2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
4BI5A 1TYGA 3LRLA 4XKYA 1QO5A 3MI6A 5GVJA 2FQIA 2DJLA 1HTIA 3O15A 5D05A 3VFLA 2C0AA 2VC6A 3A22A 1VPXA 2E1DA 2FFCA 1ME8A 4OWGA 1OF6A 1H51A 2C3ZA 4PTNA 2C16A 1OX5A 1TTQA 2DP3A 2BTMA 1QDSA 1SO3A 3E9AA 3WJXA 3S1VA 1GG1A 2Q3RA 4UFHA 1EA0A 3TMLA 4HPXA 3NL3A 3C52A 4LC8A 5U4NA 4JNMA 4S1FA 4QNWA 1T99A 1VLIA 3NQMA 3PAJA 2JKPA 4ZQNA 1ICPA 2FTPA 5D2XA 4N9BA 1X1OA 1AMKA 3LCGA 4S2BA 3GAKA 5DLCA 3ZWTA 3WK2A 3BW2A 5H2ZA 5K4ZA 4MPQA 3BG3A 3G3MA 3N34A 2JKAA 1G7VA 3LHVA 3MHFA 3NGJA 1I2QA 4O14A 1WBJA 3CWOX 3ZWSA 4H3DA 1VZWA 3P82A 5ABTA 4K8HA 4UXDA 4W9TA 3W88A 3LTPA 2Q8ZA 2E5DA 4BR1A 3T4CA 4NZJA 1Y0EA 3LDVA 2XN2A 1F6PA 4JYEA 5LHEA 1W0MA 3HOJA 3W2LA 3FJ6A 5DXYA 3IIPA 3TA6A 3GB6A 2V0TA 4J9JA 1TB3A 4RZ6A 3T78A 1OABA 5EA9A 4Y6GA 3JR2A 4OV9A 5I3GA 5BMXA 3PVFA 2A4AA 5HR6A 3C56A 4O17A 1KM2A 2A7NA 4OV4A 4FNSA 3O05A 3DFNA 5K7JA 5KINA 3BK0A 2QR6A 3QPZA 4HPJA 4WZHA 2QCFA 1YXDA 3KVKA 1F73A 3C2OA 3NR0A 3B8DA 4UFIA 2VEPA 1ZFJA 4JY9A 3IIOA 4XWUA 1KV5A 4PCFA 4N4QA 3ZR4A 2GVJA 1MO0A 1BKSA 4OQVA 4PODA 3M0ZA 2V82A 4RZ5A 1RVGA 4LRSA 2E68A 4GUIA 2NX3A 3M5ZA 2DZSA 4JTTA 4WY0A 2E5CA 4LV4A 4ZZ9A 1Q6OA 3RF9A 1W3NA 4IMDA 1TJRA 4MIMA 2DZVA 2ZRVA 3DENA 1YTEA 2PCQA 4LUIA 4JN6A 4AF0B 3S0CA 1F6KA 1CW2A 3GXTA 3SGZA 4MY9A 3KRZA 1FCUA 2HS8A 2ISVA 1ZENA 2VEKA 5CPNA 1V7YA 1PIIA 2ABAA 1XXXA 1WAUA 2C1HA 3LXAA 1GTHA 3DKLA 2GOUA 3WJYA 3TQVA 4MVAA 3QJAA 2F7FA 4O1CA 3V75A 1G4PA 2OT0A 1QFEA 3HO8A 1EEPA 1Z44A 3TKFA 4M6QA 5C6MA 1RQEA 3EWXA 4ALDA 1SO5A 2X16A 3UZ5A 2EKCA 1S3HA 1AW5A 1Q6RA 1R47A 3DI0A 3O07A 4JXCA 4GUFA 3TDFA 2QEZA 4RK8A 4HNNA 4NJHA 4MJZA 1ZAJA 3NL2A 1TMHA 3TU9A 1QOQA 5LZLA 1TJPA 3DGRA 1PCWA 1VH7A 4FHAA 1W31A 3A23A 1H60A 5BMWA 2CLIA 4O4VA 3BGGA 3HG5A 3I6RA 5AC6A 5EY5A 5DCBA 5AHLA 5U7SA 4EWND 2P1FA 3QW3A 1DQXA 3UPBA 3M16A 4O11A 4JIQA 4TR9A 5HUPA 4JX6A 4EF8A 4GUGA 4NNAA 2FPTA 4UMBA 3IGSA 1XDMA 4EVZA 3TC7A 3T55A 4M6PA 1R30A 3O1NA 3PC0A 5G2IA 3WFAA 4LY8A 1TPUA 4HSNA 1FQ0A 4MZ1A 4Z1AA 1XBYA 1PCKA 6ALDA 3TROA 1TPH1 1OX6A 3Q37A 5CG7A 4MY1A 1DQWA 2PRMA 1JVNA 1OJXA 3W6YA 3L0KA 4JICA 1EP2A 4YCPA 3BLFA 3C0JA 5DXXA 4CCDA 4LNYA 5I3HA 1ICQA 4ONVA 4XZ9A 1A5AA 3T44A 2XN1A 5HUOA 3MP3A 2NX1A 4PL1A 3LCWA 3TJXA 2QCMA 1WOBA 1I2PA 4WXYA 4WY0F 3DFPA 4HIBA 3SY5A 5G2WA 3NQ7A 1G7UA 2Y88A 1U83A 4EIVA 1FWRA 1DV7A 3LTSA 3LCLA 4X2RA 1B9BA 3BARA 1ICSA 1JCXA 2ZA3A 2FDSA 4R34A 4YLWA 4FXRA 5DN1A 1X6UA 4Q33A 1O94A 4MOZA 4Y90A 4DPQA 2J9XA 1JCJA 4LU0A 1XI3A 3DFOA 1K7EA 3SFKA 1OX4A 2NV1A 4WOQA 1TRIA 2Z6JA 3QM3A 1AW2A 3GXNA 4FB7A 1B3OA 2A1YA 3P61A 4AB4A 4HN4A 4JGDA 5D2WA 3SR7A 1ZCOA 1KTBA 1K8YA 3H53A 4ADUA 3S1WA 4XUGA 3B0VC 3T7VA 4AWTA 4Z1BA 1W5NA 3PUOA 3MO7A 3P8IA 1GVRA 4MLJA 3NQGA 2VEMA 2YDAA 4CCCA 4LS1A 4ORMA 3CIXA 3MMTA 2VFHA 1N7KA 1LLWA 2ZZ4A 1P4CA 4M19A 4K8EA 1H7XA 1Q45A 1H7PA 4RV8A 1S5WA 2DZTA 1ONRA 1YDOA 2O7QA 1SZFA 3C8FA 3NA8A 5K9CA 2WOQA 4Z1CA 3A9IA 4FX6M 1BEUA 1G4SA 1R2RA 3EX2A 4A21A 3CHVA 4ZQPA 3S9YA 3PUEA 3RU6A 1GVQA 3VE7A 2DZUA 4K39A 3TQ0A 5AHFA 4O52A 2A6LA 3TAOA 4X22A 1JUEA 4MYAA 3O6CA 5F2IA 1SZNA 4C1KA 5I3JA 2V8ZA 3BG9A 4Q32A 5AOUA 5G5IA 3G1XA 1KM5A 3W7KA 1FCQA 3S5ZA 2QJHA 1O5KA 5D04C 1WBHA 1IXPA 3ABRA 3MI3A 4M6VA 3W7HA 4NNCA 4O28A 2GVLA 1KM4A 5D09A 2WSRA 3L0NA 4Z0SA 3KX6A 2A7PA 4FNRA 3QSRA 3M1ZA 2ZZ1A 5KZEA 4H6KA 1UCWA 3C2EA 3QW4B 2J9YA 1ZHAA 1OX4B 2PE4A 1H7NA 3RNDA 2V2CA 2Y62A 5J5RA 3NZ1A 5EPDA 1XKYA 1UJPA 1A5SA 4G1KA 1PVNA 2ISSA 3DBPA 3G18A 3W83A 3CLMA 3E96A 3R2GA 3EX6A 1NFBA 2RDUA 3L0GA 2WNNA 2G96A 2WQPA 1GVSA 4XTIA 4TIMA 3H54A 1F5ZA 2F84A 2X1RA 1VYPX 3PBYA 4O10A 1UUMA 4RR4A 1HL2A 3I65A 4IJBA 2FLIA 1FXQA 3LCIA 4DF0A 5FEWA 1G6CA 1TTJA 4O16A 4O54A 2RHGA 2H3DA 3DFSA 2JKEA 4MZYA 1X8FA 5CSSA 3FKRA 3L67A 3DXIA 1VYSX 4UTWA 4LRTA 1O60A 2KZHA 3G0SA 2G95A 4X3ZA 2ZZ2A 1A50A 1VRDA 3EXSA 2J6XA 1PV8A 2ZCGA 3TCEA 1SUXA 3MWAA 3NM1A 2A85A 2J9ZA 3QRHA 3BV4A 3VE9A 3HGJA 3A21A 1QPOA 5EL1A 3MW7A 4XKYB 2NUYA 2R94A 3STGA 4A2RA 2DZXA 4N9DA 2BXVA 3WK3A 4QAIA 1LDCA 3HB9A 1OF8A 1KFLA 3PM6A 2W0UA 3EXRA 1XBVA 3LHZA 5L9FA 3P74A 2ISWA 1OK6A 3RK8A 3QH2A 4DPPA 4RXGA 5K4XA 2LLEA 1Q6LA 1I2OA 3THAA 1SZEA 4UMAA 5BRBA 1K02A 4JTUA 3LCFA 1L6SA 1ZJIA 5HULA 1YADA 4WX2A 3B05A 2DZPA 1YTKA 4EOUA 3W1UA 1XC4A 2YFNA 2BWGA 3ATZA 1WYIA 4ZVJA 1NAL1 5I3IA 3OHIA 5LNSA 3R8RA 3L9CA 2FB2A 2JBMA 5C5YA 5BNKA 3UY7A 4DO4A 5KSWA 4O50A 1LBLA 2B7PA 5F2GA 1W3TA 5AHIA 1L6WA 3F03K 2QAPA 3G8EA 5E0KA 1SU5A 4P61A 3A5VA 1NF7A 2PRLA 3O6DA 3P7YA 2QCLA 2XFWA 3UXDA 5A5WA 3BGJA 3Q58A 1MEHA 1YPIA 4QNEA 3NQ8A 1VGAA 1X7FA 5F2LA 4MJMA 4O0KA 2Z0IA 3D0CA 5HR7A 1SQ7A 3E02A 3NO5A 4IX2A 3L5LA 4YWIA 2QCEA 3KAOA 2YCEA 3TK7A 2RFGA 2E09A 1F74A 2J27A 2ZDRA 4JR5A 1L2UA 1J4EA 2WSYA 3G3DA 3ANYA 3L5MA 4OGZA 3HF3A 3MI2A 3WJWA 3RLVA 4IWWA 1KFCA 3R89A 1BWLA 3OVPA 1OFAA 3OBKA 1GQNA 1FDYA 2WV8A 3IIVA 4UTWC 2ZTKA 4KWWA 2WSQA 3I7SA 1UB3A 4FX8A 1G69A 1SPQA 3G0XA 3MP5A 2B4GA 2CWNA 2E77A 4PH6A 4EF9A 1RV8A 1YDNA 4CNNA 3S6DA 3B0UX 2X1TA 4IQLA 3NM3A 2Z2UA 1YTDA 3NXFA 4TMCA 2OMAA 3UWUA 4KFOA 1YYAA 2NUWA 4RXFA 3NPXA 2JGYA 4IUOA 5HWJA 1BWKA 3N19B 3INPA 1EUNA 5F4SA 2H8XA 3KXQA 1TPVA 1QNVA 3QZEA 2ZRXA 1THFD 1D3GA 4XTDA 4B5NA 2R91A 4E2BA 4LUJA 3EKLA 4DELA 3NAVA 2B7QA 3B4UA 3M9YA 2I14A 3W1NA 1JQVA 1DJQA 1MSSA 3W07A 3I68A 3FJLA 3G1DA 3STFA 1VR6A 3UWZA 1LOQA 1LP6A 4AHQA 5CZTA 2VFEA 3M5YA 3NQAA 3P67A 4LTSA 4NU7A 5G1YA 1TQXA 5G1TA 2YSWA 4BF9A 2E6FA 2HMCA 2ZZ5A 2Y7DA 4JTHA 1ZNNA 3W2KA 3QQ1A 1H1ZA 2YYUA 4A3UA 3N73A 5G4WA 3L2IA 3HJZA 1GYNA 5DBTA 1P0NA 3CPRA 1ZALA 1SR9A 4IMGA 4O0ZA 1TTIA 4JD4A 1AW1A 1I4NA 4R33A 3IEBA 1H7OA 1VHNA 3QMTA 3OVQA 1T96A 2CU0A 1YLVA 1JCYA 1K03A 3HGOA 1L6YA 5G4EA 5CZSA 3W2NA 3W86A 3UWVA 3DFTA 4O1BA 4XBSA 3NYZA 3WJZA 2RDWA 4TO8A 3NNTA 1ALDA 3AO0A 3W2MA 1WDWA 3W7MA 1QPRA 1F05A 4IMEA 4AVFA 5LNUA 2H8ZA 4O12A 1IXOA 1FWTA 2Y89A 3FKKA 4JY8A 2QCHA 3QPYA 5CGQA 3LERA 3A24A 3W1TA 4LVAA 3EWWA 1ME9A 2E6AA 1A5BA 4E38A 1LRTA 3SIZA 2B7NA 3W70A 3GXPA 1EP3A 4UIOA 3MHGA 3W7GA 3SSJA 3L5AA 3EEGA 3PSVA 3LLDA 3QC3A 5FESA 3NDOA 1JCNA 4GUHA 2YX0A 3KRUA 3NVTA 3FLUA 3BLEA 4LW7A 4RZ4A 5F4WA 3R13A 3STEA 1N8FA 1MEIA 1OVDA 2OJPA 1OK4A 2V5BA 1UUOA 3A5FA 2NXGA 1KM0A 3W72A 4JX5A 4BK9A 4O15A 1A5CA 3WJSA 2YW4A 2CLKA 3TJLA 4JTLA 1TPDA 3W1QA 4C1LA 4HSOA 3FFSA 1FY6A 1K3UA 3CC1A 4UFJA 1XBXA 3M41A 3OG3A 2VXNA 1EWEA 2DU2A 1TREA 1HG3A 1YXCA 1QPQA 1TPWA 1NSJA 2Y7EA 2QUUA 2A21A 4RX0A 5EKYA 1LRNA 4I7WA 1TPB1 1W5OA 1R46A 3ABSA 2WKJA 1TV5A 1FWWA 4HNUA 5AC7A 4QIUA 2ZZ7A 3LHYA 1JRBA 3W87A 4R53A 5K3VA 5LNRA 2YXGA 4P2VA 3HPXA 1H61A 5LGXA 1KM6A 3LI1A 3W7QA 2PC4A 4N9EA 1ME7A 3BG5A 3KOFA 4KFNA 3MHUA 4JTGA 1I2NA 2ZA1A 4JTFA 1VS1A 5AHNA 5FEZA 3HG4A 5G2HA 4UUIA 2VFDA 3NQCA 3LGEA 1W5QA 2O7SA 3RFAA 3SW6A 3TSMA 3PBVA 1KFKA 2VFIA 5L6UA 1A53A 4K7YA 3EWBX 3LI0A 3BW4A 1H63A 3BPWA 3IVTA 3TW7A 2NZLA 5E93A 3UXAA 3KVMA 2RDTA 4I9AA 4O13A 3CB8A 1C9DA 1G67A 1GT8A 4AF0A 3TUUA 4YCOA 1LCOA 4K36A 1TCDA 1I8JA 3W1XA 1LRQA 2Y63A 3NQ2A 1VHCA 4PC8A 1HUVA 3N2XA 5LGZA 4IPJA 5AB3A 2NUXA 3K30A 3NQVA 1W3IA 5MHBA 2A6NA 3THQA 3FYOA 1KLZA 2GUUA 1R2TA 2Z6IA 2ZRUA 3PSWA 3G22A 1NEYA 3R5EA 4WJEA 1X1ZA 5D2VA 3QYQA 4JTEA 4WUIA 1F7BA 5IM51 5FF2A 4MY8A 1GEQA 2BX7A 4CQ8A 4DQWA 3KFTA 3TXVA 1AK5A 1VYRA 2D73A 1WQ5A 3HPZA 2VFGA 5CPLA 3TH6A 1TO3A 5TIMA 1LROA 5DY3A 1DJNA 1M5WA 3M43A 2FIQA 2TSYA 1LORA 5T26A 3KRSA 2Y6ZA 1EPXA 1GJPA 2FJKA 2R8WA 4PA8A 5CSRA 1GOXA 1KM1A 2C19A 3E0IA 4QJ1A 4GRSA 2DORA 1C8VA 3LBMA 4Z08A 2VELA 4FNPA 4NT0A 1Q6QA 3C3NA 2PURA 2CLFA 3BW3A 4QQ3A 1TPEA 4D2JA 2QDGA 4MYXA 3FS2A 1XBZA 2C14A 2WO5A 2QDHA 4E0CA 5LKYA 1TTPA 1OFDA 3W74A 3P80A 3WK1A 1VJIA 1JCMP 4NX5A 3UWWA 2ZBTA 2QAFA 3NQDA 1NVMA 3LB0A 1FDJA 3LM7A 2GJNA 3GKAA 2NV2A 1UASA 3M5VA 4HNTA 3DFQA 5CPMA 3EX3A 1XM3A 1RQBA 3IGUA 5AYYA 2A0NA 4LC6A 3O8AA 1SSDA 1JUBA 4ICNA 4GNJA 3P62A 3CEPA 2TYSA 1EX5A 4XBKA 1WOAA 5KZDA 3W23A 4DEFA 1XUZA 4AEOA 2HSAA 5HNRA 3NPWA 2QF7A 3LOTA 1AL7A 2V30A 1OFRA 4AH7A 4N9CA 4IMCA 3PY2A 1K7XA 5F1UA 2W79A 5F4XA 3T40A 2YGYA 1EIXA 4GUJA 5LNVA 1Z48A 4ZL1A 5KITA 1JQXA 3LHUA 1EWDA 1QR7A 3KVJA 3O06A 1KBIA 4JS3A 4O1AA 4ZMGA 4NZFA 4ZQOA 3NQ6A 5E1QA 2CZ5A 1XFBA 3FYPA 2Y7FA 1J2WA 3P81A 4FO4A 2P0OA 1LM1A 4OE7A 3C6CA 3W7NA 4NUWA 3TNOA 1Z42A 5HINA 3TR2A 4CQ9A 3B06A 3L66A 4DO6A 4QM1A 2NWRA 1TQJA 3QMSA 1H50A 1VLWA 2BLEA 2ZZ6A 1LZOA 4FIRA 3NG3A 4I7UA 4UNLA 3S1XA 4UR8A 4LVDA 1SFLA 1LOSA 1W56A 4MZ8A 3C2RA 1Z41A 5DCDA 5DELA 4UTTA 3GIYA 4JDBA 1KTCA 3TMQA 1GWJA 1QMLA 1M7PA 3NQEA 3MBDA 2TPSA 4GFSA 3TE9A 1MXSA 3O6YX 3NL6A 3MP4A 3W1MA 1ZAHA 2YR1A 3TSBA 3ZFHA 1E51A 2CW6A 2IQTA 4NX0A 3BO9A 1IF2A 1MZHA 4POCA 1VCFA 4OHQA 1FCBA 1KLYA 4QISA 2GJLA 2QUTA 3HG2A 2X1UA 1PHWA 1RZMA 4QSHA 1G4EA 2Z1BA 3GR7A 3OEXA 4A29A 3ZS4A 5IBXA 3UQNA 4LT9A 4LWWA 1RD5A 1FBAA 1P0KA 2ZA2A 4OBTA 3W3OA 3UYCA 4FIQA 2OX1A 4WXZA 4K37A 5DY2A 1T0OA 3HG3A 4I7VA 2RH9A 4NQ1A 3S5YA 1SW3A 1LBFA 1M6JA 5HJLA 3G8RA 2V5LA 4UTLA 3G1YA 4JIPA 4TX9A 1PS9A 1D3HA 3UNDA 5BOOA 2CZEA 3PULA 3DH7A 1OYBA 1W5MA 4DBEA 1VC4A 4TU1A 4U4MA 3G1FA 4JX4A 1B4EA 3C2FA 4LVFA 2VFFA 3LHWA 1WV2A 4O8RA 1EUAA 3FEMA 4KWVA 1JR1A 4GE8A 4S2CA 1TV7A 1I45A 1G4TA 3N9SA 4GWEA 2B7OA 4UTMA 2OCZA 2Y7GA 2EHHA 3G1HA 3PUDA 3W7OA 3CWNA 1DORA 3HPSA 3S1UA 2YFOA 4O57A 3B0PA 4AXKA 1CI1A 2WJZA 5FF3A 1H62A 2XN0A 4LS2A 4LVGA 3TFCA 3ATYA 4UTUA 3TW6A 3SGUA 1ADOA 3IIZA 1WA3A 4UTHA 5DCEA 4KKXA 2A2IA 2Y85A 3GDLA 4AHOA 4IMFA 2CZFA 1GPWA 4ML9A 1P1XA 2EGZA 3VI2A 4NVTA 1QO2A 3GZ3A 1IGSA 1XCFA 1QPNA 2ABBA 4Y96A 3S5NA 4JTJA 3DZ1A 3NEVA 3UY8A 3M47A 4DXVA 1DVJA 1H5YA 2HTMA 4N02A 2X2GA 4ZQCA 5H91A 1U5JA 5C55A 1SO4A 4RCXA 4FNUA 3R12A 4CNPA 5HQEA 3HIJA 2RKXA 1DL3A 2E6YA 4M5PA 4L4LA 3CU2A 2ZRWA 3EKZA 5KMYA 3PBUA 1LOLA 4JTSA 3TAKA 2V2HA 4OT7A 3HMJG 2NX9A 1OHLA 2QCDB 2VENA 2ZTJA 2WPBA 3L68A 1H7RA 1V5XA 3I7QA 4N6EA 5K9XA 1KBJA 3NPVA 5FI8A 4AMAA 3M7WA 1TV8A 1PE1A 2R14A 3NOEA 3EWUA 1Q3NA 2ZFAA 1R2SA 3G0UA 3LCHA 5AN7A 3EWYA 1HO4A 2GQAA 2QCDA 3HGRA 3M6YA 4ADSA 2EF9A 3C2VA 1YPFA 5D38A 4DF1A 4N4PA 3EX4A 3HGSA 5BW6A 1DOSA 2OZ0A 3N2MA 3I7RA 4CLMA 1ML1A 5FEPA 4QITA 3W7CA 1TPC1 4UTTC 1SW0A 4H4IA 1D9EA 1O4UA 3O63A 1TIMA 2CFFA 3CEUA 1ZY9A 3GDRA 4MFDA 5EBUA 3NL5A 3PF3A 1KFEA 1FDZA 3B03A 1ZAIA 3LTYA 4Z0JA 3W1AA 3W7EA 4M7TA 1LLZA 4ZQMA 2H3BA 3CT7A 4AWSA 3RMJA 4RKAA 4Y9AA 3SECA 5TQLA 3S5OA 3LRKA 1WX0A 3QQ0A 3W1PA 3YPIA 4A2SA 4E2DA 1W54A 1VCVA 3GVGA 3FOKA 1GYLA 2DJXA 3EB2A 1K8XA 2ZRZA 1OFQA 2QJGA 1DHPA 4UMCA 5CPOA 4BWLC 5J5DA 3EWZA 1RR2A 3H55A 4MFEA 5KTLA 4ADTA 1GTEA 3W76A 1QCWA 4IOTA 1AL8A 1TSIA 2G97A 2J88A 4YL2A 2I9EA 4L4MA 1W8SA 3U6WA 3MYPA 2G5WA 5F2MA 2CLHA 1HFBA 4DBDA 3QF0A 4NJJA 3QSTA 2C18A 3W84A 3LXBA 1QAPA 1NF0A 1KM3A 1SZGA 2C6QA 1PL9A 2ZRYA 3E49A 2FB3A 2E5BA 4N2YA 4UTKA 1KFJA 1BTMA 2NWSA 1QOPA 3WK0A 3HQ1A 3B04A 1FCVA 4IPIA 1SFJA 1K7FA 2A7RA 1DBTA 2ATMA 4DO5A 5LNWA 5I3KA 3GNNA 2NXIA 3DHFA 3SJ3A 5D37A 5HWMA 2J24A 3CM4A 3GYEA 3W1LA 1OYCA 3LX9A 4WQ6A 1LYXA 3W9ZA 3PR2A 4GJ1A 3U2OA 3W2UA 1XL9A 2EPHA 3BVJA 2QKFA 2QCGA 1RQHA 5D2TA 4UC5A 3LV6A 3CIWA 3C61A 3TIMA 5LSMA 4BFAA 1OYAA 4XQ6A 1YDVA 3GR8A 5AHMA 3W7DA 3N14A 3P84A 5K2ZA 4FF7A 5IBXC 3MJYA 3W7PA 2WNZA 8TIMA 1K8ZA 1UBSA 3ABQA 4JYDA 3TXZA 1EB3A 1OFEA 2X30A 3UZJA 4IGHA 4ZQRA 4UCGA 5SWUA 3PB0A 4NXSA 3JS3A 2GVGA 1FX6A 5FF7A 1W37A 3PG9A 3LCXA 2OT1A 2W6RA 4O53A 3DKJA 4JDYA 2CLMA 4JTIA 4Q4KA 1B57A 2BZNA 2ZYFA 4R7JA 3UWQA 3FA5A 4LS0A 2ALDA 2PRHA 3QEZA 1HO1A 2YZRA 2H6RA 3ABOA 4BI6A 3CQ0A 3DAQA 1B4KA 5D2YA 2X1SA 3IVSA 1DKWA 4FNQA 3KVLA 3M5XA 2JK2A 3OVRA 4FEZA 1H1YA 3G1SA 4Y8FA 2EAWA 3PBWA 4IX0A 1OFOA 1I2RA 5D32A 1GVFA 1YXYA 2GQ8A 4CNOA 4AAJA 2NLIA 3GDMA 2CLOA 3S42A 2C15A 2GQ9A 2GPTA 2AQWA 2E6DA 3DU0A 1S5VA 3MBFA 1JJKA 1P5BA 2VEIA 3E12A 3U8GA 5C2XA 3GNDA 3C4UA 4N6FA 3L65A 1IXNA 4MKNA 1FUYA 4HT3A 4UFMA 1O95A 3EX1A 4WD0A 1GZGA 5C54A 1SW7A 1TRDA 4DF2A 1FWSA 4A22A 1O5XA 1LTDA 1AG1O 1GVOA 2UV8G 3GDTA 2ZZ3A 1IIGA 1W5PA 4LOCA 5A8GA 3W7LA 4OU1A 3W73A 2BSLA 3GDKA 4UR7A 2DZWA 4AHPA 4NXKA 4GBUA 3LHTA 3MUXA 4O18A 5D03A 2V81A 3VCRA 3NZRA 2CLEA 1IXQA 4NJGA 2A5HA 4BWLA 2TRSA 5KZMA 5CZJA 4JEQA 3P60A 5AC8A 2AGKA 1KTNA 3NQFA 3KHJA 3W85A 1SO6A 1FWNA 1L9WA 1S5TA 3S8HA 3W22A 4JTKA 3W1RA 3STCA 3Q2DA 3PS7A 3FIGA 2QJIA 4Z1DA 5FEXA 3CTLA 5EYWA 4AWUA 5FF0A 1VQTA 1XDLA 4MLRA 4K7VA 4LV9A 3JRKA 3P5ZA 2C13A 3VKJA 1FXPA 1JULA 2FPYA 1JUKA 4HKPA 3G24A 2Q8LA 3TQKA 3TC6A 3PB2A 3W2JA 2ATSA 3LXCA 3QMRA 2TMDA 1N55A 3N3MA 1WXJA 3QFEA 3EXTA 2Q3OA 1KA9F 7TIMA 4WOZA 1VCGA 3DHDA 2V9DA 3W7JA 2FPVA 3W7IA 3DI1A 4FX7A 3TSDA 1W1ZA 1H7WA 5DBUA 4NNBA 4CQAA 3PG8A 4IXXA 4M7SA 4NJKA 1F2JA 5CKSA 1KV8A 5AYXA 3W75A 5D02A 4UNKA 3V1PA 4RLIA 4TMBA 5CZ0A 5HMSA 4HNVA 3USBA 3F1QA 4PFMA 1OG0A 4FXSA 3IVUA 4U28A 5HWNA 2HS6A 2I1OA 1SSGA 5D33A 5K9DA 2NXHA 3MYOA 4PEKA 4UTJA 3P8JA 2H90A 3G1AA 4X9SA 2B0MA 2ZQ0A 4KFPA 1J5TA 1MEWA 2JGQA 3GLCA 2CZDA 3HBLA 3LV5A 2Y70A 4GXMA 3N9RA 3TFXA 3GK0A 3IGXA 4PL2A 1KW1A 3P5YA 4BI7A 2YPIA 2AAMA 5TBOA 3UD6A 3IV3A 4HHPA 3F4WA 2Y61A 4JYFA 3VNDA 4K6AA 1PHQA 3ELFA 3LBCA 1CX9A 3OIXA 1QWGA 4YMZA 1JCLA 3TV8A 1EP1A 3OA3A 3IRDA 3L21A 5FF4A 1C29A 2CLLA 6TIMA 2VOMA 4WY0B 3IIXA 4NJIA 3LLFA 1XUUA 3Q94A 3W71A 3F4NA 2YW3A 4IXHA 3TX9A 2V2DA 1TPFA 4CCEA 2QCCA 4LVBA 3RLUA 3GX9A 5LHFA 3GKFA 3GAYA 2QCNA 5D30A 3SI9A 2P10A 3NPUA 3M44A 4GC4A 5EMUA 4RJEA 5AHEA 1F76A 1M7OA 4YXGA 4O19A 3W7RA 1KFBA 3UPWA 2WNQA 4O4WA 1OFBA 3LRMA 2YYTA 5AYZA 1JRCA 3UWYA 1GG0A 5F1VA 4ORIA 3BLIA 1LBMA 4O1DA 1RPXA 1OFPA 2QUVA 4K38A 4UFLA 1T8XA 3SZ8A 3PWAA 4MUZA 3AJXA 5I3FA 3O16A 4UFKA 4FNTA 1IIHA 2VKZG 4UTIA 5AFDA 3G1VA
chains in the Genus database with same CATH superfamily
3MI6A 2FQIA 1ONXA 4H7VA 3VFLA 1VPXA 1UKOA 1ME8A 3MWCA 2C3ZA 2AMGA 2WAGA 2C0HA 3GXIA 3FSTA 2PBGA 1TTQA 1REQA 2BTMA 2DP3A 3ZOAA 2VX7A 1GG1A 2O9RA 2Z2AA 3S2LA 3TMLA 3C52A 3V35A 1DP0A 4GVIA 2YZ5A 5AYBA 1U33A 3FDKA 2CNCA 1W1B1 4S1FA 3IJIA 2FZBA 3OOQA 2FTPA 5D2XA 1AMKA 4B92A 1DWAM 2V3DA 4F3HA 4AVOA 4QTGA 3WK2A 3ZZ1A 4GQBA 4JHMA 1BVWA 1ISXA 3N34A 3QKEA 1VJZA 1V3IA 1RA5A 1ZJBA 3W27A 1Q2RA 3CWOX 3VGHA 3P82A 4B91A 3BZGA 4AZHA 3BH4A 4BR1A 4XX6A 1Y0EA 4FMVA 3LDVA 3C5QA 1J93A 1J79A 1F6PA 1PUDA 1MNSA 1W0MA 1JZ6A 4CEUC 2O56A 1S2AA 4J9JA 3LSBA 2DUAA 1NY1A 4W7VA 4FI4A 1RY8A 5HR6A 3C56A 1MUWA 4O17A 3T42A 4PRTA 4OV4A 5HJXA 4MB1A 3V18A 4HK7A 3O05A 5K7JA 2XM1A 1WKDA 2XGIA 2J8FA 3URBA 5C8BB 4ROQA 5HPOA 1YXDA 3KVKA 1F73A 4PUKA 4OKDA 2CBUA 2GWNA 4QDWA 4Z42C 4UFIA 1J5SA 4JY9A 2IXVA 4XWUA 4ZB5A 4PCFA 2A3EA 4HOXA 3E1F1 3RO8A 2V82A 3AIRA 4RZ5A 4LRSA 2NX3A 3M5ZA 2BY3A 3I3DA 2OSYA 2E5CA 4LV4A 4ZZ9A 1P6WA 1BQGA 1E43A 3WLIA 5HPCA 1W3NA 3U7BA 1TJRA 3UCQA 4MIMA 2ZUVA 3B9EA 1W9XA 2XINA 1XH0A 4DLFA 4BJHA 3H24A 3S0CA 1CW2A 3CZEA 3K8LA 3SGZA 1I1XA 2VUYA 4DJFD 1PIIA 2ABAA 5M3WA 3SCSA 1UKSA 4AX6A 2WANA 4B5WA 3L4UA 3GFZA 3WJYA 3TQVA 1UW9A 1XYAA 4NRSA 4H7ZA 1HVQA 1YRRA 3QY6A 3N2OA 5HMDA 1UKPA 1RQEA 3EWXA 1IYXA 4YHEA 2BB0A 2X16A 3W01A 3OYZA 3ANVA 1R47A 4JXCA 4E4UA 4H1ZA 3VGBA 2WXDM 1NWSA 1K9TA 2WCSA 5A6LA 5FJIA 3NL2A 3IK4A 1WZLA 3GE7A 3DGRA 1U30A 3MUCA 3VINA 2EG7A 5CPQA 3BGGA 3F4DA 2R24A 3ZLFA 1YQ2A 1UD5A 3I10A 1DQXA 3M16A 4TR9A 5HUPA 4EF8A 4KCUA 3L2LA 2BS9A 2BP1A 2Z1KA 3IANA 3IGSA 3T55A 1R30A 3QR1A 1XLCA 4L64A 1B1YA 4HSNA 4Z1AA 2EPKX 3EBVA 1IV8A 3STPA 5CC5A 2QMJA 1ODZA 2D23A 4MY1A 1DQWA 3W6YA 3ZMRA 3L0KA 3BLFA 2QNEA 5DXXA 4CCDA 4LNYA 4XZ9A 2WBGA 1FVPA 5A2AA 3TJXA 1U5VA 2WWCA 4DO7A 3CYJA 3VILA 2XSBA 4WY0F 3DFPA 4BHYA 4WCJA 1WDPA 5DT7A 1GW1A 1CXFA 1DV7A 1FP9A 3LTSA 4DJED 1B9BA 3L4XA 2FDSA 5C9XA 4FLOA 1UWTA 4UB9A 2J25A 4CNSA 1CECA 3GU2A 2W27A 3DFOA 1W1PA 4NILA 1EDTA 4QHRA 5BCAA 1OX4A 3VC5A 3VD5A 3SQMA 1TRIA 3QM3A 1XPGA 1FWHC 1OZQA 4JN8A 1XX1A 3FNDA 1PXGA 3B8WA 4IL0A 5I23A 3SR7A 1ZCOA 4NRRA 4Z1BA 1W5NA 1PDZA 4KCWA 2IXUA 3MO7A 4MLJA 3NQGA 2VEMA 1TFVA 4LS1A 4ORMA 3H2EA 3MMTA 5LXEA 4XD5A 1UA3A 4CU8A 1P4CA 4M19A 1H7XA 1PB0A 1H7PA 3VM5A 1S5WA 2DZTA 1ONRA 4ZXOA 1XJBA 3VOIA 5K9CA 2Z1XA 4A21A 1XIHA 3S5SA 4ZBCA 1YE6A 3RU6A 2P8CA 2YXXA 5AC4A 1JUEA 1GOKA 2WB5A 3O6CA 4W93A 5I3JA 1JCTA 4IQJA 1T41A 3TZNA 4C6IA 4DJEA 2PDLA 4HTYA 1R9ZA 4MWAE 4M6VA 1GQIA 4NNCA 4O28A 3Q65A 4JNZA 2F6XA 5D09A 4Z0SA 3KX6A 3AU2A 4FNRA 1CCWB 1JEZA 3QSRA 5KEZA 3PJTA 3WDHA 2EXOA 1SMAA 4ZTXA 1VBRA 1XF0A 4F0LA 2FHBA 3ENLA 3QW4B 2J9YA 2PE4A 4OIFA 3RNDA 2V2CA 4S3JA 4U2ZA 5B7ZA 1NFPA 1UWAA 1XKYA 1A5SA 1VFLA 4G1KA 1KQYA 3DBPA 1U22A 1JZ8A 3E96A 3V4BA 1JZ3A 4QEHA 2GYIA 4C6OA 3L0GA 5C9WA 1GVSA 1R0MA 3LY0A 2E8ZA 2HK0A 4LCSA 3VIKA 4O10A 3W0KA 1HL2A 1MQPA 4H6QA 4UBPC 1FXQA 2FHFA 4DF0A 5FEWA 3HURA 4F0KA 1GOMA 1TTJA 3RITA 2QPUA 4AX7A 4C6FA 1J0YA 5FSDC 2VJXA 1XSKA 1BYAA 4MZYA 1X8FA 3FKRA 4AZCB 3DXIA 1VYSX 4UTWA 4LRTA 1O60A 2CWXA 1DTNA 4X3ZA 4LCQA 2ZZ2A 1VRDA 3I3EA 3MCMA 2FMOA 3L2MA 4HYVA 4M8UA 3RM9A 1SUXA 5D8WA 1CDGA 1NARA 3NM1A 2Z1WA 4P7LA 4DJDC 5BXTA 3A21A 3TYUA 5EL1A 4B3ZA 5A8MA 4XKYB 1EJUC 2DZXA 1U1UA 5CH9A 2E9MA 1XBVA 1GQJA 1EZWA 1CGTA 4DPPA 4S3EA 3HMCA 4FZIA 1K4GA 5K4XA 2LLEA 4WDUA 1V4YA 1SZEA 2P5NA 5BRBA 4JTUA 3LCFA 1L6SA 1WKFA 3V3WA 4HCLA 5C9RA 2DZPA 2XG9A 3W1UA 2YFNA 1WYIA 4ZVJA 2PP0A 4WK9A 2WVVA 3VGDA 4QFUA 4LANA 5FD0A 1LBLA 5AHIA 3VMOA 5G1MA 4MSSA 1KWGA 3G8EA 5E0KA 1ADDA 1QBAA 1KXHA 3UETA 3CUXA 3A5VA 3WX7A 2R1NA 2VCAA 3WL0A 3BGJA 3M0VA 5EMJA 4QNEA 3OLIA 4KIEA 2GJRA 1X7FA 3KS5A 5LA2A 4MJMA 5TNVA 3D0CA 3NO5A 2OLSA 4IX2A 2TAAA 4UQ9A 3M64A 1PPIA 3UG4A 2YCEA 1DE5A 1XG3A 1XLHA 3CUGA 3WNNA 3REQA 2WSYA 3G3DA 1UQYA 3MUY1 1KFCA 3R89A 1OFAA 4DHGA 2MANA 3IIVA 4H2HA 4HQVA 4Q8TA 3MO4A 1UB3A 4WEVX 1ONWA 1G69A 2EG6A 3G0XA 4MB3A 2B4GA 3QKZA 2WMKA 4EF9A 1YDNA 1CB7B 1V7AA 2PWHA 1MWOA 1YTDA 2HWGA 1C8XA 3EEZA 3FA3A 4DNHA 1NOWA 4O0QA 4L9YA 4RXFA 3QZAA 3AFBA 4ZO9A 3ITGA 4IUOA 1DXIA 1BWKA 3N19B 5F4SA 3MSDA 1DIDA 1RP9A 1U2YA 2WZTA 3M7SA 4F2BA 4DELA 4AIEA 3GHSA 4KW2A 3EPOA 4IP5A 1JQVA 3IARA 1MSSA 3W07A 1E6QM 3FJLA 2CBJA 1XYBA 3MSYA 1XLMA 4M24A 1L0PA 5CZTA 3M5YA 2Y5EA 4IISA 3NQAA 1MUCA 1E5JA 3PZUA 5G1TA 3ARUA 3EGJA 3FV9A 2HMCA 1ZNNA 3R6IA 5A1AA 2PGRA 4V27A 3KCOA 1Q6EA 3WBAA 3N73A 1GNXA 3WLNA 1GYNA 5DBTA 1ZPTA 1WXZA 4YVVA 5JUVA 1B0IA 3CL6A 4UOJA 1P6BA 3DIPA 2ZUSA 2D2HA 5FJRA 3QMTA 5REQA 4J3SA 1AH0A 4AYGA 3D46A 1EEXA 2VC7A 5G4EA 4WGHA 1WE5A 2E4TA 4GY0A 3DG6A 2FZ9A 4ICMA 3N29A 1XD1A 5I00A 3UWVA 3WJZA 2X41A 2RDWA 3EDJA 2DSWA 4TO8A 2WQDA 1WDWA 4UQAA 2W61A 5LNUA 4O12A 2H8ZA 3FKKA 1L8NA 4LVAA 1ME9A 3RDKA 2B7NA 3WF1A 5HNUA 1EP3A 4HCDA 4KWOA 1XRTA 3WUGA 3WCZA 3BLEA 4RZ4A 5EMLA 3VOGA 3N15A 1FOBA 1N8FA 5DT5A 1V0LA 1XRFA 1OK4A 2ZWYA 3A5FA 2NXGA 3W72A 1A5CA 3WJSA 4CUCA 2DDXA 3SQSA 1XDJA 7CGTA 1MYRA 4C1LA 3O6AA 1P48A 1UWIA 1XBXA 3OG3A 2VXNA 2DU2A 4TUFA 4D9PA 1K70A 1NSJA 4AZIA 2C8NA 4DN1A 2Y7EA 2QUUA 1TPB1 1E9ZB 3CYVA 2CERA 4AEFA 1R46A 3ABSA 2WKJA 3S1GA 4HMCA 1FWWA 3NOYA 4HNUA 3TYCA 2ZZ7A 2BODX 4J3TA 4GVHA 5K3VA 2XH7A 3TWAA 1MXGA 1H61A 5LGXA 3W7QA 2NQZA 3AIBA 1RALA 4N9EA 2GK1A 3BSMA 1F3WA 3KOFA 4KFNA 3BMWA 3OA5A 2E1WA 2PB1A 3QHNA 3HG4A 4UUIA 1TUFA 2D0HA 4OVXA 4HMEA 1W5QA 1AVAA 3LZ3A 1C8QA 4US6A 3GG0A 1W32A 4WIWA 1MDRA 2NZLA 3IS4A 2FGZA 3BV7A 5CGTA 3CASA 3TCSA 1QHZA 3TUUA 3PZOA 4YCOA 1MRQA 2NLYA 3S2JA 1I8JA 3W1XA 3A3WA 3BICA 1PWMA 4YYFA 4YTRA 1AD1A 4PC8A 1HUVA 2G41A 2PDNA 1HKIA 3N2XA 5LGZA 3GTNA 1PIGA 2P0IA 2OELA 3IAQA 1DJGA 3VABA 3USZA 1UD6A 3CUJA 3PSWA 3G22A 3IGHX 4AC7C 4ES4A 1X1ZA 5D2VA 3VKCA 3ONCA 4JTEA 4FOKA 5HMFA 2PP3A 4M80A 4FR6A 2BX7A 3CUIA 4DQWA 3LM3A 4Q22A 4L56A 3TXVA 1RH9A 1VYRA 3QFWA 2WVTA 3ZR5A 4UNIA 2BDQA 1V3LA 5I06A 3QTGA 3SUVA 4GFIA 3CAWA 1DJNA 1M5WA 3N13A 3M43A 2FIQA 3UT0A 2Y6ZA 2W66A 3BQ6A 1R9XA 4EWJA 3M0JA 4LAZA 2FJKA 3KBSA 5CSRA 5ABFB 2PEVA 3R58A 1KM1A 2C19A 4QJ1A 1E4NA 1SVDA 1CXEA 2BBFA 4GRSA 3LBMA 4Z08A 4NT0A 3MU7A 1JZ7A 3PBGA 1QI5A 4H9MA 1PSCA 1M41A 4ZO7A 3V5CA 3GRIA 4NAEB 4R7WA 4QJ5B 2C14A 2EG8A 2WLZA 4DAIA 2QDHA 3EMQA 3FK4A 2ISDA 1TTPA 1OFDA 4H9XA 3WK1A 3RAOA 1JCMP 2YLAA 4NX5A 5XINA 1GJUA 3GNOA 3NQDA 1VBJA 4IGMA 3RM4A 1BYDA 4HZ8A 1XGDA 3LM7A 2GJNA 4DUVA 4MAZA 2VC5A 1IT8A 2G0WA 4HNTA 3XIMA 5CPMA 1XM3A 3IGUA 1AUSL 1RD6A 3TONA 3O8AA 1J6OA 4DJDD 1CLXA 2BGNE 1EX5A 4UQBA 2VHLA 2DUZA 2XIMA 3W23A 3IV8A 4AEOA 1IQ8A 5HNRA 3LOTA 1AL7A 3OO2A 3CL7A 2Y8KA 1K7XA 3T40A 3H7UA 3BXWA 1LL7A 3PTKA 1HKMA 2VDGA 4LJ3A 2ACQA 2MNRA 3KVJA 3O06A 4ZMGA 3UXKA 2A3HA 3NQ6A 2IPWA 1XFBA 4S3CA 4B16A 3APTA 4FO4A 3CAQA 3ITYA 1LM1A 3VKBA 5DMNA 3RPTA 4NUWA 3ZYZA 2RJGA 3TR2A 1NFGA 4CQ9A 3B06A 3L66A 5HXMA 2B81A 3PPFA 3O2LA 2NWRA 1TQJA 3QMSA 4LUTB 4Q4PA 4IT1A 3PJXA 4UNLA 1VFHA 3S1XA 4UR8A 3AQUA 5DQPA 2IUZA 4D1IA 7XIMA 4BQ3A 4JDBA 1Y5VA 4PB3A 5E0FA 4A35A 4GFSA 5HA7A 3NL6A 2R1PA 2ZE3A 3TSBA 3PZTA 3BO9A 3S9ZA 4OHQA 2ZC1A 3OQ8A 1YEYA 5TF0A 4QSHA 4TTGA 4LX4A 1QVBA 3SCVA 4V33A 4ZOCA 5LIXX 4A29A 1S3TC 5CGMA 3UQNA 4GQGA 1FBAA 4K8GA 4OBTA 3W3OA 1JGMA 3EPNA 2VD8A 3DYOA 3ARWA 2VGGA 5DY2A 1T0OA 3HG3A 1KR1A 4JFVA 2Y5SA 1DJXA 4ZFMA 3S5YA 3UJRA 5MKGB 3VNYA 1Q7MA 2ON3A 3KBJA 4IFRA 4UQEA 1M6JA 4LEFA 1JNEA 1MUMA 4OZOA 4UTLA 4I8DA 4XO6A 3G1YA 2VRJA 4MTVA 5DMYA 3UNDA 2CZEA 3AS1A 3DX5A 1T6MA 1W5MA 4DBEA 2IKGA 1LWJA 3L4VA 1VC4A 3GZAA 2C1GA 1B4EA 1QU4A 1PBGA 3VIJA 1I45A 3S2CA 4GWEA 3GXDA 5A8PA 4KH2A 3PBMA 1YE4A 2YA2A 4R9OA 1ITXA 2YFOA 4LUTA 1CI1A 3VO0A 3VOFA 1PAMA 2XN0A 2VP8A 1G1YA 2XH4A 2F38A 3IUIA 3SDOA 3TW6A 2BHYA 3BUVA 4UTHA 3TJ4A 5DCEA 2YOCA 4KKXA 4XD4A 4S39A 1IZKA 2CZFA 4ML9A 1P1XA 4E6MA 1DWJM 4NVTA 1EIBA 1QPNA 4Y96A 2GGGA 4I5UA 3A3HA 3ARXA 4GK8A 5CBIA 3DZ1A 1XINA 3UY8A 2Y8VA 4N02A 2X2GA 4ZQCA 4G7FA 4M51A 4HMDA 1SO4A 5C55A 3R12A 4AQLA 4WDXA 5HQEA 1JPKA 3FY1A 4CD6A 1DL3A 1JXKA 3AIEA 2PWUA 4B2DD 3DHUA 1HJXA 3WD1A 2XDFA 1YBQA 2OEKA 4GYKA 2GUYA 5BYWA 1DJWA 1DEDA 3M7WA 4I90A 5A6SA 2ZFAA 4LAUA 1R2SA 4M0XA 3EWYA 4KGLA 4Q4QA 1XYFA 4PTMA 1NELA 4WF7A 1SYTA 3EOUA 5E6YA 4Q6JA 3EX4A 1OCNA 1E72M 2W5FA 5BW6A 1BF6A 4CLMA 4QITA 2HE8A 4R85A 3BAIA 3W7CA 1QJWA 1TPC1 4CEXC 2VR2A 2IKJA 3DN5A 3O63A 3CEUA 3WENA 1KFEA 1FDZA 2X0SA 3WNPA 3H6OA 4Q8NA 1FH9A 1E3ZA 3HM7A 1US2A 3CT7A 4RKAA 3KUMA 1TV3A 5XIAA 4PBEA 3LRKA 1H11A 1DIKA 1WX0A 2WMIB 3VCCA 3RPDA 2FKPA 1VCVA 4K1WA 3JUGA 1GYLA 2DJXA 2ZRZA 4UMCA 5CPOA 1W3JA 3CV1A 4HHHA 9XIMA 3ZIZA 1RR2A 4JPGA 3LPPA 2GFTA 3EOOA 5HANA 1BXBA 3ZJ6A 1QCWA 1TSIA 1PTAA 4HJWA 4YL2A 4L4MA 1W8SA 5A94A 5F2MA 3ZT5A 4DBDA 1EBGA 3QF0A 4L61A 1AQMA 5A6JA 2XVGA 1NWRA 4FAMA 3ZJ7A 1IZJA 1NF0A 3R0KA 1KM3A 3EDDA 2C6QA 4HNLA 1M04A 2FB3A 3MPGA 3N12A 4PRWA 1ECEA 3VD3A 1Z7AA 1BTMA 4G56A 5CPSA 3DERA 2VI0A 4H2CA 2CKSA 4YTTA 5E0CA 1UG6A 1QUMA 2YKKA 3GYEA 3UZXA 4HZ6A 3KCJA 3PPGA 1OYCA 4YVPA 3CHEA 3TP4A 2QV5A 3PR2A 3WEMA 4MDOA 2QXWA 3BVJA 1MQQA 2QKFA 1BRLB 3EA3A 3BOXA 4NP7A 5LSMA 4BFAA 1YDVA 4AD2A 3N14A 4PMUA 4JTRA 1EOKA 1VIZA 5IBXC 2O92A 2BVWA 4R3UA 1K8ZA 1PKNA 2D69A 4E3TA 3QR3A 1NWUA 1EB3A 2YCLA 1IWBA 1F8MA 3OZMA 4UCGA 3RRXA 2X7VA 2DQWA 4JFWA 3PB0A 2GVGA 1FX6A 5FF7A 4WSHA 3TEVA 1K9FA 2WJDA 2PGEA 6A3HA 3ARZA 2W6RA 5BRQA 3TOYA 4F0HA 3WELA 2BZNA 4MDPA 2ALDA 2I5GA 1KRMA 1PTDA 1V6WA 2DW7A 3LNPA 2DT1A 2WSKA 2PU1A 1B4KA 3CZLA 1X7IA 4YYCA 3NQBA 3M5XA 1UOZA 3OVRA 2EAWA 1SR0A 1OFOA 5D32A 1XLKA 1GVFA 2G3FA 2GQ9A 2W67A 2G3IA 2AQWA 2E6DA 1RK5A 1XIFA 5CJMA 1FWAC 2ZADA 4PTDA 5XIMA 3L65A 1IXNA 4MKNA 1FUYA 4F79A 4UFMA 1O95A 3S6OA 3IUHA 5C54A 5IOBA 2BV9A 4DF2A 1UKTA 4A22A 4GO9A 3F4VA 4RPPA 1W9PA 3GDTA 1XCXA 4B4HA 3E6EA 1IIGA 1JFHA 1BG9A 2VL4A 3W7LA 4FF5A 3GDKA 4UR7A 2VD9A 1UR4A 2DZWA 4EE9A 1O66A 1V3JA 3CB3A 5LXXA 1XICA 5D03A 2Q8XA 2CLEA 3HPAA 4NJGA 2A5HA 4BWLA 2BVYA 3B8IA 3ZT6A 5AC8A 2AGKA 1QRQA 4GI8A 3W85A 1MDLA 3W22A 2XZ9A 3Q2DA 3ZVIA 3PS7A 4GH1A 5FF0A 1J12A 4LV9A 3NIYA 2XPKA 3JRKA 3OJGA 3P5ZA 3BANA 2C13A 1JUKA 2Q8LA 3PNZA 5CLWA 1GKQA 3PB2A 4TVUA 3V1HA 3QMRA 1W3LA 1WXJA 3QFEA 1UWUA 4M1BA 1BSLA 3B9AA 1E6RA 2YA0A 2ASHA 4DX3A 5E6ZA 3E0WA 3W7IA 3DI1A 3B0YA 1B9ZA 1VEOA 1W8GA 1KV8A 4RLIA 4TMBA 4HNVA 4S23A 1XIJA 1D3CA 1SSGA 1TVPA 1V6YA 2PLMA 2ZQ0A 1LG1A 3E2QA 3KW3A 4HCHA 1EJ7L 2JGQA 3WLRA 3LV5A 2VRKA 3F2DA 3N9RA 2PLJA 2GK1B 4BI7A 3LPGA 2EPOA 4IM4A 4ZODA 3UD6A 1RJPA 1W3KA 4JYFA 2QHAA 3GIPA 3LBCA 1QWGA 1JCLA 3OA3A 1KGWA 3IRDA 5FF4A 2VOMA 3GD6A 4B2DA 4NJIA 1H5VA 3MA8A 5AY7A 3KLKA 4QAWA 3RLHA 2YW3A 4IXHA 2V2DA 1TPFA 2GDUA 3ZSTA 4RE2A 4Z2KA 2DPEA 3CJPA 4A05A 1R5YA 2Z7GA 3PTQA 3GKFA 1AODA 2QCNA 3T0AA 3R94A 4LYRA 5FJTA 5EMUA 2O9OA 5AHEA 1WNOA 1V6UA 3H4GA 1V79A 1QBBA 3AHVA 2NV9A 1L6GA 3SN1A 3UPWA 4DLMA 4D8ZA 4XZIA 5MF5A 2RDXA 2C71A 3W81A 3N25A 4K38A 2PDGA 3PWAA 4P8UA 3BCDA 4MUZA 3AJXA 1W6TA 3MDWA 4UTIA 5AFDA 1P0DA 2WMIA 3N11A 4X0NA 4XKYA 5GVJA 3K4AA 4LB3A 1HTIA 3O15A 2PWFA 4OBRA 3M4HA 4OWGA 1OF6A 2QJMA 4PTNA 1TUXA 5DX7A 1SO3A 4M3PA 3E9AA 3WJXA 4JIEA 4OOZA 2Q3RA 1EA0A 5CPTA 4HPXA 1TWIA 1IEXA 3WN6A 1B30A 2CYGA 3U5YA 5U4NA 4NAEA 4K68A 4C7FA 2PTWA 4P5UA 3S46A 1T99A 1VLIA 1S2VA 2IQ0A 4HNOA 2QUNA 1WAWA 2GSHA 4Q8MA 3PZQA 3BOLA 5H2ZA 4MPQA 1M3UA 3BG3A 4ZXLA 1GORA 3G3MA 1FRBA 4NKCA 3F2CA 4O14A 1UMYA 4H83A 4NF7A 3T4CA 4NZJA 5CCZA 2XN2A 3ALGA 3VD4A 4JYEA 2WZMA 3TN3A 4AIUA 3FJ6A 5DXYA 1HW6A 3GB6A 2V0TA 3UG5A 3S47A 3GW3A 4RZ6A 1L2QA 3AMCA 4C65A 4R88A 3FSUA 5I3GA 1FWJC 4WVXA 3PVFA 5JVLA 1HJQA 4B5UA 1A47A 1MVYA 2QR6A 3BZJA 2QCFA 3AS3A 1D2KA 5IRPA 3C2OA 2VGBA 3IWPA 2INEA 4HZ7A 1XW8A 4PYSA 1M03A 5I02A 6TAAA 3MUIA 5A8NA 3WG6A 3CLWA 4N4QA 3T8QA 1MO0A 2W3ZA 1BYCA 4AY7A 1WUFA 3BGAA 3M0ZA 1XV8A 1R7OA 4GZIA 2E68A 3GVWA 2C91A 3CPGA 2QULA 1GZJA 3RILA 3BLOA 3S9IA 3RF9A 2PFHA 1HGYA 2DZAA 1UPPA 2DZVA 4ZOEA 3AXMA 1JAEA 3SEPA 3GXTA 4A6GA 1RCOB 1A0DA 1FCUA 3KRZA 4XB3A 3OZYA 2C1IA 4GA8A 1NH6A 4JCLA 4GO8A 3WQ4A 2VEKA 5CSYA 1XXXA 3QPEA 4EACA 1BXCA 1FHDA 3S2NA 1GTHA 1CPUA 3GNPA 4MVAA 3QJAA 2DZBA 2F7FA 5MKGA 2OFJA 5RUBA 2OT0A 3G5EA 4W5ZA 1QFEA 3TKFA 4Q4RA 4M6QA 1Q85A 4RPQA 1XRVA 4GXPA 1JF5A 1SJBA 2E3ZA 3MZ2A 3GC4A 1T7LA 1MQRA 3BAKA 2GUBA 3T08A 2XTKA 3TDFA 2QEZA 1C8YA 4HNNA 2NT0A 5LZLA 1TJPA 2CIPA 1VH7A 4GLEA 4BQ2A 3CV7A 1W31A 4U3CA 1H60A 4FPSA 4O4VA 1O5QA 3HG5A 1BYBA 1IEWA 5DCBA 1H4PA 2VZVA 4HBKA 2OSXA 3QW3A 1RCXB 3UPBA 4O11A 1XSJA 1HQTA 2WSPA 4UWMA 3BE7A 4NNAA 4CQCA 2PMQA 4U3AA 1HL9A 3R43A 4EVZA 1FWEC 1XLFA 4GQQA 2GGIA 3TC7A 4F48A 1JPIA 3L4TA 3O1NA 4M6PA 3WFAA 4C7GA 4LY8A 6ALDA 3PP7A 3TROA 1WZMA 5CG7A 3D3AA 3KTSA 4MADA 4GGBA 1C3FA 1OJXA 3LYEA 4QGCA 4JICA 1EP2A 4YCPA 4QG6A 1AJZA 1J18A 1ICQA 2DSZA 2V38A 1A5AA 1L8PA 3MY9A 2XN1A 3V0SA 3BSGA 4Z2GA 1WOBA 3S3GA 1UC4A 3CH9A 1JPMA 3WLKX 3NQ7A 2Y88A 4X9YA 1U83A 5E70A 5HATA 3LCLA 1VKFA 2FVLA 1V0KA 3VNIA 1JCXA 3O0FA 1XYCA 4PMRA 5D4YA 4ZE5A 4Q33A 2ACRA 1GVEA 4I3GA 5AVNA 1T40A 3SUTA 1XI3A 3GU1A 3H21A 3NGFA 3SFKA 1ZSXA 1QNRA 4BEUA 2V5CA 2X42A 3MKVA 1RBLA 1PKYA 1GCYA 2VT0A 3TLLA 4C90A 4JGDA 5D2WA 1J0HA 5C9UA 3B0VC 1MXDA 3UFYA 3PUOA 4FS9A 1VBUA 3H2OA 1CIUA 1P0BA 1XKJA 3WMCA 3SURA 4GI6A 5HNNA 1YDOA 2O7QA 1SZFA 3W02A 3C8FA 2WOQA 4Z1CA 1FWGC 1R2RA 1AMYA 2VX5A 3B8UA 1X39A 5CC6A 1GVQA 3VE7A 4K39A 3UJEA 3VIMA 5BWFA 3E5BA 4LYPA 4FA3A 4MYAA 2W4XA 3U9IA 2WPGA 1EXPA 1R86A 1SZNA 2WVSA 1HN1A 2J7GA 3BG9A 5G5IA 2XUCA 3M07A 1KM5A 2GDQA 3UERA 1OGBA 3S5ZA 3AS2A 4I6VA 5IXEA 1WBHA 4HOWA 1ZTVA 3L4WA 4N42A 3N04A 2WSRA 4Q3MA 3M1ZA 4QE5A 3WBXA 3C2EA 1QW8A 1OX4B 1H7NA 3AMDA 1I75A 5J5RA 4EXBA 5EPDA 5CAHA 1UJPA 1C7SA 3E5PA 4LY4A 2R1LA 1XIIA 3FX4A 3AHXA 1PIFA 2ISSA 3OHMB 3CLMA 2JF7A 2WNNA 1R3TA 2G96A 1FWIC 2QW5A 3NYDA 3LMYA 4PSPA 3N17A 1EX1A 1VYPX 1V6XA 3T6CA 3LCIA 1KCLA 3BMXA 1S38A 4GABA 3DFSA 1ITUA 2PSNA 4S3GA 1C90A 5CSSA 4F2TA 3L67A 1HKVA 4MWAB 4EK7A 1LUCB 9XIAA 1OCQA 1QHPA 1PV8A 2WMGA 2ZCGA 3CBWA 3QRHA 3BV4A 4LAMA 2ADAA 1ZLPA 3TTOA 3VE9A 1RY0A 1WKYA 3AJ7A 1O7AA 2YB1A 3PK7A 3NUKA 1UR3M 2NUYA 2R94A 3STGA 5T91A 4OUEA 1LDCA 3PM6A 3LHZA 2X0YA 2YA1A 3FAWA 2ISWA 4Z2JA 3I6EA 1OK6A 2OLHA 4WDTA 1V08A 4CVUA 1Q6LA 3BURA 1K02A 1A49A 5BXRA 4DYEA 1ZJIA 1YADA 1JGIA 2BMBA 4JKMA 4EOUA 1XIBA 4TOQA 3T9PA 3ATZA 3IAPA 1QXLA 4GIRA 1NDWA 1EJXC 1NAL1 3OHIA 1V02E 1A3HA 1MW3A 4XV0A 1ZGDA 3L9CA 2JBMA 3OLGA 4H9TA 3PFMA 5KSWA 2B7PA 3THUA 1HKJA 4CKQA 3KEHA 3B9OA 3CNYA 3CMGA 3VKAA 1OEPA 2RUSA 4P8WA 2PRLA 3P7YA 1EGZA 2QCLA 1N8IA 1YW1A 1J2BA 2DGAA 4NZ5A 4RUBA 1YPIA 4F40A 3NQ8A 2R1MA 3ALFA 2J8GA 5KETA 3N6HA 5HQLA 4LBUA 2Z25A 3RN6A 5HR7A 1SQ7A 2X2YA 1NIUA 4DZHA 3FXGA 1WDRA 2RFGA 3V0TA 1AQ0A 3EMCA 4PUEA 4IP4A 4JR5A 1L2UA 3L5MA 3HF3A 3MI2A 3WJWA 4A3YA 3T0DA 3R10A 3RLVA 1BGAA 3LPOA 1W1TA 3PTMA 3XINA 1JPDX 2ZTKA 4KWWA 2YBVA 3WSUA 3O9NA 1B3WA 2XSXA 3I7SA 3IRSA 6REQA 1W1VA 4E5TA 3AXIA 2XIBA 2OKTA 1FHLA 2XFRA 3D6NA 3B40A 2E77A 3KP0A 2PD9A 1R3VA 4CNNA 3S6DA 4AVNA 4WKFA 2ACSA 1FWDC 4DZIA 1ZP3A 1EJTC 3NM3A 3NXFA 4TMCA 2FTYA 2AKMA 5GNXA 2NUWA 3Q4DA 2X8RA 4MMWA 2Z29A 4G1NA 1FH8A 2XGZA 3QLLA 3INPA 4B15A 2HNEA 1BRLA 2H8XA 5ENLA 1QNVA 1R87A 8XIMA 2ZRXA 3CUFA 3KBNA 3COTA 4L6DA 4LUJA 3VDBA 2AOSA 3NAVA 4KEUA 4LPCA 1QK2A 4AD3A 1QHOA 3G1DA 4ATDA 1VR6A 1UC5A 4J4KA 3OGRA 4QRNA 5EMKA 3TYZA 1I0DA 2JF6A 4I9MA 4TX8A 2PF0A 3P67A 4LTSA 2OSWA 3E74A 2YSWA 4BF9A 2E6FA 2ZZ5A 1BLIA 4JTHA 1VEMA 2GVEA 2G37A 1XLEA 3W2KA 3QQ1A 3UXIA 1YMYA 3CQHA 2FFIA 4A3UA 5G4WA 5D8ZA 2BY2A 1DJZA 1P0NA 1ZALA 1SR9A 4IMGA 2PDCA 4O0ZA 2EBNA 1TTIA 4HZMA 1J0IA 4R33A 4TX6A 3R7MA 4IIEA 2CU0A 3HGOA 4J35A 4CU6A 1AFSA 1O6IA 2XFFA 1BQCA 2HPIA 3M0HA 1K4HA 3DYMA 1L6FA 1X8CA 1MW2A 1QPRA 2L5HA 4IMEA 4AVFA 4HD5A 3SN4A 4PUNA 5BRPA 3O7UA 1ZU8A 1FWTA 1NQ6A 2Y89A 4MNMA 3OZOA 3QPYA 4D6CA 3A24A 3W1TA 4ERIA 3GU9A 3EWWA 2E6AA 1A5BA 1KGUA 1UA7A 1LRTA 3ORWA 1BVNP 2YDSA 4C91A 4W4QA 2WC7A 4L1WA 1FHVA 5AECA 2DT0A 3L5AA 3EEGA 3CH0A 3LLDA 3LD5A 3NDOA 1JCNA 3RUBL 1WUEA 3KRUA 3NVTA 1KRBC 1OC6A 4LW7A 4W7WA 3STEA 5ABHA 4FK9A 3UCDA 3NSNA 1K77A 1OVDA 2PTDA 1J96A 1A5KC 4XSLA 4Y7EA 5FL0A 1PX3A 4WKHA 1TX2A 4JX5A 2VR4A 3DESA 2OB3A 4M29A 5IDZA 1EYWA 4O15A 4UR9A 4XAFA 1UZDA 7A3HA 1BAGA 2YW4A 2CLKA 5FCZA 1TPDA 2FGBA 1UR2A 3H70A 2WMFA 4EPBC 2UY4A 3WLSA 3CC1A 4UFJA 2RGLA 3BJTA 3ICJA 3BOFA 1YXCA 2CESA 1ZL1A 1UH3A 5EKYA 4I7WA 3VZZA 1W5OA 1YHTA 2NVAA 1H3GA 3WQOA 3HV8A 4QIUA 5LIYX 2CETA 3AYSA 4P2VA 3VM7A 3HPXA 1XYMA 5FJOA 4FXFA 2C79A 3KM8A 1S5MA 2GL5A 4GACA 3GS6A 3RJXA 3MHUA 1QI3A 5FEZA 5G2HA 1RP8A 1V0NA 2VFDA 3A4AA 3LGEA 4NZ3A 1GKRA 5F7UA 3SW6A 1KFKA 4Z2LA 1Q6FA 2VFIA 1A53A 3M0IA 3VIHA 4IPNB 4JOMA 3EWBX 2OOGA 3C2YA 3IVTA 3KVMA 4O13A 5I6SA 2PTXA 1G67A 4JIRA 4AF0A 1DTUA 2HVNA 3NQ2A 1VHCA 1SMDA 1XQKA 3C0LA 2VYOA 4C6PA 3K30A 3OW1A 2UBPC 5MHBA 3OLDA 1WDQA 3V7PA 2PDXA 3TTEA 3R5EA 3W37A 4UCFA 4Q7BA 3ZSSA 1GOQA 4Q7NA 3QYQA 4IGNA 1F7BA 5IM51 2PZ0A 3SFWA 3WQ5A 1WQ5A 1CYGA 4GBDA 1OGSA 4PTXA 3LPFA 1TO3A 1E0WA 5TIMA 8RUCA 3KBVA 3V16A 1EGVA 4H6RA 1ISWA 2TSYA 3CV6A 3KRSA 4ZO6A 4PUMA 3ZT7A 4PA8A 3GH5A 2D24A 1V3MA 2O9TA 2DORA 1C8VA 3EKGA 3FVDA 4J3WA 4DB7A 2D22A 2PURA 2CLFA 3AXXA 1VFOA 1EHAA 1TPEA 7PTDA 3A13A 2WHKA 4E8DA 1R3SA 2XGBA 3FS2A 1XBZA 2EJAA 3EA2A 3H2NA 4E0CA 1JF6A 3N4EA 5LKYA 3W74A 3P80A 2GGEA 2X05A 3W00A 7REQB 4Q4OA 3W26A 5JIPA 1NVMA 3LLXA 2VR5A 3M5VA 3WO8A 3G1RA 3KDNA 1VBGA 2JALA 3EX3A 3F5JA 1OWQA 2A0NA 4LC6A 1UIOA 3DEQA 4HU3A 4KWSA 1WOAA 5CAKA 3BJSA 1XUZA 1CGXA 1UP2A 2QF7A 3NPWA 2V30A 2NQ5A 1OFRA 4Q8OA 3PY2A 1J01A 3VNJA 4GUJA 1Z48A 3WNOA 4ZL1A 2VC9A 3UJSA 3WQGA 1HGWA 3LHUA 1EWDA 1QR7A 2YJQA 4L80A 4NZFA 1J6PA 2CZ5A 2Z4GA 4HP5A 1J2WA 1FKWA 3P81A 2Q71A 3TNOA 3CXOA 3FGCB 5D9MA 4XVEA 4J40A 3WNKA 1Y8BA 2VUNA 3BC9A 3U4FA 4FIRA 3NG3A 4I7UA 2Z2BA 2HNHA 1I6NA 4LF2A 2B31A 1R3QA 3G2GA 4GH3A 4UTFA 1UR0A 1LL4A 2O9PA 1P7TB 1LOSA 3K4DA 3C2RA 1Z41A 3WUEA 4ZOBA 4UTTA 1GEHA 3MQTA 3VIFA 1QMLA 1M7PA 3MBDA 1RLDA 3IJ8A 2ZXDA 3MP4A 3U5UA 3MKCA 3ZFHA 1E51A 2CW6A 1XQLA 1KLYA 3HG2A 3LBOA 4GG9A 4GCAA 3W6LA 2Z1BA 4AWEA 3I6TA 2D2OA 3OEXA 2ZVRA 3T05A 4LT9A 4H9ZA 4LWWA 4KCVA 3T2QA 1RD5A 4W8LA 4LYQA 2ZA2A 3OTRA 1TV2A 3PJUA 3UYCA 1J0KA 5I5RA 1TKKA 1ZJHA 3AMKA 3SM0A 1AZ2A 3TN5A 2HCVA 3WBYA 1OIFA 5HJLA 3NO1A 3K13A 3CT2A 3E2SA 3CZ8A 2VGIA 3GBDA 4TX9A 1PS9A 2F9RA 3PULA 3DH7A 2XM2A 1TMLA 2PBOA 1F3TA 2HROA 3HTWA 1Y65A 3C2FA 2WNWA 3LHWA 4LVFA 4O8RA 1EUAA 1JR1A 1RAKA 4C6LA 1G4TA 3N9SA 2B7OA 2OCZA 3G1HA 3CWNA 2F6KA 2WHMA 3VNKA 1HX0A 3S1UA 4GISA 3B0PA 1GOOA 1AJ2A 2FH8A 3MC5A 1DHKA 4C60A 3HQOA 1Q7ZA 4LS2A 3SGUA 4PE8A 2DSUA 3AZSA 2IMRA 4QEEA 3VI2A 2CZVA 2NQHA 3GZ3A 1IGSA 5FOOA 4PGLA 3S5NA 1U1JA 1UWSA 4JTJA 3WBEA 1EBHA 2OYMA 3RXZA 4DJEC 3L12A 3R4IA 1H5YA 2HTMA 1U5JA 4KRUA 1NP0A 2WK2A 3HIJA 3V5OA 3BLKA 4M5PA 3CU2A 2ZRWA 5KMYA 4WSKA 1LOLA 3M0YA 4EX4A 4HPHA 3JVAA 1RJRA 4OT7A 3PN8A 1MRAA 1OHLA 1J0ZA 4BF5A 1VJSA 2VENA 2QVHA 2OQYA 4D6DA 2GVYA 2WZIA 3URNA 4J7RA 2PWEA 4N6EA 1JZ5A 4IIFA 4AMAA 4N0RA 4X63A 4EXAA 1XIEA 2WJFA 3JZEA 3LCHA 1V93A 2W91A 3OPSA 2GQAA 3HGRA 3M6YA 3PUGA 5A6TC 1YPFA 4DF1A 2BVDA 1WXYA 3RX4A 3W24A 1ZUAX 4JHOA 1HL8A 5FEPA 7TAAA 4H4IA 1D9EA 1TIMA 2CFFA 1XLGA 1PZ1A 4MFDA 3NL5A 4IH3A 4RNIA 3U0HA 3TTSA 4Z0JA 3W1AA 3W7EA 1R9YA 5A8OA 2XH0A 1LLZA 3PANA 3RMJA 4Y9AA 4CVWA 1B3VA 4EPKA 1KB3A 3CZKA 2V3EA 4EPDC 3E0VA 3FJ4A 4ACYA 2ZIDA 4NHVA 2QIIA 3GVGA 4RDYA 3EB2A 1K8XA 4XAZA 2QJGA 4ZCWA 1VF8A 4C5ZA 2R9RA 5J5DA 3HA1A 3EWZA 4A8IA 2QDDA 2WKGA 4AIOA 5A6AA 3T07A 3GTIA 1OADA 3U2ZA 4DUXA 1GZ1A 2I9EA 4U31A 3E0LA 2OOFA 4KCTA 3NSXA 4WJXA 3C86A 2PCEA 2VEGA 4GC3A 2C18A 1EOMA 3W84A 4NY2A 3H23A 4NZCA 2QPXA 4NAFA 1QAPA 4KEZA 1SZGA 1PL9A 4N2YA 3QC0A 1KFJA 2FJUB 5DF0A 5A2BA 1BXNA 5FACA 1EHNA 1ISVA 1XD0A 1K7FA 2A7RA 4D6IA 4DO5A 5I3KA 3RGTA 2NXIA 2GQ3A 5DANA 4CNUA 3SJ3A 1S46A 4C1NA 4JQAA 3W9ZA 2EPHA 4E2OA 1K6WA 3VOCA 3M0KA 4V15A 2BXYA 3IJ7A 2EKGA 1UYQA 3O3RA 4XQ6A 2XYLA 3W7DA 3AXHA 2YCJA 4IPPA 5K2ZA 1ITQA 2HXUA 3MV11 4J3UA 5A6KA 2OODA 3EDFA 3ABQA 3TXZA 4ASTA 4IGHA 4DI9A 2VZUA 4ZQRA 4HGXA 3A6OA 4JFSA 2PPGA 4HVXA 2FZNA 3JS3A 1JAKA 1W37A 1US0A 5FSEC 4IQEA 1D7KA 2OT1A 4W86A 4EAMA 3WMLA 4O53A 3DKJA 4Q4KA 3EZ4A 4JQ4A 3FA5A 4KBXA 5C2GA 5I77A 2WLYA 3ABOA 3CQ0A 2P8BA 2X1SA 3T81A 4Q4SA 1DKWA 1HP4A 2OZ8A 4EAYA 2JK2A 4F9JA 1UBPC 1H1YA 4IX0A 5LA1A 3GVQA 1I2RA 4E4FA 1YXYA 2GQ8A 1CXLA 4QE4A 2FMNA 1UD2A 2CLOA 1UPMB 4RNFA 2GPTA 1XLAA 3GM8A 1N82A 3ZJ8A 5G4HC 4AYSA 5C2XA 1XC6A 1HXJA 3M46A 4D1JA 4GOAA 4MAVA 3CTTA 4L5ZA 1JYVA 3GHRA 1FWSA 1O5XA 3A4JA 1AG1O 1GVOA 2UV8G 2ZZ3A 4LOCA 4XAYA 1XS2A 2OXNA 4MGGA 4AHPA 2OWWA 4NXKA 4GBUA 2TODA 2XISA 3DYPA 3LHTA 4JIIX 2VDIA 3ECQA 2V81A 5KZMA 4JEQA 5CBBA 2HDJA 3AHTA 4LBRA 2PODA 1N8WA 1SO6A 2GZXA 4C6MA 4DJFA 3S8HA 3KZPA 3K8MA 1CLKA 3WUBA 2QJIA 3KOWA 1TG7A 2OYKA 3CTLA 5EYWA 4AWUA 1VQTA 2G4JA 1QI2A 3DG3A 3WNLA 3VKJA 1FXPA 1F8IA 2FZ8A 4D6FA 2RAGA 5IDIA 3G24A 4XD3A 3TC6A 3ITTA 3EDEA 3W2JA 4DYKA 4AD0A 3LXCA 2TMDA 3B8TA 2PU0A 1Q66A 1DJIA 1KA9F 7TIMA 1K6AA 1VCGA 3AU6A 2V9DA 4HNCA 1TE6A 1R3YA 3W7JA 3NWRA 2ZE0A 4AY1A 1V6VA 4C6EA 2Z24A 4GJJA 1QK0A 2WW5A 1LQAA 2SFPA 5E9AA 4NNBA 4IXXA 3FHQA 3SJNA 2DUXA 1H0GA 4UNKA 1XFCA 2GJXA 5HMSA 3F1QA 2J7DA 1PEZA 4FXSA 4GIAA 2I1OA 3UESA 5K9DA 1VFSA 2CBIA 1S2CA 1NWTA 3VXGA 3P8JA 1GOWA 3G1AA 4NI3A 4G7EB 4X9SA 1NP2A 2B0MA 4H7CA 4KFPA 4AW7A 3OQEA 1QI0A 4ZB0A 5DRIA 2OZ3A 1TMQA 3CPUA 2CZDA 4Z2HA 5B80A 2OGJA 3CK5A 1KC7A 3GK0A 1ZP4A 2JEPA 1ODUA 3SUUA 1DYSA 1K8CA 4XIAA 1H41A 3WD4A 3F4WA 2ZX8A 3W6MA 2Y61A 3VNDA 5HNTA 1CX9A 3CIVA 4YMZA 2GJXB 2ZVIA 1PZ3A 3TV8A 1PWLA 3VDAA 1EP1A 3EMZA 1A5MC 1C29A 5FIPA 3AIVA 5EBAA 3LLFA 4PEEA 4XZWA 3CUZA 4CNTA 3VA8A 4OFCA 3GFYA 2J13A 1A80A 2ZUMA 3GAYA 5C9ZA 4QLJA 3URAA 2HPMA 4ZEPA 2HJPA 4KGJA 3W7RA 1XWYA 4ROPA 1OCBA 5EFDA 1OFBA 2YYTA 3ES8A 3QV6A 3UWYA 1JZ4A 2Z7KA 4PULA 1LBMA 2DFAA 2O55A 8XIAA 3SN0A 3ME3A 4IFKB 5A2CA 3O16A 4PN2A 4FNTA 1IIHA 4HMNA 4ILSA 3G1VA 5HWNA 1JDFA 4GVGA 4BI5A 2CCRA 1TYGA 2IPFA 3LRLA 4QROA 3BAYA 3BCFA 2PAJA 3FAXA 5D05A 2C0AA 4GYJA 1V51A 2VC6A 2C16A 2BFGA 3GUGA 5DFAA 4L1XA 4IHCA 4DXKA 1QDSA 2E7FA 1UD3A 2OEJA 5M1TA 3S1VA 4PB4A 3K4WA 1TZ7A 3WH6A 3NL3A 3SGGA 3PZMA 4RDVA 4PBFA 1VRXA 5M03A 3M6DA 3DBNA 2P76A 3UA3A 3PAJA 2Y4SA 1MFUA 4ZQNA 3VKKA 5BOEA 3GUWA 1OINA 3N4AA 1GHRA 4YTSA 4N9BA 4GCXA 4S2BA 3GAKA 3H4XA 2CPUA 1S1PA 1M01A 3SIMA 1SJAA 3LEPA 1FA2A 1BKHA 4P8XA 1V6TA 3I4EA 3O0KA 3BAXA 4A8RA 2JKAA 1GKPA 4RL3A 3LHVA 4A3QA 3WKZA 3MHFA 1FKXA 1I2QA 3WQWA 1WBJA 3WF0A 4WRHA 3P3BA 4XK2A 1VB9A 4H3DA 4C6NA 3SCOA 4K8HA 3W88A 4W9TA 3HN3A 2QQ6A 5LHEA 4V1XA 4DZ5A 2QT3A 4PTWA 2V63A 2YIHA 3QLDA 3IIPA 1R8LA 1TB3A 4Z1YA 3FDGA 1CXHA 1K9DA 5I79A 4Y6GA 3JR2A 1JDAA 4OV9A 5BMXA 1A5NC 1QNSA 2A4AA 4PSRA 2XH2A 1KM2A 3WFZA 2A7NA 1Q5MA 5M5DA 1ECQA 4L4PA 1LJYA 5JBEA 3V0UA 3BK0A 1VBHA 3AICA 4WZHA 2VURA 3NR0A 1X6LA 1ZFJA 1HKKA 2YCKX 3IK2A 1KV5A 2G50A 1XYZA 3ZR4A 4N7QA 4NASA 2HV5A 1PZ0A 3GG1A 2JFEX 3N4FA 4ZR8A 1QNQA 3WH7A 1BKSA 4PODA 4HHMA 2ZICA 1RVGA 3V5FA 2DZSA 2PUZA 4JTTA 1JDDA 3WLTA 3KWXA 4IMDA 3L23A 4H01A 4AZ5A 1YTEA 4LUIA 3GTXA 5JQ9A 4AF0B 4Q8UA 2A79A 4EP8C 1XHGA 4MY9A 2HS8A 6REQB 3Q67A 2ISVA 1ZENA 1UR9A 4Q8PA 5CPNA 1GHSA 1WAUA 3T0TA 2C1HA 1NQKA 2DIJA 3LXAA 2HRWA 3DKLA 4DXXA 2GOUA 3SCNA 4O1CA 3V75A 1G4PA 3HO8A 1CLVA 1Z44A 3CV2A 4MHBA 4PCTA 3NTYA 2EKCA 3VK5A 1AW5A 1Q6RA 4H6EA 4GUFA 2HE5A 4RK8A 1JDCA 1OD0A 3MB9A 1QI4A 4NJHA 4MJZA 3CQKA 4MB4A 4C6KA 4AISA 3TU9A 2REQB 1QOQA 2WJEA 1VFTA 1PCWA 4UQCA 2ZKMX 3B8VA 3G77A 1JDEA 5BXPA 3I6RA 3SCUA 1BD0A 1KBLA 3VDGA 4ZSUA 4QLLA 4EWND 1DWFM 4JX6A 3AHZA 4GUGA 2WKLA 3WF4A 3VZYA 4KPLA 8A3HA 1JNDA 1XDMA 1R3WA 5KZ6A 4W8BA 2A3CA 3M0MA 3WUFA 2PZNA 2OO6A 1FQ0A 4MZ1A 1TPH1 1OX6A 3Q37A 5JU6A 1LG2A 2PRMA 3QOMA 5H8MA 4B5TA 3GY1A 4XO7A 3C0JA 2J79A 4L9ZA 4JL2A 5I3HA 4ONVA 4E3VA 3ZQ9A 3T44A 1KNWA 4IQDA 3L4ZA 3MP3A 2NX1A 5DRCA 1EH9A 4IZGA 4ERGA 4HIBA 3SY5A 5G2WA 4TTUA 1FWRA 4X2RA 4D8LA 1HIZA 4BKNA 1ICSA 5FAJA 2POZA 4P7RA 4R34A 4YLWA 4FXRA 1X6UA 3S4TA 4MOZA 4DPQA 5GJMA 2E9LA 5A69A 2J9XA 3BLPX 4H9UA 2D0GA 3LA4A 1W2PA 1WDDA 2XIJA 4WOQA 5FJPA 2Z6JA 1AW2A 1B3OA 5J8LA 1OD8A 1O5RA 2J7BA 4HN4A 3MV01 3NZGA 1KTBA 1K8YA 5C70A 3S1WA 4XUGA 3GWQA 3T7VA 1QT1A 3P8IA 1ZBWA 1GVRA 2YDAA 1ESWA 1LLWA 2ZZ4A 1KD0A 1M9HA 4K8EA 4RV8A 1JL8A 4QS6A 2YBTA 3NA8A 4FX6M 1KCZA 1BEUA 1G4SA 3EX2A 4ZQPA 4B9YA 3S9YA 3PUEA 3VAVA 3TQ0A 2A6LA 4X22A 2QIWA 2FZDA 5AYIA 4DIAA 4JFTA 3IJQA 3Q45A 5F2IA 1EPVA 2PD5A 4Q32A 5AOUA 3PHAA 3WL1A 5T9CE 4GKTA 3W7KA 2QJHA 5D04C 3ABRA 2QF8A 3W7HA 1KM4A 1A3WA 2G4FA 3L0NA 2A7PA 4BCEA 2ZZ1A 5KZEA 4H6KA 1NU5A 4AC1X 1EDQA 1R85A 3H7VA 3RCYA 2Y62A 4PMDA 1QW9A 3NZ1A 5HAOA 3GO2A 3F5LA 1QOXA 3G18A 5H8UA 3P2VA 3SUSA 3EX6A 2E40A 1UH4A 4XTIA 4J2MA 3H54A 2PDKA 2F84A 2HXTA 2X1RA 4E8CA 4PMJA 4RR4A 4Q7IA 1TWSA 4IJBA 3ZM8A 3PZVA 2E25A 2RHGA 2Y8UA 3HPFA 2JKEA 3VYLA 2ISFA 5FJUA 2J62A 1JG9A 3OLEA 1B90A 2KZHA 1G94A 2G95A 2I56A 3EXSA 3LK6A 4AXNA 4GGHA 1EQCA 4PB5A 3SRKA 2BG5A 3MWAA 5FAGA 2J9ZA 3KOXA 1UWQA 4EKJA 4QQUA 3VMNA 1OBAA 4C6CA 1IT7A 3HGJA 1ADSA 3MW7A 1TR9A 3ITXA 1WZKA 1EFZA 3WK3A 3TJIA 3HB9A 4CU7A 1KFLA 2W0UA 3EXRA 5C71A 3N6JA 3NDYA 4UZSA 5CJNA 5EGRA 4F8XA 5C7HA 1PKMA 3P93A 4RXGA 3UVAA 3CUHA 3THAA 3KL0A 5HULA 2NVCA 2YDRA 4ATLA 1XC4A 3WLQA 3NSMA 4MJ2A 3VIOA 3N9KA 5CG0A 4CN4A 5LNSA 1S1RA 3R8RA 1W1A1 3GR4A 2FB2A 5C5YA 5BNKA 1LWHA 1SFSA 3HU7A 1KRAC 1XSIA 4O50A 2HK1A 3DHPA 1W3TA 1E0XA 3T09A 3C0QA 4A8LA 1L6WA 3F03K 3MVIA 4GZ7A 2QAPA 3VD7A 3J7HA 1MW1A 1SU5A 1EXBA 1D8WA 3IPWA 3A4XA 4MWAA 1NF7A 2FYMA 3WLLA 3UXDA 1HF6A 3LUTA 3Q58A 4K2SA 1VGAA 2Z0IA 4INFA 2FVKA 3DCPA 1NDVA 2VMFA 4YWIA 3TK7A 2E09A 1F74A 3KOYA 1J4EA 1CXIA 3ANYA 3LNMA 3NJ3A 3PFRA 4IWWA 1Q2SA 1BWLA 4JN7A 1S39A 3E38A 3L7RA 3W38A 1JYWA 2WZEA 4JIHA 4QP0A 2VZSA 4RV3A 1QASA 3MP5A 3AOFA 1EJVC 4PH6A 4MM1A 3QTPA 4LUSB 1AQHA 4GPNA 4W89A 3KDOA 4QE1A 2D20A 2VZOA 1P0EA 4H00A 2G3MA 1ZBCA 1YYAA 3GXFA 1RCQA 4MG4A 3TN4A 3B97A 3GNXA 5C0QA 5HWJA 4CD8A 2AAAA 2DVTA 4QXIA 1TPVA 3TNBA 3QZEA 1THFD 4XTDA 4XUYA 4PUJA 4B5NA 3BCJA 3OIHA 4PMZA 1CZ1A 2B7QA 3B4UA 2FHCA 4L6HA 2I14A 3VC6A 3ZO9A 3W1NA 3JZUA 3WDIA 4WSJA 3MVTA 3UWZA 1LOQA 1LP6A 5JH2A 3LMZA 2HVOA 3RO6A 3WLPA 5JMUA 2I9UA 1KBKA 6CGTA 3T4WA 2QMKA 4I5XA 4H04A 2Y7DA 4ACZB 4DUOA 1RHCA 4W7UA 3UGVA 2YDQA 1J0JA 3L2IA 3HJZA 3AMLA 3CPRA 4GQ0A 1LL6A 5J04A 4U33A 4JD4A 1AW1A 1XLIA 4DWSB 1H7OA 3SRHA 4J28A 3OVQA 5IHRA 1T96A 1YLVA 4PMXA 1TJ1A 1JCYA 3BL3A 3R11A 3NYZA 3MCOA 1LLOA 1NM9A 4NAFB 3AZRA 1IXOA 4I5RA 1DPMA 1E56A 4AD4A 4EPEC 3AROA 5CGQA 3W28A 4NIRA 3VKDA 3UF9A 3MSRA 1Q7QA 3SIZA 3UPMA 2PDJA 3VUPA 3WLOA 1SM9A 1OCJA 5HBFA 1OC5A 3MHGA 3W7GA 3B9NA 3SSJA 5FESA 1RXOB 4GUHA 3S2MA 5F4WA 3FXYA 3ITOA 1MEIA 2OJPA 4B90A 4IIHA 2OKOA 3D5HA 2V5BA 1UUOA 2E9BA 5GPRA 4MF4A 1KM0A 3MS8A 2V5DA 3C8NA 4REQA 2E28A 1OQFA 4HK6A 4GINA 4IJCA 3TJLA 4JTLA 2QYGA 3UWEA 2WYSA 1VEPA 4HSOA 3FFSA 2QZRA 4ZA0A 2J78A 1EWEA 3WQ8A 2JE8A 1C9WA 1TPWA 5EB8A 3EWDA 2HBXA 4QCFA 1IR2A 5D9OA 2DH3A 1I0BA 1E5NA 3T2OA 3W87A 4R53A