1Q13A

Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
322
structure length
322
Chain Sequence
DPKFQRVALSDGHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKREDIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALKPGVEIIPTDEHGKAIFDTVDICATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWVDQSAPVLLEDPLIGALAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNFRYVTADFAIGHPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Prostaglandin-E2 9-reductase
publication title Loop relaxation, a mechanism that explains the reduced specificity of rabbit 20alpha-hydroxysteroid dehydrogenase, a member of the aldo-keto reductase superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 114
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.149: 20-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1q13A00
4XZLX 4PRRA 1EL3A 1HQTA 1AH3A 5LIXX 2PDGA 5LIUX 1AH4A 4R9OA 4LBRA 4WDWA 1SM9A 3B3DA 4H7CA 3V35A 4L1XA 1MI3A 4YS1A 4H8NA 2DV0A 2IS7A 4GABA 3R43A 3V0UA 3LQGA 4IGSA 3LEPA 4XAPA 4JQ3A 3GHRA 1X97A 2QXWA 3P2VA 4QBXA 4GACA 3LQLA 4GA8A 2ACUA 1EKOA 4HBKA 1AZ2A 2FZDA 3R8HA 4JTRA 4XVDA 4FZIA 3R8GA 2IQDA 1PYFA 3GHTA 1K8CA 4DBWA 3O0KA 1AZ1A 5JH1A 3V0TA 3ERPA 4LBSA 4JTAA 3UZWA 4F40A 2PDLA 3EB3A 4XVEA 1PWMA 3NTYA 2IPJA 4IJRA 1X96A 4AUBA 2C91A 3LZ3A 3DOPA 2IPWA 3GUGA 3MB9A 3G5EA 4XZIA 1RY0A 2R24A 1RY8A 3H4GA 3O3RA 4YU1A 3UZYA 3V36A 4RPQA 1AH0A 4DBUA 4JIRA 1XGDA 2ALRA 2BP1A 4PUUA 4JQ2A 3LD5A 1XF0A 2PFHA 3GHSA 3R6IA 2NVDA 4PUWA 3CAQA 3RX2A 2PDPA 2PDQA 3CASA 1HW6A 4FALA 1PWLA 2F38A 1MZRA 1PZ0A 2PDMA 4PMJA 3M4HA 3BUVA 3R58A 4WEVX 4JIIX 4GQGA 3N2TA 5HNUA 4WDUA 3BV7A 4JTCA 2FGBA 3R7MA 3KRBA 2AGTA 4WRHA 5AZ0A 2J8TA 1X98A 1EF3A 1T41A 4JQAA 4XO7A 5HA7A 1Q13A 2R9RA 4DZ5A 1Z89A 2ISFA 1OG6A 4XK2A 3FJNA 3Q65A 2DUZA 2IKHA 2PD9A 1S2AA 4OTKA 4JQ4A 1ADSA 2PDNA 4JTDA 2INEA 3D3FA 2PF8A 4LAUA 3LBOA 1QRQA 3CV6A 3Q67A 4I5XA 1Z8AA 2HE5A 3V0SA 3N6QA 2FZ9A 3DN5A 2FVLA 2I16A 1US0A 4QX4A 1C9WA 1VP5A 3LENA 4PR4A 1A80A 1UR3M 2F2KA 2PDBA 4WGHA 1FRBA 3CMFA 5HNTA 4FA3A 1RALA 3LNMA 1J96A 3ONCA 3MC5A 4XZMX 4WDXA 2HDJA 2HVOA 3UFYA 1JEZA 5LIYX 4YVPA 2HEJA 4PRTA 2PDUA 3WCZA 4JQ1A 1YNPA 2WZMA 1MRQA 4EXBA 2FZBA 3FX4A 4G5DA 2PDYA 4NKCA 4QR6A 1ZSXA 2HVNA 2PDWA 4YVVA 2PDFA 1R38A 1LWIA 3QKZA 2INZA 3ONBA 3R94A 2PDJA 3CAVA 4GCAA 2HE8A 4LAZA 1QWKA 3RX4A 5M2FX 3H7UA 1S1RA 2PDIA 4XZHA 3WBYA 2PD5A 1ZQ5A 3F7JA 5DANA 3U2CA 2FZ8A 3LUTA 4JTQA 2A79A 1YE6A 2BGQA 2HV5A 2BGSA 3UG8A 2IKJA 1ZGDA 4HMNA 2ACSA 3UP8A 3EAUA 2PDHA 4LB4A 2ACQA 3WBXA 1T40A 2DUXA 3EB4A 3C3UA 5LIKX 2I17A 3UZZA 5JH2A 3T42A 1M9HA 2PEVA 4L1WA 3BCJA 3UGRA 3COTA 1Z9AA 2PZNA 4JIHA 1S1PA 4WDTA 3UWEA 3M64A 4EXAA 4GQ0A 3H7RA 3UYIA 3GHUA 3WG6A 5C7HA 3LN3A 2ACRA 4IJCA 1PZ1A 2VDGA 3LZ5A 2CLPA 1EXBA 2PDKA 3M0IA 4DBSA 2IPGA 4GIEA 4QXIA 1VBJA 1ZUAX 2WZTA 4YVXA 2PDXA 3BURA 1Q5MA 1LQAA 2PDCA 1XJBA 3VXGA 3UZXA 2IPFA 4XO6A 2IKGA 3S3GA 2IKIA 2IQ0A 1YE4A 3G1RA 2P5NA 4ASTA 4MHBA 5KETA 1AFSA 1S2CA 4Q3MA 1GVEA 1IHIA 4XZNX 4ZFCA 4LB3A 1IEIA 2NVCA 4Q7BA 4FAMA 3CV7A 3RX3A 1YNQA 5AZ1A 3WBWA 1Z3NA 4ICCX 5LIWX
chains in the Genus database with same CATH superfamily
3W2UA 2FHCA 2VCAA 2YXGA 4HQVA 1P6CA 3VNYA 3HV9A 2ZUSA 4NI3A 2NVAA 4WDWA 4DWSC 4GY7A 2BVDA 1OHLA 5JBEA 1E70M 5DCBA 1YDYA 3WF1A 3ZXWA 1DL3A 2EKGA 5A6MA 5AHFA 2PRLA 3BW4A 2YSWA 5C9XA 3M1ZA 3T2QA 1CZ1A 1M41A 3MUY1 2A7PA 5H8MA 3LCIA 5BRQA 4PULA 3B8TA 4US5D 1JD7A 4LS1A 2DVUA 2J75A 2KAUC 2XH7A 1VCGA 3ICJA 3QY6A 1J2WA 1C90A 1XFBA 2DZSA 4AZCB 1KV5A 4JZ5A 1TPFA 5DY2A 3UY7A 1Q63A 2OXNA 3V4BA 2GQAA 1HJQA 5D02A 1CYGA 3EB3A 2VDHA 3WL0A 5CZ0A 3W26A 1QHOA 3LM3A 4PMNA 4LVDA 3LM7A 4AZ5A 2E8ZA 1SSGA 1VJIA 2Y7FA 3MI2A 1JGIA 1XG3A 3CQKA 1MQPA 1UCWA 4JN8A 3EWZA 3U2EA 1TO3A 3KBMA 4GJ1A 3ABRA 5FSDC 3UZYA 3V36A 1GKPA 4ZR8A 3KS6A 1QVBA 2P1FA 3BXWA 1FH9A 5FEWA 3L4WA 2HJPA 4DB7A 2TYSA 3DDMA 3FHQA 4TX9A 4UQAA 3VMOA 5HMSA 4DO6A 2WMFA 1RBLA 2ZXBA 5LYRA 2PDQA 2Z27A 1XCWA 1F61A 3HGSA 4PE8A 1X8CA 3EOOA 1PDYA 3FN9A 4Q4RA 3AXXA 3WEOA 3VM7A 3HFYA 3M0XA 5HNUA 1WKDA 2WSRA 5TBOA 4CD4A 3JZEA 3WLQA 4DF0A 1KRMA 2WO5A 2VFIA 5E0CA 2VGGA 3RMJA 5ECVA 3W76A 1B2YA 4GGHA 4L1GA 3PTDA 5DXYA 4X9SA 3VKBA 1V7AA 1TV2A 3ZSTA 3MA8A 4F48A 1OIFA 2EO7A 2QCCA 1QI5A 4F2BA 4GUHA 1C9DA 3G22A 2ANUA 1JRCA 3EA1A 3MVTA 4D8ZA 1TSIA 4IF2A 3AAMA 2YL9A 2YL5A 1BKSA 2ZA3A 3GU1A 3NOEA 3VIPA 2J78A 4Y9NA 3G1DA 1OY0A 2HE5A 3VX0A 1QDSA 1PIFA 3IJIA 3WF0A 2CKSA 1JPIA 7PTDA 1Q6LA 3EKGA 1VD6A 4C6QA 4WSHA 4YL2A 1W1ZA 3I4EA 1UPPA 2Y1HA 3PR2A 2WNNA 4CQ9A 4IIBA 4PR4A 4TTGA 3KCOA 4MPQA 2FPVA 3H12A 4CD5A 3KS5A 3JS3A 3IGXA 4C65A 4Y9AA 4NY2A 3VE9A 1K70A 1UD4A 3JU2A 1IGWA 1FH8A 1CENA 1BEUA 2OGJA 2WXDM 4AFYA 4W7WA 4JX5A 1X38A 3QMTA 3W07A 1LUCA 1V7YA 4IP4A 3RF9A 1SW0A 4TX6A 1XSJA 1EO5A 1N7KA 1QWGA 2D3NA 4JHZA 3W7IA 2DVXA 1C8QA 2E5BA 1UZ1A 3N04A 5EY5A 1Q45A 1WAUA 4H9VA 4RDVA 2BY0A 3TCSA 3OPSA 1GOOA 1XIGA 1E9ZB 5EFDA 1CDGA 1WZAA 1S5TA 1KW1A 1VAHA 3O6YX 4DIAA 1QWKA 3GB6A 1KQZA 2XIQA 4IG2B 1JZ2A 4GH3A 3BSMA 4JNZA 3WBYA 2V82A 1PCWA 4GXWA 4B2DD 4NU7A 3RILA 4RNHA 4DO4A 1N8FA 2GJLA 4JTQA 1DIDA 5F4WA 4CNOA 1SR9A 5EMUA 3TN4A 2V5LA 3SJ3A 1V3JA 1TIMA 3VOIA 4HMNA 4I5RA 3SN1A 3MSGA 1U83A 2XPKA 3PG8A 3WELA 1EJWC 1HJXA 4BEQA 2VFDA 2OG9A 2E28A 4MY8A 1V6YA 2PPGA 3AMGA 1THFD 3L4UA 4DO7A 1EDQA 1C93A 4EKJA 4FNRA 2NXGA 5F2IA 1XH0A 2C19A 5C7HA 2Z2AA 4C6JA 2QGYA 4MWAB 3WDQA 4IJCA 2CWNA 3OQ8A 1Q2SA 4WOQA 3PWGA 2XFFA 1XYBA 4RK8A 3EDJA 1L6YA 2KZHA 1ZUAX 3KHDA 3WK3A 2AMGA 2OKOA 1LLOA 4F79A 4DUVA 1JGMA 2IPFA 3ABXA 4F0RA 1IE7C 1VFFA 5HK4A 4AZ7A 4LWWA 1UB3A 3I4KA 1IR2A 1R86A 2D0FA 7REQB 1DTNA 1WDSA 5CPLA 1WDRA 1DQUA 4ADUA 2WHJA 1TB3A 3GNOA 3OGRA 2OSWA 3TSBA 5D05A 3WEMA 3B04A 1XQLA 2W4XA 3G1HA 1NFGA 4GFSA 5GQBA 3IJ7A 3VIHA 2SFPA 4HU4A 5JIPA 4MMWA 4QM1A 4UQDA 3UU0A 4M6QA 3VVGA 5FEZA 1OGBA 5CPOA 4YJ5A 1UUOA 3CV1A 2FPYA 3FNDA 3KW3A 4ICCX 2WOQA 3G3MA 3GC4A 1TMLA 3LGEA 4GO9A 1BVNP 1K1DA 1XLGA 4CN1A 1TVLA 5LIXX 4QROA 2GK1B 3DHPA 3ID7A 3GXIA 4IUOA 2YYTA 1TPH1 2J7HA 2L5HA 2G4FA 4Q8VA 3BVJA 4BF9A 3WQDA 3VGBA 5EKYA 3POHA 3TYZA 4ZQCA 2HXTA 5J5DA 5FJOA 2E09A 5D37A 4L4OA 3TJIA 3W27A 5L6UA 2FGZA 3V5FA 2XIMA 3B06A 4FNSA 5G4EA 5EMMA 5PTDA 2BOEX 1S38A 4FHAA 4ZZ9A 4IIGA 3VINA 2BHZA 3BTNA 5DRCA 2ODOA 3IJLA 1EA0A 4F9DA 3V0TA 4ALDA 3UBPC 3AIBA 4Q8QA 3OIXA 2VEGA 3PZOA 1UD2A 1QI2A 5A95A 1XIDA 3E3HA 2G3JA 2WSKA 3C2RA 1E1EA 4ERAA 6XIAA 2RDUA 1T8XA 1F5ZA 3WX7A 4IHCA 4JL1A 4ADSA 2D2JA 1X1ZA 4GVFA 3G5EA 3H54A 4C6IA 3H4GA 4GYPC 3GVQA 3FV9A 1LORA 3ITYA 4RZ5A 3WLLA 1XPYA 2BP1A 3TYDA 3THQA 1J18A 4PZVA 4RUBA 4B5NA 2ZDSA 4ZXLA 1UD8A 4WX2A 1NOUA 4UQBA 5IFTA 1G7UA 1JZ6A 3NUKA 2W6RA 1H7WA 3T6CA 4QISA 2BVWA 2WHLA 1NQ6A 3LCLA 2HZGA 1BTMA 1MZRA 3W7GA 2AAMA 1XYFA 4PMJA 4F66A 4XISA 3S46A 1TPB1 3UESA 1KWGA 4E3VA 4GQGA 1E0VA 3WMCA 1LOSA 4S3AA 3QXBA 5DF0A 5K4ZA 1QNSA 5D9MA 4DVOA 4J3ZA 2UY3A 4K8GA 3EEGA 3I7SA 1HJSA 4HJFA 4NJJA 4NJGA 5AC7A 3WLIA 3KFTA 5HA7A 4XK2A 3BQ5A 4D8LA 1TJ1A 1E6NA 2HS6A 4ROQA 4DJED 4HSNA 3AYTA 4FO4A 4YHEA 1KM2A 1BYBA 2PI6A 1V6VA 3WQ4A 2A6LA 3MVIA 5DBUA 2PDNA 5LNRA 3UCCA 4JTDA 3TYBA 2UY5A 1A4MA 3K8LA 4PMUA 4WF7A 1EA9C 3V16A 1RK5A 2OB3A 1D2KA 1JR1A 4RZ6A 3W73A 3PJUA 3MU7A 1R87A 2YBVA 3QR1A 3GQYA 1UR3M 2OSYA 3ABOA 4RX0A 4IZGA 4B3KA 5HNTA 1VFHA 3M0MA 3NQEA 1M3UA 3IK2A 4JAWA 3DZ1A 4RDYA 3MV11 3PN8A 9CGTA 1OSEA 3TAKA 2DZPA 3EGJA 3U3HA 2WKGA 3HFTA 1AODA 2V81A 4F2UA 5C9UA 1GOWA 2W79A 3I3BA 2J7BA 3KCLA 5KZ6A 1YBQA 4LY8A 1OZMA 2DZXA 4M56A 4I7WA 2R94A 3O1NA 1JPDX 1QNRA 4F9JA 2OQHA 2QUVA 3W01A 4Y6GA 3MO7A 1IEQA 1MNZA 3T0DA 3EX3A 1LM1A 4KS0A 1W9BM 2GOUA 2IXUA 3DHUA 4DXVA 3BJSA 4H9XA 3G6MA 2W3ZA 3A47A 3LMYA 1J01A 1P1XA 2NX1A 5A8GA 4ML9A 3RCMA 3RO6A 5ABGA 4MFEA 3BC9A 4DN1A 3GVGA 1RBOB 3E2SA 2PWEA 4AF0B 2PB1A 3G1SA 3OO2A 2QJNA 4RXGA 3CZKA 5I03A 3QOMA 4A22A 1IXQA 1YXYA 3PZUA 4RE2A 2Q8LA 1QK0A 3S47A 3KVMA 3UZZA 4IISA 3ES8A 5CG7A 4N4PA 1Z9AA 1J5TA 1KB3A 5AC6A 3UR7A 1J0JA 1E15A 1UWSA 3CL8A 3TUUA 2JIEA 4DZHA 2V2DA 4IPJA 4H2HA 3BV4A 3WH5A 3GLCA 4FX8A 1G1YA 2HCVA 3BLPX 2V9DA 2FTYA 3LCHA 5E9AA 1QTWA 3DCPA 4CNUA 5KZMA 2I5IA 3QEZA 4HHHA 2GJXB 4AD4A 2J7FA 3TC7A 2XN0A 3VDGA 2GWNA 5IDZA 1J12A 3RLVA 5FKYA 4MIMA 2PDCA 3TN3A 2W61A 1PYMA 1OYAA 1ONXA 4PL1A 4PYSA 1QT1A 4ZO8A 3W7RA 4LJ3A 4TX8A 1EIXA 2IKIA 1S5NA 4AWUA 4HMEA 5CZJA 5HUPA 3EWYA 3OHIA 3KTXA 1XS2A 1YE4A 4GY1A 3QVQA 5KZDA 5CSSA 3HF3A 1E73M 1KFJA 4JYFA 1ICQA 1N8IA 5CZTA 1FP8A 2Q8ZA 3W53A 1L6WA 3E0VA 3TSMA 1GNXA 2O4MA 2UV8G 4FAMA 5H8UA 5CZSA 1JAKA 1DJYA 3HG3A 1OF6A 2VWSA 5CLWA 5FJTA 3HPFA 3VX1A 5BU9A 3K4WA 3CUIA 4XZLX 1E4NA 4IFKA 5I6SA 3CHFA 5CQ1A 1FWJC 2BS9A 1R2SA 4UMAA 5F2GA 1RSCA 4Q8PA 4GQBA 3BANA 4FOUA 3IJ8A 1RJRA 4M7SA 1BRLB 3SRKA 3CTLA 1DIKA 3NZGA 1EDGA 2A3BA 1UR8A 1RH9A 4HT3A 4P7NA 4E4PA 1DEDA 5HR6A 3XINA 1TELA 4Z1AA 3IARA 1FWEC 1M1BA 5G1MA 2W92A 1FWDC 3G2GA 2OZ0A 4PTWA 4JQ3A 2ZZ6A 1WX0A 4LBUA 3L4XA 3C3NA 3RU6A 4M8UA 5XIAA 3I3DA 3O2LA 2ACUA 1V03A 4XZ9A 3A4JA 4OHQA 1FBAA 3MMDA 1R2TA 1JCNA 1FY6A 1WA3A 1KXVA 4GK8A 1KCZA 5JH1A 1FWCC 5E5CA 3NSMA 2VEKA 4PTMA 3E2RA 4HMDA 3MKKA 4B4HA 1FDJA 2YLAA 4HNLA 1MWOA 2CHOA 2FGLA 3UZWA 2WKJA 4UTWC 1TG7A 4ES4A 4W86A 3MZ2A 1VH7A 4LUTA 4AIUA 3MYPA 2YJQA 4AIOA 2YFOA 1AUSL 3CEUA 3VUSA 3NZ1A 4KWOA 3O9NA 1B1YA 3M9YA 4QG9A 2E1WA 1D7FA 3W1UA 1HP4A 4CEXC 3VE7A 3IVUA 2I5GA 3R0KA 4MJZA 4US6A 1REQB 2OFJA 1ISVA 4QP0A 3UEQA 6PTDA 3GW3A 2ALRA 1W8GA 3J7HA 1IWBA 4PUDA 4Q4SA 5D03A 3DI1A 4C6KA 2GSJA 4Z42C 3GZ3A 5FF7A 1KNWA 3F4NA 1XBXA 1EYWA 2WMGA 3R10A 4KCWA 1C8XA 3WQPA 4DO5A 3WF2A 4UZUA 5H2ZA 4OECA 5MHBA 2R1LA 3WH9A 3V1HA 3WUFA 4HU0A 4GX9A 2J79A 4BCEA 5G2WA 1EGVA 5FJJA 2A6NA 2PAJA 1EF3A 3OW1A 3MWCA 1TFVA 3SSZA 2B0MA 1B5TA 1GKRA 1RD5A 4IX2A 4UFKA 5BMXA 3CAKA 4NZ5A 3M41A 1IXNA 3KWSA 2P88A 1B4EA 2DSZA 3AC0A 4P7LA 4QS5A 4KH2A 1M7PA 1SJAA 3KRSA 1BPLB 3WD1A 1JF5A 5AYIA 2QV4A 1MDRA 3DC0A 1RR2A 2WV8A 3HGOA 1A5UA 1Z8AA 5D4YA 3MCNA 3RCNA 3RXZA 2ZUVA 3DERA 3TSDA 4O50A 4LH8A 2XFYA 4WJ8A 3IIXA 3PP7A 3ARSA 1H1ZA 1WOAA 4PEKA 1K9DA 1VFSA 3C2VA 2RDWA 4TMBA 2B7OA 5E0KA 2V63A 3PK7A 3KTCA 3B9OA 5T8GA 3LNMA 5FESA 3EOEA 4GUGA 1AJ2A 2Y7GA 4HPXA 1DTUA 2VFHA 4B9ZA 3GTIA 3VOHA 5FL0A 1OX5A 4JTHA 5BNKA 4A3QA 2QLYA 3S5YA 4UTMA 4HPNA 2ICSA 3JUGA 1ZJAA 5F4SA 3GE7A 2E67A 4C1LA 1WP6A 1QOPA 3LCFA 1Q8AA 5AC4A 1IEXA 4QR6A 3P93A 5E09A 4HYRA 1J2BA 2VFGA 2D1ZA 3KX6A 3THCA 1GJUA 1IV8A 1PL9A 4N42A 1R3WA 1OT2A 2BLEA 3CAVA 3LRLA 2XZ7A 3CHCA 3M44A 2NXHA 2WVVB 3ZR5A 2ISWA 1W3NA 4FI4A 3RX4A 5M2FX 1IYXA 3DYMA 4DJDA 1SJCA 2V3EA 4XUYA 1DV7A 5TNVA 1R3RA 4O57A 5DANA 3UPWA 4K1WA 3H55A 3WJSA 2XWEA 2MNRA 1UA7A 3SM0A 1JZ5A 2XIJA 3EXTA 1K8YA 3UG8A 2QCDB 5D8WA 3SW6A 4RXFA 1J0KA 4URIA 2E68A 4PMOA 5A6TC 3MP3A 3NO1A 2ZX7A 3E02A 1XSKA 4IGHA 2ZRVA 1XUZA 4CGTA 3E2QA 4XKMA 2AGKA 5BW6A 4JIHA 2W62A 4QE4A 1EJRC 4L4MA 4PH6A 4B92A 5DLCA 1OYCA 4Q8UA 4NSBA 5JQ9A 2OKTA 2Z25A 3NO5A 3DFNA 3I6EA 1NDWA 1QATA 3N18A 4EF9A 3EOSA 4N7QA 4LVFA 1KR1A 1EXBA 3GZAA 1QI0A 3TOPA 3DYOA 4J3XA 2IPGA 1EIBA 3IRSA 4DI8A 2QIIA 2VI0A 5I07A 2OEKA 1SFTA 1F6PA 2J8GA 2JF6A 3ZT7A 3WBEA 1HL2A 3HPSA 4KFPA 3S9IA 4JY9A 2W0UA 3B0VC 4XO6A 1H7PA 4WJXA 4LX4A 1H7XA 2QCGA 1OX6A 1KM0A 2JFEX 2NSXA 4HJWA 2V68A 4YMZA 1AFSA 1EX1A 1K9EA 2ISSA 4EIVA 4I3GA 5M1TA 3H23A 2P0IA 1J8VA 1DWJM 1TTQA 1FWWA 1ZU8A 2CLKA 4QLLA 1O66A 1GVIA 2VC9A 1W2PA 3CNYA 2ZZ1A 4MM1A 5DCEA 3GDTA 3VGEA 2BY3A 2BMBA 1M7XA 1G94A 2PCEA 1NU5A 2WCAA 3WENA 1GOXA 2QCNA 1XYCA 2VGIA 3SCOA 3GAYA 4GNVA 2WBGA 3FDGA 3AIQA 1BF6A 1ODZA 4YWSA 2BXVA 1XGEA 2PTWA 5G2HA 3AYVA 8XIAA 4YS1A 2DSWA 4DJFA 1A5OC 1J6PA 1XP3A 3DFSA 3ZQ9A 3V18A 3F4WA 1NWRA 4Q33A 1WNOA 4INFA 3A9BA 2G3NA 4C6OA 4JEQA 3TQ0A 1Y65A 3HQNA 4UTTA 3DFHA 5I2UA 1FX6A 2EGZA 4F3HA 1KM1A 1V0LA 3QYQA 2GQ8A 1PYFA 4ZTYA 4RLIA 1PAMA 1I0BA 4OUIA 4JNMA 3MANA 3W7PA 5M03A 3NDZA 3VNDA 1WKFA 3C2EA 2DSUA 4JFWA 2CNCA 2NT1A 5DQPA 1T8QA 1P0BA 4I7VA 4ATLA 2DT0A 3EBVA 4IJRA 3WMSA 1EJSC 2NLIA 4QG8A 4KEUA 1X96A 1FWBC 5C55A 4W5UA 1GCYA 4XKYB 4KGJA 5LXXA 1ZHAA 3PWIA 2E6AA 4YNGA 3D47A 3G6LA 2AL2A 4XSLA 2JGQA 5IFPA 3B9AA 3WDHA 4W8BA 4DUXA 2R1MA 1ENUA 4JR5A 3GR8A 1XKYA 4PODA 4AZCA 4JKKA 4WY0B 1EJUC 3N9SA 5HQMA 3OLDA 1O4UA 1CLXA 1UR4A 2EJAA 3W0KA 3TR2A 4ZOCA 2VO5A 2VURA 3R2GA 2FJUB 3BLFA 1UZ4A 4YTUA 1HW6A 3P82A 2A0NA 1ZFJA 3LLDA 3OVQA 2E9BA 3PPHA 2NUWA 2Y24A 2H6RA 1JNEA 5TF0A 4M0XA 3BW2A 3TMQA 3VCCA 3WLMA 4E8CA 3N2OA 1JCYA 4E3TA 2WM0A 5DY3A 4B90A 4KCUA 3W1TA 1RP9A 5REQB 4KERA 4D2JA 3UR2A 2C14A 2WMIA 4LGXA 3N2XA 2ZZ7A 3PF3A 3C2OA 5FJIA 3UWYA 2PLMA 3TJLA 2GDQA 3TROA 1BAGA 1JRBA 2OMAA 5A8QA 4PB4A 2F8QA 1WXZA 2OR2A 4PGLA 2J4GA 3GD6A 4L56A 4EACA 5GJNA 3D3FA 2C1IA 2ZA1A 1B4KA 1M03A 1TJ2A 4FNTA 4LAUA 3SZ8A 8A3HA 1KTNA 1EC7A 3CV6A 1O5KA 4GNJA 2Y5EA 5LSMA 3N6QA 4ZB2A 2QPXA 3VI2A 3TW9A 4PEEA 3LHUA 2YR1A 3GDMA 4MG4A 1T7LA 4AZHA 3IS4A 2GVYA 1E4LA 3A13A 1HO1A 3WIJA 3MSDA 4X9YA 3PFRA 2HDJA 4O1DA 5I06A 5DFAA 1QO5A 2E9MA 2CLEA 3W7EA 1XDMA 2BVYA 5BXRA 1PDZA 1BYCA 1Z7AA 1M68A 1TE6A 5BYWA 4MSSA 1OCJA 4K8HA 4H8HA 4Z2KA 3CL6A 2JK2A 5AN7A 2QS8A 3UZ5A 4JTTA 5LNWA 4Z08A 1Q6QA 1QK2A 4D1IA 4NKCA 2QNEA 1W1YA 3QKEA 4AY1A 3H22A 2PDWA 3CLMA 4AY7A 4X2PA 4O19A 2XVGA 3DFTA 4UNKA 3A6OA 4EOUA 1R30A 2PDJA 2C3ZA 3ALFA 3S2JA 5I77A 3EDDA 1S1RA 3EA2A 3GC5A 4JGDA 1KKOA 1UKTA 4LC6A 4O4VA 4GQQA 5I3GA 4DWDA 3SCVA 4OFCA 3KZPA 4A21A 5A8NA 5CPNA 1W1VA 4R27A 4GPNA 3TN6A 3EAUA 4G7FA 3WBXA 3BZGA 1WDDA 5A6SA 5K7JA 2DIEA 4MKSA 4YCOA 4JFTA 5JH2A 3MHGA 3T42A 1M9HA 3RHGA 5C0QA 3EWDA 4RV8A 2X1UA 3DC8A 3DKJA 4U2YA 1I8JA 1EUAA 3W28A 2P8BA 2ONEA 4MFDA 4IG2A 4LVGA 4WSJA 1A0DA 3WH8A 4FSAA 4H6QA 3NEHA 1FQ0A 1IT8A 1M6JA 2GGHA 5AHNA 2ZDRA 3QZAA 2UY4A 3M0HA 1JNDA 1TV4A 3LI1A 3MQTA 2Z0IA 3QR3A 4I9MA 4FXSA 3IGUA 2ZUUA 4CN4A 3NEVA 1RBAA 4NYYA 3S5OA 4LRTA 3GG8A 2UY2A 3LHTA 4J3UA 4AMCA 1VFUA 3EPNA 4HN8A 3N9RA 1LT8A 1W91A 4PMXA 3VILA 4DUWA 1OEPA 2ZXAA 3VKCA 2A3CA 1FKWA 1ML1A 2XM1A 4PUEA 4JEJA 2ZE3A 1NFPA 4CKQA 3PANA 4FLRA 1I0DA 4MWAA 3T7VA 4KT2A 4TR9A 1DHPA 1PIGA 1PX4A 3DUGA 3BDKA 3GW0A 5C70A 5CSYA 1TPC1 2J6XA 1G69A 4YXGA 4LS0A 4C60A 3L21A 4ERIA 5CPSA 4ZBCA 1PX3A 1EHNA 3L7RA 1D3HA 1RVGA 6XIMA 2VENA 3UWUA 4DJDC 1EL3A 5CPMA 3GXMA 4J3TA 3W81A 3TEVA 2W9MA 3WUGA 3U5UA 2Y88A 4R9OA 3MP5A 3NL6A 5IXEA 2Z29A 4H9TA 3KLLA 1GVQA 2C16A 4UNLA 1X6LA 3V35A 2CBUA 3TXZA 7REQA 4GZEA 3MY9A 5CC6A 1A53A 2PWVA 3OBEA 2IS7A 5D2YA 1UMYA 2BNJA 3KOFA 3GNXA 1OBAA 3EOLA 4FX7A 1LG1A 4GY0A 3U5YA 1NWTA 3R0UA 2E4TA 2HNHA 3NJ3A 4YN5A 5D2VA 3PC0A 2XDFA 4QDPA 2OT0A 3W87A 4GIYA 3NSXA 1WE5A 1TPDA 3FIGA 3ARQA 3RR4A 3FDKA 1BGGA 3CZLA 3R8HA 1DBTA 1BSIA 2GK1A 4Y9MA 1ZS2A 2VX5A 1ITXA 1DWIM 3FYPA 1UUQA 6TAAA 1QCWA 1V79A 2ZICA 2X41A 4Y8FA 1EQPA 4WLCA 3VD9A 4H8VA 1PWMA 1S46A 2Z7GA 2CLHA 3VNLA 2NV1A 3KOYA 4ZOAA 1AG1O 1MXGA 3TONA 3UVAA 3GM8A 4HHPA 3BO9A 3W1MA 3B9EA 1R9ZA 4OOZA 1MYRA 1P43A 2PLCA 4Z2GA 1VYPX 2R24A 5A6AA 3DI0A 5BRPA 1PKNA 4YU1A 4IP7A 3GS6A 3WD2A 4JN7A 4JFSA 2YIHA 1UD3A 3VD7A 5C2XA 3WYZA 4J27A 5BROA 1A47A 1WYIA 2ZC8A 4XV0A 2D20A 3MI6A 3VDHA 1ELSA 3LSCA 1RJPA 3GIQA 1MZHA 1K4GA 4V27A 1RK6A 2WQDA 3EMZA 3GU9A 3S42A 5GJPA 3SEPA 5CJMA 1LBMA 4JY8A 2CHRA 2QUTA 3CXOA 2Y89A 4EE9A 5I02A 3RAOA 3IV3A 2YOCA 4DJEC 3W29A 1JD9A 4QQUA 4TQTA 1TV5A 1PPIA 3BMXA 2AGTA 4R7OA 4JHMA 5D2TA 1UD6A 1E9LA 4E8GA 4O10A 4RL3A 2EG6A 1FVPA 1PJ9A 3EWCA 1T99A 4W87A 3K1GA 5F7UA 3SURA 5F2LA 2ISFA 2WHKA 2R8WA 4K8EA 3GKAA 1QPOA 3QC0A 3WMLA 2VGBA 4PBEA 2OELA 2PD9A 1S2AA 2CETA 4UTTC 2VWTA 1RA0A 2VJXA 1HKKA 1DQWA 3FGCB 5C9WA 1GEHA 1ZCOA 1VLWA 1F3TA 3W75A 2OODA 1CXFA 2XSXA 3LGGA 3KBWA 4XG1A 4D8AA 1IZJA 1US0A 1LBLA 3W25A 4IQJA 3ENLA 3NZRA 4A29A 4CNNA 1Y8BA 3OYZA 1LRQA 5K9CA 3GNDA 4D72A 8XIMA 1PHQA 1BQGA 4O15A 1PV8A 5LXEA 4C90A 6REQB 1UWIA 5B7YA 3GRIA 4GINA 1EQCA 3H2NA 2DDXA 3PZVA 3VUPA 3MT1A 5FOOA 3FSTA 2X0HA 2WSQA 3QFEA 2J7EA 5D09A 2VMFA 4K36A 1H63A 4E2BA 4ZO7A 4MJMA 1WV2A 2DSVA 4XAFA 2HROA 1O60A 1G4PA 4W85A 5HMDA 1OGSA 4PMDA 2OCZA 2XTKA 3STEA 1W6TA 4AVNA 4F0KA 3TVAA 4E2OA 3UGVA 5EPDA 2R14A 3OTRA 3CT7A 3R1ZA 1US3A 4A35A 4D6HA 1VJZA 1JL8A 2FZ8A 3VNJA 4GNKB 3EX1A 2WNQA 2PWDA 4QJ1A 1VJSA 3EX6A 3W7MA 3SRHA 4E6MA 4WKHA 1A5BA 2QVNA 4MPKA 4S23A 3SGUA 4CCDA 1KM6A 4R33A 4L6OA 1SO3A 2AL1A 3EB4A 1FA2A 2GFTA 3BH4A 4F2TA 1SFJA 3FKKA 5E6YA 1RP8A 1XRVA 3NQFA 3LMZA 2FIQA 4EWND 1FWIC 4LV4A 3IEBA 3SUUA 1EWEA 1W31A 5LKYA 2ADAA 4W89A 2G4JA 4JD4A 2O7QA 2Y8UA 3VOFA 3GG7A 4AF0A 1UJPA 4C6BA 2C6QA 4I6KA 4LEQA 4KEVA 1ZAIA 3PBWA 3MV01 2DT3A 3QV6A 2V5DA 1F8IA 1GONA 1VB9A 1ZALA 4LALA 4K38A 2PDXA 3UWZA 4Y7EA 1IR1A 4D9PA 4Q4KA 4TVCA 2ZVRA 1P0EA 5CJNA 3NXFA 2VR2A 4WGXA 3S3GA 1TPVA 1KCLA 2YA2A 4S2BA 2FYMA 3G1RA 1LZOA 4MNMA 4XBKA 5HATA 3VDCA 1IHIA 4ZFCA 5RUBA 2OTDA 2QDDA 3LI0A 4LB3A 3SECA 2J25A 4AXNA 2D0HA 5T26A 1U22A 3C86A 2WMKA 3MTWA 4MB3A 2VNCA 4Z2JA 1W9VA 1AQMA 1GHRA 3CV7A 4Q8OA 3WBAA 2GJXA 1KTBA 4L80A 3TZNA 4K39A 3W1AA 3TQPA 4W7UA 3VFLA 3G77A 4GKLA 2FB3A 1AH3A 1R3TA 1U2YA 3ZT6A 3WD3A 3APGA 3T78A 3WLSA 1U1UA 3I6RA 3FCPA 3OQEA 3TK7A 4QQ3A 2XN2A 1XIHA 3B3DA 2HK1A 3P14A 4MKNA 3ORWA 4AIEA 2YBUA 1R2RA 3QR0A 1NWUA 4ZOBA 2VRKA 2YPIA 4OV9A 4OBRA 5D04C 4GMEA 1VFTA 4XAPA 4AX6A 4J2MA 3OG3A 3F4CA 1KGUA 5A6LA 4CD8A 1Q85A 4ZSTA 3SIZA 4DI9A 1H7OA 3PAJA 5D9PA 1RA5A 3G1AA 4OVXA 3TW7A 2F7FA 3RITA 3B9DA 3PJWA 3UJFA 1H0IA 1BYDA 4OWGA 4GISA 1BRLA 1JCTA 4IPNB 1CTNA 5LA0A 1PTAA 2V3GA 4LBSA 3WLPA 4QE1A 9XIAA 2ZRXA 3VU2A 1DXFA 3SCNA 3PUGA 1UWRA 5ABHA 4RE4A 1W5QA 1UASA 3PNUA 1EPVA 2NSOA 2ZUMA 4XAGA 1HTIA 3K1DA 3RPMA 1TRIA 2IPWA 3G0XA 3BLIA 2FH8A 1KLZA 2QR6A 1E4MM 3THAA 1AW1A 4LQ1A 1F76A 4H9MA 4ILSA 2Z2BA 1WKYA 3MMWA 3CIXA 5AOUA 2XH4A 3NGFA 4N6EA 2C18A 1E71M 4UTHA 3L4VA 4JQ2A 3RDKA 1C8YA 3ZJ6A 4N6FA 2VX4A 1EOKA 1VBGA 3RX2A 2PURA 3ZVHB 3O05A 1PS9A 4E38A 3SCSA 3E0LA 4WXYA 3GDRA 4RCXA 1PZ0A 1VBRA 5A6JA 1TJRA 3E12A 4KBXA 3CMGA 2V0TA 4Y90A 3VDBA 4JIIX 3OGVA 3AMLA 3OGSA 2KX9A 3THDA 1CPUA 3KRBA 2VM8A 5DX7A 3QFWA 2YFNA 3KTSA 3CL7A 1REQA 1CEOA 3AQUA 4IP5A 3HG5A 4M1RA 3PZTA 3QYSA 5IM51 2TPSA 1H5YA 1JDAA 2WKLA 4QSHA 4IMGA 1OINA 3ZSSA 1JG9A 4GWEA 1D9EA 3NSNA 4QDWA 2AAAA 2Z26A 1QI4A 4QITA 1FH7A 1XYAA 3BAXA 3QBUA 2NQZA 4G6CA 3NURA 4TO8A 3GAKA 3YPIA 3S5NA 1MEWA 3FJLA 4HVXA 4LF2A 4QJ3B 3VKDA 3P81A 4NRSA 3LBMA 2WVUA 3CMFA 5D30A 2HBVA 1R85A 2GJRA 3NL3A 4TTUA 4IJBA 4ONVA 3STFA 4LAKA 4W8LA 2D22A 1E3ZA 2RUSA 1JEZA 2FZMA 1SMDA 2E77A 4UR7A 1MW2A 5G1YA 3E49A 4YVPA 4R88A 1BVWA 3GTFA 1TVNA 1CWYA 5AHIA 4NYUA 2WZMA 2PBOA 4PCNA 4PMYA 1ISWA 4GI9A 4U5KA 2DPEA 3OLEA 4RZ4A 2QHAA 5HXMA 3ITCA 3AU2A 2RDTA 5ABTA 4MB1A 1HO4A 5IRPA 1GK8A 2DJLA 1XI3A 4GCAA 3L2LA 2NW0A 1HL9A 2C71A 3LRKA 2Q02A 2PMQA 2VEFA 1OADA 1DJNA 4KKXA 2PDIA 2DP3A 3EDKA 4EANA 5C9RA 1HFBA 4ICNA 2DUAA 3I68A 2OWCA 4O1AA 1YE6A 5E6ZA 1R3YA 3HGJA 3JW7A 4X0NA 1HP5A 3E38A 4EPBC 1WB0A 3VIKA 3L4TA 1EJ7L 4ERGA 3NZPA 4GHRA 3GR7A 1GOIA 3V5OA 1ZBKA 3A4XA 1K6WA 3GFXA 2D3LA 4IIHA 4KCVA 5LIKX 1U1HA 4R9XA 3W7DA 2QJGA 4C91A 3T4WA 4KMQA 3DESA 1KWKA 2WVVA 1I2NA 3BQ6A 3K4AA 2CFFA 3SY8A 3AI0A 4EXAA 1X8FA 4J28A 3KP1A 1US2A 4ICMA 3H7RA 5CH9A 1VFLA 1UROA 3W1XA 3WG6A 2CLLA 1KQYA 3LN3A 3L2MA 2YZRA 4A4AA 4DHGA 3R8RA 2HMCA 2FJKA 1GGOA 1L9WA 3L5LA 4AMAA 2QCDA 3M0IA 4D6GA 1KXQA 3E9AA 4QXIA 3QN3A 3DIPA 5FF3A 1JCJA 4KIRA 3U4FA 3ZJ8A 3B8SA 3CBWA 5HNRA 5I3HA 4OT7A 3KE0A 4M1BA 2DT2A 2DSKA 1LDCA 3ATZA 3LXBA 5JBDA 5DCDA 4HNNA 4K2SA 5FF0A 1WXJA 2FFCA 2WANA 4S38A 4S2CA 4LNCA 3CMJA 4KFOA 4UNIA 3ZJKA 4JCLA 1PE1A 1GZGA 2YW3A 3UPBA 1KXTA 2FKPA 2VFFA 2G8ZA 2X7VA 4KWVA 1QHZA 1SO6A 4MOZA 4TXEA 4UFJA 4LYKA 5LNSA 2VZOA 4BJHA 2J7GA 1AH4A 1B30A 1FXQA 3OLIA 3A9IA 1R5YA 2H8ZA 1E55A 4HTBA 1ZTVA 1KKRA 4FX6M 4L1XA 1A5KC 1K9TA 4Q32A 5H91A 1JPKA 4H04A 1XBYA 3WLRA 2PC8A 3SN0A 2QUMA 3S83A 4JIQA 1BF2A 2ZE0A 3GDKA 3TYEA 3CAWA 4J3SA 3SRDA 4E5TA 1W3HA 3PG9A 4QLKA 1CECA 3N14A 3GC2A 1PCKA 4D6FA 4AVFA 1W1IE 3GXTA 2VC6A 4K7VA 4OUEA 3TC6A 1J0ZA 2Y7EA 3DXIA 1KV8A 3GNPA 3IGHX 4A8NA 2DVTA 1K8CA 2Y4SA 3USBA 5AYXA 1ADOA 2NQ5A 1TRDA 2VGFA 3RPDA 4AISA 3SQLA 4LAMA 2V5JA 1HGYA 3ZLGA 1GG1A 2ON3A 3BAJA 1TPEA 2PWGA 1BG9A 3AZSA 1C7SA 2Z6IA 3LG3A 2OOFA 3LCGA 1KRAC 4EPEC 6TIMA 4GRSA 1V77A 1O1ZA 4NIRA 4YCPA 4L4LA 1IT0A 5C7VA 1O1HA 4K37A 4IUGA 4HZ8A 2B81A 3GUGA 1HNYA 1BXCA 4MDPA 3UWWA 1DJXA 4XZIA 1RY8A 3FFSA 4DYKA 3K8KA 4X0VA 2P3EA 1AH0A 4DBUA 4X63A 3SCUA 3UZJA 4ZO6A 3AFBA 3E0WA 4QSFA 1B3VA 5D9OA 1UC4A 1XINA 2OYMA 2XVNA 3QGVA 4FXFA 1EEXA 3RM8A 4QHRA 2NVDA 5A8OA 3CAQA 4LOCA 4Q8MA 1FWRA 3QQ0A 5BWAA 1YDOA 4DM1A 2J88A 1P5BA 1DORA 3NPXA 2FHFA 4XKYA 5G1TA 3R58A 2CERA 5J5RA 1Q66A 3DKLA 5A69A 4UC5A 3MUZ1 3P0WA 3VCNA 2JF7A 3R0DA 1OWQA 3PBGA 3WLJA 4S3DA 2BOFX 5I3DA 1KRBC 5AZ0A 4C6EA 4WY0A 3H26A 2JEQA 3M0YA 1UQZA 4NX0A 4REQB 4WHBA 1LCOA 3BAKA 1YQ2A 4DWSD 5H1WA 3ZLFA 2YL6A 3PBUA 2PUZA 2IKHA 5C9ZA 1VHCA 1JIBA 1ADSA 3K5XA 2EPKX 3TW6A 2A3LA 4MUPA 3U8GA 1AQFA 2WJFA 1A3HA 3CQ0A 8RUCA 4U33A 2QDHA 4U10A 4X22A 3H53A 3MDUA 1L0PA 3OBKA 1EZ2A 4DX3A 1DQXA 5REQA 2X16A 3GVVA 3FVDA 1LT7A 3ARYA 3LENA 1QPNA 5FCZA 1MW0A 3RO8A 4WKAA 1FRBA 4FA3A 2EPHA 1CGTA 5CC7A 2VZVA 3FA5A 2V5CA 5FF4A 4XZMX 3UERA 1RLDA 4RNJA 2HVOA 2BSLA 1UJQA 3VOGA 1OG0A 1SZRA 5AHMA 1O5RA 1C91A 3EA3A 2NUXA 5A8MA 4BQ4A 3WCZA 4MNLA 5D9NA 2ZBTA 4JQ1A 1DWGM 2FZBA 3NVTA 1E51A 4RV3A 2C0HA 3CH0A 5T9CE 1LRTA 4FXJA 4BQ2A 2HVNA 1Q4NX 5F1UA 3WMBA 1MO0A 1R38A 1XDJA 3H7VA 4P7QA 5D2XA 5FD0A 5TAOA 1EJTC 1O68A 4PTVA 1SUXA 1GHSA 1U30A 3WNPA 2DZUA 1OFEA 3S1WA 3ATYA 5CG0A 1W9UA 1FWHC 4Z0JA 3EX4A 5G2IA 2V5BA 2Z00A 3R89A 3KUMA 4B5UA 4TV5A 3NQCA 1B0IA 3LX9A 1FWAC 4FF7A 3REQB 2BGQA 1WDQA 3PFMA 1XLEA 2TSYA 7XIMA 5M5DA 2NLYA 2CESA 2X1TA 1SJBA 5KINA 5AYBA 4BQ5A 3SCRA 2ACSA 2Z1WA 2MUCA 2PDHA 2WM1A 4YIWA 4GYKA 5FJPA 1VCVA 3CH9A 5K3VA 2R1PA 3BG3A 5MF5A 3QTPA 3IANA 3HB9A 4W8AA 3ZS4A 3UXKA 2B7QA 4HP5A 4J40A 5FJRA 3D0CA 4XBJA 4CVUA 4IOTA 1UR2A 2C7FA 1UWAA 1B57A 3IIPA 4XD6A 3H2OA 5AKQA 2J24A 3W02A 4DPPA 5JVLA 3PNZA 2FLIA 4NNCA 1SW7A 3G1FA 3ZYZA 2OWWA 3B97A 1M7JA 3W37A 4NQ1A 3BLDA 4FLSA 3O6CA 2VZUA 1XPGA 2GQ3A 3AMKA 5FEXA 1ITUA 3E5BA 1HT6A 2JE8A 6ENLA 2OLSA 3DGRA 1XHGA 3SBFA 4EVZA 2RHGA 3BURA 4HCLA 3N73A 1LQAA 1XL9A 2JQXA 4A3RA 4GVGA 1SPQA 2PWUA 1GPFA 4OKDA 5XIMA 2OLAA 1OCQA 1P7TA 4WXZA 1X7IA 2IQ0A 4LC8A 4BF7A 2O9PA 1H1NA 4XZNX 2R91A 2CXGA 3D3AA 3VA8A 4V28A 3UR8A 1NP0A 4ATDA 3ITVA 3S1VA 1UP3A 3TTEA 2CPUA 3PZMA 3TZFA 2YDRA 1PTGA 3M46A 3UD6A 3CJPA 3T0BA 4DM2A 1L6SA 3VZXA 5ENLA 3HU7A 5BWFA 5A8PA 2A1YA 3VK5A 2OSXA 4IWWA 3CIVA 4AYGA 3BL3A 1EF2A 4MWAE 4V2XA 3P84A 4H8NA 1OK4A 5GNXA 3NA8A 3GKFA 4IIDA 1QOXA 5DEZA 4MZ8A 1R9XA 4IGSA 2QMKA 5DMYA 4DY1A 1PZ3A 3PJXA 4OZOA 3BAWA 4KFNA 5SWUA 3RK8A 3GHRA 3V1PA 2G5WA 4UMBA 2GVJA 1Q6FA 1SO4A 3O06A 1H7NA 3TYAA 5I00A 5G4HC 4I90A 4QIUA 4XVDA 1QUMA 3ABSA 3FXYA 3ZIZA 3U48A 4PC8A 3WLOA 1TCMA 2PGWA 1ZCCA 2ZRUA 2H90A 4JTAA 2F6UA 2WHMA 2W67A 3S2NA 4F40A 2H8XA 4DAIA 3EPOA 3C0LA 2EBNA 5A6BA 2UBPC 4XAZA 4KRTA 2JGYA 1E9YB 4GUFA 1EEPA 4FNUA 4IQLA 1WZKA 3DOPA 1JXKA 1J4EA 3R4IA 4NZCA 3EX2A 4LVBA 4A8RA 1TUFA 2ZTKA 3TLQA 1K7EA 1R46A 3RYSA 2J9XA 4ZQNA 1UUMA 1BWKA 3QW4B 4P2VA 4MF4A 1V3LA 2FTPA 2ESCA 1A5AA 5I78A 2Y2WA 3WD4A 1M7OA 2XIOA 3APTA 3S6OA 1GQIA 2PFHA 4R53A 3VOJA 3DHFA 3AMCA 2GVEA 3VC5A 4UTJA 2TMDA 1W54A 1AQHA 3N2MA 4UMCA 1FWTA 4FR6A 4WEVX 1K7FA 1SZFA 4IGNA 4AIBA 1YW1A 5HUOA 1U33A 3BV7A 2HTMA 3FYOA 3NQ2A 3R7MA 4GYFA 3SO7A 2Q6ZA 2W91A 2EJ1A 2EXOA 4OGZA 2J8TA 3V7PA 2O9OA 4JKLA 3THUA 1R0MA 2VUYA 3SCTA 2C1HA 4NVTA 3FJNA 2E25A 3W88A 1Y7VA 3WDRA 1XIJA 1S5WA 4RDWA 1TZ7A 5LNUA 1GYLA 4K1GA 1VQTA 2NUYA 1L6GA 4ZGYA 4KESA 4R3UA 3PS7A 4E0CA 2PU1A 1L8PA 1XLLA 1W1TA 4O8AA 3WH7A 3BAYA 1ZPTA 3IK4A 3EKZA 3P5ZA 1FXPA 3VD3A 3BARA 4ZA0A 3QOKA 2BV9A 1XKJA 2PGEA 1VEPA 2J8FA 5I3KA 4AU0A 4LF1A 3BLLA 1J96A 4W5ZA 5ABFB 4TMCA 3AZRA 1PKYA 2A5HA 4UTWA 3KAOA 3B03A 3NVDA 2I1OA 3TDFA 1IXOA 3MHFA 3ZM8A 1TR9A 4IL0A 3WZ0E 5EFFA 2ZC1A 4PRTA 3FGCA 4GC3A 3P8JA 3WQOA 4JNYA 3FX4A 1PBGA 5F4XA 1R47A 2PDYA 3IACA 3LCWA 2QT3A 3FEMA 1K03A 3VPLA 2EG8A 2I5QA 2GL5A 4JTFA 4G7EB 5I3FA 1OF8A 1S5MA 4ATWA 2PBGA 3U6WA 2INZA 3M7WA 3R94A 5BCAA 2HRWA 2OO0A 2FDMA 6REQA 4ZXOA 1W3LA 2POTA 4HA4A 1EYEA 1CT5A 3CWOX 3S6TA 1W9PA 5BXTA 2VUNA 3T1GA 3LU2A 2A79A 4JBRA 2P53A 3IAQA 3MCMA 2RGLA 1BQCA 2VRQA 1XFCA 3WJYA 3SUVA 3VIOA 3M07A 1XGZA 3LPGA 3WLHA 4DQWA 4QAIA 3VKJA 4XBSA 3KBSA 3T05A 3T0CA 2VHLA 2VR5A 2ZADA 5TQLA 4PB3A 2HQAA 3UCQA 3RRAA 2XHYA 5FIPA 3TNOA 5AVNA 4C6DA 3UWEA 3CGTA 4Q8NA 3FA4A 3QQWA 2DH2A 1RLCL 3GHUA 4QCEA 1ESWA 3VIIA 4J3VA 5IDIA 4GC4A 1R3SA 4AHOA 2J13A 2BGNE 3OZYA 3ZFHA 2PWFA 3RLUA 3EKLA 3JVAA 3AU6A 3OYXA 1HKMA 4NNAA 4C6PA 4PMVA 4BKNA 4NZFA 3PTMA 4XQ6A 3QPZA 5CAKA 1B3YA 3LPOA 3SB0A 7ENLA 2YA1A 4WCJA 4QGCA 2VDIA 2OQLA 3WFZA 2I57A 4O8RA 1B9ZA 3L2IA 4HSOA 4A2RA 4N2YA 2V2HA 2C1GA 3MUCA 3PY2A 3K4DA 3CZ8A 2GPTA 1VYSX 3GIPA 5KSWA 4GLEA 2CBIA 4XB3A 1L6FA 1IEWA 1PIIA 1ONWA 4H7ZA 1QO2A 2ZOXA 1KR0A 4CU6A 1QJWA 1Z69A 2E1DA 1OD8A 2QV5A 3B8IA 1Q3NA 2NV2A 4FOJA 1XLBA 1DJIA 2FB2A 4EWJA 1UR1A 3DX5A 3MBDA 3I3EA 3TA6A 3ZOAA 2B7NA 1TTPA 2VELA 4FOKA 4YYCA 3GH5A 2G0WA 3O15A 2OX4A 1POJA 3NQAA 1XYLA 3TYUA 4ACYA 5MKGB 2WPBA 4IX0A 4KGLA 1O7AA 3CQHA 3KDOA 4RE0A 1V4YA 4AAJA 2C8NA 4IM4A 2WLZA 3S9ZA 3P2VA 4MKVA 1CGWA 1UIOA 2R1NA 1U5JA 5GVJA 2PGFA 2X2YA 1VRDA 1ME7A 2B31A 1JZ4A 1VC4A 3CEPA 3TOYA 4H6KA 1NOWA 4LSBA 1DVJA 1M65A 3QMSA 2I56A 3N6JA 4FLQA 4LU0A 1JCLA 1A5NC 1AZ1A 1V0MA 4JDBA 5C71A 2RJGA 2Y0FA 2XIBA 1EXPA 1W5NA 3W82A 2VZTA 1I6NA 3F1QA 3UXIA 2IUZA 4TU1A 4DAFA 1BYAA 4H3DA 4DNHA 3P67A 3LNPA 4QLJA 1HZYA 3OVPA 1Q6DA 4OE7A 4FB7A 1F8MA 2VP8A 1DE6A 2V5KA 4O13A 3WF3A 2J77A 1BXBA 4XZWA 3W00A 1YDNA 3MB9A 1SZEA 4Q8WA 4GBUA 2XGIA 3FJ6A 2DY3A 2OZ3A 3MKVA 1FHVA 1QBBA 2VD9A 4JTEA 3IGSA 1FWGC 1OFDA 2W5FA 1L2QA 4U2ZA 3EB2A 3W1LA 1UG6A 2I9UA 1XRSA 3PBMA 1UYQA 1TR1A 1DP0A 2DZVA 2GQ9A 4MY9A 5AC5A 3LDVA 3NQ8A 1WZLA 3CASA 3OB8A 4A3HA 1TV7A 2X40A 2WSYA 3TCEA 3W72A 2Z28A 4R7JA 1Y0EA 1B3WA 3A3WA 4OU1A 3LTSA 2PDMA 1EHAA 2XM2A 2WSPA 1YXCA 3VTRA 1HG3A 3A22A 3UR5A 3N2TA 3A21A 4NZ4A 4C6CA 4TVUA 3E0FA 2FGBA 3LYEA 3Q45A 4H9YA 4NNBA 3SQSA 1PVNA 3CK5A 1T41A 4U4MA 1R7OA 3NAVA 5CC5A 3WNLA 1OG6A 2DU2A 3NYZA 4I8YA 4US5A 3ZVHA 1Z48A 3PB2A 4N0RA 4Z0SA 1NSJA 3DU0A 3TP4A 1QAPA 1OGGA 1ZL1A 1SZNA 3W6LA 5ECUA 3APYA 1AQ0A 3NO3A 4BI6A 2XFWA 1HKJA 2XUCA 4J35A 4RKAA 1UKSA 1LQ2A 2QJJA 1T96A 1Y5VA 3CIWA 1YMYA 3PSWA 2VCBA 4WR3A 3H6OA 3QHNA 4D6EA 1BFNA 4B16A 2DH3A 2X42A 1H41A 1FKXA 1OFBA 4C7GA 4EPKA 5GJMA 3PWAA 3UFYA 1I9CB 1V0KA 4NAEB 3SR7A 1ECQA 1GKQA 1RQBA 3O7UA 4BQ3A 1MXSA 1BKHA 4GZIA 2E8YA 2HEJA 2A3EA 1XYZA 1KBLA 4R34A 3NDYA 3W24A 2DIKA 3N4AA 4I7UA 1CXKA 1FWFC 4I8DA 3R11A 1LRNA 3UA3A 4XD5A 4FNPA 1FHLA 4H8UA 3KL3A 4AHPA 1W1B1 5EL1A 4WKFA 1W2VA 1FCBA 1TV8A 2HE8A 2AQVA 3ALGA 3L68A 5BU6A 3KP0A 3P0XA 5K4XA 2TRSA 5D2WA 2Y8VA 4LAOA 1LWHA 2HK0A 1QPQA 1KTCA 1GVOA 1MEHA 3C0SA 2OJPA 3KWXA 3WUBA 4KETA 1GZJA 2DZBA 1Z42A 1F3XA 3HTWA 1OCNA 3GXDA 1W5MA 1X1OA 3LPFA 1JYXA 3KBNA 3VFCA 2WWDA 1YXDA 5CZKA 2AKZA 2V3DA 4HU3A 2CCRA 2X1SA 1TZZA 1SGJA 1XSIA 4UBPC 2QZRA 4JTKA 4C6NA 2A85A 2XN1A 2PODA 1V3KA 3KBJA 4B5TA 4MDOA 4WDTA 5F2MA 4H6RA 1OFAA 3ZR6A 3XISA 1XIBA 3DFQA 1C29A 1VEMA 1QMLA 1XC4A 3WK1A 2VEMA 4O52A 2J47A 1VCFA 4BEUA 1ICSA 3G8EA 4OQVA 4O53A 2OU4A 3VNIA 3MPGA 3I65A 3OEXA 1OQFA 3P61A 2WW5A 4UR9A 3MZNA 2PDKA 3BW3A 4ZQPA 1XX1A 4F0MA 5JXQA 1UWQA 3IJDA 1KFEA 3ITGA 1JCMP 4H6EA 4CU7A 4HNVA 1KM4A 1W32A 4HCDA 2XH0A 3AXIA 3URAA 3FY1A 2IKGA 5I0DA 2W66A 1ISZA 2EQDA 1ME8A 2QULA 2YDQA 3L67A 5EYWA 2BHYA 3ZR4A 4Q8TA 2IXVA 4HTYA 1V6XA 3IV8A 2Y62A 3AWOA 5BOEA 4N4QA 2DQWA 3FKRA 4UTKA 4AH7A 2ZUWA 3MDWA 3UG4A 4LUIA 1UW9A 4P7RA 4ADTA 1GYNA 3AUJA 4DRSA 4PRRA 4B2DA 1XR2A 5E9XA 2VQTA 3KDNA 3T2PA 4JOMA 3DH7A 3W6MA 2QMJA 2PDGA 5LIUX 4ZL1A 2J7DA 2P0OA 3UETA 3VOCA 4HNOA 3BE7A 2YBTA 1RCXB 1VPQA 1VIWA 3L65A 1E6ZA 2Z6JA 3LLXA 3S2MA 4WY0F 1E6RA 2X7WA 1XLIA 3QZ6A 4MYAA 1H62A 3WJZA 3AHTA 4CVWA 4V1XA 1OFRA 1EZWA 1L2UA 4A3YA 3M0ZA 1RQEA 1X97A 1E5JA 1NDZA 3UYCA 1Q7MA 4JICA 5DN1A 4GACA 1F2JA 3ELFA 1EP3A 1E0TA 1BTCA 2O92A 3QGKC 4FZIA 1A5CA 1TPWA 5HWMA 4IT1A 2CZFA 1XLCA 1XLHA 2A2IA 2VVSA 1OK6A 1G9HA 4LUSA 4EAMA 1IWAA 2WCSA 4O54A 3W85A 2ZX9A 1NDYA 5CSUA 4FMVA 2DZAA 5H6HA 2QAFA 1F9CA 2HBXA 3OOQA 4I9JA 3ABZA 2D73A 4NT0A 1JJKA 2V67A 4Q4OA 2DORA 3LBCA 3ITTA 4IMEA 4LCSA 4NHVA 1WKEA 1SW3A 2PS2A 3TLLA 3M0JA 2C91A 2ZRWA 1FCUA 4ORMA 2RDXA 3K13A 1TYGA 1QHPA 1WPCA 2ISVA 5HULA 3U7VA 5I7GA 3I7RA 3PZNA 3ZZ1A 2I14A 5IHRA 1QR7A 4UFLA 4JCMA 2G3IA 4PUUA 4MYXA 1RAKA 1JDEA 3SI9A 1CB2A 1H11A 4KEZA 4LYRA 3U57A 1K8XA 4J2PA 3GHSA 1ZJBA 4DBDA 1JXJA 2REQB 1G4EA 1KGWA 3UXLA 1AMKA 1VLIA 3E6EA 4FALA 1EBHA 3UT0A 1NY1A 3NPUA 1QPKA 3CHEA 3N4EA 3O16A 4IIEA 2GWGA 5AFDA 3HPZA 4BHYA 4WDUA 4IXHA 3BOLA 4G1KA 2VFEA 5HJLA 4M81A 4S3EA 3AIUA 3IUIA 3ZWSA 3MW7A 3IJ6A 3G1VA 2GDUA 4JQAA 3WJXA 3N6HA 3NQ6A 3TMLA 5F1VA 3O6DA 3EWUA 4S1FA 1V02A 3P7YA 3N4FA 2AQOA 4P5UA 4BI7A 2DUZA 1JDCA 1QPRA 4LNYA 3HPXA 2DW7A 2AL2B 1HJVA 4JFVA 4MZ1A 1UBPC 3KVJA 3SDOA 4O4WA 5E0FA 5AYZA 4GD0A 5DO8A 3A5FA 1EX5A 4IPIA 5HJYA 4HSHA 1Z44A 1ZZMA 4CNSA 4WD0A 1S2UA 3LCXA 2CZVA 5EMJA 3Q58A 3TA9A 1J79A 3AIEA 4KWWA 4QX4A 1KXHA 1VP5A 4AEOA 1TWSA 4REQA 2YCKX 1CXEA 1SQ7A 4ZCWA 1C92A 4J7RA 3JRKA 4WGHA 4A8LA 1I2RA 3QF0A 5KTLA 2XU2A 2XYLA 2PZ0A 3EYPA 3DECA 4O1BA 2GJPA 4F0HA 1NIUA 5ABEA 1JDFA 1LROA 4XZBA 3SGZA 1TJ0A 4QJ5B 5A2BA 5J04A 2YZ5A 3P60A 3W4RA 1QI3A 2E5DA 3ZMRA 4XWUA 2WMIB 1MRQA 3MKCA 4QFUA 4Y9PA 3VDAA 4AD5A 1XUUA 2YXOA 3JR2A 4N9CA 2VZSA 4MTVA 1TPUA 2QUNA 3CB8A 4Y96A 4ZSUA 1IF2A 3IJQA 4MY1A 1UH4A 1LL4A 3U9IA 2Z1KA 3STCA 3MBFA 1XYMA 1YIXA 1MW1A 3WN6A 3MUAA 4KRZA 1H61A 4K3ZA 3KL0A 4JTGA 1OFOA 4EAYA 1UOZA 4FXRA 2ZX6A 4PA8A 1FDZA 1F05A 2NZLA 2PE4A 2WC3A 2CITA 4L64A 5K2ZA 3C4UA 4FF5A 5U4NA 3W1PA 4DJEA 3QSRA 4S3JA 4ORIA 2GGJA 1UKQA 4LB4A 5AB3A 1C3FA 3H2CA 1BD0A 1T40A 4WOZA 2R1KA 3U2OA 2XG9A 2V6AA 3O63A 2QVHA 4O16A 3UGRA 1E0WA 4AZGA 4FNQA 3QJAA 1W3KA 4UQEA 2YL8A 1F73A 1AD1A 1I1WA 3FXGA 4I6VA 2A3HA 4AD3A 3REQA 1UR9A 1WUFA 2O55A 3NIYA 1HJWA 3WQ8A 1XLJA 3WDPP 1SR0A 2GSEA 5CLTA 4XTDA 4DLMA 1WQ5A 4YWIA 3BSGA 1NWSA 3IWPA 3FHAA 2CLMA 1JPHA 1F4HA 5B7ZA 3QTGA 1Z32X 4J3WA 4L9ZA 1DHKA 1BGAA 1H4PA 3PPCA 1RV8A 1E3XA 4HHMA 6CGTA 1VHNA 3W2KA 4IXXA 1ITCA 1OJXA 3MS8A 4WZHA 3PZIA 4EXQA 1SYTA 4G2DA 2DQXA 2FMNA 1ADDA 2YCLB 1DJZA 3GK0A 4PMQA 2WJEA 3DFPA 1UQYA 1ZJHA 4E4UA 4AY8A 2XSAA 1OVDA 3EMCA 3TJ4A 2HSAA 1SJDA 2QGHA 4GOAA 5AY7A 2BOGX 1O12A 4P8XA 4KPLA 3VCRA 1HGWA 3CUGA 1M53A 3W7JA 3PZQA 1NDVA 4EP8C 3TR9A 4LBRA 3ME3A 2YW4A 3I6TA 2ZZ3A 4H7CA 2O7SA 4MB5A 2YA0A 1Y5XA 1S5VA 4GUIA 1YTDA 3PTQA 3CTTA 1E6XM 3W2LA 3R43A 5DELA 3M6YA 1C7TA 1LYXA 5FA5A 3QSTA 4LRSA 4XSMA 3BG9A 3R25A 5EGRA 1NAL1 1KFBA 1RCQA 1EJXC 2QXWA 2YKKA 3VMPA 3P3BA 3UNDA 1WDWA 4CNPA 1VZWA 2CBJA 1EJVC 1DJWA 1A3WA 1G01A 3LQLA 4GYJA 1EKOA 1R9YA 4LY4A 4IQDA 1E9IA 2JKEA 3CWHA 3EZ4A 2X8RA 3R8GA 4B4FA 4H01A 2YCEA 1TTIA 4KCTA 3A12A 1B3OA 4UTLA 3EWXA 2F6KA 4LPCA 3FYYA 2ZVIA 3LTPA 1BWVA 4Q7IA 1GYMA 1UP2A 2ZUNA 3UF9A 2OX1A 1QNQA 2G3FA 1DOSA 1DPMA 5CCZA 1YLVA 4B91A 3PPGA 1ALDA 4UFMA 4WIWA 3RIKA 3BMWA 4CN6A 5HPCA 5A1AA 1YADA 4Z2IA 1TA3B 3NWRA 1XH2A 2RFGA 2ZFAA 1WAWA 3W7KA 1E1FA 2VC7A 4QEEA 1E0XA 1XGDA 3GNRA 5JU6A 1QNPA 3B0PA 4KW2A 3WK0A 1RJQA 4P61A 4Z1YA 2NQJA 3IIZA 4CQ8A 3CPRA 1O94A 3INPA 1J6OA 2CIPA 3WFLA 4ACZB 5EBAA 2F84A 3LS9A 4X61A 2Q71A 3PM6A 3AYRA 3G3DA 1Q7QA 1XLDA 3M4HA 3UG3A 2H3DA 1JI2A 1JZ3A 3W86A 1V6TA 3TFCA 4O18A 5BXSA 4JTCA 3G1YA 1XWYA 4DJDD 1BHGA 2A3AA 4H41A 4RZBA 4BZYA 5IBXA 3CU2A 1JUEA 4NL1A 2QCEA 4C1NB 1HUVA 1CI1A 4GUJA 2OQYA 4IGMA 2R9RA 4NAFB 1A5LC 4HNTA 2J27A 4MJ2A 4ZE4A 4Y2WA 4OTKA 1RD6A 3QV7A 3NQMA 2B7PA 1TKKA 4XIAA 3MWAA 3W1NA 1LL7A 2Q8XA 2ZX8A 2G37A 4N9EA 4BK9A 2PF8A 3LBOA 4ZB5A 3AICA 4H00A 2JKPA 3V0SA 1OD0A 4IPPA 4PRWA 1FWNA 5T9BG 1OM0A 3EOUA 2G95A 1C9WA 1OFQA 4LTSA 4PTNA 3A3XA 2HNEA 4K7YA 3ARWA 1WBHA 1UP0A 2PCQA 5BXPA 3EDFA 3GTHA 3VC6A 1O5XA 1V51A 4FEZA 5CXPA 4MZYA 3C8FA 4DYEA 1D8WA 5LIYX 4HK5A 3FEQA 3AMDA 2B4GA 4GI6A 1IZKA 5HWJA 4C1KA 3O0FA 1ISXA 3W7CA 3BLEA 4AZIA 4U28A 1XQKA 3NFUA 5I23A 3WQCA 1UIPA 1X1NA 3CM4A 3ONBA 3H70A 3CHVA 1JFXA 5ABFA 4BWLA 3POCA 1LOQA 3SY1A 3S1UA 5A2AA 2J9ZA 2OPJA 1AK5A 1MUWA 1MFVA 4XTIA 1E0UA 1NJJA 1VENA 1GVSA 2WJDA 1JUKA 3NPWA 3ZJ7A 1MUMA 4PB5A 2GSHA 3AS1A 1MQQA 2C0AA 2EHHA 5DT7A 1E6QM 1ZGDA 5FJUA 1R6WA 1WOBA 5T91A 4G7EA 4DJFD 3W71A 5IOBA 1TMHA 4C5ZA 3GDLA 4NJHA 4L1WA 4HPHA 3TTYA 3VIGA 2PZNA 3PSVA 2O0TA 4JYDA 3H4XA 3OVGA 2E40A 3BLKA 3Q37A 4AZ6A 1TIWA 3MCOA 4ENLA 4MVAA 1K8ZA 1MW3A 3PUEA 3V5CA 1W1A1 3NNTA 5LGZA 3VAVA 3LA4A 3GFZA 3FOKA 1GT8A 1YRRA 3M5XA 3AOFA 2CLPA 3SN4A 3GXFA 1ZJIA 3CZJA 3TTOA 1JULA 4E8DA 2CZ5A 2BXYA 2RJHA 4D6IA 5FSEC 4ZQOA 5CPQA 1UKOA 2BY2A 4BS0A 4AHQA 4AXKA 1BVZA 4OOUA 2X30A 4M19A 1CGVA 2NXIA 4UR8A 3RPTA 3BGGA 3A4WA 4JPGA 1IIHA 2Q01A 3RLHA 4CCZA 1H1YA 1G4SA 4B3ZA 5KETA 3HN3A 3GG0A 1JPMA 4LS2A 3LHWA 3HM7A 2NVCA 5AHLA 3MJMA 4LCRA 1E5NA 3SFKA 4JL2A 3BMVA 3WDIA 3WBWA 5LHFA 2G3MA 1JZ7A 1RCOB 4BR1A 1QW8A 3GY1A 1U1JA 3C2YA 1UBSA 2WPGA 3ANUA 1HQTA 3ARUA 2JBMA 1TX2A 3Q4DA 3W9ZA 2VYOA 3N34A 4ZVJA 1H2JA 2RKXA 4JYEA 2D0GA 1TMQA 2OO6A 5AYYA 2BODX 1H51A 1SM9A 1XM3A 5CKSA 3ANYA 3UQNA 2Y70A 1FTXA 2YCIX 3CQIA 2ABAA 4HOXA 4PUKA 3B4UA 5CEWA 2Y8KA 4PUNA 4ZTXA 2GGEA 4HHLA 1E40A 1S39A 8TIMA 3BLOA 1KFKA 3BGJA 3CPUA 3VGDA 3URNA 4L61A 1GPWA 3PPFA 3B8UA 1XISA 2X1RA 2BDQA 4PCFA 1GTEA 3NCOA 5KEZA 2XIIA 3DEQA 3CZGA 3GO2A 4GQRA 1BSLA 1XDLA 3OVRA 1VBUA 1J0YA 4MADA 4A6GA 1YTKA 3FLUA 1ZENA 5MKGA 3MMUA 4H7VA 3AYSA 4UFIA 5C8BB 1B54A 5HANA 3GVRA 1VYRA 1TUXA 3DG7A 3GBEA 3N2CA 2J9YA 3MP4A 4CUCA 3E2VA 3HV8A 3M0LA 4L4PA 5HQLA 3LOTA 4JDYA 1HVQA 5JUVA 3QW3A 3SSJA 3T4CA 2BX7A 4M24A 3WK2A 1DYSA 4C7DA 3TV8A 1IIGA 2VXNA 1I75A 5EMYA 2E9LA 3CQJA 3FW6A 3F5LA 2OLHA 3AHXA 4QDMA 1AA1B 2FDSA 3W74A 2WMJA 2V2CA 4HGXA 4XD3A 2HISA 4L7ZA 3ZT5A 4AVOA 2GUYA 4M29A 3AXMA 2PP1A 2H9AB 1PWLA 1HL8A 3AISA 5AVHA 4LT9A 3ARZA 4AWTA 1F4AA 4UTFA 3NQDA 1SVDA 1DWAM 3EPMA 4JHOA 4XX6A 3N25A 1IXPA 1MSSA 2QJHA 2QYGA 4NI8A 3VGHA 3W23A 1SFLA 3SUTA 4E2DA 3N29A 4PCPA 1X98A 4UXDA 2V3FA 1JUBA 2GZXA 3VGFA 2RGMA 4CCCA 1O5QA 1Q13A 2QW5A 1Z89A 2O56A 3GUWA 2PA6A 3KVLA 3C0QA 4HOWA 2DIJA 3L0KA 4V33A 3VGGA 2HPMA 3NR0A 3T8QA 1F7BA 1QU4A 3ITOA 4DXKA 5K9DA 5DMNA 3BICA 3AXHA 2INEA 3GIYA 3W2NA 4PBFA 3TWBA 3L5AA 4LUJA 2ASHA 3N19B 2YGYA 2A4AA 3QPYA 1HKIA 3OIHA 4C7FA 2UWFA 3B8WA 2FZ9A 4P8WA 2FVLA 2FTWA 2OEJA 2XJ7A 4UCGA 4GE8A 3L5MA 1GQJA 1K6AA 4HNUA 2XVKA 1K7XA 4C6MA 4G9PA 4JX4A 3S9YA 3NG3A 3KVKA 3GWQA 2XGZA 3F03K 3W7OA 1S3HA 1GVRA 3PVFA 4PCTA 5LZLA 3NYDA 5L9FA 1E43A 3UVIA 4WQ6A 1JDDA 4RNIA 3NQVA 1I4NA 1AJZA 3LERA 4DWSB 3OBAA 4EXBA 4WVXA 2QQ6A 1WCGA 1HF6A 5CGQA 4G5DA 2QJIA 4Q4MA 4J5NA 3SCPA 3ZVIA 1N55A 2BFGA 4WUIA 3TQKA 4MWAD 4YYFA 3QKZA 4KEMA 4O1FA 3PHAA 4BF5A 3QLDA 3SFWA 4GXPA 5DMLA 3HA1A 6ALDA 4LANA 4MLRA 4NAEA 2EAWA 2FPTA 3H8AA 4Z2LA 4U3CA 3TIMA 1W3JA 3U2CA 4CD6A 4X3ZA 1I2QA 3LUTA 2V30A 3DBPA 1O6IA 5IBXC 5G4WA 4GVHA 2J62A 1JYVA 1AL7A 5A6KA 3WH6A 3UP8A 2PF0A 1I1XA 3WQVA 5HWNA 3P80A 7ODCA 1XLMA 3U4AA 2PSNA 4O1CA 3BCJA 2GUUA 3CYVA 2FH6A 3UJEA 1QOQA 1TQXA 2DFAA 2CHNA 3N13A 1QW9A 4GCXA 3OA5A 3M5VA 1E1CB 1XIEA 3U7BA 3FS2A 4R5EA 3VNMA 1Q7ZA 3PUDA 4F8XA 1CGYA 3UPMA 2WZIA 4MLJA 1D8CA 5HMFA 4JTIA 3RR1A 1G7VA 1A5SA 2XISA 4PUJA 4DBSA 1RQHA 2PTYA 4IQEA 4HK7A 2YB4A 2ZIDA 4JS3A 3D46A 2GDVA 3R12A 3CLWA 5C2CA 2WZTA 3C56A 3F5KA 3G0UA 4XIMA 5CGTA 2POZA 1G5AA 3VXGA 3QMRA 1P0NA 4Q4QA 1MRAA 1OABA 1EOMA 1IQ8A 1WUEA 1UC5A 1W5PA 2I7GA 2Z1VA 4HIBA 3A4AA 3DYPA 3WDJA 1KO0A 2C13A 1EUNA 3IVSA 4HOZA 5CSRA 1DIEA 5A3HA 4JXCA 3C6CA 2YDSA 4BWLC 4AWEA 1YNQA 1XD0A 4NZJA 4HB7A 3VO0A 1AMYA 4D6JA 4DYJA 1UH3A 1B90A 1Z3NA 2D2GA 3R79A 4AYSA 3IUDA 4GXMA 2VEIA 4ZE5A 5FAJA 2NV9A 4IL2A 4UCFA 1HVXA 3CC1A 2PP3A 3S5SA 3H24A 3R13A 2QUUA 2I9EA 1X7FA 1T5AA 3ABQA 3IVTA 3ARVA 5FEPA 4EX4A 1A0EA 2CEQA 4CNTA 2NX3A 3LQGA 3UWQA 3C52A 1V0NA 1TQJA 1AD4A 1OX4B 2X1IA 2DW6A 3GYCA 3SAZA 3NM3A 2ZWYA 4U5IA 2AKMA 2OT1A 3PBVA 3OU8A 1CNVA 1GEQA 4J1OA 4HBKA 3E0IA 4D1JA 3N12A 5BZAA 2W27A 4JTRA 2IQDA 5HQEA 1B3ZA 2NWRA 3HJEA 2VC5A 1CW2A 1GOKA 4D6DA 1DJHA 3O0KA 2XFRA 1P6WA 4MUZA 3NGJA 3BOXA 3SIMA 4EK7A 2YB1A 1UH2A 3OP2A 4PBGA 1W9DM 3W2JA 3B0UX 3VD5A 1MXDA 5GNZA 3VNZA 4QCFA 4CD7A 4MNJA 5FF2A 4XUGA 4HA0A 4UTIA 3LZ3A 1G67A 5IHSA 3RFAA 3LTYA 1OC6A 1E56A 1P48A 2NX9A 1EP2A 2CWXA 1ONEA 3MI3A 1ITQA 3O3RA 2OWXA 5CC3A 1GZ1A 4J4KA 4RPQA 1TWWA 2XH2A 1XIFA 1EO7A 2X0SA 3GTXA 2Q3RA 1KGXA 3WF4A 3HG2A 4A2SA 3CV2A 3A3HA 3QQ1A 4AD2A 3SCWA 1ZLPA 4JTJA 2XVLA 2TODA 4DBEA 3B4YA 4Z1BA 2F38A 3NXLA 3S0CA 3AJXA 4QNWA 4GI4A 4PMRA 1Q2RA 4D71A 2PTZA 3RJXA 1J5SA 1S3TC 3PULA 1T0OA 2FZNA 4HZMA 2V69A 3AS2A 4WRHA 3AHYA 3STPA 4C5YA 3I7QA 1GOQA 5HAOA 1UZDA 1RXOB 2QDGA 2XZ9A 3AWNA 2ZXQA 4IH3A 4MNKA 3L66A 1F3EA 1W8SA 5TIMA 3CS2A 4DZ5A 1LJYA 3T40A 1KCXA 1FFQA 4PCSA 1AW2A 2REQA 2ZTJA 3EXSA 1P1MA 4L9YA 4PFMA 4GO8A 1GVFA 1ZY9A 1RHCA 2CYGA 5DRIA 2WZHA 2ZZ4A 4HYVA 3WQ5A 3E96A 5BRBA 5B80A 3A5VA 3KL5A 4HZ7A 3QGAC 1R8LA 5DBTA 1P0DA 5A5WA 4H1ZA 3GFYA 3LK6A 3W38A 4GI8A 2GJNA 3L23A 3QRHA 2DJXA 2I16A 1KFLA 2FHBA 3SQMA 5KMYA 1I2OA 2J66A 3BK0A 4FS9A 4GZ7A 4P7OA 4U3AA 4D6CA 2VRJA 1V02E 5CBIA 3Q94A 1TZ9A 1W0MA 4W88A 4WDXA 1BXNA 2ZX5A 3BGAA 5KITA 3FSUA 3BAIA 1YEYA 2EPNA 1GJWA 4PTXA 4KF1A 3L12A 4J9JA 1XLFA 2BVTA 1CLVA 3RM9A 3IPWA 3PTKA 2P76A 1V6UA 1QBAA 1YNPA 3WL1A 1W17A 2WVTA 2A7NA 4U31A 4TIMA 2C15A 3B8VA 1Z41A 2PWHA 3AJ7A 3C5QA 3S5ZA 3M16A 5A2CA 4GBDA 3SUWA 3TWAA 1PKMA 2VEPA 1LWIA 1LBFA 4TV6A 3T2OA 1JFHA 1KLYA 4K6AA 3PBYA 3F2BA 3WLKX 1EC9A 4CQAA 4GGBA 4NJKA 1ZQ5A 4GZJA 2P3ZA 3GTNA 4HA3A 1PKLA 3KCJA 1VBHA 2WBKA 4F0SA 1W5OA 3L4ZA 1H3GA 2E6DA 1OC5A 1SSDA 3VKKA 3VZZA 5DXXA 3E74A 4Q4PA 3TH6A 3UJSA 1HX0A 1JI1A 1F6KA 3IUHA 1OC7A 3HQPA 2PEVA 1H60A 3COTA 3PB0A 3N15A 1OIMA 4JX6A 1FHDA 1V3HA 3LHZA 4UTUA 4GQ0A 4KWSA 4RR4A 3UYIA 4FP1A 4RW5A 4RJEA 2OVLA 2WMHA 1VFOA 2ACRA 4M7TA 2VKZG 1K02A 1KBJA 2VDGA 2WC4A 1TWIA 1JF6A 1V93A 2P10A 3L9CA 3C2FA 5EBUA 1XD1A 1VBJA 3AHVA 3N17A 4L5ZA 4LYPA 4QE5A 1Q5MA 4RNFA 3TN5A 2FVKA 2ATMA 4NG3A 1S2TA 4NXKA 2VQUA 2O9RA 1CCWB 3W1RA 1PTDA 3KZSA 3UWVA 1YYAA 3TAOA 1V5XA 4O0QA 1UMLA 4N9DA 4Q3MA 4Q7NA 5HJXA 1LWJA 1HIZA 3G18A 1X6NA 3ARPA 1RPXA 3AZTA 3CUFA 3HQ1A 1K9FA 1PHWA 1V3IA 4HMCA 3HURA 2G41A 4M5PA 3RX3A 1HN1A 5LA2A 1W1PA 4MJ4A 1A3XA 1CXHA 5LIWX 1V6WA 1VGAA 3UG5A 1XV8A 2WB5A 4ECLA 4JKMA 3N3MA 1IGSA 3ES7A 3FA3A 3M5ZA 4S39A 5H8PA 3D6NA 1CB7B 3NM1A 2YCLA 4ML4A 2W63A 4YTTA 1LQ0A 2AOSA 4GABA 5BOFA 1MVYA 4V1YA 1E6SM 5FI8A 4YPJA 1SZGA 3ITLA 2BHUA 3HGRA 1NELA 3T44A 2HS8A 1Q6OA 3AROA 4MB4A 5CAHA 2VVNA 2PGRA 1JYNA 3RRXA 3RN6A 3ARTA 1KBBA 1P7TB 3OZOA 4CQDA 3SY5A 5I24A 3F2DA 4NF7A 4DBWA 1GVYA 2WCGA 3N1AA 3ERPA 3SADA 1VKFA 2DEPA 2FQIA 3QPEA 5JBFA 3URBA 4XVEA 2GVLA 2CKRA 3F4DA 4HU8A 5M3WA 4A05A 4B5XA 3NTYA 4IMDA 3GH7A 2R82A 3FAXA 2CU0A 3H2FA 2GGIA 5HMEA 3F5JA 4O0KA 3N9KA 5BMWA 2INFA 3DAQA 1QNVA 3AIWA 2V8ZA 4ZMGA 1MDLA 1AJ0A 3BOFA 1JAEA 2X0YA 3IIOA 1D3CA 3MHUA 4JFUA 2YYUA 2PU0A 3TYCA 2QEZA 1FFRA 4GX8A 4PFHA 3LD5A 1TJPA 1XF0A 3W70A 2OZTA 3P5YA 3IAPA 2EPMX 3HBLA 3B05A 2D69A 2QPSA 4HK6A 1C8VA 1SU5A 1XRFA 1TREA 1ZB5A 4AC7C 1WBJA 1DJQA 4W93A 2ZUTA 1K4HA 4IMAA 4QNEA 2QF7A 4CLMA 3BUVA 1TWZA 2XGBA 4L6HA 3LGDA 4HPGA 3WQ6A 5CBJA 1TA3A 1MQRA 2WYSA 2WVSA 3NZQA 2OYLA 5J8LA 3A23A 3UJRA 3U2ZA 2JIWA 4IFOA 1W3TA 4IPLA 4LYQA 1OFPA 4XO7A 1UPMB 3DGBA 5EB8A 1FDYA 2Y5JA 5LNVA 4N02A 4FK9A 3S1GA 1OZQA 4ACZA 1TV3A 3QY8A 3LPPA 3USZA 3CZEA 3RGTA 1TTJA 4GJJA 1ONRA 4HD5A 4ZQMA 4S3CA 1LUCB 3W7QA 3II1A 1VF8A 1Q6RA 1QRQA 4CQBA 1NARA 1W3IA 3Q67A 2OEMA 3A24A 4E4FA 2A21A 1KBKA 1KD0A 1JQVA 1ICPA 2PRMA 4CQCA 4C1NA 3EDEA 2MANA 4H19A 1A80A 2R6OA 2PDBA 3OLGA 1RALA 1UR0A 3GX9A 4NAFA 5C54A 1XICA 3TTQA 3TE9A 2D2OA 3MC5A 3ONCA 1M5WA 2VX7A 1UHVA 1GORA 2O9TA 3BJTA 3ZO9A 3NOYA 2FVMA 4UUIA 2HWGA 4OBSA 3QH2A 2BB0A 3OHMB 3LB0A 1MFUA 2F61A 1GG0A 2RH9A 4P8VA 4WSKA 4S3KA 3WKZA 1ODUA 1H7RA 2WC7A 4E2VA 1XIIA 3BCDA 1E6PA 3VNKA 1ZSXA 4YVVA 4KWUA 3LV6A 4LEFA 2OYKA 1KRCC 2WWCA 3TKFA 1GTHA 3M47A 2ATSA 4DXXA 2EPOA 4Z2HA 5I5RA 4ZQRA 3SJNA 4BA0A 4LAZA 4YHGA 2F9RA 1BLIA 1XLAA 3WD0A 4JN6A 2WQPA 3SUSA 1CIUA 4DJFC 4AX7A 4KIEA 2QCFA 3QV9A 4HPJA 2NT0A 1J93A 1Q8JA 4DEFA 1Q6EA 4HCHA 5JMUA 1EGZA 1CX9A 3HG4A 4TOQA 4GJIA 3QLLA 3CWNA 3LXCA 1XCXA 3C3UA 2VL4A 2I17A 4MAVA 1ZP3A 3I10A 3C61A 3H4WA 1DIOA 4JIEA 3S6DA 2PP0A 1S1PA 4FPSA 1NF0A 3P62A 5AECA 1NTHA 1WXYA 4H4IA 2VOMA 3N2BA 1DJGA 1QASA 3NL5A 3WY1A 4DUOA 1D7KA 2WJZA 4GKTA 3GNNA 1SFSA 2Z1BA 1RUSA 5E70A 4HZ6A 4UOZA 1PZ2A 1OB0A 2OGYA 2QPUA 3WQGA 3PJTA 1J9YA 2Z7KA 2GGGA 2G97A 3VABA 4BFAA 4GIEA 2PTDA 3BJFA 3LHYA 1RPKA 3GVWA 1RZMA 4PN2A 1F07A 4DZAA 3P6LA 3HMJG 1ZRQA 1TCDA 1CXLA 3WLNA 1LP6A 3G1XA 5G5IA 3UZXA 3O6AA 3M0KA 3PAOA 2IW0A 1UWTA 1QNOA 1GUVA 3CUZA 3BCFA 3LHVA 1UA3A 3MSRA 1S2CA 3VIMA 1SO5A 2F2HA 3W22A 3WFAA 1N8WA 4I9TA 4AEFA 4B5WA 3VMNA 3CT2A 1H5VA 1YPIA 1M01A 4M3PA 1W56A 1NOFA 1NF7A 3STGA 3FK4A 1EWDA 4PL2A 4S3GA 5CJ5A 5AZ1A 3VIFA 4RE3A 4PUMA 3B0XA 1VPYA 1VRXA 3ZWTA 3K46A 1DWFM 3HPAA 5JIWA 2X2GA 2Z24A 4GFIA 4UIOA 1RVKA 1FOBA 4M82A 1PEZA 2J7CA 3C0JA 5FACA 1UOKA 4BI5A 4NUWA 3AO0A 3WNKA 1FWSA 3PUOA 3KOWA 2Y5SA 1KFWA 1MI3A 1YX1A 3AIVA 3G24A 5EU9A 1ZAHA 1ZP4A 9RUBA 4LUYA 4A3UA 4JTUA 2CBVA 1DXEA 3V0UA 4AQLA 4W84A