3CMFA

Crystal structure of human liver 5beta-reductase (akr1d1) in complex with nadp and cortisone. resolution 1.90 a.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3cmfA00
3R8HA 4GACA 3V36A 1FRBA 1Q13A 4FZIA 3H7RA 2PFHA 2F38A 2IPWA 2BGSA 2ISFA 4XVDA 2P5NA 3LN3A 3LEPA 4DBSA 3R8GA 5LIYX 2PDQA 1RY0A 4IJRA 4WDWA 3ERPA 2IQDA 4PUWA 2HVNA 4JIRA 2R9RA 3M4HA 1T41A 4IGSA 3GHSA 1AH4A 2C91A 4XZNX 4GABA 4WEVX 2R24A 2PDFA 4XZHA 4F40A 1JEZA 4PUUA 3COTA 1S2AA 1EKOA 1LQAA 3R43A 1M9HA 3WCZA 1YE4A 3M0IA 4PRRA 5JH1A 2PF8A 4GQ0A 2PDBA 4QR6A 2PEVA 4AUBA 3LQGA 3NTYA 3UZZA 1AZ2A 2IS7A 3LNMA 3UGRA 1ZSXA 2IKIA 1MRQA 1T40A 3R58A 1AH0A 1EF3A 3U2CA 1AFSA 2HDJA 1ZGDA 5HNTA 2AGTA 2PD9A 3Q67A 4XO6A 3RX4A 3Q65A 2DUZA 4LBRA 1GVEA 3MC5A 1A80A 5C7HA 1Z9AA 4JTQA 5DANA 3ONCA 1Z8AA 4WGHA 3M64A 3VXGA 4XZMX 4IJCA 1SM9A 4JQAA 3G5EA 4OTKA 4WDXA 2HEJA 2FVLA 4XZLX 4DBUA 4JTRA 2PDCA 2I16A 3MB9A 3WBYA 1RY8A 3RX2A 1YNQA 5LIKX 4HBKA 4JQ2A 3UFYA 5AZ1A 5KETA 2BP1A 4XZIA 2IKHA 2FZ9A 1IEIA 2FZBA 1QRQA 1MZRA 2PDIA 3EB3A 2PDLA 4L1XA 2BGQA 4GCAA 3CV6A 3EB4A 4QBXA 4RPQA 1EL3A 3QKZA 3G1RA 3S3GA 2PDMA 3CV7A 4JQ1A 1ZQ5A 4NKCA 4H8NA 3O3RA 5HNUA 3WBXA 2A79A 4R9OA 1X98A 1XF0A 1S2CA 2HE5A 1Z3NA 3CAVA 4ICCX 4GA8A 2HE8A 2ALRA 1OG6A 3R7MA 1PWLA 2FGBA 4GQGA 4EXAA 2INEA 2ACUA 3BURA 3BUVA 3GHTA 5M2FX 2WZTA 5JH2A 3GHUA 1C9WA 2DV0A 1ZUAX 2ACQA 2I17A 3F7JA 4WRHA 3BCJA 4JTCA 1QWKA 3FX4A 4WDUA 3DOPA 2PDNA 2IPJA 1VBJA 2NVCA 4LB3A 4Q3MA 1R38A 1EXBA 4DBWA 3H7UA 4PRTA 2IPFA 2ACRA 2FZDA 1LWIA 1PWMA 2VDGA 3LZ3A 3CASA 4EXBA 1IHIA 4JIHA 1VP5A 1S1PA 2PD5A 3UZWA 3N2TA 4JQ4A 3R6IA 3LUTA 4MHBA 1US0A 4H7CA 2PDHA 4JQ3A 1AH3A 4PR4A 3LZ5A 4JIIX 1MI3A 2HV5A 4QX4A 1ADSA 4LB4A 1XGDA 4YVPA 2PDYA 3RX3A 3UP8A 4QXIA 1YE6A 3BV7A 3P2VA 3UZYA 1RALA 1X96A 4HMNA 4PMJA 2PZNA 3N6QA 3O0KA 2ACSA 3T42A 2DUXA 2IQ0A 3GHRA 2F2KA 4G5DA 4JTDA 2IPGA 1AZ1A 1PZ1A 4YVVA 5HA7A 2NVDA 4GIEA 3CAQA 4YVXA 3V0UA 2INZA 1Q5MA 3V35A 4LAZA 2PDPA 3LQLA 3V0SA 1PZ0A 3EAUA 3GUGA 4XVEA 3WG6A 5LIWX 5AZ0A 2PDGA 3UG8A 2PDKA 4JTAA 3B3DA 2CLPA 3WBWA 4LAUA 1X97A 4LBSA 4L1WA 3CMFA 4FAMA 1HQTA 4YU1A 4ZFCA 1Z89A 3LD5A 3ONBA 2PDWA 3KRBA 1S1RA 1YNPA 5LIUX 2IKGA 3D3FA 4I5XA 3R94A 3UZXA 2PDJA 2J8TA 2FZ8A 4YS1A 2QXWA 3UYIA 3FJNA 4DZ5A 3LENA 1PYFA 3DN5A 4XK2A 2WZMA 1J96A 4FALA 2IKJA 3V0TA 1XJBA 3UWEA 3C3UA 2PDXA 1UR3M 4FA3A 5LIXX 4ASTA 4XAPA 3LBOA 2HVOA 2PDUA 4XO7A 1HW6A 1K8CA 4Q7BA 3H4GA 4WDTA
chains in the Genus database with same CATH superfamily
4IWWA 2VZVA 4GNJA 2QZRA 3EX6A 4LXFA 3GXMA 1D2KA 3DU0A 4K38A 3H7RA 2OO0A 5C2XA 4HNCA 4JTUA 2IPWA 4AXKA 4O8AA 3G6LA 5DRCA 1O1ZA 4DAIA 1GYMA 4Q22A 1ITUA 2C71A 4P7LA 2ABAA 4IFOA 2XIMA 1TE1A 3ZSSA 4JKMA 2O56A 4GD0A 4ATWA 1GTEA 1E51A 3AHZA 1FBAA 2XGBA 4IGSA 1W9XA 3B4YA 5CC3A 1FVPA 4MZ8A 5HANA 4NYUA 4GIYA 1VJZA 3OVRA 1V93A 3TTYA 4CU7A 4PUUA 5EBUA 2CETA 2C6QA 4GE8A 4IJBA 5HATA 3KTSA 2XISA 4LAOA 3N3TA 4BS0A 4OT7A 3NJ3A 4Y96A 3GAKA 3EKLA 2FIQA 3B9DA 1W8SA 2ICSA 2PEVA 4WX2A 3O15A 1I45A 4FB7A 4LALA 4UTIA 2XFRA 1XIIA 1AZ2A 5CGQA 2QJJA 1KCZA 3SUVA 1R8LA 1DYSA 5AC4A 2XIOA 1Q85A 5FIPA 4N0RA 4DWSB 1QNRA 1AH0A 2BHZA 3M0ZA 4XZWA 4UOJA 1ZJHA 4AF0B 1E5JA 2I1OA 1VFSA 1MXGA 2AGTA 3TH6A 3NQEA 3DGRA 3Q67A 1L9WA 3DYOA 4WGXA 3W70A 1IWPA 1Q66A 3VCNA 3WNNA 1W3TA 3NA8A 1TTIA 3GG0A 4Z2HA 1R30A 2G4FA 3RILA 4LEFA 4UWMA 1UQYA 1OX4B 2QKFA 3DECA 1TE6A 4QQ3A 1XBVA 1A5CA 2Y6ZA 3VVGA 1LQ2A 4OJYA 5I09A 1MEHA 1TUFA 1K9TA 4GGHA 3GXIA 3TTEA 3VI2A 3ZLHA 4AD5A 5HOSA 3UFYA 2J8GA 1QHOA 2CC0A 4XZIA 5I6SA 3CH9A 1QRQA 3VNIA 2Z1WA 4UTWA 3ZJ6A 3WLKX 4JKKA 4N2YA 4Z2IA 4HOZA 2WKLA 1HKMA 2A7RA 5AYYA 1UZDA 4FX6M 4CNUA 1SFTA 4IG2B 2ON3A 1MW0A 2XIJA 3CHCA 1GUVA 4F66A 4H83A 1FH7A 2PU1A 2QCDA 3HURA 2BVTA 2INFA 3I4EA 4UCFA 2BTMA 2E5BA 4H6RA 4OOUA 4E38A 1GJPA 1TA3B 3UA4A 2FGBA 2OX1A 3IJQA 4BR1A 4AVNA 3RCYA 3F1QA 3T2QA 3PWIA 1JCJA 3WBAA 2GGIA 1C9WA 1J12A 3WQ4A 2C8NA 1QXLA 2IPJA 2AL2B 3OP2A 2ZX6A 4RUBA 5FAJA 1QW7A 1T7LA 3CMGA 1E73M 4UTKA 4G7FA 3SECA 2QMKA 1QPRA 4MY8A 2PGFA 5HQMA 4A2SA 1I2RA 3V18A 3WMBA 1BXCA 3PZOA 5BXSA 4ES4A 2YPIA 1JYNA 5I3HA 4NZFA 3I6EA 5AECA 1ZJBA 4V27A 2G95A 1JRCA 3KZSA 1FCVA 1O12A 3UWWA 5LA0A 1OCQA 4F0RA 4WY0A 2WC3A 4PFMA 2XG9A 2Y62A 2PWUA 1OC5A 5LKYA 1H11A 5C7VA 2F61A 3C8NA 1LOSA 3IANA 1A5SA 4QFUA 3KBNA 4PCSA 1OFEA 3A6OA 1GEQA 1FDJA 2X2YA 3QLDA 4JTFA 4B4FA 1GVYA 3ZJ7A 3WJYA 3ARQA 2AQOA 4XIMA 4CN6A 2R94A 4D8LA 1RD6A 3EX2A 1XBYA 3STPA 3E9AA 4PH6A 1HP5A 3MMWA 2PGRA 4GZJA 3UWVA 1K70A 4EWND 1K8ZA 3TXVA 2ZYFA 3BSHA 3A9BA 3SAZA 5CAKA 1N8FA 1QT1A 3ELFA 6REQB 1CB2A 3EPOA 5A6LA 1RK6A 4OWGA 4DAFA 2PDGA 3VIHA 1TVPA 4DPPA 4LWWA 5LHFA 4XTIA 4BCEA 1W9BM 5I3IA 3ITVA 1NDZA 3UW6A 5HUOA 2BSLA 5DCEA 2NV9A 1V02E 2GDUA 1ENUA 1Z89A 3TJLA 3OGVA 4DHGA 4HU8A 3WJSA 4AQLA 4EACA 1QW9A 4W5ZA 3RM4A 4JTHA 3KW3A 3ATYA 3SRKA 1SGJA 4CD5A 1UKQA 3N29A 1JULA 1SZGA 3GB6A 3NQGA 2PP3A 4DO6A 4DJFD 1OYAA 2O4QA 3IAQA 4FMVA 1JZ7A 3VIPA 5HUPA 4C6EA 4ZE5A 4WD0A 1J96A 1PXGA 3KBJA 1S38A 4GKTA 4RX0A 3T7VA 4CNTA 3GVQA 1LM1A 1IIHA 3CL8A 5AVNA 5AHNA 3VKDA 4W5UA 2PDUA 4KCUA 1BG9A 2QS8A 5JBEA 3S2MA 5H8MA 2NWSA 5GJNA 4N7QA 3I3BA 4ERIA 4YTTA 1C9DA 2V5KA 3PC0A 2VXNA 5ABFB 1DORA 1W0MA 3UNTA 3B0XA 3UPWA 3C5QA 3DX5A 4D1IA 5GNXA 5I03A 1H51A 2P5NA 3KL0A 2AAMA 4DBSA 4GI9A 2F7FA 3PVFA 4PUWA 3PWGA 4LVBA 1F61A 4QIUA 9XIMA 1OK4A 4TVDA 1MQRA 3AMGA 1E71M 2EF9A 2J7GA 1E0XA 1PB0A 4HNTA 2GSEA 3BE7A 4O16A 2Y7DA 3GTIA 3IUHA 3M0KA 2Q8LA 1ZLPA 4LYRA 3HA1A 2DZAA 3LV5A 1E0WA 3D6NA 4O8RA 4PRRA 2BB0A 5B7YA 3NZQA 2QJGA 3TAOA 5C55A 4GNKB 3WMLA 4PTNA 3WQWA 1TWDA 4GXPA 3VOHA 4GOAA 3NR0A 1ZJAA 4FX7A 1C3FA 4AMCA 1P1MA 3S47A 4BI7A 2W91A 1I0BA 1KV8A 1ZBVA 4MJZA 2Q8XA 1EWDA 1H50A 3R58A 3NCOA 4HU4A 1J18A 4PMUA 2ODOA 1C91A 1J0YA 3STEA 4IHCA 3H70A 1PO9A 4Y9OA 2Y85A 3MSDA 3VMPA 3FNDA 5AC6A 1U1UA 1IXQA 4ZMGA 4YJ5A 3S1XA 5DMLA 4J3TA 2ZVIA 3N9SA 3JU2A 3S6DA 1SMDA 1GZJA 1HO1A 4MSSA 2YXXA 1A5AA 4NAFB 4EPEC 1DL3A 1Z8AA 1A47A 4WGHA 4FXSA 1K8XA 4XZMX 4LAMA 1VCGA 3F4VA 2FB2A 1XD0A 1CLXA 4I9JA 2HEJA 3KRZA 3GO2A 2TYSA 4Z1AA 3NO1A 1KFLA 1N82A 4PULA 3WBEA 4IZGA 3N19B 1GG0A 4H04A 2W79A 3ITLA 3L4VA 2XHYA 5K2ZA 1DKWA 4JX5A 4A3YA 3EWDA 2EBNA 1XCFA 3EXTA 2JALA 3TU9A 1QFEA 3WQ8A 2J7EA 3NIYA 1CW2A 3QVQA 3IACA 4M19A 3QHMA 4UTFA 3HMCA 1TELA 4DO7A 4YXGA 4ML4A 3S3GA 1M68A 3E49A 2YB4A 2P10A 3GW0A 3O9NA 2A79A 2ZUWA 1EH9A 2VOTA 2VTFA 2CW6A 3ICJA 1NH6A 2XN1A 1QNOA 4ICCX 2G37A 1GW1A 4Q32A 3E6EA 1WZLA 1Q6FA 1OIFA 1KXHA 3WN6A 2GJNA 3PTMA 4EXAA 4P7OA 4W7WA 3ZYZA 4S2BA 3BUVA 3CL6A 4KRUA 4CNSA 4NP7A 3W87A 2ACQA 2I17A 4PCPA 4GH3A 5ABHA 1W9UA 3DOPA 2OKTA 3B97A 4IFRA 1JCLA 3VD5A 4EWJA 2DZTA 3ZR4A 5FACA 3PJXA 2DY3A 1TJ0A 1JL8A 2GVJA 4C1NA 2I57A 3QF0A 4XBSA 2OWXA 1ZL1A 4PSPA 5DFAA 2I9EA 3H7UA 1CXIA 2YL5A 3UQNA 4O1CA 1PWMA 2NLYA 3LZ3A 5AC5A 3LRMA 3MWCA 3C0SA 4HA4A 2AKZA 1XLHA 3TKFA 2OZTA 3VC5A 4KFPA 4O1FA 4H6QA 1KBLA 4IUOA 1SJBA 3HGJA 3WUBA 1EC7A 3CEUA 1VQTA 3OODA 5BMWA 4IIEA 5TF0A 3MU7A 5KITA 2Z26A 5AYBA 3GXDA 2OZ0A 3O6CA 1AL7A 1RUSA 1PE1A 3VD3A 2HK0A 3HPSA 1YE6A 1L8PA 5JVLA 5JU6A 2HXUA 1TV7A 1X96A 4JY8A 2VVNA 4RCXA 3SY5A 4Q6JA 1W3HA 1QHPA 1SJAA 3S2JA 3UG4A 1FWGC 3EEGA 1TJ2A 2WVSA 4FIRA 2E4TA 3KBSA 1QK2A 2YW3A 1TPWA 5J5DA 2P88A 4F0LA 4GHRA 4RJEA 1Q6QA 4QE5A 5I3DA 5IBXA 1P5BA 3ITYA 2ZA3A 2DU2A 1OYCA 3VNZA 4M6UA 2PDPA 3UT0A 3F2CA 4GNVA 1WNOA 3GH4A 3KFTA 1I9CB 4I7UA 4DYKA 2Q6ZA 2HTMA 3QGAC 1ZB5A 4OBTA 2A7NA 3TYUA 4MWAA 3RLUA 1CI1A 2VZOA 2DZBA 3KOZA 5H6HA 1HQTA 3U2OA 4ZXLA 4H7ZA 1KCLA 1RJRA 2RJHA 2YLAA 4O4WA 4RE2A 5J04A 1SPQA 1LORA 3AMKA 3O0FA 5A8NA 3LI0A 1D3CA 4U2YA 4QITA 4QEHA 3P6LA 1XC4A 3O16A 2RDXA 3AIUA 3NOYA 2ZBTA 3ZIZA 7TIMA 2W67A 2Z25A 5HDRA 1M7OA 3LCHA 2W3ZA 2YW4A 2VX6A 5I3JA 2GUBA 2E09A 2PTZA 4A6GA 1EB3A 2CU0A 4RPPA 3FJ4A 5CQ1A 4JL2A 3FKKA 1B4EA 4UQBA 5M17A 1K77A 4GJ1A 3LG3A 1NSJA 1CT5A 2QVNA 3PAJA 1W1A1 1W1ZA 4HSHA 3W75A 4CLMA 2PS2A 4F79A 3C3UA 4A8LA 3VFCA 3IGSA 2PDXA 3ABSA 1HNYA 1TPDA 1G69A 2VC7A 4ERGA 4QJ5B 4UFIA 3FOKA 3ZOAA 4FF7A 4RK8A 1AA1B 1AMYA 3DC0A 1WBHA 4GIAA 5LYRA 1XKJA 1FRBA 4UFMA 2TAAA 4FZIA 2VFEA 5AFDA 1UUQA 3KLLA 1O5RA 2F38A 1JUKA 1FTXA 3UESA 1XIDA 3SN0A 1TPFA 4LY8A 4KS0A 2V2DA 3ARSA 2WNQA 4L6OA 4R53A 4HJWA 5DO8A 4XBJA 4ICMA 2O55A 3I6RA 3VIGA 3O1NA 1VEPA 1Q2RA 1E9IA 4TQTA 2YBUA 4JTGA 2NQ5A 4Z1YA 1B3WA 5EMJA 1EKOA 4JXCA 4Q4KA 3PK7A 1OBAA 4UQCA 3KLKA 3WCZA 3QFEA 1NWUA 6A3HA 1M53A 4AW7A 1UR4A 5JH1A 4LTSA 1CGVA 1QPQA 2BY2A 4PMVA 1G4PA 2V5JA 3MPGA 4E5TA 1MQQA 3R0UA 5J8LA 5KSWA 3GAYA 3CTLA 4C6QA 4CQCA 1QOXA 1KO0A 1XLMA 4S3GA 4LCSA 3ANUA 3AOFA 1CLKA 5A8PA 4JX4A 1V7AA 1EC8A 4J4KA 2PTDA 4S3KA 2WKJA 3VTRA 5HNRA 3E5PA 3NM1A 5C7HA 3BG3A 5KZDA 4Z2JA 2WBGA 4RV3A 4JTQA 5I5RA 4D8AA 2H9AB 3C2OA 5CZSA 1M01A 1KC7A 4HSOA 5M5DA 5MHBA 4Q4PA 3FK4A 5M1TA 2BHYA 4M5PA 4WOZA 1XRFA 4NXSA 4DBUA 5KTLA 4LANA 1RR2A 2CZ5A 5HK4A 1B2YA 1BLIA 1V6YA 3TSMA 2OEJA 5B80A 3RX2A 3OU8A 1IF2A 1VFHA 1GQLA 3V5FA 3RYSA 3T07A 3S2LA 4MWAD 2E6FA 3TONA 4GXMA 4C6PA 1R9ZA 4UFKA 1QTWA 3LHZA 2FZ9A 3KL5A 3W73A 3A3HA 1YPXA 4H41A 3WNLA 3EWWA 1DWIM 1WZMA 3EB3A 3UGVA 4KEMA 5DX7A 2ZUSA 4HVXA 1J8VA 1EL3A 1V8EA 4FNRA 1O5XA 5HJXA 2PDMA 2CLIA 3EDJA 5CC7A 4Q8VA 2ZUMA 3ABRA 4FR1A 1G9HA 1FWIC 1PS9A 2C13A 4O52A 1AW5A 5A8OA 2Z27A 4P8VA 4HK6A 1E55A 4Y8EA 1UKSA 3SBFA 2CZEA 1S2CA 5DXYA 2V3GA 1Z3NA 1XHGA 1XUZA 3NL2A 4BQ2A 4W7VA 1JXJA 1OG6A 2WVVA 3W28A 7CGTA 4AD1A 2J13A 4RW3A 4X61A 1H5YA 3OYXA 4C60A 4MB3A 4UNIA 1ZPTA 1EYEA 3SQSA 3WUEA 1ODUA 2QPUA 2TMDA 3T0BA 2QCFA 2EG7A 1Q4WA 3GHUA 3RO8A 2Y5EA 4NNAA 3BMVA 3AYRA 1XBXA 4O15A 3ZQ9A 1TUXA 4Q4OA 2E9MA 1JRBA 1LRQA 1P7TA 2I7GA 3KBVA 5H8PA 1PTDA 1FFQA 2WCGA 3TCSA 4FXFA 1TZZA 1XLGA 2CWNA 3RLVA 3ZJ8A 3BAJA 5F2MA 4Q4MA 1UWUA 2G3IA 2WHJA 5BNKA 3AXXA 5FF0A 3N2TA 4O18A 3QR1A 3TZFA 3L2MA 2FLIA 3R0KA 4JQ3A 3PHAA 1QPOA 5HJLA 1MWOA 2BVYA 3HIJA 3VDBA 5A8GA 1XIFA 3AC0A 5E93A 7ODCA 2BG5A 4PMJA 3KBMA 4FO4A 2PZNA 4B91A 3AXKA 2ACSA 1HX0A 4H9MA 1V6WA 3ABQA 3L68A 4NJHA 4D9PA 4HHHA 2X09A 3ISIX 3B9AA 3VGDA 2X16A 3NQDA 3C52A 1B3YA 1H1NA 5RUBA 3GVGA 3GBDA 2DW7A 3E0FA 4IP7A 4LX4A 2XGIA 2A7PA 2ZRXA 3HQOA 4FNSA 5DY2A 3E38A 4JNYA 3EKGA 3MW7A 2DPEA 1PYMA 3PZTA 1UD4A 3CWHA 1R0MA 3V5OA 1CENA 4Z2GA 1U5HA 1D8WA 1JPDX 4LAUA 2P3ZA 4HJFA 3WJXA 1WZAA 1VFUA 4AHOA 1EIXA 3SRDA 4E2OA 3ENLA 1IEQA 1RA5A 2PDWA 1JI1A 1C7SA 3WLJA 1YKWA 1UR2A 1W37A 1X1NA 1FDZA 5C9RA 1U5JA 1KTNA 3U57A 1DQWA 3NZGA 2QUMA 3TFXA 4XAZA 1EO5A 3IJDA 3PP7A 3TC7A 3VNKA 3WFZA 4H8UA 3PPCA 4LYQA 3SY1A 1YHTA 3DKLA 1OWQA 4ATDA 4ACYA 2J7BA 3GDRA 1OVDA 2F2HA 2QUNA 1RBAA 1UIPA 2Y8VA 4B2DA 2IKJA 1TRDA 3ANYA 4LUJA 4ORIA 1RV8A 1EJ7L 2W61A 1J0JA 3TX9A 5LGZA 3AIEA 1JPMA 3BZGA 5LIXX 5MKGB 3N14A 1VKFA 2G3NA 3M46A 1RQHA 5FJIA 4US5A 4YIWA 4OU1A 1NJJA 4WDTA 4OBRA 4Y6GA 3GU2A 2FFIA 4Q8QA 3CUFA 4E3TA 3A22A 3TQPA 2PTXA 2W62A 3GFZA 3KDOA 2ZOXA 4K8EA 4HZ8A 5HPOA 1F3EA 2ZUNA 1OX6A 2G41A 1ZAJA 5ECUA 3WL0A 3ZFHA 1FP8A 4N4PA 1WKYA 1RY0A 1GVRA 4H1ZA 1T8QA 1QI3A 4XZBA 1NQKA 3DI0A 1JZ4A 1SFSA 2VENA 4U33A 4LVAA 1G4SA 1PBGA 4Q8TA 1ME7A 4JDBA 3GVWA 2X0SA 3AICA 3W7DA 1JI2A 4F40A 1WKFA 4M81A 5CXPA 4KGLA 3TV8A 2UY3A 4IMDA 3QPZA 5CZ0A 3NZ1A 1M9HA 1Y5XA 3LRLA 3SRFA 4ZOCA 1YE4A 1RK5A 2A3BA 3W2NA 3A9IA 3AIBA 2CFFA 1I2PA 3MI2A 2PF8A 1VZWA 1KXQA 2V5LA 3TN5A 3CNYA 5L9FA 3LQGA 1KBKA 4GY1A 4OQVA 1X6NA 4R88A 4K2SA 2BY1A 3UGRA 4J3WA 3VZZA 5AC7A 3SURA 5BXRA 1EEXA 4PMZA 5D2XA 1E6PA 2VELA 4LRTA 7XIMA 1QK0A 5C71A 2CLMA 1BFNA 1QUMA 2RHGA 4XKYA 2V38A 1MZHA 3RX4A 4RV8A 1MVYA 3U6WA 3OZMA 3LTPA 1J11A 3QW3A 4C90A 3U4FA 2E8ZA 3ZLGA 4Z2LA 1NF0A 2WPGA 2WNWA 1VFFA 2F6XA 1P43A 4P8XA 3EX3A 2J66A 1R86A 3AXHA 1E0UA 3THDA 3D46A 1TX2A 1KTBA 1IT0A 3N2CA 2WWCA 5T91A 1B5TA 4DZHA 3KX6A 4OVXA 1QASA 1Q7QA 3LBCA 4XAGA 4HBKA 4MOZA 3QHNA 5FJJA 1H7XA 2BP1A 5FJRA 1BGAA 1DJNA 2REQA 1SFLA 4WJ8A 3QY7A 4DRSA 2OSXA 1KB3A 3VOGA 2IXVA 3TMLA 2VGBA 4HMCA 3G1RA 4XUYA 1J0ZA 1UPMB 4R33A 1UUOA 3W74A 3FVMA 1B3XA 1E56A 4GVGA 3DHDA 4C6JA 3P80A 2DP3A 1ZAIA 5AHLA 4QLJA 2HXTA 3W86A 2HE5A 3UBPC 3W7NA 5BWAA 3BQ6A 3S5OA 2W0UA 1UZ4A 1GVOA 3WY1A 3R7MA 1PWLA 1GZGA 4GQGA 4B2DD 4TX9A 2WJFA 3G1XA 4MYXA 3OTRA 4QCEA 4CVUA 1E9ZB 3MSRA 3NAVA 4UMAA 1HKVA 5ABTA 4WDUA 2QW5A 1KQZA 3LPOA 4JFTA 3UF9A 5JUVA 1L2QA 4WVXA 4FNTA 4V1XA 3VCCA 4AXNA 4DWSA 3TLQA 4D6DA 3SCQA 2WK2A 2IQTA 4AF0A 2VUNA 3ZMRA 1KTCA 4U31A 4WUIA 4AZ6A 4BZYA 4YMZA 3NURA 1OCJA 2PRHA 3VDGA 2RJGA 4J3ZA 3WUGA 4MHBA 2D23A 3BW3A 4D6FA 1TV4A 4JIIX 4DYEA 5FEXA 2OB3A 1OX4A 1IZJA 1VCFA 5DCBA 2CERA 3T0CA 3WDRA 2DFAA 3T08A 4C6MA 1XCWA 3OA3A 2ZX5A 3VKAA 3VGHA 3W71A 4MNLA 5T8GA 1M65A 3F4NA 3RF9A 4NZ5A 1MXSA 3AUJA 2XH0A 1VFLA 3O0KA 1F5ZA 1VIWA 4HIBA 4EKJA 4K8GA 3CYVA 4A4AA 2F2KA 2Z1KA 2IPGA 3AISA 3LK6A 1WDPA 3VDCA 4O50A 3G1AA 3K46A 3MDWA 4DI9A 3W7GA 2BXZA 4H9TA 1V6XA 3W4RA 4NF7A 1SSGA 5A2CA 1UH4A 3TCEA 2IW0A 4IG2A 2VD8A 3CQKA 5H8UA 2VQUA 4C6KA 1JIBA 1MEWA 2OT0A 1OB0A 3CC1A 4M80A 1KXVA 5I02A 1Z69A 3TVAA 1VR6A 1XLAA 3A4WA 4A8IA 1CDGA 3WBWA 2XFWA 2A1YA 2BGNE 5K3VA 1E6NA 1JG9A 1X97A 1TA3A 3PAOA 1NP2A 3UJSA 4S3CA 2VFDA 2X30A 2E40A 3P3BA 2OGYA 3H6OA 5AKQA 4ZFCA 1HGWA 2JQXA 4X2PA 3W1AA 2NSXA 4H2HA 1E1EA 3PSWA 1S1RA 1B9ZA 2AL2A 4AIEA 2Y1HA 3FLUA 2CBJA 4RXGA 4F0MA 4PBGA 1WUEA 4D6EA 3S83A 1H7WA 3JW7A 3FDGA 2J62A 2DJXA 3L2IA 4NILA 2YJQA 2W4XA 2XSAA 2QIWA 1KQYA 3GD6A 3WLMA 1L2UA 4PTMA 3T9PA 3LENA 2Z6JA 1ML1A 2E68A 3NDZA 4DJDC 4JY9A 2CYGA 1PX8A 3VFLA 2V5DA 5E9XA 2J9YA 1EZ2A 1R3SA 1WUFA 3ITXA 4MDOA 3TSDA 3KCOA 1IXOA 3VUSA 1YW1A 3O7UA 5A2AA 4XAPA 4HYWA 3LBOA 3B40A 1K8CA 4Q7BA 3AWOA 3CMJA 2GQ3A 2NVAA 1E4NA 4XD5A 4NNCA 4P8WA 1J79A 3QYSA 3B0PA 5GJPA 1W32A 3WSUA 3P74A 1Q8AA 5SWUA 1E0TA 3C0LA 2OG9A 4C5ZA 2VCBA 4JIRA 1Q3NA 3C56A 1KM5A 3GIYA 3DAQA 3GHSA 1XDMA 4GABA 4YWSA 4DWSD 4GK8A 3E0IA 6REQA 1KFJA 3MKVA 3THQA 2OYMA 3E02A 1MXDA 1LT8A 1XLLA 2QT3A 1NAL1 4MFEA 4IMEA 4QS6A 2FPTA 3WDQA 3PNUA 3L5LA 1A0EA 3WQDA 4AZGA 5KZEA 1L8NA 2GUUA 3EBVA 2O9RA 1JCNA 1FCUA 2VJXA 2ZUVA 4ROQA 2A3LA 3PZUA 4REQB 2IKIA 3HG2A 2WC4A 2C0HA 4UTLA 1A0DA 3QMTA 2EPKX 4QAIA 3GU9A 5XINA 1TWWA 1UD8A 5LNUA 4LVGA 1W54A 1BTMA 1K9FA 4XO6A 2JFEX 1E43A 1FWJC 2E5DA 5BMXA 4GXWA 1L6GA 1A4LA 2YIHA 3RMEA 1PZ3A 1SZFA 3L9CA 3GKAA 4PMYA 3LYEA 5FEWA 4OZOA 3F03K 3PG9A 1TMQA 1EJTC 2ZC1A 4LV9A 1FCBA 3OGRA 1WDDA 4R3UA 1X1OA 3AZRA 4YWIA 1TV8A 1DBTA 4XZLX 4IPJA 3AUOA 1HTIA 3LPGA 4HTBA 3FV9A 3W3OA 3GG7A 3IK2A 5PTDA 1Q2SA 3UCCA 2V63A 1Y5WA 4Z0SA 4HPNA 3S1WA 5ABFA 3N6HA 1PAMA 3T4CA 5AZ1A 5DMNA 5AHIA 4AD2A 4HYRA 3MI3A 2WSPA 3K8LA 3BK0A 2O9OA 4E8GA 1W9DM 1D7FA 3CZEA 1X6LA 3BARA 3HGRA 4MDPA 2PDLA 4Y2WA 3WFLA 4L1XA 2BGQA 2VZSA 4GO9A 3U5YA 3WQPA 1CECA 5E5CA 3RG6A 2CZFA 4JQ1A 5FESA 5BU9A 3OLDA 1SVDA 4AEFA 3O3RA 3GWQA 1O68A 1NWTA 4U5KA 3OIXA 1XG3A 1XF0A 3P14A 3N2MA 1IZCA 1H62A 3RJYA 3S4TA 4UR7A 3AIVA 2QIIA 3NZPA 4AY1A 1QO5A 4HHLA 1XIMA 4H4IA 2HQAA 1OHLA 2D2JA 2ZQ0A 3U7BA 1BF2A 3TEVA 1W31A 2QCHA 3WJZA 2VC5A 3DFNA 3ID7A 2A0NA 3QQWA 4KESA 3U9IA 2BNJA 3N4AA 3GH7A 1S5MA 3OOQA 1TZ7A 4V28A 4HZMA 3MKKA 1CLVA 4Q3MA 1R38A 2RUSA 4O13A 4NJJA 3FYPA 1HKWA 5JBFA 1VRXA 1XX1A 3BLLA 3WF3A 1E6ZA 1XYAA 1J6OA 1US3A 2BWGA 3GK0A 1H61A 3E96A 3KHDA 3IIXA 5A6JA 2DUAA 1Y8BA 3OZPA 5AHEA 4CU8A 2YXGA 4X60A 1DJXA 2D20A 2A6NA 3S1GA 3TIMA 2V6AA 3GW3A 4NAFA 5HQLA 1KFEA 4AZ5A 4XWUA 3NPWA 1AJ2A 2Q3RA 3LZ5A 4OV4A 4C6BA 2O9TA 2D2GA 2EKGA 4PE8A 4D1JA 2CLOA 1EA0A 4H6KA 4YVPA 3A23A 3UP8A 3QN3A 2XFYA 1QBAA 5CJNA 2TRSA 5CPSA 2A3AA 4JEJA 2HVMA 2VGFA 3C2FA 3T42A 2C18A 1ISYA 3VGEA 1J0IA 1MQPA 1XFBA 4F2TA 1C8YA 2FYMA 4TTGA 4Z2KA 3DG7A 3OHMB 1UOKA 1AZ1A 2F6KA 1OEPA 4DELA 4DJDA 1WE5A 2NVDA 3W00A 3QKEA 4J7RA 2NW0A 3GNPA 2P50A 2NQZA 3USZA 4ENLA 1BAGA 1KR1A 1YDNA 4NZ4A 3V35A 4PTVA 4MM1A 4LAZA 3V5CA 2QGYA 1DWFM 1IWAA 2J7FA 1ZJIA 3C2RA 3VKBA 2VDIA 1W2VA 4Z17A 4H8HA 4IPNB 5AZ0A 4GYJA 2ISSA 2Z0IA 1EX1A 2X1IA 1EJVC 1LG1A 4S3AA 3NQ2A 3URNA 1DJQA 5HINA 1N8IA 3CMFA 1QPKA 1JD7A 3EX4A 2AKMA 4NZCA 1KRAC 3M16A 5G4HC 4IISA 3BCFA 1YNYA 2CLFA 3VILA 1YNPA 3TNBA 1R3WA 4PYSA 3CTTA 1C90A 4D6GA 2PLMA 3P7YA 2A2IA 3TW6A 2ZC8A 4YLWA 3A13A 2ZRVA 4MZYA 3UJEA 2AOSA 1OG0A 5HMSA 1UKOA 3DCPA 3N13A 3TW9A 1JYWA 3A21A 3GNXA 3VC6A 4DUXA 3W07A 3C0JA 4I9AA 1JGIA 3GTNA 4AZCA 4QG9A 2UY4A 4GGBA 3DFSA 2VMFA 3ATZA 4XO7A 2HVOA 4LOCA 1KRCC 5J5RA 4PUJA 4J5NA 1TPH1 4JL1A 1C29A 3KE0A 1BYAA 3LOTA 3BLPX 3L4XA 1MEIA 3RCMA 3REQB 4LW7A 3QTGA 3SIMA 3D0CA 2NLIA 1HF6A 1VHNA 2VRKA 5LIYX 2FJKA 1UMLA 1BWVA 3WD2A 5A1AA 1PSCA 2J78A 3KUMA 4LNCA 4JHZA 3T44A 4CN1A 1X7FA 3A5VA 3VMNA 4NXKA 1UWQA 3UY7A 1OJXA 1BKSA 1E0VA 3N11A 3ZO9A 4XZHA 1JEZA 2VFIA 3G0UA 1GKPA 4WKAA 3OVPA 3POHA 3BJTA 3PBMA 1R85A 2PCQA 2UV8G 3EMQA 5IFTA 1KFKA 3LCXA 1QPNA 3QZEA 3M0IA 1KGWA 2BS9A 5CSYA 2HNEA 2ZE0A 4ADSA 4O4VA 3DHFA 1H7RA 1XIBA 2EAWA 1CCWB 4QR6A 5C9ZA 3VGBA 2DZSA 3JZUA 3ARTA 3SCWA 3UZZA 2WMIB 1E40A 1RPXA 5CG0A 3LNMA 1SO6A 5I2UA 3R1ZA 3CT2A 1TKKA 2XPKA 1EBHA 4DPQA 4GQBA 1X7IA 1HXJA 1JD9A 1V0LA 1WDWA 3D3AA 4C6LA 4LYPA 1JCMP 4YTQA 2WM0A 2DUZA 1PKMA 1Z9AA 2WJZA 1GVQA 4QM1A 1KWKA 4MB5A 1FWNA 2C15A 2Q8ZA 4N9EA 1SM9A 3HOJA 4QNEA 2E1DA 2W9MA 4EF9A 2ISDA 4XD4A 3EDKA 4A05A 1YDOA 3AU6A 3DIPA 1GPFA 3QMSA 1J93A 4P8UA 3DFTA 2OZ3A 2DT0A 4D6JA 3V3WA 5CPTA 5F4WA 2GOUA 1I2NA 2V69A 2DJLA 3GVRA 4MY9A 4LVDA 4DN1A 1OGGA 4GCAA 3AI0A 3C3NA 1EQPA 1OFPA 3NL5A 3GC4A 1EP2A 1LOQA 4WKFA 4RZ5A 4HZ6A 4IF2A 3BLKA 3MUCA 4V1YA 1POJA 4A21A 1EX5A 4NKCA 4Y8FA 3S5YA 2O92A 1I4NA 4QDWA 4PBEA 4N6FA 2ZKMX 2YFNA 4L7ZA 2AAAA 1OINA 5LSMA 3B05A 1E9LA 3M0MA 3DI1A 4XSLA 3CZGA 1UWTA 1OT2A 3N2OA 1DIDA 1OSEA 4JAWA 2ALRA 1VLIA 3AMDA 3CO8A 3W27A 1JPIA 3H24A 2C19A 4QP0A 3TR9A 4TV6A 2VZTA 2I14A 3N4FA 3ZVHA 3H7VA 2D24A 4B5UA 3DZ1A 4LUTA 4LC8A 3T0TA 2OTDA 1RCXB 4LB3A 4UFJA 1EPXA 2F9RA 2WSRA 3W7KA 3KCJA 1QDSA 2D0FA 1OYBA 3H2MA 1TMHA 4TV5A 3T1GA 2WWDA 4PTDA 3CQ0A 1XYFA 2VEMA 4O28A 3H2EA 3WQOA 4HN8A 1SZNA 1VP5A 1HL9A 3ZR5A 2RAGA 4JQ4A 2B31A 4WY0F 4JFUA 2H9AA 1UKPA 1HGYA 2H3BA 3E2SA 2UZ9A 2HV5A 3WH8A 1IXNA 3PJUA 1DJZA 4HQVA 1KLZA 4OBSA 2CBUA 4CD6A 3RGTA 2UY5A 3TMQA 4PCFA 3ZM8A 3CB8A 1UCWA 3URQA 2QPXA 3AIWA 5G1TA 1ISWA 1EDTA 1BSIA 4W85A 3WD3A 4W93A 3BAYA 2IQ0A 3AHXA 2J6VA 3NM3A 3VNLA 1A5NC 4JS3A 4D72A 5CLTA 4BQ5A 4U4MA 4WLCA 5A94A 2Z28A 1IQ8A 2GWNA 3G1FA 4UTHA 1U33A 3NQCA 2INZA 2FPVA 4ATLA 3FVDA 5CKSA 5D30A 1UIOA 1PZ0A 3LRKA 1BRLB 4A8RA 1W1PA 3UPBA 2FTWA 5A6MA 1A4MA 1RZMA 3E5BA 3ZR6A 1WAWA 3G22A 2PRLA 3NL3A 2C1HA 1R2TA 1U1JA 4NY2A 4FLRA 1V6UA 2E7FA 1GQJA 3M07A 1J6PA 2I5QA 2E5CA 3C4UA 3STGA 4HHMA 1K8YA 3LI1A 2YB1A 4Z08A 3TDFA 2H8ZA 3M0HA 3UXLA 1A3WA 1UQZA 2YZ5A 3VGGA 2ZZ5A 3W7CA 1XH2A 5EMKA 3VM7A 3HTWA 4GQRA 1G0CA 4YCOA 1U1HA 4JTIA 5GNYA 2WMJA 2XN2A 3CQJA 2WHLA 1TG7A 2H6RA 3FS2A 5G2IA 1RD5A 2VGGA 4S39A 2C1GA 1VFMA 4GYFA 3ZVIA 3ORWA 1YPIA 4OUIA 3C2EA 1O5KA 3GIPA 1PUDA 3VOFA 2G4JA 2FGLA 3P60A 1OCBA 5D04C 2E9BA 3V16A 1POKA 3OJGA 4L9ZA 4HHPA 1UR9A 2NZLA 3NXFA 3GYEA 3GS6A 1RHCA 3BSMA 4PSRA 1OGBA 3NQMA 4K36A 1LBLA 1UA3A 3MBFA 2ISFA 3LN3A 1ITCA 1Q8JA 1F3TA 2VRJA 5LXXA 4KRTA 3KVJA 3FXYA 4U3AA 4CKQA 3LCIA 2BASA 4EAMA 2POZA 1JUBA 2YCJA 3NXLA 3N12A 3T40A 4JFVA 4B9ZA 5F7UA 4EPDC 4NX5A 2QJMA 3W1XA 2PAJA 1RXOB 1AJZA 4AVFA 4JZ5A 2OODA 3R43A 4KCVA 1Q65A 3K13A 5MF5A 3T78A 3E2RA 3GTHA 4QE4A 4E8DA 2OOGA 2EPOA 3BOLA 4GQ0A 4PN2A 1D9EA 2PDBA 2VR2A 2YX0A 4FEZA 4JFWA 3BDKA 4ZO6A 3S5ZA 2WO5A 3GU1A 3UEQA 4K39A 4IMFA 3IGHX 2D69A 2DGAA 3KM8A 3CT7A 5U7SA 4QAWA 1UROA 3IVSA 3F5LA 1L6YA 1HG3A 4NSBA 1I2OA 2WVTA 2ZZ6A 4DJFC 2FKPA 2PD9A 3M6YA 3VIOA 5IHRA 3BVJA 3O2LA 2B7NA 2ZIDA 4UTWC 1P0KA 1GVSA 2FTYA 1FWEC 3EXSA 1EUNA 1A80A 3IWPA 8XIAA 5DN1A 4NYYA 4ZQPA 4JIEA 3T2PA 1FHDA 4M82A 1NDYA 5ENLA 2ZE3A 3PN8A 2QCEA 2QDHA 2NQJA 1FWFC 4J27A 5H91A 4IP4A 3MUIA 1JF5A 5C8BB 3TN3A 1HIZA 3NO5A 3G1HA 3AJ7A 3UYCA 3L2LA 5LIKX 3LV6A 4N9CA 2VX7A 1BTCA 3GG8A 4JQ2A 4X0VA 2YA1A 4D6IA 3AMLA 4KEUA 2IKHA 1GOIA 2X7WA 1K7FA 4BEUA 2R14A 2D0GA 2QCDB 4NL1A 4CD8A 3URAA 3MHGA 3W37A 1GTHA 5TBOA 4BWLC 4YHGA 3DFYA 4O12A 4R9OA 5C2CA 1KM0A 1M7JA 3TQVA 3H4WA 1O4UA 4L61A 2QJNA 2XVNA 4J2PA 3O6YX 2ZX9A 2ZRYA 3MY9A 1LWHA 3ANVA 1VAHA 2INEA 3HFYA 2ACUA 2HMCA 3BURA 3OZOA 2C7FA 3CAWA 2B7QA 3T6CA 4NASA 4J3SA 3BCJA 3FX4A 2TPSA 4M1RA 3MCMA 3BLOA 1T5AA 2NVCA 1XH1A 1JYVA 3QPEA 1C93A 1CGXA 1AVAA 2VWSA 3SIZA 3PF3A 3IV8A 5DMYA 1GW9A 2ACRA 2QR6A 3MCOA 3LHUA 1JR1A 1YXDA 4UFHA 2VDGA 4ZZ9A 5B7ZA 1DE5A 3IK4A 3HBLA 1ZY9A 3L4ZA 4MB1A 1TV5A 4LQ1A 4WZHA 4WY0B 1LTDA 5A8QA 1X8CA 3L66A 1T96A 1XPYA 4M7TA 2XVPA 1UC4A 3H21A 4QSFA 4W7UA 3N2BA 3MV01 3CAKA 1R7AA 4AZ7A 3IUDA 3TOYA 2Y2WA 1Z48A 3UG5A 3LGEA 1XGDA 3PFRA 2NX1A 1V0KA 2WLYA 3IJIA 3L0GA 4HK7A 1FWWA 4S2CA 4UQDA 2PWHA 2V67A 1HJXA 4CQDA 4J40A 1M3UA 1FWTA 1RSCA 1CGWA 3LBMA 3QQ0A 3FCPA 3TZNA 4CCCA 3I3DA 1W3KA 4MKSA 1QBBA 2JF7A 2J4GA 3R89A 3ALFA 1WB0A 1HO4A 2XSXA 1ISVA 5A6TC 3L21A 4QQUA 2XGZA 1Y0EA 2VX4A 1FP9A 2Y63A 3CXOA 3FEQA 3LDVA 3PBWA 2BODX 3GUGA 1RJPA 1YEYA 3SCOA 1AL8A 3SUTA 4BY3A 3RIKA 3HPAA 3TJ4A 1Q6LA 5JQ9A 5D33A 4AHPA 2CHNA 1DWAM 3MUY1 3WYZA 2OGJA 4LV4A 1AD1A 4ZBCA 3LHYA 4FLQA 1CXLA 3LD5A 1UD2A 2HCVA 2ABBA 1OT1A 5I0DA 1V3JA 3WF1A 3D3FA 4B3KA 3LCWA 2WC7A 2HZGA 4TIMA 4S3BA 3UJ2A 2X1SA 4ZENA 1AODA 1E4LA 1ZCOA 1XPGA 1HN1A 3TW7A 1UH2A 1XD1A 2ALDA 1C7TA 4ZL1A 2QUTA 4WJEA 1W91A 3CUGA 1AQFA 2ZUUA 2Y61A 3G0XA 2VX5A 5FA5A 3PY2A 4FALA 4JHOA 5HMEA 1E70M 7PTDA 1VPQA 3WELA 3N9RA 3GG1A 1UW9A 3ARRA 4ASTA 3KBWA 3FAWA 3GSMA 4BHYA 4R27A 2BXVA 2DT1A 3FIGA 1JCYA 1GK8A 3MVIA 3M1ZA 1OFOA 3EDEA 4X22A 4GACA 3S42A 4GX8A 1KKOA 5DT7A 4DO5A 3L0KA 2GGHA 1OF8A 1IGWA 2FVMA 2PFHA 3C2YA 3TFCA 4DJFA 3DBPA 3EA3A 2VEGA 3P5ZA 4IJRA 5HULA 5L6UA 4WDWA 1BVNP 2YA0A 2V82A 1UOZA 1WPCA 1LLWA 2CWXA 1N2VA 2GL5A 1P0EA 1H2JA 3VU2A 3NDOA 1PX3A 1OK6A 4ZTYA 2FFCA 1EZWA 4Q4RA 3ZZ1A 3TA6A 1W1YA 5I78A 4BFAA 1VEMA 4L9XA 2VCCA 1TYGA 4IMAA 1Q6EA 3DFOA 2QCCA 3N04A 3KEHA 1ADDA 3WQGA 3ARUA 4ZXOA 2YDQA 2J24A 4O10A 3LLXA 4HN4A 3CIVA 2JK2A 1IEVA 5HMDA 3OO2A 3WMSA 4UTTC 2R1LA 3WLSA 3TYEA 1DXIA 2YKKA 1RBLA 1F6YA 1RQBA 3QQ1A 3I10A 3SDOA 3POCA 3SM0A 1LP6A 5D4YA 1XRTA 5D05A 2ZXAA 2AGKA 4QSHA 3JZEA 2D1ZA 3GDMA 5AYIA 1UR1A 3FKRA 4KIRA 4BWLA 1AFSA 2VURA 3TWAA 4BF7A 1W5MA 3BAWA 3PPHA 3WNOA 1CNVA 3SGGA 3LA4A 1WQ5A 2CEQA 1K02A 3QOMA 4ERAA 1SFJA 2GYIA 2QJIA 4ZO7A 5DEZA 3OEXA 1TJ1A 4F2UA 1XIEA 1DIOA 3PJTA 7REQA 4JQAA 4OTKA 5EKYA 2DZPA 4JTJA 1VB9A 3M0YA 4RDWA 3HJEA 2QCLA 2OLAA 2VEFA 2GDQA 4FF5A 3P61A 3MWAA 1BG4A 1UHVA 4UIOA 3MO4A 3IRSA 4GYKA 2V68A 4DVOA 3L5MA 3T2OA 3RFAA 4M29A 1ZBCA 3HN3A 1WKDA 1IEIA 2X42A 1DIEA 1A5UA 3PUDA 4LSBA 2PC4A 3AYSA 4JNMA 3SCNA 1X1ZA 3SGUA 1JZ5A 3QPYA 1UBPC 5C0QA 1ECQA 2QCNA 5HQEA 4IIBA 3EWZA 3WH9A 2BVWA 4L4LA 2QGHA 2PB1A 4L6DA 5E0FA 2CLLA 2DORA 2YCEA 3UA3A 1A50A 1UJPA 4C1LA 1JCTA 4W4QA 3LLDA 4N9DA 3BZJA 1X98A 3ABXA 4R7JA 1DJGA 1ZBKA 2FZNA 4S38A 1O66A 3RRAA 3IJLA 4IP5A 4DWDA 2WMKA 3LX9A 3BV4A 1NWSA 1KD0A 3DEQA 3AALA 3VOCA 2PZ0A 2PURA 4UZSA 1OY0A 2V0TA 3G1VA 2FQIA 1DEDA 1PTGA 1VBRA 4PA8A 1RQEA 4LFYA 1HKKA 1XLKA 2AQVA 4WQ6A 3W7QA 2DV0A 3UERA 5HMFA 1LYXA 4C1NB 4REQA 1QWKA 4GUFA 1KGXA 2GLKA 3EPNA 4HMEA 2PODA 5I24A 4C7FA 3LXAA 5FAGA 2YCLA 1X6UA 3R4IA 3TTQA 2G3JA 1GOXA 1V3HA 2PA6A 4O0KA 3N17A 4IL0A 1IR1A 1VBHA 1XRSA 4AISA 2GQ9A 2PD5A 3UZWA 4R34A 3SQLA 1RPKA 1NFPA 5M3WA 2W92A 4ZA0A 4JDYA 1US0A 3W22A 4AIOA 3HQPA 2X40A 5IBXC 3NVTA 4H3DA 3CZ8A 1HVQA 2BFGA 2GZXA 3TAKA 1LBFA 1PCKA 4ROPA 2DH2A 5FKYA 2QVHA 1R3QA 2G8ZA 4JN6A 4B9YA 1VPXA 3RX3A 4DJEA 4WK9A 3UWQA 3SCSA 3PR2A 4ZCWA 1OIMA 4AAJA 1XFCA 3TK7A 4QDMA 3OLGA 1KM6A 4MWAC 1Y7VA 4XQ6A 3MI6A 3CQHA 1ME8A 4QROA 4J35A 4G5DA 1V51A 3TQ0A 4JICA 3EOEA 2FH8A 3DYMA 4Z1BA 2GSHA 4RKAA 4F2BA 3S2NA 3QMRA 3AAMA 4AEEA 5HAOA 3UNDA 4ECLA 5DXXA 2D3NA 5IXEA 5EU9A 1PKYA 2FHCA 3JUGA 3RMJA 3WMCA 4XVEA 3FSUA 3WG6A 4N4QA 2QPSA 1XIHA 4DB7A 4E2VA 2PDKA 5LNRA 4WR3A 4AIUA 3WQ6A 1JZ2A 2BOFX 4C6OA 4LBSA 3N2XA 5CBBA 4DQWA 3LTSA 1T0OA 2PWFA 3TA9A 4KMQA 9XIAA 2EHHA 2VDHA 4HPXA 2OQHA 3IUIA 3N4EA 4B16A 1F4AA 4R9XA 5F1VA 3S9YA 1KCXA 2IKGA 2WSYA 5DLCA 4U5IA 2E8YA 2PUZA 3G2GA 2YCKX 1P6BA 3MUXA 1Q6GA 1X39A 3R25A 4MZ1A 1ONXA 5DELA 3QFWA 1LG2A 3MJYA 2J6XA 4YYFA 3HPZA 2CHOA 4N02A 2Q02A 4TX8A 4J3XA 4F8XA 1A49A 2X1TA 4JGDA 5FSDC 1XJBA 4GLEA 1OFBA 3UWUA 2OQLA 4LYKA 5A6AA 1G67A 1DPMA 4KH2A 4ADUA 3QRHA 3GNDA 5IDZA 2I56A 2Q3OA 4AG0A 1JF6A 3MQTA 4UTTA 2D2HA 3D5HA 4UQEA 3HGOA 3PUGA 1P6WA 3WEMA 4O17A 3V36A 3KL3A 1UB3A 4W89A 1GOKA 4FR6A 2W5FA 2YCIX 3JRKA 4E4PA 1TCMA 3ES7A 1V08A 5JBDA 3TROA 2CHRA 8TIMA 1DP0A 2SFPA 3G77A 1FHUA 3HMJG 1KR0A 5AOUA 1QW8A 2DQXA 3LEPA 3R8GA 3VE9A 1I60A 2PDQA 3A5FA 1FCQA 2CBVA 4D6HA 1JZ6A 3GTFA 2EPMX 3O8AA 3ME3A 3C2VA 4RZ4A 3TLLA 3B8VA 4ZO8A 3Q58A 1EGMA 4PUNA 3WQCA 3EKZA 5AYZA 3L4YA 2ISWA 3T05A 3LHTA 2ZZ2A 1H09A 5KINA 1YXYA 2AMGA 3APGA 2ZUTA 3KOFA 2HBVA 3CUHA 2BX7A 3WL1A 3TWBA 3C61A 2DSZA 3P81A 4TX6A 2ZRUA 1FHVA 3H4XA 4UXDA 4Y9NA 3SGZA 1W5OA 1WDRA 4F0SA 1PIGA 3M7WA 4V2XA 4I8YA 5I3FA 4MMWA 5AB3A 2VEKA 3NTYA 5G1MA 1KA9F 3M5YA 1TTQA 2IS7A 5A6BA 4AD4A 3VUPA 5D9MA 3F5KA 1RVGA 1Q6RA 1YTKA 4DJED 3TTSA 1EYWA 4GG9A 4PMRA 2VYOA 1EF3A 4RZ6A 2NT0A 3LCGA 1BYDA 4J2MA 3W01A 1GWJA 1ZGDA 5HWJA 4IX2A 2HK1A 1FFRA 4CEXC 3THUA 3MC5A 3CO4A 3P82A 3G1SA 1F2JA 4MKVA 3LGDA 3VAVA 4XB3A 3JR2A 1K3UA 4IUGA 1GNXA 2EPLX 3RPTA 3UZJA 3VPLA 3H12A 4TTUA 1OD8A 5C5YA 5T9CE 2XU2A 1GJUA 3LM7A 4JD4A 4RDVA 3ZWSA 4KETA 3NYDA 4TU1A 2VEIA 4AMAA 3E0VA 4MKNA 1XV8A 1S39A 1SSDA 3FHAA 3OPSA 2ADAA 1YNQA 3REQA 1MSSA 4NNBA 4O54A 3IRDA 3B8UA 6CGTA 4G6CA 3CEPA 3H2FA 4Z42C 3W29A 3TR2A 1UWIA 4HB7A 3DKJA 4NHVA 4HU3A 3NDYA 3N18A 2YSWA 4DIAA 4PCNA 4C6FA 4UNKA 4YTSA 3L67A 4UOZA 1MW3A 2F6UA 1B30A 3GXPA 1KNWA 2EG6A 3WBXA 4E2DA 1R2SA 2VZUA 2QDEA 2CKSA 1R47A 3OVGA 1VBGA 3CAVA 2VEPA 4RNHA 3EPMA 5HR6A 2ZCGA 4YN5A 1IT7A 1MO0A 3BG5A 2GSJA 3LCLA 2J79A 3PBUA 4JOMA 3CK5A 3PUOA 5DBTA 2PLKA 2GJLA 5JMUA 5JH2A 2H90A 5FF4A 3GX9A 4JTTA 3W38A 2WMIA 2FJUB 4MPQA 3MA8A 4G2DA 4EXQA 1QATA 1TVLA 3U48A 2X0YA 3WD1A 1V4YA 2B7OA 1K7XA 3TYBA 1K6AA 1XS2A 2ASHA 1Y65A 1A5BA 2EQDA 3BOXA 3FFSA 2FZDA 2WBKA 3GE7A 4W84A 1R3VA 3URBA 1W1TA 2DT3A 3UWZA 1KXTA 1XYMA 4WSJA 4BI5A 1V6TA 3KVMA 1K4GA 4LEQA 3UVIA 2E9LA 3QV7A 2R6OA 4HSNA 4NZ1A 3SQMA 3N6JA 4A22A 3L5AA 2VNCA 3OIHA 3VCRA 3P84A 4QX4A 4URIA 4UOQA 4LB4A 4QE1A 2G97A 3QLLA 3UU0A 1E6XM 4UQAA 1XLJA 4QXIA 2OX4A 2DEPA 3BV7A 1K7EA 1F8MA 2V3DA 3O05A 3MHUA 2Y8KA 4CQ8A 4ZGYA 3BSGA 2EKCA 4IPPA 3SZ8A 2HJPA 4K37A 3W7PA 2WZEA 3R5EA 1WA3A 3EB2A 1GG1A 3QV6A 4ONVA 3CAQA 5A6BD 2XZ9A 1Q6DA 3P8IA 3NEVA 3LQLA 2E3ZA 2ZVRA 2RFGA 4FLSA 5I3GA 5FEPA 3LHWA 3OBAA 5FEZA 3WK1A 1OC7A 2C14A 5I23A 3MTWA 3U7VA 4H6EA 1V02A 1WXJA 2J9XA 1DV7A 4UFLA 4GVIA 4AC7C 3CUIA 4IQJA 3MS8A 3W72A 1DHKA 1B3OA 3LY0A 1M04A 5HR7A 3QYQA 1TPVA 2VT0A 2VWTA 3P8JA 1BVWA 1W8GA 5XIMA 4FNQA 5LIUX 3INPA 2GJXA 4RNIA 2FMNA 3VIFA 1FWRA 1A5OC 3PJWA 2PRMA 3QTPA 2PTYA 1HFBA 4DZ5A 4ZQNA 4QS5A 1ELSA 1GONA 1XBZA 3S1VA 1S2TA 3YPIA 4F3HA 3GLCA 1A5MC 2VKZG 3O6AA 3TE9A 1KWGA 3V1HA 3WH5A 5HWMA 3OG2A 4ZEPA 3SCRA 4LH8A 4MFDA 4QTGA 3GXFA 5FI8A 1VHCA 3WKZA 1Q45A 1OFQA 3WENA 8CGTA 1K03A 4GUHA 2YBTA 5E6ZA 1GVIA 3QR3A 1T8XA 2Y5SA 4CQBA 4GZ7A 1ZU8A 1I0DA 4MJMA 1ZBWA 4PODA 3WK2A 2R1PA 3DGBA 3ARVA 2R1NA 3O63A 1PEZA 4Q7IA 4HOXA 1R3TA 4GJIA 3SJNA 2QAFA 3W7JA 4MLJA 1YBQB 2WMFA 5GPRA 2XVKA 3ERPA 1H3GA 2ZZ3A 5LHEA 3L65A 5DF0A 2OLSA 1RP9A 1LUCA 1PV8A 3LLFA 4LNYA 8XIMA 1IE7C 2C91A 2FDMA 4H8VA 3MHFA 5A69A 1BXBA 2OEKA 3BG9A 1BRLA 1WDSA 1S2AA 3U0HA 1MUWA 5HJYA 4FS9A 3W0KA 2Z6IA 1YDVA 5FJUA 3BJSA 2WANA 4UZUA 1JNEA 3LTYA 4WIWA 1G4TA 3LXBA 1WBJA 3VD7A 4F4RA 1OX5A 2ZX8A 4AUBA 5D37A 3W6YA 1EP3A 5AHFA 3RU6A 2DVUA 3CL7A 4CEUC 2PSNA 4KEVA 2VCAA 1CZ1A 3LSBA 3HZ3A 2D0HA 3DYPA 4TO8A 1P0BA 3OGSA 1F7BA 1VYSX 3MZ2A 2V9DA 2EO7A 3FA4A 5TNVA 3ITTA 1NFBA 3B06A 4IT1A 5BW6A 1N7KA 2GK1B 4AFYA 5FF3A 3CUJA 5REQA 4FK9A 2GVEA 1JPKA 2ATMA 4A29A 3ONCA 3E12A 3ZJKA 3GNOA 4JN8A 4JNZA 3M5ZA 1PL9A 3SN4A 2QUVA 4X2RA 1PCWA 1YADA 2YYUA 2V30A 4RLIA 4XBKA 4KQNA 1R5YA 1SUXA 2JEPA 3G0SA 3RHGA 4AVOA 1Z6KA 1XGEA 2PDCA 1J2WA 4HPJA 3MP4A 1TQXA 3WBYA 4O57A 2QF7A 4P7NA 5EYWA 2QCGA 5F4SA 4UBPC 2V2CA 4IGHA 1CXHA 1D3HA 2WXDM 2REQB 3PZIA 1V7YA 3USBA 4O0QA 2PMQA 2PF0A 3WEOA 2NX9A 3BW4A 3THCA 4Q4QA 1MZRA 4NX0A 4JTSA 3PS7A 4ZB0A 1VPYA 4JEQA 3E0LA 1CBGA 1PDZA 1E1CB 1QJWA 4HT3A 1TV3A 3WH7A 4L80A 1EF2A 1WAUA 1B3VA 3SRHA 3QV9A 4G7EA 3NSMA 1RAKA 1LL6A 5HNUA 1XLIA 2XH2A 4DWSC 5G4EA 4CD7A 1X38A 3NQBA 3B9EA 3EEZA 4Y9AA 1XCXA 2JKAA 2PBGA 5HWNA 1SO3A 2VP8A 1HUVA 2CCRA 3L0NA 3OA5A 1TRIA 3VNYA 4AHQA 1KFCA 2UBPC 4Z1CA 4N9BA 2V2HA 5H1WA 2PI6A 2FH6A 2XH4A 1DWJM 3ZXWA 4KWVA 5BRBA 1U5VA 3FA5A 4JPGA 4Z0JA 5G2WA 1VJSA 2FHBA 4X9YA 4HNLA 3MSYA 4W8LA 3VDHA 4GI6A 4MUZA 1VBJA 2KAUC 5EFDA 4Y7EA 3FDKA 3W1QA 5CSUA 1H7PA 3VD9A 4EIVA 1LWIA 4IQLA 1AG1O 3F4DA 2YGYA 3CASA 3NGFA 2A6LA 3VO0A 4JIHA 1XLBA 1XLFA 4LJ3A 1LLOA 3NSNA 4QLLA 1UA7A 4BEQA 2HPMA 1C8XA 3P5YA 4PB4A 1X8FA 2QCMA 1MFVA 3K4WA 2PTWA 4IMCA 1GORA 4XD6A 2VGIA 2PDYA 1QU4A 3W25A 1S3HA 3LM3A 2NV1A 1R9YA 4AWUA 1QWGA 3P2VA 4M7SA 6PTDA 3VKCA 2ZXBA 4J3VA 1WXZA 3AHYA 2HS8A 3AMCA 3T81A 4B3LA 3RU8X 4B15A 3I7SA 2DW6A 1HZYA 4U10A 1AK5A 1PVNA 5HA7A 2XDFA 3EWXA 2WLZA 2NUYA 3V75A 3XINA 1NDWA 3L4UA 1QNVA 3IVUA 3QHOA 4KWSA 2H8XA 5CZKA 2RGMA 4E8CA 3AS2A 3P93A 2CZVA 5I77A 1OC6A 1IWBA 1DJIA 4O11A 2RH9A 1UWRA 2G96A 3IIVA 1DOSA 1R9XA 3WEZA 4O0ZA 5LIWX 3FY1A 3U2ZA 4HTYA 1XGZA 3W6MA 1JDFA 3H53A 3XISA 4O1DA 1OABA 3TYCA 4L1WA 1EJRC 2E6DA 8A3HA 5CBIA 3EX1A 4CQ9A 2E1WA 4GY7A 4MWAE 5FJOA 3KTCA 4KGJA 3ONBA 3TC3A 4IFKA 1LJYA 1M03A 5CBJA 4GISA 3VIIA 4NI8A 1BGGA 4GC4A 1EHAA 3QY8A 2GGEA 1XIJA 1I75A 1VYRA 1RCQA 2IXUA 2PDJA 1R3RA 3W24A 3SY8A 3NQ6A 1WCGA 5BCAA 3TNOA 4GYPA 3GR7A 5BOFA 1EP1A 5CGTA 4Y90A 1NOWA 3QZ6A 4DUWA 4KFNA 5CPLA 5CG7A 1FWHC 5CPMA 3UWEA 4XX6A 4GFSA 3SN1A 4J1OA 3SFKA 4BA0A 1DTNA 3TOPA 3A4XA 5I00A 3H23A 1HW6A 2XWDA 3H4GA 4WCJA 1O60A 1ZENA 2Y7GA 4W88A 4LC6A 4WSKA 3SCUA 3DG6A 3GBEA 4KWOA 1XIGA 4MAVA 1EOMA 5K4XA 3STCA 4J28A 3RR1A 1F4HA 3S6TA 4GKLA 3WNKA 4LGXA 4I6VA 1MDLA 4LY4A 5DY3A 4NJIA 5AY7A 4XVDA 1EFZA 5LGXA 1DQXA 2FGZA 4IPIA 1H4PA 3FHQA 1HKIA 2XYLA 4XAFA 2HVNA 1MNZA 1K1DA 4JN7A 1A5KC 4CCZA 1FH8A 3PG8A 4NUWA 1XYCA 1TIWA 3FSTA 2QUUA 1IT8A 3CU2A 2ZICA 4B90A 6XIMA 1PIFA 3VX1A 1Z44A 3EWBX 1LQAA 3TTOA 5G5IA 1MMFA 5ABEA 4UNLA 2A5HA 4MB4A 3UY8A 1XKYA 3HQ1A 2XZ7A 3CB3A 4FSAA 2GQ8A 4FIQA 1DJHA 1EJWC 4AYGA 1QAPA 3M47A 3QOKA 4DX3A 1ZP3A 3Q94A 1ZSXA 1GEHA 1RVKA 4LT9A 2KZHA 3IPWA 3AS1A 3OG3A 3F5JA 4B5NA 3UR2A 1G7VA 4A3RA 1JQXA 2HDJA 3DDMA 5HNTA 3AXIA 4L5ZA 3CJPA 3WFAA 3RCNA 1V3MA 1LRTA 1V03A 3M0XA 2I5GA 1JXKA 1AUSL 4G1KA 3MUZ1 3T4WA 1GOQA 2EJ1A 2R91A 3W2LA 3MO7A 4TVCA 1ZNNA 1U2YA 4G8TA 4JYFA 1IZKA 2ZZ1A 3BICA 4RXFA 3GM8A 4C5YA 2DZXA 1R87A 2X41A 3QC3A 2BZNA 4IJCA 1GPWA 2EEXA 4GI4A 5F2LA 5D09A 2J27A 3KOXA 4OOZA 1GOMA 5HXMA 3N3MA 4L4MA 4LCRA 2I16A 2ZTKA 4AY7A 3KAOA 2DSWA 4EPBC 2G5WA 1EXPA 4OHQA 4RR4A 4DY1A 1V77A 5D9PA 1B31A 3PBYA 3PULA 2FZMA 2PDIA 1SZRA 4HNVA 5FL0A 4V33A 3VZXA 3WDIA 1N55A 4K8HA 3KOYA 1P48A 1QVBA 3MKCA 4QBXA 3S6OA 3F2DA 3QKZA 5G2HA 4B3ZA 3B9OA 3PB2A 3P67A 5JXQA 2PP0A 1FXQA 1R6WA 1F05A 1YTEA 5K9DA 2QJHA 2CLKA 2YLLA 1KLYA 4CNNA 1TJRA 5CZTA 3SO7A 4GA8A 2HE8A 4IMGA 5BXTA 3RN6A 1EA9C 2C79A 2FMOA 3FN9A 3E3HA 4EOUA 5BOOA 1VGAA 2QDDA 3H54A 4AWTA 3SCVA 1V3LA 3IGXA 2RKXA 1EOKA 3BPWA 3Q45A 2ZRZA 4MY1A 3OBKA 4NAEB 1HVXA 2WQPA 4IIFA 2WW5A 3F7JA 2ANUA 2OR2A 3U8GA 5BWFA 4HCDA 1UP0A 2PDNA 3QZAA 5LNWA 2CNCA 2BY3A 3B8TA 2Z1SA 1XC6A 1ZZMA 3UCDA 4ZSUA 3CS2A 3WNMA 1YXCA 4DBWA 4B5TA 3AYVA 4K7VA 3PZQA 1NOFA 4X63A 1CGYA 4XISA 3TN4A 1GJWA 2V5CA 2G3FA 3AQUA 4JYDA 2DZWA 4GH1A 4IX0A 3DFPA 5KEZA 3PNZA 4BI6A 1J5TA 1UPPA 2VC6A 4KERA 1K4HA 1H0IA 1CPUA 2Y24A 3E1F1 3ZT7A 1MI3A 5IRPA 1ICSA 4PB3A 1CGTA 5D2VA 1SZEA 1Z41A 5DT5A 3AS3A 2A3HA 1MW2A 4L4PA 4M8UA 2HSAA 2HWGA 1HJQA 3CLWA 2DUXA 2QHAA 1EGZA 3THAA 4RNFA 3BLEA 4E3VA 3HB9A 2XSBA 4ACZB 3L7RA 1NFGA 4RE4A 2PU0A 5U4NA 4ZB5A 3VIKA 4M3PA 3V0UA 2A21A 4TOQA 3KWSA 4I5RA 1JVNA 3EDFA 5K9CA 3DG3A 1Q5MA 3G18A 4FNUA 3R11A 2OKOA 3L23A 2OSWA 3H2AA 3R79A 4C6CA 2QQ6A 3AIQA 1E6RA 3LU2A 2Z4GA 3PPGA 1TWIA 5C2GA 1UUMA 1KM3A 5GNZA 3S9ZA 4AD3A 4GPNA 3VZYA 3Q37A 5D9OA 3BLIA 3VA8A 1OGSA 4LUYA 3S5SA 4QNWA 2AL1A 4CN4A 1W3JA 1RJQA 5E0KA 1YRRA 2GPTA 4JIPA 2WZHA 5EMLA 2HRWA 2PPGA 3UWYA 3KVKA 5D2YA 3UZXA 4H19A 3FYYA 1FX6A 4P7RA 2FZ8A 1EHNA 1M7XA 4EVZA 3WD0A 3KCLA 1XYLA 5ECVA 3HG4A 4F9DA 4DI8A 3U2EA 2WZMA 1JZ3A 2WHMA 2CXEA 4A8NA 5BU6A 5FF2A 3M5XA 3DXIA 4AZCB 3LMYA 4CGTA 2NWRA 4KWUA 2YFOA 2J7CA 4FA3A 4U3CA 4JR5A 3UPMA 5I7GA 1W56A 1Z7AA 2DZUA 4GZEA 3GUWA 1XI3A 2GFTA 4DNMA 3ZS4A 3AWNA 5LNVA 3W83A 3WDHA 1O7AA 2GWGA 3NQAA 1E9YB 3N73A 3RAOA 9RUBA 4M6QA 3H2CA 3UJFA 2KX9A 3BGJA 1FDYA 2OQYA 5EBAA 4R85A 2R9RA 4ICNA 1ESWA 3NPXA 4O1AA 2R1MA 1AH4A 3FGCB 3WK3A 4M6PA 4XZNX 3RPMA 4W87A 2GGJA 4HA1A 3TYZA 2AMXA 1MYRA 2J7HA 4G1NA 4OIFA 3PTKA 4JHMA 4NJKA 4E4UA 3CLMA 4GRSA 1W5QA 5GJMA 4M51A 4AZIA 3M6DA 4US6A 3BH4A 3RO6A 4AX7A 2O0TA 2YDSA 2Y70A 2YL9A 2X1UA 3IEBA 5BYWA 3OBEA 1JFHA 2Z29A 3S2CA 4WJXA 1W1VA 2R1KA 2ZZ4A 1EBGA 3EWYA 1OD0A 4Q8UA 4F48A 1QNQA 1V3IA 2JKPA 2TSYA 3LSCA 3SR7A 3GXNA 1XLEA 4Q8MA 4Y9PA 3GIQA 2VD9A 4K68A 1KRMA 2QV5A 3IGUA 4GBUA 4DEFA 1OZQA 3BGGA 5D38A 4FXRA 3W88A 1R3YA 4FX8A 4QRNA 3PM6A 3IAPA 4EAYA 3B0YA 4ZR8A 4WOQA 1GVEA 1KFBA 1XLDA 3SUUA 3P62A 1VFOA 3VXGA 1FQ0A 3NVDA 3IV3A 3KOWA 3UD6A 4Q7NA 3G3MA 4FP1A 3OQEA 5D2WA 5XIAA 5KZMA 4H9ZA 4XZ9A 4S1FA 3CBWA 4PMXA 1XM3A 4H00A 2VHLA 3O6DA 2JEQA 1G6CA 4Q6XA 2P8BA 4DBEA 5A6KA 3VABA 3CIXA 4GBDA 3B9NA 5EMUA 2FZBA 2BOEX 1UD5A 3B03A 3ARZA 1UR8A 4PRWA 1KBBA 3CV6A 5I79A 1QI5A 1Q4NX 3NSXA 3ITGA 1XW8A 2DQWA 1E15A 1TV2A 1Y5VA 1Q7MA 1QOQA 4MIMA 3T0AA 3PB0A 4RDZA 1QNPA 5FSEC 1YLVA 1ZS2A 1YIXA 3ZWTA 5D9NA 1CX9A 2J74A 3EYPA 4KRZA 2BDQA 2OWCA 3A4JA 3ZVHB 4RZBA 4LUTB 2HROA 2WJEA 3FEMA 1THFD 5C54A 4UQ9A 3HPFA 1IIGA 5FL1A 4O1BA 2OO6A 3OB8A 4RDYA 3N15A 4K1GA 2Y8UA 3MMDA 3PZMA 3GDTA 4KFOA 2MANA 3NQFA 2IPFA 3U3HA 3NQ8A 2GOKA 4TUFA 3W1NA 3WQFA 2FPYA 1W2PA 1UYQA 4MLRA 4EXBA 5D8ZA 4CCEA 3K5XA 4FOJA 3AO0A 2XINA 1H5VA 5A95A 3I6TA 1ZALA 2VC9A 3WO8A 3SCTA 4H7CA 3BC9A 5DRIA 3EZ4A 4PFHA 3K4AA 4D6CA 4DXKA 1JGMA 3VMOA 1UWSA 4UTMA 5I07A 3CPRA 3UXIA 2DZVA 4INFA 4LUSB 4C6NA 2XTKA 3WF0A 4GINA 3KRSA 3T09A 1BVZA 3W7MA 4MTVA 3PPFA 2Y4SA 4HMNA 3KVLA 1H7OA 3CHEA 3KHJA 4QISA 1NU5A 5EY5A 2CKRA 3D47A 1US2A 1CWYA 3MJMA 1ZRQA 2FB3A 5C70A 3GHRA 4QG8A 4I6KA 1EC9A 3XIMA 3TJXA 1HT6A 3SADA 1YMYA 4MNMA 3S46A 3DBNA 4LF1A 1LL4A 4IPLA 1KM4A 4GIEA 2GVGA 1W1IE 2DSUA 3B8DA 3HU7A 5KMYA 3EXRA 1EQCA 4CNPA 3MV11 4OE7A 3V0SA 1OFDA 3S0CA 4TVUA 4GVHA 1XL9A 3EAUA 2Y89A 1DJYA 4HYVA 2WCAA 3OZYA 3UG8A 3W76A 3AS0A 3B4UA 2P76A 3EA2A 2CLPA 2XIQA 2P53A 4BKNA 5CSSA 4PC8A 4GMEA 1F73A 1VRDA 4UCGA 2BXYA 2WAGA 4NQ1A 4ADTA 2DSVA 3LPPA 3I3EA 1XSKA 4M0XA 3A3XA 3R8RA 4E2BA 4A35A 4UR9A 5E0CA 2PWEA 1A53A 1PHQA 1FHLA 4ZOBA 3VNJA 3O07A 4H9YA 4Q8WA 3GZAA 4AX6A 4M1BA 4C6DA 2QLYA 2ZRWA 5A8MA 1CXEA 3K1GA 2QXWA 2D22A 1AW1A 1UP3A 3FJNA 1IV8A 4QGCA 3IJ6A 2PCEA 1AW2A 1ITXA 1S5WA 1LOLA 1XISA 4O1EA 4AZBA 5AVHA 3CWNA 5CGMA 2YXOA 4JX6A 1W3LA 3VNDA 2WSKA 3CHFA 1PZ2A 1UR3M 1CXFA 1SU5A 3GZ3A 2GDVA 3QW4B 2GVYA 2WNNA 2VUYA 5IFPA 1DTUA 3RUBL 1ZP4A 2F84A 4J9JA 4NVTA 1TVNA 4I3GA 5CSRA 4OECA 1BYBA 2PC8A 3OLIA 5TAOA 1NARA 5CZJA 4GUJA 4NU7A 3E2QA 1JDEA 4S3DA 2CXGA 4ZOAA 3GYCA 3SUWA 1VYPX 1XYZA 4XSMA 4KF1A 4EK7A 4DUOA 4ALDA 4IXXA 4QLKA 4DO4A 1KRBC 1T99A 4PUMA 3E74A 1AJ0A 4LRSA 5C9UA 1P1XA 3W1UA 2PDFA 1ICQA 1XXXA 2Z00A 4N6EA 5FOOA 4TMBA 2J47A 1REQB 3IIZA 2YBVA 2L5HA 1XG4A 1BQGA 1S2VA 1VH7A 1BF6A 5M03A 3EMCA 1I6NA 4LS0A 4B92A 4PGLA 4BF9A 2LLEA 3BJFA 1F3XA 1NTHA 2C0AA 1TWZA 1U30A 3GR8A 2O9PA 3C6CA 4R5EA 3ARYA 4WHBA 4PL1A 3U2CA 4GVFA 5GVJA 3GFXA 2WV8A 3B8IA 2V3EA 5CLWA 1JFXA 3V7PA 1UD6A 1CYGA 1BKHA 3QGKC 1TZ9A 3Q65A 1FXPA 2YA2A 4LBRA 4HOWA 1YQ2A 1QR7A 1H41A 5C9WA 3W6LA 4IM4A 2OPJA 5BROA 1I1WA 2QYGA 5BRPA 4WDXA 3BQ5A 1ICPA 2FVLA 2XH7A 3TUUA 2WJDA 5TD4A 4JTRA 1E1FA 1HKJA 2JIWA 2ONEA 1M5WA 4QJ3B 4GC3A 3T8QA 1VC4A 2NUXA 3G6MA 5AYXA 3B04A 1K9DA 3SCPA 3FXGA 1SO4A 4TXEA 1YBQA 3G8RA 2EPHA 1WP6A 2VQTA 4IXHA 1E4IA 4FHAA 2UWFA 1O5QA 4JCLA 4EANA 4QG6A 1DIKA 2NT1A 3UCQA 3MDUA 3DERA 1OCNA 1TTJA 3ECQA 3LHVA 3CV7A 1S5TA 1SO5A 5D2TA 1L6FA 2NSOA 2TODA 5HNNA 3N1AA 2ZWYA 1RCOB 3BWWA 4EE9A 4F0KA 3VIJA 1KKRA 4MYAA 4X0NA 4CU6A 1DXEA 3WLLA 4X3ZA 1F3WA 5AC8A 3RLHA 3CV2A 3LERA 4AY8A 4H9XA 4YCPA 2J75A 4LAKA 1F6PA 2OLHA 1QI2A 5I06A 2J9ZA 1EWEA 3GHTA 1OADA 3GDLA 4WRHA 3W9ZA 4QDPA 3WNPA 6XIAA 4JTKA 3AHTA 1UH3A 2Y5JA 4S3JA 3KS5A 5FD0A 4JIQA 1DXFA 1LWJA 1SJCA 1NDVA 1BYCA 4FOUA 4Q8NA 3HM7A 3W1LA 1O94A 4DF0A 5CC6A 4C91A 4ZQOA 3HPXA 2GK1A 1W1B1 4S3EA 3R10A 3WLNA 2PLJA 3ES8A 3T8LA 1S1PA 5FF7A 3WZ0E 2HISA 1Q7ZA 4GO8A 1LL7A 3R6IA 3B8SA 1EJXC 3EOUA 1AH3A 3I7QA 2RGLA 5BXPA 5CH9A 1MRAA 4DZAA 5JIWA 1LQ0A 2BVDA 3DC8A 1ME9A 2OEMA 4RW5A 4S3FA 4ZB2A 4GCXA 2P0IA 1XWYA 3I4KA 1F6KA 1TPUA 3MSGA 2YOCA 4LUIA 1RALA 3N6QA 4I9MA 4P7QA 3ARPA 1R2RA 2YDRA 3GTXA 4JTEA 1AD4A 1LRNA 3BW2A 3W1RA 2IUZA 3KP0A 1KM2A 5T26A 3W02A 4HNUA 1NEYA 2BV9A 5D8WA 1E1CA 3G3DA 3GDKA 4C7DA 1MNSA 3AZSA 2X05A 3WLHA 2RDWA 1AQMA 2J7DA 1ZTVA 1TCDA 1W5PA 2G0WA 3APYA 4FI4A 4AWSA 7TAAA 4WXZA 2PBOA 1KGUA 3GXTA 3PBGA 5K9XA 4MVAA 4JTAA 2QV4A 3ITOA 7ENLA 3W82A 1HJWA 4HCLA 1PTAA 1YPFA 5GQBA 3LS9A 3HV9A 2CIPA 3KS6A 2ZXQA 3ZT6A 1SJDA 4HPGA 3FYOA 4QJ1A 3G8EA 5DBUA 9CGTA 3EWCA 4B4HA 1SQ7A 3LPFA 1IYXA 4US5D 3J7HA 1EGVA 2O7QA 3CHDA 1ONWA 3M44A 2VFFA 4DUVA 1RH9A 3RM9A 2ZWZA 3BOFA 6ENLA 1GQNA 5DQPA 2FTPA 4NJGA 1F07A 3AYTA 3B0UX 1SW3A 2OOFA 3UYIA 2D2OA 3H2NA 3M5VA 2A85A 4KPLA 3HG5A 2A4AA 2I9UA 2OYLA 2EXOA 3GY1A 1PYFA 3DENA 2W66A 1W3IA 3VDAA 5CAHA 2B4GA 5EMYA 1EPVA 3HJZA 1RP8A 1JDCA 4KCWA 3UG3A 2P8CA 2EJAA 1A3XA 4HNNA 4MNKA 5MKGA 1SR9A 5K7JA 1F76A 1NM9A 2WOQA 5EFFA 3UJRA 4D8ZA 4BQ3A 1F74A 1J5SA 1FY6A 3MP5A 4GY0A 3ZLFA 2OZ8A 4UB9A 1B9BA 1Q13A 2NQLA 1Z42A 3GFYA 4JBRA 3DH7A 5CPNA 1JZ8A 4RE3A 5HBFA 2BGSA 2F8QA 3GH5A 2WKGA 1ADOA 1UKTA 2OYKA 4EPKA 1XQKA 1EJUC 1UP2A 4IIHA 4P61A 3OLEA 3MYOA 2IQDA 2WZIA 1LROA 2P3EA 1T41A 1QHZA 2NV2A 1BWLA 3W1TA 1QNSA 3BLFA 3W2UA 1G7UA 1FA2A 3OHIA 3OVQA 4WEVX 2JBMA 1W9PA 4UC5A 3H8AA 2GQAA 3W1MA 3KDNA 1B57A 2P0OA 2XJ7A 1FWBC 2X8RA 3SJ3A 1GOWA 5CJMA 3HGSA 4HNOA 1PKLA 3W81A 1BWKA 3IJ7A 1XH0A 3CUXA 1A3HA 4C6IA 1IXPA 3S9IA 1FWDC 4UR8A 4H2CA 4JCMA 4YTRA 1H0GA 3ARWA 3UXKA 3TYDA 3W26A 1XICA 1U22A 5E9AA 4DYJA 1SW0A 1HJVA 4F9JA 1XR2A 5IM51 4B5VA 5C6MA 7A3HA 3R12A 4S23A 1GYNA 3M43A 4LBUA 1D3GA 1J0KA 1TQJA 1LF1A 3FJ6A 1GVFA 3ZSTA 1O6IA 2FDSA 3WQEA 4FLOA 7REQB 4BQ4A 2EGZA 2VR4A 4IOTA 1VIZA 2Z1BA 1UZ1A 1XDLA 4OUEA 5CPOA 2JE8A 3G5EA 1NY1A 3PZ9A 4P5UA 3IIOA 1M41A 4PCTA 1PX4A 2V3FA 1H60A 1UASA 3SEPA 2NUWA 3WX7A 4E6MA 2Z2BA 4GFIA 2NXIA 2DVXA 4G9PA 1RY8A 3CGTA 3G24A 4A3HA 2VRQA 3RPDA 3BANA 3NG3A 5KETA 1I1XA 2V5BA 3FA3A 2DIJA 2PLCA 3I68A 1ISXA 4RPQA 1YYAA 4CVWA 3VKJA 3WH6A 4CUCA 4C7GA 1BD0A 5D02A 3MBDA 3CPGA 4GUIA 4UMCA 4Y9MA 1EIBA 3IVTA 2V8ZA 4H8NA 3PTDA 3W7EA 3ARXA 2CLEA 1ALDA 4W86A 4O19A 5G1YA 1H1ZA 4ZODA 4HGXA 1EEPA 3UR8A 3PFMA 2WYSA 4ML9A 4NZJA 3W53A 1BPLB 3PWAA 3AJXA 1ZCCA 3QC0A 1BQCA 3VGFA 4B5XA 1TFVA 5T9BG 3EOSA 1FWSA 2H3DA 2ZA1A 1MUCA 2W6RA 1DHPA 2O4MA 1PIIA 4QJ4B 4DJEC 1PKNA 2YCLB 3OW1A 4J3UA 1J4EA 1B90A 4HP5A 2XN0A 4AWEA 4AB4A 4IQDA 5K4ZA 1NELA 5D32A 3LNPA 3CUZA 4XKMA 4B5SA 4Q4SA 4ZQRA 1B4KA 5G4WA 3NWRA 1NOUA 1G5AA 3SW6A 1MUMA 4N42A 4XTDA 3VIMA 2MNRA 4MADA 1B0IA 3BMXA 3AXMA 2PDHA 4YPJA 1IEXA 3L12A 2WSQA 4PR4A 1R7OA 6TAAA 3FJLA 1E4MM 5ABGA 2PWGA 2C3ZA 1QCWA 2E67A 4UTJA 1MW1A 5I3KA 3H2OA 3I7RA 1H49A 3WJWA 2C16A 3PZVA 3WLPA 4KBXA 4WXYA 4DBDA 4X9SA 2OU4A 1SW7A 2Z7GA 3UXDA 4R7WA 5BRQA 1ODZA 4F0HA 4GZIA 4YVXA 3IJ8A 4Q33A 4B5WA 3RXZA 2CPUA 3W7HA 3MT1A 1SR0A 2UY2A 1UC5A 3QXBA 5E09A 5CJ5A 4H01A 2PP1A 1HP4A 5F4XA 3UETA 1VJIA 3T0DA 4MJ2A 1C92A 1XQLA 3VX0A 2GJRA 2WMHA 3K8MA 3QJAA 2QEZA 3CZKA 1JDAA 3QSTA 1BHGA 2C1IA 1TMLA 4FAMA 1G01A 3W7OA 1WX0A 4RE0A 2Z7KA 4OKDA 2R82A 1E3ZA 4D2JA 4NAEA 3UXAA 3C86A 1RLDA 4LF2A 1LZOA 3B8WA 1UZHA 3GR4A 1VBUA 4DXVA 3KRBA 2JKEA 2OFJA 1F9CA 2PGWA 3MANA 4I5XA 4KW2A 4DF2A 1QO2A 2Y88A 2J8TA 5FJTA 1WO2A 3OYZA 4Z1DA 3HG3A 2DH3A 3RRXA 4YS1A 4W9TA 4POCA 3WQVA 4FNPA 4YHEA 2BMBA 3S8HA 1NWRA 3K2GA 2XFFA 1DWGM 4DF1A 1J0HA 4EX4A 4EF8A 3VKKA 1JPHA 4AU0A 1NP0A 3UVAA 5EA9A 1B1YA 1FWCC 4CD4A 1J2BA 1UMYA 3CV1A 4WF7A 3R13A 2CESA 3CM4A 3Q4DA 4GJJA 3WLTA 3AZTA 3NL6A 2BBFA 1F8IA 4DNHA 2XM2A 1E3XA 4AYSA 2WB5A 2OCZA 5F2IA 3H26A 1BXNA 5DMMA 4ZQCA 2YL8A 3R8HA 3STFA 3W84A 2JGYA 3SSZA 4LPCA 1M7PA 1RLCL 3W2JA 3UZ5A 1TX0A 6ALDA 3BL3A 3M7SA 1A5LC 4Q8PA 2XWEA 1ZFJA 4I9TA