3CMFA

Crystal structure of human liver 5beta-reductase (akr1d1) in complex with nadp and cortisone. resolution 1.90 a.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3cmfA00
2CLPA 3COTA 4R9OA 3V35A 3Q67A 4JIIX 3WBXA 1IHIA 3U2CA 3CMFA 3WCZA 3GHSA 4I5XA 1C9WA 3R6IA 4IGSA 1Z89A 4XZNX 4PUUA 3EAUA 5HNUA 1Z3NA 3N2TA 2IQDA 5LIYX 4DBUA 1AH0A 4XZHA 1EKOA 1LQAA 1VBJA 4QBXA 4XK2A 2A79A 2DV0A 2PDMA 3GHRA 2PDXA 3LN3A 2P5NA 1EXBA 2PDQA 1EL3A 3R94A 4LB4A 3P2VA 4JQ1A 2BGSA 1PWMA 3LNMA 2HEJA 3UWEA 4FAMA 4YVPA 1MI3A 2VDGA 4OTKA 2FGBA 2FVLA 2QXWA 4YVVA 1T40A 1OG6A 4MHBA 2ACUA 4LAZA 3BURA 4YU1A 5KETA 1FRBA 1PZ0A 1S2AA 2FZBA 2HVNA 2IKIA 4WDTA 3N6QA 2PFHA 4JQ2A 5JH2A 1XGDA 5HA7A 1YNQA 1A80A 3V0UA 4Q3MA 2ACSA 1HW6A 4PRRA 4ZFCA 2PDWA 2PDHA 2F38A 4JTQA 4DBWA 1SM9A 2NVCA 3G1RA 4NKCA 3ERPA 3WBYA 2PDPA 3UZWA 1YNPA 1S1RA 3G5EA 2I16A 3R58A 5JH1A 4GA8A 3C3UA 3GHTA 2IQ0A 3FX4A 4LB3A 5HNTA 4LBRA 3VXGA 4FZIA 1X97A 3M64A 1XF0A 2HDJA 2PEVA 1LWIA 3ONCA 3FJNA 3UGRA 2HVOA 1HQTA 1AH4A 4YS1A 2WZTA 3Q65A 2R24A 1ZGDA 5AZ0A 4JTAA 3R8GA 4XZMX 3GUGA 1US0A 3MC5A 1K8CA 3F7JA 3WG6A 4H7CA 5AZ1A 2J8TA 2PZNA 2FZ8A 2PF8A 3H7UA 3CAVA 3DN5A 4PMJA 4QXIA 4PUWA 1MZRA 3V0TA 3H7RA 4GCAA 2PDLA 2HE5A 4JQ3A 5C7HA 1AZ2A 2PDBA 2FZ9A 1M9HA 2IKJA 1Q13A 3D3FA 3V36A 3R8HA 3UP8A 2IKGA 2NVDA 4JIRA 1S1PA 2IKHA 3BCJA 3O3RA 5M2FX 4WDXA 3CASA 4GABA 4F40A 3LUTA 4PRTA 3M0IA 3CV7A 1J96A 3T42A 4XZIA 2DUZA 3EB4A 3LQGA 4LBSA 3LZ5A 2ACQA 2PDJA 1EF3A 2IPWA 4EXBA 1PZ1A 2BP1A 4DBSA 3RX2A 2PDFA 1ZQ5A 2IPFA 4QR6A 4FALA 1ADSA 2HE8A 2FZDA 3KRBA 2R9RA 2DUXA 4XVEA 1Q5MA 5LIXX 3LZ3A 3R43A 4WDUA 2HV5A 1GVEA 3CAQA 4XVDA 2IS7A 1RALA 4FA3A 1PWLA 1QWKA 4GIEA 2PDIA 1Z9AA 3UZXA 1RY8A 4EXAA 3MB9A 1VP5A 4DZ5A 4GACA 4WGHA 3UYIA 4RPQA 2IPGA 1UR3M 1AZ1A 4WRHA 4WEVX 2I17A 1ZUAX 4XO7A 2AGTA 3LEPA 4IJCA 3RX4A 2WZMA 4QX4A 1Z8AA 4ASTA 5LIWX 2ALRA 3S3GA 1X96A 1JEZA 2PD9A 3R7MA 4YVXA 3O0KA 4JIHA 3ONBA 4G5DA 3M4HA 3B3DA 1X98A 4L1XA 4JTDA 4GQGA 4XAPA 4WDWA 4HMNA 4JTCA 1ZSXA 1YE4A 1AH3A 3NTYA 1MRQA 1R38A 3V0SA 4LAUA 4HBKA 3QKZA 2INEA 2PDGA 1PYFA 4XZLX 4L1WA 2PD5A 2ACRA 2PDCA 2PDKA 1QRQA 5DANA 4JQAA 4JTRA 3LENA 1XJBA 4PR4A 5LIUX 4JQ4A 3DOPA 3RX3A 4AUBA 3CV6A 1AFSA 4IJRA 3BV7A 2ISFA 4GQ0A 1RY0A 2IPJA 5LIKX 2F2KA 2BGQA 4ICCX 3UZZA 2C91A 3EB3A 4Q7BA 3GHUA 3WBWA 1T41A 2PDUA 1IEIA 2INZA 3UG8A 3LQLA 4XO6A 3UFYA 3H4GA 2PDYA 1S2CA 2PDNA 1YE6A 3BUVA 4H8NA 3LBOA 3LD5A 3UZYA
chains in the Genus database with same CATH superfamily
4IPNB 5AY7A 2WSPA 4JIIX 2ZZ1A 3WBXA 1TVNA 1QI5A 3PANA 3V5FA 4F48A 3L5AA 3L67A 4RV3A 1H0GA 4A4AA 1YW1A 4I5XA 4JHZA 4DXXA 2D22A 3WMSA 1NP2A 1SVDA 1MXSA 1XSJA 2QYGA 3TIMA 2VFIA 5I07A 1AJ0A 1QK0A 4O0ZA 3L5LA 1UQYA 1I2NA 2AAMA 4ATWA 2PLCA 3PFRA 2WKGA 1WZAA 2CLIA 3NUKA 5E09A 1LLZA 2NLIA 3CL6A 4QE1A 4QS6A 4IQDA 4IG2A 1GVSA 1UOZA 2PGEA 3M46A 2PDQA 1XYMA 3RDKA 2BGSA 3THQA 2BODX 5C5YA 2WLYA 4J3SA 4RZBA 3WQ4A 1K9DA 1EC7A 4Z1BA 1R9ZA 2G41A 1PUDA 5H6HA 1CLKA 1LBLA 5GJPA 1TR1A 4HK5A 3FEMA 3URAA 4LAZA 4KS0A 4AVNA 2YCEA 2J7DA 2GZXA 4RE2A 2XIJA 4LUYA 3DH7A 3VOFA 4XD4A 1H5VA 1XIDA 2PTZA 3WJYA 5I23A 4Z1CA 2PUZA 5IFTA 5LKYA 4ECLA 4JQ2A 1NH6A 1XGDA 1VYRA 3WMBA 4ES4A 3V0UA 4UNKA 4Q3MA 3ITOA 1S2VA 1RHCA 1SFSA 1LORA 3F5LA 3CL7A 4K2SA 2ICSA 4H2HA 4GGBA 3WBEA 3G1XA 4PTXA 2V82A 4HNLA 2A7RA 1R0MA 1EGMA 3K4DA 3SQMA 2QDHA 4O11A 2X1UA 2AL2A 4Q33A 5A6TC 4GZIA 4J3WA 1FY6A 4Q8PA 4NXKA 4UQAA 4E2BA 5BMXA 1DJZA 3IGHX 5FJRA 3G5EA 2NVAA 1XIIA 2VTFA 2YA0A 3P67A 1W56A 1V6WA 3C3UA 4LB3A 3GDKA 5HNTA 3LX9A 2Y8UA 3ARUA 1SR9A 4AIBA 4DY1A 1EJRC 4FOKA 1A5OC 1CGXA 1EX5A 3FW6A 3DDMA 3WMLA 3VO0A 4CCDA 4AQLA 1CBGA 2QGYA 4YWSA 1N8FA 3VDHA 4YS1A 7TIMA 3BQ6A 1IZCA 5AZ0A 4EP8C 4LV4A 1N8WA 4IIFA 1S2UA 3CM4A 3RCYA 4NAEB 4C6QA 3WG6A 1IEVA 4LS2A 2FZ8A 1OJXA 2QW5A 3H7UA 3RR4A 4KERA 3PY2A 3CK5A 2FJUB 3K4AA 4ATDA 3IIPA 3G1FA 2CWXA 4GO9A 4KEZA 4IGNA 1FP9A 4HPXA 3W1NA 1JRCA 3TYZA 1E5NA 1EDTA 2D2GA 1TRIA 3BLLA 3M0IA 3TA6A 1NY1A 1XPYA 1TO3A 3N2XA 1F3XA 3R8RA 4QROA 1XYFA 4NZ4A 3ALGA 4NI8A 3H2NA 3UR7A 3M44A 1DQWA 1K8ZA 1PZ1A 1XLDA 3W7EA 2ZUWA 1H50A 1BXCA 4EAYA 1KTNA 1O94A 4L9ZA 2VEKA 1QOXA 1JVNA 1G4PA 1Q5MA 3MJYA 3SBFA 1PDZA 1EXPA 1XW8A 1R7OA 1W3IA 4WDUA 2F84A 5H8PA 3EDFA 1JDFA 1JI1A 1K7EA 4YYCA 2Z26A 3AXHA 2GQ9A 2HMCA 4AMAA 1J0YA 3FXYA 4R7OA 1V0MA 3WNKA 3U7BA 1IZJA 4Q8WA 1O66A 2V5LA 1H7WA 1KA9F 2O7SA 1X1NA 4JFWA 1M68A 3TU9A 3CWNA 1DIDA 4EXAA 1QHZA 4Q6XA 1E3ZA 3W81A 1GYMA 2VEGA 1VBHA 2HCVA 1H63A 2BVDA 1V0NA 4XWUA 2O56A 3LPOA 4M24A 2XSBA 4D2JA 3K13A 3HFTA 3NZPA 1XLGA 3AIBA 4GG9A 4GIRA 3UR2A 2YDAA 3NCOA 5I02A 3O6DA 1KLYA 2Y2WA 2DZXA 4YCPA 1K4GA 2AGTA 2FVKA 2DZSA 5MF5A 5FF3A 3EX6A 4ZOCA 3IJLA 2RDWA 1GPFA 2V9DA 3EA1A 1NDZA 3NL3A 1U5JA 4HIBA 1FCVA 5F4SA 4H9MA 1KQZA 5DBTA 1ONEA 3UWQA 3M0YA 1DWJM 1E6PA 1DORA 1J01A 5FACA 4JIHA 2GVLA 2ZUUA 1SZRA 3VTRA 1GVIA 5FEZA 1JFXA 4D6IA 1GQIA 3W7HA 3VK5A 1BYDA 1BYBA 3QMSA 4JTCA 4WK9A 2ISVA 4U3CA 2GSJA 5DRIA 3GVGA 1ONXA 2GVJA 3PBMA 2XVGA 1UZHA 2OGJA 1YPIA 3H2MA 1C92A 1XLBA 1MW1A 1KXQA 2A3HA 2GJRA 2Z1XA 2G3FA 1V79A 1WNOA 1HIZA 3BV4A 4JTRA 4WLCA 3AALA 5ABGA 4AZ5A 4I7WA 4JBRA 1U33A 1WXZA 4Z42C 1PEZA 1FH8A 5E0CA 1K7XA 4WUIA 1WQ5A 2F2KA 2OTDA 3PJUA 4JNZA 4PMNA 4US5D 3ES8A 2BMBA 1DOSA 2PDUA 3NURA 3SM0A 2X1SA 5CJMA 4Z2KA 3ZLGA 1K1DA 1JPIA 3AMDA 1O1ZA 2PDYA 1OD0A 3HTWA 5DN1A 1QW9A 4H41A 2IW0A 5AHIA 3OGSA 3FY1A 4P2VA 1BLIA 3UCDA 2V8ZA 2DVXA 2J88A 4GE8A 3L12A 2WJDA 1R3RA 3E0IA 2CCRA 3QZAA 3O06A 1BXNA 4GXMA 4K8GA 1QAPA 4GY7A 2ZOXA 1DQUA 4JIEA 3NAVA 4N02A 5F4WA 1R3SA 1EOMA 5F1UA 2HPMA 1LLOA 3A4JA 4FIRA 5LIYX 4IWWA 2W27A 3FYPA 3QTGA 1CTNA 3G24A 3HPXA 1TJ1A 3THDA 3KS6A 2AL2B 5DX7A 4PUEA 2YPIA 4U5IA 1KM0A 2EAWA 3GE7A 4ZB5A 3VAVA 3T8QA 1DEDA 3KRUA 1W5PA 1R3QA 4MY9A 4DUVA 3S9YA 2YCIX 4KCUA 4UFMA 3FDGA 1TCDA 2B7QA 1F5ZA 2UWFA 4NI3A 4JQ1A 5CPNA 1WZMA 1C7SA 4QJ1A 4YVPA 1EEPA 3SDOA 3N2OA 1OVDA 1A47A 2C1GA 1YADA 3E0FA 1REQA 4RPPA 2REQA 3PTDA 1I1WA 4ZB2A 4TX6A 3E49A 3D3AA 1KM2A 3DG7A 1XXXA 4OQVA 4UTTC 1TPWA 4NT0A 4PBEA 2P0IA 2WC7A 2PAJA 1O1HA 3P8JA 1P43A 2E9MA 1D3GA 3EOSA 2Z1SA 3E2VA 2XM1A 1SW0A 3MU7A 5F4XA 1Q7QA 2J8GA 4WOZA 2V5CA 3AIEA 4RDWA 2D2HA 5T91A 3ERPA 3TJLA 4NQ1A 3GXTA 3BJTA 3P7YA 3A3HA 1U2YA 1XLAA 1V3HA 4B3KA 4ZXLA 4J2PA 2E0PA 3C2YA 4XQ6A 1MFVA 3K1GA 1EF2A 3ARXA 2OOGA 1WAUA 5CLTA 3A22A 1ZFJA 2PTXA 4IJBA 1AMKA 1NQKA 2G3IA 1PX3A 4J40A 3W01A 3MA8A 1Q2RA 4D71A 3VE7A 3G1HA 3TSDA 1WOAA 4W8BA 3OZMA 2F6KA 3LGEA 3U3HA 4FLOA 4CCEA 3HIJA 2GDQA 4QNWA 4MFDA 4JY8A 4OIFA 3W28A 2C71A 2PZNA 4HSOA 1VRDA 4I6VA 1FWEC 1RV8A 1FOBA 4DQWA 1TPC1 1Z44A 1ZALA 3I7SA 3IEBA 3W82A 3QH2A 5CH9A 4JYEA 4U2YA 4Y8FA 4MLRA 3LERA 1XQLA 2DSVA 4HPNA 3LLXA 1KBJA 3H22A 2C8NA 1KM6A 4ZVJA 4MY1A 1PKNA 3EB4A 3P82A 4K3ZA 1CGUA 3MS8A 3N11A 2IPWA 4PMOA 3GIYA 2BP1A 2W91A 3CB3A 4UFKA 4CNSA 4D1JA 5AYIA 3T9PA 5FJPA 2DZBA 2CHOA 3BGGA 4CEUC 5CKSA 4MWAA 2A1YA 4FNRA 2GGJA 4MVAA 4PULA 1G9HA 3O6CA 2X1TA 3CMJA 1E73M 1GVEA 4C65A 3A47A 4IF2A 4IIDA 1KFKA 3M9YA 3DHPA 3LTPA 4R88A 1RALA 4CU8A 3U2ZA 3H4XA 1K6AA 3OPSA 4J4KA 3GFYA 4UMAA 3AHZA 4UB9A 4YTQA 3LCLA 4H9XA 5BXTA 3AROA 4MG4A 3S2MA 3WH5A 1BF6A 4XISA 1E4IA 1TZZA 2WCSA 1LT7A 1ZENA 4X63A 4LX4A 4BKNA 3VDCA 1T8QA 2AKMA 1ZUAX 2E5DA 2GVEA 3E2QA 1HJXA 2ZFAA 1JZ2A 1WPCA 2IUZA 5CSYA 4QX4A 4MSSA 4XKMA 4A22A 1P7TA 4S39A 9CGTA 3IUHA 1AD1A 1WZKA 5FSEC 3WDHA 2WVVA 3IPWA 1W5OA 5FAJA 4CD7A 3B3DA 3O15A 1O4UA 4UFJA 3T2PA 5M5DA 3N4AA 4U3AA 4ZOEA 2A85A 1LG1A 3U5UA 1KKOA 3P6LA 3VNJA 4HMNA 2C1HA 1UD4A 2NT1A 1OY0A 2ZA2A 4LC8A 4ROPA 4UZUA 2IXUA 1IF2A 4JN8A 2P53A 5FEWA 2YCLB 1MDRA 2B7NA 5I3IA 4Z2JA 3GU9A 2J66A 2VELA 3BL3A 4D6HA 3QXBA 3UR8A 2GYIA 3TP4A 3N3TA 1IR1A 4JEQA 3MSRA 4JQ4A 2QJJA 1IT7A 4WKHA 3TCEA 5AC7A 1NFPA 2PCEA 2GPTA 1MQQA 1GZGA 3V1PA 2C91A 4K8HA 3FGCA 1F9CA 5U4NA 2XFWA 2FZMA 3T0TA 1KFJA 4DJDD 3CNYA 1A5UA 1IWPA 2Y1HA 4L61A 3EOLA 4AD2A 3STPA 1VD6A 1TWSA 2HPIA 3UJRA 1J0IA 1A5KC 3ZLFA 1U83A 1M1BA 1WX0A 2Z6IA 3SSZA 5CAHA 1H7XA 4DXVA 1UKPA 2X30A 1CXEA 3DERA 4ALDA 4H8NA 3LBOA 2OSXA 1V8EA 2RDXA 1AJ2A 4AX7A 3CHVA 5D38A 3I68A 3CAKA 2VEPA 5EFDA 2PP0A 4F3HA 3DGRA 1V51A 4JTKA 1EDGA 3STFA 2PLMA 3RCNA 2EO7A 3FKRA 4B5NA 1FCBA 3L4WA 4UTTA 1Z3NA 2HQAA 3KVJA 4OZOA 3DFPA 1CNVA 1ME7A 3SFKA 2ZUTA 3WUEA 1A0EA 3L66A 1XH2A 1HUVA 1EJUC 1SUXA 3TZNA 3W7DA 2WZEA 4R34A 4ZENA 2DV0A 2WJEA 3DIPA 2GOKA 1KGWA 4AZBA 3V5OA 4IFRA 4RV8A 1GJUA 4LWWA 1E70M 3AMLA 2NQJA 2VC5A 3LNMA 4K1WA 1MI3A 1FWRA 4IX0A 2VC9A 2FGBA 4L64A 1FWBC 1RD5A 4DO5A 1PO9A 2QCLA 5HPOA 3OA3A 3HU7A 1YPXA 1X1OA 1UR9A 4XBSA 1CX9A 1ZJHA 3KVMA 4W85A 2BY2A 4GXPA 1RP9A 4IPIA 1KNWA 3VUSA 4JYDA 3ENLA 2R1MA 1JYXA 1T7LA 2YFNA 1ECQA 1SSGA 2J7CA 4Z2GA 2PFHA 1NP0A 4URIA 3V5CA 3RO6A 3RU8X 4BQ3A 4HU8A 2Z28A 3WK2A 5A6BA 4K7YA 4Q4QA 4MADA 4HNCA 2QCGA 5T26A 3NOYA 3HGRA 1D3CA 2Z25A 2GGGA 3VFCA 1ISYA 4Y6GA 4GNVA 2W0UA 3C56A 4A35A 5G5IA 3W7PA 3AS1A 3POCA 3FHQA 4H3DA 4W4QA 2XGIA 4MKNA 2VC7A 1UIPA 4DBEA 4GQBA 2QJHA 4JTLA 1VBUA 3BSMA 6ENLA 1GHRA 1YNPA 3VOGA 1J0KA 4FXFA 3G8EA 2ZADA 3VCNA 3UWYA 2RKXA 4U31A 3HG4A 1UMYA 3BLFA 1ADOA 3AYRA 1A3XA 5A95A 7ODCA 1ZCCA 1KLZA 4ORIA 5KZ6A 1WKEA 3H55A 2FMNA 6TAAA 2WNQA 3M6YA 3P84A 1SZEA 4MWAB 3WQDA 1XH0A 2I1OA 3MV01 3GIQA 1KBIA 3ARWA 2J8FA 1IZKA 2OYMA 3UF9A 3K30A 2HBVA 4X2PA 2BHYA 3W71A 1E55A 3AOFA 3IIVA 1K03A 3MC5A 4OE7A 3THUA 3PZTA 4WGXA 3DXIA 1NTHA 3PPGA 3SURA 3B4YA 5E0FA 4GVFA 3EDDA 3SEPA 2WQDA 2WMFA 1B30A 3MYOA 1L2QA 1PSCA 1FCUA 1TA3A 3BO9A 5HINA 4HTBA 2EJ1A 1XR2A 1M9HA 2IKJA 3YPIA 2OCZA 4FO4A 4G7EB 4UQ9A 4AZIA 4A8IA 4R3UA 4JTEA 2Z0IA 2VFGA 4H8HA 3C0SA 1EX1A 1WUEA 1BWKA 4AMCA 3SCQA 2DUZA 2WPGA 2WHLA 3OOQA 2OYKA 4YHGA 4FX8A 3WQ5A 3SAZA 2WVVB 1R46A 2BOFX 2PSNA 3VM7A 1P6BA 2R1KA 3W7JA 3FSUA 1IE7C 4TVCA 1MW0A 3QKEA 3LBCA 4JFTA 4W8LA 1WXYA 4R27A 3MUCA 1DIEA 3QSRA 1I0DA 3OBEA 4AEEA 4F66A 3GZ3A 4J1OA 1PIIA 5REQB 4B16A 4AZ7A 5HMSA 1EBHA 3WF3A 5I24A 1GK8A 2EG7A 2JALA 3GDTA 1FDYA 2PI6A 4N4QA 4FNSA 3GVRA 3OP2A 1GOIA 1A5MC 4ICMA 5DBUA 4DF1A 3CIVA 3PPFA 2PDIA 2HISA 4AWUA 3M5VA 1SYTA 3MKKA 1VGAA 3LY0A 2I9EA 1EZ2A 4LANA 4DI8A 1IXOA 2VMFA 4WGHA 3F03K 1UC5A 2A21A 1XLHA 1YHTA 2O4QA 2JBMA 4GCXA 4QS5A 1W8GA 4KGLA 3HPSA 3FK4A 4NRRA 3UNTA 5BU9A 2ALDA 2CPUA 4UTWC 3OBAA 4WEVX 3T1GA 1ISZA 2P8CA 1WDSA 2ZICA 2VD8A 1J2WA 3UYCA 4GKTA 1HKIA 4IJCA 2WZMA 1JZ5A 3CUHA 3P0XA 1VFSA 4DYEA 1XG3A 4BJHA 1YDYA 1PVNA 1Z8AA 2W62A 4MUZA 4FB7A 3VGEA 5CZSA 2PD9A 3NWRA 3LYEA 4FNPA 1A5BA 3H2AA 4NILA 3B4UA 2WANA 3KWSA 1E9IA 1EA0A 4GYPC 1KB3A 3VU2A 3TTYA 2R8WA 5DLCA 5I78A 2ISDA 1H60A 2WNWA 4ERAA 3GTNA 3VNKA 2HS8A 2VD9A 1OINA 1RR2A 2INEA 5KEZA 1Q4NX 2PDGA 4LYKA 4XZLX 4L1WA 3VNYA 4LEQA 1Q6RA 2ACRA 2PDCA 3TWAA 4JQAA 4RXGA 2PS2A 4NZJA 5D9NA 1ZBCA 1HJQA 2V5KA 4XV0A 1XLFA 2Y5SA 3DYPA 5D05A 1JF5A 3OJGA 1UD6A 1W1PA 6REQB 3RPDA 2RGLA 2IPJA 4I9TA 3GYEA 4HU4A 2BGQA 1F7BA 3W1TA 3UZZA 4F0LA 3GXPA 2ZXDA 3M5YA 4YCOA 4QGCA 4XZ9A 4PEKA 1J12A 4GUFA 1IR2A 4XTIA 3NPXA 1UW9A 1ZBVA 4P7QA 1IXPA 5AFDA 5KSWA 4C60A 4YHEA 4GY0A 3UZYA 1GG1A 1AQFA 3NQEA 3UPMA 1F6PA 1XUUA 4HJFA 1JULA 5LXXA 3MSDA 2FH8A 4GUGA 3VKDA 3F4WA 3CMFA 1R6WA 4OUIA 4Y9NA 2PMQA 1BRLA 3EWWA 4DZIA 3ABOA 3F4NA 5FF4A 3B8UA 4JYFA 3QMRA 1C8VA 4LALA 3PVFA 3A24A 4XAZA 2DSKA 2EPKX 1GJWA 5FAGA 4NYUA 4WSKA 1VJSA 4DAFA 3U4AA 3TOYA 2OT0A 4NG3A 1LOSA 2A2IA 5TAOA 2J7FA 4JTFA 1HJSA 3H8AA 1IEQA 3AWOA 2DSUA 1W9XA 1A5NC 5AC8A 2E7FA 5BYWA 2OQHA 1B57A 3DFTA 3FSTA 2A3AA 1ZCOA 2CWNA 2G3MA 2QDDA 1T99A 5GNXA 3K2GA 3EGJA 4IIGA 4YU1A 4J2MA 3WKZA 2YLAA 5KETA 5C54A 1FP8A 1TE1A 4CQ8A 4IOTA 1TMHA 1HJWA 4FI4A 4UTKA 4PB3A 4X9YA 1XLMA 3EMZA 1DKWA 2IKIA 1MW2A 4MJZA 3DHDA 4D6JA 1JD9A 3GXIA 4WXZA 3NJ3A 1NDYA 4F0RA 1Z42A 1L6SA 3H6OA 4NHVA 2EHHA 4IMGA 2ZZ2A 1N8IA 3TX9A 1YX1A 4HNUA 4GC3A 3SB0A 5I6SA 1QJWA 2QUNA 2G4JA 4GYFA 4MKVA 1XYLA 3RLUA 1EUNA 1UMLA 4N42A 2CLLA 3LPPA 3PFMA 1YBQB 3OVQA 2YDSA 5IHSA 2BHZA 4E38A 1A5AA 3GD6A 4B4FA 2G8ZA 5I00A 1IEXA 5CQ1A 3TYEA 3ANVA 1DE5A 5DXXA 1E0XA 2PF0A 3P74A 3PBVA 3RU6A 4KWSA 4C5YA 1E6SM 2YZ5A 4KWVA 3W7IA 3B8IA 3LHWA 3FJNA 4WOQA 2Y0FA 5LXEA 3GB6A 4ONVA 4JFSA 1ZL1A 2WMJA 3QZEA 4IPPA 3MCMA 4A3UA 4UFHA 3R8GA 1R86A 2ZKMX 4DJDC 1K8CA 3MANA 2GUBA 1JPMA 4QQUA 1W9BM 2F6UA 4NAFB 5HR6A 1ZAIA 3DN5A 4ZEPA 4DWSA 4PUWA 3B8TA 3VGFA 1F4AA 1NOFA 4GCAA 2C15A 5I09A 1XBXA 1UKTA 1RA0A 1FCQA 4RNFA 1GT8A 3NR0A 2YXOA 4QCEA 1W9UA 4NNAA 3NDOA 5I3JA 2YDRA 1BQCA 3BCJA 3CASA 3QZ6A 1BF2A 5LGZA 5EMLA 1J96A 3T42A 4AZCA 1T96A 2W67A 3VUPA 4QRNA 3HV9A 2X2GA 3GAYA 4D8AA 4UTWA 1YEYA 4AW7A 3T55A 1AUSL 2OEMA 2O0TA 3SCUA 3KBJA 2IPFA 1K4HA 1WE5A 1GG0A 1OF8A 1E1FA 4KT2A 4O19A 5AECA 4WJXA 4D6EA 1F74A 4O14A 2I57A 2C14A 3ARPA 1YTDA 1RVGA 1W3KA 4GPNA 4LUTB 5CAKA 4R7JA 1CLVA 3BXWA 3KL0A 4XUGA 1C93A 2YGYA 1IIGA 4LC6A 1GVQA 3BAYA 4KMQA 2O7QA 3VKCA 4GXWA 2J27A 1DWAM 1JYWA 1PL9A 3FJ6A 3LTYA 2UBPC 1PCKA 4LGXA 3QPEA 3O6YX 3LSCA 1Q2SA 1RUSA 3W7GA 3S2JA 1AZ1A 4X0NA 3U7VA 2PP3A 4TO8A 4ACZA 2YSWA 3WL1A 2QCMA 4IQLA 1DXFA 2E4TA 4GO8A 4S3CA 3N2CA 2YL5A 3OLDA 2X0HA 7TAAA 4A05A 2CLOA 4UFLA 4F9DA 3VA8A 1WV2A 2Q8XA 1UASA 1EQCA 1S5NA 1OM0A 3M4HA 1HL8A 4L1XA 3W70A 3S8HA 3W1UA 1DJQA 4WKFA 1CB7B 1NWTA 1ZBKA 3BG9A 4RE4A 4QLLA 3M0VA 3S9ZA 1S5VA 1B3YA 1OX4B 4GNKB 3N1AA 3IANA 2PDKA 3DKLA 2ZUSA 1LRNA 4K39A 1TJRA 1KBKA 3MMUA 3UG4A 2WC3A 1VIWA 2VUNA 1W9DM 1XIHA 3LG3A 1PIGA 4S1FA 5FJTA 1XYZA 1PIFA 2A7PA 2AQVA 1BYAA 5TIMA 1Q63A 3XISA 4B3LA 1QASA 2BFGA 4DBDA 1VFLA 3WUFA 5DCDA 4AXNA 1ZJIA 4EX4A 3AO0A 3UG8A 3LQLA 1W1VA 2WMIA 1SO4A 1VYPX 1ME8A 3V1HA 3A4XA 2QUUA 3W86A 4F0MA 2J13A 4P8VA 5H8UA 3H23A 2CLPA 1P4CA 4PCFA 1EJWC 5AVNA 1MXDA 1UR1A 2FDSA 3LRMA 3PBGA 2WHJA 3S83A 2O9TA 1R3WA 1L6GA 4E5TA 4ML9A 2QCDB 1GOWA 2WLZA 3BLEA 3URNA 5JBEA 4GOAA 2OSWA 3HO8A 1UD3A 3WFZA 1ICQA 2QS8A 3KBSA 2POZA 2WM1A 5DMYA 1VEOA 5BNKA 2RUSA 4YPJA 3CQHA 1UKSA 3FEQA 1NWRA 1AH0A 1LQAA 1XCWA 3GW3A 3TN6A 2ABAA 3LHYA 5G1TA 3S5SA 4ERGA 2DU2A 3FCPA 5BWFA 1EUAA 3R11A 1UWTA 3PAOA 1P1XA 5ABEA 1P1MA 4FX7A 1JI2A 2PB1A 1F3WA 1HXJA 4H6RA 1SGJA 5C9UA 1AW1A 5A2CA 2ABBA 1A0CA 3V16A 1Y8BA 1J9YA 1S2WA 2VZUA 4JIQA 1KFCA 1LQ2A 4CCCA 3BG3A 5D37A 2XH4A 3EMCA 3R1ZA 4JFUA 1MNSA 1ML1A 1OCQA 4G6CA 4HHLA 4H8UA 4ZXOA 5A8NA 3UY7A 3TTEA 3MZNA 3QOMA 3EOEA 4KQNA 1FXQA 1G69A 2VKZG 1K6WA 1S5MA 3S1GA 3ZR6A 5A8MA 4UTMA 3GC4A 1TWWA 2ACSA 2GGHA 2DVUA 2X09A 2GUUA 1QNSA 3ZSTA 3RR1A 2VZSA 3FYYA 4Q4PA 4JX5A 4TOQA 3G1RA 1RJQA 3I4EA 2OPJA 4FK9A 4TUFA 5CBIA 4M80A 2BXYA 1LROA 3UR5A 4QITA 4B4HA 1QNVA 3GM8A 1BGAA 1JCMP 4DZAA 1FWTA 3EWDA 1GVOA 5A5WA 1RVKA 1E0VA 1EZWA 2OWXA 2ZDSA 1ZY9A 2J9YA 1AMYA 2IQ0A 3FX4A 1NEYA 2H8XA 3OVGA 5I77A 3QRHA 2TRSA 2Y8VA 1X97A 3M64A 3BARA 4RCXA 4ZTYA 3NM3A 4Q8VA 2W3ZA 3ZQ9A 2X42A 1TG7A 3VKKA 5I7GA 3ME3A 4MJ2A 2PU1A 3EMQA 2I7GA 3P8IA 4DRSA 3IIOA 4JL2A 1M53A 2J8TA 3KRZA 3M47A 3S1WA 2PURA 2V30A 3GRIA 4FNTA 3PG9A 2KX9A 4AEOA 4XD6A 4AAJA 3BJFA 3CUJA 3VFLA 1OIFA 3E6EA 2FZ9A 3RJYA 2E09A 5A6LA 3B9DA 5F2LA 1A3WA 3LUTA 2OR2A 3URBA 3MBDA 2VGGA 1VPQA 3LMYA 3LV6A 4UR7A 4ADSA 1US2A 3L2MA 3LZ5A 3TNOA 1DIKA 1DQXA 2PDJA 3NO5A 3W6MA 5C6MA 5I3FA 2PODA 4FNUA 3NDZA 4QE5A 3OTRA 3ORWA 5BROA 4MOZA 5MKGB 4LUJA 3ZR4A 3VPLA 3UESA 2QT3A 4HPGA 5GJNA 3C8NA 3WJZA 1ICSA 2TYSA 4AWTA 4PE8A 1IIHA 5D2YA 4NZFA 1TSIA 1PV8A 1IWBA 5CGTA 1MEHA 1S5TA 4GWEA 4P61A 4F79A 2J78A 2PRMA 1RY8A 1FKWA 4NZCA 3XIMA 1VP5A 4JS3A 5I79A 2H3DA 3PJWA 3APTA 4IISA 3W72A 4X3ZA 2GGIA 4HYWA 4WY0B 2CEQA 2UY5A 3B04A 1V5XA 3P3BA 1OG0A 4IFOA 4RPQA 2V67A 4NU7A 3LCGA 4YIWA 2NXHA 1BSIA 1TE6A 4XB3A 1G1YA 2LLEA 4ZQOA 5D03A 4NZ3A 3UQNA 1XGEA 3RNDA 3N4EA 2H3BA 3K1DA 2QHAA 3M0XA 1QHPA 3W37A 3G6MA 1ITXA 1J4EA 4MZ8A 1LOLA 3K8MA 1PAMA 1JEZA 1FFRA 4FOUA 3TYCA 4IMCA 1NJJA 1N55A 2GWGA 2GFTA 1KM5A 3UWUA 3W1RA 3AQUA 1LZOA 3RHGA 4GQGA 4F9JA 4UTHA 1LT8A 2QMJA 2YJQA 2OU4A 3PTQA 2FHFA 1X1ZA 2I14A 4Q7NA 1LBFA 3C0LA 3VKBA 4F0HA 1QOQA 1JDEA 4H1ZA 4U4MA 3QGAC 2PE4A 4G1NA 1I0BA 3IJ6A 1OGGA 1SJCA 4ILSA 5JQ9A 4AUBA 2ZE3A 3WL0A 4AF0A 5CZKA 3UXAA 4GI6A 5CSUA 1HVQA 3SN1A 4UOQA 4CNOA 1Q7ZA 4LUSA 3N19B 3NNTA 3W7RA 1UQZA 3SY8A 3DCPA 1U5HA 4LV9A 1U22A 3W27A 3KOXA 2FZNA 5AC5A 3C0QA 1RCXB 3QC0A 3V3WA 1EWDA 3TQKA 3RFAA 3M7SA 4HZ8A 3WSUA 2R94A 1ITUA 1OX6A 3QM3A 5J5RA 1VBRA 1GPWA 1RAKA 5CC6A 3WLJA 1R85A 1PX4A 2XH2A 3PG8A 3TONA 2CZVA 3EYPA 4NL1A 1HO1A 2VEFA 1BG4A 3DFYA 2CHNA 3KBNA 3CAWA 2IQDA 1VJZA 3L65A 1KV8A 1VFUA 4IHCA 4AIEA 5D9OA 3MZ2A 4JX6A 1MQRA 1WKFA 1Z7AA 2I5GA 3BSGA 2A79A 4Y90A 1GOXA 1ZRQA 4GJIA 3W2KA 3DFQA 2NW0A 4N2YA 1A0DA 5EGRA 3R94A 2HNEA 3MJMA 3JR2A 1X8CA 1PWMA 4E8CA 4FAMA 1ESWA 3BMVA 3L21A 3LV5A 4OTKA 1Q45A 3TTSA 1W6TA 3GS6A 1POJA 5J04A 2V6AA 4LRTA 1W31A 3IGXA 5IHRA 3N04A 4BHYA 2Z2BA 5ABFA 3LOTA 4C6JA 1TZ7A 1S2AA 2F2HA 3C2RA 1E6XM 1W9VA 2VC6A 3QSTA 3U57A 5D2VA 2NQLA 4Q4SA 5A2BA 4R7WA 1OYCA 1SO3A 4BEUA 4C6CA 3HA1A 1B9BA 3OZPA 3UXDA 1YNQA 4PB4A 3W02A 1XCXA 4X0VA 1CGTA 4X22A 3TNBA 1SFLA 3S5OA 1HW6A 1PZ3A 4KF1A 3TSMA 5BXRA 2PDWA 4OBRA 1XV8A 3GDMA 4GVIA 1ZTVA 3CTTA 5FJUA 1TUFA 1VAHA 3SR7A 1C90A 1Y7VA 1EYWA 3E0WA 3WNMA 2QZRA 3W53A 3IARA 5AC4A 5CPMA 3WBYA 3CPRA 4QEEA 4NJIA 3KOZA 1E1CB 3AUOA 2ZC8A 2VWSA 5KITA 2W92A 4KWUA 1CIUA 4LCRA 3D46A 4EOUA 2DT3A 3BMXA 5HMFA 1QPNA 3RRXA 2YB1A 1UR0A 3QFEA 4GC4A 1SW3A 1V4YA 4C6FA 3VCRA 3WELA 4F2TA 1QPKA 1BVNP 2DZUA 1VFTA 4DLMA 2QPXA 4NYYA 1DP0A 3LU2A 1Q8AA 4JR5A 2AMXA 5D8WA 1C8QA 3MUAA 4BI5A 4H7CA 1BVWA 1V08A 3S4TA 1A49A 1RBOB 1WAWA 4XBJA 3FNDA 1X6LA 3MI3A 3H7RA 3MUZ1 1VFFA 1SMDA 3WUGA 1GONA 5D9MA 2X7VA 1PBGA 5GNYA 1JRBA 3VCCA 1C3FA 4JTSA 3RCMA 2ZXQA 1F61A 4CLMA 1S1PA 2CXGA 3W29A 1V03A 1YMYA 2A4AA 4PCNA 4AEFA 3B03A 3AJ7A 1GTEA 2EPHA 4A2SA 3HN3A 3Q37A 3CHCA 1PS9A 1EJVC 2IMRA 4NJKA 3GR4A 4IGMA 1T0OA 4FF5A 2AQWA 5FEPA 3PAJA 1ZQ5A 4Q6JA 4DO4A 5HWJA 1OEPA 1LL7A 2D2OA 3AZSA 2OLHA 3T78A 1HKMA 2OEJA 4LUIA 1U5VA 3LZ3A 7PTDA 3CEPA 4DWDA 3P80A 4AISA 2D69A 3NL6A 1WDRA 1YDOA 1SSDA 4IUOA 3S2NA 2E6FA 1RJPA 5CSSA 3MB9A 3QW3A 4S3BA 8CGTA 3KS5A 1E43A 1SFJA 4HKPA 4QTGA 5HPCA 4EXQA 1P0DA 2WBKA 4WRHA 4KWOA 1M3UA 1GTHA 4JCLA 4TIMA 4W8AA 1E6ZA 1UP2A 1TQJA 3KP0A 4JKLA 4A8RA 3VIJA 1ZLPA 4Z2HA 4G7FA 4CVUA 1X96A 5A6JA 4IQJA 2J7EA 4CN6A 3UA4A 3WEMA 3U0HA 2Y85A 2QNEA 4IPLA 3VKJA 4UQDA 4US6A 5GNZA 2A7NA 1HL2A 3AMGA 3UT0A 2VX5A 3UWZA 4L6DA 1XLKA 5FKYA 1QNOA 1TWDA 1YE4A 1WKYA 2BG5A 5AKQA 1MEIA 4PN2A 4QAIA 1WBJA 3W2LA 4K6AA 4LAUA 5DMMA 3SRKA 4CNNA 3KCLA 2UY3A 3UCCA 4YJ5A 5DT5A 4S3AA 5E6ZA 3I3BA 1K9TA 3N34A 3M41A 5DANA 3INPA 4YXGA 1TIMA 3P5YA 4NASA 2YX0A 3CHDA 3NZQA 3VD5A 4UTLA 1FWJC 4IJRA 3BG5A 1KO0A 4ZL1A 5PTDA 1SMAA 4ICCX 2YZRA 1XINA 3UXLA 4O1EA 2DUAA 5IM51 3RN6A 4W88A 3LGDA 3PZMA 2Y61A 2B81A 2XSAA 4B5VA 2F7FA 3BOLA 1A4MA 1QPOA 1K02A 1SZGA 4MB4A 1AK5A 3H4GA 4C7FA 2DQWA 3MKCA 1G4TA 2P8BA 3F4CA 4O28A 1OFRA 3TW9A 3S42A 1YKWA 3TFXA 5HATA 4NZ5A 4BZYA 4QE4A 3PSWA 2PWDA 3TQ0A 3I7RA 1XH1A 4XBKA 1OK4A 3WQGA 5AYXA 5CPSA 3C4UA 5AHNA 1UWIA 1NSJA 5RUBA 3EB2A 1F3EA 2BXVA 2Y62A 4DEFA 2GJXA 4FOJA 4H00A 4HYVA 4AWEA 3NXLA 2HWGA 1PKMA 4QEHA 3LN3A 1EPXA 3NQ6A 4YNGA 2VEIA 1WKDA 2XH7A 3F4DA 4K1GA 4OHQA 4L80A 3NDYA 2QVHA 4N9BA 1YXCA 4DVOA 2HEJA 2D0GA 1I75A 1OABA 3MKVA 1GORA 3RXZA 5FEXA 1JGIA 4MJ4A 5ENLA 8XIMA 2QGHA 4LOCA 2JEPA 5GQBA 4IFKB 3VIKA 1KFBA 4B15A 5D04C 3R2GA 1E6RA 2XPKA 4B9YA 3CYJA 3WY1A 1OGBA 2R82A 4LNCA 3BLDA 4RW5A 1GKQA 3I10A 4HGXA 4UTUA 1NOUA 2V5DA 4REQA 2EKGA 5I5RA 4N9EA 1HJVA 4ZCWA 3HM7A 3PZOA 3UJ2A 2AL1A 2DGAA 3JU2A 3WDPP 3QV6A 2YW4A 4CVWA 1DV7A 2XHYA 2A3BA 4C6MA 4H9ZA 2G3NA 2OOFA 3HOJA 4LYQA 1LUCA 2PDHA 4WF7A 3L23A 4DBWA 1S3TC 3NL2A 4PL1A 2Q8ZA 4XSMA 3I6RA 4GI8A 3TR2A 3RK8A 1E51A 1DHKA 2OZ3A 3AYVA 2JFEX 5A6SA 3UA3A 1SPQA 1T8XA 2RGMA 4FLSA 4ZB0A 3ITTA 5I3HA 1A5SA 1EIBA 4U28A 3KLKA 3G0UA 3H24A 4Y8EA 1P5BA 1GHSA 5DMNA 5CPQA 4MB5A 4M29A 4NJHA 3QR0A 2VCAA 2ESCA 1K7FA 3CQJA 3UGRA 3E38A 3FS2A 5EA9A 1UWRA 4HNNA 5FF7A 3Q65A 5T9BG 2PWHA 3GDLA 2XU2A 2VZTA 3ZVHA 3S6TA 3HQOA 5ECVA 1E0WA 4RK8A 3RLVA 2ASHA 4PMJA 2VM8A 1OFAA 1DTUA 1FH7A 3W38A 1PTAA 1OCBA 1MXGA 1TKKA 1W0MA 1ZB5A 5IDZA 3QYQA 3L4XA 2V5JA 1OADA 2OKTA 4JCMA 3VD9A 4BA0A 5AYZA 4JIRA 1UPPA 1JUKA 4QJ4B 1IGWA 1NFBA 4H9TA 3P61A 4F40A 5AOUA 1WOBA 1AG1O 4I7VA 4KETA 3K4WA 1JCYA 4QJ5B 1EBGA 4TMCA 5DT7A 1E4LA 4FXSA 3WK3A 2C7FA 4QHRA 2DT0A 1L0PA 1JFHA 4IP4A 3VE9A 4UTJA 1XLJA 4H4IA 4NVTA 1SJDA 4H9VA 1JJKA 4AHPA 1UBSA 3F1QA 4AY8A 1XKYA 3TYDA 4B5XA 1HN1A 3G1AA 2XGZA 3W7MA 1H4PA 5A94A 4I3GA 3TLLA 4FIQA 3W9ZA 3UGVA 3QLLA 3DX5A 1DHPA 2JEQA 2NWSA 4D72A 4PODA 3MO7A 1WDQA 1JG9A 2GK1A 1L6WA 3AI0A 4A8LA 4V15A 4S3KA 4OT7A 4HU0A 4DZ5A 4GACA 3U48A 3MMDA 4O0KA 3GFXA 4H83A 1VPXA 4QG9A 1KQYA 1XRTA 1MUWA 1TTIA 1XYCA 3WENA 1V3KA 4POCA 4XIMA 1XBVA 4GX9A 3AIRA 4GGHA 4HCLA 1E0UA 1XC4A 3IACA 3WH8A 4XD5A 1EP3A 3AYTA 3LEPA 1V02E 2V5BA 2ZRYA 5A6KA 4O1DA 3L4VA 2WSQA 1CCWB 4C6EA 2DIJA 1RPKA 2HVMA 1GOKA 2XG9A 3NL5A 3ONBA 3E5PA 1K9EA 3ARRA 4XKYA 1UZ1A 1Q65A 1X98A 2MANA 2W63A 1BTMA 5M1TA 3TC6A 4LY4A 3U8GA 3GNXA 1JF6A 3A9IA 3WH6A 4GZJA 4IZGA 3MV11 4N0RA 2G96A 2QR6A 2XN0A 3AS0A 4A21A 1ZSXA 3W87A 4W9TA 3WJSA 4UNIA 5DF0A 1F6YA 2P3EA 3SFWA 2VGBA 2JF6A 2GJXB 4TU1A 4BEQA 2ZC1A 4LFYA 1O68A 2YR1A 1SW7A 3RX3A 2NX3A 4B92A 4IMFA 2Q8LA 4RX0A 2G50A 1H1ZA 1BYCA 2WVTA 4H8VA 4ORMA 1O5KA 2J77A 3G1YA 5D02A 2PU0A 5ECUA 5D2WA 1IEIA 3RLHA 2QDEA 2E3ZA 1V93A 1QOPA 3A5VA 2PDNA 3PF3A 2ZZ3A 4PUJA 3VDBA 3TA9A 3SUTA 3S5YA 5EB8A 1KC7A 3B9AA 3WFAA 1GQNA 1OZMA 2OX4A 2ADAA 3N17A 2XIBA 4Z0SA 1VF8A 2WK2A 2XH0A 5C8BB 1GVRA 1HNYA 3WQEA 4PL2A 2V69A 4QLJA 1FWWA 5C2CA 3IRDA 1TZ9A 3U2CA 3TE9A 4PFHA 1OT2A 3WCZA 2DORA 2H90A 1TTPA 3GHSA 5CZ0A 1C9WA 1V0LA 2EQDA 1PCWA 3B0VC 2OYLA 2YDQA 1NWSA 5HNUA 3TZFA 4HA0A 1RSCA 1YNYA 3ARYA 5FF2A 2ZX9A 3TUUA 2D0FA 3LLFA 1XWYA 1F3TA 3BAWA 3VGBA 1VBJA 4UIOA 4XK2A 3U2EA 3TJXA 5CJ5A 1YXYA 4ADTA 1U1UA 2X40A 1ENUA 3L68A 3SO7A 1Q6EA 2FJKA 1AODA 2DZWA 4WSHA 3CYVA 1XICA 3FYOA 2G97A 3VINA 2BASA 2E6YA 3GU2A 3PZIA 1XUZA 2FMOA 3QHMA 2ZVIA 4K38A 3RAOA 1L2UA 3GXMA 1YYAA 3NGJA 3JRKA 2CETA 3REQB 3CZGA 4MJMA 3DFOA 4S3JA 3MT1A 3L0GA 4MWAE 2QJNA 2AGKA 1FWDC 1PZ0A 3MP5A 1XHGA 2WV8A 3ZZ1A 5I3GA 1P6CA 3UCQA 5FIPA 3N3MA 2NUWA 3IIXA 3HG3A 5DY2A 1EHAA 5M03A 2XVPA 4KPLA 1UA3A 4MB1A 4AD3A 6PTDA 1R47A 3VC6A 4GUJA 4OU1A 1O60A 2XVKA 2ATSA 2NQ5A 2Y5EA 3C52A 3HPZA 3NPWA 4EF9A 1E6QM 1Q7MA 2QAPA 5EBAA 3OODA 4DLFA 4WX2A 2CBIA 3G2GA 2Y24A 4GA8A 4O53A 1XLCA 1H5YA 3WDIA 3C86A 4D9PA 2CESA 2W79A 1H0IA 3WK1A 1E71M 3SGZA 1WCGA 1QI0A 3NQDA 4Q8MA 1KTCA 3S6DA 5B80A 1F4HA 2OB3A 5FF0A 4CD5A 1XF0A 1JYVA 1UR2A 2QPSA 1ZP3A 1BEUA 3ZMRA 1JZ6A 3IV3A 5CC3A 1ITCA 1HQTA 1NIUA 1K8YA 1AH4A 2ZZ6A 3GG0A 1UG6A 3KL3A 3I6TA 4GZEA 4XAGA 2HBXA 3ATZA 1KFWA 3L7RA 4XSLA 1KRAC 3BANA 2J6XA 4DJFA 4QG6A 2PWGA 2NSXA 2PCQA 1SJBA 1H7RA 3ATYA 4WQ6A 4AG0A 1KRBC 2CERA 3OLEA 3AIQA 3VIFA 3VOIA 4RNJA 3EX1A 2A6NA 3QOKA 3TAKA 3UG5A 2XIIA 2XN1A 3GVVA 1EHNA 3R8HA 5K2ZA 2IKHA 2EG6A 2BY1A 2E28A 4KESA 4FXRA 3TR9A 1W32A 3PULA 1I2OA 1MDLA 5E6YA 1W1ZA 4W93A 1BGGA 4LNYA 1I2QA 3RPTA 3W1PA 1Z32X 4W7VA 1OT1A 4CQ9A 1YDNA 3HJZA 2BS9A 5CZJA 1Q6FA 4IG2B 4H7ZA 3KHDA 3SGGA 1WA3A 2FZDA 3NQVA 4AD1A 3KRBA 4EWND 1VKFA 3ZT7A 5A8QA 2RFGA 4L9XA 5EY5A 5I3KA 3SSJA 2HV5A 1XIBA 3WQPA 5C0QA 1JNEA 3UPWA 3AYSA 3LI0A 4HNTA 2IS7A 2WWDA 3H12A 4KIRA 3IUIA 2V0TA 2I9UA 4MIMA 4S3DA 2BOGX 1R30A 5E70A 3QPZA 2VHLA 5I06A 3WO8A 3SRFA 3E0VA 1CLXA 5AHLA 3BVJA 4PMRA 4R85A 2YB4A 1N82A 4IL2A 1FDJA 1W5MA 1X6UA 2XWDA 4E3TA 1Q6LA 4K36A 3L4ZA 2V38A 2Z1KA 3WLOA 5FA5A 4F2BA 4JNYA 2Z00A 5AHFA 3VGDA 3BAXA 2POTA 3SCNA 1B90A 4I8DA 1JQXA 3B05A 4YTUA 1PTGA 4QSFA 1IV8A 4INFA 2G95A 3EKLA 3GZAA 5C9XA 1HO4A 3SJNA 1HKWA 3B0XA 1KW1A 2OX1A 1E4MM 3A9BA 4DHGA 1DTNA 5HAOA 4UCGA 2R91A 1I1XA 5CPTA 3ZYZA 1V3MA 5BCAA 2QVNA 3PS7A 2BVYA 4IPJA 4HOWA 1IXQA 1PB0A 1PYFA 2CLEA 3WLMA 1TFVA 4IIHA 3C5QA 1W5NA 2WCAA 2YBTA 1Y65A 5EMYA 1UUMA 1AFSA 1AL7A 4KEUA 4RR4A 1XGZA 4HP5A 1V6XA 2HJPA 2NWRA 5J8LA 1MW3A 3NQAA 3R25A 2EG8A 3G3MA 4UR9A 4N9DA 5G4EA 1ME9A 1T41A 4CU7A 1QR7A 4HK6A 4YYFA 2Z2UA 1O95A 4HHHA 4LH8A 3G18A 5SWUA 3IGUA 4C91A 2DVTA 2X16A 3FDKA 2ZX6A 4DI9A 2DY3A 5I3DA 4JICA 4X60A 1IHIA 2QV5A 3IJQA 1NAL1 1UWAA 2CBJA 7REQA 3FIGA 4AY1A 2QUMA 3D5HA 4JHMA 4MYXA 1OFEA 4RUBA 1RK5A 4YLWA 3BDKA 4S2BA 1PPIA 1Z89A 3OQEA 4M6VA 2OKOA 1TVPA 1GYLA 3A3XA 4C6PA 2IQTA 3F4VA 5CG7A 1JUBA 3BCDA 1DWIM 4E2OA 3GY1A 3H2OA 3PPCA 4K8EA 1V6TA 4HA1A 4B2DA 1GKRA 2ZWYA 4A6GA 3FOKA 4P8WA 2ZBTA 1UH2A 1J0HA 5LSMA 4Q8TA 5HJYA 4ZO9A 1VFHA 4YL2A 1J6OA 3W22A 2J79A 3ABQA 3FA5A 4EVZA 2CFFA 1R87A 5G1MA 3AU6A 6TIMA 2DZVA 3CU2A 4H6KA 3Q94A 4E4UA 3CPGA 1E0TA 3WUBA 1P0KA 1UJQA 1VR6A 3CZEA 3N25A 1T6MA 4BR1A 4GKLA 1TCMA 3JVAA 1TPUA 3ARSA 2NZLA 4BWLC 1XDMA 2VGIA 4A3QA 3DFHA 2ZYFA 1A80A 4R5EA 2ODOA 3TN5A 4XD3A 1KBBA 1M5WA 2QCEA 1K70A 1Q4WA 3OGRA 3T4WA 3N13A 3W25A 2ZUNA 4CD6A 2F9RA 2UV8G 4PBFA 3WEOA 1JZ4A 5F7UA 3QY7A 5HQEA 4IP7A 1H7OA 2VO5A 4K37A 1UH3A 2QJGA 3G6LA 1GZJA 3W83A 2A6LA 1DJHA 1FFQA 2H9AA 4CQCA 3EWYA 4NX0A 3KTSA 2FTYA 1CECA 3ZIZA 5HR7A 3WNPA 3I3DA 1NOWA 5AVHA 3O6AA 1AD4A 5C55A 4UMCA 3TKFA 1VEPA 1FH9A 4Q8NA 1HKJA 3VD4A 3TC7A 3UERA 1QW7A 1JAKA 4DF0A 3RJXA 4FS9A 4J3VA 2BVTA 3F2CA 2C19A 1NQ6A 1FHVA 1R5YA 2W66A 4FHAA 4HJWA 3U5YA 3WK0A 3BQ5A 2JGQA 3RMJA 2OZTA 4LU0A 3F7JA 2PTWA 4EWJA 4OVXA 2E68A 4EPDC 3WIJA 3H7VA 4JFVA 6XIAA 5A8OA 2FTWA 1VFMA 2ZUMA 1OD8A 3CAVA 1Z6KA 5EMJA 3TFCA 3A21A 1MZRA 1JYNA 3IAPA 5J5DA 4LYPA 2J25A 3MI2A 1J11A 2J62A 2XIOA 5LHFA 1PKYA 3ZWSA 3B9NA 2VX4A 2X41A 3KE0A 1Q13A 3D3FA 2VYOA 1YRRA 2WJFA 2D23A 4RW3A 1AVAA 1AW2A 2GQ3A 4GVHA 2PP1A 1TV7A 2DJLA 1FXPA 1HL9A 1QFEA 4BF9A 3BC9A 1TPEA 2EPNA 5IRPA 2C79A 4AD4A 3MUXA 1R8LA 3VYLA 2J75A 4DBSA 3VVGA 4ZO7A 2VURA 5E9XA 4MWAD 3UZ5A 4TX9A 5IOBA 1F76A 3N4FA 4PGLA 3NEHA 1EJSC 4EE9A 4ZSUA 3CL8A 1KTBA 2D2JA 3L4TA 3TLQA 5EYWA 3RM9A 2PZ0A 5D09A 3OIXA 4Z1DA 3VX1A 4MFEA 1QTWA 5DXYA 2ZA1A 1REQB 3WBAA 3CV1A 2REQB 4BF7A 3UVAA 2DH2A 3GNRA 3STEA 1MEWA 3N73A 2NQ9A 2FLIA 4XUYA 3RIKA 1CEOA 5GJMA 3KBMA 4LRSA 4ATLA 5HWMA 4D8LA 1XSIA 3UEQA 4LEFA 3BSHA 4W5UA 3VOHA 4OBTA 1AW5A 5JBDA 1PKLA 2E5CA 3UYIA 3SJ3A 1E3XA 1R9YA 3IS4A 3W00A 2VFEA 4AC1X 3R0KA 2YA2A 2X1RA 1JDCA 4X9SA 5FESA 2QCNA 4DELA 4NF7A 4JHOA 3BWWA 3VZYA 3IIZA 5FCZA 2IXVA 1TIWA 2ZVRA 1RQHA 4KEVA 2WCGA 2VGFA 3QPYA 3S5NA 4U2ZA 4DYJA 4LYRA 3TW7A 4B3ZA 1PHWA 2GVGA 3J7HA 3O0KA 6ALDA 2WW5A 3DC0A 3PZNA 2DSWA 5LA2A 2Y7FA 1R9XA 1J5SA 1IXNA 5T9CE 2QPUA 5EU9A 1GGOA 1QI2A 4H6QA 4NZ1A 2D3NA 3EWZA 3LCWA 4ZODA 3EX4A 4A3YA 3BJSA 5AHMA 2Z6JA 4Y9PA 1WDWA 4D1IA 2V3GA 3LENA 2WM0A 4M51A 4J9JA 5EKYA 3EOOA 7XIMA 3DHFA 3UXKA 3OO2A 1E1EA 3S46A 2VR2A 3PWIA 1Q66A 3ALFA 1E9LA 2TPSA 3AU2A 3TC3A 2NX9A 5HBFA 2FIQA 3UVIA 4HK7A 3W1QA 4JDBA 3T44A 2ZTKA 2WSYA 1E40A 4RLIA 2QJIA 3WN6A 1FWNA 3GH7A 1F73A 3WQOA 4PUMA 2OQLA 4JNMA 4EPEC 2ZZ4A 3Q67A 4N4PA 3KTXA 2YKKA 3UETA 4PMVA 3B40A 4QJ3B 1QT1A 2BZNA 4Z17A 2A3CA 1TPB1 3W76A 4IP5A 4HMEA 2Z2AA 3ZLHA 1VLWA 2FPTA 4R53A 2QKFA 4GUHA 5A6AA 4U33A 4BWLA 1KM1A 2H6RA 3GC2A 2J7GA 2G0WA 2OZ0A 3THAA 3DEQA 2WKLA 4NRSA 1UPMB 2JIEA 3DKJA 3S1UA 3DGBA 4UOJA 4RE0A 3V75A 2P5NA 2RHGA 1R2TA 4X61A 4UCFA 3ITYA 1EL3A 1TV4A 2OO6A 2GL5A 4ROQA 3WH9A 4IQEA 1J5TA 3IWPA 1FWGC 1B1YA 2WHKA 2J4GA 2Z1BA 3QVQA 1VH7A 5C9ZA 1AQMA 3ES7A 4MDOA 1QMLA 4L9YA 1AL8A 5BRPA 3OQ8A 4ZQPA 2OXNA 4UNLA 4N9CA 2DP3A 3TQVA 1SU5A 3EDEA 3CBWA 1W37A 2CZEA 4WDTA 3RMEA 2ZXAA 1P7TB 3EKZA 1H61A 2B7PA 5KMYA 1KXHA 3MW7A 3O7UA 4B91A 4AXKA 1EFZA 3KX6A 3U4FA 1H41A 4EKJA 1QWGA 5A6BD 3W1LA 2VJXA 1UROA 3HV8A 3Q4DA 4HNOA 4DUOA 2OFJA 3WD4A 1XD0A 4HZ6A 4TVUA 1CPUA 6A3HA 2INFA 1SM9A 3LTSA 4FSAA 3I4KA 1XFCA 3G0SA 4JTUA 4L4MA 4KW2A 2Y6ZA 3UWWA 1S1RA 4JOMA 1DBTA 5JH1A 3NZRA 4UTFA 4AZ6A 3GHTA 2Z24A 1MZHA 2WB5A 3VGHA 3QHOA 2OVLA 3VM5A 5C2XA 4JTIA 5CJNA 1P0BA 4QDWA 2HDJA 3OB8A 4U10A 5IXEA 2HVOA 3FGCB 1B3ZA 3WLTA 3TCSA 4O4WA 1BFNA 4O1AA 1MVYA 3TTOA 1E72M 3EKGA 1VFOA 4WJEA 5T8GA 4JGDA 3VDAA 5E9AA 4M1BA 3NSMA 3F2DA 2PF8A 5C2GA 1OFDA 1DJWA 3PJTA 5IFPA 3V0TA 3NG3A 1GCYA 1KFEA 2HE5A 3GNNA 3T0AA 2XISA 3PN8A 1EEXA 1UHVA 3IVTA 5HUPA 4M7SA 5D9PA 2TAAA 4S3FA 1ALDA 2CC0A 4RE3A 4CNTA 2PBGA 1XDLA 4WDXA 5M2FX 4ZO8A 4PRTA 1XBZA 3CC1A 4OFCA 4KFPA 3LQGA 1TV2A 3STCA 5H2ZA 1HX0A 1W8SA 4F2UA 1ECEA 3BMWA 5LHEA 3BTNA 2E8ZA 4OGZA 4PZVA 3UBPC 2PWUA 5K4ZA 1KCZA 4QR6A 3MY9A 4QM1A 4IXXA 4PA8A 1UUQA 4MAVA 4UR8A 4QAWA 5CEWA 3PP7A 2NQHA 4JD4A 1SFTA 2GQ8A 5HQMA 3A12A 4LVFA 1NFGA 9XIMA 4QIUA 4M1RA 4MUPA 2XVLA 4M8UA 4LBUA 2VOTA 9XIAA 4O8RA 3IRSA 3KOYA 1RQEA 2J47A 2BDQA 2JIWA 3OLGA 4GIEA 1LQ0A 3L4UA 1RLCL 2G5WA 4I8YA 3TYBA 2BWGA 4EF8A 3PUDA 2XSXA 2GJNA 2FTPA 2GUYA 1ISXA 4E0CA 3GKFA 1H2JA 4JKKA 4EACA 3L2IA 1LG2A 2IPGA 4NY2A 5BXPA 5I03A 2WBGA 5JXQA 2WMHA 3MVTA 1FHDA 2YFOA 3DZ1A 2VZVA 1KXVA 3SCOA 3CUFA 4ZR8A 3ARTA 3LHUA 3WQ8A 1BSLA 1V3IA 1U30A 2WNNA 3W88A 4GNJA 5D8ZA 2PLKA 4LXFA 3SUUA 4P8XA 3JW7A 5EMKA 3S3GA 2OELA 1DYSA 1Q6DA 1WO2A 3VNMA 3C3NA 3HQ1A 3RM8A 3KVKA 3GNDA 4BY3A 4JTTA 1HG3A 3I3EA 3TTQA 4MDPA 3O2LA 2VQUA 4Y96A 4XAPA 1WBHA 2WWCA 4UZSA 2Y7GA 3M43A 2CZ5A 4DJED 4AB4A 2P10A 2FB2A 3II1A 3WLIA 1HT6A 5IBXC 3QKZA 1G4SA 3BH4A 1UA7A 2PD5A 4PCTA 1EB3A 1JD7A 3HGSA 3SCSA 1CGVA 1UWUA 3B0PA 4OOZA 1NDWA 1VEMA 4MAZA 2DQXA 2Q71A 8RUCA 1KCLA 1TWIA 4ZZ9A 3FJLA 3EB3A 4Q7BA 3E9AA 4US5A 1M04A 3WJXA 3L4YA 1MNZA 2FB3A 1TA3B 4OUEA 3PSVA 3HG5A 3GFZA 1W3TA 3TH6A 4IX2A 3VIPA 1GOOA 1RCQA 4JEJA 1ZU8A 1S2CA 2PRLA 4DUWA 1JDAA 1KKRA 3DBNA 1JQVA 4JZ5A 1VENA 3NPVA 4J3XA 4HN8A 1FHUA 4JY9A 3B0YA 3H21A 4Z2IA 4PUKA 3C8FA 3W6LA 5BRQA 3D47A 3I7QA 5FOOA 4HHMA 4D6DA 3B97A 3R10A 2B31A 5A8GA 3ABXA 3LS9A 4HCDA 3LM7A 5AYBA 1RXOB 4FPSA 4CUCA 1V3LA 4AX6A 3EAUA 1L9WA 3T40A 4FX6M 5BW6A 3ZT5A 3OU8A 2F61A 3QF0A 5L9FA 4MWAC 1QBBA 4RL3A 3W1AA 4IXHA 3R13A 4LAKA 3O9NA 1QNQA 1FX6A 1EO7A 4UUIA 3FVDA 4DIAA 1C7TA 1FWAC 5E93A 3ANYA 4KRTA 3EXRA 1MQPA 4LB4A 1VHCA 3B9EA 3WF2A 3MHUA 1QNPA 3DC8A 5D33A 1BG9A 4Y9MA 2DIKA 2FKPA 2OG9A 1CZ1A 2FVLA 3OYZA 4AIOA 3PHAA 4MHBA 4IMDA 3KZPA 1QVBA 1V6YA 3EDJA 3LCIA 5LNUA 3W26A 3VMOA 2BHUA 1GYNA 1ZAHA 3VZXA 2I5IA 2HK0A 4O54A 3CZ8A 3C2EA 1GVYA 1J18A 2G37A 5E1QA 3PBUA 3BOXA 1S3HA 4CD8A 3OVPA 3CUZA 4BI6A 3V18A 1TUXA 2VRJA 1OX5A 4EPKA 3C61A 4O1BA 2JKAA 1SR0A 2F38A 1L6YA 4BQ4A 2NV1A 5A8PA 2DH3A 5LYRA 5FL0A 1VJIA 1W1YA 3VD3A 2DZAA 1H09A 4YTSA 2X0YA 3AUJA 3TV8A 3MQTA 4GYPA 3CUGA 3MUY1 3L2LA 6XIMA 3NSXA 1GZ1A 1UP0A 4Z1YA 3PZVA 1Q6QA 3E1F1 4FNQA 2I16A 3R58A 4GJ1A 3A23A 2VVNA 3QR3A 4MY8A 4M6UA 2B0MA 1Z41A 4FZIA 4PTNA 1WUFA 1DVJA 2V2HA 3ONCA 1KFLA 4IIBA 2YCLA 3EBVA 3TROA 1HP4A 2RAGA 4V1XA 3O63A 3HGOA 2WMGA 1QUMA 2CHRA 1UR4A 3I65A 3MSGA 3PTKA 3AWNA 1HKVA 2VRKA 3ECQA 4NP7A 4FR6A 2XVNA 1IGSA 1PE1A 3W7QA 3CV2A 4DWSD 3W7LA 1V02A 4DUXA 3ZJKA 4KIEA 3CQIA 3IJ7A 2PDLA 3CUXA 5JBFA 3WNOA 1A4LA 1BRLB 1D8WA 1NWUA 1M03A 4GLEA 3TYAA 3GG1A 2BGNE 5I0DA 3KCOA 5G4HC 4RKAA 1Q6GA 1TMLA 3MCNA 1HTIA 3TAOA 4KFNA 1OYAA 3Q2DA 4AC7C 2D73A 1KRMA 1I8JA 4GI4A 1UP3A 4ZQRA 4G1KA 1G7UA 2WSKA 3RX2A 1K8XA 4RDYA 4GQRA 4FP1A 1EOKA 1MFUA 2ISWA 1RPXA 4R9XA 2XIMA 5BOFA 3CGTA 1F07A 1QW8A 1CXLA 1EJXC 5EBUA 3SI9A 4PTVA 3FA3A 1VBGA 4QDPA 3FKKA 3BAJA 3QV9A 4AVOA 3HMCA 5TQLA 3APGA 1NDVA 5HDRA 3CAQA 3SRHA 2TSYA 4OBSA 4PTWA 5KZEA 4N6FA 2BY3A 3N15A 3WLHA 1EJTC 3N6JA 1Q8JA 4TX8A 4PTDA 4PMUA 1JUEA 1XIEA 4M0XA 1KXTA 3QQWA 4PCPA 1PX8A 3ITLA 1S39A 1QI3A 1RBAA 5IBXA 1XLEA 4UQEA 2PPGA 1OFQA 4AH7A 4RJEA 3GSMA 3A3WA 1XG4A 5G4WA 4MKSA 3TMLA 2PLJA 3A4WA 4PYSA 4WJ8A 5CBJA 1JCNA 1JPHA 3WQCA 4G56A 4MNKA 3T07A 3JZEA 1K3UA 1UKQA 3BW3A 2HROA 2GGEA 3GH5A 2VT0A 1MO0A 2PGRA 1XD1A 5HWNA 3WLQA 1GEQA 4K68A 3R7MA 1OWQA 2V68A 5D30A 3RITA 4DX3A 3SW6A 1LP6A 1CXFA 1B4KA 3NZ1A 2GVYA 4HVXA 3B0UX 1HFBA 1E6NA 1XSKA 4HT3A 3SY5A 3CHFA 1BKHA 3O8AA 4KRUA 3ZM8A 3H26A 3NSNA 1YTEA 1MRQA 1R38A 2ZQ0A 3V0SA 1KWKA 2XDFA 1TV5A 4NIRA 1VRXA 1TTQA 4A3RA 1CGWA 3VNDA 2B7OA 1EIXA 3CZLA 2C0AA 2EJAA 2Z29A 2E6AA 3F5KA 3GVQA 4A3HA 3AXMA 3URQA 4GQ0A 2ISFA 3QQ0A 2VX6A 4BI7A 2TODA 4DWSB 3GU1A 3EXSA 3ITXA 1OC7A 5MHBA 2WHMA 2INZA 3N29A 4DJDA 4GZ7A 2X8RA 4EK7A 1UH4A 4B5SA 3FFSA 3UFYA 1H62A 3KDOA 1Q6OA 1JCTA 3LRKA 1VS1A 2C3ZA 2Y7DA 1XLIA 4AZCB 1L8NA 2FQIA 1AQ0A 4F0SA 3UNDA 1A3HA 2OWWA 2P76A 3AICA 2GDVA 4XX6A 3EWBX 1QO5A 2HRWA 4G7EA 2FDMA 5CZTA 3VIMA 1TB3A 4MMWA 3G1SA 4PMXA 4JN7A 3W1MA 2JK2A 4GFSA 1E9ZB 3PC0A 4DBUA 3GNPA 5JUVA 4M82A 1EKOA 3BE7A 2YLLA 1O5RA 1UD2A 4LVGA 4QFUA 1CW2A 1XRSA 3K5XA 2PDMA 3W73A 2C1IA 2A5HA 1EJ7L 4RNHA 2ZWZA 3E96A 1EH9A 2HSAA 4KH2A 1KR1A 4GJJA 4FR1A 2O4MA 1XIFA 3AAMA 4DZHA 1X6NA 1KCXA 4E8GA 3T81A 3HURA 3WFLA 2E6DA 3G1VA 3NYDA 4K7VA 5REQA 4OOUA 4KCWA 3O1NA 4LF2A 1OG6A 3EX2A 2FGZA 2ON3A 4QQ3A 1X8FA 4ACZB 1J8VA 1M7OA 1DJXA 4H9UA 2FZBA 2TMDA 4HMCA 4MF4A 1ONRA 3KW3A 2P1FA 1OFOA 1ZJAA 1NF0A 2HNHA 1P0EA 5HA7A 1K77A 3W0KA 2A3LA 1F8MA 4P7LA 1F6KA 2DIEA 3W23A 1UZ4A 4ZFCA 3NFUA 3T05A 4JTQA 2CLFA 4O1FA 5A69A 3GW0A 3H2EA 2QCFA 3N9RA 1GEHA 3UXIA 3M5XA 3E0LA 2AQOA 4DJEC 3AHVA 4ZTXA 1RD6A 2ANUA 2HK1A 1FBAA 3B9OA 1N2VA 4TV6A 3SQSA 4DNHA 4YN5A 1ZS2A 5C9WA 4GIYA 2VR4A 2ZCGA 5G2IA 3Q58A 1OZQA 2YYTA 3VIGA 4IMEA 4J5NA 4Y7EA 2ZRVA 4I5RA 3CXOA 2KZHA 3M07A 5HULA 3P14A 1IEWA 3HPFA 1J2BA 1B3XA 3C2VA 3R0DA 3UG3A 3SECA 2WZTA 3GG7A 1TR9A 2QMKA 4HHPA 2WMIB 1XL9A 1RQBA 3OHIA 2AAAA 2YOCA 3CS2A 4PFMA 5D2XA 4KFOA 5AZ1A 6REQA 3DI0A 1XRFA 5GVJA 1C8YA 4LS0A 3EPNA 2EPMX 3M5ZA 3FAXA 1LM1A 3B8VA 4GD0A 1V6VA 3KVLA 3NQ2A 2CNCA 2C6QA 3E3HA 3LXCA 5DEZA 3LSBA 1UZDA 4M3PA 3LCFA 3WQFA 3N9KA 2I56A 2DJXA 2J24A 3W2JA 4KCVA 4GABA 1DXIA 2VNCA 3H70A 2A0NA 1LYXA 1FWFC 3LBMA 2QF8A 1EF3A 5EFFA 2DW6A 2VFFA 1EYEA 3V4BA 1LRQA 2O9PA 3IUDA 5HJXA 2P0OA 4WZHA 3W3OA 2J9XA 4LAOA 3M7WA 4IH3A 2HE8A 3A4AA 4ZQCA 2DUXA 4XVEA 3P5ZA 2WC4A 3MO4A 3A5FA 2ZX8A 1SO6A 3TQPA 3VD7A 2C0HA 2DT1A 4B5WA 4QISA 3W7KA 4W86A 4XVDA 4I9JA 5H91A 5CBBA 1G7VA 1M7PA 4L4PA 1P6WA 1QWKA 1Q85A 3LGGA 2ZRZA 5KZMA 4AFYA 2VCBA 3FV9A 2EEXA 2Q09A 4NX5A 1EA9C 1CT5A 2WPBA 3CWHA 5TBOA 5TF0A 3JS3A 1KM4A 5KZDA 5BMWA 4RDZA 1CXHA 1PZ2A 4PRWA 1H3GA 2JE8A 3T0CA 1CI1A 3MTWA 2AKZA 2ZA3A 4MLJA 3WDRA 4C90A 5DCBA 2VFHA 3MHFA 1R3VA 3RPMA 3DG3A 1PXGA 4GH3A 3WZ0E 6CGTA 1O7AA 1A50A 4E8DA 3MMWA 2QJMA 1I60A 3OIHA 1R2SA 2WJZA 4O50A 2FPVA 1GQKA 3EX3A 4TVDA 3EWXA 4JTDA 2CBVA 2FFIA 1X7IA 1FA2A 1NVMA 1JZ8A 2MNRA 1ZJBA 2BSLA 4WDWA 4HNVA 1UB3A 2OO0A 1QO2A 4ERIA 1KGUA 4GK8A 4H01A 2WNZA 3R5EA 3ARZA 1YBQA 3GR7A 4J7RA 2NX1A 3WLKX 2E1WA 1BPLB 3S2CA 5K3VA 2PBOA 4M5PA 5M17A 2MUCA 5CPOA 4YTRA 3UY8A 4AHQA 4GBDA 3WQWA 4QP0A 4CD4A 4XAFA 5LIUX 3DOPA 1Z48A 3W2UA 1P0NA 4TV5A 1LTDA 1BWLA 4B90A 1RZMA 3ITCA 1HF6A 1PYMA 1FDZA 3R0UA 1GVFA 3NVDA 1JXKA 1J79A 2XIQA 2RJGA 3P0WA 3WBWA 5G1YA 4EIVA 3RM4A 3CWOX 1ISVA 3QV7A 2CZDA 4NJJA 2JKPA 4DWSC 1G5AA 4E6MA 3LNPA 4LVDA 1XP3A 4D6CA 4XO6A 2A3EA 1OB0A 3N9SA 2ZX7A 1US3A 1KM3A 1JL8A 2ONEA 1W9PA 3LD5A 4HQVA 4UTIA 4NAFA 5E5CA 3QQ1A 4PBGA 4AD0A 3RILA 1BQGA 1F2JA 1KD0A 4R9OA 3KRSA 4Q8QA 3DFSA 1D8CA 1VCFA 1B31A 1D3HA 2BTMA 5F2MA 3RYSA 3SZ8A 5BWAA 1IYXA 3P60A 2QF7A 2W6RA 4IGSA 2WZHA 1LCOA 3CUIA 3WNLA 1WXJA 2XJ7A 1VYSX 1GQJA 3SIZA 2AOSA 1LRTA 3NPUA 1RA5A 1FWIC 4NNCA 3LCXA 3VNZA 3CZJA 4EAMA 4KCTA 2BVWA 3WD0A 1M41A 2EKCA 1WDDA 1V3JA 2HZGA 1D7FA 1IT8A 3PR2A 3ITGA 3BZGA 2J9ZA 4GINA 3OA5A 3VI2A 4S3GA 3SIMA 3PTMA 3E5BA 4LSBA 4AIUA 4HZ7A 2BLEA 2PGFA 1H11A 3CT2A 2ZRWA 3WD2A 2HS6A 1HGWA 4JX4A 1G01A 4LUTA 4DJEA 2XGBA 1UR8A 2VOMA 5AB3A 2NSOA 4IMAA 3TW6A 4I9AA 5G2WA 4N7QA 4LY8A 1I9CB 3ICJA 4S38A 4D8ZA 4DM1A 1HP5A 4WHBA 1V7YA 5GPRA 1DXEA 3OZOA 3QYSA 3AHTA 3PB0A 2XFRA 4F0KA 1HGYA 3GTIA 4XZWA 2WYSA 2HVNA 1VCVA 4AYSA 4JXCA 3RO8A 4H2CA 1OFBA 1W3HA 1ZZMA 5CLWA 4C6KA 3LB0A 3PZ9A 4JL1A 1SZNA 4OV9A 3MCOA 1TQXA 4O4VA 3MHGA 2ATMA 3AZRA 3MP4A 1POKA 5XIAA 1EGZA 3NXFA 1OC5A 5TNVA 3BLOA 3PUGA 1UKOA 3NIYA 3NZGA 3L0KA 2E77A 2B4GA 3TJ4A 3R89A 3VNLA 3DAQA 2NVCA 8TIMA 4OKDA 2PRHA 4GQQA 3HPAA 4NKCA 1TELA 2BOEX 1XIGA 4CCZA 1R7AA 3BLPX 4GBUA 2QAFA 4JAWA 4M81A 4BFAA 3AXKA 3TDFA 3RF9A 4D6FA 3VABA 2D1ZA 3KBWA 3BAIA 4PSPA 4DXKA 1FQ0A 4AF0B 3IV8A 3GDRA 2BX7A 3CO4A 1LWIA 1I45A 4LVBA 2SFPA 1W2VA 1OC6A 1R3YA 4LUSB 1OX4A 4WVXA 4BF5A 2WO5A 3TEVA 2R24A 1ZGDA 3LK6A 3GUGA 2QIWA 3OYXA 2QEZA 4G9PA 4ZBCA 5K7JA 3W07A 4B5TA 1W3JA 3SN4A 3W24A 5A1AA 1A5CA 5HMDA 5BOOA 3PWGA 4KRZA 2QLYA 1LF1A 3M6DA 1D2KA 1EO5A 5CC7A 5FI8A 4RZ6A 1R2RA 1LWHA 3LMZA 2F6XA 2VR5A 1KBLA 1Y5VA 1LWJA 2IKGA 7ENLA 2WXDM 3LLDA 3GDBA 4W5ZA 1R3TA 4WKAA 3BPWA 1Y0EA 4LS1A 1SO5A 1VCGA 4EANA 1O5XA 4HZMA 2QV4A 4S3EA 4F8XA 5C9RA 2ZXBA 5AHEA 5CGMA 2CKRA 2WAGA 2QCDA 3M1ZA 3GLCA 3WEZA 3NEVA 3TWBA 5BOEA 4F4RA 2YL9A 1JAEA 1RJRA 2GJPA 3QGKC 1E4NA 1LLWA 4FXJA 3S0CA 2R9RA 1BAGA 3W74A 1TRDA 1LL6A 2NUYA 3QEZA 1CWYA 2VCCA 1QHOA 5HANA 1TPVA 3STGA 4C6IA 1W5QA 2QCCA 4NNBA 3HG2A 5ABFB 4BQ2A 3BZJA 2PWFA 3U2OA 1G0CA 4S2CA 2D0HA 1QDSA 3H4WA 3N2BA 4P7OA 3GUWA 3N2MA 4LCQA 4PUNA 4GHRA 3T0BA 3EWUA 3NQCA 1RK6A 1JXJA 3CQKA 2UZ9A 3GBEA 1B5TA 2G4FA 3KAOA 1I2RA 1M7XA 4ACYA 2WZIA 3NQGA 4TTGA 3NVTA 2Q02A 5I2UA 2BNJA 1XBYA 1P48A 4JKMA 1PHQA 2BB0A 2E9BA 3SCVA 3UJFA 3GC5A 1H1NA 1UBPC 1W91A 3NQBA 3AISA 4PTMA 1MUMA 5HUOA 4MM1A 2GDUA 4ENLA 3T8LA 3LI1A 3PZQA 3S1VA 4WIWA 4MB3A 5EMUA 3HQPA 2V2CA 5KINA 1TJPA 4Q7IA 4LPCA 4LCSA 4HTYA 3CMGA 4C6LA 1PJ9A 4WSJA 3GKAA 4QSHA 4YTTA 5LNRA 3TXVA 1TJ2A 3G1DA 1S5WA 2P50A 1W3NA 4XAYA 1OF6A 3LHZA 1CXKA 4O1CA 3PZUA 1XJBA 3LXBA 3USBA 4V33A 1CDGA 1M6JA 4TXEA 3ZFHA 2EPOA 3CV6A 3W7OA 5D2TA 3W2MA 4KEMA 4C6NA 4DN1A 5JU6A 5H8MA 3SCTA 2DZTA 1TPFA 3VGGA 3ABZA 1KGXA 2E8YA 4PB5A 5LZLA 3ARVA 4M19A 2XYLA 3GH4A 3WYZA 2FGLA 1JDDA 1DJIA 4ZO6A 4OJYA 4UOZA 4MNJA 2O9OA 4NXSA 3I6EA 3VMNA 3MDWA 4WY0F 5U7SA 4GIAA 2EGZA 1O12A 1QPQA 1TTJA 4DF2A 3ZWTA 2E1DA 1BHGA 3COTA 2VFDA 1J0JA 2PTYA 3ANUA 4ZQMA 2HTMA 3W7NA 1TYGA 5F1VA 4C7DA 3M0JA 1YPFA 3R6IA 4WCJA 2G3JA 2CKSA 3WLNA 5JIPA 3DG6A 1OCJA 2R1LA 4BS0A 5AN7A 4MNMA 2WMKA 1WP6A 2PWEA 2QDGA 4MYAA 1RBLA 5E0KA 1KCKA 5A2AA 1I4NA 5AYYA 3WD1A 3SCWA 3C2OA 4YWIA 3HGJA 4PH6A 2YBVA 1OFPA 3GHRA 3UJEA 1J0ZA 1B3OA 2NUXA 2WVUA 2CITA 2L5HA 2VI0A 5MKGA 1VC4A 3P2VA 2FPYA 1GW1A 3SY1A 1ODZA 3UWEA 3AC0A 3K8LA 1W1IE 2VDGA 2YL6A 4GMEA 1J10A 1OCNA 4O10A 2V3EA 3IK2A 2F8QA 3GR8A 3CH0A 1JZ7A 4UFIA 3H2FA 1IQ8A 5LA0A 4C6OA 5EPDA 1I2PA 3ISIX 3DBPA 4KKXA 4MZYA 3KCJA 3VILA 4AZHA 1TX0A 3HMJG 3BLKA 2RJHA 3PB2A 3QC3A 3TSBA 1XS2A 7A3HA 3N6QA 2CXEA 4ZMGA 1NM9A 4P8UA 4WY0A 4GRSA 1CB2A 4Q8UA 2CLHA 1EC9A 2PWVA 3VC5A 4PC8A 4PRRA 4TMBA 4WR3A 4CNUA 4Q4MA 1AJZA 1JR1A 1D9EA 4IGHA 4L5ZA 1HVXA 3OEXA 3VDGA 1S2TA 2Q01A 4HN4A 1G4EA 3PBWA 3P62A 3G22A 5LNSA 4DB7A 4G8TA 3UZJA 1VZWA 3VX0A 3E2SA 3AMCA 3BGAA 4UXDA 3KXQA 3LPGA 1YLVA 4LBRA 3QMTA 1TV3A 3KFTA 3VKAA 4BK9A 1E5JA 2AMGA 4ZSTA 4X2RA 3GWQA 1ZP4A 1QNRA 2Y4SA 4C1NA 3KLLA 3KUMA 3OG3A 1JCXA 5CC5A 1CXIA 4LVAA 1NU5A 5F2IA 4FLQA 3FJ4A 1VLIA 2R1NA 1BTCA 2J7BA 3L9CA 4Q4KA 1OIMA 4ZA0A 4GYJA 3RLGA 1ZBWA 3E74A 4LF1A 4AZGA 4JTGA 1KRCC 3TJIA 5HNNA 3TMQA 1GNXA 3N14A 4QXIA 8A3HA 4UC5A 3MUIA 1UWQA 3U6WA 4GX8A 5CSRA 2ZTJA 3BAKA 1XQKA 3CH9A 3P81A 2XUCA 4LTSA 5C7HA 3LHVA 3KZSA 2O55A 1H7PA 5BRBA 1YDVA 3V36A 3KTCA 3QN3A 1FTXA 2D24A 5EL1A 4NSBA 3GVWA 3OW1A 3O3RA 1JCLA 2CLMA 4JTHA 1WDPA 4ZFMA 1W17A 2W4XA 3K46A 5DQPA 1U1HA 1F8IA 4DO6A 4LBSA 1TVLA 2V63A 2ACQA 2Q3OA 3KDNA 3SN0A 5TD4A 4B9ZA 5K9XA 1GOMA 4I7UA 5C71A 2EBNA 2PDFA 3ZT6A 3KWXA 2DSZA 4FALA 1V6UA 3B8WA 1M01A 4C1KA 1ADSA 3D6NA 1RLDA 2GOUA 3RGTA 2GSHA 3QV8A 1GOQA 2BXZA 3WLPA 2BBFA 1Q3NA 3AIUA 3G0XA 2QQ6A 4M6PA 3ZJ6A 4W7UA 3EEZA 4J3ZA 1PWLA 3WX7A 2XN2A 1TREA 4HD5A 3E02A 3UZXA 4REQB 3AS2A 2JF7A 3MI6A 3PUEA 4HA4A 4ZE5A 2E9LA 1YXDA 5DELA 1UR3M 2PC4A 3PNZA 1XIJA 3H2CA 2C16A 5LGXA 2I17A 3WF4A 1HZYA 3QJAA 1TJ0A 4XO7A 4L6OA 4ZGYA 1LUCB 4V1YA 2PA6A 1FUYA 5LA1A 4ASTA 1QPRA 4PSRA 2OGYA 3PJXA 4AYGA 1MUCA 4CN1A 3G77A 4P5UA 5HOSA 4YVXA 1QI4A 2UY4A 1XRVA 3PM6A 3MVIA 1W1TA 1OBAA 2JGYA 1M65A 4BQ5A 4HA3A 4I5UA 1DL3A 3O16A 4GY1A 4QCFA 4UBPC 4QNEA 3QY6A 1B9ZA 2VENA 5C70A 4IUGA 2ZZ7A 1AH3A 3L0NA 3NTYA 4JDYA 4PUDA 4JTJA 1OHLA 2OQYA 4KBXA 2J7HA 3UWVA 1NELA 4O18A 4U5KA 5JMUA 3ZXWA 3WF1A 4FF7A 3SUWA 1E1CA 1QXLA 1XC6A 5HXMA 4O15A 4JN6A 2W61A 1QRQA 2Z1VA 3WJWA 3GQYA 3AHXA 4PR4A 2VQTA 1TWZA 3SUVA 3ZVHB 3FA4A 1XX1A 3BV7A 1RY0A 4UQCA 2R1PA 1TV8A 3B06A 4DYKA 4L56A 4Y2WA 3USZA 3VOJA 2Y8KA 4I90A 4CQAA 2QUVA 5BXSA 2QULA 1BXBA 3QLDA 1YE6A 4MTVA 3VZZA 3ABRA 2VP8A 4GI9A 5K9CA 1LJYA 3N6HA 3DENA 3CB8A 1HKKA 3PNUA 4GVGA 4C5ZA 1O6IA 1SZFA 3G8RA 3VOCA 2FVMA 2YXGA 4ICNA 1GKPA 5CG0A 2XWEA 3MBFA 1GUVA 3KEHA 3O07A 4PUUA 2GQAA 3N2TA 1GWJA 2FH6A 3IJ8A 3N18A 1G6CA 3C2FA 4CKQA 4V28A 3SQLA 3KHJA 2GWNA 3DECA 3IAQA 2ZUVA 2D3LA 2RDUA 4XZHA 4QBXA 2YIHA 4CU6A 3NQFA 3PWAA 4B5UA 1EC8A 1SQ7A 4O12A 3V7PA 5DO8A 3ELFA 1GW9A 2PDXA 5D4YA 5M3WA 4M6Q