2QCHA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to 5-iodo-ump
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
255
structure length
255
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 93
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qchA00
5DCEA 3M9YA 4M6QA 4AB4A 1VQTA 3GX9A 2ZTJA 4I7VA 4IGHA 1PS9A 5FESA 3DAQA 3G1DA 3OVPA 3G1HA 3HB9A 5LZLA 2DU2A 4N4PA 5A5WA 3QQ1A 2VKZG 5KINA 3VCRA 2TMDA 4LVAA 3HPZA 2VENA 3NZ1A 3M7WA 5ABTA 2ZRVA 3FA5A 4JIQA 4BI7A 4HNUA 1KA9F 4WOZA 3TIMA 2GJLA 3STFA 2QUVA 3E96A 1XBYA 3S5NA 1FDJA 5KZEA 1O60A 1T96A 3W3OA 4IX2A 5AYZA 3WJWA 1O94A 1LLWA 5D2XA 2R8WA 2VEKA 3TK7A 4Z1AA 3HJZA 1HO4A 3W1UA 5FI8A 3NVTA 2E6FA 3FYOA 3VE9A 3RNDA 4WQ6A 2VFDA 1XI3A 4NU7A 3W7EA 3A24A 1W31A 3GAKA 3NAVA 4ZVJA 4JYFA 3QEZA 3OEXA 1ZAJA 3LB0A 3LCLA 1QWGA 3W2NA 1ME7A 1OF6A 1HFBA 4DXVA 5D2YA 4MYAA 1GQNA 2IQTA 2PE4A 5LHEA 1N8FA 1KFCA 5KZMA 2Y63A 3FKKA 4O17A 4XUGA 3MHUA 1U5JA 4QQ3A 5CKSA 3LV5A 2J9XA 2WQPA 3L5MA 3IIPA 4TMBA 3L5AA 3EWUA 1KM5A 1ONRA 3M44A 1KTCA 1LTDA 4O14A 3W87A 3L66A 5F1UA 4TIMA 4JS3A 2C3ZA 3NM1A 3TH6A 1FBAA 4HT3A 3BW4A 1FCUA 3S6DA 4UTWA 4PCFA 5AHFA 3TW6A 3E12A 4O52A 4CQ9A 5AC7A 3G1SA 1QO2A 3TC6A 1LYXA 3GNNA 4NVTA 5IBXC 1XCFA 4CQAA 5HR7A 2YGYA 1NF0A 3A5VA 3DKLA 1BKSA 1JCMP 4MY9A 3GZ3A 4MY1A 1XXXA 5EA9A 3D0CA 3P5ZA 4ZL1A 3FIGA 4M7SA 3B05A 2WKJA 3W2KA 3IV3A 3TQVA 4KWVA 3P67A 1XC4A 2OJPA 5C2XA 4XTDA 2PURA 4LRTA 3S5ZA 1XBVA 2C14A 4HNVA 2QCDA 5C6MA 3TROA 2V30A 4UXDA 5LGXA 1FCBA 2NUXA 2VOMA 5CSSA 3PBUA 1KM3A 3H54A 1AK5A 2ZA2A 1PV8A 3CU2A 2F84A 5K4ZA 1KTBA 1JUBA 2ABAA 4AWSA 3WJZA 3L68A 2QCDB 4WXZA 2V2DA 4N9BA 3QF0A 4O4WA 2OMAA 4RLIA 4RZ4A 5H91A 2X1SA 2ZA3A 4PFMA 4QJ1A 4LTSA 5DBUA 1VHNA 2A85A 5DN1A 1WV2A 4XBKA 1J5TA 1QR7A 4DEFA 3MI2A 4NX0A 4AH7A 3TXZA 3GAYA 3CQ0A 1OFBA 4JR5A 1IF2A 4UFIA 3NL3A 2YXGA 2QCGA 7TIMA 3KRZA 4K36A 3B0PA 3BLFA 3PAJA 3PSVA 3S42A 3KVKA 1DORA 1VYPX 1P0KA 5D2TA 2Y7FA 3EWYA 2X1UA 2ISVA 4NNBA 3OVQA 4D2JA 5AC6A 3KHJA 2V8ZA 4UTJA 3UNDA 1X7FA 3IGSA 2YW3A 3W1MA 1W5OA 4JEQA 3CB8A 4JYEA 3BPWA 1YTKA 4QIUA 4YMZA 1XBXA 1VC4A 2J27A 4DPQA 2EHHA 2QUUA 3W72A 4DF2A 2V2HA 1LRTA 2E5CA 3FLUA 2KZHA 3KAOA 1SZFA 1XUZA 2WPBA 3WJYA 3EX1A 4Y9AA 5D37A 3C56A 3NQ8A 4GFSA 4MJZA 4O10A 4PL2A 1FWWA 2I9EA 4BFAA 2CLHA 2JKAA 4DO5A 2V81A 2GQ8A 4GXMA 1PCWA 5FEZA 5HWNA 3LCFA 3MUXA 4O1DA 1VCFA 2Q8ZA 2NXIA 3UY8A 3MW7A 3LTSA 3NM3A 1ZNNA 5K3VA 4RXFA 1OYCA 1LP6A 3NQFA 3NYZA 4E0CA 3W7HA 1G6CA 1EWEA 3NDOA 3TCEA 1ZAIA 3LX9A 3RMJA 3RLUA 4UTUA 3SGUA 3WK1A 1AW5A 3P60A 3NL5A 3W71A 3H53A 2QJGA 3HIJA 3LHWA 4WJEA 2E6AA 5T26A 3RFAA 1G4EA 5E0KA 5LNWA 4LU0A 4QNWA 1G67A 2QDGA 5G4WA 4BWLA 1LOLA 3QH2A 3W7QA 1SO4A 4HSOA 1Q6QA 3L21A 3IRDA 2DORA 1K7XA 1R2RA 4M19A 5AN7A 3P61A 2W6RA 1K7FA 5G2HA 1KV5A 2FB2A 4UMBA 1XM3A 2WSYA 4OU1A 3W7DA 1EWDA 4O53A 3SIZA 4A2SA 1BTMA 1H7OA 3BV4A 2CW6A 4M6VA 5LHFA 4A29A 1M7PA 2VFFA 3BVJA 1XBZA 1DHPA 2G5WA 3JRKA 1C9DA 3W85A 3W7GA 2ZZ7A 1SO5A 3QSRA 3R13A 3E02A 5CZTA 3E9AA 2A0NA 2CLIA 3C4UA 4RKAA 1B9BA 2V9DA 4JX4A 4L4MA 2CLEA 3U8GA 4Z1CA 4I7UA 2RDTA 4B5NA 3BG5A 3L5LA 4FHAA 1W1ZA 3QPYA 2Z0IA 3INPA 1I2OA 3MP4A 4OE7A 4ZQCA 4ZQPA 2YSWA 3HMJG 4ADUA 1OFAA 2DZTA 3UYCA 2I14A 5CZSA 4N02A 3SJ3A 2V82A 1GTHA 4BR1A 4O18A 3HGRA 1YYAA 3VNDA 3B4UA 5MHBA 2QCEA 1B57A 3HGJA 3FJ6A 3HG3A 3QW3A 3EWXA 3GR7A 2R91A 4NJKA 1U83A 3OA3A 3GXTA 3W76A 4XBSA 1GWJA 3LXBA 4MZYA 1KLYA 3N9RA 1LRNA 3SFKA 5E93A 3UXAA 4IXXA 3P84A 3QZEA 1WBHA 3HPSA 3NQVA 2C0AA 2QR6A 5EYWA 3P7YA 1H60A 3DENA 5LNSA 3C2OA 5FF4A 3TW7A 2A1YA 4K7VA 4FIQA 1YTEA 1LORA 3CC1A 3QRHA 3HPXA 3PM6A 2A6NA 3EX3A 4N6EA 3IGUA 4ZQMA 1FWRA 2O7QA 3STEA 3W1PA 4ZQRA 1SO6A 1JR1A 1SSDA 3I65A 4U28A 4S2CA 5FF0A 2ZQ0A 1TJPA 4OQVA 4AVFA 1ME8A 2HSAA 4AWTA 3HO8A 3LI1A 1H62A 3W2MA 2P1FA 1KM6A 4UFJA 2B7OA 5BMWA 3NQEA 5FEPA 3HGOA 2Z6JA 3BLIA 4X9SA 3V75A 2LLEA 2YYUA 3S1UA 4TU1A 5AC8A 4WOQA 4UR7A 3DU0A 1YLVA 1ZHAA 3O63A 3T7VA 3S0CA 4MLJA 3TXVA 3GIYA 3A5FA 1O5XA 1SZNA 3DHDA 3C52A 3IGXA 5D32A 1NAL1 3TR2A 1LCOA 3W70A 5K9DA 1LLZA 3SI9A 3GVGA 3SR7A 4N2YA 5KITA 1QPQA 1RQBA 1DKWA 4QAIA 3W7MA 1DQXA 1JULA 5HQEA 1JQVA 1YTDA 3PG9A 4O13A 3Q58A 1TTPA 1B4KA 4JTSA 1L2UA 2GPTA 4O57A 3N9SA 2Z6IA 1OG0A 3QM3A 3TKFA 4JN6A 1IXQA 2A7NA 5U7SA 1N55A 4H6KA 3W1LA 3ZS4A 1VLIA 4FNRA 1LBMA 3RF9A 3R89A 4CQ8A 4FO4A 4M5PA 3DI0A 3I7RA 3EWZA 1WBJA 3QMRA 1WOAA 4QSHA 5EPDA 4UTLA 1H1YA 1GT8A 4O0ZA 1RZMA 1JUEA 3B8DA 1NEYA 3V1PA 4UTIA 5DXYA 1Q6LA 1SFJA 2V5BA 1ADOA 3MI6A 3NQ6A 2VEIA 3E0IA 1SW0A 5C55A 2JGQA 1JUKA 4JIPA 4Q33A 3TMQA 1B3OA 4WY0A 4KKXA 1B4EA 4K38A 1LOQA 1I8JA 4MFDA 4HNTA 3FFSA 3W23A 3IIZA 4DQWA 1VZWA 5EKYA 3LXCA 1AW1A 3WK2A 4RV8A 4O28A 3CWOX 3DFTA 3DFNA 1JCYA 5FF2A 4O16A 1JCJA 2BWGA 3C2EA 1SR9A 3G8RA 3UQNA 4AF0A 1W56A 4OHQA 2C6QA 1VCGA 5LGZA 3T4CA 3IEBA 1I2PA 4MYXA 4XTIA 4M6PA 1TYGA 1I2RA 1MEIA 3O6DA 1A5SA 2FQIA 3EWBX 4N6FA 4I7WA 3C2RA 4LC8A 3SECA 8TIMA 1K7EA 3BO9A 4E2DA 1V5XA 1TPDA 5CPOA 4Z1BA 3NPWA 4C1KA 1QO5A 3IIOA 4AHQA 3UXDA 2ZTKA 3OIXA 4JX6A 4K7YA 3P62A 1RQEA 2ZZ4A 4ADTA 1T99A 5LNUA 2QAPA 1RVGA 4UTHA 4RCXA 1PHQA 1MSSA 3FOKA 3GNDA 5KMYA 1SW7A 3VE7A 2CLMA 1MO0A 1G4SA 1P1XA 4I9AA 5D03A 4HPXA 4DELA 4N9DA 4UR8A 2HS8A 4N9CA 3N2MA 1NSJA 4CNOA 3DFSA 1S5VA 3N73A 2C16A 1F74A 2NV2A 3STCA 4FNPA 4MKNA 3C6CA 1OABA 1TQJA 2X1RA 1GZGA 3GXNA 3LGEA 3WJXA 4UFHA 4JGDA 3UPBA 4FNUA 1DJNA 1D9EA 3BW2A 4X22A 3TAKA 2H8ZA 1GPWA 1ZJIA 4AAJA 5EMUA 1QOQA 1GJPA 4UNLA 3DHFA 4QITA 5HNRA 3ZFHA 1JVNA 2WNZA 4UTTA 2XFWA 3LHVA 4LV9A 2ZZ2A 3P8IA 1K8XA 1Y0EA 1FY6A 4LUIA 2NX3A 2RDUA 1X8FA 3P8JA 1SSGA 4QISA 1HO1A 3G24A 3UWUA 2G97A 5IM51 2CZEA 5CZJA 4AHPA 3TJXA 5HWJA 3W83A 2V0TA 5K7JA 4O54A 1Z44A 4JD4A 4JTHA 2Y6ZA 3SY5A 3P81A 1TO3A 2H6RA 1T8XA 4LW7A 4NJJA 4CCCA 3LTYA 1WXJA 1JCXA 4JTIA 2D73A 1KFEA 4MFEA 1OVDA 3PG8A 4O4VA 1IXPA 1XL9A 4GC4A 3NQDA 3ABOA 3GKFA 4MY8A 3SZ8A 1TQXA 5AHEA 2JKPA 2FLIA 1EP2A 3PB0A 3DFPA 5D02A 1DQWA 1YDNA 1RR2A 3GLCA 3I7QA 2Q8LA 1ZENA 3LRLA 4EVZA 3B0VC 4U4MA 1XDLA 3BARA 4YXGA 4Q4KA 3OG3A 2OCZA 1M5WA 1FCQA 2J24A 1PVNA 1ZALA 4G1KA 1UASA 2NWRA 3QJAA 5G1TA 1W5MA 2A7RA 3ANYA 3DKJA 2QCCA 1KFKA 1OX4B 1KV8A 2X16A 4A2RA 4DO4A 2X1TA 4JYDA 5G2IA 3NEVA 3DXIA 4TMCA 3BG9A 1YDVA 3G18A 4Q32A 4HIBA 4MVAA 4J9JA 4MLRA 2DZWA 3M5XA 3B03A 2I1OA 3O16A 1W0MA 4NQ1A 5I3KA 4FB7A 3PY2A 3ELFA 4WX2A 3Q2DA 1A5AA 3NXFA 1ICSA 3PB2A 5I3IA 3TX9A 4FEZA 4JTJA 4DPPA 3F4NA 1PE1A 3G0XA 4UTWC 2JBMA 1SZGA 2NX9A 2J9YA 3GB6A 1L6WA 5CGQA 5AOUA 2EKCA 3S8HA 3H55A 1R46A 1MZHA 2ZRXA 2ZFAA 1Q45A 3MBFA 1AW2A 4X2RA 5BNKA 4NXKA 4PA8A 1RQHA 4O1AA 3USBA 4IWWA 2OT1A 1LRQA 1X1OA 1X1ZA 1VHCA 3W1XA 3O6CA 1QFEA 1LZOA 4WY0F 2DP3A 3LBMA 5K9XA 2XN0A 4LVGA 3W74A 5LNVA 1VH7A 1AG1O 3TUUA 1HTIA 5AHNA 3NL6A 3QYQA 4RXGA 4IUOA 2QAFA 2AQWA 4QM1A 1FWTA 1LROA 3N2XA 1TTJA 3THAA 2FFCA 3UWWA 3TE9A 1W54A 3G0SA 4RR4A 1ML1A 5F2IA 3G22A 1LBFA 2OX1A 2VFEA 1UUOA 3BGJA 3TFXA 5U4NA 1GVQA 1XUUA 2BLEA 2PRLA 3ZWTA 3GDMA 3LHYA 5LSMA 5HUOA 1F7BA 4UCGA 4LVBA 2DZUA 2CZ5A 1VYRA 1F76A 2NWSA 1GVOA 5AHIA 3UWYA 2E5BA 1FDYA 3FJLA 3EXRA 5F2MA 2QJHA 2CWNA 2AGKA 3W7NA 2H90A 2X2GA 1D3GA 4E38A 4RZ6A 1PL9A 4ZQNA 4R33A 2Q3RA 1OFDA 3S1XA 1RPXA 5AYYA 2A2IA 2NV1A 3W1NA 3MYPA 2GUUA 1H50A 3F4WA 4FF7A 3W7OA 4HKPA 4H3DA 3L67A 1TSIA 1TV7A 3DBPA 1CI1A 4WZHA 1HUVA 3OBKA 3BK0A 5F1VA 4LRSA 3RU6A 2WSQA 2W79A 1K02A 3W1RA 5D2VA 3STGA 4IJBA 1TPH1 1W3IA 1TPB1 3LI0A 4KFOA 1G7UA 2WNQA 3W1QA 1VJIA 5D09A 2DZPA 3HGSA 3L0NA 2QCHA 4X3ZA 5C5YA 3EWWA 3N34A 5L9FA 1W3TA 2NLIA 1VGAA 1L6SA 5CPMA 4OV9A 2G95A 3NQ2A 4P61A 2RDWA 3MHGA 2Y62A 2Y7DA 2CLLA 3MYOA 2AAMA 3WJSA 1FQ0A 3O15A 4IX0A 1G4PA 3TDFA 3DZ1A 3TC7A 3HBLA 1KBIA 4LV4A 4IMFA 2P0OA 4JNMA 1Q6RA 2E68A 4ORMA 3HQ1A 3LTPA 3W6YA 5J5DA 1SUXA 3Q94A 2GQ9A 5HINA 1M6JA 4Y96A 4TR9A 1OYBA 4BWLC 5SWUA 3TJLA 1FUYA 1IXOA 5FF7A 1TV5A 1Z48A 3ZR4A 2WOQA 3O8AA 1KW1A 2B7NA 4N9EA 3IVUA 1VPXA 1NVMA 2DZXA 2H8XA 4GUGA 3GDTA 1Q3NA 3M47A 4XKYA 3G8EA 4EF9A 3EXTA 3W73A 5I3FA 1TCDA 1THFD 4YCPA 3S9YA 1JCLA 3BG3A 4NNAA 5HULA 1OJXA 2Y70A 4M7TA 4XKYB 4JTFA 3KOFA 2Z2UA 2NXHA 1XKYA 3NQGA 3CPRA 2YW4A 5K2ZA 1I2NA 1OFRA 3Q37A 2ZRZA 1G69A 3F1QA 4Y8FA 1C8VA 4RX0A 1K03A 4LS0A 3MHFA 2Q3OA 3ATYA 1F73A 4FX8A 2FB3A 2OT0A 2YZRA 1O95A 2Y7EA 3T55A 1X6UA 4IMEA 1H5YA 1R30A 5HWMA 2FPTA 1QCWA 3QMSA 3TSBA 5K4XA 5F4SA 2CLOA 4IMCA 2HS6A 4OWGA 3BGGA 2B7PA 3CIXA 5DELA 4FX7A 4AXKA 3AJXA 3EKLA 5HUPA 5H2ZA 4CLMA 3MP5A 4LNYA 1EPXA 4IMGA 1WYIA 5F2GA 1JCNA 5F2LA 5HMSA 3JR2A 1A5CA 1GVFA 3U6WA 4LY8A 3QC3A 1RD5A 2ZZ5A 1A50A 1Z41A 2B4GA 4JTEA 3TNOA 2YFOA 4P2VA 3W7CA 4O11A 2VFIA 3S1VA 1NFBA 2EGZA 3TQKA 2YR1A 1EP3A 2PCQA 3LXAA 3G3MA 4UMAA 3T44A 3N19B 3SGZA 4GRSA 3HOJA 1WA3A 1TTQA 3UY7A 1SQ7A 4K8EA 1A5BA 4MIMA 3PVFA 4KFPA 5HR6A 1YPIA 2YPIA 4HPJA 4UFKA 4YCOA 1G4TA 2E6YA 1WQ5A 2Y85A 3GXPA 3M0ZA 1YPFA 2YFNA 1F6KA 3DGRA 3BLEA 5BRBA 4JY9A 2QJIA 3KVLA 1OK6A 1QNVA 4GE8A 3UD6A 1EEPA 3R8RA 3CLMA 3GR8A 3MWAA 3FYPA 2P10A 3W7LA 3L2IA 3CM4A 5D33A 1OHLA 1TV8A 4RZ5A 4PTNA 4R34A 5GVJA 2Y88A 3S5YA 3QPZA 4C1LA 3GYEA 1QPRA 3O06A 1EX5A 2FPVA 4IMDA 4LT9A 4EIVA 1SZEA 3C2FA 1OFPA 3C61A 3I7SA 1KLZA 1EUNA 3B0UX 4RJEA 1EP1A 3CIWA 1FWSA 2GJNA 1I4NA 3O6YX 3KXQA 3LBCA 2QCLA 3THQA 1KM1A 1KM4A 3TSMA 2ZCGA 1OX6A 2BZNA 2WSRA 1YXDA 1OF8A 5IBXA 3EX2A 2JGYA 1FXQA 3ABSA 1IXNA 2WV8A 1KM2A 2BSLA 2CZFA 2JKEA 4NT0A 3W88A 1MEHA 3R2GA 1K8YA 2FJKA 5TQLA 5J5RA 1DOSA 3G1YA 1CX9A 1JJKA 1M7OA 1FWNA 3P80A 1OFEA 1VRDA 1YXYA 4TX9A 3FEMA 3O07A 4JICA 3I68A 3SSJA 1I45A 4O1CA 2CZDA 1L6YA 5AB3A 4FXSA 3ZWSA 2ZRWA 4CNPA 3S1WA 4YWIA 2V5LA 3OVRA 1GG1A 2VEPA 2YCEA 4JY8A 1SU5A 3IIVA 4HHPA 2ZZ3A 5LNRA 1TPC1 3LCXA 3GDLA 2YX0A 3NA8A 4O19A 3TAOA 4FNQA 4Z0SA 1GEQA 4UFMA 2ATMA 4OGZA 3W86A 2ZRYA 3N3MA 1KFJA 3QSTA 1OFQA 3BW3A 5KZDA 3W7IA 3LRMA 3MI3A 4ML9A 1H7NA 2A5HA 2Z1BA 5CG7A 1TB3A 3C0JA 2UV8G 3HG4A 4OBTA 3W1TA 3TSDA 1SPQA 1CW2A 3TA6A 5KSWA 4UUIA 3NG3A 4ONVA 4PH6A 3VFLA 3EX6A 1GG0A 3QMTA 4LC6A 2QF7A 1JQXA 3MP3A 4CCDA 3FKRA 1R47A 2GVJA 1C29A 3K30A 1VS1A 4KWWA 1V7YA 1TPUA 3G1FA 4NXSA 1ALDA 2E77A 2ISSA 3NGJA 4FIRA 2ATSA 4DF1A 3RLVA 3W2UA 1L9WA 4MOZA 5I3JA 3L65A 1KM0A 3LERA 2QCNA 2A7PA 1WDWA 2A21A 3I6RA 2CLKA 3DFQA 1PIIA 3KX6A 4AMAA 5KTLA 3PUEA 2BX7A 2Y61A 3OHIA 4POCA 3A23A 1NF7A 3M5VA 4GUIA 2VFGA 3B04A 5L6UA 1ME9A 4LS1A 2GQAA 1DJQA 1ICPA 3TQ0A 4IQLA 4JX5A 3NQCA 2Y7GA 3W84A 2DZVA 5D2WA 4JDBA 4HN4A 1YXCA 1W37A 1OX4A 4GWEA 3CEUA 3EX4A 1UB3A 3ABQA 1H7PA 2GVGA 2RH9A 3UZ5A 5F4XA 1H51A 2E5DA 3TMLA 3PC0A 3PULA 5DBTA 3DH7A 3LLFA 2C15A 2ZA1A 1GOXA 1TPEA 3WK3A 4LS2A 3EKZA 3DFOA 5DLCA 2C1HA 3W7RA 4UTTC 3MMTA 2JK2A 1KBJA 4GBUA 1W5PA 3C2VA 2WO5A 2DZSA 3FS2A 4E2BA 5DY3A 5DCDA 3CHVA 1QDSA 1UJPA 4Z1DA 3W75A 2PRHA 4RK8A 2BTMA 4AHOA 1XFBA 1DBTA 3C3NA 4R7JA 3W7PA 1WX0A 3CWNA 3PWAA 1TRDA 1YDOA 1F05A 4WUIA 4YLWA 4OV4A 3PR2A 2ZDRA 3PF3A 1FCVA 3NO5A 1BEUA 1UUMA 4MZ1A 1H1ZA 2E09A 4ZMGA 5CPNA 4NZFA 3M41A 3UWQA 5EY5A 4ZQOA 3LCIA 3LLDA 4ICNA 4JXCA 3YPIA 3UPWA 1TMHA 3MO7A 2O7SA 1J4EA 4DO6A 4UTKA 2ZZ1A 4DF0A 2J9ZA 4MUZA 3R5EA 3QW4B 3W07A 3MJYA 4BI5A 5CZ0A 2W0UA 4PC8A 4LWWA 1H63A 5CSRA 2EPHA 2VEMA 1OFOA 4WXYA 2CU0A 1ZFJA 2NUYA 3N14A 2A4AA 3R12A 3W7JA 3LM7A 4Y90A 4K6AA 3HG2A 3PBYA 3SW6A 2RFGA 1W5NA 5DCBA 1S5WA 3UWVA 4BI6A 1S3HA 3QFEA 4O8RA 3W2JA 4UC5A 3UZJA 3TFCA 3M1ZA 4LOCA 1JRCA 1G7VA 3P5YA 4UIOA 2E1DA 5LKYA 3L9CA 4JTKA 2VC6A 2VELA 1ZAHA 1HL2A 3VI2A 4O1BA 1AL8A 1R2TA 1BWKA 2QCMA 3LDVA 3EXSA 3TV8A 2TSYA 2ALDA 5FF3A 1R2SA 2A6LA 1VR6A 3KRUA 3S5OA 1W8SA 1EUAA 4ORIA 4IOTA 4LUJA 1ICQA 2C18A 3GKAA 5TIMA 3O05A 2WNNA 6TIMA 2NXGA 4N4QA 1UCWA 3HG5A 2J88A 4A21A 3M6YA 1P0NA 4K39A 4UFLA 3AO0A 2DJXA 2YDAA 1TIMA 5DY2A 1GTEA 3CTLA 2GVLA 2NZLA 4FX6M 1LDCA 3LCWA 1F2JA 4GJ1A 1GVRA 4NNCA 2ZBTA 5D04C 4XZ9A 3L0KA 1ZY9A 3ABRA 4GUFA 3KVMA 3HF3A 1S5TA 1Z42A 3C8FA 3UWZA 4NZJA 1EA0A 3PBVA 4K8HA 1IGSA 5CPLA 3PS7A 4ADSA 2TYSA 1LM1A 3ATZA 1KTNA 4BF9A 2Y89A 3IVSA 2HTMA 4NUWA 4HSNA 3CT7A 1O5KA 5BMXA 4O50A 3T40A 1OX5A 4PODA 4CCEA 3G1AA 1SFLA 4GUHA 5HJLA 4JDYA 5G4EA 1DV7A 4L4LA 4PEKA 1T0OA 1EIXA 4S1FA 5AHLA 2OZ0A 1UBSA 5EBUA 5G1YA 2H3BA 1JRBA 4R53A 1KFLA 1I2QA 3EEGA 3A9IA 5A8GA 1OK4A 1ZCOA 4A22A 4H4IA 1TRIA 4JTTA 5G5IA 3E49A 3O1NA 4BK9A 5BOOA 3W9ZA 1K3UA 3JS3A 4JTGA 4KFNA 2ZRUA 1GYNA 3F03K 2R94A 2ISWA 4OT7A 4HNNA 4LVFA 3M5ZA 4GUJA 2C19A 1MEWA 4TO8A 3GDKA 3M5YA 3NL2A 5D30A 3G1VA 2FTPA 1BWLA 2EAWA 4Y6GA 3NNTA 2RHGA 3A22A 3NOEA 4NJIA 3VKJA 3NPXA 2TRSA 4XWUA 2PRMA 2FIQA 2F7FA 1H7RA 3LRKA 2HMCA 3T78A 2ZYFA 4EOUA 3PUOA 4WD0A 3MBDA 2C13A 4LVDA 1YADA 5K9CA 1WOBA 5FEWA 4NJGA 2VFHA 3M16A 6ALDA 1H7XA 3M43A 4ALDA 4IXHA 3LV6A 3KRSA 2X30A 3G0UA 4MJMA 5I3HA 2CLFA 3PSWA 1FXPA 3NZRA 1A53A 1J2WA 3W1AA 3G1XA 3KFTA 1LOSA 4UMCA 2XN2A 4W9TA 3PBWA 5AFDA 1TPWA 1TPVA 5D05A 1DVJA 3GDRA 1QPOA 1SW3A 2NX1A 4Z08A 2G96A 4EWND 5C54A 1LBLA 2VXNA 2B7QA 3PUDA 3NQAA 3W7KA 3NPVA 1E51A 1W5QA 4IPIA 2FDSA 1TPFA 4S2BA 3LHUA 1H61A 2CFFA 4K37A 2V2CA 1EB3A 1QOPA 3A21A 3P82A 2EF9A 5FEXA 2XN1A 1WAUA 4MPQA 5EL1A 4GNJA 1XDMA 2J6XA 1H7WA 2DJLA 4CNNA 3P74A 1TJRA 4DBDA 1FDZA 3W22A 5BW6A 1IIGA 5DXXA 3G3DA 3EB2A 1FX6A 3LHZA 2ZZ6A 2RKXA 4DBEA 2H3DA 4JTUA 5I3GA 4AEOA 4PL1A 3GK0A 1QAPA 4FNTA 1VLWA 3WK0A 4UTMA 3W2LA 1P5BA 4O15A 4ZZ9A 3IIXA 1GVSA 1O4UA 3NR0A 2E6DA 2TPSA 2QEZA 3LOTA 4YL2A 1SO3A 3CEPA 2QCFA 4XQ6A 2QUTA 1AMKA 1RV8A 4AWUA 5D38A 1F5ZA 1F6PA 4QNEA 4O12A 1N7KA 3DI1A 2BXVA 1MXSA 2FPYA 1OYAA 4IPJA 2QKFA 4NJHA 4WY0B 4Z0JA 3LCGA 2R14A 1K8ZA 1TREA 1D3HA 3QQ0A 1QPNA 3WFAA 3RK8A 5G2WA 3TU9A 1VCVA 1IIHA 2YYTA 4FXRA 1KFBA 4A3UA 4UNKA 3U2OA 2PC4A 5AHMA 4FNSA 2GOUA 1P4CA 1QMLA 5TBOA 1TTIA 4EF8A 4JTLA 4NX5A 2NUWA 3NQ7A 5AYXA 1Q6OA 5E1QA 1VYSX 2QDHA 1HG3A 3B06A 3L0GA 3LCHA 3IVTA 4AF0B 1DL3A 2WJZA 1GYLA 2B0MA 3NQMA 5F4WA 1AL7A 4MZ8A 2ABBA 1W3NA 3NPUA 3LHTA 1PHWA 3KVJA 1PCKA 4O0KA
chains in the Genus database with same CATH superfamily
5EU9A 4WKAA 3ZZ1A 4M6QA 1QI2A 3RCMA 4I7VA 1PS9A 3O7UA 1XHGA 4J3UA 5BOEA 2NQJA 1WAWA 3V0TA 1XC6A 3PZQA 3AIQA 4N4PA 3FVMA 3A4XA 5KINA 3R10A 3TYUA 2QUNA 3S6OA 2YB1A 3OTRA 4EAYA 2Y5EA 1KA9F 4WOZA 1J18A 4CU6A 2XZ9A 1FDJA 1O60A 1T96A 1IWAA 3PPGA 3MZ2A 3XISA 4PMNA 2GJPA 3ZSSA 3HJZA 3SCTA 1HO4A 3V1HA 3L4YA 1JI1A 4C65A 2VFDA 4L56A 2BDQA 2JEPA 3NAVA 4JYFA 5C2CA 1YIXA 2YDSA 4IJRA 3NURA 2O9PA 1GVYA 4D6FA 1L6GA 4DXVA 4X2PA 1GQNA 5LHEA 1SR0A 5KZMA 1UP3A 5FD0A 5CLWA 3QVQA 3CO4A 4QQ3A 4JNZA 5I78A 2J9XA 3L5MA 1XQKA 4IP7A 1LTDA 1YMYA 4JS3A 1KWKA 4GZJA 3URQA 4A8RA 1LL6A 4QX4A 4A8NA 4UOQA 3T4WA 1LYXA 3GVQA 3MCOA 3VDHA 1HW6A 1B3ZA 1BKSA 6XIMA 2R6OA 3ME3A 1JCMP 1GKQA 3ITCA 4MY1A 1XXXA 3N2TA 3AIBA 1PKNA 4XVEA 2OJPA 4B5XA 4LUYA 4XTDA 1FHUA 2C14A 4D1IA 4DZAA 5C6MA 2D2HA 4UXDA 1MZRA 4R7OA 3VYLA 1KM3A 4F0HA 1AK5A 1PTGA 1KTBA 3L68A 2QCDB 4WXZA 3EDKA 2OMAA 3O0FA 3OVGA 1IV8A 3WX7A 4LTSA 5DBUA 5DN1A 1CGVA 4HOZA 1C8YA 1FP8A 4A4AA 3EA1A 3VD9A 3MO4A 2VX6A 1CGYA 3KTSA 4PUUA 5I7GA 4ASTA 3T2OA 1OFBA 2OTDA 4JR5A 3ICJA 2FVMA 3NL3A 2YOCA 3D47A 1XV8A 7TIMA 3GUWA 1FWFC 3GU1A 2ZDSA 3PAJA 2R1LA 3PSVA 3BICA 3KVKA 3MUCA 4J28A 1P0KA 4PTDA 5D2TA 3EWYA 4NNBA 3OVQA 2WBKA 1MMFA 4WK9A 5M1TA 5C9RA 3TN4A 3KHJA 3UNDA 5G1MA 1E0XA 3MTWA 1E5JA 3IGSA 4PUMA 1JZ3A 1E6NA 4JQ2A 4JEQA 5MKGB 3VIMA 1OC6A 4OZOA 1YTKA 4B2DA 1V3KA 3N4FA 4DF2A 2R24A 3UR2A 2E5CA 3QPEA 1JDDA 5KETA 5IRPA 4LXFA 3VOHA 4GFSA 3UXIA 4PR4A 3VX1A 4PL2A 2AMXA 3PK7A 1UR1A 3FGCB 2CLHA 2VJXA 2FJUB 2V81A 4GXMA 3LCFA 1P0BA 4ACYA 4HB7A 1DWIM 5JH1A 1T7LA 4U33A 1F3EA 1VBJA 1UYQA 3NQFA 1MYRA 4PSRA 1V6XA 1EWEA 3G6LA 3VUSA 1G5AA 1ZAIA 3AOFA 1OC7A 2OFJA 4UTUA 2ZUMA 3P60A 1WB0A 1BD0A 2A3HA 2E6AA 1P6CA 1KC7A 2BNJA 3RFAA 4IFOA 1A47A 5CZKA 1WKEA 1RBAA 3V7PA 1LOLA 1GZ1A 3W7QA 1SO4A 1NOWA 1Q6QA 3L21A 3IRDA 2PODA 1K7XA 1R2RA 4PRWA 4M19A 4GGBA 1X6NA 5AN7A 3HU7A 3F4VA 4UMBA 1XM3A 1CXEA 2WSYA 2XVPA 4L9ZA 2G4JA 1DPMA 4CD4A 4A2SA 1BTMA 3BV4A 3ZLHA 1M7PA 1DHPA 3W85A 2PI6A 1MW0A 4RDWA 2X0HA 4RKAA 3WQCA 4L4MA 4Z1CA 2VI0A 3QV6A 4I7UA 4B5NA 1R87A 1IYXA 3BG5A 3L5LA 1V3JA 4IIFA 1W1ZA 4LYPA 1E72M 4ZQCA 2PAJA 1F4HA 3PPCA 1HNYA 1V02E 2OEMA 3CHEA 4LPCA 2VL4A 1JI2A 2I14A 3BSMA 1VFSA 4KT2A 5CZSA 4IICA 3VC6A 3UYIA 4M8UA 1AFSA 5MHBA 4RDYA 3QW3A 1FFQA 1N8IA 4QSFA 4H9MA 1KLYA 4QFUA 5E93A 1UWSA 4HCDA 2XVKA 4G8TA 3M46A 1PJ9A 1MDRA 3A47A 2E1WA 5EYWA 3P7YA 1H60A 3S2JA 3QGVA 3C2OA 4AVOA 2W4XA 5B7YA 4IPNB 4KCTA 3VIOA 3UPMA 3QRHA 3PM6A 4P7LA 3IGUA 1FWRA 3SN0A 3AMLA 2GDQA 5CBIA 5C9WA 1YDYA 2ANUA 4JFWA 3WMBA 4OBRA 1XYFA 4S2CA 1TJPA 4HPGA 4D9PA 2Z24A 4BF5A 4QAWA 5DMYA 4OBSA 3UGVA 2B7OA 3NFUA 3DYMA 3NQEA 5FEPA 2Z6JA 3BTNA 2YYUA 2ZUTA 4WOQA 3F5LA 3RXZA 3O63A 2QS8A 3DHDA 4Q8UA 3TR2A 5K9DA 3L4UA 3SI9A 5ABHA 3SR7A 2G4FA 4KF1A 5KITA 3KOZA 1DKWA 1WP6A 4Z2GA 2I7GA 4KETA 3PBGA 1A4MA 1YTDA 2W3ZA 3Q58A 1TTPA 1L2UA 1CENA 2DT0A 4AFYA 1CNVA 3VDBA 3VZZA 4JN6A 3W1LA 3BC9A 2GVYA 2Z1KA 3DI0A 3I7RA 3TWAA 1WBJA 5EPDA 3NDZA 4QSHA 4UTLA 2YZ5A 1RZMA 3V1PA 4MM1A 1Q6LA 2V5BA 5BWAA 3GVVA 3H2MA 4V15A 3NQ6A 5HPOA 1BYDA 3GTXA 1SW0A 4TVCA 5C55A 2JGQA 1JUKA 4Q33A 3TMQA 1EHNA 1B3OA 3TR9A 4XZBA 4S23A 1B4EA 4K38A 3CQHA 1FWJC 1GVIA 4EXAA 4C6NA 1D8WA 1U1UA 4F2TA 4I5RA 3N11A 3VOGA 3Q67A 3VNYA 1EJSC 2XZ7A 1GOIA 4Q7IA 3LXCA 1AW1A 2E3ZA 4UZSA 1F6YA 3M0JA 1JCYA 3E3HA 1JCJA 4LUTB 4QROA 4B92A 1VIWA 2PU0A 1NJJA 3FK4A 3UQNA 3WQOA 4AF0A 3IJDA 1W56A 2XGBA 3GWQA 1KB3A 2E9BA 4QS6A 4NASA 3IEBA 1K70A 4EWJA 1TYGA 1I2RA 4HA1A 4ZB2A 3O6DA 1A5SA 4GG9A 3QV9A 2WSPA 3C2RA 3SRDA 1OCQA 3BO9A 4E2DA 2OKOA 4LAZA 2IKJA 5CPOA 3SJNA 1VPYA 4AHQA 3OIXA 2PF8A 4JX6A 4QP0A 4K7YA 2W67A 2ZZ4A 1T99A 3R94A 1ZSXA 2QAPA 2CLMA 5I2UA 1MO0A 3ZR6A 2EG7A 4HPXA 3PZTA 3AFBA 2ZOXA 4UR8A 4KQNA 3LMYA 2Z29A 3N15A 1S5VA 4MSSA 3N73A 2VVSA 1F74A 2NV2A 4MKNA 1OABA 1GZGA 3LGEA 3T1GA 4FNUA 1XRTA 4IIDA 5DQPA 5A2AA 1VEOA 3FHQA 3CB3A 1EJRC 1E1EA 4V2XA 2VZSA 3IUIA 2OQLA 1V0NA 1IZCA 2GOKA 3OA5A 1GPWA 1ZJIA 5EMUA 1GJPA 4QITA 1JL8A 4PTXA 1JVNA 2WNZA 1QATA 2XFWA 2DZAA 2ZZ2A 3FV9A 1K8XA 2OQYA 4Q4MA 4WSHA 1Y0EA 1HL8A 1FY6A 4ATWA 2NX3A 1NY1A 5ECVA 3NJ3A 3G24A 5A6SA 2P3ZA 4DJDD 4UQAA 4O54A 1ZGDA 3ID7A 3QR1A 4N7QA 3M7SA 1WE5A 2Y6ZA 4DHGA 4DBWA 2H6RA 4GMEA 3KBNA 4CCCA 3LTYA 3VD7A 1WXJA 1JCXA 1W1TA 4MFEA 1XLDA 3LLXA 1FVPA 4U3AA 4HNOA 5FJPA 1AQFA 1KQZA 1YKWA 4LQ1A 3ABOA 3PZ9A 4MY8A 4B3LA 5T9CE 4LSBA 4GIAA 2E28A 2VDIA 3PB0A 3FXGA 3VGHA 1QRQA 1D2KA 3LRLA 4EVZA 4Q4SA 1XDLA 3L4TA 5FACA 4YXGA 3OG3A 1XP3A 1M5WA 1ZALA 2MANA 1D3CA 5C7VA 3WD3A 4FXFA 2QCCA 2OOGA 1KV8A 4A2RA 2CZVA 2X1TA 1O12A 4JYDA 4QTGA 3ZXWA 3DC8A 4DJFD 3G5EA 1E71M 3W6LA 2VC9A 4LEQA 3ONBA 3D3FA 3BOFA 4J9JA 3B03A 4FB7A 1BXNA 4P7QA 3NXFA 3U57A 1QVBA 2AMGA 2CPUA 1CEOA 2J75A 3IK4A 4UTWC 4QQUA 1M3UA 2NX9A 2WW5A 5CGMA 1XIBA 5EMYA 2Z00A 4RE2A 1UC4A 1NM9A 4NF7A 1AMYA 1MZHA 1YHTA 1Q45A 4X0NA 4MAVA 2W5FA 4J1OA 4I3GA 3CQIA 4XX6A 2WVUA 5BNKA 1X6LA 3GY1A 4URIA 4PA8A 4O1AA 3WZ0E 4I5XA 4IWWA 1PZ0A 5TF0A 1LRQA 1EDGA 3O6CA 1QFEA 1LZOA 4IG2B 1US0A 2PDIA 2HK1A 5K9XA 2XN0A 5LNVA 3T0AA 1XLAA 4HPNA 3RAOA 3WSUA 3ALGA 2BBFA 4RXGA 4IUOA 2O9OA 3TNBA 2Q71A 1TTJA 2PWFA 1VFOA 1UR4A 4RR4A 3LENA 3GD6A 5LIWX 4GA8A 1VBHA 5B80A 4P8WA 5TD4A 1UUOA 3VC5A 1GVQA 2PRLA 2QULA 4BHYA 3ZWTA 4H7VA 4MMWA 4E2OA 2NT1A 1Z7AA 1R3VA 1TJ1A 2ZE0A 4U5IA 3AIUA 1E9IA 3KTCA 1V08A 1GVOA 2GJRA 1IQ8A 3PZVA 1EH9A 2QGYA 3BAXA 1DJGA 1I60A 2X2GA 3L4VA 4H01A 4RZ6A 1U1HA 4NRSA 4R33A 3C0QA 1RPXA 1EYWA 5FJRA 4PMDA 4DUWA 1Q7ZA 3DYPA 4MWAA 3MYPA 1UC5A 3DIPA 1B54A 4X0VA 4FF7A 4ILSA 5A95A 4HKPA 2HE8A 3L67A 2CNCA 3SRKA 3WFZA 4LRSA 3RU6A 2XGZA 5FCZA 2JQXA 2W79A 3BLLA 2YBTA 1H5VA 1W3IA 4KFOA 1R5YA 2DZPA 4ICCX 3HGSA 3L0NA 2VCBA 4X3ZA 1W3TA 4OV9A 3NQ2A 4XG1A 4P61A 2RDWA 3GW3A 3MHGA 2Y62A 2YL5A 2CLLA 2J74A 1XYCA 3O15A 3PNUA 4IX0A 1G4PA 1FH8A 4GQBA 3SCWA 2ACQA 5CC7A 1MNZA 2BVWA 1CGWA 1CLXA 2WC3A 4JNMA 4HU8A 3PBMA 3LTPA 3E0VA 2GWNA 1SUXA 4PMJA 3IJ8A 1M6JA 1PWMA 3VABA 1FUYA 1IXOA 2WLZA 4QCEA 1WXYA 1X39A 5A8PA 5D9NA 1BAGA 3UA3A 4WCJA 4XZHA 3ZIZA 1M03A 4NAFA 3EXTA 1TCDA 2WMGA 1C90A 1JCLA 4IQEA 1Y65A 4XZLX 3WQFA 4GHRA 4LEFA 2XH7A 4KWOA 3BG3A 4NNAA 1KQYA 4M7TA 3KOFA 2Z2UA 1E55A 1B1YA 1XKYA 1SZRA 2YW4A 3KBJA 2D22A 3L7RA 2ZRZA 3SUTA 1C8VA 2R1PA 1K03A 3T09A 4XIMA 2HV5A 3WQ4A 1F73A 3UERA 3GC2A 4FX8A 4H8VA 3M0YA 3VU2A 2DDXA 3T55A 4OTKA 4WRHA 5E6YA 5HWMA 2QUMA 1K9FA 2PP0A 1B3VA 1JPHA 4JQ3A 2CLOA 3AHTA 4OWGA 4LX4A 2B7PA 4AXKA 3TEVA 1XIDA 2V67A 3EKLA 5HUPA 1E3XA 4GNKB 1TX0A 3MSDA 3VCCA 1JCNA 3WLSA 1W17A 5HMSA 3RYSA 1A5CA 1XINA 4HGXA 4D6GA 3QC3A 2GWGA 2CERA 1CGTA 2ZWZA 5FOOA 4PUWA 3VIJA 3U9IA 3ITOA 2OELA 1ZB5A 3WDPP 2VFIA 1ADSA 3TQKA 4HTBA 3T44A 3NO3A 3REQA 1WA3A 2GUBA 3QTGA 1TTQA 2J47A 1SQ7A 4K8EA 2EPOA 3PVFA 1YPIA 4FLSA 4BEQA 3VGEA 2YPIA 4UFKA 4R7WA 1WQ5A 3BCDA 2Y85A 4Z2KA 4B5UA 4HNCA 4IGSA 2ZUVA 3DGRA 4Y7EA 3KVLA 1MRQA 3K8KA 1OK6A 1QNVA 4LAOA 2ZX6A 4BA0A 1UG6A 3R8RA 4PRTA 5I0DA 3CLMA 3FYPA 3I3DA 2Z26A 3CM4A 4LY4A 4HA0A 2VCAA 1JCTA 2WCSA 1OGBA 1OHLA 1VFHA 5LA2A 2EG8A 4LUSA 4EPEC 3UNTA 3M07A 3QPZA 4C1LA 1TZZA 1VFUA 2OWWA 2IXUA 3O06A 1MW3A 3G1RA 3OBAA 4IIHA 3LK6A 2WJEA 4YPJA 1EEXA 2WHLA 4Y9OA 1CLVA 1E0UA 4EIVA 3VAVA 1F9CA 3UP8A 1ZU8A 3M0MA 3HV8A 1MDLA 3C61A 4V28A 2Z1SA 1EUNA 1LUCB 3O6YX 2CBIA 1TA3A 3LBCA 3NXLA 2DT2A 2QCLA 3THQA 2WC7A 4HN8A 3PANA 1YXDA 3UZWA 1M41A 1B90A 4D6HA 3OGVA 1PAMA 1E6QM 2WV8A 3URAA 4ZSTA 4IH3A 1XS2A 3W88A 1MEHA 1I0BA 3HTWA 4PMVA 2VO5A 1RHCA 4I8YA 4Y9PA 1ITCA 1JJKA 5I3DA 1J0ZA 3ECQA 3SGGA 1CXFA 1JDFA 2D2JA 4O1CA 2CZDA 4FXSA 2G3FA 2FTWA 4YWIA 1S5MA 3IIVA 1FHVA 2D20A 4XIAA 3NA8A 3D3AA 1GEQA 3N13A 3OPSA 4OGZA 2X8RA 3W86A 5DMMA 3K13A 1OFQA 3BW3A 3W7IA 3MI3A 5CG7A 2YCLA 3F5KA 3C0JA 3MB9A 3W1TA 3TSDA 1EJVC 1CW2A 2REQA 1CLKA 3EMZA 2J8GA 1ONXA 4UUIA 3NZGA 3QMTA 1JQXA 4CCDA 1PZ2A 1R47A 1MRAA 2A79A 1ZS2A 4IMAA 1VS1A 1RP8A 4GGHA 3KZSA 2CEQA 2PDLA 2D69A 4GQ0A 2BOFX 2D23A 3RLVA 5A8NA 4R3UA 5I3JA 1D8CA 4EKJA 1TUXA 3FAWA 2QCNA 2A7PA 3AXXA 3DFQA 3WELA 3T81A 3PUEA 3ANVA 4H04A 3GFZA 1PBGA 4POCA 1NF7A 4GCAA 3OGRA 2YL6A 3NSNA 2UBPC 1ICPA 2GSJA 4KERA 3DUGA 2Y7GA 6XIAA 3W84A 2DZVA 3T2QA 2HVNA 1XG4A 3HFTA 4HN4A 1EFZA 3BAWA 2QLYA 5AY7A 1FA2A 2Z1XA 1H0GA 5F4XA 4C6PA 3PULA 5DBTA 4H19A 3UR8A 1KNWA 6ENLA 2VGIA 2PWDA 1XLEA 3U0HA 1GHRA 3DFOA 2C1HA 2HZGA 2JK2A 3TYEA 4MB5A 4C6CA 4PUJA 5M5DA 2DZSA 4UCFA 3VKAA 1DXIA 5DY3A 3QN3A 3CHVA 1V4YA 4DYEA 3W75A 4H9XA 4RK8A 4AHOA 3H26A 4G6CA 3C3NA 3EZ4A 3SDOA 3TYAA 2V5JA 2P3EA 3AJ7A 1TRDA 2XWEA 4WUIA 1XGDA 5I03A 3BE7A 4PSPA 1PTDA 2OODA 3NO5A 4MZ1A 2PDMA 1UH3A 4S3GA 4EPBC 3T42A 5CJMA 3AICA 3EWDA 5EY5A 1W8GA 2W91A 3VM5A 4YVPA 4JXCA 1S2TA 4ZE5A 1R9XA 1SMAA 3MO7A 1G0CA 4ROPA 4PMRA 4F3HA 2J9ZA 3QV7A 1T6MA 3R5EA 3T0BA 3MJYA 4JFTA 5F7UA 3BSGA 3PZGA 4B4FA 2VEMA 4WSKA 1V3MA 2P8BA 4NSBA 5LYRA 3UZYA 3UWVA 4KPLA 3W2JA 4UC5A 1E5NA 4QR6A 1XLKA 1GZJA 4S3AA 1G7VA 4UIOA 5LKYA 3I6EA 5GJMA 5A2BA 1EQPA 5H8UA 2VELA 1ZAHA 1HL2A 3VI2A 1GCYA 4O1BA 3ABXA 3P93A 1ODZA 3C5QA 1UUQA 1ZRQA 3EMQA 3LDVA 3JW7A 3EXSA 4RW5A 3K1DA 5GNZA 2ALDA 2CWXA 1VR6A 2O56A 1DQUA 3S5OA 4ORIA 3N3TA 2D3NA 2D0HA 3GKAA 5TIMA 3U3HA 1UPMB 1WUEA 2ZX7A 1UKTA 2WK2A 1B2YA 1EJ7L 2O9TA 4A21A 4L6HA 2DJXA 5DY2A 2GVLA 5JVLA 4DJED 2WZTA 4L7ZA 1GVRA 4D1JA 4NNCA 2PF0A 3CUZA 4XZ9A 1X96A 3LYEA 4GUFA 3KVMA 1EYEA 5LIUX 3C8FA 1U22A 3UWZA 1EA0A 4K8HA 3PS7A 1P7TB 1I6NA 1JAKA 2PGRA 1KTNA 5TAOA 2BOEX 2HTMA 4NUWA 3V18A 1QBBA 4FS9A 4F9JA 5BMXA 4PODA 2O4QA 3G1AA 1SFLA 2CYGA 3P0XA 4F0MA 4GUHA 2VRKA 1QTWA 1LWIA 4PEKA 3WNLA 2CESA 2OZ8A 5AHLA 1Y7VA 2VRJA 3UG5A 5HNTA 5G1YA 3SCPA 4R53A 5IDIA 3P2VA 3A9IA 5GNXA 5HK4A 4JTTA 5G5IA 3O1NA 5A69A 4YTSA 4HOXA 4QDPA 3VKDA 2YDQA 5J04A 3F03K 2R94A 4OT7A 1GONA 1NFGA 4LVFA 3M5ZA 4M1BA 3GXIA 5CSUA 1MEWA 1EC7A 4H8NA 3M5YA 4MPKA 5D30A 1BG9A 2BVTA 2GLKA 1ZLPA 1EC8A 2TRSA 3ZLGA 2PRMA 1H7RA 3LRKA 2HMCA 4R9XA 2HQAA 5MF5A 2ZYFA 4EOUA 3RR1A 3PUOA 3R7MA 4WD0A 4UTFA 3MBDA 5A6KA 4LVDA 5K9CA 1WOBA 6ALDA 1EGVA 4IGNA 4US6A 1UJQA 2FVLA 3G0UA 4HMDA 1Q6GA 4E8DA 4L1XA 4FOUA 1J2WA 3W1AA 2WWDA 3SUWA 1NDYA 3PBWA 1TPVA 1QI0A 5D05A 1BVZA 3GDRA 1QPOA 3RN6A 3ARVA 2NX1A 2G96A 4EWND 3RJYA 3WH9A 1NOUA 1P6BA 3AIEA 3S9ZA 3MC5A 3W7KA 1GVEA 4AD5A 1E56A 2AAAA 4LYQA 3THCA 1YQ2A 4IPIA 2FDSA 5FJTA 1TPFA 4S2BA 3LHUA 3AAMA 1JDCA 4C6MA 4B15A 2HBXA 4RPQA 1EB3A 1XG3A 4F0LA 2OSXA 2EF9A 2J13A 1XIEA 2EBNA 3VGGA 1TJRA 1R38A 4KBXA 4C1NA 3D5HA 3G3DA 1DWJM 1AZ1A 3H23A 3VZYA 3LHZA 4IIEA 3U4AA 4C7FA 2DQWA 2YIHA 3GK0A 2E40A 4O15A 2SFPA 3VINA 5A3HA 5H8MA 4YL2A 2W63A 2XVGA 2QCFA 4XQ6A 1JPMA 2FYMA 1F6PA 2INEA 1F3WA 2ZIDA 1RBLA 1N7KA 4AXNA 4IPJA 1NWRA 4JL1A 4NJHA 2EG6A 5BXPA 3JZEA 1EZWA 3RK8A 1MQRA 1JDAA 4J27A 4WJ8A 1JGMA 3U2OA 4FNSA 2GOUA 5AKQA 4DXXA 1QMLA 1IEIA 1HJSA 4DAFA 1TTIA 2NUWA 3RU8X 3VDAA 4YHEA 1Q6OA 2QDHA 1HG3A 3CO8A 3IVTA 2B0MA 1QU4A 4H00A 1Q65A 2ABBA 1W3NA 2GK1A 3LHTA 2RAGA 1E4IA 3M9YA 4AB4A 1Q7QA 1RALA 2FDMA 4HZ6A 3GX9A 2ZTJA 1WDQA 5FESA 3R8HA 4HHMA 2HE5A 2BGQA 3OVPA 1JYWA 1UD4A 5LZLA 5A1AA 2DU2A 2C8NA 1EJTC 5A5WA 3PTKA 3QQ1A 2J66A 2VKZG 3VCRA 1HIZA 1H09A 2P8CA 2VENA 3EPOA 3NZ1A 1ISZA 3GXMA 3FA5A 4HNUA 2Y8UA 2GJLA 2QUVA 3E96A 1XBYA 3S5NA 2Y5SA 3SUVA 1RSCA 4Z2LA 5AYZA 2V6AA 3WJWA 3R25A 3TC3A 2DT1A 5D2XA 4MHBA 1AH3A 2QZRA 3W1UA 3NVTA 3VE9A 3F2CA 4D71A 5HJYA 5I02A 1FP9A 1AJ0A 3W7EA 4AD1A 3GAKA 4ZVJA 2G8ZA 1ZAJA 3LB0A 1OF6A 3WNKA 1Q66A 3COTA 2PE4A 3K1GA 1DWGM 1N8FA 2AL1A 1KFCA 4OECA 1E1FA 4LCSA 1U5JA 1MW2A 5CKSA 1YNPA 3LV5A 2WQPA 5I5RA 3IIPA 1JD9A 3WF1A 3OG2A 2OXNA 4O14A 1YE4A 1EO7A 1J0JA 3TH6A 4E6MA 4HT3A 4L65A 3BW4A 3QTPA 5XINA 4HMNA 4UTWA 4C6KA 4DIAA 2Q01A 1UD5A 4O52A 5AC7A 3G1SA 1BG4A 4AY8A 4NVTA 5IBXC 5HR7A 3WDJA 3W01A 2YGYA 4CEUC 1OCJA 3CAQA 4J2MA 2VR2A 3D0CA 3ARXA 2XSAA 4F40A 2AL2B 4M7SA 3P67A 5C2XA 1JXJA 3S5ZA 1RD6A 1W3LA 3ARSA 4HNVA 2VGGA 3FDGA 1O1HA 2UWFA 3PP7A 5LGXA 4QLLA 4KWUA 2NUXA 5CSSA 2IKHA 3G77A 3F4DA 3CU2A 4PMOA 3LSCA 1JUBA 3WJZA 3BJTA 1B5TA 4KCUA 4O4WA 4NI8A 1V03A 2ZA3A 2WM1A 3WBXA 1QR7A 4Z1YA 1E0WA 4FALA 1CPUA 1BSLA 3CQ0A 1IF2A 1KCZA 5CJNA 4KS0A 4UFIA 1ZJBA 5AZ1A 2QCGA 3BAYA 4K36A 3LN3A 1XFCA 5DMNA 2X40A 2E67A 3PNZA 2ISVA 4D2JA 1UR9A 1KXQA 2V8ZA 5KZ6A 4DLMA 1L6FA 4A3YA 4J4KA 4QIUA 1XR2A 2J27A 4QJ5B 1TVLA 3CGTA 3MCNA 1U5VA 3FLUA 1E4NA 1GPFA 2OR2A 3WF4A 2PTWA 3WJYA 3B9EA 4Y9AA 2OO6A 5D37A 3NQ8A 3HQNA 4MJZA 4M1RA 1EXPA 4BFAA 1SM9A 2JKAA 4DO5A 4C60A 2GQ8A 4EAMA 4GI8A 3IJ6A 2FZ9A 2WLYA 1PIFA 1VJSA 4W7VA 4AZCA 2E0PA 3H12A 4RXFA 4UQBA 1OYCA 4JFVA 2EPNA 2GFTA 4Q7NA 2WVVA 3B8TA 3RLUA 3FW6A 1AW5A 4PMXA 1UWUA 3NL5A 3VCNA 3W71A 4R85A 4JQ1A 1R85A 3ZSTA 4GQRA 1S46A 5DF0A 3M0LA 3VMOA 3QH2A 4DJDC 3STPA 1J0KA 5LXEA 1GJWA 3EBVA 4D8ZA 2D2GA 2QV5A 4A35A 2W6RA 1K7FA 5G2HA 1KV5A 3VIIA 2FB2A 3ES7A 4W93A 3W7DA 2CHRA 3ARRA 6TAAA 3VGBA 4H41A 1H7OA 1S3TC 5LHFA 1ZTVA 2G5WA 3JRKA 4GY1A 1W9BM 2ZZ7A 2J79A 5CZTA 1R9ZA 4FOKA 4M0XA 1G01A 1V6TA 2CLEA 4UWMA 1MXGA 4IFRA 2Z0IA 3INPA 3FNDA 3MP4A 2YSWA 4JL2A 3THUA 3CQJA 3R0UA 4M80A 1F8IA 1PSCA 4N02A 1DJYA 1PDZA 3ITTA 5FSEC 2V82A 1CCWB 3HGRA 1YYAA 2AQOA 1XD1A 4TTGA 2BY3A 2R91A 3B8VA 4DM2A 4NJKA 1US3A 1DHKA 4MZYA 1ESWA 3N9RA 1V3HA 4YWSA 3W27A 2R82A 1LLOA 1M7JA 3DENA 1MW1A 5LNSA 4TV6A 5FF4A 3N6JA 1YTEA 1LORA 4N6EA 3B9AA 5CAHA 2EO7A 1SSDA 3RITA 3WUGA 5FF0A 5I23A 2ZQ0A 4KESA 2XH2A 3QY8A 7CGTA 4HU3A 4AWTA 1VJZA 4PUDA 3HO8A 3WBEA 1XLFA 1A5LC 3W2MA 2P1FA 4C90A 3MVIA 4UFJA 3EOLA 4GINA 2YCJA 4X9SA 3V75A 2QJMA 1K4HA 4TU1A 4G7EA 3DU0A 4MLJA 2XIMA 3A5FA 3GBEA 1O5XA 2CHOA 1SZNA 2NVDA 4EXQA 1LLZA 3GVGA 1UKOA 5JBEA 3A64A 2Y8KA 4N2YA 3L2MA 1BQGA 1Q63A 3AYRA 1QPQA 4DWDA 8XIAA 1XCXA 4IIBA 5HQEA 2PZNA 2QMJA 2RGMA 3TLQA 2E8YA 3TWBA 1M7XA 2OEJA 3VTRA 4EPKA 4NZCA 5HOSA 4JTSA 3NOYA 2Z6IA 1OG0A 3QM3A 1IXQA 4H6KA 4W5ZA 2J7CA 1E6SM 1ONEA 4ML4A 1RA0A 1VLIA 4FNRA 1Y5WA 2B81A 2CBUA 3SN1A 3EWZA 5REQA 2BP1A 5LIKX 2XWDA 2Z1VA 4Z42C 4LAUA 4ATDA 1J93A 3B8DA 3N12A 4HZMA 4UTIA 2VEIA 3E0IA 4JIPA 4BCEA 2XYLA 3GNRA 3GW0A 2WAGA 3B0YA 4TX8A 2POTA 4RE4A 3MU7A 4PE8A 2VZVA 2JE8A 2FZDA 4PBFA 4QE1A 5EKYA 1DIKA 3WK2A 3JUGA 3AU2A 3DFTA 4LB4A 4IHCA 3DFNA 5HA7A 2BWGA 4GYPC 4AIBA 3JU2A 3G8RA 3C0LA 4PUKA 1XYBA 2X2YA 1OG6A 2L5HA 3SN4A 1VCGA 4HQVA 1XGZA 4MYXA 2QPUA 3B8SA 1MEIA 3EWBX 4US5A 1C9WA 4I7WA 3MT1A 4I5UA 5EMLA 3SIMA 3GC5A 4LBRA 3NPWA 4C1KA 1QO5A 1LT7A 1XSJA 3UXDA 2QHAA 3OZMA 2QMKA 3T0CA 3D46A 4ADTA 1G94A 4DBUA 4UTHA 4RCXA 1PHQA 3S4TA 3FOKA 3VZXA 3GNDA 1SW7A 4GX8A 7REQA 1WO2A 4N9DA 2VRQA 3H4GA 4H7CA 3WQGA 1MUCA 1K8CA 2DEPA 3WLHA 3N2MA 2WZIA 4S38A 4ZFCA 4FNPA 3RHGA 3C6CA 1QASA 4EE9A 4ZOAA 4JGDA 4GYJA 1EL3A 4CQCA 1GOQA 4X22A 3RPTA 3TAKA 3OW1A 2H8ZA 4XZWA 4AAJA 1REQB 2XIIA 3P6LA 3CUHA 3QKEA 1XLGA 4J3XA 2X09A 4LH8A 1KRCC 1I75A 3VILA 2PDKA 5A94A 2BVDA 3MWCA 5GNYA 5A6LA 2W92A 2X7WA 4LUIA 2RDUA 1VFLA 1EHAA 1B3XA 4QISA 4JBRA 5CPSA 3RM4A 3UWUA 2EPMX 3GVRA 2XG9A 2G97A 2XPKA 3IPWA 4CD7A 4AHPA 5M3WA 4FSAA 3BCJA 2FZMA 1W1IE 2V0TA 1T8QA 1ZBWA 2PZ0A 2V5KA 1CTNA 3SY5A 3EAUA 4F48A 4NJJA 3W38A 3UESA 5BU9A 2J77A 4JTIA 4PZVA 4HSHA 3W0KA 1XL9A 4GC4A 3N2OA 4TTUA 3BLPX 3GKFA 4GIYA 3WLPA 2JKPA 4AZHA 2FLIA 1YBQB 3FDKA 5D02A 1YDNA 1TUFA 4M82A 2YA2A 4CKQA 1LL7A 1TZ7A 1HN1A 3CZEA 2OCZA 4GH1A 3UJEA 3ZJKA 2XTKA 4BQ2A 1PVNA 1UASA 1UKQA 5HMEA 3RJXA 3WDRA 1KFKA 1IEXA 1OX4B 2X16A 1DIEA 4DO4A 5G2IA 2PDCA 3BL3A 4TMCA 3MSRA 2VNCA 3R43A 2G3MA 4Q32A 3DG6A 4HIBA 5HAOA 3UG4A 4MLRA 3WNNA 2VEFA 3M5XA 3PJWA 1CXLA 4JHOA 3O16A 3OODA 5MKGA 3EDFA 1CYGA 3PY2A 3ELFA 1J79A 1D7FA 3PB2A 1ICSA 3K8LA 2WJFA 2CXGA 3CZKA 4DWSD 4DPPA 1UP0A 1W9DM 3F4NA 2HVMA 3CUJA 4IPLA 1JG9A 1WDPA 1SZGA 2PWHA 2J9YA 2XFYA 3FGCA 4MB1A 1Q85A 3H55A 3UWEA 1R46A 2ZRXA 3ZJ7A 4WJXA 3POCA 3MBFA 4MDOA 4X2RA 3HMCA 4CVWA 2OLSA 1FWEC 3K4AA 2VT0A 2P53A 1RQHA 3USBA 2OT1A 3KCLA 4JEJA 3NYDA 1X1OA 1ZQ5A 5BZAA 2F6UA 1VHCA 3W1XA 1L8PA 3IANA 3KOXA 2DP3A 2WMFA 5JIPA 5TNVA 2EJ1A 1BYAA 1VH7A 3R8GA 1MWOA 3TUUA 1HTIA 1ECQA 1JGIA 2QAFA 4QM1A 3Q45A 3A3XA 4CN6A 3THAA 3UWWA 1W54A 3G0SA 4GC3A 4E3TA 3WBWA 1LBFA 3WIJA 1TFVA 1Z89A 4GNVA 3CUXA 2OYKA 2HPIA 3QHNA 3LHYA 1EZ2A 5XIAA 5HUOA 1F7BA 1NWUA 4BJHA 4LVBA 2O4MA 3OHMB 3Q65A 2CZ5A 1VYRA 3VNLA 2ADAA 3WLIA 2E5BA 4DWSB 1FDYA 2CWNA 2AGKA 4S3FA 1OADA 3W7NA 3BAJA 2H90A 4E38A 1D3GA 2BHUA 1PL9A 4DO7A 3H2EA 1AZ2A 1OZQA 4U2ZA 1DJIA 3GFYA 2QYGA 5AYYA 1RJPA 1BHGA 2A2IA 3W1NA 4D8LA 1UOZA 2IQ0A 1H50A 4CN4A 4IISA 4WSJA 4W5UA 1I0DA 1FWBC 1SJAA 2BGNE 4H3DA 1E43A 1TSIA 1TV7A 3DBPA 4MWAB 4OKDA 3OBKA 3AISA 3S2CA 4K1GA 3T08A 3ENLA 3RRAA 4XBJA 3NCOA 3TZFA 5D2VA 4AD2A 3STGA 1XRSA 1TPB1 3LI0A 5D09A 1G7UA 3W1QA 4XKMA 3PFMA 4W85A 2DFAA 1OWQA 1BLIA 5C5YA 1RCQA 3N34A 2FZNA 4AEFA 5CPMA 2PTDA 3WDHA 3TQPA 4NI3A 5E6ZA 2Y7DA 2AAMA 3UR5A 2D24A 4JCMA 1DWHM 3S2NA 2ZUWA 1QW8A 4HNLA 5CLTA 1UBPC 3GHSA 4ZB0A 3ZJ8A 4IL0A 5HMDA 1Q6RA 2ACUA 3S47A 4ORMA 2GQ3A 1UD6A 2KAUC 3LM3A 1U2YA 3W6YA 5J5DA 5DFAA 4ZXOA 4Q8VA 2OX4A 3O8AA 2E25A 1J5SA 2ZXBA 3M0HA 4AD0A 4N9EA 3IVUA 1OIMA 1EDQA 4AX7A 2DZXA 2H8XA 1GUVA 3EOSA 3GM8A 3M47A 4XKYA 3MPGA 4Q8TA 5I3FA 2I17A 1RAKA 1XIIA 2VP8A 3S9YA 1W9PA 3V5FA 3WQPA 3UEQA 3C8NA 4F0RA 3S2LA 4GI4A 1OJXA 4BQ3A 2Y70A 2NXHA 1I2NA 1OFRA 3Q37A 1DTUA 3GIQA 1PX8A 4RNIA 4LS0A 1BYBA 3PPHA 2Q3OA 3ATYA 3BMXA 1B9ZA 3AWOA 4XVDA 2Y7EA 1JNDA 4A3QA 3KTXA 4C91A 4IL2A 4P7RA 2FPTA 5RUBA 4YU1A 1QCWA 1S2WA 4L9YA 3QMSA 5K4XA 1T40A 2VURA 1ISVA 4IMCA 4KWSA 3SADA 3BGGA 2XH4A 2PDJA 4NZ5A 4S3KA 3AJXA 2CC0A 2C91A 3MP5A 1HVQA 4DM1A 2G3JA 2OSWA 3E1F1 4LNYA 1WYIA 1GVFA 2E9LA 4GQQA 2B4GA 1VKFA 5GJPA 1XIHA 3WBYA 2OWCA 1F61A 4RNFA 3QHOA 4P2VA 3W24A 2IPWA 3OLEA 2EGZA 2QGHA 4GI9A 3KCOA 4CQDA 2E8ZA 2RJHA 2PCQA 4UMAA 3TLLA 4UQCA 1DWAM 4DJEC 2VR5A 4FPSA 4HPJA 2NVAA 4ZGYA 1HKJA 3REQB 1Z69A 1G4TA 2E6YA 4Q8QA 1BYCA 4DRSA 2IQDA 4UQ9A 1F6KA 3BJSA 3F7JA 1RH9A 3PPFA 4AW7A 3H24A 2VX4A 3BZJA 3W7LA 4Q8NA 4XV0A 4RZ5A 1VBGA 4I6VA 5EMKA 1LL4A 4TUFA 5PTDA 4LUSB 1NWTA 2YCKX 4QCFA 5A8MA 4RV3A 3WMCA 1SZEA 1O6IA 4DUXA 4JQAA 1OFPA 1BFNA 2BOGX 2PWUA 1CBGA 3WLJA 4RJEA 3CIWA 1I4NA 1FWDC 4S3EA 5D9PA 1R3YA 4RE0A 1KM1A 2ZVIA 2BZNA 4WDUA 2WSRA 5IBXA 1OF8A 3R0KA 1OY0A 3EMCA 3NSMA 1GQLA 1IXNA 1KM2A 2BSLA 2CZFA 3QC0A 1Q7MA 2G50A 4NT0A 3MCMA 5J5RA 1KRMA 4Y9NA 4QGCA 1M7OA 2DPEA 3NSXA 1VRDA 5DT7A 1Y8BA 1BSIA 2HNEA 3O07A 3WDIA 4E2VA 2WVTA 4LF2A 1SJCA 3I68A 2ZADA 1DJWA 1FTXA 3M0XA 2ZUNA 4CNPA 1QPKA 2YCEA 3EYPA 4HHPA 1V0LA 2ZZ3A 2GDVA 2A3LA 2YX0A 3TAOA 4FNQA 4HHLA 2ZRYA 4QS5A 4D6IA 3QSTA 1UR0A 5ABFA 3OBEA 2A5HA 2Z1BA 3ITVA 1S2VA 3HG4A 2UV8G 2HEJA 1GK8A 3TA6A 3NG3A 1UZDA 4AD4A 1MNSA 3VFLA 1GG0A 4PB5A 3MP3A 3FKRA 2REQB 1HKKA 3O0KA 4JIEA 2OVLA 4DNMA 5A6MA 2GVJA 3DOPA 2YA0A 5CQ1A 4KWWA 3IGHX 1TPUA 3G1FA 1IT8A 2E77A 2ISSA 4ZTYA 1TWIA 3NGJA 2ATSA 3VNIA 4DX3A 3SQLA 4MOZA 5FKYA 1CECA 3V0UA 4L61A 4IP5A 4JFUA 3B8UA 1BPLB 3I6RA 3KX6A 1J0HA 4AMAA 1GKRA 3OHIA 2Y61A 3GHRA 3U2ZA 3M5VA 5AVNA 4BKNA 3A12A 3IARA 5CEWA 1DJQA 3QOMA 3ISIX 4IQLA 2J8TA 1W37A 3M0VA 3O6AA 4MTVA 3ABQA 2GVGA 3T8LA 3U2EA 3H6OA 1RBOB 1ITXA 3GFXA 2E5DA 1V3IA 4WF7A 5CC6A 2ZXDA 2Z25A 2ZA1A 3CNYA 2WCGA 1GOXA 2VOTA 2BV9A 4AY1A 2J8FA 3A3HA 1FWIC 2WB5A 1XKJA 3WK3A 3BQ5A 4KCWA 1UP2A 1XDJA 3W7RA 4UTTC 3T07A 3LPPA 4W86A 1DIOA 4LBSA 3FS2A 3GXDA 2PDXA 4XB3A 1IT7A 1R0MA 4Z1DA 1DIDA 1TJ2A 2BTMA 4EK7A 1XFBA 4MAZA 1DBTA 1JZ5A 1F05A 2F2KA 1R7OA 1UWIA 4OV4A 1DP0A 5XIMA 3WDQA 1AD4A 1BEUA 2UY5A 5JUVA 1J0IA 4QRNA 3RIKA 2ON3A 3M41A 3MJMA 3KUMA 1Y5VA 4EXBA 2F9RA 3LLDA 4YTQA 4JIRA 1LQAA 1KXHA 2O7SA 1EGMA 3CUFA 1R3TA 4UTKA 1CZ1A 4S3CA 3WD0A 3QW4B 4ZOEA 1H63A 3QZAA 1IGWA 5CSRA 1OFOA 4WXYA 3N1AA 3LG3A 2CU0A 1XH2A 2A4AA 2NQLA 3CHCA 3W7JA 1W32A 4QG8A 4Y90A 1SVDA 3ARQA 2ISDA 1P1MA 4REQB 3EPNA 2R9RA 2RFGA 5DCBA 3CH0A 3WMSA 4BI6A 1E9YB 1S3HA 3QFEA 4O8RA 5ABEA 2XGIA 2VDGA 1RUSA 3UZJA 1KBKA 2CETA 5A8QA 1EC9A 3P5YA 1JZ4A 4HA3A 3IAPA 1S39A 2EQDA 4NRRA 4G56A 3B3DA 1BWKA 4AG0A 2QCMA 1IZKA 1OEPA 3S2MA 1BTCA 5FF3A 4HMEA 1UWTA 2FZBA 1PEZA 1EUAA 4LUJA 1XW8A 4L80A 1ICQA 2C18A 4X61A 3WQEA 4GYFA 2NXGA 2CXEA 3UETA 3N2CA 2J88A 3M6YA 4W87A 5HQLA 1TVPA 4K39A 3IJ9A 1TIMA 2IPGA 2FKPA 1A4LA 4MADA 1LDCA 3LCWA 1F2JA 4GJ1A 2G3IA 2X0SA 1O66A 3WF2A 3BOLA 2CBJA 5D04C 2ZX8A 3L0KA 3QLDA 3CV6A 3R58A 4ECLA 4DLFA 4HCHA 3VIPA 1Z42A 4X60A 1SJBA 3GG1A 4ADSA 2TYSA 1JD7A 3ATZA 1OZMA 2Y89A 1ZBCA 3UG8A 3IVSA 1JFHA 3BLOA 4HSNA 3CT7A 3UCQA 2NT0A 3VOCA 1BGGA 4O50A 5M17A 1OX5A 4MUPA 2F6KA 4JDYA 3DG7A 1DV7A 1GOWA 4L4LA 2EXOA 1EIXA 2H3BA 1JRBA 1J8VA 3H7VA 1OK4A 1ZCOA 4H4IA 1P6WA 3UXKA 4L9XA 5CSYA 1V6YA 3KBMA 4YTRA 4KFNA 2ZRUA 1CGXA 3ARUA 2XVNA 4DZIA 4KRTA 4Q22A 1UH2A 4B5TA 1WKYA 3U7VA 3NL2A 3F2BA 3G1VA 2FTPA 3PFRA 1XIGA 1MFUA 2RHGA 3NOEA 3VKJA 1UWRA 2BFGA 1PZ1A 2FIQA 1JYVA 5BXSA 1RP9A 5IHSA 3T78A 4LBUA 8CGTA 3O3RA 2C13A 3SSZA 2VFHA 1OCBA 3LV6A 3KRSA 2X30A 3AROA 4BS0A 7ODCA 1YRRA 3CL7A 4S3JA 2AKZA 3RR4A 3NZRA 4C5YA 4GYPA 1UW9A 1CB7B 3G1XA 3KFTA 4UMCA 2XN2A 4W9TA 2XSBA 5AFDA 3OZYA 1TPWA 1TWZA 3DX5A 2PP3A 1SW3A 1EBHA 4Z08A 1OIFA 4GBDA 1RVKA 3PUDA 1UHVA 1DEDA 3QOKA 2Z7KA 3W37A 3CYJA 1P43A 1XYAA 3BH4A 1TWDA 1GHSA 4FZIA 2CFFA 4K37A 3URNA 2O0TA 3WH6A 4MPQA 2WMIA 4QBXA 4GNJA 2VCCA 2DJLA 3K8MA 4CNNA 3CMGA 1FDZA 3TN6A 5BW6A 5DXXA 3WQWA 1D7KA 1ZPTA 2WHMA 2ZZ6A 3HPFA 5BRQA 4EACA 5I3GA 1MQQA 4C1NB 1A3XA 4FNTA 4UTMA 1WZAA 5HNNA 1P5BA 2TPSA 2QEZA 3LOTA 1PZ3A 1H1NA 3UR7A 3AYVA 3W53A 3N4EA 1AMKA 4AWUA 5D38A 1F5ZA 3MSYA 4L6DA 3DI1A 4UR9A 1MXSA 2FPYA 1KGXA 2Q8XA 2YLAA 4WY0B 1I1XA 3A4WA 2PD9A 1TREA 3MV01 4HPHA 3WLMA 3QQ0A 4GK8A 4R5EA 1QPNA 3CV2A 3QLLA 5G2WA 1TWWA 5IHRA 1NDZA 1ZJAA 3WUEA 2PB1A 4UNKA 5AHMA 3BCFA 3EDJA 3H70A 3EOEA 2VVNA 3NQ7A 2Y8VA 5AYXA 3WQDA 5E1QA 1VD6A 3LCHA 5CXPA 4YHGA 3LY0A 3NQMA 5F4WA 3VFCA 2F8QA 3EB4A 1JEZA 2DV0A 3CJPA 4Z2HA 1PHWA 3LS9A 5GJNA 1FWGC 1AUSL 3H7RA 2GK1B 4IGHA 1LQ0A 2PU1A 4GY0A 4AIEA 4UQEA 3VDGA 5T91A 4ZXLA 3VA8A 1WXZA 1SGJA 3HB9A 3BDKA 2F2HA 2DSUA 2JF6A 7XIMA 3T8QA 1M68A 1R3RA 2TMDA 4LVAA 4HYVA 4AEEA 5ABTA 2ZRVA 2NSOA 4HK6A 3C86A 2XJ7A 3STFA 4W8BA 3N6QA 4MKSA 5KZEA 4GCXA 4MWAE 3MMWA 3W3OA 4IX2A 5C9UA 2WKGA 1R8LA 1UWQA 4DXKA 1OQFA 1LLWA 4GI6A 2R8WA 2VEKA 3NUKA 4JCLA 3WUFA 1V6UA 3TK7A 4J3TA 2E6FA 2OGYA 3RNDA 4W7UA 4WQ6A 2NQHA 1XI3A 4GO8A 1E70M 3A24A 1W31A 1GYMA 3IRSA 3NZQA 1QWGA 3W2NA 4ERIA 1HFBA 3OJGA 2IQTA 2GDUA 3LPGA 3FKKA 3KOYA 3CMFA 5E09A 4TMBA 1KM5A 1ONRA 3ZMRA 2WVSA 2P5NA 4C6DA 2PLMA 5EFFA 3TVAA 5HPCA 3W87A 1P0EA 3L66A 5F1UA 3B97A 4TIMA 1ZBVA 4JKKA 3HJEA 3NM1A 2FHBA 3OU8A 1QW9A 3VD3A 3DBNA 3T0DA 1K6AA 3V0SA 5AHFA 1Q8JA 3TW6A 2WZEA 3E12A 5DEZA 3GDBA 3WFLA 4CQ9A 5EMMA 3CS2A 3S3GA 1NF0A 2O55A 3A5VA 2OKTA 5AZ0A 3GZ3A 3P5ZA 1VPQA 4ZL1A 3FIGA 3KZPA 3W2KA 1POKA 2PTXA 3TQVA 4KWVA 3PUGA 2PURA 2VUYA 4PCSA 1ENUA 1FCBA 5D4YA 3WN6A 1QNOA 2IPJA 2ZA2A 1PV8A 5K4ZA 3B0XA 2ABAA 4AWSA 4D72A 1E15A 3QF0A 4RLIA 4RZ4A 4MDPA 2I5QA 3RILA 2X1SA 3SEPA 4PFMA 3MV11 1NOFA 1VHNA 2A85A 4NKCA 4XBKA 1J5TA 4XISA 1TCMA 4AU0A 4AH7A 3TXZA 3GAYA 2D2OA 2RGLA 1XLCA 2PDGA 2NSXA 2D0GA 3S42A 1DORA 4H8UA 2AQVA 1MI3A 4YS1A 2DT3A 5AC6A 3CWHA 3E0FA 3MVTA 1C7SA 2DSKA 1EOMA 4Q4RA 1L2QA 2NW0A 2P76A 1HT6A 2BVYA 1IZJA 2YW3A 5A6TC 1BXBA 1W5OA 3VX0A 3CB8A 4JYEA 4QDWA 4ZSUA 3MDUA 4YMZA 1XBXA 1TV4A 1VC4A 4DPQA 2WCAA 2EHHA 2IXVA 1W91A 2FHCA 4M3PA 2VGFA 4FLRA 1YW1A 3LUTA 1CIUA 1OBAA 4QG6A 3KAOA 4GXPA 4DNHA 2V3GA 3C56A 3UCDA 1FWWA 2I9EA 1ZP4A 3QBUA 4MGGA 2HPMA 3SAZA 3TJ4A 5FEZA 2VUNA 3LNPA 3GBDA 3ZT7A 1EDTA 2Q8ZA 1K6WA 2NXIA 3FY1A 3RRXA 3UW6A 3UY8A 2V69A 3C2YA 4IM4A 5LXXA 4J40A 1JZ6A 1LP6A 3NYZA 4E0CA 3W7HA 1G6CA 4AZCB 3NDOA 3VM7A 4QJ4B 3LX9A 3CIVA 3WLLA 5FL0A 3GU2A 4ATLA 3SGUA 2PA6A 1KRBC 2WVVB 3H53A 1NFPA 2QJGA 2Z7GA 3HIJA 1UMYA 3K4WA 4IFKA 1XH0A 1G4EA 5E0KA 4LCQA 2WBGA 4RZBA 5LNWA 1RLCL 1G67A 5G4WA 1O5RA 1U1JA 3RUBL 4H7ZA 2GL5A 4HSOA 3XIMA 5CBBA 3H2FA 2PWEA 3P61A 3M6DA 2OEKA 3E38A 4FI4A 3UJSA 4GO9A 4UZUA 1EWDA 1DE6A 5A2CA 5JIWA 3DESA 1QI5A 4ZFMA 2CW6A 4Q8WA 4A29A 2VFFA 2YJQA 3W7GA 3UG3A 3R13A 3E02A 1HL9A 4U2YA 3IJIA 2A0NA 2CLIA 3C4UA 1ADDA 1B9BA 1JF6A 3TZNA 3ABZA 4FHAA 3QPYA 1I2OA 4JHZA 5JU6A 2WNWA 4ADUA 3SRHA 2NLYA 1OFAA 2DZTA 1GGOA 3MKCA 3UYCA 2IKIA 2Q09A 3W4RA 2UY4A 5ENLA 2OQHA 3WNMA 4BR1A 1UMLA 3AMGA 4CQBA 3B4UA 1JZ2A 2PBGA 2QCEA 4YYFA 3HGJA 3FJ6A 3HG3A 2V3EA 1EX1A 2NQ5A 4F9DA 3PWIA 3MMUA 1NQ6A 1JFXA 1N82A 1VFFA 2XM2A 3GXTA 3W76A 3O9NA 5T8GA 4WEVX 3SFKA 5BXTA 2QJNA 3N04A 2YA1A 3V3WA 4IXXA 1P48A 3QZEA 3G6MA 5I24A 1WBHA 3HPSA 3NQVA 7TAAA 2C0AA 4DWSC 3CLWA 5D9OA 4Y2WA 3IJQA 2BODX 3TW7A 4DJEA 4GD0A 2WM0A 1T41A 4D6EA 3CC1A 2A6NA 3BAKA 3EX3A 4FK9A 1WNOA 1E6RA 1SO6A 1JR1A 4U28A 3TONA 1SMDA 3V5OA 1XICA 3CV7A 3KWXA 4OJYA 1KM6A 3H2OA 4HZ8A 3HGOA 2LLEA 4PUNA 3VUPA 3ZLFA 1YLVA 2PDWA 3S0CA 4UNIA 4JIHA 2YCIX 3GIYA 1MVYA 4G7EB 3C52A 3IGXA 5D32A 1NAL1 1LCOA 4EP8C 1R3QA 4GXWA 2VHLA 3AS0A 1RQBA 3MZNA 4QAIA 1IR1A 4NZ1A 1JQVA 4Y9MA 1QOXA 3CZJA 4O13A 3TTYA 3GG7A 4US5D 3B40A 4PMYA 3TKFA 2DW6A 2A7NA 5U7SA 3GE7A 1LBMA 3MY9A 4Q7BA 1ISWA 3RF9A 3R89A 4CQ8A 4FO4A 4M5PA 3ONCA 1KO0A 3QMRA 2BHYA 5E9XA 3L4XA 1GT8A 4O0ZA 4XAZA 1JUEA 1IHIA 3WH7A 1Q6FA 1NEYA 3MI6A 1ADOA 2QJJA 1NIUA 1RLDA 2F6XA 1HZYA 3KDNA 3TOYA 1LOQA 5CJ5A 5I06A 9XIAA 3H22A 1QK0A 5D8WA 2A3EA 3RLHA 3FFSA 4YVXA 1V79A 3ALFA 3IIZA 3WQ8A 4DQWA 2R1NA 2PDFA 3CWOX 3KP1A 4QHRA 3RMEA 4GACA 3C2EA 1SR9A 1J9YA 1BRLA 1RY0A 3OYZA 3UJ2A 2DH2A 1WKDA 1PB0A 3T4CA 3ZM8A 2Y1HA 4XTIA 4M6PA 1RJQA 8TIMA 3SECA 4PTMA 4CNTA 1K7EA 3BGAA 2HJPA 4RL3A 1V5XA 1TPDA 4AVNA 3IIOA 2ZTKA 2INFA 1A80A 3P62A 2RJGA 1RQEA 3WLQA 3VKCA 4H8HA 5LNUA 5HQMA 4WLCA 4JPGA 1MSSA 3I6TA 3EGJA 5KMYA 1UOKA 2WANA 3VE7A 4LFYA 1AJ2A 1G4SA 1R86A 2X7VA 3NZPA 4DELA 1W1B1 2DH3A 3SQMA 3PN8A 5E5CA 4JIIX 4G1NA 4LJ3A 3ERPA 1TX2A 7REQB 1NSJA 4G5DA 2O92A 4XZNX 3M0IA 2C16A 3NEHA 3STCA 3PAOA 3UPBA 1MUWA 5E0CA 3KBVA 1TV2A 1D9EA 1W3JA 2WYSA 3BW2A 4PYSA 4NZ3A 1YX1A 4FXJA 3CBWA 4OOUA 2HVOA 4NAEA 3MDWA 2QPXA 1VBRA 3N17A 1QOQA 2OO0A 5DANA 2XUCA 3DHFA 3ZFHA 2W27A 3IK2A 1C7TA 4UTTA 4CD5A 3K46A 3LHVA 3EOUA 1M1BA 1IEVA 2CITA 3CTTA 3RCYA 3KL0A 5CCZA 9XIMA 1ZBKA 1HO1A 4L6OA 4MNLA 2BY0A 3W83A 1Z44A 3VMPA 2PEVA 3GR4A 3LBOA 4JD4A 2XDFA 4JTHA 4MB4A 4K1WA 1CDGA 2AL2A 1TO3A 5BU6A 1T8XA 3IUHA 4LW7A 1B0IA 3MS8A 5AVHA 1XCWA 4ZO6A 3EEZA 2D73A 5C9XA 1AJZA 4GFIA 2FVKA 2OZTA 3NDYA 1TQXA 4M51A 1POJA 3E2QA 1O5QA 1RR2A 3A3WA 3I7QA 3N2BA 4W88A 3B0VC 3GS6A 1UIOA 4Q4KA 1FCQA 6REQA 1GQKA 3QJAA 3ANYA 3SY8A 3DKJA 4H2HA 3SY1A 3VIKA 2XSXA 4AUBA 2AKMA 3BWWA 3BG9A 2HWGA 4R27A 3ARPA 3ARYA 4DY1A 1Q6DA 4MVAA 1OINA 3GNOA 2I57A 2DZWA 3ORWA 2J25A 3CPGA 3QZ6A 2YLLA 1ZUAX 1E6XM 4R9OA 4WX2A 3Q2DA 4M6UA 2UY3A 1A5AA 2CBVA 2PDBA 1VFTA 2WXDM 2DQXA 1HGWA 4JTJA 4Q4PA 1PE1A 3GH4A 1IWPA 2Y2WA 5IFPA 2P50A 2YL8A 1EXBA 1RXOB 3GB6A 1JYXA 4ERAA 5CGQA 1UA3A 2C1IA 3S8HA 1UROA 4I9MA 4IPPA 3GNPA 3L4ZA 2ZFAA 1CGUA 3KW3A 1BXCA 4R88A 1E9LA 5CBJA 4B90A 5LIYX 1F8MA 1X1ZA 1J12A 1DE5A 4WY0F 1AODA 4LVGA 4BY3A 3HM7A 1AG1O 3CT2A 5AHNA