4IX2A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
359
structure length
334
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 100
structure length 334
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ix2A00
1EUAA 4Q33A 1MZHA 1B9BA 2ZZ3A 1LBLA 4I7WA 5LHEA 2Y85A 2Y88A 3HG5A 2B7OA 1HG3A 3JS3A 2A21A 4EOUA 2QJIA 1B4KA 3PB0A 3DH7A 3FA5A 5FESA 4FNUA 4MFDA 5LGZA 3L5AA 3DKJA 3L0GA 1YXDA 3G1XA 1FQ0A 4CQ9A 1QPRA 4AAJA 3G3DA 3NXFA 4BWLA 4WY0F 3ABSA 3KVLA 2NXGA 1M7PA 2FPTA 3N19B 4UTWA 4YMZA 4YLWA 5AN7A 2YX0A 1JUEA 3M47A 3EWZA 3M5YA 3NL3A 3OHIA 1YPFA 1TMHA 1H62A 1K7EA 4FXSA 1X1ZA 1H7NA 1QR7A 3CWNA 1I2QA 2Q8LA 4R7JA 1XKYA 3W75A 2ZRVA 5LHFA 1JULA 1TPUA 2CLOA 2JKPA 2GVLA 1V5XA 5DCBA 3SGZA 4Z0JA 4JTUA 2NUXA 4TR9A 3W7HA 1SW3A 1GG0A 5AHEA 4PA8A 5C6MA 1A50A 5AHFA 2V2DA 4YCPA 4XKYB 4UFHA 2AQWA 5G1YA 2RFGA 5KSWA 1L6WA 3GZ3A 5HNRA 2QDHA 3C4UA 1XUUA 4O8RA 4ONVA 4TMBA 3TMLA 3CEUA 2WV8A 1SFJA 1S5VA 4JIPA 5F4XA 3KVMA 3NPWA 1VQTA 3N14A 2QCDB 3OVRA 5ABTA 2CFFA 2FTPA 3CB8A 3ABOA 4MFEA 1BWKA 4N9BA 3C2RA 5LNVA 3ZS4A 1K3UA 5MHBA 3NQDA 4NJIA 4MY1A 3TCEA 4ZZ9A 1KFBA 4LC8A 4O10A 3EEGA 1I8JA 1O60A 1RZMA 3E0IA 1SQ7A 1XM3A 3UXDA 3KXQA 1XBYA 3G0SA 4XBSA 1XDLA 1UB3A 2QCEA 3LHZA 5KMYA 4XTIA 1W0MA 2BSLA 1OJXA 1Q6LA 3PUOA 1JUBA 3PS7A 3H55A 3O63A 5G2HA 3BLFA 5F1VA 5D2TA 5BRBA 5G4WA 2QF7A 1KM1A 1ZNNA 1UJPA 4PEKA 3TXZA 1SR9A 2E1DA 4POCA 2NV1A 3TR2A 1RPXA 1T96A 4O18A 4HNUA 2YYUA 2E6DA 4O1CA 1LORA 3MBDA 3TQVA 1VCFA 2C13A 4QIUA 2A6NA 2B7QA 3O06A 1WYIA 4NJGA 3TJLA 3HPXA 2O7QA 2CZDA 3QC3A 3BG3A 1HL2A 3FJLA 1THFD 3DAQA 4UTUA 1FWNA 5DN1A 2ZCGA 3NGJA 2PE4A 4R53A 1IXPA 1EEPA 3W2NA 4K39A 2E5CA 4NNAA 3S9YA 1R2RA 3ZWTA 3MYPA 4AHOA 4G1KA 2BLEA 3DXIA 4NT0A 1L9WA 3UWZA 4JN6A 3PC0A 4TU1A 3FKKA 2X16A 4MLRA 3RU6A 4PH6A 3A5VA 1FXPA 1KM4A 3QSRA 2J9XA 1A5SA 3HOJA 2Y7GA 4XZ9A 3C61A 3HJZA 2ZZ6A 3CM4A 5DBTA 5DXYA 3YPIA 3P61A 4S2CA 2EAWA 1OFPA 1ZAHA 2AGKA 2FDSA 2CZFA 1QO2A 2GVJA 3DFQA 1GTHA 3VFLA 4JTJA 4NQ1A 1F6PA 4N9DA 5DXXA 1F73A 2YR1A 4KWWA 4XQ6A 1Q6OA 4ALDA 1JRBA 1SSDA 3M43A 5HUPA 3W73A 3I65A 1TPWA 3LB0A 1MO0A 1Q45A 3MWAA 4WX2A 4FEZA 3GB6A 3PAJA 4ZQNA 1LZOA 2E77A 3W85A 5HR6A 5CZJA 4X2RA 2CLMA 1H63A 3IGSA 4CQAA 3IRDA 5FEPA 3RNDA 4LC6A 4LRTA 3B0PA 5LNUA 2BXVA 4UTWC 2X1RA 2QCNA 4UTTA 4RZ6A 4WY0A 2WOQA 5AHLA 3W7MA 5CSRA 4O1DA 1O5XA 3T78A 3UYCA 3U6WA 3W7JA 1XL9A 4AHQA 1Z41A 4HPJA 3KRSA 3B0UX 5F2GA 4MPQA 3TNOA 4DO6A 3TJXA 3GK0A 3W7QA 4UFIA 4AHPA 2NLIA 5F4SA 4CCCA 5IM51 1ZAJA 1SZEA 3P81A 3G1SA 5D33A 3B4UA 2Z1BA 2XN0A 1VPXA 1I45A 5CPLA 3FS2A 3NR0A 2P10A 2JBMA 3RF9A 1TJPA 2HS8A 2WQPA 5AFDA 3W70A 1VGAA 3TQKA 1F74A 2JGYA 3DHFA 3N34A 3P62A 4LU0A 2ZTKA 2NX1A 1FCQA 2FFCA 4M7SA 2ZZ7A 1RQHA 4RX0A 2GJNA 2YSWA 4PL2A 4TIMA 4Z0SA 4LRSA 1GVQA 3MP4A 1BTMA 2Y7EA 1QMLA 2ATSA 1OYCA 1DVJA 4JR5A 3BGJA 1BWLA 2QCMA 3SZ8A 1OFOA 1X6UA 3G1AA 3G18A 4PFMA 1I2PA 4OBTA 3W1RA 3W6YA 3PVFA 3UD6A 4NUWA 1NEYA 3C0JA 2YFOA 2DZPA 2NXHA 3KFTA 3HGSA 3NQCA 4EF8A 3LHWA 1JCMP 3TSMA 3NL5A 2VFDA 3CHVA 2ZDRA 3HPZA 3MP5A 1P0NA 2VC6A 3NYZA 1SZGA 1WDWA 4MYXA 1FCBA 2FLIA 5AHNA 1MXSA 6TIMA 1H7RA 4O19A 3HG3A 4MZYA 3EWYA 4MVAA 1HUVA 4NNBA 1K7XA 3W7KA 3C56A 2ATMA 3PUDA 1OX4A 1J2WA 2E5DA 5K7JA 3S5YA 1RQEA 3FYOA 3BK0A 3BLEA 1OHLA 4IMCA 2J27A 3M16A 4UUIA 2JGQA 3IV3A 2JKEA 3UWVA 2Q8ZA 3P8JA 1W8SA 3LV6A 4YWIA 3FLUA 1OG0A 2QR6A 3BGGA 2OZ0A 1QOPA 3O15A 5DCDA 2VFGA 2C19A 3NQ2A 3HQ1A 1UUOA 1YXCA 1SPQA 4UFKA 4Y8FA 2Y89A 1MSSA 1ME9A 4LTSA 3RLVA 2ZRZA 4FX8A 2OMAA 4O50A 2HTMA 1PS9A 3HGRA 4N02A 3DKLA 1H1YA 5LKYA 1D9EA 1OF8A 1H7WA 3W1AA 3QW3A 3IIZA 1WOAA 3PR2A 3W1TA 5CPMA 1ZENA 2Y70A 4JTFA 1EP3A 2QJHA 1JUKA 5HMSA 1K02A 5HWMA 1VHNA 3G0XA 4DBEA 1IIHA 1KV5A 1FWSA 3AO0A 2FIQA 1DHPA 3WJSA 3BVJA 3R8RA 5TQLA 3TMQA 1KFEA 1XC4A 3KAOA 5HUOA 1F7BA 1YLVA 4ZQMA 5AHMA 4EIVA 4UTTC 3GX9A 5BMXA 1IIGA 4YL2A 4OWGA 3W1XA 3DFTA 3UWUA 2GJLA 5AHIA 5K4XA 1LRTA 3MUXA 1N8FA 4BK9A 4M6PA 5K3VA 1WOBA 4JTHA 3EWUA 5EBUA 3MI2A 4KKXA 2WNNA 1AW5A 4UMBA 1OFRA 4FXRA 1D3GA 1K8YA 3O07A 4IPIA 4FNTA 3TIMA 3LRMA 1XFBA 1SFLA 2ZA2A 1VC4A 3TQ0A 3LBCA 3NQ7A 2Q3OA 1TTIA 4DPPA 6ALDA 5E1QA 1RV8A 2X1UA 4JY9A 4DELA 3C52A 3IVTA 1F5ZA 3MHUA 3A21A 1KFCA 4OV4A 3TC7A 1LM1A 1AL7A 3UZ5A 5A8GA 5CZSA 3LHTA 3A22A 4O57A 2GPTA 1IGSA 3P5ZA 1KTCA 4LS0A 3S1VA 1D3HA 1DOSA 3W23A 1G6CA 4L4LA 4O17A 3EB2A 4N6FA 1NAL1 3NNTA 1B4EA 4CLMA 1SO4A 2LLEA 1XI3A 3PBWA 1OVDA 1W3IA 3TAKA 1KBJA 2OJPA 1OFDA 1KTNA 3HG2A 1PVNA 3NQVA 4NJHA 4IWWA 2YFNA 3CIXA 5G2WA 3INPA 5DLCA 3VI2A 4Z1AA 3RMJA 3GKFA 4JYDA 4K38A 4A2SA 3C2FA 3LV5A 2C14A 1VHCA 4UFLA 1W5QA 3W7CA 2VEKA 1G69A 1S5TA 4OE7A 2CU0A 3ANYA 3R5EA 2QCHA 1KLZA 4JTLA 2RH9A 4K8HA 3GXPA 5AC7A 3QM3A 1PL9A 3MBFA 3TX9A 4IX2A 3KVKA 3GAKA 3HBLA 5D37A 2YPIA 1HTIA 2DZSA 3C6CA 4RV8A 4FO4A 1P1XA 4M6QA 1DL3A 1AW1A 4L4MA 3DHDA 3P74A 3IVSA 3Q58A 1FY6A 2ZA3A 3NQ6A 3G24A 2ISVA 2R91A 2E68A 3GDLA 3GAYA 1TREA 4IMEA 1KM0A 1WBHA 4AWSA 2CZEA 2UV8G 4CNPA 2H3BA 1N55A 2B7NA 3QPZA 4XWUA 1OFEA 4FIRA 2YCEA 1DBTA 2GQ9A 3VCRA 3G0UA 3PF3A 2TYSA 4LY8A 4Z1DA 3P8IA 1W1ZA 3TFXA 3G8RA 2VEIA 4AWTA 3ABQA 3B04A 2NX9A 3W7PA 3K30A 3MHFA 3M0ZA 3I7QA 5C55A 2V30A 1EB3A 3L2IA 4O0KA 4N4QA 4ZL1A 2ZTJA 5FF4A 1SO3A 4DF2A 4LNYA 2FB2A 3DI0A 1R2TA 3C2VA 5L6UA 4JDYA 2H8XA 2YGYA 3LTYA 3HGOA 3HF3A 4BI6A 2WNZA 1OFQA 1K03A 2DJLA 3M41A 3EWWA 2QCGA 2ABBA 3N73A 4GXMA 3UWQA 1MEWA 5J5RA 2J24A 2CWNA 1E51A 1O4UA 3W3OA 4JTSA 1KA9F 1OK4A 1A5CA 2GQAA 3B8DA 3GYEA 4FB7A 2NX3A 1IXNA 3P84A 3E96A 2H8ZA 1TJRA 1JVNA 3QF0A 3UWYA 3CT7A 1LBMA 3CPRA 3GDKA 5K4ZA 5TBOA 3OG3A 3SECA 1VJIA 3QFEA 3UQNA 2B7PA 4MIMA 4UR7A 5D09A 3GIYA 3T55A 2ZZ1A 3LXCA 2V0TA 4Q32A 1M6JA 3EXRA 4O11A 4LOCA 4DPQA 3HIJA 3W7OA 3LI0A 1TSIA 3NDOA 3IEBA 4M5PA 3S5OA 5D03A 4RJEA 3O6YX 2ZYFA 5C54A 2EF9A 1K7FA 3JR2A 1SUXA 3LDVA 3DFNA 1CW2A 5EKYA 3HB9A 1A5AA 2VFIA 3LERA 3W2MA 4XKYA 4IMGA 3TW7A 5HR7A 4MY8A 1LOSA 1G7UA 4O4WA 2DZWA 4QJ1A 1KTBA 2F7FA 3FFSA 3W1QA 1U5JA 2QCDA 3FJ6A 1G4EA 4DXVA 2PRMA 3NQFA 4RZ5A 4A29A 2FB3A 5EYWA 2QCCA 3LRLA 3R2GA 2OCZA 5AYYA 4PL1A 3W86A 2BX7A 3NL2A 3IIXA 5AYXA 4UIOA 3M1ZA 1W56A 3NM3A 3DENA 1QFEA 5F2LA 1GYNA 3RFAA 1Z42A 4GUFA 5D05A 4RK8A 2RDUA 3WFAA 4UNKA 3CQ0A 3BV4A 3W74A 4PC8A 2JKAA 1ZFJA 3LRKA 3O05A 4OQVA 5FEWA 4AB4A 1VCVA 4JD4A 4RR4A 3TKFA 3DFPA 3WK0A 2YYTA 1TQXA 3TSBA 1SSGA 2YW3A 3NVTA 1WBJA 3PB2A 3UY7A 3PBYA 3SJ3A 4NVTA 1XDMA 3LOTA 5D02A 2Y63A 1GT8A 4BWLC 3WJXA 4DEFA 3A23A 2FQIA 1EA0A 3EXSA 3G22A 3HO8A 3F4NA 5G1TA 3LCFA 4MJZA 1VLWA 3TU9A 4E2DA 4WXYA 4NXSA 2NZLA 4FNQA 1W5MA 2AAMA 2R94A 3EX2A 5KZMA 2G95A 1QAPA 4R33A 3IGUA 3LCWA 1YPIA 1R30A 4QQ3A 1EWEA 3W2JA 4NJJA 2I9EA 1GQNA 1W54A 3N9SA 4HSNA 1EIXA 4DF1A 3W1MA 4OV9A 3W1LA 4TMCA 3L21A 1JCNA 4M6VA 1F05A 1NVMA 3V1PA 5FI8A 3P82A 3EKZA 3QEZA 2XN1A 1GPWA 1H50A 2VXNA 1I4NA 3W2UA 3L65A 1NF0A 4K36A 7TIMA 3KVJA 3TA6A 2QAPA 1HFBA 3BG5A 4GFSA 4A3UA 1YDVA 1Q6RA 2A7PA 1RD5A 3QMSA 3ABRA 4WQ6A 1PIIA 1KM2A 1LBFA 3QYQA 1AMKA 1LP6A 3G1DA 2NWRA 1WA3A 1FWTA 4UTMA 2A7RA 5DY2A 4LV4A 4HSOA 3VE9A 1OX4B 3L9CA 3GVGA 3I7SA 1S3HA 1DORA 3TC6A 4BR1A 5KINA 2H3DA 1OABA 3F4WA 4JTTA 1EX5A 1UUMA 3B06A 3UPBA 1TTQA 4MOZA 1ML1A 3B03A 1DQWA 2YZRA 4TO8A 1QPNA 3H54A 2ALDA 5H91A 4A22A 3G3MA 4GC4A 3TV8A 3N2MA 1GVRA 2V2HA 4YXGA 2QEZA 4DBDA 1BEUA 2CW6A 1VLIA 3W7EA 3NQGA 1PV8A 4QSHA 3THQA 3TFCA 3A9IA 4I7VA 1K8XA 1SO6A 1AL8A 3W9ZA 4BF9A 1TPFA 3NZRA 4GJ1A 3P7YA 3PG8A 1FUYA 2CLFA 1QCWA 3LXBA 2QUUA 3S5NA 1JCXA 4PCFA 5CKSA 4N2YA 4B5NA 2C1HA 3PSVA 4GNJA 3LHVA 4CQ8A 1JCLA 1R2SA 3BW3A 2FPYA 4JEQA 4BI5A 1XBVA 4GRSA 4S2BA 3GR8A 4JTIA 3L0NA 2QAFA 4UNLA 1UCWA 2WSQA 3QPYA 4NX0A 1KV8A 5G5IA 1VYPX 4K37A 1HO4A 4ZVJA 3ZWSA 1KFJA 3KRZA 3D0CA 3BW4A 4O1BA 3E02A 4QNEA 4JS3A 3S1UA 1LYXA 2P1FA 3IIPA 2ZZ5A 5U7SA 4X9SA 4NZFA 1L6SA 2NUYA 3LTPA 4WJEA 3KOFA 1ICSA 4PODA 1I2RA 3W1NA 3UZJA 4JX4A 4WUIA 1R46A 4IX0A 3LX9A 3Q37A 1ALDA 4Y6GA 1GZGA 3IVUA 3NA8A 4FHAA 5HWNA 1WX0A 4JGDA 5LNWA 3QQ1A 2TPSA 4X22A 2VFEA 2KZHA 1ICQA 1W31A 2QCLA 4O52A 8TIMA 3L0KA 1V7YA 2F84A 2E6FA 3NL6A 1X1OA 1H51A 3EWXA 4UMAA 4EWND 1ZALA 3W2KA 4KWVA 1TB3A 1TV7A 5LNSA 1LDCA 4JYFA 4UC5A 3ZR4A 3THAA 1VR6A 5D38A 1GJPA 5EY5A 2R14A 2CLIA 1XBZA 1QNVA 1LLZA 3GXTA 2DJXA 3HMJG 4AWUA 1ONRA 2OT1A 1XUZA 2GQ8A 1YTEA 4IPJA 3T7VA 3SY5A 2CZ5A 4NNCA 2HSAA 3H53A 5K9XA 1FCUA 2PRHA 4O53A 5D2VA 3WJWA 3W2LA 4KFPA 2ZFAA 1EWDA 4UTIA 2CLKA 1QDSA 4DF0A 1P5BA 2OX1A 1LRQA 3R89A 3C2EA 4Z1CA 1FWRA 3N2XA 1IF2A 1YTKA 1PHQA 5T26A 2DZUA 2QKFA 2W79A 5I3GA 1RQBA 4AEOA 2Z2UA 3G1VA 3QRHA 3CU2A 4K7YA 3MMTA 5K9DA 1SU5A 3FEMA 4UTHA 2DORA 4FNSA 1R47A 4O15A 5FF3A 3NPXA 2ZRYA 4LVBA 5KITA 1X8FA 1SZNA 1T99A 1LCOA 2NXIA 1J5TA 1VCGA 3SW6A 4U4MA 2P0OA 2X2GA 3WJZA 1I2NA 4JNMA 5I3IA 1GVSA 3EWBX 4FX6M 3NOEA 3WJYA 1F2JA 4O28A 1VH7A 4DO4A 5KZDA 3LLDA 4KFOA 4IOTA 4Q4KA 4RXGA 4HIBA 1H61A 2W6RA 3UPWA 3G1HA 3UNDA 1EP2A 1ME8A 4N9CA 3STCA 3CIWA 4GUHA 5CG7A 1OFBA 4AH7A 4ML9A 5CZ0A 2RHGA 2WPBA 3UWWA 3FIGA 4AF0A 3G1FA 5G2IA 5BMWA 2TRSA 4ADTA 3W7LA 4DQWA 2V5BA 1C9DA 1OFAA 3VKJA 2C0AA 2EGZA 1YDOA 3HGJA 4XBKA 5C5YA 1G4SA 4R34A 5F4WA 2TSYA 3S5ZA 4UXDA 4C1KA 2DP3A 5HULA 3W22A 3NG3A 1H7PA 2VEPA 4GUIA 3QJAA 1PCWA 3O8AA 3KHJA 1SW7A 1QWGA 1GVFA 5KZEA 1W3NA 3F03K 1H5YA 2VENA 3M44A 1M7OA 3W7RA 3STGA 4LW7A 3FOKA 3USBA 1TQJA 4BFAA 3GDRA 2DZVA 2G5WA 5EL1A 3E12A 3NEVA 5D2XA 4HPXA 2C6QA 1U83A 1M5WA 2ZA1A 3WK2A 1YYAA 2CLLA 5K9CA 4GWEA 3EX1A 4Z08A 3A5FA 3MO7A 3L5LA 1IXOA 2QJGA 1LROA 2YW4A 3LCGA 1T0OA 1KBIA 1TTPA 4CCDA 2J9ZA 4HN4A 3C3NA 4FNPA 3M9YA 2FPVA 3UXAA 1IXQA 4H4IA 5CPNA 4QNWA 1RVGA 5HINA 3W83A 2J88A 3PY2A 2ZQ0A 5IBXA 3AJXA 4IQLA 3NAVA 4BI7A 1QO5A 3E49A 4KFNA 2XN2A 3WK3A 2X1SA 1FCVA 2NV2A 2ISWA 1TPVA 4ORIA 3S1XA 3DFOA 3PM6A 1T8XA 2QCFA 3ATZA 3G1YA 4JDBA 4LT9A 3L5MA 4JTKA 2WKJA 4IUOA 1KLYA 4Z1BA 1C8VA 2EHHA 4HNVA 1Q6QA 3W7NA 5U4NA 1HO1A 2C3ZA 1PCKA 1JCYA 3DFSA 3EKLA 2PRLA 4GUJA 1TPC1 5DBUA 5K2ZA 1SO5A 1VYRA 4JYEA 3MP3A 3N9RA 4U28A 2HS6A 4NZJA 3ZFHA 4OHQA 2OT0A 3PUEA 1JQXA 5FEZA 2J6XA 3L67A 5FF7A 4RKAA 4MZ1A 2RKXA 2ZBTA 4O4VA 3TAOA 4HNTA 4H3DA 3KX6A 2RDTA 3TDFA 5D2WA 2J9YA 1K8ZA 1DJQA 1VYSX 4I7UA 5HJLA 4H6KA 4LS2A 5I3FA 3IIOA 3NQEA 5FF2A 3LLFA 1H7OA 5BOOA 1O94A 4J9JA 3GXNA 5AC8A 3M6YA 2VEMA 3S6DA 1OX5A 1JQVA 4Y9AA 1DV7A 3W1UA 3W72A 1ADOA 1O95A 1ZY9A 1CI1A 2D73A 3UY8A 2Y7FA 4LVAA 1B3OA 3V75A 3MJYA 1QOQA 4OGZA 1RR2A 1JCJA 4NXKA 4QAIA 3EXTA 4UTJA 5EMUA 3HG4A 3T40A 2A2IA 2GOUA 3O6CA 3N3MA 1UBSA 4FNRA 3W7DA 4ZMGA 1TPEA 2E6AA 1LRNA 2ISSA 3LCIA 3GNDA 4WY0B 3O1NA 3GDMA 3PULA 4LUJA 5F2IA 1FDYA 2WSRA 5I3JA 3EX6A 2A4AA 3PWAA 4M7TA 1G67A 2X30A 3SSJA 1ZHAA 4WOZA 1WXJA 1J4EA 3DGRA 1KM3A 3MI6A 3BPWA 2QDGA 3LHYA 3C2OA 2V82A 5HWJA 1TPH1 3Q2DA 2NWSA 2E6YA 2ZRWA 4HNNA 2EKCA 4LVFA 3B0VC 1FDZA 3TK7A 1TO3A 4O13A 1GWJA 1G4PA 2XFWA 3TROA 4EVZA 3VE7A 3F1QA 4WOQA 2ZZ2A 3NPUA 1GVOA 1YDNA 3EX4A 5AC6A 1LOLA 4JTGA 4ADSA 1H60A 3PG9A 4NJKA 1XBXA 1H1ZA 4JTEA 4UTKA 3GR7A 2E5BA 3IGXA 3RLUA 4ICNA 2BWGA 2R8WA 2C15A 3M5ZA 3M7WA 4LUIA 1Q3NA 4GE8A 1W5NA 1JR1A 2VFHA 2I14A 3O6DA 5F1UA 1W5OA 3MW7A 1W5PA 3FYPA 3M5XA 2EPHA 3NPVA 3G8EA 4AXKA 2JK2A 3IIVA 4NU7A 5CPOA 2ABAA 5L9FA 2Z6JA 3E9AA 3S1WA 3QW4B 4ZQOA 1WAUA 4ADUA 3CLMA 2X1TA 5E93A 1GOXA 1TPB1 4ZQCA 5D30A 1Z44A 4MJMA 4ZQPA 3W07A 2B0MA 4UMCA 4JICA 1A53A 1DKWA 4GUGA 5IBXC 5BNKA 5EPDA 1S5WA 1EPXA 2ZRUA 2H90A 3ELFA 3OVPA 2O7SA 5TIMA 1MEHA 1NF7A 1OX6A 1OK6A 3I7RA 4HHPA 1B57A 3ATYA 3NM1A 1PE1A 4E38A 3GKAA 2DZTA 1TPDA 4O12A 4DO5A 1TTJA 3P60A 5DY3A 1EP1A 4S1FA 1W37A 1W3TA 3BG9A 1L6YA 3I68A 1OYBA 3TSDA 3CC1A 1ZJIA 1FBAA 1AG1O 2WNQA 3OIXA 3LXAA 5E0KA 3U8GA 3R12A 3TH6A 1TIMA 4X3ZA 5C2XA 1NFBA 2WO5A 4A2RA 3Q94A 3W87A 3JRKA 4CCEA 2A6LA 1P4CA 4WZHA 1L2UA 1Y0EA 1KW1A 1TV8A 2Y6ZA 1PHWA 3SGUA 4MLJA 2TMDA 2E09A 4FX7A 2I1OA 3M5VA 2Z0IA 3KRUA 1A5BA 2ZZ4A 3NQMA 2BZNA 1FWWA 4HKPA 3LCHA 4O14A 4ZQRA 2CLHA 3TE9A 1F76A 2GVGA 2B4GA 4LVDA 3BARA 3TUUA 2PCQA 3DZ1A 1DJNA 4UCGA 1TYGA 4MYAA 1C29A 5EA9A 1LTDA 5DELA 4IMFA 3T4CA 1H7XA 3BW2A 4JY8A 1TRIA 3A24A 2G96A 3SR7A 3LGEA 1AK5A 3WK1A 3NO5A 1O5KA 4XTDA 4JIQA 4HT3A 3QMTA 4CNOA 3NQ8A 5KTLA 3SIZA 4W9TA 4Y96A 1TCDA 5DCEA 3SI9A 3CTLA 2QUVA 2FJKA 1OYAA 3S0CA 2V81A 1EUNA 5AOUA 3NQAA 5LGXA 3BLIA 4FIQA 1ZCOA 1I2OA 1AW2A 2H6RA 2GUUA 3C8FA 5GVJA 5I3HA 3HPSA 4AMAA 4LV9A 4IJBA 4TX9A 3P67A 5FEXA 4C1LA 2C18A 4CNNA 4JX5A 3LCXA 4UTLA 3DU0A 3LCLA 3P80A 3GDTA 4QITA 1OF6A 1JJKA 2HMCA 2VKZG 4N9EA 3STFA 1DQXA 2A5HA 5CZTA 1GYLA 4QM1A 1KFKA 3GLCA 4P61A 4O16A 3T44A 5HQEA 2A0NA 4EF9A 3PBVA 3S8HA 2V5LA 3GNNA 4PTNA 5LNRA 4N6EA 3W7GA 2YDAA 4IGHA 4MUZA 3W1PA 4IMDA 1ZAIA 1YADA 1XCFA 2WJZA 3O16A 1FXQA 3VNDA 1YTDA 4JX6A 1CX9A 3EX3A 1G7VA 4LS1A 2Q3RA 3OVQA 3LHUA 1NSJA 1GEQA 2VOMA 2ZRXA 2BTMA 5A5WA 4UFJA 4QISA 3STEA 3QSTA 3TW6A 4JXCA 3I6RA 5AB3A 2G97A 4MY9A 1KM5A 4E2BA 5LSMA 3W7IA 3QQ0A 1WV2A 2VFFA 2Z6IA 1YXYA 4XUGA 3B05A 3LTSA 4MZ8A 4LVGA 2NUWA 3QMRA 4OT7A 2PURA 3W71A 1FX6A 4I9AA 5D2YA 4RCXA 3DBPA 2YXGA 3L66A 3OA3A 4WD0A 4FF7A 5SWUA 2V2CA 2PC4A 4RLIA 1KM6A 3U2OA 4AF0B 1ICPA 5CSSA 1Z48A 2Y61A 1JRCA 3MI3A 4AVFA 1XXXA 2W0UA 3NZ1A 1GG1A 3CWOX 3LI1A 4NX5A 5LZLA 2DU2A 5D04C 2A1YA 1TV5A 2A85A 4UR8A 5F2MA 3OEXA 1KFLA 3PBUA 1QPQA 4LWWA 1G4TA 1X7FA 2RDWA 2IQTA 3OBKA 4MKNA 4RZ4A 2Y62A 3W76A 3CEPA 2VELA 1SZFA 4D2JA 2Y7DA 4IXHA 3RK8A 2WSYA 4K7VA 5J5DA 5FF0A 3FKRA 3LM7A 4N4PA 2A7NA 3QH2A 3MYOA 4E0CA 4O54A 1WQ5A 1N7KA 3TXVA 1BKSA 4IXXA 5H2ZA 1FDJA 4M19A 3BO9A 4RXFA 1SW0A 4O1AA 4YCOA 4K6AA 1LLWA 5BW6A 1GTEA 5G4EA 3W88A 1TRDA 5I3KA 2CLEA 3PSWA 3QZEA 4ORMA 2V8ZA 3R13A 5CGQA 4O0ZA 1VZWA 4WXZA 3L68A 3P5YA 1P0KA 4K8EA 1VRDA 2C16A 3W84A 1LOQA 3S42A 4Y90A 3DI1A 3LBMA 2DZXA 2QUTA 4OU1A 4GBUA 3MHGA 1VS1A 4UFMA 5D32A 1UASA 1F6KA 4A21A 1MEIA 1QPOA 5AYZA 3SFKA 1ME7A 4P2VA 2V9DA
chains in the Genus database with same CATH superfamily
4HMEA 3QGKC 2ZZ3A 7XIMA 4W87A 4S23A 3APGA 1T5AA 2Y85A 2OEKA 1UC5A 1XLIA 1W91A 1YBQA 3L4XA 5A6JA 3UU0A 3KBWA 1KNWA 3SGGA 5HMDA 4O1FA 1XPYA 1XIGA 1Q4WA 2WYSA 3DH7A 4W84A 5FESA 1XWYA 3MV01 1UMLA 3DKJA 3AHZA 3VC5A 4UOZA 4CQ9A 4D6DA 1FVPA 2HZGA 4UOJA 2GGGA 1XRSA 1XIBA 1E4MM 1YX1A 3ABSA 3QHOA 4LGXA 1M7PA 2FPTA 3N19B 1LT8A 4YLWA 4C6PA 3SO7A 3LM3A 4QE5A 1D8CA 3NL3A 1BG9A 3OHIA 1YPFA 4F40A 4UZUA 3KUMA 1XYLA 1K7EA 1QR7A 3RAOA 1I2QA 2HROA 2V63A 1NELA 2X05A 1XKYA 1S46A 1LF1A 3GU2A 4FS9A 1JULA 2BOEX 2CLOA 2JKPA 3EKGA 2W62A 4Z0JA 3UF9A 4BHYA 3GIPA 1E3XA 3VGDA 3OYXA 4S3JA 1A50A 2D0HA 5AHFA 3ZJ6A 2VGIA 2UZ9A 4PBEA 5KSWA 1L6WA 3GXFA 1E71M 4TMBA 1JZ7A 4JIPA 2WV8A 5F4XA 2YBUA 3ZLHA 3ONBA 3CB8A 3ABOA 4OKDA 2BXYA 1F8MA 4XBJA 3T08A 3R10A 3ZS4A 4BF7A 1N8WA 2WVVB 2XH2A 5MHBA 3NQDA 2YB1A 4PMYA 1KFBA 2A3EA 3AXHA 4LC8A 1C3FA 3EEGA 4H9VA 1XM3A 3UXDA 3G0SA 4XBSA 2NQ9A 3WF1A 3E3HA 3TTSA 4MWAD 3ITOA 3LHZA 1XYAA 1OIMA 1OQFA 1W0MA 1O1HA 5JH1A 4AEFA 1ZBWA 3BJTA 1OJXA 4IIEA 3MY9A 1E6QM 3QLDA 3SRFA 4PTWA 3PJUA 3BLFA 3E38A 4JCMA 1ZNNA 3TXZA 2E1DA 4POCA 2NV1A 1JYNA 3TR2A 4WJXA 1HX0A 1T96A 4XK2A 4O1CA 2DZBA 2WAGA 3BAWA 3ZT5A 3CIVA 3HA1A 3MSRA 2C13A 4RDWA 4PSPA 7A3HA 1WYIA 4NJGA 5CC5A 1KRCC 3NDZA 3G77A 2GGIA 1HL2A 3DAQA 4UTUA 1A5NC 3LGGA 1E0UA 2WCGA 3RRXA 1V02A 2FGBA 4HU0A 3W2NA 3C0SA 4G1KA 2GWNA 3A12A 1X6LA 4AZBA 3AHTA 3PC0A 4TU1A 2X16A 3V3WA 4LSBA 2DSUA 3A5VA 1KM4A 3QSRA 1A5SA 1BF6A 4BF5A 4XZ9A 4QG6A 3UESA 1TWWA 2E4TA 1XIMA 4HCDA 3YPIA 3P61A 3QPEA 2HV5A 4XZHA 2GVJA 1GTHA 3VFLA 4XD4A 3QTGA 2YR1A 2VR4A 4XQ6A 1SJAA 1SSDA 3MZNA 2MUCA 3FAXA 5C9ZA 3I65A 3VKCA 1TPWA 2OSYA 4GZIA 2XSXA 4FEZA 4GIAA 4WX2A 4RV3A 4ZQNA 1X1NA 4BQ3A 3S3GA 3IUDA 4X2RA 4DBUA 4AC7C 3TTQA 2OQLA 3IGSA 3IRDA 4LC6A 3B0PA 2BXVA 3H22A 2X1RA 2QCNA 1ZJBA 4DNMA 2ZX9A 4QS5A 4LANA 4Q8QA 1VENA 1O5XA 4RZBA 3UNTA 3HFYA 2C8NA 3B0UX 5F2GA 5TD4A 3TNOA 3W0KA 3Q65A 2FGLA 3UW6A 4DO6A 3TJXA 4XZWA 2VDHA 2FVMA 3EOSA 4UFIA 3ARWA 3SB0A 1EOMA 3P81A 1HKWA 3G1SA 3V7PA 2XHYA 5C9UA 1I45A 4U2YA 1VF8A 3UZYA 2O9OA 3TQKA 1F74A 3N34A 2WVTA 1RBOB 3P62A 4LU0A 2ZTKA 2FFCA 2IPFA 3SCSA 4Y9MA 4H2HA 2D23A 4GIEA 4TIMA 2PDXA 4KCWA 1TA3B 4P7LA 2Y7EA 3BOLA 3FV9A 4LYRA 2ATSA 8RUCA 1OYCA 1DVJA 3N6QA 2QCMA 4HZMA 2AGTA 4Q8TA 5ABFB 4G1NA 2EBNA 3CGTA 3TA9A 1C90A 3G18A 4PFMA 5DO8A 1GK8A 3W38A 3W1RA 3CL7A 5A6KA 3MCNA 3ICJA 3WD1A 3L4VA 1NEYA 4OECA 1DP0A 3WH7A 2YB4A 1ESWA 3H2EA 3NQCA 4LCRA 5AVNA 3TSMA 2Y5JA 3MP5A 3PN8A 1WDWA 1FCBA 4C6KA 2NSXA 6TIMA 4MZYA 5M17A 4MVAA 1HUVA 4Q4RA 4NNBA 3C56A 2RGMA 3SRHA 2CEQA 1XLAA 4IP5A 3ES8A 3TCSA 1JFXA 2ZXDA 2XWEA 3NIYA 2VRJA 1VFSA 3IUHA 1UG6A 1HXJA 3H2CA 2JGQA 1VIZA 2XPKA 4X61A 2Q8ZA 1E1CB 1W8SA 4H00A 1NH6A 3W25A 3KOWA 1AD4A 2GDVA 2VFGA 1X38A 5A69A 1UUOA 1BQCA 4ACYA 1JL8A 4X0VA 3KE0A 1DXEA 3B9DA 2WM0A 4O50A 2AKMA 4DRSA 1WXZA 1W1IE 1REQA 4NYYA 2BMBA 3QHNA 3AHXA 1E43A 2VP8A 2HCVA 3QW3A 1J0ZA 1RP8A 3W1TA 2PDMA 2Y70A 1XH0A 3RO8A 1EP3A 1PEZA 4FLRA 5AECA 3S9ZA 1AQHA 1KR0A 1IIHA 3LN3A 1V08A 2AMGA 2BBFA 1DHPA 3WMBA 3N17A 4L64A 1OT2A 2I16A 3LEPA 1NOUA 1RSCA 1K9FA 1F7BA 5AHMA 1R9XA 1BVNP 3GX9A 3UEQA 3V4BA 1YRRA 2EPOA 5AHIA 2PLCA 4J5NA 1J2BA 2YL5A 3MUXA 2X1IA 3UZXA 3K4WA 2PDJA 1Z8AA 2FMNA 1O1ZA 1WOBA 4W8AA 1AW5A 1V0KA 1OFRA 4FXRA 3H2NA 3FX4A 3CZLA 4FNTA 2HDJA 3GG7A 1XFBA 1SFLA 4PMQA 1VC4A 2OODA 1CTNA 3VGBA 2BY2A 3LBCA 3NQ7A 3FW6A 3CV7A 2F38A 2PGFA 5E1QA 2GDQA 1RV8A 2X1UA 4JY9A 2B31A 3AMKA 4OV4A 4AC1X 4IJCA 1Y5VA 3UZ5A 3UJRA 3PTKA 3CHEA 1DWGM 3BMXA 4O57A 3P5ZA 1IGSA 4LS0A 1D3HA 1XW8A 3W23A 1IWAA 4IISA 1SO4A 1FHDA 1OINA 1XI3A 4EPBC 3WZ0E 3RM8A 4J3SA 5BRPA 3N2TA 3R1ZA 3R0DA 3S6TA 1KTNA 3HG2A 1AJZA 3UXIA 4ROQA 1PXGA 3OYZA 3WDRA 1Q6GA 3TYBA 2C14A 4DYJA 2X41A 3W7CA 1G69A 2YL9A 3ANYA 3RX4A 1DPMA 1A5LC 2QCHA 4K8HA 5BZAA 3GXPA 5AC7A 3QM3A 1EJWC 1RA5A 3TX9A 3KVKA 3NFUA 1HKMA 3KBMA 6REQB 3C6CA 1P1XA 3URAA 1AQFA 4L4MA 3MPGA 3W00A 4DJEA 4OUEA 5LIYX 3GDLA 1W6TA 5G4HC 4IMEA 4IQEA 1CT5A 3WDHA 4XD5A 2WMIB 1XKJA 4QCEA 4AXNA 5DMNA 4KCVA 3EAUA 3P8IA 2VEIA 4AWTA 1WDRA 2NX9A 3W7PA 3K30A 3M0ZA 1XLGA 4O0KA 4N4QA 2IKJA 3PHAA 4GI6A 3ONCA 4R88A 4G56A 2UY2A 5GJNA 3GW3A 3C2VA 5L6UA 2YGYA 3HF3A 1CGXA 3MMDA 2GSHA 1UA7A 4WGXA 1F8IA 3H7VA 1MEWA 3A3XA 2CWNA 1PKYA 3WUGA 5IHRA 1K6AA 4KRUA 1A5CA 3EGJA 2GQAA 3KHDA 1CB2A 3VZYA 2DIEA 5CAHA 2NX3A 3IK2A 1WKEA 2ZXQA 2QT3A 4DZ5A 4LFYA 1RJPA 5TBOA 4AQLA 5J04A 1VJIA 4HK5A 4MIMA 4KWUA 5D09A 4E5TA 1M6JA 2OOFA 3EXRA 5A95A 1E9ZB 4LOCA 4W89A 3HIJA 1PIGA 2PBGA 5A8OA 4GYFA 5D03A 3R4IA 3O6YX 2ZYFA 3E5BA 1TV3A 4EKJA 5A6BA 1XYZA 3LDVA 3HB9A 1DXFA 4QJ5B 1KBBA 5HOSA 4XKYA 5GNZA 4L6OA 3TW7A 4O4WA 3G2GA 3WFZA 3UR5A 1DJYA 3W1QA 1U5JA 3WX7A 2QCDA 2HXTA 5C0QA 2JE8A 3NQFA 2FHBA 4A29A 3U9IA 3URBA 5EYWA 3LRLA 4LAKA 3CUIA 3W26A 3NL2A 3IIXA 5AYXA 4XSLA 3MTWA 1BLIA 4UIOA 1W56A 1DTNA 3B8IA 3KCJA 3KM8A 3OLEA 1WP6A 3RFAA 1Z42A 1V93A 2FVKA 4GUFA 5D8ZA 2Q8XA 2BASA 1FH9A 3WFAA 2YKKA 1E5JA 3CQ0A 4GBDA 4FK9A 4LXFA 4PC8A 5TNVA 1ZFJA 3LRKA 4QG8A 4Y8EA 4FAMA 5FEWA 1TJ1A 3W28A 4AB4A 1VCVA 4JD4A 3DFPA 3TSBA 4ATWA 3RYSA 1DWIM 2A3LA 2VGBA 4DUWA 3WD2A 9XIMA 4UQ9A 1AA1B 4BWLC 1B1YA 4LUSB 4DJEC 4NHVA 1OCJA 3M64A 4PRRA 3IK4A 4MJZA 4J2PA 4L56A 4E2DA 2D1ZA 3TONA 5E6ZA 4FNQA 5KZMA 2R94A 3EX2A 4M1RA 3N4FA 2W66A 4TXEA 4FI4A 1YPIA 1S38A 4C6LA 1GKQA 4L1XA 2I9EA 1W54A 4YJ5A 4DJFC 1BXCA 1VBHA 3N1AA 2DGAA 2D2JA 1VJSA 4IGNA 4M6VA 5A6AA 3QR0A 1NVMA 3BC9A 4V33A 2DW6A 3P82A 3OU8A 1UP2A 1H50A 1ZP4A 1I4NA 4YN5A 3UVAA 3L65A 1NF0A 4IG2A 2OX4A 3KVJA 3TA6A 2VWSA 1YDVA 1A5MC 1G01A 1ZZMA 2NT1A 4KS0A 4GQ0A 4MWAA 1R3VA 3AHVA 4KWOA 2NWRA 1WA3A 4IH3A 1DIDA 3KEHA 4HSOA 4ERIA 1BRLB 3VE9A 1HL8A 1OX4B 2ZADA 1UIPA 5C2CA 2J4GA 3IAPA 1PX4A 1RLCL 4UQCA 1XLEA 3B0XA 4PE8A 2NQHA 5KINA 4AU0A 1OABA 1EX5A 1YDYA 3IJIA 5HMFA 1OT1A 4L80A 1US0A 3F4VA 1X98A 4ZXLA 2PDYA 4Y9OA 1TVPA 4GC4A 3TYZA 3GTHA 2V2HA 2VT0A 3DX5A 3S83A 2QEZA 2ZX7A 4DBDA 1GVEA 2CW6A 4B5VA 1PV8A 5AY7A 3UG4A 4YNGA 1DEDA 4Q4OA 1K8XA 2ACRA 2WNWA 2POZA 1TPFA 2O9PA 3NZRA 1UBPC 3PG8A 1CPUA 2CLFA 1QCWA 5BXRA 4NL1A 1JCXA 4PCFA 3VINA 5CKSA 2OO0A 1W9BM 5H8PA 2Z28A 1JCLA 1E6SM 1XISA 2FPYA 3F7JA 4S2BA 2QAFA 2EEXA 3FGCA 4UNLA 4ATDA 1KV8A 2R6OA 1KFJA 4GABA 3D0CA 4F8XA 1HKIA 3OW1A 3F2DA 2W27A 1L6SA 1A80A 2QIIA 2NUYA 4WJEA 4V15A 4PODA 4Z1YA 3UZJA 4NZ4A 3Q37A 4FOUA 1ITCA 5HQMA 3U5UA 4FHAA 4YTRA 1AH4A 4JGDA 5T9CE 4M29A 1R3TA 1CECA 2QCLA 1V3IA 4F0SA 3NL6A 8CGTA 3EWXA 4D6FA 1ZALA 2VC5A 4KWVA 1TB3A 4KMQA 1TV7A 3NDYA 5CJMA 3WH9A 1EZWA 4UC5A 3FK4A 3ZR4A 3ARUA 3PJXA 5D38A 1DE5A 2R14A 1CENA 2FKPA 1GKPA 1QNVA 3CPGA 2P8BA 3GXTA 1D7KA 2VR5A 3R25A 1XUZA 4GNKB 4IPJA 1MXGA 3T7VA 3LQGA 3KCOA 4FXFA 2JIEA 1LL6A 2WVSA 5K9XA 5B7ZA 2XZ7A 2PRHA 3WJWA 4HMNA 4HYRA 4PFHA 2JIWA 3CZJA 1V6UA 1C7SA 3ARYA 1P5BA 4PTMA 1GEHA 4MM1A 3ANVA 4LUYA 2Z2BA 2VD9A 4Z1CA 1IT8A 1AH0A 1YTKA 1PHQA 2DZUA 2QKFA 2W79A 3QGAC 2XISA 1RQBA 1B90A 2Z2UA 3G1VA 3QRHA 4K7YA 4D9PA 4UTHA 4GMEA 2ZRYA 4HU4A 1X8FA 2NXIA 1VCGA 2KAUC 3FSUA 4W93A 3K8KA 3W01A 3ITGA 2P0IA 7REQB 3TN5A 1I2NA 4H2CA 5I07A 3CB3A 3WJYA 1F2JA 1VH7A 4J3WA 5KZDA 3ZO9A 2ZE3A 3WD4A 5LA0A 4HIBA 1E40A 1H61A 2E7FA 2PPGA 4HA0A 2W6RA 4H19A 3UNDA 1EP2A 3NGFA 3OZOA 1ME8A 1TMLA 1WZLA 3KBJA 4AF0A 5G2IA 5BMWA 4ZB5A 3BDKA 3CK5A 2OWWA 4HCLA 4DQWA 1C9DA 3FJNA 1E70M 1QHZA 4WSKA 1GW1A 2XWDA 5C5YA 2CBUA 2TSYA 2FZMA 3RGTA 3R8GA 1RXOB 2IUZA 4GD0A 3CS2A 4PCTA 4EXAA 2PC8A 1H7PA 3QJAA 1FHLA 2OKTA 2DZAA 3WENA 1MQQA 4B3LA 1H5YA 3M44A 1M7OA 1E72M 4BFAA 4O8AA 2G3NA 4MDOA 2G5WA 3NEVA 4R9XA 3CUJA 1W1TA 1U83A 3MU7A 1L2QA 3WK2A 5K9CA 3CTTA 4GWEA 1JAKA 4PUDA 2V5DA 3MO7A 1UR4A 4W7UA 4EWJA 1QI4A 4WR3A 1T0OA 2Z1WA 4TX8A 5EBAA 1SM9A 4CCDA 3C3NA 3M9YA 1S2CA 3UWEA 4PMOA 3EPNA 4BS0A 1RVGA 1FWAC 5FJRA 4D6EA 4Y2WA 1JNEA 3CHDA 4IQLA 5A8NA 4BI7A 1QO5A 3LSBA 1OD0A 1F3WA 3S1XA 4KRTA 4TTUA 1T8XA 2WMFA 3EBVA 2WWCA 2P3ZA 3RMEA 4HJWA 4Z1BA 4JAWA 2PGRA 4LCQA 3BQ6A 1HO1A 2C3ZA 1RHCA 4GUJA 1IWPA 5K2ZA 1XIJA 2V68A 1JYVA 3MP3A 5HJXA 2Q6ZA 4CD6A 3OZYA 2WQDA 4PYSA 4OHQA 3PUEA 2YZ5A 1BGGA 1TMQA 2J6XA 3FDGA 4RKAA 2PCEA 2ZBTA 2AL2A 3TAOA 3KX6A 5D2WA 3W24A 4GKTA 2ISFA 3AYSA 4H6KA 3N6HA 4LS2A 5I3FA 5A8QA 4B4HA 1J96A 1O94A 4XZBA 4MUPA 5JBFA 4JOMA 3PWIA 3W1UA 1PZ0A 4I8YA 1O95A 3WO8A 1PWLA 2Y7FA 2YDSA 1AZ1A 4LVAA 3VD3A 4JTQA 4WJ8A 1QOQA 4NXKA 3VX1A 4NILA 2DDXA 3N3MA 4KCTA 2YCLA 3LG3A 3W7DA 4ZMGA 2ISSA 2REQA 3GNDA 3O1NA 4FA3A 4PUMA 1F3XA 3GO2A 3LENA 4LUJA 4HCHA 3OPSA 1N2VA 4GYPC 4HVXA 1FDYA 2WSRA 3VA8A 3H24A 1ZRQA 3WLPA 5LA1A 1PKMA 3KBSA 3VOHA 4R7WA 4M7TA 4DM2A 2HBXA 3IAQA 5LXEA 5CJ5A 1KM3A 3ME3A 3MI6A 3BPWA 4PMDA 1UR9A 3C2OA 1QU4A 4PUKA 3MKKA 4HNNA 1FDZA 5FL0A 4JFVA 1GWJA 1G4PA 4J27A 4EVZA 3HV8A 4TVCA 3F1QA 4WOQA 3NPUA 4X60A 5C9XA 1RJQA 1YDNA 3EX4A 5AC6A 3KL5A 4JTGA 3PG9A 4NJKA 3RPDA 5FL1A 1KWKA 4UTKA 3LD5A 1ZGDA 4LYKA 2QS8A 1PWMA 1IYXA 1B30A 3RN6A 4C6DA 4C6FA 5BCAA 1ISVA 1ZBCA 2YA1A 1Q3NA 1VKFA 2D3NA 2PF8A 5JBEA 1JR1A 3UGVA 5F1UA 1W5OA 3MCMA 4DAIA 4D8ZA 1R3QA 1V0NA 2EPHA 3C3UA 4NU7A 3A3HA 2X8RA 3OLGA 2Z6JA 3ZT6A 3E9AA 3VDGA 4ZQOA 2E28A 3IUIA 1GJWA 5D30A 4MJMA 4NI3A 2P88A 3VNLA 1A53A 4GUGA 5BNKA 4QDPA 4JHOA 3DC0A 2GGJA 2FTYA 3LLXA 1MEHA 1NF7A 1OX6A 1OK6A 3I7RA 2XVGA 3ATYA 4E38A 3UA4A 3VOFA 4O12A 1DQUA 2ANUA 2INEA 1RBLA 4S1FA 1W3TA 1S2TA 2HNHA 5C9WA 3TSDA 3ZXWA 3CC1A 1A0CA 1ZJIA 1FBAA 2X09A 3PZOA 5C70A 5FJOA 3TN3A 3DUGA 3TH6A 5C2XA 5CGTA 3TN4A 1QNSA 3Q94A 2A6LA 3EPMA 1Q6CA 2CLPA 1TV8A 2VZUA 1M68A 1PHWA 2Y6ZA 1Z6KA 1V0MA 2D69A 2E09A 3KWXA 3NO1A 4XAYA 2ZKMX 4QEEA 2QV4A 1KCXA 1ZP3A 3VMPA 5E0FA 3WBWA 1WUFA 4O14A 3LMYA 2CLHA 3A3WA 1XIIA 1F76A 1REQB 2B4GA 3TUUA 1TYGA 4S3EA 4IZGA 2DEPA 5DELA 2BNJA 3T4CA 1H7XA 1UP0A 5FIPA 2BGSA 1S2AA 3F5KA 3PFRA 3QXBA 3K1GA 3VK5A 3H2AA 3QMTA 5KTLA 1VRXA 2F6KA 3SIZA 5DCEA 4Y96A 3LZ3A 3CTLA 1P6BA 2V81A 3NVDA 2PAJA 2XH4A 3NQAA 5LGXA 4FIQA 3N29A 2H6RA 1TVLA 3O0KA 3C8FA 4LAMA 5I3HA 3HPSA 4AMAA 4LV9A 4TX9A 2C18A 2EQDA 4GJJA 3DU0A 1K6WA 1R9ZA 5CG0A 1JJKA 2HMCA 4DYKA 3QY8A 3ZJ8A 4JQ3A 2A5HA 3AZSA 1GYLA 4P61A 5GPRA 1V6VA 5HQEA 4EF9A 2WWDA 4MB3A 3PBVA 1DWAM 3PZ9A 4Z2IA 2JF6A 3GNNA 3M46A 1EHAA 1FWIC 4KPLA 4YWSA 3T05A 1FFQA 1UR8A 1YADA 2J6VA 3O16A 1EIBA 4JX6A 5REQA 3T0BA 3A4WA 3UA3A 3LHUA 4F66A 3CJPA 2P3EA 2ZRXA 3OTRA 3DYPA 4R5EA 1QPKA 2J25A 3P2VA 3UXKA 3PJTA 3PANA 2EKGA 3STEA 4LAOA 1KXTA 3TWAA 5AB3A 1UOZA 3TC3A 1P6CA 4JCLA 3GSMA 4JL1A 1U1JA 1XQKA 2IPGA 3QQ0A 4QXIA 4QJ4B 1WV2A 4GKLA 4DY1A 1YXYA 2DIJA 3B05A 3LTSA 3T8QA 4GNVA 2JFEX 3HPFA 4R9OA 2ODOA 1GOIA 1DJZA 2PDFA 3W71A 5D2YA 4J3XA 4RCXA 4RLIA 1X96A 3OHMB 3VDAA 3UGRA 1Z48A 1JRCA 1KXQA 1GG1A 1LWHA 1UH3A 3LI1A 1JPDX 1UKOA 1E55A 1TV5A 2A85A 5D9MA 4B15A 1W1VA 5I6SA 3VNZA 5A2CA 1R5YA 1JI2A 4WDXA 3S2CA 3OBKA 4MKNA 3W76A 2Y62A 3GH7A 5T9BG 1ZBVA 1CLKA 3RK8A 3A4XA 3RCMA 4H1ZA 5J5DA 2ACUA 5FF0A 3FKRA 3ARRA 3QH2A 2EJ1A 3PWGA 1BKSA 3UR2A 3LNPA 2EO7A 5H2ZA 1JZ3A 4GXPA 4RXFA 1DJGA 3RM9A 2CXGA 4K6AA 1LLWA 2WZTA 1LT7A 1Y8BA 2QUMA 1FTXA 4D6CA 3CQJA 1EGZA 3SEPA 4MSSA 3P5YA 1SVDA 2TAAA 1LOQA 4QG9A 1XR2A 4OU1A 4GBUA 2VD8A 5D32A 1DJHA 3KTSA 1ME7A 3KZPA 5FAGA 1EUAA 1TE6A 1MZHA 5HPCA 1B9BA 3WQEA 5C2GA 4F4RA 3HG5A 2B7OA 1HG3A 2PODA 5M3WA 3MQTA 4Q6JA 1B4KA 4HPHA 3PB0A 2BFGA 3FA5A 4QLKA 5LXXA 1TJ0A 3AU6A 1RK5A 3L5AA 5HNNA 3L0GA 2KX9A 4QBXA 5E5CA 2DT3A 3G3DA 3C2YA 4CGTA 5CPQA 1JZ8A 4HU8A 3BMVA 3U5YA 2NXGA 1PUDA 5AN7A 3M47A 3EWZA 3M5YA 4HJFA 5B7YA 1TWZA 1UIOA 3MSGA 1P0EA 3CWNA 5CBJA 3W75A 4UNIA 4LF2A 4TR9A 3W7HA 1SW3A 1HNYA 3S9IA 5C6MA 1KGXA 3MS8A 5DF0A 2OOGA 5H8MA 4XKYB 2AQWA 1B0IA 4NG3A 3W02A 5HNRA 2QDHA 4AG0A 4O8RA 5FJPA 5FJTA 3IPWA 5GJPA 4MNJA 3II1A 1S5VA 4A8NA 3KVMA 5LYRA 1VQTA 1UC4A 3N14A 2QCDB 2CFFA 1R9YA 4N9BA 5ECVA 3C2RA 4L61A 4MMWA 5LNVA 1K3UA 6A3HA 3GU9A 3UVIA 1QBAA 4GIYA 3VUSA 1PBGA 4C6IA 1O60A 5HMEA 1I0DA 5ECUA 1XCWA 4ZB0A 3UJSA 1NWSA 1XDLA 1K8CA 2QCEA 3VGHA 4V2XA 1XH1A 2CCRA 1D2KA 3DG7A 2O4QA 1JUBA 3PS7A 1PZ1A 1TELA 3BLDA 1SFSA 1GCYA 1OBAA 5G2HA 4U3AA 4CD8A 5BRBA 5DFAA 2QF7A 4YTQA 1KM1A 4YVXA 1UJPA 1US3A 1SR9A 1UA3A 1HQTA 1MW2A 4O18A 3DG3A 1EX1A 2G41A 4JKKA 1VCFA 4C6MA 2A6NA 4HOZA 3FAWA 2YXXA 1UYQA 1WDSA 2O7QA 2CZDA 3EA1A 3BG3A 1S5NA 3FJLA 1THFD 2WPGA 2VYOA 1EEPA 1RALA 1EJSC 3WLTA 2E5CA 1TG7A 4NNAA 3AIBA 1R2RA 3ZIZA 1EDTA 4IGMA 4B3ZA 1EC7A 1L9WA 5AC4A 5EU9A 4PMVA 3B3DA 2XVLA 3H2FA 1RY8A 5EMMA 1Y65A 5T8GA 3NO3A 3I3EA 5IOBA 1FXPA 1Q7QA 2J9XA 3HOJA 4L4PA 4KW2A 2Y7GA 2HRWA 1P43A 3PZMA 4UQEA 1GYMA 1K9EA 5DRCA 3HJZA 3VMOA 2ZZ6A 4H8NA 5DBTA 1F4AA 4RNFA 2XFRA 3OQ8A 1UWIA 2EAWA 1OFPA 2WKGA 1I9CB 1NFGA 2BY1A 2FDSA 4DM1A 4B9YA 1QO2A 3DFQA 1V77A 4NQ1A 3AXMA 1F6PA 2F2KA 1XRVA 1MW3A 1AH3A 2RGLA 5J8LA 4KWWA 3ARQA 2OWXA 2J7FA 5FSDC 4FLSA 4A8IA 3BLLA 4MWAB 4IPNB 4AZCA 1X97A 1WXYA 5ABEA 5HQLA 4DZHA 4E2OA 3IWPA 4IIDA 3I6EA 4XD3A 4MADA 1WKFA 2GUYA 5I2UA 2CLMA 1JDFA 3M4HA 2XVPA 5FEPA 4LRTA 3ZVHA 1HN1A 4Y9PA 3L2MA 1W2PA 4WY0A 3W7MA 5CSRA 4R85A 5A2BA 1VFFA 3CUXA 4DXKA 4HPJA 1JGMA 3CUFA 3KRSA 1DHKA 4ZO9A 1ZJAA 2NQ5A 3R79A 3JW7A 2J8TA 1WDPA 3GK0A 3W7QA 4AHPA 4LAZA 4GOAA 1J11A 3UCCA 2NLIA 2PSNA 4ACZA 3HMCA 4CCCA 2V67A 5D33A 4F79A 2Z1BA 1RBAA 3GIQA 3NR0A 2JBMA 3RF9A 2BVYA 3W70A 1CXLA 3M0HA 3FGCB 2I17A 2NX1A 3LPGA 3VIMA 4RX0A 1UUQA 4AD2A 2YSWA 4JN8A 4PL2A 1HJVA 4Z0SA 4UTFA 4K1GA 1GVQA 5KEZA 1BTMA 2G50A 1QMLA 3BGJA 1BWLA 1XLFA 3SZ8A 5HK4A 1X6UA 1M7JA 1G94A 2DT1A 3W53A 1ECQA 1I2PA 3W6YA 3PVFA 3WF0A 2VQUA 4REQA 1R86A 3UD6A 4NUWA 3OODA 4OFCA 3C0JA 9XIAA 3P14A 2DZPA 2WC3A 3NJ3A 3TEVA 1MFUA 1C7TA 4EF8A 3MCOA 3LHWA 3XINA 3IJ9A 1EXPA 1JCMP 4WF7A 3NL5A 4HZ8A 2VFDA 2ZDRA 3HPZA 4LYPA 3NYZA 2DQWA 7CGTA 2FLIA 1LUCA 1U1HA 3N2OA 1PKLA 1YPXA 1K7XA 4HBKA 3STPA 4ZEPA 1KRMA 2CHOA 1KCLA 4I5UA 5ENLA 2POTA 3T0CA 1A47A 4AD3A 4L9XA 1NWTA 1RQEA 4YYFA 4HA4A 2J27A 1NOFA 4JKLA 5HJYA 3OGSA 3GH4A 3UWVA 1JAEA 1UQZA 1UKPA 1OG0A 5FAJA 2QR6A 1D8WA 3HV9A 2OZ0A 4TUFA 1QOPA 3O15A 3UJFA 1AFSA 2DQXA 3FY1A 6CGTA 3NQ2A 4DYEA 2ZX8A 3WF2A 3HQ1A 1YXCA 4UFKA 4MKVA 1ME9A 4LTSA 4X9YA 3RLVA 4EP8C 2ZRZA 2PWUA 2OMAA 2YJQA 2PDCA 4N02A 1Q85A 4QTGA 1H1YA 2PLKA 1IR1A 4MJ2A 1D9EA 3ARTA 4IL2A 1KBKA 3M0IA 5EMKA 4A3QA 3PR2A 4DJDD 1ZENA 4ZE5A 2QJHA 4PMNA 1JUKA 5HMSA 1K02A 3G0XA 4DBEA 3THCA 1KV5A 1G5AA 4AZHA 3R8RA 3TMQA 5LA2A 1IHIA 4RW3A 1PDZA 4NZ3A 3W4RA 2HNEA 5HUOA 4ZQMA 1H2JA 1BWVA 1MXDA 1R87A 1IIGA 4YL2A 4OWGA 3W1XA 3DFTA 3VOIA 1IQ8A 1KQZA 5K4XA 1LRTA 3GFYA 4MNLA 2HE5A 1N8FA 3QKEA 1UZ1A 2Z1KA 4M6PA 5K3VA 2VVSA 1G9HA 1OG6A 5EBUA 4ATLA 1V6XA 2VCCA 2WNNA 5E9XA 3F2CA 2EG8A 4PRWA 3LRMA 1Q7MA 1SZRA 4J2MA 2ZA2A 4H9YA 3AUOA 1GHRA 2YBVA 3SN1A 2Q3OA 4E4PA 4XIAA 3T09A 4DELA 4S39A 1F5ZA 4ZENA 3TC7A 3DCPA 1R38A 2IQ0A 5CZSA 3AMLA 3LHTA 1TIWA 4CCZA 2GPTA 1KTCA 4MHBA 3S1VA 2OU4A 1G6CA 4L4LA 4O17A 3EB2A 4N6FA 4CN4A 1NAL1 5IFPA 4C7DA 4CLMA 2LLEA 2GLKA 3PPGA 4Q7NA 3BL3A 4LALA 4HMDA 1C9WA 1L6GA 1OVDA 1NU5A 4CN6A 3TAKA 3L4TA 3VD7A 3EMQA 1ZS2A 1OFDA 4XAPA 1ONWA 1PVNA 4NJHA 1N82A 4M8UA 3CIXA 1XJBA 5G2WA 3VDBA 5DLCA 3VI2A 4FMVA 4RNHA 2D24A 3GKFA 2ASHA 3C2FA 4UFLA 1VHCA 1W5QA 1PX8A 4G7EA 3GFXA 2CU0A 3R5EA 2DFAA 3LU2A 5AC5A 1VFHA 1EHNA 5A3HA 1PL9A 3GBEA 4RDVA 5D37A 1EDGA 4AZ6A 4Z17A 3BZGA 4FO4A 1SJDA 5BROA 2W3ZA 3QV7A 1AW1A 1BSIA 2A3AA 1EL3A 3P74A 5HNUA 3CZGA 1FY6A 2ZA3A 3HJEA 1XFCA 2R91A 3GAYA 1UD8A 1LG2A 2UV8G 4XB3A 2H3BA 4XWUA 1B2YA 1OFEA 3E0VA 2YCEA 4F3HA 1RP9A 4WSHA 4R27A 2GQ9A 4A3RA 3V36A 2OLHA 3G0UA 4LY8A 4CN1A 5I5RA 3G8RA 4JNYA 3UJ2A 1KBLA 2G3IA 4IJRA 4CU8A 2AL2B 2BDQA 2ISDA 5HATA 2V30A 1Q4NX 4RNJA 2IPJA 4B16A 4GX9A 3QTPA 2OYMA 3DYMA 4DF2A 4LNYA 5BOFA 2EPNA 2FHCA 1QBBA 3TYDA 1AODA 2VMFA 5TAOA 4AD5A 1K03A 3EWWA 5G1MA 3VPLA 3ITCA 4GI4A 2J24A 3OGVA 2QF8A 3SM0A 1OK4A 3S47A 1WE5A 3B8DA 3HFTA 2G8ZA 3NOYA 3E96A 4CKQA 2UY4A 1AZ2A 4XZLX 1UWQA 2REQB 1LBMA 3GDKA 3I3DA 1EO7A 3OG3A 3SECA 3KTCA 3UQNA 4MB5A 4UR7A 1UW9A 4D6IA 4DLFA 1J79A 2F2HA 4JZ5A 1VFMA 2V0TA 3AIWA 5EFDA 3E0WA 4XZIA 3F5LA 1XRFA 1E5NA 1W1PA 2GSJA 4XSMA 5I77A 2VUNA 3S46A 1XSIA 4H8UA 3GNRA 2VGFA 4MNMA 5RUBA 1K7FA 1YEYA 2CKRA 5MF5A 4FLOA 1NJJA 3DFNA 4BZYA 1G1YA 2HE8A 5EKYA 3LS9A 4L5ZA 3H4GA 3W2MA 4IMGA 3L7RA 4MY8A 1LOSA 1G7UA 3PZNA 2HK1A 1MZRA 1KTBA 2F7FA 1XS2A 3Q67A 3NSNA 5D9NA 1XH2A 4RZ5A 1FRBA 2QCCA 1R7OA 3R2GA 2OCZA 5AYYA 2EJAA 4JN7A 1U22A 4PL1A 1QI2A 1HZYA 2FH6A 4QEHA 3M1ZA 1AJ0A 3NM3A 3DENA 2QPSA 1GYNA 1MUCA 2Z4GA 4LEFA 5D05A 1UD3A 3BV4A 1MVYA 2JKAA 2J79A 2GJPA 5I79A 3OGRA 3N9KA 3EOUA 1F4HA 4DB7A 2YYTA 4ZFMA 1JPMA 1WBJA 3SQSA 3WNLA 3UY7A 4U5IA 4I9MA 4E4FA 3CV6A 4P7RA 1GT8A 3BOXA 3WJXA 1EA0A 4CUCA 4L1GA 2OLAA 3HO8A 3F4NA 5G1TA 1CDGA 2C0HA 1VLWA 4WXYA 4NXSA 2XSAA 3WQFA 2AAMA 2G95A 1MDRA 3IGUA 4E8CA 2E9BA 3HQNA 2J7HA 1V3LA 3EDJA 1YE6A 3GNXA 4H7VA 3N9SA 4HSNA 2XIQA 3TOPA 2XIIA 4FF5A 3WUFA 1OWQA 2ZX5A 3M7SA 3AYVA 1WZAA 4S3BA 1O5QA 1F05A 3R58A 4W5ZA 3R94A 3TTYA 2Z1SA 3KLLA 5FI8A 3UERA 3EKZA 2XN1A 1GPWA 3VIGA 4KIRA 7TIMA 1HFBA 2WHJA 3BG5A 4GFSA 1TZ7A 3LNMA 1CGVA 2A7PA 1HJUA 1FA2A 2A3HA 1H0GA 1KM2A 3SCQA 3QYQA 4F9DA 1NWUA 4UTMA 4QFUA 3MB9A 1FP8A 1B3XA 4A3HA 5CC6A 3L9CA 2EPLX 3UR7A 3AC0A 3I7SA 1US2A 3TC6A 5IXEA 4WRHA 3UPBA 2DIKA 2QHAA 4INFA 3MSYA 1QASA 1DQWA 1QHOA 2YZRA 4IQDA 2EPKX 3AROA 4A22A 3G3MA 3TV8A 2IKGA 2VX5A 3CAWA 4YXGA 4IIFA 5CEWA 4UCFA 4DNHA 2JALA 4QSHA 4ZOEA 4Z2KA 3THQA 1AL8A 3W9ZA 4BF9A 3KRBA 4GJ1A 1FUYA 3RDKA 1ISYA 3VCNA 2Z26A 3PSVA 3K2GA 3BW3A 3D6NA 4JEQA 1M01A 1XBVA 3GR8A 4I5RA 3SRDA 1GOKA 2J62A 3IJ8A 4LJ3A 2Z27A 3DFYA 5REQB 2WMJA 3E2SA 4NX0A 1KXVA 4K37A 2NW0A 4CQBA 4ZVJA 1H41A 3ZWSA 3CMGA 4YU1A 4EK7A 1KRBC 4QNEA 4GJIA 3S1UA 4XG1A 4QR6A 3IIPA 2ZZ5A 4NZFA 3DECA 3OB8A 4C6NA 1NY1A 1ICSA 3W1NA 3FDKA 1Z7AA 4JX4A 4WUIA 5CXPA 1R46A 2XVNA 1T6MA 3LX9A 3MSDA 1ALDA 4WDTA 4Y6GA 3VM5A 1XGEA 3N13A 3H6OA 4C5YA 5HWNA 1W2VA 5LNWA 3QQ1A 2VFEA 1M1BA 1W31A 2V69A 3T42A 3AI0A 4AIEA 4DJED 3GUGA 3GC4A 2QIWA 3H2OA 2XFFA 3CXOA 4DHGA 1HIZA 5LNSA 3WQWA 1ITUA 2GVYA 1J9YA 2W63A 4Q3MA 2YDQA 4JFSA 5CC3A 4KEVA 2GSEA 1XBZA 4DVOA 4BKNA 4DJFD 2DJXA 3MDUA 1HJWA 1ONRA 2OT1A 3SIMA 2GQ8A 3B9EA 1RA0A 1FKWA 1XIDA 4Q8VA 2CZ5A 4NNCA 2HSAA 3H53A 1QHPA 4CU6A 1UD4A 5EMYA 4S3DA 3E2QA 4O53A 1LL7A 2C1GA 1H11A 3W2LA 3CL8A 1EWDA 2DT0A 2VGGA 1BTCA 3RPTA 2HVNA 5DMMA 3PK7A 4CNUA 1NOWA 2OX1A 2D3LA 2ALRA 3R89A 3C2EA 3SCNA 3N2XA 1F61A 4HTYA 5I0DA 5I3GA 2DSZA 3M0MA 3BSHA 1TWSA 3LA4A 3QOKA 3EB4A 3CU2A 3WKZA 1UR0A 3D5HA 1T7LA 5K9DA 3FEMA 4MB1A 3K5XA 4ZR8A 3BOFA 2DORA 4V28A 3B97A 4FNSA 4ZOCA 2RJGA 1R47A 4Q7IA 5FF3A 1EQPA 1FWFC 2VOTA 1SZNA 2PU0A 4B3KA 1QWKA 1LCOA 2IQDA 4D6JA 5DT5A 1NWRA 4PMXA 3EOLA 1J0IA 2YA0A 1FWHC 3OJGA 2VZOA 4JNMA 5I3IA 2Y2WA 1O5RA 3NOEA 3VIHA 3B8UA 4ZOBA 2JF7A 4Q4KA 1EC9A 4AVOA 3UPWA 2BODX 3G1HA 3B8TA 4N9CA 1OIFA 4GUHA 3GY1A 4AH7A 1V03A 2RHGA 1U1UA 3V0TA 3G1FA 2CBVA 1VBRA 4H8HA 1QI0A 1J12A 3MT1A 3RCYA 5CGMA 1UWSA 3VKJA 2C0AA 2BVTA 2EGZA 3HGJA 4XBKA 3ZR5A 3VNJA 2UY3A 2DP3A 4OUIA 4CU7A 3CQKA 1V6WA 1LLOA 2OB3A 4EPDC 3NG3A 2VEPA 1PIFA 3KHJA 1QWGA 2XGZA 3BAXA 2VENA 4LH8A 3BCFA 4LW7A 1BAGA 4RDZA 4DJDA 3N4EA 4DWSA 2GJXA 2DZVA 3EYPA 5AZ1A 1OD8A 5D2XA 4QHRA 1XLBA 2Z00A 1M5WA 2ZA1A 3WLNA 1JG9A 1EC8A 2FFIA 1YYAA 1MYRA 2CLLA 4Z08A 3GXMA 5D9OA 3L5LA 2DV0A 2QJGA 2YW4A 1KBIA 4MAVA 1E1EA 1JGIA 1E15A 2J9ZA 2J7EA 2OFJA 5A94A 2QGHA 6ENLA 1ECEA 3B8WA 4GQQA 2WC4A 1D3CA 2WZMA 3P0XA 4K1WA 1QI5A 4M0XA 3E49A 4KFNA 2NV2A 3M6DA 1NDVA 3CYJA 3PM6A 2QCFA 4QJ3B 4FPSA 4DZAA 1KGUA 1GQIA 2GVEA 4IUOA 1RVKA 1KLYA 2W61A 4RL3A 4HNVA 3WMSA 1VFUA 1Y5XA 5BXSA 4UBPC 3W7NA 2ZXBA 3N6JA 3GXDA 2PA6A 1FOBA 2PRLA 2ZUTA 1TPC1 2PWDA 5DBUA 3ZT7A 4DBSA 1SO5A 3N9RA 1DXIA 2W5FA 2HS6A 1CGUA 2I56A 3ZFHA 3T0AA 2SFPA 2XDFA 1QOXA 4TVUA 4O4VA 4HNTA 1FKXA 2J9YA 1K8ZA 1XLKA 4I7UA 3VILA 1SJCA 4IFRA 5BOOA 3GXNA 2VEMA 5HPOA 1OX5A 1XLHA 3WDPP 1ADOA 3UXLA 2W92A 4DUOA 3B40A 1BD0A 2FVLA 3V75A 1GOMA 4OGZA 1RR2A 3LGDA 3M0XA 4QAIA 4UTJA 1F6YA 3ZZ1A 3C5QA 2Y4SA 2HQAA 3T40A 4GH1A 2GOUA 3E2VA 3O6CA 1XSJA 4RPPA 2CHNA 3ES7A 3SUSA 1TPEA 1FFRA 2E6AA 1LRNA 1H09A 4K68A 4WY0B 2VZTA 1A0DA 5JIPA 3GDMA 3I10A 4ECLA 2Q01A 4HTBA 4ZOAA 3WDJA 3L12A 1RAKA 4CD7A 3EX6A 4D1JA 1DYSA 2J7DA 2X30A 4GZEA 1FWJC 3T2PA 1J4EA 3DGRA 5ABGA 4UOQA 3O9NA 2CNCA 2V82A 3PJWA 3Q2DA 2NWSA 2UBPC 3H4XA 4LVFA 1TO3A 2XFWA 3SCWA 2F6XA 5AYIA 5BWAA 4NZ1A 1H60A 3T1GA 6XIMA 4LPCA 4F0RA 3GR7A 2E5BA 4GVGA 3IGXA 4ICNA 2R8WA 3GNOA 4RUBA 1M9HA 3AZRA 2B81A 4DJDC 4YHGA 3SCPA 4DWSC 5C71A 1BYAA 2VFHA 2I14A 4PULA 3BSMA 3AMCA 3WG6A 3NPVA 3GW0A 1FP9A 4GO9A 3N4AA 5CPOA 4REQB 5L9FA 1ITXA 3QW4B 1WAUA 1Q13A 4ADUA 3MUAA 3CLMA 2X1TA 3AS0A 1TPB1 4L6DA 4ZQCA 2GL5A 4LUTB 1QK2A 1CBGA 3BCDA 4J4KA 1K1DA 1LUCB 4MAZA 4AFYA 3U3HA 1EPXA 2ZRUA 2O7SA 3UZWA 2Z7GA 4NRSA 3G6MA 3NM1A 2BB0A 1HL9A 1X39A 4DO5A 1A4MA 5DY3A 1EP1A 2GDUA 4G6CA 1L6YA 4N7QA 1GPFA 1TUFA 2WNQA 3OIXA 5E0KA 3R12A 5D9PA 2VHLA 4PRTA 4AD0A 3JRKA 2PD9A 1JDAA 3VD9A 1UZDA 3AU2A 2ZUNA 4JQ2A 3SGUA 4L9YA 3SRKA 5H8UA 2I1OA 3LPPA 2CBJA 1UMYA 4MJ4A 3LCHA 3FJ4A 3DZ1A 3KS6A 4ERAA 3A4AA 3QVQA 2WZIA 3IARA 4IMFA 2CXEA 4GC3A 3KL0A 2WSPA 3MUCA 2XIJA 3MDWA 2G96A 3SR7A 4G8TA 3PBGA 4Y7EA 2NT0A 3WK1A 1O5KA 4XTDA 1XIHA 4DZIA 3PUGA 4HT3A 3NQ8A 3VUPA 1TA3A 3SI9A 3SN4A 3AFBA 1EUNA 5AOUA 1LQAA 1JFHA 5ABFA 1R3SA 3WLOA 1VBUA 1JDCA 1MMFA 1WUEA 4OJYA 3T0TA 3NCOA 3P67A 2WCAA 1IEWA 3K8MA 4UTLA 3LCLA 1OZQA 1NTHA 2VKZG 3GNPA 3UFYA 1DQXA 4QM1A 2PEVA 2BY0A 4DXXA 3NXLA 4XO7A 4KEUA 1XDJA 3BSGA 5LNRA 4N6EA 4NYUA 3IS4A 1S5MA 3MKCA 1I75A 2Z24A 4JIHA 1M3UA 1XCFA 5M03A 1LJYA 1XICA 4F9JA 3EX3A 1Q6FA 3TTEA 1G7VA 1NSJA 1V7AA 5CAKA 2XYLA 1UHVA 4JTCA 2G0WA 1E1CA 5BOEA 4ZTYA 3I3BA 4QISA 3QSTA 3KCLA 4JXCA 3I6RA 4EPKA 3S2NA 1BKHA 1KM5A 3H12A 5LSMA 3ZLFA 1R0MA 2X7VA 4H7CA 2BXZA 4GIRA 4ZA0A 1EJ7L 4LVGA 2NUWA 4A6GA 3QMRA 4H01A 2XFYA 1O7AA 1UKTA 3DBPA 3OA3A 3L66A 4G7EB 4B5SA 4FF7A 1L6FA 2PC4A 2Y8UA 1ICPA 4M81A 4XZNX 1MNSA 3OO2A 1PSCA 3G1RA 3CLWA 4D6GA 2Y61A 3KP0A 5GQBA 3NSXA 2E9MA 3UETA 3CWOX 4U10A 5D04C 1B3YA 4JBRA 2PP3A 5F2MA 1KFLA 2E25A 4LWWA 1G4TA 4KH2A 4Z2LA 1X7FA 2INFA 4E3VA 4RZ4A 5E09A 4H9MA 4D2JA 4G9PA 2Y7DA 1HP4A 3LM7A 3VO0A 4N4PA 4WGHA 4KRZA 4JQ1A 1GVIA 2Y8VA 3CAQA 4R3UA 2NSOA 1N7KA 2PLJA 3TXVA 1I6NA 2DH2A 4M19A 2VC7A 2D0GA 3TVAA 1SW0A 4O1AA 3GTNA 2XZ9A 3VD4A 1TRDA 4DN1A 3QZEA 4ORMA 1UWTA 3R13A 5CGQA 1VZWA 1P0KA 1CGWA 1M7XA 4Y90A 3VVGA 1BG4A 4JL2A 2J74A 4UFMA 1UASA 1F6KA 4A21A 2OGYA 3SFKA 5AYZA 2ZUVA 3RUBL 4P2VA 2V9DA 2HBVA 5I78A 3EZ4A 3C0QA 4I7WA 5LHEA 2WSKA 2R9RA 3T4WA 3JS3A 2ZVIA 3WNNA 4EOUA 2QJIA 4YTSA 4TVDA 4FNUA 2E8ZA 5LGZA 1OC7A 1EZ2A 1YXDA 4AAJA 2R1LA 3ZR6A 4BWLA 3NXFA 3WLRA 1GOQA 4WY0F 2BHUA 1TR9A 2V3GA 4UTWA 2YX0A 4YVPA 2OKOA 4HNOA 1CYGA 1TMHA 4ZO6A 4QGCA 3RM4A 4FXSA 1X1ZA 3VX0A 4IP4A 5I3DA 2Q8LA 4IL0A 2E1WA 4KGLA 8XIMA 4DJFA 1JCTA 2VURA 4RE0A 2QGYA 4F0HA 2GVLA 1V5XA 5FKYA 2IKHA 1BHGA 4JTUA 2NUXA 3PTDA 1XYCA 1GG0A 2OTDA 4J35A 1Z32X 4DI8A 4PA8A 4FR6A 3AOFA 6REQA 3LPOA 4UFHA 4FR1A 2IXUA 2RFGA 2I7GA 2ZC1A 3C4UA 1R6WA 1XUUA 4ONVA 2A3BA 7ENLA 3NPWA 3PBMA 3WSUA 3OVRA 5ABTA 3WH6A 2X7WA 4HYVA 2WMIA 1BYDA 3TCEA 4HB7A 1XSKA 2PI6A 3N2CA 1SQ7A 1GQLA 2R1MA 4HP5A 4XKMA 2GK1B 1UB3A 4HGXA 4PZVA 4J3VA 5KMYA 4XTIA 4Q22A 3PUOA 3GHSA 3VOCA 1XRTA 1S2WA 3N11A 2OYLA 3WEZA 2PWEA 3PNZA 1O6IA 4PEKA 1KKRA 4ZO7A 3N15A 1RPXA 3WH5A 3RHGA 4HNUA 3SAZA 2E6DA 1LORA 3MBDA 4P5UA 4PMZA 5CPTA 3TQVA 3O06A 1HW6A 3TJLA 3HPXA 2OEJA 2ADAA 1BF2A 1HT6A 4GXWA 1FWNA 5DN1A 3BAJA 3NGJA 2CKSA 2PE4A 4R53A 1GORA 4JTAA 1VEOA 1A5OC 1TVNA 2PTXA 1POJA 3CUZA 1OCNA 2ZE0A 3MYPA 4AHOA 4NT0A 3FKKA 4MLRA 3RU6A 3WD3A 1K70A 3BUVA 3N12A 1C93A 4KEMA 3U2ZA 2YBTA 5DXYA 4U3CA 1PJ9A 4HOWA 4S2CA 4W8BA 1NFPA 2CZFA 4HYWA 3CZKA 2DSVA 3PZVA 5DXXA 1QNPA 1F73A 1RH9A 4X63A 4ALDA 1Z9AA 4IPPA 1JRBA 1RCOB 4GLEA 1SGJA 3WEOA 4IMAA 4AISA 3ALFA 3W73A 3LB0A 1Q45A 3GU1A 4WHBA 3WLMA 3PAJA 1LZOA 4V1YA 3VOJA 1EF3A 2YLAA 3FN9A 2QV5A 3W85A 4KETA 1E9LA 1H63A 1ADDA 4XAGA 3PPHA 3RNDA 1RY0A 5LNUA 4GHRA 4UTWC 3O0FA 3BLKA 2P53A 4A3YA 1XIFA 2J78A 3WELA 4WIWA 4IUGA 2WOQA 5AHLA 1PZ3A 4DLMA 1J5SA 5DX7A 3KBVA 3MO4A 3W7JA 4AHQA 3SDOA 3PFMA 3RR4A 1AQMA 3U0HA 5IDZA 4PGLA 4F2BA 5F4SA 5IM51 4I9JA 1JZ4A 1YNPA 5LIKX 3B4UA 1BXBA 1VPXA 3PZQA 4Q8OA 2HS8A 1KWGA 4W86A 1VGAA 5C8BB 2JGYA 4AX7A 2X0YA 1FCQA 2G3MA 4M7SA 2J77A 4GISA 2GJNA 1OGBA 1FHVA 1QW7A 2ONEA 2E8YA 3WUBA 1UOKA 4LNCA 4XAFA 1HJQA 3RU8X 1XQLA 4Q8MA 4GCAA 4OBTA 1CWYA 3MUZ1 4QRNA 1EGMA 1TX2A 1B3ZA 3MKVA 2DUAA 4HA3A 3SUUA 2YFOA 3KFTA 2ZX6A 4QX4A 3CHVA 1Q2SA 2VC6A 1QRQA 1SZGA 1YW1A 1CZ1A 1R3RA 3VIOA 5AHNA 2XG9A 1K4GA 4ZFCA 1H7RA 3TTOA 3HG3A 3AIUA 1QW9A 1X6NA 1LL4A 4Q6XA 2XGIA 1X8CA 2ATMA 2FGZA 3PUDA 1BRLA 4ZTXA 1OX4A 1J2WA 2E5DA 2PS2A 2PTYA 2GUBA 3BK0A 3M16A 4UUIA 2VUYA 3IV3A 2JKEA 3ITLA 3WLQA 4IPLA 2H9AB 3CZEA 3P8JA 4YWIA 3FNDA 3BGGA 2OELA 3NSMA 5FJJA 4P8XA 2J7GA 2PLMA 1EYEA 4PUUA 2CC0A 3DHUA 1DWFM 3THUA 2XINA 1Q6EA 3K1DA 3EWCA 2GZXA 1GKRA 2Y89A 2IXVA 4FX8A 2E0PA 2OG9A 2HTMA 5A1AA 1PS9A 3HGRA 5LKYA 3IACA 1OF8A 2P50A 2BOGX 1B31A 2Y5EA 2E67A 3AQUA 2PDLA 3IIZA 4J28A 3VAVA 3H70A 4P8WA 1J10A 5IRPA 1VHNA 1FWSA 4UWMA 5TQLA 4JNZA 4RNIA 5CSUA 1QNQA 2J75A 2QQ6A 1YLVA 3H2MA 1VEMA 4EIVA 5BMXA 4L6HA 5LIWX 3UWUA 4US5D 2GJLA 4JIIX 1JYXA 1KGWA 3EWUA 4UMBA 3WDIA 2VC9A 4IPIA 4F2TA 4W7WA 4GGHA 3AMGA 2O0TA 2OQYA 3TQ0A 2VX7A 3AIQA 1TTIA 4DPPA 4W7VA 1EPVA 6ALDA 1SJBA 1V0LA 2XIMA 3C52A 3IVTA 3MHUA 2BGNE 3A21A 5JUVA 1KFCA 5HDRA 4KIEA 1LM1A 2I5GA 3KDNA 4Z42C 3J7HA 3AWOA 1W9UA 1JD7A 1YBQB 3A22A 3WNPA 5AVHA 2I5QA 3L4YA 1OY0A 2HWGA 3WIJA 3C8NA 3NNTA 5XIAA 4KCUA 1W8GA 1UPMB 3PBWA 2GGHA 1OCBA 2PDBA 1KBJA 5I06A 1YE4A 2AAAA 1T40A 3P3BA 2NVAA 1EJVC 3WNKA 3NQVA 3REQA 4IWWA 3ANUA 4LF1A 1H4PA 1YKWA 3SUWA 5FJIA 1F07A 3RMJA 4JYDA 4A2SA 1ENUA 4GYPA 4G7FA 2C1IA 1HKVA 3DESA 3DDMA 2RH9A 3AUJA 1HKJA 3BJFA 3GAKA 3H26A 4GINA 3HBLA 3VXGA 3PNUA 2YPIA 3BICA 1OC5A 1HTIA 1GOOA 4RV8A 2C7FA 1DL3A 3DHDA 7REQA 3IVSA 3Q58A 5DMYA 3GTIA 3NQ6A 3G24A 2ISVA 2BG5A 1TREA 1UD5A 3VZXA 1W3LA 1KM0A 1WBHA 2V3FA 3OA5A 4CNPA 3MJMA 2B7NA 2Y1HA 2WC7A 3GTXA 1DBTA 3VCRA 4Z1DA 2TYSA 1A5UA 3TFXA 3B04A 1KB3A 3ITXA 3VFCA 2EXOA 3I7QA 4G2DA 5C55A 1TZZA 4U5KA 1BFNA 1DJWA 1XP3A 3WBXA 1IZJA 3SBFA 2ZTJA 5FF4A 1CXKA 3VIIA 1R2TA 1L0PA 1PTAA 5JVLA 4EAYA 1OFQA 2QCGA 2ABBA 3N73A 4HPGA 2ZDSA 3UWQA 5J5RA 3WLHA 1ZSXA 3C86A 4MF4A 4V1XA 1E51A 4ZCWA 3W3OA 3APYA 1KA9F 1K77A 3TYAA 1DIOA 3GYEA 4NI8A 3DHPA 1K9TA 2H8ZA 3WLKX 4BEQA 2CERA 5B80A 1WB0A 3QF0A 3CPRA 4AY7A 1OC6A 1BGAA 3QFEA 4FXJA 1P7TA 1EH9A 3GIYA 3T55A 3GHTA 3LXCA 1XLLA 4U33A 3EPOA 1MUWA 2J13A 5H1WA 4O11A 4M82A 3P6LA 3LI0A 1TSIA 3NDOA 1I0BA 3QV8A 4M5PA 5EB8A 1XG4A 3IJQA 1TJ2A 2EF9A 1VJZA 5C7VA 4S3KA 4CQCA 1SUXA 4XVDA 4B92A 1CW2A 4KQNA 1F9CA 1ITQA 1PTDA 3FEQA 4IP7A 2ZC8A 1GVYA 1XYFA 3GYCA 4GZJA 1CCWB 2DY3A 3FFSA 4ERGA 3I6TA 2PRMA 1UZ4A 3B4YA 3S4TA 3UCQA 5JBDA 2OGJA 2QJNA 2YLLA 1DWHM 2FZBA 3CQHA 4GY0A 2I5IA 4AYGA 3SUTA 4C5ZA 3KTXA 1ZTVA 3UG5A 4GQGA 4J40A 3R8HA 4F48A 2VL4A 2RDUA 4UNKA 2XM2<