2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
4XQ6A 1SZEA 1T0OA 3QM3A 4DBDA 1LM1A 3FYOA 4PEKA 1W31A 3B4UA 3W2UA 3WK3A 1FDZA 2JGYA 4NJIA 4O0KA 4QSHA 5HULA 4QITA 3DENA 7TIMA 4AH7A 3C8FA 2J9XA 3BLEA 2H8XA 4AVFA 1K02A 1NFBA 1K7EA 1B3OA 1SSDA 3SY5A 1HG3A 3MBDA 1PIIA 4NZFA 4LVBA 1OX6A 3NPUA 5T26A 3R89A 3NQFA 2Y6ZA 1DOSA 3NA8A 4S2CA 1VLIA 3INPA 4O12A 3S5ZA 2E6DA 3W1QA 1FCQA 2VC6A 4RK8A 2I1OA 3H55A 3TJLA 5D09A 3K30A 1PVNA 1ZJIA 4I7VA 3DFSA 1IXNA 3UY7A 3FKRA 3E0IA 4UTWC 3QPYA 4UTTA 1JRCA 2CLOA 5D2VA 3C4UA 5ABTA 3EWWA 2HMCA 3NQ2A 4WY0B 3TC7A 4FIQA 1TPFA 3MW7A 1XI3A 3DI1A 4K36A 2A2IA 4UC5A 5H2ZA 3C2RA 2BZNA 3L9CA 5HUOA 2DZSA 4LOCA 3E02A 2CLEA 1PE1A 4FO4A 2ZRZA 1JCJA 5G4EA 3EWBX 3PB0A 5CPNA 2NUYA 4MFEA 4FF7A 4MZ8A 4A3UA 3W1XA 3TUUA 3M1ZA 3UWUA 3W2NA 1T99A 3Q2DA 3R5EA 4IWWA 3GKFA 1FQ0A 4OV9A 2V30A 4IX0A 1GVFA 1ME7A 3GDRA 4UTWA 3O63A 3W7HA 4Q4KA 3S8HA 2VOMA 4M7SA 4UMBA 3WJYA 4P61A 1XC4A 5BNKA 4WZHA 4ALDA 4NJKA 3P61A 4GUIA 5LSMA 3LV6A 5EYWA 1ZHAA 2YR1A 1QFEA 2R91A 3EWZA 5D03A 1UUOA 2PC4A 2JK2A 2FPTA 1QDSA 4GJ1A 1VR6A 1XUZA 5D05A 3TCEA 5DELA 1IIHA 2E5DA 2FTPA 2H8ZA 3A23A 4BI6A 5FEZA 1XKYA 3F4WA 4L4LA 4HKPA 1SFJA 2C3ZA 3HB9A 1A5BA 2EAWA 2DZWA 4ORMA 1FDJA 1N55A 3JS3A 1EP1A 5AB3A 4ADTA 4IXHA 1UB3A 1W8SA 2RDTA 4KFNA 3GAYA 4HNNA 4Y96A 1NAL1 1XFBA 2BTMA 1R2RA 3NZ1A 3LB0A 1TB3A 5G2IA 4OU1A 1ZALA 3U2OA 1JVNA 4E2BA 3EB2A 1KV5A 4K7VA 1YXCA 3QQ0A 3SJ3A 3GR7A 1ZY9A 2V82A 3EKLA 3NR0A 3RFAA 1GPWA 4S1FA 3Q94A 4GRSA 3LRLA 3B8DA 5G2HA 2E09A 3NPXA 1TPH1 1GYLA 2RFGA 3P82A 3NQEA 3LHYA 2TYSA 5C55A 4RZ4A 1QOQA 2A1YA 3TQVA 1SFLA 1XBXA 2E5CA 3LM7A 5IM51 1I2NA 4LWWA 4O4VA 4O53A 3NVTA 3WJXA 5BOOA 4UMAA 1MEIA 3FEMA 4UFLA 5F2LA 1CX9A 4IMGA 3HIJA 2QCLA 1KM2A 3N2XA 1OX4A 4JIQA 3G0XA 1W5QA 2ABBA 4O13A 3S1WA 4YCOA 3GZ3A 2WNZA 3M47A 3W71A 3L21A 5K9XA 3TSBA 4MUZA 5I3KA 2A7NA 4WXZA 4MZYA 3G1YA 4OT7A 2WNNA 1JQXA 1SW0A 5AC8A 3GDMA 1SZFA 5DY2A 1DQWA 4R53A 1QAPA 2X16A 5G1YA 1VHNA 1VQTA 1W5MA 1P5BA 2G5WA 4NXSA 3BW3A 2WPBA 5SWUA 4DXVA 3KVLA 3T7VA 3QJAA 1AW1A 3O16A 1ZAJA 1F6KA 4BK9A 4UIOA 4HNVA 2QCHA 4QNWA 2LLEA 3WJZA 1XDLA 5KZDA 4TO8A 4XZ9A 1ZNNA 2V81A 4DQWA 1TV5A 3SGUA 2E77A 5EKYA 2J6XA 4JTKA 2TSYA 1ZENA 3NQ6A 1SO6A 1W3TA 5L6UA 1ONRA 4RXGA 1QO2A 2GQ8A 4LRTA 1P0KA 2A6NA 1ME9A 2CLKA 5KSWA 2ZDRA 4WQ6A 4MY9A 4K38A 5C2XA 2RDWA 5LZLA 1TTJA 1RR2A 2FLIA 3KVJA 2Z2UA 4MLJA 4K37A 1LBFA 2GUUA 5AFDA 3GXPA 5C54A 3W07A 4A22A 1AL8A 3W7CA 1AK5A 3UXAA 2VEMA 4YCPA 1WDWA 1F6PA 2V5BA 3P81A 3TNOA 4HN4A 3G8EA 4I7UA 5FEXA 4ZZ9A 3IEBA 1N7KA 4W9TA 4Z0JA 5CPOA 4N4QA 2CU0A 4HPJA 2WO5A 4NNBA 1FWSA 2WNQA 3L66A 3KRUA 5F2GA 3BPWA 3N9RA 3KVMA 1FCVA 5KZMA 3UWQA 4PL1A 4N9CA 1QOPA 4PFMA 4JTIA 3N3MA 1MO0A 1Q6QA 4G1KA 1OG0A 4GUHA 1XL9A 4MJMA 2QJHA 3GYEA 3BW4A 3QYQA 4H4IA 3GLCA 4N9DA 3G0SA 3W7KA 4WUIA 2QCDA 1KM1A 1LORA 3TC6A 3VE9A 3LTPA 1KM6A 2BLEA 2P0OA 3R12A 3UPWA 2A0NA 1VHCA 2Y7DA 4JDYA 1GG1A 4HSOA 4IJBA 1DORA 4LUJA 3THQA 3W1TA 4FHAA 5EBUA 4CCEA 3NQ7A 5DCEA 2C13A 1VLWA 8TIMA 2ISSA 1BTMA 3TMQA 2P10A 1FY6A 3R2GA 3HGRA 1ME8A 2G96A 3UZJA 5F4WA 3KAOA 3NQDA 3PUOA 1EWDA 3LX9A 4FNRA 4GNJA 3NOEA 1JR1A 3HF3A 4AF0B 1A5AA 1D3GA 4C1LA 2VFFA 3W1AA 3GR8A 4DBEA 5HR6A 1DV7A 3UD6A 1GEQA 4DO5A 3SR7A 1GYNA 3W7OA 5AC6A 1KM0A 1BWKA 2BSLA 2VELA 2FPVA 1PHQA 1SZGA 3QZEA 2GVJA 2QR6A 1C8VA 2ZCGA 3I6RA 3V75A 1EP2A 5AN7A 3QC3A 3LTYA 4O11A 1LRQA 1IXOA 3H54A 2O7SA 4GBUA 3DAQA 4FX8A 4BR1A 3TW6A 2NV1A 4JIPA 3SW6A 1VGAA 5I3IA 3M7WA 3UNDA 1SO5A 1W5PA 2OT1A 2WSRA 3NEVA 4GUFA 4UTKA 3NGJA 4MLRA 1ZFJA 5LNVA 4LV9A 2DZUA 2GJLA 3TR2A 4BF9A 3L2IA 4JTFA 1H7NA 2A6LA 5I3FA 3HG2A 1OYCA 3KRZA 1KFJA 2CLLA 3LI0A 2J27A 1LROA 3LCHA 1MSSA 4O10A 3D0CA 2Y62A 3FS2A 1CI1A 2ZTJA 4O14A 3M9YA 5AHLA 4MZ1A 2RDUA 1OF8A 1TPDA 5TQLA 3G8RA 2NLIA 1LOSA 3I68A 4JTJA 1V7YA 3DXIA 4QISA 2ISVA 4PA8A 4UXDA 1G4PA 1NF0A 1H1ZA 1U83A 4UNKA 3UWWA 3PC0A 3FFSA 4D2JA 3TIMA 2VXNA 4NJGA 1ML1A 4NX5A 4NUWA 4TMBA 3TQKA 1SUXA 3MWAA 1F76A 1T96A 1UUMA 2Q3RA 3IV3A 1R2TA 5AHEA 2ATMA 1WOBA 4Z08A 1TPVA 5KINA 1TV7A 4M6QA 2QCGA 2XN2A 5DBTA 4ICNA 5AYXA 1DKWA 2Y61A 2Y88A 5E1QA 4CNNA 4LS2A 4LT9A 2O7QA 1TIMA 5G2WA 3AJXA 5F2MA 2QUUA 2VFHA 3M44A 2AGKA 5CZ0A 2CLMA 2WJZA 3SIZA 3FA5A 2FB2A 3SFKA 3EWYA 1IXQA 1QWGA 1SW3A 5U7SA 4ZVJA 4LVDA 1SSGA 2QDHA 1L6WA 2VFIA 4P2VA 4O18A 1OYBA 2YPIA 2PCQA 1O5XA 4Y9AA 1EX5A 3EWXA 4JR5A 3CU2A 4GFSA 3GX9A 1KLYA 4X9SA 2ABAA 5AC7A 1S5VA 5AHMA 5AHFA 4O28A 1TPUA 3RU6A 3IGUA 4Z1CA 3PG8A 1AW2A 1WA3A 3LCWA 4XWUA 5HWMA 3L0KA 4RR4A 1AG1O 1E51A 2V8ZA 1VYPX 3IVUA 4OGZA 2XN1A 2YCEA 1DQXA 3R13A 1GTEA 2FDSA 4QNEA 1VC4A 1L2UA 3DBPA 4MY8A 2PRHA 1FWRA 4PL2A 1DHPA 2NWRA 3TU9A 1EP3A 5KTLA 3BGJA 1AMKA 3LHTA 1M6JA 4MIMA 3OBKA 1LZOA 3G24A 1JQVA 1TJRA 2CWNA 3B05A 3EX1A 4M6VA 1XBZA 1VCGA 4NQ1A 2QCCA 2YDAA 4OV4A 3TSDA 3B0UX 1LRTA 3W1NA 1WOAA 3PB2A 4JS3A 4EF9A 3ATYA 3CHVA 1GT8A 2ZYFA 3IIZA 2VFGA 4N9EA 4MKNA 4Q32A 3VFLA 2XFWA 1GVOA 4LS1A 1K8ZA 2DJXA 1OX4B 1UJPA 4C1KA 4UR7A 3W7PA 1FUYA 1WYIA 4FNPA 1HFBA 4N6FA 1O60A 3CM4A 3GNDA 1OFRA 4PH6A 4UTMA 3MMTA 5K2ZA 1RQEA 3W2LA 1WX0A 1I2OA 2Y7GA 5FF7A 3P62A 4FXRA 2V2CA 2VFEA 1TTIA 3YPIA 3P67A 4N02A 1QPQA 1AL7A 3C61A 2YW3A 3HGSA 3HGOA 3M5ZA 2NX9A 2OJPA 5HJLA 5AYYA 3VKJA 2H90A 3SI9A 1G4TA 2OZ0A 5D33A 2W6RA 4N6EA 5D30A 2C16A 3QMSA 3HBLA 3O05A 4ZMGA 3LBCA 3WK1A 1C9DA 1H51A 4TR9A 3G3DA 3NL6A 1B9BA 1K03A 5A8GA 2HS6A 3I7SA 2BXVA 1TQJA 3BG5A 1HO1A 5J5RA 5AHIA 4PC8A 4LC6A 1W5NA 3L5MA 1JCLA 4XKYA 1W1ZA 1EUAA 1HTIA 4DPQA 3W70A 3S5YA 4AWUA 2CZEA 3B0VC 1I2QA 3W85A 3CEUA 3UQNA 3P7YA 4ADSA 1GOXA 2GVGA 4PCFA 3C2OA 4NXKA 1Y0EA 3T78A 4EWND 1A5SA 4LY8A 5I3GA 3QEZA 4JYEA 3RLUA 3S6DA 4AAJA 3LCGA 5GVJA 4O52A 4RJEA 4MOZA 3LCIA 2BWGA 1TRDA 3GVGA 3HG3A 1EA0A 3W7EA 2QJGA 4Z0SA 2EPHA 3MYPA 3TV8A 1M5WA 3N19B 1RQBA 1OFPA 4Y8FA 2A7PA 2QCDB 2RHGA 4E0CA 2YZRA 3G1VA 3DFNA 2HSAA 3BGGA 3W75A 3G1XA 5H91A 3T4CA 1Q6LA 3PVFA 5D38A 1RQHA 4HT3A 3NO5A 1P0NA 3HOJA 4M6PA 3IIXA 4B5NA 1Z41A 3FKKA 2EKCA 4HSNA 1K8XA 5D02A 4UTJA 4J9JA 3W7DA 2ZRWA 2Q3OA 3N9SA 2EHHA 4ZQMA 1H50A 1PS9A 4LVAA 3IIOA 4LC8A 4YWIA 3JR2A 1DVJA 3DI0A 2VEPA 3IGXA 4RZ5A 4IPJA 2CZ5A 1WQ5A 2X1TA 1RVGA 3F4NA 3IIPA 2B7OA 3IVSA 2YXGA 1OYAA 4GUJA 3NL5A 4L4MA 1DJQA 1ZCOA 3P8JA 5D2TA 3MYOA 5FEPA 2ZQ0A 2JGQA 3NPVA 3C0JA 3LHZA 4Z1AA 3LCLA 4HNUA 3LCXA 4DEFA 1FXQA 3S5NA 4EF8A 2C18A 4JXCA 1LOLA 2CZDA 2J88A 1Q6OA 2NV2A 2X30A 1G69A 1VJIA 4UTHA 5MHBA 3NQ8A 1Z48A 2B0MA 3EWUA 3KXQA 1R2SA 3W86A 1XXXA 2DJLA 3O6CA 4EIVA 5DCBA 2WSYA 3QH2A 5HQEA 5K7JA 5EMUA 3MI3A 1QO5A 1FWNA 1IGSA 3CB8A 1H63A 5AYZA 3L67A 2OX1A 3KHJA 4K6AA 4RLIA 3B06A 2J9YA 3M0ZA 2ZRXA 4UNLA 1X6UA 1F5ZA 2W0UA 2IQTA 1B4KA 3MO7A 3EXTA 3VNDA 1BEUA 4NX0A 1J4EA 3CC1A 2E6AA 4JDBA 5D2XA 3M5YA 2Z6IA 1JUBA 1XCFA 1LP6A 4BWLC 2JKPA 4LRSA 4E38A 1SQ7A 4FEZA 1X8FA 2DZPA 4RXFA 2CLFA 3O1NA 1IXPA 3SZ8A 5CG7A 1OVDA 3W2KA 1T8XA 2NX1A 1TYGA 5FEWA 3MHFA 3G1DA 1W5OA 2WSQA 3NXFA 3FYPA 3T40A 2ZZ4A 1LBMA 4O4WA 4H6KA 3TAKA 4NJHA 4UMCA 1ZAHA 3B0PA 1OFBA 3ANYA 1TSIA 5K4XA 3BK0A 5HINA 1TTPA 2C14A 4QAIA 2PURA 2QAFA 4O19A 2QCEA 1L6SA 1YDVA 2ALDA 2Q8ZA 2OCZA 2Z0IA 4QM1A 3C2VA 3PM6A 2A85A 3PF3A 1OABA 3PSVA 3L0GA 3OEXA 3W7LA 4JTLA 1KFLA 5D2WA 4S2BA 4Z1DA 4DF1A 4GXMA 1YPFA 5I3JA 3NG3A 4DO4A 3TQ0A 1H1YA 3PWAA 1VCFA 2KZHA 1UBSA 1DBTA 4Z1BA 3R8RA 3DH7A 3GB6A 3S9YA 1J2WA 1G4EA 1I8JA 1OX5A 5LKYA 2Y7FA 4DF2A 1H7XA 3GAKA 2Y7EA 4BI7A 3G3MA 3M41A 3NQAA 4JICA 3B04A 4A2RA 1Q45A 3LHUA 3QPZA 4WY0F 1Z42A 2Z6JA 1ICSA 1OK6A 3DFTA 5BMWA 4CQAA 1OFOA 5CSRA 3MI2A 1TO3A 3W1PA 2YW4A 3G1HA 3S42A 2V0TA 1WBJA 4RX0A 5F1VA 3DHFA 4JX6A 2DZXA 3C6CA 3MHGA 4ZQRA 1ADOA 4K8EA 3W76A 1WXJA 3QMTA 1WAUA 3SGZA 2ZRYA 4LNYA 5CPMA 3LHVA 5K4ZA 3S5OA 5HMSA 4N9BA 3GNNA 4IGHA 1O4UA 1LDCA 1TRIA 3L0NA 3PY2A 3LLFA 4DF0A 1F2JA 4A29A 3S1VA 3DKLA 3S1XA 2NXIA 3DU0A 4O1CA 2AAMA 5I3HA 2FIQA 2YFOA 2A7RA 2A5HA 4O17A 3W7RA 1KV8A 2A4AA 3NAVA 5HWJA 3N2MA 3M16A 1G4SA 4ORIA 3HJZA 3NM3A 3KVKA 1LTDA 2D73A 3U6WA 5D32A 5DCDA 3TXZA 1RV8A 1FDYA 1W3IA 4BI5A 3STCA 3W83A 2R14A 4M7TA 1VYRA 3IGSA 3P5YA 3CT7A 3OVPA 4ZQCA 3RK8A 3HG4A 2PRLA 1K7XA 5E0KA 4AHOA 4AHQA 1L6YA 1NF7A 3PSWA 2J9ZA 3NQGA 3ZFHA 2H3DA 3TH6A 4FXSA 3VI2A 4ZQPA 2QAPA 4QQ3A 3HPXA 5L9FA 4AMAA 3T44A 2QKFA 3EKZA 2ZRUA 2A21A 1OFQA 3FLUA 1KFKA 2QUTA 3NDOA 5AHNA 1OF6A 4IOTA 3DFOA 1FX6A 2VFDA 3C56A 3CEPA 1ZAIA 1RD5A 3P8IA 3PBWA 1HUVA 4IMEA 5LHFA 2DZTA 4GC4A 2QF7A 3W74A 2CW6A 4LU0A 1RZMA 3MI6A 4NNAA 1B57A 1IF2A 3LV5A 1EIXA 1EEPA 1DL3A 1LRNA 1L9WA 1UCWA 3WK0A 2FPYA 6ALDA 4ZQNA 1WBHA 1W54A 3W7NA 4JTHA 3F1QA 1QR7A 3S0CA 4XKYB 4EOUA 3L5LA 2AQWA 5FF2A 3G1FA 4IXXA 2X1SA 4YL2A 4CNOA 3BLIA 4AXKA 4DPPA 2NZLA 4GWEA 3IRDA 1QPNA 1SO4A 4MJZA 1PCWA 4WOZA 2V5LA 3TMLA 1DJNA 5BW6A 2I9EA 1Z44A 4RZ6A 3TE9A 2CLIA 3W1RA 5LNWA 1PCKA 3LGEA 5TBOA 1AW5A 4UFHA 2C1HA 2DU2A 2F84A 3ABQA 3HG5A 3QW4B 1JUEA 2X1UA 1I45A 4HIBA 3STFA 5K9CA 1XUUA 4Q33A 2JBMA 4N2YA 1IIGA 1P4CA 4UUIA 4K8HA 1EUNA 3RLVA 3PAJA 3UY8A 3WJSA 5CZSA 4KWVA 4OWGA 3EEGA 3STEA 2WOQA 4TIMA 1GQNA 3LLDA 3FJ6A 3LXAA 4QJ1A 4CQ8A 4O1DA 1YTKA 3Q37A 3GDTA 1KM3A 4RKAA 1V5XA 2DORA 1YDNA 4MVAA 4IMFA 1D3HA 3UWYA 3OA3A 1MEWA 3HO8A 1YADA 3L68A 3I65A 5G1TA 3CLMA 1W56A 4RV8A 3BO9A 3BLFA 5A5WA 3A21A 3NYZA 1OFEA 1TCDA 1H7PA 2P1FA 3H53A 2B7NA 1QCWA 2E5BA 3LRMA 4O15A 4O54A 3HMJG 1JUKA 2GVLA 5F2IA 3LBMA 1GVQA 3GXTA 3RF9A 1TPEA 2FB3A 4AHPA 2Y63A 5D04C 2B7QA 1KLZA 3E49A 3N14A 1S5TA 1FWWA 4X22A 5D2YA 3GK0A 3E96A 3W2MA 3OG3A 4JTGA 4JY9A 3MUXA 3MP5A 1N8FA 5E93A 3F03K 1FXPA 4CQ9A 1A50A 1BKSA 1JCMP 3CQ0A 1YTDA 3W2JA 3P80A 3FOKA 1RPXA 3DHDA 3M6YA 5DXXA 2ISWA 1K7FA 3O15A 4IQLA 2WV8A 2TRSA 4NVTA 3DZ1A 4LVFA 4O57A 1FCUA 2FFCA 4UR8A 3BARA 3V1PA 3DKJA 1TQXA 4TMCA 2ZFAA 1SU5A 4XBSA 3N73A 2Y89A 3C52A 3L5AA 1GJPA 3ABSA 2UV8G 1K8YA 2WKJA 1I2PA 3QW3A 2DP3A 1H61A 1XDMA 1QMLA 3U8GA 1KFCA 5FI8A 3W23A 1QPRA 2QDGA 4BFAA 1LOQA 2R8WA 5HR7A 3PBVA 5KMYA 4ML9A 4U4MA 4QIUA 1HO4A 4ADUA 1R30A 4XBKA 2RKXA 1VCVA 4JEQA 2ZZ3A 1LCOA 3QF0A 4PTNA 5C6MA 2ZA3A 4PODA 1O94A 1F05A 4OBTA 3EX4A 4ONVA 1SR9A 1TTQA 2FJKA 1MXSA 3I7QA 1TPB1 2HS8A 3EX3A 4I9AA 4IUOA 3MP3A 2E6FA 1YXYA 2C0AA 2ZZ2A 1KA9F 4JN6A 3NL2A 1JJKA 4MY1A 1GG0A 3NQVA 2QCMA 1HL2A 2NXHA 2BX7A 5G4WA 3CTLA 3ZS4A 4I7WA 3TROA 3W7MA 3OVQA 1FCBA 1NEYA 1KM4A 3JRKA 2GOUA 3ABOA 1W3NA 1XBYA 3BG9A 4XUGA 3LTSA 2YGYA 2ZZ6A 3IVTA 4O16A 4JY8A 3P5ZA 2V2HA 1YLVA 3GXNA 4WD0A 3DFPA 4AWSA 4CNPA 3NZRA 3GDKA 1D9EA 1QNVA 2YX0A 3M5XA 5G5IA 2X1RA 2OT0A 2G97A 3A9IA 3NPWA 3TFXA 4IMDA 2NXGA 3TW7A 3THAA 1SZNA 1TREA 1KTBA 4FNQA 1SO3A 4NZJA 1B4EA 3QSTA 3A5FA 5HUPA 1LLWA 1I2RA 3LHWA 3UPBA 5LGZA 4NT0A 2PE4A 1S3HA 4JGDA 4JX4A 3GDLA 1CW2A 3KRSA 3STGA 3W73A 3TA6A 3I7RA 1GVSA 3W7IA 1ICPA 3A24A 1O95A 5CKSA 1S5WA 3RMJA 2YYUA 3WFAA 4KWWA 4FNUA 5EA9A 4X3ZA 3MBFA 2R94A 1F7BA 4YMZA 3B03A 1MEHA 3LERA 2OMAA 1W37A 4NJJA 4KFOA 2PRMA 1MZHA 5EY5A 3CIWA 1NSJA 3LOTA 3NNTA 3RNDA 3G0UA 4IMCA 4A2SA 3DFQA 4JTTA 3DGRA 3WJWA 4FNSA 4E2DA 2I14A 3HQ1A 3HGJA 5FESA 3CWOX 3O06A 2V2DA 1FBAA 4O1BA 4WY0A 1VYSX 1XBVA 1GVRA 3TDFA 5D37A 1M7OA 2NUXA 5TIMA 4UCGA 1KFBA 3HPZA 3LCFA 3T55A 4OE7A 4UTLA 3EXSA 1KTNA 1X1ZA 1X7FA 4JX5A 4IX2A 4UTIA 3BG3A 4CCDA 2C19A 2NX3A 3W87A 4DELA 2B7PA 4KFPA 3OHIA 3CWNA 4AEOA 5LHEA 5F4SA 5FF3A 3G1SA 4UFIA 2ZA2A 4TU1A 3W9ZA 6TIMA 1M7PA 1LYXA 3PULA 4JNMA 4ZL1A 4JYFA 4NU7A 1H62A 3TK7A 1NVMA 1TJPA 1ALDA 2C6QA 3W1UA 4JTSA 4R33A 1R47A 3W1MA 4GE8A 1WV2A 1U5JA 4Y90A 5IBXC 1TV8A 3PUEA 1O5KA 1OJXA 4MPQA 2YYTA 4O0ZA 2JKEA 3N34A 3M43A 3MJYA 3Q58A 3QRHA 4O1AA 2F7FA 4UFJA 2VEIA 1G6CA 5C5YA 1LBLA 3E9AA 5DLCA 3UXDA 5K9DA 4LS0A 1XM3A 3W84A 4WXYA 2Q8LA 2H6RA 1JCYA 4HPXA 1UASA 4CCCA 1TMHA 1PV8A 2Z1BA 3ELFA 1EPXA 2NWSA 3P84A 3ZWSA 1YYAA 4BWLA 2H3BA 4XTIA 5FF0A 1EWEA 5DN1A 4AB4A 3G1AA 3NM1A 3QMRA 1FWTA 4DO6A 1YDOA 1KFEA 4WOQA 4JTUA 3UWVA 1G7UA 4M19A 5CZJA 3KFTA 3KOFA 1SW7A 5IBXA 2TMDA 2ZA1A 2VENA 3NQCA 4UFKA 3O8AA 4EVZA 4YLWA 1BWLA 3WK2A 5EPDA 3VCRA 4H3DA 2ZRVA 3HPSA 3W6YA 2DZVA 4U28A 1JULA 2ATSA 2HTMA 3TJXA 5U4NA 1H7OA 4IPIA 1G67A 4MFDA 5J5DA 4GUGA 1R46A 1VZWA 2FQIA 2CLHA 3GKAA 4HHPA 3UZ5A 5DXYA 3LXBA 1GTHA 5CPLA 4NNCA 1Q3NA 2QUVA 1VH7A 4FIRA 3NL3A 4K39A 4O8RA 3PG9A 4FX7A 2E68A 4JYDA 3LDVA 2QCFA 2E1DA 3NQMA 1C29A 1PHWA 3W7GA 3G18A 5F4XA 4LW7A 1VS1A 1QPOA 3USBA 1VPXA 2TPSA 3C3NA 3E12A 4AWTA 3A5VA 1YXDA 1A53A 4UTUA 1K3UA 3A22A 1JCXA 3SSJA 4ZQOA 4POCA 5LNUA 4WX2A 5HWNA 2E6YA 1I4NA 3TFCA 1Q6RA 1H5YA 2ZZ5A 3PS7A 3EX6A 2ZZ1A 3UYCA 1LLZA 4CLMA 4FB7A 2WQPA 2CFFA 2QJIA 5F1UA 3W88A 3S1UA 3EXRA 1VRDA 1J5TA 3TSMA 1EB3A 1ICQA 1TPC1 3OVRA 3PR2A 3VE7A 4OQVA 4R34A 3ZR4A 1A5CA 3CPRA 1KBIA 3MHUA 3EX2A 2VKZG 3PBUA 2RH9A 3OIXA 4YXGA 2QEZA 2Y85A 1F74A 2GQ9A 3QFEA 1G7VA 2C15A 3ZWTA 2G95A 2W79A 1JRBA 1P1XA 1H7WA 3TAOA 3ATZA 1H60A 2JKAA 4Y6GA 4X2RA 3O07A 3QQ1A 1JCNA 2NUWA 5DBUA 3FJLA 4JD4A 1SPQA 1OK4A 1KM5A 2B4GA 1W0MA 4HNTA 1KBJA 2GPTA 4FX6M 1OFAA 4FNTA 1PL9A 3TX9A 5KITA 2V9DA 3FIGA 5AOUA 3BW2A 1H7RA 3UWZA 4MYAA 3KX6A 3W7JA 1X1OA 3TKFA 3GIYA 3PBYA 5BMXA 5HNRA 5LGXA 3C2EA 3LXCA 3O6DA 2ZBTA 3W3OA 4TX9A 4N4PA 2GJNA 4LUIA 2X2GA 2ZZ7A 2J24A 5KZEA 2XN0A 3CIXA 2GQAA 4UFMA 5DY3A 1F73A 1TPWA 5CSSA 4LV4A 2YFNA 4XTDA 5FF4A 3SECA 3TXVA 4OHQA 4M5PA 2EF9A 1OFDA 5LNSA 3MP4A 4O50A 3LRKA 4WJEA 4RCXA 1KTCA 3QSRA 3BVJA 3M5VA 3W72A 3ABRA 3L65A 5EL1A 3G22A 3AO0A 5CGQA 1YTEA 1YPIA 3IIVA 3W7QA 3O6YX 1GZGA 1THFD 3C2FA 3LI1A 1OHLA 4A21A 2CZFA 1GWJA 4MYXA 3PUDA 4LVGA 2VEKA 5CZTA 5K3VA 1KW1A 5BRBA 4R7JA 4AF0A 4KKXA 2QCNA 2Y70A 4K7YA 3W1LA 2EGZA 4JTEA 3P74A 3P60A 3BV4A 2ZTKA 4LTSA 3W22A 2YSWA 4UTTC 5LNRA
chains in the Genus database with same CATH superfamily
1QI0A 1SZEA 4AD2A 4ZGYA 1VFLA 4D6JA 3W2UA 3QFWA 4NJIA 4O0KA 4H6EA 2V5CA 3DENA 2Z1KA 3VD5A 1QOXA 4L9ZA 4CU8A 2BDQA 2J9XA 1NFBA 1SSDA 3SY5A 1PIIA 1JDCA 4BA0A 3UWEA 1GCYA 3IJDA 3S3GA 5FA5A 3NPUA 2ADAA 4X63A 2Y6ZA 3P6LA 1FCQA 3VFCA 2I1OA 3EDFA 4LFYA 1AODA 5D09A 3K30A 5E6YA 3U7BA 1ZJIA 1XCXA 4I7VA 2VZUA 1QHOA 3UY7A 1F9CA 1YBQB 4D6CA 3E0IA 3QPYA 4F2BA 1JRCA 4H00A 4HHLA 1LT7A 4GLEA 2J77A 1XI3A 4K36A 2A2IA 3C2RA 3G6MA 3L9CA 4QRNA 1PWMA 1XWYA 1JAEA 2D24A 4LX4A 4FO4A 3CQIA 3D47A 1A3WA 4F0LA 5C9UA 1TA3A 4NAEA 1V6XA 4JOMA 4MFEA 1QPKA 2X05A 4PUNA 1R7AA 5FJTA 2QIWA 4Q4RA 3GKFA 3KOZA 4OV9A 3TTEA 1PTGA 5CC5A 1LWHA 4UTWA 3ZXWA 3O63A 3AXKA 4AZ6A 3W24A 2GUBA 2YL8A 4L61A 4Q3MA 1J0YA 4ALDA 3EPMA 3GVQA 4H7ZA 3CUJA 5KEZA 5LSMA 1ZHAA 2YR1A 4DLFA 1GQIA 1UWSA 4GCAA 4C6BA 4DVOA 4DAFA 5D03A 2PC4A 2FPTA 4GJ1A 1KBKA 2WMFA 3H2NA 3M0YA 1PUDA 1R3SA 4OUEA 2FTPA 2H8ZA 4BI6A 4L4LA 4Q4MA 1Q65A 3HB9A 2DZWA 4K2SA 3JS3A 3S6TA 2PLCA 3UXKA 3QTGA 2J47A 2Y8UA 4IXHA 4FS9A 1U1JA 4KFNA 3GAYA 3AHZA 4Y96A 1NAL1 3EDDA 1R2RA 1TB3A 1DE5A 1ZALA 4E2BA 3GC5A 3ME3A 4QCFA 3CH0A 1KCKA 1KV5A 2XYLA 3V4BA 5CSUA 3TTQA 5C9WA 5M03A 1CB7B 5A2CA 4FMVA 4JBRA 1V03A 4I90A 5A6LA 4JTQA 4S1FA 1JYVA 4X60A 2XIMA 4E2VA 1VPYA 5G2HA 3VGBA 1TPH1 2RFGA 3B8UA 4RDYA 2P8BA 2A1YA 3LM7A 4RNFA 1GOKA 4AXNA 1J10A 4LWWA 3P0WA 4O53A 1V3MA 4UMAA 4AZBA 2XSAA 1XSJA 3FEMA 4UFLA 3E3HA 4IMGA 1KM2A 1UKSA 2BV9A 3RX4A 1C92A 3KCJA 4JIQA 2G8ZA 1W5QA 4Q6JA 3GHTA 2OGJA 4YTRA 3JVAA 3G1YA 2DW7A 3C0LA 3TLLA 2WNNA 1JQXA 1SW0A 4JNZA 1PTAA 1DQWA 4R53A 1RLDA 2ZE0A 1VHNA 3PZOA 1XS2A 3W53A 4IGSA 4DXVA 5A6BA 1BXCA 4C6OA 2VHLA 3KVLA 3O16A 1ONEA 5BWFA 3HU7A 2X09A 4UIOA 1EJ7L 2LLEA 3UG8A 4AD4A 1TV5A 3SGUA 5EKYA 4N7QA 3WDHA 3S9IA 1SO6A 5L6UA 2INFA 4RXGA 1QO2A 1M3UA 4P8XA 4DB7A 5C2XA 4KESA 2FLIA 3FEQA 2CHNA 2J7FA 1V51A 3K13A 2Z2UA 3GTNA 4B4HA 5AYIA 2GUUA 4WVXA 1Z32X 5D9NA 3W07A 5C9ZA 1ZL1A 4AEFA 4LF2A 3W7CA 2VCCA 4LQ1A 3CHFA 1WDWA 1MI3A 4ZOCA 1RY8A 4H6RA 4JTAA 1AJ2A 3G8EA 4KS0A 1N7KA 3MKCA 1EZWA 1K9FA 2YCLB 4W9TA 1TR9A 2NV9A 5CBBA 4F0SA 4NNBA 3WQCA 4XZNX 1OY0A 3H4XA 4KWUA 1TJ1A 1Y65A 1CLXA 3KRUA 5F2GA 4DWSD 1WE5A 2QDDA 5KZMA 1PXGA 1QOPA 1XYLA 4R27A 1MO0A 1O12A 3FV9A 2GGGA 3UJSA 3PK7A 4AG0A 3WEZA 3VC6A 4RDWA 4WUIA 3CAVA 2BLEA 3PJWA 1JD7A 3FW6A 3T9PA 2EPNA 2PCEA 1GG1A 1DPMA 4LUJA 1FWIC 4FHAA 4GINA 3IAPA 1BXNA 1AJZA 3CZ8A 3KZPA 8TIMA 4LAKA 3HGRA 2VD9A 5F4WA 1OBAA 3KAOA 4FNRA 4AF0B 1TKKA 1XW8A 3UYIA 5C70A 1HVXA 2VFFA 3WLNA 5HR6A 2QGHA 3TN5A 3WD4A 3UD6A 4DRSA 1CXFA 3DESA 4FLQA 4DBWA 1GJWA 4GKLA 4O0QA 3MMDA 4XUYA 1A47A 3R8GA 3V75A 1SFTA 5AN7A 5FSEC 1EDGA 3QC3A 3LTYA 4O11A 4RE0A 1PEZA 4GBUA 3DAQA 4FX8A 3V1HA 2NV1A 4EE9A 1W1A1 1VGAA 1XIIA 3UNDA 5IOBA 4MLRA 1ZFJA 2CCRA 4M1RA 5LNVA 3VKKA 1Q8AA 4LV9A 2GJLA 4WK9A 1FTXA 4BF9A 1DWJM 2Z1SA 3WUEA 1OYCA 2DH2A 3LI0A 1LROA 4GIYA 1MSSA 4O10A 1HF6A 1S38A 4JIIX 1P6WA 1FP9A 4CQBA 3M9YA 3SUWA 5AHLA 5A8QA 2RDUA 4MADA 3VINA 2NLIA 1LOSA 4XSLA 5BXTA 1V7YA 3WH9A 3AYTA 4PA8A 1H1ZA 3WYZA 5BOFA 1IEIA 3LPFA 1SFSA 2ACRA 2CWXA 2XGIA 4TMBA 4RNIA 2ZUSA 1TA3B 4NAEB 1TWSA 4ZFCA 4UQBA 3SADA 1G01A 3IV3A 3SUTA 3NGFA 1GQJA 5KINA 1PKMA 1JEZA 2QCGA 4DJDD 5E5CA 2OLHA 2HEJA 3TW9A 2Y61A 3HMCA 2Y88A 3MUCA 2PP1A 3MSDA 4PUUA 4LS2A 5EMYA 3GHUA 5AVHA 2O7QA 3OOQA 4PTDA 4WHBA 3VGHA 1BSLA 4MWAA 2AGKA 3MSGA 2AQVA 2Y4SA 3E5PA 2WJZA 3FA5A 2WCAA 4LY4A 4X0VA 2ACQA 1QWGA 2YA2A 3FJNA 2BG5A 2DT3A 2EBNA 2QDHA 4MNKA 4C6JA 4H7CA 2CEQA 2BXYA 2F6XA 1E6RA 4QE5A 1M68A 4X9SA 1HKMA 2KAUC 2XHYA 3LA4A 4B4FA 1NIUA 4O28A 1TPUA 4X9YA 4H9YA 3RAOA 1XICA 3HTWA 4QG9A 4Z1CA 4J35A 2DQXA 3ONCA 3PG8A 1AW2A 1IV8A 3BAXA 4XWUA 5I24A 4RR4A 2J7CA 3GTHA 4QE4A 4FR6A 1GOWA 4F0HA 3R13A 3ONBA 3CT2A 2FDSA 2JEQA 2XIIA 4F3HA 4NYUA 1BFNA 1DHPA 3TU9A 3ITVA 5KTLA 4J5NA 1ZTVA 4MIMA 5EGRA 1XH1A 3O0FA 3OBKA 4QG6A 3KDOA 4B16A 4DJEA 3PZUA 1R0MA 3EX1A 3TSDA 3CHVA 3LNMA 4N9EA 3O7UA 4MKNA 4C91A 2XFWA 5A69A 1E0TA 1K8ZA 1NOWA 1MUCA 2VDGA 1NWTA 1UJPA 1LG1A 4C1KA 3W7PA 1FUYA 4GJJA 3W00A 4WIWA 1HFBA 2OXNA 4PH6A 4UTMA 5K2ZA 1WX0A 4GYPA 2PD9A 3HQNA 3P62A 3OLEA 2V2CA 1TTIA 4JZ5A 4N02A 3A64A 2E9MA 1OD8A 3ZJ6A 1PDZA 3M5ZA 4XZMX 2NX9A 3EWDA 4KGLA 5HJLA 6CGTA 1V93A 5CAHA 3S47A 4R3UA 5EMKA 3B8SA 2W6RA 5D30A 4G7EA 1MWOA 4ZMGA 4G9PA 2PDFA 3T0TA 4I9JA 1XHGA 3I7SA 1JXKA 4LYRA 1TQJA 3QN3A 3ZJKA 1Y5WA 4KCVA 3V0SA 1M41A 3XINA 5AHIA 3ZSSA 3CWHA 3OZOA 1HL8A 3L5MA 1EUAA 4D6HA 4DPQA 3S5YA 3LGGA 3CEUA 3GNXA 2VC9A 1HVQA 3QR3A 4CD6A 1Y0EA 1BQCA 4EWND 2A3AA 5I3GA 2W4XA 4AAJA 5EB8A 4O52A 5DFAA 1RJRA 3I3EA 3FYYA 3NTYA 1WO2A 2R24A 1VEMA 1SGJA 4PCTA 1V0KA 3M0VA 4MNMA 4Z0SA 3A47A 3NSNA 2VNCA 2BOGX 2VWSA 3SCOA 3TV8A 3VMNA 1KGUA 4E0CA 2HSAA 3H12A 3G1XA 3W28A 4IGNA 2W66A 1Q6LA 3WNKA 3GW3A 1RQHA 1V6VA 3NO5A 1P0NA 3HOJA 5H1WA 1QTWA 2F2HA 1K8XA 2H9AA 3M0IA 3HV8A 3WLQA 3BCFA 3MSYA 4ZQMA 9XIMA 2PTWA 2OR2A 1DWIM 3WQDA 2GJXB 3WDIA 4FXFA 1DVJA 2FTYA 5A2AA 2X1TA 3MKVA 3FAWA 2GSJA 3F4NA 1H4PA 2DIKA 2J25A 3ABZA 1Q5MA 1UHVA 3NL5A 1DJQA 1ZCOA 3P8JA 2POZA 1ADDA 4FA3A 5C7VA 3VYLA 2JGQA 1QNQA 4CU6A 3C0JA 1FWAC 2XPKA 5H8UA 1S46A 4W7VA 4DEFA 2JALA 4EF8A 2C18A 2J8FA 4OZOA 5BROA 1G69A 3GYCA 1XGEA 3NQ8A 4DNHA 1Z48A 2B0MA 3EWUA 2FGLA 3NYDA 1K1DA 4JKKA 2ZXBA 3O6CA 1XIEA 5DCBA 4EIVA 2WSYA 1CGUA 2PDJA 5EMUA 3MI3A 1IGSA 1TJ2A 1CGXA 3B06A 4JPGA 3VOCA 2IQTA 1E0WA 3RPDA 3EXTA 3WNPA 3VNDA 1BEUA 2FHCA 2D3LA 1V6WA 1VB9A 1HJQA 3N12A 2CBJA 1JUBA 1LP6A 4Q8WA 4FEZA 4RXFA 2CLFA 4E3VA 1IXPA 2DUAA 3MS8A 1XIDA 4KIRA 4IFKA 5H8PA 4HZMA 4OBRA 4XB3A 2PBOA 5H6HA 3TAKA 1ZAHA 3AROA 3ANYA 1TSIA 5K4XA 4BS0A 1TTPA 1E9IA 3G6LA 3CL6A 4O8AA 1L6SA 2Q8ZA 3E2SA 2XGZA 1J9YA 4QM1A 3C2VA 2IS7A 4EPKA 2A85A 1F4AA 3L0GA 3JZEA 3OEXA 3WH5A 3T0AA 3QXBA 4MWAB 1XCWA 3BICA 2HE5A 4DO4A 3TQ0A 1H1YA 2FGBA 1DBTA 2Z1VA 3KOWA 3S9YA 2WMHA 1I8JA 4ZSUA 1OX5A 4DF2A 5I0DA 3EYPA 2Y7EA 3H4WA 3OGVA 1FWCC 3KBSA 5D4YA 2XG9A 4WY0F 3HA1A 4A3HA 3WEOA 4C6EA 1GKRA 1OK6A 4CQAA 1TO3A 4F9DA 1VEOA 4JHZA 4RX0A 3AJ7A 1DTUA 4GHRA 2OLAA 3C6CA 1MQPA 1QBBA 3EOOA 1GVYA 1S2CA 1WXJA 2ZRYA 5CPMA 4LYKA 3LHVA 3SCQA 3GNNA 1HJSA 1W1B1 2PWFA 1P48A 1UD8A 1TRIA 3BOXA 3AICA 3LLFA 1C7SA 3S1XA 5JQ9A 2GZXA 2AAMA 1QI4A 3W7RA 1KV8A 3A4WA 2A4AA 1IR2A 1G4SA 3ANVA 4ORIA 5M5DA 3NM3A 1VAHA 3G77A 2ZWYA 2D73A 3U6WA 1GONA 5DCDA 3TXZA 1FDYA 2FJUB 5MF5A 2PDLA 1GORA 2P0IA 3OPSA 3R58A 3CT7A 3VZZA 3IJ8A 4ZQCA 1NWSA 3UFYA 4IPLA 1B3XA 4AHQA 4Q8UA 3GDBA 2J9ZA 2VTFA 2H3DA 4AZ5A 1VIWA 3N25A 3W37A 4H8VA 5DT5A 1WNOA 1P1MA 4H01A 3NURA 3CAQA 3GU2A 2OSYA 2CPUA 2QPXA 7XIMA 2CIPA 1RH9A 3GH5A 1M04A 4IOTA 3OBEA 4ZBCA 1ZAIA 4G7EB 4GISA 3RM9A 2DZTA 1R3VA 5DRIA 3S83A 1CGWA 4HCHA 1V3HA 1B57A 3S9ZA 2MANA 4JQAA 1UCWA 1J2BA 1H5VA 1W54A 4Z2KA 3F1QA 5FF2A 3LZ5A 1G94A 2X1SA 3BLIA 1YRRA 4GWEA 4MJZA 4D9PA 3E2QA 1UD6A 3OP2A 4WOZA 2V5LA 3MMWA 2I9EA 3CMJA 4JTRA 4URIA 2CLIA 3BOLA 3W1RA 1QW7A 5LNWA 2HVOA 3S6OA 5TBOA 2DGAA 3V18A 1AW5A 3AALA 2C1HA 3PFRA 1F07A 3HG5A 2WPGA 1JUEA 4S3CA 3STFA 3A4AA 4N2YA 1XLBA 3KTXA 1IIGA 1P4CA 4J4KA 3GNOA 3UY8A 2BY3A 4KWVA 5LIKX 3CHEA 2WHKA 1GQNA 4DHGA 1MW1A 1R3RA 3LLDA 4AZ7A 3FJ6A 4ML4A 4QJ1A 1YTKA 2WJDA 2BMBA 1JDFA 2R1LA 3D3AA 1KQYA 5G1TA 3PANA 3B40A 3CLMA 1ISZA 5A5WA 3WG6A 2EPMX 1UJQA 2H9AB 3NYZA 3NSXA 2P1FA 3OZYA 1QCWA 2NQ5A 3GXTA 4XIAA 2HE8A 1TPEA 1SJCA 4AHPA 1ZBKA 3OZMA 3QOKA 3BAWA 1KLZA 3E49A 1FWWA 4F9JA 3GK0A 5BCAA 1UZHA 1YQ2A 3NEHA 3OG3A 3MP5A 4PFHA 1N8FA 3USZA 1FXPA 1BKSA 1OCQA 1NU5A 4QX4A 3CQ0A 3K2GA 1BSIA 1CGYA 3FOKA 3M6YA 2WSPA 1W9PA 1CECA 3KL5A 5DXXA 3O15A 4KETA 4J3TA 3VX0A 1CNVA 4NVTA 3SSZA 3DZ1A 3LEPA 1KRMA 1ESWA 4ECLA 2FFCA 5I07A 1TX0A 3OG2A 1BWVA 3LGDA 3DKJA 1TQXA 3EB3A 2CHRA 4GPNA 3N73A 3C52A 4B9YA 4GG9A 2W61A 1U5VA 1BTCA 4AD0A 3ICJA 5E70A 1L0PA 2UV8G 5LXEA 3NIYA 1XDMA 4RW3A 3U8GA 1KFCA 4PBFA 3R6IA 3WQVA 1LOQA 2FVKA 2PF8A 2R8WA 5CZKA 1NP2A 1PWLA 3I3DA 4ADUA 1R30A 2JF7A 2RKXA 1FH8A 1XG3A 1MQRA 4RW5A 1LCOA 1MRAA 1F05A 1SR9A 1TTQA 4HJWA 1UR1A 3WBXA 3H22A 2J7BA 1NELA 5FD0A 4IFKB 5HMDA 1R3YA 4JN6A 4AUBA 3CS2A 3EOUA 1EXPA 1GG0A 2QCMA 1HL2A 3UT0A 4BKNA 5JXQA 1GKPA 3N04A 3TROA 5GJPA 1NEYA 4HA0A 4F66A 3ZT5A 5A8PA 3VPLA 2PDCA 1A5LC 3AYSA 2O9OA 2YGYA 1HXJA 2SFPA 3IVTA 4HTBA 4JY8A 3WFLA 2V2HA 1YLVA 3H2OA 4JL1A 4LBSA 4WD0A 4WKHA 1QNVA 3M5XA 2WWDA 4H8HA 3A9IA 4JQ2A 1TELA 3TW7A 1SZNA 2VUNA 2IKHA 4M56A 5RUBA 1KTBA 1B4EA 3QSTA 1Q6GA 5HA7A 3LHWA 3WELA 4FOUA 1ITUA 4IIHA 2PE4A 1S3HA 2EKGA 5CLWA 3WBAA 1NARA 4JX4A 1ZJHA 3W73A 2O9PA 2VC5A 1ICPA 1X6NA 1O95A 3KBMA 1LWIA 1CLKA 3WFAA 4KWWA 4A4AA 3QLDA 1W32A 2QULA 2R94A 1F7BA 3B03A 3CPUA 1MEHA 4KEVA 2OMAA 4NJJA 4KFOA 1I75A 4GH1A 3LOTA 3G0UA 4A2SA 4JTTA 3DGRA 3P3BA 2HROA 2G3MA 2BHUA 4YVPA 3VTRA 4E2DA 2ACUA 3CWOX 1JDEA 4KF1A 4WRHA 2G3NA 3NDZA 1NDVA 1YNYA 1ZBCA 5D37A 2B31A 1DIOA 2NUXA 5TIMA 5A6SA 1OIMA 2PDKA 2VX4A 3T55A 2XH2A 1S1RA 2Z7KA 4UTIA 4PRRA 4IP7A 2P88A 4CCDA 2C19A 1JZ5A 4QEHA 3REQA 2INZA 4YWSA 3WL0A 3H4GA 5LHEA 5F4SA 3G1SA 1UR4A 4TU1A 1WKDA 1M7PA 3PULA 4M3PA 4ZL1A 2C6QA 3RGTA 1ECQA 2PS2A 3EZ4A 4AD1A 1R47A 3EWCA 1WV2A 1U5JA 3A9BA 1H1NA 4Y90A 1EJXC 3PZGA 3N4AA 3PUEA 2YYTA 1UKOA 3B9OA 3M43A 4J3XA 4M8UA 4O1AA 5AZ1A 3CXOA 1ZZMA 3HURA 1UBPC 1W1IE 2F7FA 4X2PA 1G6CA 1LBLA 3E9AA 4INFA 4RNJA 4WXYA 3KCLA 1UP3A 1JCYA 4IFRA 4FXJA 4S39A 3L4WA 5DEZA 3SCTA 1VP5A 3AIQA 3WUFA 3UR5A 1YYAA 4BWLA 4PCNA 4Q7IA 2H3BA 1DE6A 3G1AA 1K4HA 1KFEA 2CKRA 3N1AA 2OZ8A 3BTNA 2CBUA 4B2DD 1G7UA 3M0LA 2PGRA 3WLTA 1YE4A 3F7JA 4PBGA 3SRHA 4YLWA 5C71A 1YE6A 4RE3A 1QNSA 1MW3A 4QJ3B 5HAOA 4U28A 1V8EA 1H7OA 1LL6A 4IPIA 2QS8A 4GUGA 4HZ7A 1W3HA 2CLHA 3GKAA 3QZ6A 1TX2A 2DSZA 1XINA 1GTHA 1JCTA 1Q6CA 4NNCA 1QK2A 4FIRA 1VH7A 3RILA 4K39A 3IJ6A 3F5KA 5M3WA 2E1DA 4I9TA 4WDWA 3BQ6A 2E8YA 4OKDA 1ADSA 4J28A 4AWTA 4QLKA 3N4EA 2WZTA 3A22A 1JCXA 3H7VA 3H2FA 2NLYA 3D6NA 3DYOA 4CD4A 1OC5A 4LNCA 1H5YA 2ZZ5A 3PS7A 4HSHA 4AZGA 3GWQA 3N6HA 4TV5A 3SRKA 2Z25A 3W88A 3S1UA 2WC7A 3EXRA 1C91A 3DG7A 1J5TA 4V33A 1ICQA 1TPC1 3DC0A 3EDKA 4IICA 4EPEC 1M53A 4OUIA 2PDHA 1KBIA 2W63A 4Y9PA 2VKZG 1QRQA 4GYKA 3PBUA 4H83A 5DQPA 2RH9A 4P8VA 4JEJA 1YX1A 1FWHC 1H11A 2YLAA 2Y5EA 3QFEA 1E0UA 1G7VA 1N8WA 1CT5A 2C15A 3IJIA 1E4MM 2YA0A 1JRBA 2FZMA 3I3BA 1P1XA 4YHEA 1PB0A 1EC9A 1H7WA 3QQ1A 4FAMA 3FJLA 3LPOA 4IQDA 4Q4SA 2PTYA 1KBJA 4L6OA 4YNGA 2GPTA 3EAUA 4TV6A 1FVPA 3MT1A 4JHOA 1JPIA 1AUSL 5KITA 2E67A 3BW2A 4MYAA 3W7JA 2Z4GA 3PZIA 4YS1A 3TONA 3C2EA 3RDKA 3O6DA 3IARA 3AWNA 2OZ3A 3PPFA 4RE2A 5KZEA 1HX0A 3N9KA 3GS6A 1F73A 4HBKA 1RCQA 4GNKB 5DF0A 1ITCA 3ITYA 1GEHA 4WJEA 2QIIA 3F5LA 3QSRA 3BVJA 3VIMA 5IFTA 2J13A 3SRFA 3G22A 3CZGA 1YTEA 3HV9A 3C2FA 2VL4A 1OHLA 4A21A 3OIHA 2R1MA 4DJEC 4MYXA 1S39A 4H8UA 5D8WA 4DO7A 5K3VA 1JYNA 1KW1A 3FXYA 1E56A 4WEVX 3OQEA 2ZX5A 1O5RA 4FPSA 3UJEA 2EGZA 4R7OA 2W5FA 2VP8A 3BV4A 5HPCA 4NSBA 4B5WA 4CGTA 1SUXA 1E9LA 4XQ6A 4KCWA 3FYOA 2DIJA 1W31A 3B4UA 4GYPC 4QSHA 3B3DA 5HULA 3VIFA 1CTNA 1HKVA 7TIMA 3W6LA 4XD3A 2GJPA 4TVDA 2PDNA 1K02A 4DBUA 1WPCA 2FZNA 1XD1A 4LVBA 3NA8A 5A1AA 4GOAA 1KO0A 3KEHA 3EDJA 4P7RA 3EA1A 4KRUA 4RK8A 4Y9NA 5XINA 3H55A 3TJLA 4LEFA 4S3EA 1GNXA 2MUCA 3RJXA 2Y8VA 3WL1A 1A0CA 1OQFA 2XM1A 1IXNA 4U31A 3FKRA 4Q4OA 4C90A 1EJRC 1B30A 3EOLA 3C4UA 3EWWA 1JI1A 2HMCA 2HRWA 3EPNA 3TC7A 4Q4PA 1TPFA 5XIMA 3GE7A 2VZSA 1ODUA 3TTOA 3WIJA 2BVDA 1L6GA 3U3HA 8XIMA 3E02A 3KHDA 2CLEA 4NYYA 2ZRZA 4A3YA 3IK4A 1TG7A 3REQB 3ALGA 4F0KA 5G4EA 3PB0A 3DECA 1CIUA 4FF7A 1F6YA 4A3UA 3W1XA 4YJ5A 4CU7A 3TUUA 2Z2AA 3RX3A 5AC4A 3TZFA 3R5EA 4IWWA 1FQ0A 3VNYA 4IX0A 1GVFA 5CCZA 1Q7QA 1ME7A 2PDUA 3GDRA 4TOQA 2YB4A 1XLEA 2FMNA 5FL1A 3S8HA 1WUFA 1TMLA 4UMBA 1FA2A 1B0IA 4F4RA 4NL1A 5FAJA 2YBTA 3R7MA 5CC7A 2QV4A 1B3VA 1RXOB 3KP1A 3LV6A 4JAWA 4KEZA 2RAGA 5ENLA 1JL8A 1W8GA 4WSHA 4QP0A 3EWZA 1X7IA 3OVGA 1ENUA 1VR6A 1XUZA 2Z28A 1CWYA 3TCEA 2E5DA 3A23A 4D6FA 3F4WA 2C3ZA 3IK2A 4B5UA 3AC0A 5AB3A 4ADTA 3FJ4A 1WZAA 3OJGA 2CXEA 4EACA 4PMZA 2PF0A 1XFBA 2BTMA 2I7GA 3NZ1A 3LB0A 2WYSA 4KCTA 4JTCA 5G2IA 3U2OA 3TYAA 2OWXA 1BYCA 2OELA 3EB2A 4WSKA 1J18A 2QGYA 3QQ0A 4M24A 1I60A 3VNZA 2V82A 4J3VA 1EJWC 3WLLA 3LRLA 1C9WA 3AS1A 1J96A 3P82A 1QXLA 4RZ4A 4S23A 1XBXA 8XIAA 3BLDA 1J0HA 1I2NA 3WJXA 3NVTA 5BOOA 3ZT7A 7TAAA 4NZ5A 3TR9A 1WCGA 4UZUA 1OX4A 3MUZ1 3S1WA 4LCRA 3ZR6A 1HL9A 3M47A 3VNMA 5K9XA 1UKQA 3TSBA 2QW5A 4OT7A 1MYRA 4Q8MA 3GDMA 1OD0A 5CGTA 4RV3A 5DY2A 5A8MA 3E0WA 1QAPA 1E70M 4C6PA 1GVEA 1VQTA 1P5BA 1NH6A 2CETA 2NSXA 2G5WA 3BW3A 4NAFA 5SWUA 3EEZA 3SEPA 2R6OA 2EG6A 1YNQA 4BK9A 1OC7A 2QCHA 2PDWA 3WJZA 5KZDA 4TO8A 2V81A 4DQWA 3KWSA 2WZIA 2E77A 2TSYA 3ISIX 1KKOA 3QKZA 2GQ8A 4LRTA 1XSIA 5FJOA 1I1WA 2OYLA 1ME9A 4MDPA 5KSWA 1TVLA 5CBJA 3E0FA 1GQLA 1UC4A 5B7YA 4KW2A 1O1ZA 1RR2A 5JUVA 3KVJA 4I5XA 3H7RA 3AS2A 1XD0A 5AFDA 4GNVA 1WDSA 1TR1A 4A22A 5EFFA 3CH9A 2QV5A 1CXKA 1AK5A 5HQLA 3UXAA 3B0XA 3MV11 2V5BA 1J8VA 3N29A 5FEXA 3IEBA 2WVUA 3PBMA 3FGCA 1EL3A 2CU0A 1HZYA 4HPJA 2WO5A 5CQ1A 1FWSA 3IJ7A 1W2PA 3PTMA 4QDPA 5DRCA 3BPWA 3N9RA 3ITTA 1F4HA 4PB4A 4XV0A 4PFMA 3N3MA 1Q6QA 2X42A 1XL9A 3GYEA 3BW4A 3QYQA 3PWGA 3GLCA 3I4EA 4N9DA 3G0SA 5D9MA 3W7KA 4Q8OA 4GK8A 1KM1A 4PMDA 1JF6A 1KQZA 3TWBA 4W5ZA 1VHCA 4QDMA 3QR0A 1Q85A 4IJBA 1DORA 3THQA 5E6ZA 4ACYA 3R10A 4CCEA 3S5SA 3NZGA 2ISSA 4M29A 3UZJA 1QUMA 4KCUA 2VRQA 3EKGA 4NI8A 2DSUA 2CNCA 4ZA0A 4DBEA 1GEQA 3I10A 4MB5A 2VDHA 3ITLA 5DMYA 2PDXA 1A5UA 2D2JA 4RPPA 2BSLA 2VELA 5BWAA 3QC0A 4HNOA 1C8VA 2ZCGA 3ARZA 3O0KA 1EP2A 2OYMA 1O66A 2I56A 4D6IA 4BR1A 3FHQA 3WUBA 1UWIA 4EWJA 4JIPA 3DG6A 3RIKA 2CBIA 4PMJA 3TCSA 3GFYA 2YBUA 1F3XA 1A0EA 4NP7A 4GUFA 1SO5A 2WSRA 1WDQA 3R25A 4IQEA 3KRZA 2CLLA 4OBSA 3LCHA 2HWGA 1E15A 4HOXA 2ZUVA 4DAIA 3D0CA 2Y62A 3QGKC 2ZTJA 1G9HA 3F2CA 4CVWA 3R79A 2BHZA 4R7WA 1PZ1A 5GJMA 1CGVA 2D22A 4Q7NA 3I68A 3J7HA 2ODOA 3DXIA 5J8LA 4QISA 4Q8QA 1US0A 4BF7A 3BDKA 3RO6A 4K1WA 2ISVA 4CQCA 2WBKA 3MA8A 1D8WA 1U83A 3TTSA 3SRDA 4I6VA 3NXLA 5FJJA 3FFSA 3VIOA 4IGMA 1VRXA 2J7HA 1EX1A 3WLPA 3TQKA 3W38A 3AHTA 3MWAA 1CYGA 2DW6A 2Q3RA 1E3ZA 3C8NA 1AJ0A 1JAKA 3UGRA 3WQ8A 4Z08A 1OWQA 2XIOA 3FCPA 5FSDC 2BB0A 3TYUA 3R94A 4ICNA 3OLDA 5AYXA 5A6BD 5IDIA 4HMDA 2GLKA 3LSCA 2F6KA 1TIMA 3L2MA 2QUUA 2VFHA 4GY0A 2CLMA 4DX3A 3IS4A 4K1GA 3F4VA 4YVVA 3EWYA 3A3XA 4HCLA 2VZVA 1IXQA 4NHVA 3SUUA 4GGHA 1KNWA 4ZVJA 3SY1A 4P5UA 2DH3A 3WENA 2VFIA 1XRFA 2GDUA 2A79A 1SVDA 4O18A 2PCQA 1O5XA 1EX5A 4JR5A 2WB5A 4GFSA 3GX9A 3C5QA 5AC7A 1FHUA 5AHMA 5AHFA 3HPFA 4ZEPA 3CL8A 3E5BA 2ZKMX 2X0YA 3IGUA 2D3NA 4TTGA 4LAOA 2HZGA 3LCWA 5HWMA 2QVHA 1AG1O 1W1TA 1K77A 1E51A 2V8ZA 1R6WA 1WXYA 3WLRA 3GHSA 2J7EA 1OEPA 2PLKA 1YPXA 3A12A 2D2GA 4UCFA 4C1NA 1UD2A 3EMZA 4QHRA 2IPFA 4MY8A 1FWRA 3WBYA 4PL2A 4HOZA 1EDTA 1AMKA 3UBPC 1OIFA 1JQVA 4L1GA 1TJRA 3ARUA 4S3DA 2HK1A 2DVXA 3W82A 4IIGA 3MZNA 4M6VA 1XBZA 1VCGA 2QCCA 3MANA 5BRQA 4JS3A 4MNJA 1JYWA 1GT8A 2VFGA 6REQA 4Q32A 3VFLA 1B3WA 2BASA 4WF7A 1QI2A 4LS1A 3VAVA 1OX4B 3FSUA 4S3AA 3CAWA 1WYIA 3VKAA 2WHLA 1O60A 2QNEA 1TWWA 3GNDA 4E4UA 4P8UA 2WK2A 1E6QM 1I2OA 6XIMA 4H7VA 3VGFA 4ZXLA 1J0IA 3WLIA 2D23A 2VFEA 4JFTA 3T42A 3TNBA 1FWEC 6TAAA 1XIFA 3P67A 5G4HC 1QPQA 1Q63A 3T09A 4AISA 2F9RA 1AL7A 2YW3A 3HGSA 4NAFB 4IISA 3MTWA 4A6GA 1XPYA 5AYYA 1H2JA 1O1HA 3WD3A 3K5XA 4U5KA 2OZ0A 5D33A 4N6EA 2C16A 5BZAA 3HBLA 4FLSA 3LBCA 1E4NA 2AKMA 4TR9A 3U57A 1K03A 4YTTA 4DNMA 1MMFA 1V3JA 5A8GA 5M17A 4OJYA 5T9CE 3VDGA 1IQ8A 2JIWA 2Q6ZA 2GSEA 2YLLA 4UOQA 1HO1A 3N13A 1K70A 1JCLA 4LH8A 4P7QA 3CK5A 4D6GA 2XUCA 2CZEA 3B0VC 1I2QA 1LWJA 1V3IA 2Y5SA 1GOXA 4IT1A 3R8HA 3AOFA 2GVGA 2O92A 1WP6A 4QCEA 1WXZA 1UD4A 3FGCB 4DYEA 2VVSA 3RLUA 2A3EA 3SQSA 3UETA 1P7TA 2BOFX 4RJEA 1KR1A 2YIHA 3GZAA 1E5NA 3LCIA 1TRDA 3GVGA 3HG3A 1EA0A 1LG2A 1TV3A 1NFGA 1ITQA 4IMAA 1Y5XA 3MYPA 2PP3A 5J04A 1M5WA 1IYXA 4GMEA 3N19B 1OFPA 2Z2BA 3G1VA 4LGXA 3SQLA 3HQPA 5H91A 1KBLA 4DUWA 1Z41A 3FKKA 3ZLGA 4EAMA 4CD5A 1T8QA 4IHCA 4UTJA 5D02A 4IJRA 2FZ9A 3W7DA 2ZRWA 4F48A 4MWAD 2EHHA 2XSBA 4LC8A 2VX6A 3N3TA 1NDYA 3IGXA 4RZ5A 4IPJA 4GH3A 1RVGA 3IIPA 2YXGA 1EBGA 3L4UA 1KRAC 1XH2A 5D2TA 4XO7A 5T8GA 4PUWA 4HNUA 2VEGA 3CZJA 4JXCA 3PHAA 2NV2A 1VJIA 5MHBA 3KXQA 2GGEA 4HU0A 1JI2A 1XISA 1AVAA 3BWWA 3SCNA 5LIUX 5K7JA 1UWQA 1HIZA 4K6AA 2WANA 2ZRXA 4QR6A 1VFTA 4RPQA 4NX0A 4YYCA 4DJED 5JBDA 1EDQA 4A35A 3K4AA 1V0NA 2ZADA 4LUSA 4BWLC 4LRSA 4IP5A 4HMCA 1UYQA 2I16A 4C6FA 1X8FA 2DZPA 4E4FA 4P8WA 1M65A 3EOEA 2JIEA 1R9XA 1IEWA 2HPMA 3W2KA 3G1DA 3H2MA 1FHVA 5DANA 3CASA 3FYPA 2VM8A 1IWAA 5FAGA 2ZXQA 1XLIA 3BK0A 5HINA 5A6AA 5E09A 2PURA 3M0HA 2WMIA 1UIPA 2FH8A 2QCEA 3BAYA 2L5HA 1UOKA 1A5OC 2Z0IA 3PM6A 4MHBA 1U33A 3L4XA 1MW0A 3GC2A 2PZNA 2ZVIA 1QNPA 3V16A 4GVGA 2VX7A 4S2BA 4Z1DA 4GX8A 1PIGA 1J93A 2A3LA 5I3JA 3NG3A 3GBEA 1REQA 1UBSA 5TAOA 2FH6A 1UMYA 1SJAA 4EK7A 1GUVA 4XVDA 2Y7FA 4JCMA 4BI7A 3SDOA 4IM4A 3NQAA 3KE0A 3GTXA 5B80A 3FX4A 1TV4A 1E1CA 5DO8A 2PZ0A 1DYSA 3DFTA 4LYPA 4UQ9A 2O0TA 5BMWA 3MI2A 1D3CA 4HYWA 5F1VA 3DHFA 1J79A 2EEXA 4ZQRA 2HXTA 3W76A 1WAUA 4BZYA 2QPSA 3DX5A 1GKQA 2XFFA 1EO5A 3PUGA 4C1NB 4N9BA 1UW9A 1EYWA 4AY1A 2ZXDA 2Z27A 4XAPA 1O4UA 4AMCA 4CN4A 3PY2A 4DF0A 4DZHA 4GI8A 1F2JA 3S2JA 4A29A 3NFUA 4BEQA 3DKLA 3PP7A 3OYZA 3DU0A 4O1CA 1DIDA 3UJRA 3QGVA 3VM5A 2A5HA 2O55A 4G8TA 5I78A 4J3SA 5HWJA 4XZLX 2J75A 3M16A 1DP0A 6A3HA 1W91A 1X38A 6REQB 1AQ0A 3C3UA 2Q02A 5AKQA 2E7FA 1C8XA 1OGSA 3ZJ7A 1Q6DA 1E72M 1MW2A 1B31A 3OVPA 2IPGA 1WZMA 1F3TA 4PMRA 2I5GA 2C71A 2V5JA 3WQ4A 1MXDA 1K7XA 4I5UA 2PSNA 3E0VA 4ATDA 1L6YA 1NF7A 3NQGA 4D8ZA 3TH6A 3VI2A 2DIEA 5L9FA 4XD6A 4AMAA 3QV8A 3K8MA 2PWEA 4PE8A 2HNHA 1OFQA 2QUTA 3NUKA 3NDOA 1ZCCA 4AVNA 2GOKA 2XIQA 4O1FA 3W26A 1M1BA 2VRKA 1FX6A 3CEPA 4GABA 4PULA 4IMEA 1J11A 4W8LA 1HUVA 4YPJA 1AQMA 1IR1A 4LU0A 3MI6A 3IV8A 4CCZA 1WDPA 3H2CA 1EEPA 4ZO9A 1PKYA 3W01A 3URBA 1PAMA 3ZJ8A 1DL3A 4LF1A 3CMFA 3LM3A 2FPYA 1XLJA 1QR7A 1A49A 3L5LA 4NKCA 5BU6A 3G1FA 2XIBA 2ANUA 4WGHA 2FTWA 4J3WA 4ILSA 2NZLA 1SO4A 4MB3A 5IFPA 1RBLA 2OYKA 3TMLA 5BW6A 1X1NA 1QATA 6PTDA 2V3DA 4GQBA 1V0MA 2DVTA 4RZ6A 5H8MA 2BGSA 3WF4A 1PCKA 3LGEA 1E71M 2FGZA 2Z00A 3QW4B 2DY3A 1C7TA 7PTDA 4HIBA 5K9CA 1XUUA 1P7TB 2JBMA 2BODX 2O56A 4O1EA 4I6KA 3EPOA 3RLVA 1EH9A 3WJSA 2PODA 1DJWA 1N2VA 3QPEA 2WOQA 3RG6A 3C0QA 1CBGA 4O1DA 1Q66A 3GDTA 1TJ0A 4AFYA 1RSCA 2DORA 1YDNA 1YADA 3FVDA 1XIMA 3BLFA 2ZUMA 1E1FA 2OG9A 4MTVA 2X2YA 1H7PA 2W67A 4GZEA 4O15A 4O54A 3HMJG 1WZKA 1JUKA 1QI3A 5F2IA 3IRSA 1EHNA 3UA3A 3PPCA 2QVNA 5D04C 2B7QA 1S5TA 2NT1A 2BP1A 4MSSA 3AIUA 1A4MA 4JTGA 1R7OA 3KOYA 3MUXA 5D9PA 1UH4A 2GDQA 3AIEA 1A50A 1JZ3A 1YTDA 3W2JA 1RPXA 2NW0A 4IQLA 3E6EA 3WQGA 3EOSA 2VQUA 4BCEA 4L56A 3MU7A 4WDXA 3DFHA 1FCUA 4KT2A 4WJ8A 2Z1WA 2XVNA 2YDQA 3B9EA 3BARA 3V1PA 2AKZA 1SU5A 4XBSA 1GQKA 2UY5A 4PMVA 3L5AA 3H21A 3ABSA 1GK8A 4KIEA 4XD5A 1K8YA 4KEMA 3CIVA 3QW3A 1ZBVA 3UEQA 1H61A 4PTWA 1QMLA 1W1VA 4UTFA 1YHTA 4HHHA 2QDGA 2V5KA 3WNLA 4TVCA 2HVNA 5KMYA 4U4MA 2IXUA 4HU4A 4OOUA 3AISA 3N15A 1VCVA 3KUMA 4LUSB 3BLKA 4PTNA 1KCLA 2ZA3A 3G1RA 1DWAM 1CZ1A 3Q67A 2P50A 3EX4A 5AY7A 1UWRA 1MXSA 3AMGA 3OA5A 1ZP4A 4I9AA 1W9BM 2P76A 4GXPA 1MFVA 2E6FA 1JFHA 1YXYA 1PZ0A 2ZZ2A 4JIEA 4W7WA 3KS5A 4QFUA 3NL2A 1JJKA 3MUY1 4MY1A 4QSFA 3KCOA 2NXHA 2BX7A 2WMIB 5G4WA 3CTLA 3OVQA 4GIRA 1FCBA 1KM4A 3FHAA 4JN8A 3ABOA 4B3KA 1UH2A 5TF0A 1FKWA 4XUGA 3LTSA 3A4JA 2QYGA 4MJ4A 4V28A 4AWSA 4ZODA 1REQB 3NPWA 2ZE3A 2JF6A 4HZ6A 3THAA 1W3LA 1TREA 1SO3A 3EMCA 4YTSA 3QTPA 2E0PA 1I2RA 4HPGA 3UPBA 1UROA 2YCKX 5LGZA 1UWTA 3BJTA 1JD9A 3W02A 3GDLA 3BGAA 5ECUA 4J2MA 1WUEA 2VR5A 4PTMA 3VNJA 5IRPA 1DJGA 5LIXX 4WSJA 3H2EA 1F8MA 2ZUTA 2REQA 3RMJA 4XVEA 4DJFC 1U5HA 2YYUA 1JPHA 3P0XA 5EA9A 1TWIA 1B2YA 2ZC1A 3LPGA 3BJSA 3TYEA 3OGSA 1HW6A 2D2OA 2IKGA 1ODZA 1X97A 3IWPA 3FA4A 3WJWA 3AHVA 4LB3A 3GR4A 1E6NA 5DMNA 2G3IA 2QJNA 2J7GA 2ONEA 2PDYA 3HGJA 1DIKA 3FXGA 1YIXA 1FBAA 3BLLA 4PMNA 1V79A 4ZB5A 1XLAA 2WC3A 3PN8A 3WY1A 4UCGA 3HPZA 4EPDC 4QJ5B 4PZVA 1NFPA 4OE7A 2ZUNA 1KTNA 3A3WA 1O68A 1GPFA 1Q2SA 3BG3A 3PBGA 4ATLA 9CGTA 1WDRA 3OHIA 4FP1A 3CWNA 5FF3A 4PB3A 1Q4WA 1MFUA 3KS6A 1UZ4A 2ZA2A 5IXEA 3W9ZA 6TIMA 1IGWA 1XYCA 2OU4A 3GBDA 4JNMA 3MKKA 4S3FA 4NU7A 1GOIA 3TK7A 4HHMA 3MDUA 4YYFA 4JTSA 1LLOA 3DCPA 2J66A 3W1MA 4RZBA 2VRJA 1SR0A 5IBXC 1O5KA 4MPQA 3N34A 4RDZA 3MJYA 3Q58A 3QRHA 1UWAA 1HKKA 4AYGA 1N82A 5LA1A 2VEIA 4N42A 3UXDA 3THCA 5GPRA 1XM3A 2BY1A 1UASA 4CCCA 5T9BG 1TMHA 3ZSTA 4MKVA 4PEEA 5CXPA 3P84A 2E40A 1GW1A 3K8LA 4XTIA 1EWEA 4AB4A 4DO6A 1FWTA 3P2VA 3UR8A 2VGIA 4JTUA 5CAKA 1W9VA 3MVIA 1EYEA 1OCJA 1ONWA 4XD4A 3KFTA 2TMDA 3NVDA 2DV0A 2ZA1A 2VENA 5HJYA 1GOOA 4UFKA 3XISA 1E73M 3CNYA 1XIBA 2HQAA 1IZCA 5FCZA 3CGTA 4H3DA 1TUFA 2G37A 2HTMA 2OLSA 2Z7GA 3RM4A 1G67A 5J5DA 1R46A 2FQIA 2FVMA 3UZ5A 5DXYA 3LXBA 3KL0A 5C9RA 5CPLA 2F61A 4ZO7A 2QUVA 4XK2A 3NL3A 2PEVA 4O8RA 3PG9A 2E68A 3LDVA 1TCMA 3LQLA 4YN5A 1ZJAA 3Q4DA 2YCIX 3AS0A 2CC0A 4LW7A 2D2HA 1VS1A 2WVSA 3ZVHA 2PD5A 1XYFA 2YJQA 4PR4A 4FK9A 4MNLA 3UW6A 2OWWA 1XLDA 4UTUA 3QOMA 3KOXA 3QKEA 3CV6A 2V3GA 1AH3A 1B54A 3SSJA 1X98A 3WD2A 1ELSA 3OW1A 2A3BA 1CGTA 4WR3A 2PDPA 4H8NA 2P53A 2NQZA 3WBEA 3EX6A 3VGGA 2ZZ1A 1UPPA 4CLMA 1TVPA 2QHAA 5FJPA 1KC7A 5I3DA 2VT0A 1CLVA 1XJBA 4A8LA 4ES4A 5F1UA 5DT7A 2VO5A 4AD3A 5AZ0A 2G0WA 2VURA 1WDDA 2EO7A 3RJYA 1JG9A 3DOPA 4LB4A 1JF5A 3CUIA 3OIXA 4ERGA 4YXGA 1PZ2A 4AVOA 2GQ9A 3CUHA 3OLIA 3AXHA 1VJZA 4B90A 3SIMA 3WQ5A 4UBPC 3MCOA 1SJBA 1FOBA 4B3ZA 4N0RA 2NUWA 5I79A 1SPQA 1QHPA 1NM9A 4L9YA 1Z9AA 1OFAA 1PL9A 4MJ2A 3TX9A 2V9DA 4QROA 4Y7EA 5HNUA 4C6LA 3ARVA 5LGXA 5CEWA 2WMKA 4LUIA 3CO8A 2X2GA 2ZZ7A 1V02E 5G1MA 3CIXA 4GZIA 4UFMA 1BAGA 4CKQA 2D0HA 3B8TA 4LV4A 3SCUA 2YFNA 4IIDA 3SECA 3RR4A 1XFCA 2EF9A 3W4RA 3MP4A 1XQLA 4O50A 4HOWA 3HQOA 3M5VA 5EL1A 1LQAA 1ZRQA 3AO0A 4CNTA 3W7QA 4CVUA 3O6YX 1GZGA 3JU2A 1EA9C 4PSRA 2VEKA 5HANA 3TN4A 2GQ3A 3F4DA 4KKXA 4C7GA 4DUOA 1XLCA 2QCNA 4HA3A 4GA8A 4B5VA 4UQAA 3M46A 3NSMA 4LTSA 2W27A 3W22A 4UTTC 4DBDA 4UNIA 1LM1A 3QHNA 1QJWA 4PEKA 3WK3A 2BY0A 5JH2A 2JGYA 2REQB 4AY8A 3KBJA 4QITA 4ZB2A 2WJFA 3C8FA 3BLEA 3VIGA 1K7EA 1B3OA 3LLXA 4Z17A 3R11A 4FSAA 4NZFA 4DWSC 1OX6A 5T26A 3R89A 3WLSA 1DOSA 1VLIA 1WB0A 3INPA 5I5RA 4HQVA 3GY1A 3UR2A 2VC6A 4LBRA 3T4WA 2QDEA 2X0HA 5EBAA 3DFSA 1UIOA 2I57A 2OODA 4P7NA 5E0FA 4HMNA 4GX9A 2CLOA 3BLOA 3S4TA 3NQ2A 4PMYA 3AMLA 4FIQA 3TZNA 4UC5A 4W93A 5H2ZA 2BZNA 3TA9A 1VFFA 5HUOA 1BPLB 4D8AA 3AYRA 2DT1A 4LOCA 2WCGA 2CITA 2BBFA 4GO9A 4CEXC 3EWBX 5CPNA 2ISFA 2NUYA 4NZ3A 4DZAA 1SYTA 4MZ8A 1UR3M 3UWUA 3KBVA 3Q2DA 4FLOA 2G3FA 1C8YA 2C91A 2V30A 1UKPA 2OX4A 2QLYA 3AXIA 4IH3A 2X8RA 4NF7A 3W7HA 2WM1A 1IEQA 4QTGA 3W29A 5A8OA 3GH4A 4P61A 5FACA 4LEQA 1JZ8A 3ES8A 1RY0A 1XC4A 4R5EA 3DEQA 4H04A 1VFHA 2BY2A 1QFEA 1BG4A 2OOGA 1KXHA 1UUOA 1HJWA 3VKCA 4L4PA 5DELA 1NWRA 4W4QA 3ARXA 4HKPA 1RAKA 3FN9A 3BURA 3KTCA 5I7GA 2DSKA 1XYZA 4XKMA 1JZ2A 4JQ3A 3ZVIA 1UB3A 1W8SA 2RDTA 4E8DA 2XH4A 2OO0A 4ERIA 3K8KA 1JVNA 1EHAA 3WQWA 1YXCA 4AY7A 3LZ3A 2WVTA 3GR7A 4ZXOA 2UWFA 4A8IA 3VC5A 3RFAA 1GPWA 1OT1A 4HCDA 1X39A 3B8DA 2E09A 1XYMA 2TYSA 5C55A 1QOQA 2EG8A 1T7LA 2CESA 3STPA 3GU9A 4KQNA 1JDAA 3ARTA 3F5JA 4GBDA 4GY1A 1EFZA 3ZVHB 4NRSA 5F2LA 1CX9A 5M1TA 3HIJA 3CUZA 3N2XA 5JMUA 3G0XA 4O13A 3GZ3A 2WNZA 3L21A 2E4TA 4MUZA 1S2UA 4WXZA 4MZYA 4D6DA 3AFBA 1EIBA 4HK5A 4TTUA 5AC8A 3WDPP 2G4FA 2WM0A 2X16A 4IJCA 4A8RA 5G1YA 5MKGA 1W5MA 3D5HA 4NXSA 3WF3A 2WPBA 2ESCA 2J79A 3PPGA 3T7VA 3C86A 1VIZA 2YBVA 1ZAJA 1F6KA 2G3JA 3VDCA 1B5TA 3CHCA 3THUA 2PB1A 3R4IA 2EXOA 4QNWA 2HBXA 1DEDA 1EC8A 1T41A 3LY0A 4XZ9A 1ZNNA 4XZWA 1XH0A 4JNYA 2J6XA 2VEFA 3L12A 3O3RA 1C8QA 4JTKA 1ZENA 3NQ6A 1ONRA 2A6NA 3AYVA 4AIEA 4L7ZA 2CLKA 2ZDRA 4UB9A 3OQ8A 1EJTC 2RDWA 4C5ZA 2FHFA 3T1GA 1RJQA 4HA4A 1OINA 4I5RA 3WLJA 1YKWA 1RD6A 2QUMA 2CKSA 1DWHM 4FF5A 4FLRA 1AL8A 5JH1A 1JZ4A 3B9AA 1OCNA 4J3ZA 2W3ZA 4GC3A 4MKSA 5C2CA 3P81A 2Z26A 1I0DA 4U33A 3S2LA 9RUBA 4I7UA 7A3HA 4ZZ9A 4M6UA 2QJJA 2D0FA 2NVDA 2CLPA 2WNQA 1BF2A 1PYFA 4WLCA 1RBOB 3L66A 4GIAA 2ICSA 3L2LA 1FCVA 1RJPA 4JTIA 2VCBA 4F40A 4GUHA 1C3FA 1ZS2A 2QJHA 4GVIA 4JKLA 4W8AA 2FYMA 5JU6A 3VE9A 3TC6A 3R12A 3UPWA 4UQEA 3LN3A 2BVTA 4JDYA 4HSOA 2NVCA 3GXFA 2ZIDA 3UU0A 1JGMA 2P3ZA 2PPGA 1RLCL 4X0NA 1B90A 3NQ7A 5DCEA 2C13A 1VLWA 1TE6A 2W62A 4R9XA 4XBJA 4ATWA 2Y8KA 4I8DA 1BTMA 3TC3A 3TYDA 1FY6A 1W17A 4F8XA 3NQDA 2AMGA 4NY2A 1EWDA 3LX9A 3NOEA 1A5AA 4Q8NA 1D3GA 2CXGA 1OGBA 3W1AA 3GR8A 1DV7A 5I6SA 4DO5A 4JCLA 1GYNA 2XM2A 1R38A 1BWKA 2HBVA 4F2UA 5GQBA 3QZEA 2GVJA 2QR6A 3EBVA 3RM8A 3DHUA 3N2BA 7ODCA 3VD4A 1VEPA 3I6RA 1POKA 3IPWA 3H54A 3VDBA 2XVLA 2O7SA 2YZ5A 1DJZA 4TUFA 1H09A 3TW6A 4W84A 1IT8A 2GFTA 3SW6A 1P6BA 3AUOA 4R85A 1XKJA 1W5PA 2OT1A 1J01A 3NEVA 3LSBA 1XP3A 3A6OA 3NGJA 1RPKA 7REQA 1H7NA 4B9ZA 5I3FA 4FOKA 1S2WA 3K1GA 1CI1A 3T05A 4O14A 4UZSA 4MZ1A 1BKHA 3EA2A 2VGFA 2WLYA 4C6MA 3BV7A 3N2TA 1NF0A 3GRIA 4UNKA 2YKKA 3PC0A 4D2JA 4E4PA 3WMBA 1JYXA 1RCXB 1U2YA 1IE7C 4NUWA 1OCBA 2OQLA 3B9DA 1S2VA 1R2TA 3RRAA 1WOBA 3UVAA 2O4QA 1EO7A 1TPVA 4GI6A 4US5A 1Z7AA 4M6QA 3UCDA 4U2ZA 1XX1A 1BXBA 1MUWA 3GH7A 1MXGA 5DBTA 4F79A 2PTDA 4DZIA 1PBGA 3VZYA 3ZIZA 5E1QA 4LT9A 1YDYA 1GVIA 2Y24A 4AIUA 1XF0A 3UZYA 1W9XA 3T0DA 2DSWA 4F2TA 1DIEA 4QS6A 4LYQA 1V77A 3M44A 5CZ0A 3KM8A 3UCCA 2INEA 5LIWX 1XRSA 5REQA 2YL5A 4C6IA 1SW3A 4B5XA 3ZOAA 2BGNE 4WKAA 4I9MA 3FSTA 4PUEA 1NWUA 4LXFA 1UR0A 4P2VA 3UG3A 1OYBA 4H2CA 1CXLA 1EQCA 3CZKA 3TOPA 5ABEA 3CU2A 1MUMA 1KLYA 3O6AA 4C7DA 3RU6A 3T08A 2XDFA 1OZQA 1R8LA 5BRPA 3GUWA 4PUKA 1XQKA 1KXQA 1UMLA 1TIWA 1VYPX 4PYSA 2FMOA 1BD0A 1K6AA 2WSKA 1CXIA 4OGZA 2XN1A 1JZ7A 2YCEA 1DQXA 3UVIA 3VNIA 1J0ZA 4KPLA 1UD3A 4PCPA 3UGVA 3BLPX 1L2UA 2WLZA 3A13A 2R1PA 3GTIA 3QV7A 1A4LA 3MY9A 3ALFA 4DN1A 5M2FX 3WLHA 4H9XA 1LZOA 1NTHA 3G24A 1HJUA 1RHCA 2CWNA 3L4ZA 4UOZA 4NQ1A 4PGLA 3QVQA 2YDAA 4OV4A 3BANA 3GXMA 1LRTA 4D71A 1WOAA 3PB2A 4EF9A 3VU2A 3MB9A 1UH3A 5HDRA 3H2AA 1MNSA 3BMWA 3PZMA 1GVOA 2DJXA 3UG4A 1MVYA 2YB1A 3G2GA 4FNPA 1J6PA 4N6FA 4NZCA 2PFHA 4AX7A 3D3FA 1OFRA 3QHMA 2PTXA 1A80A 4GQRA 2Y7GA 1V6UA 4FXRA 1W9UA 4J7RA 1BYBA 5MKGB 2W92A 3HGOA 3PZVA 3IGHX 4PUDA 2OJPA 3OU8A 3VIIA 3VKJA 4GFIA 4M81A 3SI9A 3POHA 2BOEX 4JFSA 2V38A 2YXXA 5AC5A 3WK1A 2YL9A 1H51A 4EANA 3G3DA 2E28A 3N11A 4UQCA 1HJVA 4Y2WA 2BXVA 4PB5A 3QGAC 5ABHA 4K3ZA 3PJXA 1KCXA 1J0JA 5J5RA 4PC8A 2PDGA 4LC6A 1AQFA 3IJLA 1W1ZA 1M7XA 1TZ9A 3WUGA 3ARSA 4Z2JA 4CN1A 3W85A 1RK5A 1VFUA 3UQNA 5B7ZA 3P7YA 2P3EA 2V5DA 3FA3A 1TMQA 3M07A 3VOGA 4PCFA 3C2OA 4JQ1A 4M0XA 4NXKA 3BQ5A 4GKTA 3ABXA 3T78A 4BY3A 4LY8A 1EOMA 3QEZA 4JYEA 3XIMA 4HN8A 1GHSA 3GM8A 2Y0FA 2X7WA 2BWGA 3H24A 4LALA 1KCZA 5DX7A 1M03A 3W7EA 3HJEA 2EPHA 4C6DA 4B15A 2HDJA 4Y8FA 2A7PA 2RHGA 2YZRA 3DFNA 3W75A 3T4CA 1RA5A 4ERAA 3PVFA 3VOHA 4HT3A 3N6JA 2RJGA 4CN6A 3IIXA 3EDEA 2V67A 3BC9A 2EKCA 4HSNA 3CQHA 4ZE4A 4ZENA 4KH2A 1FKXA 3SBFA 3SJNA 3N9SA 1H50A 2R1NA 5A6MA 1PS9A 3PJUA 4LVAA 3LYEA 1WZLA 4ZO6A 5E9AA 2WZHA 3MCNA 2E25A 2B7OA 3VIPA 3IUHA 1OYAA 4C5YA 4GUJA 1AMYA 3IUIA 2FDMA 3MJMA 4L4MA