1Q13A

Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
322
structure length
322
Chain Sequence
DPKFQRVALSDGHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKREDIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALKPGVEIIPTDEHGKAIFDTVDICATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWVDQSAPVLLEDPLIGALAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNFRYVTADFAIGHPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin-E2 9-reductase
publication title Loop relaxation, a mechanism that explains the reduced specificity of rabbit 20alpha-hydroxysteroid dehydrogenase, a member of the aldo-keto reductase superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Oxidoreductase
total genus 114
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.149: 20-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1q13A00
4PUUA 4JTDA 3CASA 4R9OA 2PDKA 2PDQA 4EXBA 3M64A 4GQ0A 3V36A 3B3DA 1YNPA 1OG6A 1YE4A 3F7JA 2IQDA 5LIXX 2ACSA 2HE8A 3RX2A 3UWEA 4EXAA 2PDWA 4XZHA 5LIUX 1VBJA 2PDIA 4G5DA 2BGQA 3MC5A 2INEA 2CLPA 2ISFA 4YU1A 2FZBA 2IQ0A 1X97A 1HW6A 2I17A 2PF8A 2HDJA 1S2AA 4L1WA 4XZIA 3BUVA 3ERPA 2IPFA 1ZGDA 2PDUA 4WDXA 4WRHA 4WDUA 3R6IA 4GACA 3BCJA 4ICCX 1J96A 2HV5A 4YVPA 5JH2A 4LAZA 2PZNA 4FA3A 1US0A 4QR6A 2PDBA 3WBYA 4XAPA 4WDTA 2ALRA 3QKZA 4LBSA 2PEVA 1ADSA 2IKIA 2PFHA 3EB3A 2FZ8A 4XO6A 3EAUA 2PDNA 2R9RA 1ZSXA 5AZ1A 4XVEA 5JH1A 1EL3A 1AFSA 2I16A 5LIWX 1T41A 4HMNA 4FZIA 4PR4A 1LWIA 1AZ1A 3C3UA 1ZUAX 3LEPA 1QWKA 4JQAA 4L1XA 3EB4A 1AZ2A 3CMFA 1C9WA 2ACRA 3H7RA 3GHUA 2IKJA 3UP8A 4PMJA 5C7HA 2J8TA 3V0SA 4IGSA 1PZ0A 5HNTA 4PRTA 4FALA 4JIIX 3M0IA 4JIRA 1QRQA 1X96A 2PD9A 3S3GA 2FVLA 1EF3A 5LIYX 2WZMA 3LQGA 1EKOA 3Q67A 4GQGA 1FRBA 4Q7BA 1S1RA 3CAVA 1X98A 4IJCA 3LD5A 4YVXA 2DV0A 1GVEA 1A80A 4PRRA 5DANA 3CV7A 4JQ1A 3UFYA 1PWMA 2ACQA 3D3FA 3UG8A 1XF0A 1AH0A 4WEVX 4AUBA 4XO7A 3WBXA 3DN5A 4QXIA 4LAUA 3N6QA 3LZ3A 2PDLA 4F40A 1RALA 4WDWA 2PDHA 2PDFA 3COTA 4Q3MA 2A79A 3WCZA 2PDYA 4ASTA 3LENA 2VDGA 3G1RA 5HNUA 3BV7A 3LNMA 3RX3A 2F2KA 1YE6A 2F38A 1PYFA 3M4HA 3WBWA 3V35A 4QBXA 3O0KA 1S2CA 1Q5MA 2FZ9A 3UZXA 3FJNA 1Z3NA 1Z89A 3UGRA 4OTKA 5HA7A 4GABA 2QXWA 3LZ5A 2IKGA 1PWLA 3GHSA 2IS7A 3R8HA 1RY8A 4JTAA 1R38A 2IPWA 2C91A 2NVDA 3VXGA 2PDXA 1HQTA 1JEZA 3LUTA 1LQAA 1MZRA 2NVCA 2PDPA 1IEIA 4JQ2A 3UZZA 4GA8A 1ZQ5A 1AH4A 3O3RA 4LBRA 4XZLX 4HBKA 2PDMA 5AZ0A 4LB4A 3KRBA 2ACUA 2DUZA 3UZYA 5KETA 4JIHA 4JQ3A 3Q65A 3V0UA 3MB9A 2PD5A 1VP5A 1PZ1A 3FX4A 2PDCA 3V0TA 4JTCA 4GIEA 1RY0A 4NKCA 2PDJA 4ZFCA 3GHRA 4H7CA 4FAMA 3LBOA 3GHTA 2INZA 2IPGA 2R24A 2P5NA 1AH3A 1K8CA 2FGBA 2IKHA 1MI3A 2IPJA 4LB3A 1MRQA 1UR3M 4JQ4A 4JTRA 3H7UA 2HEJA 1S1PA 3N2TA 2HE5A 2DUXA 2BGSA 4QX4A 4MHBA 3CAQA 3ONCA 4DBSA 1XJBA 4XZMX 5LIKX 2BP1A 3H4GA 5M2FX 3LQLA 1M9HA 1Z8AA 3U2CA 4H8NA 3GUGA 3UZWA 4GCAA 3DOPA 4RPQA 1IHIA 3NTYA 2HVNA 3BURA 1Z9AA 4YS1A 2HVOA 1YNQA 4DZ5A 1XGDA 4I5XA 2WZTA 2PDGA 4WGHA 3T42A 1EXBA 1Q13A 4IJRA 4XZNX 3R94A 3R8GA 4PUWA 3R43A 3R58A 2FZDA 3P2VA 3WG6A 4DBWA 4DBUA 4XK2A 4XVDA 3R7MA 3ONBA 4YVVA 3CV6A 1T40A 3RX4A 4JTQA 2AGTA 1SM9A 3UYIA 3LN3A 3G5EA
chains in the Genus database with same CATH superfamily
5GJPA 1CGTA 1NDWA 1Q2RA 4OZOA 3M64A 3B3DA 2BY3A 3A6OA 1K03A 1FFRA 1MFVA 5CC5A 3WQFA 5LIXX 1JDDA 1EWDA 4IWWA 3T09A 5LIUX 2FHFA 1XIEA 4EWND 1RZMA 3SIZA 4RNIA 4D1IA 3ITYA 1ZCOA 3QHNA 3FDKA 1X97A 1GOOA 4QDPA 1Q45A 3CMJA 2DIJA 4JDBA 1RLDA 1L8PA 1K9FA 4PUDA 4Z2LA 1UD2A 2EAWA 1ITCA 3VGFA 3TK7A 1H7XA 2ZDSA 1CWYA 5A2CA 1ELSA 1D2KA 5FF0A 2OLSA 3MBFA 3TH6A 1RQEA 2J88A 1JXJA 4W86A 4IOTA 1O1ZA 2XVNA 4J3WA 3VDAA 1QI0A 1GW1A 2ZRWA 3L5AA 4AYSA 7ENLA 3N6HA 4X63A 1EEPA 1XH0A 4CUCA 4JFVA 3SFWA 1QBBA 1DKWA 5LGXA 1VPYA 2WMIA 1EEXA 1X39A 1Y5XA 5DX7A 3ZSSA 3CQIA 2EGZA 4DF2A 1WZKA 5J04A 4OT7A 1DORA 1PSCA 1WDPA 2GGEA 3SRDA 2BY2A 3RPTA 1EF2A 4QS5A 3R2GA 4CNUA 1QWKA 5K4XA 2HPIA 1WKDA 2ZKMX 4EIVA 2GUBA 1KXTA 2J27A 1OBAA 3FVDA 3TN3A 4HNTA 1B2YA 1JR1A 5HR6A 3F4DA 3VMPA 4BY3A 4B4HA 4L61A 2FFIA 4L4OA 3NZ1A 1MXGA 2QUUA 2ANUA 3FVMA 4GIRA 3EDKA 2XFFA 2ZA3A 3MUY1 3M0IA 3T78A 2OMAA 4LY8A 1S39A 3CH0A 5EBAA 4DJFD 1EF3A 1G1YA 5C55A 3A9IA 2NWRA 3A4JA 2HNEA 1FRBA 2AKZA 3WF3A 4W7WA 5JBDA 1FTXA 3WKZA 3WUEA 3A21A 1XFBA 4NYUA 1GVEA 3M0JA 3VPLA 3IIVA 3NM3A 4H2CA 1Q7QA 1PWMA 1SW7A 3CL6A 1UWQA 2E40A 2OT0A 2XIQA 2A0NA 4QDWA 5G1MA 2YW3A 3WDJA 3R10A 4Q4OA 1CT5A 1LWHA 3DFOA 4PYSA 5C2GA 1UIOA 1Q85A 1CENA 1LG1A 4EWJA 3JW7A 4H19A 3RM8A 4B92A 4JHOA 2FTYA 1K4HA 3W2MA 3PHAA 4TOQA 5AYBA 3S9YA 2GGHA 3E0VA 4ORMA 1OHLA 3LRKA 2WOQA 3LPPA 2AMXA 4RE0A 3TW7A 3M4HA 1QU4A 1DJQA 3BLDA 2BODX 1QI5A 1CTNA 4PEKA 1SO6A 3I7RA 2KX9A 3GXIA 3A3HA 2I57A 2V5CA 1ISWA 1O7AA 2WZEA 4HHLA 2X1RA 5EYWA 1PJ9A 3RLUA 5FIPA 3LZ5A 3WFZA 3VINA 1HO1A 3W73A 1AQFA 3TN6A 3R0KA 3SDOA 1ZBKA 4ZR8A 1H50A 1KV5A 5FF2A 3THAA 1P4CA 3GTIA 3EOOA 3E6EA 3KVJA 4MDPA 2PZ0A 1AQ0A 1K9TA 2E0PA 2E5BA 2I56A 5DT7A 3BQ5A 4YCPA 3RF9A 1VEOA 3KRBA 4UTMA 5CPSA 1UA7A 2HNHA 3ATZA 2PWUA 3NOEA 5XIMA 4O57A 4H8HA 1JUBA 1P6WA 1OT2A 2J9XA 1YMYA 4I9JA 1MW1A 4D2JA 4K8EA 1P1MA 4KH2A 1V3LA 1H1ZA 3PZGA 1UJPA 5JBEA 3VNKA 1YIXA 4AIOA 7PTDA 3PG9A 4IIGA 3W2KA 3FHQA 3A5VA 1T96A 4HOZA 3MI6A 3U2OA 5C71A 2I9EA 2NV9A 2XSBA 3LBOA 2VD9A 1OSEA 1ZY9A 4HZ6A 5FAGA 2XN1A 2XH7A 1JQXA 5FJOA 4QG6A 2A3CA 3CJPA 3QJAA 4NJKA 1OX4B 1DJXA 4GXMA 3NEVA 1QW7A 2GQ3A 4G1NA 2ZRUA 1O12A 3N2TA 2Z2BA 3DUGA 3CUZA 4XAZA 4UTTA 1TTPA 1F7BA 2FH8A 2V3EA 2AKMA 1LYXA 1UD6A 4DBSA 4H6EA 4XZMX 1Q6RA 2BP1A 1HL9A 1HKJA 1R87A 5AHLA 1AG1O 4PCFA 2EF9A 4BR1A 3PWAA 4JIEA 3DG6A 3ZWTA 4E3TA 4JTLA 2VFGA 5J5RA 2AGKA 2YL5A 3NVTA 1QJWA 1XD0A 1GYLA 4M6UA 3EKGA 3W26A 3CH9A 2R14A 4U10A 1HJUA 2J78A 4WGHA 3EMQA 1QPQA 3QHOA 3VE9A 2V38A 1H7NA 2YL8A 2Z1WA 4YHEA 1NY1A 3LXCA 1V02E 1E6PA 4MWAE 3RLGA 4GUFA 3QY7A 4N6EA 4CNSA 2EBNA 5AYIA 1JCLA 1OB0A 3KHJA 1REQB 2PTDA 1UWIA 4LNCA 3AICA 3MYPA 2WJZA 3RCNA 3OHIA 1CXEA 2H8ZA 4ZB5A 3BLPX 4GINA 4FF5A 4H6QA 2YCIX 3WENA 4IFKB 3VA8A 3UWQA 3S5SA 1CXIA 2Y5EA 4DEFA 4QJ5B 1I2RA 2VFDA 1T8QA 4UXDA 3A13A 2WLZA 3SUTA 4BS0A 1OQFA 4E4UA 1U2YA 1YNPA 3SJ3A 3ARZA 3LGGA 2VI0A 4ECLA 4LGXA 3DEQA 3O6AA 4O52A 3I68A 2KZHA 1MQQA 5HMFA 1ZS2A 4K3ZA 4M7SA 4AZCB 1KM5A 2V5BA 4XZHA 3E0WA 4QG9A 4Q8MA 3W22A 2QCMA 3MHUA 3WH6A 4KGJA 2FJUB 3BCFA 3ABZA 3DAQA 1SFJA 2E6YA 2DZPA 4TMCA 3E02A 3TCEA 1H7WA 4F0HA 3LM3A 3W71A 2J7DA 3RGTA 2D2OA 4KFPA 4JOMA 1P6CA 3NUKA 2EEXA 3KL3A 3BUVA 2QUNA 2NV1A 4HSOA 4H41A 4FOJA 3S2JA 4IG2A 1I0BA 2WMGA 4CQDA 4FA3A 4AD1A 1BD0A 1CXKA 1P43A 4Z0JA 5DF0A 2YCEA 3F03K 1CYGA 1H1NA 5A2AA 1UWTA 5AC7A 1B3YA 3WK0A 4DWSC 1ADSA 2GJXA 1QNPA 1HKIA 2PE4A 3HN3A 4UFMA 3S46A 3KOYA 2WAGA 1A5SA 3W6MA 3DFPA 4KEZA 1KB3A 4GKTA 3SY8A 1XYFA 4HN8A 3OZPA 3MI3A 2GJLA 4AC1X 3LI1A 3GNXA 4N4QA 3AMCA 4GO8A 1GHSA 3H7RA 3RCYA 3W37A 5JVLA 1IIHA 3T08A 5KZEA 3PR2A 3O07A 2X16A 3NYZA 2GK1A 3A3XA 4O12A 5EPDA 1FWCC 1EIBA 3TONA 5D09A 3P84A 4OIFA 1MVYA 1QT1A 2OR2A 2H90A 1Y5VA 3VOHA 5EMMA 4ZB2A 2WNZA 3B9NA 3FN9A 1X98A 4IJCA 2GJNA 2YA0A 4N42A 1C8XA 1FHLA 5C9WA 1O66A 4NUWA 4AF0A 1A3XA 1N8WA 2W92A 3S2LA 4KWUA 2Q3RA 2CHOA 3J7HA 2NQLA 1OX5A 2PUZA 1FWRA 3QLDA 4XO7A 1U1UA 4D9PA 3EWCA 1YPXA 2D24A 3O05A 2D3LA 1RALA 2XYLA 5HK4A 4H2HA 4GPNA 4CVWA 4BQ3A 2C18A 3TWBA 2CWXA 3FIGA 1EJVC 5T26A 1WE5A 4P7RA 4B5VA 3EX4A 2IXVA 4GZIA 4WZHA 1UYQA 4C6JA 2R1KA 4I9AA 3VIOA 4O8RA 4Q7IA 2WWDA 1BTMA 3MJYA 1F76A 2WSYA 1MQRA 4LTSA 1XS2A 2PCQA 3REQB 2PWGA 3KS5A 1BWKA 4QBXA 3MSDA 4IL0A 1BWVA 1UKPA 3UVAA 4XV0A 1TJPA 3SN1A 3TNOA 2H3DA 1TZ9A 4ZFMA 4CD4A 2P50A 1S3TC 2GVGA 4IJBA 3UJEA 1J01A 2QJNA 2PLJA 3GO2A 4JTEA 4LV9A 3BICA 1H4PA 1I1XA 3AHVA 3W6LA 2QCLA 3CPUA 5EY5A 1MW0A 3RMJA 1X6NA 3F1QA 3L0KA 2G3FA 1MFUA 1CW2A 4MVAA 2DIKA 1XI3A 3L7RA 4DO7A 1KM6A 2QV4A 4RLIA 2CLHA 4K7VA 4DJDC 1W3IA 1EDQA 1IEWA 2OKTA 3CZLA 3MQTA 1G69A 2DGAA 3P67A 3XIMA 1B30A 4RDZA 4Z17A 2OYLA 3B06A 1PEZA 2VWSA 1J5TA 3WFLA 2WC4A 1IXNA 2QJHA 1PS9A 3CB3A 1QOQA 3UT0A 2HK1A 3AFBA 1JYNA 5F2IA 5A6SA 1HJXA 3VOGA 5K3VA 1OCJA 9CGTA 5E09A 5BOFA 4A2RA 4DBDA 4H7CA 4Q33A 2Y7DA 2WCAA 3GU1A 5C2CA 2CLKA 4LUIA 3CLMA 3PPCA 3OBAA 4AXKA 5ABGA 4GLEA 4HCDA 1S2TA 1FH9A 2G8ZA 1CB2A 5D37A 4GOAA 1ISZA 5A94A 1NOWA 1FXPA 2J6XA 2OB3A 2O55A 4HZ8A 2OLAA 2NV2A 3QFWA 1W9UA 2GJPA 4PMYA 3ZZ1A 4C7GA 4YTSA 2QDGA 2ZTJA 4NZ3A 3S2MA 4G6CA 4J5NA 3FOKA 1EJRC 3ABSA 2VM8A 2A6NA 5KSWA 2YZRA 4CQAA 4N4PA 3AYRA 4CD5A 3VYLA 3UZJA 5C70A 1EXBA 4X2RA 3UD6A 1QATA 3R94A 3MO4A 3IS4A 4C65A 3EDDA 4JX5A 4IPJA 3S1GA 2YOCA 1X8CA 4HNUA 1ONXA 1R6WA 1AW5A 3CV1A 4AD5A 2O4MA 3AC0A 4DBWA 3C86A 4FXFA 3NWRA 1U1HA 1JZ3A 1G0CA 1XYAA 1BXCA 1RK5A 1KM2A 3NQAA 1GW9A 2ZUTA 1XRFA 1QW8A 2VFHA 7TAAA 2Y1HA 4JEJA 3CXOA 2VDHA 3W7DA 1YXYA 3TWAA 1A0EA 1KTCA 2GGIA 2FJKA 1SMDA 1L8NA 4DF0A 3FHAA 3HPXA 2GDQA 3NZPA 4FF7A 2XIJA 3ZT6A 2ZC8A 4LUYA 4RZ4A 4UR9A 3VIFA 2JIEA 5TF0A 3RHGA 1RXOB 2RFGA 2FZBA 4DO5A 3WEZA 3GXMA 2VHLA 5DY2A 1R0MA 4GFSA 3B0UX 2G3NA 3SGGA 3UGVA 2DPEA 1F9CA 1EHAA 1DJIA 4US5D 4WDXA 4GYKA 2FTPA 1DE6A 1W3LA 3IGXA 3IJ6A 4KERA 2GUYA 1W17A 3E5PA 2HV5A 2I5GA 3BC9A 1JFXA 4XSMA 3NQ6A 1TSIA 3N1AA 1KBBA 2B81A 4DNMA 3G6LA 4JNMA 3AHZA 2BHYA 3PUEA 1KFJA 1W3HA 3NL3A 2C7FA 3HV9A 4GC4A 3RLVA 4P61A 2OWCA 3N4FA 2ZZ3A 4NF7A 3OTRA 3W70A 3CUFA 2PDNA 1BQCA 4TVUA 2UZ9A 4XVEA 5DLCA 1F3TA 3SECA 3WUGA 4D6EA 3APGA 1QPRA 3EBVA 4MUZA 3SRFA 4OGZA 2VRKA 5BZAA 1DIEA 1ZNNA 3WQ5A 1M7XA 2ACRA 4OOUA 4ZO7A 4P7NA 1TV7A 3VO0A 3U7BA 1DOSA 4NX5A 4AEOA 5HNTA 2E5DA 3C3NA 5A6KA 2VC9A 5CPLA 2OSYA 3PNUA 3GS6A 4TQTA 1T8XA 3ZJKA 4GVFA 1Q8AA 4E5TA 5G1YA 1UHVA 3S9ZA 2WZMA 1Y7VA 4LS1A 3LI0A 2CWNA 1XYCA 3A4XA 1NFBA 2DSUA 2V3FA 1AJ2A 3LLFA 5F4SA 4WUIA 2AAAA 1X38A 4Z2HA 4GZ7A 1C29A 3HBLA 1RP9A 3LD5A 4LEFA 3S6OA 3PSWA 2NW0A 1XBVA 3NSMA 2WCSA 1M7OA 4MLRA 3D3FA 2QT3A 3UG8A 1K7FA 3VIJA 3ARTA 2X09A 2XZ9A 4W8AA 1E1FA 4NL1A 4W4QA 3WF1A 3GD6A 5EBUA 3B0PA 3WQVA 3FSUA 1AMYA 4HNLA 3OLGA 3OU8A 2YB1A 5E6YA 3QQ1A 1OT1A 3VC5A 3VNDA 1J93A 3IEBA 1R3RA 1R3YA 2YBVA 3C2OA 2YBUA 2FPVA 3VUSA 4W87A 1YE6A 1V02A 1ZAIA 4MWAA 4B2DA 4Y9AA 3WBWA 4UOJA 3O7UA 3UXAA 3WLPA 2VX5A 3P81A 2DP3A 3W7LA 1S2CA 3NO3A 5DMLA 2FZ9A 1Z3NA 4Z2JA 1E72M 4B15A 4HA4A 3WLMA 1DHPA 3WEOA 2QXWA 1LQ0A 3G8EA 1V3KA 1EJTC 1YPIA 1SR9A 2VFIA 4GVIA 3PZ9A 1QASA 5FCZA 4AAJA 4HGXA 1SW0A 4DWDA 1OK4A 1I9CB 6TIMA 3TE9A 2V3GA 3UR5A 4LVBA 2G4FA 1F5ZA 1AH4A 3ES7A 5C5YA 1E73M 3LTYA 3OVPA 1RD6A 1V93A 1XRSA 5DCBA 2A3HA 3Q65A 4DBEA 2QJMA 1VP5A 4H00A 4F0MA 3TTEA 4UQEA 2YCLB 3QR3A 4UTWC 3OYXA 4INFA 1CGUA 3A9BA 1ESWA 4E38A 4DYKA 2VJXA 3K4WA 2CBIA 4IMGA 1THFD 4YTQA 3ZT7A 1R3VA 3A23A 4I6VA 1WKFA 3QN3A 1VFOA 1GKRA 1VBGA 2XFWA 2QVNA 3W7JA 4XX6A 3P82A 4RE2A 4MOZA 4H9YA 1EPVA 3OG3A 3ORWA 1E5NA 2G37A 1JF6A 5CJNA 3M44A 1MMFA 5AC8A 1TO3A 1MZHA 1JPMA 4P8XA 2BGSA 3RJXA 1GVOA 2D22A 4MHBA 2A7RA 3BMXA 2A21A 4HSNA 4RE4A 5GJNA 5BRQA 4HVXA 3ZJ7A 3SM0A 5LA0A 3SCNA 1H49A 1EBGA 2GVEA 1KKRA 3E0LA 3C0SA 2CESA 2YW4A 1XLGA 3QR0A 5H8PA 3DESA 3O16A 3QYSA 1Z41A 2OQHA 1RH9A 4KWOA 2J9YA 5DFAA 3I7SA 4C7DA 4JKMA 4Y8FA 1QNQA 1E55A 4FK9A 1V4YA 3E5BA 3A4AA 1L0PA 1UPMB 4XVDA 4J3XA 2YA2A 1A0DA 2Y24A 2Z28A 3GIQA 1UA3A 3EB2A 4C6FA 1NWSA 3LYEA 3W7GA 3DDMA 2GVYA 3LCLA 4HA3A 3W1LA 2HMCA 1UKQA 1GHRA 2PDKA 4ACYA 1CBGA 2PDQA 2QF7A 4EAYA 3NQVA 1W5PA 3QTGA 2VC7A 4D8ZA 1AK5A 4IQEA 3M41A 3URQA 1UWUA 5J5DA 4TVDA 4GYFA 1UMYA 3F7JA 3VIIA 1ZL1A 4JN8A 6TAAA 1DWGM 3IANA 3W28A 2PBOA 4BWLA 1G9HA 2ABAA 2PDWA 5AECA 4G5DA 3TLLA 4E2VA 1W2PA 4U3AA 1KQZA 4I3GA 2DJXA 3SRHA 5I3GA 1SQ7A 1VD6A 1C93A 1M41A 1PKMA 3GU9A 5C9ZA 1OFAA 1W0MA 4HJFA 1KKOA 1WXYA 4LUJA 4MM1A 1IEVA 3FYYA 1ECEA 1WBHA 1EZWA 4IX2A 4OV4A 2GDUA 3AS1A 2IPFA 3HZ3A 4REQA 5CSYA 5DELA 5DO8A 3SJNA 1M68A 1TTIA 1IWPA 1MQPA 3SN4A 4LYRA 1IGWA 3WJSA 4PBGA 3CL8A 3WQGA 4GUHA 3VGDA 1ZAJA 1PVNA 1RP8A 3CV2A 1EBHA 1EPXA 1FCVA 4IP5A 3K1GA 3QSTA 1FKWA 1ALDA 3HB9A 3AOFA 4Q8PA 3BZGA 1TQJA 1V08A 3CUHA 2PFHA 3TDFA 2PWHA 3N2MA 1YDVA 1D3CA 4ACZA 1N82A 4W7UA 3CQHA 4KEMA 4S1FA 1VBHA 3H2CA 1OADA 4IGNA 4ZMGA 1GZJA 3C3UA 1KQYA 3L4WA 3URBA 4J4KA 3KLLA 3O63A 3OBKA 3QQ0A 4ZEPA 5D2WA 1W31A 1W1ZA 3GDRA 4CD7A 2V6AA 3CYJA 5AC5A 1DE5A 3ZO9A 2WMFA 4IIDA 3VABA 1NWTA 4FALA 2QV5A 3L67A 4C6QA 3EMCA 4NHVA 4Y8EA 1A5LC 4L6OA 1QHZA 3QZAA 2D2JA 3IWPA 1EFZA 2YA1A 2NX3A 2ZBTA 3RXZA 4ICMA 5EMLA 4G7FA 4L56A 1XYZA 3CAVA 3W7MA 4WVXA 4PB5A 1PUDA 5LXXA 4FLRA 3SGZA 3WD1A 4GWEA 4ROQA 4GIYA 1S5WA 1QO2A 1UR8A 2CHNA 2ACQA 5HXMA 1PIIA 3PWIA 4AUBA 4PFHA 1TR9A 2FZNA 2OGJA 4CCEA 1S2VA 2J24A 2INFA 5KZMA 3ZLHA 1P7TA 3F2BA 2BVWA 1V77A 2Z00A 4AVOA 1OFBA 1YYAA 3E74A 4KIRA 3P93A 6ALDA 4UUIA 3RUBL 3AMKA 1O68A 3MYOA 4O19A 4PSPA 4H7VA 1OZQA 3H21A 1GORA 4Q8NA 2D0GA 1US2A 4A8RA 1KBKA 4X22A 3BPWA 3W1MA 3EA2A 2NSOA 1OD8A 1FDZA 2E1DA 3C2FA 2TYSA 2ZUMA 2JKAA 2WQDA 3M43A 3TMLA 5FL1A 3ALGA 3LCWA 3B8VA 1O1HA 3LB0A 3N3TA 4F0KA 3T81A 4F9DA 2RGLA 1VYRA 4K8GA 3W1RA 4Q4PA 5CG7A 3LSBA 1PE1A 2P1FA 3EPNA 4Z1AA 3KL5A 1HQTA 2DQWA 1LT7A 3N73A 4XAFA 3EYPA 3JZUA 5D9OA 1LJYA 3V75A 1IEIA 4IF2A 2OZ0A 4EK7A 4HYWA 2I5IA 4OWGA 4HBKA 3W2NA 5LA2A 5AZ0A 1RHCA 1PV8A 1GOKA 4K39A 4ONVA 1KRMA 3TQ0A 4I6KA 3LHWA 1KGXA 4HA1A 1MNSA 1Q7MA 2V68A 1TREA 3WH9A 3UJSA 2Z1SA 1IGSA 2OTDA 4JYDA 4PBFA 4D8AA 5JXQA 3BAXA 2VEFA 3I6RA 3WIJA 3WLLA 2WSRA 3FV9A 3QF0A 5A6MA 2VUYA 1TJ2A 3R0DA 1K8CA 3SQSA 3SCPA 4KWWA 4E3VA 3SFKA 1RA5A 3BOFA 1RLCL 4FB7A 4DX3A 4LF1A 1S1PA 1OWQA 1IXPA 3N9RA 1P5BA 1ITXA 5L6UA 3BLOA 1PBGA 3OBEA 4O11A 3CAQA 1S38A 4OBSA 1V0MA 3GTHA 1X1NA 1GOWA 2P8CA 3DG3A 3B8SA 3MMWA 1YKWA 4GUGA 3EEZA 3GUGA 1PX8A 1J2BA 3W87A 2HISA 3FEQA 3PPHA 1PYMA 3FGCA 3H4XA 5FF4A 8RUCA 1ZENA 3GG0A 2FHBA 3CT2A 1YNQA 3E2VA 1HL2A 4J3UA 3LRLA 4XZNX 1LLWA 1EJWC 1KA9F 5IRPA 3B8UA 3QXBA 1VCGA 3IVTA 5K7JA 5HUOA 1W91A 2Y8KA 3WLIA 1KFKA 2NT1A 1XV8A 4L4PA 3DBPA 1QPOA 3W02A 1E0UA 4A3RA 2YL6A 3HQPA 1WNOA 2ZX8A 4YVVA 3L65A 1DPMA 3N12A 4Z1YA 1O5KA 1PTGA 1KCKA 2DH2A 5BCAA 3W23A 1XLDA 3OQ8A 2X1IA 1TB3A 4B16A 3CT7A 4GH1A 3UBPC 5LKYA 3ZT5A 2ESCA 4G7EB 3CS2A 4AZ5A 4AEFA 2X1UA 5LA1A 5CC3A 2Z0IA 1BRLB 3THQA 2P3EA 4ZSUA 1XQKA 3VKDA 3BSHA 4UB9A 4IHCA 1JCNA 3L0GA 4WLCA 2CLPA 3VU2A 3TROA 3VGGA 1LUCA 2BS9A 1EZ2A 2IQ0A 2G3JA 2WVVB 4QAWA 2WHJA 3ANYA 4P8WA 1UH2A 3LNPA 1JF5A 2GSJA 2E9MA 5IM51 4DI9A 4EVZA 1DTUA 3E2SA 1VS1A 2D73A 1OGGA 2BOGX 3CHDA 1B31A 4AY7A 3ISIX 2VC5A 3ITVA 3LHYA 1J96A 3AXXA 1KO0A 2E5CA 3M6YA 3M0LA 4H9VA 1US0A 2RKXA 4QSFA 3H2NA 8A3HA 3RMEA 3TSDA 1QW9A 4V1XA 1I6NA 3S1XA 3WMSA 1VFFA 3T1GA 3MKKA 4I7WA 2ZZ4A 1MYRA 3VI2A 4UR7A 1X8FA 4I9TA 3T4CA 1CXLA 3EX1A 1NWUA 2DVUA 4XKYA 1K3UA 1N7KA 3PZQA 3U9IA 3L0NA 3TUUA 4AQLA 4QJ3B 1ONEA 4W7VA 4L1XA 3EB4A 3CMFA 3CWHA 5LNVA 5HANA 1QNOA 1ZALA 1PKNA 1GVSA 5D30A 1WKEA 2D20A 2WC7A 5C7HA 1GVQA 3WMCA 2E7FA 2YLAA 1Z6KA 2YFOA 1UCWA 4JIRA 3TAKA 1NOFA 1FA2A 1PDYA 4PUMA 2R6OA 3EDEA 1W9PA 3GY1A 4LC8A 5LIYX 1WDDA 4NXKA 5G2IA 4K7YA 4H9MA 3IV3A 1H7RA 1TV2A 1DWAM 2J74A 1GEQA 4K36A 3P62A 2HSAA 2ICSA 1E9ZB 3II1A 4MJZA 3MHGA 1W6TA 2PGFA 4PUEA 4D72A 2ZICA 3DH7A 4KGLA 3QGKC 2BVDA 1OFDA 4C90A 4YMZA 4GI8A 5AHFA 5I6SA 1NVMA 4WY0B 1H61A 1DJGA 2WK2A 2GYIA 3UF9A 3CC1A 1EH9A 3GTNA 4AZ7A 4LYPA 2ZZ2A 4DN1A 3N17A 1QPNA 5BXSA 4LALA 3FKKA 4N9EA 2PODA 4HJWA 1ECQA 2NX1A 1JCXA 3WLKX 4Q8TA 1V6WA 5REQB 2OZ8A 3MKVA 3VX0A 3ICJA 2ZVIA 4WCJA 4H1ZA 4FIQA 4IISA 3TR9A 3CLWA 4C6DA 4UTFA 1O4UA 3FNDA 1P0EA 4LCRA 2ZX5A 4R7WA 3KCJA 1QPKA 3BSMA 1R38A 3T0TA 1ODZA 2NVDA 3MHFA 4NZ1A 4LUTB 2GSHA 4U5KA 4H6RA 4GIAA 2XISA 8TIMA 1ZPTA 4OUEA 2VQTA 3GNOA 4XAGA 4X0NA 1K6AA 4PZVA 4UNKA 4NXSA 4MZYA 3MJMA 3RO8A 1KFWA 1EJUC 5DQPA 2PLMA 4N9CA 1YADA 1PZ1A 3M47A 2X1SA 1RR2A 4KW2A 3UG5A 2NQZA 1VYSX 5D32A 1J0HA 5LXEA 3G1DA 1D8CA 4HMCA 3GHRA 1ENUA 4OECA 2ISDA 2VGGA 4PFMA 1DIDA 4Y9OA 3IVUA 5GNXA 2E9LA 1DBTA 4I7UA 5HUPA 2ZZ6A 2DUAA 1LOLA 4N2YA 1YBQB 1GQLA 3OEXA 4F48A 3GC2A 4AIUA 1ITQA 2XVLA 2IPJA 1JCTA 3SADA 4KMQA 1Q7ZA 3TYDA 4BK9A 1BG4A 1UW9A 4I8DA 1FKXA 3NQEA 4UWMA 1B90A 4MB4A 2Q8XA 5C54A 3QMRA 4XZWA 2EPOA 3HJZA 3IGUA 4UQDA 3QZ6A 4DJFA 1KM3A 1Q6LA 4CNPA 3H4GA 4RCXA 4WOQA 1LDCA 1DYSA 2ZADA 2ZUWA 2V30A 4S3AA 3LM7A 4LUSB 3WH5A 4RPQA 5CBBA 1RBAA 2H6RA 4PODA 1E1CA 3KX6A 1I75A 4GHRA 1SO5A 1ZHAA 3BURA 1KR1A 1PHWA 2V0TA 3GZ3A 2VCCA 4GKLA 4O13A 3T7VA 3C61A 3TMQA 2DSZA 1LBLA 1OC7A 2VXNA 3CHVA 3SURA 1H51A 2NUXA 4IJRA 3TCSA 1GPWA 5BU9A 2XVKA 1RD5A 3QPEA 1B9ZA 3VMOA 4AMAA 1YW1A 4ZTXA 5LHFA 3GVQA 4EP8C 1NQKA 1Q63A 4ZOEA 2OGYA 4MY9A 3WZ0E 4ADUA 4FNSA 3LXBA 2FVMA 2NQJA 1E0WA 1JL8A 2AGTA 2BSLA 3G5EA 3FJ4A 3SRKA 4QCFA 1W5MA 2GPTA 3UXLA 2QNEA 3HG3A 3NPWA 3SCQA 4DF1A 3QMSA 1UP0A 3L66A 3O8AA 4WXYA 2HXUA 2GVJA 2YCJA 5CSUA 4PH6A 4PCSA 1YE4A 2V2DA 1I8JA 5G2HA 1EA9C 1JZ6A 5HWMA 2EKCA 2ZXBA 1EHNA 5CPMA 4PRWA 3VAVA 3FXGA 4DNHA 5CLWA 2WMIB 3AJXA 3PY2A 4IZGA 2DVTA 3WH8A 3URAA 3NQDA 3AIEA 4Q8WA 2VO5A 5CPQA 1OCNA 3K8KA 4ZXOA 1QFEA 1ZBCA 1TA3A 3LU2A 2Z1XA 4GYPA 2XM1A 1B3VA 4NJGA 3T40A 4M8UA 4L1WA 2WCGA 4DZHA 3NURA 1TVLA 3OYZA 4UFLA 1AL8A 4RPPA 4L9XA 4OUIA 4CU8A 3PPGA 2OU4A 4JNYA 3QPYA 1GG1A 4ORIA 1BAGA 1UZHA 5JH2A 3WMLA 4BEUA 3S1VA 4NI8A 4AVFA 3ITTA 4L64A 5FACA 3KCOA 3RIKA 2QAFA 1V3JA 3A24A 3LGDA 1V7AA 1OIFA 3VIMA 3BOLA 3GLCA 1NF0A 4DUVA 1MDRA 1TCMA 3E2RA 3MCNA 4DY1A 3FY1A 4UIOA 1GK8A 2GGGA 4PE8A 3TA6A 4LAMA 1UD3A 2R9RA 4GNJA 5C9UA 1EL3A 1H62A 2O9RA 3VIPA 2AL2A 2Z7GA 3LMZA 2ZUSA 3KBJA 4KEVA 4PR4A 1XQLA 5CZJA 1O94A 4GK8A 3RITA 1AZ2A 2PGWA 4KCTA 1SO4A 1KM0A 4OFCA 4XUYA 4BKNA 1E9LA 2OOGA 3KTCA 3PTMA 5FJIA 4GQQA 4UQCA 1XIFA 2ATSA 5CZSA 3V0SA 5EKYA 1J12A 1HX0A 2VGIA 4UR8A 3EA3A 4G56A 3VNZA 3K2GA 3DFSA 3VILA 2NXIA 1TWZA 4AD2A 4C7FA 3U0HA 2A5HA 2BXYA 2CIPA 2CETA 3WJZA 1GEHA 4R7OA 5C0QA 3MUCA 4Q8OA 4EACA 4GQGA 3S5YA 3Q58A 4OU1A 1QHPA 4Q7BA 1GGOA 4ZE4A 4O4WA 1F61A 5A8QA 1TTJA 3JZEA 2XM2A 3AI0A 1BVNP 5JBFA 3UW6A 3ABQA 3BG3A 4KRUA 3PNZA 4HPGA 3GWQA 4HTYA 3ARWA 4WEVX 4FHAA 5LHEA 3QLLA 4EF8A 3NSXA 3ZR6A 4WJEA 2DZAA 1QNSA 3IK2A 3FYPA 4MNLA 5I3DA 3N15A 3FA4A 2F2HA 1OINA 1K1DA 1NARA 3RM9A 1US3A 3VTRA 2ZX9A 3KWSA 4AC7C 1FWIC 2VDGA 1X6LA 2OEJA 3VGEA 5CGMA 1SFLA 1AVAA 1C92A 2DT2A 1Z44A 1PYFA 1I60A 4AHPA 3VZZA 3P5YA 4XBSA 4GQBA 5DMMA 2G41A 3D46A 1E9YB 1OF8A 1IEQA 5BXTA 2BLEA 2IXUA 3S6TA 1WPCA 2NXHA 3I4KA 2UY3A 4KBXA 5BMWA 2PC4A 3UA4A 3W1XA 3GHSA 4DXKA 2WSQA 1RY8A 4F79A 1JDCA 5A6JA 2IPWA 2OQYA 2BWGA 4F2UA 4QLJA 3MCMA 4N02A 1R46A 1PCWA 1JIBA 1MW3A 4EAMA 3A4WA 4S39A 1MSSA 4Q4QA 2QDDA 4GA8A 3OB8A 4PTNA 3RG6A 1Q6CA 1JULA 4HYVA 3K8LA 3A3WA 3HF3A 1JDEA 1I45A 4L1GA 2JKEA 3LHZA 3OGSA 2OQLA 1SVDA 4ERGA 1P6BA 2W9MA 2RDTA 2PD5A 4MFDA 4HHMA 3UPWA 3CTLA 2HBXA 3FX4A 3MCOA 3OP2A 2DORA 3O6DA 3N13A 4N0RA 2C1IA 2CLEA 3WNPA 3BLKA 1GQIA 4R34A 4HCLA 3HGJA 1R9ZA 2X1TA 1WAUA 2LLEA 3W7RA 1KCZA 1MXSA 3ZWSA 1SMAA 1UD4A 2EG8A 2I14A 4JQ4A 4IT1A 3VKAA 1CNVA 2X8RA 4KFOA 4H9TA 1FCUA 3W7HA 3VIGA 1JCJA 1XJBA 2D23A 2VELA 4AXNA 3PULA 2VOMA 4MB5A 1JUKA 3BH4A 4LX4A 1FCBA 2YXGA 3DFHA 3WY1A 3BGGA 4J3TA 3NTYA 5ECVA 3K4AA 1Z9AA 4V2XA 4X61A 4B3KA 1SR0A 3BWWA 3WNNA 1HFBA 4F0SA 2Y85A 1Q13A 1HJWA 3NQ8A 4GFIA 2GQAA 1HTIA 3KAOA 1EB3A 4QAIA 1P0KA 4C6OA 3EWBX 4LYKA 1QNRA 1IT8A 3H4WA 2BZNA 4JY8A 1GUVA 2PTYA 2MANA 1XLMA 5F2GA 4P8VA 4DM2A 1E5JA 3ZSTA 3BJSA 1NJJA 5CPOA 4MJMA 3W29A 4AIEA 2J4GA 2WHKA 4ZE5A 3CAWA 3WLSA 2YB4A 2FB2A 1L6GA 5PTDA 3MUZ1 3REQA 3UJFA 4CD6A 3KOZA 4JR5A 4MJ2A 3H6OA 1EOMA 2CXGA 3TV8A 4GQ0A 3S1UA 3WJYA 3DGRA 1UWRA 1OG6A 1AA1B 2C3ZA 3OIHA 3G6MA 2R1LA 4M5PA 2HE8A 1UKTA 1F3XA 2QPXA 1VBJA 1PZ3A 2JIWA 2JQXA 3PTQA 2GJXB 5I07A 3DHPA 1EYEA 1ZP3A 3VD9A 2C0AA 2Z27A 7REQA 3WQEA 2MUCA 2XFYA 2D3NA 3PZIA 1IT7A 2QW5A 3KRUA 3PC0A 3ZJ6A 3DERA 4X3ZA 1UIPA 1WAWA 3STEA 3NQFA 4U5IA 3M5ZA 5LNSA 3CPRA 4XZIA 3AISA 5K9XA 2J75A 2I1OA 3WK2A 4PTXA 1XW8A 2Y0FA 1SJDA 4PC8A 4AG0A 1IXOA 3FA3A 4NNBA 4JTKA 3WQWA 4MB1A 2HROA 5BXRA 2GK1B 4A29A 1QO5A 3B05A 5HR7A 3AUOA 4HK7A 2DQXA 4JTUA 5I00A 4Y7EA 1Q65A 4Q8VA 4XO6A 2IQTA 3PK7A 5F1UA 3L4XA 2GQ9A 3TW9A 5I5RA 3P74A 1UR2A 5LIWX 4MNJA 4M3PA 1WDSA 1VIZA 3M7SA 4AF0B 2PLKA 5CZTA 1K8ZA 8CGTA 1F74A 4ZXLA 5FSDC 1XP3A 4FXJA 3A12A 5FEPA 1V5XA 5CC6A 1MUCA 4UOQA 3UETA 1I0DA 1TE1A 5ABHA 1FOBA 3P7YA 1BYBA 1DV7A 3Q45A 4TO8A 5AC6A 1XSIA 3GK0A 4PRTA 3SCSA 1R9XA 2J8GA 3G3DA 3M46A 2A3LA 1EGMA 3BAJA 4AB4A 2PD9A 1JD9A 5CCZA 1JYVA 3NVDA 2WQPA 3VM5A 1WXJA 4A8NA 3BG5A 3WDIA 1BEUA 3SI9A 3TFXA 5A8OA 3FA5A 3O06A 3W7IA 4IIFA 4C6MA 4X0VA 1GOMA 2J66A 4KIEA 1XBXA 3FAWA 2G97A 3S5OA 1A80A 4PMQA 1TV3A 3TKFA 3NR0A 4AZIA 3CV7A 4JQ1A 4ATLA 3GIPA 2Y6ZA 2Z1KA 1LZOA 2UWFA 4NZJA 1TVNA 1MEWA 1R47A 2WMJA 1RCXB 3CHCA 4IPLA 1KCLA 1VRXA 2E68A 1IYXA 1TPDA 5EFDA 3N6QA 3W75A 4YWSA 2C14A 3GVRA 3OLIA 2HXTA 1BLIA 4QEEA 4ROPA 2PDHA 4PSRA 4Y2WA 1JYXA 2A79A 3LERA 3P0WA 4B9YA 3WNOA 4RL3A 3P80A 3NNTA 3WN6A 4D6JA 2R8WA 4TV5A 5TNVA 3B4UA 2ATMA 1AJZA 1Q3NA 4GYJA 4Z1DA 1B0IA 3LLDA 1KTNA 1R9YA 1W1YA 4DJEA 1IXQA 1FWDC 1CLKA 3AUJA 1WZAA 5G4HC 1WZMA 1Z89A 4IM4A 4I8YA 4MY1A 4WF7A 3SB0A 3MWAA 5HA7A 2NUWA 3TX9A 1VJSA 2ADAA 3E0FA 3H23A 3ITGA 2OT1A 3HM7A 4RNHA 5I78A 4O53A 1M3UA 1HP4A 4C6PA 1MNZA 4US5A 3WSUA 1O5XA 4AMCA 1EGZA 4DWSD 3NA8A 1C8VA 2CU0A 3WF2A 1ZJIA 5HINA 3NXFA 2PDPA 1WB0A 2HWGA 4K6AA 3V5FA 4AZGA 2QGHA 2PS2A 3B0YA 3UZZA 3KM8A 4WKFA 1YLVA 1O5QA 1OG0A 4O4VA 3O6YX 3UZ5A 2CC0A 3I3EA 4QITA 4C1KA 3C56A 2Y89A 4HU0A 4AH7A 4A3UA 2J8FA 5C9RA 3S2CA 1GCYA 2OSWA 3WL0A 4BA0A 5A5WA 2DZVA 2PDCA 3VKJA 4PMZA 2RDXA 2XU2A 3B8WA 4UTJA 1K8XA 3MUAA 2D2GA 1Y8BA 4E8CA 1UG6A 1J11A 4U4MA 3G1SA 5D2VA 4BI6A 4GE8A 2J7FA 1P0DA 1BPLB 1CZ1A 4J2MA 3OG2A 3TZFA 5KMYA 2DZUA 3G8RA 3M0KA 2Y5JA 3IUHA 3TJLA 2UY2A 5MHBA 3PP7A 1TPFA 4QX4A 4BQ5A 1UD5A 4D6DA 1FWJC 3CZEA 1M9HA 2E4TA 3OA3A 4L6HA 4XD6A 2WKGA 1LM1A 2RDUA 1JRBA 3GAYA 3WUFA 4KFNA 1XIGA 1Z7AA 1G94A 1DXIA 1XLBA 3KEHA 1H41A 4DZ5A 4B5UA 4I5XA 1KWKA 3H24A 1QCWA 4Y90A 4IP4A 1GYMA 1VR6A 2GL5A 4L9ZA 2ZQ0A 2FIQA 2GJRA 4NVTA 3VFLA 5RUBA 3TC7A 3K4DA 4UTTC 3OA5A 3OO2A 4HKPA 2YJQA 1XINA 1H3GA 3T44A 3G1YA 3CK5A 1PXGA 3R7MA 5AY7A 4B5TA 3UG4A 4IL2A 1C90A 3P8IA 1JFHA 4IPPA 5SWUA 2OFJA 3TTSA 4ZQPA 2O4QA 4HK5A 3S6DA 2C0HA 1TV8A 2G3IA 2FTWA 5HJYA 2ZIDA 1W37A 1XIIA 1VLIA 4HMDA 4PUUA 3MO7A 3WQ8A 2X0HA 5IBXA 1J0KA 3TA9A 1WOAA 2VZOA 4M80A 3OODA 4P7OA 1V3IA 2OYMA 4JXCA 1KD0A 3BDKA 3L2LA 5K4ZA 1IR1A 3RPDA 4AZ6A 5CSSA 5I0DA 4DZIA 4D6IA 1VFHA 3KE0A 3V1PA 2O7SA 2WMKA 2POTA 3L2IA 3IJ7A 3MS8A 4Q8UA 4DJDD 4X60A 2QYGA 3AIQA 1LLZA 1HW6A 1UJQA 2XH0A 4S3BA 1PHQA 3MP3A 3MSGA 1NH6A 3E9AA 1Q6DA 2HCVA 4TVCA 1SSDA 5BNKA 2CHRA 4WK9A 5A6BD 2TRSA 1XLHA 2WZHA 1E4LA 3L4VA 2HDJA 4D8LA 5E9XA 3ARVA 2BY1A 4IMAA 4QLKA 3MTWA 2V3DA 1KM1A 1EXPA 5JUVA 2PDUA 3TYEA 3QQWA 1XXXA 1QI2A 2B7OA 2PP1A 5I79A 4GACA 4DQWA 1XL9A 1L9WA 4O50A 1B4KA 2YCLA 1EUAA 4JTTA 5TIMA 4LYQA 3D6NA 1K70A 3NZRA 1AMKA 4HNCA 3VCCA 3BARA 4MNKA 5H6HA 1DXEA 2W67A 3U3HA 5DY3A 2JF6A 1EGVA 4O1FA 2WB5A 2J77A 1EJXC 1X1ZA 2DSVA 5I06A 2X7VA 3HA1A 1X1OA 1OFEA 5AZ1A 5JH1A 5TBOA 1OCQA 2BVYA 4A4AA 1QWGA 5IHSA 3QYQA 5HBFA 3QTPA 1XDLA 1BYCA 2EG7A 1RBOB 3ZXWA 2ALDA 3N2OA 2BDQA 3F5LA 4DI8A 1CGXA 2BXZA 2WSKA 3PBVA 4GY0A 3GH4A 3XINA 1TPUA 4TX8A 5AN7A 2ZX7A 4XBJA 1NDVA 4LH8A 4JYEA 1MXDA 4DPQA 1AUSL 4F0RA 3S3GA 4NILA 1W1TA 4J1OA 3MWCA 1XYBA 3TTOA 3QY6A 1UR1A 3SCTA 1AQHA 3AXHA 3Q67A 5DXYA 1VF8A 2YL9A 3CZKA 2EPKX 3CO4A 3C0JA 3E96A 1LF1A 1B54A 3T07A 2DJLA 1E0VA 2QMJA 2DV0A 4WJXA 1AD4A 1J2WA 1E4IA 4NAFB 2Q09A 2D69A 1KCXA 3MT1A 1RA0A 3XISA 4NZFA 1AW2A 4RV3A 5ABFB 4M29A 3I4EA 4GRSA 4BQ4A 4GI6A 4JTFA 1TRIA 4DLFA 3WD2A 1OCBA 3WLRA 4WSJA 4H83A 4PBEA 4ZGYA 4F40A 2ZRXA 3SSJA 3ARRA 3MZNA 2PDFA 3HFYA 4KWVA 1GZGA 4M1RA 1BTCA 3W6YA 1JPIA 4ASTA 2OLHA 2CCRA 4UTHA 3IIXA 2ZDRA 3LNMA 2F2KA 4RDYA 1A5MC 4H9UA 3TTYA 1LL7A 3KS6A 3VDBA 1ZTVA 1WBJA 4XZBA 2REQA 3QGVA 2G4JA 1HNYA 3APTA 3E2QA 4J3SA 3UZXA 1KRAC 3FJNA 1EO5A 2XSAA 2C13A 3NL2A 3PUDA 1C7TA 2QR6A 1XWYA 1A50A 4OTKA 1UP2A 1GVFA 1QTWA 4NU7A 4QISA 3MDUA 4CEUC 4UQBA 1XG3A 2IS7A 5CH9A 5I77A 2ZA1A 4M6QA 2Q3OA 2HPMA 4K37A 4LRSA 3LUTA 3IV8A 3EPMA 1W5OA 2KAUC 5LZLA 5HMSA 2UV8G 2YPIA 3SUWA 5HWNA 4O0QA 3TW6A 2EPMX 4BJHA 4XSLA 1DJHA 4Z2IA 2XDFA 3QZEA 1SZNA 1UZ1A 3VDGA 4LPCA 2YDRA 4RXGA 1TV5A 3STGA 1VZWA 3N04A 1PTAA 4GCXA 1OFOA 3LPGA 2OCZA 3APYA 4OV9A 1BG9A 3FK4A 1C9DA 9XIAA 1TZ7A 1ZJAA 4FAMA 4IUGA 2ZZ5A 3B4YA 3SQLA 1AH3A 2C6QA 1V6VA 2BG5A 2E8ZA 3FJ6A 2Y7FA 2ZE0A 5G2WA 4JHZA 4G9PA 4BQ2A 1TJ1A 2TMDA 5I2UA 4MAVA 3NL6A 4GGBA 4FR1A 4AISA 2ZYFA 2G50A 2ZUNA 4OOZA 3N18A 1B3ZA 4N9BA 3KBNA 1VFUA 1FCQA 4HOWA 4DUWA 5A8NA 1LL6A 5HJLA 4M0XA 3U2CA 1XBZA 4C1NA 3I3DA 1XGZA 5D04C 2FKPA 2CNCA 1NTHA 5TAOA 3ZVHA 2BOFX 4MKNA 1IT0A 4DPPA 3UCDA 4IP7A 5FA5A 3S83A 2WZTA 3GG7A 3JRKA 3C52A 1GQNA 3KXQA 4ZA0A 4NRSA 4WX2A 4DELA 4QE1A 1FHDA 4EE9A 3USZA 3KBVA 3JU2A 2FZDA 5KTLA 2V63A 4HNOA 3I7QA 3ONBA 1L6SA 4JS3A 1OGSA 2BNJA 2F7FA 3E38A 3SZ8A 5HQLA 9XIMA 3PZTA 4A05A 4REQB 2VNCA 2J79A 2PBGA 1IQ8A 2ZUVA 4ZTYA 2GUUA 4EXBA 3AS0A 3V36A 3BO9A 1S5VA 1W54A 4YXGA 3MP4A 2RHGA 4ZQMA 2HVMA 2QJIA 4ICNA 4UQ9A 6REQA 2V2CA 2ZRVA 3Q37A 2ZE3A 1F6KA 2BMBA 1CEOA 5HULA 3B9EA 1JZ8A 4ACZB 4QQUA 3B97A 4A3QA 2OPJA 3ABOA 4H4IA 3DKLA 4Z1BA 1JXKA 4F4RA 4ZBCA 4DLMA 2PI6A 3EWZA 1FY6A 4NSBA 4UMCA 4NJIA 2XGIA 4HP5A 1EA0A 3QC0A 3ZFHA 3W1UA 1JAEA 1GOXA 1CGWA 4HPJA 4S2CA 3HPAA 2WNQA 4W5ZA 2ASHA 2J7CA 3UPBA 4PB4A 2PC8A 1IR2A 2GSEA 1E70M 4LQ1A 1E40A 1UR4A 5C9XA 1KLZA 2VZVA 3RPMA 2FZ8A 3LCXA 1IV8A 5FJRA 2V9DA 4GBUA 1B5TA 1ZSXA 4DUOA 2PRHA 4C1LA 2NWSA 2UY5A 1L2UA 2GWNA 4H8UA 3NDYA 4IFOA 1DWIM 1QNVA 5U7SA 3PZVA 4C6LA 2DW6A 1NSJA 2BGNE 3CQKA 1J6PA 2V69A 3DECA 4WJ8A 3K30A 4IGMA 4PMJA 3AALA 1XX1A 3G0XA 2V5JA 1AL7A 4CGTA 4JIQA 4OBTA 5BXPA 3U4FA 2QCFA 3KUMA 1WO2A 4G2DA 3NDZA 2BTMA 1OYAA 3GG8A 1T7LA 4ADTA 4Y96A 1W1A1 1POJA 1XPYA 4U28A 3WO8A 1NDZA 4GD0A 5HDRA 1FWGC 2X40A 4AWTA 3CEPA 4TTUA 1A3WA 3U2ZA 4H9XA 3TXVA 4FXRA 3L68A 4S38A 2VZTA 2GLKA 3PFRA 2X0SA 4S3DA 1CLXA 2Z24A 2BB0A 1TE6A 2FLIA 3M0MA 3MY9A 6A3HA 3R5EA 1XF0A 1BSIA 5M3WA 3TNBA 3WBXA 3WYZA 1XIMA 5BYWA 2CW6A 3VOJA 4HB7A 3EZ4A 4KPLA 3PAJA 5EGRA 3COTA 4DHGA 3BK0A 3KBMA 4G7EA 4Q3MA 1N55A 4IUOA 1UZDA 2VEPA 5AYZA 4WY0F 4E2DA 2QZRA 1VEMA 4V1YA 3CWOX 3G1RA 4NZCA 4Z1CA 1FVPA 3LHVA 4GC3A 1V6YA 2C19A 5BRPA 3OGRA 1DWFM 3LY0A 3TOYA 3W7OA 3CB8A 4C6CA 3N4EA 3HIJA 3GNDA 2Y7GA 3F4NA 2WNNA 1FWSA 3NDOA 3VDCA 4RZ6A 1E3ZA 1B3OA 1QAPA 2W5FA 4Q8QA 1HKWA 2WHMA 4ZSTA 1XYMA 1R2RA 2GGJA 3INPA 4J27A 1TPWA 2J47A 1XLJA 4MY8A 3EDJA 1UWSA 4LC6A 3DYMA 1WV2A 2P3ZA 2PDXA 5AB3A 3W07A 2E09A 3F4VA 2NVCA 4MPKA 2H9AA 5E0FA 4DXXA 1U83A 1LP6A 4MG4A 3PBGA 2EPLX 4MWAC 3TP4A 3KRZA 3GTFA 4R5EA 2E9BA 2DUZA 3BJFA 4IX0A 4H01A 4LW7A 2XIOA 3EDFA 1LLOA 3GNRA 1TMQA 3TJIA 3FCPA 2X2GA 4O28A 2R91A 4UQAA 4UNLA 2ZXDA 4GQRA 4JTCA 3STCA 4GIEA 3LTPA 2PDJA 3EWUA 4ZFCA 2XIBA 3FGCB 1VCVA 1TJ0A 1XC6A 3TTQA 2Z7KA 2CITA 5FI8A 3HQ1A 1TR1A 3BL3A 4UC5A 4OHQA 4E4PA 5D8ZA 1M01A 1Q6GA 3HMCA 5F7UA 4HD5A 1VCFA 4MB3A 1JPKA 1DXFA 3AXIA 4W93A 1EO7A 4WSKA 2PCEA 4A2SA 1UR3M 3UNTA 1SW3A 3VOIA 3RFAA 3GFYA 3W2JA 3W7CA 2A4AA 5ABEA 4UMAA 2FGZA 5BRBA 5C2XA 3QC3A 1P0BA 2DW7A 3WUBA 4PCNA 5T91A 1VAHA 3WLOA 1SJAA 1D3HA 4POCA 1GJPA 1RJQA 1ZCCA 2YDQA 2OYKA 2EO7A 2J7GA 3W7KA 5MKGB 5I7GA 3L5MA 2ZVRA 5FJTA 5GNZA 4WXZA 4QSHA 1IF2A 4PTWA 4FLSA 2WPGA 3VNJA 3N34A 3ZQ9A 4PCPA 4NNAA 1UQYA 1QXLA 3GW3A 3W72A 1GWJA 3V1HA 1E6XM 3W01A 1G6CA 4I7VA 2VFEA 1FQ0A 1LUCB 4WY0A 2XUCA 2GFTA 2Y61A 4ENLA 1FWEC 5XINA 4DBUA 3K1DA 1WZLA 1DEDA 1Q6QA 1R85A 1X7IA 3PZNA 1TPVA 2QCHA 5DT5A 5J8LA 1LL4A 2J13A 1FWTA 2DDXA 3SO7A 3WDHA 3EX2A 1C8YA 3NXLA 4GBDA 1LT8A 5REQA 3ARPA 4DUXA 1RCOB 2X41A 1NELA 3MMDA 5D05A 1A5OC 8XIAA 2HTMA 4J2PA 2CEQA 1RQHA 3WLQA 4NI3A 1D3GA 2QPUA 3WK1A 3BLLA 3OZMA 5FD0A 3RX2A 1XUZA 2A3BA 2QLYA 4O54A 1B3WA 2PDIA 3AMDA 2VVNA 3G2GA 1KV8A 2G5WA 2O92A 1XG4A 4RZ5A 1AW1A 5E70A 2ISFA 2C8NA 3L9CA 2JEPA 1M04A 1NAL1 1UBPC 4XKYB 5DXXA 1OM0A 5EMYA 1MWOA 4KT2A 4W8BA 3RO6A 2A85A 4HCHA 3LOTA 4PTVA 1V7YA 1ZGDA 1ODUA 3PBMA 3UCCA 1RK6A 2ZWYA 3DU0A 3JR2A 3HFTA 3MI2A 4B91A 4FNUA 3WDQA 5B7YA 1M03A 5IOBA 2JEQA 4NRRA 3KRSA 4BWLC 1VPXA 4IQJA 4QR6A 3WF0A 5M17A 1F4HA 1J0YA 4ZOCA 1FWBC 4KKXA 3MANA 4BZYA 2PA6A 4JNZA 3GZAA 3JVAA 1V79A 5FF3A 4UMBA 1GTEA 3TYUA 3HJEA 3GU2A 2CLFA 4JTIA 2W63A 1SYTA 2VZUA 3IJLA 4X2PA 3LEPA 1E15A 3THCA 4W84A 1EDTA 2XH2A 3HG5A 2BOEX 1HG3A 3GKAA 2OELA 3R0UA 1UC5A 1GONA 5HWJA 3UP8A 3B9AA 4LUSA 4M51A 1JDAA 1EC9A 3HOJA 1PDZA 1IZJA 2Y62A 4IXHA 5HJXA 4ALDA 3G0SA 2V8ZA 3ZIZA 3CPGA 3MVTA 4AFYA 2VKZG 4XD3A 4HSHA 4OVXA 6XIMA 6XIAA 2SFPA 3N2CA 3R89A 4CNTA 1P0NA 4CCCA 3F2DA 3M1ZA 4GX9A 4Q4RA 2WSPA 3AWOA 5DANA 3KVLA 1D8WA 1HUVA 2I5QA 3LHTA 5FJPA 3WH7A 1XR2A 1AH0A 1PTDA 4CNOA 1Q6EA 4JGDA 4RNFA 1QBAA 2RJHA 3KBSA 2HJPA 4QCEA 1TWWA 4FO4A 2X42A 1LCOA 3EX3A 5CLTA 3ITXA 1XIDA 3VC6A 3B40A 3T0DA 3H2MA 3LX9A 1S3HA 2Z29A 4C60A 4YNGA 3LENA 4NJJA 5HNUA 3BV7A 1R5YA 3VFCA 3L23A 5CPNA 2NVAA 3DCPA 3SQMA 3GDLA 3NIYA 4CCDA 4PA8A 1BWLA 1W32A 3DC0A 4ZQOA 1N2VA 2NT0A 1A5NC 4QS6A 2HZGA 5A69A 1QK0A 2ABBA 4O1CA 4RJEA 2YBTA 3TYCA 3T0CA 5KITA 1CLVA 3QOKA 1JCMP 3KLKA 2CFFA 3AZRA 1E4MM 4AU0A 4AD0A 1JNDA 4Q6XA 4K2SA 3VKCA 1TWSA 1SJBA 1F05A 4BEQA 3L12A 1JI1A 3BGAA 3QW4B 5M5DA 5HOSA 3S1WA 1VENA 3M0HA 2NLIA 1OF6A 3EKZA 4P2VA 2QCGA 3PBWA 3IJQA 3H70A 4O14A 4X9YA 5DBTA 1Q66A 2EJ1A 3GFXA 3MB9A 3BANA 4BF9A 5E93A 1UH4A 7A3HA 2XH4A 2GVLA 5AHEA 3LV5A 4FNPA 3WEMA 4ML9A 2PWEA 3CM4A 1LWJA 2XVPA 1E1CB 1Q8JA 3RN6A 2CXEA 2ONEA 1VJZA 1ME9A 2INZA 3UNDA 1XHGA 4XBKA 4CU7A 2FGBA 3WDPP 1Q4WA 2O0TA 1MI3A 1KXQA 4R88A 1GPFA 1TUXA 4IH3A 4H04A 3SY1A 5CZKA 4CQBA 2HEJA 3TC6A 3T8QA 1HJSA 2CLLA 1F6YA 3L4TA 2GDVA 2VQUA 2VD8A 3NO5A 1OJXA 1MW2A 3LCHA 5FJJA 2JK2A 4GNKB 3AHYA 1W8GA 2R82A 2YXXA 3EWWA 2XIIA 3GYCA 5LIKX 1P1XA 2DU2A 2FB3A 1Z8AA 3TVAA 4J40A 2P10A 3DFYA 1AD1A 1LROA 4YTUA 3U8GA 4AHQA 3CHFA 5FAJA 4EPDC 2QULA 1ZBVA 1G4SA 1UKSA 4OQVA 1SFSA 2CBUA 4QDMA 4YS1A 4RDWA 4MIMA 3S9IA 4Z08A 1I2QA 3MUIA 4B4FA 1X6UA 3DX5A 4CLMA 4MUPA 1FHVA 1L2QA 1I2NA 6PTDA 3M6DA 4JTHA 2X0YA 2YR1A 3AWNA 3HMJG 4HZ7A 3RR1A 3GTXA 1F3WA 3VX1A 5KZDA 2B4GA 3QPZA 3IAQA 1TELA 3P2VA 4PMDA 5I24A 1M65A 3N9KA 1B3XA 1TA3B 5K9CA 1YEYA 2TODA 3B0XA 3WD3A 4UTUA 4LFYA 3U7VA 3RRAA 1QK2A 4R3UA 4IQLA 4TX9A 3UG3A 1E1EA 3EA1A 2P0IA 1TIWA 4JTDA 4YPJA 3MP5A 1XBYA 1ZZMA 5KINA 5D4YA 3VIHA 3G24A 1SZEA 5LGZA 3G1HA 4FNQA 2CBJA 2W27A 2PMQA 3Q2DA 3WJXA 2E67A 3C2VA 4NAEA 4Y6GA 1J0IA 2W4XA 1E56A 2ZZ7A 1QR7A 3S4TA 2WKJA 1NM9A 1YX1A 3L2MA 1EWEA 3CIXA 4QQ3A 5CAKA 2PRLA 3CTTA 3AXMA 3MC5A 4XTIA 2NXGA 1E43A 3OOQA 1VBUA 2I9UA 4ZB0A 3AS2A 3B04A 4YU1A 1NEYA 4QNEA 3POHA 3GDTA 2C71A 5FL0A 2AL2B 1V3MA 1HVQA 2QCEA 5A2BA 2DZTA 1TPC1 1A53A 1TX2A 4MKSA 1FDJA 5AHNA 4NZ5A 5D02A 4QE5A 3UJ2A 3R6IA 3BMWA 3YPIA 1KXVA 2ZWZA 2DIEA 3EXRA 3UESA 3GC4A 3LCGA 4YLWA 3VNLA 3BGJA 3E12A 2ZFAA 2PZNA 5M1TA 5D9PA 5G1TA 2W91A 4MFEA 4QLLA 1UMLA 2EHHA 4R53A 4O10A 4LBSA 5L9FA 2ZCGA 2WJEA 1EC7A 1K02A 2AOSA 1TPH1 4BI5A 2H8XA 3NJ3A 3MV11 2FVKA 4CQCA 3EOUA 3OZYA 5D33A 3DIPA 3BAYA 2GQ8A 4FXSA 1XLIA 1OYBA 4ZOBA 1W9BM 2CZEA 3KTXA 3LPOA 5CKSA 1W3NA 1ZJHA 2QUTA 3DKJA 4Z0SA 1ZFJA 3ZR5A 3CIWA 4IIBA 1UR0A 5CXPA 1RBLA 3ARUA 3TFCA 1EC8A 3DBNA 1F6PA 3GHUA 4R85A 1NU5A 1E0TA 3W7NA 3BW4A 3SW6A 2WKLA 2VRQA 1VHNA 3QHMA 4CN1A 4NJHA 2QCDA 2PF0A 1RJPA 2WZIA 1KR0A 2EPNA 2C79A 3KOWA 1VEPA 1W3JA 3G3MA 1PB0A 2JF7A 3LQGA 4ZCWA 3PJXA 1K9EA 1VGAA 1HGWA 2OODA 3QV6A 2Q8LA 4A3HA 4PL2A 3OLEA 1C8QA 4YVXA 2BX7A 5E9AA 3L21A 1TKKA 4C5YA 5HPCA 3FW6A 5EFFA 5EL1A 5IFPA 2OKOA 2A6LA 3WQOA 2OXNA 2QVHA 4LAUA 3CZ8A 4TMBA 1ADDA 2F61A 1ZRQA 5D2TA 4CKQA 1NOUA 2W0UA 3GH7A 4DM1A 3BVJA 1CDGA 2AQWA 2DT3A 1XCXA 4D6CA 1M1BA 4PL1A 5EB8A 3BZJA 2DT0A 3KVKA 4NASA 3VUPA 4TV6A 3C8FA 3ITLA 5G4WA 3MKCA 3O15A 3V35A 5JIWA 3ITCA 4WOZA 3CHEA 2YCKX 4XWUA 4JKKA 1J18A 4UOZA 5BOEA 1E6ZA 3MMTA 2VCAA 5DN1A 3UWWA 1J0JA 3LBCA 3MUXA 4LCQA 5EMUA 3Q94A 4JTSA 3RU6A 4ES4A 4N7QA 1JZ5A 1S5MA 2X30A 1V3HA 3GRIA 4A6GA 3T8LA 1DTNA 4WGXA 4JTAA 1ISVA 4JICA 4AWSA 4P7QA 4HHHA 4PN2A 5KEZA 3NSNA 3W74A 3L4YA 4J9JA 1XDMA 3HG4A 3HTWA 1BFNA 1XH2A 4HTBA 4D6GA 3C2RA 3AAMA 1AQMA 3U5UA 2O7QA 3OGVA 4KCWA 2J7HA 4JPGA 5LNWA 5KETA 4JIHA 4UTIA 3PUGA 3AXKA 4FP1A 1FWWA 3HPZA 2IMRA 4AEEA 3P8JA 2ISWA 3AS3A 3V0TA 3C2YA 1G5AA 3KOXA 2CLIA 2E8YA 2QCNA 1U5JA 3WF4A 1NQ6A 5TQLA 1RSCA 5HNNA 1XLLA 3OQEA 2VMFA 1UBSA 1Q6FA 1E6RA 5CGQA 2WM1A 3WQ6A 4EPKA 3EWYA 3IUIA 2IKHA 4IGHA 2EG6A 1W2VA 4W5UA 3T9PA 1TPB1 1EIXA 1VBRA 1E71M 5EA9A 6CGTA 3DFTA 3AIVA 4S3GA 1WX0A 4UTKA 1H0IA 2TSYA 3F2CA 1DJZA 1R3QA 1XGEA 1GQKA 3GDMA 1CGVA 3WJWA 4DO6A 2X05A 3AHXA 4KF1A 3AIWA 1FBAA 1IHIA 1RPXA 4S23A 3PB2A 1DQWA 4YHGA 4C6NA 2Q02A 2WWCA 5K2ZA 1O95A 2PDGA 1GZ1A 3GQYA 3QMTA 1KRBC 3CO8A 3PTDA 4B5WA 4E6MA 2ZTKA 4PUWA 4XKMA 3A5FA 3D0CA 3R58A 7REQB 3EOSA 1NFPA 1KFEA 4DJFC 3HGSA 3KWXA 3KOFA 5CBJA 4AD3A 1IZCA 4QP0A 4Z42C 3O2LA 4CD8A 1JPHA 3RX4A 2A3AA 4U2ZA 4QTGA 1YDNA 2EJAA 5I03A 2XIMA 4JTQA 2IUZA 1JD7A 1A5BA 3C8NA 3DYOA 4QEHA 2XFRA 3IJ9A 2HS8A 3TQPA 3E49A 2HS6A 4ZO6A 1ME7A 2X2YA 3FAXA 4PMNA 1VYPX 2IQDA 2X7WA 3UY8A 3U48A 1W3TA 1UC4A 3SGUA 1E3XA 5AHMA 3AMLA 4V33A 3VVGA 1EP1A 4AIBA 2RUSA 2YFNA 3HPFA 3UWEA 2OO0A 1POKA 3GC5A 4LT9A 3T2PA 4GUIA 1FWFC 4Q6JA 1VLWA 4GZJA 3D5HA 3WELA 2ZC1A 2WVSA 1Q2SA 4TR9A 1FDYA 3NPUA 4DWSA 4JX4A 3EMZA 1Z48A 3NQ2A 3V3WA 1QMLA 4H9ZA 1XH1A 1LORA 1K4GA 4Y9MA 1KFBA 3FJLA 2YKKA 1BQGA 1XIJA 2V81A 2VP8A 2DFAA 3EGJA 4WDUA 1NFGA 4JKLA 2QPSA 1W9XA 2PTWA 4BF7A 2A3EA 1XPGA 3F4CA 4ICCX 3JS3A 8XIMA 3DHUA 3NPVA 4LAZA 5FEWA 4D71A 3M0XA 3H2AA 2WANA 1E51A 4MADA 3GIYA 2YDAA 1LOSA 4XG1A 4A35A 5FOOA 1G4TA 4JN7A 4A8LA 4CQ9A 3EOEA 4F66A 4QJ1A 5HNRA 3IGSA 4GYPC 1T6MA 2NLYA 3THUA 5AC4A 3PBYA 4XIMA 4FZIA 3SN0A 3ITOA 3ENLA 2Z2UA 4GH3A 2E28A 3MZ2A 2J62A 3UWYA 5CBIA 3EOLA 1V03A 3GBDA 4HPNA 3T55A 1PZ2A 3OIXA 4NX0A 4URIA 4B90A 4EF9A 3VOFA 1TRDA 3V5CA 3USBA 4DVOA 4GO9A 5G4EA 1DWHM 3W24A 3GR7A 1SSGA 3PTKA 1ME8A 3BE7A 4S3JA 4LU0A 3IACA 1J4EA 5CAHA 5FEZA 2FH6A 3ZS4A 3OVGA 4JEQA 3W82A 1DJYA 4LVAA 4DJED 1PIGA 1S2UA 3BLFA 3GVGA 4EPEC 3K13A 3ECQA 3LCFA 5FESA 3LRMA 4OE7A 4GJJA 2XSXA 2PB1A 1G4PA 3P3BA 1UD8A 5LNUA 4MPQA 2Y4SA 5GNYA 1GNXA 1UUOA 3H12A 3NO1A 3IIOA 4QNWA 1U1JA 2TPSA 3E1F1 3ABRA 2Y7EA 3L4UA 3VZXA 3FS2A 1XYLA 1M6JA 2FDSA 3L4ZA 4CN4A 2VR2A 3MW7A 1OIMA 4F8XA 2DSKA 3GBEA 1GTHA 1I4NA 2XPKA 4FOKA 4YTTA 2VR4A 4O1DA 1F07A 3NPXA 3M07A 4M19A 4C6IA 4DAIA 4HMEA 1ZBWA 4LVDA 3RX3A 3DHDA 3BLEA 3H22A 3TC3A 2F38A 3C0LA 3CUXA 1Z69A 2QCCA 3KBWA 3VIKA 4L5ZA 4DJDA 2PAJA 3RK8A 1Q6OA 3VNMA 4KQNA 4QROA 3TAOA 3POCA 2VZSA 1Z32X 4U2YA 5K9DA 3D3AA 4LCSA 1W1PA 1CXFA 4J3VA 1WCGA 3KHDA 3WDRA 3HPSA 5T9CE 5A6BA 3F5KA 3BCDA 3S42A 3SCUA 3STPA 1KBIA 1UH3A 1OFQA 1UR9A 3WK3A 1GG0A 4FS9A 3FSTA 5CJMA 3RYSA 2VTFA 1BKSA 4HT3A 3G1VA 3ELFA 3RU8X 1KXHA 4JQ2A 4M56A 4L7ZA 3B8DA 4DO4A 1J6OA 1ZQ5A 3O3RA 1NDYA 2VEKA 1VPQA 4D1JA 1R3TA 1V8EA 1VRDA 2YXOA 4NZ4A 4JQ3A 3PVFA 4HN4A 4UFKA 2WBKA 4E2BA 4DIAA 5JIPA 3R8RA 1KW1A 2BASA 4PUNA 5BWAA 4TTGA 3WQCA 3M0YA 4YJ5A 3W83A 1UOKA 4UCFA 1K7EA 1F2JA 4YIWA 3FKRA 3GW0A 2EXOA 4JTGA 1DJNA 4UFHA 1JRCA 5T8GA 1EOKA 3WQ4A 3GAKA 3SEPA 2QF8A 1EX1A 1K6WA 4B9ZA 2QJGA 3GHTA 3EKLA 1EJ7L 1V6UA 1FX6A 2G95A 2JKPA 3W2UA 1OY0A 2VC6A 4AY1A 3VCRA 2E6DA 5AYYA 4AZBA 4PEEA 1L6FA 2BFGA 4B3LA 3UEQA 3H7UA 4F9JA 2VYOA 4RW5A 5IHRA 1KC7A 4MAZA 4G1KA 2CKSA 2DUXA 4K1WA 3WLTA 2D0FA 3KZPA 4LANA 2FPYA 5M2FX 1OX6A 2Z6JA 3TQKA 1H60A 1SFTA 2R1PA 3TR2A 3AU2A 1TPEA 4A8IA 4RKAA 2G3MA 1EYWA 4NAFA 3OVQA 4V28A 1DIOA 1H63A 4RNJA 2FYMA 4JCMA 3T42A 5ABFA 3V18A 4NY2A 2OJPA 4BCEA 1UUMA 1BSLA 4G8TA 4PGLA 3D47A 4RX0A 3DFNA 3PZUA 4O18A 3IGHX 3NQBA 2WM0A 4TXEA 2E6FA 3IRDA 1OX4A 5D38A 2DZSA 1C3FA 5EMJA 2OZTA 4RR4A 4QM1A 1OK6A 5A6TC 1T40A 4ZODA 3VK5A 5C6MA 1WDRA 1BVZA 3BAKA 3RLHA 3OVRA 1SM9A 3UYIA 4ZQRA 4A22A 1M53A 1NIUA 2YYUA 3AHTA 2Z26A 5GVJA 4O0KA 1V0KA 1HJQA 3W7EA 3TSBA 3RJYA 2VT0A 2CLOA 1YDYA 1YTKA 3V4BA 5CC7A 4W88A 1CIUA 1CGYA 3TN4A 1MO0A 3LCIA 4R27A 2VR5A 3SCOA 1BYDA 2INEA 2J6VA 1REQA 4ZQCA 2VGBA 3G77A 2I17A 3T6CA 4BFAA 1HKKA 2TAAA 4O1AA 5CG0A 4IFKA 2BBFA 5KZ6A 4AWUA 1VIWA 1MUMA 1H7PA 3UXIA 4WRHA 4L4LA 5I3FA 5AVHA 2OZ3A 4KS0A 1JUEA 4CVUA 4KCUA 1W5QA 1EX5A 4QJ4B 5I3HA 4AZCA 2ALRA 2AAMA 5DCDA 3GXDA 3IRSA 4S3CA 3PPFA 1DVJA 3NEHA 4OKDA 5JQ9A 3EAUA 2PU1A 4XTDA 3UWZA 1Y5WA 1AODA 2YGYA 4H3DA 5H8MA 4HMNA 4JD4A 1A4MA 1DQUA 1HJVA 3NYDA 4LOCA 1IEXA 2B31A 4JQAA 1J0ZA 4RDVA 5F4WA 4WIWA 4MKVA 4D6FA 2PURA 4X9SA 3HQOA 3UXKA 4J28A 3QV9A 3WL1A 3DHFA 4TU1A 7XIMA 2MNRA 3TYAA 1PZ0A 2PP0A 5AYXA 1YTDA 3GXPA 4JIIX 3SUUA 4PMXA 3AYTA 4FX6M 4JDYA 4FOUA 4DRSA 1RVGA 5A8PA 2FVLA 4FEZA 1U33A 4XD5A 4L9YA 2OWXA 4C91A 3RDKA 1DJWA 4N6FA 5DMNA 3KFTA 2R1NA 3R1ZA 2REQB 2BXVA 1XLKA 5T9BG 4S2BA 4E8DA 1LQ2A 3CWNA 1HGYA 3UFYA 3DYPA 4Q7NA 1VKFA 1WQ5A 2Q71A 4QHRA 1F4AA 1MUWA 1VJIA 3N4AA 1PX4A 2R94A 4QE4A 4W89A 3PF3A 1BXBA 2OEKA 1IIGA 3THDA 3TN5A 3AQUA 1TV4A 4WDWA 1OD0A 1WKYA 3CZJA 3NQGA 1E9IA 3C4UA 3WFAA 3WMBA 2ISSA 2C16A 4MLJA 3CBWA 1KFCA 4RK8A 2DY3A 4M1BA 3Q4DA 1ZU8A 3IUDA 2CERA 3CAKA 3G1FA 3B8IA 1N8IA 2P88A 1UKOA 4NP7A 4XUGA 5XIAA 2PU0A 5IFTA 1OGBA 5LSMA 3MV01 4LS0A 5H1WA 4E8GA 2CZDA 3GR8A 5G5IA 3IVSA 1D9EA 1RPKA 4GGHA 3V5OA 3UQNA 4HU8A 5I02A 4M6PA 2XTKA 3S47A 1VHCA 4WSHA 4LS2A 2VX6A 4UTWA 3RCMA 4PUJA 4NYYA 4PCTA 3R8HA 3ZYZA 4FX7A 2ZXQA 4QRNA 3U5YA 2PWDA 2C91A 3W3OA 3ZLGA 3HURA 3R79A 1HF6A 1O6IA 1MZRA 1FFQA 4UZUA 3GVVA 1ADOA 3I65A 2A7NA 3LA4A 3VD5A 1KBLA 4L65A 4XZLX 3UU0A 1XICA 1R86A 4F2TA 2PDMA 1XFCA 3AZSA 4FX8A 4Q4KA 2ACUA 1KGUA 4DJEC 1LRNA 5DRIA 4ERIA 4XAYA 2CZVA 1EDGA 2QDEA 2XG9A 3V0UA 1YXDA 1F73A 2PWVA 4IG2B 4HK6A 5GQBA 3BSGA 4C1NB 5LNRA 3HO8A 2RH9A 5D2XA 1AJ0A 3R4IA 4J3ZA 3EWXA 4U3CA 2Q01A 4Q32A 3ZVHB 5A95A 3OHMB 1GKPA 1JGIA 3PFMA 4EANA 4C6EA 4ZENA 1MDLA 3QEZA 3EXSA 5DRCA 1XLEA 2IPGA 2R24A 1CI1A 1DQXA 1YQ2A 1Y65A 4YTRA 4UZSA 4H6KA 3OPSA 5A8MA 1S2WA 1SZFA 1OEPA 1TUFA 2VUNA 1TZZA 1MRQA 1M7JA 2QMKA 2F6UA 5I3IA 2EQDA 4W85A 5AOUA 3PN8A 3QW3A 1FWAC 1TJRA 3KTSA 3NQMA 3DG7A 3AIUA 4RZBA 3TIMA 1XSKA 3OZOA 2UY4A 3UPMA 2G0WA 2D1ZA 3GB6A 4CEXC 2WVUA 1KFLA 1EP2A 4ERAA 3CUJA 3IIZA 1UOZA 3W1NA 2O9PA 2VX7A 3W4RA 3LLXA 3S0CA 3FLUA 5D8WA 1ISYA 4RXFA 6REQB 4AD4A 5D9NA 1A5CA 3H8AA 3QM3A 2VFFA 4PMVA 1T0OA 2XINA 4KCVA 2B0MA 2QUMA 2OOFA 1XIBA 1TMHA 1JJKA 3TOPA 4HPHA 4IIHA 1UUQA 5I09A 1J5SA 2YIHA 4O1BA 3WG6A 4IMFA 4UFJA 3GR4A 2YX0A 2Q8ZA 2BHZA 3W84A 1BVWA 5FKYA 3IJDA 3AYVA 3I10A 4A21A 1ONWA 1DP0A 3S8HA 1OVDA 5ABTA 3W1AA 1BF2A 3LN3A 5LYRA 2YLLA 3HG2A 4R9OA 3TYBA 1I2PA 4FNTA 3PS7A 2VEMA 3FEMA 2XGZA 3WLNA 3H26A 3DENA 4DXVA 1RUSA 3SBFA 3GXNA 1GQJA 1QOPA 1R7OA 4MYAA 4WR3A 2D2HA 1VQTA 4BI7A 3AYSA 1J9YA 1V51A 2ACSA 1ICQA 4EXAA 2PLCA 3NZGA 3PJWA 3AIRA 4TUFA 1GJWA 4JN6A 3MDWA 1FHUA 2OWWA 2QIIA 4RV8A 1PKLA 4MDOA 3KDOA 2Q6ZA 3KW3A 2F6KA 3AIBA 5C7VA 3MSYA 3V16A 5TD4A 3N19B 2CKRA 2H3BA 1S2AA 3H2EA 4QG8A 2DT1A 5IBXC 1YTEA 4AHOA 4LXFA 3IARA 3W81A 4JHMA 2V67A 3AROA 5HQEA 3N9SA 5JMUA 1ZB5A 3C6CA 2QGYA 2V5KA 4YL2A 4U31A 4NQ1A 3NGFA 4AY8A 4I5RA 3JUGA 3DXIA 3W86A 1IZKA 3W38A 2PDBA 1W1VA 4NT0A 5IXEA 4XAPA 4CNNA 2XVGA 2WPBA 1UWAA 2PEVA 1XC4A 1R7AA 1DWJM 2GWGA 3PZOA 3EB3A 1WYIA 3AZTA 1DHKA 3ES8A 4FLQA 4L80A 3UJRA 2B7NA 3U6WA 5A8GA 1T41A 1LWIA 1DIKA 2NZLA 3P61A 4YCOA 2OEMA 4MMWA 1FWNA 1R2SA 3NOYA 4FLOA 2PTZA 3TZNA 4V15A 4ADSA 1OFRA 2XWEA 1H1YA 4IGSA 1P48A 7TIMA 3BG9A 4N9DA 1VH7A 2Y88A 4IPNB 1S46A 4KRTA 5MKGA 7ODCA 3GFZA 5ENLA 2F9RA 4KEUA 3EWDA 3GSMA 3AJ7A 2HK0A 1TG7A 4PUKA 2OSXA 1LTDA 3SCVA 2CYGA 2A1YA 1SUXA 1JPDX 1K9DA 1HZYA 1EJSC 3H53A 4CQ8A 3N25A 3VKKA 3VNYA 3GG1A 4ZZ9A 5FSEC 4B5SA 3VD7A 3QSRA 4PRRA 2PTXA 1K77A 2AQOA 3DFQA 1BGGA 1TMLA 4P7LA 3L5LA 1C91A 1EP3A 3TJXA 5BU6A 4QXIA 2OG9A 3EXTA 1JGMA 2WLYA 1LOQA 1QI3A 3LK6A 1TVPA 5F1VA 2GOUA 3T2OA 1TIMA 4XQ6A 1NP0A 1GT8A 2H9AB 2HBVA 3BAWA 2J25A 2Y5SA 5F2LA 1J10A 1J8VA 3RAOA 1BKHA 9RUBA 3A64A 3B9OA 5CJ5A 1B9BA 3PUOA 2VX4A 2VCBA 4Y9PA 4JL1A 5A1AA 3QKEA 3I3BA 2WV8A 4LVGA 2Z1BA 1Q5MA 4CU6A 2PRMA 3BW2A 4JFSA 2E3ZA 1KTBA 1ZAHA 2RDWA 3SUSA 2B7PA 4S3EA 3UGRA 3QV7A 3S5NA 2ZA2A 4R7JA 2IKGA 5CQ1A 1E6QM 4HA0A 4PTDA 2D0HA 4L6DA 2BHUA 2GOKA 2QKFA 1GJUA 1PO9A 1XSJA 4F2BA 1XKJA 3IJIA 3RM4A 1XCFA 2FGLA 1PKYA 3OW1A 1FH8A 1L6YA 3A47A 3U4AA 3GM8A 1QDSA 5M03A 3H55A 4LBRA 4M24A 3QBUA 4UNIA 1B4EA 1H7OA 1XD1A 1JCYA 1MEHA 1XISA 4TX6A 3G0UA 3CNYA 2QJJA 1HKVA 1LBMA 4E2OA 2VRJA 1I1WA 3WLHA 3W9ZA 4I90A 4ML4A 5AFDA 4EKJA 1W3KA 3FXYA 3P6LA 3MVIA 4W8LA 3UCQA 5IDZA 1RY0A 3TLQA 3B9DA 1WXZA 2FDMA 3ANUA 5H8UA 4R33A 1SPQA 4LNYA 2PSNA 1RCQA 4ZL1A 1LG2A 1CCWB 4HU3A 5CZ0A 1JZ7A 3W2LA 1YXCA 2P5NA 3VGHA 1SU5A 3BOXA 3B8TA 2EKGA 3NGJA 3GXFA 3MU7A 3ANVA 3ZMRA 3LV6A 4XZ9A 4HYRA 2FHCA 4GJIA 4LRTA 1W5NA 5HPOA 3W53A 1EUNA 1CXHA 3TJ4A 2F6XA 2E1WA 5FJUA 4FI4A 1TWIA 1TCDA 5I3JA 3FDGA 5HQMA 1A5AA 5DMYA 3TEVA 2Y63A 1WP6A 3GYEA 1Z42A 2BV9A 3NM1A 4GCAA 3DOPA 3AMGA 2WW5A 3TU9A 1D7FA 3W85A 3M16A 1HXJA 3LDVA 4TIMA 3CEUA 2HVOA 5BROA 1QHOA 5MF5A 4P8UA 2VENA 3CL7A 3R8GA 2AQVA 1W1IE 5I3KA 2ZRZA 4C6KA 2RAGA 2VEGA 1XLCA 5A3HA 1FXQA 4J35A 4LV4A 1HL8A 3UR7A 2I7GA 1TQXA 4XK2A 4GG9A 1WA3A 2DZBA 1W1B1 2VDIA 3BV4A 1CX9A 1HT6A 4E4FA 3VGBA 2HRWA 3R12A 3CQ0A 3PANA 1M5WA 1LRQA 4O8AA 3R11A 1U5HA 1OYCA 1H5VA 2ZZ1A 2A7PA 3M5XA 2JFEX 3QR1A 4PULA 3C0QA 1RV8A 5E0KA 5EU9A 4I9MA 3H2FA 4QIUA 2YYTA 4LSBA 1K8YA 2WVTA 4MWAD 4B2DD 3ALFA 2FFCA 4MWAB 1TWDA 4RE3A 4GI9A 2ISVA 2JGQA 1N8FA 2BGQA 5DEZA 2PP3A 3VOCA 2B7QA