3CPUA

Subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHNNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Subsite mapping of the human pancreatic alpha-amylase active site through structural, kinetic, and mutagenesis techniques.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1999-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cpuA01
1LQ0A 3BCDA 4GKLA 3W0KA 3WD2A 1UQYA 2BHYA 1B0IA 3OZPA 4FNTA 4PMDA 3OB8A 4KGJA 2J79A 3VMPA 1VJZA 1VRXA 5C8BB 3N15A 3L4XA 3SUTA 3VTRA 1TQUA 4H2CA 4LXFA 3SCOA 2EO7A 1EO5A 2WHKA 4U2ZA 5DT7A 1W3KA 3AJ7A 2ESCA 1ISVA 1JZ8A 3K46A 3EDEA 1MW1A 1BVNP 4LPCA 4ZEPA 4GI9A 4J3TA 3RJXA 1WO2A 1C3FA 4DWSC 3ZJKA 5M03A 4IPNB 2OSYA 4MPKA 4AWEA 2XN1A 3VDCA 4QAWA 4AD0A 3WD3A 1JAEA 1OINA 2DSKA 1RD6A 4EAMA 1U33A 1ZS2A 2VCAA 4BQ4A 2EACA 4D6JA 4UFIA 2CITA 2G4FA 2X2HA 3GH4A 5ABEA 3VGEA 3F5LA 1R7OA 4MNJA 1UD8A 1V3HA 2JFEX 4DWSA 3W37A 1CWYA 1OD8A 4W86A 3AFBA 1R87A 3TTQA 3AMLA 2WAGA 1W2VA 3W27A 4AXNA 1BQCA 4BQ3A 1MW3A 3AS2A 4B9YA 4AEEA 3N18A 3FHQA 4NZFA 4JKMA 1GORA 4D6HA 1K9FA 1J0JA 3CUFA 1CXLA 3IAPA 4CD4A 3AHZA 3CGTA 4UOJA 2C0HA 1DEDA 4AD1A 1C8XA 4AD5A 5A8OA 2XGIA 1JZ5A 3AS3A 4OBRA 1HJXA 5DMYA 4JAWA 3ARXA 3HG4A 1BGGA 1E5NA 1FP9A 1W9PA 3RM9A 4FLOA 1E6SM 3B9AA 4MB1A 4TOQA 2F1AA 3CLWA 4GI8A 2DGAA 4W89A 4M81A 1QHPA 4HZ8A 5GQBA 1V08A 1B3ZA 3W6LA 4LQ1A 3L4YA 1PBGA 3BMWA 2F7QA 4WKFA 3WH9A 3CPUA 1RP8A 1PX8A 3ARRA 5BRQA 1B2YA 4MADA 3BCFA 3WY4A 3WH7A 3VOCA 3MV11 1GOMA 1UH3A 1E6QM 5CLWA 3D51A 4TVDA 4EK7A 1MWOA 3VD9A 1MXDA 4FNSA 4J3SA 4W5ZA 1HL9A 1E0XA 3VDAA 4QFUA 4V2XA 4R5EA 3AHYA 1ZU8A 1UHVA 5A8PA 4H7VA 3CUHA 4M29A 2VNCA 3AIWA 1GQIA 3A5VA 4CN1A 3FNDA 1V3LA 4N42A 2WMGA 3T2QA 5KZ6A 2GDUA 2C7FA 3RPMA 1JF5A 3G6MA 1HP4A 4UR9A 2J8FA 3S2CA 3EJTA 1R86A 2G3JA 2EADA 3GYCA 4ZE5A 2VVNA 2XHYA 4JL1A 4AZHA 1CENA 1K9EA 1B30A 1MW0A 3VSVA 4AZBA 5FL1A 5AYIA 2DEPA 1KGWA 3WMSA 3AQUA 2EPOA 1TQTA 3KL3A 4X0VA 3AMDA 3O6AA 3WQWA 3O9NA 3DDGA 4W5UA 1W3JA 1ZJAA 1CTNA 1D2KA 2W5FA 2YA2A 1UD6A 1VJSA 4U33A 1DP0A 4DUXA 3ZO9A 1LL4A 3D3AA 1BTCA 4P8XA 2V3FA 4QDMA 4BZYA 3K4AA 4AEFA 3ALFA 2ZOXA 3HU7A 3CZEA 1NOFA 5EB8A 1QPKA 1B3WA 1TQVA 2RGLA 3QHMA 3IJ8A 5E6ZA 1JD7A 3WDQA 1ZB5A 1HVQA 1E73M 1MFVA 5FD0A 3AMKA 4W8AA 3WNOA 4AD4A 4FNQA 2VRJA 3MUY1 2UWFA 3T0BA 1V3MA 1BG9A 3NJ3A 1HJUA 1V02E 1VBUA 1E1FA 3AHTA 1HWWA 1FH8A 3AIEA 4F9DA 1M04A 3LXAA 3CZGA 3BVTA 2VQTA 2WWDA 2ZUWA 1WZLA 3PHAA 4DWSB 3DC0A 1EQPA 3IANA 3VGFA 1KB3A 5A8QA 1XRVA 3H53A 2GJPA 1V02A 3J7HA 2CNCA 1Q6FA 2ZUSA 5F7UA 4H41A 4AIEA 2OW7A 5CPTA 1TVNA 1PAMA 1BG4A 1H09A 3UG4A 4AZ7A 3WSUA 2ZE0A 3GNOA 2EPLX 2BVTA 3WL1A 2QPUA 4N0RA 1O6IA 4D1IA 4UZSA 3SEPA 3CUJA 2VRKA 2GJXA 4FMVA 1XCWA 4QLKA 2J62A 4PMOA 1WZAA 1KWKA 1CXKA 3MSDA 3ZT5A 1KBBA 1V3KA 3CHDA 3CZSA 2EABA 4AMXA 3LPFA 4J27A 1BYAA 4MB5A 4JFUA 5A6BA 3SCWA 5A95A 2VT0A 5A1AA 3M46A 3W82A 3HZ3A 4AYGA 2J7EA 3ECQA 4WKAA 2DSVA 5HPCA 2ZUTA 5EMYA 2XVNA 2Y24A 1PX3A 1R34A 4C7DA 4PTXA 4KH2A 3BAJA 2JIEA 3WNMA 1JZ3A 4GZJA 5A94A 2ZWZA 2JF7A 4D71A 1QI2A 2WZHA 3OGSA 1GOIA 1G1YA 3PZ9A 3AZTA 1FHDA 1UR9A 1HP5A 3MU7A 3WF2A 5ABFB 1QWNA 1BAGA 1H41A 3AXIA 5IDIA 4PSRA 1W3HA 3BC9A 2XGBA 4L4PA 3AOFA 2DQXA 2BY3A 4X9YA 1UWSA 1VEOA 4D1JA 3DX3A 1MQRA 5CSYA 3WDIA 4S3KA 2QLYA 4WJXA 5DF0A 3VIKA 5IFTA 2D3NA 4FLSA 1BF2A 1KFWA 5BROA 3PZNA 3BSGA 1QHZA 1WZMA 1KGXA 3PTQA 2OYKA 1A47A 1B3XA 1E0WA 1PEZA 1QBAA 1W9UA 2G3NA 2YDSA 3VX1A 4J3VA 3ZJ6A 4JFSA 1JFXA 1R8LA 3N9KA 4AZCB 3W24A 1NP0A 4HZ7A 1XH2A 2D24A 3PBGA 5AYBA 3VIPA 2MANA 2XFFA 5M3WA 3ZSSA 2CIPA 3LRLA 1Q4NX 4V27A 3SIMA 4ACZA 3RILA 1BSIA 1C7SA 1HXKA 4M56A 1DWAM 2F61A 3U5UA 5LA1A 5GNYA 1OB0A 1V0KA 5ABHA 3E1F1 2ZX9A 1CXEA 2CEQA 1E6ZA 4C7FA 2WKGA 4XUYA 2A3HA 5EFFA 2UY4A 4TUFA 1Z32X 2W67A 1D7FA 2EEXA 2F7PA 3HG5A 5DFAA 3WQ4A 1UWIA 4UQAA 1RH9A 1W2PA 1HJQA 1WNOA 2F7RA 1JFHA 5AC5A 5CSUA 4FK9A 3TP4A 2OYMA 3UCQA 3VGBA 5AY7A 2OSWA 1EOKA 3CBWA 1KTCA 3N04A 2OWXA 2D2OA 5M17A 5TD4A 5BXSA 1JZ4A 1J10A 5CG0A 4DUVA 2G41A 3D4YA 5BXRA 2ZX8A 3FN9A 3EJPA 1C90A 3CO4A 4NZJA 5ECUA 5IHSA 3OLDA 2YJQA 1E1EA 4PBGA 3N12A 4P7OA 3KL5A 4UZUA 2BVDA 4QCEA 4DWSD 2WNWA 1DWHM 3WD4A 4PMNA 4HP5A 1I1XA 1HVXA 3EDDA 2VR5A 3DHPA 1XHGA 4GPNA 3MSGA 2BHZA 1YQ2A 4AISA 5I78A 1LLOA 3VGHA 3WUBA 1OIMA 1HJSA 1UWTA 2WYSA 1QX1A 2WC7A 4UCFA 2ZUMA 4GZEA 2GFTA 2XUCA 4QLLA 3UR7A 1EA9C 3ZR5A 4B3KA 3MUZ1 1XC6A 2WANA 4H8VA 3SCNA 1Q6EA 2OLHA 2DPEA 1G9HA 4WSKA 1E0VA 3WIJA 3FY1A 5JBEA 2ZX7A 2PWFA 1UKQA 2VURA 2DDXA 5HDRA 3ZR6A 2D0FA 3AMGA 3VU2A 1W1TA 2BNJA 1UKTA 3K4DA 1Y7VA 1QW8A 1NARA 4CN4A 3FAWA 3SCQA 3GBEA 2V5DA 2X2YA 4XZBA 3OA5A 2J8GA 3RMEA 4V28A 1VFFA 1C92A 4PMQA 3RM8A 1E9LA 2YBTA 1V6VA 1Q6CA 1LJYA 3EMZA 2XFYA 1EO7A 3BAWA 1QI5A 3CC1A 1V3IA 1JF6A 2WVVA 5CLTA 3LPGA 2XM2A 4E2OA 3VD7A 3MV01 1C8YA 1K6AA 2VRQA 4JFWA 7CGTA 1V6WA 5DO8A 1W9BM 4P8VA 1UZ4A 1HJWA 2ZICA 4JKLA 3B8SA 4AD3A 4Z2HA 9CGTA 2WC4A 4DM1A 1MW2A 3WBAA 4BF7A 3AXHA 3BMVA 5A6AA 5E1QA 1J0YA 2F8QA 5M5DA 5D9OA 1R75A 1D3CA 1EGZA 3H55A 2DIEA 3VSUA 4HA1A 5I79A 2WVUA 2YFNA 1G01A 4BCEA 4HZ6A 4HPHA 3CH9A 4D72A 3ARZA 3POCA 4FLQA 2E8ZA 1ODZA 1V3JA 5CXPA 3H54A 3GXTA 2YA1A 4U2YA 2G3IA 1ISXA 2F7OA 3VMOA 3U57A 3WUEA 2WLZA 4PMRA 3I3DA 4WLCA 3L4UA 3OIHA 1DWFM 3L4ZA 2NSXA 2J7CA 1PIGA 3OLGA 2J7FA 2O9PA 2FE0A 4JHZA 1U30A 2F18A 4OJYA 5HPOA 1KTBA 3TTYA 2AOSA 2Y8KA 3BUIA 3BUQA 1XYZA 5A6MA 1ZBWA 3SCUA 3KL0A 1MQQA 2X0YA 2PB1A 4GQQA 3W6MA 5HNNA 5BXTA 4WK9A 1BVZA 2CESA 1F4AA 3IAQA 4NF7A 3AZRA 1V0LA 1W91A 1J9YA 2J4GA 1V0MA 2Z1SA 4PCSA 1CEOA 1NH6A 1JAKA 1GOWA 4D6GA 3AYSA 3BAKA 1C7TA 1UR2A 3AIBA 4A4AA 3W81A 1QI0A 1OGGA 3GXIA 5GPRA 1US2A 4D6CA 1JG9A 3DX4A 1ODUA 3A23A 4UNIA 2VC9A 1JDAA 4XB3A 2D0GA 3DYOA 1UG6A 2PBGA 2YBUA 2WMFA 4CVWA 4UQBA 1NWUA 1W1PA 2FHFA 2VMFA 4OOZA 4F79A 2BV9A 1LWJA 3DHUA 3PTKA 4MNKA 3WQ6A 1T0OA 3BAXA 2V3GA 2BXYA 1CZ1A 1ZBCA 1W1YA 1W9DM 1XH1A 3UERA 3D52A 5A6LA 3VDHA 1ZL1A 1SMDA 1GJUA 4CN6A 3OZOA 3VIHA 2GK1B 4HOWA 2X09A 1JYVA 2EPNA 4W93A 3AMCA 4GXPA 1V6XA 4HOZA 3CUIA 3FAXA 5CQ1A 4U5IA 2WMIA 1J0IA 5HBFA 1A3HA 4X0NA 5I23A 3OLEA 3VINA 1GQJA 4Z2JA 1GVIA 2DH2A 4PCTA 2F2HA 2FGLA 3AS0A 1EDTA 1DWJM 4JCLA 3IK2A 2V5CA 2D73A 5CJ5A 4U31A 3KEHA 1H1NA 1MFUA 1OSEA 1LL6A 3LPOA 1GVYA 1UD4A 1M01A 3M07A 3OGVA 3G6LA 3WY3A 1W32A 3HG2A 3NUKA 2YKKA 3CMJA 2PBOA 3LPPA 3A47A 2VZTA 1B3VA 4FNUA 1TA3A 4PEEA 4QCFA 4GI6A 3UG5A 2EPMX 2XG9A 4IUGA 3SCVA 4LYPA 3IJ7A 5EBAA 4WSJA 3WKZA 1WPCA 3CMGA 3WFZA 1GQLA 1JD9A 4OKDA 2XSBA 4HU8A 1JDDA 5BCAA 4PYSA 1NP2A 1B1YA 4AYSA 2WVTA 1UD2A 1R46A 3GBDA 2WHLA 1WDQA 4QP0A 5BWFA 2PI6A 4RL3A 5CGMA 4M82A 2WPGA 2XWEA 5CPSA 4ATLA 2CXGA 1UYQA 3EJQA 1UZ1A 2VX4A 4B15A 2WZIA 3UESA 3NYDA 3BAYA 4YHEA 2Y4SA 4JFTA 3BUPA 3WMBA 3WQ8A 1OT2A 2Y5EA 2PF0A 5BRPA 1HNYA 1K9DA 2WB5A 3I3BA 3LRKA 3WNKA 3VUPA 2X2IA 4HMCA 1LWHA 4CCEA 2V3DA 3M6DA 1E3XA 1CGYA 3EDFA 1UOKA 1E70M 1M53A 3VIOA 4URIA 4MB3A 2IGTA 4GZIA 5D9NA 4JCMA 1L0PA 2WW5A 4FLRA 3NCOA 2F1BA 4RE4A 2ALWA 1XD1A 2E8YA 3JUGA 1IZKA 2GDVA 2YDRA 1ZJBA 1R85A 4UQDA 1S46A 3NDZA 4F8XA 5ABGA 3BXWA 1C8QA 1HKMA 2JEPA 2VVSA 2WHJA 1E6NA 4NZCA 5BXPA 3IJ9A 4HPGA 2WSPA 4D6DA 2EPKX 3EBVA 5D9MA 2FGZA 2J47A 5A8NA 1UA3A 3WQ5A 3PZIA 3MANA 3T0AA 3A6OA 1CLXA 2IXVA 2CYGA 1BLIA 3W26A 3SUWA 1GONA 2CHOA 5HOSA 4MDOA 3U7BA 3LRMA 4PUDA 4NRSA 2XM1A 4HMEA 3RIKA 1CDGA 2WMHA 1WP6A 4TVUA 3ARTA 2WKLA 3OG2A 1EQCA 3EJSA 2VCBA 3APGA 4NXKA 5A8MA 3AROA 1RPKA 3QOMA 2GJXB 1UR1A 2UY2A 3FXYA 1UA7A 4ZFMA 2ZXAA 1EXPA 3NSMA 3POHA 3GXDA 2VX7A 1H4PA 5BYWA 1JXKA 1VF8A 1PPIA 1ECEA 1X6NA 2ZXBA 1C93A 4D6IA 4RE3A 3DX2A 2O9RA 1W9VA 4TX8A 1XGZA 2W61A 4DUWA 1HXJA 1Q6GA 4WKHA 3MMDA 2D0HA 3GNRA 2CKSA 3BAIA 1PS3A 2E9LA 2ZUVA 1NWRA 3EDJA 1HX0A 4UFKA 2G3MA 4PMZA 4Z2LA 1SYTA 1EDQA 1QNSA 4JFVA 2W63A 5LA2A 1UUQA 2DSWA 2VUYA 5FIPA 2Y2WA 3LXBA 4AZGA 4OZOA 3BLKA 4D6FA 1IT0A 1EHAA 4UFMA 1E4MM 3VD5A 3AISA 2YL9A 1J0KA 2ZX6A 1NWSA 4U3CA 1AQ0A 4AZ5A 1UKPA 3ZJ7A 3VO0A 2WBKA 3VGGA 3GH7A 3MMUA 5FKYA 3BSHA 4FNRA 1ITXA 1CGXA 1CGUA 1BYDA 3CHCA 2CCRA 3EDKA 1EHNA 4AZ6A 4CCDA 3L4TA 3N1AA 5GNZA 5HXMA 2CETA 3W25A 1PX4A 3BLBA 2J75A 4MNMA 4BS0A 2DT2A 4BA0A 4TTGA 2WSKA 3BGAA 2YDQA 1J0ZA 4NXSA 4AIOA 2E40A 3PZVA 2IXUA 3ARUA 4A3YA 3CZKA 3AIQA 4UOZA 4GIAA 3OGRA 1MVYA 2A3EA 2IUZA 5AC4A 4ACYA 1JYNA 4AMWA 3O2LA 4PUEA 3WDRA 2DT1A 1SR0A 3N11A 3CV5A 2VOTA 5I5RA 3SCPA 1TVPA 7TAAA 2DT0A 1GHRA 1OD0A 1UWRA 2XN0A 1E56A 2BY1A 3LX9A 3WFLA 3CIVA 1HIZA 4OIFA 3GDBA 4AY1A 3HN3A 1CPUA 1DTUA 2CPUA 3EJUA 2YLLA 3ARQA 1E5JA 2VTFA 3HG3A 1B9ZA 1EH9A 3WNNA 2WCSA 1KXQA 1MYRA 2J7HA 4Q7NA 1GW1A 2YLAA 4Y7EA 2EBNA 3L2MA 1TMQA 1VEPA 1X1NA 4MB4A 4M8UA 1TZ7A 2VX5A 1J18A 1PZ2A 4J3XA 1V03A 3RJYA 1KR1A 1HKJA 3SCRA 2WMJA 1HJVA 3WQVA 3GXPA 3NIYA 1AQHA 2VX6A 4P8UA 4PMUA 1L8NA 5I0DA 1QW9A 3SUUA 4Z2GA 4E8DA 3UG3A 2W91A 3GNPA 2UY5A 3DYPA 4HTYA 5A2BA 4W8BA 3BVXA 3THCA 1QBBA 2W92A 2EJ1A 1ESWA 1RP9A 1OWQA 4ATDA 3CZLA 2FHCA 3PZMA 3K8MA 3ZT7A 1V6UA 3WH8A 4AZCA 2ZXDA 1CECA 1LF1A 3NDYA 5CZKA 4W88A 1BYBA 3WNLA 1FHLA 5I2UA 1XH0A 5E70A 2DIJA 3B9DA 5A6BD 3PZUA 1MQPA 3D4ZA 1WE5A 3S6TA 4M1RA 1JNDA 3CHEA 4HA3A 2NW0A 5C71A 4KRUA 1VIWA 1UQZA 3II1A 1E40A 1CGWA 2JALA 4W7VA 4YN5A 1H49A 2WCAA 4CU7A 3WH5A 3SCTA 8CGTA 2VQUA 2BXZA 1XD0A 1DWGM 2J7GA 3ARVA 3TOPA 4DO5A 1R7AA 3KZSA 2RGMA 3QGVA 1OGSA 2QHAA 1US3A 5A2CA 1NOUA 1EIBA 1FH7A 2ZUNA 2WMKA 4P7QA 5EFDA 4H8HA 2VZSA 5A3HA 2WZEA 2CBVA 3S5ZA 4JHOA 3ZOAA 3WY2A 4AMCA 3LMYA 1QOXA 1FFRA 4ZXOA 1TFVA 5D9PA 3MMWA 4EE9A 2D23A 2NT0A 4PMVA 1BFNA 3AHVA 1UH4A 1G5AA 2O9OA 3VNZA 2WVSA 1UWUA 1W1VA 2E0PA 1KXTA 4OBSA 4ZENA 3W38A 1UWQA 4ML4A 3T09A 4TTUA 4KMQA 4W84A 1CXIA 3OBAA 4CGTA 1VEMA 4NSBA 1OBAA 2EAEA 5IXEA 2WC3A 5A6KA 1R47A 3QR3A 4PMXA 3SUVA 3A4WA 4P7NA 4P7RA 2YA0A 1VBRA 5CPQA 2EXOA 2UY3A 4CD8A 1KQYA 1WKYA 3A4AA 1E43A 1MXGA 1AMYA 4W87A 3GM8A 2ZX5A 4OUEA 3ZJ8A 3TTSA 3VDBA 2PWHA 4B16A 1PIFA 1UKSA 4HOXA 1VFMA 4AC1X 1NQ6A 1UASA 3WENA 3WNPA 1E72M 1WCGA 2JE8A 4W7UA 3VIMA 4PTVA 2AAAA 3BVVA 1JZ2A 1E4NA 3WUFA 3BLPX 3W53A 1JXJA 4PN2A 1YHTA 3FHAA 4UFLA 3K8LA 5D8ZA 1E55A 3MUIA 2WXDM 3WF4A 3QOKA 2D20A 3HJEA 6CGTA 2FH6A 3AS1A 2XVGA 2HISA 1GOKA 1UD5A 2TAAA 1U2YA 2O92A 3VIFA 2VR4A 5JBDA 1KBKA 2D22A 1E4IA 2FYVA 3AIUA 2J77A 2WM0A 3WEZA 2J7BA 1KXVA 4A3HA 3QHOA 3THDA 3WDHA 3WBEA 3VSTA 5DEZA 4MJ2A 2XTKA 4F9JA 1JL8A 2B31A 4JL2A 2D1ZA 3CZ8A 1R33A 1VAHA 2EQDA 1UKOA 1JZ6A 3HMCA 1LG1A 4CD5A 4EANA 3L2LA 1GHSA 1AQMA 4GQRA 4KGLA 3BUDA 3BVUA 4E8CA 1E3ZA 1J12A 2G8ZA 2FDMA 4Q22A 4LX4A 2CKRA 2XN2A 2ZXQA 4CCCA 1DWIM 2YL8A 1ZBKA 3VILA 3F5KA 3K1DA 6TAAA 5A2AA 5ABFA 3WN6A 3VM7A 1TE1A 3A3HA 2FH8A 3BH4A 1I1WA 1CXFA 4J7RA 2WWCA 3GXNA 4K68A 1QI3A 5I77A 3A24A 2GSJA 4TX6A 5I24A 3VVGA 4D6EA 1KQZA 2JEQA 2VI0A 3W29A 3GTNA 4W8LA 3U7VA 3VX0A 1H11A 1P6WA 3ARYA 1E6RA 1W3LA 3SCSA 2XIBA 4IM4A 3QHNA 2DT3A 5FCZA 5IHRA 3ARSA 2OSXA 3PZOA 3WEMA 1VENA 3KWXA 3EYPA 1GPFA 3AI0A 3TONA 1BHGA 5LA0A 4OGZA 5CGTA 1TG7A 1E6XM 3SUSA 4JKKA 4UQEA 3ZMRA 5A6SA 3PZQA 2DSUA 3LXCA 1B90A 3WF3A 1SMAA 2E4TA 3NSNA 4YPJA 3UR8A 1QWUA 1JYWA 2PC8A 3GZAA 3PZGA 3WELA 4XV0A 3U5YA 3EJRA 3MO4A 2VZUA 2E9MA 2BVYA 2A3BA 3ZM8A 1GZJA 1B3YA 4AW7A 2C8NA 1ITCA 4AD2A 3AIVA 2Y8VA 2XVKA 2YL5A 4WIWA 1HTYA 1XSKA 3MI6A 3TTOA 2J7DA 4JIEA 2OYLA 3VD3A 2O9TA 3A21A 2Z1KA 1XYFA 3ZT6A 2YFOA 3CHFA 4P8WA 2A3AA 2DSZA 7A3HA 1ZBVA 2GK1A 3VGDA 3CTTA 2WK2A 3WH6A 1WDSA 2XFRA 3VD4A 1WZKA 3DX0A 2W66A 1G94A 4M24A 1IZJA 4BQ5A 1H3GA 4FNPA 1OGBA 4LYQA 2QPSA 4MDPA 3VMNA 2J25A 2AMGA 3WF0A 3T0DA 3KE0A 1WDRA 2QMKA 1GQKA 4NI3A 4ZXLA 1JIBA 3WD0A 2ZUUA 2D3LA 4UQ9A 1Q6DA 1QVBA 4WF7A 2OW6A 3DYMA 4AZIA 1WDPA 3VKKA 3EMCA 4W85A 4CD6A 1JI2A 2PWEA 1GUVA 4W7WA 1GOQA 3A22A 1KXHA 2BS9A 1VFUA 2ZIDA 1CNVA 3VPLA 3WEOA 2CBUA 1DHKA 3KLLA 4TXEA 4U3AA 1NM9A 4HA4A 3W4RA 4B3LA 4LYRA 4NRRA 1O7DC 1GNXA 3TV8A 1J11A 4NX0A 5E0CA 3ARPA 1XSIA 2V3EA 4LGXA 5KEZA 2XYLA 4PRWA 2XWDA 1E6PA 1UH2A 2X05A 4C7GA 4IPLA 2GUYA 4CU8A 1HF6A 1CGTA 5DT5A 3ZIZA 4BQ2A 5JBFA 1V6YA 4CU6A 5D8WA 4XX6A 1XCXA 3OLIA 1CGVA 5GNXA 2BY0A 1JDCA 1CYGA 2W4XA 3MKKA 1KGUA 4B9ZA 1QNRA 1E4LA 1M7XA 1AVAA 4PTWA 1BYCA 3IGUA 3KLKA 1C91A 4MJ4A 5I3DA 2X1IA 1WB0A 4UTFA 1SFSA 1ISZA 3RO8A 3D50A 3CZJA 2DH3A 1EDGA 3RDKA 1OIFA 3TA9A 4GO9A 1HT6A 1LL7A 3WY1A 1HL8A 3VM5A 1G0CA 2WBGA 3N13A 3WL0A 4CVUA 3AIRA 3N17A 1HKIA 1OM0A 3L4WA 4J3UA 2E3ZA 3D5HA 4ATWA 1NOWA 4Z2KA 1H2JA 1X6LA 3WUGA 4MAZA 3T08A 2WHMA 3WF1A 4QLJA 3UEQA 2CBJA 2XVPA 3GH5A 5IFPA 4J3WA 3GXFA 3ALGA 1JI1A 1TUXA 4F66A 1CLVA 4HU0A 2OWWA 1FA2A 4U5KA 4S3JA 4RE2A 4XZWA 1V0NA 3MS8A 2BHUA 4DO4A 2FHBA 5E09A 1TCMA 2OWCA 4P7LA 3I3EA 2QV4A 1VB9A 3A4XA 3DX1A 2CBIA 1TQWA 2WMIB 1F4HA 2PWGA 5A69A 4UOQA 5C70A 1B31A 2VZVA 3VIIA 2WCGA 2BY2A 1PJ9A 4E4PA 1NWTA 3B9EA 2X2JA 3BVWA 3RCNA 5FL0A 1FP8A 4MNLA 4PTMA 1QNPA 2V38A 2XVLA 1UR4A 1H0GA 1H5VA 2XIIA 1HN1A 3VNYA 2W62A 1KCKA 6A3HA 1J01A 3ZQ9A 2JIWA 5E9AA 1N82A 1ISWA 1JYXA 3RM4A 2YIHA 1UR0A 1QNQA 4KRTA 4JZ5A 4UFJA 1TA3B 5JIPA 2WVVB 1JZ7A 3MUAA 2GVYA 1XV8A 2J74A 1TR1A 1FOBA 1CXHA 4IISA 3AZSA 1JGIA 3F4VA 1TQSA 3L4VA 3CUGA 3NSXA 4OOUA 3AICA 1GCYA 5A6JA 3S5YA 2QF8A 4EKJA 2J78A 1LG2A 1O7AA 3GXMA 2ZWYA 2CERA 4PSPA 1W9XA 1OCQA 3K8KA 3DDFA 4J28A 1KR0A 5E0FA 1HKKA 1XSJA 2XJ7A 2HVMA 4GO8A 2GJRA 5JUVA 4CUCA 3ZSTA 4Z2IA 1OT1A 1I75A 3PTMA 1CBGA 1VFOA 4GINA 1J0HA 1PZ3A 8A3HA 5FOOA 4UFHA 3M7SA 4KWUA 2XPKA 3SURA 2CHNA 3VIGA 1M03A 3F5JA 4ACZB 4YHGA 2XSAA 1QNOA 3AHXA 3DECA 4H04A 1H0IA 1BGAA 5D4YA 3T2PA 2A3CA 3AXXA 4R27A 1WAWA 1E15A 4TVCA 1QHOA 3PN8A 3CZNA 1KCLA 4UQCA 3ARWA 1BPLB 1UR8A 2X8RA 2VO5A 4CD7A 1E71M 4H8UA 1CIUA 3PZTA 2NT1A 5I6SA 3T2OA 2JF6A 2WLYA 4DM2A 1QI4A 1FH9A 5E6YA 3W28A 4ZE4A 1KWGA 2VL4A 1IV8A 2VCCA 1SZNA 3BUBA 2E9BA 1FFQA 2X0HA 4CKQA 2VZOA 2BFGA 1EOMA 1JNEA 2VJXA 3EMQA 1K9TA 3AYRA 3WDPP 4AIUA 3FW6A 2PWDA 5JIWA 4HMDA 4MTVA 1ISYA 3WMCA 4FF5A 4DO6A 4L4OA 5LYRA 3UETA 2YL6A 1GJWA 2Q8XA 4MAVA 2QMJA 1UD3A 4M80A 3VIJA 3WD1A 2YOCA 3WDJA 1GOOA 4PMYA
chains in the Genus database with same CATH superfamily
2H0FA 4GKLA 1DVXA 1MCNA 5CF3A 5I1GL 1F9CA 1M41A 3OKMB 2YBRA 3MLVL 4GG9A 2BHYA 3WD2A 1KJVA 2UY7A 3E9AA 1B0IA 3SM0A 3W86A 4PBDA 4LSRL 4UAOC 4WI3A 1IAIM 1N6UA 2PW1A 3JYCA 2J79A 1VJZA 4QRPB 3FJLA 2F5BH 1ALDA 3QUYA 4R9XA 5IDZA 3N15A 2ZVIA 1NVMA 4NKMA 4XXCC 2J9YA 3GUGA 2IV9A 1MUJB 1PCKA 3KYAA 1BJ8A 5E8NB 3SDCA 1WBXA 4KAQH 4KY2A 4H2CA 2X4RA 5HPMB 3BAEL 3LN5B 4OGYH 4WKXA 4HFUL 1FAIH 2PCPA 2EO7A 2WNGA 2YPLA 1QBLH 4JDVB 4LSPL 4P07A 2WXMA 1NFDE 3G5VB 1EO5A 1TMCB 3MCLH 3ZUCA 4TXVB 2NY1B 2V9UA 1Q6RA 1XYCA 2FTYA 4LEQA 5SWZD 5EG6C 1Q7ZA 3MRDB 1TV3A 5C2BH 5CSBA 5AQ0A 3AJ7A 1JUEA 2ESCA 3KLHC 4JB9L 1ISVA 3HAEB 4HHAB 3UPBA 3S3PA 1PWMA 5HHVH 5KZEA 2BNQE 1A6AA 1JCLA 4NZUH 4ZBJA 4F8NA 3OWRA 1IGML 2PTDA 3G0UA 2A3LA 4G3YL 4J3TA 4PS4L 4ZEPA 4HJTA 4NQXB 1BJ1H 4QF1A 2VLMD 5T5FH 1M3IA 1JVLA 2DD8H 1JHLL 2ZUYA 5KS9F 5F4SA 2VDLH 1L6GA 3QJHA 5FCUL 1C3FA 3FT0A 43CAA 4GT7A 4DFIA 1X98A 2CK0L 3MR9B 4PJXB 4RGOL 4FFZA 4K2UL 2Z35B 4HKBB 4PGCB 2WN3A 4PJIB 1H19A 3FB7A 2A83A 4WUUD 4B9KC 3BVNA 4GUGA 1VPOL 4AZ8B 4AWEA 5EOTA 5ANHA 3X1NA 4GG8B 3OPSA 1HHIA 5AL0A 4YDZA 3MNVA 3UEZA 1WFUA 4CRPA 1RUMH 4NWUH 1XTLA 2VWEC 4BFNA 3HC4H 3WIIL 4HX1A 1EDYA 1EZ2A 3OC8A 5A7BA 3DROB 1J79A 1K5NB 3ITYA 4P61A 5B3SB 3OB0K 1Q6QA 2IAMC 3AU2A 1GGTA 3WFDH 1YNQA 2EACA 1MREH 4NRZB 4O11A 1N6VA 4XPHH 3X14A 4EI5C 4UFIA 5C07D 3I9PA 4LAUA 1W0YT 2W59A 1Z42A 2DVUA 1BQHB 3GH4A 4NZ4A 3OL2A 4DP7X 4AHOA 1DSYA 3P81A 1ORSA 4Z3EA 4PH8A 1RCOB 4CEXC 3H6OA 4MNJA 1UD8A 3CFEA 4XN7A 4DKTA 1PZAA 4TNWK 2LAAA 3HFFA 4B96A 2P52A 3FTYA 3VI4A 2Y6SD 1XICA 2Z25A 4IMAA 4DWSA 1DQXA 3TT1H 4PUUA 3S1WA 2E7MA 5FDWB 1MWAH 3ZN6A 1QFWI 2Y1YA 3EOYG 2NQZA 3WQGA 1R87A 1CQYA 3ZZ1A 2CALA 1H15B 1I9IH 2WJ7A 4IRJB 3H8AA 3UFYA 1NFAA 1M2VA 1W2VA 4U4IA 2H26B 4OGAC 1NMCC 1JK8A 1KFAL 2H32B 3AXMA 3QQ9D 4P48A 4AXNA 1BQCA 4N2FA 4HALA 2DQWA 4BQ3A 3AS2A 1NEZA 1KCVH 3H56A 4NZFA 3WX7A 1P7BA 2OJZL 3KPQA 3NPSC 1KJ3H 4JKMA 4LJ3A 4A3UA 2B1AL 3BUYA 4XN9A 1GORA 2UWEA 4JEJA 1TV5A 3OW1A 3CUFA 1UT2A 3RRXA 1MI3A 1G4MA 3OZLA 5I9QB 1NLBL 1W17A 1TQBB 2P5ED 1C8XA 4ISVB 3G5WA 2Y2TA 3MO1A 1MCLA 3W1NA 4BF9A 3DO7A 3UIZA 3AS3A 1U1HA 3N1QC 3NCBB 3HN8A 1KGYE 3OXRA 4RWYH 3QT2A 4CILA 4MGGA 2D3VA 4NQSA 4WNSA 1NFGA 2OELA 5T33L 5DEFB 4LB8A 4PU2A 1W9PA 3RY6C 2FEEL 4X6FA 1KB5H 2NY6D 3RNQB 2QS8A 4JHAL 5ENWA 4HSQA 3B9AA 2HPMA 4XCNA 4DN4H 3V5FA 5AW3B 3QNZA 4TOQA 5CU9A 3CLWA 3TV3L 2AERT 1F6AB 1L3NA 5BUGA 5J06A 2VELA 3QORB 2XC8A 4LPVA 4PJCA 3ITTA 3L3KA 5B7MA 2XTJB 4YYFA 5FXCH 2PC4A 2WQRA 4M81A 1XLCA 3JTSB 4JO4H 4AMKL 1P7TB 1FPTL 3QJSB 1TJGL 2H0EA 3CLFH 3IFLH 5DQJB 5DZPA 1OWRM 2B4CH 3BMWA 2F7QA 1D8CA 3WH9A 2WXHA 4HX1B 1RP8A 2V5JA 3KFTA 4IQHA 5B39G 4TNEA 1CFTB 1H5YA 5DK2A 2CZFA 2EH8H 2X7LB 4MADA 1G0XA 2YAPA 3BCFA 5C6TL 1PKNA 3HF3A 3WY4A 3QZLA 3VCNA 1IWBA 1OYBA 5CLWA 1JRHL 2XYBA 1MO0A 2CRYA 3OR7B 4NQVB 3SPJA 4EK7A 1KLGA 5MERB 1SY6A 2E6DA 3WXWH 3HPJA 1SU5A 1YEYA 3BX7C 5IB3B 1E0XA 2WQDA 4QFUA 2UXGA 5HAOA 4BK4A 4R5EA 4DAGL 3AHYA 5HULA 4ORIA 3FRPB 5A8PA 3GIZH 3V52L 3M0MA 4MLIA 4N0UA 2APXA 3FQ1A 1XX1A 4EI5B 4J6IA 4GSUA 4A3RA 4E9RA 3GMPB 5D7JB 4HWNA 2VNCA 4MCZA 2OX4A 2BP5M 4X6CE 2VEMA 4L6OA 5D55A 3NVDA 4B3ZA 5BOEA 3QYCA 3WLWC 3AXKA 4O0ZA 2AP2A 3FNDA 4UM9D 1YNTF 4RDQG 2F54B 1A7NH 2Z91B 4B0MB 1LEKA 1V3LA 5DR5L 4KOCA 5C09D 3TZVA 4IXHA 5F4WA 2EUVA 4OHQA 1EL3A 2VFEA 2JCWA 4JUTA 3RPMA 1NGPH 2V7NB 3HC0A 4HWZA 4UR9A 2CCLA 3S2CA 3EJTA 5JR1L 2XVBA 1HI6B 4DW2L 5C07A 1LBMA 1WBJA 3M0KA 1YO4A 2YBVA 3G6JE 1K5WA 1EEYA 1E2WA 4S1FA 4L9DA 2HJFB 2YD0A 3S35X 4JL1A 5G2IA 3EH4B 4PJAE 5I1IL 4Y0GA 1CENA 1LBLA 3VQMA 3ELFA 1AXIB 3CLMA 1FDLH 2OXGB 4K4KA 1MW0A 4G80B 2DJLA 5LXVA 2R1NA 5FL1A 3GZKA 4OZ4B 4AY8A 4OGXH 4AKPA 5LWYL 4AT6A 4PR4A 1YEEL 1EO8L 3EX1A 3NCMA 1W2KT 1BXBA 1TQTA 3KL3A 1VCGA 2WW8A 2HRWA 5LXXA 3NFNB 3QEQE 3AMDA 3MHGA 1MHPL 3D3VE 1DJIA 5ALBH 3O9NA 1Z3NA 5C0IA 1EJFA 4Y5YA 2A0LD 4I3SL 1YDVA 3S96B 5J3HD 1W3JA 3OJDB 5CFHA 2PLTA 1WWAX 1XHHA 4XHQA 3F12A 2YA2A 1WF5A 2Y22A 1TYGA 5BMXA 4OAWA 5KZDA 2BSCA 1CB4A 1IM9A 4U33A 1EZUA 4WK2B 4P46D 3S88H 1RZ7L 1YYCA 4G6JL 5FF6A 5JHLH 3U0HA 1BTCA 1P7QA 3GHSA 1OGPA 2EYTB 3FUHA 2B1AH 3GBML 3M7FB 2YUVA 5ANMA 2AQVA 3VZYA 1I7TB 5F1OB 5C0BA 4BZYA 1BGXL 5AOLA 5EDSA 1PLCA 2VN3A 3ALFA 4CMHB 2JJWA 2ZOXA 1KN4L 3HU7A 1RHCA 4ENLA 4PB4A 4WKZB 4YNGA 4K3ZA 4Y2WA 4Y4KD 4JIIX 3CZEA 4FFYL 4PRDB 5J11C 1WVZA 1AYOA 5SWZA 5BS0D 4C4KT 3L3JA 2QGHA 3KYOA 3FO9A 3D07A 5HGAA 3IJ8A 3WLWD 8FABA 1JN6A 5KYWB 2W3ZA 3CK5A 4IQDA 2OL3A 2YPLD 3I02B 4Q8VA 3QXBA 3F85A 3OXSA 1AKJB 1E73M 4PRPE 4RKAA 5TQLA 4ODHH 1KNOA 1P4IL 5GS1C 3B8VA 2XKUA 4RNFA 3AMKA 3MA7B 3B0XA 1KY6A 3A3WA 2HJFA 1Z9LA 3MTXA 3O2VL 1MFBH 3L3HA 4AD4A 3BT0A 1UWYA 3EYSH 4E8GA 1KIQB 3G1FA 2UWFA 1P4LB 3IUHA 3T0BA 2PGEA 2VR2A 4BWUA 1O7SA 4YDMA 5D1QD 1R3WA 3NJ3A 3BQUB 1K6QH 2BIOA 3C75A 3P0VL 1PW3A 5SX4H 1VBUA 4C65A 1R0AH 8RUCA 2J43A 3UTSB 4R7JA 4KVPA 5K9QI 3UMTA 2WSDA 3AHTA 5C86A 1ULVA 4LPUA 1L3WA 4ZS6D 2VM8A 4D2JA 3P0GB 5G5IA 5EBMB 4FA8A 1NDVA 3Q13A 2NTFB 2J5LB 3DN5A 1MIEH 3QJZA 2JQXA 4AIZA 3BVTA 5D7EA 4X6EA 2VQTA 2NWSA 3LTSA 2WWDA 3SRFA 5J6HA 1FUNA 2ZUWA 3HGRA 2BVQB 4ZUSB 3E0LA 1UYWL 3IANA 5ECVA 4UTUA 1KB3A 1EBPA 5JPNA 2GI7A 3D4CA 1TR7A 3LQAH 5TPWL 4UTTA 2DQTL 1A6TB 4FQHB 1U4FA 1GTEA 3QUMH 4IOIA 3W1RA 3HC3L 1P1ZB 1CO1A 2JB5H 2A6NA 4PMEA 1F6PA 2YUZA 2CNCA 3APTA 4KWSA 3NP3A 1IAIH 4YXLH 2RQ8A 3MV7A 3VWKC 2CBTA 4G7FA 5DRNA 4A05A 2Q9OA 3F58L 4H88H 4IGBD 4CGUB 3IMUA 3IFPB 2ZONA 5F7UA 2AKZA 3WLQA 1A7OH 4WDIA 4US5D 1E5UI 2NVCA 3KDMB 1H09A 4C1NA 3BH9A 3UG4A 4IJRA 1NL0L 4UUJB 4A6YH 3HVNA 3FOLA 3QH3B 2K78A 1GPWA 3KBWA 3NG3A 3U1SL 4C1KA 3WFHA 4ERGA 1XR8B 5J9PA 5FYJH 4MFEA 3WSUA 2YGPA 4JAMA 3VXMA 3ULVD 3CG8A 2FFCA 3TA6A 4JFPA 3GNOA 1UENA 2R1XA 1OAZH 2EDMA 2ZNXA 3MGAA 2EPLX 2QPUA 4L0YA 3T2NH 4D1IA 1MQ8A 4UZSA 1SVDA 3GG0A 4GP8B 4F27A 3LHYA 3K5RA 3G0SA 3GS6A 4KW2A 5SWZE 1RY0A 5E2UL 3GMOB 4FMVA 5I1IH 2PLMA 5C0GB 3WL9B 1OK0A 4QLKA 2VXVH 5CAHA 3SDAC 1HH6A 3ZT5A 2IDSA 3F04A 3ULVL 1O5PA 3O9WC 2WUBL 1T2XA 2DV0A 1K8CA 4OW6A 4OGXL 3W0WD 3A67H 3JWOL 4B7LA 3CZSA 4YNYA 1TJXA 4UWMA 1SZFA 4J27A 5DJZB 3ZDYF 1LRQA 4JTRA 3A4DA 1HHJB 2Y69B 1XIJA 4MB5A 5T1LA 4Y16A 3S34H 2YSSA 5HYIA 4RFOH 4PWGA 3SCWA 2JCCF 2HFGL 1MCDA 4CLMA 3FCSB 1CFVL 1F8TL 1UG9A 3TFCA 3N1FC 1MEIA 1F3JA 2X4QB 1DDHB 4QO1A 1RZKH 5TE4H 3W82A 3NESA 4AYGA 4ZI8A 5HYJD 2XFXA 1P43A 4M8QA 1N9PA 1NCAH 3ECQA 3QUXC 3K4ZA 5B39B 4FR6A 5EU3A 4Q7BA 1AD9B 3K80A 1PLGH 1ID2A 2EE6A 1G4SA 1TIWA 4P5TA 5HHQA 1ONQA 1H15A 1NGWB 1ETJA 3ZTDC 1JRCA 2PCXA 1PV8A 4C7DA 3GJEB 2YXMA 4KH2A 3VWKD 4PJGA 2QZQA 4HS6B 4D8PA 5F7NC 4GZJA 3GINA 5LNVA 5KW9L 1W80A 4TUKH 3KM2A 3CH0A 4PRIA 3VJ6A 4MA3A 5GHWL 3UBXI 1R5VB 1EYEA 1S3TC 3DETC 1T22A 1UWXH 2CRIA 2NSMA 3URNA 3F4DA 3O6CA 4D9LL 4I18C 2JWYA 4OD2A 1UP2A 3GF8A 3C8DA 4HK0B 4J4PA 1GOIA 5CPMA 4TSBL 1JGLL 1G1YA 1IC5H 1IIKA 5DXWA 1OFEA 3H7BB 4NRYB 5B8CA 4OFYD 1T2QH 5I8CB 1EWDA 3STCA 3ZHDA 4JKPH 3WF2A 1QW7A 3DLQR 4LF3A 4JHBA 5D4IA 5ABAA 5AVHA 1PJWA 3QULA 4GYKA 3KPMB 2Z4QB 1E9ZB 4RAVB 3NRQA 3FQNB 5AB1A 1W3HA 3FIGA 1N55A 4FP8L 3BC9A 2GSMB 4P5SA 3QIWA 2W95A 1HU8A 2OA9A 3NAAH 4L4PA 3KR3L 3OAUL 1R19A 2WWKT 4NAMA 5D72L 1XYBA 4S1RL 4DX3A 4FS9A 4GG8A 4PUBH 2IDQA 3O05A 2FO8A 1M56B 2H6UA 2B39A 1MHEA 3OVUB 2HUHA 5HMSA 4WJXA 4LU5L 2RHGA 1KCBA 5EUOA 4ES9A 1BQLH 3TXVA 3UJIH 1E8XA 2OMNA 1FO0H 1E90A 2QSCL 3QAQA 4RDVA 2D3NA 4C55A 2OT0A 3QJHB 4K71C 5BROA 3WJLC 2HNHA 3PZNA 4GSQA 2EKSA 1EAPB 1QHZA 4AYFB 3NFPA 3EFDL 3WSQL 1AH0A 2ZRVA 4HLJA 5TPWH 5ICYB 4JDBA 3S3SA 3EH2A 4P5TD 3A64A 2YD6A 4F92B 4NZUL 1PEZA 3FUEA 4U6VL 4ZTXA 3IF1B 3ILQC 2XWJA 4ANKA 4R26L 1IMHC 1U8MA 1QSZA 3QHFH 3BG3A 1YXYA 4XRCA 5HQMA 4G3YH 4PS4H 2YDSA 2I26N 5DLCA 4H88L 3NFSL 4JFSA 1LE5A 1KA9F 1OE1A 3G5XA 1Z3GL 2W79A 2X1UA 3GQYA 3KS6A 1R8LA 2LT9A 4K68A 1XR9A 4PJCE 4E9TA 2OQJB 4MXWH 4NZ5A 1PZDA 1QSEE 4I77H 2HMIC 1Y6MR 4HD9A 4QXUL 4MKNA 4HUKB 2OZ4A 3PZTA 3HE6A 1LWIA 1CS6A 2Z4TA 4HZ7A 3X12B 1XH2A 1HFBA 2LE9A 1TJRA 2D24A 4JUSA 1XIWD 2WP3O 4MA3B 5JO5A 1THAA 4FJYA 4XP1H 3ZSSA 5EMKA 2PDPA 4ODVH 3NVQA 3SGGA 5IFHL 3B56A 1Q4NX 3MLSH 4NO3B 3UYIA 3SIMA 4L3CB 2IQDA 2WXGA 3GIPA 3RILA 1BSIA 4X5WB 3LGGA 1JTOA 4MMYB 4DGUA 2QQNL 1I31A 1KGJA 2VN7A 2WNXA 3WKPA 2J6EA 1RIHH 2WD0A 3L5WA 4OLVL 1OB0A 1IJ9A 2KLSA 4LVGA 1ZAGA 3QCVH 2N0KA 1U8HB 4NWTH 3ABKB 4BKLB 4BQCA 5J4MA 2F54D 2DZXA 1J4EA 3W2NA 2NX9A 1UB6B 1MCPL 2ZX9A 4RIRB 3DGGA 4FQLH 4YXKH 1I3GH 2FYYB 2Y7QA 4JFHE 5MP6H 3TESA 2I14A 3BJSA 4PJ7A 5F96H 2VLME 3B2MA 4JZOB 1YNKH 2WKGA 3ESNA 4XX5A 1AZBA 4HGMA 5D7IE 5LN4A 3WS3A 4DP8X 4FAAB 5KVFH 1SO4A 1Z32X 6XIMA 2Y3AA 5D2YA 2CDFB 3N1PC 3WBDA 1MEHA 4M5PA 5IVXF 3P0WA 1Y8BA 1RH9A 3S9IA 2PF8A 1W2PA 1ITBB 4FN0A 1T6WA 1RLBA 1B3IA 5CP3H 1WNOA 1Z9AA 1FIEA 3ULAB 3S2AA 4ETQB 1PDZA 3L54A 2D69A 2NQ5A 2NR6D 4R0LB 2QJDA 2CBQA 3FJ6A 5CSUA 3VXSD 3VGBA 4PJ5E 3RU6A 1XYAA 1F05A 4YHIA 3VC5A 2WY3B 4ANVA 5IESH 4HUMB 4W9KC 6ALDA 3QC6X 5KZCD 3HNSL 2O6DA 2IJ0C 1OCCB 2J1ZA 2TRYA 2DZPA 3N04A 3EBGA 1D5IL 2VYRE 4FFWC 5ISZE 4ZPTB 5JW4N 1XI3A 3RYMA 1UMLA 4HNTA 4HFWB 2YR3A 2E47A 5TD4A 1A80A 5I30L 5KBNC 1RK6A 4GRWF 3CVIL 5AFAA 1CICB 3BZ5A 4ORGA 2G41A 4IS6A 3CVCA 3D4YA 3NH7L 1I4NA 3H12A 3LKQA 4YDVA 5AZ0A 5BXRA 2IH3A 3FN9A 1FGNH 3LKSB 2UX7A 3SDOA 3RWGB 1IT9L 1SDDA 4HCIA 5GGUB 1AW1A 1NGZB 3UZJA 1PKMA 2J20A 4NZJA 4X9IA 4OFDA 2QJJA 3RWFA 3VI3B 5ECUA 5DFVD 1VFBB 3FO1A 1DKWA 4PFEA 5GGRY 1TQXA 5IHSA 1OFOA 4DLMA 1X3DA 1D9KC 2BJML 1E1EA 3MOAL 2C3HA 3QW3A 4JPWL 4JG0H 3DH7A 5BMWA 3IJYB 1KRAC 4WNQA 3IDNB 5KJ4A 1DWHM 4O2FA 4X6DA 1RUAL 2NX5B 5CLXA 3EDDA 3QC5X 4R83A 4TX9A 4Y4HC 4LLVB 3UWVA 4LAOA 1XGYL 1I8MB 3D1MC 3VB9A 2BHZA 2AABL 1MWAB 2OCCB 4J3OH 2XXMB 4A2FA 1LLOA 5C0QA 4NENA 5CSZB 3SQSA 4UTAL 4UT9A 1UWTA 3DTDA 5CC5A 4I6KA 4UCFA 4ETQA 2CKBA 5M94B 4KZEL 5T9CE 2AV1B 5AKVA 1OY0A 1MCHA 5IW3A 1ONWA 2GFTA 2XUCA 4YZFE 1TYRA 4QPEA 1YNYA 2WANA 5LBVA 1Z2KA 2CDFA 5ISZB 3SCNA 1Q6EA 1JRHH 1G9HA 2R1LA 4ZQTA 3LIZH 5HR7A 3FY1A 3ATFA 2PWFA 5JPMB 1UKQA 4P46A 3HPZA 2DDXA 1D2OA 1J8HD 3NGBC 3ZR6A 4YTRA 1UB6A 3IDMB 3TYGH 2PUQT 3ZDXF 3WMQA 2O56A 3AMGA 4FQIL 3QHTC 1F3EA 4M6OH 4MCMA 4L9LA 4DBUA 2AQRA 3N3MA 1A6UH 5CEWA 2ATPA 2Y7SA 2GFBA 3B3IB 4MCYA 1AGFA 2ZPKL 3X2QB 1TTAA 3W1PA 1G6CA 4JOMA 3GBEA 2QPXA 1FV1B 5B4MD 3CHSA 2Q5BA 4N2BA 1Q94B 1PCSA 3GEFA 4WD0A 1V7NL 2NCEA 5IKCA 1F5ZA 3WMLA 1JF1B 4V28A 4PMQA 3B2UC 3H3KA 4LKCA 3EH1A 25C8L 2R4RL 4GKSA 5ICXB 2GJLA 4JN1L 1AO7A 5CP7A 4DIXA 1V6VA 1LJYA 1YEGH 2YBTA 4K8GA 1U8PB 2FUQA 4YDKH 3QF0A 3GFZA 4P3DB 2Z6FA 1V3IA 1FDJA 2G95A 3BURA 2XM2A 1QUNA 1KJ2H 3M1OA 3ZTCC 4I48A 1C8YA 1GGOA 2VRQA 4CJ1A 5AW6B 4LE8A 3WHXB 3CWGA 3LEVL 4IF2A 2IH3B 4KXZI 4P8VA 3C5SA 4FIQA 5IHUL 1HJWA 2DWEA 4AX6A 2HLAB 4LKXA 4FHJA 1CR9H 3HZKA 1TX2A 4OFIA 4UV4H 5I19L 5JOPE 4AD3A 4DQWA 1ZD6A 3DZ1A 3A4FA 5CJBA 3L67A 4NQEB 4IBSA 4L2LA 1DPMA 3IV8A 1XWVA 2D7TL 4MD0B 4IEFA 4XPAH 5E1IA 4EI0A 1GQNA 2Z4GA 3K7UA 2ZSVA 3PG8A 3PPSA 5HHMD 3CFTA 5HNTA 5JQIB 3BMVA 4XPFL 1TENA 4G9DB 3CCHA 4FQXD 4WTWA 1NMBL 1ZHBB 1J0YA 5I73C 3OKNA 1TMHA 4GJ1A 4JM0A 5DMLA 1AZRA 1JXGA 2C3XA 3UTTD 4XO6A 2DB8A 4I0PD 3WFBL 2JKXA 2PNDA 4Z9KB 3WJLA 4Z7QF 3T0TA 5KAQF 4AEIH 3G0XA 1NPJA 3QIWB 2ZOKA 1CB7B 3LH9A 4MQXC 3VSUA 2KT6A 2JBMA 3PUOA 4L4VE 1OEPA 2CZVA 4KIRA 2DZUA 1JZJA 4XVTH 3MC0A 1IGSA 4AQOA 2WVUA 2YFNA 3IN0A 4ILSA 4JNMA 4HIIB 4B5VA 3F7LA 4NERA 3GVWA 5I06A 3S5OA 2XU2A 4UQ3B 2IPKA 3FQTA 3O0RH 2K7PA 4G6FB 4HIEA 2PR4L 1VFHA 2Q3AA 3MSYA 5DHMC 4CW1A 4K39A 3CAFA 5CJOL 3QPXH 3QXAA 3CV1A 3MJYA 5FUCC 1ODZA 3DJ9A 2GHZA 5L2KE 3R4IA 3VRIB 2ED9A 2YA1A 1SYVA 3GXTA 5D7SL 1OAYL 4LARL 3AQXA 3NPZB 4A63A 4IIGA 4PB3A 2WLZA 3APNA 4MQ7B 4UB9A 1SGKA 3WUEA 1NEPA 3GSWB 3ARBD 4HT1H 4PGBB 5HD8C 4HS6A 3OIHA 1RI8A 2NY5H 1OD9A 3ZHFA 3QGAC 3Q43A 3ORWA 3PQYA 5D71H 1PIGA 5AOJA 3LDBB 2O9PA 4JHZA 5HGHA 2NXGA 2F18A 1GVOA 5HPOA 1KTBA 3B4NA 3V10A 4GBUA 5AVWB 1UP0A 2CU0A 4TVPL 4PBWD 5KG9B 4FXKC 1FZJB 4MVAA 4EF3A 4HPXA 3BUQA 1VCFA 4JN8A 2P5EA 1VADB 4MRBA 2HBVA 1RJRA 4MLJA 3VXOA 1D9KA 4GRWH 4A6YB 1QR1A 1R5WB 4LHUA 4LBAA 5JMRA 2X0YA 3M8OH 3PULA 4OKVA 5DQDH 4AQ8C 1AMKA 1EEZA 3W6MA 1TEGA 2RFGA 4ZODA 1PS9A 5BXTA 1Q6LA 3LNPA 3SE9L 4WK9A 1II4E 2GCYA 4WWID 4MMZA 3PM6A 2QFPA 1F97A 2VMCA 4Q74A 4FPSA 4LBRA 5AD0A 4WGXA 5EUKA 1OTUC 2DORA 3AZRA 1W91A 2DM2A 1GVEA 3MO7A 4FX5A 1EAQA 3WL9A 1J9YA 3C0QA 4PJ9D 3UC0L 2FBJH 2Z1SA 3JZUA 4KKZA 4IMGA 1D7BA 1JAKA 1JUFA 2MIZA 2ZWSA 3V5CA 3DOPA 2Y2YA 2A85A 4DSYA 3BAKA 3N42F 4GJTB 3AIBA 4JPIB 5JORA 1WKFA 4GRLB 3BIKB 3F5WB 5HY9A 5D96C 3KBVA 3Q58A 4J2MA 4AIXA 1XL4A 1E4HA 1M9SA 5GPRA 1LOSA 3PY9A 4EUPH 2FX7L 2KLRA 2GGHA 2NMSA 4PY7A 2TRSA 1JDAA 1I1YA 1MAKA 3S1XA 2D0GA 3DYOA 1VGKB 1UG6A 2PBGA 2V5BA 2G4JA 2WMFA 4UQBA 2AXGA 5PTDA 1AP2A 1Z1WA 5E2UH 1NWUA 5HVHB 2ZYFA 5D37A 4M7SA 1HH9A 1T0PB 2NYYD 3QVAA 3RTQD 5IEKB 1YNPA 5JH2A 1MH5B 5I6MA 3UJSA 9XIAA 1AR1B 1FHUA 1KLZA 2AK1H 1IE5A 3UZVB 1Q0YH 3CD4A 4TL5A 3M88A 3PHQA 3W2DH 1Z9NA 1W31A 1LWJA 3G8EA 3U46B 3W11D 3ARFA 3DHUA 4HK0A 2IPJA 2XGZA 3SY8A 2J6WA 3B8TA 2G3ZA 5IT2H 1KFCA 4PH6A 4HLEA 3ZE0E 3MY9A 3GC5A 3GHBH 3H24A 3L0KA 3TW9A 4DJDA 4KKAD 3RZCA 3VSQA 1AGDA 4NUGL 4CN6A 4WDWA 1OC7A 5DMNA 4Z1AA 4JJHA 2A6JB 1LQAA 4FERA 4PJGB 4Z0BH 1HHKA 3EWWA 4GNVA 4OB5L 2DZBA 2X9YA 1X4YA 1MCCA 4LGRB 2IMRA 4F0SA 2VXUH 1GHFL 1GS8A 2BFVL 2LABA 2ORBL 3FAXA 4P2RE 5D2LA 4E42A 3C61A 5G4HC 5ABTA 3N6YA 1X5KA 5I23A 5CGQA 3MPGA 5DCCA 2JJUA 1MCOH 1TWWA 4GH1A 4BI6A 3B7RL 4RISH 4TV3A 2M8XA 5ABDE 3LS4L 1XWYA 2X4TB 2QJNA 3SE4A 5BVPH 1GQJA 3M1CA 1YTEA 3BO8B 1DVSA 4NQDB 3JWDL 5CN1A 1NCWH 3P2TA 1ZV2A 3IFNL 1K4CB 2YSSB 5GHWH 2ZC8A 2FJSA 1PG7W 2FGLA 4JFFD 2WMPA 4WCJA 3B9KA 4Q6IA 1FL5B 1QKZL 4FNLL 4HH9A 1DWJM 4DWDA 3WMPA 1I6NA 3VCRA 1M68A 3WLOA 1QFHA 4R7NB 4U7KA 4MNQD 3WK0A 1FWJC 4U31A 3BKJL 3KYMB 4OCRH 5CIPH 2IXQA 1OAYH 2ZNWA 5LIUX 3ATBA 1E4KA 2YEVB 3KOWA 3UZWA 2VDNB 3MCYA 1UD4A 1ZGLB 3M07A 5CGYD 4WO4D 5BRZE 3EWXA 5DSCA 4YR6B 1WQ5A 3HG2A 3LMZA 2G0WA 4GXWA 2YKKA 2Z0UA 4GVFA 1MG3C 4JEGB 1RIVL 4K8RH 2ATPB 5LCVH 3LPPA 3LS9A 3HZVA 3C09B 4YUEL 2WINB 3A47A 2BIPA 2ICWA 1F3DH 3M17B 3H26A 1B3VA 1EHKB 3HAEA 1OCWH 1YE4A 2BOCB 3Q2NA 1NMCB 2L3BA 4ACPA 2BO0A 4QCFA 2XV2A 3ULVF 1EJ8A 1FFNA 2E76C 4JCWA 2XG9A 4IUGA 4C5ZA 2GOUA 3EX6A 4FE9A 1KXTB 3BYTA 4PRNA 5EA0L 3ZZSA 3JYBA 4UOW0 4XTRD 4GAYA 4F58H 2OK0L 1Y65A 4A3QA 2RH0A 3X3GH 1TZAA 1YMYA 4FKHA 3NSJA 3WFZA 3T8XB 4K6AA 4BKLA 1A4MA 4OKDA 3LOTA 4IGMA 2CDGA 2VDMB 3FT4A 4F7CA 4PYSA 4POYA 2C1GA 4XP5L 1HOCB 3VACA 3X3FL 1WX0A 2BDNH 4U6VH 4O16A 1KTLA 4FEMA 3ESUF 3SD2A 5DJAB 1HHKB 2YD4A 3ECWA 1IJNA 1UD2A 3IIOA 3IIXA 1L6FA 2BNRB 3W7PA 3ZDZB 1AH1A 2AXJA 4QBXA 3GJFH 3ZWTA 5L0QB 4DZIA 5TDNA 2LVCA 2G5RA 2DQJH 3LJ3A 4I9WE 2CXGA 1UYQA 3BLOA 4PULA 4LPXA 1F58H 4OI9A 5FUCE 3ARGA 1Y0EA 2NQHA 2WZIA 3V6OC 4G8FA 3UESA 3BAYA 3K0YA 2YAFA 4XPHL 4FFTA 4ZMWA 1DBML 3P02A 1HZYA 1R3YA 2Y4SA 3ZFHA 1TJMA 3ETBF 4YSTA 1VFBA 3FO1B 1X44A 1D5MB 3W9DA 4ZOCA 4ATTA 2YGNA 1CG9B 3AG1B 4NSKB 5F3HB 4HYVA 4QITA 4FFWD 4XO7A 3BQUA 1Z9SA 4NX5A 5CINL 2NNRA 3RN6A 4PBXA 3LRKA 4PY7B 5F7EL 4F93B 4WI6A 4QY8A 1JERA 1RQHA 3VUPA 1GH7A 2ZXEB 4O4YL 5IQ7L 3WLNA 3WLSA 2PSNA 2Q1EA 1AACA 1DIDA 2GBTA 3QFJA 2N56A 4OCNC 1HYSC 2N01B 1LP9A 2ADIB 2PR9A 2RDWA 2VDHA 3F5WA 2FSDA 4KKCD 3IDYB 1R3LB 3TBCA 1RV6X 2LLNA 3M6DA 2NLYA 4XC3L 3ERXA 3NZHH 4FFZH 3WJXA 2PTTB 1QK0A 1AFVH 2RHEA 1KM6A 3RNKB 1TUFA 5IMOB 5B7FA 2IAAC 3FO9B 3EDFA 3MU3A 4R2GB 5HGAB 3LTYA 2XDFA 1JHTA 2P45B 4NUGH 2R2BB 3DXAA 1A8JH 1MEXH 2NXIA 1YECH 3PB0A 4HKXA 4JY6B 1ANUA 1S7XA 2QCLA 4YHPB 3OVPA 2LW3A 2HV5A 3F6JA 1M05B 1XF4A 3ABMB 3RUGF 1L5GB 5CNHA 5DD0L 5KANG 2H41A 2D7QA 2HQAA 2WW5A 4BQ9A 3NCOA 4DERA 2EIMB 4TULL 5JXEC 2ALWA 4X9HA 1XD1A 4RE4A 4MVBD 2E8YA 3VXSA 5AYYA 3B05A 1ZJBA 1WAPA 1UJ3C 1MZHA 3WFEL 4UQDA 2WN2A 4RV3A 3GAKA 4DGYL 1QOQA 2VEPA 4PJCB 1D6EA 5T33H 5F4XA 3TFKC 4W9HC 3JBG7 4PY8I 5KG9A 3GFYA 5ABGA 1BVOA 3BXWA 1NC2D 1OP3K 1C8QA 4R7XA 1IQWH 1G1OA 4Y8AA 5ENWB 1A5OC 2PTXA 1R5VA 1RLDA 2JEPA 5LVEA 5E9DA 3RP1A 3KNBB 2WHJA 4FEZA 4QXIA 3NH7H 4PJAB 4U4BA 4AYID 2HJKA 3VXQB 2JKLA 5HHOE 1P5VA 4YTQA 4JO4L 4HPGA 3WLTA 4YFLI 2WSPA 1SMOA 2ITFA 2B0SL 4P23B 2PXYA 1FFPB 1UUSA 4UILH 1NSJA 2Y5SA 3EBVA 2FGZA 1IU1A 4UUIA 3DO7B 2J47A 4PJ8B 1G4TA 3Q1SL 3ZLGA 4DHGA 2EZ0C 3FCBA 4N2GA 2B4CC 4PTTA 4ILDA 3MRFB 4JFOA 4KZDH 3EPMA 3MANA 4FYQA 2MOQA 1CBJA 1MCEA 1SFDA 3T4WA 3W26A 1DN0A 1YPFA 3SUWA 2GJ6A 1A6PA 4G8GB 1JZDC 1MAJA 2ZZ6A 5T3ZH 5HOSA 2ZF9A 2BVDA 2HZHA 3C5QA 4IDJH 4MDOA 2SODB 2IC2A 3OKYA 3PF2A 4NRSA 2DQMA 5I8OL 3EYUH 3BN9C 3SKUD 2AAMA 4HMEA 3PBYA 3OG6B 3E8UL 1XGPB 1DFBL 2ILLA 4KO5A 2ZXGA 1WP6A 3NA9L 2WKLA 3RWEA 4NN7B 3MBFA 1TT6A 4K3DH 3O11A 5CCKL 2IKHA 4AYFA 3QFGA 2ZFAA 1HH6B 4S1SH 4WTZA 4XNZC 3L7FA 1AE6L 2PPCA 4WWNA 3MFFA 3EOOA 3LMJH 4ERSL 5ETUB 5INDA 2UY2A 4GW4A 5DYOA 4LIQH 2ZXAA 2F7FA 4DBWA 4KFZC 3VKBA 3SQBA 4K8RC 2CPCA 1Q2SA 5E1AB 2VW4A 2GAZA 3POHA 3GXDA 4RMQA 1QT1A 2VX7A 2F19H 2EIZA 2JKPA 1ZSHA 1TYEB 3HZKB 3LN9A 3QUZD 4Z3HA 1D9EA 5C2CA 5IB5A 3VFPB 2DY3A 4TMPA 1SLWA 2ZXBA 2V9RA 1MFEH 1B2WH 5DHEA 4C5YA 3H2CA 2VR3A 3GBNH 1WCQA 5EU6E 4HWUA 4TX8A 4DUWA 2OMTB 3MRIB 3RB7A 4WKHA 5GISL 3TSBA 6TIMA 5J0BA 3KXFB 2BVWA 3P80A 3PGCA 4DAIA 1IE7C 2E9LA 1IFHL 2GJ6D 4H5SA 1HX0A 5IB5B 1NWRA 4IJ3B 3B7YA 4PA8A 3QV8A 2Q7AA 5DD3L 1SYTA 4HIHB 4KKNA 3GC2A 4JFVA 1BRLA 4GZ7A 5LA2A 1UUQA 1XGTA 4XNBA 2V67A 5D1XC 4AK1A 5CCHE 1IYXA 5EBGA 5FIPA 4S39A 2C15A 3HGSA 4PRIB 3D69B 3VJ6B 5J6GB 1T5AA 2W1NA 4KETA 1U8OB 3SJ3A 5IFJA 3KPNA 3ZE2B 3NPXA 2W0KA 4XXDB 3HE6C 2IBZX 4IRZA 4NQXA 4QF1B 4Y4FA 1EHAA 1PBYA 1IT0A 4OD3H 3UY8A 2GI0A 2XY2A 4ZPVB 3VD5A 4YQXL 4Q0XL 3B3IA 4MCYB 4N2LA 1J0KA 4OF8A 4DKEL 4QE1A 3HI1B 3FRUA 1A6AB 4KQ4H 2PN5A 3IDJA 1KULA 4Z7WA 1NUFA 4U3CA 2YMXL 5GJTH 1R0MA 5J13C 3EGJA 1XB8A 4K0OA 4HQQL 1PKYA 1HCFX 4FX8A 3CN0A 3QMRA 1UKPA 4AZ5A 3F1QA 1INDH 1U8KB 3MRDA 5F0LB 3GH7A 1S39A 1G9EA 4KHXL 1DDHA 1N3NA 1IKFH 1B4JH 4FNRA 1ITXA 4NU7A 5HHXL 5AOMA 4WDXA 2P46B 3EYFB 3TH2T 4GD0A 3LHVA 2D2HA 2BSTA 3QUXB 4I89A 2CCRA 3EDKA 1E9OA 4Y16B 2YCKX 1E1CA 3QXDA 3D06A 1LQ2A 3RWHB 1XH3B 1WOAA 5F2IA 3F05A 5EMMA 2C5DC 4KROB 4MXQC 3RUGE 3WQOA 3D39D 3N2JA 1MJ8H 5H2BA 3RURA 2GVEA 3QV9A 3GB7B 3UGRA 1N8ZB 4BA0A 5D4HA 1PG7L 4GNJA 3BGAA 1C5DB 1YAZA 2YDQA 2LOEA 4NXSA 1MCSA 3OKKA 5EBWA 4F8LA 5EEUA 3PZVA 1UJ3B 3JV0A 4IX2A 5CPNA 1PZSA 3CFEB 4B41A 1ZCCA 3MLZL 2GBVA 5D09A 4GIAA 1P9MC 1L9SA 1WHPA 5BZZA 4LUSA 3WE6A 4PG9B 5B7EA 4JQ2A 5DJ0A 4UTJA 5BZWA 5DN1A 5AC4A 4ACYA 1EFQA 3FSAA 15C8L 3H2AA 1OSZA 5XIAA 2FLMA 3O2LA 4PUEA 5FF6B 3P4OB 3PPFA 3C2AH 4AEHH 4KRZA 3UTPE 3VNMA 2NY2D 5DS8B 3S3GA 3QAZB 5MHSE 1W3IA 1IXOA 4ROQA 4C1NB 4X7DC 2EXSA 4TLSA 3TLLA 1BZQK 1TVPA 3SCPA 5EWIH 3W2MA 4C6BA 4KEZA 2CUAA 2DU2A 5DZNA 1ONXA 1UWRA 2FO4B 5G2NA 4KI5E 4PJXE 2PGRA 2DMHA 2IANE 2YPKB 2VRAA 3CH1A 3CDZA 3K2UL 4YEFA 3QEUA 4FXFA 3S2JA 3VC6A 5C7VA 1FSKB 4JFFA 3QI9B 3TJHD 3QJXA 3BPLC 3ITLA 3CIVA 4K55A 4ZRGA 2DL2A 3JWNG 4RH4A 1ZVSA 3V2AR 1FA4A 3G3MA 2CGRH 3IPBA 2X1XR 3GSRB 2XETA 3F58H 1QACA 4K94H 3UF9A 1I1FB 4BRVA 4Q9QL 2VEKA 4LL9A 3BTNA 2YLLA 3KBJA 1VZGA 1E5JA 4JR5A 3H6AA 2D2GA 2BMKA 4NO0D 4UQIM 1SGJA 1TTJA 4KWOA 2F58L 2WO5A 4DKFL 4WY7L 4B97A 1Q90A 3NL5A 2FAUA 3NGFA 4C47A 1KXQA 3G6DH 4ZOEA 4FQ2L 3BOXA 4PREA 3L5LA 4YDIH 1PNDA 2GQHA 1HI6A 3GLAA 3HE7B 1N4XL 3LH2H 4KK5C 4H40A 3UACA 5ADOL 5HGBA 2YLAA 3E2HC 5EN3A 5BV7C 3L2MA 5TFSL 1IKOP 4M8UA 3W9DB 1HILB 1GGIH 5HWNA 1L9QA 1UM5L 5DD1H 4IPPA 5KZCB 5GS2H 3EXTA 1KR1A 3KPLA 1HKJA 2WMJA 1BIIB 2WLKA 3CDGA 3H4WA 4CC0A 1YA5A 5JNYA 1ACXA 2DBJA 4J3BA 1A5MC 1A2YB 1MLCB 4RCAA 4UTTC 3L1EA 4A7TA 4NKCA 3RVUD 3EJJX 5CN3A 1EWEA 2P10A 3MCNA 4UR7A 3D2TA 4OLXH 1TCRA 4G43A 1JPMA 4P8UA 3CQPA 2BZNA 4WNJA 3BLDA 2PZ0A 4PMUA 5G5DA 2OR7A 4NT6A 5CMAB 2XV6B 1VYPX 2BIMA 3FUNA 3TPUA 5C7XH 3P4MB 1QVOA 3KVMA 2XPZA 4X5WA 3DYPA 1K03A 5A2BA 4W8BA 2K3TA 3G6JF 3SOBL 4ABQA 1W1IE 1KJVB 3B0YA 2FLBT 1RP9A 2FWOA 5JO5B 1OWQA 3PHOB 4ATDA 2CDGB 5D4JA 3CZLA 4DPAX 3ESMA 4LU0A 4DJMA 3LNDA 3DK2A 4FRWA 3I50L 3FXGA 4KXBA 3BWSA 4AZCA 1QSFA 3P9MA 1P7QB 5DURD 1WA1X 3FA4A 4Q97A 4J40A 2ZXDA 3LTVA 1CECA 3ONCA 3NDYA 1KCVL 4XMXA 1DLHB 4UCGA 2EDKA 2ADFH 2OMZB 4RDBA 3QYNA 4Q8WA 5E51A 3LD8C 3IDGB 5K9JH 2A0NA 4G82A 4N8VG 5T3XE 1V54B 1FHLA 4XKYA 3F6LA 3QKZA 5I2UA 4C56E 3BDYH 4P5KA 5SX4I 5DMKB 3H42H 4JRXD 1XH0A 1RZPA 4HB7A 3TNOA 3CXHK 2YW3A 1S5IL 2B1OA 5A6BD 1UURA 1LQBC 4NQEE 1E9QB 2HT2C 1MQPA 2IADA 4M1DL 4YHNA 1WE5A 1DJWA 2EKSB 2P5PA 2QDVA 4HHMA 4C83B 3CHEA 1UW9A 1FWNA 4QEEA 2MKLC 4URKA 3O8XD 1VIWA 1BJMA 2EXWD 2X9ZA 4IDLA 5E6ID 5FAGA 3T05A 4E2DA 2ZCLH 4N6EA 5G1YA 4OJEH 1QTSA 5GGSA 3DG7A 3OR6B 4QTIH 2AQTA 4X8CA 2Y70A 1QZNA 1FL5A 4GYPA 4F57L 1LBFA 4W7VA 1OZQA 2CO7A 4Q33A 3PPHA 1CU4L 4P2QA 3UJEA 4GMSH 1KBGL 2O5XH 3ZHNA 4AHPA 2BSTB 3QUXA 4CU7A 1HDMB 1L9RA 1SXNA 2WXNA 5BV7L 1G4EA 1DE6A 4JREB 4I8YA 2J8UA 4Y1AB 2VQUA 2WZAA 2ZCHL 1IGCL 1XD0A 2GPZA 3QA3A 4BFIB 3MKGA 3EOTL 5ALCH 3TYBA 3REQA 5C0AB 1GRWA 2B16A 4XG1A 2FTPA 5FACA 2PMQA 4KRMB 1W5NA 4WWOA 1TJGH 4KJYA 2FT6A 1HCVA 5EIVA 3CT7A 3KZSA 2RGMA 3QGVA 1OGSA 3M1ZA 5F9DC 4IBWA 1AHMA 4S3EA 4NKIL 5J12B 1UUMA 3NOEA 2BMBA 4ODTL 3C3NA 2R69L 4LCWE 1FH7A 2HG5B 4HSHA 1PFCA 2V9DA 3EWUA 3TR2A 1ZEAL 4H20H 5EFDA 4G7YL 1FLRL 2VZSA 3B6SA 2VUOA 5IGXL 4UMGA 4TQEH 3NJIA 4JKWA 3EGXB 4DEPB 4L5FE 3HQNA 1SHMA 3MRLA 4OZGB 5DUBA 2ZRYA 1IUZA 3MRLB 2VEIA 2ACSA 1RJYA 1ZHKB 2ACQA 2D4FA 3APDA 3ZOAA 2WQUA 2B81A 1T5WA 1ORSB 2L04A 1NDWA 1QOXA 1S7TA 2ZZ3A 4PJ9A 3LMYA 1FFRA 2W07B 3Q2VA 4HYTB 2HVNA 5HJDA 1TFVA 1GYVA 4LVEA 4OF3A 5MEQA 1NAMA 1YDPB 1X5ZA 1D2PA 4JFEB 3AHVA 5DK2B 4ANXA 1N5YL 4Z1DA 5GS3A 2XH4A 3UW6A 4HBCH 3V55A 5LSMA 2WVSA 4Q8TA 3EO9H 3O4LD 1ZGLM 3IV3A 4L4JA 3W38A 1FNLA 4Q8OA 3MJ9H 1UM5H 5DD1L 5FKPB 4QJ5B 2E6JA 3BWUC 4MZRA 3KJ4C 1N70A 3FONA 3G1HA 4KMQA 3FOKA 4RNIA 2HRGA 2JGQA 1IE4A 4W84A 3QH2A 5GZNA 5DCBA 4NKOB 4EXAA 4GRLA 1SJXA 4NSBA 1E0OB 4C59B 4L4VA 1ME9A 3MAWA 3QR3A 2HK0A 1DBMH 4X6FB 3SUVA 5DVKA 1A4CA 2KZ1B 4P7NA 1ZSDB 3D0VB 3C86A 1EZSA 1ZSDA 3MBXL 5B80A 3GMOA 2EXOA 2UY3A 4U4MA 3RITA 3V0IA 1QNVA 1V77A 4CD8A 3SOBH 2MMXA 4DQOH 3N34A 3C0JA 1U83A 4XZLX 1P48A 2G5BB 3QG7L 2PDBA 2Y8UA 4L8BA 1A02N 1BBJA 2X4PB 1MXGA 3RFZB 4EVZA 4QE5A 1A0QL 4ZS6C 2G4GA 3S3JA 3V0EA 3EJCA 1RUSA 1OPGL 5D6DA 1EX0A 4MJIA 1CFBA 2A74C 1RMFL 1QQDB 2ZCGA 4LLMB 5K9KA 1BMWA 4Q2ZB 2YPVA 2P5EB 1U2CA 4M5ZH 5SV3A 4EOWL 1VFMA 3BDKA 2EDLA 2IFFL 1YMHA 3LQAC 3NQCA 2XV0A 4KKPA 1E72M 4HEPA 3QEZA 3L3GA 5D96B 2OMUA 4ZUWB 3ULSB 2DQGH 3LIZA 3MODH 4LL1A 1HQRB 3O4LA 4XD6A 4R4FH 1D5ZB 1UXSA 5IG7B 2Z27A 1JZ2A 3HNTH 4PTVA 3GMLB 1E4NA 5L2KB 3QDJB 1T83C 3SYCA 2FWOB 4HJFA 3CSYB 2A3HA 3VFCA 6XIAA 1NGYA 4PN2A 3P6LA 3FHAA 3K8LA 3UYRL 5CR8A 4GW1B 1PCWA 2Y5JA 4KCUA 1KCSH 5JPNB 4IRZH 3MYJA 5EBLA 3QOKA 4LRTA 2UY7B 3HJEA 4IGBC 2VN5A 4NASA 2FH6A 4GMTH 3U7WH 4JO2H 4GSRA 4YTTA 1DQUA 2W81C 3KS0H 3H0TB 5FKAB 1GOKA 2N1KA 3L3OB 3B6SB 2TAAA 4JKNA 2H32H 3MSRA 4YVPA 3QIWC 5DHYB 4EN3D 3JR2A 4U1JB 2Z92A 4JY5H 1UOVA 1KBKA 2OMWB 5KYXB 4U3XA 1E4IA 1HXYB 2AEQH 4AITA 4JJOA 1K2DB 4WJG3 4UQ3A 1NCDH 2WYTA 3VE0B 3T4YA 3VWJA 3HS0B 3J2PA 3MCKB 5I7GA 4MHHG 3EOTH 3N44B 4LCCA 5ALCL 5F7DA 2J7BA 3QHOA 4U1KB 4LLDA 1SRDA 2XI9A 4M7LH 4V33A 3THDA 1SXCA 4LEXL 3V6OA 4O00A 5CZTA 1F1AA 3L4CA 5DEZA 1GT8A 5KANI 2JJSA 1JGMA 1JL8A 2VZ1A 3MRCB 4L37B 2CO7B 4U3HA 2B7NA 4IL0A 3CZ8A 1R33A 3IS1X 2GTWB 1LD9A 2WZMA 1ME8A 4ERIA 2BP0A 2RD0A 5HP5A 1JZ6A 5ISZD 1FLRH 3GK8H 3MXVL 5I76B 1NY1A 3NOYA 4MYXA 4EANA 1IIIA 4R0LC 1AZZC 43CAB 1OGTB 4GQRA 3GG8A 2Y7MA 4Y9PA 3RDTA 1FWRA 1J12A 3S37H 4IJTA 3BKMH 5IMKA 1U8NA 2FDMA 1XIFA 5CEZL 4M1GH 2QUUA 4NJ9L 1E4XH 4LX4A 3E3QE 3T04D 4NY2A 2ZXQA 1DWIM 3O16A 4YHMH 1XBXA 1RBOB 3AQYA 4Z7UF 1ETA1 3KXFE 1KM5A 4K3DL 5CCKH 3F5KA 4K2UH 4WR3A 1NSNH 1UB5A 3GTFA 1FSKC 1I9IL 1UC5A 4TLUA 1OEZW 7TIMA 3BPLB 3TEVA 1D5XA 3KLSA 4XN5A 3VXPA 3TCSA 1N5AA 5E9DE 3VM7A 4ZAKD 1TE1A 4L1WA 3NURA 3R5EA 4HU4A 5FYJL 3T7VA 1M7DB 4MDJA 2F2KA 2QDEA 4LBSA 4WEEA 4X99B 1KV8A 4BGDA 1QI3A 1LROA 2ICEB 3D05A 1B2WL 4JXCA 2GSJA 4KMTH 1SUHA 4N2EA 1EMTH 3PWNB 5AYQA 1NLBH 1KQZA 2R91A 4XP9L 3W29A 2Z1PA 1KENH 4W8LA 1O94A 3IU3A 3EJYD 4PRAB 3VX0A 4ZK8A 1WFMA 5I16B 1NF7A 4RNHA 4ERAA 4AW4A 1TFPA 3T9PA 2BS71 1E1CB 3BGMA 4MDJB 3SW6A 1K3IA 5C2XA 4Y5VC 4GFSA 5KVFE 3NN8B 5GRJH 4YK4C 3ARSA 3O2DH 3PZOA 1VENA 1FWBC 3RXZA 4R90H 1U8KA 3EH3B 1IC7L 4U05A 3AI0A 5D6DC 1WIOA 2GT9B 3TONA 5LA0A 2X6AA 1E6XM 5FOBB 3MHUA 1FFTB 1V10A 4BWTA 4X9SA 3ZMRA 3B2VH 1MLBB 2F53A 5EZOH 3PZQA 3QUHA 1KZQA 3R4RA 4GXVL 1ENUA 1JPKA 2L0DA 2CCVA 1F3TA 2HN7B 4BGLA 4ADUA 1A3HA 3UR8A 4ZQRA 4R4ND 3HMWH 3W7DA 2CHWA 2I07A 4IHOA 3TEUA 4MD4B 4P57A 3O6LH 1F6FB 2IXQB 4KBXA 3QEQA 5U7SA 3ILQD 4IMLA 3REWB 3MZ2A 2XIDA 1KCSL 3A6CH 2XG5A 2VDKB 3IDNA 3MRPB 4BE5A 4GC3A 1FNGB 4OLEA 2E9MA 5F0PB 4JVWA 3DVGB 2PR4H 3A9BA 1A9BB 1ZA6B 1B3YA 3DESA 4L8SA 3QEUB 5HNUA 4F0KA 2HJPA 3ASWA 3CVBA 3THML 3VI3A 1P7KA 2QYGA 5FYKH 3QUGA 3WN5C 4WIWA 4JBRA 4F1ZA 3ESOA 2X4TA 5CILL 2DQFB 5D7SH 1XFCA 2I16A 2PCYA 3R1GL 3SBWA 1B4LA 3LKSA 5DQJA 3VFTB 1EJXC 4ZW7A 2AK4E 1T1YA 2OYLA 1P0SE 2DLFL 5A7EA 1OABA 4JIEA 5D6CB 4IBYA 1YYML 2GZXA 3VD3A 3KWSA 1CLYL 1X4ZA 4HCRH 4UM8A 1R30A 1RZ8A 5HDBF 4Z6AT 3NO5A 4QHNA 1S3RA 1UZ6F 2ESVD 5H94B 4B27A 2WBXA 3CHFA 2LTQB 3UJJL 4KPHL 2NZ9C 2NZ1A 3A0OA 3QWRA 2DFAA 1F4XH 1TU2A 1D5RA 3L3OA 3RU8X 1KG0A 1B9KA 2A9DA 1JWMA 3VGDA 4HZLB 3BISA 3PFQA 2BGNE 2WK2A 1W8EA 4IT1A 4QGYA 3H3BC 2ATMA 3EX4A 2VP8A 3VFUB 4U1GC 1F6KA 3Q8FA 1REIA 1WZKA 5B38B 4MUZA 2P3ZA 5AOZA 4KRPB 4LBUA 5EIIA 1P5UC 3GSNL 2NNCA 1EX5A 4ZO7A 4TVPD 3CNYA 4FJ6A 3H2EA 3CSTA 3P4NB 3HG1A 2UUDK 3IMTA 3WGUB 1BF6A 2AEPH 3UXKA 2HKHL 2DEXX 3FF7A 3EYFA 4GABA 1E0TA 4F40A 3QHFL 3QS3A 4DGIH 1AJ2A 5AHEA 2BZDA 2FJKA 2QMKA 2XOTA 5PCYA 2PA6A 4IIHA 1WZ1H 2I7OA 5LGYA 4MJIE 3PPCA 2P80A 3U2SA 3GRIA 3SGZA 4UQ9A 1A1NA 1Q6DA 4WF7A 4GSDH 3BPCB 4HEPG 4XMPH 1CURA 3R94A 4E41A 4RDYA 4F4RA 2QSVA 5AW7B 5L7XL 1BZ8A 4HS3B 1N4XH 5ADOH 4MMYA 1T83A 3MX0A 4R3UA 2DQIH 4FG4A 3U2OA 1S3KL 5IFHH 3D0VA 4JY4A 4FF9A 1FZOA 1GYLA 2IV8A 1GIGH 4OGAD 4QMEA 4WWKB 1KBJA 3I2CH 3LV5A 2AV7B 2VLRD 1FX6A 2MNRA 1HHHA 1XIHA 3SY0B 3M7WA 1XKJA 5CEZE 2HT2D 3H9ZA 4HJ0D 1QRQA 1X1OA 3E3HA 2CMRH 3KHDA 3R18A 2BNUB 5LWYH 2MJWA 1L9NA 2AJVH 4NP4L 5T5FA 1XLDA 1Q0EA 1U3HB 2XU9A 4Q52A 2CBUA 2QJIA 3KLLA 1XYLA 4TXEA 5JYLA 3W24A 3GLDA 3R19A 2SEBA 4NFDA 1FDZA 1HEZA 5HYFA 3LH8A 3MLRL 2OPCA 4BHUA 4D0DB 2CGYA 4GXUM 5CBAA 1WJ3A 3CYVA 4LYRA 5AHLA 2PLKA 4FXGC 4R9OA 3C60C 4IJBA 4J35A 2ICCA 1TTQA 4RCXA 5IW6A 3VFVA 2VE6A 5EU9A 1TPXB 1NFDF 3V4UH 3GTXA 3ES6A 3WBXA 4A38A 5I1EH 3ZE1B 5AOKA 1CJYA 5E5MA 2VC6A 4GLEA 2QPFA 4RZ5A 3BP5A 2NY1D 3IUDA 3MR9A 1UH2A 3RNKA 3QQWA 4KTYA 3VFLA 3DBSA 5D9SB 2MKWA 3NEVA 4CU8A 4JFFE 5CUSH 1JCJA 4JFEE 3HV8A 5F8QC 1CDYA 1CGTA 4G9FA 4WX2A 2WIMA 4LSPH 5DT5A 4F7MA 3VA2C 1YUHB 1JVKA 5JBFA 4N8PA 3MBEC 5A2IH 4YCOA 1GVRA 4Y9MA 1WAAA 1ZCRA 2HRPH 2JELL 4HJ1A 4EF8A 4CU6A 1UYWH 3TBTA 4Z7NB 3PWPB 4P5TC 1Q6OA