1CGUA

Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Catalytic center of cyclodextrin glycosyltransferase derived from X-ray structure analysis combined with site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
total genus 227
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cguA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cguA01
3ZJ7A 5A8QA 3ZLQC 2XN9A 3IDMA 4XI5D 1ZANH 1HCFX 5ICXB 2PETA 1J05A 1TTFA 5DJ8B 1CDHA 2R0ZH 1Q0YH 1QX1A 3WJJA 3MUAA 1F4AA 3CUHA 1K4DB 1KIUA 1R85A 5MEOA 4JHZA 4P2CG 4U6VH 3T3ME 3RL2A 2X4RB 1FYTA 1MHHA 5CIPA 2ICEB 3FOLB 2H8PA 5EC2A 4P9HC 4WKHA 2Q7YA 5JW5A 2P5WE 2I07B 1GZQB 4PRHA 4Q6IB 4PEEA 5I1CL 2F54A 3QFJA 3QIBD 4HT1L 4HPGA 1FVCB 3F7QA 2CJUL 1U8IB 4N0CC 5ERWA 3IF1B 4C4KO 2OQJB 1JNLL 5DC4B 3SEPA 4P3DB 5GIRB 3VGAB 2VC2L 1TJIH 1KIPA 2QADB 3D39B 4QRUB 1F2XK 2I25N 4W84A 4QRRB 3P4OA 1IM9A 2E7HA 4TX6A 4N90E 3PZIA 3G9AB 3V0AC 3DUHA 4EDWH 4X6CB 3CFJA 3HZ3A 4AH2A 4YHNA 1Q0XL 1I1CA 1INDH 1I3GH 1EFXA 4XGZA 2GY7B 4NBZB 3RZCB 3CUPA 3POHA 3ZYZA 3O2VL 1U95A 2ARJA 3FFDA 5E8OB 4X6DA 2V5RA 3HU7A 2A83B 1LMKA 3U2SB 4F7EA 3MUIA 3DRTA 5IBLC 1SEBB 3QI9C 1T2QH 4YBQD 4XC3H 4PMQA 1A22B 3QEGH 4X6EB 3SDDB 4TVUA 3TVMD 1OPGL 1OBAA 2EXYD 5AZ2H 3S96B 4IJ3B 5DJ2B 1MLCA 3WUWG 1YC7A 5F44A 3NSXA 2HA1A 1AGEB 4FQLH 4JRYE 2XY1A 1YPZA 4F57L 1B2WL 2COQA 3U0PB 4FQXA 1HX0A 6FABH 2XRAL 5ITFA 2G3MA 8FABA 1F4YH 2ICWB 3NA9H 4NN7B 2Z1KA 2GK1A 1B3JA 3L3KB 5I9QC 1E70M 4KH2A 5L8LB 4P8XA 1JWSA 4M7KL 2GSJA 3PBGA 1CLYH 3ZTNH 4X7SL 3VXQB 3FQNA 4EDXA 1HSBA 3MBXL 3THML 3UBXA 3O9WC 4P4KB 3WHXA 1WZLA 3O11A 4K8RC 3ULUD 2GUOB 3CZJA 3RDKA 3BWUC 3U0PA 4GRLD 4YHKL 5FYLL 3MV11 4Y4KD 1JFHA 4Z7WB 3MMUA 8FABB 3U4BH 3AMLA 1NBVL 3RWCA 1WAWA 1JYXA 5ELIA 4GZIA 2X8RA 3D85B 4DOHE 2OR9L 4O5LL 4M5ZH 1BG4A 5GJSH 2NLJA 2UVEA 3O6FB 1GQIA 3DURB 2WIMA 1CGXA 5F70A 2NY3B 3RAJL 5DJAB 4C58B 2FYYB 2C7UA 4J7RA 2VZTA 5D7IF 1J11A 1VKXA 4U1MB 4M4RA 1NP0A 2DMBA 4QYOA 1TZ7A 2V5CA 3MLUH 4CRPA 3CFDA 1J8HE 4ZENA 2ZKHH 1Z5LA 1AGEA 1IAOA 2IGFL 3H9SE 3MJ7B 3V7AE 2YC1A 5I66B 3GIZH 2WPGA 1DVFD 5JZ7C 1JE6A 3H9SD 5F9WC 3LKNA 3EJZD 1NGQH 3MC0A 1JXJA 5DHVH 2N4IA 5F7DA 5D8WA 2FEEI 2FHFA 1DFBH 1VFAA 1WBXA 1E4JA 1GPOL 2J7LA 3LV3A 4M6AA 4YXLL 3GXMA 3QIUD 4IBLT 4JFPB 2XPGB 4OFYD 2ICES 5DRWA 3TNMA 2VISB 3G04A 4PPTA 2Y25A 3HNSH 4P5KB 3MJ9H 4M8UA 4Y8AA 3L9RA 1C5DB 2VL4A 4K2UL 4G6FB 3WDHA 1WICA 3SKMB 4H1LH 3DSNA 5I66A 2PYEE 3BYTA 3MRRB 2XYLA 2OSYA 2LABA 4J4PD 1CE6B 1V3IA 5F72S 3HRZB 4JANB 3MFFA 3O6KH 4PRAB 2VDQL 4QTIL 3V0WL 4HGKC 1RMFL 1JD7A 2L7JA 1K5NB 4K71B 3AS0A 4HZ8A 1IKNC 1E6RA 3L7FB 3EYUH 3BKJL 3QDGA 2OL3B 1XD1A 1H8SA 5IVOA 2Q7NA 3S4SA 3W25A 4ZDHA 1A9EB 3PNWA 3MBEC 5E9DD 3I50L 2X5PA 4OCRL 2Y6SD 3O6FC 1CFNB 1NCBH 4XNYH 4FQCH 4J12A 2CMRH 4UR9A 3BN3B 3NIGF 3KDMA 3X12A 2WWCA 1YUHB 2GK2A 1ONQA 2AXGA 2Q76B 1Z5LB 4KK9C 1FZJB 5IBTH 3LRKA 3GI8L 4Y16A 4LCUB 2CXKA 4JKLA 1N59B 4JDTL 3BHBB 1RZ8A 4H2CA 1MCQA 4OFDA 4HS3A 2OWWA 5C0CB 5EZOH 4O51B 4HZLA 3OLEA 4U1KB 2EIBA 2VJXA 2DT1A 2VDMH 2QSVA 3JZ7A 5ICYB 3DYPA 2AJSL 5A6JA 5D7KE 4LSSL 5J4MA 1SY6A 1NEUA 1CGVA 1QSEA 3MRQB 4KK6C 3VINA 2E6JA 3ULVE 4YFLF 1A14H 2Y36L 3MLSH 3QO0B 4XMKH 3GMPA 3GDBA 3WD4A 2VC9A 5KW9L 4PMVA 1WIUA 4Z8FL 3ARWA 1RJLA 5I8OL 2DM7A 4ZFOB 4N0UB 1HYRC 1Q6DA 4LEXH 3U7WL 3EDDA 1ZSDB 4I3RL 1TENA 2NNAA 5A2AA 2CR6A 2L0DA 2E7BA 2MJWA 3FN0L 1IGIH 5DZLA 3TNNA 3W39A 4ZO7A 4OF6A 5I0DA 3SJVE 3O3AA 5C08B 4G8EA 1AXSA 2W9DH 2UWEE 4YPGB 4PRIA 1RD6A 5DHVB 3RWJB 4W70A 4G8GA 4WFHD 4OQ1A 4XCCL 1W9UA 1AQ0A 4UFKA 5KS9A 3MGTB 5T1KA 3DC0A 1IQDB 1IC7L 2GCYA 3LB6D 4DO5A 1KB5L 2WCAA 3VPLA 3AMCA 5H2BA 2HKHL 4EI6A 4HUWB 2EZ0C 3PWLA 2UY7A 5C07B 3RTQD 3TA3B 1DBBH 5I73C 2A3CA 3LEVL 1FJ1A 4LLQB 3RI5K 2ZSWB 5J06A 3OAYK 6TAAA 1GGUA 3L3DB 5EU5B 4P59H 2JKXA 3RDTA 2MQ3A 5C0BD 1Y18B 4KKBD 2WMPA 5DFVD 1GW1A 2V3GA 2G60H 1HOCB 5TQ2L 1UEYA 3KJ4B 1HWGB 4Q2ZB 3Q3GA 3MRHB 1HILA 4OCYH 2VWEE 4EUPB 1LDPL 1I9RH 4G9DB 4YBLC 5TDPB 4NIKB 5IFTA 1K6QL 3QXAA 4N8CH 4TNWF 3WUEA 3BI9X 5I1KH 3MV9B 4GXUN 4MVBD 2A77H 5I1CH 1BFSA 2EIZB 5DSCB 4YBLB 5MERB 3P9WB 1IE5A 1MWAA 5HYJB 3QDME 1E4XL 2FR4B 1J9YA 3D2UA 1F6FB 2D7QA 1G9MC 3HZKA 5C0ND 5MEQB 1PVHA 2R2HB 4XNXL 1CENA 3TH3T 5DS8B 1G94A 3BQUA 4ODBD 4FXKB 2APWA 4Y4HB 3WL1A 1ED3B 4NKOA 4S0TD 1B30A 5BV7C 1QLFB 2RGSA 2VXUL 1IT9H 1KLUB 5D9SB 2HFFA 2YA2A 4ZQKA 1K9FA 3U36A 3IFPB 2O9RA 1UKTA 3T2NH 1HIML 4PTVA 1T03H 4HC1L 4R27A 1S9WA 1VA9A 3O2VH 4QRQB 5D9NA 2D7NA 3B9KD 1T89A 3U6RB 1KEGL 1CFSA 4H8VA 4UB0L 1CBVL 2DH2A 2WNWA 4HUVA 4U6HA 3PWLB 5F3BB 4JGJA 4Y16C 5DS8A 3SGDI 3OKLA 3MMWA 1LP9A 5D96B 4WLCA 2R1XA 3VGGA 2XIIA 2V2WA 3MCG1 5FB8B 3CC1A 1I8MA 4JFFB 3BLPX 1JK8A 4L4PA 2W60B 2DYPA 4I8DA 1JCKA 4YHIB 2BNQB 3IU4L 5MEND 4XBGA 3AM8A 3LRSA 3TWCH 4MDOA 2EXWC 4XPHH 5DR5H 3HAEH 1AC6A 4NOFA 2CEQA 5EUKB 1KCUL 3V4PL 3MRHA 1G0XA 2X1PA 4CL7A 5JMRA 5ABGA 4OD2B 3TVMC 4EQ2A 3A22A 2XKNB 3D0LB 1RFDH 5KANG 5DGRA 4MJ6B 3REWA 5GJTH 5JW4N 1MHHB 2OJZL 2EXYC 5E6ID 3NCBB 1BJMA 3IJYB 3KPPB 4XPTL 5DI8B 5DEGB 1TMQA 5HI4C 1W9BM 5IR1A 2AEWA 1D5BA 3LRSB 2F7RA 3T65A 1FO0H 3BDYL 2E9MA 1CTOA 5FGCE 3LS5L 1YJDC 4RAUB 2EDKA 2OCFD 2ZCHH 1BECA 2PF6A 4HCRH 3VDBA 3RVWC 2EICA 4EK7A 3EJTA 5EC1A 3EYOA 1ZEAL 5F1NA 3BWAA 3WEXB 2P8LB 5GGTA 4RISL 2IFGA 1OINA 2VCBA 4HAGA 2E27L 5DQ9B 1DANT 1HSAB 5IESL 1H3WM 2IBGA 3ELAT 3LCYA 5DJ8A 1PSKL 5C0BB 2FWOA 2VQUA 3RJDA 3GXNA 3CX5J 3OKLB 3HNVH 2RGLA 3BW9A 3LKOB 3PQYE 4UQ2B 5I16B 1GNXA 5F1SA 5IVZA 3WMCA 3HG1D 1KC5L 3AVEA 2XFXA 5CZVL 3JTSA 3FRUB 1G7HA 3U2SA 2NX5A 1CICC 3D9AH 3S5LB 3CH1A 4M81A 1A5FH 1MEXL 2BS9A 3C2AL 2R39A 4LSVL 2GFBA 4RX4A 3FFCE 5FYJH 1G7MA 4MJIB 4AZCA 5EH1A 1CLOH 2R2BA 5KVGH 4DKFL 3W6LA 3KPLA 5GIRA 3ECBB 3Q5YA 4ZS6D 1CD1A 4OZIA 1TZGL 3HE6D 4OD2A 1V05A 2X4UB 1NFKA 4FNPA 4QXGH 1W9VA 1ITBB 2OX5A 3V6ZA 4D9QE 1OAQH 1QFWL 1W3KA 4UBDD 3RFZC 4HIXL 3D3VA 5GSVB 3CZFB 1E6OL 4WW1B 2ZX7A 1AGFB 5KVFL 4EXPX 2AK1L 5DTFB 1D5IL 2DQTL 2EH8H 4X7EC 5CLTA 1DLHB 3MODH 4OCWH 1HXJA 1KB3A 3D69B 3RVVC 4AIEA 1R3HA 1XCTB 5EORH 4X4YA 4D0CA 1ZLWK 4PJXF 1EEYB 4I4WB 2GJ6B 4U5KA 2VLLB 5LA0A 2VE6B 4E2OA 2IALA 2VZOA 5A8NA 1HZHH 3SCWA 4TNVF 2V9TA 4B3KA 3OMZA 2XWBA 3VW3L 4JY6B 4B9ZA 1AQHA 5AAWA 1ACZA 5HI3C 4JPIB 2ZG2A 2FSEA 4F2MB 3BW9B 2BOBA 1T20A 3ARZA 4MTVA 2WNGA 5F7WC 4ODXA 3VFWB 1WTGT 1B1YA 1T1ZB 2P42B 3VIOA 4MCYB 4PJ8A 5ICXA 1F4WL 4X0KA 5IJVB 4L8BA 3R4DA 1H11A 4BM7A 2HISA 4X6BA 3IRZA 2G9HA 1MYRA 4RNRB 4XPGH 2BNRE 4N0UE 3VA2C 2VDML 3CLWA 2EPMX 3UEQA 3MV7A 3QUYA 3TA3D 4XCNB 2EDBA 1NLBH 5E6IB 5ISZB 2FD6L 2JEPA 4KFZC 1KJ2B 1F42A 3UJIL 4BFEA 3W4RA 1VFBB 2Y36H 4B16A 4N8VA 2IF7A 3AC0A 1OSPL 3ESVF 4I3SL 1R5IB 4HT1H 1U42A 3IJSA 3SE9H 1ISVA 3O3DB 3LEXA 2W0FA 4KWUA 1H3PL 4OLYH 2XN9D 4E0RA 5I8OH 2QPUA 3TBVA 3F5KA 1FNSH 5A2IH 2D20A 3O81A 5DRZB 1RZFL 1AH1A 4LEXL 3GNOA 2KZ1B 4QLKA 3DURA 4I3RH 3FN0H 3MLZL 3CH9A 1REIA 4HEME 4JY5L 4MNGA 4NC2B 1LQSR 2XSBA 1DBJL 3WSQH 1JPFB 1J1XH 5FYKE 4HUXA 3C6LA 1FAIL 1ZT7B 4WKAA 4JFTA 4QYOB 3RWDA 2Q3ZA 2BP3A 5I75C 2OMBA 1KPRA 1WEJH 1NDGB 4NQTA 3FJTA 2IQ9H 2D9QB 4X6CA 1IGTA 5HYQB 2YEZB 2Z8WC 4NWUH 4XVUC 2OYLA 1UKPA 5D9MA 2P46B 5F7YC 1W1TA 2LV4A 3OTTA 5HYSG 1ZHBB 1Q9KA 4ELMB 1NJ9B 3HE6C 3LV3B 1NCAL 1RVFL 4TVPD 1GQJA 4F7CB 4R2GB 1QG3A 3OKYA 3QQNA 1UACL 2N7BA 4FFWD 2Q86B 1OPGH 3GSNL 1KB5B 1V7NL 5KSAB 2XWJB 1KT2B 1LJYA 5A3ID 2WCSA 3MNZA 3LMJH 1JN6B 2JIWA 3UG4A 1IEAB 4QF1A 4Z76B 4FQXB 5KZCD 4JAMB 3QNXA 2NY5H 1I1XA 2I5YH 5TE4L 2GJ6D 2XRAH 4WHTA 2ZCLH 3L3GA 3G5ZA 1MFDL 4M62L 1FG2A 1G9NC 1XH0A 5ECJE 3KL5A 3CV5A 1XGUA 3U9UB 2OL3A 2YPLB 1A7OL 5F8QC 5FYJE 3UJJL 1PBYA 4AM0B 4PJFA 4K8RL 5JIPA 3BH8B 3MV9E 3ZTNL 1OD8A 1XYZA 1MCJA 3ET9F 3FB6A 3ESUF 4J3TA 5ETUB 2A83A 2F58H 4YUEL 1JZ7A 4C56D 1WC7A 3WIIH 1YDPA 2IFFL 1L0PA 5K9QI 1J1PH 2NPLX 1XGQA 3FMGL 1KV3A 2FLBT 2WUCH 4Z7WA 1H3VA 3IFNL 2JB5L 2OW7A 3RJQB 4TVSa 5CFHA 3VWKA 3K0WA 3JBG7 4GXUM 5EZJB 3U4BL 3SCMA 4JZOB 2EE6A 1HIMH 1MIMH 4PRIB 1T5XB 3MUGB 1ES0A 4HC1H 1N4XH 2HT3C 1NOUA 3OSKA 2AJXL 3FQUB 3OBAA 4M5ZL 1HWWA 2AV1B 3QAZC 5GJSL 1C16B 4OZGB 4QWWC 3RMEA 4AT6B 1O7AA 4P9HL 1OGAA 3HMXH 3ALPA 4XNMB 1WC7B 3BVWA 3A6CL 2GDVA 3BE1H 5E2WL 4LYPA 3WH5A 1YECL 1IGJA 5IXEA 5FFLA 1QQDA 3MLVH 1KBKA 4JFDE 1WJ3A 1PEZA 3BUYA 3LN5B 4ZPTB 3WQ5A 4RAHA 4UTAH 4LDLB 4NCC2 1QSZA 4NZTL 4YDLC 1HSBB 3QUXC 3IDYC 1G9ML 4HFWB 2ADJB 5D7JA 2EDEA 4H1LA 5BXPA 4Z0BH 3RWGB 5FGBC 4HK3J 3TNNB 4I18A 4P2OA 2QQLH 3MA7A 4K94L 4YZFE 5T1DL 3QXVA 3NPSB 2H26B 3HA0A 1FGNH 1EPFA 1RHHA 2D7TL 4EZMA 4HDIA 3ARDC 5D70L 1A4JA 5C08A 2XA3A 4HA3A 4Y5YC 1YY9D 4L5FH 3VFPA 4KQ4H 3EOTH 5DFWH 2V3DA 3LN9A 4K2UH 1WIOA 2XXCB 5A8PA 4GS7B 2X2YA 2ZCHL 5ETUA 3WSUA 4HCRL 3AY4C 3MRKA 4JCLA 4X98B 2PC8A 3RWGA 5FYJU 3GH7A 4LYRA 1CT8A 2PWGA 3P0VL 3LXBA 4HZ6A 4FXGB 2VDQH 3SCMB 3F12A 3HZMB 4QTIH 1O7VA 3V0WH 5FKYA 3E6HA 4IM8A 2F9BT 3RVTC 4AZ5A 3ULUF 1D5MB 1S5IL 2WBJA 4JHWL 5ESAA 4XCFL 1XGRA 3BGFC 5C0AA 1Q4NX 1ZU8A 2BY2A 2WMHA 3LXCA 2NY6B 3Q48A 4ORGA 4LSQH 5JA9A 2HH0H 4KVNH 5EU6E 4ZAKC 1C92A 2WZHA 3RHWF 1MCPL 3NPSC 4S10A 2XPKA 3ZIZA 2M8XA 4UDTA 1R33A 4Y7MA 1GC1L 5J11B 2EPKX 3GNML 1H0DB 4LQFL 1FZJA 4H88L 1QFUL 1JK8B 2EYSA 5B8CA 3G04B 5I24A 3X12B 5INDA 2QQKL 3DXAD 2EIZA 3OG2A 5C0DA 1TCMA 4XCEA 2CBJA 3VDCA 3AAZB 1FGVH 4P46C 4FMFA 5K93A 4PCSA 3ARBA 4MAYB 2J3SA 4FXKA 4NO2A 5LVEA 2VXSH 4OF3A 2W5FA 1U3YA 1E0OB 5MEQA 2F2HA 3RUGB 1S8DB 3T1FA 3DX0A 1FIGH 4D94A 1EBPA 5FOJA 2DKMA 3MRIA 1PIGA 1QSEB 4W7UA 4RQQA 3U36B 3RVUC 1E4WL 5K59F 1MH5B 1E6JH 2VN4A 3HMWH 4CD5A 5D9SA 3CVHB 1XSIA 5KTEL 3P73B 2F53B 4ZS6C 2DQCH 2YN3A 4K3JH 2HRPL 2J6EH 1YN6B 1D5IH 1CFSB 5IB2A 1C8XA 3OAYH 1X3DA 4BYHA 4HWBL 4DK3A 5ALBL 4X5WA 5EIVA 3SKNB 3V5KA 1CDBA 3HLAB 4PG9A 1ZJAA 4XPAH 1QEWB 4KROD 4MJ5A 4QRSA 4NQEB 3O6AA 2MCG1 3WH9A 1XIWD 3OG4B 2Y4SA 3EIFA 3KR3L 4OZGF 1RZGA 5F7HA 1FQ9C 1G7PB 1BVLB 2VABA 5FKPB 5D4QA 4G7YH 1KN4L 1YMHA 1QNPA 3G08B 1S7TB 4NHUA 4CCEA 4WW2A 4OZFH 3UC0H 4MNGE 1GGCH 4HS8L 3GMQB 5HNNA 2FWOB 2Y8KA 3OKNA 4ATDA 4UDTB 1BLNA 3VXUB 1IC7H 4AD3A 4U1IB 4PN2A 5DD5L 1ZLSL 4NQED 1N3NB 4JEGB 3MR9B 3T08A 1A6AB 4EI6B 1JPSH 4WFFE 4MD4B 4WUKH 2ZSWA 3UESA 3LEVH 3A6BL 3UG3A 4K3EH 4XV0A 3DROB 1H41A 5DEZA 4D6EA 1E4XI 5KSAC 3QI9B 4PY7B 1BBDL 2W91A 4PD4J 4LP4A 4XVSH 5I19L 1G7MB 1R3JA 5KSBF 5HHMD 1NMBL 5C9JA 1CLCA 3BKMH 1YHTA 4N0UA 1RPKA 4NO2B 3U0TA 4PMYA 4GI9A 3MLTA 3VXTA 3WFZA 4C56E 3ABZA 1BVKA 4HC1A 3N1FC 3RTQA 3IDIB 4JM4L 5HVWA 3AREA 2WMIA 1VADB 4OD1H 4P46D 3GKWL 1W3LA 2IPKB 4ISVA 3BQUC 1S9YA 5I1IH 1WFNA 1JV5A 2NW2B 2OTUA 4JM2D 2QKIA 2NY6D 1AGDB 3WHE0 1FNSL 4JL1A 1A6WH 1LE5B 1YY8B 5EBMB 3U5UA 2DQDH 4FQ2L 5C9JB 4TULH 1GGIL 1MNUH 5FO8A 3WELA 1HQ4B 1E43A 3RGVC 3MNWB 1NKRA 4Y5VA 1AE6H 1JGLH 5EBLA 3QHMA 3WKZA 2E3VA 4AL8H 3ARFC 1OTSC 1FA2A 2VXUH 2HFFB 5E6ZA 3MYZA 3SUUA 1UM4L 3JTTB 2XGIA 1U3ZA 4Z7UF 5HOSA 1LO5A 4DTGL 3KYNB 3HG2A 3L1OL 4Q9BA 2J74A 3PTMA 1IQWL 5ACZB 5IGXH 4DVBA 3DIFB 1QBLH 1VEOA 4TVPE 2NR6C 5TPWH 4K23L 4YBQC 3MR9A 2EBNA 1DZBA 4Z7UE 4LF3A 5E1AA 3OWEA 4PRDA 1U3JA 3SGDH 1BZ9B 2GW5A 4WEMB 5E9DB 3TZVB 4UV7H 3QUZA 3E6FB 3G6MA 5C6PB 3E8UL 1JWMB 1LP9B 3G6JB 3VD5A 5LWYH 4IM4A 3G5VA 1IZKA 3UZVB 4HPYL 2P48B 2APXA 4JFFA 4TRPL 1HJSA 4ODUA 1CLXA 1UUQA 1N0XH 1J5OL 3IU3B 3W2DH 1DN0A 4CADB 4DGIH 4EIGB 2ICWJ 5DD1H 3HI1B 1NC2A 2F8VA 5DTFA 4TVDA 2R8SH 4BK4A 5AZEH 4I5BA 1JNLH 5DMJB 1QBML 5DUBB 3D39A 3MRPA 4LNVA 4KZDL 1C5BL 4I4WA 5TH2B 4WV1B 2I27N 3IDMB 4C7DA 4Q9CA 1OM3H 4G8FB 2FX9L 3NPZB 2WWKO 4R3SA 3KVQA 1R87A 4AK1A 3CUPB 3ULVH 1HKIA 1UB6B 1F3DH 1TTUA 1FNEA 2F8XC 3T65B 2R1XB 1J1PL 1RZJH 5CIPB 4QLRA 3CZLA 5F9DC 4X80H 2FDMA 4NSKA 4GRWE 4P2OD 2RCSL 5CS7A 1LO5B 3HE6A 5D2NC 4UNIA 1MWAL 1YYMH 4HQQH 1U8MA 1TFVA 1OT2A 5CZXD 4FTVE 2E27H 1HF6A 1DQJB 2H2PD 1L0XA 2PWEA 1G7JA 1RI8A 4FFVC 4G7VH 5CSUA 2NZIA 5EFFA 3RWDB 4I3GA 2QTEA 4U4BA 9CGTA 4HU0A 2EECA 5B3JF 5D7LB 3KXFA 4BQ9A 4PP2B 4R5EA 4MAZA 3QUYC 3WBAA 3BLBA 2A6JB 4HIHA 1AQDA 4P9HH 1Q6FA 3MBEA 4Q9RH 3WQ6A 3T4YB 1EAPB 4XNUH 4AZBA 3BSZL 3QUZB 5ANME 2XFXB 5HHVH 2AW2A 4Z2LA 1FYTE 3KPTA 4X4XB 1C1EH 1MJ8L 1HJVA 2W0FB 5GPRA 1KSRA 4QXTA 3TTSA 1UA6L 1CFTA 3I6LD 4G6JL 2CCRA 3QBTB 2GFBB 1UD2A 1MY5A 1OTTC 1A3HA 1PJ9A 4M7KH 4L8DA 2WINA 4PUDA 1DUZB 5INCB 3SQBA 2Q8AL 1K8IA 1FP5A 1E9LA 3BZ4B 4CCCA 4OUUB 1JPFA 4PRBA 3FT2A 4L4TA 3SOBL 1K3IA 1TLKA 1FGNL 4BZ1L 1E0WA 4WU5A 2ICEA 4LLYA 2J8GA 4OZ4A 4W4OC 1UVQA 2NQCA 4JKMA 2Y72A 2LQRA 3WKML 3O3BA 3MSDA 5E1HB 5D6DC 3HZVB 4FNSA 2J4GA 3LKSB 3VXPB 4OZHA 4O5LH 4ZFGH 5GGVH 1IGMH 1NWRA 3QGVA 2DMCA 1R3KB 5ITFB 1CR9H 3VWJB 3QHNA 3OZOA 1MAJA 3BFOA 5E8EA 2GHWB 1FLTX 4PLOB 3EW3B 4PJXA 1WWAX 4GRLA 2YWZA 1VDGA 1NWTA 1B3VA 3ARVA 3NCOA 4M00A 5CBAB 4Q6IC 1P9MA 3FFCD 1KPVB 2HJLB 2A6JA 4HIHB 4MCZA 2ZKHL 2VZ3A 2J25A 4W68A 4QHKI 4IRJB 3LZFH 3TVMB 1T20B 3U83A 3ZMRA 3OG6B 1GC1H 4ZO9A 4KY1H 2I9TA 1R3IL 3WQ8A 1A3LH 3STLB 1BG9A 1X7QA 3CSPA 2PNDA 4Q6IA 1Y0LA 2BXZA 2NSXA 2OSXA 3K2MC 5JXED 4DWSC 3NIFE 3QEUB 3N0PB 3NIYA 3K8KA 3MUZ1 4JG1H 1KG0B 2ADJA 2X9WA 4XVJH 4D0CB 2G9HB 4OKVA 1NFDA 4Y7EA 4UQBA 1XF3A 5CMAB 2VURA 5CSGA 1XCQA 3JV4A 1E4WH 2XNAA 3GB7B 4QRUA 3IAPA 4HK0B 2DLTA 3V4VL 3WN5C 4POUB 3CIVA 3UTSE 1INEL 3DYOA 4UFLA 1RMFH 1MFNA 3QCTH 4PJGF 1GOFA 3KLKA 1ADQA 2W38A 5IOPB 5CUSH 4S1QH 5C07E 5CPTA 4F7MB 4GMSH 3MRGA 2ARJB 3FFDB 1C90A 4LLVB 2FE0A 3IAQA 3QJFA 2FSEB 4F2MA 3MJ6A 3CBWA 2AV1A 3EOBA 2P5EB 1RK0A 3DETD 5F1KC 3KLHC 4MD5A 3DX4A 4ZXOA 1P53A 2NZ9C 4ZE5A 3IXAA 4JZJC 3W37A 2E9JA 2ZUYA 1WBXB 5D93B 5FHAL 3WN5B 1R3KA 5C3LD 2QHAA 2W61A 2WWDA 3CHDA 4YDVB 4LPCA 3RIFK 1KN4H 2UWEA 4PJXB 1T66D 5B8CC 3W53A 1A3QA 4DN4H 1T22A 2ADIB 1NWSA 5ESAB 5C0AB 4BA0A 3QR3A 1ZS8A 3VMPA 1T21A 1IMHC 2YEZA 2YD3A 2PR4H 1EHAA 5GZNC 1KGWA 5JORB 1NDGA 2ED7A 4NQEE 2XKSA 3I6GB 2NLJB 2R0ZL 3AYSA 4WJXA 4DUWA 4PJEA 5LGJB 1ISXA 3AY4A 4Y5XA 5SWSE 3GMOB 5I1JH 2I9TB 3ZDYE 4LPXA 1F3JB 1NCAH 1RVFH 3BOVA 5E8DH 3BZFA 4BFIB 1AD9A 1UACH 1FHLA 1ZE3C 1AD0B 1A0QH 4P2RA 4YHYB 4XVSL 4XXCA 5I19H 2IH1A 1CFQB 1WF5A 4L3EA 3QEHA 4KVCH 1OAKH 4GLRH 1ZS8B 3FQNB 4EDXB 3LMJL 4DEPC 4NQCD 1IV8A 5IK3B 2BVUA 3UTPE 1P5VA 1IT0A 5B39G 1LO2H 1NFIA 3MXVH 2YZ8A 3MRKB 1PLGH 1IJ9A 4OF5A 5SWZD 3TYFB 2GSGB 5BV7H 5D8ZA 2X4NA 3RWCB 4K7PX 1LK3H 4OD1L 5BVJB 5C0EA 4YE4H 2DWDA 3BUBA 3D85A 3IJHB 3SJVD 4HWEH 1WBZB 2YFNA 4FQ2H 4ZS7L 1MFEH 4XPBL 1CZ8H 2H45A 1T7VA 4X5WB 2YBRA 3WIIL 4GKSA 1NFIB 1KCSL 2NY3C 4JFYB 2VX4A 4NJAL 1I3RB 3VNYA 2J47A 1A7PL 4YFEA 2F1BA 1T21B 3ZE0E 3VIHA 4WWKC 2W67A 5L8KB 1TUXA 1W2KT 4QNPE 3I6LE 5EA0L 1QSFE 3T3PF 2YC1B 1PS3A 5EU7C 1KEML 1YEEH 3V0VB 4UT6H 3MO1A 4QOKA 2I9LB 5FYKH 4OCYL 1NMAH 4R97C 4RL3A 2VKWA 1NARA 3QA3A 5B3NA 3NAAH 1K9EA 2J7HA 3VXMD 3A67L 4FLRA 5D7LD 4HUUB 4UTAL 1JIBA 4JKKA 4DGIL 4NRYA 3D5HA 3TA9A 1P6FA 4QHMA 3D2UB 1QI4A 1U0QA 1LG1A 4MGXA 4URIA 1FV1B 4H1LG 5F96L 1U93A 5KAQG 4MAUH 3L4XA 2O9OA 2CGRH 4OGZA 1OCWH 1T2JA 5E6IC 4Z0BL 3HG5A 4ZSOA 3VFRA 3S34H 1C5BH 3BAJA 1BVLA 2VABB 5FKPA 3G6DL 1S7UB 2EPNA 1RUQH 5FDWA 4UTFA 1BOGB 1RULH 4LRNH 4CD4A 2WIIA 3BSGA 3V2AR 1IAMA 4KK8C 5MHSD 1A9EA 3CU7A 3PNWB 4MA8L 1XMWA 1A6UL 3SY0B 1NBVH 2XZQL 3B43A 5E5MB 5EDXA 4UQ3B 5GGUA 2A74A 1U93B 2OSWA 3RDTC 4PRID 4EUPA 2DOCA 3MV8E 1ZB5A 3UERA 1CBVH 2WWKT 3DX1A 4PJGB 3F8UB 1LO3L 1QYGL 3AQUA 2VDOL 3MRJB 4R4BB 1G9HA 3LRHA 3KPSD 2IBZY 5FDWB 2DIBA 2VLKB 3BP7A 5DSCA 3VX1A 1FZKB 3QHFH 4ZUSA 5EIQA 1QOKA 1JUFA 3H9SB 5DVMA 1TZHB 2FATH 2ZXDA 1BZ7B 2G75B 5BV7B 1MY7A 3GBDA 2VDRL 4JE4B 5CWSB 1D9KA 3DIFA 2DDQL 4P0DA 4ORGB 4EN3C 5I2IA 1I8LC 4Q9RL 2AXJA 3ALXA 1L6ZA 1LWRA 3WD5L 3RBSA 2J5LC 4Z7NE 2E5EA 1I1AC 4IMLA 5IIEB 1ZGLM 3DGGA 1J10A 4LCWD 1KNOA 3BX7C 4BA8A 4FLSA 2VXTH 4TOYH 1UZ6F 2IAND 4E41D 1WQVT 4JHOA 1K8DA 4LU5L 2QQKH 4YXLH 4KMTH 4PRPD 4G6JH 1U6AH 4IHOA 4PFEA 5C0CE 5MI0C 4XPTH 2BVOA 1I9IL 4MNQA 4F7TB 2PYEB 4QHLB 4XCEB 3CO4A 1YPZE 4NZUH 1ZMYA 4JRYA 1A6TA 3MRCB 3MNVA 2DM4A 1MQRA 4OB5L 2AXHA 4KAQH 5GGTH 4PGJA 3RVXD 1HI6B 1PBGA 1PYWA 4PY8I 4BZ1H 1B88A 1HH9B 1WDRA 1B6UA 1BFNA 2FZ3B 5KVDL 4NT6B 3WYRA 1HSAA 1F90H 3AIBA 2D4FA 2B2XH 4KI5F 4YPGA 4BH8B 2B7DT 4XP9H 2E9IA 4M80A 2G41A 3TBSB 4HLJA 4ETQA 1U8LB 3R06B 3HRPA 4XZUA 4G3YL 3K4ZA 1JHLH 1IQDA 5F7NC 4BZYA 3BJ91 1T1WB 1G7IA 3EYUL 1FCCA 4POZD 1WCQA 5BXSA 1YMMA 2W65B 4JKWA 5JR1L 5F7EH 5MEPB 5TQ0L 2QLVB 5ACLA 43C9A 5KVMC 3O2WL 2QMKA 4PJDB 43CAA 1H3UA 3KR3H 1W1VA 2PF0A 4OCRH 3AHXA 1S7QB 2GJJA 2W4XA 5J12B 4WFED 2CK2A 2VLRE 3HAEA 3B9KB 5T5NF 2Z8SA 4JKPH 2APTA 4HKXA 4RWYL 1WVZA 3K2UH 3P2TA 3ZDXF 1GGCL 4LSVH 1Y18A 2ZG1A 4JM2B 1A3RH 4JHBA 1R5WB 1D9KB 3GMQA 3EJRA 3THCA 3O8XA 4MA1B 1R3LB 4QXGL 2BXYA 5FYKU 3VXUA 1MW1A 4S1DD 2L7UA 1E4MM 1RZJC 3S5YA 4PJEF 3CFEA 3QO1A 4PJHB 1NGYA 2DYPB 2A2QT 3O8XD 5D2NE 2F7PA 3DROA 4L3AA 1MPAH 2YL6A 3CCHA 1WLHA 4MNQB 4WTXA 1DLHA 2D22A 3DV6A 3D5OF 3HE7B 4LASL 4OGXH 4P46A 4PBXA 5F6IB 5CIPH 1A1MB 4H26A 2F74B 4CW1B 4ZMAT 2EACA 4B7LA 2XN9E 4WEBH 4WUUB 1YN7A 4G6MH 5DWUL 3QO1B 4PJHA 1JDAA 4M56A 5I1IL 5FXCH 2F54D 3QFJD 3QIBA 4OZFG 3BCFA 1X1NA 4S3KA 4F9DA 3QXDA 4OZHE 1J05B 3PWPE 3B8SA 1MUJA 4RMVA 3ZT6A 3CSGA 2QSCL 4Z95L 4MB3A 5SWSB 3CFCL 4ZFZB 1JF1B 3IK2A 4KKNA 5LGKA 3EO0A 3WENA 3SE3A 2Z31D 4YR6A 1L0YA 3ILPB 3S37L 2BY0A 2QADD 3C60D 1FFPB 3SGJC 3S8WA 3FQWB 3QIUB 5IGXL 4Y16D 1MFUA 4DM2A 3TZVC 1EZVY 1QNRA 1HKKA 2VDLL 3HKFA 2G60L 3H42H 5TQ2H 1BZ9A 2IADB 3GSQA 4KTDH 3HUJA 1NWUA 4W8LA 3IDIA 1KYOJ 2A38A 1OSZB 1NEZG 3DX9B 3NIDE 4U3HA 4GAJH 5CP3A 3TJHD 3UJIH 4A2LA 1NBZB 3TH4T 1XIWC 3VGAC 3NZHH 4HF5H 1EZVX 4N8CL 5C0IB 4MAVA 2XTKA 4CCDA 3RIAF 5I1KL 5E0CA 1AGDA 5DI8A 3HS0B 4Z7UB 5EU6D 1V7MH 5ISZE 2AMGA 3VXUE 5I15H 3VUPA 3B2VL 1YEIH 1LO2L 1MFVA 5DT1H 1H09A 3JUGA 3IFOB 1IC4H 4BH7B 4LLDB 4E42B 2ZUSA 1W72A 1AHWA 4AYSA 5HYSA 1OSZA 5HI4D 2VB5A 1P2CB 4JY5H 1JHTB 3OB0H 3K3QA 1FCGA 3FZUC 3QULA 5EWIL 4YDJA 3T0ED 3SDXA 1OM3L 2YD8A 5EUOE 2R23B 1NQ6A 5L0QB 2R29H 3VMOA 4ZS7H 5GRYA 4UIKL 2SEBA 1H9VA 4WI8A 2J1KA 2D0HA 2CQVA 3WH7A 1N6QH 4W5ZA 4GW1B 5EFIB 2KUTA 4V1DD 2Z0BA 2V2TA 4GBXC 5A3IC 1A64A 1QFOA 4NQSA 2FIKB 4UU9B 1ADQH 1JF1A 4FNLL 4M7ZB 4QAWA 3QHOA 5IT2H 1TQBB 3O45B 5J3HC 2PW1A 3CGTA 4JFQA 1DQJA 1CXFA 1NGZB 1CGUA 2UWEB 2GK1B 5D7IE 2DSVA 3U9PH 4NQXA 3VRJA 3RRQA 1G7JB 3V6BR 4LVOC 3V6ZB 2XWTB 2AGJL 1BYDA 3T0DA 1KEMH 1UWEH 2ZUVA 5D7LA 3DX9A 4WHYH 1MW3A 3BPCB 3MCKB 4XAKE 1H3XA 4XNUL 5AYUL 5GSVA 3KEHA 3GMOA 2UUDK 1MJ8H 5JQ6L 5GJTL 1OTSD 3ARFD 3PDOB 1Q9LB 3PABA 3I9GH 3WMSA 2ZX9A 3ZDYF 1FYHB 3C9NB 1AXTL 1A7OH 5KOVC 2OQJA 3JXAA 3QAZB 1S9XB 4UFJA 3V6FA 1FNEB 1BFOA 5HGGS 4H7VA 4GKNA 3Q5TA 4Y4KA 5DUPH 3EO9L 4GI6A 4WTWA 1MELA 1NJ9A 4D9QD 2F5BL 5TF0A 4U6YA 25C8H 4F7CA 3JWDC 4X9HA 1LEGA 2Z35A 5JPMA 4LL9A 4AY0A 4RGOL 3L95B 3MRFB 4ODTH 1HIZA 3CFDB 4LHUA 1UCBL 5AUMA 4G80A 5IESH 1PX3A 2NXZB 3C6LD 3WL9B 1NKOA 1EFXB 3QUXD 4QHKJ 4Y19A 3RL1A 1IGML 3DVFA 4NQUA 4DZ8A 3QXUA 4FHBD 3OKOB 3U46A 3WJLA 3G5ZB 4PMRA 1SMAA 1TA3B 3PIQA 2BNUA 2YZ1A 4M1DH 5KOMC 4B9YA 3DI3B 3FAWA 5DJ2A 2QV4A 2FO4B 4XXDA 4LGXA 2X10A 1YY9C 1NMCC 5HTSA 1Q6GA 1OGSA 1KLFA 2XYCA 4GW5B 1ZBKA 4YJZL 1S3KL 1AXIB 1CL7L 3VD7A 4IDJL 1FP8A 4PLKC 4YHLH 2O5XL 2F5AH 1TZGH 2UY3A 5CJQH 4RMRA 3SIMA 3VGEA 1LD9A 4M9OA 4P9ML 4MNHB 5F1OB 4PUBL 3DMMB 3PGDB 4HJGA 5EU6B 5FCZA 2X1OA 2G5RA 4XP4H 1HNGA 2LTQB 2FH8A 1JTOA 2JIXD 1HYSD 2HTKC 1JZ8A 4KQ4L 1GGYA 4ZOAA 2YPLE 1S7SB 3T0EC 5A6AA 4HXAL 4XVJL 5HGDA 2VZSA 4HK3N 5DK0A 1NAML 2CO6B 3DRTB 2KKQA 3MODL 1IAIH 2XY2A 4GKSB 3X17A 4GRLB 3FT4B 1AI1H 2GITA 3VKKA 3LQMA 2B1HL 3M07A 1KTLB 2AXGB 1INEH 1XGRB 3A23A 3PDGA 4CVXB 3ULUE 4LCUA 4NQCE 1E28B 3MQIA 1NC4A 4ZTOH 5DURD 4EN3B 1VEPA 1Q38A 5BS0E 6FABL 2Y07H 3NIGE 1FDLH 1FNGB 2HH0L 3ARBC 2WUBL 2UYLB 3CHCA 2P1YA 3RL1B 3GSXA 4X83A 5C8JA 4LAQL 5LCVH 1KF9B 5HY9A 3BVUA 2YL8A 4RDQG 2H32A 3PL6D 4PJCE 4RGNE 4DVRH 5IROA 1M1SA 1BPVA 4ENED 4AENA 1CGSH 1QTYT 2BNUB 3SDAA 3BAKA 2VDPL 5IVXF 1QFUH 2JJWA 4IMKA 4WW2C 1ODUA 3AXXA 1T5XA 1B0WA 2CIKB 3MUGA 5F6HI 3RKDD 5I1DA 4KRLB 3VTRA 3GSRA 4XBEH 3OGOE 5D1ZA 3VOCA 3KWWA 3MRIB 3AJ7A 1VENA 4MDPA 3N04A 4L4JA 1C7TA 5I1JL 1S7UA 5BRZD 3WDRA 4AMKH 2EO1A 2FD6H 3K4DA 3BUYB 4ZPTA 2JCCB 4M7JL 4AM0A 1BWWA 4MQSB 1YZZA 1NUFA 3SKMA 4K3JL 4PV9B 3CFKA 3W28A 2J6EL 1G6VK 1C5DA 3L9RB 4P23D 4OLXH 1NBYA 2OYKA 4NQEA 4XHQA 1MCFA 3FT3B 3RWFB 1UGNA 1HJWA 4IDLA 4U1LA 3VG0L 1BYBA 3MFFB 4MMXC 4OD3H 1ES0B 1OB1A 4S2SA 4UV4L 3MJ8B 4YE4L 5HBFA 5ECUA 3KPNA 3GIZL 3AAZA 3K81A 1A2YB 3EOYG 3H9ZA 1HOCA 2IGTA 3IGAA 3Q5OA 4JY4B 4R96B 2VIRB 3SE3C 4WHYG 4IOFC 5TD4A 1SJHB 3NJ3A 3TBYB 4JFOB 3QXAB 1IM3B 5E4IA 2TAAA 1HJXA 5KJRL 3C87A 4GRLC 3HR5A 1HKFA 4GSDL 3K1KC 3S37H 3ZE2E 4OI8A 1SHMA 3QI9A 3ZDZE 1HJUA 3TGXA 4EJ1C 1M7IB 1DEEA 1IC5L 3OQ3B 1CK0H 5D1ZB 1PKQE 2XUCA 4YZFF 3OHXA 2C3HA 1JYNA 4LSTL 3BAIA 5TDOA 3MSPA 4P7RA 5IROC 5FYKL 2IMNA 3V0VA 2I24N 3MRNB 1XGPB 3CLEL 2RB8A 4HDIB 3PQYD 5JNYB 3VFVB 3G5YA 3VFPB 5JPNB 5E03A 1S7RA 3ARDA 1SBSL 1D6VL 1FH5H 1X4ZA 2RBLA 3BXNB 4HWNA 1U8PA 3KLSA 5F96H 5FO8B 5FM5M 7FABH 4LNRA 3GSNB 4NFDA 1IC4L 2Z31B 2V17H 1G7LB 3EMCA 1BX2A 3IDYB 4YX2H 3WS6A 4G5ZL 4J23A 1NSNL 3DUSB 2WBJB 1RUQL 4FP8H 5TJWK 4YHIA 3AHVA 2NNAB 2XIDA 4L8CB 2ZNXA 4Z7WE 4IS6A 2B1AH 2PO6C 4XAKD 2B5IC 2ESVA 2BX5A 1GYAA 2G4FA 2R29L 4GKZB 4ODSL 4J27A 4WSJA 3OIHA 3NUKA 1QNZH 5GGUB 1S7RB 3ARDB 1NAMA 4OZGE 1ITCA 5EIIA 1N4XL 4ZUUA 3ME0A 2XKNA 2WLYA 3SBWA 3RBGA 1FLRH 5L7XH 1A14L 1JZ2A 4AZ6A 4FNLH 4KQ3H 4R4BA 3AU1B 4CVZA 3ZE2F 7A3HA 3REWB 1TPXB 4PYSA 3ZDZF 1P4BL 3O2DH 4CU6A 3QHFL 1VFMA 1F2QA 3UDWC 5GRVK 1TJGL 3PE9A 4HG4K 1MQPA 1UXWA 3MLYH 4UFIA 5MENB 1DEEB 2AGJH 1Z0MA 5EBWA 5FKAA 3VWKC 4DUXA 1RIHL 4XRCA 1A1MA 2UY5A 3KYKL 3VFRB 2VX6A 3MRNA 3TIEA 5FYLD 1JHKH 2YBUA 2EDTA 5F7KC 4KUCF 4U33A 4J2XA 1U30A 4QY8A 3WIFA 5F1IA 3ARPA 1U8HA 2MFNA 3CX5K 5GXBB 4NZUL 7TAAA 5FKAB 2FR4A 3AIEA 1C08B 1DDHB 2C3GA 2OZ4L 1ED3A 4NKOB 3S5LA 4M02A 4Z7QF 3SDDD 4Y4HD 1WSST 3AZSA 3FRUA 2DWEA 4OT1L 4HMDA 1QR4A 2ESVB 4OGAC 1RZGB 5KVDH 4M29A 5BZWA 3BMVA 4WWKB 4L8CA 5D9PA 4HIIB 1YYML 4LSPH 1JAKA 5F3HB 1RUPH 3GI9H 4KRPC 4ZQKB 1X4YA 3OKNB 2WCGA 3RZCD 3VXNB 2VLJE 3SO3B 2FX8L 3D52A 1J0IA 1N2RB 4CKQA 1BD2D 2BSSA 3LSOA 4M61A 4MXWL 3WJLC 1YEKH 2VLRB 3AU1A 4CVZB 5JR1H 2EDNA 5DJ0A 4OOUA 3MTRA 2A77L 1JFXA 1GOQA 3FHQA 1Q9WA 2XWEA 2E8ZA 3H3PH 1TIUA 2NY2D 1XR8A 3L5XH 4XWGL 5F9WB 1ZHNB 5JW4R 5HHVL 1Q1JH 5CSZA 1QKZL 4L1HA 1HXKA 4LCIH 1E4NA 4JIEA 4RFOH 4L8DB 3H7BA 4OI9A 3H53A 2R9HC 1ZA3A 3BT2L 3U0TB 3S3PA 1IL1A 4KRUA 3QZWA 4E4PA 1BJ8A 1JNNH 1T4KA 2DBLH 2ZUQB 3QNZB 2ZXBA 3RTQB 1E71M 2P5EE 5HYSB 3EHBD 4OM0H 1I4FA 2DQFB 5IWLC 1YY8A 5EBMA 1G0YR 3IETB 5HGBB 4LDOB 1WO2A 4ALAL 1V5JA 2EDYA 2FB4H 4PP2A 2W65A 3HUJF 4KKBC 5DFVC 4LASH 3O6LH 1JNJA 3QZWB 3KYAA 1UD8A 4QO1A 2X44D 3T2QA 1WCBB 4PJ8B 4JRYD 3ZOAA 1BF2A 4WEBL 3L5WB 3NN8A 3HI5L 3TWCL 2Z35B 2YSSB 2DQFA 3LPOA 4GMTH 2V7NA 1YEDA 3EDJA 5HPOA 1R75A 3SCSA 5BRPA 4JL2A 1OD0A 2B8OT 4LLWB 3JV5A 1OP9A 5D2LE 1OAYH 4GI8A 2MCPL 3CHFA 4H41A 5EB8A 3F7PC 3TO2A 3MOBH 1T04B 4PIRF 4JFZL 5L9DH 1G6RA 5HYEA 2YA0A 2X89D 1YNTA 1E72M 2GIYA 3S88H 5HDBE 4JHAH 5IHZB 3UTTA 4F15C 5K9JL 3PHAA 4KY1L 4M4PA 3NCCB 3O0RL 4WY7L 5JUVA 2YWYA 3WD1A 3TO4B 3BJLA 1NCUA 3ORJA 2PTUA 5F93C 2V9RA 3QCUH 3ARBD 1J86A 2QSTA 4O9HH 4LK4A 3RZCA 3IDJB 1A6ZA 3FQWA 1BBDH 1ZEAH 3HFML 2VDLH 1IM9D 3JSSA 2WWMC 1XF5A 4JG1L 5GGRY 2ORBH 3ZKQD 2XVGA 4M7LH 5BJTA 4LGRB 3K80A 1BM3H 2NXZD 4MHHI 4U6YB 3OR6A 1KPRB 4OV5B 1LGVA 2R9HD 3MRGB 3UTQB 1R5VB 3MSGA 4PYHA 4Y2OA 5IHBA 4R2GD 1R6VA 3KLDA 3IF1A 2B4CH 3GZKA 3EOBB 3LDBC 5I0ZA 5DUMH 2DQDL 1CYGA 4JPVH 2VLJA 1MNUL 3IJ8A 1FPTH 2J62A 1FL6B 3INUL 1U8JA 3B9EA 1F45A 1ND0B 2C9AA 4DFHA 4NN5B 5E2TL 4ATLA 3TBTB 3CU1A 1O0VA 2X9YA 5E8PB 1GOHA 1LF1A 1UM4H 3W0WB 1W1YA 5C0JB 3TT1H 5EPMB 4KJQD 2CKNA 2GAZB 4AEHH 4XC1H 4M3KB 3GBML 1MIEL 2X4UA 2ZIDA 2R1YA 4I0CC 2NMSA 3S36X 5DRNB 2X70B 2VERN 4DWSA 4ZTPH 5JW5B 3F7VA 5IMMA 3SPVB 4U1SA 1X5IA 1FL3A 2NY4B 4MD0A 3O45A 4CAGA 3DTXB 2XZCH 2AV7B 1GUVA 4GSDH 5JO5A 4Y19D 3OXRA 4QHUA 5C0IA 1VPOH 2FIKA 3CK0L 4HJGB 3S3JA 2CLRA 3T0EE 2GTWB 3MROA 2CUMA 5EORL 3MUHL 1Z9MA 4HS6A 4BSVB 3PF2A 4KVCL 3FXYA 3X14A 5DD1L 5D8JL 1C5CL 2BSTB 2JF1A 3A4AA 2X4OA 5FUOH 5JIKA 4CDHA 4ZXLA 4KPHL 1UWXH 3EMQA 3WNPA 1M05A 1TTGA 2MANA 1A7NL 3KS0H 2Y6SC 2GYSA 1VJSA 5DVKA 3RNQA 1R86A 4IPLA 4U31A 3NSMA 3MZGB 1UH2A 3UO1H 3RWEA 3C9NA 3S36L 4DGYL 4YHYC 3LQZB 4HGWB 4NO5A 3ZE1F 3C5ZC 1DQDH 3PZGA 2HLFD 4GS7C 1KXVA 5TGBA 4OZGA 5D6DA 4R7NB 3WF1A 1BGXH 5D1XC 5D72H 2KQNA 1TCRA 3SE4A 1D7FA 1WFTA 2YHGA 4P8WA 1IGJB 1I75A 5AC5A 4U3XA 4RMSA 5EB9A 3W0WA 4IPNB 1AD0A 2WKGA 4CKVX 3TBTA 3CXHJ 1UH3A 1IBGH 1RZ8B 1RP9A 5IOPA 5LBSL 2X70A 5J1TC 3BUQA 1MLCB 3FL7A 4MQTB 3ZZ1A 3QUZD 1OOAA 2ENSA 1BGGA 5LYRA 1NPUA 4ELME 5L7XL 1HXYA 4JRXE 3MA9H 4KQ3L 3RY5A 4D3CL 5BMFL 1H5BA 4Y19B 2IAMD 4JRXD 4EBQL 5BVJA 5JO5B 3OKOA 4MLSA 2Y8VA 3NAAL 3RY4A 2E7LC 2VN7A 1TG7A 4DOHB 3IFLL 3PIQB 3C2SA 5AD0B 4M9PA 1F8TL 3X13A 2EDLA 1XGZA 4PMOA 2Y9RT 1OAUL 3QNXB 5GISH 2P45B 4YHLL 5IMOB 2F5AL 1I7UB 2V7HA 5E2UL 4UILH 2FRGP 1OB1B 3OKKA 5CJQL 4BFGA 5JPMB 3RUGF 3EJJX 4PJ5D 1KR0A 2AEIT 4ELKB 2J7FA 1FG2B 1ZS2A 1MI5E 3KXFD 3O4LB 5FK9B 1SR0A 4DZBA 1R46A 3HCVB 1BIHA 4L29A 5GGRB 1XCXA 5E5MA 1U8KB 4HJJL 3UAJD 4U2ZA 5JOPE 3UMTA 1MCNA 1H8NA 1RHFA 2DQUL 5TGBB 3ZHDA 4ACPA 2XXMB 1IAKA 1RJYA 1I7UA 2FYYA 5DURB 4EN3D 4WKFA 1R47A 3PWNA 5IWLA 1AI1L 4X6CF 5KS9F 1U8OB 3WF3A 3QJHA 5IW6B 4HUUA 2NW0A 3MJ7A 4Z78A 1FL5B 1I1FB 2GTZB 3ARBB 1KWKA 1NC4B 4FXLA 1BQHB 1M71A 2R1WB 3DETC 4ZTOL 3KLHD 1HHKB 4H5SB 3W0WE 2EEDA 3UP1A 4QF1B 4PJIF 4Z76A 2X4QB 1E3ZA 3A47A 3RNKB 5IVXE 4C4KT 3PG2A 4G9DA 5TDPA 5GZOD 3LKNB 1E5NA 4EAMA 3QFDB 4KMLB 3WD5H 3HZYA 4U7MA 3MV9A 4LHJB 4NKDA 2EDFA 4GG6E 4B5EA 5ITBL 5D6CA 1CGSL 3QPQD 4PMZA 5DRWB 3SDCA 1FZOA 3QUZC 3RWJA 3QDJA 4RFOL 4P5MA 3TFKC 1FVDB 3OGVA 3EJZC 3MACH 5D7JB 4N5EC 3S98A 1A6TB 3MRCA 3FMGH 2WC7A 4AG4H 2JF6A 3VILA 2AK4D 2QQNL 3HHRB 3QIUC 3QIWA 4N5UA 5ID1A 4TTDC 3CC5A 5K9OB 4D6HA 2Y5TA 1ZVSA 3HZYB 4P3CH 3PJSB 2NXYC 4BH8A 3FOMA 3AICA 3H6JA 3HNTH 2DSUA 4BQ2A 1JP5A 1WBZA 1AHWC 4NNYA 3NMEA 4X5LA 3V52H 2HFGL 1A6AA 4CD6A 4U6HB 1I7RA 3QUXB 1N8ZA 3M17B 3QDGE 5BS0A 5F3BA 2JELL 5I6XC 4OJFH 4FXGA 2IQAA 2EXWD 4P57A 4QGTA 5IB1A 5E08L 4X6CE 43CAB 4M6NL 1EO8H 2ZOKB 3OGSA 4U3CA 4W8AA 5DVOA 3ARUA 3T04D 2W62A 1G9MH 2B20A 1U92B 4CMHB 4WWKA 3VXOA 1NGPL 5T3ZD 3TP4A 1MF2H 4I0PA 4MDIB 2PYEA 1MCLA 4OLZL 5GQBA 3ZKXC 1CIDA 4Z2GA 3HE7C 3AB0B 4AEIL 2IBZX 3H8NA 2WQ8A 5K9QG 3KL3A 5T3XD 1JRHL 1QI5A 1I1WA 1E15A 4B53A 5ENWA 5GSRA 3HR5B 3MRBA 4HXBL 5IF0A 5DO8A 4JFOA 1EHLH 1FVDA 1FZKA 4XBPB 4JZJA 5GS0L 4O9HL 4OAWA 3MYJB 5DK3A 5IW1B 3DV6B 2VTFA 4NXKA 2UUDH 1NFDF 2HG5B 3CC5B 4UBDC 4JFEE 2XG5A 5E4EC 5FA3B 4KKCC 4LSTH 2ZOXA 4ZE4A 1ZLVH 3VXRB 1J8HA 3HC0B 1S5IH 1JWUB 4K9EC 1E3XA 1BF8A 4HOZA 4HIIA 4TSAH 1X44A 2D03H 4LMQE 2G5BA 2LTQC 5C2BL 4LSQL 2JK5A 4O2CA 5I1AB 2WIIB 1B4JL 2OTWA 5I2UA 1MRFH 4LXFA 5DLML 1HKJA 1P4IL 3H54A 5JLZA 4A4AA 5C08D 4OAWB 2B4CL 3P4MB 1R5WA 3SUWA 4K7PL 4NKIL 4D72A 3TZVA 3QR2A 1EO5A 4KI5E 5CEZE 3FY1A 1CZ8L 2NXYD 4KHTL 4G5ZH 5L2KB 4XB8A 2CHNA 2P5WD 2QSCH 4NO0D 2QEJA 4X9GA 3IU3A 1RV6X 4BSWA 2WVVB 4EQ3A 3KS0J 3NN8B 5HJ3B 3HNSL 1A7PH 2DTML 3CCHB 1BJ1J 1S9VA 3WFDH 1Q9OA 3VNZA 4U05A 2ZX6A 3ZHKA 3P3YA 1WK0A 1NGXA 2IWGA 2BNQD 2PUQT 1RIUL 2AABL 1ZA3B 2UZIL 4AJ0A 2CKBH 4GJTB 4N5ED 2X1XR 1JD9A 4FTVD 3WEXA 1OW0A 2BVDA 2DSKA 5I8CA 4OLUL 4RFNC 1MHPH 3HN3A 1S7QA 1P4BH 5F8RC 3FQTA 4TYUA 2KBGA 2PXYC 3W82A 2WSPA 3D3VE 5SWQA 3DX8B 4G6AC 1TJGH 3O4OC 2YKLL 4XPAL 3R1GL 1N64L 4JJ5B 3HG4A 3FZUD 2CHOA 1QACA 2WQRA 1LNUB 2ALWA 1HH9A 2W0LA 4E42A 5IG7B 1HI6A 5BO1H 2CGRL 2C3VA 1UT9A 1FFOB 2A9MH 3PZVA 1RZKL 3S34L 1S9KC 3RWIA 1WCBA 3SCUA 1KTRL 4PTTA 1MVUB 3DX8A 1NBQA 3C6SB 3DX6A 1B0RA 3O41B 2ZX5A 4LVNC 5IR1B 3CXDL 4MA8H 3OR7A 3A24A 1BD2E 3PQYB 1A6UH 1DQDL 5CBEB 1JPSL 4GAGH 3PZOA 1N3NA 3QCVH 3WFBH 2C7FA 4R7DB 2W60A 1C08A 2Q3AA 3OAZH 5LA2A 2BMKB 4MWFA 5E94A 2V5MA 2OI9B 1F6AA 3RWIB 1PG7X 1UWQA 4M8QA 3KPMA 4WCYH 1J1OH 1JGIA 5CP7A 5KW9H 5C0JA 1D3CA 2E40A 4EVNA 3HAEG 4LDEB 3H7LA 4BQBA 3R0NA 1LG2A 1V03A 2VDRH 4Y4FC 1FO0B 2PO6B 4QRRA 5ISZA 2F54E 3QFJE 1I7TB 4MA1C 1DLFH 3JWDH 4LRIC 4QP0A 2H41A 4KZEH 1KIPB 3D4ZA 1L7TH 3NA4A 5DJ0B 1FBIL 1KGCD 1ZHNA 3EO0B 4N68A 2W9DL 4NUGH 3DTXA 1Q9WB 5JDSB 4RAVA 2E4TA 4KTYA 2CLRB 4PLKD 5CP7B 4LU5H 1G6RH 1PEWA 4ODUB 5FUCC 1UENA 1R5VA 4X6DB 8A3HA 1NAKL 5GS1B 3WNMA 3PWVB 5HD8D 4D9RD 3UJTH 1SJVA 4XB7A 2KH2B 1U8JB 4ODXB 1LO0L 5DUPL 2DBLL 4DTGH 4QCIA 4HFUH 4MMZC 3FB5A 4PMUA 4GQQA 1OY3B 3OJVC 2R4RH 1UA7A 1DSFH 4LCCA 4HJJH 5D7JC 1C91A 4G8GD 1N2RA 3TVMA 5JIIA 4UZUA 1X9QA 1UZ4A 4PRPE 5IHUH 2R0LH 4NM4L 2E0PA 3F7VB 1CTNA 5IMMB 3E8UH 4NZDA 1LDPH 4G3YH 1JHLL 4G9FE 2XI9A 5EOCJ 5AWNL 3VWKD 3C08H 1A7QH 2YPVL 4HBCL 2UY4A 1X7QB 5DMGC 4R8WL 1EXUA 5C3TA 3G5VB 1W72B 4V27A 4NPYA 1FFPA 4ZXBD 1ZXQA 3STLA 1J0YA 3GEWB 1KIRB 4X6FB 5KVEL 5D9OA 2MNUA 5E5UB 1ZV5A 1JNEA 1P4LA 3ZKMD 4JFXB 4AISA 1QRND 3CPUA 4I5BB 5CJ8A 5T3ZE 2CLZB 2P8PB 1TQSA 3ALWA 1T89C 4P99A 4GW4B 4APQC 5SX4I 4IRJD 1S3KH 3RNQB 1SZNA 3WNLA 2CK0H 1IT9L 4KGJA 3SDCC 2VKXA 5H37H 1OQXA 3NTCL 5E7BA 5I6SA 4WY7H 4F66A 2ZZUT 4P2QD 4PUBH 3L4VA 4OSUL 2Z1SA 3NSNA 2CKSA 3AIVA 4QRPA 1MW2A 3UZEA 4M24A 3CMOL 5IQ7L 4D1IA 2MKLC 2X2HA 4X6BB 1CF8L 4R7NA 5CSBA 5CINH 3HFMH 4HQQL 3FO0H 4XCNA 1INQA 3AXLA 5GS0D 3QULB 3PZ9A 4P3CL 1P7KA 4YC2B 4XP6H 1P2CA 3GIVB 3AUVA 5D93C 2V7NB 1QR1B 3LD8C 3SDXB 2EYTA 2YUWA 1EV2E 3HZVA 1ZK9A 3O3BB 2XFFA 3GO1H 3TJEH 3VFWA 4EOWH 1KXTA 1AMYA 4XNMA 2ESCA 4JPVL 4CGTA 1EIBA 2NTFA 1ZBWA 4AWEA 1UA3A 5D7JD 4NKQB 4J4PA 4QXTB 3FQXB 4ZAKD 2AP2A 4JDVA 3BD3A 1HJQA 3GBLA 5SX5H 2ZCKH 5KZCB 5J12C 4R0LA 3SJVA 1MCOL 2BDNL 2RAMA 1UKOA 4XC1L 3WDPP 4JFXA 4GW4A 3EO1A 4H1LB 3N1PC 5EZIH 1EERB 2BJMH 1JRHH 2CLZA 3WO3B 5ABHA 2R1YB 2F8OA 4Q7NA 1SYTA 1PQZB 2G2RB 3H42L 4RISH 5DK2A 3PGFL 3AI0A 4LVNB 3SKJH 3BPLB 2JB6B 2Z91A 1K5NA 3QDHA 4ODHL 4UIMB 5F9OL 4P8VA 4XHJD 3ARSA 3LRGA 2Q6WA 4QLLA 3ZKND 3PV6B 4M7JH 5D1QC 3KLLA 3HCVA 4L29B 3CVHL 4PLJD 5GGRA 1W2VA 2FO4A 4XXDB 2A73B 4MAYC 3V6OC 2CIIB 5DVLA 5D8JH 4PJ5E 3PWNB 1T0MB 4JAMA 3SDYL 3RWFA 4KJPD 5DJZB 4JZNA 1NFDB 4JFHE 4KKLC 4HK0A 2E9BA 3QUML 4FQ1H 3SDAB 5HPMA 1U8OA 1E5JA 3VG0H 4HA4A 3GK8H 4UV4H 5FYLE 3S36H 2AJYL 3U0WH 2HKFH 4ZXBC 1SVCP 2DT0A 2R4SL 1EA9C 4ML4A 4K7PH 4L9LA 4F7MA 5A3HA 3IANA 3QHTC 5IM7B 3MI6A 1DBML 4MS8C 3W0WD 2E7LA 3VE0A 4QRTB 5BW7C 3QIWD 5D72L 3FQXA 5DJZA 1H0DA 4QOKD 4JFSA 3TV3H 3DXAE 2NY1D 5KSAA 2C1OB 4ELMF 1YYLH 2H3NB 2DTMH 1QW8A 5IT2L 1IBGL 3LKRB 2AK1H 4PV9A 2BC4B 2X2JA 1OQOA 3UTTD 2PB1A 5ESVA 3W6MA 1IC5H 1SFSA 1FVEA 3VM7A 2X89A 1RIUH 2AABH 1MJUH 2GSIA 3V4VH 1AQKH 3C8DA 1ESWA 5F7DB 2F18A 1H5BB 1U2CA 1A1NA 1T6VN 3CVIL 3O3AB 3QIWB 4Y5YB 1JL8A 2W92A 4ZYKB 2YPLA 1EVUA 3W39B 5ADPL 4GMSL 2YD6A 1BOGA 1XH3A 1VAHA 1JBJA 3ULUC 2DF3A 1EVTC 3O3UN 5JBFA 2CUHA 3SUTA 4YQXH 3QEHB 5GS3A 3DYMA 4BZ2L 4ZOEA 3BKCL 3MLWL 5DHVA 5JQ6H 3I9GL 4PYGA 4CMMA 5DK0B 3S6TA 1AKJA 2HLAB 2VZVA 4WI7A 3GSNA 2IPUG 4Y0GA 3TIDA 3MREA 4K68A 4BFBD 4NN7C 4NQVA 5H2BB 32C2A 3IAGC 5E4EB 3NOIA 2XVKA 5ALCH 5CCKL 3KPQA 4Y5YA 3VXRE 2PXYD 1HVXA 1UD3A 2A9NL 4UDUA 3H0TA 2QHRH 4X99A 2NY7L 5D1QD 1P6AB 1XHGA 1F4WH 4HW6A 2IXUA 4JCMA 1XZ0B 2PR4L 4TSBL 2PYFB 1FNGA 3W38A 5FK9A 2FL5A 2BFVH 1M4KA 3LVEA 1UCBH 5T1MA 2WW5A 3VFNA 5CXPA 1VB9A 4F58H 4PJEB 4NQVB 1LE9B 4QXWA 1QI2A 4Y19E 2FEDC 2H3NA 4XP1L 4PJIE 1A0QL 2EEXA 1EO7A 1TQWA 3V8OA 1S78D 1ZHKB 5HDOA 4IHOB 3GXDA 2IH1B 1VBUA 1MQKH 3STZA 5I1LA 3G5YB 2WVVA 1UASA 5AD0A 4HS3B 1FVEB 2V9QA 5HYFA 5D1XB 3VXSD 4YDKL 1PLGL 1A2YA 4JG0H 2AJZB 3EZJB 3SKNA 3GHEH 3BH9A 5I74B 5JXAL 1P9MC 3LIZH 4JM2C 3BVXA 3OLGA 3F4VA 3GH5A 4Y88A 3MLZH 2X4QA 4ENEC 1F02I 4KZEL 4P7OA 3MMEA 4PMNA 4QFUA 3RGVD 1G7PA 1RK1A 3ES6A 1U3HC 3QQ9C 5I1AA 4PJEE 3QHZL 4XP4L 1U8HB 3VU2A 2F61A 2IANE 4GPNA 3W11C 3O4LD 1BSIA 2EDHA 1FV1A 2YN5A 4U1LB 1I3RA 4J3SA 4IOSD 3MJ8A 1S7WA 1YA5A 2VITB 2B39A 3LQAC 3SCVA 3GMMB 1EBAA 1ISZA 5CGYC 4EUPH 1TETH 2AQ1A 2XFYA 1QFPA 3B9KA 3CVHA 2FL5B 2DTSA 5D71H 1YEEL 1P1ZA 4I77L 5JHDB 3QOMA 4NC0B 1U2YA 1YN6A 5C0FB 2DIEA 4LHUD 1TQVA 4E9LA 2DLHA 3B2UC 3OKMA 3EOAB 3AOFA 2I5YL 4QOKB 5TE4H 4L4OA 3RVTD 5C07A 2UWFA 1QWUA 2P43B 1A1OA 3OPZH 5GRUH 1CLZH 1WFUA 4OGYL 1U3HB 2JE8A 1H5VA 4NP4L 3B8YA 3KJ6L 4NRYB 5B8CB 1KCLA 3WLWC 1KELH 3BUTA 3HI1A 3OHXB 3CTTA 4R0LC 4MQ7B 4Q9QL 2GFTA 2WM0A 2AOSA 5I71B 4KK6D 4PJ7B 2CIPA 3Q3GB 1M7DA 2V5DA 3LY6A 3B5HA 3IDGA 2WZEA 3WUBA 3UTSB 5E1QA 5I3DA 5JW3H 1UQZA 1KWGA 1ODAA 4XBEL 4XX1G 4FNRA 3VI3E 2F74A 5KSBE 3FHAA 5L2KD 4Q0XL 3TO4D 3T77B 3ZKMC 4LKCB 1T3FA 5K33A 2GT9B 3IDXH 2F53A 5CBEA 2DQGH 4XNQA 4XBPA 1QO3B 5E00B 3SQOH 3CDFA 2YRZA 3QEQB 2X1IA 2FB4L 5BS0B 3S4SG 1LO3H 1QYGH 1MCHA 3HMXL 4GRMA 1DBKH 3HUJE 1GOGA 1ZTXH 1E6NA 3L7EB 3BIBX 1WAAE 2ZOKA 4HH9B 4R4FH 1OD9A 4XP6L 2HVKB 3ZHLA 3MKKA 2CLVA 4R26H 4PJXE 1B4JH 1I9JL 2DQJL 1KGUA 1UHVA 1S9YB 3L4YA 5DLMH 4WIWA 2A3EA 5D5MB 1KB9J 1G7IB 1AO7A 1MLBB 5BOPA 3SDXF 2FGWL 5EUOF 5CEYB 5FDYA 3P4MA 4TVCA 5T1DH 1ETZB 5IIEA 2D2OA 5DJDB 2AAVA 3U7BA 5BOZG 1JPTH 2WVUA 2WWMD 4KJQC 5CD5D 3BLKA 1I9IH 1V02E 5HDBF 2YS4A 3DO3A 5F3HA 1DWFM 5M3WA 3WIHH 4K7PY 5J1SC 1H15B 4H0HB 3IDGB 3C60B 4NRXB 3WFDL 3MRDB 3TBWA 1P4LB 3BPOC 3OAZK 4HEPG 4IRSB 3RHWK 2A6IA 5DC0A 5KSBB 1PG7W 1OGTA 2P7TB 4NKMB 5DMKA 2CESA 3UPRB 2VLMD 4WO4A 1AJ7H 2DIAA 2P8PA 2NY4D 2C4FT 4LX4A 5I8CB 2FZ3A 3EDKA 4HAFA 1WDPA 4U1HA 3LXAA 2VR9A 1MFCH 5C0NC 1EJOL 3IFPA 3O9WD 4MJID 4JPWL 4OV5A 2GJZA 1DWAM 4QY8B 3BKYH 2F53E 1GJUA 2CBUA 2ICWI 2R69L 4CADA 3BVNA 2R0WL 2E7MA 4K7FA 2BOBB 5KSBA 2DSZA 3HE7D 4TNWK 3Q6FB 2XSAA 3CIQA 4P23A 5DUBA 3PZQA 4JFQB 3WE6B 4FA8A 4YHEA 4ONHB 1HKLL 4LARH 4UOW1 3RX5A 2WP3O 1IAII 4YX2L 1RZKH 2DB8A 5FA4B 3ARRA 3INUH 4JLRA 1XH1A 1HTYA 2AJYH 3U0WL 1I1YA 4MVBC 3QDMD 5KG9A 5F9AC 5JUEH 4N0RA 3T0EB 4JDZA 4D0BA 2VLRA 1WZAA 1A6ZB 4HKJA 4OBRA 4Q97A 5DJYB 3QXDB 4AEHL 5DD3L 1JMXA 1GRWA 2HFEA 1MRCL 3VFOA 2BVYA 3LH2L 4FQXD 1AY1H 5DT7A 1VF8A 3N9KA 1R5IA 2M26A 4FQIH 4H0GA 3QG7L 4MWFB 5E94B 4BSJA 1Y0LB 2BVEA 2G8ZA 2YSSA 1G0DA 5E70A 5C0BE 4OGXL 3D39E 3KPMB 4JFED 1FFRA 4P4KA 3WHXB 3WF2A 4LLWA 3W9EA 1KTKE 4RCAA 1GHFH 4B7IA 2P49B 4OKVB 2PO6A 4PG2A 3CVIH 5EO1A 3VXRD 4QKXB 4TNVK 5I79A 2AXFB 1L7TL 4JFFE 1HL8A 1EFXD 3W5NA 4NUGL 3G6JE 1LO4H 2WVSA 4UINH 4PJ7F 2XV6B 4YHOL 5C0GB 5HYQA 5GRZA 4RMQA 3UO1L 3W27A 4PSRA 1W3JA 1UWGL 4L9LC 4Z7UA 1KR1A 4Y8DC 3L4WA 2ATPB 2VT0A 4AQOA 3RU8L 3T2OA 1BREA 1KXTB 5ALCL 5CCKH 5DJAA 1EHNA 3GKZA 3IFOA 2WB5A 3O3EA 1SMOA 1GPFA 4PGDA 4LBEA 5LGHH 4JDTH 4UNTA 3L3KA 3NCYS 1L7IH 1YMMD 3WO4B 4H8HA 5L2JB 2R23A 2XN9B 4X5XA 2J8HA 3QQ3A 1OGBA 2OSLB 4PRHD 1KB5A 4GLRI 4OTXH 4PB0H 4YDJB 3GI9L 4JPIA 3U48A 2XTLA 2R0LL 2GUOA 3VSVA 4MDJB 2BSTA 5LKNA 2P24A 1DANU 4OZHB 3ULVC 1A7QL 3QWOA 3ULSA 1NOFA 3T4YA 3BEWA 1M05B 1YEKL 4OF0A 2WW8A 3VCLB 1V7ML 4HV8B 3D3VB 2WBWB 4GZEA 4FQHB 5HHOA 3HC4H 4PRPB 1QLEH 3H3PL 5JOPD 1FH9A 3WLBA 4P5KA 4FQQB 4CD8A 4KDTA 5DT1L 1OIFA 4FQXC 1R24B 3CUJA 4GZJA 1BQSA 4OBSA 5DGQA 4ZSOE 4BH7A 1CE6A 5DHXB 5A16A 4L9DA 2X09A 5EO1B 1YDPB 3MU7A 5EZJA 1I8KB 3KLAA 2DQHL 3RM4A 3SPVA 3O6FD 3CFJB 4YHGA 1VHPA 5HYIA 4UIKH 3JVGA 2NY3D 2YUXA 4AMXA 1US2A 2GTWA 2B0SH 3H2WA 3F7RA 5EU4B 5IQ7H 1IEHA 2JCCF 3DO7A 2VLJB 2RFXA 4UOQA 2FEEL 4J3WA 8CGTA 4YH6A 3FB8A 2VDNH 3FO0L 3GXFA 1VACA 1ND0A 3QEGL 1OGAD 4YHMH 5I23A 2DQUH 3T0AA 3PZNA 3QQ4A 3L5IA 1EEZB 3QQ9D 3BAXA 5I73B 2Q76A 5E24E 4HPYH 4YHPA 5EULV 4J28A 5GS2H 2F8QA 1AO7E 5I1HH 2ZSVB 4JB9H 4NN5C 1RU9H 2H32H 1ISYA 2VQ1B 3IXTA 1UWEL 4WENB 1LK2B 5FF6A 2YL5A 2RHEA 1XGTB 2CIKA 3FCTB 5DQDL 4LLVA 4PJCF 4F57H 3KWWB 3DXAA 3AROA 3TJEL 1QBMH 4W6YB 1K4CA 1FOBA 1VACB 5CJOH 1UZ8A 4CBPA 2FJGB 4LHUG 3UYPA 3NA9L 5GRJL 3MV8B 4MJ4A 3SCMC 3UCQA 2CDGA 1T1XA 4MB4A 1LEIB 3P30H 1H0GA 3RPMA 3VXQA 4RE4A 1XH3B 1CQYA 4UTBL 4F33A 1KG0A 4XNXH 3WH8A 3IYLW 3WUFA 3EJYD 4I0PC 3SE8L 4Y4FB 1KUMA 1GIGL 2GEEA 1OLLA 2DLGA 1EUUA 3CSYA 3KLAB 1I8KA 2Z93B 4L4TD 4MA7H 4WUUE 3F12B 2D7MA 3HZMA 4NXSA 2BNJA 1OP3K 2H6PA 5A16B 3RIFF 2QQNH 5E56A 4NGHL 2F1AA 3JV4B 1DN2A 4RA3A 3LB6C 5CJBA 5DMGD 3FO1A 1I85A 3VJ6A 1AD9B 1BM3L 1KACB 3BHBA 4WU7A 4F3FA 1GVIA 2O5ZH 4G8GB 5HVHC 3A3HA 4NO5B 1HXMB 2N7AA 4LYQA 4HMCA 2RIKA 1FNHA 3ZT7A 1ZTXL 4O4YL 1UJ3A 3L3IA 4PSPA 1S7SA 1V3LA 1BEYL 4HKBA 3N1AA 2G3JA 1HHHB 5GNYA 2GSGA 4FQ1L 3AZRA 3IU4H 1IILE 1EAJA 2ADIA 3L3HB 4M6NH 3EZ8A 5DO2D 4B0MM 1RP8A 2X7LA 5I1GL 4K3DL 2V5YA 1U92A 3I2CH 3ULVD 4NZRH 4TQEH 1NCCL 2HJFA 3EYQC 4LVOB 4NBYB 4F3FB 1U8NA 4H25B 1PG7H 1I7ZB 3QRGH 4DAGH 5TDOB 5L8JB 2WMGA 4FABL 4EN3A 1RFDL 1D6EB 1XAUA 1ZWIA 4BKLB 3KPSB 5IVNA 2OJZH 1UJ3B 3L3IB 4TOQA 3TCLA 4M7ZC 3ARTA 2VL5B 2Y5TB 1IAKB 3QPXL 1Z9LA 4OIAA 4OM1H 2R15A 4K55A 5JNYA 5C08E 4YWGH 2XTJB 1B3YA 1UQYA 4X0NA 1GJIA 3G6AA 3BP4A 3RGHA 1FH7A 4HXAH 1FL5A 1I1FA 5A8OA 5IK3A 4APQA 2EEBA 3RM8A 5L0QC 4S1DC 1JDDA 1U8PB 1IGYA 3TC9A 3OZ9L 1RAMA 1BQUA 1LL6A 4GBXA 3SCMD 3A4WA 2F19H 1XGQB 1NFDE 3WV0A 2AEPH 1HNYA 1C8PA 4XTRC 1VRXA 1YMHB 1U91B 1KLUA 4LPYA 2VLKA 5HPMB 4JFDA 4MSWB 5IHLB 3IJ9A 4JPWH 3EFDH 3NFSH 2JCCA 1SBBA 3BKJH 3LN4A 4HIJA 1S7TA 4P2QA 1T83A 4BZ2H 3AMDA 3L5JA 1MRFL 3CFKB 3S4SB 4WGWB 1U8KA 1CFNA 1TE1A 5C0FA 3SCTA 4MZ3A 1A7RH 1OGAB 4PJIA 2O61B 1Z32X 4Z7WF 5HY9B 3W81A 1C3FA 2DL9A 4OZFB 3QOKA 1R3IH 5F9JA 2ILLA 2BY1A 4N1HB 3WS6C 1BAFH 5FYJL 4NCC1 3ZE0F 5JBDA 1OWQA 3F5WA 1K9TA 1A4KB 1UXWB 4Y5XC 5IW6A 1KJMA 5EZOL 2EE9A 2BC4A 2VXVH 4IRSC 3P9LA 4Y2DC 3QDJD 1M53A 4YGVB 3TTYA 2VLKD 5D5MA 5MENA 3KAAA 4IOIA 3TCLB 2DYPD 3O8XB 3VXRA 5C70A 1D5XA 3MV8D 3AS1A 5IFHH 4WDIA 2OW6A 4GG6F 2PXYA 2YK1H 4FQIL 5M7QA 4J3XA 1V3MA 3QO0A 3BP4B 5CKAA 4KDTC 2WHMA 2OTUB 2Y7QB 1LDSA 5C0DB 3WDJA 4S1QL 2DQTH 2EH8L 3UTOA 5D1XA 3VXOB 1CFBA 4LRIA 4Y4FD 4LSUL 3QEQA 3RZWA 4XZUB 5F1IB 1YNKH 2C5DC 3ARED 1CU4H 3QT2A 1MCRA 3BH9B 35C8L 4JG0L 2XKUA 4PJ9B 3WFCH 2KL6A 5FM8A 3L2MA 1LL7A 4TXEA 2ZJSH 4L4TE 1F8TH 2X9XA 3MUJA 5IQ9B 2HVKA 2C3VB 4PJDA 4UDUB 1L6XA 4PV8A 5GGQL 5BO1L 1IZJA 1YPZF 1LO4L 4D9RE 3W26A 4KJYB 5A43C 1WE5A 4OQTA 5HHXH 5KS9B 3I6KB 4V28A 1B6DA 3VFNB 4O02H 5ANMA 3UTPD 1P5UA 2X40A 4DW2L 2Z31A 4JGUA 4NC1E 3M17A 5BZDB 3BP7B 2VXQL 2YD2A 3WFBL 3SN6N 2CNCA 4WGVB 5EO0A 1GJWA 2PI6A 4WW2B 1Q6EA 5HI3D 1QW9A 1UH4A 1YJDL 4YXHL 2CO7B 3NACL 1NOWA 1UWSA 5JBEA 4Y2DB 4WDIB 3AISA 4HGMA 3MXVL 5B38A 1GVYA 3WXVH 3FRPA 3OAUL 5D2LF 2JALA 2Y7QA 4TUKL 1CN4A 1NUGA 1FAKT 5DMYA 4G8FA 1WT5A 2H2SD 3P73A 4LEOB 2X05A 1BD2A 2Q8BH 4F7TA 1H3PH 4OLYL 4OIIH 4PREA 1NCTA 3BEVA 5IEHA 3SUVA 3NCMA 1J9CT 1G9NH 1AIFB 1WWBX 4JO4L 4PJ9A 2VLME 1GXEA 4YK4B 2V17L 2Q20A 3MV7E 3MRLA 3P77A 1HKMA 1UB6A 3GSVA 3TPUA 1C93A 4NNXA 1J1XL 3HE6B 2ZP0T 5IBUB 4ZFZA 4FS0A 4Y4HA 3UJTL 2VITA 2XG4A 4UUJA 2O9TA 2FCBA 2AJ3A 3FB7A 1W72L 2Y23A 1TVBB 2AJVH 5I1EH 3L3OB 1QNZL 1E6PA 1T80A 4JLRB 1P1ZB 2OJEA 2OTWB 4FFZL 3EBAA 4G6KH 1Q72L 2I60L 4JRWA 3RJYA 3Q2CA 3SQOL 1UXSA 2HFEB 2XICA 5IBUG 5GS0C 1N5YL 4B15A 3DX3A 1FYTB 3BN9C 3D3VD 4HLZH 2RR3A 4ZXBB 1QSED 5IHZA 3WY3A 4U6VL 4IRSD 5E7FA 2ITDA 1SYVA 5AWNH 1J12A 3QH3A 4NPYB 4R4FL 2YPVH 3BIKB 4HBCH 5T5FL 2H8PB 4X8XA 4JB9L 4LLAA 3ZDXE 4PTTB 1RIHH 5C0AD 1RH9A 2O5YL 4HBQA 3TO4A 3UR7A 1N5AA 3O9WB 4P4KC 4CD7A 5I74C 1S46A 3GFUA 3OLDA 4JO1H 5KEZA 4E8CA 4QT5B 4ZUWB 4FTVB 3VRLF 5BJTB 2ZICA 1XCTA 4F8XA 1JHKL 1VGKA 3IDNB 4K3GA 1HEZB 3LPFA 4FFWC 1MJ7L 4GOSA 5FV1L 1HL9A 3P30L 5CAYB 2CK0L 4K8RH 2CDFA 1T2XA 1OCQA 4UNUA 3TH2T 4Z7VB 3LKSA 1IEBA 4UQAA 1Q0XH 3SE8H 1INDL 1I3GL 1XR9A 3F7YB 1OGTB 2IFFH 2P7TA 3KG5A 3M8OL 4NKMA 5DMKB 3RA7L 4LSDA 3OJMB 2V2TB 4X7TA 5F1NB 2JB5H 2EJ1A 3BAEL 1XGYH 1ZLWH 5CINL 4LSPL 3UPRA 3DHPA 1RUPL 5IHRA 5AYQA 4EI5B 1IL1B 5KSVA 3BWAB 4HWZB 3C6LB 4FRWA 5E8EB 4HOWA 1YQVH 1PSKH 4M48H 3V8CA 4RGNC 4TSAL 4MCZB 2AJXH 5A6LA 4ODVL 3BVVA 1G7QA 2NX5E 2O92A 3GZAA 3BISA 5CJ5A 3V7MA 1SEQL 4F8TA 5IB4B 3WFEL 1JDCA 2AQ3A 1QZ1A 2R56H 2J7EA 2C26A 3F7YA 3PQYA 5IMLB 3H3KA 4FQLL 4O4YH 3CAFA 4UQ2A 5I16A 3L5XL 4MD0B 2NTFB 5E6IA 1MJJA 5IB3B 1A7BA 1BQLH 5CGMA 1OARL 1QRNE 1I85C 4NKIH 1HKLH 1U8MB 4LHQB 1V6WA 3POCA 4A6YA 5EU7E 2VH5L 3U7VA 2HTLC 5CD3B 1F11A 1VGEL 5KG9B 4DKFH 4U5IA 4EVNB 1PZ2A 1CLYL 3KZSA 3JUYA 3BIAX 3H7BB 4NDMA 1FC2D 4UFMA 4KHXL 5FEBA 3W29A 2BOCB 2FLRT 1MCOH 2BDNH 1AQDB 2E7CA 3WJJC 5MHSE 2D3NA 1N82A 3FN9A 3QPXH 4OM0L 2Q1EA 1LD9B 2DH3A 4JR9L 3NDZA 2XNAB 3RWEB 3BD5A 1IEBB 3QG7H 3VMNA 3EOTL 4CUCA 4XP9L 1NANI 1EQPA 1T1XB 4QGYA 3S6CA 4TX8A 3LHPH 4NRZA 1UOKA 3CH8A 4Y5VC 3DSFH 4J6RL 3GNPA 4OCWL 4F33B 4X4YB 2JF7A 2YDSA 4CN4A 1KPUA 3T1WA 3GHBL 2WVTA 2C3WA 2HT3D 2Z8RA 3FB8B 3CLFL 3DMMD 3VXME 4QRRE 2WV3A 4YHPB 2DJSA 4HHAA 5HHNA 2DJUA 3AFLA 3OB0K 3ZL4L 4OCLC 4GMTL 1A9BA 2IALB 1SJEA 2CRIA 5AC4A 5IMKA 2Z4QB 4I48A 1G01A 1UR8A 1Q9LA 2NY2C 1ZT4A 3PDOA 2K7PA 3GK8L 3MLRH 4Z2HA 2ZUUA 4JFZH 3S7GA 5L9DL 3UROR 1TXKA 5I8KH 1BBJB 3C8HA 3CXDH 1EAPA 1BFOB 4ZNEE 3W9DA 3O0RH 4FFVD 2WP3T 4E5XB 5LQBL 4YFDB 4NYLA 1AR1D 1XV8A 4V1DE 1WWWX 2Q7YB