2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
b'ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
1O4UA 4UTWA 3N14A 2H3BA 2WNNA 4Z1DA 3R8RA 3LHYA 3L0KA 3QZEA 3CEPA 1X1ZA 2ISWA 3HGOA 4OGZA 3HO8A 5LHEA 3MYPA 1TSIA 4JXCA 2W79A 1Q6RA 1FCVA 4LC6A 1A53A 4IX0A 5KZEA 2NXHA 1SPQA 3M47A 3TFXA 3DKJA 4M19A 4WOQA 5HQEA 3T40A 3W7MA 5D38A 4TU1A 3HB9A 1YXCA 1MEIA 3LTSA 2XN2A 3NXFA 4O50A 3MI6A 5G2WA 3TU9A 1SW0A 2CFFA 1TPC1 2WKJA 4N9BA 2WOQA 2QDHA 1UUOA 3HOJA 4E2DA 4UTUA 3VE7A 3RMJA 3FKRA 3TR2A 3PS7A 2VXNA 2Q8ZA 3FIGA 1M7OA 4WQ6A 3C8FA 2JK2A 4J9JA 2WSQA 4LUIA 1J4EA 2QUUA 3QJAA 3O6DA 3W86A 2J9ZA 2TYSA 4NZFA 1LOLA 1K3UA 3M7WA 3LI0A 1DQWA 1CI1A 2DZSA 3Q2DA 5DBTA 3HMJG 1Q6QA 1JR1A 1ME7A 4FO4A 3W73A 4MPQA 4JYFA 3L5MA 1P0NA 4O1DA 3BW4A 1JCMP 3LOTA 1W3TA 3TC6A 3S1WA 2E6YA 4RXFA 4B5NA 3QQ1A 1CX9A 3HIJA 1AW1A 1F6KA 3TSMA 1NF7A 1H5YA 4MYXA 1H62A 1X6UA 3NEVA 3ANYA 5HWMA 1EUAA 4O1CA 1JCYA 1EP3A 4UR7A 3WFAA 2OT1A 3HG3A 1LBLA 3IIXA 1W1ZA 5D05A 4FNPA 5L6UA 4KWVA 4LVDA 1KBIA 2FQIA 3ZWSA 1I8JA 1L6YA 4ZL1A 2G96A 3GYEA 2RH9A 3R12A 1KFJA 3MBFA 3A5VA 2R8WA 2YX0A 3W1QA 1VGAA 1WOAA 1OFRA 2C16A 4QQ3A 2NUWA 4AXKA 4GWEA 3PBYA 3C2RA 1T8XA 1ZCOA 4JTUA 1SW3A 4JX5A 3C52A 4K7VA 1G7VA 1OJXA 4KKXA 2GQ9A 2QJGA 1OK6A 3LLDA 4LW7A 4DQWA 4AHQA 1M7PA 1W5OA 5CZTA 1L6WA 2HS8A 1QPQA 2X1RA 5EBUA 3LV5A 4RK8A 2Z2UA 3N19B 4CQAA 1TPVA 1VH7A 3UZJA 3PC0A 3M5XA 1GT8A 3WK2A 3BK0A 2ZZ1A 4MYAA 4XBSA 1Z44A 2H8XA 5AYZA 3HQ1A 3NO5A 1KM0A 3B04A 5K9DA 4UFHA 3LLFA 3L66A 2JKPA 1EEPA 3NQFA 5EY5A 3LCHA 4IXXA 3GAYA 4FB7A 1ML1A 5CKSA 1KV8A 1PE1A 1O5KA 2FB2A 2ZRVA 3DZ1A 3MP4A 3T7VA 1B4EA 1DOSA 5E0KA 1ZAHA 4WXZA 3LTYA 1TPWA 2ISVA 3CLMA 3IEBA 5AC8A 4TO8A 1GWJA 1W8SA 3MBDA 5E1QA 1I2NA 3GNNA 4GJ1A 4WUIA 3WJWA 3CT7A 3SW6A 1LZOA 3G0XA 3T4CA 4NQ1A 4AWUA 4CCEA 2ZQ0A 3LTPA 3N34A 3O15A 5C54A 5F2MA 2PRLA 4NJHA 4O54A 5F2LA 4AHOA 1EIXA 3BO9A 4ORIA 3R2GA 1ZALA 3IV3A 3EB2A 4C1KA 1PVNA 4XQ6A 1LDCA 3C6CA 2GJNA 4N4PA 2WNQA 4S2BA 2BLEA 1R2TA 3UWUA 2YYTA 3UWVA 3W7PA 4UFIA 2Z6JA 1YTKA 1LP6A 5GVJA 3QM3A 1SSGA 5DY2A 3O8AA 2Q3OA 1QFEA 3CQ0A 1K7XA 3S1VA 4O53A 3PULA 1VLWA 4UMAA 4GNJA 4KFNA 3RFAA 4NJKA 3VKJA 4OV9A 1U5JA 7TIMA 2ZZ6A 5DCEA 5LSMA 2FPVA 1ALDA 4UXDA 1M5WA 3CEUA 1LOQA 1VPXA 3V1PA 4JIQA 3GR8A 1QOQA 3TX9A 2P1FA 4Z0SA 3SY5A 2QUTA 1Q45A 4G1KA 4ZVJA 4U4MA 3L21A 3L68A 5T26A 2WJZA 4FNTA 3A5FA 1OABA 2YFOA 3GB6A 3QQ0A 4O57A 1IIGA 1WAUA 4LWWA 4UTTC 3M5ZA 5C5YA 1JUKA 1EX5A 1DORA 3LCLA 4PL1A 1VQTA 4OWGA 4Y9AA 4JGDA 5DELA 2C6QA 3UY8A 3M5VA 1D9EA 2YFNA 1OVDA 3W76A 3R13A 5I3JA 2CZEA 3W1PA 1SZFA 2VC6A 1P4CA 2B7PA 3HPZA 4JTHA 4LVFA 5LNWA 2NZLA 1W5NA 2NWSA 2TPSA 4JTFA 4DO4A 4IX2A 4Y90A 5BMWA 4HNUA 1KA9F 4JS3A 1JQXA 3PG8A 1X1OA 4UFJA 1VHCA 3KVKA 3C2FA 3NL3A 3TMQA 2WV8A 3M0ZA 2QCGA 1FDYA 3S1XA 2C1HA 1TMHA 1H61A 1YLVA 1AW2A 1P5BA 2CLKA 1EPXA 1KLZA 3IIZA 4U28A 4JTEA 4WZHA 2ABAA 3TSBA 4QSHA 3PR2A 4Z1BA 1IXPA 3QPYA 3RF9A 5K3VA 2X30A 4JTJA 3I7RA 3W2JA 4MZ1A 3PBVA 4NX5A 4PC8A 2H3DA 4O10A 5AN7A 1DJQA 4JIPA 1OFEA 2ZRYA 2Z0IA 3C2EA 1XC4A 3PAJA 4WXYA 4LTSA 1QNVA 4P2VA 2BX7A 3DFTA 4LY8A 3STEA 2DJLA 3O6CA 4DF0A 5CGQA 5CG7A 4LS2A 2VFGA 1JJKA 4OBTA 1W5PA 3TCEA 1VS1A 3DI1A 4QISA 4WOZA 4LNYA 1B4KA 3SJ3A 4LOCA 4XUGA 3TXVA 2Y62A 3D0CA 1D3HA 3U2OA 1EWEA 5CZSA 3N9SA 4MVAA 3W2KA 3DH7A 1GG0A 4MZYA 1A5CA 3O05A 3DFNA 4LVBA 1LOSA 1OFOA 1TO3A 5CPLA 1YTDA 1TRDA 2F7FA 1A50A 5CPMA 4XTDA 1LRTA 2A2IA 3USBA 3UPBA 3EX6A 4JY8A 5E93A 4IUOA 5U7SA 3CWOX 3FA5A 5EYWA 5FEZA 3LDVA 3S5NA 5LGXA 5AYXA 3S0CA 5F4SA 5HULA 2BSLA 1H7OA 1P1XA 3B0VC 4ICNA 3DENA 1Z42A 1VHNA 2EHHA 3N73A 3EX1A 4HPJA 3AO0A 1KM3A 4RZ6A 1IGSA 4NT0A 3W23A 4NNAA 1TQXA 5SWUA 3IGUA 1DHPA 3W7NA 3O6YX 3W7KA 2QAFA 3CHVA 4UTWC 2DZWA 3UWZA 4N6EA 3DFOA 3P5YA 4CNPA 2A6NA 1FWRA 1TTIA 1PL9A 3EKLA 2GPTA 3L9CA 2Y63A 1FBAA 1AG1O 1AL8A 3TUUA 2FDSA 3TXZA 2CW6A 3C0JA 3GLCA 3RNDA 3ABQA 4AAJA 4RKAA 1ADOA 1K8YA 3IIVA 1XBYA 4LU0A 4JDYA 6TIMA 2QJHA 2WNZA 1SUXA 1RR2A 5D33A 6ALDA 4EVZA 4IPIA 3UNDA 3W2MA 3S5YA 1A5BA 2NWRA 2G95A 3ELFA 2VFHA 4OT7A 4LS0A 1ME9A 4IJBA 3FYOA 1XM3A 1FUYA 1I2OA 2ZFAA 4ZQNA 3CC1A 4M7TA 4AVFA 3MI3A 3GXPA 3CIXA 3NPVA 1TB3A 4ZQCA 2CZFA 2YW3A 1Z41A 3CB8A 1A5SA 4MOZA 2NX9A 4BWLA 2PRHA 4NVTA 1XDLA 3QFEA 1Q6LA 1ZJIA 2A7RA 3W7JA 1GYNA 2VELA 5AB3A 2A0NA 5C2XA 3W2UA 1KM1A 4HNNA 2GQ8A 3W72A 3NPWA 2ZZ2A 5F4WA 4PODA 3OVQA 1L9WA 4IMDA 5LZLA 3IIOA 3YPIA 4I7VA 2P0OA 2BWGA 3THAA 3NYZA 4O16A 1F74A 2ZYFA 3TDFA 3B8DA 1PV8A 2QCCA 4O17A 5LNSA 3GNDA 4QITA 1KBJA 3EWUA 5DCDA 3PF3A 4Q4KA 2CLLA 2Y6ZA 4MLRA 2RDUA 4FNSA 2Y7EA 2HMCA 4DF1A 1SO4A 1JCXA 1F2JA 4MIMA 4AHPA 1GG1A 1OX5A 2RKXA 3JR2A 3NQMA 3P5ZA 3ATYA 1VRDA 3W85A 3G1FA 4HNTA 2JKEA 1Y0EA 2FFCA 5HR6A 1N7KA 1B9BA 4Z1CA 1RV8A 2GVLA 3SGUA 1A5AA 4NXSA 5FI8A 4HT3A 3W7EA 3B0UX 3PWAA 1ZNNA 1YXDA 3CWNA 1N8FA 1GVRA 4N9DA 1L2UA 1H50A 3P60A 4NNCA 4JN6A 3F03K 2V8ZA 2QUVA 1KM5A 5D2YA 3FS2A 3QF0A 2DZXA 4FXSA 5D32A 2E6FA 4O0KA 3NZ1A 5KINA 4NJIA 1WBHA 3QMTA 5FEPA 3HBLA 3VFLA 5FF7A 5G4WA 5LHFA 2GUUA 3ZWTA 2QCFA 1W37A 1WV2A 2VFIA 1W0MA 2B4GA 3W1LA 1CW2A 5CPOA 2ABBA 3NQEA 3C56A 2AQWA 5EPDA 3Q94A 2DZPA 3W7CA 4AWTA 1KTNA 4AWSA 3EX4A 5IBXA 1RQEA 3DBPA 2X2GA 2EKCA 3C61A 5D2WA 2V9DA 1H1ZA 4IMGA 1F5ZA 4I7WA 5BOOA 1XUUA 2A7PA 3L5LA 1MZHA 3E02A 3P82A 5FEWA 1KFEA 3PUEA 3HG4A 5HINA 2E6DA 4LVAA 1K03A 2J6XA 4E0CA 3WJSA 4TMCA 3HG5A 5EA9A 1VCFA 3NR0A 3I6RA 3W88A 2V2CA 4MLJA 3PY2A 3E0IA 1KTBA 3EXSA 4UMCA 2E09A 1ONRA 4JYDA 2VEKA 3B03A 2I9EA 2OT0A 1I2PA 3L5AA 2Y7GA 4O28A 4N6FA 2FIQA 1FDJA 1FCBA 3KOFA 1G6CA 3U6WA 3CTLA 2CLFA 2GOUA 1GQNA 3ZS4A 2OMAA 3U8GA 3QEZA 4GRSA 1DBTA 1KTCA 5TIMA 5D37A 3VNDA 3TC7A 2YZRA 3ZFHA 3MHUA 3ATZA 1VYPX 3N9RA 5DY3A 4PEKA 4R53A 5FF2A 5DLCA 3FEMA 3LX9A 1GTHA 2CLOA 4HPXA 4UC5A 5I3KA 1GVSA 1UASA 3OIXA 4CLMA 4UFLA 4IWWA 2E5CA 3E9AA 1MEHA 1NFBA 4NU7A 4X9SA 1SZGA 2X1UA 4S1FA 2Q8LA 3OHIA 3W6YA 3PSVA 4A2SA 2ZRWA 4NJGA 4R34A 1PHWA 5D2TA 1ICQA 3LBMA 4LUJA 4UTLA 2RFGA 1W3IA 4IMEA 1SZEA 2AGKA 4HSNA 4LT9A 3WK1A 5D04C 4KFPA 5G1TA 3W87A 3LBCA 4UTKA 4FX6M 1VZWA 3GKAA 1KW1A 3PB0A 3M44A 3UQNA 3LRKA 3VI2A 1XL9A 2CLEA 3TAOA 3GR7A 5HUPA 2E6AA 3NG3A 3QSRA 4HHPA 3T44A 2V82A 1AK5A 1BWKA 3OEXA 3KVLA 3LI1A 1I2RA 1H51A 2I1OA 1UCWA 2PCQA 4ALDA 2E77A 2BXVA 3GAKA 3S9YA 1LRQA 4TMBA 4OQVA 2F84A 2Y85A 4HN4A 4AEOA 1FWNA 4Z08A 1JQVA 1TV8A 1SSDA 3I7SA 4K38A 3NOEA 4JTLA 3DGRA 4L4LA 1R47A 2NLIA 3F4WA 3P74A 1SZNA 4XKYA 4CNNA 1I4NA 3L67A 3NPUA 1NAL1 3HGSA 3IVUA 4M5PA 3FLUA 4EIVA 4UTMA 4JICA 1LBMA 1YXYA 3DHFA 4WD0A 5KZMA 3IGSA 4UUIA 2ATSA 3W75A 5F1UA 4UFMA 1U83A 4LV4A 5KTLA 3EWZA 3G18A 5CSSA 5BMXA 1XXXA 4ORMA 3W7LA 4N02A 4YCOA 1H1YA 1WQ5A 3HPSA 2WSYA 1TJPA 1G4SA 1WBJA 3WJXA 3RLVA 1W3NA 3W07A 1IF2A 4A3UA 1OFPA 3C4UA 2H6RA 2YYUA 3G1DA 2IQTA 3SI9A 1HO1A 1FWTA 1OX6A 3M41A 1W56A 1F7BA 2QCHA 1IXNA 2VFFA 3HGJA 4ADUA 3GX9A 2A1YA 4M6QA 4CNOA 1T0OA 3NQ2A 2JGQA 1PHQA 3L65A 3LHUA 3PUDA 1C29A 3LHZA 3NQ7A 1KFCA 4LC8A 2DZTA 1F6PA 4LRSA 4JYEA 2O7QA 3MP5A 2QAPA 3BGJA 3QRHA 5LKYA 4QM1A 2VOMA 2CU0A 5FF4A 1GJPA 1OX4B 2RDTA 4BF9A 1KFBA 3S5ZA 1B3OA 4RZ5A 3PVFA 1E51A 1G7UA 1TTJA 2QR6A 4DO5A 2Y88A 1H7RA 1G4PA 2HTMA 1BEUA 3GDRA 3CPRA 4HNVA 1NVMA 5AHNA 1FWWA 1WOBA 2OX1A 4O4WA 5G5IA 1UJPA 5H91A 3S42A 3G0SA 1FQ0A 1IIHA 5AHIA 3Q37A 2RHGA 1F76A 3T55A 1EWDA 3TA6A 1WX0A 3EWXA 2A5HA 2EAWA 1S5WA 2UV8G 1HUVA 2E5BA 3RK8A 3WK3A 2QCDB 3W22A 1ZAIA 5I3FA 3ABSA 1NSJA 3ABOA 5AHFA 4YXGA 1R46A 3IVTA 4FF7A 4BI7A 5H2ZA 2CLHA 5K9CA 2OCZA 1EB3A 1ZAJA 4Z1AA 4PH6A 5MHBA 2ZDRA 3L0NA 3W71A 1V5XA 1TJRA 2TRSA 3LCIA 4XKYB 1SFJA 1LLWA 4GUIA 3PBUA 1VCGA 2PRMA 1HTIA 3BLFA 3FFSA 1KM6A 4CQ8A 1TV5A 1TREA 3SR7A 4EF9A 4O19A 3TROA 3WJZA 3W1XA 3RLUA 3MHGA 1R2SA 3JS3A 4UIOA 4UCGA 1K7EA 2ALDA 4YL2A 1GZGA 4DXVA 3P61A 4M6PA 4DPQA 3A23A 4CCDA 3S1UA 1G4TA 3FYPA 3INPA 3NQVA 1FCQA 5G2HA 3P80A 3GDMA 1LYXA 4QNEA 2Z1BA 3NZRA 4A29A 5U4NA 3EKZA 3W3OA 1BTMA 2A85A 1RQBA 3NM1A 3E96A 5BW6A 4M7SA 4Y8FA 2ZZ4A 4ZZ9A 3P81A 4JTKA 1AL7A 2NX3A 3BPWA 1OYAA 2RDWA 3F4NA 3TSDA 3FOKA 3DFPA 1L6SA 5AFDA 3NPXA 1VLIA 5CZ0A 4LV9A 3NQGA 3GXNA 2V2HA 3TW7A 2FB3A 3OVPA 3W7OA 3GDLA 1S3HA 2ZA3A 3LXCA 3DAQA 3NAVA 4R33A 1G67A 3QW3A 4JTTA 4IMCA 3SZ8A 3UWWA 1FWSA 2V2DA 1QAPA 2YGYA 1JRBA 1H7XA 1RZMA 2ZA1A 3P8IA 5AOUA 4BWLC 1UBSA 3KHJA 5BRBA 1VR6A 3HPXA 3STCA 3M9YA 1O60A 4L4MA 4GUFA 3TJXA 4DBEA 4H3DA 2JGYA 4X22A 3W1NA 2TSYA 3TQ0A 5L9FA 1QOPA 2NUYA 1J5TA 4O4VA 3G22A 4M6VA 5FEXA 4UTJA 3HGRA 3L0GA 4UMBA 1R30A 4FXRA 4DPPA 3PSWA 2TMDA 3N2XA 3R89A 4H6KA 1OHLA 5DN1A 2V5BA 3A21A 4UTIA 1JULA 5HR7A 5AHEA 2DP3A 2A21A 3MJYA 3MO7A 3KAOA 3NM3A 3W83A 3TQVA 3LXAA 4H4IA 3PG9A 3LERA 3BVJA 4TX9A 3O63A 2FPYA 3NDOA 1ZENA 1S5TA 3VCRA 2FJKA 1EP2A 1K7FA 1C8VA 4NNBA 4EOUA 4JX4A 3QH2A 2LLEA 1FXPA 4BK9A 1TPB1 2HS6A 3JRKA 4RR4A 4QAIA 3EXTA 2C14A 3DXIA 4UTHA 5HNRA 3DFSA 3NA8A 3A9IA 4O15A 2CWNA 1O95A 3G3DA 1ME8A 2KZHA 3NGJA 2BZNA 5CPNA 1XCFA 4P61A 2PC4A 3G1SA 3EEGA 3S5OA 3W9ZA 1K02A 2YSWA 4GUJA 2CLIA 3KRUA 3W7HA 2C18A 3OG3A 1LTDA 1VYRA 1IXOA 4K7YA 2ZTJA 1FXQA 4LS1A 3LM7A 1VYSX 4CCCA 3B4UA 3O16A 5KZDA 1Z48A 3IGXA 4AF0B 4RXGA 4ZQOA 4GUHA 3SIZA 4CQ9A 5IBXC 3SGZA 2JKAA 1THFD 2W6RA 1WDWA 1ZY9A 2QKFA 3DU0A 3G1YA 4EWND 1KV5A 1W54A 4NXKA 1VCVA 2OZ0A 2BTMA 4ZMGA 2NUXA 2YW4A 2G5WA 1QO5A 1OF8A 4O1AA 3T78A 1MEWA 1JCLA 3NQAA 4JEQA 1EP1A 3W7RA 4A21A 3BG9A 1X7FA 3H53A 3UZ5A 3P7YA 3DFQA 5EMUA 2EF9A 4WY0B 1W31A 1W5QA 1SQ7A 1OFAA 3I68A 4BI5A 1TV7A 1T99A 4O14A 2ISSA 1G4EA 4YWIA 1GOXA 4KWWA 3V75A 3CM4A 3TMLA 2B7QA 1NF0A 3TJLA 5DBUA 1JVNA 1R2RA 3UXDA 2YXGA 2NV1A 4I9AA 2H8ZA 1DKWA 4Z0JA 2Y7DA 5AYYA 4K6AA 2X16A 1KLYA 1MSSA 1WYIA 3SFKA 3TFCA 4IOTA 3BG5A 1XBZA 3L2IA 2VENA 3PM6A 2J24A 2DJXA 2XN1A 3I65A 5F4XA 4XTIA 3UWYA 2VFDA 1JUEA 4RZ4A 1TPDA 1EUNA 3NQCA 3UPWA 1QDSA 4JX6A 4ADSA 2GQAA 2J9XA 1DVJA 3MP3A 1BWLA 3GIYA 3B0PA 1DL3A 5K4XA 1MXSA 1G69A 4GFSA 2C0AA 3GDTA 4MY9A 5D03A 3QW4B 5DXYA 3OVRA 3S8HA 2YDAA 1M6JA 5KITA 4FNQA 1LROA 4WJEA 3UY7A 1QCWA 4NZJA 2Y61A 4K36A 2B7NA 2J27A 1TQJA 2PURA 1OFBA 3G8RA 1VC4A 4K8HA 4X2RA 1TTQA 3KRSA 1JCNA 3FJLA 3P84A 1VJIA 5FESA 1RVGA 5KMYA 2VEIA 3R5EA 1YDNA 3NQDA 4ZQPA 3QMRA 3W2LA 2X1TA 3M6YA 1YTEA 2QJIA 3P67A 4UNLA 1AW5A 4E2BA 1DQXA 4QIUA 4MJZA 3BG3A 1RPXA 2B7OA 3EXRA 5HWJA 1TPEA 3W1UA 1XBXA 1LRNA 3G24A 4OU1A 1P0KA 4YLWA 3QYQA 2DZUA 1ZFJA 1LLZA 3W1TA 1XI3A 5DCBA 4QJ1A 5AC7A 3TQKA 2NXGA 4O18A 4NJJA 1FX6A 3GDKA 1XDMA 3TNOA 1GEQA 2E5DA 2GVGA 1LM1A 3MI2A 4JNMA 3TK7A 5F2GA 2VEPA 1C9DA 1MO0A 3M1ZA 4Q32A 3W74A 1SFLA 3TE9A 4K8EA 1F73A 1OX4A 3QSTA 4PA8A 1YDVA 3W7IA 4A22A 4PFMA 1JCJA 4PTNA 3IIPA 2ZTKA 3TAKA 5D02A 5K4ZA 4RCXA 3LCWA 1H7PA 4GUGA 1JRCA 4O8RA 3QC3A 2Z6IA 4AB4A 1OFQA 2ZRUA 2HSAA 3KX6A 3B06A 2AAMA 1TPFA 2WSRA 5D09A 2CLMA 3MWAA 2E1DA 4ADTA 4TR9A 5AC6A 1XFBA 4RJEA 3KXQA 1TPUA 2ZCGA 3SECA 5K7JA 2QCDA 1PIIA 3M16A 5HJLA 5FF0A 4MY8A 3GK0A 3NL6A 4BI6A 5IM51 3TIMA 1QO2A 3LB0A 5TQLA 3NL2A 8TIMA 4GXMA 3LCXA 1FCUA 2XFWA 5G4EA 1HG3A 1QPNA 4Y6GA 4PL2A 4UNKA 3A22A 1SO5A 3NL5A 3LXBA 1SR9A 2J88A 2C19A 2QDGA 2H90A 3HG2A 2A7NA 4FX8A 4IQLA 5TBOA 1LCOA 2ZRXA 3P62A 4KFOA 1H63A 1OFDA 3W2NA 1X8FA 3FKKA 3MHFA 3I7QA 3C2VA 2A6LA 4FIRA 4O0ZA 4TIMA 3OA3A 5D30A 3S6DA 4EF8A 5FF3A 5CSRA 1HFBA 5K2ZA 4BFAA 4ML9A 2YPIA 3AJXA 1H7NA 3KRZA 3H54A 1XUZA 2VEMA 2VKZG 4X3ZA 1OK4A 1H60A 3G1HA 4N2YA 2QCMA 3C2OA 3QPZA 3KVJA 3FJ6A 4HSOA 4RV8A 4HIBA 4Q33A 1RQHA 3STFA 4LRTA 2P10A 4PCFA 4ZQRA 4O12A 1T96A 4GC4A 2ZA2A 3TV8A 3NNTA 1QPOA 1ICSA 3GZ3A 3UXAA 3M43A 5I3GA 3PUOA 2DZVA 4JTGA 4JTSA 1SO6A 2EGZA 5A5WA 1TCDA 4D2JA 1F05A 1NEYA 2C15A 2ZZ7A 2V81A 1IXQA 2ZZ3A 3A24A 4FX7A 4N4QA 3LV6A 1GTEA 3W7GA 2QEZA 5LNVA 4FHAA 2E68A 1SU5A 4ZQMA 2NV2A 3H55A 1GPWA 3EWYA 3G3MA 4HKPA 3LHTA 4POCA 3UD6A 5A8GA 2QCEA 3NQ6A 1PCWA 4WX2A 3LRMA 3EX3A 3WJYA 2FLIA 4JDBA 3MMTA 2V30A 3PBWA 1S5VA 4GBUA 1KM2A 3O06A 1WA3A 2D73A 4FEZA 4DEFA 1GVFA 2ATMA 3BW3A 5G2IA 4QNWA 1WXJA 4IPJA 4OHQA 1OYCA 3VE9A 4XWUA 4IMFA 1LORA 1W5MA 1QPRA 4C1LA 2XN0A 1TYGA 1AMKA 4NUWA 1V7YA 4UR8A 3CIWA 4RX0A 4YCPA 1J2WA 3ABRA 3EX2A 2V0TA 1K8XA 3LRLA 4E38A 2W0UA 3EWBX 2R14A 4JTIA 2PE4A 5AHMA 3Q58A 3O07A 4I7UA 1GVOA 3THQA 2ZZ5A 2EPHA 1XBVA 2CZDA 2R91A 2R94A 4N9EA 5LNRA 2QCLA 5EL1A 4DF2A 2NX1A 5ABTA 4W9TA 1EA0A 1FY6A 5DXXA 4DELA 4UTTA 2WPBA 2WQPA 3MYOA 5LNUA 1OF6A 3TH6A 4NX0A 1FDZA 3HF3A 1ZHAA 1I45A 1YYAA 3C3NA 3G1AA 4MJMA 4IXHA 5BNKA 1B57A 3N3MA 1DV7A 3BW2A 3EWWA 2O7SA 5LGZA 3UWQA 1K8ZA 2YR1A 4AH7A 5J5DA 1LBFA 3GKFA 2Y70A 5HMSA 1TTPA 3MUXA 4BR1A 3RU6A 1SW7A 3DKLA 3P8JA 5J5RA 3W1RA 3CU2A 3LGEA 1TIMA 2B0MA 2X1SA 5AHLA 4A2RA 5KSWA 2Q3RA 4JY9A 4O11A 4AF0A 3E12A 3BV4A 4GE8A 5HWNA 2J9YA 4MZ8A 4MUZA 3G1VA 3PB2A 3GXTA 3DHDA 3SSJA 1HO4A 4O13A 3G1XA 3M5YA 3MW7A 2C3ZA 4S2CA 3TKFA 4K39A 4IGHA 4MY1A 4OE7A 5C6MA 4ONVA 2QCNA 1GVQA 1Q3NA 3LCGA 3W1MA 3WK0A 1QR7A 1BKSA 1KM4A 4WY0A 1I2QA 2Y7FA 2I14A 2OJPA 4Y96A 3KVMA 1QMLA 2NXIA 3ZR4A 1YPIA 5K9XA 4K37A 3BLEA 3BGGA 3LHVA 2CZ5A 1OG0A 1O94A 1KFLA 3NQ8A 4WY0F 1SO3A 4JD4A 3LHWA 2VFEA 3G8EA 4LVGA 5EKYA 3N2MA 3E49A 3GVGA 3DI0A 1KFKA 1YDOA 3W84A 1RD5A 1H7WA 4AMAA 5F2IA 1GYLA 2GJLA 4R7JA 1DJNA 3TW6A 4FIQA 1XKYA 4YMZA 1TRIA 2YCEA 3F1QA 5F1VA 2DORA 2ZRZA 1ICPA 3KFTA 4O52A 2QF7A 2FPTA 3HJZA 1JUBA 3W7QA 2DU2A 2Y89A 5CZJA 5I3HA 1OYBA 1D3GA 3O1NA 3UYCA 4FNUA 2ZBTA 1YADA 5HUOA 1N55A 2G97A 2C13A 3BARA 1YPFA 4MFDA 2FTPA 5C55A 4MFEA 3LCFA 4UFKA 4RLIA 4DBDA 3W7DA 1PS9A 5G1YA 3STGA 4MKNA 3W70A 4N9CA 1TPH1 2WO5A 4DO6A 3K30A 1HL2A 3IRDA 3W1AA 3QMSA 1PCKA 1Q6OA 2GVJA 3B05A 4JR5A 3IVSA 5I3IA 4O1BA 2JBMA 1UB3A 1UUMA 2V5LA 4XZ9A 1O5XA 3G0UA 4XBKA 3OBKA 5D2VA 4OV4A 3NVTA 5D2XA 1QWGA 2A4AA 3BLIA 4FNRA
chains in the Genus database with same CATH superfamily
3N14A 2WNNA 4Z1DA 3L0KA 3QZEA 7CGTA 5A8OA 1ZLPA 2EJAA 3EB4A 1TSIA 1EJSC 2W79A 1Q6RA 3E3HA 1A53A 2XH4A 4M19A 1TMLA 6PTDA 3T40A 4L9YA 3ITYA 1HKVA 3HB9A 4X60A 4M24A 1MEIA 3QGAC 1E40A 2NV9A 2OTDA 4QG8A 1FKXA 1QK0A 1G1YA 3MI6A 4D6EA 3TYEA 2ISFA 1UD3A 2CFFA 2WOQA 5DF0A 2QDHA 1UUOA 3VE7A 4H9MA 3RMJA 2WSKA 4HMNA 4WQ6A 1B0IA 3GU9A 3XISA 4LUIA 1XSIA 4B3ZA 3O6DA 3W86A 2J9ZA 4Q8UA 3ZVIA 2V5CA 1K3UA 2QXWA 1DQWA 1W2PA 2HRWA 5DBTA 2YCJA 3PWIA 4S38A 4HTBA 4MPQA 1PDZA 4JYFA 2OLHA 4QX4A 1JCMP 1OIFA 3TTEA 4U3AA 3QQ1A 3OU8A 5A3HA 3UBPC 3LSCA 4M8UA 1E0UA 1NF7A 2VC7A 1H62A 2OQLA 3NEVA 3SY1A 2PP0A 1EUAA 1IT7A 4C6OA 1M7JA 4MNKA 3RMEA 2PS2A 1TZ9A 1N82A 3LNMA 1ZQ5A 3WFAA 3F5JA 1MW2A 4WGHA 1KBIA 3CH9A 3ZWSA 1VFHA 1L6YA 1HJUA 2Z28A 4ZL1A 4NAEA 3FAWA 1JPIA 2EG8A 1XLJA 2CZVA 3BLPX 4UOQA 1KFJA 5HOSA 3OGRA 2P3ZA 1ITCA 5CSYA 1XG4A 3R58A 5D9PA 3HPAA 4C6QA 4GWEA 2OO6A 1T8XA 1ZCOA 2ZXBA 4HP5A 2YL5A 4B92A 4JX5A 1X38A 3VDGA 2V5KA 1NDVA 1OJXA 1GOWA 2GQ9A 2E7FA 1DWFM 5I2UA 4OBRA 4DQWA 4JL2A 3PJUA 1WXYA 3N17A 1L6WA 4IUGA 3KZSA 3MZ2A 2X1RA 2HWGA 2ZC1A 4AD0A 2FVLA 2QZRA 3N19B 3UZJA 3LG3A 3UG3A 2D69A 3QHMA 5JQ9A 1HW6A 1J96A 1CWYA 4MYAA 4FAMA 1A0DA 1WZKA 1G9HA 5IFTA 4HCHA 2IS7A 1A5UA 1Q4NX 3B04A 3H4XA 4FR1A 3LLFA 3MUZ1 3L66A 3NQFA 4QJ4B 5IHRA 3GAYA 3VDHA 1EJXC 1Q65A 2FB2A 2ZRVA 1DOSA 4MWAB 4WXZA 1XINA 3IEBA 3CO4A 1KC7A 3WQPA 4TO8A 3CMJA 5A95A 4PMXA 5ABEA 1W8SA 2NW0A 2YB1A 4U3CA 3EDEA 1I2NA 3D3FA 3WJWA 3H2FA 3G0XA 1Y5WA 3T4CA 3N6QA 4AWUA 3LTPA 3N34A 5F2LA 2H9AB 4AY8A 1L8PA 3VFCA 3CB3A 1B30A 3WIJA 2UY2A 4C1KA 4XQ6A 2C79A 4CKQA 1I1WA 4ZENA 3UWUA 2UY5A 1E5JA 3AROA 4FI4A 1GQKA 1NDYA 4W89A 5DY2A 4X9YA 3O8AA 2Q3OA 3E5PA 1K7XA 3S1VA 4A4AA 2G41A 3CZLA 4O53A 3UERA 1VLWA 1W1VA 4BQ3A 3GM8A 1IT8A 4KFNA 3RFAA 2E67A 4OV9A 3QQWA 4M3PA 4H19A 3OLIA 3PTMA 3CEUA 4DJFA 1YNYA 2R24A 1EO5A 3JZEA 2NT1A 3GR8A 1PPIA 3CAWA 4IG2B 3MUAA 2PWFA 4M0XA 1JZ5A 1Q45A 2MANA 3GDBA 4C6MA 3AYRA 3PHAA 3L68A 5T26A 2WJZA 5PTDA 4NKCA 1EGVA 2ZX9A 3TWBA 3WLLA 3BSMA 3M5ZA 5C5YA 1JUKA 1NARA 4DY1A 2G8ZA 4DUVA 1DORA 1MRAA 5D8ZA 4JGDA 3FXYA 4Y9OA 2YFNA 3B0YA 3T0AA 3R13A 1X6NA 1SZFA 1P4CA 2J25A 4JTHA 2NZLA 3WSUA 1OD8A 5KETA 1E1CB 4S3JA 4I9TA 1E4NA 3APGA 3SO7A 1AMYA 2W92A 4HNUA 1UH2A 3TR9A 1VHCA 4GCXA 3FVMA 2AL1A 4KEVA 1MW1A 2F6KA 1H61A 1YLVA 2CLKA 1EPXA 1KLZA 4KWUA 4V15A 4U28A 4JTEA 4J3SA 4W5ZA 3OP2A 1UBPC 2BDQA 3HMCA 4Q8PA 3RF9A 5K3VA 1V03A 2X30A 3MWCA 4JTJA 2PLMA 3PPHA 4E3VA 3W2JA 1E6XM 4AX7A 3PBVA 2H3DA 1IHIA 1HL9A 3GXFA 1DJQA 2VC9A 1Z8AA 3RIKA 1OFEA 4M1BA 2ZRYA 1XC4A 3AU6A 2AQVA 3PZIA 3LU2A 3OLEA 2J7CA 4LY8A 3GTFA 3STEA 3USZA 4DF0A 5CGQA 4GQQA 1VFFA 3HFTA 2PTWA 3N2CA 1XYLA 3DI1A 1R3VA 2Z00A 1U22A 4KEUA 4D6FA 4IPLA 4LOCA 3D0CA 3PTDA 3IJIA 4PUEA 2YIHA 5CZSA 1JNDA 1V8EA 2Z1VA 5CLWA 3PP7A 1P6CA 1A5CA 3F5KA 2DSWA 3VPLA 5CPLA 1TRDA 1A50A 3GD6A 5CPMA 2DVTA 2CWXA 4C6LA 3UPBA 2PBOA 4JY8A 4IUOA 5MKGA 3CWOX 1WXZA 3RR1A 5FEZA 4A3HA 3O0FA 4J5NA 5AYXA 1FFRA 4B5TA 1MUCA 1GYMA 1V6TA 1QNOA 4ICNA 3C3UA 1D3CA 1Z42A 3O6AA 1XYAA 2WMKA 4AIUA 2BBFA 4M81A 3EX1A 4A35A 2VD9A 5I7GA 3CL8A 4A8RA 3W7NA 1HKIA 3W7KA 4C7DA 4I6VA 4UTWC 4DZHA 3CZKA 2DZWA 2FGLA 2OGYA 4JFWA 3H7UA 4CNPA 1FWRA 3GC2A 5CH9A 4JQ4A 5I79A 3SY8A 1U30A 2Y63A 1AL8A 4CN4A 2CW6A 4D6CA 3BAXA 4UCFA 4GBDA 2V38A 3VINA 1M53A 1YEYA 3IIVA 2IKGA 4LU0A 4QE5A 1EJTC 2QJHA 6ALDA 4EVZA 2AQOA 3UNDA 5CEWA 3S5YA 3CPUA 2F8QA 4D9PA 2IW0A 4OVXA 3H6OA 3ELFA 1EZWA 3KDOA 4DXKA 2C0HA 4LS0A 4IJBA 3FYOA 1XM3A 1I2OA 2ZFAA 3CC1A 3RO6A 3E2QA 4DWDA 3IANA 3GXPA 3CIXA 5GNYA 3NPVA 2WPGA 4XK2A 2BVTA 1QNRA 2G3IA 4MOZA 2HNEA 2VZSA 4J2MA 4PMOA 3VMOA 1K77A 4B91A 1NFPA 4W88A 1VKFA 2A7RA 1GYNA 3SRDA 2A0NA 3WF4A 1W2VA 3W2UA 2GQ8A 2PP1A 5BXTA 2ZZ2A 6CGTA 5F4WA 4C65A 1A0CA 4PODA 4IMDA 1ONEA 3YPIA 2PLCA 1DXEA 3CZ8A 2BWGA 5IRPA 3NYZA 2ZYFA 3B8DA 1PV8A 3VD9A 2QUMA 4O0QA 3GH4A 4QITA 5REQB 4GIEA 1YHTA 3EWUA 3UZYA 1OCJA 2CLLA 3L4ZA 3UF9A 4DF1A 1Z6KA 1F2JA 4MIMA 4AHPA 3BLOA 4B4FA 2VZVA 3JR2A 4PMYA 3R0UA 2JQXA 1RALA 1UKPA 2C1GA 3OG2A 4BA0A 2PPGA 3G1FA 3BSGA 1JIBA 1BYBA 3R0KA 4H7VA 4MJ4A 4NAFB 3SGUA 5KEZA 2VR4A 4F0RA 3H7RA 2E9MA 4QRNA 1MQPA 3CWNA 1N8FA 4CCZA 2O55A 5CJMA 1H50A 3P60A 4NNCA 1C93A 3MQTA 1HKWA 3GNOA 4JN6A 1OBAA 1KM5A 3FVDA 3FS2A 1B3VA 4UQ9A 3MS8A 4FXSA 1MVYA 4W5UA 2QIIA 1X1NA 1UUQA 4AC7C 1WBHA 1OEPA 3QMTA 4Q8MA 2Z2AA 5FF7A 3OOQA 5LHFA 2VEGA 1JDAA 1D8CA 3GNRA 1TE1A 3W1LA 1NM9A 5M1TA 2R1NA 3OGVA 2AQWA 1BWVA 3Q94A 4AWSA 2WHKA 2G3NA 1RQEA 4EANA 4GX9A 4EACA 3P93A 1KFEA 2CBIA 3PUEA 3HG4A 5HINA 4LVAA 2J6XA 4JKKA 4MM1A 5IXEA 1TV4A 1R3RA 2WW5A 4NHVA 3WLKX 4JTDA 1TX0A 3NQBA 1O1ZA 3W88A 4TVUA 4QG9A 2HE8A 4AD4A 1VJSA 3FY1A 3H2CA 4PTDA 3EXSA 3OYZA 1ZU8A 4XISA 4Y9MA 2CHOA 2FFIA 2TAAA 1GOOA 3NSMA 5C9WA 2PLKA 2ZUUA 1G6CA 2CLFA 1VFTA 1TVNA 2GOUA 1GQNA 2OMAA 3CH0A 2KAUC 3VNDA 3TC7A 3ZFHA 1PUDA 1E1FA 4PEKA 4R53A 1PDYA 5DLCA 3A4AA 4LYPA 3FEMA 1BVWA 1CLKA 3LX9A 1GTHA 4JFUA 5C7HA 2CLOA 4HU4A 5I3KA 1UASA 3MU7A 3N11A 3URNA 4MTVA 2E5CA 3E9AA 4X9SA 1VEPA 2YCKX 3TTYA 4G7EB 2X1UA 3BCDA 2J77A 4AEFA 3HJEA 3W6YA 3PSVA 4YS1A 1NIUA 3TLQA 1PHWA 1K9TA 3ZLHA 1CT5A 3T09A 4AD1A 1W3IA 1FOBA 1SZEA 4CVWA 2BOFX 3W82A 1ISVA 4IFKA 1LQ2A 5D04C 1QU4A 5H6HA 1QI0A 1JZ4A 4FX6M 4MGGA 3PB0A 1CBGA 4ATLA 3FSTA 4ROPA 1XL9A 3GXDA 4GLEA 4E4FA 4S3GA 4B16A 3OEXA 3WQFA 2HZGA 3TYCA 1S39A 2Y85A 4AEOA 1XPGA 1JQVA 1XF0A 1TV8A 1YIXA 3I7SA 4IJCA 3QN3A 4JTLA 2BHYA 3DGRA 1U5VA 2ICSA 1SZNA 4JEJA 4CNNA 5HJYA 3HGSA 1RY0A 1ENUA 3SSZA 3TN4A 3KL5A 3RX2A 3DHFA 1UD4A 5BU9A 2NVDA 4TV5A 5F1UA 3RCMA 1U83A 2R82A 4GYJA 2GSEA 3ITOA 5CSSA 2PDMA 3A3HA 1BRLB 4ORMA 1VFUA 4N02A 1RJQA 1WQ5A 4JIIX 3VD3A 3HPSA 2WSYA 1XRVA 3RLVA 1W3NA 1K4HA 4A3UA 2YDRA 1OFPA 3VNIA 1ZRQA 3L4UA 2YYUA 3G1DA 2IQTA 3VABA 3U4FA 4ADUA 2ODOA 3GX9A 1UMYA 3DN5A 2A1YA 3DFYA 1T0OA 4X2PA 4ERGA 5EMMA 3L7RA 3IAPA 1C29A 3LHZA 3QBUA 1KFCA 3GH7A 4WSHA 3VKDA 1V0LA 1F6PA 2XDFA 1TVPA 3UETA 2O7QA 3QRHA 3L4YA 4BQ2A 5FF4A 3TN6A 3BCFA 2RDTA 1B3OA 4RZ5A 3VIKA 2DT2A 1TTJA 2HXTA 4D6IA 1G4PA 5LA1A 1JF5A 3GDRA 3H26A 1XFCA 2OX1A 5H91A 4F2BA 1FQ0A 1IIHA 3O7UA 2R9RA 1HIZA 2RHGA 5A94A 3VZZA 4PCTA 4J35A 1EWDA 3TA6A 3KBSA 3AWOA 3VOGA 3N4FA 2VCBA 2JIEA 3KOWA 3ARZA 2BB0A 1OZMA 1R0MA 1NSJA 2WZMA 3ABOA 3C5QA 1R46A 4KMQA 4FF7A 4AUBA 4BI7A 2QDEA 2PWEA 3LPPA 1R6WA 4Z1AA 4GISA 2OGJA 5MHBA 3UZZA 2TRSA 4FR6A 5EFDA 1SFJA 4W86A 2ZWYA 3ITXA 3FFSA 3DBNA 1TREA 3CMFA 3AZSA 2G37A 3SB0A 3VAVA 1V77A 3MHGA 3JS3A 4UIOA 1GCYA 1GZGA 2BGSA 4B5UA 4DPQA 4WF7A 1RLDA 4QE1A 3INPA 2ZICA 1GKRA 2NVCA 1BXNA 2OWXA 3P80A 3EKGA 1XIBA 3B8VA 5CC5A 4A29A 1HN1A 2ZOXA 3GR4A 2VVNA 4Q4SA 3W3OA 1BTMA 2A85A 1V4YA 4Y8FA 1QNQA 1QHZA 1OYAA 4Q4RA 3GTIA 3H23A 4LB3A 2DUAA 5EMKA 4MSSA 3GFXA 5AZ0A 4HHHA 5C2CA 1GORA 2J75A 1W1TA 3TW7A 3OVPA 3W7OA 4R33A 1G67A 1GZ1A 3WZ0E 4E8DA 2YCLB 4JTTA 4GMEA 4ZGYA 1IV8A 2V2DA 1QAPA 1FWBC 5AOUA 4HU0A 3WLOA 2VRJA 3BURA 3KHJA 3APTA 1VR6A 4R7WA 3M9YA 3PJTA 2PODA 4H3DA 4X22A 3W1NA 1J0JA 4ZOCA 2NUYA 1WZMA 4O4VA 3G22A 3G6MA 4UTJA 2XSBA 4Z2LA 4XD4A 1R30A 1QVBA 3EMCA 3THCA 2TMDA 1L8NA 3B9DA 1GQJA 1XIJA 5DN1A 2V5BA 1XW8A 2EEXA 3WH6A 4UTIA 5AHEA 1Z89A 2V5JA 4Z17A 3C8NA 3MO7A 3V3WA 3KAOA 4E6MA 1TV3A 4TX9A 3BVJA 1XX1A 3O63A 2W62A 4S3FA 3MMDA 2C7FA 3RJYA 3VCRA 2FJKA 1EP2A 4JX4A 3ZVHA 3AOFA 2ACSA 2E3ZA 3QV6A 1H0GA 4RR4A 2BXYA 4MNJA 3IK2A 3GC4A 3EXTA 2I17A 4P5UA 3H4WA 5HNRA 1E43A 3ZSTA 1UIOA 1K6AA 2E25A 3R6IA 3E0FA 2Y5SA 2BZNA 3MVTA 1F61A 3QHNA 2UBPC 3G1SA 3H12A 4WDUA 4A3RA 2YSWA 3K4DA 1P0DA 4GUJA 2CLIA 5E5CA 1JDDA 3S5SA 5BU6A 1LTDA 1IXOA 1GONA 3TA9A 4ML4A 1FXQA 3AXXA 1YNQA 4G2DA 3C0QA 3ME3A 3N15A 1P6BA 4F0KA 4PUNA 4RXGA 3LUTA 2NT0A 1WDWA 1ZY9A 1NP0A 2W63A 3DU0A 4EWND 1KV5A 4NXKA 1F8MA 4ZMGA 1J0YA 1J11A 1H4PA 2NUXA 1MUWA 5I00A 3R8HA 1JCLA 4LALA 4PBFA 4JEQA 4A21A 1K1DA 5HXMA 1AH3A 5CGTA 2FMOA 3UZ5A 5EMUA 2EF9A 3CLWA 1BYCA 2EXOA 4OBSA 5T8GA 1B3WA 5LXEA 2VWSA 4YTUA 3V1HA 1G4EA 2J74A 2OSYA 3KDNA 1GOXA 4H9UA 4KWWA 5F7UA 1V02A 3TMLA 1XIFA 2B7QA 5HJXA 4MJ2A 4JHMA 4YN5A 2PMQA 2YXGA 1DKWA 3TN5A 1KLYA 3DDMA 5M3WA 3SFKA 1SFSA 1ISWA 3CZJA 3L2IA 4Z2IA 1E6PA 4G9PA 3UWYA 3VZXA 3LGGA 1HKKA 4PB4A 7REQA 3DX5A 3H2MA 1DIKA 4QDMA 3W24A 3GVRA 2DGAA 2P3EA 3BWWA 2GK1B 3WDIA 3A4JA 1DL3A 5K4XA 1G69A 1OT2A 2DZBA 3GDTA 4L6DA 4D8AA 1XRFA 2WC3A 1GUVA 1M6JA 2YDAA 5KITA 2INFA 3WLSA 1QCWA 4IHCA 4K36A 4JKLA 1POKA 2INZA 1VC4A 1PZ1A 4HZ6A 4K8HA 3SCOA 4HA1A 4KERA 4URIA 3S9ZA 3O2LA 3R5EA 3QMRA 3U9IA 3TTQA 1WDRA 3MY9A 1YTEA 1TA3A 1AW5A 3VZYA 4QIUA 2QQ6A 4B2DA 3UG8A 3QFWA 4L5ZA 1V02E 1XSJA 4AC1X 2ZC8A 2BY1A 3UWEA 2AGTA 3LPFA 1C7SA 1UZ4A 3AIBA 1R9ZA 1CGVA 1NWSA 1F3TA 4F79A 1TR9A 7PTDA 4QJ1A 2PZNA 3S2MA 4CD7A 4O18A 3W26A 4GC3A 2E5DA 1EJ7L 3MI2A 4FOUA 2XH2A 3B3DA 2VL4A 3VGBA 3U7VA 1FWDC 1UQZA 4AYSA 4PA8A 4J40A 3W7IA 5FJUA 4BZYA 2FJUB 2ZTKA 3NURA 3TAKA 3CQJA 4HD5A 4RCXA 3DCPA 1JRCA 1JYVA 1GOMA 2WMGA 4D72A 2ZE0A 2HSAA 2WVVB 4ENLA 3H8AA 1BYDA 2O9OA 4QLKA 4WRHA 4J3TA 2WSRA 5D09A 4HNOA 5EBAA 4RJEA 4C91A 5K7JA 3WDJA 1UW9A 1KBLA 2PU0A 2HBXA 3GW3A 3M16A 2WBGA 4DYJA 4MY8A 3KS6A 1WO2A 1E4MM 1H0IA 3FA3A 3W25A 3LYEA 2QJNA 5HMDA 2RGLA 3UU0A 4PTMA 2XFWA 5G4EA 1R8LA 1QPNA 4PL2A 3A22A 3THDA 4DBSA 1PSCA 3NL5A 5BXSA 4WEVX 3E5BA 2J88A 2C19A 3ABXA 3QLLA 1LUCA 4GKTA 2ZRXA 3P62A 1DHKA 3W2NA 1IEQA 3AC0A 3KCOA 3I7QA 3CO8A 1VENA 1PX4A 4WIWA 3GUGA 3QKEA 4S3KA 1CPUA 3CAQA 3HQPA 4BFAA 4ML9A 2YPIA 3KRZA 3RO8A 3GC5A 2PDXA 3G1HA 2OZ3A 3Q45A 1JDEA 1Q4WA 3CXOA 3CV7A 2V63A 3UJFA 3UGRA 4HIBA 4Q33A 4OIFA 3S46A 4PCFA 1J6PA 1LLOA 4QGCA 2Y8KA 2P76A 1QOXA 4HMDA 4TTGA 4ERIA 5A6TC 1BG9A 4HA3A 3NNTA 1EF2A 1X39A 4PCPA 4RW5A 3ID7A 4PTWA 4JTSA 1XLHA 3F2DA 1DIOA 1TCDA 2QGYA 2V81A 4FX7A 3WN6A 4OUEA 4QE4A 3VKBA 2VZTA 1W6TA 1EJVC 4G1NA 2FZ8A 1LWHA 1HGYA 3EWYA 1C8QA 4ZODA 4QEEA 3LHTA 4POCA 1U2YA 3MZNA 5FJPA 5A8GA 2QCEA 5JUVA 3LRMA 1WPCA 3WLTA 2FLIA 1C91A 2V30A 1S5VA 1KM2A 1DEDA 5EMYA 4GYKA 2ATMA 4LUSA 2PB1A 4IMFA 1LORA 1W5MA 1CNVA 4DLFA 3EX2A 3WNLA 1K8XA 4HJWA 3LRLA 2PE4A 1T40A 1GOIA 4LYKA 1U1JA 3W28A 1GVOA 1TKKA 2R94A 4BEUA 3LZ3A 3AIVA 2QCLA 5LNRA 4DF2A 1NY1A 5FAGA 1EEXA 4K2SA 1ISXA 1EA0A 5DXXA 2WQPA 3MYOA 4CU6A 3WFZA 5I3DA 2PSNA 3UPMA 4EAYA 2C8NA 2DUXA 2P88A 2Q71A 1I45A 3SJNA 2O0TA 1OY0A 3KL0A 4ZOAA 1JPMA 3EWWA 5LGZA 4L9ZA 4HJFA 3ARWA 4C5ZA 1LBFA 3CK5A 2Y70A 5HMSA 3DG7A 1TTPA 3PTQA 5IFPA 4DJEC 2J6VA 3DKLA 3P8JA 3RCYA 7XIMA 1A4MA 3LGEA 5HBFA 3I4EA 3A13A 3AIEA 2B0MA 5HA7A 3T6CA 3AIWA 4DJDA 1FP9A 3ZJ7A 2HBVA 4JY9A 4AF0A 2PDWA 4MZ8A 4MUZA 3G1VA 3GXTA 4RDVA 3T81A 4O13A 2IPWA 4JTAA 3M5YA 4M82A 4JKMA 1QHOA 1ZGDA 3UCQA 1AH4A 2QCNA 4ECLA 1QR7A 1A80A 3P0WA 5FJTA 1JZ3A 4PUJA 3H2NA 3KVMA 1QMLA 1VPYA 4LBSA 1YPIA 4KW2A 4WDWA 1WKEA 1US3A 4U5KA 1IYXA 4I9JA 4GG9A 4WY0F 1SO3A 4JD4A 3CV1A 3LHWA 4DUXA 3E49A 3GHTA 4HN8A 3OA5A 4QJ3B 4LPCA 1MRQA 3VILA 5A8MA 3TOYA 4GZ7A 4R7JA 3TW6A 4YMZA 2YCEA 2PDHA 1UKTA 2VVSA 5F1VA 3PBMA 2DORA 4ROQA 2ZRZA 4UQCA 1FVPA 2X40A 2CHRA 2FPTA 3HJZA 5CPQA 3W7QA 2WJFA 3KBMA 4ICCX 1D3GA 3IJLA 3O1NA 4FNUA 2G97A 2C13A 3QOKA 4UNIA 3Q65A 1YPFA 4MFDA 4KEMA 4MFEA 4J27A 1S1PA 4BQ5A 5G1YA 1FWIC 3W70A 1TWDA 5ENLA 4GABA 2WO5A 1HL2A 5HPOA 1AZ2A 1Q6OA 3RRXA 3VIOA 3VCCA 3ARTA 1S38A 4XZ9A 4V1YA 2Q8XA 2VC5A 3OBKA 3N1AA 3AJ7A 5D2VA 5DQPA 3KTCA 1EC9A 5ECVA 4HZ8A 3B4YA 1NELA 3BLIA 3COTA 4P8XA 1O4UA 5IHSA 5CC6A 3DHPA 4LUTA 3UNTA 3WUGA 4OGZA 3T2PA 3DESA 2PWGA 3M47A 3TFXA 3RG6A 1PX8A 4WOQA 5D38A 1NOWA 4TU1A 1JEZA 1YXCA 2ZDSA 3BZGA 1F07A 4Q4MA 4KGJA 1IZKA 1YNPA 4E2DA 4UTUA 1DJGA 4PN2A 3FKRA 3OBAA 3TR2A 2VXNA 2Q8ZA 4MAZA 3FIGA 5E9XA 3E6EA 4W7UA 3ITVA 3SN4A 2CXEA 4ILSA 4AD5A 3W02A 3L12A 1UWQA 3QJAA 4NZFA 3APYA 1B3ZA 1B1YA 3M7SA 3LI0A 1CI1A 3EDDA 3ENLA 1GOQA 3N6HA 3HMJG 1Q6QA 1JR1A 4ZO7A 3UXLA 1ME7A 2OELA 5CLTA 3W73A 1RCQA 3S83A 3V36A 4PMDA 3L5MA 1P0NA 4O1DA 3AALA 3A9BA 3LOTA 1P1MA 1H3GA 4JNYA 3WG6A 2PZ0A 2E6YA 1H41A 3KOYA 4B5NA 2BNJA 1CX9A 3HIJA 4LEQA 1F6KA 1PEZA 3IS4A 2PDJA 1RA0A 3ZMRA 1X6UA 3MC5A 3T2OA 1KCLA 1DP0A 4JQ1A 1JCYA 1EP3A 5BRPA 1ZUAX 4AIBA 2OT1A 3HG3A 3IIXA 1W1ZA 3SCSA 4FNPA 5L6UA 2QPUA 4KWVA 2WZTA 1H5VA 1BSIA 1XIHA 4AZIA 3FDGA 3KRBA 1E9YB 1W9PA 2X8RA 4W93A 1CGWA 2FTWA 3R12A 4H04A 3A5VA 1FKWA 1HZYA 4DN1A 2B81A 3EGJA 4R9OA 3W1QA 4XIMA 1WOAA 1OFRA 2NUWA 4DZAA 4Q4OA 3FGCA 1ZSXA 1Q2SA 1SYTA 4HCLA 4K7VA 2XVNA 2Q02A 5I5RA 2A3CA 3BLLA 4WVXA 1OK6A 3LLDA 4LW7A 1KXVA 2J7EA 1M7PA 4MMWA 4F3HA 5EBUA 4NYUA 3PZMA 2J47A 3QGVA 2DDXA 1V3KA 1KXTA 3AYTA 3PC0A 2OYLA 3S4TA 1H09A 2NSXA 4ZFCA 3F4CA 3VKAA 1Z44A 1KRCC 4ZO8A 2ANUA 3NO5A 3E38A 1ADDA 5K9DA 1UIPA 4PMQA 3ITCA 4FA3A 1ITQA 1AJ0A 2JKPA 1EEPA 4IXXA 2WLZA 5CKSA 1O5KA 4HYVA 3M6DA 1SR0A 4ICMA 2AKZA 3LTYA 1F8IA 1TPWA 3WLMA 1PIFA 2GJPA 1TVLA 2PDCA 4C6PA 2DIKA 1GWJA 1LJYA 4I8DA 1VEOA 2DW7A 2VGFA 4H01A 1GHRA 3BMWA 4C6EA 5E1QA 3S6OA 1BSLA 4WUIA 1HP4A 3ARSA 1Q7ZA 3GUWA 4W7VA 1EIBA 1H11A 4CCEA 2ZQ0A 3O15A 5DRIA 2YJQA 2XTKA 4ORIA 1ZALA 4DXXA 3N3TA 1LDCA 4ZEPA 4BCEA 2GJNA 4DYKA 4UZSA 4DBWA 1R38A 3UESA 3POHA 3EA1A 4M1RA 2YYTA 3OBEA 3UWVA 3W7PA 4W8LA 3W0KA 4CU8A 3QM3A 1CDGA 2J8GA 1QW8A 5CGMA 1MFUA 3CQ0A 3PULA 4L4OA 2O92A 4GNJA 3KWSA 4DUOA 1HT6A 1EHNA 7TIMA 2ZZ6A 3ICJA 2FPVA 2RDXA 4G6CA 1B5TA 1DE5A 1CGUA 1Z69A 3CUGA 2A79A 3ZM8A 2WNWA 4QXIA 3SY5A 1Q85A 3WENA 4G1KA 1EOKA 4PMJA 2R1KA 3HA1A 2OWWA 1T41A 3A5FA 1SJAA 3U57A 2YFOA 2GOKA 3GB6A 4O57A 1VF8A 2JF6A 1MDRA 1EX5A 2NQJA 4Y9AA 3GQYA 2E9BA 1U33A 3AI0A 4TX6A 3KOXA 4XAZA 1GZJA 1C8YA 1NOUA 3PZQA 2CIPA 3P3BA 4B2DD 2C71A 2NWSA 2TPSA 4JTFA 3OODA 4H9TA 4JIHA 3DC8A 1KA9F 2JF7A 4O8AA 4LNCA 3L4XA 1QI2A 1DIDA 4Q8VA 2WWDA 1UP2A 1BXBA 1H49A 2GJXA 1FDYA 1MXGA 1B54A 1P5BA 4WZHA 3AICA 2ABAA 2WBKA 5CCZA 1IXPA 5C8BB 4G5DA 3PPCA 4CD5A 2Z4GA 5XINA 2GFTA 1G5AA 2WMIA 4MZ1A 4XD3A 4PC8A 4YPJA 3UZXA 3WH8A 1ITUA 2WKGA 2W3ZA 1JZ6A 3VU2A 4JIPA 3N29A 3C2EA 2G4JA 3DUGA 4IQEA 4WXYA 3VNMA 2CBUA 4BEQA 1XLKA 2VX6A 1DTUA 4V1XA 4H6EA 2YDQA 2VFGA 1EBHA 1JJKA 6TAAA 1VS1A 1J0HA 3ERPA 4GGHA 4WOZA 3CQKA 3GNPA 3TXVA 1XGZA 4BS0A 1EA9C 2PC8A 1EWEA 4NYYA 1UR9A 3DH7A 1I9CB 4MZYA 1XYBA 4LVBA 1TO3A 3WO8A 2WCSA 1W8GA 1LRTA 2A2IA 3DHUA 1JYXA 3B40A 1LQ0A 1OGGA 3FA5A 3WQCA 3S5NA 1PKLA 1ZCCA 5HK4A 3CASA 5HULA 3UJRA 4YYCA 1Q7MA 3DENA 1UG6A 1XIEA 2BHUA 3N73A 4HPJA 1F3EA 3PZTA 2Z1WA 2CCRA 3W23A 1TQXA 2IKJA 5SWUA 3IGUA 3DC0A 3C86A 3O6YX 1O66A 3CHVA 2R6OA 3PZNA 3ZT5A 2CPUA 3F4DA 2YXOA 4UZUA 4XAGA 3L9CA 4XZBA 2A3EA 3RPTA 3O0KA 1DJWA 3TUUA 2FDSA 3TXZA 4EXAA 3C0JA 1T6MA 2CBVA 4QP0A 4Z2KA 4AAJA 1W9UA 4B5VA 1JYWA 4X0VA 1ADOA 2WHJA 1K8YA 3JZUA 4PCNA 1IR1A 1MI3A 3LD5A 1CENA 1RR2A 3N12A 5D33A 2W5FA 1E6ZA 4GYFA 2VFHA 1TWWA 1FRBA 4CQBA 1E6NA 3EOEA 3B8IA 4ZQNA 4ZFMA 4XV0A 4M7TA 3VIJA 2GVYA 4H9VA 4CD6A 1U1UA 2CZFA 2YW3A 1Z41A 1AJ2A 2D0GA 3AU2A 2PF0A 3L2LA 1OC5A 4XAYA 2NX9A 3BUVA 2PRHA 4WDTA 1MNZA 2HXUA 9XIMA 3IJQA 5AB3A 4CNSA 3WQEA 2J7DA 3NPWA 3RUBL 3RCNA 5LZLA 2BS9A 4F0LA 3W81A 2P0OA 5MKGB 3THAA 4O16A 3TDFA 4KCWA 4O17A 3BXWA 4GHRA 5LXXA 1RAKA 3PF3A 4FNSA 3T0CA 4HNCA 1HJXA 2HMCA 5I24A 1VRXA 4EKJA 1SO4A 4FALA 3AQUA 1GG1A 4TX8A 2D0HA 4I3GA 3E2VA 3P5ZA 1WE5A 1MZRA 4S39A 5T91A 3T1GA 4YYFA 1W1B1 4JFVA 1Y0EA 2FFCA 1SMAA 4AXNA 2YA1A 3NDZA 4OKDA 2OOFA 4HPGA 1CGYA 4IQJA 5FI8A 1O5QA 4HT3A 1UHVA 3A4WA 4N9DA 1L2UA 5HQMA 1PZ3A 1UR4A 1KRBC 3F03K 4MWAA 4DJDD 2QUVA 1MQRA 4GYPA 5D4YA 5CBBA 3NSNA 4O0KA 4GXWA 4D6GA 3PJXA 3ZWTA 5E0FA 1W37A 2QDDA 2VFIA 5DT7A 3WD0A 2B4GA 2A3BA 4MG4A 3F4VA 4LXFA 1XCXA 2ABBA 4ATWA 3EDFA 4JHOA 4AWTA 2GSHA 2OVLA 1IGWA 4RW3A 4HYWA 3BDKA 1P6WA 2EKCA 1KRMA 3C61A 2V9DA 1F5ZA 4MHBA 3VO0A 3L5LA 2J8TA 1QJWA 3E02A 1IQ8A 3GG8A 4E0CA 2WHLA 3WJSA 3LPGA 1KKRA 1VCFA 1E5NA 5CXPA 4MLJA 3PY2A 4KETA 1CEOA 1VB9A 3CUZA 3W29A 1J0ZA 1ONRA 5I06A 1VFMA 3B03A 2I9EA 4LAMA 1EQPA 4ZCWA 1GEHA 1R3WA 3U6WA 3BTNA 2WXDM 3W37A 4PTXA 3QTPA 3ZO9A 3U8GA 4ZO9A 5TIMA 2HNHA 2OQYA 3MHUA 1VYPX 3N9RA 2Z1SA 2XWEA 4MWAE 4UC5A 1GVSA 2DVXA 2D22A 4CLMA 3T9PA 2NQHA 1MEHA 4NU7A 3RN6A 5FJOA 1PYMA 2ZX8A 4S1FA 2W61A 3GNXA 2D1ZA 3TYAA 2POTA 2F6UA 3FYYA 4F2UA 4NJGA 2QHAA 1IWBA 3AXHA 2D2JA 3H7VA 4DJFC 5HPCA 4LUJA 4H2CA 1V6WA 2AGKA 2E0PA 5CAHA 1E1CA 4M6UA 4LT9A 3WK1A 1XYZA 2OLAA 1W32A 2Z7GA 3TTOA 3QY7A 3GFYA 4NIRA 4H8NA 1VZWA 2WSPA 1E4IA 4L65A 4DVOA 4A05A 4EK7A 3UQNA 2IKHA 2CLEA 2X7WA 3GR7A 5HUPA 1A3HA 3W01A 1BWKA 3BCJA 3WCZA 1H51A 1UCWA 2NSOA 2DSUA 4TMBA 4OQVA 4HN4A 1RD6A 3ANUA 1LF1A 1CGTA 3TZFA 1YRRA 4DIAA 4V28A 3DYMA 1R47A 2NLIA 5E6ZA 1C3FA 1UWRA 3DG6A 4GI8A 3NPUA 3IVUA 4JICA 1LBMA 2WKLA 4UUIA 2OPJA 5KTLA 3EWZA 1Q8AA 4OOUA 1U1HA 2UWFA 1Q7QA 3W6LA 1TJPA 2GDVA 3W07A 1IF2A 1J8VA 1UR2A 3PFMA 3C4UA 3LS9A 4A3YA 2H6RA 3SI9A 4NASA 2JALA 3M41A 1F7BA 3T08A 1UROA 1GKPA 1PHQA 1DXIA 3L65A 4LC8A 3NQ7A 3ES8A 2DZTA 1W17A 2QAPA 3WF3A 4QM1A 1SVDA 4PRWA 4ZBCA 4DWSA 1X7IA 1RBOB 3WLNA 1KFBA 3S5ZA 4GNKB 2QVHA 3RILA 2IPJA 2X41A 1FWJC 1E51A 4L56A 4QCEA 2HEJA 4DO5A 4ZE4A 3VGHA 1A5KC 1FHUA 1NVMA 5AHNA 4AZGA 4C1NA 5G5IA 3G0SA 2XH0A 3RM9A 2ZXDA 2VDGA 3AHYA 5AHIA 2DZAA 3Q37A 1HJQA 3T55A 3GG7A 4JN8A 3OTRA 2BOEX 1XLBA 3EDJA 4XD5A 1AD1A 2VOTA 3RK8A 3WK3A 2QCDB 2FHCA 4C5YA 1E15A 3IGHX 5I3FA 3ABSA 3TTSA 1Q5MA 2ZADA 1WDDA 1OSEA 2BVDA 4ZXLA 5H2ZA 5K9CA 2FZ9A 2OCZA 1ZAJA 2JE8A 3W71A 1RXOB 1V5XA 2FGBA 5CAKA 3LCIA 4GD0A 1V3MA 1ZBKA 2DY3A 2GZXA 3V0TA 2VI0A 1NTHA 5DMMA 1HTIA 3BLFA 3TQPA 2YL8A 4F0HA 4CQ8A 1TV5A 1VBGA 1AUSL 4EF9A 5TF0A 3TROA 3RX4A 4N42A 1XP3A 2QVNA 2ONEA 4UCGA 1PYFA 2ALDA 4YL2A 4M6PA 3A23A 3RU8X 1IEXA 1G4TA 3S1UA 4DI9A 3GXIA 5FJJA 4DRSA 4CUCA 1JCTA 1FCQA 1LYXA 5M2FX 4QNEA 3M0YA 1KR0A 4P7LA 3NZRA 1WP6A 3QGKC 1RQBA 3RXZA 4NILA 3E96A 3SCWA 1EXBA 1Q8JA 3P81A 4JTKA 1PXGA 3GYCA 5GPRA 2RDWA 1AJZA 1V79A 1L6SA 2R1PA 4MDOA 4LV9A 1R3SA 2GLKA 3F2BA 1SJCA 1E0VA 4LH8A 4MDPA 3GDLA 1S3HA 1KGWA 3LXCA 2ZVIA 3DAQA 1OC7A 2W9MA 3NAVA 3R0DA 1S2TA 4JFTA 3W27A 4IMCA 3SZ8A 3UWWA 1FWSA 4FLSA 1DTNA 2J7GA 3I4KA 1JRBA 1H7XA 1RZMA 2ZA1A 5BRBA 3QVQA 3IPWA 3HPXA 1W3JA 2I5GA 2YA2A 3H2AA 4L4MA 4I5UA 1QNSA 2TSYA 3REQA 3QV9A 1DYSA 5AY7A 1BVNP 2WM1A 5GNXA 3L0GA 1CB7B 1JZ8A 4DPPA 2PUZA 3U2ZA 4NAFA 4H6KA 3SCVA 2BG5A 1M68A 5HMEA 3DG3A 1JULA 3KCJA 3RLHA 4ACZB 2GDQA 1HXJA 1I75A 2VQUA 1KCXA 4WDXA 1ZENA 3H2OA 1K9EA 4NNBA 4EOUA 3H4GA 3GBDA 2LLEA 1FXPA 2VT0A 2OEKA 4BK9A 1KXQA 4XZMX 1NQ6A 4Q4PA 2FDMA 4QAIA 1ZJAA 1KQZA 1EDQA 4HQVA 3NA8A 3A9IA 1EDTA 3GXMA 1S2WA 1UA7A 1EQCA 3G3DA 1ME8A 2KZHA 1XCFA 3FHQA 3V5OA 1A5LC 2PC4A 4DB7A 4GGBA 8A3HA 3K8LA 3W9ZA 1K02A 1WKYA 4G8TA 2C18A 4IPNB 4YVPA 3ORWA 4HU8A 4ZXOA 3V18A 5AYIA 1NWTA 4ZTXA 3VC5A 3T05A 1QXLA 3GH5A 3RDKA 4CCCA 1CECA 1A3XA 4PBGA 3M0VA 4ZQOA 3SGZA 2JKAA 2W6RA 1P48A 3G1YA 4QSFA 4LUYA 1VCVA 2PAJA 3BV7A 2YW4A 2G5WA 3PPGA 4D1IA 4O1AA 3T78A 2PEVA 1MEWA 2AMGA 3NQAA 3R4IA 1S1RA 3W7RA 2P53A 4UQEA 1EDGA 3H53A 3P7YA 3DFQA 2Z24A 4YHEA 2VCAA 4QR6A 2FTYA 1OFAA 1P7TB 3K1DA 1TV7A 2ESCA 2NQLA 5BYWA 1Z7AA 4V27A 1BQCA 1EX1A 4G7EA 1DJXA 5CG0A 1XLGA 3WY1A 5EGRA 5DX7A 1FWHC 1O7AA 3NO1A 2H8ZA 4GZEA 4Z0JA 5AYYA 4K6AA 3U7BA 1PWLA 3ZVHB 3TFCA 2VQTA 3BG5A 3PM6A 2XN1A 4XTIA 2VFDA 4PB3A 3QPEA 4RZ4A 3JU2A 1TPDA 4A6GA 5A6JA 2GQAA 1DVJA 2OYMA 2GGIA 3MP3A 3N04A 3QHOA 1E0WA 4GFSA 2C0AA 4MY9A 2O4MA 3N4EA 3QW4B 3OVRA 2EQDA 3SCTA 3T0TA 4DNMA 1LROA 4W8BA 3UY7A 4NZJA 2B7NA 1E73M 3G8RA 4HHMA 3XINA 1UWSA 3KRSA 3NJ3A 1JCNA 4LQ1A 1VFLA 4W87A 3P84A 2GSJA 2D23A 5FESA 1YDNA 2FH8A 3EAUA 3JVAA 3M6YA 1E6RA 3TN3A 3K1GA 4ASTA 1CYGA 2RGMA 4J7RA 4E2BA 3ARVA 1VBJA 2F6XA 3BG3A 4LANA 2B7OA 3EXRA 3UCDA 5HWJA 1TPEA 3W1UA 1LRNA 9RUBA 5JXQA 3G24A 2C1IA 4OU1A 5I23A 1GW9A 3MO4A 3K4AA 1LLZA 4F40A 3W1TA 1E56A 1XI3A 3MUY1 4Y8EA 2CBJA 5AC7A 1LWIA 2Z2BA 3TQKA 2NXGA 3GDKA 1TJ2A 1GEQA 2GVGA 4US5A 1UOKA 5F2GA 2VEPA 2PI6A 3PFRA 4Q32A 3VOJA 1UZHA 1SFLA 3QSTA 1A5NC 3PAOA 1YDVA 4AY1A 4A22A 1E3ZA 4MB3A 2HVOA 3BJTA 5K4ZA 3LCWA 4YTSA 1ZP4A 1VFOA 1CLXA 2ZRUA 3KX6A 2AAMA 1TPFA 6REQA 2WZIA 2CLMA 2DV0A 4ADTA 2OEJA 5AC6A 1EYWA 1REQB 4S3AA 5JH2A 2XGIA 1IWPA 1J9YA 5HJLA 1CXIA 5FF0A 1AQ0A 3GK0A 3U5YA 3RLGA 1TUXA 4E3TA 4HYRA 4H8HA 3LB0A 5TQLA 1JL8A 4GXMA 3BOFA 2WJEA 1FCUA 2VD8A 4Y6GA 1PTDA 1E9IA 1CLVA 3AAMA 2QDGA 2EKGA 1UC5A 4FX8A 4IGNA 5TBOA 5DT5A 1H63A 1OFDA 2O9PA 2Q09A 3SGGA 3FKKA 4MWAD 3LN3A 3GSMA 2WCGA 4NZ1A 4QBXA 5H1WA 5AYBA 3S3GA 2XZ7A 3I6EA 2VCCA 5D30A 4G7FA 1NDZA 3GU1A 5FF3A 2CKSA 1KBBA 1CIUA 3VDAA 3ZZ1A 3H54A 2VKZG 1OK4A 3VDCA 2QCMA 1QATA 4JQ3A 2V3FA 4U33A 5A6LA 4B90A 2P10A 4O12A 3MUCA 4JQAA 2Y1HA 4YVXA 4Z2GA 3TV8A 1ICSA 3CJPA 2PGWA 2DZVA 5DMLA 1SO6A 4PRTA 3S9IA 5A5WA 1F05A 2C15A 2ZZ3A 3LV6A 2FHBA 1Q6GA 4FHAA 5ABFA 2NV2A 4L7ZA 1XG3A 2FKPA 3H55A 4DZ5A 1NJJA 4QROA 4HKPA 3UD6A 3HZ3A 4NI8A 4WX2A 3AXKA 2FVKA 3U2EA 4JDBA 3AYVA 3PBWA 4IZGA 3B9EA 3UGVA 4FEZA 3AS3A 3IJDA 4QNWA 3VE9A 2DPEA 4XWUA 4H7CA 3CUJA 3VIHA 2PDBA 1V7YA 4UR8A 3CIWA 2FYMA 4RX0A 4YCPA 1KD0A 1MFVA 2P0IA 2A3LA 2W0UA 4Z42C 4GO8A 1JXJA 1ZS2A 3GU2A 3POCA 4LAOA 3R43A 2V6AA 3A6OA 1XBVA 2JEQA 2CZDA 2R91A 4RNHA 4N9EA 2PDPA 1OB0A 4PFHA 4W9TA 1FY6A 4UTTA 4DELA 3EMZA 5B7ZA 3CUIA 5LNUA 2VNCA 1UH4A 1FH9A 2IPGA 3VCNA 1HL8A 3BSHA 3HF3A 3UVAA 1YYAA 3KTSA 3C3NA 2XVPA 3G1AA 3FA4A 4JFSA 4KESA 3BW2A 2EJ1A 2J7HA 1Z3NA 3UWQA 1ZBCA 4AH7A 4XBJA 2CNCA 5BCAA 3RITA 1XRSA 1SW7A 3CL6A 4GXPA 4YNGA 5J5RA 4KS0A 3W1RA 4AYGA 2G3FA 3UG4A 3ITGA 1FP8A 1LT8A 4EXQA 4A2RA 2J9YA 1PTAA 3WQ4A 3EEZA 4F2TA 3LMZA 4CD8A 3SSJA 3CAVA 1HO4A 1DJIA 4GQBA 3IACA 1QASA 3TKFA 4NL1A 4CQDA 3EPMA 5C6MA 2BFGA 1PZ2A 1GVQA 1Q3NA 3LCGA 2Y7FA 4OJYA 4NI3A 3ZR4A 5K9XA 1LL6A 2EO7A 3BGGA 3LHVA 4LUSB 4B9ZA 1NDWA 1GVEA 2QLYA 1OG0A 1ODUA 1O94A 3NQ8A 3SFWA 1PKNA 4GCAA 5EKYA 3N2MA 3GVGA 1OZQA 2WVTA 4DWSD 1RD5A 2DT3A 3U48A 1K8CA 3OZPA 1PAMA 3CHDA 2GJLA 1FWFC 4HPHA 1JFHA 2EPNA 1AFSA 1Q2RA 1OD0A 1JUBA 2DU2A 2Y89A 3UYCA 2BHZA 3CS2A 4CVUA 3BARA 4OOZA 3CV2A 2SFPA 1XD0A 2ZKMX 4DBDA 1O5RA 1DWJM 1T7LA 4A3QA 4N9CA 1KFWA 4HBKA 1TPH1 4DO6A 3IRDA 1KRAC 4EE9A 3EOUA 4JR5A 1TWIA 1UKOA 3IVSA 4K68A 5I3IA 1E71M 1MNSA 1O5XA 3G0UA 4KH2A 4XBKA 5E0CA 3KL3A 4J3VA 3MSDA 3OB8A 1ECQA 4J3ZA 4NP7A 2QULA 1HJVA 5KZ6A 4F66A 3LHYA 1ZPTA 3R8GA 3ANVA 3MYPA 4JXCA 3TYDA 3SUSA 1FCVA 3GWQA 2NXHA 2PTXA 3N25A 2VYOA 3DKJA 5HQEA 3GS6A 2XG9A 4AZCA 2XN2A 3WH7A 4O50A 3QOMA 3VGEA 2OB3A 1AH0A 2WKJA 2HCVA 3PS7A 1M7OA 3BC9A 2GJRA 2OYKA 4J9JA 2WSQA 4H8UA 3TZNA 1J4EA 1VBRA 2XU2A 4LCRA 5BRQA 1S5MA 1B3YA 2TYSA 1JPDX 1MYRA 3RGTA 3PANA 3SCRA 5A8NA 1LOLA 3M7WA 1V3JA 2VMFA 1HVXA 2HV5A 3MPGA 5CPTA 2XM1A 5D8WA 3VNLA 4FO4A 3URBA 2PA6A 4H6RA 1POJA 4YTTA 4KT2A 1F6YA 1W3TA 1GHSA 4GQGA 4IQDA 3S1WA 4RXFA 1ZJHA 3S2NA 2PTDA 5A6BA 1AODA 4BKNA 4F9DA 1H5YA 1EFZA 4MYXA 4R3UA 1XICA 2VGGA 2WB5A 4IFOA 4LYRA 4PMVA 4O1CA 3V7PA 3NIYA 1KB3A 5D05A 3KBJA 2AMXA 1IT0A 2ON3A 1I8JA 4RDYA 2XWDA 3SUVA 3JUGA 1NOFA 2QT3A 2G96A 3GYEA 2EPOA 3MBFA 3VYLA 4PTVA 2R8WA 1GKQA 2W91A 3CMGA 1VGAA 2CITA 2YA0A 1W1IE 2C16A 3URAA 4C6IA 1MW0A 3V4BA 4AXKA 3PBYA 3C2RA 4DNHA 2HJPA 3C52A 2VUYA 3LEPA 3PNZA 2FZMA 1VFSA 4M29A 3ONBA 3CT2A 4UQAA 4XG1A 3UJEA 3MKVA 2RJHA 3OO2A 1JFXA 3CYJA 2YKKA 4LCSA 4CQAA 2WMJA 1TPVA 1YX1A 4I8YA 1LL4A 2IMRA 3BK0A 2AOSA 5BZAA 4E2VA 2BGNE 2ZUMA 1JGMA 4L4PA 2H8XA 5AYZA 6XIMA 3U3HA 3HQ1A 1KM0A 2VX4A 1C8XA 4CEXC 2PDIA 3UT0A 1V3HA 4FOJA 4FB7A 1R7OA 2QV5A 1PE1A 3E74A 4LAKA 1K9DA 3MP4A 1B4EA 5E0KA 3RRAA 3LPOA 3CWHA 1ZAHA 1R5YA 3K8KA 4MF4A 2ISVA 1Q6FA 2WVUA 3TOPA 3WMBA 4GKLA 3NZQA 3MBDA 1LQAA 2Z7KA 4GJ1A 1JXKA 3CT7A 3OVGA 3QV7A 1NP2A 1HKJA 4KQNA 2FH6A 1XPYA 1HJSA 2F38A 2PRLA 4NJHA 2J7BA 9XIAA 2PLJA 4TVCA 3BO9A 2J13A 3WDHA 2DT0A 2E8ZA 4AISA 4H9YA 4N4PA 4EP8C 4S2BA 1IWAA 2BLEA 1R2TA 1QI5A 5DO8A 3RM4A 4M80A 3F2CA 3CHEA 3IUHA 4UFIA 4X0NA 2Z6JA 4ZOBA 4AD3A 6A3HA 1NU5A 3FGCB 1UR8A 4RNFA 2AL2A 1QFEA 1UR0A 3SCQA 4FMVA 4WGXA 1JF6A 4U31A 2I5IA 3N2OA 5CBIA 3VKJA 2VRQA 4M51A 1S2VA 4IGSA 4Q6JA 4PSPA 2D2HA 4N7QA 5DCEA 5LSMA 1ALDA 4QDWA 3NDYA 1M5WA 1VPXA 3OZOA 1YDYA 5JBEA 3V5CA 3T8QA 3WFLA 2P1FA 4H83A 2YLLA 2OZTA 2GGJA 2QUTA 3OW1A 1UWUA 1EZ2A 4ZVJA 2QMJA 3V35A 4FNTA 1GOKA 2Y2WA 4WJ8A 1WAUA 4LWWA 4ERAA 4KWSA 1E0TA 3LCLA 5JBFA 1VQTA 4JAWA 3TYZA 3M64A 2C6QA 3VVGA 1US0A 1RPKA 4IP7A 1OVDA 3W76A 3ZIZA 2D3NA 2CZEA 3W1PA 4EPBC 2VC6A 2B7PA 5LNWA 3MSYA 1MDLA 4BY3A 4DO4A 5BMWA 3MV01 4R5EA 3KVKA 3MDUA 3C2FA 1ISYA 2E40A 3M0ZA 1OADA 2C1HA 1TMHA 4DJDC 4YJ5A 3W38A 3LZ5A 1AW2A 5XIMA 3BAJA 1RUSA 4XAPA 3WNKA 1CTNA 1VEMA 4US5D 5XIAA 1YBQA 4QSHA 1W3HA 4Z1BA 3WNNA 4LX4A 5EFFA 1JZ7A 3QPYA 3E2SA 3U2CA 3I7RA 1FH8A 1EBGA 2PGFA 3N13A 4O10A 2J62A 2Z26A 1I6NA 2QS8A 2Z0IA 4KIEA 3BMXA 1PIGA 4JOMA 4LTSA 4P2VA 3DFTA 1SMDA 4UBPC 3WD4A 5EMJA 3LBOA 3QTGA 3I3EA 3HM7A 3O6CA 5CG7A 5RUBA 4GH1A 2PDGA 1W5PA 2WC7A 5C70A 5AECA 4QISA 1V6VA 1E0XA 2J79A 3AZRA 1IEIA 1EO7A 4GIYA 4IL0A 2QJMA 2VHLA 3N9SA 4Z2JA 4HVXA 1CXLA 1ZL1A 4HA4A 2XFFA 4MVAA 3W2KA 2HPMA 3O05A 3DFNA 2PTYA 4IT1A 1XQLA 2EPMX 1OFOA 1JYNA 1YTDA 2F7FA 2G3JA 1UA3A 3SN1A 1I1XA 3EX6A 5E93A 3LDVA 5LGXA 3CPGA 3S0CA 1X98A 5F4SA 3VX1A 5I09A 4GIAA 2BSLA 5FKYA 1FWCC 1P1XA 2DVUA 3WL1A 4P7QA 1VHNA 1KM3A 1X96A 4RZ6A 4RE0A 4NT0A 3UA4A 1MW3A 1DHPA 3E1F1 4C6CA 2QAFA 2OZ8A 2IUZA 7TAAA 4N6EA 3P5YA 3IJ6A 1TTIA 1O1HA 3QKZA 3S2LA 3KHDA 2WMIB 5ECUA 3ABQA 3MMWA 3IWPA 4RKAA 4D71A 5DMYA 1QUMA 1PKMA 2OODA 3V0UA 4JDYA 6TIMA 4FSAA 3SEPA 1EJWC 2WNZA 3L4VA 3W2MA 2G95A 2XFRA 4X61A 5EU9A 2G0WA 1S3TC 1FUYA 2E9LA 5BWAA 5FA5A 4AVFA 3UW6A 3BJSA 3CB8A 3STPA 7ENLA 2GWNA 1PZ0A 4BWLA 4NVTA 2I7GA 3VXGA 3VUPA 3QFEA 5HNTA 1Q6LA 1YMYA 2VELA 1KM1A 3W72A 3WLHA 1JZ2A 4CU7A 3OVQA 1MMFA 3IUIA 3OQ8A 1F74A 2QCCA 4U10A 4A8LA 3FCPA 4U2ZA 3GNDA 1KBJA 1QTWA 4REQB 5E09A 2WHMA 3KW3A 3IJ7A 2UZ9A 3QLDA 2Y7EA 4WSKA 4KGLA 3MCMA 3SCNA 3ATYA 1VRDA 4IIBA 2PDUA 2WLYA 4HNTA 2JKEA 5HR6A 1DQUA 2EG6A 1TFVA 3PZVA 5M03A 4Z1CA 4MADA 2GVLA 4C6JA 1A5AA 2J4GA 2VURA 4JTRA 4NXSA 2IXVA 3J7HA 1EGZA 1ZNNA 3VNJA 2OSWA 1GVRA 5FSEC 1OG6A 3TC3A 2Q6ZA 2VUNA 3QY6A 1QW7A 2DH3A 3NZ1A 4AVNA 5G1MA 3FAXA 5KINA 3WNMA 1D8WA 1VIWA 2XIQA 2XIBA 4TVDA 1WV2A 1W0MA 4C6BA 5J8LA 1DIEA 4Y9PA 5CJNA 3NQEA 2O9TA 4DM2A 2ASHA 3LQGA 1KTNA 3IJ9A 2D2GA 3BOXA 5IBXA 3DBPA 2X2GA 3P2VA 4IMGA 4I7WA 2L5HA 1XD1A 1MZHA 1F4AA 3EYPA 5FEWA 5HDRA 1Q13A 1WKFA 2HE5A 2VTFA 3HG5A 1WDPA 5EA9A 4F48A 1MQQA 2PBGA 4V2XA 1KTBA 3GFZA 1LWJA 2X05A 3WF0A 2OT0A 3L5AA 2Y7GA 4N6FA 2FIQA 1FDJA 4L1GA 4DJED 1FCBA 1LT7A 1RK6A 3WYZA 3D3AA 3SUTA 3QEZA 4QG6A 5D37A 2YZRA 3DFHA 4W8AA 4H2HA 5FF2A 4HPXA 1JNEA 2PGRA 3OIXA 1WZAA 4UFLA 4IWWA 5C7VA 3LQLA 3TJIA 8XIAA 2G3MA 2WZEA 1SFTA 1C9WA 2Q8LA 3OHIA 2PDFA 1HF6A 4XZNX 4A2SA 1B2YA 3B8UA 2IPFA 3LBMA 4IMEA 2DIEA 3TYUA 4CGTA 3WELA 1DWAM 1UZDA 2EPKX 2XYLA 3NTYA 4UTKA 3GKAA 3M44A 5AC4A 1TE6A 3E0LA 2PDQA 3ZJKA 3VI2A 4PZVA 1FFQA 2XHYA 2Y24A 2E6AA 3NG3A 2QIWA 3QSRA 4HHPA 3VOCA 4C6FA 2V82A 5M5DA 3KVLA 3LI1A 1I2RA 2I1OA 1IEVA 2PCQA 1V0KA 4ALDA 3VNKA 2BXVA 2D0FA 2F84A 1UPMB 1FWNA 1SSDA 3B9OA 4HPNA 1GGOA 2X0YA 1GVYA 3BMVA 4XKYA 1J6OA 3NGFA 3L67A 1NAL1 5H8PA 3FLUA 4FZIA 3BZJA