1CGUA

Catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Catalytic center of cyclodextrin glycosyltransferase derived from X-ray structure analysis combined with site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 227
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cguA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cguA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cguA01
1MPAL 4LF3B 4RSVA 1GQKA 1XCQA 3IS0X 3DUSA 3GHEH 4I0CC 4M1CD 4XBGA 2VH5L 4PRWA 1MIEH 1OPGL 3CMGA 4OTXL 3MUGB 3GSWA 2NCMA 3TPUB 3LH2H 3KNBB 3LZFH 2YL5A 5JA8B 1MHCA 3ARRA 3L5IA 3QO0A 2E8ZA 2AXGB 1N2RB 1W9XA 1D5ZA 4QHMA 4XXDB 4Y2DA 5GGVH 3L2MA 1NQ6A 2XOTA 1UH2A 1KUMA 3ARPA 2I07B 4DUWA 1E4JA 4I0PA 3RI5K 5CZXC 3QIBB 3AVEA 1ZHKA 4PRAB 5GGRA 4AIEA 3MRLB 4WU5B 2X40A 3VMPA 1Q72H 3BVNA 1J18A 5BVPL 4OCWL 2CEQA 2ZCLH 1H3UA 4I2XE 4MCZB 4J3OC 2CYGA 2X4PB 2DQDL 5EOQL 4ODVL 2NY7L 2X41A 1I7RA 1U2HA 1NCCH 4NSKB 2BVEA 5E8OB 2DYPB 2OSLA 4JZOB 3R4DA 2A3CA 5E2JA 2DQXA 3MANA 2P5WA 2J4WL 5BS0D 2WINA 1L7IH 5K9QG 1DE4B 3LN4B 3CXDH 5EFIB 2XSBA 3AHXA 1G7PA 5DGQA 4G6FB 1RUQH 4HEME 3DBXA 3AIUA 4URIA 1T3FA 1R3HB 1FNHA 4QFUA 4QRTB 3VRJA 2JIWA 2GJ6B 3FO1B 4PLNC 4MA7H 2JALA 2Q7YB 2X2IA 3BP4A 2WMFA 2F8XC 1OD8A 4O58H 2O93L 4F7CB 3ROLB 4U3XA 1K4CA 1J1OL 5GS1A 1BFNA 3QO1B 5IHLB 5E99L 1I1AB 5ANME 3VFMA 2I5YL 4JB9H 1Z5LA 1LO0L 5DO8A 4HWBA 3SDXF 4NQDE 4F3FA 4UQ9A 2ARWA 4IRJA 4WUUB 3HR5A 3R8BB 4NX0A 2HTKD 1NC2B 2D0GA 3MODH 5IQ7H 4N0CD 3DUHA 2A74B 4JM2B 1TQUA 4HA1A 3A6CL 4NOBA 3KLHD 2Y06H 4K8RH 3MROB 4PJIF 1F4XH 3LPPA 2C1PB 2JIEA 4ACYA 1UCBH 3GK8H 3A22A 3V6BR 3RDTB 4XT1C 5L88L 5DUBB 1GW1A 5I1DB 5F88A 2FYYA 2WNWA 3BCDA 3GBNH 4F37F 5LQBL 5A2CA 2AJUL 2DQIH 2JCCB 1Q6FA 1TPXC 5D7JA 3UTSE 5CXPA 4PMNA 5C0FA 3EJJX 3P11L 2PO6A 4ZYKA 1I8LA 2APXA 3S34H 1A1MB 1H1NA 1I7TB 3C2SA 3PWNB 4K9EL 2ZWZA 3ZYOA 3WEXA 4DEPC 2ORBH 2CKNA 3FQNA 2IMMA 5MP6H 3IDXH 2VAJA 4XCNB 1F4HA 2X7LA 5L2KD 4BZYA 1AR2A 1FAKT 5EO1B 1JGEB 2Q8BL 2X89D 4NP4L 1A9EB 2P8MB 2WVUA 1DBJH 4YH6A 4IRZH 1K5NB 4U6YA 5GS0C 2BOBA 2R2CA 2FD6H 4KRPB 3NFSL 4UFJA 2GYSA 3NTCH 4BH7A 4D94A 1R0AH 1U2YA 3QI9C 2YK1L 4N5UA 2YD6A 4KWUA 1RURH 2NX5A 4IHOA 4NZJA 1O0VA 4AD3A 3AXXA 3WD3A 1AQ0A 1RI8A 3NAAL 2V7HB 3WBDA 3S4SA 1D9KA 3FB8B 3VIKA 1HI6A 5C0GA 4K71C 1XH2A 2EYSA 3L1OH 1FG2B 4XTRD 4KQ3H 1RIVH 2B1HL 4NJ9H 4WNQA 3HE7B 2E3ZA 2HKHH 2JK5A 2A3AA 3M6DA 5FYJD 4GKNA 4WV1A 1BOGA 2W0FA 1JXKA 5D4YA 4Z2JA 2QKIA 5D1QC 1H0DA 2NNAA 1NGPH 1X5YA 3CLFL 1W32A 3O2VL 3A21A 4A3YA 1RJYA 4UDTB 2CK0H 4UTBL 1HDMB 3BDXA 2YPKA 3NOIA 1NOUA 2Y6SC 2ZKHH 3VRIA 1X7QA 2WMIB 2ZSVA 4OFIA 1EVUA 4QNPF 3V0AC 1V3LA 4UQDA 3TTOA 4Y5XA 5I1CL 5EC1A 5EBWB 3RHWF 3S96A 4HBCH 2NY1B 2VKXA 4QHNB 5I23A 1IC4H 2KH2B 3QJFB 3VGAB 2RR3A 2OWCA 3IDYC 3LKQA 3C60C 3MV7D 5J56B 5HHPB 5DDHB 3QCUH 2Z35B 3IDIA 3RWJB 3QXWA 5JPMB 3KJ6L 1MRCL 1PLGH 1WBZB 2F5AH 2XTJC 1BGAA 4Z95H 2V38A 3AXIA 1QLFB 4HWBH 3MV9A 2YD9A 1WFOA 2IQAB 1MY7A 3TV3H 2CBUA 2DT1A 3CX5K 4HH8A 2IUZA 4OCMC 1D5IH 1UA6L 1GPOH 1UM6L 1W0VB 5EUOF 3VI4E 1WP6A 2JTDA 1GRWA 1HKFA 3AIWA 4QGTA 1PZ2A 4H5SB 1V08A 4X80L 1U42A 2EXOA 1XYZA 2X4RB 4IOIA 4GW4B 3S36X 5HDBE 4UT7H 1MLCB 4MGXA 1RZGB 1DWHM 3JTTA 4TNWF 3OAYH 1MJ7H 4HIJA 4HIXH 3QIUD 1KCRL 4JFOA 5KBNC 3D2UD 1KBGL 3VFGH 4PRID 4IPLA 3MTRA 1T89C 4ODHH 4UFMA 3QUYD 2NPLX 1FL6B 2AEWA 3THCA 1NSNL 4G43B 2UZIH 3KYNA 3IJ7A 5TE6L 1NP0A 1ZVSA 1VFFA 4L4VE 2VC9A 4G8GA 4Z7VB 1BQHA 3HG1A 3VFOB 1ZA6A 1B2WH 4XNYL 2R2EA 4ZNEE 3WFCH 1HH6B 4NGHH 1CWVA 5DJ2B 3IYLW 3ZE0F 1JPFA 2GSJA 3U0TB 4P23C 4LDOB 4FLOA 1K9FA 2UY5A 5ICZB 4DJMA 1ZANH 3RZCA 1B3XA 2CDEA 3SGEI 4W86A 2O9OA 1IKFH 2NY5L 5I74C 3Q3GA 2YPLE 3OJVC 4GO6B 3RVTD 3K4ZA 3O6ML 5F72S 5KZ6A 4JFEA 3DX6B 5F7DA 2HFFA 3NACH 1E28A 4JPWH 2VQ1A 1CPUA 3BD3A 3WSQH 1GZQB 1Z3GH 1LEIB 4YWGL 1IGMH 3U1SH 4FQXA 3HNTH 4HAGA 4Q9QH 1ETZA 2VX6A 2BOCB 1DUZA 1PQZB 5KS9B 2E9LA 2F53D 2RIKA 4XZUA 3DGGA 1CGSH 1HINH 2R1XA 4X7TB 5K9OA 3RTQB 4OZOA 3CFKA 4OZGA 1PG7H 3P4NA 1KR1A 5D71L 4C54A 1KCKA 1C1EH 1GYAA 1RD6A 4S1QH 1KB9K 3BMVA 1UKOA 3F5WB 4EIGB 4XHJC 4WF7A 4AD1A 2BJML 4Z0XA 3EYOA 5ESQB 2GFBB 3LAFA 3I6GB 3W39B 3L4YA 3PDDA 1UG9A 2VDQH 4KRNA 1PW3A 1P9MC 3GB7B 2OYLA 3VM5A 1OIFA 4PMRA 1AP2B 2BVUA 2JF1A 3SEPA 3HPJB 1EEYA 1OAXL 4O5LL 4K3GA 5GJTL 4N1CA 2H26B 5HBBA 3L3JA 4P2RD 2BNQD 3SKNB 3ZHKA 1GAFL 5ALCH 4YN5A 5IMOA 3JWOC 5K9JH 1WEJL 3WEOA 4A6YA 4X6EB 4I77H 3RY6A 2R1WB 1X4ZA 2AK1L 4M4RA 1ZS8B 4P5MB 4J3WA 1X4XA 5DTFB 1MUJB 3GSNB 5F7EL 3TBWA 3A23A 4JKLA 1GONA 3O9WC 1Y7VA 2VLJB 4JZJA 5B39B 5HYSB 1WBYB 1DZBA 3U82B 4Q6IB 1U3HB 2MHAB 1RIUL 3VO0A 1J5OL 4F37K 1UD3A 4MHHG 4PJ5A 1RVFL 1JNNH 4JDTL 5C0CB 3QNXB 4HJ0D 3KL3A 3TWCL 3NIDF 3OR6A 4AQOA 1CD8A 4FNUA 1MHPH 4YHGA 1IGTA 3AGVA 3G04B 3SCMD 5KSBE 1V3MA 2DQGH 1R47A 3CX2A 4GKOA 4LRNH 1G0CA 1NGYB 2ZUQC 1G7QB 5LA2A 2WMPA 3RX5A 3ARED 1QSEA 3C9NB 3QDGD 5T3ZH 4KK5D 1XGUA 1LO2H 5DVLA 1UD8A 5C09D 1EFXA 2X1XR 1IEAA 3ZE2E 5ACZB 4PUEA 4OCSH 2ADGA 5DK3A 1CFBA 3P4MB 4Y19B 1F90H 1T0PB 3UTTD 4HX1A 4PJHF 2P48B 4Y7EA 5M17A 4XPGL 1IGCL 3GXNA 3IJSA 3U57A 4P2YA 3P9MB 3OAUH 4P5TC 4YBLC 3TBYA 2FGWH 4UINL 4G80B 5MENE 2AABL 5T1DH 3CHFA 3RILA 1E6PA 4F7PA 2R56H 5BRZB 5ISZD 2W62A 3M45A 5CEZE 4AMXA 5GGTL 3SBWC 4HHAA 3CSYA 3I3EA 1OOAA 4ZG1A 1AXIB 3W82A 4K7FB 4JHOA 2H2SD 3WFDL 5GGUB 1S78C 3ECQA 2B20A 5MEPB 4PTXA 2C4FT 5LBSH 2AXFA 2WLYA 3A67H 3FQRA 4WWKD 1AMYA 3HC3L 1LMKA 3LDBC 5LGKA 1AQDB 5IXEA 4G6AD 1FV1B 1INQA 5TF1L 1B30A 5JBEA 1E15A 4R2GB 4MJIA 4HS6B 4MCYA 2PR4H 4ZO8A 3PWPE 1CWYA 4KKBD 4U7KA 3T09A 1HJUA 1Q9LB 3FT2A 2CKBB 1FAIH 4AZBA 3IU4H 1U3YA 3VX0A 3B9DA 3NUKA 4X4MA 5DJ6B 1L9NA 3O2DL 3DXAA 4PRNB 3BN3B 5CGTA 4CRPA 5ITFA 3LKSA 3VNZA 5FYKU 1YMMB 5GHWH 1NCAL 4DW2H 4UBDD 1EIBA 5B3NA 3DI2B 4GQQA 5IF0A 3SGKA 3V6OE 3R1GL 5C0DA 3P4LA 3BZ4A 3VFSA 4YHNB 4DWSA 1TFVA 4R8WL 4FFWC 5T1MA 5EZJB 4PJ9A 3VWJC 2IPUG 3BPOC 3MNWA 3F6IA 1FH5L 3VH8A 1EXPA 3TTSA 1LJYA 2I60H 4CMHC 3O3UN 4ZFOB 2QQLL 1T2JA 5D7LA 1BQCA 3B8YA 1FFPA 1R5VB 1E1FA 4NT6B 4ENEC 4Z7WA 1S7XA 3C6SA 3PG2A 3PV6B 5E2UH 4OZFA 1MVFA 1MFCL 4PR5B 3ARDC 1CECA 3WLWD 5B38G 2Y23A 3JTSB 3PBGA 2BNRA 3I6LD 3VXUA 5D72L 4PG9A 3EYVA 2VH5H 5T3XL 1OPGH 4OTXH 1R87A 1BREA 3HE6B 4ZFMA 1QSZA 4GKZA 1CXEA 3BIAX 4ERSL 1FGNL 5IBLD 5IVXB 5DK0A 2E9WA 5E00A 4D9LL 4M61B 4NPYA 4V2BA 1TTGA 4JREB 3NIGE 2ZUMA 3FFDA 2IANE 2HMID 4H88L 4OCWH 3CFJA 3FFCA 1V03A 4ZSOE 2DQDH 3SKOB 3SDYL 5EOQH 1S9YB 3JV4B 3SJVB 2P24B 3HCVB 2Y07L 1QI2A 3ARBA 5FKPA 4FP8H 1RAMA 1XSJA 4OLVH 1ONQB 5LVEA 1WUNT 4V28A 1YJDC 2WMJA 5IHBA 1MQKL 2A0LC 5D9SB 5HD8C 2A6DB 2VISB 4HIEB 4MA3B 1TVDA 4RDQF 4HBQA 4Y2DC 3WUEA 3ILPA 3TVMA 1BJMA 2ICWA 4TTDD 4XI5D 3CC5B 4I0PC 3S5LB 5C71A 4WU7B 1ITXA 5CJXA 1JG9A 5A3HA 4X0NA 4GS7C 3NMEA 4LP4A 2YS4A 4MQ7B 1I8IB 1K8DA 5BMFH 4D0DA 2PTVA 4X4XA 4D3CL 1F45A 1MFDH 4AIZB 2I5YH 4M62L 2DSVA 1RZFL 3GIVA 5CGYC 3QG7L 2IANB 2UYLA 3N1FC 5JZ7D 4DM1A 4DVBB 4YO0A 4TOQA 4Z2HA 2PXYB 1UWEL 1D5BB 1KTDA 2DRUA 4HFUL 2B1AL 1PDKA 1HIMH 2A1WL 3QQ9D 3B3IA 1YEFL 4G8FB 3VXMD 3EOBA 3AS1A 3DV6A 4H25B 1NP2A 3T4YB 3FT3B 3SE9L 5CIPA 5L88H 1YN7A 2GJXB 4WUKL 4DZBA 5D7IA 2D4DA 5LQBH 3W4RA 1GH7A 1TZHB 1PX3A 2Z31B 3BKJL 3RWIB 4HGMA 3WEMA 5BZWB 1CIDA 4FA8A 4MAUL 3P11H 1OWQA 1BM3L 5GS1C 4XVSL 3ULUL 3QUZD 2VRKA 5CPQA 1AXSA 4KTDL 5I66A 2QSCL 1J8HA 1K8IA 1QO3A 1TA3B 1BJ1H 1TJIL 4FQPA 1JAEA 4MDPA 1ZE3C 3KPPB 2FL5A 4IRJC 3I3BA 5I0ZA 5DR5H 4PGEB 4HC1L 4LDEB 3WLBA 1QWNA 3BEWB 4OFYD 4Y5YA 5JMRA 2Z92B 2R2HA 3DRQA 2Q8BH 4QHUB 3FQTA 3TO4C 2NY0D 4AL8L 3RVVC 3QDJA 2GAZB 3WDHA 1NC4A 3LS4H 4YX2L 1MCEA 4ZDHB 3NFSH 5HYJA 2CXKA 4FTVE 1E71M 2ATKA 3WH5A 2YK1H 4FFZL 4RGOL 4NQEB 3T0AA 5D7JC 3NAAH 3ZT7A 5F7UA 4GQRA 1Q6GA 4OFKA 1NOWA 4QCIA 4L3ED 4TUKL 1UJ3A 2PO6C 3AS0A 3GI8H 5F1IA 3R8QA 4ODSL 2RGSA 1NWRA 5CEYB 5EU7C 3VXSD 1U8NA 5EIIB 1MFBL 1BZ7A 4AZ8A 3M7SA 3SDAB 4OZHE 3GJEA 5D4QA 4OF0A 1YNLL 3GKWL 3IXAB 5JHDE 4LSVL 2J8UA 5GJSL 4M00A 3CLFH 4WO4B 3DMMD 3OX8B 3O2VH 1H3TA 2J77A 5T1KA 5BXFB 2UZXB 3N50A 4UTBH 2HVKA 1VFAA 1M05A 1ULVA 2HJFA 3W37A 3VGEA 1Y0LA 2VC2H 1A3QA 3PHOB 1FZOA 5DRNA 2IH1B 2RGMA 5H35A 5FA4B 2FX7L 1GZPA 1G7HA 2AEPH 3F12B 3W0WA 1PZ3A 2XSAA 4M7JL 1MAML 4GAJL 1A9BA 2JB6A 5DT1L 3VJ6A 1QI5A 1CCZA 2XWDA 1GCFA 3REVB 1HYRC 4X6DA 5GSVA 3RGVA 2G3NA 1D9KC 3EBAA 4K7PY 3SPVA 3KJ6H 1I85A 1BD2E 5F7MC 1QNZH 5A40E 1EEZA 3EGSA 2OJZL 2APFA 3BSZL 5E8EA 5LWYL 4U1HA 3F5JA 5DJDB 3POCA 1UA6H 2OTUA 1KWKA 2G5BB 4HJGA 2J7BA 4PRDB 3U30C 4GLRH 2YKKA 5FKAA 4RFEA 1CBVL 4Z7UA 5TJWK 1RULL 5IR1A 1OT1A 3PWUA 2QR0B 3P77B 1AI1L 2WZHA 3QJHB 3A6BL 3VDBA 3WIFB 4Y5XC 1G0YR 4ZS7L 5E9DD 4ZFZB 4ZXOA 3ULVH 5HYQA 1KCRH 2F15A 5FL0A 1KBGH 2BMKA 4J3XA 5CMAA 1N6VA 4PPTA 2ARJQ 5I79A 1JJUA 1JPST 3GJFK 1NSNH 2DYPD 3CXHJ 3U7YH 4PJGA 3MRRB 2IPUK 1UVQB 5A43C 5EBLA 4QXTB 1J10A 4XNYH 2NW3B 3LXAA 4R97C 4G6FD 4WTXA 4WW2F 3AXLB 1U41A 3HAEA 4LAJH 3FO0L 5DYOA 4LLWB 4LYQA 3HRPA 3WF0A 3FAWA 4HIHB 4C56E 4OCNC 2GTZA 4EJ1C 5B8CB 1ZT4A 1PG7W 4Y4KB 1JWUA 2BSSB 1KIPB 1W72L 2NY5H 2ZOLA 4F7EB 3TBTB 4NRRA 2PF0A 1KQYA 1VKXA 1LK3L 1NH6A 1QBAA 1IJ9A 3EOAA 5C8JB 1JNHA 1KACB 4NO2A 4PTVA 1W0WB 5HHXL 2WMGA 4W89A 1Q9OA 3TNNB 2GSIA 4X6BB 4YWGH 4YEEA 3MNVB 1RJZB 4JFDE 5HDLA 1NC2D 2MQ0A 5IBTH 1S7SB 1MREL 2XN1A 4F66A 4JM2D 5CKGA 3BPCB 1IC7H 5GGTA 1R75A 2JEQA 2Y36L 2QLYA 1LK2A 4PMUA 5D2LB 1S5IL 3RDTD 1K3IA 4LCWB 4DUXA 4Q7NA 1FNEA 1KEGL 2ESVA 5JR1L 1CE1L 1XGRB 2VXUL 4NZRH 5D71H 3CVHL 1BIIA 3RZCC 1C92A 5DJAA 3OLDA 4QRSA 4M6NL 4OF6A 4MNGA 4XV0A 3VXTA 4LGPB 1E27A 5ABEA 4C56B 3VFTB 3N0PB 1N4XL 3O4LB 4E9LA 4HA4A 2XKUA 2DLFL 3OF6A 5BV7L 1PKQE 3CPLB 1FZKA 3ARZA 3VWKC 1W9PA 2DL2A 5IJKA 2CIPA 1OAXH 1MJUL 2GVYA 4O5LH 5GJTH 4FQXC 4Z78B 3QA3B 5TH2A 1XCTB 3STBA 1WBXA 2WVVB 4NQDD 1WEJH 4E41A 1IBGL 5H37H 4BH8B 3QSKB 3SDXA 3PZOA 3GUTA 3V52L 4KRPD 3QEHA 5HHOE 4RQQA 2J8GA 3ZMRA 1UB5A 3QT2A 1DVFD 2AK1H 1WWAX 1T04A 2IPTL 1RZ7L 2VITB 5I73C 5KJRL 3UPCA 5DMKA 5F7EH 3DYMA 5C1MB 1U8HB 1I3VA 2CXGA 3BO8A 3RVUD 4TNVF 2V5YA 1JF1A 3WFEL 4CKVX 3G5YA 3F7RA 4MB1A 1LWRA 4ODTL 4HKXB 3MMEA 1HWGB 3UTSD 4UIMB 3HE7D 2VABA 1RIUH 1J5OH 3CDGA 5D6CB 4N0YH 2YD7A 4Y4FC 1RVFH 4JDTH 5K9KA 1QI3A 1SJEB 3A5VA 1DCLA 3TWCH 5LXGL 1B3JA 1QACA 2EH8L 3CUIA 3MI6A 3HAEH 1OF2B 3WCYA 4ZS6C 1Z2KA 2FE0A 4JKKA 1PS3A 4HUWB 2O9PA 4DOHB 1R33A 2NY1D 4EZMA 3L4UA 1QNSA 3UZQA 4FLSA 3GNRA 5DD1L 5JXEC 4JZJC 5J89A 5KSUB 3DSFH 2B2XH 1X9QA 2J4GA 5EU5B 1V7ML 4XNQA 4CJ0A 1EJOL 2EXYC 5KAQF 1UWRA 4U3AA 4OZIA 1IGCH 1KJ2L 1FCGA 1S9XA 4IDJH 4AEFA 4WI8A 5SWSA 4GFTB 1QQDB 2YD3A 4UINH 4ODUA 2V5CA 3H7BA 3K8MA 3ZKSD 3SDCA 4F57H 1QFUL 1X5HA 3C5ZC 3BKML 3RP1A 3VI4F 3U4EB 5GGTH 2X1OA 2GW5A 4GG8A 3SIMA 5EDXA 1ZSDB 5KVDL 8FABB 2DKMA 3Q0HA 4J7RA 9CGTA 5HDBF 4PIRF 1YHTA 3P40A 3HC3H 1WC7B 4ZO6A 4F15C 2JIXB 5FO7A 5CP7B 4XP9L 2OTWB 2XPGA 5TF1H 2GJJA 4Q9CA 5DUML 4WI9A 1FP9A 3MLVL 2OWWA 2HISA 3QUKB 3BQUC 1ZLSL 5A3ID 1MYRA 4G9DB 3P9LB 1OD0A 3D39E 4QRPA 3O2DH 4YNYA 1X5LA 1NCAH 1LO4H 1DUYB 1QLEL 2XTJE 2OK0H 3R1GH 4HEPG 4HMEA 3EYSL 4U7MA 3ILQC 2MPAL 4XRCB 3FT4A 3H6JA 3B83A 4YK4C 3S88L 1JWMA 1I3GL 4Q0XL 3UESA 5HI4D 2VR9A 1FH5H 4KPHL 2Q1EA 4U1IB 3M46A 2OW6A 5IKCB 5IBUB 2QQLH 1W9VA 1US3A 1JDDA 3MA9L 1AH1A 2EDFA 1IEHA 2ITCA 3GSQB 4U6VL 4JFHE 1AD9A 5C0BA 2Z8SA 3BZEB 2G9HB 3OKLA 1G84A 1KNOB 2DGAA 1RZ8A 3V8OA 4KKLC 3RTQD 4HC1A 4LK4A 4L4VD 3SGKC 4YHEA 1T20A 4LIQL 1R3LB 5T3XH 4IIQA 5DMGC 3TN0B 3H8NA 1HXMA 4DWSC 4N8VB 4Q2ZA 5FO9B 4NCC2 4ERSH 1DBKL 5C9KA 4PJ9C 2ZUNA 4D9LH 1RMFL 4J8RB 2IADB 3UZVB 1E56A 3CH1B 3L3GA 5F89A 4BELD 5AD0B 1SBBA 3ABZA 4LNRB 3VFNA 3CZLA 1TCRA 5KSAA 5FDYA 2YPLD 1X3DA 1H3PH 3O11A 1N8ZA 5E2WL 1JYNA 1HK6A 4H88H 4LVHB 5LCVH 1NGZB 3KPOA 4K9EC 1OCWH 1O7VA 3E6FA 4TN9A 4Z5RA 3QEGL 3SDYH 1BSIA 2OSWA 1DN0B 1UH4A 3JUZA 5HGAA 3QWOB 2Y07H 1JIBA 5I24A 1D5XA 2QADB 2EDHA 4FN0A 5INCB 4ZEPA 2FWOB 2C26A 4P2QA 4PGDB 3NA9L 3KWXA 1YYLL 1MQKH 3MLRL 3RY4A 3MJ9L 4LLDA 3MMWA 4PTUA 1I9RL 1NMBL 5F9AC 3GXMA 1HVQA 2VLJD 4I18A 3SE8H 1B0IA 4HMCA 3HKFA 4YHLH 1NGWB 2MMXA 3F62A 5C0EB 1U3HD 4J1UA 3ZIZA 2E6JA 1JGVL 1DBAL 1LGVA 1H3XA 4JFFE 2R1YA 3G5ZA 1SEBB 4OLUH 5HY9B 4PD4J 2KBGA 3GMPA 4M62H 4P23B 5FM5O 1RZFH 3QEQE 5J7CC 4ATLA 1N7ML 3ZR6A 3KPQA 1G7MB 5DEGA 5A69A 1RH9A 1KXTA 3FONA 2MOVA 5FM5M 1S7VB 1UWEH 4LCYB 4PJXB 2NT1A 5A6JA 2AV1B 4WFFE 4HFUH 5KSBF 1W1TA 1VFBA 4OBRA 2X4SA 2A1WH 4GW5B 1PPIA 1YEFH 3AU1A 2C3VA 4WWID 3VGHA 3TCLB 5D2NB 4XB3A 1X5JA 2WHKA 1MRDL 3MRIA 3N1QC 4E5XB 1ZBCA 3SE9H 2V3GA 1TNNA 3PZ9A 3TVMC 3VG0L 3BAEH 4KDTC 4QHLA 1ACYL 4NO0D 5INDB 3QEUB 3L3IA 3ZE2F 3BKJH 2VIRB 2RFXA 4ISVB 3P30L 5FL1A 5DJCA 3K3QA 1IL1B 1FO0L 4MAUH 4HOWA 4NN7C 1S5HB 3ULUH 1NM9A 2YL8A 1KTLB 5ESVA 2EZ0D 4KTDH 3REWB 2QSCH 4TNVK 4UMGA 1TJIH 4OM1L 5DJZB 5E8PA 4Y1AB 4AJ0A 3QUMB 1AQKL 2YSSA 4OCRL 4LSTL 4M1RA 4HC1H 4OUUA 4PBXA 3AIQA 3DVNB 3QEQB 1JYWA 4P4KA 1GGIL 1XZ0A 2J3SA 1I1FA 4AL8H 1VENA 2IG2H 2IXUA 5IVOA 1ORSB 2ENSA 1HNYA 1CXLA 2XZZA 3BN9D 5F7LB 4PP1C 4ZUWA 1NMCC 4P2OB 4AZ6A 1F4WL 1W72A 2HFTA 1I1YB 3KPMB 4FFZH 4RGOH 5D1XA 3SURA 4LNVA 1YC7A 3L4XA 4F7TB 4TUKH 3I75A 2NQCA 3G6JB 4CKQA 3RA7L 2AXHA 2I9LB 2XYCA 4M1GL 1HSBB 5GNZA 1CLVA 3MLZH 3GI9L 1T83A 1T03L 3PNWA 4CUCA 3PTMA 3MLSL 2XN0A 3CO4A 4FQIL 4PJCA 2IAMD 4ZFGH 1E73M 2V2WB 2AAAA 3GKWH 3LB6D 2F7QA 2H41A 4LSVH 5MEND 3H53A 5GJSH 2X8RA 3O9WB 4Y5YC 5CHNB 4ONOA 5CEZD 1JDCA 5F7FA 3H9YA 1AGBB 4DKEH 4BFEA 5J1AB 3II1A 3VMOA 2AJSL 5HDRA 3CVHA 1WICA 2FX7H 4AYSA 5FGBC 3KXFB 5ICYB 4PGJA 3QIWA 1MAMH 4GAJH 1IC5L 1V7NL 3MV8E 1OM3H 3V6FB 5DT1H 1MCQA 1BOYA 1U9KA 1MCDA 4KROC 1G9ML 2CLZB 5FA3A 3TPKA 2ZG2A 3FKUS 2HT4C 1CFSB 3B8SA 4HZ8A 1UJ3C 5CSGA 4TUJB 1F3DH 2C1OB 1G6RB 4IDLA 1UZ6E 5DJ0A 3PABA 3LKNA 4YXKL 4IBLT 1UXWA 3UJIH 3Q5TA 5AWNL 4M6AA 2OJZH 5F71A 1I7ZA 2FGLA 1CLCA 1NWSA 2FJHB 4XPBL 4P7OA 3HE6D 2JLLA 4U1JB 4XPAL 4W8AA 1Z9OA 1YUHB 2PC8A 4PYGA 1X5XA 3DX7B 3ZJ7A 2D24A 1IZKA 1XR9B 3IS1X 1CBVH 3GXFA 2CITA 5CILL 3ECBB 3VGFA 1H49A 5AC4A 1HQRA 1AI1H 3WH8A 4P5TB 2KKQA 3A6BH 4FNLL 1GOGA 1VA9A 3F7YA 4ZS7H 3NIGF 1HJXA 3X13A 3X12B 2A73A 3HLAB 1R5WB 3H9SA 1Z9LA 3RGVC 3DGCR 2J47A 2ICWI 1OGTB 3DV4A 3GJFA 3MYZA 2UWEA 1JP5A 3F58L 5BQ7B 2FLRT 1I85C 2XZAH 3MRJA 1XC6A 2VJXA 4M8QB 4NBYB 1A2YA 2YRPA 5L8JB 3GXIA 3CFBA 1OP9A 4MA1C 3GNML 1B3WA 2ITDB 1FNGB 1DP0A 1P7QA 2XIDA 1SBSL 4GAYA 1UWSA 1MVYA 4DN3H 1BFOA 2HLFC 4ZXBA 2BRQA 2W9EH 3FO0H 3PGFL 1E6JL 4E0RA 5B38A 2J74A 1MI5A 4F2MA 1MCIA 4MJ5A 5IB3A 4OOUA 4GLRI 4JRWA 2ED7A 2PTTB 2YD4A 1W72H 3HZMB 2Y1VA 3TA3D 2ALWA 3CZEA 4TVPE 1BTCA 2F74B 2W9DL 3OJDB 3HZVA 1LK3H 3VXPA 3HZKA 4LPXA 2WAGA 1KJ2A 2IAND 3LKRB 2ED8A 1JN6B 1HEZB 4B3LA 4EKXA 3VWJB 2BNUA 1MREH 5FUCC 3KL5A 1U8PA 4UV4L 4ZAKB 2BK8A 5CSZA 4LASL 4EI5A 2Y36H 3QZWB 4LVNB 4Y4HA 3PP4L 1XD0A 2VXUH 5EU4B 5GIRB 3DX2A 2Z31D 4FQQB 2W5FA 3KPSA 2NY4B 2N7BA 4U6XA 5DC4B 2NXYC 3PWLA 4U33A 1N4XH 4QOKB 5F3HB 2C7FA 4X98A 1BGGA 1VGKA 4MAYD 3BP5B 1LO5B 1U95A 1EXUA 2DLFH 3IAPA 5BV7H 3AIBA 2ZIDA 3GBML 1OT2A 3X14B 3C8KA 4JAWA 2Z8RA 1N59A 2PBOA 5TQ2H 3EFFA 1XF5B 2BCKB 2X2YA 4TX6A 1KXHA 3DX9B 3GFUA 1AGCB 1JHTB 1CXHA 1K6QH 3MRKA 5DVMA 2VDOL 5DJ8B 3QFJA 3BGMA 1SZNA 2OJEA 1B1YA 4E8DA 1JXJA 1TCMA 3AC0A 4LGSB 4X9FA 1AGFB 1PKOA 3T2PA 1IBGH 2R8SH 3JZ7A 5J11B 4S3JA 1WZMA 3V52H 5EC2B 1NBZB 4NQED 2P5WE 2IPTH 1RZ7H 5KJRH 1QWUA 3N11A 5DGRA 3QQ4B 2R0LH 3ZTJG 4W81A 3WFEH 1KCUL 1OB0A 2KZ1B 4AZHA 4XGZB 3E6HA 1WGOA 3BIKB 3GJFH 1U8LA 1UUQA 2JJVA 3IFNL 4OZHF 4QLRA 2CIKB 5IJKC 2OLDA 4HLZG 4UV7L 4XMLL 2N1KA 4QRRB 3C2AL 4W88A 5ERWA 3CTTA 3UXFA 3RRQA 4Y5VB 3MFFB 5CPTA 4AK1A 1T1ZB 2A83A 1ZL1A 1YZZA 2Q6WA 1ISZA 1ZHKB 2X4OA 1FP5A 1X4YA 2EH8H 5GGRB 4B7IA 1AD0B 3AAZA 1FHDA 3D25A 2GHWB 3BVNB 2GT9B 3IB4A 2HWZH 2EAEA 4GO8A 4OI7A 1UM5L 4PREA 4IS6A 2VRQA 2O5YL 4D2NA 1EO5A 4NQCA 1UR0A 4IOFC 5DD1H 3QG6A 1M7DB 4AD0A 1YEEL 5C8BB 4Z77B 4K94L 3OGVA 1V7MH 2GY5A 3M17A 3UCQA 1EJOH 1B3ZA 4R4BB 1U8QA 1WAAA 6A3HA 4PYHA 4YDVA 2FYVA 4POZD 5AYUH 3OXSB 4XVUC 1J0HA 3FRPG 4YJZL 5C07B 32C2B 4PB9L 5EU7E 2NZ9C 1MHEB 1KJMB 1VB9A 4JR9H 4K7PH 4M43L 3QDAA 5JHDD 1W91A 1AIFB 1VHPA 5GS1B 3O6FA 1T1YB 1SJHB 3SCSA 3IDMA 1QHZA 3GSXA 5T5FL 4XBPA 1MVUB 2B31A 1QNRA 3DDGA 3E1F1 3FMGL 3GZKA 3WNOA 4RE3A 4LSSH 1QHPA 1C5CL 4XP9H 4M48H 3RWDB 3HMWL 3SDDB 2CR3A 5DUMH 4PRPA 3MLVH 5J12B 3TO4B 4NRSA 3SCUA 3EMCA 3DVGB 1ZLSH 2V9QA 5E5MA 4APQC 1ED3A 1TLKA 3P4OB 2XG5A 3RVWC 1BD2D 1JV5A 3SDCC 4CNIB 2UUDK 4R0LA 4HKZB 1RZJH 2WC4A 1QLEH 1AKJD 4DN4H 3D9AL 4R7NA 1DEEA 5C0FB 5DURB 1GOHA 3FB6A 2W65A 3QWRA 2BFVL 1A4KA 3EYSH 4KTEL 4BQCA 1QW8A 4FG6D 4Y4KD 4BUHA 5JIWA 3DPBA 5HPMB 2PW1A 1AY1L 3DECA 3IDGB 4Q0XH 3S88H 2VDKH 5I8EA 4UTAH 2HKFL 4NHUB 4ALAL 3ARFB 5ID0B 2QMJA 1NCWL 4X99B 5A6LA 3VILA 4OD3H 4PJEB 5EBMB 3TBSB 2EEBA 1FO0A 2XM1A 3LMYA 2FHBA 1NOFA 3MA9H 4C55A 4JFQB 3TH3T 3RJYA 3KGRA 1IQWL 1VGEL 4U6VH 1FZMA 1I8MB 2DWEB 2BOBB 2MFNA 3PF2A 1V8HA 2VXTL 3SOBL 4DVRH 1YC8A 1U8JA 4BH7B 3VCLA 4UU9B 1DDHB 1FSKC 1LD9A 1FVCA 3BH9B 1C5DA 4XNZC 1T2XA 3U0PA 4QHKI 4CD7A 2Y5TA 2R9HD 1Q9WB 3MV9E 5IW3A 1OAYL 1UT9A 3GGWB 4TSAL 1DQJB 1UQSB 2HVMA 1XH3B 2DJSA 3HRZA 3MOBL 3U7AA 4C56D 3HG3A 2LAAA 1RMFH 2JK5B 1UACL 3O4LD 2W4XA 2YN3A 5ELIA 1BG4A 2ZUYA 3KWWA 1MCBA 4GRLC 5F9WC 4ONHA 1MW2A 3D5OF 1RK1B 4DCQA 3WHXA 5E2WH 3U30B 3ULUC 1KT2A 1RK0A 1YPZB 1IAOA 2ZP0T 1X7QB 3FO2A 3DX8B 2VZ1A 2VCAA 4EI6A 4NF7A 3EJUA 2F9BT 4NDMB 4ZD3L 5TPWL 4P5KA 5ABGA 5HXMA 3BD5A 2G3MA 4D6IA 1ITCA 5HI5C 2ZUVA 3NA9H 1MCPH 1YYLH 3D3VA 1UKTA 3MJ9H 4G8GE 3WXWH 3MRQA 3HG1E 3L5XH 3L9RB 1I9RH 1NMBH 4MNQB 3NSXA 4TX8A 4NRZA 4JCLA 5CJOL 4NO5B 3CSGA 5FCUL 1W9DM 1ORQB 1QG3A 4WENB 3HC0A 5HVHC 5SV3A 5D5MF 2HYMA 5ENWB 2H32A 5KSAC 1F3JA 5C0JB 2WZEA 4QO1A 1JGVH 1DBAH 3WN5B 5T3ZE 5D93C 3RBGA 1ZLVK 4DFHA 1UM4L 1QBML 5IV2B 5D8WA 2GCYA 3L3HB 1BVKA 3QNZB 4D6CA 2V5RA 4KRUA 4JFEE 3FW6A 4DKDC 3L95A 3AMKA 3VE0A 3TONA 5DRWB 3JTTB 4MVBC 2IC2A 2XKNB 1XGTA 5FYJL 4PY8I 4UQAA 5E5RB 4MWFB 1E3XA 1MQ8A 4K3EL 2YBRA 5EFDA 4KGJA 3D4YA 4ZO7A 4MJ2A 4JJ5B 1Q0XL 4NOFA 4NN6B 1ISVA 2GJZA 4HDIB 5HHOD 4I18C 4H04A 2LAGB 5IB4A 1HKJA 4P46B 3WUGA 3VTRA 3IAQA 4G8GB 4OZGE 1TETH 4Z7QE 2DDXA 3CHCA 3HG1B 3P30H 4LMQI 1RV6X 4ZUVB 1T0OA 1ZA6B 4QKXB 1FO0H 5MI0B 1B3VA 5FO8B 2YD2A 2XVPA 3BH8A 4F7MA 4FHBD 4UT6L 3V5HB 1M4KA 3B6SA 2D22A 4G3YL 1L0XA 2EJ1A 4PJBA 2XFFA 1A47A 2D9QB 4OM1H 4RZCA 1ZB5A 1O7DC 1FORH 1CLXA 4S10A 1AQKH 4S2SA 3MRMA 4OCRH 3MXWL 4LSTH 1GVYA 3C87A 3OR7B 3KYKH 5M7QA 1N64L 5FHBH 5FCSH 1GGIH 3BZDA 1ECEA 3AZTA 2VAAA 1G9HA 3VWKB 1K3ZA 1T7WA 4AYFA 4NCDA 4MDIB 3BZFA 1F4WH 4L8BB 2GDVA 2W67A 1A4JB 1EAPB 1ETZB 3GMMA 6FABL 4PV9A 2ENYA 1G5AA 2DF3A 5T33L 5LYRA 1WCGA 1MCLA 3RA7H 3HB3C 1IAKB 4M1GH 3C08L 3GI9H 1FFQA 4CW1A 3QI9D 1T03H 2WP3O 4MAVA 3E2HB 3MLSH 1OTTD 5I73B 4HUVB 4FQIH 5EB8A 4RISL 4PJ8B 5FOJA 2DQUL 4GO9A 4A3HA 3MLYH 1UA3A 4UZGA 4Z0XB 4NFBA 3T0BA 4PJ5E 4P4KC 4TRPH 2WSPA 3BP7B 4EUPG 4AT6B 1JGUL 2DMKA 1EEYB 2AJSH 5FYKL 4OBSA 2F58L 2GDUA 3ZYZA 1V0KA 3LSOA 5B4MC 3HN3A 4MQXD 2VDNH 4Y4FB 1IC5H 1JFXA 4GRMA 2BSRA 3WD0A 5F6IC 5HHQA 2H32H 3QXDB 1OW0C 1G9MH 5I2UA 1FHGA 4LKCA 5ID1B 1ESWA 4HF5L 1QSEE 4PGBB 3FQUA 2V3DA 2FR4B 4W8LA 4EN3A 1T22B 4DAGH 4NKMA 1T83C 2H6PA 1K4DB 2DLEA 3VU2A 3VIHA 5AWNH 4JQXA 1HZHL 1ODUA 1TJGH 4V2XA 3D39D 4XPBH 3HI1A 4BYHA 1E4KA 4HSQA 3TN0D 3C6LB 3U6RA 1FRGL 2QLVB 4L5FH 3B5GA 3BT2L 3MBEA 2XTJD 4PJFA 4YC2C 2R0KL 2HT3C 5CILH 1OSPL 3V4PL 1N6QL 4BFGA 4PLKC 1BFSA 4KJPC 2E27L 4OLZL 4FNLH 2XN2A 3QIWC 3LPOA 2EPKX 4LLYB 1HYSC 3C5ZB 1T5XB 4ACZA 4G8IB 5C08B 4WFHD 3SE3A 2UY7A 4QYOA 5BV7C 3MYJA 3AIRA 2HJKA 3PUCA 5I1EL 1ZHNB 1V5JA 1I4FB 2HJLB 3SKUD 5B3JE 4V2CB 4MJIE 1TENA 4XZWA 3R06A 1XSIA 2FIKA 5BZDA 3CFEB 3V0WH 5JXAL 3KPRB 3B9KA 1BYCA 3CMOL 3WS3B 4BSVB 4X4ME 3DXAE 2Q76A 1L4IA 3BP6B 4HX1B 1CFTA 3TV8A 1ZWIB 2QQQA 3PGFH 1E6JH 1HOCA 3BQUB 5CINH 1XRVA 2OW7A 2C4FU 4U5KA 4RA0C 4TVSa 4OQTL 5IEHB 2AK4A 4DGVH 4NNYA 4AMKL 4QWWC 1BZ9B 2CKRA 2HH0H 2N56A 1CDUA 2OXHA 2WAHA 3IU3A 4F7PB 1D2KA 2FEDC 1EDGA 3GSUA 1JGDA 1H3GA 1NCDH 2QHRH 2FH8A 1TE1A 1IM3A 1TQCB 4P23D 3WL9B 4FFYL 3ZO9A 2E9JA 3QQNA 4NWUL 2EDBA 3L3DA 1OTSC 2EIEA 1U3ZA 3OB0K 3QDMB 1XH0A 3KR3L 1DWGM 2WNGA 4XVJH 5D7LE 1H8SA 3IJ9A 5JIHA 2WZIA 3HI6H 4TPRL 4YDLC 4AZCB 4CD8A 1HQ4A 3HPLB 4Z7WE 4PEEA 4UV4H 4NKOB 3LKPB 1UZ8A 3SN6N 4MJIB 3LKOA 4ZXBC 1KN2H 3ZDXE 1MNUL 4L8CB 5D70L 2BNRE 4M1DH 1QRNB 3VXUE 4F80A 2H9GA 3TZVA 1T0MA 4CCDA 1I9JL 4LCIL 2KPNA 2VSCA 3BDYH 1NJ9A 2EE2A 1Q9KA 4MHHI 5IF0B 3RWFA 1K9TA 3ZJ6A 3T77A 2YD8A 1H0GA 3EO1B 1NMAL 5JQ6H 3BZ4B 3MFGB 4RX4D 3GBMH 3VFSB 1A0QL 1WKYA 1T4KB 4H1LB 4MXWL 1MFNA 4XHJD 3WFBL 4ZUSB 2DQCL 1H5BA 1ND0A 3VH8B 3H55A 3QEQD 4PSPA 2HVJA 2VDOH 3FFCE 5CGMA 4XP5L 5GGSA 4EI5C 4OGXH 1KG0B 5DK2A 3DX0A 1M71A 2EDTA 4Y4HC 3MJ8A 5A2FA 3DROA 4LYPA 4WFFD 2R4RL 1JZ7A 2GSGA 4XWOC 4MJ6A 4GKSA 5BS0A 3WQWA 5F9JB 1PJ9A 4GT7A 4LDLB 4PRBA 1KIQA 4WW1A 3ALFA 3GSOB 1DL7L 1YY8A 3VXNA 3ZYJA 1U8OA 3U46A 3KS0J 2WIIB 2VZTA 4M03A 1A3LH 4HUUB 4Y7MA 1UKSA 1YEDA 4Y89A 1MW1A 3L3OA 5FHAL 1CLYL 1NAML 2D31A 2NXZB 4GMSL 2D4FA 2XA3A 4BKLB 1H15A 4Y0GA 3WHE0 4UV7H 1QTYT 4XMLH 2L4OA 4OCYL 1LP9F 3C2AH 3FY1A 2CDGA 2FECL 2JB5L 1P4LB 3O9WD 5FDWA 5E00B 1XF2B 1RPQA 1N0LA 1PZ5A 2H3NA 1QR4A 2LVEA 1FYHB 1ZHLA 3VFRA 4OJFL 4YHKH 3CDCA 1AGDA 3WD5H 3CK0L 3UYPA 2P49B 3KXFD 5CJ8A 1IGYA 1OTUC 2Z9TA 3CFJB 3IFOB 1KLGA 2UY3A 2R29L 5ABFB 2DOCA 1U92B 2O5YH 2MQCA 4LSUL 4U6HA 5SWQB 1J1XH 4LKXB 4DM2A 2VURA 4ODWA 5A2IH 4K94H 1R6VA 1GJIA 1UZ6F 1GIGH 2WBGA 1GGYA 4JRYB 3F5KA 1R24A 1HP5A 3Q5YA 5D7IE 4L9LB 4HGWB 2W1NA 2ZSWA 3IKCB 2EIDA 1EOMA 1FIEA 4CVZA 2Q86B 4RGNC 3TVMB 3KVQA 4JQIL 2ICWJ 2OX5A 4PB9H 1LE5B 2WVTA 1P53A 3CVIH 2VZSA 4M43H 3MOAL 1J8HE 1ZGLA 1E0XA 1OAQL 1C7TA 4NN7B 3AXHA 4P5TD 1TUXA 4D0DB 4GI8A 1LEKA 2GTWA 2X4QA 1UHVA 1S7RB 3AFLA 1FJ1A 2P7TA 1NBYB 2UYLB 3BUYA 4N5EC 3HFMH 1TQWA 3PP3K 1LE9A 1C5CH 3QDJE 3L7FB 4U1NA 4BQ9A 1A6ZA 3HMWH 3MV8D 4RNRA 3D51A 4IJ3C 1NLDL 1BIHA 1S78D 3Q2CA 1T5WA 3GH7A 5C0AA 5J3HC 4D71A 1VSCA 4P0DA 1A1NB 1FL3B 3S6CA 2HAZA 1CXKA 1D6VL 1NMCB 3S8WA 4NNPL 1SFSA 2PCPA 5TDPB 2NR6C 3BVUA 5KN5A 4FXGB 4ELKA 3D9AH 1R5IA 5J6GA 4LCCA 2BFVH 3O6FC 4KTEH 3QB7C 4MB4A 2FCBA 2J8UE 1KJVA 3HMXL 3UBXB 1E4LA 3ETBF 5I66B 1GCYA 3WQ4A 1AY1H 3ARGA 1K8IB 2EC9U 3RX8A 1B2YA 2HKFH 3GRWL 4ALAH 3X11B 4OFPA 1ZT7A 2P5EB 4PMXA 1KBKA 1Q1JL 5F1OB 3UPRA 3U7BA 2V2XA 3IETB 5L6YH 4YR6A 4EDWL 3W0WE 2R2HB 4YHPA 4FFWD 4G8EA 3FQTB 5GS0L 3VWJD 3U9PH 2QSTA 3PV7A 2XWJA 4WDIA 1IQWH 1VGEH 2WW8A 4YLQT 1GSMA 5C0RL 5AAMA 3PDOA 3OBAA 4ZAKD 3G6DL 3EUUA 2J75A 1CICA 1JPGA 4X6DE 2VXTH 4J4PD 3W26A 1MHHA 3PQYA 3BRDA 5CCKL 4R0LC 2O92A 5HVGB 1OAUL 4PJAA 4ZUUB 4WSKA 4ENED 2OR8A 2PYEB 4UFKA 4LHUB 4G9FA 2GI7A 3SUWA 5TGBA 5TQ0H 1OAYH 4GZJA 4JHAL 2VWEC 3OLIA 1U8NB 4KTYA 1BZ7B 3NDYA 5KANI 3RIFF 3MOBH 2A3HA 2G75A 5HVFB 1TVPA 1T66C 1UACH 4X6FA 3CZKA 4HS8L 4Z7UE 2XACC 3LRKA 1IQDA 4R26H 1MY5A 5IM7B 4MQSB 1U58A 1NFDB 4K8RD 3VD3A 4YXHH 1QEWA 4KK8C 5E1AA 2ZOKB 4C7DA 2HJFB 3GM0A 3QIUA 4MS8C 1EX0A 1DQQB 4MNHB 1HL9A 3CUHA 5AYQA 2CPCA 5EN2A 1FZOB 1UH3A 2NY6B 1PBYA 4PRIA 3SCWA 4H2CA 2H2PC 3U36B 3FAXA 1GZPB 4JO4H 3H0TB 3W0WB 3OKKA 3T2QA 3Q6FB 2WC7A 4ZD3H 3W9EB 3VJ6B 5TPWH 4UB0L 4QT5A 4AYGA 5H94B 4KMTL 4PJGE 5TF0A 4LSDA 3QUXC 1XIWB 4GAGH 4PJ7B 1MCSA 2BVOA 4JGUA 5FUCE 1UWUA 3SCVA 2Z91B 1KPVA 3ALPA 4BA0A 4WW2C 4PRHB 1ZBKA 4FRWA 2DWDA 5L0QC 4ORGB 1BX2A 3WD1A 5FCUH 3TT1L 3QULA 2HLAA 4MA1B 4OV6F 3IDJB 4M7ZC 4KRLB 4CAGA 1V3KA 4UNVA 1S7UA 3QPQC 3UERA 5HD8D 2OTUB 2GK2A 2ILLA 4HJGB 2MKLC 2EIZB 5EB9A 5F1NA 4QRRD 2X0HA 4Y2DD 1EHLH 2DH3A 1UM4H 1BVLB 3QHFL 4JFYA 3KLDA 2JJUA 4I0PD 4BZ1L 4PV8A 1JF6A 3CZJA 2C3GA 4POUB 3DETD 2XY1A 3HG5A 3SKJH 4U1KA 5IB5A 1E4MM 5CSBA 2DN7A 4W93A 1I8KA 4I3SL 5B39G 5HYSG 1IT9L 2X6MA 1ZGLM 3L5HA 4MMZC 4C83B 5GRXG 4K3EH 1T6WA 5HGDA 3KYMA 2BMKB 2F53A 3WE6A 3CZFA 5CGYD 3MJ7A 1Q0XH 1FVEA 1YYMH 4MYWB 4ELMA 1MJJB 2P5WD 3DIFB 4KKCC 2ESVE 3DURB 4LPCA 4MADA 2CLVA 1G9MC 2X2JA 2J5LB 4ATDA 2ZX8A 4HXAL 2X4TB 4MNGE 2D20A 3WUZA 3EYUL 5C07D 4OF7A 1P69B 4D9RE 1A6VL 2GTZB 1WZAA 4KZEH 3FO9A 3UYOD 3MXWH 4HUXB 5IIEB 1KLUB 4OF3A 1P6AB 1ZLWK 1N64H 4P2RA 3W25A 5EBAA 1A02N 3ALGA 4MA8L 1TVBA 2N7AA 3QFDA 4PP2B 3EOAB 4FXKB 5JIIA 1JNHB 4WI4A 4NXSA 1BPVA 3GHBL 4E41E 4Q9BA 4OQTA 2VNCA 4X6CA 3SDXE 1Q0YL 1N5AA 4LXFA 3NPSB 3SDDD 5CSUA 1PX4A 5K93A 2YBUA 4XP4H 6FABH 2ZZUT 4F8QA 3GO1L 5FD0A 1CENA 1JMXA 1MWAL 1UCTA 3TO4D 3O2WH 2WZPD 5EWIL 2PI6A 5FGCB 3RVVD 5T33H 1RUAL 3J7HA 3C09C 1WZ1L 1P7KA 1MLBA 2HRLA 3OZOA 4U2ZA 1FNEB 3EBVA 3TLRA 4D1JA 1KB5L 1M7XA 1A3RH 4V1DB 3UX9B 2HT2C 2D3NA 3RO8A 5DJAB 4RISH 1FGVL 4XNMA 1CYGA 5D7JD 2FRGP 1E4NA 5EO9A 3GXTA 4KGLA 1E27B 1TR1A 3PL6A 2V5MA 2CGRL 2IALB 4U2YA 2YUZA 1FFOA 3W27A 4JRXA 1JGUH 3MKKA 1IEBA 3ARFD 1U8MA 5FYKH 3SCMA 4AH2A 4YHZL 4KMLB 1KCVL 2BS9A 3EAKA 1KPUA 2JJWA 2QSVA 5JUEL 3UG5A 3RBSA 1HCFX 5DQ9B 4P59L 3AREA 4DWHA 5IMLA 1T7YA 2BHUA 2OZ4L 3QDGA 1S8DA 5AG8A 5L2KB 1K9DA 1ZLVH 4HF5H 2AJYL 2BVYA 3B5TA 5EZLB 5C09A 3SDXB 1RP9A 4NKDB 1E4IA 3FTGB 5JO5A 5AC5A 2WUCL 4NNXA 3V6ZB 3GSVA 1QOXA 4FZ8L 4KJWC 4PJIB 3H9HA 4OZIE 1FH9A 3BO8B 1PY4A 1NGXB 1SEQL 1D9KD 5SWSE 1XYFA 1FRGH 1JF1B 3PZGA 3PZUA 4KAQL 3BT2H 4U49A 1OP5K 4O2CB 2R0KH 2YEZB 1HILB 1OSPH 4YHIA 3ULSA 1N6QH 4C7FA 3QHOA 3WMBA 3VFPB 3TT3L 2E27H 3CDGB 3NSNA 5IW1A 4Q58C 3F7VA 5DA4A 1KGWA 4YBQC 3L7EA 2G2RA 4RFNC 1PZUB 5FYLE 4S3KA 1CZ8L 1ZVHA 4LMQE 4XX1G 3IDNA 1V3HA 1NAMA 4L4TA 4N0UE 3BC9A 3QPXH 4EN3C 2PWGA 2CCRA 2B0SL 1KPRA 5IB1A 1AQHA 4NUJA 4AM0B 4JQXC 2VLRA 2GUOA 3ZKMC 2P8LA 5JXAH 1GXEA 4Z18A 1E4KC 1QBLL 3O3BB 1OGGA 1XF3B 2VN7A 3G5VA 3VXQA 3WUWB 4QRPE 4MNQD 3MBEC 1HHGA 3GH5A 1DWJM 3WO4B 3WDPP 5J0BA 3MV9D 3LIZL 4JIEA 3KLSA 1R3IL 4CL7A 4OQTH 1S3KL 4APQB 4U1GC 3K2UH 3TGXA 2FDMA 1GC1L 4AMKH 5D9MA 1CNVA 2EPOA 1UA7A 2VLKA 4DZ8B 4V27A 5CEXA 1C12B 3SE3C 4GG8B 3OHXA 3CH9A 5I76B 2OQJA 3D0VB 3RIFK 3VD4A 4NWUH 4GUPA 4KKAC 2DIEA 4GG6F 1UASA 2IGTA 3F8UB 1CDCA 3KR3H 4BK4A 2A6KB 4PJDA 4N0UB 3LEVL 4TPRH 4X5XA 3ULUE 1YN6B 1JK8A 3S5LG 2IBZY 3B9KC 3ZKQD 2BHZA 4RMSA 1WFTA 2IFFL 3L4WA 4XCYA 1C91A 2Q8AL 2GK0B 4NC0B 5C0BE 3VFUB 4Y16A 1UYQA 3D2UB 4QF1B 4UNTA 2A6IA 2I26N 4RAUA 1NUDA 2EIBA 3A6OA 1MNUH 5D70H 3V5KB 3O41A 3EZ8A 1HXJA 3VFWB 4G8GD 2SEBB 4HS3B 4PG2A 4ZQKB 1I9JH 5IQ9A 4LCIH 5CZVL 3CUGA 3HG1D 1UB6A 4Z7QF 4JY4B 4FFVC 5DEFA 4YNYB 1C90A 5IHUL 1A1OA 4K94C 4EQ3A 4OJYA 3ZE1E 2P47B 1NMAH 2ZX9A 5D5MA 1A0QH 2YPVH 5T3ZD 2G3JA 4MXWH 3O3AA 3WFBH 4OUEA 5EUOB 4HZ6A 5IMMA 4MD4A 4XCEA 5CWSA 5DJXB 5KVEL 4ZTPL 2ZXDA 2O26U 4JFED 4ETQB 4QCEA 4GRLB 5HHNB 5I8OH 4XP5H 5E4EB 3W53A 4NQTA 3KPNA 5IDIA 3VWKD 4PUBH 2R4RH 4M1CC 4EXPX 2APBA 4FQXD 1RUPH 2NTFA 3HMXA 4H8WL 3TZVC 5I1KL 3HR6A 2VCCA 4P2QE 3Q48A 4UT9L 1JVKA 2LTQB 1DL7H 3GRWA 4U1MA 3HG4A 1YDPB 4JDVB 3C5JB 2YXFA 2B7DT 5D1ZA 5FHAH 1YEJL 1CLYH 4L9DA 4MD5A 4UQCA 4GMSH 4XAKE 1J0KA 1HL8A 3RL1A 1E6QM 4ZPTB 4GBXA 1NDGB 1Z0MA 5GS2H 4Q2ZB 3VNYA 1U0QA 3FHAA 3CBWA 2JB5H 5F6HI 4NZDA 1DR9A 1H5BC 2FJFB 3K8KA 1GUVA 3A4WA 1DFBL 3ARXA 4PTTA 5DQJA 3L3GB 5T1LB 2EYRA 3GMOB 4NRYB 4OJFH 3OKOA 5A6MA 1MJ8L 1B9ZA 1SYSA 3CK0H 4CVXB 4Y4FD 2Z93A 1NEZB 3WY1A 1UKPA 3VXMA 5C2UB 2WHMA 4LSUH 3STLA 5M03A 1YJDL 3JV5A 2BNQB 1WF5A 2CNCA 2BNJA 1A6AB 3ZSTA 4ZS6D 3W9DA 2CBIA 2FHFA 1FNLA 1HT6A 3EYQC 1JF5A 4GINA 1OCQA 1IM9A 1HHKB 2BY2A 4YBHA 4MD0A 1QBBA 4MSWB 3G6AB 1UQZA 5JXED 3QUZA 4KFZC 3C6LD 5F3BB 3NIFE 5I71B 4GMTH 4JQIH 5A95A 1D6EB 2R0WL 4TQEL 2EXYD 1OP3K 4JDZA 3MOAH 3VFVA 3RL2A 2N4IA 3NZ8A 3VG9C 1OWRM 2A9NL 2HTKC 3RPIB 4OFYA 2X9YA 3GMQA 4PJ5D 4LLUA 1CFQA 3SGDH 5TFSH 3MCKA 4I4WB 3KLHC 3C5ZD 2E7BA 4F8TA 1TZIA 4YXLL 2QQKL 4OLXL 1BBJB 5EORL 1ODAA 4FQHA 3ZQ9A 2WB5A 3T4AA 5JTWA 4KVCL 1NLDH 1NKRA 3DARA 2KUTA 4ZOBA 4EUPA 5B3JF 1QSED 3MRIB 3QH3B 1CFVH 5KVGL 3AUVA 3CSBA 3KPRD 1EFXD 5EULV 3VXSA 1JTOA 4NNPH 4K07A 4P8UA 3MRGA 4Z7OE 2YDQA 2LFGA 5DD6A 1IRAY 1EEUA 1VADA 2YFNA 4RAVA 1AFVL 3UO1H 2BDNL 2YC1A 5SX5K 5DMIL 3BQUD 4LLQB 4FLQA 1JNLL 4PJCE 1IT0A 3UTTB 3MRPB 3ROOB 5DXWA 3HMXH 5I1HL 3OZ9L 4JLRA 1J8KA 1U93A 3AZRA 1R3JA 1DWAM 1CEOA 2PW2B 5E8NB 5I1LA 3GRWH 4BZ2L 1CD1A 2BSTA 4AZ7A 1Q1JH 5ISZB 4FQLL 3ILQD 3MA7A 2C7UA 3BUQA 1MEXH 3FJTA 5GS0H 4U05A 4PB0L 5DI8A 4QLJA 1X6NA 3L6FA 1DN2A 1CL7H 4P48A 5C0RH 3D3AA 1TQBC 1QI4A 3TIEA 3G6DH 2OI9C 4ZUWB 1G01A 1GOQA 3OL2A 3QCVL 2PUQT 4WWKB 4LF3A 7CGTA 1EPFA 3O81A 5I75C 4MJID 4Z2GA 3PWVB 1OAUH 3NH7L 3NFNB 1DQML 2F19L 1UD4A 1UADC 5E24E 2XA8L 3MUGA 4MAZA 3TPUA 3KNBA 4UOQA 4JHAH 1JHKH 2AXGA 3LHPL 1N2RA 1BYDA 4ZXLA 4Q7DA 5JOPE 4XXDA 1CK0L 3ARGC 3QRFM 2VUOA 4KKLD 4HWEL 2CUIA 2F5BL 4PJHB 3IGAB 3MLXL 4U6TA 3QHZL 3QIBA 4NZUL 5DS8A 3CLWA 4PRAA 2D03L 2I27N 5DMGD 2NW0A 4U0QB 4WU5A 5IFHL 4GSDL 1F97A 1K2DB 3O9NA 4E42A 5A8QA 3T2NL 4MCZA 4TTGA 5I19L 4KI5C 4KUCF 2XT1B 2X4PA 1GJUA 2YA2A 1Q6EA 3H9SE 1CICC 3D52A 4NSKA 5E8OA 5IFPA 2GY7B 2DYPA 3PXJA 3OKMB 3MUJA 4JZOA 5D7LD 5FIPA 3QR3A 5EO0A 1KBBA 1OAKL 1HHJB 1KEMH 2AJXL 4UB0H 5FA3B 3T0VA 2DSWA 3VIGA 4X9YA 3SHSA 1DE4A 4KMTH 3E8UL 3FOLB 3LN4A 5DRXB 5EFIA 4M82A 1B0GB 3L5JA 5DC0A 4OLYL 5D7KE 3KG5A 1SMAA 2J6EL 1R3HA 3ZDYF 2BNRD 3BSGA 3PP3H 3AMCA 4QRTA 5A16B 3UR8A 2GJ6A 3FO1A 4NC1C 4P4RB 4PN2A 4Z6AT 5I1GH 2OZ4A 3ROLA 4F7CA 4BCEA 4NQXA 1MI5E 5IHRA 5KTEL 3QO1A 4ZNCD 4RFOL 2CKBL 1I1AA 4J6RL 2A9ML 4LSPL 3WMSA 2XN9E 1E6RA 4WUUA 4JL2A 4KUCD 43C9B 1NC2A 2A73B 3BIBX 1CT8B 2A74A 4JM2A 1T0NB 3FFCD 2I24N 8CGTA 1RZKL 3L5WB 2AV7B 2VX5A 4B9ZA 3DWTA 2C1PA 3MRFB 2OYPA 4IEFB 1INEL 2EO1A 3RDTA 1OINA 5DUBA 1P6WA 3HZYB 5I1DA 5DHVA 1LEGB 4JRYD 1S7TB 1P7QB 4WI2A 2JCCA 3WV0A 2X5PA 4ZFOL 3GMLA 3TOPA 3QYCA 5D7IF 3AHYA 4GQPH 3TNMB 3RVTC 1CD9B 3KPSE 2NSXA 1A1MA 4HXAH 1I7TA 3PWNA 1BG9A 3TVMD 3EYUH 4AC1X 5EOTB 1A6VH 1MI5B 3U79A 4MJ5B 4K23L 1Y6MR 1AXTL 1CDYA 1QP1A 5GZOD 4XCNA 1JUFA 1OB1B 4N9GB 1LP9A 1CXFA 3PJSB 4OB5L 5EO1A 5I5RA 3ZLQC 4MA8H 1JGEA 3BEVB 1OSZB 4XNXH 2P8MA 2XN9B 2EADA 3QFJE 1K5NA 3BGFC 1ZA3B 3GHBH 4UIKH 1Q0YH 35C8L 4H0IA 1VACB 4FABL 4PSRA 2UY2A 3GO1H 1MWAH 2V7HA 5EWIH 1N26A 4EI5B 1RUAH 3ALXA 4JPIB 5JW4R 4PP1D 4ODXA 1FG2A 2P45B 4XPHL 3HE7A 1KB5H 3EYFA 2DI9A 2V7NB 1FGVH 4HP5A 1HKLL 3SO3B 5KW9L 4G7VL 2V3EA 5DWUL 4HKJB 1HJWA 1VGKB 4UDTA 3AHZA 4M80A 1HDMA 2J8UF 4RGNE 3V8CA 5I17A 1J8HD 5KG9B 3NCJH 4NQSB 2R69L 3KZSA 1BBDL 4HTYA 1QNQA 2WMIA 3K2MC 4LIQE 2OM5A 1N59B 2BV9A 2P5ED 4KMQA 3HMCA 4OV5B 4FOMA 1KCVH 1A7OL 3RIAK 5JUEH 3KLAB 5EBWA 4QHNA 1A7QL 4LQFH 3QJFA 3GXDA 3GSRB 1LG1A 3LEXA 1LLOA 3QDJD 2AJYH 4GOSA 5HHPA 4NQCE 5DDHA 2V5DA 2Z35A 2ADJB 1S9VB 4TSBH 1NUNB 3RWJA 4EBQL 5JPMA 1WITA 1WBZA 4X6DF 2GJPA 2WUCH 2F8QA 4TOYH 1QLFA 2CO6B 2EDQA 2IQAA 4FZ8H 2IGFL 4KROD 4XC1L 3K4DA 2D7MA 2HT4D 2PYED 4LHUD 1WAAE 4KI1A 5DHXB 3BH4A 5JW5B 4P9HL 1DLFL 1SEQH 3PL6C 1RHHA 3V4VH 1W0VA 5IBUG 4DQOL 1S9WB 4KAQH 2BVTA 4L3EB 3UJTL 2E7LA 2VDLL 3CMJA 3E0GA 1EGJA 4OKVB 2W0PA 4ORZC 4QXUL 3T3ME 2VZVA 4H5SA 1HIZA 1VBUA 3SCMC 3TT3H 2X4RA 4GW4A 4Z7UF 1HHHB 1MLCA 3T0EC 5ERWB 3WENA 1RZGA 1RPKA 4OOZA 5DHVH 3AREC 1ZKAA 3ZKNC 3WDIA 3PHQB 1CZ8H 2X4OB 3DMMB 3JV6B 4OSUL 4MNLA 3W0WD 1FL6A 3N06B 4N8VG 4G43A 3OKDA 2B0SH 2KZWA 4KDWA 3WKML 3W24A 4PRPE 2RGLA 4Z7VA 2Q3AA 1QBLH 3VFOA 4PJGF 4PGZA 4MPKA 1ZAGA 3D69B 1HH6A 3T1WA 3M17B 5DJ2A 2DAVA 4IJ3B 3T08A 3IJYB 4PRHD 1W2VA 5MERA 1A7PL 4NHCL 4WHDA 1NUGA 3PIQB 3U0TA 4L4PA 3LIZH 4YDVB 5ICZA 1R3IH 3IFPB 4HG4J 1GC1H 1G0DA 4LEXL 1R46A 2VWEE 3AMLA 1WFUA 1VESA 1KELL 3DX6A 1X6LA 2HTLC 3AROA 3FB7B 2X05A 2J25A 2FSEB 1GZQA 1LEIA 3S98A 1KFAL 3MR9A 2RJMA 3ET9F 3S36L 4KKBC 1WSST 2ARJB 1AVAA 3DYOA 5DLML 1T1XB 1OAZL 3CZSA 2IBGA 3WNNA 2Q8XA 5E9DB 2BOCA 3SCPA 3NZHL 1PQZA 5KS9A 4AY0A 4YHMH 4KVNL 1RZIB 2Q8AH 4OAWB 5TDNA 4BQBA 5DVKA 1C3FA 4X7TA 3DO7B 2XY2A 3RTQA 3SQBA 4X7SL 4R3SB 4Q22A 3OZPA 3H7LA 4O51A 3MNZB 4G6ML 3TFKC 4C59B 2CIIB 4BJLA 2ZPKL 3PZMA 3U7VA 2VDML 4JFXB 5ESQA 2GFBA 5IHUH 3G6MA 3I6GA 3DLQR 3RNQB 4R7NB 3GB7A 1A4KB 1AP2A 3I02B 3HPJA 1JZ8A 5M94B 1Y6KR 3HNVL 3NBNA 5EIQA 2NXYD 5KVEH 4ZTPH 2OL3L 3SKNA 3UTPE 2YWZA 2FEEI 2J88L 5I8KH 1M01A 4ESKA 2D1ZA 2B5IC 4UZSA 1OP5H 4L3AA 2DKSA 3MRNB 4Q9RL 1FYTE 4KDVA 4JG0L 4J12A 4Y16C 3T1FB 1BLNA 4X6EA 5A2AA 2R1WA 2XHYA 4GQ9L 1F11B 1HSAB 1BECA 1NFKA 4H8WH 3WIJA 4BFBD 2ZX6A 4PG2C 1ZS8A 4P5MA 4XWGL 4I2XB 1VEMA 5DTFA 4JY5L 1MUJA 4UT9H 1U8JB 4O4YL 3D3VE 2G41A 4RWYH 2NT0A 4PTMA 4MNJA 2VLJA 5B39A 1LD9B 5HYSA 4JFZL 4HXBH 1WBYA 1YEJH 4TVPH 5CP3H 3RQ3A 1B0RB 4Q6IA 4JEGB 4X9BA 2MHAA 5GRJH 1NLBL 1N0XL 3KJ4B 3QUXB 4HFWB 4NC2B 3I84A 4V1DD 4NBXB 1FN4B 2AOSA 3WFLA 2D3VA 2HMIC 3IFLL 5IROA 3RPKA 4WW2B 2AJ3B 1AO7E 4M6ML 3HRZB 4KY1L 4Z76B 2XJ7A 3MUAA 1HWWA 1AGEB 5C0CA 2IQ9L 3QNXA 2FGZA 4R7DB 3RWEB 4F9LA 4W4NA 1DFBH 4JFSA 4ODBD 4FNRA 3OF6D 4N1HB 1OGAE 3F5LA 4DCQB 4M3JA 3WIHL 3MRBB 1MJ8H 1C16B 3U4BL 4AD2A 4HIIB 2HRPL 4WKAA 3B9EA 4M9PA 1LO3H 1G7QA 2BVQB 3ARSA 1FYTB 3BUBA 1QRKA 3MUZ1 4YZFE 2AW2A 3C9NA 1QLRA 5ANMB 3MGTB 1YJDH 3MLUH 4AENB 4E41D 1GOKA 1BEYL 1F4YH 1KULA 3SKMB 5F21B 1MFUA 1OM0A 4HU0A 4M7LT 5D1ZC 2R2BB 2ICEB 4NQDB 3P4MA 4Y19A 3QCTL 2E6QA 3VDCA 3D3VB 4GBXC 3DVIA 1XFPA 4BQ4A 3P9MA 3FRUB 5E6IA 4IOFD 1QYGL 4G80A 1DVFB 4LHJB 4NRZB 4OZIF 4PCTA 3EDDA 3ESUF 2VLLB 4N90E 4HUMB 5C9JB 2R0WH 5BRZA 4HJJL 5MEOA 2OSYA 5JZ7C 3BMWA 2OCFD 1E6OL 5I18H 1VRXA 4PJBE 2FECI 2EDWA 1T1WA 1AO7B 1WV7T 3G6LA 2A9NH 1XGYL 3THML 4K7FA 4OKDA 3FCTB 2W59A 4XVUD 4YIQA 2X09A 5DZNA 5GGUA 3UTSB 3V4UL 3QXAB 4BA8A 3B4NA 1ES0B 5DFWH 1MAKA 5E56A 5MEPA 3K1DA 4GAFB 2J6EA 1U36A 3WBEA 4YXLH 1OGAB 2QQKH 4OLXH 2NZ9D 5EORH 1AQDA 5T3XD 1FV1A 4URTB 4M93B 3BJ91 1G7LB 2UV3A 1U8IB 4KVCH 4D6DA 1UWXK 4G5ZL 2YBRB 2A6JB 1KB3A 1Q9LA 2CKBA 5AY7A 5HI3C 3U9UB 5KVGH 4PRNA 1J01A 4XNUL 4CBPA 1QFOA 1YMMA 5FV1L 1EA9C 4RE2A 4MMXC 2F61A 5TE7H 3HS0B 2BDNH 3CJJA 3RWHB 4JPVL 5A6AA 1HH9B 3C09B 4XP6L 5EU6A 4UI2A 1OY3B 4YHNA 4APQD 3RWGA 3RVWD 5I1HH 3SDCD 3F7QA 5JIPA 5EZJA 1JNJA 15C8L 4HV8B 1SY6L 4O9HL 4P7NA 3ALWA 4S2SB 1A22B 2J8HA 3SGDI 1BPLB 4AZ5A 4X8JB 5I9QB 2CJUL 3MRDB 2CR6A 1QNPA 5E2TH 2FBJL 4ZFOA 1UR4A 3TYFB 4O00A 5FM8A 2V17L 4NT6A 4PB0H 4ZPVB 4NRXA 3PV6A 4PMOA 1WQVT 2M2DA 4PR5A 3ULUF 2QBWA 1EMTH 3BZFB 3QCVH 3JTSA 5CBEB 5EPMB 1JNDA 3OGSA 2D3LA 1EO7A 3NH7H 1JZ3A 4UQ3A 1QX1A 2F19H 4PV9B 5I2IB 4LFHD 3STZA 3MC0A 4UAOB 2XA8H 5HGHB 3HE6A 4MB5A 5EA0L 2D0FA 2X4UB 1NFIB 5CUSL 2BVPB 3LHPH 4WCYL 1HJSA 1LDSA 1BQSA 1CK0H 5IVXA 3GMRB 5CD5C 2W9LA 3BWAA 4HWEH 2F5BH 4PJFE 3MLXH 2V2TB 3DX3A 3ZE1F 3QHZH 4NZUH 1XF1A 2D03H 5FK9A 3OPZL 5JDSB 4GSDH 1G7IB 3QZWG 2BXZA 4P7RA 1IAIL 4M5YL 4NI3A 4O2FB 3OKEB 5I19H 4LBEB 3SKOA 1WIPA 2H1PL 4GRLD 1S9YA 5L7XH 1US2A 3SJVA 2P24A 3HCVA 1WDQA 1CIUA 1OP3H 1F58L 4EOWL 1VFOA 3FN0L 4GRMB 1ONQA 2QTEA 4NQVB 4GG6A 3TTYA 1CL7I 3IT8D 1TFHA 3R0NA 2AJXH 3ULUD 4BQ5A 1U2CA 1KXQA 3O3EB 2W91A 3QWQB 4MNKA 3E8UH 3VD9A 5F6HJ 5D9SA 5C0BD 1BAFH 2A6DA 2VISA 4HIEA 4MA3A 3MMDA 2H6PB 3N15A 3GIZH 1OARL 4X4YB 1QA9B 3S5LA 2Q20A 3QIBC 5HI5D 5EOCL 3BCFA 4DGYH 1VF8A 4KK9C 4WU7A 4L4VB 2CRMA 4CVWA 3T2OA 3N1GC 2AK4E 2WM0A 4MQ7A 3MBEB 4YHOH 4NZTL 4HAFA 3P0YL 4RFOH 1G6VK 4JZ5A 4QAWA 4J6RH 4AIZA 4KC3B 2A9MH 1UZ1A 2G4FA 4HZLB 5T1LD 1ITBB 2FB4L 3BPLB 3O4OB 3VRLE 3EJZC 4F9JA 1HE7A 4LSPH 5KSAD 4DVBA 2PXYA 4LLAA 1D5BA 43CAB 2XWTB 1I1WA 1CF8L 2JF6A 3LPGA 3BVXA 2YPLB 4M9OA 1RZKH 2K9UA 4G8FA 3RX7A 3V7AG 2RB8A 1G0XA 4G42B 1J7VR 1Y18B 3FT3A 1INEH 2I9TB 3PWJA 4JHWL 4MVBD 5KZCD 1GOFA 5HGBB 2GJXA 1JD7A 1TZHA 2Z31A 4P2QD 4W87A 3WQ8A 5FGSA 3VIOA 3RWIA 5BZWA 3GKZA 3LN5B 3S3SA 2BY3A 5ILTL 4AZGA 4WY7L 4OT1L 1IC1A 1G7JB 4FLRA 2CDFB 1I1AC 3DSNA 5IK3B 2ZICA 2AI0H 3NIFF 1FL5B 1TA3A 5I1IH 5DC9B 3ZJ8A 2CPUA 4PBVC 2AK4B 3EW3B 5IOPB 4K23H 3KPPA 1N5YH 4NNYB 3VW3L 1DSFL 1KF9B 4PGEA 2ADIB 4OB5H 3BEWA 1I1CA 5FYJU 3OAZH 2Z92A 4JM2C 1HJQA 4M4PA 1QR1A 4QHUA 1MAJA 5JIKA 2GAZA 4UILH 4ZDHA 2Y7QB 3TP4A 2WKLA 35C8H 1RY7B 3N1PC 4OCXL 4NQEA 1HQ4B 5BS0E 2A3EA 5I1JL 1WLHA 5HJ3B 4PGCA 3GBLA 4FQCH 2VN4A 5ETUB 4XXCC 1Z6JT 5CEYA 4P8XA 3CFCL 3BKYL 3UC0L 2H9GB 4XPHH 3D0LB 3SDAA 4TXEA 4W6WB 4Z7OF 2GUYA 4IMKA 2FIRT 3CZGA 3IXAA 5F8RC 1HKLH 4NO0B 4PLJC 4G7VH 2NY3B 2X44D 4UUJB 3AM8A 4WO4A 4PMZA 2VUYA 3OX8A 1NJ9B 3LRSA 4PJCF 5DD0L 7A3HA 5DWUH 5BXFA 3RWFB 1MRFH 5B21A 3PHOA 1P2CB 1A6UL 4WRLA 1GHFL 1BBDH 2IH1A 1F8TL 5FA4A 2XI9A 1GC1C 1A7OH 3WY4A 1RJLB 1BQUA 3D4ZA 3ZOAA 4G7YL 1LL6A 4HK0A 3REVA 1MCCA 1HXKA 3RVUC 4CJ1A 5D6DA 1KR0A 4JKPL 4K3DL 4EBQH 2GSGB 1SVZA 1EUUA 5KSBB 4R4NC 3HE7C 5A1AA 25C8H 3WBAA 4WW1B 1MW0A 2OL3A 2IGFH 4XC1H 2KQNA 2VDRH 1NKOA 5IW6B 5DJDA 3U46B 4P9HH 1DLFH 2G5BA 4DQOH 3W6MA 1E6NA 5FAAA 4PRDA 5CD3B 5ICXB 4QXUH 1AQMA 3P77A 4IPNB 1KTBA 4IUGA 1KYOK 3QJHA 3FQWA 3WIFA 1PVHA 1NCBL 5BO1L 3EOTH 2IAMB 3IDUA 5CLTA 4W6XB 4A6YH 5MENB 3VGAC 2HN7B 1ISYA 4X9GA 1ZHLB 2HT3D 4OSUH 4WFED 4R5EA 1F4AA 4PLKD 1SJXA 3IJ8A 4KJPD 1AGDB 3T8XB 4NXKA 4QXGL 1IGJB 4P57B 5DHYB 3L2LA 3QIWD 2JF7A 2XWEA 2UWEF 3WKMH 1HYSD 2EYTB 1KV3A 3MRRA 2Q7NA 4LPWA 3QUML 1UVQA 2P42B 4OIBA 5DF0A 4GZIA 5FUOL 5C0AE 3MLTB 2XRAL 4QXTA 2EDJA 1WDPA 2NW3A 2RCSL 3AXLA 3WIHA 4LVOB 2E7LC 3LQZB 4LLWA 1A7PH 4NHCH 4HIHA 2LABA 4LOUD 4H8WC 2YA1A 3MS8A 3PWPB 5FYJE 1MPAH 5B8CA 2EDNA 4XCFL 3EJRA 3EJQA 2BSSA 1KIPA 5AUMB 2GFTA 4F7EA 4R4FL 2OP4L 1MFAL 3TBTA 3UG4A 5JW4Q 4ONFL 1TQTA 2W60A 3RWCB 2VQUA 3P73B 3WFHB 1W0WA 3TNNA 1AHWB 4X6BA 4ZUTB 2X4QB 3MNVA 3S36H 4WHYH 4NN5B 1RJZA 5F7KC 4B3KA 1CG9B 5DLMH 1RU9L 1OAZH 1S7SA 2FEDD 5A3IC 5F1KC 4KI5E 3BPCA 5BVPH 1JPSL 4RNRB 1OTSD 5TD4A 1LF1A 5D2LA 4LCWA 3CZNA 3PQYE 4ODVH 2NY7H 4X0KB 5C0AB 5IJVB 1XGRA 4PJAE 3IF1B 1E4XL 2ERJB 2YUVA 4NYLB 2B8OT 1FDLL 2JJSA 1P7QD 3AY4A 2JEPA 4G6MH 2OI9B 4ONGL 4G9FE 5D7KD 4X5WB 4J23A 4QTHB 4YGVB 2ZPKH 4OD1L 5IB2B 2J4WH 2E7MA 5I75B 2VDMH 4OGAD 1UEYA 3VFTA 4ZXBD 3O4LA 2AJVL 5KN5B 3MZTA 5BOZG 3OGCB 3OKNB 1R5IB 4H26B 5J6GB 3BAJA 5FYLL 5GSRB 4ZOCA 4FMVA 2MJWA 3GNOA 1G6RL 1F6FB 1VERA 3CPLA 4NC1E 1MI5D 1VFUA 4I48B 5ABDE 3I50L 3QAZB 3T0WA 5L2JB 4FNPA 4Z78A 1ZLUH 3HJEA 4EQ2A 3QA3A 5IEKB 2OL3H 1F6AB 2J88H 3TA3B 2WVVA 2DI8A 4HPYL 1J1OH 2XN9D 1MCJA 4PRIE 4JG0H 4BH8A 3BE1L 3JUYA 5E99H 4JPKL 3RTQC 2EDEA 1LO0H 1MCWM 4LRIA 1J05B 1BAGA 1FZJB 3CUPB 2VITA 3B2UC 1SY6A 1H9VA 4XWGH 4NJAL 4FNSA 4JY5H 2FDBP 3D18B 4ZSOB 1U8HA 4O4YH 1MHHB 4RE4A 4EI5D 1NQBA 4Y4HD 3A6CH 1PYWB 4JFZH 4HZ7A 5FYKE 4XWOD 1HP4A 4HKXA 2OLHA 4UIMA 4GPNA 1HN1A 1NLBH 1N0XH 5AZ2L 5M5DA 2IXVA 5DD5L 1YA5A 1T7XA 3AFBA 2Z4QB 1XF4B 5D6CA 5GGVL 4M6MH 4KY1H 2AJUH 2G75B 3VSTA 3BXNB 4X6FB 1SJEA 4MXQC 2IQ9H 3MLPA 2IF7A 1RIHL 1U58B 3CSPA 1OF2A 4MAYB 4YAQB 4BQ6A 1Q72L 4K9EH 3MRCB 3UEQA 4OZFH 4IISA 5BVJB 3U4BH 4OI8A 4S11A 4HUWA 2HRPH 4MDJB 3IVKB 3TTQA 2VZUA 3KS0H 3QFJD 3VGGA 1B90A 5DRZB 1Q38A 2R4SL 4WEBL 2F53E 1BEYH 5KSUA 4C57C 3BKCL 3L3KB 5EU5A 4YHYB 4NP4H 2D23A 2XFXB 1OTUD 3MGOA 3QCTH 4Q6IC 4ELME 3QXUA 4W68A 2Y8KA 1EEQA 3WSUA 2FZ3B 5D96B 1TQSA 3KPLB 5IROC 2EDLA 1QQDA 1QYGH 1BX2B 1WAAF 5ADPL 4P3DB 3HTLX 3W0KA 3QULB 4F9LC 2YDRA 4MA7L 4LYRA 3VIIA 3U4EA 1I8LC 3NCYS 2Y2WA 1E6OH 4O58L 1S7UB 1ZSDA 5FF6B 1V6UA 2QSQA 8FABA 1XGYH 3T3MF 3TIDB 3QQ3B 3V4UH 3MREB 2B1HH 4LGXA 4RGND 2AQ1A 1GQLA 4P2RE 2X9WA 2FJGB 4D0CB 1WC7A 4M7KL 2JIXA 3BJLA 1YY9C 5CP7A 2OTWA 1WTGT 1I8KB 5CLWA 5IQ7L 4DO4A 1FC1A 2OMNA 4U4BA 1W1VA 2D7TL 4X6CE 4G5ZH 4AWEA 1M7IB 4IM8A 2YBTA 3NFPB 1QFWL 1ZJAA 4AXNA 4K8RL 1WZLA 4NQCD 1U8KA 4GRWE 5E6IC 1UCBL 1KLFA 2DTML 5I1CH 3BGFB 3P9LA 4G9DA 4JAMB 1XHGA 1YNTA 2EZ0C 4XNUH 5ACMA 2P8PB 1UR9A 1OLLA 4P2CG 5CQ1A 4Z2KA 1DUYA 4FTVB 3DYPA 4CADB 5J3HD 4PUDA 4AD5A 5JOFA 4JPVH 1XGQA 2EECA 1MRCH 4LARL 3PN8A 4YDJB 4XP6H 2R0ZL 2WHLA 1S46A 3WJJA 4XRCA 5JLZB 4WV1C 15C8H 1SY6H 1NGQL 4O9HH 3WJLA 2NR6D 3FO9B 4KJYB 3KHOA 2J2ZA 5MP6L 4TUOB 1UM6H 4OZHB 5HHME 4JRXE 2CJUH 1XMWA 5IKCA 2G8ZA 3O6FD 4R2GC 5JHDB 2VL4A 3NN8B 3TH4T 3T0EE 4XCCL 1LDPL 1INDL 2MCPL 2V17H 4X80H 5CIPH 7TAAA 2WHJA 4FQ1L 3DRTB 1DBJL 3CC1A 1KGUA 1II4E 3QDGE 3BUTA 1XR8B 1ZHBB 2FD6L 3BPNC 5L8KB 5C09E 1W2KT 2G9HA 4LCUB 3NDZA 3CCHA 1KNOA 3CHEA 3RKPA 1RURL 4PRPD 4MJ4A 4YPJA 1R3LA 5ESAB 4HMDA 1UXSB 1RZKC 5EA0H 3TN0A 5CUSH 1MLBB 5TE6H 5FO9A 4S1DD 4WCYH 3VDHA 2OYKA 2Y72A 5B22A 1PEWA 1RIVL 5CBAB 5BXPA 3OGRA 1T21A 1NCNA 4J8RA 3LX9A 4I3GA 2IADA 1BD2B 4ZTOL 2J1KA 5AD0A 4M02A 2R15A 1CLOL 4HH9B 4LNRA 4IMLB 3OPZH 3UTQB 1AKJB 4QRQB 2OWXA 2GJRA 3QNYB 1IAIH 3GBEA 1FFOB 1NGZA 4U1SB 1T66D 4CMMB 1C7SA 5E1QA 3ARQA 3QP3A 4LU5L 2H1PH 5JBDA 1DN0A 4L4TE 3QWOA 3MV11 5E7FA 3O6MH 3T0EB 1F58H 4JY6B 4EOWH 3FN0H 4WLCA 1P7HL 4KK8D 1GGCL 5C0IB 3A4AA 5INCA 1IC4L 3WIIL 1D5MB 4D0BB 2FWOA 4PGDA 1VCAA 2VLRE 3HE6C 1KXVA 1CFNB 2H2PD 5JO5B 4QY8B 2EDDA 4DKFL 2ZWLT 4H1LG 1KGCE 1OARH 3VH8G 4IRSA 3TV3L 4JREC 3H9HB 5C0EA 5F7NC 1UWXH 3QUXD 3ZYIA 1GPOL 4DK3A 4TVCA 3O3DB 1FLTX 2BFGA 4BF7A 1VEPA 1DLHB 1IAIM 1S7QB 4NZTH 3P0YH 1SEBA 3QOMA 4GXUM 4YHIB 5HY9A 2V5TA 2VLKE 2VDPL 4P23A 2BJMH 1XGZA 2FB4H 1G7MA 3QPQD 2ZJSL 1S7VA 4LCYA 4PJXA 1MJ7L 2AV1A 4HIXL 3EFDL 3UTPD 1E0VA 1K9EA 1P5VA 1CF8H 4OLWL 4GW5A 1EVTC 2XNAA 5LJYH 3M1BB 4PJDE 5JORB 1FYTD