1MI3A

1.8 angstrom structure of xylose reductase from candida tenuis in complex with nad
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylose reductase
publication title Structure of xylose reductase bound to NAD+ and the basis for single and dual co-substrate specificity in family 2 aldo-keto reductases
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
total genus 113
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1mi3A00
4AUBA 3QKZA 4YVVA 1AZ1A 4QBXA 4XZIA 4XK2A 2BP1A 4XAPA 2PDUA 4WDUA 3V0SA 2IS7A 2IKIA 1ZGDA 4WGHA 3UG8A 1R38A 4JTCA 2P5NA 4GCAA 3WBYA 1C9WA 2PDBA 1MRQA 5AZ0A 1S2AA 4JTDA 1EXBA 5LIYX 5DANA 3UZXA 1HQTA 2HE8A 3M64A 1Z9AA 3DOPA 4MHBA 2NVDA 4R9OA 4XVEA 2QXWA 3ONCA 4QX4A 1AH4A 3BUVA 3R6IA 2PDYA 3H4GA 4XVDA 2C91A 4LAUA 1JEZA 5LIUX 1EF3A 2FVLA 3B3DA 3WBXA 2PF8A 3R94A 4FA3A 5AZ1A 4JIRA 2ALRA 4LBSA 2HV5A 4JQ3A 5LIXX 1IEIA 2IKGA 2NVCA 5M2FX 3UFYA 4PUUA 3R43A 3LUTA 4L1XA 3T42A 4LAZA 2PD5A 2IPFA 1YNPA 3UGRA 3S3GA 3UZWA 3N6QA 2DUZA 3MC5A 3RX4A 2BGSA 3Q65A 4LB4A 4IJRA 4DBSA 3LD5A 2HVNA 1US0A 2PDCA 4NKCA 2PDIA 4IGSA 4YS1A 3EB3A 2IKJA 2PD9A 2R24A 4XZMX 3H7UA 2PDHA 1OG6A 2PDKA 5JH1A 3KRBA 4JQ2A 4LBRA 1AZ2A 4RPQA 4XO7A 4LB3A 4FZIA 2J8TA 2A79A 2INEA 2IQDA 2PDJA 3VXGA 1IHIA 1RY8A 1Z8AA 4PRTA 4DBWA 2PZNA 3GUGA 4DBUA 4WRHA 3UZZA 1T40A 3LENA 3EB4A 2FZBA 3R8HA 3N2TA 3ONBA 2PDNA 1LWIA 1XGDA 1AH0A 1LQAA 4GACA 2CLPA 1QRQA 1UR3M 2PDPA 1PZ0A 4H8NA 1FRBA 1Z89A 2PFHA 4JQAA 2PDMA 2HDJA 2PDFA 4HMNA 1MI3A 2ISFA 4XZNX 3CV7A 1XF0A 1Q5MA 1VBJA 2FZDA 3G5EA 2WZMA 5HNUA 4ZFCA 2F2KA 3LQLA 4GABA 3GHRA 3RX3A 4JTAA 3LNMA 3F7JA 4JQ1A 1RALA 3P2VA 2PDLA 3CASA 3UZYA 1X97A 3RX2A 1J96A 4PR4A 3UWEA 4GIEA 1YNQA 4F40A 1GVEA 2I16A 4FAMA 4GQ0A 3BCJA 3FX4A 4H7CA 4WDWA 3NTYA 3V0TA 4JIHA 2FGBA 3GHTA 1S2CA 3M4HA 4PUWA 1Z3NA 1XJBA 3DN5A 3MB9A 2HEJA 1X96A 4WDXA 4ICCX 1PYFA 1EKOA 1EL3A 1MZRA 2R9RA 4JTQA 4DZ5A 2AGTA 2HE5A 1K8CA 4YVXA 2VDGA 1Q13A 2ACUA 2PDGA 4PRRA 2I17A 4ASTA 1RY0A 2FZ9A 3GHUA 2ACRA 4HBKA 1ADSA 1ZUAX 4XZLX 2IPWA 2PEVA 5LIKX 1A80A 4YU1A 4YVPA 2ACSA 2INZA 3O0KA 5HA7A 3WBWA 4XO6A 3CV6A 2PDXA 3BURA 3GHSA 3FJNA 1X98A 1SM9A 5C7HA 2BGQA 4JIIX 1QWKA 2IQ0A 3WG6A 4EXBA 5LIWX 5HNTA 2HVOA 3O3RA 1S1PA 1VP5A 3LEPA 2DUXA 4XZHA 4OTKA 1PWMA 1PZ1A 4GA8A 1YE6A 1YE4A 2FZ8A 3U2CA 3V0UA 2F38A 4QXIA 4EXAA 3G1RA 3R7MA 1AFSA 4Q7BA 3CMFA 4QR6A 1AH3A 2WZTA 1HW6A 3EAUA 3LQGA 3LBOA 4FALA 1ZQ5A 5KETA 3BV7A 4WDTA 2IPGA 3M0IA 4PMJA 3LZ5A 1M9HA 2PDQA 3CAVA 3COTA 4IJCA 3ERPA 1PWLA 4G5DA 2IKHA 3Q67A 1S1RA 3UYIA 4Q3MA 2PDWA 4L1WA 3V36A 2DV0A 3R58A 1T41A 3CAQA 4I5XA 3UP8A 3V35A 4GQGA 3WCZA 3LZ3A 5JH2A 1ZSXA 2ACQA 4JTRA 3LN3A 2IPJA 4JQ4A 4WEVX 3C3UA 3R8GA 3D3FA 3H7RA
chains in the Genus database with same CATH superfamily
2VENA 1M04A 3QRHA 1LT7A 4XAYA 4FNTA 3M0LA 3E2RA 4DNHA 4XK2A 3F5LA 3H70A 3LX9A 3D46A 1W1B1 2JFEX 4FPSA 1Y65A 5E1QA 1A47A 1MFVA 7REQA 3H12A 4CNOA 1JULA 1W2PA 3IGXA 5GNYA 3KHJA 1MXSA 4N4PA 3RLGA 5F2GA 1QCWA 1VAHA 3M0MA 8RUCA 2WJDA 3N25A 2XU2A 3V1PA 4HYVA 4GUGA 4AWSA 4AYSA 1FWTA 3MCMA 3W00A 4W7WA 4P8UA 4QJ4B 2V3DA 4Z1DA 3A47A 4PCSA 5D2VA 1OB0A 3C2FA 2HPIA 1NP2A 5DX7A 1M3UA 5IXEA 3LCFA 1QI2A 2WNNA 1OIMA 2C1GA 2Z00A 4DLMA 2CXEA 1Y7VA 2WHKA 3AMKA 2X1UA 3CC1A 4Y8FA 3MSRA 3S2NA 2VQUA 3W70A 1TPUA 3WDQA 2DQWA 2YCLB 2PDHA 3WUEA 1WX0A 1DVJA 3S9ZA 1J0IA 3HM7A 3MUY1 3ZSTA 3FJ6A 2QUVA 1E6RA 1WUEA 1BQCA 3W1MA 3USBA 2VR2A 2PLKA 3GB6A 4WX2A 3BPWA 6PTDA 1KGWA 4O1BA 3ES7A 4K3ZA 1UH3A 2WNZA 4D1IA 3LENA 2DZUA 4L4PA 4PBEA 3CHDA 1O94A 2Y5EA 1Q85A 1E5JA 4V15A 1ISWA 1XSIA 3WH9A 3F4VA 1P43A 4DNMA 3DECA 4KS0A 2BY3A 3UVIA 2FGZA 3BQ5A 5A6LA 1UMLA 1MDRA 2VFDA 3VMPA 2WOQA 4M5PA 1Q7ZA 1A4MA 4C6OA 2FGLA 3RK8A 4BWLA 5AHLA 4XZNX 1UR4A 5C2GA 3UG4A 3RRAA 2UY3A 1YADA 4MOZA 3AHZA 1ZBKA 1B30A 4A29A 3LV6A 4C6JA 4AW7A 1LL7A 4IUOA 2GQ8A 1UBSA 3GH5A 2LLEA 4A3RA 1UWAA 1NDYA 2PCEA 3WQCA 4PBFA 2V3GA 2P0OA 1G4SA 4XAGA 2OELA 5ENLA 3WLNA 2GWGA 4QLLA 2BS9A 4MFDA 2PBOA 4PZVA 1M7JA 4PMUA 4DUOA 4WR3A 4KT2A 1MEWA 2PU0A 4XB3A 1HKIA 1Q7MA 1V3MA 3NNTA 3CQKA 4OOZA 4OQVA 1TKKA 1KRAC 4XIMA 1XCWA 4LF1A 3W7QA 4CVUA 5AVHA 3PFRA 3M4HA 1XJBA 4BQ2A 4MM1A 3URQA 3OPSA 4BI5A 5FJTA 1UHVA 2DW6A 4UNKA 3LNPA 3R11A 3GXNA 4LYRA 1B9ZA 4UQCA 1FCBA 4J1OA 2AGTA 4GZEA 1H3GA 3WKZA 1VEMA 1P0DA 4TIMA 4Z2KA 3GK0A 2V82A 4P8WA 4X2PA 3TVAA 1DWJM 1TWZA 4XG1A 4B5WA 1X39A 2X1IA 3ATZA 5K2ZA 4IWWA 5C2CA 4QLJA 2VGFA 4YVPA 4NI3A 2V5DA 3MJYA 3U57A 4D6CA 2UZ9A 3CL7A 3VOFA 3N3TA 2RGLA 4LYPA 2FDMA 1R2RA 5FJUA 3B9DA 4WY0F 4KWUA 1SPQA 1IGSA 4JOMA 5I00A 4CU7A 3L4WA 1OC6A 1ONEA 3E12A 1TPC1 4AHPA 4RE4A 5KITA 1VYRA 2OT1A 2Z7GA 1W91A 4QS5A 4J3UA 3DYOA 5LNWA 3B8IA 4EAMA 2WHMA 4GY1A 3PUDA 4DWSC 4REQA 3CH9A 2QCNA 2C8NA 1J5TA 5A6MA 1UYQA 4G9PA 1IEWA 4GGBA 3AICA 3GY1A 1EBHA 2HXTA 2Y70A 4C6IA 5A2CA 1EX1A 2ZUUA 2P8BA 3WH5A 2CKRA 3WH7A 4A3YA 3GSMA 4NZ4A 4E5TA 3MMTA 4WSHA 3LMYA 5D4YA 1UWSA 2I7GA 1DV7A 3MV01 4AC1X 1O5KA 1D3GA 4KWWA 5SWUA 1R0MA 3SIMA 3WEZA 2XGBA 3HV9A 1E70M 5AYBA 1NU5A 1V02E 2XPKA 3VUSA 1PS9A 4PB5A 3EWZA 1XD0A 3COTA 1TRDA 6ALDA 2IKHA 5AN7A 3WLJA 4G6CA 4Y7EA 2BOFX 5TBOA 1E9YB 1UW9A 3V35A 4IH3A 4KFOA 5ECUA 1A5LC 2CERA 4J5NA 3DIPA 4OBTA 4HJFA 2JEPA 4W5UA 3VCRA 4WEVX 3D3FA 3LU2A 4EANA 4POCA 3W2LA 4CEUC 3W82A 3W86A 2QDDA 1HL9A 1UR8A 3DH7A 4AFYA 1K4GA 1YTEA 4XKYA 3VKCA 4EOUA 3CZGA 1PO9A 3BSHA 1R87A 3R4IA 3GDKA 2VZVA 1NF0A 2VUYA 4HMCA 3WBYA 1V3KA 2C16A 3B9NA 1EWDA 3QFEA 3ZT6A 4XD5A 5DANA 4HTYA 4MY8A 1N7KA 1SZEA 3UJEA 2QXWA 1ONRA 3KAOA 1CXIA 3KX6A 4U5IA 5BOEA 1QATA 3I65A 3GG0A 4QROA 1EF3A 1HKJA 2QCEA 3WO8A 2P1FA 2B7OA 1LP6A 4QEEA 2NWSA 3WN6A 1A3WA 1YBQB 3JZEA 3PR2A 5ABEA 2GUUA 5HUOA 4JTIA 5LA2A 5AYXA 4KCWA 3RU8X 2VT0A 4KF1A 2QMJA 4O1CA 5G2IA 3IRSA 3VDCA 3M6DA 1HJQA 2Z28A 1VH7A 4B4FA 1ZCOA 3ABRA 3G24A 2PP0A 1VZWA 3B97A 3VM7A 4ACZA 3KWXA 4LX4A 4AZCA 1RPXA 4N9EA 3RFAA 4Z17A 4MFEA 1WAWA 4MYAA 1XX1A 3ANVA 4U33A 4F9DA 1G94A 3WMSA 2PP3A 3MS8A 3HFTA 3RX4A 4DJDA 2ZA3A 4IXXA 4JX5A 2QUNA 3DKLA 3HGJA 2J74A 5CPLA 3VKKA 3LK6A 2R24A 3E2QA 3G77A 3HG3A 4O1EA 3F5KA 1TJ2A 3QYSA 4DWSD 3FW6A 3C8NA 3GNPA 3ALFA 5FF3A 1AZ2A 2AKZA 3S47A 4JYDA 4WSJA 4BEQA 1DJWA 1NH6A 1FWBC 3M7WA 4GCXA 4MY1A 4PH6A 1DTNA 1KGUA 1XICA 1LWHA 2ODOA 4MIMA 4X9SA 3B06A 1FWCC 4GYJA 4ZB2A 4DRSA 5EKYA 1GQIA 2XJ7A 5F4WA 3FV9A 2B31A 1QJWA 4QNEA 1SMAA 4PUEA 3E6EA 3OW1A 3GH7A 2HDJA 1QNOA 2RDXA 1KO0A 4IG2B 2TRSA 3CV7A 2JBMA 2OFJA 4XZWA 1R3QA 2EPKX 3QMRA 2FFIA 3N18A 4LUSB 1H7PA 1NEYA 5REQA 4NYYA 3HA1A 3QR3A 4XX6A 3AWOA 1LDCA 2ZVIA 4YN5A 1JJKA 5FAJA 3TJIA 5HUPA 4I7WA 1DJHA 1YPFA 3C4UA 3DCPA 3WIJA 3WK3A 4C6CA 4KKXA 3H4WA 2A3CA 1A0EA 5AKQA 4O12A 3W1PA 2JF7A 3DFSA 5EFDA 3SUUA 2OJPA 4PEEA 1MW1A 3A3HA 1PIFA 2HISA 1ENUA 3I7QA 1ZBWA 2QJNA 1GYNA 2QR6A 3ARSA 4R34A 4MNJA 1AD4A 3U5YA 3RHGA 4NJIA 3U7VA 5DEZA 3K5XA 3QSRA 1WAUA 1EO7A 1SFSA 3WNOA 4CD5A 3AUJA 1B3XA 3OODA 1GVQA 1QW9A 3VNMA 4EAYA 1JDCA 2J47A 4RXFA 2Z26A 3LBCA 5K7JA 1GVSA 5K9CA 4UBPC 4NAEB 4FXSA 4UTMA 3PM6A 3T0AA 4EPEC 3AAMA 3AIRA 2YZ5A 2L5HA 1UPMB 4JN6A 1EJUC 2CHRA 3A22A 2CYGA 3AUOA 1DEDA 4XO6A 3ZMRA 4MNLA 4NIRA 3GNDA 1EJTC 4S3AA 5D05A 1KFWA 4E4PA 3NDZA 2CZVA 4MY9A 3GNRA 1VHCA 2Z1XA 4Z2GA 4MDOA 3VU2A 1S2VA 1SW3A 1UIOA 3TYZA 1VB9A 3VIKA 1B3YA 4UTJA 4JHMA 4KCTA 4M7SA 1CNVA 2XZ7A 1R9XA 2AL2B 2VTFA 3DG3A 1MUCA 3O3RA 1AD1A 1K70A 1TQXA 5CPSA 4H6QA 3STCA 4GC3A 4DWSB 1XS2A 5DT5A 1R8LA 4CQBA 4DXXA 1QO5A 1K9EA 4CN6A 1KB3A 4ZTXA 4ZO9A 1J01A 2F38A 4HK6A 1XQLA 3RJYA 1GTHA 2HPMA 5CZKA 5KMYA 5AOUA 1WZMA 1EQPA 1VF8A 3CMFA 2J7EA 1UH2A 2O9PA 3N4EA 4GG9A 6CGTA 3VGFA 1QR7A 5I09A 3DFOA 5GVJA 2WHJA 1JQXA 1JG9A 2E77A 3M0IA 4HNUA 2WMKA 4HNTA 1E4NA 4K8GA 3L0NA 3LERA 5FACA 5I3DA 4NP7A 3UYCA 4L1WA 5ABGA 2ZRVA 3LMZA 5MF5A 3L66A 1UP3A 1OK4A 4GZIA 1ZCCA 2VMFA 4A21A 5I03A 3G1VA 3D0CA 4F9JA 2Y88A 3PAJA 4JQ4A 1T5AA 5H8PA 3CM4A 2ZRYA 3VNIA 4GXMA 1CECA 4UOQA 3W75A 5FI8A 4D71A 3TZFA 1SO6A 4DYEA 1AZ1A 1JCYA 3W7MA 2XUCA 1H1ZA 2PDUA 3TW9A 1E6QM 4KH2A 2YR1A 4L1GA 2E1WA 1FOBA 3NQEA 3SRHA 2W66A 2OQLA 3O6CA 1C9WA 4HCDA 2OODA 5KSWA 1A5UA 4C60A 1E0WA 3K8MA 2FHFA 3G3MA 2VELA 3PZGA 5C7VA 3NQ8A 3G2GA 3EDJA 3CUJA 4ROPA 1TPVA 3T44A 3IJIA 1JPKA 1FWGC 3QV9A 2J24A 3OLIA 3ENLA 4RNJA 2D0FA 3FY1A 1OCQA 1OT2A 5CSUA 4FK9A 3XINA 1YDOA 2VRJA 2FVLA 5LHFA 1FFQA 3OEXA 4UCGA 2R82A 2A1YA 2YKKA 2WKJA 4R7WA 2PTYA 2DZVA 4FA3A 2FJKA 3W2KA 3Q45A 2F6KA 2ZQ0A 4Z0SA 4C6FA 5CBBA 3CK5A 3UFYA 5KZMA 1EIBA 5AHNA 1QMLA 3K4AA 1JR1A 1FWRA 1K7XA 2RJHA 4GUIA 2IQTA 2XG9A 4LB4A 4IJRA 3LD5A 1US0A 1XGZA 5XINA 4NKCA 1WE5A 2OVLA 2BXZA 3O6YX 3A3XA 3RITA 3W22A 3E0LA 2DZBA 2IKJA 3TC6A 3OLGA 1ZP3A 1E1EA 2QIIA 3WQPA 3N04A 1WP6A 1TPH1 4QHRA 2BHZA 2R8WA 5AYIA 1UR2A 1K8ZA 5CGQA 3W28A 1OD0A 1QOPA 1KM0A 3O63A 3UA4A 3GZ3A 2VFIA 3VNYA 4DJFD 4JTSA 2PDJA 3H54A 4ATDA 3KVMA 1IHIA 3P8JA 3E2SA 1UZ1A 5GQBA 2V3FA 2PTZA 3R8HA 4DZAA 1XLHA 2GVJA 2OTDA 1YRRA 4GISA 3QQ0A 2F9RA 4FXJA 1TMQA 3KCOA 1OG0A 1Z89A 3WQ4A 4D8AA 1CX9A 4UR7A 1TZZA 5F1UA 2EPNA 1CGTA 4YNGA 1TZ9A 1ITXA 2UWFA 3WLOA 4NZ3A 5EMMA 1XF0A 3TYDA 1E9IA 1CXKA 4H9UA 5G2WA 1K9FA 3W24A 3MPGA 5CXPA 4C1KA 2PWUA 4XD3A 4CD4A 3IVTA 2G50A 3MZNA 1QPNA 1V02A 3GUWA 2ZZ4A 1EGMA 2Y7FA 3BMXA 3M46A 3TZNA 2IMRA 1B4EA 1E5NA 3LI1A 5IHRA 5CPMA 2H8ZA 2NUWA 5IFTA 1M41A 3LHUA 1OFDA 3O6DA 3I6EA 3SFWA 2J7CA 2EGZA 5AYYA 5D9NA 3BJTA 1N2VA 3H7VA 3FJ4A 1HNYA 2PGWA 3FHQA 3STEA 3QSTA 5CCZA 3POCA 1S5VA 2WMIB 4ADUA 4L56A 2FQIA 1RA5A 2YPIA 2FB2A 2D0HA 1TUXA 1PX8A 3AIWA 3NDYA 4C91A 1FX6A 2CBUA 4MMWA 5H1WA 1I75A 2OOGA 1RVKA 2WVVA 4L9YA 3T2OA 1OCBA 1PBGA 3MHUA 2WSRA 1JZ2A 4MWAC 4N02A 3HF3A 2OYLA 2D20A 3W7IA 4I8DA 4YWIA 2ACRA 3CZLA 3OHMB 3CTTA 3LHTA 5IOBA 4Y9OA 3NIYA 1A80A 2QAPA 1QW8A 4QJ3B 5AFDA 3N12A 1RK5A 1A5SA 3N73A 3CV6A 3THAA 1LRQA 4Z1AA 2Z1KA 3WLQA 6ENLA 2WWDA 5I3KA 3EXTA 4KEZA 1KD0A 2DPEA 2A3EA 4GRSA 1SM9A 2OPJA 1CXFA 3DFHA 2VX7A 1KNWA 3RMEA 2D2GA 3HO8A 4QG6A 4XTIA 3ZT5A 3KP0A 2WJEA 3W72A 3M0XA 2J77A 4PFMA 1ZY9A 4CKQA 4JTTA 2HCVA 2G4JA 5A8NA 4PL2A 5DBUA 1QK0A 1VFSA 4S3BA 1W9VA 1LQ0A 3LPPA 3DI1A 1X7IA 5LNUA 1PZ1A 2WC3A 2FZ8A 3HQ1A 1GTEA 4GYPA 4QQUA 1VKFA 5A69A 3VDAA 5LNVA 2P88A 3QFWA 3UD6A 2QV4A 2XISA 1V6UA 2KZHA 5DMLA 3ZR5A 2POTA 3HJZA 4DIAA 4B5VA 3UG3A 2ZX8A 1CXHA 3K8KA 4J3TA 4NZ1A 2EO7A 3G22A 3PZTA 3THDA 3NR0A 4PN2A 4IFOA 1UJQA 4AIUA 4RW5A 5GPRA 4OVXA 3DENA 1W1PA 4GWEA 5M3WA 2XIBA 1GCYA 1V4YA 2GK1B 2Z1VA 1T41A 2DUAA 3RPTA 4UFHA 4O0KA 3EKGA 2HXUA 5G4WA 4AZ5A 3EYPA 4UFKA 1G4TA 1DIKA 1UB3A 4RV8A 2J9XA 2UV8G 1XYMA 4QDMA 4MLRA 3VD3A 3UESA 4P7QA 1B0IA 1BGGA 4DEFA 4HHHA 4K8HA 4AYGA 3ITGA 2BP1A 4QNWA 2XVNA 5FEWA 1YBQA 2FH8A 1HGWA 2E09A 2IS7A 3P5ZA 3WMCA 5DCEA 4TOQA 3T8QA 1GOQA 4K36A 2EG6A 3E5PA 4GK8A 1ALDA 1UROA 3SRDA 3TC3A 8CGTA 1UUMA 3Q37A 3CUHA 3T7VA 5A6TC 2ZTJA 3SCNA 1HQTA 4IIBA 1Q2SA 5E9XA 1DJQA 2V8ZA 1OFQA 3K4WA 1QO2A 4GY0A 1YDYA 2A7NA 3CTLA 3TP4A 1NOUA 2B7NA 4JY9A 3PZOA 3GYCA 1LBLA 3O2LA 2QCDB 4TVCA 2JGYA 1P7TB 2ON3A 2XDFA 1XWYA 1W1TA 3B9OA 1Q6CA 3OYXA 1PV8A 3TV8A 1PDYA 3GXPA 2C6QA 4URIA 4ACYA 4FO4A 2I5IA 5LIXX 4AVOA 3W73A 1WPCA 1NSJA 3WLTA 1W3HA 1B2YA 3TH6A 1NARA 3PULA 3TYUA 4PMQA 5FCZA 1TA3B 2QDHA 4B5SA 1JVNA 2DZTA 2PD5A 1L6GA 3B4YA 2C0HA 3SM0A 2Z1BA 2PURA 4I9AA 4XISA 4TX9A 4I7VA 3ARRA 2HVNA 4HU3A 2Z0IA 3O16A 4B5UA 4JGDA 4YS1A 1IYXA 3MVIA 4IPNB 2PRLA 3M5VA 1P1XA 2J6XA 3G1YA 3ABSA 1GW9A 2NX3A 2H9AB 2VM8A 4JQ2A 2VZTA 3H2OA 4EPDC 4AY7A 1ONXA 4EPKA 1QOXA 3B0XA 4JBRA 3UR7A 4H8UA 3VFCA 5J5DA 1IV8A 3GS6A 2BWGA 3CS2A 3MT1A 4OT7A 2WQDA 2BNJA 4GIYA 3WQVA 4XV0A 3TSMA 1WOBA 2CZ5A 4GACA 2E6FA 1EPXA 1NDZA 4QAWA 3NXFA 2QQ6A 1FRBA 3DGRA 4HCLA 3TCEA 1BF2A 1HJUA 1V6WA 1XIHA 2ZVRA 1LQ2A 3CO8A 2QGHA 1ZS2A 2NQZA 3SGGA 3ZOAA 1FP8A 2J9ZA 4CN4A 3CUGA 4WOQA 1PX3A 3ZYZA 3CHFA 2XHYA 3TE9A 2DZXA 2DSZA 1G67A 1LRNA 1PE1A 1SW7A 1W2VA 2ABBA 2B7PA 1VGAA 4ZQPA 3MSYA 5DCBA 1DXEA 3AROA 1GVYA 1IR1A 2WLYA 1O7AA 1LUCA 3I4EA 1TJ0A 4H01A 3T8LA 2HZGA 2QF7A 3VCCA 2Q01A 3SBFA 1PKMA 4U5KA 1AUSL 4F40A 1PTAA 4YXGA 3V4BA 1TUFA 3FX4A 3PP7A 5A8MA 4LOCA 1H7WA 1EWEA 4BZYA 4MAVA 3VNDA 3ZXWA 2FGBA 4GI9A 2VI0A 1R3RA 4AXKA 1GQKA 1KLYA 3KBJA 5HWJA 3GO2A 1TPDA 1RH9A 4QFUA 3OYZA 1TPEA 1CPUA 4J3SA 4O18A 5CAHA 1ECQA 4JTQA 4JTLA 3LRLA 4LBUA 3BICA 2YW4A 3TTYA 3MTWA 3IV3A 4YVXA 2W63A 3W9ZA 4HOWA 3PHAA 4PRRA 1R3TA 3AHYA 3PJWA 3SEPA 5M1TA 4A2SA 1UC5A 2CZFA 5BCAA 3K1GA 4NNBA 1PX4A 4M6QA 1MUWA 1PKLA 3LHWA 4QE4A 1TRIA 4AB4A 3KL5A 4MWAB 1W37A 4OV4A 2G41A 1IIHA 3GKFA 1JIBA 5EMKA 1MYRA 1YHTA 3WJSA 3W07A 2DT0A 4IPIA 1K4HA 1B57A 2E67A 4IGHA 2HWGA 4IFKB 1ZALA 1GOMA 4NXSA 1IEVA 3W2NA 4DUVA 2V5KA 1BLIA 2GVYA 5I3IA 4GUFA 5CC3A 3AS2A 1VFUA 3FJNA 4W7UA 3FXGA 1ZJBA 1POKA 1F3TA 2XWEA 4HNNA 3QPEA 2VGBA 5ABFA 2WMGA 4HD5A 3WZ0E 4DYKA 2PGEA 4I6VA 4YHGA 3NQ7A 1KWGA 3VD9A 3AHXA 5HJLA 3O15A 4ZXLA 3WG6A 3EDKA 4Q8WA 2OKOA 4DZHA 3UWUA 4GHRA 3GR7A 2X2YA 2OYKA 1U1JA 1J6PA 3DHPA 4GVFA 1CGUA 3CAKA 3DG7A 4C6LA 2DUXA 4MYXA 5FAGA 3TYBA 4EPBC 1PEZA 4KEVA 1OSEA 1QFEA 1JUBA 3RJXA 3R13A 2CEQA 1QI5A 2O7SA 2CCRA 4F0MA 1BKSA 4LY4A 4PMRA 1XYFA 3LRKA 1ZQ5A 2DVTA 1PWLA 4AHOA 4D8ZA 1BXNA 3IIOA 2VR5A 4O1DA 4JICA 2AAMA 1MNSA 3NG3A 3CAQA 1GEHA 4RPPA 3QLLA 1UZDA 3ZWTA 3AYRA 1XQKA 4MWAE 4RCXA 3UPBA 1TWDA 1W5OA 4A3UA 4HZ6A 3QC3A 2HSAA 2XZ9A 1OX6A 5BU6A 4M19A 4QEHA 4Y2WA 3TYCA 1XIIA 1QW7A 3NUKA 2UBPC 3QC0A 5AC5A 5LKYA 3A24A 1R85A 4UMCA 5IBXC 4UQBA 3IAPA 1ZHAA 1CWYA 3GR8A 5EGRA 1HL2A 1LCOA 4DVOA 4ATLA 3S2CA 1GONA 1RD5A 4KWOA 1EXBA 4FOJA 3VC5A 5CG7A 3IVUA 4CNPA 4B2DD 4N6FA 1EZ2A 3W1QA 4FLRA 2PDYA 4L6DA 2PC8A 3C86A 2VFEA 3BW3A 3GDRA 1W54A 1UWRA 5EMJA 4FOUA 1AW2A 1SYTA 4PBGA 4CCEA 4XUGA 4F2BA 1GOIA 1TMHA 1F7BA 5K4ZA 1ZNNA 4LBSA 1XW8A 2VEIA 1JZ3A 3WL1A 5HWMA 5AC7A 3RLHA 4GPNA 3K4DA 4JKKA 1KFBA 2Q09A 3AZRA 2C1HA 3NOYA 3ARPA 1G69A 4MJ4A 3TQPA 8TIMA 3AO0A 3DESA 1G4EA 1IXPA 4JX6A 1E43A 5MKGA 2VO5A 3TJXA 4PMYA 3FYYA 4RW3A 2GOUA 1KTNA 3DHUA 3WEOA 4ZO8A 1BRLA 3CL8A 2E1DA 1VRDA 4ENLA 3P5YA 4F0RA 4LW7A 1H7XA 2Y5JA 2CHNA 5LXXA 4EX4A 3NQ6A 4D6EA 1J93A 3ME3A 1LOQA 3BARA 3C61A 2FH6A 3WF4A 3OOQA 3OA3A 3CQJA 4DUXA 3LY0A 1Q66A 3I4KA 2R1PA 3IGUA 4MKNA 4Q8QA 4CEXC 4DBWA 2OYMA 1WDSA 3ITLA 2ZC1A 3EB4A 1DXIA 3FYOA 2DZAA 4O4VA 1AODA 3W02A 4C7FA 1REQB 3U48A 1VIWA 1PUDA 3PPFA 4BS0A 3PG8A 1OX5A 4WJ8A 1LQAA 2PWDA 3IJ7A 4K7VA 5HAOA 1F4AA 3UZ5A 5LA1A 2J79A 1TVLA 1BGAA 3PUEA 4PSRA 1L6SA 2A85A 2GZXA 4LY8A 3HIJA 1O66A 5EYWA 3WBEA 2ZADA 1R3SA 1YTKA 4JEJA 5LA0A 3GTHA 5I02A 3QR0A 3G1DA 4W5ZA 3W1XA 1RQHA 1BG4A 3VOJA 2WCAA 1CLKA 3DU0A 3VC6A 3GHRA 3RX3A 3FYPA 1V03A 4HZ8A 2G37A 2VDHA 1EOKA 1R30A 4Q4SA 1J2WA 2D2OA 3CPRA 1AL8A 3P2VA 3L0GA 2D3LA 3ZM8A 3LHYA 3S1GA 2XYLA 3TR9A 1W3NA 4D9PA 1YNYA 3HTWA 4GIEA 1XFCA 4PFHA 3VDBA 4B3LA 4PB4A 1GVEA 4GUJA 4HU4A 1OCNA 1X38A 3A4AA 3A9BA 1E71M 1P6BA 2ZUVA 2GOKA 1SJCA 3GC2A 1PTGA 3NZ1A 4X60A 4PB3A 3S2LA 1V5XA 2HROA 3PTKA 2XTKA 3C0LA 3I3DA 3JW7A 2VWSA 1JI1A 3G8RA 2NQLA 3WFZA 2FTWA 1WDDA 2R9RA 4OJYA 1HUVA 1W17A 4ZE5A 1W6TA 4DZ5A 4GQBA 3TFXA 3WEMA 4PCPA 1PDZA 4MB4A 3U2OA 4I9TA 3AS1A 2PDGA 4ZO7A 5F1VA 4HCHA 1FFRA 4PTDA 2PEVA 1TIWA 5LIKX 2RDUA 4YHEA 2FHCA 3XISA 3KHDA 3C52A 4JY8A 3KTXA 2O7QA 3APYA 4BFAA 5I3HA 4MGGA 3L9CA 4Q4PA 5FSEC 1A5KC 3N2XA 5BMWA 1J8VA 2C3ZA 4JTJA 2OWCA 2P50A 2JKPA 3C2YA 4GZ7A 3V5OA 4DJFA 2YL6A 3N9SA 1L8NA 1OGGA 1KCZA 4GO8A 2BY0A 1GOKA 4YTSA 4GIAA 1V08A 4UB9A 4GE8A 2V6AA 1A5NC 1ZBCA 1YW1A 2NX1A 1WDRA 4IIHA 1UD6A 1XLIA 5BWAA 1PHQA 3POHA 3ZLFA 1KR1A 2PCQA 4HMEA 2Y7DA 4HOZA 3E0WA 4WKHA 1UKPA 2F8QA 3LEPA 4IMCA 3UVAA 1V6XA 3SUTA 3NQCA 1HF6A 1VFLA 1ZRQA 3ZJ7A 3VIOA 4H7VA 3JZUA 5A6SA 3P62A 2A4AA 2FYMA 2QAFA 2VXNA 2WHLA 1AFSA 3TAKA 3GXMA 2Z29A 4DJED 4QR6A 4FNQA 3HQPA 1QNQA 3BOFA 5U7SA 3QZAA 2FB3A 4JN8A 4TX6A 5CZSA 1KTBA 2IPGA 5AHFA 2ABAA 1XRSA 3BZGA 1K7FA 1THFD 1L2QA 3B0VC 2XIIA 4AD0A 1LTDA 5EA9A 4C5ZA 1SVDA 1QXLA 3GRIA 3W81A 2C18A 1I9CB 4RZ6A 1RCQA 3ITVA 3FXYA 2GVGA 5E0FA 4AWEA 2V5CA 3RR1A 3GAYA 4UTTC 3GD6A 3L68A 1FXPA 4HPNA 4C1LA 5JH2A 3SSJA 3IIVA 1W3KA 3P8IA 4FLOA 2W5FA 6XIMA 2CWXA 1W1YA 5I2UA 4ZR8A 3P67A 5HPCA 2PC4A 1NWSA 3E49A 3BDKA 1D7FA 4ZODA 3UQNA 4XAPA 4S2BA 3WLRA 4Q8NA 3C8FA 4H9YA 2OWWA 1E72M 2REQB 2G3IA 2O0TA 3EKZA 1U2YA 2P5NA 4LFYA 7PTDA 1Q45A 4HNLA 1OM0A 2TAAA 5TIMA 4O50A 1JCNA 2E6AA 3THUA 3JUGA 3BAWA 4AF0B 1EH9A 1XD1A 1FA2A 3NEHA 4N9DA 5CPNA 2YBUA 2R1NA 4GFSA 1OC5A 2VFHA 4E3VA 4M1BA 1OF6A 2X09A 8XIAA 4LCRA 2Q3RA 4Z2HA 4BHYA 4HA4A 1I6NA 3T78A 2NUYA 3C0SA 5A8QA 3GXDA 2NXHA 2NSOA 3ITYA 1K9TA 1P0KA 3SCUA 4L61A 4O14A 3C2OA 2OO6A 3TOYA 1OBAA 3CHCA 3CAWA 4NAFB 1GJPA 4ZA0A 2E0PA 3M47A 3II1A 1ZJHA 5FOOA 1UKOA 3TWAA 1Q6GA 2ZIDA 3WDIA 4L1XA 2DSUA 1TPFA 2Y63A 2V5BA 4N4QA 1DWIM 3MUAA 3I6TA 1KCXA 1BVZA 4MZYA 3U4FA 3TSBA 3ALGA 1E51A 3AMCA 1TX2A 3L12A 4G7EB 1WZLA 1ZU8A 3QV6A 1ICSA 4IICA 3GC4A 1BFNA 1QVBA 2ZA1A 1XRVA 3TUUA 1Q3NA 2FJUB 4B3KA 2XH4A 1W1A1 1CW2A 2QJGA 3W7NA 4PODA 3E3HA 1NDWA 4RDWA 1JL8A 2W0UA 3W7RA 1KV5A 3SCWA 3KZSA 3L4TA 1XIEA 3TSDA 1EJWC 1H63A 3W1NA 4DQWA 3S5ZA 2W67A 3CH0A 3MO7A 3XIMA 4TMCA 4ZXOA 1W5QA 1XV8A 4V1XA 2GVEA 2NQ5A 4LUTB 1K8YA 4JYEA 2GGJA 1XGDA 2QDGA 5I23A 3NM1A 1T0OA 1DTUA 3B04A 3DBPA 1HKWA 5CEWA 3LPFA 1LM1A 4L80A 3VKBA 3KBWA 3MHFA 1H11A 3VABA 2I5GA 3QTPA 4KRTA 4WHBA 1YTDA 3SW6A 1FH7A 4G8TA 1ODZA 2E5DA 2A3LA 4IGMA 2O56A 1XIDA 3G5EA 1F61A 1J0JA 4X3ZA 4KEMA 3KP1A 2CIPA 3H23A 4FSAA 2ATSA 4NI8A 2QIWA 2ZOXA 5A1AA 1O68A 4TVDA 1GQJA 2GYIA 2F2KA 1XKYA 3ARVA 4F2TA 1YPXA 3IK2A 4Y9PA 3IGHX 2RFGA 3ARUA 3U9IA 4E4UA 1GHSA 2OX1A 4E3TA 4KCVA 4H9MA 2PDLA 4E4FA 2Y0FA 2R1MA 2EPMX 4DELA 2FLIA 4S3KA 1E73M 1QNPA 5A94A 3T0TA 1J96A 1JYNA 3AZSA 1S2TA 3HPZA 1YNQA 4HNVA 1UZ4A 1NM9A 2QV5A 2OGYA 3BCJA 4N0RA 3STPA 1EC8A 1C92A 1TZ7A 2YYTA 4LUJA 1CB7B 3H53A 1UUOA 2IW0A 5JXQA 3VOHA 4WDXA 5GJMA 3CIWA 2X2GA 4IQEA 1H62A 1MZRA 4ZQRA 5I7GA 4D6GA 3OBAA 1C8QA 3PNZA 1Y8BA 1X1OA 1OC7A 3T81A 2IUZA 5TAOA 1Y0EA 1RBLA 4G1KA 3MUXA 2W3ZA 2QNEA 2NLIA 1XI3A 4I3GA 3QKEA 4IM4A 4L4OA 4O10A 3BLKA 3OLDA 4Q8VA 4ZQNA 3IGSA 2J78A 2DT3A 4RDZA 3UXLA 1JF6A 4UR8A 1OVDA 4YU1A 2WSYA 4W9TA 5FD0A 5HA7A 2XM2A 3F4NA 2OEKA 1EA0A 4J4KA 3GHSA 1Q63A 5CLTA 2Z2BA 3EZ4A 1R47A 1K3UA 3O6AA 1ZAJA 4O8AA 2CLKA 1OCJA 2QPSA 4LYKA 4GYFA 3SJ3A 1H0IA 2OR2A 3QW3A 5FA5A 1S5WA 3NM3A 4U4MA 1FHLA 3ARXA 4AZHA 2QVNA 4ADTA 2E3ZA 3GXTA 1FWNA 5H91A 2F7FA 5BZAA 3D47A 3HB9A 2EKGA 4IMAA 4HU0A 4IUGA 2CXGA 1UJPA 3OG3A 3VZXA 3ZVHB 1QOQA 2ISVA 2QJJA 2G3JA 2WK2A 3HURA 1DJYA 2XINA 1VHNA 4FALA 4WY0A 4A8NA 1EP3A 4PMJA 3LZ5A 2VRQA 1OZQA 1OJXA 1ZJAA 2VJXA 1TV3A 5C5YA 3UYIA 2DIEA 3ZLHA 3MKCA 3T0CA 1T7LA 1AQFA 3D5HA 3HPSA 3WD2A 4GOAA 1LOLA 1E55A 4X22A 1CB2A 4LSBA 5D30A 1JGMA 1IXNA 3TN6A 3N2MA 4FF7A 3AYTA 3VM5A 3WLSA 4K1WA 2Z1WA 3W88A 1J0HA 3VINA 2ZCGA 3V7PA 1EGZA 2YX0A 4JR5A 1XYAA 1H09A 4NX5A 1SGJA 4D72A 3DFNA 3W7EA 3MKKA 4LC6A 4BF9A 4MPQA 4IT1A 5CQ1A 1JZ6A 1N82A 3B05A 4P7NA 2YYUA 3TQ0A 4JTCA 4DPQA 1C7TA 3F2BA 4RDYA 3VMOA 3FIGA 4GJJA 5DMMA 5HMDA 4MTVA 2P3ZA 4JTDA 3UA3A 4UFIA 3GIQA 1XR2A 3I3EA 4M56A 2V2HA 1B5TA 3B8SA 3IIXA 1AA1B 2EPLX 3MY9A 5HQLA 1T96A 4YTUA 3H4GA 3NZQA 4DAIA 1ITCA 3PK7A 5CPTA 3WNMA 2BVYA 4GKTA 3B3DA 2QW5A 4CCCA 4O16A 2KAUC 3KZPA 1EF2A 2TYSA 5AZ1A 1O6IA 3EMQA 4Q8UA 2OZ8A 3WQDA 4YMZA 1DJGA 4QQ3A 3BG3A 3IIZA 4XBJA 3UWYA 4UOJA 3BLIA 1F9CA 4IMGA 1C8XA 4ONVA 6REQA 2DSWA 4OUIA 1UOZA 4LAZA 3K30A 2X1RA 1CGVA 4HZ7A 1YNPA 1XGEA 3PBMA 5GNZA 3VKDA 3N6QA 2WW5A 4K2SA 4WVXA 1XYCA 5BWFA 2BGSA 3AU6A 2OEJA 2H3DA 2CWNA 3FDKA 1RV8A 2PDCA 4J27A 4O0QA 3K8LA 1A50A 2ZX9A 2VRKA 4KIRA 1L6YA 3W76A 4GJIA 1LLOA 1ISZA 3N2CA 4XZMX 3ZR6A 1A3XA 1DBTA 2XGZA 3L4UA 5BXPA 3S1VA 2XSXA 3P81A 4LH8A 4OFCA 2ZDSA 4B5NA 4GBDA 2J8TA 3DUGA 4N2YA 3SQSA 1JAEA 1G7VA 1B54A 4Y96A 1TPB1 1KM3A 2IQDA 1PTDA 3EWUA 1TREA 2PZNA 4DBUA 3VTRA 4LUYA 5DF0A 4F2UA 1C90A 2FZBA 1F8MA 1CGXA 3WF0A 1DWGM 4Z2IA 3B8DA 4S3FA 5CJ5A 5CGTA 3U3HA 1RSCA 5ECVA 3PBVA 4JCMA 3D6NA 3STFA 3RDKA 3G1SA 1X8CA 1PB0A 5F2MA 1N55A 3C0JA 1LL4A 4KFPA 3S4TA 3AMLA 1Z44A 2PDFA 1MI3A 4R33A 3PZQA 3NDOA 4HK7A 5HNUA 2WLZA 2Q6ZA 2Y24A 3WD0A 5D33A 4W4QA 3F4DA 2FVKA 5FSDC 3Q2DA 4DB7A 5HR6A 2AQVA 2VD8A 1UWUA 3WY1A 2O9RA 5T9CE 4GD0A 4O15A 1EDTA 2PSNA 4B2DA 5D04C 4JQ1A 3SY8A 3QZEA 4Q4KA 4B9ZA 4TVUA 1IT8A 1H5YA 3MCOA 1FQ0A 2GVLA 1SR9A 4W8AA 3QN3A 4FR1A 5CC6A 1ME9A 4JIPA 3EBVA 5XIMA 1U5HA 1QBAA 4C1NA 2V38A 2ZRUA 5LXEA 3MP3A 1VBHA 1OF8A 4DI9A 3U8GA 1VBGA 2CLOA 3F2CA 3MB9A 2VC7A 3WJXA 4FS9A 4XSLA 3TA9A 3LTPA 2VD9A 2YXXA 2J25A 1POJA 2ZC8A 2PF0A 3DFYA 1WDQA 3K13A 1TTQA 4AZBA 4OV9A 1U5VA 4N6EA 4GH1A 4CNNA 4HPJA 4WK9A 5H8MA 4GFIA 5E0CA 3GDBA 3GNNA 2ACUA 4IP5A 4BF7A 4JFUA 4WXYA 1DKWA 3L21A 3LPGA 4TR9A 2F84A 3I6RA 1RY0A 4JHOA 1V0MA 1DHKA 1YXCA 4LEQA 4AU0A 3GTFA 4EWND 4A6GA 2ZRWA 3KLKA 3S2JA 1X7FA 1EHAA 3VAVA 3SURA 1VFTA 3WBWA 1E0XA 3GFYA 4JYFA 4AG0A 2J7FA 3BURA 4J3WA 1A5OC 4B15A 4L65A 4DZIA 4G1NA 4QIUA 5HNRA 3SN4A 4PTVA 2A21A 4UFLA 3ES8A 3DGBA 3NQVA 2JQXA 2D22A 2VCBA 1QWKA 3DI0A 4S3DA 3LLDA 5D09A 2A7RA 3L2MA 3NQFA 3VIGA 4NHVA 1XXXA 5HNTA 4X0VA 4IISA 2J66A 2HVOA 3SADA 1HX0A 2EPHA 3SI9A 5GNXA 2E28A 2OSXA 3WJYA 2NQHA 4AXNA 1MW3A 1DWAM 1HVQA 3HG5A 2X0HA 1JYXA 1MWOA 2I9EA 4V33A 1NELA 1WZKA 4S23A 1WXYA 1EJSC 2WV8A 3PVFA 5EY5A 4QXIA 2OKTA 2G3MA 3APTA 1JYVA 4GVGA 1OFOA 1RK6A 2R1KA 4H41A 3S9IA 4M6VA 2XN1A 3W87A 5KTLA 3EGJA 3LBOA 3FDGA 1R7OA 1YEYA 3PPHA 2BZNA 1ME7A 1M9HA 2Z7KA 5LGZA 3T09A 1MUMA 3VK5A 1EGVA 4MUZA 4NJKA 1RP9A 2G96A 4RZ5A 5H6HA 2ZUSA 2ONEA 2V2CA 3UJFA 2RDWA 1OQFA 1US2A 4AZ7A 1EEPA 3TW6A 3TU9A 2VQTA 4F0LA 1A0CA 1FY6A 4AMCA 4J3ZA 5DXXA 1ZJIA 3MU7A 4AC7C 3SN1A 3TWBA 3VI2A 4CNTA 3NPVA 5HQEA 5K4XA 5BU9A 3N14A 5JVLA 1J5SA 2XVLA 4LS0A 3CWOX 4FB7A 1C8VA 4YVVA 4FHAA 2ZWZA 4AEFA 1D3CA 5CSSA 1BTCA 2QF8A 5DY2A 1BWKA 1J2BA 3CYVA 2D23A 1NY1A 2WMFA 1R3YA 4PL1A 4FI4A 4DXVA 2DIKA 2PDBA 6TAAA 4M29A 3FK4A 3DOPA 5D32A 3CNYA 1W3IA 4LV9A 1GQLA 4R9OA 3J7HA 1AL7A 3LSCA 3BUVA 5DMYA 4L9XA 1J0ZA 1T8QA 1S3HA 2DORA 3A5VA 2FKPA 3SB0A 4FIQA 1ELSA 4F0KA 4BR1A 4O11A 3OA5A 3B8TA 4TO8A 3AXMA 2CC0A 5C55A 3CZEA 2X40A 2PF8A 1IF2A 3EEZA 2NX9A 3GU1A 3MDUA 3TR2A 5DT7A 3FGCA 5GJPA 2P0IA 2WBGA 1YDNA 3GVRA 3L0KA 4RL3A 4ERAA 1UA3A 3M0VA 4LNYA 4PMNA 4UTWA 3TJLA 1TB3A 4H00A 2DP3A 2DDXA 3GBDA 2YL9A 5FJPA 3M1ZA 1XUUA 3VO0A 2XH0A 3Q65A 2VVSA 1L6FA 3FVDA 2BB0A 3CT7A 9RUBA 2D0GA 4ZB0A 2NT0A 3EB3A 2G5WA 5CSYA 4DJEA 5BYWA 2PD9A 4LAOA 2YFOA 5AB3A 4ZVJA 4LNCA 2R91A 3P84A 2OZ3A 3LCLA 2GPTA 2PWFA 2PTWA 3T9PA 2Q02A 4UUIA 2WCSA 2E68A 5DO8A 4FZIA 4UTIA 1G9HA 3NL6A 1LBFA 1M1BA 1VLIA 4H2HA 5CKSA 2ISDA 2W62A 3EXRA 1EJXC 1GYLA 4N9BA 3SCVA 3VDHA 4KERA 1UPPA 5A6BD 4K8EA 3M0YA 2FPVA 1KM6A 3TYEA 4CQCA 3BH4A 3ITTA 1NP0A 1X6NA 1AH0A 1F05A 1XLAA 2J7HA 1Z42A 2Z25A 3TKFA 3LHVA 4XWUA 4ADSA 3UXDA 4NZFA 4BY3A 2Y6ZA 3AJ7A 1VR6A 1EEXA 5CC7A 3BG9A 2PPGA 4CU6A 1GKRA 2X0SA 2H90A 3M5ZA 4IP7A 3UWWA 3BE7A 4W8BA 4LCQA 4MJZA 3E1F1 2G3NA 4JIEA 2PP1A 4E0CA 4QCFA 2XIOA 1JD7A 3B0UX 3EXSA 3F1QA 1EDQA 1GZJA 3GC5A 3W7CA 3MWCA 1SFTA 1FWDC 3CWHA 3WQGA 4JL2A 7A3HA 3AISA 1XLFA 3R0DA 1JXJA 3PZVA 5FJRA 3PZUA 4WUIA 7REQB 1UD8A 3E0VA 2FTYA 1PYMA 3FVMA 3W7OA 1RJRA 2HBXA 1XLBA 3LCWA 3QOKA 1K7EA 4FIRA 1W5MA 1UH4A 1S46A 3MMWA 4R27A 2X05A 1PAMA 3TJ4A 4MG4A 1Q6QA 2WWCA 1FH8A 2CNCA 4S3CA 4H7CA 3R25A 4WDWA 4GUHA 1Z6KA 3QF0A 4JEQA 4IFRA 3SRFA 4JIHA 5HINA 5DY3A 1W1ZA 1RJQA 2VOTA 3SQLA 2G8ZA 3FA3A 3SGZA 2C1IA 4AEEA 1PSCA 1P4CA 4NXKA 3SCQA 3M6YA 1QPOA 4PUKA 3WDJA 1UR9A 2XGIA 4TU1A 1JPHA 1EL3A 2Y7EA 4N7QA 5J04A 4JKMA 1Z32X 4XKMA 1QNVA 3NCOA 1JUEA 4JFWA 1QNSA 1ISXA 3RMJA 5FJOA 4C5YA 1LF1A 2QJMA 3W6LA 1Q13A 4P8VA 4DJDC 4CGTA 1TIMA 3NO5A 3UCDA 1FWAC 3W6YA 3LOTA 1HKMA 5IM51 1ADSA 1MEIA 1VPYA 3GU2A 4W7VA 5D9MA 3T08A 3QMSA 4ILSA 5D2WA 2J9YA 2YFNA 4L6HA 4Y90A 4QDWA 4IPLA 3CPGA 4L5ZA 5AHIA 2XFFA 2PDXA 2BMBA 4D1JA 1JXKA 1XISA 1UR0A 5CLWA 4QSHA 4RE3A 1X98A 2AGKA 1AMKA 1SJBA 2EG8A 4L4MA 3RCYA 3S6TA 3NO3A 3H8AA 4LS1A 1I2NA 1HG3A 2XFWA 3HPXA 4H19A 1B3VA 4UQEA 1W8SA 3N9RA 3HN3A 4Q8OA 2RGMA 4IF2A 1GOWA 1FWEC 2C7FA 3SAZA 3WH8A 1VP5A 2WXDM 1XDJA 3TMLA 1VJZA 2QPUA 2F61A 4IPJA 3DHFA 1R3VA 3O9NA 1ZENA 2ZX7A 5D8ZA 1Q8JA 3AMDA 1MQPA 5BOOA 1V8EA 4LVFA 4HSOA 2OEMA 3UGVA 1PXGA 5T26A 4IX2A 4UCFA 1PZ2A 2PDQA 4NNAA 1IZCA 3IK4A 1KM2A 1S1RA 4Q3MA 3T0BA 3HGOA 3S5SA 2VEMA 1WKEA 2YCIX 4I5XA 3W1RA 1M53A 4XZBA 1QPKA 1OYAA 2PA6A 3C6CA 3BG5A 1RJPA 3HGRA 5CZ0A 4PMOA 4MAZA 2FIQA 1QU4A 3FA5A 3VIMA 4O0ZA 1GT8A 5AYZA 3A9IA 3B9AA 5T8GA 4DO5A 4WQ6A 3SCTA 2I9UA 4O57A 4D8LA 5AVNA 2PB1A 3MMDA 2OZTA 1F5ZA 5C9UA 3K1DA 3CL6A 1JCXA 3BW4A 1FWWA 4ZQMA 4YTTA 2IKIA 4WGHA 4H3DA 4GCAA 1GEQA 1XYZA 2Z6IA 5AZ0A 3S0CA 3N6HA 2I56A 3JU2A 2JALA 1I0DA 2C0AA 1WDWA 2NUXA 3F2DA 4Q7NA 5G1TA 2FTPA 1AH4A 3R6IA 3RCNA 3VD7A 1NQKA 1RZMA 1YYAA 3P61A 3CQ0A 1M7PA 3QBUA 1JEZA 2D24A 4YL2A 3VA8A 3OIXA 1JZ4A 4FLQA 3ARZA 1MFUA 1R9YA 5DRIA 1VQTA 1TWWA 4UFMA 2OQHA 1GG1A 1XINA 4XSMA 4KMQA 3VNLA 1TX0A 1XBZA 3QXBA 5D2TA 3KTSA 1SO3A 4KW2A 1GGOA 3ZLGA 4JHZA 2D1ZA 2QUMA 1KBIA 1CDGA 3WUGA 4MNMA 1K77A 5FL0A 1UKTA 3H2NA 1XLKA 4REQB 1E4LA 5EMYA 1E6ZA 1OX4A 1OD8A 3W7LA 5JIWA 1E1CA 3BCFA 1N8FA 2F6XA 4HPGA 4BQ5A 1Q4NX 5BMXA 4Z2JA 1ODUA 5G5IA 3WLLA 2YJQA 3QY6A 3SCSA 4JAWA 2AQWA 4W86A 1KR0A 3ABQA 1FCQA 3N1AA 2HQAA 3KRBA 3O07A 4LEFA 3RCMA 4EF8A 3L2IA 4KCUA 1P5BA 1IEQA 3NQDA 4IGNA 4WOZA 1IWBA 1YDVA 5HBFA 4WF7A 3W1UA 1XLDA 3CZJA 1LG1A 3E2VA 1Z8AA 2VEFA 3GUGA 5AHMA 3CHVA 3N2TA 4A05A 3SCRA 2F6UA 3RUBL 3BTNA 3REQA 3W6MA 3S1WA 3LS9A 1I60A 2X7WA 1QRQA 2ZICA 1E0UA 1PZ0A 3LGDA 3AC0A 2WM0A 4NNCA 4PA8A 4HMNA 1VLWA 1FWFC 1O1ZA 4F48A 4Q4MA 1Q5MA 3OZOA 1RLDA 4ZOCA 3ZQ9A 3AXIA 2D3NA 3OVGA 5CZTA 5LNRA 5D2XA 1MO0A 4XKYB 1QI0A 3EX4A 1UKQA 3LQLA 3TLLA 4YCPA 4Z0JA 3U7BA 3S6OA 1KBKA 3SN0A 4JTAA 1FWHC 3F5JA 3UW6A 3LNMA 2WMHA 3L5LA 3PB2A 3KRSA 4GH3A 2E6YA 3UWQA 5A6AA 2BSLA 4WLCA 3QHMA 1IXQA 2V68A 1TG7A 4PE8A 2CHOA 4WXZA 4P7RA 4Q33A 1WBJA 1JZ7A 1KFLA 1B90A 3PTMA 2Q8ZA 4BEUA 2BHUA 4YYCA 4NL1A 1A53A 4CCDA 4M3PA 4LAMA 1KFCA 2AMXA 3SZ8A 1J11A 4FEZA 1PYFA 4M81A 5DBTA 1S5TA 1LYXA 3MSDA 2D2HA 3DYPA 2VEKA 2SFPA 5E6YA 4I8YA 1LJYA 3WD1A 3L2LA 1A5CA 2ZXAA 4ACZB 5HMEA 2ESCA 4AZCB 2VDGA 3BANA 3AS3A 1XIBA 4ASTA 4E38A 3IJDA 5L6UA 1AMYA 2E9BA 3N3MA 4GI6A 1IT0A 3WNLA 4NU7A 4HBKA 3SR7A 1OFBA 4JTFA 3B8WA 1KTCA 3T2QA 2D69A 4HA0A 3GVGA 1RR2A 4AMAA 1B1YA 2INZA 3EPMA 4A2RA 1LWJA 3M5YA 3TX9A 3RIKA 3WELA 1GOOA 1K9DA 1DWFM 3QY8A 3V5FA 1CI1A 3EDEA 2HS6A 1NFGA 4LU0A 1QDSA 1VEPA 1QT1A 1OWQA 3VPLA 1JCTA 3EA2A 3G0XA 1X1ZA 4Y9NA 2HJPA 3BO9A 3P74A 3CEUA 3I7SA 2PRMA 4FX7A 1B3OA 1E6SM 4W84A 4F4RA 1XDMA 4JN7A 9XIAA 3WQEA 2C71A 4UZUA 1S1PA 2DU2A 3SO7A 8XIMA 1K6AA 4BF5A 2DVUA 4LF2A 1XSJA 1XM3A 1K1DA 3BQ6A 3H26A 1B4KA 3SDOA 1UZHA 3CO4A 1TV2A 2Y8KA 3UZJA 1SJAA 3Q58A 4FXRA 1YE4A 1B9BA 3OVPA 1PJ9A 3QMTA 1J10A 3M43A 3G1RA 1O4UA 3W3OA 2YCLA 5BNKA 1K03A 3HPFA 3CQHA 1CGWA 2BLEA 2WZIA 5EB8A 3EAUA 4XQ6A 4HYWA 1UKSA 5REQB 4R7OA 3VIPA 3P80A 1TCDA 4RZ4A 5KZ6A 2E9MA 4IJCA 2YCJA 1I2PA 1E6PA 2CLLA 1VS1A 1JCMP 3LCHA 3G1AA 4AZ6A 3EA1A 2VFGA 4KIEA 4DF2A 4GQRA 4H6RA 3UP8A 1XG4A 3OGRA 1G1YA 1F6KA 3UCQA 4GQGA 1XLGA 3GXIA 1ZSXA 2ACQA 4UQ9A 3PN8A 4JTRA 3R8RA 5BW6A 1A5MC 1R6WA 5C8BB 2ASHA 1GVRA 4R85A 1CXLA 3L5AA 3L4VA 3QKZA 2I5QA 1EOMA 1W3TA 2BY2A 1XLJA 3M5XA 3EOOA 4QISA 1O5QA 3VGHA 4FR6A 2HK0A 3EWDA 1JRCA 1R2TA 4WDUA 5KEZA 1Z69A 3Q4DA 3T40A 1AW1A 2X30A 1KQYA 1K6WA 4Q4QA 2YOCA 1J18A 4AIBA 4UTKA 1SO5A 3VX1A 1Q6LA 1EUNA 1QI4A 4WKAA 4H9TA 1Q6EA 4RDVA 3QJAA 3QQ1A 4XBSA 1XPGA 3KBSA 3KS5A 3IANA 3TC7A 2X1SA 4XVDA 4HHPA 1UOKA 1NJJA 2CFFA 3FLUA 4IIEA 1TV8A 2ZX5A 1UA7A 5A95A 3NVDA 2O55A 1XFBA 1NWRA 3BXWA 3BSMA 2OB3A 1DIEA 4WZHA 3MSGA 2VUNA 2ZUNA 3RNDA 1K02A 4JQ3A 1IEIA 2NVAA 4X63A 4PUUA 1F3WA 4M51A 3T42A 1J0YA 1G6CA 3S5OA 4MB1A 2TPSA 2YCKX 2BTMA 1XCFA 2X42A 5E70A 2PU1A 2DUZA 4J2MA 3WF1A 3WFAA 3L4YA 3AHVA 3FAXA 3CB8A 2EQDA 4GYPC 2OX4A 2PGRA 1C7SA 3LHZA 3W85A 1WXJA 2GJRA 2CW6A 3VVGA 1GVFA 4LJ3A 1TO3A 2VEPA 3NGFA 3YPIA 2E5BA 2VCAA 2YZRA 1EX5A 4RX0A 2DW7A 7TIMA 3LDVA 4HN8A 3RO8A 1SFLA 1F73A 2FHBA 3VUPA 1VFHA 4HB7A 3TFCA 4D2JA 1JFHA 4ZTYA 3DC0A 2J6VA 3WQOA 1RY8A 4JTHA 1XH1A 4WRHA 1T40A 4GGHA 1LBMA 1US3A 2Y7GA 4PSPA 2I1OA 3IAQA 3ZJ8A 4C6EA 5D8WA 2F2HA 1QPQA 4QRNA 2PLJA 3KBNA 4CQ9A 2CLPA 4ROQA 1MZHA 3DFQA 4W88A 3VOCA 1YQ2A 3L4ZA 4JQAA 4EKJA 3GQYA 2VC5A 3EOSA 4K1GA 2VURA 2ISFA 3TN3A 3DFPA 2ZXQA 4F3HA 4ZFCA 3QHOA 1SW0A 4AD1A 5A8OA 1W9PA 2G3FA 2WYSA 3N29A 4UIOA 4B9YA 5CJNA 3ELFA 1W1VA 1VYSX 2CBJA 2E5CA 1EFZA 1EBGA 1UWIA 3GFXA 1X97A 3UWEA 3AYSA 4EACA 2POZA 1BPLB 1F74A 1FHDA 3LGEA 4PUMA 3MYPA 1A5AA 1PPIA 3ATYA 3QTGA 1TMLA 2QYGA 3NTYA 1IE7C 1J0KA 2J4GA 2CU0A 3QV7A 4ORMA 1UR1A 2AOSA 3ZIZA 3WMBA 1E3ZA 3DFTA 3HFYA 4JDYA 2YXGA 4PUWA 4AVNA 3H2AA 1JGIA 1VFOA 2V5JA 3L7RA 5HK4A 3OHIA 1B3WA 2AAAA 4LVAA 5J8LA 1BWVA 3ORWA 4H1ZA 1DL3A 5DLCA 4WIWA 3WK2A 1RCOB 4DLFA 3R5EA 3IJ6A 3STGA 2YBVA 1M03A 4V27A 1GVIA 3OO2A 5C70A 3PG9A 1HP4A 2DGAA 5IDZA 1RA0A 2QJIA 3O06A 2ZFAA 3URNA 1IIGA 4PMXA 4YTQA 2XVPA 5HR7A 2ACSA 1R3WA 3O0KA 4UTHA 2GJPA 3P7YA 3P93A 3M07A 3NQBA 5DRCA 2BOEX 4GC4A 1W5NA 5BXSA 4YCOA 2H8XA 3E96A 4NJGA 3W26A 4X2RA 3RU6A 3UJSA 3OVQA 4PMVA 5A6BA 2NV9A 2QEZA 3WX7A 3KCJA 3B4UA 1W0MA 1H2JA 3IACA 5DELA 2QKFA 4NG3A 4EXBA 4HN4A 1OY0A 2VC9A 4QSFA 3BL3A 3VGEA 2ISSA 1SR0A 4IIGA 4A22A 2WO5A 5JQ9A 3ARYA 3N6JA 4FNPA 3KBMA 1DQWA 1LL6A 4FX8A 3PC0A 4H8VA 3GG1A 5TQLA 1EZWA 1GKQA 4ZL1A 3M0JA 3WDPP 3QEZA 4MWAD 1M7OA 4EXAA 1SU5A 3R7MA 2WPBA 1V6YA 2VL4A 2ZUMA 3PBWA 1MEHA 2A2IA 1OEPA 3JRKA 3LQGA 7ENLA 3KE0A 2QUUA 2RH9A 4FNSA 1RUSA 1WYIA 2Y62A 3NQMA 3LBMA 4NRSA 3ERPA 3RLUA 1V3JA 1XBYA 1JNDA 3ZR4A 2PDWA 3V36A 5A8GA 3S8HA 3MP5A 3G1XA 3GYEA 4GZJA 4UC5A 1RD6A 3KOYA 3TXVA 1PHWA 1O12A 3WNKA 5AC6A 2WJZA 2V67A 1GJWA 3R8GA 2BXVA 4IG2A 2FMNA 1GYMA 3ABZA 4I90A 3E38A 3C3NA 3LLFA 4LUSA 3WQWA 2XFRA 1S38A 4JNZA 4XD4A 4QE1A 3S46A 2A3HA 5HDRA 3TOPA 4O17A 1CGYA 1KFEA 1R38A 3T0DA 3RGTA 1KXQA 1MRQA 2WVVB 3GX9A 2WNQA 4M82A 3NL3A 2H6RA 1YLVA 4U3AA 3VGDA 4B5TA 1HIZA 3AYVA 1GK8A 1O5XA 1V0NA 2ZUWA 2HE8A 1SZNA 4HSHA 2XH2A 1EYWA 1Z9AA 2QCMA 1XDLA 1FTXA 4MHBA 3CYJA 1Y5WA 4H9ZA 4HNOA 4P2VA 4C65A 5I78A 4Y8EA 1P0EA 1V0LA 2WKGA 4HZMA 1PZ3A 4HYRA 4LANA 1I1WA 1CYGA 4Q8MA 2Y85A 3WBXA 3PB0A 3PS7A 1G5AA 3T2PA 1YXYA 3W2UA 1BTMA 1ECEA 2W27A 2NT1A 1OFRA 2IXVA 4J9JA 4JCLA 3GR4A 2PODA 4KETA 1GOXA 5CG0A 3MV11 3HJEA 1N8IA 1J6OA 1KM5A 4XTDA 4HT3A 2PE4A 5IRPA 4B5XA 2X16A 2BHYA 1LT8A 1PIIA 1FDYA 1PCKA 1AQ0A 1YXDA 1IGWA 3B9EA 3JS3A 4NAEA 1H1YA 4PMZA 4EWJA 3S3GA 2PWVA 3WUFA 4GBUA 3BGGA 3W7DA 2P10A 4LCSA 4ZSTA 5ABTA 5HMFA 4DO4A 2WNWA 3ARTA 4OBRA 1TPWA 3RAOA 2OXNA 3AS0A 3C2VA 4P8XA 2PDIA 1UD5A 1VCFA 2YLAA 2OCZA 3U0HA 3IRDA 1D3HA 5CJMA 5BOFA 1OT1A 3N13A 1KC7A 3BLLA 1QUMA 3GLCA 4H4IA 4M7TA 2YB1A 4AAJA 4GNKB 2VKZG 3CXOA 4HQVA 3IARA 4QJ5B 4XBKA 2UY4A 4TTUA 4U2ZA 3WNPA 2GQ3A 3WLMA 2BGNE 3OBKA 1ZB5A 1GPWA 5B7YA 1ICQA 1NOFA 2AL2A 4NQ1A 1LLWA 2XVGA 3E0FA 3LA4A 3W2JA 2OSWA 5C2XA 4B3ZA 4RNIA 1EHNA 2CLHA 3KTCA 2J8GA 3NO1A 2GDUA 3EDDA 4DWSA 3WDHA 3TTSA 3VOGA 1XIJA 5E9AA 1U22A 1XG3A 4M1RA 3TONA 4DO6A 1BYBA 4B91A 4CNUA 4MB5A 2PDMA 3FS2A 1VENA 1JF5A 1TFVA 1P0BA 2W92A 3L67A 2VX4A 4S3EA 1S2WA 1XPYA 3C2RA 4HNCA 2E7FA 2GGHA 2C13A 3KVKA 4CVWA 4L6OA 4IQLA 4A35A 4H9VA 1SFJA 4JTEA 5L9FA 1SZRA 1TR9A 3U2ZA 1WA3A 4IL0A 2WVTA 2VC6A 4AZIA 2CLMA 1ISVA 1GORA 3RM8A 3KVJA 3F4CA 4K37A 1RALA 3VNKA 4GI4A 3KW3A 3CASA 2A0NA 4O52A 1WO2A 4GMEA 3V5CA 4UR9A 1CTNA 1M65A 1JD9A 1TWSA 1VRXA 4US5D 5B7ZA 1D7KA 3RILA 3PWIA 3VIIA 3LPOA 4O54A 4RK8A 3LXAA 3O7UA 3V0TA 2YDQA 1RHCA 4EF9A 3GVVA 1WOAA 4E6MA 1FCVA 1H1NA 3SCOA 3P3BA 4KPLA 1KGXA 1Z3NA 2HTMA 5BRPA 2HEJA 1X96A 2G97A 4QCEA 2W6RA 4ES4A 3FSTA 4F66A 4O28A 5CC5A 1WCGA 5H2ZA 3FA4A 3TAOA 1TV5A 2YLLA 3U5UA 1Q4WA 4A8LA 3M0ZA 4KGLA 1W31A 2OO0A 1QASA 2BG5A 2XIJA 2Q8XA 1EUAA 1QHOA 2HNEA 3G1HA 3EDFA 3BAKA 1KRBC 3GHUA 1H7OA 2JEQA 3TDFA 1ESWA 5E6ZA 1OIFA 3ANUA 3UBPC 2Z6JA 2DZPA 3BMWA 2XFYA 3NL2A 1S2UA 1V93A 1Y5XA 3W1AA 2R6OA 1TE1A 1O95A 2BVDA 3KWSA 4KFNA 4I9JA 1NTHA 4IL2A 5D02A 3A4WA 5K9XA 3NQ2A 4Q4RA 1FWSA 3HU7A 5M17A 2MUCA 1Y5VA 4P7LA 3BZJA 3CBWA 1JAKA 5T9BG 3DC8A 3ARQA 3WLPA 4MSSA 4BA0A 2X0YA 1BYAA 1KKOA 1FCUA 3EX2A 1SSDA 3OZMA 4I5UA 4XZ9A 5FJJA 2GJXB 3UT0A 3PBYA 3GIYA 5HJXA 2Z4GA 5I07A 2QDEA 1UP2A 4E2DA 1E4MM 7TAAA 1AH3A 2WZTA 4D6IA 1HW6A 1VCGA 4RV3A 4AWTA 5G4EA 3GDMA 3PWAA 4HHLA 5FEPA 3T07A 3HQOA 1FUYA 2Z2UA 3A4JA 4W89A 1X1NA 1LUCB 1XLEA 4YPJA 2DSVA 1KBJA 4HSNA 1W56A 3AIBA 2DV0A 1QHZA 3PUGA 3WSUA 5BRQA 3CLMA 1EJRC 3UR5A 4BI6A 3LZ3A 3BLFA 1DJNA 3OGSA 1SMDA 3URBA 2VGIA 2DQXA 4QAIA 4ALDA 4O13A 2QJHA 3T05A 3HZ3A 4XZIA 2VP8A 1CENA 4N9CA 1DJZA 3R12A 4XUYA 1TELA 4QS6A 2P3EA 4F8XA 1DHPA 5IDIA 4KWSA 3NWRA 2XH7A 3UG8A 2AQOA 1SJDA 4CUCA 1KXTA 1YKWA 2DH3A 1JDFA 2BBFA 3P14A 1W8GA 1S2AA 1KM1A 1E0TA 3NSMA 3VNZA 4D6DA 2NVDA 1XRFA 2DEPA 1XLCA 4F0SA 3WQ5A 3AQUA 4RE0A 4N42A 3W7GA 3CV1A 2C91A 1BF6A 4LAUA 3UY8A 3S2MA 3LGGA 4W85A 2RKXA 1KKRA 3VYLA 4DJFC 5B80A 2AKMA 4LT9A 6A3HA 3TROA 4CN1A 2GJNA 5FF2A 1B3ZA 1PL9A 3HV8A 2WMIA 1QHPA 5C9RA 4ZZ9A 5ABFB 2VGGA 4P61A 3P82A 4QDPA 3N11A 5DMNA 3KVLA 2NVCA 1GJUA 2CESA 3EWYA 1F3XA 3BCDA 3LUTA 2PWGA 1TTPA 2IPFA 3CZKA 1Z41A 2PTDA 3R0KA 4LAKA 4XAFA 3QW4B 2WQPA 3F4WA 4C6BA 2VNCA 3FAWA 4YLWA 3G6MA 3U6WA 1UWTA 3G18A 4GKLA 5TD4A 4IGSA 4IPPA 4BKNA 4H9XA 4JPGA 3HGSA 1FWJC 2VOMA 4AD2A 2ZYFA 2GSJA 1MW2A 4PCFA 3W27A 1OG6A 3MI3A 1ITUA 3LLXA 4AD3A 4LBRA 1H4PA 3GZAA 4QJ1A 2WZEA 3K46A 3PNUA 4H83A 3NPUA 2PGFA 4RR4A 2Z24A 1HL8A 1NFBA 3WQ8A 5PTDA 2P76A 1TSIA 4A4AA 5D37A 3WMLA 4IZGA 3UZZA 3TCSA 2FPTA 4AWUA 4NY2A 3N34A 1LLZA 2PLMA 1KW1A 3WH6A 3H2CA 4H6KA 4OKDA 4ZE4A 4AVFA 3S9YA 1B31A 3P60A 2NXGA 2RDTA 3I3BA 1UC4A 5JMUA 1V6VA 3WNNA 5G4HC 1HTIA 4MKVA 3CUIA 5A5WA 1R46A 1EQCA 2GWNA 3OIHA 4AD5A 2Z27A 3AIEA 2B81A 3PF3A 1DJXA 4UXDA 2FZDA 2QVHA 2OQYA 1UP0A 1TVPA 4R7JA 2V0TA 3ITXA 4GABA 4CD8A 2VVNA 4TTGA 3PY2A 3T4CA 3KL0A 3WD4A 4QE5A 3BLPX 3BAYA 1FKWA 4AY1A 1LROA 1C8YA 4HTBA 2GK1A 1OHLA 4JDBA 4V2XA 2NWRA 2ZX6A 1J12A 1EYEA 1KRMA 2NLYA 2A6NA 4LRSA 1W9UA 1C9DA 1HJSA 3HQNA 5LNSA 4BQ3A 2DSKA 2RJGA 2CBIA 2DZSA 3WL0A 5T91A 1W32A 1W9XA 4X0NA 3OB8A 3HBLA 3TTQA 1GZGA 5FEXA 4C7GA 3GHTA 1S2CA 3QGVA 2ZRZA 3NSXA 4HK5A 2EHHA 8A3HA 2YB4A 3KEHA 2AMGA 3UXIA 2ZZ2A 3VIHA 3A21A 4J3XA 3EX6A 3I10A 4DAFA 1V3LA 4CD6A 5CGMA 3IEBA 4M24A 4KWVA 3IPWA 5MKGB 4I5RA 4XAZA 3WUBA 2G4FA 1ZUAX 2PWEA 4D6JA 4X61A 3VZZA 1BRLB 1XLLA 3GTIA 4S2CA 1YPIA 1JDEA 3CUFA 4KESA 4WJXA 3WQFA 4C6QA 3MO4A 2QCDA 1BHGA 1P7TA 1A4LA 2P53A 1TE6A 2NXIA 3PWGA 4O1AA 1DYSA 1V3HA 3RLVA 4B92A 4DBDA 1CZ1A 4WKFA 3GDTA 4L4LA 3W0KA 4EK7A 1T8XA 4U28A 1BQGA 4YIWA 2QUTA 1HO4A 1XCXA 3W1LA 1TA3A 1ZAIA 3NPWA 4FX6M 3MBFA 1P6WA 5HOSA 1UD2A 5CZJA 2Q3OA 1VJSA 3ITOA 4IHCA 1NF7A 3B8UA 4NILA 3VMNA 2VHLA 3W38A 1T6MA 4S1FA 1L8PA 3RM4A 4KRUA 2H9AA 2ZZ5A 3ARWA 4ERGA 2R1LA 2KX9A 3LV5A 2WZHA 1OFEA 1H50A 3NYDA 2CETA 5C9WA 1HVXA 3OVRA 3DBNA 2C15A 2WJFA 3MYOA 3CEPA 4J3VA 3THQA 1JZ5A 4D6HA 1E1FA 4JZ5A 2R14A 4PGLA 4U3CA 2QCHA 4ZMGA 1JRBA 4AX6A 3QZ6A 1OGBA 3PZ9A 2PWHA 1TTIA 1D8WA 3N2OA 4W87A 3CGTA 2EPOA 4PMDA 1OZMA 1E40A 1TJRA 1UQZA 1EP2A 1ADOA 4GX9A 3QGAC 3VX0A 1SZGA 3UJ2A 5MHBA 1XC4A 5G1MA 3GFZA 3GIPA 7XIMA 3ABXA 3GG7A 2XIMA 1L2UA 4QBXA 1AK5A 3G3DA 2FDSA 2EJAA 2J7GA 5RUBA 4CNSA 1OFAA 3PTDA 4GNJA 2ZBTA 1OK6A 3EWXA 4EVZA 2C14A 5I3FA 3CJPA 5KINA 1QAPA 3AJXA 2WANA 3QPYA 1TCMA 1ONWA 3UZXA 4PUDA 1WXZA 2HMCA 1HO1A 1HP5A 3R79A 5TNVA 3UPMA 3INPA 4Q7IA 2W9MA 1W5PA 2BASA 5C54A 1FVPA 2VR4A 1CBGA 3G6LA 5LIUX 3EPOA 1QNRA 4FLSA 4ATWA 3NVTA 3DZ1A 4TV6A 3N17A 3VOIA 1DXFA 5E0KA 3FNDA 1K8XA 3AMGA 1V0KA 2NV1A 3AIUA 4W93A 3L65A 1E15A 1J4EA 2HV5A 2OLSA 2VX6A 6XIAA 2O92A 1V7AA 1DWHM 5K3VA 4IIFA 3H2FA 5JBFA 2GUBA 3DERA 3R43A 3V18A 3B40A 4JS3A 3NZGA 2BY1A 4LRTA 4J28A 3KDOA 3B0YA 2B0MA 5EL1A 4BJHA 2G0WA 1UCWA 1NWTA 3PJTA 1V77A 1LG2A 1A5BA 4MNKA 4TX8A 4DBSA 4DYJA 4MWAA 7ODCA 1JFXA 3CPUA 1ME8A 1BYDA 2VYOA 4I7UA 4JIQA 1ICPA 3TYAA 4JFSA 4IFKA 3H7UA 5JH1A 1EP1A 2YCEA 2V3EA 4S39A 4RPQA 3BW2A 1IQ8A 4IOTA 3WK0A 4C6DA 1JYWA 3MA8A 5CH9A 3SRKA 2ZDRA 1CXEA 1SZFA 5H8UA 3EEGA 4DI8A 4L64A 1X6LA 3UU0A 1G7UA 2J13A 1V79A 1XKJA 5C9ZA 4HIBA 2E6DA 4PC8A 3WYZA 4DY1A 4FXFA 3T4WA 1FHVA 4PTNA 4JFTA 2WSKA 3GNOA 1FP9A 3OZPA 3FKRA 1JCJA 2QCLA 3GWQA 3VIJA 3EWBX 3TEVA 1BVNP 2TMDA 4UMAA 3H24A 4H8NA 4YYFA 1IWPA 4H8HA 2Y4SA 4ZCWA 3VCNA 3U2EA 1HFBA 1IEXA 3ZZ1A 3EX3A 1VBJA 1EJVC 1BG9A 4DO7A 5HWNA 2WZMA 4EXQA 2V69A 4OOUA 4A3HA 3IJ8A 1QI3A 4K39A 1RP8A 2ZZ6A 1RLCL 1KRCC 1I4NA 4C6MA 5F2IA 4CQAA 4ZBCA 5A8PA 4M6PA 2B7QA 1Q2RA 3MQTA 3E02A 4RUBA 4MVAA 3MUIA 1I1XA 2RUSA 3N2BA 3IUHA 3UZYA 1G4PA 3P6LA 1MQQA 4PR4A 2DJLA 5DQPA 1X6UA 1W1IE 2AL1A 2YA2A 4LWWA 2ZA2A 2ALDA 4R53A 4GQ0A 2ZXDA 3L23A 1CEOA 5HANA 4HHMA 5FKYA 1O60A 3PJUA 4MJMA 4OBSA 2JIEA 3AU2A 4FOKA 4NSBA 3NJ3A 3PBUA 1D8CA 2ISWA 4W8LA 4RJEA 1DE5A 3KDNA 5F2LA 4AEOA 4GNVA 2XN2A 4F79A 2WCGA 3IJLA 4Y6GA 2V81A 3QHNA 5I24A 3PPCA 1PKYA 3W2MA 1U83A 2UY5A 4UTFA 4K38A 4AD4A 5DN1A 1KWKA 1ZZMA 3SJNA 3DDMA 1K8CA 1EPVA 4BQ4A 4LVDA 4XIAA 4HU8A 1Z7AA 2CZEA 1F4HA 1CIUA 2OSYA 5FEZA 3W7PA 3A4XA 4QG9A 1XP3A 1UMYA 1MDLA 2JGQA 1BEUA 3BSGA 2DH2A 1DP0A 2O9OA 5TF0A 1U1HA 3EOLA 4E8CA 4OWGA 2CPUA 3RPMA 3OJGA 3F03K 5HJYA 1V6TA 5K9DA 1KXVA 1LORA 4LUIA 1JPIA 5FF4A 3GTNA 4ZB5A 3UY7A 2GJXA 4LXFA 3UEQA 1XRTA 4O19A 5HNNA 1R7AA 2B4GA 4S3GA 4CD7A 3CQIA 3ECQA 2XM1A 3EA3A 3FSUA 5C7HA 2BGQA 5JUVA 5A3HA 5U4NA 2TODA 1TJ1A 2IQ0A 1VPQA 2BVTA 1R2SA 1X8FA 5EU9A 1E9LA 1H51A 2DJXA 1VC4A 3CMGA 1Q6RA 2DFAA 3GE7A 3OQEA 1H41A 3W83A 4R5EA 1U5JA 1KM4A 1WBHA 3CMJA 3EX1A 3MI6A 2YDSA 4OTKA 3UCCA 3MANA 1NFPA 4A3QA 2J62A 1C3FA 5FF0A 2Q71A 3VD5A 1WUFA 2O9TA 3VKAA 3FCPA 4PTXA 4HPHA 4MJ2A 4G2DA 1TVNA 3PZMA 2X7VA 3LCXA 3C5QA 1JNEA 3H22A 1F8IA 3SECA 1CCWB 2GGEA 3TIMA 4WDTA 3APGA 1ISYA 4FNUA 3ID7A 3OLEA 3MUZ1 3CUZA 4GI8A 4NVTA 4QP0A 1P48A 1BVWA 3Q67A 1YX1A 1NWUA 2GLKA 1VFMA 1UG6A 4US5A 2WSQA 3VNJA 3NAVA 4YJ5A 1REQA 1DIOA 3KBVA 3RYSA 4S3JA 3WENA 2XIQA 1S5NA 2V9DA 1H0GA 2W79A 5I5RA 4MZ8A 1LRTA 4EE9A 4AUBA 5EBUA 2C19A 2QT3A 3KOXA 3VGBA 1BD0A 5HATA 1JPMA 4Y9MA 2OOFA 2YBTA 3U4AA 1ZGDA 1DQXA 3LI0A 1WQ5A 4OHQA 1M7XA 3B03A 4Z1BA 3WK1A 1RAKA 1MXDA 2WPGA 4J7RA 4R88A 1P6CA 1IWAA 3GG8A 5J5RA 4RZBA 3QH2A 1M5WA 3C2EA 2PLCA 2VZOA 3SY1A 3QGKC 4NX0A 3W23A 2FVMA 4U10A 3KL3A 1SQ7A 1XBXA 3H6OA 5DXYA 2QZRA 1HGYA 3IUDA 2E40A 2QLYA 2OWXA 4LALA 5G1YA 2CKSA 3C0QA 3AIVA 2GDQA 4LGXA 4JIRA 4HA3A 2PMQA 4ECLA 4ZEPA 5FIPA 4XD6A 4ZGYA 2NQ9A 3T55A 2IKGA 3HMJG 3FEQA 1EA9C 3MDWA 4H04A 4YWSA 4B4HA 1UWQA 4ICMA 3LSBA 1WKDA 4A8RA 3ICJA 3O0FA 4GVHA 1GUVA 3OP2A 3MC5A 4K7YA 3TK7A 1GZ1A 1WKYA 1E3XA 5AY7A 3VKJA 3GM8A 1OABA 5HMSA 3N19B 3AXKA 3PZIA 3W7KA 1MQRA 5EFFA 5KZDA 3KS6A 2WAGA 3EKLA 3IWPA 3MCNA 1JI2A 3MVTA 3ITCA 2PUZA 1IT7A 1NAL1 2PDKA 3IS4A 4MDPA 2WMJA 1P0NA 4JX4A 2ZWYA 1ZFJA 4M8UA 3CB3A 2QCCA 4HMDA 3V1HA 4WY0B 1JPDX 4LVBA 5C9XA 1XHGA 3PAOA 2A79A 1HT6A 1NVMA 1ADDA 3NEVA 2YSWA 3R0UA 1EC7A 4K6AA 3QY7A 4L7ZA 3Q94A 4DXKA 4WD0A 4PRTA 3AIQA 1HKVA 4UNIA 2CLIA 1KBBA 1Z48A 3PPGA 3RRXA 5LGXA 2NW0A 5AHEA 4DF0A 3CHEA 1E56A 3WLKX 3UWVA 1TV4A 2PI6A 5HXMA 3QOMA 2GSEA 3P0XA 1FXQA 1UR3M 2BODX 3H2EA 2PDPA 1E0VA 1PVNA 2GFTA 3R10A 4Z1YA 1GWJA 3KXQA 1WNOA 4HGXA 3VFLA 1IZKA 1I2QA 3USZA 3EWWA 3MHGA 3MBDA 3GVQA 2PS2A 3MUCA 4Q32A 3RF9A 5LSMA 4FP1A 2GSHA 5D03A 4NUWA 4Z2LA 3W1TA 4E8GA 2EG7A 3RN6A 2XSBA 1KXHA 4RLIA 2YW3A 4UMBA 1RXOB 2YL5A 3F7JA 1OADA 2R94A 3VE7A 5HULA 4BWLC 3M7SA 1L0PA 3IJQA 3NOEA 1H49A 5DCDA 2VFFA 3VIFA 2GUYA 3OTRA 3WD3A 1RQEA 2GGIA 4C7DA 4FNRA 1R5YA 1EDGA 1WB0A 4AHQA 3WJZA 1ZPTA 3PUOA 1JCLA 1GKPA 1IR2A 2VCCA 3KUMA 4GVIA 2QPXA 2BX7A 4C6NA 3PBGA 1MMFA 4U31A 3DX5A 3GAKA 4DF1A 3TXZA 4LQ1A 4JTKA 4ICCX 4ZO6A 1G0CA 1CLXA 1ZL1A 2OZ0A 4WCJA 2J8FA 4OE7A 1PKNA 3GVWA 2FFCA 2REQA 4UTWC 3M0KA 3ZFHA 1AVAA 6REQB 2UY2A 4M80A 2HE5A 5IBXA 2OG9A 4INFA 3LTSA 5IHSA 1TTJA 4V1YA 3MP4A 3E0IA 4KRZA 1AW5A 3IV8A 4AF0A 4HKPA 3DG6A 2FZ9A 4NF7A 1N8WA 5KZEA 1U1UA 4DJEC 1XC6A 4AIOA 2V5LA 1BXBA 1NQ6A 1KFJA 3GBEA 4OZOA 4UTLA 1VBUA 4JTGA 3LXCA 3KFTA 3NSNA 5AC8A 2PTXA 4PCNA 4PULA 3QLDA 4MKSA 4MLJA 1UD3A 4R3UA 1QWGA 4I9MA 4US6A 4NAFA 5A6JA 5JU6A 1E9ZB 3BAJA 3G8EA 4HVXA 4PEKA 2Y8VA 3RXZA 3URAA 3DEQA 5ABHA 3PZNA 4M6UA 3FKKA 2GQAA 3EWCA 2G95A 1UQYA 2ZXBA 2MANA 2E9LA 1TJPA 4MADA 1JDAA 5I6SA 1VCVA 2GQ9A 2WKLA 1E6XM 1VFFA 4HJWA 3QYQA 3UF9A 4UTUA 1ZTVA 4RNHA 1PIGA 4JKLA 4J40A 4LTSA 1XBVA 4G7EA 3HMCA 2OMAA 2PRHA 3AALA 4AX7A 3LM3A 3V0UA 4H7ZA 4J35A 4DWDA 2BVWA 3LYEA 4NJHA 3CUXA 3RG6A 3AFBA 3E9AA 3UNTA 3H4XA 2BV9A 2C79A 3MW7A 3LB0A 2ZZ7A 5KETA 5GJNA 5HPOA 4UNLA 2H3BA 3BK0A 3BLOA 3CAVA 5AECA 4HPXA 4G5DA 4MPKA 3WJWA 5D9PA 3NFUA 2FZNA 3R58A 1VBRA 3KOFA 2HRWA 4LUTA 1SO4A 1TWIA 3HG2A 1M01A 2X41A 1SSGA 1H61A 3FOKA 1DORA 3NQAA 3ZJ6A 5BROA 2IPJA 5XIAA 1RBOB 4C1NB 3C3UA 3VDGA 1FWIC 1DJIA 5I3GA 1F07A 4MB3A 5EMUA 1WDPA 1XYBA 2CZDA 3DHDA 3MMUA 2EBNA 4GIRA 3V0SA 2Y89A 5JBEA 4I6KA 3EPNA 5F4SA 2JKEA