5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-1,6-bisphosphate aldolase
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
5HR7A 2DORA 3FA5A 3HJZA 1FQ0A 3FOKA 1NFBA 4UTJA 3ABOA 1SPQA 3O1NA 1OX4A 4JX5A 3QPZA 1FCBA 2FJKA 3G1XA 1A5SA 4WY0B 1Q3NA 1OFEA 1GVSA 5AHNA 5HUOA 1LORA 3TSMA 3MBFA 1W31A 1XXXA 3QEZA 2H3BA 3NGJA 3A24A 1OK4A 3BPWA 4JTGA 3P61A 1LTDA 4K7YA 1KFCA 3LCIA 4N9CA 3THQA 4BI7A 1FWNA 3MWAA 4IOTA 3EXSA 4DXVA 1ME7A 5F2IA 3M0ZA 5K9XA 3VCRA 4L4LA 5DBTA 4BI5A 4OE7A 3VFLA 2FPVA 1OYBA 2B0MA 3DHFA 3E0IA 3W84A 2ZQ0A 1CW2A 5LNVA 1V5XA 1L6YA 3BLIA 4H3DA 3NO5A 4ZL1A 3VI2A 3Q2DA 1FDJA 4OWGA 5EYWA 2O7SA 1P1XA 2RHGA 4O8RA 3M5VA 2OT0A 2DZWA 4IX2A 3GAKA 5LNUA 3B0VC 1NF0A 1Q6QA 2V82A 3MI6A 4DEFA 1W5NA 4NU7A 3FIGA 4LS2A 3PUOA 1KM1A 4MY1A 3I7RA 1EUAA 3MYOA 4FF7A 1Q6LA 2WV8A 2VELA 4JXCA 2C16A 2ZA1A 4M6QA 1UASA 1F2JA 5I3KA 3W2KA 1F05A 2GVJA 5T26A 4LVBA 3U8GA 1S5WA 1GEQA 5CPOA 3N34A 4QNWA 4AF0B 1H60A 5AN7A 2FPYA 1K7FA 4CCDA 5E0KA 3R8RA 3MP3A 3HQ1A 4LRTA 3GZ3A 3M44A 1ZALA 3NPVA 3CLMA 4XWUA 2QDGA 4TMBA 4JNMA 1LBLA 1CI1A 4CNOA 2CLHA 1MEWA 3ABSA 3QW3A 5G1TA 3A23A 3W9ZA 1WA3A 2CZDA 3PBWA 1I2PA 1KM5A 3GDKA 2E5BA 2R8WA 3RMJA 3R12A 4D2JA 3IGUA 1B4KA 2CZFA 1BWLA 5DN1A 1WOAA 4JR5A 4MJZA 4RZ4A 3W22A 1EB3A 1N8FA 3IV3A 3NPXA 2OMAA 4CNNA 4XKYA 4CQAA 3LX9A 3W2NA 5F2GA 3S5YA 4X2RA 3AO0A 1N7KA 2G95A 4LVFA 4NJGA 2C19A 2XN1A 3HPXA 1TPVA 1OVDA 5G2HA 2B7PA 1MZHA 1YYAA 3S1XA 2W79A 1OF8A 1P0NA 1PS9A 1O94A 4X3ZA 3WJSA 3M9YA 1X6UA 1H7XA 1BTMA 1EWEA 2QAPA 1Z48A 1ZAIA 1WXJA 2Y61A 2E6AA 4O28A 3VE7A 1R46A 2C3ZA 3OVQA 3FFSA 3W1LA 2QEZA 2DZSA 4O13A 3DGRA 3S42A 2DP3A 2CU0A 2ATMA 3NQ2A 3TROA 4UNKA 1F5ZA 5AYYA 3GIYA 3QYQA 4KFNA 3T40A 3EWYA 3A5FA 5D38A 4XZ9A 5FEXA 2E77A 4ZZ9A 4UFHA 2XFWA 3M5XA 1SU5A 4WQ6A 1XBZA 4KFOA 4JY8A 3TCEA 4Y96A 3RF9A 3EWWA 4O12A 4BK9A 4GWEA 2E68A 1JQXA 2J6XA 4QQ3A 4MFDA 3UXDA 3CIXA 2B7OA 4Q33A 2E6YA 5FF2A 1LRQA 2ATSA 3QRHA 3E12A 3WFAA 3TK7A 4JS3A 2ZFAA 1ONRA 4NQ1A 3LHZA 1QNVA 1JUEA 4TX9A 2Y62A 3L0NA 1ML1A 1YDVA 1I45A 5K9CA 5BMWA 3THAA 1SSDA 2CLEA 1QR7A 5CZ0A 1ZHAA 2BXVA 4RR4A 3G18A 1OFPA 1FWSA 1ZNNA 4O11A 4IMFA 3D0CA 3RLVA 4QIUA 1RR2A 3R2GA 3C2VA 3PG9A 2VOMA 5I3FA 2YR1A 4Z1DA 1WX0A 2ZRZA 2V0TA 1ALDA 1FBAA 4MZ1A 3ATZA 3M47A 4MUZA 2ZZ1A 1UCWA 4IJBA 5BRBA 4FIRA 4WOQA 4PODA 2VEPA 2FPTA 1W54A 2VENA 4Y6GA 4E2BA 3FKRA 3LV5A 3TJLA 3WJZA 1PV8A 3C2RA 2NX3A 1K02A 4AVFA 1LP6A 1NVMA 4O19A 3TW7A 4MOZA 2QCEA 2TSYA 1KFLA 1VR6A 3O05A 5LNRA 3I7QA 1FCQA 2Q3OA 1KA9F 3SI9A 3C61A 3ZWSA 3I7SA 1TCDA 1ICSA 1VCGA 2V81A 4BI6A 1I2NA 2DZPA 3IVTA 4IMEA 2Y70A 3HBLA 3PC0A 3QM3A 1GTHA 4M6PA 1GJPA 1VYSX 4HHPA 2A7PA 4LV9A 4QJ1A 1HFBA 3DU0A 4JICA 1KFKA 3TQKA 1TIMA 3B0PA 3PBUA 1W5MA 3UY8A 3I68A 3N14A 4GC4A 3R89A 2CLFA 4XBSA 1JCJA 1ADOA 3EX4A 3P8JA 2GQ8A 3UYCA 4XQ6A 3W76A 1IIGA 4ADUA 4UXDA 4WY0F 2PRHA 4K7VA 1KFBA 3CPRA 1Z41A 1W5OA 3P82A 3S1UA 3LRMA 3LXCA 5F4XA 5EY5A 2PE4A 4NJKA 4AWUA 1F74A 3VNDA 3MMTA 2B4GA 4LW7A 3W72A 1QPQA 3OBKA 4N6EA 1L6SA 4CQ8A 3FYOA 3WK1A 3S9YA 2NXGA 1DJQA 1W0MA 5G4EA 2X2GA 3HG5A 1A53A 2A21A 3W2LA 1V7YA 1TPB1 2ISSA 5D04C 3HPZA 2F84A 2Y89A 4DO5A 4C1KA 2EAWA 2ZRUA 3P80A 3G0SA 4TMCA 2PC4A 3M5ZA 3LHYA 4NX5A 5D2VA 3LCLA 4UTWC 1XC4A 2F7FA 2HS8A 1JCXA 3E9AA 1S5TA 4FX6M 1LM1A 3KFTA 1OFBA 3P81A 3UWQA 3VKJA 4A22A 4LC6A 3LI0A 2ZA3A 2ZBTA 1TQJA 3KRSA 1IXQA 2DZXA 3MJYA 2C13A 1FWTA 4Y90A 2A85A 3DXIA 3TE9A 1DQXA 3W7QA 1VCFA 1Y0EA 3PAJA 1YXDA 4NVTA 1GWJA 3W7DA 3W1UA 3ZFHA 4JTJA 4IUOA 4A29A 3SGZA 1FY6A 5EBUA 3TU9A 3CWOX 3LLDA 3W1MA 2JGQA 3L5AA 2X1SA 4GUIA 3NVTA 3EWBX 4M5PA 3W1NA 3IIOA 1RV8A 3TSDA 4K6AA 4LS1A 3JRKA 4ZQRA 2G97A 1W5QA 4GBUA 1YDOA 3ATYA 1K7EA 1YXCA 4S2CA 1W5PA 5AB3A 2E5DA 5E93A 1G7UA 2QF7A 3GYEA 1KV8A 4HNTA 2YGYA 4JTTA 1ME9A 4GXMA 1RVGA 1R2SA 4ML9A 4R7JA 4XTDA 3G1DA 4DF2A 2NUWA 2YDAA 1PE1A 5KZDA 3JR2A 4ZVJA 4IPJA 1W56A 2WNQA 1TPUA 5FF0A 1AL7A 3PG8A 4NXSA 4ONVA 3RNDA 2JK2A 1LCOA 2JKEA 2WQPA 3R13A 4UTWA 2ISVA 3W7GA 4G1KA 1SO5A 3NYZA 2TYSA 3GDLA 3W7JA 4A2RA 3E02A 4UTHA 1K8ZA 4UIOA 3HF3A 1M6JA 2FDSA 4JTUA 5LSMA 2HS6A 2ABBA 3NQMA 5CZJA 3NQ7A 1XCFA 1IXPA 1J2WA 3PUEA 1TPH1 5AYZA 1OJXA 4LT9A 4BFAA 2OCZA 4JX6A 5L6UA 4DO4A 4NNBA 3CWNA 5H2ZA 5IM51 1GG1A 4PFMA 2ZTJA 2HMCA 3DI0A 4YMZA 3KVJA 1OFRA 3GDMA 3TAOA 3KXQA 3NL3A 2E6FA 5HQEA 4TU1A 4UTLA 3NQDA 3P7YA 3NA8A 3LI1A 3M5YA 3NEVA 1QDSA 1OFAA 1R2RA 1GVFA 1Q6OA 4LTSA 4BWLA 1GVQA 4OQVA 1VZWA 1B9BA 4DBEA 4IMCA 1IXNA 5KINA 3O07A 1TREA 4AHPA 3LHVA 2VC6A 2ZRXA 2Z2UA 3W7MA 1WOBA 4FX7A 3INPA 5G5IA 4AWSA 3F03K 3BGJA 1PL9A 3NM1A 2A2IA 1T8XA 3DFNA 3JS3A 2V30A 3LV6A 3G8RA 1SQ7A 2NWRA 3KVMA 4AHOA 4ADSA 5BW6A 3EWXA 3UPBA 2C1HA 2NZLA 3KVKA 5I3IA 1FXQA 4FO4A 5U7SA 1WBHA 2GJNA 8TIMA 3S8HA 5CSRA 5K9DA 4O4WA 5HWMA 1TB3A 3SFKA 3SZ8A 1O4UA 1HO1A 2VEKA 3TSBA 1QPRA 4FNTA 5DCDA 4NT0A 4ZQCA 3W71A 4AXKA 4WY0A 3PY2A 2ZZ5A 1OFOA 3N3MA 5A5WA 3A9IA 3N9SA 1YADA 2V2CA 1YXYA 1TRDA 2CWNA 4HSOA 3G24A 3EX3A 2YYUA 3G1YA 2QDHA 3MHGA 3C8FA 4EF8A 3IIPA 2FIQA 3GR8A 3PSWA 1B3OA 3GDRA 3MI3A 3LTPA 1H7NA 5D30A 2V2DA 4Z08A 1XUZA 4FXRA 1DV7A 4Q32A 4FB7A 3P5YA 2EGZA 1I2QA 4IGHA 1LBFA 3G1FA 1TV8A 5EPDA 3TQVA 1HTIA 4NUWA 2ZTKA 3QJAA 4QNEA 1UUMA 1VRDA 1XUUA 1EA0A 5K2ZA 2NX1A 3BW2A 3ELFA 1FWWA 3L2IA 1AW5A 1JUBA 1NF7A 1DHPA 4HPJA 3CEPA 1L6WA 3LRKA 2QUTA 4RJEA 4EF9A 1ME8A 2WPBA 3PULA 4BF9A 3TFXA 2C18A 2GPTA 3S0CA 3P74A 1RD5A 3M41A 3A22A 1JUKA 3QMSA 3C4UA 5CZSA 3B03A 4WJEA 1U83A 3W1AA 1TJPA 3DFOA 4H6KA 4UMCA 3E96A 1F6PA 3V75A 3NNTA 1SSGA 2DZUA 3P62A 1L2UA 1QMLA 3CEUA 5EL1A 2DZTA 4AF0A 2NXIA 4HT3A 4N6FA 3S5NA 3SGUA 4HNUA 1LRTA 3EKLA 1GPWA 5I3HA 1W37A 1SW3A 4HN4A 4DPPA 1SW0A 4R34A 2WSQA 3TUUA 4N2YA 5D2YA 3QZEA 4LV4A 1VJIA 4KFPA 3NM3A 3QMTA 3B06A 4UTUA 4NJJA 3HMJG 3C56A 3GKFA 5C5YA 2VEMA 3NQFA 5G1YA 4FNPA 3G22A 3G3DA 5DY2A 4N9DA 3F4NA 1LYXA 4LNYA 3MHUA 3SW6A 2QJHA 2Y63A 1SZGA 4N4QA 3UY7A 4O10A 3DH7A 3MP5A 1GT8A 3L9CA 3UWUA 1VH7A 4WXYA 5F4SA 3MW7A 1VCVA 3NG3A 2QR6A 7TIMA 5GVJA 1O95A 3BG3A 1KM6A 3C6CA 1TPC1 1OX6A 1F76A 3P8IA 3ZR4A 3Q94A 4P2VA 4UTKA 3UNDA 5F1UA 1SFLA 2ZYFA 1J5TA 2QCHA 3C2FA 3W73A 3TXVA 4UMAA 1G7VA 4I9AA 4NNCA 2IQTA 3LOTA 4A3UA 2Z6JA 3PWAA 5HUPA 3W74A 1K7XA 3I65A 1HO4A 3TV8A 1DORA 4M7TA 2W6RA 1O5XA 2CFFA 2QCMA 5KZEA 4JYFA 3UWYA 3W87A 3TDFA 4OBTA 1FWRA 4ORIA 1QOPA 2QCGA 3WK3A 3FKKA 3EB2A 4JTSA 5D05A 5D02A 3L21A 1FCUA 1VQTA 2CLLA 2OX1A 1VLWA 4QAIA 4HIBA 2EF9A 4YWIA 1PVNA 4UUIA 1JCLA 2J88A 1F7BA 4EVZA 5J5RA 2QCNA 5LKYA 3IIZA 2QCCA 3NDOA 3RFAA 1G4EA 1QFEA 1TPWA 1GQNA 3W1QA 1QPOA 2YPIA 4ALDA 3N2MA 2YSWA 2WSYA 5LNSA 2YW4A 3F1QA 4RLIA 4ZQOA 4K36A 4RV8A 3BLEA 3O6YX 4LWWA 4NJIA 1TRIA 4MFEA 4K39A 2X1RA 3Q37A 1P5BA 4FHAA 1F73A 4JTIA 1XBVA 2V5BA 4P61A 5G2IA 3W2UA 5EMUA 5I3JA 2WSRA 4IMDA 3UQNA 3O15A 2Z6IA 4UFJA 1TQXA 4MVAA 2Q8ZA 1K8YA 5CZTA 1U5JA 1EP2A 2RH9A 4NZJA 4UTMA 1BEUA 1VPXA 4X22A 1W3IA 3GB6A 3NQEA 2PCQA 1QAPA 2GUUA 3LDVA 2ZZ2A 4FNQA 2GOUA 2XN2A 2P10A 3SY5A 1EX5A 3CQ0A 1IGSA 5AHEA 1ICQA 1X7FA 1XM3A 3DAQA 5C55A 2H90A 1FDYA 4O1BA 3W3OA 2ABAA 3TAKA 2X16A 5AHFA 1SUXA 1TPDA 3LB0A 4FIQA 3LXAA 3W07A 3BVJA 3Q58A 3T78A 3B04A 4DELA 2ZZ7A 1OABA 2BWGA 1G4SA 2E5CA 4MZYA 2C0AA 2NLIA 4Z1CA 2B7NA 4FXSA 5FF4A 3LCFA 1WBJA 3CT7A 3W7CA 3PSVA 5CPLA 5H91A 2OZ0A 1TJRA 3DFQA 3IIVA 3SR7A 4O57A 4Z1AA 3UXAA 4POCA 3G1AA 3MO7A 1JR1A 4LVGA 3QC3A 1PHQA 3HPSA 2I9EA 4XBKA 1M7OA 1QO2A 2RDTA 1OFDA 2O7QA 5TQLA 1KFJA 3QQ0A 4L4MA 5HMSA 4LU0A 3W85A 4PC8A 2RFGA 1S3HA 1FDZA 3OEXA 3C52A 4ZQPA 1SO3A 1EWDA 4MY8A 1A5CA 3HIJA 4JTKA 5FI8A 5FEZA 1W3NA 4GRSA 4YCPA 4JDYA 4DPQA 1TSIA 1OFQA 2NXHA 3LRLA 5KMYA 3B8DA 4BR1A 1H1YA 3C2OA 1H63A 2WKJA 3HGRA 3H54A 5EKYA 5AC7A 1GVOA 4PH6A 4ORMA 2FQIA 1VHCA 5FF3A 2P0OA 2AGKA 3GK0A 2PRMA 3CM4A 4RZ6A 3PF3A 1FX6A 1YTDA 1BWKA 4OT7A 1YDNA 3ZWTA 1XDLA 1B57A 3CHVA 5KZMA 4E38A 1WYIA 4PCFA 3W7LA 2G96A 2P1FA 3G1HA 4ZQNA 5F1VA 2WNZA 3G0UA 2FLIA 3FS2A 4OU1A 3NQCA 3N2XA 1G4TA 2TRSA 4DF1A 3W83A 3W7HA 1VGAA 4JYEA 1OYAA 1OK6A 5DLCA 2I1OA 3W1PA 1GTEA 4O52A 3WJYA 3LTYA 4UR8A 1KLYA 2VFEA 4GNJA 1SO6A 5K3VA 4UCGA 1D9EA 3KVLA 3TX9A 4K8HA 1YPFA 4JY9A 4R33A 5L9FA 3SSJA 3RU6A 3N73A 3PVFA 3QW4B 4S1FA 1K03A 1GOXA 2A0NA 4IX0A 1EUNA 3SECA 1KTNA 3TC6A 5CPMA 3BLFA 3DFTA 1WQ5A 2ZRYA 4UFKA 1RQEA 3LERA 1JCMP 3W6YA 3G8EA 5AHLA 3OVRA 2Y7EA 4YXGA 3GXTA 3LBMA 2VFGA 4UTTC 3IVUA 2BTMA 3S1VA 4GUHA 4HPXA 5ABTA 2V9DA 4O1CA 5BMXA 1EPXA 2ZZ4A 3L0KA 5HR6A 3O63A 2H8XA 3S5ZA 1OYCA 3E49A 5D09A 1ZAJA 3PB0A 1LLWA 2BX7A 1SR9A 5DXXA 3M6YA 1KTBA 2QCLA 1KM2A 1DVJA 1RQBA 3EKZA 1YPIA 1AW1A 4ADTA 3W7KA 3CC1A 3DKJA 2UV8G 3DHDA 2CLMA 3L5LA 4EOUA 1D3GA 5HNRA 2YFNA 5HWJA 4KKXA 5AFDA 4MYXA 4UR7A 3EWZA 1TTJA 3STGA 2R91A 4EIVA 3LXBA 2A4AA 1WV2A 1G6CA 4MIMA 3T7VA 3TJXA 3N19B 1LROA 4WD0A 5AC8A 3M43A 1GVRA 3ABRA 4TIMA 4GUFA 5DELA 3GNNA 1A5AA 1AW2A 3G1SA 4FNSA 4JIQA 3GNDA 5G4WA 4QM1A 2Z0IA 3HO8A 1EEPA 4I7UA 5TIMA 1MEHA 3BARA 3L0GA 3PUDA 3TIMA 3LHUA 2GQ9A 5MHBA 4YLWA 1IXOA 4Z0SA 1XI3A 1XL9A 4B5NA 4N9EA 5HJLA 5AHIA 3H53A 1LOSA 1DBTA 1TTQA 1UBSA 2BSLA 3LCHA 1PCKA 1GG0A 3TA6A 5G2WA 2KZHA 1ZENA 3G0XA 3U2OA 2ZCGA 4KWWA 3SIZA 2VKZG 1OG0A 4LS0A 4QITA 3LTSA 4FNUA 2QCDB 4UMBA 1J4EA 4O50A 3YPIA 3W2JA 3USBA 3TR2A 1WDWA 1W8SA 5TBOA 3LHWA 4RXFA 4ICNA 5LGXA 2VFDA 2WO5A 3CU2A 1KV5A 3W7NA 2Q3RA 2QCDA 1KBJA 5C2XA 4E0CA 1ZY9A 4YL2A 1C29A 1DKWA 5F4WA 1H7OA 4K37A 2EKCA 1E51A 3DZ1A 3DKLA 4GUJA 4UFLA 4GFSA 4CQ9A 4DBDA 1H50A 1SZFA 4O1AA 2JBMA 4OV9A 3MBDA 4M19A 1O60A 3LM7A 4X9SA 1H62A 4RK8A 4O15A 2Y88A 4AAJA 1H5YA 3HGSA 1QO5A 4CCEA 4AH7A 5LGZA 5DXYA 1GYNA 1OX5A 4MZ8A 6TIMA 2G5WA 5DCBA 3GXPA 2VEIA 3K30A 3NQ8A 3GLCA 1KM4A 3OA3A 2BLEA 5LNWA 3QPYA 4GUGA 5HULA 5BOOA 1TO3A 3TKFA 1SO4A 3KHJA 1IF2A 1LOQA 4K8EA 1ZCOA 4UFIA 1TPEA 2E09A 2CZ5A 3L65A 5AC6A 5AOUA 2R94A 1A50A 1D3HA 5FEWA 1JRCA 4NZFA 1Z42A 3BW4A 5D2XA 2C14A 4O17A 1LZOA 2Y7FA 1SFJA 4WX2A 3FEMA 3PB2A 3HOJA 3IVSA 5AYXA 1I8JA 4GE8A 4RX0A 2NV2A 2ZRWA 3OVPA 2E6DA 4NNAA 4Z1BA 5DY3A 2PRLA 1O5KA 3UZJA 3L5MA 2LLEA 3M7WA 5CSSA 1AL8A 2HSAA 2E1DA 3TMQA 1HL2A 4MLJA 4CLMA 2X30A 1X1OA 2YCEA 4O14A 1RQHA 1XBXA 2FB2A 4FX8A 1TPFA 1LOLA 1BKSA 5D37A 2VXNA 1GZGA 4OGZA 3EX6A 1PIIA 5D33A 1EP1A 5A8GA 3STCA 5E1QA 1I2RA 3RK8A 1TV5A 1SW7A 1C9DA 4XKYB 1T99A 3IGSA 1QPNA 1TV7A 2GVLA 2QJGA 4JX4A 3SJ3A 1T0OA 4I7VA 1XBYA 3EEGA 5KSWA 4IXHA 1H7WA 1LDCA 2A1YA 1H51A 3MUXA 5DBUA 5KTLA 4HSNA 3UWVA 4MLRA 4Z0JA 2C15A 3EWUA 3QFEA 3WJWA 3C0JA 1I4NA 3C2EA 4UTIA 2QUUA 3BV4A 4I7WA 4WXZA 3F4WA 5CKSA 1UUOA 4TR9A 3I6RA 3GDTA 1MXSA 4M7SA 1RPXA 3A21A 3BGGA 3W2MA 4LVAA 1H7RA 4FNRA 3W7IA 5LHEA 3P67A 3HG3A 1PCWA 5FESA 3L67A 4N02A 1ZAHA 3NQGA 4HKPA 2CW6A 3TFCA 1JQVA 4WOZA 4O16A 1SZEA 4QISA 1G67A 3LCXA 1KM0A 3W7RA 1XKYA 2WJZA 4E2DA 2J9YA 3KRZA 4WUIA 4JD4A 4YCOA 2GQAA 1VHNA 1QOQA 1TTIA 2X1TA 3OIXA 3R5EA 5I3GA 3EXRA 3HGOA 4JTEA 3GR7A 3DFPA 2QCFA 3PM6A 3STEA 2AAMA 2EHHA 4R53A 2YXGA 1F6KA 3LLFA 3LCGA 4HNNA 4JTHA 4O4VA 3PS7A 5CPNA 3PBVA 2H3DA 2C6QA 3QQ1A 2TMDA 4O1DA 4PL2A 2NX9A 1JULA 4IWWA 3FLUA 3TH6A 4DQWA 4FEZA 4IXXA 1M5WA 2J9ZA 3RLUA 1JRBA 1TTPA 1YLVA 2B7QA 2ZZ6A 2ZA2A 1XDMA 1P0KA 3NQAA 1Q45A 2OT1A 3LGEA 2J24A 4KWVA 5CGQA 4A2SA 2Y7DA 3GAYA 3M1ZA 1KBIA 3HG2A 4LVDA 1HG3A 3WK0A 2CLOA 4JTLA 2CLIA 1W3TA 3UWZA 5EA9A 5FEPA 2Z1BA 2ZDRA 1FCVA 3EX1A 2J9XA 3W86A 1C8VA 4MY9A 3TC7A 2ALDA 2TPSA 3L66A 1DQWA 1H61A 4IPIA 1AMKA 4NX0A 4LOCA 1TYGA 1K8XA 2VFFA 5KITA 1NAL1 5CG7A 3OHIA 1R30A 2A7RA 1JJKA 4LRSA 1R47A 2ZRVA 5U4NA 3VE9A 4LUIA 3V1PA 3IEBA 1Z44A 1AK5A 2D73A 4PEKA 4JEQA 2XN0A 1ZJIA 3QF0A 5LHFA 3O06A 3P84A 1QWGA 3AJXA 1PHWA 3ABQA 3NL6A 3OG3A 3H55A 1M7PA 3BW3A 2V8ZA 2OJPA 2JKAA 1N55A 1TMHA 2H6RA 4JGDA 5D03A 2CLKA 2CZEA 3S5OA 3FJ6A 3LBCA 4PL1A 2A5HA 4AMAA 4JDBA 3M16A 4PA8A 1T96A 2DJXA 3LCWA 2NV1A 3DENA 4LC8A 4IMGA 1UB3A 3IIXA 4O0KA 5HWNA 1JCNA 3GX9A 4AHQA 1DOSA 1VYPX 2W0UA 2A6LA 3BG9A 3IRDA 2GVGA 4JTFA 2FB3A 3DBPA 2A6NA 4MKNA 4RCXA 3P60A 3KAOA 4A21A 1LBMA 3QSRA 3WJXA 5F2LA 3T55A 4XUGA 2QAFA 2Y6ZA 3QMRA 1KW1A 1G4PA 3HB9A 4U28A 4O53A 3UWWA 1OHLA 3CTLA 1LRNA 3S1WA 4C1LA 3U6WA 5DCEA 4K38A 4MYAA 2V5LA 3NPWA 5J5DA 4GJ1A 1OF6A 3BK0A 5D32A 4QSHA 2X1UA 1MSSA 1KLZA 4OV4A 4PTNA 3W1XA 2RDWA 4Q4KA 3NPUA 3G3MA 1EP3A 1X8FA 2YW3A 4LY8A 3W1TA 2ISWA 2VFHA 1FXPA 4RZ5A 3W88A 3GXNA 4M6VA 2YZRA 2PURA 1DJNA 1ICPA 3NL5A 1UJPA 5HINA 4ZMGA 4N9BA 5LZLA 3GVGA 4HNVA 3GKAA 3BO9A 5SWUA 1RZMA 1Q6RA 4JIPA 3HG4A 3W1RA 5IBXC 1THFD 3ANYA 3MHFA 5K4ZA 1XFBA 3KRUA 1MO0A 3QSTA 3S6DA 1B4EA 1MEIA 3C3NA 5AHMA 3B05A 1P4CA 3W75A 3TXZA 4DO6A 1KFEA 1FUYA 1VLIA 2QUVA 4MJMA 2QKFA 2RDUA 3NAVA 5F2MA 3A5VA 1A5BA 4Y9AA 4BWLC 1I2OA 1CX9A 2NUXA 4H4IA 4JN6A 3B4UA 4MPQA 2Q8LA 1ZFJA 4UFMA 3PR2A 2VFIA 1JCYA 4Y8FA 3QH2A 4IQLA 3O16A 2Y85A 1VYRA 2YX0A 3G1VA 1EIXA 4EWND 1LLZA 1YTEA 3L68A 2I14A 3N9RA 4AWTA 1NEYA 2NWSA 2R14A 3NZ1A 2Y7GA 4S2BA 3KOFA 5FF7A 1AG1O 4ZQMA 6ALDA 3O6DA 2WOQA 4N4PA 2NUYA 1IIHA 3W70A 4WZHA 1H7PA 3PBYA 5C54A 1SZNA 3TNOA 1VC4A 4JYDA 5K4XA 3HGJA 3NXFA 1HUVA 3CIWA 4W9TA 3IGXA 2WNNA 4U4MA 1H1ZA 4O0ZA 2J27A 3FJLA 1GYLA 1JVNA 1DL3A 3UPWA 4TO8A 3NR0A 2DJLA 2ZZ3A 4RXGA 2FTPA 5K7JA 3KX6A 5D2WA 4AEOA 3MI2A 1KM3A 1WAUA 2GJLA 3TW6A 3DI1A 2BZNA 1R2TA 1YTKA 3EXTA 4O18A 4OHQA 3EX2A 3T4CA 4DF0A 3ZS4A 2FFCA 2H8ZA 5IBXA 3P5ZA 1VS1A 1NSJA 3LHTA 3NZRA 1X1ZA 3UZ5A 3O8AA 3NQVA 4CNPA 3BG5A 4XTIA 1G69A 3TQ0A 3STFA 2HTMA 3NQ6A 3MP4A 5C6MA 4O54A 2YFOA 5D2TA 1KTCA 3DFSA 2DU2A 3W7EA 2JGYA 1W1ZA 3NOEA 4LUJA 2V2HA 5BNKA 3W7PA 2EPHA 3W7OA 4UTTA 2QJIA 2A7NA 3T44A 1S5VA 1QCWA 4UC5A 4NJHA 3MYPA 4UNLA 3UD6A 3CB8A 2RKXA 4AB4A 3O6CA 1OX4B 2AQWA 4CCCA 3FYPA 2DZVA 4NXKA 4RKAA 3B0UX 4J9JA 3W23A 3WK2A 3NL2A 3TMLA 2YYTA 1K3UA 1L9WA 2JKPA
chains in the Genus database with same CATH superfamily
1NP2A 3FA3A 2WHKA 1OT1A 1ZU8A 4YIWA 4NKCA 3WDRA 3ABOA 2C1IA 3O1NA 5CPQA 4JX5A 3QPZA 1FCBA 2FJKA 1A5SA 2NVAA 4LB4A 4PCSA 1BWVA 2ISDA 1W31A 3B8VA 3GIQA 4TQTA 3GG8A 3MZNA 1GW9A 4N9CA 3THQA 2XISA 2F61A 2C7FA 3AHXA 2DIJA 3E2RA 1HX0A 4K1WA 2CPUA 4M8UA 4NZCA 4Q8VA 4M6UA 2B0MA 1TWSA 3E0IA 4LBUA 2CCRA 3TYUA 2ZQ0A 2GGIA 4H3DA 4RE2A 3VI2A 9RUBA 4F66A 1FDJA 3S46A 4OWGA 1E6ZA 3VX1A 2RHGA 2BHZA 1XYBA 3AZTA 3GNOA 2OT0A 5HK4A 3MI6A 1W5NA 1Y65A 3AYVA 3FIGA 1KFWA 5EGRA 1ZQ5A 4JXCA 2C16A 4M6QA 1CNVA 2GK1B 2UZ9A 2XSAA 4AW7A 4KT2A 3LEPA 3U8GA 3G6MA 1S5WA 4KETA 4QNWA 4HU0A 2YCLB 3MP3A 3HQ1A 3GZ3A 1NH6A 5GJMA 2HJPA 4XWUA 1JPDX 4TMBA 1FFRA 1E0WA 3ERPA 3BQ6A 4JNMA 1LBLA 4D6DA 2CLHA 1I75A 1MEWA 4D6IA 1JI2A 2CZDA 4H7VA 2R8WA 3EOUA 3T2OA 2D22A 4DJDA 3CYJA 3W22A 2NT1A 3IV3A 4I9TA 4J3XA 3W29A 4CQAA 3GHSA 4X2RA 3N15A 3AO0A 4RL3A 1JI1A 4GQ0A 4H6RA 4Z2HA 2G95A 4LVFA 4V27A 3GO2A 3WDJA 3CV7A 1TPVA 1US0A 3SN1A 1OF8A 1GW1A 1P0NA 4AQLA 3GUWA 4A8NA 3OHMB 3HFTA 1H7XA 1R6WA 3OBEA 2Y61A 4DHGA 4B5TA 2E6AA 1MQRA 2INFA 3OO2A 1E4NA 3NQ2A 3NO3A 4ZA0A 4BA0A 1XQLA 3QYQA 3PTMA 3T40A 1AZ1A 3A5FA 4RDVA 5FEXA 3CB3A 2E77A 5JH1A 4CEUC 4JTCA 2XFWA 4E3TA 2QMJA 1XBZA 5H6HA 1ITQA 2E4TA 3RF9A 2G4JA 2XJ7A 2GUYA 3H6OA 3H12A 4GWEA 2PTWA 4AVOA 2HZGA 3CZKA 5CJNA 1YNQA 3K4DA 4Q33A 3RU8X 2VEGA 4LAUA 5FF2A 2V5DA 4PMRA 1LRQA 1NELA 5CJMA 1JXKA 1QNVA 1SGJA 2Y62A 4J3WA 4I5XA 1ML1A 5XINA 4AD4A 4HZ6A 5BMWA 3THUA 1SSDA 4KQNA 2CLEA 2J77A 1GOQA 4WSKA 1NY1A 5FAJA 1E4MM 1ZHAA 4HGXA 4AFYA 1ZNNA 2YLLA 4O11A 3KCJA 4IMFA 5A6JA 1RR2A 3R2GA 3KHDA 3C2VA 1R3YA 5I3FA 2CXGA 3NSNA 3QOMA 4TV5A 5GJPA 2EPNA 4K1GA 4DO7A 3BWWA 2PDGA 3M47A 2ZZ1A 1UCWA 4IJBA 5BRBA 4L61A 1KXQA 2VEPA 3GVVA 2VENA 5CQ1A 2YCJA 4DUWA 3LV5A 3TJLA 4CEXC 1K02A 4AVFA 1LP6A 3TW7A 1MQQA 1W1VA 5LNRA 3GBDA 1NM9A 1K9TA 3SI9A 3C61A 4D6HA 2Q02A 2WHLA 3I7SA 2DFAA 1KQZA 2V81A 4BI6A 1VEMA 4HYVA 1S2WA 1YBQA 2DZPA 4IMEA 3RO6A 1UUQA 3S83A 1GTHA 1VYSX 4HHPA 5FIPA 2GSJA 1HFBA 1W8GA 1V02A 2F38A 4XD4A 3UY8A 3N14A 1JCJA 1ADOA 4IQEA 1W6TA 3UYCA 4XQ6A 3WQ8A 4AY8A 3B0YA 4WY0F 4UTFA 4GY1A 4PMUA 5REQB 1RD6A 3LXCA 4C5YA 4ZB0A 4AWUA 5HDRA 4I6VA 1BYCA 3VNDA 3MMTA 1UR2A 4C6FA 3SQMA 1VIWA 1GEHA 1L6SA 1JYVA 4CQ8A 3WK1A 3WBXA 3WH8A 1IR2A 3QHNA 1E5JA 1A53A 2FVLA 2ISSA 5D04C 2Y89A 3FXYA 4C60A 2EAWA 2I56A 4TMCA 5HBFA 3LHYA 1Y5WA 1Z69A 1XC4A 3VDAA 2F7FA 1JCXA 1DPMA 1S1RA 1LM1A 3E0WA 1OFBA 3CUXA 4A22A 4LC6A 3TW9A 2P50A 3T0DA 1IXQA 2DZXA 3VGHA 1V3MA 2VTFA 4LUTA 4H9YA 1M1BA 2A85A 3IK4A 3SGGA 5HANA 3W7DA 2RDXA 1XCWA 3DERA 4J3UA 2VMFA 5HMEA 3SBFA 3FA4A 2ONEA 4A29A 1GGOA 1FY6A 1U1UA 5EBUA 3POCA 3V5OA 2JGQA 4MNMA 4GUIA 1GJUA 2DVXA 3EWBX 1TZ9A 1YDOA 3RCMA 2WJEA 3ATYA 4HN8A 1S46A 2ZE0A 1O5QA 1MRAA 2HVNA 2VX4A 2E5DA 1NOFA 3VCNA 4IT1A 1C8YA 3A3XA 3BURA 1R2SA 1QT1A 3DFHA 4DF2A 2ADAA 5I06A 5KZDA 3JR2A 1OC7A 3VIFA 1TPUA 1CWYA 1AL7A 4LB3A 1C93A 3VIGA 1LCOA 2ZC8A 2ISVA 3W7GA 5AVHA 1S38A 2PU0A 1SO5A 1F8MA 3GDLA 4A2RA 1K8ZA 4DZ5A 3U7BA 5CC5A 4GISA 4XO7A 3CL7A 5CZJA 5A1AA 1J2WA 1X6LA 3PUEA 3AYSA 4JX6A 4DB7A 4GCAA 1WAWA 3BAKA 3FHQA 4ZOAA 3XISA 4PFMA 2ZTJA 1GQKA 1YPXA 4YMZA 4PTDA 3NL3A 1UH3A 4TU1A 5MKGA 4HBKA 3M5YA 3S3GA 3BLDA 1OFAA 1R2RA 4LTSA 3FJNA 4BWLA 1GVQA 5LIYX 3ZSTA 4OQVA 3RLGA 1IXNA 1TIWA 2FH8A 1F3TA 3R1ZA 3EKGA 1R86A 2DSWA 2Z1VA 2A3LA 3SCNA 3KZSA 2Z2UA 4JQ2A 2XGZA 4MNJA 1FVPA 2DVTA 3BGJA 1ONEA 1YNPA 3NM1A 1JNEA 3JS3A 1Z6KA 5CC7A 3G8RA 3BQ5A 4QE5A 2NWRA 3KVMA 4B5SA 5BW6A 3EWXA 1K77A 2E1WA 1FXQA 4NYYA 5U7SA 5JBFA 4M1BA 4QQUA 3N2OA 3AYTA 4AIUA 3SQSA 4O4WA 5FL1A 5HWMA 1O4UA 2ZUMA 1VFSA 1EQPA 4ZQCA 1LQ2A 1XGDA 4WY0A 1H4PA 1ODUA 1T7LA 3QR0A 3NZQA 4MSSA 5A5WA 1PPIA 3SADA 2CWNA 4HSOA 3OGVA 4UQCA 3EX3A 2YYUA 1KR1A 2QDHA 3MHGA 1XYZA 5GNYA 5EMMA 2FIQA 3UG4A 3IACA 4PRRA 3CIVA 4J2MA 3GNPA 3C0SA 3GTHA 4R7OA 4PMYA 1BXCA 1BYAA 3AIEA 3LBOA 2EGZA 4ZR8A 1BF2A 2PBOA 4IGHA 4I9JA 1LBFA 5AVNA 2NV9A 2A3EA 2BGSA 1UUMA 3HJEA 1EA9C 1UMLA 3N4EA 3BW2A 3U57A 1E1FA 1XG4A 4IH3A 4HPJA 3WQPA 1L6WA 4EF9A 4H8UA 4BF9A 2XZ9A 1YW1A 2HBXA 2GPTA 4C7GA 4YTRA 4UWMA 2ZUNA 5DFAA 4UB9A 5I03A 2J4GA 3NSXA 4PUWA 1JUKA 1SJDA 4B9YA 4F4RA 1Z8AA 3QXBA 4QLKA 1TJPA 4AWEA 4JCLA 1F6PA 9XIAA 5BROA 3WQ4A 1L2UA 2PZNA 3WD1A 1ISXA 4AF0A 5C2CA 1JDAA 5JVLA 1GPWA 4AISA 1SW3A 3F2BA 4KH2A 3BCJA 3FVDA 3TUUA 5D2YA 3QZEA 4C90A 4NJJA 2HK0A 3DYOA 3K2GA 3M0LA 4AZ6A 2GVEA 5G1YA 3VDHA 1Q4WA 3EOSA 3OG2A 3MHUA 1MW3A 2QJHA 4N4QA 5H8UA 3UY7A 3QLDA 1Q2SA 3MP5A 1QI3A 1VCVA 2ACRA 5GVJA 7TIMA 1TPC1 3P8IA 1DWIM 3ZR4A 1XRFA 4H00A 2EJ1A 1R85A 3A3HA 2ZX5A 1SFLA 3C2FA 3W73A 3CHCA 4S3CA 4PGLA 2IQTA 1BRLB 3LOTA 3PWAA 1K7XA 4PMOA 1HO4A 2GDVA 4X63A 1DORA 4M7TA 4ZO9A 2DEPA 4EACA 4WEVX 4JYFA 2VGFA 3RJXA 7ENLA 3LGGA 1LLOA 3TDFA 1CEOA 2D3LA 2QCGA 3WK3A 3DYMA 5JQ9A 3WN6A 1HL9A 5CPSA 1A5KC 3PPGA 3WDHA 1PVNA 4O0QA 2J88A 1F7BA 1XWYA 5J5RA 2QCCA 3A12A 3NDOA 3QBUA 1G4EA 3GWQA 3VOJA 3W1QA 1QPOA 4ALDA 5I24A 3H2OA 3V35A 4RLIA 4K36A 4GLEA 3BCDA 3WLLA 3EPNA 3L4VA 1HJVA 3W0KA 1F8IA 1TRIA 1T41A 3VOHA 4FHAA 3OPSA 4MUPA 4P61A 4X9YA 1CXIA 4WSJA 1CGTA 2WSRA 5I7GA 3GG1A 4KEZA 4Y2WA 3N2TA 4QHRA 1EDQA 1TQXA 4MVAA 4IFRA 2Z26A 1VPXA 3GB6A 4W7VA 5LXXA 3CQ0A 4HMEA 5AHEA 4CD7A 3DAQA 3QY6A 5C55A 1W1PA 4O1BA 5AHFA 4ICCX 1SUXA 3LXAA 2VX7A 3B04A 1XISA 1A5UA 4C6IA 4GXPA 2B7NA 1WBJA 3W7CA 3OGSA 2QPUA 2OZ0A 3TOPA 3SR7A 4IG2B 4QR6A 3VKAA 4KRZA 2CC0A 1M7OA 4Q7BA 1OFDA 3DDMA 5TQLA 1FHLA 4MB1A 3W85A 2J79A 3PJUA 3VK5A 2GGEA 4ZQPA 2ZOXA 4US5D 1A5CA 2PAJA 4JTKA 5FEZA 1W3NA 4GRSA 1RPKA 4JZ5A 4YCPA 1G0CA 2OQLA 3UFYA 3SCOA 1VF8A 4C5ZA 3K5XA 2XVNA 1E43A 4IZGA 1XF0A 3KRBA 3B8DA 1EGVA 1NARA 4BR1A 1LT8A 3NDYA 1QW7A 1OGSA 2WKJA 5DO8A 4I3GA 3VDGA 4GYPC 2G3FA 1GVOA 2CYGA 2ZWZA 5IHSA 1S2TA 2P5NA 3UCCA 4E5TA 3RXZA 4RE0A 5FF3A 5ENLA 1DJXA 1RJPA 3WUGA 4J4KA 3PF3A 4RZ6A 3OVGA 3T07A 2FGLA 1XP3A 2NQZA 3EWCA 4ATWA 2OGJA 3ZWTA 3UERA 3BLLA 5M17A 1QXLA 1QOXA 5KZMA 4E38A 3W7LA 4A3HA 3PBGA 2G96A 2P1FA 4MJ4A 3G1HA 3BTNA 3SIMA 3MJMA 3FS2A 4OU1A 1J11A 4IIFA 2PU1A 2W63A 1VGAA 4JYEA 4AYSA 3GVWA 2I1OA 1VFLA 1UR3M 3RDKA 4PBFA 1JD7A 1V3IA 3OW1A 1BGGA 2D2OA 2VRQA 3B8TA 4UCGA 4GC3A 1D9EA 1GKQA 3KVLA 1YPFA 4JY9A 4R33A 3QW4B 1K03A 1GOXA 4FK9A 2H9AB 3I3EA 1EUNA 1SZRA 1FOBA 1RXOB 5CPMA 3GXMA 3DFTA 2ZRYA 4AX7A 1QW8A 2CESA 4G8TA 3RGTA 5AHLA 2Y7EA 5A6LA 4PRWA 2R6OA 2ZUTA 4XZHA 3OZYA 1AFSA 1PZ0A 1E72M 2Z1KA 4UTTC 4WLCA 3ARTA 4Q6XA 2V9DA 5BMXA 5HR6A 2D2GA 3MDWA 3S5ZA 1ZSXA 2ACQA 2Z1WA 1SR9A 1RBLA 5DT7A 5E6YA 4KF1A 4XD3A 4RDZA 2QIIA 2QCLA 1DVJA 1RQBA 1YPIA 4DLFA 2XSBA 2VR2A 3L4XA 4ADTA 2P8CA 2PBGA 3CS2A 4DJFA 4XKMA 3EGJA 4ATDA 4QAWA 1CYGA 1OQFA 3QTGA 3L5LA 3OLIA 5LA2A 2R24A 3WQCA 1VPYA 6PTDA 2J7FA 5HWJA 4KKXA 4MYXA 3U2ZA 4NIRA 8A3HA 1TFVA 1QVBA 3N19B 5CBBA 2L5HA 3ABRA 2FGZA 2HE5A 4JIQA 2FHCA 3R8HA 1X6NA 1EEPA 5TIMA 4PZVA 1DEDA 3LHUA 2ZUVA 2IKHA 2OU4A 5EFFA 3KWXA 3WEOA 1XI3A 5HJLA 1DBTA 4L9YA 3LCHA 1PCKA 3PBMA 4GACA 1W1A1 1G9HA 1HNYA 5BRQA 4AVNA 3LTSA 2GWGA 4UMBA 4HZ8A 1BXNA 2EO7A 2ACSA 4F2UA 2DIEA 3USBA 1PO9A 1W8SA 2NQ5A 2ICSA 3SRKA 2WO5A 4DWSA 3VZYA 1L8PA 3EA2A 2QCDA 3AIQA 2PDPA 2BOGX 2XZ7A 4RNJA 3PJTA 2EKCA 1VAHA 1KC7A 3NYDA 4GUJA 2WWDA 4W5UA 4UFLA 4GFSA 2G37A 2P3ZA 5DQPA 1W9UA 1H50A 3EDFA 3AI0A 2IKJA 3U4FA 1OIFA 4Q3MA 2Y1HA 4OV9A 1E70M 3WL0A 4M19A 1O60A 4X9SA 4RK8A 3CNYA 1P1MA 3RR1A 3DBNA 1L6FA 2GJXB 3B8UA 4F9DA 5E0CA 2XGIA 4AH7A 4GZEA 1HZYA 6TIMA 3NQ8A 3GLCA 1KM4A 3OA3A 5I07A 3H2EA 5LNWA 3IJ8A 1UD2A 1FTXA 1W91A 4GUGA 4S3KA 1TO3A 3TNBA 3TKFA 4KEVA 2YLAA 3KHJA 3M0YA 1ZCOA 4UFIA 2CZ5A 5AC6A 4OECA 2R94A 3URAA 1D3HA 4NZFA 1Z42A 3V5CA 4WX2A 3SN0A 4ZEPA 3OVPA 2E6DA 1I60A 1PKNA 4Z1BA 5DY3A 1K4GA 4B2DD 5BRPA 1J0ZA 3BGAA 1RP9A 1J01A 4LQ1A 4C7FA 4Q4PA 1UD6A 1BLIA 3RR4A 1BGAA 2ALRA 2CIPA 2PDMA 3TR9A 2YCEA 3E5BA 3CMFA 3RILA 3VM7A 4FX8A 1DJGA 4YWSA 1W9PA 5D37A 1IE7C 4WKFA 3EX6A 1E4IA 4FR1A 5A8GA 4QS5A 4BQ3A 4G7FA 4Z42C 1CECA 4EPDC 1POJA 1TV5A 2DSVA 1C9DA 3IGSA 1WPCA 1QPNA 3W26A 2QJGA 1XSKA 1NU5A 3URBA 1NIUA 4F0RA 3UZWA 3TN5A 1E9LA 3QV6A 3TYZA 1S2AA 2AMXA 3PANA 4IXHA 3GR4A 1H51A 3GVQA 5LA1A 2EPMX 4QG6A 4ZTYA 2CBJA 4M56A 5CKSA 2Y4SA 3F4WA 4WVXA 2ZADA 3RLHA 4AIBA 1RPXA 3BGGA 3SCSA 1M04A 1H7RA 4FNRA 1SJBA 5LHEA 3KOWA 4AU0A 4MWAD 3LMYA 1RCXB 3MUAA 4GD0A 3TFCA 3MMWA 4O16A 4QISA 1BF6A 4AD1A 3W7RA 3ANVA 1XKYA 4D6GA 2GGGA 2PWHA 4DBSA 2OX4A 4F0MA 4WUIA 4CCZA 3B9EA 1D2KA 2E7FA 1QOQA 3Q45A 5XIAA 1HVQA 3KBSA 4KPLA 2X1TA 3DFPA 3A4XA 3STEA 2EHHA 1PX4A 1AD1A 3WX7A 1F6KA 4OBRA 3I6TA 1JD9A 3N04A 1TE6A 3WLKX 2GWNA 3FDKA 1JULA 2DPEA 2C1GA 2FHBA 4XBJA 2BMBA 4I8YA 1M5WA 1OD0A 3BJTA 2ZA2A 4C6KA 3SCQA 1TV2A 2J24A 1ZLPA 4HHLA 1TWWA 4A2SA 4ZE4A 3ARZA 3HG2A 4HK6A 4LVDA 3FXGA 3WK0A 2EXOA 2CLIA 4ZB2A 2V69A 1W3TA 4F79A 3UWZA 4UZSA 2ZDRA 3TC7A 4MY9A 3BMVA 4NSBA 4CN4A 4RE4A 2TPSA 1ZBWA 1S2CA 4IPIA 3N29A 1B54A 5G1MA 3A6OA 1K8XA 2I7GA 1F3XA 4JN8A 3MSYA 2A79A 1WXZA 4KS0A 4LRSA 1R47A 3VE9A 4LUIA 3DYPA 3V1PA 2WVVB 3RM9A 1AK5A 1HKKA 1V0MA 3WEZA 3QF0A 5LHFA 4YTUA 1E71M 4ROQA 1QWGA 4KGJA 3GUGA 1PHWA 3OYXA 3NL6A 3OG3A 1B30A 1ZCCA 3BW3A 4YVPA 4GA8A 2OJPA 2YIHA 3MT1A 2H6RA 3CMJA 5D03A 4JGDA 2CLKA 2CZEA 1UKTA 3M16A 1ZBVA 3ITCA 4IIHA 1T96A 1NFPA 1W9XA 2GOKA 4DRSA 3WNNA 1EJTC 1B1YA 1UB3A 4XVDA 1DE6A 1O68A 4O0KA 1GPFA 3SUSA 1CB7B 2WM1A 5GPRA 1XLHA 3MPGA 4Y9PA 1U1JA 3NUKA 3CT2A 1S39A 3DBPA 3TWAA 1PUDA 2A6NA 2VZTA 3P60A 1D7FA 3KAOA 4FMVA 1LBMA 3QSRA 3MUY1 3SEPA 4XUGA 1G4PA 2BVDA 2Q8XA 3AMGA 1JFXA 5AZ1A 1OHLA 1Z7AA 3CTLA 2OOGA 4K38A 4MYAA 5A6AA 1FH8A 2BP1A 5PTDA 3BK0A 1L2QA 3COTA 3CWHA 1G94A 2X1UA 1X38A 1MSSA 3KS5A 3OU8A 4Q4KA 1WZKA 1QNPA 3MSRA 3ANUA 3W1TA 3WLOA 1ISVA 2VFHA 4HQVA 3VZZA 4RZ5A 2OLAA 1QBAA 2PDCA 2REQA 1DJNA 1E4LA 3NL5A 4ZMGA 1UJPA 5LZLA 3GVGA 4HNVA 4Q8QA 3GKAA 4EPBC 4A4AA 2F6XA 1RZMA 4GIYA 1Q6RA 3E0LA 3O0KA 3HG4A 3QGKC 3OTRA 4F0KA 1EYWA 3S6DA 2A3AA 1VFTA 5FJRA 3W02A 3P14A 1MEIA 2DIKA 1J9YA 1FUYA 1KFEA 3CHEA 5HXMA 1E9YB 1A5BA 1E0UA 4Y9AA 3BAIA 2Q8LA 1ZFJA 4UFMA 4XSMA 3GC4A 1BFNA 1JCYA 3QH2A 3BSHA 3B9NA 3G1VA 3CO4A 3VC6A 5CG0A 3PZIA 3L68A 3FGCB 3N9RA 3NZ1A 1AG1O 5I5RA 2WOQA 4A3YA 2NUYA 1IIHA 3W70A 3PBYA 5C54A 4D72A 3V7PA 1VC4A 1ZUAX 3HGJA 1LL4A 2DUXA 4ZO6A 1H1ZA 1Z3NA 3UGVA 1GYLA 1JVNA 1DL3A 3NR0A 1NOWA 1FWHC 5K7JA 3CQKA 3KX6A 3ZLGA 1UA3A 2GJLA 3TW6A 3DI1A 1PYMA 2BZNA 4Q8MA 4V33A 3RX2A 1R2TA 2VZOA 3ZS4A 2FFCA 5JH2A 2POTA 3P5ZA 4M81A 1RY0A 2PD5A 1X1ZA 4F0SA 3NQVA 4GIRA 4L80A 1JPHA 2WKGA 3MP4A 5D8ZA 2YFOA 1RUSA 2FZ8A 3NEHA 1UC5A 1A0EA 2OWXA 2V3GA 4FXJA 4WGHA 4IIEA 3W7OA 1X97A 2QJIA 3WNLA 3AS0A 5JXQA 3V16A 5JIPA 4LGXA 4C6BA 4QLJA 4GCXA 3O6CA 3DESA 1DWFM 1U22A 2PWFA 3FYPA 3B0UX 4J9JA 4ZB5A 1K3UA 4LAZA 4OOUA 1VENA 1H2JA 5HR7A 1W17A 3P2VA 4PMNA 1LWIA 3CTTA 5M5DA 2V5KA 3UT0A 4ZOEA 2P88A 1I6NA 3GZAA 1REQA 2OXNA 2OZTA 1FHDA 1G01A 1S1PA 4HZ7A 1V3HA 2VDGA 3BL3A 2V3DA 2J25A 4WY0B 1Q3NA 2ZX7A 1Q2RA 2XHYA 3TSMA 3VGBA 3QEZA 1E0VA 3H70A 3BPWA 1Z89A 2DVUA 1KFCA 4HK5A 4OOZA 2YL8A 3ITYA 5I3DA 3EXSA 4DXVA 4QLLA 5A6MA 2W3ZA 5CC3A 4L4LA 2XUCA 4BI5A 4OE7A 3VFLA 3APYA 2FPVA 1EC9A 4Q7IA 3W84A 3O9NA 2E3ZA 4KWUA 3WFLA 1L6YA 3BLIA 3Q2DA 1FH7A 2O7SA 4O8RA 4DJED 4MNKA 3M5VA 2DZWA 3DUGA 4TVUA 1Q6QA 4PBEA 4DEFA 4JNYA 4LS2A 3ZOAA 4K2SA 2XIBA 3WDIA 3I7RA 4CU6A 3THCA 2VELA 4JIIX 5A8NA 4D8LA 1F2JA 4KRTA 4IGNA 4J27A 2HISA 3QLLA 4LVBA 1GEQA 1WKEA 1GONA 4P7QA 4AF0B 4QGCA 1ENUA 1H60A 3P0XA 1AH3A 2FPYA 1K7FA 5E0KA 3R8RA 1UD3A 2VZVA 5T8GA 4LRTA 3IPWA 3GH7A 1KGXA 4GI8A 3M44A 2X41A 3CLMA 1MI3A 3EMZA 1HJXA 2HROA 3HFYA 4FAMA 1MXDA 1CI1A 2HWGA 4OBSA 4GYFA 3QW3A 2YCLA 2EPOA 3A23A 1QI4A 4NG3A 3PBWA 4XG1A 1V3JA 4X60A 2OSYA 3UXKA 3CAKA 3RMJA 3IGUA 1B4KA 1JEZA 2CZFA 4W89A 2IXVA 1WOAA 1EDGA 4XK2A 5FJIA 3NPXA 4WF7A 4K3ZA 1OIMA 2OMAA 1R7OA 1V8EA 1QPKA 1CGVA 4XKYA 4Q8WA 3SRDA 4LSBA 3WBYA 1KRMA 3ISIX 5F2GA 2DY3A 3U5UA 3TTQA 3CZJA 2C19A 3P93A 3P0WA 4AD2A 3NTYA 5G2HA 4DJEC 2B7PA 4NAEA 1MUWA 3WJSA 4X3ZA 5BXPA 1DIDA 1B3YA 1I9CB 1EC8A 3GNRA 1EO5A 3HQPA 4RDYA 2QAPA 2Y24A 4O28A 3VE7A 3NFUA 1R46A 2C3ZA 4R85A 4W87A 4AZ5A 3FFSA 4QE1A 3W1LA 2QEZA 2DZSA 3S42A 3DGRA 2CU0A 2ATMA 1UH4A 1OT2A 1UBPC 1XH1A 2OTDA 4KFNA 5D9NA 1PIFA 4XO6A 1Q6GA 2WANA 6XIAA 5FSDC 3AWNA 1ONXA 3M0KA 2YA0A 1E5NA 4FZIA 3REQA 3M5XA 3M46A 1O7AA 4WQ6A 3NGFA 1IEWA 3ARVA 1V0LA 3N3TA 3M07A 4JY8A 4Y96A 3EWWA 2ODOA 4O12A 3UF9A 4TVDA 1AQHA 4W86A 2J6XA 4QQ3A 3UXDA 3CIXA 3QY7A 1POKA 3E5PA 1EH9A 2ATSA 4LFYA 3WLTA 4EAMA 4NQ1A 1UH2A 2GGJA 3WG6A 1Q85A 5A95A 3L0NA 4JKLA 1YDVA 5K9CA 1SR0A 3WNKA 2PI6A 1QR7A 3N6JA 1R9XA 5AKQA 4PBGA 3G18A 1OFPA 1FWSA 2G3NA 4U2YA 1QI2A 1HGYA 2JF7A 4QIUA 1CENA 3RLVA 4DUVA 1J93A 5H8MA 2VOMA 5HQMA 4Z1DA 1WX0A 4CNSA 1ALDA 1FBAA 4MUZA 5D8WA 3GBEA 3S2JA 4A35A 1JYXA 5IXEA 4E2BA 3FKRA 2PA6A 3WJZA 1PV8A 2NX3A 4GIEA 1NVMA 4O19A 4WKAA 3TTOA 1DIKA 7REQA 1KFLA 1VR6A 3I10A 1J0YA 1KA9F 3CV2A 3POHA 1DE5A 1OZQA 1TCDA 1ICSA 1VCGA 4AD5A 4UCFA 1I2NA 3IVTA 4HHHA 3U3HA 3HBLA 3PC0A 3DC0A 1WXYA 1A5NC 2C91A 2IUZA 4M6PA 1M53A 3WH9A 2PGEA 3CO8A 4QJ1A 3HPFA 3BJSA 2A3HA 3B0PA 2XGBA 3PBUA 1W5MA 1EJRC 1QK2A 4GC4A 2FDMA 4U5KA 3EX4A 4DYKA 3IK2A 2RAGA 3VYLA 1V7AA 3FCPA 3IJDA 4H9UA 1HP5A 4EK7A 2VGIA 4UXDA 4UQEA 4K7VA 3U4AA 1KFBA 2PDNA 2QS8A 2EJAA 5A8PA 1Z41A 3W4RA 3S1UA 2ASHA 1LL6A 3ZIZA 3UPMA 1EX1A 4LW7A 3U5YA 4QEHA 1QPQA 3OBKA 1EO7A 3FYOA 1DJQA 4OTKA 3ZT6A 5CGTA 1QHZA 5REQA 2ZXDA 3HG5A 2A21A 3QPEA 1V7YA 1KXHA 3HPZA 1PDYA 2V3EA 3AIUA 4C1KA 3P80A 3G0SA 2VEFA 3M5ZA 1W9VA 4HPGA 4CVUA 3LCLA 1IT0A 1O5RA 4RW5A 2HS8A 3CPUA 5D9MA 3K8MA 4DY1A 1RJRA 3R94A 3DGBA 2PC8A 1R3VA 3MJYA 2C13A 3QFWA 3QGVA 1GVIA 4NAFB 4H83A 1DQXA 2GDQA 3KLLA 1P0EA 1XFCA 1TV4A 4IPPA 3SRFA 4JAWA 4V15A 4JTJA 3GW3A 2QT3A 3AJ7A 2J47A 5LIKX 2ZUUA 2I5GA 4H8HA 3W1MA 3HU7A 3AIBA 4QROA 3L5AA 5M3WA 4AZGA 3UU0A 3NVTA 3W1NA 1WZLA 3PNZA 3RRXA 4ZQRA 2G97A 1V4YA 1LG2A 3VGDA 1WE5A 4LH8A 4S2CA 3TN3A 4F9JA 3F5JA 1W5PA 2PDKA 4QFUA 2OYKA 1DYSA 2DH3A 2CHOA 3WQ5A 4HNTA 4GXMA 2OYMA 4ML9A 4C6DA 4HVXA 5AY7A 3G1DA 4XV0A 1H49A 3PK7A 7CGTA 3KBMA 4V2XA 2WNQA 3SCTA 4J2PA 1IEXA 3PG8A 4NXSA 2JK2A 1Q8JA 2WQPA 1FWJC 3VD9A 4ACZA 4NHVA 3NYZA 2XVGA 3E02A 4ZSTA 1C92A 1Y7VA 4UIOA 2QHAA 1TR1A 4U2ZA 4UOQA 1DIEA 4F0LA 5LSMA 2HS6A 3NQMA 1CXHA 3CLWA 5CPTA 1M3UA 5HPOA 5AYZA 1OJXA 4D6FA 4BFAA 2DT3A 4NL1A 1SMAA 2VD9A 4NNBA 2J7BA 3CWNA 3RUBL 4E8CA 1GG1A 1MUMA 4QG8A 1OFRA 2CBUA 3KXQA 2Z4GA 1OINA 1CTNA 1R9ZA 3EPOA 3T8QA 3NQDA 4PUEA 3P7YA 1C7TA 1DHKA 1QATA 3IAPA 4IQDA 4IIBA 4GH3A 4E4FA 4O1FA 2PWDA 1VZWA 1B9BA 3E38A 1BG4A 2XYLA 4AHPA 2VC6A 4I5RA 1QI5A 2ZRXA 1ECQA 1QHOA 3SUTA 5AYIA 3WUFA 1T8QA 2FMOA 3F03K 3W82A 2PDJA 1PL9A 3MTWA 1T8XA 3LV6A 1B90A 4DWSB 2NQJA 4AHOA 2C1HA 2NZLA 5JMUA 3KVKA 1WBHA 5JU6A 2GJNA 4ERGA 5K9DA 3AYRA 1U1HA 1BVNP 1P6CA 3W71A 4LANA 3KDOA 5EMLA 3MCNA 3N3MA 1HKIA 3A9IA 3N9SA 2V2CA 1YXYA 4PUUA 3C8FA 3IIPA 1CGUA 5EBAA 3ZYZA 8XIMA 4DBUA 4V1XA 5MF5A 1TWIA 4J3VA 2ZX8A 3MI3A 3A4JA 4EX4A 4H9ZA 2PLMA 4Q32A 4FB7A 1T6MA 1JF6A 1YEYA 4WJXA 1I2QA 3S5SA 3G1FA 4EAYA 4IHCA 4JFVA 3WLHA 4NUWA 1SM9A 2ZTKA 2PWVA 1X98A 3O6AA 1EKOA 2E8YA 3I4KA 5GNXA 3ELFA 3V3WA 4TVCA 4FXFA 4I9MA 1PEZA 3L2IA 7ODCA 1AW5A 1SFTA 4RJEA 4A8LA 3WF1A 5A94A 4ZBCA 3TFXA 3F4VA 1IEIA 3CH9A 1F07A 3S0CA 3N9KA 3PZUA 3S6TA 1CGWA 4HA4A 1W1B1 2ZE3A 2QGYA 3N6HA 3E96A 3PAOA 1S5NA 4I5UA 5EL1A 1GORA 2ESCA 1DTNA 4GX9A 4HT3A 3SGUA 2QW5A 1LRTA 4S23A 1J5SA 4LF2A 3A4AA 3CZLA 1DJWA 3VIIA 1OC6A 2WSQA 3NM3A 3B06A 5FKYA 2R1KA 1H0GA 3C56A 1OM0A 1ZJBA 4KEUA 3TP4A 1PTGA 3I3DA 3NQFA 5AYBA 2D1ZA 2OZ8A 2JFEX 3G22A 3TOYA 4GQGA 3CYVA 5DY2A 4L1XA 4XB3A 1J0IA 1LYXA 3A9BA 4LNYA 3SW6A 2Y63A 1SZGA 4J3ZA 2B31A 3UWUA 1GOOA 3MW7A 5A2BA 3GC5A 4TUFA 1O95A 2Q01A 1EEXA 1OX6A 4KCWA 1W2VA 4UTKA 4FOJA 1F4AA 2D0GA 5GQBA 1YE4A 3UA3A 2ZYFA 1J5TA 3NQBA 3TXVA 1UA7A 1G7VA 4UMAA 4JNZA 2QDDA 3I65A 4JCMA 1OWQA 3EOEA 4C65A 2Q6ZA 2W6RA 1CCWB 2QCMA 4GGHA 4Y9OA 4OBTA 1E15A 3T0BA 2X42A 3FKKA 5E0FA 4JTSA 1BRLA 3L21A 2OX1A 2WMHA 3CASA 4XAYA 2AQOA 4KGLA 2QCNA 5LKYA 3R4IA 1TPWA 1XGZA 3KCOA 2QMKA 2YPIA 2YSWA 4H9TA 2Y8KA 3OP2A 3AMDA 2PDIA 3F1QA 4ZQOA 3OLGA 2FYMA 3BLEA 4Z2IA 3QHOA 2YL5A 4MFEA 3SQLA 2X1RA 4W5ZA 5F7UA 4HYRA 5G2IA 3W2UA 3HN3A 3VGGA 2Z6IA 4UFJA 2Y5EA 3PPCA 4H04A 4U3CA 4NZ4A 3UZYA 3ABZA 3TQPA 3VZXA 1DXEA 1EP2A 2RH9A 4NZJA 4UTMA 5AC5A 1UIPA 4WDXA 4DZAA 2VRKA 1NTHA 3LDVA 2ZZ2A 3FV9A 2IQDA 4FNQA 3WQFA 2KX9A 1EX5A 1IGSA 1GKPA 1X7FA 1XM3A 2VGGA 4K8GA 2RJGA 4HB7A 1FDYA 2ABAA 3TAKA 1KWKA 1TPDA 3RO8A 3W07A 3BVJA 3Q58A 1TKKA 3L12A 3VOCA 1UWRA 2ZZ7A 2WMGA 4UQDA 4ATLA 1A0DA 4I6KA 3G6LA 5FF4A 1FKXA 3ABXA 1V6UA 3JU2A 3SURA 1ZBKA 1TJRA 3DFQA 5BCAA 3IIVA 4Z1AA 1UWAA 1UC4A 2QJNA 3G1AA 3MO7A 4LVGA 3N11A 3T08A 3UG8A 3QC3A 4HU8A 3HPSA 4XBKA 2RDTA 3QZ6A 1VB9A 4GI9A 3QQ0A 1DIOA 4L4MA 5HMSA 4PC8A 4QTGA 1XHGA 5ECUA 3WLPA 1S3HA 3ZLHA 1ISZA 1FDZA 3OEXA 1SO3A 4JKMA 3KS6A 1EWDA 1XIFA 2I5QA 2OLHA 3VOFA 1ZPTA 1AJZA 3NDZA 1CIUA 4JDYA 4K68A 4REQA 4DPQA 1RA5A 4LCRA 2WC4A 3LRLA 3PPHA 4LALA 1HL8A 1WP6A 3C0QA 3KUMA 3WD3A 1XYMA 2XTKA 2NVDA 1UZ1A 1H1YA 3M0JA 1H63A 2FTWA 5EKYA 4FA3A 2Z7GA 4PH6A 4MWAA 2BG5A 5RUBA 4ORMA 3TJ4A 1XIDA 4S38A 1CPUA 4GNVA 1V6XA 1EFZA 1X8CA 2QXWA 2VZUA 1HKMA 1JYNA 2W9MA 3CM4A 2CHRA 3GU9A 3KW3A 1YDNA 1JDCA 4H6EA 3KTSA 4S3GA 2Q09A 5BXSA 3CHVA 3ZQ9A 1WYIA 4PCFA 2XM1A 1A3XA 3NQCA 4PB5A 1RA0A 2TRSA 4WDWA 3W83A 2YL9A 3ALGA 4AIOA 3DECA 3WH7A 1OK6A 4AY7A 3W1PA 2FFIA 3MS8A 2PDFA 1KLYA 5HMDA 2XIQA 5K3VA 1UR8A 2PS2A 3USZA 1BKHA 2O9TA 2INEA 4KIEA 3PVFA 2QNEA 3E0VA 5C8BB 1ONWA 2QV5A 1CXKA 1Q6EA 1E6RA 4EWJA 1DWAM 3H7UA 1JCMP 3W6YA 4IMAA 5E9AA 4YXGA 3ITTA 3GXTA 1Z32X 4FPSA 2AOSA 8CGTA 3LBMA 2VFGA 1FWCC 1QNSA 2BTMA 2WBGA 2PD9A 2R1LA 2H9AA 2ZZ4A 3O63A 8XIAA 4MADA 4WSHA 1OYCA 4MB3A 5D09A 1VKFA 1W3HA 1HN1A 3M6YA 4CQDA 1KM2A 5BU6A 1AW1A 3KP0A 3W7KA 3IJ7A 3CC1A 2VOTA 4H7ZA 4JQAA 2VDIA 1WKDA 2V67A 3UZZA 3KLKA 2XH7A 4GVIA 1FP8A 4QBXA 4HCDA 1TTJA 3H7VA 2PP3A 2P0IA 1H1NA 2BXYA 2OYLA 4FOKA 4A05A 1UWQA 3TJXA 4WD0A 1EGZA 5AC8A 1GVRA 1HF6A 3SN4A 4TIMA 4GUFA 1WKFA 1A5AA 1AW2A 3G1SA 3GTIA 3FX4A 3GNDA 2J13A 4FLQA 4DJDD 5E09A 1B3ZA 4Z2LA 3WDPP 1JXJA 3A47A 3TIMA 4Y7EA 3UJEA 3RPTA 4PTVA 3GS6A 4B5NA 4N9EA 1LOSA 3R58A 1TTQA 4BHYA 1UBSA 2BSLA 2FZNA 2PDWA 2O92A 3KL0A 2XIOA 2KZHA 1ZENA 3U2OA 4Z1YA 2VKZG 1OG0A 3QV8A 4LS0A 2F6UA 4QITA 3UWEA 3UG3A 4JKKA 1JPIA 2D24A 3W2JA 3TR2A 2JEPA 4JQ1A 4DAIA 2J75A 3QY8A 3T9PA 2VFDA 3ONBA 1KV5A 1MNSA 5J04A 1IQ8A 2MNRA 3H7RA 1MYRA 5C2XA 3M4HA 1KB3A 1UIOA 1C29A 4C7DA 5F4WA 2GJPA 4K37A 4QJ5B 1E51A 3VMPA 3DKLA 3NWRA 1UR4A 4DBDA 4O1AA 2JBMA 2OEJA 3OQEA 2VWTA 4M29A 4O15A 4B5WA 4L56A 4AAJA 2WMKA 2V38A 5LGZA 5DXYA 2OGYA 4MZ8A 5DCBA 3GYCA 4L9XA 3B9AA 1F6YA 4DJDC 4M51A 2E40A 2DW6A 1K8CA 4Q8TA 1K6WA 3AOFA 2XU2A 3R0KA 1CXEA 4K8EA 1KXVA 1V0NA 2GJXA 4LBRA 4D8AA 1A50A 5FEWA 1FWFC 2C14A 1XDJA 4O17A 1SFJA 3FEMA 3PB2A 1RCQA 3ICJA 4IL2A 2IXUA 5AYXA 3EDDA 4QJ4B 2ZRWA 4B3ZA 2OELA 4MWAE 1L8NA 4S3AA 1Q63A 2LLEA 3LYEA 2JQXA 2DH2A 2X7VA 3TMQA 2VCBA 4Q4MA 4JL2A 3LK6A 4CLMA 2X30A 3B9OA 2XIIA 1UR9A 1RQHA 1F3EA 1LOLA 1A4MA 2VXNA 1GZGA 2V5JA 1PIIA 1BTCA 1EP1A 3ZR5A 3STCA 3EZ4A 1I2RA 5FACA 4B9ZA 4XKYB 1T99A 3EMQA 5I09A 1TE1A 1X7IA 3I6EA 2WXDM 4JX4A 1E6QM 3OBAA 1T0OA 3Q65A 2YDQA 3C3UA 1VBJA 3UWVA 3ES7A 4MLRA 2C15A 4NAEB 3CUGA 2DDXA 3T4WA 4JTDA 1JPKA 3C0JA 3G2GA 3C2EA 4UTIA 1IWAA 1UKQA 1KRBC 3TLQA 2XH2A 1UUOA 2PDLA 4C6JA 4TR9A 3I6RA 3GDTA 4LPCA 4PUNA 4LVAA 1XICA 1XLAA 4UBPC 1H5VA 3HG3A 1I0BA 4M80A 1PCWA 2OQHA 2QUNA 4OIFA 3NQGA 3REQB 1JQVA 3PNUA 1IZKA 2XPKA 1SZEA 5IDZA 3FHAA 2CLPA 4ENLA 1T40A 4MKSA 1FWBC 4PULA 3E3HA 1U5HA 3H2NA 4YCOA 4JD4A 1O6IA 1JAEA 1VHNA 3ARQA 3JVAA 1DTUA 1MW0A 3AHTA 1UQYA 1TTIA 1BG9A 7TAAA 1NWRA 3EXRA 5I3GA 3GR7A 4G6CA 4GQRA 4H8VA 2AAMA 4ZFCA 4R53A 3BV7A 1FKWA 2YXGA 3U0HA 3H21A 4JTHA 5A69A 4BEQA 2TMDA 2C0HA 4O1DA 4W88A 3MC5A 4IWWA 4E8GA 3S2NA 2XIMA 4HP5A 3TH6A 3RPMA 4IXXA 2J9ZA 1UWUA 2XVPA 1JL8A 1TTPA 2B7QA 1Q45A 2OT1A 3LG3A 3LGEA 4HTYA 4TV6A 3H8AA 2FHFA 3GAYA 1KBIA 2Y5JA 2CLOA 4JTLA 4W7WA 1V3LA 1UG6A 4PSRA 2NQ9A 4GX8A 1E6SM 2J9XA 3W86A 1C8VA 1RHCA 3L66A 2NQHA 3AMLA 7REQB 3URQA 5JBEA 4CD8A 4DIAA 4TOQA 3BAWA 8RUCA 2J6VA 1R30A 2QUMA 1JJKA 2P76A 4UQ9A 3IEBA 4FLRA 1QWKA 4RV3A 3F5LA 1R3SA 3AJXA 4RDWA 3WBWA 3BMWA 3II1A 3H55A 2WVVA 3ZVHA 3S5OA 5CH9A 3FJ6A 3LBCA 2CXEA 4PL1A 2A5HA 4AMAA 4PA8A 3BC9A 3DENA 4IMGA 1AMYA 3RJYA 2EBNA 4S3EA 3CJPA 3D6NA 2VI0A 2O4QA 1YX1A 1VYPX 3BG9A 4KCTA 3H23A 3NOYA 4AC7C 4H9MA 3D46A 4RCXA 4A21A 4GO9A 2FGBA 3IUIA 5F2LA 3RMEA 2VCAA 3SO7A 1Z9AA 3HB9A 3RN6A 4HNLA 3OB8A 3UWWA 1LRNA 4C1LA 5DCEA 1B3XA 1OB0A 1GQLA 3TVAA 4AC1X 1VJZA 4W85A 5D32A 4B3LA 3DX5A 3K8LA 4L1WA 4OV4A 2RDWA 3G3MA 4B16A 1EP3A 2DGAA 4HU3A 1X8FA 2J74A 2G50A 1VFOA 2DQWA 4D6CA 3S4TA 2ZVRA 2ZXBA 3D3AA 2PURA 3KCLA 3WLRA 1RBOB 5EMKA 4W4QA 4DZIA 4JIPA 5HMFA 2Y0FA 4RNHA 5IBXC 1THFD 3MHFA 3ZO9A 2PB1A 5I02A 4UNIA 3AIWA 3PZGA 3R7MA 5C2GA 1XLIA 3S1GA 5M03A 1A3WA 1P4CA 1IWBA 5LIUX 3W75A 3TXZA 4AD3A 4L6HA 4JN7A 1U30A 1VLIA 2QKFA 1UKSA 5F2MA 3A5VA 3C2YA 4BWLC 1CX9A 2NUXA 4H4IA 3B4UA 5A8QA 2TAAA 2BHYA 3KM8A 1VBGA 2VFIA 4ACZB 2I57A 1BHGA 4U10A 1KCKA 4J1OA 4C6PA 2HK1A 3O16A 3E6EA 3LN3A 2Y85A 3KZPA 1J8VA 4B3KA 1LLZA 3SM0A 5CAKA 3ITGA 1NEYA 3ES8A 5D9OA 3Q4DA 5FF7A 3PHAA 1XYCA 4PUKA 3VKDA 2ZUWA 4ZSUA 3DFYA 1H7PA 1SZNA 4YU1A 3TNOA 3IUHA 5K4XA 1HKVA 1HXJA 1Q4NX 1V0KA 5BOFA 4O0ZA 2VQTA 3FGCA 3QQWA 3FJLA 3UPWA 4TO8A 2DJLA 4RXGA 4Y9NA 3LMZA 4AEOA 4IFOA 4KMQA 1WAUA 3DG6A 4O18A 3WY1A 2Y5SA 3A13A 2H8ZA 5IBXA 4CNPA 3LQLA 4XTIA 3TQ0A 3GTXA 4XAGA 3T09A 2JE8A 4O54A 4QDPA 3RITA 2KAUC 1XKJA 4J5NA 3NOEA 5BNKA 3WENA 3MUCA 3W7PA 4HCHA 1A5MC 2A7NA 2D3NA 5JBDA 1TX2A 4UC5A 5ABFA 4NJHA 3MYPA 1CLKA 3ME3A 2CZVA 4AB4A 1OX4B 4PR4A 2AQWA 2DZVA 4GYJA 2XH4A 4FSAA 3TMLA 1EGMA 1EBHA 1GK8A 2JKPA 2DORA 4IJCA 3FA5A 3OODA 4N42A 1FQ0A 1NFBA 1QU4A 3GXIA 3RCNA 4PN2A 4XZLX 1EPVA 1D7KA 3G1XA 1OFEA 4HSHA 5HUOA 2HXTA 4C1NA 1ZS2A 2VT0A 4E4PA 1IR1A 2H3BA 2G8ZA 4KERA 4JTGA 3N17A 1EJSC 1LTDA 5DMYA 4K7YA 3LCIA 4BI7A 1FWNA 3MWAA 1EJ7L 4IOTA 2HPMA 1ME7A 5F2IA 5K9XA 4IFKA 3S47A 3TJIA 3UCDA 3T0AA 3DHFA 3GHUA 1I1XA 1CW2A 1V5XA 2D69A 4ZL1A 1QTWA 2OODA 3WH6A 3ZSSA 4DVOA 1FRBA 3EA3A 5EYWA 1IHIA 2PDQA 4DNHA 4B15A 2C71A 2OPJA 3QYSA 4C6NA 3GAKA 2FH6A 2V82A 3AWOA 4L9ZA 4NU7A 3WBEA 4NRSA 3RAOA 1KM1A 4MY1A 1IYXA 1EUAA 4FF7A 1Q6LA 4J3SA 2WV8A 4HMCA 4L4PA 1A49A 1UASA 3IS4A 4LEFA 5I3KA 3EDEA 4HHMA 1R9YA 2GVJA 1R3RA 4XD6A 2EPKX 3WQEA 5IRPA 5BWFA 3K46A 1ZALA 3NPVA 2QDGA 2G3JA 3MKCA 3SAZA 4CNOA 3KE0A 2VR4A 3ZLFA 5G1TA 1KBLA 1PTAA 1ISWA 1WA3A 1J6OA 1I2PA 1KM5A 2I17A 3K4WA 4YTTA 3VPLA 2PCEA 4H6QA 1ECEA 3OA5A 4MJZA 4JR5A 2AKMA 4JFUA 5E5CA 2QULA 3OOQA 1H3GA 4IQJA 3W2NA 3S5YA 4IL0A 5C7VA 1A4LA 2R1PA 1WB0A 3H24A 2XN1A 1M9HA 1LWJA 4LBSA 3N13A 4LF1A 1OVDA 3FVMA 3S1XA 1SYTA 3RG6A 4MDOA 2OKTA 2W79A 2YB1A 3PZTA 1BPLB 2X0YA 4CQBA 1X6UA 4QDWA 1EWEA 5A6BA 1PDZA 3ZVIA 4YS1A 5T91A 4FP1A 4PCTA 4GMEA 2Z24A 2Y8VA 4R9OA 4O8AA 5AYYA 1V08A 1DXFA 2Z2AA 3VNIA 3W25A 2HE8A 3EDKA 3EWYA 5D38A 3W01A 4ZZ9A 4YJ5A 4HNCA 5IHRA 4UFHA 3RRAA 1SU5A 1B31A 4Y8EA 4KFOA 3VA8A 1BYBA 3TCEA 2GZXA 3GC2A 1UWSA 4IPNB 3VIMA 5LIWX 1VFHA 4BK9A 4Z17A 2E68A 2HPIA 1JQXA 2Z28A 4BS0A 4MFDA 1JDDA 2E6YA 3RYSA 4B4HA 1MDRA 5CSUA 3QRHA 5CLTA 3WFAA 3TK7A 3BZGA 2HQAA 2ZFAA 1ONRA 3V0SA 1JUEA 4TX9A 3AHZA 3GNXA 4L64A 4BF5A 5BXRA 4E3VA 4DM2A 1I45A 1Y5XA 3THAA 2R1MA 1SFSA 1DJZA 1XPYA 1VEPA 5CZ0A 3JZUA 3EPMA 3WIJA 2BXVA 4RR4A 4WCJA 4M3PA 2YB4A 4XZNX 3WNPA 3D0CA 4AZ7A 2BBFA 3DG7A 3PG9A 3ZJKA 3WQOA 2ZRZA 2E0PA 3ZJ7A 1ZTVA 3UXIA 1RBAA 4MZ1A 3ATZA 3UVIA 2WYSA 4UZUA 2ZDSA 4KRUA 4PODA 2FPTA 1W54A 1WCGA 2CETA 1CXLA 3MU7A 3C2RA 1XD0A 2UY5A 3U2CA 3CL8A 3GH4A 1KNWA 3L4ZA 2QCEA 2TSYA 3WLMA 4DJFD 2VC5A 1FCQA 2IKGA 2Q3OA 2VQUA 3KOYA 4F40A 4L1GA 2WCSA 3ARXA 3TCSA 3PJXA 3UESA 4S3BA 2Y70A 3QM3A 4KW2A 4RW3A 1GJPA 1HQTA 2A7PA 3SCVA 5CCZA 4CQCA 3HA1A 3DU0A 4JICA 4B91A 4BJHA 2VD8A 4REQB 3SCRA 5C0QA 3I68A 4KCVA 3UGRA 3R89A 2CLFA 3AFBA 3ZXWA 1VPQA 3VXGA 4LYRA 4GQBA 2GQ8A 3W76A 1IIGA 1QASA 1WDPA 3L7RA 1QNRA 4IGSA 1XLGA 3WH5A 3PZNA 4UOZA 3VNZA 2WLZA 4LYQA 3PTQA 3P82A 3LRMA 4MWAB 3ENLA 5F4XA 3VDCA 2PE4A 4NJKA 2E28A 1F74A 2B4GA 3W72A 4LUYA 4WJ8A 1HKJA 4N6EA 2Z2BA 1KO0A 2X0HA 1B5TA 1X39A 1W0MA 4H19A 1AD4A 3W2LA 1TPB1 2F84A 4DO5A 1NQ6A 2PC4A 2BV9A 3CMGA 4W8AA 1CT5A 4UTWC 3AXIA 2BVWA 3PN8A 3E9AA 1S5TA 4FX6M 1US3A 2VVNA 5A6SA 3KFTA 4YYCA 3P81A 3VKJA 3UWQA 2P53A 4YTQA 2ZBTA 3KRSA 1GOMA 3EBVA 2ZICA 2UY3A 3F4DA 1FWTA 4Y90A 2DT2A 2O9RA 4DJFC 3DXIA 1G1YA 3ZM8A 4H9XA 1KCZA 3W7QA 1VCFA 3DOPA 1Y0EA 2Z1XA 1YXDA 4NVTA 1GWJA 1E9ZB 2O9OA 2BOFX 3W1UA 3KTXA 2OSWA 4IUOA 1UHVA 3TU9A 3CWOX 4X61A 2OO6A 4HU4A 2A3CA 1PKLA 1XYAA 2X1SA 2JEQA 4NAFA 4M5PA 4BY3A 3IIOA 4ZE5A 2W92A 1W5QA 4GBUA 3WD4A 5LA0A 3EAUA 1P43A 2BHUA 5E93A 3DEQA 4IF2A 3GYEA 4JTTA 2BASA 1AJ2A 4R7JA 2PLKA 3TONA 2NUWA 1B3VA 4H2CA 3VGFA 2YDAA 1PE1A 1A5OC 1OADA 3RNDA 2JKEA 3R13A 4Q4OA 4UTWA 1HJSA 1TX0A 2IPWA 3LUTA 4L6OA 4ACYA 5I00A 3W7JA 4UTHA 1E1EA 1XLLA 2PWUA 3HF3A 1M6JA 2FDSA 2ABBA 1EF2A 2DT1A 4DM1A 4FALA 4PRTA 1XCFA 1IXPA 1CLXA 3AALA 3OGRA 4JTRA 4DWSC 1R3QA 3RM8A 2OCZA 5L6UA 3KBWA 5AECA 5H2ZA 1PB0A 2PDBA 2WK2A 1MNZA 4MF4A 3BAXA 3ZT5A 3GDMA 5I77A 2E6FA 3GE7A 3OLEA 2EG7A 3WNOA 1ADDA 4FI4A 4ECLA 4DXKA 2BXZA 3NEVA 1GVFA 4DBEA 5KINA 5LIXX 3O07A 3UBPC 3BUVA 1TREA 3LHVA 4FLSA 3WMCA 4FX7A 3INPA 1EL3A 3FYYA 3VOIA 4W84A 5C9XA 2VC7A 4GKLA 3BICA 5CC6A 3BE7A 4M1RA 2A2IA 4D6JA 3DFNA 3WUBA 3UXLA 5A2AA 3VOGA 1W9DM 3AHVA 1SQ7A 3ARUA 3G5EA 4ADSA 2EKGA 5I3IA 3VABA 4FO4A 1XYFA 1WDSA 4LUSB 4U5IA 1EZWA 1Q6DA 3S8HA 4RE3A 5CSRA 4QS6A 3RPDA 1TB3A 3MVIA 1HO1A 2VEKA 3BOXA 1QPRA 5DCDA 5FJUA 1Q6FA 1OBAA 4KBXA 3APTA 3PY2A 1MZRA 2ZZ5A 1OFOA 2AL1A 3K13A 3G24A 1JZ7A 4EF8A 5KETA 1C9WA 3GHTA 3GR8A 1BVZA 3GW0A 1H7NA 2FKPA 3W38A 1H11A 4FXRA 3VD3A 4CNUA 4ZXLA 3VKBA 3P5YA 1TJ1A 1FH9A 3PTKA 3MMUA 2FVMA 1TV8A 2GJRA 4GOAA 1HTIA 3GFZA 4A3QA 4J40A 4OJYA 3W6LA 1JCTA 1K70A 3MY9A 5ABHA 1ESWA 2VC9A 5K2ZA 1C8QA 4L4OA 2PTDA 1JUBA 1OZMA 1NF7A 1DHPA 3PULA 4GQQA 4ZO8A 4P8UA 2C18A 3LS9A 3AS1A 1RD5A 1XLBA 3M41A 3A22A 3BXWA 2WZTA 5IFPA 3C5QA 5CZSA 3B03A 2YBTA 4WJEA 1U83A 3W1AA 3VGEA 3DFOA 4UMCA 1TWZA 1TVNA 3V75A 3NNTA 2DZUA 4AY1A 1FHUA 3BSGA 3WFZA 3CEUA 4PUJA 4EXBA 3B40A 3QZAA 3E2VA 3MB9A 2NXIA 4HNUA 4N6FA 3S5NA 4L65A 1AH4A 5I3HA 2OG9A 1W37A 1SW0A 3ARPA 4N2YA 4AG0A 2VVSA 4LX4A 3QMTA 4JFWA 3HMJG 5KZ6A 2Z27A 3GKFA 1ZRQA 1A3HA 3ALFA 1W1YA 3SUUA 2X09A 4FNPA 3G3DA 1JDFA 4N9DA 4HMNA 1JIBA 1S5MA 1XINA 4O10A 1GT8A 4WXYA 5F4SA 3BG3A 2WNWA 1KM6A 3ARRA 3C6CA 4GO8A 2XINA 3UNDA 4L5ZA 3MANA 3XIMA 4W93A 1Y5VA 5E9XA 4I9AA 4NNCA 4A3UA 2D0FA 2Z6JA 1H0IA 5DX7A 2WC3A 1PZ1A 2WHJA 2W61A 4D9PA 4R7WA 3W87A 4A8RA 1FWRA 2DSUA 2W5FA 4J3TA 1RVKA 2EQDA 5D05A 1FCUA 5EMYA 2CLLA 4OUIA 4QAIA 4HIBA 1SVDA 2OWWA 2EF9A 4UUIA 3VC5A 1A80A 2CKRA 3IIZA 1RAKA 1QFEA 3QV9A 1GQNA 4Q4SA 1OCNA 3N2MA 3EB3A 3VD5A 2YW4A 2E9MA