5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
b'HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphate aldolase
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Lyase
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
4NXSA 4JTKA 3W7EA 2VEMA 1S5TA 1U5JA 1OK6A 4PL2A 1M7OA 3NNTA 3DU0A 3DHDA 3NXFA 2NX1A 4RR4A 1X8FA 3A23A 5J5RA 3DHFA 1SW0A 2B7PA 1TO3A 5DELA 1BWLA 1LBFA 2ZRVA 2ZQ0A 4O14A 2Y7GA 1RVGA 2E6FA 3PG8A 5KINA 4O17A 4HNVA 2HS6A 4MKNA 1W5MA 1H7RA 3GDRA 2E77A 3NQ2A 3H54A 1PCKA 4WXYA 2V2HA 5FEPA 3FEMA 3S42A 3QMTA 3LCFA 2WNZA 3IVUA 4JYEA 4QQ3A 3KVJA 5E0KA 3HPXA 4IXHA 1FY6A 4PODA 3S5ZA 3TJLA 3W9ZA 2Z1BA 1UASA 4DF1A 1W5NA 5G2WA 4N6EA 1TPH1 1NF0A 1EB3A 1J2WA 3S5OA 3JS3A 3OA3A 3SI9A 3N34A 3EXTA 1QNVA 3MUXA 4KWVA 4GFSA 4K36A 2QCHA 4R53A 3MI6A 2QDHA 5FEXA 2CU0A 5KMYA 1EP2A 1IIHA 1LRTA 2CLLA 1Q6OA 4J9JA 2A6LA 1JCLA 1H5YA 3CTLA 3QW3A 4UNLA 4UMAA 5HUPA 5LNVA 1XXXA 1SFLA 2GJNA 1XUUA 3KFTA 2ZZ4A 1OX4B 4QAIA 3QW4B 3QJAA 2YCEA 4H6KA 5D32A 3KVMA 5HWJA 3HIJA 4MY9A 3W2KA 4ML9A 2NV1A 3W7KA 1Z44A 3SR7A 2ISVA 5E1QA 5AHLA 1UCWA 5T26A 1JCMP 4IWWA 3W70A 3S6DA 2BLEA 4JGDA 2A7PA 4QJ1A 4Y6GA 4RZ5A 1L6YA 3OHIA 4UFKA 3DZ1A 2Z2UA 1K8ZA 1A5CA 3VE7A 2B7NA 3UWWA 3BG5A 1K8YA 3EX2A 1XBXA 1IXNA 1JUEA 3OEXA 5AHNA 3FYPA 4FNQA 2QJGA 2CFFA 5L6UA 1V5XA 2WV8A 1Q6LA 2CLKA 2VFIA 5HR6A 1KFEA 1F05A 2YYUA 4OGZA 3LI1A 2C16A 5GVJA 1WAUA 3G8RA 3NQ6A 3W72A 3ZS4A 2FLIA 1SO6A 1WOAA 4KFOA 5K2ZA 1TCDA 3NVTA 2RHGA 1FXQA 3CC1A 3FFSA 3LXCA 2NX3A 2E5CA 4DEFA 5HWNA 5EBUA 2FQIA 4GC4A 4N6FA 1H63A 1RPXA 3F03K 4Z1BA 3BG9A 3NQGA 3I7RA 4LUIA 1SR9A 2J9ZA 4DPPA 3KAOA 3W1QA 1RQHA 1QAPA 3NL6A 4LY8A 3ZWSA 4QNWA 4HPXA 1F7BA 1OX5A 1W0MA 3HGRA 5KITA 1BTMA 1GVQA 3GB6A 4Q33A 1TTJA 5AYYA 4JN6A 5HINA 1K03A 3QFEA 1JRBA 4QIUA 4NX5A 1L6SA 1WX0A 5D38A 1H62A 5H91A 2GVJA 3OIXA 3BW3A 2QCEA 2OCZA 2ZFAA 4YMZA 2H3DA 4NZFA 4Z08A 3PUEA 4MY8A 1Q3NA 3W1AA 3NYZA 3A24A 4MZ8A 3I65A 4O15A 2J6XA 3R13A 4JTTA 4S1FA 2A4AA 2WNNA 4ZL1A 4KFPA 4O57A 4O0KA 3WK1A 1XKYA 4GE8A 1KFCA 3S1WA 5F4XA 4O4VA 4CQ8A 4QISA 4FNTA 4ZQMA 1EIXA 4NU7A 1NVMA 4YCPA 3LI0A 4A2RA 1ZAJA 2VFFA 3GIYA 3BO9A 1T8XA 4EWND 4FNPA 4NVTA 3UZJA 5H2ZA 3ANYA 3HPZA 2A0NA 4ZVJA 3GAKA 4FIQA 1H51A 3BW2A 5EY5A 5C54A 3UXDA 3BGGA 4RXFA 1FQ0A 2VEIA 4NJHA 1OABA 5AB3A 1MO0A 3LBCA 4JD4A 4U28A 3PVFA 3MHFA 4ADSA 1P4CA 4AHPA 3CB8A 4Y8FA 1I2QA 1H1YA 1LBLA 3GVGA 4LV4A 1W56A 3W7PA 2I9EA 3L68A 3C3NA 1W5PA 3ATZA 2I14A 3GDLA 1THFD 1RD5A 3EX4A 2JKPA 4K8HA 4JYFA 5LGXA 2GQ8A 4DXVA 3TXZA 4GNJA 1RZMA 3B8DA 3KRZA 1GT8A 1QO5A 3LTSA 3QF0A 3L9CA 3UQNA 1W3NA 4IPJA 5KTLA 3W2UA 3LX9A 5AN7A 5D05A 3TE9A 1SW3A 3SW6A 1G4EA 5FF7A 3UWZA 3G1HA 3T4CA 1VQTA 3VE9A 4UTIA 2EF9A 1GTHA 3SECA 3UYCA 4O52A 1PHQA 2GVLA 3PSWA 3LV5A 3MHGA 3EWWA 3NQEA 3ABRA 3T78A 1YTKA 1O95A 2ZRYA 3C2OA 5KZEA 1ZENA 3IIPA 2NZLA 4X2RA 1VC4A 4OV4A 3GXNA 1RV8A 3A5VA 3NL3A 3LCXA 3W84A 4UTWC 3S5YA 2WSYA 3PULA 3QRHA 4ORIA 1DORA 4IMFA 3MI3A 2EPHA 3FYOA 2QUUA 4MPQA 1QWGA 5F2GA 2YXGA 1GOXA 1KM4A 2DZTA 5LSMA 4TO8A 4Q4KA 3S0CA 3HGJA 3QSTA 1OJXA 4O12A 1I2RA 3LHZA 3UWUA 2YYTA 3IGSA 3BK0A 2ZZ2A 3G0XA 3C8FA 4JS3A 3UPBA 4OWGA 3MP5A 1VR6A 3JRKA 3WJWA 5BW6A 1TV8A 1SZNA 3M9YA 1LRQA 2CLMA 2CLOA 1UUOA 3ELFA 1B3OA 3P61A 3YPIA 4LVGA 3WJYA 1X1OA 4AWSA 3TFXA 4EIVA 5G5IA 1QFEA 3SZ8A 4EF8A 3DKJA 1G69A 3IVSA 2V82A 1TSIA 5LNRA 3QPZA 5EL1A 4MIMA 1NF7A 2RDTA 3TXVA 3PBVA 1FCQA 4POCA 5AFDA 4IOTA 2TYSA 1FDZA 1QO2A 2B7OA 4LS2A 5G1YA 5F4SA 2PC4A 1TREA 3LHYA 4FXRA 5LHFA 2YW4A 2PRHA 4O1CA 4BWLC 3P84A 2E6AA 5FESA 3N2XA 1PHWA 4O8RA 4O10A 5D04C 3NM3A 3LERA 3HG5A 4E0CA 5DBUA 1KW1A 3LBMA 5EKYA 3OG3A 3HF3A 2R94A 5HNRA 1J5TA 1M5WA 5D2YA 3DI0A 2A7NA 4QITA 3ZR4A 1VYSX 1XI3A 4Z0SA 2VEPA 2P0OA 3F1QA 4HSNA 2CLHA 2ISWA 1PE1A 3NAVA 1Z42A 1U83A 1AW2A 3W2JA 1UB3A 3W1PA 3BV4A 4WY0A 2Y62A 1W31A 5SWUA 3DENA 1JVNA 8TIMA 1ICPA 2JKAA 3CEPA 2V8ZA 1SSDA 3BGJA 3MO7A 3ABQA 2QKFA 1IF2A 4DO5A 1LM1A 2ZA1A 4PFMA 2FPTA 3L0KA 3NQMA 3M1ZA 3N9RA 4NUWA 3PG9A 1G4PA 1M7PA 3NDOA 3O6YX 4EVZA 2ZCGA 5K7JA 1AMKA 3FIGA 3W7JA 2OZ0A 4M6VA 1TJPA 3W1RA 1X6UA 3W7HA 2FB3A 4UFMA 1DQXA 1KA9F 1ZHAA 3DFSA 4JIQA 1LRNA 5HULA 1XL9A 3NQ8A 2VOMA 2V2CA 2EHHA 5DY3A 4C1LA 4HNUA 4L4LA 5TIMA 3MW7A 4O18A 2V5LA 3KX6A 3GK0A 1FWRA 4WD0A 3M41A 2F84A 1HUVA 4GUIA 3BLFA 1YXCA 3TK7A 1OX6A 3HO8A 4LU0A 1ZAIA 1TTQA 2NLIA 7TIMA 1HL2A 3C2RA 5F1UA 4WOQA 3V75A 4RCXA 3HJZA 4GXMA 2B0MA 2Z6IA 4B5NA 3CWOX 3TW6A 4CNNA 1EEPA 3C6CA 1NFBA 4ZQRA 1TQJA 1FWWA 2JGQA 4WQ6A 6ALDA 4OU1A 3W87A 1SZGA 1CX9A 4A21A 3TH6A 4HSOA 1JQXA 3UNDA 4JTEA 3TSMA 1GG0A 4IUOA 4X3ZA 1A5AA 1LOLA 4LW7A 2V0TA 4GUFA 1C8VA 5CKSA 1YDVA 2VKZG 1LYXA 4BI5A 1YLVA 3B4UA 4K38A 4XZ9A 3KHJA 1GTEA 3LGEA 4M7SA 2Q3RA 1DKWA 2WSRA 3R2GA 2GQ9A 1KM2A 3LRKA 4M19A 3JR2A 3QQ1A 5D09A 2NWSA 4MZ1A 5A5WA 2FJKA 3HPSA 3EB2A 1A53A 5AHMA 4GUHA 1TMHA 4KKXA 1EPXA 4W9TA 2EGZA 3G1XA 4N9EA 3W71A 1Z41A 2CLIA 3R89A 1ML1A 1XC4A 2VFEA 4FNRA 3KRSA 1TV5A 3MYOA 4K39A 4RKAA 1JULA 4DO6A 3Q37A 4AWUA 3BVJA 3B0VC 1SO4A 1IXPA 4PL1A 3SJ3A 3QM3A 2YDAA 1ME9A 1DQWA 1QPRA 1G6CA 3C4UA 2QCFA 1SQ7A 4BWLA 1FDJA 4O16A 3FJLA 4O50A 5EA9A 3H53A 2C3ZA 4O53A 2C0AA 5AHFA 1F6PA 4HT3A 3PWAA 2YFOA 1DV7A 3TIMA 4ZQPA 1LROA 3QEZA 1F6KA 3G3DA 3G0SA 4PEKA 3W7RA 3W74A 4UCGA 3GDTA 4JX4A 5BRBA 2UV8G 4Z0JA 2ATSA 2ZRUA 3DBPA 2ATMA 3TSBA 1FCBA 1Q6RA 3PB0A 4XUGA 4GWEA 3W2LA 1PIIA 3CEUA 3DFQA 5G1TA 3KOFA 3TKFA 2J24A 1QMLA 2E1DA 5HJLA 3LHWA 1BWKA 3W83A 1TPDA 1SSGA 4N9CA 2HSAA 1LTDA 1R30A 2YZRA 4O1BA 3LDVA 1S5WA 2BXVA 1ZY9A 2OT1A 1K02A 3C61A 1GYNA 2HTMA 4MYXA 3BLEA 5FF0A 1OFOA 2E5BA 1O5KA 3IIZA 4LV9A 3I68A 2DZXA 2QUVA 3WK0A 2ZZ1A 3A5FA 3IIVA 3GYEA 1Y0EA 4LRTA 1TYGA 1LBMA 1N55A 2QF7A 1GJPA 4UXDA 1KFLA 4RJEA 1H7XA 3LTYA 1TTPA 1DVJA 5D2XA 3W75A 4XQ6A 1VHNA 3EX6A 1VH7A 3W88A 2Y6ZA 3KVLA 3GNDA 3K30A 4A2SA 4OBTA 3M5VA 4UFLA 3GDKA 3N14A 4JTIA 2PURA 2AGKA 1VS1A 3GZ3A 4JTLA 1ALDA 3IRDA 4IGHA 2JK2A 3TNOA 2H8XA 4O28A 1XBVA 3DI1A 2C14A 1XDLA 5FI8A 1ZCOA 1YXYA 1NEYA 3B0PA 3LCIA 4UFJA 3TC7A 2J88A 5CZTA 1S5VA 4LVBA 4R7JA 1CW2A 1WA3A 2GPTA 3TQ0A 3QH2A 1HO4A 3O6DA 5BMXA 3TSDA 4MJMA 1VYPX 2ZA2A 3NR0A 2A85A 4AF0A 3W1NA 1OK4A 2F7FA 4QM1A 3QQ0A 2Y7FA 3CM4A 3RLVA 3VKJA 1T99A 3W7GA 2R14A 2V30A 4LC6A 2NXIA 1PV8A 3N73A 2X30A 1FBAA 1KM1A 1XM3A 2X1TA 4UTUA 3BW4A 1B9BA 1KFBA 1UJPA 1O5XA 4WY0B 1XUZA 4H3DA 5KSWA 3WK3A 3INPA 4CQAA 2BSLA 3UD6A 1I2NA 1X7FA 4UR7A 3SGZA 4AWTA 1OFRA 3NO5A 1L2UA 1KM5A 4HKPA 2R91A 1WQ5A 2ABAA 2XN0A 4NT0A 3CPRA 3TAKA 4M7TA 3CIXA 1DBTA 3PS7A 1XFBA 3CT7A 3W1UA 3O16A 4O54A 4WJEA 4MUZA 5AHEA 2G95A 3LOTA 3IV3A 4L4MA 2QJHA 4ORMA 3TCEA 4FX6M 3LXBA 4HN4A 3TAOA 1W8SA 1AL7A 1ZAHA 2WPBA 3G0UA 2ZZ5A 4ADUA 3M5YA 2NXHA 4N02A 3MP3A 4UMBA 4WXZA 1HG3A 2V2DA 1FCVA 1LLZA 2LLEA 5F2IA 5CZ0A 2Y7EA 4LWWA 3U2OA 4PCFA 4JTUA 1G67A 3P7YA 3WK2A 1TB3A 4UTLA 4CNOA 3ZWTA 3LB0A 3FKRA 2CZ5A 3HGOA 3T55A 1A5BA 3M0ZA 1PL9A 3RF9A 5F1VA 2DU2A 2FPVA 4NJIA 3W1TA 4ZQNA 4FXSA 3TQVA 4C1KA 4FNSA 5FEWA 1I45A 3CQ0A 4LC8A 5U7SA 1GZGA 1TPUA 1SFJA 1IXOA 3FA5A 4K7VA 4LT9A 3MWAA 3N19B 2O7QA 1OYAA 2ZRWA 3UY7A 2H6RA 5EYWA 3W7DA 3R5EA 3O1NA 2YGYA 3E12A 3MBFA 1KFKA 4E2DA 4HNNA 2E09A 4KFNA 2DZUA 1ICQA 3PBWA 4S2CA 3F4NA 2P10A 2W79A 5I3IA 4MFDA 5FF3A 2Y61A 1TJRA 4QNEA 3RU6A 3QMRA 3O06A 2XN1A 3DH7A 1KTCA 3O15A 3M47A 2A2IA 1TPC1 1L6WA 1L9WA 3ABSA 2V9DA 1RR2A 4IMGA 5I3GA 3MJYA 1R2RA 4ZQOA 3F4WA 3HOJA 3LHTA 4MY1A 4S2BA 1SZEA 1WV2A 3Q58A 3NZ1A 1ADOA 5I3FA 3W1MA 2ALDA 1H61A 3TX9A 4JYDA 3OBKA 1QPQA 1TPWA 4TMBA 5LNUA 2NUWA 2GUUA 1EA0A 2V5BA 4RK8A 1KFJA 4IMEA 1SUXA 3PF3A 3D0CA 2DZPA 1MXSA 2EAWA 4NNCA 4NX0A 1SU5A 4K37A 3IIOA 4GBUA 5CSRA 1K7XA 2NX9A 2H8ZA 5CPLA 3Q2DA 5CPMA 3N9SA 3PBYA 2AQWA 2QCGA 4JIPA 3PUOA 4LRSA 1OFDA 1XDMA 4TMCA 3BLIA 1DHPA 3MHUA 4JTHA 3QMSA 4O11A 2QCNA 2DORA 5D30A 4OE7A 4XTDA 5KZDA 2WQPA 2X2GA 2A21A 3S1XA 2TSYA 3PSVA 3W85A 3DXIA 4PTNA 3QSRA 1FCUA 4RLIA 1ICSA 1EUNA 1HTIA 1GVFA 1T0OA 3W2NA 1GVOA 4MJZA 4YXGA 1W3TA 3G3MA 3NZRA 1V7YA 4LTSA 4PC8A 2EKCA 5A8GA 1VJIA 1MSSA 5J5DA 3W73A 5D37A 4Z1CA 1UUMA 1FWNA 4JDYA 3TJXA 4UNKA 3HG4A 2PRLA 1GPWA 4ADTA 3A21A 2ABBA 4DPQA 3OVPA 3W7QA 4UR8A 3P80A 1JCXA 3DAQA 3WJZA 2OX1A 1OVDA 1XBYA 1AW1A 3RLUA 4O1AA 3P8IA 4GUJA 2FB2A 5CZJA 1MEHA 4FHAA 1JR1A 4LVFA 2DP3A 1Q45A 4IQLA 3M5XA 2VXNA 1G4TA 4PH6A 3UXAA 5IBXA 1T96A 1JRCA 2ZRXA 3T40A 5AHIA 2Y89A 1ONRA 2RDUA 4JEQA 4CCCA 4LNYA 2QAPA 3UWQA 3W22A 4IMCA 3NPWA 3P67A 2TPSA 5MHBA 3UY8A 5K4XA 4OHQA 4A29A 5LKYA 1K7EA 2C6QA 4ZQCA 3P82A 1GYLA 1IXQA 4G1KA 1GG1A 2OMAA 2NV2A 4NJJA 4IMDA 2W6RA 4MLRA 3EX1A 4UTJA 4HHPA 2QCMA 3TDFA 1IIGA 4JDBA 4TR9A 2Q8LA 2ISSA 3LV6A 5FF4A 1W37A 3GXTA 4AF0B 1FXPA 4UTTC 3P81A 1H7NA 4IX0A 1K7FA 4H4IA 1OFAA 2J27A 5U4NA 4ZZ9A 1ME8A 2GOUA 3STEA 3FOKA 1FUYA 4RX0A 4X22A 4WOZA 5DY2A 4M6PA 1BKSA 4K6AA 2CZDA 4NXKA 1LCOA 4XKYA 3MP4A 3TA6A 5D2TA 3EXRA 1JCJA 5K3VA 1R47A 2QCDA 3AJXA 4NJGA 2R8WA 3O05A 3DFTA 3U6WA 1GVRA 3QC3A 4UTHA 3TROA 2WNQA 1SW7A 3HG3A 1WDWA 3PB2A 4NZJA 4AHQA 3HGSA 3BPWA 2HS8A 1HO1A 1SPQA 4M6QA 2FFCA 4K8EA 5I3JA 2ZBTA 3NQCA 2Z0IA 4N2YA 4UFIA 1VLIA 3RMJA 3SFKA 3SSJA 3G1DA 2WOQA 1IGSA 3EWXA 1JJKA 4CCDA 3G1AA 3W1LA 2XN2A 4JICA 3DKLA 3TMQA 3E0IA 1WBHA 2V81A 5EMUA 3DFNA 3C2EA 4N4QA 3GKAA 1VLWA 5F2LA 3EXSA 5LNWA 4UUIA 3WJXA 3THQA 2IQTA 1A50A 2C13A 3NQVA 2JGYA 3PM6A 3A22A 3A9IA 1G7UA 3B06A 1I2OA 1QOQA 4M5PA 3KRUA 1W54A 1YDNA 4NQ1A 3W07A 4TX9A 1P0KA 1JQVA 2PRMA 3M43A 2J9XA 3I7QA 3I7SA 3L0NA 4TU1A 3CIWA 5AOUA 4R34A 1D3HA 2YFNA 5C55A 3O63A 1J4EA 1F76A 3GLCA 1W1ZA 4A3UA 4DF0A 5AC7A 4I7WA 1N7KA 3I6RA 2ZRZA 3CLMA 1YTDA 3S5NA 2C15A 4XWUA 3EEGA 2CLFA 2HMCA 3B04A 5CPOA 3EKLA 1FX6A 1OF6A 2P1FA 4MOZA 3NGJA 5DXYA 3UWYA 3AO0A 4LS1A 3HG2A 3W7CA 1HFBA 4JX6A 1OF8A 2RFGA 1LZOA 3MYPA 2FTPA 1XCFA 2FIQA 3WFAA 1XBZA 5K4ZA 4JXCA 4IX2A 2GQAA 3NL2A 3W7IA 4AEOA 1MEWA 4BR1A 3EWZA 3EWUA 3CWNA 4WX2A 3B05A 1I4NA 5G2IA 3NPVA 4AHOA 4RXGA 1KBIA 4U4MA 4LS0A 3H55A 5TQLA 2PCQA 1P0NA 5FF2A 1EP1A 2YPIA 2CLEA 4ZMGA 1NAL1 3ATYA 4Y90A 4LVAA 2ZDRA 5C6MA 1VPXA 4AMAA 4DELA 3STGA 1LDCA 4A22A 1B4KA 1VYRA 3U8GA 5ABTA 3L5AA 2VELA 3HMJG 3W3OA 3T44A 4BK9A 3IEBA 2GVGA 3W76A 1P5BA 3TW7A 1DJQA 1I8JA 3KVKA 3SIZA 4UTTA 4MZYA 1EX5A 3LHVA 4JY8A 3TQKA 4UTMA 3LCHA 1D9EA 3NEVA 5AC6A 3PBUA 1GVSA 1Q6QA 3W1XA 2G96A 2OT0A 2Z6JA 2ZA3A 1TRIA 3C2FA 1CI1A 1YXDA 1OFBA 2G5WA 1TIMA 1VHCA 2X1RA 1VCVA 5DCEA 2CZEA 1SO5A 5CG7A 4ONVA 3L5LA 1G4SA 1EP3A 3P62A 3S9YA 2Y88A 4I7VA 3TMLA 4DF2A 4LOCA 3M44A 3W23A 2QEZA 1B4EA 3UWVA 3TV8A 5LHEA 3TR2A 1EUAA 3TFCA 3V1PA 4YCOA 2DZVA 5LNSA 5G4WA 5CGQA 4CLMA 4QSHA 1LLWA 5K9DA 4YL2A 1KLZA 4NNBA 1ZJIA 1ZFJA 3B03A 5HQEA 4FX8A 4JTGA 5EPDA 1H7OA 3THAA 4LUJA 1YDOA 3R12A 1JCYA 1ZNNA 1KV8A 5BNKA 2QCLA 3O6CA 1QPNA 2RKXA 1P1XA 5DCDA 3BG3A 1TV7A 3S1UA 2WJZA 1C9DA 4UTKA 2QDGA 3M16A 1AK5A 4JTJA 2B7QA 4GRSA 3M6YA 4BFAA 3R8RA 2VEKA 3S1VA 5BOOA 3W7OA 3QZEA 1FDYA 3RFAA 4Z1DA 1I2PA 2D73A 2NUYA 3IGXA 4O13A 1A5SA 1QPOA 2FDSA 1EWEA 1YPIA 4AB4A 3LRMA 5AC8A 4HIBA 5HWMA 3IGUA 1TTIA 4AXKA 4GUGA 4JTFA 4DO4A 3UZ5A 3G18A 3NG3A 2QJIA 3LLFA 3W7LA 3IVTA 3STFA 1KM0A 1JCNA 3LTPA 5IM51 1SZFA 3NA8A 1OG0A 5IBXC 2ZTKA 2YR1A 2ZZ6A 3EWYA 3P8JA 3FKKA 4K7YA 1F73A 1EWDA 3PY2A 2X1UA 1AL8A 2B4GA 4EOUA 3KXQA 4XKYB 1W5QA 2E6YA 1KM6A 5D2VA 4JX5A 3E02A 2BZNA 2QCDB 3UPWA 2CWNA 3G1SA 4JNMA 1MEIA 3EWBX 4MLJA 3NOEA 3G1YA 1W3IA 1OFQA 2YSWA 3P60A 1GWJA 1YPFA 3ZFHA 2WO5A 4FO4A 1GEQA 2C1HA 3P5ZA 2VC6A 4OV9A 4O0ZA 5AYXA 4XTIA 1G7VA 4RZ4A 1K8XA 1B57A 2RH9A 2AAMA 1TPVA 3M7WA 3VI2A 3HBLA 1PVNA 1WXJA 2BWGA 2DZWA 1OFPA 3LCLA 4JR5A 4CQ9A 3P74A 1DJNA 3USBA 5CZSA 3C52A 4P2VA 2KZHA 5I3HA 1BEUA 4AVFA 4TIMA 3BARA 3DFPA 1LOQA 1R2TA 1R46A 4O19A 4I7UA 2YW3A 4XBSA 3VCRA 5G4EA 3LLDA 1KTBA 5E93A 2NWRA 1R2SA 3W6YA 1ME7A 1VCFA 1OFEA 4N9BA 4CCEA 4MVAA 1C29A 1AW5A 1DL3A 3OVRA 2FPYA 3LCWA 5TBOA 3E49A 2ZYFA 2W0UA 3TUUA 3NQ7A 3GKFA 4DBEA 4OQVA 3LM7A 3G8EA 4AH7A 2WSQA 2C18A 2Y63A 4OT7A 2X1SA 3NQDA 3T7VA 3MBDA 5AYZA 4Z1AA 1OYBA 2OJPA 3E9AA 3G22A 3LHUA 1TPEA 2ZZ7A 5HUOA 5DBTA 4HNTA 2Y7DA 3DGRA 1UBSA 1RQBA 3NL5A 3VFLA 1FWSA 3NPUA 4YLWA 1OX4A 5I3KA 2H3BA 3FLUA 2E68A 3W7MA 3EX3A 3GNNA 4IXXA 3SGUA 5K9CA 3N3MA 3LCGA 1QDSA 1QCWA 3Q94A 1VRDA 5KZMA 3NM1A 4RV8A 1WYIA 2QUTA 3FS2A 2C19A 5LGZA 5L9FA 1QOPA 1AG1O 1O60A 3MI2A 3P5YA 2I1OA 5HR7A 2WKJA 1YYAA 1E51A 3L5MA 1M6JA 1H7PA 4UC5A 2Q8ZA 1YADA 4I9AA 2VENA 3SY5A 5K9XA 3LRLA 4HPJA 3G1VA 4FEZA 3NPXA 3CU2A 1TPB1 4JTSA 3L66A 4O4WA 2NXGA 4AAJA 3GR7A 3NQFA 4JY9A 4IPIA 5D02A 2QR6A 5HMSA 3E96A 4WZHA 2Y70A 1JUBA 1NSJA 4WUIA 3IIXA 5C2XA 1Z48A 2TMDA 3GDMA 2VFHA 2VFDA 4FIRA 1TQXA 2RDWA 3G1FA 3W86A 5DXXA 3QPYA 4LVDA 4N4PA 2ZTJA 1GQNA 5D2WA 3W7NA 4ALDA 3NQAA 4UFHA 4MFEA 2JBMA 4FB7A 5LZLA 1X1ZA 2DZSA 3L2IA 1LP6A 3PAJA 2E5DA 1KM3A 2CZFA 3PR2A 4YWIA 2A7RA 5D33A 4BI7A 2X16A 4DBDA 6TIMA 2QAFA 1H1ZA 2PE4A 4ICNA 4XBKA 3B0UX 2A5HA 3TU9A 4N9DA 4E38A 5DN1A 1OYCA 4RZ6A 4GJ1A 4UIOA 3RK8A 2H90A 3PC0A 3GX9A 1KV5A 3N2MA 3O8AA 1K3UA 1LORA 2Y85A 3C0JA 3GR8A 2VFGA 4UMCA 3L67A 2QCCA 1FWTA 1VCGA 3DFOA 3ABOA 4EF9A 4E2BA 1KBJA 3HQ1A 2Q3OA 3GAYA 5G2HA 3PUDA 1D3GA 1N8FA 1S3HA 3FJ6A 2ZZ3A 4Y9AA 4R33A 1W5OA 1LOSA 1RQEA 1OHLA 1F74A 1KLYA 1O94A 4FF7A 3L0GA 5F4WA 1H7WA 4KWWA 1TRDA 2G97A 4DQWA 3WJSA 2BX7A 4O1DA 3VNDA 5D03A 2A1YA 1DOSA 4NJKA 1TPFA 4Y96A 3HB9A 4FX7A 2JKEA 2CW6A 3CHVA 3LXAA 1PCWA 3S8HA 5BMWA 1JUKA 3L65A 1WBJA 2J9YA 1O4UA 1F2JA 3M5ZA 3RNDA 1VGAA 3STCA 4NNAA 5CSSA 3C2VA 3OVQA 3W2MA 1MZHA 1QR7A 3QYQA 1YTEA 1ZALA 3O07A 1WOBA 2A6NA 4PA8A 4CNPA 3GXPA 4BI6A 1KTNA 5F2MA 4UTWA 3L21A 5FEZA 2O7SA 3MMTA 2GJLA 1H50A 4BF9A 2DJXA 3TC6A 5DCBA 4WY0F 2XFWA 3C56A 2YX0A 1VZWA 4D2JA 4Q32A 2BTMA 2E6DA 3EKZA 4P61A 1PS9A 1SO3A 5DLCA 4IJBA 2NUXA 5CPNA 2DJLA 2TRSA 4FNUA 4X9SA 1F5ZA 1H60A 5C5YA 4MYAA 3G24A
chains in the Genus database with same CATH superfamily
4JTKA 1V8EA 3W7EA 1S5TA 2UWFA 5A6TC 4BEUA 5BROA 4R9XA 3DU0A 3WSUA 3NXFA 2Y2WA 4RR4A 1X8FA 3GYCA 3EMZA 1SW0A 1XRSA 1TO3A 1S2UA 3NO1A 4O14A 4DO7A 2DSKA 5EGRA 5KINA 2A3CA 4O17A 2HS6A 4MKNA 1W5MA 4C6KA 1S38A 2PLMA 3UF9A 3H54A 1DWGM 1LL7A 3WMCA 3QMTA 3LCFA 2P5NA 1UZHA 3G2GA 3KVJA 1F3EA 1FY6A 2XH2A 3S5ZA 4JQ1A 3N4EA 1AD1A 4PUWA 1UASA 4DF1A 5FD0A 4DAIA 3OTRA 1K4HA 1NF0A 3VOHA 1J2WA 4P8VA 3SI9A 3N34A 1O68A 4ZENA 3R94A 3GU9A 3MDWA 3BCFA 5A69A 3MI6A 2QDHA 3QV8A 5KMYA 4RE0A 3V3WA 2ZOXA 4J9JA 2QPSA 2A6LA 2ACUA 1QW7A 2KX9A 3PTQA 1ZSXA 3JU2A 2Q09A 3CTLA 4KPLA 5TF0A 1PX4A 1QW9A 1XXXA 2GJNA 1VFHA 3DYOA 2ZZ4A 1OX4B 1E6PA 3LBOA 1NDVA 2R1NA 4JKKA 3QJAA 1ZJBA 3HIJA 3CNYA 1MW1A 4Q8QA 1RA0A 1MXGA 3SR7A 5LYRA 5E1QA 4UQBA 5AHLA 1DQUA 5T26A 1JCMP 9CGTA 3S6DA 5LA1A 4JGDA 2MUCA 4PMDA 2QMJA 3AFBA 3ARUA 2Z2UA 4LX4A 2P50A 4ZTXA 4GO9A 3VE7A 1JZ5A 3UWWA 1B3VA 1K8YA 4B9ZA 3EX2A 1ITUA 4JHOA 1XSJA 1HJWA 4FPSA 2CLKA 4M1RA 4XZHA 4OGZA 2C16A 2PWDA 3TYBA 3ZS4A 1SO6A 2X7VA 3AMDA 3JZEA 4KFOA 1XLAA 3QKZA 4V1XA 4ZOCA 2J7CA 2E5CA 4LSBA 4DEFA 2D23A 2FQIA 2YL8A 3ARSA 1H63A 1RPXA 4Z1BA 1UD6A 3BG9A 3I7RA 4S39A 1SR9A 4DPPA 4GINA 2ZE3A 1CGWA 1RQHA 1WDPA 4FLOA 1QAPA 4LY8A 4C6CA 5BU6A 4HPXA 4D6DA 5KITA 3AXXA 5EFFA 4Q33A 1XYMA 3WBWA 5LXXA 4GZJA 1K03A 1DIKA 1I0BA 3CV6A 1XIMA 3MMWA 4IQDA 3SCVA 3OIXA 2RGMA 5BU9A 3EMCA 4CGTA 4YYFA 2E25A 3REQB 1R7AA 3ARXA 1C93A 3W1AA 1NJJA 4PUDA 1EA9C 1U5VA 2DUZA 3A24A 1RXOB 4QAWA 2A4AA 2WNNA 3U4AA 4GE8A 1KFCA 1W3JA 4U33A 1X7IA 1V77A 2QS8A 3RJXA 4LB4A 1F4HA 4L64A 2CNCA 1LUCB 4ZQMA 4S3KA 4NU7A 1NOUA 3WQ6A 3LI0A 2ZE0A 1NOFA 4A2RA 4QROA 3THDA 3GIYA 4PTWA 1MMFA 1T8XA 2NVAA 2WPGA 5H2ZA 1J11A 3ORWA 4FIQA 3MKVA 1EDTA 5FJIA 3UXDA 4OBSA 2EQDA 3TYCA 1XYLA 3PJUA 4NJHA 1IYXA 4TV6A 3WUGA 4H6EA 5AB3A 5I0DA 1V3JA 1VFTA 4XKMA 2Z27A 1P4CA 2DH3A 4S3AA 1H1YA 1LBLA 2ZVRA 1W56A 2I9EA 1JZ6A 1GZ1A 3ATZA 2I14A 4JNZA 3EOEA 2JKPA 5LGXA 3TXZA 2ZDSA 4LGXA 4AZ7A 2PTYA 2ZXAA 4A05A 1OIMA 1QO5A 3QF0A 4Y9PA 3GIPA 4EWJA 3B0XA 4W7WA 3MCNA 3W2UA 2GK1B 1O6IA 1Y5WA 1SW3A 2VVNA 4X0VA 3VE9A 3EOSA 1GTHA 4R88A 1BXBA 3EWWA 3RGTA 2PD9A 3B9AA 1YTKA 1O95A 4D72A 2ZRYA 5KZEA 1QHPA 1W32A 3GXFA 3DG3A 4J40A 4QEHA 3FEQA 4GD0A 1RV8A 4KCVA 3NL3A 2PBGA 2Y8KA 5AY7A 2G50A 1W9PA 3EPMA 3PULA 2PF8A 2WC4A 4ORIA 4AZIA 3MI3A 3FYOA 3CYVA 4R85A 1QWGA 3UA3A 1GOXA 2YXGA 4LAKA 4MWAC 5LSMA 3S0CA 4U3CA 1RSCA 2ZZ2A 3G0XA 4JS3A 2ZXBA 3UPBA 1H0IA 4DBSA 4OWGA 3WJWA 5BW6A 4J4KA 5GNXA 2D20A 1UUOA 1SM9A 3P61A 1KWGA 3K4DA 4IISA 1J79A 4AWSA 3ES8A 1QFEA 3SZ8A 3IVSA 1G69A 2NQHA 3FV9A 4ZO9A 3QPZA 3C2YA 3KOYA 4MIMA 1NF7A 2V3FA 4HD5A 2TYSA 5A6LA 1OSEA 1IR1A 5A6KA 1R3TA 1U30A 1ZTVA 2XIIA 1EOKA 1Q8JA 4FXRA 4G7EB 4BCEA 4NZCA 2PRHA 2V3GA 3VKCA 1PBGA 3RX4A 2G3FA 3P84A 5M5DA 4O8RA 5BYWA 1KW1A 3LBMA 2DIJA 5HNRA 3O2LA 5D2YA 1TV3A 4LB3A 4QITA 1F6YA 3MSYA 4I9TA 4Z0SA 2E9LA 5LIXX 1Z42A 3SN1A 4TV5A 3TYDA 2HRWA 3S2MA 3BV4A 2Y62A 3QZ6A 3E2QA 4GY0A 5BXRA 3GNRA 2JKAA 1T6MA 2DW7A 3BGJA 2QKFA 1IF2A 1LM1A 3FK4A 2VDGA 4PFMA 3GU2A 5ECUA 1US3A 3M1ZA 3LSCA 3WQFA 3N9RA 4LCRA 1G4PA 3WDHA 4ZB0A 3O6YX 5C2CA 4GMEA 4ROPA 1PIFA 3W7JA 4M6VA 4TVUA 1TJPA 4AIBA 3C0LA 4MNJA 1VF8A 3W7HA 3ZVHA 4UFMA 1DQXA 1KA9F 1Q6CA 1ZHAA 3CMFA 1V6YA 5B80A 3A13A 4QQUA 2EHHA 5GJNA 5DY3A 3AWNA 4F0SA 4G2DA 4HYWA 1HUVA 3CL6A 3ITLA 3RX3A 3UXLA 1HKMA 4LEFA 3FAWA 1ZAIA 2NLIA 5F1UA 2OTDA 1XICA 3TTSA 1EJXC 3VNKA 4WOQA 3RDKA 1JYXA 2VGFA 4GA8A 6TAAA 2B0MA 1EEPA 4DYEA 1VEOA 1TQJA 1N8IA 2HQAA 2WBGA 4HSOA 4GZ7A 2V0TA 5ABEA 3R25A 5CKSA 1IEWA 1YDVA 4WGXA 2D22A 1P6WA 3CWHA 3B4UA 1AQ0A 4K38A 3KHJA 4HU8A 1BFNA 3LGEA 3BMWA 1XV8A 1BF2A 3WLSA 2O4QA 1DKWA 2WSRA 3R2GA 2GQ9A 2NQZA 1PSCA 3LRKA 4LJ3A 4QLJA 2G3JA 2VJXA 4GFIA 2NWSA 4GVGA 1KCLA 2FJKA 1UA7A 2NQLA 4GUHA 3T8QA 3GW3A 2CERA 1KR0A 2EGZA 3WF4A 1X96A 2CLIA 3T05A 3TJIA 1EQCA 4OZOA 4HK7A 3T09A 2NV9A 3VDBA 3MYOA 4RKAA 2NVDA 1JULA 2Q8XA 4WDWA 4EP8C 1XLBA 3BVJA 1SO4A 1IXPA 3SJ3A 1QOXA 2YDAA 1ME9A 2YDRA 2WYSA 2V5DA 1V08A 2IPFA 4LAMA 1SQ7A 1XLEA 1FDJA 2F8QA 2DQXA 4H41A 3H53A 3VIJA 2J79A 4O53A 1AD4A 4RDYA 1F6PA 4HT3A 2X09A 2YFOA 4ZQPA 2QF8A 3T0BA 1B2YA 3QEZA 3QN3A 1M7JA 3G3DA 3RPTA 5XIAA 3T0AA 4H9XA 4D1JA 2AKZA 3VGDA 3CB3A 5BRBA 1TUXA 2ZRUA 1UR9A 2GFTA 4UOQA 2DZAA 3DFQA 3EDJA 2OLAA 1YDYA 3KOFA 4E5TA 3PZVA 1QMLA 4X60A 4AC1X 1FHVA 1S5NA 2FH8A 3LHWA 1FTXA 3IJ8A 1KGWA 1SSGA 1LTDA 2YZRA 2EJAA 3HA1A 2BXVA 4IIFA 1K02A 1NQ6A 1JI2A 2HTMA 3BLEA 5FF0A 5BXSA 1S2WA 4ZEPA 1EIBA 1Y0EA 1TYGA 1XYFA 4NYUA 2QF7A 1GJPA 4E3TA 2WJDA 4RJEA 3E2RA 4H00A 3DUGA 3BZGA 4MUPA 1H7XA 3HFTA 5D2XA 3SFWA 1S1RA 1VH7A 1BYBA 2CHRA 1I75A 4A2SA 1VIWA 2IKIA 4UFLA 2WC3A 1VBRA 1HGWA 5DX7A 3O6AA 2PURA 1J0IA 3HU7A 2XZ7A 3ONCA 4H83A 3UXIA 3GZ3A 4JTLA 3GBEA 4J5NA 5HNTA 1A5OC 1MQRA 1R5YA 4B3LA 2QPXA 1PKYA 1YHTA 1Z69A 2PF0A 4XD6A 2DVXA 4PMUA 3RJYA 4BHYA 2POTA 4IQEA 2V3DA 2J88A 1S5VA 1WA3A 7ODCA 4GACA 4UOZA 3ITOA 5FAJA 2P53A 3O6DA 2QVHA 3TSDA 1VYPX 4AF0A 1UC4A 2NW0A 3GWQA 1QATA 5F7UA 3ARRA 2BS9A 3L7RA 1T99A 1EF3A 3VIIA 1GZJA 1EBHA 2R14A 2V30A 1PV8A 4UTUA 2JIEA 4U31A 4PUKA 2V69A 4HBKA 4H3DA 5KSWA 3EOLA 1TA3B 2BSLA 1X7FA 2ODOA 3NO5A 2OWCA 1KM5A 1EHNA 4L65A 1E4MM 3J7HA 1ITXA 2ABAA 4DJFC 3OOQA 3CPRA 3R11A 3CIXA 3BUVA 2QV4A 3CT7A 2Y8VA 3O16A 4O54A 1ZJAA 2PDJA 3CPGA 1AZ1A 5AHEA 3EZ4A 3IV3A 1TR9A 3SCOA 4KCTA 5ABFA 4X9YA 4ORMA 4PMZA 3TCEA 5C9XA 3AS0A 5CSUA 3TAOA 2W9MA 1UJQA 1R9XA 3ITGA 4UMBA 1HKVA 3CUIA 1YBQA 3CASA 3M7SA 2D0GA 2LLEA 2Y7EA 3U3HA 5A6JA 2IS7A 3DIPA 2R82A 3DERA 1GW9A 1G67A 1CLKA 2FTYA 3P7YA 1DWHM 3WK2A 1Z3NA 2XDFA 2HJPA 2GGIA 3IJ9A 3NIYA 2REQB 4L6DA 2FPVA 3WQVA 2Z1WA 4FXSA 5FEWA 1CBGA 4LC8A 1GZGA 4A8NA 3IWPA 3UCDA 1A0CA 2J7DA 3BLDA 1IXOA 4F79A 4Q22A 4LT9A 5M2FX 1F61A 3UY7A 3CO4A 3VTRA 2XVKA 2W63A 3QHNA 2DUXA 3PZUA 4K3ZA 1W17A 4J3ZA 3KOWA 4IGSA 4TOQA 3PPFA 3PPCA 2X40A 1HQTA 3QOMA 3VZXA 2PODA 3O15A 4QS6A 4L1XA 2A2IA 1TPC1 1L6WA 1RR2A 1P0EA 3KDOA 3UP8A 4I6VA 3MV11 4XBJA 3W1MA 5C0QA 4PMQA 3TX9A 3AIEA 1TPWA 3UR5A 1FOBA 4IMEA 2XZ9A 4YVXA 3CMGA 4NX0A 4K37A 5RUBA 2NX9A 2XU2A 1V51A 3Q2DA 6PTDA 2AQWA 2E8ZA 1YX1A 1W1TA 1XLHA 4LRSA 1OFDA 1XDMA 2O4MA 3MHUA 4I90A 4CU8A 3N04A 4RE4A 3KRBA 4RDVA 1VBHA 3VX0A 3S1XA 3BLLA 3AYTA 3DXIA 1YNQA 4ATLA 3WUBA 3K4WA 4MWAD 2A3BA 1GVFA 2HWGA 1T0OA 3URNA 4LUSA 1GVOA 3R58A 1W3TA 5CGMA 3G3MA 4DLMA 2WBKA 4KW2A 4LFYA 4AYGA 1VFUA 3IAPA 3ZOAA 4E2OA 4AEFA 2Y5SA 4XB3A 3N25A 5J5DA 3W73A 3IJQA 1K1DA 1UUMA 2NQ9A 4I9MA 6XIAA 4I5RA 2XSAA 3CTTA 3TJXA 1H3GA 1JGMA 3A9BA 3HG4A 5IRPA 4H9TA 2PRLA 1GPWA 2FTWA 3A21A 3OVPA 3W7QA 4C91A 5JIPA 3M0VA 4L80A 4FK9A 1CGTA 1JCXA 2CESA 4GIAA 1PX8A 3DAQA 1AW1A 3VOJA 4O1AA 3P8IA 1E55A 2FB2A 4KEVA 1XX1A 2DVTA 3TVAA 4PB3A 2WZEA 2DP3A 2AAAA 3PPGA 1J0HA 2DSVA 3UXAA 3V4BA 4LAUA 1J6OA 3T40A 3W02A 1H1NA 4CVUA 3AZTA 1ONRA 1K77A 2BY3A 4FP1A 2D69A 1XIEA 3XIMA 4HA1A 2QAPA 1TX2A 3EDDA 1H5VA 3VKKA 3EYPA 1PO9A 1F8IA 2FGBA 3C86A 5LKYA 4YTSA 2C6QA 3RITA 1BLIA 3MUZ1 4NJJA 4EXBA 1O7AA 2PWVA 1VRXA 4IL0A 3IPWA 2CKSA 4MNLA 3URAA 3REQA 3EX1A 4HHPA 1Y65A 2Q8LA 3LV6A 4KEZA 3GXTA 3PUGA 4UTTC 4DXXA 4UWMA 1IV8A 3W4RA 3VOIA 4H4IA 2J27A 1GORA 3L4XA 2FVLA 4IJCA 3FOKA 4RX0A 2OEKA 2YXXA 5I3DA 1HZYA 2OELA 3IRSA 4XKYA 3TA6A 2BV9A 3K2GA 1QASA 4QTGA 1R87A 1Y5VA 2Z26A 2QLYA 2NT0A 1BKHA 3DFTA 3LPFA 3NDZA 2IKHA 1GVRA 3QC3A 4UTHA 2WNQA 1LL4A 4WGHA 1B90A 1WCGA 3UU0A 4AHQA 3HGSA 3BPWA 5A2BA 1HJUA 3HJEA 3ITVA 2Y0FA 2FFCA 5MF5A 2Z0IA 4N2YA 1RA5A 1S39A 3VD4A 3RMJA 1NARA 3G1DA 1ISZA 3FSUA 3T9PA 1RCXB 1FH8A 3GY1A 4RUBA 5PTDA 1CGYA 3ZR5A 3DKLA 5C9WA 2A79A 1WBHA 3WYZA 3ICJA 4Z2KA 2VZOA 2I5QA 3NYDA 5JBDA 2RDXA 2ALRA 3BOFA 3EXSA 4C1NA 2J7HA 4UUIA 3WJXA 3ARWA 1GJUA 3THQA 4UB9A 1JCTA 1GUVA 3A22A 4P8WA 3B06A 4LALA 3RM9A 1W54A 1P0KA 4RDWA 1DWFM 1JQVA 2HDJA 3UG4A 2QYGA 3I7SA 2PBOA 5AOUA 4C7DA 5C2GA 4R34A 1D3HA 2XWDA 1VBUA 2L5HA 5C55A 5IXEA 2VZUA 2I5GA 1F76A 1HL9A 1BWVA 3S6OA 4A3UA 5DEZA 1WZAA 4DF0A 5AC7A 3I6RA 2ZRZA 1B1YA 4X61A 3E5BA 4H7ZA 4RNIA 3NVDA 1CPUA 4XWUA 4W89A 4H19A 3MMUA 3B04A 4HMDA 3EKLA 1OM0A 1RVKA 4MOZA 2VWSA 3R1ZA 5DXYA 4HOWA 3UWYA 3F2DA 3VABA 1RD6A 3M64A 2IW0A 3HG2A 1XSKA 3W25A 1HFBA 1OF8A 1M01A 1UKOA 1LZOA 1PZ1A 3WL0A 3WQPA 3DGBA 1BQCA 1H11A 2WNWA 4JXCA 4IX2A 3NL2A 4AEOA 2GGGA 3RMEA 4BR1A 2OYMA 3BAXA 5E9XA 3UW6A 3CWNA 3M0XA 1I4NA 4QEEA 5G2IA 3E5PA 4RXGA 4LS0A 3H55A 5TQLA 5FF2A 2KAUC 4QG6A 3B3DA 3V1HA 2VUYA 3ATYA 4Y90A 5JBEA 4JQ3A 4FLQA 4LVAA 1CGXA 2ZDRA 1U1HA 1XD1A 4ERIA 3OA5A 1OZMA 3UETA 4A22A 1UWQA 2X42A 2D1ZA 3W82A 2OKTA 2I17A 3L5AA 4JIIX 4BK9A 3T44A 1WZLA 2E9BA 5HXMA 3TW7A 3VNZA 1DJQA 3KVKA 3SIZA 4UTTA 2BDQA 5CBIA 1R8LA 1AFSA 3VXGA 4HNOA 3OU8A 4A3HA 5AC6A 3WDQA 1OGSA 3AQUA 3WD1A 3W1XA 4F9JA 1EC9A 2Z6JA 4WEVX 1BYAA 3H2EA 1OFBA 2X1RA 5DCEA 3P2VA 1T8QA 3ZSTA 4GIEA 4GIYA 3S9YA 4IHCA 4PMYA 3TC3A 3TR2A 4AYSA 2CBUA 4ZE4A 1EJVC 3TFCA 3WH5A 5CGQA 2VO5A 4GJIA 4H9YA 3B03A 3ABXA 4MADA 4LUJA 3R12A 5A3HA 2WC7A 2OR2A 1UA3A 2FZMA 3VD7A 1A49A 1QPNA 4IG2B 4WVXA 1XDJA 5DCDA 3B8VA 4KERA 2BNJA 3S1UA 4UTKA 2AMGA 1EGMA 2HZGA 4OUIA 4W5ZA 1DHKA 1D7KA 4NKCA 3M6YA 3R8RA 3S1VA 4REQA 1OT2A 3W7OA 4D6FA 5FJUA 1FDYA 3RFAA 1I2PA 4BQ2A 4GK8A 1XRVA 3N13A 1QPOA 3LRMA 4EXAA 3GUGA 1GQLA 3VK5A 4AXKA 4JQ2A 4DO4A 3FYYA 4H9UA 3STFA 1KM0A 3CV1A 3LTPA 2BGSA 4B2DD 4DJFD 4GYFA 1V93A 2FZDA 2D2GA 3NA8A 2ZX8A 2IQ0A 2ZTKA 4LPCA 1AMYA 3FKKA 4GZIA 1EWDA 3PY2A 4DUOA 1E6QM 2B4GA 1DJWA 1JI1A 4B5TA 1KM6A 1OQFA 2QCDB 3ARPA 4IMAA 3G1SA 1S3TC 3G1YA 2BY1A 2XIOA 4E8DA 1IEQA 1FKXA 1OFQA 2YSWA 3ZFHA 4GY1A 4XO7A 1TWZA 3URBA 3V0UA 2XM1A 1B57A 3B8TA 2AAMA 3F4VA 4HYVA 5HJXA 5CH9A 2PDMA 4ZXOA 1PVNA 1WXJA 3VNJA 4NRRA 1I9CB 2BWGA 3LCLA 5HBFA 4CQ9A 2AQOA 1Q5MA 2PP3A 3BV7A 4IFRA 5D9NA 3ARTA 3SEPA 4C5YA 1UROA 5I3HA 1V3KA 4AVFA 1VEPA 1R2TA 5M3WA 3VIFA 4XBSA 5G4EA 2QMKA 1EO7A 6XIMA 3W6YA 4I5UA 2E1WA 2HVOA 4GGHA 4AEEA 4CCEA 1N82A 1AW5A 1DL3A 3RHGA 5TBOA 3BSGA 3ONBA 1G94A 4H6QA 1V0KA 3MV01 4OQVA 2WSQA 3CUHA 4J28A 5E70A 2X1SA 3NQDA 3T7VA 2GYIA 1OYBA 2BVWA 3E9AA 3ZO9A 1TPEA 2ZZ7A 1J9YA 5DBTA 5HUOA 4HNTA 5FOOA 1RQBA 1FWIC 3W26A 5BRPA 3BWWA 3NPUA 2FZNA 5I3KA 2PDGA 2BBFA 3EX3A 3VM7A 5K9CA 5E0CA 1L6FA 1QDSA 5DMLA 1EGVA 1VRDA 5FJRA 1EXPA 5KZMA 4RV8A 3FS2A 1FH9A 5J8LA 1QOPA 1AG1O 3M6DA 4DJDC 5CJ5A 4IFKB 1XLDA 4GVHA 1E51A 2WB5A 3L5MA 1M6JA 2QDEA 1TMLA 4I9AA 2OYLA 4HPJA 4NAFB 3G1VA 4FEZA 3U7VA 2GUBA 5A2CA 5I00A 2IQDA 1KKOA 1Q85A 3GR7A 5D02A 3WNOA 4KCUA 1VJSA 4WZHA 3VNMA 3T0CA 1ZJHA 3PZOA 4Z1YA 3GDMA 4FIRA 4X2PA 1KRAC 2WCSA 2VYOA 4TQTA 3W86A 4EKJA 2HXTA 4JIHA 3QPYA 3AYSA 4E4PA 5D2WA 3WNLA 4UFHA 1GKPA 5LZLA 3CAWA 7REQA 1LP6A 2XH0A 2CZFA 2B81A 1SJAA 4YWIA 1A5LC 4ZBCA 4F66A 4BI7A 4DBDA 2VI0A 4ICNA 3TTYA 2A5HA 1CT5A 4RZ6A 5DT7A 2VZTA 1M03A 3N2MA 3O8AA 3H23A 1TX0A 1LORA 2Y85A 4XD5A 3V36A 2FZBA 3BQ6A 4EF9A 2OWXA 3T2PA 1I1XA 3A12A 5G2HA 2DSZA 1D3GA 4Q8WA 1S3HA 3FJ6A 1CXLA 4LAZA 5A6BD 4R33A 4MAZA 3PBGA 4WDUA 1W5OA 1LOSA 1OHLA 1O94A 3L0GA 3QV6A 3GFYA 4DQWA 2G97A 4CEXC 5A8OA 3VNDA 3S2CA 4EAMA 5D03A 4NF7A 2YDSA 4NJKA 1U33A 1DJXA 3DOPA 3AOFA 2O56A 5A8NA 3HB9A 3VAVA 1SFTA 2CW6A 3CHVA 1PCWA 3AS3A 2CC0A 2GJXA 5B7ZA 3L65A 1MXDA 1XPGA 1K9FA 1UQZA 3RNDA 2VZSA 3RLHA 1LWHA 1OBAA 5CSSA 5FL0A 3W2MA 1YTEA 1ZALA 3O07A 2WVVB 4N7QA 4GIRA 5JIWA 3A3HA 4PA8A 2A6NA 1AQHA 3L21A 3SCQA 3BDKA 2GJLA 5CPQA 1H50A 2BG5A 2EJ1A 4HU4A 3SURA 3TC6A 5FIPA 4PUMA 1E3XA 3PTDA 4D2JA 1SO3A 5AVNA 5CPNA 1XGZA 4XAPA 2PWUA 3RM8A 4H01A 4NRSA 2FHFA 3KLKA 3IJ7A 2G3NA 5IHSA 4UZUA 4CN1A 3ZT6A 1IE7C 1W9XA 4KQNA 3DHFA 2B7PA 5FKYA 1EC8A 5CXPA 5DELA 1GVIA 1UW9A 4M81A 2Z28A 3EAUA 3M0MA 4XZIA 5AKQA 2J25A 1ENUA 4Q8VA 1H7RA 1XKJA 1XP3A 3N18A 6REQB 5DMYA 1QI0A 2EPNA 3NQ2A 1E0TA 1PCKA 4WXYA 1GYMA 3E6EA 3S42A 5D4YA 5E0KA 4PMRA 3HPXA 4PODA 2Z1BA 3IK2A 2ZADA 4UQDA 2AL2A 3OA3A 2XWEA 2OYKA 1KQZA 4QLLA 3SCWA 1QNVA 4PTMA 3CZKA 1UR4A 3WEMA 4GFSA 4K36A 2QCHA 4NILA 1IIHA 1LRTA 1Q6OA 3TYEA 4I8DA 1H5YA 3QPEA 3WFZA 4UOJA 2GVYA 4AY1A 4BQ5A 1V0NA 4XZBA 4UMAA 1W2VA 3W24A 5E09A 4B15A 1U5HA 3NWRA 3PBMA 1XUUA 3H2OA 4RL3A 5IHRA 1E9YB 1PUDA 1F3XA 2PTZA 2YCEA 5D32A 2V3EA 5HWJA 3LSBA 4PTXA 3W2KA 3W7KA 3H6OA 2XG9A 4ZODA 1Z44A 1UCWA 4ECLA 3W70A 4IWWA 2C91A 2ZIDA 1HJQA 1TZ7A 4QJ1A 1L6YA 4KIEA 4UFKA 3WELA 1IEIA 1K8ZA 4S3EA 2OQHA 5A8PA 3IGHX 2E9MA 3BG5A 3B9EA 1EJWC 1UR3M 1UWTA 1XBXA 3K1DA 1JUEA 1K8CA 1Q2SA 2XFRA 3VIKA 2QJGA 2WV8A 1Q6LA 1UOKA 2WZIA 2YYUA 5CG0A 2BHUA 5GVJA 1WAUA 2WMKA 3G8RA 1IZKA 1W1B1 1R3RA 3LXCA 3QBUA 5HWNA 1O1HA 1IT7A 3ZLFA 2UBPC 3NQGA 2J9ZA 2DH2A 4JIEA 4JKMA 3KAOA 3W1QA 3A6OA 3ZWSA 4QNWA 4L9ZA 3HGRA 2VTFA 1QI4A 1CECA 4XZLX 1GVQA 1WKFA 3GB6A 3H2CA 3APTA 3VCNA 3UG8A 3D6NA 1WZKA 1WDRA 1O12A 3QFEA 1JRBA 4QIUA 1H4PA 1C91A 1UPMB 4JPGA 5H91A 2GVJA 2XTKA 2OCZA 3SRFA 4YMZA 3OIHA 2EG7A 4NZFA 4KGLA 4Z08A 3PUEA 4MY8A 2EPKX 3BC9A 4HU0A 4JBRA 1BRLA 3NYZA 3F5KA 5EMLA 3I65A 2VGGA 3R13A 4JTTA 4PCPA 4U5KA 4S1FA 2X2YA 3RCMA 4O57A 1QUMA 4Q8MA 5GPRA 3TZNA 1UR0A 3GBDA 4B5WA 2XVPA 3KTSA 5CJMA 4AMCA 3WCZA 1DJZA 2V5JA 5EMMA 4H2HA 3UZJA 3U0HA 4EANA 5EBAA 3PNUA 3GAKA 3AIQA 3HMCA 2VR2A 5C54A 1AJ0A 4DHGA 2VEIA 3SAZA 1OABA 1PTGA 1MO0A 3LBCA 8XIAA 4U28A 3MHFA 1QPKA 2F61A 4Y8FA 1J01A 1I2QA 3VIOA 3QGAC 3R0DA 4W4QA 1RCQA 3VOCA 4R3UA 1THFD 3ME3A 4C6IA 1MW3A 2GQ8A 3UERA 4D6HA 2INZA 3DDMA 3AYRA 3UWEA 3CAQA 2G3MA 3KRZA 1GT8A 2EXOA 3L9CA 2GDQA 3UQNA 1W3NA 2PMQA 4IPJA 5KTLA 4IZGA 3TEVA 3FJNA 1D3CA 3SW6A 3IJIA 1G4EA 5FF7A 3AUJA 4YTTA 3UWZA 3LZ3A 3T4CA 1IEVA 1VQTA 1KQYA 4JTQA 4UTIA 1W1VA 3LMZA 4RW3A 4O52A 2GVLA 4QCEA 3PSWA 3WLJA 6CGTA 7XIMA 3T78A 1ISXA 1ZENA 3AWOA 2NZLA 1VC4A 1CGUA 1S46A 3UBPC 4HN8A 1WO2A 1PDZA 2E8YA 3QRHA 1DORA 2EPHA 2QUUA 2DZTA 3BGAA 4TO8A 3HGJA 3QSTA 2G41A 3LHZA 4AD5A 4H8NA 3IGSA 3BK0A 3C8FA 1C92A 1TIWA 3CQKA 2BP1A 3AAMA 1XHGA 3MP5A 1KXVA 3JRKA 1SZNA 2ACQA 1V7AA 2BVDA 1PYFA 3WJYA 3OVGA 4AZCB 3K13A 1E3ZA 2CXGA 1ODZA 4EF8A 3DKJA 2V82A 1JPKA 5LNRA 1PB0A 5EL1A 2HNEA 3AMKA 4HMNA 2CWXA 3MMDA 4RPQA 2ACRA 3TXVA 1FCQA 5AFDA 2HPIA 4BF5A 1FDZA 1QO2A 2I16A 1G01A 2DGAA 5G1YA 5F4SA 3THCA 4IIDA 3APYA 1AODA 5LHFA 2I56A 4XIMA 3GQYA 3SY8A 2E6AA 1IGWA 4FXJA 1VFMA 4O10A 5D04C 4JFTA 1LJYA 5EKYA 3KCJA 2POZA 1FP9A 3DI0A 9RUBA 1FA2A 3HTWA 3UR8A 4J1OA 3AI0A 2CLHA 4YTRA 2ISWA 4NHVA 1NFPA 4R27A 3LEPA 3W2JA 2QXWA 2PDHA 4EXQA 2BOFX 2IMRA 1JVNA 1EJSC 2QVNA 2EEXA 1ICPA 1H41A 3T0DA 1X6NA 4HOXA 4US5A 3AXIA 1AH4A 1SSDA 3ABQA 4XG1A 3TWAA 2WVUA 3VA8A 7TAAA 2FPTA 3FVMA 3NQMA 3RRXA 1BD0A 3ZSSA 5ECVA 3PG9A 3TCSA 4FS9A 2DW6A 3D3FA 1M7PA 2ZCGA 3FIGA 1UD2A 1X6UA 2OX4A 1FHDA 3A4WA 4GVIA 2Y5JA 2V2CA 1V79A 2XYLA 4H9MA 1OC6A 4B16A 4L4LA 3VMOA 2RGLA 3MW7A 4O18A 2WZTA 4GBDA 4TTUA 4YTQA 1FWRA 4GKTA 3M41A 2F84A 1ISVA 1MW0A 1UKSA 3CH0A 3N2TA 1NOWA 3VCCA 1FWAC 4EAYA 2PP1A 3L4ZA 1HL2A 1Q6DA 4L61A 2VX5A 4U2ZA 1IZJA 3PTMA 3NTYA 3CWOX 3VPLA 1XYAA 1QRQA 2BGQA 4WQ6A 1MUMA 4FLSA 3W87A 1QNQA 2PB1A 1WPCA 5M03A 4A21A 1YKWA 3GDBA 3HM7A 2SFPA 3UNDA 4H2CA 3GTHA 4UQ9A 1A5AA 1RY8A 2QPUA 1UP2A 2VKZG 3ZJ6A 1LYXA 4BI5A 4ASTA 1CCWB 1EX1A 3W37A 1LT7A 3ENLA 1XPYA 3HPSA 2X7WA 3E1F1 4KKXA 1TMHA 4W9TA 1BG4A 1HVXA 1Z41A 1XC4A 2VFEA 4FNRA 4DX3A 3EPOA 5A6SA 2VDIA 4B5UA 1E5JA 1F3TA 4ZE5A 3B0VC 3SCRA 1CWYA 4HP5A 2QCFA 4P7OA 3CBWA 2YLLA 3GFZA 3OQ8A 4JIRA 4O50A 2PGFA 5AHFA 4MJ4A 1DV7A 4PULA 2YL6A 1OGGA 1V3MA 3W7RA 1H49A 3W74A 5A8MA 4UCGA 3GDTA 3VDCA 4JX4A 4W5UA 3LS9A 2UV8G 2ATSA 3AHXA 3TSBA 3S2LA 1FCBA 5FAGA 1E40A 3FHAA 1PIIA 1CB2A 2W5FA 1L2QA 2CPUA 5G1TA 4LQ1A 4U3AA 4LNCA 1ESWA 2E1DA 3LPOA 4C6LA 2HSAA 2Y8UA 1R30A 1Y5XA 4AY7A 1D8CA 4QBXA 1S5WA 1HT6A 1OFOA 4LV9A 3H7UA 2QUVA 7PTDA 2PDPA 5T91A 3A5FA 3OO2A 5I2UA 3IIVA 3K46A 4LRTA 1LBMA 3PZ9A 3EB4A 1UMYA 5CC7A 1E6ZA 3LTYA 1TTPA 3EX6A 3W88A 1OT1A 4LYRA 1P6BA 1SZRA 3GNDA 3K30A 1C7SA 4IIEA 3N14A 3H7VA 5A8QA 2AGKA 1VS1A 2H9AA 4IFOA 1DE5A 1ONXA 3AS1A 4IGHA 3SQSA 3TNOA 4O28A 1XBVA 1SYTA 5FI8A 1NEYA 3B0PA 2INFA 3WDJA 1BSIA 4R7JA 3TQ0A 3BLOA 2PTDA 5BMXA 1XC6A 1DTNA 2ZA2A 3EWDA 3W1NA 1OK4A 2F7FA 4QM1A 3SB0A 4L6OA 2WKGA 3VKJA 2OODA 3RLVA 1NWRA 3W7GA 1US0A 3N73A 3C0QA 1FBAA 1KM1A 1XCWA 4C6MA 3LENA 9XIMA 2DPEA 4JHMA 3KM8A 2BHZA 4EACA 4MPKA 5REQA 1E6XM 2Z24A 3DN5A 3SGZA 1OFRA 2HROA 3T6CA 2R91A 2XN0A 3TAKA 3W1UA 4A8RA 4H8UA 1Z9AA 3R6IA 3GW0A 5I7GA 2G95A 1LWIA 3TR9A 4XUYA 3GTNA 1XRFA 5TNVA 1I6NA 5HATA 3OODA 4HN4A 1M65A 1M68A 1ZAHA 1AL7A 3ZVHB 2WPBA 2ZZ5A 4W7UA 3M5YA 4N02A 3H70A 3MP3A 3TN4A 3TNBA 4F0RA 1HG3A 5CC5A 2V2DA 1XQLA 4XD3A 1DP0A 2FGZA 1LG2A 2F6XA 4K1WA 3U2OA 1BAGA 1W2PA 4CU6A 4DXKA 4HA0A 1TWDA 3FKRA 3HGOA 3T55A 3W29A 1A5BA 1PL9A 2W67A 1W9BM 2WJFA 3FGCA 3ITCA 4Y9MA 4C1KA 1FWCC 1I45A 3L4UA 2W3ZA 5U7SA 3N19B 2O7QA 5CPSA 2H6RA 5EYWA 3W7DA 4B4HA 4PUJA 4JZ5A 3R5EA 4AWEA 3MBFA 4KWUA 1KFKA 1A0EA 2R1MA 4E2DA 4CQDA 3SUSA 3FCPA 1W3LA 2VURA 3F4NA 3CHDA 3UCQA 4BJHA 4MFDA 1HF6A 2YOCA 1V6VA 4QNEA 3RU6A 3QMRA 3P3BA 4D8ZA 1HL8A 3MUIA 3WDRA 4C5ZA 1C8XA 3RX2A 3LG3A 2DSUA 3ABSA 2V9DA 4IMGA 1DJYA 1KGUA 4JCMA 3MJYA 3COTA 5LIWX 3UVAA 3MB9A 3RUBL 5HPCA 4MY1A 1UR1A 2PTXA 1Z32X 4WCJA 2XIBA 3NZ1A 1ADOA 1JPMA 4LF1A 1H61A 4OUEA 3FDKA 1F07A 4F2BA 2NLYA 1MWOA 3W01A 1KFJA 3PF3A 1EEXA 3D0CA 2EAWA 4GBUA 4HVXA 5CSRA 1K7XA 2H8ZA 3WBEA 4GI6A 4N42A 3W81A 3PBYA 3QHMA 3WLMA 1S2VA 3PUOA 3MQTA 2FYMA 2YBUA 1DHPA 5D30A 2EPLX 2DT2A 4QE1A 4OE7A 5KZDA 2WQPA 4H1ZA 2Z2BA 2P8CA 2ZVIA 1FCUA 1T40A 3QSRA 3VFCA 3BAJA 3POCA 1RBAA 3FA4A 2PLKA 2J7GA 1JG9A 2EG8A 4B3KA 4QCFA 1CGVA 1C8QA 4YJ5A 1UC5A 3SIMA 4MJZA 1ZP4A 1V7YA 4GC3A 1MFUA 3D3AA 3WENA 2EKCA 3OYXA 4C6BA 4Z1CA 3BLPX 3VIPA 1SMDA 4JDYA 1I1WA 3FW6A 2BHYA 1MUWA 3TYAA 1K70A 1Q4NX 3TOPA 1BVNP 4UR8A 3S2JA 4Q6XA 1Q6EA 1TUFA 1GPFA 2GSEA 4GH1A 4UZSA 3MS8A 3GG7A 1MEHA 4XISA 3KTXA 3TTOA 1DJHA 1Q45A 2VGBA 5HQLA 3M5XA 4A3YA 3DEQA 1J5SA 1G4TA 2PLJA 2IUZA 3QR3A 4ACZB 1KBBA 4PH6A 3T2QA 1T96A 2MNRA 1JRCA 3EMQA 3AHVA 2GUYA 4LYQA 3NPWA 1KKRA 3P67A 2TPSA 4E2VA 1TZ9A 3UY8A 3WD2A 4W84A 2BASA 4PUNA 3XISA 2I5IA 3BMXA 4A29A 4Q3MA 1XD0A 4ZQCA 3P82A 1GYLA 3IJLA 2OMAA 1DPMA 1XLMA 5HNUA 1GQIA 4MLRA 2DUAA 4UTJA 2QCMA 3TDFA 4Q7NA 4TR9A 4C6FA 1W37A 4AF0B 5LIKX 3K4AA 3M46A 1H7NA 1TZZA 5U4NA 1EKOA 1XS2A 2FJUB 1V6TA 4IPPA 1FUYA 4US6A 4WOZA 4NXKA 1LCOA 1Z6KA 2WCAA 3EXRA 5K3VA 3SUVA 4QR6A 2R8WA 3CL8A 4IPNB 3FNDA 2XFFA 2NQJA 1JEZA 2GWGA 1SW7A 3PB2A 1UH3A 1HO1A 1E6RA 4Q8PA 4G5DA 4UFIA 3UGRA 1VLIA 2PCEA 4Z2HA 4OJYA 1HIZA 3L23A 1IGSA 2CETA 1HKIA 1CTNA 4G6CA 5ABFB 5EMKA 3W1LA 2XN2A 3BCDA 2FMOA 3WL1A 4IH3A 5H6HA 1E4LA 1V02A 4N4QA 3GKAA 1YBQB 3R4IA 5F2LA 4MF4A 3DBNA 3DFYA 1POKA 2IQTA 4Q7BA 4ICMA 2JGYA 3PM6A 1G7UA 4M5PA 3KRUA 4YNGA 4CD6A 1OG6A 3NZQA 2G37A 3ALFA 1MNZA 3V0TA 3I7QA 1XF0A 4ZB2A 1TE1A 3O63A 4RDZA 1MI3A 4XIAA 1YNPA 1J4EA 2NSOA 3WF2A 5IFTA 4OKDA 3I4EA 3AMCA 1N7KA 3CLMA 2XSBA 1OF6A 1RAKA 4LS1A 3WNPA 1GOKA 1VJZA 3GTIA 4BEQA 4NAEA 4JX6A 2RFGA 4PMJA 7ENLA 1XCFA 3CUJA 3HFYA 1NY1A 1E4NA 2Z1KA 5LIUX 1MEWA 4DWDA 2FVMA 3EWUA 3WX7A 3B05A 4GYPA 1KBIA 4U4MA 1IT8A 1E9IA 1EO5A 4AZCA 3N29A 2CLEA 5CGTA 4AD1A 3ZLHA 4O0QA 4XD4A 3C0SA 4M1BA 1NAL1 4IP4A 2G3IA 4F3HA 2XIJA 3UR2A 2X41A 3FHQA 1A80A 3MDUA 3GH7A 1B4KA 3OZOA 3VUPA 3N6QA 1FWDC 1VYRA 3U8GA 4O1FA 2VELA 4Z17A 2DEPA 2VRJA 4LH8A 3UYIA 3IEBA 2GVGA 2WM0A 1P5BA 1X1NA 1I8JA 2OQYA 1EX5A 3E0FA 4JY8A 3TQKA 4D9PA 4LUSB 2QUNA 1YW1A 4KH2A 9XIAA 1US2A 1J93A 2ZA3A 3C2FA 2VX7A 2Z7GA 4F2UA 1TIMA 3GS6A 2VQTA 3P62A 4DF2A 3E0WA 3I4KA 1B4EA 5D9PA 3WLKX 3TV8A 3V5FA 1EUAA 4INFA 2ZUSA 3WZ0E 4XV0A 3V1PA 5LNSA 4CNSA 5G4WA 4A4AA 1IWBA 1LLWA 1JL8A 4NNBA 4BKNA 4JTGA 5EPDA 1H7OA 3THAA 3E0LA 4UQAA 1WKDA 3WNNA 4Z2IA 3WBYA 2RKXA 1P1XA 3S83A 3BG3A 3MZNA 5HMFA 4XK2A 2XVLA 1C9DA 5A94A 3VC5A 2QDGA 1NWTA 4JTJA 4D6IA 2VEKA 4O1EA 4F9DA 3UEQA 5LIYX 2W27A 4S3FA 4M0XA 3ITTA 4O13A 2FDSA 1EWEA 4M8UA 2BGNE 3WF0A 2J66A 3CAVA 1KD0A 3IGUA 4JCLA 1TVLA 4DAFA 3QOKA 3G18A 2IKJA 2QJIA 1ZUAX 3ZQ9A 3MA8A 4XZWA 3VDAA 1JCNA 3WN6A 3TN3A 1MDRA 5IM51 3MCOA 4Y9OA 3ARYA 1N8WA 1OG0A 5IBXC 4M56A 2BOGX 1P0BA 4EOUA 3R0KA 4XKYB 1DE6A 1NFGA 2PGWA 4AZ5A 2JE8A 2PDFA 3BJSA 4MLJA 1HN1A 3DFHA 4FI4A 4PRWA 4L4OA 4HPNA 2J4GA 1YPFA 4FO4A 2DQWA 1GEQA 4GNVA 2C1HA 3OP2A 4OV9A 1EF2A 4L5ZA 3HZ3A 2RH9A 4RPPA 2C71A 3G77A 1HX0A 3QV9A 3WD4A 2RUSA 4MM1A 3MVIA 2Z29A 3TTEA 3MO4A 4W87A 1OFPA 4JR5A 2WW5A 3R8HA 1DJNA 4X63A 2E7FA 3WLNA 2ZUVA 4L6HA 4CN4A 1MQQA 4P2VA 2KZHA 4C1NB 3T8LA 4HTYA 3M0KA 3BARA 1R46A 4O19A 1C7TA 3WDPP 3LLDA 1JDEA 3WQOA 4MVAA 4NZ3A 4P7NA 5AYIA 2FPYA 3TUUA 3LMYA 3GKFA 3CS2A 4DBEA 3LM7A 5CQ1A 4LBUA 3GO2A 4DY1A 4GG9A 3OBAA 1N2VA 5HAOA 3MBDA 5AYZA 4Z1AA 3H4WA 1DXFA 3P0WA 1UWAA 4E6MA 2Y7DA 4PMVA 1QBBA 1IR2A 3VFLA 4WSHA 3QTGA 4LCSA 2E68A 2ZC8A 4IXXA 4QRNA 3N3MA 1QCWA 3Q94A 4HYRA 1B54A 3NZPA 4BS0A 1W9DM 3NM1A 4GGBA 1XR2A 4YYCA 3DCPA 3LQLA 2VX6A 3GIQA 4DZHA 4NL1A 4P5UA 4ZFCA 2C1IA 2WANA 1YADA 4NP7A 1X38A 4S3CA 3VX1A 3LRLA 3CO8A 3U2ZA 4XAGA 4F0LA 1KB3A 1UHVA 1P48A 1TPB1 3CUFA 4S3DA 4UR9A 4AAJA 4JY9A 2GQ3A 4WHBA 2ASHA 2QR6A 3QR0A 2QJNA 2PA6A 2HXUA 3ZIZA 2FHBA 4ATDA 2VFHA 2VFDA 4J3XA 1ODUA 1YPXA 1TQXA 4RE2A 4QJ3B 5JBFA 4P8XA 3W7NA 4ALDA 2DZSA 3L2IA 1QW8A 8RUCA 4AVNA 2Q71A 2J47A 3WH7A 4MNMA 4KEMA 6TIMA 1UH4A 4C90A 3DYPA 2QAFA 4XBKA 4TVDA 4E38A 5DN1A 4GJ1A 3T42A 2H90A 2E67A 3GX9A 5I79A 1S2CA 4P7RA 1FWHC 3S9ZA 2XVNA 4MTVA 4UMCA 3DFOA 3V7PA 3ABOA 4ZOBA 4E2BA 1KRBC 2Q3OA 3GAYA 4ZCWA 4IQJA 1JDAA 2Z4GA 3H2AA 1J0ZA 3GUWA 1LQAA 1KLYA 4Q6JA 1TRDA 4WK9A 4Z2LA 1R3SA 4Y96A 1JDDA 4REQB 2D0HA 5TD4A 3WG6A 3VKAA 3L4TA 5HOSA 1PYMA 1UKTA 3OLGA 4DLFA 2W92A 2AOSA 1VGAA 3STCA 3OHMB 5I5RA 4Z2JA 1L8PA 1QR7A 1TKKA 3QYQA 3DX5A 4PYSA 3ZT7A 3B8SA 3GXPA 1J96A 3GZAA 3QVQA 4RV3A 3M0IA 4BF9A 2JIWA 2DJXA 3T1GA 1BGGA 4WY0F 2XFWA 2Z1XA 3C56A 2YX0A 4MWAA 3F7JA 4I9JA 5DLCA 4IJBA 2NUXA 5CPTA 4B9YA 3VNLA 1XINA 3D5HA 2W62A 4HB7A 4FNUA 1PKNA 1QNRA 3WD0A 1ITQA 3VILA 4NXSA 4LY4A 4HZ7A 2VEMA 2DVUA 4KCWA 2BODX 3NNTA 2PU1A 4LEQA 2NX1A 5J5RA 3QGVA 1BWLA 2DT0A 2JEPA 3V35A 1RVGA 2CLPA 2E6FA 3ALGA 2JEQA 3PG8A 4CQCA 3ZJKA 4HNVA 2OLSA 1MFVA 5GQBA 3FEMA 4GVFA 1ZRQA 5BWAA 1QU4A 4JYEA 4QQ3A 3OQEA 4IXHA 4Y7EA 3W9ZA 3RIKA 3WNKA 3GD6A 1W5NA 5G2WA 4N6EA 1TPH1 2CBJA 4WLCA 3TA9A 3S5OA 2PU0A 2W4XA 4JTRA 3EXTA 2EO7A 4KWVA 3OLEA 4A8LA 2J75A 2VC5A 2CU0A 5IOBA 3OB8A 3BAIA 3QW3A 4UNLA 2WHLA 3WF3A 3S9IA 1REQA 4JNYA 1SFLA 3VGHA 3LPPA 3EDFA 4XSMA 1L8NA 4QAIA 1UR2A 4H6KA 3A4JA 2NV1A 1QVBA 3QFWA 2RAGA 3N3TA 4DWSC 1JYVA 1KNWA 4JN7A 1UD3A 1PWLA 1KXTA 2X0YA 1TWWA 3HPAA 3E2SA 2A7PA 4ACZA 4RZ5A 2OPJA 3OHIA 3DZ1A 2ZX5A 4JL1A 3AUOA 3H2MA 4MB4A 2ZWYA 1Z8AA 1ZLPA 3AHZA 3MT1A 1PX3A 2OVLA 4I3GA 1IXNA 3ZT5A 3OEXA 5AHNA 2CFFA 5L6UA 4CEUC 1VFFA 2GSHA 5HR6A 1KFEA 2FHCA 2RJGA 1WXZA 1K6AA 4HA4A 3LI1A 1C8YA 3E38A 3NQ6A 3W72A 4L9YA 1TCDA 1UKPA 2RHGA 4PSRA 1VPQA 1XIHA 3CC1A 4E4UA 2NX3A 4GCXA 1J10A 4GC4A 3F03K 3UJRA 1UP3A 3KZPA 4CQBA 3KBSA 3T4WA 2UZ9A 1A3WA 2E4TA 3NL6A 1UD5A 1F7BA 4QGCA 7REQB 3QKEA 2WQDA 2YBVA 4W85A 2WLYA 4W93A 3RCNA 4DYJA 5AYYA 4L9XA 3O7UA 3SN4A 3EA3A 3N9KA 5D8ZA 1WX0A 5D38A 1H62A 5FACA 3BW3A 2QCEA 1B3XA 1F9CA 2ZFAA 2H3DA 1RK6A 2YCKX 1KXQA 3M0HA 2J77A 3H8AA 2O9TA 4O15A 1ZPTA 4ZL1A 4KFPA 4O0KA 3WK1A 1XKYA 2R6OA 3O9NA 4O4VA 4CQ8A 1POJA 4V28A 3MSGA 4XO6A 3H24A 1HKWA 1EIXA 3WBAA 2YCLA 1NVMA 4YCPA 3MC5A 1ZAJA 5CJNA 2WAGA 3BJFA 3N6HA 4YHGA 1XLJA 4FNPA 4NVTA 3ANYA 1WKEA 4ZVJA 1H51A 3BW2A 5EY5A 1E1EA 1G0CA 3BGGA 4RXFA 4IPLA 1FQ0A 2GJXB 3MCMA 4J35A 3L4WA 4ADSA 3TOYA 2VQUA 4PSPA 4AHPA 4GO8A 2WLZA 3NEHA 1RJRA 4LV4A 3W7PA 3WD3A 3L68A 4AG0A 3C3NA 1W5PA 3EX4A 4K8HA 2PDNA 5A2AA 4DXVA 1J0JA 2QUMA 2QIWA 5FJPA 3V5OA 3H2NA 4QJ4B 4GNJA 4QS5A 4WKHA 3OZPA 1UKQA 1RZMA 3B8DA 3QY7A 1FHUA 4OVXA 3FDGA 1IHIA 2HPMA 3LX9A 3CMJA 5AN7A 5JH2A 1D2KA 2GOKA 5M17A 5D05A 3TE9A 3W53A 3G1HA 2XPKA 3A47A 1T7LA 1XIFA 1FVPA 2DDXA 2EF9A 1EZWA 2D3NA 3LV5A 3KS6A 2PP0A 4R5EA 2C7FA 2OFJA 2ON3A 2VM8A 4L56A 4X2RA 3GXNA 1TJ0A 7A3HA 2V63A 3LCXA 3W84A 4A8IA 4UTWC 3S5YA 4EPDC 4DBUA 3PAOA 4S23A 4MPQA 1GQJA 5F2GA 1KM4A 1D7FA 4W8LA 1R86A 1UR8A 3BURA 1OJXA 4GI4A 1B0IA 3WLOA 2YYTA 2XGBA 1TFVA 4GQBA 2INEA 3P14A 1GW1A 4JHZA 2BXYA 4Q4MA 1LRQA 2AL2B 2CLOA 3ELFA 1B3OA 1P43A 1QNOA 4V27A 4AQLA 5G5IA 2ZUWA 4YVPA 4FAMA 1FRBA 4G56A 2C0HA 3SM0A 2RDTA 3PBVA 4POCA 4IOTA 1O5RA 3UXKA 2PC4A 4LF2A 2CZVA 1TREA 4B2DA 2QHAA 4DJFA 2YW4A 4CD5A 3KOZA 3N2XA 1PHWA 2IXVA 3NM3A 3HG5A 3FAXA 3HF3A 2R94A 2VCBA 3GTXA 2IXUA 3ZR4A 1XI3A 2E28A 1E0UA 3F1QA 1DXIA 4WSJA 3C5QA 1AW2A 1UB3A 5HDRA 3W1PA 3CJPA 2FKPA 4WY0A 2ZX6A 5SWUA 1HKJA 3DENA 3CZJA 1S1PA 4BY3A 1JAKA 8TIMA 4HZ8A 2V8ZA 3MO7A 2PGRA 4JFSA 1H2JA 4DO5A 4IM4A 5HMDA 4LBSA 3NDOA 2WZHA 3SGGA 4EVZA 5G1MA 5K7JA 1AMKA 3W1RA 2UY3A 5AECA 1MUCA 1M41A 3DFSA 4JIQA 3WY1A 4JQAA 3RAOA 1PDYA 1LRNA 4WR3A 5HULA 3WBXA 1XL9A 2GSJA 2GVEA 4C1LA 4YTUA 3KBJA 1NQKA 2V5LA 3GK0A 4E8GA 1CB7B 1FFRA 4NI3A 4G8TA 3TZFA 5FCZA 3BLFA 1YXCA 3TK7A 1OX6A 3H2FA 3KP0A 2WZMA 3ARVA 1CXEA 3C2RA 2J62A 4KRZA 3LNMA 2V67A 2O9OA 2OSXA 3RILA 3V75A 5I77A 1UH2A 1TJ1A 4GXMA 4TX8A 4H7VA 4ERGA 4CNNA 2PPGA 1LG1A 3M4HA 4ZQRA 3NOYA 6ALDA 1FWWA 4KS0A 1BRLB 3GE7A 1SZGA 2VEFA 1XYBA 4MB1A 1CX9A 3TH6A 1JQXA 5GNZA 1ZP3A 3EWCA 3TSMA 1E0VA 1GG0A 1LOLA 1V6WA 4GUFA 2YL9A 3TYZA 1E9ZB 1YLVA 1ZL1A 3AZRA 3WQGA 3PWIA 3OBEA 4M7SA 3VDGA 2BMBA 4ATWA 3G6MA 1KM2A 4M19A 1XH2A 3QQ1A 3WLQA 5D09A 4MZ1A 3EB2A 5XINA 1EPXA 3PFMA 3OJGA 3U5YA 1VBGA 1HVQA 2AL1A 3SQLA 4AFYA 3EBVA 1RBLA 2WCGA 3BAYA 3QQWA 1UWUA 3AIRA 4ZOAA 1TR1A 4DO6A 3KL5A 1OGBA 3GNOA 4KRUA 2WSPA 4MG4A 5ABGA 4HCHA 2VD8A 1E43A 4WKFA 1DQWA 1QPRA 1G6CA 3C4UA 3MUCA 2VR4A 3JW7A 4PB4A 1JNDA 3FJLA 3I10A 5EA9A 2C3ZA 1XIIA 1A3HA 1W3HA 3PWAA 3T07A 3TIMA 3TN5A 1LROA 1WAWA 1F6KA 3K8MA 3BAKA 1R3WA 4Z0JA 1UZ4A 3DBPA 2ATMA 1OY0A 3PB0A 3U4FA 4F0KA 4GWEA 3W2LA 1YMYA 4M82A 3RR1A 1JZ8A 3CEUA 4G1NA 3SO7A 1JXJA 1J0KA 3TKFA 2J24A 2XIQA 1CDGA 1R3YA 1KRMA 3C8NA 4N9CA 2CBVA 2YBTA 3F4DA 1B31A 4LCQA 1NIUA 4O1BA 1ZY9A 3C61A 1GYNA 1ZGDA 4MYXA 2FMNA 4QDPA 1AQFA 3IIZA 3I68A 2DZXA 4B5SA 2WMIA 3WK0A 3WEOA 2ZZ1A 5A6BA 3GYEA 1VFLA 1VBJA 3FXYA 4OBRA 1XG3A 4UXDA 2R1KA 5BWFA 3S3GA 1DVJA 3EEZA 3BQ5A 3W75A 4A3QA 1VHNA 2PC8A 5EU9A 4KGJA 2VCAA 3QLDA 2Y6ZA 1EL3A 1S5MA 4OBTA 3WEZA 1BVZA 3CL7A 4KMQA 3SRKA 1C90A 4DWSD 2OG9A 3PK7A 4J3WA 1ALDA 1AZ2A 3T81A 2JK2A 1TWSA 4PMXA 3DI1A 2VGIA 1XDLA 1ZCOA 1ECQA 4RE3A 5JU6A 3LCIA 4UFJA 1A4LA 3SCPA 1SJCA 3TC7A 3WH8A 1NELA 4HU3A 1CW2A 2GPTA 2G4JA 3QH2A 4IIBA 2EBNA 2ZX9A 4PEEA 2XUCA 1Z7AA 4XAFA 3UJ2A 3NR0A 4LUYA 1DWJM 2A85A 1CXHA 1QI3A 3CM4A 4GY7A 2J7BA 1L6GA 3UCCA 2V5CA 3MSRA 1J18A 2X30A 1XM3A 5HMEA 3BW4A 1B9BA 5JQ9A 4RNJA 1KFBA 1UJPA 4RNHA 3KHDA 5FSEC 1XUZA 2VL4A 3UD6A 1I2NA 3SRDA 4UR7A 4AWTA 1O5QA 3D46A 1L2UA 4Q4SA 4AX7A 1WQ5A 3CH9A 2J7EA 4M7TA 1DBTA 3PS7A 1XFBA 4QX4A 4A35A 4MUZA 3MUY1 3LOTA 4G9PA 3AIUA 3LXBA 1F4AA 1UYQA 4XAZA 3GG8A 4W8BA 1ZZMA 1JZ2A 1EHAA 3RM4A 1LLZA 5AZ0A 4DN1A 5CZ0A 3R0UA 3ITXA 4LWWA 4M3PA 3AIVA 5EMYA 4JTUA 3CIVA 4E3VA 4UTLA 4JFUA 2QDDA 2CZ5A 3RF9A 3AZSA 5F1VA