5C6MA

Crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
247
structure length
247
Chain Sequence
MSDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAGDTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFELVKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAGADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAGGVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNLLHTLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Shewanella halifaxensis
molecule tags Lyase
total genus 100
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c6mA00
2BSLA 3NQAA 3QPZA 2QJHA 4P61A 4D2JA 1K8XA 1QOPA 5D02A 2EF9A 1SO3A 3DKLA 4HPXA 1C29A 3EWZA 1EB3A 4X22A 3WFAA 2CZEA 3L68A 2JKPA 4JX6A 2JGYA 4OQVA 5DY3A 4K6AA 4O54A 2DZVA 1HG3A 1T99A 4BI6A 3W07A 3E02A 1Q45A 1H7NA 2QJIA 1OYCA 1YDNA 2CLKA 2AGKA 3O63A 3GR7A 3W1NA 4HT3A 1KA9F 1SZNA 4WUIA 1OFPA 2QJGA 1LBLA 1FCBA 1WQ5A 2Q8ZA 4RKAA 5K9DA 4N4PA 3PS7A 3I7SA 1G67A 2PRMA 1NSJA 3M47A 4GUFA 2CLFA 3LV6A 3BO9A 1VLIA 3LCWA 2ZZ5A 3DENA 3G1VA 1WA3A 1K7FA 2CFFA 4Z08A 3W1RA 1XI3A 3HB9A 3LHWA 1H7OA 3MYPA 3U8GA 4WY0F 4O0KA 3LRMA 3PULA 5G2HA 1THFD 3C56A 1GOXA 5KTLA 5A8GA 3QYQA 4NUWA 1GVFA 1ICQA 1JRCA 5LNRA 3CU2A 5G2IA 5K9XA 4TMBA 5D03A 4DO6A 4KFPA 5LHEA 4O15A 4A21A 3L2IA 2YXGA 3M44A 3LCGA 4N9CA 4AF0A 3O6DA 3I65A 4DQWA 1JUBA 2VEKA 3LB0A 4BWLA 1WXJA 2ZZ1A 3KHJA 3GXPA 3I68A 4I7WA 3LCIA 1LRTA 2QDHA 5BMWA 2DZPA 4Q4KA 2XN2A 4HNVA 2J24A 1LDCA 1MEWA 2ISWA 3DFTA 2G97A 4KWVA 1VGAA 4WY0B 5U4NA 3RMJA 3QM3A 1W3IA 5CZTA 3M1ZA 3TE9A 4AH7A 5DY2A 3NPVA 2R94A 3DKJA 1JVNA 3GIYA 2QEZA 1IGSA 4IUOA 1JCNA 3TROA 5EPDA 3M6YA 3JRKA 4AB4A 4O4VA 4E2DA 1EUNA 4Y90A 1UBSA 1I4NA 3OVQA 4FNUA 3A24A 4JYFA 5HWJA 1ONRA 1YXCA 4Z1DA 1O4UA 2YR1A 2ZRYA 1UUOA 1FY6A 3EWXA 4PEKA 3EX6A 5I3JA 4N6FA 4JD4A 7TIMA 3UPWA 1VLWA 3M5ZA 5AHIA 2PURA 4DBEA 3LCFA 3N9RA 4FEZA 1B4EA 1XM3A 4TU1A 1XFBA 3MBFA 4QSHA 5FF7A 5EMUA 4NZJA 2Z0IA 4ADSA 4FIQA 4HN4A 3OBKA 2P1FA 4GC4A 1P1XA 4IQLA 1H62A 3H53A 4IGHA 1K3UA 4O28A 3NA8A 3RLUA 1FDJA 4ZVJA 1TTPA 2X1TA 1PIIA 1DV7A 4O19A 5EL1A 1SSGA 3QFEA 1T96A 5I3IA 5AN7A 4DXVA 5E0KA 1TTIA 2QCDA 2WOQA 1YXYA 2ZBTA 4U28A 3CT7A 4JGDA 1TPDA 1TPUA 3LXBA 2F84A 4IMCA 2Z6JA 3C2FA 3SFKA 3GB6A 5CGQA 1I8JA 3NPWA 1C9DA 2C15A 4XKYB 1U5JA 1OABA 1JQVA 4TO8A 5CZ0A 4XQ6A 4FXRA 3GK0A 1SO5A 1TV7A 2PCQA 1Z42A 1TPEA 1D3GA 3HPSA 3Q58A 1QWGA 1KFEA 3PUEA 5TBOA 2YYUA 1KM2A 1W5NA 4LV9A 5F2GA 1T8XA 4UUIA 3TJXA 4DEFA 1GVSA 5D04C 1JCJA 4CNNA 3R12A 4JICA 5CZJA 5CZSA 1HTIA 5CG7A 2Y61A 1N55A 2OT1A 3STFA 3ABSA 1P5BA 4GUHA 1AG1O 3W2JA 4UFMA 1FQ0A 3EX4A 2G5WA 5HUPA 2GQ8A 3TK7A 1OK6A 4CLMA 2BLEA 3EWYA 3B0PA 3WK2A 2YDAA 3T55A 3TR2A 3K30A 3M0ZA 3KXQA 2GJLA 4DPPA 1A5CA 1TPC1 3D0CA 3N3MA 4MZYA 4R34A 2DJXA 4RR4A 3GDKA 4RXGA 2V9DA 3KOFA 1RZMA 3MWAA 3VE7A 4LC6A 3PBWA 4FNSA 3U2OA 3GVGA 4Y8FA 3LHTA 4JTTA 4OE7A 5H91A 3TCEA 3EKLA 5KZEA 1UASA 4NXKA 3MI3A 1KFLA 4GRSA 3G0SA 5DXXA 3ZFHA 3LBMA 5E1QA 3PB0A 1CW2A 5D38A 1I45A 4XTIA 1FWRA 4NVTA 2H8ZA 1XL9A 1FXPA 1NF0A 1QO2A 2E5DA 1D9EA 1P0NA 4N9BA 1DBTA 3IIXA 3P62A 5LGZA 3THQA 2Q3OA 1KV8A 4O1AA 4FNPA 4Y6GA 3W7KA 3B0UX 1XXXA 1A5BA 4UCGA 1SPQA 5G2WA 3O07A 4MYAA 4LWWA 2C6QA 4ICNA 4WOQA 1QDSA 2FIQA 1X7FA 2ZZ4A 3KVJA 4IMEA 1AW1A 1TPB1 2E6YA 3HMJG 5LGXA 2J9ZA 3WK1A 1SO6A 3DZ1A 4LNYA 4UTUA 3O1NA 4UFJA 1Q6LA 2RDTA 2H6RA 3EXTA 3ZS4A 1S5WA 4GWEA 4MY8A 5D2VA 5AFDA 2VELA 4YLWA 3WJZA 3N2MA 1SSDA 1G4PA 4OT7A 4ZQCA 3EXSA 4XBKA 2ZDRA 2RH9A 1AW5A 3R13A 1TPWA 3BK0A 1QO5A 4Y9AA 2WO5A 4M7SA 2VFIA 1EPXA 5I3HA 1VCFA 4RCXA 1MO0A 2EKCA 3SY5A 5D32A 1FWTA 1JCXA 1NVMA 1PCWA 4LUIA 3W1UA 3U6WA 1TYGA 2CLLA 5K4XA 2DORA 3DFNA 1EP2A 2FFCA 2WSQA 3C0JA 3KRUA 2NV1A 2ZRUA 4RZ5A 1LBFA 5I3GA 4ZQPA 1SQ7A 2E77A 2Z1BA 3QH2A 3DFOA 3OEXA 4LVGA 2I1OA 4I7UA 1A5AA 4DPQA 1ZHAA 3G1XA 3W7GA 1W56A 3QC3A 1F5ZA 3A23A 5L6UA 3TQVA 1O5KA 1G4SA 3W1XA 3E0IA 2YZRA 1GEQA 2BX7A 3PAJA 4RJEA 5DLCA 1F73A 1UJPA 2QDGA 3B0VC 1TIMA 3W7IA 3BW3A 3UZ5A 4I9AA 3G1YA 3DXIA 2GOUA 4IX2A 4W9TA 5FEPA 1HO4A 3PF3A 4PCFA 1QPQA 3S42A 2ZA1A 4AF0B 1SUXA 3CC1A 3DHFA 4NJGA 4X9SA 1A5SA 2VC6A 3DGRA 4TR9A 1HO1A 3EX3A 2TMDA 4S1FA 2C0AA 1ZENA 3BLFA 3DH7A 1GYLA 5F2MA 3UWWA 4NX0A 2WJZA 2PRLA 1VYSX 3EEGA 2A4AA 1F7BA 4GUIA 3HGOA 2ATSA 3NQDA 4LTSA 1H61A 3KAOA 5BW6A 1OFBA 4ZQOA 2QKFA 2QCNA 1AL7A 1S5VA 3PUDA 4TIMA 5F4XA 1YADA 3N73A 3OHIA 3W7MA 1H7PA 4JN6A 4OV4A 4UMCA 1VYPX 4HHPA 1EIXA 3EWBX 3G8RA 1LRNA 3P80A 2C16A 4M6VA 2Y63A 4Z0SA 1RQBA 4X2RA 2YFOA 3TSDA 3W7LA 2V5LA 3OVPA 2Y7DA 4O57A 3LHZA 4LVFA 3VE9A 3A21A 3BPWA 1QPRA 3FOKA 1DL3A 3LX9A 3QMTA 3W83A 4UMAA 5G4WA 4KKXA 1PE1A 4UNLA 1GG1A 1MZHA 3G22A 3KVMA 3W2NA 4GJ1A 2OT0A 2I9EA 4J9JA 2ZRWA 1IXPA 1L2UA 5FESA 2C1HA 1LBMA 2QCDB 3G8EA 1X1OA 1F05A 1UUMA 1VQTA 4QJ1A 1OYBA 2X30A 1VCGA 3LV5A 3A9IA 3PWAA 1XDMA 4BI5A 1VHCA 5BNKA 2P0OA 2NX9A 2WQPA 1ZNNA 2GJNA 3HF3A 3M5VA 3R2GA 3E9AA 4M19A 1TJPA 2ZA2A 3O06A 3R5EA 1PHQA 4U4MA 1BTMA 3W1QA 3HGRA 5H2ZA 3O6YX 2Q8LA 5KSWA 4RK8A 4BF9A 4HSNA 1EP3A 3GLCA 1KM1A 1YTEA 2FPTA 3FJ6A 2TYSA 4O50A 5DBTA 3TQKA 1PL9A 2ALDA 4XUGA 2TSYA 3PG8A 4Y96A 3WJSA 5KZMA 3P7YA 1WOAA 3NXFA 3OA3A 3DFSA 2EAWA 4RLIA 3S5YA 1TV8A 2FB3A 4QM1A 3L21A 5AOUA 4K7VA 3VFLA 1XUUA 1L6YA 2CZDA 3CQ0A 5J5RA 5HR6A 3HO8A 4ZQMA 3IVUA 1BEUA 2YPIA 3NPUA 1LYXA 1ZAHA 4MJZA 4EVZA 5K2ZA 1PHWA 2R91A 1OX4A 3W85A 4A29A 3M7WA 2C3ZA 1H63A 3FJLA 1UB3A 4GBUA 3IGSA 2X1RA 3F4NA 2PE4A 4ZQNA 4JX4A 3NGJA 3LCXA 4LW7A 3N14A 4QITA 1OHLA 4NZFA 4R7JA 1H1YA 2DP3A 1QMLA 3DI1A 1F6PA 1MXSA 4LVDA 3W7CA 3GXNA 3DBPA 4NXSA 4QISA 4JTHA 4DO4A 3KRSA 5F1VA 5FEZA 1XUZA 3TX9A 1P0KA 2C13A 5D2WA 5CSRA 3NOEA 5HWNA 3Q94A 1OF8A 2J88A 4QAIA 2E5BA 2GPTA 2C14A 3N9SA 5FI8A 1TPH1 4CQAA 4WQ6A 1LOQA 4ADTA 5BRBA 1Z41A 2J9YA 3JR2A 4JTKA 4FXSA 5FEWA 4IXHA 1O95A 3NZRA 1YTDA 3TFCA 1XC4A 5IM51 4QNWA 2ATMA 3S1VA 4Z1AA 4HNNA 4OV9A 1FX6A 1VH7A 4UC5A 3LGEA 5BOOA 3NNTA 3P74A 5HWMA 4RXFA 3NL5A 2PC4A 1MSSA 3TIMA 3GNNA 4UFIA 2YX0A 1LLZA 5LNVA 1DQWA 1SFJA 4OHQA 3LLDA 3LLFA 2V0TA 4PTNA 1FWNA 3W74A 3RFAA 2QF7A 3S8HA 3SGZA 4O8RA 1L6WA 1S3HA 4UMBA 1EEPA 3HG2A 4O1DA 4JX5A 3QSTA 6ALDA 4Q33A 1TRDA 2QCCA 5EA9A 3W84A 4HNUA 2Z6IA 1VJIA 4G1KA 3I6RA 2ZZ6A 3S1XA 4YWIA 3G1DA 4UR7A 1DKWA 4ORMA 4ORIA 2OZ0A 2V81A 4K36A 2NZLA 3S5NA 4O14A 4O12A 2JGQA 3P84A 2B7QA 5A5WA 1KW1A 3C61A 4GUGA 3E12A 1KFCA 1G4TA 1L6SA 2CLEA 1GJPA 3TA6A 5G1YA 3MHFA 3LTPA 4O16A 3QW4B 3CIXA 4O17A 1R2SA 1ME7A 3W86A 4O11A 4N02A 1YTKA 4MZ8A 4XZ9A 2E6FA 1AL8A 3STCA 1KLYA 3BLEA 2YYTA 3W1LA 3L5AA 4MY1A 3BLIA 5IBXA 4NT0A 2E6AA 3TC7A 4AWUA 1XBXA 3GYEA 2WNQA 3W9ZA 3NZ1A 2Y6ZA 2G95A 2ZZ7A 3ABQA 4JIQA 1PV8A 3SI9A 1PS9A 1H5YA 1ME9A 2YGYA 3QSRA 3H55A 1Q6QA 1QR7A 4FNRA 4E38A 1FDYA 1G6CA 1QPNA 4NJIA 2JBMA 1OFDA 5K7JA 1H7RA 3BG3A 2V2HA 1K8ZA 3PY2A 1QFEA 1IF2A 3SJ3A 3BARA 5HJLA 3UNDA 3GAYA 3W70A 3NO5A 2QAPA 1YPIA 1IXOA 3P60A 3W7RA 3HPZA 2J27A 3R89A 3L66A 3HPXA 1EX5A 3G1HA 1R46A 4M7TA 4MIMA 3H54A 1W3NA 1N8FA 1EWEA 4FNTA 2AQWA 3M43A 1DVJA 4K7YA 3W6YA 1Z48A 4L4MA 2ZRXA 4CCCA 3QQ0A 2GVLA 3FYPA 2ZRVA 1QNVA 1W5PA 2A1YA 4S2BA 2JK2A 5IBXC 4MYXA 1KM6A 4MFEA 2RHGA 2VENA 3IVSA 3Q2DA 5DCDA 4O52A 3FKKA 4UTJA 1EP1A 1LOSA 3W22A 3LHUA 3PM6A 5D2XA 3QJAA 3FFSA 1KFKA 3MP5A 2FTPA 4CCEA 2JKAA 1H51A 1KM0A 1TO3A 2EPHA 1JJKA 1ICSA 2GUUA 3CPRA 1OG0A 1XBZA 3USBA 3I7QA 4R33A 2YCEA 4N9DA 4BFAA 5F4WA 4EOUA 3F03K 2QUVA 3KVLA 3NQ2A 5LSMA 4RZ4A 3DU0A 4H6KA 2NLIA 2BTMA 3DAQA 2YW3A 3TC6A 3P5ZA 5I3KA 4OU1A 1G69A 1KTNA 1ZALA 4KWWA 3T40A 1I2QA 3NEVA 2QCEA 3HIJA 4JTFA 4CNPA 3G24A 2NXHA 1LLWA 1JRBA 4OBTA 4PFMA 1GT8A 1FXQA 2QCMA 8TIMA 2NWSA 3CEUA 2HS8A 3TSBA 2J6XA 5KMYA 4UTTC 1R2TA 1OX4B 1FCVA 1W5QA 2EGZA 1JUEA 1L9WA 1V7YA 3KRZA 4UTMA 4NNBA 3NQ6A 3LCHA 1F6KA 1TB3A 1WOBA 3HBLA 3IGXA 3W75A 1N7KA 2A7NA 1LORA 4LUJA 4RX0A 2VEPA 4FHAA 1KFBA 3QMSA 1W31A 2R14A 2VEMA 3FS2A 3LTYA 5CPOA 4JEQA 1ZJIA 4XBSA 4AAJA 3UYCA 1J2WA 1I2PA 3TMLA 3G1SA 1TPFA 2EHHA 1JULA 4K38A 1DJQA 1LP6A 3V1PA 4MVAA 1FWWA 1ME8A 1OVDA 3BW4A 1F74A 3TJLA 4DF0A 2H8XA 3W88A 4O53A 3C2VA 4ZL1A 5HNRA 2Y85A 5T26A 3MMTA 3A5FA 4IJBA 4GFSA 2A21A 1BWLA 2ZQ0A 1R47A 4EIVA 2HTMA 3UXAA 3TH6A 2F7FA 1AK5A 4KFOA 5HQEA 1XBYA 2DZSA 3W1MA 2Z2UA 2VFFA 4LV4A 2DJLA 4GNJA 4AHPA 4M5PA 2FQIA 4LC8A 1VRDA 3PSVA 3L0GA 3ELFA 1EWDA 3G3MA 1WYIA 4MUZA 3W7NA 3I7RA 4JTGA 4JR5A 1ALDA 1CI1A 1RPXA 1G4EA 4L4LA 3S9YA 4Q32A 3MW7A 5AYYA 5G1TA 2QAFA 3MO7A 4O0ZA 1RR2A 2VFDA 2ZCGA 3PSWA 3TKFA 1FWSA 3BGJA 3FA5A 3GKAA 3BGGA 4NNCA 2DZWA 3VI2A 4LOCA 3DHDA 3NL6A 2CLMA 1RQHA 2B7PA 2HMCA 3IIZA 2CLHA 2V2CA 3L67A 3C3NA 2E5CA 2QCHA 1ICPA 5FF4A 4NNAA 5CPLA 3S1WA 3S1UA 3ABOA 2CZFA 1F76A 4IMGA 5C5YA 1W3TA 3UWUA 3BG5A 3TV8A 3NQVA 5LNUA 4O4WA 3LXAA 2I14A 3W3OA 4PL1A 5U7SA 5AYXA 3L9CA 4IWWA 3GX9A 3LDVA 4UTHA 2ZZ3A 4IX0A 4LU0A 4A22A 3B4UA 1EA0A 2ABBA 1NAL1 3O6CA 1I2NA 2HSAA 4K37A 4DBDA 4JY9A 3W7JA 2FLIA 3CIWA 4HPJA 3FYOA 4FX6M 1W1ZA 2ZTJA 4AHOA 3F4WA 3OIXA 2OCZA 4Z1CA 1G7VA 1QPOA 3TSMA 3CTLA 1SW7A 3E49A 3MI2A 4WOZA 4UTWC 4JNMA 1GTEA 3DFPA 1A53A 2V8ZA 1F2JA 1ZFJA 4YXGA 5D05A 5KZDA 3B06A 3B04A 1BKSA 4JY8A 4LT9A 4MJMA 5AC8A 2YFNA 4JTEA 4BR1A 2GQ9A 1JCLA 5F1UA 5I3FA 1U83A 3CM4A 2C19A 1O5XA 1TCDA 2WV8A 3R8RA 4WD0A 3P8IA 3C2OA 2NXIA 3UPBA 1OFRA 1W8SA 3O16A 4A2SA 3W2UA 2TPSA 4AEOA 2J9XA 1VYRA 4PC8A 4WZHA 3ZWTA 3NQ7A 4JTSA 3ZR4A 2ZFAA 4Z1BA 2B4GA 2VKZG 1Q3NA 2RKXA 4EWND 1E51A 3OG3A 3L5MA 5G5IA 3GXTA 3TAKA 4YCPA 3TW6A 5FF0A 3EB2A 3WK3A 1LRQA 3W2MA 3W72A 2Y88A 1TSIA 3EWWA 1IIGA 3LI1A 2A5HA 3IRDA 3W7QA 3PB2A 4DF1A 3ATYA 3LRKA 1B3OA 3LHYA 3NQEA 4JDBA 3T7VA 1LZOA 3LXCA 1WAUA 3STGA 2WSYA 4LRTA 1FCQA 3CHVA 2ZYFA 4LVBA 4M6PA 4LS1A 4N2YA 3W73A 2UV8G 3E96A 4DELA 5AC7A 3W7EA 3HQ1A 4UIOA 4S2CA 4MPQA 1JUKA 4XTDA 3HGJA 1KFJA 3LHVA 4N4QA 1DQXA 3NVTA 5K4ZA 4O18A 1QAPA 1DJNA 2A7RA 3NYZA 4EF8A 5L9FA 5SWUA 1KM4A 2ZZ2A 3L0NA 4IOTA 3BG9A 2D73A 1OFEA 2FPYA 4P2VA 1LM1A 1SFLA 3BVJA 3GDTA 5TQLA 3W1PA 1QOQA 1JCYA 2NX1A 1KM5A 5LZLA 4DF2A 3MHGA 4QNEA 2RFGA 1MEHA 4FIRA 4RV8A 4JTIA 4WXZA 4JYEA 1DHPA 1OJXA 1Q6RA 1VCVA 5AB3A 2H90A 3N19B 3P67A 3LM7A 2VOMA 3KFTA 3W7HA 4UXDA 2VXNA 3NDOA 3DI0A 3EKZA 2E1DA 4BK9A 1QCWA 4C1LA 3AO0A 4HIBA 2WSRA 3L5LA 4O1BA 3C52A 4LVAA 1HUVA 4LY8A 4C1KA 1H1ZA 3C6CA 1GPWA 2NX3A 3W1TA 4IPIA 3LI0A 2Q3RA 1B9BA 3W7DA 4GXMA 1VPXA 3NQ8A 5HR7A 1K8YA 2FDSA 4DO5A 2OMAA 1YXDA 3MI6A 4GE8A 1RV8A 1M6JA 2WNZA 1SO4A 1NF7A 3CLMA 3G0UA 5D37A 3Q37A 2ABAA 2GVGA 2W79A 1XKYA 3UQNA 3GR8A 2FJKA 4LRSA 4IXXA 3LCLA 2WNNA 3QZEA 3A22A 4LS0A 1W54A 1JR1A 5AHNA 3IGUA 5KITA 4MLJA 3QRHA 1LROA 3GNDA 3STEA 3LBCA 1KLZA 4FO4A 3SR7A 1K03A 2RDWA 4LS2A 1W5OA 2YW4A 2WKJA 4UFLA 1ZAIA 1YPFA 1R30A 1IIHA 2H3BA 3S5OA 5FF2A 1OYAA 4CQ9A 3HG3A 1A50A 3CWOX 3UY8A 1LTDA 3SIZA 3CWNA 1I2OA 3NAVA 3W23A 1X8FA 3WK0A 3TAOA 2DZXA 2NXGA 1CX9A 4PA8A 4QIUA 2IQTA 4ZMGA 1YDVA 4ADUA 3GDRA 1SZFA 4JS3A 3NR0A 4K39A 3VKJA 4Z0JA 3W7PA 4BWLC 4NJJA 4PL2A 5CKSA 2LLEA 2CLIA 3GKFA 4AWTA 3QQ1A 2B7NA 1TQXA 1HFBA 1M5WA 2OX1A 1OF6A 1GQNA 3O8AA 4X3ZA 1GVOA 1AW2A 2C18A 4ONVA 4PH6A 4N9EA 3V75A 3B03A 3N2XA 2CU0A 5F2LA 1V5XA 5HULA 3M41A 3IIVA 5E93A 3UWVA 3MHUA 1EUAA 5DXYA 3C8FA 3LOTA 3P61A 1ZCOA 1JCMP 4PODA 5CSSA 3TFXA 2B0MA 1XDLA 1OK4A 3NQGA 3QPYA 4MY9A 3T44A 5KINA 2BXVA 3FLUA 1GYNA 1JQXA 3EXRA 3C2EA 4NJKA 1O60A 1KTCA 4MZ1A 1W37A 3NQMA 3W2LA 5C2XA 3NL2A 5D2YA 3IEBA 1TJRA 4M6QA 1PCKA 3UY7A 3RNDA 1YYAA 2NUYA 4HNTA 4B5NA 2O7SA 3PC0A 1GTHA 2WPBA 2NUWA 1DOSA 4FX8A 3G1AA 1NEYA 1KM3A 1KTBA 2YSWA 1X1ZA 4NU7A 1VHNA 3T4CA 4JDYA 4N6EA 4UTTA 3M16A 1IXQA 1HL2A 1K7XA 6TIMA 3GZ3A 4IMFA 3W2KA 3DFQA 3TXZA 3W1AA 4OWGA 4UTLA 4WJEA 1R2RA 3TUUA 1OFAA 2A85A 1VR6A 1FCUA 2BZNA 3G3DA 3SW6A 1TQJA 3TDFA 2BWGA 3ANYA 1C8VA 1SW3A 4FB7A 5CPNA 4KFNA 3NM3A 4JTUA 2VFEA 3F1QA 1ZAJA 3MJYA 4FNQA 5C55A 2HS6A 1SZEA 4R53A 3G18A 4MOZA 1TTJA 3ATZA 3RLVA 4NQ1A 3HGSA 3JS3A 5F2IA 1W0MA 3HG4A 5EYWA 3FKRA 2JKEA 2X2GA 2XN0A 1AMKA 1B4KA 1GG0A 1WDWA 2P10A 4EF9A 2Y7GA 2E6DA 1IXNA 3A5VA 3KVKA 3TNOA 1GVQA 3O15A 3C4UA 4ALDA 2E68A 3VNDA 3LERA 3UWQA 2DZUA 1NFBA 2QUTA 5GVJA 4O13A 4HSOA 4OGZA 2W0UA 3NQCA 1MEIA 4AMAA 3UWZA 3MYOA 3SGUA 5G4EA 5DN1A 3RU6A 3UZJA 5LNWA 3IIOA 3CB8A 2A6LA 3QMRA 3M5XA 2V82A 1DORA 2Y70A 3NL3A 5K3VA 5LNSA 4AXKA 1G7UA 3PG9A 3ABRA 5HUOA 4TMCA 5EY5A 3QF0A 2ZTKA 4WY0A 3W71A 4I7VA 5ABTA 5AC6A 2FB2A 1WBJA 1TREA 4YCOA 3WJYA 4YMZA 2DU2A 3P8JA 4JXCA 4GUJA 1VC4A 4H4IA 1FBAA 4UNKA 3UD6A 4E0CA 3MBDA 2XN1A 1D3HA 2FPVA 3GDMA 5MHBA 1VZWA 4E2BA 1ZY9A 3OVRA 1SU5A 2CLOA 1TV5A 3KX6A 5F4SA 3TMQA 5LHFA 1X6UA 2QCGA 2Y62A 2CZ5A 2ZRZA 1M7OA 5CPMA 4JTJA 3BV4A 3TQ0A 5FF3A 4IMDA 3G0XA 3PR2A 5HMSA 3PUOA 4ML9A 3T78A 2Y7EA 3PBVA 1PVNA 2ISSA 4YL2A 2X16A 4JTLA 5EBUA 4CCDA 1ML1A 4H3DA 5DBUA 3HOJA 4K8EA 2QCLA 1YDOA 1K7EA 3O05A 4CQ8A 1WV2A 4HKPA 3MUXA 5EKYA 4UTKA 3MP3A 3L65A 2GVJA 5D30A 4UFHA 3C2RA 1SZGA 2ISVA 1XCFA 3YPIA 2X1SA 5DCEA 5AHLA 1TRIA 1RVGA 1B57A 2E09A 4BI7A 1WBHA 3BW2A 3M9YA 2KZHA 3N34A 3PBUA 5J5DA 1RQEA 4NX5A 1P4CA 4UTWA 5D09A 1OFOA 4POCA 3S5ZA 3W7OA 1BWKA 3AJXA 1J4EA 1TPVA 1XBVA 2O7QA 2VFGA 3PBYA 5AHEA 4ZZ9A 1OX6A 5DELA 4A3UA 5D33A 3RF9A 3EX1A 3EWUA 3TW7A 4UR8A 4XKYA 2DZTA 2A0NA 3CEPA 4UTIA 1TMHA 5FEXA 2OJPA 1O94A 2A6NA 2NV2A 2Y89A 1I2RA 1H7WA 2TRSA 1S5TA 3B05A 1GWJA 2PRHA 5TIMA 2B7OA 3THAA 5HINA 4ZQRA 1H7XA 1Q6OA 4WXYA 1FDZA 5AYZA 3FEMA 1UCWA 4AHQA 3S6DA 3ZWSA 5AHMA 3TXVA 3P82A 2V5BA 3SSJA 1OX5A 1KBIA 1RD5A 1W5MA 4XWUA 1T0OA 1Z44A 5AHFA 1LOLA 3LTSA 3M5YA 1GVRA 3NG3A 2V2DA 5D2TA 1TTQA 1KBJA 2W6RA 1SW0A 3SZ8A 3QEZA 2A7PA 1M7PA 2R8WA 3SECA 3LRLA 1ADOA 2Y7FA 3WJXA 3NPXA 3W87A 3NQFA 1YLVA 4CNOA 3FIGA 2QCFA 3RK8A 2CWNA 3EX2A 1GZGA 2H3DA 3GDLA 3G1FA 1Y0EA 4FX7A 2XFWA 4MFDA 3B8DA 1H60A 2AAMA 4K8HA 3UXDA 2VFHA 3INPA 2CW6A 4IPJA 4FF7A 4O1CA 2ZA3A 3PVFA 2A2IA 4QQ3A 5K9CA 3P81A 4MLRA 1OFQA 1FUYA 4A2RA 4NJHA 1H50A 5BMXA 3NM1A 1SR9A 3S0CA 2RDUA 3GAKA 2VEIA 4O10A 4WX2A 3IIPA 3W76A 3VCRA 4TX9A 3UWYA 5C54A 2X1UA 4UFKA 4AVFA 2NWRA 5LKYA 2GQAA 3QW3A 1WX0A 5DCBA 2G96A 3IVTA 3MP4A 2QR6A 4JIPA 1LCOA 2V30A 1VS1A 4AWSA 5C6MA 3IV3A 4JYDA 3WJWA 3TU9A 4MKNA 2QUUA 4RZ6A 2NUXA 3HG5A 1J5TA 3HJZA 3P5YA 1K02A 3L0KA 1KV5A
chains in the Genus database with same CATH superfamily
3NQAA 4P61A 1EJRC 3BC9A 3GC2A 4HYVA 4HPXA 1CGVA 3L68A 5CG0A 1GZJA 2JKPA 5A3HA 4JX6A 4C6FA 4RE0A 4DJED 1HG3A 4H19A 3OHMB 1M7JA 3VOGA 3W4RA 3URBA 3DYMA 3GVRA 3BAIA 1M1BA 1OYCA 3O63A 1KA9F 3R10A 2PBGA 4K1GA 1RCXB 4DNHA 2FZ9A 4N4PA 3VKKA 3I7SA 4C90A 1QHOA 3LK6A 3TOYA 1NSJA 2BY2A 1OINA 3LV6A 1QNSA 4A05A 3LCWA 2ZZ5A 1TELA 1K7FA 2QV5A 4HZ6A 1KRMA 3HB9A 1PSCA 4ZE5A 3S47A 2QQ6A 3PULA 5G2HA 5LXXA 1THFD 3N3TA 5I0DA 5A8GA 2G41A 1XPYA 3CU2A 4BJHA 2WWDA 2VL4A 2GGHA 4GCAA 2YXGA 3LCGA 1G94A 1N8WA 2VEKA 3T81A 4G2DA 3GXPA 4NAEA 1Q8AA 3LZ3A 1K77A 2QDHA 4UQCA 3BQ6A 2XIBA 4C6BA 4HNVA 3RMJA 1J10A 1TVNA 3BCFA 4JOMA 5HOSA 3TE9A 5DY2A 3DKJA 2OEMA 4IUOA 3TROA 3GWQA 3JRKA 3OP2A 2XIJA 4H6EA 3V0UA 1I4NA 3A24A 1R0MA 3DBNA 1EC7A 1ONRA 3FW6A 1TJ0A 2ZRYA 3ITGA 3UT0A 1KXQA 5ABHA 3TA9A 4JD4A 1LT8A 3LMYA 3W82A 4AZBA 3ARVA 1EZWA 2PURA 2WBKA 1I0DA 1YBQA 2VVSA 2ZWYA 4C91A 2XFFA 2Y24A 4FIQA 4HN4A 1J93A 3NIYA 4NKCA 4MB1A 1H62A 3K13A 4IGHA 2XM1A 1PTAA 3NA8A 3RLUA 5DF0A 1TTPA 3OVGA 3NZPA 4H9UA 4AZ5A 5I3IA 1PYFA 1BG9A 2VC5A 1UZDA 4DXVA 2QCDA 4D6GA 1YXYA 2D3LA 2ZBTA 1RK5A 2X09A 3MV01 2G4JA 1MW2A 4OTKA 5FAGA 1B2YA 4GINA 3GHTA 4IMCA 2Z6JA 2BOEX 3F2BA 3C2FA 1JD7A 3WDPP 1J0ZA 1EJSC 2C15A 1XICA 3W27A 3GDBA 1TWIA 1JPIA 1W9PA 1TV7A 1TPEA 3HPSA 4QXIA 3KBJA 5TBOA 1KM2A 2J7DA 3RRAA 4DEFA 1C90A 2A3AA 5A2BA 4CNNA 2J62A 5CZJA 1MWOA 2FGZA 2HE8A 4GUHA 1FQ0A 4PB4A 4NSBA 1XKJA 1OK6A 1A3WA 3DG3A 3B0PA 2XGZA 2YDAA 4Q8UA 3TR2A 1BPLB 1E0XA 2XVPA 4DJFC 3T0BA 1TPC1 3D0CA 4PE8A 2PGFA 4MZYA 2XVKA 1HL8A 3GDKA 4AIBA 1RZMA 9RUBA 3AYSA 1DQUA 3U2OA 3GVGA 1UASA 2QJJA 4XAGA 1KFLA 4HJFA 2VX7A 5E1QA 1L6FA 1E71M 1XLBA 1SM9A 2CCRA 1FWRA 3MKVA 3RYSA 3WLMA 1E1CB 5D8ZA 3AHXA 1V02A 3O0KA 2W63A 5LGZA 3PZ9A 1SPQA 4AIOA 4G7EA 1M3UA 2FDMA 3FAWA 5FJPA 3N11A 1X7FA 1TMQA 4X2PA 4IG2A 5LGXA 1SO6A 3IACA 1ISWA 5CLWA 4AD3A 1Q6LA 2VGFA 1XD0A 2XH4A 3ZS4A 1S5WA 4YLWA 2GGIA 4ZB5A 3N2MA 2PDUA 3VNKA 4MGGA 3ITOA 1G4PA 3UCCA 4XBKA 1TV4A 2BDQA 1H11A 3B4YA 1TKKA 3GY1A 3POCA 3R13A 3SCOA 1QO5A 4Y9AA 3WQ4A 1M65A 5AKQA 2QMJA 2VFIA 4OZOA 1VCFA 3UFYA 2VC9A 4RCXA 2ZX6A 4GJIA 3BCJA 3SY5A 1PCWA 1CLKA 1O68A 3LM3A 3WMSA 3VOJA 4JEJA 4GNVA 1IZCA 1ZJBA 3HPAA 2WSQA 1XYBA 3KRUA 5I3GA 1GORA 3M0MA 5BXPA 3QH2A 4MNMA 1OCJA 2I1OA 1MYRA 3FY1A 1W56A 3QC3A 3UP8A 3WO8A 1F5ZA 2Z00A 3A23A 1Z3NA 3W1XA 1O5KA 1G4SA 4HB7A 3O7UA 1XRSA 3E0IA 3PJXA 3OBAA 4GABA 3PAJA 3ENLA 1F73A 1UJPA 1FKXA 2XIQA 3E5BA 1BAGA 2E7FA 1HO4A 4PCFA 1W91A 4NJGA 4GVIA 4E3VA 4X9SA 5AZ1A 5EMKA 2VC6A 4TR9A 3WN6A 2TMDA 4S1FA 4ACZA 4NAEB 4AZHA 3DH7A 1K4GA 3SCQA 3UZXA 1LG1A 3PUGA 4HU4A 2WJZA 2PRLA 1VYSX 5A6KA 1W3KA 1KBLA 3RJYA 1Y7VA 3PZNA 4GUIA 4LTSA 1ZP3A 4PEEA 2W4XA 4LGXA 2G3JA 5BW6A 1OFBA 1RLCL 2OEJA 4ZQOA 5B80A 1J2BA 3CNYA 4IL2A 1S5VA 3PUDA 3W7MA 4P7OA 4X0VA 4UCFA 3CJPA 2VDHA 2BGSA 1EIXA 3LD5A 3G8RA 2NQ9A 2XGBA 2YIHA 2YFOA 1JYXA 3KRBA 1YBQB 1XP3A 3LHZA 5E9AA 4XSMA 1R87A 2B81A 1A5OC 4TTUA 1SFSA 4UMAA 2E9MA 3UA3A 1GG1A 1BVNP 3LGDA 3G22A 2OT0A 2L5HA 3ANUA 4P7RA 2NQJA 3GIQA 5FESA 2I57A 3EOUA 2QCDB 1F05A 2BY3A 2D2HA 3HV9A 4EWJA 2F61A 3H2MA 3GBEA 3A9IA 4PRRA 3CHCA 3U9IA 1AFSA 1OADA 4QROA 2WQPA 5CBBA 5FIPA 1EDGA 5GQBA 3R2GA 3VCCA 1QHZA 2V5CA 3T07A 3O06A 3HGRA 4IP7A 5H2ZA 5A94A 2CPUA 3SN1A 4HA4A 1RLDA 4IIHA 5T91A 3GLCA 4LBSA 1KM1A 1DHKA 3FJ6A 4O50A 5DBTA 3TQKA 2ALDA 3TLQA 2Z1SA 4XUGA 2XFRA 4L9XA 3WJSA 2BHZA 1V3LA 4KBXA 5HA7A 1WOAA 1E6RA 1SMAA 2WJDA 4QM1A 7REQA 2X0YA 4E4UA 4K7VA 3QV6A 4CQCA 1L6YA 3T0TA 1XRTA 4ZQMA 3IVUA 3MV11 4Y9OA 1BEUA 1R86A 1GVEA 1CIUA 5K2ZA 3RG6A 3OLEA 4W84A 3PZTA 3WLIA 4EKJA 4U3CA 4H9MA 2C3ZA 3AYRA 4QP0A 3FJLA 1TWSA 1UB3A 1UUQA 3FA3A 4ZQNA 3LCXA 3N14A 4AIUA 4QITA 4JHOA 2F9RA 5FKYA 2Z25A 4H9ZA 5A6BA 1PUDA 3GXNA 4B5SA 1CXKA 3NTYA 3WDQA 4FAMA 3OGSA 3KBVA 1XUZA 4QQUA 3TX9A 1OGSA 3H2OA 4XVEA 1P0KA 1YMYA 1WAWA 1S5MA 1OF8A 1XCXA 4QTGA 1Q7ZA 2J88A 4QAIA 4CVWA 4I9MA 2E5BA 2PF8A 1TPH1 4UQEA 1P0DA 4WQ6A 3CO8A 1RBOB 4LY4A 2J6VA 1FP8A 4F66A 4IXHA 3EA1A 4FP1A 1LLOA 1YTDA 1XC4A 3TFCA 2ATMA 1VENA 1OD0A 1VH7A 1EL3A 3FCPA 3LGEA 3VD4A 1GW9A 4DX3A 4G7EB 3GNNA 2VUYA 3QXBA 1LLZA 1DQWA 3GFXA 3LLDA 4AD0A 3BICA 1R3QA 4IG2B 3OU8A 3PWGA 2CKSA 2IXUA 2FYMA 2V0TA 4NILA 4PTNA 4B4HA 3RFAA 3SGZA 1UZ1A 4O8RA 3PAOA 3H2CA 3TR9A 3KHDA 2X41A 2YJQA 1FWGC 3EBVA 4CU6A 4JX5A 4LAKA 4U2ZA 2QCCA 3MZNA 1VJIA 2PDBA 3SN0A 4NAFA 2Y1HA 3WDRA 3CYVA 4G1KA 3LNMA 4YWIA 1I1WA 3T0DA 3N2BA 2OZ0A 3V1HA 1GQIA 2NZLA 4K36A 1TR9A 4B2DD 2WLZA 3R0UA 2JGQA 2X8RA 3DOPA 3QBUA 3GU9A 2FVKA 3E12A 1GW1A 1KFCA 4ZTYA 1L6SA 2CLEA 1GJPA 3TA6A 3MHFA 3C0LA 1JDAA 3W86A 2WJEA 3PBGA 4N02A 3VK5A 1Y5WA 4DUXA 2ESCA 3EB4A 5AVHA 1AL8A 2UY2A 3UNTA 3R0KA 1U22A 2VCBA 2EPNA 4NT0A 1A80A 4AWUA 1XV8A 3VGFA 3POHA 3KEHA 4XZWA 3W9ZA 2PFHA 3CAVA 3NZ1A 2CERA 2ZZ7A 4ATWA 3BXWA 4JIQA 1PV8A 1FH9A 4PCNA 3ABXA 4Z2GA 3RJXA 4AZCA 4L65A 5T9CE 1IE7C 3H55A 1QR7A 3RM8A 4FNRA 4E38A 1FDYA 3WUGA 4XO7A 2JBMA 3WLRA 2CYGA 1XINA 2PDHA 3BG3A 1CGXA 1K8ZA 1QFEA 4KEUA 1JIBA 1BXNA 2PTXA 1Q8JA 4MWAE 3ERPA 5HJLA 1JPMA 1J79A 1YPIA 5CAHA 2GVEA 3W7RA 1IZJA 3L66A 3HPXA 1EX5A 3VDGA 1R46A 2DUXA 3M43A 1DVJA 4K7YA 2ZRXA 2P3EA 6PTDA 1H0GA 3C8NA 4J3VA 3ALFA 1MDLA 3QQ0A 2PDFA 2ZRVA 1W5PA 4XAPA 1M03A 2BOGX 4Y2WA 5IBXC 4YTSA 1QNQA 4H7VA 3UETA 3HA1A 1V6WA 3PZMA 2VENA 3IVSA 3Q2DA 3W22A 2XUCA 1GQLA 3LHUA 3PM6A 3H24A 1FVPA 1EC8A 4NI3A 2J78A 4KETA 2J7GA 4CCEA 4CQBA 2EJAA 1KM0A 3AJ7A 5XIMA 1S2CA 4DWDA 3CPRA 2VDIA 3USBA 4L9YA 3KBSA 4ZOEA 4N9DA 3HV8A 1ENUA 4EOUA 4AC1X 1TR1A 2C71A 4RZ4A 3DU0A 2FZ8A 4WSKA 3GNPA 3WLPA 2JF7A 3DAQA 1XQKA 1O12A 2Z2AA 4A3HA 1ZALA 5DRCA 3AI0A 2Y5JA 3T40A 3E0WA 3T42A 3UJFA 4B9ZA 5JBEA 2BHYA 3ITXA 4R27A 2ZXQA 1RBAA 1FXQA 7REQB 2AMXA 1JNDA 4K3ZA 3TSBA 2IKJA 4HA3A 3VNLA 3MMWA 3FYYA 1R2TA 4C6DA 3G2GA 1FWBC 1QOXA 5T8GA 3NQ6A 3KOWA 4LAZA 4M81A 3R94A 5JH2A 2A7NA 1LORA 2FZMA 2OZ3A 2OSXA 4GX9A 2VEPA 1FHUA 1KFBA 7ENLA 5FL0A 3GVWA 3LTYA 5CPOA 4JEQA 1ZJIA 2CXEA 4AAJA 1D8CA 3E2RA 1MUCA 3G1SA 4P8UA 1AZ2A 1RP9A 4K38A 4NYYA 1LP6A 3V1PA 3BW4A 1F74A 3TJLA 4DF0A 2EBNA 1ISVA 3W88A 4O53A 1IWAA 5HNRA 3AXXA 2OXNA 2Y85A 5HATA 1U5HA 4GISA 4QJ4B 4HOZA 4CN4A 4EPKA 3I6EA 2X40A 3QV9A 2VM8A 4BQ4A 5G1MA 1IGWA 4M5PA 3MO4A 3ELFA 5EB8A 1EWDA 1WYIA 2DSKA 1J01A 4WGXA 4LUYA 1VFOA 3ARQA 2I5QA 1G4EA 1WE5A 3H70A 4L4LA 1J18A 3CPGA 3MUAA 5AYYA 4KGLA 1PB0A 2HXTA 1BSLA 5G1TA 3MO7A 3WH5A 4IIDA 1FWSA 3BGJA 4D6JA 3BLPX 3WBYA 2DZWA 3KBNA 4LOCA 1MZRA 4S39A 2ICSA 4C6LA 1E0TA 5DMYA 2V2CA 4NAFB 1FRBA 2A3HA 1MW3A 4W89A 2PDMA 3S1UA 4IMGA 1E9YB 3TV8A 4B91A 4I6VA 4EK7A 1S1RA 3PTMA 4E5TA 2CEQA 1BGGA 4UBPC 3B40A 5AYXA 3L9CA 4IWWA 3AIWA 1OT1A 3MANA 4IX0A 3P6LA 1MRQA 3B4UA 4EXAA 5AC4A 4HMCA 1I2NA 1JFXA 3KDOA 2D20A 1QI5A 1EO7A 3NCOA 3SIMA 2V6AA 4FX6M 5REQA 3MPGA 3OIXA 2QJNA 2ZX9A 1G7VA 4W88A 1UP0A 1W8GA 3CTLA 5B7ZA 1QI0A 4B16A 4ICCX 5AECA 4LFYA 1SW7A 1UQYA 3LN3A 2E3ZA 2V8ZA 4PMXA 4J2PA 3SM0A 5KZDA 4EXBA 1ADSA 1TX0A 2J13A 3B04A 4YHGA 4FALA 2VD9A 5I3FA 3CM4A 3L4VA 3R8RA 1TCDA 3KL5A 4WD0A 3AQUA 3C2OA 2NXIA 2GGJA 3O16A 4A2SA 5DQPA 2TPSA 4AZCB 2J9XA 3KOYA 3TJ4A 3WLNA 1ODUA 1WDDA 3ZR4A 2ZFAA 1J0HA 1Q3NA 2ACSA 2IPWA 4WSJA 4AIEA 3OG3A 4IMAA 3M64A 4QS5A 5FF0A 3EB2A 1RJRA 3W6MA 1HJVA 1ZJHA 4JN8A 2HZGA 3ARWA 2INFA 3ZVIA 1QBBA 4D6FA 3WLHA 1RP8A 2A5HA 3W7QA 3TOPA 3LRKA 3VOIA 1XLKA 2AGTA 3NQEA 4JDBA 2QGHA 3ZYZA 5LXEA 3STGA 4BHYA 1FCQA 4DZIA 4LYKA 3AIEA 4MB3A 3W73A 3N17A 4DELA 5AC7A 3A3XA 1UD4A 2R82A 2JEPA 2DH2A 3KLKA 3HGJA 3NO1A 3LHVA 4GI6A 3NVTA 2W92A 1J0YA 3QPEA 3WEZA 5I06A 2A7RA 5L9FA 2BGQA 4HZ8A 5SWUA 3E3HA 2ZZ2A 2JIEA 1OFEA 3PPFA 5HANA 2FPYA 1WKFA 1LM1A 2AKZA 5TQLA 3SBFA 4WJXA 1JCYA 3THCA 2DPEA 2TAAA 1E6QM 1KCZA 2HISA 4FIRA 2DEPA 2HNEA 3N25A 2WJFA 1OJXA 3P67A 3KFTA 4UXDA 2VXNA 3NDOA 5ECVA 4M1RA 4O1BA 4JQ4A 1S2UA 4C1KA 4WLCA 3BLDA 5A8NA 6CGTA 1VPXA 5HR7A 2QVHA 4D8AA 1YXDA 2IKGA 4GE8A 2ACQA 2I5GA 1SO4A 1AD1A 3U2CA 1FFRA 4PB3A 5A8PA 1US2A 1KFWA 3DC0A 4O0QA 1FHLA 3KCOA 2ZX8A 3PK7A 1RY8A 4L80A 3UQNA 2FJKA 5D9MA 1QU4A 4C6PA 2VR4A 3T0CA 1CZ1A 4RE3A 4YTQA 4IL0A 1JR1A 5AHNA 4GX8A 2NQZA 4MLJA 3QRHA 3VNZA 1LROA 2YXOA 1JYVA 4PMZA 3SCRA 1C8YA 4FO4A 1K03A 2XWEA 4LS2A 1VB9A 1W5OA 3HFYA 4H8HA 2CHRA 3S3GA 1V6UA 2DDXA 1E0UA 3N6JA 5FF2A 1EC9A 3CWOX 4J3UA 1LTDA 3HM7A 4GYPC 4HHMA 1WPCA 3WK0A 3NZQA 4IM4A 3PJWA 3TAOA 3VXGA 5BZAA 3KWSA 3TZFA 4PMQA 3GDRA 3XIMA 4K39A 3VKJA 2IQDA 1UOZA 1ZCCA 6REQA 2LLEA 2CLIA 3GKFA 2XINA 3QQ1A 1M5WA 2OX1A 2WB5A 3QC0A 4GIRA 4JIEA 1GVOA 4ONVA 2BG5A 3KZSA 5I5RA 5F2LA 3VUSA 1FFQA 1LL7A 4HU0A 1XDLA 1OK4A 1KCKA 3AU2A 3M6DA 3WNKA 3C2EA 4E2VA 5F7UA 5AC5A 5H8PA 3ZM8A 5D2YA 3K8MA 3OTRA 3IEBA 1TJRA 1R85A 1PCKA 4GACA 4UB9A 3UY7A 2NUYA 1V51A 1GOQA 4HNTA 3BJSA 5HNNA 1BQGA 3SCWA 1EGZA 3PC0A 4FX8A 1W2VA 3ZR5A 3G1AA 1KM3A 1KTBA 4XG1A 2YSWA 4BQ5A 1X1ZA 5HMEA 5REQB 2WSPA 1IXQA 1HL2A 1K7XA 4LH8A 6TIMA 3TXZA 4UTLA 3B3DA 4J3WA 4DLFA 2AAAA 3U2EA 1FCUA 3G3DA 1BF2A 1T40A 3WH9A 1C8VA 2G8ZA 4FB7A 4KCVA 5CPNA 4KFNA 1ZAJA 3L12A 3M0LA 3KDNA 4ROPA 3RLVA 1W0MA 3T05A 2VHLA 3FKRA 2PGWA 1B4KA 1VKFA 4MMWA 3ES8A 4AQLA 4X63A 3LZ5A 2NT0A 3B9AA 3IK2A 5KZ6A 3C4UA 2PWHA 3R79A 1NQ6A 3VNDA 1EPVA 2WHKA 1NP2A 3CUJA 3CUGA 4MB5A 5GVJA 1JCTA 4O13A 1GYMA 1QJWA 1MEIA 1A5KC 3GU1A 3TNBA 4JIHA 3CPUA 4E8CA 5DN1A 5HK4A 1OCQA 3UZJA 1R6WA 3CB8A 1FWIC 3L7RA 2Y2WA 1HJXA 4OJYA 5K3VA 3ABRA 1Q13A 5EY5A 1UG6A 1CGWA 3CQKA 4XAFA 4LEFA 5AC6A 1WBJA 4PTVA 1VP5A 3P8JA 4CD5A 4DJDD 3EDDA 1E6NA 5EU9A 5MHBA 1D3HA 1US0A 4F2BA 4B90A 3R43A 2BV9A 2E8YA 2Y62A 2ZRZA 4HU8A 1M7OA 2XZ7A 3S4TA 4JTJA 2PD9A 3BV4A 4WJ8A 3TQ0A 4QG8A 3SQSA 3PR2A 4YPJA 4JKKA 3HJEA 1GEHA 1SJAA 2X16A 5EBUA 4B92A 5DBUA 4ENLA 1YDOA 1UKTA 1BXBA 2CC0A 4CQ8A 2C1IA 4HKPA 3N2CA 1WV2A 4ZA0A 4UQ9A 3FJ4A 1PTDA 2X7VA 3MP3A 2D2GA 1XCFA 4AY7A 1Z89A 2E09A 3T09A 2CLPA 1WBHA 2DT1A 2KZHA 1S39A 3N4AA 1NOFA 3PBUA 5J5DA 1RQEA 3U0HA 2Z1VA 3S5ZA 3AJXA 1TPVA 1XBVA 2GGGA 4X60A 3PBYA 4ZZ9A 1OX6A 4GQBA 1UR9A 3EX1A 4MM1A 2R1LA 1JXJA 2O9PA 1DJWA 2CBIA 4XKYA 3QZAA 2DZTA 3SCNA 1W1PA 1W3HA 3CEPA 4UTIA 4DB7A 5FEXA 5C71A 4F8XA 2E25A 1CGYA 2WCAA 3SSZA 2A6NA 2WMKA 2Y89A 4URIA 3SCPA 1S5TA 3H6OA 5E5CA 3THAA 4ZQRA 4CNTA 2W61A 5AYZA 4JFUA 2OQYA 4WKHA 3FEMA 2F2HA 4D1IA 5CEWA 2O9TA 5AHMA 3P82A 2V5BA 4XWUA 1T0OA 1WDSA 1MW1A 4NG3A 3FVDA 1TTQA 4ZTXA 2A7PA 4DWSD 2JIWA 2WYSA 3WJXA 3NPXA 4HN8A 2XHYA 4QDWA 2ZWZA 4TVCA 5EFFA 2BHUA 3EX2A 3KOZA 1GZGA 4H04A 3GDLA 1Y0EA 3QFWA 4FX7A 3AIVA 3Q67A 4RDVA 3TTOA 2ZC1A 4KW2A 4HMNA 1WKDA 2W62A 4S3GA 4K8HA 3UXDA 4DZAA 6REQB 3PBMA 2HXUA 3BAXA 4A6GA 3BURA 3PVFA 4QQ3A 4Q4MA 4QLJA 4HPNA 3S2NA 1P1MA 3N04A 3Q45A 1LQ0A 2GDVA 4DXKA 4CU8A 5J04A 3PPGA 4PCSA 1EBHA 4W8BA 1SR9A 3RX3A 1OG6A 3S0CA 2R1PA 2VEIA 3ZMRA 2ZXBA 2XYLA 1I75A 1QK0A 3MDUA 2VR5A 2P8BA 4TX9A 5C54A 3VOFA 1ZPTA 4UFKA 4AVFA 2NWRA 2GSJA 4M82A 2GQAA 3QW3A 1RA5A 3QHNA 3VD9A 2VWSA 1PKYA 3UERA 1K8CA 3W6LA 2V30A 1GJUA 5C6MA 3TU9A 3MCMA 3WF1A 3IS4A 4RZ6A 1F61A 3HG5A 1TCMA 3BTNA 4R9OA 5A8MA 1JFHA 2QJHA 1GQKA 3K4DA 3VMPA 1QOPA 5D02A 5KEZA 2EF9A 2GJRA 1XYCA 4DVOA 1EB3A 3IAPA 3VGGA 4AWEA 1JAKA 2JGYA 4OQVA 4H8UA 5DY3A 5M03A 1HKJA 4K6AA 2DZVA 2QPUA 3EMZA 3BJFA 1EGMA 4GYFA 4BI6A 3W07A 1GONA 3E02A 1SR0A 4MNJA 2QJIA 3GW0A 1YDNA 2CLKA 2AGKA 1Q85A 3BAJA 3A4AA 3GR7A 4PUDA 1GHRA 3ZOAA 4KT2A 2QJGA 4XVDA 2Z24A 4W7VA 2ZUTA 1F3XA 1EJVC 4NZ4A 1G67A 3AC0A 3M47A 4GUFA 4EX4A 1R9YA 1XYAA 1V4YA 4LCSA 3WH7A 4GI8A 4H00A 3G1VA 3PJTA 2CFFA 8A3HA 2GQ3A 1BWVA 3DN5A 1EJTC 1N2VA 4J1OA 5BXSA 4JHZA 3GNRA 4O0KA 1VIZA 5E09A 3C56A 4UQDA 5KTLA 5C9UA 3QYQA 1JRCA 4GYPA 4JPGA 4OECA 5DT5A 3TN5A 1TFVA 2ONEA 1S2TA 2E1WA 4KFPA 3I3BA 3M44A 4XD6A 3QGAC 2BVDA 1TZ7A 2FVMA 4D71A 2BFGA 3GH7A 3LB0A 4Q8NA 4A8LA 4OVXA 4I7WA 3LCIA 4UQAA 1LRTA 1E4LA 1MEWA 2OG9A 5U4NA 2OQLA 3QM3A 1W3IA 3G77A 4GKTA 3M1ZA 4AH7A 1EJWC 3NPVA 2Y0FA 4CNUA 3GIYA 1IGSA 3MCNA 2R1NA 2RUSA 4H83A 4FA3A 1B3XA 3H21A 4X61A 1HKVA 4Y90A 4JYFA 5HWJA 1E72M 1HT6A 3UXIA 1UUOA 3RGTA 1VAHA 5CGMA 3U7VA 2C1GA 3GTXA 1QRQA 4JTRA 3CQJA 3M5ZA 4DBEA 3LCFA 3N9RA 3EWDA 4PGLA 1B4EA 4TU1A 1XFBA 3MBFA 4QSHA 5FF7A 2BB0A 3OBKA 1Q66A 4IQLA 4JFTA 2YCKX 3ITCA 1EOKA 1CENA 4O28A 1PAMA 1NM9A 1AJZA 3BAKA 4DUWA 4ZVJA 2X1TA 3AXIA 5C8BB 3BOLA 1SSGA 4RDWA 1T96A 1ISYA 4DBWA 4ERGA 4G56A 1I60A 1NJJA 4L9ZA 3GU2A 3LXBA 1GZ1A 2F84A 1KQZA 1S2WA 5HNUA 1PXGA 3SFKA 1RJPA 4H8VA 3NPWA 4QJ5B 4XKYB 3I6TA 4FXRA 1SO5A 3AUJA 4PMJA 1YE4A 4BCEA 1D3GA 3EOLA 3U48A 1YHTA 3T2OA 1QWGA 1XIEA 1B5TA 3IUIA 3MMDA 1Z69A 2PDJA 3B9NA 3BSMA 3R7MA 1A5LC 3R12A 4JICA 4WK9A 3SCVA 2D1ZA 2Z7GA 1EO5A 2AL2A 2FKPA 4OBSA 5CG7A 2OT1A 2Z7KA 2OYLA 3STFA 3RPDA 1AG1O 3W2JA 4UFMA 2PWVA 1S2VA 5HUPA 3TK7A 3SAZA 2UWFA 4CLMA 2BLEA 3EWYA 1ZBKA 1ZJAA 3K30A 4F4RA 4HOXA 4FR1A 4DPPA 1A5CA 3N3MA 2Y4SA 3S9ZA 1AMYA 2GL5A 3IK4A 4RXGA 2OELA 2V9DA 3KOFA 3MWAA 1XD1A 3AYTA 1PDYA 4LC6A 2CXGA 4FNSA 3DG7A 4Y8FA 1ECQA 4JTTA 3ZIZA 3WNOA 3EKLA 4HP5A 5KZEA 1ITUA 4JHMA 5FL1A 3IJDA 4GRSA 3G0SA 5D8WA 3N12A 5DXXA 1T6MA 3DUGA 1LF1A 2EEXA 3ITLA 5D38A 1I45A 1PKNA 4XTIA 4HYRA 4NVTA 2J7FA 1XL9A 1ITQA 2E5DA 2PEVA 3TN3A 3ZZ1A 5M5DA 3P62A 2JALA 4C7GA 3PWIA 3EPOA 3CQHA 4JN7A 1KRAC 4O1AA 3W7KA 4B5WA 3ZJ6A 5G2WA 5BXTA 4AD5A 2VZOA 2YCJA 2C6QA 4WOQA 1QDSA 2FIQA 1XH1A 4AYGA 1X38A 4NI8A 1O5RA 2E6YA 3H4WA 3WK1A 3AIRA 2H9AA 2V63A 3O1NA 2RDTA 2H6RA 4MTVA 2NT1A 4WF7A 1XLAA 4ZQCA 3D6NA 3HQPA 1AW5A 1OQFA 3RDKA 3N4FA 1OZQA 3REQA 4H2HA 2ODOA 3WUEA 4D6CA 3H23A 1UR3M 3OLDA 4YHEA 1QW7A 3F5JA 3GC5A 5I3HA 4AISA 4JTDA 1T41A 4AVNA 1JCXA 1KCLA 1DTUA 5K4XA 2DORA 1DWFM 1LL4A 3E0LA 4M24A 1F4HA 9XIMA 3C0JA 4ZO7A 3KLLA 2ZRUA 1LBFA 5JXQA 2QLYA 3GBDA 2Z1BA 3TYUA 3DFOA 1V3MA 1TE1A 1GCYA 3BOXA 2XVLA 4KGJA 3CS2A 3WBXA 2DUAA 5HAOA 4US5A 4WRHA 3S2CA 1DPMA 5L6UA 3TQVA 4RJEA 1AQMA 5DLCA 2VVNA 3B0VC 1TIMA 1XG3A 4OOZA 3G1YA 5E6ZA 4W9TA 3SUWA 3M0JA 4LAMA 3PF3A 3UJSA 1QPQA 1JDCA 2ZA1A 3RAOA 1SUXA 3CC1A 3DHFA 3RO6A 1BSIA 1IEQA 1RUSA 1HO1A 4GQQA 4GOAA 2GZXA 3QOKA 4UZUA 2C0AA 2V69A 3MVTA 1B31A 1PX3A 3EEGA 4P8XA 1V6VA 2JQXA 1BF6A 1F7BA 2ATSA 1A4MA 3ISIX 2QKFA 2QCNA 4TIMA 1O5QA 3VZZA 4OV4A 3QZ6A 4UMCA 2EKGA 4HHPA 1MQPA 4HCHA 2C16A 1OZMA 1PZ1A 1E56A 5DX7A 2WMJA 3W7LA 3RMEA 3CZ8A 4O57A 4LVFA 3A21A 2WMGA 1XFCA 2P3ZA 3U5UA 2QT3A 3QMTA 4B5XA 1OGBA 1QXLA 3W81A 3PPHA 2FHCA 5E9XA 4PMNA 1H41A 3KVMA 2A3LA 3THUA 2CIPA 2I9EA 4F79A 3QR1A 2ZRWA 3HQOA 4PUJA 4RZBA 4H7CA 2G50A 2OZ8A 3G8EA 1X1OA 4V28A 4QJ1A 4X0NA 1UD6A 2P0IA 3PWAA 2PDIA 4BI5A 2P0OA 2NX9A 4U31A 2PWUA 3M5VA 3QTGA 4M19A 4PR4A 1E73M 4Z42C 2ZA2A 4LUSA 4PYSA 1PHQA 4U4MA 5HDRA 3W1QA 1CLVA 1EYEA 1EP3A 2FPTA 2TYSA 3QTPA 1VD6A 4E4FA 2TSYA 3PG8A 4Y96A 1TX2A 1AH4A 4HK6A 4TVUA 3OA3A 3DFSA 2EAWA 4MB4A 4RLIA 3S5YA 2AL2B 4PRTA 2FB3A 4F3HA 3IUHA 5C9XA 5C7HA 3VFLA 3R1ZA 3CQ0A 3FDGA 2YPIA 1V79A 3HN3A 1TUXA 1H49A 4A29A 3VOCA 5A6JA 3P0XA 4GBUA 1KKOA 4Q4QA 2X0HA 2PE4A 3NGJA 4LW7A 1CB7B 3L2MA 2V38A 4NZFA 1H1YA 4JIRA 1Q6GA 4B5VA 1V3HA 4GLEA 3IJ6A 3W7CA 3WBEA 4NXSA 4DO4A 3KRSA 3MZ2A 4L4OA 5F1VA 2WWCA 2O9OA 2I9UA 1UD5A 3NYDA 2INZA 3NDZA 4H8NA 3UG3A 3VGHA 1XWYA 2C14A 4L1GA 1UH4A 4CQAA 4AU0A 2VZTA 1Z41A 5GNZA 4W8LA 3HURA 2W66A 3NZRA 4GFIA 1C93A 5IM51 3TYAA 4FPSA 1FX6A 1K6AA 4UC5A 4YS1A 3NNTA 3RPTA 5HWMA 3WNLA 3BDKA 3NL5A 1Q5MA 4GC3A 1NWRA 1MSSA 2Q09A 1AJ0A 1KGWA 1O1ZA 1SMDA 2YX0A 4S3DA 3AALA 1SFJA 4OHQA 4XISA 3SRHA 5LNVA 3LLFA 2RDXA 4I5UA 2ADAA 3TYEA 2H9AB 3CUIA 1FWNA 4DAIA 3W74A 1KCXA 2QF7A 3S8HA 4O1DA 4OUIA 3QSTA 4Q33A 1TRDA 3W84A 5EA9A 2Z6IA 3SO7A 3GH5A 2J66A 3VGBA 3NSNA 4KH2A 1ZGDA 3S1XA 4GNKB 3REQB 1JAEA 1DKWA 1KC7A 4ORIA 2F2KA 1Q6CA 1GOIA 4O14A 4O12A 4D8ZA 3BANA 3P84A 3DEQA 5A5WA 4CN6A 4BA0A 3BZGA 1XLGA 4CD7A 5E70A 3RLGA 4AY1A 3V4BA 3PZIA 4DAFA 5G1YA 2RJGA 4LYRA 3VKAA 3LTPA 4O16A 5CPSA 3CIXA 4LB4A 4O17A 1PX4A 1ZP4A 2WXDM 3B9DA 4O11A 2DSVA 1V8EA 1YTKA 2W3ZA 4MZ8A 4IIFA 5DMNA 2G37A 2O55A 5GNYA 4ZOBA 3W1LA 1ITXA 4XAYA 1V0MA 4J7RA 3AS1A 3WLKX 4IH3A 1XDJA 2Y6ZA 3TTYA 2GWGA 2G95A 2DFAA 4ZXOA 4DNMA 3L4XA 2FTWA 1H5YA 4Q8TA 1Q6QA 1G6CA 1QPNA 1PZ0A 2ZUUA 5K7JA 5CJMA 1H7RA 2V2HA 3T4WA 3PY2A 1XLIA 3GXIA 3WCZA 1O66A 1TA3A 3BARA 1HP4A 2DT0A 1IXOA 2I56A 2DVTA 3HPZA 3FJNA 4MIMA 3H54A 1XIBA 3UCQA 2GK1A 3CZJA 4US6A 1EWEA 2AQWA 4L1WA 4L4MA 3WF3A 3M4HA 2AMGA 3DHUA 1AQFA 3TN4A 2A1YA 4S2BA 1NDZA 6XIMA 1VEPA 2PDNA 2UBPC 1KM6A 4FOUA 4Z2LA 5LIWX 4UTJA 1LOSA 3KBMA 1UWSA 5CAKA 1KFKA 2Z4GA 2O0TA 2QDDA 1W9DM 3EPMA 2JKAA 3S6TA 2QVNA 4BZYA 3UGVA 2GUUA 4QGCA 1XBZA 3ZT7A 4MNKA 4V1YA 3PTQA 4L6DA 5F4WA 2QUVA 3KVLA 1XLJA 3H7RA 4H6KA 2RGLA 2BTMA 2VRKA 1G69A 1P0BA 2NSXA 2C0HA 1I2QA 3NEVA 1AQHA 3HIJA 1OIMA 4JTFA 4B5UA 1X39A 5JH1A 3IJIA 1LLWA 1XSKA 3GRIA 1CCWB 3AIBA 4CQDA 1GT8A 4OFCA 3GTHA 3PHAA 1B90A 2PU0A 2QCMA 1YRRA 1V08A 2HS8A 2J6XA 5KMYA 4UTTC 4MSSA 2CHOA 1FCVA 4WCJA 5FJOA 2CBVA 1W5QA 2EGZA 3A12A 1L9WA 4Z1YA 3KRZA 4UTMA 4NNBA 3AIQA 2ZDSA 4C5ZA 3GC4A 3LCHA 1F6KA 3HBLA 3VA8A 3IGXA 3W75A 1J5SA 3WL1A 4RX0A 1CGTA 3QMSA 1W31A 2GOKA 3FS2A 1QUMA 3AWOA 4QFUA 1UP3A 2PCEA 1J2WA 1I2PA 1WZKA 3CZGA 3L4WA 1FWWA 1OCBA 1C3FA 2E0PA 4YU1A 3AXKA 3L4YA 3MMTA 5MKGA 1ADDA 4GFSA 4C6CA 1F3WA 2XH7A 2A21A 1R47A 4EIVA 4LYQA 2HTMA 2F7FA 1AK5A 3BLLA 3CZKA 2QUNA 4GZJA 3V18A 1HQTA 3F4DA 4JCLA 2DJLA 4GNJA 4GBDA 4L56A 4LC8A 1WDQA 1AZ1A 3NGFA 3G3MA 3WZ0E 1RD6A 4ZXLA 3SUTA 5IRPA 3EA2A 3MW7A 4F0LA 2CZVA 3BOFA 2QAFA 1A3XA 1RR2A 1BYAA 3GE7A 4TXEA 3BGGA 3XINA 2D2JA 3SY8A 2PDGA 3NL6A 2CLMA 3UXLA 3L67A 4N0RA 3VUPA 1B30A 2QCHA 2D22A 3ANVA 1PWLA 1HKIA 3FA4A 5C5YA 1W3TA 4EPBC 4XZLX 1DJXA 2I14A 3UBPC 2VOTA 2MANA 3WF4A 3LDVA 4UTHA 2J7CA 2WZIA 4ZFCA 1J0JA 1NAL1 3O6CA 4YWSA 2HSAA 2WQDA 2CWXA 4JY9A 4W85A 3W7JA 1T5AA 3CIWA 3FNDA 3WH8A 4I5RA 1W1ZA 4FXFA 3MUY1 1M01A 3MQTA 4C5YA 3NEHA 4WDUA 3MI2A 2YCIX 3DFPA 4GYKA 4Y9MA 1XISA 3B06A 2QUMA 1FH7A 1LJYA 4J35A 4JY8A 4LT9A 5DMLA 5DT7A 3PTKA 2YFNA 3LS9A 2YBUA 5F1UA 1U83A 1W17A 3SY1A 1C8QA 1OFRA 1E6ZA 4KESA 4AEOA 4WZHA 3ZWTA 4R85A 5ENLA 3A6OA 3NQ7A 4CD6A 1Q6EA 3LBOA 4BF7A 4Z1BA 2B4GA 2VX4A 2RKXA 4CD8A 4EWND 4MDOA 1TA3B 3M0VA 4QX4A 3CK5A 1WP6A 3TAKA 4Q4RA 4J5NA 3U4FA 2Z26A 1LRQA 1HP5A 1SVDA 1XSJA 2Y88A 1TSIA 3T8LA 4GZEA 3EWWA 2I16A 2GK1B 2UY5A 3FXGA 3VTRA 3ATYA 1B3OA 2IS7A 3LHYA 2PC8A 2YZ5A 3LXCA 1WAUA 4RL3A 4CGTA 2ZYFA 2PP3A 3DCPA 3EOOA 4LS1A 4N2YA 1EYWA 1CXIA 3E96A 3W7EA 1JZ3A 4L1XA 4UIOA 2BXZA 4S2CA 4XTDA 5CGTA 1DQXA 1JDEA 3A47A 3DIPA 5K4ZA 3DGBA 1LL6A 3BMVA 3N6QA 1C8XA 1DJNA 1X8CA 1J12A 1TWWA 4EF8A 4S23A 5I24A 1SFLA 2J7HA 2PA6A 2QULA 5CXPA 5GNXA 1HW6A 4ES4A 1KM5A 1IHIA 1OEPA 4DF2A 4QNEA 1MEHA 4AZIA 3B9EA 3BGAA 4JYEA 1UQZA 4LEQA 4WXZA 5A8OA 1KR1A 1DHPA 2DH3A 1VCVA 5AB3A 2H90A 3N19B 2PDXA 2VOMA 1HJQA 1XG4A 2Z2BA 4EE9A 3EKZA 1QCWA 2WSRA 2JFEX 3ITVA 3SQMA 1HUVA 4LY8A 4DWSC 3WLLA 4EACA 1H1ZA 3C6CA 3DHPA 3W1TA 4PBEA 3V5FA 1EJ7L 1B9BA 3VZXA 1F3EA 3BSGA 2OODA 5A6AA 1EEXA 4GXMA 4MHBA 5KETA 2BVWA 1X7IA 3VKCA 4H6QA 2WZMA 3WQWA 1RV8A 1YEYA 4L5ZA 2Y5EA 2W91A 3QY6A 1AD4A 1A3HA 3CLMA 3G0UA 1V03A 3Q37A 3APGA 2W79A 3OZOA 4AMCA 3MUIA 3QVQA 4MJ4A 2WNNA 3ARZA 3A22A 7CGTA 4LCQA 5H8MA 1R3RA 3CZEA 2IXVA 4AD2A 1OB0A 3STEA 1RK6A 1KLZA 2RDWA 2PDYA 3OYZA 4S3CA 1F3TA 4UFLA 1R5YA 1YPFA 4O1FA 4LAUA 1KNWA 2H3BA 3K1DA 4NZCA 3W25A 1E6SM 1QW8A 1A50A 4ASTA 4GCXA 3SUVA 2FGBA 3SIZA 4F0HA 3URAA 1R3WA 1EQCA 2PS2A 3NDYA 3MS8A 2HVOA 4DI9A 5E0FA 3ARTA 1YDVA 2XG9A 3NR0A 5ECUA 4BWLC 4NJJA 5CKSA 3ONBA 3W38A 3TYDA 3QV8A 1TQXA 5I07A 1B9ZA 1GQNA 3O8AA 4X3ZA 1CXFA 5I2UA 4GY0A 5H8UA 3B03A 2VGIA 3N2XA 1WKYA 3M41A 3IIVA 5E93A 3UWVA 5BRPA 5DXYA 1EH9A 5CSSA 4AZ6A 5CQ1A 2REQA 3QPYA 4LBUA 4U3AA 3WD0A 3LPGA 2DW6A 5JVLA 3FLUA 4ZENA 4DHGA 3K5XA 3EXRA 1O60A 3UPMA 7TAAA 3NQMA 3W2LA 3V16A 2PB1A 1ZUAX 4B9YA 3IGHX 1YYAA 3RNDA 4DIAA 4B5NA 3AAMA 4QG6A 1DOSA 1V0NA 4HU3A 3EOEA 2GSEA 4W4QA 3JW7A 3ZQ9A 4JCMA 4G9PA 1IYXA 1UWUA 1VHNA 4PMRA 4V2XA 4UTTA 3M16A 4IMFA 4DUVA 1E9ZB 3W1AA 3DESA 4OWGA 4WJEA 1VR6A 2BZNA 2GDUA 2BWGA 1XF0A 1SW3A 1QNRA 2E28A 4YVXA 5I03A 2VFEA 3MJYA 5FA5A 1KWGA 5GJPA 1SZEA 4MOZA 3QYSA 3HGSA 3BLOA 3HG4A 4FOKA 1JEZA 5HJYA 1US3A 4ZOCA 2XN0A 3D3FA 3GTIA 4QDMA 4H9YA 1Q4WA 3KWXA 3A5VA 3VC5A 3TNOA 1KXHA 3O15A 3WF2A 3U3HA 2OOGA 1TJ1A 1U1UA 1K9DA 2NLYA 4HMEA 4KPLA 1WUFA 2QV4A 2ZVIA 2W0UA 4DYJA 4ICMA 4GZ7A 5HPCA 4JAWA 3SGUA 4PN2A 5T9BG 2CBJA 3RCMA 2EPKX 3N29A 1YQ2A 5LNWA 2A6LA 2WZTA 3KW3A 4UTFA 1HVQA 2V82A 3ALGA 5FOOA 2XTKA 2DQWA 1E4MM 2Y70A 3NL3A 5FJJA 5LNSA 2CKRA 1HKKA 5HUOA 4Q4PA 3QF0A 4AG0A 4I7VA 1G0CA 1TREA 4YCOA 4B15A 4YMZA 4GUJA 5IXEA 2ISFA 3CZLA 1FBAA 4FS9A 4UNKA 4E0CA 3MBDA 2ZADA 4E2BA 1ZY9A 3OVRA 4Q8MA 1IWPA 1SU5A 2CLOA 3KX6A 3M0HA 3TMQA 3UVIA 4FK9A 3EDFA 1QI3A 4QG9A 7XIMA 3G0XA 5FJRA 3PBVA 1XRVA 3CAWA 1PKMA 3GFYA 2MNRA 3ECQA 5I02A 4MWAC 1IQ8A 3G1RA 1I9CB 1VFFA 3LA4A 4EP8C 4CUCA 3GS6A 3PP7A 1MNZA 5D30A 1B3YA 2HJPA 5DFAA 1SZGA 2EQDA 2ISVA 5AHLA 1RVGA 4IPLA 1N8IA 4ZOAA 2PLJA 3ITTA 4AEFA 4C7DA 3WH6A 5D09A 1OFOA 4POCA 3W7OA 1E1FA 3FN9A 2HV5A 3RF9A 1PTGA 5IDIA 1U33A 2WNWA 1TMHA 3SDOA 1U1JA 3KM8A 1K9FA 1O94A 2PTWA 2NV2A 2Q8XA 3A4XA 2PWGA 4BQ2A 4PCTA 1H7WA 5I78A 2TRSA 4QHRA 2PRHA 2W5FA 3S1GA 1Q6OA 1P6CA 1EHNA 2WVTA 2V5KA 4AHQA 3S6DA 1CXHA 3EKGA 1J0KA 3OGVA 3C5QA 2ZIDA 1KBIA 1W5MA 3S6OA 4RNFA 3R25A 5AHFA 3R8GA 1LOLA 4W87A 5C9WA 2W6RA 3USZA 1X96A 3MSRA 2GFTA 1M7PA 3PNUA 1TZZA 4F9JA 2E40A 3WQ5A 1S3TC 1ADOA 2VQTA 1YLVA 1OC6A 2BODX 5CH9A 4UOQA 2QCFA 5I79A 3RK8A 3ABZA 1J6OA 3WL0A 1EJUC 3SEPA 2AAMA 3LNPA 2G3MA 3L2LA 4LF1A 1MNSA 1M41A 4IPJA 4P8VA 4Q22A 3EDEA 4J2MA 2HE5A 1UR2A 4O1CA 5K9CA 3ITYA 4I3GA 3FX4A 4MLRA 4NJHA 3WEMA 2EJ1A 3V7PA 4LX4A 3GAKA 4GH3A 5BROA 5PTDA 4PSRA 4XUYA 4O10A 4WX2A 3IIPA 3W76A 4Y8EA 3UWYA 1O1HA 5LKYA 2Y5SA 5DCBA 3VFCA 1BHGA 2REQB 2G96A 4QEHA 4Q7IA 5A6TC 4D72A 4PTDA 3QR0A 4MKNA 2QUUA 4Y7EA 4GVGA 3P5YA 3LPPA 3WY1A 4DWSA 2VZSA 4D2JA 1K8XA 3RITA 3EWZA 3WFAA 2NVCA 3N6HA 1T99A 1VFLA 1E9IA 1PPIA 1Q45A 1QHPA 2QGYA 3W1NA 4HT3A 3S2LA 5D9PA 2VJXA 2ZE3A 2VRJA 4JZ5A 5I00A 1LBLA 4Z2KA 3H22A 2Q8ZA 4RKAA 5K9DA 1D3CA 3PS7A 1JF5A 4I5XA 3VINA 4H2CA 4PTXA 3WQDA 2PRMA 1G5AA 4XBJA 2CLFA 3BO9A 1WZMA 1EHAA 5LIYX 3DENA 1RXOB 3DDMA 3OB8A 4EPDC 3TCSA 1XI3A 1H7OA 3WQPA 3PZGA 3LRMA 1U30A 3OW1A 1GOXA 1P7TA 1ICQA 1UA7A 3SRKA 4YNGA 5K9XA 5D03A 1D7FA 1UD3A 4DO6A 4N42A 4O15A 3L2IA 5J8LA 3QR3A 4AF0A 3SCTA 1JDDA 2BOFX 4ZSUA 5EMJA 1UMYA 3GD6A 4BWLA 2PWEA 2ZZ1A 3KHJA 4ATDA 3I68A 4YYCA 5BMWA 1BYDA 4GI9A 4Q4KA 3UJRA 1HNYA 4ERAA 2J4GA 3OPSA 1LDCA 2ISWA 3DFTA 1DWJM 4KWVA 1VGAA 4F2UA 1IEIA 2YL8A 5CZTA 3HTWA 4IFRA 2R94A 4PUNA 2UY4A 1QWKA 2QEZA 3AHZA 3MT1A 1E0VA 1R3YA 3K4WA 3M6YA 4OKDA 1Q63A 4AB4A 5LA0A 4E2DA 1UBSA 1IZKA 4IQDA 4MG4A 4IHCA 1YXCA 1O4UA 2YR1A 1FY6A 3EWXA 4PEKA 1XGEA 3I3DA 4M51A 3UPWA 1VLWA 1EX1A 2VRQA 1VFSA 5AHIA 5FD0A 3I4EA 2P50A 4H6RA 1XM3A 3WFZA 1YNPA 2Z0IA 4ADSA 1GKPA 1P1XA 3SUUA 1FWDC 1K3UA 2XIOA 1UKOA 3BQ5A 1FDJA 4IGSA 1PIIA 4R7WA 2YL5A 4O19A 3QFEA 1GUVA 1E15A 4JKMA 5AN7A 5B7YA 4WHBA 4IIGA 2WOQA 4DJFA 4U28A 3CT7A 3ZXWA 4JGDA 1TPUA 4OIFA 1ZBWA 1B3VA 1Y5XA 2E4TA 3O6AA 3AS3A 5CGQA 1C9DA 1OABA 1JQVA 4TO8A 4XQ6A 4ACZB 4B3KA 4GQ0A 1W1A1 2PCQA 3WYZA 1XC6A 5BOEA 1B3WA 1XGZA 1ZQ5A 3RILA 2WM0A 2YYUA 4LV9A 1QATA 1T8XA 2OWWA 1GQJA 3TJXA 1UWTA 3R4IA 5D04C 1JCJA 3PN8A 3TP4A 1R38A 1HTIA 2Y61A 1N55A 3QQWA 3O9NA 2GQ8A 1JI1A 2X05A 3AS0A 1W1IE 3WK2A 4PULA 3THDA 4JKLA 2Y8KA 3T55A 4ZO6A 3M0ZA 4PB5A 1RHCA 3KXQA 3WQCA 2GJLA 3V3WA 2OVLA 3KUMA 3IRSA 4H7ZA 3BMWA 4R34A 1WXYA 3VKDA 2DJXA 4RR4A 1DIOA 1CT5A 2YA2A 1FTXA 3VE7A 1UH3A 1QPKA 2IW0A 1I6NA 4U33A 1S2AA 3U4AA 3TCEA 5A6LA 4NXKA 5BU9A 3MI3A 2KX9A 3IJ8A 4I90A 3LBMA 3QKZA 2AOSA 1CW2A 1VBGA 1J9YA 2H8ZA 1KQYA 1NF0A 4M1BA 1NWTA 3KL0A 1QO2A 3C0QA 1P0NA 3IIXA 1KXVA 2P5NA 2Q3OA 3E5PA 1KV8A 4GY1A 4Y6GA 3GNOA 3URNA 3MC5A 1A5BA 4MWAA 4ZBCA 1JXKA 3O07A 2XVGA 4IP4A 1MRAA 3L23A 4ICNA 2E9BA 5CC5A 4KCWA 3AIUA 2WKLA 1TPB1 3HMJG 2WHMA 4DWSB 1DXEA 4LNYA 3WNMA 4UTUA 4PUEA 4UFJA 3EXTA 2VR2A 2ZXDA 1JL8A 4C6EA 4GWEA 4MY8A 5D2VA 2BY1A 4CKQA 2X42A 4OT7A 3EXSA 2ZDRA 5EGRA 5I09A 1DYSA 3BK0A 3R6IA 2ZOXA 1XIMA 4M7SA 3CXOA 2PDLA 3CMFA 4ATLA 4PTWA 5LIUX 1MO0A 2OU4A 2EKCA 5D32A 1FWTA 3W1UA 4LUIA 4HJWA 1RY0A 1TYGA 1PWMA 4J3TA 2CLLA 3KP1A 4WKAA 3DFNA 2TODA 3TC3A 2BBFA 2IKHA 2NV1A 4RZ5A 1ZU8A 4ZQPA 5LA2A 2NSOA 3OBEA 4DPQA 3LLXA 4IISA 2ON3A 3TZNA 3MU7A 5HMDA 3BZJA 2VGGA 1H5VA 1XLHA 1GEQA 2BX7A 4GYJA 2J7EA 4ZB2A 3OODA 3W7IA 1P7TB 4I9AA 4S38A 2GOUA 4IX2A 2EXOA 1ZS2A 3S42A 1ISXA 4A4AA 4AF0B 2WC4A 1HZYA 1A5SA 2F6KA 1IEWA 3DGRA 1DIEA 3WLOA 3DFHA 4R3UA 4UNIA 3HQNA 4GO9A 3BLFA 2R9RA 3M0IA 3VNYA 3UWWA 4GGHA 5FJIA 4NX0A 1QVBA 1HGWA 2VCAA 2A4AA 1KWKA 3HGOA 3NQDA 1EFZA 3GO2A 1H61A 3B0YA 3KAOA 2D0GA 2DQXA 3IPWA 5F4XA 3CGTA 1DWGM 3N73A 3OHIA 2I7GA 1VF8A 3QLLA 4JN6A 2YOCA 1BD0A 1VYPX 3SCUA 4B3ZA 1EBGA 2A3EA 3P80A 2D0FA 1YPXA 3ZSSA 4I8DA 1RQBA 4X2RA 5BYWA 3E1F1 2Y7DA 1ZBVA 4WIWA 1XW8A 4MAVA 1UKSA 2WVUA 1X98A 3DERA 3DECA 4S3AA 3W83A 3AWNA 5CC7A 5G4WA 4M8UA 2GSHA 1PE1A 4UNLA 1UR4A 3W2NA 4GJ1A 4J9JA 2J8FA 3RIKA 4DO7A 3F4CA 1LBMA 3UG4A 3UEQA 3K4AA 4NP7A 1UUMA 3IJLA 4A35A 4J3ZA 4Q7NA 2X30A 1VCGA 3LV5A 3SN4A 1XDMA 3AMCA 1VHCA 5BNKA 1A0CA 2Y8VA 1ZB5A 1KKRA 3OZMA 3E9AA 1J6PA 1TJPA 4OUEA 4C65A 3FHAA 3R5EA 1BTMA 1XIJA 4KWSA 3O6YX 5CPQA 2VO5A 4RK8A 3P0WA 3TJIA 1UYQA 1EXBA 2HK1A 3WQ8A 3LPOA 1A5UA 1PL9A 2NV9A 1D7KA 5KZMA 3P7YA 3PTDA 3GG8A 3NXFA 3SURA 2XM2A 1U5VA 1RJQA 3VX0A 4U5IA 4JQ3A 1UIOA 1FA2A 1NQKA 1XUUA 2POZA 5IHSA 5J5RA 2WVSA 3HO8A 2XJ7A 2J8TA 1KB3A 3CHEA 3NPUA 1LYXA 1ZAHA 1GK8A 1PHWA 4QDPA 1OX4A 3JVAA 3M7WA 3WNPA 4A3YA 3LQGA 1F4AA 1UZ4A 4FLQA 4JX4A 5MF5A 1R7AA 1UBPC 1H09A 1OHLA 4R7JA 1K4HA 1QMLA 1F6PA 1MXSA 4LVDA 5M3WA 3SGGA 3DBPA 4QISA 3AS2A 4JTHA 5GJNA 5BXRA 5D2WA 3EAUA 5HWNA 4LPCA 3Q94A 1G1YA 4JQAA 1JGMA 1DEDA 4ZFMA 1LOQA 5BRBA 2J9YA 3JR2A 1E4NA 2QYGA 5IDZA 3MTWA 2OKOA 1FP9A 2YKKA 3AOFA 1NDVA 2ZUMA 3S1VA 3CH9A 3N2OA 4Z1AA 4HNNA 3HMCA 4LALA 3CT2A 3P74A 2PU1A 3O3RA 4MWAB 2PC4A 1AH3A 3TIMA 4FLRA 4XIAA 4JTQA 3RCYA 2HEJA 2XISA 2OOFA 2Q02A 3TONA 2EO7A 1P6WA 4YTRA 1L6WA 4UMBA 2IPJA 1EEPA 4QE5A 3V0SA 3HG2A 1E55A 2VDGA 4DM1A 4TOQA 3CV1A 4LJ3A 4YTTA 6ALDA 3APYA 4RNHA 4R88A 2INEA 2VEGA 1BKHA 4W7UA 2VTFA 1MDRA 3I6RA 2ZZ6A 2F6XA 2BVYA 3G1DA 1EF2A 1HVXA 2FGLA 1S38A 2J47A 4ORMA 2V81A 2XIIA 2YL9A 3S5NA 5D9NA 4FSAA 3WQFA 3AISA 3IJ9A 3VILA 1KW1A 1Z32X 1G4TA 3EA3A 3K8LA 2IMRA 4BF5A 4PTMA 3QW4B 1R2SA 3CUZA 1ME7A 4IJCA 3CH0A 1X97A 3F5LA 3GUWA 3BWWA 4XZ9A 4AX6A 2WLYA 1GOKA 3VMNA 3STCA 1KLYA 3BLEA 2YYTA 1UC4A 1NWUA 4P7QA 3DC8A 5IBXA 2E6AA 1B54A 4QBXA 2WNQA 1QBAA 3I10A 2X2YA 5A6MA 3FV9A 4QLLA 2D2OA 4DJEC 4AVOA 3RM9A 1CDGA 1V02E 3VO0A 3OZYA 1MFVA 3QSRA 3LUTA 4J28A 2DUZA 2YA1A 4NJIA 2BP1A 1WDPA 4JFVA 1L0PA 1W3LA 4RPPA 5M17A 4AC7C 3P93A 1WDRA 1IF2A 3SJ3A 1W1VA 3W70A 1H1NA 2YDQA 3NO5A 4XZNX 4C6NA 2J27A 3R89A 1HKWA 4C1NA 3G1HA 4M7TA 1F6YA 1N8FA 1MQQA 5BCAA 3AMDA 1Z48A 4CCCA 3TW9A 3LG3A 3T2PA 4IQEA 1SJBA 2GVLA 3WSUA 2V3EA 2C7FA 3FYPA 4F48A