5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Lyase
molecule keywords Fructose-1,6-bisphosphate aldolase
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
1TV5A 3TJLA 2VEKA 1GTEA 4AHQA 3UYCA 2V30A 3TXVA 1O4UA 1QPNA 1X1OA 3FFSA 1ZAIA 4ADSA 3W1NA 1K03A 4QNWA 2X1RA 4JYFA 5EL1A 4JDBA 1BTMA 3G1AA 2GJNA 4UTUA 1KTBA 1IGSA 4JYEA 5D2YA 3EX3A 5C54A 5AC7A 1H60A 5EKYA 1PIIA 2CLMA 5HR7A 2VXNA 2E5DA 2H3BA 2QCFA 4FX6M 2ZZ2A 3UXAA 3WJWA 4RR4A 1FBAA 3HGOA 1AL8A 4UUIA 2A6NA 3EWWA 3NQGA 3P81A 4O18A 1KV8A 4UTWC 3MP5A 4YL2A 4OV4A 2QCMA 3DFQA 4E0CA 1N7KA 1OYAA 4NJHA 3EXRA 3UY7A 2H8ZA 5TQLA 4K8HA 4A2RA 3M47A 3W3OA 5HUPA 1HTIA 4IXXA 1ICPA 3ELFA 5CKSA 4N9EA 5F4XA 2A1YA 3BW2A 4Z0JA 3KRUA 1GVOA 1YDOA 1KM0A 3WK1A 5C5YA 1FWRA 3C2RA 1LRQA 2F84A 4N4QA 3CIWA 3W83A 2X30A 5D09A 4WY0A 1SSGA 3C56A 5T26A 1ML1A 4FNQA 3W1LA 1I2OA 1WQ5A 2O7SA 2WQPA 2ZQ0A 3TJXA 4MFEA 3W7GA 3M44A 1P0NA 2EF9A 3GKFA 4X22A 1OX4B 2WV8A 3GZ3A 3B04A 2GVJA 3L21A 3IGXA 5CGQA 1QR7A 2FJKA 2IQTA 2VFGA 4UTIA 4FEZA 1G67A 1S5TA 3B03A 1AW2A 3BG9A 3OVRA 1QOQA 3TMLA 3S8HA 1ZHAA 5F1VA 3GYEA 4O28A 3TQ0A 3QPYA 2XFWA 3H55A 1QOPA 1VC4A 1EIXA 3PUOA 3W2UA 4X3ZA 1OFAA 1XKYA 4MYXA 2H8XA 3IRDA 5BMXA 4PA8A 4UCGA 3SI9A 2J9YA 2Y7EA 1YXDA 3LCLA 3TSBA 1XL9A 4P61A 1SW7A 4UNLA 3FEMA 2NV2A 4N9CA 5BRBA 3E49A 1G4TA 5G2IA 2DU2A 5EY5A 3A5VA 2A21A 3QFEA 4Y6GA 1GJPA 3S5ZA 5DCEA 4FX7A 3P8IA 1ME9A 1L2UA 5F4SA 5ABTA 3VE7A 4ADUA 4MZYA 4ADTA 3SY5A 2ISWA 1LOSA 1GVFA 3G8RA 1FCUA 1K02A 3STEA 3DKJA 2CFFA 1XDMA 5SWUA 5HR6A 1TTQA 3HG4A 1BWLA 1VR6A 3KOFA 1XBXA 1C29A 1B57A 2OX1A 1W5MA 2TMDA 3A21A 4NJKA 4RZ5A 1F6PA 4LNYA 4MKNA 1VGAA 4BI7A 2BZNA 4QSHA 4OE7A 1Z41A 5HMSA 3GIYA 3A9IA 3G1FA 1RQBA 2V2DA 3VFLA 1VRDA 4HNNA 4K38A 3AO0A 4JIQA 2JK2A 3TROA 5HULA 1KM6A 1NVMA 3P82A 5K4XA 3OVQA 1F05A 4NUWA 5FEXA 4E38A 3UPBA 5CSRA 3DFNA 4MZ8A 1FX6A 4CCDA 3LERA 1YADA 4ZQRA 1ZAHA 4UC5A 2WKJA 4HNVA 2Z6JA 1B4EA 4MY8A 1OYBA 3ZFHA 3NL2A 3KHJA 1EP1A 1AW5A 3PB2A 2VOMA 1VQTA 1EUAA 1TYGA 3MP3A 4TMBA 2FLIA 1GOXA 4GE8A 4Q33A 2ZZ7A 1C9DA 2A7PA 2WSYA 1P5BA 1YXYA 1OFQA 3RF9A 1GPWA 1B3OA 1TQJA 5AHNA 1O94A 4ZVJA 4EWND 4PFMA 2NUWA 1HG3A 3QF0A 2ZZ4A 5AYZA 4PODA 2ISVA 4FNSA 1WBJA 3W2MA 3GDRA 5FI8A 1JQXA 1VYPX 3EXSA 5D32A 4DPPA 3VE9A 4N6FA 3LCWA 5FF7A 3C2EA 1GVSA 3HQ1A 3PUEA 3SGUA 1G69A 3IGSA 1TTIA 3UY8A 1W8SA 2HS6A 3G1DA 4DO4A 5A5WA 1H7RA 5CZSA 3OA3A 1UUMA 3QM3A 2NX9A 1QO2A 3C0JA 2QCNA 4N6EA 2ZRVA 3A5FA 5HWMA 2AGKA 4FX8A 4O1DA 4I7WA 3LLDA 4FB7A 3NA8A 3DHDA 3KVJA 1OF6A 3OIXA 5BOOA 2B0MA 3M1ZA 5LNWA 4NNAA 3TSMA 3B4UA 2ZRUA 2DZVA 3SIZA 4EIVA 2RFGA 3BLEA 1LM1A 2BTMA 2H3DA 4MIMA 1WA3A 4MUZA 4GUHA 1R2SA 1I2NA 1JRBA 5AOUA 5C55A 3G1YA 5FEPA 1H1YA 3P80A 1O5KA 1TRIA 4S1FA 4PC8A 4XZ9A 4KWWA 5KTLA 4LC6A 1DOSA 4IX2A 2PCQA 3G0UA 3W7MA 1TJPA 1W5OA 4GXMA 3NXFA 1DORA 5D30A 2CLLA 2F7FA 1JCMP 3GX9A 1WDWA 2UV8G 1W3NA 1TV8A 5DBTA 3RNDA 4FIQA 1Y0EA 1JCNA 2J27A 2GJLA 3TIMA 1YXCA 4O17A 1I4NA 3HO8A 4NXSA 2WNQA 3F03K 1A53A 2CZDA 4O52A 3W2LA 3WFAA 3IVSA 1H51A 1KFLA 5F2GA 1GEQA 5DBUA 3PY2A 2FIQA 1XDLA 4AMAA 3L5LA 3L66A 1F5ZA 1IIGA 3TR2A 1DQXA 1BWKA 4BWLC 1F73A 3CTLA 4JEQA 2E77A 3TH6A 3GDKA 2Y7FA 3G1HA 2RH9A 3KVLA 3CB8A 3DENA 4BWLA 2WSRA 4JN6A 2PE4A 1VS1A 3QRHA 3L5MA 3WJYA 4B5NA 5CPNA 4ZQOA 2G97A 2YFOA 3LGEA 1TV7A 4GWEA 5CPOA 5D02A 5LNSA 1XBVA 4HT3A 3W86A 4PH6A 3UWWA 3W76A 1SZEA 1RPXA 2Q3RA 2VELA 5AYXA 1W56A 5DN1A 2QAFA 3GK0A 1KFKA 3HIJA 2VFDA 3NPWA 3KVKA 5F2IA 4DXVA 1YDVA 1AMKA 1SZGA 5EA9A 4Y96A 7TIMA 1OX4A 4JTGA 5FEWA 2A7RA 1P4CA 2R91A 2Y70A 1WOAA 3MBDA 2RDWA 3PWAA 4FHAA 4CCEA 4O1AA 3IGUA 2FB2A 3FJ6A 1Z48A 1LORA 4MPQA 1T0OA 2ZYFA 4I7UA 3PSWA 1LDCA 4ALDA 5KITA 4YMZA 2CLIA 2A85A 1EEPA 3NGJA 1SSDA 4LRTA 2ZTKA 2ZZ5A 3EKZA 5KZMA 3R2GA 2Q3OA 5LHFA 4K37A 1X1ZA 2NXIA 4GUFA 2BWGA 3W1AA 3DFTA 5AB3A 3QSRA 3BV4A 1LRTA 1P0KA 3FKKA 5I3IA 1TCDA 1NFBA 4RKAA 3W7EA 3NQAA 1K7XA 4IQLA 4Z08A 4E2DA 4Z1AA 1H7NA 4EOUA 1OK6A 3IEBA 4O53A 2Y61A 3PUDA 3G18A 1QMLA 2QR6A 3C3NA 3GXTA 2GQAA 1ADOA 1XCFA 3HGJA 4UNKA 1K3UA 3LRLA 2DZWA 1JCJA 3LTPA 2VKZG 1TIMA 1OK4A 5U4NA 4BI5A 1P1XA 2Y62A 3GLCA 2OZ0A 4PL2A 3W1MA 5HWJA 1GZGA 3N73A 4U28A 3P61A 3S0CA 1LYXA 5DY3A 2YDAA 2CLFA 3B0PA 2QCLA 2HS8A 2C18A 2FPYA 4LVDA 2PRHA 1Q6OA 4PCFA 2B7PA 3W73A 3GAYA 2H90A 3TC6A 3W1XA 3FKRA 5FEZA 4XWUA 1KBJA 3KAOA 4BR1A 1EWDA 3ATYA 4QNEA 1Q6RA 3I65A 1VHCA 1ZCOA 5HJLA 5IBXA 4UFKA 1K7EA 2W79A 3WJXA 1HUVA 2VFHA 3DXIA 3W1RA 1GT8A 5IBXC 4DQWA 2TPSA 3EWZA 1VYSX 2Q8LA 1N55A 1PV8A 2G95A 4K8EA 3THAA 1OYCA 1W3TA 4JTTA 4ICNA 3NQMA 4LUIA 3MBFA 3PULA 1K8ZA 4D2JA 1ICQA 3LV5A 1ZFJA 2ALDA 3BLFA 4DO5A 1RV8A 2QCEA 1K8YA 4C1KA 4ZQCA 1M5WA 5DXXA 2J88A 1FQ0A 2B7QA 4PTNA 4YCOA 3IIXA 2AQWA 4QISA 1OFOA 3G0SA 1WV2A 4GBUA 1EX5A 2LLEA 1OFEA 5K7JA 2EAWA 4UFJA 4NU7A 2E5CA 2YW3A 5AHMA 2JBMA 4IX0A 1J4EA 1C8VA 1W1ZA 2Y89A 1SU5A 1MEHA 3W6YA 3QMTA 1LROA 2YSWA 1WYIA 3TV8A 1VCGA 3QJAA 1KM3A 5FF2A 3O6DA 2NLIA 4GRSA 4NJGA 4O10A 4M19A 3NG3A 3CC1A 1QWGA 1OFRA 4RJEA 2W6RA 3NOEA 3NL3A 2YCEA 3MWAA 4FNRA 3NQVA 4FF7A 1TQXA 2A0NA 3W87A 3M6YA 5CPLA 5CPMA 2OCZA 2RKXA 3E9AA 4HKPA 1SUXA 4R34A 1GYNA 3EWUA 5F2MA 5U7SA 1MSSA 2ZZ3A 5A8GA 3SR7A 3G3MA 1SO6A 3W7HA 1YPFA 4MLJA 1I2PA 3MO7A 2Y63A 4Z1DA 3QMRA 4AAJA 2ZRXA 2ZBTA 3M7WA 3DAQA 3USBA 4PEKA 5G4WA 1OX6A 3LDVA 1VPXA 3UD6A 4Y9AA 3UQNA 3NQ6A 1OFDA 2NX3A 2YGYA 2NXHA 3Q37A 1H7PA 3W7KA 4TIMA 3ANYA 1YLVA 2QDGA 4K36A 4UFIA 1KFBA 4CNOA 1MZHA 4JY8A 3LRKA 1RZMA 3DHFA 3R8RA 3U6WA 4HSNA 4X2RA 5DCDA 1TPFA 1ZALA 4JTJA 4UIOA 2J6XA 3HF3A 3W7OA 2R8WA 2QUUA 4UTTC 2JKAA 5DELA 3N9RA 3CIXA 4CNPA 3I7SA 3ABOA 3SJ3A 1NAL1 4NJJA 4UTTA 3NM1A 2V9DA 4HNUA 1W5PA 3G3DA 1JUKA 3GVGA 4UTWA 3TE9A 2E68A 3DI0A 4I9AA 4DF2A 2QJGA 5D2VA 2ABAA 3EX6A 1JRCA 3HG5A 2WNZA 5IM51 3TXZA 2ZRZA 3NQFA 4O54A 4JDYA 1QCWA 5BMWA 4IMEA 4OHQA 2WPBA 1LP6A 1VYRA 4JTIA 1R46A 4MJZA 2BXVA 2YYTA 3PAJA 2CU0A 2Y7DA 3BG5A 2R94A 1VH7A 5FF4A 3TA6A 1ME7A 3ATZA 4JD4A 1LOQA 4WY0F 1UASA 4BI6A 2VFIA 1KM4A 1W54A 3UWVA 1W5NA 3S5YA 1HFBA 3KFTA 1AG1O 3LTSA 4XKYA 3BPWA 1D3HA 5EBUA 1KFEA 3EKLA 3W1TA 4EF9A 3KVMA 2D73A 1ZAJA 1TTJA 1VCVA 4Q4KA 1KV5A 4ONVA 1FDYA 4GNJA 3CWNA 1QDSA 4WX2A 2XN0A 2E6AA 3C6CA 4KFOA 1OABA 3A24A 2EPHA 3P67A 1PS9A 1TTPA 3H53A 3OBKA 3BARA 2RDUA 4NXKA 3G1SA 4Q32A 1SO4A 4IOTA 2W0UA 4N9BA 1B4KA 4JTEA 1PE1A 4DF0A 1LZOA 4LW7A 1TMHA 5AC6A 5KMYA 3P7YA 3O63A 1A5AA 5HWNA 2X2GA 3TMQA 1V7YA 4CQ9A 3I6RA 4LV9A 2QCCA 3M5XA 5D2WA 3SFKA 1TB3A 3NPUA 1OVDA 3KXQA 3DI1A 4A22A 4H3DA 3DKLA 1LTDA 1G6CA 1YDNA 4X9SA 1CX9A 5D2XA 4WJEA 4WQ6A 4M6QA 5EMUA 3LCFA 3LCHA 2JKPA 4LUJA 3S5OA 1EA0A 3P5YA 5LSMA 4UTLA 2E09A 3EX1A 5AHFA 1H62A 4IGHA 4QAIA 1UJPA 3OVPA 3S1VA 4LWWA 4JTKA 2ZA2A 3UWUA 4MY1A 1XFBA 3QPZA 3ZR4A 1T96A 1OG0A 3HOJA 4IMFA 2BLEA 4A29A 3TU9A 2GQ9A 4LS1A 4IJBA 3N2MA 1XI3A 5CZJA 5LNRA 1B9BA 3MHUA 3SW6A 5K9CA 5HNRA 3MI3A 2NWRA 1FXPA 4IPIA 2YXGA 1F6KA 4JR5A 4MZ1A 4NX5A 2TRSA 4LTSA 2DZPA 1VJIA 4JX6A 4N9DA 3S1XA 1FWTA 4OU1A 3PBYA 3NVTA 4K7YA 2QJIA 2VC6A 4RX0A 4CCCA 1SFJA 3M5ZA 1DKWA 1M7PA 4CLMA 3HPSA 1S3HA 2X16A 5I3FA 3N2XA 2FFCA 1TPEA 4O1BA 5I3HA 1AW1A 4MY9A 2QCHA 5AN7A 2ZTJA 3UWQA 3V75A 5K9DA 4S2BA 2VEPA 2OMAA 1KW1A 4CQAA 4H6KA 3C2OA 3FLUA 2DZXA 1GQNA 3P84A 3NQCA 8TIMA 3LXAA 1JQVA 3OHIA 3Q58A 4OWGA 3W1QA 1F74A 4LVGA 3S9YA 1VCFA 3GXPA 3M5VA 3C4UA 3QC3A 2E5BA 4OQVA 1U83A 2ZRWA 4QIUA 5G4EA 2DJXA 3STGA 2ZCGA 4LVAA 3W70A 1Q45A 3MP4A 2A4AA 3BK0A 3PG8A 3E02A 1SR9A 4HPXA 4MOZA 5F1UA 1X8FA 2ATMA 1FWSA 4LT9A 4H4IA 3QSTA 5I3KA 3A23A 3ZWSA 1PL9A 3HPZA 4XBKA 2ZA3A 4Z0SA 2CLOA 3T7VA 1M7OA 3MYOA 2FB3A 3G1VA 1FWNA 5F2LA 3W23A 3QQ0A 4C1LA 1GG1A 2C6QA 4MVAA 3HB9A 1UUOA 3DFSA 1TPDA 2YPIA 4O1CA 3W07A 1UCWA 4AWSA 2YZRA 2ZZ1A 2PC4A 3V1PA 4O4WA 4NZJA 2Y88A 1WBHA 4N2YA 1H61A 2QDHA 3BW4A 4AEOA 3T55A 1K7FA 4DBEA 1R2RA 3O15A 4FNTA 1VLIA 3EX2A 4JS3A 2ATSA 3E12A 3W7LA 3TC7A 4RCXA 1FXQA 3CWOX 1L6SA 2J9ZA 1D9EA 1TPUA 4UFMA 1S5WA 4RZ4A 4M6VA 5TBOA 1VLWA 2B7OA 3GB6A 3HGSA 4IMGA 4Z1CA 4IMCA 3S42A 1F76A 5AFDA 1JCLA 4P2VA 1W3IA 4O0ZA 3B0VC 2KZHA 3MW7A 3WK0A 1T8XA 4RLIA 1Q6LA 3LXCA 3DH7A 1H7WA 5D05A 3WK2A 2JGYA 3CU2A 3F4WA 1KBIA 4ZMGA 1PCKA 3PS7A 3TK7A 1DL3A 5HUOA 5E93A 2HTMA 1VZWA 1J2WA 1O60A 3FOKA 1Z42A 3GDTA 2E6YA 4FIRA 1LRNA 2V0TA 3EWXA 1FCBA 3NPVA 2YR1A 4MFDA 1QPQA 3IVTA 1KFJA 1KM1A 3R89A 1XXXA 2YFNA 1FWWA 3MYPA 5G1YA 4JGDA 4OT7A 2PURA 3W7JA 3S1UA 3W75A 5KINA 5AHLA 3W7IA 3CT7A 4M6PA 1ZY9A 3IIOA 2VEIA 2V2CA 4K39A 3W84A 4NNCA 1NF0A 2ZRYA 5AYYA 3WJSA 4K6AA 4YLWA 4KKXA 4NJIA 1Z44A 3LB0A 1IF2A 3NAVA 4S2CA 3PB0A 4KFNA 1I2RA 4LC8A 1R2TA 1WX0A 1LBMA 2O7QA 4ZQNA 3W7CA 1IIHA 3G0XA 1SQ7A 1YTEA 3HG2A 1OF8A 4O14A 5K3VA 4I7VA 5H91A 5DXYA 3O16A 2CLKA 3KRZA 2VFFA 4GUGA 3ABQA 3TFXA 3NZ1A 3NR0A 1MEWA 3EEGA 2GPTA 3QEZA 3DZ1A 4GUJA 3MMTA 1W0MA 1SO5A 1I45A 3LLFA 3ZS4A 1L6WA 3HPXA 2QCDA 2Y85A 3O6CA 3UPWA 2CZ5A 2YX0A 2Z1BA 2V8ZA 3JS3A 4GFSA 2NUXA 4O4VA 5DCBA 4A2SA 3B0UX 3M43A 1UB3A 3HGRA 1G4SA 1H50A 3AJXA 3N19B 5I3GA 2BX7A 3UXDA 5K4ZA 3MHGA 4IXHA 5EYWA 2ZDRA 3ABRA 3EB2A 3CLMA 4AF0A 3CQ0A 5CG7A 2C15A 1H63A 1KM5A 5K2ZA 1JVNA 1XUZA 3T4CA 4R53A 1Q6QA 3W1PA 3GKAA 3RLVA 2C14A 1SZFA 1X7FA 3W9ZA 2V81A 4TMCA 3JR2A 3TCEA 4L4LA 2I9EA 4O13A 3HMJG 3EX4A 5FESA 1LBFA 3IV3A 1JULA 1LOLA 1H7XA 3UWZA 4EF8A 3PR2A 2NV1A 2EGZA 4O16A 1EWEA 2FQIA 4RXGA 5FF0A 1KFCA 1SPQA 4AF0B 1TPC1 5CSSA 1NEYA 4JY9A 4JX4A 3M0ZA 3CHVA 3R13A 4WD0A 2X1TA 3LHUA 5L9FA 1RR2A 2NWSA 4UTHA 2Y6ZA 5LNUA 4DEFA 1ZNNA 5D37A 3N3MA 4HN4A 4KWVA 1AL7A 1FUYA 5FF3A 4ZQMA 4PL1A 3TX9A 3INPA 1H5YA 4EVZA 5J5RA 3ABSA 3MI2A 4MJMA 3SECA 5J5DA 2QUVA 5DY2A 1WAUA 3RFAA 1LBLA 1THFD 3NNTA 3I7RA 5C6MA 3W22A 3G8EA 4POCA 3W2JA 3O06A 4GC4A 2GOUA 1AK5A 3A22A 4JX5A 4ZL1A 4LOCA 4O57A 1OX5A 3VI2A 1QNVA 4UXDA 1L9WA 3DGRA 2C16A 2VENA 1KLZA 5H2ZA 2G5WA 4FNUA 1HL2A 2QEZA 4FNPA 3U2OA 1JCYA 5K9XA 2GUUA 2GVLA 2J9XA 2NXGA 5G2HA 3LHTA 1FCVA 1I8JA 3BGGA 2YYUA 3WJZA 3NZRA 3P8JA 1LLZA 4G1KA 3HG3A 1L6YA 1MO0A 3SGZA 1YTDA 2TYSA 4JTSA 1M6JA 4ORMA 3TAOA 2ABBA 4XUGA 3LHVA 3DBPA 5CZ0A 4BF9A 4GJ1A 3T44A 4WY0B 3FA5A 3S1WA 3MJYA 3W2KA 4AB4A 1TJRA 3STCA 4UFHA 1J5TA 4UR8A 3BG3A 3BVJA 1ICSA 2FPVA 3NQDA 1W37A 3TW6A 2QJHA 3C52A 4Y90A 1DBTA 3LTYA 3RK8A 1XM3A 4LRSA 3MHFA 2P1FA 3Q2DA 3Q94A 3E96A 2H6RA 1EUNA 4AWUA 3LI0A 3VNDA 3M41A 3NEVA 4N02A 4NT0A 1QAPA 3TSDA 1SO3A 2E6DA 1WOBA 3GR7A 5KZDA 2QUTA 5LKYA 5LNVA 2ZZ6A 2WO5A 3LCXA 1T99A 3BW3A 4JNMA 5D38A 3G24A 4NVTA 1W31A 2QCGA 3C61A 3LOTA 4TX9A 3NO5A 3L9CA 3L68A 3TQVA 3IIPA 3HJZA 5BNKA 2AAMA 1U5JA 3MI6A 1RD5A 4IWWA 3GDMA 3L0GA 2JKEA 3W7PA 2V2HA 5AHEA 1XBYA 3FYOA 4NX0A 1IXPA 4JYDA 3UZJA 2WOQA 3I7QA 2GVGA 2Y7GA 3W88A 4LU0A 4YWIA 3W71A 2Z2UA 2C13A 3QW3A 5LGXA 3QQ1A 4J9JA 4CQ8A 3L5AA 4K7VA 3STFA 1CW2A 4W9TA 3PG9A 1IXQA 3YPIA 4BK9A 1F7BA 3DFOA 3L67A 4FXRA 1TPB1 5HQEA 2A7NA 3CEUA 3L0KA 3W72A 1GTHA 1E51A 5AC8A 5D03A 1HO1A 3TNOA 4A3UA 4JTFA 3OG3A 1QO5A 4GUIA 2Z0IA 3CM4A 3R5EA 5I3JA 1EP2A 1BKSA 3LBCA 3W7QA 2C1HA 4RXFA 4ML9A 4QM1A 2B4GA 4RK8A 5G5IA 2G96A 2PRMA 5GVJA 1JR1A 1O95A 1XC4A 3M9YA 2OT0A 3F4NA 3G22A 3NL5A 2FDSA 1EP3A 4TU1A 1GYLA 2CLEA 4IUOA 3TDFA 1QPOA 3QH2A 1VHNA 3LCGA 3TQKA 1A5BA 3LHWA 1SFLA 4XTIA 5TIMA 1TRDA 4UMAA 1DQWA 2X1SA 3DFPA 3D0CA 2E6FA 3PSVA 3G1XA 3DU0A 3QMSA 2P10A 3S5NA 1SW0A 1RQHA 4TO8A 2NX1A 4R7JA 3NYZA 3T78A 1N8FA 1O5XA 4NQ1A 4UMCA 4UFLA 3N9SA 5E1QA 2QF7A 3NPXA 3E0IA 3W1UA 3M5YA 3C8FA 1LCOA 1G7VA 4HIBA 3HBLA 2I1OA 4FXSA 1TREA 3RU6A 1K8XA 5LHEA 3PM6A 1DJNA 4O0KA 1S5VA 4WXYA 2WSQA 5HINA 3EXTA 3FYPA 1H7OA 4AXKA 4AWTA 3LI1A 4OGZA 2ZFAA 5LZLA 4DF1A 1MXSA 4AVFA 3B8DA 3O8AA 3GNDA 4DELA 1OHLA 1CI1A 3LCIA 4MYAA 5LGZA 3GR8A 3PC0A 4UMBA 3O1NA 2CWNA 1FCQA 6TIMA 3PF3A 1TPWA 2HSAA 2Z6IA 2PRLA 5KSWA 3W85A 4JIPA 5D2TA 4HNTA 3N14A 2XN2A 2Q8ZA 3GDLA 2FPTA 4U4MA 5AHIA 2BSLA 4FO4A 2CZFA 2B7NA 1PHQA 4IMDA 1IXOA 3FJLA 4LS2A 1XUUA 2GQ8A 2X1UA 3FIGA 3K30A 3LM7A 4DO6A 4DPQA 4DBDA 3NQ2A 3IIVA 1MEIA 4ORIA 1JCXA 3LBMA 1G7UA 1Q3NA 4JTUA 6ALDA 4UTMA 4YCPA 2V82A 1I2QA 4E2BA 1ZJIA 2XN1A 4A21A 4QITA 3EWBX 1GWJA 3KRSA 2NUYA 1ZENA 3O6YX 3NL6A 1FDZA 1G4PA 1TPH1 3PBVA 2A2IA 1R47A 3IIZA 1H1ZA 3W7DA 3L65A 3BO9A 3W7NA 2CW6A 4XTDA 3T40A 4M7TA 4NZFA 3NM3A 3LHYA 4YXGA 4O11A 4XKYB 1D3GA 2DZUA 1GVRA 1OJXA 3UNDA 4M7SA 2CLHA 2DZTA 2E1DA 1LLWA 4N4PA 4XQ6A 4WUIA 3W7RA 3TW7A 3PBUA 1RQEA 5D33A 2V5BA 3P74A 5F4WA 1XBZA 3CPRA 1DJQA 3NQ7A 1X6UA 4WXZA 4XBSA 4RZ6A 1TPVA 4UTKA 4QJ1A 4MLRA 2DORA 4JTLA 1KM2A 4OBTA 5CZTA 1IXNA 1GVQA 3TFCA 1R30A 1ALDA 3EWYA 3JRKA 3UZ5A 2V5LA 3C2VA 2WJZA 3I68A 3RMJA 4O12A 2VFEA 3B05A 2QCDB 3RLUA 3THQA 3N34A 1DV7A 3TUUA 4LY8A 2DZSA 4WOZA 1A5SA 4Y8FA 5KZEA 5MHBA 4UTJA 2DP3A 3TAKA 4LVFA 3P60A 1FDJA 2VEMA 5BW6A 1KTCA 3B06A 3QZEA 1F2JA 1FY6A 5C2XA 1QFEA 2A6LA 2EHHA 1TO3A 2P0OA 2C3ZA 4O8RA 1ME8A 4QQ3A 4CNNA 1OFPA 3R12A 1V5XA 1W5QA 3SZ8A 3PVFA 4O19A 4KFPA 4LV4A 3F1QA 3H54A 5E0KA 2C0AA 4WOQA 3BGJA 3O07A 2FTPA 3W2NA 5EPDA 1PVNA 4ZZ9A 1SW3A 4JTHA 4L4MA 4M5PA 3QW4B 4IPJA 3CEPA 3W74A 1GG0A 1OFBA 1YYAA 3NDOA 4ZQPA 3QYQA 4AH7A 4JXCA 1NF7A 1DVJA 2ZA1A 3SSJA 2OT1A 2JGQA 2EKCA 1UBSA 3GNNA 3S6DA 5DLCA 1PHWA 2WNNA 1G4EA 2I14A 4O15A 1YTKA 1QPRA 4JICA 1RVGA 4LS0A 3P62A 5D04C 5G2WA 3UWYA 1PCWA 3U8GA 3KX6A 1WXJA 5L6UA 2A5HA 2RHGA 3M16A 2R14A 2DJLA 3VCRA 1NSJA 3PBWA 3LRMA 2HMCA 3ZWTA 2ISSA 1JUEA 1HO4A 1EB3A 3C2FA 4R33A 2CZEA 3GXNA 4BFAA 4HSOA 4O50A 1KA9F 1KLYA 3NQEA 2OJPA 3MUXA 3LHZA 5G1TA 1JJKA 3OEXA 1KTNA 3WK3A 2RDTA 4Z1BA 4OV9A 3IVUA 3O05A 4WZHA 3L0NA 3NQ8A 2NZLA 2TSYA 4TR9A 1DHPA 1YPIA 3LV6A 4HPJA 1EPXA 3P5ZA 2QAPA 3L2IA 4UR7A 3LXBA 1BEUA 1TSIA 3LX9A 4HHPA 4LVBA 1A50A 2QKFA 2C19A 1SZNA 4AHOA 3VKJA 4AHPA 3BLIA 3GAKA 1JUBA 3FS2A 1A5CA 1ONRA 4NNBA 2J24A 3TKFA 2YW4A 4RV8A
chains in the Genus database with same CATH superfamily
2VEKA 1GTEA 4AHQA 3G1RA 3TXVA 2PDXA 4GVGA 2QHAA 1J0JA 2OGYA 1YNPA 3W1NA 1UUQA 4N42A 1QHPA 4YTSA 1IR1A 3WMLA 4JDBA 3C0QA 1ZP3A 3G1AA 4UTUA 1A0DA 1XYLA 1KTBA 3WQ4A 2PDIA 2HPMA 4KEVA 1NM9A 3B8VA 4RDYA 5EKYA 1KWKA 4AD0A 2H3BA 1RALA 3CQIA 5CAKA 2ZZ2A 4MWAC 2QUNA 3F5LA 3CYVA 1AL8A 3S4TA 4O18A 1KV8A 2OZTA 5TAOA 4UTWC 4DWDA 4HK5A 2QCMA 3VNJA 3DFQA 4NJHA 5FAJA 1B31A 1F4HA 2CLPA 3RAOA 1RJRA 2PGRA 4A2RA 2CHRA 4K8HA 4LXFA 3W3OA 1GNXA 4FOUA 5EMMA 3CUJA 3K1GA 5GPRA 3WDRA 5F4XA 1ZBVA 4Z0JA 3QY8A 3KRUA 5D4YA 1KM0A 3WK1A 4WSHA 2JIWA 2P50A 1LRQA 4QAWA 3PBGA 4FLSA 2CXEA 3SUWA 4AY8A 5CPQA 2PZ0A 3W1LA 4C6EA 4NYYA 3MUAA 4GNVA 4W88A 3SCUA 2ZQ0A 3W7GA 1BLIA 4C5ZA 2DUZA 1B1YA 2WV8A 3WBWA 2GVJA 5CGQA 1QR7A 3SCOA 5C2CA 1UC5A 2VGFA 1X97A 4FEZA 1S5TA 4EACA 3B03A 3TN6A 3BG9A 1GEHA 1E72M 5GJMA 3H26A 3H2CA 6PTDA 4P8VA 4B4FA 1C92A 3QPYA 3UJSA 4D1JA 2XFWA 4HZ8A 3UEQA 2UWFA 1EIXA 1JZ2A 3W2UA 1J93A 3IUHA 1NP2A 1EXBA 4X3ZA 1XKYA 3LS9A 4MNKA 4MYXA 1WZLA 4M3PA 3UR5A 1Y65A 5BMXA 4MSSA 1VEOA 4PA8A 3CAVA 4UCGA 3SI9A 1DP0A 2Y7EA 4QP0A 1KRBC 3TSBA 3KP0A 4P61A 1SW7A 1UR9A 4B90A 3DG7A 5M5DA 1T40A 1A0CA 4IIEA 2DU2A 3II1A 3EPMA 3JZEA 1TVNA 1LQ2A 5ABTA 5T9BG 3ZVHA 4MZYA 3SY5A 3G8RA 1FCUA 1EXPA 3E2VA 4CQCA 3KOFA 3GVWA 1B57A 3APTA 2OX1A 4QDMA 3KBNA 2TMDA 4RZ5A 3EA1A 4DUXA 4LNYA 4MKNA 3PTDA 5HMSA 3GIYA 1PZ3A 3A9IA 3G1FA 2V2DA 5HULA 1VKFA 1WE5A 3MCMA 4L64A 3OQ8A 4L9ZA 1TVPA 3PZOA 2F2KA 2BOGX 2PUZA 1C90A 3DFHA 4XVEA 4OKDA 1E3ZA 3OBAA 5CSRA 2V5DA 3DFNA 1XYAA 1XH2A 3LERA 2GGJA 1YADA 2WKJA 4PMOA 1Q6FA 2PDGA 5C0QA 1B4EA 3SRDA 5EMKA 4AWEA 2J25A 2J77A 1AW5A 3PB2A 4I9TA 2VOMA 2D3NA 5FL1A 1GOXA 3NUKA 1RXOB 2W63A 2WSYA 2D0GA 3AIVA 4S3BA 1GPWA 1TQJA 1XIHA 4CD4A 3GNPA 1CB7B 2AMXA 2J7BA 4ZVJA 3K8LA 3N13A 2NUWA 3QF0A 3ARYA 3SUVA 2ZZ4A 5AYZA 2ISVA 4FNSA 1WBJA 3WIJA 3W2MA 5FI8A 3URNA 2OFJA 4JNZA 3C86A 5IHRA 4N6FA 2PMQA 3C2EA 2PWGA 4PBGA 1GVSA 4ZB0A 1W3KA 3IGSA 4B4HA 3RX3A 3UY8A 4DO4A 5RUBA 1H7RA 4L4OA 5CZSA 4HVXA 3QM3A 1GOQA 1EGZA 2ZRVA 1K4HA 4HBKA 4FX8A 1Y8BA 3OIXA 2J66A 1QUMA 4H8NA 1O5QA 2DZVA 3HZ3A 2JFEX 3SIZA 3AYVA 3WDJA 2IW0A 5AOUA 5C55A 3G1YA 1H1YA 1FVPA 4XZ9A 4NAFB 5KTLA 1OM0A 1ECEA 4IX2A 7ENLA 4C6KA 1TJPA 1W5OA 2OELA 5D30A 4YTQA 5A8QA 2CLLA 5I2UA 1WDWA 1EGMA 3KCJA 1W3NA 3UJ2A 4IFOA 4OBSA 2BODX 1XLIA 2YBUA 2X0HA 1YXCA 3HO8A 3KBSA 4NXSA 4W89A 3U57A 1M7JA 1R85A 1P7TB 1AZ1A 4QG9A 3PY2A 3LSBA 1XLHA 1F5ZA 4X60A 1BWKA 1F73A 3CTLA 4JEQA 3A3WA 1UR0A 1NIUA 4BF7A 1MRQA 3G1HA 5FJUA 2PLJA 4HJFA 3KVLA 4Y2WA 4BWLA 2WSRA 3SGGA 1EHAA 4B5TA 3SUTA 1H1NA 3WJYA 4B5NA 3BC9A 3BOFA 1U2YA 1B54A 2G97A 4AUBA 1YIXA 3BURA 3JZUA 5D02A 1XBVA 4GI9A 1U5HA 5G1MA 4PH6A 3TQPA 2NVAA 2Q3RA 1Q85A 2VR4A 4UQEA 4NZCA 3HIJA 2VFDA 3KVKA 7PTDA 1QNPA 1DJXA 1AMKA 4Q4RA 1OX4A 1JPMA 5IOBA 4B2DD 4PUMA 4JIHA 3OZYA 3FJ6A 3PJXA 2PFHA 1US0A 1T0OA 4KPLA 1ZP4A 4YMZA 2CLIA 5A6AA 4DJED 1SSDA 1Z32X 4LJ3A 4KESA 3BMXA 2NXIA 1GQJA 3SN0A 3W1AA 3DFTA 4JKMA 1V7AA 1WKFA 4M82A 4QJ3B 3VTRA 4PTVA 5M1TA 3M0LA 3M4HA 4MHBA 1U5VA 1NFBA 3V7PA 4RKAA 4Z08A 1K7XA 4KMQA 4DXXA 2NQJA 4E2DA 4Z1AA 1OK6A 3TJIA 2Y61A 4B3LA 5XIAA 4UWMA 4BQ4A 5M3WA 3GXTA 4WDWA 4CN1A 1BG9A 1I60A 1MXDA 2VKZG 3WBYA 3WD0A 5U4NA 3GLCA 4GZEA 4JHMA 4H6QA 5HWJA 2HDJA 3N73A 3KS5A 4B91A 2PLCA 1OD0A 3WNPA 3B0PA 2JEPA 1V6WA 2V63A 4PCFA 2B7PA 3H6OA 3W1XA 3CAKA 5FEZA 4XWUA 3KAOA 3WLQA 4GIRA 1XLJA 1JYVA 1S3TC 4CQBA 1Q6RA 4ACZB 3N2OA 1J9YA 2XVPA 4XAYA 3SUUA 2WPGA 5A8OA 2ZDSA 5HJLA 2VDIA 4XO6A 3AMCA 1E0WA 3FGCB 3WQFA 3V35A 3OBEA 2VFHA 1GT8A 4DQWA 4I6KA 1RPKA 2TPSA 3EDDA 3WMBA 1XLAA 2FJUB 4JTTA 1W1TA 4LUIA 3MBFA 4ACYA 3PULA 1K8ZA 3V4BA 5AECA 1YKWA 3BLFA 5DT5A 4ZSUA 2YDSA 2INZA 1M5WA 5DXXA 2YXOA 1FQ0A 1NDWA 2AQWA 4QISA 4ES4A 2J74A 2LLEA 1XIMA 2E5CA 1RP8A 7ODCA 3WNMA 1NDZA 1NFPA 3D46A 1C91A 1NP0A 4CN4A 3ZR5A 3IUDA 1R3QA 5FF2A 3UJRA 4O10A 3UZYA 2FMNA 2CBUA 3ME3A 4RJEA 4JNYA 3NL3A 4FNRA 1V4YA 3NQVA 3SJNA 4Z2IA 5LYRA 1JD7A 5CPLA 2OCZA 4HKPA 4R34A 4NILA 1GYNA 3U7VA 7REQA 3LPOA 5HQMA 2ODOA 3AUJA 3VZXA 3AU6A 2WC7A 4H9YA 3W7HA 1ELSA 2HISA 3D5HA 1JDCA 4Z1DA 3APYA 3DYMA 3DAQA 5G4WA 1XSIA 1A5NC 4GYPC 1DJGA 3LDVA 4M56A 4MKSA 3UQNA 1ZJHA 5DFAA 3Q37A 4CU8A 4IT1A 3BV7A 2RDXA 3EOSA 1Q8JA 1KFBA 2W4XA 3U6WA 3E6EA 5DO8A 3E2RA 4F0SA 2R8WA 3N6HA 4CD7A 3N9RA 3CIXA 1UR4A 1P48A 1WKYA 3ABOA 4LYRA 3RRXA 2WYSA 1NELA 1XYMA 1V03A 1OT1A 3AFBA 3QR1A 2E68A 5D2VA 4U3AA 1FHUA 1JRCA 2Y1HA 3TXZA 3VGEA 3BGAA 3NQFA 3WF3A 2VX7A 3GNOA 4FLRA 4JDYA 4KCTA 4O54A 5BMWA 4OHQA 5A6LA 1LP6A 1HVXA 2CU0A 3VOFA 3GXMA 3TYEA 3BG5A 2R94A 5FF4A 3TA6A 3T2PA 3DUGA 5AY7A 1XYBA 2VQTA 4FOJA 2REQA 1W54A 1W5NA 1MW0A 3MJMA 1HFBA 1E0VA 5C9RA 3QKZA 4S38A 1TIWA 3AYSA 3CBWA 5E9XA 1MW2A 1KV5A 3CWNA 4WX2A 2EPHA 3WD1A 1H0GA 4LAZA 1JYNA 4W8AA 2RDUA 4NXKA 4WSJA 4B5UA 1SO4A 4IOTA 3RJXA 5DMNA 1PE1A 1XS2A 3KLLA 1AD1A 3S9ZA 3O63A 3B9DA 2FZMA 1A5AA 4GKTA 5H8MA 1V7YA 4CQ9A 1X8CA 2QCCA 3M5XA 5D2WA 2C79A 3M7SA 3KXQA 1D8WA 1WO2A 4H3DA 2BXZA 1ISVA 3CHDA 4HA0A 4WJEA 1S2UA 1CXEA 3LCHA 2R1PA 5ECUA 3H2NA 3H4WA 1K9DA 5A1AA 2OX4A 5EMLA 4WKHA 3S5OA 3WN6A 2OXNA 4D6HA 1RCOB 4QAIA 1UJPA 1E9LA 1A4LA 2VZUA 3RG6A 1Z8AA 2ZA2A 4HA4A 1H5VA 1XFBA 2OB3A 1T96A 3CL8A 1L6FA 4A29A 4LS1A 1XI3A 1FFQA 3MHUA 3SW6A 2W66A 3ITGA 2ZC8A 5BXSA 4NX5A 2ACRA 2GVYA 1UKPA 1UOKA 4OU1A 3IAPA 1GORA 4K7YA 3NVTA 2EJ1A 2QJIA 2WHLA 1R3RA 1A4MA 4I3GA 3MUCA 2HZGA 3M5ZA 1DKWA 2IXUA 3MUZ1 2FMOA 1S3HA 1QJWA 1UBPC 3T9PA 3M0YA 1A3WA 1AW1A 4L7ZA 4C6OA 2QCHA 4IGNA 4S2BA 2VEPA 4PCTA 4S3JA 3C2OA 3P84A 4K68A 4OWGA 5I3DA 3C4UA 3QC3A 2CHNA 1D2KA 1PKMA 1U83A 1PPIA 2WHMA 3MP4A 2A4AA 3E02A 5T91A 1SR9A 2IKHA 1Y5WA 4IISA 2J7DA 4MOZA 3ONBA 5I3KA 4LH8A 2ZUWA 2ZA3A 3T7VA 5A2BA 4A35A 4AU0A 2PP1A 2ZWZA 1V3LA 3CPGA 3RPDA 1FWNA 1XSJA 3W23A 2PA6A 1EBHA 1WUEA 2DT3A 4C1LA 1HXJA 4MVAA 1UUOA 3DFSA 4MTVA 1JIBA 1TPDA 2YPIA 3W07A 1UCWA 1BXNA 2PC4A 4NZJA 3UCDA 2G4JA 2Y88A 3ENLA 1H61A 1E6RA 1QU4A 1WAWA 2QDHA 4AEOA 2F61A 3S2NA 3I10A 3RO8A 1VLIA 3EX2A 3R94A 1N2VA 2ATSA 3E12A 3W7LA 4D71A 1PX8A 3CHFA 3CWOX 3CJPA 1H09A 2PDHA 3CMJA 4IMGA 4Z1CA 4I5XA 4IMCA 4A8NA 3S42A 3GBEA 2OGJA 5AFDA 4HCLA 1JCLA 4P2VA 4O0ZA 1GW9A 1S46A 4YHEA 3ISIX 3DOPA 4U10A 1JXKA 1Q6LA 4WJ8A 3MDWA 3ZO9A 3WK2A 3CU2A 2V38A 3F4DA 1HKVA 4R5EA 2VHLA 3A3HA 3WDHA 3UWEA 1LRNA 4HPHA 5FL0A 4V1XA 1TX2A 3NPVA 2ZXQA 2YR1A 3SCRA 1DIKA 2PTZA 3VMOA 1FWWA 4LAMA 2XGIA 3IJ9A 3S1UA 1ZY9A 2V2CA 4F2BA 3W84A 3AZSA 1F4AA 4ATLA 3T2QA 5AYYA 3WJSA 4QTGA 4WKFA 4KKXA 1VEPA 3V5CA 3OP2A 3LB0A 1IF2A 3ARZA 2CC0A 2QNEA 1S1RA 4KGJA 4ZQNA 3W7CA 5K3VA 4JZ5A 1CXHA 4JKKA 5DXYA 3ABXA 3KRZA 1K9FA 1PTGA 4F2UA 1IEQA 3AALA 4GUJA 4UZSA 3MZNA 4ZFMA 4E8DA 1SO5A 4B2DA 4QLJA 3HURA 2QCDA 4QS5A 2WMGA 3R43A 3WH5A 3B0UX 1EDTA 3F4CA 3AJXA 4U5KA 5I3GA 2C71A 2BX7A 3VOJA 3RCNA 2ZDRA 8XIMA 1J12A 2E28A 4KEMA 1MDLA 4C90A 3UGVA 1LT8A 2X2YA 5CG7A 3ITTA 2VTFA 5K2ZA 3H21A 3GKAA 1A5UA 1SZFA 1R9YA 3TCEA 4L4LA 4H2HA 3DG6A 1N82A 3PZ9A 2I9EA 2Z28A 3WKZA 3D47A 2P5NA 3EX4A 3KTXA 1JI2A 5FESA 1O6IA 1IT0A 1K77A 4LUSB 1H7XA 1XYZA 4O16A 4S3GA 4CNSA 4ZXLA 2FQIA 4ZSTA 2UZ9A 5FF0A 1KFCA 2X1IA 1MI3A 3B0YA 4D1IA 4WD0A 3LHUA 2DVTA 2NWSA 5AVHA 4GZIA 1T6MA 1XDJA 2Y8VA 3INPA 1UC4A 4DZIA 4EVZA 3M0VA 4LUYA 1RAKA 4E4FA 3SCQA 3RUBL 1LBLA 4JQ1A 1HVQA 5LA0A 2PDJA 1DYSA 3QGKC 1MDRA 4AQLA 1W9BM 1UZHA 2C7FA 2GOUA 4HYRA 1AK5A 4O57A 1QNVA 3DGRA 2C16A 2VENA 4D8LA 2PU0A 1YDYA 2G5WA 4FNUA 1HL2A 4FNPA 4J3XA 3VKBA 4PUNA 5K9XA 3EGJA 4FSAA 5HBFA 1DWAM 3LHTA 3BGGA 4L61A 2PF8A 2V68A 3VIHA 3TAOA 3DN5A 3VINA 4XUGA 3LHVA 2GSEA 4BF9A 1B90A 4GJ1A 2HV5A 1FHDA 4WY0B 3MJYA 1ZLPA 2PCEA 2FDMA 3VDBA 4AB4A 1TJRA 1PTAA 4UFHA 3STCA 4UR8A 1NH6A 1BXBA 2X7VA 1W37A 2BHZA 3KM8A 1DBTA 3RK8A 5ABEA 4AZBA 3CH0A 3LY0A 3LQLA 5M2FX 3E96A 2XTKA 4AWUA 1EA9C 1PB0A 1EL3A 2V3DA 2W9MA 1QW8A 2YL9A 1I0DA 2E6DA 4L9YA 3PNZA 1F6YA 3WQEA 2V67A 3BW3A 4JNMA 2QCGA 3L9CA 4QG6A 2EG7A 4HK7A 4GGHA 4G2DA 3PJWA 4KWOA 3IWPA 3UR2A 4C60A 4JFWA 4C6FA 3EOLA 2V2HA 3BLOA 1XBYA 4NX0A 3VVGA 1AUSL 2JF7A 4MWAE 1T41A 1SMDA 2Y7GA 4IIHA 3W88A 4LU0A 2Z2UA 4Z17A 3QW3A 3QQ1A 3VA8A 4FP1A 4CQ8A 2IXVA 4S3AA 3YPIA 1F7BA 4I5RA 5IHSA 3KHDA 2HEJA 4CN6A 4JQ4A 3BCFA 1TPB1 2NQZA 2ZX9A 3W72A 3FGCA 4PTXA 4NY2A 3LPPA 1JZ8A 4LPCA 1ODUA 3EDJA 2PDKA 3IANA 3AHXA 4GUIA 2FGBA 3R5EA 1VJZA 5I3JA 1EF2A 3KS6A 4UQAA 3W24A 4V1YA 1U1UA 1BVZA 4RXFA 5I78A 4ML9A 3UBPC 4QM1A 1SMAA 4AISA 1ZL1A 2ZUMA 3B0XA 4AY1A 3BQ6A 1XG4A 3QLDA 3NL5A 2X0SA 4GABA 1QPOA 1VHNA 3LCGA 2YKKA 4Q6XA 4AW7A 3IJLA 3LHWA 1SFLA 4XTIA 3T81A 3B8WA 3DFPA 3H8AA 3PSVA 3G1XA 1UHVA 2VC9A 3NYZA 2Z25A 4DZHA 1LLOA 1J11A 2YDQA 4UFLA 4YTTA 1PX4A 3HMCA 3TWAA 2QF7A 3E0IA 3SUSA 1LCOA 3ORWA 4HIBA 4IIDA 1DEDA 2X41A 4Z42C 4WDXA 4FXSA 1TREA 1K8XA 5LHEA 4LGXA 4G8TA 1DJNA 3I3DA 3PM6A 2VRKA 5BYWA 1O1ZA 5HPOA 2CYGA 3EXTA 3D6NA 5A8PA 4GG9A 4L9XA 3LI1A 1PDZA 2PDFA 2X05A 4OGZA 4DJFC 3UA4A 4I9MA 2BDQA 4AVFA 3MZ2A 2VNCA 3GNDA 1NQ6A 1XHGA 3NJ3A 4QG8A 1VFTA 2X8RA 4MYAA 1FOBA 1UKTA 1FCQA 1XINA 3GR4A 4YIWA 2P76A 3WDPP 5KSWA 3W85A 1ZTVA 5D2TA 2VI0A 2V69A 3N14A 4XAPA 2FPTA 4U4MA 3N15A 5REQB 1UR3M 4GQ0A 2VCCA 3KWSA 3AS2A 1FWIC 2B7NA 1PHQA 3KOYA 5H6HA 2Q02A 1OZMA 3FJLA 3MCOA 5E6ZA 3CO4A 5I09A 4Q4MA 3K30A 3F2DA 2F8QA 5H8UA 2OPJA 3IIVA 1A5OC 3UXIA 3M0MA 1F3XA 5DX7A 3LBMA 1UJQA 3PJUA 6ALDA 2YA1A 4US5D 1I2QA 2AL2A 2I16A 1GWJA 1FH8A 4JTRA 2NUYA 4BHYA 1C3FA 4Q8MA 4IQEA 2XSBA 3AIUA 2DSKA 2BHYA 4ROPA 3M46A 2VRQA 3S46A 4DUVA 4M7TA 4NZFA 3LHYA 4O11A 2G4FA 4I5UA 1GVRA 3LYEA 2QV4A 3B9EA 1TE1A 3ZVHB 2REQB 4XD3A 4MWAD 1S5NA 2V5BA 1UQYA 4K8GA 1Q7MA 3NQ7A 2OVLA 4WDUA 3QY7A 1BRLB 3N18A 4JTLA 3S1GA 1KM2A 2GFTA 1GVQA 3TYZA 3EWYA 4A3HA 4JKLA 3VKKA 4IG2A 4AD2A 4O12A 2VFEA 3RLUA 2W91A 2BGSA 3TUUA 4FLOA 2Z2AA 4ZA0A 3WFZA 1QI3A 1E9ZB 3TAKA 4OZOA 4LVFA 1N8WA 2VEMA 3WY1A 5BW6A 3QZEA 4LYPA 6A3HA 3UFYA 3E74A 2Y24A 1AZ2A 3VIPA 4CNNA 1OFPA 1V5XA 3S83A 3K13A 4AYSA 1ODZA 3RPMA 1BPLB 4R9OA 2HQAA 4KFPA 3ARSA 3FX4A 1E4NA 1FH7A 5A6SA 1E6XM 1JPHA 1W91A 4WOQA 1DXEA 2FTPA 4UCFA 1OB0A 5EPDA 6REQB 1SJDA 1E1FA 1GG0A 4MNJA 1JPIA 1EJWC 1KCLA 3WLLA 2OT1A 9RUBA 2JGQA 2EKCA 3RU8X 3BJSA 3GNNA 5C7VA 3NSNA 2WNNA 1LG2A 2I14A 1HX0A 2WC4A 2BG5A 3N25A 4JTDA 4GZJA 2JE8A 4LS0A 5G2WA 3GHUA 5LIUX 3W53A 1OCNA 2RHGA 3M16A 2DJLA 3AHTA 3CUXA 3HQPA 1UZDA 2E9LA 3M0KA 4BFAA 1KA9F 3OEXA 4YS1A 4OV9A 1MXGA 4WZHA 3W00A 3GFYA 1XFCA 2TSYA 5E5CA 1YPIA 4HPJA 2NQLA 3P5ZA 1UH3A 2AMGA 1QW7A 3W6MA 1JCTA 3LXBA 1UR1A 4GCXA 4QLKA 5DQPA 3NZPA 2QKFA 5CSUA 3WEOA 4AHOA 3LMZA 1DIDA 4CD5A 1ONRA 2J24A 3TKFA 3RITA 3B8SA 4XKMA 2FVLA 3KDOA 3KW3A 3VIJA 1O4UA 2PDYA 1QPNA 3FFSA 4QNWA 4JYFA 3JU2A 3TLLA 5EL1A 2DV0A 2QJNA 4AC7C 3L4VA 1BTMA 1OD8A 3P14A 1S1PA 2OYKA 3O0FA 1IGSA 4JYEA 5D2YA 3PWIA 5JBDA 1DWGM 2CBVA 5AC7A 1CGWA 1YX1A 1O1HA 1DWIM 4JCLA 3L2MA 1EYEA 5ABFA 2CLMA 1XLFA 1MFVA 2VXNA 1E0XA 1YBQB 2QCFA 3BANA 3UXAA 3FHQA 1FBAA 1V3HA 1UWAA 4HOWA 3OPSA 2A6NA 3CZJA 3EWWA 1G5AA 3SQLA 4YL2A 5G4HC 3OW1A 3I3BA 1EJ7L 4Q4SA 2PGEA 1N7KA 1OYAA 4LSBA 4XISA 3EXRA 4D6EA 3BCDA 4IMAA 4IIBA 3KBJA 5TQLA 4PUDA 3EB4A 1IEWA 3GHTA 1HTIA 1E5JA 4IXXA 1VFMA 3EMZA 4N9EA 1TZZA 3P3BA 4WVXA 3O0KA 4HOZA 3UGRA 2WHKA 3C2RA 4Q4OA 2ALRA 3SRHA 2AAAA 4JFTA 3EDKA 3L12A 5D09A 3T0BA 3C56A 3AU2A 1WQ5A 3PHAA 1ZBWA 4IQDA 4C6IA 4S39A 4GNKB 2DY3A 3GKFA 2E3ZA 1TZ7A 2ANUA 4X22A 3WUEA 2W61A 3SEPA 4AIBA 1MNSA 3GE7A 2Q09A 4NIRA 3I6EA 4J40A 3IGXA 3W27A 3LPFA 3VGBA 1HQTA 2PS2A 4NSBA 3M6DA 5I77A 1DTNA 3UP8A 1ZB5A 3OVRA 1JYWA 1JF5A 3ITLA 5F1VA 4CEUC 1CWYA 1W1VA 4O28A 3W01A 1HKIA 1VC4A 2NVCA 3WNLA 2EXOA 4G9PA 1OFAA 2OEJA 4DNHA 3IUIA 3L23A 1F8IA 1MUCA 4EWJA 2J9YA 3MMWA 3PTKA 4MKVA 4IG2B 2I5QA 4UNLA 4WLCA 1OGGA 3FEMA 3PFRA 4N9CA 3E49A 1L6GA 3I4KA 4L4PA 4MF4A 3AWOA 5G2IA 2PDUA 2VOTA 1TELA 3A4XA 2A21A 4H83A 1BQGA 2IPFA 1CYGA 3EPNA 4FX7A 1ME9A 5F4SA 3VE7A 2X40A 1CXLA 4BQ2A 3O3RA 3EYPA 3STEA 3GTIA 3DKJA 1XDMA 1BWLA 1X6NA 1XBXA 2JQXA 4Q8NA 2OZ3A 5JH1A 2BZNA 4Q8TA 3LD5A 4NZ5A 1Z41A 4OE7A 1I1XA 1XIDA 1E1EA 4K38A 1EPVA 2JK2A 4JIQA 5PTDA 1KM6A 4PGLA 1NVMA 4FF5A 3OVQA 4JFUA 3ERPA 4NUWA 1AJZA 1A5MC 5CEWA 4YN5A 4MZ8A 3ZJ8A 4ZB5A 4ZQRA 4RDWA 1ZAHA 1S38A 4HNVA 2NT0A 3VNMA 4MY8A 1OYBA 3ZFHA 5HMDA 3FHAA 5HXMA 3NL2A 3VIFA 1K1DA 1W1YA 3KHJA 4IM4A 3CL6A 1PSCA 4AY7A 5EFFA 1U22A 3AC0A 3MP3A 5I03A 3GO2A 4Q8VA 1XR2A 3ANUA 4DAFA 3WG6A 5CC5A 5BRPA 2ZZ7A 4KWUA 3UVIA 1R6WA 1P5BA 3RF9A 4MG4A 3ZLFA 2VZVA 3KTCA 4B16A 4K3ZA 4I90A 1HG3A 1WDSA 4Y9MA 4OBRA 2INFA 4PODA 1JEZA 1EO5A 4IHCA 2OWCA 2GJRA 4TVUA 1X7IA 2RAGA 5D32A 1V0NA 2XJ7A 2WANA 3VE9A 2VDGA 5FF7A 4HYVA 3HQ1A 1FWAC 2Z7KA 1TTIA 1W8SA 2HS6A 3G1DA 1SYTA 4J5NA 3QGAC 5A5WA 3VIMA 1ZRQA 4GZ7A 3WCZA 2PSNA 2NX9A 3WMSA 3FXYA 3V0SA 2R1MA 5HWMA 1BYDA 3VGFA 2HXUA 4I7WA 4FB7A 1K9TA 3NA8A 3DHDA 3R8GA 3KVJA 1OF6A 2X09A 3M1ZA 2ZX6A 4GA8A 3B4UA 2ZRUA 3WF1A 4G56A 4Z2HA 4EIVA 2RFGA 4CNUA 2H3DA 3BLDA 4GUHA 1JRBA 1TRIA 3SADA 2E8ZA 5E70A 4LC6A 2G3JA 2PCQA 3ZQ9A 1HKWA 1YBQA 4GXMA 3NXFA 3FK4A 4IGSA 3UZZA 2F7FA 3EOUA 1VF8A 3GX9A 1R8LA 1W2PA 2E0PA 1P0BA 2UV8G 1JAKA 4PMRA 1UWSA 1Y0EA 1GKQA 2VD8A 2J27A 3ZLHA 2GJLA 2I17A 3VILA 1OY0A 3IV8A 1I4NA 4O52A 1F07A 4D6IA 4BS0A 4H41A 2DSVA 7TAAA 4AMAA 1W1PA 1DQXA 1TG7A 3NURA 1FHLA 2CXGA 2E77A 1OINA 3GDKA 2Y7FA 1REQB 4ZO9A 1KBLA 2OYMA 3CTTA 4OOZA 2VJXA 4I8YA 3SDOA 4Z2KA 2QMJA 2Z1KA 1LJYA 1OCQA 4ZQOA 2YFOA 3GXFA 1DHKA 4GWEA 1B0IA 5CPOA 3UWWA 4IJRA 4ZE5A 5AYXA 4LB4A 2PWDA 3GK0A 3NPWA 5LA1A 2E40A 1R3SA 4DXVA 2D1ZA 4JTGA 3N2BA 3KOWA 4R3UA 2GLKA 2PBGA 1WOAA 3MBDA 2HVOA 3STPA 2YIHA 4CCEA 4HNOA 3IGUA 3GHSA 5I02A 2MANA 5MKGA 4ALDA 1LDCA 2CNCA 3NGJA 3W02A 2ZTKA 5KZMA 3R2GA 3MMUA 3R0DA 3BSHA 1V3KA 2PZNA 2XFFA 2EKGA 1P0KA 5JBFA 1PZ2A 4CU7A 4IF2A 1EIBA 3GIQA 2W62A 4C7DA 4FLQA 1WUFA 2ZUTA 4EOUA 3IEBA 2GSHA 3PUDA 5CC3A 5D8WA 2QR6A 9XIMA 2EPMX 1XCFA 1JCJA 1TIMA 3CB3A 2WMIA 4U2ZA 3O2LA 4BI5A 2Y62A 1TA3B 5JQ9A 2XH4A 2E9BA 3P61A 1T7LA 5DY3A 3FY1A 3RRAA 2QCLA 2C18A 3WQWA 2H90A 4P8XA 3TC6A 1WXYA 1W32A 1YW1A 2AKZA 3ATYA 1OC7A 4M29A 3IAQA 1KBBA 3I65A 3RLGA 1VHCA 4ERIA 5AC5A 5IBXA 1MW1A 1K7EA 2W79A 3UJEA 3WQPA 4DZAA 4JOMA 4XG1A 4MB3A 4GQGA 4I8DA 1R0MA 3EWZA 4GGBA 2Q8LA 3MSYA 4K8EA 3CZGA 1W3TA 3KOXA 3PFMA 2XFYA 2PWUA 1C8XA 2P53A 3HU7A 4FA3A 4DO5A 4C1KA 3CQJA 2J88A 1Q7QA 3T6CA 4YCOA 3IIXA 1OFEA 3R11A 5AHMA 3ARQA 2JBMA 1NWSA 4GO8A 1GONA 1SU5A 1MEHA 1D3CA 1WYIA 3B8TA 1VCGA 3GTFA 3QJAA 4HA3A 3SQMA 2EG8A 4GRSA 4J7RA 1UIPA 3AIBA 3UG4A 1TE6A 3NG3A 1QWGA 4HMDA 3NOEA 2A3AA 3MWAA 1TQXA 5CJMA 3EBVA 4X2PA 5CPMA 2RKXA 3AUOA 1Q4NX 3GH7A 1SUXA 4N7QA 4Y9PA 3RM8A 4JN8A 1QRQA 2PTWA 5U7SA 3SR7A 4N0RA 3THDA 3G3MA 4MB5A 2BOFX 3SY1A 4MNMA 3G6MA 1I2PA 3VIKA 2J79A 2QPUA 1QI2A 3J7HA 3RR1A 2ZRXA 1E6QM 1ISYA 2YCLA 4PEKA 2HNHA 1VPXA 2OR2A 4OIFA 4GACA 4NKCA 1OFDA 2NX3A 2YGYA 1E1CA 2NXHA 1H7PA 1ISZA 3RO6A 3OODA 1QI0A 1YLVA 2QDGA 3OIHA 4UFIA 4GVFA 4F48A 1TUFA 3R8RA 4FZIA 2Z1XA 4LUTA 4CGTA 1TPFA 4X63A 2O4MA 1XLKA 2VZSA 2QUUA 1KXHA 4UTTC 5DELA 3VOGA 1E0UA 2PGWA 2PDBA 3S5SA 3VDAA 2TAAA 1XLBA 4UTTA 3R0KA 4DM1A 3D3FA 4HNUA 1W5PA 3G3DA 4UTWA 3TZNA 4J3WA 1DXFA 2WJDA 3DI0A 4AX7A 4DF2A 1C7SA 2QJGA 4DYKA 3EX6A 1CECA 3VCCA 2VO5A 2PD5A 2D2JA 2ZRZA 5ABGA 2EPKX 1WPCA 1FP9A 2XIOA 1TJ1A 3GZAA 4IMEA 2VGIA 2YA0A 3AISA 1VYRA 5JIWA 1AA1B 1R46A 4MJZA 2YYTA 2I7GA 1FWJC 1UASA 2VFIA 5I5RA 1KM4A 4CQDA 3UWVA 3K2GA 3N6JA 2XHYA 3KFTA 3WDIA 1AG1O 3BPWA 5EBUA 3KCOA 1JXJA 2QUMA 1ZAJA 4D72A 4Q4KA 1VPQA 4ONVA 1QDSA 1QTWA 2YB4A 2E6AA 1OABA 3A24A 3LGGA 2CIPA 3VUSA 4QEHA 1D7KA 1KGUA 3QV6A 4AZIA 1E6SM 2Y5JA 2CITA 4Q32A 4H9MA 4N9BA 3A13A 1UZ4A 1VFLA 1LG1A 2J75A 4DF0A 1LZOA 4LW7A 3UXLA 6CGTA 4TV6A 4BEQA 1TMHA 4G7EB 4ZE4A 2GJXB 2J4GA 5AC6A 3VOHA 5HWNA 3TMQA 5DT7A 1H11A 3I6RA 4LV9A 1FP8A 3MWCA 1TB3A 3NPUA 4BF5A 1NDVA 1JGMA 2SFPA 3DKLA 1LTDA 1YDNA 3WD4A 1UW9A 2JKPA 3ARRA 1Q5MA 4UQCA 3TTEA 4LUJA 5A69A 3TTQA 2E09A 1MVYA 1H62A 4W8BA 2BGNE 1X1NA 2V3EA 4QJ4B 4DWSB 2G50A 3ZR4A 2GQ3A 1OG0A 3HOJA 3TU9A 3CUZA 1G0CA 1VJSA 2GQ9A 3MDUA 3M0XA 5A2AA 1PKNA 5K9CA 5HNRA 3MI3A 1FXPA 1F6KA 3CUGA 3VDGA 1VJIA 4JX6A 1V8EA 3TZFA 3REQB 1JZ4A 1M7PA 3TYBA 3HPSA 1E6PA 1BQCA 1J18A 4TTGA 2FFCA 1XW8A 1FKWA 1HJSA 1V6YA 4O1BA 5I3HA 1RP9A 2D3LA 2IS7A 1CGVA 1KW1A 3TN3A 3FLUA 4J3ZA 1JQVA 3OHIA 1I9CB 3W1QA 5FJIA 1VCFA 3JVAA 3M5VA 4GJJA 3VD5A 1AQ0A 2E5BA 1XLEA 4OQVA 3N29A 4YPJA 3FDGA 4QIUA 4ILSA 5G4EA 2DJXA 3AS3A 3VDCA 3PG8A 3VABA 4GX8A 4JFVA 4LEFA 4HPXA 1M1BA 2WK2A 2Z26A 3OYZA 4AZCB 3ZWSA 1WKEA 4HNCA 1PL9A 3HPZA 3WMCA 5A6MA 2Y8KA 2CLOA 3CLWA 2EJAA 2FB3A 3G1VA 4G5DA 1EQCA 1X98A 5D8ZA 2GGIA 4F0HA 3VKCA 1GPFA 1S2TA 1AQHA 3HB9A 3CZEA 1OBAA 3V1PA 1MMFA 4F9JA 5AKQA 1GHSA 3JUGA 2WCGA 2QDDA 4N2YA 4QROA 2WKLA 4HOXA 4DBEA 4GLEA 1XIBA 3O15A 1H3GA 4H7VA 2GVEA 3R1ZA 1NY1A 1A5LC 1FXQA 1L6SA 3WF2A 2XIQA 1GOKA 2J9ZA 1D9EA 1TPUA 1UH4A 2P8CA 1QATA 1S5WA 3PK7A 4M6VA 1VLWA 2B7OA 3GB6A 4B5XA 2YOCA 5F7UA 3WH9A 3F7JA 2WMIB 3W81A 4O0QA 4GI8A 2FZ9A 3FSUA 3W0KA 1GJWA 1W3LA 5D05A 2O4QA 1V93A 4ZMGA 1N8IA 4KCWA 1Z9AA 5KZ6A 4HTBA 3TK7A 3IGHX 4DHGA 4D6GA 3SAZA 1Z42A 4JHZA 4FIRA 1CXFA 2DEPA 3FVMA 3NVDA 3PWGA 1FCBA 1HJVA 4V2XA 2PDCA 2Z1VA 5GQBA 2ONEA 1FFRA 1HF6A 4PTWA 2XIIA 1K8CA 1VENA 4NHVA 2PURA 3W75A 2FKPA 5AHLA 3W7IA 1UZ1A 4HU8A 1XC6A 1V0MA 2VEIA 4K39A 3VC5A 4YLWA 4DYJA 4NJIA 4S2CA 4AZHA 3PB0A 4HP5A 1LBMA 1PKYA 3G0XA 1SQ7A 1YTEA 4O14A 4I7VA 3A4AA 5H91A 4YYFA 4BCEA 2CLKA 2VURA 2DT0A 4TX8A 4GVHA 1MEWA 3LBOA 3AOFA 4DBWA 2HK0A 4IP7A 3IACA 2X0YA 1W0MA 1WKDA 1WDQA 2WBKA 1L6WA 1AH3A 2E25A 3HPXA 3GIPA 2Y85A 4PBFA 1XSKA 3C0LA 2V8ZA 1T8QA 3WLMA 4GFSA 3E2QA 4O4VA 5DCBA 3TTOA 4NYUA 4UBPC 4S3FA 4ML4A 3UXDA 3MHGA 2Z29A 1GVEA 3WD2A 1UR2A 2C15A 1H63A 1Q6EA 1HL8A 1JVNA 1XUZA 3CH9A 3GY1A 3W1PA 1VEMA 1U33A 1X7FA 4GYJA 4XUYA 3AMGA 2J8FA 5EBAA 1EJTC 1PZ0A 1ONWA 4M1RA 1WB0A 4H19A 4W87A 2X7WA 2BFGA 1ECQA 1M7XA 3PR2A 2NV1A 3BCJA 3VNYA 1PO9A 4J3UA 1Q8AA 4LY4A 4AIEA 1JZ3A 3QR0A 1LQAA 4IL0A 5A94A 1C9WA 4U2YA 1IWAA 4JY9A 4JX4A 1YMYA 3MV01 3M0ZA 2ZVRA 3UF9A 2Y6ZA 4DEFA 1ZNNA 5MF5A 3N3MA 4HN4A 3TLQA 4XBJA 2G0WA 2XSAA 4D6FA 1H5YA 1V02E 4JL1A 3MY9A 1DXIA 1XLCA 3SECA 5J5DA 4ACZA 1THFD 3NSXA 1AQMA 5CH9A 2HK1A 2WCAA 4POCA 3W2JA 3O06A 1UQZA 3MPGA 9CGTA 3GM8A 1JNEA 2YL6A 3PZMA 3CUHA 5FSEC 1HGWA 3A22A 4LOCA 1XRSA 4B3ZA 5T8GA 2WMFA 3BAKA 3KZSA 1KLZA 3ITVA 4ZXOA 2XDFA 3U2OA 2HVMA 3ZMRA 3WUGA 2VC5A 3OJGA 1F61A 2Q01A 2GVLA 2J9XA 4REQB 4R27A 2NXGA 4M1BA 4QRNA 2OLHA 4QBXA 3P8JA 1L6YA 1Z6KA 3SGZA 4JTSA 1M6JA 1R3WA 4W4QA 3BH4A 3DBPA 3TCSA 3T44A 4GMEA 3CZLA 3JW7A 4CEXC 4Q3MA 1H2JA 4D8AA 3UYIA 1J5TA 4J3TA 2QGHA 3BG3A 6ENLA 1OEPA 1ICSA 2FPVA 2VX4A 3TW6A 4PEEA 2WLYA 3T07A 3C52A 2FH8A 3G77A 1B3YA 1FHVA 3RXZA 3MHFA 3CS2A 3Q94A 4E4PA 3VNDA 3NEVA 4GC3A 2EPOA 3TSDA 1KGWA 2ZXAA 1WOBA 5KZDA 2QUTA 2O9TA 4WIWA 2UY2A 4YJ5A 3LCXA 4ZBCA 2D69A 4EK7A 4KRUA 3LMYA 1RLDA 3G24A 3C61A 4GH1A 1P6CA 1D7FA 3TQVA 3OZPA 3HJZA 5BNKA 3MSRA 1W9XA 3VMNA 2XSXA 2Z2BA 2ESCA 3GDMA 3GQYA 3WH8A 1VFSA 5AHEA 3FYOA 3ES8A 3UZJA 3U9IA 2AGTA 2RGLA 2GVGA 3W71A 3AAMA 4F79A 3AIEA 4J9JA 5C8BB 3L5AA 3STFA 1CW2A 2QPSA 4X0VA 1QBAA 4TTUA 3L67A 4FXRA 2BOEX 2JF6A 5HQEA 5DF0A 3L0KA 5HNTA 3GRIA 3RX2A 5LIXX 1UWTA 5AC8A 4A3UA 4L1WA 3OG3A 4UOZA 1HZYA 2Z0IA 4Y7EA 3CM4A 4KGLA 1JDFA 5FCZA 1EP2A 3QVQA 3W7QA 1BYCA 1WP6A 1OSEA 4CKQA 4NF7A 7XIMA 1YPXA 2B4GA 4BQ5A 2XM1A 2PRMA 3R58A 5GVJA 3BZJA 2DVUA 4XVDA 3VGDA 2HNEA 4NI3A 3BUVA 5BRQA 3ZXWA 3G22A 2PWEA 3Q45A 4W86A 2A3EA 3TQKA 2PBOA 1UH2A 1TRDA 4W8LA 1GCYA 4ZR8A 2E6FA 1RD6A 2WMJA 4AD5A 3DU0A 2P10A 4LFYA 1DJYA 1SW0A 3S5NA 3K4AA 1RQHA 3MSDA 1UWRA 3T78A 2CBJA 1SVDA 4NQ1A 4PYSA 5EB8A 2DUAA 1UKQA 1OIMA 1NWTA 1JI1A 1ZSXA 3RGTA 3M5YA 3C8FA 4Q22A 1KGXA 1G7VA 1WCGA 3E0FA 2I1OA 2PTXA 4C6NA 3L2LA 3D3AA 2D0FA 4PBEA 5FSDC 3EA3A 1GUVA 1S5VA 2BS9A 3VCNA 3IJIA 5HINA 3V18A 1V6UA 3FYPA 5ABHA 1EQPA 2WZMA 4DF1A 1B2YA 1ITQA 4IFRA 2P88A 3O8AA 4KH2A 4NG3A 3CZ8A 4LCRA 3LCIA 1MYRA 3ZJKA 3O1NA 2CWNA 5CJ5A 4NAEB 2XIJA 5ABFB 4K2SA 4ZCWA 1X39A 2XN2A 3LNPA 2Q6ZA 2BSLA 4P7NA 4IMDA 1AQFA 1IXOA 2G3IA 1LWJA 4LS2A 3RPTA 3F4VA 2GQ8A 4PMXA 2X1UA 2AKMA 4DO6A 4DPQA 3SO7A 3NQ2A 3BAJA 2A3CA 4ORIA 2WVTA 1G7UA 1Q3NA 4JTUA 3GNRA 4YCPA 3E3HA 2V82A 4FAMA 1MUWA 2XN1A 4E4UA 3HA1A 3H2AA 3VNZA 3KBMA 3NL6A 3HQNA 2UY4A 4OUIA 4PMZA 1WZMA 3T09A 2WSKA 5BROA 1V6TA 1EX1A 3U2ZA 3W7NA 3T40A 1OG6A 4XKYB 2DZUA 5LIWX 2YCIX 4Y8EA 1JZ5A 4M7SA 2E1DA 1LLWA 3DCPA 4XQ6A 1CIUA 4WUIA 3W7RA 3TW7A 2HBXA 1RQEA 5D33A 3P74A 4GQRA 3E2SA 3CPRA 3CYJA 1RY8A 4WXZA 4RZ6A 4Q8WA 1GVIA 3HFTA 1TPVA 1CGXA 4PTMA 5CZTA 1XRFA 1R30A 3JRKA 1B9ZA 2V5LA 3C2VA 1R7AA 2WJZA 1O66A 3HQOA 3CV6A 4ZO6A 1Q2RA 2QCDB 3LG3A 3GFZA 5JUVA 3UG3A 4KIEA 3A9BA 2PP3A 3GU2A 4JHOA 4AZCA 5MHBA 2DVXA 1TWDA 3P60A 4ZOAA 2CWXA 2V3GA 5C7HA 1BGGA 3WQOA 2EHHA 2C3ZA 4QQ3A 2YDRA 3R12A 1FWCC 2QYGA 1W5QA 1F3WA 2CKRA 2EBNA 4LV4A 1HGYA 2XM2A 2YLLA 3HM7A 3DX5A 3EMCA 2C0AA 4M51A 3WNKA 1W9DM 4ZO7A 5I7GA 3O07A 4GXPA 2QPXA 1PZ1A 1SW3A 4JTHA 2B31A 1NOUA 4HPGA 3W74A 1OFBA 1YYAA 4ZQPA 3PPFA 3QYQA 5C9WA 4JXCA 2ZA1A 3WX7A 1ONEA 2GUBA 3UG5A 3PZQA 3IJ6A 4YVPA 3OLDA 1G4EA 2PWHA 4O15A 4XZMX 1RVGA 5LIYX 3WLTA 2J6VA 4MDPA 5D04C 2OEKA 1MNZA 2VWTA 3UWYA 2OODA 1PCWA 2EPLX 1PWMA 2C1IA 3KX6A 5L6UA 1HNYA 3VCRA 1BRLA 3UJFA 3LRMA 1V3MA 2BHUA 3ZWTA 1HO4A 2F6KA 3E1F1 5CSYA 4O50A 3UETA 3NQEA 4G1NA 3LHZA 5G1TA 2I5GA 3XIMA 1GYMA 1KTNA 2DSZA 3VNIA 4Z1BA 3MMDA 3IVUA 3O05A 4QDPA 3T4WA 3SCTA 2HROA 2VVNA 2ZX8A 2NZLA 4MWAB 1DHPA 3VKDA 1J0ZA 4PMUA 2QAPA 4GCAA 1M9HA 3UU0A 2J13A 4QSFA 4UR7A 5A2CA 4J2MA 4X0NA 2VDHA 3DFYA 1H41A 1T5AA 1AVAA 1REQA 1OT2A 4NNBA 3CV7A 2GUYA 1TV5A 3TJLA 2WZEA 2V30A 4P8UA 4M8UA 4FI4A 3LUTA 6XIAA 3NTYA 1ZAIA 3NIYA 1BF6A 1RY0A 5CPTA 4JEJA 1K03A 2X1RA 2WVUA 1YNYA 5FJOA 2I57A 1S2CA 1JG9A 5C54A 3ALGA 3QBUA 1CZ1A 1W3JA 1UMYA 2PC8A 4JIEA 4DUWA 2PDQA 5I00A 5C9XA 2WBGA 3SRKA 3NDYA 3BAYA 4OTKA 4FX6M 1CGTA 2OKOA 3WJWA 3ZOAA 2DPEA 3MKKA 4QCEA 1F3TA 3P81A 2G8ZA 3R25A 3MP5A 4OV4A 1VAHA 3H7RA 1R3TA 5BWAA 4NI8A 1Z3NA 1HL9A 3R6IA 3M47A 1CCWB 5HUPA 3QV8A 5BXTA 2WMHA 1ICPA 3HJEA 3U5YA 4RDZA 4FR1A 1Q63A 1A5KC 3EOOA 2XFRA 3B9AA 1GVOA 1FWRA 1ONXA 4TQTA 2F84A 4ZOCA 1CEOA 2X30A 1E70M 3N12A 3N4FA 4GBDA 2DT1A 5T26A 4RDVA 4FNQA 3MUIA 3TJXA 3M44A 3H70A 1P0NA 3R10A 4MJ2A 3ZSTA 4AZ7A 4DWSA 3HV9A 4DY1A 3VKAA 5CG0A 1OX4B 2QV5A 3GZ3A 5I06A 3B04A 4HMEA 4DWSC 4PMDA 2RUSA 3NOYA 2FJKA 2IQTA 2VFGA 3H23A 4UTIA 2F9RA 1G67A 1PBGA 4Q6JA 1AW2A 3H24A 3BMVA 2GL5A 1QOQA 1ZHAA 4D6CA 3GYEA 5HPCA 4JL2A 3TQ0A 2PDWA 4DJFD 1J0YA 3H55A 3TYCA 1KC7A 2DQWA 3PUOA 5FJRA 5CBIA 4KWSA 4G7FA 5CC6A 2H8XA 3IRDA 3PUGA 3SQSA 3WUFA 3DC8A 4Q7IA 4G7EA 1YXDA 3EZ4A 3LCLA 1XL9A 3K4DA 1J5SA 4IUGA 2NV2A 5GNYA 4C1NA 2IKIA 5BRBA 1JD9A 3KOZA 1QHOA 1G4TA 2ZXDA 4Y6GA 5CBBA 3TJ4A 1HJQA 2POZA 3P8IA 1L2UA 1RCQA 4ADUA 3KL5A 3T2OA 3DHUA 2ISWA 2WJEA 1PIFA 2WAGA 1LL4A 4P7OA 4WGHA 2CFFA 5SWUA 1TTQA 3HG4A 1W5MA 3QQWA 3L7RA 2VR2A 4B9ZA 4BI7A 4GIYA 3NWRA 1C93A 1XX1A 2FGZA 4PMVA 1RQBA 1CT5A 4S23A 3VFLA 3WBEA 3OGVA 3TROA 1DWJM 1W9UA 4RNHA 4LCQA 1FTXA 3T8LA 3O9NA 1Q6GA 1Z7AA 4EXAA 1F05A 4R7WA 2DIJA 3GC4A 4E38A 3UPBA 1W17A 4CCDA 1XLLA 1M01A 2WW5A 2Z6JA 3NDZA 3CO8A 2WZHA 4KEUA 4Y9NA 2IUZA 4W7VA 1E0TA 1EUAA 1TYGA 3SFWA 2FLIA 1CLXA 4GH3A 1XYCA 1IQ8A 4IPNB 1C9DA 2RJHA 2PODA 4REQA 2A7PA 3OQEA 3T05A 1YXYA 1OFQA 5JVLA 3WLNA 5AHNA 4PUUA 4AEEA 1O94A 1ADSA 4EWND 2VX6A 3WUBA 1E1CB 2XISA 3QC0A 3KL0A 1QASA 3GDRA 4H9XA 4W93A 1C7TA 1VYPX 2QJJA 3EXSA 4MMWA 1AH4A 4DPPA 4WCJA 1BSLA 4MM1A 4PUWA 3PUEA 1G69A 4EE9A 3OA3A 4J3SA 4WF7A 4J4KA 5D9NA 5BXPA 3BMWA 1OIFA 4E2VA 2XH0A 7REQB 5JU6A 1QO2A 4IQJA 4N6EA 3A5FA 2AGKA 4O1DA 2QLYA 3V0TA 1WDRA 5CZKA 3T42A 4A3RA 2CETA 3GXDA 5LNWA 4NNAA 1Q7ZA 4B15A 4ICMA 3U2CA 1LM1A 4NASA 2IKJA 1WA3A 4MUZA 5E6YA 5FEPA 1EC9A 1O5KA 4S1FA 4PC8A 1E43A 3ZT5A 2ASHA 1DOSA 2POTA 3WQ5A 1GOWA 4YU1A 1UA3A 3W7MA 2E1WA 1DORA 1VP5A 4ECLA 1JCMP 3EA2A 5I23A 3N17A 5H8PA 1X6LA 3THCA 4MAZA 1SR0A 1E55A 4WSKA 5DBTA 3RNDA 2YBTA 4FIQA 1ISWA 4F0KA 1W9VA 3R8HA 2OQYA 2D23A 2WNQA 3WQVA 2CZDA 3W2LA 4FXFA 3G5EA 3IVSA 1H51A 1LL7A 1KFLA 1GEQA 5DBUA 4QEEA 1XDLA 4MDOA 4YTRA 1TMLA 4G6CA 3L66A 3TR2A 1IIGA 3POHA 2Z7GA 3TH6A 3DESA 4AZGA 1LT7A 2PDMA 2RH9A 2WSPA 3CB8A 3DENA 3F5KA 4JN6A 2PE4A 1VS1A 3FJNA 3QRHA 3MANA 3VNKA 4R88A 3LGEA 3ZVIA 2C1GA 6XIMA 4NZ4A 3QHMA 3S6TA 5LNSA 3W86A 4HT3A 3MSGA 3W76A 1SZEA 1QT1A 2A79A 5DN1A 2QAFA 5F2IA 1KFKA 2OWXA 4L6OA 5GJNA 3KZPA 2XZ7A 4ENLA 1SZGA 2HRWA 3PZNA 4Q7BA 3W4RA 4XSLA 4GINA 2A7RA 1P4CA 5C9UA 2O0TA 3HN3A 2RDWA 4AD3A 3PWAA 3S3GA 3LK6A 1Z48A 5I24A 5JH2A 4MPQA 2AQOA 1UWQA 2ZYFA 3PSWA 3FDKA 1M04A 1EEPA 3FSTA 3BOXA 4PE8A 1JPDX 3CHEA 3EKZA 4C91A 4C6LA 2Q3OA 4K37A 1YE6A 1VBJA 3BV4A 2ZUNA 4HSHA 3FKKA 4EX4A 4U31A 1TCDA 4WR3A 1XCWA 3W7EA 1H7NA 3FJ4A 4O53A 3G18A 1QMLA 1ADOA 1K3UA 3LRLA 1NJJA 1E15A 1R38A 3ZM8A 2G37A 2DIEA 3GDBA 1P1XA 4IFKB 4PL2A 4XD4A 4U28A 2BVWA 3U48A 1E56A 3AYRA 4RUBA 4D8ZA 3S0CA 2ZE0A 2CLFA 4RE0A 1QHZA 4RW5A 2PRHA 3CGTA 1J0HA 3K8KA 4JFSA 3FKRA 3GUGA 2DDXA 1EWDA 2VUYA 1XD1A 1TJ2A 1M68A 4TVCA 2D2GA 2WVVB 4DRSA 4XZBA 3ICJA 4AX6A 3U2EA 3SSZA 1QVBA 2VRJA 1VFOA 1ADDA 1US2A 2GJXA 2GDQA 4FOKA 5CBJA 3WJXA 1HUVA 3AICA 3W1RA 3BQ5A 2D22A 2ZADA 4XSMA 4BA0A 1HN1A 4ROQA 2OQHA 3LU2A 1PV8A 2G95A 3AXMA 1OYCA 2D2OA 5I0DA 2BVDA 4D2JA 3PANA 3GBDA 2ALDA 3OVGA 4NRRA 1RV8A 2J8GA 1K8YA 2QCEA 2EQDA 1OCJA 5C2GA 1J6OA 5D9PA 3S6OA 2B7QA 1SFTA 4PTNA 5JMUA 1XGZA 4GBUA 1EX5A 4UFJA 2GDVA 2YW3A 4AC1X 3VC6A 1Q2SA 4IX0A 1M65A 1C8VA 4NAFA 2Y89A 4XZIA 3SCPA 3QMTA 2PDPA 4KQNA 3QYSA 1SJCA 3O6DA 2NLIA 4ZENA 4NJGA 2G41A 4M19A 3CC1A 4C1NB 2W6RA 2BY3A 1KXQA 2EEXA 4FF7A 3CMGA 3W87A 3M6YA 1BYAA 3E9AA 1VPYA 3EWUA 1HJUA 5F2MA 1A47A 1POKA 4GQBA 1KCZA 3QPEA 1YPFA 4MLJA 3M0HA 3MO7A 3IPWA 3TW9A 3RM9A 3QMRA 3USBA 1OX6A 4Y9AA 3O6AA 4E3VA 3NQ6A 1CXKA 2HXTA 2BXYA 4B92A 4PZVA 2ON3A 3ANYA 1FWDC 4HA1A 4K36A 1MZHA 3AQUA 4C7FA 1RZMA 3P2VA 2UY5A 4TOQA 3MKCA 3E5PA 3AXHA 3T0TA 3N4EA 1ZALA 3S2JA 4UIOA 2J6XA 4IP5A 3W7OA 3LA4A 3NO3A 2VCBA 3MV11 2QVHA 4CNPA 1O7AA 4GJIA 2E8YA 4GYKA 4E2OA 4NJJA 3WF0A 2DGAA 2DW6A 1YRRA 4LF2A 3XINA 1ITCA 1JUKA 1EJUC 1EDGA 2FH6A 3GVGA 3QV9A 4Q8PA 5FOOA 5IM51 2WNZA 4A05A 1B5TA 3EOEA 3GG0A 1J0KA 3UXKA 1QCWA 3K5XA 3BLPX 3U0HA 3IJQA 2FVKA 2WPBA 4UNIA 4JTIA 4Z1YA 2BXVA 2Y7DA 1I6NA 1LOQA 4QR6A 4PRRA 4DN1A 4GY1A 4PMYA 4R9XA 3KP1A 3DERA 1TX0A 3KLKA 5GNXA 3CXOA 3S5YA 5CQ1A 1D3HA 4J28A 1U1HA 3W1TA 3KVMA 2BVYA 3ARWA 4NRSA 4QDWA 5D9MA 1EJVC 1UD6A 1ITXA 3ARVA 4GNJA 2XN0A 3KDNA 3UCCA 4KFOA 3P67A 3H53A 3T1GA 1L2QA 3C3UA 2ZUUA 3N9KA 3OBKA 3BARA 1EZWA 2J7EA 1C8QA 2W0UA 1WZKA 2Y5SA 2W3ZA 1KR1A 3VUPA 1FWHC 1RCXB 1LUCB 4DJFA 5KMYA 4NZ3A 3P7YA 4ZGYA 3N1AA 1HW6A 4AZ6A 3FAWA 1V51A 2PGFA 2FVMA 4ZOBA 2Z24A 4A22A 3CV1A 3HV8A 4FR6A 2C91A 4W85A 1G6CA 4M80A 3GG7A 4X9SA 1CX9A 1PYMA 5E9AA 4WQ6A 4LUTB 3OG2A 3VZZA 1DJHA 3F5JA 1MWOA 1EA0A 5LSMA 4DJDD 4IFKA 3BDKA 3GC2A 4UTFA 1K9EA 3EX1A 4IGHA 3KE0A 3S1VA 3OO2A 3QN3A 4LWWA