3CPUA

Subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Subsite mapping of the human pancreatic alpha-amylase active site through structural, kinetic, and mutagenesis techniques.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cpuA01
1J9YA 4LYPA 2FE0A 1G9HA 2PWEA 1X6NA 3ARTA 3AJ7A 3I3DA 4U2ZA 3ARUA 4W89A 3AMCA 2V3DA 3A4AA 3OGSA 1UOKA 1GCYA 3BVWA 2VUYA 4X0NA 1KB3A 1BQCA 3K4AA 1D2KA 3J7HA 3LPGA 4RL3A 1DP0A 3WL0A 1UUQA 2VZUA 5GNXA 1XCXA 3FXYA 3GXIA 2OYLA 4M29A 5JUVA 1PZ3A 3VGGA 2YBUA 3EJRA 3IJ7A 4D71A 3L4WA 3GNRA 1BPLB 1E15A 3ZJ6A 4PTVA 4UTFA 2BVYA 2CITA 2J74A 1V6VA 2G3IA 1XRVA 4DO4A 3WQ6A 5GNYA 3ZT6A 2VI0A 1C90A 1JXKA 2BY2A 3FAWA 1R8LA 3EDJA 1RH9A 3AHYA 1C8XA 2XVPA 4CVUA 1QI5A 3ARXA 2BHZA 1DTUA 3WDJA 4DM1A 1NQ6A 3G6MA 1V3LA 1MQRA 3HZ3A 2OWCA 1GVYA 1KXHA 5C71A 2J79A 2VURA 4B15A 5JBFA 1R46A 1HJVA 2VZTA 3WD4A 3W28A 1E0XA 1UASA 1I1WA 4OJYA 2CHNA 1B3XA 3ARQA 2QPUA 1J0JA 4J3WA 4F79A 5I2UA 4J3SA 4KRTA 1ZBKA 2WKGA 4CCDA 3VIFA 2PBOA 1BHGA 4DWSD 1T0OA 2G8ZA 2XM2A 2WPGA 4UOJA 1IZKA 5BROA 3VIOA 3DDFA 3OZPA 3HJEA 2EADA 4EANA 5E6YA 3BUQA 3VTRA 3GNOA 4E2OA 2F7PA 1W1YA 4XX6A 1HX0A 1PIFA 4WSJA 4W84A 1UQZA 1B3YA 3VDCA 1CGTA 3MSGA 1OINA 3RPMA 3SCWA 3NDYA 3VD7A 4ATLA 1HP4A 4MTVA 3PBGA 4QLLA 1QBBA 2ESCA 1L8NA 1XH1A 3ZJKA 3FW6A 1HKJA 2DQXA 4QCFA 3VIPA 3WUFA 3GBDA 1E4MM 2BY1A 4DWSC 3CUHA 1MW1A 2WVSA 2VQUA 4GIAA 3FHQA 3DHUA 2EAEA 4UQAA 1OBAA 3MV11 4DM2A 1JYWA 2J7HA 4BQ5A 4ZXOA 3VINA 5ABHA 3GYCA 4NXKA 3WNLA 4AWEA 1UYQA 4UR9A 3WY2A 4KH2A 3VX0A 4P7OA 3H55A 2DT2A 3GM8A 5CGMA 1VRXA 4W7WA 1ZS2A 3CZSA 4NZFA 1DWJM 3CBWA 3SURA 1V0LA 4RE4A 3UR7A 3JUGA 3SCNA 2XSAA 2X0HA 3SUVA 2BFGA 2WMJA 1E5NA 2WMIA 4HZ7A 4PMXA 2Y2WA 4B16A 5C70A 3LPPA 4AZ7A 5HXMA 3TONA 3WMCA 3POCA 5I77A 1W32A 1JDCA 1VB9A 4AD1A 3W27A 4F8XA 5A8PA 3F4VA 2O9OA 3I3BA 3VUPA 2XYLA 4M80A 1HVXA 2WANA 1BGGA 3LMYA 4CUCA 3WUEA 2PC8A 1E72M 3WD1A 1KWKA 2DT3A 1UD4A 3GZAA 3VD3A 5CXPA 5FL0A 2A3CA 3WDHA 2O9TA 2DSKA 1KBKA 4D6HA 4OOUA 1CGWA 4LGXA 1JNDA 1W1VA 3UR8A 2E4TA 3BMWA 5EFDA 3A4WA 3QOMA 4F9DA 5GQBA 3WENA 3K1DA 3HN3A 3F5KA 4N0RA 3T0DA 2XN2A 4D6IA 2DH2A 1FOBA 3NSNA 2GJXA 2BNJA 5DT7A 4P7RA 1PZ2A 1CPUA 4HZ8A 5AC5A 5AYIA 1XYZA 1KR1A 2VZOA 1TMQA 1F4HA 3WQ5A 1J11A 1M03A 2PWFA 5M17A 3BUDA 1B0IA 1ZBWA 5LA1A 1HXKA 3CZGA 1GOKA 2XHYA 4UOZA 2XIBA 2X09A 1CDGA 3QR3A 3BSGA 1WZMA 1HKMA 4HZ6A 3W38A 2X8RA 3AS0A 1NP2A 1VJZA 3POHA 1HF6A 2RGMA 3FN9A 3NYDA 1V6UA 2VTFA 1UG6A 4LQ1A 1KR0A 1HL9A 2ZX9A 3TOPA 4AIOA 3QHNA 1LG1A 1W3JA 2WCSA 3T2QA 2YKKA 1EGZA 3VDBA 1J0HA 1TZ7A 3O9NA 1MQPA 3BSHA 2CERA 2BXZA 4J28A 4ATWA 1C91A 4FK9A 1WKYA 2QMJA 2WC4A 1R7OA 3S5ZA 1XH0A 3SCQA 4UQEA 4JFWA 2XVGA 3ARZA 4WK9A 2D22A 2BY0A 5HOSA 2E8YA 2Y5EA 1PS3A 1JG9A 1UR4A 5JIPA 3THCA 1E56A 3WN6A 3WFLA 2WLYA 2ZWYA 3MSDA 2WBKA 5BRPA 3TV8A 1CYGA 4W86A 1FH9A 2ZX7A 2VT0A 5F7UA 4X9YA 2VMFA 4AZIA 2WZIA 1LJYA 2WNWA 3KL0A 1ISYA 3BMVA 4A4AA 3PTMA 1JYVA 4W88A 2A3BA 1IV8A 7TAAA 5M3WA 1XSKA 3HG3A 3ZT7A 3B9DA 5LA0A 1JF5A 1JXJA 1BTCA 1UA3A 2GK1B 2J8FA 1W2PA 3VIGA 3AHZA 1MVYA 3BH4A 5E9AA 2DDXA 2CYGA 2PWGA 1VBRA 1HJUA 2ZIDA 3A21A 3WNPA 4CGTA 3A4XA 4NZCA 3ARWA 1YHTA 4CCEA 3OG2A 4EKJA 1CXKA 2DT0A 3VIHA 1TUXA 2AAAA 3SCSA 1OT2A 1NWTA 2IXUA 1UWIA 2VRQA 2DIEA 2J25A 5BXSA 3KE0A 1CTNA 4JFVA 2AOSA 3ARSA 3CC1A 4JKLA 3MMUA 3B9EA 3ARRA 2Y4SA 2WHKA 2VZSA 1EH9A 3RIKA 1H09A 4UFMA 2NSXA 2YL5A 1BG4A 1E1EA 1E71M 2XJ7A 2HISA 3WY4A 1X6LA 4XUYA 4BQ2A 4KRUA 4HP5A 3MUIA 3BVUA 3WMSA 4TVCA 5JBEA 3KZSA 4FNUA 3CHFA 4M8UA 2F7QA 2ZX5A 2V3GA 2QF8A 1PX8A 3PTKA 4H7VA 1BVNP 2FHBA 1UWQA 4P8XA 4P7QA 3UG5A 4TTGA 2E9BA 3AYRA 4D6JA 2FHCA 2ZE0A 1WDRA 3LXCA 2ZX8A 2PBGA 4Q22A 3WD0A 1NH6A 4AZCB 2ZXAA 2F61A 1GOOA 3DECA 4IUGA 2YLLA 1HWWA 2J62A 3VOCA 2ZUWA 1XGZA 1FA2A 3PZTA 4LPCA 1SMAA 2MANA 4D72A 1FH8A 2G3MA 4OBSA 1WZAA 3CHEA 1QNOA 3WH8A 1E9LA 3CHCA 3SUSA 3A24A 2X2JA 4JZ5A 5A95A 5EB8A 3DC0A 3ZR6A 4D6CA 1LL7A 3OGVA 4JKKA 2AMGA 4GZIA 1BAGA 3RILA 4L4OA 1BYCA 1W1TA 3WH6A 4R27A 3EYPA 1SMDA 2W91A 3WMBA 4H04A 1E6PA 4AZBA 3EJSA 1ZBCA 3U5YA 4NSBA 1VEPA 3DYPA 4TVDA 4FF5A 1QVBA 1HTYA 2EXOA 1V6WA 3NDZA 3DX4A 5KEZA 3CUFA 5FOOA 1E1FA 1UD5A 4V27A 2CCRA 2J4GA 5E70A 1U2YA 4B3KA 2Y24A 1VFOA 2D73A 5FKYA 3RM9A 2CPUA 2JF7A 4GI6A 1GVIA 2F1BA 2F8QA 3EMCA 2UY5A 3WEZA 1C92A 4XV0A 1OIMA 4PTXA 3CUGA 3CUJA 1FFQA 1PAMA 1BG9A 3T08A 5EBAA 1GUVA 5CPTA 1XCWA 5ABFB 4D6FA 2UY2A 1K9DA 3W81A 1WDPA 2XUCA 2EABA 2BVDA 1DWAM 4QAWA 4ZE5A 3ZT5A 1I1XA 3MU7A 4YHEA 3TTYA 1NWRA 4V28A 3VIIA 1KQYA 3AISA 1GNXA 3VNYA 3CUIA 4W5UA 5HPOA 5E6ZA 1JD9A 1PEZA 1N82A 1E73M 3EJTA 3VO0A 3GXDA 4R5EA 3GH7A 5CG0A 2WC7A 3WNOA 1CLVA 2GJPA 1VBUA 3VMPA 4QLKA 1DHKA 1E55A 1US2A 2EPLX 4GZEA 1NP0A 4AD0A 1HN1A 5I6SA 3OGRA 1EHNA 4BQ4A 4MB1A 1JZ7A 3DX0A 2WMHA 1JF6A 1E70M 1H1NA 5DFAA 3ARVA 5D9NA 1XC6A 1RP8A 3W4RA 5DMYA 4JHOA 2VVSA 1BF2A 3GXPA 4MJ4A 2JE8A 1WNOA 5A2AA 2JEQA 4BF7A 1FFRA 1O6IA 1Q6FA 3IAQA 1OD8A 3WY1A 1EDTA 5DF0A 2BS9A 3HG4A 4AD5A 5A6MA 3FAXA 4M56A 4AC1X 3OIHA 2XPKA 1MW0A 3PZOA 1R86A 3NUKA 1GONA 1Q6DA 4DO5A 3BUBA 2W62A 4KGJA 2B31A 6CGTA 2GVYA 5KZ6A 4XB3A 1H11A 4UQ9A 1O7DC 4A3HA 1MYRA 1EDGA 2J75A 1CGXA 1UWSA 1LQ0A 3AICA 5CSUA 3NCOA 2W61A 5E1QA 5A8NA 2D0FA 4HOZA 3RM8A 7CGTA 2WB5A 3BUIA 1XD0A 2OSXA 4GQQA 4PMYA 1UR1A 1OM0A 2WHLA 3GBEA 4S3JA 1V03A 5A6KA 2XGIA 4GO8A 1CIUA 2EJ1A 4OIFA 3W6LA 4FLRA 1EDQA 2YA1A 2JIWA 3ARYA 1IT0A 2CEQA 1W9BM 2ZUVA 1ZJBA 4CVWA 1JDAA 3SEPA 3WQVA 3F5LA 1W3HA 3HMCA 4TX6A 5A8MA 4Q7NA 4C7FA 1SR0A 5DEZA 2IXVA 4MNKA 3T2PA 2GSJA 1W1PA 4UQBA 3VD9A 4PYSA 3L2LA 3WUBA 3AIUA 1E3XA 4HU8A 3EDDA 1LWHA 1SFSA 1KFWA 1VENA 5D8ZA 3E1F1 2G3NA 2V3EA 3OLIA 4C7DA 1UR0A 1EO5A 3LRMA 3AMDA 5IDIA 1E6NA 3AHXA 3S2CA 2WMIB 1BVZA 3D50A 1L0PA 3G6LA 2JEPA 3L4VA 2J7GA 6A3HA 2BY3A 3N13A 3II1A 5I0DA 2D0HA 3VD5A 1VFUA 3D4YA 1JD7A 1ZL1A 2ALWA 1LF1A 4E8DA 3B8SA 1O7AA 1DWGM 2VOTA 4CD6A 1H5VA 1EOMA 1JL8A 1CENA 3VPLA 4JCLA 1ZBVA 1V3MA 3CH9A 4LYRA 1W3KA 3EMZA 1G5AA 1E6RA 4FLOA 3AZTA 1MW3A 3EJUA 1C93A 1DEDA 2XVKA 1LG2A 2VX6A 3SCRA 1WE5A 2FYVA 2FH8A 2XTKA 3M07A 3FHAA 1CXHA 1JZ8A 2ZUNA 5A6JA 4BQ3A 3N11A 4ZE4A 3KEHA 4AMCA 3IJ8A 4XZWA 2WYSA 5CJ5A 3MKKA 4PEEA 3PZIA 3VSUA 1ZJAA 4OZOA 2GFTA 4AMXA 2OW7A 1AVAA 3ZR5A 3W0KA 1E40A 4EE9A 1OD0A 2Q8XA 5EFFA 2DSVA 2WAGA 5DO8A 4CU8A 2PWHA 4JKMA 2CKSA 3KLLA 1UKOA 1CZ1A 4PMNA 3NSMA 4PMOA 4D1IA 3AS3A 4NF7A 4W7VA 1UH2A 1GZJA 4PUDA 2YLAA 4K68A 1QHPA 2EPNA 2D20A 1QNSA 3PZGA 2VR5A 1E6XM 1R87A 1GOWA 4GI9A 2DPEA 3N1AA 2W4XA 4W5ZA 4AW7A 2XG9A 4WKFA 4P8WA 4C7GA 4H8UA 4M81A 1DWIM 4IISA 5A6BA 4GQRA 3VVGA 3RJYA 2XN0A 2X2YA 1UA7A 2WVVB 2QV4A 3OB8A 4MB4A 2EPMX 3MUZ1 4ACZB 1V0NA 1HL8A 5BCAA 3GH4A 1QW8A 3MV01 1CXEA 4TUFA 3DX3A 4LYQA 1ITXA 4OBRA 3VGDA 3GNPA 2JALA 1EIBA 3WDRA 4UNIA 1UKSA 4FLQA 3DYOA 2EO7A 1QWNA 3RM4A 3WL1A 1JZ4A 1WDQA 4FNSA 3THDA 2CKRA 1JZ6A 1KGWA 3BLKA 3WSUA 2EQDA 3BC9A 3BGAA 1GQKA 1Z32X 1XSIA 3L4XA 3AIEA 3UESA 1UKTA 2VC9A 3VDAA 4JAWA 1C7SA 2DT1A 1J10A 3VNZA 4UZSA 3ZJ8A 3VKKA 1R85A 4N42A 4LXFA 4PMDA 2ZXQA 4PN2A 3DX1A 5LA2A 3W25A 3HU7A 3LPFA 1M7XA 3WQWA 3BAKA 3L4ZA 4M24A 3WNMA 2YBTA 1V08A 3GXMA 3BUPA 1VJSA 1G0CA 2CBIA 4QDMA 4V2XA 2FGLA 4E4PA 2VQTA 4E8CA 3CLWA 1TQTA 1EA9C 3GXTA 2PWDA 3MUAA 1JZ2A 1KCKA 5CPSA 1TFVA 5A1AA 3CZJA 1KWGA 3DHPA 5JIWA 1WCGA 2OYKA 4AY1A 4HA4A 1GJWA 2FGZA 1OGSA 3MS8A 3AHTA 4RE2A 5BRQA 1ISVA 4TXEA 1BSIA 3SUWA 4J27A 2WM0A 3VX1A 2F18A 2E9LA 3BAWA 1PX4A 2VCCA 5IHRA 2BHUA 3BXWA 3WDPP 1C8YA 4CKQA 1CGVA 1G94A 1HP5A 1TG7A 3O2LA 4IM4A 4AXNA 4PRWA 3N9KA 2NW0A 4CN1A 2FDMA 5A8OA 3RO8A 1CGUA 3WY3A 2Z1SA 3IGUA 5IXEA 2OYMA 3UETA 2XN1A 3WDQA 1W2VA 3D51A 1UR9A 3U7VA 1NOUA 3ZM8A 4F9JA 3OZOA 9CGTA 1KTCA 1B3WA 1AQHA 1E5JA 2WWCA 1V3JA 1LL4A 2WW5A 4HOXA 3TP4A 1MFVA 1TA3A 4D6DA 3TTQA 3MMWA 3WUGA 4FLSA 1UD3A 1JDDA 4UQDA 5BXPA 2A3EA 4Z2GA 3T09A 4OOZA 3N15A 1NOWA 2WMGA 5CSYA 4AISA 3CZ8A 3WIJA 1HT6A 2E3ZA 1B3ZA 1W9UA 3QHMA 4MNMA 4P7LA 3ZJ7A 5M5DA 3U57A 3WQ8A 1OCQA 1FP8A 1H0IA 5A3HA 2X2HA 1QI2A 4PMUA 3AXHA 4KWUA 1CWYA 2VCBA 4Z2IA 2JF6A 1UHVA 5AC4A 2WCGA 1W9VA 1UZ4A 2V5DA 4QLJA 3UEQA 4HPHA 1HXJA 4OKDA 2NT0A 3DX2A 2X0YA 3AFBA 4HTYA 5A2CA 2VZVA 2Z1KA 5M03A 2GK1A 5I23A 4MB3A 1FHLA 4UZUA 3BLPX 1RD6A 2D24A 4IPLA 2ZICA 1PBGA 1FP9A 1QW9A 2XVNA 3UG4A 1MXGA 2VX5A 4CN6A 4W7UA 4CD4A 4X0VA 2ZX6A 4CCCA 4EK7A 2XGBA 3K46A 1ZU8A 3APGA 4PMVA 1AQMA 2DH3A 1VEMA 3ZOAA 3L2MA 2A3HA 3K8MA 5BWFA 4H8HA 4HMCA 1E4NA 1WO2A 2WBGA 1US3A 2A3AA 3PTQA 4WKHA 4MPKA 1D3CA 1GOQA 2IGTA 4W87A 4J3UA 3WD3A 3AMGA 8A3HA 2XVLA 5A2BA 1CXIA 1GPFA 4DUWA 2J7EA 1TQUA 2D3LA 3SUTA 3LXBA 4UOQA 2UY3A 3W82A 5HBFA 3TTSA 2VO5A 3AHVA 1FH7A 1K9TA 3AIVA 1J12A 3S5YA 4TTUA 3S6TA 3T2OA 3WF0A 5A8QA 3W29A 5GNZA 4NXSA 2FH6A 4DWSA 3LXAA 2XM1A 4NRRA 3WF4A 2QPSA 1BLIA 5FL1A 2QHAA 3K8LA 1QX1A 3D4ZA 3O6AA 4QP0A 4B9ZA 2HVMA 4GPNA 2EEXA 3VSTA 1UD8A 2VRKA 2F2HA 1CECA 4GKLA 3GXNA 1CNVA 2WMKA 1K9FA 4AZCA 4CU6A 4AYGA 4FNTA 3CO4A 1X1NA 1W9XA 4UFLA 1HJXA 2YDQA 3GDBA 1TQSA 1VEOA 4MNLA 3WF3A 1SYTA 4CN4A 2J8GA 1R47A 1MFUA 1XHGA 2J7DA 4HU0A 2C0HA 1UZ1A 3N17A 5IFTA 5D9MA 4DO6A 3AS1A 4QFUA 2O9PA 3ZSTA 4HMEA 4D6GA 3PN8A 3L4UA 2YDRA 1K6AA 5BXRA 1QNPA 3KL3A 3AMLA 3CHDA 1M53A 2IUZA 2C8NA 1JI1A 1R33A 3UCQA 2CBJA 2YA0A 1I75A 1J0ZA 1WDSA 3WELA 1V3KA 3KL5A 3IANA 2WSPA 3IAPA 1CXLA 1KBBA 1QI3A 2WKLA 2G4FA 3U7BA 3W24A 8CGTA 1C8QA 2DGAA 4U3AA 1XSJA 1UKQA 3MANA 4AMWA 3EJQA 3A6OA 1E4LA 5A69A 4AZ5A 4F66A 5D4YA 1G1YA 1GQIA 1J0KA 3MI6A 1Y7VA 3WNNA 1B2YA 3KWXA 2BVTA 5GPRA 1MQQA 2WVTA 1VAHA 1KQZA 2D3NA 1BYAA 3TA9A 3D5HA 4W85A 4MAZA 3WFZA 5ABFA 1EO7A 4W8BA 4U31A 1UR8A 1GW1A 4W8LA 4A3YA 3W53A 1OT1A 1B3VA 2UWFA 5FIPA 3VGBA 3NSXA 3BCFA 5LYRA 4URIA 2VCAA 3VMNA 3PHAA 4W8AA 5A6SA 4HMDA 4ML4A 4JL1A 2E9MA 5AY7A 2EPOA 1CEOA 4HPGA 4P8UA 3SCUA 2XFFA 5CGTA 4Z2JA 5A94A 1QPKA 2ZUUA 4LX4A 3W6MA 3BAJA 4QCEA 3DYMA 1B9ZA 2J7CA 3CTTA 3BCDA 2CBUA 3A5VA 3LPOA 1JYNA 1UKPA 4J7RA 3VMOA 1UWTA 3KLKA 3VSVA 1V0MA 1GHRA 4HOWA 1G01A 5CLTA 2J7FA 5ABEA 3VM7A 1VIWA 1Q6EA 2VX4A 1Q4NX 1ODZA 3CZLA 1J0IA 5I3DA 1JI2A 3FY1A 1R75A 5C8BB 3AOFA 5A6AA 1HIZA 1BYBA 3CV5A 1UWUA 5EMYA 4PUEA 1XH2A 1B30A 1JAKA 3QOKA 5D8WA 4UFHA 1R34A 2CNCA 2PB1A 4AEFA 1H2JA 5HDRA 3HG2A 1NWUA 3N18A 5IHSA 2XFYA 3ALGA 1VF8A 1UH3A 2X1IA 1ISWA 5TD4A 1UWRA 3EJPA 4WKAA 3L4YA 3W37A 4JL2A 3UERA 1RPKA 1QNRA 1W9DM 3WH7A 3LRKA 4RE3A 2UY4A 2WHMA 2DEPA 3M7SA 1ODUA 4PTMA 4TVUA 3ZQ9A 1W9PA 3W26A 4J3VA 1BGAA 4P7NA 1V3IA 4PMRA 1E0WA 2OSYA 2DIJA 4XZBA 5D9PA 4J3TA 2GUYA 2O9RA 4BZYA 2CIPA 1XV8A 2YIHA 1B1YA 5CQ1A 2G3JA 4PMQA 3AYSA 1MXDA 3VIMA 3D52A 1ISZA 2D23A 4H41A 3WH9A 1KXTA 3WDIA 3SCTA 1YQ2A 2W92A 4H2CA 3I3EA 4NX0A 1UQYA 4CD5A 4B3LA 2ZUSA 4UFIA 1KTBA 3SCVA 2GJXB 2VX7A 2WZEA 2D1ZA 4IPNB 4ZENA 3AIBA 1ECEA 3ARPA 4PCTA 3AIQA 4UQCA 1V6XA 4DUVA 3IJ9A 3VGEA 3FNDA 3T0AA 2OWWA 5ECUA 5HPCA 2G41A 1H0GA 4CD8A 1UH4A 5E09A 5CLWA 4WF7A 4UFJA 2GDUA 1GHSA 1B90A 1B31A 1CXFA 3K4DA 3UG3A 4KMQA 1TR1A 4AYSA 4U2YA 1AQ0A 3AIRA 1OWQA 4PCSA 3SUUA 3WF2A 2ZXBA 3WH5A 3SCPA 1GQJA 1GOMA 3WQ4A 1HJSA 3AXXA 3ALFA 2WC3A 3AROA 3WBEA 3HG5A 5I24A 3AMKA 1A3HA 1MWOA 1V6YA 4Z2HA 5I5RA 4MB5A 1JZ3A 4WIWA 2OLHA 2ZWZA 2F7RA 1EXPA 4EAMA 4BCEA 2XSBA 5CZKA 5A6LA 5I78A 3LX9A 1QNQA 3MO4A 1EQPA 4GXPA 1JNEA 1R7AA 2CBVA 1KCLA 3GH5A 2OW6A 2OSWA 1GORA 3WBAA 1K9EA 4S3KA 1JZ5A 3AZRA 3RMEA 1SZNA 1HJQA 3ZO9A 1S46A 3VD4A 1E0VA 2J47A 2JFEX 2Y8KA 3GXFA 1ESWA 3U5UA 3PZNA 4OUEA 2W67A 4JFSA 1KXVA 3L4TA 2PF0A 3EBVA 4ZXLA 3A3HA 1H4PA 2V3FA 2CESA 5E0CA 1E6ZA 3A22A 3CZEA 1J0YA 3BVTA 1DWHM 4PBGA 1CBGA 5FCZA 3ECQA 4MDPA 1P6WA 5AYBA 4Y7EA 1KGUA 1TA3B 5D9OA 4CD7A 3OLEA 1E4IA 1JYXA 4AD2A 2F1AA 1GQLA 3BVXA 1BYDA 3CIVA 1JFHA 3RDKA 2W5FA 1ITCA 4GI8A 2EPKX 3CZKA 2EBNA 1V02E 2GDVA 4FNPA 2WVVA 1HKIA 1J01A 4ACZA 4HA3A 2ZOXA 1JGIA 3ZIZA 4GO9A 1PX3A 1HVQA 4L4PA 2VL4A 1WB0A 3AS2A 4JFTA 2CXGA 4PTWA 4Z2LA 2YA2A 2YL8A 1QI4A 1FHDA 3H53A 2XFRA 1HKKA 1NM9A 1TCMA 4M1RA 3VILA 4D1JA 2XIIA 4U3CA 1VFMA 3A23A 3ZSSA 4JIEA 1MW2A 1U33A 3TTOA 4JCMA 2WHJA 2BXYA 1VFFA 1NARA 4BA0A 3VDHA 4H8VA 4YHGA 3M6DA 2WCAA 3SCOA 3WF1A 1PJ9A 2YDSA 2OWXA 1CGYA 1PIGA 4AZ6A 2CETA 2VVNA 2XWDA 1GOIA 1E6QM 3RCNA 1ZB5A 1NWSA 3D3AA 2YL6A 1TQWA 4ATDA 1PPIA 2V38A 3VIJA 3PZMA 2V5CA 3PZUA 3PZ9A 1H41A 3T0BA 5BYWA 2WSKA 1C7TA 2GJRA 2O92A 4MJ2A 1XD1A 4MNJA 4WLCA 1E43A 1JFXA 1QBAA 3CPUA 2E40A 2PI6A 1OSEA 3OBAA 5CPQA 5I79A 1H3GA 4W93A 3VGHA 3AI0A 1E6SM 3CGTA 2F7OA 4YPJA 4AD4A 4NRSA 1JIBA 2TAAA 3M46A 1QWUA 4MDOA 1QHOA 1J18A 2X05A 4U5KA 5A6BD 7A3HA 4BS0A 1UD6A 1EQCA 1Q6GA 2XWEA 4WJXA 3CZNA 2VNCA 3BVVA 1TQVA 4MADA 4DWSB 2YFOA 1LWJA 3WNKA 2W63A 4TX8A 3EDKA 4P8VA 3VIKA 2D2OA 4NZJA 1WPCA 3ZMRA 4DUXA 2YFNA 4U33A 1OGGA 2VJXA 4GINA 1W91A 3DDGA 4PSRA 3BAXA 2ZUMA 1OGBA 3B9AA 4KGLA 4GZJA 5BXTA 2D0GA 3WD2A 2ZUTA 1WAWA 3BAIA 1GJUA 3WKZA 1QHZA 1Q6CA 4FNQA 3AQUA 3LRLA 4ACYA 1UD2A 2WMFA 4AEEA 1DWFM 1TVNA 2E8ZA 1XYFA 1F4AA 2YOCA 1OB0A 4AZGA 5JBDA 1RP9A 2J77A 3SIMA 1ISXA 2W66A 4UFKA 1TVPA 1C3FA 1TE1A 3WEOA 1A47A 2VRJA 2QLYA 4D6EA 2JIEA 4WSKA 1KGXA 1NOFA 3VM5A 3IK2A 4CU7A 1BFNA 1EHAA 3MMDA 4FMVA 1CLXA 3BAYA 3EDEA 3QHOA 1V0KA 5ABGA 2DSWA 3BLBA 2WVUA 1H49A 3MUY1 1U30A 2VR4A 2J78A 2YL9A 4YN5A 3NIYA 1QOXA 5E0FA 3RJXA 2EACA 2X2IA 3AIWA 1M01A 2J7BA 4MAVA 1JAEA 4AIEA 2BV9A 3OLGA 2WZHA 4U5IA 2DSUA 1KXQA 1AMYA 5FD0A 1WZLA 4FNRA 4JHZA 2FHFA 1EOKA 3OA5A 3F5JA 2C7FA 3A47A 4UCFA 1D7FA 5IFPA 3PZVA 4ZEPA 1M04A 2YJQA 4AD3A 2WLZA 3EDFA 2E0PA 3K8KA 3VU2A 1LLOA 1W3LA 4ZFMA 1WP6A 4OGZA 4J3XA 3WEMA 1HNYA 4NI3A 1HJWA 3NJ3A 3QGVA 2WK2A 3CMGA 2NT1A 2QMKA 2WWDA 1E3ZA 3CMJA 3GTNA 4PMZA 4AZHA 1WZKA 1OIFA 3H54A 1V3HA 4AIUA 2RGLA 4HA1A 5HNNA 4B9YA 1V02A 4TOQA 4Z2KA 4JFUA 2CHOA 3AXIA 1UR2A 2WXDM 1QI0A 3N12A 2BHYA 2ZXDA 2Y8VA 4M82A 3OLDA 4PSPA 3AZSA 1IZJA 2DSZA 3PZQA 1LL6A 6TAAA 3EMQA 3VGFA 3N04A 5DT5A
chains in the Genus database with same CATH superfamily
3AZUA 4L5FH 4NQSA 2IMRA 5ACMA 2Y6ZA 5KVGL 3RFZB 4MBOA 4DVBB 3ARUA 4S1QH 2RGSA 3WK2A 4XOCA 1DDHA 4PTNA 4N6FA 3ASWA 1PKOA 2L5HA 4UIKH 3HBPA 4OH2A 1WFOA 1KRMA 4C5ZA 1ROWA 3L4WA 5GSVB 1YY8A 4B9GA 4HUWB 1IBHA 4PTTA 1LK3L 2EEAA 2P1YA 3OXRA 4OZHE 2XWZA 2AHIA 1XFBA 4NNBA 2B9BA 3HG1E 3AHYA 4O4VA 3FO2B 3KRSA 1I1YB 2IANA 1S78D 5G2IA 5KVGH 4B15A 1X5JA 1J9CT 4YLWA 3C86A 4IRZA 5CBEA 3PS7A 5D8JL 4F0HA 1OL0A 3VIFA 3CBRA 3VIOA 1LK3H 1UUMA 2V33A 1DVQA 2VCOA 3VTRA 3GNOA 2D7QA 3Q2CA 5JDSB 4YE0A 4FIRA 1ZLUK 1I3VA 1JF1B 5IEHB 3REVB 1G4SA 4NRXA 1YPZA 4HMNA 1G7MB 3JBG7 4Z0BL 2OCFD 4JFEA 1BMWA 1SLUA 4PJFF 4GIAA 1R3QA 3OPUA 4G8GD 4WTZA 3DHUA 2GYIA 2WYZA 4LBEA 2ITFA 3WNLA 3AU0A 5M1TA 2A74B 2EKJA 3BN9C 4UR9A 5HWJA 2YRZA 3ZPDA 2F9BT 3QO0B 4KJQD 5JIQA 1JPFB 3CBWA 2R2HB 5MEOB 4ZL1A 3O6ML 3CSYA 4XC1H 3Q4DA 3V9EA 3P0GB 4WI5A 3BVJA 3ATZA 4WJKB 3THML 5C70A 4QQUA 1WG3A 2QDGA 1YYLL 3NJHA 5I77A 1REIA 3V0UA 5KBNC 4AD1A 5D30A 4Z0BH 2HPTA 3WIFB 3MYJA 3MRLA 1U8LA 1HVXA 4OI8A 4Y9BA 2DWEA 1KF9B 1LILA 1FSKC 4OZGF 5EUOB 2YAHA 1QFPA 4ADUA 5C2GA 4N2KA 4GYPA 2EIJB 4P2OD 3X11B 1O5QA 5INCA 1FVCB 3GUGA 4S3GA 4UDTB 1A25A 1TTRA 2H6PB 1W1VA 1QFWL 2E4TA 2GJZB 1BVKB 5ISZE 2IH3B 2DQGL 5GQBA 2ICWB 1AW1A 3F5KA 4N0RA 1AKPA 3UTSA 4IPJA 4YTSA 1LO0L 5D6DC 3THMH 2BNJA 2ODHA 3T81A 4L8SB 5AC5A 1YYLH 3GS0A 4R84A 1TE6A 3G5YB 5KVEE 3WE1A 4N85A 3RRQA 3S36X 1HXKA 3A5FA 1HDMB 3NIGE 1TJRA 3PFQA 4OFCA 1MAJA 3IKCA 4Z77B 4LF3A 4BKTC 4KK8C 3PANA 1QFWH 2QMJA 3W11C 3GJFH 2DPKA 2OMTA 1XLCA 3WZ0E 3L1FA 2DQGH 4IJTA 3FTWA 1AIFB 4PJBB 1G6VK 5C55A 1LO0H 4WEVX 4DRSA 1EC9A 1G4MA 3BQUC 3LMJL 2OT1A 4L6HA 1UCBL 5L2JA 1VD6A 2GC7C 3VA8A 1XSKA 4XD6A 5J56B 3UY8A 4JM2C 4M5TA 4K71C 1E8WA 4X6DA 3X13A 2GJLA 4MAYA 2PWGA 1DN0B 4ZJ9A 3RX9A 3VDGA 2AAAA 4JANA 3QCTL 3C2VA 3TA3A 2W0KA 3RWGA 3VTAA 4KJWC 1SJHB 4GH7B 1YDYA 4D8AA 1YUHA 1H09A 3LMJH 4GBDA 4IJ3B 3KDMB 1UCBH 5DUPL 2PPAA 3ARFC 4K8HA 3C6CA 4HP5A 4CEXC 5EUKB 4PZVA 4TVCA 3CHFA 4A2FA 5IEKB 2YN5A 3O4LD 4HAFA 4PJXF 1M2VB 3DOPA 4ADGA 2DJUA 3TJHD 3QCTH 4Z7NF 3WLBB 4IIBA 1GVFA 4FTDA 4PWJA 2WBJB 1NFIA 3WLMA 4IX0A 4DK5A 1HHKB 2OL3H 4NFBA 3RGVB 5DUPH 3VXQB 1O95A 1M65A 1YLVA 4H0HB 1VCAA 2WWKT 3TH3T 3QORB 2DKMA 3THUA 4FF5A 4F7CB 5JH1A 2EXOA 1V6WA 1TJGL 1DOSA 5LZLA 5T1MB 2Y2YA 3VYPA 3UWWA 2JJUA 4EUPG 2P5WA 3MCOA 4V1DB 2V8MA 3C0QA 3UJSA 3TEWA 4GEJA 4OCYL 5DQPA 3NFNB 3TO4B 4KIEA 1AFVL 1PMYA 2Q5BA 4L3EE 4JFFB 3QQ1A 1WDPA 3Q45A 4PJDA 1TTJA 3R7MA 2AAVA 4ZE5A 1AZUA 1ACZA 2G5BB 3HNVH 4U10A 1QK2A 3CUIA 5E6ZA 3OHXC 4L23A 4MJJA 1TJGH 1DFBL 3WJLA 4K8RC 2HT4D 5B7MA 2Y6SC 4QO1B 3F01A 4Z18A 1K03A 5FYLE 4P07A 5HYSB 5GS2D 1AFVH 4N8CL 4YSPA 3R5EA 3KP0A 3QUMB 5GRVL 4BF7A 4R96B 3WHXA 5DZLA 4EJ1C 4FQLH 4QHNA 1V7AA 1Z66A 2PXYC 2W62A 3IPEA 5HYJD 2J6XA 1ZVHA 3TN0D 1DFBH 1W5MA 3CT2A 3S2JA 4Z7WE 2W61A 2REQB 4HOZA 1UT2A 3V35A 1S5IL 5AZEL 1TR7A 1AG0A 3BH8A 1N68A 4MJHA 3C6LD 5HI5C 4N8CH 3BZEB 4K94L 4OIFA 1FL6B 2JIWA 3MJ9A 4EI6A 2JGYA 3DPBA 3EB4A 3WQVA 3F5LA 4N24A 4NNPL 2AV7A 3VUAA 3HFFA 2IXVA 2CHZA 3UDWA 3L2LA 4MLJA 1T20A 3IDMA 1R5VA 4FI6A 4YTRA 2A4CA 4POZC 4XTRD 1S5IH 5AZEH 5F6HI 3OBKA 3MBDA 3W1TA 3GNML 4JMNA 3GMMB 3T6CA 5K33A 2D0HA 1NU5A 4LLMB 3KPRA 4K94H 1DWGM 3PQYA 3VABA 1K6QL 3RPBA 3ZE2E 4BK5C 3BE1L 2VDNB 3CDYA 2ZT9C 4HQQL 4NNPH 1W3KA 4BFOA 2PW1B 2AQVA 1FPTL 3ZUNC 3NXFA 1DEDA 3FQUB 4ELME 3M07A 1PY0A 3D25B 1K8IA 1XCQA 4JQ2A 1IZCA 1JJUA 1G7JB 2D9CA 3PZIA 4OZOA 3VSUA 4NUJA 4AIZA 2Y72A 3GNMH 3K6SA 1PE1A 3BYTA 5IB2B 2WNXA 2WAGA 1A3QA 1L9WA 4F91B 1PYWB 2QVTA 1MLCB 2EIMB 2W65B 4PJHE 4F33B 4L1TA 4LASH 4S3AA 5AVZB 4NF7A 4AG0A 1K6QH 3BE1H 1YG9A 4HQQH 5FC9A 1FPTH 3K7UA 1XLEA 3YPIA 1GOWA 1LE5A 3UO1L 4HISA 4W5ZA 4FO4A 2JCCF 4FSAA 5CINL 4PJCE 3FCGA 2B0SL 5FV2A 4TV5A 3P62A 4E2VA 4ACZB 3CV6A 5BCAA 1ZY9A 1QW8A 2Q86B 2Y1VA 4TUFA 2GOKA 1VFTA 1V7NH 4XP5L 3V6FB 4NG3A 3UZEA 3FT0A 4GKOA 5F1SA 3ISWA 1QWNA 1KGWA 3ETBJ 2V2TA 2ZCHL 5F7KC 4R3SB 2QSVA 1JR1A 3P4NB 1R85A 4RAHA 3B0UX 1I8IA 3W87A 1OEZW 4HKZA 1ZVSA 5CINH 2EINB 4X6FA 3GZPA 2B0SH 2QJDA 3MRJB 2R14A 5AN7A 3LDBB 4QDMA 4NQCA 3LTPA 1EA9C 2AC0A 1BD2A 5L2KB 1KCKA 2R8WA 3JV5A 3O6FD 3L68A 4HS6A 4XP5H 2QUTA 1HH9B 1HC1A 3UTOA 5JIWA 4KJYA 1IGJA 3AXKA 5EEYA 3URNA 3QQ3A 4PI2A 5EU4A 3U4EA 5B3JF 3SUWA 4LANA 3BO8B 3AY2A 4ZYKA 3GG1A 4ZO8A 4M8QB 2ZCHH 5IFJA 3CM4A 4LVBA 5BRBA 3GSOA 4AXNA 4JRYA 4AZUA 1F8MA 3CSGA 1X44A 1MRCL 2Z1SA 5E2JA 3EWBX 4GE8A 2K6YA 3FUNA 4L3FA 1X5LA 4DEWA 3N91A 2BVEA 1GGTA 3BH9A 1PDKA 2BVOB 4UNLA 1IXOA 5E4EB 5MF5A 2P48B 5F6HJ 3FS2A 5E8EA 1KO0A 5DJCA 2E9IA 4I3SL 3FOMB 1E8YA 1JWUA 3V2AR 2A0LC 4KWUA 1SJBA 3T65A 3JWNE 1F13A 1NEZA 1CFSB 1MRCH 2IFGA 4KXZH 4PRRA 2H3NB 5E93A 2P10A 3LH8A 5I23A 3FCBA 1FDLL 4OZIF 2WNGA 2YPIA 4PREA 1P7TA 3ITOA 4CN6A 4X0VA 1RUQL 4I3SH 2HJLA 3GLDA 5B8CB 2O56A 5KINA 5CP7A 4W9DC 1NANI 4PW9A 1CICD 3PWVA 4ONHB 4ZW5A 2ITCA 1SYVB 3DG7A 4TTUA 1ETZA 4GX9A 4INFA 4Z17A 4IK7A 1E8ZA 2PW2A 3UMNA 1NBCA 4B92A 1D8WA 3VI4A 4GPNA 1BREA 3TH4T 2R8SL 4YS1A 4XCNB 4AYGA 2VGBA 4OIAA 3IXAA 1KJ2L 1GW6A 1W9XA 1RUQH 4UFLA 2OELA 4YSCA 2X0VA 2CBTA 2VDLH 3GVWA 1GK8A 4HK3J 3F65A 1RMFL 3BPWA 1J8HA 3P9WB 2Y7OA 3EXRA 3WSQL 3DGRA 4G8GA 2C8NA 5KYWA 1CT8A 4XNXL 2DVXA 1I75A 4JN2A 2QQLL 2YEZB 2DGAA 4I5UA 4LOUC 1NFDB 1JPSL 3LLXA 2R8SH 2JF1A 5D72L 3NIFF 4TOYL 1I2QA 4APQB 4KCWA 1BBJA 1FG2B 3QJFA 2XFXA 4QRSA 2H4EA 3FQTB 5IUCA 1B2YA 2K0RA 1MQQA 5I15L 3DMMD 5L8KB 4ZBCA 4AENA 1F2JA 4OCSL 1RMFH 4PFMA 1KKRA 5HHXL 2Z25A 1GW1A 3WSQH 4L4VB 1UZ8B 4D0CA 3WTSA 1GZPB 2Y23A 4XNXH 1WBYA 1BYPA 2QQLH 4AX7A 5A6SA 3W1LA 4GGHA 1CLKA 4P2OA 4KEZA 3EWDA 5BQ7B 2XWJB 2RBLA 2BNQD 4FNLL 5EOTA 3NURA 3F7VA 4P8UA 4WTXA 5EIQA 1JPSH 5D72H 4TOYH 2ZUUA 5DMKB 3DYMA 1OWWA 3SQBB 4HPJA 5I6PA 4QXVA 4GKSA 1HUVA 3RUGA 3ZKMD 5I15H 5E9DE 4OCSH 1DQTA 2AQQA 2R2BB 5LBSL 4FFZA 3C56A 1RJZB 3HA1A 3CZLA 4ZFCA 3R18A 1T7LA 1I53A 1VPOL 3RZWA 4FG0A 4MG4A 3H3KA 3N18A 1NWUA 2NY4C 3RVXC 4FNLH 1UH3A 4KKBC 1RPKA 3STFA 1XFPA 3PFRA 2GVGA 4DYJA 3O8XB 1ODUA 3G0SA 4C59B 1W0WB 4WI9A 3NQ6A 3P2DA 4A8RA 2ZD0A 4MD4B 5F9OL 4ABQA 5LBSH 1OWRM 1H61A 4MMXA 2WZ0A 1FVEB 2N7BA 1OOAA 1R6WA 1MWAA 3WEBA 1XIHA 4JDYA 2O6FA 4QRBA 2VUOA 1AMXA 4RVBA 4QMEA 4DZ8A 4NKMB 4OZHF 4PRPD 2BSLA 4DLMA 4JW3A 4V11A 1GT8A 5T9BG 5FSEC 3FB8B 1OAZL 4HK0A 1HXMA 1LO5A 4UFJA 1TJMA 3S6OA 2WWMD 3HE6A 2AERT 1URIA 1W1A1 2ZNXA 3OKKB 1H8NA 5AYTA 5DJYB 5F9OH 1IEIA 3R7RA 3U2CA 5KVEL 3RZCC 4TRPL 1OP5K 1KPUA 1JZJA 3PFUA 4XBPA 5IJBC 4F57L 3NA9L 3V5CA 1K77A 5HNTA 5CZTA 3HG5A 3GSWB 5I24A 4KV5E 1ZTXE 1NCDL 2OLHA 5ESVB 2GSEA 3UXAA 3B37A 4YL2A 1ADQL 4QRPB 4R4FL 1R7AA 3PWLA 2ZOLA 1KGYE 3MJ8A 4YDIL 1OAZH 2IBGA 4Y2DB 3DI0A 2V2WB 5EU7E 4WO0A 4XIMA 1HO1A 3UAAA 5KVEH 2KL6A 4IU2B 2APTA 3UP6A 4DKFL 3AUWB 1W6WA 4JPSA 4AZ8B 4OR1A 1DVTA 1FL3B 2E56A 7REQA 5DHDA 5ERWA 1NCDH 1UWAA 1OK6A 1JFHA 1BXXA 2W5FA 4Y4KB 3W22A 2H9AB 5C07E 5B7FA 4Q6YA 2J3SA 3AY4C 1ADQH 1X5XA 1P5UA 2X88A 5FHAL 2OR9L 3QULA 3U48A 1I9JL 4J3OG 2XFRA 5DLML 1XH3B 3SDCD 4DKFH 4IXXA 2OPJA 4JCMA 3OPZH 4BA0A 5C9ZA 3WF1A 4P2CG 1WKFA 2EO9A 5EB9A 4IQEA 4X61A 1JCLA 3CIXA 5DWUL 1M1BA 2Z29A 5AB2A 4WWKD 4FXKB 3Q9PA 5FHAH 2OR9H 5AAWC 1QBAA 2C18A 1I9JH 5CPQA 4WJEA 1E6SM 3NGJA 5HI3C 3IMWA 3ZS4A 3FL7A 2HJKA 2X05A 5DLMH 4BS0A 4XO6A 2R51A 4EN3A 1OGPA 1S7SB 3IAGC 4ZA0A 4NL1A 1DVFD 4H3DA 2OMXB 4A55A 4PTUA 2VDRB 3TN0A 2DQUL 2CO7A 2DTML 5DWUH 3FT3B 4UIMA 3FS9A 1TWDA 4FNQA 2P44B 2H26A 1I7TA 1GRWA 3W39B 1NLDL 4WHCA 3C6LA 1U8HB 3VOGA 1F4AA 4HUVA 1U8QB 1TVPA 1BXUA 3ULUC 1X7TA 4M5SA 4NAMA 1Y07A 2E7DA 2R91A 3DETD 4ZTEA 3GB7B 3QFDB 3CHRA 2E25A 2DAVA 3MBED 2DSWA 1KLUB 3BLBA 2GQ8A 2DQUH 3NIYA 4W9CC 2DTMH 1T21A 1KN2L 3U1PA 4YN3A 2CHRA 3TBSB 2FHFA 4JYEA 3JWOL 5IIEB 3KCJA 5FYLL 3SN1A 3VH8A 1NLDH 3E5BA 1EWHA 4DYKA 2C3XA 1T83A 3HE7B 4NI3A 3QG7L 5FYKU 4PMZA 3CH1B 4HDIB 1LD9A 5AB9A 4JFUA 5GS3A 3EFDH 1NCIA 3NGBB 3S2NA 2Y8VA 3EAUA 1JPGA 3T71A 1MRDL 2I9LA 3JRKA 4NJIA 1KN2H 3QUKA 2UZYB 5FDWB 3ASNB 1M9SA 3LN5B 3N04A 2EEBA 3JWOH 2FIKA 3AG3B 1GW9A 5FYLH 2AKZA 4ZQTA 4YUEL 2Z0UA 3QDGE 1QG3A 2VFFA 1LDSA 2EH8L 3WL0A 1H0DB 3QG7H 1UUQA 3TWCL 2C9PA 5TF0A 1U1JA 4WK2B 2DM3A 4PTVA 2X4SB 4PD4K 4FTVA 4R4NC 3IGLA 1V6VA 1XRVA 3UNTA 4DO4A 2ESVB 2YPVL 1MRDH 4L4TB 1YMHA 4MNQE 4XMLL 3HQPA 3TBWA 1XXDC 2ZNWA 4LLQB 2F58L 5LBGA 5KETA 2FJFB 1B4KA 3B06A 1MUMA 3EOBB 4YUEH 4I6KA 2FVMA 2XFWA 5I3HA 1F8TL 3ZBMA 2EH8H 4BHUI 5EZJA 4JFOB 3TWCH 5C8JB 4HIXL 1SUJA 1IC4L 4LB8A 3EGJA 3U1SL 4AVFA 4NZDA 1RVGA 3E2HC 4HCDA 4E2OA 2YPVH 4ALDA 1W1YA 4G6AD 4XMLH 3QCUL 3H1ZA 3TVMA 1KFBA 3GMQA 3W0WB 2LU7A 1XZWA 1D5ZA 1VA9A 2XKNB 3GFYA 2HTKC 3ARDB 4BIKA 4FP8H 4WO4C 1T2QL 5F7NC 1F8TH 2OI9B 1REQB 3C6EA 4G7FA 4EI5C 3TZNA 4PTDA 1U4EA 4HIXH 2HXAA 3H4GA 5L6YH 2O5XL 4LT7A 2JSFA 3U1SH 5EBGA 2IADB 3DPDA 1FO0L 2HJFB 2UVFA 3K2UL 4Z7WF 2J5LB 3MOAL 1RQEA 3SN6N 3G5XA 1GZQB 1LL1A 3TYFA 3KWVA 1MO0A 3QCUH 1AJZA 4GOSA 4ALAL 2Y2WA 5FK9A 2CNZA 3QQ0A 4XZUA 3LNIA 1X5HA 3WMCA 1A6WL 3MO1B 4IIGA 4MWFB 4KKQA 1VIZA 3K80A 1I7UA 4HG4K 4F7KA 5A8PA 1T2QH 1BX2B 3T1WA 3SKMA 2PCXA 3MODL 3R8HA 3RU6A 2O5XH 4JHVA 3MJMA 1FO0H 1NM4A 2R4RL 4CW1B 3K2UH 5I76B 3MOAH 3RNQB 2UZXA 2OQJA 4RA0C 3E6HB 4MASA 1WAPA 1LWRA 3IPFA 4ALAH 3CV2A 3AM8A 2ZVIA 2Y0SA 5FO9A 4RNIA 1A6WH 4HZ8A 1TMQA 1UUNA 2YZ8A 1EEYB 4P46D 4Y19D 3ZE2F 1S5NA 4DN4L 3BSGA 2R9HD 1JTOA 3MODH 2Y07L 3KW7A 5E2TL 3FN9A 4ELMF 4MHHG 1NBVH 1TMHA 3OAZK 4MDJB 1CICA 1J0HA 3T2LA 1GGCL 2R4RH 1V10A 3MV8E 1R7OA 4H26B 2BIQA 4X4YA 3VWJD 1H5BB 3C60C 5KBPA 2E9GA 5FM5M 5BXFB 3MDUA 2WLNA 2VDHA 2ZWYA 1CYGA 3I9IA 3TSMA 4M4PA 5BOJA 3VXMD 4PJHF 1AO7B 3IARA 4DN4H 2GTZB 1IV8A 1T96A 2RQEA 2Y07H 5E2TH 3P02A 3O1NA 4LHJB 1NA8A 3HRPA 1THCA 2DMBA 4PJCF 1QZNA 1RL1A 4CGTA 1GGCH 5C9RA 3STLA 5J13C 2R1XB 3SCSA 2FPYA 1GPOL 4C47A 4AYDC 1WFJA 1QRQA 1EVUA 3URQA 2XACC 4NKOB 5CEZD 3MMUA 5DFWH 1NGWA 4GO6B 3PL6C 4N02A 4KZCA 4QIRA 4U1MB 4MJIE 3WY4A 4OW6A 1Q94A 4GP4B 3SGJC 3BVUA 2NXHA 4RGNC 3BDXA 5MEQA 2F7QA 1BVNP 2VW7A 5U4NA 2XV2A 5BO0D 1Z5LB 3JWNH 4LS2A 2RTTA 1GOOA 1WGVA 1KYUA 1TTUA 1TXKA 1HWWA 2XIDA 1HGYA 2PD5A 3HC2A 4RQQB 4P4RA 3FJTA 3ES6B 5DCCA 4YLQT 2MANA 3VXGA 2OCZA 1SJVA 4M62L 3UPWA 2BNUB 1DUYB 3CFKB 4IEFA 1JP5A 3A24A 1PLGL 3ZR6A 3FSZA 4DH2A 1KD0A 5HVGB 2CXEA 3SE8L 3CFBA 4WEEA 4X0KA 1OSZB 2MTAA 3HPJB 2O55A 3TUUA 4S3BA 4ELDA 3TIMA 5MHSE 2QFRA 4EO5A 5TDOB 1J5TA 4GRLD 1KRBC 3FJLA 4WI7A 2YUZA 4PTXA 4J4KA 4H6QA 1DV7A 4Z1AA 4B50A 4QJ1A 4RDQG 1FZMA 2RALA 5E1HB 4NC1E 1PLGH 1NCOA 4LKCB 4Y5YB 4YFLI 2G5RA 3MU7A 5DUML 5IK3A 3VIIA 1S39A 3SE8H 4S23A 1XCTA 2DWYA 5HPOA 4UB0L 3EXTA 3WFHA 3HZKB 3GH7A 1OP9A 4JDTL 2WW8A 3ESUF 4GXFA 3NFPA 3L3IA 2AJZB 1J93A 1IBBA 1ZHLA 4Z0XB 1H1NA 4CNNA 2J57A 4WI0B 1L5GB 3EOTL 4ES4A 2AABL 3M0VA 1X5AA 5DWPA 1GOGA 1SXBA 3EYOB 4Y16B 1PKQE 4CNTA 3R0DA 2VR7A 4FC3E 5DUMH 2XPKA 3JV0A 4OLYL 3ZRSA 2Z28A 1Q6DA 3SQOL 4KGJA 3WHE1 2NYKA 3FTGB 1H11A 3CZFA 2GITB 1W72L 3QEUA 4JDTH 4TQEL 1XSOA 3AWOA 5EORL 1EO8L 4NSKB 3GBEA 5D09A 2O4QA 4U1KA 5I8CB 2IH9A 4Z7VE 1K3UA 3EOTH 1CIUA 2AABH 4IGMA 3C75A 1AZRA 2C3ZA 1UT9A 3II3A 3DX5A 1JNNL 5C0CD 3UTQB 4PB4A 4X8XA 4OLYH 4QS5A 1MREL 3VI3E 4XZLX 1ODAA 3SQOH 5D2NB 3VNDA 5D8ZA 3E1F1 4AH7A 1W72H 1UTDA 4AWUA 4TQEH 3B7RL 3VG0L 5EORH 1EO8H 3S2CA 3G6LA 3BAEL 5DMLA 1MIEH 3II1A 2X4PB 3B8VA 5GSRB 4ZSOA 1QNVA 4FFWC 3RXZA 2BNRA 3W9ZA 4FR1A 4CD6A 4HU4A 2QVIA 4F8LA 2OEKA 4DP1X 5HGHB 5HR7A 2VN5A 1MREH 1C93A 5EOQL 1P69B 2XTKA 1UXSA 2A9NL 5J12B 1KM2A 5HHME 1JK8B 3N11A 1BM3L 4GYBA 5CJ5A 1UPMB 3VG0H 5DJDB 5BZAA 3KBHE 4R9HA 1OD0A 3BAEH 5FECA 5EPDA 4F9PC 4DKDC 1D9KB 2EDMA 3O45B 4XWGL 4WWKA 3NCBB 1IWBA 3PGFL 5AOZA 2Y7GA 3MHGA 1EJ6A 1ZAHA 4IIQC 3IVTA 2HRPL 3OKDB 4Z7QF 1LO3L 4HJGA 5J0BA 3B9NA 1WKDA 1YEDB 4CAGA 1HHJA 4LU0A 2VLKE 3N1AA 1EF3A 1JJKA 2W4XA 3Q3GA 5EOQH 2A9NH 4KXZI 2X2YA 4F2ME 2WVVB 2EUZA 1BM3H 2QGHA 3NOYA 1DVFA 2JH2A 4X6CE 1JWSA 5K7JA 2VLMD 2E7CA 2QNEA 1LP6A 3LEYL 5KYXA 1KB5L 1JZ4A 3GEWB 4OB5L 5JH2A 1NVMA 4WX2A 1MNUL 1F11B 2G0KA 5HYQB 4GVIA 4L3CA 4R9XA 3UESA 3MCKB 3VDAA 2HRPH 5IHZA 1LO3H 1YA5A 5TPWL 5HMSA 2X28A 3DX1A 4JRXA 3QLDA 2F6AA 1VJSA 1ZD6A 4FL4C 2VDIA 3AUVA 1B9BA 4YBQD 3MBEA 1LP9A 3LEYH 1KB5H 4MNGE 1W0VA 4OB5H 2D8KA 5DSCB 2J13A 1MNUH 3ARED 4FQXC 4N8VG 5D37A 1SRDA 1CLYL 4IBVA 4WU5B 3VFCA 3TO2B 4HUNB 5TPWH 2FDMA 4B3EA 3T44A 1NPUA 5CMAA 3KVJA 3LZ5A 3MBWB 1TRIA 3BP6B 4F9JA 3NZ8A 3SADA 3ZXAC 1WBZA 1OW0A 5XINA 3TT1L 1BEXA 1LROA 3TTQA 1DBKL 3VCLA 1X7SA 1H19A 3MX0A 4EIVA 4LW7A 1FJ1A 1GS6X 1QQDB 3U7AA 4DSYA 4B9JA 4D8OA 4M1CC 3QR1A 3WIJA 3LQAL 3B2PA 4MWAB 3MZNA 3GUTB 3NJJA 2AW2A 1HQTA 1MVFA 5D2TA 1CLYH 5JQ9A 5J4MA 1KW1A 4FZEH 2JF6A 1O5PA 3GVGA 4X9BA 2N56A 2XBDA 2WQRA 2FJGA 3GVVA 5I73B 3WUZA 1HH6B 3QI9B 4QX4A 1QLEL 3AFBA 3AWGA 2Z1KA 5DD1H 5I07A 4KTEL 2VDQL 2D24A 4PJ9B 1DBKH 1XYMA 1CDIA 3DI1A 2ATKA 1QKZH 4ES9A 3FU8A 2V68A 2ZX6A 2Y25A 3LQAH 4MFHA 3RYMA 5HR6A 4YE4L 1KIQA 4OHQA 2QEJA 4XO3A 3DVGA 3K8MA 5F7AA 2DZPA 2Z6FA 5AW6B 2X4QB 3GWJA 4R26L 1GOQA 3NQEA 1NAML 3RPDA 4LT9A 1A6TB 3DFPA 2QVMA 3TTSA 2HJPA 3AHVA 5J5DA 5CSRA 1PNCA 3IJYB 5DC2A 3ALXA 3JT0A 1Z48A 1QLEH 2DMCA 4DBUA 4Y89A 3PWPB 4XVSL 3SE9L 3T0ED 3EJYC 4KTEH 4E3TA 5FL1A 5BRZA 2VDQH 4B0MM 5EULV 2GBUA 4MSWA 3TNMA 1CNVA 4AZCA 4LCWB 1N8ZB 3PHOB 4S2BA 4YE4H 5B39B 3ARGD 2UYLA 4A8NA 2J7DA 1NAMH 1KGCD 3EBAA 1VFLA 4HZMA 4AL8L 4HXAL 4MXWL 3UBGA 1JI1A 4JFDE 1IT8A 3EFFB 3X1EA 5C0FB 1YNLL 2A7BA 4XVSH 3SE9H 4H40A 2AZAA 3MANA 1SN2A 5T1LB 1P0DA 3I9GL 2RCSL 1ZCOA 3U46A 3VCRA 3MI6A 4K94C 1NUGA 1BQHB 3TLLA 2GBAA 5E8OA 4L2LA 1KQZA 1FVDB 4CILA 4O5LH 4U1LA 4GRWB 3MPGA 1S4IA 1HOCB 4AL8H 4HXAH 4HWUA 1H15B 2UWFA 4PRBA 1O9ZA 1EHXA 5BW7A 1FIEA 1T89A 1NIBA 1YNLH 1Q9OA 1R0MA 1TSHA 4I9JA 1EA0A 4A67A 3LHYA 5CGTA 5E5CA 3I9GH 2RCSH 2JQXA 4QCEA 1Y6NR 1AR1B 2PR9A 2X12A 4C6OA 4BINA 3G1AA 4YHLL 2VUNA 5KS9B 4LY8A 2M8XA 4JO4L 3OB0H 4P46A 2ZRVA 3OXSA 4Y19A 4IYKA 4KZEL 2X40A 1JI2A 3NZQA 4YFDB 4Z3FA 3VSQA 3NO5A 1Q3NA 4LCYB 2GT9B 4JJ5A 1B30A 2PB1A 1YTKA 3BANA 3SZKC 3HG2A 4GAJL 5IHSA 4ZMYA 4V1YA 5LNRA 2LU5A 3R4RA 3WUWA 3W37A 3VWJA 2BP5M 2YXGA 4PJEE 3FFOA 1FWNA 3M7SA 4PTMA 4TVUA 1MKFA 4ZUUA 3V1PA 1G69A 4PMRA 4YHLH 3L5HA 4Z5RA 4JO4H 1OFDA 2JJVA 3X3GL 4KZEH 2P53A 1ISZA 3VFLA 4JN6A 4I1NB 4KRPB 4W4OC 5D8JH 1FFNB 2P80A 4QROA 4YWGL 1BAWA 4GAJH 5C54A 4XMVA 1KYOK 2DEXX 2WLLA 2PDYA 1MUWA 5FKPA 3T4YA 1TV2A 5HPCA 1DL7L 5E09A 1E5YA 4O2CB 5IB4B 4FQQB 4HUUB 3K4DA 4KMQA 2CWRA 3HZMB 2AJXL 2X9WA 3GR8A 4WGXA 5CBIA 3X3GH 4NP4L 3WF2A 1CLCA 4DP9X 5F9WB 3D0VB 3ALFA 3R43A 1PQZA 4PY7A 3QXAB 4YWGH 4PL1A 2XWBB 1JZ3A 1POJA 3M44A 3MO4A 5J6GB 3O6MH 2XH7A 3KPTA 3O3RA 1IBDA 2CPCA 1ZIAA 5IMMA 2Z1VA 3KCPA 2NSOA 1TT6A 4ORGB 2DLGA 1G4PA 2CR0A 1NCGA 3ZKXB 3EBVA 3TCEA 4ZXLA 2AJXH 5DJ8A 1XX9C 3U2ZA 3KHOA 4NP4H 5HATA 2HT2D 2A5UA 1FGVL 2E1WA 5AYBA 1KGUA 4MDIB 1RXOB 5D9OA 2Z7ZA 2NV1A 3EEGA 3UPCA 4LSUL 5BZDB 3O41A 4GG8B 4QCIA 3CIVA 5C08E 4LF1A 3OJMB 3ZIZA 2HUHA 3APDA 3WLWC 1PX3A 4GRLA 4LGSB 2E3VA 5DO2C 4HF5L 2FTAA 3QZNA 5GJPA 3JTTA 3RPTA 2XVBA 1TCMA 1FYTD 5JYLA 3M5VA 1YEHL 1FGVH 4XO8A 5I6LA 2W07B 2UXGA 4LSUH 3CDGB 2CETA 1RZKL 2MQCA 1QOKA 2HB0A 1ZT7B 5JMOC 3IRZA 2ZC1A 1PPIA 2RQ8A 4FB7A 2DJXA 3VXNB 2WSKA 4YHNA 3CUZA 4IBTA 4HF5H 4PCNA 2RB8A 4UT6L 4HJ0D 4XN5A 3VWKB 1H60A 1V4YA 3P77B 3K4ZA 2PR4L 3KGTA 1YEHH 2VNCA 5C0IB 3DFTA 1RLCL 2XWTB 3VIKA 2BDQA 1GWJA 2EECA 4ONGL 5IJKC 5DZVA 1IXQA 4DETA 2ZUMA 4C1KA 4GZJA 1RZKH 5EDXA 2R24A 1Q9WA 3XISA 4P2RB 5I1LA 4CDHA 3CQFA 1E65A 3BPCA 3CK5A 3CFQA 4G9PA 2HG0A 4JFYA 4UT6H 3NDYE 1HCFX 5HGDA 3WEOA 5C0CA 3SN0A 3VKCA 2PR4H 4HOMA 1BFNA 1LUCA 1QMUA 4BQ6A 4Z7AA 4PWFA 4TQHA 2NUWA 4ZB2A 2VC6A 3G6JE 5ABGA 1Y5WA 3KJ6L 4ONGH 1U30A 3EYSL 3EO0B 1JPHA 1F6AB 1OK0A 1RK1B 2N01B 2EDYA 3RWFA 3QZ6A 3DUHA 3QQ4B 2YRBA 4R90L 5D5MA 1ZT4A 5EFIB 3T8XB 1E9IA 4ZEPA 1M04A 4YLBA 3PUOA 4A3RA 2NVAA 5DK2A 3QEQB 3K2GA 1ZS8A 2VMCA 2WK2A 4AZHA 1C16A 3H54A 1RJYB 3FC8A 4F24A 3VFTA 2G95A 3EYSH 4U6XB 1USZA 3EYUL 3MTWA 2ZXDA 4Q6KA 3BTNA 4F3FA 3EMQA 1TNMA 4OCYH 4R90H 4NZUL 3I3DA 3URAA 4BH7A 1RIUL 3K2MC 1KN4L 4GACA 1BQCA 2VITB 1ZT1B 5EEVA 2A6JA 2XTLA 5D7LB 3EJRA 2BIHA 3GB6A 3VQ2C 3LKSB 2NLJA 2YC1A 1IEXA 4GI4A 3GDCA 2VSKB 4GSQA 2ALRA 4WDIB 3MRMA 1U92A 3EYUH 4MGGA 4HIHA 4OCRL 1O94A 2PURA 1S7VB 1TIUA 2FZBA 3VXSA 3U2SB 5CSZA 2BBFA 5IFAL 1RIUH 1ANUA 5JBFA 3OODA 4NT6A 1YYML 4N6RB 3TWYA 4WJ5A 4PGZA 1MNNA 1UASA 2OULB 5D4QA 4JPQA 4K3HA 5CCJA 1KA9F 4OCWL 1IQ8A 4XG1A 4G9DA 3CQKA 3G8RA 4Q8TA 5KSUB 2EDBA 4XMTA 2HAZA 3GS6A 2LAGB 1LLZA 1MIML 4OCRH 4NY2A 1SN5A 5DMJB 1RBOB 1K8ZA 1JQVA 1EAQA 2VC2L 3AQDA 4JDBA 2ED6A 5IFAH 2I1OA 1HP4A 4WR3A 5C0JB 4AGPA 1WT5A 1OGAB 4AYID 1JPDX 2GK2A 3MRHB 3QS3A 4XAFA 1NCWL 2GUBA 2WVSA 5F88A 1R24B 3QJSB 5GRJL 4WUUD 1OT4A 2DW6A 2H3KA 1PTDA 4BQ5A 3KS0J 4BD4A 4UYPA 3SPJA 3R1GL 1WTGT 4AUUA 5DLCA 4JG1L 4U6TA 1ZUAX 1INQA 3RGBA 3FOLB 2OLSA 2A6IA 5KOMC 5BUPA 3GPEA 1XISA 2WMIA 4HZ7A 2VC2H 4NO0D 4Z7VF 2ID5A 3P6LA 1J6OA 3POCA 1T7XA 3G0XA 4NO5A 1W32A 4G83A 1EFZA 5CFAA 2R69A 3NEOA 5H91A 4TXVB 1X9QA 1NCWH 3OAUL 4YDZA 5GRJH 4XBSA 3PWJA 2TRYA 4WAFA 2DT3A 3VI3F 5AVTB 3WN5A 3R1GH 3H24A 2AMUA 4JG1H 5JXQA 1TFPA 2GJ6A 3UR8A 4PWHA 3LG3A 2TYSA 3BMWA 2NW3B 3PXHA 1GC1L 3M17B 2DKUA 2Q8AL 2A21A 5CC7A 2PDHA 3K30A 3CC5A 1TQCC 1P7KA 3BEWA 4RAVA 2X7VA 2F53B 3FCTA 3OAUH 3WU1A 5FFLA 1H6UA 4RZBA 1Z5YD 3NYDA 4PU2A 3PNUA 3UO1H 3H6OA 2PTYA 3XIMA 3F6IA 1FA4A 1P1MA 2PPCA 3BWUF 2I26N 4GBXB 1XF2A 4PGEB 2VOMA 1GC1H 4B96A 5EDSA 2Q8AH 4PRNA 2VFIA 4H00A 3N85L 1XF0A 4W86A 4N2BA 4O02L 2PKDA 4X6EB 1QPQA 3EADA 2WZIA 1PZBA 4KRMB 4KWWA 5I1GL 4G6JL 2GK1B 5EIIG 1IILE 1A3LL 1SGJA 4GAFB 3MGOB 2GTWB 3JZEA 3KEDA 4X6CF 4C4KT 3RWHA 5FO8A 1CTNA 5ICXA 4X2UA 3MRPA 3N85H 5DLLA 2MNRA 4O02H 3IT8D 1II4E 5RUBA 5LGJA 1E1EA 2XJ7A 4XNQB 2UZPA 3VB8A 3WO8A 3NFSL 4G6JH 4M8UA 3DFQA 2VDKB 4I5RA 4S1RL 3BI9X 1CX9A 1A3LH 5BQDA 1DLFL 3LXCA 3FZUC 4IOIB 2FNBA 4HBQA 3FGCA 1UB5B 3U9UA 4EZKA 4LC8A 3PGDB 2O61B 3AAZB 3JWOC 3P82A 5FB8A 5AAMC 2XZQL 1P4LB 4JIHA 5EB8A 3GMLA 3MXVL 4D9QD 3BP5A 2SEBA 3NFSH 4XZNX 3EYPA 1S9WA 1SMDA 1FWHC 5E08L 4S1RH 5ICZB 2EGZA 2B16A 1IEVA 5D7IB 2QVFB 5KEZA 1DLFH 4GQZA 1PDYA 4V27A 2L8AA 2CCRA 1AZZC 1JOIA 4NQQA 3H26A 1YO4A 4TVPD 3C6SA 2JF7A 3UWEA 4M9OA 2FX7L 1GVIA 1FDLH 4K36A 4J3OH 4UC5A 1IKNC 5EBAA 1EJUC 1E9OB 1K9DA 1CE6A 3W81A 4NJGA 3IGHX 4LK4A 4LLYB 4F2UA 2F6XA 2RJHA 1F3EA 1Z9SB 1HTIA 5KTEL 1KQYA 4NN7C 2DRUA 1Y18B 5E08H 3ABRA 2VABA 5EN3A 3QWQB 4F27A 2XG4B 4JPWL 2WC7A 1FAIL 4QLKA 5CZJA 4XNMA 1ES0A 3OMAB 2FX7H 3CDFA 4BSJA 1LDPL 3TYDA 2VVSA 2MRYA 3OZYA 5D6CA 1KTNA 4O0ZA 2WLMA 3MHFA 4V1XA 2MPVA 4HTBA 2DM2A 1KJ2H 1KBWA 7PTDA 1UBSA 3HG4A 4G80B 3AGVA 4OFDA 4M56A 2WGXA 2V67A 3TFKD 5D7SL 3D09A 1TITA 5KTEH 2B1HL 1TCRA 2AXJA 5KZ6A 2B7QA 3CNKA 1UWSA 1ICTA 1RSFA 3CU1A 4JPWH 5KSAB 1YVLA 2XCMC 1FAIH 3JQOB 3ROLB 5DVMA 1NBYB 4J3OF 4LL9A 1VGAA 3NYZA 5A40E 1XGDA 3QUZC 2NZLA 1WSST 1LDPH 4DNHA 4WW2B 3W6LA 4BKLA 2YA1A 1S7QA 1J87A 4UUIA 4YYCA 2P5PA 4JFXB 1UMLA 3G77A 4PMJA 3ATFA 5K59E 5D7SH 2B1HH 1YNTA 1Q13A 4R34A 3OMIB 4IRSB 1E3XA 3EDDA 5HHXH 1KFWA 1SVDA 1CFVL 3IDGB 3T8MA 3SCMB 4N90D 4L1BA 5JHDE 3MKCA 3F7RA 3UD6A 4XPFL 4ALAC 4LC6A 3DX7B 2AK4B 4PVLA 4GJIA 1EOMA 1CENA 2VLRB 5HHPB 3R0MA 1TPXC 1CDJA 3CHXA 2GAZA 1UUSA 5CJNA 4FLOA 2HT3D 4O1FA 3GPSA 3EZ4A 5L6UA 4G1KA 1J88A 3QUXB 1FYTA 3IDJA 1I2PA 1K4CB 1CFVH 4TUKL 1VPOH 3D6NA 2QADB 4JD4A 5IBLD 4F5CE 3OW1A 4LUSB 3AABA 4ZAKB 3QJXA 4XPFH 5DO8A 5ES4B 1CZ1A 3NSMA 2AXFA 4QHMA 5I6XB 1L6XA 1RPXA 4K68A 2FECI 4URKA 3E0VA 2FDBP 3WS3A 4A6GA 3SGDH 4XISA 1DWIM 2X1RA 4FDWA 2WLIA 3E7JA 3FQXB 3NPXA 4AQAA 3T77B 5DZOA 4KQ4L 4TUKH 4R7XA 1BOGB 2DD8L 2H47C 1S9VB 1Z1WA 3VFSA 1P2CA 5LGKA 3O4LA 4RA3A 1IJ9A 4E68A 4PJEF 3UZQA 1U9KA 3AYTA 4KX9A 3LZFL 5JPNA 1YE6A 3PAUA 3OKNB 4QG6A 1HAWA 2VR6A 2Z7WA 4DAIA 3NIDE 1TSRA 4M4RA 5JOFA 4TRPH 1D5MA 1V08A 1G0CA 1OZQA 1N10A 4F57H 1QPXA 1XGPB 3JWNC 4KQ4H 3NA9H 2HX7A 3WV0A 4LAOA 2DW7A 2DD8H 5HDOA 5HUPA 2WZ6A 2FGZA 1DE5A 1OGSA 4XCYA 4NQVA 4EEEA 4R4FH 2P9RA 3LZFH 2VXQL 2F18A 4YDIH 3EB3A 1XMWA 2M83A 3LGDA 2F54E 5TDNB 4F8NA 4CKQA 5C6MA 2QZQA 1RUSA 1BIHA 3RO8A 5ABDE 4XO4A 3N2JA 1XZ0A 2OYMA 3QNYA 3WDQA 2R1WA 2NVCA 5DXXA 2R2EB 2FB2A 4CA4A 2GGGA 3SKOA 3PG8A 5T1KB 2P7TB 2R1PA 1UD3A 1ACCA 4EP8C 3U6RB 4W9KC 3L4CA 4YHYB 2VXQH 2YYUA 3DXAB 2OZ4L 5KZMA 3WQ8A 4AKOA 1KCWA 2XV0A 3WLQA 5G5DB 4NQXB 1UHVA 3NIGF 3N4EA 3TK7A 4NRYB 2VISA 2VLLB 2EG8A 5K3VA 5IG7B 2KQNA 4HPHA 3NJLA 4ZMWA 1SGKA 2FDSA 1IIKA 2FZNA 3A0OA 3W7IA 4Q4PA 4Y9AA 2YXVA 5HYJA 5BJTB 2IDCA 3UG4A 5BS0D 3G3DA 3GMRA 2IXQB 2FB3A 2DMGA 4U1JA 4CMHB 2QVHA 4PMVA 4L9YA 3Q44A 2OZ4H 3IVUA 4YDLB 1ZCCA 3ITYA 4OU3A 3MGTB 3FRPA 4N0CC 3R19A 4XHJD 4OQTL 1OLZA 5JOEA 3BW9A 4D9LL 1ONRA 3CIAA 4JTAA 2WQUA 2FH6A 4NQSB 2XXFA 2WN3A 3R1ZA 3EOOA 3WG6A 3GI9L 3AFLA 4F4RA 1JS4A 4ETQB 1DDHB 5L4MA 3QIBD 4W9EC 1MFUA 2WKOA 4KTGA 5IQNA 2PYED 3AMLA 1DQVA 3TIEA 3PPCA 4JIPA 3L0GA 1A49A 4BSVA 3GI9H 4GLEA 3V0TA 4IWWA 3E0WA 1G1YA 4TV3A 3QIUD 5EF0A 3WBXA 1KFEA 3WNNA 5CBEB 3VXRD 4H6EA 4NENB 3KVDD 2ILLA 1BECA 2Y5TB 2EDLA 3RVTC 1EO7A 3ROOA 4A3YA 4DP2X 5GS1A 1OT1A 1MG3C 1T66C 4WGWB 1TZ8A 2CJTA 2VZ1A 3D12B 3G6JF 4Q8WA 3RY6C 4NRXB 3BUYA 4QGYA 1YPZB 5EUOE 3SE6A 2OJEA 3H4WA 5LKYA 4JFEB 3FQWA 3RHWF 1FAKT 3M1OA 1UZ6E 3LBOA 1QXLA 3QXVA 1F3JA 1GHRA 3ARBC 3O3EA 3B4NA 4CVXA 3D05A 1AZVA 3DURA 4Q9CA 2Z1PA 4DW2L 2Q6ZA 3CSYB 3MKVA 3BSZA 2HXTA 4HJWA 1YMME 4Z7OB 5CILL 3V18A 3DI2B 4G7EB 1QFWI 4NX5A 5DJAA 2AQ1A 4AEIL 2I9EA 3E0LA 3EJPA 5FJUA 3DESA 4JFQB 3MYJB 3MRLB 1U8LB 3S8HA 3O6FA 5D1QE 4JTJA 3TPKA 4Y4FD 5DD5L 2F58H 4J3VA 4LV4A 4MZRA 2VKWA 2WTPA 3DFHA 4W9GC 2YGOA 2YIHA 3KOYA 3ABKB 5EU7C 2J43A 1JN6A 1EJTC 3AYSA 2HX9A 4DW2H 2W92A 4AEHL 1IJNA 1DVYA 5T3XD 3FUFA 4HNUA 4TU1A 1FXQA 1IC4H 2NZ9D 1U93A 2XX1A 3N9RA 3TFCA 4Y9GA 1B0WA 2G60L 3LLFA 1YUKB 3VXOB 4AEIH 3HMWL 3SKUD 2XH2A 1J9RA 3ZTEA 4RSVA 3FFDA 2IAMB 5DD5H 1E2ZA 1O0VA 3NQIA 1ENUA 4GW1A 2CBOA 3IKCB 2CCWA 4P48A 2EKSB 3MRDB 2J8OA 1UCWA 3PR2A 3UBXG 1GQJA 5E5UB 2OMTB 5IJDC 3SO5A 4RDQF 4M6QA 1P4BL 1MDAA 2H0PA 1R3VA 3M9YA 4BF9A 2G60H 2F8VA 3LS5L 5I78A 3HMWH 4FCAA 5L2JB 1EX5A 2I5YL 4LOVA 3LHVA 3DKLA 3UJ2A 1AW2A 5FF7A 4LVOC 3UPMA 3PPEA 1L9NA 3X13B 3QJQB 4P23D 4ROPA 1A21A 2PDJA 1H4PA 1EPXA 5BMFL 3KPSD 1K6WA 3N6HA 4JANB 2XPYA 3DVNB 1TA3B 5EBWA 3RWGB 4ZMAT 1P4BH 1HSBB 5FYJU 3LS5H 1WF5A 1YUHB 1B4RA 4HJIA 2UWEA 2OMYA 5I28A 3WNJA 4GO9A 4FQCL 2LU4A 3LQAC 4GJJA 2I5YH 2X4TB 4LSQL 1YJDL 1CI5A 4IRJC 3D39E 4V1DE 4Z2LA 3MRIA 4GH1A 2CA4A 3W76A 5BMFH 3VILA 4JR9L 4D1JA 2DVTA 4JIEA 2IAAC 5IR1A 5IJVA 1L3NA 4JTDA 3BRFA 2RKXA 1SO5A 3ZFHA 5CSGA 1NFIB 4YL4A 1BZ8A 2J66A 5TTRA 4ZMQA 4I1RA 4O17A 2W9DL 5KSBA 4FQCH 2IWGA 1L9QA 4LSQH 1YJDH 3WGUB 1DE4A 4WLCA 4XN8A 1E43A 5J9PA 1H3GA 3I75A 1N3NA 1T7WA 2XKSA 1QRKA 3IFNL 4JR9H 3DMMA 6TIMA 3NG3A 3NPZB 3SDAC 3LKOA 4YPGA 4Z1CA 3KGSA 3ULVD 4E4UA 3ZMRA 4KK9D 3AVEA 2VJXA 3BAXA 3ULSA 5I71B 5DDHA 2EE6A 3TW7A 4NNXB 3WD2A 2NRDA 4PJDB 1BFSA 1BKHA 3BAIA 4ODTL 1Q6CA 2W9DH 3O0FA 1GPOH 4H8QA 2BNQA 5KZCD 2WOQA 4YBLB 2GI0A 5D1XE 1VZWA 1FWCC 4KJPD 2D7NA 4UFKA 5FI8A 3BKCL 3P93A 2DI8A 4WSKA 3DOHA 4H9XA 4AL8C 2EYSB 4XPHL 4TNWF 4Y4HC 3EDEA 3H42L 3MRNA 4AKPA 2ZOKA 1XYAA 3BPLB 5CJ8A 2YL9A 1IEAB 2EACA 4QYAA 2OMWA 4ODTH 5EC1A 4LVHB 3K1KC 1ZHKA 4Z1DA 1SMOA 4QHNB 4ZI8A 3AT0A 4AVKA 1BWLA 2NXGA 2ETWA 4M62H 4PGCA 3EDFA 3T6WA 3BKCH 3LIZL 4GAYA 4XPHH 2ADJA 3H42H 3W9DA 4QE1A 2L04A 3AADB 5DMGD 4K3DL 4HALA 1I7ZB 2BHYA 4NAFA 3F7JA 4EI6B 3DPBB 4FJYA 2MKWA 5JPMA 2AV7B 3WO4B 1G9HA 1E50A 2CG9X 4PRPA 4AGMA 2VDOB 4EAEA 5H8MA 2V3DA 1T20B 3IDMB 4YO0A 1R5VB 1OOWA 5FKAA 1SF3A 4JX0A 1E0UA 4KKCD 1WCBA 1CK0L 2NY3D 2YBUA 3N2MA 4D71A 3AXLB 3MV7E 4UB0H 1D5XB 4K3DH 3WS6C 3CEPA 1HCVA 1YNYA 3KPRB 1RZ8A 2QCLA 3PQYB 4WK0B 3MJWA 4G6CA 1A50A 3WDJA 4DM1A 3SDDC 2OWCA 5EBUA 2IDFA 4QXTA 4B97A 1GYLA 4WOQA 1XCQB 4GP5B 4MD5A 4PS4L 3GDRA 2WV3A 4JQIA 1CK0H 4KRTA 1ET7A 4NUJB 5DHVA 4AIZB 4KI5D 4Z3IA 3K6SB 4C65A 3DDFA 1CJYA 4XAPA 2W60A 3QXDA 1HKVA 4XX6A 5E1AA 4H4IA 1JDEA 4D8LA 1TMLA 4GFSA 1HE7A 2PLMA 4MMZC 2YSTA 5L2KE 4DUOA 4OZFB 1GL4B 4YDNA 1FV1B 4TN9A 4DWSC 1TPVA 4PS4H 4C6PA 1JNNH 1SJDA 1JYWA 1WZ1L 2HWGA 1U8PA 4DJFD 1WOBA 4I9MA 1BVWA 1YEGL 3NQ2A 4BFFA 2ENQA 1NMCB 4HNCA 1UYQA 3SDCA 3FO9B 3L3OB 4KWVA 5C2XA 4HLEA 3HR5A 3LZ3A 2P46B 4YHZL 3SURA 4QSHA 32C2A 1H6EA 4B4FA 4JZOA 2V2TB 2Z2UA 4HN8A 1E5NA 4FFTA 1AP2A 1ZTXL 3O6CA 1TWIA 4WVXA 2XGZA 4AZ7A 3TL5A 4KKAC 2RDWA 2X9YA 3W27A 1U8NA 5IT2L 1Q65A 3RX4A 4HKZB 1ZVSB 2R0LL 4KDTA 4E9RA 4I4WA 3LMYA 5K59F 2PC8A 2G2NA 5IQLA 4NVTA 4M1BA 4JY5L 1YEGH 4KJYB 3OTTA 5ABTA 4YHZH 3QQ3B 5EU4B 3ITLA 2CRMA 3U4EB 4RUBA 3FV9A 1L2UA 5HHQA 3GF8A 4FD0A 1Q6QA 1HCYA 2V5KA 5IFJB 1ZTXH 3MMEA 1X39A 3RLUA 1N5AB 4S38A 1V55B 3KWWB 4JRYB 4HVXA 3WQ5A 4FHKA 5DZPA 5IT2H 4MXQC 4XWGH 3PGFH 1EK3A 1T0PB 3W88A 2CR6A 2R0LH 2Z8WC 1KPRA 3UWZA 1K8DB 1HF6A 3C2AL 1H7WA 3BH9B 1PDKB 4HWNA 5L9FA 5J04A 4QHLA 4O53A 1DQJA 1TKKA 5AQ0A 4J28A 2OTWA 5E8EB 3LZOA 2WC4A 3RA7L 4OFQA 1I4NA 3LZNA 1BQUA 2EKCA 1PWLA 2YAMA 1RZKC 1WFUA 5I09A 2VQ1A 1OANA 5HOSA 2BOLA 4ICXA 1JWUB 5DRNA 3NRPA 4XAYA 4XPAL 5DJXA 3T65B 4LALA 1WBJA 1NEZB 3QIBA 1LJYA 4YLCA 2VAJA 1MCSA 1RK0A 5E0KA 5H4YA 3U0HA 1X4ZA 3U2JA 2EPHA 3C2AH 3V0VA 3C5ZD 4A2MA 2Q3XA 1W2PA 2XICA 4K5OA 3PWNA 2PYEA 3S9ZA 3UVAA 4PREB 4ZXBB 1P7TB 5JHBA 4UNVA 2Q20A 3RA7H 4MMWA 2EDJA 4KV5F 3S96A 2HPMA 2HJLB 1TQBC 4HU3A 3F4WA 1G7PB 2PDIA 5IREA 4XPAH 4TPRL 3QIUA 3EOLA 3R06B 3PWVB 3VXRA 1NFDE 2ITCB 1X6LA 2A9AA 2RHGA 1ETZB 5JBEA 2MQ3A 3NIDF 4NC1C 4WHBA 2PW2B 1EB3A 3ZKSD 2FHBA 4L05A 1PL3A 1R3HA 3EBIA 4D6JA 4P8QA 2Z31C 4ZS6D 1T2JA 1UG9A 3LQLA 1GYVA 3RUBL 4PJGA 1GYAA 3DECA 2C1PA 1JCMP 2I7GA 3MLYL 4I18A 3TT1H 1Z44A 2X1UA 2VM3A 3PP4L 2HPIA 3U25A 4LVDA 4M3PA 1SMAA 3X2QB 4NKCA 1J8HB 3W2LA 4TPRH 3V6OE 3ZUCA 4WY7L 2CZNA 3ZQWA 4G8GB 3FVDA 1CT8B 4YX2L 2KERA 1BYCA 3CAVA 1BZQK 4GA8A 4G1EB 4H04A 3S1GA 4MHBA 3DYPA 3QUYD 2P5EB 4XQ6A 1WAUA 3QJFB 4PPTA 2XFXB 4QRSB 5BOPA 4CC0A 5ICYB 3BCJA 3MBXL 3MLYH 3PU7A 3RTQD 3PP4H 2GW5A 1Z69A 4F8OA 3EMCA 1EZ2A 4HK3N 3OWRA 4PMEA 2OODA 1TPC1 4WY7H 3WI9A 3IV8A 4Y4FA 1KTLA 4M3KB 4D0CB 4R7JA 1WBYB 3P2VA 1GXEA 4YX2H 2ZA1A 4R26H 3S2MA 3ECWA 1EJ8A 4W5UA 4NUQA 3V4LA 4POCA 3F7VB 3UCRA 2MOGA 3SZ8A 4IGHA 3HURA 4RNFA 3S5LG 4GKSB 3MBXH 3RUGB 1B4TA 1YEEL 4MB1A 1XB3A 1NEUA 4PMFA 4DIXA 5BNXD 4K39A 1P1ZA 1LYQA 5SWSE 3QEZA 3LSOA 4C6KA 5ENLA 3JV6B 2HZGA 3K4WA 2C9SA 3VNMA 2PZNA 1TJXA 1PCWA 4M51A 1R86A 1DQDL 2VRAA 3P0YL 1FWJC 4PJIB 2WB7A 5ADOL 2X1OA 4CNIB 3FEMA 4MXWH 5CCKL 5GZOC 3BUIA 5KYUA 1YEEH 3QM3A 5C9XA 5IF0A 4X2RA 2J9XA 4C6BA 1UENA 4O58L 3GRWL 1ZGLM 4GO8A 4LP5A 4LRIA 4MMXB 1U3YA 3T3MB 1WCQA 1IQWL 1FRGL 1MWAB 5DQ9B 4C7FA 2EAWA 4MNKA 3T2PA 2CDFB 3VD9A 1ZAJA 3BOLA 4HQVA 4DXXA 1DQDH 3P0YH 1NUFA 3KPSA 2CIKA 1OAKL 4ZOCA 4EUPH 5ADPL 5ADOH 5LHDA 1XQLA 3R12A 4FX6M 5CCKH 3UZYA 1HXMB 1LO5B 1U22A 1U91A 2J7GA 2BY3A 3HE6B 1VHNA 4KWOA 2NV9A 1TVLA 4O58H 3GRWH 3V10A 3S98A 5IQMA 2VOTA 4NOBA 4JCLA 4JIQA 5I00A 1IQWH 2IWEA 1OV8A 5GGVY 3VXMA