3CMFA

Crystal structure of human liver 5beta-reductase (akr1d1) in complex with nadp and cortisone. resolution 1.90 a.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
b'DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3cmfA00
3Q65A 1AH4A 3V36A 1Q13A 5LIWX 4YS1A 3COTA 3WBYA 2DUXA 2HVNA 1X97A 4JTRA 2PDNA 4FAMA 1AZ2A 3R43A 5DANA 4LB3A 1IHIA 3WBXA 3LNMA 2ACSA 2HDJA 1AH0A 2C91A 1X98A 1PWLA 1XF0A 1AFSA 4JQ4A 3WBWA 2ACQA 1XGDA 3H4GA 1PWMA 4ICCX 4GABA 1SM9A 2PDHA 1EKOA 5LIYX 3R8HA 2FVLA 4IJRA 3M0IA 2HV5A 2IKGA 1YNPA 2PDLA 4QR6A 2NVDA 4H8NA 1ZUAX 2WZMA 3NTYA 4L1XA 4L1WA 2HE5A 3V0SA 2IKJA 3R8GA 4NKCA 4HBKA 1ADSA 2ACRA 2J8TA 1RALA 2IQ0A 3CV7A 2DUZA 2PDJA 3RX4A 1AZ1A 3G1RA 3R7MA 4GACA 3CASA 2FGBA 4Q7BA 3UZXA 3N6QA 3N2TA 4GA8A 2HVOA 3U2CA 1PYFA 1S2AA 3T42A 2PDPA 4XAPA 4LAZA 4XO7A 5M2FX 3GHTA 3LD5A 4MHBA 1EL3A 3KRBA 5AZ1A 4OTKA 1US0A 3M4HA 3UP8A 4EXAA 3V0TA 1AH3A 3G5EA 4WRHA 2PDXA 3LUTA 2PDCA 2IPWA 4YVXA 3B3DA 2INEA 4Q3MA 3RX2A 1MRQA 1ZSXA 3CAVA 4PRTA 4QX4A 4EXBA 4LBRA 4R9OA 1MZRA 1PZ1A 2IPFA 3BUVA 2R24A 3GHRA 1J96A 3R6IA 3LBOA 2PEVA 4IGSA 1YE6A 4JTQA 2BP1A 3ONCA 1YNQA 2IQDA 2PDFA 3RX3A 3CAQA 3LN3A 2I16A 4XO6A 1LQAA 3F7JA 3CMFA 1QRQA 3O3RA 2IKHA 2INZA 3EB3A 4JQ3A 4DBSA 2VDGA 2PD5A 2F38A 2QXWA 2FZDA 2PFHA 3C3UA 2HE8A 1RY8A 1VP5A 2IPGA 3LZ3A 1ZGDA 4G5DA 4HMNA 4XZNX 2F2KA 3BURA 3UYIA 2FZ8A 1JEZA 2ALRA 4LB4A 2PDYA 3BCJA 3BV7A 1R38A 2ACUA 1Z3NA 3ONBA 3UWEA 3Q67A 1T41A 1S1PA 4FZIA 4PRRA 4XZMX 4PR4A 2AGTA 4XVEA 2WZTA 4ASTA 4WGHA 2FZ9A 1RY0A 1Z89A 2FZBA 1VBJA 3D3FA 3S3GA 3M64A 4GQ0A 4FA3A 4JTAA 1EF3A 5HNUA 4QXIA 4XZIA 4LBSA 4YU1A 2NVCA 1T40A 4WDUA 1A80A 4PUWA 3WCZA 4GCAA 2IPJA 4RPQA 4WDWA 4F40A 4I5XA 4DZ5A 5AZ0A 3R94A 5JH2A 5LIXX 4XZLX 4DBWA 3FX4A 4JTDA 4AUBA 1HQTA 3EB4A 4IJCA 3MC5A 1MI3A 4PMJA 3GUGA 4JIHA 2PDMA 2PDWA 3GHSA 2HEJA 4XVDA 4PUUA 4JTCA 3UZWA 2I17A 2BGSA 3UFYA 4LAUA 1OG6A 1Z8AA 1FRBA 1Q5MA 4YVVA 3LZ5A 3FJNA 1K8CA 3LEPA 1LWIA 1C9WA 4GIEA 2P5NA 3V35A 2PZNA 4WDXA 1Z9AA 2R9RA 3DOPA 1S1RA 5LIUX 1X96A 3V0UA 3UG8A 3EAUA 1S2CA 4JIIX 3O0KA 3UZZA 4JQ1A 3DN5A 2DV0A 3GHUA 4JIRA 1ZQ5A 1M9HA 2IS7A 1UR3M 2PD9A 5C7HA 2A79A 4GQGA 2PDIA 4XK2A 4WEVX 4JQ2A 2PDKA 4H7CA 4ZFCA 3UGRA 3QKZA 5LIKX 2PF8A 3P2VA 5HA7A 5KETA 1PZ0A 3ERPA 1XJBA 3WG6A 3LQLA 4FALA 4QBXA 2CLPA 1YE4A 1QWKA 2PDGA 1IEIA 3VXGA 1HW6A 5JH1A 2PDQA 2PDUA 4DBUA 5HNTA 2BGQA 3R58A 3MB9A 3LQGA 3H7RA 2ISFA 3UZYA 4YVPA 2PDBA 4XZHA 3H7UA 3CV6A 4WDTA 4JQAA 2IKIA 1EXBA 3LENA 1GVEA
chains in the Genus database with same CATH superfamily
2W6RA 3UGVA 1PDZA 4W85A 3OU8A 3V36A 1FKXA 3R8RA 4J3SA 1YDVA 1TFVA 1Z7AA 3ORWA 2V63A 4ONVA 1X97A 2JIWA 4LCSA 1TR1A 2FLIA 4LCQA 4BI7A 3PB2A 1CI1A 4I9TA 2FFIA 2V81A 2W3ZA 1D8WA 2Z27A 1V3JA 2HVMA 2WNNA 4LEQA 4NASA 3NPXA 3GR7A 3GB6A 1XIEA 1NFGA 4O16A 1E0VA 3MYOA 3MP3A 4Z42C 4FR1A 1CLVA 1JCMP 4J3TA 4IPLA 2PSNA 4N0RA 1K3UA 4IJBA 5C7VA 4UQ9A 4AIEA 1AQMA 3IGUA 1HJUA 1XIDA 4ZO6A 3EPNA 6XIMA 3BZJA 3ZT5A 1WDDA 1UB3A 2IUZA 1EGVA 2ACRA 1E6XM 2D0GA 2YW4A 3A47A 3QJAA 3KP0A 4MG4A 4I6VA 2X2YA 1UKPA 4IF2A 1CZ1A 1WP6A 2FGBA 4H8VA 2DT2A 1EIBA 4GA8A 3F4VA 3O6CA 4UC5A 5EYWA 1LRQA 4E6MA 1YXDA 1AQHA 1CXHA 1EJVC 4XAPA 1E0UA 4GY7A 5CAHA 2X09A 4FR6A 3SQSA 1OCBA 4CCDA 2H9AB 2VKZG 1F05A 2PLMA 3CZGA 1RVGA 5G4WA 1BQCA 4DI9A 1PIGA 1QOQA 4DO6A 1F61A 1PUDA 2NQ9A 1V5XA 2CERA 5C5YA 3UQNA 4L4LA 3PP7A 1JZ2A 5AZ1A 1JCLA 3N3TA 4HU0A 3G1VA 3SQMA 2CEQA 1ZENA 4QIUA 1ZFJA 3OQEA 1QASA 3RMEA 2V5JA 3O6YX 2YDQA 4HZ8A 1BKSA 2V2DA 2QCFA 4JS3A 1EUNA 3NURA 4J2PA 2WW5A 4JTFA 4ZQPA 4TR9A 4EXQA 1XDMA 1XUUA 3AU2A 1JPIA 3GNDA 1KA9F 2ZX6A 4TQTA 3TTOA 1ME8A 2QIWA 2UY3A 3MYPA 4EVZA 4ZTXA 4NZ5A 3W1XA 3SUTA 3W86A 3CIVA 3AMKA 1M01A 1BQGA 3HURA 4DQWA 3AJXA 1JRBA 3GIPA 2P3ZA 3R89A 1W1ZA 3V4BA 5A6SA 3K30A 4EPDC 2O9PA 4HQVA 7CGTA 1WDRA 5DXXA 4K36A 1XCXA 3UXLA 2YX0A 4ROPA 2IKHA 4XD4A 2BY3A 3M9YA 5DT7A 1DWHM 2NQJA 4LH8A 1TV8A 1FKWA 3WF1A 4GI6A 4A3UA 5IRPA 4HZMA 3ECQA 3BJFA 1NM9A 2FZ8A 3NM1A 2PF0A 4IQDA 4B90A 1KBJA 7A3HA 2PC4A 3I3DA 1Z3NA 2D2JA 5BROA 2Y63A 4L6OA 3CUXA 4JX4A 4BEUA 4PRRA 3PZGA 5LXXA 4L65A 4HCDA 3H2CA 3CWOX 3BW2A 2QUTA 4GYPC 3R0UA 3L0GA 5G1MA 3UWUA 2PBGA 7XIMA 3QGVA 1K77A 1FWFC 1ZBKA 2HPIA 2CFFA 3QLLA 4HOWA 4GQ0A 2QMJA 1YXCA 3DCPA 2I56A 4HA0A 3WMLA 3LLXA 5B7YA 4F0SA 4XZIA 2XHYA 2OYMA 5A2CA 3T9PA 1A80A 3NVDA 4AZBA 2ZRZA 2PODA 3LPGA 4I5XA 5LIXX 3TQ0A 1V3MA 2JALA 4C6IA 4UZUA 1W3KA 3Q94A 3EWXA 4GYPA 3LCWA 3ZXWA 4NAEA 2VZUA 5EA9A 3ID7A 3UWWA 2QNEA 1PKMA 5I00A 3POHA 4Q8UA 3WELA 5CGQA 3UFYA 3KBJA 4P61A 2D2OA 3VO0A 4LYRA 4AZ7A 1GVOA 3QGAC 4LUSA 4LRSA 5LYRA 3K2GA 1JZ8A 1OABA 3M7WA 2E6FA 1B4EA 3ENLA 4QJ4B 3WN6A 3ATYA 4WDXA 4J3UA 3MWCA 2BXVA 4L6HA 3DX5A 1S1RA 2VNCA 3GZ3A 3PBUA 5D4YA 3PBMA 3O1NA 1M53A 2J9ZA 3OVQA 1TV2A 3IRDA 2HK1A 3LRLA 1TJ2A 4RK8A 4J40A 1KNWA 2WM0A 4IICA 1J12A 2PWEA 3IEBA 3TSDA 2VEPA 3N73A 3WLTA 1RLDA 2W66A 1TVNA 1UKOA 4FNRA 3IPWA 2OFJA 3P2VA 4IMAA 4CUCA 1PIFA 2EPMX 4OIFA 5D9PA 1IWPA 1HP5A 3M0YA 1IR2A 3GNOA 4GE8A 3LHUA 3ZJ7A 2XN1A 2YR1A 1VEOA 2PLCA 3DHUA 4NI3A 4HPJA 4W7VA 1DIDA 4HJWA 2PDUA 1UP0A 4G7EB 3FW6A 1VLWA 3MB9A 4MNJA 3TK7A 3WH7A 2PDBA 3QC0A 4C6EA 1W3TA 1TE6A 3S2JA 4D2JA 4RDYA 1BXNA 4JPGA 2BODX 4IPPA 1GPFA 7ODCA 2HQAA 4D9PA 3LHTA 3W7GA 4H9UA 1E9ZB 3OVGA 3W7QA 3WBYA 3FEMA 1MEIA 3U4AA 3BE7A 3UCCA 1V6UA 3MWAA 3VUPA 1TV3A 4UQBA 1ZNNA 2I5QA 5J5DA 3B8IA 3R2GA 1KR0A 1TZ9A 1J10A 4ICMA 3W1TA 2RDUA 2GK1B 2VX7A 7REQA 1J79A 4L7ZA 5D2XA 3ARSA 3N1AA 4M29A 4QM1A 1KCXA 4J28A 5K3VA 3BCDA 3THUA 1ZPTA 1JQXA 1EWEA 3LXAA 3UD6A 3GVGA 4S3GA 1FP8A 3GXFA 1XCFA 1TX2A 4QR6A 4PBEA 3DECA 4IMFA 2WSKA 1GCYA 1IEXA 4F0MA 4MPKA 3GY1A 1V6YA 1MUMA 2YCEA 1KW1A 1UA7A 2VFFA 4XB3A 4E2VA 1R2TA 1WBHA 4HTYA 3AAMA 3SECA 4XG1A 1UJPA 3WQEA 3P0XA 5BU6A 4Z2JA 1HN1A 5MF5A 4FX8A 2W27A 3ITLA 4WLCA 4O14A 3HPZA 2F6KA 4S3JA 2PRMA 3PUDA 4GNVA 3S2LA 3QHMA 3NZPA 4F9DA 1ITCA 3HTWA 4N2YA 3PFMA 1WKYA 3C8FA 3EWDA 4KGJA 3LCGA 4M6QA 3KOZA 5KZMA 1BAGA 1JFHA 4LAZA 1JDEA 2NQ5A 3V5OA 3HG4A 5HOSA 1EQPA 3ZR5A 4ZXLA 1ONRA 3CB3A 1KXQA 2X0YA 4JY8A 1GKRA 4EF8A 5EMLA 5C6MA 5ABGA 3MBFA 1W1B1 4H9MA 1FHLA 1W8GA 4MSSA 1GW9A 4XX6A 5EY5A 4E2OA 3UP8A 1O5RA 3EMCA 5CSSA 5D2VA 1B3YA 3NOYA 1V93A 4AXKA 3BAKA 1E40A 1EGMA 3UJ2A 4OZOA 1XH2A 2PTDA 1T99A 2VOMA 2BVDA 3SSJA 3KW3A 1JVNA 4EXBA 2EXOA 4JYEA 2D0HA 5HWJA 3THDA 1CXFA 1W3IA 2ISDA 4JIEA 4XZ9A 3NM3A 4YYFA 4DO4A 3M1ZA 5CH9A 1E1CB 1WAWA 1HG3A 3TJ4A 4ATLA 2QHAA 3PTQA 3H2MA 5CLTA 1FBAA 3C0LA 2VL4A 4LOCA 4AZCA 1J8VA 2ZX8A 4IX2A 3RAOA 1MW0A 4PEKA 1QI3A 3U6WA 9XIAA 4YLWA 1AL7A 1XQKA 4O4WA 5GNYA 4CNTA 2OWCA 1ESWA 2R1MA 3FEQA 4KFPA 3UYIA 2VEIA 3N25A 4MAZA 1VYSX 2HXTA 3ZZ1A 3OHIA 3WF4A 1JDDA 4ZQOA 1ZJAA 4FZIA 4Q33A 2X1UA 3E12A 3VD3A 4GX8A 4DWDA 2WZTA 4C7DA 3W81A 2QVNA 1XXXA 2OX4A 3CTLA 5EL1A 5KSWA 2B7PA 2PU0A 3G1YA 5DN1A 3AUJA 5HNUA 4XZBA 5AC6A 1FWWA 3PZIA 5HMFA 2YA0A 1AW1A 2I57A 1T40A 3F5KA 1G7UA 4XTIA 2V3FA 4WKHA 1WO2A 3KVMA 2CLMA 2QYGA 2ZC1A 1ISVA 3AROA 4OV4A 2VEMA 4IGMA 3PSWA 3OP2A 3M0LA 2RHGA 4JIHA 1XINA 2PDMA 2ZZ7A 1TPEA 3GHSA 2I17A 2BGSA 2VC7A 4LTSA 4O28A 3TJLA 5AYXA 3WNNA 4MZ8A 1XGZA 3L5AA 2G3NA 1A5BA 1OD8A 1XRSA 4YVVA 1FWBC 1GPWA 3W00A 1G69A 2CKRA 1I8JA 1CECA 1P5BA 1TA3A 4C7GA 4H7VA 2VURA 1PKLA 3G18A 4KWWA 4OKDA 4LFYA 4AY1A 4PRWA 3ZFHA 4S3KA 1U5JA 4NJGA 4X2PA 3MVIA 2YBTA 2YL8A 3GG0A 3GIQA 5LA1A 1EEXA 2OSXA 5CC6A 2XZ9A 3WQ8A 4CQAA 4PCPA 1WE5A 2ZQ0A 1ME7A 1KV5A 3TIMA 4L80A 1JYVA 5D2YA 3GKAA 3VGFA 1TMHA 2DZSA 3CLWA 3IUIA 4MNKA 2GGEA 2QKFA 4DWSA 3MV01 4A3YA 3ANVA 3KAOA 3BAJA 3WG6A 4LUYA 3L4UA 5BXTA 2F9RA 3FNDA 1QNVA 3TYDA 3VDHA 4QBXA 2PDGA 4JKMA 5HK4A 3EOLA 3Q4DA 1KRAC 3N14A 1K7EA 3DH7A 5AECA 4NAFA 4JQAA 3T8QA 1YIXA 4R88A 1R30A 3TYEA 1PV8A 2L5HA 2B7QA 3M0MA 3BWWA 1V08A 3SCSA 2D73A 3BSMA 3VGBA 2DUXA 2HVNA 3GTNA 1Q6RA 2V5LA 1MSSA 1FH9A 5BXRA 2OZTA 4MM1A 4JN7A 2V5CA 3H2EA 2J7DA 1RCQA 2D3NA 2ACSA 3I7RA 2C91A 3QBUA 2V3DA 3DGRA 4KFOA 4ZB2A 4DX3A 4PUJA 3AJ7A 1UWTA 3WBWA 3T08A 1Q6GA 2HMCA 2YCLA 4GI9A 4H41A 2TMDA 4K37A 2PDHA 1HJVA 4LUJA 3IV3A 1CWYA 3T55A 1FWNA 2B0MA 1BF6A 3PVFA 2HK0A 4GYJA 3BMXA 3SN0A 4O0KA 1WKFA 1O95A 5EBAA 3A9BA 3SJ3A 3F4WA 2VUNA 5LNSA 1KRMA 3N2XA 4ZSUA 3SRHA 3B8DA 2E28A 1EDGA 2OT1A 1FHVA 4O15A 3DHDA 4KWSA 4JHOA 5MKGB 1DJYA 4FNQA 3LCHA 1U22A 4GK8A 2R6OA 3WUFA 5I77A 1WUFA 1NTHA 3UZXA 3NDOA 4HPXA 4OUIA 2Y8KA 3UXAA 3QM3A 4AX7A 1EF2A 1VENA 1JZ6A 5H8PA 5M2FX 3B8WA 5BCAA 1TMLA 2CWNA 1D3HA 4KEUA 4PSRA 1E3ZA 1U5VA 1QPOA 1V6WA 1TPC1 4IFRA 1VEMA 1WX0A 2YL5A 4OHQA 5BOEA 4KERA 4JTIA 3CAKA 4FLOA 3MO7A 5G4HC 3RR4A 4AG0A 4Z2KA 1FWSA 1RQBA 2VGBA 3OIXA 3QR0A 4NL1A 3KP1A 4MMWA 2VO5A 1SZEA 4US5A 4GIYA 3FJLA 1Q66A 3DYPA 3FVMA 1NDWA 3C0SA 4CEXC 1RPKA 3MVTA 4A8NA 5I3IA 2HISA 2V9DA 1C91A 1JZ7A 2GVGA 2RDXA 2FDSA 2WVVB 4MB3A 3BLOA 5C8BB 4D8LA 4LF2A 1BSIA 3GHRA 5GPRA 2A3AA 1SJAA 2P50A 1UKTA 3W37A 4MLRA 5J8LA 2ZADA 1ZY9A 3RO8A 2BFGA 1XLAA 4NAEB 4PZVA 3W72A 4B16A 1VH7A 1PAMA 4JOMA 3TW6A 3CMFA 3ZVHA 1EP1A 1EDQA 1H7PA 1J5TA 3U5UA 4ACYA 3GH4A 2YL6A 2FVKA 5PTDA 2DIJA 3CHFA 2AGKA 1GVQA 5BZAA 1Q45A 2ZZ5A 3O0FA 4LUSB 4FP1A 5A6MA 2IPGA 3ALFA 4EIVA 1P0BA 5AVHA 1HUVA 3TSMA 2BB0A 2GQAA 1UD2A 4F0RA 2X7VA 1Q6EA 2J88A 4QJ1A 5HDRA 4PB3A 1EJUC 5DT5A 2DPEA 1Q63A 1S2TA 4UQDA 1TPH1 2VFIA 4WHBA 3ONBA 4O54A 5JBEA 2XN2A 1LJYA 5K4ZA 1T6MA 4C7FA 3WQCA 4XVEA 4JL1A 3QY8A 2BOFX 3W26A 3JS3A 3QSTA 3ABRA 3AALA 3HQ1A 3QVQA 1MFVA 4O1CA 1TV7A 3ZWTA 1PCKA 4A3QA 3P93A 1JZ4A 3PZMA 4C6DA 3E74A 2W4XA 2GGIA 1F6KA 1SYTA 4B4HA 2PGRA 1XYAA 2XG9A 4BF7A 2VRQA 1HNYA 5A8MA 3M0VA 4RV8A 1FFQA 5FJRA 3CQJA 3GXTA 3TEVA 3FX4A 3MV11 2IMRA 3E96A 3MSRA 4LUTB 3HF3A 1S5MA 4N6FA 2HEJA 2P8BA 2TPSA 5ABEA 3RM4A 1VZWA 2E5DA 4Q4RA 4NJKA 4BFAA 1I0BA 1KV8A 3IIVA 4F3HA 2AMXA 4RLIA 3SBFA 4GIEA 1CGVA 1D9EA 1BXBA 3S1GA 3IANA 4HZ7A 1N82A 3EWBX 3AIEA 3QPZA 2QJGA 1RPXA 3XIMA 2GDVA 2XIMA 4M6UA 3C0QA 3TMQA 5AFDA 3ZSSA 1UBPC 3EMQA 4JR5A 2QLYA 3D0CA 4KS0A 1PTGA 6CGTA 3QH2A 3F1QA 4LQ1A 4HU3A 5DY3A 1BVWA 4H3DA 1CGTA 2Z6JA 2IS7A 2DJXA 1IGSA 1EUAA 5A3HA 1Y0EA 4Y8EA 3GD6A 3GUWA 2Z25A 4FIQA 3SCUA 3HMJG 5HUPA 3MI3A 1JUKA 1OC5A 3VCNA 3QKZA 4IQJA 4P7NA 4UIOA 5CZSA 4PMYA 2Y4SA 3MUCA 1XJBA 4V2XA 3B4YA 4ZFMA 1LOQA 3BL3A 3E6EA 3PUGA 5K7JA 1R6WA 1V0KA 3KDNA 4U5KA 3OYZA 3LCLA 3GO2A 3M5ZA 3NOEA 1XR2A 2ISFA 4UFIA 1XLEA 4MWAE 1AD1A 4MDOA 3ITXA 3PBYA 3I7QA 3W1UA 3QRHA 3BQ5A 1TPUA 1FDYA 1AH4A 4GMEA 3APYA 3T7VA 2FFCA 1SO6A 4MY8A 2HROA 3TTQA 3GG7A 5F7UA 2GWGA 4I8DA 3NSNA 1IXNA 3HPAA 2EG6A 1SO3A 4CN1A 1VGAA 3LMYA 1NH6A 2YFOA 4BQ5A 3MS8A 4JTKA 5M17A 1JPHA 1IEVA 1Q6QA 4DLMA 3W24A 2J24A 4CNUA 4Q4OA 4FOUA 3QLDA 2J6XA 1P6WA 1XI3A 1J01A 1VHNA 4B5UA 1XL9A 1WV2A 3RYSA 3VDCA 4IMGA 1W1A1 4KCUA 4NRSA 2VEFA 3L4WA 4FX7A 2WPGA 2XM1A 1XIGA 4I3GA 7PTDA 4B4FA 3G0XA 3UG4A 4Q4SA 1BRLA 4GFIA 4GKTA 1R2SA 1NOFA 3WDPP 1LUCB 3Q37A 1QHOA 4GZJA 1LOLA 3VMNA 4IP4A 3QW4B 1H4PA 3ARPA 1IT0A 4R7OA 2ZICA 3AIUA 2Q8ZA 3R7MA 4GACA 3WD4A 1O1ZA 1N8IA 1Z41A 2YOCA 4FXJA 2WCAA 4PBFA 3GU1A 1QPNA 1P0EA 1VFHA 3U2CA 1POJA 1PYFA 4Q6JA 3WQDA 2WWDA 4RL3A 2EPKX 3WLNA 1H61A 3EOUA 1KXHA 1ISXA 4YTUA 3TXVA 4K39A 1JFXA 4J1OA 3CL6A 1A53A 4C6JA 4ZO8A 1XBZA 1C8XA 3UR2A 4PMXA 3CXOA 4Y96A 2CCRA 4WOZA 5A2AA 4I9AA 4KEMA 3BMVA 3AXXA 2E67A 1SR9A 4MDPA 1REQA 5CGTA 2OXNA 9CGTA 3BANA 2IPWA 2QJJA 3I7SA 4ZR8A 3URAA 1TCDA 3P8JA 4AF0A 4A4AA 4S3AA 2AQOA 3MJYA 1CLXA 1QJWA 5E9XA 5T26A 2QCNA 2RDTA 1FCQA 1ZSXA 1SZFA 2FZMA 4YL2A 1QPKA 1YW1A 8XIMA 1IWBA 1F3XA 1YLVA 3W2JA 3W38A 4LYQA 2Y0FA 2FHBA 2ON3A 1QNRA 2HPMA 3PWGA 4JAWA 2ZUUA 4H6RA 1QOXA 4PSPA 2OEMA 1G6CA 4C6PA 3HGOA 3W7CA 4JBRA 2FHFA 2NWRA 4JFUA 4KFNA 2A1YA 1KTNA 4XO6A 4ZXOA 2F84A 2WKJA 4FS9A 3CIXA 4C1NB 4YNGA 2H3BA 1O12A 4LWWA 2FZDA 3NSMA 3LGEA 1TA3B 1F3WA 2VGFA 3XINA 4HNCA 3CO4A 4HMNA 3PFRA 3SFKA 3OLGA 3WH9A 3UR8A 5M03A 3LDVA 5KEZA 4WXZA 5A8PA 5IM51 5LSMA 1J4EA 1BG4A 3HZ3A 1SZGA 2PU1A 3TFCA 5HINA 1DWIM 3RDKA 5E0CA 1T41A 3VVGA 4UQEA 2HS8A 4R34A 1UPPA 2DDXA 4HVXA 3AYSA 1I1XA 3HFTA 1OIFA 1KR1A 3R12A 4NJJA 1V03A 4ZCWA 2OR2A 4MLJA 3L4YA 1EGZA 2YXGA 3CO8A 3B0UX 7TAAA 4DJFD 2G5WA 3LXCA 1PX4A 3M64A 1UWSA 4D8AA 3ARQA 1UUOA 1EEPA 2FB3A 3VNMA 1XRTA 3VC6A 1XIMA 1UWQA 4AY8A 5FJUA 4G6CA 2QUUA 4CQ8A 3WDIA 4YN5A 1R8LA 1C93A 1LLOA 5F4WA 1QPQA 3H8AA 3VOJA 5U4NA 4AISA 3W9ZA 2GVEA 4LAKA 1A3WA 3RJYA 4FXRA 5I06A 5HJLA 3II1A 2UV8G 4HA3A 1H41A 4NAFB 4GBDA 1RP8A 1KKRA 3FFSA 1I2OA 1EPVA 1K02A 1U83A 3OHMB 3BZGA 4Q4KA 4BEQA 1LWIA 1OB0A 2VZSA 4ZODA 2P5NA 1OCJA 3EYPA 2DIKA 3C6CA 4F2UA 2BNJA 1C29A 4E2DA 1V0NA 4BK9A 4NNBA 4JDYA 3OIHA 4AAJA 2XZ7A 2VI0A 1VPYA 3HO8A 2PBOA 3A22A 4S38A 4C91A 3TLQA 3EDEA 4LVFA 1VFOA 1EZWA 5A69A 3GC5A 3N15A 4RR4A 1LWHA 1OG0A 3C0JA 4NZJA 5CZKA 4A8RA 3GHUA 4V1YA 1E4NA 1H7NA 2YCLB 3AIQA 2OQHA 1W0MA 2ZWYA 1QW7A 4S3EA 4G56A 2D0FA 2R1PA 3MCNA 4Z2HA 1Q6OA 1A5CA 2PDKA 5HWNA 3WLRA 1VBRA 4PMVA 2WMFA 3PHAA 4WQ6A 1OZQA 3K1DA 4H9VA 3W53A 3KRUA 2GUUA 2PRLA 4H9YA 3BLLA 2FQIA 3W7HA 4MJ2A 1L6WA 3MDWA 1C7SA 4PBGA 2WMIA 1DJQA 1HO1A 5F1VA 3ZR4A 1DJWA 4FALA 1TPFA 1ZHAA 3VXGA 4M81A 4AYGA 1TIMA 2VQUA 4HHLA 4ZBCA 2HBVA 3MMDA 4L9ZA 4MWAA 2E9BA 3LERA 3B9OA 3HQPA 5AHFA 3WQ6A 3Q58A 3NO5A 1EHNA 2QZRA 4FF7A 3TN5A 2OO0A 4QG9A 1KC7A 4QLLA 1QNQA 1RH9A 4HA4A 4LNCA 3HQNA 1ZL1A 4WVXA 1B5TA 2X16A 3NQGA 3D47A 2B81A 3JRKA 4DVOA 3GAKA 1L9WA 3V75A 3W2KA 2C6QA 4AZGA 3WLMA 1H7RA 2QCDA 3M0ZA 3T1GA 3E5PA 5D2TA 1LP6A 3TN4A 1R5YA 4O52A 1EIXA 1ITUA 1J93A 4Q8PA 1ZP3A 2J8GA 2NX3A 1OEPA 4LBUA 4QE4A 2E3ZA 4Z0JA 2VC5A 1RA0A 1QHPA 1V0MA 2CETA 1FWTA 4C6LA 3LI0A 2IKGA 2O92A 4DF0A 3ABZA 4JGDA 3GIYA 4CGTA 4D1IA 4KIRA 4IIEA 3H12A 3V18A 5D8ZA 2Z2UA 4JTGA 3OO2A 1DIEA 2I1OA 2P88A 1OGGA 2C71A 5CPTA 3V0SA 4A21A 2DSKA 4I90A 3A4WA 4HNNA 2CLIA 4L61A 1X38A 1JJKA 3CV7A 5C71A 3ZVHB 4OECA 1KM2A 3NO3A 2FZNA 2QCMA 3FLUA 3F4NA 3GU9A 1X1NA 1B31A 1M1BA 3G22A 1YX1A 4PMZA 2WO5A 4UTIA 4DXXA 3GR8A 4QDMA 1LL7A 1K6WA 1BF2A 3TE9A 1W1IE 1WKDA 4WKAA 1YPIA 3T2QA 4M7SA 3GDBA 1HL9A 1ZJHA 3NPWA 4R5EA 4K1GA 2YLAA 3AHZA 3G6MA 1RQHA 1XIIA 4HHHA 2YYTA 1R9ZA 2Y5JA 1UP2A 4JHZA 2INFA 3FJ6A 1A0EA 1YBQB 3ITYA 2FJUB 3M43A 5REQA 6TAAA 1JCXA 4OTKA 1PHWA 1US0A 1EJTC 4PGLA 5I7GA 3P14A 4P8VA 1A5MC 3LX9A 3LUTA 2C0HA 4CKQA 3AIRA 1W9XA 1CLKA 3BPWA 2INEA 2CZFA 2KZHA 2W79A 4GIRA 1EX1A 3T0BA 3NNTA 2O4QA 5FA5A 4QE5A 3E0FA 3BTNA 1R47A 3EDFA 3B9NA 3NUKA 3KHDA 3LBOA 3SGGA 3QMTA 4JTQA 5AC4A 3WEMA 1YNYA 4RW5A 2EKGA 4O57A 2WANA 3RX3A 3DUGA 3O07A 4M80A 3M44A 1HO4A 1C90A 3R79A 4K1WA 2WMGA 1B57A 2DZAA 3VKCA 2QJIA 3QZEA 4XAGA 2A3CA 4JQ3A 3UPBA 2WK2A 2Z1WA 5D9NA 3AXIA 4DYKA 1VP5A 2IXVA 3W6LA 3UNTA 3LM3A 3S4TA 2GJLA 2C0AA 1BKHA 1Z32X 4QLJA 3DKJA 1EBGA 3U2ZA 1UOKA 1H09A 4D6GA 4GVFA 2Q8LA 3UVAA 3ANYA 2Z6IA 2R82A 2Z29A 3RILA 1VC4A 3C2YA 3OGSA 2OQLA 3MSGA 1A0DA 3OQ8A 4M6PA 3QEZA 4UCFA 4MTVA 4BS0A 1RY0A 4PULA 1JD7A 3TJXA 3TQKA 3VABA 2CHNA 3VM7A 1NVMA 2CZDA 2OZ0A 3H7VA 4ZSTA 3ZT6A 2X30A 3ARUA 1X6NA 4NF7A 1ZJBA 4LS0A 1Y7VA 4XD5A 2IPJA 2Z0IA 3LHVA 4DZ5A 3TU9A 3I4KA 3W02A 3USZA 4RXGA 2YSWA 1BHGA 2GZXA 4W84A 4CNNA 2WZHA 3IGHX 7TIMA 1NF0A 2GJPA 2V30A 2YKKA 1BGGA 1SSDA 1B3WA 1R3VA 3D46A 1YKWA 3WQGA 1Z48A 5G2WA 4NIRA 1BWVA 3ABOA 1CPUA 2NLIA 1W5MA 2CLFA 1UWAA 1H0GA 1V51A 4EK7A 3KFTA 4GI8A 4GNJA 4O1BA 1R85A 4S3FA 2OTDA 3GM8A 3AWOA 1E55A 1P4CA 3FHAA 3PULA 5AHIA 1S2CA 3UWVA 4IQEA 4A8LA 2HWGA 1WBJA 3OG2A 4LY8A 1MWOA 3EXTA 4DNMA 2A79A 2NV9A 5A1AA 3B05A 4D6IA 2XH2A 4PTNA 4LVDA 3NDYA 2ZWZA 4DO7A 3GG8A 3WDJA 3W22A 3TKFA 1RK5A 3S47A 4BQ4A 9XIMA 2YCJA 3BSGA 1WYIA 2FGZA 1QW8A 3VIJA 1XRVA 2EBNA 3SCQA 2BZNA 4TXEA 3C2VA 3VNZA 4ADUA 3LPOA 4N6EA 2E0PA 4NQ1A 4GNKB 2E8YA 1HKKA 1HW6A 4B2DD 4FOKA 4PA8A 3VOCA 4P2VA 3DBPA 1OJXA 4QAWA 3UJRA 4IIBA 2OSWA 4PCSA 3IJLA 4NXKA 1HT6A 1TJ1A 2G4JA 5EMKA 2OELA 2ZDSA 2VFHA 1V3IA 4MUZA 3HG5A 4DJDD 1A5LC 1QWGA 1Q65A 2HZGA 2ZFAA 1X1ZA 1KM6A 3VI2A 5GVJA 4KWUA 2AAMA 1PL9A 5CSUA 3FKKA 2G3FA 1KRCC 5CZTA 2PTZA 5L6UA 3UYCA 3B8TA 2O7SA 4BQ3A 2EHHA 4QE1A 3CZKA 3R0KA 2QMKA 3WBXA 3KM8A 1DOSA 3LV5A 1X7IA 4H1ZA 3VIKA 2ZX9A 2ATSA 3B40A 1W1PA 2OSYA 1XIFA 5A8GA 1W9VA 1AFSA 2PP0A 4AF0B 4MF4A 1JNDA 3HGRA 1JULA 1HP4A 5FF0A 2GQ8A 1GQIA 4PFMA 1DWJM 4QNWA 2Z2BA 4B5WA 3NSXA 3RLUA 1B54A 4GPNA 2P0IA 3RU6A 2DY3A 3SIZA 2PDLA 3HBLA 3MANA 1F6YA 4L1GA 4Z2IA 1UH3A 2FGLA 1U30A 2Z2AA 4Q8VA 1TWDA 2BY1A 3UERA 1RD6A 1MXGA 1AD4A 1XFBA 4F2TA 3TAOA 3VGEA 3FVDA 2G3JA 2Q8XA 2QPXA 4DXKA 4HU8A 4AXNA 1DQWA 1P7TB 2E4TA 3NVTA 4JXCA 2XVGA 4UTJA 3LRKA 1EO5A 5BMXA 2H9AA 4RV3A 4Q7BA 3SSZA 1N8FA 3ABQA 1CXKA 1N55A 5ABTA 5JBFA 5KMYA 2QVHA 4QS5A 4O8RA 3AIWA 3KOYA 3T42A 4QGCA 1CIUA 4WKFA 1GOXA 3G3MA 1DORA 2HNEA 1M7XA 1V6XA 4U28A 3CYVA 2GFTA 4F9JA 2QJMA 1XPYA 1NSJA 2ZE0A 2IW0A 3H54A 3S9YA 3G2GA 1G01A 4ZZ9A 5A8QA 4EXAA 3M5XA 2XIOA 1IEQA 1ENUA 4KCVA 3A3WA 4Y9MA 1MFUA 3RHGA 1FCBA 1TJPA 2E40A 4F0HA 2PGFA 3LLDA 2A3BA 4K6AA 4KMQA 3CM4A 4Z2LA 2AL1A 2UWFA 1IT7A 1OYAA 3A13A 3LRMA 1FXPA 4NUWA 3VDGA 1O7AA 4UNKA 3V3WA 1DIKA 5IBXC 2WHJA 1PPIA 2A21A 3AYRA 2ZUVA 3VKBA 2DZXA 5FACA 2RGLA 4AD2A 4H6QA 5FCZA 2Y8UA 3P0WA 2I16A 4HNTA 1SW7A 1UD6A 2DVXA 3CPUA 3MHFA 2GSHA 1UZ4A 3AUOA 1VFLA 4D6DA 1F7BA 2ZYFA 3KZPA 3GR4A 1VF8A 5DBUA 3KRZA 2CBJA 2PFHA 4WJXA 5IBXA 1RY8A 6PTDA 4I9JA 4CQDA 1FHDA 1FDZA 2VX4A 4JTTA 3WF0A 1XFCA 5BRBA 1KLYA 4RNFA 4LVGA 3BLDA 4XZNX 4N02A 1GG1A 3SIMA 5F2GA 2Z28A 3S9ZA 3WJWA 2WM1A 1L6GA 2Y1HA 5D09A 1R7AA 3OB8A 2BWGA 3EEZA 3M41A 8XIAA 1UWRA 1CCWB 1KWGA 4LT9A 1U2YA 4G8TA 2VQTA 5EB8A 4Y2WA 4U3AA 2EJ1A 1E1FA 1SGJA 3NPUA 4XAYA 4ATDA 1TKKA 1K7XA 1VBJA 3W82A 2YB1A 2DEPA 4NRRA 1B3VA 3WDHA 1A3XA 2ABAA 3B0XA 1SMAA 3W83A 5A6TC 2Y24A 4A2RA 3N19B 4CQBA 5HPCA 5LZLA 2DQWA 4N42A 4EX4A 4Z1AA 1JCNA 1QOPA 4JTAA 1XDLA 4Z17A 3HV8A 5CZJA 4FX6M 2OG9A 4R3UA 4YU1A 3RN6A 4V28A 3KS6A 4PTXA 4XZLX 5K2ZA 4JKLA 5HANA 3OZYA 1JR1A 4Q4MA 3VZZA 3WLOA 2YBVA 4MB5A 4QEEA 1XYMA 4XSMA 4OBRA 3MQTA 3QY6A 3P84A 4FMVA 2PDWA 1U1JA 4Y9AA 4DJEA 2A3LA 2AAAA 3ITCA 4JX5A 4NZ4A 3WK2A 3BAWA 3CHEA 1DHKA 3VKKA 4UWMA 3V35A 2BLEA 3KCLA 3MI2A 4M0XA 2NX9A 5DO8A 3Q45A 4RPPA 3EWUA 1LTDA 3M47A 4XV0A 4LVAA 1EC7A 3KLKA 1FWDC 1S2WA 3UY8A 3RPDA 3UG8A 1QNOA 4XUYA 1DTUA 3N17A 4AB4A 3G6LA 3O0KA 1OM0A 1DBTA 2H3DA 5FAGA 2V3EA 3LK6A 3SZ8A 2H90A 3P61A 4JL2A 4QITA 3UPWA 4F79A 5C7HA 1UR0A 3EDJA 3IV8A 2A7PA 1ML1A 4AU0A 5F2LA 3O05A 4PUDA 3THAA 3EA3A 4GX9A 3RLHA 1AQFA 3IS4A 4G7EA 1FX6A 1NOWA 1XS2A 4AC7C 5I78A 4XD6A 1NDZA 2OLAA 3L21A 1UZHA 1MMFA 1Z44A 5FEPA 1OYBA 4O10A 4RDWA 4KIEA 1QWKA 4C6KA 5FEXA 1I6NA 2DZWA 3E2VA 4CQCA 1JG9A 2PZ0A 1MW1A 4QFUA 1PVNA 2OGJA 3GTHA 2MNRA 4NY2A 2BHZA 3DFPA 1EQCA 3H55A 2VVSA 2A6NA 3BLEA 1B1YA 4HYRA 2Y88A 2X1SA 4WXYA 2GK1A 3EA1A 4TIMA 3SDOA 3UBPC 1GG0A 4UOQA 4AHOA 2GWNA 1ALDA 4FNPA 3LTPA 3EZ4A 4Y9PA 1PTAA 4L5ZA 2WBGA 2EPLX 2WSQA 1TX0A 5C2CA 4EWND 3UWZA 4YTQA 3LNMA 1EZ2A 4AX6A 3HB9A 4CN4A 3VDAA 4FHAA 3SUUA 1GORA 4HA1A 1NY1A 2G8ZA 3WLIA 1G1YA 3TYBA 4O8AA 4W5UA 2QDDA 4ICCX 4PL1A 1TPB1 2FVLA 3L5MA 1ZCCA 3M0IA 1JNEA 3HPSA 4M1RA 2ANUA 1VJSA 3CAWA 3OZPA 2FJKA 4IQLA 1KWKA 1EO7A 4Z2GA 3BJTA 1FWEC 5LNWA 3VIOA 4E8CA 2IKJA 5LGXA 1FWIC 3K4DA 4NNCA 3RGTA 4C6OA 5A6BD 2ZUSA 3UEQA 3W71A 2AL2B 3VM5A 2PUZA 1RALA 1XKJA 5FOOA 3GAYA 4UNIA 3IJIA 4UMAA 1EH9A 4YHGA 4V27A 5E1QA 5FJJA 3CMGA 1AQ0A 2Y7DA 1U1HA 3I3EA 3DXIA 1W9UA 3OW1A 1FQ0A 5T91A 4U5IA 4IFKA 5FF7A 1TIWA 4QJ3B 4IZGA 2OLHA 4EOUA 1K9DA 3AMCA 3NQ8A 1H0IA 4BWLC 3T6CA 2DVUA 2W9MA 1THFD 3C5QA 4WSHA 3GTFA 4DB7A 1CXEA 2ZRYA 5FJPA 1YPFA 3GNXA 2GGGA 3D5HA 4BI5A 3U4FA 1EXPA 2J13A 5DELA 5AC8A 2HTMA 1PO9A 5JXQA 2TRSA 3K5XA 3MY9A 4NI8A 1YMYA 2X0HA 1FP9A 1P0KA 3A64A 5I3JA 3MDUA 1E1CA 1UW9A 2GOUA 3DERA 3LNPA 1ME9A 4QG8A 2WHKA 4UTHA 3C86A 4URIA 3FKRA 3W0KA 5H6HA 5F1UA 2QCGA 1MO0A 3W7RA 5G1YA 3CGTA 1UH2A 1BYAA 1F9CA 5CPNA 3M5YA 3PAJA 5EU9A 4UFHA 4HD5A 3W01A 2WZIA 1H7WA 3T0AA 1MQQA 3F5JA 3F7JA 3SUVA 3VNYA 1EWDA 4OFCA 1E43A 2J78A 2ZZ1A 1VPXA 3QY7A 3QC3A 4JTEA 4H19A 1M03A 3TWBA 4S1FA 1KRBC 3E2SA 4CD4A 3BVJA 3UZ5A 4GQQA 4QDPA 2ZBTA 3M6DA 3ABSA 3VUSA 3RG6A 1RQEA 1KFBA 3P8IA 3EA2A 3G0SA 2R94A 3KBVA 3PG8A 2VMFA 2ALRA 3W7EA 3EOSA 3JUGA 3K4WA 3QR1A 3KX6A 3W76A 1GOOA 3PPCA 4M8UA 1T5AA 3VOGA 3NAVA 4TX9A 2WVUA 3UWEA 4ZOEA 4AVNA 4E8DA 5I5RA 2RKXA 3LGDA 3B8SA 4GHRA 3C56A 3TFXA 3QPEA 4DZHA 2NVAA 3GFXA 4O53A 3EBVA 4YXGA 2KAUC 1Y5WA 4IXXA 1O4UA 3GXDA 4C6QA 1J0KA 3IJ7A 4EKJA 4ZMGA 3SADA 5E5CA 1W56A 3N12A 3AO0A 4F4RA 1M41A 1SW0A 1OCNA 2NUYA 4J35A 4AD5A 2NVCA 4MKNA 4WDUA 3HN3A 2QDHA 2WNQA 3W3OA 5AZ0A 1JDCA 1HKMA 5IXEA 1FXQA 4DPQA 2QT3A 4JTDA 3VMOA 1UCWA 2J7HA 3AS3A 3KXQA 4JTJA 3GC4A 1DKWA 4Z08A 1LYXA 4YMZA 4Z1DA 3DFYA 3UCQA 3VNIA 1UZDA 3EXSA 3LEPA 5M3WA 3WL1A 2C14A 1V3LA 1RSCA 1UROA 1K9FA 1OQFA 1A4MA 4TVUA 1E6NA 3EKZA 1RBAA 3CEPA 1OX5A 1SFTA 4J3ZA 5CG0A 3GW0A 1EOKA 4ROQA 5AHNA 3EWZA 1POKA 4QS6A 4B91A 3DFOA 1NJJA 3UW6A 4JDBA 4DHGA 2BXYA 5DRIA 5F2MA 3FGCA 4W8AA 2EAWA 4S3BA 4FLRA 2REQB 1XPGA 2B4GA 3V7PA 2GLKA 1B30A 2PDIA 4DI8A 2VJXA 2PP3A 1JYNA 1H62A 4CEUC 3W7IA 5F4SA 4JTLA 4A05A 3VNLA 4O12A 4LNYA 5DF0A 2PP1A 2ABBA 3P3BA 1GJWA 1PZ0A 4BQ2A 1VFUA 4UXDA 3AMLA 1JXKA 3ABXA 3CMJA 3LMZA 4NSBA 2PDQA 2ZXQA 1D3CA 3QXBA 3GKFA 1CENA 4WJ8A 2ISVA 2DH2A 1OT2A 4D6JA 1J0JA 3QZ6A 2ZTKA 1R3RA 1H5VA 5AYBA 1MW3A 2RH9A 2VCCA 1NWSA 1E71M 2J27A 1DXFA 1MRAA 3SUSA 4RE2A 3G8RA 2XIIA 3TR2A 2QUMA 3CTTA 4N4QA 4KBXA 1PE1A 5FEWA 4DF1A 2XFYA 4KKXA 2WLYA 2NT0A 3R25A 5TBOA 3V16A 3L4XA 4LAOA 3VD5A 1PZ3A 3MA8A 3CUJA 4JY9A 5DQPA 3QF0A 4XAZA 3NQVA 4C1LA 1KGUA 3NQ2A 1JIBA 2VDIA 4D8ZA 5AC7A 4DM1A 4JQ4A 4M24A 1J18A 3U5YA 1EPXA 1DWAM 1RJPA 1CXLA 1T8XA 3KBSA 2WMJA 1Y65A 1DJHA 2VP8A 4MFEA 1A5UA 1SUXA 2V5KA 4AZIA 1QI4A 4GH1A 3W1LA 7ENLA 1O66A 2VZOA 3ES7A 2NVDA 3USBA 4XISA 3CHVA 5MKGA 3FK4A 3NQ6A 3W1RA 2JE8A 1N7KA 3VOHA 4C60A 2P8CA 4OGZA 2PE4A 1A3HA 4AEFA 4X3ZA 5TD4A 1UIPA 4DO5A 2ZRUA 3WUBA 1TZ7A 2J74A 4O17A 1KM0A 3B97A 1LORA 5DCBA 3WH8A 2OKOA 3DHPA 3EX3A 3SQLA 2DH3A 3WX7A 2ZDRA 1UC4A 3AISA 4DXVA 3LY0A 2OYLA 1BXCA 5D02A 4IH3A 3CIWA 4C65A 2HXUA 3W7LA 4ZQCA 1VCFA 3NFUA 2DZVA 1J5SA 2Y89A 1KXVA 1FWCC 4NX5A 3W29A 4EANA 3WDQA 5XINA 3JR2A 1F8MA 1UKQA 2PS2A 4E2BA 1V77A 1GOIA 1S2VA 4LALA 3WLPA 1O6IA 3HFYA 1OFDA 3W88A 4K8EA 2NQLA 1H5YA 1MNSA 1UD5A 2WVVA 2PCEA 2PDXA 2CESA 2F7FA 1K70A 2JKAA 4PMQA 4B15A 1VD6A 1CW2A 3B3DA 3WH5A 5CXPA 3FHQA 1VRDA 4N9DA 3VZYA 1RK6A 2CZEA 2RJHA 2ZX5A 4UTWC 5LGZA 2NXHA 3FAXA 1H60A 3U0HA 4BJHA 1EOMA 4ZB5A 1OFPA 1LQ0A 1KFKA 3O9NA 3ONCA 3PBWA 4L6DA 4FPSA 2G50A 1V79A 3P5YA 4LC8A 4V15A 3TONA 3BO9A 3WMSA 5CC3A 1FH7A 2EO7A 2DFAA 4UTWA 2W5FA 3URQA 3O3RA 3GBEA 1WXZA 4H04A 3RO6A 3W07A 2PD5A 3WENA 2TYSA 2QXWA 4I5RA 1EBHA 3THQA 3M7SA 1E6ZA 4LV9A 3G1XA 3GXNA 4B5VA 3L2LA 2LLEA 4UOZA 2YXXA 4AZ6A 3KBMA 3TYCA 3R13A 3NGFA 2XH0A 3OZMA 1VYPX 3UA4A 2ZIDA 3GSMA 3UG3A 1GKPA 1GOMA 4N9CA 5CKSA 3S1UA 3SCNA 1S1PA 4IIGA 4XZMX 2J62A 4W8LA 1CGXA 1R3QA 2DW6A 4CCEA 4E38A 3BGJA 1QI0A 1F73A 2VR2A 4CU6A 4HOXA 3DYMA 3T40A 4X63A 2ZOXA 2WQDA 1XSJA 2PWDA 3TJIA 3PPGA 2A5HA 3GZAA 3OJGA 1LWJA 3S6OA 2Z4GA 3TW7A 4LUTA 3WMBA 1QVBA 3DENA 1OF8A 1R7OA 1D7KA 4PUWA 3KOFA 4RPQA 4DZAA 1CDGA 3R94A 2CBUA 3AHVA 1Y8BA 1H63A 5ECVA 3BQ6A 4GGHA 3G1SA 4DBWA 2Y8VA 4S3DA 3H70A 4NT0A 2V8ZA 3TCEA 4QNEA 4MFDA 1K4HA 2QUNA 1QO2A 3A3HA 1V7AA 2VD8A 4HK6A 5FESA 1IXQA 4ZOBA 1NWTA 3KLLA 1GYMA 3NL5A 3N9KA 3VAVA 1CEOA 1HXJA 1R9XA 4J27A 2QDEA 2PZNA 1R3YA 2RFGA 2OODA 3MKCA 2ODOA 4UMBA 4IIDA 4LEFA 4W7UA 3GYEA 3JZEA 2YA2A 4I7WA 1K6AA 2X0SA 3VCCA 1Q8AA 1V8EA 1VFFA 4C6BA 3U57A 4HP5A 3GYCA 5GJNA 4GQGA 3WY1A 4I5UA 4RW3A 1OD0A 1IGWA 4AWTA 1SJBA 2Q6ZA 4WF7A 4H7CA 2VR4A 3EX6A 4ZFCA 3IK4A 4IXHA 1S38A 1SZNA 2O9TA 4UTTC 3NQ7A 1MXDA 4TV6A 1VYRA 1ZAIA 4H9XA 1LBMA 3U7VA 2AKZA 1EFZA 1VEPA 5LA0A 3TC3A 1G94A 3ZSTA 4G1NA 1J6OA 2QJHA 1XHGA 5G2IA 3AXHA 4UTUA 1Q6DA 1XLCA 2E68A 1QHZA 4UTTA 1WOBA 1HJXA 4KRZA 5HNNA 4ZQMA 1IZJA 3WUGA 4O13A 1RJRA 4IFKB 1W1YA 4O1AA 1JF6A 1T96A 2CLEA 4YS1A 1FFRA 3L7RA 1EC9A 4L4OA 4ZQRA 1F2JA 1OX6A 4FAMA 1O5QA 4GWEA 1Q6LA 2ZX7A 3JZUA 3W1PA 4NZ3A 3I4EA 3R43A 5DANA 2VCBA 3MHGA 4X9SA 3S9IA 2HDJA 2QDGA 3R5EA 2HRWA 3MT1A 2QUVA 1A5AA 3TOYA 2XVPA 1XGDA 4B5NA 4FEZA 4HSHA 3S2MA 1LL6A 4J2MA 5LIYX 4QISA 1GOQA 4JFSA 3LB0A 1LUCA 5FD0A 1UA3A 5HQEA 3MUXA 1GVSA 4XKMA 3QV9A 4F48A 4ERAA 2FYMA 5F2IA 3NTYA 1WZLA 5LHFA 4O1DA 3R8GA 4NKCA 3PBVA 4BCEA 5KZEA 2J7GA 2NV2A 3GDRA 3E0VA 3QN3A 2A3EA 1WXYA 3G1DA 2J8TA 4LANA 3MPGA 1XYLA 3VX0A 5K9XA 2WZEA 1P48A 2GVYA 1XLFA 1HKVA 3OLIA 4XIAA 1R46A 3GNRA 1YTEA 3R1ZA 3FA5A 4P8XA 3W87A 1J0HA 3ARZA 1KQZA 5CC7A 1GOWA 1RLCL 4R27A 2G37A 2PDPA 4GVHA 1S3HA 4I7VA 3KWXA 3H21A 1MYRA 1R87A 4FI4A 2V69A 1TVPA 3TYAA 2XFRA 2GJNA 1DHPA 3RLVA 1G0CA 1ONWA 3OEXA 4MHBA 3W1MA 3KRBA 2AKMA 1LDCA 5KINA 3N04A 1AW5A 1KKOA 3P5ZA 1DPMA 4LSBA 4ZO7A 3SCTA 4EWJA 5HQLA 3TMLA 3BOLA 1DXIA 1FDJA 3WK1A 5CG7A 1UJQA 1UASA 1OC6A 4DUWA 1Q6FA 2Z1BA 4AVOA 1TV5A 3LBMA 2WHLA 4A29A 4B5XA 1H51A 1HKWA 3CAVA 1HGWA 1JCTA 2WVTA 4FIRA 4DF2A 1KBBA 1SO5A 4GUJA 4HMDA 3H22A 4H8HA 1QU4A 3VKDA 2VM8A 4W8BA 1EJSC 4C1NA 4TTGA 4D6CA 3M5VA 5BXSA 3NL2A 3PM6A 4GXWA 3LN3A 4J3WA 1XBYA 1NDVA 1O5XA 2ALDA 1XC6A 1QR7A 2J8FA 5GQBA 2DZUA 1EP2A 5HMSA 2VFGA 3UJSA 1GVRA 1SZRA 1DJGA 2VCAA 4PMDA 1W31A 1F5ZA 5H8UA 4DWSC 4RZBA 2F38A 1JYXA 1E3XA 5M5DA 3C3UA 3ZLHA 2UZ9A 3L12A 4LPCA 2YB4A 2JK2A 4J4KA 3TNOA 1DP0A 2W0UA 2V38A 3EXRA 3RM9A 4KWVA 4ZE5A 3BV7A 3BAXA 4TU1A 1OY0A 4JYDA 3VE9A 3KCJA 4HGXA 5FL0A 5XIMA 5CCZA 3FGCB 2MANA 1L8NA 1TSIA 1OFQA 4MADA 4F2BA 1SFJA 3KBWA 3FXGA 3ITOA 4QJ5B 4WGHA 2VEGA 1OGSA 4PMNA 2G3MA 1GKQA 2ZZ4A 4Q4PA 3B0PA 3GVRA 4GQRA 5KZ6A 5FAJA 2V3GA 1H11A 4M6VA 4WY0B 2D22A 3J7HA 4Q8NA 4LXFA 1E4LA 4O4VA 4LYPA 1FWGC 1M7OA 3VGDA 5IDIA 1KTCA 3B9AA 3ITTA 1RVKA 4YTSA 2VTFA 4AWSA 4KETA 1RR2A 1GVYA 2XJ7A 2QAFA 2CKSA 5C9ZA 4BKNA 4RE4A 4KWOA 3VYLA 2BMBA 3UWYA 3IAQA 4HYVA 3ARTA 4PUUA 3E0IA 3UZWA 1KBKA 1WCGA 3EPOA 1K8XA 1XLHA 3ZOAA 2E9MA 5I03A 2GJXB 2FTWA 1X6UA 2YDRA 2GYIA 2O9RA 1UR1A 1Q7QA 3AXMA 3NZQA 1O94A 1I60A 1E4IA 2P53A 2ESCA 2QGYA 3L2MA 2Y85A 5CSRA 4U3CA 1TV4A 3C2RA 2QCLA 3SCOA 3OOQA 3KVKA 4GH3A 1KFJA 5BOFA 2OEKA 1E56A 5CJ5A 1PEZA 2WJDA 1E15A 4OOUA 1OHLA 1KCLA 4RZ5A 2RDWA 3E3HA 4PCFA 2I9EA 1IEWA 2W63A 4K8HA 1Q8JA 5I79A 2ZZ3A 3M0HA 1RHCA 4HCLA 2YJQA 1KM5A 3D6NA 3E1F1 4DYJA 4J7RA 4P7OA 1ICPA 4IFOA 2X8RA 4GIAA 4NG3A 2XDFA 1OIMA 2ZUMA 5HA7A 2CBVA 5CBJA 1DE5A 3W7MA 3BG9A 1RZMA 4ACZA 3CEUA 2X41A 3UXKA 2QAPA 1UIOA 5BNKA 3AS0A 4RJEA 2NW0A 4NZ1A 2J47A 3FCPA 2I5GA 4NVTA 3MW7A 3VIPA 1K9EA 5HNTA 3R58A 1CT5A 3LQGA 1P6BA 1NQ6A 3OBAA 4YVPA 1ONEA 2D23A 5I07A 3NDZA 3MBDA 1C9DA 1XSKA 4HN8A 4INFA 4C6CA 1H1YA 1JUBA 5JQ9A 1Q13A 4XUGA 4E3VA 4MY9A 5BWFA 2VRKA 1GTEA 1RP9A 2OJPA 2Z26A 3TA9A 4S2BA 1YDYA 4GC3A 4P8WA 1IE7C 4IUGA 5A8OA 2F8QA 2GGJA 1K8YA 3QPYA 4B3LA 3N2MA 3DFSA 4B9YA 1OX4B 2H6RA 1I0DA 3BXWA 1V3KA 2OWXA 1AH0A 3NJ3A 4MB1A 4Y8FA 1A4LA 2ZC8A 8CGTA 3S5YA 5IFPA 1DL3A 2FIQA 1PWLA 5I3GA 1XF0A 3VPLA 4MZ1A 1XQLA 4LUIA 4DUVA 1R9YA 2YFNA 1SM9A 3N18A 4ADSA 1I9CB 2VFEA 3OVRA 1ELSA 4AYSA 1YNPA 3KHJA 1CB2A 1H3GA 5HXMA 3NZGA 1GQKA 3N2BA 2VUYA 3QV8A 3SFWA 1NP0A 4IIFA 3TOPA 3VTRA 2NWSA 4RKAA 1S5NA 4OOZA 4JYFA 4WX2A 1VCGA 3G77A 2PDJA 3ZVIA 5U7SA 2XVNA 3W28A 4M51A 3WFLA 1AZ1A 2WKGA 5H91A 3BARA 2JKPA 5JMUA 2GPTA 2DZTA 4YWSA 5B7ZA 1OINA 4L9XA 2C1GA 4TOQA 3KDOA 1YBQA 4G2DA 3HGJA 2ZA1A 3DC0A 4U31A 3DG3A 1EJXC 3UESA 1OBAA 1XWYA 3IWPA 1GHSA 5C54A 4TMBA 4PUEA 5E70A 3W1AA 1UUMA 1GYNA 4L4MA 3V0TA 3PK7A 1V6VA 1XIJA 3MU7A 1YPXA 4YVXA 3UCDA 2J75A 3MKVA 3U2EA 2KX9A 4MOZA 5TF0A 2E6YA 2Z7GA 1DVJA 3NYDA 3MUIA 4CD6A 3VKAA 1M7JA 3O06A 3HMCA 1JPDX 2O7QA 1XH1A 3LLFA 4QX4A 2DSWA 4YIWA 1KM1A 3TQPA 1N2VA 2VOTA 4CD5A 2YL9A 3WNPA 3VOIA 3L65A 1TPVA 3CH0A 1MZHA 3BLPX 1D7FA 2C16A 1Q2RA 3OPSA 2OEJA 3L0NA 4TUFA 2TODA 3DIPA 3APTA 3N34A 2BOGX 1WB0A 3SRKA 5J5RA 3H4WA 3VGGA 1EX5A 1OWQA 1U1UA 2CBIA 2Q02A 2XIJA 4IHCA 3FV9A 3AXKA 3EB3A 1QTWA 1TWIA 1QDSA 3I65A 4UBPC 3VOFA 3H6OA 4ORIA 4GJJA 1UOZA 3WQOA 1RBLA 4H9ZA 2AOSA 3UJEA 1ZGDA 5AOUA 2EKCA 1TO3A 1UP3A 3DU0A 4RE0A 4AEOA 5FF4A 1DWGM 5A5WA 3YPIA 1LT8A 4ZOCA 1E73M 3O7UA 1R38A 2PGEA 4AMAA 1TELA 1XLJA 1PZ2A 1YADA 3KL3A 1IZKA 3W7OA 1WZMA 1W17A 5HUOA 1VLIA 1G4SA 2D3LA 5GJPA 4GZ7A 1TJRA 2PURA 1JCYA 2Y70A 3MP4A 4KQNA 1HVQA 3LCXA 3I6TA 3TX9A 5A6JA 3FOKA 1EA9C 4TX6A 3AMGA 1PX3A 4QRNA 3P74A 2VT0A 1A5OC 1E6QM 4OQVA 2EEXA 3EGJA 2J25A 3HG3A 5CSYA 1UR4A 4Q7IA 1XLIA 4FA3A 4V33A 3ZMRA 3WF3A 4ZQNA 2ZRVA 3WCZA 2A6LA 3DFTA 4L64A 4WDWA 3TTYA 1ZAJA 5LNVA 1DYSA 3W2LA 4RNHA 4C6MA 1RAKA 1WZAA 4MJZA 3QW3A 1LCOA 3T2PA 1HQTA 1VCVA 2GQ3A 3MC5A 4PB5A 1KCZA 2WAGA 2VZVA 4XVDA 4FNTA 2DSZA 3CWNA 3WEZA 4HPHA 4JNYA 3EPMA 1ADOA 3ZWSA 1PXGA 3AU6A 3P82A 3RM8A 1Q5MA 4KCWA 4GGBA 3G1AA 1WKEA 3RNDA 4H83A 2Y61A 1QW9A 5C55A 2BXZA 5D37A 2NT1A 2D2GA 1U5HA 2ZRWA 4A2SA 3KTSA 4RE3A 1H50A 3DOPA 4JFVA 2ZA3A 1GOKA 3GDTA 3PG9A 4NX0A 2E1DA 1VBGA 3KL0A 3GTXA 4WCJA 4HT3A 2ZXDA 3MI6A 3E5BA 4GO9A 5FJIA 2FPVA 3VA8A 4CCCA 6REQA 1NFPA 2QPSA 2MUCA 2JKEA 4S23A 2WC3A 1ZQ5A 1RJQA 3BAIA 5C70A 1UR3M 1DQXA 2J7CA 2OGYA 3GH5A 2D1ZA 1TTPA 1P0NA 5EKYA 3DESA 4XTDA 4GO8A 3E2RA 2QW5A 4KESA 2ZUWA 3N4AA 4ZENA 3IGSA 3BW4A 5EMJA 5K4XA 2J9YA 4AVFA 3FDGA 3CPRA 2I14A 3VGHA 2E1WA 1GTHA 1GQJA 4DBUA 4Q6XA 3IVTA 1NF7A 3FYOA 3VMPA 4PTDA 3WLKX 3IJDA 1J0YA 2I9UA 4GRSA 3SCWA 1Z6KA 1Q6CA 4RZ4A 3QKEA 4YWIA 4E4FA 2X1IA 4HNLA 1YTKA 2XFFA 3PTMA 3EDDA 2WJFA 3HQOA 3TYUA 4XBJA 1TQXA 1V6TA 3WD2A 5JVLA 5LIWX 3WK0A 1PX8A 2JGYA 3LHWA 1F07A 3EWWA 3T81A 1H1NA 1R2RA 4JNMA 1AK5A 4IG2B 1HJQA 4IT1A 1L0PA 2VXNA 2XFWA 1AZ2A 4MNMA 1AUSL 2HNHA 4KRTA 1SFLA 3PWIA 4MNLA 1WOAA 4P7LA 5LHEA 2EJAA 4MZYA 4P7QA 1KGXA 3NPVA 3T4WA 1VFSA 2X1TA 4UR9A 5AYZA 5C9XA 2ACQA 3H4GA 3K8MA 5AC5A 4GYFA 1VBHA 2Y62A 3UU0A 4LS2A 3NEVA 4LS1A 5TNVA 4IJRA 3WF2A 3O15A 4FK9A 1DE6A 2R1LA 1Q7ZA 1P7TA 4BA0A 3B04A 4UNLA 3KOWA 1JCJA 5MHBA 1H2JA 4W7WA 2WZMA 3WBEA 5D9MA 1LOSA 2D24A 2HE5A 3HPXA 4UB9A 3SW6A 2FH8A 4NHVA 1UYQA 4FB7A 3CQKA 3GG1A 4O0QA 2IQ0A 4U33A 1E0WA 4JCLA 2ISSA 2JQXA 3IJ6A 2DUZA 5AKQA 4JIQA 3P60A 4S39A 2E6DA 3KCOA 4YTTA 3VX1A 3IJ9A 1OK6A 3PSVA 4GC4A 1A47A 2X40A 2VGGA 3T0CA 3FA4A 4RUBA 3NR0A 3W70A 1B9BA 1OC7A 1ECQA 3PJTA 4ZOAA 4LC6A 5EMYA 2FPYA 3U3HA 3LGGA 3VIHA 3RF9A 3VIMA 5EFFA 3BOXA 2CLLA 5FF2A 3QYSA 3CZEA 3WD3A 4HKPA 4PMUA 4R7WA 1TR9A 3CQIA 3LCFA 3MMWA 1JAKA 5ECUA 1V7YA 2UY4A 3O16A 3G1HA 4MAVA 4ZB0A 3A5VA 4QHRA 3WNKA 1AH3A 4REQA 3G5EA 1OF6A 8A3HA 3PS7A 4FNSA 4JTUA 3HA1A 1QUMA 2OT0A 3TQVA 2PB1A 4DWSD 4GVGA 6A3HA 1VB9A 3VC5A 5SWUA 2CLKA 3QV7A 3WDRA 4A8IA 4CD8A 4J5NA 2DVTA 1W5NA 3CYJA 1TB3A 2CC0A 3DYOA 3L66A 5GJMA 5CPOA 1XISA 4KEZA 5JUVA 3JU2A 2PWVA 4R9OA 2VELA 1MZRA 1PZ1A 4Q4QA 3A3XA 1TG7A 3BUVA 1PSCA 3LOTA 1J96A 3RCMA 1JZ5A 3R6IA 3SCVA 3A12A 2WSRA 3NGJA 2WJZA 5XIAA 2O0TA 2F6UA 3CAQA 4GKLA 4FOJA 3WJYA 4ML9A 5M1TA 3C8NA 3MJMA 3LA4A 5CAKA 3GW3A 1BWLA 3L4TA 1M5WA 2P1FA 4HSNA 4KH2A 4KCTA 2HJPA 3EX2A 4R33A 3PR2A 3WQPA 2XSBA 3G8EA 2QGHA 1VRXA 2XGZA 3LZ3A 3NIYA 1SO4A 1RCOB 4M3PA 1GK8A 2BHYA 2BV9A 3G3DA 5AHMA 3TV8A 5T9BG 3VIFA 1FH8A 3NG3A 4XZWA 3QHNA 4MWAC 4IX0A 1VR6A 3UR5A 1ISYA 1EHAA 3E49A 3CZLA 2J7BA 3AMDA 4LYKA 4M7TA 2WVSA 3GS6A 1XRFA 2XM2A 3EWYA 4HK7A 3ARXA 4W93A 3QGKC 4IIHA 3OG3A 4BI6A 3RPMA 2J79A 3HIJA 1BVZA 4IP5A 2FZBA 3OYXA 4ORMA 1ZB5A 3S83A 3C2EA 1F74A 3LSBA 4JTHA 1E5JA 1XYFA 1L2UA 4TVCA 2VC9A 2R91A 1XIHA 2VGIA 4QXIA 1VFMA 4ACZB 3IVUA 3CHCA 4ZEPA 3C2FA 1OVDA 4H9TA 2Y7FA 1LT7A 4AHPA 4E5TA 5JH2A 3AICA 4CD7A 3QZAA 1HX0A 1XYZA 4AUBA 4IJCA 4G9PA 4JFWA 1LROA 5D33A 3N6JA 1FCUA 1FY6A 1DQUA 2A85A 3DKLA 4POCA 3KS5A 2ZCGA 3GE7A 1Z8AA 3RUBL 1FRBA 1ZP4A 3P6LA 1G5AA 1R0MA 1K8CA 1VPQA 2TSYA 2ZE3A 3C4UA 2ICSA 3N6HA 1FOBA 3LCIA 2CIPA 3RFAA 2XPKA 4K3ZA 2E25A 2VWTA 3UPMA 3NCOA 2F61A 3DAQA 4LY4A 1UQZA 5AY7A 2WBKA 3ITVA 4US5D 5DLCA 3TNBA 5LIUX 3IJ8A 3IIPA 2X7WA 3BDKA 3C61A 3N4EA 4NZCA 4NP7A 4UR8A 2GQ9A 4HNVA 1F4HA 3KZSA 2G4FA 1NAL1 1IR1A 3NWRA 2YW3A 1S2UA 2PD9A 1VAHA 3OTRA 5FL1A 3IIOA 4K7YA 3AYTA 1JI1A 4JQ2A 4AHQA 5FIPA 3MMUA 4MJ4A 4Y9NA 3UGRA 2WNZA 3OBKA 1PYMA 1TYGA 4W87A 5CZ0A 1JL8A 5BWAA 4TV5A 4NU7A 2OQYA 3F4DA 3U8GA 1YE4A 3E38A 3NL6A 2UY5A 3GRIA 1XIBA 4J3VA 3P80A 3W2MA 3S5ZA 1LLWA 3H7RA 1KLZA 4K38A 3ATZA 5A8NA 2ZVRA 1TWZA 1SPQA 3LYEA 1ODZA 4JKKA 3LENA 2C79A 5A94A 1X7FA 1E72M 3ME3A 4P8UA 4X0VA 1UHVA 1YDOA 3L67A 4Q8TA 1WXJA 3DDMA 2VX5A 1BYDA 5I09A 1UH4A 1IF2A 2PDNA 3KUMA 5BYWA 2Y6ZA 5E6YA 4DN1A 2E8ZA 1J2BA 1WDPA 4PODA 4PN2A 2VZTA 4UQAA 2PLKA 5BRPA 1X1OA 1R3TA 5DRCA 3CLMA 3K46A 3R10A 4E4PA 1XYBA 1F8IA 1OFEA 4W9TA 2QEZA 3F4CA 4DJFC 3KE0A 1Y5VA 4NYYA 1Y5XA 3V1PA 4MKVA 4RNIA 4X9YA 5KZDA 3HG2A 3ALGA 5D38A 5I6SA 2AL2A 3A4XA 3V5CA 4PUNA 2O55A 2J9XA 3CU2A 3MSYA 4H8NA 4KW2A 4L1XA 2A3HA 3UG5A 4L1WA 5T9CE 2WCSA 3PC0A 4HHPA 4DJFA 2G0WA 1Q7MA 2NSXA 1ADSA 4L9YA 3GX9A 1NOUA 2XH7A 1US3A 3CH9A 4GI4A 4OBTA 6ALDA 4FXSA 2OX1A 1UWIA 3TVAA 3LHYA 1WAUA 3QMRA 4GG9A 3TYZA 4AQLA 1TTIA 3G1RA 4GY0A 4GBUA 4RDVA 2BDQA 2NQZA 4YPJA 5BU9A 4RX0A 4A22A 1BTMA 1GNXA 3QTPA 3VIGA 3REQA 1QO5A 2ZZ2A 4IGHA 4BZYA 1X8CA 2Y7EA 4GZIA 2POTA 3WFAA 4PFHA 2DSVA 3QFWA 2WC4A 2V68A 3W7PA 3GHTA 1BG9A 5DCDA 2BVTA 4PE8A 2ISWA 1I2RA 2P10A 3WLQA 1EL3A 3F03K 4AWEA 4DNHA 1C3FA 3INPA 3QSRA 2C7FA 1B9ZA 3M4HA 3VD4A 2QCEA 1V3HA 3BK0A 1M68A 3P7YA 3PWAA 1OSEA 4RXFA 2GSEA 3NQFA 4C6FA 2WB5A 2PDCA 1WDSA 4Q8WA 4TTUA 5J04A 1GT8A 2C19A 2WHMA 3WL0A 3DZ1A 3MTWA 4GXPA 1XLKA 3EOEA 4DM2A 2WSPA 1CGWA 2QQ6A 3BOFA 3IJQA 5CPQA 4KPLA 1N8WA 4HB7A 1B2YA 1R3WA 1PBGA 1VJIA 2CNCA 3S8HA 2ADAA 1QNPA 2E5BA 1WNOA 2EF9A 1XCWA 3GVVA 1YEYA 3CV1A 3ZR6A 2CPUA 1PCWA 3T78A 4B9ZA 3L5LA 2PTYA 3SCRA 3TW9A 2FH6A 3PZ9A 1CGYA 3N13A 2CWXA 2QV4A 4C6NA 1UD4A 4QAIA 2RUSA 2WLZA 3GVWA 1CX9A 3PZOA 3NXFA 1J0ZA 4M56A 4US6A 3T2OA 3VD9A 5DMYA 4I7UA 3I68A 3UR7A 4JD4A 1UC5A 2F2KA 4JEJA 2H8XA 1TJ0A 5G2HA 4DUXA 3H24A 3BCJA 5LNRA 1W91A 4NJIA 1L6SA 2CXGA 1TTQA 1ECEA 1YHTA 2YZRA 4PCNA 4P5UA 4AY7A 2BVWA 1V4YA 6REQB 5HNRA 4S3CA 1DJZA 4PR4A 2YYUA 5K9CA 1AJ0A 3WH6A 4ASTA 3PAOA 1WDWA 1OFRA 3FIGA 3PJWA 5IFTA 3CT2A 3N11A 2J4GA 3O6AA 3C52A 5FSEC 3RU8X 1S39A 4JCMA 3XISA 4H00A 5EBUA 4OE7A 5HAOA 1Q2SA 3EEGA 2YPIA 4L56A 4IP7A 2CHOA 1JGIA 4ES4A 1ZRQA 3H26A 3SAZA 1DWFM 2XYLA 2V67A 2DT3A 3OGVA 4Y6GA 2Q71A 3B0VC 3LTSA 3L4VA 1JDAA 3WYZA 4WR3A 4AZHA 3NQDA 1NP2A 4ECLA 4JZ5A 5DX7A 4HK5A 1E70M 2ZUTA 1B3XA 4PB4A 3W85A 5D05A 3A4AA 3LI1A 3LZ5A 2CHRA 5ABHA 3TC7A 3WNOA 1YRRA 1W8SA 4HSOA 4CU7A 1XD0A 1C9WA 3RJXA 3UZJA 3SUWA 3W7DA 2V5BA 4EPEC 3WKZA 4GY1A 4Z1YA 1NDYA 1E6PA 2C1IA 3R0DA 3BMWA 2X2GA 1Z9AA 3CZ8A 3MHUA 2JIEA 2DSUA 2REQA 1ZLPA 2VX6A 3S1WA 1GQLA 3U7BA 4YYCA 3IIZA 1K8ZA 3WNLA 1RXOB 4JIIX 2GJRA 3UZZA 3CUHA 3NO1A 3ZQ9A 1D3GA 1JGMA 4JIRA 3MZ2A 1M9HA 4MPQA 1Q85A 4GJIA 5EGRA 3K13A 4D71A 4DZIA 1ODUA 2DW7A 1MNZA 3HPFA 3U48A 1W5OA 4ENLA 3H2NA 3KTCA 2X42A 3VE7A 1TQJA 3ARYA 3RMJA 3W73A 1XM3A 4LVBA 2J7FA 3TP4A 1E4MM 3CT7A 3TZFA 3IVSA 1KGWA 1S3TC 3GU2A 3ERPA 4HJFA 1KCKA 3AZTA 4QQUA 2CLPA 3SEPA 1P1XA 2PPGA 4KRUA 2BGQA 4XAFA 2Z7KA 3SB0A 3PB0A 1T0OA 1NEYA 2Y5EA 5EFDA 2BTMA 3QFEA 3KRSA 2X1RA 1EXBA 4B5SA 2IXUA 3OA5A 1IXOA 3M46A 3CV2A 2NZLA 4A3HA 5TQLA 3G1FA 3ZJKA 5LNUA 5G4EA 1K4GA 4PYSA 4E0CA 3COTA 1AJ2A 3EX4A 3HM7A 3M6YA 4F0LA 5EMMA 4YCPA 2YXOA 1UQYA 5D30A 1IHIA 3AIVA 3F5LA 1S46A 2Y5SA 1I75A 5TIMA 2QPUA 3DFQA 3WEOA 3A6OA 4DRSA 1KO0A 4REQB 1C8QA 3NZ1A 1W3NA 2CLHA 2WSYA 5C2XA 1PWMA 4ZL1A 3MKKA 3FYPA 1XLLA 3TDFA 2ASHA 1EKOA 2D2HA 2I7GA 4Y9OA 4TX8A 3T0DA 1LLZA 1E0XA 4B3KA 1LG1A 4HCHA 5FKYA 4EE9A 2FPTA 2PC8A 7REQB 4XBKA 2JEQA 1OFBA 3RK8A 1ZUAX 3NQCA 4DAFA 3RPTA 4KF1A 3A9IA 3K4AA 3BICA 4GINA 3EB2A 1T8QA 2YGYA 4JHMA 3TTSA 5C0QA 3CUGA 1QK0A 1CTNA 4RCXA 4ATWA 4Y90A 5TAOA 1LZOA 1HTIA 3E02A 3P81A 4MYAA 3FN9A 3WLHA 2FB2A 3NYZA 3AS1A 1A0CA 1LRNA 3LV6A 3UJFA 4YHEA 3W6YA 4LW7A 3H23A 3OODA 3RLGA 4HNUA 2XN0A 1WDQA 1P43A 3ELFA 4XO7A 3WUEA 5BMWA 2WCGA 4HPGA 1C8YA 4K7VA 1TVLA 4F0KA 4UMCA 5CC5A 3CB8A 1E5NA 1EJWC 4DJEC 4GUIA 5FJTA 1GZJA 5ABFA 1A50A 4XWUA 1AMYA 4JN8A 2FTYA 2W62A 2OOGA 1Q4WA 2D69A 2H8ZA 3GXMA 1IQ8A 1UD8A 4WY0F 2XVKA 3TCSA 4Q3MA 3PTKA 3HOJA 5CJMA 1Z69A 5D03A 2QJNA 1CBGA 1VJZA 2B7NA 3CUZA 4MYXA 4N4PA 4AWUA 3GVQA 3DI1A 4XSLA 1KD0A 5D9OA 4MWAD 5JBDA 1KM4A 1JI2A 3ARWA 3STEA 3AHTA 1A49A 2PEVA 4MKSA 3SCPA 4PCTA 4EPKA 2IQDA 3IUHA 4DJDC 3ZIZA 3MUZ1 1E9LA 5HR7A 3N2OA 2OKTA 3CL7A 1IZCA 3KVJA 3I6RA 2BX7A 2OYKA 1TE1A 1XD1A 2OZ8A 4B2DA 1ZCOA 4AD3A 4GOAA 1DJXA 4HU4A 5A6KA 3FA3A 3W23A 1QK2A 3L2IA 3HV9A 4FO4A 3I6EA 2BY2A 4AZCB 1XLMA 1JQVA 4DJDA 3BURA 5D32A 1KFLA 4MY1A 1FHUA 4Q8MA 4LB4A 3GFZA 1EDTA 3KBNA 4EAMA 3T07A 4BHYA 3BGGA 2ACUA 5HMEA 3EDKA 4ML4A 2GDUA 4IPJA 1M3UA 3W7JA 2YDSA 3S1XA 5E6ZA 3VNDA 3Q67A 2EG7A 3MCMA 1W2VA 1G4EA 5HULA 2NXIA 4EP8C 1CGUA 2ZXAA 3PUOA 4CNSA 2WNWA 2VENA 2FZ9A 4AIUA 1Z89A 3B06A 1XW8A 3DI0A 4X22A 3UA3A 4LF1A 4P7RA 3BV4A 5KITA 2DORA 2DU2A 1AVAA 3S3GA 1QBBA 1IIHA 4H8UA 4NJHA 4V1XA 5I24A 2Z1SA 1UZ1A 5GNXA 1G4TA 4LBSA 4HPNA 3SO7A 1B4KA 2FMOA 3A5FA 1L2QA 1W3LA 1SQ7A 2CYGA 3WSUA 4L4PA 4C5ZA 4WGXA 5G5IA 2QF7A 1ZS2A 3PUEA 1VBUA 4PMJA 2YLLA 3K8LA 1S5TA 1LRTA 2WWCA 3MSDA 4AD4A 4DLFA 1MDRA 4W89A 1XC4A 6TIMA 3FY1A 1DTNA 4ALDA 1MEHA 2PWGA 1KFEA 4HN4A 4HMCA 3VINA 6XIAA 2A0NA 1JUEA 3PBGA 3AFBA 4ZGYA 3N9SA 3GLCA 1BTCA 4RDZA 1YDNA 2RGMA 2NLYA 2EPHA 3AQUA 5DFAA 1CYGA 1NU5A 1XG4A 3PNUA 4TVDA 1X96A 3VFCA 5IDZA 4GLEA 1NELA 1Z42A 3RRAA 2HCVA 1CXIA 3EOOA 1YQ2A 3W4RA 2DV0A 3UT0A 4KEVA 2B31A 1VIZA 3ANUA 1H1ZA 1C92A 1JPMA 5CQ1A 3SY1A 3NXLA 3T0TA 1E0TA 4O11A 2E77A 3S46A 4QCEA 1ITXA 1PS9A 4WJEA 4MUPA 4UFLA 2C18A 3AHYA 1FVPA 2E6AA 1XX1A 4GUHA 2CW6A 2OLSA 2OVLA 1OCQA 3AOFA 3STPA 1J2WA 4CQ9A 4H2HA 1PJ9A 3LBCA 2NQHA 5JIWA 1IXPA 1MQRA 4AFYA 3MCOA 3H53A 4DWSB 3W2NA 3UXIA 3UZYA 2HS6A 2XWDA 2JFEX 3CV6A 4LGXA 1KM3A 1BGAA 1HGYA 3A21A 3W1NA 1B90A 1Q3NA 1CB7B 3B9DA 3REQB 5H8MA 4X60A 1GVEA 2E9LA 4LV4A 1I2PA 2JF7A 3LSCA 4JICA 1PKYA 3TXZA 3MO4A 2C15A 3T4CA 3DFNA 1MDLA 3IAPA 5BOOA 1V02E 3GDKA 3RXZA 3GK0A 5IOBA 3PY2A 3EWCA 1KQYA 4GJ1A 4N9EA 3SRFA 3LS9A 3PPHA 1RA5A 2FTPA 2CU0A 4HOZA 2GL5A 3W1QA 2ZZ6A 1H49A 2V2HA 1X98A 1UMYA 5JU6A 3W7NA 1SJCA 1QPRA 4Z1CA 1X39A 1ADDA 5E0FA 3NQAA 4EF9A 4GABA 5HMDA 2G3IA 1LG2A 2A7NA 2GVJA 2HV5A 3L23A 3VKJA 3A23A 4D6HA 3ZJ8A 1TMQA 4UZSA 3C3NA 3W6MA 2NSOA 2Z1XA 1BPLB 2BS9A 4U2ZA 1R86A 3BW3A 1E9YB 1KTBA 1K03A 4HBKA 2QS8A 1E6SM 4W88A 3PJXA 1SR0A 3LM7A 2R14A 4BF9A 1QMLA 4OV9A 3CS2A 3DC8A 1HF6A 1BYBA 2WPBA 1SJDA 4M82A 4DUOA 1RV8A 5T8GA 1XBVA 2YDAA 3RCNA 1GW1A 5HWMA 3N2TA 2OCZA 1SMDA 4JFTA 1OFOA 1AMKA 3SY8A 2DP3A 3Q2DA 1S2AA 3VIIA 5K9DA 3NQBA 1US2A 3P67A 4MIMA 1TWWA 1XLGA 8RUCA 5HJXA 1I45A 5B80A 4IMDA 5FF3A 3QTGA 3THCA 3BLIA 2GVLA 1GWJA 3PZTA 3H2AA 1XDJA 2XU2A 2ATMA 3MMTA 3O2LA 3SJNA 1MVYA 2XISA 4PUMA 3SURA 1L6FA 5FSDC 3TH6A 2EGZA 2PTWA 3KVLA 4ZTYA 1JRCA 3AWNA 4WRHA 3PNZA 3QQWA 4PMOA 4BR1A 1XICA 4AC1X 1ZAHA 2VDHA 3VD7A 1MW2A 2E09A 1ZBVA 1W37A 3PZQA 4F66A 3E0WA 3B03A 4PRTA 3ZS4A 3AC0A 3VNKA 1HFBA 3GTIA 4B3ZA 2BP1A 9RUBA 3GBDA 1BEUA 1TUXA 2A7RA 2Z00A 1FWRA 4AD0A 3GDLA 3BSHA 1QT1A 2DQXA 3SGUA 3R11A 1GZGA 1JF5A 4JNZA 2B7OA 4ZO9A 1EA0A 3QQ1A 2FHCA 2PTXA 1ISZA 4AIBA 1X6LA 4DBSA 2VDGA 1DEDA 4O1FA 1GUVA 5AVNA 1BSLA 2NUWA 4I6KA 4N9BA 3HGSA 3S5OA 2R8WA 1O5KA 3BJSA 4O19A 4AH7A 4QEHA 4XKYA 3WQ5A 3CWHA 1K9TA 2QCHA 5I23A 3T44A 1J9YA 1PKNA 2X05A 4UUIA 1SVDA 5AHLA 2Y2WA 3ISIX 2PDYA 4X0NA 3TWAA 5CBBA 1F4AA 3TROA 4I8YA 4WUIA 1EP3A 2CLOA 1EB3A 3CHDA 2AQWA 4WY0A 4QQ3A 2AGTA 3AI0A 1FWAC 3LTYA 5DMNA 4GD0A 2PA6A 3N29A 3O63A 4IWWA 3S2NA 1GEQA 3N9RA 3MUY1 1JAEA 3WK3A 1QI5A 1I1WA 5FJOA 3STGA 1WQ5A 2XGIA 5D2WA 1MUCA 1ICSA 1KBLA 3DG7A 1UR2A 1EF3A 2DGAA 3ZJ6A 3M0XA 2OZ3A 3ARRA 3LG3A 1IIGA 3WD1A 3SR7A 3QV6A 1RUSA 1KBIA 5CPSA 3GXPA 4QDWA 2GJXA 2FVMA 3G24A 3SN4A 1M7PA 2BOEX 4UFMA 1L6YA 1I4NA 1OFAA 4QSHA 3F2DA 2EPNA 4QLKA 3IGXA 2ZUNA 4IISA 5A6BA 4GYKA 4MVAA 4WZHA 2YA1A 1EYEA 2NXGA 2WKLA 2WJEA 4IGNA 2SFPA 2EQDA 3AHXA 4LAUA 5BW6A 4E8GA 1W9BM 1TPWA 3TUUA 1W32A 4IOTA 1HKJA 5HPOA 4IPNB 4J3XA 3FS2A 1E51A 4U2YA 2CZ5A 1U33A 4H01A 4WSJA 3UXDA 2BG5A 1VKFA 1QBAA 2CITA 2OPJA 4PEEA 3R4IA 1W54A 3WFZA 3UY7A 1IWAA 3L68A 4Q22A 3KTXA 2WOQA 1FA2A 4JQ1A 3P62A 4JN6A 3WJXA 5GNZA 1NWRA 2J66A 3LHZA 1OGBA 2DZBA 3RITA 5E93A 4XK2A 2Q3OA 5HATA 3S0CA 4F8XA 3PJUA 3VU2A 3EX1A 1DJIA 5LKYA 1XUZA 3WLLA 3L0KA 3WBAA 4Q8OA 1AJZA 4AEEA 5KETA 4O50A 4GUGA 3KOXA 3OZOA 4HMEA 2OO6A 1XH0A 2A2IA 4R7JA 2Q09A 1VIWA 5HR6A 4UFJA 3SM0A 5JH1A 4IMEA 3KL5A 1K7FA 3GC2A 2FKPA 3HJZA 1ZBCA 3URNA 4DBDA 4EAYA 1TWSA 3D3AA 3L4ZA 1C8VA 4XZHA 1UUQA 4H6KA 3DGBA 4WDTA 4OBSA 4JIPA 1F76A 3SI9A 5HJYA 4D6FA 3FSTA 2DIEA 1E9IA 4QSFA 1OX4A 1VS1A 1XBXA 4O1EA 2Z1VA 5ENLA 3GQYA 3DFHA 1V02A 3T8LA 1TRIA 4JTRA 1TRDA 1MQPA 2NV1A 1KB3A 2BHUA 3GH7A 3H4XA 2IQTA 2F2HA 1T7LA 3PZUA