1CGUA

Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
684
structure length
684
Chain Sequence
b'DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Catalytic center of cyclodextrin glycosyltransferase derived from X-ray structure analysis combined with site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 227
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cguA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cguA01
3W2DH 1TJHH 3MPCA 3GNPA 1IT9L 2WIIA 4QLKA 5HHNA 3RDTD 1AJ7L 2FLRT 4P99A 5HHOB 5BYWA 5DJDB 4U6VH 4IRJA 5DMKA 3TP4A 4LDLB 3O4OB 1V6XA 2H32A 4FFZH 4HPOL 1W9VA 4F2MA 5I8CB 4UAOB 4WIQA 4XPHL 5D9SB 3C5JA 1EERB 1A6VL 4MJIB 3AM8A 3GFUA 3H9YA 1OSZB 5FM8A 1S7QA 4G9FE 2ENYA 1HVQA 5DWUL 1QSEB 3K8MA 3RWJB 1UKTA 2PYFB 1AIFB 5D5MB 4P23B 2Y2WA 5CSBA 5EO1B 4P46B 3VD7A 5CP7B 4UR9A 1JZ2A 2NY0C 3MMEA 1H49A 3DO3A 4JKPH 4NN7B 2CK0L 3UTZA 1S8DA 2HFEA 4X7DC 4U4BA 4KZDH 4G8IB 2VDNH 2J6EH 3WF1A 3CTTA 2YFNA 2GY5A 1C3FA 4LRIC 1QFOA 2DQGH 4YXKH 3X12A 4FTVE 4BH7B 1QVBA 4NHUB 5AEAA 2VCBA 4J3OC 1FNAA 1HYRC 5GS1C 4MDIB 3HMCA 5D71H 1RULH 1J8HE 1X4XA 4M6AA 4OT1H 2KL6A 1IM9A 4G5ZL 2LV4A 1VHPA 3HRZB 1JPSL 4PUEA 3S6TA 4KK6C 3RVVC 3D52A 4Z78B 1BF8A 4RNRB 5MENE 3SPVB 4APQD 4PJ7B 5CSZB 2LQRA 1G7MB 4M1CC 2NY2B 2Y06L 3ZSSA 2J47A 1J5OL 3BP7B 4L4VD 4JDVB 4YHIB 1BGXH 3QNYA 2R0ZH 3DX1A 1N64L 2F7QA 3ECQA 3BXNA 4O5LH 5IWLA 3O8XA 2A83A 4HKZB 4PJDA 3SUSA 4CW1B 1QLEL 3CC5B 4LLDB 5C92A 1XD1A 2APFA 3ROLA 1CFSB 3CMOH 4BUHA 3L5XL 2XY1A 5JHDA 3ECBA 2FB4L 4WCYL 1FC1A 1W2VA 5IK3A 1XIWC 2X4OB 1GHRA 2GHWB 5B8CC 5L7XL 2WSKA 4XCNA 2XN9E 3VFSB 3BAJA 4Y5YC 3H42H 2X1OA 1R5VA 3A47A 2QEJA 1RZIA 1WJ3A 2NSXA 4NDMB 5E8EA 2E7LC 4PGJA 3UTSA 3TO4C 2PCPA 4QRPD 3RM8A 4C4KO 4KI5F 3V4UL 5BRZB 1MJUH 1D2KA 4EBQH 3DVNA 1K9TA 3C2AL 4QTIL 3FQUA 2EECA 5D7IB 4S2SA 3QWOB 4L3AA 2AKRA 3PDOA 3LV3A 3VXUE 4AEFA 4GXPA 3OGRA 1V6WA 4XC3H 5D8WA 2W60B 1I1XA 3L4UA 5I8OH 2FGWH 3I3EA 4XVUC 1FZMA 4YHML 2V2TA 3NIFE 5EOCH 4GLRH 2IADA 3NPZB 2ZUNA 1GGBL 3NN8B 2ESCA 1QKZL 1YNTA 4D71A 4GW4A 1XGYL 2RB8A 2MQ3A 1ZLVH 1XGQA 5E8OB 1EUUA 3EO9H 3KYNB 3HJEA 1IAOA 4KHXL 1JD9A 3MNWB 4CADB 4QTHB 1T21B 3OL2A 5I1EL 2J6EA 3QNZA 3NOIA 3MUHL 4NPYA 3NUKA 3WD1A 1TZIA 2OJZL 1KJ2B 5JOPE 3HPJA 2NY0B 1FFOA 3DXAB 1YEGL 1AGBA 2PO6D 3P4OB 3D6GA 4U7MA 2M1KA 4HUKB 4MJ5A 1PGRB 2HYMA 2R2HA 4UI2A 4UIMB 2OW6A 2GTZB 1E6JH 3VIIA 4J1UA 4U31A 4W6WB 1U8PA 3MJ9L 2NY6D 5MEOA 3V5HB 3SKUD 3L7FB 2F5BL 3GMOB 2ESVB 3ALPA 3D48R 4WFED 4HU8A 3FFCE 2DPEA 1KTRL 5GS1B 3MJ6A 2AK4B 2YK1H 4XPBL 5CD5D 4LYPA 2YL9A 1BFTA 4JZOA 4LHUG 1WAAA 1T5XB 3BQUC 3DRQA 3RNQA 2FBOJ 2Y6SC 4MZ3A 5EBGA 1W0VA 1FFNB 4MXWL 5KSUA 3HB3D 1NFDE 3TZVC 2UV3A 3KYMB 3RGVA 5M03A 1YEJH 4BQ3A 2CPCA 4UQAA 3BGMA 4OUOA 4YHYC 4NZUL 4Y4FB 5T3XL 1V0KA 1W9XA 3VFWA 4Z2KA 3SCWA 2M8XA 2Y24A 3QDMD 3AZTA 4JY5L 3PHOB 1XCQA 3TNNB 3OTTA 4AH2A 4L8CB 4BFIB 2HTLC 4B16A 4BZ2L 1I9JL 1XGRB 5GGUB 3C6SB 5F7EH 2J8UA 2RFXA 3QQ3A 3AMDA 5CHNA 1PYWB 1BD2A 5HHMB 3IGAA 1GQIA 4WU7B 2DQUH 5CAYB 5IESL 3R4DA 3WJLC 1A6TA 1U9KA 3NDYA 3QCTL 2Q7YB 2JIXA 3RX5A 3D85A 2FX7L 1SMOA 2R4RH 4KTEL 4UQ9A 1K9EA 4F58L 5BZDB 2FIRT 4TSBL 5GGVH 2X0HA 3EGSA 1PZUB 2X41A 1GYAA 2BHYA 3H3BC 3PWPB 3OLIA 4UFLA 3QDGB 2BZDA 2DWDB 3U0PA 2RR3A 3TO4B 2A6JA 3QH3B 4PRAA 2DSVA 2EQDA 4OIBA 1T5WA 1JGLH 4ODSH 1OF2B 2YDQA 4DZBA 3Q6GL 4IOFC 5L8JB 2YC1B 5L2KE 1XD0A 1A7OH 3BGAA 1B0GB 3VXSA 5I0ZA 3OR6A 4WUUA 4UT9L 1AY1H 3DV4A 4M8QB 5LCVH 3GJEA 1ONQB 2G3IA 3DPBA 4WWKD 1B3JA 1DDHB 1HILA 4D1JA 1XF5A 5AC4A 2FSEA 1E6NA 5B38G 3BYTA 4LVOB 3EOAA 2CIIA 1QFWH 2CMRL 5FGBC 3UESA 4Q9CA 1FNSL 1EIBA 2CJUL 3QIBA 1A47A 2DLFH 4RX4D 4Y19A 4PR5A 3F7PC 1ODUA 5DLMH 1SJVA 2DBLH 1QZ1A 1UGNA 2QBWA 1RQ5A 3HE7C 5JXAL 2W9DL 1N6VA 3JSSA 4PTTB 4X6CA 3AREA 3WNOA 1F3JB 1XH2A 1UB5A 5MERA 2WLYA 1VADB 2ZOKA 1NGXA 2VT0A 1H5BC 1UD3A 1A6ZB 3BSZH 3DV6B 2DQJH 5D70H 3VINA 3PJSB 4XCCL 4ZFMA 1LDPL 3IDGA 1KELL 4L8BB 5SWZA 4HKJB 3BHBA 3GH7A 3UAJC 1CTOA 3FO0L 5AYUL 2OJEA 2XFRA 2DQEH 2FIKA 4U49A 1AGFA 1HNGA 3LKSA 3HUJF 2BJML 2C7UA 2ZXDA 3T0EA 2X4PB 1RK1A 3C5ZA 4FZ8H 1QRNB 4PV8A 5FV2A 5IB3A 5KW9L 5F44A 5T3XD 4U1NB 2VQTA 1XZ0B 1MFEL 4DUVA 1P4IH 3BCFA 1IZJA 4U3CA 3IU3B 2E8YA 4AQOA 2YPKB 3MRIB 3W0KA 2O61A 3EOBA 1D5ZA 2X05A 4CVWA 1BFSA 2VUYA 5FO8A 5F1IA 2GCYB 3PQYE 1KYOJ 4XHQA 3MLSH 2IAMB 4LEXH 3CU7A 1V7MH 2VLJA 3MZTA 2VLLA 3NJ3A 3UBXI 3C60D 3Q48A 5DMIL 3UJIH 3OKMA 4FMKA 2XGBA 2RIKA 2WIIB 3MGAA 5HHNB 2L4OA 1VFAA 3O6FC 3RWIB 1CFVL 3EYFB 4IRJB 4U0RC 4AG4H 2ADJA 5I0DA 4XB7A 1F6LL 5CGYC 5C7XH 4HIJA 1T0PB 4ONFL 4IIQA 4IRSA 1LE5A 3C5JB 4MMZC 1NMBL 1RIVH 3MOBH 3OJMB 4LCUA 2NX5D 5IV2B 3H7LA 4ZUTB 1R85A 2AEWA 4Z2IA 4EQ2A 3GXNA 5J1TC 4CCCA 3QEUA 4OGYH 5HHVL 1C90A 2YA0A 4KKAD 1DL7H 2DDQH 1OGAD 1GJWA 3WDJA 1IGCH 2CUHA 3WD2A 4OD2B 1FNHA 2EEAA 1A6UL 2HJKA 3GMRA 4X99A 4MXQC 1X5LA 3QAZC 4HOZA 2AJZA 4JVUA 2XTJE 1OD0A 3H0TB 2EDFA 4PUBH 4XX1E 5EOCJ 2X2IA 5GNZA 1YPZE 4AD3A 3VXMD 4GS7C 1FYTA 4KKBC 2CLVA 4JFQB 1KLUB 4PSRA 2B4CC 1Q0YH 4F9JA 4JFED 5T5FL 2ZX6A 1OTUC 3EFFB 5GGQL 5JBDA 3KE0A 4HH9A 3AHZA 1AP2A 4JM4H 2F5AH 2HFFA 4U2YA 1NFKA 1H0DB 2I9LA 3POHA 4HK0B 5I15L 1AR1C 4X0NA 4NBYB 4P4KC 5CWSB 3GB7B 5JTWA 3OKNB 2YXFA 1PEWA 4G6MH 4JPWH 3MLTB 4V28A 3VGFA 4NQED 3AI0A 5GIRA 3QG6B 4U6YB 3D39A 3LKOA 1ZHBB 2YJQA 5C0GA 1QNZH 1SEQL 1N4XL 1ZHKA 4PMDA 2VDRL 2ITDB 1UWIA 1W3LA 3D25A 3MLYH 1BQLH 5D6CA 4XNYH 3S35H 3QNYB 4UZGA 1NAKH 5DD5H 4MS8D 4NO0A 5FO9A 1MI5B 2A83B 4RGND 4OZFG 1C16A 1MCEA 5EPMA 3G6AA 5JXED 2Q8BL 4NC1E 3P30H 4IM8A 1OB1A 5CJQL 1F11A 1CXLA 1BWWA 1NBVL 5E8DH 4FABL 4ZUSB 4L3EA 2P8PA 4XCNB 5EFIA 1EHAA 1NWTA 1ZVSB 3NIFF 3A67L 1R5VB 1CIUA 4PJIE 1KV3A 2JJWA 1IT9H 4WI5A 5LJYH 5DVKA 1AJ7H 3H53A 1TQBC 3QULB 3GUTA 1A21A 3BVXA 5DJAB 1S7XA 4NT6B 4NNYA 2HT3D 4HPOH 3U4BL 3DVNB 4NNXA 4BCEA 2IFGA 3UTTB 4OV6F 4PTUB 3GMNA 2MOVA 4FNRA 3IKCA 5CJ5A 2DM4A 3TF7C 3MJ7A 1U92B 2YD8A 4YGAB 5DWUH 3U30C 1T0MA 3AXXA 3T3MF 3IB4A 1G9EA 4OCXL 4P8WA 1FVEB 4AZBA 4MB5A 5ALBL 2CXKA 2V2TB 1HINL 1TTGA 4Y4HD 1B2WL 5DEGB 3RVUD 3IJ7A 1PZ5A 2CK0H 1A22B 3QWRD 4U0RB 2HRLA 4TTDC 1F3RB 1RZKL 4GI6A 4FQPA 4WI6A 5D1XC 4MDJA 2GIYA 4ETYA 1YNTB 5I24A 3AIEA 5INDA 3QUYA 1MQQA 3VRIA 2ED8A 1BZ7B 3TH2T 2WCSA 2VLRB 4UNTA 3VFNB 2AVGA 5F7KC 4QF1A 4RWHA 3W4RA 4PJ8B 3MLRL 4AZ5A 5ABEA 25C8L 3WBDA 4N68A 2R1WB 4JO2L 5GISL 4Q9QL 1BM3L 2P1YA 1TZIB 2Q1EA 3NZ8A 5KZCD 1NFIA 4G5ZH 1JPSH 2FZ3A 4OZ4B 5KVFH 4APQA 1U36A 4MJ5B 3IDYC 5E99L 2R2HB 5TFSL 4KRPD 1S9YA 4GS7B 2Y06H 1E15A 4L4VA 5J1AA 4P5MA 3CVHL 3VE0A 3BP6B 1HHJA 5MEOB 2JELL 1N64H 2W61A 5CEZD 2VZ1A 4D9RD 3RWGA 1TNNA 3BUYB 1QLEH 4P4KB 5HYEA 4GG6E 2OR7A 1KQZA 3LXCA 5D7LB 3U4EA 3L5XH 3RVTC 3MR9A 2FB4H 1RJZB 4WCYH 3TBSA 4J3TA 5I6SA 4P49A 1HL9A 2Z91B 1Z32X 4L4JA 5L7XH 5F1NB 1NBQA 1SBBA 1KJ3L 2GQHA 3ZMRA 5KSUB 2DSKA 1T0NA 3VWKC 4XI5C 1RZFL 3RGVB 3AIBA 4W7WA 3DRTA 3ZYJA 3PNWA 4HH8A 3SKMA 4QRPA 3L6FA 1B31A 5H2BB 4AH2B 4K3HA 3V4UH 3EJJX 2YRPA 2WYSA 1DQTA 4QTIH 1HCVA 4V1DB 3TVMC 4I2XA 1JNJA 3OXSB 4UB0L 3G6DL 3DJ9A 3BDYL 2C3VB 2UWEA 3GIVB 1T4KA 4IPNB 3BIKA 2E3VA 4XNQB 1S9WA 1WZAA 2GAZA 2X70B 3QEHA 1E1EA 2RBLA 1J01A 1L6XA 3EGSB 3LVEA 4N0UB 3UO1L 2CRIA 2VDQL 2JCCA 4YHMH 4K23L 4HFUL 2YA1A 1TUXA 1GIGL 4Y1AB 1I7ZA 4F8XA 1J1OL 4MMXC 2ZOLB 1GGBH 4WI4A 1K4CA 1QKZH 3GIZL 1M71B 4HAFA 5GJSL 4PRBB 1H3TA 3OB0H 1NDMB 5EUOA 4JFDB 1N59A 3DHJA 3DDGA 4R3SB 4KHXH 4L29B 3MUGA 3VXSB 1CD1A 1CD8A 4UT7L 4R90L 2W63A 1QHOA 3OR6B 5I1EH 3U30B 1X5YA 3WKNA 4IMLB 5HNNA 1HXJA 2X42A 1LEKB 3QHOA 2WWKT 3OAYK 2PO6A 4OBRA 1YEGH 4BQ4A 3QIWC 1WV7T 4IHOB 1GQKA 4EDXB 4ODUA 5AG9A 4OLYL 5D1XB 4YDVA 1V8HA 2VLKE 3HMXL 3MJ9H 3VIJA 3C09B 1Q9WA 1ORSA 2OCFD 3QIBB 3IYLW 4Y19B 1CWVA 2F5BH 1RZJL 4X80L 2OWXA 1ZANL 4OM1L 1WWWX 5DVMA 3GBNL 5E1HB 2DH3A 1J9YA 1H3WM 3SKOA 3NSXA 2B5IC 2ATPB 1HXYA 3DECA 1HF6A 4HGWA 3AREB 1BVLA 3D18B 3MGTB 3V0AC 1UASA 2NLJB 3MV8E 1KGXA 3KR3L 3NBNA 3F58L 4MXWH 3IDYB 2A1WL 4WEUD 3T09A 1MYRA 4G9FB 1FYHB 2C4FU 4HGMA 4NZUH 5T3XH 3QDMA 5KVMC 4OUEA 4JY5H 2H8PA 1RUKL 5HI3C 4HCRL 1G9MC 3GDBA 4BZ2H 1I9JH 5EU3A 1G7JA 3CZNA 4ZUWB 1RK1B 5C08E 4XNMA 4N1EA 4F9PC 2FLBT 2IBGA 5IESH 5DHYB 4D0BB 1AQDA 3SE3C 4O2EA 3QCTH 1M7XA 3W6LA 1OAZL 4HJ0C 4HW6A 5LAXB 2FX7H 4KTEH 1A7QL 3VFVA 4F58H 2H3NA 3MROB 1DWFM 4TSBH 1CD9B 3VWKB 4FTVB 2ZXQA 1WFNA 2XVGA 1WICA 4LKCA 3QZWB 1DUZB 4QCEA 2Y7QB 1RUQL 2ZSVA 5DUML 4BQ9A 2C7FA 3IDXL 1CWYA 3LKRA 3C8KA 3OXRB 4OZHB 4Q58C 4NO2B 5IVZA 5MENB 1YPZF 1DEDA 5DHVH 5C8JB 2WMFA 3Q6GH 4ZO8A 1VFAB 1A02N 4UT6L 2RGMA 1UD4A 4MHHI 3HZYB 1BHGA 1N7ML 3ULSB 2NZ9C 5F7LB 4CBPA 4F15C 3EMZA 2DLGA 4UT9H 4FHBD 3X13B 5HGGS 3G9AB 2JALA 5M95B 4YDJA 1VFBA 4DN3L 3F5WB 5LYRA 1P9MA 3RWHB 1CDUA 3QDAA 3TA3C 3TN0D 5F3BA 3KXFE 1MRCL 4MSWB 1AD0A 1JUFB 1NSNL 1F90L 3QFJD 5EN2B 5FYLL 1WBYA 2CMRH 3VJ6A 4RFEA 4WTZG 1NGWA 4PD4J 5IFHL 1FNSH 5CMAB 2CJUH 4RX4A 4EI6B 2QSQA 1EQCA 1A8JH 1I3UA 3HG1E 3MUIA 1TXKA 1MJ8L 4BQ5A 3ET9F 1UUQA 1WLHA 2XNAB 3EOYG 4P3DA 3CDYA 3MJ9A 5DRZA 5CINL 4PBVC 4D94A 5JXAH 2VAAA 2W9DH 4AYFA 1A6PA 4DUWA 1G9NC 2I9LB 1J88A 4JFFE 5IB2A 4EK7A 1KTLA 4H0IA 3QIWB 3VXUB 4EVNB 3CUPA 4W5ZA 1GZPA 3T08A 4CVXB 3QJHA 5F89A 4V2XA 2NPLX 1NC2B 4XCCH 1LDPH 5C0BE 5DQJB 5FYKU 1KELH 3O9WD 3KDMA 2EDXA 3L3JA 3QHFL 5JO5A 5E2WL 1UB6B 5HD8C 3FO0H 4OI7A 2PB1A 5AYUH 4OKVB 2F1AA 3AFBA 5C0GB 4PMOA 4LGRB 3IJSA 4L8SA 5GZOC 2BJMH 1UWTA 2A74B 5D6CB 5KW9H 1LLOA 1EDGA 3PG2A 5HJ3A 2I07A 1T04A 1MFEH 5IGXL 3NFPB 4A4AA 4FQLL 2AK1L 3FT2A 4RQQA 4PJGA 5FCSH 1KC5L 3B2UC 5TPWL 1BYDA 4UINL 4LBEA 3QJFA 4E41D 3TO2A 4JQIH 1LP9B 2ILLA 1Q4NX 4P2OC 4GO9A 1OP9A 4W6XB 4L3EB 4PRNA 4Y4KD 2OL3L 3NPSC 3C60A 3KPNA 1KWKA 4P2RD 3FT3A 2DM3A 5DMIH 3RJDA 4JFHE 4ONGL 3CFDA 2E9WA 2J88L 1CFVH 1NWRA 5IEKB 3I75A 3MXVL 3CHFA 2DSWA 3UROR 3BKYL 3MV7A 3DI2B 4YE4L 5DF0A 2GJRA 4EEEA 4QHMB 4MJ6B 4GKZB 4NNXB 4TUJA 1DBJL 1JGDA 2X89D 4ONFH 4Y5XC 5DHVA 3CMJA 2JIWA 2PW2A 3FFCB 1MHCB 4QAWA 1DVFA 2NX5A 1D5MA 3TM6A 4F7PB 5I19L 4QP0A 3TPUA 1U8JA 4KXZI 3MJ7B 2GFBA 3LMJL 4G8GD 5HHVH 3FFDB 1OGAA 4WO4C 2WHJA 4GIAA 2BXZA 3U6RA 1GHSA 3CLEL 1SFSA 4KJQD 2B8OT 1A6UH 1VCAA 3ARBA 1NFDB 4PJDE 5IMMB 3VXMA 3OG4B 1U6AL 1ODZA 4MDJB 3CZKA 3VDAA 5JHDE 1HH9B 3CFEA 4N9OB 4JFEA 5INDB 3MRRB 5JDSB 3QUYB 1MQRA 5FYLD 5T5FH 1NEZA 1FG9C 4F15B 5GGQH 3TNMA 4GG6F 3VIPA 1IAIM 3EDKA 3TPKA 3O41B 3LIZL 2ICWA 5HVGB 2GK1B 4EZMA 1QO3B 3VFUA 2X9XA 3N85L 3TA3B 3HI5L 3QEQA 4JRYD 4UFJA 3T4YA 3UTSE 4LEOA 1PW3A 4NQEA 4YXHL 5I1DA 3W26A 3W0WE 4B0MM 2Q8AH 4JGJA 3FN3A 3WUWB 3CNKA 3MBXL 2X9YA 2BOCB 1SEQH 4MAVA 1S9YB 2VDRH 3PGCB 2F18A 1IQWL 1ZS8A 3ZJ7A 1K8DA 4WWID 4PFEA 3R0MA 5JPNA 1UZ6E 4DKDC 2IAND 3PABA 3MMUA 1G9HA 3IJHB 2XTJC 3D0VA 4TVPL 2YLAA 5JXEA 3WEMA 4ZFGL 3UYPA 1HQ4B 5DRNB 5I8EA 3MR9B 4URTB 5CJQH 5GRXG 1NBVH 4ZQKB 4FABH 3DVGB 1K3ZA 1Q0XL 3RAJL 1QYGL 2Q8XA 3A67H 3KJ6L 4G8EA 4LLVB 4ZXOA 5K9QG 3BVTA 1OAUL 1KLGB 1U8KB 3PNWB 3D69B 3B3IB 3CCHA 2XXCB 3MV9B 4XP6L 1VBRA 3EJPA 3MBEC 1R0AL 4I0KA 2DBJA 5CJOL 3IETA 4MJ4A 3U4BH 4XBPB 1NC4B 1EQPA 1RJLB 5LGKA 3EYOA 3DX9B 5C2BL 4AL8H 3QI9D 4EQ3A 1T1ZB 5BOZG 5I1AA 1EMTL 1T4KB 2VABB 4B50A 2EPNA 4PJEE 4XAKD 2XN2A 2WXDM 2NR6D 3MRBA 2HWZH 3NPSB 3PWJA 1ED3B 4LASL 5CJ8A 1MCOL 4XBGA 1R3HA 2J7LA 4OCXH 4PGBB 5ALBH 5IB4A 1ZT7A 4Y4HA 3TH4T 2GUYA 4GRWF 1JFXA 1HINH 4NC1C 1B2WH 3QWRA 5BXTA 5DFWH 5E5UB 4DWSC 1W1VA 3LD8C 4NKOB 1RZKH 4KK5D 5ABFB 5FOBB 2FWOB 1K4CB 4GRMA 2Q76A 1ITCA 1LO2L 3I6GB 4M56A 1WAAE 1ROWA 1YEDA 2UY3A 4HBCL 3AMCA 2WWCA 1HKMA 1XF4B 1M7IB 1XSKA 4HS3A 2D03H 3MLRH 4M7KL 25C8H 4JO2H 4Q9QH 4UTBL 1BM3H 4WFGD 4JLRA 4OSUL 1IC4L 1T2XA 4OKDA 4RMWA 1FORL 3GSOA 1FLTX 4C83B 4U7SA 5I74C 4GBXC 3C8DA 3PQYB 4BZ1L 1IBGL 2J8UE 4X83A 5E99H 3RFZC 2VUOA 3T3PE 1BD2E 2WVSA 2VDKL 1JWSB 3CZLA 1LQ0A 3CVHH 3VGGA 2ZPKL 1BVNP 2JELH 4JN2A 4KMTH 1Q9WB 4HX1A 1AKJB 3KPQB 2A6IA 1I4FB 1BQHB 2E9LA 2ICWJ 3RZWA 2R39A 4BK5A 3CH9A 3RP1A 2XTLA 1TLKA 4FNUA 4F9DA 2PW1A 2VLME 2GEEA 4HGWB 1E73M 4OJYA 4L3CB 3L3KA 4NOFA 1A6WL 2BY2A 5AYQA 3JV5A 1SHMA 2R69L 1KJ3H 3SDDD 2WBJC 3RWEB 3OB8A 4TVPD 3RUGA 4FXGB 1RZFH 4ZE4A 4KKLD 1E5JA 43CAA 2W9EL 5AUMA 1C12B 1GHFL 1K8IB 3RL1B 1J7VR 4WI8A 4WUUE 4U2ZA 4HWEL 4AD2A 4MXVE 4XVTL 3SGKA 5D2LA 2APXA 4UB0H 4OZGF 3NVQA 4ZPTB 4U1MB 4U05A 5CPTA 4NGHL 4YFLI 2CLRA 1E28B 2OR9L 2WC7A 1EXUA 1OWQA 1S46A 5GGSA 1CLOL 1A14L 3VFMB 5EBAA 2VDQH 1R3JA 4K23H 4Y8DC 4HFUH 3P3YA 1H3PL 4XV0A 1GIGH 4YX2H 5GNXA 1J1OH 4JZJC 1VFMA 2GSIB 4GKNA 3ROOB 2VDLL 3KLAB 5BCAA 3MBEB 2ZSVB 4I9WE 3OKYA 2CHOA 4ORGB 4H8VA 4YIQB 3GIZH 4IOIA 4M93C 1T89A 5GJSH 5IVZB 3S4SA 4LCWD 4TRPL 5K59F 3EO0A 3VH8G 4KZEL 1OP3K 2G4FA 1RMFL 1OGTB 4O2FA 3BP4B 3V5KA 3I84A 2V7HB 3VXPB 4UT7H 1IEAA 4R90H 4PRHB 5SWZE 2HAZA 3TJHD 4KFZC 1M03A 4RBPH 4HULB 4TUOB 1HDMB 2VDML 5EC1A 3IDJB 4H5SB 3EJZD 4YDJB 4DWSB 1V3IA 3LD8B 1KG0B 2BC4B 3LQMA 3T0EE 3AIUA 4MD5B 5T1LD 2HKFL 1KN4L 3RVXC 2YSSB 3VJ6B 3HMXH 2XZAL 3KGRA 3D3VE 4HS8L 4OAWA 4PJIB 5KN5B 1I7TB 5C0AE 1RZJH 4X80H 4AIUA 1ZANH 4OM1H 3WUWG 2HTKD 3GBNH 1CT8B 1I7UA 5FK9A 3CVHA 1TQCC 1H3XA 2YPLE 5ICZA 3HE6D 5KSBA 3ZKMD 4R4NC 1FL3B 5ANMA 3N13A 2VLJE 5I74B 4GBXB 3KR3H 4HIEA 5H35A 3F58H 1FZKB 1BLNB 5FO7B 2A1WH 3HNTL 2E40A 2Z31C 4TSAL 3TGXA 3ZT5A 5E0CA 4AZ8A 5DJYA 1RUKH 4HCRH 3W82A 3KS0H 1EUTA 1CBVL 4RE3A 3IJSB 3MJGX 4R0LA 2YBRA 4PLJC 5HJ3B 2FNBA 2I07B 1BAFH 1TJIL 4GKSA 1WE5A 3LXBA 3VXTA 3WQVA 4P48A 1EHLH 3QDJD 4M43L 1OAZH 4ODWB 1HCFX 1ZWIA 1PPIA 1CFNA 2WBJB 3N11A 1A7QH 4I5BA 4BELD 3H6JA 5I2IB 1DBKL 2XPKA 1JPFB 1HI6A 3S3JA 1GH7A 5DVLA 2HVKA 4JFZL 4MLIA 5KBNC 4XUYA 5EOQL 2ATKA 4JDTL 1E72M 4HUUA 3KPNB 4GO6B 4PJDF 5DS8B 1HHGA 5DUMH 5A40E 2PI6A 2RGSA 3LB6D 5EBMB 4XNUL 4ZAKD 3AIWA 5EWIL 4U1LA 3AYRA 4UT6H 3P73A 3FB6A 1UWSA 5DJXB 3I75B 1N7MH 1HSAB 1IRAY 3V5DA 3MRLA 3MV7B 2ZCLL 5CEYB 1HX0A 1CI5A 1U58B 1JNLL 1JGDB 4DFHA 1DP0A 1NCWL 3WQ6A 4P59L 1YUHB 3AXLB 1TQTA 4MAYC 3OSKA 1DVFB 4DN3H 3TN0A 4JZJB 4PP1C 1MRCH 3QFJA 1NSNH 1F90H 5LA0A 3SCMD 1NPUA 4P2YA 5FYLH 4M93B 2ARJB 4Z7NF 5IFHH 4ELMA 3ARBB 4QRTA 1FJ1B 5E9DD 1JRHL 1U8HA 3MGOA 1MJ8H 5EU5A 4M8VA 1C5DA 3HMXA 1YMMD 5CINH 3BW9B 3CZJA 4QO1A 4IS6A 5E6ID 2YD7A 3WLBA 5FA3A 1MCKA 1AO7D 3AHVA 4KQ4L 4ELKA 4M61B 1US3A 1GXEA 2DQHL 3DMMC 3QEQB 3PZ9A 4PJHE 3PBGA 3KYKL 4L9LC 2H9GA 4C56B 2CDFA 4G7VL 3ZTJH 3O9WA 5CGTA 2B1AL 5KTEL 2YPVL 3PDGA 1I8KA 2ORBL 3O2DL 3QHFH 2V2XB 2NXYB 4FQ1L 4ZUUA 5C07B 3WFEL 1JZ4A 5E2WH 4YK4C 3T8XA 5C71A 1RZGB 3AMLA 1VIWA 3MLXL 1SY6L 1W1PA 2GK0A 4JREC 1TQCB 3GXTA 3WEOA 2CR3A 4KWUA 2DWEA 1V3HA 1G1CA 3L7EA 3MRFA 5ABGA 1T1YB 4HCRA 3I6KB 3CD4A 3VRLE 3BP5B 5IGXH 5A69A 2MSPA 3A21A 1RY7B 1P7KB 4FQLH 2AK1H 4UV4L 4FLQA 1KC5H 5TPWH 4MWFB 4UINH 4H26B 1AMYA 5ID0A 4E41A 1BFVL 5DZOA 2V3EA 1VENA 4LOUD 1WC7A 4PG2C 2Z31B 4JRXD 4ACYA 1QA9B 4XX1G 2NY4D 3FRPG 4Y4KA 3IDNB 1E6RA 2A9ML 3OLGA 5GHWL 2EDYA 4EN3D 3O11A 4EKJA 2OL3H 4Q2ZA 3W9DA 4P2RA 3B9KA 1SJEA 3ULUC 4AZHA 2I25N 4ONGH 3IKKA 3VFPA 1T3FA 2E6QA 2J88H 3T0XA 4DO6A 1IAMA 2EDQA 4F7TB 3FCTB 1CICA 4QRUA 3GSUB 4FMFA 4KUCF 4U33A 1KOAA 3BKYH 4YE4H 1WAAF 3IETB 1MCLA 2FEDC 3MCKA 2X89A 4CNIA 1II4E 1DBJH 4L1DA 3VMOA 4I48A 2VAJA 1ITBB 4R7DA 5I19H 1CZ8L 3QO0A 3ALFA 2D22A 3BVVA 5IQ7L 4MJ2A 4JFSA 1MAKA 2XYLA 4L4VE 4G8GA 1W72B 3LMJH 3QQNA 2NY3D 3MV8B 3L4TA 5GGVY 2OMNA 4DVBA 4P2QD 1CEOA 2J8UF 3CLEH 1JRHI 4ZUVB 3T3PF 3IJ8A 4ZFFB 1OAKL 3UYOD 4Z7QE 1EGJL 3PWLA 1KB5L 4GAJL 2ZOXA 5IB1A 2BOBB 1U6AH 2GITA 4EUPG 1HN1A 5C6WH 2BNRD 3W27A 4MA3B 4DZ8B 4HDIB 4KKCC 3VXNA 2XSBA 4ZODA 2EPLX 2X4UA 3VFTA 2QSTA 3SCTA 4MAYB 3LKPB 5JQHC 5CBAB 3U83A 1UJ3A 3LIZH 4WF7A 4MA7L 4JFVA 4KK8D 3W6MA 3N85H 2VVNA 3BEVA 4JRYA 3HI5H 4OLVL 5K9KA 1LEGB 2A3AA 2VXVL 4QRPE 4YXHH 4FQIL 5HI4C 4P9MH 3RBGA 3IRZA 1FN4A 4D6CA 1MWOA 3MBXH 1MW2A 4KROC 1ISZA 4ONHB 1OVZA 4I2XE 3T77B 5HDOA 3ZDZF 3PDDA 3CIQA 1IQWH 1SYVA 2UWEE 4JN2B 3EAKA 4AENB 4MXVF 1JF1B 3OKKA 4HLZG 2XVNA 4YPGA 2IANA 3ARYA 4KJWD 3SUVA 2P46B 3OG2A 5M3WA 4TVPH 3DMMB 4ZFGH 1BF2A 2JCCE 1YHTA 4LSDA 1CGYA 2GTWB 4L9LB 1VDGA 1GONA 3REVA 4KJPC 4ZFZB 3QXAB 1R75A 1Q0XH 4X5XB 4YK4B 1QYGH 2XFFA 2BNUA 5BJTB 3LN5A 3KJ6H 4XT1C 5F88A 1Y6NR 3UC0L 4X6EB 2HT2C 1OAUH 4JREB 5EUOE 1OLLA 1Q9LA 2I9TA 1ZU8A 2EDTA 3QPXL 5AUMB 3G9VA 2VITB 5IBLD 4X6CF 1V6UA 3W25A 4XP6H 2OL3A 4N0RA 4YO0B 1R0AH 1KPRA 1J8KA 5CJOH 2EDJA 3KS0J 3MRQB 1LNUA 3LKNA 1TVBB 4LCCA 3MTRA 5DC9B 4PJAB 3SDXA 3E2HC 3QI9A 3QUKB 1FSKC 3MS8A 2N4IA 2Z8VC 5ESVA 1EMTH 5FDWA 3WFDL 1U8QB 1T20A 2N7BA 5F9OL 1CFTA 4BFBD 4JZNA 4LASH 1HKJA 1MCOH 4JFFB 3FO2A 3WY4A 4WIWA 5A8QA 5I6XC 4GJTB 4J8RA 3KZSA 4U1IA 4WFEE 2WWDA 3S34L 2CXGA 4OGAC 2NXZD 3BT2L 1VRXA 4EANA 5C0BB 3PL6C 1PDKA 3CFJB 1C5CL 4OLZL 5EO0A 1UXWA 5J3HC 5T1MB 3PZGA 4JGUA 3JWOC 1LO2H 5DR5L 3S4SB 1BWMA 1X5JA 5HHXL 1FIGL 4MNHB 4LU5L 3BVNB 3V5KB 4HKXB 4YH6A 1F5WA 1LK2B 3TBWB 2EH7L 3HNSL 4M7KH 4UIKL 3EIFA 2GVYA 1M6OA 2CH8A 3QDME 1S7TA 3MRKA 4UTBH 1MFAL 2GT9B 3MRJA 1IC4H 4OSUH 1I8MA 4XPGL 5EC1B 1FORH 5JLZB 3WHE1 1QI5A 1NEUA 1YEKL 3T0DA 4M4PA 4BZ1H 4YAQA 3SE9L 1IBGH 1QI2A 4ODXA 3GKWL 1IGTA 3EYPA 1G6RL 2Y5EA 3ETBF 2VDKH 4TVDA 4O00A 2ZPKH 5BZWB 1CZ1A 2ZUXA 3PHQB 2DSZA 4KDTA 4RAHA 4JFOB 5FL1A 1GL4B 2EXWD 4LVHC 4PCTA 4RAUB 2DJSA 2FCBA 5ICZB 4MAUL 5KSBB 1MWAB 3L5IA 3WIHL 5DJ6A 1UZ4A 3IDIB 1A6WH 1A7PL 3KNBA 3SDDA 2R69H 3LPWA 2GJXB 2OTWB 4W84A 5H35B 4KROB 1YDPA 3THCA 4QT5A 5K9QI 1QSZA 5C0CB 4NKIL 1T6WA 2W9EH 4G3YL 3QRFM 1GHFH 3PE9A 1UVQA 3VI4E 1ZMYA 4PPTA 5DO2D 3OKLB 4HWEH 3HC0A 5FYKL 3U36B 3PTMA 2D4FA 1J11A 4R0LB 4XVTH 2X4NA 2YBRB 3S5ZA 2FJFA 4YFDB 1DQMH 1CFBA 1MUJB 4UMGA 4X4MA 4GKSB 3UZVB 4NI3A 4NGHH 4PREB 3V6FB 1F13A 2OR9H 4X0KA 4FFVD 1UXSB 1NUGA 4AD1A 4S1DC 3Q2CA 4I5BB 1KEML 1CLOH 3RRQA 1A14H 2P8MB 5FKYA 2DKUA 1RVFL 4OLEA 1NCTA 3K2MC 1H3PH 2IXVA 4AY1A 1GZQA 3K80A 1NDGA 4OZIA 2Y72A 3W0WB 2EJ1A 4QEGA 4Y2DD 3O4LE 4H20L 4LCWA 1HVXA 3NCCB 1KYOK 4U1KA 4TRPH 5EUKA 3E2HB 2JE8A 1FSKB 4KZEH 3P73B 1RMFH 2NTFA 4KI1A 1UR8A 4U1SB 3SKNA 1HJVA 4I3RL 3BN9D 3DETD 1FO0L 4EI5C 4KDVA 3DROA 4UFIA 2AW2A 2IPTL 4QRSB 1MJ7L 1CDBA 1R34A 3KLSA 1XGTA 1CTNA 5I6XB 2VDMH 2MFNA 3S5LB 3ZDYE 2AJYL 1R7AA 4H8WC 1XF3B 3PL6B 4MQ7A 5T1LA 2R9HC 2OXGA 3MUY1 1G7IA 5KAQF 4QHKI 3PGDB 4TQEL 1ZT1B 2H1PH 2XZAH 4HS8H 4F57L 2NYYC 4FK9A 3OGCA 2F58L 3JBG7 3OX8A 1HXMB 4PJGE 5EH1A 1URLA 1U8HB 3MRHA 1JP5A 3L3IB 4ZTOL 3L3OA 1C5DB 2CITA 1IC5H 5A3IC 1NQBA 3HE6A 4FRWA 1F6AA 1D5XA 2WIMA 4FXLA 4Z5RA 5A3HA 1CDHA 2P5ED 3PZTA 2CBIA 4P7OA 2BSSB 1H8NA 4MNMA 3HNTH 4TSAH 4PJEB 2HT4C 5HYFA 2DGAA 5IF0B 2O9TA 3PHAA 5EFFA 4AEHL 1LEIB 5L88L 5DMGD 4E9LA 5E1AA 2EYRB 3EMQA 1I8KB 4LFHG 4X6DE 3RVWC 2ZUYA 2ZUWA 2YUZA 1RAMA 5FM5M 4M7JL 1OM3H 1U3HC 5TE6L 5I17A 1IGFL 1CBVH 5GZNC 3S2CA 3MRGB 3WIFB 2GK0B 2NX5E 1MCSA 4AIZA 3Q6FB 7A3HA 1TJIH 3L7EB 3U46B 2BVPB 3R1GH 4N5UA 4D6IA 3QDJA 4FQQB 1K9DA 2APVA 3T0WA 2KZWA 4JAWA 5I76A 1L0XA 3HZKA 5FYKD 1EJOH 4HA4A 4GO8A 1DBKH 3QUXD 4RMRA 4X7TA 3VIMA 3AC0A 5BWFA 4E5XB 3VXME 1ZV5A 5BS0B 4JFZH 2C1PA 4Y5VC 4O4YL 5DK2B 5EOQH 4JDTH 3WIIL 4N90D 4I0PD 4JFEE 2D7MA 3B9KB 4NSBA 3EJSA 35C8H 1SJEB 5IJKC 3WSUA 4JANB 4ZAKA 3DURA 4XNUH 5EWIH 3ZT6A 3PWVA 1BLIA 3WUBA 2P24A 5JA9A 4JKMA 3GSWB 1RHFA 4NZRL 1CICB 5FECA 4LSPL 1EEZA 2ZCLH 4RA3A 2XG4A 5DJ8B 5LBSL 3W29A 4UILH 2ZXBA 1JNLH 1NCWH 4NQEE 2V9RA 3SGJC 3FHQA 4P59H 4XVJL 5I73C 2CLZA 1W1YA 3FNDA 4NQCD 1XR9B 2AJ3A 4X7FC 3QB7C 4G8GB 3SCMA 5HY9B 5F7MC 1CGSL 4UNIA 1YY8B 1J0IA 4DVBB 1U8MB 5I8KL 2YHGA 3FOLB 3NFNA 3GXPA 4RGNE 4W89A 3M46A 4CVUA 4YBQC 5E9DA 3PWLB 3D87B 2UWEF 3P9WB 3X11A 5DI8A 2L7UA 2YIHA 4EI5B 4YHPB 2ADFH 1LL4A 1YMMA 3NACL 3VXNB 4KU1A 5E6IA 5IOPA 3WQ8A 3SDYL 2A0LD 1AO7A 3F65A 1U8LA 5B39A 4CDGC 4KQ4H 2JCCF 2F54B 2BY3A 1H15B 3CSGA 2A38A 5AWNL 1TETL 3CIVA 5MI0C 2BSTB 2DQHH 1B0RA 4J3VA 4UNUA 2QJDA 2WMIA 4PRIB 2PTTA 1TZHB 3KYKH 5D1ZC 2VZSA 4G7VH 4HUWA 3L4YA 1A2YB 3BH8B 4QOKE 2YPVH 5TDOB 5KTEH 2ORBH 3O2DH 3ULVL 4FQ1H 5LKNA 3WFEH 5IMKB 2MNUA 1UC6A 5EUOF 1XGPA 3RIFF 4CMMA 5TGBB 3T4AB 3WIJA 3MLXH 1SY6H 3LRHA 1CGVA 1M4KA 1AC0A 2COQA 3EJUA 1QQDB 2WWMD 2VL5B 4JN1L 1BP3B 2VXQL 4UV4H 1Q72L 3FZUD 1HYSD 2Q7NA 3UPAA 3HI1A 2GJ6B 1BFVH 3NAAL 5D9MA 1A1NA 4JRXA 1J0JA 4X9GA 1LGVA 1KXQE 3HLAB 4EJ1C 1BQSA 1DN0B 3RHWK 1X1NA 4EN3A 2A9MH 4HV8A 3ZKXC 5GHWH 5J1SC 5JBEA 1QPPA 3DVIA 1E9LA 1OGGA 1U42A 3B8YA 3QXDB 3DX7A 4HG4J 5J89A 2EDKA 5ESQA 2R8SH 4NOBA 1ZS2A 3RDTC 4F37K 4EKXA 1WDRA 4MDOA 4OJFL 2P42B 3ESUF 2EH8L 1FL6A 3U7VA 3BPCA 4QYOB 5HTSA 3D3VB 1LF1A 4NM8L 1KCVL 3OIHA 2BX5A 1C7SA 3E3QE 4ZS7L 5C0AB 1VKXB 4I4WB 4C55A 2CDGB 4FNQA 1BBJA 3VM5A 3T1WA 3F5LA 1AQ0A 5I1LA 4D6EA 4K07A 2F1BA 1CZ8H 4LLWA 5ESVB 2YPLB 4MCYA 5FD0A 5ICXA 1TQVA 4FMVA 4U1GC 4Y5VB 4ZG1A 4P2QA 2HP4A 3Q0HA 3E6HB 2RCSL 5CEZE 2OLDA 4D9RE 3MRNB 1E27A 1OAKH 1IGJB 3SHSA 1EGJH 2H2SD 3I6LE 1KB5H 4Z76A 4ZXBD 4GAJH 3S5LG 4LKXB 1IAIL 4LYQA 1UXWB 1C08B 3GO1L 4HJGA 2BNRA 1NJ9A 4B5EA 2XT1B 3C87A 5IEHA 1QVOA 2FEEI 5BW7A 2XQBL 5I23A 4XZWA 3FQTA 5EU4B 4K7PL 4P2CG 1L0QA 3DBXA 3U2SA 2F7RA 3SE8H 3RUGE 3BXWA 4MA7H 4C7DA 4N0CC 4OLVH 1T7VA 4G42A 2VXVH 3MRKB 5SWSB 4OLWL 4FQIH 3GMPA 1B3ZA 1QPKA 5E70A 1PG7W 1X4ZA 4P9HC 3SGDI 5E2UL 1U8NA 3GXIA 1Z5LB 4ODXB 5D2LE 5MP6H 4PJBE 3VI4F 4W8AA 5FB8A 3GHEL 1R24B 3O2DA 4QGTA 4P5KA 1IV8A 3ULVD 4YLQT 5JPMA 3N1AA 4HEPG 1KLFA 4NC0B 4JG1L 2E7BA 4K8RC 5MI0B 4GW5A 1SY6A 3G6LA 4PGCA 5LGJB 5D1ZB 3ARGA 3QUZC 5IHZB 1R3KA 2EACA 3JV6B 5DJ6B 2MCPL 4PGEA 1UWRA 1WBXB 3TWCL 1MPAL 5IKCA 1G0DA 3BKCL 1NM9A 3CBWA 1E6SM 1T1XA 1KNOB 4LHUD 2Y4SA 1MHEA 3UC0H 1BZ9A 5EZJB 4KUZL 2EYTA 3QPXH 1EA9C 4XH2A 5DQ9A 4NO3B 2YEZA 3HAEB 5TDPA 3DX2A 4BA0A 1UEYA 4LF3A 1TCRA 5ISZD 3BWUC 3PTKA 4HUVA 4O02L 3SY0B 3EBVA 1TZGL 5GRJL 3BEWA 1BEYL 3WH9A 2EO1A 1DCLA 3WFDH 3EJYC 4X0KB 1QPXA 5F9OH 3ZKXB 4BSWA 3AMGA 1A0QL 1HHHB 2EIZA 3ZDYF 4AIEA 2A6KA 4UOQA 4BKLA 4AD0A 4ATDA 2GJZA 3EBAA 3OAYH 3KJ4C 4PJHB 3S34H 4DQOL 4O2CA 5A8OA 2CHNA 4G43A 5C0DB 3BT2H 3TYGL 4JVPA 1RHHB 4OLZH 1C5CH 2KQMA 2VC9A 1ETZA 3V0WL 1HHKB 2YRZA 4PJGF 5SX4I 4G80A 4WV1A 4MJID 5DR5H 5ANME 1N5YH 5HHXH 1FIGH 4BF7A 2NTFB 2X4RB 4LU5H 1EGJA 3BJLA 1KB5A 2O5ZL 3G08B 2ADGA 1QSED 3ZJ8A 2XUCA 4POZC 2OTUA 3UYRH 3MCLL 4U1GB 4DCQA 4Z7WB 2EH7H 5L2JA 1EZVX 3HNSH 4P23D 4GZIA 5IFPA 5EU7E 4I77L 2QADC 3G6JE 4P46D 4Q6IC 3VOCA 4UIKH 4AXNA 5E8PB 1MFAH 1Q9OB 5DSCB 4XPGH 4ODTL 4YDLC 4JL1A 5FKPA 3TTQA 1YEKH 4NYLA 3P77A 4F7MB 1CXHA 3GKWH 1G6RH 3UTQB 1U2YA 1FP9A 1KJ2L 4AT6B 4PJ9C 4XCYB 4CAGA 1JGIA 1A4JB 5GGRA 3WFZA 5H37H 3ZYZA 1YEHL 1BZQK 4BQCA 4ZOBA 1QRKA 5EBLA 4PTMA 3JWDC 1F6AB 1M7DB 3MCG1 4MAUH 2PF0A 3AIRA 1H3VA 2FGZA 1UQYA 3WIHH 3QHZL 3RIFK 1A7PH 3T2PA 2NY2D 2CIPA 1GSMA 4HA3A 4GFTB 1GZJA 3RIAF 5HPMB 2FHCA 4FG6D 1F2XK 5ABDE 3BZDA 1QOXA 3QFDA 1PX8A 2P7TA 1KB3A 4NQVA 5B4MD 4MD0A 4BQ2A 4NKIH 4G3YH 1D5BA 4WU5A 3RY6A 1JNEA 3FQWA 1ADQL 3FMGL 1X4YA 4X9YA 6A3HA 5I17B 1K6QL 1A9EA 3WHE0 4NJ9L 4O58L 1NGYA 1N2RB 3FB8A 5HGHB 5IFJA 1JNNL 3P9LB 1TTUA 1P7QB 4LAQL 4N9GA 2FHFA 4TTUA 4UQ2B 3HG2A 1VGKB 4W6YB 2G5RA 3QYCA 3DVFA 1WB0A 1MFCL 1KEMH 1X7QA 4ELME 4H1LB 1RVFH 1R5WB 3O3EB 2O93L 2CNCA 3C08L 4MCZB 5BRZD 5GRZA 2FR4B 2D0FA 4HHAB 4HMEA 3GJFH 3CSYB 3FO9B 3ALXA 4NQXA 4Y2DA 2CRZA 3H9SA 5CP3H 1WP6A 3GI9L 5HYJB 4H20H 3ZOAA 3BD3A 4G6FB 4Z77A 2HG5A 4R96A 4R4BB 1WZMA 5BOPA 1DANU 3VD5A 1MELA 4I3RH 4ETQA 1FO0H 1QSFB 3MO1A 3POCA 4GOSA 3QHTC 4QRQB 5DHXB 2AXFB 5K9OB 2IPTH 5GGSY 5FA4A 2VQ1B 1MJ7H 3IU4L 1RUAL 3AAZA 1DLFL 1MCBA 3BAKA 4WWKC 1U91B 3CH1B 3KJ4B 1VA9A 2XWBB 1DBBL 3WL9A 2AJYH 4ZOAA 2NW3A 3WFBL 3U0TA 2E5EA 1LD9B 5ADOL 3GSVB 3WS6C 2FECL 1GGCH 2HFTA 4F57H 3RKDC 2F58H 6FABL 1GPFA 2K1MA 5DUPH 5FKAB 4XNXL 5FUOL 2ZUUA 1OCWL 2KDGA 1D6EB 4X7CC 1L0YA 3ZKNC 4E41E 4JHOA 2W67A 1JPGB 1JI2A 4ZTOH 1K4DB 1G6RA 2BVTA 3BAEL 2MCG1 4FLSA 2KH2B 3J7HA 4Q6IB 2QADB 4K3JL 3U5UA 1FNGA 4D6HA 2F2HA 1XAUA 2NY0D 1T1WA 2AXGA 3DXAD 1ZE3C 5KS9A 3FT4B 2P5EA 1MW1A 5EU6E 5B39B 5JIHA 1YNKL 3VI3E 4YDLB 2QPSA 3DWTA 2WMHA 4CU7A 4MQXC 5HGAB 4BQ6A 4UUJA 3AU1B 3KPRB 2PTTB 4AEHH 1KXVA 4HUWB 4PJ9B 5L88H 4E4PA 2ESVD 3WIHA 5A6MA 4X98B 4YWGL 4M7JH 4P7QA 5TE6H 1NANH 1IGFH 2AK4D 2P47B 4WI2A 4MD4A 1LHZA 3WD5L 2QR0B 2VE6A 3AGVA 1UA6L 1KGCD 4J12A 3RVVD 3MFFA 1XCTB 3V6ZA 4ZFOA 3PIQA 5CZVL 5HYSA 2ZWZA 4M1CD 4LCYA 1E4MM 4LSVL 1UG6A 1UKSA 4Y4FD 3QUXA 1R86A 1U8OB 1CPUA 1QEWA 4CMHC 4JM2C 1WT5A 2BNQB 3ZE1F 4A3HA 4J6RL 2Q86A 4A6YB 1B88A 4TVUA 1DWAM 4O4YH 3TT3L 2DAVA 1S7WB 3WIIH 1E56A 4TN9A 5F7DA 5I1HL 3NH7L 3W9EB 1C8XA 5F9WC 5HHMD 1HEZB 3DX7B 2VERN 3E8UL 4LLYA 1RUPL 4LDOB 1QACA 4PY7A 1I75A 2AV7B 2MQ0A 4E2OA 3V4VL 3BPCB 4M1DL 4NZRH 4U7KA 5GXBB 3GJFA 4X6BB 1EFQA 4LSPH 4OD3H 1GJUA 5LBSH 4QHNB 3BKJL 4C54A 1TVPA 8A3HA 5DD1L 3NSNA 2E7MA 5KAQG 1BVKB 3PWPD 3RUGF 3G5ZB 2VWEE 3QDGD 3W39A 3TO4D 3AJ7A 4JO3L 5ITFB 4RFNC 3WE6B 1FO0A 4DK3A 3UZQA 3ARQA 3LQAC 2GI7A 4XTRC 5JQ6L 2B7DT 1CGSH 1CQKA 1UR9A 5DUBB 3BD5A 5I8KH 2BSRA 4HK3J 5D2LF 4ZDHA 2IANE 2IGFL 3I2CL 4ZEPA 2DF3A 2P5WA 2R2EB 3B43A 3RTQC 5IIEA 4U6HA 4L5FL 3NACH 4K7PX 4LRNH 2GSGA 2W9LA 3SDYH 2J8HA 3MJ8B 4X6FB 2FJHB 3B6SA 2IJ0C 1MCFA 3RMEA 1OW0C 4KRLB 3U2SB 1GCYA 5AWNH 1TETH 5FGCE 2DQCL 2R29L 2JF6A 1JMZA 4LLUA 1CDJA 1EBAA 2C5DC 3MODH 3ULVH 1K2DB 4UV7L 3EDFA 3L2LA 2IH3A 4K71C 3UDWA 3SDXE 4GQRA 1FVDB 3HFML 5D1QC 1IE5A 4PJCA 3UPRA 3CU1A 1KTDB 3IS0X 4FOMA 5AY7A 1JGEB 5IM7B 4XAKE 3O4LB 4JO4H 1ZEAL 2F61A 4JN1H 5IBUB 1UZ8A 4RGNC 1IEBA 2IBZX 2GK2A 4TX6A 2VXQH 3UG5A 4UTFA 2FJGA 4GAFB 2FO4A 2OWCA 2LTQC 1KTKE 1I1CA 3NAAH 4WHYG 2WCGA 4HMDA 4ZPVB 1FG2A 2IPKA 4XNZC 5DK3A 4XP4L 5TF0A 3ARGB 1KT2B 3II1A 4PJ5E 5A43C 4PGEB 3EZ8A 1GQLA 5IKCB 3RWFA 2X1QA 1E6XM 3O9NA 5J56B 1G0XA 2WNGA 2P4AB 1QRND 1V7NL 1MNUL 4PTXA 1RZ8B 3WFHA 1BZ9B 4DKEL 4OJFH 3IANA 2G2RB 4QNPE 4AWEA 2EH8H 4DJMA 2BS9A 2IPUG 3MRCB 1DTUA 2Y6SD 4NM8H 4LP4A 5BVJB 3TZVD 1KCVH 1TCRB 4WFGE 4ZS7H 1MLBA 3QXUA 3OJDA 5KSVB 4RGOL 2IAMD 4M62L 1UKOA 2F53B 4QWWC 1HKFA 3BEWB 3S36L 5KG9B 4CMHB 4JM2B 4JE4B 4Z7VA 4LCIL 3TCXA 1JIBA 1FV1A 2D7NA 2HTLD 2R0WL 5E4EC 4YPJA 4QHLB 5F9WB 4JDZB 2XGIA 5IG7A 5DT5A 1W0WA 4OF8A 2RCSH 4IRJD 1ZLSL 3Q3GB 5D2NC 1U8IA 4QCIA 4ZXBA 1HL8A 1E70M 1F58L 2XIDA 1IAIH 3B9EA 4DN4L 4G80B 5F6IC 3HHRB 2XQBH 3UBXB 4WHTB 5FF6A 1T22A 4K7PH 3CZSA 4W4OA 1V08A 4J27A 4RFNB 3FJTA 4N0FA 1GVYA 1EAPB 1QBBA 4DCQB 5L2JB 1HH6A 5IW3A 4IOFD 3VFRB 4JKPL 5A8NA 3T0VA 4OLWH 1NUDA 3W5NA 1ITXA 3AHTA 2ITCA 1UCBH 1FL5B 4F7EB 5E2UH 3RGHA 3ARSA 5C0FB 3RTQB 4KRPC 3AIVA 2LVCA 3P4MB 3ZJ6A 4NZDA 4W8LA 5IQ9A 1NGPL 4X4ME 1GOIA 1MF2H 5DJCA 3GHEH 3MANA 3AMKA 5IB5B 3RNKA 5AYIA 3OMZA 4GZEA 1UH3A 2B4CL 1O7VA 2OX5A 4JG1H 5CPQA 3A4XA 1Q8MA 3FQXB 2AV1A 4YR6A 3VXRE 3E6FB 3AS0A 4KGLA 4KTDL 4C59B 2XYCA 4O9HL 4IJ3C 4ELMF 1CXEA 3TWCH 1MPAH 3BKCH 1PKQB 4AMXA 1RJYB 3WDIA 2AQ1A 4LHUA 5J6HA 4HZ6A 1ZJAA 4PMNA 3QFDB 5D1QB 3TCLB 4FXKB 3JWNC 4KUZH 3VFOB 4JCMA 1MI5D 4OV5B 1JFHA 2DH2A 1CE1L 4CD8A 4HIIA 4PCSA 1JWMB 3U7YL 3ZHKA 4TNVF 5ISZA 2WSPA 1AXSA 4GT7A 2CQVA 2LTQB 1OP3H 1MCWW 4O02H 1TZGH 3ZLQC 5I1KL 5KOMC 3WJJA 5GRJH 5IFJB 1BEYH 4XNZB 3HG4A 2W65A 3UAJD 1S7UA 3LPPA 4N9GB 2C3GA 4XCEB 2KQNA 2X1WL 3CO4A 2WCAA 3MRMA 2VI0A 2WW8A 1A0QH 1H8OA 5LXGH 3LH2H 1HWGB 1EFXB 4EDWL 5DJDA 3UEZA 3F7VB 2D0HA 5E03A 3NCJL 3GI8L 5F9DC 1JK8B 4DQOH 5I8CA 4J28A 3TYGH 4MQTB 3PWNB 5D9SA 3UTTD 3V0WH 4N0YL 1WZLA 3H9SB 4MJIA 2AJVH 1WQVT 3UEQA 4W87A 5JA8B 4Z77B 1CXKA 2VL4A 1RPQA 4J3WA 4OFIA 5L9DL 1NBYB 1QSEA 2O5ZH 3KWXA 3RWJA 4AZCB 1DBML 2PYFA 4LMQI 3MCLH 1AIFA 5D5MA 3UJTL 4P23A 2FD6L 5F1SA 4P46A 4YUEL 4M6ML 5CP7A 4I77H 2DM2A 3VI3F 1GGUA 2RAMA 3KG5A 2DQTL 2J8OA 2X7LA 3L3GA 4X9HA 5C8BB 2CSPA 5AG8A 4OI8A 4ODTH 5D2NB 4KVCL 3L5WB 4G8IA 5CGYD 2V5TA 2J5LB 3I50L 1H0IA 2FBJL 4NN6C 4R2GC 1YC8A 1I7RB 4NCDA 3NSMA 3A23A 1KJ2H 2HKHL 5F6IB 3JTTA 3H7BA 2VLRD 3MLPA 4BH7A 2J62A 4NHUA 3SE4C 3EYQC 3R8BB 3OA5A 2NW2B 4PJ8D 1CL7L 4MDIA 1XV8A 1I1FB 1HNFA 4AD5A 1YEHH 1CF8L 3EJRA 1ZA6B 3QSKB 2PETA 5ESAB 3HKFA 2HJLA 3HRZA 4N8VB 4WUKL 4Z78A 4MXQD 1JHKL 4RNRA 4YC2C 3VMPA 5KS9B 3SPVA 1MQKL 4PJ7A 5CSZA 3IFOB 3QHZH 1G7MA 2DLEA 3LZFL 3OJVC 3QNXB 3VGDA 3MYJB 3NA4A 4HXAL 4KKBD 1T66C 4KRNA 1HXKA 3BP7A 3OZ9L 4NSKB 4YHIA 2H26A 4UUJB 1OTUD 3P4NB 4NO5B 2IEPA 4P5TC 4HKZA 4CW1A 2FYVA 4LLDA 1AR1D 4P4KD 1CFSA 1WTGT 1CE6B 3GH5A 4IISA 1ADQH 1UADC 3FMGH 5D7LD 1DLHB 2YN5A 3BWAB 4NJ9H 4O58H 1KCRL 2X4OA 4OZFH 1JNNH 1EHXA 1YECL 4LAQH 5TD4A 1CG9B 4IJ3B 4ZFOB 5HYSB 1ERNA 3LOWA 4GG8A 5IHSA 3PV7A 4NDMA 5ILTL 3LRKA 1MFCH 3I02A 1I85C 2AXHA 4IMKA 5E9DE 3VX0A 2X4SB 2O26U 3BOVA 5BRZA 2Q86B 3P11L 3C08H 3FONB 4LSQH 4MYWB 1YMME 5D7IA 4V1DD 1WNOA 3RQ3A 3LAFA 1E6OL 3GI9H 1E6ZA 2CO6B 1I3RB 4LSUL 3ABZA 4PJBB 3AHYA 4MNGA 4RRPA 1GORA 2DIAA 2W60A 5F8RC 4RDQF 4NFDA 5BROA 4AZ6A 4AIOA 5HHQB 4KH2A 3BIBX 4ZS6D 1KR0A 3IU4H 1RUAH 5DYOB 1L0PA 1DLFH 2ZJSL 4Y1AD 4QHUB 2FYYB 3WN5C 3NN8A 3UBXG 5ACZB 5E2JA 4S3JA 3S3PA 2H6PB 4KJYB 1DBBH 1A9BB 1ISXA 5MEPB 2VZTA 4CD5A 3B83A 3QUMB 1EEYB 3BZEB 3FW6A 4KI5E 1W9BM 2X1PA 1X44A 5ADOH 5BVPL 4XB3A 5E8OA 2OYLA 3KYNA 5IVXA 4PBGA 5BRPA 4JFDD 3SDXF 4ZDHB 6FABH 2WQRA 4CADA 4XNXH 4QTHA 1T21A 5FUOH 1OCWH 3VXSD 2P5WB 3AUVA 4OCNC 2D4DA 4OCYH 1AY1L 3N9GL 3GSXB 3N1GC 1L4IA 4JRXE 4HWNA 1LWHA 3BAEH 1LILA 1KJ2A 4JFYB 4K3JH 3VO0A 1XR8B 3DXAA 1RH9A 3WMCA 4WHCA 1FFRA 3ARPA 4QY8B 2GTZA 4TTDD 1YNKH 5D1XD 1DQQA 4H7VA 4ZO9A 1F97A 1OY3B 3V5HA 4YN5A 4NN6B 3S6CA 1C7TA 4R2GB 5A95A 4DK6A 3QIBD 3L7FA 4LRIA 3SDAC 1ZHLB 5CSYA 2ESVA 2VZUA 4HF5L 2LU3A 1EH9A 5IHLB 3LQZB 3BSGA 4YWGH 1HJWA 4JAMB 4QNPF 4MPKA 5GS1A 2AK4A 4QRRE 3ARED 3UPRB 4RBPK 5A6SA 2V5SA 1DEEB 3WD5H 5HSFA 1HIZA 1UA6H 3ELAT 4YC2B 5F21B 3TBYB 3VSVA 3EYUL 1FFNA 1ADQA 1V02A 1JHTB 4H8UA 1GGIL 4DOHB 3KYMA 5CZVH 5IROC 3LMYA 2VISA 3UJJL 4F9LC 4LSVH 4G9FD 3S96B 2GYSA 3PHOA 1NUNB 4OZFA 4AZ7A 3TNNA 1F42A 3G6JB 4J6RH 1MCJA 2V6HA 4BFIA 4X9BA 3B8SA 1Z3GL 1OD7A 1XGRA 3I85A 5J4MA 3C6SA 4TNVK 5MHSE 1DUYB 1ZTXL 2NY5C 1HKKA 3TT3H 3RWFB 1MHHB 1PYWA 4RIRB 4Z7UB 5I1HH 3NH7H 4WU7A 4LK4A 3RVTD 3E8UH 1MIEL 1RUPH 3WFHB 3Q5OA 2Q7YA 1XIWA 4E8CA 2CYGA 5B8CA 5I3DA 5C0EA 3V4VH 4M1DH 1G9ML 3UX9B 4Y5YA 3WF2A 5CD3B 3QRGL 5BZDA 3MMWA 1UWGL 4RGMB 3OBAA 1WF5A 4XB8A 3S36X 5F96H 3VWKD 4FTVD 3TLRA 3BKJH 1H09A 2B39A 2HLFD 5DD1H 2E7LA 3QDGA 4PG9B 2DWDA 3TO4A 2EDLA 3QH3A 1V7ML 1WIUA 2Y5TB 4JO3H 1I1YB 2G5BB 2WMGA 2YDSA 1OF2A 5MEND 3AS3A 5JQ6H 2YC1A 2R23B 4LQFH 2Z4QA 2J3SA 2O9OA 2HA1A 1PIFA 1B0GA 4Y7MA 2A73B 1MFVA 3WH6A 4ZXBB 1OBAA 4PTWA 2EKJA 5DFTA 3V95A 7TAAA 3GXMA 4M8QA 1U93A 2HJFB 1ONQA 2XZQL 4L5FH 5M7QA 2YXMA 3N17A 1DSFL 2AOSA 4AMCA 1QFWI 3V9FA 2FL5B 3WN5B 3O2VL 3WD0A 3D2UB 3OR7B 3ZIZA 4H2CA 4N0FB 4OZIF 5EOTB 3ILQC 2DQCH 1HH6B 2R29H 1RD6A 1IKFH 4JHZA 2B31A 3HMWL 4N8VG 4J4PC 3TC9A 2BFGA 4K68A 4UV7H 3X14B 1IMHC 3RZCC 4PTTA 4GRLC 1DWGM 3HFMH 1KJMB 3P4LA 1F3JA 3UZEA 4NUJB 4PP2B 1LE9A 3AOFA 3U82B 4HOWA 1ND0B 1ZEAH 1A6ZA 3QIWD 3VXUD 3RNKB 1FH8A 1VEOA 2ICCA 1OTSC 2XSAA 2XPGB 1TITA 1NC2D 4HD9A 4AQ1B 3AXHA 4L8BA 2E27L 4HKJA 2WZEA 1NCBH 5FCUL 5CKGA 1G9NL 3Q5TA 4XP4H 3SDAB 4D72A 3IAPA 2G75B 2YMXL 2D2OA 3MLYL 3O6AA 3S35L 1QRNA 2PN5A 3D0LB 1Q94A 4U1NA 1MNUH 1CVSC 1XZ0A 5DD5L 1NLBL 1CDCA 3MLZL 5FHBL 3IU3A 4DKEH 2YPKA 1M04A 3MRIA 3BQUA 5EB9A 4QXTB 1F02I 2IG2L 3FB5B 4GQQA 2PNDA 3TZVA 2BVEA 2GJJA 5HYQB 2GCYA 1L7TL 4YBHA 3RPIB 4RGOH 4M62H 1PD6A 3D5HA 4L3ED 3S36H 3MXWL 5HI3D 2W65B 4LCIH 1H11A 5JOPD 1H1NA 3MRMB 1VFUA 3GM8A 2R0WH 3RWCB 5EU6B 1YZZA 2HN7B 3RWIA 1UM5L 3EYFA 1ZA3A 1HQRB 5EZOL 4NQDE 3WJLA 4J2XA 1KJVB 1ZLSH 5DURB 3HUJE 2D7TL 4TX8A 3DX4A 3ARDC 4FS0A 1MQ8A 4OM0L 3WHXB 4RSVA 1F58H 1X5ZA 3FFCD 2Z92B 4DN4H 5IV2A 4HFWA 4HWBH 2X2HA 4ZUTA 1QW9A 3VX1A 1R46A 4HLJA 5E7FA 4K9EC 3DLQR 1NH6A 3VSTA 4UFMA 4PJFB 4WVRA 4AYGA 1J87A 3CAFA 3CDFA 4OD2A 5D7JC 1MLCB 2AAAA 1AD9B 2V5RA 2X7LB 3L3GB 3BRDA 3H0TA 5J8OA 3IF1B 2NZ9D 1WPCA 3IDMB 2X9WA 1XGUB 4JFQA 3TIDB 1KLUA 2DD8L 4YHGA 1TFHA 1XH0A 2PYEB 3PXHA 3QUYD 3EFFA 4J3SA 5DRWB 2YD9A 1NGPH 1H0DA 4HK0A 5E08H 5B38B 3JTTB 3H7BB 5CWSA 3GB7A 3CLWA 3SJVE 4DO4A 3OKNA 5IJVB 2QHLA 3TA3D 5CZXC 2G9HB 2V7NB 4NKMA 4Z0BL 4GW1B 2B4CH 4FF5A 4NP4L 1ZHNA 3MLTA 5FGBA 4DEPB 2AQ2A 2HJLB 3QXWA 3UCQA 1W3KA 3QG6A 1ZKAA 4U6YA 1CLYL 3INUL 5KVFL 1KIPB 4KTDH 1ZHBA 5C3LD 4G6AC 3U57A 1QUNA 4O9HH 2ITDA 2QV4A 5FM4A 2EDWA 1F4YL 1HT6A 3HE7A 2H26B 4OCLC 3RZCB 4GRLB 4KKLC 4N5EC 1MI5A 1A7BA 2I60H 3QBTB 1CE1H 3WH7A 1H5BA 5D96C 3U7YH 3ZO0A 2HISA 1FHDA 4B7IA 5DJ0A 4DFIA 2FGLA 5GRWA 4ZUSA 5I1KH 2JJTC 4EOWL 1Z9MA 4UOZA 4N42A 1U30A 4M3JA 4PJXB 1ZVSA 5HD8D 4D0DB 1JAEA 2VCAA 2QPUA 5C0IB 3SGEH 1MCPL 4S3KA 2RHEA 3MRPA 4GG8B 2OYPA 2WV3A 4ZSOB 5GZOD 5IW6B 3QULA 3I02B 2DDXA 5HI5C 3O3AA 4EDWH 3RX7A 5DJAA 3MV9D 4NT6A 3T0AA 2ZXAA 5I71C 5FGCB 2FO1A 3NCJH 3GI8H 4RZCB 1QD0A 2F19L 1I9EA 2AEPL 1JNHB 3UPCA 3AICA 1NC4D 3UTTA 4PTUA 1IGYB 3PZUA 3WV0A 4N0YH 2BRRL 4JB9L 3NTCL 1PIGA 1OAYL 1KPUB 5B21A 2IH1B 2P5EE 3CPLB 1U92A 4BSVB 5L9DH 2A6DB 4MNGB 3MV01 3UTOA 1DBMH 4U1JB 2F15A 1FVEA 5FDYA 2E9JA 3UJTH 4YFEA 1K6AA 5DDHB 2FD6H 3C9NB 3OKOB 4YUEH 2XG5A 1Z9LA 4M6MH 3O6FA 5DEGA 3TJHC 4HIXL 1ZBVA 2DQTH 4PB9L 5JW5B 1D9KC 3N1FC 3WNPA 3ARDB 4KVCH 3EHBC 3DX6B 5CFHA 2D7QA 3I50H 4PJ5B 4EIGB 2FBJH 4S0TD 1BZ7A 4K3DH 4MHHG 3M17B 1T80A 1E4XL 2HKHH 2VLRA 4J3UA 3HZMB 4XZUB 5IVXB 2MHAB 3DO7A 4XC1H 3VFNA 3GBEA 5JNYA 2J7FA 3WQ4A 2ZZUT 4RMTA 4PJ8A 4P7RA 4MB4A 5BMFL 2F7OA 5FYKE 4TSCL 1CL7H 2R1WA 3KPSA 5J57B 2G3MA 3MLUL 2UUDH 1CF8H 1BIIB 1XF1A 5D7JB 1QNSA 5L6YL 4WUKH 4OZ4A 3T3ME 1NLDL 1JHKH 1JN6B 3PQYD 1MQKH 1E4LA 3LZFH 3WL0A 4HXAH 1DQQB 3BP6A 3OZ9H 5JIWA 5LWYL 4POYA 4H0GA 5JIIA 4R26L 1AKJD 4Q74A 4WJ5B 2CBVA 3BUYA 5HGBB 3BLKA 4P4KA 3WDHA 5GGRY 1CGXA 1IKNC 2AXJA 3F12B 1QBLL 3L3HA 3SKJL 5TH2B 2EXOA 5D7LA 4WNQB 2R1XB 5HHPB 5D9PA 4K3EL 3LS4L 2UY6A 1RJZA 4P4RB 1RSFA 2D9CA 1KCRH 1GPOL 2Z91A 5D72L 5F1NA 1QLRB 2XFXA 4NQCE 1YECH 1NWUA 1CYGA 5JMOC 5GJTL 1A4KB 2VISB 4GKLA 5ILTH 4D8PB 2EIBA 3N9KA 2BMKB 2ZCHL 4OZFB 5H2BA 5ETUB 5BQ7B 1IEHA 3P11H 4V1DA 2XTJD 5D96B 2DB8A 3RY4A 3OXSA 4CL7A 1OAQL 1E6OH 2C3VA 2X8RA 1WFUA 5F6HJ 4NRRA 3CDGB 3GIVA 1XIWB 4LSUH 2WVVB 2AJXL 1OCQA 5B8CB 1KF9B 4XNQA 5C0EB 4DGYL 2X70A 4Y5YB 3KEHA 1XH3A 5E0QA 4HG4K 5GNYA 4XPFL 3GNOA 4N0UA 2PBOA 2XWTB 3LRSB 2VX6A 4Y1AA 4GI9A 2ZJSH 2ZOLA 2YD4A 5I71B 2EC9T 3VXRB 3MBED 3CFBA 1M71A 2VKWA 2Y9RT 4GQ9L 4PRBA 3DC0A 1VPOH 1MCDA 4D6DA 2IMMA 2BHUA 1WTLA 1ODAA 1NDMA 4GMSH 5BVPH 2Z4QB 4JFDA 4R3SA 5D93C 4L29A 2XQYG 3F6IA 5J11C 3WMBA 7FABL 3NABL 4M80A 2BP3A 4PRHD 3N9GH 4IMLA 1U93B 4WENB 1E3XA 1LEKA 2QL1A 2YOCA 1KXTB 3SUTA 3VGAC 3VNYA 4KRMB 3SBWC 3GXDA 4IHOA 4DWSD 4EDXA 1D9KB 2MKLC 4Q7NA 5D1XA 3EO1A 3GMLB 3KLDA 5EC2B 3A22A 2ZUTA 3OKEB 1U2HA 4CVZB 3GSRB 4HF5H 1U0QA 2WZHA 5IBTL 2BHZA 2VR9A 1LMKA 2ATPA 5GQBA 1B9ZA 3D18A 3MGTA 3V52L 2NLJA 3VCLB 4KI5C 4Z7VE 3SCVA 1LE9B 4UFKA 1A1MB 3BDXA 1ZK9A 4GBXD 3EYUH 3CXDL 1W3HA 3EZJB 1GGIH 1RFDL 3HPLB 4G9FA 4U1HB 3UJJH 1JHLL 1AGDB 4S0SD 5SV3A 1L6ZA 5ACLA 1G7PB 2ZG2A 3S35X 1CLVA 4L8DB 2BY1A 3SCUA 1Z3GH 1TTFA 3H9HB 1BAGA 1ZTXH 4UZSA 4HUXB 4ZUWA 2H2PC 3G5VB 3BAWA 1Q94B 2Z93B 4MA8L 1MIEH 4Y2OA 5DHYA 5CJXC 4D0BA 4FA8A 3CC1A 2ARJQ 3BQUB 4WDIB 4AMKL 5LAXA 3WLWC 1G9MH 3QRGH 4YQXL 2WBJD 3O6KL 3MROA 1UWGH 3TZVB 3VWKA 1S78C 1J0YA 4FTVA 4JQIL 4WW2F 2EPOA 2UVFA 3QZWA 4YHYB 4QLLA 2X1XR 1DUZA 2D23A 1G5AA 2Y7QA 1J8HA 1FOBA 3O3DB 5SX5K 2DL2A 3B5TA 2BSED 1YQVL 2W92A 4Q7DA 3OXRA 4OZHA 5MENA 1IZKA 4NO2A 1CGWA 5C8JA 2GDUA 3TVMA 3VA2C 5HYIA 1ZA3B 2YR3A 3HZYA 3ULVE 2XN1A 1V3JA 3ULSA 2AEIT 3BRFA 3MV7D 1MXDA 3DOSA 1Z6JT 1E1FA 1W72L 1GVIA 5IMOB 5C09E 3TONA 4XZBA 2IWGA 3X13A 5IW1B 2XZQH 2GUOA 3UCRA 1DVFD 4HFWB 3F5WA 1DSFH 1F45A 3PF2A 3RWHA 5CEXA 3GBML 2EDDA 1JUFA 2JTDA 3O2VH 4MSWA 2KUTA 2XN9A 5EN2A 2ICWI 5CMAA 3REWA 3ARBD 4EI6A 1KGWA 1EZVY 5D6DC 3W24A 1RP9A 2J8FA 3HMWH 5BXFB 2F8XC 1LWRA 5D93B 5FHAL 3V6BR 2YKLL 5C9KA 5ISZE 2XNAA 2Y8KA 4TPRL 3KLLA 3T0BA 1Y18B 5LGHL 5J11B 3V0VB 2V2WA 1W1TA 2HVJB 3FKUS 4GH7B 4PSPA 2NCMA 3VGAB 3KPMB 2J7CA 3QIWA 3VXUA 4EVNA 3FN0L 4CVXA 3QEQD 5HHOE 4NKMB 1NC2A 2ICES 3RVXD 3BPOC 4C56D 1ZHNB 5DQJA 2E27H 4JCLA 2Q8AL 1UYQA 5C07D 2NXYD 5FCUH 1UB6A 1G9NH 1L8NA 4OKVA 2QQKL 4IDLA 5MEQB 2YMXH 4MJIE 2A74A 5ERWB 5K93A 3HE7B 2E4TA 4L4TB 2XHYA 2XWJB 5CG0A 1JI1A 1NLBH 4X8JB 1R5IA 5ID1B 3MLZH 3NFPA 4R4ND 5FHBH 1JZ8A 3IFPB 4HIHB 5IBLC 2CPUA 3AQUA 1QLFB 2DJ4A 2ZUMA 2IG2H 1H5BB 5B22A 1EX0A 4M00A 1MCQA 2A3BA 1E55A 1LP9A 2Z31D 1T83C 5DJ0B 2HRPL 1L7TH 3P0GB 2PR4L 2VZVA 5IMLB 3MXWH 2AS5M 4ZE5A 1V0MA 3TTSA 4MNQB 1UQZA 5C86A 1JF5A 2J7EA 3HS0B 4XXCC 4DW2L 3A6BL 4U3HA 3MRPB 3P0VL 2WHKA 3MUZ1 2DIEA 1UM5H 3U79A 4ZO7A 4HZ8A 3O3AB 5IEKA 3SCOA 4PLJD 5EZOH 4F9PA 4HSQA 1LL6A 4M81A 3SE3A 2D7TH 2W66A 2I26N 3ARZA 4QHMA 2BNJA 4MJ6A 4GKZA 2ZUVA 3O0RL 4OM0H 4RE4A 4D9LL 3ULUL 3FFCA 3MYZA 4AL8L 1MHCA 2VH5L 5D7SL 3KPPB 4F7PA 1JYXA 4LGSB 1UWXH 1KCLA 4PJ7E 2X1IA 4JQXC 2EEDA 4QRRB 2HWZL 5ENWB 2WPGA 3W81A 3FFDA 3MV8D 5HDLA 5TDNB 1UA7A 4G6KH 2XTKA 2XVPA 1NFDA 3O6FB 4NIKB 5IMMA 3DTXB 2CEQA 2V5DA 1MREL 4BA8A 4NXSA 1AGEA 1NKOA 2XM2A 4NZCA 2DD8H 1HH9A 1ZXQA 5JDSA 4UQEA 3MRRA 4Z2LA 4MAYD 5KSAC 3O41A 4YBLC 2X09A 2GK1A 3DO7B 1VFFA 5C08D 1Z9SA 1F00I 4OUUB 5JNYB 1QO3A 2D03L 5TQ2L 2GW5A 1DBAL 3TA3A 3VGHA 5GSRB 1FQ9C 4LDEB 4PP1D 3KPSB 4HS6B 2V5MA 4Z0BH 2G41A 4PRPB 2OK0H 1J10A 4NP4H 1TNMA 1E6QM 5C0JB 2FHBA 2OP4L 3T2NL 3WUWA 3BZ4A 5GPRA 3QAZB 1R8LA 1CLYH 3INUH 4P7LA 2BOCA 1NOFA 4TNWF 4JPIA 3CUHA 4NHCL 3PGCA 4WW2C 3C6LC 4PY8J 1F4YH 4KMTL 3TEUA 3QT2A 1QNOA 1MWAL 1INEL 4RMSA 4M29A 4I3GA 2YD2A 2VN7A 3IJHA 1CBGA 3L3HB 1FP8A 4WW1B 2AEQL 3GSQB 1TA3B 2NY1C 3DMMD 4PMVA 1HQ4A 5DRNA 3FRUB 2EE3A 3BPOB 4ZQKA 4LHJB 3DVGA 1YYML 4PMYA 3WO4C 4EOWH 2DEPA 2XFXB 1OTTC 2ZUQC 2WMPA 4LLVA 1MCPH 2R0LL 2C1OB 2WVTA 3SUUA 1KLGA 1U8KA 5FYJE 1JNDA 1IM3B 3D69A 5AAMA 1MFDL 3B3IA 2DT2A 3MV9A 3VW3H 4PJCF 3KVQA 2VN4A 3N1PC 5DC4B 2F19H 4XBPA 2DT3A 2AEPH 3MOQA 1NC4A 1JDAA 2DT1A 1RJLA 2HLAA 3DX9A 3AVEA 5E00B 1YMHB 2BRRH 4JB9H 3NTCH 1OAYH 3DXAE 1T1ZA 1OIMA 4P2OA 5I66A 2VABA 2NQCA 3S88L 4WLCA 3B4NA 3ESVF 1UR0A 2NZIA 1ED3A 3PWUB 1XH3B 4JFFD 1EEQA 4PGBA 2YUWA 5DEFB 3V6OE 3ULUD 5FOOA 1AH1A 4PBWD 1HJSA 5GS0C 1TQBB 1N26A 2ESVE 5BV7C 4HIXH 4YX2L 2UZYB 4PB9H 4KRUA 4NKOA 1TPXC 5C0BD 5ABFA 4WFFD 5FOBA 2FWOA 5EZLB 2AK4E 3CFBB 3PP4L 5H8DA 5DGQA 5TF1L 2FEDD 3H3KA 4Y5XA 2YL5A 3I6GA 5IFAL 1HSBA 1KGCE 3UP1A 3QXVA 4LGPB 1E4XH 2BVOB 1XF4A 1M7IA 2IUZA 2I5YL 3BVUA 1XT5A 3KYAA 3EUUA 2D3VA 2WZIA 2D9QB 1N5AB 1KTCA 5BMFH 1H5VA 4TSCH 4Z7VF 4WO4A 1INDL 3MLUH 3JWOL 3KYOB 4C83A 1S9VA 3DUUB 2K3TA 5L6YH 4F3FB 1NLDH 3PQYA 3R06B 4FFWC 4K7PY 4F33A 4KQ3L 3DIFB 1T2QL 4XRCA 2Q3AA 1X6NA 4GRWE 2O5YL 3UR7A 1HOCB 1JWSA 2X10A 3EO1B 2NNAB 1QR4A 4KKCD 2R2CA 4M82A 5LWYH 1AKJA 3KPQA 5F72S 4R26H 4D6FA 3N15A 1I4FA 1BQHA 2IQAB 2JK5B 2XKNB 5DZLA 5KSAB 3C2SA 4YBLB 1FGVL 2XXMB 4TULL 4NQDB 1QBLH 3SKJH 3HUJB 5T1DL 3PWPE 4K3EH 3LS4H 3D5OF 3QDGE 3A24A 4HLZH 2CD0A 4DM2A 4L3CA 4J7RA 4HP5A 1GPOH 5D72H 5HI4D 3ARWA 3WUEA 43C9B 3RWEA 2EKSB 1A6AB 2WANA 15C8L 4KROD 3B9VA 5GJTH 1EO5A 4FXGA 3HC3L 1XSIA 3W38A 1P1ZA 3C6LB 4KPHL 5C0CD 3M6DA 3QUXC 1C12A 1K8IA 1KPVB 2ZCHH 3K4AA 2VSDA 4V2BA 5T1KB 3D4YA 3RL1A 4CU8A 2MTPA 1B90A 1BYCA 3ULVF 4P3CL 5J13C 3STLA 3D9AL 1HHIB 1ZT4B 1YPZA 2L0DA 4I0PC 4QGYA 5DZNA 4HC1L 3WNLA 4EIZC 1S7RA 2NY1B 4ZTPL 5AZEL 1OAQH 4OBSA 4K94C 1BAFL 4ZPTA 4U1MA 4NRXB 1EHLL 3K74B 3NA9H 1B3WA 1E28A 5TQ0L 2AJXH 2DRUA 4JGMA 4L1HA 4KJPD 4P8VA 4DGYH 2ZUQB 4DO5A 5T5NF 3V4PL 4XPFH 2EDEA 3SJVB 3VFMA 3WNNA 2HT2D 5LVEA 1E0WA 1WBZB 4HMCA 4MB3A 1Y0LA 1FNEB 1J8HB 2X4TB 2GSIA 3ROOA 3T1FB 3KLAA 4W4NA 3MBEA 3VPLA 3RPMA 3W0WD 2JJSC 3LY6A 4ORGA 4YIQA 5ELIA 4NKQB 5IT2L 4OTXL 4GQ9H 2WC4A 3TVMB 4MB1A 1OARL 5BRQA 4YGVB 1OGTA 5E5RB 3EJTA 3BP4A 1QR1B 2DIBA 4P0DA 3SDCC 3BYYA 2V7HA 4OZGE 3VXPA 1WITA 3O6LL 3LEXB 4PRHA 2OSLA 3NABH 7FABH 5CSUA 3MO4A 4ALAL 2DM7A 2NMSA 4TUOA 1HDMA 2GUOB 3IVKB 1AI1L 3IDJA 2VDOL 1W2KT 3EFDH 3WSQL 4H5SA 4PGDB 5I1JL 4X0VA 4LPVA 3W5MA 5EIVA 4DWSA 4GINA 5CEXB 4OGAD 1KG0A 1TPXB 2BC4A 4MD5A 3PL6D 1KIUA 1QRNE 5J3HD 3GJFK 2XN9B 1IQDB 4PB0L 3RA7L 4R6UA 2YSSA 1MAJA 2DMBA 1X5HA 4H04A 2F8QA 3REWB 3PGFL 4PJIA 5KN5A 1MFUA 1I7TA 5I16B 3NCEB 4BS0A 4A2MA 1W9UA 4H8WL 5K59E 4UCFA 1CT8A 3TBVB 1GOQA 1KQYA 5F7HA 3STZB 5IBTH 4FNTA 5EBWA 4WTXA 5D5MF 1FL3A 2V2WB 2VJXA 4TXEA 3V52H 3BSHA 3PZNA 4OB5L 1T7WA 3ARFC 3GBDA 1JDDA 4TNWK 2DLTA 4GBXA 1FZKA 1BLNA 5FO7A 3CXDH 2ZWLT 1RFDH 3ZR5A 1JHLH 2ERJC 4OIAA 1A5FL 2LAAA 4WJXA 1GQJA 2E8ZA 1ULVA 3TFKC 2CDEB 2C26A 4U6XB 3BH9B 1RP8A 1XSJA 4BM7A 1Q6GA 3VIOA 3MLVL 4JHBA 2XZZA 5I75C 2B5IB 3LRGA 5C70A 4MA8H 1R5IB 3K0WA 2B0SL 4ZXLA 4FQXC 3A0OA 3OKDB 4ODWA 4AMKH 2VX5A 2WBJA 3FTGB 4XAWL 5I2IA 2QLVB 3P9MB 4YQXH 4PJ7F 1YC7A 3O6KH 4UBDD 3QIUC 3CMGA 1JPFA 2B20A 3QG7L 3T2QA 4JFPB 5T33L 3P0YL 5E56A 3LN9A 1HE7A 5BS0D 1PSKH 5A2BA 4YDKL 3SQBA 5E94B 1AGCB 3CJJA 5DS8A 4R7NA 12E8L 3B9KD 1YQVH 5DFVC 5J13B 5EBMA 4NQSB 1IJ9A 4OIFA 5DJXA 1E4WL 3BKML 5DT1L 1HSAA 3ILPB 1CICD 2WWKO 5D4QA 5CEYA 1U58A 1HP4A 1N8ZB 1W72H 1AHWC 5D8JL 5DXWA