3VMNA

Crystal structure of dextranase from streptococcus mutans
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
633
Chain Sequence
NGNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords Dextranase
total genus 222
structure length 633
sequence length 633
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmnA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmnA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmnA02
3MJ7A 1BGXL 4MB5A 5FECA 2XPGB 1H5VA 3MGTB 4Z0BH 5A1AA 4L4VE 2PYEA 4GUPB 1WTGT 3VXRE 5IVXA 1RD6A 1YMMD 1CD0A 3THMH 4PRNB 5FCSH 2ZKHH 2F61A 4ODVL 1K2DA 2DYPD 1NQ6A 3D3VA 2DTML 4OLXH 5EBGA 5ISZE 5D2LA 2VX7A 4LCYA 4YWGL 3MJGX 4Y19A 5IROC 2UVEA 2ZUYA 4G43B 4WDIA 5KJRH 4B7IA 2CEQA 1WZKA 1GZQA 3ARFB 1ZLVH 3OZ9H 5GGSB 1GJIA 3U83A 5LKNA 3GYCA 1DQQB 1PLGL 3ORJA 1MIML 4P46B 3L3DB 5T3XD 2ZCHH 3QEQB 2JTDA 3IFOA 3BPCB 2R4RL 1SMAA 5HGBA 4M6ML 3STBA 3GXIA 2R8SH 1BG9A 2AJYH 1V6UA 3FOLB 5CZVH 3FB8B 3VSVA 5FOBA 5CGYC 5FKAA 1OD8A 4LPYA 1BF2A 2B1AH 1TE1A 3R8BB 3S35X 2OTWB 4LBEA 2DLGA 1E4KA 4TSAL 1T89C 3MRJB 4CCCA 1E6SM 4HWZB 1ZVHA 2F18A 5IUSA 1CD8A 2HLAB 3FQUA 4NP4L 4NZRH 3BIKA 5JHDA 1DL7H 1OAUH 3B9DA 5CLWA 3SDCC 4FLRA 2QHAA 3P73B 1MFNA 3WO4C 1AC6A 2YD7A 4PRNA 1CLVA 4H5SB 1I7UA 1YEFH 1BFVL 5B8CB 1J88A 2CIKA 2OJZL 2WHMA 3D1MC 1CFNB 4H25B 1AKJB 1LEGB 1PD6A 5TF1H 4NQXA 2QMKA 4HIIB 1CXHA 2VDQH 4XAKD 1RUQL 4FTVB 1HQ4A 1QFPA 2JKXA 1N0XL 1BZ9A 4YHPB 5DQ9A 4Z7OE 1FNAA 2FZ3B 5I1GL 3ZTJH 3ARDD 4PY7A 1NGZA 4H1LH 1ZE3C 2EDJA 3QQ3B 4N8VB 5MEPB 3G6DL 5HYJD 4NO3A 1JPTL 1JUFA 4P3CL 3RJQB 4I18A 4JHAL 4BCEA 2FHBA 5BV7B 1A14L 1RUPL 5MP6H 2F8VA 3KPLB 1RUAH 4IHOA 4OSUH 4RMTA 1LEIB 1NCCL 2Q3AA 3FO2B 3MLRH 1TPXC 2V17L 3DSFL 5FUOL 1FH8A 3VGAC 1H5BA 3UTTE 2EDXA 2ICCA 5BZWB 1MFVA 2X4NA 4U1MB 2AS5M 4X5WB 3OKMB 3MRKB 4PRDA 4NI3A 5F7KC 1QBLL 3R1GL 5DURB 4NF7A 2Q1EA 4KJPD 4MXVE 4B15A 2NX5B 1WVZA 1JNDA 2NCMA 5F1SA 2ZXQA 4U1GB 4PJ7A 3O6ML 1U3ZA 3PZUA 3RKPA 5IGXL 5HVFB 3GSQB 2CRYA 3DLQR 1HEZB 3VFMA 5MP6L 3H3BC 4NRRA 1JXJA 4I3RL 5DJAB 2CUMA 4G8FA 3OAZK 5H37H 2F58L 2LABA 1WZMA 2ERJB 2D22A 5TDOA 2OWCA 2C5DC 5FKPB 5CSGA 5I76A 1UM4L 1DLHA 1YDPA 4LIQL 3GKWL 1XD1A 1SFSA 1NCBL 4QHUA 3T2PA 3MXVH 3MACL 1PZ3A 2PO6D 2WBJC 4PMZA 2ZOKB 3D25B 1DZBA 3RVUD 2WVUA 4CN6A 3X12A 2F1BA 3ZL4L 2BVDA 1EGJL 2E7LC 3MV8B 3CK0H 1JNHA 3L5XL 4HSQA 4XZUA 2P8MA 1DR9A 2JJSC 4GXVH 1KJ2H 6FABH 5I18L 3MBEC 1E4WH 4W84A 4M5YH 4F7CA 2M26A 5SX4I 1KGCD 3BZ4B 5JOEA 5IFAL 2VLJE 4WWKB 3KYMB 4LGPB 1W91A 3KPSA 3PL6B 5CGTA 5KVDH 3WY2A 5E6IC 5DO8A 3WQWA 3SDXA 2NSXA 2CUIA 4X99A 3JVGC 5E1AA 3UXFA 3CC5A 3MA9L 3ARGD 5KAQG 3BYTA 1AGEB 3RY5A 3NUKA 5D6DC 3U9UB 5ADPH 1DSFL 1A1MA 3MLPA 2GK2A 1EH9A 3DMMA 4PJ5D 1BYAA 3PZVA 2VZOA 5DLMH 5BZWA 5GS3A 4CNIB 5C0IB 4ZOAA 4GXUM 4YQXL 4OKVA 3I9GH 4YJZL 1DN0B 2BNQB 1MIMH 4WI8A 1WZLA 4JFVA 4GQRA 1DLHB 4MJ2A 4OZHE 1OM0A 3CSPA 1A3LL 4OV5B 2EYSB 1GOGA 4U6YB 4Y1AE 2XN9B 5CD5C 4MA1C 5DZNA 5DMIH 1S7UB 2OYKA 3AOFA 1QSFB 5D2LF 3B5TA 1HKKA 1ZHNA 4G9FA 3W37A 4Q0XH 3CX5J 2PC8A 2NW0A 3IJSA 2AXFA 4O4YL 5IFJA 4HJJH 2DSKA 2Q8AL 4P4KC 3B3IB 5FYLD 4QOKA 1NLBH 3QZWG 4JFEE 2A74B 4JJ5A 5HI4C 2XTKA 4M4PA 2AEIT 2YPVL 2IGTA 1KBKA 5AYBA 5HHXH 4M1DL 2VZSA 3ILPB 3BIKB 1XF3B 2V38A 3MA7B 3DSNA 5GSVA 3RWEA 1F8TL 2IAMC 3QUXC 5C0DB 3O6FA 4NKOB 3VU2A 2CJUH 2O5YH 4NGHL 3LHPH 2PO6B 4MSWB 4QLJA 4B9ZA 1HYRC 3NSMA 4D1IA 3GJFA 1EEYB 5ITFA 1XIWA 3G6JB 5FYJE 2F54A 4D9LH 3G6LA 1QNZL 2F54E 5K93A 4O2FA 3FB8A 1MJ7L 3MRIA 3PWUA 4LVNC 4NO3B 4NZDA 1A6VL 4J6RL 4L8BA 3OKLB 2E7CA 4CDGC 3A67L 3BDXA 1H11A 3GMLA 1HQ4B 3SUVA 3O3DB 1AE6H 3QUKA 4UBDD 4XPAH 1NGXA 2FBJH 4MD0A 1A4KB 3T0XA 4JHOA 1M7DA 4NRXB 4BFEA 1X4XA 2Q3ZA 3OKKB 3T1FA 3OGCB 5HGAB 3DPBA 4FQXD 3BWAB 2XIBA 2V5TA 4P5KA 4TUFA 3WIIL 3QWQB 3D0LB 5GRJL 2B1HH 5TFSH 3F7PC 1BIIA 4DKEL 2ZX6A 4NPYA 4BELD 3AXLB 3O2DL 4XPGL 3C5ZD 4HWZA 1ERNA 3QIWA 4P8UA 3Q5OA 2VDRL 3MLTB 4JY6B 3QWRA 3ARDC 3VMOA 4W6XB 5F7EH 5E24E 1I8MB 3ULUC 1QQDA 2IANA 1QFUL 1W1PA 3C09B 1BBJA 4AD4A 5HGBB 4S1QL 3ELAT 4U0RC 3FXYA 4XVSH 1ZS2A 1CIUA 2F53E 3G5ZB 4JM2F 4Y1AB 1B6UA 5HDRA 3HRZA 3TM6A 2IFFL 4HJ0C 1UVQA 2A83B 5DDHB 5IVXF 4QY8A 2JB6B 3AFBA 2IPTH 5J6HA 1TVDA 1TFHA 3F6LA 1NC4D 4NIKB 1YY9C 4JFQB 3WUBA 4KTDL 5DLML 5H2BB 2OK0H 4AY1A 1T0NB 3L7FB 3PHOB 3GSOB 5C2BL 1O6IA 2NY4B 4NZUL 3BN3B 3QIUA 4U2ZA 5DTFA 3ULUD 4U3XA 4WY7H 4Z2KA 5D9SB 2J75A 2Y06H 3GTNA 5SX5K 4O5LH 4NQXB 4TVPL 1J0KA 1KNOB 4NHUA 4P3WA 3IRPX 2A9NH 3FRUA 3QO1B 1SEBA 2X89A 4HWEH 2CLVA 2H6PB 4U1KA 2GITA 3JSSA 4M43H 3WO3B 5DVNA 3H42H 1H8SA 1WZ1L 1DWAM 2G4FA 5MERB 2CDFA 3HR5A 3QIUD 3VRJA 1BZQK 3AMKA 5EA0L 3U6RA 1SJEB 3OJDB 1KJ2L 4PSPA 3X3GL 5DQJA 1MREH 2RHEA 1YQ2A 4UFIA 4U1NB 2MSPA 2F54B 4P99A 4GG6A 1N3NA 3HI6L 3U0WL 3MBXH 5J11B 3WL0A 4PY8J 4KZEH 4JY4B 4HIXH 2VISA 5IVOA 3V0VA 3KYNA 4YR6A 3LQAH 4K3JL 1Q8MA 4F7MA 2PW2B 4NO0B 4JFFA 3MXWL 3RPIB 3DYMA 5LA0A 4Q9RH 4AZGA 4PG2A 2D03L 4NQSA 1C7TA 3VIHA 1QSEE 5DEGB 1J8HB 2MNUA 1BFOA 2X89D 4JKMA 2W60A 5EZIL 4P0DA 4MNJA 3U2SA 2A9ML 2P5EB 4ZFMA 4LSPL 5ICZB 3KYKH 4PJGF 3K7UA 1QWNA 2CGRL 1RHFA 3NACL 2UY5A 5CPQA 4JFOB 1WBYB 2HT4D 1QX1A 1J9CT 2DWEA 2VQ1A 3U7WL 1F6LL 2NPLX 4L8BB 4ODTL 1U8HB 4FZ8H 3D3VB 3PGDB 5FCUL 1VA9A 1SM3H 3CH1B 2B31A 3MNVB 3NZ8A 5ESAA 1T03L 3WQ5A 4P4KD 3C5SA 4H8HA 1MFCL 1PG7L 4QRSA 2QHRH 1GXEA 2X4UB 1AO7B 4PGJA 1ZKAA 3QXAB 1HKLL 2GTZB 3QFJD 3V8OA 1FYTD 4N0FB 4NYLA 4DZBB 1AQMA 3ARXA 3FO9A 1RIVL 1JZ5A 3PWVB 1B3VA 2Y8VA 1L7TL 3POCA 1ZVSB 2EC8A 5I66B 3RO8A 3AZSA 2ZPKH 3DX2A 4Z7VF 3LV3A 2WW5A 2G9HB 3FB5B 1IAKB 1HYSD 3ZHLA 2NY1D 3HZKA 4TOYL 4ELMF 3T0EA 5ANMB 4ACZA 2EDBA 4ETQA 3IGUA 1F3DH 3P4OA 1EEYA 3NCJL 4M48L 4BQBA 1M03A 1ZJAA 3WLWD 5DO2C 4YHYC 4ORZC 4UQDA 4A3YA 3RDTA 1RP9A 3VW3L 4JPWH 5K9KB 5GGRY 4FXGA 3D85D 3RWJB 1XR9A 2GJXB 4XH2B 1MFEH 1WB0A 4BH7B 5BS0D 2J8FA 1K4CA 4ALAH 5MEQA 3NN8A 2FO1A 1MFUA 4J28A 4JLRA 5CS7A 1FZJA 5DQDL 3L5HA 3KGRA 1UHVA 5C0BB 4MZ3A 2H1PL 1FZOB 2OSLA 3NACH 4I8DA 1WFOA 5HJ3B 5GS1A 4G5ZL 4LPCA 3VXTB 2VLRD 3GSVB 3NFSL 3OX8B 5GGRA 1V0MA 5FK9B 3LS4H 4HBCH 3SE4C 3UJJH 5E0FA 2WZHA 4L4JA 1CBGA 1FP9A 4GKSA 4PP2A 2H9GA 4CJ0A 2X4UA 1SYSA 1FZJB 2X42A 2CPUA 4RGOH 4YDLC 3P9MB 3PWNB 4OLYL 3O2VL 4YHZH 3AYSA 5I1JH 1HJUA 1OGTA 2N1KA 4AM0A 2WVSA 2D0GA 2VXVL 4M6MH 3RJXA 5GRYA 2YS4A 4J3VA 5IQ9A 3CUFA 2YZ8A 2OZ4H 1PY4A 4NQVB 4MQ7A 4WKFA 3PNWB 1Q72L 3EO1B 3MODL 3EOTL 2X9XA 4U1IB 1DN0A 4PB0L 1E0XA 3GO1H 5KSAC 4O58L 3HC0B 5JLZB 4FFYH 3AMLA 4JN1H 3TN0C 3H8NA 3U2SB 1UA6L 3IS0X 3G6AA 3OHXB 1U2CA 4IOFC 1A6AA 4H1LB 1DWHM 2XRAH 5HHOA 4YWGH 2OSXA 5A2CA 3KNBB 2FX9H 2VXTH 1A3RL 2A73B 1MCLA 4YE4L 4M43L 5IBUB 1AFVL 3QDGD 1BYBA 4M82A 3UR8A 2YOCA 4NN7B 3VXRB 4OF7A 4P2QB 3CSYA 1G9NL 4GQPH 3HUJF 4HZ7A 1YDPB 2WBJD 4ZSOA 2ZWYA 1MRDH 1CLYH 4MJ6B 5TDNA 3IFPA 3KLAB 1MAKA 3MV8D 1RI8A 2ZOXA 1P7KA 5MHSE 3I6GB 4D0BA 2C1OB 2NXZD 3CZEA 1T03H 2RGMA 4ZTPL 3H9ZA 3QULA 3V5KB 1OSZB 3JVGA 1FL3B 3EYUH 4XZUB 1Q6EA 3OZPA 4E5XA 4TXEA 3QUZA 4OT1L 4HKJB 4C57C 5KSUB 1WAWA 1F58L 2GIYA 1F4XL 1HXYA 1WCGA 3U7WH 3WBAA 1DBBH 3BVTA 2XI9A 5C0EB 4JHWL 1JXKA 3WH6A 1FZOA 4UV4H 3CHCA 2OJEB 1B0IA 2FO4A 4JQXA 1NGYA 4Q22A 4N0UE 5HYJA 5E9DE 4I3SH 1QSFE 5ITBL 3M1BA 1K3IA 3LPOA 3BGAA 1KTRL 3QHZL 4U05A 3QDMA 5DD0L 4CADA 4HWUA 1UWGL 3DRQA 3PWLB 4W6YB 4TULL 2H26A 5GSRA 4WU5A 3ARBA 5CP3H 1VJSA 2IAND 3DUUB 1PZ2A 3D39E 2R29L 5ADOH 4WFGE 2A3AA 3P0VH 5EZJB 5GGSY 2AQ2A 4KDVA 2E9WA 3CPLB 3QUZD 1WWAX 4GQ9H 3UTQA 5DZLA 3VX1A 3AQUA 2MTPA 1YYMH 4K3EH 5ABHA 5KS9A 1BAGA 1OIFA 2ADJB 3BDYH 3WNPA 2X5PA 1FO0B 3DJ9A 3O8XB 3PZMA 1GVYA 4HPOL 2BDNH 2C7UB 3HNTH 1N5YH 4PGEB 1CICC 1IKNC 1D5XB 2QR0A 1E56A 4KRTA 5IBTL 2X0YA 3UDWA 2F53D 3H2WA 1P4LB 4KFZC 1NBVH 2DICA 1SYVB 3BKML 3DMMD 3WELA 4LDOB 5C1MB 2KL6A 4R7NB 4ZD3L 3LRSA 3BPOB 4DGIH 5D70H 4ZDHA 4PJIE 2R1WB 4YHPA 4HZ8A 4JZ5A 3EGSA 3N1FC 1MW3A 4YX2H 2GFTA 1Y0LA 5JUEL 4LVHB 3EOYG 4XCNA 5EZLA 2GI7A 3CVIH 1K8DB 3U0TB 1BBDH 4I18C 1FLRH 2YN5A 1QFWI 4KGJA 3U5UA 4OT1H 3MCLH 4LSSL 1CD1A 2UVFA 3FB6B 1MCOL 1YECH 4UQCA 5FHAL 5DT7A 2ADGB 5ECJE 3UZVB 2YPLB 1D9KC 4PJ9B 5BRPA 1K8DA 3U0TA 2ZX9A 2J74A 1N5AB 3IAQA 4KQ4L 4D0CA 4PJAA 4KROB 4QHKI 2BHUA 4DN3L 4BH8A 5TDPA 3GXNA 4QEGA 3GBMH 4YFLI 1JG9A 1UG6A 1QNSA 5KSBA 2EO9A 2DGAA 1E1FA 4AMXA 1VJZA 3C8KB 3O4LD 1JTPA 2VOTA 3HR5B 2R0LL 3OJVC 3TN0B 1HZHL 4P9HH 3AB0B 4PPTA 1XR8B 4UI2A 1UJTA 2V9QA 5MENA 1XT5A 4PJBA 4ZAKA 1IGMH 3VCLA 5BXFA 2MPAH 4PR5B 4JZJA 4UNTA 4P9MH 3WMBA 3U1SL 4YEEA 4AZBA 3O8XA 1GOQA 4FQ2L 1Z6JT 4HLZH 4FXKA 5GNZA 2J8UA 3TPUA 3QO0B 4KVCH 4WO4B 6TAAA 5F1IB 4KMQA 3L7FA 1ZS8B 3D39D 4OFKA 3A22A 1K9FA 5CP7A 4CD7A 4DQOH 3QUZB 3QUXB 5KSVA 1OTTD 3UX9B 1Q0XL 1MI5E 3C60A 1OWRM 2RAMA 1BM3L 1S7UA 2ICWA 3LOWA 1A6VH 3QIBA 4XHJC 1SYVA 2FD6L 5EZJA 5HSFA 3S36H 5GJTH 3DUSA 5CMAA 3B4NA 5FUCC 2QSCL 3SPVA 4CU6A 4J3UA 4ZSOB 2VVNA 1BYDA 4F15B 2AJSH 1SJHB 2MKLC 4RZCB 2DT2A 2PWHA 4DVBA 5GS2D 1U8KB 3CUHA 3WF4A 5HHNB 2HFFB 4M4RA 1R5VB 3L6FB 3GXMA 2F9BT 5ENWB 2E9BA 4JM2A 3H9SA 4V2XA 3QI9A 4I9WD 2C3GA 1CICB 3HG1B 4N0YL 3RZCA 1W3KA 1ZANH 3K0WA 1HK6A 1MFDL 4RBPK 3EYQC 1Z9SA 4ZTOL 2CERA 3DGGA 3GNMH 5I1IL 1UZ8B 3FTGB 1J0ZA 2HT3D 4NQVA 4LDEB 1UKQA 1SBSH 1HSBB 3EDDA 4LIQE 1UD2A 1J1OL 3TH4T 3W9DB 1QLRB 4HUNB 1YEDA 4OTXH 3D3VD 4WVRA 4HZLA 3TN0D 4U2YA 2XJ7A 1S7VA 2GUYA 1EOMA 2G75A 4MJ5A 2VL4A 4UTFA 2DKSA 2FJHA 1OLLA 2AK4E 1ZGLA 3RVTC 2C7FA 2F5AH 4F37F 1T0PB 1RAMA 1R46A 5D9NA 1IT9H 4R0LC 1EUTA 4C4KT 1US2A 3VFGH 2XTLA 3WIFA 1PBYA 1FFRA 3FCTA 3WD5L 4HS3A 3EO0A 4B7LA 2R69H 4ZYKA 2MFNA 3S5ZA 3KPPA 5FCUH 3MMEB 1D5IL 3X3FL 1A1MB 3JWOC 1J8HD 3N9GH 3NCBB 1OAKL 4YXKL 3NN8B 4WW2F 1TR1A 1PS3A 4DZ8B 4LHUD 4XZBA 1KGCE 3J8F7 4JFEB 3WD4A 5JDSB 4MJ6A 2EDOA 1RMFH 2DQUL 3QG7H 1ISYA 3MV9B 3VWKD 2HVKA 1ZLWK 3LS4L 4HBCL 4M6AA 1RUPH 4K7PL 3BZFB 1A14H 2KUTA 4K9EH 4I4WB 4ZFZA 4D9RD 2ICEB 1OP5H 4MNGA 2OI9B 2XIIA 1N6VA 3S4SA 2PF0A 2GY7B 3QBTB 2NX5A 3FRPG 4XXCA 5L7XL 5DQDH 5AAWA 4YDJA 2EACA 2VC9A 5CPTA 2YRPA 2VAAA 5C08A 1VKXA 2IQAA 3KR3L 4TSCH 4EQ3A 2HTKC 4RMSA 2X4NB 4U1MA 4UDTB 4ONGH 3CK0L 4ONHB 3EDJA 3D18B 2DQCL 4P46C 1OP3H 1VFAB 4BQ9A 3O6AA 1MI5B 4R7DA 3Q1SL 2JELL 4JPWL 1ZT7B 3K80A 4NQDA 4DO4A 3O2WL 1ITCA 4H8WH 5C8JA 5FO9B 2WLZA 4MJ5B 2EIBA 1QBMH 2ZUQC 1QYGL 3LN5A 4I3GA 1ZBCA 4ZO6A 5JIWA 5IQ9B 2V2XA 4GAYA 4M8QA 1B3WA 5CJXC 5FHBH 4PJ5B 5F88B 3ILQD 1E6RA 1WZ1H 3IETB 4JFHD 5GGVL 4QF1B 4F8XA 1LL4A 5IW6B 2P44B 3T09A 5FK9A 4QHLA 2Q8XA 1A7RL 5I79A 4LLVB 2WP3O 3EJYD 5K33A 3RU8H 3W5MA 1F3RB 1R3LB 4BZ1L 2AEWA 5BS0B 1UENA 4Z7QE 2AJVH 3KL3A 4X5XB 4X0VA 3WD2A 2VAAB 5C08B 2W9DL 5DJCA 1QSED 1INDL 1RZJH 1ROWA 1UQSA 3ULVH 4ZFZB 1U8NB 5HYQA 3R8QA 3SCMD 5C07A 4P9HC 1GC1L 1MUJB 2W65B 3QPXL 1F42A 3GBNL 1W0YT 1PX3A 1T1XB 3TZVA 2ADFL 5F89B 3FFDB 2GVYA 4FLQA 5L8JB 5TE4L 3VO0A 3U7VA 2CNCA 1NWTA 4R4BA 1MCIA 5EBAA 5T1DH 2YD4A 4OZIB 4CKQA 4JRWA 4HQQL 2UZYB 4I0PD 4IMKC 2P8MB 4JFFD 4IIQA 5JUVA 3LMJH 4P7NA 3OIHA 1GHFL 1B0WA 1DBKL 3CDGB 3T65A 2VDNH 1G0CA 3A4XA 4Q9RL 1S7QA 3W4RA 3VD4A 4FQIH 1KBGH 1BAFH 1EGZA 1T1ZA 5DYOB 2EDFA 3SOBH 3GI9L 1ORQA 2PXYC 4NHCH 2VIRA 3MBXL 1A9BA 1YEDB 5D7LE 4PY8I 5E7FA 4C56E 3PGDA 2G41A 4FHBD 3X3GH 2B5IB 1J12A 1NGWB 2XWJB 4JFFB 3WFBL 4ODHH 1ZLVK 1DCLA 4JY5L 4ZUTB 2PR4L 3LKQB 5AWNH 5E8DL 3U46B 4E4PA 1FDLL 2XQBH 2G60H 1VCAA 5FGRA 2RCSL 5D1ZB 1I3UA 3MO1A 4FP8L 1JZ7A 1FZMB 3QI9B 3MREB 4WI2A 3S35L 2DDQL 3MOAL 5GISL 3F8UB 2UY3A 1DQMH 5DS8B 2A6JA 4NO2B 3RWGA 3MV7A 3SKJH 2N7AA 1KJMA 3MQIA 2PW2A 2VO5A 4YDLB 4PMQA 4NT6A 1MCHA 2CJUL 4UIMA 2JJUA 1XGRB 2YSSB 1I9RH 3RUGE 4RE3A 3CFCH 3HE7A 3D85A 1IJ9A 1ZLUH 2WIIA 2QQLH 4Q9QL 2IANE 2IPTL 2DH3A 1RZJC 3D9AH 3MCG1 2NY5H 2P5EE 4OIAA 1X5AA 4P4RA 1QI0A 1P4BL 5J4MA 5L2KD 1K9TA 3S8WA 5H2BA 4DN4L 5ECUA 1QHPA 2FYYA 1FG2B 2MCPL 5ERWB 1V3MA 4NOBA 1XCTA 4GMTL 3TWCH 1QR1A 4WFEE 5C08E 5I16B 4EDWH 4HIIA 4LPVA 2DQHH 4S2SB 3THML 5BXRA 5HYSA 4V2BA 1KNOA 3VXQA 2WVVB 4NN6B 3VE0A 3B8YA 4O00A 4P2RA 1H4PA 1A4KA 3OG4B 1XGQB 2OR8A 1M71B 4R0LA 4CBPA 1GOOA 5I6XC 1CK0L 1X5JA 3HB3C 3EFDH 5F96H 1ZAGA 4PJIB 1FGVL 4WJ5B 2KQMA 3PDDA 3V2AR 1UOKA 3O81A 2PTVA 1E28B 4H41A 3CVIL 3OPZH 4LBEB 5A8QA 4Y7MA 5EUOB 5F1NB 2Y6SC 5IHLB 1Q6FA 4J3OC 4M7LL 1UA3A 3AIWA 3FQNA 4LAQH 3LKQA 4WWKD 4EI6B 3FKUS 3HB3D 1FYTB 3KXFA 4YHOH 5DJ2A 4E8DA 1RJZA 1KOAA 5IVZB 3BUYA 3GMRA 1I1AA 2B4CC 1XHGA 1QKZH 4ORGA 3OQ3B 3VWJD 2XN1A 1P69B 1BQUA 1MEXL 2EC9U 3QUMB 4J4PA 4L9LB 4UTBL 2QQNH 5K9QI 3SCTA 3AI0A 1MHPH 5D5MB 1RU9H 5H8DA 2E5EA 5E03A 3LEVH 4JPVH 4OCMC 4Y16D 4JFFE 4UAOC 4AG4L 2CD0A 3EDFA 3WL1A 1UM5L 1CGXA 2CKBA 5FCZA 1R47A 2HG5A 3VOCA 1FL5B 4TVPD 3GMQA 2DL2A 5JA8B 2KPNA 1E6OL 3B9AA 1EJ6A 2CKRA 4J4PD 2BOBB 4QOKD 1UB6A 1YJDC 1J1XH 4JQXC 1EOKA 4OZHF 4QRUB 3TA3C 1HWWA 3H6JA 2BSSA 4EKJA 3TO4B 4K07A 3ZO9A 1FJ1A 3KXFD 4NQED 1IVLA 3FFDA 4KI5C 2ZCKL 4TUOB 3BN9C 4TULH 1Q6GA 1Q9KB 1C08B 2J5LC 2P4AB 4M1CD 1VB9A 3K8MA 4C54A 4ONHA 1OAQH 1Q4NX 5EU6B 1CDYA 4D6DA 1G9NC 3MNZB 4OGYH 1DUYB 1E6ZA 2E6PA 5D4YA 1FAKT 5ALCH 5JW5B 1CI5A 1NAMH 2NTFB 5GZOC 4X8XA 2WNWA 4KKAD 1MHEB 3REWB 1NC2A 4PJBE 2FRGP 4MAZA 1UFUA 3C6LB 3LIZL 4HFWB 1U2HA 1ODAA 3KPQA 1RZKL 2ZUTA 1RSFA 2HTLD 3PTMA 3IETA 5D1QD 1CDGA 4LVHC 2GK0B 3KDMB 3O6LL 1T5XB 1H3PH 3DX8B 4RA0C 4AM0B 3TJHC 4L8CB 4OV6F 5GQBA 2W67A 2F8OA 3HZYB 3HG1E 4NQEE 5TPWH 5HYJB 1S7RB 1RFDL 5CD3B 1S9XA 5FUOH 3B3IA 4PB9H 4ZUWB 2QPUA 4KC3B 5HNNA 2V5YA 1PFCA 2NW3B 5LA1A 1UD6A 1CL7L 1TZHB 5ABEA 4N1HB 5EU7C 3TIDB 4HS6A 5EIVA 2CO6B 1DWIM 3HUJB 5F9JA 2D73A 3HMWH 2HFTA 2Q8BH 3BZEA 3NCFB 3LEXA 4GBXA 3GSUB 3RTQD 3BLPX 4WU7A 4CGTA 1LDSA 5C0CE 3WH5A 4ZUUA 1A6PA 2EECA 2DQDH 2UWEA 3M8OL 2JELH 3TBVB 1D5BB 3MODH 1TA3B 1UD3A 3AB0C 2G5BB 3TEUA 4LX4A 3VD7A 1NBZA 1ADQA 3QPQC 1LL6A 3WO4B 4PGCA 4JREB 3UZQA 3BAEL 3O6KL 5GRVK 2ATPB 3UYOD 3OKMA 1CXFA 3FB5A 4EE9A 4U0RB 1Q94A 4JG0H 4EUPG 1U8KA 1F4AA 4M7LT 2XZAL 4PYGA 2VURA 1TIUA 1HIMH 4JL1A 3ROOB 2ZWLT 3W0WB 5JA9A 1KACB 1JL8A 2IPKA 4PTXA 3QXAA 1KTDB 3BUIA 1WWCA 3FT4A 4HIEB 4U6XB 3SPVB 1XSJA 4MTVA 1OARH 1XYFA 3BPNC 3D69A 4PUDA 2ALWA 4CVXA 4PTTB 3QJFB 4MJIA 3L3KA 3O4LA 3TNMA 2BNJA 3TIDA 4QHNB 1RZKC 1MXDA 5DVOA 4ZUVB 5I8KL 3G6AB 2E3ZA 1BZ9B 2PI6A 4Q9QH 3DSFH 4U33A 2XFRA 4BFIA 2QV4A 1CICD 3FQRA 5C8BB 3IT8D 3VIPA 4ZUWA 3S5LG 2OYLA 2DIEA 3OZOA 3TA3A 3QSKB 4NX0A 3MOBL 1JPGA 1QLFB 4OLXL 5JW4R 4LLYA 2MQ3A 3H55A 4XH2A 1NWRA 5MI0B 2MQCA 1J87A 2FGWH 3KXFB 3SDYL 1FHLA 4YNYA 2XZZA 4IMLB 4XB7A 1KIQB 3RDTD 4N0UA 4X7SH 4E41E 5HYJE 4LPXA 5AD0A 2EPOA 1JGEA 5TF1L 4JY5H 5HJ3A 2ERJC 5GS1B 3WFBH 4MVBD 1RH9A 1YEFL 4HK0A 1JVKA 3RWHB 1WIOA 1X4YA 4XX1G 3SIMA 1KB5H 5DFAA 4R97C 4EOWH 3GIVB 3QB7C 1M1SA 2H32A 4YZFF 1J5OL 2EDEA 3IDYC 3TO4D 4XBEH 5E08L 5I1AA 3NIDF 3I6LE 5IFHL 5BZDA 4X7TA 5EC1A 3MKKA 2ZX8A 1CLZH 1OAYL 1SEQL 3SDYH 3S36L 1CWVA 1XGUA 3UTPD 2BSSB 1MLCB 1N8ZA 1WEJL 4JAMB 4G7VH 5ICXA 4ZXLA 2O61B 4X6BB 3LMJL 1JNLL 1IAIL 2LTQB 1HX0A 3GHEL 1ISXA 3BAIA 2DLTA 4XHQA 2YL5A 3AMGA 1R24B 1WIUA 5JW4N 4H04A 2VAJA 2JJVA 4R2GB 3CHEA 3L3HA 3LRHA 4W5UA 4XB3A 4ETYA 4RMUA 3MUHL 3RGHA 2GSGB 2Y72A 3L3OB 5FM5M 3S5LA 3VXMA 2HRLA 2MQ0A 3SE4A 3PTKA 4L9LA 3TT1H 1CE1H 1UCBL 1HHJA 3O3BA 1H3UA 4LOUD 3BAJA 1RZJL 5J0BA 2JLLA 4C55A 3BSZL 2Y36H 3BX7C 4N0RA 5JHDD 3CV5A 2DS4A 4S1SL 4QLKA 5C0JB 3DHUA 2W61A 4IM4A 1DQQA 1LP9E 5DWUH 2ESVD 5KSAD 1KPUA 4N9OB 4YBQD 3UPCA 2FWOA 1KFWA 1QNOA 3Q5YA 2VN4A 5IB1A 4EVNB 1KXQE 4EI5B 5FGSA 3QUYD 3GH4A 1IC7L 3D0VA 5DI8B 1HJXA 1W1TA 4BQ5A 4YAQA 1U8LA 4PJFB 5IOPB 2FB4L 3WLBA 4M9PA 1N8ZB 1K4DA 3UTSE 5IIEA 35C8L 1CK0H 5C0RL 3QIWC 3EYFA 5IHUL 3BQUC 1N4XL 2WP3T 1UG9A 5D8JL 4LGXA 2DQCH 4KKLC 4FA8A 3NSNA 2J6EL 1GUVA 1I1FA 4ZD3H 5LGJB 3PHSA 1E28A 4LHJB 5DHXB 4NN7C 1AJ7L 3ZDXF 3MRIB 2PXYA 5I0ZA 3NBNA 5DT5A 3ET9F 3F7VB 2LQRA 1H41A 3ZLQC 1XFPA 2GK1B 2CDFB 1BP3B 3IF1B 2BSTA 3ARPA 4JKPH 1XEDA 5T5NG 5D8ZA 3NOIA 3B2UC 3CCHA 1RMFL 5DO2D 5T3ZH 5JOPD 3CFCL 4LOUC 3NIFF 4GI6A 3EBAA 5DRZB 1IGIL 1M7IA 3V95A 4LXFA 5JMOC 2C4XA 5IJVA 3O6FC 5DI8A 1R33A 3UG4A 5CPSA 2ID5A 4RNRA 3TP4A 3AREB 3B43A 1N2RB 3DXAD 3IDJA 4C83A 5GS0L 4V1DA 4J6RH 5CKGA 3MJ9L 3WF3A 3RFZC 1IEBB 3O9WD 4HLZG 1A6WH 3BH8B 3IANA 1OAQL 2VQTA 1EHAA 7TAAA 4K23H 3RAJH 1RZGB 5FB8B 1T2QH 5CIPH 3OF6A 3LN5B 1HHJB 2A0LC 3L3GA 4WV1A 1TITA 3GSRB 4C56A 2DMKA 1FIGL 1EXUB 4YGVA 3C8DA 5I1LB 1FZMA 3ARED 1XCQA 4OKVB 1ZA6B 3OWEA 1F4XH 1V0KA 1JN6B 5D72L 5DJXB 1G7HB 5F7DB 2YPVH 3CU1A 1I1XA 5SWSA 3EYUL 2EBNA 1IBGH 2X6MA 1FC2D 1IAOA 3IDXH 1AXIB 3LKSA 1AQKL 1IC5L 4N1CA 1I85A 2ZUSA 3TVMA 5BS0E 3II1A 2BMKB 3DARA 3L7EA 3IDGA 3O0RH 4HJJL 5EBLB 4X4YA 4AG4H 2AV1B 2IALA 4IEFB 3RWEB 2XN9E 2PUQT 1BQHA 2VERN 2XACC 5GJTL 3IKKA 5DUBA 3AC0A 3MLYL 1ZHKA 1F13A 1RK1A 4JPKL 5IF0B 4XXCC 3WFZA 2AP2A 2QSTA 1I1WA 1RZ7H 3T3ME 3IJHA 3OLGA 3FMGL 5D93B 1DVFC 4OLZH 3EMCA 3CBWA 3C6SB 4KY1L 3ULVC 4AL8H 5E2UH 1MFBH 2R4SL 2KZWA 3LH2L 4NQCD 5JXEA 2DBLH 3V6BR 4P5MA 4GINA 3QDME 5CBEB 3B8SA 2YWYA 3MBEA 3H7BA 5D7LB 5EU5A 2C3WA 3SKMA 1CDIA 1D9KB 4PJ9C 1HHHB 2X1QA 3VM5A 4HZLB 1NDMB 2Z91A 4KKLD 2HFEA 2VXVH 3W38A 3ZT5A 4G6AD 5A8NA 2X70A 4FS0A 4L8SC 1QI2A 4M8QB 2ZUVA 4NO5B 3X17A 1BGAA 2FR4A 1UWXH 3KLSA 1GOMA 3QUMH 2A6DB 3VGGA 3V4VH 3MLYH 4W4OC 4K7FB 5L8KB 4IS6B 1A2YB 1YNKL 3N0PB 2A1WL 3NFSH 1RIHL 4FF5A 3WQ6A 1RZIB 1FE8H 2WBKA 1UEMA 4NJAH 3SGKA 3LN4A 4JG1L 2HJKA 4LLVA 4LPUA 1ISVA 1W72H 3HG1A 3LKRB 3FN9A 1S9VA 4KJQD 1VERA 4L8DA 3ROLA 2IMMA 3IDXL 1FP8A 3I6KA 3OXSA 4K7FA 1FAIH 4PIRF 4DN4H 2AQ3A 2PW1B 1TQWA 4RGNC 2VI0A 1JTOA 2ICWJ 1OSPL 2GTWA 1HTYA 3HPLB 4L3EE 4GRWE 3MCLL 1C8PA 3S5YA 5L7XH 1HINH 4Z2IA 1IGTA 1B4RA 5FF6A 1BBDL 5D7IE 1JE6A 1IAMA 3T08A 4G8GB 5D6CB 4BKLB 4KPHH 1AO7A 1NCBH 4HU8A 4JREC 4ZFFA 1JAEA 5D1XA 4F7CB 3L5WB 2DQUH 3QG7L 5AAMA 1G01A 2H3NB 3DI3B 1F4WH 2BVQA 5C0GA 4XNXL 2R2EB 5C9JA 5DJYA 4ZEPA 3VH8B 3FNDA 3SCQA 1RV6X 3MCKA 2F58H 1KB9J 1IC4L 1MVFA 3QDHA 2X4OA 3EYOA 5T1LA 5IHRA 3VVGA 2FZ3A 2GJJA 3MR9A 4ERSH 1G5AA 3W0WE 3JTTA 3U7YL 3ZJ8A 1FH5H 3MV8E 2UWEE 4Z76A 5T33L 2NR6D 3O11B 4R96A 3WDQA 1ES0B 1E27B 3SDXB 4ZOEA 3T4AA 3CU7A 4K94L 4JRXB 3QIBC 3QR2A 1F6FB 2EIZB 4YN5A 2W63A 4GKLA 1YPZB 2RFXB 1IFHL 2CXGA 4F9PC 4YC2C 1J8HA 1ACYL 4AK1A 4AZIA 3H53A 3VFTB 4MX7A 2Q86B 1W32A 1Y6KR 2E3VA 4EDXA 1NGQL 2OMNA 5E56A 1VFBB 5SWZD 3ULVE 4EI5A 3I02B 4MNQD 1S9WB 3DO7B 3ULUE 4XHJD 3GNML 4LKXA 3O3EB 3MROA 1TJGH 1W9PA 3OAUL 3RZCD 1EO8L 1M04A 5T1LD 3BIBX 1DDHB 2J2ZA 3BHBA 5C2UB 4LCUA 2BNQE 4PJAE 3AIBA 1RUMH 4JDVA 3BGMB 3F62A 1GOIA 5E4EB 1T0OA 3DX7A 4Q2ZA 3U4EB 5F71A 1C92A 3GNOA 5E2VL 1UM5H 2P5WA 4Y4FC 4KZDH 4MXQC 3ZTNH 1HL9A 2A2QT 3WFHA 2Y25A 2ATKA 4GS7B 1ESWA 2A0LD 3Q5TA 3V4VL 2NNAB 4X9HA 4P5KB 1G9HA 4S0SD 3EJRA 3MLVL 1NWUA 1KPVB 2ESVB 5KSAB 5T3XH 1RP8A 4XTRC 1ETZB 1W1YA 3MUAA 4XCCH 3PWPD 5CINH 5FUZH 3U30B 1REIA 3MRFA 3LCYA 5C6TH 3W29A 4XC3L 3G5VB 2SEBB 1MH5A 2BNQD 4JGUA 3ZE2F 1X44A 3PL6D 1G1CA 5DUPH 4L4TB 1CFVL 1I7TA 2AEPL 2XKUA 2OW6A 1ISZA 2DKMA 5E2UL 3FQXB 1P7QD 4AYSA 1KPVA 4FXLA 4KHXH 4X0KA 3SDDA 3VFPA 1YMHB 3Q6FB 1FGVH 1DDHA 3BHBB 4M7ZC 1UYQA 5LWYL 1BVKB 2X4RA 5TDPB 4PB0H 4IOIB 4WO4A 1J11A 5L8LB 1YEEL 4G9DB 1UADC 3RIAF 3I02A 1WT5C 1CCZA 3EZJB 2NY6B 1BZ7A 3B9KD 2OTUA 5FIEA 3BOVA 4POZD 2NZ9C 5IIEB 4XX6A 5B8CA 4K9EC 4X6EA 4XCEB 3MGOB 5GRUL 1R0AH 5FYLL 2APFA 5CILL 4AQ1B 1A9BB 2ZKHL 1HL8A 2Z4QA 4LLQA 5E7BA 2XWDA 2J78A 1QR4A 4K7PH 4TN9A 4AT6A 4OGAC 4LP5A 4PGZA 4U31A 3SUWA 1DWJM 3W6MA 4HKZA 1JRHL 3VXME 1QOXA 5I8OH 2E27L 4HUXB 5EIIA 2DAVA 2X4OB 5T1LB 2V3DA 2XVGA 4AD2A 3V9FA 5HI4D 1R3KA 3MLZH 4S1DC 4OIIL 4KJYA 5A6LA 3N04A 5ITFB 4PJHE 2I07B 3D2UD 4H20L 4OV5A 1U33A 3PP3H 1W2PA 1ONQB 1WF5A 3FT2A 5ILTL 2VDOL 3HLAB 4M24A 3IJ9A 2VDOH 5E1QA 1A22B 5I1KH 2DM2A 2ED8A 3VIMA 2CKNA 3W2DL 2JK5A 4JFXB 4DCQA 3VDBA 1NARA 1U8OB 2VXSH 1KLUB 1NBQA 5KEZA 1IGCL 1MRCL 4KVNL 4H1LA 4Y2DC 1QNZH 4NWTL 3ZYZA 1SY6A 5I1IH 1YEGH 1PGRB 1G7JB 5AY7A 2Z1SA 1YY8A 1V3KA 3W5NA 4GQQA 1CE6A 3WHE0 1FBIL 4WUUB 3S37X 3VXUD 2P7TA 4KPHL 2F1AA 3D51A 2EPLX 2ICWI 1HT6A 5I8KH 4QF1A 2YL8A 12E8H 1E4KC 2NXZB 4N9GB 2Q6WB 1HNYA 5JHDE 1FVCB 1M6OA 1T7VA 5BW7A 1IGTB 3FJTA 5CP3A 3QHZH 4NQCE 1ZEAL 2VR5A 3P9WB 4P5TD 5TJWK 5EO0A 3EAKA 3I50H 5CAYB 3TBWA 2X4PB 1W72L 2AJSL 4PTMA 1I3RB 1RULH 3NDZA 4NQDB 4L8DB 2C9AA 1AI1H 1R75A 2ITDA 3SJVB 4UV4L 5E8PA 3SGJC 3EBVA 2A9MH 3LQZA 5EORH 3OA5A 4UQ3B 2AERT 1ZBWA 1FCCA 1BPVA 5I1HH 1XGPB 1IZJA 1EK3A 3GMNB 4LASL 4BSWB 3GUTA 3P2TA 4HUKB 4F9JA 5DJ8A 1LG2A 1OW0A 3ECBA 1I1YA 3LRMA 3O6KH 1QFWH 4P2RE 3PP3K 2HMID 4XNUH 3WS6A 1RJYB 3GBLA 5BYWA 1EO5A 3WS3A 5B38A 1H3XA 4FLSA 1CFVH 3QCTL 3TV3H 5GGTA 4A6YA 5KN5B 5BJTA 1J8HE 4KZEL 4F7EB 4MPKA 3S88H 2R0KL 1R7AA 3TYFA 2A73A 2VLKA 1KT2A 1ULVA 4HKBA 1K9EA 1I8LA 4ONFH 5CQ1A 3C6SA 3UYRL 5B38G 3MV8A 3TNMB 2WMPA 2P8PA 4YHLH 1ED3B 5ESVB 1UEYA 4GW1A 4Y5YA 2GKIA 1BIHA 3IKCB 3BUBA 3RM8A 4J1UB 4MJ4A 2GJZA 3SE9L 4XMLH 1MVUA 1XIWD 1UKTA 2IBZX 2R0KH 4JO3H 3GSRA 1YYLH 4NUJB 4RMRA 4Y16A 2XVNA 1NFIB 1LE5B 4KTEL 2Z9TA 1E4WL 3QA3A 2EDWA 3IYLW 4UMGA 1CZ8H 3M46A 1GOHA 2DF3A 3W9DA 4ZXBB 2PBGA 5F6IC 1OHQA 1SMDA 2QTEA 1ZWIB 5FV2A 1T21A 3KLKA 2O9OA 4OLYH 4YHZL 2WWCA 3BP6A 4WEUD 4F15C 1S9VB 5DVKA 3CSGA 4K9EL 1UWEH 4PP1D 4W70A 2BFVL 4YIQA 3RZCB 3ES6A 4AJ0A 4POYA 1T83A 5TQ0H 1UM4H 1W9BM 4YHIA 4NC0B 3I3BA 3WSUA 5IKCA 2F8XC 4ZUUB 4UCFA 3RUGA 5J8OA 3CX2A 1A7NH 2EDYA 3MJ9H 4WI6A 1RK0B 3A6BH 3IGAB 4U4BA 4JN2A 4PFEA 3BZEB 3QDGE 4Z7VA 3HC4L 1FO0H 1NCDH 5CIPB 3EMQA 4Q58C 1B0RB 1CGVA 2CBIA 3DVGA 2XGIA 1C3FA 4H7VA 5DRNB 1VACB 4QTIH 3VIKA 1B2YA 1LP9B 3VIIA 3QIBB 2ICWB 1T1YB 1LVEA 3E6HA 4LGSB 4D9RE 1TQSA 1CTOA 4DUXA 4IRZL 4MCZB 4ZPTA 1OB1A 3RZWA 4OGAD 3UTSB 3X14B 2F8QA 2PO6C 1KXTB 2ZXBA 2D31B 5DFVD 3TVMC 1RIUL 3W2DH 3PIQB 3RGVC 3GJEB 3MMUA 2B2XH 3DTXA 3IDNA 4J8RB 1BFSA 4ZAKB 1KLFA 1IGYA 4POZC 4QRSB 2XYLA 3AVEA 4LVNB 5A43C 1U30A 3LXBA 5EPMA 1MHCB 3D4YA 4CVZB 2E8YA 3NABH 3D50A 2D7TH 5C09A 4M81A 1NBYB 3GK8L 3ZT7A 3SUUA 1EVTC 1LILA 2D7OA 4NDMA 4OJFL 4EBQL 4QXTA 1KN2L 5IG7B 4ZYKB 4NGHH 3HFML 2Z8WC 5GPRA 3A23A 2W59A 2E27H 4GAGL 3LS5H 1JRHH 1JWUA 4F7TB 3L95A 4XBPA 5JW4Q 3MRNA 2VX6A 1F90H 4M1DH 1URLA 3KPRB 4X6DA 1BFVH 1F58H 4N90D 5DMJB 5BQ7A 2YPLA 3HE6C 4D0DA 5HTSA 1QNRA 3MV7B 4GS7C 3CHFA 2AEQL 3VFRA 5DF0A 3D2UB 4PRPA 1N0LA 5E0CA 4PRPE 4FQQB 3BCDA 5I1EL 3FT3B 4KI5E 1R5WB 2GJ6A 3TH3T 3PABB 2XYCA 4OLVL 5FYKL 3HCVA 4XP6L 4ELKB 3W24A 3HKFA 1OTTC 3UAJD 3NDYA 5DQJB 3RI5F 4BA0A 5LWYH 2EIEA 4MXQD 4XPHL 4WFFE 2J3SA 4AZCA 3L3JB 1YEHH 2EDHA 1WAAA 5HHMB 3KPNA 1UCBH 2Q8BL 1HI6B 2VKWA 4TUJA 3MRRB 4WSKA 2XPGA 1XSIA 2VLME 1OM3L 3IK2A 1H3VA 4DFHA 5JXED 3GNPA 1EFXA 1RURL 4OZFB 2EYTB 3BQUA 4U7MA 4P5TC 3T2NH 1KN4L 1MWAA 4XMKH 1RFDH 2Q76B 4KK6D 1UJ3C 3E8UH 1C5BH 3MOAH 5GISH 3SKNB 1CGWA 3X13B 3ZE1E 3CVHA 1KB3A 1UWSA 3UJJL 2FATH 3IVKA 5MENE 1BTCA 5HD8C 1EEZB 1AGDA 4FQJH 4L5FL 3UPRB 4N0CC 4X7TB 1S46A 4FQXC 4PBXA 5IB5A 5JPNB 4HIJB 4BSVA 2OXGA 3OLIA 5B22A 3M17B 2ZSVB 4YDVB 3C08L 1AD0B 3K1DA 4P7LA 4ZO7A 4R6UA 2Y2WA 1B0GB 4BQCA 1NGYB 1LEKB 4Z7UB 4OFVA 3FO1A 4LMQE 1IV8A 1JK8A 1UR8A 1JGUL 2DLFL 1RJCA 3BRFA 2GAZB 4X4MA 3CDYA 1ZLSH 3UJTH 2YUZA 4MDIB 3VXSE 3LMYA 3VXSA 5BV7L 5DXWA 3BGFC 4KK8D 3L3KB 3L4TA 1YEJH 4MYWB 5FM5O 4QRQA 1KPRA 3N17A 2ADGA 1QLEH 3W28A 2D0HA 4DK6A 4GRLD 4NO2A 3RWGB 3OGCA 5TDNB 1FORL 5TE7H 3SGJA 5IM7A 3CNKA 4R3SB 5CEZE 4QDMA 1ND0A 2I5YH 4M8UA 1K5NA 1GJWA 3LRGA 3F7QA 4K94H 3VRLE 2YPLE 1MJJA 5T1MA 2E7HA 5HGHB 4JKPL 3JUZA 3CGTA 3PE9A 4GOSA 1VFFA 4GRLA 5BW7C 2Q7NA 3ZIZA 3WN6A 4TTGA 1EHNA 2ZUWA 2LFGA 5C0ND 3U9UA 3UPAA 4WFHE 2AJZA 3BP5B 4UQBA 3A6BL 4KI1A 4MDPA 4ZFGH 1D6EB 3CZJA 4L4VA 2XPKA 5AC5A 3SDAD 3HG5A 3RU8L 3O2DA 3ZYJA 5BJTB 3QXDB 5HHME 3QEGL 1FNSL 5M95B 2D7NA 4FQHB 3GSXA 4R96B 2IQ9H 4LEOB 2VKXA 4M7JL 3WF2A 4XI5D 3L3IA 1TZGH 1ZK9A 2IJ0C 3GUTB 1AY1H 1KSRA 1PZ5A 5EOTA 4UU9B 3ARWA 4X9IA 3I3EA 2NY0B 3CPLA 4UQ3A 3UTQB 1EDQA 3PL6C 5C9JB 3PP4H 4U6TA 1H0DA 4NQTA 4HS8L 4F3FA 3Q1SH 1HNGA 2G5BA 1ZGLB 2XSAA 3ARGC 2DT1A 2C3XA 4FQ1H 5HDLA 1QSFA 1HSAA 3LRKA 5F3BB 5CIPA 2XTJE 1J1PH 1DQJA 1TQVA 2OYMA 1U8NA 5HYQB 4WU7B 3ZSSA 4FQLL 2YBUA 4GW4B 5BO1L 3ZKNC 4NZRL 5DFWH 1A8JH 1YY9D 2WBJA 4I0PC 4U1JB 2VRQA 2K9UA 1XRVA 2NY5L 1A0QH 3VFOB 1FQ9C 1MSPA 4GO8A 3DHJA 5I2UA 2J12B 1N64L 3ARQA 4XX1E 1I9RL 1F11B 2G2RB 3LH2H 4P2OB 1QTYT 4KQ3L 2AV7B 5I74B 1E4JA 2DOCA 3VFVA 1ZHNB 4G9FB 1ZB5A 1P7QB 2VNCA 4P7RA 3QJFA 4NSBA 1E4IA 2IH1B 2CMRL 1J0HA 3RA7L 3GXTA 4NQDD 4JFZH 2NXYB 4XVUC 1V3HA 2F19H 4G7VL 4YUEH 3FT4B 4U6XA 4LLAA 3BSGA 2DJ4A 3MRGA 2RCSH 3EJYC 1IMHC 4F9DA 3T0BA 4U3HA 1AP2B 3HZVB 4P7OA 4AEFA 5EZOH 1T7YA 1NCUA 3DMMB 1ZEAH 4GXVL 1A6AB 4MS8C 1FPTL 3VFSA 2ARJQ 2APBA 1R34A 4OQ1A 5HHPB 2WUCH 2F53A 1A4JB 2ZCKH 4JQVA 5C0CA 4LHUA 1UKPA 4ZPVB 5D1QB 1QFWM 3OL2A 1CLCA 1DANT 1T0MA 1JDCA 4MNKA 2X4TA 5IEHA 2FX7L 1UWXK 4FZEL 3WFEH 2EYRB 4TOYH 3FFCA 2OTUB 4ZE4A 2Y5TA 4F7MB 4KRLB 5AC4A 3SY0B 1I7ZA 4JFDA 4G42A 4Y88A 5IEKB 2RGSA 5GS0H 1UXWA 4WFED 5EC2B 3TJEH 3C8HA 1ZSDB 5F8RC 2IMNA 4OZIF 5DD6A 4W87A 1NFDA 2HJFB 5A3IC 4D0CB 1I9IH 4M6NH 3V4PH 1UD4A 4PLKD 3FO1B 4FLOA 3CDFA 3CHDA 3OJDA 5FIPA 1JBJA 4EEEA 3BP7B 4M29A 5EO0B 4DQOL 4XNMA 2J47A 4H0IA 4K2UH 1QI3A 1T89A 5I71C 1NMBH 4WUKH 4HTYA 5A16A 2UY4A 3VXQB 2WVVA 5JPNA 4QWWD 4TRPH 4UT7H 4EN3B 4JKKA 4LRIA 1MCPL 1U58B 1GZQB 2J4WL 5EWIH 4CMMA 4PJGB 2BK8A 3BRGC 1B3XA 3DX6A 1JHKL 2DQGL 4JG0L 2IG2L 1NSNL 3BKJH 3DNKA 2LE9A 4I0PB 3NTCH 2QJDA 1GGBL 4G9FD 5ENWA 1OD9A 5E94B 4MDOA 4F57L 3KPOA 1E6JH 4LQFL 3MXWH 2V6HA 5GRWA 1KR1A 1UGNA 3NFPA 1ZLSL 1ZT1A 2DQIH 2ZIDA 5SX4H 4J27A 4DGYH 1KJVB 1F02I 1TVHA 1D5MB 1A7BA 2DM7A 3C60D 4BZYA 3SE3A 2VH5L 4QHMA 4PJCB 1YA5A 1XCTB 3CVHB 4I18B 3S7GA 1H0IA 1A3LH 5D1XC 5D7KE 4C83B 2FSEA 3ARFD 3D52A 1IC7H 2X7LB 3A5VA 2HG5B 3G5XA 4FNRA 3HI5L 1CQYA 1FNSH 4PRHE 1MXGA 4P7QA 1TDQA 5H35A 1WT5A 3WN5A 4GXUN 4JR9H 2J6EA 5D70L 4Z8FL 2CH8A 2OL3L 4RDQF 4PRPB 3BWAA 5C0NC 1DQLL 1TZ7A 2EAEA 5HHOD 4OM1H 1VDGA 3KWWA 4XTRD 3LAFA 1Q1JL 5JW3H 2R69L 5A6BA 2VUOA 4LYRA 5JDJA 2XQBL 2BDNL 2XY1A 5D1ZA 4I48A 1YHTA 4OD1H 3RPKA 3BDYL 3EOAB 5E5MB 3H54A 3PWJA 1KF9B 5EC2A 3QI9D 5C0JA 1YEHL 4NQUA 2EDDA 1QEWB 1R3JA 1A5FL 1OP5K 4WSJA 3EMZA 4LLWA 2Y24A 4PJIA 1NGWA 5JXAH 3WD0A 1KYOJ 5EBMB 4H8UA 4ODVH 4R4FH 1ITBB 5IBLD 4QAWA 3VWKB 4XP6H 2WPGA 1JFHA 4HKXA 4WW2C 3DI2B 5HI5D 3GMPB 3CFKA 1MUJA 2W65A 1G0XA 4U7KA 4PJDF 4B9YA 1T22B 2MOVA 2OCFD 2UYLB 3O6FD 2GTWB 3HTLX 4MQXD 4MZ2A 3E0GA 4AIEA 1TVBB 2Y9RT 5CSZA 3U4BL 2D31A 1KJ2A 1LK2B 1U8IB 1KXQA 2D4FA 3DOSA 5FO7A 5GRJH 1SVZA 1WTLA 3NCEB 4LFHD 2LU3A 4GAFB 4QOKB 1B30A 5M5DA 1ZU8A 2ZUNA 3PZGA 2CKBL 3C9NA 3BH9A 1LO4L 1JJUA 1N59A 4LQ1A 4QHLB 3HE7B 4OB5L 2HKHL 5E0QA 4JPVL 4E0RB 1D6VH 4JO1L 5JNYB 3RWDA 1W72A 1UA7A 1X3DA 1C16B 4MNLA 4XWOC 4WHTB 1W0WA 4HC1H 4PRBB 1X7QA 4G6FD 4HMDA 1I1CA 4PV9B 4HA4A 1EBAA 3V4PL 1JMXA 1CLYL 3FB7B 4EANA 4BQ3A 1MRDL 1I9IL 3FHAA 4U1HA 3DROA 1EHXA 4S1DD 1HE7A 2BNQA 5ISZD 4PJ8B 1Y6MR 4PRAA 3UBXA 1NFDB 2HJFA 4JM4L 4LPWA 5BRZD 1G9ML 3K8LA 5FEBA 2BNRE 4G6ML 4HHAA 1OGAB 4G42B 3ARBB 3U9PL 3V7AG 3DVNA 3K81A 3QUYA 4GW4A 2Y7QB 5SWSD 1GOWA 4HCRA 1N0XH 4YK4B 1BQCA 5BRZA 1A7OL 4K3DH 4DUVA 5IKCB 4HJGB 4MLSA 2KZ1B 1HHHA 4EN3A 4I5BB 1CLXA 1XD0A 3P3YA 4NRZA 3NSXA 2L7UA 3NGBB 4ONGL 5J89A 1MHHA 1UCTA 1FPTH 1GONA 1D9KD 3TZVC 3E1F1 4K71B 3HNVH 5CXPA 5C3TA 3KZSA 1OAUL 1S7TB 3D39B 4HK0B 3RWHA 4S0TD 1NCAL 3TGXA 3AMDA 3LEYH 1PVHA 2FE0A 4X6CF 4NP4H 4HJ0D 3R4DA 2WKGA 1J05B 1H1NA 3WEMA 3WEOA 3RKDD 4QRRA 4NFBA 4MNGB 5C0BD 1RHHB 3EJTA 5EH1A 4LVOC 5D7JB 5C07E 3BUPA 1HXKA 3GSNL 2G75B 2HVKB 3BW9A 1EXPA 2Z31A 2ARJB 4DEPB 2C3VB 4RGNB 3QOMA 2BRRH 2Y7QA 5KAQF 3LPFA 1Q94B 4OI8A 1EDTA 1DEEA 3WY4A 3W0KA 1BJ1H 1P7QA 3BEVA 5E8NA 5I15L 4WGWB 5ID1A 4KTEH 2WQ8A 2NY4C 3MMEA 5EU6E 5I8EA 5ABFB 3VFGL 2DLEA 3OAYH 2AK4A 5EUKA 1R3LA 3MS8A 1YN7A 5DK0B 3VINA 2HJKB 3TT3H 4RNRB 1VF8A 2I60H 3SE9H 1R8LA 2HRPL 3SUSA 3APGA 5GRXG 4Y4HA 4JFTA 2F2HA 1YEKL 3VGBA 4FQLH 5DEFA 2FLBT 4MJIB 1S7VB 3F5WB 1F2XK 6FABL 4LL9A 3MSDA 1AGCA 5L0QB 2DWDB 5HDBF 4GW5B 1M6OB 3FO2A 1HF6A 5IB2B 1E4LA 3TA3D 3U0PA 4AY0A 3QNYB 4PD4K 1HKLH 4FNLH 4OCNC 3RVXD 5I74C 4F3FB 1FHGA 4HWBH 3BVNA 1N3NB 3JWDL 4AC1X 3UCRA 1VFAA 2PXYB 1LQSR 4PRIA 2PTUA 3OGVA 5DRXB 1UQYA 2CPCA 4Y89A 5A2LH 5MEPA 4S3KA 4DKDC 1PZ5B 5EOTB 5B3JF 5EO1A 3FN0H 1S9KC 4UFLA 4FG6D 4NBXB 5CFHA 4ML4A 3QO0A 1OGAE 5EIQA 3L3IB 1VIWA 3KPSE 2P5ED 2IWGA 4KUZL 4E2OA 32C2B 2V5CA 2AJXH 1U3JA 4UZGA 4UB0L 2Z0BA 3L4VA 4I0CC 5FKYA 3ALPA 4OLWH 1QRNA 3F5JA 4C58B 1RUKL 2GCYA 5A3HA 4YHKH 3SGDI 1JMZA 1UWEL 1AGDB 4LKCA 2YD6A 3DUSB 1CE6B 1LDPL 2CR3A 2V3FA 4NSKB 4W86A 1TCMA 1QA9B 4F8TA 3EJJX 1OWQA 3MNZA 3QCVL 1CNVA 5D1QC 1EIBA 3H3PH 1E6OH 4LSDA 3RGVA 1R7OA 1V6YA 1CT8B 4LNRB 2GFBB 4NQCA 1BFTA 2VT0A 1JHLH 2R0ZH 2HVJA 3KWWB 2VB5A 1M53A 2DIJA 5F44A 3RVVD 5EBMA 2VLKD 4K7PX 1JCKA 1J01A 1B2WL 1JNNL 3C5JB 1KLGB 5I73C 3KDMA 3MC0A 3HN3A 1XGYL 4RFOL 2DT3A 3WNMA 5IMOA 5JNYA 1ODUA 2J79A 4JFUA 4YXLL 2XXMB 3PWJB 1YN6B 4XRCB 2CLRB 1VBUA 4HH8A 2AK1L 4HXBL 4NKDA 3GO1L 4PGBB 4DKFL 4YHYB 4PTUA 4HOZA 3WIJA 3L2LA 2EDLA 1B1YA 4M7LH 4PN2A 1GGUA 3JWOH 2NY6D 5F7YC 5I15H 4TYUA 4LAJH 5IMOB 4YDIL 1NEUA 3KHOA 1MF2L 3M45A 2WZPD 2XN9D 4L1DA 4ZQKA 2FB4H 3CMOL 4AZ8A 5CWSB 3DURA 4PJEA 1FZKB 2CSPA 2XKNA 3K4ZA 2VITB 1T83C 3CMJA 2W07A 1SY6H 3BUDA 3U4AA 2DTSA 3BVVA 4NXKA 3RL2B 5D9OA 3UPRA 2X4QB 1QI4A 3LB6D 5DMKB 5C0FA 4W88A 1X5LA 3D5HA 3AXIA 3CZLA 1DE4A 2O26U 2CHOA 4BF7A 2VITA 1U95B 2CBUA 3F7VA 5IG7A 1H2JA 2QMJA 2J7DA 5E94A 3B2VH 4JZOA 3EW3B 3HRPA 2NYYD 1CGYA 1JV5A 3WENA 4CMHB 1WQVT 3MANA 3OGRA 5A6KA 1P4BH 1X5GA 4Y4KA 4TVPE 2J8UB 4JGJA 4PTUB 3D9AL 5DRWA 3BXWA 4Y5YC 5D2NC 4L4TD 3WJLA 1INQA 3VJ6B 2WINA 5C6WH 4J8RA 1QVOA 1E1EA 3ME0A 1NOUA 5KJRL 1BG4A 1FHDA 4PJEB 4I0KA 2OR9H 5EOQL 4JDTH 3AFLA 2XNAB 5EUOE 4HV8A 3S35H 4G6MH 3CUJA 3VRIB 1P5UA 2I9LB 3DV6A 3JTSB 3BT2L 2VDPL 3MRJA 2B5IC 1KXVC 4ZTOH 4XCCL 4L9LC 4WW2B 1W2KT 4XPAL 1D3CA 1YN6A 4XRCA 3SCNA 5DC0A 4NWUH 4Z78B 3FOLA 2DQFB 5E9DA 3GSNB 4HP5A 1KCKA 1H9VA 2IAMD 4R4ND 4MCYA 5E8EA 1NEZA 2NY1C 1AGCB 3CD4A 2F74B 1P7KB 2CLZA 1E0OB 2IXUA 3FW6A 3GRWH 4IRSD 3LKPA 1INEH 3RI5K 3G5VA 3W0WA 1WNOA 3MO1B 3MRRA 2FL5B 3IDIB 1EA9C 8A3HA 2YD8A 4QFUA 2CKBH 5BVPL 2P5WD 2V7NB 5SWSE 1OPGL 1WO2A 3RTQA 4HU0A 1BJ8A 2GT9A 4KUCF 3TF7C 3OF6D 5F7UA 2V7HA 2FD6H 2YD9A 1C90A 4NFDA 4RAUB 2CDGB 1A7PH 3EYVB 5ESQB 1QFOA 5GRUH 2DJSA 1NCNA 2W91A 3QULB 4XMKL 4QO1A 5GGUB 2Q8AH 3QJHA 4JGMA 4W8BA 1G7PB 1TJGL 4YPGA 5T1DL 3W25A 4AENB 5IMLA 1NAMB 1S5HB 2XA3A 4RQQA 5CD5D 3SURA 3LZFL 5D5MF 3FT3A 4ZFFB 2EO1A 1UWRA 5E2TL 4D6JA 1NDGB 3BZ4A 2IPKB 1NGQH 3PDOA 5E8OA 3QPXH 1GC1H 2DWDA 4S1RH 5DFTA 1K6AA 4N8CL 3CH9A 2WHLA 3GSWB 4X80H 5FYJL 2F7PA 4ZE5A 2Z93B 4NCDA 1UA6H 1PZUB 3C09C 4NBYB 2W0FB 1XAUA 3PUCA 2DQJL 1KENL 4GPNA 4X6CA 4NM4L 3FOMA 4GLRI 3TONA 3RGVB 4AD1A 3F58L 8FABA 2UUDH 3GBML 4DO5A 1PX8A 1U0QA 1NUDA 1F3JA 1T1WA 4M00A 4O5LL 4TVPH 3UMTA 5CD3A 4ATWA 2CESA 4HGWA 2ADIB 3NCCB 1BVLA 2YPLD 4ISVA 4F9LA 4KKBC 1QFHA 5L88L 3HZMB 4ODUA 1G0DA 4CUCA 2JF7A 1VAHA 3SN6N 1C12B 2XG5A 3GMNA 4BSWA 2F7QA 3MBED 2WCAA 2UY6A 4I2XA 3B9EA 3AICA 3MBEB 5T5FH 1S7SB 3G08A 4UDUB 1NP0A 1AGBB 3TBYB 4HC1A 1GJUA 2IFFH 1GCYA 4XVTH 5F6IB 3AY4C 2G3MA 1KN2H 1KIRB 2VR9A 2R2HA 4DGIL 2XG9A 3N15A 1KTLA 4OM0L 1G7IA 1GGYA 2GUOB 1DQJB 2CHNA 1KELL 2CRIA 3KVQA 1LE9B 2MWCA 3OTTA 1PJ9A 4OIFA 5D8WA 4OUUA 2YJQA 3OAUH 1ZA3A 4FMVA 4DO6A 3N1PC 1E6JL 4HX1B 1G7PA 4YPGB 2EH8H 3FAWA 2VSDA 3NAAH 4V2CB 1ADQH 2XHYA 1J10A 4KMLB 1JNNH 5AYUL 1SMOA 3NTCL 1TPXB 2AJZB 3BP5A 4TVUA 5FOOA 4JZNB 4PJGE 2C4FT 4PYSA 1LK2A 4P2OA 4LLDB 1JHLL 5DA4A 1QNPA 2EPKX 4XNZC 1US3A 5E1AB 1WP6A 4AISA 3PJSB 1C8XA 4L3CB 5EN2A 1MFCH 1PG7H 4HUUB 4U1HB 1I8KB 4GKNB 5JOFB 1T2XA 2PYEE 3NIFE 4RIRB 3ZT6A 1KXVA 1DEEB 4UQAA 4LCWE 2XV6B 1FVDB 2EDNA 4PLOB 1FOBA 2ADIA 1GORA 2Z91B 2JIWA 3WH8A 3MLSH 1XCXA 2CUHA 1IM9A 4O51B 3V6OE 5E2TH 4LF3B 1V0NA 4OLWL 4RCAA 3PXHA 3VXNB 1DLFH 1LO3L 2OSLB 4GJTB 3I50L 1L7IH 1IBGL 4RRPA 4JFYA 4X6CE 1PKQA 1HKMA 1L4IA 2F74A 5HI5C 5J1AB 5I9QB 2OR7A 3G9AB 3S37H 3W26A 4MD5A 4AQOA 3Q6GH 3STLA 4FNQA 2DSUA 5CSBA 1FN4B 1GGTA 4ODWA 5KW9L 1FFPA 1FNGB 3ZOAA 1T04A 1MHPL 2DQXA 3F12A 2CYGA 4D8PA 1X5HA 4UTBH 1IGCH 3UJIL 4W8AA 2EZ0D 4X6DF 4X5WA 5C09D 5CSZB 3BESR 3AAZB 5HHNA 1QBAA 3QP3A 3RHWF 4OJYA 5CEXB 2GSIB 2YDSA 3PG2A 5KS9F 3VG9C 3RPMA 5F93C 5BWFA 3QDGA 4Z7VE 4Z2GA 4EUPA 3QDJD 1KJVA 2M1KA 1HXMA 5CZVL 2XUCA 2ZX7A 4GSDL 2NY0C 2X4SA 5IMMB 1QR1B 2PB1A 1IEBA 2P47B 1Z5LB 1G6RB 5I77A 4DW2L 2IGFH 2XT1B 2CDEB 2P46B 4QXGH 2F54D 2X10A 3RWFA 4I9WE 43CAB 4N5UA 1JPSH 4MA7H 4JY6A 2HVMA 4MAUL 4TTDC 2EH8L 1P6WA 3VIOA 2XVPA 3GHBH 5EORL 2BCKA 2DIBA 3GGWA 5KVDL 5EO9A 2NY2B 1OF2A 4GKOA 3VCLB 2DYPB 1AQ0A 1NCAH 4OFYD 4OZHA 1KLGA 3L6FA 2FHCA 1AQKH 1IC5H 1OTUC 1U8MA 4U6HB 5MHSD 4YZFE 1MFEL 1EHLL 4BK4A 1NKRA 12E8L 3TLRA 2FGZA 3OKOA 4PJDE 3AU1B 3GMLB 1A7OH 3QIWD 3L3HB 4D9QD 4IDJL 2X7LA 1ZSDA 3EYSH 4PLJC 5F1OB 3P11L 2ZUMA 1U91B 4PJ9A 4MAYA 4ZOCA 3OBAA 1Q0YL 2OS7A 4Y19E 5AG8A 3FY1A 1IGJB 2J7FA 3DXAA 2PO6A 3BKMH 1E4XI 5ACZA 3WD1A 4I3RH 2OTPA 4DKFH 4OGXL 4P46A 2YPKA 4H26B 3VE0B 5FUZL 4CDHA 3EYFB 3Q48A 1OP3K 5A16B 3MLVH 2OLDA 3A6OA 5A2FA 5IR1B 2Y36L 4UZSA 1M05B 3BYYA 3JV4A 3V6ZA 3NZHH 1KENH 3QUKB 4I77H 4GZEA 1UM6L 3DUHA 3T4YA 1GZPA 3BP7A 1WE5A 4MWFA 3C5ZB 4Q9BA 2XM2A 3OKDA 3V5HA 5D9PA 4ODTH 1KGWA 1FA2A 2W0PA 3LHPL 1LP9A 4ZNCD 3SE8H 5HYIA 1HJVA 1AP2A 3HCVB 2RB8A 3NH7L 4MQSB 1XGUB 2YR3A 5IQ7H 1GAFH 1GC1C 1S78C 1DANU 2WWMC 1QG3A 3MGTA 4IMLA 4F33B 3AIQA 1T1XA 5F9WC 3SDXF 3GJEA 1FO0A 4Z7VB 4X0KB 1BOYA 4BUHA 2GUOA 3M07A 4JHAH 1CTNA 3GXDA 1R0AL 3ZM8A 3TCLB 5F6HJ 5GGVY 5D1ZC 5EU4B 4CU7A 1MY5A 1QQDB 4ZPVA 2CBVA 1MCSA 3R0MA 4P2RD 4MS8D 2CIIB 4IRSB 3NIYA 1ACZA 2HLFD 3VILA 1DBBL 4NZTL 1NEZG 1MRFL 3MUZ1 3AROA 3D0LA 3C87A 4LCIH 4ZS7H 4ZSOE 3CMGA 3VKKA 3M1BB 4CMMB 4HUWB 5HYFA 3V7AE 2WZIA 2WBWB 1EZVX 4W7VA 4RMVA 1TCRB 4U1LB 2NZ9D 1YC8A 5JZ7C 1A7RH 5H94B 4YIQB 3ZDYE 2F5BH 3E6FA 3KJ4C 1MI5A 4R7DB 5I75B 1B88A 3AZTA 2Y06L 4BSJA 3T65B 1L9MA 1CYGA 4M3JA 2QQQA 1N6QH 3O4LB 3MA9H 3D39A 2XRAL 3WE6A 4F2MB 3QEUB 2YL9A 1SJXA 3WQ4A 3S4SB 1IM3A 2UZIL 3E6FB 3TT1L 3ZE0F 3IFPB 3KLAA 3MV01 4LKXB 3HPJA 3RM4A 3WKNA 3O45B 1QHOA 5J1TC 5DD1H 3N1MC 2E9LA 1XMWA 2FJGB 1HINL 5ID0B 3KPTA 4CADB 1T7ZA 5FF6B 5E9AA 4FQCH 1QW8A 3INUH 1HSBA 1C91A 4OZGB 5D4QA 4ZFOA 3GMMA 3L5XH 2EDQA 2R2HB 2HAZA 2VH5H 5HPOA 5IV2A 3ECBB 3BAYA 1M01A 1RUML 2DTMH 4UUJB 5IFPA 4LHUB 5JOPE 3TNNB 4MXVF 4P8XA 1AD9B 1GL4B 3MXVL 2VRAA 4AEHH 4RGMB 3AHXA 1A7QH 3FFCE 2O92A 4O2CA 5KG9B 4HUMB 4KV5F 1GIGH 4HIHB 2B4CH 2HH0H 5F70A 5DFVC 2KBGA 2H1PH 1J5OH 1GGBH 4GO9A 4ODUB 4LSQL 2B1HL 3CMOH 4PRBA 4L8CA 4KRPC 1JHKH 4Y5XC 1LQ0A 4IOFD 1UXSB 4GXPA 1Q9WA 5E8EB 4KH2A 4R8WL 2RJMA 1UYWL 5D1XB 3SBWC 4NNXA 3NMEA 4OQTH 1FNEB 4P3DA 1N7ML 4DAGL 1UR0A 4XB8A 4TUKL 5IMLB 2MKWA 3ESVF 4NQDE 1I3VA 5I8CA 1MCDA 3SDCB 2YBTA 4Z7OF 3EO9H 4LCCB 3C5ZA 1CXLA 3A67H 3ZSTA 3CFBA 1RZ7L 2GT9B 3RIKA 2VCCA 1E4XL 2QKIA 1T80A 1R5VA 5BROA 4G8GE 5DVMA 4OCRL 1SBSL 2NW2B 4JQIL 3SQOH 4KV5E 1LL7A 3FAXA 4U1IA 5HHVL 1O7VA 4Z7UF 1WAAE 3QXDA 4MNGE 3ZKMC 3L1OL 5F6HI 2FJFA 4HJGA 3S96A 5JTWA 4TVDA 5IM7B 1ZHBB 3S37L 2VLJA 2WKLA 4D72A 4XBGA 3LKSB 1QRKA 3EYQD 1CN4A 4RGNE 4PBGA 3HU7A 1D6VL 4JO1H 3HMXL 4Y5VA 2N7BA 3AM8A 4M02A 4WI5A 1M05A 1KV3A 1I8IB 3TTYA 1P2CA 3LIZH 5E2JA 1BGGA 4MNQB 1U9KA 1RUKH 1U8QB 3IU3A 3IDIA 5FKAB 2I9LA 5JIIA 4TSBL 3STZB 3OKDB 4XAWH 4AH2B 1YNKH 1AKJA 3U7BA 2Z93A 3NCMA 4DFIA 1TZIA 5GS0D 3JV6A 5K59F 5EZOL 1FZKA 2XKNB 1BM3H 1QLRA 4N5ED 4NWUL 1JYXA 1HKFA 4IRJB 1HDMA 3SDDC 3ZDYF 3D0VB 4KVCL 1A6TA 3WUWB 1H5BC 4AENA 4KRUA 4K3JH 4V1DE 2N56A 2YC1B 1RQ5A 4OZFH 4PGBA 1NC2B 5D9MA 3VRIA 1MFBL 1PDKA 4PRPD 1CEOA 1NWSA 2E7MA 4IRJA 1R3IH 4OLZL 1HZHH 4FMFA 5I75C 1IAKA 4U6HA 2W0LA 3QUMA 2V7NA 3CLEH 3I6LD 5ADPL 3V5DA 1AD0A 1G7HA 5F7DA 1OL0A 1Z3GL 3CXDL 4PJFF 3GIZH 1D5XA 3VFWB 2FLRT 3TYGH 1J0YA 3OKOB 1H8OA 3H9HA 3MYJA 1DEDA 2X2IA 4AD3A 1W2VA 3CCHB 4HWEL 1MW2A 1E3XA 1TMQA 3KE0A 2F7RA 2Y5EA 3P77B 4PJ8C 5KVEL 4C7GA 3KPLA 2OYPA 5JR1L 3L9RA 3MFFA 4OM1L 3VPLA 2DMCA 3BE1H 2P24B 1CBVL 3WUEA 3DX0A 1CDBA 2VTFA 3MNWB 3SBWA 3SKNA 3QYCA 2HISA 3OJMB 4PG9B 1JPFB 1LD9B 1CWYA 1UZ6F 4XBGB 3CZ8A 2FCBA 4LSSH 5DA0B 5D8JH 2DI8A 3W11D 4MMZC 5C9KA 2QSVA 5D72H 1KGUA 1BD2E 3RIFF 4L4TE 1QO3B 2V9RA 4NBZB 4LCWD 4YXHH 4XI5C 5J1SC 5E6ZA 1LO2L 4YHMH 4NHUB 3WNKA 4HEME 4Q2ZB 5GHWL 4B3LA 1G7MA 5K9JH 1B0GA 4XNUL 4ZS7L 4Q74A 3JZ7A 4JFHE 3MJ9A 2HWZH 1WKYA 1T5WA 4G8IA 4CMHC 3CC1A 5L88H 4LASH 2BNRA 4OGYL 4ONOA 1W8OA 5L9DL 1XGTA 2VL5A 3RY6C 3GGWB 2FWOB 1U58A 4X83A 3HG3A 4IOIA 4KJWD 1FGNH 4LQFH 3F58H 1A3QA 3OKEA 1C8QA 4Y5VB 3OG2A 4MNHA 4JQVC 5FGBC 2BVOA 4G8EB 1UC6A 3UTSD 3V5KA 4M5ZH 2AW2A 3WXWH 1YZZA 3QQ9C 5I17B 3MFFB 3FQXA 3MLUH 4LEXL 1CF8H 3QNXA 4AIZB 2GITB 5JIHA 5DD5L 3UO1H 1KWKA 3FRUB 4UR9A 2E7BA 5ADOL 1LNUB 3SGEH 2W9EH 5CEXA 4Z76B 1RUAL 3MV9E 4JQIH 3SQOL 1PKQB 4Z7NF 3QNZB 3GSOA 4QRPE 4M8VA 1MLBB 4LU5L 3QFDA 3EYPA 4D8PB 3MTRA 3T3PF 3CZGA 3RDTC 3BJ91 1O7DC 3BVNB 1KC5L 3QDJA 2WMIA 1T0MB 1IM9D 5DR5L 1S9YA 1OSEA 3MRGB 5DSCB 1D5ZB 4IISA 1TQCC 5BXTA 3T0EC 2XFXB 4HH9A 1G7LA 3B2UD 3MLXL 1J05A 3PV6A 3WDIA 3P11H 3AIRA 5T3XE 4D1JA 4IIQB 4LLUA 3KEHA 1T1YA 3JWDH 1HHKA 1J18A 1NMAL 2B4CL 1EERB 5F9AC 1MHHB 2UY7A 3VX0A 3HG1D 1NUFA 3MLTA 5D71H 4FQJL 2DM4A 2P48B 4PV8B 1P4IL 4QRPD 4LCWB 3BT2H 1KQYA 5DWUL 4W89A 2FGWL 1VFOA 4EDWL 4U1JA 2EH7H 3BEVB 5E8NB 4HUWA 3WS3B 3GMMB 4Z95L 5A2BA 2NY2C 2P42B 3HPLA 4ISVB 2V3GA 1DVFA 4LP4A 5EU3A 1BD2A 3P30L 4NJ9H 3LSOB 4K3GA 3ROLB 1YEEH 5D7JA 4AZ6A 3MFGB 5A6BD 4UDUA 4MA7L 3BMWA 3SJVA 1Y6NR 5C0AA 5CEZH 3RL1B 2WCGA 3VFUA 3D18A 4ETQB 3WUFA 5HDOA 5KSUA 1CFQB 1XYZA 3U48A 1GCFA 2AJVL 1JGDB 4IM8A 2C0HA 1I4FA 2ZCLH 1BVLB 1Z9OA 4WFGD 2V2XB 1WEJH 3SJVD 5BVJA 4WKAA 4K3HA 4HW6A 4UT9L 3HHRB 1NMAH 1GGCH 5EUOF 3ZZ1A 3UJIH 3MV11 1IT0A 5A6AA 3WE6B 4L29B 4UDTA 5L0QC 1KB5L 4KKBD 4RAUA 1EAPB 3MUJA 1XGPA 2KQNA 2R2BB 3UTTD 1QBML 4O2CB 5KG9A 4PMDA 4PJCF 5DJXA 1L0QA 4ATLA 7A3HA 4GMSH 1A64A 3VSTA 2IH3A 4HS8H 4IRSA 4FQHA 2DQDL 5JBEA 2W60B 4OCXH 5E2WH 3PGFH 7CGTA 4APQA 2HP4A 2VN7A 1JF5A 5AZEL 1NLDL 3PZOA 2YBRB 4U1SB 1FRGL 1W9XA 4N8VG 4UNVA 5CEYA 3DGCR 5TH2B 5BV7C 5F3BA 4HT1L 1BLIA 8CGTA 1TFVA 1U8HA 1EO8H 1R3HA 3EZ8A 1HH6A 3AYRA 5HHVH 2AXGA 8FABB 4JFOA 5IQ7L 3WH7A 2BJMH 3WDJA 3O6MH 4AIXA 3GBNH 4GZJA 1MLBA 1KCSL 2NXYC 3S34H 1S7TA 5I5RA 4U6VL 3TCLA 1ZT4B 3O2LA 5ETUB 3BN9D 5BRQA 1QPKA 4ORGB 4QRQB 2ZSVA 3MYZA 2IFGA 4F58L 4M6OH 3F7RA 3AREC 3KYKL 1NOFA 5MEOA 3AREA 5A6JA 4Y4KB 2D1ZA 4PLKC 4CKVX 2VLLA 1S78D 5KTEL 2VZTA 3QG6B 1J1OH 4FFVD 1Q0YH 3BO8A 5JW5A 1ADQL 4Z7WF 3MLWL 1SYTA 1GOFA 4HHAB 3TIEA 1NLDH 5B4MC 1UASA 2P1YA 4HKZB 1EFXD 5KVFL 3CDCA 4HWBL 4NUGL 2QHLA 4PMYA 4H8WL 2GTZA 1I3RA 3PZNA 3TA9A 3Q3GA 3L3GB 4HV8B 1KWGA 5ACZB 1OIMA 5JXAL 1X9QA 5DHVH 5I17A 2ZUUA 2V2WB 2JCCA 4MHHI 1FYTE 2VCBA 1QZ1A 4ZQKB 3C08H 3EJQA 3ILQC 3PHOA 3WHE1 4QTHB 5EB9A 1QBBA 2B0SL 3HMWL 2XWBB 5HDQH 3EFFB 3T2OA 2D7PA 1TXKA 5EDXA 5H35B 3BQUB 4HUVA 2ZG1A 4XP9L 1MAMH 5JHLH 3GSQA 1DE4B 4W4NA 4X4ZA 5D1XD 1FFOB 3BQUD 2BY3A 1MI5D 5DMKA 5BOPA 3WS6C 1ZTXL 4B3KA 2VE6B 5DJZB 5IK3B 1F4YH 3EOBB 5AUMB 2JB6A 2UWEF 5E6IB 5I71B 2Z4QB 1ZXQA 4KROC 4LLQB 1VGEL 1T66D 3I3DA 1XH1A 4JZOB 1HI6A 5DZOA 1MNUH 2XG4A 1AXTH 3K2UL 5HHQA 3S2CA 1PY9A 1RPKA 4NRYA 5CLTA 4JFYB 2OK0L 2JFEX 1Q9KA 3P77A 4GSDH 4P2QD 1J8KA 4GRWB 1A21A 3NFNB 4MDJA 3RVTD 1IL1B 2VISB 4PJAF 1ZT1B 3V0VB 3OR7B 4X0NA 4HA3A 2PYFB 3TIEB 2X2YA 2W0KA 4OUOA 3AAZA 4QRUA 2J8HA 2ITCA 3AGVA 4B0MM 1HH9B 2WC3A 1QEWA 2IPUK 4QTHA 5SWQA 2FH8A 2OX5A 5INDB 5A6SA 1CS6A 4NN6C 1K85A 3BJLA 3ULVF 3HNVL 2VLJB 5HYEA 1EFXB 4OZFA 2YLAA 4XP1H 4Y7EA 1EO7A 4NFCA 1XGQA 2VRKA 2MJWA 1MH5B 3STLB 1QRNB 4PJBB 2GSGA 1KCVH 1ITXA 2VZUA 3ISWA 4UOW0 5I30L 2H2SC 1MJUL 4JO2L 2QKIB 4G43A 4WDIB 4XCYA 5IOPA 2IG2H 4ZDHB 5CJ8A 1QD0A 4DWHA 5B39B 3WIIH 1EAPA 2NNAA 1AY1L 1MPAH 3B9VA 3HS0B 5E6IA 3MI6A 1Q9LB 1U3HB 5ICYB 4KDTC 3E6HB 2VLLB 2APXA 2X9WA 1UWQA 5GZOD 1KG0A 4NKDB 1JFXA 4BH8B 3WFCL 2EE9A 4R4BB 1I7RA 1DTUA 1IKFL 4WNQA 1E6PA 3A0OA 4PRWA 2BSRB 2FBJL 4NT6B 5M03A 2APWA 3G5ZA 2VQUA 4I2XE 4GW5A 5IMMA 2M2DA 3LDBC 4JCMA 5CJBA 3CFIC 4CD6A 2IH1A 5IEHB 4AWEA 2NR6C 1OB1B 1V7NH 4L4PA 4APQB 4B16A 4OI7A 4HUUA 2WBGA 4Z7WE 4H0HB 3HNTL 3ZE2E 3VI3E 2GSIA 3U1SH 3EJPA 4PCTA 5C0EA 4M93C 4UNUA 1KIQA 3WKZA 3TO4C 4ODHL 1MFAL 5EO1B 5HHXL 3VFNA 1KCUH 4YC2B 4M1GH 4FABH 1K3ZA 3PF2A 1RJLB 1DVFB 2WIMA 3QUXD 5I8CB 3VH8A 3N50A 3FZUD 1JYWA 4PJGA 3G6MA 1M4KA 3I6GA 5TD4A 5I30H 5I2IA 5J7CC 3SCMC 4OLUH 3BXNA 1V7ML 1KCVL 2QR0B 3QNYA 5F7LB 1FGNL 2CQVA 3DX7B 3U4EA 3DHPA 4OD2B 5CEZD 3O11A 5J9PB 3U7AA 4G3YL 2VDNL 1CIDA 4JB9L 4NKIL 2A6JB 2DI9A 4LLUB 1WDPA 2NY3D 3MR9B 4KRPD 1U42A 2W0FA 3B5GA 2YHGA 3AS3A 5KBNC 2WMHA 2IQAB 4TPRL 3INUL 4GH7B 3R0NA 5HVWA 4TOQA 2XVLA 4M7KL 3UROR 5JQHC 5GZND 4OZIA 5TQ2L 2Z92A 1OW0C 4MMXC 3TYFB 2Z31B 4GT7A 4ODBD 1S7SA 2VLKE 4JPIB 4URIA 2D7QA 3MA7A 3MV9A 1IAIM 3C60C 2UZIH 1N6UA 5EU3B 1J86A 5A2AA 4DZ8A 3VXUE 5IMKB 2NY3C 4WW1A 1UB5B 3KNBA 3OGOE 5KZ6A 3PWNA 2OWXA