3VMNA

Crystal structure of dextranase from streptococcus mutans
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
633
Chain Sequence
NGNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Dextranase
publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
total genus 222
structure length 633
sequence length 633
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmnA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmnA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmnA02
4W6XB 1NGYA 4DZ8A 1FP9A 1HI6B 4WY7L 4QRRE 1SMOA 3FFCA 3CSYA 5IVOA 7FABH 4X5WA 4P7QA 1A1NA 3NCJH 1X9QA 4UZUA 1HH6B 2PKDA 3MCLH 1IT0A 2NY0B 5DK2A 2NTFB 2WZEA 3F58L 1YDPB 1X7QA 3UAJC 4X80L 4YAQB 2VDPL 3WE6A 2NR6C 4L3EB 4N8VG 4Z7UA 4NQDB 4R7DB 1EGZA 1OAKL 1H3PL 3ET9F 5DD0H 1FHGA 3TO4A 3FY1A 5KN5A 5KS9B 2KDGA 4PV8A 1CI5A 3DX8A 3LKSB 1SYTA 3RY4A 4Q0XH 1N6VA 3IU3B 4M00A 5D96B 3ZSSA 4JQIL 2BNQE 5EC1B 3OR6A 1MHHB 4EKJA 2IBZY 1WISA 3F7PC 3IDXH 4PMVA 3QEQD 1CFBA 4TUJB 2PNDA 3LPWA 3RWFB 2I07B 2ITDB 1MCBA 3STBA 4OFPA 4HUXA 3CIQA 4KV5F 4D6GA 3Q48A 4PMXA 4AD2A 5JW3H 4PTWA 2BSSA 5JQHC 5E2UL 3SPVA 5DMJB 1KB9K 4BQBA 1BX2A 3K8KA 4GXVH 3MBXH 4NBXB 3MUIA 2DM2A 3RIKA 2XZZA 3WQ5A 3O2DL 1A22B 2DIEA 1FZKA 1CF8L 1CN4A 3FQWA 2Y5EA 3JV4B 5D9PA 5EOQH 3VI4F 3WHXA 4X98A 1W3JA 3WHE1 5GISH 3KLSA 1NFIB 1WB0A 5KW9L 4LSRH 3GI9L 4LVNC 3MNZA 4Z77B 1KFWA 4ZDHB 1GJWA 1P5UA 2PTTA 1JAKA 4BZ1H 3V4PH 1XF4B 2NX5D 3KYKL 4YFLF 2ZUQC 4ONGL 2VAJA 4NHUB 3VH8B 2G5BB 3RZCB 3LHPH 3MANA 2P8LA 3SBWA 5I76B 3KEHA 5LBSH 2B4CL 3OQ3B 1HKIA 1A6UH 1RHHA 4WNQB 3OLDA 1F4YL 2J12B 1I7UA 3UCQA 5D1QB 3VGFA 1QI2A 4HTYA 2ZUYA 5H2BA 1XSKA 4HQQL 2IADA 4ERSH 4KTEH 5IQ9A 1W9DM 2OTPA 5FYKL 2PO6A 1RIVH 12E8H 1JV5B 1AD0A 4QRUB 3DNKA 2VCBA 5DGQA 2NY5H 1PQZB 3D2UA 1FLRL 3R1GL 1A6PA 1J1PH 1OSEA 5BJTA 1T1YA 3IVKA 2X9WA 1JN6A 1DBML 3TJEH 1CENA 3G08A 4YDIH 3MLPA 2IPUG 1EEUA 1J0KA 5IHUH 3VD4A 5D1XA 1IEHA 4JN2B 5IJVB 1CDIA 1GAFL 5M3WA 4KAQL 3U57A 1EEYA 2FSEB 4ZENA 5ID1A 4N8PA 1AC0A 2IH3A 5BS0E 4UNIA 4M93C 2X4TA 4JPKL 3QOKA 4MS8C 4GKSA 2FD6L 2JB5L 4NM4L 1FHDA 5BXTA 5ETUB 4ELME 3D48R 3VD5A 4QCIB 3O3AB 2DYPA 1H0DB 5JXEC 4KY1H 3RMEA 1A4JB 1TZHA 4JN1L 3GTNA 5EORL 2VCCA 3QQ4A 2F53E 1O7SA 1E6PA 2O5YH 2VLJD 1CLVA 1RH9A 4PJDE 5C07A 5FL1A 5C0BE 3WUWA 1TG7A 4NRRA 5SX5H 4I48A 1OSPL 1YPZA 3INUH 4KUCF 3O4OC 1K3ZA 2AMGA 5I1HL 2BRQA 1KENH 5I24A 3GSQB 5FGCE 3WDHA 4ODUA 5CMAA 5F9OH 4A2MA 2UY6A 4OZFH 4Z5RA 1M4KA 2P7TA 1MCFA 2XZCH 2EBNA 1GGBH 4DVBA 3QFJB 3IGAB 3SJVA 3KYOA 4M7KH 2ICES 4D8PA 4LSUH 1QBLL 3UAJD 2MKLC 5TFSL 1CDBA 3WMBA 3DX3A 1IC7H 5I6SA 2FHBA 3MR9A 2VCAA 1BOGA 4GS7B 4LIQH 4N8CH 4LCWD 3F8UB 4HZ8A 1QSFA 3LRKA 1UB5A 5CS7A 4MDPA 4CMMB 5I1KL 4AC1X 4FA8A 4JFYA 4XPTL 5C6TH 5CJXC 2OI9B 1X6NA 1NAKH 3L4YA 3QCUL 1XCQA 3AIRA 1UZ6E 4DCQA 2X1QA 4KDTC 4RAUA 1XGTA 4LSTL 2VLRA 3NDYA 1J9YA 4X6CF 1NWRA 3JUYA 3LRSA 4P2RB 2A9MH 3B83A 5FYJH 1IARB 1NBZA 3MYZA 1RP8A 5GGQH 3CZJA 4UIKH 2PI6A 1J5OH 4CBPA 1INEL 3GIZL 1VPOH 4RMQA 5DR5L 1PSKH 3H7LA 4JFQA 4JL1A 3OAZK 5BXSA 3MGOB 1CNVA 2VABB 1HXMB 3FTGA 3AREC 1W8OA 4S3JA 1MHCA 4QXGH 1HXYB 3K0WA 4MQXC 4NGHL 3DIFA 4JFXA 1MVYA 1BQCA 5D8WA 4HOZA 3V6BR 2GTZB 2QQQA 2YN5A 4PV9B 4HH9A 5HGHB 3RDTA 3REWB 2F5AH 1H49A 4PJDF 1WZ1H 4BKLA 2X2JA 1SJXA 3MRNA 1OD0A 3NABL 3DI3B 5BQ7A 2DD8L 3JXAA 3TA3A 5DF0A 1IGYB 3EGSB 3VFTB 5E70A 3RKPA 3SGEI 1IEBA 1NH6A 5GHWH 3A6CL 3EYFA 2ARJA 4J8RB 3S6TA 4OCMC 2F58L 1CXKA 2DT3A 1KPUB 5H37H 3GSNA 1QVOB 3WS6A 4X99A 1FORL 3CHDA 2GDVA 1UM4L 4ORGA 1MLBB 5I1IH 5FO9A 5HYQA 4W4NA 3L5WA 3ZTJG 3MLXH 1ITXA 2PW2A 1Q4NX 1IRAY 3ARBA 3A4AA 5F7FA 2NXZB 1TVNA 1C8PA 4M5YH 2GJXA 5DD1H 4JG1L 4K94L 1T22B 2AJSH 2EE2A 4H2CA 4G43B 4PJBB 2AGJL 5CCKL 1MNUL 1VADB 4M1RA 4JCLA 3VM7A 2PWHA 4K2UH 5E9DA 2ZSWB 4OZFA 1Y6KR 4MS8D 4TQEL 1TJGL 1UA6H 2GKIA 4A3HA 5TQ0H 1EEQA 2GFBA 2DQJH 3X17A 5JXED 3MROB 1RULL 3DURB 3ARXA 3KWWA 1IKNA 3J8F7 5D9MA 1QKZL 3B9KC 4XT1C 4NZRL 4A4AA 3BEVA 5I1CH 1P7QB 2E0PA 3CMGA 3DJ9A 3AHZA 3BSHA 4GMTH 4R8WL 3O6KL 4XAKE 2X10A 3HI1B 1ZVSA 3R4DA 2F1BA 2J79A 3QA3B 3UJTL 4LFHD 5DRXA 4OZOA 4PRHB 3SDXF 2VX4A 3KR3H 4K7FB 4C57C 3RVVC 4QRPE 1MIEL 3AHXA 1U8NA 3E8UH 5K9QG 1WICA 5GRVL 1XIWB 1HZHH 4WI3A 4P5KB 3BOVA 5F8RC 2DJSA 3NYDA 1VDGA 1SJVA 5CIPB 1T0PB 1OT1A 4HKZB 5CSYA 5GRZA 1DQJB 5E99H 1LJYA 4WUUE 4B16A 3UX9B 4Y2DD 4W85A 2BSED 4O02L 4JFSA 3AIWA 1PKQA 2XPGB 1E4WH 1G6RA 4W87A 3QJHA 1TCRB 2AJXH 3PL6C 3ARPA 1JD9A 2V5DA 3QJFA 4GG8B 5A2FA 1IAKB 2VX6A 1WVZA 4QHKI 5J3HD 3V4VL 2PCPB 2D9QB 4OZGE 5CSZA 3D87B 4WIQA 1WAAE 3EJPA 1AH1A 1KEML 2AEQL 3B2UC 4AQOA 2ZWZA 1Q9LA 3N85H 2MWCA 5JOFA 1INDH 4M1CC 3RIFF 4Q9CA 3N9GL 4V2CB 3UPRA 2DMCA 2QV2A 4F66A 4H25B 2FB4L 5HGGS 3U36A 1DLFH 1F2QA 3WFZA 3WKZA 1EXUB 2PYED 4FXKB 4GRLA 5J57B 3VINA 2WIIB 5IWLA 5DMIH 5DVMA 5JIIA 1MWAL 5C0AB 4UDTB 2AK1L 4ZTOH 3JTTB 4RFNC 2ZOKB 5CEXB 2R23B 2L4OA 1F11B 4OT1H 1D6EB 3HB3D 1DWJM 4LSQH 1INQB 2XV6B 1DQLL 3HA0A 1DVFA 4OLUL 5T3ZE 3QDJA 5IMKA 1OP5H 2A1WL 4NQCD 1IM9D 1MIML 1UM5H 3MXWH 3FONA 4W4OC 1I1RA 3V6OE 1OGGA 4DVRL 1UA7A 1KEGL 4DWHA 3FQTA 3WBDA 1X4YA 5JUEL 4MA7H 1VFBB 5I8KL 1NKRA 4CL7A 2OTUB 4HIXL 3IDMB 4K7PL 1AVAA 4OZIB 1Q8MA 2JLLA 2F7QA 1U93A 4NZCA 3WF2A 1F2XK 4K23H 3HRZB 3PJSB 5CP3A 3S96A 4LEOA 3G6DL 3KPOB 4C59B 5IF0A 3V95A 4AIOA 5D7LB 3QEHA 3JV6A 4PJAA 1UZ8A 2Y72A 1CT8B 1W8NA 1BYAA 1BZ7B 5BXRA 3TA9A 2D7OA 4P4RB 5GSVB 3WXVL 3BEWA 4XCFL 2P24A 1CE1L 4AT6B 1UYWH 5DJCB 1RZGB 3HZKA 3RO8A 4FQQB 3O45B 1A6VH 4F33A 3WDIA 3QXTA 4N0RA 3BRFA 5TE6H 5JHDA 3WMSA 1FPTL 3I2CL 4GZJA 4OCYH 3KJ6L 1SHMA 3SDDB 3HE6B 4RNRA 3WUEA 4I2XB 3O41A 1B88A 2ZSVA 3W6MA 5CWSA 3FNDA 4JHAL 3QEQA 4LYRA 4JZJB 1V7NL 3VSVA 3TBVA 2L0DA 1ZT7A 1A7NL 3GO1H 4OZHB 4AY0A 4OZGF 1M03A 4JFFA 3DX7A 4RISH 5D1ZB 2OP4L 3C5SB 1K6AA 1UCTA 1N7ML 1U0QA 3TJHC 3KLLA 4AMKH 1R87A 4XPFL 3B9KD 5D2LB 2CEQA 4X4ME 5ABHA 3JVGA 3BZFB 2UY5A 5IROC 1VFFA 2AK4E 1BHGA 1T89A 5KVGH 1CDHA 4HPYL 3S7GA 4OIBA 1IGIL 4MNHB 3U2SA 3UC0H 4PGZA 4BQ5A 1JGDB 5EBAA 5LAXA 1QSEB 5ABFB 5IR1A 2BOBA 3MRLB 4L8DB 1T1XB 2DQTH 2VZUA 4QLLA 4J6RH 3PIQA 3W0KA 1W72H 1YNTA 1OGAB 1L9NA 4HUWA 1VGKA 2F7PA 4R26L 3RHWK 1T3FA 1JNNH 1EJOH 4H26B 2OJEB 4E0RA 5DFVD 1HIMH 4J3WA 3GBNH 4WEBL 5ELIA 3SE3A 4F7EB 1XGRA 4JM2F 1JGEB 4DN4L 4OI9A 1T83A 2XFRA 4Y16C 1QR1A 3TPUA 1NL0L 2DDXA 1IAIL 1K85A 1HH9B 4G8IA 3TZVC 2ZCHL 2A3AA 4W88A 3LPPA 3V8CA 3HFML 4XP6H 1FE8L 1LK2B 1UQZA 1U6AH 3C6LB 5GGTH 3WNMA 3HMWH 4K3JL 5EU6E 1URLA 1TQUA 2J7FA 3O9WC 3PL6D 4AD0A 1HQ4B 3O6MH 1SFSA 5B3JF 2FYYA 1G7IB 3O6LH 4LFHG 4RGOL 5CKAA 5E4EC 2EXWC 3SUSA 4QHUA 3VWJC 1ZLUH 1LQ0A 1MCQA 1IL1A 3L3JA 4X7SL 4PRBA 1FO0L 1H8NA 3MV8E 3VE0B 1X5YA 2XKNB 1J9CT 3FAWA 3IDYC 4QHLA 5J12C 1R24A 2BSRA 3VIGA 4M1CD 4PJGA 4PJ9A 3KLAA 1A9EB 3JBG7 1RP9A 4JFDE 3RWHA 4AIZB 2IANE 5F1NA 3MLWL 4OD2A 5L2KA 4U3HA 3BI9X 1QNOA 4JZNA 1NGWB 4YHNA 4HBCL 5HGAB 1SEBB 4PJ5E 3OG6B 4XVJH 1LP9E 1I9EA 3DX4A 5C9JB 3V52H 4MQSB 3IDIB 1G7QB 1SJEB 1KOAA 1GW1A 1FFOB 5C0IB 2VLJA 4UILH 1KIQB 4PUBL 2F61A 1I4FA 1JP5A 4YHKH 4JDVA 3T65B 3HLAB 5I1AB 1YHTA 4X7TB 4XRCB 3LXCA 4RWYH 3V6OC 1K9TA 1F3DH 2YL9A 2FYVA 1A2YB 2WVSA 3BVVA 1A6ZB 2GQHA 3A6OA 4U1KB 4I0PA 2VC2L 4NRSA 3NCFB 3WLWD 2A77L 2DQIH 1F13A 4GRWB 1OLZA 1RK1B 5MENB 2WSPA 1RZFL 4CN4A 3VFOB 1P6WA 1YEIH 3GMNA 1K4CB 3QDMA 3P9MA 4HCRH 4H0GA 4UV7L 1UR1A 3FQUA 4LVEA 4LCWA 4C7GA 1MWAB 5FFLA 4U1JA 1D9KB 1I1FB 4R6UA 3ALGA 5DC0A 1NP0A 3P11H 3QQ9C 4NC1E 1BPLB 3GNPA 3PGDA 2FX9L 4LCIH 3HHRB 3S88L 5FB8B 1FIEA 4PRIE 3GI8L 4Q9QL 4M9PA 3VXRB 1J1OL 4JFWA 3F5LA 2DQGH 4HF5L 4PTUB 3UTSA 4D0BA 4X0NA 3VFGL 2HVMA 3NPZB 3MRQA 1QBMH 4KJYB 4OGZA 2DM4A 2Z91A 4DGIL 1AKJB 1JFXA 2P45B 1W0WB 1NUGA 5SX5K 2BHYA 1VGEH 3TJHD 3GHEH 1W9VA 1SYSB 3Q6FB 5GRUL 1I3RA 2W67A 2CMRL 1WWBX 3VFMA 1ZHLB 1MJUH 3OHXB 3OKOA 4Z7WB 1PIFA 4M43H 1J86A 2WVUA 1T4KA 1MFDL 4HAFA 4O51A 3OXRA 1Q6CA 3MUAA 4OLYL 2AKRB 1UWXK 1GVYA 5GGTA 4OCWL 1GQKA 4JO1L 4ZFOL 4WFHD 4Z2IA 1NCWL 2VIRB 3HAEG 4XP9L 3DGGA 4G5ZL 4WW1B 1LP9F 3WDJA 3IFPA 2XQBL 5A43C 3TNNA 4ELKA 4L4TE 4BFIA 5EIIB 4UTAH 1T7VA 1HX0A 1O7AA 3ZYOA 2BVOA 2CXGA 4PIRF 4Y16D 1KWKA 3WFBL 1GHFL 2J88L 3U0WL 3DUSB 2Y1VA 2EKSA 4R3SA 1AHWB 3TZVD 2YC1B 3HR6A 3S36X 5HGBA 1JWUB 1AXTH 4PGBA 1QWUA 1F58L 1ITBB 4BQ9A 2HJKB 1BD2E 1YEKL 2DPEA 1XV8A 5CG0A 5C71A 1LO0L 4WDIB 1P53A 3UBXG 3ARUA 3O9WD 3P0VH 2WVTA 3MV7E 1JNLL 4PBGA 3T2PA 1OAUH 5GNZA 3RPIA 1CICA 2XYLA 2YD9A 4JJHA 5H35B 1G0DA 4LLAA 2AV1B 1F6AB 3V7AG 4KZDL 4RBPH 2FIKA 4NWTH 2EXWD 3BKJL 3FT4A 1HP5A 4MNGB 3VWJD 3S4SA 4XZBA 2CO7B 3Q3GA 2X1PA 3V0VA 4GO9A 3L6FA 1EAJA 4YDKL 2EE3A 2D0FA 3GSUB 3P0GB 3GSXA 4OGXH 4TSCL 5IGXH 4NZTH 4IBLT 1JE6A 4U1NB 4LAQH 3G6LA 5D9SA 5HHOE 1FZJB 2X4OA 5I8EB 5H94B 1H15A 4GINA 2B5IC 5EDXA 3UROR 3O4LE 4UQ2A 5JW4N 5CEZE 5MEOA 3TBSB 4LHUD 1YN6B 2W0FB 2UWEE 4LLVB 5JXEA 1YNLH 4U1SB 3HUJF 4OV5B 1ZLSL 1HKMA 1GGIL 4UNVA 3ZT5A 1S9VA 1WBZB 2WANA 3QWQB 4JFVA 1CS6A 4RMVA 4HCRA 2CJUL 1OSZB 4JKMA 2D22A 3LN5B 1F3JB 4QHKJ 2ENYA 4Z95L 5EUOF 1E27B 1F00I 2CKBH 3CX5J 4HHAB 1Y18B 4MSWA 3SY0A 3WXWL 1TFHA 3CC5A 2R69L 1XAUA 1QRNB 3NACH 5JDSA 4FHBD 1MAJA 3UG5A 1GPOH 1S5HB 5E1HB 5JBEA 5E1AB 4LARL 4GKNB 4Z0XB 4XMKH 3M46A 2IBZX 4GG6F 1FO0B 3VFRB 3WEMA 4Y4KB 4HXAL 5DYOB 1NGXB 5ESVB 1MF2H 5IOPA 5GNYA 4HKJA 3VJ6A 1S78C 2CUHA 3HNVL 4R97C 4QRRA 1JDAA 3OR7B 5KOMC 3RTQB 5AYBA 1QZ1A 1T7YA 2V17L 3D0LB 3CZFA 3BN9D 3W9EB 1BBJB 1BVLA 3B5TA 3FAXA 1S9WA 1A5FH 3W2DH 2X4RB 5IMOB 2R56L 3QQ9D 4D0CB 1FDLH 3BYYA 2X2YA 1SY6A 4G6AC 4HC1L 1N2RA 5FGRA 1XGYH 3GSVA 4M7LT 5J9PB 4PEEA 3QXUA 2WHJA 3ARSA 1BEYL 2ADGA 5EZJA 2V7HA 1MY7A 2XG9A 2CIPA 2BNQA 2EADA 3BGMB 5CPTA 3KPQA 1I9RH 4RZCA 3L3IA 2VVSA 1L7IL 3NIGE 5FCUL 4KROC 4HG4J 1OGTA 4PJIB 3AFLA 4JAMA 4WFGE 4XX1E 5C0JA 4PMRA 1RVFH 5FA4A 5JR1H 4CADA 2YRZA 5IHSA 3L3DA 4Z76A 3GJEA 1YNKH 4FZ8L 2D23A 2WINA 2XWTA 3AREA 3BT2H 4DO5A 2NY6B 3TIDB 3BP7B 4MCYB 4EDXB 2X6MA 4JPWL 1JGIA 1KTKE 3QIBB 1KXTA 3ARFD 4XNUL 2UV3A 3WFEH 4OTXL 4EVNB 3VG9B 4PRPE 2QADC 1QYGL 5DUBB 1G9NC 4YQXH 2OXHA 5EUKB 4AEIL 1IM9A 3GBDA 3RY5A 1HK6A 2V7NA 5C09D 4DO6A 1TVHA 5AYUL 4MXVE 4P9HC 4FNRA 5A2AA 2BY0A 4J3TA 3SDYL 4NBYB 5D4YA 3W24A 4I3SL 2FGWL 4X6EB 4BH7A 3ULVD 1BMGA 4JRXB 2NYYC 3EYPA 4WUKH 4YNYB 1FYTD 3ZHLA 1T21B 5F9WC 3WIHH 3TIEB 5SWZB 2P5EE 2BV9A 2Y4SA 2W66A 3WD1A 1ZLWH 1VSCA 5C0CB 3UETA 3U0TA 5GS0L 3VW3H 3SDCC 3PTKA 2H3NA 3AXIA 4CD4A 4OF3A 5I17B 2DTMH 1JGLL 3C87A 2EDRA 1BWWA 1WWWX 1E6SM 1FNAA 1LDSA 2R29H 1RK0B 4F58L 3NSNA 1N6QH 4LP5A 4ZFOB 4ZFGH 3F5WA 3FO2B 4YFLI 1F4AA 2VXUL 3NCEB 3QFDA 2QSCH 3EOYG 2BRRH 3MXVH 5B4MC 5EU7E 1W9XA 2IAMA 3MLRH 1CVSC 3I84A 5IK3B 1OHQA 4GQ9H 2ZZUT 1OOAA 3IAPA 4CJ0A 3VA2C 1Y6NR 3S2CA 1R5WA 4JFDD 4GO8A 3UTOA 5DEFA 5IEKA 1C7TA 2EDEA 2FX7L 3QXDA 1M7DA 4G6JH 4ZFFA 3GBLA 2CDEA 5HHPA 3NAAL 4HS3B 1KSRA 3DBXB 3NIGF 2ZCLL 5EC2A 5C6WH 4XVSL 1DL7H 2X44D 1G7JA 8A3HA 2YEZA 2Q8AH 1IM3B 3MFGB 4PJ8A 1W32A 2VRAA 3HG1B 4NCC2 1FRGH 4QHMA 4ELMA 5DD5H 4N90E 1ADQL 2HLFD 5L0QB 5GS1C 1T5XB 2VAAB 4KKAC 3VGAB 5JW5B 4HS6B 2YPVL 1U3HA 4HUVB 1ESWA 2F53A 2HJLA 2UZXB 2WLZA 3IFLL 4MMXC 1IGCL 1NFDE 2FJHB 2VDQL 4L4OA 4TVCA 4PJDA 5IW6A 1P7KB 3VU2A 2IWGA 4U6HB 5DQDH 1VKXB 2WCSA 4WSKA 3HZ3A 2JJSA 1BFOA 1MH5A 1T5WA 1E6ZA 4PRWA 3VRIB 3S35L 1YEJL 1E9LA 5LGJA 5FYLL 3S5LA 3IKKA 4NRYA 1WZAA 1XF3A 4MXVF 4PMZA 2NLJB 4H88L 4U1GB 3OG4B 1D2KA 3MMEA 4WHYG 3S5ZA 1LEIB 3MV9D 1EFXB 4R2GB 5DMKA 5FYKU 4NFBA 2NY1C 2Y24A 2BFVL 4DWSC 5MHSD 2CKRA 4KVCH 3G5YA 3RUGE 4XZUB 3ZKXC 1BLNB 1EXPA 2IFFH 5FUCC 4UV4L 1G7LB 3T4YB 2ADJB 5E8OB 3QI9B 1NMAL 1EQCA 1YECH 2FBJL 2QKIA 1OVZA 5I74B 2WHMA 1BZ9A 4TUKH 4ZYKB 5E94A 4PB0H 2OS7A 4XP5L 3W39B 2DLTA 2IGTA 1NDMB 4KROD 5D6CB 1R46A 1OAQH 2LAAA 4O2FB 3KG5A 3UPCA 5K9KB 5IFHL 1DFBL 3DX6A 3NCYS 3EYVB 5GGSA 1NFKA 1BYDA 1N0XH 5IFAH 5JQ6L 4YZFF 9CGTA 3WD4A 2GDUA 5DJ8B 4JO2H 4RFEB 4ZODA 3WIHA 3GXPA 1IEAB 2Y07L 1Z9MA 2Z93A 1DBBL 4FNUA 5FOBB 4BZYA 3LS4H 4U1IA 4QY8B 1AQKH 1ZHBA 2JB6A 3E0GA 4MD0B 3H9YA 3WUWG 4ML4A 4R4BB 4CJ1A 3WSQH 4R90L 2QADD 4G9DA 3CV5A 5GGUB 4W4OA 2B2XH 1IC5H 4BQ6A 4X5LA 4EN3B 1E6JH 2EC9T 5D70H 1GZPA 2CRIA 4NRZB 4OUEA 4LCYB 4NM8L 3TBWB 1LE9B 1I8MB 3BO8B 1ORSA 3FB7B 4LLUA 4DKEL 2P5WE 1CTOA 2NYYD 1NFDF 5HDLA 2F8VA 4D0DA 1WJ3A 1KPRB 1LL4A 2B8OT 3V4UL 1KF9B 1HL9A 3NN8B 5E5MA 3SKMA 4TULH 4ONFL 5K9OA 4TTDC 2XY2A 4IIQB 4PLOB 4X4XA 3SDCD 3ZT7A 2PWGA 2XWJA 3T0EC 5ALBL 2OSLA 3MO1B 2MNUA 2PBGA 4YGAB 1RMFH 1S46A 4RGMC 3DV6A 4JG0H 3NSMA 15C8H 4JM4L 3WNPA 1A7QH 4LLQA 1GIGL 2D7TL 4MA3B 5T3ZH 2YPKB 1DHKA 5T5NG 1LO3L 5GGRA 2K3TA 4NNPL 5A2BA 3CZKA 2NZIA 4GAYA 1I7RA 5SV4A 5JW4Q 1UB6A 5B4MD 4H8UA 3UESA 1GGYA 4PSPA 4MNMA 5HVHB 4XC1H 2C1OB 5TE4H 1ISVA 4QLJA 3PHAA 2DQHH 4WKHA 4HIIB 5SWSE 3ORJA 4MADA 3LMJH 4U7KA 2UY3A 5I1JH 2VLLB 1ZEAH 2XJ7A 5EU7C 1AGFB 2JTDA 1FNEB 3TNMA 3FN0L 2F18A 2VWEC 5IT2H 4F9JA 4L4VB 2DDQH 4OQTH 5LWYL 3EYOA 4HMDA 1IQDA 4F7TA 4AMXA 4PBVC 3DROA 2X9XA 2WZPD 3UG4A 5IROA 3NGBC 4Q2ZB 1F8TH 4KKAD 4OAWB 4E5XA 4LDOB 2DWDB 2ZWLT 4L9DA 3G6AB 3P0YL 5KSVB 5CZVL 1E3XA 5ADOH 2CESA 2J6EL 1U91A 1U41A 4AZ7A 4LGSB 4CNIB 4FQXC 5E00B 4JFHD 3VXUD 3TF7C 2WK2A 5J56B 1IQWH 1GQJA 1KC5H 1VEOA 4RCAA 4P23B 3PZGA 3UJIL 2XKUA 4O2EA 3BPLC 2AS5M 3FB6A 4UUJB 2K1MA 2VDOH 4F7CA 4QRPA 5I15L 3QULB 4PG9B 4NUGH 5FDWB 3I9GH 3LEVH 4X8XA 1ACZA 4FRWA 1IJ9A 1DQDL 4L3EE 5IP4A 3EJYC 5MI0C 1XD0A 2X4QB 3BH8B 3FOLA 2NY1D 2C7FA 4WEMB 2R8SH 4FABH 5ITBL 1S3KH 4DWSD 1J8HB 2H26A 5FD0A 5GQBA 5KS9E 2H8PA 2CSPA 4X4YB 3HC3L 2IG2L 3O9WA 4WUUA 5E09A 2X40A 3MRHB 2DSZA 3BLKA 5ICYB 2XM1A 2J7EA 1B2WH 1EO8H 1RUPH 3MYJA 2YA1A 4KUZH 3W38A 1P2CA 3VWJA 4PREB 5E8EA 1QOXA 4QYOA 1IGJA 4HIJA 3MGTB 4JZOB 2W60A 4JHWL 1XGPB 4FS0A 3WD5H 3WBEA 4OZGA 3ULVH 1WAAA 3MX0A 4JKPH 3CVHA 1GGCL 2W9DL 1EO5A 3LQAC 4KJPC 1XR8A 2EYTB 1F45A 1H11A 4LMQE 3PWLA 2HFEA 5CSBA 1D5ZB 4Y19B 2C1PA 1FV1B 1RY7B 1M71B 1SBSH 3QXWA 3WD3A 4Z7VB 4F37K 2Y8VA 4LHUA 4MQ7A 1TQCB 5I30H 4W89A 1AD9A 1M05A 4NZJA 1OINA 4YH6A 2G75B 3VX0A 4HXBL 5ICXA 3ZTNH 4NO5A 3ZJ6A 1RZ8A 5HVGB 3WLBB 3NCBB 1NMCB 5DQJA 2AQ3A 4LNRB 1XFPA 3Q5YA 1PEZA 3HC0A 1G0CA 1JWSB 3AMGA 4UFHA 2R1WB 5B22A 1OY3B 3AUVA 5FO8B 4OIFA 1QACA 2PR4L 5CPQA 3V6OA 4GI6A 1X5LA 3UDWC 4P7NA 2A6JB 3RL1B 1KBGL 2EYSA 3LEXB 4FXGB 2VSDA 4M8QA 1JF1A 1T1WA 4TTDD 2OSXA 4E4PA 3T0ED 5EH1A 4UAOB 3QEGH 4B9ZA 2AXFA 43CAA 4OQTA 3NA4A 3GSOA 2O5XL 4OUUB 2XKSA 3BD3A 4NT6B 5L7XL 2NSXA 2VXTH 1QQDB 5CLWA 2ZCKL 4HGWB 1ZHNA 3D25B 3I3BA 3Q5TA 4JAWA 3L9RA 4FQLH 4HSQA 3U46A 2BJML 3A4WA 2HFFA 4MMZC 2R0ZH 6FABL 1O6IA 3FO9A 5ISZD 4YE4L 2AJ3B 1RZ7L 3O3BA 3T77B 2J74A 4JRYB 3DVIA 3ES6A 4ONOA 1W2VA 5I79A 2ZIDA 3NFSL 3FJTA 1ECEA 1FGVH 3QGVA 1R86A 4J4PD 3MREA 4WV1B 3V5HA 4X0KA 3C08L 5I66A 3CZEA 5C3LD 2DL2A 2DL9A 5I73C 2WWCA 1NCAL 1A4KB 1JF6A 1RURL 4LPUA 3W5MA 4C7DA 3G9AB 4Z2GA 4OFYA 1EDGA 4NUJB 5KTEL 3Q6GL 2R2HA 2YKKA 3CK0H 3NSXA 1BJMA 1HDMA 1UKSA 4JHZA 5DMGD 4KHTH 2EPMX 4X4MA 4JGMA 3C5JB 5IV2A 5I8CB 1BLIA 4XPBH 2AK4A 5C2UB 1SZNA 4Q74A 35C8H 5I71C 1LG1A 3QCTH 1C5BL 3FT2A 4X6BB 1TIUA 3WIIH 1BGAA 1DP0A 3QUXB 5T1MA 1GSMA 2H41A 5EBMB 4PMQA 5CBEA 2Q3ZA 5DA0B 3SKNA 1CQYA 1FH9A 6CGTA 3D85A 2Y36H 1BIIA 4HX1B 3LZFH 1CCZA 3L95A 3MRMB 3VX1A 5FO7B 1FYTA 1ZV5A 4YHZH 3WD0A 1W91A 2X09A 3CMOH 4MNQD 3HJEA 1O0VA 2OR9H 2NY0C 2FX8L 3QDAA 3AC0A 5TJWK 3HRPA 5LXGL 1T0MB 1YY9C 4AMCA 4HEME 3H7BB 4YHYB 5IHZB 5M95B 3AMLA 4N0CC 1S9XB 4GOSA 4H5SB 2FDBP 2WNWA 1LNUB 1XR9A 5EU6A 3AI0A 1G9NH 3HI5H 1XZ0B 4L1HA 2JIXD 3NTCL 3LH2H 1BQHA 5D96C 2XI9A 2FIRT 4P9HH 4I18B 4UQ9A 5D7JB 2X4SA 5LA1A 5ANMB 1AGCB 2J7DA 3R06B 2GVYA 3SKUD 1XF5B 3MV8A 3TEUA 4BH8A 2XN1A 1I1AD 5E2TH 4CU7A 4KQ3L 5KSAB 2D31A 3O3DB 5F8QC 5HHQA 2VXSL 3QG6B 3BLBA 1G7MA 4X5XB 1R8LA 2O93L 2YLLA 1R5IA 4JFDA 4UIMB 2R0LL 3UCRA 5DC4B 2AXJA 1HHIA 1Q6GA 3ZLQC 5BXFB 4BK4A 5DURD 1RUAL 5IIEB 5EU5A 3G5ZB 4PJ5A 3PZNA 3QT2A 4C56D 1LP9A 1X5JA 1MVUB 4ZS7H 2NPLX 1RJYB 5FM5M 2AEPH 3P4OB 4B0MM 1TITA 3CDGA 3TH2T 2DQUL 4ODWA 2DT1A 4UTBH 4YXKH 5CKGA 3DWTA 3MLYL 1FYHB 1D6VH 1JHLH 3KPPA 1R3IH 5IMLB 4IRSD 1YJDC 3TH3T 3M1BB 3FQRA 5TDNA 2ESVB 2FL5B 2WUCH 1CFNA 3P77B 1MXGA 1DEDA 1U92A 3DV4B 5DJ0B 4XCYB 3RZCC 4HFWB 4XTRC 5B39A 3NIDE 4QDMA 1MCWM 3QUMH 1KLGA 5D1QC 2QLYA 3GBEA 3TT3L 3D3VD 2IEPA 4DTGL 4OOZA 3BUQA 3M8OH 4ZMAT 2FWOA 3K80A 2X70B 1MQQA 3IB4A 3EYUL 4HKBA 4WTXA 5DS8B 5HDRA 4HWEL 3S37X 4C83A 4F7PB 5DHYA 5DJAA 4P3CL 5F7DA 4QTIL 4P3WA 2OL3B 4NKOB 2R9HC 3WFCL 2C4FT 4XBPB 3CLFL 5C8JB 4PRIA 1U33A 4GMSH 3O3EB 2O9TA 5ESQB 1JGVL 3CAFA 3CZ8A 4LDLB 1IZJA 1L7TL 1LL6A 2D03H 1OM3H 5A16A 4PJFB 4S10A 5IFJA 3I50L 4JPIB 4LYQA 1HHJA 5DO8A 4M48H 3C8KA 2CLZB 3NZ8B 2YKLH 3QHMA 3IFOB 4DZBB 3X3FL 4NNXA 3OKLB 3MRIB 4WO4B 2J3SA 5L2JB 3KXFD 1MRFL 3FB8A 3Q2CA 4A6YA 5BVPL 3PWPE 5C0RH 3SO5A 1I1YB 1GONA 4I9WE 3OAUH 1KTDB 2V5SA 1DQMH 3B2VL 2EYRB 4LOUC 1AQDA 2M1KA 4TOYH 2ZNWA 2E9LA 2XY1A 2YWYA 3GIVA 2VDNL 1NDGA 4LRIC 5I75C 4W6WB 3U7WL 1NCBH 2JK5A 3HG4A 3WY3A 4OFKA 5J13B 2J78A 4L4TA 1KN2L 4AIUA 1Q72L 2H6PA 4CGTA 1YMMD 1Z3GL 1PZUB 5EFIA 3MUZ1 2NY0D 4BFBD 1KBBA 2FLRT 2J2ZA 4YPGA 3DO7A 3EOBB 2GCYA 5AD0A 5HTSA 4L3ED 1BD2A 2VJXA 5TGBA 3VIOA 1BM3H 4XZWA 5A6SA 3BKYL 4NQDD 4WFEE 5AZ2L 3SDCA 1SR0A 3H9HB 3HNTH 2YFNA 1ZKAA 1KELH 1UD8A 4JKWA 4G42A 2UUDH 3MV7A 1RFDH 3KPRB 1OIFA 2DSKA 4QCEA 3V6FA 4BQ4A 3RNQA 2OI9C 5HHMB 1KPVA 4W68A 1N8ZA 1TFVA 4OJFL 5HGDB 5C7XL 1HTYA 3G6MA 1IGMH 4I8DA 1WFTA 1FBIL 2NW3A 1GNXA 5T33L 1Q0XH 5HD8C 1QFOA 2VX5A 3OAYK 1Y0LB 1RZJC 4ISVA 5F3BB 5ENWB 5EWIL 4M4PA 1XCTB 3W25A 4PFEA 5A8PA 3CFKA 2HKFL 3MJGX 4JFZH 3A24A 1WC7B 2OYLA 4XNXL 4ODHH 5DJ6A 5IQ7H 4QOKD 5DEGB 1KLUB 2MPAL 2QEJA 2Q86A 3O4LA 2VITB 5DJXA 5EA0L 3HKFA 3VXOA 3LEYH 4XNMB 3QUMA 2UWEA 1ZT1B 2NNAA 5F7LB 3F7RA 3MUGB 4TNVK 5GS1A 1W0VA 3PWVA 3ILPB 5IVZB 3HPJB 1LGVA 4PS4H 1W3KA 5DD3L 2MOVA 3GEWB 1I7ZB 1R3HB 4Q6IB 4QTHB 2QF8A 2RIKA 1FIGH 2BC4A 4ZD3H 3M17A 3WEXB 2ZPKL 2VH5L 3UERA 1F5WA 4S3KA 2G60H 4NO0A 4ZAKA 1TZIA 5ILTL 4ZUWA 2BX5A 4MZ2A 2JCCE 4QXUL 1A14L 1U58A 3L5JA 3DX0A 2OMNA 4M6ML 1BF2A 5E9AA 3MRPA 3BUYA 5D7LE 4BZ2L 4XTRD 2AOSA 4WU5B 3L3HB 2FECI 4KPHH 4NKMB 1VBRA 3G6JB 3KS0H 4AEFA 1IKFL 1HJXA 4NQVB 4GW1A 3EYSL 4D2NA 2PC8A 3PZQA 5D1QD 4P3DB 4ZXOA 4U6TA 4NP4H 4PGCA 4PJHB 5EG6C 4OKDA 1GXEA 5FHAH 2JKXA 1BECA 1WWAX 1GC1L 3RVUC 1B3JA 1LQSR 3UO1L 4LQFH 3QHFH 2JJUA 4XCEB 3UYOD 4MNKA 2YUZA 4V1DB 1E6NA 4I2XE 4NCC1 2R9HD 4M7JH 4Q6YA 2M2DA 5T5FL 4HOWA 4BQ3A 1A3HA 3MACH 4Z78A 4EOWL 1HHKB 4AW7A 5CSGA 2BNJA 3KYMA 2V3GA 4HS8H 4BYHA 1NWTA 4OBRA 1QO3B 5DRNB 2R0KL 1LLOA 1T7ZA 3QCVH 4Q9RL 5HJ3A 3GJFB 5ACZA 4N42A 4WJ5B 1PGRB 1YMHB 5A6MA 4YHOL 5B3NA 1IGFL 1T04A 5A95A 3K7UA 4DM2A 4ODVH 1CFTA 4C54A 4E41B 3VWKB 43C9A 4Y7EA 4R4FL 4UU9A 2EPOA 5I19L 4C55A 5TH2B 2AP2A 1QSEE 2B4CC 1FL5A 3THCA 4HT1L 3LS5H 2XTJB 4LOUD 2PTUA 2X8RA 3D0VB 3A67H 3PP3K 5D5MF 3DI2B 5F7MC 1PS3A 4I1NB 5GSRA 3V9FA 3KZSA 4GLRI 1AC6A 3HPLB 5F1IA 1R0AH 4TNWF 1BJ1H 3WNNA 1DLHB 2FNBA 1MOEA 5E8NB 4PJXB 3SGJC 1NLBL 2OMBA 3QFJD 3LQAH 1XIWC 4MAYB 1EMTH 5GPRA 4Y5VA 4PMDA 2W59A 3G5XB 2DJ4A 3DHMA 1CZ1A 4Y88A 3QUYB 3WS3A 4IHOA 2XVPA 1CLOL 3T08A 1MQRA 1ZANH 3BGFB 3KNBA 5K33A 5C08B 4MJ4A 5HHVH 3WY1A 2JCCF 1LL7A 3QHZH 1A9BA 3TT1L 4OLXL 1CFQB 3QUKA 5ALCL 1AE6L 4Z9KB 3GXMA 2P5EA 1QLRB 5DQ9A 2YSSB 2I5YH 4HMEA 1I85C 1KB3A 3CUFA 1RJZA 1CGSL 5IESL 3JWOL 1YUHA 3CZGA 1R3JB 4MAVA 2R4SL 2P8MA 3TTSA 3IJSA 1V7ML 5HD8D 3OKMB 1TETH 4XX6A 5DGRA 2HJFA 4ZQKA 3QO1B 4MD4A 3WJLC 4P2RD 4GUPA 4RGND 3HS0B 2BK8A 3K4ZA 3V5DA 5C0FA 2B1AH 3ZKQD 4OIIL 4HUNB 5D72H 1MI5B 4FZEL 2AERT 2IQAA 4ZSOB 4R7NA 3SUWA 2QMJA 3AS0A 4G6KH 4HLZH 1UD5A 2O5ZL 4U5KA 1AJ7L 1CGWA 4CVZA 1TZGH 2XT1B 3HNSL 1KN4L 3A6BH 3OIHA 3T1FA 4HP5A 4HZLA 5DJZA 3SKJL 3EJQA 2ICWA 3FT3A 5CUSL 3LY6A 2BDNH 1QFWI 3IJHA 5FK9B 3IXTA 2DT2A 1S7RA 5HHNB 4M6AA 1UQYA 5TF1L 5KEZA 3B43A 3ZO9A 4IS6A 3DXAE 4FQXA 3GMPB 3GHBH 1BVKA 1NFDA 1A7PH 1U8OA 3H3PL 1UVQA 3LCYA 2X4NA 3CBWA 1H3VA 1WIPA 3GUTA 5C0GA 5T3XE 3KPMB 3VKKA 2RCSL 3SCWA 5IW1B 2DBLH 5HYJE 5HY9A 5C6PB 2NY2B 2DMKA 3SDAB 1H5BC 1I3GH 1J01A 1T03L 4TRPL 3IU4H 3EBAA 4P4KB 4WI2A 1T20B 3PZMA 5DHVA 4CCEA 3FO0L 3MJ6A 3ZKMD 1XGQB 3HAEB 3M7SA 2YL8A 4HFUH 4R96B 4CVWA 3BPOB 3S98A 3TBTB 2NXZD 3WQWA 3VXRE 2EAEA 3RUGA 1CL7I 2JIXA 4GXUM 4UT6H 4EUPB 1OWRM 3SDDC 4YR6A 5CHNB 3HE6C 1JGUL 1MRCH 5D9NA 3LKRB 1QG3A 3D51A 4G7YH 1V3LA 3ULSA 3MC0A 4RE3A 3L3GA 4WKAA 3DETC 2CRMA 1G84A 4RRPA 2GJZA 4ONHA 4B9YA 4XBGB 1J11A 5DRZB 4XVTH 1C5CH 3CFDB 1NGPL 1I3VA 2J8FA 4YXLH 4LDEB 2W4XA 4Z7WE 3L3KB 5F7NC 2VE6A 3SCNA 3D9AH 2EIZB 1XGUA 3V5KA 1SEQL 5F96H 1WFUA 2Z0BA 1MQ8A 2XZAH 3TTQA 3QNXA 1QBAA 4PB9L 5A69A 1Q38A 4XXDA 4MVBD 1PYWB 1QA9B 5FYKD 3H53A 3MJ9H 1FHLA 4PRHD 4CD5A 1C08B 2BSTA 5T1LB 1KJ2A 1NEZA 4LPXA 4OKVA 2C3GA 3MJ7A 4ENEC 3STLA 1WTGT 2AEIT 1XIWD 3LIZL 3UDWA 3MRJB 4MWFB 3BKCH 1OAXH 4P46B 1E6OH 1TJIH 4H41A 5EU4A 2P5WA 1P4IL 4JO4L 1QSZA 3OJ2C 4S2SA 2IGFH 1E55A 2Q76A 2ENSA 1OCWL 4MJ6B 3C6LC 1DUZA 3LSOA 2JJTC 2UVEA 1CXHA 5D93B 3E6HB 4YDJB 3OKKB 4MNGE 4NOBA 4J3XA 4QO1A 1DN0A 3NH7H 3BSZL 1Q1JH 2B20A 1JL8A 2VKXA 2BOCB 4P0DA 5F97E 4U6YA 1B4RA 2EE9A 4Q22A 3SE8L 2DQFB 1S7UA 1YJDH 4FQHA 3RGVD 5JNYA 3WL0A 3F6LA 3VD3A 4L29B 2N56A 3MCLL 5D2NB 4IDJH 1ES0B 4AZCA 2GTWA 2VRJA 3U9UA 4UZGA 1ZWIA 4H8VA 2CLVB 1J8KA 3LKQA 1TA3B 4NNYB 3QQ3A 2EPNA 1BIHA 5SWSA 2V6HA 5DD0L 5C0AD 2P8PB 3PN8A 3L4VA 1IILE 1MFCH 4S11A 4YXHH 2WWKT 3EO1B 1GOWA 4Q0XL 3W29A 4J23A 4TXEA 4NSKA 3PQYD 5KSBE 1NCTA 3ZZ1A 1KJMB 2Z4QA 4OM1H 4H1LA 4NJ9H 3IDXL 4Z7WF 1MPAL 4P2QB 3S3PA 2O61A 1P9MA 5E5UB 4HKXA 3N04A 5DVOA 1YEHH 2XSBA 3CVIH 1DBJH 1C7SA 4PJEF 3VXME 5EN2A 2HH0H 1QFUH 3VFVB 1BTCA 3VSUA 1HWGB 3KYNA 2Q6WB 2Y25A 4Z8FH 1MCCA 2CDGB 4P49A 3TONA 4GXVL 1GRWA 1HI6A 5GRJL 1LK3H 4W81A 1HH6A 5EOQL 1QUNA 2NTFA 3VRJB 2HMID 5CD5C 4G8GE 1XH0A 5F72S 4YAQA 4LNVA 2VOTA 5GISL 4L3EA 4LSRL 4PRDB 3MMDA 2EACA 3WY4A 1JHTA 1D9KC 4AYFA 2QSVA 2GK2A 5KS9A 5J0BA 3LKSA 1JNDA 5DVLA 3BE1H 3SDDD 3IU3A 5CSUA 1MFAH 3HE6D 5CJ8A 3MNWB 5EC1A 4DZ8B 1RU9H 2D1ZA 1HOCB 3I6GA 2EDHA 2BVQA 1MHHA 3MJ9A 5EZIL 4TUJA 2GAZB 5LBSL 1A6UL 3RWFA 1EHLL 2QPSA 2I24N 4OLVH 2HN7B 5DK2B 1TVPA 3P3YA 4NQSB 1X7QB 5D1ZD 1QFPA 4ERSL 2VUYA 1KBKA 1HCVA 2D20A 1JTOA 1PZ2A 1JAEA 4TVPE 3VDCA 1KCSH 3BZEB 1JPSH 4FTVB 4D72A 1BAFL 1C1EH 3VDAA 2C3VB 4NFCA 5HDBF 1QSED 3TJEL 3OR6B 2XVNA 4KMLB 4YDIL 1KYOK 1HHGB 4B3LA 3FFCE 4NX0A 2HP4A 1WEJL 1OGAD 5KSBF 4MJIB 3K74B 4PY7B 1HNYA 1B3VA 2BS9A 1CDUA 5KAQF 2WPGA 2ZJSL 3C60A 1RZJH 1AR1C 5E08L 3S5YA 2FZ3A 5D6DA 3GSNL 4N1EA 5CJOH 4Z7UE 3ZHDA 2GUYA 3IXAB 2HVKB 1YQVL 4KY1L 5IBTH 1F90L 1AHWC 4JO3H 4D1JA 1H3TA 4Q97A 1OP3K 3VH8A 2G5BA 3CFCH 3MV01 3RZCA 1K6QL 5I76A 4DN3L 5CAYB 1QNRA 3ABZA 5EO9B 4KXZI 3FQWB 3C6LD 4FLQA 5D1QA 4X98B 3INUL 3WHXB 3O0RL 1JRHI 4HK3J 4U1MA 4X80H 5BZWA 4U31A 3KL5A 1NBYB 2P49B 1OAKH 2P48B 1JV5A 1PY4A 4QRUA 2EABA 5A6AA 4F9LC 5F9OL 2YD8A 1PQZA 2H1PH 4PY8I 3PE9A 4JQIH 5EB8A 4LSSL 4M7KL 4S1QH 4LSUL 3L7EA 2ZG1A 3BWAB 4K9EL 2P8LB 3CLEL 1PD6A 5J1AB 3THML 1R3KA 5J6HB 2F7RA 1RHHB 4MJ5A 4JN2A 5IJVA 2A3EA 2E9IA 4LIQL 1I7UB 1QP1A 1XYZA 4EDWL 4Y4HD 5H2BB 2IADB 1RJLA 1S7WA 1S7QA 4JVWA 5IQ9B 3KPTA 2EEBA 1MCRA 2GEEA 2E6JA 1AD0B 1OAYL 5C6TL 1H0DA 5GZOD 1A4JA 4D6IA 4YDLC 3AIBA 2JF6A 5EOCJ 1U8HA 4U1LA 3CFBA 5BJTB 3O2DH 4ZOAA 1JN6B 4XC3H 1Z0MA 1CF8H 3IKCB 1EGJH 3V0WH 2HTLC 3VXSB 4AH2A 5D1XB 5FYJL 4ZO8A 4LRIA 1ORQB 4UIKL 3LAFA 5KW9H 4DGVH 1EEYB 3GI9H 3GSQA 2CBJA 2EDOA 5ERWA 2BNRE 1VPOL 4GKSB 3W0WD 3BHBB 4Y4KC 1G6RL 2DYPB 5CEYA 3KYKH 2WBJB 4GH7B 5MEND 3SE4C 1TZHB 4QXGL 1RPKA 3WH5A 3MNVA 1Q9KA 4Z7UF 1JPGB 3QIUC 4GXUN 5DK3A 3RTQC 4JVUA 2B4CH 4XPAH 5C07B 5GIRA 1F4YH 2GJ6B 3WUWB 3CUPB 5J1TC 5GXBB 2ITCA 4KGLA 3BZDA 2GJPA 1YPZB 1JYXA 1D9KD 3P2TA 3W81A 5MP6L 5IB5B 4JFEE 1T6VN 3SCMA 2VT0A 3P9WB 3ZIZA 3AU1B 2EDDA 3TLRA 5FYKH 5KZCD 1R5VA 4ODUB 2DTSA 5CMAB 4BELD 4S1RH 2VLKB 2P7TB 2XZQL 4OSUL 4Z7QE 1FLRH 3EDJA 3R1GH 4BUGA 2X4UB 4NKIL 1LE5B 1RD6A 1CGYA 3LN4A 1MCSA 3N06B 1JVKA 4JDTL 3HZMA 4D8PB 4NYLA 5F6IB 3OTTA 1O5DT 4BSVB 1AKJD 5KBNC 3VCLB 1Q9WB 3CXDH 1LO5B 3DVNB 1KXVA 5CIPH 3VOCA 3MR9B 4XUYA 3LX9A 1NC2A 1GAFH 2EEXA 2ALWA 1TMCB 5TF0A 3KL3A 4ODXA 5I1IL 1UB5B 2J8UE 4OCLC 2GK1B 2FD6H 2JB5H 2IXVA 2HRLA 3MLXL 1TVBB 4JFYB 3LOWA 3MGOA 1A6TB 1HXMA 2ZOXA 1FZMB 4M5YL 5FA3B 4IRJB 4JN1H 1HXYA 5EORH 1XCQB 1FNHA 2AJSL 2YL6A 3QIBC 1JPFB 2VLRB 2MFNA 3VG9C 1N5AA 1OSPH 4O9HL 5HGHA 1UR4A 3OB0H 4HWZA 1CXEA 3UYRL 2DQJL 3WQ6A 4WTZG 2BVUA 4H0HB 1CYGA 1XF1A 1SVZA 3VMNA 2XGIA 4JFQB 4K07A 1YY8A 4M82A 1IGYA 3VFTA 3FTGB 4L8BA 4EI5B 5JORB 1QW9A 3SIMA 1MHCB 1CDCA 1KR1A 4JFXB 1QBLH 1QLEL 1E4JA 4HDIB 1ZS8B 4X6DE 1A47A 4HH9B 1JYVA 5JPMA 1MLBA 3BXNA 3KR3L 3HG2A 2WCAA 3RDTB 4YHPA 2X89A 1JFHA 3U5YA 1QPKA 1FSKB 5I1KH 5HI5C 1MCEA 1CBVL 4FN0A 4XPTH 2VL5A 2D4DA 1Z9OA 1IT9L 1EGJA 2OSYA 1ONQB 3CSPA 4XWGH 2WXDM 3QWRD 5BOPA 3BQUB 1IEBB 4G43A 7TAAA 1EHNA 4IDLA 5E99L 2ARJB 1YEEL 3CIVA 4ODSH 4Z7QF 3O2LA 3GSNB 2YA2A 4X99B 3U9PL 4HJGB 1E4WL 3GRWH 2C3HA 4HIEA 2EDNA 4ORGB 3FRPG 1ZLVH 3SURA 4DAGL 3N1GC 1N26A 4YHLL 1C16A 2NY7L 1INEH 2BCKA 3GIZH 3L5WB 5DR5H 1N4XL 2E4TA 2LU3A 1P7QA 3ARBB 5J11B 4CDGC 5L0QC 2GJXB 3UTPE 3VGAC 4NGHH 2J8UF 1EOKA 3RAJL 3HI1A 2DH2A 2CBUA 1QRND 1IFHL 3N85L 4G7VL 1T2XA 1AI1L 2E7LC 1HINL 3H42L 2YDRA 3D18B 3MUY1 3IJ7A 4K7FA 3UTTE 3WDPP 2XRAL 3SGJA 1DZBA 2GFBB 4FQPA 1JZ3A 4Y4KD 5T1KA 5DMIL 1XIWA 2IFGA 3OLGA 4PRAB 5D4QA 3QO0B 3NABH 2AAAA 3BP4B 3KWWB 3MV9B 4LSQL 3BEVB 5CIPA 3RTQD 1TCMA 1PLGH 2A6KA 4HKZA 1J8HE 1WO2A 3PABB 5INDB 4UDUB 3R8QA 1HWHB 3A6CH 3MRRA 4U1GC 1UM5L 3MXWL 2F58H 3ME0A 5CBAA 3EIFA 4HWBH 4DK6A 4QWWC 1FORH 2XPGA 1B0GB 4M7ZC 3U48A 3L5XL 1I85A 2XUCA 2NQCA 1TCRA 4M9OA 5E9DE 1QI3A 1WDSA 3P30L 4X6DF 1IV8A 4NQED 1IAKA 3QI9C 4K23L 3RVTC 5L88H 4LKXB 5I74C 2PCPA 1MFBL 5F6HI 4P48A 4MXQC 3SE9H 4EJ1C 1NANH 5KVFH 2AQ1A 5AUMA 2AGJH 3SEPA 5CCKH 3LRHA 1WDPA 4IISA 1P84J 2KUTA 4WENB 2VZTA 1LDPH 4X9YA 1PKQB 4I13B 3EFFA 3PF2A 1GJIA 4TQEH 1EXUA 1CQKA 1G6RB 4FXKA 4Y8DC 1A6VL 1QHOA 2WIIA 4ZOEA 5C0AA 1RULH 2NY6D 4IOFC 3JTTA 4EQ3A 2R2CA 3FW6A 2ZOKA 4GSDH 4KRNA 1F11A 7A3HA 1D6EA 1QKZH 1ZVYA 2MCPH 3HR5A 4NZRH 1HJWA 4ZXLA 3GMQA 3QIBD 3RWEA 3D6GA 1RUKH 4R8WH 4JY4B 3O6KH 4D9QD 2YJQA 4PN2A 4MXWL 1A3LH 4D6HA 3UJTH 1Q9LB 3PP4L 1S7XA 5F9AC 1V0KA 3QG7L 4ZE4A 3G5VA 1WUNT 4RISL 3UPRB 3RWCB 1D5MB 1R33A 1VFBA 1B3ZA 3IDMA 1HILA 4AMKL 1FNFA 4JRXD 4GRLB 4XWOC 3HRZA 5E24E 4HJ0D 1HKFA 4OFDA 2VDRL 1QFWM 2JCCA 3KPOA 3CTTA 2JELL 3UC0L 5SWZD 3C2SA 5D7LA 5FIPA 4TVDA 4JB9L 1H5BA 2J47A 3FOMA 1SMDA 1CT8A 5C0CD 4IIQC 2DQTL 3GRWA 1WCGA 1BZ7A 4J6RL 4O4YL 4K3HA 5GSVA 4B15A 4F80A 3ZJ8A 1CEOA 1MQPA 4JEGB 1ZJBA 5ABGA 4FQQA 5HI5D 1EJOL 5FDYA 3VIKA 1HIML 3ALFA 4JANA 3ZDXE 3WUZA 4X8JA 2XA3A 2WQRA 4ZO6A 4ORZC 5FOJA 1U2CA 3EDFA 3HE6A 3S96B 1TQSA 2IC2A 4I2XA 3V4VH 1DN2A 5HVHC 1GOHA 5EFDA 3TCXA 1KEMH 3QEHB 2AEQH 4I3RL 2EEAA 3BD5A 1J88A 1MQKL 1NUNB 5GGTL 4GRWH 4WK9A 3QDJE 3ESUF 2AV7A 4QXWA 2DLFH 4CVXA 4GW5B 3N9GH 3C5SA 2FB4H 1BQUA 4QXTB 2E7MA 3OF6D 3GK8L 3P73B 3HG1D 2YWZA 1MWAH 3AY4C 4GAJL 3K46A 3BZFA 5LGHL 5JHDB 5KVDH 3W27A 3B5HA 4MNHA 4PY8J 1HJSA 3MZTA 1JGDA 1S5IL 5DI8B 4HWBA 4RNRB 1QSEA 3PNWA 5GS0C 5ABFA 3MRLA 3OKNB 2ZSVB 4OLUH 1T1XA 1X5XA 3RM4A 1QI0A 2A1WH 2APWA 1MIMH 4D9RE 4Y5XB 3LPFA 4DVRH 3IFNL 3SQOL 1MAML 5JLZB 4ETQA 4JFFB 5JUEH 3DX7B 4XNQA 1QRKA 4H26A 4OGYH 4P23C 2P44B 5HPMB 4F7EA 4HIXH 1MW0A 3OBAA 4XVJL 4G6FB 1HH9A 5BVJA 3BCFA 3G6DH 2VXQH 3U2SB 5MEQA 2E5EA 1EFXD 4R2GD 4RFOL 5IR1B 4TX6A 2BOBB 1LK2A 5E2WL 5I0ZA 1M04A 1V05A 3C6LA 4G80B 2CIIA 3U4BL 3QZWG 3WXVH 4F3FB 5IHLB 4RWYL 1CE1H 1G7IA 4ZNCD 3PGCB 3MMWA 3QI9D 1T3FB 2AJVL 3GMMB 1QEWB 3WH6A 1E4XI 1EK3A 5ANME 3I2CH 1OQOA 2DQIL 3TPUB 3KJ6H 3VE0A 4U3XA 3TP4A 1JYWA 2O92A 5J6GB 4YEFA 4HUUA 3TYGL 3ZDXF 4JHAH 1YEIL 1V08A 3BP6B 4BFEA 1V7NH 3AJ7A 4F9DA 1TNMA 3OG2A 4LPYA 1NCCL 1A7NH 2CK0H 2HT4C 5C0EA 1JHKH 1J0ZA 4WWKB 1N7MH 3SUVA 2FYYB 1D7FA 1OARL 1TQCC 4LCIL 4XPFH 3O9NA 5I18H 4WFFE 4URTB 1BAGA 3AVEA 1UH3A 3EFDL 2WVVA 1G7QA 2D7MA 4QHUB 4HPGA 4JZ5A 4HPYH 1IGIH 4PTMA 1X1NA 3VXQB 3VVGA 1LD9B 4QHLB 1NMCC 4BJLA 5C0IA 2NX5E 1R24B 1X5IA 1KIQA 4EN3D 1QI5A 3T65A 4D94A 1MREH 4PJGB 4PJ9B 1VFAA 3F7YA 3KLAB 4I0CC 4U1HB 4XRCA 1VGEL 2F9BT 1GZQB 4PJ7B 3LQZA 3DXAA 5F1NB 3F5JA 5L2KB 4R26H 1A2YA 1BZQK 4JZNB 4U1KA 5F7YC 4KRLB 1MJUL 3BDYL 4PJAF 2MQCA 4DN4H 3CUJA 1SY6L 4UI2A 4JHOA 1NL0H 1B4JL 1JMZA 1IAIH 4UT9L 3GMLB 3VG0H 2EECA 1RK1A 5GGVL 3BUDA 5MENA 2ZCHH 4UAOC 5DVKA 1JNHA 5I1DB 2ARWA 3MV11 3TN0B 5HYJA 1VESA 1E40A 3HFMH 4TTUA 3QYCA 4BSWA 2VN4A 1N59A 1BQSA 1A64A 5JIPA 4GXPA 1B3XA 1H8SA 1X5ZA 2HFGL 4RGOH 1XSJA 4I0PB 5FB8A 4O00A 4L5FL 3A3HA 3U4EB 3VXRA 4HPOL 4BF7A 1FO0H 4PTUA 1IBGL 4WV1C 3ZQ9A 4G9FD 4PJFE 5CZXD 3WQ4A 4KJYA 3P0VL 1AKJA 4L4VD 4KC3B 3QDMB 2G41A 3OKDB 1W0WA 1YN7B 1OAUL 5FUZH 1UG6A 1K3IA 3P9MB 1F4WH 2WIMA 2CKNA 4LSDA 1SYSA 3IDJB 3MLWH 3FQUB 2OTWA 4U1JB 4HV8A 2C7UA 1A3RL 2E6PA 4LSPL 3OHXA 4Z7WA 1IC4L 5GS0D 2PF0A 2B7DT 2AKRA 4W7VA 5GZNC 5IGXL 5BO1L 4PUDA 3VDBA 3QH3A 3UTPD 2VIRA 3K2UL 4UINL 2Y23A 8FABA 4HK3N 2DWEA 4JY5L 4PUBH 1JCKA 3MRQB 2Z91B 5CILH 1PVHA 4P23D 3QUXC 5EIIA 1U8LA 2Q20A 5E0QA 3GMOA 5FUOH 1V6UA 4A3YA 4KKBC 4LCWE 2BNUB 5EIVA 1YNLL 1LILA 1ZU8A 3E3QC 1CWVA 3VFMB 4WI7A 2YC1A 1JWUA 4YFDB 3GXDA 2A77H 4O51B 4TVPH 2EZ0D 3H9SB 3NCOA 4XCNA 4J3SA 1RZFH 4DEPB 1UWTA 4E8DA 4YHYC 1A21A 3CUIA 1TMQA 3NACL 1JNJA 1G0XA 2HLAB 3KPRE 3IFPB 4UV7H 5DWUL 1KCRL 3WF1A 2AV1A 4LVNB 4NQXA 2K7PA 2YPLD 3TNNB 4ELKB 1MJ7L 4Y5YB 5HHME 4BFIB 4PR5B 4F9LA 2V2XA 1H0IA 2EPLX 5A3ID 4MNGA 2BVOB 3VO0A 3OLIA 2V5MA 2R2BB 2FX9H 3GH4A 1PZ5B 3LKNA 4R3SB 2ZUNA 3S88H 1MF2L 5GRXG 3ZJKA 4I18C 5D7JC 3LB6C 3UTZB 4Q9QH 5HDOA 1JZ4A 3VGDA 4U1NA 4HF5H 2B39A 3VD7A 3CLWA 3VFGH 1IE5A 4OCRH 5KSAC 1FZJA 3TV8A 5I8EA 5H94A 1A5FL 3MCKA 4Y19D 4N5EC 2HT4D 5FYLD 3PZ9A 1FH5H 4N9GA 3RPIB 3V6ZB 1CICB 3TBSA 5LG1A 1FDLL 5DLML 1DBKH 2VZOA 3HZVB 4AM0B 4LLVA 3FT4B 3ZE0E 1PJ9A 2CMRH 4U1SA 3IDUA 1H3GA 1XGYL 3U6RB 5JDJA 1R75A 2X4PA 3Q3GB 1LWJA 1MFDH 1A7OL 1AY1L 1OSZA 2H32B 4Y1AB 5KSBA 4U7SA 3GSXB 4UQDA 4JO1H 2YIHA 1UXWB 4MDIB 3ZM8A 5F6HJ 1E27A 4F8XA 2EICA 4AD5A 4HHAA 4IRSB 4G5ZH 5D9SB 4AIXA 1H15B 2JJVA 2XQBH 4NZUH 5E1AA 4GKNA 4Z0XA 5JR1L 5LJYH 5MEOB 3VXMA 3W5NA 3IK2A 4AD4A 4W70A 1FO0A 2A73A 3G6JE 3QDGB 3WFBH 1YNKL 3VFRA 2J88H 5DYOA 1NGXA 1YC8A 3BT2L 2CO6B 3SE4A 4DO4A 3HMXL 4L3CB 4PJHE 1F58H 1U8JA 4GRMB 2PWFA 3QIUA 2FGLA 4IOSD 1V6WA 3RTQA 3QR3A 3WH8A 3L4UA 1LO0H 1U42A 4XP1L 1BBJA 4NRXB 5I9QB 4WLCA 2X4RA 2F19H 5IMOA 2JEPA 1JNLH 3O4OB 4G8GA 4D0CA 2GFTA 3ROLB 4KZDH 1ZLVK 1W9BM 4X9FA 1EVTC 4JRYD 4CVUA 2OW7A 4WUKL 4U7MA 4LEXL 4JREB 2Q3AA 4QP0A 3WIHL 2HT3C 3OZPA 5IOPB 3BGMA 1MFEL 4IRZH 4YLQT 4DUVA 3VJ6B 4TSCH 1KB5L 2QQKH 4QRRB 2CRYA 2R4RL 4D3CL 3TCLA 1RZKL 4PJIA 1BVLB 4GBXB 1S9WB 1KCVL 3KXFB 3GSWB 2DTML 2C9AA 2EH7H 4P2YA 3T0XA 1UT9A 1VFMA 1N2RB 2R29L 4AMWA 5ABDE 4WO4C 1N6QL 4Q58C 2ICCA 5GZND 1BYCA 3BP7A 1H5VA 4MCYA 5EOTA 1GGIH 5A8MA 1EBPA 4LK4A 4EDXA 2ADGB 4K8RC 5EZJB 4HBQA 2V7HB 2QSCL 3MXVL 4FNLH 4P7LA 1NC4A 3MLRL 2CJUH 4AZBA 3ZE0F 1N3NB 3KPQB 4RZCB 4Z95H 3FB5B 3QUXD 3BESR 4OCXL 3AZSA 3WFLA 3WXWH 1OGTB 1CVRA 2R69H 4YK4B 4D9RD 1YMMB 5C0JB 1N82A 1PY9A 4KKBD 5K59F 3UP1A 5J13C 1ZVHA 5LYRA 4LARH 2E3ZA 3L3DB 1GGTA 5D71L 2Q8AL 1E4NA 4KI5E 4XBEL 1T21A 3U1SL 1FRGL 1TENA 4HXAH 4XPHH 5DUMH 2XWTB 3AREB 5IG7B 1MHEB 1X4XA 3HNVH 1E4MM 3VFSA 1EZVY 2V17H 1AGDB 5C0CA 4AG4L 3WIFB 5KVMC 3T04D 1L9MA 1CLZH 3C8HA 5F1KC 2R56H 1G0YR 3RI5K 1WBYB 1T0OA 1DWGM 2E6QA 4FLRA 4UQ3B 3PGFL 1RK0A 5D7JD 3LB6D 1HVXA 3N12A 3FO2A 1J0HA 2PYEE 5KSAD 4QOKB 3W9DB 5IK3A 4ZSOE 1BGXH 4QKXB 4PD4J 2X2HA 4N5ED 5FCUH 4POZD 3WFHB 1WE5A 1G7PB 2ADFH 4NQCE 4DFHA 4HS3A 4YWGL 3EHBD 2UYLB 4IJ3B 3WEZA 1D5XB 2APBA 1X5GA 1IM3A 2JFEX 4WFFD 4FZ8H 2F2HA 4CD6A 5GRVK 1OP9A 3WNLA 5A8NA 4R9HA 4TUKL 5DK0B 2WC4A 1T5XA 2VAAA 3HCVB 4X6CB 4CW1A 1VAHA 4HA1A 4HS6A 4HUVA 2LU4A 4JPWH 3EMCA 1H09A 2IAMB 1I8IB 4HULB 1FCGA 4XNUH 1OAQL 2FJHA 4Q6IC 1VENA 4GO6B 1P7KA 1QYGH 4U6HA 1W2KT 1EAPA 2WKGA 4AEIH 4B3KA 3AISA 1TJHH 3EO0A 1R5WB 2ESVD 5AYUH 3QXDB 1LEGB 5HHPB 3NA9L 2CDEB 2RFXA 4FFYL 3LKOA 3EDEA 4P2OD 2AJUL 1NBQA 2L7JA 5BS0B 1D5IH 1XH3B 4I3SH 4X7EC 1G7JB 3ULUE 2YEZB 2BNRA 4PJ8B 2CITA 2FR4A 2C5DC 4TYUA 1OCQA 1CLYH 2NTSP 3EZJB 3P4MA 3WSQL 2NLJA 3WV0A 1U3HB 2FCBA 2F53B 2LU7A 1LEIA 2XIIA 1F6LL 4MA8H 5EBLB 3W53A 3UEQA 3SCRA 5GS0H 4PJDB 5L8KB 1PX8A 1FAIL 1NAML 5C0BB 4AZ8A 4DKFL 4XZUA 4ZEPA 2XQYK 4LHJB 4R5EA 1BFOB 1MH5B 1T5WB 2IQ9L 3CVHL 5D7SH 1G7LA 3T4YA 3BVXA 1MCPH 1JGLH 2ADJA 4JFEA 1GH7A 3QI9A 2HT3D 5FGCB 4APQB 4F37F 4PBWD 4ZYKA 3RL2B 4FFWC 1MCKA 4NRYB 3W39A 2DJUA 1NDMA 3K1KC 5D6CA 3SCPA 4HGKC 4O2FA 4XH2A 2CETA 1A1MB 4WI4A 4E42A 2OYMA 5BRQA 1GPFA 1RMFL 3EYVA 3ALXA 1HP4A 1AR2A 1RSFA 5DMKB 1EERB 1MRDH 3V7AE 4RFEA 2P1YA 2FX7H 1SM3L 5T3ZL 4B53A 2GUOB 3WQVA 3VWKC 4WO4D 5M7QA 2ZCLH 5FOBA 1FP5A 3W4RA 4XVSH 1V6XA 4K8RD 2J8UA 4LPCA 4MD0A 5BW7A 1ZGLM 2QKIB 4R4BA 1BZ9B 1DCLA 1ADQH 1PX3A 2VN7A 4R4ND 5E94B 3D4YA 2YRLA 5FYJU 5GGUA 2E27H 4CKQA 4M03A 4G8FB 1KULA 4UCFA 4U0QB 3DX6B 5SWQA 5FKPB 4ZOCA 1LE9A 4OQTL 1I8MA 4NO2B 4LKCA 5TDPB 3DRQA 3TTYA 3GZKA 2VZVA 3H9ZA 2DLIA 1E0VA 3S35H 4QLRA 4MAYC 1YEJH 4O2CB 2VLMD 2Z93B 4WCYL 1WWCA 3UJJH 3ZSTA 5F9DC 4RFNB 4Y2DC 3QUYC 1F8TL 5FYLH 1OGBA 2ESCA 1KB5B 4FLSA 2YUWA 3NN8A 3BGFC 3QPQC 2OJZH 4PTVA 4KI5C 4IIQA 1KB9J 4H88H 3MO1A 4G9DB 3ISWA 3SDXB 2GT9A 1XGZA 2RGSA 3SCQA 4NC0B 4GKOA 5JHLL 2HKHH 4X6DA 3KPRD 1GZPB 2VXVL 1IQWL 3N0PB 5J3HC 4XHJC 5IB1B 2YPKA 1ORSB 4LLUB 2BFGA 4UV4H 5HHMD 3REVA 1HKLL 4RGNB 4DFIA 4NXKA 1NMAH 4KK6C 1ZT4B 5D2NE 3WN5C 4NUGL 1M7IA 2FBJH 5HHXH 1MEXH 4LLMA 5E5MB 3QAZB 3SKMB 2QHAA 4W7UA 1PW3A 4X4XB 1UFUA 4DUXA 2XWJB 2VLLA 3X13B 4RX4D 4L4VA 2EDWA 3HB3C 4ELMF 5JQ6H 2IMMA 4TX8A 3NFPA 4PUEA 4LLQB 5FV2A 1RUPL 4YHML 4N8VA 5ITFB 3AY4A 2Y07H 2X7LA 1DBBH 4Q2ZA 4OAWA 3IDNB 1WZKA 1UB6B 4JE4B 2DWDA 3G6AA 5HOSA 2Q8XA 1P4LA 3JTSB 4R90H 3ROOB 4KHXL 4J1UA 5TQ2L 2UZYB 4KRUA 1Z9LA 3NFNB 2X2IA 2DI9A 4NM8H 2IBBA 4P23A 4AJ0A 2XN0A 3ZDYE 3UTTA 1IQDB 4UUJA 4DKEH 1QNZL 3G9VA 3DROB 4PG9A 2VNCA 5FDWA 3O11A 1GORA 3N1QC 1EUUA 3V4UH 5HVWA 4E5XB 2MJWA 2NY2C 3ULUC 3SDAC 2ZP0T 1R47A 4LF3A 1OPGL 3P4LA 4P4KC 1J8HA 5ALBH 3OZ9L 3GYCA 4QT5B 4PJCE 1CG9B 4KKCC 1AFVL 4EXPX 1JIBA 3MRHA 2XSAA 4CCDA 4V1DD 4JM4H 3BPOC 1CXFA 2IF7A 5ICYA 1OD9A 3C09B 2Z35A 1ADQA 4O2EB 3IRZA 1QHZA 4FFWD 4EK7A 4PREA 4QRPB 1UZ6F 5AYQA 4QLKA 1S7VA 2F7OA 5IT2L 2UY2A 3VM5A 4GI8A 2CGRH 5LCVL 2I60L 5HVFB 2VXTL 1WDRA 2W65A 2H26B 1WPCA 1KACB 2H8PB 1JK8A 1UCBL 3FN0H 4FTVE 4WFHE 4E41D 4WUUB 3VWKD 3DGCR 2RGMA 1FV1A 1M71A 4TUFA 2Z1SA 5BOZG 3U7AA 3QIWB 1QI4A 1NOWA 4FQJH 5KANG 4CN6A 2XTJD 1P2CB 2G75A 1FGVL 2V3DA 1TUXA 1IGJB 4HIJB 3P0YH 3ZDZE 5CZVH 1GC1C 1B90A 3RIAF 1E4LA 4P57B 1G01A 2J6EH 3OWEA 1NAMB 1JWSA 4OZGB 1ZA3B 5DFVC 5GGVY 2D73A 2ATPA 5EO1B 3BUTA 4YDVB 3LVEA 3CVHB 3CFIC 4ZPTA 1XR8B 2BVEA 3KPSD 1B0RB 1CR9L 3PWLB 5EU3B 4MAYD 3F4VA 3F62A 5F9JA 1FNSH 3UJIH 3QUYD 3S3JA 4NQTA 4OM0H 3LEXA 3GXIA 4MQ7B 4V2BA 3RVXC 4FXGA 3QPQD 3GMRB 1AD9B 3MLVH 1XF2B 3SCVA 4KI5D 5C08D 2BY2A 3HU7A 5ICXB 3ZDYF 2WMIB 1RZ8B 4ATLA 3BDXA 1DQDH 2HVJB 2A9NH 5DQJB 2GIYA 35C8L 2XN9B 3VA6A 3ZTJH 1DWFM 3HC0B 5ITBH 1QQDA 5IM7A 1JXKA 3UXFA 5E2VH 4XHJD 4QRTA 2GY5A 3BAJA 3H2WA 3D25A 1EBAA 3MRKA 3RGVB 2CNCA 1WT5C 4JM2B 3C9NA 5JBDA 4KK6D 4ZFZA 1KJVB 3CZNA 2Y36L 3T77A 4PJCF 5F21B 2FECL 2EYSB 2WMFA 3H3KA 5K93A 2OWXA 1I3UA 1E72M 3WN6A 5DXWA 4WV1A 5D2NC 4JHWH 2Q8BH 4OFIA 1MI5D 2AXFB 4A6YL 4CU6A 3QRGL 3QPXL 3GSOB 5DT5A 1T2QH 2ZUXA 3MBEB 3MLUH 1A4KA 1GGCH 3PQYB 1LO4L 3KPLB 3B6SB 4EANA 2RGLA 4P8UA 1BSIA 1A7RL 3HI5L 3F65A 1NMBL 2EH8L 4NUJA 3U46B 2IPKB 4OF0A 1PG7X 2O26U 3UPAA 3FO9B 3BAXA 4FFZH 3QUZB 4P9HL 2DSWA 1I8KB 3ES6B 3BVWA 3VXSE 1SYVB 4HXBH 2Y06L 1UWUA 3MREB 1V3JA 2OL3H 2OSWA 4D6DA 4X0KB 4LASL 5E4IA 4X6BA 2EE6A 5IFPA 5I66B 4TOQA 4ZNEE 4UQCA 3QUXA 4QGTA 1N5YL 4WW2B 3WL1A 3MLSH 5EBMA 3WLWC 4ZOBA 1ZOXA 4OD1L 2FJGB 3ZDZF 1EUTA 4JGUA 4WI5A 4LCCA 1MCWW 3GKZA 2EDQA 1BF8A 1ZXQA 4OCNC 1K5NA 2A3BA 2R2HB 4K3GA 1UXSA 1I9IH 1KBGH 4F9PC 4NKDB 4EIZC 2NY2D 3ULUD 5FO7A 3SDAD 3TESA 2GJ6E 3S36L 3BPNB 4YUEH 4P4KD 3IS0X 3FN9A 2PW1A 3DRTB 2AEPL 2AK4B 5D8JL 5I23A 1T0MA 1V6VA 4JFPA 4K8RH 1FC2D 2O5XH 2ADIB 3PV6B 4KKCD 5IHZA 5L7XH 5T1DL 1QNPA 1N64L 4H5SA 1JDDA 1M6OA 3MRCB 2ZCKH 2XA8L 1LNUA 3WD2A 5T1MB 2VLKE 4DM1A 4PTXA 1XZ0A 5C8BB 5DJYB 1FVDB 4P59L 3SKNB 3LRMA 5ICZA 6FABH 4AIEA 1Q0YH 1CD0A 3D85B 2IH1B 4I18A 1WAAF 1BWMA 3NFSH 5CEZL 5ANMA 2KKQA 1AGCA 5I8OH 4KRPB 4GFTB 1XF5A 4TNVF 3KLKA 3BW9B 3EJTA 3C08H 1FJ1B 2J7LA 3O3DA 3T2OA 3M8OL 1EV2E 2ILLA 1RURH 2I9LB 3H55A 5CD3B 2ZUVA 2GSIB 4CCCA 4KK8C 3FN3A 5EOCL 5EU6B 3MLTB 3WFDL 1S9YB 2AABL 5BXFA 5A6BD 5KTEH 3Q6GH 5GJTH 2A74B 1BQHB 5C09E 2BY1A 2F8QA 2XG5A 3OPZL 4J3OC 1H41A 4MYWB 1RUQL 3NUKA 2G9HB 5CP7B 3ULVE 2GYSA 3P4OA 5T1LD 4PMNA 4EXKA 1FYTE 1A0QH 4RL3A 3PXJA 4UOQA 2NY4D 5A2JH 1OM3L 4BA8A 4NN6C 2NX5A 5HHQB 1OT2A 3RWJB 4KJWC 2VDKL 4P46D 2NT0A 3M1BA 3RVXD 4DGYH 2IANB 1A7BA 1HHIB 2FL5A 4HJJL 4RIRB 4U6XB 3P77A 3UG3A 4FQIL 2CXKA 5DJ0A 1QFWL 5C0RL 3RBGA 5EU5B 1MUJB 2F54D 1F97A 4HFWA 4XCYA 1KR0A 5F71A 2AJZB 1LP9B 4RMUA 1NUDA 1G6VK 2RR3A 4D71A 1OAZH 4TOYL 1UD3A 3IGUA 5LXGH 5EBGA 4ODWB 1E5NA 2Z92A 4XP4L 3MLZH 5DVNA 3M6DA 2V3FA 3SHSA 2DT0A 5DS8A 3DOSA 3KPPB 3K8MA 4F7PA 4ZXBB 4XXCA 3RNKB 3UZVB 3FQRB 2C8NA 3NTCH 1CFNB 4Y4FD 1C5DB 2OL3A 4N0UB 1L4IA 2CPCA 3FHQA 4JHBA 1NOUA 4XBPA 5C8JA 4Y4HB 2WZHA 1CLCA 3DMMB 3O3EA 3ZL4H 5B39B 5ESQA 4UT7L 5HI3C 4R97B 2ED7A 3UZQA 3ZYZA 4GAGL 3U7VA 1BM3L 4L4PA 1J1XH 4KQ3H 4NQUA 4PJFA 4JPIA 4KI1A 3S34L 2Y6SC 4DKAA 1RFDL 3DX9A 3IFOA 2E7CA 2VVNA 1CL7L 1KCUL 3OKLA 3MRIA 2MQ3A 4NN7B 3AIUA 1KIRA 5F7DB 1RUAH 4P2QD 2OWCA 2GK0A 1IGML 2OX5A 1I1YA 4J7RA 4NJAH 3U7BA 5LQBH 1FAKT 1KTDA 2WP3T 1Z32X 4LCUB 4I77L 4PRIB 1YEDB 2DLGA 1HYRC 2C3XA 3W0WB 3KDMB 1E15A 1AO7D 3E1F1 3FKUS 5A16B 5IFJB 4ODHL 1G9ML 3PZIA 5IBUB 3VFPB 1HHJB 3ULVF 2NW0A 3BZ4B 2ICEB 3C8KB 4L8SC 3HUJB 3GJFH 3MV9E 2IALB 4QF1B 2OQJB 3QHNA 3BN9C 4YGVA 5MHSE 4HIHA 2WBJC 4ZUVB 3I6KA 4A6YB 3FB8B 4M7LL 1UWRA 4GW4B 5DJ2B 4TSAL 5EUOB 2JE8A 5AAWA 3EOBA 3RU8L 5KZCB 3TH4T 3MA9H 3L7FA 1AQDB 5JO5A 3H9HA 1FIGL 4ZD3L 3TT3H 4UOW0 5HI4C 4DTGH 5I1EL 1NBVL 2W61A 3GIVB 3TV3L 5E6IB 1ETZA 4LVOC 1W72A 4GG6B 1EH9A 2JK5B 3KPRA 1J05A 3LXAA 4HWEH 1DR9A 3CDCA 4L4TB 4DJMA 2H6PB 4QTIH 4KPHL 2NT1A 3T8XA 1AGEB 4M62H 2QHRH 2J4WH 3LV3B 3WFCH 3CLFH 5F6IC 1K2DA 1Y0LA 4NP4L 3DO7B 4I4WA 1S9KC 4J28A 1JGVH 1BD2B 2P47B 1XCTA 5TGBB 1XCWA 4Z0BL 3VFNB 1FL3B 4N0YL 1L7TH 1WC7A 4KK8D 3UTQA 5HYFA 2EIBA 3I50H 8CGTA 3RPKA 4FTVD 1FH8A 2OK0L 3MV7B 2CBIA 3BP5A 3F7VB 2A2QT 3JWDC 3ARFC 3X3FH 3RY6C 2WV3A 3PWNB 3RNQB 1CD9B 2F5BH 4ZG1A 3N15A 4IRJC 1MLCA 3BPCB 5BVPH 3LD8B 3ILPA 3KE0A 4EUPG 3HPJA 1ISXA 1II4E 2X05A 2NW3B 1MFNA 4MDJA 2UZIH 4MJID 1I7ZA 1R3HA 4QTHA 3GGWA 3T4AB 5K9QI 4GQQA 1NSNL 4QRQB 3QNYA 4KJWD 3ULVC 4H8WC 2VDNH 3PDOA 3U7WH 5HHOB 4ODVL 4M1DL 3II1A 5BRZB 4OV6F 5DC9B 3O4LB 2MHAA 4B7LA 1KN2H 1Q72H 1MW1A 2IPUK 4NKMA 3EJJX 3T2NH 3AZRA 3G6JA 1Z3GH 1UUQA 4EI5C 2NNAB 2EDKA 1W0VB 4OCSL 3A67L 4KVNL 2XFXB 3VI3E 4NZDA 4NHCL 4PJHA 4CD8A 1DQTA 1NCUA 4D9LH 3BKYH 5AZ2H 4M56A 2BC4B 2WBWB 3ARDB 2NCMA 3RDTC 3V8OA 1TTUA 4XCEA 4JJ5B 1JBJA 3L4WA 3O6AA 2XICA 4ZUTA 2WC3A 3LQAL 4ZAKB 1FSKC 1TZIB 4ZUWB 4ODTL 2HRPH 3MRPB 3RX8A 1T0NB 2C3WA 4CU8A 2CYGA 5HI3D 3MRDB 4M24A 3BVTA 3BQUC 1DANT 4GW1B 5CGMA 3QHZL 1U30A 1H3XA 5SX4H 2WW5A 1QO3A 1KTLA 4PGCB 4EZMA 1KCKA 2Y6SD 3GJFA 5EWIH 1TQBB 4GT7A 4WJ5A 3E6FA 3ULUH 2IPTL 3WS6C 3OGVA 1YMHA 3MQIA 2HLFC 5DDHA 3O8XB 1Q9OB 3VWKA 1KJ2L 1DEEB 1R34A 3HAEH 3QZWB 4JFHE 3QQNA 1E56A 5E95B 3S97C 3VXUE 4ZTPL 1ZBVA 3ARBC 5J11C 4U6VL 32C2B 1T66D 5KAQG 3EOTH 1TETL 1JTPA 1V3IA 3VXSD 3D0VA 2FJFA 5D1XD 4DOHE 5E2JA 5DD3H 4EUPH 3D69A 1EOMA 1F3RB 2A3HA 3VNYA 1MSPA 3OSKA 4HK0A 2ZPKH 1KJ3L 4G6KL 1KNOA 3RWIA 4GQRA 2AXGB 4KTDH 4G8EB 2HG5A 2DYPD 1TZGL 1W3HA 2P46B 1CFTB 3A6BL 4MAYA 5E8PA 2WBJD 5ILTH 3G5XA 3Q1SL 4QXUH 1A14H 5FUCE 1H1NA 4Y2DA 3QUYA 4UU9B 5F89A 4K9EC 4BZ2H 1K8IB 3K4AA 5I77A 5BMFL 2BDNL 2KBGA 1FL5B 5C07D 4M5ZL 5C08A 5L9DL 1IKFH 5MEPB 3T2QA 2GJ6D 3EYSH 3LN9A 3ZKNC 3OB8A 1DTUA 5CJXA 4ACYA 5HI4D 4NQEB 3WELA 3K2MC 1GC1H 4KDTA 2CKSA 2WBGA 5K9JH 1VBUA 4PRPB 2HAZA 3QHTC 3SOBL 2AXHA 3O2VL 2VLKD 1GVIA 3OV6A 5DA4A 1CU4L 1K8DA 4Y5VB 5F7KC 3WN5A 1SJHA 4YC2B 1WTLA 3OKMA 2W9EL 3X14B 3QO1A 3RWDB 4EOWH 3KNBB 3OL2A 2PYEA 1JRHL 5DRWA 5IEHA 3EKCA 1QSFD 3IF1B 4ZSOA 5EO0A 3I75A 2J4GA 2P4AB 2P5EB 5DQ9B 5MERB 4YHOH 2UWEF 4TN9A 5CJBA 4OI8A 1RJZB 4CKVX 3VXTB 2X42A 4AWEA 1FCCA 4NI3A 4IRJD 3WMCA 1YEFL 1YUHB 4NQCA 4R4FH 5I19H 1GL4B 2J25A 2P8MB 3IJSB 5FK9A 1XT5A 4G7YL 2FGZA 2VLRD 4ZQKB 4MD4B 3AYSA 4GUPB 3UMTA 1K4DB 1DUYA 3V5DB 5C0FB 4KMTL 3MSDA 3GMPA 5C9KA 2IQAB 5E6YA 3T0EE 1XEDA 3I6LD 4YHGA 4R7NB 2YD6A 1TPXC 4JFOB 4HLJA 5GRWA 1NLBH 1CFVL 4CVZB 3KPMA 4EI5D 2VMFA 4QHNB 5IFTA 5IVXE 1UH2A 5KJRL 5DJZB 3FT3B 1CLOH 5EIQA 2XN2A 1VJZA 3LPOA 3SDAA 1WDQA 3RKDC 2G3JA 1VRXA 3IXTB 3OJDB 5ISZE