2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
4MY8A 3Q94A 4HN4A 1O5KA 5MHBA 4N6FA 1AK5A 2G97A 3I7QA 3S5YA 3W87A 2YX0A 3TAOA 3TFXA 1MO0A 2GJNA 3NVTA 3HO8A 3PC0A 3GAYA 3LLDA 2YCEA 1TREA 1AW1A 2GVJA 4X22A 4BWLA 2VELA 2BWGA 3P74A 5FF7A 5CPNA 1A50A 3NEVA 1QPOA 5LGZA 3P60A 3PG8A 3QMSA 4RKAA 5U7SA 4M6PA 4Y8FA 4KWVA 4NX5A 1KLZA 1L6WA 4ZQOA 1XUZA 2WNQA 1FCUA 3GXPA 2ZZ3A 2ZQ0A 1XM3A 4ZL1A 2E77A 3BLFA 1I2PA 1TTQA 4FXRA 5D03A 4JTIA 3G1VA 3M5XA 2FB3A 1TV7A 5I3IA 3OA3A 2Q3OA 2J9XA 4OT7A 2Q8LA 2JK2A 4R53A 2DZSA 3I68A 3GNNA 1VCFA 5I3FA 1LRQA 1GVQA 3C4UA 3S5OA 3H54A 1XXXA 2CLIA 2AQWA 1FQ0A 4IMGA 4LRTA 4EIVA 3Q58A 3LCFA 1KM4A 3QJAA 2E1DA 4DF0A 1KM0A 4LOCA 4Z1CA 3NPUA 1OF6A 2TMDA 2C18A 4O19A 1ME7A 4ZQRA 2CWNA 1NAL1 2DZUA 3SR7A 2E6YA 3RFAA 2B7PA 3W88A 5DY2A 3OEXA 1KFEA 4O13A 4ADUA 1J4EA 4EVZA 3BK0A 4CNNA 4N9CA 4BI6A 4RZ4A 3M5YA 3BVJA 5BOOA 4GBUA 2EGZA 3O07A 1W31A 3UYCA 2XN2A 5DCEA 1J2WA 4LS0A 5IBXC 3OG3A 2FPYA 3EWWA 4A21A 4DO5A 3STFA 1ML1A 2Y7FA 3DXIA 2A7NA 1BWKA 1XL9A 2ZYFA 4MUZA 4DBDA 5CZJA 1OVDA 5U4NA 1QPRA 3NA8A 1LCOA 2ZRVA 3GXTA 4HHPA 4LV9A 4X3ZA 1W5MA 3SECA 1FWSA 3HQ1A 5AB3A 2HTMA 4ORIA 1FY6A 2JGYA 3CWOX 3A21A 3KXQA 4AWSA 4O54A 4FNSA 4UMAA 1QOQA 2YXGA 4JDYA 3T7VA 1OYAA 3PBWA 1FWNA 1HO4A 3S5NA 3LB0A 4O8RA 4HKPA 1SU5A 2X1TA 5KZDA 1SZGA 1XDMA 3YPIA 3ABRA 2V2HA 3MHGA 3M47A 3E0IA 3WJYA 2RHGA 5AHMA 2X30A 4JY8A 2DZVA 3W1PA 1Z41A 1JRCA 2XFWA 2FPVA 1K03A 3O63A 1E51A 3L67A 2NWSA 1H7PA 4ZQPA 5LGXA 1DVJA 3W1LA 5DCBA 1X6UA 4PH6A 4JTEA 1JUBA 3R12A 3NPWA 2FB2A 3LHTA 3LTYA 5DELA 1SFJA 4UFHA 5CKSA 1LOQA 3NZRA 1X1ZA 3WJXA 3A5FA 4UUIA 5H91A 3RNDA 1F6PA 3C61A 5EA9A 2BX7A 1G4EA 2YFNA 1ZNNA 2Q3RA 3G0XA 5CGQA 3PVFA 4UFLA 4MY9A 3W1QA 1KFCA 4LC8A 2E68A 4PL2A 1IIGA 1TJRA 2DZPA 2QDGA 3LCIA 3P61A 5BW6A 2QR6A 5KTLA 1WDWA 4PEKA 1W3TA 2E5CA 3PG9A 3E02A 3LXAA 5AN7A 2QJIA 3CU2A 3K30A 4WXZA 1GJPA 1O94A 1PV8A 4K8EA 1V5XA 1VHCA 3M16A 4O14A 4UNKA 3CIWA 2QCLA 2GUUA 1DBTA 3IIXA 4WXYA 3E96A 3IV3A 1TTIA 1RPXA 1G7VA 3CM4A 3W1NA 4N4QA 1SO4A 5D2VA 1FCBA 4WZHA 5D2YA 5HMSA 4UTLA 3HGOA 5BNKA 3P5ZA 3W7QA 3I7RA 5G1YA 3JR2A 1ZENA 4UFMA 4LU0A 1H7XA 4HPJA 3G1YA 5HINA 1QMLA 4LRSA 4Z0SA 3TROA 1AL7A 3W1TA 3CWNA 4MYAA 1G7UA 3QH2A 3STEA 3UWQA 2BSLA 3M5VA 3BLEA 1H61A 3V1PA 1K7FA 2NX9A 3KVKA 3L66A 3N19B 1XUUA 3OVPA 3BG5A 1KFJA 3A9IA 4NJIA 5D05A 3PR2A 4JX4A 4GE8A 3NL2A 3DI0A 3LCGA 5HUPA 3WK3A 4YL2A 1JQVA 3LHVA 4RK8A 2J27A 3PAJA 4UCGA 5IBXA 3MP4A 2Z1BA 2PE4A 3LCHA 4IX2A 3NQ8A 1EP3A 4AF0A 1LRNA 1DQWA 1ZJIA 2RDUA 2NUXA 1A5SA 5LNWA 3HG4A 1XFBA 3L9CA 4FX8A 4BI5A 3G1XA 4NQ1A 1TTJA 1Q3NA 3FOKA 3PS7A 4O10A 3UD6A 4S1FA 2LLEA 4UR8A 3W74A 2Y88A 5F2IA 3O06A 2Q8ZA 1NSJA 1KM3A 2CZ5A 3B05A 3SGUA 1FWRA 2QCEA 3ZR4A 1YLVA 1FDYA 3M9YA 2Y89A 4O17A 4UMBA 3SJ3A 2JKPA 1RD5A 3W7JA 2WPBA 2ZZ6A 3W76A 1TQXA 1L2UA 5CG7A 4IWWA 1K8XA 4EF8A 3S9YA 4JTLA 1W3IA 1QPQA 3T40A 2XN0A 2Z0IA 4WUIA 4ADSA 3FS2A 1TPVA 1SW7A 3NPVA 4RX0A 2NUWA 4LY8A 2VFFA 5K9CA 1KTNA 3QSTA 1T96A 3IIOA 1VHNA 3CLMA 2R91A 1H1YA 3KFTA 3QRHA 4O15A 3UNDA 1U5JA 3LI0A 3PSVA 4S2CA 1R2RA 4QISA 2V0TA 3UWZA 4IJBA 1WA3A 3WJSA 2QCFA 3DH7A 2EAWA 2A6LA 1F05A 1M7OA 3TCEA 3W84A 4RZ6A 3UXDA 3SIZA 5TBOA 2A4AA 4BF9A 4GWEA 1I8JA 4MOZA 3LRMA 1P5BA 1QPNA 2WNNA 4O16A 3R89A 1VLWA 2V8ZA 5I3KA 4R33A 1LORA 4A29A 5AC7A 1H50A 2DORA 3KRSA 1W37A 2NZLA 2NXGA 4O0ZA 5D33A 5GVJA 4Z1BA 2F7FA 1VYPX 4E0CA 4CCCA 3KOFA 4HNVA 3HJZA 4OGZA 3TAKA 5F1VA 1DV7A 1SZFA 3W7GA 1MEIA 5F4XA 2VEPA 5T26A 5HNRA 3PY2A 2YYTA 2J9ZA 4BFAA 1RVGA 3L2IA 2OZ0A 3EX6A 3O6YX 3PB2A 1GVFA 2ATMA 3NL5A 4UTUA 4BK9A 5AFDA 3ATYA 1W56A 3TV8A 4NJKA 2ZTKA 2X1UA 1SQ7A 3W7LA 2IQTA 3W75A 2WQPA 5ABTA 5CZSA 4O4WA 5K3VA 4U4MA 4LV4A 4M7SA 3RF9A 3HIJA 3VE7A 4WY0A 3G1AA 3S42A 2VFIA 2DJXA 5BRBA 2B7OA 5D04C 1T99A 4XZ9A 1XBVA 2ZRZA 1SO3A 1K7EA 3M43A 4NNAA 3FJLA 4CLMA 5DN1A 1LLZA 1VJIA 3GR7A 3IVSA 2I14A 4JY9A 1BKSA 1F7BA 3NL6A 1SPQA 4JNMA 3NL3A 3ZFHA 1NFBA 3A5VA 5G1TA 3QQ0A 2QJGA 3FEMA 2R14A 1N8FA 4TU1A 5LHFA 3GAKA 4UMCA 1OG0A 1UJPA 2CLKA 1PIIA 1L6SA 5LNSA 2Y6ZA 1LTDA 4UR7A 3ZWSA 1S3HA 4JEQA 1KM6A 3MMTA 2JBMA 4FNPA 4K8HA 1YXCA 1QWGA 2GQ9A 1HL2A 3NQDA 4NU7A 2ZTJA 1EP1A 1DJQA 1LZOA 3G8RA 2HMCA 4C1KA 3W7KA 3TSMA 2WSQA 1MEWA 1SFLA 2QUUA 2ZFAA 5LNUA 3TMLA 4KKXA 2NV2A 1QDSA 5I3JA 3QPYA 3UPWA 5HWMA 3NPXA 1AW5A 3C2OA 1DQXA 3PSWA 5F1UA 1PCWA 4UNLA 3P5YA 1VS1A 3FLUA 1HTIA 3EKZA 3TH6A 4RCXA 1LBMA 1PL9A 5HWJA 3G1SA 4DEFA 1SUXA 3NQ7A 1IXPA 2PCQA 3EKLA 1R2SA 3KHJA 5A5WA 3S0CA 1D3HA 2YW4A 4HSNA 4O53A 3W1XA 4JTSA 3M0ZA 3ABSA 2QAPA 4K7VA 5AHEA 3OBKA 3CEPA 3TE9A 5LHEA 4X9SA 4DF1A 3TIMA 4K37A 2B0MA 4RXGA 3IGXA 3N3MA 3BG3A 3QSRA 1K8ZA 1G69A 2V5LA 1TPC1 4I9AA 3UWUA 2E6AA 5E93A 4N9BA 2YPIA 2G5WA 4UFJA 4AWTA 4OWGA 1ZHAA 3SW6A 2ZRXA 4FHAA 3LHZA 4TO8A 4RZ5A 1TPUA 3TX9A 4Q4KA 2ZZ7A 3BW4A 2FDSA 3RLUA 4DXVA 5K9XA 1YADA 1VQTA 3DFOA 3KVJA 3AJXA 2CLMA 3MO7A 1MEHA 1ME8A 3DFQA 3TQVA 1TV5A 4M6QA 3U2OA 4O11A 4IOTA 2RDWA 3LCWA 3THAA 3N2MA 4PCFA 5CZTA 4PA8A 3R13A 3NOEA 2GVGA 3SSJA 1LBLA 3W70A 4R7JA 1IXOA 3DI1A 2P0OA 3STGA 1D9EA 2J88A 2NWRA 3LTPA 3W85A 2J6XA 3U6WA 2Z6IA 3QFEA 4L4LA 3W7NA 1X8FA 1OX4A 5F2MA 4JTTA 1H1ZA 3DFTA 3LXBA 4NJGA 3IEBA 2NX3A 3EWZA 1W3NA 1WQ5A 4MIMA 1H7WA 4CNPA 1KW1A 1YPIA 3GYEA 1RQEA 4H6KA 3UZJA 1PCKA 2V2CA 4FEZA 1C9DA 3N9RA 1H7OA 3W2KA 3W2NA 2A7PA 3NQ6A 5I3HA 3TJLA 5EMUA 2ABBA 2DU2A 3I65A 4RXFA 3B04A 1C8VA 5G4EA 2V30A 4JX6A 1QFEA 1XKYA 4GUIA 4LVDA 5CSSA 2QJHA 1KM1A 5F4SA 3W2UA 3TQ0A 1MZHA 4HT3A 2J9YA 5FEXA 4IX0A 4UTKA 4NZJA 2NXHA 3QQ1A 5FF4A 1NEYA 2CLOA 5LZLA 1DOSA 5FF0A 3T44A 1QCWA 3EX2A 2X16A 4KFOA 1WXJA 1ME9A 3EB2A 2ZA3A 1JUEA 1SR9A 2H90A 1XCFA 2Y61A 3B4UA 4NJJA 3W72A 2VEMA 4B5NA 2CLLA 3G18A 1EB3A 2QEZA 3G24A 1OFDA 3HG2A 1XBZA 3I6RA 4JXCA 3LI1A 1UBSA 5F4WA 1KBJA 3MW7A 3NYZA 4O0KA 2QF7A 1TIMA 3HGSA 5L9FA 1GEQA 4JTKA 4NJHA 2Y63A 1OYCA 2A85A 2A5HA 5AHLA 3TU9A 4GUFA 4TMCA 1UUOA 4YWIA 3P80A 3DFPA 3L5MA 4AWUA 1R47A 3G1FA 5SWUA 1GWJA 1YXYA 1TPFA 2EF9A 3UY7A 4MZ1A 2WO5A 3DENA 4N9DA 4LWWA 3MP3A 3C2VA 3CC1A 4MY1A 1VLIA 2CFFA 1TQJA 1W5QA 1PHQA 3W6YA 2O7SA 3P8JA 3EWUA 5KITA 1Z48A 2CLFA 3QYQA 4QNEA 3CB8A 4O4VA 4IXXA 5AHNA 1DL3A 1FXQA 2QCDB 4GFSA 4IQLA 5DBUA 1G4TA 4K39A 3RMJA 5FI8A 3MP5A 1GPWA 1WBJA 4MLRA 5FEWA 2RH9A 1MSSA 3QEZA 2VEIA 2DZXA 3WK2A 3TW6A 2CZEA 6TIMA 4Q32A 3HB9A 3W2LA 3MI2A 1RZMA 5AC8A 1RV8A 2YR1A 4Z08A 3TC7A 3B0VC 4GUHA 2QCMA 5D38A 4HNUA 4UC5A 2ZZ4A 1W5PA 1OK6A 1HG3A 4PL1A 4KFPA 3MYPA 3N73A 4UFKA 3VCRA 3M7WA 3RLVA 3LHUA 4ZQCA 1KFLA 2ZZ5A 3EWXA 1H60A 1SW0A 3R5EA 3S5ZA 3GR8A 3M1ZA 1O5XA 3W73A 2TSYA 1XI3A 3W1RA 3A24A 3G0UA 4ZZ9A 5DY3A 1AW2A 1I45A 3NQVA 4N6EA 3FKRA 1ZCOA 3MUXA 4XBKA 4WJEA 3QW4B 3Q37A 4JICA 3TFCA 5J5RA 1WBHA 1JRBA 3BW2A 2P10A 1ZFJA 1ZAIA 5D37A 2ZZ2A 4AH7A 1VCVA 1I2RA 2DZWA 3MHUA 1I4NA 4XWUA 3PBYA 1TPB1 2YSWA 4WY0F 4A2RA 1Y0EA 3W23A 2JKAA 1I2QA 1OFOA 1T8XA 2VENA 3GDLA 3ZS4A 2PRHA 4FNTA 4O50A 4OV9A 1UUMA 2E6FA 4QITA 4JYDA 1K8YA 3QMRA 3NQMA 3P81A 1LBFA 2QCGA 1DORA 3W7IA 3FA5A 4CQ9A 4UIOA 1IGSA 3U8GA 1TO3A 1OFBA 4X2RA 2EHHA 1UCWA 3QF0A 3PB0A 3IVUA 5KMYA 4JGDA 3B06A 2G95A 3CT7A 4JTFA 3LM7A 3MYOA 1L9WA 3DGRA 3P7YA 2RDTA 2ZA2A 5C54A 3LTSA 1EUAA 3LBMA 3TXZA 5D02A 4AB4A 1KM5A 2ZRWA 2FPTA 1QO5A 2ZZ1A 3PM6A 2VFGA 4XKYB 3RU6A 8TIMA 1G4SA 4XTDA 1K7XA 1Q6OA 3BGGA 4KFNA 1EWDA 3EXSA 3KX6A 5AYZA 1THFD 4Y96A 4BI7A 4OE7A 2ISSA 3W7CA 3HBLA 5AYYA 1Z42A 1TV8A 2WSYA 5C5YA 2H8XA 1KFKA 2OX1A 2Y85A 2TPSA 5J5DA 3NGJA 4AHPA 3M44A 4FNUA 1KV8A 3GNDA 5G4WA 3S1UA 3CIXA 3O8AA 1FDJA 3C8FA 4M19A 3M6YA 2DJLA 5CPLA 2Y7GA 2HSAA 1KTBA 2DZTA 3F4NA 1H51A 5DLCA 4FIQA 1ICPA 1ICQA 1F2JA 4G1KA 3NNTA 3B0PA 5K4ZA 4K7YA 1HFBA 3W7EA 3O16A 3TDFA 4JTUA 1H63A 1OFAA 4O1AA 3UXAA 1H7NA 5CSRA 1UB3A 3NQAA 3TA6A 2YDAA 1VYRA 2VFDA 3T55A 4CQ8A 3C2FA 4O18A 4XBSA 5F2LA 4OQVA 5DBTA 5G2WA 5BMXA 1D3GA 3F1QA 5KZEA 3S1WA 2NLIA 2DP3A 3B0UX 3P67A 3DU0A 3EX4A 3NXFA 3UPBA 4DO6A 5HWNA 1B4KA 2E5BA 1S5WA 4ZVJA 4JTGA 3HPXA 3P62A 4H4IA 4NX0A 1YTKA 3NDOA 2X1RA 3PBUA 5HULA 1OYBA 1TYGA 6ALDA 1YDVA 3N9SA 1RQHA 3IVTA 4YXGA 3ABQA 3G0SA 1FCVA 3W7MA 3W22A 3PBVA 5KSWA 2QUTA 3UZ5A 3LRLA 2V5BA 2QCHA 3PUDA 1F76A 1X7FA 2Y62A 1W5NA 4ADTA 3W71A 4QSHA 3PULA 1YDOA 3G22A 3L0NA 5AHFA 2H3BA 4TX9A 4XTIA 3GK0A 3LXCA 2TRSA 5L6UA 1HO1A 1W1ZA 5LNRA 4LUJA 2CZDA 1YTDA 3INPA 4GUJA 3OHIA 3WJWA 3SI9A 3PF3A 2A2IA 4IMDA 4O28A 1LP6A 4CQAA 3M5ZA 4Y9AA 4FB7A 4YMZA 3E49A 1EEPA 4LW7A 1LROA 4LVGA 2Y7DA 1TPDA 5E1QA 1JCYA 5AOUA 3W9ZA 1TTPA 1KV5A 1T0OA 3NQFA 5G5IA 1OX5A 2ABAA 2QKFA 4N9EA 1N55A 3I7SA 1WOAA 3SY5A 3BV4A 4P2VA 3HGJA 3ELFA 2BXVA 3DFSA 1JJKA 3T4CA 1DKWA 3KRUA 4OHQA 4GNJA 3Q2DA 1ZALA 1TRIA 4TMBA 3KVLA 3W7DA 5D09A 1B9BA 4NNBA 3OIXA 2FJKA 3LBCA 3FKKA 1BEUA 3TSDA 5FEZA 1Q6RA 3L68A 1PVNA 3IIPA 2JGQA 5AHIA 4DQWA 3M41A 1O4UA 3RK8A 2B7QA 3GDMA 1SZNA 2GQAA 2D73A 2V81A 2ATSA 5D2TA 1A5AA 1VGAA 4RR4A 3O6DA 2V2DA 2YYUA 5FESA 4LT9A 1WV2A 3B03A 1GVSA 3WK1A 1M7PA 4UTWA 1JCNA 3T78A 1DHPA 3B8DA 4UTMA 1OHLA 4ZQNA 5CPOA 3EXTA 2A7RA 2VFHA 3L0GA 2OT1A 2R94A 3GKAA 4ZQMA 4NXKA 3MBDA 3O1NA 3IGUA 4E2DA 3GVGA 5TIMA 4WX2A 4I7UA 3SGZA 5TQLA 5EKYA 4UXDA 3TW7A 4ALDA 1CX9A 4Q33A 3HPZA 3LOTA 1F6KA 3EEGA 4LVFA 2F84A 3STCA 4HIBA 4E2BA 2ZBTA 1OFRA 3NQ2A 2TYSA 2ISVA 2ISWA 4PC8A 4KWWA 2XN1A 4YCPA 3A22A 3UWWA 4FX6M 1LLWA 2W6RA 3HF3A 4BR1A 2H3DA 3TR2A 3NM1A 4LVAA 3TQKA 3CHVA 3S8HA 4I7VA 3TSBA 4UTWC 2B7NA 3WK0A 4XQ6A 2NV1A 5EYWA 1B3OA 1YDNA 1R46A 2C0AA 4AVFA 5A8GA 2Z6JA 1VH7A 3L0KA 3W2MA 1IF2A 2R8WA 4E38A 4Z1AA 3UWYA 4QJ1A 3NM3A 2C16A 2B4GA 1F5ZA 1KBIA 1SZEA 3C0JA 4TR9A 1MXSA 2ZDRA 3VFLA 1JCLA 4CCDA 3CPRA 1OJXA 1EPXA 1IXNA 3NG3A 3NQEA 5CPMA 4AMAA 1TCDA 2E09A 2CZFA 1VYSX 4IXHA 4IUOA 1G6CA 1KM2A 1ALDA 3PUOA 3MBFA 3WFAA 1SSDA 1H62A 5D2WA 2QAFA 4N02A 4L4MA 4MJZA 1YXDA 4NVTA 5G2HA 1GG0A 1OF8A 2C1HA 1O60A 1VZWA 1O95A 2C6QA 3QMTA 1I2OA 4EOUA 5K2ZA 3CTLA 3HOJA 1WAUA 1GOXA 1NF7A 1OFPA 4OU1A 1KLYA 3FIGA 3C52A 3WJZA 4H3DA 4UTHA 4HSOA 3N2XA 1GTEA 5HQEA 2QDHA 4J9JA 3JRKA 4LUIA 3TMQA 1G67A 1IXQA 3G1DA 5AC6A 3LRKA 2I1OA 3E12A 4NNCA 5LSMA 4PTNA 3L65A 5D2XA 1Q45A 1ZAJA 2FTPA 4IPJA 1Z44A 1GYNA 1OX4B 1ZY9A 3MHFA 2A6NA 1LRTA 3QM3A 4GRSA 1XBYA 4NZFA 1W5OA 2QCNA 2GVLA 4GC4A 1W54A 3EXRA 4A22A 4FXSA 2VFEA 4LTSA 3NQCA 3TUUA 2X2GA 1ONRA 4FF7A 4LS1A 4UTJA 3VI2A 1PS9A 5DXXA 2VC6A 1EP2A 1TPH1 3L21A 4HNNA 1JQXA 4JIQA 5K7JA 1EX5A 1ADOA 3D0CA 1W8SA 2UV8G 3HMJG 3LV5A 2WNZA 1GVOA 1EWEA 5G2IA 1OFEA 3W1UA 3G3DA 4MVAA 5K4XA 4K38A 4IGHA 4ONVA 2BTMA 3UWVA 4Y6GA 1DJNA 1K3UA 3L5LA 3GB6A 1QR7A 3QPZA 1N7KA 3THQA 4MLJA 3O6CA 3LX9A 3L5AA 3TC6A 2VOMA 4AHOA 1P4CA 5E0KA 4FX7A 1JUKA 4IMEA 4POCA 4MFEA 4D2JA 2ZRUA 3OVQA 3PWAA 3OVRA 5C55A 3IRDA 3FYOA 1FWWA 1OX6A 1WYIA 4RLIA 1P0NA 5KINA 3ANYA 4A2SA 1S5TA 3NQGA 3TK7A 1AG1O 3HGRA 3LERA 1I2NA 1U83A 4CNOA 5F2GA 2V9DA 3C3NA 5EPDA 2WJZA 1F74A 1NF0A 4JR5A 2C19A 4AF0B 3W86A 2EKCA 4I7WA 4JDBA 4ICNA 1XBXA 1VPXA 4WQ6A 2WKJA 3IGSA 2OJPA 4O52A 1HUVA 3H55A 3KRZA 3LCLA 2VEKA 3DFNA 2HS8A 2VXNA 3P82A 1QOPA 3FYPA 4JYFA 4XKYA 4AXKA 4JX5A 1FUYA 1SO6A 4MPQA 3V75A 5I3GA 3BO9A 5C6MA 2GOUA 1GG1A 1FXPA 2CW6A 2QUVA 1WX0A 4QIUA 3N14A 2ZRYA 3DHFA 4FNRA 4NXSA 3MWAA 4P61A 5DCDA 4BWLC 1ICSA 3IIZA 2GQ8A 4JD4A 1XDLA 4FIRA 4QAIA 3EWYA 4JTJA 1Q6QA 4UFIA 1AL8A 1IIHA 4Z0JA 1NVMA 4AEOA 2NX1A 4UTTC 3MJYA 4OV4A 4ZMGA 4TIMA 5HUOA 3DBPA 4O1BA 1GYLA 5FEPA 5KZMA 3W1MA 3ZWTA 2FFCA 2X1SA 2FQIA 3H53A 5EY5A 3HG3A 2RKXA 4XUGA 1TRDA 3NO5A 2C15A 3G8EA 3ABOA 1LOLA 3O05A 1GT8A 2BLEA 2PRMA 4LNYA 2E6DA 3W7OA 1FCQA 3NR0A 1A53A 4R34A 1PE1A 3C2RA 4IPIA 3EX3A 2GPTA 5LKYA 4A3UA 1LYXA 1UASA 2A21A 2YGYA 4DO4A 3W7PA 1H7RA 3W1AA 3LHYA 4IMCA 1JCXA 3W2JA 3GDTA 5LNVA 3FFSA 3GLCA 1CI1A 2VKZG 2QCDA 7TIMA 2W79A 1SW3A 3LCXA 4RV8A 1EIXA 5IM51 3C56A 3P84A 3VE9A 1OABA 3R8RA 2OCZA 2GJLA 3O15A 4EWND 4MZ8A 2WSRA 3KVMA 4LC6A 2V82A 3S6DA 1H5YA 3TNOA 4O57A 4NT0A 2ZCGA 1YPFA 3BW3A 5FF3A 2A1YA 1KTCA 3BGJA 2WOQA 3QC3A 1LOSA 3IIVA 4YCOA 4Z1DA 4K36A 1C29A 5EL1A 1QAPA 1FX6A 3W07A 1JR1A 4DF2A 2RFGA 2PURA 4QNWA 3NZ1A 1QNVA 2ALDA 1P1XA 4OBTA 4GUGA 1TPWA 4N4PA 3GZ3A 4WY0B 4LS2A 1OK4A 3BARA 3S1XA 3USBA 3GX9A 3DKJA 2JKEA 3C2EA 1YTEA 4JTHA 4O1DA 5DXYA 1VCGA 4N2YA 3GDKA 1GVRA 5EBUA 4PODA 2PC4A 1FWTA 4HNTA 3EX1A 3DZ1A 2FLIA 3F4WA 3N34A 1FBAA 3MI3A 1Q6LA 1ZAHA 2O7QA 1W0MA 4DPQA 2W0UA 4EF9A 1S5VA 4MKNA 1VC4A 1M6JA 4CCEA 3SZ8A 5HR7A 4GXMA 3W3OA 2YFOA 4WOQA 1PHWA 3NAVA 5FF2A 4MJMA 2ZA1A 1KFBA 2Z2UA 4LVBA 3LHWA 3G3MA 1EUNA 1RQBA 4IMFA 1JVNA 1BWLA 3W83A 1EA0A 1R30A 3LDVA 3AO0A 3GDRA 5AYXA 3EWBX 1M5WA 1BTMA 1FDZA 2Y70A 3JS3A 2EPHA 3G1HA 5H2ZA 3A23A 1LM1A 2I9EA 1F73A 1GTHA 4K6AA 5D30A 1VRDA 3ATZA 5D32A 1SO5A 4FO4A 4GJ1A 3QW3A 2C3ZA 3F03K 2OT0A 3DKLA 3TXVA 4M5PA 3W7RA 4HPXA 3GXNA 1SSGA 4JS3A 2P1FA 5K9DA 1P0KA 2HS6A 3C6CA 2WV8A 4AAJA 4UTTA 4DPPA 4RJEA 2C13A 4Y90A 2E5DA 2QCCA 4ORMA 4YLWA 4JYEA 4M6VA 1GQNA 1G4PA 1L6YA 2FIQA 3FJ6A 4UTIA 3P8IA 3QZEA 4PFMA 1V7YA 1CW2A 2OMAA 3DAQA 3VNDA 4DBEA 3TKFA 2NXIA 1JULA 2C14A 4U28A 1A5CA 1TPEA 2Y7EA 1B57A 1J5TA 2H6RA 1TMHA 2CLHA 4MFDA 3UQNA 4JIPA 1XC4A 4WOZA 3E9AA 1QO2A 4MZYA 4ML9A 3BLIA 3UY8A 5HJLA 3LGEA 2YZRA 5C2XA 1KA9F 1YYAA 2CLEA 5BMWA 3KAOA 2H8ZA 3DHDA 5CZ0A 4MYXA 4W9TA 1GZGA 4QQ3A 2A0NA 3SFKA 1X1OA 4FNQA 4JN6A 3HPSA 3PUEA 1RR2A 1TB3A 3LV6A 4QM1A 4O12A 2J24A 4M7TA 2YW3A 1OFQA 3CEUA 3R2GA 4S2BA 3GKFA 1TSIA 3LLFA 4DELA 1VR6A 2G96A 3CQ0A 4NUWA 3BG9A 4O1CA 3S1VA 4WD0A 5HR6A 1B4EA 2CU0A 1AMKA 2PRLA 3BPWA 1R2TA 2NUYA 1A5BA 1JCJA 3MI6A 3VKJA 1WOBA 1LDCA 1TJPA 2AGKA 2AAMA 2BZNA 2KZHA 4C1LA 4AHQA 3W7HA 1JCMP 3GIYA 3HG5A 1K02A 3TJXA
chains in the Genus database with same CATH superfamily
2VGBA 1Z7AA 5REQA 3ECQA 3S5YA 5MHBA 1RSCA 2W4XA 3QXBA 1MO0A 2GJNA 2ACRA 3PC0A 3LLDA 2YCEA 2GVJA 3M0IA 1H5VA 2IMRA 3QZAA 2ZADA 3P74A 1A47A 4QBXA 5CPNA 1VENA 2I5QA 3NEVA 4QQUA 1QPOA 5LGZA 3P60A 1VF8A 3QGKC 5BYWA 4M6PA 4HHLA 4NX5A 1KLZA 1L6WA 2WZHA 4ERGA 1FCUA 2PDGA 4JFUA 3CZ8A 1K9FA 4ZL1A 4P8WA 1H4PA 3SURA 2WBKA 5AZ1A 3NIYA 2PWEA 3M5XA 2Q3OA 3A4WA 4PBGA 3WIJA 4B3KA 1CGUA 2MNRA 2DZSA 4MNLA 1KR0A 3F5LA 4IMAA 3WLQA 1VB9A 3M64A 4Q8VA 3HTWA 4Q8UA 1LRQA 2CLIA 3WMLA 4V27A 1FQ0A 3R10A 2HV5A 4EIVA 4B2DA 1EKOA 4DF0A 1R9YA 4LOCA 3NPUA 4DM1A 4S3CA 4O19A 3PJUA 5KETA 3RIKA 1I0DA 4ZQRA 2DW6A 1NAL1 3SR7A 3RFAA 3W88A 2B7PA 3TTEA 4B5SA 2OSXA 3GWQA 3IANA 2HNHA 2KAUC 3FV9A 1XLJA 3TW9A 1XWYA 4RZ4A 3BVJA 2EGZA 1ADDA 1V3HA 4BQ2A 5DCEA 1J2WA 4LS0A 5IBXC 4ZE5A 3W00A 5B7YA 1MXGA 2FTYA 2Y7FA 4PUMA 1UIOA 2A7NA 4MUPA 3EMZA 1W1PA 1NQKA 2Z24A 2BASA 1UZHA 3RCMA 3NA8A 3GXTA 4Q6JA 4KF1A 4X3ZA 4ORIA 1FY6A 1A3WA 2JGYA 4GKLA 1RY0A 3KXQA 3NXLA 4H9XA 4U3AA 4JDYA 2XH0A 1C91A 1OYAA 3PBWA 3U5UA 1OB0A 2WHLA 1Y8BA 3LB0A 5KZDA 2ZUTA 3GVRA 3YPIA 1JPDX 2PODA 4V1XA 3UXIA 2TAAA 2ZXQA 3KOWA 3I4KA 2DZVA 2ZUWA 4D9PA 1JRCA 1R7AA 3ZZ1A 1TJ1A 3AUJA 1RCOB 4BQ4A 2XVKA 4H9VA 1DVJA 3W1LA 5DCBA 4GYPA 1OZMA 3UR7A 5E9XA 3NPWA 2FB2A 5H8UA 4PFHA 3NZRA 1X1ZA 3WJXA 3A5FA 3C61A 5EA9A 3BAJA 1TCMA 4QROA 2HVMA 3N17A 3VGDA 3DYOA 3MDUA 4PMOA 4UFLA 4MY9A 1KFCA 1NY1A 2EBNA 3MSDA 2WMKA 3LCIA 1Q5MA 2F9RA 1WDWA 4PEKA 5C9WA 3E02A 3LXAA 1V77A 3CU2A 3K30A 2G41A 1PV8A 4BA0A 4GC3A 3T07A 3DESA 1PDZA 3CMFA 4XZBA 1I75A 4DO7A 3MZNA 3UWEA 1Q2RA 3BMVA 3T0BA 2GDVA 4DZ5A 1XYFA 3IV3A 3W1NA 3ZJKA 4N4QA 1SO4A 4WZHA 5D4YA 3GDBA 4M6UA 5BNKA 4DYEA 1KNWA 4DUOA 5G1YA 3GNOA 1GK8A 2RAGA 4LAZA 4B5XA 2YA1A 1H7XA 4LU0A 4C7FA 1D2KA 1LUCA 4Z0SA 1AL7A 2VC7A 4FLRA 3GVQA 3STEA 4BS0A 4GIRA 3UWQA 3RN6A 2VEFA 4AIUA 1XRVA 3VA8A 1GGOA 3APTA 1RP8A 1US0A 3O0FA 3V1PA 3M46A 1IV8A 3AS3A 3MY9A 4P8XA 5JVLA 3BAIA 4P8UA 4L6OA 4L5ZA 4I5RA 4IL0A 3AIRA 1Q85A 3WK3A 2PLKA 1Q6GA 1JQVA 1RALA 3QTPA 3WUBA 4GINA 2J27A 1J0ZA 4UCGA 2PE4A 3LCHA 2XIBA 3WCZA 4L9XA 2DIJA 1EP3A 3ABZA 3BLPX 2RDUA 4GQGA 3WEOA 2IPWA 3OZYA 1XFBA 2V63A 3L9CA 4AMCA 4BI5A 2QT3A 4NQ1A 4F40A 2OEJA 3FOKA 4O10A 3ANVA 2PU1A 4DJDA 4J3UA 4S1FA 1UD3A 5AKQA 5I24A 5F2IA 7REQA 1KM3A 3M0VA 5XINA 4GVIA 5HXMA 1IEWA 1RHCA 2JKPA 4XZLX 3ZQ9A 1WDRA 1K8XA 4EF8A 3U3HA 4XKMA 4FAMA 4ADSA 1TPVA 1SW7A 3LGGA 2IPGA 3G77A 5K9CA 2GYIA 3P3BA 1KBBA 1VHNA 4XD4A 3UZYA 3UNDA 1U5JA 4S2CA 1R2RA 3EB3A 1GJWA 4PULA 3DH7A 1M7OA 3W84A 2PP0A 2PDNA 4GWEA 4MOZA 1K9TA 1H0GA 2I5GA 1JPHA 2PUZA 4O16A 1VFSA 3MA8A 1SMAA 4L61A 3BAYA 3LG3A 4GO8A 5I3KA 1O5RA 4XD3A 1QNSA 4O0ZA 2GSHA 2F7FA 5FJUA 4E0CA 4C91A 4AZ5A 3TJIA 3HJZA 4ZBCA 1DV7A 4HD5A 3W7GA 3J7HA 4IUGA 4O8AA 3PB2A 3O6YX 1T40A 3NL5A 2CEQA 1KRCC 5AFDA 3ATYA 1HF6A 1F9CA 4JQ1A 3AZTA 7TAAA 3TV8A 4WLCA 1H49A 1UKTA 1W91A 3RPTA 4GI9A 3EOUA 3W75A 1Q7ZA 3K13A 5ABTA 5K3VA 4ZENA 4RZBA 4M7SA 3V5CA 1TWDA 1EGMA 3HIJA 4WY0A 4D1IA 3U7BA 3G1AA 3C0LA 3PZMA 1W9PA 2VFIA 3PFMA 4PE8A 2B7OA 2VCAA 1T99A 3URAA 3GS6A 4XZ9A 1SO3A 4IHCA 4LEFA 5BOFA 1VJIA 4B91A 2BS9A 1DHKA 2VL4A 1F7BA 3AROA 3NL6A 1JD7A 1SPQA 4HNCA 3T0AA 3VILA 3ZFHA 3A5VA 4OKDA 3QQ0A 2R1LA 4TU1A 1N8FA 3C0SA 2AGTA 4A8LA 1L6SA 2X1IA 2Y6ZA 4R9XA 3SADA 2Z26A 4Q3MA 1AH0A 3ZWSA 3DUGA 2PFHA 2GQ9A 1QI0A 1HL2A 3NQDA 1EP1A 1DJQA 1HL9A 2HMCA 4C1KA 3TSMA 4ZEPA 1SFLA 3IJDA 2D69A 4IQDA 1V6VA 1TWIA 5LNUA 4ML4A 2XWEA 4Q8NA 3GVWA 3THDA 4KKXA 5I3JA 3QPYA 2X8RA 3UPWA 1AW5A 1DQXA 3IV8A 3N3TA 3P5YA 4QDMA 4Z2KA 3PZ9A 1LBMA 1PL9A 4GCXA 1XIJA 3QHMA 3NQ7A 1H41A 1IXPA 1W9XA 2PCQA 3WN6A 3EAUA 3KHJA 4UOQA 3CL6A 2V67A 4B4FA 2G3MA 1D3HA 3W1XA 4GH1A 4MB4A 1M03A 3ABSA 3O6AA 1I6NA 3TE9A 1TV4A 2JF6A 3IGXA 2PLJA 4INFA 2E6AA 2JQXA 2G5WA 4UFJA 3CQKA 1HGWA 4D6JA 4E2VA 4TO8A 1XD0A 1A5MC 1TPUA 5AC4A 3WBXA 3TLQA 1DWIM 3BW4A 1XHGA 4UOZA 3RLUA 1XISA 1YADA 1I0BA 2CLMA 1MEHA 3AMCA 2J6VA 2WMJA 1ZJHA 4S3AA 2HWGA 3U2OA 4O11A 2WNWA 4HP5A 2NQ5A 2PAJA 2DH3A 3THAA 1CPUA 5CZTA 3UESA 2NVDA 4PA8A 3R79A 4AYGA 1RP9A 3SSJA 4LF1A 2YIHA 3W70A 4Z42C 3L23A 2B31A 1DJIA 1IXOA 2P0OA 4HMNA 1D9EA 2J88A 3OLGA 3SM0A 1JAEA 1FWEC 4FXFA 5T8GA 2A3EA 2O0TA 1J12A 4L4LA 1BSIA 4PMXA 3DFTA 1IEXA 3HV8A 3ZYZA 5CC3A 1AJ2A 2FMNA 4DIAA 1MUMA 4E8DA 1YE4A 3ZVHA 4OBRA 3U2EA 1H7OA 5DMYA 2VUYA 3H7UA 3NQ6A 4H01A 1RJRA 3CO8A 5FACA 2ZKMX 5H6HA 1WKFA 1DJWA 5A8MA 2F61A 4GBDA 1XDJA 2FZDA 4ROPA 4RXFA 2WZEA 2PGRA 4FZIA 4H9UA 3WQ8A 1QFEA 3H7VA 2WC4A 1DEDA 1F3WA 5CSSA 4Y9MA 1PEZA 1YEYA 1SM9A 1VEOA 3W2UA 1IWAA 4HT3A 1ZTVA 3M0HA 4IICA 4LBRA 3DC8A 1NM9A 5I00A 4HMEA 1NEYA 2A3AA 3KL3A 3GU9A 1QCWA 2X16A 4S3DA 4U31A 1JUEA 1XCFA 1O6IA 1W2PA 1Z89A 2PSNA 4LAMA 5IDIA 2INZA 2CLLA 3NOYA 3FA4A 1OFDA 1XBZA 1UBSA 3A4XA 2OYKA 3MW7A 2E40A 3SO7A 1U5VA 2ZXAA 3IUDA 3ZXWA 3HGSA 5L9FA 3CO4A 2XDFA 1PO9A 4Q4RA 1OYCA 1WDDA 3KL0A 3TU9A 3LQLA 4HYRA 4DI8A 4L64A 1UUOA 1SJAA 2HJPA 3BLOA 4DBUA 4YWIA 3REQB 3DFPA 5SWUA 3VMOA 3BSGA 4C1NB 2EF9A 3A3WA 4ZB2A 4N9DA 1L6GA 3MP3A 4MY1A 3GC5A 2CBUA 3V5OA 4GCAA 3IJ8A 3UCQA 3WD3A 3E2QA 1ZUAX 4C65A 1PHQA 3W6YA 5JQ9A 2O7SA 3Q45A 1UPPA 3BJSA 3CB8A 3URBA 1GW1A 4IXXA 4KMQA 1FXQA 3RMJA 3B9OA 3W38A 3BOLA 4FMVA 1KRBC 2QHAA 3W53A 3KCOA 2VEIA 2DZXA 3VOJA 3LSCA 6TIMA 2OO0A 2HEJA 3W2LA 1X7IA 4DY1A 3VOFA 1B31A 5HBFA 4PSRA 4S38A 2JF7A 4GUHA 2QCMA 2RDXA 4WR3A 2HE5A 4PMNA 5HNNA 1W5PA 2BV9A 4ROQA 3UCDA 4PL1A 3MYPA 4U3CA 4JIIX 1REQB 3KLLA 3M7WA 5A2AA 3RLVA 2FVMA 2HPIA 1BQCA 2R9RA 4W88A 4A8IA 3S5ZA 1EC8A 3M1ZA 1O5XA 3N11A 3F5JA 3G0UA 5DY3A 1I45A 4HN8A 2BOFX 5M3WA 1Y5WA 1ZCOA 1QI2A 1S46A 3VDAA 3E0FA 1F3EA 1JRBA 3BW2A 1ZFJA 3B8WA 2ZZ2A 1Y5VA 2PDIA 1EL3A 1M7XA 2WCGA 1QW7A 3PBYA 2YSWA 2HBVA 3WBAA 3W23A 1EDTA 1T8XA 3NJ3A 2V3EA 1AQMA 3LUTA 1UUMA 4IIHA 2E6FA 3BGAA 1NP0A 4HB7A 1TMLA 3WBEA 2G3IA 2QCGA 1ODUA 2HROA 3FA5A 5I09A 2PMQA 4UIOA 3ZJ8A 2YL8A 1EJSC 1PKNA 4F0KA 4US6A 3PB0A 4QTGA 4K1GA 2ZUMA 4HK5A 2RDTA 5C54A 2XVGA 3LBMA 3TXZA 2VHLA 1MRQA 1JZ4A 3QKZA 2Z00A 4XSLA 2ZRWA 2FPTA 2ZZ1A 2DQWA 8TIMA 2R6OA 1JPKA 1K7XA 2YLLA 1XJBA 5E6ZA 3DFHA 1EWDA 5AYZA 1XH2A 4Y96A 2QMJA 4HBKA 4X0VA 3HBLA 3W7CA 2EJAA 1BYDA 4QFUA 1TV8A 2WSYA 5C5YA 1EGZA 2ZX9A 1KFKA 3MUIA 1PBGA 3ABXA 5J5DA 3OLDA 4AHPA 2D3NA 4FNUA 2OKOA 2BXZA 3UNTA 3CIXA 4M19A 4GYJA 1W3LA 5CPLA 1BTCA 4GVHA 1BGGA 4TVUA 1KTBA 1RBOB 3GBEA 1XICA 3U4FA 3RLGA 2YA2A 5E0FA 4GD0A 4Q22A 1M1BA 3B8SA 3OODA 4A35A 1OD0A 2YBTA 1O7AA 2ZOXA 3WDJA 4MKVA 4G1KA 4ZODA 4JOMA 4K7YA 3O16A 3TDFA 3LS9A 4JTUA 4GVGA 1WUEA 3WDRA 2J8GA 1E4IA 4L80A 1NDYA 3L2MA 4FSAA 1VYRA 4LALA 3T55A 4B16A 4D8AA 4O18A 4ZO6A 1ZBVA 3VGHA 3VIIA 4OQVA 4KGJA 1OM0A 3ARXA 3FX4A 2NLIA 4G56A 3FAWA 3B0UX 3DU0A 4AZCA 2AL2B 5FD0A 2E5BA 3AS0A 2P88A 4JTGA 5C9XA 3HPXA 3ITXA 3D3FA 4NX0A 3VIMA 2QS8A 3PBUA 1OYBA 1EJVC 3I3EA 1RQHA 3DCPA 3MWCA 2G8ZA 4F4RA 2QUTA 3UZ5A 1CXKA 5A6JA 7REQB 4RE4A 1YMYA 1YDOA 2FVKA 4E4FA 3L0NA 1W32A 2Q01A 3WD0A 2GZXA 3H2CA 1HO1A 1E6ZA 4LUJA 1YTDA 2Q09A 3INPA 2VO5A 3WJWA 4B92A 2A2IA 4IMDA 5BWAA 1IR1A 4O28A 2OKTA 2P50A 4Y9AA 4PUNA 3RX4A 1EEPA 3KM8A 3EA3A 3CQHA 1NOUA 1GKQA 4LBUA 3U2ZA 2YA0A 2R24A 4JEJA 4WHBA 3WUEA 2IQ0A 3NQFA 3T9PA 3DFYA 2ABAA 4N9EA 1WOAA 3TYZA 3SY5A 4L9ZA 4AIEA 4Z2LA 3HGJA 3ELFA 2BXVA 1JJKA 1TV2A 3Q2DA 1ZALA 2VQUA 3K8KA 1B9BA 2BHYA 7PTDA 2FJKA 3QVQA 1V51A 2FZBA 1OGSA 1Q6RA 1PVNA 3IIPA 2XH4A 1A80A 1LT8A 1FWIC 2YOCA 2X41A 3GDMA 1OCQA 2ATSA 1UWQA 3LA4A 4RR4A 3WH7A 1FRBA 4XZHA 3USZA 4MNKA 2PDBA 3GW0A 4UTWA 1Q6CA 1MFUA 4PMRA 3R6IA 4NRRA 4BEUA 4YYFA 2Z1VA 1Q7QA 1AODA 3GU2A 4KCUA 2WHKA 9CGTA 2OT1A 4ZQMA 3FN9A 1UR9A 4NXKA 4U2YA 3JUGA 3N6QA 3U7VA 3P0WA 2DT2A 2FKPA 3GVGA 3F2DA 3SGZA 4ZO8A 5TQLA 1K70A 4UXDA 4L1WA 4MGGA 4GMEA 2J25A 4DWSC 1IT7A 1FWJC 4WJ8A 4TTUA 1UWUA 1OC6A 1GQLA 1QT1A 2AKZA 3NQ2A 5C9ZA 3WH5A 4PC8A 2XN1A 4FX6M 1LLWA 2W6RA 4BR1A 5FSEC 4EPDC 4F0RA 4O1FA 3TQKA 2GVEA 3GC4A 3FGCA 3L4VA 3WK0A 3I6TA 4XQ6A 2YL5A 2OYMA 1LG1A 4GNVA 4NI3A 5A8GA 2C7FA 4Z1AA 3NM3A 2C16A 3ZVIA 2CBJA 4KEZA 1KBIA 3H8AA 2DSVA 3VFLA 5JH2A 2WC7A 3TN3A 5PTDA 4CCDA 1LL6A 1IXNA 3NG3A 3NQEA 5CPMA 4AMAA 4HOZA 2E09A 2CZFA 1VYSX 2FHCA 1GVIA 4IUOA 3LZ5A 3PUOA 4QG6A 3MBFA 3SCRA 1V02E 2BY1A 1MXDA 3AXKA 3AWOA 2QAFA 4L4MA 4NVTA 1YXDA 3GFXA 1GG0A 2C1HA 5G2HA 2GK1A 1X98A 1S2WA 3SBFA 2VD9A 5ECUA 4L7ZA 2HZGA 3IACA 1CB2A 1EHAA 3FIGA 3C52A 4G2DA 2OGJA 2X0HA 3WJZA 4UTHA 3PAOA 4N42A 1GTEA 2XIOA 3SUTA 5HQEA 2QDHA 4LUIA 2CKRA 1POJA 3NDZA 5AC6A 3OW1A 3AC0A 3LRKA 2WYSA 3EPMA 4QE1A 3BQ6A 4NAEA 3H2EA 4ENLA 5E0CA 3OGSA 1R3TA 1XIFA 4XD6A 1Z44A 3NZPA 3L2LA 3H12A 1HJSA 3ORWA 3MJMA 1AFSA 5FSDC 3PTKA 3RILA 3GXMA 4GRSA 3VDBA 1RK5A 1F8MA 2QCNA 2GVLA 1K9EA 3FGCB 3T8LA 3CT2A 1KGXA 2WXDM 3H22A 2Y5SA 4NP7A 3NQCA 1WKDA 1XLIA 1ONRA 3VI2A 4CQBA 1ECEA 3APYA 3UXKA 1BF6A 1QNPA 2YL6A 2WQDA 1QNQA 5I07A 3PTDA 4F0LA 3AHXA 4NI8A 3F4DA 3HMJG 4M1BA 1EF3A 1OFEA 3W1UA 4IGHA 1EDQA 2WMGA 3UWVA 4Y6GA 3M0MA 1O68A 1K3UA 3QQWA 3EDKA 4HGXA 4H8HA 5M17A 2YZ5A 1HVXA 5HQLA 3L5AA 4IMEA 4MFEA 2WVSA 3T0DA 5C55A 3TLLA 1TR1A 4J3XA 2WWCA 1P0NA 3CNYA 3L4TA 3ANYA 4A2SA 1S5TA 3NQGA 4CN1A 2I7GA 2OLSA 2QQ6A 3LERA 4E4UA 3WQWA 1U83A 3JW7A 1PTGA 3KBJA 3PPCA 1XLGA 1XYLA 6TAAA 3DYMA 4I7WA 2QPUA 2E9BA 1XBXA 1CLXA 1GONA 2CZVA 3IGSA 4D8LA 3UJ2A 4O52A 3EKGA 5HK4A 1ADSA 3ARZA 3H24A 3DFNA 2HS8A 5I03A 3HM7A 5HANA 3OA5A 2VXNA 3P82A 1DXEA 1QOPA 3FYPA 2I5IA 4YTUA 3VM5A 4LUSB 4JX5A 1SO6A 3V75A 1CYGA 1R38A 4HQVA 1TVNA 3DHUA 1FXPA 4PUUA 1WX0A 3FY1A 3GH7A 3GVVA 1X1NA 4FNRA 5EMKA 4HPHA 2Q8XA 3IIZA 2G4JA 4AD0A 2WZTA 1RVKA 3WNNA 4FIRA 5GNXA 1XSIA 3SN4A 4UFIA 2PDXA 2NX1A 4H00A 3MJYA 2A3BA 5IXEA 3K2GA 1JEZA 3IAPA 2NQLA 1ZCCA 1Q8AA 2FFCA 1XR2A 2CESA 3UP8A 2FQIA 3GZAA 1UMYA 5EY5A 3UJFA 4XUGA 5M2FX 4S3EA 1LOLA 3G2GA 1GT8A 2BLEA 2ASHA 4LNYA 1XLFA 2WSKA 4TX8A 1SFTA 1RLDA 1B3WA 2PLMA 4C6EA 1PWMA 2FMOA 3CHDA 3EX3A 4KESA 5LKYA 2A21A 3AU2A 1FH8A 4DO4A 5CLWA 1H7RA 3W1AA 4LY4A 4W86A 3W2JA 1OT2A 1JIBA 1PYMA 1FP8A 2ZC1A 1SW3A 4DX3A 1EOMA 3C56A 4KW2A 2EQDA 3VE9A 3O15A 1VFOA 4NZ4A 4E4PA 3TNOA 4QSFA 4NT0A 3LSBA 4WVXA 2A1YA 1KTCA 1RAKA 5I77A 3H23A 1Y5XA 3E5PA 4YCOA 1UYQA 1UWTA 3QZ6A 3PP7A 2ALDA 1P1XA 4OBTA 4H6RA 4N4PA 3D3AA 4WY0B 1QI3A 3AICA 2IKJA 3BARA 3K5XA 4LAUA 2UWFA 3VZYA 3N2CA 4J27A 3C2EA 4JTHA 2QVHA 5DXYA 1VCGA 1D8WA 4G5DA 4HNTA 3SRFA 1JXKA 2PS2A 5JIWA 2XGIA 2PGWA 2VR5A 3RMEA 1FA2A 2OXNA 3VIOA 3B9DA 2QXWA 4TXEA 5G1MA 1KD0A 4DPQA 4L1GA 4MKNA 1VC4A 4MDPA 4CCEA 2IW0A 4MNJA 2YFOA 5CSYA 2PWVA 3ARUA 3CUGA 3NAVA 4Q4SA 3WLJA 5A2BA 2PB1A 4MJMA 4JQ2A 2ZA1A 3VINA 5AVNA 1PIFA 2Z1KA 1XSKA 1VJZA 2ZX7A 3VIPA 3G3MA 4AQLA 1BD0A 2YBVA 3W83A 2BY2A 3ZIZA 3FHQA 1FDZA 4U5IA 4DJDC 1SJDA 3RO8A 1X97A 1GTHA 3LEPA 1E6NA 4K6AA 1VRDA 4Y9NA 2Y8VA 5D32A 1SO5A 4KIRA 4GJ1A 3UXLA 1Z6KA 2D22A 4TQTA 2PCEA 4HPXA 1Y65A 1LQAA 1J79A 3BCDA 4JS3A 4C6JA 2J77A 3CUJA 5G4HC 4DPPA 3IUIA 2C13A 2E5DA 3H4GA 1ZJBA 2YDQA 4JYEA 1XG3A 1G4PA 1L6YA 3NZGA 4ZSTA 1KB3A 3A12A 4F9JA 2OMAA 5DMLA 3UPMA 3TKFA 4LUTA 3HFTA 4GI4A 1JGMA 2C14A 2E25A 4ZOCA 4W7WA 2H6RA 1XLAA 1UR8A 3UQNA 4KS0A 1XC4A 1MMFA 3E9AA 3K46A 5TNVA 2J78A 4MZYA 4ML9A 3BLIA 4D72A 3W28A 1KC7A 1TG7A 4HTBA 5M03A 3UY8A 4Y8EA 1GZJA 4ZSUA 4Q8OA 1S39A 4MJ2A 5IRPA 2YDSA 1J6OA 3N29A 4M7TA 1OFQA 4V2XA 4GX8A 4NUWA 1FFQA 4QEEA 4DN1A 3WDPP 1MNSA 2CU0A 2GUYA 1JCJA 2BDQA 5IOBA 1LDCA 2DIEA 2AGKA 1H1NA 4JNYA 5F7UA 2BZNA 2KZHA 4XZIA 3EMCA 1JCMP 3BURA 4DNMA 3QPEA 2DY3A 1QHPA 4HN4A 1FOBA 3W87A 2YX0A 3TFXA 3WNKA 1W6TA 4AVOA 4HZMA 1TREA 4X22A 4GFIA 1DJXA 2OG9A 3OGVA 4CD6A 4NSBA 3WLRA 5LXEA 1E4MM 2VELA 2SFPA 1FWBC 1CIUA 4ZQOA 2PDYA 2ZZ3A 3PNUA 1HQTA 4QS5A 5FJIA 1J93A 4AZ6A 3BLFA 2ZUVA 5D03A 3AHYA 4CN6A 1BKHA 5D9PA 4R53A 3DC0A 1HJQA 3WLKX 3I68A 3WD4A 1F8IA 5I3FA 3C4UA 1GQKA 2VI0A 3R25A 1FTXA 3PFRA 4LRTA 3MCOA 5JBDA 4JKKA 1KM0A 3VKBA 4JHMA 2TMDA 1X39A 1C7SA 5JXQA 4JZ5A 2XVPA 1PZ0A 2P5NA 1W17A 4O13A 4ADUA 1J4EA 4EVZA 3UCCA 3BSHA 1ITXA 3CZEA 3M5YA 4BI6A 3E3HA 5BOOA 4AIOA 1W31A 3CBWA 3MMDA 3KL5A 1XPYA 3EWDA 3STFA 3DXIA 4J4KA 4C7DA 1BWKA 1E1CA 1XL9A 3VNMA 1V02A 4IP4A 1OVDA 5HMFA 2YDRA 4FF5A 2ZRVA 4LV9A 1SGJA 4D6GA 3OBAA 1W5MA 3SECA 1FWSA 5CBIA 2G3FA 4O54A 3POCA 4Q4PA 4G7EB 5JBFA 2YXGA 5CAKA 1FWNA 3N13A 2E28A 1HO4A 3S5NA 4LANA 1NWRA 4HKPA 2X1TA 1L2QA 3MHGA 3OVGA 2VZOA 5AHMA 2X30A 3UR2A 2VR4A 2XFWA 2FPVA 3DHPA 3O63A 1E51A 3BMWA 3L67A 1DIDA 4XV0A 2OGYA 2W62A 4CU7A 3LHTA 4S3BA 2J7BA 4UFHA 1LOQA 4UUIA 3SJNA 3LD5A 3RNDA 3MUY1 1EZWA 2VRJA 2VOTA 1G4EA 2YFNA 1ZNNA 1GHSA 3G0XA 1R7OA 3PVFA 3S3GA 4GY7A 1E6RA 3K4WA 3M7SA 6A3HA 3T09A 3P61A 2QR6A 4CD8A 3GXDA 4EPKA 1ELSA 3RX3A 3PG9A 5AN7A 2GWGA 2A3CA 1VIZA 1O94A 5LIKX 4O1EA 4XISA 1HKJA 3WDQA 4O14A 1EJRC 3N4AA 1QPKA 3E96A 1Z3NA 1V03A 1P0EA 1E9LA 1CCWB 5D2VA 1FHDA 3FJNA 5D2YA 3H4WA 5HMSA 3UA4A 3I7RA 3PZUA 1ZENA 2OQYA 3K1DA 4UFMA 1B2YA 4HPJA 5FCZA 2VJXA 2J7EA 3E74A 3EEZA 1IZJA 1QMLA 3E0LA 4LRSA 4RV3A 3GQYA 3H70A 1V0MA 4H8VA 3K1GA 1R5YA 4TX6A 1PYFA 1G7UA 4U2ZA 2HXTA 3M5VA 3N2OA 2EG7A 3BZGA 1H61A 1K7FA 2OO6A 1XLKA 3T4WA 3FXGA 3OVPA 4OBSA 2QF8A 4NJIA 5D05A 2VM8A 2VZVA 2W61A 1TE1A 3ZOAA 4V28A 3VCCA 3NL2A 3DI0A 4GYKA 3LCGA 4GH3A 3PAJA 4V1YA 4IX2A 4AF0A 3VGBA 1ZJIA 4KERA 3GXFA 3WNPA 3N12A 4GISA 1ESWA 4Q4MA 4UBPC 4FX8A 2QMKA 2J47A 3C2YA 4OTKA 1JAKA 3SCNA 1UWSA 1V3KA 4U5KA 2Y88A 1MDRA 3BXWA 5GPRA 2Q8ZA 1NSJA 4D6HA 1FWRA 1F07A 4M24A 1GPFA 4O17A 3SJ3A 3TN6A 3W7JA 4GIYA 3WLMA 2ZZ6A 3SCSA 5HMEA 1TQXA 4IWWA 1BPLB 2D0GA 1G5AA 1W3IA 1QPQA 3T81A 3P0XA 2X7WA 4YS1A 3V18A 2NUWA 2QIIA 4PTVA 1T96A 2V3GA 3OLIA 1H1YA 1UPMB 1IEQA 3QRHA 1PWLA 3LI0A 1CB7B 4S3JA 4IQJA 1QNOA 2NQZA 2QCFA 2EAWA 3TCEA 4B5WA 1F05A 2D24A 4GO9A 5TBOA 4BF9A 1I8JA 1R3RA 1QPNA 4HZ7A 4F9DA 5T9BG 1J96A 1FKWA 4R33A 4A29A 3E0WA 4F2UA 4B2DD 1H50A 2DORA 3T08A 1TR9A 3V0SA 2ZUSA 4F2BA 4YHEA 3MQTA 4WSKA 3CZGA 1Q7MA 4Z1BA 1LUCB 1XKJA 2WSPA 5LIWX 3KOFA 1L8NA 4HNVA 2XWDA 4OGZA 4C6PA 3RU8X 3TAKA 3PHAA 2XIQA 3B40A 1NWUA 1MEIA 4IQEA 5AZ0A 3JVAA 1BWVA 3PY2A 4DLFA 5LA2A 2OZ0A 3EX6A 2OQLA 3TEVA 1GVFA 2VX7A 3MSRA 3ZT7A 3RGTA 2ZTKA 1EJWC 3THUA 2X1UA 1XINA 1SQ7A 3WH6A 3G6MA 1B5TA 1CDGA 1XQLA 1TZ9A 4HMCA 1AUSL 2VZSA 1BVZA 4Q8MA 4LV4A 3HFYA 4H9MA 2WAGA 3VE7A 3S42A 1F4AA 4TOQA 5FKYA 3L7RA 4NY2A 5D04C 3W02A 2ESCA 4HPGA 1OZQA 3T0TA 4IIFA 4CLMA 4Q7IA 3GR7A 3BJFA 3WY1A 1BKSA 1EH9A 1TKKA 3B4YA 4JNMA 4A8NA 1J10A 1NFBA 5EBAA 1GORA 1OY0A 3FEMA 1JPMA 2OWCA 4UMCA 1UJPA 1OWQA 5GQBA 3PZNA 4J2MA 2J66A 3MMTA 4FNPA 1YXCA 3GR4A 1QWGA 3RDKA 1PX3A 3S2MA 4NU7A 3ARRA 1LT7A 2PF8A 1LZOA 1IWBA 5E9AA 4KH2A 3W7KA 4R5EA 2Z27A 2ZFAA 3VK5A 3N6HA 1XPGA 4HNOA 3C2OA 1B3ZA 1PCWA 3FLUA 2RGLA 1HTIA 3TH6A 3RITA 1F3XA 4D71A 4UR9A 3SQSA 1SUXA 3RHGA 2YW4A 4HSNA 3FA3A 3ARQA 5M5DA 2QAPA 4ZXLA 5AHEA 3OBKA 4ACYA 3TIMA 2B0MA 4RXGA 3QSRA 2XPKA 1G69A 3FW6A 1TPC1 4I9AA 2NQ9A 2Z1SA 3HQNA 4N9BA 1P6CA 1PSCA 4OUEA 3SW6A 2ZRXA 4FHAA 3TX9A 3AIQA 4DWSA 4XZWA 1IYXA 3HZ3A 3NO3A 2FDSA 3RCYA 2RUSA 1VQTA 2Z4GA 3FCPA 3KVJA 2NSXA 3MO7A 3REQA 1TV5A 2O92A 1WXZA 4I6VA 1M68A 3SCOA 2RDWA 1D3CA 2PTYA 3LCWA 1UKSA 3NOEA 1LBLA 3BMXA 1R0MA 3VGGA 4DBSA 1NIUA 3STGA 2W91A 3F2BA 7ENLA 3U6WA 1DTUA 3IAQA 3W7NA 4DZIA 2R1PA 1F6YA 3RR4A 1H1ZA 1CGWA 1VFHA 4DJED 3CASA 3LXBA 3VZZA 4BQ5A 2NX3A 3MV01 1WQ5A 4NG3A 1YPIA 5HATA 3UW6A 1VBHA 3UZJA 4CUCA 4EXAA 4B3ZA 4KCTA 2V2CA 4EKJA 3N9RA 3W2KA 1MZRA 3W2NA 4QJ3B 2HVOA 5I3HA 2XIJA 4GACA 2X2YA 2V5CA 2V30A 4LFYA 4JX6A 2ZDSA 3NEHA 4WCJA 1UKQA 4GUIA 2QJHA 4C6FA 2D23A 3AXIA 2DT3A 3TQ0A 3XIMA 4IX0A 1CLKA 4NZJA 3QQ1A 1NOWA 4J3TA 5FF4A 1S3TC 2CLOA 1DOSA 1XCXA 3EX2A 4KFOA 3T44A 2NT0A 4NYUA 2E8YA 2A79A 1HKVA 2H90A 5DMMA 4NJJA 3R4IA 3W72A 2DT1A 4C60A 4B5NA 3G18A 2QEZA 3LI1A 1KBJA 4XUYA 1DWGM 1ENUA 2WVVA 1QUMA 1TIMA 4CN4A 3WLLA 1UR3M 5CAHA 4NJHA 2A5HA 3CV2A 5AHLA 3LQGA 2Z29A 4TMCA 1E4LA 3HURA 3WL0A 3ZR6A 2V69A 2PGEA 3P80A 4R7OA 3L5MA 3G1FA 4CKQA 2XJ7A 3U2CA 1PAMA 1JFHA 3UY7A 4MZ1A 2WO5A 1RD6A 4LWWA 1JI1A 4PBFA 1ONEA 4XO6A 5LA0A 2YB1A 3EWUA 1QVBA 5KITA 3ARTA 5A6LA 3PNZA 2A3LA 2V5DA 1Q4NX 3WUGA 5AHNA 1SYTA 2EXOA 4IQLA 2VRKA 5FI8A 3MP5A 1GPWA 1IE7C 1ONXA 1N2VA 2RH9A 3SRHA 1E9IA 3QEZA 1SFSA 3TW6A 4CEUC 3K4AA 1RV8A 3GTXA 2GOKA 3B0VC 3SQMA 1VKFA 2QDEA 1KXHA 3VOIA 4HNUA 2ZZ4A 1OK6A 1HG3A 4JL1A 1E6XM 1W3JA 1SR0A 3N73A 2DW7A 2ZVRA 3IK2A 4GQBA 5JBEA 4ZQCA 3WNMA 4LCRA 3R5EA 5GJPA 3W73A 2TSYA 2XIMA 1XI3A 4JFVA 1RJQA 3A24A 5BXSA 3QY6A 2WW5A 4IISA 3MUXA 3GNRA 2CHNA 4WJEA 2AMXA 4W7VA 3QW4B 2D2OA 1O1HA 4DM2A 2IKGA 1FKXA 3WQ6A 1EDGA 3MHUA 4OVXA 4XWUA 2Y2WA 5LXXA 4J1OA 1WDQA 5C70A 4I6KA 1Y0EA 1I2QA 3HN3A 4IFKA 3GDLA 5BCAA 4HOXA 2PRHA 1JZ6A 3P93A 3UZWA 4FNTA 4O50A 2AKMA 3R7MA 4JCLA 2UY2A 4JYDA 3QMRA 3NQMA 1LBFA 1DORA 5HMDA 3W7IA 1JDDA 4CQ9A 4V15A 1YRRA 1S1PA 3BWWA 4X2RA 2EHHA 4GY1A 4YTRA 1P7TB 4FR1A 1V3MA 2G95A 3V0UA 3CT7A 1P48A 3DGRA 3P7YA 5M1TA 4C5ZA 1EUAA 5C9UA 1MDLA 1RBLA 1XH0A 1QO5A 1FWGC 4JFSA 1PKLA 3LMZA 3PM6A 4FOKA 3EOOA 4XTDA 2O4QA 1BAGA 2XZ7A 3EXSA 4BI7A 2F6KA 5AYYA 4D1JA 1PXGA 2H8XA 1S5MA 4JIHA 1H3GA 1A5NC 2TPSA 2BVDA 4HPNA 1TX2A 4E6MA 2BHUA 3M44A 3WQFA 3NTYA 3CZJA 1FDJA 3O8AA 2F6XA 2DJLA 1MUCA 5DANA 3OQ8A 1S5NA 2OLAA 2Y7GA 3CPUA 3XISA 3M0KA 2DZTA 1YPXA 1LWJA 4R3UA 3F4NA 2VNCA 3O2LA 1ICQA 1R86A 3IRSA 4AFYA 4HCLA 4GK8A 3KHDA 3B0PA 3E2SA 3C3UA 1H63A 4NZ1A 3KLKA 1UA3A 1T5AA 1C8QA 2EPLX 4CQ8A 5D9OA 5F2LA 4JQ4A 1XLBA 4AC7C 1H2JA 5FL1A 5BMXA 2J4GA 3F1QA 2E9LA 3QTGA 3ZJ6A 2DP3A 4IPPA 3E38A 3NXFA 3UPBA 2X0YA 1ITQA 1BYAA 1O66A 4H4IA 4CVUA 5FAJA 1YTKA 3M0JA 4R7WA 5CBJA 4IIDA 5HULA 3TYCA 4GGBA 2GGIA 4IP7A 3A64A 1L0PA 1JNDA 3G0SA 4K68A 2A3HA 1K77A 4BQ3A 5KSWA 3HU7A 1QU4A 2QCHA 3DBNA 1RA0A 1X7FA 2Y62A 3G22A 1MQQA 2H3BA 4B15A 1UP2A 3JZUA 2POTA 4NRSA 1UC5A 2O9TA 2TRSA 4GKTA 3COTA 1XSJA 1TUXA 2WMFA 2ACUA 6ENLA 1TJ0A 1LP6A 4XZMX 1TWSA 3M5ZA 5BWFA 4FB7A 4DBWA 2G37A 4LW7A 4ZOEA 4LVGA 3BDKA 4MB1A 5E1QA 1JCYA 3SY1A 3W9ZA 1TTPA 5G5IA 1OX5A 1ZP3A 3GE7A 3BV4A 1JXJA 4MWAA 1DKWA 3KRUA 5D09A 1TRIA 4NNBA 3H6OA 3OIXA 3CTTA 4US5D 4ZFCA 2E7FA 2WCAA 4I8DA 2YCIX 1HKIA 3CB3A 3FSUA 1A5AA 1JGIA 2V2DA 3VNLA 2Q6ZA 1P7TA 4QX4A 1FWDC 4WDUA 3WK1A 1VPQA 2EG8A 2DV0A 1NP2A 2GDUA 3WMCA 4ZQNA 4DUWA 2INEA 4EK7A 3EXTA 4NASA 3K8MA 3ITOA 3NURA 4OZOA 4A3QA 4MG4A 3W82A 2IPFA 2R94A 3GKAA 3MBDA 2QULA 4LPCA 1B54A 4E2DA 5HNTA 1TZ7A 5TIMA 2QV5A 5EKYA 1KQYA 2P8BA 3GNPA 4Q33A 3SUSA 4NL1A 1BYBA 3RRAA 3LOTA 3RJXA 1F6KA 3VD9A 4Z2HA 1JFXA 3SSZA 1XIMA 2TYSA 4KWWA 3A22A 1B1YA 3UWWA 1FHVA 3HF3A 4ZFMA 3MS8A 3NM1A 4LVAA 1BYCA 3S8HA 1ZB5A 2B7NA 2FZ9A 1E1CB 3LU2A 4Q4QA 6CGTA 1UH3A 3F4CA 1B3OA 4GVFA 1R46A 2Z6JA 3QKEA 2R8WA 1TA3A 2AQVA 1OGBA 4HJFA 4QJ1A 2B4GA 2FZNA 2PI6A 4ATDA 2VC9A 3C0JA 3VFCA 4TR9A 4CGTA 5H1WA 1OJXA 1EPXA 4GXPA 1J0JA 5I23A 3RR1A 1G6CA 1KM2A 3AI0A 3VDHA 4JQ3A 3WFAA 2DFAA 5FAGA 1EC9A 3S4TA 3KCJA 1F61A 3VUSA 5J8LA 5FJOA 4H41A 4DJEA 4PRRA 2C6QA 1KKRA 3QMTA 4C6KA 4EOUA 5K2ZA 3HOJA 1NF7A 1KLYA 1CECA 2VZTA 1YBQB 4HSOA 4E5TA 3JRKA 5D8WA 3TMQA 1G67A 1IXQA 1HKMA 2I1OA 4PTNA 3SEPA 2OPJA 3UYIA 2DDXA 3DX5A 1HIZA 3MKVA 4IPJA 2BP1A 4ICMA 1V0KA 3MPGA 1JDCA 2P53A 3MHFA 4DWSB 2A6NA 3KS5A 1LRTA 1UR1A 4Q8PA 2MUCA 2KX9A 3QLLA 4HCDA 4NZFA 4GQQA 3CH0A 1S2TA 3KTXA 4GC4A 1W54A 4PSPA 3NDYA 3D47A 2WLZA 1C3FA 1AQFA 3TUUA 3GFYA 3R0DA 4FF7A 4PUWA 4HK7A 1JZ7A 4UTJA 1PKMA 3GY1A 1Q6DA 4AX6A 1EP2A 1TPH1 4RDZA 4PTDA 3OYZA 1JQXA 3GHTA 3M6DA 4XZNX 3DN5A 1P1MA 3D0CA 5EU9A 2HPMA 4QDWA 2NQHA 2PDHA 2HDJA 4XIAA 4GQRA 5G2IA 3QHNA 3HV9A 5K4XA 1W1A1 4K38A 1R85A 1GOOA 2BTMA 4X63A 1DJNA 1O5QA 1DWJM 3GB6A 3IGHX 1QR7A 3AXXA 5DX7A 5FIPA 1N7KA 2OX4A 1JG9A 3OLEA 4C6MA 4LYPA 4MLJA 4AHOA 1P4CA 5E0KA 1VRXA 4POCA 4FX7A 4D2JA 2P3EA 1E40A 4ES4A 3FYOA 1OX6A 1WYIA 3M0XA 3HPFA 3IJ9A 4MPKA 1C92A 5KINA 4REQB 4AU0A 3WQDA 9RUBA 1R6WA 4DJFD 5F2GA 1SJCA 2V9DA 1F74A 1NF0A 3H4XA 3SCWA 3W86A 3WKZA 5GNZA 2G3NA 3EYPA 2WKJA 1EXPA 1E1FA 3KRZA 3PN8A 2EPOA 2VVNA 2DVXA 2HCVA 2JEPA 3B8VA 2XFRA 1VFTA 4JYFA 3W24A 4MPQA 5I3GA 2WKGA 4HZ8A 2RJGA 1OINA 3W29A 4ZXOA 3GSMA 5RUBA 3DHFA 1EA9C 3TTSA 5A8NA 1XDLA 4DJEC 2IQDA 3ES8A 2JEQA 4JTJA 5BROA 2HVNA 4JKMA 1AL8A 4NAEB 4Z0JA 1OADA 2D2HA 1QW9A 3SN0A 3CZKA 4MKSA 4OV4A 3ARWA 1A0DA 3S6OA 3SUVA 5HUOA 2AQOA 3DBPA 1NTHA 3CUXA 5KZMA 3AMLA 3KWXA 3W1MA 3ZWTA 1GHRA 1VFFA 2RKXA 1A5UA 1TRDA 2C15A 4RNJA 3G8EA 3O05A 1E0WA 1W2VA 3TWAA 2E6DA 3VDGA 4ERIA 1GOIA 7A3HA 4X0NA 4R34A 1UR4A 4IPIA 4FK9A 1AVAA 1MVYA 4F48A 2YCJA 1B30A 1OD8A 4P5UA 5D9NA 3F2CA 3W7PA 4AYSA 3LHYA 1TJ2A 1QK0A 1Q2SA 1JCXA 4XO7A 3TN4A 1JI2A 3IPWA 3VIKA 3LCXA 3HPAA 1EIXA 3QV8A 3ZLFA 1QI5A 1ZZMA 3R8RA 4ZGYA 4EWND 4P7NA 4MZ8A 2WSRA 2V82A 1KXVA 4FOUA 4O57A 3MT1A 2ZCGA 5CC6A 4GX9A 1YPFA 1UP3A 2WOQA 4W93A 2C1IA 3QC3A 3GTNA 9XIAA 2UY4A 3RPDA 1PZ1A 5T9CE 1C29A 1QAPA 1FX6A 3PPGA 3H2OA 2RFGA 4QNWA 3WDHA 2WM1A 3VTRA 3ITVA 4IM4A 1W8GA 4GUGA 3GZ3A 2YXOA 4LS2A 1MW3A 4GZEA 1OK4A 3USBA 5DF0A 3GX9A 5A94A 4DYJA 4WRHA 3ZMRA 4N2YA 4PODA 2WB5A 2UY5A 4LUSA 4A3HA 1OT1A 1M7JA 1NFGA 1VBJA 2BODX 1TWZA 3N34A 4O0QA 3UEQA 1ZAHA 4E2OA 8XIMA 1KO0A 2W0UA 1S5VA 3GNXA 3SZ8A 1I60A 3LGDA 3WG6A 3BV7A 1KFBA 3AHTA 3KZSA 3CL7A 4Y7EA 3LHWA 4GQ0A 1RQBA 1TIWA 4YPJA 1BWLA 2REQB 3UT0A 1IQ8A 3GDRA 4Y9OA 3EWBX 2WM0A 2Y70A 1BTMA 3JS3A 4Z2GA 3G1HA 4JN8A 5LA1A 3QOMA 1BXNA 1LM1A 2I9EA 2FHBA 1LQ2A 5GJNA 5A6TC 1F73A 4CD7A 3I4EA 5DO8A 7CGTA 1PPIA 3ATZA 4Y9PA 1C93A 1GQIA 4FO4A 4CD4A 3DKLA 5GJMA 4Q8WA 4M5PA 1AH3A 3GXNA 4NZCA 3VXGA 1AJ0A 2GFTA 2ANUA 3C6CA 4B90A 3VC6A 5AVHA 4UTTA 3LPOA 1JF5A 4RJEA 5CGTA 4ORMA 5DMNA 4M6VA 3WEMA 1K9DA 4PMVA 4UTIA 3P8IA 3LLXA 1QXLA 3CK5A 3L4XA 4ZR8A 3QZEA 4PUJA 3VM7A 1XFCA 2Y5EA 5BZAA 2J7FA 3VNDA 4DBEA 2NXIA 7ODCA 1JULA 2L5HA 3CAKA 1A5CA 1E71M 1TPEA 2WHMA 2YCLB 3CZLA 1BGAA 1TMHA 1VBUA 3VKDA 4JIPA 4H04A 2OU4A 4HK6A 1KA9F 2J79A 5BMWA 5MF5A 3KAOA 3GFZA 2H8ZA 3DHDA 1MNZA 3Q67A 4MYXA 4W9TA 1P0DA 1GZGA 2VUNA 3MCMA 3QY8A 3LV6A 4QM1A 4S2BA 2BNJA 2G96A 1XLLA 3TJ4A 2YL9A 3GD6A 3CQ0A 5FJJA 2ICSA 3PANA 4O1CA 1RCQA 3SCUA 2PRLA 3OZOA 1A5BA 1BF2A 3QOKA 3VMNA 1JZ3A 3MI6A 1TJPA 5CPQA 3V3WA 4C1LA 1ISZA 4W5UA 3CUIA 2BVWA 1CGXA 1AJZA 3HG5A 1LWIA 1KQZA 4FS9A 3TR9A 3TJXA 5IFTA 4ICCX 2GGEA 4MY8A 3Q94A 5CJNA 2CWXA 4N6FA 1AK5A 3I7QA 2VCCA 3TAOA 3BE7A 3NVTA 3HO8A 1M65A 5C0QA 1AW1A 1T41A 4PB3A 3NUKA 3A3HA 4BWLA 1H11A 3F4VA 1A50A 3PG8A 3CHEA 4AZ7A 1QOXA 4B4HA 1E70M 2IPJA 4Y8FA 1XUZA 5E09A 2WNQA 4I5UA 2R1NA 2ZQ0A 1XM3A 2E77A 1TWWA 1DJYA 2DUXA 1C8XA 2PDWA 2BGNE 2FB3A 1DTNA 1TV7A 1B3YA 2HQAA 2INFA 5I3IA 3OA3A 4HVXA 3DDMA 4FLSA 3GNNA 1TVPA 1JD9A 1VCFA 2FGZA 4WJXA 1DJHA 3H54A 4DI9A 1REQA 1XXXA 1UHVA 2OODA 4ZTYA 3ONBA 1LQ0A 4PRWA 2HRWA 3LCFA 1KM4A 1PZ3A 4Z1CA 1OF6A 1VEMA 1ME7A 2CWNA 4HSHA 3VVGA 2E6YA 1YQ2A 1KFEA 4MF4A 4N9CA 4D6CA 3U9IA 3L4ZA 3UYCA 3W01A 2XVNA 3MV11 3IUHA 3S2CA 4DO5A 1ML1A 3KOXA 2ZYFA 1ZU8A 4US5A 3MKKA 6REQB 3DIPA 2WLYA 1UZ1A 4RE2A 1ISVA 1QPRA 4CNSA 3PZIA 4L65A 3HQ1A 4GA8A 4J7RA 3N15A 2YBUA 3A21A 4AWSA 4CEXC 4C90A 4A6GA 4FNSA 4C6DA 1BRLB 4UMAA 4PRTA 3WLTA 1F4HA 1U1UA 3QN3A 4M82A 3TOPA 1SU5A 1SZGA 1EYEA 2GQ3A 3M47A 3E0IA 3WJYA 1VFUA 2RHGA 1V93A 5BU9A 3W1PA 2OSWA 1Z41A 1JCTA 2I56A 5CQ1A 2VP8A 2NWSA 3VNJA 4ZQPA 5LGXA 2PWUA 4EPEC 2HK1A 3L12A 1A5KC 2DPEA 2FJUB 3R12A 3LTYA 2O55A 1SFJA 5CKSA 4WGHA 2OTDA 2XGBA 3LNMA 3LENA 3UJRA 2BX7A 2P3ZA 1AZ1A 1DIKA 5CGQA 1UWRA 3OTRA 3W1QA 4PL2A 2E68A 1ZRQA 1ZQ5A 1UD6A 2IUZA 4JIEA 5BW6A 1EF2A 2E5CA 2XFYA 2QJJA 2QJIA 1EEXA 5HOSA 3GTIA 4WXZA 3S9ZA 3UU0A 3ARPA 1VHCA 2O9PA 3M16A 3RLHA 2PDKA 3TTOA 4G7FA 1HP5A 2GUUA 5D8ZA 2ISFA 1TTIA 1G7VA 2X05A 1TMQA 4QG9A 4L56A 2VTFA 1FCBA 4IFRA 4X61A 1YIXA 4KIEA 4UTLA 3HGOA 1A4LA 3P5ZA 1WB0A 3JR2A 1BRLA 3TYEA 4AD4A 3OOQA 3QY7A 4M29A 3G1YA 5HINA 4LYRA 4L4OA 3TROA 3W1TA 3CWNA 1NDWA 3VGEA 5I06A 1HZYA 3QH2A 4HU8A 4EAYA 1B3VA 3CWHA 3BLEA 3IK4A 4XAZA 3N4EA 2Z2BA 1PTAA 1QATA 1UH4A 3L66A 3N19B 1KFJA 3A9IA 3PR2A 4S3GA 2JFEX 1XV8A 4ATLA 4H9TA 1XCWA 4B9ZA 5HUPA 4YL2A 4KEMA 3LHVA 4RK8A 4J3WA 4KEVA 5IBXA 3MP4A 4G9PA 4LYKA 2DSWA 4GPNA 3GIQA 2EJ1A 1LRNA 4YJ5A 1AQHA 1OG6A 3G1XA 3U0HA 4KT2A 3PS7A 2C71A 2XFFA 2DVTA 3URQA 1RY8A 4UR8A 1MI3A 3GHRA 3NSMA 3O06A 1FH9A 2OWWA 5E6YA 3B05A 3SGUA 3MTWA 1PJ9A 2BMBA 1RD5A 3W76A 1C90A 4AZHA 5AYBA 3S9YA 2V5JA 1J6PA 4JTLA 3T40A 2XN0A 4WUIA 3TVAA 3NPVA 4DUXA 3GC2A 2XSXA 4J3VA 1HJXA 2BXYA 3MVIA 1D7FA 2W27A 3KFTA 3VIHA 5XIAA 1BFNA 1DPMA 3WBWA 2E1WA 2V0TA 3UWZA 4IJBA 1WA3A 3WJSA 2A6LA 3AYTA 1CTNA 4RZ6A 3UXDA 3UGVA 4XSMA 2A4AA 3VYLA 3LRMA 3S1GA 2WNNA 3VOHA 3R89A 2XU2A 1VLWA 2V8ZA 2VZUA 3MVTA 1QTWA 3KWSA 3DG7A 3EZ4A 3KRSA 1W37A 2NZLA 2NXGA 4P8VA 5D33A 5GVJA 3V35A 1VYPX 2V68A 3AIEA 2OFJA 4CCCA 3FVMA 4ATWA 1SZFA 1OGGA 4W89A 1Q66A 5T26A 2OB3A 4DYKA 4BFAA 1RVGA 3L2IA 5TAOA 2WMIB 3BCJA 3EGJA 2ATMA 4UTUA 4BK9A 3ME3A 5A6MA 4WDWA 4ZOBA 4MWAB 3SUWA 5LIUX 2EO7A 3W7LA 4RDYA 2IQTA 1GNXA 1MW2A 3GH4A 2WQPA 5FJRA 3SCQA 3TQPA 4U4MA 3EWCA 1X6LA 2X40A 3RYSA 1R8LA 3ZJ7A 4C6IA 5BRBA 2PWHA 2PTDA 4OFCA 3BAXA 4AD3A 1YHTA 3B3DA 4XVDA 3KDOA 3FJLA 2PDCA 1LLZA 4E8CA 3IVSA 4JY9A 1ZSXA 1A5OC 3NL3A 1EHNA 5CC5A 3VZXA 5LHFA 3GAKA 1OG0A 2CLKA 2GDQA 1GJUA 3ZM8A 1LTDA 3LNPA 1OSEA 4C6LA 1KM6A 1KKOA 3NYDA 1ZBWA 1V6TA 4K8HA 4NYYA 2ZWYA 4J28A 1PKYA 1PTDA 1K6WA 4FP1A 2WC3A 2WSQA 1MEWA 2VRQA 1L8PA 2IXVA 3PZOA 1XC6A 3O7UA 4HYWA 3THCA 3WLIA 5CJ5A 1MRAA 5HWMA 3NPXA 3A4JA 3PSWA 5F1UA 3GG1A 4UNLA 5AY7A 2GK1B 2PWDA 4C1NA 3N04A 3G1SA 3UZXA 4W85A 4H2CA 1R2SA 3S0CA 4O53A 1O12A 3GTHA 1CXIA 3W4RA 3VX1A 3WENA 3M0ZA 2BOEX 1ZBCA 1CZ1A 2ZWZA 4X9SA 4DF1A 4K37A 1UD4A 4NIRA 3UBPC 2Y1HA 3UZZA 3BG3A 1ITUA 1K8ZA 3SGGA 3UWUA 1JZ5A 2YPIA 3WNLA 1DJGA 4OWGA 4UQ9A 1ZHAA 3LHZA 1UKPA 4UQCA 4PMYA 4G6CA 2ZZ7A 4YYCA 1E1EA 4LF2A 3CXOA 4DXVA 5K9XA 1G1YA 1VFLA 3AJXA 2XYLA 3DFQA 3L4YA 4M6QA 2NV9A 4DJDD 1UWAA 5FJTA 2ALRA 4QAWA 2DGAA 3N2MA 4PCFA 5EMLA 1OCJA 3R13A 2GVGA 2FFIA 4WDTA 4AG0A 4RNHA 3AYRA 2XVLA 1UBPC 3WBYA 4PGLA 4XAPA 4D6IA 2J6XA 2Z6IA 3QFEA 1XYAA 4AZBA 3DG6A 1X8FA 3GHUA 3MDWA 5F2MA 3AZSA 2JIEA 5A8OA 4A05A 3E5BA 3WH9A 1W1IE 1VBGA 3EWZA 1W3NA 4M8UA 4MIMA 1H7WA 4CNPA 3BICA 1YNQA 4RPQA 2YLAA 1RQEA 3EMQA 1YKWA 4H6KA 1ISXA 4FEZA 1C9DA 5B80A 1UD5A 5C2CA 3WQOA 2PC8A 4IPLA 5EMUA 2BVTA 2BB0A 3I65A 3LZ3A 3N9KA 2D20A 3M07A 4WKAA 3B04A 1C8VA 2D3LA 1B90A 3GUGA 2O9RA 2WMHA 5F4SA 4GG9A 1U2YA 2HK0A 3PTMA 3CMJA 4YWSA 3SQLA 3CAQA 5MKGB 2BGSA 2J9YA 2Z7KA 4UTKA 2NXHA 3AJ7A 2FGLA 1XIBA 3EB2A 3PBMA 1SR9A 1E0VA 1U30A 2Y61A 3B4UA 1XGDA 4C6QA 2CETA 5DEZA 1CBGA 4AWEA 2GLKA 3KTCA 3G24A 4F0MA 3WO8A 1IT8A 4JXCA 4CNUA 5F4WA 3GG8A 3NYZA 4O0KA 3CUHA 3ZT6A 1BQGA 4MB3A 3GUWA 4QRNA 4JTKA 4LX4A 4Z17A 2Y63A 5KZ6A 2A85A 4IGNA 4KBXA 2PA6A 1NU5A 3MSGA 1GWJA 3ZO9A 1TPFA 5CH9A 3I10A 3VUPA 1VIWA 3CV7A 1RXOB 3C2VA 3CC1A 1J5SA 2CFFA 1CXHA 3RG6A 4AD5A 3TZFA 2ONEA 1K4GA 3WF4A 3PZGA 2R1MA 3T42A 1VD6A 1Z48A 2CLFA 3QYQA 4MADA 1Z8AA 2WVTA 4PCPA 3AMKA 4GZ7A 4GFSA 1OCBA 2V6AA 5DBUA 4ACZB 1G4TA 5JMUA 4MLRA 3GO2A 5FEWA 4PBEA 4RL3A 1WO2A 3E2VA 2CZEA 1GVYA 3EDFA 4DZHA 2XH7A