 4GQRA 2J7CA 1XRVA 3WQ4A 3EDDA 3OZOA 2ZX6A 2CHNA 2YL9A 1EGZA 2XGBA 2JEPA 3M07A 2C7FA 4D6GA 1B3XA 1E0XA 3ARRA 4PEEA 4D6HA 4YHEA 1HVQA 4DWSD 1H1NA 1E40A 2EQDA 5FKYA 3A47A 1KR1A 4PUDA 2XFYA 3AOFA 1UD5A 3VX1A 1QI5A 4CU7A 3VKKA 3DX0A 4AZCA 1EH9A 4FF5A 4AD3A 3ZT7A 1VEMA 1CXLA 4X0NA 2OSXA 1EQCA 2BS9A 3O2LA 3WUEA 3PTQA 4WF7A 5BCAA 1PS3A 1JAKA 3WNLA 4CD6A 4ZE5A 4JHOA 2XFFA 4UOZA 1XSKA 2Y2WA 1US2A 4J27A 1E15A 4AMXA 1JDDA 4GI6A 2W67A 2VUYA 3U57A 2QLYA 2WCAA 1E4LA 1LF1A 4CD4A 3NDYA 3EDFA 3MU7A 2VURA 3ECQA 4UFIA 3SCOA 1V02E 1UR1A 2XVPA 3HMCA 2WKLA 1E6XM 1WZKA 1Q6CA 1JNEA 3VIIA 3B8SA 3SCSA 3CH9A 4MTVA 1K9EA 5JUVA 3AS2A 4A4AA 2F18A 2YA1A 1UQYA 2EPOA 4XZWA 1WAWA 4MB1A 3MANA 2XVNA 1UR0A 4H8UA 4AC1X 3BVXA 2CETA 4MAZA 4NSBA 5M03A 1FP9A 5A2CA 3WEOA 3AHTA 3N11A 3THDA 1UG6A 3IJ9A 2PI6A 2AOSA 1B0IA 5I23A 1CIUA 2WWCA 4LYPA 4DUWA 1E72M 5JIWA 3RPMA 2ZICA 4FLQA 4RL3A 3DYPA 1EDQA 3MI6A 1M04A 1MFUA 2DPEA 2NW0A 3W38A 4H8VA 4KGJA 1U33A 3UG4A 3FAWA 3WDJA 4V2XA 2ZE0A 1UR2A 3BGAA 1DEDA 2UY4A 1Z32X 4CN4A 2CESA 2ZIDA 3HG4A 3I3BA 3AROA 3PZQA 4IM4A 4HTYA 1BG9A 2FGZA 3W81A 2YL5A 3CZLA 2G41A 1UZ4A 2OWWA 1DTUA 4A3HA 4DWSA 3WD1A 2X0HA 2EO7A 3F5JA 3PZUA 6A3HA 1LLOA 3VD4A 4MPKA 1GJWA 4ZE4A 2D0HA 1JF5A 3WBEA 4WSKA 3UETA 5I5RA 1CXKA 1VAHA 4JKMA 2ZX8A 2VNCA 4FLOA 1FFRA 4D1JA 4PTMA 3SCQA 3MUIA 1AQ0A 1KB3A 1EDTA 2WMFA 1GOIA 4UFMA 3LRKA 3CHDA 1UD4A 4GZEA 4URIA 5BWFA 4B9ZA 1ODUA 3GM8A 1HT6A 7A3HA 2VRJA 2WLYA 4TUFA 1MXDA 2FH8A 2GVYA 5GPRA 3WEZA 3ZJ6A 1IT0A 4W8LA 1C7SA 1PX8A 4KRTA 4J28A 4ACYA 3EBVA 2YL6A 3PZMA 3VU2A 2D23A 3AIWA 5D9MA 4YN5A 3ARQA 6TAAA 3UR7A 1V3MA 3EJQA 4NX0A 1LL7A 4UFHA 5A6JA 4PMYA 3LX9A 2J79A 2VCCA 2F1BA 4IISA 1WZAA 4OIFA 1V0MA 2DSWA 4PMVA 4UQCA 1Q4NX 2FGLA 2XPKA 3CZKA 2F8QA 3OBAA 1UOKA 3ARUA 5JBFA 4HOXA 3WF3A 2E9BA 3VSVA 1UKOA 1CGWA 2O9TA 3W24A 4GO9A 2E9MA 1XD1A 1OBAA 3MMUA 2VTFA 1PJ9A 1UWIA 1CENA 4CVWA 1DWFM 1JFXA 4AD4A 4P7NA 3AIBA 3NUKA 1TE1A 1WPCA 4KWUA 1OGSA 4FNUA 3VIFA 2CEQA 3HU7A 4N0RA 5CGMA 3SUWA 1KCLA 3VNZA 4JFWA 3CUHA 5A6KA 5EFFA 1PZ3A 5CLWA 1AMYA 4GZJA 3TTQA 1KWGA 2J75A 4DWSB 2XHYA 1QVBA 2GJPA 2EBNA 4UQDA 5CG0A 4LQ1A 2ZUWA 1W91A 3DDGA 9CGTA 3L4TA 2XYLA 4JKKA 3WY2A 5BRQA 3QHOA 4JZ5A 3RM9A 4CVUA 1NOWA 3VTRA 3W53A 2VX7A 2ZX9A 1FOBA 2WC4A 4MJ2A 5AC5A 4AIOA 2WM0A 1NWTA 2E4TA 3AXXA 3SUVA 3WFZA 1E6SM 5C71A 2A3EA 1UZ1A 1TVPA 4MNJA 5D9PA 2VOTA 4P8VA 4M82A 1F4AA 4DM2A 1LL4A 3ZSSA 2VC9A 2GK1A 1M03A 4H41A 4Q22A 1WDRA 2X2IA 1BSIA 4AEFA 4MAVA 3BMWA 4DO4A 2NT1A 3QR3A 1QHPA 1KGXA 4W84A 3AIQA 1WO2A 3TOPA 4UFLA 1CGXA 2X1IA 3WN6A 3T2QA 3JUGA 5I3DA 1VFMA 2A3AA 2CKSA 4D6IA 3ARWA 1H2JA 3LXCA 1CEOA 2OYMA 3KLLA 2NSXA 3KZSA 1KQZA 2A3HA 4QFUA 4WKHA 1OD0A 5DT5A 1E43A 3L4ZA 4ACZA 4DUVA 2FE0A 1BG4A 3WUBA 1FHLA 2YDQA 4QP0A 3RM4A 4L4PA 1KQYA 1E6RA 1SR0A 2WBKA 1W1PA 2YFOA 3K46A 1GOQA 2E3ZA 3CUGA 4BA0A 4U5IA 3L2LA 5HXMA 2DEPA 3SUTA 2OSYA 1V08A 4NRRA 3CV5A 4OBSA 1B2YA 3ALFA 2W66A 5I78A 1R47A 1TUXA 3ZOAA 1GOOA 3GXIA 1R87A 8A3HA 3WQWA 1EDGA 2EEXA 3FY1A 1E4NA 2VQTA 4A3YA 3ZIZA 2O92A 3VDBA 1MWOA 1GUVA 4NXSA 1UWSA 3AHVA 4QAWA 4CD8A 4KMQA 2Y24A 5C8BB 3ARPA 3WMBA 5A94A 1HXJA 3FNDA 4S3KA 2ZUVA 3GH7A 4W89A 3SUSA 3CHCA 2V5CA 3LPFA 4QDMA 2XIBA 2VR5A 3BSGA 3D4ZA 1W9XA 2Y8KA 4JKLA 4PN2A 2D0GA 4J3WA 1B90A 4WSJA 1LQ0A 3VILA 4JFVA 2YBUA 4ML4A 1PX3A 3KLKA 2DH2A 5CSYA 1HJVA 4X0VA 2E0PA 2WZEA 1QNQA 3WH8A 2UY5A 4NF7A 1W1VA 3ARXA 2TAAA 1LJYA 2F2HA 3BLBA 2RGLA 3KWXA 1XD0A 2E8ZA 4W5UA 2VQUA 2DT0A 3WF4A 2X2YA 3W0KA 3AHYA 1KTBA 2WXDM 5CSUA 3GDBA 4HZ6A 3BVWA 5I79A 1WCGA 2J62A 3CPUA 3IK2A 3CZGA 4ACZB 2X2JA 3S5YA 3PN8A 2XTKA 4AIEA 3OZPA 3VGEA 3POCA 1PAMA 4PMOA 1YQ2A 5E9AA 3VDCA 3RM8A 2YL8A 1UH2A 2J7FA 2BHYA 1JGIA 1EA9C 1L8NA 1N82A 3I3DA 3N17A 1JXJA 3GYCA 2E8YA 1BTCA 5CGTA 4J3XA 5ECUA 1LWHA 3VD3A 1B3VA 2FHBA 2XGIA 3EJTA 3S6TA 1XYZA 4BZYA 1XYFA 1EHAA 4H04A 2XUCA 3BCFA 1CNVA 3TP4A 1BGGA 1J0JA 1OM0A 2BXZA 3BVUA 1CXEA 4W7UA 2BV9A 1J10A 4H8HA 3WF1A 3G6MA 4CD5A 1UKSA 1E0WA 2BVYA 4E8CA 5M3WA 4IPLA 4CN1A 1HJUA 5IHSA 1BYDA 3LPPA 1W3JA 5TD4A 1CWYA 1GQKA 2WVVA 1KR0A 4CGTA 1WDPA 1B30A 3HJEA 5CQ1A 4PSPA 1J0KA 3W28A 1R86A 1JG9A 2FDMA 2XSBA 2WW5A 3SURA 1IZKA 4DM1A 1CTNA 4NZFA 3GBEA 4AZIA 2D0FA 4D71A 3CIVA 3VIHA 3LXBA 5FD0A 4KGLA 3AMKA 3EJSA 4OGZA 4NI3A 2XFRA 3A4XA 3FN9A 1A3HA 2IXUA 1C8XA 1FHDA 5FL1A 4ATLA 5GQBA 2ZXQA 3VVGA 1MQRA 4BQ5A 7CGTA 1DWGM 4GIAA 1ZL1A 4YPJA 4W5ZA 2JEQA 3LPGA 5KZ6A 3UEQA 4HPGA 3UERA 4MB4A 3DX1A 1NWRA 4BCEA 2JF6A 3T0DA 3ARSA 1HP5A 4XV0A 4LGXA 2J7EA 3BUDA 2CERA 3RO8A 2CIPA 1QX1A 5DF0A 4V27A 1J18A 3D52A 1JZ7A 2PB1A 1GNXA 2UWFA 3MS8A 1UKPA 1NP0A 4P8WA 1LG1A 1GOMA 6CGTA 1JZ2A 1GHRA 2Z1SA 2OYKA 1W32A 3A22A 2V38A 3MMDA 2B31A 2VRKA 4NZCA 3EJUA 5F7UA 3W4RA 1WP6A 4HMEA 3A4WA 1TMQA 3WNNA 5FOOA 3H54A 5I6SA 4M29A 1EIBA 3CZSA 2FYVA 1MQQA 1QW8A 2WAGA 3VX0A 2PWHA 4W8BA 3GXPA 4CCCA 5FL0A 5E1QA 2BVDA 4LPCA 5CPTA 4UTFA 3BAIA 5A2AA 1KGWA 3WFLA 4HU8A 2OYLA 4UCFA 1CGVA 4PMRA 2IUZA 4MNLA 2XIIA 1TZ7A 4MB5A 1XH0A 3VGDA 7TAAA 1WB0A 4PCSA 5EMYA 1BHGA 2GUYA 2ZUTA 1CXFA 2F7PA 2OW6A 2GDUA 3AS3A 5GNXA 1WNOA 3N13A 5FIPA 1X6NA 1E4MM 2WVVB 1ISXA 2V3FA 1QPKA 2WHMA 3MV11 1F4HA 4ATWA 3F5LA 4BQ3A 3T2PA 1JIBA 3U7BA 1W1TA 5CZKA 4HA3A 1KTCA 4TX6A 1MW1A 1FA2A 3VD5A 5BXRA 1V3LA 4HZ7A 2VR4A 3TA9A 3OGSA 3WELA 3ALGA 1ODZA 3L4YA 3CMJA 2J7BA 3N1AA 1E6ZA 1Q6FA 3WBAA 1MVYA 4CKQA 5IDIA 3MUZ1 4BQ2A 2A3BA 1GZJA 4U3CA 2GDVA 3VUPA 2WBGA 2ZX5A 3IAPA 1O7DC 2ZUNA 2V3GA 1GQLA 3KL0A 2ZWYA 2WC3A 3AHZA 5A69A 2BXYA 4GPNA 1U2YA 4D6DA 3VDHA 4B16A 2DDXA 1V3IA 3WIJA 3POHA 5EB8A 3W26A 4MJ4A 4LYQA 1NOFA 1E5NA 2OW7A 3MUY1 3S5ZA 2JIWA 2XSAA 1NH6A 4AZCB 2ZUMA 1KCKA 4K68A 2X8RA 5BYWA 1VIWA 1GHSA 1H49A 1KGUA 2VVSA 4U2ZA 1HTYA 2DSKA 3FW6A 1W9DM 3T0BA 2O9RA 4ZXLA 2D2OA 4AZ7A 4J3UA 3PBGA 2V3DA 3AYSA 1V3KA 3FHQA 5A8PA 1HX0A 2YDSA 2VJXA 2ZXAA 3M6DA 1G94A 2VZTA 1IZJA 3D5HA 1JYWA 1W3LA 1WZMA 3VD9A 5M17A 1UA3A 5A8NA 4D6EA 1WZLA 3VGBA 2QF8A 2WHJA 3S2CA 3W6MA 1VJZA 2EADA 4XX6A 4AXNA 1H11A 4Q7NA 3BAJA 3WDHA 4C7DA 3WUGA 3ARTA 3NIYA 4LX4A 2F7RA 3ZJ7A 2X2HA 3WH7A 3D51A 5BXSA 3EDKA 2WMGA 1FH9A 2PWEA 2BNJA 1YHTA 4UQBA 3DHPA 3SCVA 1OD8A 5LA1A 1U30A 4D6FA 5A8QA 3BVTA 1UKTA 1ZB5A 1R85A 3IGUA 1ISZA 4UOJA 2CBVA 1GVYA 2WHKA 1BGAA 4NXKA 1D3CA 3VOCA 3LRMA 5DFAA 4MDOA 4E8DA 2FH6A 4YHGA 1FFQA 2VZOA 3GZAA 3H53A 2G8ZA 1ESWA 1S46A 1JDAA 4HP5A 3BAKA 2QMJA 2EPMX 3A5VA 1H41A 1UWTA 3AICA 1CXHA 2JALA 2VX4A 5CJ5A 2FHCA 2G3MA 2CXGA 1W9PA 4MNKA 1EHNA 3H55A 4ATDA 4HMCA 1J01A 1O6IA 1ECEA 1HWWA 4FMVA 1QI2A 1KFWA 3CHEA 1WDSA 4P7LA 3TV8A 2YLLA 1C93A 1KBBA 4RE2A 5IFPA 3CC1A 1E6PA 4ZENA 3K1DA 3VMOA 2E40A 1ZBWA 1OT2A 3CO4A 4Z2GA 1Q6EA 1R8LA 1HXKA 4U33A 4W88A 5A6MA 1LWJA 2XG9A 3BLKA 1JI2A 3AZTA 2PWGA 1RD6A 2G3IA 1JZ8A 4EKJA 1JYNA 3PZ9A 5JIPA 3AMCA 3ZR5A 1J0ZA 2WWDA 1QHZA 4GINA 1J12A 4CU6A 3U7VA 2CCRA 3VIKA 1BFNA 2WSPA 4OKDA 3NCOA 3BC9A 3AIRA 1UUQA 3BMVA 5EBAA 4KRUA 4TVDA 3F5KA 4AD2A 3LRLA 3WUFA 5I24A 3VM7A 1E9LA 4OJYA 2WZHA 4AISA 4U5KA 3AMLA 3OLDA 2VZUA 2IXVA 4PMNA 3K8MA 3D3AA 1RPKA 1JZ4A 4OOZA 2E9LA 2X09A 4FNRA 1VEPA 2YBTA 3HG2A 2OLHA 2J7HA 3WDPP 3J7HA 3BUIA 5A95A 1CXIA 2YKKA 4IUGA 4AMCA 3VMPA 2FHFA 4AZ5A 1QBBA 1HL8A 4QLJA 4D72A 1E71M 3M7SA 1T0OA 1ITXA 1GVIA 5FCZA 1JDCA 1FH8A 3AXIA 3VO0A 2WMIA 1ZJAA 3CTTA 1QI4A 2V5DA 1JL8A 1US3A 1B31A 2XN1A 2XVGA 2WVSA 3RIKA 3VGHA 2EPKX 2BVTA 1H3GA 3HG5A 3MUAA 1FH7A 3L2MA 4J3TA 2GFTA 5CLTA 4WKFA 3VINA 4OUEA 3AYRA 2PBGA 3MKKA 3AMDA 4AD0A 4B3KA 2W63A 3QOKA 4PTWA 1UD2A 3CGTA 3W29A 3WNMA 4AD5A 3SCUA 1D2KA 1PX4A 1HJSA 1PIFA 4LXFA 3W37A 4PYSA 2WK2A 3OG2A 2AAAA 1BQCA 1W3HA 2CYGA 4FNTA 2XN2A 4QLKA 4CUCA 4ZXOA 2W62A 4FK9A 3E1F1 1ISWA 1KBKA 1CYGA 1JYXA 1NWUA 1XCWA 4P7OA 1OB0A 4JHZA 1C8QA 3SCTA 5EFDA 4WIWA 1JD7A 5KEZA 1XSIA 3PZOA 2G3JA 3B9AA 2GK1B 3BLPX 1V02A 2O9OA 1VBRA 2PBOA 4ZFMA 1UD6A 3WF0A 3K8KA 2D22A 2WNWA 1UD8A 1W9BM 1E73M 3SCWA 4AYGA 1MFVA 1UR4A 4WKAA 3EMQA 1H5VA 3UESA 4U31A 4FNQA 3AMGA 4GZIA 4B3LA 3BSHA 4X9YA 3WD4A 4ZEPA 2DIJA 4FNSA 4E2OA 4M81A 2DGAA 1H0IA 3TTOA 3WY3A 1XHGA 2VI0A 3SCNA 2ALWA 1ISVA 1I1WA 1VFOA 3AS0A 4FLRA 3FHAA 5IXEA 1WKYA 1HKIA 3GXFA 2G4FA 3I3EA 3GXNA 1QOXA 5HBFA 3WD3A 4WLCA 4UQAA 1W2PA 1QNOA 2OSWA 3NJ3A 1SFSA 3EMZA 1VF8A 8CGTA 2WMIB 3PTMA 3VD7A 1W9UA 2WB5A 3PZVA 3ZJKA 4AIUA 5D9NA 1XCXA 3OB8A 1K9DA 1CLVA 2RGMA 4PRWA 2BFGA 3CZ8A 4JIEA 4CCDA 1MW2A 3L4WA 1OINA 4HZ8A 3ZSTA 1Q6GA 1E1FA 3LXAA 3WH5A 2J7GA 2J4GA 3OGVA 1UYQA 4LYRA 1XH2A 2WPGA 4QCEA 5BRPA 2QPUA 4GXPA 4AWEA 4Z2LA 3VM5A 1J11A 1HVXA 4W87A 3U5UA 5JBEA 4GI9A 3WH9A 1GOKA 1ZBCA 1VJSA 4UZSA 5IFTA 1VBUA 5I77A 3ZQ9A 4DUXA 3RDKA 1V6WA 5BXPA 2XVLA 2CNCA 1UWUA 3PZTA 4JAWA 2VX6A 4QCFA 4PSRA 1R7OA 1C92A 2VCBA 4TVCA 1TQUA 2GJXA 1K9FA 3UG3A 3VGGA 1QNRA 3AIVA 3A3HA 3WKZA 4NZJA 2UY2A 1V0LA 1BAGA 1E3XA 1P6WA 1HJXA 3GNRA 2W5FA 4TVUA 1GJUA 1UR9A 4Z2KA 1MQPA 3GH5A 3AI0A 1BYBA 1C91A 3A23A 2A3CA 3DX4A 2V3EA 5ABHA 4JL2A
chains in the Genus database with same CATH superfamily
5FB8B 4EF3A 4ZW5A 4KZCA 1U8KA 1N2RA 3IJ6A 2X7LA 4GQQA 1XHHA 4MKNA 2EE6A 4LVHC 5D8ZA 4KWVA 1NF0A 5KYXB 2VC2B 4Y4HD 5GRJH 4DHLA 4W7VA 3TYUA 3K0YA 4C6EA 3PGCA 5JH2A 3BZ4B 3TZNA 3IXAA 5AYIA 3W00A 1M6JA 5F3FA 1IE5A 4GG6A 3W7PA 4RDZA 4YDKL 1FZJA 2EE9A 4PV9B 2J2ZA 3EDJA 4WDTA 2OELA 4HJGB 5C55A 1J5DA 2P48B 4CJ1A 1TVDA 1FNFA 1C7TA 1SLUA 4KIRA 3KCJA 3T4YB 1T0NA 1H8OA 4BR1A 2ITCA 3QIUB 1YRRA 2FWSA 1OY0A 2IPKA 4DEPB 1PG7L 4DIAA 2GJXB 2OQJB 4R0LB 1E8XA 4JZOA 1JWMB 4PJDE 1YPZA 1KW1A 1F58H 3OQ3B 4BI5A 1WUFA 1T2QH 4U10A 4J8RA 4M4PA 3O6AA 4PJGA 1D7FA 4LCVA 5FWQA 4CMHC 3MREA 1LL6A 1YYML 2DVXA 2C8NA 2TYSA 3T6ZA 4X6EB 4WK0B 3QC0A 5D5ME 3EGDB 4H1LG 3KL3A 3FB6A 4RK8A 3VIMA 4I9XA 4AVFA 2YRBA 2B0SH 3HC4L 4FR6A 3KEHA 5D8JL 4AV5A 3IFLH 1JNNL 1HIML 1H63A 5CJXC 3NG3A 5FK9A 2GSEA 4W9CC 3X12B 3WMQA 1HL9A 3TZVA 3MO7A 3ZO9A 2VT0A 1MXGA 4NRSA 3I6LE 2PF0A 1XF4A 1L9PA 1PFCA 5D4YA 2VCOA 2CLKA 4H6EA 3V0WL 4H7VA 5AOJA 1P6AB 4AQ8C 1SJCA 2BZDA 4GOAA 3QE5A 3U46B 2MQGA 1ZLSH 1TWDA 3S6DA 1ZRQA 3TTYA 2NVCA 1ZAIA 5GS1A 3GSRB 1CFNB 3U48A 4AMKL 1WSST 1AS7A 3UG8A 1TLMA 4JFEA 1MRDH 3D69A 3DGBA 3O3UN 4LVGA 4NKMB 1XRFA 3QIBA 5IEHB 4PFEA 3OD3A 1ZU8A 1KXQE 5D4IA 4GI4A 3ROLA 1UUOA 4Y96A 5EN3A 5DJCA 5DJAA 2L4OA 3W11D 2DU2A 2J5WA 3UZ5A 4FXKA 4BCXA 3RWEB 3S9DB 2BNQA 3EA3A 3RVXC 4XZBA 5LZLA 4GC4A 5DJ0A 2F53E 1RD5A 3NCJH 1XR9A 1CDYA 4M6NH 5JHLL 2VMFA 4JRWA 2AZAA 1KA9F 1IV8A 5AYTA 4P2QA 3TPKA 4DWSC 3K72A 4L3CB 4ZX5A 3UYIA 4R9OA 2OVLA 5JLZA 4D6CA 4U0QB 1ZGLP 2NVAA 4C57C 5A8OA 3IRPX 1Q9OB 4M56A 4KFMA 3MKGA 1KLUB 4LB3A 4D8LA 4JGUA 5ADOH 3W2UA 4XSMA 3GLAA 1AGEA 3C2EA 4FZIA 3OAYK 4RSYA 5BVJA 3EWBX 2EXWC 4DQWA 1H3VA 3RPDA 1CLYH 1RVFH 2CO2A 4YWIA 4U0RC 3KJ6L 3WBXA 3QDAA 4XVSL 5E8OB 5AFAA 4XI5C 1RJRA 2PCPB 1M01A 3W7MA 4PJFA 3BGGA 2F5BH 4TXEA 1E1EA 4CKVX 3A3YB 1XLGA 4FB7A 4OQTA 4QWWC 2O7QA 1NEZG 3ITGA 2ENSA 4F33A 5A3HA 2VO8A 3WK0A 3DC0A 3DVIA 1PHQA 4DJFA 2BDQA 1JWUA 4ORGA 3O1NA 5I17B 5LGJA 1KRAC 2JB6B 4HIHA 4GRLD 3NIGF 4H88H 2C9VA 3JTSB 1FFNA 1OPGH 3DBXB 1NIAA 2DW5A 4TQIA 2CR0A 1WE5A 4BSWB 3ARVA 4XTIA 2VAAB 3BG3A 1L2QA 3XIMA 3UTPD 1H8LA 4M3JA 1L6SA 4M8QA 1ZLDA 3DOSA 2FK9A 1XAKA 3TAOA 3OKOA 4K8HA 2X28A 3GNMH 3BDXA 3ABGA 5M94B 1NCAL 4CAGA 2C14A 4PTUA 1PWLA 4HXAL 2FZ3A 1QTSA 4JCLA 2WXGA 4NJ9L 2YB4A 3C2VA 1KC5L 1KRBC 1CGSH 3R2GA 4QRUA 1SVCP 3GS6A 4JHWL 4QHKI 1T1XA 2Z1KA 3GIQA 2ESVD 1KENH 4GX8A 1YEWA 1UZHA 3HV9A 3N12A 1JPSH 5HHXL 5E7FA 1NBZA 4FP8H 4FNPA 4M61A 1ZT1B 3VCRA 1N0XL 3FSWA 4ODBD 4RNRA 3QKEA 5EEZA 1RU9L 4EXKA 3U2EA 4P4KA 5HGBB 3UO1L 2F7QA 2Q8AL 3HA1A 1I7RA 2VDNL 4H20H 1D5XB 1VRSA 4PJIB 4RE4A 1HWHB 1EYEA 3L5AA 4A37A 1DVXA 5I9QB 4M19A 2G75B 3MJGX 5EO0B 1GYVA 1MCSA 3SCRA 4RBPK 3RIFK 4CNOA 3GI9L 4GQRA 5GS2D 5JMUA 1I7ZB 1WFIA 3QZWB 1TTBA 3IGXA 6PCYA 5GS0L 1WKDA 4NT0A 2DQJH 3KS5A 4NO3B 3NSFA 1QSFE 2ZZ6A 4FF5A 4AD3A 5LNSA 1ZT4A 1VEMA 3D9AH 2CD0A 1XI3A 2OMWA 3HB3C 2XFFA 3S3GA 2OEJA 4XTRC 1XGYL 2JK2A 3OTRA 3KLAB 1J5OH 1PKQB 1DJZA 3BQUD 3L0GA 4ANUA 3W1NA 3L17A 2EPOA 3D1MC 5DXXA 3IV8A 2WXJA 4N0UA 2QTEA 1FP9A 3WEOA 4KMLB 3UP1A 3EFFA 3NIGB 5D2NE 5CCKH 4OI8A 2F19H 1CG9A 4P5KB 4LK4A 5CCJA 3PGDA 4RMQA 1FRGH 3UDWC 3DYPA 1EDQA 1GG0A 2Q76A 4MASA 4Y4KB 3CLMA 1IBBA 3H9SE 5CSSA 1U33A 1L2UA 2ATSA 4WKZB 2GUOA 5JPNC 3QN3A 2XUWA 4ZUSA 2VD9A 4NI6A 4IM4A 4Z76A 4FA7B 2HTLC 43CAA 3NSYA 2G41A 4K3JH 2B7QA 4LSRH 1REQA 3LZOA 3BP5A 1SJXA 3TURA 1YTKA 3FCTA 2GTWB 4D1JA 4L1LA 2F74B 4I6KA 3WMLA 4HSHA 2JB5L 1SXNA 1AHKA 4Y1TA 4Q4MA 3EH4B 3MBED 4XWGH 5HJ3A 1KXTB 3S96B 2EKGA 3O41A 5AW1B 2IIJA 4EQ3A 3ZKMD 4L1XA 2VRJA 3GK8H 2NV2A 2PDBA 3PWUB 1VF5C 4I9MA 3EBVA 1K7XA 2DEWX 3TCEA 3FTSA 3KCPA 1TDQA 3GBNL 5EORH 1TX0A 1B6UA 2WSYA 4Q3MA 3PUUA 3QQ4A 2F1BA 3QWNA 5SWZE 1K72A 3RYSA 5GZOA 3GU9A 2F8QA 4OF6A 1R3HA 2G5UA 2EEDA 1MDRA 5DCDA 5EZLA 2VTFA 3QFDA 5CWSB 1TE1A 1R5WB 4BWLA 1F3WA 3VIFA 2XG5B 1KCLA 5EFFA 5JOFA 5DZ9A 2OMVA 1NFDA 2XY1A 4YR6B 5T3ZL 4YHYC 5D2LF 1AI1H 2HVKB 3MLZL 1MAKA 1Y6MR 3IJYB 1TJ0A 1TO5A 4JVUA 5FYKL 1VYRA 1SY6H 1N7MH 4KUZH 2BASA 1AS8A 1KBLA 2NX5A 4MNJA 3FONB 4PREA 4NAJA 4GA8A 1AMXA 4YFLI 5AW4B 3OVUB 3WFCL 3F2DA 1TPUA 4L9LB 5BS0B 2UVEA 3NQMA 3DUGA 5ALCH 1NDYA 3ARWA 2RJGA 3OAUL 1E43A 4ACZA 2YK1L 3BKJL 3FPYA 5J6GB 2E1WA 4LNRA 4HUMB 3IBEA 2FIKB 3AJXA 3L2LA 4QO1B 4QRQA 4HJ1A 4QI3A 2OSYA 1DQML 1TRDA 1XFPA 1TZIA 3S35L 2VR8A 2CXKA 2D4FA 2WB1A 3ZUCA 2LLGA 1ONQB 3ENEA 4J9JA 5D70H 5DR5H 1IM3A 1BVLB 4NYUA 1CLOH 3QW9A 3ZKSD 1GTEA 1F3DH 3GI8L 4XZUB 5E8NA 2EZ0D 5E6ID 3F4DA 3P67A 1N5YL 3GO1L 3M5ZA 5E1GA 3HCVA 3TCLA 3QA3B 3QIUD 1GSKA 2O1AA 2AGTA 1YNTA 2J27A 1TJIH 4OT7A 4WSJA 4ML4A 2DJLA 2VXNA 4JPKL 2OTUB 2CRMA 2UY5A 3WGUB 4Y19A 2RGLA 4WQ6A 4W5UA 2DWTA 1GKEA 3W0KA 1AACA 3AHYA 3VXSE 4GUPB 3S5YA 3PN8A 7PTDA 3M1CA 4GQ9H 3OR6A 3O8XB 1DIOA 3KPPA 1TV4A 2BHYA 1EA9C 3COOA 4F57H 3DXAA 4AZUA 1TRIA 4M51A 4LHUA 2ICEB 4UU9B 1AKJD 3S7GA 1IFHL 3ZWSA 1BGGA 5EO1B 2X6VA 3HZKA 3QJVB 2YPLE 2BV9A 5C08B 3G6MA 2A7PA 1BIIB 3TWBA 4NILA 5T1KB 3L2IA 5TD4A 1GQKA 1KR0A 2ZWNA 4PB5A 1WDPA 1B30A 2PFHA 3QXDB 2R83A 3P3SA 3NAAH 2FEEL 4FGMA 1C5DA 5LIXX 1TV2A 1A3HA 1S7SA 2BM3A 1QWKA 1XICA 1UC6A 3UPMA 1NAKH 1IKNC 3LCIA 4K37A 3MVTA 2PD9A 4MB4A 3DX1A 2OM5A 1YECH 1XGEA 2BS71 1BRLB 1Q85A 2MNWA 2Z8SA 2W8CA 4L48A 4PL1A 3I2CH 1XSOA 2G60H 1T21B 4N26A 4K7FB 2Y70A 2CH8A 2DD8L 3GHSA 3E6HB 4WV1A 2OYKA 3WG7B 5SX5H 3PL6A 4M29A 3GGWB 1GYNA 1CL7L 4ADIA 1QW8A 2Q86A 3B03A 3OC8A 3K2MC 4PRDA 3DO4A 1N6QL 4H3DA 2KPNA 3C0SA 4IPPA 2OYLA 1YCSA 1NMBL 1WB0A 1W3IA 2E77A 1S4IA 1BHGA 2ZUTA 2XA8L 4LMQI 4Z7UB 5BJTA 1JV5A 2WHMA 1DTNA 3MOAH 1VCFA 1YEGL 5IOKA 1O68A 1KTCA 1BOGA 4LLVA 1DBAH 1YEFL 1R2SA 2V2WB 1B0RB 3IUHA 1NL0H 1U83A 3VH8B 3TA9A 3CWHA 2OL3A 1Z44A 4GXVH 2KAUC 1K8YA 1OM3H 4JO2L 5EF1A 4Z7QB 4P2OC 4FERA 1EUAA 2VDKB 3V2AR 1GHFH 4YPGA 2X4PA 2ATMA 1ZVNA 3AHZA 2YZ8A 1S7VA 1BD2D 4D6DA 5D7IB 4CEUC 3L95B 4HT1H 1DLFH 3N34A 2QGDA 1IO4C 2UZYB 1GHSA 4X83A 5CGYD 5KVGE 1QBMH 1I53A 3QEQB 4LEQA 3D07A 5EBMA 3AYSA 3UYRL 4J1OA 3PP4L 2VJXA 3VYOA 5TF1L 3VD9A 2YPVA 4XNZC 3VWJD 3WLQA 3LKQA 3DVNB 1T20A 4CLMA 4TPRH 5IVZB 4MZRA 2Y62A 5JDSA 2ID5A 2I9TA 3M7WA 2BOBB 3I84A 4HIXH 3CLEH 3CVIH 4R7JA 1I7TA 1R9ZA 2A99A 3H2AA 3V5HA 3OGOE 2DM3A 2CALA 4XMLH 3VFPB 4JTTA 4XNBA 4DNHA 4MAYA 3BX7C 1C5BH 2Z29A 4UF7C 4YHGA 1AD9B 5I18H 2VZOA 3U30C 3O3DA 1LO4H 3ULUF 4KC3B 5FM8A 3AICA 5GGVH 4NFDA 4YDLC 3P0XA 5G1MA 1HWWA 2FJUB 4Q9RL 3DEQA 1CS6A 4KESA 2CHXA 1SLXA 1TETL 4ZO9A 3G5YB 1H8SA 1T7LA 4G7EA 3VOFA 2VDOH 4GYPC 2E5EA 2MTPA 2YRLA 3QORA 4EKXA 2KERA 5IFHL 3O3RA 4JLRA 4YIQA 5CN2A 2Y1VA 3W1TA 2QGCA 5LVEA 2FCBA 5IT2H 5F6IC 5AENA 3BN9C 3SQRA 3QWOB 2V63A 1B54A 5AKRA 1PZDA 3RL2B 1DVUA 6ALDA 3G5ZA 2DWYA 1JZ4A 5RUBA 4B5WA 3LBMA 4O02A 3UY7A 2GPZA 1GC1C 5HVFB 4AMCA 4IMLB 3BL3A 3OZ9L 1MSSA 2DWSA 3P9LB 3ZE1F 3RDTD 3JVAA 3MRIB 3TR2A 2AQOA 5I3IA 5FXCH 4LQFL 2LTQC 2VL5A 1EO8H 4Y9GA 1SJVA 2AV7A 4PG2C 2HLFC 3L3OA 3KYKL 3ZDWA 4N90E 1AHWB 1B0GA 3V0FA 3GKWH 3M0JA 4BK5A 1SYSB 3O9WD 4JIRA 1DBBL 3BEVA 1YRKA 5FF2A 4QJ1A 2VDMH 4P7OA 3D3VA 4PBDA 1XIWB 1KTJA 2CR6A 5HPMB 4IMCA 3UNTA 3EWCA 4OWGA 3DX9B 4LLUB 1NCGA 5DHYA 5FYJH 1HQRA 1XW8A 3B3BA 4FNQA 4U6YA 4XMXA 4JFYA 3IU4L 4KVNL 4OCNC 5G1YA 1FDLH 2EDXA 2R94A 1S2UA 3QNZB 3NCYP 1MEXH 4F7EA 3AS0A 1G84A 3I3EA 4LSUH 3G1YA 3WD3A 4V2CB 4RX4A 2HCZX 3SDAA 4NUJB 3SYCA 1RK7A 4AIUA 1NCDL 2A83B 4U1IB 1I8KB 2V2XB 3QDGE 2RGMA 2O4MA 3N2BA 2NYKA 3E5PA 3PWPE 4Z1CA 3R25A 2BODX 5GGTA 2NY5L 3WQCA 2OR7A 2QPUA 4MD5B 3MRFA 4NQCD 5LNGA 5LDSA 4UZSA 1AH4A 3KJ4C 5DLMH 3HPSA 3QRBA 4YXLL 4EE2A 1UWGL 1QNRA 1FHNA 4EQ2A 3RI5K 4WOZA 3VRIB 5LLIC 2P3EA 5L0QB 1MQPA 1F90H 3S3DB 4RR4A 1WFMA 3FFCE 4MXVE 5CP7B 3FMGH 1F1DA 3CZNA 4WENB 3TBWA 2Y7QA 1KGCE 1MNZA 3EH3B 2IXQB 2WGXA 4LDEB 3WFHA 5HDBB 1AQFA 2VDQL 2X6BA 2HKHH 3NPSB 3NJFA 3REVB 4BJHA 5DI8B 2FTAA 4FHAA 1OTTC 2ADAA 2GSJA 3STBA 1KBVA 3DAQA 4AK1A 4QE4A 1MWAB 2ZNXA 2E74C 3O3AB 3WXVH 4XNQB 4G2DA 3RQ3A 4XBEL 4PWJA 2EG8A 1F4WH 4L5FE 4G6JH 1ZSDB 1N4XL 1EJVC 1P7QB 2D73A 4MKMA 2DEYX 4W9JC 3PWNA 1T1WA 5EU6D 3IJ7A 4J5VA 2EVFA 5FOBB 1HH6B 5BS0D 4QYAA 5BOJA 1HXMA 3CUJA 2WXOA 5DMYA 3DDFA 4CQBA 3WS3B 1ENUA 1JVNA 6PTDA 2IW0A 1UZ8B 4NAQA 1BZDA 2VENA 1INQB 5JIMA 2GFBA 2NUTA 3QJFA 2ZCGA 3ELFA 4FIRA 2VFFA 2A6KA 3WIFA 3L7EB 5DUBB 4CW1A 2MANA 3TO4B 3T8LA 4S2SA 4TOQA 4UNKA 4UTHA 4RFOL 3VI3E 3MZGB 2GAZA 4GO8A 3BQ5A 2ZXBA 2XZQL 1NFGA 3APFA 3D8MA 3X3GH 4ABWA 1DVFC 4HZMA 4MA8H 3NYDA 5JORA 1PBGA 1QO2A 1LD9B 3VXPA 4X4XA 3EGXA 4O52A 4HPJA 3NCWA 1ZPTA 4ERAA 5ILTL 2AQVA 2GJZB 5HI3C 5I8CA 3AYTA 2XWEA 3QJUB 3MV7A 4TS6A 4ZX3A 5F7WC 4G8GB 2DTSA 4Z17A 2V5MA 4M3PA 4Q97A 4HCRH 4IKKA 1J8HD 4M1RA 4PGLA 3PZNA 3GMQA 1KEGL 2A38A 4TYUA 4F93B 4Z95L 4NNCA 3DBSA 2V0TA 4EUPH 1K9TA 2BVOB 3GIZL 1PG7W 4ZFFB 5BV7C 1A22B 3WDRA 2YDRA 5LA0A 2B14A 3LCXA 3NIDF 3S4SA 3LD5A 4M7KL 4HU4A 1IGJA 4NAMA 1I8IA 3P6LA 4Z9KB 3GXMA 1VRDA 2GJRA 2Y0SA 2E4FA 4FQXB 4A22A 3WNPA 5L6YL 2DT2A 3ILQD 5ANME 1GGTA 2J8UE 2VJ8A 4J3OH 4YHPB 3IXTB 1KYOJ 3VWKD 2VITB 1I45A 3KTCA 2XV0A 4Z7AA 2NY4C 1JBJA 4GRWB 2QJNA 3BOLA 5T1KD 1IVTA 1VGKB 1UM4H 1QBAA 2VL4A 3EXLA 2EKSB 2YAQA 2YOCA 1NGPL 2MMXA 5KYWA 4PVMA 1EQPA 1AO7A 3DFOA 4TTGA 4PJXF 3RMEA 1BQGA 4HGXA 3BHBB 3GMLA 4AEEA 1KDIA 4ZAKA 5CPOA 3H7BB 4FA3A 1FORL 4NG3A 3B1TA 1JD9A 1HEHC 4PJ8B 2ZPKH 5EFIB 3ZMRA 5D7JA 4AYFA 1DWJM 4J1UB 3M46A 4YHNA 4YHKL 1U8MA 1S7XB 5JIIA 2AV1B 3Q1EA 3QY8A 5F2IA 1E4WH 3WO4C 3FU3A 3UJJL 1DJWA 2FT8A 3U9WA 2RH0A 1Z9OA 4WTQA 4J3VA 4ZQKA 3VVWA 5EC2A 3SGGA 3D39E 4RZBA 2VEKA 2P45B 1E27B 1RUKL 3D25B 1UB6A 3M5VA 2OJZH 4WIQA 3RUGF 4LOEA 2H3NB 3THCA 4B5TA 3B2DC 4JG1H 1R19A 1OFPA 5ICYA 4NBYB 4JREC 2GBUA 3PNRB 4BFNA 4EK7A 4LPWA 3IFOB 3HG3A 3GBML 3GMPA 1YEHH 2WXLA 1NLDH 1V8EA 3GR4A 3IACA 1O5KA 3STZB 1U4EA 1KLZA 3WX7A 4Z2IA 4PJAE 4NN6C 4ABVA 2RB8A 3GQYA 3LKOA 4KO6A 1NLBL 3BAXA 4YJZL 1NAL1 5KSUA 1BEYL 4PJ7A 4IGBA 4RA3A 1SEBA 3ARFA 1T40A 2VM8A 3PWLB 3Q7JA 1QWNA 3ILPA 3T1FB 1HHKA 4QXTB 2ZJSL 2OKTA 4N22A 2PC8A 4GG8B 5ESAB 2DEXX 1WHOA 4G7FA 5DJXB 3VDAA 5H4YA 3GIVA 2V8LA 3Q2DA 1Y0EA 4AD1A 1IC5H 2PYEE 1YY8B 2V33A 3QO1A 2NQZA 1WIUA 1V10A 2VXSH 2AKRB 1C3FA 5CEZL 4JFUA 1PQZA 3O15A 1W72B 1GZHA 4JQ4A 1BQHB 2YJQA 4BEIA 5AD0B 4K55A 5H6HA 4I9WE 5CEXA 4FNLH 1JGLL 1VKXB 4YDIH 1L5GA 1BV8A 1EO5A 1EPXA 2ZCHL 4ECNA 1A8JH 3NH7L 4FKEA 3EWUA 4QBXA 4S3JA 2HYMA 2W0FA 4E42B 3NRPA 4UTCA 4ZPTB 5DMNA 2YZRA 3FUNA 1MHCA 2OPJA 4L9DA 4JKPL 4S1DC 3W0WB 5JOPD 3B9VA 2EGZA 1RQ5A 4TNVF 4G6CA 4PJXB 1EXHA 1RZJL 2ARJA 2WZIA 3BP6B 1YC8A 4YGVA 3W83A 4N6QA 3WQ4A 3BPNC 5F7KC 4O15A 3M07A 3V4UL 3RWHA 3BANA 3SPVB 3VXRE 1EWHA 3MBWB 1H1NA 3RWDB 1Q2RA 3SE3C 3U7WL 3ZTJH 1UD5A 1ZXQA 3MDJA 3OAYH 5IHZB 4AZCA 3TIDA 3TBYB 4H26A 4QSFA 2HSIA 1AR2A 3FU8A 4INFA 3X1NA 4A3RA 4QIUA 1L6ZA 2YGPA 1OF2A 3NDYA 3MU7A 3MMEA 1TELA 1B6DA 1BBJB 1CCWB 2GQHA 2E7LA 3L3IA 4Q8PA 1MFAL 3PWAA 4H83A 4GRLB 3KXFD 4UM8B 4JTEA 2XVNA 3GVVA 1W1ZA 3STFA 1I9IH 5DRCA 1ED3B 1ZGLM 1EZVX 1ES0B 3IJ9A 4C6KA 3L0KA 1YEJL 2I14A 1YNLL 3DFNA 2DRUA 5DC0A 5CZVL 1ZJIA 1RERA 2ZA3A 5HANA 3W38A 2HJKB 4GWEA 3LNIA 4PJEB 4K94C 1IBYA 3A6CH 3WJJC 3I50L 3C87A 2I69A 4AY7A 2IALB 1GOHA 3WD1A 1JCJA 3SPHA 4GP5B 4LJ3A 1TTIA 4L4VD 1W1A1 3U7YL 2QKIC 3GFUA 1VFLA 4FLOA 4YHMH 2ESVB 1QRKA 3SCQA 2JKTM 3ALPA 3ZS4A 4UUIA 3HPZA 1GOIA 3LRKA 1Q45A 3R8HA 5B8CC 3NCMA 3IVSA 3BJ91 4PRPA 3QR2A 5ALBL 3ZJ6A 2XICA 5D1QE 1ZPLA 4PJCF 5JHLA 3RHWF 3BW4A 5EH1A 1M71A 3SGDH 5IQ7L 1NCWL 2YBRB 2VWSA 2M1KA 3KR3L 4BJLA 4MFEA 2LAGB 3FOLA 3BLFA 2CK0H 1I4FA 1D6EB 3REWA 3U4EA 1S5HB 1UKOA 2KDGA 1CFTB 3HMXL 5K93A 1PJ9A 1UWIA 1CENA 4PJBE 1PSKH 4HKXB 4LV4A 1QVOA 4NM4H 3C2AH 4RBPH 4JFWA 1I7UB 3E9AA 2GL5A 3QYMA 3D0VA 3V95A 1KDJA 3QQ9C 1AIZA 4ASTA 1SW3A 3OPSA 2Y72A 2VMEA 1H62A 2ATPB 3VI4F 1DQQB 1EBPA 3CCHB 1F6KA 1R0MA 2WKJA 5DHXB 5F89B 1HZHH 1TVPA 3GMNB 3GNXA 2VOTA 1TCRA 2E1DA 3TT1L 1LL4A 2LLEA 4O2FB 3OAWA 3AXKA 2Y6SC 4Q22A 2L7JA 3BQUB 3T0EE 4W84A 4XCYA 2DQIH 2XQBL 3W7QA 3WN6A 4XX5A 2A3AA 3TFCA 4N3TA 5TBOA 3IS1X 2OYMA 5B80A 2ILLA 3L4ZA 3SBWC 4OVXA 2B7NA 5L9DH 3L5LA 4YXKL 2RQEA 5D1XD 2BLEA 1XLMA 3HE6A 2YFOA 1UXMA 4A05A 2AJ3A 3QZWG 4RGNE 1FH5L 1R5VA 2E3ZA 4CMMB 3OZYA 3GHBH 1UZGA 4EPKA 3MO1A 5TDNB 3FRPB 1U6AH 1CE6B 2IDFA 1NCBL 1EUNA 3CV2A 2E5BA 1AY1L 3ABZA 4JR5A 3W84A 4AKPA 5DBUA 5MERA 2Q7YA 3PJLA 5IBTL 5FECA 3F7VA 4I48A 2WXHA 2ZUVA 5AVRB 4R6UA 5H4ZA 3NCFB 5D2VA 3MBEB 2BFVH 4GQZA 4K23L 4Q7BA 5CZXC 3PBWA 3ZDYE 4R7WA 3TJ4A 2YBUA 4Q2ZB 5IVXB 3W85A 5F9JA 5IFAH 2JBMA 4DTGH 5FYJE 3RAJH 5K59F 3QTGA 4W9KC 3KWXA 3UX9B 1K8DA 4RWYL 1EFZA 3T8QA 5CSUA 5E1HB 4B5ZA 1WCGA 4WTWA 2HXUA 4KQNA 3OZPA 2V9QA 3HMJG 3W1AA 3WL9A 4MHHI 4MMZA 5T1DH 1UH2A 3B2UC 1JGIA 3I3DA 4A1RA 4NFCA 4FQHA 1BTCA 5IIEA 5CGTA 4C60A 2G2RA 5SWSB 1PS9A 5D96B 1XYZA 4L37A 1PYWB 3EG9A 2ZVRA 3L08A 4R7LA 3VCLB 2BXZA 2J6WA 2PDPA 4W7UA 4AX7A 4I5RA 3FSZA 3VOHA 3IDYB 5DD6B 3JWDC 3WLWC 3PUEA 2QVHA 1YMME 4HHAA 2X87A 4IPLA 2DZVA 4ZS7L 5IR1B 4PLKD 3B2PA 2H45A 4OZFB 3L7FA 1R0AL 4AZIA 4D0DA 4R83A 1GGOA 4TR9A 3ORWA 1SFDA 1ZKAA 2Z92A 3UABA 5F9DC 5FL1A 2X1PA 2ZXQA 3VVGA 4XNDA 1SDAB 2X4RA 1ZL1A 1I3VA 2KX9A 2VKZG 4HPGA 5HGDB 2WMPA 4BCEA 3T0DA 2EIBA 4PWIA 2VDPL 4XBGB 4XV0A 2CIPA 1QX1A 3ZTNL 3MUHL 4XP5H 5C0DA 3KWUA 5AC7A 3ZYZA 1UKPA 1D5BB 1GOMA 2B7PA 1KIQB 1N6UA 5LG6A 5E5LA 5KYYA 2B31A 1WIOA 1T0PB 4WW1B 1TMQA 4JO8A 1EIBA 1O94A 3O6CA 4Z3FA 5CPTA 2E9WA 1XLBA 4HU8A 2BVQA 2XZZA 5E08H 2BWQA 4YK4B 5ESVA 4PVNA 2PW1A 1YNYA 2CM6A 3R0DA 2AXWA 2YMTA 5CEWA 3OKLB 2W1NA 3MLRL 1GEHA 3F5LA 3S3PA 5E6IB 4HULB 3IMTA 4N4PA 1IBZA 1SQMA 5ID0B 3STCA 1FVEB 4NZ3A 4PJ8D 5AW2B 1DQJB 1QATA 3OGSA 3ALGA 4HKZB 2H1LM 3WU1A 1F2QA 4UTBH 1LK3L 7PAZA 3GR7A 4JDTH 1EAOA 2UX6A 2Y61A 4JFQA 2D31A 5HP5A 1OW0C 3ZHLA 4UT7L 3VC5A 3GRWL 3QQWA 1O7DC 4HNOA 5B7YA 4Z0BH 2RHGA 4YVNA 4XPFH 5ESQB 3GUWA 5A6IA 3POHA 3TX9A 3SIZA 3FBQA 3KPTA 2A0NA 1X7QA 4DBDA 1R5IA 2NCEA 4K68A 1UYWH 3C8DA 4IKLA 3HNTL 3SECA 1HTYA 2DSKA 3FW6A 1FHGA 2KS0A 4ZXLA 5I26A 4YZFF 4NHVA 2QR0B 1AKJB 2P42B 1RZ7H 4TSBL 1PDZA 5EU5A 3FB7B 2YC1B 1F3EA 1NIBA 2XBDA 4LNVA 2X4UB 2QVIA 2DV6A 2QF8A 3INUH 4HCGA 3TEXA 5LBVA 5LNUA 1VERA 2XPYA 3WUGA 3GT6A 5DK3A 4NKCA 4MPQA 2ZVIA 1HH9A 3HA0A 3LHPH 3CS2A 1QDSA 2CKBB 1YBQA 3DHPA 4IFKA 1MF2L 1UKTA 2ZSVA 1HEJC 3BPWA 3T8XA 2DBLH 4X80H 5F96H 4EBQH 3CBRA 2JMRA 1QFPA 1KN2L 5FS5A 2NY2C 1GS7A 2NX3A 4QQ3A 2F6KA 1E9OA 1EJUC 4L4TA 1CXHA 3VXNB 2HFGH 2CXGA 3ARDC 4ATDA 2CZVA 3TNOA 1G9NH 4M6MH 3BPCB 3N5AA 1EX5A 1IAOA 4WO4C 3F7LA 3VB9A 3C2FA 2EC9T 1MQ8A 4UINL 5DMJB 3VMOA 3HHSA 1ZBWA 3FCGA 4MXQC 1FRBA 3CO4A 1R8LA 5MF5A 2X1TA 2XG9A 3TWCL 4PJIF 2WJ5A 2DI9A 4LCIH 4K5MA 4GO6B 3AMCA 3ZHNA 1J0ZA 2CJ3A 4KPHH 2QF7A 3U7VA 2CCRA 1EPFA 3W0WD 2C3VA 3WJMB 1UQSB 4D3CL 2UWEA 5EHFA 4MZ8A 3TXAA 3CQHA 4AD2A 1D8CA 1FFTB 1HS6A 2WQRA 3WUFA 4GNKB 3EO9H 2IXVA 3K8MA 3TYGH 5E1AA 4EJ1C 1CFBA 5KINA 4LKXB 3VMPA 2PSNA 1TZGL 1ZLWK 1NKRA 1VFHA 1BFSA 2J57A 4YWGH 3WBYA 3JWNH 5F9WC 1FKWA 2JGQA 5FAJA 3VO0A 1RZKH 3U0TB 4FAMA 2D7MA 2F08A 3NVQA 1NDGB 2XWJA 2GITB 1XZWA 4W4OC 2EYTB 2GEQA 1BD2B 1FH2A 5FUCE 1D5MA 2V2TB 1IEIA 4FADA 4I9JA 3HZMB 3RCYA 3W29A 2PABA 3S35X 2IO5A 4H4NA 2VR3A 3WSQL 4QG9A 3CD4A 4ODTL 5XINA 3MV8A 4C1NA 2A73B 4K2UH 3T8MA 3MUCA 4I7ZC 1G7LB 5SV3A 4NN7C 2Z31C 1A6PA 5DA4A 5C5YA 4B5SA 3E2HC 2HVOA 3MA9H 2C1GA 5I07A 1HKWA 1J9TA 4KVCH 4LEEA 3VWJB 5H37G 3LPWA 3H2EA 4FHBD 1SN2A 1IGWA 2B16A 3VH8G 3GAYA 5HHPB 1IIGA 3Q5YA 3L54A 2OXGA 4WHDA 3BSHA 1ZGLA 2CRIA 3PV6B 3NFNB 1KBGH 1GZPA 4ODXA 2VI0A 2APBA 3BLEA 4FTVE 4XN4A 5IXEA 2R15A 4YQXL 1Z48A 5KN5A 1F0LA 1AJ2A 5C9UA 3NQ2A 1W9UA 3BUYB 2BZCA 4DJEA 4NSKA 3NQGA 3W2LA 3V4VH 2CJUH 3ZSTA 4F24A 3I6KB 4QPEA 1TMLA 1EJFA 2CLFA 1XBRA 1E65A 4J40A 2F53D 1BJMA 2VLME 2FR4A 2WLIA 1U91A 3LDBB 1WA0X 1AJ7H 1A5AA 4ERGA 3DLQR 1OARH 3ES6B 3ULUC 3UG3A 4ZW8A 2RHEA 1A1OA 3H3KA 2PDGA 1GJUA 1ECQA 2HRPH 2JCCF 4FFWD 5HI4C 1N64H 2P1FA 4AWTA 1I1YB 2P5WB 4XBPA 4OJFH 1BIHA 5I3GA 3N04A 3IDUA 3AWOA 4HQQL 1Z0MA 4AQEB 3W57A 2VUKA 2MNJB 1LUCA 3QQ1A 5HVHB 3S0CA 5BXFB 4AZBA 3AXHA 1Q13A 3RDTB 1H6FA 3ZTDC 1Q3NA 3CAWA 4UILH 2WZ5A 3X14A 1O9VA 1HJWA 3WF2A 2W9EL 2BY2A 3SKOB 4RGOL 3B0PA 5I1AA 2XTSA 1P7BA 2AF2A 5F6HJ 1JFHA 4PMXA 1S8DA 2I32A 5LN4A 4NPJA 3PTKA 1R6WA 3WIAA 1EEPA 1RH9A 4IBVA 3GSVA 3O9WB 4I87A 4I0PA 3N9SA 3OB0H 2UZXB 4FMFA 1XF3B 1GZGA 1FLTX 1DQUA 1A5FL 4P3WA 1A7PH 3VFVA 4H5SA 3QDHA 3WGVB 1XC6A 4H1ZA 4NJIA 1XZ0B 3UMNA 2OLDA 4MA1B 5E6YA 1H7PA 1DQDH 2QFRA 4ANKA 4N2GA 1XF1A 3UH8A 4W9IC 3R4DA 1UZ6F 5HDOA 1QNSA 1SJBA 3MI3A 2DUXA 3QDJE 3FCSA 1M05A 3S88H 3MSGA 3DIFA 5T3XH 3LB6D 4OD2A 3UROR 1LLZA 1FO0H 2OSLB 4HK5A 1M6OB 4XCNB 3CFEA 1K2DB 3AY4C 3MLWL 3CE1A 4LASL 4I5XA 2A1WL 1U42A 4QS6A 3TVMC 3UZEC 1AD0A 1N6VA 1ZE3C 4LAMA 2R9HD 3HNSL 3AC0A 1UMLA 3MRNA 3ARED 3U5YA 4I2XB 5EMUA 4NQCB 5T33L 4XVJL 1DJXA 2YOAA 3ETTA 3O4OB 4UQ9A 1TWSA 5KW9L 2ERJC 2LR4A 3FRUA 5T1MB 4YHZL 2RUSA 3BH9A 1EAPA 3WTVA 2SFPA 1TPVA 3V36A 3PIQB 5L88L 1EOMA 1W56A 2ACUA 4L8BB 1NEYA 5F1UA 5D38A 4WQOA 1NIEA 3OVQA 4YN3A 5EU3B 2NZLA 2XNAA 1DUZB 4CVZA 2JCCB 4X4KA 1TKWA 5SWSD 1GOWA 1JXKA 3WFDL 2PWVA 5A6BD 1GPOL 2FDBP 4R4BA 3WLBB 3WNKA 5I1DA 3QHTC 1OWRM 2B4CH 1XTMA 4G80A 4UMSA 3U2CA 1MZZA 1CVRA 2WLMA 4L05A 3WFBL 4C7FA 1IQDA 1JK9B 3MNWA 1M41A 3W6YA 1UB5A 2Q01A 1UD3A 4QHPA 3OJMB 5LCVL 1SZFA 2BP0A 2R4RL 2WMJA 2MQ0A 9PCYA 3T09A 1AL7A 5DZNA 1Z5HA 4JNXA 1MW3A 1NAML 2CMRL 2VN7A 1SJHA 5CMAA 4N8VB 4X6CB 2FT7A 3CHFA 2GQ9A 1CLXA 5EU6B 4XXWC 1V6UA 1GORA 1FSKC 2NW2B 8RUCA 4OD1H 2HVMA 2VEGA 3SO7A 3WN5A 3H9SD 3UYPB 4ZX4A 3FAXA 4PY8J 1V03A 3FH8A 1SGJA 1AIFB 1WRFA 3X1FA 4NKOB 3MLTB 4WHBA 1SXSA 1MH5A 3ZKXC 2OI9B 1LOQA 3FH7A 1A02N 1IC7H 3K6IA 4TTDC 1G9HA 1MUWA 4H8WC 4KRMB 4LOVA 3TNNB 3GIYA 3FT1A 4MZ1A 3KPOB 4WI3A 1POKA 1S7WA 3GY1A 1I0BA 4ZNEE 3CXHK 3S34L 2WQSA 4Z7UF 1JAEA 1FJ1B 1BA9A 1ZAGA 3DJSA 4WUKH 4M00A 2EDRA 2D8KA 1OTSC 2DAVA 1ZTXL 5HBBA 3TBTB 4OTXH 3ZKNC 4ZUVB 3NOEA 5IMKA 2Q3AA 1U3NA 4LSTH 4MNGA 3R5EA 1LYQA 4M43L 3IE4A 2OMBA 5A2BA 3PHSA 4ZSOE 3LSOB 3OPZL 4HJWA 4Z7QF 4KUCD 3U9PL 1XDJA 1J8HB 1A4LA 2N0MA 4U3AA 3CUPB 3AZRA 1QMUA 4D1IA 2QZRA 2X70B 5SWZD 3BWSA 2Q8XA 5AVYB 5E0FA 5D7IF 4ELMB 4DZBB 2P80A 1UXLA 4RKAA 1U36A 2DSZA 2ARJQ 4WUUA 4APQC 4AF0A 3V0AC 2NXYD 4G8EA 3HR6A 2GCYB 4P7RA 4A2SA 3TPUA 4P7QA 3IS0X 3DVGB 1GGIL 1YQVL 3M45A 5GS3A 2PU0A 4ACTA 4UFKA 5EPMA 4JFZH 1TNNA 2ITDA 3ZY7A 1TUPA 3VWKB 3OJDA 1P9MC 4E9YA 4PWKA 1QPXA 5E2WH 4LEOB 1HHIB 1XQ4A 2OR9H 3MJ9H 3XISA 4HHPA 4C8XA 3QPKA 4GW5B 3K6SB 2DH3A 3LZ5A 1LMIA 1UENA 4PI2A 5E99H 3L1OH 2J6XA 4GSXA 1BMZA 5HD8D 5BPPA 3V0TA 5LNEA 2OB3A 4R7NA 4R88A 4CNPA 4E2DA 2W4XA 1W9VA 1DE4B 3FXYA 3V4PH 2MCAA 1ML1A 1NFBA 4X7SH 4XOAA 4PMFA 3VG0L 3QV7A 3VAEA 2G2NA 3K74B 2JEPA 3QY7A 1XPYA 4LEXL 2WKOA 1RIVH 3LGGA 4WVRA 5FPIA 2NV9A 4EIGB 1G4TA 5ITBH 1KR1A 2MPAH 3P73A 4J6RL 2WLHA 2QJDA 1Y1DA 1MFDL 1QI5A 4PS4L 5DZOA 2HXTA 3SW6A 5AL0A 4MLRA 4U4BA 3IMBA 1U21A 4QHLB 1F7BA 1XYCA 3F03K 2OJEB 1H6UA 4JFFE 4KDWA 4UOZA 1XSKA 2Y2WA 3KGRA 4TNFA 1E15A 2VJ0A 3S1VA 5CILL 1I0DA 5IW6A 3RZCC 2WJFA 4E0RA 1LO2L 5M95B 3T77A 3QIWD 3G24A 2WLLA 4Q4PA 2QQ6A 5JUVA 3QJSB 3ZVVA 1O60A 1IAKB 1RULH 3K4ZA 1QD0A 4BRVA 4UQ2A 3SY5A 5FJTA 3ATYA 5AVTB 4K8RD 1JNJA 4JY6B 2FSEA 1P4IH 4G9DA 2VKXA 3RO6A 1H5BA 4K8EA 4HZLB 2EYSB 4LLQA 2FEEI 1EBGA 5JU6A 1A64A 3MOQA 4H8VA 3B9KC 4CN4A 2ZIDA 3CQJA 2OXHA 5B39B 1Q38A 4DESA 1XGUB 3MDWA 4YHIA 1QZNA 1TIUA 1H7OA 5CN1A 2DVUA 2BRRH 2DF3A 3QZAA 4OLXH 1JHTB 3AQYA 3WBEA 5IG7A 1IGYB 2VNCA 2YPLD 3ULVD 5HHNB 3O11B 3TBCA 3E12A 4TLSA 1BXAA 4ZMXA 3CHDA 5I74C 4URIA 4QRBA 1TWWA 1MEWA 2YHGA 1YN6B 3RGBA 5TE6H 1CL7I 4GJIA 2G5BA 4EF8A 3H2NA 3HQOA 3RXZA 3SQSA 4XRCB 1SW0A 4L8SA 1E9QB 1EX0A 2NUWA 1TFHA 2R0ZH 5E9DE 3RFZA 4WSGA 3E49A 5CIPA 4Z7IA 4OZGB 5F9OL 2ROYA 3GVGA 4Z7OE 5FF7A 5DVLA 4JPIB 2JF1A 1WA2X 2YUWA 4I18A 1YN7A 1ZPUA 3HE7C 2X5PA 3MTRA 5FYLD 2B2XL 2V67A 4A6YL 4KJWC 4OB5L 3HFFA 3SUWA 4AKOA 4YMPA 4JDVB 4KNQA 3P4LA 4P46C 3QDMA 3LU2A 2GGGA 2ZUWA 3G1HA 1BQHG 1S2EA 3V0VA 2JTYA 3QUKA 3C8KA 1NOWA 3GWJA 1SYVB 3B0XA 4UI2A 3MSRA 3B40A 4K1GA 5J5EA 4AH7A 1GZQB 1EEZA 4IL2A 5KAQG 1I3RA 1AA1B 4TLUA 1GGBH 5GJTL 3UZYA 4MAVA 5F0MB 1LP6A 1WO2A 1Z9SB 3KXFB 3KWWA 5BO1L 2I85A 2P5WD 3EB3A 5JQHC 4QFUA 1OD0A 3HPLB 5HDBF 3ZRCC 3WMPA 4ZFOB 3Q2WA 3WQOA 4BH7B 2WBKA 4TQPA 2Y5TA 3AT8A 3SKMB 4K7PL 4W1TA 3CUGA 1BQKA 4Y8AA 3BLLA 3UP6A 4YXHL 1NZRA 4Y5XB 4IIQB 4YMZA 3JV4A 3CV5A 4OBSA 2W66A 2Q2EB 2YN3A 4NQVA 2OEMA 1NGZB 1ILSA 5C6TH 2BWGA 3F12A 4NZUH 5MEQA 3MYJA 4L4VB 1FKXA 4QAWA 4K2SA 2Y07H 3OB0K 4M7LL 3E6FA 3SJVB 5E03A 4LB8A 3TC7A 1EXUA 4M6AA 3F2LA 3CHCA 3YPIA 4Y4FA 2VXTH 3FZUC 3US1A 4JKLA 3QUYD 2WY3B 4BEQA 1FXPA 2WZEA 3Q2CA 4AQAA 3WH8A 3NCYS 2CLVA 3WF4A 1AYRA 4S2CA 2MCMA 2VLKE 3GDBA 2X2JA 5CPMA 4PMOA 1M2OA 1NFIB 4H6RA 3FB5A 3RM8A 5KS9A 3U1SL 3N17A 5CZJA 2EIJB 3EOYG 1Y0LA 4IQLA 3PJNA 1N8ZB 4G7YH 5EULV 1OCRB 3VD0A 3TNMB 1B3VA 2XGIA 1IL1A 1TYJA 1ZEAL 1UOZA 3AT0A 3ZYIA 3Q6GL 2VXUL 2QUNA 2CIKA 3D30A 1M57B 4LSPH 4DUOA 4FE9A 1TPDA 3APTA 4CD5A 2C79A 5DJZB 1VFBB 1XXFC 3GPEA 1YXCA 1ZV2A 1HJUA 1E4HA 1JPST 5HY9A 1PTAA 3R79A 2GABA 4NZFA 3MC5A 4LCUA 4UIOA 3LSCA 2BSSA 4QDWA 2HVNA 2DP3A 4GW1B 5C0IB 1P5VA 4X8JB 4NI3A 3FN9A 4CGUB 2CO3A 2C26A 3P0GB 3A9IA 4MGGA 1OAUL 5GQBA 3N9GH 1MQRA 1V8HA 1FNEA 4IKNA 3B56A 3M1BB 4H0LC 1LLAA 1KRCC 4HS6B 4DAFA 5CJXA 3RWCA 3OODA 4RRPG 2GSGA 3UAAA 1JCLA 1TV5A 1QUMA 3RTQA 2KZKA 1JZ7A 2XN9A 4GRWF 5JW4M 2R1WA 5D1XB 2O61B 4R97B 4CNSA 1UA6H 4P07A 3KYAA 1JZ2A 3TLLA 3ZLFA 3EJUA 4YO0B 1WP6A 3EYSL 4YGAB 4CCZA 1MHHA 3GSMA 3LTSA 3GXPA 3O6FD 4D9QE 3H22A 2WNXA 3O6LL 4K94L 3WFLA 3BE1H 3U0PB 4ENLA 3DUUB 1NFKA 1VJIA 2BS8A 3EPOA 4IJ3B 3MV11 5A6TC 5CLYA 1U2HA 4LC8A 1BP3B 5CR1A 2VISA 3DN5A 4BQ3A 1Z1WA 1YNPA 4GY1A 1HKLL 3MN8A 2I1OA 3RIAK 4LLMA 1XISA 3SDCC 5E8DH 3LOWA 3NSJA 3QMTA 1OEPA 1Q6FA 2WNZA 5C07A 4KFNA 2V7NA 4G3YL 1S9KC 1MCJA 2H47C 3RLSA 1BZOA 3GEWB 2ZRVA 4O00A 3MHZA 2ZWYA 3QKZA 1GL4B 1IXNA 3N40F 3EGSA 3HMXA 4DEPC 3FRPG 1PVNA 2P7TA 2YGOA 2ZUMA 4BQ8A 3FQXA 3QDGD 1IC1A 4WCYL 3FUHA 5T3XE 4MWAE 4U2ZA 1W9DM 3TOYA 4FAAB 1PWMA 5GJSH 5EOCH 2PW2A 3BIKA 3E9UA 1HX0A 4ERSH 3M6DA 4B9JA 1MREL 1FDZA 4M93B 2I5IA 1Z3GH 4Y2DC 5T1LA 1CU4H 1ORQA 4N8UA 3KZPA 3DOHA 2Y5SA 1EFXB 3E80A 2F7RA 4LX4A 1VADB 3STLA 1IFRA 4REQA 4ZQOA 4Q7IA 3SQBA 1QAWA 2PP3A 1U8LB 3DSNA 4B7IA 2F8IA 1OAQL 2QBWA 5C0RH 5B3SB 1KGCD 4MQ7B 4DKFL 1G6RB 4MSWB 3RX2A 4LLWA 1D9KC 2WNGA 3I6TA 1ZDSA 3QAQA 2R1YA 1QR7A 2Q8ZA 5DCBA 3EFDL 2XX0A 4HP5A 3M43A 4FG4A 2C71A 5KVEH 4BH8B 2FHCA 3WTTA 1MNSA 5AUMB 4M4RB 1QI2A 5DQDL 2DYRB 3QVAA 1IKFH 2WO5A 4ZXBD 1FGVL 2EH8H 2B1AH 5IFPA 4AQ1C 1NINA 1QYGL 3TYBA 3K1DA 5KAQF 5MI0B 1VZWA 1WKFA 3OR7B 1IT9L 5FGCB 1QO3B 2RCSL 1BFVH 3AZTA 1U8HB 1K7EA 1P4UA 3PZ9A 1FVDA 2QPXA 3I6GB 4OZFG 3BKCL 4FPSA 2QEJA 3PPEA 1AP2B 4I7VA 3BMVA 4LLDA 5DJDA 3NZRA 3MHGA 2GQAA 4JG0H 3VM7A 3DGGA 3N3MA 2COVD 2X0UA 1IBGL 3CV1A 5DURD 3ASNB 4CQ8A 4D72A 2VXVL 2IFGA 43C9A 2DQDL 1JZIA 3F58H 1CT8B 3BAEH 4BK4A 5DQ9B 3HAEB 3WO8A 1CDBA 1JL8A 1LMKA 2YAHA 1PGRB 3E0VA 1IEWA 4LCYA 4ZFZA 3IDJB 1MJJB 2P5NA 3VINA 4OUOA 4ZBCA 2GW5A 3BPLB 1UD2A 3TA3D 2HRWA 4WNSA 4JY5L 5IB2A 4JB9H 3VW3L 1ORSB 3W37A 4DERA 2WK2A 4KK5D 3OG2A 3QF0A 4MS8D 2QGYA 1MCFA 1A9EA 3MLUH 4A38A 4H0HB 3C5ZC 3R13A 3FJTA 4U1SB 4EMZA 4D2JA 3DG6A 3FQRB 4NQXA 3TYFB 3DHJA 1F4XH 5JXEA 2D22A 3CFNA 3EXRA 3CK0L 4WKAA 4PJEF 3T55A 4KY2A 3W2JA 2IANA 4HNTA 1G7HB 2NY6C 1JWSB 2IEPA 1X9RA 4MCYB 1AMKA 4Q8VA 5CPNA 1A6UH 3A67H 4PJ9C 3O3BA 2ARWA 2HDJA 4NRZB 2Z0UA 4YSOA 1JGUL 1Y1UA 3OXRA 3GUTB 1BFOA 4Q8QA 4C83B 1XCXA 4E41E 3VFGH 4Q4EA 4NIRA 3CZ8A 4UUJA 1Q66A 4K5PA 1DBMH 4L6HA 4NQUA 1CYXA 3IUDA 5FUOL 5F71A 5DEFB 3G8EA 1T22B 1MRCH 1K3UA 2BIMA 1GAFH 2GVEA 4QRTB 4HUVB 5I28A 4ZTYA 2VDLH 5DFTA 5E6UB 1MJUL 4JPWH 4LVOC 5DS8A 3LN5A 4O02H 4XP1L 2VMJA 2OCZA 2FQGA 1BJ1J 4P5TD 4GAYB 1HJXA 1QLFA 2IWGA 1M3JA 2BOLA 4OCWL 3JT2A 2DQEH 2XFWA 1C91A 3HV8A 5I1HL 4U49A 3J2PA 4F5CE 3B83A 1OAKL 2GY5A 4P5MA 3BZEA 4QROA 1MQKL 3UP8A 1RJYB 4HKJA 3WQ5A 1WT5C 2W91A 4WWKD 5AG8A 2PZ0A 3WS6C 1S3KH 4PPTA 3GRWA 4O58H 2ZX7A 4DBUA 5JPMB 2Z00A 1RZFH 2IOIA 2MKLC 3UCQA 1TQWA 3D39D 2ZFAA 1ZLWH 2OOGA 3G18A 4BF5A 4KHXL 1BVNP 5D5MB 5I1IL 4NDMB 3FEQA 2Y1YA 2OV0A 4RCAA 2AQWA 3U9UA 1ADDA 2C1PA 2QV4A 2YBGA 5HGGS 1H1ZA 4XVEA 3HQPA 4E5XA 1RZQA 1HILA 4JN7A 1MCBA 1H0GA 3F5WA 4ETQA 6FABL 2V9RA 1E6QM 4HJJL 4E4PA 4BF7A 3AXLA 3R18A 2WV8A 4DP2X 2VMDA 3QUMB 3TYEA 2QNEA 4ANXA 1MRFH 4X60A 4IRSD 1XF5B 2VABA 1PG7X 1E51A 3DA0A 1TPWA 4XNAA 3LGDA 3NZGA 5F1IA 5TFSH 4F2TA 2J47A 3KPSA 2C9PA 1T6BX 4QY8A 5I1EH 1Z41A 4LGPB 3OQ8A 1BDYA 2BY1A 5I71C 3G1DA 1TTPA 3BUBA 3L5MA 4UR7A 4YBLB 3DSFL 1WC7B 4PHXA 3BSZH 4C90A 2YR3A 4Y4KC 5IDZA 4Z0XB 3IT8D 4ONFL 5TE4H 4K3DH 1U8PA 3H3PL 4I9WD 3M4HA 3K8LA 3SJVD 1XVSA 3N25A 4KRLB 1LO0H 4OIIL 4LDLB 1NARA 5IVXF 4NNXB 4OLVL 3V6OA 2GSMB 1ZSXA 1NCIA 1UHVA 3OKEB 2FYYA 2F53B 3OQRA 4JUTA 3UJRA 3KOXA 2I7SA 1A3QA 1J9YA 4DB7A 1JPTH 5CZRA 2JF7A 2XVKA 2ZRXA 2EDLA 2DS4A 5HHVL 2YD9A 3NSDA 4P3CL 2GJ6A 4Y7MA 1JGVH 1FWDC 3S5LA 3DX8A 3GXTA 2CDGB 1CGUA 3R06B 5H8UA 3QJAA 4XXDA 1L6PA 3T6CA 3HLAB 1A5NC 5BW6A 4G42B 2I60L 3TK7A 1CECA 4JPGA 2EAEA 3NN8B 4BKSC 2QSVA 4RDWA 3S5OA 5BMWA 1JNHA 3CX5K 3OGCA 4QG6A 2VQ1B 4DGYL 4ZRGA 3OYZA 3FTZA 3HTWA 4JO4L 4M48L 2VH5H 2C91A 3C6SA 2HKAA 1QZ1A 3B06A 4GYFA 1ND0A 4M1CC 1RK1A 1K6QL 2W0KA 5DMKB 4ZOBA 3CN4A 1G43A 5JXQA 4HWZB 2CJSA 3QZLA 1R3SA 5FO9A 1OWQA 3ML9A 5C7VA 2JJSC 2BCMA 5HNRA 5AC8A 4MJ5B 1PKYA 2J4WH 4ANWA 5JUEH 4A7SA 4JO1L 4Q8TA 2V7HA 1IGIL 2WUCL 3RVWC 4UV7L 4MVAA 4UFJA 2C3WA 2ZZ3A 1J1OL 3MUGA 4IFOA 1EKOA 1B0WA 3OG6B 2OTDA 2BVEA 1JV2A 5AN7A 4Z78A 4RAUA 2G9HB 3EJYC 4UTIA 2VB5A 3KMDA 3FOMB 1J4EA 2I9UA 3IAQA 1Y7VA 3SDDC 5DD5H 1ZBVA 4U7MA 1SOSA 1PNCA 3I6EA 4KNTA 1MLBB 4IMEA 3P0VL 3RU6A 1F8IA 2WO3B 4F2BA 5LBSH 1E28B 4HOMA 1BWKA 3ZIYA 2YLAA 5E4EB 5IKCB 4LUTA 3CVHH 4JZNA 1W0VA 2A6IA 2UXTA 1LP9E 5D1QD 1QLRB 3GTNA 3K4DA 5CBAB 2R1PA 1KELH 2A4EA 4G83A 4PRBA 1XCQB 2A77H 1T7YA 4JE4B 4LOFA 4MVBC 4L1SA 3I75A 4MMXB 2N3JA 2NR6C 1SMDA 3ZMEA 3C61A 3AREB 4DF2A 2GG1A 4JM2A 3G6DL 2H3XC 4O4YH 2Z91A 4YLWA 2OO6A 3MSDA 4ZSUA 3QJHB 5INDB 5GIRA 5IB3A 4PTTA 2IFFL 1VPXA 1FAIL 4AKQA 2OAAA 4B97A 2C0HA 1FWXA 5F7EL 3UPBA 5IJCC 4NHUB 4QX4A 2EYRB 2ZOKA 1A3LL 5CSRA 2N1TE 3H6AA 1JRHH 2XXGA 3TYDA 3WSUA 4WI5A 1V0NA 1ZHKB 4JTLA 4GVIA 1RIHH 5GGSB 2EPHA 5AHFA 2AXGB 1GJIA 4P2OA 1UCBH 3WJSA 4X6FA 1QEXA 2VZVA 3AUWB 3K80A 3EWDA 2X41A 3CFDB 2AC0A 1ZT7B 1XKJA 1EFXD 2EHHA 5BNKA 3A4DA 2J9XA 5ABEA 2XKNA 1T4KB 3DECA 4WEVX 1XV8A 2POTA 4QF1A 3T0ED 2KZBA 3V0HA 3VIGA 2XJ7A 1THCA 4F1ZA 1SJAA 4GFIA 1VGEH 3AABA 5D2NB 4HCFA 3CVDA 1FFPB 3DU0A 4RGND 5CBJA 4OCLC 3H9SB 2R27A 2VN3A 2DQUH 3ESPA 4P4RB 4ICMA 4S3DA 4YLBA 1XKYA 5F7DB 3PSVA 4NQED 1JPFA 3ZT7A 1I9JH 1W8OA 4EDXB 1EQCA 1FWBC 4WTXA 2I9LB 2J5LB 1PS3A 4NERA 1POJA 1BZEA 1OY3B 3FO2B 4OFPA 1XDMA 3EWYA 1LF1A 5T9BG 3BYTA 1LROA 3SCSA 1K9EA 4OKVA 1Q1JL 3ZPDA 3N6QA 1XG3A 4O2EA 4HIIB 4N8VG 3ULAB 1UG6A 4IP7A 4GPVA 5FFLA