5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphate aldolase
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Lyase
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
1SO5A 3BV4A 3HOJA 4Z08A 1SSGA 4FX6M 3Q58A 5K4XA 1TYGA 4AEOA 2Y89A 3Q2DA 3LCIA 5LGZA 1CX9A 3UWQA 3NQCA 3BG9A 2PRMA 1DKWA 2JK2A 2YYUA 2OX1A 3CLMA 1H7WA 4LV4A 1R2RA 1LOQA 5I3KA 2I1OA 4GUJA 3B05A 3DGRA 4FEZA 4MYXA 4PC8A 5AHNA 3A21A 4TMCA 4X2RA 3W7LA 5D09A 5F2GA 1S3HA 5IBXA 1KTNA 3HPXA 4O8RA 5LNWA 2NUWA 5HJLA 5U4NA 4J9JA 3ZWSA 2NV2A 3INPA 4IQLA 5BW6A 1DL3A 1Q6LA 1YTKA 4N9EA 2DZWA 3THQA 4AHPA 4IMEA 2WNNA 3N9SA 4XTIA 5G2HA 4WZHA 3SW6A 4NX5A 1I4NA 3W7PA 3P5YA 1GYLA 5DN1A 4UCGA 5CKSA 1T0OA 3W6YA 5HUPA 1ME7A 1H7XA 1HO1A 2GVJA 3BW3A 2DZXA 1F5ZA 3EX3A 3PM6A 1JJKA 2V9DA 1P1XA 3C52A 1MSSA 2Z6IA 3IGUA 3USBA 3VI2A 2NXHA 5F1VA 1KBJA 3S1XA 4BWLA 4UFMA 2O7SA 3LCLA 5D2VA 2CWNA 1H7OA 4ZVJA 3WJWA 2FLIA 1YDOA 1YTEA 1OF6A 3NZ1A 4K38A 5HR7A 1Y0EA 1L2UA 1OFEA 2WSYA 2QAPA 4HPJA 1DBTA 1VRDA 2Y7GA 4JTFA 1KM6A 2DU2A 1NF0A 3MHFA 2J24A 1YXDA 2CW6A 3CWNA 2VFIA 1YLVA 3GDTA 3I65A 1QR7A 2CFFA 5A8GA 2A7NA 2NXIA 1DJQA 4QNWA 1WXJA 3WK1A 3EXRA 4UTUA 1GVFA 3VFLA 4MZ1A 1EP1A 1K8ZA 4YL2A 5D33A 3RK8A 2OMAA 1FQ0A 5L6UA 2YGYA 2G96A 1O60A 2OZ0A 3TW7A 3NNTA 4DO4A 4LUJA 1ICSA 2CLKA 3O1NA 4RCXA 1BKSA 4NNCA 4QISA 4A3UA 3JRKA 3TQ0A 4UTWA 3FYPA 3NYZA 1N8FA 1XM3A 3VKJA 5J5DA 1G6CA 3L5LA 2X1TA 4BI5A 1X8FA 2DZTA 1KM1A 4LU0A 1QCWA 2CLMA 4NT0A 3GR8A 2B7PA 3NPUA 4K7YA 3DZ1A 5EL1A 3TKFA 4MZYA 1TRIA 3CPRA 1LOSA 4JIPA 1SR9A 3C3NA 5LNRA 4NJGA 1WA3A 4CCEA 1IIGA 1TPWA 3P67A 3FIGA 4PL1A 1QOPA 1GWJA 1M7PA 3T55A 2ZZ4A 5LNVA 4R34A 5LSMA 4NQ1A 4CQAA 1Q6RA 1VPXA 1TPB1 3P8JA 1G7UA 1ICPA 2V2DA 1TJPA 5TIMA 1FCVA 5E0KA 4M5PA 1D3GA 3W72A 3LBMA 3FJLA 3OHIA 1VCGA 2B0MA 2A21A 2E5DA 3TSBA 2YZRA 3LTYA 1LRQA 4JR5A 3IGXA 4NVTA 1DJNA 1KM5A 1TB3A 1JCXA 1WV2A 5BMXA 3ABOA 4O1AA 3UWWA 3M47A 3PB0A 3LBCA 3NR0A 3NPVA 2NLIA 3ATYA 3DXIA 3W7GA 3W1AA 2VOMA 5U7SA 4AWUA 1VZWA 1W1ZA 3V75A 3C0JA 1UUMA 4LOCA 4MLRA 3W2UA 2FJKA 2RDUA 4LNYA 2VELA 3STEA 1O94A 2E6AA 2E09A 2ZA3A 3NL3A 1Q6QA 2ZTJA 3W2JA 1SZGA 2VFGA 3OVQA 1OFPA 3W1RA 2HS8A 5DCEA 3W1LA 4YMZA 2G95A 1OFAA 1OK4A 4HN4A 3LOTA 3RNDA 4Y6GA 3PUDA 2ABBA 3NPXA 2QCDA 3W70A 3DFOA 4FXSA 4MKNA 3TSMA 3H53A 1EX5A 4O4VA 5HULA 4K6AA 4XKYA 5K4ZA 1PIIA 1K02A 3EKLA 3NZRA 3CB8A 4MUZA 1F2JA 1XL9A 1PVNA 2FIQA 1EEPA 3HF3A 3S5YA 1X6UA 1TV8A 3C2RA 5D2TA 3IIPA 4DF1A 4AF0A 1OFBA 3B4UA 4O50A 3QW4B 3M5XA 4O13A 1EWEA 3HPZA 1AW2A 4IMFA 1WBJA 4K37A 1W5QA 5AYZA 3QRHA 2CZ5A 3N9RA 4GWEA 4N6EA 2GJNA 3PBWA 1KM2A 2A6NA 2JKPA 1VC4A 3C6CA 4UMAA 4BR1A 2YR1A 4ADTA 3G1SA 1T99A 3OG3A 4FX8A 2QCFA 3N3MA 3P74A 3DI1A 3I7RA 3W88A 4RJEA 3P80A 3TA6A 1YXCA 3VNDA 2Q3RA 1XDLA 3GDKA 3KXQA 4O14A 3B03A 4A29A 4EIVA 1DORA 4AVFA 3MJYA 4LC6A 1TPDA 2DZPA 4HSOA 4E38A 1UBSA 5KZEA 3D0CA 2YX0A 4GXMA 3KVJA 3NQ2A 4GUGA 1I8JA 1KTBA 3GR7A 3SGZA 1IF2A 2J9XA 3L66A 2YPIA 1WAUA 4NNAA 3W7CA 5LKYA 5CZTA 2VENA 3S8HA 1BTMA 1SW0A 2C16A 5TBOA 2R94A 4HPXA 1F76A 2NUYA 4Z0JA 3G1DA 1ZENA 1ALDA 3OBKA 3GIYA 4LRTA 1I45A 5F4WA 1VHNA 4UR8A 3A5VA 1JQVA 3W1XA 3QM3A 1RPXA 3QMTA 4ORMA 4MYAA 4IWWA 3F4WA 3W7QA 1L6WA 3THAA 5I3FA 1HG3A 3TJLA 1VYPX 4HNVA 4AWSA 3HG3A 4OWGA 3MYOA 1HTIA 2NXGA 3E49A 2XFWA 3P81A 4N4PA 4RZ4A 5K9DA 3TU9A 2A7PA 3VE9A 3PS7A 1H1ZA 1CW2A 4N4QA 4E2DA 4NJJA 3G22A 3G1YA 3KX6A 3P60A 3WJZA 3QMRA 3SJ3A 5K2ZA 3M1ZA 1LBFA 1OX6A 1Z48A 4O1CA 1XKYA 3ZS4A 4UMCA 4GJ1A 2FQIA 2V2CA 2P0OA 4FXRA 3MWAA 4DQWA 4IXXA 1KV5A 4CNPA 4LVFA 3W7JA 3LHTA 1EA0A 3ZWTA 2RFGA 3C4UA 4C1KA 4LVAA 4JTUA 3HG2A 2D73A 4TR9A 3VE7A 4EWND 1TMHA 1Z41A 2ZA2A 4MFEA 5AB3A 2CU0A 4QSHA 4DPPA 3KAOA 3TSDA 3GVGA 2QDGA 5FEPA 3SIZA 1MXSA 2VEMA 1JUBA 4FB7A 1PS9A 4ZZ9A 3QZEA 3DH7A 4IJBA 3UD6A 1C29A 4JTGA 3A22A 2C13A 1G7VA 2VFEA 1P0KA 3N2XA 1XC4A 2HTMA 4B5NA 1ME9A 3S42A 3EKZA 3GDRA 3BO9A 1GTEA 2FPVA 4TO8A 3HBLA 3TW6A 1KM0A 3S5NA 1LBLA 5BNKA 2EF9A 4GNJA 4LY8A 3TQKA 1SW7A 2FPTA 2QJIA 4JS3A 2QCMA 1SZNA 1M7OA 2Z1BA 3V1PA 4UTLA 3W86A 3IVUA 1KLZA 1XUZA 1L6YA 3W2LA 2C19A 2QKFA 3L5MA 4JX4A 1KW1A 4Y8FA 5EY5A 3W1QA 1ZJIA 4O28A 3HJZA 1IGSA 4M6VA 4XWUA 2VC6A 1FDZA 2ISVA 3G3DA 1TV5A 4UFKA 2GVGA 2EAWA 2AAMA 3TC7A 4O0KA 3B0VC 4NXSA 3CEPA 3M5ZA 3CHVA 4EOUA 4BK9A 3NDOA 1FWRA 4WOQA 4Y96A 3M5YA 5CZJA 3P7YA 3DI0A 5J5RA 3QYQA 3DENA 3W3OA 4O4WA 1I2PA 1W3TA 2YXGA 3W73A 1TPH1 3NL2A 1AW5A 3W7EA 1SZEA 3BGJA 3ANYA 1FCQA 1OFDA 2WKJA 5ABTA 1QPQA 4XTDA 5DCBA 3CIWA 3VCRA 1P4CA 4LTSA 4S1FA 1SSDA 4MZ8A 1U83A 1I2OA 3C61A 3L65A 5CSSA 1GQNA 2H90A 3T40A 2W0UA 3KOFA 1WOAA 2FTPA 3GXTA 2I9EA 4UXDA 4FNQA 3KHJA 3UWVA 3QH2A 1YTDA 3MYPA 3P8IA 3CT7A 4S2CA 2QCDB 5EA9A 2DZVA 2J9YA 3W1TA 1GVOA 5C54A 5D2XA 4IUOA 3SY5A 5C5YA 3MP3A 3L9CA 4GC4A 4YCPA 4ZQNA 3UWYA 3PAJA 3EWWA 3HB9A 2Q8LA 2CZEA 1TV7A 4O0ZA 1FX6A 3R5EA 4L4LA 2CLOA 2YFNA 3TXZA 4OV4A 5KMYA 4UTMA 2QCLA 4KFNA 1W54A 4RX0A 1S5TA 3TC6A 1WOBA 4PEKA 3FYOA 3C2EA 2WO5A 1EWDA 3W2KA 5DY3A 1K7EA 1T96A 3LLFA 5D30A 3LV6A 3M41A 2QCGA 4JDYA 3O16A 4WY0A 3S1VA 1K03A 1VCFA 2VEIA 4EF9A 3DHFA 4LVGA 1KFEA 3IIZA 3BLFA 3QF0A 3M7WA 4IPJA 5TQLA 5F4SA 1ONRA 3T44A 2FDSA 1X1ZA 2X16A 1KBIA 5D38A 1W3IA 2BXVA 5C6MA 4K8HA 3CQ0A 5DLCA 4UTHA 2QR6A 4UMBA 2ATMA 2XN2A 4ADSA 1A53A 1H7RA 3NGJA 3MHGA 2G5WA 3HO8A 2C1HA 3LRKA 3EWUA 2A2IA 3PWAA 4FIQA 4KWWA 1W5MA 4CCDA 5DELA 1PCWA 3OVPA 3PBUA 3B0PA 2C6QA 1H1YA 4ZQMA 3LI1A 1WQ5A 3ABQA 5E93A 1YPFA 3G18A 1JCNA 3NM3A 2WOQA 4POCA 4P61A 2V5BA 3IVTA 3R2GA 2B4GA 1TPVA 3DFTA 1OG0A 3PVFA 3QPYA 4OU1A 3TMQA 5D2WA 1OABA 5LHFA 1VQTA 2ATSA 2OT1A 1OK6A 3WFAA 4ML9A 1JVNA 1YDNA 3LDVA 4O57A 1JRCA 2NUXA 3W2NA 4DXVA 3P5ZA 3P62A 3GZ3A 1WDWA 3E96A 2ZYFA 3SR7A 5AFDA 1JCLA 4MJMA 2C0AA 3PY2A 3S1WA 5DY2A 1P5BA 3GKAA 2Y61A 1GEQA 4IPIA 3E02A 4GFSA 4UFHA 4HNTA 1R47A 1ZAIA 4JTHA 1MZHA 4OE7A 4RLIA 4N02A 4DF2A 4QITA 4FNTA 1DQXA 3F1QA 4NZFA 2PCQA 3KRSA 3IVSA 1GTHA 3EX6A 1JUKA 4FNUA 4NZJA 2NV1A 3IIXA 3SZ8A 3NQ7A 2RDWA 1FCUA 3W9ZA 3G8RA 2TMDA 3B06A 3NG3A 1H63A 4RZ5A 2BWGA 3FA5A 4M19A 1NAL1 1QO2A 1NSJA 3BARA 3K30A 4JTEA 3UWZA 4R53A 4CQ8A 3NQVA 3KVLA 2NWSA 4YLWA 2ABAA 3M6YA 3TDFA 3UPBA 3LXAA 3W74A 3NPWA 2ZFAA 1QNVA 4XBKA 5D37A 1F05A 2Y7EA 5MHBA 4JTKA 1TPFA 1MEHA 3RF9A 5I3GA 5G4WA 4MJZA 3UNDA 2G97A 3M0ZA 4FF7A 3NQ8A 4JY9A 4AWTA 2Q8ZA 3N2MA 3GX9A 3LHYA 3N19B 1K8YA 3DFNA 3TX9A 3EXSA 1FBAA 4RKAA 1TPC1 5CG7A 4JTIA 5A5WA 2W6RA 3P84A 1ZY9A 2V8ZA 1RQBA 3R89A 2V5LA 3M43A 4LUIA 3E12A 1UJPA 4UNKA 3W23A 2H8ZA 5K9CA 1TQJA 3W85A 3UXAA 3I7SA 2I14A 4UNLA 1KV8A 1NF7A 2VFFA 1K8XA 1KLYA 3TIMA 4AB4A 1AL8A 1ICQA 5AHEA 1B4EA 4PCFA 1DOSA 4MY8A 1NEYA 3TMLA 3G24A 4JX5A 3LHZA 3MI6A 1H7NA 1PL9A 5AYYA 3T78A 1JCJA 5K7JA 2WNZA 5E1QA 3MO7A 1H60A 3M16A 2DZSA 2BLEA 3TAOA 3KVKA 2CLFA 4CNOA 5AYXA 2J9ZA 2YDAA 3GLCA 2BX7A 4E2BA 1TQXA 4ZMGA 1AMKA 5AC7A 4ZQCA 1OYAA 5EYWA 3E0IA 4JN6A 3TFCA 2KZHA 4WXZA 5FEXA 3IRDA 3W83A 2Y7DA 2C18A 1OYBA 2Y63A 4Q33A 3DFSA 1CI1A 1V5XA 2E6DA 4QIUA 5AHMA 2C14A 3LRMA 2ZRZA 3LB0A 1SW3A 3W7RA 3TQVA 4PODA 4XZ9A 1PV8A 3JR2A 3MHUA 4WX2A 3SGUA 3G0SA 5D32A 4Z1BA 4R7JA 2QUUA 2HSAA 2BZNA 4TX9A 3A24A 1ADOA 3BW2A 1XBXA 5AOUA 1TCDA 2JGQA 5AC8A 5LNUA 3EWYA 1NVMA 5BMWA 4LVDA 1VYSX 5D03A 4JICA 2EKCA 3G0XA 2ISWA 2R8WA 1ML1A 3O6YX 1UCWA 2QUTA 1VJIA 2DJLA 1KA9F 2EPHA 3PF3A 2GVLA 2VEPA 3MUXA 1XCFA 3TH6A 2A0NA 3W7OA 2E68A 3GB6A 3LLDA 5FF2A 2AQWA 3M5VA 3TFXA 3G3MA 5CGQA 3TV8A 4DBEA 1TO3A 1G4PA 1AG1O 3NOEA 1PHWA 1J4EA 3GXPA 4UTJA 4LC8A 3BGGA 4YWIA 4PL2A 1G4TA 4ZL1A 3PSVA 2PRLA 4JTTA 5DBTA 4A2SA 4WXYA 2P10A 3HQ1A 1GOXA 3G8EA 1JCMP 1ZAHA 1C8VA 4OQVA 5FEWA 4KKXA 3AJXA 3G1HA 1OVDA 4ONVA 1R46A 4O52A 2CZDA 2CLHA 4H3DA 5C2XA 2OT0A 4LV9A 4P2VA 1FXPA 4DEFA 3BLEA 1YDVA 2ZZ3A 4CQ9A 5I3HA 1GVSA 3W7DA 1FWTA 4E0CA 1EP2A 1ZCOA 2GQ8A 2QCHA 1FCBA 3IGSA 1IXQA 5LZLA 4ZQPA 1IIHA 2ZBTA 1F7BA 4LVBA 3NQMA 1J2WA 4I7WA 2E6FA 2TPSA 3DKJA 5FEZA 4CCCA 1VLIA 2XN0A 2X1RA 3GNNA 5FF3A 4IGHA 2TYSA 3GAKA 3IIOA 3HGJA 3DBPA 3R13A 3OEXA 2ZRXA 3UZJA 2P1FA 1GJPA 5KSWA 5F2MA 1YXYA 3UXDA 2X2GA 4FNRA 4O18A 3JS3A 4HNUA 4IMCA 4O19A 4A2RA 3QFEA 4OBTA 2WNQA 3I6RA 1QPRA 3U2OA 1SO4A 2H6RA 1A5SA 3PG8A 1TPUA 1H62A 1H61A 5G1YA 2QCCA 5KINA 1X1OA 2V30A 4NJIA 1LRNA 1ME8A 4QM1A 4H6KA 3W22A 3NL5A 5HUOA 4GRSA 1KFKA 4RK8A 4WOZA 3OVRA 1EP3A 5C55A 3W1MA 5KZMA 4JDBA 3MP5A 3WK0A 3KVMA 1JQXA 3CIXA 3S5OA 4QAIA 4LS2A 1SFLA 3MBFA 1SU5A 4GE8A 1LYXA 4PA8A 3FJ6A 3EWXA 1R30A 3QSRA 2GOUA 3A23A 2ZZ7A 2Y6ZA 1W3NA 2ZTKA 1MEIA 3NAVA 4X3ZA 3BPWA 2E6YA 4O16A 2RDTA 3LXBA 4K39A 4JYFA 1JR1A 3LERA 4TMBA 3LM7A 3HGOA 3TJXA 5AHLA 4IX2A 1XBZA 2FFCA 3PUOA 1VCVA 2FB2A 1SZFA 1LBMA 2F7FA 2Y70A 4N9DA 4JXCA 3S1UA 1VR6A 1B4KA 3L21A 4FIRA 4FNPA 3UQNA 5LNSA 1GVRA 2TSYA 3W07A 2QCEA 1OX4A 3QSTA 3NQFA 2QJHA 1LOLA 3MBDA 4IMDA 4A22A 4XBSA 5SWUA 3QW3A 3G1XA 2ZRWA 4UIOA 5D02A 1GG1A 3O63A 4UTKA 2E5CA 3L68A 2QF7A 3LRLA 3QPZA 4MVAA 5HWMA 4DO6A 3O6DA 1FWNA 3GYEA 5LHEA 4O15A 2VFHA 1KM3A 3C56A 4M6QA 3PG9A 1BEUA 1H50A 4BI7A 1AL7A 3UY8A 4CNNA 3PB2A 4D2JA 2A85A 2QDHA 4OGZA 1Q3NA 5F1UA 3LHVA 1G69A 2UV8G 5F4XA 3QC3A 2RH9A 2WPBA 3DU0A 1TJRA 5AN7A 4OT7A 4HIBA 1S5VA 4XQ6A 1A5AA 2YCEA 4GUHA 2B7OA 4HKPA 4C1LA 3W87A 2JBMA 3GAYA 4L4MA 1N55A 1AW1A 4OHQA 2ZZ1A 3I7QA 4Y90A 3ZFHA 2Z2UA 4M7TA 1KFLA 5CSRA 4JGDA 5HQEA 3W7KA 1DHPA 3EWZA 3IIVA 4XKYB 3DKLA 1IXOA 4ICNA 3M9YA 1BWKA 2E1DA 2WQPA 3DFQA 2GQAA 1H5YA 3W84A 2QEZA 1DV7A 5KZDA 3TNOA 4DBDA 4O1DA 3P61A 1P0NA 3SFKA 4K8EA 5EMUA 4LWWA 1I2NA 5KTLA 4IOTA 4AF0B 1W0MA 1QPOA 2V0TA 5L9FA 2TRSA 1F6PA 3EX2A 4LRSA 4ZQRA 4JTLA 1KFBA 3TROA 2VKZG 2PRHA 3TE9A 1O4UA 4PTNA 1KFCA 4QJ1A 6TIMA 4K36A 2X1SA 4HHPA 2PE4A 5KITA 4KFOA 5LGXA 4GUFA 4UTTC 3EEGA 3STFA 4RV8A 3BG3A 2BTMA 1TTIA 2A7RA 2GQ9A 5G4EA 1H51A 3WK3A 4LT9A 4Z0SA 4WY0F 3PBVA 3G1VA 1A50A 3O06A 3LV5A 3CEUA 3S0CA 1K7FA 2R14A 2ALDA 2E5BA 5FF4A 2Z0IA 3NEVA 2JKAA 3L0GA 2ZRUA 1N7KA 3CC1A 4O10A 1QFEA 3LHUA 3NA8A 1MEWA 5CZ0A 3CWOX 3LX9A 2J88A 3NQDA 4G1KA 3MW7A 3STCA 3DHDA 4NU7A 3SI9A 4KWVA 1HFBA 1ZHAA 4U28A 1O5KA 4FO4A 1VYRA 1XBYA 2RHGA 1GG0A 1IXPA 3RU6A 1O95A 3T4CA 3AO0A 1NFBA 1B57A 3IEBA 4JTSA 5FI8A 3LGEA 3ATZA 4U4MA 2PC4A 6ALDA 3MI2A 1J5TA 3EB2A 4M7SA 4JY8A 1D3HA 1EPXA 1F6KA 3EWBX 4JYDA 3Q94A 1B9BA 3G1AA 1VHCA 2YSWA 3FKKA 4O12A 3MMTA 2GPTA 4X9SA 4IMGA 3MP4A 1OHLA 3HGSA 1LLWA 3S5ZA 2AGKA 5BOOA 1LTDA 4Z1CA 4XUGA 3PR2A 1UUOA 3LCXA 2Y62A 1C9DA 3KFTA 5DXYA 2HS6A 2DZUA 4UFIA 1TRDA 3W1UA 2E77A 1LM1A 2C15A 3W75A 4HNNA 5I3JA 3RMJA 1FY6A 3BLIA 4ZQOA 1ZNNA 1T8XA 2Y88A 5F2IA 3H54A 1OF8A 4IXHA 5K9XA 1R2TA 4O1BA 3A5FA 2ZA1A 4Z1DA 4BI6A 2FB3A 2PURA 1XUUA 3UY7A 3S9YA 1SO6A 4NJHA 1B3OA 2WJZA 3H55A 3LI0A 3QQ1A 3C2FA 2JGYA 3EX4A 3G0UA 1A5BA 2B7NA 2B7QA 4AMAA 4A21A 1FWSA 3W7HA 2YW4A 3FKRA 1LLZA 2Q3OA 2VXNA 5FF7A 4Z1AA 5EKYA 2R91A 3O07A 1GZGA 4ALDA 2NWRA 1RQHA 1TTPA 2CZFA 2J6XA 2F84A 5T26A 1JRBA 2H8XA 5HMSA 3PULA 1W56A 5G2IA 3RFAA 2OCZA 3FOKA 4I7VA 4AAJA 2ZRYA 3U8GA 1FUYA 2A4AA 4CLMA 2Y85A 5GVJA 4BF9A 1Q6OA 4EF8A 3ABRA 3O6CA 5DXXA 3L0NA 1TTJA 4M6PA 3N14A 4NX0A 3IV3A 1QMLA 1QPNA 4JTJA 3N73A 3NQAA 3RLUA 3GKFA 4WJEA 2H3DA 3LCGA 3NXFA 3C2OA 3L67A 2A5HA 1D9EA 1OX5A 4GBUA 1F74A 2CLLA 5CPNA 5IM51 1MO0A 1HL2A 5HWJA 4AHQA 4S2BA 4Q32A 1LP6A 5H2ZA 4UC5A 1JCYA 4N9CA 2CLIA 4RXFA 3W1NA 2ISSA 4ADUA 1DVJA 2V82A 2ZCGA 1OX4B 1Z44A 1BWLA 2A6LA 2ZQ0A 1R2SA 3W76A 4O17A 2OJPA 2V81A 5D2YA 3MI3A 4I7UA 1SUXA 1QOQA 3WJSA 3SECA 3UWUA 5AHFA 1OFOA 4LW7A 1YADA 3LTPA 3QJAA 4KFPA 1YPIA 4FHAA 2JKEA 4RZ6A 2W79A 4YXGA 1TIMA 3HPSA 3NM1A 1K7XA 1EUNA 3E9AA 1OFQA 2J27A 4JD4A 3S6DA 4IX0A 4TU1A 1RD5A 3BW4A 2YW3A 4OV9A 4JEQA 3PBYA 1ZALA 2HMCA 3YPIA 1F73A 1OYCA 1I2RA 3TR2A 2NX1A 3OA3A 1PE1A 4QNEA 5IBXC 5FF0A 4MPQA 1RZMA 3L5AA 5CPLA 4HSNA 4MLJA 4O54A 1ZAJA 3GK0A 5H91A 2VFDA 4QQ3A 1LDCA 2EHHA 5I3IA 1QAPA 3WJYA 1JUEA 4O11A 3FEMA 1Z42A 3FLUA 1RV8A 5EBUA 5G5IA 3UZ5A 4BFAA 2YFOA 3M44A 3PSWA 1UB3A 4MIMA 4PH6A 1THFD 4GUIA 3NL6A 1H7PA 1JULA 3B8DA 3T7VA 5AC6A 2QCNA 1U5JA 1M6JA 2YYTA 3B0UX 3LHWA 4HT3A 2XN1A 1W5PA 4UTTA 2WV8A 4NNBA 4WY0B 2ZZ6A 3F4NA 3ELFA 4BWLC 1WYIA 1XXXA 2NX9A 3W71A 3QMSA 3UPWA 3OIXA 2WSRA 3A9IA 1RQEA 1M5WA 4UTIA 3R8RA 1TSIA 3UYCA 1LCOA 4Q4KA 1FWWA 1FXQA 2QAFA 2NX3A 4RXGA 4H4IA 3C2VA 1VS1A 1RR2A 3NVTA 4N2YA 3W2MA 1UASA 3FS2A 3HIJA 3WJXA 2X30A 5D05A 5DCDA 4FX7A 5G1TA 3LCFA 2LLEA 1Q45A 2RKXA 2QJGA 1KFJA 1LROA 4MY1A 4DF0A 3R12A 3BK0A 4AXKA 1SO3A 1TREA 4MFDA 3DFPA 4TIMA 3TK7A 2DJXA 3W7NA 2FPYA 1X7FA 3Q37A 1AK5A 4YCOA 2O7QA 2Z6JA 3U6WA 4Y9AA 3WK2A 1WX0A 5CPMA 3B04A 3GXNA 1G4SA 3GDLA 3LCHA 5FESA 3TXVA 4K7VA 3NQGA 4FNSA 3EX1A 3HG5A 4DELA 3GDMA 1WBHA 4UR7A 1TPEA 1GYNA 2DP3A 4UTWC 1XI3A 1QWGA 2BSLA 4R33A 1EB3A 1ZFJA 1PHQA 2ZRVA 5AHIA 4X22A 4N6FA 1VLWA 4NJKA 5HR6A 1OJXA 1EUAA 4WQ6A 4JNMA 3KRUA 5K3VA 1IXNA 3ZR4A 2ZZ2A 1LZOA 3RLVA 4WD0A 4JX6A 4LS1A 3TAKA 2NZLA 1GVQA 3P82A 1W8SA 3G1FA 1S5WA 2IQTA 1KM4A 3HGRA 4MOZA 1XDMA 3TUUA 3LTSA 1A5CA 3W7IA 1K3UA 4UFLA 3CTLA 3F03K 4PFMA 1RVGA 3DAQA 3O8AA 1V7YA 1OFRA 2CLEA 1W37A 4JYEA 3L2IA 3EXTA 5DBUA 3I68A 7TIMA 1FDJA 3CM4A 1O5XA 3NQ6A 1HO4A 1G4EA 4JIQA 5G2WA 1G67A 3ABSA 3PUEA 5CPOA 1QDSA 1VH7A 3SSJA 1LRTA 1L9WA 1I2QA 2QUVA 2X1UA 3NQEA 3TCEA 2EGZA 3GNDA 3C8FA 1EIXA 2ZDRA 1HUVA 1LORA 1W31A 4NUWA 4LS0A 4WUIA 5EPDA 1L6SA 1W5OA 4UUIA 3BVJA 3O05A 2GUUA 2A1YA 2V2HA 4NXKA 4MY9A 4W9TA 3HG4A 1DQWA 3LXCA 3O15A 2DORA 4UFJA 1KTCA 1XBVA 4AHOA 3HMJG 1GPWA 4DPQA 1GT8A 5HINA 1YYAA 1XFBA 1QO5A 1E51A 2VEKA 4EVZA 1TTQA 1FDYA 1SQ7A 4N9BA 3FFSA 5BRBA 3CU2A 3QEZA 2Y7FA 2GJLA 3W7MA 3LCWA 2ZZ5A 3KRZA 3PC0A 1PCKA 2C3ZA 3QQ0A 4DO5A 3NO5A 1SPQA 4RR4A 1SFJA 3STGA 1W5NA 4I9AA 2H3BA 4O53A 5F2LA 3BG5A 4ORIA 4AH7A 8TIMA 5HNRA 3W1PA 1VGAA 5CZSA 5D04C 2WSQA 3L0KA 5HWNA 3N34A
chains in the Genus database with same CATH superfamily
2A3EA 3BV4A 3OLDA 1R9XA 4J28A 4PMXA 3Q2DA 1CT5A 3RIKA 2WAGA 2VZOA 2VZSA 3UWQA 3BGAA 4CKQA 4PMZA 3WNMA 1NDZA 3V1HA 3TCSA 2JK2A 4S3KA 2OX1A 1UR0A 5T91A 3VOIA 4LV4A 4FA3A 3WDRA 2DY3A 5I3KA 1VRXA 2DH2A 1CGYA 3B05A 4MYXA 2PP3A 3WLJA 4PC8A 4G2DA 3SCOA 3W7LA 2J7CA 2FJUB 4EKJA 5F2GA 2E25A 2XVPA 3L2MA 3WUBA 1KTNA 2GYIA 1OD8A 4JN8A 2NUWA 5U4NA 2ASHA 2NV2A 4IQLA 1BRLB 2ACRA 1YTKA 5EFFA 4LJ3A 1OGSA 3THQA 4AHPA 1UHVA 1E56A 4AX6A 1I9CB 5DRIA 3N9SA 4WSKA 3V18A 1A5LC 5DN1A 1S3TC 5CKSA 4PE8A 4BZYA 1E55A 2HROA 2POZA 1L2QA 1JPHA 2XM1A 1HO1A 3HPAA 3ZZ1A 3BW3A 2DZXA 3EX3A 3UA3A 3PM6A 2ZADA 1ZU8A 5CGMA 1JJKA 4S23A 1P1XA 3CYJA 1MSSA 2Z6IA 3VI2A 2NXHA 1KBJA 2QJNA 2AGTA 2RDXA 3OYZA 4UFMA 1BSIA 1P7TA 3AOFA 5D2VA 2VUNA 1YTEA 4B5SA 4C90A 4K38A 3QZAA 1BTCA 1OFEA 1L6FA 4ICCX 2QAPA 2HQAA 3CHDA 3ZMRA 4Q7NA 1YXDA 1E5JA 1WKEA 5A6BD 2CFFA 1DJQA 4QNWA 3WK1A 4P7RA 2BHZA 2YCIX 1ZGDA 4MZ1A 3OQEA 4G5DA 4YL2A 2OEKA 1UUQA 4H9UA 4XZIA 4XISA 4GY0A 4XIMA 2W63A 2G96A 2CBIA 1O60A 3NNTA 1UC5A 3LA4A 4DO4A 4LUJA 3QOKA 4QISA 4HJWA 3TTOA 3VKJA 3T0CA 1DWGM 3UXLA 1E40A 2Z2AA 3EA3A 2VR2A 2IQ0A 3OHMB 2W92A 1SR9A 4C5YA 3IUDA 2VD9A 1WA3A 4CCEA 3CV6A 4QX4A 4YN5A 1M7PA 3H23A 2F8QA 3T55A 3SRHA 2ZZ4A 1NELA 2W62A 5LNVA 3ZYZA 3APTA 2CEQA 3FCPA 3WELA 3SEPA 3WMCA 1VFMA 3B40A 2YDQA 1OCJA 4NAEA 4HP5A 1OM0A 4RPQA 3D6NA 4Q7IA 3OHIA 3AHXA 2A21A 2ANUA 4Q4SA 2YZRA 3LTYA 3IGXA 5REQA 1TB3A 4HPNA 1JCXA 2F6KA 3ABOA 4CU8A 1XD1A 1TWZA 2NLIA 1REQA 3R10A 5U7SA 5XINA 1OZMA 4AVOA 1WPCA 3C0JA 4HZMA 3W2UA 1O94A 3SURA 4PCPA 2P3ZA 3E2QA 4DUVA 3W2JA 1SZGA 2VFGA 4J3UA 1XLFA 3K8LA 2G95A 3KBNA 4HN4A 3J7HA 3LOTA 3RNDA 5CZKA 4S38A 2ABBA 4F9JA 4FXSA 4MKNA 5C9UA 1K6AA 2PU1A 2UZ9A 3TJIA 4O4VA 1RCOB 4S3CA 4XKYA 2R1LA 3KP0A 4DJEA 1XLBA 1PIIA 1XRSA 1XL9A 4PULA 5FJRA 1WDPA 3KBWA 3CUHA 1UPMB 4Y9OA 3CK5A 4WDTA 1TV8A 3IIPA 3TTYA 2E1WA 3DN5A 1DPMA 1OFBA 4O50A 3STPA 3QW4B 2WMKA 3DYPA 3GH4A 3QV7A 3ZVHA 1AW2A 5AYZA 4GWEA 3AXKA 4N6EA 2GJNA 3PBWA 1KM2A 3QKEA 1QBBA 1O7AA 1PAMA 3WLMA 1CGWA 4O0QA 4GO8A 3N3MA 3A12A 3CAWA 5M03A 1IV8A 3P74A 1VKFA 3W88A 3W25A 2XZ9A 3TN6A 1M41A 3BOFA 3ICJA 2Q3RA 3KXQA 4PSPA 1IZCA 1OINA 2REQA 3WO8A 3MY9A 4KCTA 4AVFA 2DZPA 4HSOA 2Y2WA 1OIMA 3VDGA 4E38A 1RY8A 3D0CA 2YX0A 3R8HA 1DJXA 2WBGA 4JFTA 3NQ2A 1GOQA 2PBOA 1KTBA 3SGZA 4AIEA 2J9XA 3L66A 3ZSTA 4NNAA 5LKYA 2VENA 4GCAA 3A4AA 1NTHA 2C16A 2ZX8A 1DE6A 4F9DA 4GACA 3VMOA 2R94A 4H8VA 4HA4A 2F6XA 4Z0JA 3WL1A 3OLIA 5ECUA 2Y8KA 1ZENA 4U33A 3GIYA 1WDQA 2QNEA 1OCBA 4DUWA 4Q6XA 5F4WA 4UR8A 3VD4A 1OC5A 3A5VA 1ECQA 3URQA 1JQVA 3WDIA 4AZCB 5I79A 1VIZA 5JVLA 5CEWA 1W2VA 1F3XA 1PBGA 4I6VA 1XSIA 2V3DA 2XIBA 3F4WA 3W7QA 1VYPX 3GVVA 1LL7A 1RVKA 4LQ1A 1U30A 2NXGA 3P81A 5K9DA 3Q45A 4BHYA 2BASA 3A13A 3P14A 7PTDA 2A7PA 1H1ZA 4N4QA 3RG6A 3NEHA 1VBRA 3M1ZA 3AMGA 2O9TA 4D6GA 2IUZA 2FQIA 2P0OA 3SCTA 8CGTA 3MWAA 4CNPA 1EIBA 3KEHA 2FH8A 3ANUA 3ZWTA 3T2OA 4HNLA 3GHRA 4JTUA 3PTDA 3HG2A 2NSOA 1TMHA 5AB3A 3WNPA 4DPPA 3ES8A 4AIOA 3GVGA 2IXVA 2QDGA 3SIZA 2FZDA 4A35A 5HMEA 3UU0A 2DSKA 4IICA 1JUBA 4L7ZA 4ZZ9A 1SM9A 3QZEA 3DH7A 1A0DA 1C29A 2PDHA 3N25A 1UBPC 3ABXA 1KFWA 2PDQA 1BSLA 3CT2A 3IS4A 1XFCA 2QHAA 4GHRA 2HTMA 3BO9A 4TO8A 1XYZA 4E2VA 3T4WA 5A8OA 4JQ3A 3WNNA 1K9TA 4JCMA 4GNJA 2VJXA 4JS3A 1S5NA 4HK7A 1SZNA 4C7DA 3GDBA 2E0PA 4XAPA 1XICA 3OZOA 1VFTA 2DVTA 3SRKA 1L6YA 2C19A 1KW1A 4JQAA 3W1QA 1ZJIA 4O28A 5JIWA 1QW9A 3FW6A 4XWUA 1I0DA 4UFKA 2GVGA 4REQA 4NXSA 2XINA 4D72A 1I60A 3CHVA 4Y9MA 4EOUA 1FP8A 1F3TA 2UY2A 4QS6A 3P7YA 5CZJA 3DENA 1AD1A 1DJZA 3W3OA 3WF3A 3WNKA 1I2PA 3RCYA 1MDLA 5JH1A 3VNMA 3BGJA 1FCQA 1OFDA 3WD3A 1Q7QA 1BLIA 4QLLA 4HTBA 4M1RA 1H2JA 4B90A 1K9EA 1TA3B 2BB0A 4FR6A 4AX7A 1KBBA 4C6JA 1WOAA 2FTPA 1TR1A 3GXTA 4UXDA 3N3TA 4FNQA 2Z26A 4XZLX 4B9YA 1ITUA 1KGUA 1UYQA 2DZVA 5LIYX 2QW5A 1GVOA 1VEPA 5C5YA 3L9CA 4GC4A 4A8IA 1KC7A 2VTFA 2CZEA 3F7JA 3R5EA 2ACUA 2CLOA 4L4LA 1J10A 2YFNA 4PUWA 2VNCA 4UTMA 5I03A 3MWCA 5E0FA 1XIMA 1X6NA 2C8NA 3FYOA 2XH2A 3OOQA 4DJDC 3C2EA 2WO5A 3G6MA 3QGVA 1KQZA 1W91A 1HP4A 1ZL1A 3S1VA 1K03A 3CASA 3CGTA 4JHOA 2GWNA 4KRZA 5H8PA 2EEXA 1KFEA 2E4TA 4PCSA 3ARYA 5TQLA 5ABEA 3XINA 5F4SA 4G56A 1ONRA 2BXYA 2PCEA 2YLLA 5D38A 5FL1A 4UOZA 3SN4A 4ZTYA 5C6MA 1T40A 4K8HA 5DLCA 1CXIA 5FJUA 1NDYA 1DYSA 4UMBA 1UH4A 4KS0A 3MHGA 3EWUA 3N1AA 3GBDA 3HQOA 3TN4A 4I9TA 5I0DA 1H0GA 2VX4A 2JEPA 3MV01 3PBUA 1VPYA 3LI1A 5E93A 1IEQA 3IVTA 3FV9A 1K1DA 3URNA 1VQTA 2C91A 3S5SA 3PFRA 4O57A 4Y9NA 4O8AA 4Q8WA 4DXVA 2PF0A 4HK6A 3GZ3A 2FHCA 4UQ9A 4L56A 2ZUMA 1CYGA 4ZB5A 2D0HA 3SO7A 3R58A 4N0RA 2BG5A 1EJ7L 1P0DA 1UWRA 4LH8A 1J11A 3R7MA 1GEQA 4DY1A 2WLYA 1E1CB 4HNTA 3GC2A 1ZAIA 4A8NA 5CSUA 1XPYA 2OLAA 3CHFA 3KCJA 2DSVA 4N02A 1ZSXA 3F1QA 2PCQA 4IJCA 1LWHA 4JZ5A 3EX6A 4FNUA 3IK4A 2NV1A 5JU6A 4H2HA 3DBNA 2VC7A 5AVHA 1FCUA 3W9ZA 3G8RA 3SCSA 5I6SA 3B06A 3NG3A 4J2MA 4RZ5A 5ECVA 4C6PA 3FA5A 1HIZA 3WQ5A 4JFVA 4ECLA 1V08A 4JTEA 3UWZA 4CQ8A 1UOZA 3KVLA 5JBFA 3MVTA 1JZ2A 3CQIA 4NAFA 4CD5A 3UPBA 3W74A 2YA0A 2P53A 1ECEA 1VP5A 3U7VA 1J6PA 5MHBA 4JTKA 5I3GA 3U5UA 4MJZA 3P6LA 2P8CA 1C8XA 3M0ZA 1O66A 2B81A 4XD4A 3UJ2A 4MSSA 3N2MA 3WLHA 1DJGA 3TX9A 3EXSA 4XVEA 3ZQ9A 3G1RA 1WDSA 5CG7A 3RX2A 1MYRA 5CJMA 3D3AA 2V8ZA 2WCAA 3GU2A 3AZRA 3QHOA 4GCXA 3MZNA 4KEZA 3KBMA 1NJJA 2G3JA 1X98A 1KV8A 1NF7A 1NY1A 3H7RA 1CBGA 3TIMA 4L64A 1A80A 4F2UA 1JZ4A 1AL8A 1ICQA 1R3QA 3AAMA 2FKPA 4JX5A 4CD8A 3MI6A 1C9WA 5AYYA 4W5UA 2GGEA 5I3DA 2WNZA 1QWKA 4H6EA 4CNOA 1A5UA 3M07A 3GLCA 1Z7AA 2XWEA 2IQDA 1OYAA 5EYWA 3TFCA 4XZHA 1XLJA 4P8UA 4QCFA 3IRDA 3W83A 1BF2A 1OYBA 4Q33A 5A3HA 4MTVA 1UWAA 5AHMA 3MCMA 2C14A 3LRMA 4J3SA 1OB0A 4PODA 2OZTA 2AQOA 1PV8A 3JR2A 4J1OA 1V3KA 3SUVA 3OO2A 4K68A 1Q65A 4D1JA 2V38A 3BOXA 3E74A 2OZ3A 3NUKA 2CXGA 1XBXA 4QDMA 5IFTA 4DBWA 4LVDA 2FZMA 5D03A 2EKCA 2ISWA 1ML1A 1S2AA 2DIJA 5BXPA 2XISA 4TX6A 2GVLA 2O92A 3AU2A 3KCOA 2E68A 2YA2A 4JL2A 3GB6A 3G3MA 2X7VA 1GQKA 1P6BA 4NZ4A 4GYPA 1AG1O 1PHWA 1KXQA 1V3MA 1J4EA 4UTJA 3RUBL 4LC8A 3BGGA 1G4TA 2ZVIA 2GJXA 1EPVA 2P10A 3HQ1A 1GOXA 1JCMP 1ZAHA 5FEWA 5EGRA 4P5UA 4NRSA 4LV9A 2YDSA 2V63A 4P2VA 3BLEA 1P6CA 3W7DA 1QI2A 1S39A 4E0CA 1FCBA 4HN8A 4J2PA 2PWHA 1V4YA 3WMLA 8A3HA 1IIHA 2ZBTA 3SQLA 3NQMA 1Z8AA 2FMNA 2PDKA 3T0TA 4A6GA 5XIMA 4IP4A 4QSFA 1VLIA 2X1RA 4W8LA 2V5CA 2QPUA 2X0HA 3ITTA 1JD7A 2TYSA 3VPLA 3HGJA 2XU2A 3DBPA 1JF6A 3UT0A 4MDPA 2ZRXA 3UZJA 2P1FA 3FNDA 2VP8A 1YXYA 5C9WA 3HPFA 5C9ZA 1H11A 4IMCA 5AY7A 1CLXA 3QFEA 4KCUA 2WNQA 2EPOA 3I6RA 3U2OA 2H6RA 3SSZA 4CQBA 2PGEA 1IEIA 1TPUA 1H62A 3GTFA 1FKWA 1X1OA 1J0JA 4US5D 1HKMA 4QM1A 5H1WA 4ACZB 3W22A 3GTHA 1UP0A 3FJNA 4GRSA 3K2GA 4WOZA 3OVRA 4KMQA 5C55A 4AISA 4PSRA 1UR9A 1B54A 3KVMA 3S5OA 4L5ZA 3ZLFA 5LXEA 2PGRA 4DWSA 1QK0A 3MBFA 2DW7A 1EEXA 3WMSA 1OWQA 3FJ6A 3ZR6A 1TUXA 3ARUA 3IJQA 2ZZ7A 2Y6ZA 1W3NA 3VUPA 1WCGA 1VF8A 4X3ZA 4CGTA 3KWXA 4W84A 3ALGA 3LXBA 5I24A 1RHCA 4TMBA 2I9UA 5D9NA 4Q6JA 3TJXA 5AHLA 1FFRA 3PP7A 1XBZA 1E0TA 1SZFA 4LY4A 4G8TA 4OVXA 5A8PA 3PUGA 1ZS2A 2PUZA 1B4KA 4FNPA 3KL3A 2YL8A 3GG0A 2YLAA 1H3GA 1TR9A 2PTWA 2QJHA 1OZQA 1CGTA 3MBDA 4A22A 2E28A 4XBSA 2ZRWA 3O63A 3PZMA 3AXIA 1ADDA 1XIHA 3LRLA 4DO6A 2PWGA 1FWNA 3GYEA 4WCJA 1XS2A 5LHEA 1ZCCA 4AU0A 1KM3A 3C56A 2CBVA 4M6QA 3SUUA 1H50A 2FZ8A 1Q7ZA 4CNNA 4D2JA 1XIEA 2A85A 3QV8A 1Q3NA 2IPJA 4CNSA 4PTXA 2UV8G 4LAKA 3H12A 2OQHA 1FFQA 5AN7A 1PIGA 4D8ZA 1A5AA 4GUHA 2H9AA 1VFSA 4J3WA 4NILA 4C1LA 3WUEA 4DM2A 4L4MA 2INFA 2ZZ1A 4ENLA 3G2GA 4J35A 4M7TA 3WQEA 2XZ7A 2EBNA 1DHPA 1KNWA 3VAVA 1ONXA 3IIVA 4L4PA 2DH3A 4XKYB 1IXOA 2WQPA 3CO8A 2GQAA 1J93A 3P61A 3SFKA 4IOTA 1W2PA 2V3GA 1W0MA 3LUTA 4YTUA 1HGYA 4XZBA 4H04A 3CJPA 3PZVA 4A3HA 3B9DA 3PNZA 1KFBA 2VKZG 3PNUA 2WMJA 4H9YA 1UR3M 4DX3A 4K36A 2X1SA 4V2XA 5LGXA 3AYSA 3STFA 2REQB 5G4EA 1RA0A 1H51A 3WK3A 4DRSA 4Z0SA 4F2TA 3PBVA 3RU8X 2AMGA 3G1VA 4JKKA 1A50A 1PTAA 3PANA 3CZGA 3CEUA 1K7FA 3TLQA 1MMFA 2WWDA 4HNCA 3L0GA 2HK0A 3GSMA 4UBPC 1QFEA 1V0LA 3VFCA 3NA8A 1VEOA 3CWOX 1IE7C 1QI0A 2G0WA 4ICMA 2J88A 3O0FA 4GXPA 3M0VA 3Q65A 3DHDA 1QVBA 3GC4A 3QZ6A 2DDXA 2QJMA 3NSXA 5A2CA 3U48A 4X2PA 4NZ3A 2I7GA 4IG2A 3N29A 3RRAA 5BXTA 3AO0A 1PX8A 1B57A 3IEBA 3MKCA 4P8VA 1W9PA 1RJRA 3ATZA 3LSCA 4U4MA 6ALDA 1HKVA 3PFMA 3EB2A 3CUZA 4JY8A 2PDUA 1B9BA 3AISA 5I77A 4XIAA 3GC5A 1JZ7A 1OY0A 4O12A 2GPTA 1CGUA 1H1NA 1ZB5A 1FWDC 5BOOA 5D8WA 1LTDA 1ZQ5A 2G8ZA 3U57A 4GQBA 1V3HA 3LCXA 3C2YA 1EBHA 2HPMA 2HS6A 1XH0A 2E77A 4M24A 4HNNA 5CC7A 3RMJA 1FY6A 4ZQOA 4PBGA 2VCAA 2WZHA 1WUEA 4C5ZA 3COTA 4O1BA 1M68A 2PURA 4Z2KA 4NJHA 1B3OA 6A3HA 3RPDA 1EO7A 2DFAA 3C2FA 2JGYA 3EX4A 2B7QA 1IT0A 5FF7A 1LLZA 4Z1AA 2VXNA 3BSHA 5EKYA 1LL6A 1W1YA 4ZCWA 2XVKA 3O07A 3PJTA 2NWRA 1RQHA 1TTPA 2CZFA 2J6XA 1KWGA 1OC7A 4BCEA 2VDGA 2XFYA 5HMSA 5G2IA 3RFAA 2OCZA 2VGGA 2ZRYA 3AHVA 1FWCC 4HD5A 2Q02A 2Y85A 4R3UA 2OYMA 3VINA 3O6CA 1E4LA 1V0NA 3L0NA 2QIWA 1E0UA 4NX0A 4ZGYA 3LM3A 2A5HA 2G50A 4GBUA 1F74A 1RUSA 4AHQA 2ZUSA 4Q32A 4X63A 1W9UA 3HA1A 5H2ZA 2CLIA 3FHQA 4ADUA 4YVXA 4A3RA 1D7KA 3GO2A 2F6UA 2QMKA 1DTUA 1Z44A 1B3VA 2A6LA 4GQRA 1JFXA 1R2SA 3I3EA 3W76A 3MI3A 1D8WA 4I7UA 3L7RA 4AXNA 2PDNA 5T9CE 3KBSA 1AJZA 2CBUA 4FHAA 1CENA 4YXGA 3TTSA 5CQ1A 1JXJA 5IXEA 1K7XA 1EUNA 4UWMA 3ZVIA 1OFQA 3H26A 4AYSA 4IX0A 2QGYA 4TU1A 2FHBA 3TYDA 2YW3A 4OV9A 3FSUA 1QPKA 2JE8A 1E0WA 2HMCA 4GJJA 5BRQA 4AEEA 1I2RA 4BF5A 2NX1A 3OA3A 1KKOA 1PE1A 3QTPA 4QNEA 1YE6A 4CEXC 3FEQA 5CPLA 1PDYA 4O54A 5IHSA 3GK0A 3VIFA 2VFDA 1XH2A 3WJYA 5FAJA 4Z2JA 4O11A 2WHLA 4RNJA 3FEMA 1Z42A 2PDPA 5GNYA 3PZUA 1W1PA 2OTDA 4PH6A 3R0KA 1NM9A 4F0HA 4GUIA 3B8DA 3FY1A 1PX4A 4UOQA 3M0YA 3T7VA 4F66A 3GHUA 5AC6A 3UESA 1E4NA 2PI6A 1M6JA 2YYTA 4S3BA 3PHAA 2E67A 4HT3A 1AQMA 4J27A 1HKKA 5CG0A 4UTTA 5EU9A 2ZX6A 1WYIA 1JDAA 4QGCA 2WSRA 2YBVA 1K9DA 1TSIA 1FWBC 4PCNA 4Q4KA 1XGZA 4L61A 3ME3A 7REQA 1OG6A 1VS1A 4AZ7A 3W2MA 4KWSA 4PTWA 5A6BA 2X30A 1V3LA 4LCSA 1H49A 3C0SA 7TAAA 5G1TA 1BPLB 2QJGA 4EPKA 2CKSA 4AXKA 4R88A 1JEZA 1TREA 3AU6A 5GNXA 2FPYA 4HK5A 3REQA 1O12A 3GXNA 4GIYA 1G4SA 4Z42C 4I8YA 1RLDA 1B5TA 1MRQA 4FNSA 3EX1A 3HG5A 1TPEA 3M4HA 4PEEA 2DP3A 4EWJA 4ZA0A 4UTWC 4HPHA 2TODA 3QHNA 1PHQA 2E8ZA 1YHTA 3SRFA 4N6FA 3HQNA 4NJKA 5HR6A 1EUAA 3TZNA 3MT1A 5TF0A 3ITVA 1Y5XA 2HE8A 1IXNA 1ZJHA 4TVCA 1LZOA 1R87A 1WKDA 3V5OA 2C7FA 4JX6A 3FSTA 1AMYA 4C6LA 1YRRA 5FSEC 3NO3A 2CCRA 2NVAA 4MOZA 2I5QA 4IMAA 3SQSA 3VX0A 3TUUA 4NZ1A 1A5CA 4UFLA 4HU8A 1CIUA 4MWAD 1OFRA 1VAHA 4KRUA 4WSJA 5DX7A 5DBUA 1HO4A 3ABSA 1ADSA 1VH7A 4DI8A 2QUVA 1TZ9A 3IV8A 3ZO9A 2PGFA 3C8FA 1EIXA 1W31A 4PUUA 3WH6A 1CGXA 3EDJA 2O4MA 4R9OA 1W5OA 4TVUA 2GUUA 1QNPA 4NXKA 4MY9A 4W9TA 4LNCA 3LXCA 1A4LA 2ADAA 4XB3A 4R85A 4NIRA 3JU2A 4UFJA 1C92A 4AHOA 3RO6A 2OVLA 4DPQA 4LPCA 4YU1A 4QFUA 2VL4A 1LWIA 1TTQA 1UKPA 1S2VA 1LL4A 1EX1A 1K4HA 2P8BA 3QEZA 3PZ9A 1HT6A 3URAA 1A5MC 1Y5VA 1PCKA 2C3ZA 3NO5A 1C91A 4RR4A 4I9AA 1R6WA 4O53A 2ZUTA 3BG5A 3WNOA 3LNPA 3CWHA 3I6TA 3V16A 2Y0FA 5HWNA 3N34A 4ZXOA 2EPMX 1HJWA 1SO5A 4Z08A 1SSGA 2VURA 4PYSA 2HCVA 3Q58A 3OBAA 4AEOA 2WCSA 3LCIA 5E5CA 5LGZA 3VGBA 3GZAA 1DKWA 2YKKA 1XIBA 3ZJ7A 4S3FA 2WQDA 2VI0A 1NWUA 1BAGA 1H7WA 3CLMA 3VMPA 1R2RA 1R3SA 4R7WA 2OEMA 4FEZA 5AHNA 4GYJA 4AD3A 5CSYA 3AICA 2GK1B 1S3HA 3W0KA 3VNIA 3WD0A 4PCTA 3H4XA 3HPXA 4O8RA 4C6FA 3MUAA 4E5TA 4D6HA 5HJLA 2CHRA 1HL9A 4C6KA 4W87A 3FDKA 1KBLA 1MW1A 1H5VA 4QBXA 3M7SA 2PSNA 3W4RA 3QR3A 4ZO8A 3ITYA 4WZHA 4X60A 4NX5A 3W7PA 3P5YA 1XG3A 5DMNA 1T0OA 1H7XA 3CIVA 3GH5A 3URBA 1R7AA 4NASA 2V9DA 1HKIA 3C52A 2OR2A 3USBA 1R5YA 1WNOA 4JHMA 1VD6A 1BVNP 2PWDA 3NZGA 5F1VA 4BWLA 2PB1A 3C5QA 4KEUA 4C6QA 2PEVA 2ZX5A 3KZSA 4MKSA 3RYSA 1Q8AA 2GZXA 4D6FA 1OF6A 1UQYA 3AIUA 1Y0EA 1MQPA 3D46A 4ZTXA 3PBMA 1A5NC 3QBUA 2WSKA 4JQ1A 2VFIA 4H9TA 3GDTA 3UJEA 1QR7A 5A8GA 3OA5A 2A7NA 1XIFA 1WXJA 4LAMA 3EXRA 1U1UA 3K4DA 1GVFA 2DVXA 4EXAA 3RCNA 1K8ZA 2Z1WA 5PTDA 3UR8A 2EJ1A 2OMAA 4Z1YA 1FQ0A 2DV0A 1FWJC 3WKZA 3VM7A 3NSMA 3SIMA 1FWGC 2BVTA 3FXGA 2XWDA 4K8GA 2D3NA 1Z32X 4JEJA 1YNYA 1RXOB 3LPOA 3UXIA 1EZWA 4D8AA 3TJ4A 1BKSA 1UKOA 4TTGA 2VVNA 2X1TA 1K77A 4LU0A 1QCWA 3ZJKA 4LB4A 5EL1A 1M53A 3OJGA 4MZYA 4GX8A 2WMHA 1LOSA 4JIPA 1F9CA 1OCNA 3C3NA 4NJGA 3BCDA 4PMUA 4F4RA 1IIGA 4XO7A 2X1IA 2VOTA 3FIGA 3EOLA 3WQGA 1XV8A 4PMVA 3DECA 4XG1A 4ZB0A 4OUIA 2J66A 2ZC8A 4WDXA 4R34A 5LSMA 4PB3A 3W6MA 4XD6A 1TE6A 4DWDA 4CQAA 1FP9A 4WKAA 2D2JA 1NIUA 1G7UA 3P8JA 4DI9A 1ICPA 3CH0A 1D3GA 1K6WA 4GI4A 3FJLA 2R1PA 1ZBCA 1BGGA 2VZVA 1YQ2A 4BJHA 4UCFA 1UC4A 3KDOA 2POTA 2X0YA 3CQJA 1E3XA 1Q85A 2P0IA 1XLEA 4O1AA 3UWWA 3M47A 3PB0A 3EAUA 1OGGA 3NPVA 3NR0A 3ATYA 3DXIA 1BXNA 2IKJA 1VZWA 1E4IA 3NSNA 1EJUC 4V1XA 4LOCA 4MLRA 2VELA 3STEA 3BANA 4B3KA 1XYAA 2ZTJA 3NL3A 1OFPA 3W1RA 2HS8A 4PRTA 1IEVA 4EPDC 4L1WA 1U22A 2OQLA 3W70A 3TSMA 3CZJA 4ATWA 5H8MA 2E9BA 3HJEA 4UQBA 1XLHA 2O9RA 4MHBA 4MUZA 3GYCA 1EEPA 3HF3A 5D2TA 4AF0A 1JI2A 3B4UA 3IGHX 1XX1A 5FJJA 3HPZA 4IMFA 1W5QA 4XV0A 3VOFA 2BOFX 5AECA 3C6CA 4UMAA 4ADTA 2EXOA 4FZIA 4FX8A 2QCFA 3I7RA 4RJEA 1K8CA 3TA6A 3VNDA 4WKHA 3L4WA 3B03A 2EG6A 5HDRA 2ZUUA 1DORA 3MJYA 4L80A 4Q8PA 4URIA 1PWLA 4P8XA 4ERGA 4E4PA 3H7VA 3VNLA 4KIEA 1DXIA 5E6ZA 1P0EA 3BV7A 1SJAA 2PTYA 5KZEA 1FA2A 5CXPA 3KVJA 4Q4OA 4KIRA 5JIPA 3S9IA 1AFSA 3LMYA 1DXFA 3FA4A 2XSAA 4AWEA 3L4XA 4PMJA 3W7CA 3PWGA 5BZAA 4AMCA 1KXVA 2XPKA 3AWNA 4N7QA 2NUYA 3G1DA 1DWFM 1QT1A 1I45A 5DO8A 2WVUA 4W86A 1VHNA 2YL9A 1AODA 3N2BA 3W1XA 2E8YA 1BG4A 4C6IA 4MYAA 5I02A 1CB2A 5I3FA 1HG3A 3MVIA 3HFYA 2GGHA 4L4OA 3HG3A 3NXLA 3MYOA 4N4PA 4PR4A 5CPSA 2NQZA 3B0XA 3VE9A 1CW2A 4IG2B 3KX6A 2QDEA 4G7EA 2DW6A 1OX6A 4O1CA 3WF4A 4ERIA 1RBOB 3WD1A 2VRKA 4ZSUA 3LQLA 5GNZA 3LENA 3PWIA 4DQWA 3PPGA 3LU2A 1Z6KA 3PK7A 4GH1A 4IL2A 4XAZA 1EA0A 4AZBA 3O0KA 5A69A 4BF7A 2D73A 4B16A 3R94A 2W5FA 5CC6A 4CU7A 4M51A 5B7YA 1PIFA 2FDMA 2WANA 4FB7A 1LQ2A 2NV9A 3UG8A 1PS9A 4WGXA 2ODOA 1LLOA 4IJBA 2QT3A 3MMWA 4U5IA 1W9VA 4LYQA 1JZ5A 1E6QM 3KWSA 3KL5A 1G7VA 2VFEA 4F0MA 2OO0A 3OIHA 3N2XA 1XC4A 3KOZA 2PC8A 3E0WA 3TW6A 1LBLA 4F79A 4EE9A 2PAJA 4FLOA 3ZT6A 4LY8A 2FPTA 3U4AA 1V03A 1NH6A 2V3FA 4UTLA 4GQQA 4DXKA 1XUZA 4WLCA 3W2LA 2QKFA 3WLNA 5TNVA 5CJNA 3E0LA 3HJZA 4Q8MA 3GTNA 1H41A 2WVTA 2Z24A 4M6VA 3BQ5A 1TWSA 3IPWA 4UQAA 4QR6A 2EAWA 2AAMA 3TC7A 3CEPA 1U1HA 2ZXDA 4BK9A 1FWRA 3GG7A 3N17A 4Y96A 3F5JA 5J5RA 1SJBA 2HNHA 4GQGA 4A3YA 5A6LA 3WIJA 1SYTA 4KWUA 2XVLA 2VD8A 3W73A 2C1GA 2PDIA 4HSHA 2UBPC 3ANYA 4R9XA 1QPQA 4XTDA 3ONBA 3WLKX 5DCBA 3EMZA 3IAQA 3CIWA 3VCRA 3QR0A 4S1FA 4WF7A 1HN1A 1GQNA 4JTAA 2VEFA 3UZZA 2H90A 1KCXA 2W0UA 2NT0A 2I9EA 3KHJA 4WRHA 4UQCA 1YTDA 3MYPA 3GVRA 2QCDB 3BAXA 3S1GA 1PJ9A 2J9YA 2E3ZA 2GSHA 1UIPA 4IUOA 4XAGA 4BQ5A 4YCPA 1QRQA 4UZSA 3PAJA 1JIBA 4ZOAA 4J40A 1Q8JA 3HB9A 4NY2A 2Q8LA 1TV7A 4TOQA 2ZX7A 5KMYA 2QCLA 1W54A 4JL1A 1H4PA 1V02A 3TYUA 4QCEA 1SMDA 4PEKA 4DN1A 3QGKC 1EWDA 3MSRA 3W2KA 1UD3A 3LLFA 2W27A 4EAYA 2IW0A 3O16A 1VCFA 1HZYA 4K2SA 4DUOA 4EF9A 1A5OC 3DHFA 4LVGA 1AZ1A 2X09A 1P43A 1OC6A 3T44A 4D6IA 2FDSA 2X16A 1KBIA 3SCVA 3W01A 3CQ0A 2Q01A 2KAUC 2QR6A 1XD0A 1A53A 4LAOA 3BL3A 3VZYA 1J8VA 3WG6A 4KWWA 4PMYA 3OVPA 3VU2A 2C6QA 1H1YA 4ZQMA 1WQ5A 3ABQA 1AQHA 3KZPA 3T07A 2WOQA 4P61A 1NQKA 2V5BA 1J01A 4H83A 3QPYA 3PVFA 3NWRA 3EDDA 2E40A 5LA2A 5LHFA 3OGRA 3AQUA 2OU4A 4AD2A 2AQVA 3VIMA 3RN6A 3F5KA 4ML9A 1WZLA 5LIXX 3LDVA 1JRCA 7ODCA 4J3VA 2FGZA 2AKMA 1R0MA 1WDWA 4AYGA 3PJXA 1C7TA 1DJWA 4H7ZA 4GI8A 2C0AA 3PY2A 1XISA 5DY2A 4H01A 3GKAA 5LIKX 1SMAA 3W00A 4D71A 3E02A 4US5A 2VC5A 2WLZA 1I75A 1MZHA 3H70A 3WF1A 3N4AA 4DF2A 4FNTA 4GVIA 1DQXA 4NZFA 3LBOA 4NZJA 4CN6A 1UMYA 2EPNA 3IIXA 3F2DA 2XIOA 1POKA 1FWFC 4GZJA 3BARA 4ZR8A 3K30A 4UQDA 3WLQA 1HKWA 2NWSA 4FLQA 4LANA 1OIFA 2ABAA 5TAOA 1XCXA 4MG4A 3TDFA 3C0LA 1XQKA 2ZFAA 2EQDA 1SZRA 1XGDA 1ISXA 1M9HA 3UNDA 2VC9A 2PMQA 1IT7A 4JY9A 3FGCB 3LHYA 1JNDA 1PKMA 1K8YA 3DFNA 1DJIA 3CH9A 5A5WA 1JDFA 2G3MA 4Q4MA 1RQBA 3W6LA 3R89A 3ID7A 2V5LA 1CEOA 1RY0A 4UNKA 2D69A 1TQJA 1EGMA 4BEUA 3I7SA 1US2A 2I14A 1PTDA 2HK1A 1B4EA 4PCFA 4MY8A 1BYDA 4C7GA 1NEYA 3IJ9A 3TMLA 3LHZA 1PL9A 3T78A 4QG6A 4JFSA 2CLFA 3LS9A 1US0A 3PPHA 2YDAA 1EYEA 1GHSA 2PP0A 2PD5A 1TQXA 4ZMGA 1AMKA 5AC7A 4ZQCA 4B4FA 3N4FA 4JN6A 2KZHA 4Y7EA 5FEXA 4Q8OA 2J75A 5A6JA 2WMIB 2R9RA 2C18A 3AIQA 4YTTA 4Y9PA 2SFPA 2E6DA 4C60A 4DBUA 2ZRZA 3S83A 4XZ9A 4AZ5A 2QJJA 1XPGA 3IK2A 1T5AA 4FP1A 4Z1BA 4GZ7A 3PZQA 2Z29A 2QUUA 1PYFA 2HSAA 4XO6A 4UTFA 3A24A 3BW2A 4MUPA 1S1RA 5AC8A 5LNUA 4Q4PA 5BMWA 1VYSX 3O6YX 1VJIA 2DJLA 1KA9F 2ICSA 3T81A 3BLOA 2A0NA 4C6BA 3W7OA 2WVVB 2Z28A 3LLDA 2A3HA 4MB4A 4DYKA 4WJ8A 2AQWA 3NCOA 3SUWA 5CGQA 3TV8A 2QVNA 4DBEA 1TO3A 3QY6A 4IIDA 5JXQA 5BXRA 1EC9A 3GXPA 2Y4SA 4ZL1A 3PSVA 2DT2A 2PRLA 4A2SA 1DWJM 2OSXA 1J18A 4LBRA 4KKXA 4C1NA 3AJXA 2CZDA 3B8TA 4H3DA 2D1ZA 5GPRA 3CL8A 1FXPA 5I7GA 4H6RA 2OSWA 1CXHA 1YDVA 1GVSA 3UR7A 2GQ8A 2QCHA 4HB7A 2CIPA 1JF5A 3BCJA 4HMEA 3IGSA 3PJUA 5LZLA 5HBFA 1TFVA 1PPIA 1J2WA 3NTYA 1JGIA 3ABZA 5FACA 5FF3A 2IMRA 3GAKA 3BC9A 1JZ3A 4KH2A 5JUVA 1JPDX 3AALA 3OEXA 4WVXA 1GJPA 5F2MA 1MXGA 3C3UA 4W85A 3UXDA 3QN3A 2X2GA 5EFDA 2VO5A 2PFHA 3B9AA 2VX6A 4JIHA 1QPRA 4OKDA 1CXFA 1VBGA 1GKQA 1Z89A 4P7NA 3E2VA 5G1YA 2PZNA 4FALA 2QCCA 2DT3A 5KINA 4NJIA 2R6OA 1X6LA 3KP1A 3W38A 4RK8A 5M3WA 1FWHC 2ONEA 4H00A 4AEFA 4GIEA 3CIXA 4QEEA 4H7VA 1AQFA 2CYGA 2PTZA 3CV2A 5AC5A 4GE8A 3GFYA 1RK5A 2YDRA 1LYXA 1DTNA 5E9XA 4LCRA 4PA8A 3F2BA 3EWXA 1KR0A 4DZIA 3FJ4A 2QUNA 2GOUA 3A23A 3MQTA 2ZTKA 1MEIA 3NAVA 5AKQA 2E6YA 4O16A 3VYLA 4K39A 1E4MM 5A8NA 2PLCA 2FFCA 2VT0A 4RDZA 3PUOA 4G7FA 2FB2A 2CERA 2IS7A 2XIMA 3S2LA 4AVNA 2XDFA 3A64A 3HURA 1VR6A 1BF6A 3VKKA 5T9BG 3WQDA 1KRMA 2TSYA 3LK6A 1RP8A 3NQFA 2XTKA 1KRAC 3QXBA 3GU1A 3QW3A 3SUSA 3ITOA 4UTKA 5D02A 2E5CA 3VD5A 2A79A 3TYAA 3L68A 2QF7A 4MVAA 5H6HA 2VGBA 2WNWA 4O15A 1YIXA 1XRVA 2XIJA 7XIMA 5F1UA 1FHUA 2OQYA 1G69A 4YYFA 5F4XA 3A6OA 3LY0A 1ELSA 5DANA 1TJRA 5JH2A 1HVQA 4HKPA 2HJPA 4NG3A 3HU7A 4PUDA 1N55A 1AW1A 3K1DA 3I7QA 4Y90A 4V27A 1IYXA 5XIAA 2YXXA 4JGDA 1GKPA 3W7KA 3EWZA 3GFXA 1JNEA 4ICNA 2X41A 4LALA 1PZ3A 2QEZA 1DV7A 2Z00A 1ESWA 5KZDA 1Q7MA 1E5NA 3WUGA 2J47A 4LWWA 1I2NA 5KTLA 2PDXA 4AF0B 2INEA 2DEPA 3RR4A 3ZT7A 2V0TA 2D20A 3QY7A 1GOMA 5L9FA 3B8IA 3OZMA 3EX2A 3I10A 1FH8A 6PTDA 2DT0A 4LAUA 1V6YA 3TZFA 1O4UA 3H2OA 1KFCA 4QJ1A 6TIMA 2FMOA 4M81A 1MW2A 4IFKB 4IIHA 3VILA 4RV8A 3WLIA 3BG3A 1E9ZB 2F2KA 1UZ1A 4LF1A 1W17A 2GQ9A 1DP0A 5CLWA 3R8GA 4JOMA 2BY3A 1JG9A 4G6CA 1YNQA 3LV5A 1ZUAX 4DJDD 1Q66A 2E5BA 4HCDA 5FF4A 3KBVA 3DEQA 3H2FA 3FAXA 2INZA 2V5DA 2OWWA 3MC5A 3VOHA 5HJXA 5HANA 3AS3A 1MUWA 3BLKA 2AL2A 4HHLA 3LX9A 3P3BA 4IIFA 3STCA 4NU7A 3SI9A 1PB0A 1HFBA 1S5MA 3CZKA 3WH8A 4C6EA 3WX7A 4IIBA 1NDVA 1BQCA 1GG0A 1IXPA 1RBLA 1UR8A 4H9MA 4O1EA 4JTSA 2O4QA 2WK2A 1M04A 2CETA 3MI2A 8RUCA 3VO0A 1DEDA 4M7SA 2QULA 1EPXA 3EWBX 4JYDA 3Q94A 4ZE4A 3G1AA 3K4AA 2FVKA 4FXFA 3WCZA 3ARZA 5FA5A 3MMTA 4KEVA 2V5KA 3OZPA 1JDCA 4ZO9A 4A4AA 1UG6A 2P88A 4Z1CA 1TJ2A 4G7EB 1UUOA 3SY1A 2Y62A 1C9DA 3IUIA 5DXYA 2DZUA 1BFNA 3W1UA 3GIQA 1AD4A 3N04A 1ZNNA 1T8XA 1W9BM 3H54A 3UBPC 4XZWA 1KXHA 1Z3NA 3EPNA 5K9XA 3WD4A 3TYCA 2BNJA 3BMXA 4Z1DA 5I5RA 3DC0A 2FB3A 5LIUX 1SO6A 3B3DA 3H55A 1VFLA 1UWUA 4MWAA 1A5BA 7CGTA 2B7NA 4JTDA 4AMAA 4A21A 3UVAA 1FWSA 3W7HA 4XVDA 1US3A 2R91A 4ALDA 2IPWA 3A3XA 3H2NA 4E6MA 3OBEA 2F84A 2X7WA 1KCZA 1EDGA 3PULA 3SM0A 1XSKA 3M0KA 3FOKA 4ZODA 4DHGA 2D0GA 3M0IA 4BF9A 1Q6OA 1U2YA 3ABRA 1TVPA 1WDDA 2XFFA 1QMLA 1QPNA 4AUBA 3RLUA 4WJEA 3WFLA 3TN3A 4GGBA 2X42A 1PO9A 1QOXA 4KRTA 5IM51 1MO0A 3RJXA 1HL2A 3CV7A 1GUVA 3NVDA 4S2BA 1GNXA 1LP6A 4X9YA 5I09A 2WJFA 2V68A 2OYKA 3W1NA 4RXFA 3BJTA 1B3WA 1OX4B 2GGGA 2Z7KA 1V6WA 3P93A 2L5HA 1Y7VA 3A4WA 2YB1A 1FTXA 3U2ZA 3V4BA 4O17A 2OJPA 2V81A 3R4IA 1NP2A 1TMLA 3HMCA 5D2YA 5GJMA 5EB8A 3WJSA 3AFBA 3SECA 3UWUA 1OFOA 5BYWA 3EMCA 4YJ5A 2HV5A 2D24A 2P76A 3NM1A 2PPGA 2D2OA 4HU3A 3LPFA 3KS6A 2J27A 4H19A 2PDYA 2NQJA 1UWTA 3NZPA 5JBDA 2D0FA 2X2YA 2DUAA 2WZIA 3DDMA 4JEQA 3PBYA 3YPIA 1EF2A 3UR5A 4P7OA 5CPQA 1OYCA 3M64A 1UP2A 3KOXA 4E4UA 1BRLA 2R24A 5FF0A 1MRAA 1R9YA 5CBJA 4MAZA 3L5AA 5HA7A 4MLJA 4KESA 1Q4WA 1IZKA 2PWUA 1OCQA 5LA1A 3MDUA 2EHHA 1QAPA 1JUEA 4V1YA 3FLUA 1RV8A 5G5IA 3RXZA 3ZOAA 3M44A 1F4AA 5HQLA 1THFD 1W3HA 4ERAA 4PTVA 1M7XA 3LNMA 3NL6A 4LBSA 5E6YA 3K46A 1GHRA 4GPNA 3GIPA 2D2GA 2OO6A 1Z69A 4KQNA 1PX3A 4CNTA 1W1B1 3RCMA 5A1AA 1MFVA 1QHPA 1J12A 3E1F1 3ELFA 3F4NA 4GKTA 1VB9A 4HA0A 3W71A 3OIXA 1D8CA 1J0HA 3AIVA 3TYBA 4EP8C 3UERA 1H0IA 1E6XM 1FWWA 4PMDA 4V33A 3QVQA 1XRTA 2Y1HA 4GNKB 3C2VA 1N8WA 3AS0A 3C8NA 4N2YA 3U2CA 3FS2A 4P7LA 3O6AA 1WUFA 4WDUA 3VIIA 4FX7A 3LCFA 5F7UA 4HQVA 2RKXA 3O7UA 1MWOA 1LROA 3WEMA 1B3XA 3USZA 2W66A 3BK0A 4B5UA 3B8UA 3B9EA 4HZ7A 2I57A 1DIDA 1SR0A 4G9PA 3CL6A 3L2LA 3U6WA 1XP3A 1ONWA 4Y9AA 3S6OA 2VR4A 3Q4DA 3B04A 5CPMA 3GDLA 2XHYA 3TXVA 3NQGA 3U4FA 4DELA 2FGBA 4UR7A 3S6TA 1GYNA 1B30A 2MNRA 1DJHA 2ZRVA 3NDYA 5AHIA 1XIDA 1X8CA 3TOPA 1VLWA 5B7ZA 1Q2SA 1D7FA 3KRUA 3ZR4A 4HGXA 4CVWA 4IUGA 4WDWA 3VGFA 3TAKA 5BU9A 3AHTA 4YTQA 1GVQA 3P82A 3DHUA 3E0VA 1B3YA 2PDJA 3KOYA 3OQ8A 2DZAA 1LUCB 3UCCA 3BSMA 2DQXA 3RILA 4W89A 2PDBA 1KM4A 3O2LA 4S3GA 1XDMA 4GG9A 3LTSA 3CAQA 4GVFA 3AIBA 3CTLA 3WBWA 1RVGA 4QJ4B 1YW1A 3DAQA 4I5UA 3L2IA 1HXJA 1M01A 3NQ6A 5G2WA 3PUEA 4XBJA 4M56A 1LRTA 1I2QA 3M6DA 2VRJA 3TCEA 3BLDA 3BMWA 1EZ2A 1LORA 4NUWA 4LS0A 3U2EA 4WUIA 5EPDA 1OADA 4CD7A 3BVJA 4KGJA 3VMNA 3BWWA 3HG4A 4GQ0A 1PXGA 2J7FA 1Q4NX 2DORA 1XBVA 4HZ6A 4MMWA 3MKVA 1UD4A 2X0SA 3AZSA 5HINA 1YYAA 4FAMA 2D22A 1QW8A 3HV9A 1E51A 2VEKA 4L6DA 2BXZA 1SQ7A 4B2DD 1W9XA 3CU2A 2ZVRA 3BSGA 3UGRA 2ZZ5A 3PC0A 3GUGA 5ABFA 1SPQA 1W5NA 4DJEC 4OOUA 1V02E 2H3BA 1I0BA 2P5NA 4AH7A 8TIMA 4YWSA 2J7DA 5CZSA 2XUCA 3CL7A 5D04C 3TN5A 2WSQA 5CBBA 3BCFA 1KGXA 1KO0A 3L0KA 2O9OA 2ZICA 1TX2A 4FX6M 3WEOA 4DAIA 5K4XA 3F4CA 3PZGA 4GMEA 3MPGA 1CX9A 1ZPTA 3NQCA 3BG9A 2YYUA 4D1IA 3OPSA 3ZIZA 3WQ8A 2I1OA 4GUJA 3CUJA 4EK7A 4OOZA 2ZC1A 3A21A 4LGXA 4LYPA 4X2RA 5D09A 1QNRA 4LYKA 1W8GA 5IBXA 5ABGA 1QATA 3I3DA 5IFPA 4J9JA 4KT2A 3INPA 3PAOA 3R43A 3ZWSA 1DL3A 5BW6A 1GYMA 2NT1A 4N9EA 1UWIA 4XTIA 5G2HA 3SW6A 3RDKA 1GYLA 4AZCA 5HUPA 1ME7A 4J4KA 4W7WA 3S2NA 3ZLGA 3RPMA 5EMMA 1J6OA 3V36A 5CGTA 4TV6A 4TQTA 3DG6A 3S1XA 3MSDA 3VDHA 1HL8A 2O9PA 1ZLPA 3SCNA 1F3EA 1H7OA 4ZVJA 3WJWA 2YCLA 2G41A 4MKVA 3BUVA 1KQYA 1L2UA 5D9OA 2FZNA 6XIAA 1KKRA 4HPJA 1M7JA 2Y7GA 4F40A 3MV11 1NF0A 3MHFA 5G1MA 3CWNA 4A8LA 3CZEA 4LEQA 1NU5A 5C2GA 3K8KA 5C7HA 4PZVA 4M0XA 4CD4A 2E9LA 3ZJ6A 4UTUA 1GJUA 3C86A 3VFLA 4AZHA 5M5DA 1MUCA 4DZAA 5D33A 3TVAA 1C93A 3UZWA 1WP6A 1LG1A 5L6UA 1B1YA 5KEZA 5I2UA 2YGYA 1XINA 4WSHA 2OZ0A 3TW7A 1XLMA 1ICSA 1TV4A 2CLKA 4IHCA 4RCXA 1EDQA 4GJIA 2P50A 4NNCA 4A3UA 1GK8A 1UZDA 2YBTA 3JRKA 1X39A 3TQ0A 4C7FA 2HXTA 3K5XA 3FYPA 1V3JA 1N8FA 2EPKX 3SB0A 2YBUA 1E71M 4BI5A 1KM1A 2CLMA 4NT0A 4K7YA 3NPUA 3TKFA 4UQEA 3TC3A 1TRIA 3AYTA 3GQYA 1C3FA 4Z2HA 5BOEA 1Y5WA 1MDRA 2JQXA 3ZSSA 2VR5A 1TPWA 2ZUVA 4ILSA 4YHGA 1QOPA 3MB9A 4JPGA 1V6TA 3TOYA 3UWEA 2GVEA 4XX6A 1ISWA 2WSPA 4NQ1A 3SN1A 1AUSL 2CITA 1Q6RA 5MKGB 3OYXA 2VZUA 4B5VA 4QEHA 2V2DA 1TJPA 4ZSTA 1FCVA 5E0KA 4M5PA 1S46A 3NYDA 4RE0A 2WPGA 2GDQA 1VCGA 2E5DA 3TSBA 3W81A 1GKRA 4NVTA 1UD8A 1DJNA 3KL0A 4W8AA 4DNMA 3AHYA 2ISFA 4PBFA 1FOBA 3AXXA 1MI3A 3W1AA 2VOMA 4XUYA 1XSJA 3V75A 3AMDA 3UR2A 1GVYA 4LNYA 1DWAM 1RJPA 3VKCA 2E6AA 1TA3A 3P2VA 2E09A 5HQMA 2QYGA 4Z2LA 6CGTA 3W1LA 2WMFA 3S47A 3CUXA 4Y6GA 1GOWA 1TG7A 4K1GA 3NPXA 1UIOA 3I3BA 4PGLA 4TUFA 3V0SA 3PBGA 1EX5A 2QGHA 3OG2A 4N42A 4K6AA 1TX0A 5K4ZA 1PKYA 1TCMA 4D6DA 4HOWA 5C2CA 5AZ1A 3TNBA 1Q6EA 3B97A 1NDWA 3C2RA 4OJYA 2XGIA 3M5XA 1X38A 1JPKA 4O13A 2QPSA 1EWEA 1WBJA 1KCLA 4K37A 3QRHA 3N9RA 2A6NA 2JKPA 1VC4A 2GUBA 2NQ5A 2YR1A 1QK2A 1VFHA 3OG3A 3DI1A 3ZM8A 1YXCA 1JZ8A 1XDLA 4B5XA 3LZ3A 5LA0A 4O14A 3UPMA 3WYZA 2VEGA 4QS5A 1UOKA 4LC6A 1L6GA 9XIAA 1RCQA 2Q71A 2PTXA 3AZTA 3AMCA 4KW2A 3ARPA 4Q8VA 4GUGA 1I8JA 1IF2A 1UQZA 2F38A 5DMMA 4RV3A 3WZ0E 4LXFA 3S8HA 1QU4A 1V6VA 5TBOA 2J7BA 4HPXA 4OIFA 3IJIA 4GINA 2Y24A 3RR1A 2OYLA 3OBKA 2BOGX 5DEZA 2IKHA 5E09A 3MDWA 1NWRA 2FGLA 2Z1XA 3ISIX 3VIGA 3QM3A 4TX8A 1EGVA 1DIOA 4RW5A 4ORMA 5HNUA 3KW3A 2ZOXA 1NFPA 1XYBA 5HOSA 1GVIA 1C8YA 4BQ3A 1ZTVA 2GUYA 1YKWA 1XF0A 1ZRQA 3GW3A 4AWSA 1PKLA 2HNEA 1E1CA 1XJBA 1P7TB 1HTIA 1SFSA 3I4EA 4LSBA 2XFWA 4RZ4A 3TU9A 2DSZA 2HEJA 3OZYA 3G22A 3G1YA 4RNIA 2X40A 4RUBA 3SJ3A 4S3AA 4PUNA 1Z48A 4J7RA 3ZS4A 4UMCA 2EG8A 2VX5A 1U5VA 4IXXA 1KV5A 4LVFA 5JBEA 3A4JA 3CAKA 2J7EA 4QAWA 1U5HA 2AAAA 2RFGA 4FK9A 4C1KA 2GFTA 4TR9A 4EWND 1PWMA 1Z41A 2ZA2A 3AC0A 3KOWA 1DQUA 2CU0A 4I90A 2F2HA 3KAOA 4QSHA 3TSDA 3AUJA 5AYBA 3H2EA 1JXKA 3HN3A 2AMXA 2VEMA 2PWVA 3AS2A 3W27A 2YL5A 4JKMA 1I1WA 4LX4A 3AMKA 4JTGA 4MDOA 1ZBVA 2FTYA 4GI9A 1P0KA 2PF8A 1EQCA 4B5NA 1ME9A 4GA8A 1GTEA 1KM0A 3FN9A 3S5NA 3VVGA 2XM2A 5BNKA 3WH5A 1SW7A 2QJIA 4E3TA 2QCMA 4KETA 3EA2A 3TTEA 1E0VA 2QV4A 4HOXA 1M7OA 2Z1BA 3QV6A 2RGLA 3EPMA 3W86A 3IVUA 2PDMA 1ISYA 2PLMA 2V3EA 1J0ZA 5EY5A 4CQDA 4GY7A 1GCYA 1FDZA 3GNOA 1TV5A 4F48A 1MQRA 1MZRA 3IJ8A 4O0KA 4NAEB 3CQKA 1CXKA 1WZAA 3NDOA 4KCVA 3DI0A 2WHJA 1CWYA 3QYQA 1UD6A 5REQB 4AD5A 3TYZA 3TW9A 2WHMA 1BVZA 1EFZA 1FWAC 1S2TA 1AW5A 3W7EA 4RW3A 1REQB 1UWSA 2KX9A 5IDZA 5EMJA 5D4YA 1P4CA 1XCWA 4QTGA 2J7GA 1CTNA 3L65A 1FWEC 3W37A 3U0HA 4QG9A 3VUSA 3BXWA 4JNZA 3T40A 1GQLA 3KOFA 2FYMA 3B9NA 3N13A 2VRQA 3ARVA 3CT7A 3P8IA 4H8NA 3SCUA 2J77A 2PBGA 5C54A 3MP3A 2VDIA 4ZQNA 4UR9A 4M8UA 1O6IA 2RJGA 3JZEA 2VGIA 1ZP3A 4O0ZA 4EPBC 3TXZA 3BOLA 3NO1A 4Q22A 4XK2A 4L9YA 4RX0A 1KBKA 2OZ8A 2ZIDA 4NI3A 1PZ1A 3ZVHB 4ZO7A 5C70A 4D9PA 5DY3A 1K7EA 4GYPC 3SFWA 4JDYA 2QCGA 3BMVA 4WY0A 4NYUA 5FL0A 3UG3A 5C7VA 4IISA 4DLMA 5C8BB 4UZUA 3VGEA 8XIAA 1BQGA 3T8LA 3IIZA 2VHLA 3M7WA 3PZNA 3D3FA 5D8ZA 3UZXA 1X1ZA 3KTXA 2YL6A 1JPMA 1W3IA 3WH7A 4CU6A 1GW1A 3GBEA 4L9ZA 3E5PA 4UTHA 1V93A 3L4ZA 3GD6A 3WDQA 1G94A 4ADSA 1HVXA 3LRKA 2C1HA 1UZ4A 2PWEA 4FIQA 1SVDA 4AIUA 3MO4A 4CCDA 3UF9A 3B0PA 5M17A 1DIEA 4LUSA 2I17A 3G18A 1JCNA 3NM3A 2J8FA 3SRDA 3TQPA 2CBJA 4M82A 4GVHA 3DFTA 1OG0A 4OU1A 2BHUA 2IPFA 4J5NA 1OABA 5G4HC 2ATSA 3QPEA 1GQJA 2FZ9A 2OT1A 3THUA 1OK6A 4PUKA 3GHSA 1JDDA 4A05A 3E0FA 3W2NA 3VNZA 3P5ZA 4MWAE 3NURA 3SR7A 5AFDA 1JCLA 1DWHM 1A3HA 1WAWA 3L12A 1E6SM 3WQ6A 1Q6CA 4FMVA 2Y61A 4ACZA 2DVUA 4IPIA 4EAMA 4GFSA 4QHRA 4UFHA 4XSLA 1J2BA 3ES7A 3MUY1 4RLIA 4AZIA 4QITA 1UH3A 3O3RA 3QTGA 1PZ0A 3VOGA 2OOFA 3NQ7A 3MS8A 3OTRA 2RDWA 3GE7A 4DWSC 1VENA 1H63A 2Y5JA 2BDQA 3UCQA 2PU0A 3CS2A 3I6EA 3M0LA 4B15A 1NAL1 3GNPA 1JAEA 3L4UA 1HF6A 4R53A 4HYWA 2DQWA 3SQMA 3LXAA 3C0QA 3NPWA 4RE4A 3VD7A 3KBJA 1R38A 4XBKA 1F05A 1RSCA 1P48A 1TPFA 1MEHA 5G4WA 3F4VA 2G97A 4FF7A 4KF1A 3GX9A 1R3VA 1FBAA 1NQ6A 4RKAA 3TYEA 1TPC1 3BICA 2W6RA 3E2RA 3T9PA 4RE3A 3M43A 3S9ZA 4LUIA 3E12A 3W23A 1BKHA 4JFWA 5K9CA 3UXAA 4UNLA 3DUGA 3H2MA 2VFFA 1KLYA 3W24A 1DOSA 2BMBA 5AC4A 1X97A 1RJQA 1H7NA 2WZMA 3LG3A 4W7UA 5K7JA 1FVPA