1ICPA

Crystal structure of 12-oxophytodienoate reductase 1 from tomato complexed with peg400
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
364
structure length
358
Chain Sequence
QVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTCTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 12-OXOPHYTODIENOATE REDUCTASE 1
publication title X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
pubmed doi rcsb
source organism Solanum lycopersicum
total genus 125
structure length 358
sequence length 364
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1icpA00
1S3HA 3S8HA 2YCEA 3TQVA 1A5AA 1WAUA 4LS2A 3T55A 1EA0A 3GKFA 1QPOA 1XCFA 1W5NA 4LC8A 3W7HA 1TREA 3TXVA 1R46A 1YXDA 2VC6A 5AYYA 3O06A 4AXKA 1OYBA 5AN7A 2G5WA 4O15A 3S1XA 2XN1A 1JCYA 2P10A 3MI3A 3LLDA 4IOTA 4NJJA 4JNMA 1VCGA 3W23A 4DEFA 1PIIA 4EVZA 4AWTA 3LV5A 1LBLA 1LBFA 2Q8ZA 3UZ5A 3EKZA 4UTIA 3LTSA 1VZWA 3HGSA 2Q8LA 5CSRA 5AYZA 1PVNA 3M43A 1KFBA 4WX2A 1ZAIA 3E49A 1YXCA 2GJNA 1N7KA 3W1NA 3DKJA 3EWZA 1FDYA 4JIQA 5HWJA 4ORIA 3BLIA 1MXSA 1TSIA 2BSLA 4B5NA 1FQ0A 4FX6M 1D3GA 2XFWA 3HO8A 2NXIA 2J24A 1FBAA 1TQJA 5D03A 4O50A 1F2JA 5AHIA 3BG3A 3LHVA 3SW6A 5I3GA 4PC8A 3CU2A 4AMAA 1MSSA 4GC4A 3NO5A 4XTIA 4BF9A 4CLMA 1LCOA 1TJRA 3GR8A 1AL8A 1TPC1 3H53A 1LM1A 4RJEA 4UFMA 3LB0A 1GG1A 3EX2A 1CX9A 1WXJA 2B7OA 4WUIA 3PSVA 4JICA 4N9EA 1LRNA 3W2UA 4QQ3A 3NQEA 4BI7A 5D38A 1GVQA 1OYAA 1H61A 4QISA 2V0TA 4Z1BA 1JRBA 2DZTA 3GIYA 3NA8A 3O15A 1NVMA 5AB3A 4RXFA 3WJSA 4KFPA 1ZNNA 3STGA 5LNWA 2Y89A 1TRDA 2E1DA 3LHWA 2NUWA 4ZQRA 3UPWA 2HSAA 2PURA 3PB2A 3F4NA 4XTDA 5KZMA 2YFOA 4M19A 1QCWA 4E2BA 3CIXA 3T78A 6ALDA 2C6QA 4OU1A 5MHBA 3GYEA 4IPJA 3AJXA 3M16A 3STCA 3W2LA 4QAIA 3INPA 3HG3A 4GUFA 2ZRVA 2ZQ0A 1UCWA 5EY5A 4DBEA 4ZVJA 4D2JA 3LCGA 5CPOA 2G95A 3PG8A 3YPIA 1IXQA 1F73A 1XBYA 4LS0A 2C0AA 3UQNA 3SR7A 4RR4A 3JRKA 3LBCA 1H7WA 5HWMA 2WV8A 4NXKA 4BWLA 1H51A 2E09A 2PRMA 1GPWA 1J2WA 5LGXA 4JTEA 2J9ZA 1K8XA 3WK2A 1P5BA 1W0MA 4K39A 2PRHA 1FWRA 3W7EA 4ADSA 2A4AA 3NAVA 3P5ZA 4I9AA 1ADOA 1G4SA 3EXRA 2O7QA 5LNSA 5K7JA 4UTKA 4N6EA 5KITA 2VFDA 3S6DA 3EX3A 1Q6RA 3E9AA 3O6YX 1I2PA 4Z1CA 3QPYA 1H7NA 3W87A 3SGUA 3B0VC 2ABBA 3THAA 4LT9A 1VHNA 2BXVA 2ZZ5A 2ZRYA 1IIHA 1AW5A 3EWUA 1N55A 3NVTA 3UPBA 1KTNA 4EIVA 1VHCA 1JULA 3O05A 3RK8A 3S5ZA 4I7WA 3G1XA 4BK9A 1H7PA 1KTBA 1ZY9A 3PSWA 1QOQA 5D37A 2X1TA 3OVRA 3I7QA 2OJPA 3HPZA 3TC6A 4MFDA 5G5IA 2Y6ZA 3M9YA 5L6UA 1JQXA 4BWLC 1DJNA 4Y96A 2J6XA 2YX0A 1GEQA 4FNUA 2JK2A 3UWVA 1NF7A 4M5PA 1SU5A 4A2SA 5G1YA 5EBUA 2A1YA 3MP4A 3S5NA 2H8XA 3E96A 4PL2A 2GVGA 4ONVA 4O1BA 2W6RA 2QUUA 3GLCA 2NWRA 2EKCA 2DU2A 3G1HA 1RVGA 4OGZA 1IXPA 2C1HA 5D2WA 1VR6A 1DKWA 1GTHA 3DZ1A 2LLEA 3FLUA 4QITA 1QAPA 1C29A 2GQAA 3M5XA 1XXXA 2X1UA 2RHGA 4JY8A 3E0IA 3LCLA 1L6SA 2D73A 3GXTA 4BI5A 3NQFA 4MY9A 2YW4A 3M0ZA 4IMEA 4Y8FA 1VRDA 2FTPA 1RQEA 4JYEA 5K3VA 3W72A 4O54A 5D2VA 4N02A 3BW3A 2ZTKA 3P62A 3MI2A 1RZMA 1LOSA 3CEUA 4ZL1A 2Y61A 3MMTA 3UZJA 3QMRA 5F2IA 2GJLA 2RDUA 1AMKA 4GUHA 4GUIA 1X6UA 4O0ZA 3F1QA 3BK0A 3PVFA 2ZZ1A 4HNTA 2E77A 1OVDA 3Q2DA 4C1KA 4RKAA 4CCEA 1YADA 3LXCA 2ISWA 2R14A 3U2OA 1EP3A 4NX0A 4IPIA 3HB9A 3N19B 4AF0A 4WOZA 1KA9F 3NGJA 1OFBA 1EIXA 3ANYA 5LKYA 3NL3A 4NVTA 4NQ1A 1SO3A 3EXSA 1SW0A 4JTKA 4LVDA 3W6YA 4YL2A 3VI2A 1W5QA 2ZZ2A 1EX5A 1KM1A 2WSQA 2GQ8A 3QEZA 2GVLA 4DXVA 4TMCA 1OYCA 3PS7A 3NPXA 4JX4A 4PEKA 1WYIA 5DELA 3N73A 4MIMA 4DF2A 4CNNA 2QDHA 1MZHA 1W37A 4OE7A 3B0UX 2ZTJA 1WX0A 3D0CA 5FI8A 3R89A 3GVGA 2KZHA 3TC7A 2EGZA 3L9CA 5D02A 4R34A 1YTEA 3ATZA 5AHNA 1I2OA 2CLLA 3TKFA 4O0KA 4L4MA 3W76A 4WZHA 1VQTA 1E51A 4K8EA 1BKSA 4HKPA 4JGDA 5C55A 1AW2A 4W9TA 1FDJA 4MY1A 5U7SA 5H91A 3KXQA 4FX8A 3MP5A 5IM51 5DXYA 4ICNA 4FF7A 3W1TA 3E02A 3LRMA 3VFLA 1O5XA 4JX6A 3DXIA 1SSDA 1DHPA 2ZRUA 4UR8A 4JTIA 1XC4A 1SFJA 1OFDA 3IIVA 5H2ZA 3P80A 1TPWA 4YCPA 5I3FA 3G1AA 5SWUA 3OEXA 1ICSA 2V30A 5D05A 4TU1A 3TMLA 3H55A 1YDNA 3A21A 3TA6A 4AHOA 2HS8A 1OF8A 2NX1A 3LCFA 4UTHA 3NYZA 3HIJA 1ZALA 3HGOA 5FESA 1YPFA 1ALDA 1KBIA 4CQ8A 4QM1A 5CZJA 4HT3A 2GUUA 3IIPA 2B0MA 4GRSA 4JYFA 4UMBA 4BFAA 5T26A 3FIGA 2QJIA 4POCA 1I2NA 3GDMA 1LROA 3G0SA 4OWGA 5DY2A 2ZZ6A 1BWKA 2QCMA 5HULA 4YLWA 2QCNA 4IJBA 1OX4B 1Q6QA 1H7RA 1IIGA 3KVJA 4QNWA 3O63A 4JTFA 1DORA 4GBUA 4CNOA 1I2RA 2VFIA 4JR5A 3TMQA 4TMBA 1P1XA 1YTKA 3CHVA 2O7SA 2CLHA 1K7EA 1OX4A 3NPVA 1LRTA 1S5TA 1SZGA 2Y7EA 4UFLA 1TPH1 4O11A 4Q32A 5F1VA 4OHQA 3QPZA 3W7OA 1DQWA 1HO1A 5D30A 4YWIA 3C2VA 3TE9A 1RQBA 1LOQA 3RF9A 1HFBA 2ZFAA 3P8IA 3WFAA 2A2IA 2VEKA 4RZ5A 2ZZ3A 4O1DA 5DN1A 2TYSA 4JTGA 3TDFA 1KV8A 3PUOA 2C18A 3UYCA 3W7KA 1LRQA 3SZ8A 1JCMP 1X7FA 1XUZA 2TMDA 1EWEA 1U83A 2WJZA 3W1LA 1ZJIA 4JN6A 3CC1A 1Z48A 2NUYA 4WJEA 2YPIA 3STEA 3TAOA 1EPXA 2GPTA 1FWWA 2NLIA 2QCGA 3CB8A 4LC6A 1ZFJA 1TYGA 4P61A 4NX5A 2CLEA 4LVFA 3FYPA 2R94A 2QAPA 3SSJA 1JCNA 2Y7DA 3RLVA 3TROA 3WK3A 1KM2A 4BR1A 3IIXA 4HNVA 5DCBA 1XFBA 2B7QA 4WD0A 3UWUA 1TTPA 3L65A 4N9BA 2WNZA 2WO5A 1ONRA 1OFPA 4JDBA 4UTLA 3LGEA 4O53A 3NM1A 2Y62A 4O19A 1H7OA 1R47A 1CI1A 2ZBTA 3EB2A 5KSWA 3C6CA 3USBA 3HJZA 1H7XA 3OHIA 3EKLA 3LRLA 1UUOA 4PFMA 1SW7A 3GDTA 3TXZA 1JUBA 1UUMA 4E2DA 3ABOA 5BW6A 3P74A 2NX9A 2HMCA 1XBZA 1QPQA 3GNDA 4UFIA 1OFAA 3O1NA 3GDLA 4UTMA 2CZEA 2JKAA 2V5BA 3NDOA 3CLMA 3KX6A 3LCWA 2H8ZA 4KKXA 4LRSA 2CU0A 2OX1A 3BLEA 4M6PA 1ME8A 3DKLA 1TQXA 5A5WA 3HPSA 4U4MA 3NL6A 4NT0A 4IMCA 4FHAA 4KWWA 3HGRA 3TAKA 1YXYA 1AK5A 3W86A 1TTJA 1FY6A 1H50A 3EXTA 4L4LA 4M7SA 5HINA 4XQ6A 3TH6A 5A8GA 1GVRA 3LHUA 5LNRA 1KLZA 2WOQA 3C0JA 3M41A 3IIZA 4XKYB 4JTUA 2NX3A 3PULA 1HO4A 2C13A 4HSNA 3TQKA 4MOZA 4X9SA 1FUYA 1GVFA 3P60A 4NJKA 1UBSA 3CTLA 3EEGA 4DO5A 4XKYA 3EWYA 1OK6A 5LHEA 1R30A 3FS2A 4G1KA 3H54A 3LBMA 1HG3A 1K7XA 4JTHA 2V81A 5TBOA 3DU0A 2ZRZA 3PBWA 5EMUA 4EF8A 4QSHA 4UFHA 3A23A 2ALDA 2OMAA 3C61A 3GDKA 3P84A 1WBHA 3JR2A 1NF0A 3G18A 1I45A 3OIXA 1KW1A 4JY9A 5K4XA 2DZVA 2FFCA 2A7NA 4Z0SA 3B04A 4NXSA 2UV8G 3TUUA 4M6VA 3TNOA 3I65A 3I7SA 2V5LA 2X16A 2FB2A 4H4IA 4RCXA 3T40A 1OX5A 4KWVA 1QWGA 4UNKA 1OFRA 2ATMA 3CM4A 3LM7A 4IWWA 2YYUA 1MO0A 1F76A 3DFOA 3IVSA 1P0KA 3DAQA 1C8VA 5BOOA 4UFKA 1S5VA 2J9YA 3GZ3A 3HPXA 5HR6A 1JUKA 3ABSA 3WJXA 2HTMA 3MYPA 1JJKA 3FEMA 2DJLA 2E6FA 2E68A 4GE8A 4PH6A 3PUDA 4A2RA 1B4EA 1UB3A 3FYOA 2OZ0A 1QO2A 3T44A 1BEUA 3A22A 2ZRXA 2FLIA 4LV9A 1O60A 4IMFA 5CZTA 2CW6A 4MFEA 3QMSA 1PS9A 1VYSX 1GVSA 1K8YA 3QC3A 2FPYA 2ZYFA 2VFHA 4FNTA 3B06A 3TCEA 3F4WA 2E6AA 2TRSA 3G22A 4DO6A 1V7YA 1XBXA 4MYAA 5AOUA 1F6KA 2A5HA 1FCBA 4NZFA 3TJLA 1GJPA 1G6CA 4O18A 4OV4A 3L21A 2ISSA 3BGGA 4O28A 1GWJA 5E0KA 5BNKA 2BLEA 3W7NA 2DZWA 1VYPX 3PM6A 3IVUA 2Y7GA 4AEOA 1D3HA 1V5XA 4N9CA 1OHLA 5C6MA 4AVFA 4MZ8A 3W7MA 1ZAHA 3ABRA 3N14A 5D2XA 1DBTA 5EYWA 3IGXA 4E0CA 4UMCA 1B57A 1K02A 4GNJA 4O57A 1HUVA 1OJXA 3QH2A 1PHQA 2CLFA 2DJXA 4NUWA 4XUGA 3ZS4A 1GOXA 1FXPA 5DCDA 4O16A 5DCEA 3P8JA 4X3ZA 3CEPA 4PODA 2NV1A 4WY0A 5BMWA 1MEHA 4DELA 3HG2A 4DPQA 3MYOA 2H3DA 4O4WA 2ZZ7A 4NJGA 1XDMA 1AG1O 5D2TA 1FX6A 3W7JA 4RXGA 3RLUA 3TQ0A 1EP1A 1J5TA 2YYTA 4AHQA 4Y90A 3LI0A 5TQLA 4O8RA 3HG4A 1WDWA 4NNAA 1O95A 4LU0A 2WQPA 5G2WA 4K8HA 4R33A 5I3HA 3P82A 5J5RA 5F4SA 1WBJA 3C52A 4ZQNA 1KTCA 3AO0A 4ADTA 3G1VA 5F4WA 3UD6A 4KFOA 5KMYA 5HUOA 3OA3A 4FXSA 3KVLA 1NFBA 5BMXA 4O12A 3G8EA 3DFNA 2NXHA 3O07A 1XI3A 2E6DA 5E1QA 4GFSA 4JYDA 4Z1DA 3MBDA 5LSMA 5E93A 5AC8A 3B03A 4JD4A 2EF9A 1U5JA 5AHMA 3KRSA 2QF7A 1RR2A 5K9DA 3GNNA 5FEPA 4UTUA 2ISVA 2BX7A 3R8RA 3TX9A 1Z44A 4GJ1A 5AC6A 4AF0B 3QSRA 1WOBA 1B3OA 3RFAA 4X22A 3LHYA 4GWEA 1Q6LA 3ZFHA 5KINA 4XWUA 4TO8A 4LVGA 3DBPA 4UR7A 5LZLA 4N2YA 3G0UA 3EX6A 3OVPA 5K2ZA 2GOUA 4N4QA 4FNQA 2NUXA 1KM6A 2JKEA 1QO5A 2QCHA 3L2IA 2PC4A 4HIBA 4PA8A 4UUIA 1LBMA 3M44A 1X1OA 5DBTA 4M6QA 1H5YA 3NQDA 2J88A 1R2RA 7TIMA 4WOQA 2B7PA 3BGJA 3W2NA 3C2FA 3P5YA 3HMJG 3UY7A 4Z1AA 1KM5A 3WK0A 2YW3A 3KFTA 3L67A 1VH7A 2DP3A 2A0NA 4U28A 3RU6A 3KHJA 4ZQCA 3WJYA 1PCKA 5F2MA 3O8AA 4ZQPA 4EWND 2QCFA 4H6KA 3GAYA 1L9WA 4HNNA 4NNBA 2X2GA 1KM3A 2V8ZA 1XBVA 3BG5A 5KZEA 5C2XA 3JS3A 1TTIA 4CCDA 4FIRA 2DZXA 1TCDA 3QF0A 2DZUA 3BO9A 3KRUA 2EHHA 2V2CA 3P81A 3LOTA 1DOSA 1JVNA 4A22A 1VLWA 1FWSA 2X1SA 3Q58A 6TIMA 4S1FA 5LHFA 1Q3NA 3PAJA 1XM3A 3HBLA 1GYLA 3DH7A 4DPPA 1GZGA 4NZJA 3HQ1A 1W31A 2QJHA 1PE1A 1YPIA 5LNUA 2VFEA 3BW4A 4O17A 3W7DA 5ABTA 1BTMA 3DGRA 4JEQA 3W1PA 1X1ZA 3N3MA 1SQ7A 3W7QA 4UTJA 3O16A 1RV8A 2DORA 3S1UA 1GYNA 3BLFA 3IGSA 4DQWA 2ZCGA 4PL1A 2TPSA 3LCXA 3U8GA 1FDZA 3NQ6A 3UY8A 3CWOX 3W1UA 3N9RA 1DVJA 3T4CA 1X8FA 4IGHA 4OT7A 1QDSA 3M5ZA 2XN2A 4AB4A 2A6NA 1OK4A 4UMAA 3MHGA 3K30A 3W9ZA 4MUZA 4UFJA 4EF9A 4FX7A 3VCRA 1KFJA 3GR7A 2QKFA 1M7OA 3W22A 1TB3A 1L6WA 1LTDA 4WXYA 1NSJA 3UWZA 5FEZA 5L9FA 1G7UA 1N8FA 5G1TA 1SO6A 5BRBA 2IQTA 4O4VA 3W1RA 3LCHA 4M7TA 3QW3A 4CNPA 1OABA 1T8XA 5U4NA 4QIUA 2Z0IA 1ME7A 3W75A 4I7UA 4UTWA 3QJAA 2YFNA 1GT8A 3LDVA 5K9XA 2VEPA 3A9IA 3MP3A 3PBYA 4ZQMA 1I2QA 2F7FA 5F4XA 4JIPA 3NNTA 1KLYA 1TV5A 3PB0A 2Y88A 3W07A 4O1AA 1TPDA 1JR1A 2OT1A 3UXAA 1WA3A 3NEVA 1VPXA 3NXFA 3OVQA 3W7IA 1KFKA 4Z08A 3W70A 3KVMA 4YCOA 1QMLA 2Y7FA 4CQ9A 4N4PA 2QCLA 4IMDA 1ML1A 1VGAA 1BWLA 4ZMGA 2QCDA 1UJPA 3QZEA 4TIMA 4ZZ9A 1JCXA 1TPUA 4AWUA 1ZCOA 3N34A 3W1XA 4NJHA 3TSDA 2R91A 1DV7A 3KVKA 3N2XA 4DBDA 2NXGA 4Q4KA 1OX6A 2PRLA 3LERA 3RMJA 3W3OA 3LTYA 1PCWA 4ORMA 1W8SA 1YYAA 3SJ3A 2Z2UA 1QNVA 1W56A 5HQEA 4UTWC 4HSOA 1OFQA 3E12A 1O4UA 5FF2A 4UCGA 2CZFA 1ZENA 2FPVA 3NOEA 3I68A 1A5BA 3VNDA 4NJIA 2EAWA 2NWSA 3QSTA 1DJQA 5FF7A 1FCVA 2E6YA 1Y0EA 3BW2A 3QRHA 1T96A 2VEIA 1GQNA 3TFXA 3HGJA 1TPVA 5CG7A 3LV6A 4ALDA 2RKXA 2PCQA 3DHDA 1EEPA 5AFDA 3G3DA 4AHPA 1SZFA 4OV9A 5I3IA 2G96A 2C19A 3S1VA 1AW1A 2QEZA 3I6RA 3Q37A 1TJPA 1IF2A 1R2SA 3NPUA 4UTTA 4R53A 2I9EA 3PC0A 3KOFA 1XDLA 3NQ7A 4FB7A 4JXCA 4RZ4A 5GVJA 4UC5A 4GUGA 3SIZA 5C54A 3M5YA 2A7RA 3P67A 4K7YA 4OQVA 1R2TA 4Y9AA 4LTSA 2JGQA 1T99A 2ZRWA 5AHEA 3TSBA 3ZR4A 3B0PA 1WOAA 4HPJA 4WXZA 1W3NA 1LP6A 2JBMA 1FWNA 1M5WA 1A5SA 1H1ZA 5CPLA 5AHFA 1G67A 3W1AA 3TJXA 3OG3A 3M5VA 2BTMA 3G24A 3GX9A 3BV4A 5AC7A 1DL3A 1JRCA 1C9DA 2YR1A 4IMGA 3F03K 5CKSA 2FQIA 4FO4A 1F05A 1YDOA 3R12A 4UTTC 3IIOA 2QAFA 5G4WA 4AAJA 5C5YA 3THQA 4LVAA 2HS6A 2GQ9A 2BZNA 3A5VA 1IGSA 3VE9A 1ME9A 3G8RA 1YTDA 1D9EA 1I8JA 2PE4A 1HTIA 2B7NA 4DF0A 4JTLA 2WSRA 2C16A 3NZ1A 3P61A 4IUOA 5HUPA 4Z0JA 1FCQA 3O6DA 2ZA1A 2P1FA 1FWTA 4N9DA 1TO3A 3L66A 3MJYA 3R5EA 3EWWA 1T0OA 2Y70A 1L6YA 4XBKA 4PCFA 3S5OA 3ATYA 5HR7A 4LW7A 4MKNA 4R7JA 1YDVA 1G7VA 1VC4A 1EWDA 1W54A 3C8FA 2Y85A 3LTPA 1CW2A 1K8ZA 3W2MA 1K3UA 2DZPA 5HJLA 3A5FA 3IEBA 3CT7A 3WJZA 4DF1A 3G1SA 5K4ZA 3FFSA 2BWGA 4FXRA 4ZQOA 1OFEA 1TPB1 3IV3A 3EX4A 3B4UA 1QFEA 1W5MA 3ZWSA 3NG3A 2AGKA 5FF3A 3GK0A 1AL7A 3I7RA 3FJLA 4IXXA 4ADUA 2OT0A 2V9DA 1O94A 3L5LA 2CLMA 3L68A 3LI1A 4HNUA 5D33A 1FXQA 3GXNA 1VCFA 3VKJA 5J5DA 5LNVA 5EL1A 3VE7A 3HOJA 3L0KA 2CLIA 1XL9A 2V2DA 3M1ZA 4LNYA 2XN0A 1SW3A 3GXPA 1QOPA 3NR0A 1SO5A 5FEWA 2ZDRA 2FB3A 2CZ5A 3SY5A 1A50A 2RH9A 4MJMA 2RFGA 4I7VA 2Q3OA 4LOCA 5DY3A 4C1LA 1TIMA 2FPTA 5LGZA 3TV8A 1VLIA 2E5DA 3LCIA 4WY0B 4MLRA 4FEZA 4OBTA 1PV8A 2QUVA 5D04C 1B9BA 1PHWA 1SZNA 3QW4B 1TTQA 5FF4A 4QJ1A 5CZSA 5DXXA 1LLZA 4JX5A 1W5OA 1GTEA 4LV4A 1KFCA 3PBUA 8TIMA 1OG0A 4PTNA 3C56A 2H90A 3ZWTA 1F7BA 1W3TA 2VELA 4MVAA 5FEXA 1RQHA 3NL5A 1EB3A 2ABAA 3CIWA 3W1MA 1G4EA 4HPXA 3NL2A 3L5MA 3LRKA 1KBJA 1LOLA 5I3KA 4MLJA 1VYRA 3TU9A 3FKKA 3TR2A 5G4EA 4RK8A 4X2RA 4K37A 2CZDA 3W7RA 3UNDA 3W7LA 3PG9A 3C2RA 4MYXA 1THFD 2Q3RA 1LZOA 4IX2A 1TV8A 5F2GA 5KZDA 2C15A 1KFEA 4S2CA 4NNCA 1NEYA 1VJIA 2H6RA 3C2OA 1KV5A 4LRTA 2X1RA 1ICPA 3PWAA 3NQVA 3UWWA 3G1DA 3P7YA 5AHLA 5AYXA 3FKRA 4HHPA 1H1YA 2YSWA 3NQAA 4HN4A 2GVJA 2V2HA 3G3MA 2QUTA 3W2JA 2B4GA 1PL9A 3RNDA 1P4CA 2H3BA 3FOKA 5DBUA 1EP2A 3CPRA 3W83A 1VCVA 3W88A 1JUEA 1KFLA 3G1YA 3FJ6A 3PY2A 3GKAA 3MHUA 4A29A 4N6FA 3S42A 1HL2A 4WY0F 4YMZA 2Z6IA 1IXOA 3PR2A 1SR9A 2AAMA 1JCJA 2A21A 2JGYA 4MPQA 3UWYA 3OBKA 1TPFA 4RLIA 3NPWA 1W5PA 3KAOA 1TRIA 3V1PA 2CLOA 1J4EA 2G97A 3NQCA 1QR7A 2WNQA 2NV2A 2P0OA 4IX0A 1A53A 3W84A 1ICQA 4CCCA 2J27A 4XBSA 5F1UA 1ZHAA 3L0GA 4P2VA 1SSGA 2C3ZA 1SFLA 4LWWA 4MY8A 4EOUA 3BARA 1IXNA 3S1WA 2CLKA 3QYQA 4K36A 2JKPA 2VFFA 2J9XA 3C2EA 5F2LA 5EPDA 3SGZA 3DFPA 3PUEA 2W79A 5G2IA 2WSYA 4YXGA 2Z6JA 4A21A 4JDYA 3DFTA 2YZRA 3GDRA 1H63A 3EX1A 4JS3A 4O52A 3CQ0A 3W7GA 1EUNA 4JTJA 2ZZ4A 5D32A 3LHZA 1EUAA 3QMTA 3EWXA 5D2YA 4FIQA 4H3DA 5CSSA 1SPQA 1P0NA 5HWNA 4CQAA 5EKYA 3HG5A 2WPBA 1WV2A 3QFEA 1SUXA 3W1QA 2VFGA 3Q94A 5CGQA 4TX9A 5IBXA 3N2MA 4WQ6A 4FNPA 1A5CA 2WNNA 3DI1A 4MJZA 2C14A 4LY8A 3HF3A 1LYXA 3MWAA 2FIQA 1M6JA 5TIMA 3WJWA 1H60A 3T7VA 3GAKA 5G2HA 2F84A 4NU7A 2VOMA 2V82A 3LX9A 4FNRA 2WKJA 2ZA2A 4LUJA 4RX0A 3KRZA 4BI6A 2FJKA 2QCCA 5K9CA 3ELFA 1SZEA 2VKZG 3W7PA 1KM4A 3MI6A 2TSYA 3TW7A 3W85A 1XUUA 5DLCA 3TW6A 5CPNA 3ABQA 5HNRA 2A7PA 1JQVA 5I3JA 3TIMA 1QPRA 4RV8A 2QR6A 1WQ5A 2VENA 3W7CA 2ZA3A 3TFCA 3W74A 2QJGA 2RDWA 1F74A 1JCLA 2A6LA 4Y6GA 3NQ8A 2QDGA 3W73A 3DFQA 3UWQA 3L0NA 3IGUA 2OCZA 5HMSA 1W3IA 1K7FA 3LXBA 4E38A 3FA5A 2CWNA 4GUJA 5IBXC 3M7WA 4AWSA 3NQGA 4O1CA 3V75A 4ML9A 4O14A 1MEIA 5D09A 3DI0A 1LORA 4MZ1A 3UXDA 3R13A 4UNLA 2R8WA 2E5CA 3SECA 1RPXA 3QQ0A 4RZ6A 4IXHA 5CZ0A 1OFOA 1Q6OA 1UASA 1L2UA 1G69A 1Q45A 3SFKA 3G1FA 4K7VA 3M47A 2VEMA 1OF6A 1I4NA 3SI9A 1RD5A 3IRDA 3CWNA 4LUIA 3LLFA 1SO4A 3LXAA 2Y63A 2E5BA 4K6AA 4LS1A 4O13A 4XZ9A 1H62A 1VS1A 4UIOA 3DHFA 1GG0A 5KTLA 3U6WA 2VXNA 3A24A 1W1ZA 4K38A 1YLVA 3N9SA 3MHFA 1LLWA 3EWBX 2RDTA 4LVBA 3MBFA 3W71A 1ZAJA 1XKYA 2X30A 4FNSA 3S5YA 1K03A 3MO7A 3BVJA 3NZRA 2QCDB 3B8DA 2AQWA 2FDSA 3O6CA 2I14A 2EPHA 5EA9A 1B4KA 1TMHA 4J9JA 1F5ZA 1TV7A 3MW7A 4IQLA 4JTTA 3S0CA 3S9YA 4A3UA 3M6YA 4Q33A 1DQXA 1KM0A 3B05A 4JTSA 1Z42A 5CPMA 2I1OA 3DFSA 3C3NA 3STFA 3W2KA 3C4UA 3G0XA 1G4TA 2DZSA 3NQ2A 3GB6A 3QQ1A 4MZYA 1LDCA 3DENA 2A85A 3R2GA 3NQMA 1MEWA 1QPNA 3PF3A 1Z41A 4QNEA 3LHTA 4AH7A 1S5WA 1NAL1 3L5AA 4O10A 1M7PA 4TR9A 1F6PA 5FF0A 3TK7A 3PBVA 1G4PA 3BG9A 3NM3A 3QM3A 2YXGA 3IVTA 4DO4A 1FCUA 3WK1A 2YGYA 4UXDA 2ATSA 4S2BA 2QCEA 4GXMA 1TPEA 2NZLA 2W0UA 2CFFA 3BPWA 2Z1BA 4KFNA 3TSMA 3MUXA 1GVOA 2YDAA 1O5KA
chains in the Genus database with same CATH superfamily
2TODA 3F2BA 3TQVA 1S2AA 1A5AA 4LS2A 2XM2A 4R7OA 4HYRA 1EA0A 1UD5A 1H0IA 3F4DA 4LC8A 1JZ8A 1XG4A 4QG6A 1LQ0A 1EJVC 3PK7A 3M4HA 3O06A 3UCDA 1W1VA 4AXKA 1J18A 3EB4A 3AMLA 2G5WA 2XN1A 3KLLA 3O6AA 1IEXA 1XYCA 2Y8VA 4W5UA 3BLDA 3S5SA 4HCHA 1Z9AA 1QNSA 1XD0A 4IOTA 1JPHA 4JNMA 4L9ZA 1VCGA 1PIIA 4EVZA 1LBFA 1E9LA 2Q8ZA 3E5BA 5E9AA 3EKZA 2BOGX 1NQKA 3LTSA 4JIEA 1E70M 1UH4A 1Y5VA 3CB3A 1PVNA 1KFBA 1J0KA 1MMFA 1ZAIA 1XYZA 2QNEA 3W1NA 2QHAA 1FDYA 4JIQA 1ZJBA 3OLIA 3BLIA 1MXSA 2BSLA 4PTDA 1KB3A 4B5NA 2E7FA 2J24A 2GJPA 1TQJA 5D03A 4O50A 5AHIA 3BG3A 3LHVA 5I3GA 4WKAA 1S39A 4H9YA 1LCOA 5A6MA 4XZHA 1TPC1 1QBAA 2NT1A 1LM1A 1CX9A 2B7OA 4TVUA 4JICA 1G94A 2NVDA 3W2UA 4UQBA 1FP8A 1GZJA 1AQHA 1TFVA 2PWGA 3NQEA 5J04A 3GUGA 1GVQA 1OYAA 1H61A 1ITQA 3ZLFA 2V0TA 4Z1BA 3B8IA 2IPFA 4KCTA 4YTQA 3GIYA 3TEVA 3FVDA 5AB3A 4KFPA 1EQCA 5EMYA 4V1XA 3MZ2A 5LNWA 3ZXWA 2PWEA 2FVKA 2PURA 4LCRA 1O12A 4LF2A 4OZOA 4GQRA 4NZCA 3GM8A 3CIXA 3UEQA 2QJNA 4YS1A 1MW2A 1AFSA 4DVOA 4IPJA 3STCA 3W2LA 2OELA 2HCVA 3HG3A 4AIUA 2ZRVA 2ZQ0A 1HL8A 1LT7A 4DBEA 5AY7A 5A95A 3VIGA 1A0DA 3WD0A 3YPIA 4L6DA 1PKLA 1B0IA 1EJUC 1CXLA 1VFFA 3ZR6A 1H51A 2PRMA 4O8AA 1O5QA 5LGXA 4WGHA 2J9ZA 3B9EA 1K8XA 3WK2A 1XYFA 5IOBA 3PJUA 3AU2A 3U2EA 3OGRA 3W0KA 4IIDA 1WDSA 4IL0A 2A4AA 4YVVA 3R0KA 1XH1A 2O7QA 3Q45A 5LNSA 3BSGA 3RGTA 5KITA 2ZC1A 4I90A 1W9DM 4Z1CA 3QPYA 4AD2A 4QG9A 2ABBA 4B5TA 4LT9A 2J7BA 3DG7A 2VM8A 4M82A 2ZRYA 1TELA 1V6YA 1RA5A 5D4YA 4AW7A 1BRLB 4I7WA 1EZ2A 4BK9A 2GGIA 4M1BA 4IIGA 5D37A 2X1TA 2OJPA 3TC6A 4MFDA 4XD3A 5G5IA 7CGTA 1BRLA 3M9YA 3MV01 1JQXA 3CZLA 2NSOA 2YX0A 1G01A 2W63A 2E1WA 3HN3A 1UKSA 1NF7A 3O0KA 3WBXA 1SU5A 5G1YA 5T9BG 3VOJA 4J1OA 4H6QA 2VI0A 3E96A 3SQLA 4DJFA 4F3HA 2NWRA 4JEJA 1H49A 1P6BA 2NQJA 2DU2A 3G1HA 1B30A 4JTDA 4OGZA 3RYSA 1IXPA 2C1HA 1JZ2A 3WQFA 3FLUA 5IHRA 3M5XA 4JY8A 3LCLA 2J6VA 4OIFA 3WQOA 5JBEA 2D73A 3GXTA 1F3XA 4MY9A 2AGTA 5FSDC 3P0WA 1PYMA 1J01A 3PP7A 2FTPA 4JYEA 3T09A 3EZ4A 5FAGA 5A2CA 2ZTKA 1RZMA 2XFFA 1ADSA 1LOSA 3CEUA 1V02E 2QGHA 2VOTA 2Y61A 2OYMA 3MMTA 3QMRA 4Y2WA 2I17A 4E2VA 4GUIA 1C92A 1J96A 2XIMA 5FL0A 4O0ZA 1CTNA 3OB8A 1EDGA 3KWXA 1Z6KA 2E77A 3KP1A 4C1KA 1Q85A 3SCRA 1YADA 3PUGA 4P8WA 4NX0A 2OX4A 1FKXA 3LZ5A 2DSUA 3N19B 4WOZA 1KA9F 1TWIA 5LKYA 2UY3A 5BWAA 3PNUA 3CO8A 4ZO7A 3VMOA 1EJWC 1UWQA 4YL2A 3WF4A 1KM1A 2JE8A 3BGAA 3GWQA 2GVLA 1Z32X 4DXVA 1E5NA 3PS7A 3QOKA 3NPXA 3CMFA 3U4FA 3N73A 2DQXA 4E8DA 3I6TA 4ZB0A 3R89A 3C0LA 2DSWA 3TC7A 2EGZA 3L9CA 3EWCA 4R34A 3RXZA 3V0UA 1UZDA 1FHUA 1X7IA 2R24A 9XIAA 1K9FA 5AHNA 1YBQB 5H6HA 1E55A 2ZVIA 4XAFA 3A12A 1E51A 4EXBA 2CEQA 1AW2A 2Z24A 4W9TA 1ZBWA 4I9MA 5U7SA 4MNJA 1I75A 5IM51 1WXYA 5DXYA 4ICNA 3W1TA 3B9DA 1O5XA 4JX6A 3DXIA 1SSDA 2ZRUA 1SR0A 1QASA 4JTIA 5A6LA 3VGEA 1SFJA 3GVRA 4HOWA 3GVVA 3R0UA 5I02A 2J77A 3PN8A 3GFZA 5SWUA 4FR1A 3GTIA 3OEXA 4XAYA 1CGVA 5D05A 4GKTA 1YDNA 3A21A 3CNYA 2HS8A 1OF8A 2NX1A 4GVHA 1M68A 3BH4A 1V0KA 1VP5A 3NYZA 3HIJA 4CKQA 3BAYA 3PZMA 4QLKA 1ALDA 1KBIA 4G8TA 4HT3A 3VIFA 4BFAA 5T26A 4POCA 1IR2A 3GDMA 4OWGA 2R1MA 4F0HA 5CSYA 5A69A 3THCA 2ASHA 2QCMA 2QCNA 4JCMA 1H7RA 3KVJA 1YNPA 4GBUA 3TMQA 3HA1A 1IZCA 4KESA 3BAKA 3POHA 5I06A 1K9EA 4HB7A 3PNZA 1EC9A 1LRTA 3M0IA 1SZGA 2XFYA 3IAQA 2OOFA 3WF3A 4FLRA 1RP8A 4C90A 1GOQA 2PB1A 4TQTA 5D30A 4YWIA 4ZSTA 2B31A 1RQBA 3RM8A 2X8RA 2WJDA 1XLKA 3ENLA 4W93A 4M81A 2TYSA 3WIJA 3GNXA 4V15A 5ABGA 2DIEA 3UYCA 3W7KA 3VGHA 1OT1A 5A6JA 5REQA 1LRQA 3WSUA 1JCMP 4H7VA 3FYYA 4ILSA 1WZMA 3RITA 3TZNA 1H5VA 2WJZA 3GE7A 3CC1A 2NUYA 4WDUA 2V3GA 3V3WA 2VJXA 4GABA 4D8LA 4E8CA 4UQEA 1IHIA 3WKZA 2AOSA 1MI3A 3CAVA 2VX7A 1XLBA 4HNVA 3UERA 4GD0A 5ECVA 4N9BA 4IPLA 2WO5A 5C7HA 4JDBA 4QXIA 2GGGA 3NM1A 4O53A 4Y9NA 1BG9A 4HA3A 3HJZA 3LRLA 4LB3A 5I09A 3KZPA 3K8MA 1JUBA 1A47A 4E2DA 5XIMA 3ABOA 2VGGA 3P74A 4C7DA 2HWGA 4HZ8A 3GNDA 4WSJA 4UFIA 4Q8TA 3GDLA 3M0YA 4U5KA 1E0XA 4Q7BA 2JKAA 2VDHA 3WCZA 3NDOA 3PPGA 4GY0A 5I24A 3AJ7A 4LRSA 1LWHA 4C1NB 2FGBA 3HPSA 2HE8A 1C7SA 4DJDC 4G9PA 4ROQA 3TAKA 1TTJA 3AMKA 2FTYA 4LNCA 5FOOA 3EXTA 4L4LA 4M7SA 3W27A 2DT0A 3TH6A 2XGZA 5LNRA 5HMEA 3VIJA 2FTWA 3C0JA 3AIRA 3EDEA 4QTGA 2NX3A 4PCTA 4ZE4A 4PMVA 1FUYA 2F38A 4WSKA 4UQAA 2D69A 4C6LA 3R43A 3VKBA 2D1ZA 2J25A 3EWYA 4PMDA 4MM1A 3MO4A 3H26A 2G37A 3QTPA 2YCJA 4HZMA 4Y7EA 2WM1A 2V81A 3J7HA 4WDXA 3BMWA 4ACZA 4QSHA 4EF8A 3CZ8A 4JFUA 2REQB 3N12A 3P84A 1WBHA 4YU1A 3JR2A 1TG7A 4JY9A 5K4XA 2DZVA 2XYLA 3RN6A 4JNZA 4P7OA 2A7NA 1GW1A 1A3XA 2EJ1A 2HE5A 3TUUA 1WUFA 2D0GA 2V5LA 3C0QA 4MHBA 2PSNA 3LPOA 3UCQA 3Q67A 3AYVA 4RCXA 4AC7C 2PD5A 2FHFA 4UNKA 2C0HA 3CM4A 1F76A 3DAQA 3A47A 5BOOA 1ODUA 4UFKA 3MV11 3AUOA 4XZMX 1Q6DA 3PZIA 3SEPA 3VIHA 3VX1A 2PBGA 3M0VA 3MYPA 3UA4A 4ASTA 4L64A 2E6FA 4Q4MA 4LBRA 1IEVA 1RVKA 2AL2B 1UB3A 4KGJA 2J7DA 3PTMA 1RJPA 3T44A 2FLIA 5D8WA 5EMJA 1HL9A 2AL2A 1I9CB 1ZJAA 3PPCA 4MFEA 1PDYA 4J3ZA 1HX0A 4LAZA 1K8YA 3GY1A 2Z1WA 2ZYFA 2VFHA 3GTHA 4FNTA 3B06A 3TCEA 2OO0A 5DMLA 3PJWA 4Q8WA 1XBXA 1A3WA 3JZUA 1F6KA 3D3AA 2DZAA 3DHUA 1V6XA 1JDFA 3L21A 2C79A 1X8CA 1B54A 3W7NA 2WC4A 3U9IA 4I5RA 2Y7GA 1BSLA 4IQJA 4M8UA 2Y24A 3W7MA 3N17A 3PZTA 1DBTA 5EYWA 4E0CA 1MQQA 3I3BA 1FFRA 4GNJA 1K02A 1EOKA 1R9ZA 4O57A 1HUVA 1OJXA 2DJXA 4YVXA 3ZS4A 3ZSTA 3A4XA 3OQ8A 3BZGA 2HEJA 3CEPA 4Q4QA 4HN8A 2NV1A 1MEHA 3KP0A 3WF1A 3WQ5A 2OSWA 4O4WA 2JIWA 2ZZ7A 1XQKA 1QI0A 5E9XA 2WBKA 3N6HA 3TTEA 3FGCB 1PAMA 2Z2BA 3TQ0A 3RHGA 4AHQA 2IW0A 4AZBA 4M51A 3HG4A 2GVYA 3OG2A 5I5RA 3V36A 2WQPA 4DI9A 3GZAA 3WO8A 3VYLA 2E9MA 4ZQNA 5CJMA 1FWAC 3SRKA 4YJ5A 4D71A 3LN3A 5F4WA 4G7FA 3UD6A 2BGNE 2X41A 5HUOA 4W7VA 4Z42C 5E1QA 4JYDA 1TV2A 1XLCA 5C9WA 1GQLA 4B3KA 3R11A 4QQUA 4ZSUA 2OYLA 3ARVA 3WLKX 3LPGA 1WKEA 4DUWA 2PDQA 4US5A 1Z44A 4GJ1A 5CBBA 1B3OA 3T0TA 5T8GA 2PLJA 2AAAA 3VIOA 2PDKA 2VC5A 4GKLA 1ZJHA 4N2YA 3G0UA 2ESCA 5EMLA 4QEEA 2GOUA 5K2ZA 2NUXA 2HNEA 2PWUA 3EPOA 1LBMA 2J8FA 4D72A 1X1OA 1GZ1A 1J12A 1RY8A 1J93A 5DBTA 3T1GA 2Y5JA 3D5HA 7TIMA 3U5UA 1BYDA 1UKTA 3BURA 3HM7A 2OKOA 2JFEX 4F79A 2B81A 3WK0A 3SCUA 3ARQA 2A0NA 4U28A 3RU6A 4CU7A 1PCKA 4TVCA 2FH6A 1MNSA 3BV7A 4H6KA 3GAYA 1L9WA 2ZDSA 4NNBA 1KM3A 4ZOCA 2V8ZA 5HDRA 1XBVA 5KZEA 3JS3A 1TTIA 4XV0A 4FIRA 3BO9A 2YA1A 2PZNA 4C6QA 1DOSA 2G41A 2E4TA 1JI2A 3FAXA 4JQ1A 4S1FA 5LHFA 2C1GA 1GYLA 3DH7A 3R79A 3UP8A 3REQB 2GSJA 3QC0A 1NWRA 4NZJA 1W31A 2QJHA 1YPIA 5BROA 3PFRA 3HQPA 3G6LA 5LNUA 3UU0A 6REQA 2VFEA 3N15A 1XLLA 3W7DA 5ABTA 2E25A 3KS6A 3REQA 4Z1YA 4GI8A 3TWAA 1TWSA 4RNJA 3BLFA 3IGSA 2ZCGA 1BG4A 5D9OA 4AY8A 1Q4WA 2TPSA 3MA8A 5CBJA 1J5SA 4XD4A 4X60A 1OT2A 3WF0A 4IGHA 3GC4A 2PP0A 1XRSA 1E0UA 4CVWA 3QOMA 1RCXB 5BZAA 1TWDA 1OCNA 4AB4A 1WO2A 4KEUA 1B3ZA 1XIIA 1EZWA 3UPMA 1M3UA 3R25A 1BYAA 4XX6A 4S38A 1L6WA 1EYWA 1KR0A 4HCLA 3UWZA 4HTYA 5FEZA 5L9FA 1N8FA 1D7FA 4O4VA 1BXCA 2GQ3A 3LCHA 5A2BA 3QW3A 1XWYA 5JIWA 3IGHX 3VC5A 4QIUA 1BVZA 3MMUA 3VUSA 5C9XA 2IKIA 4JL2A 4UTWA 1SZRA 5HNTA 1POKA 1E56A 2VUYA 3LDVA 5K9XA 3PBYA 2ZKMX 3VKDA 1VFUA 4S3CA 2F7FA 2VHLA 4JIPA 2VR4A 2Z2AA 3W07A 1TPDA 1JR1A 2OT1A 3ITVA 3NEVA 3NXFA 2D3LA 2WC7A 3W7IA 5I79A 4N4PA 4IMDA 1JZ3A 4DZIA 5EFDA 2CERA 2ZICA 3N34A 3HQNA 2ZXQA 2XTKA 4NI3A 1DV7A 3KVKA 1HQTA 2PRLA 3RMJA 4C6BA 4ORMA 2PDBA 4D6JA 4NYUA 5AYBA 1W56A 3QV8A 2VVSA 5GNYA 4UTWC 4ICMA 1BAGA 3QKZA 1FWHC 4UCGA 4IQEA 5FJUA 1TKKA 4IIEA 1V4YA 3PPHA 5CC3A 3IJ6A 4TVDA 1SM9A 3VNDA 3EA2A 1EJXC 1PEZA 4WK9A 2W92A 3QSTA 5EB8A 2E6YA 3CHFA 5HXMA 4QP0A 2XPKA 3QV9A 3NVDA 4ALDA 2DVXA 2PF8A 3VUPA 2PCQA 4D9PA 2WVTA 1CXKA 3RUBL 1SZFA 4I9JA 2QEZA 3I6RA 2VMFA 1PO9A 1KRMA 3ZYZA 3FJNA 4UTTA 2YOCA 2I9EA 3MUZ1 2J8GA 1HW6A 1A3HA 3B8SA 4IPNB 1JPMA 3KUMA 3NQ7A 1S46A 4RZ4A 4GUGA 2A7RA 3P67A 3V7PA 4OQVA 2BY1A 4DXKA 1I0BA 4Y9AA 2CKRA 1GKRA 4LTSA 2PDWA 1T99A 1UKOA 2H9AB 2E28A 3PJXA 5E09A 3TJ4A 2GDUA 1PPIA 1I0DA 3F4VA 4GFIA 1AVAA 5CPLA 2H9AA 1KKRA 3OG3A 1LWIA 3F2CA 3GTNA 3S2JA 3G24A 3BV4A 5AC7A 5HJXA 3H2OA 1C9DA 1CXFA 3F03K 3LS9A 4G7EA 3WLMA 3R12A 4UTTC 4C6PA 1WB0A 3IIOA 1Z3NA 4IH3A 3RIKA 4XG1A 1R3TA 2V5KA 3OZYA 2BZNA 4L1GA 1IGSA 7REQB 4M1RA 4PMXA 1H11A 1D9EA 1I8JA 1BHGA 3V18A 2B7NA 2WZTA 4JTLA 2C16A 1A5KC 3NZ1A 1H41A 1NDWA 4LGXA 1CWYA 5HUPA 4Z0JA 2ZX8A 3O6DA 1T41A 5I7GA 3MJYA 3R5EA 2Y70A 5AKQA 4R7JA 1YDVA 5TAOA 1R0MA 2WMKA 4Y9PA 3C8FA 2Y85A 1CW2A 1K8ZA 1K3UA 2DZPA 2Y5EA 4BS0A 4WHBA 3LK6A 3ARRA 4B3ZA 4DF1A 3RLGA 4X0NA 1EA9C 2BWGA 3HMCA 2PWVA 3GIPA 1QFEA 3ZWSA 5FF3A 1QHZA 1AL7A 3EPNA 2G3JA 5C9RA 4IIBA 2MANA 3T0BA 2BMBA 2WJFA 3L68A 4KWOA 5EL1A 4PMOA 3HOJA 2CLIA 1GYMA 1XL9A 2V2DA 1SW3A 1QOPA 2Z26A 1SO5A 1WNOA 4DNHA 5A8NA 3OGVA 1A50A 4ZFMA 2RFGA 3SN0A 5LGZA 3TV8A 1VLIA 1I60A 4WY0B 1E6RA 4MLRA 1TMQA 1B9BA 2BB0A 4Q6JA 1SZNA 1TTQA 3H4WA 4H9ZA 3VZZA 2WM0A 3V0SA 1KCKA 4JTCA 3CUXA 4G6CA 5JXQA 4LV4A 8TIMA 1MYRA 1ZGDA 3T42A 2H90A 3H24A 1GUVA 1RQHA 4A8IA 3VOFA 3W1MA 1G4EA 4RW5A 1WKFA 5HAOA 3LRKA 4MLJA 1P0BA 4V33A 1VYRA 3TTSA 4X2RA 3VGGA 2X2YA 5DANA 3VX0A 3W7LA 3PG9A 4WF7A 3BXWA 5F7UA 5D9PA 3D3FA 1RA0A 3C5QA 4MYXA 4S23A 1PKMA 4DIAA 3A4JA 1LZOA 4CD4A 3W37A 3WG6A 1Z7AA 3WFZA 3SQSA 4LRTA 4H83A 3UNTA 1VAHA 3UWWA 3G1DA 3P7YA 4HP5A 2DH3A 1H1YA 1NP0A 4BKNA 2EEXA 4HN4A 4QE5A 3WUGA 2B4GA 1P4CA 2H3BA 5DBUA 1FWGC 3W01A 1OIFA 3W83A 3W88A 1PX8A 1U5HA 2V5JA 4DLMA 4A29A 1DWHM 3DIPA 4NZ4A 3S42A 1HL2A 1DIOA 1Z69A 1UP2A 4YMZA 5HPOA 2AAMA 1VD6A 4KCUA 4MPQA 4P8UA 2PCEA 2V69A 3OBKA 2DH2A 2JIEA 3KAOA 3V1PA 2CLOA 4H2CA 1J4EA 4RE4A 1RLCL 3R1ZA 3VNMA 3UBPC 4NP7A 2P0OA 4IX0A 3W6MA 4B5UA 2QIWA 4OBRA 2WWCA 1E1CA 1A53A 2J27A 1KCLA 2D2OA 4EOUA 3W24A 3S1WA 3JU2A 4L1WA 1WDDA 2J9XA 5F2LA 3BOXA 5G2IA 1MNZA 4B91A 2XM1A 1HKIA 4Y8EA 3W7GA 2G3FA 3IARA 4L65A 2ZC8A 4XK2A 1EFZA 5EKYA 4UCFA 1W1A1 2BVYA 5HATA 3Q94A 2VGFA 2E40A 5A1AA 5IBXA 3SRDA 2V67A 3AZRA 3W81A 4W7WA 1M01A 1A5CA 4MJZA 3BICA 5JH1A 3VGDA 3EOUA 3KL0A 1Q13A 2W66A 3VKAA 3VO0A 5DMMA 2VOMA 2V82A 3PFMA 5E5CA 4FNRA 1QOXA 2WKJA 3QYSA 1SJCA 1R3WA 2VKZG 2HK1A 3URNA 1A5UA 4ZODA 3H2EA 1UZHA 2GSHA 5CPNA 5I3JA 3TIMA 2QR6A 1EF2A 4DBWA 4M3PA 2QJGA 1EDQA 4MKVA 2A6LA 3KHDA 4Q4RA 4Y6GA 4AZCA 4NAFB 2OCZA 3TJIA 1W3IA 3FA5A 4A3RA 1P1MA 5IBXC 4DLFA 1E1EA 3CK5A 5CEWA 2HPIA 4O14A 5EGRA 2WMFA 2CBVA 3UXDA 3U3HA 2WVSA 3TCSA 1UUQA 4DUVA 1CXHA 1L2UA 1KFWA 1G69A 3G1FA 4GI6A 3N2OA 3IRDA 4E4UA 4LAKA 3LG3A 2E5BA 4K6AA 3TTYA 4XZ9A 1H62A 2FZ8A 2XZ9A 4UIOA 2DW7A 3DHFA 1GG0A 2I56A 3U6WA 1VBGA 2WVUA 2Q01A 3A24A 1W1ZA 4C6EA 2WXDM 3MHFA 1E5JA 3AIQA 7TAAA 3LUTA 4FXFA 2IXUA 3W71A 3NZQA 1UWSA 4GK8A 3WLRA 3WLTA 3QY8A 3NZRA 3DDMA 2QCDB 2FDSA 1CGYA 3O6CA 2I14A 2D23A 5EA9A 1RK5A 2O0TA 3SBFA 1TMHA 4J9JA 4HMDA 4A3UA 3QGAC 4Q33A 1UWAA 4QBXA 1US2A 2QULA 4XO7A 3B05A 3E3HA 3STFA 4NG3A 3RU8X 3G0XA 1FHDA 3LEPA 1V6TA 1E6ZA 1T7LA 5CC6A 4OKDA 1OSEA 1S5WA 4O10A 4F4RA 1F6PA 1HNYA 4PTWA 3TK7A 4W7UA 2YXGA 3TC3A 5I00A 1UA7A 4LF1A 3HQOA 1RHCA 2XISA 3HURA 3LD5A 4DO4A 1FCUA 3WK1A 5CLWA 2NQLA 1W32A 1IV8A 4QFUA 2GVEA 3V5OA 4D1IA 2Z1BA 5A8OA 1Q7ZA 4F9DA 3TSMA 3MUXA 1GVOA 2YDAA 2Z25A 2YCEA 3E5PA 2BGSA 1D8WA 3W28A 3GKFA 3PZVA 2J62A 4DY1A 5M3WA 5A6TC 1EGMA 2VZTA 2VC6A 4MG4A 2ZX5A 3S1XA 4LYPA 1S5NA 4Q8MA 3FJ4A 4EANA 1VEOA 3MI3A 1AMYA 4R5EA 3GXFA 2J13A 3W23A 1LBLA 2VEGA 3UZ5A 3AZTA 3GIQA 5JUVA 1ISYA 2Q8LA 5CSRA 3WLIA 5AYZA 1YXCA 3T9PA 1N7KA 3DKJA 3EWZA 1ZBKA 4FSAA 4XZLX 3FW6A 4FX6M 4EAYA 3ABXA 1FBAA 3V16A 4DUOA 4GC3A 1F2JA 4AD3A 2FGZA 3T81A 1MSSA 4GC4A 3NZGA 2QPUA 4GG9A 2YIHA 1GG1A 3EX2A 3KCJA 1LRNA 1UA3A 2AQOA 4QQ3A 1P7TB 4RL3A 1R85A 3L4UA 3NQBA 4XSLA 4QISA 2XWDA 4CQBA 5JH2A 3MY9A 4WGXA 2E3ZA 4GZEA 2C7FA 3O15A 4Q8NA 1NVMA 1HT6A 4NSBA 3RJYA 4W5ZA 1B3VA 5HMDA 5LXEA 2AMGA 1E9YB 1KRBC 2E1DA 3RPDA 3LHWA 5DT5A 4ZQRA 3UPWA 4XTDA 1GEHA 3VNKA 5KZMA 4KIEA 4OOZA 2QZRA 3UZWA 4M19A 1QCWA 4E2BA 3AXHA 4FALA 3ORWA 2BXYA 1G0CA 4QAIA 3INPA 4QDMA 2XIBA 2CHRA 1N8WA 3GFYA 4D2JA 1ZZMA 3LCGA 2G95A 3PG8A 1XBYA 4LS0A 2C0AA 1CCWB 3UQNA 4RR4A 3LBCA 1H7WA 1CGWA 2QMJA 4R85A 5I6SA 3H2NA 3UW6A 2MUCA 3TONA 4F2UA 3VM7A 3PAOA 1J2WA 4JTEA 1P5BA 1PDZA 2PRHA 2G3NA 3FHQA 3W7EA 1W9VA 3NAVA 1BGGA 3P5ZA 1DIDA 4I9AA 4Q4PA 1ADOA 1U22A 5C2GA 3NZPA 1X96A 2VFDA 3S6DA 3MT1A 4BF7A 1Q6RA 3E9AA 4AD0A 3MVTA 3SGUA 3CQIA 1RLDA 1AW5A 1IYXA 3PZUA 4EXQA 3UPBA 1KTNA 1Q65A 1VHCA 1JULA 3RK8A 3S5ZA 3G1XA 1KTBA 4Q6XA 1QOQA 4Q8UA 3H2FA 3DHPA 3LMYA 4AISA 3CL6A 3QV7A 1AQFA 1WP6A 2ZXBA 1V79A 1MW1A 1KGWA 4IG2A 3LZ3A 5B7ZA 1XQLA 3HPFA 5EBUA 4OECA 3W4RA 4QROA 1B3WA 3MP4A 4L56A 4PL2A 3O2LA 4DYEA 4ONVA 4M56A 4O1BA 2QGYA 3AOFA 3GS6A 4GNVA 3RMEA 4UOZA 4CNUA 1BQCA 1DKWA 3DZ1A 4PMUA 1XXXA 1JYWA 2X1UA 3F7JA 4GNKB 5DF0A 1W9XA 2NQ5A 3VD7A 1TZ9A 3MDUA 1AQ0A 1QU4A 2EPOA 2WMHA 4LUTB 4IMEA 3NO1A 2BBFA 5BWFA 4FP1A 2DQWA 1RQEA 2GLKA 2PTDA 3BW3A 3GNOA 3MI2A 4LUTA 4I5UA 3PZGA 4HPHA 1V0LA 4ZL1A 3WYZA 4DB7A 5F2IA 1KBLA 4H9VA 1GOWA 4HNCA 2VRQA 3PVFA 1Q7QA 2D3NA 3W25A 4R88A 1OVDA 1E6PA 4RKAA 3LXCA 3VD5A 3U2OA 2ADAA 3CZGA 4LBSA 1FWCC 3UWEA 1OFBA 5DMNA 4NQ1A 1I6NA 3L4YA 2FHCA 4K3ZA 4B5SA 4JTKA 3M6DA 2Z00A 1UMYA 1S2TA 3APYA 4BQ5A 3K4AA 3VI2A 3WZ0E 2ZZ2A 5IHSA 2Z1SA 5CLTA 1UIOA 3DC8A 2VUNA 1FH8A 4PEKA 1C8QA 4C6JA 3N4AA 1JGMA 2D2HA 1RBOB 2YBUA 4L9XA 4CNNA 2QDHA 4UB9A 3UVIA 4KIRA 2XJ7A 1MZHA 1W37A 5FI8A 4W87A 3GVGA 3LSBA 2KZHA 4CU8A 3RRXA 4HZ7A 1YTEA 3ATZA 3VDCA 1LLOA 1YRRA 4WIWA 3PZ9A 4L4MA 3WQEA 4WZHA 1ISXA 4JGDA 4Q8PA 5CQ1A 1MDLA 5H91A 2J47A 1QK2A 4FF7A 4QRNA 2Y8UA 4TV6A 3S47A 2OYKA 4LYQA 1HJVA 4P7QA 4MAZA 1OFDA 5H2ZA 3P80A 3G1AA 2QXWA 1JAKA 2V30A 5M17A 1DYSA 2PDHA 1IWAA 4J2MA 1ISWA 3ITLA 4DI8A 3LCFA 5CPQA 4UTHA 5M03A 1EL3A 1ZALA 3H70A 4KS0A 1NQ6A 2HISA 3TOYA 3F5KA 1W1TA 1R6WA 3JUGA 2HXTA 2GUUA 4GRSA 4JYFA 4UMBA 3RR4A 4CNSA 3MCNA 3NSXA 2F6UA 1LROA 3OO2A 2E0PA 1E3ZA 4IJBA 1IIGA 4EACA 4QNWA 3O63A 4V27A 4XKMA 2WANA 4AIBA 4IFOA 4DM2A 5DQPA 4TMBA 1P1XA 3EWDA 2OO6A 3HJEA 2CLHA 1K7EA 1E71M 2FZDA 1UIPA 1XKJA 5F1VA 2PDNA 1HO1A 1UPPA 5LXXA 1TA3A 1V0NA 1HFBA 2PMQA 2DDXA 4LAUA 2A2IA 2RDXA 4E2OA 2PS2A 5DN1A 4JTGA 2QJJA 3COTA 4S3AA 1CLKA 3DOPA 1CIUA 3SZ8A 1TE1A 4J27A 1DWAM 1XUZA 1F4AA 1V7AA 2EPLX 1ZJIA 4JN6A 2CZVA 1OBAA 1Q4NX 2YPIA 4I6KA 1TWZA 2PWFA 3AXMA 1J8VA 2NLIA 2ISDA 4CQDA 3EPMA 2QCGA 1ZB5A 3CXOA 4P61A 1SFSA 4AMCA 4NX5A 1ITUA 4LVFA 3SSJA 2Y7DA 4IGSA 4IFKA 3TROA 2IQ0A 5LIYX 1UQZA 1UYQA 4MWAD 3IIXA 3N2CA 3IV8A 1F9CA 3B97A 3R94A 1TTPA 1XIBA 2WNZA 3NSNA 1K8CA 3GW0A 2O56A 4UTLA 3GC2A 2Y62A 1XSIA 1H7OA 3EB2A 1CI1A 4XD6A 5KSWA 4PBEA 2EO7A 4TX6A 3N4FA 4UTFA 1UUOA 1M03A 4AD4A 1EPVA 2PEVA 3WDPP 3GDTA 4MGGA 2NX9A 1XBZA 1OGGA 1OFAA 4JPGA 4UTMA 2CZEA 3CLMA 3KX6A 4KKXA 1OY0A 5BU6A 3SUSA 3OVGA 4Q8QA 2I57A 2ON3A 4PFHA 3S3GA 1BSIA 3NL6A 2FZMA 1QNQA 3GBEA 4E3TA 4PTVA 1E6NA 1YXYA 2FYMA 4EP8C 1NARA 3S1GA 1GVRA 2GOKA 2VRKA 3UF9A 2V5CA 4ZB5A 3LHUA 1KLZA 1F4HA 2WOQA 4RZBA 4J2PA 2BOFX 1WDQA 1IE7C 3OZMA 1GOOA 3PPFA 1MUWA 3TN4A 2HRWA 1VEMA 4NJKA 3GG8A 1M1BA 2GDVA 4PUDA 3WX7A 2EPKX 2YCIX 3RPTA 1OK6A 5LHEA 1C8XA 1R30A 3FS2A 3H54A 4JIIX 3LBMA 1K7XA 1DWGM 3WUFA 4LEFA 3BCDA 4JTHA 5TBOA 3DU0A 3THDA 2Q8XA 3CZKA 4PUMA 2C71A 1NF0A 1JXJA 4DZAA 1V77A 3GVWA 5BCAA 4R7WA 2VEFA 1QI4A 4TTGA 3L23A 3TZFA 2G8ZA 2UV8G 1QI2A 1OQFA 5A2AA 3CQHA 3WDJA 3I7SA 1CPUA 1JFXA 1DTNA 4XUYA 1S2WA 4B5VA 3RCNA 4ENLA 4EE9A 3GVQA 1PKYA 1ONEA 1MO0A 3DFOA 3IVSA 4PMJA 8CGTA 1P0KA 3OU8A 3HPXA 1GPFA 7ENLA 1JUKA 4OBSA 1XLMA 3UYIA 4WLCA 2ZE3A 3W53A 4K2SA 4KERA 3FEMA 3UZZA 3CHDA 4GE8A 4PH6A 1UW9A 3PUDA 3ARXA 4PZVA 1DEDA 3FYOA 3I4EA 3TYBA 4BY3A 4JQAA 3NCOA 1QO2A 1BEUA 2WKLA 3DYOA 3A22A 3NDZA 2IKGA 2EKGA 4A8RA 4IMFA 2VC9A 3K4WA 3C3UA 1V3JA 4RNFA 2CESA 3QMSA 1V6WA 1YQ2A 3UESA 1UD6A 2TRSA 3G22A 1V7YA 4HZ6A 4XAZA 4MYAA 3AHTA 2WPGA 4L4PA 4NZ3A 4O18A 4YHGA 2ISSA 3BGGA 1GWJA 1PUDA 5E0KA 5BNKA 2D0HA 3C0SA 3PM6A 3BAWA 3IVUA 4AEOA 4AZ7A 1H1NA 1OHLA 5C6MA 4F40A 4AVFA 1FVPA 4RDWA 4RPPA 5G4HC 5CCZA 1KCZA 5H8PA 1KNWA 4GXPA 1XSJA 1MZRA 3QGKC 4FOKA 2J66A 2BGQA 1Q8AA 4IUGA 1R3SA 4B5XA 3TLQA 1KGXA 5DCEA 4X3ZA 4PODA 3H7RA 5BMWA 4D6FA 1DJGA 4DELA 5MF5A 4BEQA 1YIXA 1REQB 3CS2A 2XSXA 1ZS2A 1XDMA 1M65A 1QNOA 1FX6A 4C7GA 4RXGA 3RLUA 1EP1A 1J5TA 3CAWA 3CUFA 2C1IA 2YYTA 3LI0A 3VOIA 4BQ3A 1W2VA 4XO6A 4BHYA 5IFTA 1O95A 1QW7A 4LU0A 5G2WA 4K8HA 4R33A 5I3HA 4NRRA 5J5RA 5F4SA 2X0SA 3AC0A 3ZJKA 3C52A 4GYPA 4ADTA 2ZUTA 1IT0A 3WY1A 4KFOA 3QLLA 3OA3A 1HN1A 3E2VA 4AUBA 1NFBA 3EA1A 3G8EA 2NXHA 2E6DA 1JYNA 1A5MC 4GFSA 3MBDA 5LSMA 3WDRA 2GYIA 1WCGA 3UJRA 4JD4A 2CBUA 3B0XA 2AQVA 4HMCA 1RR2A 2YL9A 3TA9A 5FEPA 4QG8A 5LA0A 2ISVA 2VTFA 3TX9A 1AH0A 4O0QA 3ZQ9A 5AC6A 4AF0B 2R6OA 4X22A 4OTKA 2OFJA 1Q6LA 2JF7A 3ZFHA 3NFUA 4FOJA 5C7VA 2ZUVA 2QUMA 1J0IA 1N2VA 3OZPA 1KM6A 4GYPC 2GL5A 1E4IA 2FMNA 2QCHA 3L2IA 2PC4A 1XYBA 4PA8A 4UUIA 3M44A 4DZHA 4A05A 1K4GA 4KWSA 2ZXDA 4M6QA 1H5YA 1W9UA 1R2RA 4H9XA 4WOQA 1X6LA 2A3HA 2B7PA 5M1TA 3P5YA 4PTMA 4GCXA 8XIMA 2WYSA 1LG2A 1KM5A 3WL0A 5I3DA 3L67A 3KHJA 3BLOA 4HJWA 3ONCA 3WJYA 4HD5A 1US0A 4QSFA 3O8AA 4ZQPA 3H2AA 4WEVX 1NU5A 2YXOA 3AS2A 1A4LA 3I6EA 2XVKA 3BG5A 1V3HA 2RGLA 1XIFA 3KRUA 2EHHA 3P81A 3WLLA 4A22A 1FWSA 5HMFA 3PAJA 4HU0A 3EDKA 3WNPA 3T8QA 2Y0FA 4N7QA 4LYKA 1GZGA 4NRSA 1IZJA 4F0SA 3W1PA 3K1DA 3SDOA 1V3LA 4S39A 1GORA 3N3MA 1NM9A 1UMLA 4GY7A 2R9RA 3W7QA 1V3KA 2VR2A 3O16A 4W4QA 3IJ7A 2VT0A 1GYNA 2V68A 1PWLA 3VD3A 1FDZA 4GO9A 3CWOX 3W1UA 3IWPA 4MWAB 3RR1A 3N9RA 4KF1A 1Q2SA 4OT7A 4TV5A 2WHLA 1PZ3A 1QDSA 1MQPA 3ZOAA 5CAKA 3ES7A 3MHGA 3K30A 4MWAA 1ISZA 4MUZA 2HROA 2QKFA 3C8NA 4UQCA 3CH9A 2CITA 1HKVA 4WXYA 1NSJA 2C91A 2Q71A 5DRCA 5G1TA 5BRBA 2IQTA 2VURA 3OLDA 3W1RA 3EKGA 4CNPA 3CO4A 1OABA 2WC3A 4EPBC 2Z0IA 1QW9A 5XINA 1ME7A 3W75A 5A3HA 4IL2A 1B31A 2VQTA 5HQMA 1JPIA 2YFNA 1GT8A 3MP3A 1I2QA 2NQHA 2YBVA 3QBUA 2OU4A 3NNTA 2ZX7A 1X97A 3KCLA 1TV5A 3G77A 4FPSA 3WUEA 2Y88A 3MC5A 3OZOA 3UXAA 1V51A 4MPKA 2GGEA 2P76A 4Q8VA 1Y7VA 4Z08A 3KVMA 3PWIA 4DBUA 2PU0A 1BWLA 1OCJA 2G3MA 3D6NA 5BYWA 3I10A 4ZZ9A 3ARZA 1TPUA 4GA8A 1ZCOA 3CQJA 1XYAA 2CHNA 1K6AA 4DWSB 1UROA 1OX6A 2BS9A 1SVDA 4TX8A 2W61A 3LERA 3WLNA 2R1NA 3LTYA 1BQGA 3CUHA 1OG6A 2X09A 1QNVA 1QPKA 4GZ7A 4KBXA 4DWSA 1OFQA 3E12A 5LA1A 2CZFA 4ZOAA 1ZENA 2FPVA 5MKGA 3QHNA 2WB5A 1KBBA 2ZIDA 1A5BA 1VFTA 5FL1A 2NV9A 3ZSSA 2BVTA 3GH7A 2UBPC 1CZ1A 4NJIA 2NWSA 4YPJA 1FCVA 3FY1A 4QX4A 3BW2A 1ODZA 2BG5A 2ZWYA 3IK2A 2F61A 1GQNA 1XLAA 3TFXA 2PGWA 1TPVA 5CG7A 1DJYA 4IT1A 1L6FA 4JFSA 3DHDA 2ALRA 3M0KA 5AFDA 4F66A 3WBYA 3G3DA 1JZ7A 3O9NA 4AHPA 4OV9A 2G96A 1ZSXA 4C6IA 3A3XA 3Q37A 1IF2A 3JVAA 6ENLA 2GJXB 2IPJA 1OGBA 4DJED 3F4CA 3KOFA 3BC9A 3R0DA 3MB9A 4FB7A 2EQDA 1GQIA 1BLIA 2GJXA 3MKKA 5GVJA 2Z7GA 4QLLA 4ZBCA 3HU7A 1W3HA 5CAHA 1R2TA 2INFA 3ZR4A 3B0PA 1WOAA 3A4AA 4HPJA 4WXZA 2Z1VA 4G1NA 5C8BB 1FWNA 1M5WA 1H1ZA 3QR0A 1XG3A 2FZBA 1DQUA 2O9TA 3M5VA 4M6UA 2BTMA 2Z28A 1ZBCA 4NASA 4P8XA 2FQIA 1TVNA 3MUAA 4AAJA 3EOEA 1YDYA 4JQ3A 3FX4A 3THQA 2GQ9A 2X40A 3A5VA 2JEQA 3MSDA 4XZBA 1YTDA 3ITTA 4X61A 4DF0A 3P61A 1GNXA 1N82A 5LIWX 5HBFA 3MWCA 1NOUA 1FWTA 1S2CA 3LGGA 2UY5A 2PBOA 5H8UA 1T0OA 1E40A 4XBKA 3ATYA 3WEZA 4HYWA 3UJFA 2P88A 3VPLA 1C9WA 3KL5A 2DEPA 1G7VA 3QR1A 3U48A 5CJ5A 3LTPA 4IPPA 3W2MA 1EKOA 3BLLA 5HJLA 3WLHA 2J79A 3G1SA 4G2DA 2DGAA 3FFSA 5HANA 4FXRA 3TYAA 2PDXA 1TPB1 3CHEA 2W4XA 3NG3A 2DVTA 3RO6A 4IXXA 2GFTA 1TZZA 4WCJA 2OT0A 2V9DA 4GQ0A 3L5LA 2ZWZA 1WDPA 2XGBA 5D33A 3VKJA 4L9YA 2VWTA 1U1UA 4PMRA 4B9ZA 2ZUNA 5FEWA 2ZDRA 4A8NA 3BAXA 4KQNA 2RH9A 4MJMA 2GWNA 4AY7A 1TVPA 3UJEA 3E0WA 2Q3OA 1JF6A 4LOCA 1JI1A 4WDTA 1AUSL 2FPTA 4E4PA 3NJ3A 4LALA 4FS9A 1CENA 1XLDA 5D04C 1BTCA 1PHWA 4K8GA 2QT3A 3AHYA 3UETA 4QJ1A 5CZSA 5FJTA 3S2MA 3QV6A 3FN9A 1GTEA 1PTDA 2XH2A 1EHNA 1FRBA 3CASA 2ZADA 4V2XA 4AWEA 1R9YA 2ABAA 3CIWA 4QEHA 2XFRA 3E6EA 3LU2A 1RK6A 1ZP3A 5I3KA 3PZNA 4L5ZA 1UR4A 1UC4A 3TU9A 3FKKA 2CZDA 1L6GA 4YWSA 5I77A 1THFD 4FXJA 4PUEA 4IX2A 1LL6A 5KZDA 1XX1A 2PDIA 1KFEA 2DSVA 2WBGA 1KWKA 2H6RA 2GZXA 1XIJA 2X1RA 1ICPA 3PWAA 3E74A 5AHLA 1XF0A 3UXKA 3S6TA 4HHPA 3LBOA 2WKGA 2YSWA 3VM5A 1Z89A 3NQAA 2NQZA 2QUTA 1YX1A 3FOKA 1KFLA 2D24A 3GKAA 4AZ5A 4K1WA 2P3EA 1EXPA 3H2CA 5A6BD 1Y65A 5AECA 4B5WA 4IP5A 2Z6IA 3PTKA 2X05A 3RCMA 4KW2A 1JCJA 3UWYA 2ZX9A 3ZVHB 5XIAA 1W5PA 3AHVA 4FLSA 3NQCA 4EWJA 1VKFA 1Q6CA 2KAUC 4CGTA 3PJTA 1D7KA 3ZVHA 3C2YA 1ICQA 3W84A 1J9YA 4JAWA 5EMMA 4XBSA 1ZHAA 4AD5A 4JCLA 2C3ZA 1SFLA 3BLPX 4MY8A 4QE4A 4ZE5A 3TYEA 2CLKA 2BVDA 1JNDA 4DJFC 2JKPA 3CWHA 2CLPA 2CXEA 4W89A 4TXEA 3GDRA 3EX1A 1JPDX 5EBAA 2VWSA 1ZRQA 3CQ0A 1CGUA 4JTJA 1EUAA 1UD8A 1SPQA 1P0NA 4PUJA 5GNZA 4CQAA 3AIBA 3DGBA 3U0HA 2Y5SA 1RXOB 1WV2A 3QFEA 1SUXA 3AALA 1B2YA 4FNPA 4J3SA 2WZEA 2C14A 3VXGA 3GG7A 3FA4A 3WLQA 3MWAA 5TIMA 4S3KA 4UWMA 3AIEA 4MADA 4JFWA 1H60A 3T7VA 1GQJA 4NU7A 3WLSA 1EO7A 4IM4A 2D20A 2ZA2A 4IP4A 6TAAA 1TJ1A 5HQLA 4PRTA 4CUCA 3HFTA 1YBQA 3EMQA 4H6EA 2Z1KA 3MI6A 4LXFA 1XUUA 1RJQA 2YLLA 3AYTA 1A5OC 3QKEA 5CBIA 5DLCA 5HNRA 2A7PA 2QDEA 1QPRA 4RV8A 2ACSA 1WQ5A 2VENA 4EXAA 3TFCA 4BQ4A 4TTUA 3SGGA 1DE6A 1PKNA 4C7FA 1E0WA 1VFSA 4GUJA 3W38A 3M7WA 3DEQA 4AWSA 3RILA 3NQGA 2QPSA 1L2QA 4ML9A 4GO8A 5LA2A 4MZ1A 1TV4A 1MXDA 1K4HA 4RZ6A 3FXYA 3LY0A 4QLJA 1Q45A 1HIZA 2VEMA 1OF6A 2E8YA 3M47A 3AMGA 2HNHA 4LUIA 1T5AA 3NXLA 3V5FA 4O13A 4MKSA 4DBSA 1UKPA 1U1JA 5JVLA 4ZEPA 4K38A 1YLVA 3N9SA 1E1FA 3EWBX 1MUMA 4Q7IA 2EPNA 4XISA 4D6IA 2YCKX 4LVBA 4Z17A 1OZQA 1FWBC 3CUGA 5C9ZA 3EDDA 4IJRA 2EJAA 4AD1A 4FNSA 1GHRA 3MO7A 4A3HA 4I8YA 4S3DA 3STPA 1HF6A 3UXIA 3I3EA 3II1A 1ZUAX 2VZOA 4S3BA 1TV7A 4IQLA 2F2KA 3AXXA 3M6YA 1LQAA 1F07A 5ABFB 4JN8A 3OA5A 5CZKA 1Z42A 5J8LA 2DZSA 3NQ2A 1LDCA 3DENA 3R2GA 5B7YA 5ABFA 2J7HA 1CDGA 3LHTA 9RUBA 4YTUA 4CN4A 9CGTA 1EJTC 1M7PA 4DWDA 1S38A 2NVCA 2V6AA 2P53A 2QV4A 3PBVA 3BG9A 3FVMA 2Y1HA 1JZ4A 3IVTA 2CNCA 1LG1A 4B2DD 1TJ2A 1GKPA 4UXDA 4NHVA 3WQ6A 3FXGA 4S2BA 4GXMA 1QWKA 2CFFA 3BPWA 1NWSA 1O5KA 3S8HA 2P0IA 4HA4A 3CUJA 4Z2LA 1QPOA 1W5NA 1NWUA 1TREA 2PI6A 3TXVA 4MB4A 3W29A 5AYYA 2ZE0A 3CV2A 1V0MA 4D1JA 1OYBA 4O15A 5FJIA 3QHOA 4C1NA 1O1HA 3LLDA 4LUYA 4NJJA 3N4EA 5LIXX 3G6MA 4MDPA 4HPNA 2PDCA 3KLKA 4DAIA 3ABZA 3M43A 2BP1A 2NW0A 3PZOA 2GJNA 1HGYA 2PDYA 5HWJA 4ORIA 1GHSA 4CCZA 1P43A 2VC7A 1D3GA 5JBFA 3I3DA 4DAFA 3HO8A 2NXIA 1IEIA 1QRQA 1W9BM 3SW6A 2BDQA 2O9PA 5BXSA 3B40A 3NO5A 4XTIA 4BF9A 1AL8A 4U3CA 3FCPA 1NWTA 3LB0A 3HZ3A 1WXJA 4WUIA 4N9EA 4J3TA 5CPSA 3VTRA 2REQA 4P7LA 4DYJA 2ZUWA 1WZKA 4FA3A 2BASA 2YA0A 4XZIA 5D38A 3KBJA 2GJRA 2PDGA 2TAAA 3WNNA 4RXFA 3WJSA 1U30A 2HVOA 1ZNNA 4Q22A 2V3DA 3WD2A 3VNJA 2DZBA 2Y89A 4D8ZA 1DWIM 2HSAA 2DVUA 1XIMA 5G1MA 2YFOA 1NJJA 2XU2A 2P8BA 4PUWA 1U1HA 3H6OA 3UGRA 3T78A 1EO5A 2XVLA 4OU1A 3EDFA 3XIMA 3AJXA 1EX1A 2W91A 4D6EA 4PCSA 2UZ9A 5EY5A 4ZVJA 1EBHA 5CPOA 1RBAA 1IXQA 1F73A 4PRRA 1G9HA 4H7CA 3K8LA 3AS0A 4PSPA 3SR7A 1IEQA 2A79A 3SCSA 3CHCA 4S3JA 3AWOA 3RLHA 2E09A 3WL1A 1POJA 4XZWA 2O92A 4MSSA 1GPWA 1UBPC 3MMDA 1ZPTA 3S6OA 3GNPA 2XIOA 4K39A 1FWRA 1P48A 2BVWA 1YW1A 1KQYA 3N11A 2YL8A 1G4SA 3SCNA 5K7JA 4UTKA 3ISIX 3EX3A 1HP5A 1WZLA 3QZAA 1I2PA 1DJXA 3UT0A 3EBVA 3UXLA 3W87A 3B0VC 4W84A 1VHNA 2ZZ5A 1IIHA 3M0HA 3EWUA 3ZIZA 4L1XA 3LNMA 3V1HA 4C6KA 4ZCWA 2JF6A 1UH3A 1ZY9A 3LQLA 3PSWA 3VNLA 4HQVA 3OVRA 3I7QA 3HPZA 2GWGA 2Y6ZA 5L6UA 1B9ZA 3DCPA 4AFYA 2ONEA 4U5IA 2IKHA 3ONBA 4GX9A 1GEQA 3DECA 1XHGA 3UWVA 3BJTA 5C71A 4M5PA 2A1YA 2FDMA 4J3XA 2GVGA 3BJSA 3ZMRA 3FGCA 2QUUA 2EKCA 4HU4A 3ZR5A 2IKJA 1JEZA 3BWWA 1VR6A 4GI4A 2LLEA 1H09A 4QITA 1QAPA 1C29A 5I23A 2GQAA 2RHGA 3E0IA 1XGDA 3ZZ1A 1PTAA 5BXRA 4IP7A 1L6SA 5GQBA 1WAWA 2YW4A 1R3RA 4LUSB 4Y8FA 1VRDA 1UJQA 1X38A 3W72A 2UWFA 3RX4A 5D2VA 3P62A 1E4NA 4L6HA 4GX8A 3UZJA 2RDUA 3UR2A 1D8CA 4CVUA 4F48A 3BK0A 2ZZ1A 4HNTA 3Q2DA 4CCEA 1QHPA 4F0KA 2ISWA 3UR5A 4IPIA 3HB9A 4GGBA 4S3FA 3NGJA 1EIXA 3T0CA 3NL3A 1IT8A 4NVTA 4DJFD 1SO3A 2XIIA 3MMWA 4RE0A 2Z4GA 3EXSA 1SW0A 1UP0A 4LVDA 3W6YA 3WD3A 1W5QA 1ZTVA 1TIWA 1EX5A 2WSQA 2CBIA 4PB3A 3QXBA 4ZO9A 4DHGA 3QEZA 1XIDA 3C86A 3FV9A 3DUGA 4TMCA 1OYCA 1X6NA 1NOWA 4EPKA 4U2YA 4JX4A 4LJ3A 1WYIA 3R7MA 4DF2A 2X0YA 3ES8A 2PTZA 1XLHA 4GQBA 4OE7A 2ZTJA 3OHMB 4H01A 4YYFA 2AKZA 5D02A 2CIPA 3AIWA 4H41A 1IZKA 3I4KA 4O0KA 1XC6A 1DJHA 1VQTA 4GXWA 2R1KA 4K8EA 1DWJM 1DE5A 3ZJ7A 3L4VA 4FX8A 3MP5A 2PA6A 1EGVA 3T05A 4EAMA 2X0HA 2FFIA 3AIUA 3OBAA 1UC5A 4W88A 4MMWA 1TPWA 3WNKA 1AZ2A 3SUUA 5I3FA 4YCPA 2XSBA 2Q6ZA 1HVQA 1ICSA 1W1B1 1TWWA 4TU1A 3TMLA 3HTWA 3URAA 3NURA 1FWIC 1VBJA 4JFVA 4CQ8A 4NIRA 4C6NA 1KXTA 1S1PA 2B0MA 4O1EA 4H9TA 5FCZA 3KOWA 1XRVA 5DY2A 4ERIA 1BWKA 2XH4A 4PUNA 2EXOA 4YLWA 5KZ6A 1OX4B 1Q6QA 4N0RA 1KD0A 4JTFA 1DORA 1XPYA 4CNOA 4JR5A 3IJIA 4AVOA 1YTKA 1EDTA 5CSUA 3CHVA 1DJIA 3AHXA 1OX4A 1DXFA 3NPVA 5AZ1A 4WJXA 1S5TA 2POZA 4P7NA 3N1AA 2YB1A 1UHVA 4MNKA 1TPH1 4O11A 3AMCA 3MUY1 4REQB 4JL1A 4OHQA 1KCXA 3QPZA 3W7OA 1DQWA 3VC6A 3GXMA 3MCOA 1VJSA 4L6OA 1LOQA 7A3HA 2ZFAA 3L7RA 3P8IA 3WFAA 4P5UA 3CLWA 3SUWA 4UOJA 1ZP4A 4O1DA 7ODCA 3TDFA 2C18A 2PP3A 4HK7A 4YYCA 1X7FA 3CYJA 1UD2A 2TMDA 1EWEA 1U83A 3W1LA 5I0DA 3AROA 4DYKA 2VZSA 3WQWA 1DTUA 3WMCA 4LQ1A 1EYEA 4HHLA 2JALA 4B9YA 2HDJA 4RW3A 3STEA 1C3FA 2GPTA 3VU2A 1FWWA 4JNYA 1CLXA 3NSMA 1C90A 1TYGA 1ZFJA 3OJGA 3V0TA 2CLEA 3TLLA 3VNIA 2R94A 5I07A 4C60A 2QAPA 1JCNA 4WKHA 4C65A 1GKQA 1KM2A 5HK4A 1E9IA 3WK3A 3Q65A 4ZGYA 1SMAA 1WPCA 2B7QA 4WD0A 3CH0A 3GHRA 1EQPA 1ZLPA 4MUPA 1ONRA 1EOMA 1R47A 3C6CA 3AI0A 3USBA 1C91A 1ESWA 4M24A 2WCGA 4GACA 3P0XA 1H7XA 1A0EA 4GVIA 3EKLA 2J78A 4AX6A 2BV9A 3TXZA 3T8LA 4HNLA 5JMUA 3WQ8A 1UR9A 5BW6A 4PMYA 5T9CE 2XSAA 1W2PA 1VFOA 2HMCA 3HV8A 2QMKA 3BE7A 4HPGA 1QPQA 4CQCA 1UR0A 1CXEA 2V5BA 1TUXA 4E5TA 3VD4A 4ES4A 2H8ZA 3ARUA 3H22A 3KOXA 2CU0A 2XVNA 4M6PA 1V3MA 1ME8A 3DKLA 1TQXA 5A5WA 3WH9A 4U4MA 4AVNA 2ISFA 4J4KA 4NT0A 1C7TA 4IMCA 3EGJA 3FSUA 1GVYA 4AYGA 3HGRA 1BFNA 3W86A 2PDFA 4PMNA 1F61A 1H50A 3BDKA 4K68A 1GOIA 4KEMA 5HINA 3FDKA 1CEOA 1NIUA 4DJDD 3IIZA 4GJJA 4XKYB 2YDRA 2IXVA 4JTUA 3WDHA 1HO4A 2C13A 1PZ2A 4HSNA 3BOLA 4MOZA 4X9SA 1GJUA 3AFBA 3PTQA 2GK1B 3GG0A 3S46A 3OGSA 3CTLA 1E9ZB 3EEGA 4R27A 4DO5A 1K9TA 4XKYA 4JHZA 2YDSA 3E1F1 2OR2A 3EA3A 4G1KA 2YZ5A 3VIIA 2GK1A 3S9ZA 2ZRZA 3PBWA 4RDVA 5EMUA 2OEKA 3SRHA 1RUSA 2E8ZA 3P3BA 3R8GA 1J79A 3G18A 1I45A 4JIRA 1KW1A 1AJZA 2XGIA 2FFCA 5CC5A 1YNQA 4Z0SA 4AX7A 4NXSA 4MDOA 4H1ZA 3M07A 2OPJA 4H4IA 4BA0A 3ZT6A 1OX5A 2WK2A 1UG6A 4KWVA 3QHMA 1OADA 2ATMA 4FF5A 2J75A 3P14A 3UR8A 1EC7A 1C8VA 1BPLB 2DSZA 2J9YA 1S2VA 3KE0A 3ABSA 3WJXA 1PXGA 2DW6A 1VB9A 2HTMA 4J5NA 1U33A 4GGHA 3MSYA 1OC7A 3MQTA 7REQA 2DJLA 2XH0A 1TV3A 2BFGA 3CIVA 3GR4A 4GYKA 4A2RA 3NYDA 3GQYA 3A3WA 3GHSA 3N13A 3EDJA 1J6PA 2ZRXA 1O60A 5EU9A 1VRXA 5CZTA 1A0CA 2HPMA 1WZAA 3VINA 1VYSX 3QC3A 3IANA 3VNZA 1EBGA 1NH6A 3W26A 4KCVA 3F4WA 2E6AA 1FHLA 4KEZA 5AOUA 3FSTA 3ZLGA 2A5HA 4AY1A 2CPUA 1SJAA 4NZFA 3TJLA 3FK4A 3B8TA 1VBRA 1GJPA 3S9IA 1TCMA 4OV4A 2VL4A 1QHOA 4DO7A 2BLEA 1W9PA 1UOKA 2UY4A 2YJQA 5HNNA 3D47A 3WQVA 3LSCA 1AD4A 1BXBA 1V5XA 2PDMA 4N9CA 4XAGA 1R3VA 1XYMA 2G3IA 1ZAHA 2Z1XA 1TR9A 3IGXA 3PBMA