1CGUA

Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Catalytic center of cyclodextrin glycosyltransferase derived from X-ray structure analysis combined with site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus circulans
total genus 227
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cguA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cguA01
3SURA 4PGCA 1C90A 1E28A 3LQAL 4PJCF 3QUYA 1TNMA 1L8NA 5F7EH 3UR7A 2XKNA 5EB8A 1AO7D 3ILQD 4PRIA 3L95A 4P23B 2APVA 1IC4L 2IAMB 4KQ4L 3THML 5IV2A 5IROA 5FEBA 1GQLA 2BERA 4O5LH 5JIHA 5C1MB 3E3QC 4PJEE 3VIGA 4MWFB 2NY4C 3DUSA 4U0RC 3UO1L 3SY0B 4PG2A 1LO3H 5CEXA 3BW9A 3HS0A 1EHNA 3JZ7A 2IUZA 5JOFA 2WVVB 1EOMA 4LSTL 1CLZL 1ZT1B 4G7VH 1BOGA 4LVNC 1DTUA 3OXRB 3L5JA 3UG4A 5JR1L 5EBWB 1WVZA 1JWSB 3DGCR 3W9EB 4AIEA 4Z7UB 4PJ7B 2R1XA 2HT2C 2NXYB 3QEQE 2YWZA 3B3IB 5IHLB 1E28B 1UZ8A 1BYDA 4LK4A 3JTTA 2XKNB 3LXAA 1I75A 4UQDA 4MNHA 4PRIB 3L95B 1A9BA 4W4OA 2DQDH 3BRDA 1X6NA 4YXHL 4EJ1C 5A8QA 4X5WA 5IV2B 3SUVA 1BIIB 1T0MA 1FSKB 2X9WA 3MODL 4D2NA 4WFGE 3DUSB 5GS1A 3IF1A 3A67H 3MZTA 1KCKA 2XVPA 5CEXB 3ZKND 1IC7L 2R4SL 1NLDH 1MCCA 3D5OF 2J7DA 4LP5A 5JOFB 5I1IH 1Q0YL 1XCWA 1HJXA 5H2BA 3C6LB 3P9LA 4E2OA 4OOZA 4AZ8A 3DV4A 2R56L 3QEHA 1CK0H 1RK0A 3BKML 4X0KB 4Y5VA 2CYGA 5DVMA 4HKXA 1E40A 1DQQA 2JCCE 4OCXL 2ZKHH 3T0EE 1MCNA 1HIMH 2R1XB 3EZ8A 3MREA 1DFBL 3QEUA 4LCWA 1UZ8B 2E27H 3KLDA 4TUJB 3JTTB 3N06B 5F1KC 3GI8H 1E6JH 4MNHB 1IM3A 3LHPL 1JZ5A 3MPCA 2FJFA 2XN9E 2AQ1A 5IW3A 5GRZA 3U36A 2HKHH 3PHAA 4K2UL 4NQEE 1T0MB 1VDGA 4JKKA 1KTLA 3MLZH 5J1AB 4URIA 5GS1B 4FP8L 2DIAA 3IF1B 5CAYB 2QHRL 1CWYA 3HZYA 4G6KH 4HX1A 3I6GB 5E03A 3TZVD 1IV8A 3WD3A 3LN4B 2ZCKL 3PTMA 1J8HD 2APXA 5H2BB 3P9LB 3U4AA 4GZJA 3QEHB 1UB6A 3VI3F 1UWGL 1RK0B 1NSNL 2FHCA 2AV7A 4HXAL 4Y5VB 4J7RA 1XIWC 3CO4A 4HKXB 3BUDA 1DQQB 1KOAA 3OR6A 1WAAE 1HTYA 4L4TD 5LGHL 3DHMA 5JLZA 4CKVX 3SQBA 3QEUB 4LCWB 4WV1B 2VQUA 1I8KA 1A1NA 4MDIA 3OAUL 2X41A 3PHSA 2E9BA 1IM3B 2KQNA 4QY8A 1R86A 3VNZA 3A4XA 5HI5C 3ZTJG 5BWFA 4IOIA 3UTSD 2WP3O 1E73M 1JGUH 4NWTH 3ALFA 1X4XA 5HGAA 4PYHA 3UC0L 4OFYD 4BQCA 3HE7A 1MRCH 2DM4A 3LKOA 5EO0B 5C3TA 3CZFA 2PETA 2I25N 4MS8D 4YWGH 1LNUA 1KCVH 3HZYB 3RJQB 3NFSH 3V0WH 3VOCA 3RP1A 3MXWH 3S34H 3VW3L 3RY5A 4NRXB 3TCXA 2A3BA 2AV7B 2VOTA 5T1MA 1NLBH 5F7DA 2PYEE 4CN6A 3D4ZA 4DVRL 3OR6B 4P2RB 5H8DA 5ECJE 3QQ3B 4J3VA 4HWBH 4F2MA 3CVHL 4GXVH 4HEPG 5JLZB 2YJQA 1R8LA 3KLLA 4W81A 4CDHA 1MAML 5D1ZC 5F96H 3ZLQC 1WO2A 4ZFOL 4HA1A 3GBNH 1I8KB 1A1NB 5TE6H 3DARA 1Z2KA 4MDIB 3OB0K 4OM0H 2BVUA 4J4PC 4TUOB 2AV1B 3OF6D 4XCCH 4RMVA 4QY8B 4LFHD 1FL6A 5GGTH 1U8JA 3PZ9A 3VFGL 3N1AA 2OZ4A 4NX0A 1T89A 2VZTA 3HE7B 5CINL 1LWRA 3LKOB 1KN4H 3CZFB 4ZD3H 1LP9E 2BNRD 4P8UA 1FNGB 3QCVL 1LNUB 1AVAA 5K33A 2NY2C 3QR2A 4YR6A 5E1QA 1B3YA 2A6IA 3DI3B 1WQVT 4MB4A 3TLRA 4U3XA 4NM4L 2OTPA 3KNBA 4LSVL 4OZGF 4ENEC 1LDPH 5F7DB 3ARTA 5TF1L 3VXRE 1ZLSL 3TT3L 1NGPL 4YBLB 2HTLC 2OP4L 4KDTA 3DI2B 4F2MB 2C3HA 1NH6A 1WCBA 5TDOA 1WFTA 1HZHH 5HDOA 1OP3H 4DKDC 1IGFH 3K4AA 1WBYA 3EYPA 1E6ZA 2G75B 3UEQA 3NZ8A 3SE8H 4NQTA 1FL6B 3BDBA 1RPQA 1H5BA 1A4JA 1U8JB 5C09D 5CG0A 4Q9QL 1N4XL 2ZUMA 1AE6L 2W07A 4KK6C 4UIKH 3MJ9L 4GRLA 4G7YL 5DJDB 1GCYA 4XCFH 1AD0A 1CZ8L 2HKFH 2P48B 3JV4A 3S6CA 1HN1A 1XCQA 3KPRD 2XIIA 3UBXG 1KGCD 4DO4A 4PJAF 2YKLL 4GRWH 1D5XA 1OGGA 4U1GC 3KNBB 1E3XA 1JK8B 4R4FH 3WQ8A 4IOFD 1G7HB 3BDXA 3MRGA 1ZVYA 2VCBA 4NRZA 4Y1AE 3PABA 2AK4E 2O61A 5MHSD 4NWUH 5LVEA 5TDOB 3TO4D 2DPEA 1CN4A 1K2DA 4K55A 4OLWH 1WBYB 1MJ8H 2V5SA 4UINH 2OYMA 1JFXA 5CEZE 3BQUD 1UWXH 4WTXA 1H5BB 3ALXA 1ZKAA 4FRWA 4JZJC 1XV8A 4NO2A 2MQCA 4G42A 4OF6A 4GRLB 1KIQA 4O2CA 1N59B 2QPSA 2BNQD 5HDRA 2O92A 5I77A 4R4NC 5D6CA 1AO7E 3QI9C 3HI5L 3D2UA 1XH0A 2OR7A 5KSAD 3SOBL 3JV4B 1TQSA 1B2WH 4MAUH 5C6WH 2UWEF 3MUHL 1D5XB 4OCWL 2YFOA 2DJSA 4DEPC 5F93C 5KZCB 4NRSA 3ZKMC 4PJDA 1C3FA 1IGYA 1JFQL 3S35X 1ZLUK 4OI7A 3AXHA 1EK3A 3UG5A 1H4PA 5A8MA 4H5SA 4ONFL 2O61B 2DQXA 4DKAA 1E72M 3D3AA 1NCAL 2ARWA 1GJWA 3P0GB 4P3WA 4DM1A 1K2DB 4L8SA 2R4RL 4KTYA 4NN7B 5FUOL 4XMKL 4XPGL 1R3KA 1HKMA 1MHPL 5E4EC 4LQFH 1YYMH 4M1DH 4XB8A 4HJ0C 3J7HA 4NO2B 3RIAF 4EUPA 2BXYA 3UDWA 1O7AA 3SDCC 5E2VL 1KIQB 4X6CF 4XVTL 4KROB 4O2CB 4LKCA 4LCCA 4JRXA 1BFTA 4FZEL 1IEAB 2WPGA 2J7BA 2YWYA 4XNXL 5D6CB 3HRPA 4RFEA 4F37F 3D2UB 5CJQH 1OAXL 4JRYD 1ODZA 1L7IH 4XVJH 1AI1H 1ZSDA 1US3A 1A0QL 1XGYH 4FFZL 4MX7B 3SBWC 5CZVH 5DURB 2VITA 4NQCD 5HYJD 2WZHA 2FRGP 1VF8A 4P9HH 2D24A 4U1IA 1IGYB 3QNXA 5JZ7C 4NGHH 4KK5C 2CITA 3L7EA 1QFWI 4H5SB 5L7XH 3BAXA 1OW0C 4EOWH 4WJXA 3D87B 4FOMA 4L8SB 3F7QA 4MDPA 1R3KB 3O3BA 3IAPA 2Y36H 4IIQA 3WHE0 1YNKL 4K23H 4KMLB 4HW6A 3FQRA 4AMXA 5D72H 1VEMA 1XGUB 4LRNL 1L7TH 4QO1A 4EUPB 3HG2A 1E4MM 2WINA 4PUBL 2F9BT 1H3TA 3WNNA 4LKCB 4LCCB 1F45A 1WP6A 2CH8A 1JPTH 4TVPD 4QXTA 4RFEB 3EJYD 1YZZA 4WDIA 5C0GB 4WWKB 4LRIC 4Q9CA 4RGND 3EJSA 3QG6A 4B5EA 3SDYH 4HS8H 3RM9A 1LK2A 4JHZA 3H0TA 2NX5A 1OWWA 2JF6A 4GBXB 4M6AA 4JANA 5EU5B 3BHBA 1VAHA 1GL4B 1OPGH 3G9AB 3QNXB 3SDAD 3HE6B 2YMXH 1MFDL 3BRGC 3L7EB 2CMRL 3BZ4A 2YUXA 3BP7A 3HI1A 4HZ8A 4YQXL 3WD2A 1AQDB 2IPTH 4LX4A 3C2SA 3F5KA 1IKNA 1B6UA 2J8UF 1L6ZA 1Y18B 4M9PA 3B43A 2XKUA 1G7MA 3SGKC 3TNMA 5FCUL 3A21A 3O3BB 4IIQB 5ERWA 4MDOA 1CIUA 4KK9C 2AEWA 3FQRB 1UD3A 4JL1A 2JK5B 3PP4L 4L4TE 1HP4A 4L5FL 3DO7B 1A21A 3BAIA 2MANA 2WINB 3ARFB 3W29A 1P7QD 2XA8H 4M7ZC 2JALA 3FRPG 4QXTB 2A77L 3OJDA 4H1LA 4WDIB 3HJEA 3ZR5A 4JO3L 3UXFA 1SMOA 1LK2B 1Q9LA 1G1YA 4R96A 1TITA 5FYKL 2IG2H 5DDHA 3FFDA 1CXKA 3I75A 4JANB 3BHBB 4DUVA 3VFPB 2AMGA 3N04A 3N11A 4H26A 1A7QH 2CXKA 1JPSH 2CQVA 3PWNA 3WY4A 3CU1A 1CU4H 1ZTXH 4O2FA 4KKCD 3T2QA 3HI1B 4M7LL 4KRNA 3MBEA 5I18L 3CK0H 4PJXA 3H8NA 4UB0H 4Z76B 4BK5A 1G7MB 2ZXQA 1EEQA 5KVEH 5FF6A 1KPVA 5ERWB 4JGUA 3VMOA 4DTGH 1Y7VA 2EEBA 4IJ3B 3CZKA 4QDMA 4OFIA 1KCLA 4L8BA 3VWKD 1JPFB 3NAAL 1JHTA 1LO5A 4PCTA 5ICZA 4JFEB 4N0YH 4XWOD 4XC1H 4H1LB 1D5IH 4AYFA 4G9FA 1YHTA 5D93C 3HMCA 1NKOA 1B1YA 3HKFA 3GH7A 1FH5L 1Q9LB 3CLEL 3WIIH 1UD2A 4R96B 1KSRA 1QLEL 3K80A 5HY9A 4F15C 4FNQA 2FWOA 3VE0A 3MSGA 3U4EA 5GGRY 3NA9L 4OB5H 1S5HB 4JB9L 4PLKD 2BNRE 4Y0GA 5D9SB 2X2YA 4QRRA 4H26B 2Q7NA 3PWNB 5A6SA 3PL6D 1WPCA 1FZJA 4O2FB 4DO6A 5IHUL 4PJXB 5K9JH 1Q72L 4OI8A 3MOBL 2CXGA 1TLKA 2ADGA 5D2NB 3CIVA 3AHYA 5FL1A 3UZVB 3NIYA 1KPVB 2HFGH 4GRMA 3N9GH 2YIHA 4P3DA 3WKNA 4L8BB 1JHTB 1LO5B 1KLUA 5FM8A 4Z0XA 1DEDA 3QFJA 1W0WB 3ZJKA 2XG9A 4JHAH 1QBLL 3I50L 2CJUH 5C71A 2CIPA 1KFWA 3VXQB 4G9FB 2NYYC 5C09E 2EDLA 2FJHA 3AY4A 3VIOA 4JDVA 4UT6H 5HY9B 3BUYA 2FWOB 3IFNL 3RWHA 3VE0B 3U4EB 2NY6D 4XC3H 1RHFA 2L0DA 4BYHA 1NWTA 4XPTL 4QRRB 2NW0A 4HOXA 4YDVA 1FZJB 1A3LL 1CXLA 3LQZA 1HHJA 2FB4L 1Q6GA 4FQXD 2DDQL 3OL2A 5AAWA 2IANA 4UI2A 4GRMB 5A8PA 5HI4C 4N0RA 5AG9A 3O6FD 3DSFH 4P3DB 2LTQB 1KLUB 2N1KA 3DECA 5MHSE 1JDAA 3QFJB 1IAIM 2YKKA 3ZYIA 3W0KA 1BSIA 3NSMA 2Q76A 5BXSA 3LRLA 4UQ9A 4NNPL 1N0XL 4DWHA 1E4WH 1N64H 1KJ2A 4WUKH 3UZQA 4U49A 4MCZA 3QQNA 2QV4A 3GHBL 2Q8BH 3RWHB 3V0AC 1G0DA 2NMSA 4XP1H 4PP1C 4HA3A 3ZDZF 2ZUNA 4Z7OE 2EKJA 1LL7A 4YXKL 3FOLA 3KPSD 3P0VH 3UTZA 4S1QL 3LQZB 4HIXH 1MCWM 1HHJB 1M53A 1V6YA 4Z2LA 1D6VL 4V27A 1FL3A 4LXFA 5GJSL 4WSKA 4L3EE 1OGAD 1UVQB 4CVUA 1OQXA 3U57A 2YUZA 3S88H 5IB1B 1FORH 5E9DD 1A6AA 2B39A 4DM2A 1P4IH 1VADA 2R0KH 1G7JA 1A6UL 2Y07L 1KJ2B 3RWCA 1WJ3A 5JDJA 3POCA 4MCZB 1RI8A 4AIZA 4H0GA 2YRPA 4HUUA 2VVSA 1CBGA 4AEIL 4WUUD 4Z95H 4CN1A 1WKYA 1U3HA 4OZHA 3S5ZA 1ZBKA 3OXSA 1P84J 3C8KA 4LVEA 1M7DA 4M6OL 4R6UA 4J3UA 4PLOB 4EI6A 4MNKA 5HOSA 4AD3A 1QPXA 1VBUA 2OZ4H 3UTZB 3RVVD 4KI5F 5DD0H 4ZSOA 4OV6F 4ZNEA 4NQCE 3F5WA 2IALA 4R8WH 3U30C 1MCLA 4F3FA 1FL3B 1CLOL 2NCMA 3GSOA 4D71A 4JO2H 1KT2B 1MW2A 1XAUA 2J8HA 2GI7A 1RUAH 4I3SL 1MI5A 4XPBH 4XZWA 1NCBL 1R5WA 3ARED 2VLKD 5F8QC 5JHLH 4D0CB 1A6AB 2BJMH 4X7SH 1G7JB 1YMMD 5AZ2H 3U46B 2P5EA 3RWCB 4LLWA 1ORSA 3AMDA 3VDBA 4HKBA 4AIZB 1UKTA 2WBJA 1QI5A 3IJHA 4HUUB 4PEEA 4YDKH 2YBRB 5C7XL 1U3HB 4OZHB 3N1QC 4F57L 3OXSB 3C8KB 1BYBA 2X2IA 3WY1A 1KIPA 1UXWA 4FFWC 1GCFA 1WEJH 5FDWA 5TFSH 3CSBA 3F5WB 1LO2L 5HXMA 2IALB 3D3VA 4OD3H 4U3CA 5EA0L 2YA0A 3GSOB 3JWDH 5AZEH 4PS4L 3PZMA 1TTUA 4RNRA 4OF7A 1BJMA 5B3JE 5HDQL 1MI5B 5A6MA 1R5WB 4K3EL 2M26A 5CGTA 1UWSA 1DCLA 2JJTA 5I8EA 4F37K 3BD4A 4QLKA 4L8CA 3TTSA 1GGYA 4OFKA 2P5EB 2W0LA 4LLWB 4X6DE 2N7BA 4HBCL 1ORSB 4HKBB 4I0CC 4GG6A 3IJHB 1IVLA 1P5UA 3CZ8A 1U41A 4XMPH 2KL6A 5ID1B 4Y16D 5ICYA 2DL2A 2V2WA 1HKLH 3U79A 3P11H 2YZ8A 5ABHA 1UXWB 5CD3A 5SX4I 5I79A 4UOJA 5J06A 4PREA 5FDWB 2E7CA 3MA9L 3GMQA 4MSWA 5TE4H 3D9AL 3QIWA 3D3VB 5HBBA 5J11B 2NY0C 2GK1A 2V5DA 1VSCA 2YDSA 3NACH 3MRKB 1BGXL 1ZA3A 3VXOA 4YHMH 3H3PL 1IE5A 5JIKA 4P9MH 3C6SA 5K9KA 4ZE4A 5HHXL 4OLUH 5IB5A 3IDGA 3RX5A 5I8EB 3TYGL 1JZ3A 2AAAA 4L8CB 2OSXA 1QUNA 2AGJH 4HKJB 3TWCL 2VIRA 3WBEA 3H9HA 2E7BA 3Q5OA 5GHWH 4RISL 3DUUA 4PJCA 4GG6B 1AXSB 2GKIA 3W37A 4YC2B 5C0FA 3ZDYF 2WUCH 5ICYB 1N2RA 5JHDD 1F13A 4Z9KB 3W0WD 1T7YA 3MC0A 1DSFL 1ZEAL 1SEQL 4M4RA 4KY1H 1X5IA 4EUPH 1EHXA 2XKSA 4TOYH 5MEOA 4PREB 4GO9A 3VD7A 1R3LB 3OTTA 3GMQB 4MSWB 5F70A 4DAGL 3VIMA 1IT0A 2VRKA 2H2PC 1EJ6A 3QIWB 4RL3A 4WI6A 2GK1B 3GNMH 3LXBA 3QDJE 3VXOB 1JD9A 1F4XL 1Z9OA 1V08A 2OWWA 1BQLH 5BXFA 4P23D 4LDOB 5MEPB 3C6SB 5K9KB 1E4XI 3N1GC 2IAMD 3L3GA 3VI4F 3IDGB 2YPLE 5DSCB 3EYSL 2I9TA 5D71L 4HU0A 2VH5L 4D6EA 4YHLH 4AL8L 3L4UA 1FZKA 3B2UD 4Q74A 3DUUB 4FTVD 4PJCB 4KUCD 4ODHL 5C0FB 1UWRA 4JFOA 4KK8D 4YHKH 1NBVH 3ZT6A 2X42A 5ITBL 3GXPA 1FYTA 1KTDA 3B4NA 1BJ1H 4WEMB 3T1FA 4UFLA 4CNIA 5DQJB 2E9WA 1QRNB 4KVCL 5F9OL 5I1AA 2NXYD 1IQDA 2B20A 4P5MA 4HLZG 4WLCA 4QLJA 4I0PA 5E09A 4PRID 1NC4A 3U7WL 5BXFB 3PWPD 3WH6A 4PY7A 3VFTA 5IMOB 4M6NL 1DWHM 5BXRA 1FPTH 4L3AA 3AU1A 4WTZG 3L3GB 3RWFB 1VB9A 1I9IL 4O02H 1X44A 5HVWA 1ZHBB 5KS9E 4QHMA 3ZYOA 4BM7A 4OLXL 3VXMA 5GRUH 3VGGA 2XTKA 1NMAH 3SCVA 2YS4A 2J6EA 3T0DA 4BZ2L 5JBFA 1EMTL 3C6LD 4JFOB 1KF9B 4EDWL 3GSWA 1WWBX 2CDEB 1SY6L 1RJCA 4F9JA 4NZRH 3MACH 1EAJA 2XQBH 3T1FB 3MLSL 4GQ9L 4PN2A 4JG0L 4CNIB 3G04A 1A3RH 5I1AB 1UWTA 1KN2H 2W0KA 1AHWC 4X5LA 4FLOA 4OCSH 1JHLL 1RZGA 4H1LH 2EH8H 4FABL 4ACZB 4NRRA 2AS5M 1YEHL 4WKHA 3KPSE 1NC4B 3MUGA 4LHUA 3RPIA 1MWAB 5AWNH 3VFTB 4Z7QF 1DLFH 1G9NH 1HVXA 4UT7H 2OMBA 1DBJL 3AU1B 4M1GL 3ZE2E 1L9MA 1H9VA 2VE6A 3L6FA 1D5BA 2W0FA 4KKLC 1JUFB 1V3JA 4WFED 3V8CA 1WCGA 2WWCA 2HTKD 3EO9H 3NPSC 3B6SA 1OGAE 3VXMB 4NHCL 3IDXH 4CD7A 1DQLH 1FHDA 4IEFB 4MB5A 4YXLL 1X9QA 1IL1A 4YFLF 2NR6D 1UACL 3QT2A 5L2KB 5TJWK 3WXVL 3FQWA 5C92A 2OYKA 1PIGA 3GSWB 3ZSSA 43C9B 2EDXA 5EU6B 5CFHA 3H42H 1LK3L 1NCWL 4AK1A 3KR3H 1FLTX 1BM3L 1RHHA 5B8CC 4RIRA 4R7DA 4WUUE 2C26A 5FOJA 5JIIA 4LCWD 1RZGB 4W5ZA 5DO2C 1GJIA 1T22B 3TBYA 3M7SA 2J78A 3MUGB 5T3ZL 4LHUB 3RPIB 3KEHA 2B7DT 3EAKA 3M8OH 1A5FL 4J6RL 2VE6B 3L2LA 4OZIE 2GW5A 5EFDA 1D5BB 1LO4L 4MJ6A 3CVIH 3GKWH 4GRWE 4XBPA 2WUBL 3IDIA 3B6SB 5EUKA 1KXVA 2V3EA 1U8QA 1QNPA 4RWYL 2JIEA 4FQ1L 2P46B 3BSZL 3GHEH 4RX4A 1T7XA 5DJZA 1WT5C 2XGIA 4IRZL 4I5BA 4QHNA 4PGDA 5A95A 3BVNA 5HHPA 3ULVH 3FQWB 3FO9B 5ANMA 3H9ZA 5EORL 3WIHL 2CNCA 3NIFF 4BSWA 4W68A 1ITBB 2AJZA 3MR9A 1RHHB 3RVUC 1GOOA 4P2RD 1Z9SA 4UFJA 4FFVC 4RIRB 3EW3B 2J88L 2DH3A 4OSUL 4R7DB 3WUZA 5I8CA 2X4PA 3WEMA 3NUKA 1UM4L 4DGIH 2Y06L 3QZWG 4MD4A 4HULB 3WSUA 1L0QA 5E6IA 4LSPL 3M46A 3HB3D 3HN3A 4RMSA 1I1AD 3O3UN 4G8FA 4XTRC 5HSFA 4MNQA 1PLGL 2MCG1 3CUPA 3OLEA 4OZGA 5KG9A 1WLHA 2VDNL 3GSRA 4XBEL 5IVXF 3WS3A 4WSJA 4XBPB 3HE7D 4BF7A 2PCPA 3IDMA 5DUPL 5EUKB 3RVWC 3KLAA 1U8QB 2F58H 5FYKU 3F4VA 3LB6D 5IMKA 4JM2F 5EO1A 4XNQB 4XHJC 5HGHA 5DJZB 4I5BB 1V03A 1F6FB 2OX5A 2V17L 3X12A 3ARGC 4PGDB 1GOGA 4P46A 4GMSH 5HHPB 2JIWA 5ECUA 2ZE0A 1D5MA 3OKMA 2X0YA 3QAZC 2CBUA 1SYSA 2CDGA 4K71C 3QPQD 2AJZB 4X6EA 5CP7A 3LEYH 1XCTA 4Y2DD 1MOEA 1UXSB 5I8CB 4PLJC 3T4YA 2EECA 1S7VB 4PMOA 4Y89A 4AH2B 3DMMA 4YPGB 4MD4B 4N9OB 4OQTL 4JZOB 1KJ2H 1QYGH 3EFFA 5E6IB 4PJAA 3X14A 1P9MA 3EYUL 4G8FB 4JVUA 3BYYA 4FFYH 5C9JA 2UWFA 3CUPB 4OZGB 1OHQA 1JF1A 5KG9B 1PJ9A 3GSRB 4TSCL 3WS3B 1IM9A 3K4DA 4XAKD 4HBQA 5KTEL 2OL3L 2W9LA 1IGJA 4WO4D 2PCPB 1I8IA 4MQXD 3KLAB 2YK1H 3P4OA 1HH9A 1TJHL 2AEPH 4I77L 1CFVH 5D8JH 5IMKB 4LLVA 1QNSA 3G5XB 2P5WB 2VLJD 3K8LA 4P9HC 1QBBA 2NW2A 3U7VA 4CVZA 4P46B 4XB7A 4TX8A 3IU4H 2ED8A 1D5MB 3ARQA 1IC5L 1SYSB 1TIUA 2CDGB 5DMIH 1TVPA 3SGDI 1TVNA 4X6EB 1A3HA 5CP7B 1AXIB 3Q6GH 4AD1A 4HGKC 1XCTB 3MUY1 3T4YB 2Z8SA 3UJTH 2H41A 5E6ZA 1OCQA 2P44B 2J12B 5EZOL 4DOHE 4W93A 2WLYA 4YBQD 1CD9B 4XGZA 2UWEA 3I2CL 4PJAB 3X14B 3WBDA 1ITCA 4RGOH 4JAMA 1CS6A 1N26A 5C9JB 3SCMC 3VXTA 2GK0A 1JI1A 5L0QB 1BQHG 5EN2A 2FH6A 2XVGA 1GUVA 1FAIH 2AOSA 1I8IB 3AAZB 5FYLL 1ZVSA 5HPCA 3O8XD 1HH9B 1NKRA 4LLVB 3HG3A 5DEGA 4JFTA 2N56A 5SWZB 2EPOA 2NW2B 4CVZB 5CD5C 1R0AL 2CK0H 3BYTA 3FMGL 3EDKA 4J3OC 5FAAA 4FXKA 3L4ZA 4X6CA 5FCSH 2F54D 3K81A 4WY7H 1EO8L 5B39B 2VISA 4R2GC 3TH3T 4OUEA 5EUOF 4NT6A 1OT2A 1HWWA 2ZPKL 2UWEB 1KC5H 4JAMB 5CJOH 5SV4A 2XJ7A 1NCDH 4Z7UE 4PJ7E 2GK0B 3VXTB 1OLLA 2PNDA 1NWUA 5HDBE 3LS5L 5EN2B 2VX7A 1SJEB 2CRIA 3SDDD 3W2DH 1ZVSB 3CMOL 3QUYC 5A8OA 1RIVL 4HUVB 2DQIL 2GTZA 4PRIE 8FABB 5A6LA 4AG4L 3GGWA 5TH2A 3GFUA 1FZMA 1R24A 3H54A 5DEGB 4FQLH 1CDCA 4JCMA 1UWUA 5KW9H 1EGJL 2Z0BA 3N13A 4GSDH 3EBVA 5IROC 1O7DC 2AJ3B 5T1DH 3F65A 2VN7A 2F5BL 4FXKB 4XNUH 2WBGA 1W72L 4X6CB 1CWVA 4U05A 1JZ6A 4WKFA 2HP4A 2VZ1A 4Z8FH 4U1SA 4LU5H 2VISB 4ZS7L 1JZ7A 4AZHA 1OTTD 1IQWH 4TOQA 1HKKA 3WQ4A 3BJLA 4ZYKA 1FGNH 4NT6B 5D7LA 1I4FB 3STBA 4YHEA 1EQCA 4JGMA 4ODTL 1V02A 2XG4A 2J4WL 1UYQA 3VMPA 3QUZA 4OIBA 3QRGH 4DN4L 3AMCA 1A6ZA 1TZGL 4NFCA 3L5XL 3EJUA 3KLSA 4YK4C 5HD8D 3BE1H 1HOCA 2VX5A 2B0SL 2DTSA 4WIWA 4IMLB 2I07B 1JCKA 1UH4A 4GW4A 4GKOA 4M56A 3GGWB 5FO7A 5TH2B 4V2CB 1FZMB 1R24B 4WWKD 3U7AA 2J8UA 1OSPH 2VLRD 1PAMA 3JV0A 3DROA 2I60H 4QXUL 1FP8A 5K93A 2XZCH 4U6YB 1I7ZA 3JV6A 3WMBA 2AEIT 4Y2OA 4GBXD 3O6KL 3LKSA 3MGTA 3IRZA 4EN3D 5KSUA 5GS1C 1CE6A 3HE6D 4ELMA 4F9LA 4U1SB 3TONA 5IVNA 4W88A 4TRPL 3B9DA 1KLFA 4LAJH 2HMIC 4ZYKB 4UTBL 1C93A 3ZJ7A 5A2LH 1HNGA 4Y5VC 1T7ZA 4JQVA 1EIBA 3QJFA 4C56D 3LZFH 5T3XL 4YE4H 3WFEH 5E5MA 5DJXA 1A6ZB 3ARFD 2BOBA 1HOCB 3PV7A 4LCWE 1BYCA 1D6EA 3K46A 1I7TA 1AKJD 5GGQL 4GW4B 1FFPB 5FO7B 5BROA 1HSAA 4HK3N 1TQBC 5IHSA 3IRPX 3PTKA 3VILA 5I1KH 1S3KL 1I7ZB 3JV6B 3C60A 5ISZA 4MVBC 1UR4A 3SEPA 4HS6B 4PRDB 5FKYA 3LKSB 2UY4A 3MGTB 1DBAH 4LQ1A 4JM4H 5IHRA 5KSUB 1CE6B 4ELMB 2O9TA 4I18A 1KV3A 5C0RL 2DS4A 1MPAL 4KVNL 1NOWA 3IFOA 4HTYA 1JTPA 4FZ8H 1AFVH 1PKOA 3S97C 4DO5A 4JKLA 3CVHA 4LARH 4P2RE 2DQEH 3QJFB 2EQDA 2XXCB 3DX6A 1M05A 3BO8A 3DYOA 5E5MB 4ZFOA 4U1JA 2Y5EA 3FZUC 1UFUA 4P2CG 5IHBA 3MU7A 3C5SA 4JFED 4P4RB 1I7TB 4S1SH 2IBGA 4XMLH 5IWLA 4FNSA 1S9WB 3TEUA 5KJRH 3VSVA 3LPFA 1HSAB 3CSPA 4F80A 4PGZA 1MIEH 2A38A 4NM8L 3C60B 2HRPH 2JEQA 5ISZB 3OLDA 3E1F1 3RIKA 1QPPA 5F7FA 1M71A 1MWAH 2Y23A 1MCSA 1T83A 4F8TA 4APQD 2WC3A 1P6WA 4PJ5A 1QNRA 3IFOB 6A3HA 5GZNC 4PMXA 3GMNB 3EJZD 4AD5A 4TX6A 3W6LA 1BWWA 5IJVA 3D0LA 1GOHA 4YBHA 1FLRH 2V9TA 2VSCA 3CVHB 3H7BA 3DX6B 2C3VB 5ABFA 1M05B 2QJDA 3BO8B 4ZFOB 5EU3A 4OTXL 1KUMA 2VXVL 3D51A 5D8WA 1W2PA 2Y6SD 5IG7A 2M8XA 3SUWA 3TO2A 5HYEA 5K9OA 4OF5A 5JQ6L 1MCDA 5CWSA 4PRAB 5I1LA 3RHWK 1GAFL 3TESA 2FX8H 5DRWA 1FG2A 4RDQG 3MJ9A 4OI9A 3MMWA 5FUZL 2UZIH 4XAKE 1BPLB 4ZENA 1QR1A 5JMOC 3V52L 3CHCA 1NBZA 1WICA 3A6CL 4F7EA 1M71B 4Q0XH 4KHTH 3SUSA 4F7TA 2BSED 5L8KB 1L9NA 5I30H 3WDQA 1FC1A 1FN4B 4PJ5B 3GBEA 1I85A 4N8VA 2R8SL 1NAKH 4OGZA 3V4UL 3X3GL 3HZMA 4W8AA 4KHXL 1BAFL 1S7UB 3MV9A 2YD3A 3H7BB 2WVSA 5ABFB 2EDFA 3BVTA 4Y4HD 1TCRB 2R2CA 5EU3B 4JFUA 1E4KA 2R0WH 4KDTC 5E99L 5A6BA 3WQVA 4OBRA 2D7TH 4UILL 4CU8A 1VKXA 2DTMH 1RJYB 5C6TH 4LLYA 3TO2B 1OBAA 1NPUA 4JPVH 5I1LB 2X4OA 3UP1A 4MB1A 5DRWB 4YHZL 1WZLA 3R1GL 5BQ7A 1UR8A 3K3QA 4UTAL 3T0WA 5DMYA 1FVCA 2OJZH 1P4BH 3MI6A 4GAJH 4HZ6A 2NY1D 1UH3A 4GRLC 2XWTA 3V2AR 4IRJA 4M8VA 1LF1A 1YY9C 1NBZB 4UDUB 2FR4A 3T2OA 3S9DB 4UQAA 3N85L 4P59H 4F7TB 4ZFGH 1OAYH 3ILQC 4NJAL 1CPUA 3AQUA 3CZLA 1U93A 3DC0A 4N8VB 4Q58C 1HJWA 1B0GA 1J7VR 3K2MC 4BH7B 3HA0A 3GUTA 1MEXL 3CCHA 1AP2A 2IGFH 3KPMB 4KKAD 4LEOA 3MV9B 5ADPL 1ND0A 5ILTL 1C5BH 2EE2A 3U5UA 1S9KC 3VD5A 4F58L 1PYWA 4LLYB 1Q6EA 4JZ5A 4FQ2H 5GNXA 3F58L 2O5YH 2X4OB 3QOMA 2D0FA 2FBJL 4JG1L 4DGYL 1UA7A 2J47A 3VGHA 3AB0C 5BQ7B 5I1HL 2FX7H 2R29L 2B5IB 1FVCB 4S2SB 1K3ZA 5K59E 1HHGB 1KXTB 5GGVH 3WY2A 2XWTB 4KROC 5M7QA 5KAQF 1P1ZA 4FQIH 1QG3A 1NGYA 2FR4B 3MV7A 5E00A 2GJ6D 1E43A 3P0YL 1C8XA 4HUMB 4BFBD 4UOW1 3K0WA 3SPVA 1U93B 4CDGC 1B0GB 3WE6A 1AJ7L 2V5TA 2AXHA 4BSVA 4N90D 1NCCL 5DQDH 2NPLX 2WBWB 3CCHB 3EO0A 1CLXA 1AP2B 3DHJA 5BMFH 3E2HB 5CSBA 4P48A 2N4IA 1ND0B 4OJFH 2X70B 4JFYA 3KYKH 1QW9A 1EEZA 2A0LC 3LVEA 3LMJL 1PYWB 3LH2H 4UNVA 1M1SA 4F9PA 2D22A 5J12C 4JJHA 4ONGL 5SWSA 3WL9A 1GONA 4WFHD 3ARVA 4D8PA 1JI2A 1OM0A 3P30L 3TT1H 3ZHKA 1BFSA 5BS0A 1JDDA 1OB1A 1C08A 5E8NA 2CPCA 5EU4A 3VFUA 2DQUH 1C8YA 1H2JA 1KB5L 3BXNA 1P1ZB 4KJPD 2VAAA 4XB3A 4MNMA 1NGYB 2CRYA 5E00B 2AABH 1MW1A 5DZOA 4U1LA 1TMCB 3Q1SH 1GORA 1T4KA 4OLEA 4H8HA 2GTWA 3WE6B 2JB5L 4TSAL 2V2TA 3TTYA 4C7DA 2ATPA 1IEBA 4ZUSA 4IRSD 2VX4A 1SVZA 3WD4A 3PGCA 4KJQD 4JFYB 4OT1L 2B4CH 3U0PA 1MI5D 1W9PA 2IQAA 3KYAA 5FOBB 5BZWA 4KI1A 3O4OC 5DS8A 4FLQA 3S4SA 35C8H 3N1MC 3ZTNL 1JXJA 5HVFB 1UA3A 1ZANH 1DQJA 3TJEH 4G6FB 3WL9B 4D8PB 4HK0A 2E7LA 3IGAA 5BS0B 3GXNA 3LKQA 4XX6A 5TGBA 1OB1B 2DQJH 4BKLB 1S7RA 2NXZB 5CJBA 5EU4B 3OAYH 1IT9H 1QD0A 5H35A 1GPOL 3VFUB 4UV7H 1GOWA 4PV8A 3K8KA 2PTUA 2XTJB 5KOMC 2VAAB 3FN3A 2DI9A 3X13A 1XC6A 2HA1A 5C0BA 5JNYA 1WTLA 4U1LB 4JLRA 1ED3A 3F12A 3J8F7 4J1UB 4ODUB 3WJLA 4Z77A 4G9DA 3FAWA 1QHPA 2V2TB 4K9EH 1H8OA 1IC4H 3FY1A 1ISXA 2ATPB 3THMH 1EFXA 4ZUSB 4PJBF 4YNYA 2VERN 3IAQA 4OCNC 1NMCB 3IB4A 3U0PB 5DVKA 3UO1H 1J0IA 3WD5L 5BZWB 5DS8B 3S4SB 1T1WA 1WC7B 4O2EA 5GGSY 4LSTH 4HK0B 1CLZH 2BX5A 3NPZB 5IBLD 1OF2A 3AM8A 3LKQB 4AMWA 3MCG1 1S7RB 1S7WA 2ESVA 4JFEE 3AS3A 5H35B 3QUKA 4PV8B 3WDPP 2BS9A 4FG6C 1O0VA 3O45B 1WZ1L 3X13B 3CFKA 5A8NA 5JNYB 5C0BB 3MXVL 3F12B 3H9SA 2D7OA 1MWOA 1X5KA 4G9DB 2ZUVA 32C2A 3CLWA 3ZE1E 3GJFB 2NY5L 3P2TA 8CGTA 3AIUA 4JJ5A 4Y8AA 1EFXB 3ZIZA 2UY3A 4YNYB 3MODH 2OWXA 2VXTH 4TUKL 4WHTB 4WI8A 2IWGA 2LVEA 1US2A 1RVFL 1IAOA 3NIDE 2ZJSL 1PG7W 4PJXE 2HWZL 2OWCA 3MBEC 1IC7H 2R4SH 4U1KA 2R1YA 5D2NE 3ZJ6A 2YA1A 2Y25A 1Q0YH 1IGIL 1T1WB 5ID0A 4O2EB 1BFOA 3KG5A 2MHAB 1A6WL 5GS0H 4F7PA 1OF2B 3BKMH 1FE8L 1BEYH 4ALAL 5EZIL 1FNLA 1S7WB 3W81A 2ESVB 2JIXB 4OCXH 3JTSA 1J05A 2ZWLT 3SCPA 1MREL 1BZQK 1RULL 1DFBH 3CFKB 4G9FE 1KPUA 3WUWA 1R7AA 1QFWM 1JNEA 4B0MM 5FD0A 3H9SB 4OLVL 4RGMC 1OAQL 4IBLT 1QRND 2DLGA 3LHPH 3RAJL 1MHHA 2VDPL 2EE3A 1BQUA 5DLML 4HAGA 4JJ5B 4Q6IB 1FNFA 2VTFA 1T1YB 4QRRE 4K2UH 3UPAA 3QHZL 3VIJA 4BELD 4Z7VB 3QUMB 3CV5A 1EVUA 4ZXBD 3OZPA 1IAOB 3VM5A 2WIIA 2QHRH 4U1KB 3T0VA 2R1YB 1MW0A 3ULVE 2ZCKH 5CKAA 4M48L 5ID0B 4QCIA 4LPTA 5JOPE 3ULVC 2R23A 4LGXA 3QWOA 4F7PB 1UWGH 1NSNH 1JIBA 2LU3A 4HXAH 5DF0A 5E7FA 2LTQC 3QFJE 2IADA 4LL9A 3L4VA 4ZTPL 8A3HA 3KJ4C 1RIUL 3L3HA 4XH2B 4N0UA 3JTSB 2WKLA 4DN3L 4EUPG 1NBQA 2JLLA 3WUWB 5I6XB 3RGVD 2J5LB 3QG7L 1BD2B 3FKUS 3OAUH 4M5ZL 4UQ3A 1K8IB 1JPGA 1EZVX 2VRJA 1MHHB 1QBML 2F1AA 5AEAA 1X4ZA 3E6FA 1I1YA 3F5JA 4YUEL 2XZZA 1LD9B 3UC0H 3B9KA 2GJXA 2P8PA 1NC4D 4MXWL 3NA4A 1SHMA 5I8OL 1XGPA 4NCDA 2GJJA 1XGQA 3QNZA 2WIIB 1QFHA 5CUSL 4LYPA 2W65A 4TVSa 1PZ5A 4QCIB 3LEVH 1VJSA 2R23B 3QWOB 2NY4B 3VW3H 2PW2A 4U0RB 5JMRA 3U9PL 4Q9RL 3ZYJA 3F6IA 3D1MC 2IADB 5EU7C 5C0EA 3L3HB 1KB9K 3G5VA 4DVRH 1BYAA 4N0UB 5L2KD 3MRPA 5E5RB 3BXWA 3CVHH 2B1HL 5FM5M 1MFBL 1YEFL 5EU6D 2WSPA 2XIDA 4MJ5A 5F1NA 4NC0B 4KZEL 3ECBA 2VO5A 3DVGA 1PBYA 4H8WC 1AGBB 3W39A 5K9QI 4Z5RA 4ZEPA 3C87A 4W86A 3E6FB 1I1YB 1R5IA 1OIFA 1U8NA 3LKRA 3B9KB 1OWQA 5CINH 2P8PB 1JWUA 1DDHA 5GZOC 3O3AB 1XGQB 4BUGA 2VDOL 1GGIL 3QCVH 1DBKL 2D31A 4FNLL 1NFIA 3BDYL 5F72S 2HLAA 3SKJL 2ICWJ 1F8TL 2DQFB 2A6JB 1D3CA 3L1OH 4I48A 3L5WA 3VXNA 3N50A 2WM0A 3IGUA 1HI6A 1RU9L 2PW2B 3ULUD 4NM4H 2YDRA 3U9UA 3PWUB 2WZIA 1WBZB 5TF1H 5C0EB 1ZLSH 3G5VB 1KJVA 3TT3H 1NGPH 3AZSA 2DT0A 3MRPB 2OP4H 3O2WH 1A7RL 3S35H 3MMUA 4HMCA 4WFHE 4MJ5B 3AS0A 5F1NB 1XIWA 1DN0B 1U8MB 1P5VA 3DVGB 5DFTA 3GSNB 4GJTB 5ACLA 4H1LG 4Z5RB 1QI0A 4OZHE 4JM2A 4P5KB 4Z7WB 4Q9QH 1U3HC 1R5IB 1VFBB 1MIML 1N4XH 3ARUA 3I9GL 3SKMA 3UJJL 1AE6H 4YHPB 3OHXB 3VWJA 3LKRB 1KEML 3MJ9H 1R6VA 3VIPA 4G7YH 4OD2A 1DDHB 2YBUA 1YEEH 3EJYC 1CZ8H 4RGNC 4MA3A 2A1WL 1NFDF 2VXQL 2X89A 3SGJC 2D31B 3V6FA 1XGRA 1Z5LA 3AYRA 5IT2L 3GZAA 1NFIB 4W89A 1KNOA 4I48B 2YKLH 3L5WB 3VXNB 1RMFH 4KWUA 1F90L 2FH8A 3U9UB 1MI5E 4LAQL 2M2DA 1W3HA 3T3MF 1QSFA 1LL6A 1RP9A 2P5EE 5ABGA 2BZDA 1XIWB 4EI5D 3CFDA 1HEZA 4HUWA 5IEKB 1JBJA 3SDXF 3EJPA 2WBJC 4JM2B 5D7KE 3AIBA 3SKMB 3T77A 5D1ZA 1T80A 4ELKB 1AY1L 3EOBA 3KHQA 5E6ID 2Z92A 2BFGA 3MLXH 4OD2B 2CESA 4M4PA 2G8ZA 3ZR6A 3HI5H 1R3IL 1T20B 1PG7L 4FMKA 1ORQA 3SOBH 1Z5LB 3V6FB 4Z2JA 2Z9TA 3D3VE 2A3AA 5GJTL 1KELL 1KNOB 1AGFA 1FIGL 4LKXA 2X09A 3OJ2C 3R0MA 2P5WD 2H8PA 5JXEA 2RFXA 1JFQH 1G6RL 3T4AA 3ZE0E 3RIFF 1I1RA 1QSFB 2WW8A 1NCAH 2H45A 3V6BR 3KXFD 2WMIB 2R4RH 3CFDB 5FUOH 4GG6E 1HEZB 3BVWA 4HUWB 4XMKH 5J6HA 5DTFA 4CW1A 1MHPH 4JY6A 4W6WB 4X6FB 4YC2C 1CDJA 4PBXA 4P0DA 3T77B 5D1ZB 1BQCA 2XUCA 5DJ0A 1F3DJ 3EOBB 3MCLH 1I3RA 2Z92B 7CGTA 1HF6A 4FZEH 3I6KA 1INQA 4XNXH 2DYPB 2EXWC 5CSZA 3P4NB 4W7VA 4RMUA 2Z31D 1KJMB 4HT1H 3RJYA 1OAXH 3MNVB 4TPRL 5CCKL 2XFRA 4JFHE 1A0QH 3QIWC 4FFZH 1AGFB 1GZJA 1KACB 3AFLA 4KAQH 4LKXB 5EUOA 5DT1L 2NLJA 4PLKC 4TULL 5SWZD 2NY2B 3QPXL 3AMLA 1G9HA 1S7TA 1FFOA 1W8OA 4N8CL 3VDCA 4OOUA 3T4AB 2VDRH 1EJOL 3NFPA 3U0WL 1TFVA 2MKWA 3V7MA 5T33L 2NT0A 4PJCE 5J6HB 1RUKL 1MCQA 3GK8L 1YNKH 4K8RL 1UKSA 4LRNH 1R3JA 5SV3A 1EHAA 4PUBH 5DJ0B 1I3RB 4X8XA 1A7OL 3ES6A 1INQB 5GISL 5CSZB 1FNHA 2F5AL 1QRNE 3W26A 3PQYB 5HHOD 5A2FA 3LY6A 1XH3A 1IZJA 1LG1A 4RMTA 5CEZL 5B3NA 3IU3A 4PFEA 5EUOB 4NC1C 2NLJB 1TMQA 3AZTA 3D39A 3IXAA 3RZCA 3WO3B 2C8NA 2L7JA 1S7TB 1FFOB 5HYIA 3BLKA 4JAWA 4E0RB 1MFDH 4NKOA 4J2XA 2EC8A 3NFPB 4U1GB 1RIHH 4FQXC 4YQXH 3KAAA 5BJTA 2VL4A 3X17A 4NP4L 2PXYA 3R8BB 2UY2A 5FCUH 1HKJA 3BZDA 4MD0A 1SY6A 3BP5A 3PP4H 4L5FH 5B22A 3X11A 4NO0D 1R3JB 1FFRA 4WW2C 2ERJC 2WCGA 4YJZL 1NP2A 3DX9A 2ALWA 4YEEA 2P42B 3U7YH 5HPMA 3MRNA 2AXFA 1ZLVH 4JZJB 3FQUA 2D2OA 3TNNA 2P24A 1XH3B 5LG1A 3SDCA 3WUBA 4D9RD 3NGBC 4DZBB 2BVOA 4OV5A 3JV5A 3IU3B 4I0PC 4P5TD 4Y4KD 3C8DA 4U5IA 1QQDA 3D39B 3IXAB 3RZCB 1RH9A 4QRTB 4L3CA 3GJFH 1ZT7A 4XP5L 4J12A 3RKDD 4PPTA 4NKOB 1ZLWK 5C0IA 4W70A 1SZNA 4DEPB 4M7LH 5I18H 3VXME 5BJTB 1C5DA 2ESCA 5T5FL 2PWDA 1N6QL 1OGBA 5GS0D 4NUJA 2C3XA 2PTTB 4MD0B 5L2KE 1OW0A 4ONHB 3NAAH 4Z2KA 2ICCA 5EU6E 1S5IL 1I9EA 3DX9B 1W91A 3QFDB 2QV2A 5E4EB 2BK8A 3ARWA 5HI3D 5HPMB 1GIGL 3MRNB 2R9HD 3FQUB 3TNNB 4GI9A 3SDCB 1FH5H 2DLIA 3CLEH 1ZS2A 1JYWA 1I8MA 3RY4A 4CADA 1XD0A 4IM4A 2F53A 3VM7A 1GGCL 3IFLL 3W53A 4LRIA 3NA9H 4JB9H 2Y4SA 2LQRA 4AZIA 3WF3A 4YO0A 1WWCA 1MF2L 1ZT7B 1WZKA 3MRFB 4MNLA 3QQ4A 1KTRL 1LMKA 1RZKL 4JFFA 1JGVL 5A1AA 4C7GA 4Y5XC 1Q72H 1C5DB 3CUGA 3MOBH 2J1KA 5I24A 3QUMH 5DZNA 2FGWL 3L3DA 4W6XB 2X8RA 4NUJB 3VRLF 4JFVA 5C07A 3WIHA 5CMAA 4LOUD 4RBPH 2PO6A 3VGFA 1X5HA 1ZHNB 4X0VA 1QBLH 3O4LA 1JRHH 1WF5A 5I76A 1MQQA 3B8YA 5EZJA 2V2XA 3PIQA 3ISWA 5EIIA 4HFUH 5CBAA 1I8MB 3HUJF 2YSSA 3IFNH 4HPYL 1MLCA 3F62A 3T2NL 3VFRA 4XPTH 1CQYA 1RUMH 4YO0B 2O9RA 2OMNA 1RJZA 1OTSC 1YJDL 3BGFC 4V2BA 5DD3L 1A3LH 3QQ4B 3WFZA 3ALGA 4JFFB 2FB4H 1KXVC 2DDQH 2UUDH 1RV6X 1WAAF 2VCAA 3L3DB 1YNLL 5C07B 1EH9A 1U92A 5I9QC 1VGKA 4XWGL 2PO6B 4NZCA 1OAUL 3LPWA 2OJEB 5C0CB 4NPYA 1TTFA 2EDBA 1NC2A 4PBWD 4OQTA 4NNPH 1P4LA 1N0XH 5I76B 3V6OA 5EZJB 3VXUB 3MTRA 2V2XB 2AK1H 2CUHA 3ARPA 2A74A 1ZE3C 3PIQB 5C8JA 5D7JA 3K2UL 5CBAB 4Y16C 4JO4L 1ZA6A 1Y0LB 3QYCA 4M7ZB 1EDGA 3WHXA 3VFOA 3T0BA 3DVFA 1IGCL 2OL3A 3VFRB 4OZGE 4OGYL 1RJZB 1MXGA 2HVMA 2R0LH 4YXKH 5F7UA 4UR9A 4EE9A 5A2AA 4CCDA 1N6UA 3O81A 3QHOA 2PR4H 4JQIL 4FMVA 3LCYA 3GSVA 4MXVE 2ICWI 1KGWA 5JXAL 3TBTA 1FHLA 1YEDA 1DANU 2P5WE 4S1RL 3EJJX 5GJSH 3FB6A 1U92B 4JPKL 5D8ZA 4P46C 1VGKB 1XR8A 2JEPA 2A6DB 3OKEA 1ODUA 1T7WA 2IBZY 2IQ9L 4NPYB 1RZJC 1MXDA 5C0AD 1A6UH 4NSBA 1P4LB 1WDSA 4XP4L 3TBWB 1VGEL 2ARJA 5C8JB 2A74B 3U4BH 3KLHC 3DMMC 4X9HA 5D7JB 2WMGA 4TNWF 4AZCA 3GM8A 4AEIH 4PJAE 3WHXB 1QSED 3VFOB 1VEPA 1HINL 4V28A 3GSNH 5HHQA 4P8XA 4NBXB 2EDYA 1P9MC 5T1LD 5D93B 5LA2A 2I5YL 4X4YA 3DYMA 3TA3C 4M6OH 2OR8A 5L0QC 4F15B 1D5ZA 2VJXA 3MO4A 1VA9A 2XG5A 4FLRA 4HSQA 1EQPA 3GSVB 1ECEA 4LIQL 3QH3A 4K68A 3JUGA 3TBTB 3OPZL 5ADOL 4LMQI 5SWZE 1HIZA 2AI0H 1CLOH 1W0YT 1W8NA 4MD5A 2XVKA 3VXSB 3UYRL 3R06A 3ILPA 4D9QD 3SE4C 4JCLA 1XR8B 4I3SH 1ROWA 3OKEB 2IH3A 5F7NC 1LO0L 5MI0B 3QIBA 2FLRT 3IETA 5KEZA 3WDRA 2ZOKB 2XPGA 5E8DL 2J77A 2WV3A 2WQRA 1CDBA 3QIUD 4AZCB 3W6MA 5C7XH 2UWEE 5D2LA 5HHQB 3LN5A 4X4YB 2V38A 1GGUA 3FRUB 3LQAC 1CCZA 4BZ1L 4IDJL 4LHUG 1D5ZB 2DH2A 3WCYA 3LMYA 4KJWD 3GBML 5IVZB 1XF5A 3GJFK 1EDQA 4HGWA 1EGJA 1LO2H 1T5XA 3G5YA 1QFPA 4HH9A 4NQDA 5I16A 4YHYC 1BX2A 4NCC2 1ZGLM 3PBGA 2BCKA 4PS4H 1OIMA 5I15L 1W0VA 1NARA 4PJ8A 3KE0A 1W72A 4YDLC 2GY5A 3BN3B 5HDQH 1CR9L 2DQHL 4K3EH 5C0NC 3HU7A 3WF2A 4MMXC 2IH3B 3WLWC 1BLIA 3MOQA 3I3DA 4X6CE 5F97E 3QIBB 3IETB 4AM0A 3T65A 2XPGB 4HMEA 3EO1A 1EUUA 4HBCH 4K7PY 4AENA 3BH8B 4ZOCA 3L4YA 4FQJH 4UFIA 5A2IH 1ZBCA 5D2LB 4XVUC 3MRJB 2WMHA 1MFNA 4G3YH 3RPMA 5B38A 3GSXA 3ZKSD 3LD8C 4TN9A 2ZSWA 2ADJB 4PTTA 5FYJH 4Z2GA 1JE6A 5J7CC 2VR4A 4OFDA 3MA9H 1XF5B 4H8WL 4HGWB 1T5XB 4HH9B 5HHMB 4NQDB 5CJXA 5I16B 1LJYA 1EXUA 2D23A 4HZ7A 3V95A 2BCKB 1W0VB 5C6PB 4DGVL 3H3PH 5DJCA 1GJUA 2CO6B 3MO1A 1BFNA 5HHXH 3TYGH 5LBSL 3E8UL 2HTKC 1INEL 4AM0B 3TWCH 5I73B 1OCWL 2G2RA 3EO1B 4DW2L 3C09C 4RISH 1DUYA 2XVLA 4S3KA 3RJXA 5F7HA 3EYFA 4ZFZA 5CSUA 3K4ZA 1V02E 6CGTA 4G6FD 2KBGA 1W1PA 3R4DA 4NN6B 1GGBL 3QUZC 4NKDA 1IEHA 4PMQA 2XN0A 1DSFH 1ZEAH 1RZ8B 3GSXB 4PJBA 4XPFL 3GBDA 4XP6L 1V3IA 2ZSWB 4PTTB 4RE2A 3TVMD 2XTJD 2N7AA 4DAGH 4OAWA 1T2QL 2IJ0C 3WFBL 3B8SA 1EXUB 1UJ3C 1F4XH 3VFVB 3C5ZA 5DD1H 5DJCB 4TVPL 2GCYA 3MO1B 3U30B 2EDKA 1QPKA 5TQ0H 5F7EL 2BVEA 3Q0HA 4ZQKA 3EYSH 4AZ6A 4ELME 2WNGA 4PR5B 2VH5H 2BVPA 2CRMA 3BCFA 1MH5A 1M01A 4AL8H 3OGSA 3WNKA 2ZX8A 2YXMA 1DUYB 5DD6B 4ODHH 2OR9L 4M6ML 3D18A 3U48A 4CMMA 1XRVA 4UIMA 4JQVC 1U95A 5ITBH 1DN2A 2EYRA 2AJUH 1GW1A 3SJVA 1LEGB 3RDTA 4PJBB 4ZO7A 3UMTA 1JF6A 3O9WD 5J1SC 5C9KA 3CX5K 4C59B 4KVCH 3UTTA 5F9OH 1MVYA 4E41B 4IDLA 1HXMA 1K9FA 3PXJA 3CDGB 3LPOA 3V0VA 4I9WD 4HUKB 3QWRD 1I1AC 2Y9RT 3N1PC 5ISZE 4ERSL 4M6NH 5C8BB 3C60C 2GCYB 3V7AE 1I9IH 3NCYP 5J89A 2VKWA 3LSOA 1PEWA 2BVPB 1E4IA 1MH5B 4I18C 4D94A 3QXAA 3GI9H 4WNQB 3QQ9D 5B39G 2K3TA 3CFJB 2PUQT 2X1PA 1U36A 2YN5A 4WFFD 4F7CA 4G80A 1YPZA 3HTLX 4EDWH 1M7XA 1U95B 2EYRB 1WTGT 3O2LA 3LRKA 3QPQC 2X4NA 3RDTB 1TPXB 5I1IL 4Y2DC 1KCUH 2JIXD 3MLSH 4GQ9H 4JGJA 4JG0H 5IK3B 5TE7L 2RQ8A 4PYGA 4M61B 1HXMB 2VWEC 3B2VH 4HCRH 4QOKA 5IEHA 4HOZA 1JHLH 2NY3D 4N1HB 4FABH 4ORGA 5J13C 3UPRA 2ZKHL 3RTQA 2WWMC 1H3VA 4PJHB 4GLRI 5HTSA 5HHNA 4NKQB 3U6RA 2DM3A 3NH7L 1DBJH 1QFWH 1TNNA 4M1GH 4WF7A 3M1BB 4PSRA 4X4ZA 4WO4C 3GI8L 3LSOB 5C08D 3MRQA 1WNOA 1T83C 2DQTL 4PJ5E 3FFCB 3VJ6A 1A7BA 3MV8A 3QXAB 3QXWA 2HKHL 3BUIA 4YXLH 4N9GA 1UACH 1U2CA 4KRPD 4F7CB 5IESL 3WXVH 4AQ1B 4HQQH 5L8JB 1YPZB 1F02I 3BPOC 4D0DA 2MQ3A 4CD4A 2X4NB 3CBWA 3GMLA 2KUTA 5KVFH 1LK3H 3DXAA 1NCWH 3U82B 4PUEA 1NMBL 3MUAA 1BM3H 1MJJA 3WEZA 4QRPD 3RFZC 1CD0A 2HG5A 5BVJA 2EXYD 1MCOL 4M5YL 2GEEA 5IEHB 1WDRA 1ZL1A 4BQ2A 2FJGB 4NHUA 3FQXA 3GNPA 4ORGB 5GS2H 5IF0A 3UPRB 1BD2D 1OARH 1QLFA 5CZXC 5HHNB 5T3ZH 3F5LA 5DC4B 2PF6A 2FHBA 1A5FH 1HL8A 4J6RH 1NQBA 1LO4H 4JRWA 3O8XC 2HJLA 2YL8A 3MRQB 4RWYH 3VJ6B 2BSRB 4FQ1H 3WIJA 4WGVB 3C9NA 4QCEA 4AZGA 2HT4D 2XZAL 4IRZH 4PIRF 2WANA 4LGPB 4N9GB 1IBGL 3NZHL 4XP9L 3UZEA 2BVDA 3MV9E 4NOBA 3L2MA 1GZQA 4YWGL 4D0DB 5EORH 1CGSL 1P2CA 3WIHH 3QNYA 3DXAB 4LBEA 1EEYA 4RA0C 1JWMA 4DQOL 1MJJB 2ZCHL 4ZE5A 2Q8XA 5DVOA 5BVJB 2HG5B 3QDMA 3S34L 4MAZA 1U8OA 1LG2A 1RZ7L 3D50A 5AYIA 1UM4H 5JQHC 2Y06H 1NLBL 4XT1C 3FQXB 5FK9B 2WZPD 5IF0B 4LSPH 1UH2A 4WI9A 1JFHA 1TVBA 2EDQA 4GXVL 1CZ1A 3BUPA 3GNRA 5HVHB 1G9MC 2D4FA 2HT2D 4UOW0 1AHWA 2UZYB 2VDNH 4XBEH 3QEQD 4IRJC 3C8HA 3SDDC 5MENA 4N1EA 3UJIL 2XXMB 3VKKA 2HJLB 1I3UA 5DUPH 5DWUL 4ZUWA 5GGTL 1XD1A 5I6SA 2VUOA 4PRWA 3C9NB 3SE3C 1UCTA 2V17H 3V9FA 5FDYA 2CPUA 1UM6H 3OWEA 3RX8A 3RZWA 1IFHL 3MFGB 2ZICA 3BN9C 1P2CB 4WFGD 4S10A 1DE4A 4LBEB 1EEYB 3JBG7 1MFUA 4OIFA 2OI9C 3AMKA 3QDMB 1OTTC 1U8OB 3HC0B 4KI5E 1BVLA 4L4JA 5T1KA 1NFDA 4PRHA 4Z7OF 4OQTH 1AR1D 2A9ML 4HDIB 3UCQA 2ZZUT 1KB5A 4TVUA 1RZFL 4WI7A 1J86A 3EYUH 5JBEA 4P2QA 3T0ED 1AHWB 3W24A 2YL9A 1IKFL 3K8MA 5HD8C 4TSCH 4PJFB 4OKDA 5KTEH 5A2CA 2C0HA 4ODWA 4ZUWB 3V7AG 1TJHH 5A3IC 2Z8RA 3O6AA 2NNAA 4UZSA 1HSBB 3QO0A 3BAYA 5EULV 5GNYA 3RL1A 3NPSB 5C2BL 2ICEB 5I1GL 1IMHC 3MRBA 1NCUA 1IC5H 2PW1A 1U3ZA 1MAJA 4EN3C 3MUZ1 1F58L 4H20L 5H37H 1WT5A 4PMRA 1PZ3A 3HG1A 3PWJA 4BS0A 2A73A 2QHLA 3QOKA 5T1KB 1BVLB 4F9PC 1BBJA 1NFDB 4PRHB 1B4JL 5EZOH 3KVQA 5BS0E 4MCYA 1KB5B 4A2MA 1FL5A 5B8CB 1HYSC 2NXZC 1CXHA 3DNKA 4P2QB 2XTJE 3POHA 1CTNA 3N1FC 3TPUA 5LCVH 7FABL 15C8L 2V7HA 2ZUQC 2FEEI 4JKMA 5FYLH 2DKSA 3CNKA 1CI5A 2BSSA 5HI5D 2NNAB 1ZWIA 5EOTA 2X89D 2W9EL 1HILA 3QO0B 3KGRA 1B6DA 3RL1B 2LAGB 3FMGH 5D70H 4POUB 1UD8A 1BP3B 1GOFA 3MRBB 1ZGLB 4IPLA 2PW1B 2HFFA 4LVHC 3HG1B 3PWJB 3GMRA 4QWWD 4X7DC 1T1XA 1EO8H 1FC2D 1EDTA 3QB7C 2AKRB 1BBJB 2ZUXA 5ESQB 3NTCL 1KENL 4MCYB 2P1YA 1FL5B 4PCSA 3P77A 4P8WA 4ZUTB 2XN1A 1PPIA 5BZDB 3D0VA 1MRFH 1V3LA 2C7FA 4WTWA 1QHOA 3WNOA 5E8OB 3LS5H 5FYJD 3N9KA 1L6XA 2HN7A 1OL0A 5C0BE 1DVFA 2V7HB 4Y19B 4J4PD 4KTEH 3CMOH 5B3JF 4GKLA 3CFCL 1RIVH 2DYPD 2DQIH 1E6XM 2BSSB 4AG4H 1KLGA 3WJLC 5EOTB 1HILB 2GHWB 1XT5A 3P4LA 4X7TB 4MZ2A 5DJYA 2DLFL 3FT3A 7TAAA 1HHKA 4N8VG 4X6DF 1L7IL 3NCCB 1MCFA 3CFBB 1QHZA 3IKCA 4M00A 4N0CC 2XYLA 3GMRB 4QRUA 2Z93A 1T1XB 4GFTB 1EVTC 4JO1L 2QQQA 1YECH 4ZS7H 3GMPB 2DSVA 4Y4FA 4GKNA 4HEME 4ENED 3V5DA 3DJ9A 1T5WA 2XWBA 4EKJA 4ODTH 3AM8C 1ADQL 3VXRD 2J4WH 4M1RA 2ESVE 3D0VB 4JFDA 3V5HA 1SQ2N 4DN4H 3L5XH 2HN7B 2B0SH 1P7KA 2EPKX 3QSKB 5KSVA 4K23L 3H9SE 3O11A 3T2PA 1MJ7L 4G8GB 1KLGB 3PQYD 5DJ6A 4QXUH 2GITA 5DJYB 1T03H 1X7QA 3FT3B 1JPTL 4OZ4A 4U1HA 1HHKB 4CD8A 1H49A 2D3LA 4ZTOL 2L4OA 4HWUA 3NJ3A 2WB5A 2A83A 4Z7VE 3O6KH 2NSXA 1U2HA 3TIDA 1PS3A 3EYOA 3IKCB 1K8DB 2Z93B 1I7UA 3PDOB 4TRPH 4LLDA 2J25A 5E4IA 4GKNB 1OPGL 4UTBH 4ODSL 4OKVB 5IBUB 2P8LA 2XWBB 5HYSB 5E0FA 4JY4A 3DIFB 4PUDA 4JFDB 5T3XH 3V5HB 3OGRA 3TH4T 5LYRA 1UWEL 2AK4D 4AMKL 1R33A 3WH8A 3GXTA 1P7KB 1A2YA 3CHDA 5KSVB 2EDTA 3O11B 5GGQH 1BD2E 4HFWA 3SCMB 5H94A 5DJ6B 3HC4L 1CYGA 1MFAL 2FEDC 4MNGA 1X7QB 3OGOE 4K07A 3PHQA 1S3KH 4OZ4B 4U1HB 5EO9A 2EIBA 2A83B 3DETD 4KKBC 3QI9D 5CSYA 4MB3A 3WDIA 4L9DA 3D39D 4M1CD 1R46A 2GUYA 2IG2L 4G8IA 1D9KD 4ZG1A 2BMKA 4XXDA 1TQWA 1IGMH 4KVNH 3WY3A 3E3QE 4LLDB 1KTBA 5DMKA 2Z4QA 2FE0A 1D2KA 3TA9A 4XXCC 2P8LB 3VDHA 3VUPA 3GKZA 4OFPA 1HHIA 1RY7B 3RM4A 1ZTXL 3UBXA 4JY4B 4XUYA 4N0UE 4LVOB 3LOWA 4R2GB 5SX4H 1K4CA 3BLPX 1QR4A 3P4MA 4JDZA 5DMGC 1JDCA 5LXGL 4L29A 1T7VA 4DTGL 3EJQA 2FO4A 4WGWB 4HJ0D 2ZX9A 4HFWB 3MLYL 5H94B 4DWSA 5M95B 5JW4N 4MNGB 1DQDH 3SDCD 4PGCB 3MSDA 4KRLB 3PHQB 1GNXA 4NM8H 3QUYB 2C1OA 3NYDA 1MYRA 3B9KC 5ITFA 4LEXL 1HQ4A 4G6MH 4JZNA 4AIOA 4DFIA 5JW4M 4WW2F 4G8IB 1WFNA 2R2EA 2XN9A 1H8NA 3AMGA 2QQNL 3E0GA 4OCYH 1QLRA 4AEHL 2Z4QB 2Y8VA 5KBNC 4NQEA 2PTVA 5CKGA 1ACYH 4MGXA 3S4SG 5HYFA 1AH1A 4P4KA 4F7MA 5JZ7D 3HUJA 4KK5D 5DJ8A 3GH4A 1DANT 3BW9B 3HS0B 4YFLI 4HZLA 2O5ZL 5DC9B 3W11D 2H9GA 4OTXH 2VXVH 1K4CB 1G94A 3P4MB 1H0DA 4JDZB 1MCKA 2CK2A 4L29B 1BOGB 4NDMA 5JQ6H 2HFGL 4JFSA 3N9GL 2FO4B 1S9YA 1GAFH 1H11A 2DIJA 5GS2D 4QAWA 4UT9L 4Z7WE 4MYWB 4YK4B 3DVNA 1WAAA 1SYTA 2YL6A 1E4XH 4FF5A 2CJUL 5SX5H 2CHOA 3S3JA 1WBXA 5ITFB 1TA3A 4JFXA 3A6CH 1A1OA 1A9BB 1T0NA 2ENSA 1HQ4B 3NIFE 4JZNB 3SKOA 1AGEA 3ZDXE 2R2EB 4KU1A 4X5WB 3UETA 4JFFD 4NZFA 1KB9J 3X3GH 5FXCH 4JFZL 4GOSA 5CEYA 1BAFH 43CAA 4M82A 4M02A 2VURA 3HUJB 1E15A 4KJQC 2ZX7A 1ISWA 2ORBL 4HZLB 3SKNA 5FV1L 4EANA 4J3WA 4TUFA 5DRNA 5E9AA 4BA0A 1H0DB 2PN5A 3DV4B 4GO8A 5A6AA 1C1EL 4FN0A 4JPIA 1ULVA 4NDMB 5C0CD 4J3SA 4QF1A 1S9YB 4KK9D 3VD4A 4YHZH 4Z78A 3VXUD 3R1GH 4OZIF 4UTAH 3DVNB 2C4XA 4GRWF 4JM2C 1CICA 2CUMA 3MREB 1FV1A 5KVDH 3VWJC 1SEBA 4NYLA 3TFKC 1W2KT 4WUKL 1WBXB 1TA3B 4JFXB 3WMSA 1A1OB 1T0NB 2FJFB 1TQBB 3DSNA 4X7EC 3BJ91 3SKOB 4HZAA 1ES0A 1AGEB 1YMHA 3U36B 3N85H 5GGRA 1BVNP 4NJAH 1V6WA 1JGLL 4PB0L 2APBA 1EGZA 2Q6WA 3QGVA 1G6RA 1KTLB 1MEXH 5CEYB 1X5GA 2AJYL 43CAB 1A7PL 3BLBA 4HX1B 5CXPA 5ILTH 3SKNB 2O9OA 5C86A 1DL7L 5DRNB 1QSFE 1FFQA 4F58H 4NZUL 2BHZA 5DA0B 1UB6B 4JPIB 5IQ7L 2CBVA 4QF1B 3GTNA 3F58H 4PMUA 3ZYZA 1ZJAA 5A2BA 2EDWA 2FBJH 4JG1H 4TNVF 4DGYH 4Z78B 4A3YA 3WUWG 5I1HH 3MRHA 3QDGA 1C12A 3OJMB 1FORL 2R0KL 3K1DA 4HGMA 5FYJE 3RJDA 4NYLB 4QGTA 2UZXB 3L4XA 1JMXA 3ARBA 4U6HA 3C08H 4M81A 1OGTA 4ZOEA 2RHEA 2Z35A 2EPMX 1ES0B 5DK0A 4IOIB 1YMHB 3BKCL 4NBZB 3P0YH 4Y7EA 1A64A 4MJIA 3WFLA 3PP3K 5F1OB 1NP0A 1Q0XL 1WSST 4LSSL 1Q9WA 5GGRB 5HGAB 1F4YH 3FRPA 4N5UA 3ARYA 1AJ7H 5DZLA 2Q6WB 1PBGA 1G6RB 3GXMA 4AZ5A 4OD1L 5EOCJ 5JXEC 3AXIA 3VXSD 4N5EC 3KDMA 4A2LA 3ARDA 2BDNL 4GT7A 4GAFB 4MA8H 3LMJH 4D6HA 1CLVA 1URLA 1O7VA 3QBTB 3EJTA 1WIOA 5T1MB 2BXZA 4ONGH 2I9LA 3O6ML 1RUAL 4KV5E 5HDLA 3P30H 1KG0A 3QDGB 1C12B 5JHLL 4X7SL 4Y1AA 1E6OL 4R26L 5F6HJ 1MY5A 3RO8A 1GGTA 3OGVA 5GPRA 3T09A 1KB5H 1NUGA 2ZUTA 1JAKA 1UZ4A 3PQYE 1RURL 5FYLD 4WEBH 5DK0B 4E8DA 1CE1L 3IDYC 1X1NA 4MJIB 1AGDA 1NGZA 1Q9WB 3SUUA 2UYLA 3SCSA 2JB5H 3S37L 5EUOE 4HV8A 5HPOA 5FUCC 1L0YA 1DWGM 1OD9A 3SCOA 2BVTA 1GOIA 2VDQL 1WEJL 2BY2A 4ODVH 2F19L 4YR6B 4OT1H 3KDMB 4ZXBC 3OR7A 3ARDB 3M17A 4D6IA 2A6IB 4OD3L 2DIEA 1E0WA 3JWDL 5KSBF 3MFFA 2B2XL 3WO4C 3ZTNH 1GZPA 1BIHA 2I9LB 5HI4D 4XZUA 4PD4K 1KG0B 5GSVA 4ZNCD 1WCBB 2QQLL 4QNPE 1GPOH 3S8WA 2V7NA 3NZ8B 3RGVC 1PD6A 4LSRL 1A4JB 3MA7A 1EO5A 3TYFA 1NGZB 2CGRL 1ZXQA 2HRLA 1CFTA 1HKLL 2UYLB 3P11L 1T3FA 4HV8B 5HHMD 1AD0B 5FHBL 1P6AB 4KUCF 1UKQA 3D39E 1G9ML 2GDUA 5I74C 5BRZA 2EXOA 3RZCC 5LWYH 1XCQB 4O4YL 2VDMH 3QWQB 3WFHA 4KTDL 3V4VL 3OR7B 1GHFL 3M17B 3MJ8A 3OBAA 3NSNA 1BTCA 3BRFA 2CBIA 3NACL 3WDJA 5DYOA 2B1AL 3MFFB 4YHML 3JUYA 4EQ3A 4Z7NE 2PXYC 4GO6B 3MRGB 4L3ED 4M3KB 3CUHA 3QP3A 3H3BC 4NRZB 4YHOL 3OLIA 1CLCA 3PABB 3GSUA 4OLUL 3I6LD 4RDQF 5GSVB 2XTLA 3KPOA 1HJVA 1MUJA 1FP5A 2VZVA 4HC1H 1XMWA 5GHWL 2V7NB 4Q9BA 3AB0B 1CLYH 3ESUF 1CGYA 4M29A 2OQJA 3II1A 4ZS6C 3MXVH 3TYFB 3FONA 3S37X 2HVKA 2WUCL 4AEEA 4G42B 1PSKL 1CFTB 4FQPA 2YD5A 2X2JA 1JL8A 3CXDH 1T3FB 2QR0A 1KCSH 1ZGLP 4AYSA 3TN0D 3RL2A 2AAVA 5BRZB 2H2SC 3FO1A 4WCYH 3SGDH 3WFHB 2H6PA 4P99A 3MJ8B 1I3GL 1EBAA 4QHLA 2ZJSH 3F7YA 5DYOB 4UU9A 1BQLL 1IGIH 4PJDB 4S1DC 4NBYB 4P7LA 2QQKL 1A6WH 3ULUC 3GSUB 5KZ6A 3PZIA 3TZVA 4ALAH 2EDNA 2IXUA 1J8HA 3CZEA 2ZCLL 1MUJB 2XACC 5F7YC 4PJ9C 5J12B 2YN3A 2FEEL 5AYUH 3A3HA 4A4AA 1RULH 2OQJB 3FONB 2HVKB 1JNLL 5T3ZE 2VXSL 4YHKL 1NGWA 3AXLA 4W4NA 3RAJH 4E41D 2QR0B 2VDPH 3HAEA 4JRXB 5CBEA 5TF0A 1I9JL 3RL2B 3WF4A 4AZ7A 4GMTL 2IPUK 4FFWD 4UFMA 4I3RL 5F1IA 3MUIA 4D3CH 2XSAA 3MLTA 1ZSDB 3M45A 3UTSA 2H6PB 2EE9A 4JFFE 2VITB 2X44D 5D96C 3RI5F 5I71B 4G6JL 3UAJC 4OFYA 1WDQA 4MAYC 1JYXA 1IAII 4UU9B 2XYCA 4M48H 4U1IB 3K1KC 1PFCA 5C07E 4PLNC 2EC9T 1QNQA 1ZMYA 3WQWA 1Q1JL 3L4TA 5BXTA 1LWJA 3O4OB 3VO0A 4ZTPH 2PO6C 1J8HB 4W7WA 1RIUH 1I1FA 3DRTA 5C0CE 4CMHC 2H26A 5GRUL 4PJGF 1H0GA 3BVUA 1NMAL 4EI5C 3VXUE 2OLDA 5JIWA 4M5ZH 1T04A 3AXLB 2J2ZA 1G0XA 3HZ3A 3KJ6L 2A3HA 1QBMH 3HAEB 2D73A 1X5JA 4KPHL 3MACL 3L9RA 3H9YA 3KPLA 3BUBA 3OF6A 3QG6B 1A3RL 3MLTB 3O3EA 4MXWH 1KN2L 2YD9A 3UTSB 5IB2A 5I8OH 3H0TB 3Q5YA 2NX5B 4JR9L 2NY0D 5DC0A 5I8KL 1DBBH 1UC6A 3DDFA 2YPKA 5L88L 1Q4NX 1G9NL 1TETL 3FFCD 3H6JA 4DZ8A 4Q9RH 4Z6AT 3BZ4B 3BP7B 4H25A 2UVEA 3SO3B 5I0ZA 2H26B 1G0CA 1P69B 1YN6A 3TNMB 3IDXL 2B1HH 1YEFH 3OZ9L 4H0HB 2J4GA 1BLNA 4OF8A 4CRPA 1OP3K 4J3TA 1N5YL 3FN9A 4KZEH 3V6OC 1MQKL 2FATH 5I1CH 2DMBA 3GO1L 1T04B 5D7JC 1PGRB 3H42L 3BPNB 2VXUL 1F4AA 3LRMA 3OJDB 4Z0BH 3L9RB 3KPLB 3BIBX 1F4WL 3O3EB 2J7GA 4HG4K 1FIEA 2H2PD 1XF4A 1GGIH 1DBKH 1EERB 5DDHB 1VEOA 1AGCA 3FFDB 3I75B 3CLFH 3BDYH 2FSEA 5D7SL 3SKJH 2WZEA 1F8TH 1MNUL 3GNOA 2YPKB 3NOIA 3QDJD 4JPWL 1QX1A 3VXSE 4DZ8B 3IJ9A 3I85A 3KPRA 1CECA 4MLSA 3GKWL 3MBEB 1CT8A 3VFNA 2W38A 2YPLD 4UQCA 1YN6B 4PY8J 5FF6B 5INCA 3HI6L 3HMXL 3MLUH 1U30A 5MI0C 2E9LA 3BIKA 4PMVA 4BQ4A 1BLNB 1KJ3L 4LCIL 1OP9A 5ICZB 4OCRL 1UWXK 4TTUA 2ARJQ 3TO4A 3DHPA 3I9GH 1MIMH 4HPOL 1KEMH 4RGMB 3BP6A 5FYLE 3BQUA 4HD9A 2XQYG 2NW3A 5D7IA 1W9DM 1VERA 5E2UL 2A1WH 2VXQH 4XNMA 2DSUA 4TNVK 5IT2H 1RPKA 4NQUA 4WU7A 5E2TL 2BNQA 1TQCC 3ESVF 4P2OD 4POZD 5KSAA 1FQ9C 4YHIA 4NI3A 3GMMA 2CKBL 3RUGA 3KPRB 4LAQH 1SBBA 4ZAKD 2EO9A 3R8QA 3MS8A 5A16A 3QHNA 1CT8B 3VFNB 5J9PA 2ADGB 1J87A 2EO7A 4LLMA 5INCB 4QT5A 2E8ZA 3QIBC 3BIKB 4GMSL 1DZBA 3KJ4B 4Z0XB 5JW3H 3QDMD 2XWDA 5GGUA 3WDHA 1AC0A 4XCYA 5D2LE 3RQ3A 3OIHA 2F8VA 4NOFA 1AY1H 4GAGH 4XI5C 1V0LA 3BP6B 3LPPA 4RMQA 2NW3B 2FJHB 3F7VA 5D7IB 4JDVB 3BWUC 4FHBD 3LRSA 2J7HA 3BUYB 1R3IH 4XNMB 1PG7H 5I1JH 4XAWL 5HHME 4NQDE 4WU7B 4FQCH 3ZT5A 4RFOL 4BQ9A 4NQSA 1NBYA 3NN8A 2BNQB 2DLHA 1P6FA 4FFYL 4P5TC 4Y4KC 1UQSA 2GT9A 4YZFE 2WHMA 5KSAB 1CGXA 4YDVB 4JRYA 3RUGB 4PJ8C 1ZOXA 5A16B 1OTUC 5CS7A 2C7UA 4KKLD 1G6RH 2YK1L 4HAFA 3MLWL 2IANB 5LAXA 4LLMB 1ISYA 4NQCA 1CFVL 5HYJA 4QT5B 2YDQA 5I73C 1JVKA 4CCCA 3I6LE 1BECA 3IU4L 3RWDA 2OYPA 4LPYA 2CKNA 4I8DA 4RZCA 4XCYB 1FH9A 2Q76B 5F6HI 2DI8A 4F8XA 1H3UA 3AVEA 2VZSA 3Q6GL 4W84A 1IAKA 3UYOD 4NN6C 4OLZL 3UJTL 5F3HA 3NCJL 3REWA 3BD5A 3LRSB 2D4DA 1MCPL 4TPRH 5DO2D 4NQSB 1NBYB 3NN8B 4GUPA 1VFAA 5CILH 1MFCL 5CJXC 2VT0A 3UROR 1J10A 4RGOL 3HG5A 3FOLB 1UQSB 2A9NL 1KBBA 5DT1H 4P49A 1A3QA 2QSTA 4JRYB 3SGJA 4TULH 1A4KA 4XNZC 3QPXH 5F6IC 4AXNA 2C7UB 4N8CH 4F9DA 5D1QD 5LAXB 5HYJB 4LSDA 2WMFA 1EJOH 3U0WH 1YNTA 2WHJA 3WS6A 5I0DA 3SDAA 2VZOA 5GSRA 2CK0L 3RWDB 2V5YA 1RUKH 5T3XE 4K8RH 3GK8H 4RZCB 4A6YL 2ZIDA 1VADB 1CQKA 2XPKA 3O41A 3RVUD 4PJBE 2ZG3A 4FFVD 3MOAL 5GISH 2D20A 2F5AH 3G6JF 4E41E 1F11A 3QHFL 1P7QA 4IMKC 3ARSA 5M94B 1FH7A 4OM1H 1M7DB 4Y19D 4EI6B 5CJOL 4LCYA 1NCDL 3L4WA 4XTRD 3ME0A 3CC1A 4RGNB 3WYRA 2PKDA 3C5ZC 1A4KB 4ZSOB 3W2DL 3FTGA 4KXZH 5DEFA 5H37G 5L2JA 3RVWD 4F3FB 3PZTA 2P49B 2DQCL 1UG9A 1YNTB 1CGTA 3RA7L 4BH8A 4XHJD 5IW1A 3SDAB 4D9LL 5GSRB 1HXJA 5EOQH 4NP4H 1LVEA 3ARGD 3ZM8A 2NTFA 5DRXA 2F7RA 3MV01 4FA8A 3CDFA 1ZBVA 3EMZA 3X3FL 3B83A 1JP5A 1U0QA 3SGEI 4I2XA 4PTXA 3O41B 5ALCL 3N0PB 3NIGE 1BZ7A 5FO9A 2ZXBA 2W0PA 3RDTC 3MLRL 4E42A 3FB7A 1IQWL 1TPXC 2WBJB 5CGMA 4PLJD 3FOMA 4URTB 1U9KA 1F11B 5DQ9A 5FB8A 1P7QB 4KUZH 1IJ9A 1J8KA 2BC4A 1YQ2A 2EYSA 1MCWW 1KIPB 1A7NL 4LCYB 1PQZA 4G8GD 4PJHE 4FNUA 4IUGA 3BE1L 2ZX5A 3FTGB 1QFUL 5DEFB 1DLHA 1FO0L 25C8L 3AZRA 2FO1A 2D7MA 4BH8B 2I60L 3FFCE 4R3SA 4RNRB 4JL2A 3FT4A 5LKNA 3PL6A 1NGXA 5EH1A 5T5FH 1N6QH 5DRXB 1GHRA 5KAQG 4UUJA 3OG4B 4O51A 3VSUA 1YPZE 3PNWA 4I2XB 3CX5J 5HHVL 3QXUA 1BZ7B 2GSIA 1S5IH 5FO9B 3RI5K 3WELA 2O9PA 4E42B 3FB7B 3LS4H 3ZE1F 4MADA 3S98A 3VTRA 3FOMB 4ESKA 4QRSA 3HG4A 1CGVA 1TZ7A 2DWEA 5FB8B 2V2WB 4TVCA 2BC4B 5DUMH 2FCBA 3CD4A 2EYSB 3HZKA 3D25A 4Y88A 1TG7A 2EEDA 3LZFL 4M62L 5CD3B 4YE4L 3WFEL 1PQZB 2RBLA 3EOYG 5E2WL 4PJXF 3SCMD 3RTQC 1A6TA 3QCUL 4C83A 1E4LA 1MF2H 2YBTA 1DLHB 3A47A 3HZVA 2G3NA 3CDYA 4P7NA 1NDMA 1ZA3B 1JGVH 2X1OA 4EIZC 1UENA 3EDJA 4UNUA 5KANI 3BGMA 2FGWH 3FT4B 4GW5A 1NGXB 5CD5D 3HCVA 5IB5B 4AMCA 4UUJB 4O51B 1DBAL 4ATDA 4FQXA 5GRYA 2D7PA 3PNWB 4AIUA 2GSIB 4H04A 1BZ9A 2VIRB 3DXAE 3H9HB 4OCMC 1NGQL 4CCEA 4LDLB 3O6FA 1I8LC 2APWA 1H3PL 4R2GD 1BPVA 1EBPA 1AFVL 1KPRA 4R4BA 2DWEB 4K7PL 1U6AL 1YEKH 2WMKA 1N2RB 3BD3A 4WW2A 3BSHA 2UV3A 2DQEL 2WVTA 3D25B 4JE4B 5ABEA 4YGVA 1T21A 2J79A 4HPYH 3WKML 2O26U 4L4PA 3CJJA 5MEOB 1A6TB 1HWGB 4C83B 4HLJA 4S1SL 3HAEH 4PJIF 5HVHC 4UAOB 1NL0L 1YJDH 3WD0A 1SJVA 5GGTA 3INUL 3HZVB 3QUYD 5DD3H 1YYLL 2NY6B 1NDMB 1Z9LA 2R2BA 3QUXC 3BZEA 4O58L 1MHCA 1FH8A 5B4MC 5AD0A 3L3IA 2IBBA 4XNYH 3BGMB 2CIKA 3KPSA 1MIEL 3FO0H 4TSBL 3ALWA 3NSXA 2HRPL 4P2YA 1YNLH 2LVCA 4JDTH 2HLFC 2ADFL 2WHLA 4JKWA 4FQXB 2D0HA 4RMWA 2I9TB 4XWGH 1MWAL 1PDKA 1OAUH 1FZKB 3BOVA 1AMYA 2IGTA 1T2JA 3KYNA 3OKKA 2CCRA 1JG9A 1FBIH 5KN5A 3O6FB 3D5HA 3QDME 5ELIA 1MVUA 4PGJA 3EOTL 2WAHA 4MHHI 1HDMA 4WW2B 5E9DA 2ERJB 4YH6A 5CP3A 4X4XA 1FYTB 1KTDB 2J7LA 4JO4H 2F7OA 4MTVA 3GJEA 1T21B 2VX6A 1IGCH 1XSIA 3JXAA 4OGYH 2DBLL 1VFUA 2HFTA 1IQDB 3U5YA 4P5MB 4L8DA 4PJFE 4WUUA 3NGBB 1IC1A 1UCBL 4HHAA 4JQIH 2R2BB 5DGQA 4WRLA 4I0PB 5CHNA 4E9LA 5JOEA 3L3IB 4PY7B 2UZIL 2CIKB 1GOKA 3OGCA 4D6GA 1CGUA 4S1RH 2YD8A 1J0YA 4F66A 5J1TC 4JPKH 2R15A 4QHMB 4OZIA 4Y5XA 1WE5A 4PY8I 1E0VA 3NMEA 4M43L 3H7LA 3STLA 1MFVA 3KYNB 3OKKB 5KN5B 2JE8A 4K7PX 1CXIA 2OTWA 3ARRA 3AREA 1F6AA 1VGEH 1NFDE 2VLKA 4PRHE 3ULUL