2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
2X1SA 2CW6A 5U7SA 4BR1A 5LKYA 4M6QA 2WNNA 3PF3A 2YPIA 5KZDA 1DJNA 4ZZ9A 1GG1A 3W2NA 5LGZA 3P80A 3G8RA 3OVQA 2WV8A 3UQNA 4EF8A 3FJLA 1I2NA 3E12A 4O10A 3FA5A 3EWWA 3E9AA 4UTJA 2OZ0A 4HN4A 2J24A 4UTHA 2VEIA 3QMTA 3LCWA 1D3GA 1H1YA 4UMCA 3U6WA 1ZAJA 3NR0A 3LV6A 3OEXA 5K9XA 2G5WA 5AHFA 5J5DA 1Q3NA 2GUUA 3NPVA 3MO7A 2PCQA 3NQDA 1H7NA 4GWEA 4Z0JA 3IIZA 3W83A 2Y88A 1TTIA 4RXGA 3G1HA 1I2QA 3D0CA 3W7HA 4EOUA 1QCWA 5K7JA 3C3NA 1KM1A 1RV8A 2JKEA 4W9TA 3U2OA 4CLMA 2XN2A 1H7PA 4JTIA 4ZQPA 3NZRA 2C13A 3MP3A 4TMCA 1F2JA 4HPXA 4GBUA 3GNDA 5F1UA 3ZWSA 1BWLA 4L4LA 3W1NA 1F6PA 1GVOA 3VCRA 3G1VA 5TQLA 5FF0A 2J88A 5HR6A 1K7EA 4ICNA 4D2JA 3WFAA 5AHMA 1DL3A 3W75A 3BLEA 4UC5A 2YYUA 1M6JA 3THQA 3PBWA 1N8FA 3B0VC 3WK1A 3TDFA 2QCGA 1JUEA 4DPPA 5EMUA 3PG8A 4R34A 5EA9A 5GVJA 4RK8A 2X30A 4N9BA 5HULA 1YXCA 5KZMA 1MZHA 4CCCA 3NA8A 5DCDA 3N73A 3NGJA 3EB2A 2OJPA 3MI3A 1DHPA 2YGYA 1SUXA 5CPLA 5IM51 4ZQCA 1LBLA 3KVMA 5AHLA 3T40A 3QYQA 4O57A 5AC8A 1GVQA 5SWUA 2CLIA 1VPXA 4JNMA 1AW1A 2DZUA 3WJWA 3IIPA 1H50A 1XUZA 1L6WA 3NDOA 4C1LA 2R8WA 2WQPA 3PBYA 2A2IA 3BVJA 4FO4A 3TH6A 1KM6A 3R13A 3W7RA 2A1YA 4I7WA 4JYEA 3W2MA 3W88A 5D2WA 4UTIA 4MVAA 2OMAA 5D32A 3JS3A 1AL8A 2PRMA 2Y7DA 1MEHA 3B0PA 2NZLA 5LGXA 5D09A 1S5WA 3E0IA 3HPZA 1VS1A 4LT9A 4BK9A 2B7QA 2A7RA 3DFPA 3RFAA 1IXQA 4M19A 4O54A 2GOUA 1T96A 4KFNA 4OV4A 4GXMA 4LTSA 5C5YA 4OBTA 2Y63A 4KFPA 3OVRA 3W1XA 1OG0A 4NT0A 3NL6A 3TA6A 2CLMA 3ZR4A 3FS2A 4O0ZA 2E5BA 2W0UA 2NUWA 4Z1DA 5E93A 4IMFA 4N9DA 2JKAA 3LCHA 3Q37A 3WK2A 3S5NA 3W7EA 4JTKA 1AW2A 1A53A 3LHYA 4MJMA 4NZFA 3W76A 2V81A 2ZRVA 3M9YA 4FXRA 2WKJA 3P81A 1M7OA 4UXDA 2R94A 2ISWA 3NVTA 3MW7A 4K37A 4WY0A 4FB7A 1LLWA 1UJPA 2ZCGA 2QAPA 2DZXA 1DJQA 1KM2A 3QZEA 3W7OA 4XBSA 1WXJA 3LXBA 1JCXA 2WNQA 3O15A 3HBLA 3UXDA 3UWQA 3B04A 4QQ3A 2VFDA 5DLCA 1L2UA 4IUOA 3MP4A 5D02A 5BOOA 2XN0A 3B03A 2PC4A 1B9BA 4IMDA 1WOBA 5AC7A 2DZTA 4O8RA 4ADSA 3HGRA 3HPSA 3STEA 3ABOA 2ISSA 3FLUA 4K8HA 4EWND 3F1QA 1BKSA 4HNTA 2E5DA 1KFEA 1LROA 3HF3A 4I9AA 1FWRA 1TPC1 5F4SA 3TXZA 1TPVA 3QPZA 2R14A 4MIMA 1PCKA 3LRLA 3EEGA 2ISVA 3W6YA 1XUUA 1GZGA 4O11A 4BI7A 4JTJA 4CCEA 4MPQA 4N6EA 3DENA 3INPA 3M5ZA 5FEXA 2FDSA 4UFHA 2YZRA 4AHPA 5G2IA 3PULA 5DXXA 5D2YA 5G1YA 3MUXA 2Q3RA 3Q94A 4JGDA 5EKYA 4UNLA 2UV8G 4YLWA 3SI9A 1N7KA 4P61A 4H6KA 2I14A 3EWXA 3TMLA 5J5RA 1OHLA 1GOXA 1RZMA 4RZ4A 3TX9A 1ZNNA 3A21A 1K8XA 4XQ6A 5AYZA 4UUIA 4MYXA 2ZZ2A 4JTHA 4AXKA 1XC4A 3QF0A 5EYWA 3GAYA 4LVFA 4JTSA 1F76A 2XFWA 3IVUA 3W3OA 2V9DA 3FIGA 4DBDA 3O6DA 3TAOA 2I1OA 3DXIA 1OFPA 4S2BA 3T7VA 3C56A 4TX9A 1IXNA 4M5PA 2FLIA 4U4MA 1NEYA 1Z48A 1TV5A 3I7QA 4O19A 4G1KA 3W1TA 4Z1AA 3NOEA 2P0OA 1GG0A 5CZ0A 2NUXA 4O15A 1SO3A 1B3OA 5DCBA 1SZEA 4TO8A 2YFNA 1TB3A 1ZY9A 4FNSA 3LCXA 4MLJA 2ZZ1A 3S0CA 3MYPA 5FI8A 2DU2A 2RDTA 3PUEA 1G7VA 3S1VA 2WSYA 3K30A 1Z41A 3BW2A 1EPXA 2G96A 4GUFA 2FFCA 1SR9A 3M16A 3IIVA 3EWYA 5KINA 2QDHA 3TV8A 2Z6JA 1I2RA 3LBCA 3CQ0A 3MHGA 5F1VA 5FESA 3U8GA 4YCPA 3HG5A 4L4MA 4LC6A 4AWSA 1HO4A 2BSLA 1XBYA 4CCDA 5HUPA 3A9IA 3EXRA 2YR1A 2YCEA 3TC6A 3M41A 4ALDA 1AW5A 5KMYA 2X1UA 3IGXA 1R47A 4GUJA 2TYSA 3LXAA 3TMQA 2VXNA 5TBOA 4QISA 5K9DA 3GR8A 4HSNA 2QDGA 1YDNA 4FX7A 4NU7A 2Y89A 3A24A 2V82A 4ADUA 3PUOA 1HO1A 4UFIA 2ZZ3A 1LYXA 2H6RA 3NAVA 2QAFA 3PG9A 1Z44A 3ZWTA 2ZYFA 3P84A 1H63A 5LHEA 5HQEA 2Y62A 1H7WA 4JX4A 1KM0A 1X1OA 2FPYA 3B8DA 2CLFA 4DEFA 2GJLA 2WPBA 4XWUA 3SFKA 3F03K 5D30A 2R91A 1UBSA 2W6RA 1YTKA 4CNNA 4IMCA 1K03A 2OCZA 3LLDA 2V2CA 3EWZA 1QPNA 4OE7A 1PHQA 3IRDA 4O52A 4UMAA 1K02A 3L65A 5FF3A 2DZWA 1D3HA 1PCWA 3GK0A 1PL9A 1JRCA 4LV4A 5D38A 5HINA 2EHHA 4QNWA 3W72A 4N4QA 1EP2A 4ML9A 2JGQA 5HJLA 1ME7A 3BK0A 3V1PA 1B4KA 5G4WA 2OT1A 3R89A 4IX2A 3LX9A 1SW3A 4MFDA 1NF0A 2OT0A 4RZ6A 3E49A 5BNKA 4AF0A 1R2SA 3NQ7A 1TPH1 1R30A 5EBUA 3CM4A 4MFEA 1IGSA 3W1LA 3TC7A 1AK5A 1EP1A 1DOSA 4OT7A 5CZSA 4LS0A 3RLVA 4S2CA 1RVGA 5F2GA 1HL2A 3NPWA 2B0MA 4QSHA 4JTEA 3NQ2A 2TMDA 5LSMA 4M7TA 3TSBA 4WOZA 4ZQMA 1H1ZA 1QPQA 1P5BA 4JY8A 2FTPA 1F6KA 4NZJA 1RQBA 2VEMA 3G1DA 5TIMA 3S5OA 2ZRYA 1F5ZA 4AH7A 4Q32A 4LUJA 1I8JA 2CZDA 5CPOA 1LOLA 3LBMA 4MOZA 1FDZA 3R2GA 3MI6A 1TREA 3LV5A 3NM1A 4O18A 4EF9A 3TUUA 4LNYA 1FWNA 3BLFA 4K39A 3YPIA 4O14A 1VHNA 3L67A 1W5NA 3STGA 1JR1A 1KLZA 2VFFA 4NUWA 1H5YA 4NJJA 3OVPA 1FBAA 4LWWA 2CLOA 1NSJA 4I7VA 3LTYA 2QUUA 1TO3A 3W7GA 3ZFHA 1WAUA 3DFSA 4K38A 4OHQA 4EIVA 3CT7A 1U83A 5FF2A 4A21A 3GVGA 4AHQA 3HQ1A 3W7MA 2J9XA 3ABQA 3SSJA 4NJGA 3CWNA 3W85A 1KFBA 1SPQA 2VEPA 2CU0A 4K7YA 1QPRA 3NNTA 3MWAA 3HG3A 2GQAA 1GJPA 1LBFA 4JX5A 3DBPA 1SZFA 1FCBA 1OYBA 4UCGA 1JRBA 4M6PA 2EF9A 3W23A 3EXTA 1GVFA 3M1ZA 2X16A 3USBA 2Z6IA 3FKRA 1KTNA 4GUIA 3PB2A 1HUVA 1X1ZA 3RU6A 4NXKA 1ICSA 2JKPA 4HNUA 5F2MA 4ORMA 3VKJA 3CEPA 2QCNA 4HHPA 3PSWA 1RQEA 2P1FA 1SFJA 5BMWA 1I2OA 3DFOA 1OF8A 4NJHA 1XCFA 4R33A 2B7OA 1V5XA 4Y96A 1O5XA 3UPWA 1I4NA 4FNUA 4LS2A 2QKFA 5EL1A 4IWWA 2VKZG 3DZ1A 3CIWA 2DJLA 3HGOA 1PIIA 2RHGA 3GXTA 6TIMA 5I3HA 4ZL1A 3NL5A 1W3TA 3T55A 3TCEA 4A29A 4K8EA 2YDAA 2FPVA 3UWVA 3VNDA 2C3ZA 2G95A 2ZQ0A 2FB2A 4AWTA 2NXGA 2QF7A 4NX5A 4O1CA 5L9FA 2CZEA 4MY9A 3GKFA 4IX0A 2E09A 2EGZA 4IMGA 1OK6A 4XBKA 3FEMA 4JTLA 1JCNA 2GVJA 5G1TA 1KV8A 4H3DA 4NNBA 4BI5A 3LHUA 1S5TA 4PA8A 3GDMA 1IXOA 1J5TA 3L5AA 4O28A 2H3BA 3IGUA 4Y6GA 3M43A 4JEQA 5AN7A 2A4AA 3TFCA 2X1TA 4KKXA 1Z42A 4I7UA 1W3NA 4IOTA 3UY8A 4DO4A 3N19B 2Z0IA 3SW6A 3BW4A 2CZ5A 1GEQA 3GYEA 2QCDB 3RNDA 1VYSX 4X3ZA 3G8EA 4Z1BA 1XM3A 1FXPA 4WD0A 1C9DA 2E6YA 1XKYA 3NQ6A 1YPIA 4P2VA 3LRMA 1K8ZA 4HPJA 3E02A 4LVGA 1JVNA 3GAKA 4Z1CA 4CQ8A 5K4XA 3TROA 3GX9A 1E51A 2Q8LA 1IIHA 5K2ZA 2EPHA 1KTBA 3W1RA 2NX1A 1LP6A 3GDRA 3C2RA 1ALDA 2IQTA 4JY9A 1YTDA 1GVRA 4ZQOA 2A7NA 5HR7A 3HPXA 1THFD 3W1PA 1W37A 3QSTA 2C15A 1FWSA 1LRQA 1OYAA 4O12A 3N9RA 4O53A 1VZWA 3B06A 1FCUA 3NO5A 3C0JA 3OIXA 1I2PA 5D03A 1OFBA 1ZCOA 2QCHA 2H3DA 1WV2A 3KRZA 2RKXA 2W79A 4LS1A 3MYOA 1BEUA 1WA3A 1FCQA 1IXPA 3B4UA 1YYAA 3F4NA 2CFFA 3DFQA 4IXHA 4C1KA 3N34A 3TAKA 4TR9A 2GQ8A 5DBTA 5LNUA 1A50A 4GUGA 4WY0F 1PV8A 1ZAIA 3A5VA 4UIOA 3KHJA 1OX6A 4NNAA 3UNDA 1QPOA 3L0GA 1QAPA 3ELFA 3QPYA 4PH6A 3TQVA 3LXCA 3QFEA 2C18A 3N9SA 2KZHA 1TMHA 1JJKA 4MJZA 1SU5A 1MXSA 4PL2A 5A8GA 2FJKA 4BFAA 1TPEA 1W5PA 1SO6A 4GC4A 2A5HA 3G1AA 1ZHAA 4E0CA 4Q33A 3KX6A 1G4SA 4O1DA 3W7KA 3LB0A 3G3MA 3M44A 4WY0B 3W7LA 2C14A 1TRIA 3FOKA 1GTEA 3CWOX 1GPWA 3LHVA 1VLIA 1OVDA 4ADTA 5I3IA 1KTCA 1LRTA 1Y0EA 1EUAA 2G97A 3L9CA 4N6FA 1TPDA 4BI6A 3PWAA 2QJGA 5T26A 3TE9A 3EWBX 1QOPA 1DBTA 3ZS4A 4UTMA 4XZ9A 3SGUA 2J6XA 5AFDA 3PB0A 3KVKA 1X8FA 3A22A 3W71A 4N4PA 3NL2A 1DKWA 4RXFA 1NAL1 1GQNA 4JYDA 3N2MA 5EY5A 4MZ8A 1XDMA 1EX5A 2WNZA 5DY3A 3FYPA 3LCGA 4QM1A 3NPUA 1JCYA 1YXYA 5DY2A 1QMLA 1VYPX 2CLHA 3W7NA 1ICPA 1MO0A 1X6UA 3BO9A 3BV4A 3KRSA 2YYTA 4UFMA 3WJSA 1IIGA 3HO8A 4DQWA 1UCWA 1SW0A 1FUYA 1TJRA 1VJIA 4E2DA 4DF2A 1KBIA 4DPQA 1AG1O 1S3HA 2ZZ4A 4LRSA 1TPUA 1KM3A 3HGJA 4ZQNA 3NQGA 3CLMA 5C54A 1ZALA 4O4WA 3SGZA 3W86A 1LRNA 3LERA 1FWTA 2V8ZA 5CGQA 5DN1A 2HMCA 2OX1A 5HWNA 2E5CA 3ATZA 3W1MA 1C29A 3TQKA 3UYCA 2GVGA 3H55A 3LTPA 3WK0A 3PY2A 1RD5A 2XN1A 3QEZA 3DHDA 3M0ZA 2V5LA 1GTHA 2DZVA 5I3KA 2FIQA 2F7FA 2ABBA 1ZJIA 2V2DA 5C6MA 5L6UA 3HJZA 1SSDA 3UZ5A 1UB3A 1QO5A 2E6FA 3PC0A 1H51A 1TTJA 3B05A 4WUIA 4R7JA 4XKYA 5LHFA 3TW7A 3G1SA 3STCA 3GB6A 4M7SA 3OHIA 3NEVA 3DGRA 1O60A 5CG7A 4GUHA 4YCOA 3W1AA 1OFDA 1GVSA 1W0MA 1P0KA 2B7NA 3MBDA 1TRDA 1OK4A 1WYIA 2JGYA 4A2SA 4PC8A 3LLFA 4ZQRA 2BWGA 1MEWA 2V0TA 3WK3A 1R2RA 3M47A 1VGAA 1G69A 1GYNA 5I3JA 2QCLA 3DH7A 3CHVA 4OQVA 1R2TA 3OBKA 3P82A 1NFBA 1Q45A 3DU0A 3FYOA 1R46A 2J27A 5CKSA 2RDWA 3O63A 1SZGA 3S8HA 2VFEA 5D2VA 3G1XA 3UWWA 3ANYA 5DCEA 3VE9A 5HWMA 2TSYA 5AOUA 1KM5A 5D2XA 2FQIA 2VFIA 4HIBA 3RF9A 4IPJA 4FIQA 4R53A 1MSSA 5H91A 3W07A 4XTDA 3WJZA 2E6AA 3CB8A 4LUIA 3SR7A 3L0KA 3UXAA 4FX6M 4MLRA 5HMSA 2A85A 5FEWA 1T0OA 1K7XA 4AVFA 3MBFA 1Q6RA 2NUYA 1XBXA 4JTGA 3TQ0A 4WXYA 2PRLA 2ZTKA 3R8RA 4QITA 3A5FA 4LV9A 4RKAA 1KM4A 3HIJA 4DO5A 3C2VA 2BZNA 3EXSA 1YDOA 1B57A 3NZ1A 4OV9A 1WBHA 2A6LA 3WJYA 1K7FA 2ZRZA 1YDVA 5E1QA 4PTNA 4IMEA 1QNVA 1L6SA 1W54A 1OFRA 3FJ6A 1XL9A 5IBXC 4A3UA 2O7SA 2Z2UA 4K36A 3CEUA 5HUOA 4AEOA 1TTQA 4MY8A 3W70A 4PFMA 1FCVA 1VQTA 3JRKA 4KFOA 3NPXA 3M5XA 3BLIA 5H2ZA 4NJIA 2F84A 3TU9A 1F7BA 3PVFA 1A5AA 1VCFA 3T4CA 3A23A 1EUNA 2NV1A 3LHZA 3IIXA 4XTIA 5DELA 5BMXA 3P5ZA 1D9EA 5I3FA 1OX4A 1YTEA 3LHTA 3I7RA 1LM1A 1VCGA 3LDVA 1FDJA 5K3VA 4RR4A 3LCLA 3GKAA 1L6YA 1RQHA 2NWRA 3M5VA 1H60A 1CW2A 3PSVA 3TFXA 4TIMA 4E38A 3KVLA 1BTMA 2E77A 2ZA2A 4UTTC 2ZZ7A 2CZFA 2QUVA 1SO4A 3G18A 2PURA 3STFA 1F73A 3QW3A 4LW7A 3O06A 1A5BA 4AF0B 3MI2A 2FPTA 2CLKA 2HS8A 3R5EA 3PBVA 1W5QA 4LVAA 3O16A 3HGSA 4N9EA 5AHEA 1JCLA 1VH7A 2WO5A 3W7DA 4WXZA 1QR7A 4IXXA 1FQ0A 3KRUA 3WJXA 5K9CA 1G7UA 3M7WA 4GJ1A 3QW4B 4UMBA 3DI0A 1ZAHA 3UY7A 3NQFA 1TPFA 3P74A 3M6YA 3BG3A 3TJXA 2ABAA 1EIXA 5KZEA 2D73A 3C2EA 1PS9A 3S5YA 3E96A 1BWKA 1C8VA 1U5JA 3LCFA 4KWWA 5F2IA 4AB4A 1P1XA 3I7SA 5BRBA 1J2WA 1W1ZA 3C61A 2Y7GA 2Q3OA 3NQMA 1ME9A 3BARA 3C6CA 3ABRA 2QCEA 4UFLA 3UD6A 5IBXA 3T44A 3QMSA 3QMRA 3L21A 2E68A 3BPWA 1SW7A 4H4IA 5C55A 3GDLA 3M5YA 3H53A 2GQ9A 4YMZA 4IGHA 5CPMA 3GZ3A 5FF7A 4FNQA 4JIPA 4N9CA 4X2RA 1XXXA 5CZJA 2C16A 4O16A 1F74A 3P61A 3SJ3A 3KFTA 4LY8A 3EX6A 3L5MA 4LU0A 1XI3A 3MHUA 3FKKA 3W22A 3W73A 5CSRA 1EB3A 2X1RA 5KSWA 3OG3A 2ZRUA 4NNCA 3TXVA 1XDLA 3W2KA 1YLVA 3P8JA 1B4EA 4PODA 4KWVA 5AHIA 3DAQA 1HG3A 5LNSA 3EX4A 3T78A 4UNKA 4Z0SA 1K3UA 2GVLA 4JTFA 1JULA 5G2HA 1VYRA 3G3DA 5G4EA 3PAJA 3F4WA 2VENA 3O07A 1KLYA 2E6DA 4K6AA 1EWDA 4UTTA 4ZMGA 2YX0A 1TYGA 3GR7A 5FEZA 1VHCA 4S1FA 1ICQA 5G5IA 2FB3A 4UTLA 2TPSA 4QAIA 1ONRA 3W87A 4GFSA 3W1UA 3TW6A 3BG9A 4JTUA 1WBJA 4A2RA 2ZA1A 2RH9A 4BWLC 1SO5A 3BW3A 1VC4A 1W5MA 4LRTA 4HKPA 4LOCA 4Y90A 4MY1A 2A0NA 1G4TA 5D37A 3O8AA 2PE4A 3PBUA 3O6CA 1TQXA 1GWJA 3EKZA 1JQXA 3C2OA 4TMBA 2BLEA 3GXPA 4GE8A 3TSMA 2A7PA 4CNOA 3S9YA 4JXCA 3DKLA 2ALDA 3KVJA 1GT8A 4IPIA 3UWZA 3P62A 4RLIA 1NVMA 2QCDA 1LORA 3QH2A 3O6YX 5EPDA 1TQJA 5FEPA 4UTUA 1VLWA 3NQ8A 3TJLA 2ZA3A 5AHNA 3RMJA 3W7JA 3IVTA 5LNRA 5A5WA 2QCMA 3W7PA 3W9ZA 2E1DA 3NQEA 4AAJA 3NM3A 3EX3A 1QOQA 2I9EA 3UZJA 1P4CA 1TSIA 1JCMP 7TIMA 3W2JA 3NXFA 1M7PA 1MEIA 4PCFA 3G1FA 1XBVA 4YXGA 4OU1A 3HG2A 2J9ZA 1I45A 2C0AA 1OFEA 4CQAA 1LZOA 3IEBA 3N14A 5F2LA 4CQ9A 4UR7A 2YW3A 4O0KA 1YPFA 2Y6ZA 3S1XA 1L9WA 1WOAA 3NG3A 1SSGA 5HWJA 2Y7FA 2ZDRA 1OYCA 3QM3A 2VOMA 3MHFA 2NX3A 5AYXA 4DELA 1O4UA 1H7XA 4WQ6A 1AL7A 4QNEA 5U4NA 4BWLA 3QQ1A 1VCVA 3LOTA 4FX8A 3I68A 4O17A 4WJEA 4GRSA 3I65A 2VFGA 4JTTA 3NQVA 4K7VA 1QFEA 1X7FA 1XFBA 2YSWA 1CI1A 2CLLA 1T8XA 1HFBA 3CTLA 1KW1A 3G1YA 3TR2A 4E2BA 2V5BA 2GPTA 2NXHA 1PE1A 3N2XA 3TK7A 2BTMA 4LVDA 2A21A 2HS6A 5AB3A 2RFGA 4Y8FA 3KAOA 3VI2A 1FWWA 2WSRA 5C2XA 1YXDA 3P67A 2DZPA 4FNTA 1FY6A 2VFHA 5K4ZA 1T99A 4JD4A 4FNPA 4NJKA 1JCJA 4Q4KA 1LTDA 4JS3A 2QEZA 4DF0A 2WJZA 2ZFAA 3G24A 1LBMA 2BXVA 4AHOA 4ZVJA 2DORA 3EKLA 4WZHA 3TNOA 2CWNA 4UTWC 1Q6LA 1LCOA 3G22A 2A6NA 1WDWA 1TJPA 3C52A 1W8SA 5HNRA 1JUKA 1PHWA 2LLEA 1EEPA 2B4GA 2NX9A 3GXNA 4MYAA 2ZZ5A 1PVNA 3ABSA 3CC1A 4LVBA 3L5LA 3L2IA 3SIZA 1LLZA 2B7PA 2Y70A 2Y61A 4OWGA 1EWEA 1Q6OA 2H8ZA 4X9SA 4N2YA 2ATSA 1DQXA 2HTMA 3QRHA 3SZ8A 3GIYA 1F05A 4Z08A 4RV8A 3MP5A 3LM7A 3NQCA 4DO6A 1G4PA 2YW4A 1JQVA 5F4XA 3ATYA 1QO2A 1XBZA 3P8IA 1W31A 2NWSA 3S42A 2ZTJA 1M5WA 3W84A 3LGEA 2QJHA 1WX0A 2AQWA 4JICA 2HSAA 2EKCA 2QR6A 1P0NA 2ZRXA 4JX6A 4JN6A 3QQ0A 1H62A 1TPB1 3TKFA 3PM6A 4NX0A 2DP3A 3RK8A 1SQ7A 1H7RA 3P7YA 2O7QA 1S5VA 3BGGA 3G0SA 2QCFA 1TPWA 5AC6A 3W7QA 3O1NA 3W2LA 3C2FA 4O13A 1DQWA 4CNPA 3LI0A 5D05A 3DI1A 1K8YA 3FFSA 3B0UX 3QC3A 5DXYA 4B5NA 1HTIA 4FF7A 2VEKA 4HNVA 1KFCA 2V2HA 4RZ5A 4XUGA 6ALDA 4FEZA 2P10A 1TCDA 1KFKA 4Y9AA 3KXQA 3EX1A 5CZTA 4M6VA 1Q6QA 3RLUA 3IIOA 1EA0A 2AAMA 3LRKA 1N55A 3G0UA 3THAA 4DBEA 3S1UA 3MJYA 5CPNA 1RR2A 5KITA 2ATMA 3BG5A 3GDKA 3GNNA 4FIRA 3UWYA 2J9YA 2V30A 2TRSA 8TIMA 3I6RA 3P60A 4XKYB 4N02A 4NXSA 4OGZA 4UTWA 1QWGA 3HB9A 1SFLA 3PS7A 4HNNA 3Q2DA 4U28A 4YL2A 3NYZA 3VFLA 1LOSA 1G4EA 3LI1A 1YADA 2Y85A 1VR6A 1ME8A 5LNVA 4O1AA 5LZLA 3Q58A 1RPXA 3EWUA 1V7YA 2JK2A 4EVZA 1DVJA 3MMTA 4MZYA 1FXQA 4X22A 3W74A 3DFNA 1QDSA 5G2WA 3IVSA 5LNWA 5D33A 3VE7A 1VRDA 2NXIA 5FF4A 1G67A 1W5OA 1DV7A 5CSSA 1WQ5A 4UFKA 3IGSA 2RDUA 3DFTA 4FHAA 4O4VA 3P5YA 4QIUA 4LC8A 4YWIA 1OJXA 1TV7A 4FNRA 3W7CA 5DBUA 5KTLA 3BGJA 3UPBA 1ZENA 4J9JA 2QJIA 3GDTA 5AYYA 4DXVA 1OFOA 4O50A 1SZNA 4ONVA 4MKNA 3CIXA 4A22A 1OX5A 1KV5A 3N3MA 1OF6A 3L0NA 2QCCA 4QJ1A 1J4EA 4POCA 2X2GA 1O5KA 2ZRWA 2Z1BA 1OABA 4RCXA 4AMAA 3CPRA 2DJXA 2C6QA 2YXGA 3C8FA 4IQLA 1A5CA 3EX2A 3O05A 3R12A 3TIMA 1LDCA 4PL1A 5D04C 1H61A 1DORA 1KBJA 2WSQA 4WOQA 3HMJG 1OFQA 5E0KA 3PUDA 4JDBA 1IF2A 3HG4A 2WOQA 3AO0A 3CU2A 4O1BA 3DHFA 1TTPA 4ORIA 1TV8A 3G0XA 4HSOA 2ZZ6A 1ADOA 2H8XA 1KFLA 5D2TA 4TU1A 3TSDA 2Y7EA 5BW6A 2BX7A 3LTSA 2C19A 4BF9A 4UR8A 4GNJA 2ZBTA 1FDYA 1H7OA 1W3IA 3S5ZA 3LCIA 3QJAA 1OX4B 4NVTA 1KA9F 3S6DA 2PRHA 3W2UA 4FXSA 1O94A 3LHWA 3L68A 1G6CA 4UFJA 3IV3A 1W56A 3HOJA 2JBMA 1O95A 4HT3A 4JYFA 2YFOA 3QSRA 2CLEA 2NLIA 3OA3A 4PEKA 1JUBA 3KOFA 3S1WA 4JR5A 3H54A 4UTKA 3W1QA 4DF1A 2NV2A 4WX2A 1EP3A 5ABTA 2Q8ZA 1UUOA 4AWUA 3SECA 2QUTA 2GJNA 4JIQA 1GYLA 1UASA 4RX0A 4MUZA 5MHBA 4RJEA 5I3GA 1TIMA 1CX9A 2VC6A 3C4UA 3GLCA 4JDYA 1KFJA 3JR2A 2C1HA 4IJBA 1AMKA 5F4WA 3W7IA 2H90A 3AJXA 3V75A 4NQ1A 1NF7A 2VELA 2DZSA 3NL3A 3PR2A 2EAWA 3L66A 4MZ1A 3UWUA 3NQAA 3DKJA 3SY5A 1A5SA 1ML1A 1ZFJA 2AGKA 1FX6A 1LOQA 1UUMA 1OFAA
chains in the Genus database with same CATH superfamily
4BQ3A 1OADA 4MSSA 3AHXA 2W91A 4BR1A 1JG9A 3CAWA 4ES4A 4M6QA 3TTQA 2WNNA 3PF3A 3SSZA 2YPIA 5KZDA 5LGZA 3ARYA 3EAUA 3G8RA 3PPCA 4H9MA 4D8AA 2CXGA 3UQNA 2EG7A 1UWRA 1IR2A 2PAJA 3E9AA 1RUSA 1KKOA 3CUIA 2PBOA 2OZ0A 4HN4A 2J24A 3QMTA 5E6YA 4UMCA 4AD3A 3GTIA 3R94A 2ZC1A 4TOQA 3RM4A 2G5WA 4EWJA 5PTDA 1Q3NA 2GUUA 3NQDA 2PCQA 1JYXA 4GWEA 1T40A 4Z0JA 4ZA0A 3KZSA 4S3BA 3RUBL 3W83A 1XGEA 5HBFA 3W7HA 2V67A 4YVVA 3C3NA 1PUDA 1KM1A 1RV8A 5ECUA 4C6MA 1QWKA 1AH4A 2PA6A 4GQQA 4W9TA 2XN2A 2VUYA 2AL1A 3FDKA 3LUTA 3NZRA 2W27A 4RZBA 2QT3A 3WQFA 3ZWSA 1J6OA 4L5ZA 5FF0A 2QV5A 1K7EA 4ICNA 4NZ5A 4D2JA 2J74A 3W75A 4YTQA 4F9DA 3VM7A 2E1WA 2YYUA 1EF2A 3TDFA 2QCGA 1QK2A 3HU7A 1EBHA 4RK8A 1I60A 4AU0A 1RA5A 4HZ6A 1L8NA 5DCDA 2BOGX 1LL4A 1NDWA 2OJPA 1W8GA 4WGHA 3KEHA 3CYJA 3BZGA 1OGSA 3KVMA 2WNWA 5SWUA 3MDUA 2CLIA 4NY2A 1V6YA 4J4KA 1MW1A 2ADAA 1H50A 1XUZA 4HU0A 3NDOA 4GI4A 1ITXA 2WQPA 3FVMA 1QASA 3TH6A 1NOUA 1KM6A 5IHRA 3WLOA 3W6LA 2B31A 2VEFA 4HA0A 3UJRA 4W86A 2GFTA 2OMAA 5D32A 4QE5A 4NAEB 2QZRA 3B0PA 1WDQA 4OTKA 1CGXA 4Q8QA 4KESA 1VS1A 4BK9A 4HSHA 3FV9A 5BWFA 1QUMA 3DFPA 1VFFA 3RFAA 4FLOA 4M19A 3VTRA 1T96A 4TVCA 3VGBA 1TR9A 4OBTA 4B3LA 2Y63A 2OZ8A 4FA3A 3OVRA 2XIJA 1SFTA 3QVQA 4NT0A 3TA6A 2CLMA 1VFOA 4IMFA 3LCHA 3W7EA 4JTKA 4DHGA 3LHYA 3P0WA 3S46A 2ANUA 3SQSA 3VIKA 3M9YA 2WKJA 4UXDA 1U33A 1UD4A 4EXBA 1Y5WA 2DZXA 3QZEA 1KM2A 3REQB 4WSKA 3O15A 3VMPA 4C5ZA 4GNVA 3B04A 3T8LA 3VD3A 1L2UA 4IUOA 4MNJA 4F0LA 4B5XA 3MP4A 2CNCA 4H8VA 3OYZA 4MB4A 3PZNA 2VX5A 1K6WA 3WZ0E 3WH9A 2OGJA 1R38A 2FHBA 5FSEC 4GZEA 2WW5A 3HGRA 3HPSA 3STEA 1JAEA 3HA1A 4QDWA 3F1QA 4HNTA 1C91A 4E5TA 1LROA 2OWXA 5DQPA 4NASA 5F4SA 1TPVA 2R14A 3WUEA 3VGDA 5DT7A 1TVNA 3LRLA 3EEGA 2VR2A 1GQLA 5D9MA 3RR1A 1ZPTA 3NUKA 3R0KA 1E6NA 4N6EA 2VJXA 3M5ZA 1E5NA 5FAJA 4UFHA 5DXXA 5D2YA 1UWSA 4H9TA 3MUXA 3K4DA 1EZWA 3Q94A 2QS8A 5EKYA 1NH6A 3SI9A 4P61A 1H4PA 2E8YA 4H6KA 3ORWA 1P0BA 1RZMA 3CGTA 3U5YA 3NIYA 4GLEA 1V0KA 4MYXA 2ZZ2A 1GNXA 1F76A 4L6DA 2Z1KA 3TAOA 2I1OA 3DXIA 3V5CA 1OFPA 4S2BA 3T7VA 1QI0A 2VYOA 2E40A 4XX6A 3HFYA 1Z48A 2X41A 1TV5A 2XIBA 3I7QA 4K1WA 2P0OA 5CZ0A 4O15A 1B3OA 1PKLA 3E74A 2QGHA 5HPCA 1YDYA 2Z1WA 4AZCB 1PB0A 2Z29A 2YFNA 3B9OA 1ZY9A 1IGWA 3DHUA 3LCXA 2ZZ1A 3S0CA 4JFTA 4EE9A 4RE2A 5AC4A 1WZAA 3S1VA 1Y5XA 2WSYA 3NZQA 4IIDA 2G96A 4GUFA 5TD4A 4EXAA 2GSEA 3M16A 3EWYA 3OOQA 1VBJA 3TOPA 3LBCA 3EDDA 3CQ0A 4WSHA 2EQDA 4YCPA 3HG5A 4G7EB 2DZAA 4U5IA 3WL0A 4QE1A 4LC6A 1HO4A 5H8MA 3EXRA 4KRUA 3TC6A 5A8QA 3FNDA 4D6JA 5KMYA 4A4AA 3PJXA 3LXAA 3C0QA 3DERA 3FW6A 3UZZA 2TODA 4HSNA 1QK0A 3UR7A 4NKCA 4FX7A 1HNYA 2XFFA 3A24A 2V82A 2I16A 4MF4A 2D20A 3GTNA 4QCFA 4V1XA 1HO1A 2ESCA 2QNEA 3SY8A 2ZZ3A 3E5BA 1SZRA 1GZ1A 3PG9A 1QRQA 1Z44A 3K46A 2XSBA 1EL3A 2PF8A 3TN6A 1PKYA 2QDDA 1J2BA 4OBSA 1XKJA 3AMCA 1E4MM 1J18A 2R91A 4TTGA 2W6RA 4CNNA 4IMCA 5DRCA 4KEMA 4CN1A 1AVAA 2NVDA 3I10A 1PHQA 1VIWA 4O52A 1OCJA 2WC3A 3WLPA 5FF3A 2DZWA 1D3HA 4HP5A 5HQMA 1JRCA 3RRXA 4V33A 3GYCA 5D38A 4GZIA 3GBDA 3DGBA 4QNWA 3IJ7A 3T0TA 4UZUA 4N4QA 2Y8UA 1EP2A 4ML9A 2JGQA 3RPDA 2O0TA 2DUAA 3APYA 5G4WA 2OT1A 3CH0A 4HCLA 5CSUA 2EPKX 3NQ7A 3DUGA 2AQVA 1DOSA 4OT7A 1ZBWA 5CZSA 5AKQA 1VBHA 4S2CA 4HVXA 5A3HA 2VGBA 3NPWA 4REQA 2TMDA 4EAMA 4M7TA 4H19A 3TSBA 4ZFMA 3T0CA 4JY8A 3B8UA 3G1DA 1AUSL 1WDSA 2ZRYA 4QLLA 4Y9NA 3ZT7A 5CPOA 1LOLA 2OX4A 3VUPA 3ZVHA 3A12A 3QFWA 1ADSA 4DWSC 1KNWA 4ZBCA 4WDXA 4LB3A 1FWNA 4LNYA 3GR4A 1IQ8A 3ITLA 4KERA 3F2BA 3BLFA 4K39A 4O14A 1PEZA 1CEOA 1KLZA 3EEZA 2VFFA 4IF2A 3GXFA 4NJJA 4RNHA 4AD0A 4HA1A 3EA1A 1MRQA 3TP4A 4X63A 1NSJA 3G77A 3LTYA 2QUUA 1TO3A 4L56A 4KCTA 4IQEA 4K38A 4HPNA 3FDGA 3CT7A 1W9VA 3HQ1A 1ZTVA 2J9XA 2VI0A 2TAAA 3SSJA 3QV7A 2V5KA 1A3XA 1KFBA 2V5CA 2GGHA 4K7YA 3HG3A 2GQAA 1LBFA 4PE8A 5D9NA 1EFZA 1FCBA 3WNKA 1YIXA 3M1ZA 3NYDA 2WLZA 4W89A 1KTNA 1HUVA 2JKPA 4HNUA 2Y5SA 2QCNA 3CEPA 3H4XA 1YE6A 3PSWA 2DSUA 5BMWA 2B7OA 2XH2A 4HYVA 1KC7A 2W61A 2ZX7A 1I4NA 4LS2A 4C6BA 3A3WA 3WD1A 3W24A 4QJ4B 2W4XA 3HGOA 3QHNA 4W85A 1PIIA 2JF6A 3DOPA 6TIMA 5I3HA 3RN6A 4ZL1A 1E9LA 4CQCA 1XR2A 8XIAA 3OZYA 3H26A 2C3ZA 3IK2A 1E4NA 2G95A 2ZQ0A 1VPYA 2NXGA 2O4MA 4NX5A 2IPJA 4IX0A 2V3EA 2FZ9A 3FEMA 4ZCWA 2X0HA 4PMJA 1E6QM 4IL0A 3L5AA 4AIBA 4WKHA 4JEQA 1ESWA 4ZFCA 1GOOA 2WJDA 2ICSA 4KKXA 3UY8A 4IOTA 4DO4A 1TMLA 4F2BA 3SW6A 3U4FA 3EDFA 3R25A 3GYEA 4I8YA 5LYRA 1FXPA 1UR2A 2XINA 2E6YA 5TNVA 3K8MA 1YPIA 1FWIC 3V16A 3ZLFA 3MVIA 2BS9A 4AC1X 3LRMA 3ZJ6A 2J25A 1K8ZA 4ATLA 2FTWA 1FA2A 5CH9A 5C0QA 5K4XA 3TROA 1E51A 4XZMX 2Q8LA 1FVPA 1IIHA 1OWQA 4BS0A 1XGDA 2NX1A 1LP6A 4C6KA 1Y65A 2HJPA 1IWPA 2HBVA 3HPXA 3TJ4A 3IJ8A 3QSTA 1FWSA 4TXEA 1OYAA 2D1ZA 3OIXA 1I2PA 4MAVA 5D03A 3PPFA 3PAOA 2H3DA 4LS1A 1WV2A 3KRZA 3F4DA 4X2PA 3TC3A 2VQTA 1A80A 1BEUA 1WA3A 1J12A 1IXPA 3O7UA 2WZHA 2CFFA 4LUTB 4C1KA 1B2YA 1MFUA 5LNUA 3G2GA 1ZAIA 3H22A 1OX6A 4J3XA 2Q09A 1W3HA 3GNOA 1QAPA 3ELFA 3KDNA 3LMZA 3TQVA 1E1CA 1TVLA 2C18A 1TV2A 1O12A 2YBTA 5CJMA 4EANA 4MJZA 3SUSA 4PL2A 2FJKA 4BFAA 3CZKA 1XF0A 1ZHAA 3BXWA 3W7KA 2J75A 6REQA 2X05A 3MUZ1 3PBMA 1B3YA 4UNIA 2XM2A 1V3HA 3CWOX 3P2VA 3GE7A 1KTCA 2YCIX 1Y0EA 4N6FA 3SQLA 1L6FA 3ZS4A 2Q01A 6XIMA 4XZ9A 3T09A 5AFDA 2QJMA 3KVKA 1X8FA 3A22A 4Y9MA 3NL2A 1XD0A 4RXFA 1GQNA 1J6PA 1W3JA 4MZ8A 5BXSA 1EX5A 1Z32X 3S6TA 4IISA 3NZGA 1QMLA 2CLHA 3W7NA 1GOMA 3KRSA 2YYTA 3L23A 2DH3A 4DF2A 1KBIA 3RYSA 4MB3A 1KM3A 3NQGA 3WQ8A 2G3NA 3SGZA 4IT1A 1ELSA 2HMCA 1OZMA 3K13A 2WYSA 3UYCA 1PTGA 3FA3A 3WK0A 3PY2A 1W91A 4GIRA 1AJ2A 3WKZA 1MDRA 2FIQA 1EQCA 5FCZA 1WKFA 3MA8A 3HJZA 1QBAA 1RBAA 1UWAA 1PIFA 3PC0A 3B05A 4WUIA 3G1SA 1MVYA 3PZGA 4M7SA 1S2TA 3NEVA 3DGRA 4GUHA 1S2UA 2HBXA 1P0KA 2DSWA 3QHMA 3EKGA 3LLFA 4DJFA 3OJGA 2V0TA 3IARA 1I9CB 3AROA 4JNYA 1PX3A 2E9BA 1EC9A 3N6HA 4XKMA 3WDRA 1E40A 2HQAA 1BYBA 1DJXA 2WZEA 4S3FA 3C2YA 3OBKA 3P82A 1Q45A 5EMKA 3O63A 1GOWA 2ZUSA 3F4VA 5D2VA 6ENLA 5DANA 5DCEA 5DO8A 4UB9A 3T07A 3EDKA 2INEA 3LPFA 3RF9A 2C0HA 1UIPA 4QR6A 4H9UA 1MSSA 1C90A 3PZMA 5AVNA 3B3DA 2IPGA 3CB8A 3T6CA 2VP8A 4MLRA 5FEWA 1BVZA 4ML4A 2UY5A 1A49A 4KCWA 3TQ0A 4WXYA 4DO7A 2Y2WA 4JTCA 2VWTA 3PHAA 4KIEA 4LV9A 2ZX6A 3F2DA 1KM4A 4OZOA 3HIJA 1NDZA 3BJTA 4GY1A 1B57A 1F3WA 1XFCA 1K7FA 4GABA 2CYGA 3MUAA 3CEUA 2ALRA 3PZOA 3JVAA 4KFOA 3M5XA 3GTHA 1YNQA 5T9CE 4S39A 4KWSA 4LY4A 4WEVX 1HKIA 3RHGA 1EGVA 1VCFA 3A23A 3N9KA 3SQMA 2Z7KA 3KOWA 3T05A 3LHZA 4L1WA 4LALA 4A3HA 3CO4A 2BBFA 3P5ZA 2WC7A 4PUUA 3FVDA 1B5TA 3FHQA 5I3FA 4FS9A 4YYFA 2PC8A 4JIHA 3QPEA 4H00A 5K3VA 3LCLA 1MRAA 3M5VA 3DECA 1RA0A 1B31A 1JDFA 3TEVA 4HN8A 4TIMA 4LBRA 3K8KA 2ZZ7A 2CZFA 1SO4A 3MC5A 4MUPA 1BKHA 1PYFA 1UA3A 3GRIA 2FPTA 3PNUA 2BGSA 3PBVA 4ZE5A 3NZPA 4LVAA 1U1JA 4GZJA 5CLTA 1VH7A 3F5LA 1EJ7L 1XD1A 3WMBA 3VVGA 2OVLA 4REQB 1FWAC 1W1VA 3DI0A 3UY7A 1OIFA 3NQFA 3HJEA 3M6YA 1UC5A 3S5SA 3TJXA 2BASA 4GO9A 1SJAA 2INFA 4CQBA 3C2EA 4O0QA 3OGVA 3SB0A 3IJ6A 4RW3A 4PMQA 4D9PA 1BWKA 1C8VA 5BRBA 3LCFA 4KWWA 5LXEA 4C6NA 1W1ZA 2Y7GA 5LIWX 1MW3A 4L64A 3R11A 3MUY1 4DJED 2E68A 1EZ2A 5LIXX 5C55A 3MUCA 3GZ3A 1N8IA 1WPCA 2FMNA 4GXPA 1UQZA 4FNQA 4X2RA 1PDZA 1PDYA 4MWAA 2C16A 1W9XA 1F74A 3GU1A 3SJ3A 1MQQA 5FJUA 3AICA 3EX6A 1JEZA 2VEGA 2DT2A 5CSRA 2VZSA 1U30A 5G4HC 5C71A 1A5LC 1M7JA 2CPUA 3KTSA 4HGXA 4LH8A 1E55A 1OINA 3QLLA 4PODA 5AHIA 3B9NA 3DAQA 1JZ3A 1RLDA 3URAA 3T78A 4UNKA 4Z0SA 4JTFA 1FWJC 3WLKX 1E6PA 4BF7A 4K6AA 3LS9A 2POTA 4CEUC 1TYGA 5DX7A 3GR7A 5M03A 1LT8A 5G5IA 5GNZA 2FB3A 4UTLA 1XP3A 4QAIA 4GFSA 3W1UA 3TYBA 2RGLA 1W5MA 3VDGA 4LOCA 1V6WA 1G4TA 3VKDA 2QVNA 3PBUA 4LB4A 1TQXA 4YHGA 4HZ8A 1JQXA 2XH0A 3C2OA 2BLEA 1DXIA 4Q6JA 4CNOA 2E0PA 3KVJA 4IPIA 3CIVA 1U2YA 4KF1A 4GI9A 6TAAA 4Y9OA 4JQ3A 3V0TA 4RLIA 3GVWA 3DFHA 1XLGA 1TQJA 5FEPA 1AFSA 2VHLA 4IFKA 3IVTA 3FAXA 5A5WA 3MSDA 4W88A 2ZIDA 1X98A 1EKOA 2W67A 4AAJA 3B8SA 3H7VA 3GBEA 2BY3A 5A6BA 3UZJA 1P4CA 4PMDA 1JCMP 4W8BA 7TIMA 3TYEA 3SEPA 4YXGA 4OU1A 4PSPA 1FHDA 1VFLA 2J9ZA 5JIPA 4YTRA 3BLOA 4ZB2A 3BAWA 3N14A 3M64A 2RGMA 4CQ9A 1M3UA 3XIMA 3WCZA 1NM9A 4UR7A 4DXXA 4J2MA 3GHUA 5HWJA 5EMLA 5DT5A 1XYZA 5CJNA 4JPGA 1TELA 1PSCA 5I6SA 4HMNA 5ABFA 3STPA 3MHFA 1H7XA 3GC5A 4WQ6A 5U4NA 4DN1A 5EMYA 3SUVA 1VCVA 1XINA 3MANA 2BXYA 1BVNP 4GJJA 3I65A 1XJBA 4K7VA 1E1FA 1IT7A 1JDDA 3CTLA 2Y4SA 3RGTA 1UBPC 3TR2A 4WHBA 3EMQA 2IKGA 2BG5A 1Q2RA 2J77A 4JFVA 4Y8FA 3WBYA 1FWWA 2J62A 2GGEA 1FY6A 2VFHA 5K4ZA 3GC2A 2OSXA 4GQBA 4Q4KA 2FGZA 2WHKA 4NZ1A 1LTDA 4IIEA 4JS3A 2IXVA 1E1CB 3ANVA 4FALA 3WDPP 3UR8A 5HANA 4LQ1A 3G24A 1OM0A 4AHOA 4ZVJA 4LGXA 2X09A 4M82A 1FHUA 4HMEA 4UTWC 1GQIA 3ECQA 3ICJA 7TAAA 1TJPA 1W8SA 1XSKA 3EDJA 1UR4A 4JCLA 1PHWA 2LLEA 3I4KA 1HKWA 3R6IA 3VOHA 4A8IA 2EBNA 3L2IA 4OWGA 2H8ZA 1XLFA 3CASA 2HTMA 3FEQA 4A05A 3MP5A 3LM7A 3NQCA 3SO7A 1K1DA 3CHDA 1QO2A 3P8IA 2NWSA 1NP0A 2ZTJA 5A8MA 3W84A 4JICA 1E9IA 2HSAA 5A2BA 3WENA 4HU4A 2VWSA 4F66A 3PM6A 4NX0A 1K4HA 3PTKA 2C1GA 3P7YA 2EXOA 5BRQA 3PFMA 3A4XA 1IR1A 3G0SA 1R3SA 1A0EA 1E6RA 3O1NA 3W2LA 3C2FA 4AWEA 4CNPA 4AX6A 3NVDA 1K8YA 1W17A 1M53A 1IWAA 2AKMA 4CU6A 4PN2A 4RZ5A 1LL7A 3TONA 3NJ3A 6ALDA 4FEZA 2GVEA 3V0UA 1KFKA 3H2EA 1ZSXA 3WSUA 4Y9AA 3G6MA 1V6UA 2XH7A 2ZXDA 4UWMA 3MV01 2CCRA 4M6VA 4C65A 2AQOA 3GTFA 1EA0A 2AAMA 4PMNA 3U2ZA 4J1OA 2WQDA 2GDUA 3S1UA 2VD9A 5FIPA 5BCAA 3IWPA 3VIPA 3GM8A 2BOFX 2TRSA 2X40A 4IL2A 1H11A 4L65A 5GJMA 2YB4A 3P60A 5IOBA 2PTDA 2OYKA 3TW9A 5HDRA 1SFLA 1IWBA 3Q2DA 2PDNA 2PUZA 1LOSA 3VINA 1F8MA 2XIQA 3M0IA 3S4TA 1RPXA 4QHRA 3VNYA 3QV8A 1UP2A 4QQUA 5A8OA 4V2XA 4MZYA 2BVWA 2ASHA 3W74A 4DBWA 2C91A 2G4FA 5LNWA 4M3PA 4RDYA 1W5OA 3ANUA 2PZ0A 3K2GA 4ZENA 3UA4A 3DFTA 4O4VA 4KRTA 4QIUA 4YWIA 3LD5A 4FNRA 3WF3A 5DBUA 1E0VA 3BGJA 3UPBA 4J9JA 3GDTA 3UJSA 1OFOA 3VCCA 1M01A 1S1PA 1OQFA 4A22A 2Z00A 5FJOA 3WL1A 4TVUA 4XAYA 3CAVA 3UCQA 3QOKA 4JAWA 1DJGA 3CPRA 1RALA 2DJXA 4IHCA 2XVLA 1DQUA 2C6QA 2YXGA 8A3HA 4QG8A 1EXBA 2F6UA 1A5CA 2IMRA 2OFJA 3O05A 3TIMA 4B4HA 1HKJA 4PL1A 1R6WA 1CGYA 1H61A 1KBJA 4QLKA 1YX1A 5EB8A 3OPSA 3OTRA 1OFQA 4KBXA 4O1BA 3CU2A 3DHFA 5CC7A 1TTPA 3HURA 5A1AA 4C6CA 2R1MA 3KL0A 4PULA 1F07A 5D2TA 2IS7A 2IKIA 1G01A 3IJIA 3GXMA 2C19A 5HAOA 1EH9A 1JFHA 1XHGA 2FZ8A 3MVTA 1ZU8A 3W37A 1H7OA 2I5IA 5I0DA 1VP5A 1KA9F 3GHTA 2PRHA 1F8IA 4FXSA 3LHWA 3L4UA 4RE4A 3HOJA 3WMSA 2X7VA 4JYFA 1DWFM 1MXDA 2Z28A 4PEKA 2EPOA 4JR5A 3AXMA 1JPHA 5ABTA 2Q71A 2Q8ZA 1UUOA 4JQ1A 1XG4A 4IH3A 1KFJA 3JR2A 1HGYA 2IQ0A 1IV8A 1XRVA 3V75A 1NF7A 4GISA 3A4AA 3NL3A 3PR2A 4FLRA 5CQ1A 1ZCCA 2CESA 3NQAA 3SY5A 3VXGA 2AGKA 2V63A 2BFGA 4Z17A 1YBQB 3VAVA 3QR1A 4AIUA 2O9PA 2DH2A 1UUMA 1DJWA 1OFAA 2CW6A 5AC5A 3VA8A 2XGIA 4D1JA 2JIEA 3R58A 2WCSA 2XZ9A 1J01A 4H6RA 1DJNA 4ZZ9A 4ICMA 3BSMA 3U48A 1NARA 3W2NA 3SCNA 2DV0A 4XZIA 4HTBA 5GQBA 3FJLA 1CB2A 1ODZA 1E0XA 1OSEA 4OIFA 5GPRA 3ZYZA 3E0LA 1HF6A 4UTJA 3FCPA 1D3GA 1S38A 1RK5A 4B2DD 2C8NA 4MWAB 3O2LA 5K9XA 2ACQA 3NO3A 1X6NA 5J5DA 2UZ9A 2VC7A 3PZUA 3MO7A 3PJUA 1H7NA 4O8AA 1E73M 4QRNA 3WUGA 3GNPA 1I2QA 3WDHA 1CCWB 2OKOA 4EOUA 3ERPA 5I24A 2OKTA 3B8VA 1QCWA 3NOYA 5K7JA 1YW1A 2YOCA 4Q3MA 4E8GA 1S39A 5BYWA 4PMUA 2ZDSA 1H7PA 2WHJA 1EGZA 4JTIA 2C13A 2BGNE 4TMCA 4XD5A 3FX4A 1DHKA 4HPXA 1MNSA 5F1UA 4B5VA 1BWLA 3QTPA 3AS1A 3BZJA 4L4LA 3FHAA 1GVOA 3VCRA 5TQLA 2J88A 4GX9A 3EOOA 1US0A 3BGAA 4KRZA 3W00A 1DL3A 3AIVA 3ALFA 1JAKA 1JZ7A 3THQA 4GCXA 3B0VC 3WK1A 1EBGA 8RUCA 4ROQA 3B8IA 5EMUA 4M0XA 3GFZA 3GG7A 3QLDA 2SFPA 3W81A 1GVYA 3NXLA 5HULA 3BJFA 3VCNA 3NGJA 4RPQA 2DQWA 1OCBA 5FJTA 3UJEA 4FR6A 2BHZA 3CUJA 4H9YA 5CPLA 4ZQCA 5IHSA 5AHLA 3T40A 4E8CA 1H0IA 3QYQA 1GVQA 1TCMA 3VIGA 4NILA 1AW1A 5B80A 1ZLPA 1Q6DA 2R8WA 1ZP3A 4GQ0A 4FOJA 4IG2B 3OLGA 2F38A 3AYVA 4C7DA 1TA3A 3HMCA 3KOXA 2RJHA 3W2MA 3GTXA 5HATA 3VOGA 1AL8A 1LWHA 2PDPA 2Y7DA 1MEHA 4A3QA 3S2CA 2VZOA 3II1A 5LGXA 5D09A 1S5WA 3HPZA 1GOQA 3AHZA 5LA0A 3APGA 3AI0A 3P0XA 3A6OA 3CQHA 4V27A 2A7RA 4O54A 2GOUA 5HPOA 4KFNA 4OV4A 4GXMA 4PRRA 4AFYA 4KFPA 1VD6A 5CCZA 4RNIA 1OGBA 1MXGA 1TV3A 2OEKA 2E5BA 3M4HA 3KBSA 3WDJA 2JKAA 3S5NA 1TIWA 1AH0A 3ZSSA 4HJWA 1A53A 4NZFA 2PWEA 3NQBA 3BCFA 1E72M 4HOZA 5ABFB 4N0RA 4CD7A 3NVTA 3MW7A 1P6BA 1H41A 4WY0A 1LLWA 3B9AA 2ZCGA 1EX1A 1DJQA 3QGKC 1DXEA 1WXJA 4L4OA 4GKTA 3UXDA 3UWQA 1JYWA 1L8PA 2VFDA 1MWOA 2HPIA 2XN0A 2W63A 1VFHA 2PDGA 3AMGA 3VGEA 1B9BA 4IMDA 3L4VA 4A35A 1K70A 4PUWA 3CLWA 4FP1A 5JVLA 2XFYA 3ABOA 4EWND 3HF3A 2I17A 2GJPA 2ISVA 3W6YA 1XUUA 1GZGA 4LANA 4CCEA 3M0MA 2OZTA 3T08A 2ZUVA 3AYRA 3ITCA 4HPHA 1CXEA 2P53A 1JNEA 2FDSA 2YZRA 4AHPA 1LUCB 4PUDA 2GDVA 3T2OA 4JGDA 4LEQA 4YLWA 1XQLA 2I14A 3EWXA 1UKTA 1GOXA 3TX9A 2OLAA 3GW3A 1K8XA 5AYZA 6A3HA 4WK9A 2P0IA 5EYWA 1KGXA 3IVUA 3FIGA 1OGGA 4E8DA 3U2CA 2UY3A 4IJCA 3OIHA 4TX9A 1IXNA 3J7HA 4I5UA 1IT8A 3OVGA 4IPPA 1Z9AA 1NIUA 5E9XA 1NEYA 2EG6A 4G1KA 1IZKA 3W1TA 1CTNA 2QUNA 2NUXA 4HA3A 1G9HA 3TYZA 5I2UA 5I5RA 5DCBA 3D5HA 1DWAM 5KZ6A 3WQVA 4TO8A 5A6LA 3UZYA 4DY1A 3AAMA 2FZBA 4MLJA 5FI8A 1XIDA 2DU2A 2RDTA 4C6IA 3KLLA 3OHMB 1EO7A 2R82A 3K30A 4KH2A 4K3ZA 2PWUA 3BW2A 2XWDA 4GQGA 4X0NA 2QDHA 2Z6JA 5ABGA 1UD5A 1US3A 3MHGA 5F1VA 3U8GA 2UY2A 4W84A 4MAZA 4K2SA 2Z2BA 3Q65A 4JKMA 3PN8A 2CHNA 4DVOA 1XBYA 5HUPA 3V18A 3M41A 1DIOA 4LYRA 3IGXA 4F3HA 3PWIA 2C1IA 2GGJA 3T9PA 4QDPA 1TE6A 2V5JA 3WQOA 1YDNA 1K4GA 2Y89A 4ACZA 3O6AA 3MB9A 4ADUA 3PUOA 3ITGA 3CHCA 4DZ5A 3EB4A 2H6RA 2Z1SA 2QAFA 3SM0A 4YU1A 1ZB5A 3VDHA 4FOUA 5D9OA 2FPYA 3B8DA 1PWMA 2CLFA 2GJLA 4XWUA 1T8QA 2RUSA 5MKGA 4RDWA 3NDYA 2OCZA 3ARVA 3I4EA 3EWZA 5JUVA 3UG5A 4AZHA 4WRHA 1CB7B 3GHRA 6PTDA 4PYSA 3L65A 3H12A 4GCAA 1LQ0A 1NOFA 4JHMA 5C8BB 5HINA 1TWSA 3N11A 3CPGA 2NLYA 4AW7A 3T1GA 2FZNA 5CC5A 3TN4A 1ME7A 2X1IA 3R89A 3ZLHA 1SW3A 3OZOA 1KXVA 1WCGA 2HDJA 2OT0A 1BGAA 3E49A 3BICA 5DMMA 1R2SA 3KP1A 1H2JA 1IGSA 3W1LA 3TC7A 1EP1A 1HL9A 1VJZA 3VD5A 4GI6A 2FGBA 1OY0A 3DESA 1HL2A 5M5DA 3AIUA 3K1GA 4QSHA 3AMDA 4FXFA 4JTEA 3ABZA 4ZXOA 5LSMA 4DX3A 1NP2A 3RLHA 4ZQMA 1XRFA 1ZUAX 4F0HA 4NF7A 3OZPA 1QI3A 3BH4A 1V0NA 4D6EA 3M07A 4JNZA 2VEMA 1SVDA 4ROPA 2C71A 2V3GA 1F5ZA 4US5A 2R1LA 1QNRA 3LBMA 4MOZA 3R2GA 1P0EA 3ITVA 1CXFA 5E0CA 3TNBA 3LV5A 4EF9A 3KBMA 4HJFA 3ZT5A 1QI2A 4W8AA 1H3GA 3OB8A 3T42A 4AZ7A 2FH8A 3K8LA 1WP6A 4YYCA 1H09A 1W5NA 2V69A 3AMLA 1JR1A 1VEPA 3B9DA 3CPUA 4DJDD 1RJQA 2CLOA 1HGWA 1E15A 3VGGA 1DJYA 1NFPA 2J7FA 4R7OA 3ZFHA 4IP5A 3DEQA 4XSMA 3BE7A 5FF2A 4MWAE 2YA2A 3Q45A 2PI6A 4YTTA 3UNTA 4PRWA 1DJZA 1RD6A 3W7MA 3R43A 3OGRA 4NYYA 3TOYA 3ABQA 3CWNA 5C7VA 3PZTA 3W85A 3R8HA 1SPQA 4HD5A 2VEPA 1W1YA 2VR4A 4LCSA 4M1BA 3MWAA 4Q8MA 5CBIA 1EOKA 1GJPA 1R3WA 1MFVA 4JX5A 3DBPA 3PWGA 3ISIX 4E2VA 3EXTA 1CLVA 1N82A 4GYKA 2XWEA 1DIDA 3ARZA 1ITQA 1X1ZA 3IJQA 3E2VA 3RU6A 3V36A 3H2OA 1VRXA 1ICSA 5F2MA 3EZ4A 4ORMA 2ZVIA 4JN8A 3PJTA 4HHPA 2ON3A 2P1FA 1AD1A 3WQGA 3CV7A 5DMLA 3DFOA 4NJHA 1XCFA 3G6LA 4LPCA 4Y96A 4U2ZA 2A79A 4HYRA 2QKFA 5EL1A 3UGRA 4HK7A 3THDA 1MNZA 3CIWA 4PMRA 2RHGA 1XPGA 3GXTA 4GQRA 3AIRA 3NL5A 4F4RA 1W3TA 1EYEA 3CUHA 3T55A 1KXTA 3UWVA 1KCZA 3K1DA 2QPXA 3WY1A 2QF7A 2CZEA 4MY9A 3GKFA 2OLHA 2E09A 4B5WA 2EGZA 4IMGA 1OBAA 1JCNA 6CGTA 2GWGA 1UMLA 4U3AA 3VKBA 4H3DA 3W0KA 2VQUA 4B5TA 1IXOA 1LQ2A 3LSBA 4I90A 4Y6GA 2X1TA 3KTCA 3F4CA 4KCVA 5KEZA 2YKKA 2VL4A 3FSTA 2VVNA 3RNDA 4WLCA 4WD0A 1C9DA 3TZNA 1XKYA 4UQAA 4HPJA 3E02A 4CN6A 3BANA 3N2BA 4LVGA 5E09A 1JVNA 2J7BA 3GAKA 2FGLA 4Z1CA 4C6LA 2ZX5A 1UWQA 4H6EA 4PMXA 3LENA 2QQ6A 1TUXA 1JI2A 1ISXA 5K2ZA 1FP8A 3GDRA 1ALDA 4Q4MA 4F40A 1GVRA 3NFUA 3R7MA 4DJEA 1FOBA 1R0MA 4GO8A 4O12A 3W4RA 1F61A 1TA3B 1MUCA 2WBKA 3C0JA 1UZ4A 4DLFA 2OEMA 2ZXBA 3QY6A 3BCJA 1NWRA 1OFBA 2QCHA 3NCOA 3MYOA 1S2VA 5CGMA 2HV5A 1FCQA 3TN3A 3S6OA 3GH5A 3F4NA 5FA5A 5HA7A 4DIAA 4IIHA 5H1WA 4OUEA 5IFPA 2VZUA 3REQA 1VFMA 4GUGA 4F0KA 9CGTA 4GI8A 3JW7A 3KHJA 2WM1A 3URQA 2BB0A 3UNDA 1QPOA 2PWFA 3QPYA 5RUBA 2EPNA 1WO2A 1B54A 1Q7ZA 3AYSA 4UQCA 1JJKA 3ZXWA 1QOXA 4FR1A 1TPEA 1XIFA 3M6DA 3MWCA 1SO6A 1UC4A 4GC4A 1J10A 1UD3A 5FACA 3G1AA 3LBOA 1OCQA 1G4SA 2BVTA 1A0CA 2Z7GA 3LB0A 3G3MA 4WY0B 4DJFC 1TX0A 3UESA 4JOMA 5A69A 1GTEA 7REQA 1GPWA 4B9YA 4C6OA 4AVNA 4E4PA 3HZ3A 1TPDA 2Z1VA 2QJGA 2OU4A 5A2CA 3QKEA 3H2MA 3TE9A 2V6AA 4W7WA 4US6A 2WKGA 4UTMA 3DC8A 2BXZA 4ZO9A 4MM1A 4GACA 3PB0A 4AG0A 2NW0A 1EXPA 3H70A 1NAL1 3FJNA 2FTYA 4EPEC 2WNZA 4EPDC 3LCGA 3NPUA 2WKLA 1OC5A 1NY1A 1O1ZA 2QVHA 1AQ0A 3VZXA 3RCMA 2PU1A 3BO9A 1IIGA 2OYMA 3QBUA 1ZP4A 5ECVA 2HRWA 4DQWA 4YS1A 1SW0A 1FUYA 1TJRA 1VJIA 2YA0A 1AG1O 1S3HA 1WDPA 3SCWA 3CMFA 4Y2WA 4F8XA 5C54A 4AZCA 2GJRA 3W86A 4EXQA 3BOFA 3ARRA 4XG1A 3LERA 1TKKA 5CGQA 3AXIA 5DN1A 5HWNA 3OA5A 2HK1A 2E5CA 4Q6XA 2Z2AA 4DZHA 2WMGA 1RLCL 1GORA 3TQKA 2GVGA 3ARPA 3ITTA 3CHFA 1RD5A 2YCLB 2XN1A 1JDCA 1XLIA 5BXRA 3M0ZA 1DWJM 2DZVA 5I3KA 1EC8A 5C2CA 1BXNA 1SSDA 1QO5A 1RCXB 3OP2A 4R7JA 3OW1A 3TW7A 3ZLGA 3GB6A 4BA0A 3WLIA 4YCOA 4NAFA 1X39A 3W1AA 1KGWA 1W0MA 2B7NA 3PZVA 3TJIA 1J5SA 2PWGA 4ZQRA 2DUZA 1MEWA 1B90A 4ZO8A 1XH2A 4DUOA 4Y8EA 1R2RA 3IGHX 5A6JA 1VGAA 3ID7A 1G69A 3RO6A 5I3JA 2QCLA 3DH7A 4V28A 9XIAA 4J3UA 4XZNX 3THUA 2VFEA 3G1XA 3UWWA 3UEQA 2TSYA 1ENUA 3L2MA 5AOUA 4R85A 3KL5A 2FQIA 4JTQA 1F4HA 3C3UA 1JZ6A 5H91A 3W07A 2YLAA 4XTDA 3SR7A 4LUIA 3L0KA 3UXAA 4FX6M 4GG9A 9XIMA 4AVFA 3SCRA 2NUYA 5IFTA 1F3XA 2DSVA 2E67A 2VUNA 3CJPA 3A5FA 4MWAD 1UKSA 3BMVA 4RKAA 1RVKA 4ACZB 4HMCA 3VIHA 2R6OA 3WJYA 3AHYA 2ZRZA 3RXZA 1L6SA 2DEPA 3ZIZA 2XJ7A 1UKPA 3SN0A 2Z2UA 4K36A 4MJ4A 1V6VA 4AZ6A 4XSLA 3DG7A 1XLAA 1F7BA 3PVFA 4C6JA 1A5AA 3N12A 4KGJA 2QXWA 4RPPA 2PU0A 1JZ8A 3VUSA 1HJQA 3UW6A 3IIXA 4MWAC 1UH2A 1J0KA 3WDQA 3WLQA 1D9EA 5LIUX 1B3WA 1YTEA 3CUZA 1VCGA 4LBUA 1A0DA 1DP0A 3GKAA 3SY1A 1HKMA 1HL8A 4NRRA 3TFXA 4D8ZA 3KVLA 4G56A 2E77A 1TWIA 3QV6A 2MANA 2QUVA 2EO7A 2PURA 3STFA 4LW7A 1W1PA 3MKCA 4H7ZA 3MI2A 1MQPA 1E9YB 2F9RA 4AZGA 3O16A 1I0BA 1UMYA 3L12A 2XFRA 1UYQA 3RR4A 4IXXA 5C2GA 2WK2A 1BYCA 3KRUA 2WSKA 3M7WA 1CLKA 4QFUA 3QW4B 4L6OA 3VIJA 3P74A 2DPEA 4L9YA 2ABAA 3SFWA 1EIXA 5KZEA 1DE5A 5A6BD 3H2CA 4AY8A 2D22A 3CL7A 2VURA 3APTA 5F2IA 3WF4A 1QHOA 4AB4A 1J2WA 1EEXA 5H8UA 4GPNA 2QCEA 5CPSA 5IBXA 1UR3M 2GSHA 2VGIA 2Z26A 3QMRA 3BPWA 2O56A 3GDLA 4EAYA 2GQ9A 4IGHA 1GW9A 3UG3A 2BVDA 4JIPA 1V8EA 2V68A 4JL1A 4PEEA 3SCVA 4O16A 3GVQA 4B5SA 3KM8A 3AALA 4KEZA 3CMJA 1KQYA 4LU0A 1XI3A 4H1ZA 1LJYA 3W22A 1EB3A 4AMCA 1GPFA 1AODA 5KSWA 1K9DA 3B8WA 1XDLA 4KMQA 4I6VA 3P8JA 4KWVA 4CD8A 4J5NA 1UZDA 5FAGA 4GY0A 3EX4A 1U1HA 2PDFA 2GVLA 4ATWA 2ZVRA 1D2KA 1VYRA 3G3DA 2NQ9A 1FFRA 2PDIA 2YX0A 3KW3A 1GKQA 4L4PA 4LAUA 1Q4WA 4S38A 1ONRA 3VC6A 4B4FA 4JZ5A 3W87A 3TW6A 3BG9A 4X60A 3GVVA 4A2RA 1TVPA 2RH9A 4JTAA 4LRTA 4HKPA 1T7LA 3O8AA 5D37A 3B97A 4PUEA 3WNLA 1J9YA 1WKDA 3LSCA 1M1BA 1HP5A 3UF9A 5H6HA 1RH9A 3W02A 1DJHA 4IP7A 2Q8XA 1TWWA 2FVKA 3WIJA 3EWCA 3TSMA 1BVWA 4ECLA 4IFOA 2A3HA 3P62A 4LSBA 4S3KA 3EDEA 1GVEA 3O6YX 1XSIA 2E28A 4UTUA 4LX4A 3R0UA 3W01A 1VLWA 3NQ8A 2ZA3A 4JKLA 4QX4A 5KETA 1ZL1A 5LNRA 3BAXA 1V79A 4FPSA 1TJ2A 1J0JA 2E1DA 3ARXA 1QT1A 4KPLA 4XZHA 3SJNA 3EX3A 1TWDA 2D24A 3AC0A 3Q67A 2I9EA 2VCCA 3W29A 4KEVA 1FWEC 2BOEX 4HHLA 3QR0A 1AA1B 4IP4A 1GCYA 3NXFA 2DT1A 3G1FA 3AIWA 4EPKA 3HG2A 4JKKA 4H2CA 1AQHA 1UJQA 3ZJ8A 4TX6A 4CQAA 5F2LA 2FZMA 1D7FA 3ES8A 3AYTA 4O0KA 1YPFA 2QHAA 2Y6ZA 3S1XA 1L9WA 1WOAA 4LUTA 4XD6A 4JQ4A 1OYCA 3QM3A 1L6GA 2CITA 2E4TA 1BG4A 2NX3A 5AYXA 4DELA 1JZ4A 1O4UA 1R3VA 1AL7A 4BWLA 4HPGA 4LBSA 4YNGA 1Q7QA 4Q4QA 3EA2A 4PCNA 4B9ZA 2HEJA 4HU8A 2VFGA 4JTTA 1X7FA 1XFBA 2NSXA 2J4GA 3VX1A 1HFBA 5D8ZA 3UVIA 4B2DA 4NZ4A 4E2BA 2V5BA 2NXHA 2HCVA 1UWTA 3UA3A 4P7QA 4D6HA 2HS6A 2RFGA 3PBGA 2BP1A 4E4UA 2QIIA 2DZPA 4FNTA 3V5FA 4AIOA 4PTMA 2VCBA 1B3ZA 3V0SA 1X8CA 3I3DA 2QEZA 2Y8VA 4DF0A 3AS2A 2PP3A 2YL9A 2YCJA 2BXVA 3EKLA 3SAZA 8XIMA 3TNOA 1MUWA 3DIPA 3C52A 2J8FA 2Q02A 4H8UA 4Z2KA 3POCA 3GXNA 7REQB 2JEQA 1PVNA 3CC1A 5HQLA 3PJWA 5GJPA 1ISZA 2Y70A 2Y61A 4XO7A 1Q6OA 4IQDA 1V03A 5DMNA 4WDUA 2J7EA 1R86A 3GIYA 4Z08A 3RPTA 1UG6A 3CYVA 2E7FA 3WEMA 3WDIA 2QMKA 3DC0A 3DYPA 1W31A 2J8GA 2MUCA 1PX8A 2EKCA 1P0NA 2FHFA 5AVHA 3WEOA 4JX6A 3QQ0A 4XAZA 1WB0A 1TPB1 4JHZA 1S5VA 3IV8A 3WQPA 4JFWA 2QCFA 1TPWA 5AC6A 1KBLA 3W7QA 1E56A 3E3HA 3DI1A 5I23A 4IM4A 3QC3A 5DXYA 3UFYA 4FF7A 4WIWA 1A5NC 1TCDA 3KCJA 4M80A 5CZTA 1Q6QA 1ZRQA 3RLUA 1JZ5A 3LRKA 3G0UA 5CPNA 3GNNA 4FIRA 4JBRA 2Z27A 3S2MA 2EPLX 3MKKA 1QWGA 1ZJBA 4NAFB 3HB9A 4WDTA 3FGCA 1O7AA 4AD2A 4HNNA 3TQPA 3NYZA 3W25A 2GGIA 3LI1A 2Y85A 1VR6A 4H01A 1UKQA 5T9BG 5JBDA 3EWUA 5CEWA 1JXKA 1O5RA 3I6EA 1DVJA 4WKAA 1FXQA 3UWEA 3MQTA 3CQKA 4XZWA 4IPNB 2WMJA 5D33A 1VRDA 5LA1A 3THCA 5FF4A 4M6UA 1DV7A 2RDUA 4FK9A 4GNKB 1A4LA 3W7CA 2JFEX 1POJA 3MKVA 1ZENA 5AYYA 2QJIA 3ZO9A 1UP0A 5CSYA 7A3HA 4DNHA 1KV5A 3LA4A 2QCCA 4HMDA 1H1NA 4POCA 2YBUA 2X2GA 2ZRWA 2D3LA 2Z1BA 1NQ6A 1OABA 1U5HA 3TLQA 1LL6A 1GHSA 4N7QA 3O0FA 5H8PA 3C8FA 3VZYA 1J8VA 1AZ2A 1F9CA 3R12A 5D04C 1DORA 1JNDA 3M0XA 3QGAC 5E0KA 4JDBA 3HG4A 3AO0A 3CXOA 2VOTA 1TV8A 2CBIA 3AMKA 4AZ5A 3UCDA 5CBJA 2DQXA 3WQWA 1ADOA 2IQDA 1UROA 1JDAA 1KFLA 2VT0A 2J47A 2VGFA 3UETA 2Y7EA 3UGVA 2P3EA 2BX7A 1DPMA 2BV9A 2HE5A 3WELA 4H41A 1I1WA 4QJ5B 1W3IA 1WNOA 3S5ZA 3S6DA 1G6CA 2XIMA 3IV3A 4XAGA 4IIBA 4I9JA 2YFOA 5CC3A 2NLIA 3AZTA 3C0LA 3KOFA 1K77A 3H54A 2J7HA 3CK5A 4DF1A 2D69A 4EK7A 3L4ZA 2HVOA 1EP3A 4GVHA 4JTDA 4GGBA 4AWUA 2QUTA 3WNNA 1PWLA 2GJNA 5CZKA 1XW8A 1UASA 1XRSA 4RJEA 5I3GA 1TIMA 3GLCA 4Q4OA 2CBUA 2C1HA 3W7IA 3DFYA 2H90A 3E2SA 3SURA 1KXQA 3N4EA 3AJXA 4NQ1A 1E6SM 1T41A 2J8TA 4GINA 3UWUA 1NU5A 3VIIA 1LG2A 1FX6A 3T0AA 2WHMA 2XGBA 2NVAA 5U7SA 1KCXA 2DY3A 3NGFA 5LKYA 4Q8OA 2VR5A 3H6OA 4C6QA 4GC3A 1GG1A 1XLHA 3AXKA 3OVQA 3U2EA 4EF8A 2PGEA 3FA5A 3EWWA 1W9UA 4GFIA 3A3XA 3UCCA 4UTHA 3C5QA 2DZBA 1H1YA 1MQRA 2CIPA 1ZAJA 3NR0A 3MSYA 3OEXA 4H6QA 4DI8A 1NWUA 1TR1A 2WVSA 2AAAA 3IIZA 3SRDA 2RDXA 3EB3A 3G1HA 1HJXA 1RBOB 3D0CA 4Q8VA 1PBGA 3CUXA 3R8GA 2ZE0A 1A3HA 4KQNA 1P0DA 1BQCA 5DEZA 3I6TA 3VD9A 2AMXA 4HTYA 9RUBA 4ZQPA 4A8RA 4D6DA 3HN3A 1F2JA 2C79A 4YN5A 3WLRA 3WMCA 3PTDA 2PDUA 5HR6A 4NRSA 3WFAA 1Q6CA 4Y7EA 1YHTA 5AHMA 2VD8A 2WJEA 3BLEA 1QNPA 3GIPA 1M03A 4LNCA 3PBWA 3UXKA 1BYAA 3PG8A 4R34A 3V5OA 1RP8A 5GVJA 2X30A 4N9BA 3E1F1 1W9PA 5KZMA 4DWSB 5D8WA 5JIWA 3NA8A 3N73A 1RBLA 1SUXA 3QKZA 3WH7A 4O57A 5HNNA 5CBBA 1VPXA 4JNMA 2OSWA 5C9WA 3FSUA 5A8PA 1CDGA 1DWHM 1L6WA 4C1LA 4UZSA 3PBYA 2FH6A 1C8YA 5A6KA 3U3HA 1X7IA 3LEPA 3R13A 3W7RA 2A1YA 4I7WA 5LIKX 3QC0A 4UTIA 4MVAA 3M0KA 2A3CA 3ZJ7A 3S2NA 1WZMA 4QS6A 2X0SA 1ZS2A 2PBGA 3URBA 1GJUA 2QDEA 3T2QA 2NZLA 1OC7A 1XH0A 1UOZA 1ZGDA 4DJDA 1IZCA 2XVPA 4C6FA 4MKVA 3CMGA 3VKKA 2BODX 2B7QA 1PPIA 1IXQA 3UZXA 2WZMA 4ZEPA 3PK7A 4LTSA 3ABXA 1I75A 1KFWA 1SJCA 4IUGA 3W1XA 3RM9A 4JIRA 1EJRC 3NL6A 3AWNA 1GVIA 3ZR4A 1A5OC 3FS2A 4Z1DA 4AYGA 1J93A 3CL8A 4MJMA 3W76A 2V81A 2ZRVA 4ZB0A 3P81A 1M7OA 2R94A 3FYYA 3MCOA 4XUYA 2ISWA 4JTRA 1CGWA 4V15A 3AOFA 1BXBA 4D6CA 4ZO7A 1Y7VA 1EJWC 3W7OA 4XBSA 1Q13A 3IUIA 4XD4A 1EHNA 1A5MC 4QQ3A 5DLCA 1E3ZA 1E9ZB 4BEQA 3OLEA 3UYIA 3B03A 2YZ5A 4I3GA 1IYXA 1RXOB 1D7KA 3HPAA 5AC7A 2DZTA 4O8RA 4ADSA 3LN3A 4NZ3A 3BURA 3FLUA 4ZTYA 4K8HA 1BKSA 2E5DA 2E3ZA 3D47A 4QDMA 4UTFA 4I9AA 4CU7A 1TPC1 2IXUA 1I1XA 3FN9A 1FWDC 4H2HA 3H7RA 4O11A 4JTJA 2PDCA 2OO6A 4MPQA 4QS5A 4R7WA 3DENA 3INPA 2A3EA 3S2LA 1X97A 3PULA 3VPLA 1XV8A 1LLOA 2Q3RA 2YJQA 1MDLA 5BU6A 3P14A 3H21A 3AZSA 3TWBA 5J5RA 1OHLA 4RZ4A 3A21A 2QGYA 4UUIA 4JTHA 1XC4A 2CBJA 2YIHA 4LVFA 3VM5A 3WLHA 4IZGA 4CNUA 3R0DA 5M1TA 5M3WA 3U57A 3T81A 4DBDA 3KL3A 2WZTA 4GH1A 4Q8WA 3C56A 4U4MA 4HNCA 3DG6A 3GUGA 2F8QA 1R87A 1GG0A 2PTZA 2Q6ZA 4MKSA 1SO3A 3BQ6A 1GK8A 1SZEA 3ONBA 3MYPA 4XZLX 2HK0A 1ISWA 4J3VA 1G7VA 2FKPA 2D2JA 5BROA 3MSRA 4LUSA 2FVMA 1Z41A 1KBKA 4UCFA 3E5PA 1EPXA 3BL3A 1UD6A 1L2QA 4P7OA 2AOSA 3IIVA 5KINA 3GG8A 3WFZA 5FESA 2WAGA 1RPKA 1XQKA 4DYJA 4US5D 2XM1A 5CJ5A 1UZHA 3WLTA 1FWHC 1YNYA 3VO0A 1B9ZA 2YCEA 4XVDA 1AW5A 1V3KA 2EKGA 2PDMA 3N25A 2X1UA 4GUJA 1R47A 2D3NA 3N13A 2PWHA 2TYSA 5ABHA 1YEYA 3TMQA 2VXNA 5TBOA 5K9DA 3GR8A 3EOEA 4GX8A 3BWWA 4NU7A 5C9ZA 2NQHA 4NYUA 1LYXA 2XIOA 3NAVA 3FGCB 4F0RA 1ADDA 2QMJA 3ZWTA 1H63A 4F9JA 5HQEA 1G5AA 2Y62A 3UPMA 2OR2A 1W32A 1ONWA 3ZMRA 4DEFA 2WPBA 3UXLA 2HROA 1W9DM 3F03K 1C9WA 4FI4A 5D30A 1HJWA 1UBSA 4P7NA 1YTKA 1UUQA 1T6MA 3WLMA 2V2CA 3EPMA 1U1UA 3LMYA 3IRDA 1S2AA 1K02A 1UW9A 1PCWA 1PL9A 4NHVA 4LV4A 5A94A 1W2VA 2H9AB 2OOGA 3P93A 5HJLA 4GYFA 3BK0A 3V1PA 1B4KA 3LX9A 3MDWA 3RDKA 2NVCA 1NF0A 4RZ6A 1ZBCA 3WQDA 3OLDA 4GA8A 4AF0A 3L4XA 3W38A 1BHGA 4L1GA 2FZDA 1TPH1 3GH7A 5EBUA 3CM4A 4MB5A 4GKLA 4ZSTA 3N17A 4FAMA 3KHDA 1AK5A 4KCUA 2X42A 2PDJA 5HK4A 1RVGA 4H9VA 4GGHA 1UZ1A 5F2GA 3BMWA 3NQ2A 4WJ8A 4MNKA 2WM0A 2YL8A 2FJUB 4G6CA 4WOZA 3U4AA 1J11A 1EYWA 3S1GA 5FJIA 1H1ZA 1QPQA 4PB4A 1P5BA 3IUHA 5M17A 4JFSA 3T8QA 3GIQA 3GG1A 2ZXQA 1WDRA 4HYWA 3FK4A 3S5OA 2YBVA 5GJNA 1O6IA 4NI3A 4AH7A 1RP9A 3RIKA 1CYGA 1E0WA 2EEXA 3ZR6A 3E2QA 1FDZA 1YBQA 1SM9A 1TREA 2Y5JA 1XLLA 3KBNA 3RRAA 3WF2A 4O18A 3TUUA 4N42A 3WQ4A 7ENLA 1TMQA 4UQDA 2YLLA 4WVXA 1ONXA 1VHNA 4U5KA 4S3GA 2BMBA 3STGA 3KTXA 3SBFA 1BYDA 2DDXA 4V1YA 4DM2A 4AVOA 3ZT6A 4U31A 1J0YA 1FBAA 4LWWA 2HVMA 4HK6A 4QSFA 1TZ9A 3WD2A 2BY2A 4S23A 4OHQA 4EIVA 2BY1A 2CLPA 2HNHA 1OEPA 1G94A 3OQ8A 3VNZA 2I57A 2C7FA 2OO0A 1REQB 2W62A 3VFCA 1QPRA 3NNTA 3UR5A 3LG3A 3BLLA 1BPLB 4LEFA 4RL3A 4XV0A 1SZFA 1ZBKA 1OYBA 4S3JA 4UCGA 4M6PA 5BU9A 2EF9A 3W23A 3HV8A 2P8CA 2X16A 2WPGA 2PCEA 2Z6IA 3EBVA 1UP3A 4DJEC 3JZUA 3PB2A 3CBWA 1ITUA 4M8UA 3AUOA 4ZO6A 2WMKA 2ZUMA 4G2DA 1SFJA 2ZKMX 2GSJA 1I2OA 1OF8A 1V7AA 3SN1A 3UPWA 4D71A 4NZCA 2VVSA 1VPQA 1XDJA 4IWWA 4WR3A 5JBEA 2DJLA 1BRLA 4CQDA 3AU6A 3FXGA 3D3AA 1Q5MA 3WQEA 4C5YA 4K8EA 3PZIA 2OB3A 1R3YA 1EJTC 2FB2A 4LFYA 2W3ZA 4D6GA 1VBGA 1SMAA 4J3SA 1OK6A 4MDPA 1XCXA 2GVJA 3VGFA 1G1YA 3BLDA 3IPWA 5G1TA 2ZX8A 1FP9A 1S5TA 3S3GA 4PA8A 4GYPA 3VGHA 1JPIA 3GDMA 4AIEA 1J5TA 4O28A 2H3BA 3M43A 1QHPA 4GYJA 3H24A 1Z42A 4I7UA 1W3NA 4IG2A 3N19B 1W1TA 2OZ3A 4AY7A 2QCDB 2G41A 1VYSX 4X3ZA 3CV1A 1XM3A 3NQ6A 1OT1A 3WQ6A 1JPDX 4S3CA 3A64A 3WUFA 4JL2A 3W82A 4CQ8A 4PCTA 1PAMA 2G4JA 1W6TA 2PDKA 4PUJA 3N2OA 1YTDA 5EFFA 3S9IA 2WVUA 2A7NA 1Z89A 3WX7A 5HJYA 1W37A 1XYFA 2ISDA 3VIOA 2C15A 2PZNA 3SUWA 1JD9A 1F3EA 1VZWA 3B06A 1V08A 1FCUA 3A3HA 3ME3A 3HV9A 2HE8A 4ASTA 2W79A 1HN1A 5A6SA 2DVXA 3B4UA 3OO2A 4IXHA 4AYSA 4KGLA 3DYMA 3N34A 4UOQA 2F6KA 2GQ8A 2D2HA 4WY0F 2GK1A 1PV8A 4UIOA 3H23A 1MI3A 1D8CA 3WH5A 3KOZA 1BQGA 3WF1A 4C7GA 2KZHA 1TMHA 1MXSA 5A8GA 4K68A 3LK6A 4B90A 2J66A 2QPSA 3TN5A 4EP8C 1S46A 2IPFA 3CZJA 4Q33A 1KXHA 3KX6A 2GUYA 4BQ2A 2I7GA 2WVVB 4O1DA 4MHBA 2C14A 3W7LA 3GO2A 4ZTXA 1TRIA 4IGSA 3LHVA 1VLIA 4G8TA 4GK8A 2MNRA 1LRTA 1EUAA 2G97A 3L9CA 2GGGA 5AZ1A 5CPTA 1JYNA 1LUCA 1QOPA 1DBTA 2ZUWA 4UOJA 2J6XA 4ENLA 1V3IA 4J35A 2QULA 3WD0A 3NTYA 1DKWA 2F2KA 1BWVA 3SRKA 4QAWA 2DVTA 5I77A 4JYDA 4W5UA 5EY5A 2AL2A 1KCKA 5DY3A 3GNRA 2GYIA 5C9UA 4QM1A 1YXYA 3B9EA 3GXDA 3EGJA 3WH6A 3KWXA 1MO0A 4GMEA 1X6UA 3BV4A 1I6NA 3WJSA 3IAPA 4EACA 4B91A