1CGUA

Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Catalytic center of cyclodextrin glycosyltransferase derived from X-ray structure analysis combined with site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
total genus 227
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cguA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cguA01
1ZVSB 2R2HA 3DV4B 1A5FL 3REWB 2YA1A 3W37A 2XICA 4LSVL 3HE7A 1JGUL 4IDLA 5C0RH 3ZR5A 2HLFC 2R4SL 5FKAB 4FNLH 1JMZA 1NH6A 5CMAB 2R0ZL 4ODHL 4KDTC 1OAUL 4DEPC 4ONHB 2P45B 1ZXQA 2R69H 1Q9LB 5I18H 2EDXA 4XPGH 4CCCA 3TF7C 5ADPL 3IJ7A 3EDEA 4JM2C 1PPIA 4K7PY 3Q6FB 2ADIB 4M1CC 3W11D 4ZSOA 5I15L 1KQYA 1NC2A 1OTTC 3AIQA 5IF0B 5BVPL 4GLRI 4MVBC 4PG2A 4JPKH 4POUB 2GUOB 4M24A 5C0RL 2PTVA 1VERA 2F58L 2RFXA 3BWAA 1W2VA 5GZNC 1MF2H 1YQVL 2BMKA 3DBXB 3FO9A 5DJ0B 5I1HL 4HOXA 3VFPB 3CFDA 5JLZB 3DX6A 4P2OB 1UXSA 3BVNB 3JVGC 2XG4A 1A4JA 3VMPA 5CFHA 4NKIH 3UP1A 4PRBA 3GBLA 1VSCA 3G6AB 3S5ZA 1AQKH 5LQBH 3EJYD 4WDIB 4BZYA 4BFGA 3EW3B 2EO1A 1I9EA 3JV6A 9CGTA 4NNXB 2GK1B 1YEEH 4XXDB 1W0VA 3GJEB 4MVBD 4L8SA 2IPKB 3LIZH 3RJQB 3NMEA 1LK3H 2QADC 3S36L 3A3HA 1OM3L 3VH8G 1B0GB 4OLUH 3LV3A 2QHRH 4FQXC 5CWSB 3QHTC 1IGIH 5EU5B 1NFIA 3FFCB 5B39A 3GSOB 4MA7H 4XNQA 3N85L 5GZND 4JFDB 1AGDA 4YE4L 4JJ5B 3F58H 5GRJH 4U1GC 3VOCA 4KU1A 3V5HA 5CBAA 3S3JA 3BKML 4BZ2L 3FB6A 2J7CA 3LQZA 2WMIA 2AXJA 1DL7H 4IMKC 1BG9A 3JWOL 2ICWI 1ODAA 4L3EE 3MOBL 5DFAA 1Z2KA 3PP4H 2GK1A 5MERB 3WKML 4AZIA 4OZHB 2EYSA 4UT9H 3OV6A 3QOKA 2DM3A 1UB6B 5E8OA 2IXVA 2HRPL 1KBGL 2ZZUT 3FQNB 2ZUVA 1QLFB 4G43B 4GRLC 2WZPD 1U8PB 2WMPA 5IROC 1U8QA 1AE6L 3G9AB 3AJ7A 2JE8A 1FORH 1NBYA 2Z1SA 3BP5B 4YDKL 4JR9L 5F1KC 1BJMA 4OF6A 1DZBA 3RX5A 4TPRL 1BZQK 5D2NB 4CMMA 1INQB 3U7AA 1VFMA 4E0RA 1LHZA 4NNYA 3I9GL 3EKCA 4XNMB 4F7TB 1EOKA 1SMAA 1F00I 5IB3B 5CKGA 3AIRA 1CXHA 2NY0D 4KUZL 3ESVF 2A1WL 2UUDK 5F88A 1JL8A 1MRCH 3FO2A 1YDPB 2E27L 3K80A 3QDJD 5ICXB 1GVYA 5C09E 2CESA 5D7KE 4ELMB 5EA0H 3Q6FA 3ZE1E 4MJ5B 3C2SA 2VDKH 4UR9A 3VD5A 4JFED 4XPAH 2I5YH 1JYNA 4JFWA 5F3HB 3FXYA 1CGWA 2AJUL 1VEOA 1TVHB 4F9LC 3LKSA 3MO4A 4AIOA 1LO2H 1MY7A 4EI5D 2ICWJ 2UVEA 1CG9A 3IRPX 4MQXC 3QGVA 1T83A 3NCYS 4FQPA 4G6MH 1XD1A 2NYYD 1B0RB 4PLNC 5JPNB 1VPOL 1X7QB 3DGGA 3BHBA 3VSVA 4NC1E 3M46A 1I1AD 5D6DC 3FTGA 2QPUA 5I18L 1G7MA 3VRJB 2B1HL 2AJZA 4F7CA 2D4DA 4NHCL 1CGUA 5JQHC 3W0WA 1NLBH 1INEH 2CKBH 2FL5B 4UTFA 3LV3B 2D0FA 3LEYH 1XEDA 2HJKB 5HGGS 3HI6H 4H0IA 5IB1B 5CJ5A 4XPBH 4G8FA 3L7EB 3DIFA 2GEEA 4JO3L 1W9PA 3D2UD 4BZ1L 2WMJA 4P57B 5L8KB 1HVQA 4ZXBB 4PJDA 2XWDA 4UAOB 3IAGC 4XPTL 4XCEA 1AFVL 2LFGA 2DLGA 4QXGL 1CDBA 1P1ZA 3NSMA 2WCSA 3KVQA 5T1KB 3BQUA 5KVGL 2VITA 5J56B 2P8MA 4ZUWA 5JW5B 3GI9H 4PJHF 4YHYB 2CO7B 4LPCA 4NKIL 5IEKB 3N17A 4NQDE 4MPKA 4GQPH 3PL6D 3QUMA 3BDYH 2GITB 4ODXA 2Y06L 5E5MB 5LWYL 3W29A 5IFPA 2DSZA 3K1KC 1FL5B 4XCYA 1UOKA 1T1XA 4YNYB 1W3KA 4R7NA 2JB6B 3V7AG 1HL9A 4OGXH 5DA4A 3MV8B 4MDJA 3GSNA 2X4TA 5DGRA 4ZFMA 1MW0A 3U79A 1EO7A 4IRSB 3FQUA 1IAOA 1NBVL 3PWPD 1DUYB 4WLCA 1T21A 4M61A 5E4EB 4B50A 3MZGB 5FCZA 3LH2H 3VXMA 4PY8I 3PGDA 3PDOB 3QFJD 1BD2E 3O11A 2B1AL 4G3YH 4PB9L 3WXVL 1DVFB 1MYRA 4HS3B 3IKCB 2PWFA 5HHOA 3MUGB 4LMQE 1IGJB 3W53A 2XFRA 3BLPX 5I71C 3OQ3B 5HVHC 3A4XA 5FD0A 1U8IB 1KSRA 4ZS6D 4PJXB 5F21B 1BVLB 2E7CA 1KTDB 4OLUL 4MAYA 4I3SL 4FFYL 4M61B 4Z0XA 4MJ6A 5I1EL 1IGIL 2IQAA 3LKPB 2W91A 4DW2L 2QV4A 4HZLA 5JBDA 3FQUB 4XXDA 3BIKA 1AHWB 3D85B 1G7LB 3HHRB 3VFGH 3IDJB 4WW2C 3TJHC 3S37H 3E0GA 4PRHA 3KL3A 1YMHB 1IGCH 3LVEA 4MLIA 4YHGA 4GS7B 3WH6A 4G80B 2JCCE 5BWFA 4ELKA 1ECEA 3NFPA 2DLTA 3C60A 1UXWA 1ZT1B 3A21A 3QRGL 1FL5A 4R97B 4AY0A 3QUXD 1F90L 5IHUH 2AAAA 2X1IA 1A3QA 5CJXA 4PMYA 1KCSH 4PP1D 4DOHE 1T89A 5C0JA 1UCTA 4JFZL 1A1MA 2VDQL 3JXAA 4N68A 3HI5L 3WSUA 4ALAH 4WFGE 5E6IC 4X6DE 2E8YA 5I1GH 2BERA 1J05A 3CFCH 4LPTA 4GG6F 2IANB 3P0YH 1QSVA 4TVPL 3RWIA 4QTIH 5ALCL 2VLKA 4ELKB 4U1GB 2OXGA 3R4DA 4JFPA 4UQ3B 4S10A 4DWSD 5FO7A 2BVPA 2EACA 4KUZH 3QIUC 2XG9A 3D85A 1Q9KA 1A6AA 3MRHB 3O9WC 4ODUB 4P7RA 2W38A 4BA0A 1CZ1A 5HI3C 4WWKD 2QADB 5E0QA 4TRPL 1E4KC 3DV6A 4JY6B 4GAGL 4PFEA 5GISL 3VXRE 1QRNA 1BFOA 3OLGA 3CUGA 2JK5B 2Y7QB 5DK3A 1KB5B 3ARRA 1R46A 4F3FB 5DQ9A 2R8SH 4MNJA 4P9ML 4NWUH 1HKFA 2YLLA 2LVEA 4WKFA 3U2SA 5BV7C 4PJBE 4WU5A 3V52H 1KJ2L 2EIBA 3OR6B 2VZTA 3ARED 4WHYH 4DFIA 3MRFB 2FECI 3MJGX 3BZEB 5GGTA 3WO4B 2FATL 4JRYA 3SY0B 4L4OA 4OCXH 1R5VB 3FRUA 3W9EB 3FKUS 3MFFA 5KS9A 3L5WA 3EDKA 4OCLC 2ICWA 4OZGF 3QIUB 3VXNB 4YHOL 3GXFA 1T1YA 2ZCLL 4M7ZC 4Y5XB 1HH6B 5DEFB 5HYFA 1LLOA 2FECL 1X9QA 5F9JA 3LKNA 4QGYA 1VENA 3OKLB 3GHEL 2XVLA 4KZEH 5C9JB 5D2NA 2H2PC 1T3FB 4PRAA 3SGEH 2XGBA 4JHZA 4J3XA 2FZ3B 2X0YA 3LN5B 3OZPA 3QR2A 4MCYB 3VD3A 5T3ZL 4Z2IA 5KEZA 1X4YA 1FHGA 2QHRL 1EGJL 2YK1H 3PABA 4ZUWB 1CXEA 4ONFH 4OLVL 5CSZB 4JFVA 5DRXB 5F7MC 1EA9C 4DVBA 1AO7A 3WNPA 1G7LA 4OZIE 3GXPA 1R7AA 3UBXB 1Y6NR 3TO4C 1JYVA 2V7NB 3QDMA 2MPAH 4XGZA 1FO0B 4PEEA 1RZFL 3RJXA 5DI8B 3ZTNH 3PL6A 1J5OH 4GXUN 1KIQB 3N11A 3X14B 2IG2L 5E9DD 4KPHH 1QG3A 2XZQL 2GYSA 5F7HA 3G04B 4P46B 2F9BT 3KPNB 4QRTA 3SPVA 5DRZB 1TPXB 1WZ1L 3VWKB 1HN1A 3F12B 2WVUA 2CPUA 4HZ6A 3PDDA 3HG2A 4H20L 3VFNB 3CGTA 5FYKE 4NM8H 1H4PA 2IALB 3NACL 3VRLE 4OFYD 5HPMB 3F5KA 3S6TA 4OCNC 1NCDH 3KS0J 5EN2A 4DCQB 4FQCH 1IQDA 1MFAL 2B4CC 1VGEL 1DVFC 4J1UA 3MLSH 1S7VB 4I3RH 25C8L 1WK0A 3GM8A 5DQDH 3Q1SL 5B39G 3SBWA 4XRCA 1T1XB 4FNLL 3SDAB 3F12A 2IGFH 4ZE5A 3TOPA 1JGDB 1RHHB 4QOKE 2WVTA 5DRZA 3VXSE 1PIGA 3GMMB 4J27A 5FCUL 3VDHA 2E4TA 1KWGA 5E94B 5L6YL 4RGNB 2XN1A 4JO4L 1M6OB 1IBGH 4G8EB 4OQTL 3ULUH 4U1MA 3HUJA 5B38B 2NY5C 4WI6A 5KVMC 1MCJA 1XV8A 4X6CF 5C0GA 1J0IA 4FG6C 4Y2OA 4GBXB 4H88L 3ZMRA 5EFIB 3KPOA 3MXVH 4Z7VB 2A3BA 5ID1A 1D5IH 1Z3GL 4H1LB 5FK9B 2A83A 4PJDB 4M93C 4PRIA 4GBXC 4JAMA 4NO5B 5F1NA 4X5LA 1OP3K 4PV8B 3WH5A 1RZKH 2F74B 4NN7B 5GGRA 1LG2A 5DC0A 4BQCA 1QPPA 4P46D 5JIIA 2AV7B 2BNQD 4X6DB 1ORQB 1GOKA 1QI0A 4JIEA 1GJWA 2HTKC 2K7PA 3CMGA 4YPGA 1M6OA 1R5IB 1V8HA 2GT9B 2VL5B 1T04B 1CECA 1Q8MA 2BNRD 1KIPA 4G7YL 5IMLB 4HH9A 2ZX6A 5HDLA 5T3XH 3V5HB 4FQJL 5DJAB 1LO3L 1TQUA 4JR9H 3IJSA 5E6YA 2H41A 2X4QA 2X09A 5F7WC 3HMXH 2AEPL 3KYAA 5I1KL 1P7QA 1NEZB 2XZAH 4FQXA 3E3QC 1CD9B 3ECBB 2FIRT 3QDJB 1WICA 1JFQL 3QCUH 4O02L 1EQCA 1PG7L 4IIQC 3SGJA 4JY5H 3GJEA 2Q8AH 3QDJE 4JFZH 1UQZA 3P3YA 2J4GA 1IC5L 4XWGH 3C5ZB 4G6JL 4JFFE 5T3ZD 4AH2A 5GRJL 4I1NB 4OCYH 3GNML 5M17A 1W9BM 1QD0A 3WSQH 2ITCA 4J6RL 4TX8A 2JF1A 3EOBA 3MRMA 2O9RA 3SCMA 4KDVA 2XWBB 4CW1A 3UCRA 4TNVF 1KXHA 3CXHK 4MD0A 1N64H 4MTVA 1F3DH 4PJ7A 5DJYB 2GUYA 1WITA 4W8BA 2VNCA 1FCGA 4OJFL 3G6JB 4LVNC 3QEUB 3VRLF 1NGZA 4WEBH 3PZUA 1TZGL 1G6RA 5T1DL 4ETYA 1A6AB 2W0FB 2X1WL 1DE4B 1DUZB 1PGRB 3W24A 1JNLH 1MCWM 2FJFB 3SCMD 4LVEA 1J01A 3MJ7A 1OW0C 4HWNA 5AWNL 3TVMB 5HYJA 2Q76A 1VF8A 2DYPB 4NHCH 3ZT7A 4HQQL 2ADJA 1MAML 3PHAA 3BZFB 3FMGH 4Q22A 1E1EA 1M7DB 4GT7A 1I9JL 1QQDA 2YK1L 4OSUH 4MCYA 2FO4B 4G42B 2R56H 5DK2A 3UEZA 2ALWA 1NGZB 1VKXB 2MQ3A 5KSBA 5CJQL 3ULUC 4MAUH 3LQZB 2WMIB 2I9LA 1YZZA 2DSVA 2FSEB 5TD4A 5KS9F 1JTPA 5E00A 1D9KC 5J8OA 5IEHB 1M7IB 1MVUB 3W5NA 5CEZL 1E73M 3DJ9A 1NBZA 4TVPE 3QULB 1R3IL 3GSUA 3QHOA 2PN5A 3ULSB 5A3ID 4AD0A 4R7DB 4NO0A 3ARGD 3RDTC 5EIIB 5EWIH 4EDXA 3MLZL 1IGYA 3RL1A 1XIWB 1HH9A 1VACA 4NJAH 2XM2A 3IS0X 2V5DA 1FLRL 2V3FA 1OAUH 2L4OA 1R3HB 3VUPA 3RZWA 5H94A 4POZC 1UM6L 1CICB 1YEFL 3L5HA 4MAYB 2Y7QA 3U7BA 1BX2A 1FBIL 32C2B 3ABZA 3NAAL 1BJ1H 1B4JL 3WHXA 2WKGA 2M1KA 2VDMH 4CKVX 1AP2B 5D7IF 2YEZA 3H7LA 3OAYK 3U7WH 4IM4A 4DO6A 2GT9A 5F7UA 1WNOA 3RHWF 3ARXA 3OG6B 5C0BD 4P2RB 2XJ7A 5BXFB 4PRID 2Q7NA 4JL2A 4D6CA 4H26B 2Y9RT 2MKLC 4FF5A 1NCUA 2BVOB 1JGIA 2RR3A 4WFFE 5DO2C 1MCQA 3CZJA 5D1QA 2LVCA 2NR6C 4OT1H 4RGMC 5KZCB 2YRPA 1ZL1A 4UUJA 1V3MA 5CP3A 2D31B 3L5IA 1ETZA 4I2XE 3ZL4L 4Y7EA 1EO8H 1HKMA 2K1MA 2CK2A 3BN3B 2VKXA 1EX0A 1KR1A 5D70L 1FSKC 3QT2A 1ZE3C 5EG6C 3PWJA 5LBSL 1KGCD 5KN5A 3QXAB 2DL9A 1ZMYA 4OFYA 2Z31A 3BPLB 3O6FA 1DANT 5DJZA 5DLMH 3UROR 3SURA 2P24B 3CHCA 1TJIH 2GITA 5E5MA 1ZVSA 3PWNB 1U3HD 1UC6A 1G84A 4HC1A 5CIPH 4F9DA 5ICZB 1J5OL 3KPLA 4AZ6A 3EOBB 3MRMB 4LOUC 2D23A 2KZ1B 1EGJA 1F90H 1XR8A 1KV3A 5DDHB 5GQBA 3IGUA 4X80H 5HGBA 1DWHM 1R3KA 5AUMB 1FC2D 4JPWL 4ZAKB 3HU7A 3QG6B 3EAKA 3EFFB 4KMQA 1K6QH 1KIRB 3ALWA 3HUJF 4D6HA 1E4LA 2D73A 4PLJD 4X6DF 1MQRA 4PMOA 2A0LC 3ZJ7A 5E9DA 4J3VA 2EH7H 3NH7L 4U1JA 5F7EL 3P11H 3CUJA 2VDPL 3CZFB 5AYUL 2WIIA 3I3BA 3RZCB 1J8HA 2GSIA 3DXAE 5B8CB 1JWMB 5T3ZH 1FA2A 4GO9A 3K8KA 2CEQA 4AT6B 3IKKA 1AO7D 4MS8D 3SPVB 5DZLA 3A4WA 4UILL 2NXYD 4XAWH 4PLOB 4HPOH 1MVUA 5D7SH 5IQ9A 2XWJB 1IC5H 4XWGL 5CCKH 4KI5D 4M8UA 4IRZH 1QNPA 5L8LB 1G0CA 1LL6A 4QHNB 2Q20A 5ABFA 3QI9B 4S1DC 1W0WA 2VL5A 4UIMB 3KWWB 5LA2A 4LCIH 1FG2A 4PJEE 3FFDB 1I7RB 1KIUA 3F5WB 2D03H 3AREC 2GK2A 1SM3H 3EFDH 4R2GC 4M1CD 3EHBD 3W11C 2BHZA 3QUMH 2D7TH 5I0DA 2BOCA 3V5DB 3DGCR 5A6BD 3QG6A 1W8OA 4UDUA 4AJ0A 1AR1D 3N9KA 1NGWB 1SJEA 2XTJD 3BKYL 4Y89A 1MJ8H 4ZUUA 1QPKA 5ADPH 5IB3A 1MPAH 4M4PA 5ALBL 5C0NC 3HMWL 3AXIA 3IDMB 1MWAB 1ZSDA 3QOMA 2AJXL 1RIVL 1RIHL 3C6LC 1TCMA 4CVXB 3SE8H 4N0CC 4PG2C 3GIZL 3R8QA 5SV3A 1E15A 5C8JA 2H8PA 1T1YB 5BZDA 1E6OL 1L0PA 3AHZA 4XMLH 2E7HA 3TA3D 3GMOA 1G0DA 4UQ2A 4WY7H 3L3DA 1CR9H 3WNNA 3KYMB 3WEOA 2IFGA 5F6HI 2CRIA 3SDCA 3TIEA 4F7PB 3WNMA 3ECQA 5JDSA 1CGYA 1QLFA 1KTLA 5K9QI 5ACZA 3BAXA 4HA1A 3AZRA 4HU0A 1U95B 4ONHA 3D85D 4XPBL 2VLJA 2W9DL 1R34A 1TDQA 1FN4B 4WJXA 4F3FA 1MIML 2FDBP 4G9FE 1RH9A 5TE4H 1MCPL 5E09A 5D1ZA 4XMPL 2XTKA 1TLKA 4U1NB 4W4OC 3KL0A 1U91A 2LABA 3QIBB 1U8JB 1I1FA 5K59F 4ZUTB 5IK3A 5CZXD 3VWJD 4JFDA 3VWJA 1J12A 5ECJE 4UNUA 2QL1A 4I5BB 3GMLA 3O2LA 2BSSB 3TA3C 1UFUA 5AYIA 1JZ2A 3MSPA 3MXWH 2UVFA 4JPVL 1WWAX 4PJ8A 3PP3H 2FIKA 2SEBB 4ZD3H 3CHFA 1S7QB 4O2CA 4OZFG 5HHMD 4MJ5A 1RVFH 5E0FA 4PJEF 3VFUB 4G6KH 1GW1A 3DX8A 2HN7A 4ZDHB 4QRSA 1KTKE 2IANA 3EJRA 2ZNWA 4LSPH 4JY4A 3MC0A 3G6AA 1QR1A 3KPMB 3RDTB 2NY3C 2VCBA 1HTYA 4IOSD 3CTTA 3D3VB 5SV4A 3C60D 2J6EH 3F7QA 1DQJA 1HKLL 2Z8RA 3PG2A 3MXWL 4JPVH 3RVTD 2Q8AL 2I9LB 3MLSL 4I3RL 4K8RC 1YEGL 4MJ2A 4R3SA 5BRQA 1H3UA 4G8GD 1D9KB 2F8XC 3WFHA 4PJBF 4BSWB 1Q6FA 1HXMB 3DVGB 4Z95H 1NCBL 1CENA 2R0LL 1II4E 3OR7A 1LD9B 1DQMH 1ZLVH 3T0EC 2Y6SD 4AQ1B 4YHML 1KN2H 2AQ2A 4AEEA 2I9TA 4M62L 3D52A 5D9MA 3BXNA 5INDA 3EYQD 1WBYB 3GMRB 1FAKT 2O26U 1KJMB 1LVEA 4PJ7E 3TBYA 5IWLC 2ZWLT 2BHYA 3THMH 1I8IA 4M6OL 5ANMB 2F54D 3DVFA 4M6ML 1SMOA 3QFJA 3DPBA 2NY6C 2R9HD 3GSWA 2X4OB 1FGNH 3SJVE 4J2XA 3QIWA 4XWOD 3U0TB 3L3OB 4HS8L 2OZ4A 5ABEA 3Q48A 1KB5A 1HF6A 2D7PA 1MAKA 3E6FA 3RVWC 3VFWB 3K46A 2PW1B 1ERNA 2XN2A 5GGSB 1MJJA 2HT2D 5T33L 3CFEB 1DP0A 4D6EA 4X0VA 3PGDB 2AQ3A 2Z31C 4HGKC 1JWMA 3O6FC 2CCRA 5LGKA 1OSZA 2Y6SC 3AIVA 3UR7A 5D7LE 5TF0A 4Z7NF 5LJYH 2WANA 3DX9A 4F7MB 2Y23A 1IAMA 4HWZA 4P2OC 3ME0A 5IBTH 1KT2B 1VJSA 3AHXA 4PMNA 2IFFH 4HF5H 3DMMC 4HA3A 3FQWA 3MRNA 3B43A 3MCLL 4OV5B 1EO8L 2CBUA 3OB8A 2EDYA 3EJZC 1S9VA 3TT1H 3U4EB 3SE4C 3MRKB 1QLRB 1V3LA 5SWSD 4HUMB 3RILA 2BV9A 2JF6A 2VQ1B 3LDBB 3NPSB 4LCYA 3WMCA 5L2JA 1BEYL 1ITXA 3FONA 2WVVB 3PZQA 1UA3A 1NWUA 3EZ8A 5A2JH 3GRWH 5CSYA 3WIJA 5I2IB 3QDAA 4MMZC 4UUJB 4FLRA 4JFUA 3TJEH 3U7WL 4JVUA 4ZQKB 1NSNL 4F80A 2YDRA 4F79A 3QCVL 3S34L 4HCRL 3U9PL 4L3EB 2A1WH 1XF5B 1C08B 4TTGA 5J9PA 4N90D 4Y1AD 4ERSL 4L4PA 1YUHB 1A7QH 1TR1A 3HKFA 3BCDA 5SWSB 2ZCHH 3D25B 3QUYB 5ADOH 1WZMA 2E6PA 1R86A 5DJ8A 1WJ3A 3QAZB 4RZCA 5EU7E 3ZDZF 2ATKB 3ARQA 1DQQB 2K9UA 3IDYC 1RIUH 4QHKI 3IXAA 3BHBB 4F33A 5HVGB 4X99A 1DQDL 3HS0A 3HG3A 4YHLL 2Q86A 1RHFA 2EKJA 4JFFD 4Q9QH 3QWRD 5C8BB 4RIRB 2ITDA 2WM0A 2R1YA 4XMPH 3MLTA 3VMNA 4YXHH 1JAKA 2F18A 3PQYA 3V6FB 1ODZA 4UV4L 5L0QB 3MBED 2XFYA 1NLBL 2VXUH 3A6CL 4YDVB 1JD9A 2WWCA 5AD0A 2F8QA 4L9LA 4B0MM 2YN3A 1GZJA 4UQ2B 1SY6L 4ZPVB 1S9KC 1UG9A 3CFIC 4KMLB 4F7TA 5IB2B 4M43L 4ZFZB 3REVB 5IEHA 1CDHA 4BH7A 2H9GA 1EEZA 4XHJC 5GIRB 2G9HA 1TJGL 2CUIA 5DHXB 4EDWH 5DYOA 1OAYH 2C26A 3MRDB 3IETA 3U48A 1VADA 3TNNB 3T08A 4RQQB 2VIRB 1NMCB 4QCIA 3VW3H 4AIUA 1PYWA 4HUUB 3CBWA 1YMHA 4BQ2A 1P4IL 1YJDC 3TNMB 5HDQL 4WY7L 3O9NA 1JPGA 4X9YA 4O2FA 3T3PF 2QSQA 3WQWA 4OZIB 5EZOL 1N3NA 4QF1A 5FL1A 1D9KD 4MJ6B 4Q7NA 4D3CH 3MREB 4EKJA 2DWEA 1CIDA 4P59L 3VFSB 1FCCA 4CVZA 3WD5H 1GGIH 3ARGC 1FL3A 3PN8A 1CXIA 4W4NA 5JO5A 5A2AA 4WSJA 5DUPL 3HFML 3IKCA 1NDMB 1V6WA 2YPLA 1NDGB 2H32A 3R06A 3U7YH 5L9DL 1FORL 3TTQA 1UR1A 4D72A 1U3JA 3D48R 2QSTA 5B8CA 5DT1L 2UY2A 1ISYA 1FSKB 4ZMAT 1Y0LB 4RE4A 5MI0B 4LQFH 4PJBA 1DFBH 4NC0B 1F8TL 2RCSH 4KJPD 1RUAH 1C1EH 3F62A 4HPYL 1KR0A 3QH3A 1KXQE 4KROD 5F9OL 1OVZA 3MLUL 2GJRA 4P4KD 5GJTL 4S1QH 3NUKA 1EMTL 1GJUA 5AG9A 4YE4H 2X2YA 5GNXA 3PL6C 3IFOB 1A64A 3PXJA 1R85A 2DBLL 3S8WA 4XBPB 4W5ZA 2VLRE 1IGCL 1CDJA 4YXHL 2AJ3A 5B3NA 1L6XA 3U46B 3WJLA 4CD8A 1QI3A 3CSPA 4H41A 5IQ7L 3GXDA 4NUJA 5D5MA 4PJ9B 1K2DB 1NAMH 2EC9T 3PP3K 1I85C 1TQBC 4Z5RA 1GHFH 1OL0A 3L3IB 3AMGA 3JV4A 4N8CH 3I6LD 1OSEA 3QQ4A 1BBDH 5D1XA 3QUKB 5I71B 3T4AB 1CT8A 2PYFA 4RGOL 5H2BB 2YD6A 4MDIB 4FZ8L 4TOQA 1CL7I 3BGFB 4GI6A 1E72M 1JTTA 3OZOA 1PJ9A 3IFPA 3SDDB 1NSNH 4POZD 4UNIA 4FNQA 2A6KA 4HHAB 5GRUH 3GMMA 4LSUH 3L4VA 4CL7A 5I8KL 2BXYA 3TCXA 1X7QA 3DGGB 1MCIA 1AY1L 2CGRH 1T1WA 1BX2B 4H04A 3VRIA 1U0QA 4U0RB 5GJSH 3KR3H 1NFIB 3FFCA 1IZJA 1WT5A 3WBEA 3X12B 3RVUC 3NCMA 4HWBA 2XA8H 3CDYA 2Q8XA 2VDNL 2FHBA 1KJVA 5BMFL 1LEKB 1BPLB 4LARL 3QXDA 1DWFM 1IGYB 1DBKL 2JIXB 2KBGA 3C87A 3RL1B 1HH9B 3QEQA 3QO0B 4XMLL 1V6XA 4KKNA 4ACYA 4HKXA 3UBXG 4H8VA 4XVUC 5F89B 1U41A 3BESR 4HPOL 4HU8A 2BNRA 3MYJB 4QYOB 1FPTH 5IG7B 4QLJA 1BVLA 3QXVA 3KJ4C 4YHYC 3O9WA 2QF8A 3IYLW 3S7GA 1BQSA 4YO0A 4P46A 5TQ0L 3CV5A 2J7EA 1YJDH 1B3WA 1PEZA 1WUNT 1YEHL 5GS1A 5I1AB 2DL2A 1RJCA 1E6ZA 4HUXA 1NOWA 3OG2A 4XP5L 5DEGA 2X41A 3F7RA 1XGTA 4QRUA 1FNSH 5ERWB 2XVPA 1MJ7L 3FB5A 2O5YH 3LKQA 4NPYB 5GZOC 1FO0A 3PWUB 3ROLB 1W2KT 5KBNC 3EUUA 5HXMA 1N8ZB 1OT2A 3QDMD 1V0NA 3NABH 1J1XL 4PV9B 5MENA 2AABL 1KT2A 3C5ZC 1J9YA 5ABDE 4GSDH 4MMXC 4F7MA 3IVKA 4U0RC 4Y19D 3TYGH 4P3CL 4R4FH 3P0VL 3M8OL 1BZ9B 4APQC 4QRRA 4NKQB 4OI9A 4LLDA 1LO5A 4PCTA 1HHHA 4A4AA 3SKOB 1UWIA 2QJDA 1HJVA 4HBQA 3FT4B 5CUSH 3IU3B 1IC7L 4YC2B 3VI3F 4AL8H 3PWUA 3DDGA 1I4FA 1TVBB 1XGTB 2VUYA 4XP9L 4IRJD 3C60C 2ZJSL 3OKYA 4NM4H 3UR8A 1AGDB 3PV7A 1XCTB 3BGAA 3D18A 3MCKA 3IJ8A 4DGIH 3PHOB 5HTSA 1QFWH 1E4WH 5A8MA 4NT6B 3HC4H 1R75A 3ARSA 4U1SA 1NCAH 2NY7H 4YDLB 5JZ7D 4JRXD 4XTRD 1ZHBA 3FL7A 1AMYA 2EZ0C 1MW3A 5FDWA 1Z5LB 4XNZB 1CICA 5I73B 2R4SH 3QWQB 3GO1H 4JRYD 4LIQH 4K7PX 4QRPA 5DRWA 3HE6B 5FYLE 4F58L 2FBJL 3TZVD 3BSGA 4TSAH 3W26A 2NY1C 1AD0B 4E41B 3V6OC 1R3JA 3RRQA 1EEUA 5SWZE 4QEGA 1LE5A 3BD3A 2CIKA 2PYEA 4JZNA 1GGCL 3OKMB 1QSFD 3EYOB 4MNQB 3SDDA 2Z93A 3RM8A 1U2HA 1GZQA 3H7BB 1RK0A 4Q58C 5J1AB 2RFXB 1S7TA 2EDDA 1QBLH 4YDJA 2C5DC 4PJCB 2BNQB 3SDYL 4BFBD 4M5ZH 3MJ9H 4YHKH 1GOHA 2DQIH 5J89A 2H45A 4RGOH 1OQOA 4R27A 1CFVH 4ZXOA 2J6EA 3H6JA 1TCRA 3CH1A 1W1YA 4PJAE 1W2PA 3ZKND 2DYPA 1QTYT 4NRSA 1Q6DA 1A6TA 5JIHA 1E1FA 1K2DA 3CSYB 3P4MB 1EOMA 4U5KA 5GSRB 1W0YT 5FYJU 3VGBA 3QPXL 1C91A 5DMYA 3U46A 3QEUA 3FRPG 1FL6A 5FAAA 3ARWA 1AGBB 2ZOLB 5BYWA 4PD4J 2EE6A 3OA5A 4UNTA 4LRIA 2G5RA 3IFOA 4ZTPL 3S98A 1MRFL 5IVZA 1GGIL 2NXYB 2R1XB 4OLXH 1FNFA 5D70H 1KXVA 3CVHH 3QJHB 15C8L 3O6LL 5EN2B 1NL0L 2NXYC 1PLGL 2VH5H 4D2NA 4F7PA 1BTCA 2IEPA 1I9IH 4NQUA 4E42A 2WC3A 3A24A 2BNUA 5E5RB 4JCLA 1QACA 1RQ5A 1F4XL 3WBAA 1T5XA 1FNAA 2AJVH 4QT5B 2HT4D 2DSUA 1S46A 4OCWH 2YIHA 2H32B 3R06B 3HPJB 3BUPA 4C57C 3LPGA 4HD9A 3EMCA 2VERN 4X9GA 2EE2A 5I76B 2VQTA 3BD5A 2DKMA 5CEYB 1HHKA 5C0CA 1RUKH 4XI5C 2AJSH 1SR0A 2F7OA 4NQTA 3A6BL 4R96A 3W0WE 1IEAB 3P2TA 1VKXA 4LCCA 2P8PB 3OKDB 2P8LA 3QEQE 2LV4A 4QRRE 2FGWL 4GRLA 2CDEA 1SJEB 3H9SA 1OGAE 2IFFL 4HF5L 2OW6A 3BPNC 2I24N 2BY1A 3ARBA 3TPUB 5BZWB 3DX4A 4X7EC 4IHOB 3BPOC 5HYEA 2CDFA 4LLQB 3RVXD 3P73B 1T83C 3OGCB 5JW3H 4C56D 2EIZA 2Y1VA 1YC8A 3MA7B 1FG2B 2ZPKH 4XBEL 4G7VL 3STLA 4K2UL 1IILE 5FYKD 4UQ9A 2NY5L 4M7LH 1JNEA 1QHOA 4JZJA 4ATWA 1SM3L 3K74B 4YGVB 2CNCA 2XWJA 5FGBC 4F7EB 2VLME 5KOMC 2NPLX 5DD5L 5BVJA 5JW5A 4C7GA 5FA3B 4MAUL 4JY5L 4PN2A 3HPJA 2A6DB 1NJ9B 5F71A 1G1CA 3VH8A 2X4RA 4KV5E 1QSEB 1NANH 4MAYD 4WU7B 5F97E 3HAEG 1H0DB 2VWEE 5FXCH 3EJSA 2CSPA 3ZE1F 1BMGA 4NRZA 1F6FB 4NQSB 4LP5A 5E9DB 3W39A 1KJVB 5H37G 4K23H 3E8UL 4RX4D 3QUZA 1U30A 3O81A 3S2CA 3NVQA 4KJWC 3X3FL 2NT1A 3M07A 2QLYA 4OB5H 3O3DB 1P7QB 2Q3ZA 3HS0B 4CN1A 1LO4H 4FNSA 3MRQA 4Q9QL 1WIUA 2W65A 1KJ2H 1NCBH 2R4RH 4TTUA 4R0LA 1M04A 4QRQB 3B2UD 1Q6CA 2V5MA 2ZOLA 4FNRA 4APQB 3MJ9L 1XCQB 2Z4QA 3STBA 3JWDH 3C8DA 1T04A 3WFBH 1FDLL 5TJWK 3VJ6A 4HV8A 4WFGD 3NGBB 4L8CB 1MCOL 5HY9A 1QEWA 1PQZB 5KN5B 4PJHB 3QUZB 1LO0L 5MEND 4X9IA 5CPTA 4GXVL 1UEMA 2WP3T 2VYRE 3MRBB 2Y07H 3U36B 5C07E 2QPSA 2WWDA 1R3LB 5JDJA 1P53A 1WTGT 4TN9A 4NSKB 3ULUD 4WTXA 1U8HA 4PY7B 5DS8A 1F6LL 3T1FA 3DX0A 1XGYH 3B9DA 2OCFD 1AHWC 1SBBA 1NCNA 3S35X 5HI4C 3OAZK 2GK0B 2VDRH 2XZAL 1OWQA 4U7MA 3RWFB 4ORGA 2NYYC 2NT0A 3TTSA 4F57H 3BQUC 1TQWA 1BLIA 3J8F7 1WAAA 3LCYA 4UAOC 1J0HA 2FO1A 2X9WA 4L4VD 4LLMA 3JTSA 1WSST 2FJHB 3BE1H 4OZOA 2J4WH 1JPST 1INDH 4KVNH 4HBCL 2ZKHH 1LEIB 1JF6A 3VNZA 3RWCA 4C56B 3GJFA 4RWYL 1G01A 1R3JB 2BSED 1C5DB 4JZOB 5CJOH 5T1MB 3V5DA 1K5NB 5IVXA 4ISVA 2PNDA 2PR4H 3P30H 4NUGL 1V3HA 1UB6A 3CDGB 4EUPA 4FN0A 4JRYB 3BT2H 5TE6H 3SY0A 5I19H 1FP8A 1NCCH 3SKJH 5MERA 5EUOF 2IQAB 3PJSA 5D6DA 4H2CA 4I18C 4M03A 4K3JH 1Z9LA 2GJXA 4HBCH 1MJJB 1PLGH 5IKCB 1WPCA 4EOWH 2CKRA 5FB8B 4NT6A 3ILQC 1NAKL 4GSDL 1D5BA 3VE0A 4OIBA 4N0FB 4PLKD 4N0YL 3MGAA 2Q7YA 3GZKA 2GKIA 4O5LH 2X7LA 2XYCA 1V7MH 2VQUA 5EIVA 4HK0A 3MNWB 3QFJB 2W60A 2XWTB 5DFTA 1FVEA 1BQHG 1TNNA 4PJAF 1NLDH 4OZIA 2WHMA 3PQYE 4KXZI 1QO3A 5TQ2L 4IRSA 1FGNL 4NC1C 3K7UA 1JI1A 3DETC 4WI7A 5INDB 3CMJA 3RPIA 3GZAA 1MFDH 4I3GA 4QLLA 4JFPB 3UJTL 1WFTA 5HDOA 5FGRA 1WF5A 5GRYA 3QIBC 5JHDB 3CLEH 4Z7UE 1LP9B 4UFIA 2UWEE 4GKNB 4S1SH 1KBGH 1JV5B 3PWNA 2DKUA 4FQCL 3HZYA 4DQOH 2D7MA 1VIWA 4PJFF 3ARTA 2QADD 3SCOA 3PZTA 4HA4A 1Q1JL 2V2XB 1TZHB 3AMDA 2EE9A 3TV8A 3BP6B 3MV11 4GW1B 1A3LH 3VFTB 1BF2A 3TEUA 5DUML 2LAAA 4Z7QE 2NTFA 1UYWH 4KRLB 2J6EL 2AJVL 2DQHL 2OI9B 3DX8B 1WV7T 3BN9D 3NFPB 2GVYA 1P7QD 4MYWB 5C0IA 2OTWB 3JTTB 1A5FH 4D71A 2RAMA 3HTLX 1YEKL 3MV7A 2FX8H 1ZT4A 4ZEPA 4G8FB 4PJIA 1JZ5A 3CIQA 3OR6A 4BF7A 4HJJL 5HGAA 1PX3A 1KPRA 1AI1L 1R0AH 4LASL 4EVNB 4KKCC 5IFJB 1G7MB 1KOAA 1MFUA 1NMBH 4TSBH 4X4XA 5DTFA 3AB0B 1JFQH 3ROOA 4HXAH 4Z7UA 5D1ZB 3KPRD 4O4YL 1W3HA 3NZHH 1RY7B 4FLSA 2QHAA 4LYPA 3VWJC 5AYBA 3MA9L 5AYQA 3T0EA 1NFDF 3K1DA 4CCEA 5FCUH 4M7ZB 1ISXA 4PRNB 4YUEH 5DMGD 2V3GA 1SBSL 2DLEA 3WJJA 3UPRA 2VE6A 1BJ1J 3K4ZA 2C7UA 1B0WA 3U5UA 4ELMA 4FQLL 3H55A 2CK0L 2A2QT 1J05B 1EDTA 4N0CD 2A6DA 4XH2A 5CQ1A 3PTKA 4GW1A 3U1SL 3SO5A 3WS3B 4FTVE 2G3MA 4NZRH 2XPGA 1MLBA 4NRXA 4F58H 3SJVA 5JTWA 1LE9A 1RUQH 3PZGA 1M05A 3HZVB 1TTFA 5A2IH 3UJTH 4WJ5A 3FO1A 4A2MA 4Y2DD 3ES6B 5D1ZC 1F4YH 5C0EB 3FAWA 4ZUUB 1BIIA 1TENA 2WSKA 1DBBH 3PV6A 3O2VH 1U8QB 3HA0A 3BEVA 2MCG1 1O7DC 2YD5A 1I1AB 2HVJB 1ACYH 4JKWA 1MREH 3A22A 5DJCB 4Z6AT 3LQAC 1I7RA 5HYQA 1OAKL 2X4UB 1TJHL 1WIPA 4CKQA 4QY8B 4KGLA 3HMXA 4L5FL 5M94B 5HNNA 2X4NA 3AREB 3EYVB 4C59B 2ZSWB 1AQ0A 2AJYH 5IMMB 1X44A 3SUWA 4UT9L 5LGJB 3OX8A 4I18A 5IVNA 3LS4L 7FABL 3D9AH 4RAUB 3RU8H 1A14H 1JNDA 2W67A 3TT3L 3WDPP 1LO4L 4LSQH 3C6LA 1B0GA 2IANE 3APGA 4TUJB 3O2DA 4J4PC 1LNUA 1G7IB 4Q0XL 1O5DT 3TN0C 5CKAA 3NFNB 4K7FB 5HHME 2O61A 1B30A 1S7XB 1B88A 3UDWC 5EFDA 2A73A 5AZEH 1UH4A 5A69A 3RUGE 1NEZG 4URIA 1FE8H 3BUYB 3S6CA 1UA6L 4LPVA 3MBEC 3A0OA 4PJCF 4TTDD 3EJTA 3CAFA 2AP2A 3TO4D 3ECBA 5LWYH 1H5BC 1GQLA 1WQVT 2J3SA 3M45A 5KVDL 4RSVA 3AY4A 1XR8B 3PABB 1LEIA 4NRYA 4D0DB 5IVOA 4N8CL 5TDOA 1K4CB 4G9FD 5BXSA 3BJ91 3MJ9A 4BQ8A 4YIQA 1AGBA 2QQLH 4PBGA 1QKZL 1YNKH 2NX5D 2OLDA 3S36H 3HG1E 2DTSA 1WFOA 3PXHA 3ZDXE 3NIDE 2B5IC 4MNQD 3WMBA 1B0IA 5D8ZA 3IFLL 1YEKH 1T5WA 3SE4A 5DHVH 5DQJA 3DSNA 2HVMA 3NDYA 3OXSB 1W9VA 1K9FA 3QXWA 1YYLL 5C07D 2HTLC 2IGFL 3K4DA 4L4TD 5T5NG 4FNPA 5A94A 3O4LA 4PJAA 5E8DH 3WDQA 1E27A 1A3LL 1Q9LA 5A16B 1DSFL 5D7LD 1OT1A 1U33A 1QYGL 3W0WB 1FZJB 4P5MB 1PG7H 5J1AA 3WY3A 1IM3B 2HH0L 1BFVL 4JM2D 2YEZB 1A4KB 1HKJA 1ZTXL 4PYGA 1E55A 2IQ9H 3MROB 4ZO8A 1L7TH 3UTSD 5A6SA 4PG9A 2CIKB 2NXZD 2YA2A 5GRVK 4PRPD 4Y4FA 4KK6C 2VLKD 3AB0C 2WZIA 2FH8A 2BRRH 3WIHL 3LKSB 3BKCL 5H94B 1SEQH 1LK3L 3MRGB 1AVAA 1RULH 1VHPA 3HLAA 1M53A 5IFTA 1MCCA 5F9WC 3G5YB 3N1GC 3P77B 1HZHH 2X1OA 5TDPB 2VLKB 1ZV5A 4MX7B 4WEUD 1H0DA 5EIIA 1WBZA 5HHOE 3CO4A 2HFTA 3UTOA 3HMCA 3NFSH 3N50A 3SCWA 3WKZA 4OM1H 2WMGA 4PRBB 3HN3A 1HKIA 2G75A 2XFXA 2DT2A 1A6ZB 3R8BB 3ZTJG 4YGVA 4F7EA 1H9VA 4X7CC 1BYAA 3GMQA 1Q9OB 4MWFB 3RGVD 1ZOXA 2VDLH 3X3FH 3PL6B 4XVSH 4K07A 5KSBB 2FYYA 3DTXB 2EDBA 4G6AD 5FKPB 1C12A 1NAMB 1KELL 1FOBA 2HG5A 2AK4D 1E0XA 5E8PA 4LHJB 1XC6A 4ZSOE 2FEEI 4OCYL 4RAVA 3WUWG 5FIEA 5A6LA 1T0OA 4I2XB 3IJ9A 1MFBH 2CDFB 4DWSA 3SOBL 4CU8A 5IF0A 3RDKA 5E2UL 5KSBF 4MNMA 2X1XR 1NFDA 1K8IA 2XA8L 3EJPA 1QNQA 3ES6A 1VEMA 1ZAGA 3MGOA 1T1ZA 3HAEB 2YUWA 1ZLSH 5HVWA 2AEQL 3N15A 2EDQA 3HC3L 4ODHH 3LEVL 3D0VB 3TP4A 2OX5A 2VLLA 3PWPA 4WKAA 3CSGA 3OIHA 3L5JA 4UMGA 4YUEL 2B7DT 4OCMC 1R87A 3IXTA 1HHIA 3MFFB 3V9FA 4JFHE 4L8SC 1JXKA 5FECB 3VX0A 3CZEA 3W2DL 1R5WA 3RZCA 2YR3A 4KPHL 2YC1A 1PKQA 4H25A 2DIJA 1S5IL 1PVHA 2EDKA 1OGAA 4E42B 2ZP0T 1I8KA 2P4AB 4AXNA 2DSKA 1HVXA 3QXDB 3NBNA 4CDGC 3DHJA 1SVCP 1YYMH 3KNBA 5F9WB 3GYCA 3ET9F 1E9LA 1LEGA 2UY3A 3VVGA 2DOCA 4WO4B 1OTSC 3ZDXF 1E4WL 2YBUA 4L8DB 3GH5A 2IF7A 2RGLA 4WFED 4Y8DC 2ORBH 3D5HA 5JW4R 4OOZA 4W89A 2VLKE 3PZOA 5DXWA 4FQHB 5EC2B 5F7YC 1XYZA 4PJ9D 1BGXL 4JG1H 4GKZA 5FYJL 4YJZL 3QNZB 1RZIB 3ZKNC 3DHMA 4LU5L 4Y4HB 1DQTA 1NFDB 2QLVB 3AFLA 1EK3A 1MUJA 1HP5A 2L7JA 3BQUB 4UINL 5IV2A 3LIZL 4U0QB 1A6TB 1WCGA 2CPCA 3G5ZB 3FZUD 1B3XA 1CQYA 2F74A 3RKDC 1CXFA 4N9GB 1U2CA 5CD5C 4KRPD 4YHIB 1QYGH 1J86A 3VIKA 3C6SA 3R1GL 4UIKH 4Y16B 5ABGA 1YEGH 4Y5YA 3GXMA 1X5ZA 4YHPA 4ZO7A 1EFXB 2F7PA 3DIFB 3WMSA 3BUTA 3HUJB 3MUY1 5T1DH 1K6AA 2A9NL 5J11C 2PWEA 5IMKA 3IDYB 1JZ6A 3TM6A 1KF9B 4KJWD 1K3ZA 4JHBA 4LSPL 5EO1B 4WUUD 1E40A 3PZVA 5IK3B 3VMOA 3HZYB 5EZJB 3EYOA 1IEBA 2VZVA 1JGDA 3WQ5A 4RISL 1I7TB 4U1NA 3VG9C 2IADB 1J1PH 4A6YL 5KAQF 4M7KL 4ONOA 1X5IA 3JSSA 3MJ6A 3GH4A 2CIIB 1ZB5A 4WO4A 4XNUH 4Y16C 5E70A 1N0XL 3W5MA 3AY4C 5DRWB 5GGSY 2WUBL 4OF7A 1MCDA 1BF8A 4G3YL 1OD0A 2JJTC 3ZKMC 1UCBH 2WNWA 1A7RH 1YNLL 3I75B 3RWDA 4V1DA 3SDXA 3WS6A 2J74A 3L95B 5FHBH 3QO1B 1UA6H 3GXIA 4NXKA 5TFSL 3MROA 1OAZL 4E4PA 5F1OB 5CD3A 3PQYD 2VC2L 3G04A 5I9QB 5I66A 3OMZA 4PTXA 2VLJE 5SX4H 4EIZC 3W4RA 2M26A 3OGVA 4G9DB 4JFXB 4KUCF 5HHVH 4CVXA 3O2DL 1OBAA 1VRXA 1NQBA 2GTZA 3Q6GL 2IH3B 3SHSA 4B53A 4KRUA 4RGMB 1GHRA 2AK1L 1T2JA 3LD8C 2E5EA 4XPHL 1T21B 2F5BL 2V9RA 1DWJM 5F9AC 3FMGL 4WSKA 1EUTA 1HHGB 1I8LC 3CUPA 3IDNB 1G7HB 4KDWA 5T33H 43C9A 1D6VH 2ZX5A 2WQRA 3DX7A 2ESVE 1FIEA 2OJEA 3TO4B 4B16A 4BQ4A 1A8JH 2ATPA 2NY1B 1AC6A 2BDNH 1ND0A 1Z3GH 2XN9B 3WY4A 2EYSB 4W5UA 5CGTA 4EQ2A 4IDJH 2GJ6E 1RZJH 2CRZA 1BQLL 1YEEL 3LN5A 4MAYC 4JRXE 4MS8C 5F1IB 3OSKA 1ISZA 1MSPA 2DGAA 3MRLB 1H3PH 1CU4L 3MPCA 4OUUA 1SYVB 2EICA 3RGHA 1H0GA 4Z78A 2HRPH 2W61A 3C8HA 2NY6B 4Y5XA 2BSTA 3WENA 3QUML 1A3HA 5I66B 5KVDH 3ZKSD 1F5WA 4G6JH 3MODH 4XP1H 4ERSH 3I3EA 2LU7A 1OQXA 3BAIA 1JGVL 2P47B 5MEPB 2VJXA 1L6ZA 4V1DD 4JG0H 2Q6WB 2G8ZA 2YXFA 1DQLL 5HVFB 1H3VA 1G7JA 5E4IA 1EHAA 4M3JA 5KW9H 3SO3C 3TWCH 2V5RA 3KXFB 1HK6A 5C08D 2PO6C 5DQ9B 1KFAH 1TZGH 3S4SB 3SKUD 4ZAKD 1XT5A 5HYIA 5C09A 3NPZB 4KAQL 5IMLA 1IEBB 3CXHJ 4XP6H 4YHZH 3NYDA 3DUUA 2UWEF 2VDPH 2Z35A 3WSQL 4B3KA 5MHSE 1AIFA 5ESVA 4MD5A 2A74A 4XXCC 3CLEL 3V0WL 5HPOA 3H42H 4PY8J 2DM7A 5ACZB 2HLAB 5C0FA 5JW4M 4D9RE 4XT1C 5DJXA 3C2AL 1WDRA 2PWDA 2F54A 3DRQA 3JV4B 2ICCA 1FNEB 4OKVA 5GHWL 2VZ1A 5EFIA 4UTBL 4PTVA 5A8OA 5A2LH 5E0CA 4DGIL 2B2XL 3S5LB 4LHUG 1S9YA 1Z9OA 4XVTH 1DCLA 3CFJA 3GIVB 2DQHH 2DIAA 2XPGB 4Q7DA 1GYAA 4BFIB 2QBWA 2Z8WC 3BDBA 3R1GH 5IBUB 1QFOA 4CAGA 5J1SC 4WVRA 4IPNB 1IAKA 3KPRB 4YIQB 2L7UA 3B9KD 3IDXH 1G6RL 4PUBH 2C3WA 4Y5VB 5BW7A 2GFTA 1CLZL 4RMUA 4U6YB 2OXHA 2FNBA 5HGDB 1NC4B 4EZMA 4PJ8C 2JB5L 2W0PA 1UACH 2E8ZA 2DLHA 3BVTA 1N6QH 3RTQC 1QI5A 4N0UA 4NQCD 1BM3H 4XVSL 3IFLH 2YMXH 1C8QA 3OKKA 5DUPH 4PMQA 4PJBB 1A14L 3NZHL 1AGEA 4XC3H 2EDWA 2R2EB 3WV0A 3IXTB 1U8IA 2C8NA 5ENWB 4FLOA 1I9IL 4TOYH 4P5KB 4LSDA 1A7RL 1YNLH 2D22A 3AS1A 1NUFA 5C08E 4Y4KD 5BO1L 3DROA 2CJUH 1UYWL 5IT2L 4P9HC 4U3AA 4AZHA 4PJ5B 2YPVH 3PDOA 3EFDL 4O9HH 5JXEC 4Z7VE 4KVCL 4X6BB 2ZUQB 4Z2HA 2VZSA 1OTTD 2OYLA 3QFJE 4XGZB 4HUWA 2CBIA 3GSVB 4FS0A 3NCBB 1F4WH 1RAMA 2B1AH 2OR8A 5D1ZD 4MADA 5IXEA 4D0CA 2F58H 5EDXA 2XM1A 1QNSA 5JPMA 3ZYJA 3G5VA 1A1OB 1HNYA 4GRWE 1ZS8A 1R3KB 5HI4D 1DE4A 1DUZA 4N5ED 3FNDA 1NUDA 4WUUE 4NUGH 3CZSA 3PHSA 5GRXG 1FYTB 2EDOA 5CBEB 1XH2A 3ARFB 1B1YA 2FDMA 3QUMB 4ODXB 3T65A 3C5JA 1MLBB 2WUBH 4NRXB 4PD4K 5ABHA 5BS0E 1LE9B 4H8WH 1JGVH 3KHQA 1I3UA 2VH5L 2HT2C 2CRYA 2FYVA 2XFXB 3H8NA 3KLAB 4OD1L 3G5VB 2CXKA 2E7LA 1P9MA 4AEIL 5IBTL 1IGML 3EDDA 2NZ9C 1RZKC 2KDGA 4RISH 4F57L 5EC1A 1OM3H 4XVTL 2VDLL 2J8GA 2FGZA 3O8XD 4MB5A 3TN0D 3WLWC 1TPXC 1BGXH 4JG1L 5FYJH 4M80A 3KL5A 3V6FA 3MR9A 1MJ7H 1C5BL 5FHAH 5C0FB 2UYLB 12E8L 1TETL 1HT6A 3AXLA 1ZEAL 1GL4B 3HRZA 3UJJH 1GAFL 3HRPA 4X98B 3U2SB 2FL5A 5EO9A 3VG0H 3K8MA 5C0BB 1ITBB 3WELA 1UACL 3OGRA 1KG0A 1LWJA 3QUZC 4PJXE 4AMCA 3CFKA 4NCC1 5DMGC 5IOPB 2VURA 8FABB 5CEXB 1MI5B 3VXMD 2BP3A 4RGNC 3SCSA 2ILLA 3PBGA 5JOFA 3WFZA 1VGEH 2IXUA 3AYSA 1MIMH 4CNIB 3VXUE 3O4LD 4X98A 4Z18A 5J9PB 1XAUA 5CIPB 4GKSA 3L3JA 1IM9A 1GPOL 1U58B 3JTTA 2XFFA 4YEEA 4YHNA 2WWKO 5EUKA 1U9KA 2R0WH 3BSHA 5CXPA 4ATDA 3QG7H 5IVXE 1IARB 4J3OC 3VGHA 5DD6B 1X5LA 3QDGE 4AD5A 3OBAA 4TVDA 4P9HL 1BFSA 4W70A 4YEFA 3RWHB 3QI9D 3VXME 4RGND 4OUUB 3N1PC 3HZMA 4D3CL 1JRHL 5DSCA 1Q94A 1JK8B 2DQEL 1FNEA 4OKVB 5HD8C 1CTNA 1B4JH 3EDFA 1F4XH 3QNXA 4HKJA 4QHLB 3MA7A 5E6ZA 2GDUA 4KI5E 3LX9A 2X4SB 3VI4F 2XZQH 3SJVD 1X5YA 2DJSA 3TO4A 3TVMD 4XC3L 2HJLA 1SHMA 2UZIH 3OGSA 3KNBB 5DUBB 1JGLH 4L8BA 2P48B 1QRND 4NKOA 2APXA 3ARBC 3DVNA 2WAGA 4J4PD 4GUPA 1MCKA 5FV1L 3C6LD 3BPNB 4PJEA 4S2SA 4EXPX 4S1RL 3KPQA 4DAGL 1UD4A 2NX5E 2AI0H 5ACMA 4BQ3A 4TUJA 3RUGB 2F19H 2EEAA 2WHKA 1VBRA 3KPSA 4P48A 1MLCA 4WTZG 4H7VA 2E9MA 1MFAH 4DO4A 1FL3B 2IUZA 1HDMA 3QR3A 3VD4A 4HX1B 4B7LA 2YL8A 3AMLA 2MJWA 4O58L 3GSWB 4D9LL 1JGEB 2FB4L 4FXKB 1J8HB 3P4NB 2GY7B 3OKKB 5BW7C 2XY2A 3SUTA 2BSRA 3PGCB 1LGVA 1PY4A 2ZX8A 4HP5A 4O4YH 2F19L 3BXNB 2DIBA 4OD2B 5IVXF 4UBDD 4XXCA 4P9MH 4YHLH 3OR7B 1AQKL 5LQBL 4QCIB 1QI2A 4DK6A 3A5VA 2WK2A 1QBLL 4V27A 4JVWA 5HGDA 1UXSB 4MQ7B 1JXJA 1IGTB 1ONQA 2I07B 3U30C 4JZJB 5IJVA 1MH5B 4PRWA 4GAFB 1JPSL 1OB0A 4HAGA 5E8DL 4K3HA 3GSNH 1CF8L 4PRAB 4AK1A 2APFA 1F4HA 1ZHLB 1S7UB 4M9OA 5E2JA 1SEQL 2J7HA 3CNKA 4JKPL 7CGTA 1MHCB 1JWUA 1PAMA 5TE7H 5EIQA 2EYTB 3SKJL 4AYSA 4YHPB 2RHEA 3GKWH 3OG4B 2YPKA 4YBLC 1ZLUK 5D7JA 4ZDHA 3C6SB 2CGRL 4YDLC 3MX0A 1FV1B 1DQML 1XGPB 4YHMH 3U36A 5I1GL 4EDWL 3RIFF 2GIYA 4FXKA 3KYNB 1ZJBA 5AZ2H 2CQVA 1WO2A 3BP7B 1VEPA 1XIWD 1SYTA 5I15H 5C6WH 4PJ5D 2IC2A 1O7SA 5B3JF 1V02A 2YWZA 4OLEA 5JHDE 5D71H 4F33B 2AEWA 1L9NA 4GKLA 3NJ3A 3VM5A 5C3LD 1UWEL 2COQA 2ID5A 1XRVA 2ERJC 2O5ZL 4EUPG 2WINB 1FFRA 4HIIB 5IGXL 3L4WA 4XB3A 5IESL 1U93B 3D25A 5C1MB 1RPKA 5GNYA 4DCQA 2MCPH 4Y19E 1YY8B 4PGCB 4HXAL 3N18A 5FOOA 1GQJA 1QNZL 2R8SL 5IHUL 2NY2D 1DQDH 4B9YA 3HE6C 4BKLA 4JFTA 5GRWA 2Q6WA 4P2QA 3FCTA 3H54A 3HG1B 1U8OA 3NABL 3X11A 1I3VA 2P5ED 2YPKB 2WPGA 3BFOA 1KB9J 1I7TA 4OD1H 4PGDB 4EIGB 4XCCL 3D69A 1BFNA 3MMUA 4OFKA 5GGTH 3VDCA 5EH1A 3NIFF 2F5BH 3BKCH 3KJ4B 2ZICA 2UY6A 3NIFE 1H5BA 4RNRA 1QFUL 4H1LH 4J3TA 4WI9A 3VFSA 4X6CB 3O45A 3S34H 4PMDA 4CGTA 3TPKA 2C0HA 5DK0A 1D5ZA 3T0EE 2BFGA 2FO4A 4G42A 5DK2B 1PS3A 4HGMA 2WLZA 3EJYC 5EUKB 1JPGB 4GMSH 3UDWA 3OLEA 2Z0BA 5FYKH 1TJGH 2JELL 4KKBC 1BVKB 5JQ6H 2AI0L 4P23D 2BNQA 3PP4L 4Z0BH 2WC4A 4Q2ZA 2BSRB 3PGCA 3F7VB 2W0FA 1NWRA 3TNNA 5DD5H 1C16B 1WFUA 1RJLA 2A73B 2IH3A 4Z7QF 3CVIL 3FB5B 4NPYA 3WDIA 5FOBB 5CBAB 3WNLA 1GH7A 3IANA 4EI5A 3PNWA 4XZUB 1O0VA 3VXQB 3P9WB 1X5XA 1FH8A 1N5AA 4PJFE 5DHYB 5CD3B 5FUOL 3O3UN 4DZBA 1E43A 1BQHA 3KPQB 2UYLA 1W9XA 4OF8A 2BNUB 4HJGA 2IPUK 4AZ7A 1MOEA 3MACL 4V1DB 4PRPE 2QEJA 5HD8D 4AM0B 3TYFB 2I27N 5I1LB 1WP6A 2OLHA 2JB5H 3QJHA 4HIJB 4NWTL 3BPCB 3OKOB 1FFQA 3MOBH 2F2HA 1B3VA 4WHCA 3EYSH 4E41D 2X4PB 5M7QA 1S78C 5IIEB 2H2PD 1U8KA 1JYWA 2EXOA 4Y7MA 3JWDC 4XCYB 4RAHA 1MIEL 4QTIL 1GGBL 4YWGH 3QZWB 3TO2B 4ENED 4L4VA 3WEXA 5M95B 1FL6B 5I23A 1GOGA 2VXTH 3RPKA 3V2AR 3JV5A 1CTOA 2J2ZA 2P5EA 5E8NB 4Q2ZB 1JDCA 3WLBA 3P11L 1S7WB 3O6KL 1EFXA 4TSCH 4X8JA 3RY6A 3ZJKA 1QBML 1W9DM 1JF1B 4HUVA 4Z7WB 4JLRB 3LKOA 3OKEA 2WWKT 1MELA 1SY6A 1UM5L 3KJ6H 1FNGA 1E6OH 4B3LA 5HYJD 2HTLD 4N8VG 2UZIL 4EE9A 1T6WA 4GW5B 3H7BA 3EGSB 1YY9C 1S7TB 1XGYL 1MFEL 2AJZB 3F6IA 2Z93B 3WNOA 2CO6B 3WEMA 5IB5B 2OR9L 1D6EB 3EJZD 4JO2L 1TMCB 5EC2A 3O9WB 4OV5A 5C2BL 6FABL 5CGYD 4MB1A 4MQ7A 4NYLA 3VFRA 5TH2B 2OL3B 2XKSA 3QHFL 1JNHA 4F9LA 2C1PA 3EO1A 1H15A 5EBWA 5LCVH 4RMRA 5A2FA 4J1UB 1OINA 1OP9A 2NY3D 3QEQB 3QO0A 2IQ9L 4MD4B 2P49B 4X7TB 5C0CD 5GRUL 1NMCC 2B4CL 2VN7A 3UZEA 1Q4NX 1U8LA 2OWXA 4D9QD 4KJQC 3A6BH 4BUHA 1WZAA 1PDKA 1A9BA 3WL1A 1I1CA 1I8KB 4JFEB 2B1HH 3BIBX 3JWOH 1R3IH 5K93A 2LQRA 1CDYA 4IOIB 2YD4A 5E6IB 1E6QM 3SCVA 4L4TE 3D4ZA 5J6GB 3CFEA 2DI8A 4W7WA 1KPUB 4HLZG 5D72L 5BQ7B 1YEIH 2F53D 2D3VA 1MHHB 1J1OH 1A1NB 1T22A 4P2QD 2GJ6D 2QR0B 4R4ND 4ORZC 2EADA 1GONA 3NA9L 4HWEL 5I0ZA 1N5YL 1PX8A 5BV7B 2A6IA 4PR5A 1ES0B 3HG5A 1MQQA 3E3QE 3MGOB 2XNAB 3HAEA 5TF1L 1WIOA 1RZFH 3C8KB 1NMBL 1UH3A 1JN6B 4DWHA 1SEBA 2XN9A 3WD5L 3BGMB 3B5HA 4D6JA 4S1DD 2ZXDA 5JPMB 3O4LE 1JUFB 1UB5A 3EDJA 4MNKA 3LHPH 4IS6A 2DRUA 2O5XL 3BDXA 1RZ8B 1T20A 4GPNA 4HWEH 1N5YH 4NRRA 2BXZA 4U1HA 1QOXA 3KWWA 1UZ1A 4KRTA 5D4QA 2XNAA 5SX5H 3LQAH 3F5JA 5T5FH 3UTPE 2BRRL 2QV2A 4EBQL 2A77L 1UWSA 3UJIL 1AGCB 4L3CA 4MD0B 3LD8B 4Z77A 3VXSB 5E1QA 3QWOB 4CADB 2F1AA 4LOUD 3FQTB 2GTWA 2IH1A 2UZYB 1KGWA 4ZPVA 5KSAA 3LMYA 4FXGB 1CVSC 2MNUA 2BJML 1KCLA 3WXVH 5KZ6A 3VO0A 4I48A 3T3ME 4EK7A 3EOTL 1N82A 43CAB 3JWDL 3SDCD 3ZM8A 5DMIL 5MENE 1U3ZA 1CLYL 3PUCA 5ESAA 2X70B 5HBFA 5F3BB 2HAZA 2KQNA 4UU9B 3MUZ1 2DTML 4QHMA 3HC0A 3VDAA 1V3JA 2GTWB 1NDMA 3L1OL 4OFDA 4JAWA 5GGVL 5J6HB 5AC5A 5EOTB 1V6VA 2JCCB 5SWQB 3C5SA 5B22A 3JBG7 2WINA 2W66A 3RNKB 2EC9U 3N13A 5FKYA 4GOSA 3MA9H 5I73C 1PKOA 2E27H 4HHAA 5EZIH 2CBVA 2OZ4L 1JPFA 5AYUH 2QQNH 1KB5L 1ZBCA 1EDQA 1FN4A 4HT1H 1HIML 2BFVH 2NSXA 3RUGF 2WHJA 2NW2B 4I0PB 3PWJB 1Q0XH 3SQOL 5EULV 2HISA 3PGFH 4LKXB 4PGEB 4KHXL 1ZGLM 4UV7L 5DD1H 1LMKA 3EBVA 1GUVA 3KPSD 4RMQA 1AR1C 1F3RB 2GSGB 3G5XA 5IGXH 1HWGB 3V4PL 2UV3A 1RUAL 4IIQB 3ZHKA 1IGMH 4OIFA 1TZHA 4WWKC 1GJIA 4NUJB 5D5MB 4JQIL 3NCCB 5INCB 5TE6L 5CZVL 3RX7A 5C07A 3U4EA 3T65B 1N2RB 1EMTH 4LEXL 3S96B 1QRNE 1ONQB 5IJVB 1CE6B 4R6UA 1LG1A 5F1SA 4GG8A 4DKDC 1EFQA 2YD7A 3L6FA 4ENEC 4YFLI 2C1OA 4NKDA 1IQWL 4M6NL 4D6IA 3DMMB 4PRNA 4FMFA 2ZNXA 1BLNA 3MV9A 4G9FA 4L3ED 1HKLH 2YD2A 2F15A 1UZ6F 2YD9A 1QP1A 5JXED 1CPUA 8A3HA 3NOIA 5K9KB 3WN6A 5TH2A 4PJ9C 4YH6A 4Z7UB 4Z95L 3G6MA 3BO8B 4JRXA 2GY5A 4HEME 3L5XH 2YPLB 3O41A 1Z9SA 1MCHA 2EKSB 2BOBB 3U7VA 4PGBB 3RY6C 4HIEB 1U6AL 1FFPA 1WGOA 1DWGM 1HQRB 2PO6A 3WUEA 1AGCA 4Z77B 5EUOB 3NGBC 4IRJA 2X4OA 2I60L 2VR9A 2R39A 4ZUSB 2BVEA 5TPWL 4ZO9A 1N3NB 5MP6L 2VOTA 1JZ3A 1QWUA 5CS7A 3GSQA 1J9CT 5HHVL 3UBXA 1IAOB 3RNQB 4M9PA 4TUKH 2XQYK 3VGGA 4CVWA 2Y72A 2HVJA 5DJCA 3WCYA 3LRLA 3EJJX 5DRXA 2Q76B 5ITBH 2WSPA 4TX6A 1CDCA 5AG8A 5B21A 1OF2B 4AY1A 3GJFB 4JFYA 2CKBL 4Y1AB 4KRNA 3WFHB 1ULVA 4LCCB 1UM4L 1IV8A 3D1MC 3L4TA 3FB7A 3TBWA 3HZMB 4HOZA 1KN4L 1T4KB 1Q9OA 4MWFA 2F8VA 1ZBVA 3RWHA 3REVA 4QDMA 3B4NA 2H9GB 1N6VA 2XTJB 1EBPA 3T1WA 2W0LA 2CLZA 4OAWA 3M1BB 5LXGL 4U6XA 3ZKMD 4JGUA 4TUOA 5KVGH 2R2CA 3QDGA 1OB1B 2F54B 3DRQB 3FJTA 2E7LC 3DI2B 5E2TH 3RTQD 2YUVA 5DZOA 1EHNA 1TQSA 3V6ZA 4B7IA 3BZEA 4AEHH 4LGPB 4BQBA 4XP4H 3NA9H 3AFBA 3ARDC 4OLWL 5ICYB 1B2WH 4X0KA 5TGBA 4D6DA 2HJFB 5A6AA 3DROB 4HIIA 4IISA 3VINA 3GH7A 1UR0A 4PMUA 3VFRB 4GQQA 4YBHA 4K94C 1AP2A 3WJLC 4ODSH 4U5IA 2YS4A 4JKLA 4HG4K 2EEXA 3WD2A 1F97A 3MOQA 3LAFA 4DN4L 3WL9A 2MQCA 3IDUA 5C0BA 1YUHA 3T0WA 3NZ8A 5D1XD 5ICYA 2R4RL 3CSYA 3P4MA 3UESA 2XIIA 3UBXI 1EXUA 5FO9B 4FQ1L 2BVPB 1I1YA 3CH8A 5JDSB 3QEHA 1FLTX 5I1KH 2W63A 4JO1L 4PJAB 4Y16A 3ULVL 2VZOA 3DURB 4JHAL 2Z91A 1YNTA 1UD8A 4NN7C 4OM0L 2FE0A 4N8VB 4W93A 5AAWA 4BSWA 4KROB 4Z5RB 2NTFB 3WY1A 3O45B 4I0CC 1N0XH 4C58B 2J5LB 5L2KB 2W0KA 1CR9L 3B3IB 4GZEA 1D5XA 2XXCB 1RJYB 1U8NA 3AS3A 3MNVA 3BMVA 3QAZC 1DR9A 3KPMA 4KK8C 1JHLH 4M6NH 4OI7A 2F53B 3AVEA 3LN9A 2ADGA 4FRWA 1FZKB 4V2CB 3TV3L 1EZVX 1OLLA 4AMXA 4RL3A 2V17L 3OLIA 4YFLF 5AAMA 1BP3B 2XTJE 2G5BB 3P73A 2UWFA 5I1JH 3AM8C 5H37H 2GCYA 2ZJSH 2JJUA 3K2UL 5E8OB 3RQ3A 3AS0A 1QW8A 2J8OA 3IDNA 2G2RB 3GHEH 4RBPK 2IAMD 4N8PA 4JM2F 4HUWB 3BPLC 3U83A 4ZNEA 3NPSC 1A7PH 3HB3D 1I3RB 3FB6B 1ZHBB 3LDBC 3I02B 4AZ5A 2X7LB 4LRNL 4DK3A 5DJ2A 1E70M 1DBKH 5HHMB 3D87B 3GMPB 3E6HA 4ZODA 1NP2A 1FNHA 4NNPL 4P5KA 5BJTA 1EAJA 5C70A 4W84A 2VX7A 2XSAA 3HE7D 1BYBA 5HYSG 3VG9B 2JTDA 4OZFH 1MXGA 1KB5H 2ZWYA 4DM2A 4IRJC 2G2RA 4NQEE 4DTGH 5JUEH 4OLZL 1YEHH 3DLQR 2VDML 4YAQA 3BC9A 1JZ4A 2OBGA 1K5NA 1G6VK 4NC2B 5TE7L 1NBQA 4MD4A 5J11B 2G3JA 3QEGL 2DI7A 3WKNA 3DC0A 4UOW0 4NZCA 1ED3A 4W8AA 1KLFA 4Z7WF 3H9HA 1T0PB 1FZKA 2DPEA 2Y5TB 3G08A 3MRDA 4H0HB 1RZKL 4IMLB 1RJZA 4R3SB 1A3RH 4X6CA 1YMMD 1LL7A 4AZBA 1R5IA 3ARZA 5JR1H 1I85A 3HNVL 3NAAH 2UZXB 1AKJB 4K55A 4PLKC 1AQDA 5IW1B 3WUBA 4KV5F 1FNGB 2R2BB 2VN4A 3NCFB 3G5XB 43C9B 1X5AA 4PS4H 1U8HB 5DS8B 1XZ0B 3T1FB 3QDGD 2DQTL 3LKOB 4ZXBA 4YXLL 4MA8L 4NN6B 1I1YB 4P57A 4PCSA 3MRFA 1JZ7A 1DBML 1YMMA 4PJ8B 4WUKH 3T0EB 2R0KL 1INEL 1GOFA 2KPNA 4PBVC 4ACZB 1LP9E 2VXQL 4P2RA 4LLYB 3PGFL 3VWJB 5KS9E 3PTQA 2KL6A 2NY2B 3DUUB 1BFOB 1E6NA 4KQ3H 1CWVA 4K3DL 1I1WA 4PS4L 3K2UH 3CFKB 2XHYA 3W0KA 1WDSA 3D3AA 3NCYP 1B0RA 3LQAL 5JUVA 4KJQD 3MRQB 2VDOH 1S7VA 1KPRB 2Q1EA 2B2XH 3DOSA 1BGGA 3HMWH 2IBBA 1Q9KB 4L8BB 4Z8FH 3BUIA 4XP5H 5LAXB 3DVIA 3EOAB 1TIUA 4WK9A 2DKSA 1DBAL 3H3KA 5M5DA 1R5WB 1YDPA 5ICXA 3QHZL 2UUDH 1QSEA 4TULH 1Y18B 2K3TA 2IBZX 3TA3B 1NMAH 2OWCA 3B9VA 2XKUA 1XSJA 4A3YA 4YHKL 2DM2A 5I16B 1UD6A 4PJ9A 4GO8A 1U3YA 1MHCA 4X4ME 3FT2A 3QWOA 3MRKA 2H6PB 5BMFH 2XYLA 4DZ8A 3GXNA 2CK0H 2ZUYA 3FB7B 4L29B 5MEOB 2VC2H 1GORA 3L3GA 3RHWK 4P5TC 4NI3A 3HC3H 4XAWL 4Z76B 3RVWD 1QSFE 2O93L 1VFUA 4FMVA 3F7VA 3VIGA 1QFPA 1T7YA 2WZEA 1OF2A 1Q1JH 3OGCA 1U8PA 3ZE0F 3S88H 3TTYA 4JB9L 4P8WA 4I2XA 5JIKA 3BGFC 1OIFA 4UNVA 2X44D 5IBUG 1UWXK 2X1PA 3GXTA 4BH8A 3LB6D 3NZ8B 2YPVL 4X4YA 3RWJA 3H42L 3THCA 3B9EA 5DD3H 4RA0C 5FO8A 3ROLA 1UVQA 1JRHI 3IJYA 2DAVA 4ELMF 3TCLB 4NZFA 2YDQA 4LPWA 4AYGA 3ZO0A 2PW1A 5E6ID 1UWGL 5I8CB 1PZ2A 1GOOA 4TVSa 3QIUA 3VXNA 2YZ1A 4F8XA 1JNJA 5I2UA 1H3PL 3F7YA 3F7PC 3Q5TA 2VRQA 1FAIH 5IMMA 3TTOA 1E4XL 1HINL 4JKKA 1A7NH 2X4NB 3KJ6L 4NM4L 1HXYB 4R2GB 4NZRL 4U2ZA 4C54A 4AIZB 2ZWZA 1N59B 4ODWA 1CFQB 3VSTA 4Q74A 4AIEA 4X6CE 3MV8A 3HAEH 3P40A 4JZOA 5T1MA 3BX7C 1S3KL 4BQ6A 1LJYA 4JHAH 1CFSB 3CFDB 3ILQD 4P2OA 4OCXL 2IAMC 1OP5H 5ESQA 2VISA 2Y4SA 4QNPF 5K9OB 3DV6B 1CLOH 2ZCKH 4UTAH 4JPKL 3BXWA 3L4ZA 3B3IA 3ESUF 4NZJA 2YKLL 1M7DA 2ZUSA 4IDJL 4Y8AA 3QFDB 3SUVA 3RZCC 4HW6A 1RZGA 1F45A 2GUOA 4KK5D 1P1ZB 4LL9A 1GNXA 5F1NB 2C3XA 3SQBA 2Z8VC 5KZCD 1JHTA 4AZCB 5ACLA 3V0WH 3QQ9C 5DGQA 3O3AB 3NN8B 5D2LE 3VIFA 5CGYC 3UTSE 4GO6B 4XNUL 4M93B 3WH9A 1T03H 1CD1A 3CVHL 4CD4A 3MRCA 5KG9B 1WZ1H 4NBYB 4P2QE 4PJCA 3UC0L 3PZIA 5A6BA 3QFDA 5HY9B 2WAHA 4MXQC 3W25A 2MWCA 2PXYB 2BOBA 3SE3A 5BXFA 2HWZL 2AJ3B 4FZEL 4X99B 2YOCA 5FM5M 3VU2A 3TO2A 2E6JA 3QUYC 3OKMA 4YGAB 1J0ZA 2PBOA 3WFCL 1EXPA 5T3XE 2YMXL 4QTHB 2BNRB 3MYJA 5IG7A 4NX0A 1NCCL 3PJSB 4AENA 1FH5H 3FZUC 4LLUB 4KJYA 4PTTA 1WFNA 5AC4A 3N1AA 4G9FB 2PW2A 5BRPA 1JMXA 3CU1A 3IDIB 2XUCA 4NQSA 4BZ2H 2LAGB 1DBJL 3X12A 4MJIE 2CBJA 4GZJA 2EH8H 1KCRL 3IFNH 1CFBA 2DQIL 4MXWL 4OGAC 3L3DB 1YMME 3HPLB 4XB8A 4KMTH 1A7BA 5L0QC 4D0BB 3LRKA 3MRIB 3TBVB 4U33A 4CD7A 3TZVA 3LXAA 3LQMA 1NBZB 2R1WA 3ZHLA 3CFJB 3GIVA 5FUZL 4Z78B 3UJJL 2HRLA 3U4BL 4ACZA 4OZGE 2FSEA 3H9YA 4JQXC 4JQVA 4CVZB 5I1CH 3H53A 5J0BA 4OM1L 3OZ9H 2OYMA 5DO8A 3TH3T 4EEEA 2AJYL 1A2YA 3I6GA 3IU3A 4S1RH 4DAGH 5D2NC 1T20B 3B6SB 5E9AA 4LLVB 1F2XK 1QW9A 3WD3A 4KVCH 2ADJB 3G6DH 2KH2B 4M1RA 4WEBL 1AD9A 4PV9A 1GZPB 3AIEA 2YZ8A 2RJMA 5KSVB 4GKOA 4GRLB 4H8UA 4LDOB 1J18A 4EKXA 4IEFB 4WJ5B 5SX4I 3ULVH 3ZIZA 4ONGH 4ZUSA 3SBWC 4OLZH 3VWKD 2RCSL 5ESQB 3RVVC 4ZENA 3QUXB 4ZPTA 2H2SC 3OGOE 1CFSA 2HKHL 4TNWK 3Q5OA 3T04D 4OSUL 2HH0H 3MRIA 2HVKA 1H8SA 4XVJL 1E0VA 4U7SA 4D9RD 1GOWA 2HMID 5DVLA 4IOIA 4RFEA 4P2QB 1MHEB 3ZZ1A 1RD6A 4HKXB 5EOQL 1CF8H 2ICEB 4NNXA 4P59H 2OK0L 4JQIH 4TQEL 1S5HB 3MLXH 5BRZD 1WAAE 3ZR6A 1IVLA 4W6WB 1A6VH 3FY1A 1UASA 3JUZA 3QXUA 1FO0H 2HT4C 3MQIA 5C7XL 1M03A 1GHFL 1P4IH 2C9AA 5TQ2H 1I8MA 1OSPL 3UTTB 1ZEAH 5H8DA 3ALGA 4PGZA 3V52L 3AIUA 5BOZG 4XBEH 1I8LA 5JPNA 2NY3B 3QEQD 3SE9H 4V28A 2J88L 2Z31B 3O6FB 5CJBA 4TVPD 3GB7A 2GJZB 3IDGB 3LS5L 3L4YA 3WIHA 3L4UA 3MRHA 3AAZB 5E56A 4MJID 3MLXL 1P6AB 3RA7L 1JUFA 4KKCD 1BVKA 1WEJH 3WQ8A 3QUKA 2EJ1A 4JFSA 1XFPA 5EFFA 1MHPL 3MV8D 4M43H 1G7QA 4P9HH 2F53E 1C8YA 1DDHA 1OSPH 5FUZH 5DJXB 4LHUB 4KAQH 4UQEA 5ID1B 5AZEL 1WAAF 1D5ZB 3I50L 1T3FA 3UTTD 5IW1A 5DUMH 3D51A 4GMTL 4WENB 4NNYB 1C5CH 2UY5A 4TVPH 2DIEA 4HJ0C 4O2EA 5CLWA 3X3GL 2GJZA 3IDGA 2W07A 3IK2A 3GMLB 3WDRA 5E94A 5DFWH 4UDTB 4UV7H 4XH2B 2CR6A 4QRQA 4P2RE 5J6GA 2OSWA 4NRYB 1GIGH 1UJ3B 4JCMA 1B3ZA 4HS6B 4L5FH 4LASH 3RWDB 1JRHH 1ADQA 3L3JB 4UZGA 3SE3C 1H2JA 5I74C 4X7TA 3MANA 4OLXL 1GGCH 4M7KH 1OW0A 5HGHA 3S4SG 2DLFL 4MXVF 4Z0XB 1F4WL 2B5IB 4TVUA 3RY5A 5IBLD 1DHKA 3MS8A 1BAGA 3IXAB 4U1SB 2WYSA 3C6LB 5SX5K 4W6YB 4NQED 5F7EH 3FQTA 2IBZY 3E6HB 4OCSH 4KZDL 5IMKB 1L0XA 4ODTL 5CWSA 4EI5B 5ETUB 5D2LA 4P7NA 1MI5D 3VXMB 5DURD 3W27A 3I6LE 4MDOA 2W92A 1IAIH 4X7FC 1US3A 1M71B 3D39D 3GKZA 4O2FB 3FQXB 1ZU8A 3WE6B 1TQVA 1KJ2A 1EGZA 4YC2C 4AIXA 1UWXH 5E1HB 5SWZD 5IW3A 3IU4H 3IVKB 5EO0B 2FB4H 5IVXB 2NY0B 1P4BH 5BZWA 3C5ZD 3RX8A 3ZDZE 4BK4A 4KHTL 3EJQA 1FH7A 4PJFA 1GCYA 2MKWA 1HSAA 5FUCC 1FHLA 1A2YB 3I6GB 4E41E 1BVZA 5KANI 3IJHA 3CZLA 1JK8A 5E2TL 2AK4E 4K71C 1SJHA 1V7NH 1OGTB 2D9CA 4KHXH 2ZUTA 5J13C 5GGQH 1M05B 3HZVA 2BVUA 3LKNB 4CW1B 2EXWC 5DC9B 3UTTA 4EXKA 1G5AA 2AMGA 6A3HA 3MV8E 1HH6A 3ELAT 2MPAL 4UQAA 2XN9E 1FIGL 2HKFH 4N0YH 2OTUA 4WFEE 3RM9A 2B20A 1MCEA 5D7JD 4GRMA 5C08A 3RIAK 1I1AC 3LN4B 4PJGA 5D9SA 5T3ZE 3P4NA 3VGAB 4D94A 3O3EB 1OARH 4HFUH 4OKDA 4NZUH 3O3BB 2GW5A 1IFHH 2OL3L 1RUKL 5FM5O 1L7TL 4GW4A 3QPQD 4O00A 2ARJB 1MFCH 4P8UA 4AG4L 3EO1B 1IGJA 3NCEB 5DJ6A 3GBEA 5EOQH 4TNWF 2EH8L 3VXQA 1GQKA 1U8JA 3O41B 2VLRA 4PREB 4A6YA 1YN6B 2BVDA 4UIKL 8FABA 1HILB 1G0YR 2DT0A 1QBBA 2WWMD 2OP4L 5IB5A 3KPSE 3TN0B 5IFJA 3AICA 2EIDA 3U1SH 3VWKC 4X9HA 3MLWL 3CLFL 3QA3A 2EDLA 5CP7B 1IGFH 4HLJA 4DGVL 3WJJC 4GW4B 1RU9H 1EHXA 1VA9A 3I50H 1FV1A 5EORH 4OZGA 2XN0A 1UQSA 1TA3A 3UJIH 4NF7A 2XPKA 5B8CC 2NXZC 4PP1C 4K7PL 4HOWA 2PTTA 1BHGA 4YZFF 5ISZA 4LIQE 5C6PB 3UTZA 3MODL 5DD1L 5GGUA 2OYPA 3GO1L 5IFHH 3WUFA 2BNRE 1MRCL 2EDNA 1E4JA 5K33A 4MJIA 3RWFA 2NQCA 1R0AL 2X2HA 4NO3A 3SCPA 1ORSB 3KWXA 3P4OB 1F3JA 4OJYA 1KEGH 1WAWA 1G9NL 1ZA3B 4ZS7H 2OSLA 4M56A 3BP5A 2G4FA 1DDHB 1UQSB 1Q38A 4I0KA 2WMFA 5C7XH 1MCPH 2VXTL 3DX9B 1LEKA 4OBSA 2DMKA 3BZDA 3ALXA 4K3DH 1KJ2B 4P7LA 3OWEA 2C7FA 1HIZA 5HI5D 3GJFK 2Q8BH 3GB7B 1KJ3L 3B2UC 4HZLB 3T3PE 4F7CB 1JDAA 4CD6A 4Z7OF 5DF0A 4UFKA 1QHPA 4WO4D 3RVXC 3MI6A 1CEOA 3K2MC 5I1IL 1E5JA 3P0VH 1KTDA 4Z0BL 3QZWG 4R0LB 3MLUH 3QULA 4UZSA 1EHLH 1P5VA 3HCVB 4BUGA 2F1BA 5B39B 1X3DA 4LF3A 3QUYD 1UKQA 3GHBH 3OAUH 4MDIA 1TJHH 3RGVC 5ANMA 4OF0A 3VIPA 4M81A 1S9XB 1S8DA 1URLA 2C3GA 4U6HA 2OYKA 3TVMC 4JN2B 5HGHB 4PJGB 4AZCA 1AGFA 4EBQH 3GMNB 5C2BH 4JKPH 5CEZD 3POHA 4YX2L 3H9SD 4K3EH 5C08B 3L3IA 5K59E 1T7XA 4R8WL 1NAML 3ARBD 5CILH 3EFFA 4U6XB 2M8XA 2DD8L 4HS6A 4DJMA 1Q6EA 4GRLD 4YNYA 4I4WB 4MAZA 3K4AA 4WCYL 4RMTA 4MNLA 4KY1H 2VXVL 4PMVA 4UCFA 1SYSA 4NP4L 3UYPA 5K9OA 3WEZA 1IQWH 1QBMH 2R23A 1GGUA 4NBXB 3WUWB 4HDIA 5JQ6L 2Y24A 1KFWA 3WKMH 4JB9H 3GTNA 1D5XB 3LKRA 4OF5A 5FFLA 5FM8A 1VFOA 5CP3H 4BH7B 4U1LA 3AXXA 3SCQA 1HYRC 2QSCH 2J7FA 1PBYA 3K8LA 4UOJA 1A1OA 5T1KA 1C92A 2WBJC 2Z91B 2D31A 3BIAX 4G8GA 1E71M 1NCWL 4OZIF 1S7QA 1P84K 1E3XA 2NY4D 2VVSA 3WN5B 4HC1H 1QLEL 5CIPA 4DOHB 5IB1A 2A6IB 4PR5B 2YBRA 3ULUE 3ISWA 1TNMA 4HIEA 2V9TA 1N26A 4RAUA 5I8CA 2IAND 2ZUXA 1KBKA 4JJHA 3C9NB 1UA7A 3BYTA 3WH7A 1FFNB 4FTVA 4PJ8D 2YLAA 1JGLL 3HZKA 3OB0K 4C7DA 1Z32X 4UTBH 2DT3A 2ZCHL 3KG5A 5HHPA 1MFCL 4KK9C 4K2UH 5F93C 1IM3A 1W9UA 1B31A 4J8RB 3VCLB 3S9DB 1FZJA 5F7LB 3S35L 1IBGL 1CL7H 1ZVHA