4IX2A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
359
structure length
334
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP.
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 100
structure length 334
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ix2A00
1OX5A 1D3GA 1MXSA 1Z41A 4ADTA 3W6YA 4NU7A 1R47A 1JR1A 3M47A 2C13A 5D30A 1T0OA 1SO4A 1Q6RA 3EWBX 2NX9A 1XXXA 3PUEA 1P0NA 1AW1A 3NL6A 3W7EA 1X6UA 4AHOA 5DY2A 2OZ0A 4JTJA 1OFOA 1LP6A 4QJ1A 1L6WA 2CLIA 1X7FA 1EEPA 5AN7A 1GQNA 3NNTA 3IVUA 3NAVA 3G0SA 5G1YA 3W1QA 3P82A 3QM3A 4I7WA 4XKYB 4N9EA 2VKZG 3SGUA 4HHPA 5HQEA 2HMCA 4GUIA 4JTTA 5CPMA 5T26A 4RZ6A 2PRMA 3MMTA 5C55A 4IPIA 3PSVA 4OHQA 4XBKA 3TH6A 2X1TA 5K7JA 3GKAA 4JDYA 4AF0B 2JGQA 4N9CA 1C9DA 2QCNA 1WBHA 2VFGA 4EF9A 1KLYA 4HSNA 4JTLA 2LLEA 3LXAA 5LKYA 1F73A 3P81A 4YCPA 1TV5A 4JEQA 1T96A 5J5RA 3RMJA 4BR1A 2OCZA 5D2YA 3C2RA 2Y7DA 1WBJA 4O1BA 3C2FA 3GNNA 1XUUA 1FX6A 1AK5A 2Y62A 1LTDA 3TMQA 1P4CA 1G4TA 5FF2A 1TB3A 1AL8A 1PS9A 2WNQA 4N02A 1Q45A 1A5SA 2QCLA 3EWUA 3A5VA 2P0OA 3SZ8A 3TSMA 2QCHA 4MJZA 3LRMA 3W7IA 2VELA 4UR7A 3W7JA 1OHLA 4UTJA 4OV4A 4EWND 2QJIA 3LV6A 3UWQA 2QDHA 5AHMA 3L65A 3BV4A 1JVNA 1LRTA 1GVOA 1YTKA 1K3UA 4M7SA 2V0TA 1MEWA 2NXGA 3CEPA 4HNTA 3HPXA 4AHQA 2XN1A 3YPIA 3LTPA 1M7PA 1OYBA 3IIVA 3VCRA 1YLVA 3SI9A 3BLIA 5FF0A 3WJSA 5G2WA 1JRCA 3HBLA 1TO3A 4I7UA 3TAKA 1KM3A 1G4SA 1YXDA 3OEXA 5CSSA 5E93A 2PRHA 2YYTA 4E0CA 1F74A 5HINA 2GPTA 1G69A 4FNQA 2FPTA 4OU1A 4FNSA 4MPQA 1KFKA 1P0KA 1SZFA 3PUDA 5AC7A 3GKFA 5I3JA 4JTSA 2YPIA 4XBSA 3W2KA 1XM3A 3EXSA 2NXHA 2CLMA 4GJ1A 1TPUA 3UYCA 1H7WA 2X1SA 1EX5A 4IPJA 5U7SA 1W5QA 2R14A 3G8EA 5D33A 3GB6A 3S1WA 3LERA 4GWEA 5DBUA 2OX1A 4QAIA 1Q6QA 3BVJA 2QUTA 4ZL1A 1YTDA 4LV4A 3TC6A 3F03K 4GXMA 5AHEA 1FUYA 2V81A 3HB9A 4XTDA 5F4XA 2V5LA 4M6QA 1RV8A 1MEIA 3STFA 3IIOA 1FCVA 4IMCA 3EX1A 1OFQA 5D38A 2O7QA 3DENA 3NO5A 2A0NA 1ICQA 3EX3A 3KHJA 1KFEA 3NQCA 3IVTA 4MOZA 2OT1A 1J5TA 3KVLA 3O63A 4CQ9A 3G0XA 1XBYA 3L21A 1I8JA 4FNRA 4JD4A 4O15A 4CNPA 4Q4KA 4Z0SA 3UZ5A 4FNPA 3GR8A 3CQ0A 4M5PA 3DFPA 3UQNA 1KM4A 4HT3A 1FBAA 3QSTA 4XWUA 2PURA 1DL3A 3C2VA 5D05A 2EPHA 2A4AA 1MEHA 1YDVA 2ZTJA 4MFDA 1VHCA 1PCKA 5FEWA 1XFBA 1OFAA 2C3ZA 2ZZ6A 3N9RA 4JDBA 3A23A 2ZRVA 5K3VA 1KTCA 3KVJA 3K30A 3QH2A 3W1XA 4BK9A 3L5LA 4NJGA 2ZQ0A 4O8RA 5DY3A 4CLMA 1TPDA 3I7RA 1W5PA 4O28A 1I2OA 4Y96A 3L2IA 1EPXA 1JRBA 2DJXA 3O6YX 4GUFA 3BG3A 1F76A 1U5JA 2ATSA 4QSHA 2Q8ZA 2J9YA 5C6MA 4KFPA 4GFSA 4M6PA 5CPNA 3W83A 3TNOA 2RDTA 1YADA 4Y8FA 1K8ZA 4YMZA 3TK7A 3N19B 3PY2A 3B0VC 3IRDA 2GVJA 1ZJIA 2Y63A 3NQMA 2BTMA 3TV8A 1SSDA 1WX0A 4PCFA 3UWVA 1GVSA 3EX4A 4LU0A 1DJQA 2PRLA 4CCDA 3S1XA 4O14A 2NLIA 3BG9A 5K4ZA 1HO1A 1VHNA 3TW7A 5EMUA 1SQ7A 4E2DA 2FIQA 3B4UA 2X1UA 3Q58A 4AB4A 2WQPA 2A6LA 1YXCA 3F4NA 3SIZA 3EWXA 3GDTA 2BWGA 3NPXA 4EOUA 2V9DA 3IGUA 1GJPA 1Z48A 4DELA 3A22A 5SWUA 3LBMA 1YTEA 4Y6GA 3DU0A 3C56A 1I2QA 2RFGA 2JGYA 2A1YA 1K03A 2I9EA 3QRHA 1TQXA 3ATZA 2ISWA 1CI1A 4XUGA 1WOAA 2RDWA 1DV7A 1G67A 5DCBA 4Y90A 8TIMA 4WXZA 3GAYA 2J27A 3M5ZA 3NR0A 4E2BA 3G18A 1SO6A 3SW6A 3NEVA 1VLIA 3SY5A 2J24A 5HR7A 3W7DA 1OYAA 3QFEA 5F4SA 4MFEA 5LHEA 2J9XA 2QEZA 4JX4A 1GYNA 5F1UA 2QR6A 2WSQA 3T7VA 3ABOA 3P61A 3S8HA 4UUIA 4UTHA 2YGYA 3VE7A 1ZNNA 4FNUA 4GBUA 2WNNA 4WZHA 5HWJA 4MY1A 1DBTA 2WV8A 2H3BA 1UASA 3P5YA 3QMTA 4JGDA 5DBTA 2V2CA 4YLWA 3D0CA 3I65A 5F4WA 3OBKA 3TAOA 1VCVA 1W5NA 1EWDA 4OQVA 2CZDA 3QSRA 5G2HA 1OG0A 3KAOA 4NUWA 3M16A 4PA8A 3W86A 3LHWA 4K39A 1ICPA 4AWUA 1EB3A 3CT7A 3W1TA 2B7PA 3PWAA 1ONRA 4X9SA 4ZVJA 3NPVA 1E51A 3G1SA 1EP1A 3G1HA 1W37A 1P1XA 3W2NA 3UWUA 4K7YA 3S1UA 4BF9A 1Z42A 3DFOA 4Z1AA 3L68A 1RQBA 1FWSA 5CZ0A 5DN1A 1ME9A 5CKSA 5DCEA 4QISA 2DORA 4IMEA 4RV8A 3CC1A 1I2NA 3GYEA 3HPZA 2NWSA 1M5WA 1EA0A 3P60A 1Q3NA 2G96A 2HS6A 5HJLA 2NUXA 5AHFA 2Y89A 1K7XA 4IGHA 5D37A 1B57A 2KZHA 4XKYA 1SW7A 3VI2A 4HPJA 1IXNA 5CZTA 4PODA 5CZSA 4JX6A 2ZYFA 3TDFA 4M6VA 4HNUA 1QR7A 5F1VA 3A9IA 1N7KA 1I45A 2VENA 3LCIA 4KFNA 3R13A 3TROA 1XI3A 2B7NA 5A5WA 4S2BA 1O5XA 2JKEA 1IGSA 1WV2A 5CZJA 2GVGA 3C2EA 3LTYA 4CNNA 2FPYA 1OK6A 1TPEA 3PR2A 4R53A 4AH7A 4FIQA 2EF9A 4MZ8A 2V8ZA 2YW4A 2QCMA 1XKYA 4UTIA 1TREA 3Q2DA 1ZAIA 3S5OA 5HR6A 1QPNA 1K8XA 3NL3A 5KTLA 4CNOA 2FTPA 3ZWSA 2XFWA 4RLIA 4NQ1A 1H7XA 1NF7A 4JR5A 3DFQA 2VOMA 2YCEA 1VLWA 3S1VA 2QCCA 1OX6A 4JTIA 4LWWA 2FB3A 2E6AA 2NZLA 1JJKA 2ZRXA 1I2PA 1W54A 5F2MA 4TU1A 2B7OA 4UTTA 3MP3A 3GNDA 2Y70A 4M7TA 4O1AA 1FXPA 4NJIA 3STGA 5K9DA 3VE9A 2NV2A 1H7NA 3N34A 1HL2A 3HGRA 3C4UA 4IJBA 4DO6A 2Q3OA 3I7SA 3LOTA 4LVAA 1TPWA 1JCLA 3O16A 4FHAA 4JY9A 4U4MA 5H2ZA 4UMAA 3GXPA 3TA6A 3V75A 3TFCA 1VCFA 3IV3A 1TRIA 4O50A 4MZYA 2EHHA 2QAPA 5AYYA 2YZRA 4UTLA 1KM6A 1DVJA 1W3TA 1NSJA 1KM1A 1X1OA 2JKPA 3TCEA 3TIMA 1JCYA 3HJZA 4MY9A 5G1TA 3PB0A 3TMLA 1S3HA 2DZXA 3LCXA 1WA3A 3RLUA 1YDNA 3C61A 2VC6A 3B04A 2Z2UA 3TX9A 5J5DA 3VKJA 1J4EA 2F84A 1L9WA 2ZDRA 4BI6A 3HIJA 3FKKA 4LOCA 1SFJA 1UJPA 2D73A 3KRZA 4ADUA 3BG5A 1LRQA 4JXCA 4IUOA 2FQIA 3U8GA 4FF7A 4ZQMA 3TFXA 2R94A 1JCXA 2R8WA 3ATYA 4ML9A 2FPVA 1TV7A 1KM0A 4TR9A 4RXFA 4K8EA 1EWEA 3C52A 4EIVA 2AQWA 1Q6LA 4IMFA 4ORIA 5H91A 3A21A 3LHUA 3KVKA 1QCWA 3R2GA 2YXGA 1WDWA 3DHDA 3W75A 3RU6A 3NXFA 3GK0A 3A24A 3RNDA 3I68A 2A6NA 3DKJA 1KV5A 1TPB1 1UBSA 1QOQA 3FYPA 3TJLA 3L0GA 4UIOA 4KKXA 3W72A 1TYGA 2QCDA 3PF3A 4G1KA 3EWYA 5I3HA 3W74A 5F2GA 4JTFA 3ELFA 2YR1A 1LLZA 2YSWA 4CQ8A 5FI8A 3DZ1A 3FEMA 1VYSX 3CWNA 1LOSA 3NYZA 1SZNA 3LHZA 4NT0A 4P61A 4A29A 3ZS4A 3WFAA 3NQGA 1UCWA 4NJHA 4BI7A 3TSBA 3NQFA 3VFLA 2V5BA 1F2JA 4O1DA 2Q8LA 1PV8A 1ZCOA 1W8SA 1R30A 2V30A 3GXNA 1SW3A 3W7CA 1LLWA 1W3IA 2OT0A 4O4WA 1RPXA 1GT8A 1GPWA 5I3KA 3WK3A 2ZZ3A 2HSAA 1RVGA 3KRUA 4QNEA 3A5FA 2BX7A 3PBWA 5LGZA 3N2XA 1PIIA 1VS1A 2X30A 2C6QA 4D2JA 1ML1A 4YCOA 3W1MA 1TTJA 4IOTA 1H1ZA 3B8DA 1XBXA 3LCFA 1A5BA 1Y0EA 3BO9A 1KFCA 3KXQA 4PTNA 4FIRA 1HTIA 3W7GA 4ONVA 4MYXA 1F5ZA 2BXVA 3N2MA 3E9AA 3M9YA 2Z6IA 4MVAA 4TX9A 4OT7A 1B9BA 3L0KA 4U28A 1MO0A 3EWZA 1KLZA 4X22A 4DQWA 3W73A 3W7RA 2UV8G 2E6YA 3WJYA 4Q33A 4R34A 2TMDA 4JTGA 1QAPA 4P2VA 2YW3A 2YFNA 5DELA 3WK2A 3NL5A 2GJNA 3C6CA 1SFLA 2WSRA 4PEKA 3I7QA 3CLMA 4NXSA 3HGOA 2ZBTA 2R91A 4O13A 3B03A 5ABTA 5MHBA 3W71A 4UXDA 3PUOA 3P80A 3IVSA 4UTTC 2PCQA 4O11A 4A3UA 5U4NA 5BW6A 1EUNA 4EF8A 3S5ZA 3WJWA 1FWNA 3EX2A 3KFTA 1EP3A 2P1FA 2FLIA 1JUEA 3RFAA 4CCCA 3NZRA 4QITA 1B4KA 1LBMA 4LC6A 3P62A 1L6SA 2W6RA 3MBFA 4HPXA 4C1KA 2A7NA 1OFBA 1KBIA 1GZGA 2QCDB 1TPFA 3FA5A 1JQVA 2NUYA 5EPDA 5I3IA 3P74A 1RQHA 3OVPA 1SPQA 3PS7A 3FKRA 4LY8A 2I14A 3PULA 3UXAA 1Q6OA 2HS8A 4W9TA 4LVBA 3IIXA 5FF4A 3AJXA 3BK0A 1LOLA 4K37A 3S0CA 4J9JA 5LNSA 1KTBA 3W7OA 1H7PA 3NGJA 1PHQA 2H6RA 1NEYA 1JUKA 1ADOA 1J2WA 2WPBA 3MHFA 2A2IA 3CM4A 3TR2A 3LM7A 1SUXA 4WOQA 3V1PA 2C18A 4PH6A 3P8JA 3S6DA 1S5WA 2CFFA 4BI5A 1LOQA 3PG8A 4LRTA 5G5IA 1LM1A 1JULA 2QKFA 3L66A 1BEUA 3C3NA 4UTWA 3GDKA 3TUUA 4X2RA 2RH9A 1LROA 1GTHA 1TTIA 2DP3A 5FEZA 5K4XA 3QMSA 3L5MA 1ZFJA 3EEGA 1O95A 1VYPX 3P84A 4NVTA 4AVFA 3TC7A 3STCA 2GJLA 1LRNA 3NQEA 3UZJA 1OFPA 3P67A 4JTHA 3CU2A 1FDZA 1JCNA 1P5BA 2DU2A 3O6DA 4UNLA 3S9YA 4NX0A 4K8HA 4KWVA 1SZEA 4O16A 5DCDA 3RF9A 1G6CA 5E0KA 1RQEA 2VFIA 1FDJA 3MO7A 4NX5A 4IMDA 4IXXA 5C5YA 2XN0A 1HFBA 1ZY9A 1AW5A 1VCGA 2ZZ7A 5KZMA 5AB3A 4JYFA 2AAMA 4OV9A 3QMRA 3QQ1A 3G22A 3B06A 4NZFA 3GLCA 3M0ZA 4RJEA 5F2IA 4UFKA 2X16A 1XDMA 4N9BA 1UUMA 4GC4A 1DJNA 2DZUA 1A5CA 5FEPA 4A21A 4O54A 1DKWA 1VR6A 5I3FA 5EA9A 1N8FA 3W1AA 1L2UA 2VEIA 2VEPA 3FOKA 4AEOA 3HO8A 4LUJA 4GNJA 1M7OA 4UTUA 5EBUA 1XC4A 3U6WA 3GX9A 3MJYA 1FY6A 1C8VA 2CWNA 5LNWA 4NXKA 4QQ3A 3G1VA 3RK8A 3LRKA 1WQ5A 3AO0A 1LYXA 4ZQPA 3R8RA 3W2JA 2CLOA 1KFJA 3NM1A 5AYZA 1FWWA 5LGXA 2NWRA 2DZPA 5GVJA 1H50A 3GXTA 4S2CA 3N3MA 4N6EA 3GR7A 4O4VA 4R7JA 3O6CA 5D03A 2ZZ4A 1FCBA 1KFBA 2ZZ1A 3LLFA 5DLCA 3W23A 2H8XA 2EKCA 5HUPA 4QIUA 1F6PA 1NVMA 2B0MA 3JRKA 2ZTKA 3W07A 5A8GA 5KINA 2H8ZA 1PHWA 3HMJG 1HUVA 2BZNA 1AL7A 4PL2A 4KWWA 3PBYA 3BW3A 3DI1A 2C0AA 3FJLA 4NJJA 4UFHA 1YPIA 5LHFA 1QO2A 4MKNA 2F7FA 1FDYA 3MW7A 3O15A 4K6AA 5L9FA 3SJ3A 1MSSA 3F1QA 1TSIA 3G1AA 4WY0A 3BW4A 2CLLA 1R2RA 3LI0A 2QJGA 4PFMA 1QNVA 2YX0A 2GVLA 1IXPA 1OFRA 4JIPA 4POCA 4RXGA 5K9XA 1OFEA 3THQA 2E09A 3O05A 1SO5A 3O06A 3L0NA 4AWSA 1LDCA 4HNNA 4DBDA 3F4WA 4A2SA 3LCLA 1ZHAA 1TPVA 1H7OA 5K9CA 3CPRA 1N55A 3GDMA 3UPWA 3KVMA 1SZGA 3SR7A 2QUUA 3HGSA 1FCQA 1DHPA 3P8IA 2PE4A 3UWYA 4UCGA 1DQWA 3HG2A 1F6KA 1ALDA 3M44A 3EB2A 3LXCA 5EYWA 4DPQA 3M5VA 4YXGA 4JICA 1H62A 3NQ8A 5FESA 3WJXA 1NAL1 3DAQA 1ZAJA 3FS2A 5IBXA 2B7QA 2A7PA 4JTEA 4CCEA 2W0UA 4JS3A 4UTWC 4LTSA 3T78A 1K8YA 3E0IA 1PL9A 4O10A 1QPOA 5G2IA 1VC4A 3Q94A 4NNBA 5BRBA 3LCGA 1GTEA 4WOZA 3SFKA 4BWLA 1GYLA 4HKPA 3OVQA 2J6XA 1Z44A 3HF3A 1QDSA 3O1NA 4WQ6A 4N4PA 3BARA 2JKAA 4IXHA 3BGJA 1A53A 2NXIA 2YYUA 3HG3A 4JTKA 3L9CA 3W7PA 1KM2A 2FDSA 4I7VA 5FEXA 4HN4A 5AC6A 3QJAA 1KM5A 3DH7A 2V82A 1OJXA 4IMGA 3LDVA 4O53A 5AOUA 3NQDA 3ZFHA 4GUGA 3LCHA 2A5HA 3NL2A 2FFCA 2A85A 3OA3A 1W1ZA 2A21A 2DZVA 4LUIA 3EX6A 3OHIA 3STEA 1GVRA 1JCJA 4HIBA 3UD6A 4NZJA 1S5VA 4GUJA 1SSGA 2RKXA 2ALDA 4H6KA 4TMCA 3JS3A 1TQJA 3NM3A 3O8AA 4N9DA 4NJKA 2XN2A 4HNVA 3W9ZA 4NNCA 4WX2A 4O18A 5HWMA 3NOEA 3QQ0A 4FNTA 3G3DA 3SECA 3PBUA 1FQ0A 1D9EA 3C8FA 1OF6A 3CTLA 3DFSA 5BMWA 1MZHA 3IIZA 1R46A 2E77A 2QDGA 4UFLA 5CG7A 3MHUA 1I4NA 2CU0A 2FB2A 2ZRYA 3G1YA 3DFTA 4WY0B 3PSWA 3QPZA 1KFLA 5BOOA 4DO4A 1ZAHA 1HG3A 3UY7A 3LBCA 3TW6A 3IIPA 3W7NA 1O4UA 4DEFA 1X8FA 2FJKA 2YDAA 4I9AA 3ABRA 5AHIA 3USBA 3GIYA 1IXQA 2VFDA 5HULA 4FXSA 3MYPA 2Q3RA 4RZ4A 4XZ9A 5HNRA 2QCEA 3PBVA 3LHTA 2C15A 2E5CA 1RD5A 3L5AA 3UWWA 3NZ1A 4Z0JA 4UTMA 5D09A 4L4LA 3HQ1A 3MP5A 3E12A 3G1XA 4EVZA 2QCFA 2WOQA 3BLEA 2Z1BA 2ZFAA 4LS2A 2VEKA 2ZRWA 5EKYA 4MY8A 4UFMA 1OF8A 4ADSA 3BGGA 1HO4A 2CLFA 1GVQA 3CWOX 2TSYA 2C16A 3DXIA 3M5YA 4UNKA 1SU5A 1TRDA 2NX3A 3PC0A 4FXRA 3MI2A 1SO3A 2WNZA 3FFSA 7TIMA 4KFOA 4ORMA 5FF7A 3H55A 1OYCA 4L4MA 4TO8A 1NFBA 3R5EA 3G3MA 4WD0A 4DF1A 1WOBA 4Q32A 1H7RA 3W2MA 4GUHA 1YDOA 3W1RA 3DKLA 5LZLA 1FWRA 2ZA1A 3W88A 1PE1A 1TJRA 3NPWA 1QOPA 4LVGA 3NQ7A 4TMBA 3OG3A 1H1YA 1TTPA 1ICSA 3G0UA 3DFNA 4DXVA 4ALDA 5IBXC 2CLEA 3EKLA 3MI3A 2WKJA 3PM6A 2E68A 4AHPA 3QF0A 1H60A 4A2RA 4WY0F 3IGSA 5IM51 2QAFA 3GDLA 5TIMA 3LXBA 4K7VA 4RX0A 4BWLC 3CB8A 4JYDA 2OJPA 4JYEA 4X3ZA 4NNAA 3EWWA 3T55A 3W7KA 1BWLA 1JUBA 3S5NA 3KX6A 1D3HA 4ZQCA 1OVDA 2VFHA 3LB0A 4RR4A 3G1DA 5CPOA 3W7MA 3HGJA 3W7QA 2AGKA 3QZEA 2TRSA 2RHGA 4FX6M 2DZSA 2ZA2A 4YWIA 3LLDA 2ISSA 3ABSA 5AHLA 3W7LA 2JK2A 4DPPA 3M6YA 2ATMA 2C1HA 3VNDA 3NG3A 1T8XA 3PG9A 3LHVA 3MHGA 3WJZA 3JR2A 2E5BA 1X1ZA 1H51A 2QCGA 4QM1A 2GQAA 3MYOA 3TJXA 4GE8A 5HWNA 4LW7A 3TQ0A 3WK0A 4UR8A 1XUZA 1IIGA 4Z1DA 1LBFA 1VJIA 2ISVA 3TXZA 2WSYA 5DXXA 3DBPA 1NF0A 5AC8A 2C19A 4WJEA 2Z6JA 4ZQOA 3PVFA 1W0MA 1OX4A 2EGZA 3H54A 2VFFA 3NA8A 3C2OA 2VEMA 1THFD 3MI6A 4FEZA 1IXOA 3UNDA 2G95A 4PL1A 3QEZA 2HTMA 3T4CA 1TIMA 4O52A 2A7RA 1ME7A 4OWGA 3QC3A 3FJ6A 3M43A 4LVDA 4RCXA 3W70A 2GUUA 2DZWA 1TV8A 4WUIA 3O07A 3LX9A 4ZQNA 4C1LA 3N9SA 1KTNA 2GQ8A 2J88A 4UC5A 5G4EA 3W87A 2H3DA 1O60A 1RZMA 4FX7A 4ZQRA 3HPSA 1KW1A 3CHVA 1LZOA 3W76A 1G7VA 3LV5A 5D2XA 2H90A 1W31A 3SGZA 2ZRUA 1VPXA 3QPYA 4LV9A 3DGRA 2Y85A 3R89A 5LNVA 4IWWA 4LT9A 1GG0A 1KA9F 1SR9A 4IX2A 5CGQA 3EXRA 1SW0A 1IIHA 2E6FA 1VH7A 1VRDA 3G8RA 3SSJA 1BTMA 1LORA 3MP4A 1AMKA 3GAKA 2QUVA 1PVNA 1FCUA 1ZALA 4S1FA 1QMLA 1CX9A 1G4PA 4QNWA 3M1ZA 4LVFA 1B3OA 4FB7A 3W1LA 5D04C 1QPQA 1A5AA 2Y61A 2Z0IA 1LCOA 4UFJA 4LS0A 4AAJA 1WYIA 5BNKA 1R2SA 5D02A 2GQ9A 4OBTA 1XCFA 2V2DA 1DQXA 1G4EA 3B0PA 4RZ5A 3U2OA 1JQXA 3TQKA 3NVTA 3E49A 1LBLA 4M19A 5CPLA 4ICNA 4MYAA 2X2GA 3FLUA 1C29A 3W1NA 2ZRZA 1H63A 3LRLA 1ME8A 4O0ZA 1CW2A 5KMYA 4O17A 1RR2A 2ABBA 2P10A 3LCWA 1O5KA 3ANYA 3IGXA 3UWZA 1VZWA 2YFOA 3HOJA 3GZ3A 1GOXA 2Y6ZA 1L6YA 4AMAA 2RDUA 4K36A 1FXQA 5KITA 4H3DA 1S5TA 2G97A 4R33A 3KRSA 3NDOA 4JX5A 2CZ5A 2Y7GA 1QO5A 1DORA 4JY8A 5FF3A 1OX4B 4H4IA 3MUXA 4IX0A 5C2XA 2JBMA 4IQLA 3ABQA 1XBZA 2E5DA 3HG5A 3UXDA 1V7YA 1VQTA 3L67A 4XQ6A 1KV8A 4O0KA 3P7YA 4PC8A 3S5YA 3QW3A 1WXJA 5G4WA 4O1CA 1AW2A 1H5YA 3OVRA 3LGEA 4MLJA 3S42A 1U83A 3NPUA 4ZZ9A 5LNRA 3M5XA 1H61A 4Z1BA 3W2LA 1OABA 1XDLA 2CW6A 5LSMA 3MWAA 3B05A 3WK1A 3UPBA 5F2LA 1T99A 1TMHA 5HUOA 4MLRA 3M7WA 5LNUA 1R2TA 3TSDA 3BLFA 1G7UA 4O12A 2W79A 3KOFA 4OE7A 3EXTA 1JCMP 2B4GA 4FX8A 4A22A 3T44A 5CSRA 1TJPA 2E1DA 3W22A 4RKAA 2CLKA 1IF2A 4UTKA 5K2ZA 3W84A 5EY5A 1GEQA 4UFIA 1QWGA 1KBJA 4Z08A 1ZENA 5E1QA 3PAJA 3INPA 5I3GA 2PC4A 5KZDA 4YL2A 1OK4A 2X1RA 3FYOA 1GVFA 2TPSA 3TKFA 2ZZ2A 3NQ6A 2ZCGA 3QYQA 3TXVA 3W1UA 1YYAA 4JN6A 1TCDA 4LRSA 3GVGA 3MBDA 4N6FA 3W1PA 4DF2A 2IQTA 2G5WA 2GOUA 4JTUA 5D2TA 4B5NA 1VGAA 4AWTA 1M6JA 3G24A 2TYSA 1GG1A 3N73A 1YXYA 4DBEA 2Y7EA 4MZ1A 4E38A 3FIGA 3LI1A 3HG4A 2ABAA 5D2VA 5AYXA 2VFEA 3BW2A 5HMSA 1K7EA 2BLEA 3LHYA 3EKZA 1TPC1 5AFDA 5BMXA 1PCWA 1XL9A 4BFAA 3P5ZA 2NUWA 2NV1A 3TQVA 1EUAA 1GWJA 3GDRA 3T40A 2O7SA 1WAUA 3BPWA 3R12A 5D32A 1XBVA 1DOSA 3CIWA 2Y7FA 1V5XA 1OFDA 2QJHA 5L6UA 4ZMGA 3W7HA 4MIMA 4DF0A 6TIMA 4MUZA 3LTSA 1W5MA 1YPFA 1A50A 3RLVA 4O19A 3W2UA 5AHNA 4RK8A 3PB2A 3THAA 5C54A 1W3NA 3C0JA 2CZFA 4XTIA 4AF0A 4Y9AA 1UUOA 1VYRA 1BWKA 3I6RA 4N4QA 2Y88A 1I2RA 2OMAA 3W3OA 2J9ZA 4AXKA 4DO5A 1W5OA 4WXYA 2NX1A 2QF7A 5D2WA 5KSWA 3M41A 3IEBA 3NQAA 4HSOA 1O94A 2C14A 2VXNA 4LS1A 1F7BA 4UMCA 3CEUA 4LC8A 2BSLA 3G1FA 4UMBA 2DJLA 3TE9A 3B0UX 3CIXA 3NQ2A 4O57A 2ZA3A 1FWTA 3E96A 4MJMA 3DI0A 2I1OA 2ZZ5A 1EIXA 1TPH1 2E6DA 1QFEA 1W56A 3DHFA 4N2YA 1B4EA 3ZWTA 3N14A 2CZEA 1TTQA 1AG1O 1K02A 4JIQA 3TU9A 4OGZA 5DXYA 3H53A 4LNYA 1UB3A 2WJZA 3QW4B 1QPRA 4GRSA 3ZR4A 1F05A 3OIXA 5EL1A 2WO5A 1EP2A 1K7FA 4CQAA 1BKSA 3UY8A 5TQLA 2V2HA 3E02A 3NQVA 2EAWA 4JNMA 4TIMA 4K38A 3Q37A 5KZEA 4Z1CA 3W85A 4FO4A 2DZTA 2CLHA 6ALDA 5TBOA
chains in the Genus database with same CATH superfamily
1OX5A 3CAVA 5HNTA 2ACUA 2GUYA 1XYMA 4NU7A 5D30A 1L6GA 4LAOA 1T0OA 3LPFA 1NP2A 4H8VA 3OTRA 3T1GA 3EWBX 1YNYA 4B3KA 5C70A 1WNOA 1XH1A 2CHOA 1UD2A 2XIOA 3VC5A 5DY2A 4JTJA 4CD5A 1QATA 4UNIA 1V0NA 3ZO9A 3LK6A 1T5AA 3NAVA 3P82A 3WD0A 1C8QA 4N9EA 4LEQA 1J12A 7REQB 3N13A 1EGMA 1CECA 4IPIA 2FFIA 1YEYA 1RJPA 1YE4A 1QTWA 1CXHA 2I17A 4XZMX 3GKAA 4JDYA 4N9CA 3NOYA 1HL8A 3BJTA 3AICA 4IFKA 4EF9A 2VQTA 4JTLA 3H23A 3ITYA 1F73A 2OR2A 3P81A 1KB3A 1TV5A 5REQB 3ARWA 5ABHA 3ZJ8A 3SM0A 1FWGC 1E1EA 2PGFA 1WBJA 3KBMA 4O1BA 3GNNA 1NTHA 1FX6A 1AK5A 2Y62A 5IXEA 4LAUA 3CH0A 4RW5A 3BAWA 2BS9A 3UG4A 3LPOA 2WNQA 4H2CA 4MUPA 4LB3A 3WDRA 2A3AA 4MJZA 1A5MC 3O2LA 1R86A 2D23A 3FV9A 3GNXA 4EWND 2QJIA 2QDHA 1P0DA 2IQ0A 2XSBA 1PKLA 1YHTA 4M7SA 1NOUA 1PYMA 1MEWA 2NXGA 3CEPA 5ABEA 4FOUA 4JFSA 2XN1A 4QEHA 1CB2A 2ZXBA 1FWJC 3BLIA 4YS1A 5FF0A 3SIMA 3TAKA 1OC5A 2O92A 1SFTA 4AZGA 1G4SA 1YXDA 3UG3A 5CSSA 1BLIA 1R3VA 4FNQA 4ZFCA 3M0LA 4FNSA 1P0KA 1P1MA 4KESA 3MJMA 5I3JA 3VIMA 1XM3A 1XYBA 2NXHA 2CLMA 3KBNA 4GJ1A 3UYCA 1H7WA 1EX5A 1EC8A 3WLOA 3GHSA 5D33A 1J0JA 4ZOAA 1MW1A 2OX1A 3BVJA 1YTDA 5A69A 3F03K 1EJ7L 5HMFA 2V81A 1R3TA 4M6QA 1ZS2A 2WAGA 3I4EA 4MAVA 3STFA 1FCVA 1F4AA 3W27A 5AC4A 1E6QM 1ITQA 3EX3A 3V0TA 2PDGA 3IVTA 8CGTA 4QROA 3HFTA 3CAWA 4E6MA 1J5TA 3KVLA 3RYSA 3OA5A 3G0XA 3CASA 1XBYA 5LA0A 2D2OA 3UZ5A 4FNPA 4M5PA 4LSBA 3DFPA 1KBKA 2OELA 1B54A 4EXQA 2EPHA 4W7UA 3B8VA 4H6RA 4MFDA 5FEWA 2YCJA 1PAMA 2C3ZA 1NP0A 3F4VA 2PD9A 2ZRVA 1WO2A 1RJQA 3SY8A 4U3AA 2NVCA 3W1XA 4W84A 3JZEA 3PJTA 2O9TA 1W5PA 3K8MA 4O28A 3OW1A 1JRBA 3W82A 3VIGA 3O6YX 3GTXA 4GUFA 1XIJA 3BG3A 4XO7A 3AIEA 2GDVA 2HNEA 4FR1A 2Q09A 2Q8ZA 2J9YA 1FRBA 1B31A 3FXGA 2QMJA 4QBXA 2XM1A 4UZUA 4B2DD 1YADA 1GZJA 3VOCA 3PWIA 1K8ZA 3RX4A 3RM8A 4JEJA 4F0MA 2XUCA 3N19B 3PY2A 4GCXA 2I5IA 3B0VC 2WVVA 2QF8A 3CMJA 1SSDA 1WX0A 5MKGA 4HOZA 4IGNA 3BGAA 3OP2A 3EEZA 1K70A 5KZ6A 2INZA 1XG4A 1OD0A 4CCDA 3APTA 1K4HA 4DXXA 5I77A 4O14A 4UR9A 1VBUA 1VHNA 3U2ZA 4OOUA 2J8GA 2X1UA 1JF5A 4E2OA 3WLQA 4D6CA 5HQLA 3F4NA 3SIZA 4YNGA 4EOUA 3WLRA 4MNLA 3ZR6A 3UR2A 4LUTB 1YTEA 4C7FA 4F66A 1YRRA 3QRHA 1K03A 1YE6A 4GQRA 4JTCA 1MZRA 4W7VA 4U31A 3QC0A 3EB3A 3ZOAA 3GY1A 4GZEA 3B9DA 3BJFA 4FAMA 4WXZA 3WQFA 3M5ZA 4B3LA 3NR0A 5GPRA 4Z1YA 3BAKA 5CJMA 2ACSA 3N1AA 1YMYA 1VLIA 5C9RA 3D3AA 5H8PA 1Q6DA 1E4IA 5F4SA 4MFEA 5LHEA 5F1UA 4KMQA 4C6LA 4D6HA 1FH7A 5A8NA 1GCYA 2BHZA 3P61A 1TJ2A 3QGVA 3VE7A 5HWJA 4MY1A 1DBTA 3H24A 4F0HA 4KERA 1OGBA 5DBTA 5F7UA 4G2DA 3H70A 3TAOA 3DC8A 1EWDA 2W63A 4PA8A 3KAOA 3M16A 3NSMA 4JHOA 5CZKA 1ICPA 1U1UA 4X9SA 4ZVJA 2XPKA 4AWEA 3R1ZA 1EP1A 3G1HA 2FMNA 4YWSA 1EA9C 4BF9A 4DI8A 1AD1A 3L68A 2D3NA 3B8SA 3H2NA 4MNJA 2WSPA 3FHQA 3WDIA 2DH3A 1IEQA 2X09A 3C3UA 5DCEA 4QISA 1U22A 2D22A 3AIUA 5BOFA 5EMYA 3CC1A 3HPZA 2A3BA 3P60A 3OU8A 1B1YA 4GGBA 3UJSA 3S4TA 1B57A 1JI2A 1SW7A 3TEVA 4UQEA 4PODA 2V68A 3G5EA 1UWIA 4N42A 4M6VA 5CSUA 3A9IA 4OIFA 2VENA 4KFNA 3R13A 4G1NA 3K8LA 4EX4A 4ACZA 3C2EA 3UA3A 2FPYA 1UZDA 4D1IA 2E25A 1SVDA 1V7AA 1XIBA 2YW4A 3S5OA 3WLTA 1QRQA 3BDKA 4QP0A 4CNOA 3KZPA 4GK8A 5T9BG 2G37A 1NF7A 3FHAA 2VOMA 2J4GA 2YCEA 3PPCA 2WM0A 4HB7A 4M81A 2E6AA 1JCTA 1WKYA 1I2PA 4CN6A 3ZXWA 5F2MA 4TU1A 4UTTA 4I6KA 5A1AA 4HZMA 4O1AA 1V8EA 3IJ7A 2BOGX 4QLLA 1HL2A 2F8QA 3U5YA 4IJBA 4DO6A 3I7SA 3O6AA 3CAKA 3OB8A 1FWCC 3POHA 1RUSA 1E9LA 5T9CE 3ANUA 3N29A 4UQ9A 1TRIA 2EHHA 4PUUA 2YZRA 3QGAC 2VC9A 3WH7A 1X1OA 3TCEA 3KBSA 1OIFA 4TX8A 4EPKA 2Z2UA 1J4EA 1XRSA 5A6BA 1RVKA 1HJSA 2QXWA 3TYBA 4HPNA 3BG5A 3LSCA 3U8GA 3TFXA 1AH4A 2R94A 4RXFA 2UWFA 3AMDA 2AQWA 2FYMA 1WB0A 4IMFA 4KQNA 1DJXA 3KVKA 5CAHA 4DUWA 1QCWA 3W75A 2I5GA 3RU6A 3KCJA 2HNHA 1KV5A 4MPKA 1P7TB 2DY3A 3BTNA 3WUFA 4E3VA 3EB4A 3TJLA 3L0GA 1ADDA 2QCDA 4W8LA 3M0KA 3JVAA 4FP1A 3EWYA 3W74A 2PBOA 1UP0A 4S39A 2QGHA 4JTFA 5LIUX 3ELFA 2YR1A 3VZZA 5E09A 5C7VA 1UR1A 5CG0A 5JXQA 3KP1A 1IEVA 3WF1A 3GUWA 3CWNA 1LOSA 3C86A 3NYZA 4TVDA 1SZNA 4F0KA 3LHZA 1KQZA 4NT0A 4P61A 3CUJA 1VEOA 3WFAA 3HU7A 3OLDA 3RCNA 1VFSA 2Q8LA 2EG8A 4S3KA 5HANA 3CMFA 1NDVA 4L6OA 1SW3A 1LLWA 3WDHA 1PSCA 1FA2A 1GT8A 1EXPA 5I3KA 4ZSTA 2HSAA 4QNEA 2G8ZA 3WELA 1BYAA 3A5FA 2PTZA 4B4HA 4D6IA 3BMXA 1RP9A 1ML1A 4Q7IA 4YCOA 1Y8BA 3MO4A 1H1ZA 3VIKA 2PA6A 4RZBA 4WKFA 1UD4A 2HROA 2Q71A 4ZA0A 4FOJA 2VVSA 1JDCA 3KXQA 3IUIA 3CZLA 1KR0A 3DG3A 1CXKA 1F5ZA 2EPOA 5ABGA 1VBJA 4ES4A 1HIZA 1MO0A 1KLZA 3W73A 4IG2A 1D7FA 2UV8G 3EDKA 4P2VA 5FL0A 2YFNA 5DELA 1J93A 4DJDA 3EYPA 1XQLA 1VJSA 3B9NA 4AZ6A 4O13A 3B03A 5ABTA 3W71A 4UXDA 3P80A 1XSKA 5FSEC 3UJEA 1NY1A 3RPMA 4F9DA 3WF4A 4A4AA 5U4NA 4LF1A 3ARZA 5TD4A 1EUNA 5A8OA 4EF8A 3ZSSA 2UY3A 3S5ZA 1FWNA 3KFTA 3WY1A 2P1FA 2OPJA 3CHEA 1E9ZB 2HWGA 3P62A 1A0CA 5BRPA 1KXTA 4NIRA 1GW9A 4JCLA 3FA5A 1GKPA 4IPNB 3GYCA 3PS7A 4N0RA 1J79A 4LY8A 3KE0A 3TTSA 1CLVA 3PZTA 1PX3A 3VU2A 1Q6OA 4LVBA 3UJ2A 5FL1A 2G3IA 4QR6A 5FF4A 4Q8TA 1CB7B 4C6EA 5I78A 1WDRA 3MDWA 3WENA 2H6RA 2WPBA 1J2WA 4XZLX 1RBAA 2NT1A 3WQDA 3TR2A 3LM7A 2WKLA 4HYRA 1DWAM 3VD9A 4WOQA 1SR0A 1XSJA 2C18A 3S6DA 3ID7A 2GK1A 2PSNA 5DMMA 2JF7A 2YB1A 1Q13A 4WDXA 4QDMA 1JULA 1X6LA 4TVCA 3L66A 1Q6EA 1BEUA 2JIWA 4CD6A 3GVQA 5K4XA 2OODA 3CZGA 3LUTA 3DIPA 3NQEA 3UZJA 1OFPA 1DXIA 1VBRA 3T81A 5FKYA 2CEQA 3GD6A 1JCNA 3ZT7A 4X2PA 3AUJA 2ZWZA 4FLRA 4K8HA 2VWSA 1SZEA 3RLHA 2CZVA 2J8TA 4JIEA 1MDLA 2Y5EA 1HFBA 1HXJA 4I5RA 2VQUA 4BJHA 4R5EA 3UEQA 5AB3A 3ARUA 5JH2A 2F61A 4JYFA 1UBPC 3QMRA 5I03A 3NCOA 3AZTA 1W2PA 3T8LA 2PB1A 3B06A 2V5CA 3IJQA 1XKJA 3IUHA 5EB8A 1UWTA 5FEPA 1DKWA 1VR6A 3II1A 3O9NA 3W00A 3GU1A 3DG7A 3L4UA 5EBUA 3GX9A 1VFMA 3MJYA 3BMVA 2CWNA 3S2MA 3G1VA 4QE1A 3KL5A 1WZMA 1KC7A 4DAIA 2I9UA 4U2YA 3W2JA 3PPHA 2YIHA 1AJ2A 4MB3A 3VD3A 4KRTA 1H50A 4ZXOA 1PB0A 5LXXA 1HKMA 4DYEA 4N6EA 4UQAA 1W9VA 2ZVRA 4R7JA 4MNKA 3ZIZA 1XYCA 1XCXA 5BXRA 1IT8A 1KFBA 4NSBA 3W23A 4AC1X 1C3FA 1EJWC 4MJ4A 2H8XA 4J3SA 3T0AA 5A8GA 4AYGA 1IEWA 2E0PA 2BZNA 5H8UA 1AL7A 4PL2A 4ZGYA 3FJLA 2C0AA 4IPPA 1Q8AA 5EMJA 4X0NA 1XD1A 5LHFA 1V6XA 4GKLA 2OO0A 2QJMA 5FIPA 3O15A 2HDJA 4I6VA 3WBAA 4GFIA 4Q4PA 1MSSA 1GHSA 1K6WA 3KDOA 2QJGA 1QNVA 3SUSA 1IXPA 1OFRA 2P8CA 1R3RA 3AS0A 4GJIA 1AH3A 1EGZA 2E09A 1KNWA 4H1ZA 3S6TA 3LBOA 3L0NA 1ZSXA 3GTNA 3LCLA 3CPRA 4HNCA 3QYSA 3UPWA 3U48A 2QUUA 5G4HC 2QV4A 2ZE0A 3TW9A 1DHPA 3P8IA 3GXFA 3N2CA 3WNOA 4DPQA 3FSUA 1PO9A 4R7WA 1V6VA 3RJYA 2XFFA 3NQ8A 3WJXA 3DAQA 3ARPA 3FS2A 4JTEA 1TE6A 4R85A 3CK5A 3WFLA 4LTSA 1YBQB 1NFGA 1QUMA 5BRBA 3LCGA 4BWLA 4HKPA 3OVQA 3VKDA 4UTFA 2FHCA 3WEOA 1QDSA 3O1NA 3VMOA 4N4PA 3BARA 1UROA 1TR9A 2X2YA 2PDKA 1KM2A 4AISA 1UD8A 1E71M 2Z27A 1KM5A 4MTVA 2XVNA 3MZNA 2IKGA 1NU5A 5AOUA 3NQDA 1S2UA 1IYXA 2BG5A 3NL2A 2FFCA 3EX6A 3OGRA 3CQKA 3S2CA 1BVZA 2PTDA 2R1LA 4GUJA 2RKXA 2ALDA 4US6A 1NDYA 1WXYA 3N4AA 1FWBC 1DWGM 4NJKA 2XN2A 1R9XA 1O7AA 4NNCA 5HWMA 4WLCA 5JU6A 3KL3A 2HCVA 1TX0A 2YLAA 1WZAA 1D9EA 3CTLA 3DFSA 1DTNA 4UFLA 4R9XA 4OOZA 1I4NA 1WZKA 3PNZA 2CU0A 2OO6A 3DFTA 4RL3A 7TAAA 4YPJA 3QPZA 2L5HA 1GNXA 4MADA 2FZMA 1PZ1A 3UYIA 3RO6A 5A6KA 2VCCA 1UWUA 3KM8A 1HKKA 4A8IA 2FJKA 4ZR8A 2VFDA 4LBSA 5HULA 4JNYA 1GOWA 1LL4A 3MYPA 1XF0A 3ME3A 2WBGA 3CUFA 3CL7A 1TWIA 3IARA 4XO6A 2DW6A 3L5AA 5D09A 1AFSA 3XIMA 4B3ZA 3HQ1A 2E1WA 4EVZA 3VK5A 2WOQA 4MWAD 2CBVA 4MY8A 2J13A 1JD7A 4C6QA 3ZR5A 2CLFA 3V0SA 3AALA 3FK4A 1KKRA 1R5YA 1WKDA 1QJWA 1MNSA 1PWMA 4YN5A 2NX3A 3VKAA 2VZSA 4WR3A 2WNZA 3FFSA 5IFPA 1BQCA 2ZC1A 3H2AA 1IGWA 4ORMA 3H55A 5D9MA 4L4MA 2W3ZA 4Q8QA 4M82A 4WD0A 1Q2SA 1H7RA 1GVYA 3SCVA 3W2MA 3PJWA 1FFQA 3FNDA 2ZUNA 4GX9A 3RM4A 1HKIA 1LT8A 2PFHA 2ZA1A 2ODOA 2OGYA 4D6GA 3EZ4A 1QOPA 5CLWA 2P50A 1TTPA 1UA3A 5HDRA 3DFNA 4DXVA 3PM6A 4AHPA 1U33A 2QMKA 4J3VA 1H60A 1QI4A 4GYFA 2QAFA 4RW3A 3BOLA 3QY8A 5TIMA 4C7DA 4JYDA 3USZA 4NG3A 4PB3A 4NNAA 1V0MA 3T55A 1UPMB 5D8WA 3BOFA 1A5NC 1ECEA 2IXUA 3ZVHA 4ZXLA 4RR4A 1M01A 3E0WA 3G1DA 1EBGA 4GO9A 5KETA 3DHPA 4RE0A 3MMUA 4DPPA 3ABSA 1ELSA 1VFOA 1UKTA 4ZTYA 1M3UA 4Q8OA 2ATMA 1OWQA 4URIA 1QW9A 1T8XA 1TFVA 3CPGA 4B5SA 2E5BA 1X1ZA 1ZBVA 1NWTA 2QCGA 5BROA 2CYGA 1F07A 5FJOA 4HHLA 1XUZA 4GO8A 2ISVA 3KOZA 1A4MA 2DZAA 2WSYA 3M46A 3KEHA 2VM8A 3DCPA 1QI0A 3W37A 3T2PA 1U2YA 2PLCA 3PAOA 4HMNA 3PVFA 3SCQA 3H54A 2EGZA 3UZZA 2WJDA 2XIJA 3D47A 3MI6A 1CBGA 1V6TA 4LCQA 1EX1A 4AYSA 3QEZA 1MW3A 2C8NA 2DT1A 1TIMA 1OCQA 5ECUA 1ME7A 3GNPA 4GINA 4GGHA 3M43A 3TOYA 3WF0A 4RCXA 3UXLA 3WDJA 1RLDA 3O07A 3LX9A 4C6BA 4C1LA 1OC7A 1B3XA 3MSRA 3RCYA 2PDBA 1E9YB 1GQKA 1UIPA 1O60A 4HCLA 1CCWB 1W1B1 2Y4SA 4PBEA 3RG6A 1BVNP 4MKVA 1LZOA 3D6NA 4IFKB 2OX4A 2I7GA 4REQA 4XUYA 2ZRUA 2J7EA 3QPYA 4LV9A 4C65A 2XH4A 2OKOA 1GG0A 1SR9A 2GZXA 1TV4A 4AD1A 1BTMA 4QQUA 1LORA 3MP4A 1AMKA 5H8MA 1XDJA 1QMLA 1ESWA 3R7MA 4FB7A 3W1LA 1A5AA 2Z0IA 3ZMRA 1LCOA 2XZ7A 2ZOXA 4AAJA 1WYIA 3WLPA 1PX4A 2R1MA 1HJVA 2GQ9A 5IOBA 1MUWA 2F38A 1ENUA 3B0PA 3QTPA 3UT0A 1JQXA 4HBKA 3TQKA 5I79A 1LBLA 2Y8KA 3FLUA 4XBJA 3W1NA 3DFYA 4A3YA 3LRLA 3B9EA 1ZZMA 3PANA 3AMGA 5C9XA 1TJ1A 2WYSA 4BF5A 3RMEA 2ABBA 4IQEA 2P10A 2C7FA 3ANYA 4F79A 2QVNA 2YFOA 3HOJA 2B81A 1V3LA 4DY1A 4AMAA 4K36A 1FXQA 2G97A 4HJWA 4R33A 3NDOA 4JX5A 1B3YA 4G8TA 1QO5A 5FF3A 4H4IA 4WJXA 3H2EA 4IX0A 5HBFA 1JZ4A 2HISA 2AKZA 2BNJA 3ABQA 2ZUTA 3UXDA 1VQTA 3GG1A 1VKFA 2JEQA 4XQ6A 4IFOA 4PSRA 1A5LC 3QW3A 1JYWA 2OOGA 1AW2A 3A12A 5HNNA 3LGEA 4MLJA 1IEXA 4PCSA 3KW3A 4E4PA 1EH9A 2J75A 5JBEA 2J7BA 4KIRA 3M7WA 3KHDA 1JCMP 3L4ZA 1Q63A 4PTXA 4A22A 1GKQA 3BAYA 4KWOA 4GY7A 2CIPA 4XD4A 2IKIA 1ZENA 5E1QA 4AY8A 4YL2A 1XIDA 4MKSA 5BYWA 2R82A 3VNJA 3ARTA 3STPA 1Q4WA 2ZZ2A 2ZCGA 2C91A 1FH9A 4JN6A 3GVGA 3W1PA 3CQJA 1V3IA 3KRBA 2GOUA 4CGTA 1IR1A 4R7OA 4O8AA 4EPDC 3L2MA 1VGAA 3V4BA 3DFHA 3CS2A 1M6JA 3GSMA 5DF0A 3N73A 4DBEA 5I02A 4S3DA 1FWIC 5D2VA 3TOPA 3GDBA 1UKQA 4AEFA 4ZOEA 3BAIA 1X39A 3EKZA 4XZIA 1O68A 2BASA 3AOFA 2PDFA 4F48A 1Q7MA 3W26A 5MKGB 1PCWA 1XYFA 3G1RA 3ONBA 3KOXA 2NUWA 3T40A 3U9IA 2DUZA 1WAUA 2O7SA 1DOSA 1PTGA 3EPNA 3GTIA 2Y7FA 3AS2A 3FA4A 2QJHA 3U57A 4ZMGA 4MIMA 3GG7A 2RDXA 1A50A 4GYPA 1ZJHA 3PB2A 3THAA 2CZFA 5I6SA 4UWMA 1VYRA 2CWXA 4EKJA 4R88A 4KS0A 3UCDA 1T7LA 2Z7KA 1QVBA 5KSWA 3M41A 3WQVA 3AI0A 4DWSB 2C14A 4BS0A 4DJFA 4DZHA 5J8LA 4UMCA 4LC8A 4AX6A 1P6BA 2DJLA 3ARYA 3B0UX 4GJJA 2ZA3A 3AMLA 3HQNA 4P8XA 3GFZA 1UWRA 1W56A 1B4EA 5I09A 2PWHA 4FLQA 2VCAA 1EXBA 1XW8A 5DXYA 2B31A 3UWEA 4PSPA 3SCNA 4PMJA 3BJSA 1UWQA 2J47A 1QPRA 4ZB2A 1OGSA 3ZR4A 3RRXA 2WO5A 3CIVA 1I1XA 2WLYA 1E4MM 4TIMA 4HJFA 4Z1CA 1OBAA 4YYFA 1EYEA 4IFRA 4FO4A 2FTYA 2EPKX 3QBUA 1UH4A 4AVNA 3VM7A 3B8UA 4ADTA 3W6YA 7ODCA 1XIEA 1JR1A 3N2TA 1M04A 1Q6RA 1UOKA 2NX9A 2PDMA 2W4XA 2QPSA 1P0NA 4ZO9A 4AUBA 3RXZA 1AW1A 2WHKA 4P8WA 4L65A 1HX0A 1M7JA 3EBVA 4UB9A 1EEPA 3A3HA 5AN7A 3NNTA 1UMLA 3UR8A 4C60A 1EGVA 1ZBCA 3GXMA 1GPFA 1HVQA 4PUDA 3C0LA 5CXPA 1Y5XA 4HHPA 4H9MA 2HMCA 4P8VA 3EDDA 1B2YA 3R0UA 5CPMA 3PZMA 2RAGA 1FKXA 4OHQA 4E2VA 1HW6A 1BXCA 2Z1SA 4YTTA 1X1NA 5EGRA 1EQCA 1TKKA 2AL2A 1WP6A 4PR4A 1E9IA 1UKSA 2HVOA 4JPGA 1KLYA 2PAJA 1NWRA 2CETA 4M1RA 3QHMA 3HM7A 2A79A 1T96A 4Q6JA 4BR1A 5D2YA 3C2RA 2O4QA 4IJRA 4CQBA 1XUUA 5I23A 5A8PA 3RJXA 3WN6A 1EHNA 4B16A 2PDYA 3VD4A 4N02A 1Q45A 2QCLA 4J27A 3A5VA 4LB4A 1Z7AA 4LBUA 5HATA 2QCHA 1U1HA 3W7IA 4HMDA 4OV4A 3MKCA 2GWGA 3UWQA 2BHUA 2I56A 5AHMA 3BV4A 3VDBA 2NVDA 4RDVA 2V0TA 5FJUA 3BXWA 3CHDA 3SCTA 2XU2A 3HPXA 4AHQA 3MY9A 3YPIA 3LTPA 3VCRA 1YLVA 1GQIA 2UY2A 2DH2A 3WJSA 2Q8XA 1JRCA 3HBLA 2E9BA 3W25A 2HK0A 3AXXA 4M56A 3U2CA 4H41A 3IK4A 1F74A 1G69A 4DLFA 2UY5A 4MPQA 1KFKA 5DMNA 3PUDA 4H6EA 3W6LA 1H5VA 3CWHA 4HK7A 1R9ZA 3W2KA 1LWIA 3WBEA 2BOEX 1B0IA 3FJNA 4O0QA 1W5QA 2R14A 1CYGA 4V27A 4V2XA 1BYCA 4TXEA 1Q6QA 1ZJAA 2PWDA 4ZL1A 4OFCA 4LV4A 1QHOA 3HB9A 4XTDA 4PRWA 5F4XA 1CGUA 4NY2A 6A3HA 4LUTA 4C91A 4BEUA 3DENA 3NO5A 2V6AA 2A0NA 3OO2A 3NQCA 5JBDA 4JIRA 4MOZA 2OT1A 2VGGA 4MWAC 3I6TA 4YVXA 3O63A 4CQ9A 3RILA 3L21A 1TWSA 3C0SA 2VRQA 2WANA 3U4AA 4Q4KA 1KRAC 3GR8A 1GORA 1ZU8A 1KM4A 2DGAA 5C2GA 4XWUA 5HPCA 4NAFA 5A2CA 4L9ZA 2IUZA 4C6KA 2A4AA 1MEHA 3POCA 4CQDA 2OZTA 4JDBA 2W61A 2BY1A 2MANA 4HPGA 4OZOA 1KTCA 2CBUA 5M03A 4LUYA 4HA4A 3WMCA 4IUGA 4NI8A 4P7OA 4US5A 1UR9A 4GY1A 4IIEA 4BK9A 3DYPA 5DY3A 3I7RA 3HPAA 3SY1A 2Y5JA 4PTDA 4Y96A 4PMVA 3E0FA 2DJXA 2OWCA 3PP7A 2ZX9A 4QSHA 2PZNA 4KFPA 1NJJA 4M6PA 4D6EA 3CMGA 4HSHA 2G3FA 4GVIA 4K8GA 1DYSA 2DT0A 2VZTA 4OUIA 1K4GA 4YMZA 1HKJA 4FLSA 3WD2A 2J7FA 1VIWA 2XHYA 2D2JA 3SSZA 1ZJIA 1B90A 3NQMA 2BTMA 1W1A1 2PUZA 2YDRA 4PCFA 3UWVA 4H9VA 1FWEC 1EKOA 3HJEA 3NYDA 3VFCA 1DJQA 2PRLA 2HK1A 1WDSA 3AXIA 2ZXAA 4GPNA 5A8QA 3S1XA 1ECQA 1W3LA 3BG9A 5HXMA 1IWAA 3TW7A 5EMUA 1ISYA 4E2DA 4AB4A 3Q58A 4C5YA 3LN3A 1FP9A 5CPTA 1YXCA 2TAAA 3GDTA 2FKPA 3OZYA 2V9DA 3GO2A 3W24A 1Z48A 2OLAA 4DELA 4Y6GA 1WDQA 2J8FA 3QQWA 2A1YA 3RX3A 1JFXA 2PP1A 1CI1A 4XUGA 4L80A 3DDMA 2RDWA 1DV7A 1G67A 5DCBA 4Y90A 2YLLA 4XD5A 2VUNA 4W7WA 2INEA 4E2BA 1AJZA 4PMYA 2DVTA 4MMWA 1J96A 3SY5A 3VX1A 3W7DA 1W1PA 1TWDA 1JYXA 4JX4A 1GYNA 4ZODA 4W8AA 4J7RA 3ABOA 6TAAA 3S8HA 1VJZA 1ZNNA 4TQTA 1K1DA 1FOBA 2WV8A 1B9ZA 1UASA 1XRFA 3P5YA 3N6QA 3QMTA 1K9TA 4YLWA 3IANA 2ESCA 1ONXA 1XINA 1W5NA 2CZDA 1OG0A 4NUWA 3QV8A 4V28A 1TVNA 3S2LA 3LHWA 4QLKA 1EB3A 3WQ8A 3CT7A 3W1TA 3PWAA 4NZ3A 3GC5A 5BZAA 2D3LA 1E51A 4GI8A 3REQB 1PX8A 1W37A 5E0FA 1X8CA 4K7YA 3S1UA 4Z1AA 3WF3A 1MQPA 5CZ0A 5FJIA 5DN1A 5CKSA 4PEEA 1TR1A 2P88A 4IMEA 3GYEA 1I2NA 1M5WA 1W2VA 4HN8A 2ANUA 2HS6A 2Y89A 3SRFA 3SB0A 4GVHA 4J4KA 5JIPA 4PBFA 1V3MA 3MWCA 4XKYA 4QTGA 4H7VA 3PZOA 4HPJA 1P7TA 3ZLHA 1XH2A 2ZYFA 3GHUA 2O56A 1VENA 1N7KA 2UY4A 2XVKA 3LCIA 1J0ZA 3TROA 3IGHX 1XI3A 3NUKA 3H4WA 1O5XA 2JKEA 2CKSA 4CNNA 1Q7QA 3IJLA 2QDEA 3PWGA 1EOMA 1TPEA 1XLMA 3PR2A 2OWWA 1XKYA 1RCXB 3AC0A 4DZ5A 4UTIA 1TREA 3Q2DA 1S1PA 1ZAIA 4M1BA 5HR6A 3NL3A 1BXNA 2GJRA 3O0KA 4C6PA 1H7XA 3KLLA 1I1WA 1VLWA 4JTIA 4LWWA 3AYTA 1W54A 3UP8A 2B7OA 2GYIA 3MP3A 1EO7A 3F5JA 3MA8A 3W0KA 3STGA 1NARA 3SEPA 3N34A 4XAPA 3MTWA 3LQGA 4H04A 1EJSC 5C8BB 3HGRA 5FACA 2F2KA 3IPWA 3C4UA 3LOTA 1XG3A 3IACA 4LVAA 4DB7A 4JY9A 3RAOA 3HMCA 4UMAA 3C5QA 3V75A 1VCFA 3IV3A 1VPYA 5AYYA 4UTLA 1E55A 4QJ4B 1NSJA 1KM1A 3ALFA 1UH3A 3TIMA 5HOSA 3BV7A 2R6OA 4UQDA 3EOOA 3FDGA 2DZXA 3LCXA 4C6OA 5M17A 5LIWX 2VC6A 5I00A 4NRSA 1EJVC 3FKKA 3FAWA 3BANA 4ADUA 4JXCA 4IUOA 3WDQA 4ZQMA 5LNRA 2FPVA 1TV7A 1KM0A 1EWEA 3DERA 1CXFA 1Q6LA 2ACRA 2AOSA 1UA7A 1BRLB 1DP0A 3A21A 4JKKA 3CV2A 3NO1A 5HJYA 3BSHA 5A6BD 1H49A 3W4RA 3CV1A 3UR7A 3TVAA 4PUEA 4PZVA 4XZWA 3NGFA 2WMIB 3NWRA 1QOQA 1Q7ZA 4XVDA 4KKXA 4S3GA 3EOLA 5I3HA 2EPLX 3P6LA 2REQB 9RUBA 4OUEA 3FXYA 1GOMA 5E0CA 3XINA 4GABA 1DIDA 1YKWA 3ZS4A 2NSOA 3VFLA 1IEIA 4HTBA 3AZRA 1ZCOA 4D8LA 3TTYA 3LGGA 3GXNA 3DHUA 3W7CA 4ECLA 2OT0A 4J3TA 1ZJBA 1W1VA 3CYVA 5B80A 1RVGA 3KRUA 4U5IA 3Q4DA 1LJYA 4NP7A 1F3WA 2FZBA 5LGZA 1PIIA 1VS1A 5CGTA 1CPUA 1XIGA 3BLOA 3W1MA 4IOTA 4XKMA 3AS3A 3E38A 1N8WA 3LCFA 2FVLA 1E6ZA 3K2GA 3WLSA 3APYA 4PTNA 4FIRA 1HTIA 4ONVA 4ASTA 3SUUA 3N2MA 4DHGA 4MVAA 4TX9A 4OT7A 1ZB5A 1B9BA 1MQRA 4X22A 3ITXA 3WJYA 3WH8A 2HVNA 4Q33A 3R8GA 3PZVA 3V18A 3WK2A 3NL5A 3T0DA 2WSRA 3I7QA 1FWDC 2ZBTA 3GW0A 1UR0A 4Z2IA 5DT5A 3PUOA 3IVSA 3H6OA 2G3MA 5I06A 3V7PA 2PCQA 4DJDD 4NHVA 1CLKA 1KR1A 4P7NA 3R10A 5DT7A 3BQ5A 1LWHA 3GVVA 4GYKA 1EP3A 1KBBA 3FGCB 1UUQA 4CCCA 4ICMA 3NZRA 4QITA 4LC6A 4DUXA 2R9RA 2CESA 3GIPA 2VMFA 3MBFA 1CXLA 4C1KA 2VDHA 2A7NA 1OFBA 2PCEA 1JQVA 2NUYA 5EPDA 3P74A 1ISZA 1SPQA 2PI6A 5GNXA 4C1NA 5XIMA 3FKRA 2PD5A 1R6WA 2I14A 1DJYA 3KBVA 3VD7A 3PULA 4C6NA 2HS8A 4BQ3A 4WVXA 4HMCA 2QS8A 2BODX 3LENA 1EC7A 1LOLA 4K37A 5LNSA 1HQTA 1CWYA 5EBAA 1JUKA 3M64A 4AD3A 1OG6A 2IPJA 3OODA 3E74A 2QYGA 2OZ3A 4N7QA 2ON3A 3EOEA 2GVEA 4H19A 2YA0A 4HTYA 1D7KA 1SM9A 3P8JA 1S5WA 2CFFA 1BYDA 1LOQA 1BGGA 2PLJA 4BI5A 3PG8A 5G5IA 4PE8A 3GDKA 3TUUA 7PTDA 4CN1A 5BRQA 1LROA 2OEMA 5AC5A 1TTIA 3L5MA 3XISA 3E2RA 1O95A 1VYPX 4B2DA 1IR2A 2GJLA 1JD9A 1OSEA 4GQBA 3H12A 1FDZA 1EZWA 1T40A 2F6XA 4B9YA 2VCBA 2VGFA 1BG4A 3LNPA 4UNLA 4FPSA 8XIMA 4C5ZA 5DCDA 3V5CA 3CQIA 1FDJA 2VC5A 3MO7A 3ZVHB 2PODA 4IXXA 3B4YA 1ZL1A 1NELA 2XH0A 1ZY9A 1AW5A 2WWDA 1XLDA 2ZZ7A 2GJPA 4ROQA 2WVTA 2IW0A 1RHCA 3FDKA 4OV9A 4HCDA 1W9XA 2IPFA 3QQ1A 1ZBWA 3AHYA 3E6EA 4NZFA 1GYMA 1SJAA 3EDJA 2FHBA 5F2IA 4C6CA 4GC4A 4F2BA 2DZUA 1YBQA 4O54A 3W1AA 4FOKA 3MU7A 2VX4A 1UZHA 1XLJA 1OCJA 1FY6A 3ARXA 5LNWA 4L56A 1HVXA 1P6WA 1JZ6A 2PF8A 1EFZA 1RP8A 2CLOA 2PMQA 3NM1A 5AYZA 2WXDM 3CYJA 3UXKA 1UHVA 4U3CA 1S2CA 2VWTA 5AZ0A 1SGJA 3GR7A 3ZLFA 1EQPA 3URQA 3O6CA 1JZ7A 2EQDA 5AVNA 3CUIA 3WD3A 5DLCA 2NQ9A 2D0HA 2VZUA 4QIUA 4AFYA 1NVMA 3RR4A 5CCZA 3GS6A 2V5KA 4DNHA 5XIAA 2CHRA 3UCCA 4ZB0A 3VM5A 1H11A 4MHBA 1BPLB 1YPIA 1LUCA 4H83A 1K9EA 1PKMA 1QO2A 2Z26A 5L9FA 3F5LA 1V3KA 4HOXA 5A6AA 2CLLA 2PPGA 3LI0A 4K2SA 2YX0A 2GVLA 4POCA 3GNRA 3VGFA 3WDPP 3O06A 4OBSA 1LDCA 4CKQA 4HNNA 4A2SA 1HGWA 4Y8EA 1FP8A 3RIKA 2XGIA 1W1YA 1E72M 2OU4A 3KVMA 1SZGA 1YIXA 3SR7A 2WZMA 3HGSA 4C6IA 4HYVA 1F6KA 3M44A 2YBVA 1DTUA 2PWFA 2OEKA 4JICA 1H62A 4DZIA 1NAL1 3BH4A 4IIFA 1ZAJA 2OGJA 2B7QA 2YB4A 2A7PA 4DJED 2MNRA 1UH2A 4CCEA 1XLEA 2W0UA 4JS3A 1K8YA 4P8UA 1PL9A 2ZUVA 2G4FA 4NNBA 1QNSA 4F2UA 5CJ5A 1VFHA 1XH0A 2BHYA 1Z32X 4I8DA 2J6XA 1R3WA 4FLOA 2O55A 2DFAA 4K1WA 3MUAA 1EHAA 3S1GA 5FJPA 3BGJA 1BWVA 1PTDA 2FDSA 4HZ6A 4CD7A 4HN4A 5AC6A 3QJAA 2VHLA 4Q22A 3DH7A 2ISDA 3H8AA 1C91A 4GUGA 4CCZA 2BGQA 4MWAE 3WX7A 1S3TC 4WDTA 3OA3A 2DZVA 3A64A 1MMFA 1GVRA 3STEA 2WZTA 4NZJA 3MKKA 2WHMA 1SSGA 2BVDA 3AIRA 4H6KA 1TQJA 1RCOB 4F4RA 3P0XA 1BKHA 2Q6ZA 3VGGA 4HNVA 3W9ZA 8A3HA 4WX2A 4O18A 2E3ZA 3EDEA 1XR2A 3NOEA 1EIBA 3G3DA 1DWFM 4OTKA 3SECA 1R3SA 3PBUA 2DT2A 1FQ0A 3C8FA 1J0IA 5BXSA 3ZJ7A 1MZHA 4HP5A 1TUXA 4YU1A 3W29A 3QKZA 2ZX8A 2ZRYA 1VFFA 3N25A 1VBHA 1KFLA 4DO4A 1ZAHA 1TZ7A 3UY7A 3LBCA 3TW6A 5BU9A 2YL6A 4GBDA 1MRAA 3IIPA 1O4UA 3GC4A 1ZGDA 1KO0A 2YDAA 4V1YA 2G50A 1V08A 1U5VA 3GHTA 3USBA 1OCBA 3NDZA 4FXSA 3B0YA 2Q3RA 4XZ9A 1XHGA 1E4NA 3OYZA 2C15A 2E5CA 4XAZA 3UWWA 4YHEA 4Z0JA 4WIWA 2ZFAA 2NV9A 1EL3A 4LS2A 3CPUA 2IKJA 2SFPA 3PJUA 4CEXC 4ADSA 1US3A 2G0WA 3BGGA 3L4YA 2AQOA 3OOQA 4BY3A 4EACA 3TTQA 3M5YA 1TRDA 3QFWA 2V38A 4UZSA 1MNZA 1SO3A 3MI2A 4LEFA 3BUVA 1MXDA 2GJXA 4KFOA 2E7FA 2ZC8A 5FF7A 2GDQA 1YNQA 1WOBA 4Q32A 3AZSA 2EPNA 4DN1A 5LZLA 1A5KC 1FWRA 3G2GA 3TONA 3VKKA 3PBGA 1PE1A 5XINA 4Q8VA 3R0KA 4LVGA 3CUZA 4AG0A 4GZJA 2BBFA 4NL1A 3G0UA 3TYZA 1A0DA 5IBXC 3MI3A 1M65A 3WLHA 3VCNA 3DYOA 4RDWA 4C6DA 3IGSA 2PDLA 5IM51 3GDLA 3S46A 3LXBA 3CB8A 2YA1A 2OJPA 3P0WA 4JKLA 3S5NA 3A9BA 3AHZA 2VFHA 1EJRC 4E8CA 2FZ9A 3OBAA 3LB0A 1AJ0A 2NQLA 5CPOA 2AGKA 3VIOA 2PGWA 1M68A 1WZLA 1XSIA 1KRBC 4TTGA 3W7LA 3N4FA 1GUVA 1IWBA 3NG3A 1QPKA 3VVGA 3T8QA 3MHGA 2DSUA 4B9ZA 3WJZA 4PUNA 1XP3A 3AU6A 3MYOA 4PMDA 4ATLA 5HWNA 3TQ0A 5RUBA 4Z1DA 1VJIA 3AHTA 1LT7A 2Z6JA 4ZQOA 1QOXA 6REQA 1C8YA 3PK7A 3NA8A 2VEMA 1M9HA 3UNDA 4KGLA 1DJHA 2WMHA 5C9ZA 2A7RA 1JI1A 3VABA 3QC3A 4S38A 3AYVA 1TV8A 3AAMA 3PJXA 4ZQNA 4IT1A 5TAOA 2VR2A 4HU3A 1KTNA 2GQ8A 2J88A 3GH7A 2DZBA 2Y0FA 2AL2B 4K1GA 4UC5A 3ZJKA 1XRVA 4FX7A 4DBSA 1C93A 1WE5A 4XG1A 4XB3A 1G7VA 3LV5A 3SGZA 1VPXA 1XJBA 2Y85A 3KBJA 5LNVA 3ARSA 1KA9F 4IISA 1SW0A 2E6FA 1VH7A 1VRDA 1I0BA 3G8RA 1DJWA 4LAKA 1K9DA 3U0HA 2OEJA 2EPMX 4D71A 1F3TA 2QUVA 4H00A 3KZSA 1IT0A 4FF5A 3VGHA 4S1FA 1CX9A 1B3OA 2VC7A 1L6FA 2Y61A 3HTWA 1FTXA 2DIEA 4UFJA 4LS0A 2NQHA 3PZUA 1QNOA 5D9OA 4OBTA 1XCFA 2V2DA 4J2MA 2EJ1A 1G4EA 1YPXA 4RZ5A 3B9AA 4RUBA 2WVSA 1UKPA 3NVTA 3E49A 5CPLA 2W92A 4ICNA 3B8IA 4TV6A 1H63A 3WMSA 2GVYA 2WMFA 4EWJA 1ZP4A 3DECA 1QT1A 5FJTA 1RR2A 4GH1A 1PKYA 3RN6A 4GYJA 3KCOA 1JDFA 2PDWA 3CZKA 2HZGA 4KWSA 2RDUA 1J6PA 3NO3A 1P0EA 1DXEA 9XIMA 5FSDC 2CZ5A 2Y7GA 3PTKA 1DORA 3BURA 1KGXA 4JY8A 4DNMA 2YBUA 1OX4B 1DE5A 2AMGA 2GWNA 2BV9A 1V0LA 5CC3A 4IQLA 4PUWA 2WHJA 2E4TA 1XBZA 2E5DA 3HG5A 2Z29A 3O3RA 3Q45A 1V79A 1KV8A 3P7YA 4Z2KA 1W9UA 2XDFA 3TA9A 5AVHA 5BOEA 4DWSA 3OVRA 2X1IA 4TOQA 5HQMA 3M0MA 4Z1BA 2NT0A 3W2LA 2PLKA 4BCEA 3K4DA 1XDLA 2CW6A 5LSMA 1A5UA 2PP0A 1E15A 4DI9A 3UPBA 3HURA 4IGSA 1TMHA 2UBPC 3TYEA 5HUOA 3BWWA 5LNUA 3SJNA 4NAFB 3TSDA 4RE4A 2BMBA 4BQ4A 2W79A 1ITUA 3KOFA 3EXTA 2WNWA 4FX8A 3T44A 2HJPA 4A3RA 3W22A 4D6DA 4XISA 2CLKA 4D9PA 1WKFA 3W84A 4UOZA 1AA1B 4UFIA 1QWGA 2O4MA 1PXGA 2DT3A 3PAJA 5I3GA 2AMXA 3OPSA 1TVLA 1GVIA 2X1RA 3DG6A 3FYOA 4HHMA 1GVFA 4A6GA 3V0UA 1QXLA 1HF6A 3TYDA 3NQ6A 1YYAA 3EGJA 3TLLA 1PDYA 1TCDA 3WNNA 3H7UA 2G5WA 4JTUA 5D2TA 3HN3A 4B5NA 2GDUA 3QXBA 3SUWA 1GZ1A 2Y24A 4AVOA 3VX0A 2ZDSA 2OWXA 3G24A 4MZ1A 4BQ2A 3FIGA 4E38A 3LI1A 3AMCA 1QI2A 1RBLA 1VIZA 4XZBA 1CNVA 2BLEA 2IKHA 1TPC1 3FYYA 4J3WA 3MCMA 4WDWA 3L12A 1J2BA 3P5ZA 4IH3A 2XFYA 4PYSA 3ABZA 3BPWA 3WSUA 1TZZA 1A0EA 1JG9A 2DSVA 3L23A 3E3HA 2DQWA 1V5XA 1OFDA 4B5VA 4NAEA 1OM0A 6TIMA 1YPFA 1EPVA 4WDUA 4YHGA 2WJEA 2BGSA 3H2MA 4XVEA 2PS2A 4XTIA 2I5QA 4Y9AA 1B3VA 1HKWA 2ISFA 2HQAA 3I6RA 3JUGA 4ATWA 5DANA 4AXKA 3NZGA 3V3WA 4DO5A 2NX1A 2XVPA 5D2WA 3BSMA 1G01A 3NQAA 4KCTA 3OHMB 1ISXA 4IPLA 1F7BA 1E0UA 3CEUA 1E6SM 4UMBA 3TN3A 2NVAA 3NQ2A 2YXXA 1FWTA 1EIXA 4Z2LA 2XVGA 3OGVA 4WSJA 3ZWTA 4B5TA 1BSLA 4DJFD 1A80A 4AY1A 2F2HA 3R58A 1UR2A 3MUZ1 4Z2GA 1RPKA 4AIUA 3F4DA 1F05A 3OIXA 1K7FA 3WEMA 3M0XA 1Q2RA 1BKSA 2X7VA 3EAUA 3I3DA 2V2HA 2ACQA 3NQVA 2GLKA 3M0IA 1RLCL 3A13A 1QNRA 2BY3A 1S39A 4MB5A 2CLHA 1GOOA 1S2AA 4F2TA 5TNVA 4MWAA 5C7HA 4LUSB 4KGJA 2C13A 1SO4A 4XK2A 3VDAA 3PUEA 4Q4OA 2VJXA 2PWUA 2X40A 2NQJA 1I75A 1PZ3A 2OZ0A 1QNPA 4MDOA 3SUTA 1L6WA 2CLIA 5G1MA 1Z69A 1GQNA 1F9CA 3NZQA 4FMVA 5G1YA 3W1QA 4EP8C 3GVWA 1DXFA 3ENLA 3LZ5A 2POZA 4I7WA 4XKYB 2VKZG 3SGUA 3PZ9A 4I9JA 5HQEA 2BVYA 1CZ1A 3VIJA 1DIOA 4X61A 3VDGA 3PTQA 5BXTA 2CERA 3PSVA 1A5OC 2OZ8A 2ZX6A 3TH6A 3RLGA 1XQKA 3F2CA 4GNVA 4J5NA 3FA3A 4WGXA 5FOOA 2OQHA 4AF0B 1R3YA 4P7LA 5CEWA 2QCNA 1I60A 4DJEC 4GA8A 2VFGA 4PMUA 3EMCA 2IS7A 4AQLA 1GK8A 4YCPA 3MMWA 2WC3A 1KGWA 1SFSA 4HU8A 1W1IE 4ROPA 2RJGA 3RMJA 5J5RA 2OCZA 1RY0A 1D8WA 5HPOA 1K8CA 3WLNA 4PUKA 2QLYA 3VD5A 3AWNA 4KH2A 1LTDA 2FZ8A 3TMQA 1P4CA 3PUGA 1AL8A 4DBUA 5LIXX 3TYAA 1A5SA 3EWUA 1W9BM 3A6OA 2P0OA 3DESA 3SZ8A 6XIMA 3N17A 4UR7A 1OHLA 4S23A 3LV6A 4H9ZA 2R24A 4ZFMA 3ZLGA 3NURA 1GVOA 3NZPA 4HYWA 1U5HA 2BB0A 2OOFA 5LYRA 4HNTA 1SMAA 1BXBA 4I5UA 1OYBA 4JN8A 3IIVA 4PRRA 3BSGA 5G2WA 1TO3A 1Q65A 4WKHA 1XLAA 2CNCA 2J7DA 3KP0A 1KM3A 4B91A 3SRHA 4A3QA 3OEXA 4E0CA 5HINA 1CLXA 4J28A 1C7SA 3PZNA 1SZFA 1NIUA 5AC7A 4ZEPA 2PDCA 4JTSA 2YPIA 3S83A 3E5BA 1M53A 4PMZA 4U33A 1ZTVA 4IPJA 5U7SA 4PCPA 4JN7A 2X0HA 1KXVA 3G8EA 3SQLA 1PIFA 1S5MA 1US0A 4PB4A 4GWEA 4D8ZA 4QAIA 3RM9A 3KOYA 1MWOA 4L6HA 1OADA 4GI6A 4GXMA 5AHEA 3ARVA 4IJCA 1UJQA 2EO7A 2V5LA 3HQOA 4IMCA 3S5SA 1P0BA 2YBTA 2Q01A 5D38A 1ICQA 1HJWA 4B90A 1JNDA 3CH9A 3KLKA 2TODA 3MQTA 3QV7A 3LYEA 3F2BA 4FNRA 5I7GA 4O15A 3L7RA 5CC7A 2F9RA 3FSTA 3CQ0A 5FA5A 3UQNA 2X8RA 1OIMA 2PURA 5M5DA 3B8WA 2PDQA 3C2VA 1YDVA 3MVTA 3N2OA 1GOIA 4F3HA 3S3GA 2PBGA 1R7AA 4QXIA 5K3VA 2OXNA 3VA8A 2V67A 4GI4A 3RRAA 2PDUA 1IZJA 1UZ4A 2ZUMA 3L5LA 2J79A 4NJGA 4AX7A 4O8RA 3HA1A 1TPDA 1F4HA 1XD0A 3WKZA 3L2IA 3T07A 1EPXA 2HE8A 2UZ9A 3EWDA 4HA0A 1UYQA 3FVMA 1LQ0A 3VIIA 3REQA 3QV6A 1U5JA 5C6MA 2EEXA 4GFSA 4US5D 1PYFA 3VIFA 1B5TA 2J7CA 2RDTA 4JKMA 4C6FA 1K9FA 1BGAA 1CIUA 3SQMA 2GQ3A 3IRDA 2GVJA 4XAYA 4DYKA 4LF2A 3TV8A 5JMUA 4CU6A 1GVSA 4UCFA 3QOKA 3EX4A 4LU0A 2GOKA 3NJ3A 2V3GA 3ITGA 5K4ZA 4GCAA 1J0YA 1HO1A 4R27A 1SQ7A 2QJNA 3C0QA 2Z1VA 3ALGA 2WQPA 1YNPA 3AIVA 2BWGA 4R3UA 4F0LA 2WMKA 3K8KA 3S2NA 1GJPA 4HU4A 1V6YA 2XWEA 3A22A 5SWUA 3LBMA 3DU0A 2FTWA 1I2QA 2RFGA 1JYVA 2I9EA 2ISWA 1AH0A 4C1NB 5CPQA 3VGEA 2XIQA 1WOAA 2WC4A 4Z17A 3AHXA 3E2SA 1XLGA 1G5AA 1L0PA 4A05A 4B15A 5HR7A 5H6HA 1O5QA 1OYAA 5DO8A 3QFEA 3NQBA 4F9JA 2J9XA 2QEZA 2PWVA 2WSQA 4S3FA 3UCQA 4JQ2A 4EANA 3T7VA 3PNUA 4CU8A 2GFTA 2YGYA 4GBUA 3WL0A 1E5JA 2H3BA 4JGDA 1KD0A 2V2CA 4YIWA 3KWSA 3RO8A 3GE7A 4Y9MA 1VCVA 5G2HA 3LD5A 3L4XA 1POJA 4K39A 1X7IA 3UJFA 2B7PA 3I4KA 1WPCA 2FDMA 1W3KA 1W3HA 3W81A 2QJJA 4BKNA 1Z42A 3DFOA 1MYRA 3S9ZA 1RQBA 4DUOA 1FWSA 3PFMA 4GQQA 3V16A 3TYCA 3ERPA 4AW7A 1ME9A 2EBNA 3TC3A 2YKKA 2DORA 4ZE5A 4RV8A 2JEPA 1X97A 2NWSA 1JGIA 1EA0A 4I90A 1CENA 4P7QA 1BRLA 4AXNA 4G7EA 1B3ZA 1K7XA 2KZHA 4XV0A 3SAZA 3VI2A 1TZ9A 1IXNA 5CZTA 4LALA 1JDEA 5CZSA 4BF7A 3VTRA 3TDFA 2WMIA 3W53A 2Y5SA 4HNUA 3GXIA 5HA7A 3AIQA 4PMXA 3WLKX 4KCVA 2VTFA 3K4WA 5A5WA 4S2BA 1WV2A 5CZJA 1HZYA 3VIPA 1JAKA 1MQQA 1XGEA 2REQA 2NQ5A 3UZXA 2J6VA 4FIQA 2CPUA 2V8ZA 4ERGA 1VAHA 2QCMA 3CHCA 3LM3A 2FGLA 4JQ3A 3GWQA 1H0IA 3MVIA 1QBBA 4J2PA 1W1TA 4Q8UA 3DFQA 3TCSA 2HBXA 2I57A 4JQ1A 3AISA 5MF5A 2J25A 2QCCA 1OX6A 2NZLA 3BQ6A 4CU7A 2ZRXA 4QCFA 1TIWA 2FJUB 4EXAA 4M7TA 2Y70A 3VE9A 2NV2A 1H7NA 5J04A 3H7VA 4DUVA 3WUEA 1R85A 4IICA 2O9RA 2Q3OA 2WQDA 4ML4A 1TPWA 5E70A 1JCLA 1ZBKA 3O16A 1CGYA 1PZ0A 4JFWA 2FGBA 3M0VA 4NRRA 2Z1KA 4J35A 7CGTA 1LUCB 5M3WA 2JKPA 4D6FA 3HJZA 2A3HA 2YDQA 5G1TA 1I9CB 3PB0A 3BC9A 2XWDA 3RLUA 3C61A 3TX9A 5J5DA 2F84A 4LOCA 1SFJA 1E3ZA 3KRZA 3CZJA 4HZ7A 3UESA 2H9AA 7A3HA 3U3HA 2FQIA 3M6DA 4BEQA 3ATYA 4TR9A 3R0DA 3DYMA 3OZOA 3MPGA 3AS1A 3DGBA 1LLOA 4E3TA 3R2GA 2YXGA 1LWJA 3DHDA 3NXFA 3VNLA 3RNDA 4KBXA 3ANVA 1KKOA 1FHVA 3FGCA 2A6NA 4ZO8A 4RPQA 1UBSA 1V51A 4ZO6A 4JIHA 1EF3A 3HPFA 4UIOA 1TYGA 2Z1WA 4G1KA 1MW0A 3HV9A 4JTDA 1GGOA 4OECA 4YTQA 2W5FA 2VGIA 3THDA 2VZOA 4J1OA 4Q8MA 3FEMA 1VYSX 1H41A 3ZM8A 2XJ7A 3MUIA 4QS6A 1EBHA 1LG2A 4NKCA 1MRQA 4BI7A 3TSBA 5A2BA 3NQFA 5C0QA 4PUMA 4WF7A 1PV8A 2POTA 3R43A 3IJDA 1UOZA 3GXDA 4G5DA 4O4WA 2DIKA 5ABFA 5AY7A 3WK3A 2ZZ3A 1IHIA 2ASHA 1R0MA 2C1GA 2BX7A 3AWOA 1VEPA 3N2XA 3WQOA 3MB9A 1PUDA 2ZXQA 1TTJA 3B8DA 1A5BA 3CNYA 1Y0EA 2YL5A 1XIHA 1R9YA 3ECQA 2HE5A 4GYPC 2BXVA 2E67A 2Z6IA 5FJRA 3IUDA 1V0KA 1VFUA 1BFNA 4HHHA 3TYUA 3L0KA 4Z2JA 1B30A 1WDPA 4R34A 1XGDA 4JTGA 4F0RA 3RU8X 1L8NA 1QAPA 3BICA 5M1TA 3C6CA 4ERAA 1SFLA 4DJFC 4UOJA 3CLMA 1I6NA 3D5HA 5MHBA 3L4WA 1L8PA 3EMZA 3L4TA 4PMRA 2YL8A 1J0HA 4PB5A 3WJWA 3EX2A 2D0GA 3I10A 3H4GA 2RGMA 2FLIA 4HMEA 2OQYA 4DYJA 1JGMA 3CUGA 3AJ7A 4RNJA 1XLLA 2X0YA 1KBIA 3SUVA 3PFRA 3KBWA 3N3TA 4FXJA 4Q7NA 3UXAA 1V3HA 3P14A 4W9TA 2OG9A 3R79A 1AZ2A 1ISWA 2RGLA 2YA2A 3AJXA 2GJXB 2PDJA 3BK0A 3UGRA 1PJ9A 3S0CA 2DQXA 3JU2A 1H7PA 1PHQA 3PPGA 1ADOA 1JDDA 2Z24A 3WNPA 1W9DM 5HJXA 7XIMA 4GKTA 5IDIA 1A3HA 3CM4A 3I3EA 3IWPA 3B8TA 1BF6A 1ZLPA 1TV2A 4WKAA 1H2JA 1UC5A 1SUXA 4HA1A 4QS5A 1KWKA 3WQWA 1IZCA 1UP3A 1EOKA 3CO4A 3FVDA 1LM1A 4LPCA 2QKFA 3UVIA 4YJ5A 4Q4MA 3C3NA 3GH5A 2RH9A 4QG6A 2D20A 3VOJA 3EEGA 3KS5A 4NVTA 2CITA 3FY1A 3STCA 1J11A 3E2QA 2VO5A 3LZ3A 3CAQA 4G56A 4JTHA 4DXKA 3WH6A 4L7ZA 3CU2A 1P5BA 2QDDA 3V5OA 3KTSA 4NX0A 4O16A 1G6CA 1RQEA 1E0VA 2W62A 4KW2A 4AZIA 4HCHA 1V93A 2J62A 3AXHA 1F3XA 1POKA 2E9LA 3AUOA 1HKVA 1Q8JA 5KZMA 2VT0A 1V4YA 2AAMA 5H1WA 3T6CA 4UQCA 4AIOA 4X60A 3G22A 1EC9A 3GLCA 1J6OA 4L1GA 4UFKA 1TVPA 4W4QA 1XDMA 1DJNA 1A5CA 4V1XA 4AD5A 4A21A 3WO8A 3E2VA 5I3FA 3P3BA 3ITOA 5EA9A 1N8FA