1ICPA

Crystal structure of 12-oxophytodienoate reductase 1 from tomato complexed with peg400
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
364
structure length
358
Chain Sequence
QVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTCTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords 12-OXOPHYTODIENOATE REDUCTASE 1
total genus 125
structure length 358
sequence length 364
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1icpA00
3RNDA 1MEWA 4JNMA 3TSDA 3P84A 5CKSA 1GWJA 4OU1A 5CPMA 1G67A 4JGDA 4YL2A 3TAOA 2ZZ5A 3AJXA 4DXVA 1ME9A 3HBLA 1YDNA 3MYPA 2WNNA 2CZFA 1QPRA 2QEZA 2WNZA 1F6KA 1NVMA 2FB3A 5HWNA 3EB2A 4ZQOA 1TTIA 4O13A 1KTNA 5LHEA 5EMUA 4QNWA 3IIXA 3KRUA 3O15A 2E5CA 2RH9A 4HNTA 4O15A 3LCWA 4IX0A 5FEXA 1YADA 1ICSA 1X7FA 4AWUA 3MHFA 3L0NA 5HR7A 3A21A 1VCGA 1TPVA 1TQXA 5G5IA 2V2HA 3GNNA 2VFEA 4HSOA 3W1TA 3I65A 2PCQA 3DGRA 3IVUA 4PH6A 1W31A 1H7PA 1KFLA 2J9ZA 1H1YA 3E9AA 3G3MA 4K37A 4Y90A 5C6MA 3W72A 4K7YA 1MXSA 5D03A 1T0OA 3HQ1A 4HKPA 2GUUA 4Q32A 4DPPA 1W3NA 2ZA2A 3PB2A 3LXBA 2FLIA 3B03A 1W5QA 4M19A 1FWTA 5HWMA 5AHEA 3PBYA 4XKYA 1TMHA 3C2FA 1NF7A 4R53A 3C2VA 4KWWA 4QISA 5L9FA 4KFOA 5HR6A 5DXXA 1SQ7A 3BGGA 3GXTA 3W7HA 3LHTA 3C3NA 5L6UA 3DFOA 2W79A 2FDSA 4IGHA 3NQ6A 2NX3A 1R47A 2VFHA 4FNRA 3SGUA 5DCEA 2W0UA 3W76A 1ZHAA 3CB8A 4FB7A 3OEXA 3CU2A 3QSTA 2TPSA 1G4TA 3H55A 3GX9A 3PWAA 5AN7A 2CLOA 1TJPA 2CLKA 2ZRZA 4S2BA 2EF9A 4UTUA 2NLIA 3R8RA 5LHFA 1FCQA 1UASA 1CX9A 4GNJA 3EX2A 4DEFA 5FF7A 1HFBA 3YPIA 1V5XA 5FF2A 1QAPA 3TE9A 2J88A 2QCHA 3A9IA 4XKYB 1QMLA 2C0AA 2G96A 5G2WA 4O57A 3DAQA 3M5YA 3PSWA 3R5EA 3NPWA 2ZA3A 3LLFA 1FDZA 3NQ8A 3S1UA 5E93A 5DXYA 3PBUA 1AG1O 5BRBA 1KM0A 1KBJA 3L5MA 1RR2A 1OYCA 2GVJA 3MHGA 3TQ0A 1KM4A 4PTNA 1SFJA 3LHYA 4AMAA 3FKRA 3L5AA 2Y7GA 1LRQA 4YCPA 3N19B 4XUGA 2Y7EA 2YGYA 2E6DA 1B57A 1OFAA 2FIQA 1WXJA 2YX0A 2HS8A 3ABSA 3CEPA 1OFRA 3TKFA 4N9EA 1L9WA 4M6QA 1KFEA 1LDCA 1JULA 4XZ9A 2FQIA 3PUDA 3C61A 3UXAA 1QOQA 2CWNA 1ICQA 1ICPA 4O4VA 5I3FA 3IGUA 2CZEA 4GC4A 3U8GA 1HO4A 4FX6M 8TIMA 3GDKA 5D33A 3IV3A 2Y89A 1JCLA 3USBA 4AAJA 3NG3A 1DV7A 3SECA 3NNTA 5LGXA 4LVDA 5GVJA 1DQWA 3DHFA 3HO8A 3QMTA 3W73A 4RKAA 5D32A 1G7UA 1LCOA 1R2RA 3HOJA 1MZHA 4JYDA 1L2UA 3CLMA 1GG0A 1PHQA 5CPOA 4NQ1A 4RZ5A 3EEGA 3A24A 1H5YA 1G4EA 4ALDA 2ZRUA 1AW1A 4FO4A 2Y88A 2J27A 1C9DA 1Q6QA 3RF9A 1K7EA 5D04C 3QQ0A 5FF3A 1VGAA 1NSJA 2QJIA 1ADOA 4ZVJA 2DJLA 2NUYA 5D2VA 4RZ6A 5D09A 5CSSA 4NNCA 1KW1A 2RDUA 3W1PA 1G69A 1JCYA 1OJXA 2LLEA 2VFFA 3GR8A 2HSAA 5KZMA 4N6FA 5H91A 3NL2A 4NVTA 2V9DA 2B7NA 3NQEA 3L21A 4UR7A 3NXFA 4M7TA 1QFEA 4JX5A 1R2TA 1PCWA 3W71A 1VCFA 2J24A 1FY6A 2RHGA 3I68A 2VEPA 1H63A 2AGKA 1OFEA 4DBEA 4DBDA 1CI1A 1OYBA 3NL6A 4DQWA 2VC6A 4MLRA 5BNKA 3W1XA 1TV5A 2QUTA 2VOMA 1P5BA 2YFNA 3C0JA 3W7CA 1KM1A 2QDHA 2YFOA 1TPC1 3B0PA 1N8FA 5CPNA 1SR9A 3GKAA 3MI3A 1XBYA 1FDJA 5CPLA 2DZSA 3TV8A 3CT7A 4N6EA 4PFMA 4UXDA 1XC4A 4LS2A 5AC6A 1LRTA 4CQAA 1U5JA 1KBIA 4O4WA 1OX6A 5U4NA 1C29A 3QSRA 4NJKA 1EUAA 1IXQA 2CLLA 1H50A 3CEUA 1L6WA 2BX7A 4ZMGA 2NUXA 4BI5A 1SO4A 2Q8LA 2A6LA 1XFBA 3Q37A 4K36A 3SY5A 3UZJA 5I3HA 3EWUA 3LV6A 1VYPX 1PE1A 3A23A 4G1KA 3JS3A 1A50A 3ATZA 1FCBA 3BG5A 4HPXA 1I2PA 1QPQA 3G8RA 5KZDA 1JUEA 1B3OA 4IWWA 3TUUA 4O52A 2ZYFA 3LB0A 3QFEA 5DLCA 2ISVA 4IXHA 2X1RA 4BFAA 4N02A 4NZFA 1A5SA 1J5TA 1TPEA 1H62A 1F73A 1L6YA 1X1ZA 2CFFA 2R91A 3BG3A 2Z6IA 3O6CA 3CTLA 4IX2A 2A7NA 2OT0A 3C8FA 1K7FA 3GIYA 2OCZA 3NQFA 4IXXA 1PS9A 2AAMA 5T26A 3CWNA 1VRDA 4AHQA 4JTTA 4DO5A 3HF3A 5CSRA 2VEMA 4RZ4A 2TSYA 1AL8A 3B04A 4FX7A 3PBWA 1TTQA 2ZRVA 3W7KA 3G1AA 1KM6A 1VHNA 3W7IA 2A4AA 5HWJA 3PB0A 4Z08A 2A7PA 1JCMP 1BWLA 2F7FA 4N2YA 1GTHA 3TMQA 5K7JA 4U28A 3W85A 3B06A 2XN0A 3VCRA 1MO0A 3KRZA 1K7XA 4POCA 4YCOA 5CZSA 1LTDA 2NXHA 1LP6A 4C1KA 3KVJA 2J9XA 2G97A 5F4WA 3UXDA 5KTLA 2R94A 3WK1A 2Q8ZA 1MEIA 5HUPA 4MJMA 2VFDA 5AHMA 1F7BA 2GJLA 3TC7A 1LLZA 4M6PA 3NQGA 3UZ5A 4QQ3A 3P81A 3W88A 3KVKA 4R33A 3RLUA 3GLCA 1V7YA 2YZRA 1SO3A 3LHVA 1K3UA 4DO4A 4O19A 3IRDA 3UWWA 4JTJA 3KX6A 3INPA 2EPHA 3F03K 2ZBTA 1WA3A 3CQ0A 1UBSA 2HMCA 1ML1A 1NFBA 4OHQA 1W3IA 3M1ZA 1BEUA 1TRDA 3LBMA 3Q58A 3FEMA 1LBMA 4LV9A 4WJEA 1Q3NA 5BMXA 2NUWA 5AYXA 1FWWA 1S5TA 4L4MA 4NNAA 2CW6A 1D3GA 1A5AA 3DKJA 2CLFA 2GQ8A 1EP1A 1W1ZA 3C6CA 3OBKA 5FF4A 4O1AA 3EXTA 4LNYA 2EAWA 1FDYA 1ZENA 4JD4A 4CCEA 1HL2A 3W1UA 4JR5A 3IVSA 4CCCA 2ZZ3A 4GFSA 3S5ZA 4UFLA 3TQKA 3PY2A 2RDTA 3QPYA 2YDAA 2QAPA 3HG3A 4CQ8A 1ZFJA 3E49A 5TQLA 3N9SA 1J2WA 2A1YA 1P1XA 4IUOA 5F1VA 4ZQRA 4UTIA 4P2VA 3O05A 4ORMA 4AEOA 3W7NA 2WJZA 4E2DA 4JY8A 5HJLA 3Q2DA 4JTHA 4WXZA 4BF9A 1TB3A 3ZWTA 3KXQA 3MI2A 3W22A 5G2HA 2A0NA 1GZGA 5LGZA 1TSIA 3GKFA 2V0TA 5TIMA 1EWEA 1C8VA 4JYFA 2R8WA 5F2LA 2I9EA 3NPVA 3TXZA 4LS1A 2QDGA 1K8YA 4X9SA 1GQNA 7TIMA 1I45A 5FI8A 1W37A 1W3TA 4NJGA 1VZWA 2WNQA 3DFSA 3DENA 3FYOA 1B9BA 1YPIA 3N73A 4HIBA 1ME8A 4XBKA 1M5WA 1RQEA 4UNLA 1O5KA 1K8ZA 4B5NA 5BW6A 3NZ1A 4FIRA 3T55A 4ADSA 4IQLA 3FJ6A 1TV8A 3PM6A 3U2OA 1G4SA 2WOQA 1OABA 1JR1A 3E02A 1GYLA 1GVFA 3O06A 1G7VA 3PF3A 4NZJA 3L0KA 4LUJA 3PAJA 3HGRA 3MP5A 1GVQA 3DBPA 1WYIA 3W6YA 1U83A 3P8IA 1TJRA 1XUUA 1AL7A 1KFKA 2YSWA 4XTIA 4W9TA 1LLWA 4ONVA 2BTMA 4I7UA 5FF0A 2JGQA 4O16A 3LHZA 4MJZA 5D02A 3EX6A 4LC8A 3G8EA 2PC4A 3CPRA 2WKJA 3M47A 2NV2A 3P62A 2P10A 3W70A 3W7JA 2OJPA 3W7QA 1PCKA 4JTEA 4Z1AA 3GDRA 1OX5A 1HTIA 1M6JA 1RD5A 3LRMA 3WJYA 4LVFA 3TJLA 3K30A 4X3ZA 4JTUA 4GRSA 4GUFA 4UTTA 3DFTA 3QJAA 2WPBA 3DZ1A 1RPXA 1JQVA 3B05A 1K02A 1R46A 5DELA 1FWRA 4UTJA 1NAL1 3VE9A 4CCDA 1X1OA 1FQ0A 4PODA 2H6RA 3NO5A 4O8RA 3C2EA 4JS3A 1EB3A 1LZOA 3EX4A 3HG5A 4FNTA 3N3MA 4O18A 4DF2A 4MFEA 1FBAA 2XFWA 2A85A 3W1QA 2C15A 3LI0A 3QEZA 3ZR4A 4LC6A 2C6QA 3GXPA 5IM51 3VFLA 2QCNA 2QR6A 3TA6A 2Y62A 3CC1A 3G18A 4BWLA 3TK7A 3W74A 2DP3A 2ZTKA 4A2RA 1IGSA 4UFIA 4ZL1A 1JCJA 3M44A 2Y70A 2ALDA 3GNDA 5F4SA 4MYXA 1O4UA 4FX8A 4EWND 2GVLA 1HO1A 3GDTA 2HTMA 3E12A 1TPDA 3BGJA 3NQ2A 5TBOA 4WOQA 3JRKA 4JTIA 1F05A 3LDVA 4HNVA 3V1PA 3TNOA 2DZXA 2Y85A 2JKPA 3C4UA 4XBSA 4JYEA 1JVNA 2C14A 1TTPA 1FX6A 3G22A 2A7RA 2I1OA 3P5YA 2Z2UA 2V30A 1DOSA 3TR2A 1TREA 3LV5A 4RLIA 2GJNA 2B7QA 1UCWA 4E38A 4BK9A 1GVSA 3HPZA 3N2XA 1DQXA 1ZAJA 3NGJA 1JRCA 1JUKA 3O8AA 3DXIA 1KFJA 2E6FA 4MY9A 2E6YA 4GXMA 4NU7A 2A6NA 4MUZA 4TIMA 4N9DA 3MBDA 3CIXA 5HUOA 4EF9A 2E68A 4PL2A 5AOUA 1AW2A 1VLIA 4A21A 3I6RA 4QJ1A 3MP3A 1OYAA 2C3ZA 1KTCA 1M7OA 3M5XA 1W56A 4HN4A 1H7RA 3WK0A 1EP3A 4HSNA 2E6AA 4RV8A 3CHVA 4LU0A 1GVOA 2KZHA 2QJGA 2ZRXA 1LOQA 2ZCGA 4IMEA 3N2MA 5D2TA 3SW6A 4JTSA 2ZDRA 6TIMA 3KAOA 2GPTA 4JDYA 2J6XA 1QR7A 2C18A 2W6RA 4GJ1A 3IIOA 4Y8FA 3AO0A 4AWTA 4CLMA 3W75A 5FEWA 2PRLA 4O11A 4WY0B 1XI3A 5G4WA 1I2NA 3GK0A 1A5CA 4UFJA 5AYYA 1KM5A 2IQTA 2G95A 1VQTA 4TMBA 3NA8A 3PG9A 2WQPA 3STGA 4JIPA 3TIMA 3W1NA 4OWGA 3C2OA 4WD0A 3LHUA 3LLDA 2YR1A 3F4WA 1SU5A 1TRIA 2FPTA 5A5WA 4WY0A 4LTSA 3EWXA 3QQ1A 5K2ZA 3R2GA 1B4KA 3TXVA 3W7OA 4X2RA 4UMCA 3N14A 3P60A 1XUZA 1OFBA 3EWBX 3MO7A 3MYOA 4OQVA 1SW7A 3DFQA 1YXCA 3QF0A 3ABQA 5F2GA 1I8JA 1Q6RA 2O7QA 1BWKA 3STEA 1IXOA 2RFGA 5IBXA 4JX4A 4HHPA 1SSGA 3NQVA 3TU9A 1TPB1 2VXNA 1R2SA 4NXKA 2FPYA 1Y0EA 3UWYA 5LNWA 4UTTC 2FB2A 3IEBA 3EXSA 1OK6A 5DCBA 3GDLA 3UY8A 2EHHA 2ZZ7A 4YMZA 4K39A 3OHIA 2QCDB 3FIGA 1OVDA 2ZFAA 4YWIA 1QCWA 3NDOA 3P80A 3W23A 4ADUA 4E2BA 1HUVA 1VR6A 1WOAA 3C56A 5K9XA 2BZNA 5A8GA 3LOTA 4RK8A 4X22A 2A2IA 3W2KA 4MZ1A 3LTSA 4GUGA 3W83A 2FFCA 1H7OA 3WFAA 1LOSA 4ORIA 4MY8A 2CLIA 4GE8A 1TTJA 2QCDA 3ANYA 3M41A 3GVGA 2CZ5A 3OA3A 1F2JA 3W1LA 1IIHA 3G1SA 4RXGA 1OFQA 4GUJA 1GPWA 2B4GA 4O1DA 1ZNNA 4J9JA 2PE4A 1S5VA 4FXRA 1KFBA 3UPWA 1G4PA 5AHIA 3LRLA 4HNUA 1IIGA 4IMGA 5D37A 1W8SA 4UFMA 1WQ5A 2NWSA 3O1NA 2B7PA 4IPIA 4K7VA 4JXCA 4NUWA 1F76A 5C55A 3RK8A 2BWGA 2V2CA 5HMSA 4MIMA 3IIZA 4AWSA 2CZDA 3N34A 3G1XA 4CNOA 4JIQA 4O1CA 4QIUA 4YLWA 3NQ7A 4FIQA 3O07A 3B4UA 3M9YA 2ZRYA 1EEPA 2QUVA 1L6SA 3TFCA 3M5VA 4Z0SA 1ZALA 5IBXC 4I7VA 1XL9A 3HG2A 5EKYA 3T40A 4UTWC 3UWZA 2P0OA 3TSMA 3WJSA 4QITA 1YPFA 2WSQA 4K8HA 3W2JA 1YLVA 1OX4A 2NXGA 3QMRA 4MFDA 5C54A 1AK5A 1T99A 3WJXA 2ZA1A 4Z0JA 3A5VA 1I2OA 3BLFA 3HGJA 3PBVA 3G0UA 5BMWA 2CU0A 1TQJA 1S5WA 4N9BA 3NVTA 1TCDA 4K8EA 3LTPA 2X1TA 3W7EA 2X30A 2CLEA 5AHLA 3TX9A 2NX1A 3FOKA 3G1HA 4WXYA 1KM2A 4Z1BA 4KKXA 4UTLA 4UIOA 1OK4A 2YXGA 2NZLA 3IIVA 2V5BA 4Q33A 4NJHA 2QAFA 1QPOA 4WY0F 1DVJA 4RX0A 2GQAA 4ADTA 4O50A 1VYRA 2NX9A 4XWUA 3ZWSA 2QF7A 4P61A 4YXGA 4IJBA 2DU2A 3MHUA 4H6KA 3HG4A 3A5FA 1PV8A 4MZYA 3T44A 1YDOA 3FLUA 5ABTA 3G24A 2Z0IA 1I2RA 1RQBA 1ALDA 1TPWA 4QM1A 5C5YA 2JGYA 3HPXA 3PC0A 2X1SA 4C1LA 2E09A 3R13A 1EA0A 3G3DA 3B8DA 2G5WA 4UTHA 1W5OA 2QCGA 4A22A 3THAA 3L5LA 5D2WA 4AVFA 1O60A 1VLWA 3L9CA 2YCEA 3QH2A 3G1FA 3W1RA 1LYXA 2E1DA 1YTDA 1W5PA 3FKKA 5EY5A 1KTBA 3W2LA 1Z41A 3C52A 3LI1A 2H3BA 1EIXA 4LUIA 4JTFA 3D0CA 4JTKA 1SO5A 3QZEA 4MY1A 1X6UA 4BR1A 1S3HA 3I7QA 2NV1A 4AHPA 1GVRA 1QPNA 3G1VA 1T96A 3DI0A 3HGSA 1PVNA 1DKWA 1WDWA 3W1AA 3WJWA 1VJIA 1FXQA 2VFGA 3OVRA 3QM3A 1DBTA 4UNKA 1PL9A 1VHCA 3NQCA 4O0ZA 4UFKA 3NAVA 1EX5A 5LSMA 2QKFA 3O6YX 4TO8A 3HIJA 2DORA 4O17A 1GOXA 4ZQCA 4WZHA 4MPQA 4Y9AA 3C2RA 4TX9A 1O5XA 3NR0A 5I3KA 3UPBA 1JRBA 4ICNA 3NM1A 4KFNA 3TC6A 4K38A 2E5BA 5CZTA 2EKCA 5LNUA 1NF0A 3P8JA 5HNRA 5DBUA 1IXNA 3I7SA 1F74A 3O6DA 1WV2A 3W7MA 3DFNA 1K8XA 5DBTA 1YTEA 4WQ6A 1CW2A 4IMCA 4FNQA 3TSBA 1W0MA 4O12A 3WJZA 3GB6A 1VS1A 1Z44A 3CIWA 1TV7A 3PR2A 3ZFHA 2TMDA 3W2NA 5BOOA 3SIZA 4RCXA 4M7SA 3L66A 4U4MA 5LZLA 1LBFA 1DL3A 5FEPA 4PEKA 1OFOA 3E0IA 2DZPA 2D73A 3IIPA 3LM7A 2H8XA 3W1MA 4PC8A 5KSWA 3BLEA 3S9YA 1X8FA 3DFPA 3LHWA 1W5MA 2JKAA 3M16A 1I4NA 4D2JA 3IGSA 3EX1A 2X16A 3JR2A 3LXCA 4NXSA 1KA9F 5HULA 4UMBA 3TQVA 3S6DA 4OE7A 3NL3A 3NPXA 4N4QA 4BI7A 1F5ZA 1SZNA 1VYSX 1MSSA 3NZRA 2E5DA 4UUIA 3I7RA 2A5HA 2Y7DA 4FEZA 1FWNA 5F2MA 1YTKA 2WV8A 3S0CA 1IXPA 4MLJA 3TROA 2NWRA 1SSDA 5K9DA 1H7WA 3LCGA 1LORA 3HB9A 4GBUA 2I14A 3NQAA 3O16A 1D3HA 2Y7FA 4PA8A 2R14A 1FCUA 1N7KA 3VI2A 1UB3A 2OZ0A 4L4LA 4LVGA 2ATMA 3W9ZA 4FNSA 4RJEA 5LKYA 3SSJA 5I3GA 1W54A 5I3JA 2Z1BA 3BW4A 5KINA 2OMAA 1YYAA 5AC8A 1DHPA 5DY3A 4UMAA 1VPXA 3RFAA 5K9CA 4UTWA 1ZAIA 4RR4A 5I3IA 4OT7A 1RV8A 1PIIA 3BVJA 2BSLA 3B0VC 4DELA 3L67A 2VEKA 4AXKA 3S1XA 2YW4A 3T4CA 4Z1DA 1FWSA 2PRMA 3LCXA 5G1YA 3W7GA 1H60A 3G0SA 4DO6A 5FEZA 4CQ9A 4IOTA 3TW6A 1G6CA 4CNNA 4LRTA 4LRSA 1P0KA 4WX2A 4I7WA 3VKJA 2B0MA 4TU1A 1H7NA 5CG7A 4EOUA 4O1BA 1SFLA 3M7WA 5D38A 4H3DA 3ABOA 2QCEA 4H4IA 3UWVA 2ISSA 1WAUA 3WK3A 1WBHA 3DH7A 4LWWA 5MHBA 3PUOA 4Q4KA 1A53A 3NEVA 5D30A 3BARA 3L65A 1SZFA 1E51A 1Q6OA 1I2QA 4MZ8A 3HPSA 3DHDA 3S5YA 1PHWA 2Z6JA 2GVGA 1GEQA 2AQWA 3NQDA 3PULA 3PS7A 3ATYA 5G1TA 1P4CA 4LY8A 2PURA 2JK2A 2P1FA 5DY2A 1TYGA 3PUEA 3L2IA 3FYPA 3KVMA 1H1ZA 2YPIA 4NX5A 3SZ8A 4EIVA 2V2DA 3HMJG 2YYUA 4K6AA 2TRSA 3FFSA 3P61A 3TH6A 2O7SA 3DU0A 3EKZA 4FNPA 4N9CA 4WOZA 1SO6A 1XXXA 1EUNA 4UFHA 2DZTA 2UV8G 4O28A 4ZZ9A 1KLYA 2ZZ4A 3H53A 4NNBA 3W3OA 3F1QA 2A21A 2FPVA 3SGZA 1KLZA 5D2XA 3R12A 3M43A 3W7RA 1WOBA 1H61A 3SR7A 3U6WA 1H51A 1B4EA 3MWAA 3R89A 1UUOA 4IPJA 5CGQA 4KFPA 2NXIA 1YXYA 2H90A 4LVBA 4MKNA 3W87A 4NT0A 4JTGA 5CZJA 1EWDA 4CNPA 1M7PA 1R30A 1O94A 3P74A 2E77A 1TPUA 1XBVA 3Q94A 3T78A 3W07A 4M6VA 1A5BA 4LVAA 3RLVA 1LOLA 5EL1A 3M5ZA 2VEIA 3BG9A 5E0KA 1HG3A 1T8XA 5SWUA 3MJYA 3UYCA 3EWWA 6ALDA 1YDVA 5AC7A 1QO2A 3KOFA 3TMLA 1AMKA 3MI6A 1AW5A 1ZAHA 4AB4A 3UQNA 3HGOA 4R7JA 2QUUA 3QRHA 5FESA 4IMFA 2WSRA 3S42A 3UWUA 1J4EA 1QNVA 1JUBA 4LOCA 5HQEA 3NOEA 3ELFA 3N9RA 3FS2A 1TPH1 3GR7A 4UR8A 3EWYA 3GXNA 1TIMA 3NYZA 5K4ZA 1THFD 3M0ZA 5F2IA 3HJZA 1RZMA 4A2SA 1NEYA 3LCLA 1DJQA 3NQMA 3PSVA 3RMJA 2OX1A 1RVGA 3F4NA 3LGEA 3QPZA 4DPQA 2QCLA 3IGXA 2JKEA 1EPXA 1XBXA 4JDBA 3PVFA 3UNDA 2ZZ1A 3W7LA 3VE7A 3SI9A 4RXFA 1DORA 1KM3A 2QCFA 4LV4A 2B7OA 4JICA 1ONRA 4WUIA 1SZGA 3GAYA 1SPQA 3S8HA 4OV4A 2V81A 1OX4B 2ISWA 1LROA 3G0XA 5KZEA 3P5ZA 2ZRWA 3BLIA 3TDFA 3TFXA 1W5NA 4UC5A 5DN1A 2ZTJA 1Q6LA 1BTMA 4JEQA 3STCA 2DZUA 1GJPA 3GAKA 3TCEA 5C2XA 3OG3A 2XN1A 2VENA 2H3DA 3MMTA 5AYZA 4HT3A 1KV8A 5K3VA 3L68A 4KWVA 4S1FA 4AH7A 4OV9A 2YW3A 3NPUA 4IMDA 5EA9A 1Z42A 1SUXA 4GUHA 4JX6A 5CZ0A 1FXPA 5F1UA 5HINA 1N55A 2C13A 2ABAA 1OHLA 3SFKA 4PL1A 1QO5A 2Q3OA 3EWZA 3W86A 1DJNA 4E0CA 4R34A 2FTPA 4O14A 5G4EA 5LNVA 1TPFA 3QW4B 2DZVA 3LX9A 4O54A 2JBMA 2ABBA 1OF6A 5E1QA 3BW3A 4MOZA 1KFCA 2TYSA 1XDLA 3LTYA 1XM3A 1ZY9A 1FUYA 4LS0A 2QJHA 2DZWA 3QYQA 2ZQ0A 3KFTA 4O53A 5EPDA 3W7DA 3BPWA 1GT8A 3BK0A 5AHNA 4DF0A 3QMSA 1SW0A 2GQ9A 1LRNA 2X1UA 5G2IA 2RDWA 1LBLA 5AB3A 1JCXA 1QWGA 4XTDA 4O0KA 1K03A 3NM3A 3P82A 3S5OA 1FCVA 2QCCA 3S1VA 2ZZ6A 4BWLC 3B0UX 3MW7A 4FHAA 1MEHA 2WSYA 1JJKA 2DJXA 4ZQMA 5KITA 3H54A 3VNDA 4O10A 4FNUA 5LNSA 4GWEA 2Q3RA 4JN6A 1VH7A 4ZQNA 3FA5A 1WBJA 3DI1A 3UD6A 3M6YA 4UTMA 1SW3A 5AHFA 3TAKA 1VCVA 1SZEA 3MBFA 4BI6A 3MUXA 3LERA 4JY9A 2F84A 2HS6A 2V5LA 3LCHA 3THQA 2V82A 3A22A 2YYTA 5J5RA 4A29A 3BV4A 1D9EA 2BXVA 3FJLA 4NJIA 4N4PA 3V75A 3W7PA 1XBZA 4UCGA 1BKSA 3LBCA 5U7SA 1JQXA 4TMCA 4XQ6A 4OGZA 3SJ3A 1YXDA 1XKYA 1Z48A 4AF0B 3S5NA 1UUMA 5EBUA 1GG1A 3ZS4A 4QAIA 2RKXA 3KHJA 4EF8A 1VC4A 2WO5A 3OVPA 1H7XA 3BO9A 3PG8A 2XN2A 4I9AA 2EGZA 1RQHA 2V8ZA 3L0GA 2VELA 3G1DA 2PRHA 2FJKA 3IVTA 4NX0A 4PCFA 1ZCOA 3OVQA 4DF1A 2VKZG 5LNRA 1XCFA 3W2MA 1EP2A 3OIXA 2C19A 3TW7A 1GYNA 4MYAA 2GOUA 3KVLA 3TJXA 4HPJA 3W84A 4UTKA 2H8ZA 4MVAA 3KRSA 1KV5A 1OFDA 3RU6A 2Y6ZA 4Y6GA 4OBTA 2C16A 3UY7A 3STFA 1GTEA 4QNEA 3LRKA 2BLEA 3QW3A 4M5PA 4AF0A 1LM1A 2OT1A 3LXAA 3WK2A 3T7VA 4QSHA 3GYEA 3LCIA 3GDMA 3G1YA 3LCFA 4NJJA 4FXSA 3QC3A 3CM4A 1TO3A 4TR9A 3EKLA 1QDSA 1P0NA 1ZJIA 4ZQPA 2ATSA 3DKLA 3MP4A 4Y96A 1O95A 2Y63A 1UJPA 4AHOA 4FF7A 3S1WA 4GUIA 2Y61A 5H2ZA 1WX0A 2QCMA 4A3UA 3O63A 5D2YA 1OG0A 4LT9A 4ML9A 3W2UA 5AFDA 2CLHA 2X2GA 3E96A 5D05A 3P7YA 4HNNA 1JCNA 5DCDA 5F4XA 2CLMA 1F6PA 5K4XA 2C1HA 3UWQA 2J9YA 3ABRA 1IF2A 4Z1CA 1XDMA 5EYWA 2ZZ2A 3EX3A 1Q45A 3NL5A 3P67A 5KMYA 1QOPA 4S2CA 1OFPA 2VFIA 1ME7A 4EVZA 4JTLA 3EXRA 1OF8A 5J5DA 4LW7A 3BW2A 3GZ3A 3CWOX
chains in the Genus database with same CATH superfamily
3WBEA 3RNDA 1MEWA 3CMJA 1P6WA 1J96A 3G6MA 1OM0A 3TAOA 4YL2A 5A94A 4DXVA 1W9XA 5A6KA 3HBLA 3GWQA 1YDNA 3RR1A 4ZA0A 4A3HA 1AH3A 1A3XA 1QPRA 3TN4A 4LGXA 3MVIA 1F6KA 2FB3A 3AXHA 1CNVA 4GFIA 1KD0A 5AC5A 2D22A 4HPGA 3O15A 2BHYA 1XG3A 4HYRA 1W3HA 4RE3A 1NM9A 3E0LA 1FVPA 4O15A 4IX0A 1YADA 1TX0A 2J8GA 1ICSA 4WJXA 4AWUA 3MHFA 1YNPA 1VBHA 3FA3A 1T7LA 2C1GA 1XLFA 2YCIX 1W2PA 5G5IA 2O4MA 4RZBA 1EJ7L 4HSOA 3R7MA 3M07A 2PCQA 3DGRA 3F2DA 1RALA 1O1ZA 2J9ZA 2OOFA 3G3MA 4K37A 2PAJA 3BAYA 2PDCA 1XLKA 3DGBA 3UZZA 4ZCWA 1LWIA 2OLSA 2ZC8A 3M0HA 2X2YA 4F0LA 2GUUA 4P7LA 3BC9A 3RITA 2ZA2A 4OUIA 5A2CA 3PB2A 1MQPA 5C9RA 2FLIA 3B03A 3JVAA 1W5QA 3T0BA 3SCUA 5AHEA 1XLEA 3KL5A 1BF6A 3C2FA 4R53A 2BNJA 3C2VA 3OW1A 1PYFA 4GIAA 1VEOA 3BGGA 3LBOA 3LHTA 2I5GA 4EPKA 4QLKA 4LALA 2W79A 4HK7A 4IGHA 2NX3A 1ECEA 1QU4A 1TJ1A 4FNRA 3W76A 2QW5A 3O2LA 3U7BA 3CB8A 4FB7A 3KBMA 3GW0A 3BCJA 8RUCA 2JFEX 4HYVA 1DIDA 4ZOCA 2BXZA 2CLOA 1SVDA 3ID7A 4JTCA 1J0YA 3LG3A 2EF9A 2PDBA 1F4AA 1PX8A 3EB3A 2CHOA 3EX2A 3VINA 5FF7A 3YPIA 4W88A 4KWUA 3OHMB 2QCHA 3L4VA 3D5HA 3M0YA 2G96A 4O57A 4B5VA 1VB9A 2ZA3A 3NQ8A 1CXIA 5E93A 5DXYA 3R8GA 1AG1O 1KBJA 3ZLHA 4K3ZA 3RJXA 2GVJA 4DHGA 1R3QA 1SFJA 2HZGA 4RNIA 4YCPA 4XD5A 3N19B 2GWNA 3T81A 2Y7EA 1XIIA 2E6DA 1OFAA 4LBRA 4PUEA 3CL6A 4RE2A 4LCQA 4HMNA 3TKFA 1L9WA 1S2WA 4M6QA 1KFEA 2OPJA 1JULA 2R1LA 4DZ5A 2EPNA 4WHBA 2EXOA 3TOYA 4O4VA 4NZ5A 4CU7A 3OZPA 1V6XA 4FX6M 3VCCA 1U5VA 3GDKA 1UUQA 4E4PA 3USBA 4AAJA 3NG3A 3T05A 3WQEA 4LVDA 2FDMA 4QROA 3DHFA 3QMTA 3ZO9A 4RKAA 5D32A 1P0EA 4JYDA 3SFWA 4IIGA 4V2XA 1G4EA 4ALDA 5EMJA 1AW1A 4FSAA 1Q7ZA 3HURA 1ENUA 3ZIZA 4LCRA 3WDRA 1GQJA 3RF9A 1K7EA 5D04C 4WGHA 3SDOA 4Z17A 3EOLA 3RM4A 5LA1A 4UQ9A 1JDFA 1KW1A 4YNGA 4BQ2A 3W1PA 1OJXA 3ARWA 2VFFA 2ZVRA 4N6FA 2WCSA 3NL2A 4LUTB 2D0GA 2B7NA 3NQEA 3L21A 1YKWA 1FHUA 4UR7A 3NXFA 1Q13A 2VP8A 1VCFA 2REQB 4D6FA 2VO5A 3XINA 2VEPA 2HPIA 3BTNA 4AIOA 1KBLA 3NL6A 3C2YA 4MLRA 4OKDA 2QUTA 4DUOA 2VOMA 3WBXA 3FSUA 2YCJA 3MWCA 1HGWA 3RPTA 3C0JA 1IWBA 2V69A 1KGUA 1RUSA 3PTKA 3H4WA 1B9ZA 3W53A 4NP7A 5JQ9A 3PWGA 1PX4A 3TV8A 1BHGA 4K68A 2GGJA 4N6EA 4PFMA 1EJRC 2J7EA 5AC6A 4L5ZA 3IV8A 2WZTA 4CQAA 2Q09A 4O1FA 1U5JA 5CXPA 4IG2A 4O4WA 4AVNA 1Q6CA 3WD1A 3QSRA 3GUGA 4NJKA 1IXQA 4AZ5A 5JBEA 3DFYA 3VOJA 3AIRA 1L6WA 3CEUA 3VMOA 1PWMA 1FWDC 4HVXA 3Q37A 3RX2A 2VDHA 2FHCA 5I3HA 1QK2A 2V63A 4NRSA 3G8RA 4KPLA 1JUEA 4XUYA 2D2JA 4D72A 3VO0A 4YHEA 3TUUA 4O52A 3QFEA 1W91A 4FAMA 1LL6A 5DLCA 3M7SA 1PTDA 1A5SA 1US2A 4IICA 1EOMA 1TPEA 1F73A 1I1XA 1S2UA 1CWYA 4KERA 2OT0A 4WKHA 3GIYA 4HD5A 4IXXA 4F2TA 1NP2A 2D2GA 5T26A 4JTTA 4DO5A 4B3KA 2QUNA 5CSRA 2VEMA 3VDBA 4P7QA 4Q8MA 1MDLA 4H83A 4FX7A 5FJJA 2ZRVA 3LMZA 5CPSA 1VHNA 1UIOA 3W7IA 5IHRA 4QX4A 4LUYA 4Z08A 5HWJA 4AZGA 4CVUA 1UD2A 4PBFA 1CXHA 3P93A 1BGAA 3WF2A 3TMQA 2PGWA 3ANUA 1NFGA 3BAXA 3ARTA 4H9VA 1HL8A 4NAEB 2R6OA 1X38A 5FAGA 1R38A 3DX5A 3CV7A 4PUJA 2G97A 5KTLA 1Q7MA 5HUPA 5FJUA 1V6WA 1XLDA 2SFPA 3TC7A 4QP0A 3R11A 1M03A 1F61A 2PTWA 3AYSA 3P81A 3W88A 1A5MC 2EPKX 2YZRA 2PDPA 1EA9C 3CH9A 4HCLA 3GQYA 4UB9A 1MW2A 2E67A 4U10A 3F03K 3CQ0A 2HMCA 1MYRA 1NFBA 4F8XA 1N2VA 2HJPA 1LBMA 4WJEA 1Q3NA 2ZDSA 2IS7A 4PTDA 1V02A 5BMXA 2Z7GA 1KXVA 2C7FA 1D3GA 3DKJA 1EP1A 3C6CA 3OBKA 2GDQA 4EK7A 3AYTA 3GC5A 3ARVA 4GFSA 1TVNA 2RDTA 3QPYA 2HXTA 3OLIA 1HKJA 1ZFJA 3E49A 4L80A 3U0HA 1FH9A 5F1VA 4ZQRA 4UTIA 3OGRA 3O05A 4ORMA 1ZTVA 3W7NA 4JY8A 5HJLA 3NJ3A 4WXZA 1TB3A 1F3WA 3N11A 3MI2A 2IPFA 2A0NA 1TSIA 2V0TA 4GYFA 4J27A 4JYFA 5F2LA 2WW5A 4D8ZA 3LENA 1QBBA 4Y8EA 4X9SA 4J3UA 3MKKA 1KC7A 3URQA 3NZQA 3ISIX 1VZWA 4B5XA 4EKJA 4H00A 3DENA 3KBSA 4PMVA 3UVAA 2XISA 4HIBA 4HNOA 1VFLA 1EDTA 4WSJA 1GOMA 3EZ4A 3U2OA 1G4SA 3ONCA 1GYLA 1GVFA 1T40A 3O06A 1G7VA 3SUSA 3F2CA 3T2PA 4F79A 4Q7NA 3GTXA 2F61A 1XUUA 1XLMA 1AL7A 2YSWA 4KH2A 4I7UA 3TYCA 5FF0A 1QJWA 4HZ8A 2PWUA 5BWAA 1YRRA 4E3TA 3G8EA 2PC4A 2NV2A 3W70A 3W7JA 3UU0A 4IQEA 1BYDA 1WKYA 1OCBA 1ONWA 1XIDA 4AX7A 3M0JA 1M6JA 1J10A 4H7CA 3TJLA 3NVDA 3K30A 1UD4A 4X3ZA 4JTUA 4GUFA 4UTTA 1VIWA 3OP2A 3B05A 4RE0A 1R46A 4LBUA 4UTJA 2WSPA 2AL2B 1FQ0A 3GH5A 2H6RA 3NO5A 1XV8A 2BVTA 4AD5A 1EB3A 2J62A 1IGWA 4QSFA 3VMNA 3VUSA 4DWSA 4CUCA 2XFWA 1T41A 3E0WA 4HK5A 4LC6A 2C6QA 1F8IA 1UQZA 2Y62A 5GQBA 4WK9A 1MZRA 4RW5A 3FXGA 3TK7A 2OGJA 1UH4A 1AH4A 3RYSA 3VIOA 4MYXA 1O4UA 4C91A 2GVLA 3GDTA 5HNTA 3V5OA 4U3CA 5TBOA 3I3EA 3JRKA 4JTIA 9CGTA 1EJSC 4KWOA 4I5XA 4HNVA 4Z2LA 3TNOA 3UGRA 3LA4A 1E6QM 4PMZA 2DUZA 4MB5A 2Z1SA 4XBSA 4KGJA 4Z1YA 1SR0A 3WMLA 4DRSA 4YTUA 4C65A 1JPKA 2V30A 1DOSA 1KRCC 4RLIA 1PIGA 4Q22A 2PF8A 2QVHA 1OCJA 3GY1A 5T91A 3N2XA 2Y8KA 1C93A 3NGJA 1JUKA 3B8UA 1M68A 3DXIA 4LCSA 4UZSA 3HFTA 2A6NA 4LYKA 6A3HA 2PD5A 1AW2A 2VT0A 4QJ1A 1KTCA 2CXGA 4DNHA 1EP3A 4DBUA 4HSNA 3H7VA 1TWWA 2ZWYA 4RV8A 3WDPP 3CHVA 5CBIA 5C0QA 1A0DA 1LT7A 1LOQA 5AYIA 2ZCGA 3S6OA 4IMEA 1CB7B 2NQJA 1EQCA 3SW6A 1BVZA 3RO8A 2GPTA 4ZBCA 4JDYA 2PWVA 4QFUA 1NH6A 4Q8UA 1QR7A 5FACA 1VBRA 4Y8FA 4W7WA 1E4IA 3W75A 1UWTA 3MCNA 1H09A 5G4WA 1A5CA 4IG2B 1R85A 2ODOA 3K2GA 5AYYA 1OC5A 4Z2HA 3QKZA 4ZB0A 3FGCA 1VQTA 4TMBA 4TX8A 3NA8A 2WQPA 3K1GA 1FKXA 3N18A 4OWGA 1C8QA 4AC1X 2YR1A 3NSMA 1TRIA 2FPTA 4JIRA 2VC9A 5I78A 1RBOB 1XH2A 3EWXA 1EZWA 3BLDA 4E4FA 3TXVA 2CHNA 3P60A 3N14A 3N29A 1XGZA 4OQVA 1TV4A 2PODA 3W6LA 2MANA 4DO7A 3WFZA 1AJ0A 2RFGA 5IBXA 2HWGA 4JX4A 3AICA 4OZOA 1Y0EA 3UWYA 4WGXA 1JD9A 2ZUVA 3U2EA 3EXSA 2QGYA 3VIFA 2PLCA 4HNCA 1DJWA 3I6TA 1ITQA 3IUHA 2ZZ7A 4YMZA 2WJFA 4HTBA 1RLDA 2QCDB 1A5OC 3B97A 2D2OA 1WOAA 4MB1A 3C56A 5K9XA 3LOTA 4CN1A 3V16A 1VFUA 5D8WA 1J01A 3FHAA 4GUGA 1UOKA 4ZXLA 1IYXA 1PDYA 4C7GA 1H7OA 3ES7A 3WFAA 2RUSA 4GE8A 2QCDA 2QMKA 5KEZA 1OWQA 2FZNA 4AZ6A 2XFYA 3CAQA 5ENLA 3B0YA 3VZXA 5AZ0A 4GUJA 1GPWA 3UXKA 3CUFA 1ZNNA 3L4XA 2QIWA 1PJ9A 3LRLA 4IMGA 1W8SA 1KO0A 4IPIA 4JXCA 1GGOA 1F76A 3APYA 2ZC1A 2V2CA 5FL1A 3HU7A 1WAWA 3ZYZA 1JPHA 3EKGA 2FGZA 3IJIA 2CZDA 1NDVA 3N34A 4OECA 4JIQA 3AWOA 3O07A 5FL0A 1VPQA 3LN3A 3AXMA 5LIWX 3PTMA 4IP5A 2QT3A 1IR2A 2GQ3A 3A3XA 1EEPA 4S3EA 3KP1A 3TFCA 1DWJM 5KZ6A 2DUAA 1HX0A 5EKYA 1H3GA 3WQGA 5T9CE 2FZBA 1YLVA 2NXGA 3QMRA 5C54A 3F2BA 1DEDA 2ZA1A 2EO7A 3A5VA 2XIOA 1KNWA 2GZXA 5BMWA 2CU0A 4RNFA 3WDJA 2PLJA 1S5WA 2X41A 5CG0A 4PFHA 5FJTA 3TLQA 3KP0A 4D6DA 3TX9A 1DIOA 2QPXA 3G1HA 1HXJA 3CUZA 2ZX6A 4GZJA 1ZCCA 4UIOA 3IIVA 2V5BA 1CGUA 2QAFA 1Q5MA 2GQAA 1QHZA 1BKHA 1KWGA 4XWUA 5FAJA 1S38A 5AY7A 4YXGA 2DU2A 3WQ4A 1VJSA 4GA8A 4QS5A 3CHCA 1RQBA 1UR4A 4HQVA 5C5YA 1TA3B 2J79A 3HPXA 3PC0A 4C1LA 1EA0A 2G5WA 3W37A 3PZMA 3FX4A 3L9CA 3G1FA 1K8CA 4B91A 1LYXA 3FKKA 1KTBA 2H3BA 4GQRA 5EMMA 2BVDA 4JTFA 5CLWA 1MRQA 2UY4A 1SO5A 3QZEA 4BR1A 1S3HA 1IQ8A 3MO4A 3WLMA 1IV8A 1UH2A 2J66A 3R6IA 1DKWA 2PDMA 1TCMA 2VFGA 3OPSA 4QGCA 3IJLA 2OZ3A 2BHUA 3WNPA 2E4TA 4B2DA 3H2NA 1GQLA 4GKLA 4B3ZA 4Y9AA 3Q67A 2BBFA 3UPBA 4AZ7A 3H21A 1ZJBA 1HQTA 5CZTA 2EKCA 3ARXA 5I00A 1BRLB 4PGLA 3IJ8A 3RHGA 3WQOA 4CU6A 4ZTYA 3UZXA 3DEQA 3O6DA 1V3LA 4IIHA 3ALGA 3E74A 1CW2A 4GI4A 1FA2A 1KRMA 2REQA 4F0HA 3GB6A 4ML4A 1VS1A 1Z44A 4UOJA 1TV7A 3PR2A 3W2NA 4JQ4A 4RCXA 3L66A 3SUUA 1KCLA 2PEVA 3DUGA 4CQBA 3O9NA 3DFHA 2F2KA 2I16A 3E0IA 4I9JA 3UERA 2DZPA 1W9PA 4KGLA 5HOSA 3CHFA 4M0XA 5KSWA 7PTDA 2DPEA 3DFPA 4JFVA 3LHWA 4QEHA 5I23A 1UC5A 3M16A 1EGZA 3EX1A 2X16A 1P6BA 1KA9F 2BOFX 3AFBA 4OOZA 4UMBA 3AIEA 3MZNA 1VYSX 4Q8VA 4A4AA 3NZRA 3CNYA 2XIIA 1BAGA 5F2MA 2WV8A 4MLJA 1ZRQA 5IHSA 1SSDA 5K9DA 3HB9A 1XCWA 3NQAA 4XX6A 4AY1A 4ECLA 3F5KA 1EC9A 3OQEA 1FCUA 1N7KA 4JKKA 4EACA 2PDNA 4PTVA 2OZ0A 3OOQA 1ZJAA 4L6HA 4QLJA 3W6MA 1W54A 5I3JA 2X0YA 2Z1BA 2WC3A 3GNOA 5A6MA 2D3LA 4DUVA 1TMQA 4NL1A 5K9CA 1UKTA 3SQSA 5A8OA 3AIBA 4NZ1A 1UHVA 1ZAIA 3SCQA 2GGIA 4DELA 3K8KA 4GI8A 2GDVA 2YW4A 2WZIA 2XINA 1F4HA 3G0SA 3PBMA 4QJ3B 5BXPA 4CQ9A 3ZR5A 4IHCA 4LRSA 5CAHA 4LAMA 1W1B1 5A6LA 3CGTA 4HK6A 3RILA 2B0MA 4FP1A 4DJDA 4GGHA 3MZ2A 3CUJA 5ECVA 3PN8A 3PZIA 4PTWA 4O1BA 2QLYA 3ABOA 4AD0A 4MUPA 2GFTA 5HMDA 5MHBA 2ZUUA 4U5IA 5I7GA 5I2UA 1BFNA 1SZFA 1E51A 1Q6OA 5A6SA 4XK2A 3DHDA 1YEYA 2X7WA 3R8HA 3MUCA 5C2GA 4ZOBA 2PURA 1DWGM 2JK2A 2WKLA 3TOPA 3PUEA 3L2IA 3FYPA 1HT6A 3KVMA 1H1ZA 4DJEA 2VQTA 3CZ8A 2GWGA 3P61A 2OYKA 2YLAA 4FNPA 1RHCA 3KTSA 4YS1A 4UFHA 3D47A 2AOSA 3QV6A 4GVIA 2ZZ4A 4F9JA 4C6KA 1DWHM 3SGZA 2JALA 2XVLA 4GGBA 1H61A 2OO0A 3N1AA 3SIMA 2GVYA 3WLKX 1EF2A 3KZSA 1E5NA 4U33A 5T9BG 4IPJA 4KFPA 2NXIA 3H70A 5G4HC 4JHOA 3RIKA 3NWRA 1U2YA 2DIKA 5CZJA 3UCCA 1E9LA 2E9MA 1JYNA 2W9MA 2Z2AA 1WCGA 1A5BA 1JDAA 3RLVA 1V0MA 4G6CA 1LOLA 5EL1A 3WY1A 1CGWA 3UYCA 5GPRA 1J0KA 3BAJA 4S23A 4PMJA 7XIMA 3UQNA 4R7JA 2GSJA 4E8CA 2FVKA 1FRBA 1UA7A 2WSRA 5ABGA 3CZGA 3S42A 3BMWA 1J4EA 1JUBA 5HQEA 1J5SA 4X9YA 1TPH1 3GR7A 2VZTA 3BH4A 1THFD 4CD6A 2YXXA 3KBVA 1CGXA 3PFMA 2CITA 4EXQA 3UF9A 3LCLA 3GD6A 1POJA 3PSVA 3BLLA 3F4NA 3QPZA 3QHNA 1EBHA 3IGXA 3KBNA 5DRIA 3UG3A 7REQB 4UWMA 1M65A 5DANA 1EHNA 2QCFA 3VIJA 1MRAA 4J40A 3SUVA 3R1ZA 5HMFA 4WRHA 4OV4A 3SCPA 2V81A 4Z2IA 2ISWA 4MAZA 3KL3A 1S1RA 3TDFA 1R3SA 5DN1A 2Z1WA 1Q6LA 1LQAA 4G7FA 3GG0A 2GL5A 5BXRA 3GAKA 2AL2A 2OWWA 3L4ZA 1IR1A 2Y2WA 2H3DA 1KV8A 4KWVA 4ZO6A 1JAEA 5H8MA 3G5EA 5DRCA 4IMDA 1RBAA 2OU4A 1PIFA 1FXPA 1QO5A 3EWZA 5C71A 1B3ZA 1D7KA 4R34A 2FTPA 4O14A 2Q6ZA 1TPFA 4O54A 2A3EA 2ABBA 3B8IA 3CAWA 3S3GA 4Q8QA 3BW3A 3CHDA 4P7NA 1LQ2A 2YZ5A 1XM3A 2O4QA 3WX7A 2QJHA 4H9XA 2Y4SA 3KFTA 3W7DA 3BPWA 1A5UA 3BK0A 3QMSA 4DJDD 1DXFA 4JFSA 3FDKA 2GQ9A 1LRNA 2DW7A 1LBLA 3VKDA 1JIBA 5AB3A 3ENLA 1QWGA 4XTDA 4O0KA 4ZEPA 3S5OA 1JF5A 1FCVA 4RW3A 1XW8A 2OTDA 1ZJHA 2DH3A 4C7DA 2D0FA 4ZR8A 4FHAA 4DJED 2WSYA 1JJKA 3VOGA 1AQFA 5KITA 3H54A 3VNDA 2Q3RA 2DEPA 1VH7A 3DI1A 3M6YA 4W84A 3GXMA 4DZHA 5AHFA 3EYPA 2Y1HA 5BRPA 3DDMA 2ZXBA 2PB1A 4KT2A 4JQ1A 4JY9A 3T0AA 3CO4A 3EWDA 3KE0A 3BWWA 8CGTA 4AW7A 3NXLA 1RD6A 3NCOA 3ABXA 3VGGA 3BV4A 1D9EA 1UZHA 3W7PA 1XBZA 1BLIA 5EB8A 2OEKA 2P3EA 2EKGA 4Q8OA 3B9AA 3LGDA 1FH7A 1E40A 1ADDA 2RKXA 5BXSA 1UOZA 3GU9A 1YPXA 1IWAA 1FTXA 4NYYA 1HVQA 5D9MA 4GY0A 1Y65A 1RQHA 3G1DA 1XWYA 4C5ZA 4DF1A 2VKZG 5LNRA 4KF1A 3VZZA 4AIUA 2P5NA 4BCEA 5HQLA 4MYAA 3TYZA 4HPJA 3W84A 4UTKA 1BPLB 2HCVA 4MPKA 1JGMA 3T0TA 3ITCA 3KRSA 4MVAA 1AUSL 4UQEA 4Y6GA 4OBTA 2C16A 2DSKA 3VD3A 1GTEA 2BOGX 4J4KA 3LRKA 3QW3A 4M5PA 2OZ8A 3WK2A 2BY0A 4HPNA 4S38A 2I56A 1MWOA 2VX5A 3EKLA 1QDSA 3WLQA 1RK6A 1P0NA 3U7VA 5M2FX 3LPFA 2ATSA 3DYOA 1CEOA 1ZBKA 4PUWA 2ZIDA 3KHDA 3L4WA 2Y63A 4QG6A 4NASA 4X0VA 3BZJA 3S1WA 1WX0A 2QCMA 4KRTA 1E70M 5D2YA 4ML9A 3MV11 1KCZA 3AAMA 1Q63A 1JZ2A 4I8DA 4EPDC 5I09A 2H9AA 3AZSA 4HNNA 5F4XA 3H2AA 4CD4A 1Z8AA 2R1NA 2C1HA 2FZ9A 3WMCA 5A6BA 2J9YA 4L56A 3VC5A 1VFMA 4W8AA 1NWRA 5E9AA 3MSYA 4C6NA 3EX3A 2C71A 1VP5A 4WLCA 1JG9A 3P67A 5KMYA 3TJIA 4EVZA 5JIPA 5J5DA 4GNVA 4LW7A 4REQB 1AQ0A 4JNMA 4A8NA 1XPGA 3MYPA 4NAFA 1V0NA 3HQOA 8XIMA 4MWAD 5HWNA 1P6CA 3SCWA 4O13A 4DY1A 1KTNA 1OGBA 4QNWA 3IIXA 3KRUA 2I9UA 3WLJA 2VUNA 1HKWA 5JMUA 1PBGA 2WBKA 3L0NA 3A21A 4CN6A 2P3ZA 3GNNA 4QE1A 4PTXA 3W1TA 5LIKX 4KEMA 4PH6A 1W31A 1H7PA 1KFLA 3E9AA 1XLAA 1V3MA 4Y90A 3OVGA 5I24A 1R3RA 4P7RA 1MXSA 5D03A 4HKPA 2D0HA 5E0FA 4YIWA 2PBOA 3WLPA 2A3LA 1GJUA 3ITLA 1E6ZA 1Q6DA 1GOQA 3PNZA 1BTCA 4P8UA 1FWTA 4ZB2A 5HWMA 4XKYA 2NVDA 1TMHA 3WNKA 1CLXA 1RCOB 3MUZ1 3IS4A 4QISA 5L9FA 4KFOA 1FWHC 4AG0A 3W7HA 3C3NA 3MCOA 3H23A 3PHAA 3NQ6A 2VFHA 3SGUA 3COTA 5DCEA 4UQCA 3OEXA 2TPSA 4GC3A 4DXXA 3QBUA 1G4TA 3H55A 3PWAA 1AQHA 4L1XA 2R1MA 1G01A 2ON3A 5BYWA 3R8RA 4ACZA 4RNHA 1CX9A 1UH3A 4L7ZA 1DTUA 3IUIA 1O7AA 1QAPA 5TD4A 1EJUC 2FZMA 5H1WA 3VILA 2J88A 4W85A 1QW8A 3QLLA 3T1GA 1UD3A 1FDZA 2OSWA 1IEIA 4AZCA 3QR3A 5A2AA 5BRBA 1UZ1A 2OELA 4MJ2A 1OYCA 1TR1A 4EWJA 4HGXA 5GJNA 4LNCA 2QPSA 3TA9A 4UOQA 1LRQA 5FKYA 2WCAA 4H9ZA 1XIBA 4ACYA 1WXJA 2YX0A 2HS8A 3CEPA 1OFRA 1LG1A 2XGIA 2GK1B 3UJSA 1LDCA 2FH8A 2Y5JA 3TYEA 3WMBA 2G3IA 5C9XA 1CLVA 1QOQA 1ICQA 2QV5A 3QY7A 5I3FA 4GC4A 3U8GA 2VVSA 2G3NA 1JF6A 5D33A 1MFUA 3IV3A 1JCLA 2O9RA 1GJWA 4GVFA 1FOBA 2C79A 3NNTA 5GVJA 1DQWA 1G7UA 3CV2A 4LPCA 3RMEA 1LLOA 2HVNA 1MZHA 3HOJA 4P5UA 2Q8XA 3TTOA 1GG0A 3K1DA 5CPOA 4NQ1A 4RZ5A 1BVWA 1H5YA 4JN7A 3HA1A 1E6PA 2J27A 1Q6QA 3I4EA 4KEVA 4J3VA 4HYWA 1VGAA 1E0XA 3FY1A 4ZVJA 1XIGA 2OQYA 5CSSA 1IEQA 3AWNA 2PDYA 4JTAA 4AXNA 2RDUA 1U22A 3BOLA 3ZT6A 4DLMA 4W86A 4W8LA 4M7TA 1K4HA 4HA4A 4AEFA 4IIDA 1R2TA 5XINA 1PCWA 1FY6A 3I68A 2V38A 3UT0A 3ARUA 3ITTA 1H63A 1EXBA 1OYBA 3QPEA 3P3BA 5G1MA 3WSUA 4AQLA 4DQWA 1UWIA 3M0LA 1P1MA 1W2VA 2FHBA 1J6PA 3W7CA 3VKKA 1KM1A 2YFOA 4D6CA 3B0PA 3MSDA 3H4XA 1SR9A 3MI3A 4DWSD 2DZSA 3L7RA 4UXDA 2WB5A 4LS2A 3TYDA 5MF5A 4GZ7A 2XUCA 1KBIA 1W1TA 3ARZA 1OX6A 2WMJA 5U4NA 2PDUA 4H8VA 4RNJA 4YPJA 1EUAA 1TFVA 1H50A 4ZMGA 4L65A 1GZ1A 3AOFA 2NUXA 6TAAA 1SO4A 2CXEA 3HTWA 4KCTA 4K36A 4IGMA 1XLJA 3VKAA 3SY5A 1TE1A 3EWUA 1VYPX 1PE1A 3A23A 4G1KA 3JS3A 4OBRA 1A50A 9XIAA 3MUAA 4LEFA 1UKPA 1CCWB 2JIWA 4HPXA 3T07A 3UEQA 4EX4A 3UG8A 4HHHA 3GBEA 5EFFA 1UWQA 3APTA 2ZYFA 5JH2A 2ISVA 4XZHA 1KRAC 4L64A 1ITUA 3VD5A 4C1NA 4BFAA 1V4YA 3E2VA 4PEEA 5D8ZA 3OBAA 1E55A 2R91A 5GJMA 3BG3A 1WP6A 2Z6IA 1GZJA 3CTLA 3O6CA 4IX2A 3REQB 4B5SA 2DIEA 3ZLFA 2A7NA 1K7FA 2OCZA 3NQFA 1N82A 3GM8A 1C8YA 2AAMA 1CENA 1XRTA 3MKVA 4S39A 2EPOA 3BSHA 2VDGA 4TV5A 3R10A 1AL8A 2WZEA 3B04A 3FNDA 3TYBA 1TTQA 2CYGA 1KM6A 1SJBA 2A4AA 2A7PA 2F7FA 5BROA 4N2YA 1GTHA 3ZJ6A 4U28A 3ZSTA 2XSXA 3B06A 1H41A 1MO0A 3VGEA 3KRZA 4F48A 4NZCA 3KVJA 1YBQA 2QJJA 4Y9OA 5F4WA 3UXDA 2R94A 4M81A 3GTIA 1U5HA 4MJMA 4D9PA 2GJLA 3BLPX 3NQGA 3UZ5A 4GBDA 1LT8A 3GBDA 2WWCA 1NY1A 4A35A 4R33A 4AZCB 4JHMA 4OIFA 3RLUA 5A3HA 3LHVA 1K3UA 3PPGA 3K8MA 4O19A 3SQMA 2YA0A 3SAZA 1OC6A 4JTJA 3KX6A 3MQTA 3RX4A 2EPHA 1E3XA 1WA3A 1ML1A 4H2HA 5C9ZA 3SRFA 5AZ1A 3Q58A 2WWDA 3W28A 1JD7A 1A49A 4X63A 1FWWA 5DMLA 4C6IA 1TJ2A 2CW6A 4NNAA 3F4DA 1O5RA 3TP4A 5FF4A 3WF0A 5TF0A 2EAWA 1ZENA 4JR5A 4TVUA 1E56A 4UFLA 5BU6A 5I0DA 3PY2A 3AS2A 2WM1A 1NWTA 2YDAA 3H2MA 3U48A 7CGTA 5FJOA 4CQ8A 3DC0A 3N9SA 1VFOA 1UP3A 3AS1A 2JEQA 2QV4A 4IUOA 4XZWA 4NI3A 1VIZA 4GJJA 3HMCA 3W22A 3WQCA 3VDGA 4ICMA 3GKFA 3WQWA 4JKLA 1GK8A 1EDQA 3BMVA 1ISYA 2AQVA 4GCXA 3WUBA 4H9MA 3LPOA 4G7EB 4LS1A 1GQNA 3V0TA 1HIZA 4NJGA 4UCFA 3QGAC 1OZMA 1PPIA 2IUZA 3EGJA 3FYOA 3N73A 1E4NA 3GHTA 1TZ9A 1O5KA 3SUTA 1ZPTA 3PM6A 3E02A 2DSUA 3OBEA 4J3XA 4NZJA 3PF3A 1A5LC 3RR4A 3L0KA 4QDMA 4LUJA 2ANUA 3UZWA 1XIJA 1U83A 3P8IA 1GVYA 1TJRA 3UXIA 3SCTA 1KFKA 3AU2A 4ONVA 2BTMA 4J3SA 4F3HA 2JGQA 2OB3A 4AISA 4O16A 2QUMA 4B92A 3LHZA 2FJUB 5D02A 2XH2A 3EX6A 3UVIA 3CPRA 3P62A 1YE6A 1CGYA 3SJNA 4BY3A 1PCKA 3AS3A 3GDRA 4DYKA 3TTEA 1EQPA 3FVDA 1HTIA 2DT3A 3LRMA 4HB7A 3WJYA 4Q6XA 1JZ8A 3AIQA 1E4MM 3WD0A 3QJAA 3JZUA 1FWJC 1JQVA 3QYSA 5DELA 2EG8A 5CZKA 4L1GA 2PWFA 3RU8X 4JS3A 3AYRA 3HG5A 4FNTA 3N3MA 4DF2A 4MFEA 3VAVA 1CXEA 4E6MA 2A85A 3MU7A 2C15A 3EBVA 3QEZA 3ZR4A 1DIKA 4WDUA 3RPMA 3VUPA 1XLIA 4NF7A 4PMOA 1IGSA 3C86A 3S2LA 2Y70A 1TVLA 2ALDA 3H8AA 1XYBA 2V5CA 1HO1A 2HTMA 3E12A 3FAWA 1QI3A 4H6QA 1TPDA 1K77A 4GY1A 4WOQA 3FK4A 1C8XA 4JCLA 3LDVA 1ZQ5A 3THDA 2E9LA 2DZXA 2Y85A 1G1YA 4PMXA 1UWAA 3E2RA 2P88A 3W00A 4Q4SA 4U2YA 1TTPA 3ME3A 1FX6A 3G22A 4HJFA 3LV5A 2GJNA 3CZEA 4BK9A 1GVSA 3HPZA 4DAFA 1U1HA 2ZUTA 3H2OA 4B16A 4MY9A 3ARRA 1KFWA 1W3KA 2E6YA 4MUZA 1R8LA 4AY7A 4JAWA 1QI5A 2G37A 3R0KA 4PL2A 3BXWA 5AOUA 3S9ZA 4JTDA 4A21A 3P2VA 2C3ZA 4J1OA 2ZKMX 3M5XA 1W56A 1CBGA 4I5UA 2GYIA 1XYCA 4NZ3A 2HVMA 2VEFA 1CGTA 3BOFA 1FWCC 3RRXA 3CV6A 3WUGA 4JTSA 4IFKA 6TIMA 3N3TA 3KAOA 3ZT7A 3F4VA 2W6RA 2VQUA 4AWTA 4CLMA 1GPFA 5FEWA 5AKQA 4O11A 4PBEA 1I2NA 4URIA 4UFJA 1XLBA 3CZKA 3GHRA 2EJAA 1KM5A 2PDGA 1AFSA 2IQTA 2G95A 3NOYA 3EA1A 2XSBA 3PG9A 1REQB 4JIPA 4KMQA 3TIMA 3W1NA 4WD0A 4C6LA 3F4WA 3WF1A 4GNKB 1SU5A 5A5WA 2IMRA 3S47A 4MWAE 3QQ1A 5K2ZA 1SFSA 1NIUA 2HK0A 4QJ5B 3N12A 1BD0A 1YMYA 3EDJA 3MO7A 5F2GA 4EPEC 1BVNP 1I8JA 2XM2A 2XJ7A 1KXTA 2PDJA 3STEA 2XU2A 4DLFA 1SSGA 3LEPA 4HHPA 4Z2GA 1GW9A 3WD4A 2DGAA 4NXKA 3S83A 1HNYA 1MQQA 4UTTC 2DSZA 4L9YA 4AYGA 2PS2A 5DCBA 2W66A 3GDLA 6ENLA 2O56A 4K39A 4D6EA 1AJZA 5HBFA 4E2BA 1MW0A 2GSEA 4X22A 2A2IA 4CD8A 3TR9A 1XC6A 2CLIA 1HKIA 3ANYA 4L6DA 2CZ5A 3OA3A 3W1LA 3GFZA 1XIFA 2P8CA 9RUBA 3AMCA 3G1SA 1UWSA 3XISA 1EZ2A 4J9JA 1RJPA 2Z28A 2Z25A 3F7JA 1UR2A 4HNUA 1YBQB 5D37A 4UFMA 4WSKA 1ZBWA 4K7VA 5XIMA 4XBJA 3PZQA 2PU0A 4NUWA 3MDWA 5HMSA 2QXWA 1UKSA 6XIAA 4MIMA 4Q6JA 3IIZA 3UWEA 5JBFA 2YCKX 1O5QA 1SM9A 3G1XA 4FIQA 3CPGA 3S1GA 2GJRA 4GOAA 4RE4A 5KETA 1AD4A 1XD0A 3WDQA 3M0KA 2VUYA 1L6SA 2Y5SA 3IPWA 3PTQA 4B4HA 3M5VA 2O9OA 1XL9A 3HG2A 1ITCA 4RL3A 1QNOA 3TSMA 2I17A 2XFFA 3B8SA 1YPFA 2WSQA 4QAWA 3W2JA 1OX4A 3IJQA 4MNKA 4MFDA 1AK5A 4FR6A 1T99A 4EAYA 4Z0JA 3BLFA 4HZ7A 4ILSA 4L4PA 2QPUA 3VOHA 1TQJA 4LAUA 4K8EA 4WIWA 3LTPA 2X1TA 2CLEA 3ONBA 2NX1A 4FLRA 4KKXA 1C7SA 4HZMA 4NJHA 4WY0F 5FSDC 1DVJA 3ZJ8A 4O50A 1JXJA 2CEQA 1ISVA 3ZWSA 4P61A 4LEQA 3MHUA 4H6KA 1XX1A 5DQPA 4MZYA 5ABTA 3GE7A 1FWEC 4QM1A 1Q6EA 3R58A 4Z2JA 2R1PA 2X1SA 2RGLA 2HE8A 2WVVA 2E09A 3B8DA 4UTHA 4IT1A 4W4QA 4GYKA 3E2QA 3L5LA 3SN1A 4AVFA 1VLWA 2YCEA 1TUXA 1AODA 2E40A 3DERA 3W1RA 2E1DA 2OZTA 3KOYA 1YTDA 1W5PA 3LI1A 1EIXA 2YDSA 4MDOA 1TVPA 2G41A 4DN1A 2VYOA 3OLDA 4J7RA 3PAOA 4GLEA 3E6EA 1X6UA 3I7QA 1M04A 1DXEA 2YOCA 2ESCA 3VKBA 1PVNA 1E1CB 2BHZA 3PUGA 3WJWA 1H49A 3OVRA 2X1IA 3S2MA 4AUBA 3NQCA 1TWSA 4UFKA 4YVVA 2QKFA 1W9BM 3HIJA 2DORA 4F40A 1GOXA 1GOOA 1DYSA 4MPQA 3GHUA 1M9HA 1O5XA 2PP1A 2NV9A 3E0VA 1SGJA 4K38A 5HMEA 1BWVA 2E8ZA 2E5BA 3WH6A 4D71A 2YA2A 2WBGA 1NF0A 3B8TA 1C3FA 6CGTA 2CESA 3VNLA 3ZVIA 3WBYA 2VZVA 1K8XA 5DBTA 1OC7A 1XGEA 3M64A 4O12A 4PB5A 2Z4GA 3N2OA 3SN0A 2XFRA 3CIWA 2IXVA 2A79A 3EA2A 1R0MA 4PB3A 2HK1A 1NWSA 1DL3A 5FEPA 2GUYA 4PEKA 3T2OA 3IIPA 3LM7A 1C92A 1XIHA 2E1WA 2DDXA 2ZVIA 4D2JA 5DMNA 3K4AA 4AFYA 3AS0A 4NXSA 3CHEA 3NL3A 3NPXA 3UZYA 4IMAA 4QRNA 4KIRA 4FLQA 4BI7A 1UD5A 1M7JA 3TN3A 1F5ZA 4PUMA 2E5DA 3POHA 1QI0A 5CBJA 1FWNA 1IXPA 2NWRA 4MB3A 2J25A 2G3JA 1LORA 4NHVA 2I14A 1DWIM 3O16A 1DIEA 2VGIA 4IPLA 4Q4PA 5LIXX 1BYBA 2J7BA 5H6HA 1EBGA 2QYGA 4J28A 2VZOA 4L4LA 5I02A 3CH0A 3W9ZA 4FNSA 1SZRA 4RJEA 1B5TA 3WNMA 3SSJA 5I3GA 2OWXA 1XH0A 2WKGA 4P7OA 1HL9A 1MXDA 1Z69A 3N2TA 5KINA 2OMAA 5CQ1A 1MUCA 1SMAA 4B2DD 5AC8A 4FOKA 4UMAA 4DUXA 3AIWA 2Z26A 2PTYA 4RR4A 5I3IA 1RV8A 1OD8A 3C0QA 5ABEA 2BSLA 3KDOA 1CYGA 4AXKA 1FWSA 1H60A 1Z9AA 4R3UA 4CNNA 2PGFA 1M41A 2D69A 2C1IA 4I7WA 1O1HA 3KCJA 3VGBA 4R9XA 1H7NA 4AVOA 2VHLA 1UZ4A 1SFLA 3M7WA 5D38A 2O55A 2QCEA 4H4IA 2ISSA 2OFJA 4LXFA 3WK3A 4LWWA 4Q4KA 1A53A 3NEVA 5D30A 1KBBA 3BARA 4MZ8A 4BQ3A 3HPSA 2E0PA 1PHWA 5B80A 1I60A 1GEQA 2AQWA 3NQDA 3PULA 3CASA 3PS7A 3MMWA 1P4CA 4LY8A 2HE5A 4GXPA 3WQ5A 2DT1A 5DY2A 1UKQA 1TYGA 2YPIA 3SZ8A 4EIVA 3ICJA 2V2DA 4LB3A 3SY1A 3DU0A 4WOZA 1EJTC 3S2JA 1XINA 2V5JA 1SJCA 4DM2A 4NNBA 1PTAA 1EGMA 3W3OA 3F1QA 1AH0A 1HW6A 8XIAA 3R12A 2UWFA 2X05A 3SR7A 3W24A 3B9EA 3UR5A 4HZ6A 3MWAA 3R89A 1BQCA 1R7AA 2Y24A 3PWIA 4LVBA 4C6JA 1OIFA 2XGBA 4JTGA 3EPOA 3R79A 2ZICA 2QHAA 3P74A 1I0BA 2E77A 4NAEA 4PCTA 3T78A 4LB4A 3BAWA 1NARA 4P8WA 4M6VA 5LA2A 4LVAA 1WXYA 3KS5A 1ISZA 2PDHA 3FCPA 5E0KA 5PTDA 3MJYA 1AVAA 1REQA 2DFAA 3A3WA 4JIEA 3EWWA 2J7FA 3KOFA 1AMKA 3MI6A 4HMCA 4NIRA 4AEEA 3KZPA 3QVQA 5FESA 1K70A 1QW7A 1ECQA 1H1NA 3N9RA 3FS2A 3FW6A 3EMCA 2WHMA 4UR8A 3AZRA 1W9DM 4LY4A 3NYZA 4F9DA 5K4ZA 3HN3A 1F6YA 3M0ZA 3UA3A 3OYXA 4A2SA 1NEYA 3NQMA 4K2SA 3RMJA 2OX1A 2QCLA 5DMMA 1HKKA 4GJIA 5E6ZA 4JDBA 3UNDA 4H19A 1NFPA 3NO3A 1KM3A 2YDRA 4JICA 1J8VA 1ONRA 2Z1XA 1X6NA 3S8HA 2A3BA 1OX4B 4F4RA 2NVCA 1GYMA 2I7GA 5KZEA 3P5ZA 1VJZA 3T0DA 2E8YA 1PO9A 5LYRA 4GO9A 3QR1A 3QLDA 1GJPA 2ZUSA 3TCEA 5GJPA 5C2XA 2CPUA 1B31A 4DJFD 1Q4NX 2VENA 3MMTA 3TZNA 3QR0A 4HT3A 4ES4A 5K3VA 3L68A 3W27A 4AH7A 3NPUA 4O0QA 5EA9A 3MSRA 4DJDC 1SUXA 4GUHA 4JX6A 1L8PA 1V79A 4CNTA 2WNWA 2J8TA 3FA4A 1AZ1A 4IQJA 1CDGA 1F3TA 4E8DA 5G4EA 2ZX7A 4FPSA 2WVVB 3LX9A 4IGNA 5E1QA 4XO6A 1E15A 4MOZA 1KFCA 1XDLA 4Q8WA 7ENLA 5E9XA 2ACRA 3QYQA 3F5LA 4GQGA 4DF0A 4XAZA 1XP3A 2JF6A 2PZ0A 2RDWA 3VDHA 4AD1A 3VIKA 1P0BA 2DQXA 1VEPA 3KM8A 3S1VA 1QTWA 4IPNB 2RJHA 3DIPA 4DBSA 3WH7A 1MEHA 2DJXA 5C9WA 4YTTA 2IKGA 1B1YA 5I5RA 4GWEA 1Z6KA 4EP8C 3CQJA 4ZQNA 3TZFA 1WBJA 3UD6A 4UTMA 1SW3A 3QOMA 6XIMA 3L4YA 1AJ2A 5IDIA 2GGGA 3MUXA 2OG9A 4JQ3A 4M1RA 4IM4A 3AHZA 3SCRA 2V5LA 3FVMA 5GNXA 3THQA 2V82A 3A22A 3PZGA 2W67A 3ITXA 4GMEA 3FJLA 4UCGA 1JQXA 3SJ3A 1Q8JA 2D23A 3CIVA 1A5NC 3S5NA 3W4RA 2BY3A 3DG6A 3WH8A 2PSNA 2HDJA 4QAIA 3KHJA 5EBAA 1H5VA 2VR4A 2PDFA 3N4EA 1JZ3A 4JPGA 4H8HA 3OA5A 3PG8A 2XN2A 4I9AA 1JYWA 3VABA 3L0GA 1NDWA 4GI6A 3FSTA 1RXOB 1J0ZA 1A4MA 1DJGA 1T6MA 6REQA 1EP2A 3OIXA 1OIMA 2C19A 2WSKA 3TW7A 2GOUA 1NJJA 3KUMA 3UY7A 3ERPA 5I79A 4AF0A 1LM1A 2OT1A 3LXAA 3NO1A 3UBPC 2PDKA 1F07A 1MXGA 4NJJA 3QC3A 1B54A 2CCRA 3SCNA 3WLTA 1I9CB 1TE6A 2HNHA 1FWBC 1O95A 2YIHA 4FF7A 2Y61A 1OY0A 5H2ZA 2PWDA 3EOUA 1UA3A 2CLHA 1XCXA 2X2GA 1P48A 3IAQA 2AGTA 4LUTA 3E96A 1KR0A 3S5SA 1F6PA 2IPWA 5K4XA 2ZUMA 3GH4A 4UZUA 4Z1CA 4C90A 1V6YA 3PZUA 1HVXA 3IANA 4PMRA 3IJDA 3NL5A 1XYFA 2FZDA 2GJXB 4HA1A 2VFIA 1KGXA 2WHLA 1XHGA 4W93A 3BW2A 2NT0A 1KB3A 4NYUA 1R5YA 1GWJA 4JGDA 5ABFA 3AJXA 1PKNA 4HHMA 3NSNA 2QEZA 1NVMA 2YB1A 4C6CA 4XZMX 4ZQOA 1TV3A 4DAIA 4DZAA 4S3FA 5EMUA 4S3AA 3KW3A 3QC0A 4HNTA 4PUNA 1Y5VA 3K4WA 1KXQA 4NSBA 4K1GA 3GTHA 1FHLA 1X7FA 2F6UA 2WVUA 1VFFA 2BFGA 4HOZA 5HR7A 2YBVA 1VCGA 3UJ2A 3KLLA 1TPVA 1TQXA 4I3GA 1KWKA 2V2HA 2VFEA 3I65A 3CV1A 4LFYA 5BOEA 2OEJA 3E3HA 4K7YA 1NDZA 2HXUA 3NURA 2IKJA 3MMDA 1S2TA 2FMOA 2VNCA 2YA1A 1RCQA 1DHKA 4KBXA 4DPPA 3ARYA 1W3NA 4H41A 1YW1A 3LXBA 5TNVA 3R0DA 4TTGA 2OLHA 3IJ9A 3U5YA 1UWRA 3WQPA 4WDTA 3WFLA 1BXBA 2AKMA 3I3DA 4HOWA 1SQ7A 4DBWA 1RA5A 3CQKA 3DFOA 1I75A 2FDSA 5JXQA 3OZYA 1V77A 3GVQA 4F66A 2VGGA 2PF0A 3CU2A 4MNJA 1EIBA 1L6GA 2QQ6A 1XLLA 3GX9A 3L2LA 4HU4A 1UQYA 2WLZA 3EB4A 4PMUA 3ITVA 1TJPA 2CLKA 3E2SA 3VYLA 2ZRZA 4S2BA 1H2JA 4JIIX 1UASA 1PXGA 4DEFA 1HFBA 2QZRA 5CGTA 5FF2A 4LF2A 3TE9A 1EYEA 1UJQA 1V6UA 3A9IA 3OG2A 1XISA 1QMLA 1JI1A 5CC5A 2BV9A 3M5YA 5HAOA 4BKNA 3E5BA 3BCDA 1E1EA 3PBUA 1BYAA 5A6AA 1RR2A 4WDWA 3U3HA 5JBDA 2WHKA 3MHGA 1G5AA 2XZ9A 3TQ0A 3MS8A 1KR1A 5H8PA 4PTNA 2Z1KA 4JBRA 3GVVA 3ES8A 3IGHX 3AXIA 3FKRA 1WDQA 4XD6A 2YGYA 2D1ZA 1BXCA 2OEMA 3ABSA 1YX1A 5I03A 4N9EA 1K9EA 4E3VA 1E9YB 3GNPA 3PPFA 4D6GA 2QDDA 3VKCA 4V27A 1ICPA 3M0VA 2CZEA 3ZM8A 1IHIA 2BP1A 4A3QA 1D2KA 1RLCL 3H26A 8TIMA 2VX6A 2CKSA 1DV7A 3SECA 1F9CA 1LCOA 4NI8A 2OWCA 2NVAA 1J79A 3L4TA 3WQ6A 3A12A 3D3FA 4GKTA 1RPKA 4I5RA 1L2UA 3HPAA 4GIYA 3A9BA 4JN8A 3EEGA 3A24A 1A5KC 3AU6A 2CLPA 2ZRUA 4L6OA 4JFTA 2VWSA 3GUWA 4C5YA 4GINA 4M1BA 4PMNA 2Q02A 1C9DA 1R6WA 2KX9A 3QQ0A 2HRWA 1NSJA 1KRBC 2DJLA 5D2VA 1X39A 3LY0A 1G69A 1JCYA 1TELA 3GIQA 2LLEA 3GR8A 2HSAA 5KZMA 3AIUA 3H24A 1MNZA 2V9DA 3H7RA 3BICA 4XZNX 3NIYA 2DIJA 1U33A 1QFEA 3P0WA 4DYJA 1QUMA 2Q01A 3W71A 2J24A 5DEZA 3CMGA 1QHOA 1H4PA 3VNKA 2VMFA 3LS9A 1OFEA 3W02A 4DBDA 1OBAA 4HA3A 2VC6A 4UR9A 5BNKA 3W1XA 1TV5A 4FOJA 1P5BA 1GQIA 1J0HA 2YFNA 2QDHA 2FMNA 4KESA 4A8IA 1HJSA 1GVIA 3GKAA 1TG7A 1JFXA 3WLOA 1XC4A 4D8LA 1LRTA 2VZUA 3CZLA 2E28A 3GG8A 1C91A 3AROA 4MADA 2XZ7A 1C29A 3CYVA 4X60A 3VX0A 4ATDA 3CL7A 4J3WA 2EG7A 4BI5A 1W1A1 1L6FA 1IZJA 4FI4A 4KCWA 2CBIA 1Z7AA 5M1TA 1LL4A 3ATZA 2CWXA 3NEHA 5I6SA 1FCBA 2Y8VA 2B81A 1W1VA 2YCLB 1QPQA 5KZDA 4A6GA 3H4GA 1OSEA 3AMDA 4GACA 3UNTA 4PMDA 1UIPA 3LUTA 4H04A 4GYPA 1X8CA 4Y9MA 4CVWA 2BGSA 3SN4A 4A05A 2Z24A 2BY2A 2AKZA 3G6LA 4AIBA 1WZMA 2CFFA 1RJRA 1QT1A 3T9PA 4REQA 3JU2A 1AZ2A 3C8FA 3VVGA 1E71M 1F8MA 3WQFA 3RCNA 1VRDA 4AHQA 2OSYA 3HF3A 4J2PA 1WO2A 4RZ4A 1R87A 3AXKA 3PFRA 3PBWA 3KBJA 4AD4A 1Q2RA 3G1AA 2FVMA 3UP8A 2ASHA 3PB0A 1JCMP 1WZLA 3P14A 2PU1A 1W3JA 3LPPA 3G77A 4FR1A 3W85A 2RGMA 1RBLA 3ZMRA 3VCRA 1K7XA 4POCA 4YCOA 4Z42C 1CGVA 3SEPA 4CCZA 1LP6A 2J9XA 2Q8ZA 1MEIA 3ZVHB 1H0IA 3JZEA 4OFCA 3SY8A 5AHMA 1F7BA 3UCDA 3UR8A 3IK4A 1WDSA 2FZ8A 1LLZA 2OYMA 4ERIA 3CUHA 4JZ5A 3KLKA 1H0GA 1J93A 3SQLA 3GLCA 4GIRA 3VMPA 3DYMA 3NZGA 2GGEA 1GQKA 3MVTA 4DO4A 4PSPA 3IRDA 3GTNA 3WN6A 2VRQA 4GVGA 4ERGA 1XGDA 3GHSA 1KQZA 1W8GA 4V28A 3INPA 3B8VA 3WNOA 2PBGA 1UBSA 3M1ZA 1BEUA 2F9RA 1EJWC 1WUEA 1MFVA 1HJVA 4CQDA 5LXEA 3VGHA 4A3RA 2NUWA 5AYXA 1S5TA 1ODUA 3N2BA 4GIEA 2CLFA 3QHMA 2GQ8A 3U2CA 1W1ZA 2DH2A 3UETA 4O1AA 4LNYA 4JD4A 4CCEA 1HL2A 2DQWA 3IVSA 4CCCA 3S5ZA 3TQKA 2Z27A 4YTSA 2QAPA 4TUFA 3HG3A 3PZVA 3UR7A 1QPKA 3CWHA 1J2WA 1P1XA 3VNJA 3H2FA 4P2VA 1N8IA 4AEOA 2WJZA 4B5UA 2BS9A 1J0IA 4JTHA 1Q4WA 1TMLA 1EJXC 3TYUA 5G2HA 1GZGA 5LGZA 2FH6A 5FOOA 1EWEA 2FHFA 2V6AA 2ZWZA 4L4OA 4HMDA 2R8WA 5LIUX 1RY0A 2PDIA 2PGRA 3QTGA 2AMGA 3SB0A 3EDKA 3PTDA 3BAIA 4J35A 5FI8A 4YHGA 1W37A 1ADSA 2XSAA 2WNQA 3KS6A 3DFSA 3LM3A 1ME8A 1V08A 4XBKA 2CZVA 1M5WA 4AIEA 2X7VA 2VGBA 4UNLA 4US5A 4B5NA 4GCAA 5E70A 3NZ1A 5BW6A 3T55A 4ADSA 3FJ6A 4GABA 1TV8A 3IACA 2WOQA 1OABA 1JR1A 3U4AA 3A4JA 3MP5A 3PAJA 1XICA 3DBPA 1WYIA 3VIGA 3RCYA 1GCYA 4Y7EA 3AHYA 5JU6A 4XTIA 3RUBL 4KW2A 3CUGA 1JPDX 2OODA 1LUCB 4MJZA 2G8ZA 4AYSA 2P10A 4PUDA 2OJPA 4HCHA 4OJYA 3W7QA 4JTEA 4Z1AA 1OX5A 3PJTA 3ZT5A 1RD5A 4YYCA 2L5HA 2QVNA 1QASA 2WPBA 3T8QA 1RPXA 1FWRA 4PRTA 4CCDA 1X1OA 4NILA 4R88A 4PODA 3DOPA 4V1YA 3C2EA 1E6RA 1LZOA 2WVSA 1QVBA 4BF7A 3VIHA 1U1UA 2YLLA 2PDXA 3ALFA 2WXDM 3LI0A 1B2YA 3BAKA 2XIJA 3GXPA 3V35A 5IM51 3VFLA 1UP2A 3CC1A 3O0KA 1RP8A 3UW6A 4BWLA 4PCSA 3W74A 1K9TA 3O0FA 2DP3A 1XD1A 2ZTKA 4A2RA 4LJ3A 4UFIA 2YKKA 4LUSB 4B15A 4ZL1A 3M44A 2BXYA 2NW0A 2XWDA 3VOCA 2VX7A 2O9TA 1RH9A 4QR6A 1XYLA 1Z3NA 3BGJA 3NQ2A 4LF1A 3WEZA 1CXFA 4RDWA 3OYZA 2MUCA 3R4IA 4AD3A 3RCMA 4DYEA 2JKPA 5REQA 3RX3A 2YDQA 3C4UA 3GXDA 4JYEA 3FJNA 4U5KA 4ZB5A 5AYBA 3RGTA 2A7RA 2OO6A 3P5YA 4XVDA 3VIIA 5HA7A 1UCWA 4WDXA 1J12A 4ZODA 5REQB 4Q4MA 3UCQA 3RXZA 3HPFA 1DQXA 3RDKA 1XG4A 1E6NA 4HP5A 2E6FA 4N9DA 3PJWA 3TNBA 5C7VA 4L61A 3MBDA 2A3AA 5HUOA 1MUWA 5DF0A 1EL3A 4H8NA 1M7OA 2J6VA 3EDEA 1C9WA 1H7RA 5FSEC 2IKHA 1LF1A 2E6AA 4PMYA 1S2AA 1UMYA 4LU0A 2KZHA 3B9NA 2VGFA 2QJGA 4DJFC 2ZRXA 2DY3A 2ZUNA 5D2TA 2HV5A 3SRHA 1GKPA 3WMSA 4ERAA 3EDDA 3MA8A 2J6XA 3IIOA 3AALA 4WY0B 1XI3A 2Z7KA 4FXJA 3GK0A 1J0JA 5EU9A 1AMYA 3PZOA 1X1NA 3V0SA 2V5KA 3C2OA 3TYAA 1TUFA 3LLDA 1V3HA 2VD8A 2VM8A 4WY0A 1HF6A 1TJ0A 5ABHA 3N9KA 1SFTA 1XUZA 5A8PA 4F0RA 4HMEA 3MYOA 1RJQA 1SW7A 4KWSA 3DFQA 1YXCA 3QF0A 1RK5A 2UY5A 3V7PA 1Q6RA 1XLHA 2O7QA 4AX6A 1BWKA 2WAGA 3PANA 1IXOA 4INFA 4G2DA 5ABFB 1TPB1 1IT7A 2VXNA 1R2SA 4G8TA 2D24A 2H9AB 2FB2A 3IEBA 1GOIA 1VF8A 4C6DA 3UY8A 5CAKA 3GXIA 2NSXA 3BUVA 3N6QA 3CS2A 3FIGA 7REQA 4YWIA 1QCWA 3NDOA 3P80A 3W23A 2OLAA 2Z29A 1HUVA 5A8GA 2P0IA 4RK8A 1EJVC 3GC4A 3W2KA 1B30A 2XDFA 3LTSA 1TV2A 3W83A 2FFCA 4A3YA 4D6HA 5FJIA 4FMVA 1LOSA 1S2VA 1X96A 3NSXA 3PZNA 3M41A 3GVGA 1F2JA 3MMUA 1IIHA 4S3JA 4E4UA 4ATWA 4GQ0A 2B4GA 1QOXA 5CJ5A 3SRKA 4B4FA 3UPWA 5BCAA 2VCCA 1IIGA 1TIWA 4J5NA 3ITGA 3WD2A 1NOUA 3C5QA 3CLWA