5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphate aldolase
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Lyase
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
1G4PA 3LCWA 2QCNA 3QC3A 5DXXA 5F1VA 1G69A 4AEOA 1SSGA 1OFEA 3C8FA 4GNJA 3ATZA 3CLMA 4N9EA 2GOUA 4XZ9A 2NWSA 1O5KA 3P8JA 4UFKA 4GE8A 3SZ8A 5C55A 5KITA 4JIPA 1T99A 2DZVA 3W1NA 3A21A 3NM3A 5AYZA 4K6AA 3EX3A 3QPYA 1ZNNA 2BTMA 4NJHA 3CU2A 1TMHA 4AB4A 5AC7A 2QEZA 3C2VA 3GDMA 1F7BA 2E5CA 4K36A 4JTIA 2C15A 2ZA2A 3C4UA 4WY0B 4WY0F 4X9SA 3W85A 5FF3A 2R94A 3P82A 4LW7A 4GUIA 3IGSA 3BG5A 4IMEA 2ZTJA 3DH7A 1OFOA 1O94A 4DELA 3SFKA 3B4UA 2FJKA 1JQVA 3DXIA 2ZZ2A 4XKYA 3ABQA 5F4SA 3KRZA 3FYOA 1ZALA 2O7SA 3CPRA 1XDLA 3SJ3A 1EUAA 4H3DA 4LT9A 4K8HA 3S42A 2VELA 3W7MA 4EIVA 4PCFA 2WSYA 1KLYA 3P7YA 1UUMA 4WOQA 5F2LA 3UZ5A 1A5SA 2JKAA 2ZZ5A 3UWVA 2CLFA 4MJZA 4MUZA 3SR7A 3LHUA 1JULA 2NLIA 2NV1A 4WD0A 3T78A 3NL2A 4OV9A 1I2NA 3PBVA 1XKYA 3PF3A 1KM2A 4PTNA 4CQ8A 1F5ZA 4RZ4A 2DZWA 1C29A 3USBA 3EXRA 3G3DA 4A29A 3FA5A 4QM1A 4MFDA 1EWEA 4EF8A 3W3OA 2YSWA 2R91A 4O1AA 1CW2A 1OG0A 4LS2A 1E51A 4UTKA 1U83A 4GUGA 4MPQA 1D9EA 3NM1A 5AHNA 2YW4A 4NXSA 4AMAA 1YDVA 5F2GA 2V2DA 5DCEA 1TCDA 1VZWA 5LSMA 3LB0A 4JX5A 1H61A 2NXIA 3RLVA 1EWDA 3G8EA 2DZXA 1A53A 5AHIA 1EPXA 1W5MA 3L5AA 1FWSA 4AAJA 1LOQA 4HNUA 1F6KA 1ME8A 3LI0A 3LGEA 5DLCA 1QOQA 3BW4A 1MZHA 1TRIA 4IXHA 3W2LA 1YXDA 3G1HA 4M7SA 3G1SA 1F2JA 3VE7A 1S3HA 3S9YA 1H7WA 2Z6IA 2ZFAA 3TMLA 4DF2A 4RV8A 3M0ZA 4L4LA 2Z1BA 3EXSA 3GK0A 3PG8A 1YLVA 4ZZ9A 2YDAA 3C2EA 1YPIA 3TR2A 1TRDA 2QUTA 1SO3A 3O16A 1I2QA 4WX2A 1H7NA 4NJGA 4DPPA 2C16A 2FLIA 2I9EA 4GRSA 3LRMA 3DFOA 3W7JA 2YFNA 2G96A 3TROA 2QJGA 3EWWA 3NQEA 3LHZA 1SQ7A 3VE9A 2DZPA 2H6RA 3M5XA 1HO1A 5CPLA 4MY1A 3PBWA 3C56A 3KRSA 1TPB1 4GUJA 1JCYA 4QISA 4OWGA 3FEMA 4P2VA 1I2RA 1BTMA 4WUIA 2A2IA 4HHPA 6TIMA 2Y85A 3DKJA 3QEZA 1K03A 1TPFA 5CZSA 3ZFHA 1XC4A 4U28A 1LRQA 3ELFA 2P10A 4PH6A 4UTWC 2B7NA 4RCXA 3L67A 1W1ZA 2OMAA 3I65A 4NXKA 4Y6GA 5K9DA 1BEUA 1H1ZA 4UFHA 2OJPA 1QNVA 3D0CA 2Y63A 3GXPA 1G67A 4CNNA 2BX7A 1SZNA 2V30A 1TJPA 4DBEA 4IXXA 4ZQNA 4ML9A 4ZL1A 4IGHA 3O05A 1G6CA 5DBTA 2BSLA 3W1UA 1I45A 4MY8A 2NX9A 1QAPA 5C2XA 2V9DA 4N6EA 3RFAA 2RKXA 4RX0A 2DP3A 5H91A 1KM1A 4N02A 3UWUA 1ZJIA 1OFBA 4IPIA 3C6CA 4ICNA 1ZFJA 5CPNA 5K4XA 3GVGA 5T26A 1TV7A 3I6RA 4LRTA 2Y6ZA 1ZAIA 2HMCA 4LY8A 5CPMA 5D03A 1JRCA 4OU1A 3TJXA 4ZVJA 1QMLA 2DZSA 3W7CA 2A4AA 3EKZA 5AHFA 3MUXA 4O28A 3DZ1A 2NZLA 3G8RA 3IVSA 3G22A 4Y8FA 1WV2A 5FI8A 3GXNA 4OBTA 2QDHA 3I7SA 3S5YA 1SZGA 5AC8A 1GTHA 4HPJA 2B0MA 3HQ1A 2EHHA 2YXGA 3NO5A 4D2JA 5CZ0A 4I9AA 4K8EA 1TSIA 3DHFA 1RPXA 2CZDA 1PHQA 1TQJA 3GAYA 2A6NA 1WXJA 1F6PA 5HULA 3QFEA 3W6YA 3GX9A 2Y7DA 3IVUA 5A5WA 3UY8A 1FDYA 3IIZA 5AHEA 1VYPX 5HNRA 2E09A 2W0UA 3TC7A 4A3UA 2YCEA 3MMTA 3EWUA 5LNVA 3QYQA 5AHLA 2BLEA 2C18A 5AYXA 3OEXA 5GVJA 1M7PA 1OX4B 1VJIA 5FF7A 3BG3A 2Q8LA 2QAFA 1H60A 2VFFA 5D37A 1KFCA 4HKPA 3UD6A 1H7OA 4ADTA 1IIGA 2V0TA 3TUUA 4JGDA 3N2XA 1XBZA 3L66A 3N9SA 4XBKA 1R30A 1IXQA 3C2FA 1EP3A 3M43A 3C61A 2A0NA 1UUOA 1W0MA 2HS8A 5I3KA 4FX6M 4Q33A 1H7RA 2CLEA 3WK3A 1RZMA 3CTLA 1P0NA 5FF0A 1TPC1 4RK8A 2VFGA 4E38A 3CT7A 1GVRA 4OT7A 3IGXA 1FXPA 3W87A 1PCKA 4FF7A 3BV4A 3GDKA 5LGZA 2ZZ4A 1JCNA 2PC4A 1YYAA 3W1PA 3QPZA 2B4GA 4AVFA 1WOBA 3LCIA 4S2BA 1WYIA 3TAKA 4ADUA 2E5DA 3L21A 3LCFA 4DF0A 2VEMA 3T55A 5L6UA 1PV8A 3L0KA 5KSWA 3NQMA 5D2WA 3W7OA 1WAUA 3E02A 2JGYA 3LTYA 3W7EA 3NQ2A 2B7PA 3EX2A 3W75A 3G1AA 1SW7A 4HSNA 1CI1A 5HJLA 4NNBA 4CLMA 3E0IA 3MHGA 1LOSA 5LNRA 2RDUA 4UFIA 3LM7A 1IXNA 4JYFA 4YL2A 3PWAA 3WK0A 2C1HA 4XTIA 3W7HA 4DEFA 2NUYA 4QNEA 1OYAA 4AHQA 2PCQA 4N9BA 1SSDA 4MZ1A 3G0SA 4YCOA 3P61A 4BR1A 5CKSA 5TBOA 3B06A 3NQ7A 4YXGA 3L0NA 1N7KA 4RKAA 3GDTA 1G7UA 5BNKA 3R5EA 3NL3A 2XN0A 2DZTA 2ZRZA 3GZ3A 5U4NA 4ZQOA 3B04A 1FWNA 1XUUA 3DU0A 4QAIA 4LVFA 5KZMA 3LXCA 2QDGA 4R53A 1DBTA 2VXNA 4N4QA 3BARA 4RZ5A 5G5IA 3NEVA 4UNKA 1CX9A 3KFTA 3LX9A 3PY2A 2Y61A 3FJLA 4JYDA 1RVGA 1U5JA 3W2MA 3MHFA 4UR7A 1R2RA 3QW4B 4OE7A 5AC6A 2G97A 3NR0A 2J6XA 4N4PA 3CEPA 1QPNA 3UNDA 4E0CA 3IRDA 2RDWA 4S1FA 4O11A 3WJSA 3LXBA 4C1LA 5G2HA 1SW3A 1MEHA 1LRNA 3ZWTA 5D09A 1VQTA 3K30A 1W5OA 4NJIA 2FB2A 4O12A 2Z2UA 3TQKA 1TV5A 3KVMA 1I2PA 1TPUA 4JY9A 4DPQA 2VENA 1K8XA 4ZQRA 1LM1A 3EWBX 4BI6A 3I68A 3W1QA 2EF9A 5HWJA 5LHEA 2E6DA 2NXHA 4JX6A 3Q37A 2ATSA 2X1SA 3HG2A 1QOPA 4Y90A 3P5ZA 5L9FA 2E6AA 1KFEA 3CC1A 4IX2A 3GKFA 5BW6A 4FO4A 1VCGA 3W2NA 3NL5A 4JYEA 2QJIA 3LTSA 3NG3A 1JCJA 1EP1A 4Q32A 3UQNA 3NPWA 3O06A 5G1YA 4IMDA 4KFOA 4PC8A 5D2TA 2YPIA 3KX6A 3TNOA 2JK2A 3MI2A 3HPZA 3NZ1A 3IVTA 2EPHA 1LP6A 4MOZA 1FWRA 3O15A 5D38A 3EX4A 1DVJA 4JTLA 2BXVA 1ICPA 1TB3A 2OX1A 4JN6A 5F1UA 3KXQA 4OV4A 2J9XA 5D2XA 2WOQA 2ABAA 3BG9A 3WJYA 4O50A 1K7XA 3TFXA 3R13A 3L5MA 3WK2A 2Y89A 1GJPA 5FEXA 4AWTA 4XKYB 4KWVA 4UIOA 2GVGA 3DHDA 1WBJA 4PL2A 1Q6QA 1LLWA 2ZRYA 1AL8A 4HT3A 1IF2A 2X16A 3NPXA 1F74A 1XXXA 3R8RA 1DOSA 1OFDA 3HIJA 1KV5A 5D05A 5IBXA 3W07A 3W7NA 3A5VA 1JRBA 4UTTC 1K8YA 3UZJA 1G4SA 4MLJA 4AHOA 2FTPA 1K02A 4Y96A 1T8XA 2CW6A 1LBFA 4NNAA 1IXOA 3HG3A 2X1RA 2ZDRA 4NX0A 5LKYA 3MW7A 2VFIA 4JTUA 4O1CA 1B3OA 1IXPA 3NQ8A 3O63A 4BK9A 5I3HA 4NUWA 2X1TA 1C8VA 2WPBA 3KHJA 1DORA 1WDWA 2ALDA 3PUDA 3LCXA 3P60A 4DF1A 3OIXA 1K8ZA 2ZQ0A 3LXAA 3NQFA 4TMCA 1G4EA 4UTMA 2A21A 4IOTA 2A6LA 4JTEA 1FWWA 2C19A 1B4KA 3FJ6A 4RXGA 1QFEA 2G95A 1GEQA 3P84A 2J9ZA 3W7IA 2D73A 1FBAA 3ZS4A 3HGSA 3SGZA 2WQPA 2V82A 4UMCA 5IM51 3NQDA 1M6JA 1XCFA 4HN4A 3UY7A 1SU5A 1GQNA 1OX5A 4FIRA 2ZZ7A 3BW3A 2ZBTA 3W7GA 1EA0A 5FF4A 1TO3A 4Z1AA 4FX7A 1W56A 2R14A 5FF2A 2Q8ZA 4BFAA 2WV8A 5K9CA 4NJJA 3B05A 1L6SA 3G18A 3W1TA 4FHAA 4MZYA 4O19A 4U4MA 4O0KA 1LLZA 4MIMA 3W1LA 1KTNA 2ZYFA 4ALDA 1FWTA 4O13A 2ISWA 3BLEA 2NXGA 4OHQA 3IV3A 3NAVA 1OK4A 3PC0A 4NQ1A 5K9XA 1V5XA 3SI9A 2DORA 5HINA 2W79A 1YTDA 1ZCOA 2GVLA 5LZLA 3SGUA 1GVOA 4IJBA 4K37A 4GUFA 2V2HA 4UFLA 5CZTA 3LTPA 1I8JA 3RK8A 4BF9A 1NEYA 4MKNA 1PL9A 4JEQA 2NX1A 4AH7A 1TTPA 1VPXA 4NU7A 4O10A 3LHWA 2HSAA 3ATYA 3GKAA 2CU0A 2F84A 3HG5A 3CHVA 4O8RA 4W9TA 1RQEA 3HBLA 3LCHA 1NFBA 2VFEA 3R12A 5EA9A 4EWND 1DKWA 5G2IA 3NPUA 4PEKA 1F05A 2Y62A 4XWUA 2WNNA 3L0GA 3UPBA 1KM4A 3W7KA 1J5TA 3TMQA 2OCZA 3MI6A 2QF7A 4UFMA 3IIVA 4QNWA 3IIXA 3W84A 3OHIA 2PRHA 2GJLA 3NQ6A 5EKYA 4LUIA 3TK7A 1OFRA 2GJNA 4Z0SA 1OFAA 1XDMA 3G3MA 3MP4A 3LCLA 2FPYA 1V7YA 4FX8A 5J5DA 5LNSA 2Z6JA 4A2RA 3PM6A 2VKZG 2CWNA 1FQ0A 3T7VA 2XN1A 4OGZA 4X2RA 2XFWA 3ZWSA 3O6YX 4UR8A 3STCA 1L6WA 4NT0A 1PCWA 5FEWA 5G1TA 3BLIA 3PG9A 3QZEA 1RD5A 3GXTA 4TO8A 5D30A 3TW6A 4JR5A 1ICQA 3EEGA 3MBFA 5C6MA 2X1UA 1YDNA 4O0ZA 3WK1A 3GR8A 3DFTA 1KM6A 1L9WA 4IMFA 3S1VA 4B5NA 1ZHAA 1XFBA 1GVQA 1WBHA 1VC4A 3GR7A 4ZMGA 5KMYA 3ANYA 3UWQA 1W5PA 3HGJA 3G24A 3R89A 4YLWA 2Y88A 4N2YA 3L5LA 3LI1A 3LHTA 4LTSA 2TMDA 4H6KA 4FXRA 4YWIA 5D33A 1W3TA 3GDRA 4FNQA 4WXYA 5HR6A 2YX0A 3TX9A 3L65A 1XM3A 3STEA 4QIUA 1FCVA 1TREA 5F4WA 1W54A 2FB3A 3LRKA 1X6UA 3QM3A 1MEIA 4FNUA 3STFA 4YCPA 3R2GA 3MJYA 4GBUA 3DGRA 1YPFA 3S0CA 3H55A 1AW5A 1W37A 1K3UA 3NVTA 3TU9A 5HWMA 3JRKA 3B0PA 3A9IA 1VHNA 2CLMA 1H1YA 2IQTA 1ICSA 1THFD 4LVAA 5D32A 3DENA 2WKJA 3S5NA 3NGJA 1LDCA 1OJXA 3KVKA 1NAL1 1XUZA 3F4WA 4M6PA 4HSOA 1LYXA 1A5CA 3G0XA 1H51A 3PSWA 3MWAA 4LVGA 3WJXA 3O8AA 3HB9A 2E6FA 1FX6A 3CWOX 4JD4A 3OA3A 3HOJA 1SZFA 3FS2A 4UTTA 3DKLA 3BO9A 4IUOA 3M5ZA 4X3ZA 1QR7A 4FB7A 1EP2A 1VH7A 5IBXC 2TRSA 3DFSA 3O6CA 1SO5A 1H7PA 1SFJA 1TPH1 4LNYA 3THQA 2H8ZA 1MEWA 3OG3A 1WQ5A 5AOUA 4CNOA 1KM5A 1PVNA 1BKSA 2X30A 3RNDA 4BI7A 1Y0EA 3G0UA 4BWLA 4HNVA 4TR9A 1JCMP 3W7DA 3C2OA 1XBXA 1G7VA 1TPWA 5AN7A 1W3NA 3VFLA 5HR7A 4UMBA 3EWXA 5U7SA 4AF0A 1GT8A 1EUNA 3GNDA 1R47A 4MYXA 1FY6A 4A2SA 2Y7EA 5D04C 4FNTA 2NV2A 2QCDA 5E0KA 1OABA 1N55A 5K2ZA 5AYYA 1EIXA 1W5NA 1GPWA 2ZRUA 1WOAA 3CB8A 1OVDA 1GTEA 1Z44A 3W73A 3B0VC 4ZQMA 3BK0A 5CG7A 3W23A 3UXDA 1LOLA 3EX1A 3LDVA 4K7YA 5HUOA 1AW2A 3G1YA 3SIZA 2ZZ6A 4GXMA 4O4WA 1PE1A 5K3VA 1F76A 1RQHA 3KRUA 5K4ZA 3ABOA 3DFPA 1VCFA 1K7EA 5ABTA 1OF8A 3M5YA 5F4XA 3EX6A 1TYGA 4X22A 2A1YA 4FNPA 1H5YA 4WJEA 1FDJA 4DQWA 3NYZA 3ABRA 4R34A 3PSVA 1SFLA 1GYNA 4LC6A 1OFPA 4QITA 2V81A 3E9AA 2ZRXA 2QJHA 1NF7A 3W86A 5DY2A 4H4IA 3GYEA 4ZQCA 3NQVA 3LCGA 3LV5A 1P0KA 1Z48A 1JUKA 5G4EA 2PRLA 3A23A 4HNNA 4DO6A 1AMKA 2CLKA 2YZRA 3V1PA 2Y70A 2YFOA 1LTDA 2HTMA 4NNCA 3WJWA 1KLZA 5CSRA 1KM3A 1KM0A 4O17A 1KBIA 3HMJG 1O5XA 5HMSA 1Q45A 3UPWA 3P80A 3TXVA 5D02A 2C3ZA 4K39A 4TIMA 1W5QA 1DJQA 1YXYA 3G1DA 3IIOA 4R33A 2ZCGA 4CCDA 3A5FA 3RU6A 3A22A 1LCOA 2ZA3A 1VYSX 5EL1A 1H63A 1R2SA 3CWNA 3QW3A 5C54A 3QSRA 1TJRA 3BVJA 3Q94A 3CM4A 3THAA 1HFBA 2NX3A 3PUOA 4P61A 5MHBA 3PBUA 2CLIA 2QCMA 2TPSA 3HJZA 3TSBA 2EGZA 4O18A 1TTQA 4MY9A 2YYTA 2QCEA 1S5TA 2J24A 3QJAA 1FXQA 2C14A 5A8GA 3BPWA 5KZEA 3TE9A 1X8FA 4NZFA 4UTLA 3HGOA 1BWLA 3M9YA 3EB2A 1I4NA 2WNZA 3N73A 1MO0A 1GYLA 1XL9A 1P4CA 3N9RA 4KFNA 1VLWA 4FNRA 3INPA 1TPEA 2ZRVA 4O15A 1ME9A 1AK5A 5G2WA 2E77A 1C9DA 1GG1A 3W72A 4JDYA 3QMSA 4O1BA 3NNTA 1KW1A 1LRTA 3TH6A 4O14A 4Z0JA 4FNSA 3CIWA 3N3MA 3BGJA 2AGKA 2CZ5A 1FDZA 5BMXA 3G1XA 1QCWA 2B7OA 5EPDA 1VRDA 2FPVA 2TYSA 3S5ZA 1H62A 3S5OA 5HQEA 2GVJA 4AWUA 3RF9A 4Q4KA 1ML1A 1J4EA 3VKJA 4O1DA 2AQWA 5EYWA 4JXCA 3V75A 4M7TA 2J9YA 1AW1A 4UUIA 2H90A 3LLDA 3YPIA 4M6VA 3AO0A 2FQIA 4CQAA 3F03K 4JTGA 4K7VA 4CCCA 5C5YA 5LNUA 5AFDA 3P62A 1TQXA 3EWYA 4RJEA 4Z1DA 3E49A 3GDLA 4DO5A 1A5AA 2CZEA 2WJZA 4LOCA 3HPSA 3P8IA 2UV8G 2G5WA 3T4CA 4LU0A 1VYRA 4O52A 2GQAA 4GJ1A 4HIBA 4LV4A 4UTHA 2WSRA 3M41A 2E68A 4O57A 3W1MA 3L2IA 1K7FA 3LV6A 4S2CA 3LBMA 2JKPA 2QCLA 4TX9A 3E96A 1YTEA 2NUWA 1QWGA 3O6DA 4J9JA 1FCBA 1OX6A 3GNNA 4LUJA 3B8DA 1AG1O 3EXTA 1GZGA 4HPXA 2ZA1A 1XBYA 1F73A 2VFDA 4UTUA 1ME7A 3M16A 4MVAA 3SY5A 2V8ZA 2VEKA 2DZUA 2CLLA 5SWUA 3I7RA 3T44A 3P67A 2RFGA 4Z1BA 3NQAA 3TSMA 2WSQA 3FIGA 4LV9A 1FCUA 2QUUA 2H8XA 1O60A 3QH2A 2XN2A 4WY0A 1UCWA 5E1QA 1MSSA 4PFMA 1S5WA 3W7LA 2Q3OA 2E1DA 3U6WA 4IX0A 1A5BA 2PE4A 3NXFA 3QMRA 4JICA 1P5BA 2YGYA 3VI2A 1TTJA 3M6YA 2GUUA 3CQ0A 2TSYA 1LZOA 4UTJA 1KFJA 2VOMA 1UASA 3NL6A 3TV8A 4BWLC 1Z42A 4CQ9A 1Z41A 2E6YA 4M5PA 3BGGA 3PULA 2ZZ1A 4LVBA 5KTLA 2A7NA 2YYUA 4JTJA 3TKFA 1WX0A 1GG0A 1OHLA 5TQLA 1GVSA 4WOZA 1B4EA 1FCQA 5EMUA 3NQGA 1LROA 1NSJA 4AWSA 3TSDA 1ZENA 4UCGA 4DBDA 4MLRA 3MP5A 1KFBA 3TDFA 3W7PA 3U8GA 4XQ6A 3GAKA 2NUXA 3SECA 4RXFA 3UWYA 2FDSA 4ONVA 4XUGA 4AHPA 2FPTA 1Q6OA 4ZQPA 1VLIA 3MBDA 4UNLA 3TC6A 8TIMA 1X7FA 1ZAHA 3EWZA 2ZZ3A 1H7XA 1UBSA 3B03A 3LHVA 5G4WA 5I3FA 3HPXA 3EKLA 1W8SA 2CFFA 1JCXA 1DL3A 3E12A 4GUHA 3N2MA 3UYCA 3W70A 5I3IA 4WZHA 1JQXA 3O1NA 1W3IA 3NDOA 4XTDA 2RDTA 3NA8A 1HL2A 1QDSA 5BMWA 1NF0A 1Q6LA 3W74A 4NX5A 1X1ZA 4PA8A 3HGRA 1TPVA 1R46A 2GQ9A 1HG3A 1IGSA 4JTKA 3DI1A 4UC5A 4I7VA 2CLHA 4JTFA 5KINA 5CSSA 2RH9A 3LHYA 2PRMA 3ABSA 4O53A 1S5VA 2CLOA 2VFHA 3A24A 2A7RA 1KFLA 1HUVA 1KV8A 4GC4A 2A7PA 2V5BA 3N14A 1PIIA 2I1OA 4IPJA 3TQVA 3PUEA 3OVRA 3UWZA 3KVLA 4JY8A 3OVPA 3C3NA 2Y7GA 4JS3A 4E2BA 5DY3A 1UJPA 4IWWA 3DI0A 3GB6A 4A21A 5CZJA 4JIQA 2VC6A 3QQ0A 1WA3A 2DJLA 3NOEA 1L2UA 1HO4A 3JR2A 4UXDA 2C6QA 4EOUA 1A50A 1QPRA 1KTCA 1BWKA 1IIHA 5EBUA 3W2KA 5F2MA 4MYAA 4LWWA 2B7QA 2YW3A 4DO4A 5FEPA 3GIYA 4IQLA 4TMBA 2FIQA 2A85A 2QCFA 3PB2A 4XBSA 4IMCA 1T0OA 4JTTA 4MFEA 1YTKA 3TAOA 3UXAA 4I7WA 3C0JA 1GOXA 1MXSA 3W1AA 2ATMA 1O95A 1SO4A 4DXVA 3FLUA 2QCCA 5CGQA 3M47A 3N34A 4CNPA 4LVDA 3QF0A 5DBUA 3NPVA 4ADSA 5FESA 3S1WA 3HF3A 4WQ6A 3P74A 3W7RA 1DQXA 1ZAJA 1YADA 3FFSA 3FOKA 1VR6A 1NVMA 4POCA 1T96A 1UB3A 2ABBA 3I7QA 4K38A 1JCLA 4EVZA 2WO5A 3PBYA 2C13A 5J5RA 3LLFA 5I3GA 3W9ZA 1ONRA 1O4UA 2Q3RA 4I7UA 3TJLA 5LNWA 4KFPA 4E2DA 3G1FA 5CPOA 4AXKA 3P81A 3MYOA 1JJKA 1QO5A 3PS7A 3NQCA 3N19B 4LRSA 2OT0A 2A5HA 1KBJA 1JVNA 4CCEA 5EY5A 2PURA 5DN1A 3HO8A 4JDBA 3TA6A 5F2IA 4Z1CA 1P1XA 1X1OA 3WFAA 1TPDA 3AJXA 3LRLA 4JTSA 4ORIA 3QRHA 4HNTA 5LHFA 3QMTA 4FIQA 2R8WA 1ADOA 2DU2A 4RR4A 3F1QA 3W2UA 1TV8A 4LS1A 3CIXA 3DFQA 3TCEA 2V5LA 2JKEA 2WNQA 4N9DA 5H2ZA 4RZ6A 4PODA 1KTBA 4N6FA 3MO7A 1VS1A 2LLEA 3LBCA 1DQWA 2X2GA 3W71A 5FEZA 3STGA 1QPQA 1FUYA 5DXYA 5DCBA 5KZDA 4AF0B 4L4MA 3TFCA 3CEUA 1OX4A 1RQBA 5DELA 3W83A 1AL7A 1JR1A 1J2WA 2CZFA 1OYBA 4LS0A 2QCDB 2Z0IA 5DCDA 2OT1A 1QO2A 3W2JA 1Q6RA 2QCHA 3H54A 4FXSA 5E93A 3MP3A 3HG4A 4NZJA 4TU1A 3TXZA 3FKRA 2O7QA 1TTIA 4GWEA 3TIMA 4KWWA 1ZY9A 3W22A 1H50A 3OVQA 2ZTKA 2BWGA 3M1ZA 2BZNA 4GFSA 3W1XA 3C52A 3FYPA 2E5BA 4NJKA 5D2YA 4IMGA 2KZHA 3ZR4A 2ZRWA 4BI5A 3W7QA 3DFNA 1SUXA 1YXCA 2I14A 2V2CA 2QUVA 3NZRA 4UTIA 4UFJA 2VEPA 1JUBA 2C0AA 1OK6A 3VNDA 2Y7FA 5D2VA 5TIMA 1M5WA 2W6RA 1SW0A 5HUPA 2HS6A 4JX4A 3WJZA 1D3HA 1B57A 1OFQA 3M5VA 4MJMA 4Y9AA 1W31A 3B0UX 1OYCA 3IIPA 1DHPA 1EEPA 2EKCA 2P1FA 3LERA 1VHCA 4C1KA 1PHWA 1I2OA 3KAOA 4N9CA 4MZ8A 5K7JA 2GQ8A 1R2TA 4O16A 1OF6A 1GVFA 3MI3A 1TIMA 3S1UA 4O4VA 2YR1A 1RV8A 1XI3A 1LORA 3Q2DA 3S1XA 3SW6A 2EAWA 4R7JA 1L6YA 1SPQA 4UMAA 4JTHA 2NWRA 3BLFA 3LOTA 1Q3NA 1YDOA 4ORMA 4M19A 4EF9A 1DV7A 3F4NA 3QSTA 4JNMA 4QSHA 1KFKA 3FKKA 4RLIA 1LBMA 3S8HA 4NVTA 3QQ1A 3W88A 1DJNA 3C2RA 3MYPA 3U2OA 3GLCA 4QQ3A 5LGXA 1SO6A 3IEBA 1PS9A 4FEZA 2J27A 4PL1A 4UTWA 3TW7A 1GWJA 3SSJA 2H3BA 1KA9F 5HWNA 1LBLA 1EB3A 1SZEA 1D3GA 1G4TA 3Q58A 2DJXA 3M44A 2J88A 1N8FA 3W1RA 3O07A 3PVFA 1EX5A 4KKXA 4WXZA 2F7FA 3S6DA 1VGAA 3OBKA 1SR9A 3BW2A 2QR6A 1HTIA 1RR2A 3VCRA 3H53A 6ALDA 2QAPA 4QJ1A 1M7OA 2VEIA 3MHUA 2OZ0A 4G1KA 7TIMA 2H3DA 3P5YA 3T40A 2QCGA 2FFCA 3G1VA 3KOFA 2GPTA 3PR2A 5BOOA 2RHGA 3KVJA 3RLUA 4A22A 3IGUA 4O54A 4YMZA 3M7WA 4OQVA 5I3JA 1ALDA 4LC8A 1XBVA 5BRBA 5AB3A 3TQ0A 3W76A 3RMJA 1QPOA 4M6QA 2ISSA 3L68A 3PAJA 2JBMA 2AAMA 5AHMA 3JS3A 2JGQA 4Z08A 3DBPA 2ISVA 2QKFA 1B9BA 1VCVA 3L9CA 3PB0A 2P0OA 3UWWA 1JUEA 3DAQA
chains in the Genus database with same CATH superfamily
5BXTA 1G69A 5C7VA 3AMLA 4GNJA 2B81A 2WB5A 3ATZA 4QROA 3B8SA 5J8LA 2GOUA 1O5KA 3FDGA 3SZ8A 3QLDA 5KITA 1CB2A 4JIPA 2DZVA 3H8AA 3NM3A 4NG3A 4R85A 3PPFA 1N82A 5D9MA 5LIXX 1TMHA 2QEZA 5CH9A 3C2VA 2FZBA 3GDMA 1FH7A 3T9PA 1V02A 3UJ2A 4K36A 3PTQA 4GZIA 3CH0A 1UMLA 3C4UA 1PB0A 2ON3A 4LEFA 4GUIA 2XVKA 1O94A 4XUYA 3KCJA 3SFKA 3MMWA 1C9WA 1XRFA 4W89A 1DQUA 4EK7A 4FK9A 4QEEA 4MB1A 2O7SA 2J7CA 1GVEA 2OKOA 2OOFA 3SY8A 1FTXA 1XG4A 3S42A 4EIVA 2OWXA 3CTTA 4PCFA 2WSYA 1KLYA 5F2LA 3UZ5A 2YBVA 1HL9A 3SR7A 1U1JA 4RDWA 4XAFA 4HZ6A 3BC9A 4WD0A 5E0CA 3T1GA 3NL2A 2DSVA 1I2NA 3PBVA 3EMQA 3AI0A 3SN4A 3RU8X 3RCMA 2DVUA 3K46A 4A29A 4DX3A 1W32A 1EWEA 1B0IA 3VMPA 3PANA 2BVTA 1E51A 4IIFA 4V15A 3ZR6A 4GUGA 4MPQA 3KL3A 1QWKA 3B4YA 3VGHA 5JIWA 1TUFA 1Z3NA 2HK0A 3HURA 2GGGA 4NXSA 5I24A 1S5MA 3HM7A 4PUWA 4WRHA 2V2DA 3Q65A 1ZQ5A 1HX0A 1VZWA 5DCEA 1O12A 1H61A 5HQMA 3NSXA 4PUEA 2OYLA 1A53A 5AHIA 1W5MA 3GVRA 4AAJA 3OTRA 1EO7A 1QOQA 3PPGA 1TRIA 3AALA 3H4XA 1YXDA 3EOSA 4ECLA 1PEZA 3KDOA 2ZFAA 3TMLA 1SMDA 4L4LA 1S2CA 3GK0A 3PG8A 4ZZ9A 2QUTA 5EBAA 4WX2A 4CNSA 1H7NA 3UYIA 2O0TA 2QJJA 2BY2A 4DPPA 2I9EA 2V69A 3VOCA 2EPKX 2QJGA 3EWWA 1NJJA 4X2PA 1XIFA 4F79A 1H11A 3AHYA 1OQFA 4PEEA 1H3GA 4CD7A 1B2YA 1YPXA 1H2JA 3WO8A 4PRWA 3VA8A 1TPB1 1JCYA 2EG7A 2XWEA 5IDZA 4P2VA 2YL9A 4ZODA 2F61A 4HMDA 1UJQA 1NWUA 4QSFA 3TTOA 2A2IA 3VDGA 1ZP3A 1K03A 2D3LA 3ZFHA 1TWWA 3LPFA 2XH4A 1VIZA 5MKGB 1XISA 4HNCA 3ELFA 4D1JA 1SMAA 2P10A 2E25A 3LY0A 3TNBA 3POCA 3DOPA 1H1ZA 3MDWA 4UFHA 2Z1SA 3HPFA 1BG9A 5FJOA 3ITXA 2FHFA 4CNNA 3MZ2A 1CXLA 3AS0A 1CB7B 4IT1A 4ICMA 4IGHA 1MW3A 4ACYA 1WNOA 4JQ4A 2BSLA 1I45A 4MY8A 2NX9A 1DJIA 1EJTC 2Y5SA 3SCWA 1GOMA 2E9LA 3UWUA 1KM1A 2PZNA 4GKTA 1OFBA 3F4CA 3C6CA 3ALFA 4ICNA 3GVGA 2ZOXA 4E8CA 5CLTA 4PBGA 4KRTA 4J3SA 1W9UA 4H2HA 5CPMA 2G37A 4OU1A 2DPEA 3TJXA 1T41A 4PMQA 2VURA 3U7VA 4CEXC 5FL1A 4GH1A 5C0QA 2XFYA 5CBIA 4CD4A 3IVSA 3G22A 4DYJA 2WVVA 5FI8A 3GXNA 4OOZA 2QDHA 4QJ4B 3S5YA 3CZEA 3C0QA 3FHAA 1VFUA 1AH0A 4RL3A 1NDZA 1V6UA 2PD9A 4XZLX 1UR1A 4D2JA 1RPXA 1WXJA 1F6PA 3W6YA 3QFEA 2W9MA 5A5WA 3AMDA 3GRIA 4W5UA 3QYQA 2QHAA 3OEXA 3T81A 5T8GA 2ZE0A 5CC6A 1J12A 1FHVA 1DP0A 3TOYA 1B3WA 1ZCCA 2QAFA 2VFFA 1KFCA 2QDEA 3UD6A 1M68A 1VEOA 2PDLA 1PZ2A 3I6EA 3TUUA 3N2XA 4YYFA 4AD2A 3LYEA 4HPNA 4JFUA 1KGUA 3MKKA 1EP3A 1ZJBA 4MWAB 2DH3A 3M43A 3C61A 3SCTA 2A0NA 5I3KA 4B5SA 4LYRA 1H7RA 1MW1A 1LT7A 2VFGA 1S2VA 1GVRA 3GU1A 3HV8A 1GNXA 1FXPA 4GO9A 4FF7A 4QE1A 1JPDX 2O4MA 2ZZ4A 3ZSTA 4DM2A 3W26A 1A4LA 3LCIA 4S2BA 2C0HA 1R9XA 1PV8A 3DFYA 5KSWA 1VKFA 3NQMA 4MPKA 4W8LA 2GJRA 5D2WA 4Y8EA 3W7OA 1W9BM 1WAUA 3WDIA 2B7PA 3H2NA 3W75A 3ZVIA 3G1AA 1SW7A 4UCFA 3KLLA 6ENLA 2AL2B 1UR9A 3W25A 3M4HA 3LM7A 4ATDA 1IXNA 1VIWA 5HJXA 1H49A 1I9CB 1IYXA 1V0NA 2DIEA 3W81A 4HJWA 3W7HA 2BDQA 4NZCA 4AHQA 1PKMA 4N9BA 3VCNA 2XISA 3REQB 1GZJA 4GC3A 3P61A 3QR1A 1AQMA 1QK0A 5CKSA 5D8ZA 1X8CA 4BKNA 4H9MA 3NQ7A 3UXLA 3L0NA 4Z2HA 3JUGA 5BNKA 3R5EA 3BJSA 2FHCA 3LZ5A 1H5VA 2DZTA 2VX4A 2YDRA 3QYSA 1J96A 5U4NA 4ZQOA 3USZA 2PLJA 1XUUA 3SUVA 4QAIA 1AJ0A 4KF1A 4WEVX 3LNPA 3ZJ6A 3BARA 4RZ5A 1GYMA 1WZLA 1EF2A 2DH2A 1VBUA 3UP8A 3FJLA 4WF7A 1A49A 4DAIA 1RVGA 1U5JA 1VD6A 4IISA 4XZNX 3B9NA 3GXFA 2CC0A 3OVGA 3ENLA 1RVKA 3RITA 4I8YA 2ISFA 3CAQA 4N4PA 4DWSC 1QPNA 2J7DA 3IRDA 4S1FA 2VVNA 3LXBA 5G2HA 1U22A 3B0YA 3NXLA 3QKEA 3AYRA 4FR1A 3FGCA 1PBGA 3KEHA 1GORA 4K1GA 4NIRA 2W27A 1UKPA 5C2GA 3SN1A 1LM1A 3EWBX 4BI6A 3KWXA 5T9CE 4QP0A 1SJDA 2FZ8A 3WDJA 3KTCA 2YB4A 5LHEA 4QCEA 4DJEC 3OU8A 3BICA 4W7WA 3LQLA 3HG2A 5DFAA 1E0UA 1CLVA 1QOPA 1QNSA 4JZ5A 4JHZA 2CNCA 4MWAD 3CC1A 4FO4A 3NL5A 4OBRA 2QJIA 4Q32A 1KD0A 3CUHA 1SGJA 1O6IA 2QNEA 3O06A 4ZOAA 2FGBA 4KFOA 5D2TA 2YPIA 2WZMA 3IVTA 3CASA 1AODA 1J8VA 1BTCA 3BE7A 2PTWA 1MI3A 1Q6EA 3W24A 2IW0A 3APYA 1F3WA 2WOQA 3BG9A 3ZLFA 4DBUA 4QTGA 3FVMA 4EXAA 2HBXA 5FEXA 4AWTA 1Z7AA 4KWVA 2GVGA 3GD6A 3RM4A 1Q6QA 1LLWA 4ZGYA 1AL8A 1OC7A 3UJEA 4HT3A 2Z2BA 3A13A 2X16A 3PTKA 1XXXA 3F7JA 3E38A 3RILA 4JQ3A 3TN4A 5DEZA 1ESWA 1CLKA 3EOEA 3QC0A 2RJHA 4ZTYA 1T8XA 3GIPA 3HG3A 2X1RA 4LANA 2QPSA 3EWCA 1NQKA 4W86A 3MW7A 4CKQA 2VFIA 4O1CA 4JN8A 1IXPA 4MG4A 3TYUA 3TN5A 4U10A 3GG1A 1X98A 2J8TA 2WPBA 3N6JA 2D2JA 2OODA 2PLMA 3PUDA 2WANA 3P60A 2EKGA 4Y7EA 3V5CA 3N13A 1P1MA 5GPRA 3LXAA 3NQFA 1DJXA 1RBOB 4UTMA 4L64A 2C19A 4C6BA 4YTUA 1QFEA 2G95A 5FD0A 2WBGA 1K4GA 3GQYA 1JFXA 3SGZA 1SU5A 2A3HA 4WKHA 1DIOA 2ZZ7A 3M46A 4AVNA 4Z1AA 4WGHA 4G5DA 1W56A 5TF0A 2QPXA 2Q8ZA 3MKCA 5K9CA 4PMNA 3H2FA 4QG9A 4RNHA 3CO8A 3VOFA 4FHAA 3EYPA 1IT0A 4EANA 3LSCA 2GJPA 1OT1A 4MIMA 2PDQA 4ALDA 3WIJA 3K13A 3BLEA 1N8IA 3K4DA 1XYLA 4PTVA 3UG5A 1OK4A 2OLSA 3PNZA 2X41A 2YCJA 5HINA 2W79A 5I3DA 1ZCOA 2FZDA 2GVLA 3KDNA 4DJDA 5LZLA 3SGUA 1TWZA 4GUFA 2NT0A 3LTPA 1R3VA 1J79A 3M0KA 1RBLA 2NX1A 4DI8A 1VPXA 4WSHA 2CZVA 2PDKA 3GKAA 2CU0A 3HG5A 3TEVA 4PMJA 3S2JA 1CLXA 1NFBA 3R12A 1DKWA 4Q8PA 3R25A 4RNIA 2Y62A 3ID7A 2WNNA 3OHMB 2J8FA 4HPHA 3CHEA 4QNWA 1XLFA 3OHIA 4R9XA 2VP8A 3G3MA 3MP4A 1NFGA 2VGIA 4FX8A 2BGSA 5J5DA 2DT3A 5LNSA 2VKZG 1FQ0A 3II1A 1HQTA 3ZWSA 1VBRA 3LGGA 4UR8A 1L6WA 3TTYA 5FEWA 3BLIA 3FA3A 3MO4A 3GXTA 1K9DA 3WUGA 3KM8A 3W38A 3GU2A 4LCRA 4ENLA 1OZMA 4JKKA 3EEGA 1E1CB 3QZAA 3CWHA 2BOFX 2X1UA 4O0ZA 4HA0A 2E1WA 3UGVA 2NQZA 3H22A 1KM6A 4M51A 3GO2A 5M5DA 2X8RA 3QOKA 1TKKA 2BODX 4WCJA 1W5PA 1GPFA 1YMYA 3HGJA 2UBPC 5AC5A 2G8ZA 3E2RA 4WXYA 2YX0A 1ONWA 1TREA 1W54A 4Q4SA 3QM3A 1MEIA 1XD0A 4YCPA 4GBUA 3S0CA 1YPFA 3ANVA 3BMVA 3B0PA 2HXTA 1H1YA 4B92A 4LVAA 5D32A 1UD6A 3WUFA 3VDCA 1LDCA 1VBHA 3R8HA 4HTYA 5IOBA 3F4WA 2EQDA 4BS0A 1H51A 3B40A 1A0CA 1FHUA 1CBGA 2WJFA 3WQ4A 4S3AA 2VX5A 1MQQA 3BO9A 1WB0A 1WZKA 3GHUA 3IARA 2J4GA 5LA0A 1G94A 3OGRA 2Z27A 1VH7A 3Q67A 5DMMA 4TTUA 1IHIA 2TRSA 3KBWA 5I09A 1H7PA 3E0FA 3RM9A 1SFJA 1TPH1 1Y5XA 3SAZA 3PUGA 3QGVA 2EJAA 1BKSA 4BI7A 3G0UA 4KIEA 4BWLA 4D6CA 4HNVA 1UG6A 2WMIB 3W7DA 3C2OA 4Q4OA 1PYFA 3QY6A 3HQNA 5CQ1A 1EUNA 3P14A 3PZUA 4L61A 4WJXA 1R47A 2MANA 4MYXA 4AU0A 3RJXA 1DWJM 4DAFA 2NV2A 3R7MA 4QE5A 3WBXA 5E0KA 1DXEA 1E0XA 2XGZA 5AYYA 2UY5A 2ZRUA 3W73A 3W23A 3TCSA 2C1GA 1LOLA 4GQQA 3UXDA 3L4UA 4K7YA 5HUOA 1X1NA 2CBIA 3H7UA 3SIZA 3R11A 3H4WA 5DT7A 1RQHA 5K4ZA 4Z2JA 3ME3A 3UGRA 3WDRA 5A6TC 1VFOA 1I0DA 4LCSA 3EX6A 1BPLB 4EAMA 1ZU8A 4G7FA 1HZYA 4X22A 2PWGA 4P8VA 2VTFA 3AIWA 1CWYA 1LQAA 4IF2A 1GYNA 1Z89A 1OFPA 3TYZA 4B3LA 3VD9A 2QJHA 5DY2A 1IWAA 2PLKA 3A47A 3G77A 3LV5A 3WZ0E 4DO6A 3AXMA 1AMKA 5HDRA 2DY3A 5IFTA 1UZ1A 4NNCA 3QQWA 2PBOA 5CSRA 5I5RA 5ABGA 1TVNA 3P80A 4GIRA 1W1IE 3IIOA 1JDCA 1FP8A 3RU6A 1JDAA 3A22A 1QBAA 1LCOA 3FGCB 4AZIA 1EDTA 4Q8UA 1EF3A 1S46A 1TFVA 5C54A 5T91A 3BVJA 3Q94A 4EACA 1HFBA 3PUOA 1XLDA 5CGMA 2GVYA 3AFBA 2CLIA 2TPSA 3CT2A 4HK6A 2EGZA 5DQPA 2JEQA 4PMRA 3QVQA 4FLSA 4LYQA 3LA4A 1CYGA 3U0HA 1FA2A 1EJXC 3FXYA 3SCRA 3WD2A 3BPWA 5KZEA 3H4GA 4NZFA 3M9YA 4JOMA 1BG4A 3RPDA 3VKAA 3DG3A 1TE1A 2VDHA 4O15A 4D8AA 2WHLA 2E77A 4ZB5A 3W72A 4HMCA 3TH6A 1E9YB 4FNSA 3WQ6A 2CZ5A 2OELA 4DLFA 1QCWA 5LXXA 2DT2A 2TYSA 3S9ZA 3T4WA 4U5KA 2GVJA 3QR3A 3ZOAA 4FI4A 2E67A 5EYWA 2XTKA 1V51A 1AW1A 4OKDA 4RDYA 3LLDA 4FOUA 3AO0A 3VNYA 2Y4SA 3AZSA 3S2LA 1DWIM 3GIQA 3F03K 4MHBA 1A3WA 1OG6A 1QBBA 1TQXA 1J6PA 4Z1DA 3E49A 1Z32X 3GDLA 1A5AA 2CZEA 2WJZA 1OWQA 1P6BA 1XH1A 3AXHA 2G5WA 4LU0A 4O52A 1DIKA 2WM1A 2WSRA 4O57A 2O9OA 3TZFA 2YB1A 4J3UA 1EYEA 4RZBA 2QCLA 3MT1A 1YTEA 1FCBA 3GNNA 3B8DA 4WIWA 2X42A 3U5UA 1GZGA 4HPXA 3LS9A 3MCOA 4O1EA 3M16A 3SY5A 4MVAA 2V8ZA 2VEKA 3EMZA 5SWUA 3I7RA 3T44A 3KTXA 2WMFA 4Z1BA 3NQAA 1M01A 2WSQA 4HN8A 4M80A 4LV9A 1FCUA 4WDTA 2H8XA 3QH2A 2XN2A 4WY0A 1J0KA 1DJHA 1MSSA 1GGOA 2POZA 1DXIA 1DTUA 3W7LA 1TVLA 2E1DA 5BROA 2DZBA 3H70A 4OVXA 3T05A 3CUFA 4Y9PA 3AZRA 3VI2A 2HVMA 4IGSA 2ZDSA 4GYPA 1LZOA 1UASA 4CU7A 1Z42A 4HHLA 2D24A 3VKKA 1Z41A 4BZYA 3S6OA 3PULA 4LVBA 3L4ZA 5KTLA 4GIAA 4Q8NA 5E0FA 5DT5A 1WDDA 1WX0A 3AIEA 2IPFA 4J1OA 3IK2A 1HGWA 2QUNA 1OHLA 4B16A 6XIMA 1GVSA 4QS5A 2OWWA 1R87A 4DBDA 4KCUA 4MLRA 3MCMA 7CGTA 1W91A 3W7PA 3U8GA 4IP7A 4XQ6A 4MNKA 4RXFA 3UWYA 4ERAA 4XUGA 4FPSA 1VFLA 1VLIA 2XH0A 8TIMA 1KRBC 3RLGA 2HXUA 3LHVA 5G4WA 1GHRA 1V03A 3UEQA 3N2MA 4H41A 5ECUA 1JFHA 1SM9A 4NRRA 4J2PA 3QTPA 1I6NA 3OLDA 4PA8A 3VDBA 3HGRA 1TPVA 4P7NA 4PMDA 1HG3A 3DI1A 4I7VA 1MQPA 2CLHA 3IAQA 5CSSA 4XZWA 2ZADA 2PRMA 2IKGA 2CLOA 1JAEA 2J78A 3DFHA 1HJVA 4LALA 4NSBA 3U9IA 3IUHA 1UH3A 1PIIA 4H6RA 3TQVA 4B5TA 1XSKA 3GFZA 1ENUA 1J5SA 3IJDA 1OGGA 3OPSA 1H0IA 5JBDA 4E5TA 5CZJA 1UWAA 4JIQA 1AMYA 5CSUA 2QMKA 3NWRA 3W02A 2ZWYA 4EOUA 2PA6A 1BYAA 1IIHA 4D8LA 2J7GA 1Y65A 4DO4A 3S83A 3EB3A 3HZ3A 2JFEX 1ONEA 1MW2A 1T0OA 2P50A 1E1FA 3TAOA 3ICJA 3KLKA 3OZMA 1S38A 3W1AA 2EO7A 4A4AA 4QXIA 4IHCA 4ERGA 4DXVA 3VD3A 6A3HA 4HA3A 4IFKB 4ADSA 3HF3A 5C9UA 4Q4QA 4FSAA 1JL8A 1DQXA 3W7RA 4I5XA 4F9JA 2WKGA 3ARZA 1NVMA 3KHDA 4ZE5A 4K38A 3I7QA 3T08A 4AXNA 4D6HA 3ITCA 3A3XA 4R9OA 1HF6A 4L6DA 5I3GA 2XM2A 4I7UA 5LNWA 3ZZ1A 5CPOA 3SCQA 4PUNA 1JJKA 1ZL1A 4R7WA 4UZUA 4ZXLA 1EEXA 5BCAA 1EQCA 4DZAA 2A5HA 1KBJA 2PURA 4L5ZA 3WNNA 3WFZA 1BRLA 3I4KA 3AJXA 3LRLA 1BKHA 1UWIA 4AZCB 4MMWA 4D71A 2VC7A 8CGTA 3VGBA 4GGBA 1EC7A 3W2UA 4TV5A 1MYRA 4OTKA 4B5XA 2GOKA 4FZIA 4JNZA 3B8UA 3WQ5A 4FA3A 1JNEA 5HJYA 3SGGA 3XISA 4DJDD 2Z1WA 1JG9A 5FEZA 2YJQA 3U5YA 1WXZA 2WSKA 1XCWA 4KQNA 1KXTA 4L4MA 3KW3A 1JYWA 2VGFA 1AZ2A 2UZ9A 5FACA 4B2DA 2CZFA 1EC8A 3AMKA 2WW5A 6CGTA 1W9XA 5XINA 2QCHA 3UW6A 2PAJA 1XLLA 3WFLA 1KCKA 4YVVA 5HBFA 1UC5A 1UR8A 4XB3A 1YE4A 1ZY9A 5HPOA 3BANA 4DWSD 2BZNA 4DUOA 3C52A 2E5BA 5D2YA 2KZHA 2ZRWA 5C71A 1KQYA 3BZJA 3DFNA 3AWNA 3L4YA 5E9AA 1LF1A 4KEUA 4MWAE 1Q2RA 4UTIA 1DPMA 3V35A 3VNDA 2P3EA 2W6RA 3LBOA 4YJ5A 1SW0A 5HUPA 2ACUA 4DJED 3K1DA 3V4BA 4H9XA 4JFSA 3S2NA 2PTXA 3PJXA 1DHPA 1QHZA 4C1KA 5AECA 2OZ3A 4MZ8A 4LAMA 2GQ8A 3ZXWA 3S1UA 4O4VA 1OCQA 4LXFA 3A6OA 3Q2DA 2VO5A 2EAWA 3IUDA 4GQGA 1PSCA 4R7JA 1L6YA 1SPQA 1CGVA 2VGBA 3LOTA 1Q3NA 1KGWA 1YDOA 4EF9A 4HQVA 1DV7A 3F4NA 3QSTA 3WF1A 2V68A 5JXQA 3NO1A 3WQGA 4YVPA 1K1DA 3S8HA 3PZIA 1K9TA 4QCFA 3TTSA 1XIEA 5LGXA 3H2CA 1PPIA 1JCTA 3IEBA 1UD4A 3GFYA 3WQFA 1JYVA 2OXNA 4PL1A 1LQ0A 4UTWA 1GWJA 3BXWA 4EP8C 1KA9F 1CXKA 1GKQA 1EB3A 1D3GA 2DJXA 3N12A 2PDIA 3M44A 2YDSA 2J88A 3O07A 1OD0A 1SJBA 5ABHA 1KRMA 1TX2A 3GXDA 4DXXA 1HL8A 3BW2A 1R3SA 2QR6A 2Z26A 1NP0A 2XSBA 2PGRA 2G50A 5BU6A 4PULA 2PI6A 4G1KA 7TIMA 3KUMA 3WH5A 3DEQA 3G1VA 3KCLA 3OBAA 3T09A 4A22A 4HU8A 1DXFA 3A9BA 3MANA 1E56A 4YMZA 4OQVA 4BHYA 3EPOA 3UA3A 5BRBA 3L2LA 1VBGA 1WUEA 4UBPC 3L68A 3PAJA 4Q7NA 5AHMA 3JS3A 3DBPA 2ISVA 3BL3A 3L9CA 1MZRA 1JUEA 1JF5A 5AY7A 4XO7A 3LCWA 1FHLA 1PJ9A 2QCNA 2EPNA 3KOWA 2VL4A 4AEOA 1OFEA 3S3GA 1EZ2A 1V3LA 2PDPA 5EMYA 2NWSA 3NZQA 4GG9A 1T99A 5AYZA 4TXEA 4K6AA 3EX3A 4LAZA 2BTMA 3DYMA 3BSMA 8A3HA 1TG7A 2CHRA 4AB4A 5AC7A 3B8IA 2DDXA 2E5CA 3E2SA 2C15A 1R38A 4FLOA 4WY0B 4WY0F 4X9SA 3W85A 1FRBA 2R94A 3IGSA 1RJRA 3UZWA 3MUY1 2ZTJA 3F5KA 2Q6ZA 4LF2A 2NQ9A 4XAPA 3B4UA 3UR2A 4ZSUA 3B8WA 4DZIA 3AIUA 3V0SA 1V02E 2WPGA 1XV8A 2Z1KA 2VCCA 3KRZA 3FYOA 4XIMA 2E28A 1XDLA 3SJ3A 4BQ2A 3EOUA 4H3DA 2VELA 3W7MA 3WENA 1PX3A 3P7YA 4WOQA 3W28A 3R6IA 3R94A 4JBRA 3PHAA 3UWVA 4KWUA 2DFAA 3IV8A 1JULA 2NLIA 3CPGA 1UD8A 1X38A 3GG7A 2PP3A 4Q4RA 1RA0A 2CETA 1HJQA 3WQCA 1KM2A 4PTNA 2R6OA 3PZMA 1XLIA 4RZ4A 2DZWA 3W4RA 3EXRA 5HNTA 2YSWA 3B9EA 3BLKA 4B9YA 2PGWA 1CW2A 4UOZA 4L7ZA 2Y0FA 2WHJA 4RE0A 2W91A 1QI3A 1U83A 3BLDA 3CBWA 3NM1A 2G41A 5AHNA 4HB7A 3PJWA 2ZVRA 1TCDA 2OX4A 5LSMA 2PU1A 2NXIA 4JAWA 4I6VA 1IR2A 3VM5A 2WLYA 4HNUA 1LOQA 4A3HA 3VC6A 3SCPA 4GX8A 5DLCA 1CXIA 1RHCA 2BBFA 1B9ZA 2Z1VA 1EJWC 3G1HA 1F2JA 1H7WA 4DF2A 4HNOA 3R0UA 2Z1BA 3EXSA 3FAXA 2YDAA 5IHSA 1AD4A 1TRDA 3TVAA 4NJGA 2EPMX 4DJFC 4GRSA 3NSNA 3UESA 4MNMA 3E1F1 2DZPA 1F4HA 1HO1A 2OTDA 4MY1A 2CHOA 3PBWA 2Y5EA 3C56A 3VKDA 4GUJA 3MU7A 4ICCX 4PMOA 3FEMA 3RR4A 1CCWB 2JALA 1K8CA 4CU8A 4JHMA 5C70A 2Y85A 4XD4A 1TPFA 3SCUA 1XC4A 2PS2A 4AEEA 3F2BA 3VMNA 3IACA 2DW7A 2B7NA 4C91A 1W1ZA 2OMAA 3I65A 4GHRA 4Y6GA 1BEUA 2OJPA 4IH3A 4XAYA 4XISA 2Y63A 4LBUA 1G67A 3W6MA 3AYTA 1TJPA 4RDVA 5JVLA 4QLJA 5EFDA 4ZL1A 5DBTA 5H8PA 1YW1A 1QAPA 3KCOA 4IICA 2V9DA 4GYJA 4AEFA 2RKXA 5HPCA 3UCDA 1ZGDA 4JCMA 1TV7A 1V6XA 3WD4A 4WDXA 2HMCA 2QXWA 3AIBA 2I5GA 1O7AA 3BTNA 3N11A 4ZVJA 4IIDA 1QMLA 1BXBA 4J2MA 3KBMA 1GVIA 3PAOA 5AHFA 4O28A 5HNUA 2P88A 3DZ1A 3LK6A 2NZLA 1CENA 1ISWA 3BLOA 1RP8A 1WV2A 4C6FA 1SZGA 2WMJA 4AD1A 2BNJA 4HPJA 2B0MA 2EHHA 2EG6A 3WLPA 4KEZA 5EMJA 1UD2A 2BG5A 2VYOA 3NO5A 2YOCA 3URBA 4K8EA 2ACSA 2DQWA 2ISDA 3GY1A 2CZDA 1PHQA 4XK2A 3VGGA 1P6WA 3GAYA 2A6NA 2BXYA 4WLCA 4PMUA 3GX9A 2Y7DA 3VD7A 4FAMA 1FDYA 2E09A 3GZAA 2W0UA 1LWHA 2YCEA 2HPMA 1JDDA 4IG2A 3ZLGA 2PWHA 2C18A 5AYXA 4RW5A 5DMLA 3VU2A 4MDPA 3ZLHA 1SZRA 3BUVA 3UPMA 1XYMA 3BG3A 4M8UA 2X1IA 5D37A 1QNPA 4HKPA 4H00A 2C8NA 1R86A 1IQ8A 2V0TA 2AL1A 1Q63A 4XBKA 1R30A 1V08A 4S23A 1IXQA 3C2FA 3H2EA 1UUOA 2HS8A 1DHKA 3FJ4A 3RM8A 4FX6M 4Q33A 2CLEA 3WNOA 3WK3A 2D2OA 3FX4A 1K6AA 4DZHA 1P0NA 4BEQA 1TPC1 4RK8A 3QPEA 5CCZA 2BVYA 3OBEA 3B9AA 3BV4A 2X0HA 3GDKA 3OO2A 1E6SM 1ZTVA 2WZHA 5LGZA 2UY3A 1JCNA 3CLWA 3QPZA 1TMLA 1WDSA 2B4GA 1WOBA 3NCOA 5A6BA 5I03A 3TAKA 5I79A 2E5DA 5RUBA 3E0VA 1TZZA 4DF0A 4W8AA 2VEMA 3DDMA 4GJIA 2OO6A 3QHOA 3OZPA 3KZPA 2J66A 1J0IA 1NFPA 4WKAA 1EQPA 2JGYA 4HSNA 1CI1A 3WD3A 5LNRA 2RDUA 3SRDA 4JYFA 4YL2A 5DF0A 1RCQA 2C1HA 1UPMB 4XTIA 3FAWA 4YNGA 4DEFA 1TVPA 4PTDA 1OYAA 4KERA 1SSDA 4MKVA 5HMFA 5A6KA 3GBDA 4BR1A 2QJNA 4C90A 3GNRA 3B06A 3WBWA 5LIWX 4JTRA 3IPWA 4NAFA 3NL3A 2C79A 1HKKA 1MFVA 4HHHA 3CS2A 3GZ3A 1BWVA 2OKTA 1X96A 4W87A 4KMQA 3R0KA 1EDQA 1SVDA 1FWNA 1XIJA 3DU0A 4NHVA 5KZMA 4F0HA 2VXNA 4RPPA 2Z29A 1NTHA 1CXFA 2PCEA 2D0FA 4C6JA 3DG6A 4AD0A 4AX7A 2O55A 2W66A 3M0IA 1VAHA 4E4PA 1GKPA 3WLMA 3IJQA 1R2RA 3SBFA 2VCBA 5AC6A 1JYXA 2G97A 2J6XA 4XZMX 4ZB2A 2BOGX 3OA5A 4CQCA 3UNDA 1VJSA 1E5NA 3APGA 3DYPA 4C1LA 1Q6GA 2YBUA 4Y2WA 3LU2A 1MEHA 4LQ1A 3WMSA 1IE7C 1QI5A 1VQTA 2IKHA 1W5OA 4NJIA 1RUSA 3VIGA 4O12A 3TQKA 4EKJA 2VENA 1NDYA 4ZQRA 1YRRA 2DUXA 2BP1A 2OB3A 4B2DD 1QHOA 2QZRA 3Q37A 2YXOA 2ATSA 2X1SA 7PTDA 3EGJA 5CBBA 4Y90A 3P5ZA 4H19A 3QZ6A 1NWSA 4IQEA 1KFEA 4IX2A 4ML4A 1OD8A 1VCGA 1HP4A 3N6QA 1MQRA 3W2NA 3S46A 1MUWA 3GSMA 3NG3A 4AZHA 2HE8A 1EP1A 3UQNA 2YXXA 1UKSA 4RUBA 3KX6A 4JIIX 2WHMA 4JQ2A 3HPZA 1UIPA 2EPHA 4MOZA 4A6GA 3EX4A 4GQRA 3AHXA 3AUJA 2BXVA 3TQPA 1XWYA 5F1UA 3VNLA 3L7RA 2J9XA 2ABAA 3LPGA 1K7XA 1EO5A 4EXBA 4ZA0A 3WK2A 2Y89A 1A4MA 1MVYA 2DSZA 1WBJA 4PL2A 4LPCA 1KWKA 3WCZA 4A3QA 4EWJA 1QUMA 3NPXA 3W27A 1F74A 1F6YA 1DOSA 2J79A 5IRPA 5A94A 4Q4PA 3N04A 1AJ2A 1KV5A 3GG8A 5D05A 5IBXA 1XH2A 1CGYA 3CV1A 1JRBA 1IT7A 4UTTC 3ARYA 3U4FA 1K8YA 4B5UA 3AWOA 1XW8A 1W1VA 1K02A 3M0XA 2VD8A 4W4QA 3SQLA 4PCNA 2QW5A 1UR2A 3O63A 3TYCA 2V6AA 1ZBCA 2X1TA 3SDOA 1OZQA 1W3JA 1LG1A 4K68A 2BXZA 2YCIX 2ALDA 2I16A 3LCXA 3N6HA 4ZOEA 3OIXA 4AZBA 1JXJA 4LEQA 2ZQ0A 1S39A 1XR2A 3WMCA 1FWEC 4TMCA 2A21A 2A6LA 3WL0A 4AFYA 1E0TA 1HJUA 3U2CA 1B4KA 3FJ6A 3H7RA 3M0YA 3UZYA 4S3BA 1ITCA 4E4FA 1GEQA 1UP3A 2PDJA 1T6MA 1FBAA 1P43A 3ZS4A 5IHRA 5JIPA 4D6DA 1MDLA 5IM51 1VENA 3NQDA 3AYSA 3BW3A 2ZBTA 5FF4A 3NGFA 2GGHA 1L6SA 2XM1A 3D3AA 4D8ZA 1HNYA 3W1TA 3V0TA 7A3HA 1QPKA 1B5TA 1EH9A 1EJ7L 1VJZA 3W1LA 1KTNA 2ZYFA 3AISA 2ISWA 4LF1A 4J3VA 4G2DA 3VVGA 1F3XA 2XWDA 4OHQA 3IV3A 1CGUA 5E6ZA 3SI9A 5AZ0A 3MMDA 2QYGA 4IJBA 1I8JA 3RK8A 3BAJA 4I5UA 4KETA 4DB7A 1PL9A 4JEQA 4IIHA 4FMVA 3RYSA 1PO9A 3MZNA 2WC7A 4LAUA 4YTQA 2Z7KA 2WJEA 2OSXA 4LFYA 2X09A 3H2OA 1CZ1A 4O8RA 3HBLA 3CYJA 2VFEA 3W82A 4U33A 4EWND 4Z2LA 1XD1A 5BOFA 4GOAA 3NSMA 4PEKA 3L0GA 3N4EA 3H2AA 1XHGA 2F38A 3W7KA 4Z2GA 3LSBA 3S9IA 3JVAA 1RSCA 2ZUMA 1EX1A 1ZBVA 3NQ6A 5EKYA 3IUIA 3TK7A 4WDWA 2WYSA 1OFRA 1OFAA 4YIWA 1QRQA 3LCLA 3AJ7A 4Y9NA 1HKMA 2WM0A 4S3CA 4ZCWA 1PWLA 2Z6JA 4A2RA 3E2QA 1JZ2A 4H7VA 4OGZA 2XFWA 3O6YX 3UG3A 4AZ5A 3STCA 1P0EA 3OGSA 1PCWA 5G1TA 3GFXA 4P8XA 3IRSA 1YDYA 4PTMA 2J75A 3NDZA 3VIIA 5CJMA 4CN1A 3U57A 3DFTA 1L9WA 4FLQA 4IMFA 2Q02A 3ZT6A 1WBHA 3GR7A 4ZMGA 5KMYA 4GVFA 3FCPA 1KR1A 1VB9A 4N2YA 3ZQ9A 2V3FA 1NQ6A 4AZGA 4YWIA 1X97A 3GDRA 3TX9A 3LD5A 1XIGA 3FSTA 3EB4A 4GI4A 3V18A 2PWEA 3EEZA 1X6UA 4FNUA 3VCCA 3STFA 3SRFA 3EDEA 3R2GA 3MJYA 4PMXA 3DGRA 4FS9A 3H55A 4J3WA 3NVTA 3JRKA 1IEIA 4IG2B 2IQTA 3A12A 4V1XA 3DENA 3T0CA 2WKJA 3NGJA 1R9YA 4JPGA 1OJXA 2WZEA 3KVKA 5HA7A 1NAL1 4JTDA 1UROA 4HSOA 1LYXA 1A5CA 4GX9A 2PZ0A 3PSWA 1S2TA 1M65A 3FVDA 4H9ZA 1NOWA 3RX3A 3HB9A 3CWOX 1SZFA 5FJUA 1GQKA 4UTTA 2D0GA 4JFTA 5FCZA 4IUOA 3ITOA 5B7ZA 2YA1A 3M5ZA 4X3ZA 1QR7A 2WCGA 1MRQA 4MM1A 3UJSA 2C1IA 1W1TA 2HRWA 2Z4GA 3GNXA 3W53A 1VRXA 1SO5A 2VGGA 2XJ7A 4LNYA 1LLOA 3T0BA 4HA1A 1W3LA 4XVEA 4GMEA 4IP5A 1WQ5A 4U2ZA 2IS7A 4CNOA 2J7HA 4MUPA 5JMUA 4RE2A 3RNDA 1PZ0A 2CHNA 4TR9A 1G7VA 2XVGA 4CU6A 5AN7A 1W3NA 1E6PA 3VFLA 4UMBA 3EWXA 3K4WA 2D2GA 1KR0A 3RPMA 3GNDA 4A2SA 3IAPA 2Z28A 3R10A 4HA4A 2QIWA 2BVDA 4WGXA 1XLBA 1V3MA 1N55A 2XIQA 4X0VA 3WLQA 1W5NA 4H8HA 1WOAA 4DO7A 1GOIA 1GQLA 1GTEA 3FDKA 1Z44A 3BK0A 4NYUA 1FKXA 4Q8QA 1PE1A 3T8QA 5K3VA 1V0KA 4E4UA 1JEZA 1Z69A 3KRUA 3ABOA 4NAFB 1HVXA 1VCFA 4FXJA 1QOXA 2H9AB 2GUYA 2YDQA 4HNLA 1LQ2A 3WD0A 1Q2SA 1FDJA 1G5AA 4CD8A 4DQWA 4R34A 1MW0A 4C7FA 2Y8UA 3PSVA 4D6FA 1DWHM 2V81A 3E9AA 3UZXA 3RO8A 4EAYA 3W86A 3KZSA 1JZ4A 4ZQCA 1E72M 1UOZA 8RUCA 4BQ3A 4RE4A 1LL4A 4P5UA 4GYFA 3MB9A 2YCLA 4ZSTA 5HQLA 1C8XA 2CYGA 5LXEA 1R7OA 1KLZA 4N42A 1KM0A 3HMJG 3ZJKA 6REQA 3UPWA 3TXVA 2NLYA 2C3ZA 1GQIA 4K39A 1FFRA 1DJQA 1UZ4A 1W1A1 3A5FA 1Z8AA 2ZA3A 3A64A 1VYSX 4TVDA 5EL1A 1HW6A 1OT2A 4ZO9A 4KRUA 3EA2A 3JZEA 3QW3A 3QSRA 4QDMA 4C6NA 5MHBA 5EMMA 2QCMA 4IL0A 2P53A 1TTQA 2WVUA 1SR0A 4MY9A 4ZB0A 2J24A 1IZKA 1FXQA 4H7CA 1WO2A 2V5KA 2QMJA 1YBQA 1X8FA 3R0DA 4UTLA 2Y8VA 3VOJA 3N73A 4JFWA 1GYLA 7REQB 4KFNA 3P2VA 1KRAC 1VLWA 4FNRA 5I00A 1YNPA 5A6JA 3GH4A 3UXIA 4WHBA 2EXOA 3BLPX 1AK5A 5ABFB 1KRCC 4B90A 4V33A 3QMSA 3NNTA 1HIZA 3HV9A 4DYEA 1KW1A 4LUTA 4IFRA 5M03A 3U2ZA 4IZGA 3N3MA 9RUBA 2AGKA 1CGTA 4FP1A 4F66A 4TTGA 2B7OA 5EPDA 3EDFA 2BY1A 2CBVA 1VRDA 4EPEC 1H62A 1EGZA 5HQEA 1E5JA 1XP3A 1UWTA 3O0KA 1J4EA 4O1DA 1GUVA 3E5PA 4JXCA 2JQXA 1W9PA 2V63A 1FP9A 1JZ5A 4CCCA 1B54A 3WUEA 4XZIA 5AFDA 3P62A 5D4YA 5CJNA 1BSLA 4IIEA 3HPSA 3LPPA 4G1NA 2UV8G 4LH8A 4HIBA 4AIEA 2E68A 1U1UA 1YNQA 4DI9A 4DZ5A 2QIIA 1K7FA 1E0VA 1DWAM 3K8KA 4TX9A 2VZTA 4I9JA 4J9JA 3NURA 4LUJA 5EFFA 3RX2A 4GPNA 2CWXA 1OIMA 4UTUA 3IJIA 4C1NA 2DZUA 2CLLA 1VP5A 4HU4A 3A3HA 5G4HC 5DO8A 2RFGA 4Z17A 2YKKA 3QY8A 3SQSA 2F6KA 3HQPA 1PTAA 1XLJA 4NP7A 1I0BA 3WY1A 2Y5JA 1LL7A 1IT8A 3K8LA 3TOPA 1A5BA 3SURA 5AZ1A 1P5BA 3CL8A 2YGYA 3WH8A 1TTJA 3M6YA 3V1HA 1KKOA 1L8PA 4B15A 3TV8A 3WLNA 3KS6A 4CVUA 3VC5A 3DC8A 3M0VA 3BGGA 2ZZ1A 3DN5A 2YYUA 2GZXA 3TKFA 1RJQA 4UOJA 2UY4A 3FJNA 4QX4A 3ONCA 5J04A 1EHAA 4M6UA 4WOZA 1B4EA 4YHGA 5EMUA 5JH2A 1LROA 1AZ1A 4GD0A 1XGDA 2R1PA 3MP5A 3TDFA 2NUXA 2IQ0A 3GUGA 4DWDA 4HMEA 2FDSA 3BSHA 4GI6A 2FPTA 3AU2A 2BOEX 1KCXA 3MBDA 3GXIA 4IMAA 1X7FA 2ZZ3A 1H7XA 1OADA 3SCNA 4GO8A 3EKLA 1W8SA 2CFFA 3CQHA 3W70A 4H9VA 5I3IA 1JQXA 3O1NA 2PDFA 5FSEC 3NDOA 4XTDA 3MUCA 4M0XA 3H7VA 1HL2A 5BMWA 2VR5A 3W74A 3IK4A 3B97A 2ZXAA 3N1AA 2VRKA 3EDKA 2HZGA 3ARRA 4JTFA 2RH9A 1Q66A 2VX6A 1XYFA 3ABSA 4C6QA 3A24A 1N2VA 1F07A 4L9XA 1J0ZA 2CESA 5BOEA 2HDJA 4R5EA 1XLHA 2G3IA 4GINA 2I1OA 4IPJA 2Q09A 3PUEA 4JIEA 3CGTA 3E0LA 3KVLA 3VK5A 4E2BA 5M17A 5DY3A 2FH6A 4DVOA 3GB6A 3CUZA 3QQ0A 1NOUA 1WA3A 4GCXA 3UJFA 3WF0A 4DXKA 4UXDA 2C6QA 3COTA 2WLZA 1XINA 5EBUA 5F2MA 3G2GA 2B7QA 2WBKA 2YW3A 2ZUVA 5FEPA 1J10A 4QE4A 1GKRA 4MTVA 3D47A 2A85A 3VDHA 1F8IA 4XBSA 4IMCA 1GOQA 4JTTA 4DBSA 5C7HA 2DT1A 1YTKA 3M64A 3C0JA 3BAWA 1QU4A 2FMNA 1US2A 4HHMA 3VX0A 1SO4A 4W7UA 3FLUA 3O9NA 2J13A 2VM8A 1HGYA 2AMGA 3N34A 4LVDA 3NPVA 4W85A 1HVQA 3S1WA 3CAKA 2V5CA 1DJGA 4WQ6A 3WH7A 1KXQA 1ZAJA 2X7WA 1VR6A 1V3KA 3F5LA 3LQGA 1M04A 3VAVA 2ABBA 1JCLA 3UNTA 1ONRA 2Q3RA 4NY2A 4UB9A 3WDHA 2C7FA 1UUQA 5I78A 4C65A 4CUCA 2YCKX 1R3TA 3VX1A 1ADDA 1REQA 3N3TA 4LRSA 4KWOA 1A5KC 3ZT7A 3EDDA 3HO8A 3CUGA 2DGAA 1SFSA 1FWJC 3TW9A 4GY1A 3XINA 2J8GA 2E8ZA 1ITUA 4WSJA 2HJPA 3KBVA 3CZKA 5LHFA 4TV6A 2R1LA 3QMTA 1ADOA 1XX1A 3BCJA 1M03A 2R1NA 3AAMA 3HTWA 4LS1A 1DYSA 4DYKA 4GY7A 3GTNA 3RAOA 2FVKA 1W6TA 1OBAA 4N9DA 4MGGA 5DX7A 3MO7A 3ABZA 4Q8MA 2LLEA 1DQWA 5GJPA 4C6OA 4FF5A 3ZM8A 3STGA 1V3IA 2PDHA 3RHGA 3CHCA 5KZDA 4HZMA 5CC7A 1MDRA 4AY7A 3CEUA 1OX4A 4URIA 3RXZA 1AL7A 3VOIA 1J2WA 1OYBA 4F48A 2Z0IA 5DCDA 3A4JA 3T8LA 2PMQA 4B3KA 2WCAA 3HG4A 4S39A 1XIHA 2I5QA 3W22A 2D0HA 1SFTA 2ZTKA 3ANUA 1XLGA 4QLLA 3W1XA 3FYPA 4NJKA 4P7LA 1V4YA 1F9CA 2KAUC 1JDFA 1EA9C 1XF0A 3UCQA 2Z25A 4QGCA 1YXCA 5CLWA 2I14A 2J25A 3TP4A 2V2CA 3UA4A 3U2EA 5E09A 3NZRA 2VEPA 2C0AA 3N2CA 1OK6A 2HVOA 1PX4A 2J74A 2Y7FA 4EXQA 5TIMA 2ZWZA 3WQDA 1US0A 1V6WA 5T9BG 2IPJA 2X40A 1B57A 2A3AA 1V3JA 3M5VA 1CECA 3IIPA 4IM4A 2REQA 3EA1A 4FXFA 1JAKA 4IJRA 1HJWA 4PUKA 1I2OA 2EPOA 3KAOA 3S2MA 1UH4A 1P7TA 2YCLB 1R2TA 2WJDA 1EXBA 3MI3A 1B31A 4O1FA 1TIMA 1B3ZA 3D3FA 4MNLA 2YR1A 2WWDA 3SW6A 6REQB 5M3WA 4UMAA 4JTHA 3BLFA 4UWMA 1S5NA 1ZBKA 2NQHA 4ORMA 2FGZA 2MNRA 1O1ZA 1O5RA 4HBKA 1KFKA 1XICA 3FKKA 1AH3A 2WZIA 3H26A 4RV3A 2EG8A 3CZGA 3OOQA 3BOXA 2OSWA 1R3WA 3FHQA 1SO6A 2FGLA 2NQLA 3N2OA 1PS9A 4FEZA 1AVAA 3TW7A 3T2OA 1YBQB 2H3BA 3QHNA 1LBLA 5HWNA 1G4TA 2IUZA 9XIMA 1XLCA 3DG7A 2QULA 4KKXA 2F7FA 3S6DA 3V5FA 1G1YA 1HKIA 1SR9A 3LENA 2VC5A 1Y5WA 4KEMA 5I2UA 4LBRA 4QJ1A 4JQAA 5CPQA 3QTGA 3VIJA 2J77A 3KP1A 5FJJA 4ACZA 3PR2A 5G1MA 5BOOA 3VNJA 1BGAA 1PZ1A 2I5IA 1GEHA 1QJWA 3IGUA 3M7WA 1XPGA 4F2BA 3BGAA 2V3DA 4NYYA 2XSXA 4M6QA 2JBMA 5A6MA 2ANUA 3V0UA 1BXCA 4Z08A 2JGQA 5I23A 2QKFA 1XYBA 4J5NA 2INZA 3DAQA 1G4PA 4C7DA 3QC3A 5DXXA 2VVSA 1CIUA 3GC4A 3R4IA 3CLMA 4N9EA 4PMZA 1CPUA 5I6SA 1VEMA 3P8JA 4UFKA 4X63A 3A21A 1E6ZA 4P7RA 4RW3A 1TX0A 4C1NB 1ZNNA 1OCJA 3J7HA 1J01A 1J11A 3GE7A 5A2CA 1FWBC 1E6QM 4D6EA 4JTIA 2ZA2A 1QT1A 3CV2A 1RY0A 2GUBA 2TODA 3ARQA 4J4KA 3CMJA 1E70M 3DH7A 3SRKA 1OFOA 4DELA 5I0DA 2F8QA 2FJKA 3DXIA 5M1TA 5A8QA 2P76A 3ABQA 1W1B1 5F4SA 1A5MC 3QV7A 4D6JA 1JDEA 4M1BA 3CPRA 1QVBA 2G3FA 4LT9A 7ENLA 1UUMA 1Q4WA 1A5SA 2QV5A 4MUZA 3QOMA 4DUXA 1QNRA 3LHUA 3PBMA 1JI2A 2NV1A 3MS8A 4GACA 1XKYA 3PF3A 4E2VA 4IPLA 1B90A 4G7EA 4KH2A 3WEOA 4LB3A 1F5ZA 3W6LA 3GC5A 1V3HA 3USBA 3FA4A 4QM1A 4AZ6A 3LMZA 4MWAC 4UNIA 1A5NC 3P0XA 1R8LA 2CBJA 2DV0A 1OG0A 4J3TA 2O4QA 1K4HA 4RPQA 5EMKA 1AH4A 2YW4A 1YDVA 3RCNA 5F2GA 3FV9A 4EPKA 1WP6A 4G56A 3WQWA 2XIMA 3LB0A 1Y8BA 1FH9A 1EWDA 3G8EA 3RLVA 5BU9A 1EPXA 1K70A 3L5AA 1N8WA 1FWSA 3CAVA 1ME8A 3LI0A 5C9XA 1B1YA 2OLAA 1UP0A 2E8YA 2QGHA 5KEZA 3BW4A 3TJIA 4IXHA 3W2LA 4M7SA 3R58A 3S9YA 2Z6IA 3IJ9A 4RV8A 5BXSA 1YLVA 4REQA 3OLIA 4LYKA 1YPIA 3TR2A 2OWCA 3O16A 3HFTA 2FLIA 1XYAA 3DFOA 3W7JA 2G96A 4Q7IA 3B9DA 3LHZA 1MRAA 3VE9A 3M5XA 5CPLA 3VGFA 5IDIA 4QISA 4P8UA 4OWGA 1UWUA 4TX6A 1BTMA 1NIUA 4JCLA 3U4AA 2F2KA 3G5EA 3DKJA 3QEZA 2CXEA 1XDJA 5DRCA 1D8CA 1LRQA 3IWPA 4PH6A 2Q8XA 4GXWA 4DWSA 4RCXA 3L67A 4NXKA 1S2WA 1GW1A 3BDKA 3K8MA 1PXGA 2DVTA 2WXDM 3GXPA 4IGNA 2BX7A 2V30A 4LUYA 4DBEA 4B4HA 4IXXA 4ZQNA 4ML9A 3NDYA 3O05A 3N25A 4B3ZA 3F4DA 1ISZA 3T0DA 3W29A 4N6EA 4PYSA 3RFAA 4RX0A 2E9MA 1EZWA 4F8XA 4DJEA 4N02A 2VJXA 4IPIA 4XO6A 1QTWA 3UVAA 1ZFJA 5T26A 2Y6ZA 1ZAIA 1FWHC 1GOOA 4LY8A 1YEYA 5D03A 1O5QA 3WNLA 1JRCA 5CZKA 2WVVB 2BB0A 2DZSA 3W7CA 2A4AA 3EKZA 5GNZA 5BWFA 3MUXA 1H4PA 2INFA 2V3EA 2D69A 1OM0A 4KT2A 3SSZA 4HOXA 4Y8FA 4FLRA 2BY0A 4BJHA 4OBTA 3WH6A 3SCVA 5JBEA 1J93A 1EBHA 1GTHA 1P6CA 2YXGA 5BZAA 1IZJA 2AGTA 3K1GA 1TSIA 3DHFA 2PDBA 4GVHA 4C5ZA 4HYRA 3UT0A 4YYCA 3IVUA 3P93A 3IIZA 5AHEA 2XH2A 5HNRA 3BJFA 5JUVA 3TC7A 1PKNA 2PWDA 1TUXA 1A5LC 1PKYA 1RD6A 4QEHA 1OX4B 1VJIA 3SUTA 5FF7A 5LIKX 1H60A 1AQ0A 4HMNA 3E0WA 1H7OA 1IIGA 1WCGA 2G3JA 5LIUX 1XBZA 3CPUA 3EAUA 1IEVA 4KS0A 4GLEA 3BAXA 3URAA 1HKVA 3VZZA 3MSRA 2V3GA 3UBPC 3BOLA 2WQDA 4HCLA 1W0MA 1WE5A 3K2GA 3K4AA 3IJ8A 3CTLA 1RALA 5FF0A 1YKWA 4M24A 3CT7A 3IGXA 4D6GA 3CQIA 1PCKA 3GVVA 1JZ7A 1ODZA 1PTDA 2PC4A 1YYAA 4PCPA 2VRQA 4G6CA 4NL1A 1X6LA 4ADUA 1WYIA 4LJ3A 1T8QA 3T55A 3L0KA 3LN3A 3U48A 3CUIA 3APTA 3MTWA 3WLRA 4Z1YA 2CEQA 3LTYA 3NQ2A 3EX2A 5AVHA 1DIEA 1W17A 1LOSA 1P0DA 4UFIA 3VGDA 3QHMA 3THDA 3A4WA 2ICSA 5EMLA 1P7TB 3WK0A 3PZQA 4C6KA 2ZX8A 2HISA 2KX9A 2NUYA 3UERA 3RPTA 3NZGA 4QRNA 2BVWA 3BH4A 4R3UA 3HN3A 4E3VA 4KEVA 3G0SA 8XIMA 3RRAA 5TBOA 3GH5A 2OEJA 1UR3M 1HP5A 2CCRA 3E74A 4RKAA 5B7YA 3GDTA 1G7UA 5HAOA 4MJ2A 3WNPA 2HEJA 5E6YA 4GQ0A 2GFTA 1FWCC 2D3NA 3REQA 5A1AA 2XN0A 3ES7A 4PMVA 3VNKA 2ZRZA 1Z6KA 3B04A 4XIAA 1JPMA 5IXEA 1V7AA 1XG3A 1UHVA 1CNVA 3PWIA 4N4QA 3SUSA 3NEVA 4UNKA 3LX9A 4JYDA 3PWGA 2DSUA 4PSRA 4MKSA 2PGFA 3DECA 1E9IA 2HV5A 1J2BA 3MHFA 4DNMA 4DBWA 5BXRA 4P7QA 2R24A 1KCZA 3QW4B 4OE7A 1XLAA 1YNYA 3WQEA 2HE5A 3VUPA 1D7KA 1UA3A 1EKOA 2ZVIA 2XZ7A 3NR0A 3MA8A 2HROA 2YLLA 4ZO6A 4G8TA 1OIFA 2RDWA 2O92A 4O11A 3WJSA 3IS4A 2HBVA 3SB0A 1SW3A 1TA3A 5FSDC 4AZ7A 1M53A 4RNJA 4AWEA 4ACZB 4ZR8A 2A3CA 5LYRA 3WQOA 1BQGA 1UH2A 2OYKA 1I2PA 1XRTA 2GJXA 3GTHA 1ONXA 1EDGA 3SRHA 1HN1A 1FWDC 4D9PA 4UR9A 1XGZA 3NJ3A 3W1QA 3AXIA 3BAKA 2IKJA 5HWJA 2E6DA 2NXHA 3IJ6A 4JX6A 2R1MA 3JZUA 1NOFA 3VILA 1AA1B 5L9FA 1IWPA 1U1HA 2ZXQA 5JU6A 3BMWA 2YIHA 2WVSA 3I3BA 4J27A 1ZLPA 3NPWA 3V16A 3VD5A 3O6AA 3VXGA 4ZOCA 3TNOA 1XLEA 2JK2A 1UWQA 4C6LA 3O15A 2PWUA 1TV4A 4Q7BA 2X2YA 4JTLA 4NZ5A 1E4IA 1ICPA 4DNHA 4JN6A 1EL3A 1FWFC 2NSXA 3WJYA 1BF2A 3TFXA 1UD3A 3SY1A 2UWFA 3GW3A 4F0KA 4CD6A 1JZ8A 1IR1A 1WDPA 4UIOA 1L6GA 2ZRYA 2ZX9A 2ZUUA 2EBNA 4JIHA 4L80A 1IF2A 4PCSA 1RH9A 1E9ZB 1GJWA 3HIJA 3OYXA 1NU5A 1U5VA 4JL2A 1PIFA 2G0WA 3D5HA 2OQHA 4G7EB 4MLJA 4Y96A 2CW6A 1IXOA 2ZDRA 4NX0A 3WX7A 5LKYA 4IQDA 3WDQA 1B3OA 3F4VA 3NQ8A 3T0AA 4DUWA 4NUWA 3T0TA 2FH8A 2TAAA 4HCHA 1WDWA 4ZO8A 4BQ4A 2J7EA 3AS2A 1UWSA 1ZJAA 3LG3A 2XIJA 2YZ5A 2P3ZA 1K8ZA 4XD3A 4H9TA 3AXKA 3T6CA 1D8WA 4IQJA 1ELSA 4M81A 4RXGA 3OP2A 4TOQA 3W7IA 1KO0A 3HGSA 1J9YA 2V82A 2VX7A 1Q6CA 1XCFA 4HN4A 3M07A 1L2QA 3F2DA 1GQNA 2AAAA 4FIRA 3N2BA 2A3BA 3N4AA 4HYWA 1BVNP 4IPPA 4LCQA 4FX7A 3I3DA 2R14A 4REQB 1A0DA 4NJJA 3GU9A 2DUAA 3IGHX 1F8MA 3B05A 4F2UA 2AOSA 3N4FA 3G18A 4MZYA 4O19A 2E40A 1W3HA 4O0KA 3OJGA 1MXDA 1FWTA 4OFCA 4ILSA 4AIBA 1J6OA 3TWAA 5K9XA 3PC0A 4NQ1A 5GQBA 2DORA 1YTDA 3N9KA 4K37A 2V2HA 4PTWA 3C8NA 3NQBA 2WC3A 3L4WA 1GOWA 1I75A 4PRTA 4BF9A 2HPIA 1NEYA 3SUUA 3MV11 3WQ8A 1TTPA 4DWSB 3GDBA 3GR4A 1AQFA 4NU7A 1O68A 3GTXA 3SCOA 3LHWA 2HSAA 3ATYA 1LG2A 3WLOA 1RLCL 3CHVA 4W9TA 1RQEA 1S1PA 4X61A 5EA9A 5G2IA 1AD1A 3OZOA 3EMCA 1F05A 3AHVA 1RBAA 4XWUA 3UPBA 1KM4A 1J5TA 2XIIA 2R9RA 3TMQA 4CVWA 2QF7A 4QQUA 3IIVA 3W84A 2DEPA 2PRHA 4ASTA 1A80A 3P3BA 4LUIA 4Z0SA 2WZTA 3QGAC 2FPYA 2JF7A 1ZS2A 3D6NA 3KTSA 3PM6A 3ZYZA 2BGNE 3AIRA 2UY2A 1JPKA 1NM9A 3WLSA 3AHTA 3QV9A 5D30A 2WMGA 1EIBA 2QV4A 3WBAA 1ICQA 3MBFA 5C6MA 1ECQA 6TAAA 3WK1A 3GR8A