3VMNA

Crystal structure of dextranase from streptococcus mutans
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
633
structure length
633
Chain Sequence
NGNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dextranase
publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 222
structure length 633
sequence length 633
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmnA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmnA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmnA02
2YUXA 4AEEA 4I3GA 1A6UL 1NMBH 3MMEB 3ARBD 2E5EA 3KE0A 2NY4C 2C4XA 2PYEA 3EYUL 5DVKA 1KACB 1UM5L 5FYLH 2H3NB 1F11A 1IEHA 2DT0A 1ZS8A 2QADB 1IILE 3OHXA 1F8TL 2YPVH 3SQOL 3VG9C 3F8UB 3LRMA 2WHLA 3RWDA 1YEJH 2ZNWA 3P0YH 4MB3A 4S1SH 3QZWA 1HP5A 3GSRB 3OAZH 5DRZB 4OF6A 3RAJH 2WC4A 1FLTX 4M9OA 2FO1A 3W81A 4WO4B 4ZO8A 5CP7B 1AGBB 4WCYL 1CYGA 2BVEA 2YK1H 3S97C 3RBSA 4UAOC 2DQCL 2W91A 4PTTB 2HH0L 5DWUL 1GJWA 2BNRB 1CFSA 3GHBL 4JVPA 2PXYC 3WS3A 1A6VH 1KLFA 3BIKA 3DYOA 1V0KA 2C7UA 5E2TL 1MIEH 1UR0A 1LLOA 4PJIA 1HZHH 3QFJB 1OSZB 3SDCA 3V6OE 3AIQA 1L0PA 5JLZA 1WFTA 2PBGA 3OGRA 3A67L 5EFDA 4P2OC 1WDQA 4YE4H 4G43B 1ADQH 1Q9OA 4H0IA 1ZBKA 5EUOF 3QNZB 5EU7E 1A1MA 5I66B 1KGCE 5IQ7H 2CESA 5MEPB 3UTZA 1MWOA 3RL1A 5CIPB 4D9LH 3BZ4A 5IVXF 3VH8A 4WUUE 3PNWB 3S35L 3ZT6A 1BYBA 1A7OL 2KUTA 1BZ9A 5F6HJ 4WI4A 1QFHA 4PIRF 5DK0B 1E6JL 1R3LA 2D31B 2Y24A 1WBXA 1P4BL 1S7XA 3KAAA 5T1KB 4X4XB 4Z7VF 1QNZL 3HS0A 2XPGB 5E1AB 1U58A 3N1AA 1GOMA 1R87A 4X9YA 1KNOA 4PJAB 4OUOA 5IJVA 4NN7C 1FP8A 3QDAA 3A6BH 5L9DL 3QDMB 1CLOL 4F37F 5CD3A 4N9GA 3T4AA 4MJ4A 3WELA 1AI1H 1ZAGA 5E00A 1KENH 2HISA 2IH1B 3K46A 3GSUA 1UWQA 5I15L 3MRJA 1FFPA 2F54E 3DMMB 3O45B 3T3PE 3AUVA 1I4FB 4XX1G 4ZXOA 5EB9A 1P2CA 5C6TH 5A8OA 3VGAC 3VGEA 3TVMB 3PWVA 5E8OA 4KKAC 2PETA 3F6LA 3PGCB 1W0WB 5J9PA 3HU7A 3T2NH 2JIXB 1GIGH 3U4EB 4QO1A 1K9TA 1DDHB 4D9LL 1PJ9A 1SEQH 3WFEH 5IGXH 2HLAB 4LSPH 5JOFA 3QEQE 1CFVL 5LGHL 3VFSB 1HTYA 3FB8B 2BSTA 1MEXL 3CVIH 5BV7L 4NQTA 4PRPD 1PS3A 5EO9B 3S36L 2XZQH 2FYYA 4G7YH 5MHSE 5CJBA 3P11H 3UMTA 4XBEL 2GAZB 1TA3A 1CD0A 3MSGA 4M1DH 2A3AA 3QH3A 3F62A 5CPQA 3UTSD 1AQ0A 2NPLX 1TCMA 4JPKH 1KCRL 4HIHA 4P4KC 3TTOA 5LA1A 1UVQA 1HHIB 1JK8B 2DYPA 3FTGA 3X11A 3NOIA 3ARUA 3MRNA 4OZFB 4AZCA 4K3JL 3UJIH 1NGXB 3BE1L 3ZE0F 4D71A 5L6YL 1GZQA 4LU5H 3CLEL 5F9JB 2E7MA 2QLYA 1HJVA 3VXUE 1AD0B 2CLZB 4LVNC 4OCRH 4YBLC 3O6KL 3SE8L 5DJ2B 5FIEA 1MJUL 5I3DA 3D5HA 5D2LA 3G9AB 4P23A 1E28A 1Q94B 2VRJA 1CG9B 4YO0A 2HKFH 3GSQA 5DR5H 3MV9E 3N12A 1Z5LB 4JFXB 4LASL 1CU4L 4GH7B 2R29L 3Q6FB 3RIAK 4QWWD 7FABL 4MMXC 5ICZB 5FHBL 4H20H 3ULUD 2OZ4L 1TCRA 3MCG1 4KI5C 3CVIL 4OZGF 5HI3C 2ZZUT 5IEKA 5C9JB 4JFSA 1NFDF 4FNTA 3K4ZA 2EO7A 4L4OA 3TA3C 2FEEL 1OTSD 3VIHA 2Z8WC 1OIMA 4UBDD 5C9KA 3V6ZB 1HQRB 4LGRB 4OZIE 5AYBA 1RU9L 4LHQB 4JQVA 2Z92B 1CFTA 1W0VA 2K3TA 4UNTA 1B30A 1KEML 5C0BD 3LEYH 5HGAA 1R5IB 1SM3H 4RFEA 4QT5A 1YN6A 4PJBB 3A21A 5FL0A 1NUFA 1UQYA 2X4PA 3TBTA 1JDDA 3HZVA 3KLSA 2XTJD 2CRYA 2EZ0D 3L95B 2C3VB 1ZHNB 5CP3A 2K1MA 2PTVA 2XSAA 1Y6NR 4M1CD 4XPFL 4B15A 3AFLA 2D03H 5FA4B 2BY0A 4W6YB 5CEYB 3K74B 4ZO7A 4UQEA 3KL5A 5IK3B 5I23A 1IBGL 2EIBA 3TONA 4EI5B 2DSZA 2WP3T 4IUGA 1JD7A 4OZHE 4XCNA 4AQ1B 4DN4H 4HPOH 4L8CA 4HW6A 4BFGA 1RZKH 4LNVA 4OFDA 1YEGL 3GGWA 1A4KB 1INDL 1M03A 4UFIA 4D8PA 2UWEE 1UENA 2UY2A 1LEKA 4RFNB 2VCAA 3AS0A 1CQYA 3RY4A 4LCWD 4DWHA 2QV4A 3NSNA 3AU1B 1VGKB 2G3IA 1JUFA 2AJYL 3PDGA 1I7UA 4JPWH 4HS8H 1JNLH 4UFKA 4NZTH 3IDYC 4DFHA 4U7KA 3TH3T 1A1NA 3E2HC 5BVJA 3BUIA 2YRPA 1GOKA 2EH8H 5TQ0L 1G6RL 1UG9A 3OKLA 4H1LB 4LNRA 3G5XB 4TPRL 3HAEB 5DEFA 2ZJSL 4LCIL 1TDQA 5I9QC 5FF6A 1U8NA 3EYPA 1BD2D 4OQ1A 1ORSB 4WUUA 2D4FA 3MJ7B 3L6FB 1NQBA 4Y88A 4OCYH 3GBML 3PQYD 32C2B 2A77H 2AABH 2HT3D 1ITCA 1Y18A 4DN4L 3MRQB 3MMDA 1WAAF 3IAQA 5IHLB 3P40A 1EFXD 2ID5A 1UC6A 2YZ1A 1A7NL 4HUUA 3ARDB 1T3FA 5IHZB 3BN3B 1K4CB 3IDGA 1KELH 3AHTA 1LQSR 1U91B 3I75B 3H0TA 3S34H 4MXVE 4AK1A 2ZUQC 4WFFD 5I6XC 3SCWA 1YQVL 2HJLB 1DEEB 4Z5RA 3MRFB 3OR7A 3AY4A 4OKVB 2F54A 2G4FA 3X13A 3LN4B 2Z91A 3N0PB 4P8UA 4NUJA 2QQQA 3IKCB 4IRZH 4OGAC 2GJXB 2BNQE 2X7LB 3S4SG 3F58L 3BEVA 3LMJL 4YGVA 3GI8L 3LX9A 1JPSH 2EH8L 3G6JE 1MLCB 5I73C 5D5MB 4ZOCA 5IV2A 4FQQA 5KVFL 5E99L 3PV6B 3MMEA 1TFHA 2GK2A 5MI0B 2ITCA 4JFED 3W9DA 5EU6D 3OA5A 4R5EA 3JWOH 3IT8D 4XNYH 1QI3A 4A6YL 5CBEB 1FNSH 5LJYH 1X4ZA 5CKGA 4NP4L 4L3ED 3TT1L 1GUVA 3D4YA 3MOBH 3BGMB 1D6VL 3DURB 1JGUH 3LDBB 3CXDH 3LEVH 1B31A 4UQ9A 1JRHL 3I02A 3QXUA 2QMJA 1OT1A 1HCVA 1HIZA 4EBQH 4YWGL 1W32A 2HN7B 5TF1H 2VLKA 3RHWF 4P2YA 5ESVB 4OJYA 5I8OH 4IDJL 4WUKL 5JNYB 2VDLL 3UG4A 1MI5E 4PJEE 5CP7A 3SE9L 4NZFA 1VBUA 1X5XA 5JQ6H 1ZLUK 3IFPB 3KPOB 4YZFE 3S34L 4K3HA 1NDGB 1G7IB 5GRUH 4PTTA 3STLA 3MUJA 5FB8B 5F89B 3KLHD 2V2TA 1QKZL 3KYOB 5JBEA 2W9DH 3OXRB 1JAKA 3WV0A 5I19H 2V5CA 1IVLA 4GXUN 3QUXC 1FO0B 5JOEA 3QFJA 2X0HA 1OSZA 4IRZL 1T5XA 3BD5A 3D0LB 1V3KA 3NIGE 2GYSA 3G6DL 4NJAL 4UTFA 3QUYB 1VJSA 1V8HA 4RGOH 4EUPB 3O2LA 1E6OH 5I66A 5F93C 5EU3A 1WPCA 4J4PA 3POCA 1S5IH 4JFPA 5HHPB 2QF8A 2HWZL 3HE6D 2CKBH 3TBYB 43CAA 4WU5A 2O5ZL 1W9UA 4HPYL 1PG7H 1BBDH 4W93A 3ZMRA 4E0RA 4DGVH 1WZMA 2JCCE 2HMIC 5EN2A 5T3XH 3LEVL 3UX9B 2E9WA 4LF3B 2EABA 1ZA3B 5HYJE 4G6KH 2NY0B 3VFVB 4X6EB 1UXWB 5FO7B 1P69B 4DVRH 2CXKA 3ARBB 2AJXL 3VE0B 2B31A 4BK4A 3Q1SL 4S3KA 1KJ2L 4KVCH 1JTTA 2OL3H 1HNGA 3QWRD 3D0VA 3BKML 4Z7WF 3S7GA 4Y5VB 2EACA 4Q2ZB 1HH6A 3N50A 4XC3H 4E9LA 1IC7L 1GNXA 1RI8A 2VIRB 3IFLH 3AGVA 1OGGA 3DV4B 1E4JA 1VFFA 5EBLA 3BDXA 3O45A 3QO1B 2ICWB 3T08A 4JANA 1I4FA 2MANA 4WI5A 4HWEL 3SCMA 4G8GB 2OP4L 3TVMA 1HE7A 3BDBA 4V1DA 5EA0H 1I3RA 4Y89A 1A6PA 1CE1H 1GAFH 3U4EA 2J5LB 4QHUA 3MRIA 1NMAL 2IFGA 2ADGA 2HLAA 4L4VD 2YPLE 5C3TA 1FHDA 3FB8A 5KG9B 1PG7L 4M24A 5EO9A 2BERA 2APTA 2O5YL 5C0RL 1J87A 4WIQA 4DQOH 2DBLL 3FHAA 5JZ7D 2GAZA 3UTTD 5D8JH 2CUHA 1R3KA 4FQXD 4UOJA 3MCKA 4K7FB 2BX5A 3UPCA 1XF4B 5I1CL 4W7WA 4Z0BH 4X0KB 1OCWH 4AEHH 3ALWA 1VDGA 1OAXH 1T89A 4DW2H 2CNCA 4HZ8A 4B3KA 4ORZC 5KS9B 1SYVA 5FKPB 3PP3K 1XGZA 4JJHA 3MLZL 2VXTH 1ZGLA 5FYKD 3SDYH 2BHZA 5JDSB 1AD0A 5C0GB 2CLZA 2DF3A 5FKAB 2O9RA 1IARB 4X4ZA 3HI6L 1BAFH 2CBIA 5GS1C 2ZUTA 3QIUD 1QG3A 1Q94A 2VN7A 4QXGH 3W27A 2VDOL 4OCSL 4ODVL 3AY4C 2IXVA 3GYCA 4JFXA 4IISA 2I5YH 4POUB 5D7IE 1OSEA 4RGNE 2NY2B 3LXBA 5KTEH 3GSXA 2J7BA 4PJ5A 4R4NC 2GSIB 4ZG1A 1YZZA 4Z7UF 3V95A 3PUCA 2MOVA 5C9JA 4PG2A 4FLQA 1MY5A 5FA3A 3KZSA 1CXIA 4GLRH 4M8QA 2QADC 5IB1B 5HGBB 4AD0A 4OGYL 1N2RB 2DQUH 3WKZA 2F74A 2EPOA 1RD6A 1DE4A 2FO4B 4IEFB 4GRWH 5I30H 1EK3A 1X3DA 3L5WA 2BHYA 2WHJA 3WDPP 1T20B 2DMCA 1OAXL 4FG6D 1W1TA 2EIEA 4XNMB 1KJVA 4PRPB 5HHXH 4O4YL 4HIIB 4WO4C 1TMQA 4W87A 1XSJA 5EH1A 2JJTA 4HV8B 1XD1A 2J6EA 3BN9C 1U8KA 4KKBC 2VMFA 5F1KC 3UTSB 1SBBA 4HA4A 1BQLH 4UUJA 4J23A 2X1OA 2X4OA 4EAMA 5FA4A 2FNBA 4C83B 2BZDA 3SPVA 5IK3A 2ZXBA 4K94C 5F8QC 3NABL 2F8XC 1DSFL 2P45B 2Q8XA 1JDAA 1A4KA 4MNQA 2GJZB 2YPKA 3MRPA 2AEPL 3GZKA 1NMCB 5L7XL 4PJEA 5IW1B 3NTCH 2W62A 3LRSA 4LRNL 4YFDB 3QIBD 2EKSB 1XF2B 3OAUL 4ZYKB 4KZDL 1C3FA 2EAEA 4U1KA 4LBEB 3B8YA 5EBAA 4QOKE 1F2QA 4R7NB 1X7QB 4U1MA 4J2XA 4I0KA 2XICA 2NQCA 5ADPH 1QBAA 2AXGB 1HSAA 1AD9A 1EERB 1MXDA 1OOAA 3KGRA 1VB9A 1LE5B 1XF1A 2PYFA 2YD5A 2AK4A 1DN0A 5D70H 2ZUMA 4BFIB 5DHYB 3G5XA 2K9UA 4WHYG 1E4LA 1ORSA 1ZVSB 3GTNA 3UR8A 5E95B 3QB7C 5C0CE 3MJ7A 4JZNA 2X09A 3O6FD 2BRQA 1IGIH 3DMMC 5C0BB 4D9QD 2G5BB 1FFRA 1AQMA 3RVXC 3PV7A 4FNLH 4TULH 4UB0H 1W2PA 3TVMC 2EDEA 5BRZD 4MDJA 2PWFA 2XTJB 2DIEA 4U1JA 3GSNB 1UUQA 1MPAH 3PWPE 4NJ9L 3BWAA 4OQTA 4S11A 4O00A 1DLHA 5IHZA 5MEOB 1CFQB 4HMDA 1E6PA 3MXWL 1OD7A 4G8EB 4JM2A 4EVNB 5I76A 2ZIDA 2G75A 2MTPA 2QHLA 1IC4H 3BHBA 4I0PD 1QNPA 4U05A 5BZDA 3MRFA 1YY8B 4KROD 4P2RB 2Y4SA 2VXVH 4P3CL 4ACZA 1CVRA 3HG1E 3G5ZB 3LN4A 1TZ7A 3VXME 3DUUA 3D18B 1YEIH 3MROB 2GJXA 1BBJA 3UERA 4HGKC 1T22A 25C8L 1JHLL 3DVNA 1IAKB 1SJHA 2R0KH 4F7EB 5GZNC 5CINH 3LKNB 4XXCA 3SJVE 1F4AA 1U95B 3CK0L 4GKSA 3SE3C 4JN2B 3TBSB 2G2RB 2YPLA 4JFFE 2YDQA 1BJ1H 1H5BB 3Q48A 4OZ4A 3JWDC 3EFDL 3RKDD 2LU3A 2ICCA 2IPKA 4QNPE 2DEPA 2C3HA 2KQMA 1WDSA 2RBLA 3JBG7 1GGBL 2ITDA 3FO9A 1W72A 5CJXC 3Q6GL 4NX0A 4UB0L 1AFVL 5JIKA 1W91A 4D6CA 1TETL 1QNRA 4G6JH 4LSUH 3MRLB 1MPAL 5IB3A 4FF5A 3IJYB 2XVLA 4M29A 4D9RE 1BD2B 2X0YA 4PLNC 1FG9C 1XD0A 5BMFL 2CIPA 3ZT7A 4EDXA 2AV1B 4YK4B 3BIAX 5T1MB 5GGSA 3V4PL 5A2CA 5KAQF 3VSVA 5F89A 1FZJA 5CP3H 3PQYB 3VX1A 4V2BA 5INDA 3OR6B 3KYOA 4OGZA 5BYWA 1MHPL 2XSBA 1D5BA 3TA9A 4RAHA 5TJWK 4GO6B 4PRDB 1KV3A 1KTLA 3MRKA 1RZ7L 5J8OA 4JY5L 2CCRA 5DS8A 2VLLA 2XZCH 1EFXB 4GO8A 4MD4A 3T77B 3BP5B 3OG6B 4PJGB 2JIWA 1NAKH 4JO3L 3QUYA 3K2MC 2G3MA 1NCWH 43C9A 4EUPA 5GGTL 3NIFE 4ZUUA 3TNMB 4WWKC 1MQQA 4HZ6A 4IRJA 1QFWH 2CDGA 3VI3E 4AT6A 1FL6A 5GRJL 3D52A 1FH7A 2YBUA 1G01A 2PW2B 3QBTB 1MCOH 5EBGA 3AMGA 3H53A 4PJXB 4XMLL 1N3NB 2PN5A 4OLVL 4LSQH 5L2KA 4PTWA 3VFVA 5F9DC 1WAWA 1FIGH 2R39A 3GMQB 4NRYA 5HHVH 3ARBA 4JFEB 4MLSA 3P2TA 5EU6B 1ZXQA 4JR9H 4EI5C 2V3GA 3UDWA 1A5FH 4RMRA 4W4OA 2YSSB 3DGGB 3HC3L 1C1EL 3E8UL 3GBNH 4L3EB 4ZAKD 2HJFB 2EE3A 1AO7D 4Q2ZA 3I50H 4WGWB 5IJKC 4K3EL 1U33A 4Q9CA 3MGAA 5MERB 2ZUSA 5FECB 3SCRA 2BP3A 2FX7L 4NWTL 4RFNC 5E8PA 4ZFGH 3HG5A 1BPLB 3FB6B 5EUOB 2FJGA 4YXLL 4HUVA 4UFHA 4UOW1 3NCCB 5A3IC 1G5AA 1QFWL 5CZKA 1ZV5A 1EXPA 2J74A 1MRDL 4FZEL 1OW0C 4XPHL 8FABB 5JOPD 1BGGA 4YHPA 4MPKA 3PXJA 1XV8A 1MCOL 4ACPA 3IDJB 1JD9A 3AXHA 3S4SB 3K2UH 4LQ1A 2YL6A 4PJHB 2I9TB 5F9AC 4RGMB 1J5OH 4RIRB 3O6AA 3HE7A 1U6AL 3SE4A 1C5CH 2YD4A 5M94B 1CICD 5JXEA 1XIWD 1F3JA 1ZHBB 3ZOAA 2WNGA 5HD8C 3BXNB 4X9FA 4HGWB 1OM3L 4EANA 5GJSH 3DXAD 4TSBH 3HE6B 4EOWL 1DBAL 1TJGH 2F7RA 3GBNL 2P49B 4BQBA 3PWLA 4HAFA 5KS9A 4BQ4A 4XZWA 3ARDC 4XZUB 4Y1AE 5JPNA 4MNHB 1J7VR 3U4AA 3I85A 1LG2A 1CDGA 5LGJB 2VX7A 2G3JA 5C0GA 1XR8B 2FL5B 1N5YH 3TO2A 1BM3L 3RHWK 1MFEL 3SGEH 4LCCB 4XTRD 1WQVT 3HHRB 5C0CA 4Y2OA 2OTWA 1RQ5A 3WQ5A 4OLWL 3QRFM 4KRPD 3CGTA 4KY1H 4LAQH 5DI8B 3QQ4A 2R4SH 2YMXH 3Q5TA 5D7KE 3OGSA 1NDMA 1AH1A 3BSZH 5SX5K 3THMH 4MQXC 4UOW0 5MI0C 3T1FB 1SJVA 4KI5E 4JRYE 2ED7A 3C6LD 5IBTL 1YC7A 4UI2A 2DTMH 4U6YB 1CBGA 3CAFA 4NQUA 3LDBC 5A43C 4EKJA 3HG1A 1VFAB 3KR3L 5GJSL 4RFOL 3ULVC 4JHWL 1T20A 4L4VB 3LKOA 4W68A 4X8JB 1HJQA 4K2UH 4PB0H 3SGEI 4C7GA 4XNMA 3L3IB 1RIVH 1NAML 2VT0A 3KPSA 4XMKL 1B3VA 1DQLH 4PD4K 4AEIH 1X9QA 2IANE 4D1IA 3QISA 3UTTB 1TVDA 1QI0A 4FQXB 4JFFA 4MNGE 4POZC 2R23A 1IEAA 2D1ZA 1M7IA 2F15A 2F19H 3VCLA 4YBHA 5E56A 4LGXA 5FXCH 3B83A 2P8LA 3QCTH 2X70B 3W38A 3DHJA 1EGJA 1BQHA 2WQ8A 4NQXA 5FCUH 4G3YH 5IVXE 2B1AH 2ZG3A 4LLAA 4DZ8A 1TJIH 1VACA 1YYLH 4RAVA 5FO9A 4ZXBA 2GJZA 2PBOA 1HHGB 3THML 4H8UA 4PLKD 3HC0B 3QSKB 4ZNEA 3IJSB 3SDXE 2IBZX 2B0SL 3AIUA 3QIUB 5FOOA 2EKSA 4GG6A 4HDIB 3N1PC 4P7LA 4Z7VE 4ZYKA 5MENA 1HJXA 3HR5B 4NFCA 3V52H 1F97A 4P2QE 5F7DA 3RWGB 4DFIA 4R7NA 1I1AD 5IM7B 2R4RH 3BJLA 4LIQE 1RJYB 1YY9D 4MZ2A 3CZFA 1R5VB 2HYMA 4LEOA 3T0XA 1M6OA 1NBVL 4YUEH 5JORB 1UCTA 3ARBC 2PWDA 1LE5A 3D25A 1D9KD 5ILTL 1JV5B 1IAIL 2J62A 2QV2A 5ISZD 2VXQH 2BDNH 2XZZA 2DLEA 3K80A 4TUJA 3IF1B 3TIDA 4AEIL 4BFIA 2D3LA 4Y5VC 4EI6A 3MODH 2WUCH 5FM8A 2XVGA 1DBML 1E4MM 3DROA 2Y36L 2EH7L 3H9SE 1MNUH 5KAQG 3W5MA 1UA6H 3QCTL 3U2SA 3IS0X 5C0BA 2D7TL 3U7WL 1RK1B 3VO0A 5B8CC 1WSST 4J1UA 3LS4H 4LSVH 1YYLL 1S7VB 1T7WA 4QRUB 3WN6A 1UKOA 5HYFA 4Q6IB 3RVUD 1CXFA 2J5LC 3KYNB 4JFOB 1MSPA 4WEBH 3O3BA 3VNZA 1INQA 3MUGA 1I85A 3V52L 4X6FA 2CJUH 4Z8FL 4H5SB 5EO1B 1G0XA 3RUGF 5I1KH 2QBWA 2CRMA 1QYGL 1URLA 3MROA 4U1HA 2FWOB 3FQUB 5C2BH 3UEZA 4I2XE 3ESUF 4ODXB 3KS0J 1IAKA 4HK3N 2DDQH 4X6CB 4WI9A 4F7EA 4FNPA 5I1GL 2MSPA 4ZUVA 4LCWA 4CVWA 4CJ1A 4KH2A 5JUVA 4AH2B 1AE6H 4G8FB 5DUBB 1K8DA 4MGXA 3KXFD 3RJDA 2A9NH 3TIEB 4LYQA 2P7TB 4P3DB 1E5NA 1EZVX 1AGCB 1GC1C 2NLJB 1FBIL 2XKNB 1ES0A 2X4UB 4DTGH 5ICXB 3EOAB 5ALCL 1QSVA 3L5HA 4OZGE 4CKVX 4HJJH 3R06B 4JHOA 1KLGA 4YHYB 2C1PA 3TO4D 2X89D 4ORGB 4GBXC 5I0ZA 2NY2C 2AV1A 2J6EH 2VN4A 5T1MA 3GO1L 5CEZD 3O6FB 4QY8B 3MO1B 5KN5B 2W0PA 2VZSA 5C0DA 1RP8A 1PBYA 2VLJE 1WBYB 1WLHA 3CFKB 3K81A 4PRDA 5LQBH 2DJUA 1IJ9A 5BRZB 1XF5A 1EFXA 5EC2A 3T77A 4YC2B 1RUMH 1OINA 4O51A 4PJGA 1JFQL 3B9KB 4UCFA 2EXWC 3ES6B 2OW7A 2AGJL 2ZUWA 3BKYH 1LMKA 5C7XH 3L2LA 1IGJB 3DUSB 4UDTB 3AI0A 4TSCL 4ZD3H 4NZDA 2Q8BH 4KROB 1KYOK 4NWUH 4O2FB 3QCUH 4XVJL 1JYNA 2HTLD 1FNGA 5GNYA 3EO0B 1SHMA 2Z4QB 4N8PA 4OD3L 5AEAA 4Y4HD 3VXQB 4OM1H 2EBNA 3VRIB 3GKZA 3FO0L 3QOMA 1KLUB 3VXRE 4XBPB 2FYVA 4OIIH 4HUMB 4UQAA 5E9DE 5E94A 5CD5D 3OKEB 4R8WH 2ZOLA 2WMPA 2X4QB 1JPTH 3NFPB 1NP2A 3DGGA 3W37A 4OJFL 3LPOA 2R1WB 5JDJA 2UVFA 3HAEH 1NMCC 1B0WA 1TZHB 3MBXL 1UR4A 2C9AA 3Q5YA 4FXKB 4LARL 3BVXA 3CSGA 5F1NB 3UPAA 1TVBA 1HXYB 1MF2L 3FB6A 5EUOA 3BP4A 3S5LG 3ZKND 1UZ4A 2DIBA 1KB9J 4ISVB 1Q0XH 5E2JA 1U8OB 1BFNA 1H1NA 5IMLB 3ULUC 3SGKA 2WIMA 1JMXA 3EOTL 3JSSA 4JQIH 4OQTH 5IVXA 1TNNA 1QW8A 3EYQD 3P0VL 3RVWC 1ZA6B 1CLXA 4O2CA 3KPPB 1A2YA 3LS5H 4WFEE 1P84J 3MV01 1T1YB 2YL8A 2DQGH 1AIFA 1K8IB 1OTSC 1SMDA 4JFHE 4UBDC 3MYJB 1KN4L 2ZX9A 4Z7VA 5EORL 2M26A 4RIRA 4HK3J 3S37L 5C0IB 4BSJA 1VBRA 2GSGB 1X5FA 1YNKH 4Y19E 3D9AH 4M5YL 3EJZD 1RFDH 4HGWA 1SQ2N 1JZ4A 2EDJA 2G3NA 4ETQB 4R90H 1JXKA 1KWGA 2WWKO 2XTJC 4NKMA 2OWXA 2Y06L 2A9ML 4XZUA 3TESA 4TUKH 4MNHA 2IF7A 4UQCA 4DO6A 1NC2D 2Y1VA 4M1CC 5AD0B 1ODUA 4O9HL 3A4AA 1AVAA 4MVBD 4W8LA 4MDIB 5DD3L 1OD8A 1W72H 1Q6CA 3ULVH 2CR6A 3TGXA 3AJ7A 2XA8L 3GMOB 5FHAH 1L4IA 4MA3B 4ZAKB 1AO7B 3WSUA 1TVPA 4C7FA 3IFNL 4MXWH 1T6WA 2C1OA 1F4YL 5I1DB 1KTDA 1KXQE 1GVIA 3VFTA 4F3FA 5C86A 3CZNA 5C8BB 1J1OH 3GH4A 4JFZH 4OAWA 3OXSB 1ZHKB 3I84A 1H5BC 1IEBA 1VGEL 2OSLB 4KAQH 4U6YA 4I3RH 1BPVA 5ABFA 3NN8B 1YQ2A 1G0YR 4J3VA 3IXTA 2Y5TB 5C70A 4NC0B 4XAKE 3VGBA 4EUPH 3HMCA 4NHCL 4AD5A 4L4VA 4X8JA 4V28A 3C2SA 2HJKA 3L3IA 4A2MA 4CW1A 5GSVB 3KPQB 4PRAA 3SKNA 5GJTL 3RPIB 2FD6H 4NKIH 2GY5A 3CH9A 1E4WH 3GB7A 3RWHB 2W5FA 1INEL 4YK4C 5HPCA 3V5HA 1QX1A 2D23A 1LK2B 2XQBL 5JR1L 1CICB 4C7DA 1WITA 3O2WL 2DM7A 3UPRB 1XIWB 5M7QA 3MSDA 3M1BB 2BNRE 3DXAB 5FHAL 3RWIA 1ISVA 4UIKH 4RISH 3JVGA 5TH2B 1SJEA 2Y5EA 2X1WL 1UACH 4OZGA 2V17L 4Z7UB 1C12A 1T0NB 2XV6B 3MREB 2YD6A 1NFDA 2XT1B 4LLQA 3S8WA 3W29A 3O4LD 4MD0A 4NC2B 2IADA 5IFHH 3QIUA 4OCMC 4OLUH 4CU7A 2BNUB 1RY7B 3VA6A 2CHNA 2BSRB 4YLQT 5GIRB 4J8RA 4OLYH 4UV4H 2XOTA 1B2WL 4ZDHB 4CDGC 4KRPB 1E4KC 2FZ3A 1N4XH 1NEUA 4D1JA 4CKQA 5DJCA 3RWGA 1EJ6A 1TIUA 2ZX7A 4PBWD 2A6JB 1CK0H 1UWEH 1A3HA 1C92A 5HDQL 2V38A 5I1HH 1UG6A 3RDKA 3SKMA 3EYFB 5B3NA 3H3PH 4DEPB 1AXSA 5ENWA 3QWOB 1JV5A 1N6VA 1F6AB 3BAEL 1A7QH 1JE6A 4X4ME 5HI4D 1S8DB 3C6LB 3PDOA 4PJAE 4WY7L 2NTFB 5F3HB 1Z9OA 1CS6A 3GNOA 2X5PA 3ZJ8A 3QDME 4JGJA 3PHSA 3PZIA 3VRLF 5CJQL 3EJRA 5AZEH 4MD5B 2VRKA 3LHPH 5TE7L 3GIZL 1MCJA 1CFNA 3O11A 4Y2DD 4WV1A 5HDOA 1RK1A 1OB1B 3VXRA 5FOBB 1QSED 2ICWI 2J7DA 3S96A 1V7ML 3KPNA 4Q6IA 2I07A 5CPTA 5ID1B 5H8DA 4G6FD 5I24A 3KLHC 4E4PA 4KTDL 1V6XA 1DANT 1NANH 4JFOA 4D0DB 3KLAA 3LSOA 1L8NA 3PZUA 1MFBH 1VFBA 4GKZB 4HKJB 5IMKA 1BVNP 1T66D 2QQLH 1W3JA 1IZKA 4F57L 1N4XL 1BWWA 4H5SA 2DKMA 1U8PA 2YHGA 3WFBL 4NKOA 5ETUA 1A3RL 5EOTA 4UNUA 4RGMC 5I1HL 4WFGE 2JELH 1IM3A 4NO0A 1FFOA 5H37H 1G9HA 3LZFL 4RCAA 4B3LA 3U0TB 1WE5A 2CYGA 2EXYD 3HKFA 4FQPA 2F5BH 1HHKB 3QIBA 4DGIL 1I9IH 3HE6C 1ND0B 1HKLL 4MYWB 3CPLB 1OP3H 5FOJA 1I7ZA 4URTB 1GGCL 5LA0A 4XB7A 4WU7A 2FX9L 3PBGA 4P3DA 1I1AB 3QDJD 2X9YA 4KTEH 3MI6A 3QEUB 3LHPL 5JIWA 1OAUH 3WQ4A 2XKNA 4JCMA 1FLRL 3GJEA 2X4UA 1WAAA 2V5SA 2X8RA 5M5DA 4K23L 4LCCC 3V5DA 3GUTA 1MFDH 4HXBL 1D9KB 3N9KA 3CFDB 3BW9A 1WFUA 5ISZB 4I3SH 3ZJ7A 3OB8A 1S7WB 2K7PA 3R06A 3S88H 2AVGA 3FAWA 2YWZA 2P5ED 4NN5B 4AG4H 4IOIB 1K85A 4KUZL 1KSRA 4U2YA 1OY3B 1TQSA 3KLKA 1OAKL 5K9QG 1EEYB 4LKXA 2WINA 1WV7T 1NGWA 3I9GH 4Z7OF 3GNML 5J56B 4MCYA 1YJDH 1FRGH 3ROOA 4DO5A 1MVUB 1RH9A 3T0AA 1G9MC 1EGJH 5HHQA 4I4WB 4NM8L 5A16A 1QRNA 3VNYA 3ZKXB 4K8RH 3WFHB 1RZJL 4OUUA 1KCKA 3O2DL 3SBWA 4FQHB 3WIFB 2CRIA 1L6ZA 4UDTA 3OLIA 4I0PA 3PP4L 2AP2A 4BZYA 4KKNA 4Z6AT 1PX8A 1KXQA 4O2FA 4PJBE 3WF1A 3TWCH 1LD9A 3GSWB 4HS3A 1BVKB 3WLWD 4FQXC 4KJQD 3VXQA 5JXAH 3ROLB 2WW5A 1MH5B 5CSZB 3ULUH 1SFSA 3HFMH 5CZVH 2DH3A 3AISA 3OKEA 3BP7B 3FONA 5AWNH 1GZPA 4XVSL 3NFPA 4QRSB 3ARGB 1CBVH 1EPFA 2E8YA 4NO5A 4IOFD 1UADC 1MVYA 1ZLUH 1TZHA 1VADA 1T1WA 3X12A 1UR2A 4FXKA 1RJCA 4GAJH 2BVQB 3QIUC 3RJQB 3BAWA 1EGZA 4BF7A 3LH2L 4HH9B 5JBDA 4LOUD 3BVNB 3TN0D 4HF5L 4IMKC 4CVZB 4HSQA 2A1WH 4ZOEA 1IT9H 2Q7YA 3AXIA 2GW5A 1A4JB 2AEQL 2O92A 3QUKA 1PYWA 3O3DB 1U8OA 5I18L 4XI5D 1FNEA 5IMLA 2VAAB 3SUSA 2VOTA 2O5XL 3BZDA 3GNPA 4WENB 4DKEH 1OAYH 4LQFL 2ORBH 1S3KH 4RMTA 4XCCH 4WTWA 3QHOA 3RNQB 4Y8DC 4R4BB 4YHNA 2HVMA 1JNNH 4PBVC 1I9JL 4KK6D 1L0XA 1D5MB 4PLJC 3MYJA 5FEBA 1US3A 5DRXA 2ARJQ 3TNNA 2RCSH 5D72H 3WN5A 4AXNA 5TDPA 5CZVL 1DANU 4YFLF 5A2BA 1ZTXH 1GGIL 4PS4L 5EBMB 4FQIH 5I1EL 1V02A 1F2XK 3UYRL 4YDKL 1NOWA 4Z7WA 1DBJL 4EXPX 5CKAA 1RVFH 1UJ3A 2Q8AL 3CMOH 1C90A 2BHUA 3P9LB 1KXVA 3HCVA 4Q6IC 1FORH 4IRSA 2CERA 2CLRB 3EJYD 5BZWB 3KPMA 4Y4HB 4KDTA 5AD0A 4AZGA 4HKZA 3TEUA 1YHTA 1YDPA 5F7YC 3WLBA 1IT9L 4ZFOL 3UBXA 1BTCA 4MJ5A 2CK0H 2D0FA 2PF6A 4ZPVA 4R3SB 4K07A 4TXEA 5HGDB 2XRAH 2C7FA 3BESR 4XNQB 4PJ8D 1B2YA 2VLRE 5ITFA 4XT1C 4QHNA 3SKOA 1DQDH 3IAGC 1A02N 1JNNL 1XCXA 3VIPA 1JN6A 1UA3A 3E6FB 1ZWIA 4JFDD 4NSKA 3S6CA 1HVXA 4ATLA 1SY6L 1T80A 3PWJB 5D7LE 3DI3B 2GJPA 1JWMB 4TNVF 1D5XB 4XCFH 1JNHB 4PJCB 2XG9A 3H3BC 4OUEA 2VQTA 4NRSA 4KMLB 2ZX6A 2H8PB 3QFDB 3W0WD 1IFHH 2WMFA 4YHYC 4XWGL 3V7MA 3GMRB 4S1QL 1E0OB 2ESVD 3QDGD 1AY1L 3OF6A 1K3IA 3PP3H 4YFEA 5L8LB 1P1ZA 4OI8A 3O6FC 1V3MA 3EOBA 5DMKB 4XPBH 1K4DB 4MQSB 3EW3B 3ZR5A 4NQDE 3UPRA 4GAYA 1Q9KA 1TITA 5ERWA 3DXAA 5J6GB 4JO2L 3VG0H 2ICEA 4UINH 3PTKA 4PJ7E 5TH2A 1MHCA 3MACL 3B9KC 3GMNA 3WDHA 3WL9A 4Z2GA 3WKMH 1V0MA 3TZVD 4RQQB 1NC2B 4Z7UA 3KL0A 1U9KA 1T0NA 3SBWC 3S5LB 1LE9A 4DM2A 5ICYA 3H2WA 3NSXA 2GUOB 4X7SH 5JMRA 1CGSH 5GIRA 5JO5B 4KROC 2NTSP 1R7OA 4F7CB 2VNCA 4M6AA 3ZO9A 4PMUA 1HWWA 1N6QH 4WW2F 4HT1L 3POHA 5AYQA 2DSVA 4HGMA 1I8IB 2H6PB 2LFGA 3OB0K 1AQDA 3FQRB 5EBWA 3WEOA 3GIVA 2L7JA 3MMWA 3PL6D 2DTSA 3QG6B 3ZM8A 2X10A 3DOSA 4ZTOL 4JFUA 1EVUA 4F58L 3ESVF 1QBMH 5HPMB 1QA9A 4UQDA 3C6LA 5I6SA 4AD3A 2N7BA 3N06B 5F3HA 1JGVH 1JYXA 4YHZL 1P4IH 4XPBL 3RKDC 1F42A 5L2JB 1IAOB 5LXGL 3F7PC 3LN5A 4XV0A 1Q9LA 2B1HH 4S0SD 5T5NF 4K9EC 2OYKA 2F53E 2E6JA 3DWTA 3IGAA 5D2NE 5I0DA 1AGDB 5C09E 4ELKB 3IU4H 3OAYK 4G8GE 4YX2L 1HKIA 1BLNA 2VURA 3W28A 3NBNA 4HJGB 2M8XA 4Z2LA 4GOSA 3QP3A 1N0XH 4GKZA 5CCKH 4HKJA 5D96B 3MFGB 2EDNA 2X2JA 1MCPL 1EEZA 5KSVA 2IFFH 4QHLB 2UZIH 5EZOH 1EJOL 2AJVH 1EO7A 1C91A 4Z7NE 2HKHH 1YMME 4X5WA 2R1XB 3BUTA 2ENSA 4ELMB 2ZX5A 1HOCA 1BOGA 4YN5A 2AJ3B 1LF1A 2Z35B 4HIJA 2AAAA 4JN1H 1PIFA 3O4LB 1FQ9C 4N5UA 5IWLC 1V6WA 3F4VA 4CUCA 4E42A 4M6MH 4P5TD 4TVPE 1ND0A 4ZUWB 5DVMA 4G6ML 5J12B 5K9KB 2GJRA 1HP4A 3CPLA 3LB6D 2PWHA 1P4IL 1KXVC 3CSYB 4ZPTA 4AYGA 1VEOA 4AZIA 4N1EA 5HI5D 1I1AA 3ZT5A 3DX9B 1EUUA 4FNRA 3PABB 1GOWA 1L9NA 1LJYA 3N11A 4QTHA 3QUML 1OAZH 1UYWH 1RIUH 4NNYB 5HXMA 1H4PA 4LIQL 1RUPH 3DSFL 2FX8L 2NZ9D 5DD0H 5ABHA 1A1OA 2J2ZA 3VFMA 1CIUA 4ZAKC 5EZIL 5E5MB 5DA0B 4F7MA 1KIPB 2BVYA 5HGGS 4E41D 3OJDB 3HPLA 3X14B 1DUYA 5LCVH 1T1ZA 3VFRA 1C5DB 1F4XH 4IOIA 4NQCD 1AP2B 4XH2B 2JALA 1XH3B 3INUH 4GMTL 4WEUD 4Y2DB 2E7BA 3PHAA 2AK1L 1ERNA 5DMIH 3ZSTA 1QSEB 1AHWB 3D50A 5I1IL 2XUCA 4PMQA 1HNYA 4QRPE 4F2MA 4XBGB 2IC2A 2QQNH 4M7JH 1S9VB 5TDNB 1A9BA 3MPCA 2FGWH 4GMSL 3HG2A 4G6FB 4M00A 5EO0B 2OQJA 1EA9C 2E0PA 1TPXB 4FQHA 4U1SB 4U6HB 5FYKH 1B0RB 5CUSL 4PGCA 3PZVA 4KHTH 3MS8A 5F9OL 4PUEA 3W53A 3RWJB 3EIFA 2VLRA 3T3MF 3F65A 5JHLL 4N90E 4UQ3A 5B38G 1DFBL 4HU0A 4PRPE 4P5MB 4LPVA 5IIEB 1D5IL 1ODZA 4L5FH 2LVCA 1W2VA 4AIUA 1J0IA 1H8SA 5HSFA 1CICC 1P7KB 3FQTB 4L8BB 4UILH 5DJ0B 2WUBL 3ROLA 1XIWC 1RUPL 1CZ8H 3SCOA 4JY4A 5D7LA 2AJSH 4JB9H 3U5YA 3FFCE 2CO7B 4QRSA 3L4TA 3MXVL 1UM6H 3KXFA 1OGSA 1TMCB 2V7HB 1F4XL 1DJSA 3QDJB 5ACZA 2IGFL 4R0LA 2L7UA 3WDQA 2CGRL 1BG9A 3OQ3B 2BVQA 1PSKL 4M6NH 5HHNA 4Y16A 2DLFL 4XTRC 2X4TA 4BJLA 3QNYB 3RDTD 3CDGB 2FR4B 4M7LL 3D39A 4HH9A 3VX0A 3BVNA 4KRPC 4NQDA 2HFGL 2CKSA 3MRGB 4WLCA 3TO4A 3O3DA 1E27A 4PRHD 1NLDH 4U2ZA 2GUYA 1HKMA 1KGWA 5F72S 4FLOA 2P5EB 2XGIA 4PJ7A 5DC0A 2ZG2A 1PKQB 3WUGA 1LP9E 4DEPC 4C54A 5C07A 5IVOA 1KTRL 2EDFA 5A2LH 1A7RH 5KOMC 2PKDA 3C6LC 1GJUA 1FH8A 3HLAA 3ILQC 5EU5B 3AFBA 4CD6A 3OKDB 3BAIA 3SKUD 5I74C 1FN4B 1NEZG 3B9AA 4JY6B 3U0WH 1XC6A 2EYSA 4QXTB 2QQKH 3RQ3A 4KPHH 5D1QD 3C87A 4PYHA 2QPUA 5EZJA 2PB1A 1IKNC 5HDBF 1I1CA 1R0AL 1JZ8A 4KVNH 4D3CH 4M7LT 2OLDA 1I8LA 2R56H 3EFFA 5C0EB 3FB5A 4KUCD 1DBKH 3T0VA 4N0FB 4QXUL 5BZWA 5TDOB 1LQ0A 1J1XH 2ATKB 3CVHL 4JRXD 1JWUB 1G7PA 5I75B 3VWJD 5E2UH 3WUWG 4EQ2A 4S1RH 4X98A 3O0RH 4S2SA 3ZE1E 5FV1L 3VRJB 1UYQA 3WFLA 2I25N 3T0EE 3MV8D 1H0DB 4R3SA 1DLFH 4FOMA 3WD4A 2VLME 3OZ9H 4P2RE 2IBGA 2F53A 3G6MA 1HQ4B 4XNQA 1GRWA 4ZSOE 3REWB 4PLKC 5D2NA 3M8OH 3H42H 3BYTA 4X6DF 1DCLA 3GSOB 5F44A 4H26B 1A7RL 4PV8B 3LMYA 1HINL 1KTKE 2VC2H 5DQJA 2P5WE 3UJTL 3TFKD 1OD9A 3TN0B 2NY5C 3GKWL 3BZEB 1HKKA 3CU1A 4JO1H 4HU8A 1ZLVH 2IAMC 1I1AC 4L8DA 3OZPA 1BJMA 1ZS2A 4GXVL 5F70A 5KVEL 1YY9C 1HDMB 4HLZG 4KK9D 1UWSA 1JNHA 2IBBA 2F58L 3RTQD 4PPTA 1D9KC 2R8SH 4W8BA 5DT5A 2H8PA 1N8ZA 4P9MH 4X5XA 3FT4B 4L8SB 5D71L 5E6IA 1DWJM 3BT2H 5DSCA 5LGKA 5TPWH 1XR9A 1X5KA 3GMRA 3WHXB 5BW7A 3A0OA 1JF1A 4HULB 1RZGB 3IJ7A 2YLAA 1K6QL 3ABZA 3TV3L 5GHWH 4HFWA 1BZ7A 4JDTH 4PFEA 4OCXL 2B39A 5JW4N 4H8WC 5J6GA 4WHYH 4Q9QH 2VWEC 2NT0A 3EAKA 4WKAA 1DLFL 3OZ9L 1M05B 3QRGH 5MEQB 1CGUA 3WE6B 4NQED 2J7HA 1JGDB 3LQAL 3W11D 1EX0A 1BIIB 2HA1A 3MSPA 3RVUC 3ZKXC 4NRXB 1HILB 2J88L 4Q0XL 2VAJA 3O3AA 4P7QA 1AKJA 3UESA 3V0WH 4M7KH 5SX5H 1RK0B 2EDBA 3GRWL 4JO1L 1B3JA 1ISWA 3ZDZE 1BYAA 4ODBD 3BCDA 4NBZB 4K9EH 2BXZA 3MA9L 1FNHA 3RY5A 3CUIA 1BFOB 5BO1L 2VDMH 5K9JL 2E3VA 4PJ8B 3UETA 4ENEC 4DOHE 1CE6B 3B2VH 5LAXA 4PJXE 2DWEA 2WVUA 5I2IA 2NYYC 5D6DC 2Z31A 3IDMB 1QFUL 2HAZA 1MFNA 3LQMA 4P9ML 3X17A 3GXPA 1T83A 5DQDL 3BLKA 1OM0A 3OL2A 4DKDC 3ARGC 4JFDB 1A6ZA 1U8IA 1U2HA 3DO7B 1T2QH 4DO4A 1D5ZB 3QZWG 5E8EA 1I7TB 1BEYH 4MAYD 3H9HB 4OF7A 3VGGA 1C8PA 3QIWD 3QAZB 1IAOA 4C4KO 2DQFB 4X80H 2Z93B 3ECBA 4FXGA 1QQDA 2V2XA 5I1LB 4NQVB 3VXOA 3L3KB 2D4DA 3BYYA 3DBXA 3W0WB 4NGHL 3NGBB 4KRLB 3C6SB 2GFBA 2ESVB 3QDGB 3HZMA 1KGUA 2JFEX 4PYGA 2ZSWB 2B4CC 3ZE2F 1L0QA 3CTTA 1CXHA 4XP9H 4LLMB 5JW3H 1FP9A 3VXSD 1QVOA 3NPZB 2Q6WB 4AMCA 5FM4A 3LKRB 3U4BH 15C8L 4BZ2L 2QHRL 1W2KT 1G7HA 2PYED 3HMWL 2A38A 1V6UA 3NA9L 4F33B 2R1XA 1LO0L 4TYUA 3TZVB 5HY9B 1HKJA 2DB8A 3MLRL 4RZCA 4PJHE 5GGQH 3ZDYE 3VH8G 3HRZB 2AJZB 3RY6A 2EECA 5TE4L 3TJEH 4R4FH 3T3PF 4K94L 4AMKL 5I2UA 1DBBL 2YBRB 5ACLA 3R4DA 2AMGA 1YPZB 2RGSA 1LP9A 3NAAH 4CVXB 5KVMC 3PHQA 4TNVK 2YWYA 1CDCA 2GITB 4QHKI 4Y4HC 3HMXL 1NQ6A 1V7NL 2DWDA 3PL6B 4NKDA 2HTKD 4DM1A 2R0LH 1E56A 3CUFA 1DZBA 4XNZB 3BSHA 5IHRA 3L3OB 1Z3GL 4NM4L 3DX1A 1T04B 1W8NA 2CDEB 4HKBB 3MRCA 5F7KC 3G04A 2BRRH 5ID0B 5MP6L 1ZANH 3RX5A 2J7EA 3SDCD 4H2CA 4N8CH 2QLVB 4FQJH 1S7TA 4UT7L 3BJ91 4ZS7L 5JW3L 4HPHA 1FPTH 3SIMA 3U4BL 1LEGA 2DD8H 5HOSA 1HSBB 3RWEA 5B3JE 4CCDA 3RUGA 1CIDA 3WSQL 5CGYD 3CLWA 4Y2DA 3QI9D 4QYOB 3ZKNC 5EOCH 1QACA 3MLSH 3NA4A 4XMPH 1X5AA 1S9VA 5TDNA 5CMAB 1NCCH 3ALFA 2DI9A 5JIIA 3EYQC 2X44D 1V3JA 1KN2L 4U1IA 5E8DL 4OD2A 3VD4A 1JGEA 4LEXL 3ZYOA 2WNWA 3MJ9A 3G9VA 4AENA 2BOCA 1MREL 2XKSA 3SOBH 1GVYA 2P5WA 3K1KC 3PF2A 1K9DA 2R0LL 5EOQH 2IG2H 3FQTA 4XP1L 2EYTA 4L8BA 2WCAA 3EJZC 4UZSA 1JZ3A 3WFDH 4UT9H 5BS0A 3NDZA 5F88B 4P5TB 1ACYH 2NXYD 3EBAA 5LVEA 4FNSA 1ZANL 4FQJL 4OTXH 2V7HA 1TLKA 5C0AE 4NXSA 4OZIF 4ESKA 1MQKL 3L3GA 3HNTH 4MVBC 2PO6A 4HJ0C 4D0CB 2CDFB 4BFBD 4E8CA 2NW2B 4HX1A 2C4FT 3QNYA 1GONA 3MLSL 4NZUH 5HHME 2JJSA 4JPIA 1DWHM 3JWDL 2YEZA 5JHDD 4IIQB 3MRGA 2JKXA 2KKQA 1WUNT 2WC7A 5AG8A 1A22B 4E41B 3O41A 1FDLL 1CLZH 2DLTA 2XXMB 4LPUA 4NQCB 4YBQC 4WSJA 1C08A 4NQSB 4RMSA 2J79A 5DTFB 5KSBB 1RUKH 3AREA 1JGLL 3EYSH 3I3DA 1TE1A 3SOBL 3JTSA 4CMHB 4OZHF 5HVFB 5EU5A 3FOMB 1ETZA 4NNXB 5EOQL 4CN1A 4PY8J 2UWEF 1I75A 4GSDL 1T0MB 4P46C 4JZ5A 3BISA 1CR9H 4R97B 4NYLB 2MHAB 4RE2A 5F1IA 4P23D 1OHQA 3AMDA 5GGRB 4HA3A 2UYLB 1XGQA 4ZO6A 5AYUL 3WCYA 3L7FB 5I78A 3B9DA 1T21B 3P4NA 1NBYA 4MAUL 2ZUXA 4HWUA 1FVCB 2FJHB 2VDNH 3L7EB 3EKCA 1GH7A 5FYJE 3VM5A 2XZAL 4GW4B 4ONGL 1PY4A 1SZNA 1NC4A 3FN0H 5D96C 1KC5H 4AW7A 4PBGA 3DX7B 1WF5A 3VRJA 4HEME 3PGDA 2BVPA 4Q7NA 4PMXA 3DVIA 2LABA 4H0GA 1OTTD 2FHBA 4D6IA 1W9VA 2ADIB 3BH9B 3IETB 4CN6A 5L88H 3EDJA 4JM4L 2O61B 3EYVB 3GSOA 4NNPL 3REVB 5E4EB 3RDTB 4IOSD 1RUAL 5J12C 3P4MB 3OBAA 4X6CE 4GXPA 3FXYA 1H3PH 1T4KB 3DETD 1IGYB 1VENA 1JF5A 1B0GB 4KC3B 4PRHB 4A6YB 5T3ZE 3QA3B 3SDDB 3MUHL 2AI0H 3MGTA 4MXVF 2PR4H 5B38B 5I8EB 1X5ZA 2JE8A 3F6IA 1MCHA 1MRCL 1FNAA 4U7MA 2J4GA 5D1ZA 2FATL 3IVKA 1IMHC 5B21A 2IH3B 1S9YA 1CENA 5HI4C 4CJ0A 1JYWA 5JTWA 4YXHH 3HNVH 1RURL 1IKFH 2EDLA 2QEJA 1LO3H 3GK8L 4TUFA 3WMCA 2DM3A 3ZL4H 3G6JF 3PJSA 4D6GA 3QO0B 1Q4NX 4Y2DC 3FOLA 4G5ZH 3WEXB 3VFPB 1BGXL 2ADJB 1IGTB 1LWRA 4X99B 1OIFA 1I3VA 4ZTPH 2X4NA 2A6DB 1BYCA 1DWAM 1XYZA 1AHWC 5E03A 2WWCA 3P4OB 1U3HA 5E2VH 2CMRL 1WBZB 4X6BA 4L3CB 2J8UB 4XPTL 3CMJA 2DIJA 5DK2B 1BIIA 4PG9B 4L4TE 2VZ3A 2EIDA 1TPXC 2DM4A 2VISA 4JRXB 3OKMA 2ARJB 1IGCL 2CRZA 4BH7A 3VWJB 1T66C 4OGXH 4U6TA 5F7EL 3TYGH 5BJTB 3MKKA 4WKFA 1B3XA 4Z2JA 3L3JB 2BJMH 4TUOB 1KGCD 3MV8B 2J47A 3N9GL 3L2MA 2FEDD 4YZFF 1BFOA 4JL1A 2EDYA 2R0WH 4PJ8A 4Z95L 3P30L 4WUUD 5F1SA 2W66A 2EXYC 3HUJE 3RWFA 1BQSA 3IDMA 2VR4A 2B4CH 4K3DH 2C4FU 4YHOH 1SBSL 1OGTA 4PB9H 3ZTNH 4QLKA 1NEZB 4K7PX 2A83B 3UTPE 3QHFL 1EOKA 1QD0A 5A6LA 4JFDA 3PN8A 3NIGF 5A2IH 1G7LA 4ERSL 5CJOH 1D5ZA 3VFNB 3CPUA 1I7TA 4RA0C 3O3EB 2CIKB 3RGVA 3FT3A 3KL3A 1CTOA 5ESQB 1WEJH 3AZTA 3VIKA 1QNSA 4P59L 2R2BA 3L3KA 2ICES 4YR6B 4LPCA 1TZIA 1GOIA 1NLBH 2XIDA 1HXMB 3V7AE 4R26H 1R86A 5HJ3A 4NZRH 3NUKA 5AC4A 2JCCF 3C6SA 4G80B 4Y4KD 1A6AA 3HZKB 3WUWB 4N9OB 4KMQA 2F54D 4LHUA 2EC8A 5HGHB 1RHHA 1FE8L 1ZK9A 2ZSWA 3I6KB 1DN2A 3C5SA 4HS6A 1H49A 3MLTB 4U5KA 2YZ8A 5D6CB 3TT3H 4Q22A 2H2SD 4UV7L 3LKRA 4U6VH 2OYMA 4WI8A 4ZUSB 4F9PA 1FIEA 4WW2B 5SV4A 2CKBB 3RA7L 1H3XA 1E0WA 4YQXH 2OTUA 1E6XM 2H45A 4NQEB 2DQHL 4OF0A 4LRIA 1MJ7L 5GRWA 1TTGA 3C2AL 4M62L 4OM0L 3QEQD 5TFSL 3TZVA 5EWIH 1QBLL 3BAJA 4KJYA 1UQSB 2IMMA 1FO0L 2ZWYA 2JK5B 3U7AA 4UTBL 2FDBP 5MHSD 2YBRA 1A14L 1IGFH 1H15B 3NIDE 3E6HB 4JZOB 3HB3D 5IFJB 5SX4I 4J3UA 4ZFZA 4EEEA 4GIAA 2VLKD 3IXAA 3NCBB 3OKNB 4CVXA 5FD0A 2HRPH 2OJEA 3D3VE 5DD5L 3WXWH 3MZGB 3WLWC 2ILLA 2WZEA 4KJQC 5M95B 4G7VH 4OCLC 4KMTL 2JB6A 2WM0A 3PL6A 1CLYH 5DYOA 5I8CB 3HI1A 2VSDA 4C56E 3CC1A 4WJXA 1BVLB 1S78D 3K8KA 3L4ZA 3DYPA 3TM6A 4ZS6D 3VXUD 3U0PB 1FCGA 4MA7H 4MAYB 3W9EA 4BZ1H 5JIHA 3QIWB 3MGOB 1LK3L 1AGEB 3GMMB 2G60H 4HHAB 3MV9D 4GZEA 1QOKA 2OZ4A 4CD4A 1RZFL 4M1GL 4J4PD 4LOUC 2FB4H 3TN0C 4EN3A 1XCTB 4M48H 1WTGT 3HC4H 4XAWH 4QYOA 5DFVD 1R24B 2OI9B 1JHKL 2GTZB 2X1QA 3OKYA 1UM4L 4PJFB 3TH2T 1HKFA 1BYDA 4XI5C 2VB5A 3QR3A 4HUWB 2W63A 3RIKA 3X3GL 5FKYA 3MOAL 1RUQH 2JJUA 1JPFB 3VXSB 1FJ1A 2HVKA 5E7BA 3HN3A 1MFAH 1U93A 1XH1A 1AXTL 4DCQB 5F7HA 4KK6C 4L8SC 3BRGC 4BQCA 2PYEB 2KZWA 3V4UL 3PG2A 1PAMA 1MFUA 3HI5H 1UD2A 1ZS8B 4YDJA 5D7IF 1G9NC 4LSRH 3KJ6L 1XGYH 3OHXB 4FMFA 2GK1A 3WF4A 5D7JD 2R2HA 4WTZA 3BD3A 4K7PH 3QZWB 6FABH 1FYHB 4P5TA 4X0VA 4N0YL 1B1YA 3NYDA 3EDDA 4NSBA 3U6RA 4JKLA 2WHKA 3BKJH 1Q72H 1V05A 3SCMD 3AXLA 4XGZA 2C26A 2VERN 1NCDL 1KIQA 1T7ZA 2F9BT 3EJYC 4TVPL 5IESL 2GK0A 3QCVH 2ATPB 1K2DA 3DNKA 1UKPA 1CFSB 2VCCA 3WS3B 3LEXA 2N7AA 3BIKB 1M4KA 2C7UB 5A2AA 4Y8AA 5IROC 2W9EL 4PJIB 1KBGL 2N1KA 1GC1L 3U79A 5ADOH 3SDCB 1F5WA 5CSUA 1VPOL 5JLZB 3QG7L 2P47B 4PJ8C 4ALAH 4NCC2 3MNZA 4B41A 3OKKB 3MU7A 4GRWB 4NQCA 3WUBA 4FMKA 4UT6L 5DTFA 1A1MB 1ZLWH 4DZBB 3WD2A 4L4TA 3UTZB 3ISWA 1KCVL 3QI9B 3RL1B 3J7HA 4O58L 3BZ4B 1QTYT 3EGSA 4MS8D 1KQYA 1G6RA 3VH8B 1KPVB 2VH5H 4N5ED 4BSVA 1BZ9B 3VW3H 1YEHH 5IEHA 4P7NA 4FP8L 3E3QC 4NNXA 2WC3A 1J9YA 3P4LA 3V4VH 1CFBA 3QAZC 4XP4L 1R3LB 2VL4A 1NBZA 1YYMH 4NYLA 1FH5L 4OF5A 2C8NA 1NWSA 1XCWA 1KNOB 1OGAE 3NGBC 3B5HA 3L7FA 1T21A 2ZXAA 2XWTB 3W39A 2XN9A 2YKLL 3GBDA 4LVOC 1OWRM 4JO4H 3FRUB 2FJHA 5CD3B 1AQKL 4N9GB 3T4AB 4NC1E 4OV6F 3TYFA 1MJ8L 5BVPL 5DD1L 3BVTA 2DQDL 4GW4A 4HIXL 4H25A 3DIFB 5CQ1A 3GSUB 1NFKA 2NXYB 4XPAL 4PJ5D 3MRJB 1FFPB 2FH8A 5DD6A 3CUPB 3ZZ1A 2P43B 1MELA 1KB5L 4I9WE 4FFYL 3PWVB 1NGQL 5E8OB 3TZVC 4M6OH 1B4JL 4ONFL 4HBCL 1ZKAA 5FGCB 4DKFH 5J9PB 1T1XA 3WFZA 3IETA 2ADIA 3F5WA 4DGYL 5HYIA 2O61A 1KEGL 3EYVA 4RWHA 3REVA 4JDZA 5JOFB 4W84A 3P4MA 4PUBL 4MNKA 2JB5H 1T4KA 1N7ML 4W81A 2FYYB 4PRHA 1TA3B 5B38A 3C8HA 3QH3B 4F9LC 4XNZC 3A3HA 2E27L 4L29A 1RJLA 3QXDA 2ZKHL 4HIHB 4WNQA 1YEFL 4W86A 3MJ9H 3N1GC 2O9TA 3NFSL 3FTGB 5IW6A 4JO4L 4NBYB 5ISZE 1QEWA 2YLLA 4GAGL 2A6IA 3HPJB 2WAGA 3BMVA 3WQWA 1GZQB 3V79C 4ZODA 5IMMB 4MNQD 1RZIA 3D3VA 1MI5D 3D85A 4C57C 2E7HA 3WEXA 5D1QA 2ADJA 1WTLA 5D2LB 4P23B 2A6DA 1JZ2A 1E28B 5DGQA 1O7DC 1EAPB 3FCTA 3MLWL 4YO0B 1WBZA 3GSQB 2VWEE 3VPLA 5DK2A 1MJJA 4QNPF 3GBEA 1CLCA 2F7QA 5C8JA 1EHLL 4Z7QF 4OIFA 4JRXA 1MWAL 2ARJA 3EHBC 3MUY1 3RVVD 1I9RH 2WANA 2VL5A 3GSNL 3AC0A 1RMFL 5IEKB 4QTIH 2Q20A 5E6YA 3A6OA 5IBLC 3C09B 2VDRL 2N56A 1YEKH 2AEWA 1IC5H 5DT1H 5HHOA 3AYSA 2AK4D 4H88H 1X4YA 2EO1A 5AYIA 4M1RA 2VKXA 1J11A 1QSFE 2MNUA 5A6SA 5GS0L 1HYRC 4CU6A 3RJYA 5ANMA 3S35X 3C60D 2QSCH 1FG2B 1W0VB 4LVHB 3DVGA 1EQPA 2A3BA 1NEZA 5HGAB 3K3QA 3LB6C 3RBGA 3WIIH 4QT5B 1YN6B 3QEGL 1KJ2A 5HI5C 2X4PB 3MR9B 1CD9B 1W0YT 4UQ2A 3TBTB 1G84A 3HZVB 1LG1A 4P2CG 3O3EA 3MJ6A 3O6LL 3NIFF 4RMVA 1PPIA 4WI3A 3RTQA 3VI3F 4M02A 1QNQA 2NZ9C 4IS6A 3EJQA 4YR6A 1XGPA 4H8VA 1HXMA 4IIQC 4G8IA 1A9EA 3WEMA 2DQEH 4G80A 1BF2A 3BC9A 4XCNB 2PF0A 3MV7E 2OR9H 1EHAA 5HGHA 2GHWB 5J1AB 1J12A 3MLTA 2VKWA 2WVTA 5D6CA 2OM5A 4D8PB 5CEZE 4L9LA 4ODHL 3A23A 3FMGL 4M43H 3TTQA 4WW2A 1LEKB 2I27N 4CMHC 3B43A 3R1GH 3DECA 2NY7H 2YBTA 4NQEA 5F7NC 1PDKA 1E40A 1C16A 4YAQA 1Z2KA 1PQZA 1H3WM 2YPLD 3QJFA 1P5VA 1JUFB 1VA9A 1I7UB 4MB4A 4KGLA 3OB0H 4KI1A 3DUHA 3S36X 4ZFFA 5J57B 4UFMA 4DUWA 2FBJL 4MQTB 4R97C 3WIIL 1A1NB 1C5BH 1H15A 1TVNA 3U7VA 4G9FA 2DQJH 4XPTH 5J4MA 3IDXL 1KCUH 3OKLB 1A6UH 3OKNA 1RZKC 4LNRB 2YXFA 5DEFB 1P9MA 5DMGC 3EYUH 1VEPA 1FFQA 2QSQA 2KL6A 1UM5H 4XP6L 3VGDA 1MRFL 3VXTA 4WUUB 5F7WC 3SGJA 5I8CA 1SVCP 1QLFB 3SQOH 2WCSA 4XNXL 2EEXA 4PTUB 1HX0A 3EOYG 2P8PA 2NW3A 2DQIL 1Y18B 4FN0A 2IQAA 2V6HA 1X5YA 1S5HA 1ZLSL 4MAYA 3OAYH 4X4YA 3SKJL 1OGAA 1J0ZA 3MGOA 1AGEA 1T3FB 5K9QI 3IJ9A 4AIZB 5E4EC 3RDTC 3H0TB 2DDXA 2DQCH 3FKUS 5DWUH 2HH0H 4OT1L 3VUPA 4IRJD 8A3HA 3O6ML 3GHBH 4PGEA 4GFTB 3BQUD 1H0GA 4Z5RB 2VO5A 5E2TH 4Y4KB 1KPUA 3OR7B 1Y0LB 4HUWA 5GGVY 4BFEA 2F54B 3V8CA 4TVSa 3X13B 3SDDC 3ME0A 5GRVL 2Z91B 4NUJB 3FW6A 3A67H 4OV5A 1JPFA 1FAIL 5I79A 4KGJA 2W65A 4M5ZH 3BEVB 2VXSL 5ITBL 4YGVB 4CADA 5L2KD 1FL3A 4PJCE 4CAGA 4DCQA 5IV2B 4FQQB 1HK6A 2ITCB 4JQXC 1H9VA 3W9DB 4IM4A 3IRPX 1GJIA 1X5LA 5AAMA 3S35H 3QEQB 1R46A 1A7OH 4LLDA 3I6GB 2CHOA 2P42B 1E6JH 2F5AL 3CDYA 5FGSA 3RWCB 3CIVA 4KI5F 4QRRE 3I02B 1P4BH 5DJYA 2WWKT 4P8VA 3KG5A 1QNZH 2VLKB 3AVEA 1KXHA 4M9PA 3W0KA 1AGFA 3L4UA 2EC9T 3U1SH 5EDXA 3IGUA 2ATPA 5L9DH 1WWCA 1CLOH 3VWJC 3STLB 1BIHA 4QRQA 2V2TB 2OJZH 3KPLB 5IVZA 4X7DC 1Q6GA 3JWOC 5H37G 1MUJA 3ZKMD 3VXUB 5I15H 4M03A 4MA1B 1T5XB 2FDMA 4ZMAT 3LXCA 1ZVYA 5DO2D 3MCLL 4M5ZL 3OKKA 3VMOA 3EDFA 1B6UA 4DN3L 1KCSL 3QUZA 2R0ZH 3HE7D 4UU9A 1HN1A 4DZBA 1F58L 4TNWF 5EU3B 3TFKC 5JXED 4TX8A 3SCSA 2A73A 3QI9A 4QOKD 4EXKA 1KCLA 2QKIA 4JFPB 1DQTA 1ZE3C 1KPVA 3CFCL 43CAB 1CFVH 4WU5B 5LGHH 1I8KA 1ACZA 1MEXH 4L4JA 5BV7H 3S36H 1SR0A 2J4WL 4E0RB 4KK9C 1RJZA 5EN2B 1JPGB 3SDXF 4R96A 3A6CL 3VDHA 1HEZB 4XBEH 3D69B 1TQTA 3ZE2E 1FH9A 1G9ML 4LXFA 4FTVA 5D7SL 5C0CD 3ALGA 3GDBA 3MLVL 5KW9H 1KCRH 1BHGA 1LDPL 4X9HA 3U1SL 2XWTA 4BUHA 1F4WL 2W0KA 1A3LH 2BVTA 3AAZA 3FRUA 5D4YA 3D0VB 4M4PA 4K3JH 4GINA 1HH6B 2OJZL 4AYFA 3BE1H 5DA4A 5L6YH 1YNTA 1BQHG 1E72M 3CLEH 5SWZA 1W9PA 3CCHA 5DEZA 3DIFA 1P6WA 3PWPD 1OAQL 4WW2C 5IFAL 4PRBA 2EQDA 3EMZA 5EBLB 3CUPA 3UTQA 1IQDA 3O6KH 3SE8H 2QR0A 4JANB 1MJUH 2DICA 4ODTL 3SCMB 2FJFA 1H3VA 1EUTA 1R5WB 3DHUA 3L1OH 4GRLA 3CC5A 4V1DB 2R0ZL 2ZOKA 1I3RB 2APXA 5DJDB 3FO2A 1WJ3A 1AR1D 4LASH 1CU4H 5E0FA 5T33L 4ELME 2R29H 4QHUB 3HG1D 3MRIB 3NCYP 3TBVA 2ADGB 7FABH 3VXMD 5FHBH 1FZMA 3O4LE 4CD7A 2Z8SA 2OZ4H 5JHDA 5JUEH 3DARA 1SMAA 1GCYA 3KPSD 1II4E 2WXDM 1ISZA 3ET9F 2NR6D 3OKOB 5SV3A 1U8LB 3SJVD 4P9HL 4PP2A 3UROR 3T65A 1R3KB 2ADFL 4X83A 2BC4A 1B90A 3MCKB 4JFFD 3F7YA 2V5MA 3LAFA 1RU9H 4UNIA 5KW9L 2P1YA 1ZJAA 4MNMA 3OG2A 1A3LL 2J78A 2G9HA 1BQUA 1KEMH 1BF8A 4MAYC 4X9GA 1UFUA 3HPJA 4ONHA 3QIWC 1SYVB 1BLIA 1U8QA 4K8RD 3ULSA 2WYSA 1F3DH 4JLRA 4ZXBD 5IMMA 3VJ6B 3DV6A 1KPRA 5CJ5A 1ZGLB 3PGFL 5GISL 4APQD 1Y6MR 5A8NA 1RPQA 5D9NA 2F8QA 3QXAA 2C3XA 5T3ZH 1HJWA 2OI9C 3L1OL 1EAPA 4XPFH 5C0JA 5IT2L 5MEND 1ZT1A 4X6DA 1QSEE 1IBGH 1E71M 5D1XD 4RMWA 5DHXB 2W0FA 2YIHA 1YEGH 3TBWA 5GGTA 1INDH 5JUEL 3GSXB 4RMQA 4PJ5B 2FGLA 1KULA 5FYJL 5FA3B 4S0TD 4M8QB 3RO8A 1PD6A 3SCTA 4TRPL 2EC9U 1U3YA 5DLML 2F74B 2AJYH 1DE4B 1FG2A 5IBUG 2VC9A 4U1NB 4G9DA 4G6AD 4LLYA 3L5WB 5HGDA 1DUZA 5K59F 5ALBL 3AYRA 4LYRA 1CDIA 4ZFMA 5EG6C 2YS4A 2H26A 1KJVB 2WQRA 1B3ZA 2YA1A 4PGDB 1DWFM 5GGVL 3RFZC 3G6JB 5TQ0H 4HKXB 1G6RH 3MR9A 2EXOA 3FN9A 4NDMB 3AQUA 3DHPA 1U8KB 4TPRH 2HTKC 2ZJSH 4LCIH 3WIJA 3C8DA 4XCEA 4BH8B 5T3ZL 4OFVA 1NCAL 1TFVA 1VRXA 4WI6A 4UUJB 2RB8A 2X4OB 5FUCE 3PIQA 3GBMH 4W89A 3SPVB 1N64L 3U36A 3ARFA 1WC7A 3SDCC 3FQWA 4QRRA 2TAAA 2D7QA 5J1AA 5C0FA 4MNQB 2YPKB 3MRPB 4EDWH 1A7NH 4HUXB 2VSCA 1MI5B 4PJEB 4F9DA 2P5EE 5JQHC 2W59A 2Z8VC 1KGXA 3PWNA 4QCIA 1NSNL 3LRSB 5BROA 5EFFA 2VI0A 1SMOA 1UB6B 4FK9A 2VQ1A 4KKAD 4R9HA 1I1FB 1YQVH 4U1KB 1L7TL 1IE5A 3ZLQC 4CRPA 4U1MB 3O2VH 1PG7X 3GSVA 4GRMA 1C8YA 1WCQA 3V6OA 1XF3A 4E2OA 1VCAA 3I2CL 3WMBA 1HSAB 1CEOA 1AD9B 4X9BA 1L7IL 3F58H 3LMJH 3GI8H 2PYFB 2V3DA 4FABL 2AK4B 1OP3K 1DN0B 4OCWL 1EH9A 5E99H 5KVFH 3LV3B 2VRQA 4PTXA 2VZUA 4KHXL 3FT2A 5DJZB 4U5IA 4A6YH 5IHBA 3C60B 4G42B 3TT1H 1A0QL 4NP4H 4JZNB 1QLFA 1FHGA 5A94A 1D6VH 1XYFA 4PTUA 2NXYC 4GPNA 1LL4A 1WVZA 1TQBB 1W1YA 1X5JA 4M8VA 1CPUA 1JRHH 1BX2B 4YWGH 1R3HB 3MZTA 4MDJB 4U1JB 4IDJH 4EDWL 5K9OA 4WUKH 4J6RL 4F7PB 2I24N 1KXTA 2VDLH 3BWAB 4HMEA 1DLHB 3PHOB 3SE9H 1WZLA 4YHEA 4AIZA 5KVGL 4I0CC 2VXUH 3CH8A 3U46B 5I1JL 4JM2B 5I76B 1TUXA 3NZ8A 2G75B 5E09A 4WJ5B 3L3DA 5D7KD 1HXJA 1QKZH 1IQWL 1DL7L 3BHBB 5JA9A 5BZDB 2AQ1A 3BI9X 4Y4KA 2E7CA 4X7TA 1Y0LA 3O2VL 5FGBA 4ACZB 1N26A 3CIQA 3DUUB 4KKCD 4YFLI 5DEGB 4HC1L 1RIHL 5HVGB 4D0BA 4XC1L 4KI5D 1BBJB 4D2NA 3VIFA 4JRYD 1T22B 3BLBA 3DVNB 3G6DH 4HQQL 4NJAH 3VOCA 1SJHB 2GJ6E 4PR5B 3TA3D 4NN6B 2CPUA 2UUDK 4AZ5A 1JRHI 5L8JB 1NAMA 4GKSB 2HWZH 4MHHG 2YPLB 3QEQA 4UIMA 3WNMA 1C8QA 2O5ZH 1H3UA 4OZ4B 3BLPX 5HDRA 3I6GA 4HPYH 3V6FA 3SCPA 2IPKB 5IHUL 3RWCA 2ITDB 2WV3A 3FO9B 1W72B 5C3LD 1UD5A 1I3GL 4P23C 4ODWB 1ORQA 5J11C 1XAUA 1KB3A 1WIOA 1OP9A 3DJ9A 5C08E 3PWUA 12E8L 4UR9A 2ZSVA 5IB3B 2AJXH 1Q0YL 1KTBA 3FFDA 3Q1SH 1KJ2H 3TPKA 4AIEA 4Z18A 2WW8A 4M3KB 2BV9A 4OI7A 4OF3A 5IQ9A 4EDXB 1B3WA 1PY9A 2VXUL 3VKKA 5GS3A 3BKMH 5GGSB 2WVVB 4JJ5A 1FZJB 2O93L 1ZT7A 2YD7A 3HTLX 3KPLA 5INDB 4LMQI 1IC7H 1D5BB 2Y23A 4XB3A 4ZXLA 3VXUA 3VIGA 3CFBB 1WDRA 3ARZA 1KTLB 3IU3A 1TZGL 3MRKB 2DPEA 5DS8B 2XTLA 2VLLB 5FYLE 5DJXA 4MD4B 1FFNA 4CVUA 4HWEH 3WL1A 2OP4H 5GRYA 4Y4FD 4GT7A 1J0KA 4JQVC 43C9B 4LLUA 3MV9A 4P7RA 4EE9A 1FYTE 4ZUUB 4LVHC 4YIQB 4TQEL 4HTYA 4F9JA 4IRJB 2CDGB 1MCWM 4AT6B 1CL7L 5D7IB 1FL6B 1NMAH 3BQUB 4PJ9A 2NCMA 3DETC 4QKXB 5LG1A 2VZOA 2RFXA 3BP6A 5FYJU 4BQ6A 2V7NA 2O5YH 5C0RH 1JPGA 2DBLH 1R3JA 3E3QE 3GI9L 5F6IB 1HEZA 5L2KB 5DJ8A 3D69A 2XVPA 4OZIA 4NRYB 5I1CH 2V9RA 4YDIL 3RKPA 1CT8A 4LCUB 4HLZH 4R2GD 3RRQA 4MJ6A 3WNPA 3IDNA 5ESAA 1E4NA 3QDGE 5D7JA 1J05A 3MLZH 4YHLL 3G08B 4PLOB 5GSRA 3MRRA 5E8PB 1F6LL 3HI6H 4PJAF 2ZPKL 5LBSL 4TTGA 1I9EA 2FJGB 1R5WA 1Z9SA 3PXHA 3ARQA 4HFUL 4HUVB 4B5EA 4AZHA 2VDOH 4OCSH 1CD1A 4ODVH 1NM9A 3CV5A 5DJDA 3C8KB 1YNLL 2MPAL 2D2OA 3WF0A 4OZHA 1DR9A 4LPYA 1MIML 4DJMA 4W4NA 3UYOD 2O9OA 1Q1JL 4Z77A 4KQ3L 1DQJA 3QEHA 1G7JB 2OLHA 4NF7A 4YHPB 4FQLL 2Z1KA 3OIHA 2UWEA 2FEDC 1HJSA 2VUOA 4XPGH 3QR2A 5KZ6A 2WZPD 1ZT4A 3OKOA 1U8LA 4YNYB 1O5DT 4ZOBA 1W1PA 2NXZD 2D7PA 1PBGA 1HHJA 3HE7B 4OGYH 3OX8A 2PTUA 4QEGA 5JMOC 2BCKA 4QOKB 3LIZL 1F3JB 1R85A 4JAWA 2WBKA 4Y5XA 2Q86B 4H7VA 4BQ5A 1HCFX 2A74B 3IS1X 3PWLB 5EUKA 4JFVA 1R3IL 4O4YH 5T1DL 4Q9RL 4LSTH 5JPNB 3QPXL 4NHUB 1U8JA 3VJ6A 1WIUA 5BXPA 3RZCD 3VWKA 3TO2B 1KQZA 1WNOA 1JTOA 1C7TA 1TNMA 2BVOB 4ODUB 5IB4A 5C0CB 2OTWB 4Y4KC 5DFTA 1LO4L 1CWVA 2YOCA 5FGBC 4X7CC 5DJAB 1XH2A 2E9IA 3KYKL 2ED9A 5HYEA 3QQ4B 2VLJD 5IFTA 3NABH 2DKSA 1Q6EA 3H7LA 1WZAA 1DSFH 1CF8H 3S2CA 1NDMB 2H2SC 3CZ8A 2W60A 1US2A 4CNIA 4AM0A 3PWPB 2AEPH 4Q6YA 2B2XL 5L7XH 4JHAL 4XPGL 4LRNH 5C71A 4M8UA 1ITXA 3M46A 4P57A 3RL2A 4KFZC 3OAUH 3AMCA 2XM1A 1ZBVA 4KZDH 1WWAX 3KLLA 5CHNA 1QOXA 5CBAA 1BP3B 3WIHL 4U1NA 4LVEA 4QXWA 3HG1B 3VXMB 3HB3C 1S7RA 3KDMA 3LKOB 2BNQA 2WK2A 5EULV 3BDYL 4PGDA 5I1AA 5IB2A 1MHEA 3VXRD 4LSTL 3G6JA 3GHEL 4HKXA 3E1F1 3KPSB 5E9DD 1B6DA 4NDMA 4NO3A 2C5DC 3RU8L 4LGPB 3SJVB 1JHTA 4HMCA 4BH8A 5J6HA 4TX6A 3MJ8B 2NY5L 4JFFB 2KPNA 1UEYA 2R23B 1IEAB 1M7IB 5KJRL 3UJJL 3VCLB 2VVNA 4NPYA 4ZS6C 4NO2B 5ABEA 2P8LB 4Z2KA 4MA1C 4PJBF 4F37K 2OXGA 3NACL 4S1DD 1BQHB 1AC6A 4GLRI 4NQXB 4DK3A 4RNRA 4DZ8B 1CF8L 2VDQL 1EHXA 4MNLA 1VACB 4L1DA 5GRZA 4RAVB 3ZO0A 4ZXBB 5C08A 5FO9B 4XHJD 4NO0D 4HUXA 3MNWA 1J8HE 1MI5A 4OKDA 4NJ9H 4APQB 4J4PC 3KHOA 3MXWH 5INCA 5DFVC 5KSBE 1LO2L 4GG6B 5CWSA 5IB5A 1UB6A 2CETA 1MYRA 3AM8A 3CLFL 3KLDA 5MENB 1I1FA 3N1MC 4UAOB 1T03L 5F7DB 4WFED 5A6JA 2YFNA 5D1XB 4P3CH 4H8WL 5D4QA 1MW0A 5KEZA 3WQ8A 1MVFA 2GQHA 2J12B 3CZFB 4WDIB 4JFHD 4LEOB 2CPCA 5B4MC 1M6OB 1QLEL 4V2CB 25C8H 3X3FL 1JHLH 3SCNA 3QGVA 3D25B 4JKPL 2P8MB 1S46A 4LSSL 5T5FL 3TIDB 4TUJB 2ZCHL 3SQBA 3LV3A 1P7HL 2A2QT 4Y19D 4PSRA 3FRPA 1J1PL 2AKRA 3GMLA 2E7LA 5DJZA 3CK0H 3S6TA 4EI6B 1EXUA 4X7EC 3C60A 4G42A 1QHPA 7CGTA 1PGRB 3DROB 4HCRL 1N59A 1PFCA 1H09A 3EFDH 2BVUA 1VF8A 2JCCA 3U2SB 3H54A 5CFHA 5GNZA 1GGBH 4OLXL 5HYJA 4HXAL 3Q6GH 5J1TC 3SCMC 2DGAA 1BX2A 1AFVH 4ZFOB 4J1UB 4XB8A 2PI6A 2FLBT 1R3HA 1TETH 1UCBL 2HT4C 2BSSA 3FB7B 1U0QA 4YPGA 4F7PA 2WMHA 4BSWB 1QRND 3PHOA 1BSIA 4P8WA 5BMFH 5JIPA 2ZWZA 1A6WL 4U6XA 3U46A 4FFZL 3C5JB 3V4PH 3NCJL 3O3BB 1INQB 3MUGB 3QNXA 4WJ5A 3UXFA 5I77A 2CD0A 1MHPH 4X6FB 4WHTA 1QR1A 1CNVA 1RZ7H 4JY5H 5E08L 5DEGA 4R6UA 4U1HB 4UDUA 4U33A 1ZSDB 3MLXH 4JO3H 4XRCA 1EIBA 4PN2A 3MRBA 4PR5A 4MS8C 5GGTH 5EIIA 5DGRA 4BQ2A 4ZUVB 2A0LC 4N5EC 1T89C 4LCWB 4N0UE 5CEZL 5IBUB 4XAKD 35C8L 1K8DB 3TP4A 5GRJH 5IDIA 4M61A 4WHCA 5E2WL 2SEBA 1DTUA 3WD0A 4B50A 3MBEA 2WAHA 4CCEA 1FGVL 3M17A 4KRTA 1FVEA 4XMLH 1LWJA 4OLVH 4Z7QE 4NZCA 1PLGL 1ES0B 3G6AB 5D5MF 1OQOA 4ODWA 1BJ1J 1UA7A 4PTMA 2H1PL 4KKLD 1MXGA 4KKBD 4LHJB 1KLGB 2C1PB 3D6GA 4MA8H 3HC3H 4ATWA 1PZ3A 1C1EH 4PRWA 3E8UH 3BKCL 1DQQA 2ED8A 2WMIB 3UBXG 2R1YB 2V5TA 4UTAL 4YHML 2WVVA 2ZX8A 4NKQB 4K3EH 1IGML 5C0DB 5SWSE 3JXAA 4PG2C 5EPMB 4PJDE 4PP1D 4EIZC 3SUWA 3CFBA 2FX7H 4NWTH 1QHZA 3UP1A 4W85A 1YMHA 1XSKA 1XF5B 5EC2B 1UR1A 3EBVA 3MV8E 1F3RB 3MLXL 4YXLH 4O51B 4LVNB 4RSVA 2QPSA 2WMKA 1GZJA 3W24A 5LWYL 3DRTA 2WWDA 1J01A 2P48B 4YIQA 4XCYA 3UO1L 3EYOA 5D7IA 3BQUA 4PJ7F 5FK9B 2O9PA 1MRDH 2Y7QA 2I60L 4FZEH 4XPHH 2F1BA 3L3HA 1V3IA 4BS0A 5CEXA 4PV9B 2JJTC 1ZEAL 3N04A 3QYCA 1FNGB 4IRSD 1WISA 1R33A 2R9HD 4JRYB 3C5ZA 3IYLW 3O4OB 4O5LL 5KSAA 4OD1L 2D7NA 1U6AH 5E94B 4X8XA 3QDMD 3L5XL 3O8XA 2ZOLB 4QDMA 4LCUA 1G7MA 4MA8L 1OM3H 2G41A 1E5JA 3APGA 3THCA 4EOWH 1DBAH 3HJEA 2V3FA 4LGSB 1TJHL 3S9DB 2AJUL 1F90L 2Y6SC 1SYSA 1IM9A 2JJVA 3FQXA 3G08A 5DVNA 1TVBB 3V0VA 3CX5J 2XTKA 4UZUA 1QFWI 3MRDA 1BM3H 1MFEH 1OTUD 1CDYA 1CQKA 3ZDXE 3BP4B 3ECQA 3SDAA 1JZ5A 4NCDA 2RIKA 5E4IA 3F7RA 4OLWH 1FZOB 3C8KA 4J3WA 5T3XE 2HFEA 5I17A 5IVXB 1NJ9A 4NUGL 4O2CB 4WFGD 2OCFD 4NI3A 1A2YB 1G7JA 4L4PA 1NGZA 1RPKA 1DVFA 1KG0B 5TE6L 5DUML 1AIFB 3SDXB 1ZLVK 1GQLA 3MUZ1 2QHAA 3DGCR 3BEWB 4PRIE 4Z7VB 3OF6D 4YNYA 5IBTH 4UFJA 4Y4FB 4I48A 2WVSA 5BCAA 3QPQD 2EE2A 4QOKA 1GHFL 1TQBC 3K7UA 7A3HA 2Q86A 4PRNA 3KR3H 2J3SA 4RFOH 4JHWH 4S10A 2DSWA 4Z7NF 1G0CA 2A74A 1JBJA 4DWSA 4NKMB 3PZ9A 3B2UC 1HYSC 1NAMH 5IFPA 4XMKH 1NGPL 3KPRE 4NHUA 2IEPA 2EDOA 4OLZL 3VFOA 3WNLA 2KH2B 3UAJD 3WS6A 4JM2C 5KZCD 2W4XA 1KJMB 2VDPL 4K68A 1K3ZA 1GOGA 2BVOA 4ODUA 5I9QB 3N18A 1E73M 4R2GB 5DJAA 4JFWA 4N0CD 2HRLA 3HNSL 4PJFE 1YEDA 5DK3A 2ZCLL 3ARRA 5D8ZA 2GY7B 2YRZA 3ARXA 3G5YB 3O9WA 1KUMA 2C1OB 3O2DA 4GW5B 3L4WA 3PWPA 4BM7A 1U2YA 3CXHJ 1KTDB 3VXSE 3PDDA 4XXCC 2NX5E 3VFTB 2XNAA 1WGOA 4NN6C 4F3FB 2B0SH 3JZ7A 1OSPL 4GI6A 1OF2A 4OAWB 5IOPA 1MCRA 1IEBB 3TJHD 2PYEE 1FGNL 1M1SA 1Q6DA 1SJXA 2J25A 5ABFB 4WWKD 1KT2A 3IXTB 3VI4E 3ZYJA 5KANG 3GJFK 3HG4A 3ZKQD 2E9MA 3GMPA 3AMKA 2Q7NA 3VXMA 3V5KB 5FCSH 4YEEA 2HJKB 1NBVH 1WP6A 4I2XB 1MCEA 3L4YA 4KRNA 4CW1B 2C0HA 5ILTH 1RULL 1IAIH 2HFFA 4PRAB 4OSUL 3SKNB 1NCBL 4B16A 1EO5A 4XNUH 1QFWM 4N0UA 3GB7B 3SJVA