1Q13A

Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
322
structure length
322
Chain Sequence
b'DPKFQRVALSDGHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKREDIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALKPGVEIIPTDEHGKAIFDTVDICATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWVDQSAPVLLEDPLIGALAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNFRYVTADFAIGHPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin-E2 9-reductase
publication title Loop relaxation, a mechanism that explains the reduced specificity of rabbit 20alpha-hydroxysteroid dehydrogenase, a member of the aldo-keto reductase superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Oxidoreductase
total genus 114
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.149: 20-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1q13A00
1ZGDA 4WEVX 3UFYA 2J8TA 4FALA 2ACSA 2PDXA 4JIRA 3P2VA 2PDLA 1XJBA 2PDUA 2I17A 2IPWA 2IPFA 5HNUA 1EKOA 1X96A 2AGTA 4F40A 1C9WA 3BUVA 3CV6A 3EB3A 1Q5MA 2BGSA 4QXIA 1RY8A 3COTA 1PWLA 2FVLA 1ZSXA 3UP8A 1M9HA 4I5XA 1YE6A 2PFHA 3M4HA 1ZQ5A 4G5DA 2ALRA 3UG8A 3R43A 2IKGA 3GHUA 2IS7A 2FZ8A 1RY0A 3R94A 1MZRA 2IPJA 3LQLA 4XVDA 4XK2A 5AZ0A 2PD9A 2P5NA 2ACUA 1XGDA 4JQ2A 4RPQA 1A80A 1UR3M 1XF0A 2WZMA 4Q7BA 1VP5A 3LD5A 4PUUA 1S2CA 3V0UA 3Q67A 4FZIA 1IHIA 2PDIA 3O0KA 4FAMA 4R9OA 2ACRA 3U2CA 4GA8A 4DZ5A 4ICCX 3LZ3A 2PDJA 2BGQA 3N2TA 5LIUX 4JQAA 3M0IA 3GHTA 3EAUA 1US0A 4OTKA 3CAQA 4PRRA 3UZZA 4XZLX 3UWEA 1HW6A 4WDUA 1PWMA 1EL3A 1OG6A 3FJNA 1S2AA 3N6QA 1J96A 3B3DA 4NKCA 1IEIA 1S1PA 2FZDA 4H7CA 4GACA 4ZFCA 3CV7A 3UYIA 3CASA 5HNTA 4JTDA 3D3FA 1RALA 5C7HA 2IKIA 1S1RA 2R9RA 4IGSA 1PZ1A 2INZA 5LIYX 3RX3A 2HVOA 3V35A 1VBJA 4L1XA 5LIWX 3R58A 2NVDA 2FGBA 3RX2A 2VDGA 1ZUAX 3LEPA 1Z3NA 2PDFA 2HV5A 1SM9A 2PEVA 4YVVA 2HE8A 4LB3A 4ASTA 5LIXX 4HMNA 5HA7A 4QBXA 4GCAA 3UGRA 5M2FX 4LAUA 1PZ0A 3GHRA 3LUTA 2IQDA 2PDNA 2PDYA 3UZYA 4WRHA 3V0SA 3LZ5A 1YNQA 3H7RA 2DV0A 4HBKA 4JTCA 4LBRA 2C91A 5DANA 1QWKA 3UZXA 1EXBA 3R8HA 4YVXA 3NTYA 2PDMA 4AUBA 3ERPA 4EXAA 4LAZA 3EB4A 3CAVA 3VXGA 4WDXA 4IJRA 4JQ3A 3M64A 4GABA 1Z8AA 1X97A 4MHBA 3F7JA 4XVEA 4JTAA 3T42A 3WBWA 1K8CA 1X98A 2PDPA 1AZ1A 2I16A 4QX4A 3CMFA 2IKHA 2R24A 1Z9AA 2F38A 2PDQA 3GHSA 3RX4A 2IPGA 4YVPA 2HEJA 1HQTA 4GQ0A 4QR6A 3DOPA 4JIIX 1Q13A 3BURA 3DN5A 3LN3A 2QXWA 2FZBA 4JQ4A 3Q65A 3G1RA 5KETA 4GQGA 2PZNA 2DUZA 3LQGA 2F2KA 3R7MA 3G5EA 3QKZA 3KRBA 4WDTA 1AH4A 2HVNA 4DBSA 2PDHA 1AZ2A 2BP1A 4PRTA 3LNMA 4H8NA 3MC5A 4PMJA 2DUXA 1LQAA 3FX4A 3C3UA 3R8GA 2HDJA 4JTRA 2FZ9A 1T41A 4XZNX 2A79A 3ONBA 1AFSA 4WDWA 3UZWA 2ISFA 2WZTA 1T40A 3ONCA 2PF8A 5AZ1A 2PDCA 1MI3A 3WBXA 4WGHA 3R6IA 3WG6A 4JQ1A 1QRQA 4IJCA 4Q3MA 4XZMX 5JH1A 2PD5A 2PDGA 3S3GA 4DBWA 2CLPA 4PUWA 4YS1A 4YU1A 3LBOA 4EXBA 3V0TA 1Z89A 4LBSA 1YE4A 2IQ0A 2INEA 2NVCA 2PDWA 4JIHA 4L1WA 1MRQA 1AH3A 2ACQA 1LWIA 4FA3A 3LENA 4XAPA 3GUGA 4PR4A 3V36A 4JTQA 1AH0A 1R38A 2IKJA 1JEZA 2HE5A 2PDKA 1GVEA 1EF3A 3O3RA 3WBYA 4GIEA 4XZIA 1FRBA 5JH2A 3BV7A 1ADSA 1PYFA 4LB4A 4XO6A 3MB9A 1YNPA 2PDBA 3WCZA 3H7UA 3BCJA 3H4GA 4XZHA 4DBUA 4XO7A 5LIKX
chains in the Genus database with same CATH superfamily
3OA5A 2D20A 3GH5A 3KCJA 4R9XA 1B3YA 2FTWA 3LOTA 3VABA 1LBFA 2A1YA 4JX4A 1CGYA 1F6PA 1OFDA 2PDUA 4IG2B 3BZJA 4A3HA 1FVPA 4NAEA 2I17A 5XIMA 4CLMA 3O9NA 1KBKA 3IVTA 2FB3A 3R1ZA 2FHFA 4Z42C 1OFEA 3ZJ6A 4D6GA 3CWOX 1ITQA 2J78A 1LRNA 1JZ6A 4ORIA 2DEPA 4QITA 3VD4A 1UR9A 3BK0A 1P0KA 4OT7A 2Y63A 1E43A 5BROA 4HN4A 1XH1A 1WOAA 3SUTA 4GG9A 2H8XA 4JN8A 2INFA 4NVTA 2IXUA 4WZHA 2VX6A 3GRIA 1JCJA 1GPWA 1OFBA 4Y90A 3L4YA 1W2VA 3P82A 1RY0A 1RLDA 1LDCA 1V02E 5HQMA 3BLEA 2WNQA 3IJ8A 1IT7A 2PTZA 1F4HA 4K7VA 1A5OC 1FCVA 4UQAA 2G50A 5FJJA 4I9MA 2OYMA 4PUNA 1Y5WA 3W0KA 4JPGA 3TTQA 2D1ZA 3O06A 4R9OA 1VHCA 3SO7A 5CZSA 1GHRA 1WNOA 1CXFA 1FOBA 2RHGA 1C7TA 3KBWA 5TQLA 3WQFA 4BK9A 4AWUA 4GYFA 3UCDA 1P7TB 2Y5SA 1M41A 2P50A 1TJ2A 3AS1A 1EL3A 1XIMA 2PLMA 5FKYA 2YBUA 2E6DA 5DBTA 3S1XA 3B3DA 4YJ5A 4CNPA 2ATMA 1SR9A 2WV8A 1W9DM 5HINA 3WLSA 4GJJA 1PYMA 2CLIA 4LVBA 1ZPTA 3M6YA 1JPMA 4L1GA 4GO8A 2V5KA 3LM3A 1QJWA 4JTJA 3WNLA 3HPZA 3GAKA 5D8ZA 2ZRUA 4RV3A 3VMNA 1GUVA 5AKQA 1VEOA 3GX9A 3RHGA 2FVMA 4AZ5A 2WJZA 3TW6A 1EZWA 1O5RA 3GR4A 4IH3A 4D2JA 1HX0A 4UTKA 4E4UA 1XP3A 1N7KA 4ASTA 5DO8A 2OSWA 2J77A 3AXXA 3GDBA 1EXPA 2FJUB 4LAUA 1OABA 1JCMP 3L68A 1FCQA 4QG6A 3T8LA 2BG5A 1UR0A 4GY7A 3R12A 2WSKA 1E6NA 3N04A 4R27A 3SCSA 1E15A 3EB2A 1E6QM 7REQB 1EWEA 1Z6KA 5E09A 1UWRA 3PBUA 3MJYA 1EXBA 5J8LA 5IRPA 5C6MA 4I3GA 1XPGA 1UWTA 2BXYA 3NG3A 3KBMA 2MUCA 4ONVA 3K1GA 4FR6A 4O10A 2VOMA 2YJQA 3TCEA 3JVAA 4UFJA 3RU8X 3AHTA 1HF6A 3N14A 4E4PA 3NGJA 3DX5A 3N2XA 3GTXA 1V6TA 4WXZA 1XLCA 4P7NA 3TONA 1X98A 1EGZA 2PDPA 3UY7A 4QDMA 3M0VA 2YCJA 3MUZ1 1UZ4A 4RE2A 4H7ZA 2WC3A 1BD0A 3BURA 1PHQA 1OT1A 2WVVA 4OVXA 2FZBA 4MAZA 2XH2A 3AOFA 3IIZA 2RH9A 3FN9A 4MTVA 2DUZA 4YIWA 5AHLA 3OO2A 5K9XA 4Y9OA 4R33A 1QCWA 5MHBA 1QOXA 2XZ9A 3CTTA 4O0KA 1CX9A 1UW9A 5H8UA 3LX9A 1LLZA 2XSXA 3IUIA 3EMZA 1H51A 4DJED 1RJQA 2YW3A 3W7JA 3ALFA 3W7KA 2V3FA 4NT0A 1ZBVA 2H6RA 4X60A 1ELSA 5ABHA 3OBEA 5TIMA 3EPOA 4WX2A 1WZLA 4XZNX 4N42A 5I02A 4PN2A 4RDVA 2VR4A 4F8XA 3LG3A 4JNYA 3B9DA 2UY4A 4Q6JA 1HFBA 1A5KC 2VWSA 4IQEA 4F0KA 3GC2A 2BLEA 2GGHA 2WZIA 4Q8QA 1HO4A 2JKPA 4O0ZA 3W86A 3EZ4A 2FVKA 2E6AA 3N3MA 2CKSA 3H2AA 2OKTA 1C90A 1BQCA 3A9IA 3HIJA 3AICA 4CNNA 2QGHA 1VLWA 4YU1A 2ZXAA 4JICA 4ZEPA 1IWPA 1KGXA 2AMGA 5EL1A 1TV5A 2J47A 1GTHA 5PTDA 1G6CA 2IQ0A 1LOLA 2QCNA 3N6HA 1EJTC 1W3LA 2FHBA 3USZA 1LL6A 5CC6A 2Q8ZA 4XD6A 4PCNA 4AU0A 1OSEA 2KX9A 4L64A 1LYXA 3MWCA 3AS2A 1GVOA 4WSHA 4NYUA 5I2UA 2YA1A 2X7VA 4PL2A 2WMKA 4FX7A 1A4MA 5B7YA 5HWNA 1OHLA 1KC7A 3VKDA 2CIPA 1LRTA 1HVQA 2Z1KA 2VRJA 1V3JA 1DOSA 3IEBA 5I77A 4LQ1A 5BWFA 3LDVA 4ZO6A 3VE9A 1LG2A 3ZZ1A 1GQNA 4W86A 3UY8A 2FJKA 1GK8A 1WBJA 4LALA 1DKWA 3ABOA 4Z2GA 2QYGA 1G1YA 4MWAD 3AYTA 1YHTA 5HWJA 3IK2A 3L4ZA 2I9EA 3E0FA 1YNYA 4NZ4A 4LV9A 3U5YA 2E68A 5AYYA 1ZU8A 2WKJA 5GJNA 5C2GA 4JFWA 1KM1A 1ZCCA 3PTKA 5AYXA 1D3CA 3S46A 3IIPA 4O1DA 1OYAA 1G69A 1YXCA 4LUYA 4ADTA 4JIRA 2FMNA 1XH2A 4UNKA 2QCMA 1UD2A 1EX5A 3TW7A 4ZMGA 4DHGA 4HPJA 2CLEA 3NPWA 3G6LA 1AMKA 1LL7A 3S1VA 4KWOA 4URIA 4CCZA 1RSCA 4C6IA 1LOSA 1DXFA 4NJGA 2WHLA 1R3SA 2QF8A 4RDYA 4NXSA 1OC7A 1GJWA 1KFLA 2FH6A 2QULA 3WQWA 1XYFA 1CNVA 2Y5EA 2E4TA 2ZE0A 3ARVA 3KZPA 2DZPA 3EMQA 3TK7A 5KZDA 1WZMA 2ZDSA 4WF7A 2HPMA 1JZ2A 1NOUA 2DQWA 2P76A 4X63A 4MKVA 2E5BA 1KFBA 2DZSA 4LAOA 2XH7A 1VP5A 3ZR5A 4MGGA 3KL0A 2ACRA 4D6DA 4DZ5A 1YQ2A 1L6SA 1J6OA 2BBFA 1FWTA 5EB8A 3ZJKA 3NAVA 1ICQA 1X39A 3DG7A 1FFQA 3TTEA 3M0IA 4PRWA 3MI3A 3PWIA 3RO6A 3GHTA 2Z6JA 2WJDA 3VC6A 3D5HA 2XG9A 1CYGA 2VDIA 3F2DA 5JXQA 3DDMA 3EWYA 1N8WA 3QW3A 4H6QA 1MEIA 1G5AA 4TX8A 2QUTA 5H6HA 5AHMA 1TRIA 1SPQA 1H5VA 1OEPA 4GZ7A 4AZBA 4PBEA 1FDYA 5CBBA 2WW5A 3JS3A 1XBVA 3QY8A 4UR9A 4M82A 2VD8A 1NJJA 4B5UA 3N9RA 2DT0A 2VYOA 3EX1A 3W85A 4MYXA 1EHNA 1Z48A 1KXTA 3PFRA 7CGTA 1JR1A 4KWUA 3HFYA 1LBLA 3DAQA 1I1XA 2CHRA 5HJXA 5CBJA 1DJIA 3DUGA 1BKSA 4L1XA 2E6FA 3PC0A 3MYOA 4ZTXA 4TVUA 2UV8G 3E2QA 4POCA 1XX1A 2FFCA 1ISXA 3PJUA 2X05A 5AHFA 4NJHA 4Q4OA 3BAYA 4QM1A 5CPOA 3LHWA 4WVXA 3MHUA 1IZJA 4E2OA 5DRIA 1JUBA 4ROQA 4M80A 1Y65A 1SMAA 1JQXA 4MYAA 2D23A 3S0CA 2PDYA 4W7WA 4TQTA 4GLEA 4Q8UA 3UZYA 3VIJA 3GC4A 3V0SA 3BICA 1OFQA 4EP8C 4FK9A 5DMYA 4LY8A 3IRSA 1KM4A 3E38A 1QU4A 1MNZA 3VFLA 4EXAA 4I9TA 3SCOA 3TYDA 2X1TA 1EC7A 4H9MA 1AUSL 2VNCA 2Q71A 2CLOA 3VCCA 2FDSA 4MHBA 1MNSA 2ESCA 3ZJ8A 2QQ6A 1B1YA 1X7IA 1YRRA 4HA1A 3S5SA 4RLIA 4DM1A 4QNEA 1QO2A 3NXLA 4Y2WA 2OGYA 2IKHA 3SZ8A 4BWLC 5C71A 4ICMA 1HQTA 2V67A 4K8EA 2J62A 3U7BA 2P88A 3EX3A 1HGYA 2Q01A 1FWHC 5IBXA 1JDAA 3RM4A 3VDGA 2YL6A 4PEKA 1BRLB 1HGWA 3GYCA 1ISZA 4QP0A 2GVYA 3WQCA 5CZTA 5I06A 5HNRA 3TR9A 1GOXA 1W37A 4JY9A 4O50A 5DXYA 1VC4A 1QAPA 1TJRA 1H4PA 4KQNA 2HXUA 2D24A 3FYPA 1TTQA 1V02A 3FX4A 4K3ZA 2E67A 3AZTA 2NV2A 4KETA 4WSJA 3LHUA 1EJRC 2GVEA 1K8YA 1F3EA 2VGFA 3NEHA 2BXZA 1CB2A 2GQAA 4PTXA 1JFXA 3FFSA 2HWGA 4M1RA 3C56A 1BQGA 1BEUA 4NZJA 2GZXA 1MI3A 3WBXA 1E3XA 5CZJA 4Y96A 5HQLA 1D3GA 1YEYA 2A3BA 3VGDA 1F2JA 2QJGA 2XIQA 2XGZA 3WMCA 3WJZA 3TYEA 4DM2A 2VM8A 3GXTA 1HKVA 1OX4B 3WLNA 2OWCA 3GLCA 1IF2A 4GPNA 4QRNA 1TPVA 2VC6A 1QHOA 3V4BA 1H63A 3RMJA 1Z89A 5A8MA 4LVGA 3VGGA 2Y2WA 4NZFA 1O68A 4CNUA 2BHUA 1KRCC 3PJWA 5H8PA 4YCPA 3OLGA 4FI4A 3SR7A 4IMEA 3POCA 5I23A 4PYSA 4DJEC 2O7SA 4Z0SA 5TBOA 3W73A 1WPCA 2VOTA 3RCNA 2H9AB 4LYPA 2OQHA 3BLPX 4M51A 2WOQA 3VU2A 4LGXA 4UNIA 2QPSA 1DVJA 3FSUA 3FGCB 1XDLA 1MW2A 1QO5A 4K8GA 3NQEA 3LPGA 2DSZA 3LMYA 4MB4A 3SGGA 2EF9A 2NT0A 4JTUA 3O6YX 4M6QA 4L56A 2DT2A 3CO4A 4CVUA 1DE6A 3H12A 2VURA 5HJYA 1BF2A 4FB7A 3TQVA 4ENLA 4JHZA 3G1DA 4EX4A 3TJXA 2BTMA 1NWRA 1C91A 1MXGA 4XZHA 5JBDA 3PAOA 3E3HA 1XD1A 3LK6A 1TTIA 2AGKA 3VO0A 1OJXA 4AXKA 1MUMA 1GW9A 3IJLA 1XSIA 2OX4A 4PODA 1DV7A 4NZ1A 1XJBA 1KM0A 4IT1A 2IPWA 1FA2A 1A0EA 3NYZA 3D0CA 2ABAA 5XINA 1C9WA 1NF0A 3VGFA 3R2GA 2Z7GA 4UTLA 1DJWA 4JTEA 1KM3A 3GZAA 4GVIA 4BF5A 2CC0A 4TMCA 4HQVA 3HQ1A 1K4HA 2PFHA 1JZ8A 3W9ZA 1JYXA 3BGJA 5CC7A 3RILA 4QDPA 3NVDA 1X8CA 2YOCA 3GHUA 2FPYA 2YX0A 3ORWA 3LQLA 2PWDA 2RDWA 2PAJA 5IHSA 2DT3A 2GJRA 1JL8A 1G94A 4GCXA 1FY6A 1AL7A 1WXZA 4GKLA 4MWAC 1VH7A 2GQ8A 3LD5A 4UTWA 4IP5A 1UP2A 4JTLA 4F2TA 3LRMA 4QQUA 2AAMA 2V5JA 3LZ3A 3HG2A 1PAMA 2X41A 1C7SA 3V18A 1TVPA 3QV6A 3A21A 3PWAA 3I4KA 1JI1A 5D04C 1JULA 4LVAA 1S39A 4M6VA 4RNHA 1ODUA 3CAQA 4XZLX 3Q37A 4HYVA 1K03A 1XV8A 1A49A 1MEWA 5M03A 3AIUA 1TREA 3H26A 3W7LA 3VKAA 1XLKA 4TOQA 5I03A 1BLIA 3GIQA 3H22A 4P7LA 1X1NA 5G1TA 1ZENA 2J9YA 2PRHA 5K9DA 1W3KA 3GNRA 3T0AA 5HXMA 3O63A 4HKPA 4EOUA 3A5FA 1K9DA 3MUXA 1XSKA 3HF3A 4J9JA 1QW9A 5C5YA 4M7TA 1KFJA 1W1PA 3TFCA 4H9ZA 2Z1XA 4LV4A 5LIWX 2ISVA 3CC1A 1TJPA 5GNYA 3KS6A 3ICJA 3RCMA 3U2EA 1KGWA 4F48A 1XRFA 4HK5A 2NUYA 3CEUA 5AHIA 4IFOA 5BWAA 3KVMA 1PTDA 3SDOA 1OQFA 1H0IA 4GISA 4QS5A 5CQ1A 2EQDA 1RLCL 1E0VA 1ZALA 3NCOA 2IQDA 2DSUA 1CXHA 1GOMA 1R85A 4AF0A 2X8RA 4XBSA 4PBFA 1B57A 3SGUA 3CPGA 1QPQA 4JYDA 2IMRA 3AALA 3KL3A 1EP2A 2G4FA 4Z2JA 1Q2RA 2ABBA 2CNCA 1UQYA 1XPYA 2X40A 5E0FA 4W5ZA 5DRCA 4OOUA 1LUCB 5IFPA 3O0FA 1UZHA 5U7SA 3UR7A 5CSSA 3B8TA 4MJ2A 1EZ2A 1VF8A 1TPWA 3VXGA 4PTWA 5E9XA 1SW3A 1O4UA 2OT0A 3W7QA 1VCGA 1P0DA 2VR5A 3L2LA 3T42A 1BG4A 4HHMA 1KV5A 3PBGA 3GC5A 3PR2A 2YXOA 2FGLA 2VFIA 3URBA 3UA4A 3HG3A 3ZMRA 1JZ3A 5D2WA 4JX6A 1DJGA 3IVSA 1TJ0A 2ZUSA 4HYWA 1P48A 4JQ4A 4HMEA 3OYXA 4WOQA 3HQNA 1QPKA 5CJMA 3RGTA 2VMFA 4GQGA 3TU9A 1JG9A 1G4SA 1VIZA 3PUDA 5DCBA 3QKZA 2ZWYA 3EX6A 1RD5A 4O28A 2BP1A 1M68A 3UF9A 1H7NA 3W1QA 1NEYA 4RNIA 5LYRA 1DJXA 1NDZA 3O2LA 2AKZA 4M24A 4KPLA 4O15A 1IIHA 1JXJA 3DFQA 3T40A 3TIMA 3S5ZA 4R7WA 5TAOA 2XFYA 1VQTA 2QUVA 4G9PA 3W27A 4FNSA 4HSOA 3SUWA 1AFSA 4WDWA 1NFGA 3WF1A 3VCNA 2NQLA 5DMMA 3N4AA 1D7FA 1QWGA 2PDCA 1XIFA 5BXRA 4WGHA 3ITVA 4MLJA 3HO8A 2EPHA 4F0LA 2VFHA 1FWWA 1Q85A 2R91A 3C2EA 1UMLA 3VM7A 4F4RA 2OZ0A 2FPTA 3S6TA 1WQ5A 1XCWA 1RBLA 4J3VA 2UY2A 2XPKA 3EX2A 4JDYA 3G3MA 1XGEA 2AQVA 4FNRA 3MBDA 3BG5A 3P74A 3GVQA 2UY5A 3T2PA 3ZLFA 5FACA 1XGZA 3BZGA 3SN1A 1V51A 4LNYA 1ME8A 1GQJA 3BCDA 3K30A 1MRQA 2QUMA 4K37A 2XH4A 5ABFA 3UCCA 1OD0A 2Z2UA 3LV5A 3PZQA 2DH3A 3WLPA 1Q6OA 5B80A 4JTQA 1AH0A 2GOUA 4DLMA 1HJSA 3OLEA 1W1TA 3PZTA 3WDRA 1GJUA 3ZQ9A 2PTXA 4OZOA 1NFBA 1ZAIA 5FF7A 5XIAA 1Q6CA 3UG3A 3PG8A 4P5UA 1GG0A 4JIQA 2G8ZA 3OG2A 3VA8A 4H9VA 2XZ7A 1GPFA 4EE9A 3VMOA 1EJ7L 5FF0A 1AG1O 1ODZA 2ZA2A 3RPDA 1WKDA 3LPOA 3CZJA 1VJSA 3EOEA 3HQPA 2TMDA 3C5QA 4L9ZA 3MSGA 3TEVA 4HPXA 5FL0A 3WLKX 1FH8A 1W1VA 4HOXA 4TIMA 3N6JA 4FALA 2O4MA 2VQTA 3VNKA 1TMLA 1TRDA 5D2TA 3WUGA 4MB1A 3KBNA 1BWVA 3KTXA 4ML4A 2GWNA 3RLVA 1QATA 3TTYA 1EKOA 3NZQA 5H91A 1M7XA 4S3KA 1Q3NA 4DO4A 3ZJ7A 3QLDA 4AZCA 1UA3A 5A2BA 3SSJA 4LVFA 3COTA 4UFLA 1E1EA 4D6CA 3F2CA 2W67A 4LAKA 3PTMA 2DSWA 2NWSA 3OIXA 5K4ZA 2XTKA 3E12A 2WKLA 2A0NA 3C6CA 4G5DA 4N4QA 5TD4A 1ZL1A 5HATA 1GOWA 5C0QA 1E0XA 5FEZA 1NH6A 1P0EA 4K38A 4H8UA 3CM4A 3ELFA 2IPJA 5I00A 5CAHA 3DBNA 4WY0A 3BE7A 3HGOA 3TSDA 5LHEA 3TJ4A 4F79A 3O07A 3LRKA 3HOJA 3FY1A 3MU7A 3HBLA 2RGLA 3VDCA 3KHJA 5C2CA 1I2PA 1SZRA 1Y8BA 2WVVB 4AC7C 4AEEA 4U2ZA 1W5OA 3VPLA 1E9ZB 3FOKA 2E28A 1NOWA 1GOQA 2WCSA 1OYBA 3HGRA 1US0A 4Q33A 3VFCA 3WFAA 4DAFA 3UZZA 2CZDA 3PUOA 3O6DA 4XISA 3SCPA 3S6OA 4NX5A 1DBTA 3A23A 4CNTA 4QJ3B 2CZEA 2CETA 3NFUA 1NDYA 1WOBA 2XIMA 2WC4A 4ZFCA 4OHQA 1E6RA 1K6AA 3P6LA 3M0MA 4AX6A 1S3TC 3PP7A 4U33A 1RVGA 3S47A 3EOSA 3C2VA 1H09A 1JIBA 4NZ3A 4PMRA 1IXNA 3NL5A 4MPQA 5KITA 4B5TA 4D6JA 4UFHA 3OZOA 4PCPA 5FF3A 3GB6A 3NQBA 4N9EA 3BGGA 1A3HA 1B30A 4O52A 3W7GA 4MDOA 4F66A 2NQHA 3BXWA 1BVNP 4I8YA 1K7XA 3H8AA 1TTPA 3DYMA 4WXYA 1HKJA 5FF2A 5KINA 1LLOA 2ZTJA 2OEMA 2ZVIA 3GXIA 4NZ5A 1XSJA 1EHAA 3DFYA 3VNZA 4K1WA 1FXPA 1EO5A 1EQPA 2ZYFA 1KBIA 1BYDA 1EGMA 3QHOA 4Y9NA 1TPDA 3AMCA 2TRSA 3LZ5A 4ZQOA 1AODA 3FV9A 2DV0A 2A85A 2POZA 4GBUA 3GW3A 4J3ZA 5LHFA 1TV3A 2PDMA 4AC1X 3IACA 3B0YA 1MW3A 4P8UA 4LAZA 4B92A 4P8VA 1PKMA 3LHTA 3SRDA 3FKKA 3NSNA 3RJXA 4GABA 3WLIA 2QJMA 2NW0A 4Q4KA 2QVHA 3PPFA 3VM5A 3F7JA 3W28A 3VOHA 4AY1A 3D46A 2OOFA 5KZEA 3ZS4A 1BTCA 4GH3A 2QCCA 2H3DA 1TWIA 3W02A 3RX4A 3KP0A 3W1UA 3T08A 4GQ0A 3CHCA 4P2VA 4TTGA 1WUEA 4CQ9A 1PO9A 3CB8A 4S23A 3ZM8A 2A3EA 5E0KA 3U7VA 4J40A 2D0HA 3IK4A 3MV11 5IDIA 2JALA 2HTMA 1E0TA 3KRBA 1QPNA 4JTKA 1UH2A 5LNWA 4PCSA 1XFBA 2AAAA 1VYPX 4RZ4A 4C6DA 2NLIA 4PRTA 1ZBKA 4TO8A 3M0XA 4A8LA 3RMEA 3AXHA 1G7VA 3R8GA 5C9XA 4AZ6A 2Y7FA 2ZADA 2PTDA 2OZTA 3VK5A 4LYKA 4RV8A 2HRWA 1WUFA 3WJWA 4FNTA 2VZTA 3L2MA 3P8JA 1JCNA 1KNWA 1YIXA 2MNRA 3AXMA 4IPNB 1GZ1A 2V63A 3QHNA 1S38A 4KEVA 3UXAA 4IMFA 4C7FA 1JYWA 2CYGA 1XLDA 3B9AA 3W23A 1EA9C 3W88A 1E40A 1OX5A 2VFDA 3PANA 5HMEA 1K1DA 4NJJA 4D71A 3MKCA 3UCQA 5MKGB 3AHVA 3IJDA 3V3WA 1FWRA 4HHPA 2OKOA 4LS1A 1J10A 3WO8A 3QV7A 3U8GA 4REQA 4GE8A 2WMHA 5LA0A 1MEHA 5H8MA 3DXIA 2J7FA 2HNEA 1U83A 2ZTKA 1YE4A 3GWQA 1YTDA 2YCIX 2NVCA 3VGHA 5ENLA 2CZVA 3ZLHA 3DYOA 2HK0A 4BQ5A 3OPSA 3DGBA 2NX1A 1W2PA 3R10A 3LENA 1HL9A 1QVBA 3N29A 4PMUA 4IHCA 4PR4A 2GDUA 2FGZA 1UKPA 3VZYA 4GXPA 5CPTA 3PB2A 2H3BA 4CEUC 3NIYA 4UTUA 4LRSA 4B4HA 3UJFA 1WDQA 1KB3A 1RUSA 4OV4A 1FFRA 5DX7A 4GXWA 5BRBA 1ZY9A 3PZIA 7TIMA 1WCGA 1UD6A 1QNPA 2XDFA 4LS2A 1B31A 2PA6A 5AHEA 3ZOAA 4Q4SA 3B8VA 4M19A 3UPMA 2EAWA 1OZQA 4AD0A 3CLMA 1R86A 1UHVA 4D8LA 4U5IA 1WDPA 3WN6A 1JCXA 4GNVA 5AYIA 5D33A 3ZXWA 3CPUA 3L21A 1UOZA 3KZSA 2DJLA 4JX5A 2PWFA 3RNDA 1SZEA 3QHMA 3VD7A 2YZRA 4AZGA 1MQRA 4PB4A 2GVJA 4J28A 2IUZA 2GGIA 3EX4A 1FKXA 1ZJHA 3NDYA 2FVLA 1PIIA 1E73M 3L65A 3T05A 4DWSB 4W7VA 4X9YA 1M9HA 2QMJA 4S3CA 3PS7A 4UXDA 2ZA1A 2H90A 2VX5A 3NEVA 4ZODA 2A7NA 5LGXA 2CXGA 1GJPA 1A5SA 2PP1A 3M1ZA 2MANA 3E02A 4JNZA 3GK0A 4O54A 3NZ1A 3VOIA 4AXNA 4XVDA 4IP7A 4KGJA 3NQMA 2GK1A 2PD9A 3QMSA 4B90A 4H00A 1PX4A 2QIWA 2ACUA 1GVYA 2J7GA 2VCCA 1DP0A 2PBGA 1F9CA 4XBJA 4ZO7A 1TUFA 3K46A 4K68A 4FZIA 3SAZA 2P1FA 2X2YA 3MUY1 3VIGA 2E6YA 2WKGA 2A21A 2EO7A 3HV9A 3TQKA 1OCBA 3A4JA 6ALDA 1MRAA 1I60A 1UMYA 4ZL1A 3W1AA 3CTLA 2PWHA 4TV6A 3WF2A 2J24A 4DJDA 3UVIA 3UZ5A 3VNLA 1XC4A 3W71A 4B5WA 4HOWA 1EDTA 4D8ZA 3MTWA 4AY7A 1ME9A 3H21A 5A6AA 1TFVA 1LL4A 2BVYA 2C1HA 1Y0EA 1NELA 4JGDA 3WDJA 4NASA 3CUIA 4AMAA 4F9JA 1FWCC 1IEIA 1R6WA 5F1UA 1C8VA 2Z4GA 1OY0A 3EWWA 3U57A 4E2BA 4IM4A 3QQ1A 5E9AA 3IVUA 4MSSA 3ZVIA 1XDJA 3A4XA 3S5NA 5LIYX 3VUSA 3LNPA 3HZ3A 5K4XA 4MFDA 2PB1A 2VCBA 3GNXA 5TF0A 3GNNA 1ZUAX 3A47A 3CUJA 2WSRA 3LEPA 4XD4A 1LWJA 2YR1A 4J3XA 1H1ZA 3E9AA 1OINA 5FCZA 4O11A 4GKTA 4HMNA 3KOFA 4O16A 4UZUA 4LXFA 1WKYA 3FDGA 5HMFA 2YPIA 3VIIA 4DUXA 2P0OA 2ZZ5A 4HMDA 3DI0A 4N9DA 4CCCA 2Q6ZA 4C6MA 1YNQA 3PBYA 3P3BA 3WLMA 1FCUA 1VFSA 4JTCA 1UD4A 2NUWA 5BOOA 4FO4A 4Z2IA 3ERPA 3URAA 3WEZA 4M0XA 5ABGA 2FH8A 4GUJA 2ZX8A 4HNCA 3WF0A 2NZLA 2XYLA 4GI4A 1TB3A 3NQGA 1F05A 1M53A 3E0VA 3C0JA 4TMBA 1RCXB 2VEMA 1S5NA 2VJXA 1Q66A 3WFZA 2XGBA 3GTHA 2Y85A 1W5NA 3HJEA 1N8FA 2FFIA 1GVSA 2G41A 3MW7A 1PS9A 2ZUTA 1Z9AA 2OYLA 3IV3A 2AMXA 2VGIA 1V6WA 2EG7A 3GBEA 1YLVA 3N17A 2X1SA 3ITOA 2VENA 3TOYA 3PBMA 2PRLA 1D7KA 3EWBX 2GGEA 2QAFA 4PMOA 4ZE4A 4UTIA 4DNHA 5E6YA 4GIYA 2XSAA 1RA5A 5K3VA 2PDHA 2E5DA 3QQWA 4I7VA 4CU6A 3AIVA 4S3EA 2WO5A 3W2KA 5BZAA 1H62A 1W9XA 2OGJA 3CIXA 2XHYA 3GG7A 6TAAA 2WHMA 2X1RA 3M0JA 3NM1A 3F5KA 2WWDA 4GNJA 2GYIA 5EY5A 4C6PA 1A5AA 1CGVA 4GH1A 3IGHX 1VBUA 3FCPA 3QZAA 4JN7A 3BLLA 2EPKX 3B8WA 3A24A 2ISDA 3UWQA 4WOZA 5T9BG 1VENA 3ABXA 3OU8A 5MF5A 1RJRA 2WSYA 1UUQA 3WMLA 1XIHA 1OT2A 1M01A 1TE6A 3S3GA 4NILA 1KRBC 4YMZA 3VE7A 3P0XA 1UKOA 4PUWA 2W92A 1ICPA 1D9EA 3THAA 3UPWA 2QCHA 1EUAA 4E8CA 5BMWA 1EP1A 1E0UA 1NWTA 1KTCA 1NVMA 1P43A 1PCKA 3HMJG 4KS0A 1SQ7A 1KR1A 1AH3A 2Y7DA 3LYEA 1FWDC 3CNYA 1JNEA 3L4TA 4OBRA 3MMUA 2X1IA 1GOIA 1PKNA 1ECEA 4XIAA 1R3QA 4ERIA 2C3ZA 3NUKA 4C1KA 5A6BA 3XISA 2GWGA 3POHA 1KWGA 2D73A 4WSKA 4LCQA 4RZ5A 4U2YA 3LTYA 4C7GA 3QRHA 5CLTA 1PYFA 2WXDM 3AMKA 4E8DA 1XLIA 2DW7A 1HNYA 3KEHA 4LJ3A 3P93A 4M3PA 3CHVA 3LA4A 2CCRA 2Y1HA 5BNKA 3BPWA 1KTBA 4E2VA 1OC6A 1KO0A 3A9BA 1WYIA 5FSEC 1B90A 3RLGA 1E4IA 2PDXA 1W1A1 1DJQA 4YYCA 3NSXA 2GJXA 1TWDA 1LTDA 4AVFA 2OO6A 4AF0B 4GUGA 1XL9A 4M7SA 2RKXA 3WMBA 2G97A 4YLWA 3XIMA 3F4CA 5T8GA 3G3DA 1SYTA 5EMKA 3QJAA 3TN4A 2J25A 4IGHA 2E09A 1YE6A 2VX4A 3TLLA 2A2IA 3L9CA 4WKFA 1S46A 2WB5A 4JTTA 5HMDA 1R3VA 3CZKA 4ZE5A 3AIQA 2YYTA 5FJRA 4LANA 2VC5A 5GQBA 3GIPA 2PU1A 3NM3A 2Y7GA 2CITA 2FPVA 4UTJA 3STFA 3KOYA 1U1JA 5FJIA 1P4CA 1K8ZA 3A22A 1XGDA 5T91A 3W70A 4J4KA 3ITCA 2R1KA 3E5PA 4DUWA 1V4YA 3WL1A 4W93A 3IPWA 1MDRA 5I3IA 2DZBA 3Q67A 3SCRA 2ZCGA 3F03K 4IMCA 3OVQA 4IFKA 4Q6XA 2J7HA 4C6BA 1I2OA 2I5IA 4ICCX 2HVMA 1HJWA 3SW6A 5FJTA 4ZB0A 5A2AA 2E25A 1PE1A 3MT1A 4IICA 4DEFA 4KEUA 4KFNA 4V27A 4E3VA 5FSDC 4Q8PA 5AN7A 1KXVA 3CJPA 3UWEA 3ZWSA 1JPKA 1BVZA 4C1LA 4ROPA 1JXKA 3NQ8A 4XAYA 3STCA 4O8RA 3S2MA 5AC5A 4MUPA 2WMGA 3PHAA 3PVFA 2FZDA 3NPXA 5I24A 3OTRA 1LROA 4A2SA 4HIBA 3LLFA 3L66A 3NL2A 2A3AA 1MSSA 4X9SA 4J5NA 3IIVA 5H2ZA 4TVDA 1RALA 2ZZ7A 4WD0A 4IGSA 2YW4A 3C2YA 3H2MA 2VZSA 4M1BA 2FGBA 3EWZA 2J4GA 1US3A 4RL3A 2Z6IA 1KKOA 2G3JA 2O56A 2Z2BA 3DESA 3CL7A 1EJVC 5CC3A 1EBHA 2W62A 3EWXA 3N9SA 4BEQA 1TMHA 3SGZA 1E4NA 2DY3A 2Y8KA 3LPFA 1L6WA 3NQAA 4GGHA 5IFTA 1KA9F 5ABTA 3XINA 1QI0A 4DO5A 5REQB 2PDNA 3W7HA 5I3DA 3LTPA 2CHNA 1W5PA 3H23A 1BWLA 1QK0A 2WAGA 4X3ZA 3VDAA 1KKRA 1KCKA 3RN6A 6REQB 1QNRA 3BC9A 2C91A 1IQ8A 3MP5A 2OQLA 1QWKA 4WK9A 1K9FA 9XIMA 4ICNA 1BG9A 4H1ZA 3ZWTA 1UR4A 1PCWA 3EDEA 3FYYA 4FR1A 3VINA 4A29A 3E49A 3FJ4A 4LEQA 1NP2A 1RPXA 1Y5VA 1F07A 5CLWA 3LCWA 1EQCA 2R1PA 4CVWA 8XIAA 1S2VA 2JBMA 2OMAA 4C6FA 2A4AA 2I16A 3PWGA 4GYJA 3THCA 4EPKA 1POJA 4FLOA 5DEZA 3NJ3A 4MNLA 2JF6A 4ACZA 4D6HA 3OA3A 2QJIA 1WA3A 1AJZA 3DOPA 4QIUA 2G0WA 2BFGA 4IZGA 3U4FA 1IZCA 4WY0F 5E93A 1Z69A 2J8GA 2QLYA 3C8FA 3MO7A 4Q8WA 1OCNA 4IXHA 1XYLA 1AQMA 4O57A 4ZVJA 4C1NA 1ISVA 1YPFA 4A3QA 2DQXA 4WDTA 3QPYA 4ZOBA 4ERGA 5J5DA 3EWUA 1AH4A 4ATDA 4BF7A 5BOFA 1B2YA 4AZCB 3FS2A 3NWRA 3RPTA 1EEPA 1RZMA 1M7PA 4DRSA 3EYPA 1JRBA 4QEEA 2HNHA 4PMJA 1M7JA 2ZRWA 3UA3A 5A6TC 5D02A 2HDJA 3L0GA 4IL2A 3DU0A 1B5TA 2R94A 2Y24A 2DT1A 1OCJA 4LFYA 1JZ4A 3A3XA 2OXNA 1P0NA 2QCFA 1X7FA 2LLEA 4WY0B 2TPSA 1UWIA 1DPMA 5EFDA 4UTFA 5JH1A 1DJNA 1H61A 1DYSA 4HD5A 1SUXA 4H2HA 5C55A 4Q4RA 1Q6GA 3BG3A 4FIRA 1GWJA 3GNPA 4ACYA 1ITCA 3WLJA 4LUSA 4YS1A 2YLAA 2EJAA 2ZC8A 1V0MA 3BLDA 4DUOA 3AIBA 3PZOA 4UZSA 1WXYA 1YBQA 3CQ0A 3CXOA 3JRKA 5U4NA 1Q6QA 4QTGA 1B3VA 3TN5A 3CUZA 3FXYA 2D0FA 4AD2A 4I8DA 1PX3A 2WZEA 1J8VA 3U5UA 1J11A 3DECA 1PKYA 4HTYA 1EPXA 4FA3A 1W54A 3QSTA 3UR8A 4M8UA 2QJJA 3WH9A 4RPPA 3SCUA 5C70A 1TG7A 1P6WA 1E1FA 1SJBA 3WKZA 1L0PA 3W2JA 2F61A 3FVMA 4FOJA 3INPA 3K5XA 1EF3A 5LNRA 3M5XA 3WQ5A 4DJFA 3M5ZA 3WBYA 4O8AA 1HUVA 3BL3A 4PUDA 2OWWA 3RRXA 4GIEA 2Q3RA 4XZIA 5H1WA 1MWOA 3C2FA 4RX0A 4H6EA 1RV8A 3BO9A 4NU7A 1TPEA 3OOQA 3PAJA 2CLKA 3P0WA 4EWJA 3E6EA 4BHYA 2YFNA 2WCGA 3S42A 1W17A 3I3DA 3GKAA 3RYSA 1EOKA 4HTBA 4A8RA 1A5UA 3T0TA 2RGMA 1SZGA 4XO7A 3O6AA 1Q45A 1T8XA 5GNXA 5CG0A 4HZ6A 4WEVX 3UFYA 4YN5A 4DY1A 3IJQA 2CZ5A 4H3DA 4TUFA 1A5MC 1U30A 1E5JA 3ZO9A 4YWIA 3SIZA 4Z08A 1NM9A 3G24A 4ZGYA 4GVHA 5M17A 1WO2A 5G2IA 1OGSA 1L8NA 1NAL1 1XYAA 3GH4A 3WY1A 4B16A 1CWYA 3VYLA 2Y61A 4EF8A 1W91A 1VJIA 1HP5A 1ZRQA 3DGRA 2RFGA 2C71A 4KKXA 7ENLA 2O9TA 2W66A 3UG8A 3R43A 4S38A 5JIPA 1A5CA 4OJYA 2IKGA 2AOSA 3FK4A 5A69A 3WQDA 2XVPA 4QDWA 4J3TA 3R94A 5HPCA 1OGGA 1TV4A 3AJXA 1TWSA 4I5RA 3WLLA 4FLQA 1S5TA 2VZVA 4AD3A 3G8EA 4CGTA 1B54A 4HB7A 3CQJA 4ZQNA 3TYZA 3OHMB 2GDQA 2DZXA 3W1RA 3L2IA 1XLHA 3QYSA 3EWCA 1AJ0A 4DWDA 3H2EA 2KAUC 3GVWA 5DQPA 2J9ZA 4W7UA 3UJSA 2QCGA 1I75A 2Y4SA 5C9UA 3EPMA 3STPA 5GJPA 1RR2A 1Q7QA 1O66A 3S5OA 4KESA 3FEMA 4S2BA 2V2CA 3QR1A 2X30A 1YX1A 1SR0A 1DTNA 4XAGA 1TIWA 2YKKA 1Q7MA 3NGFA 3S2CA 4QISA 1IEWA 4U31A 4R53A 4H7CA 1BPLB 1FWNA 2YBVA 4H83A 4CN1A 4BFAA 4YTTA 4UTMA 2OOGA 2PS2A 3NOEA 5EMYA 2E9LA 4OV9A 4ZQMA 4CD4A 3W4RA 4ZQRA 2UZ9A 2PWEA 5EBAA 3D3FA 3GIYA 3AHZA 1NTHA 4QJ4B 2GL5A 2BVWA 4OECA 4LYRA 2DVUA 3W1TA 1CXIA 4XIMA 3PZNA 3RR1A 3MZNA 3E2SA 2AQOA 1NWUA 4O19A 4I9AA 3S6DA 3TA6A 1PBGA 4RXFA 1UWAA 3T81A 1UC5A 3BJSA 2P8BA 2VDGA 1GVFA 1KCZA 4NP7A 5BW6A 1RVKA 2C1GA 2PDFA 3GNDA 3PZVA 1N2VA 4REQB 2OQYA 3AIEA 4A3YA 2BS9A 1Q6FA 5D30A 4K36A 4O18A 1E4MM 1W9UA 3KAOA 5F2LA 2OODA 2VRQA 1Q6DA 3W01A 2O0TA 4D6FA 1F4AA 3HMCA 3GR8A 3AMGA 4LEFA 3EGJA 4BF9A 3ITGA 1ZBCA 3UGVA 3C52A 1Z32X 2CBVA 5DCDA 3MUCA 4ATWA 3MI6A 4WCJA 5EMJA 3DFSA 1W5MA 2X0YA 2ZDRA 4JHOA 1TA3A 1RBOB 1TV7A 2BY0A 2HBXA 5G2WA 1H60A 3EA2A 3E5BA 3AU6A 1SFTA 3I3BA 4JQ3A 2Z1BA 4LU0A 3GKFA 2PPGA 4IIEA 1K8CA 3I6EA 1V7YA 4QFUA 2PP3A 2HZGA 4RDWA 2G3NA 4GC4A 1UQZA 3VDHA 3BAIA 3P84A 4Y9MA 3SRKA 4E6MA 5HUPA 1UP0A 3QTPA 3TKFA 2I9UA 2POTA 3G1RA 4A2RA 3R13A 3R7MA 3UJEA 2XIJA 4X2PA 1W9PA 1Q4WA 2PGEA 1I4NA 3GG1A 3WQ4A 4DBSA 4HMCA 4LCRA 4D72A 3LI0A 1ZCOA 3UJRA 1VR6A 5HK4A 3MC5A 3A12A 5HQEA 1ITUA 3BSHA 2J79A 3LCXA 4RR4A 3C3UA 3QM3A 4DPQA 1W9BM 1XRSA 3QY7A 1NF7A 3CLWA 3WL0A 4BQ2A 2W4XA 4BQ3A 1ZB5A 1EDGA 2B7PA 2OPJA 3MSDA 2E77A 3PG9A 2D2HA 4PTVA 4W85A 2VT0A 3GVVA 3OLIA 5DCEA 4DX3A 1TSIA 2QV5A 1E9IA 1A50A 3KDNA 4GZJA 1WKEA 3C8NA 2J66A 3ANYA 2W9MA 3TYAA 1J0JA 2CLPA 4E3TA 1GOOA 1WDDA 2BSLA 1I45A 3DHPA 4F0RA 1CGWA 1JCLA 4ZOCA 1ZP4A 4FHAA 4Q8VA 1E4LA 5LA2A 5JBEA 1IV8A 4HNVA 4Z1YA 3STGA 2EPMX 4PFMA 4GYPC 3VOGA 4GFSA 4WHBA 4JIHA 3R4IA 2VEPA 2FTYA 3SCTA 3VIOA 2VELA 1LWIA 1VKFA 1V6VA 2BASA 4LF2A 1FX6A 1V3MA 2RDUA 4UTTC 4HA4A 3GXFA 3TTOA 5EYWA 3VKJA 4DELA 1XUUA 3I7SA 4I90A 1UYQA 3M7SA 2XFFA 4JKLA 3FSTA 4XZWA 2FKPA 4QLKA 3ARPA 1TQXA 3P62A 3W7RA 1J5TA 4ZOEA 5C54A 2HBVA 1QOPA 2YA0A 3WCZA 4FS9A 2ZUVA 3GU9A 1GVQA 1RA0A 2V5BA 1OBAA 4DYEA 4YNGA 4PGLA 2VRKA 1UC4A 2ZC1A 4K6AA 4GNKB 2TYSA 4LNCA 3J7HA 1KXHA 3M0KA 1QBBA 1PTGA 3NQ2A 4DYKA 2XFRA 1IWBA 4AHOA 4GVFA 2IPFA 2E9MA 5D38A 4L5ZA 3HU7A 2GUYA 5BMXA 4FEZA 2NXIA 4Z1BA 4DZAA 4HSHA 1F7BA 1QASA 4HNTA 5EMUA 1WV2A 1RY8A 4UNLA 4WJ8A 2ZFAA 1FDZA 3EXTA 1ZSXA 4PMDA 1GQKA 1W1ZA 2D2OA 3UESA 4A8NA 2VZUA 4BY3A 5AC6A 1VCFA 4ML9A 1HG3A 1XH0A 3OJGA 3OIHA 6A3HA 1O1ZA 3KOZA 3QVQA 3M4HA 1ZQ5A 5DN1A 1W1YA 3FLUA 4LRTA 1BAGA 3WH7A 2R1LA 5EGRA 3BLFA 1PV8A 1YDVA 1TKKA 2ISSA 1R9YA 1RD6A 4Y7EA 3KP1A 2OLAA 2V30A 1L2QA 3LHVA 2O9OA 4NQ1A 2QVNA 3CZEA 2XN0A 2QZRA 3LM7A 1KW1A 1WB0A 4PUUA 3KXQA 3VIHA 3AZSA 4EXQA 1DL3A 1DWJM 3N18A 2JGYA 1UIPA 2WMJA 1JUEA 3PTDA 1EBGA 1R3YA 4ZO9A 4LT9A 2C79A 1F3XA 2PTYA 1TVNA 5D05A 4FXRA 2BGQA 4IX0A 1BTMA 1S2WA 1AJ2A 5LIUX 1XXXA 4CKQA 1R2RA 3MKVA 1PVNA 3TC7A 2BWGA 2ZUMA 4GQQA 1T0OA 3RK8A 2QW5A 3MSYA 4ECLA 3SY1A 5BU9A 4YWSA 3EKZA 3ARUA 1J96A 1N8IA 4EIVA 3BAKA 2XVKA 4KFOA 1GG1A 1H7OA 1HKWA 3HPFA 5LA1A 3LXAA 3FYOA 1ENUA 3VDBA 4MNKA 4JL2A 5AVNA 3W1LA 3RX3A 1KFWA 2HVOA 3KRZA 1DORA 3M5YA 3BSMA 4DB7A 5HDRA 1NSJA 4RZBA 2OSYA 4BQ4A 1E3ZA 4Z0JA 4IF2A 1SFSA 2DW6A 5G4EA 4GRSA 1JFHA 2HE8A 3WIJA 5LNUA 5F4XA 2X42A 4XKMA 4QBXA 4GXMA 2Z27A 4MWAE 3W00A 3IUDA 3RO8A 4UQDA 1UJQA 3WJXA 4N9BA 2GJPA 1LF1A 1QFEA 4BI5A 2V2HA 4N6FA 1T7LA 3W1PA 5FIPA 4LS0A 4LBRA 3THQA 1JDDA 2BGNE 1WBHA 3VAVA 5IM51 1GORA 4TVCA 1R0MA 3ARYA 1IXPA 4YVXA 3NTYA 2G37A 3O8AA 5DELA 3SI9A 1W3JA 1UUMA 2CBJA 3QXBA 3BLIA 1QW7A 4MAVA 3WJYA 3VGEA 3GU2A 4GUHA 1H11A 3M07A 1CB7B 3BW4A 1I9CB 3IGSA 4GUIA 9CGTA 2WPBA 4EPBC 5FA5A 2YB1A 1OD8A 3HB9A 3LBCA 3CHDA 5EPDA 4LTSA 3WJSA 2DZWA 2W3ZA 4ERAA 1D3HA 3I6RA 4R85A 4XQ6A 5CSUA 1GZGA 2GJXB 2EPOA 3WDPP 5M3WA 3WUBA 1T8QA 4AISA 3GTNA 4M56A 1GKPA 3N11A 5HBFA 3B04A 2I56A 3LNMA 5EU9A 2XVNA 2PWGA 3EDJA 1GNXA 2P8CA 3W6LA 4LUTB 2YDRA 3E1F1 1KBBA 3RR4A 1WKFA 3V5FA 3O15A 3OLDA 4EK7A 3NQFA 4G7FA 3SJ3A 3MCOA 3WNKA 4JFUA 2PCEA 4Q7IA 1RK6A 3B0UX 3GVGA 4EWND 1F3TA 4UBPC 2WZTA 3PJXA 1XKYA 1DIDA 4Q8MA 1G0CA 1AA1B 4IUGA 4NIRA 1A0CA 3PPGA 4C5YA 2PF8A 2OO0A 5AB3A 2W79A 3R6IA 1JDCA 3AMDA 3Q2DA 1RAKA 1HJVA 4ZB5A 5JUVA 1IT0A 1G4PA 4YYFA 3R0DA 3UXLA 1KFEA 3FDKA 2GDVA 3G1XA 1D8CA 2A5HA 1GTEA 4PMZA 2Z1VA 4GGBA 3DFTA 4ZA0A 5I3KA 4X61A 4ZBCA 1ONXA 1QNSA 1W1IE 2VGBA 1JUKA 1QPRA 1V6YA 1F74A 2HCVA 5IHRA 2V3DA 2DZUA 1L6FA 1EFZA 4TX6A 5D8WA 4CQCA 5A3HA 3UWZA 1I2NA 1VBGA 4IIGA 3V36A 1GKRA 1UR8A 2WVUA 1FCBA 3Q4DA 3T07A 5JIWA 1Q63A 3EDFA 2ZX6A 1XCXA 2HS6A 4AX7A 1V77A 2QCLA 4ADSA 5TNVA 1JZ7A 3E96A 4RW5A 2X09A 3GW0A 3BGAA 1REQB 4U5KA 3LLXA 2DPEA 2E1DA 2V3GA 1E9LA 4KH2A 1TQJA 4LB4A 3MB9A 1V7AA 1DQXA 2AL2A 2ZA3A 4BA0A 1OG0A 3S2LA 1HL8A 4DBUA 3IGXA 3IAPA 3TYUA 1W6TA 2I57A 3MI2A 5DT7A 4YHEA 1DJZA 4HU3A 1NQ6A 3GG0A 4QAWA 1NP0A 3PSWA 1FXQA 3V16A 3QTGA 2PGRA 4FXFA 1EEXA 1TVLA 2BVDA 4B5XA 4KBXA 5HNNA 2AGTA 3WQPA 2OEJA 4HJFA 4J3WA 3MP3A 1WZKA 2O4QA 2WQPA 2GUUA 3C2RA 4IIDA 1KLYA 3M5VA 4IX2A 3A3HA 1GYNA 4QJ1A 3B4YA 2DIKA 2QUUA 4JKKA 2CFFA 3ECQA 3WMSA 1LJYA 4INFA 1PXGA 3WQEA 4HZMA 4B4FA 4GX8A 1TELA 3GXDA 4HCLA 4HOZA 4HVXA 1D2KA 4NF7A 3TV8A 2W6RA 4UWMA 1HL2A 1A3WA 1XCFA 1POKA 3TXZA 1UKSA 2WZMA 1A5LC 2PGWA 3QFWA 4ACZB 1RK5A 5BXSA 5ECVA 1ADOA 1XQKA 2VEKA 1IHIA 2X0SA 4QLJA 2A6NA 5JMUA 4UFIA 1QI5A 3T8QA 3HM7A 3VNYA 2G3IA 2ALDA 3EOUA 3C0QA 4AAJA 4C1NB 1JI2A 2VXNA 4JQAA 4RZ6A 3SY8A 3FHAA 1I0BA 2VFGA 1FWIC 2B7QA 1X6NA 4GMEA 1KM6A 5HWMA 2QDHA 4MVAA 3AAMA 3UPBA 4Z1AA 4HGXA 2VUNA 1MMFA 4E38A 2ZRVA 4XG1A 4AD1A 1OG6A 3D3AA 5GNZA 2QCDB 2B81A 4H9YA 3AUOA 3BWWA 3ARSA 7PTDA 1B4EA 4KWVA 4ZCWA 3HN3A 1UIOA 4J3UA 1H49A 3W6MA 4MOZA 3NPVA 3T9PA 2YFOA 4KFPA 4OWGA 3WQ8A 1HKKA 3AMLA 4FNPA 4JTDA 3NQDA 2OVLA 2R9RA 3SECA 2TODA 1PZ1A 3TUUA 2JQXA 2YCKX 3WZ0E 5DLCA 4QE5A 5CXPA 2HROA 2DZTA 4JTHA 4XUYA 3W72A 2F9RA 3AXKA 4BWLA 1F6KA 4OE7A 1H3GA 1SM9A 3FNDA 1XBZA 1R87A 4YVVA 1RHCA 1VEPA 1YBQB 4XD3A 3IIXA 3VMPA 5HA7A 4YTRA 2ZX7A 1G7UA 3GDTA 2ZWZA 2ZXDA 3W24A 3QR3A 4JKMA 3LUTA 4UC5A 3AIRA 3HA1A 1A5NC 3THUA 1EC9A 5I3FA 1XINA 5CJ5A 5D2XA 1BXBA 3I65A 4S1FA 1DXEA 2ASHA 4UR8A 4A4AA 1OCQA 3GTIA 2VUYA 5HR7A 4LF1A 3DFNA 4PSPA 4KCVA 3FHQA 5IDZA 3DFHA 1K70A 3KBSA 4LVDA 3UXIA 4FF5A 1K6WA 2YZ5A 4YTQA 3WNOA 4WJEA 3TW9A 5JVLA 3KOXA 1UR1A 1E1CA 4DF1A 4FSAA 2EHHA 1EJUC 1RBAA 5I3GA 3BG9A 3G1SA 1HN1A 2QEZA 4C6JA 4E4FA 4QX4A 3CMFA 3PZ9A 2D69A 2B0MA 5CEWA 2YCLB 3GS6A 2FYMA 3W6YA 3GHSA 1DTUA 4GVGA 4L80A 3IV8A 4Y9AA 2ZOXA 3LN3A 4IIFA 2OU4A 5DBUA 5KETA 3AROA 3KBVA 4PH6A 3GY1A 4AWSA 2OX1A 4W4QA 2Q8LA 3HG4A 3W1XA 1JDEA 3WBEA 4AIEA 1LQ2A 5HUOA 4DJEA 5HOSA 1Q8JA 4J2MA 1J4EA 3M0HA 5CC5A 3JUGA 4H9TA 3G1YA 3LGGA 1L6YA 2VGGA 1O5KA 1T41A 2A79A 1ZJAA 2PODA 2V5LA 1FHVA 5A8QA 5T9CE 8CGTA 4B3KA 4UR7A 4L6HA 4GY1A 1R30A 1K8XA 3ANUA 4LC6A 4RE0A 4NZCA 3QY6A 1K4GA 4D8AA 2QAPA 5C9WA 4PTMA 2W0UA 1IWAA 4B5VA 4C5ZA 2BOEX 3WFLA 1VJZA 3TDFA 1ZAHA 2XIOA 5EMMA 4YTUA 1BXCA 5CSRA 1E9YB 1YW1A 3KCLA 4LBSA 2VP8A 5AC8A 1VBHA 1Q6EA 4QSFA 1NWSA 4KIEA 2HXTA 3CO8A 4QEHA 4B9YA 4CQ8A 5K7JA 5CG7A 2J7BA 1V93A 2V0TA 1XYMA 3MYPA 2REQB 3TNOA 2R82A 2ZQ0A 3VKBA 1EP3A 4C6OA 4V1YA 3NL6A 4S3JA 3BOFA 1HXJA 4GFIA 5G1MA 3GDMA 3MCNA 3H70A 2DUAA 1Z44A 3G22A 1GVEA 4AEOA 5CBIA 5I3JA 4LC8A 1XIJA 1DQWA 1FHUA 3W7DA 3ABZA 1QNOA 4JAWA 2F8QA 3CYJA 3M9YA 2QIIA 3NQCA 3DHFA 2C7FA 2X16A 4MWAA 4XTIA 3KE0A 3N4FA 2V6AA 4U4MA 3DH7A 2ZUUA 1KXQA 3TROA 1W8GA 2ZXQA 3TXVA 2G4JA 4QE4A 3VTRA 2CXEA 1H5YA 3A4WA 3GUWA 3THDA 3TCSA 3HG5A 2ACSA 4IWWA 3RDKA 4DUVA 5DF0A 1UBPC 3AC0A 3DBPA 4AZHA 2C18A 3TVAA 3ARRA 3H2FA 3I6TA 1X96A 3PUGA 3CT7A 3O7UA 5KZMA 4F40A 5BRQA 1M65A 4JYEA 5D9MA 1MFUA 3OP2A 2V3EA 4Q4PA 2XM2A 3V75A 2ZBTA 1KBJA 1JD7A 2PC8A 1GT8A 1UBSA 1H7PA 3QSRA 3SN0A 2JFEX 1DIOA 1YADA 4NSBA 2NQZA 4GUFA 2AL1A 3BARA 5A6SA 2WBKA 4UIOA 2Y8VA 2J74A 5FI8A 2IS7A 4AWEA 2BMBA 1MZRA 1KBLA 1V3HA 3DKLA 2Z1SA 1QI2A 5T26A 4AB4A 1XF0A 4CQDA 1XBYA 4K2SA 3T55A 3V0UA 4QSHA 3N2OA 4KGLA 4FAMA 4DNMA 1W3NA 4XUGA 1E6PA 4LH8A 3WK0A 1BSIA 4P7QA 3N2TA 2Y88A 4WJXA 3MBFA 1LUCA 1PL9A 2VR2A 3GR7A 3WF3A 3EAUA 2V2DA 2D0GA 4V2XA 4HHHA 1ADDA 3EXSA 3W2LA 1A0DA 1PIFA 1FWFC 3RM9A 3G1FA 3ZT5A 3CB3A 3FAWA 1YDOA 3Q94A 3ARWA 5HPOA 1N82A 2RJGA 3JW7A 4NKCA 1CLVA 3WEMA 3VD9A 2C16A 3HURA 1S1PA 3WLRA 1XLJA 1FKWA 4N6EA 2BHZA 5AYZA 1RXOB 4NAEB 4HA3A 5BXPA 4Q4QA 2QCEA 3PPHA 4GX9A 3UR5A 1LM1A 3K8LA 3W7MA 3LSBA 3UWVA 3LI1A 2IKIA 4HT3A 2Z0IA 3M0LA 1UZDA 1Z42A 2XU2A 1EJXC 4UFMA 3LGDA 3SBFA 1QXLA 3OVRA 3RUBL 3NSMA 1R2SA 1U33A 3TX9A 2YXXA 3IJ6A 2WHKA 4X2RA 4OIFA 1Z3NA 3GZ3A 3F4WA 4MJ4A 4CQAA 4AVOA 1CW2A 4UOJA 2XWEA 3SQSA 4DQWA 2YBTA 4A21A 4FXJA 3A64A 2ZICA 3WSUA 3FA3A 4MG4A 3GFZA 7A3HA 4IIHA 3NYDA 3U48A 2WLYA 4LAMA 1D8WA 3H7RA 4HA0A 2UBPC 2CZFA 4UMBA 4NJIA 1AVAA 3I7QA 1XISA 1J18A 4CCEA 2D2JA 3BMXA 4DWSD 3MHGA 1OYCA 3QF0A 5HAOA 2PBOA 4GIAA 1VFFA 4IJRA 1GONA 1R47A 1X97A 3SSZA 4PE8A 5F2IA 3RU6A 3V5OA 4BCEA 3LLDA 2QMKA 1BGGA 3KW3A 1NQKA 3OB8A 1ZAJA 3W07A 2F38A 1OFOA 5G2HA 2V38A 3SADA 5RUBA 4L9YA 1YXDA 4TV5A 4DBEA 7TAAA 3RAOA 1J6PA 2QXWA 3AI0A 3EPNA 1B0IA 2KZHA 3Q65A 2AQWA 4EVZA 3CQHA 3F5JA 1F8IA 3LQGA 1LBMA 3B05A 3DC0A 3ID7A 4K8HA 4N2YA 4UOQA 4DF0A 3VVGA 1AZ2A 3JR2A 3TQ0A 4UMAA 3VGBA 4OBTA 4JOMA 3V5CA 2ONEA 2I14A 1QNQA 1XLLA 1MXDA 1LQAA 1UD5A 3KHDA 4MKSA 2P53A 3UBPC 3W7NA 6PTDA 2WZHA 4QLLA 4FOKA 3OZPA 2DVXA 5EFFA 3ONCA 2RDXA 4Q3MA 1JYVA 3H2NA 2VVSA 3G18A 2W27A 3VD5A 1JD9A 5I5RA 1I6NA 2EG8A 2GGGA 2A3HA 3EDKA 1VFLA 3PB0A 1UH4A 3AS0A 3IAQA 3QMTA 1YXYA 1QTWA 4DI9A 3WNNA 5CJNA 4V1XA 3LCHA 3FW6A 3PBWA 3CGTA 3NVTA 4KRZA 1M5WA 2PDWA 3OGRA 3AS3A 4RK8A 1DWGM 3LU2A 4I6VA 3QEZA 3VCRA 1SZFA 4S2CA 2NUXA 4IQJA 3NA8A 3S9ZA 2ZRYA 3OGSA 1O12A 1I2QA 3CV1A 1GKQA 1FRBA 2CWXA 3U6WA 3TAKA 3BV7A 1XKJA 3BCFA 1U22A 3D6NA 5M5DA 3L12A 3N9KA 5KEZA 2V9DA 1VIWA 3PF3A 2PDBA 4DPPA 4PMXA 3WQVA 2V82A 3H7UA 3L23A 4O12A 1US2A 1CT5A 1GEHA 2UWFA 4IL0A 2ODOA 3S9IA 2CERA 1FH7A 2EPNA 1P1MA 3VIKA 2WHJA 1TV2A 5I79A 1K7EA 1QNVA 2E0PA 1SO3A 4MADA 1F3WA 3PJTA 2P3EA 1M6JA 4JCMA 3A5VA 3ZSSA 4AH7A 5LXXA 3K8MA 4Q22A 1U5JA 1ZP3A 1EIXA 3TAOA 3DHUA 4CN6A 2E7FA 3G1HA 3KRSA 3WD3A 1E56A 4I5XA 1CLXA 4RW3A 3VOJA 3BANA 2QDDA 3H2OA 2VEGA 4JY8A 1ZBWA 3CH9A 2FLIA 1FP9A 3TFXA 1XW8A 3B8DA 3LSCA 3QPEA 1DHPA 3QGKC 2P5NA 4QNWA 3M43A 3W2NA 4HHLA 5CCZA 1DWIM 2PF0A 4UQEA 4MZYA 1TR9A 3N3TA 4V33A 1TX2A 5FAJA 3NOYA 1P5BA 3P5ZA 4GA8A 3WX7A 5GVJA 1C29A 2QDEA 4K7YA 1IEQA 1OFAA 3TZFA 3WNPA 5L6UA 1W1B1 4JR5A 2WNZA 2VFFA 4OBSA 1GCYA 1O95A 5D32A 1XRVA 4MIMA 4I5UA 2OB3A 4L6DA 4W9TA 2C19A 1XUZA 2GGJA 4IMGA 3WDHA 3N6QA 4R7JA 3B8IA 3MMWA 1L2UA 1Z7AA 1Q2SA 2DSKA 1EX1A 1GQLA 5HULA 4ZR8A 5IXEA 1VGAA 2C14A 3MJMA 5HNTA 3GBDA 3AIWA 6ENLA 1IR2A 4AWTA 3K4DA 2J6XA 2PI6A 2A7PA 3EOOA 4AZ7A 4N02A 4O1CA 4XAFA 5A8OA 3SFWA 3V35A 3GXMA 5LZLA 3WD4A 4US5D 1J12A 4YCOA 4I6KA 3RX2A 3L0NA 3KLLA 1T99A 1H1NA 3G0XA 3AYRA 3GNOA 1QI3A 3BW2A 3OYZA 2Z2AA 1XC6A 4LB3A 3I7RA 2BY2A 1EPVA 3KCOA 4B3LA 1J93A 4E5TA 3NXFA 3MO4A 4LUJA 3H55A 4ZB2A 4CD6A 4QE1A 2DDXA 1HT6A 3CQKA 1MO0A 5AOUA 5HR6A 3S4TA 2OTDA 1UR2A 3QYQA 1DQUA 5A8NA 1MYRA 3W7OA 4GBDA 3AWOA 3DERA 5I07A 2J7DA 1ZFJA 5C7VA 1CEOA 2HISA 1V79A 2BOFX 3CQIA 5DT5A 3M64A 4MY8A 4AD5A 5MKGA 1E72M 2G5WA 2R1NA 4PMYA 4XVEA 5A2CA 3UNTA 4MB5A 2BXVA 4KT2A 1SMDA 5AHNA 1P6CA 1K7FA 2YDAA 4JDBA 3C0SA 3TSBA 3W25A 2OR2A 2PSNA 2AL2B 4CEXC 1KR0A 4XSLA 3P14A 4QG9A 1MZHA 2YL9A 2XVLA 1I2RA 4EACA 1X6UA 2Z28A 3O16A 4NRSA 2WMIA 1X1OA 3VNDA 2WSQA 5CGQA 2OFJA 2OZ3A 4JIEA 1GHSA 1OZMA 3EWDA 3DFPA 1J0IA 4QHRA 3PULA 3PY2A 3OHIA 3W76A 2JEQA 2X2GA 2E1WA 4JEQA 4B15A 2B7NA 5LKYA 4G1KA 4V15A 4PSRA 3W26A 2XINA 3R0KA 4U3CA 1KCLA 3TWAA 4CUCA 3LHZA 1J0KA 4GQRA 5E5CA 3P60A 3P81A 2DIJA 2DU2A 5CPQA 2GQ9A 4DWSC 1VEMA 4NAFA 1FWBC 4A3UA 2OEKA 3B0XA 3TQPA 3ONBA 1BHGA 1FBAA 4F0SA 3G0SA 1AD1A 2C13A 4HN8A 5CGTA 4IQLA 5AZ1A 4DI8A 1LLWA 3WG6A 3TH6A 1WDRA 4M6PA 4GYKA 4TR9A 4F9DA 3SQLA 1NDVA 2B7OA 1LG1A 3UU0A 2PD5A 3I4EA 3NZGA 4DBWA 4PEEA 3ITXA 1VD6A 1TUXA 3ARQA 4WQ6A 5ECUA 4QCEA 2E9BA 2FZNA 2EKGA 3TYCA 2RDTA 5IBXC 3LB0A 2ICSA 4DWSA 3GH7A 1AQHA 1ONWA 2PC4A 1SVDA 3N73A 3KBJA 1U5HA 1BYCA 1XWYA 1E70M 2INEA 4FX8A 1QK2A 4G56A 4NJKA 3QGAC 4NI3A 1TO3A 1J0ZA 3GDKA 4JFSA 3H2CA 5I78A 4PMNA 1GVIA 2NT1A 4HYRA 3FEQA 4U10A 1O6IA 2I7GA 1VBRA 1O60A 2BNJA 1GYLA 3NR0A 1AK5A 2HE5A 2OWXA 1H1YA 4RNJA 3O3RA 1VHNA 3U2ZA 1QHPA 4RDZA 3S1UA 2WVSA 4YL2A 5K9CA 1W3HA 4L4OA 3LMZA 1R3WA 3LCFA 1P1XA 4M81A 4PC8A 4A8IA 5IOBA 1E51A 4BI6A 1CBGA 4LW7A 1PJ9A 2R8WA 5I3HA 3SQMA 3W1NA 3QR0A 1FP8A 3VNMA 2I1OA 3WD0A 3VI2A 1J79A 3S1WA 3NNTA 4O4VA 1ECQA 2B31A 4AD4A 4J2PA 3O05A 3FJ6A 1RQEA 2OLSA 1CZ1A 1B9ZA 2AKMA 1IR1A 4UOZA 2J88A 4H6KA 5DY3A 1FWSA 3M7WA 5L9FA 1EYEA 4A05A 2A7RA 4QXIA 1EOMA 4LUIA 1HKIA 1EF2A 1OFRA 5CPSA 4ES4A 1UJPA 3WNMA 1WDSA 3DIPA 2E8YA 4JYFA 1OFPA 2WC7A 3UZJA 1EO7A 3PM6A 1ZLPA 4K1GA 4L6OA 3NQ6A 4CU8A 2JIEA 1O5XA 2J27A 1E1CB 4EPEC 2GSEA 3PZUA 3LPPA 3PK7A 3DKJA 4FX6M 4KEZA 2BDQA 3AHYA 4ZO8A 3MDUA 4C60A 3M6DA 2JKAA 4JQ2A 1J01A 1A80A 1H7XA 1UKQA 1LP6A 1S2CA 4UCGA 3EA3A 4O4WA 3BV4A 3O0KA 3CH0A 8XIMA 3IJ9A 4UQ9A 2O9RA 2V5CA 2XISA 1SU5A 4Z1CA 3S8HA 3KTSA 2C0AA 2ON3A 1JF5A 3QBUA 2VC9A 3O6CA 4X0VA 2OJPA 2WBGA 3SN4A 4XWUA 2ZX5A 3PNUA 1ML1A 3B40A 1WDWA 1UOKA 3G8RA 2B4GA 3Q58A 3LTSA 4W88A 1DWFM 5M1TA 1HW6A 4IISA 4HP5A 2JK2A 3V1HA 4NNCA 1TPFA 3ZYZA 5FJUA 1Y7VA 3BQ6A 5EBUA 2DZVA 4O1BA 3CV7A 4PB5A 2F6UA 4OGZA 3PFMA 1PPIA 4JIPA 1BFNA 3CASA 4B3ZA 4O0QA 3F4NA 4WR3A 1O5QA 1CCWB 1CGXA 3JZEA 2WJEA 3VIPA 1TIMA 4JNMA 1VRXA 1J2WA 3VNJA 3UYCA 4ZXLA 3SRHA 3TLQA 3VKKA 2F7FA 3QQ0A 4AIOA 4UTWC 1PEZA 1GGOA 1NY1A 3FAXA 4CD5A 4Z2HA 1XR2A 3HFTA 3TJLA 3WLHA 3E74A 2PEVA 3IWPA 4L61A 1XLAA 4PTNA 1VAHA 1RCOB 8TIMA 3ATYA 1ONRA 3HGSA 3QC0A 2NXHA 3WQ6A 3UNDA 5FD0A 1W32A 1EH9A 3MUAA 1R7AA 1VFHA 1Y5XA 3URQA 4LBUA 4MZ1A 1KD0A 3B9OA 4J27A 2ADAA 3W2UA 1FWEC 4A6GA 5DANA 4KERA 4MNMA 3C0LA 3AU2A 4S3DA 4S3AA 1TMQA 5FAGA 2L5HA 2G3FA 3EB4A 3ZVHA 3C86A 4G7EA 4NHVA 4Z1DA 3E2VA 5I7GA 2UY3A 3U2OA 4WDXA 3UJ2A 1HJXA 1QI4A 1AW2A 5FEWA 3WBWA 4P7RA 3PBVA 3LXCA 3R8RA 4MWAB 4PB3A 3CZ8A 1AZ1A 4QJ5B 2HK1A 1TJ1A 3MS8A 4ZFMA 3CAWA 2YDQA 7ODCA 3GFXA 5D9OA 3N4EA 3EBVA 3KFTA 1Q6LA 2PLCA 3IIOA 1Q4NX 3UQNA 4QR6A 4G8TA 1DE5A 2QV4A 4PBGA 3T2QA 5G5IA 3F2BA 4E8GA 1OC5A 4PFHA 4JBRA 3F4VA 1ESWA 3C3NA 3G5EA 4H9UA 5LNVA 3QW4B 3M16A 4F2UA 5AVHA 3TA9A 8A3HA 3MZ2A 2XH0A 4ORMA 2BVTA 1H7WA 4KCTA 2DUXA 4US5A 4H4IA 5CGMA 1S5WA 3QH2A 4RNFA 3U0HA 3UWWA 3BVJA 5LNSA 3K8KA 1EC8A 3CPRA 4QGCA 4GO9A 1V08A 4GHRA 1TZZA 7XIMA 3BDKA 5E70A 3AJ7A 5I09A 1W56A 4JQ1A 5FESA 2IQTA 3NZPA 1XIBA 4JCLA 1PUDA 1EA0A 3W37A 3CMGA 4PMVA 2XN2A 1QPOA 5CAKA 1TPH1 3KDOA 1UROA 3I10A 1PX8A 5C8BB 3PUEA 4EXBA 4BS0A 1UP3A 1OK6A 2J75A 3UWYA 1K77A 3ES8A 4ZQCA 2SFPA 1MVYA 4HZ7A 1N55A 3VOFA 1TZ9A 3N34A 3RF9A 2O55A 3ZR6A 4GOAA 4LOCA 1TWWA 4DXVA 1X6LA 3RLUA 4HNLA 4KIRA 4M6UA 3HJZA 4IFRA 4C7DA 3PN8A 5JH2A 1ADSA 3E0LA 1ME7A 1VZWA 2E40A 1UB3A 3B06A 4JTGA 3W53A 1JVNA 2JIWA 1XIGA 3OZYA 2R1MA 3KS5A 3TR2A 2PCQA 4HCHA 2HMCA 5LIKX 1EUNA 1ZGDA 3W83A 1JPHA 1QDSA 2XM1A 2G96A 1LOQA 4IGNA 2PWUA 5D09A 2TSYA 4KRTA 1JCYA 4JHMA 3FA4A 3BAJA 1KWKA 5CH9A 3I68A 4H9XA 3WBAA 3AQUA 2YGYA 3EB3A 2X0HA 3BAWA 2CLLA 4LY4A 3U3HA 3OGVA 3H54A 2D3NA 3ABQA 3UP8A 4Y9PA 1NARA 1AW5A 2XJ7A 3I3EA 1R8LA 1EIBA 1J0YA 1MW0A 5K2ZA 2ZKMX 3QOKA 4NX0A 3RXZA 3W74A 3L67A 3Q45A 3FKRA 5ABFB 3W84A 4Q32A 4B91A 4KMQA 5REQA 1HIZA 3BJTA 3N2MA 1UASA 3NZRA 3GYEA 3TTSA 2PDIA 4NYYA 1R2TA 3A13A 6REQA 3U2CA 2DORA 1SFLA 4UUIA 1CXLA 1R3RA 4GQBA 2Q3OA 2WWCA 3WD2A 4IPPA 3DEQA 3S2NA 1WAWA 3ZLGA 1I8JA 2Z00A 4DJDD 4O14A 5CPLA 2XN1A 1M1BA 3FVDA 2HPIA 1YPIA 1L8PA 1QR7A 1XLFA 1THFD 4GD0A 3H4WA 4JL1A 3TOPA 1Q8AA 2QHAA 4FPSA 1OM0A 4WKHA 3SIMA 3W7IA 3L5LA 3F5LA 3CS2A 3NO5A 1VB9A 4KCWA 4HPGA 4N4PA 5AFDA 2C6QA 3UWUA 3ENLA 4QQ3A 5BOEA 4NNBA 1T5AA 3W2MA 4U28A 3ZSTA 1EJSC 1HKMA 5JQ9A 1YTKA 4H6RA 3R58A 2EJ1A 4JFTA 2JE8A 3TYBA 2WPGA 3H4XA 2ZIDA 5A1AA 3LBMA 5F1VA 4O1AA 1LCOA 3SFKA 3ME3A 2I5QA 3BOLA 4XZ9A 2HV5A 3L4UA 1X38A 3TZNA 4Q8OA 3GVRA 1V0LA 1HTIA 4HSNA 5LIXX 4PZVA 4A3RA 1DWAM 1XDMA 2Q8XA 3M41A 2O9PA 3APYA 3N2CA 2CPUA 2VWTA 1MUCA 4IUOA 3H53A 2J9XA 4JTIA 4H41A 4Z17A 4WRHA 6XIAA 3WDQA 2P3ZA 1RQHA 1YYAA 2C15A 3P80A 4ZTYA 1IEXA 3R8HA 1XD0A 3WK1A 1F6YA 4HPHA 2WK2A 5F4WA 2GJLA 4F0HA 3B4UA 3APTA 5A6MA 1ICSA 1OGBA 5KMYA 3MKKA 4PULA 4UQBA 3KRUA 3M46A 3E0IA 1W3IA 1WE5A 3L4VA 2R14A 1KQYA 1BF6A 3M44A 1FWGC 1VFMA 2WCAA 1PSCA 4PUKA 3CUGA 1MXSA 3BAXA 4YPJA 1XLGA 2F2HA 2Y0FA 2BB0A 1JQVA 1S2UA 1CXKA 2IPGA 3KLKA 4UCFA 5A5WA 4DF2A 1A3XA 1E6ZA 3T0CA 1HO1A 4RUBA 1G4TA 5D37A 3KWSA 4MUZA 3DCPA 3WLQA 4ZSTA 3REQA 3SB0A 2ZRZA 3F4DA 2ZUNA 3OZMA 3ARXA 4HU8A 1E6XM 4JN6A 2W5FA 1T6MA 2FMOA 2HVNA 1UG6A 1UCWA 1ZHAA 1IYXA 5EA9A 4H8NA 3M0YA 1V5XA 5LXEA 1YDYA 3R11A 4JTRA 3MV01 3HPAA 2GPTA 5G1YA 1SGJA 3QZEA 1EJWC 3GFYA 4DVOA 4OOZA 5BCAA 3VC5A 1V3LA 3T2OA 1V03A 4EANA 4DO6A 4A22A 2WM1A 3L5MA 2CU0A 3GDRA 1B3WA 4PMQA 4HPNA 3G6MA 1TCMA 1GVRA 1W5QA 3PSVA 3W82A 5D9NA 1PDYA 3K1DA 4FNQA 1B3ZA 4WKAA 3ATZA 3EXRA 5D2YA 3OVPA 4AIBA 3MSRA 1TPUA 3CAKA 5HMSA 3OODA 2V69A 4DXKA 1JGIA 2IW0A 1V3KA 1UD3A 2NQJA 2VQUA 2ZX9A 1DEDA 2J13A 4N9CA 3CIWA 4HJWA 4AHQA 1NOFA 4L1WA 1O1HA 3V1PA 3SCQA 2Z26A 4DO7A 1H7RA 1LT8A 2QNEA 4AEFA 2VC7A 4GZIA 4WGXA 1GYMA 2HJPA 2BX7A 3P67A 4GK8A 2IKJA 1BSLA 3RRAA 4DLFA 5A6BD 5J5RA 1JEZA 4IXXA 3BH4A 3TSMA 3CT2A 1E0WA 1CI1A 3C4UA 1X1ZA 1RCQA 3SCWA 3NURA 1SSGA 5B7ZA 5F2GA 2DGAA 1SW7A 4MF4A 4GIRA 3CIVA 5CZKA 3DI1A 2EPLX 5DXXA 2Q09A 1WP6A 3GTFA 1F5ZA 4Y6GA 2VFEA 4W84A 1R9ZA 1TTJA 2HS8A 4JD4A 1FDJA 1NFPA 4IPLA 3DC8A 5E0CA 4YXGA 3EA1A 1PB0A 4J35A 3RITA 1W9VA 3N2BA 4C6KA 4YTSA 1PDZA 2V68A 5J04A 4TU1A 1W3TA 3TE9A 4S3BA 2ZZ4A 3BUVA 3ISIX 5A95A 4UMCA 3FA5A 2BGSA 3P7YA 1FH9A 3WF4A 4XSMA 1PWLA 1DIKA 4K39A 1XRTA 4L9XA 5DFAA 1UWUA 1AQ0A 5DMNA 4GJ1A 1Z41A 3URNA 4CN4A 1AMYA 3PZMA 2A3CA 1J2BA 3VOCA 3PPCA 2WMFA 2GUBA 2OSXA 1S2TA 1UH3A 2OG9A 2XSBA 2Y62A 3BW3A 2OELA 2CKRA 4ZOAA 1QHZA 1C8QA 3QC3A 2FZ8A 4KW2A 8RUCA 3DYPA 4XKYA 5G4WA 4FLRA 4XK2A 1SZNA 3P8IA 4W87A 3ITYA 3EDDA 4H04A 2PURA 3WH8A 3MA8A 4BKNA 3ITTA 3EEZA 3UR2A 3L5AA 1W8SA 4KWWA 3UT0A 3IUHA 1XICA 4AHPA 1E6SM 2QGYA 2WMIB 5FOOA 1UKTA 2PDJA 3MCMA 9RUBA 1JAKA 2CBUA 4L7ZA 1Q65A 4CD8A 4XB3A 2VEIA 4OTKA 2D22A 3AYVA 4DXXA 4PRRA 1BYAA 3WK2A 4CNOA 2CWNA 1K9EA 4MKNA 4XV0A 1PWMA 4JZ5A 2WQDA 2JGQA 1S2AA 1O94A 4AFYA 1BKHA 3W7CA 2J6VA 1F8MA 5HANA 4NAFB 4E0CA 4NL1A 3BLOA 1C3FA 5A6JA 3MUIA 3UYIA 3UERA 1B4KA 1FTXA 4F0MA 3SUUA 3QZ6A 2A3LA 5C7HA 4AQLA 2Z29A 3U4AA 4N0RA 1JGMA 1VPXA 1V3IA 5DY2A 1M7OA 3MHFA 3B97A 2H8ZA 5AY7A 3WELA 1PTAA 2Y6ZA 4L4PA 4R3UA 2NVDA 4AYGA 2GQ3A 3OBAA 4KWSA 6XIMA 3UG5A 1UA7A 3QPZA 3K4AA 2P10A 4UB9A 2BOGX 2GK1B 1OF8A 4W8LA 3OW1A 4DJDC 1VYSX 2NXGA 3GHRA 4J1OA 3K2GA 2QKFA 3CEPA 4IG2A 3CL6A 1QBAA 4ZENA 1P0BA 2WYSA 1VFTA 1P6BA 2FIQA 4UQCA 4TXEA 4MPKA 1JAEA 3BMVA 2DVTA 4QAIA 1SO5A 3DG3A 5D4YA 4I7UA 3SY5A 1E71M 4AUBA 4NNAA 1G4EA 4M5PA 2XGIA 3GD6A 3WQOA 3BLKA 4MMWA 4OUEA 1OB0A 1HP4A 3S9YA 5FF4A 2PP0A 4GJIA 1Z8AA 4EPDC 4Q8NA 1CGUA 1R7OA 3LCIA 1ISWA 1BYBA 3GG8A 4DZIA 4JTAA 2PE4A 2Z25A 3WUFA 4M29A 1TR1A 2VL4A 3LCLA 6CGTA 3ES7A 3OBKA 1R5YA 4GC3A 1IGWA 4YVPA 2HEJA 2GJNA 3A4AA 1V8EA 4IPJA 4JTSA 3DN5A 4DIAA 1SJDA 1J9YA 3HPXA 1XHGA 2PZNA 4L4MA 1JPDX 3CUXA 2F2KA 4DYJA 3RCYA 3TJIA 2Y8UA 3TN6A 1KLZA 4GYPA 1IE7C 2VD9A 1P7TA 4RE3A 3PZGA 3QLLA 3S83A 4NY2A 4DAIA 1AQFA 4EF9A 1KV8A 3QN3A 1G67A 5I6SA 2VKZG 1IT8A 4G6CA 4OFCA 4UTTA 2VHLA 3GDLA 3VILA 4FNUA 1V0KA 1V6XA 2J8FA 4S3FA 2E3ZA 1T40A 1TYGA 5A6KA 1S5MA 4I9JA 3TC3A 4LPCA 1KCXA 5JU6A 1QRQA 4IJCA 4XZMX 1GQIA 3CUFA 2JKEA 3G2GA 1FQ0A 3MP4A 3N12A 1B3OA 3LERA 2Y70A 1OK4A 4RKAA 2NV1A 2JF7A 3AYSA 1DJHA 2Y7EA 1KFCA 3LBOA 2YYUA 1PZ2A 4Z2KA 1OWQA 1W0MA 5C9RA 2ISWA 2RAGA 1DIEA 3T1GA 4PUEA 1QMLA 1CLKA 4GINA 1KM2A 2FHCA 1A5BA 1U5VA 2ACQA 4R7OA 3U9IA 3K4WA 4H01A 4KRUA 3R79A 2C8NA 4XAPA 3WEOA 4CQBA 7REQA 2FZMA 2RUSA 3H7VA 1GW1A 1V0NA 4JTFA 3VZZA 3HQOA 4QROA 2ZE3A 3N13A 4JS3A 5FJOA 1C93A 3WLOA 4A35A 2PMQA 4D6EA 1MQPA 4JFVA 4DJFD 1MQQA 2W61A 3IJ7A 1UPMB 4ZSUA 2TAAA 2A6LA 4C6NA 3EKLA 3MPGA 2NSXA 3K13A 1DXIA 3NQ7A 5AC7A 1ZS2A 3IJIA 3QKEA 4W8BA 3GXPA 4NXKA 4HNOA 4D9PA 3S1GA 3BCJA 3VD3A 3VX1A 3BJFA 2VI0A 1KFKA 4NI8A 3B03A 2J8TA 3BMWA 1HJQA 3A3WA 3LCGA 1LQ0A 4Q8TA 5HNUA 1ZTVA 3HPSA 1XYCA 1IZKA 4KEMA 4PCFA 1XQLA 4GWEA 5BU6A 2QR6A 2WLZA 3S2JA 1Q5MA 2ZXBA 3L7RA 4MM1A 3TWBA 3L4WA 2NQ9A 4IMDA 3CL8A 2ZZ6A 4MB3A 3WYZA 4MJMA 1M03A 5EKYA 5GPRA 3ZVHB 4G7EB 1A53A 1WXJA 2QPUA 2ALRA 4AMCA 1PIGA 2IXVA