5C6MA

Crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
247
structure length
247
Chain Sequence
b'MSDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAGDTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFELVKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAGADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAGGVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNLLHTLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
molecule tags Lyase
source organism Shewanella halifaxensis
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
total genus 100
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c6mA00
1TV5A 3LHUA 3BGJA 1TV8A 3BO9A 4ZZ9A 1NAL1 1WV2A 1R2SA 2E6DA 4NQ1A 1ICPA 1B4KA 2QDHA 1XBZA 1GVOA 2BXVA 4A2SA 2O7QA 3W2LA 4IMFA 2X1UA 3OA3A 5D03A 1I2NA 3LHTA 4FX8A 3RMJA 2QUUA 1L6SA 1XDLA 3QW4B 3RK8A 3P80A 3I6RA 3NGJA 5G2WA 4CNNA 4KKXA 1ME9A 3L0GA 1WOAA 3GNNA 3PULA 4CNOA 3EWXA 3OHIA 3JR2A 2EPHA 5D2XA 1MEHA 4O0KA 1VC4A 3LLFA 2VKZG 4EF9A 3G3DA 3M6YA 4TU1A 4I7VA 1WA3A 2DZUA 5LNWA 1EB3A 3MYOA 3DHFA 3HGOA 5AHNA 4OE7A 4JD4A 5U7SA 3W2KA 4IX2A 2VEMA 3G1FA 4UTTC 4JTSA 4B5NA 4JN6A 1HTIA 2O7SA 3PM6A 3H53A 1GYLA 1YDVA 3W7GA 3EKZA 2BLEA 2C0AA 1QO2A 3FKRA 4Y8FA 3DFNA 2GOUA 2ZYFA 4GRSA 2Z0IA 2YXGA 1YYAA 2A4AA 4PA8A 3UZ5A 2ZZ2A 1QR7A 3QM3A 3Q2DA 1G69A 4ZQCA 2E68A 2FIQA 5EL1A 1J4EA 5FF2A 1TPB1 2C19A 4LOCA 3TQVA 3QPYA 3G1XA 5IBXC 1ONRA 1RQHA 1PE1A 2R94A 2V0TA 3UY8A 4FIRA 4UR8A 3S1UA 4LVGA 3LCHA 3EEGA 1LROA 4TX9A 1AL8A 4LV9A 1KBJA 2ZFAA 3SJ3A 2YSWA 1VRDA 1XBXA 3W1TA 2HMCA 5G2IA 3UWUA 2C1HA 3MHFA 3N3MA 4QISA 3W1RA 1B9BA 2E09A 2WOQA 4M19A 3L5MA 3LM7A 3HOJA 4PH6A 3P67A 4O1CA 2B4GA 4NZFA 4K36A 4WX2A 1F76A 1GYNA 1X6UA 4E38A 4GC4A 1SO5A 3NQEA 3IIOA 5HMSA 3Q94A 4AF0A 3H55A 3W7HA 3P62A 1SSDA 4H4IA 3TV8A 2NWSA 1JULA 4WUIA 2A2IA 5DBTA 1EP3A 2QDGA 4Z1AA 3T4CA 2YPIA 1N7KA 5CPLA 3SY5A 3L5AA 5BMXA 1DJNA 1TTIA 1UBSA 4RZ6A 4FNPA 2VFFA 3W86A 1KFBA 3I68A 5DLCA 3PSWA 1KFJA 1OFOA 4LV4A 1VQTA 1WBJA 3A5FA 2C14A 1SFJA 4IOTA 1R2RA 4UIOA 1W3IA 4UTWC 3PB2A 3SGUA 5FEZA 1MEIA 1Q6OA 3MO7A 2HS8A 2VFIA 3GVGA 1WAUA 1KV5A 1CW2A 3N34A 1I4NA 3W74A 2Y62A 4AHPA 5FF0A 4LUIA 3QC3A 2ISVA 3IV3A 1H5YA 4D2JA 5AC7A 1I2QA 1Z48A 5DCBA 5AYYA 3UXAA 1JQVA 5D37A 3STFA 3W7DA 4CQ9A 1OFAA 1GOXA 3V1PA 3FJLA 5HR7A 5DBUA 4O17A 3M9YA 1JVNA 1F7BA 2C6QA 1A5BA 1PHQA 1VYPX 2ZA1A 2QF7A 3W71A 3DI1A 2JKPA 4HPJA 1X8FA 3M44A 5T26A 4BI5A 3PUDA 5L9FA 1KM5A 2ZRYA 5DXYA 4LRTA 3OVQA 5BMWA 3VNDA 3WFAA 2F7FA 3QZEA 3KOFA 2RKXA 2J88A 4YWIA 3IGXA 4X2RA 1BEUA 1YTEA 1YTKA 1M7PA 2ZZ7A 2YDAA 4WQ6A 4AWTA 2CLFA 3O1NA 4KWWA 5C55A 5LGXA 5AB3A 2TMDA 4M7SA 3W1NA 3QSRA 4O15A 5AYZA 3O6CA 4G1KA 4S2BA 3W9ZA 3OVPA 3W1MA 4LY8A 4AHOA 4MFEA 6ALDA 3C6CA 3DFTA 1M6JA 2HSAA 2VEPA 1W37A 4YCPA 4NX5A 2QCDB 4O8RA 1QOPA 3STEA 2ABBA 1B57A 1KV8A 3W7QA 1G6CA 2YFOA 4JNMA 3TU9A 3G0UA 1VPXA 3W2NA 3EX4A 4UFMA 3U6WA 3QMSA 1I2PA 3TFXA 1WOBA 4XBSA 3HG2A 4OU1A 3HGJA 5C5YA 4GE8A 4CCDA 1YADA 5H2ZA 2YYTA 4NJJA 1HL2A 2QCGA 4O1DA 3T44A 1O4UA 1H7PA 1VCGA 3B05A 1TTQA 1TJPA 3LDVA 1DJQA 3G18A 1KLZA 2CU0A 2JGQA 1Q45A 3MJYA 1NEYA 3OBKA 1KTBA 3P81A 5DCDA 1LDCA 5TIMA 1WX0A 4DBDA 4LS1A 3FLUA 1PIIA 5FEWA 5LKYA 3G1VA 2NXIA 3W2UA 2IQTA 4UXDA 1JUBA 3S5NA 1PHWA 2CLKA 5BNKA 1V5XA 1XL9A 2EHHA 3DFPA 3HF3A 4UTJA 1OK4A 3O6DA 3A23A 3TW6A 3RLVA 1LRTA 1EPXA 4EIVA 3W83A 4GUHA 3SGZA 3L2IA 4PC8A 3N9RA 2CLOA 4JYFA 4ADSA 1FDJA 1F6PA 1W5PA 1E51A 3TK7A 2Q8ZA 4A3UA 1MO0A 4JXCA 1OFEA 3BLEA 3UXDA 3EWUA 3S5OA 3G0SA 1LRNA 1UB3A 3QSTA 2VENA 2NUYA 4MLRA 1RD5A 1VYRA 3LRLA 3G3MA 1YTDA 3QPZA 4GWEA 1QOQA 3NDOA 4O4WA 2DORA 5K4ZA 3NQVA 3FA5A 3G1HA 4RR4A 3PVFA 3W72A 2D73A 3S1XA 3S0CA 1K8XA 2B7NA 3P5YA 4BR1A 3GR8A 1NSJA 4JDYA 1OX4A 4R34A 1D3GA 1KM1A 1YXYA 1OFPA 2QUVA 4O52A 3PBYA 1ZAHA 2BZNA 2PCQA 4I7WA 2C3ZA 1SZNA 4UTHA 3G1AA 2VFHA 2ZRUA 3TSBA 1KTNA 4MUZA 4HNUA 4UR7A 3NQMA 1F05A 5EKYA 3PC0A 1TPEA 4RXFA 1RZMA 1YDOA 3N2MA 4JTLA 3SI9A 1Z44A 1QAPA 3MI3A 5KINA 1K8YA 1VLWA 3PB0A 3CTLA 4O50A 4RZ4A 1IGSA 2A6NA 4O0ZA 4LC8A 4NJKA 4S1FA 4UC5A 5CPMA 5AFDA 4YMZA 2OZ0A 5EPDA 2EAWA 3TAKA 2V2HA 5F2LA 3LCLA 1WBHA 1OF6A 3LB0A 4JR5A 1GZGA 3MMTA 3JS3A 1TRDA 1H1ZA 3W07A 3NZ1A 2FPVA 2C15A 4OGZA 2B7OA 1KM2A 1KM0A 3R8RA 3E12A 5HWNA 2EF9A 4Y96A 3B03A 3THAA 4MPQA 3W76A 4C1KA 3EWWA 1Q6RA 4GNJA 4PFMA 5H91A 3WJXA 5CZTA 3FJ6A 1G4PA 1KFLA 4GUJA 1W5OA 1X1ZA 3NQCA 1KFKA 1FXQA 4JTIA 3NL6A 2JBMA 2X16A 2QCDA 4AF0B 1QCWA 4O54A 4JIPA 1KLYA 3TSMA 1K8ZA 1QO5A 3WJSA 4O28A 3TNOA 5IBXA 1QDSA 3S5YA 3HBLA 3SECA 2QJGA 1OABA 4JDBA 2A6LA 3EWZA 3PBVA 4MOZA 2BX7A 4DO4A 3MP4A 4ONVA 3MP3A 3DU0A 3FEMA 3W6YA 4UMCA 1FWSA 1DORA 2QJIA 3LRMA 2ZRXA 3UQNA 1SZFA 3DFQA 3W75A 2B7PA 2Z2UA 1SZGA 1R46A 2NV1A 4WY0F 1FDZA 3JRKA 3PR2A 4FXSA 4HNVA 2FB3A 2YGYA 4LUJA 3WK2A 2XN2A 3C52A 3WK3A 5KTLA 1QPRA 5IM51 3UPWA 4ZMGA 1U5JA 1T0OA 4P2VA 3RLUA 2V2DA 4QQ3A 2ZRZA 1SO4A 3GLCA 1GTHA 1Q6LA 2PRHA 4AB4A 4IGHA 1W8SA 3M47A 3NYZA 2PRMA 1GT8A 1LLZA 4GUIA 1ZENA 3B8DA 1RPXA 3MHGA 3IIVA 4U28A 2V9DA 3E96A 4RJEA 4GJ1A 2Z6JA 2GQAA 4R33A 3W88A 4DO6A 5CGQA 4K39A 4UTTA 3ZS4A 1OYCA 2DU2A 4MKNA 5LNSA 5LNVA 6TIMA 3M1ZA 3R12A 1W56A 4AH7A 4JY8A 5A5WA 3MBDA 4A22A 1TPVA 1W5QA 3ATZA 5F4XA 4AWUA 1W0MA 2X1TA 3NQAA 4L4MA 4UTUA 4OBTA 3O06A 2DJXA 2FB2A 1DV7A 3P5ZA 2JGYA 4FX7A 2F84A 3I65A 3HG5A 1TPUA 3MWAA 1WDWA 1N8FA 3C4UA 3QH2A 3USBA 4BF9A 3GZ3A 2QCHA 4NXKA 1XC4A 1GTEA 3ANYA 3PAJA 1TJRA 2C16A 1X1OA 3BLFA 1UUMA 4MY8A 3GX9A 3M16A 2Q8LA 3L0NA 4ALDA 2BWGA 4LNYA 4MIMA 2XFWA 4N9DA 2ZA2A 1GJPA 3O6YX 1FCUA 5KITA 3LCWA 1P5BA 4ZQRA 4MZYA 1DQWA 3CT7A 3PG8A 3UNDA 3ZFHA 1P0NA 1YPFA 4HSNA 3TMQA 3W7OA 5CZSA 3CEPA 3CB8A 1XDMA 2FPTA 5LHFA 4NJHA 4AXKA 2B7QA 5D2TA 3A24A 3V75A 2V81A 5FEPA 3EX2A 3SW6A 2Z1BA 3SR7A 2NV2A 2H8XA 4DF2A 4QM1A 3IVTA 1SU5A 3MP5A 5AHLA 4LU0A 3B4UA 4ML9A 3C3NA 3HGSA 1SO6A 4M6VA 3TW7A 1EWEA 1K7EA 4NJGA 5CPOA 3FS2A 3W7IA 3WJZA 1LZOA 4R7JA 5J5RA 1SW3A 1FCVA 1OHLA 4DO5A 2WNNA 4IMCA 2A5HA 4UNLA 1QPQA 5HQEA 4LS0A 1T96A 3M43A 2QJHA 1JUKA 4UTMA 5G2HA 3B0VC 3NPXA 2TYSA 4LVDA 1UASA 1OVDA 3AJXA 3LTSA 4IWWA 3KVJA 2CZFA 3L5LA 2ZQ0A 3NQDA 4LS2A 3GIYA 3C2RA 3CEUA 5EY5A 2FPYA 1EUAA 1TQXA 2NWRA 3BG5A 2DZTA 2QCNA 2WNZA 3NPWA 3HPZA 5FEXA 3T55A 3LHYA 2PC4A 2W6RA 3G24A 5HULA 1OYBA 4OWGA 4S2CA 1ZHAA 1L9WA 2WV8A 4IMEA 3W87A 4IMDA 1L6WA 2YZRA 2DZVA 4W9TA 1L2UA 1LYXA 3ABSA 4GUFA 2QCMA 3WJYA 3UWQA 1FWRA 1QPOA 2Z6IA 4CQAA 3EX1A 1BWLA 4TMCA 4NZJA 2TSYA 2OT0A 2GPTA 1SW7A 3NQ2A 2H3BA 2CLHA 1I2RA 3KX6A 2W79A 5D2WA 1AL7A 1D9EA 3LCIA 1ALDA 4WOZA 4LVAA 2NX9A 4PL1A 2LLEA 2G95A 4FNSA 3IIXA 1UCWA 3W3OA 1P1XA 3GK0A 3GNDA 1PS9A 1JCLA 1K7FA 5HWJA 2ABAA 2VEKA 3W7EA 4MYAA 1IXPA 1JUEA 2OX1A 4ZL1A 4ZQMA 3C8FA 5K7JA 4XUGA 4BWLC 3M0ZA 3LTYA 4FO4A 1F6KA 2BSLA 3IIZA 1MSSA 5I3HA 5D33A 1DVJA 3T78A 4E0CA 4FIQA 2YR1A 1EIXA 4UFKA 3L66A 1K02A 4QNWA 1K7XA 2DZWA 4OQVA 5HWMA 3BVJA 1NF0A 3KVLA 1GPWA 3F4NA 3TC7A 3F1QA 3UYCA 1XI3A 4U4MA 1UUOA 1JCYA 3GDKA 5E93A 3U2OA 5CZ0A 2V5LA 3DHDA 3NO5A 4WXZA 4K37A 2WQPA 4RLIA 4IX0A 3DKLA 4LW7A 3LTPA 1PL9A 3DZ1A 3QEZA 2FDSA 2X1SA 4FNRA 5KZMA 1C8VA 1VJIA 3P74A 1G7VA 4NNCA 2V5BA 3B0PA 1GWJA 4JIQA 5HNRA 1IIGA 3TKFA 1WXJA 3W2JA 4EF8A 1AK5A 2W0UA 5K9DA 4OV9A 3F4WA 3INPA 1IIHA 4LRSA 1W31A 2QEZA 2WSYA 3LV5A 2J9ZA 3NA8A 3ZR4A 4DXVA 3NL5A 2A7NA 5K2ZA 3C2OA 3BGGA 1FY6A 2JKEA 5CKSA 3UD6A 3UZJA 3YPIA 1GVFA 3OG3A 4BWLA 3QJAA 4E2BA 3MYPA 2FLIA 3LV6A 3TJLA 4HN4A 1D3HA 5FF7A 5F1VA 1TRIA 3FIGA 1O94A 1GQNA 3G22A 4EOUA 4RXGA 5CSSA 4Q33A 2WSQA 3P8JA 4UUIA 4RX0A 1KW1A 4Q4KA 3BARA 3EXRA 5CG7A 4HSOA 4H6KA 2AGKA 2DZSA 3LI1A 3GAYA 1OFQA 3WK1A 3MI6A 3VE7A 4Z1DA 1JQXA 5D32A 2OT1A 3WK0A 2J24A 3W22A 4NX0A 1TO3A 3RNDA 1W3TA 2GQ8A 2NLIA 4MZ8A 3NQ7A 3W1PA 2G5WA 2I1OA 3PG9A 5FF3A 3FFSA 3HQ1A 3KXQA 1ME8A 2A85A 3PS7A 3HMJG 1ZCOA 2J9YA 2GUUA 3O07A 3LXCA 4X22A 3DKJA 2YFNA 4M7TA 1TREA 4JS3A 3DH7A 1TQJA 1EUNA 1VGAA 2EGZA 1XXXA 3GB6A 4JTUA 4JYDA 1FWTA 1G7UA 1JJKA 5BOOA 1ZAJA 4LVBA 2Y7FA 1HUVA 1XM3A 4Y6GA 2OMAA 3G1SA 4XWUA 5D38A 3S1WA 2ZBTA 3VKJA 4YLWA 3NVTA 3LI0A 1LTDA 2A7PA 5HR6A 2X30A 4N9BA 2Y89A 4NJIA 1AMKA 3M5XA 3GR7A 4ZQPA 5D2VA 2QUTA 3W7PA 2AAMA 4O57A 3CWNA 5EMUA 4WZHA 4O10A 3BW2A 1IXNA 4JTFA 4XTIA 2Y7GA 4JTTA 1A5SA 2YX0A 3GKAA 1A5AA 1FCQA 5C54A 4BFAA 3CWOX 4Q32A 4EWND 1TTPA 5D04C 3KFTA 3KRZA 3C2VA 2NX3A 4TMBA 2Q3OA 2FQIA 3W73A 3DXIA 4UFJA 1Y0EA 2H3DA 1DQXA 3HG4A 3TX9A 8TIMA 5DXXA 3TC6A 5FESA 3MUXA 3C61A 2E6YA 1J5TA 5K9CA 3GXNA 2B0MA 4JY9A 3N73A 1KA9F 3TCEA 1KBIA 3EKLA 4JX4A 3NAVA 1O5KA 3UWYA 1G4TA 2XN1A 4GXMA 1KFEA 2HS6A 1PCWA 1DHPA 3QQ0A 1LM1A 3TAOA 3NM1A 3O05A 4L4LA 1SZEA 3W1LA 1QMLA 4RKAA 4DF0A 5FF4A 3LBCA 3LGEA 3KAOA 4TR9A 3VE9A 3LCXA 4WY0B 4HNNA 5L6UA 1GG0A 4RCXA 2QCLA 1VH7A 3G1DA 5DCEA 1TPH1 3W84A 1TPFA 1GVQA 4PCFA 1XBYA 2R91A 3NXFA 3NQ6A 3MI2A 1SR9A 3W1XA 4QAIA 1JCMP 3GKFA 4DPPA 2QR6A 5F2IA 2NZLA 2RH9A 1OG0A 4HHPA 2ZTJA 3HO8A 3HGRA 3PBWA 3PY2A 4MLJA 4O13A 4RK8A 2J27A 4AWSA 1VR6A 3DBPA 1I8JA 3IVUA 2QAFA 2ATMA 2ZCGA 3W23A 1H62A 3LERA 1JRCA 4QNEA 4K7VA 3LRKA 4FNTA 5AOUA 3CU2A 1R2TA 3G1YA 3P84A 4NXSA 7TIMA 1SPQA 1Z41A 2C18A 2QCFA 3W85A 2PURA 1M5WA 2BTMA 1SQ7A 3E49A 4LC6A 5AHMA 1O5XA 3NQFA 5A8GA 2HTMA 1ICSA 3BG3A 3ABRA 4MZ1A 1H7WA 3DENA 4QJ1A 3C2EA 3QQ1A 4GFSA 3NOEA 3TXZA 4O18A 4X3ZA 4O19A 1W5MA 3P7YA 3O63A 3BW4A 1W3NA 4IMGA 3ZWTA 4FF7A 1F2JA 3B06A 5AC6A 3L65A 3UPBA 5J5DA 5D09A 4BI6A 4O12A 5EBUA 2I14A 2Y7DA 2E5DA 1ZY9A 3KVKA 3HJZA 5CZJA 4FXRA 5I3JA 1ADOA 1ZNNA 3GDRA 5HINA 3DGRA 2VEIA 4WOQA 1XUZA 1W54A 1NFBA 2WNQA 3QMTA 4PL2A 4Z1CA 4HKPA 4NNBA 4TO8A 3LX9A 2CFFA 1FBAA 1OK6A 3ABOA 1G4SA 2E6AA 4IXHA 1DOSA 1FWNA 3Q58A 3OVRA 3HPSA 1JCNA 1SFLA 1UJPA 3S8HA 1LLWA 4Y9AA 2CZ5A 2NXGA 1G67A 1DL3A 2Y61A 3IGUA 4N6EA 4A29A 2XN0A 1MEWA 3CM4A 3EWBX 3RFAA 3GXTA 3NM3A 4UFHA 3LCFA 2YW3A 2NXHA 2VFDA 1F73A 4A2RA 3C56A 3K30A 2VELA 1C9DA 4GUGA 1FX6A 1O95A 5AYXA 4FX6M 1TSIA 5F2MA 2H90A 1LBLA 4UNKA 3QYQA 3TH6A 3A5VA 4OHQA 3O8AA 5HJLA 2X1RA 1O60A 2ALDA 4HIBA 4P61A 5F1UA 3TQKA 2ATSA 1TYGA 4O4VA 3HPXA 2A21A 1PCKA 1OYAA 3DFSA 1W5NA 3UY7A 5CSRA 2RDTA 2E6FA 3BLIA 4DEFA 3AO0A 4KFNA 3H54A 1J2WA 4XBKA 3ELFA 4K7YA 5DELA 3FYOA 3PUOA 5F4SA 4MJMA 2CW6A 1H7NA 3BG9A 3DFOA 4YL2A 3T40A 4AMAA 2H8ZA 3CIWA 4HNTA 4M6QA 2GVJA 3NZRA 5G4WA 5D30A 4JTJA 4X9SA 4CQ8A 3S6DA 3A21A 5TBOA 3TSDA 1T99A 4LWWA 2YYUA 3W7RA 3ABQA 1S5WA 1LOLA 3IRDA 4DQWA 3LXBA 3C0JA 3RU6A 2ZZ5A 3UWWA 3TIMA 3F03K 1BWKA 3QMRA 1BKSA 4AHQA 3CC1A 1GVRA 3W7CA 1LORA 3G0XA 3P82A 2Y88A 1F5ZA 3LLDA 4HT3A 1TIMA 4WJEA 2VC6A 2VOMA 1QNVA 1XKYA 1I45A 1ZALA 4ADTA 1VS1A 1XUUA 5D05A 4PTNA 2ISSA 4EVZA 5F4WA 1OX6A 5D02A 1A50A 4A21A 5KZDA 3OIXA 1EX5A 5E0KA 4NT0A 2X2GA 4UMBA 1WQ5A 4H3DA 4IQLA 2KZHA 4UFIA 1YDNA 4CLMA 4DELA 3I7QA 1U83A 1LRQA 2ZA3A 1VHCA 1M7OA 4BK9A 5BRBA 3GDLA 2CLLA 2E1DA 3EWYA 3IGSA 5LNUA 2GVLA 5U4NA 2RDWA 3W70A 3R5EA 2Y7EA 3VCRA 5LSMA 3P60A 4XKYA 2ZDRA 1TV7A 1QPNA 4JTEA 3TMLA 2Y85A 3BV4A 4O16A 3LHVA 1L6YA 4WD0A 3TR2A 4MY1A 1A5CA 1TPDA 1VYSX 2VFGA 4XQ6A 1G4EA 2H6RA 2R14A 1VZWA 2R8WA 4N9CA 2A1YA 2ZRWA 3A9IA 3SZ8A 1TCDA 1AW5A 2DZXA 3G8EA 3W1UA 3FOKA 3GYEA 1K03A 3IIPA 4FNUA 3THQA 3NEVA 1S5VA 4QITA 1PVNA 1T8XA 4Z0JA 4JICA 5FI8A 4AEOA 3W7LA 1LBFA 3NL2A 2RHGA 4NUWA 1VHNA 3EXTA 1H7RA 1FQ0A 2J6XA 2VXNA 3KHJA 3ZWSA 1TPWA 4BI7A 1YLVA 4K6AA 4JX6A 3SFKA 5C6MA 3LBMA 1C29A 4POCA 1ICQA 1OX5A 2OJPA 1P0KA 3TROA 2V30A 3HIJA 3EXSA 1XBVA 4M6PA 4WY0A 5DY2A 4I7UA 1CI1A 4JX5A 4O11A 1Z42A 3LHZA 5LGZA 4O1BA 4DPQA 3W2MA 2RDUA 3VI2A 4GBUA 4O1AA 3W1AA 1LP6A 5BW6A 1P4CA 3PUEA 4MJZA 5I3FA 2GQ9A 2QKFA 5EYWA 2QCCA 1TB3A 4Z0SA 1ML1A 1ZAIA 4NU7A 4DF1A 2DP3A 3NR0A 5F2GA 1BTMA 1OX4B 4IPJA 1FWWA 5LZLA 1GEQA 5AN7A 3O16A 3UWZA 1B4EA 1OFDA 3G8RA 4JYEA 2G96A 5C2XA 3LXAA 4K8HA 2JKAA 1LBMA 2TRSA 4FNQA 2FJKA 4ZQNA 1GVSA 3PSVA 4AVFA 1CX9A 3L21A 3IEBA 5LHEA 5SWUA 3BPWA 1MZHA 2P1FA 1YPIA 4UMAA 2E5BA 4OT7A 1LOQA 4Y90A 3TE9A 2ZZ1A 1JCXA 3KRSA 3TXVA 3L68A 2JK2A 4QSHA 1LCOA 4N6FA 4N02A 5G1TA 1JRBA 4YXGA 3NPVA 4PODA 2RFGA 4JTGA 4YCOA 3WJWA 1S5TA 2G97A 4ADUA 5E1QA 4WXYA 2YCEA 4QIUA 2NX1A 3E9AA 1ME7A 2VFEA 1HG3A 1OF8A 2NUWA 1RV8A 5G4EA 5CPNA 2DJLA 1PV8A 4CCCA 3QF0A 2CZDA 2EKCA 1AW2A 2C13A 3STGA 2GJLA 1H60A 1RVGA 2ZRVA 4JEQA 4E2DA 2FTPA 3FKKA 2E77A 1VLIA 1H63A 3ATYA 3P8IA 4NNAA 5G5IA 2TPSA 3QFEA 3DI0A 4Z1BA 2ISWA 4NVTA 4UTKA 4JGDA 3C2FA 4IJBA 1IXQA 3A22A 3M5VA 1JR1A 4FEZA 2V82A 2I9EA 3HG3A 3P61A 2QAPA 5DY3A 4I9AA 1AW1A 3W7MA 3BK0A 5K4XA 3B0UX 1FCBA 3W7KA 3CQ0A 3RF9A 3PF3A 2OCZA 1SW0A 2CLIA 3R13A 4OV4A 4IXXA 2ZZ3A 3E02A 5I3GA 4UTLA 3FYPA 4O53A 3O15A 3S5ZA 1GG1A 1TMHA 2WSRA 1XFBA 4N4QA 3TJXA 5AHEA 1AG1O 3W1QA 1KTCA 3VFLA 3W7NA 4KFOA 1H51A 2YW4A 3E0IA 4MYXA 4C1LA 3TFCA 3MBFA 4JTHA 4M5PA 1I2OA 3GXPA 5G1YA 2V8ZA 1THFD 2QCEA 5ABTA 3EB2A 1F74A 1EP2A 4CNPA 3CHVA 4MFDA 1B3OA 1HO4A 2ZTKA 4FB7A 1R47A 4KFPA 1RQEA 5AHIA 1VCFA 1H7XA 3LOTA 3N9SA 3L67A 1TTJA 5I3IA 2GJNA 4UTWA 1W1ZA 3U8GA 3CLMA 1OFBA 2FFCA 2CLEA 2CZEA 4UCGA 4LT9A 3QW3A 1KFCA 4J9JA 3NQGA 2CLMA 2WJZA 4KWVA 3UWVA 5I3KA 3D0CA 4UTIA 3L9CA 3TA6A 3CPRA 1IF2A 3W7JA 4ORIA 1YXDA 3QRHA 3EX3A 3Q37A 3SSJA 4RV8A 4DBEA 4IUOA 2P0OA 1N55A 3KVMA 3NPUA 4ORMA 1HFBA 4TIMA 1TPC1 2UV8G 3OEXA 4ICNA 4CCEA 3NQ8A 1S3HA 1Q3NA 1H1YA 3L0KA 5AHFA 1Q6QA 3HB9A 1SSGA 5MHBA 3I7SA 4PEKA 1EEPA 3KRUA 3I7RA 4N4PA 2GVGA 4RZ5A 3NL3A 4MY9A 1JCJA 2Y63A 1RR2A 4ZVJA 3R2GA 2WKJA 1KM3A 2NUXA 4IPIA 4K38A 1OFRA 1EP1A 2DZPA 1IXOA 3M41A 5KMYA 3BW3A 1QFEA 1FXPA 4XZ9A 1H61A 3DAQA 2ZZ4A 3T7VA 4XKYB 4LTSA 2V2CA 3PBUA 4N9EA 5GVJA 2E5CA 3N19B 4XTDA 1EA0A 1KM6A 5AC8A 1NF7A 3NNTA 1H7OA 3STCA 2A0NA 4AAJA 3PWAA 5TQLA 1V7YA 3EX6A 1DKWA 3CIXA 3TUUA 1R30A 4LVFA 1WYIA 4ZQOA 1EWDA 1K3UA 3LCGA 5LNRA 2Q3RA 4O14A 1OJXA 5K9XA 2ZZ6A 1FUYA 1RQBA 1LOSA 3MW7A 5HUPA 3M5ZA 1FDYA 2Y6ZA 1SUXA 5KZEA 2PRLA 5HUOA 1H50A 1NVMA 1XCFA 2WPBA 5K3VA 3R89A 4FHAA 3N2XA 2J9XA 1YXCA 5KSWA 3M5YA 3B04A 3TQ0A 2WO5A 4MVAA 5D2YA 4UFLA 3IVSA 1QWGA 3LHWA 5EA9A 2PE4A 3SIZA 4Z08A 2CWNA 1DBTA 4JTKA 4N2YA 3M7WA 2A7RA 1HO1A 4K8EA 3GAKA 1VCVA 1A53A 1ZFJA 3GDTA 2P10A 3TDFA 3S42A 3MHUA 1ZJIA 1KM4A 4HPXA 1X7FA 1SO3A 3GDMA 3NG3A 2AQWA 1MXSA 3S1VA 2Y70A 3N14A 4R53A 5DN1A 3S9YA
chains in the Genus database with same CATH superfamily
4C6EA 1WKDA 3AS3A 3BGJA 3BO9A 1IEWA 2VWTA 3EKGA 1JDCA 4L4PA 1WV2A 3ARXA 3E0FA 1VFUA 1W9DM 1R3SA 2CZVA 2O7QA 4EXBA 3OA3A 5BXSA 3LHTA 3CXOA 1J18A 3QW4B 3KRBA 4IISA 3P80A 4GBDA 3RITA 3ARSA 5ABHA 4KKXA 4Q7NA 3L23A 4Q4PA 5CC7A 3OLIA 4DNMA 4CNOA 3T0DA 3FVDA 3JR2A 5HPOA 2GGGA 1Q85A 5IHSA 4O0KA 2CC0A 3UEQA 1VC4A 1NFPA 2BODX 2QHAA 1E15A 2DZUA 2D3NA 2PDHA 1EB3A 3MYOA 3HGOA 3KS5A 1GK8A 4JD4A 3I3DA 1VF8A 3WD1A 2XFFA 1VIWA 3TN6A 2DQXA 2BVTA 4DUOA 4YU1A 1P6BA 2BOEX 1B5TA 4LUSA 1YDVA 2BLEA 3FDGA 3DFNA 2ZYFA 6CGTA 3D5HA 3P93A 3ERPA 1R0MA 7TAAA 2ZZ2A 1RBAA 4K2SA 2CYGA 5EL1A 4J5NA 5FF2A 1H09A 3AMKA 2F2KA 3WLHA 2WQDA 3QPYA 1XRFA 4F48A 1TUXA 1PE1A 4BKNA 2Z28A 4C6BA 4MGGA 4LVGA 4TX9A 5C7VA 2OSXA 4LV9A 1KBJA 3OLGA 4KGLA 3OYXA 1VRDA 3DG7A 3LNMA 2E3ZA 1TX2A 3K2GA 1XBXA 3MVTA 3N3MA 1KCLA 2E09A 5I0DA 1HW6A 3VIHA 1KQZA 1NJJA 4B9ZA 4PH6A 4NAEB 4K36A 4WX2A 1GYNA 1X6UA 3RG6A 4KRZA 5HMSA 3V5OA 3UYIA 1XGZA 4QG8A 1WDRA 1EJ7L 2BP1A 4JFWA 3TV8A 2NWSA 4ICCX 4HU4A 3N18A 2A2IA 5DBTA 4MNMA 2QDGA 2YPIA 3L5AA 1NM9A 1EO7A 4GGHA 2D20A 4GCXA 4JFVA 4W4QA 1IEQA 3PZOA 3WF0A 5DLCA 4TVDA 3W02A 1OFOA 1VQTA 1BLIA 2QMJA 4IOTA 3SGUA 1X6NA 1Q6OA 1ISXA 1WAUA 3EOEA 1DIOA 4MWAD 2ISVA 1H5YA 3EMZA 1I2QA 5JXQA 1GQJA 1JQVA 3DDMA 3STFA 3QY6A 1OFAA 3V1PA 3E5BA 3LNPA 4O17A 1A5BA 3DI1A 5XIAA 2JKPA 4PZVA 2INEA 3O3RA 4NG3A 3BAKA 3CYVA 1KM5A 1HZYA 3VDCA 4LRTA 1WO2A 1DE5A 2FMOA 4FK9A 2J7GA 3WFAA 3QZEA 4GI4A 2VUNA 2GJRA 3IGXA 1YTEA 2ZZ7A 4AWTA 2D2OA 4FS9A 3BICA 4IPLA 3QSRA 4O15A 5EU9A 5AYZA 2XGBA 4G1KA 2ZKMX 2CKSA 3W9ZA 1R9XA 4PTMA 5ABFA 3C6CA 3DFTA 2HSAA 2VEPA 1PX8A 4NX5A 3R25A 1UHVA 4M0XA 3KCJA 2HDJA 9RUBA 4D6JA 3W7QA 2YFOA 4UFMA 4HJWA 4LAUA 5D9PA 3TA9A 5C5YA 1D3CA 2NW0A 5A1AA 1HGWA 3LGDA 5H2ZA 3GHUA 1J2BA 5ECVA 4GYKA 1O4UA 1VCGA 3UGRA 2XVLA 1DJQA 2E25A 1ZZMA 1E72M 3LBOA 1X96A 3UR2A 4IIDA 5DCDA 4F8XA 3GHTA 3CUXA 4UB9A 1BHGA 2GL5A 2JFEX 2DV0A 3LEPA 5FEWA 3ONBA 2WVTA 2BDQA 3WQDA 3LMZA 4QDWA 2CLKA 5BNKA 2FH8A 2WWCA 1E40A 4PUNA 1DIDA 5LYRA 1OK4A 3O6DA 1LRTA 4RE4A 1EPXA 5A8OA 4GMEA 4XBJA 1JYWA 4AW7A 3UFYA 2XU2A 3L2IA 1JEZA 3EB3A 2XSXA 4K3ZA 4UR9A 4JYFA 3SCTA 3TYEA 4CD4A 2VZUA 4IQEA 3FEQA 4PMXA 4A3UA 2YZ5A 2OEMA 1HJUA 4NZ1A 3G0SA 5FOOA 3QSTA 4A8RA 2C1GA 1RD5A 3LRLA 1VYRA 2XGZA 5I09A 3KOYA 3QPZA 4GWEA 4MJ4A 3LQGA 3NDOA 1D7KA 3NQVA 3PVFA 1E6RA 3FCPA 3S0CA 1HX0A 3M0XA 4KEUA 4JDYA 1EA9C 1E0VA 1OX4A 1TWSA 4O52A 1ISWA 1ZAHA 2PCQA 3QV7A 4WF7A 2ESCA 4LEQA 5HQLA 4Q4MA 3NOYA 2ZRUA 4ZOCA 2ZXQA 3PZ9A 3TSBA 3VZYA 4MUZA 3ZJ7A 4HNUA 1A0CA 4UR7A 5EKYA 2I5IA 3BOFA 5JH1A 4JTLA 3IK2A 1Z44A 1K8YA 3AHXA 4O50A 1TV4A 3KCLA 3IV8A 4RZ4A 2GJPA 2A6NA 4NJKA 1HL8A 3VM7A 1ECEA 2EAWA 2V2HA 3LCLA 3REQB 3XIMA 1MUMA 1DXFA 1LUCA 1Q6GA 1W1TA 2PDUA 2G37A 5REQA 3GVQA 1R3YA 4FLQA 3CV2A 3E5PA 2YL6A 1ZP3A 4DWSD 2PDXA 2CITA 4S3CA 1KM2A 3R8RA 1RP9A 3V0TA 1FWDC 2JIWA 5BU9A 2D24A 5HOSA 4LNCA 3WLOA 4PULA 3TP4A 1Q6RA 1C90A 1OCBA 3UCQA 4PRWA 2A3AA 5CLWA 2GOKA 1ESWA 1FXQA 1UA7A 3W28A 3RXZA 2X16A 4F4RA 1QCWA 4W8LA 4HOWA 3FAWA 1HL9A 3TNOA 4XZLX 2AL2A 1Q66A 3HBLA 3VPLA 1OABA 1Z3NA 2G3NA 3PBVA 3S6OA 4DWSB 8RUCA 2BX7A 2J77A 3MZ2A 4ONVA 1CXKA 3MP3A 3FEMA 4F66A 2CPUA 4ATDA 4H83A 3JU2A 2VCCA 3W75A 3DFQA 4AEFA 2ZUUA 3NZPA 1R46A 4LUJA 4RDYA 1DJWA 4D8AA 3SM0A 4P2VA 2V2DA 4QQ3A 3R8GA 4BEUA 3R4IA 4IGHA 3M47A 1BGGA 1PTDA 4PMJA 3S9ZA 2G8ZA 1NP2A 3M0KA 1RPXA 3MHGA 1XIJA 3WLLA 3IIVA 1M9HA 5I3DA 1WE5A 3PFRA 3PJTA 4B5TA 4B16A 4D72A 2PLCA 2DU2A 1J0JA 3EBVA 1TJ0A 1E3XA 1PO9A 4H1ZA 3M1ZA 2PCEA 1TKKA 4AH7A 1NQKA 5A5WA 2AQVA 4JQ3A 4ATWA 4AWUA 5EFFA 2PDIA 1PXGA 3BCFA 2HK1A 4H7ZA 1PBGA 4OBTA 3O06A 2OPJA 1KXTA 2DJXA 3GWQA 3P5ZA 1MW2A 1VBRA 1NU5A 2BGNE 2DQWA 1BQCA 2JALA 1U33A 4YHGA 4H7CA 4BQ2A 1PPIA 1UD6A 4PUMA 3QH2A 4CNTA 3GZ3A 3A12A 2QCHA 1XC4A 2HE5A 4HZ7A 1GTEA 1L8PA 1A47A 3VKCA 4G9PA 4IM4A 4CUCA 1TJRA 1RSCA 2C16A 3BLFA 4W87A 4NY2A 4PMQA 3M16A 2Q8LA 3L0NA 2XFWA 4GIYA 3SRDA 1FP9A 1KXHA 5KITA 3C2YA 4OOZA 3F4CA 1YX1A 4MZYA 1WDDA 3UNDA 4LUTB 1CNVA 1P0NA 5RUBA 3DG3A 2PF8A 3GE7A 2BHUA 3I4KA 5CZSA 4QCEA 2CERA 5CC6A 1Q6CA 2B7QA 5EB8A 5D2TA 4WDTA 4XV0A 3UPMA 2V81A 3SR7A 4DF2A 3DFHA 3AHYA 1QRQA 3MKVA 2WMHA 3IVTA 2FGLA 4OFCA 2BY2A 4LU0A 3L7RA 1SO6A 4M6VA 3TW7A 5FCZA 5C2CA 3FS2A 4KCVA 3WJZA 2XWEA 2JF7A 1WZKA 1AD4A 1LZOA 5E5CA 3PZTA 3OQEA 5J5RA 1SW3A 2WNNA 2A5HA 4PMVA 4UNLA 5HQEA 5JUVA 4G7EA 4LS0A 3M43A 1XIMA 1JUKA 2IMRA 2P88A 2XINA 3LTSA 2GDUA 3KVJA 3A3HA 2ZQ0A 3NQDA 4LS2A 4IICA 3C2RA 4C91A 4G2DA 2CWXA 1XIIA 3CEUA 5EY5A 3RM8A 1MQRA 3R10A 4LH8A 4JTDA 4MB3A 1Y65A 1P0BA 4AUBA 1OYBA 4OWGA 3UT0A 4LYQA 2OYMA 4U31A 2OXNA 4PMNA 3LSBA 2QGYA 4R7WA 1L6WA 4TVCA 3WQPA 4GUFA 2QCMA 2F9RA 4G7FA 3UWQA 4B92A 3AMGA 1QXLA 1GOWA 2CXEA 3C3UA 4TMCA 5DF0A 2QQ6A 3NQ2A 2R6OA 2CLHA 3HA1A 1CGTA 2WMIA 5D2WA 2QS8A 4KF1A 2XSAA 4PL1A 2GGEA 2FZDA 3SEPA 4FNSA 4ZO7A 1F4AA 4K1WA 4QQUA 3GK0A 4LY4A 1Z8AA 4YPJA 5CAKA 4HSHA 4W7VA 5DMLA 1E6SM 1K7FA 2EPOA 5JH2A 4ZL1A 2XIIA 3M0ZA 1BKHA 4FO4A 4E0CA 3A13A 2YR1A 3UJRA 3W4RA 2J7EA 5G1MA 3NJ3A 1IEIA 5HJYA 3L66A 1K02A 4QNWA 4D6HA 4OQVA 1GPWA 3F4NA 3F1QA 1XI3A 1EBHA 4LYRA 1UUOA 3ZLHA 3GDKA 3BGAA 3AYTA 3OGRA 1JDAA 1FWJC 4FR6A 4LW7A 3V7PA 1PL9A 1A3HA 3GY1A 5HNNA 3H6OA 3RPTA 1GWJA 1ISZA 4F0RA 3OVGA 1WXJA 3KP1A 1AK5A 2WMFA 2GLKA 1ELSA 4WKAA 3SUTA 4D8ZA 3A3XA 1IIHA 3GVWA 3ZO9A 1D2KA 2A7NA 3VD7A 1PWLA 1CT5A 5CLTA 1CCWB 1P6CA 3QJAA 1KKRA 2EEXA 3LM3A 4E2BA 1TRIA 1G5AA 4EOUA 3TYBA 3P8JA 4UUIA 4RX0A 2INFA 1KW1A 3EXRA 3UXIA 1Q13A 2XHYA 4Q8WA 4ZSTA 1EJRC 4HSOA 1K9TA 3AAMA 4IFOA 2DZSA 3LI1A 1OFQA 1L6FA 2QXWA 3LY0A 2ZE3A 3TNBA 1JYNA 1NIUA 1DWAM 3TQPA 4RPPA 1V6UA 1JFHA 3D47A 4YN5A 1OZMA 1PKMA 3W1PA 2I5GA 5CGTA 2YBUA 2J9YA 3IJDA 4S3GA 3DKJA 1I1WA 3CHCA 3RR4A 4IH3A 4MADA 1FWHC 4ACYA 1FWTA 2I56A 1H3GA 3OZMA 4GPNA 2OMAA 5D38A 3S1WA 4PMYA 3VKJA 2O9TA 5T91A 5B7YA 2HEJA 3EOLA 4N9BA 4AEEA 4NJIA 4IFKB 1OG6A 3FN9A 5FIPA 4O10A 1A49A 4H9ZA 3M0VA 4XTIA 1E43A 2YX0A 3AUOA 5C54A 1E6NA 4Q32A 4EWND 3FVMA 4LF2A 1SMAA 1X97A 3KFTA 2F38A 1ZBWA 1XLLA 4IFKA 4DO7A 4UFJA 2QVHA 3SO7A 2F8QA 1E6XM 4QS6A 2IKJA 3AROA 4C6NA 3C61A 1VFMA 1DJGA 1J5TA 3AXKA 2NSOA 5J04A 2XZ7A 1PWMA 3QTGA 3MKKA 4O8AA 2XH0A 4M1RA 4TQTA 6REQB 1RH9A 2I5QA 2XN1A 4IJRA 3EYPA 1DHPA 1LM1A 3TAOA 3LZ5A 4D6FA 3B9EA 2WMKA 3KAOA 4TR9A 4WY0B 1HJWA 1GG0A 3RX4A 4RCXA 2WKLA 2QCLA 1S2CA 3EWDA 2EKGA 1W1PA 2QIWA 4QG9A 3VNMA 2WBGA 1TPFA 4PCFA 3MI2A 1SR9A 1JCMP 2ZVRA 4MM1A 1US3A 2WXDM 4AD0A 5F2IA 1HP5A 1JF6A 2X42A 5CJMA 1PX3A 4HHPA 3LLXA 2BMBA 5EMMA 4C6KA 4P8WA 2J27A 4AWSA 4HZ8A 3S5SA 3DBPA 4IJCA 5ABGA 1HVXA 1I8JA 3GXFA 3IVUA 3O0FA 4H9VA 4U2YA 2WJDA 2HROA 4I5XA 3QQWA 4KESA 2VP8A 1JRCA 1DYSA 3H2AA 4K7VA 2V5DA 1UZHA 1BXNA 4QSFA 1FTXA 1UWTA 1YBQA 5AOUA 3CU2A 3GG0A 5IDZA 1XRTA 3THCA 1Z41A 2C18A 1OIMA 2BTMA 4PGLA 4LC6A 5AHMA 2J8TA 1EJVC 1BF6A 2HTMA 1ICSA 3ABRA 1H7WA 3DENA 4QJ1A 3LPPA 1E9YB 2DSVA 1XIFA 4GFSA 4QX4A 3URQA 2ZUSA 4O18A 5HPCA 4X3ZA 4Q8UA 3PPFA 4JQ4A 1PIFA 1F2JA 5AC6A 4DLMA 3VIOA 4E3TA 1E5JA 3OU8A 3AS1A 3PTMA 4O12A 2D69A 4MF4A 3IAQA 5C9WA 4Y9OA 3KVKA 2Z25A 2QV5A 1NFGA 2WMGA 1V8EA 4XVEA 1XUZA 2WNQA 2VZOA 4LGXA 2ZWZA 4YTUA 1XRVA 4R9OA 1FWCC 1A0EA 4Q4RA 3L12A 5LXXA 2E6AA 6XIMA 2TODA 5DFAA 4JPGA 3ZLGA 1DOSA 3ARVA 2VC7A 3HPSA 1JCNA 2POZA 4IGSA 1PKNA 4BJHA 3GHSA 5CPTA 3RFAA 3A4WA 4C7FA 4UFHA 5M2FX 1TA3B 4LAZA 2VFDA 2BVDA 4EXQA 2RDXA 3VVGA 3C56A 2OGJA 3K30A 4PUKA 1BF2A 4FX6M 2F2HA 5JVLA 2H90A 3SCUA 4OHQA 3UESA 4CNUA 1QVBA 4RL3A 1KC7A 4HIBA 5F1UA 4H9MA 2PC8A 1PCKA 4KETA 4PTWA 1K6WA 3W81A 3BLIA 3AO0A 1TJ1A 4ZA0A 1J2WA 2YDRA 2QGHA 2P53A 2FZNA 4RV3A 1E0XA 2ZVIA 5I6SA 3BG9A 5BXTA 3DFOA 3T40A 2X40A 3E0VA 2H8ZA 3CIWA 4M6QA 2WCAA 2R1MA 1V51A 5DMYA 1O5QA 2DVTA 3FW6A 3CMGA 1S5WA 2J25A 1LOLA 1ZB5A 2MUCA 1WAWA 1SVDA 3CO4A 3VGEA 1FH9A 3AIUA 3UWWA 3T1GA 3F03K 1XH2A 3SQMA 3QMRA 4US6A 3GXIA 1UKPA 2FVMA 3HN3A 4N0RA 1KGUA 3UZYA 3G0XA 1WPCA 3P82A 1VENA 3LLDA 3T05A 4L1XA 1O1ZA 2WWDA 4Z17A 1XF0A 4MAZA 3CIVA 5D9NA 2RUSA 3OP2A 1POKA 4BCEA 1VS1A 1XUUA 1VJSA 1A50A 5KZDA 3N25A 3HFTA 3UJSA 4UMBA 3MV11 3A9BA 4UFIA 1YDNA 3WMLA 1VHCA 1S2TA 3GDLA 1UROA 4ZE5A 1V3KA 3W70A 3VCRA 3R0UA 5LSMA 3P60A 4Q6XA 4XKYA 1M53A 2W91A 2Y85A 4PB4A 3AMCA 2CIPA 1L6YA 3TR2A 3F5KA 1JCTA 4OJYA 1P6WA 3AIWA 1XQKA 2VD9A 1VYSX 2YL5A 5FL0A 2H6RA 3DBNA 4UTFA 1BSLA 3AI0A 2VGBA 2A1YA 2ZRWA 2YIHA 3BCJA 5HQMA 1GVEA 1AW5A 1EH9A 1RHCA 1S2UA 4FPSA 3GYEA 4FNUA 1K03A 5FJRA 1CZ1A 3NEVA 1S5VA 1T8XA 2Z1XA 4AEOA 3CQJA 1LBFA 5AYIA 3VIJA 4LCRA 1YDYA 3H2NA 5JQ9A 1H7RA 1FQ0A 5LIKX 4NZ4A 4BI7A 1YLVA 3T81A 2J13A 4JX6A 2OSYA 4POCA 1DIEA 1DJXA 1M04A 4ZGYA 1P0KA 3N17A 4D71A 1REQA 4L9XA 5M03A 5BU6A 3S9IA 4M6PA 4PEEA 4UZUA 4O11A 1UZ4A 3VIGA 4DPQA 3SN1A 3W2MA 3W1AA 5BW6A 4NIRA 1JZ5A 1RCQA 2AL2B 1ML1A 2Q02A 3DX5A 4OBSA 4NU7A 3WNNA 2DP3A 4CD7A 1BTMA 1OX4B 4DWSA 3CHEA 1GEQA 3PWIA 1B3ZA 1B4EA 1XGEA 4JYEA 2G96A 2TRSA 4FNQA 2FJKA 2HPMA 1EEXA 4QHRA 5I23A 5FSEC 3TLLA 1XLMA 1LOQA 4GVHA 1S39A 3LD5A 2VHLA 2VVNA 4ASTA 4AZ7A 2NQLA 2ZZ1A 4TX8A 4D8LA 2JK2A 2DUZA 1LCOA 2J7BA 5CSUA 3I10A 5G1TA 1R9YA 3NPVA 1C8YA 1XICA 3SDOA 4JTGA 3AHZA 1GKRA 4QBXA 4XB3A 2QDDA 2IS7A 1FWGC 4F0HA 3VZXA 2NUWA 4GHRA 1A3XA 1QNPA 3AS2A 2WPGA 3V5FA 3TCSA 4Q8VA 2C13A 3STGA 4AD1A 1S1RA 4E2DA 1MDLA 2OQLA 2ZE0A 1VLIA 1H63A 3BSHA 3P8IA 3D6NA 1MMFA 4DVOA 4Z1BA 1UR0A 3CNYA 4NVTA 2WC3A 4JGDA 3C2FA 3EA3A 4C5YA 3A22A 1JR1A 2EQDA 2I9EA 1B3YA 2V82A 3JZEA 1AH3A 1TFVA 1TG7A 5DY3A 2XYLA 1AW1A 4C65A 5AC4A 4Z2GA 3W7KA 3CQ0A 3RF9A 2WM0A 2CLIA 2HXTA 1HKVA 4C6MA 1E70M 2OU4A 3WX7A 4HGXA 2ZZ3A 4MG4A 3E02A 4UTLA 3DHUA 3FYPA 1ZS2A 3QHOA 1GG1A 1TMHA 1E1EA 3VMPA 3UJFA 8A3HA 2GUBA 3VFLA 4KFOA 2YW4A 3E0IA 4L56A 3APTA 2PDLA 3CQKA 3QFWA 1WNOA 3PPCA 2V8ZA 2QCEA 4WRHA 3TN3A 4AZHA 4AZIA 1PYMA 1EP2A 3BMXA 1AJ2A 4LUYA 2J7FA 1JYXA 1CEOA 2J74A 5D4YA 2WLYA 1H7XA 3ITOA 4QGCA 3U8GA 1OFBA 2FFCA 2WYSA 3R0DA 1DWHM 4B2DD 1HVQA 4FOKA 5E9AA 3D0CA 4UTIA 3L9CA 4ORIA 3QRHA 2V69A 4HMDA 4RV8A 3WF4A 2A3EA 1XWYA 1JDDA 1N55A 3KVMA 1KRMA 1QOXA 4ORMA 3GW3A 4TIMA 1TPC1 1QU4A 1WDPA 2YB1A 3V35A 1UOZA 3GW0A 1S3HA 5FJIA 3KZPA 3AIQA 1EC8A 1Q6QA 1GPFA 4M82A 4J3VA 1T40A 1UIPA 3AIEA 3F5LA 4N4PA 2GVGA 4RZ5A 2D3LA 4MY9A 1V77A 2Y63A 1W1B1 1NWUA 3K46A 2WKJA 4E5TA 1BVNP 4K38A 1EP1A 4JQ1A 2YJQA 2ACUA 2OO0A 5KEZA 5GQBA 3CUHA 2WNWA 3BW3A 3UXKA 3N29A 1QFEA 1IT8A 3DN5A 3VOIA 3OG2A 2X09A 3LA4A 3GS6A 3I6EA 4N9EA 2Y1HA 3N19B 1EA0A 1KM6A 2OWXA 2HVOA 1H7OA 1US0A 4DJED 3STCA 2A0NA 3B0YA 4AAJA 2WVVB 2QPSA 5TQLA 5A8NA 1W9VA 3P2VA 1K3UA 1KGXA 3LCGA 2W5FA 4XX6A 2VL4A 1CB2A 4KMQA 1RQBA 4ENLA 3CAQA 5REQB 3M5ZA 3NDYA 1AH0A 1NVMA 2V38A 2WK2A 4F2TA 4LCSA 3AXHA 3VOCA 1M7JA 1RCXB 5EMLA 3M5YA 4QJ5B 4L4OA 2EPMX 1V79A 4MVAA 3EGJA 3CPGA 3TDFA 3U3HA 3S42A 3MHUA 1TR1A 3W24A 3MV01 2AQWA 4DXXA 1KWKA 2XFYA 4CD5A 1MXSA 1W9PA 2Y70A 4R53A 2OYLA 5DN1A 5FJOA 2P76A 4ZZ9A 1AZ2A 1R2SA 4NQ1A 2DUAA 1CLXA 1W3LA 4JFTA 3WQWA 4GQRA 1G0CA 1XBZA 2BXVA 5E0CA 5D03A 4PR4A 3RMJA 1KWGA 3SCSA 1UC5A 4CNNA 1ME9A 3V0SA 1WOAA 3CH9A 4Q8QA 4GO9A 2A79A 2ASHA 5D2XA 1XYZA 3LLFA 4PBEA 1G01A 3G3DA 3M6YA 4UQDA 3E1F1 5LNWA 1FHUA 2YCLB 4OTKA 4HU0A 4RPQA 3WEOA 4QTGA 4KW2A 5U7SA 3W2KA 3G1FA 4B5NA 9XIMA 3PNZA 3S2CA 3PM6A 5JBEA 2PWGA 5A6MA 3GFZA 3EKZA 4Y9NA 3BSGA 1QO2A 3FKRA 4REQB 2GOUA 2YXGA 4A8IA 2VI0A 3A6OA 1N82A 4MMWA 1JF5A 1QR7A 3QKZA 4ZQCA 5CJ5A 2FIQA 1J4EA 1CGUA 1OGBA 4D6DA 2OB3A 1NELA 1FWBC 3PZMA 4XZNX 4C6DA 4DWSC 3G1XA 3JZUA 1ONRA 5A94A 4US5A 4UR8A 3S1UA 1PUDA 1S38A 1UP0A 3UWUA 2DPEA 2C1HA 3MHFA 4QISA 4YHEA 3WZ0E 4OUIA 3GG1A 3B8UA 5IFPA 5E6YA 4NZFA 1F76A 3ARRA 1XINA 2ZXDA 3CV1A 1I75A 3WQVA 1A3WA 1SSDA 3LPFA 4Q4OA 2G0WA 4I6VA 1EP3A 4Z1AA 4W84A 1N7KA 1UR8A 1R6WA 1TTIA 3B8SA 2VFFA 2E4TA 3I68A 2C79A 3PSWA 1FHVA 2CHOA 3GUWA 1W2PA 2XM1A 2VR4A 2UWFA 1MEIA 3MO7A 2D0FA 2HS8A 2VFIA 3GVGA 2BVWA 3WKZA 3WCZA 3NYDA 1KV5A 4IFRA 3N34A 3W74A 5FF0A 4LUIA 3GHRA 1LWJA 2XSBA 4D2JA 3H21A 1VBHA 4GVIA 4EACA 4BQ5A 4E2OA 2PFHA 2XJ7A 3T9PA 3W7DA 4H2HA 4CQ9A 3LK6A 3FJLA 5DBUA 3M9YA 1JVNA 4XZBA 1SFTA 2C6QA 2DSKA 4LPCA 5G4HC 1WDQA 4HMNA 5H8UA 1X8FA 3M44A 3VX0A 1L6GA 5DXYA 2PLJA 3R94A 5D9MA 4GOAA 2J88A 5A8MA 4MNKA 3C0QA 4ZB0A 1OD0A 1BEUA 4WQ6A 4KWWA 3AIVA 2DH2A 5LA0A 1CLVA 3O6CA 4CQCA 4S2BA 3KBWA 4LY8A 3E2SA 3DYPA 4DJFD 3AHVA 3W27A 6TAAA 3SURA 4O8RA 3B9AA 3STEA 4XSMA 2ABBA 4UQAA 1KV8A 1PIGA 2YLAA 3AIBA 4A8NA 4JNMA 3G0UA 3TTYA 1UUQA 3M6DA 1E1CA 4E4UA 1I2PA 3TFXA 7REQA 3HG2A 1DJYA 4CN1A 4DJFC 2IKIA 4CCDA 5HAOA 1UKOA 1LQ0A 5DT5A 2Y8UA 5M3WA 2ZX6A 1S2AA 1ZSXA 4AY1A 8XIMA 4O1DA 3AJ7A 1KFWA 4XIAA 1H7PA 1TTQA 1TJPA 3LDVA 1XH0A 3G18A 2ZIDA 4DJDA 2CU0A 2JGQA 3CGTA 1OT2A 2L5HA 1V6TA 2PD9A 1LDCA 4DBDA 1QK2A 1PIIA 4H7VA 3SSZA 2P5NA 1M41A 2I7GA 3RHGA 5LKYA 3IRSA 5IDIA 2IQTA 1PHWA 2E67A 1QI3A 2EHHA 3DFPA 3HF3A 3MCMA 1BFNA 3WNPA 3ZVHB 3FXGA 4JKKA 4EIVA 4YVPA 4CVWA 5A6JA 3W83A 4C1NB 4GUHA 3SGZA 3HV8A 3BJTA 4W89A 3LYEA 2AKMA 2CLOA 1FDJA 1UA3A 1UD8A 1J5SA 3TK7A 2Q8ZA 1MO0A 1UB3A 2G4FA 2NUYA 3WUFA 3G3MA 1YTDA 4J28A 1QI5A 1QOQA 5LA2A 1J9YA 4W7WA 4RR4A 3WSUA 3VUSA 3S1XA 1K8XA 1SJDA 4GYFA 4BR1A 4OZOA 2XWDA 3CWHA 1Q4NX 2WHJA 2VZVA 3ITXA 3UZWA 5A6BD 1KM1A 1QATA 1TZ7A 3U7BA 3VOGA 1DJHA 3GU9A 4NZ3A 1SZNA 2V3GA 3WFLA 3G1AA 1YNYA 4LAMA 3NVDA 4RE2A 3PC0A 1RZMA 1YDOA 3BV7A 1QAPA 3MI3A 3CTLA 4XD3A 1PKYA 2OSWA 2NQHA 1IGSA 4NZ5A 3V1HA 4S1FA 3EEZA 4YMZA 2UZ9A 5F2LA 3QHNA 3RO8A 3T0BA 3GZAA 1OF6A 3HURA 3LB0A 4JR5A 4DAFA 4RW5A 2F6UA 3MMTA 1JPDX 2CXGA 1I60A 1TRDA 2PGEA 3NZ1A 4OGZA 2B7OA 1AA1B 4PCSA 3Q45A 4AZBA 2CBIA 3THAA 4MPQA 3OIHA 3H4WA 5TD4A 4WKHA 4PFMA 4GXPA 5T8GA 2QJNA 1KFLA 1W5OA 1X1ZA 5I03A 3QR0A 1KFKA 4JTIA 1OGGA 1PAMA 4V28A 2JBMA 4AF0B 3KL3A 5EGRA 3G6MA 1VEPA 4JIPA 3TSMA 3WJSA 2DVXA 3T42A 1EOMA 1Q7MA 3KTCA 2X0YA 3BL3A 3GR4A 3WQFA 1VP5A 3IK4A 2XPKA 5LXEA 3DU0A 3U4AA 4UMCA 1HKWA 1Q2SA 4L6DA 3LRMA 2WZTA 9CGTA 5A2BA 4DBWA 4GNKB 2WMIB 4J3SA 3MCOA 2Z2UA 1SZGA 2NV1A 4WY0F 3CLWA 1UOKA 4GGBA 5FJPA 1FDZA 2FB3A 2YGYA 4TVUA 2XN2A 1B1YA 3ME3A 3OTRA 1ODUA 5KTLA 1QPRA 5IM51 3GG8A 1KCZA 3UPWA 1U5JA 3AS0A 1GJUA 3EOOA 1G9HA 2ZRZA 5IFTA 1UH2A 2ACRA 2X8RA 1B3WA 3GC5A 1W8SA 4GUIA 1VD6A 1ZENA 4P7OA 2AOSA 4U33A 4WHBA 1MDRA 1IZCA 4U28A 3E96A 1EYEA 4H6RA 2GQAA 3KBMA 4K39A 4UTTA 3ZS4A 1Z69A 1UQYA 2JF6A 5LNSA 3R12A 1W56A 4GY1A 4LBSA 4A22A 1PTGA 2Z2AA 4C5ZA 1W5QA 1DJZA 1FOBA 3ATZA 4F0SA 2OELA 1V4YA 3U7VA 2X1TA 1QPKA 4L4MA 2O0TA 4UTUA 4B91A 4PSPA 2AKZA 2FB2A 1DV7A 2FHFA 1DP0A 4JKMA 4A3QA 2JGYA 4ZR8A 3OGVA 5FA5A 3HG5A 2VMFA 2FDMA 2D2HA 4BF9A 2DFAA 1RLDA 1LT7A 4FR1A 3B3DA 1C8XA 1DXEA 4NXKA 4AYGA 3ANYA 3WQ4A 1OB0A 3N1AA 1ONWA 1UUMA 4ALDA 4LNYA 3GU2A 1GJWA 4KEMA 1AVAA 3O6YX 1FCUA 1TVPA 3QR3A 4GYJA 4L1WA 1K6AA 3UR7A 3OO2A 1P5BA 2PAJA 2YLLA 1DQWA 4GZJA 3F2BA 3ZFHA 3APYA 3FDKA 1KKOA 3SN0A 1EKOA 3CB8A 1IZKA 4NJHA 3W37A 4AXKA 1EFZA 3A24A 3CZJA 1VIZA 5BOEA 3AIRA 3EX2A 4XUYA 4AIEA 3O0KA 4DJEA 2NV2A 2H8XA 3RU8X 3T09A 4AG0A 2AL1A 3MP5A 4NI8A 4ML9A 3RO6A 1XLAA 4V1YA 3C3NA 1D8CA 2PDGA 2X05A 3SQSA 4QCFA 1X38A 1JDFA 4AX6A 4R7JA 5ENLA 3WIJA 1XLEA 3O9NA 6XIAA 2OODA 4ROQA 1XX1A 3FV9A 1CTNA 4UTMA 2BVYA 1CDGA 3AJXA 1X98A 2DW6A 1XCWA 2CZFA 3BURA 5FKYA 4KGJA 3CAWA 1FWFC 2QW5A 3QY7A 1XHGA 2FPYA 3FGCB 2DZTA 2QCNA 2GVEA 4DJFA 3DEQA 1CGXA 2WNZA 3HPZA 1GOKA 5FEXA 3TZNA 1XS2A 4BZYA 4W7UA 4S2CA 4DBSA 1L9WA 1EJXC 3W87A 5XINA 4D6CA 4ZSUA 4IMDA 3RRAA 3SBFA 4Y7EA 4W9TA 2DZVA 2PPGA 1FP8A 1LQAA 1FWRA 1QPOA 1AODA 2V3FA 5TNVA 1LL4A 1V6VA 2YL8A 3CJPA 1ODZA 2DIKA 4HYWA 2PDYA 3L2LA 3WELA 4B15A 3ARUA 4AIBA 2E7FA 4PE8A 1AL7A 2XIMA 3LCIA 4PMUA 1ALDA 4WOZA 1LL7A 2NX9A 2LLEA 1S1PA 3IIXA 1HJVA 1UCWA 1CYGA 3H4GA 1P1XA 1OIFA 3WDQA 2ZC1A 2VGFA 1PS9A 1JCLA 1YQ2A 1EGVA 1GHRA 3CZKA 4MYAA 1IXPA 3OLEA 2CESA 1F4HA 4BWLC 3HTWA 1WZMA 1FH7A 3LTYA 3C5QA 3W38A 1MSSA 1RP8A 1TX0A 1DVJA 4O1FA 1GGOA 2F6KA 1W32A 3P14A 2WCGA 1ZGDA 3NDZA 2FHCA 3CASA 3EDDA 2ZUNA 2BHZA 1JCYA 2Z7GA 2HV5A 2V5LA 3DHDA 3NO5A 4WXZA 2MANA 3UCCA 2GVYA 3HPFA 3I4EA 3CTTA 3LTPA 3QEZA 4UQCA 4FNRA 5FACA 1REQB 4NNCA 3N04A 3TC3A 3B0PA 2PDJA 4KWSA 1IIGA 3ISIX 3TKFA 1BWVA 3TN4A 4EF8A 5K9DA 3F4WA 3HFYA 1ZP4A 1CGVA 2JQXA 5BOFA 3OBEA 3KTXA 4XD6A 3GNOA 4IPPA 2BGSA 5K2ZA 3C2OA 4MKVA 1SM9A 5CKSA 3YPIA 3WBYA 4G8TA 1GQNA 3BE7A 5CSSA 3WQOA 3T4WA 4Q4KA 4RE3A 3CAVA 3UG4A 4H6KA 3CMFA 3MWCA 2REQB 5HXMA 1NDWA 7PTDA 3QXBA 1EOKA 3MI6A 3VE7A 4Z1DA 1KXVA 2YDSA 4S39A 3WK0A 4NX0A 4ZB2A 5ABFB 3RNDA 2GQ8A 2NLIA 4MZ8A 2I1OA 1I0BA 5ABEA 4XISA 3HQ1A 4GABA 2J7DA 1ME8A 2E9MA 3PS7A 1V6YA 4MWAB 1ZCOA 3WH6A 3Q65A 4X22A 1VFOA 4JS3A 2HVNA 1VGAA 3GB6A 1XXXA 3PJUA 1G7UA 5A6TC 4LVBA 1TMLA 2YBTA 3M0IA 3N2OA 1XLIA 3WO8A 1JXKA 1XFCA 2PMQA 3NVTA 3LI0A 1LTDA 2A7PA 2R1LA 5HR6A 5I06A 2X30A 2Y89A 1AMKA 3M5XA 2Y2WA 4KEVA 5GNXA 5D2VA 4DJEC 3THDA 1DIKA 3VGGA 2OLHA 4WZHA 4KBXA 4GH3A 4GIEA 2GJXB 1XYCA 3GNPA 1KD0A 4JTTA 1A5SA 5DQPA 1A5AA 3UU0A 4B5UA 1Q8AA 5HNTA 4OVXA 1TTPA 3K13A 5D04C 3C2VA 4UZSA 1GOIA 2HE8A 1KRCC 3SFWA 3W73A 2VEGA 1DQXA 4YNGA 2E28A 8TIMA 3EZ4A 2GJXA 3TC6A 5FESA 1V08A 3UVIA 5CG0A 1E9IA 2E6YA 1J01A 1E9LA 3GVRA 3WNKA 5K9CA 4PB3A 4JY9A 1XIHA 3TCEA 4EAYA 1TVNA 3NAVA 1GOQA 3UWYA 1G4TA 3CV6A 4GXMA 1LUCB 2HS6A 4Q8OA 1PCWA 5A6AA 4NKCA 3WQ8A 5H1WA 4L5ZA 3WH5A 3NM1A 1R38A 3RCMA 4HNOA 4PTXA 1SZEA 1T6MA 4RKAA 1W2VA 3LGEA 3T2OA 5HA7A 4NSBA 4HNNA 4JL2A 5I07A 1UJQA 1VH7A 3XINA 5JBDA 1Q65A 1TPH1 2WC7A 4UQBA 4DZHA 4YTRA 3SUSA 4YTTA 3W84A 1MW1A 2DSZA 1UMYA 4GQ0A 4Q8MA 3QOKA 3W1XA 3ZLFA 4DPPA 3R79A 1NDYA 4EPEC 4MLJA 4RK8A 4JAWA 4INFA 2IPWA 1MFUA 2QAFA 2VO5A 4DYKA 3DC0A 2ATMA 2ZCGA 2PS2A 1BG9A 1H62A 3ARZA 3C0LA 3LERA 4KCUA 4QNEA 3LRKA 1R85A 1JI2A 4MUPA 4GQBA 7TIMA 4R5EA 3VXGA 2QCFA 2PURA 1M5WA 2ZOXA 2O56A 3E49A 1J11A 4RE0A 3ORWA 5A95A 3B97A 6ENLA 1EIBA 1ZBVA 1EJTC 3GU1A 2FVKA 2ODOA 2VZSA 3NOEA 3TXZA 1W5MA 3P7YA 3BW4A 3O63A 2NVDA 1JZ6A 3CAKA 3UPBA 1AFSA 2I14A 3ZM8A 1QHOA 2C1IA 3OHMB 1R87A 4FXRA 4DB7A 5I3JA 5HINA 3DGRA 3WL0A 2GYIA 3QOMA 2VJXA 3QMTA 3WH8A 1OD8A 3VD4A 5MF5A 2CFFA 4KRUA 1FBAA 1A5NC 1G4SA 4JL1A 4ZFMA 2HISA 4CVUA 3M0JA 3OVRA 2EBNA 4LEFA 1SFLA 1GNXA 2CZ5A 1G67A 1JFXA 4ZB5A 1JGIA 1DL3A 1P7TA 2Y61A 4N6EA 1R3TA 3FY1A 4HZ6A 4EE9A 3VGHA 4JN7A 5I24A 2VT0A 4J3XA 3VNIA 1X1NA 5CXPA 3LCFA 4XAGA 3VZZA 4D9PA 3FJ4A 1F73A 2OZTA 4A2RA 2PEVA 5LIUX 1TSIA 1K77A 2EPKX 1LBLA 3TH6A 1UR2A 4WDXA 1WDSA 2XIOA 3OODA 4S3KA 3U5YA 1HKJA 2A21A 4WCJA 3RPMA 1E56A 2E6FA 3L4WA 3VO0A 4DEFA 3H54A 3DC8A 4XBKA 1F61A 5DELA 3PUOA 3H23A 2EPLX 4IPNB 2IUZA 5F4SA 4IUGA 1OSEA 4LALA 3RN6A 1EJWC 2CW6A 1H7NA 1L0PA 2E8ZA 3F2CA 1Z7AA 1H0GA 2QDEA 2GGIA 2GVJA 5C9RA 4X9SA 3S6DA 4JIEA 2DIJA 3WBWA 4HHHA 4LWWA 4ZOBA 1TVLA 4DQWA 4GK8A 3C0JA 4Z2HA 4CD8A 1EXPA 3TIMA 1WKEA 1OBAA 3KBJA 2OKTA 4AHQA 1GVRA 3W7CA 2P3EA 1U22A 1F5ZA 1RBOB 4DXKA 4WJEA 4QFUA 3KOXA 2WW5A 2P8BA 5BWAA 4MPKA 2GZXA 2WCSA 1ZALA 4ADTA 5D05A 4PTNA 5C9UA 3VYLA 5F4WA 5D02A 4GD0A 3VCNA 3OIXA 2ZXBA 4NT0A 4IQLA 2KZHA 2Z27A 4HA4A 3I7QA 1LRQA 2PTXA 4BK9A 3GIPA 2GGHA 3MC5A 2E1DA 3R43A 5LNUA 2DY3A 4JQ2A 4GH1A 3ITCA 4S38A 4DUWA 1TV7A 3GTHA 4O16A 3W6MA 1BAGA 2NQ5A 4MY1A 4B9YA 4XQ6A 1VZWA 3D3AA 2VEFA 2BY0A 2VWSA 1F3TA 3B8TA 1TCDA 2DZXA 4GO8A 1JI1A 1J0YA 4XD4A 4QITA 5AZ0A 4Z0JA 4JICA 5FI8A 3W7LA 4TTUA 1DWGM 1QHPA 2VXNA 5I7GA 3ZWSA 1EJUC 4K6AA 5C6MA 1WXZA 3KDNA 1ICQA 3LPOA 3UETA 3AHTA 4IP4A 1RK5A 3NFUA 3UR5A 3H22A 1XH1A 3UVAA 4QR6A 4I7UA 4EPBC 1Z42A 2YA2A 4P7RA 4QLKA 1WKYA 4GBUA 1P4CA 3PUEA 1DWFM 2ZUTA 1TB3A 4Z0SA 4F40A 2PWEA 1SYTA 3E2QA 1WKFA 1H5VA 3H7VA 1GCYA 4BEQA 5H8PA 3G8RA 1RA0A 1BGAA 5C2XA 2BASA 4MJ2A 2JKAA 1V6WA 1CX9A 3S1GA 5SWUA 3BPWA 1MZHA 2P1FA 2YA0A 3EA2A 3TWBA 2P50A 1Q5MA 4N6FA 3IANA 4PODA 5GJMA 1B0IA 1NY1A 3D3FA 3KP0A 1F07A 4C6OA 1T7LA 4PBFA 4YCOA 3WJWA 1S5TA 2VD8A 4WSJA 4ADUA 4MDOA 3ITLA 1XIBA 4BF5A 2YCEA 1RD6A 2NX1A 5C70A 4NP7A 2VFEA 1TUFA 1OF8A 1XLFA 3N13A 5CPNA 1JZ2A 1VPYA 4UOJA 4CCCA 2EKCA 4AD2A 1M7XA 2Z24A 1AW2A 3AZSA 1K8CA 3H26A 3WF3A 4HU8A 1H60A 3G1RA 4N42A 4C6IA 1NWRA 3WNOA 1QWKA 1W8GA 3ATYA 1GVYA 1PDYA 4CU6A 3QFEA 3TTQA 4CEXC 2HK0A 5IHRA 3AYVA 4RW3A 3VTRA 4FEZA 3CQHA 1QHZA 3W26A 3IJ8A 5A69A 2QAPA 3ES8A 2ZX5A 1FCBA 3QZAA 1B90A 1W9UA 3WEZA 4HVXA 1UKTA 2OCZA 2BNJA 3N6HA 4OV4A 4IXXA 2OG9A 1R3WA 1MRAA 2YDQA 4TOQA 3O15A 3S5ZA 3U2EA 2WSRA 2W67A 5TF0A 5AHEA 4PBGA 4IF2A 3BZJA 3UXLA 1ZPTA 3W1QA 2YL9A 5PTDA 8XIAA 1H51A 4L7ZA 5CJNA 2OZ3A 3RGTA 4QLJA 3MBFA 3BSMA 1EZ2A 1OM0A 4AD5A 5G1YA 3GFYA 1THFD 4WDUA 3F4DA 1ISYA 3EB2A 4CNPA 2QULA 4MFDA 4R3UA 3U57A 4FB7A 3WNMA 1L2QA 1TCMA 1RQEA 5AHIA 1VCFA 3RMEA 3LOTA 1UR1A 1TTJA 1O66A 3CHFA 2GJNA 4UTWA 1W1ZA 3CLMA 3UA4A 1X8CA 2X7WA 2CLEA 1V0NA 1LG1A 2OO6A 1VFFA 3WN6A 3TTEA 3NQGA 1HKMA 2WJZA 3UWVA 5CPQA 3CPRA 1N8WA 1YXDA 1WXYA 3C86A 3VNYA 2VRQA 4BY3A 4DBEA 2OQHA 3S47A 1TV3A 1G94A 4F0KA 3WDRA 3NPUA 4RNJA 2E9LA 3URBA 2VDHA 2UV8G 3OEXA 4CCEA 2J66A 1Q3NA 1WZLA 4DNHA 3CPUA 1WUEA 1SSGA 3EPMA 3KRUA 1W91A 3I7RA 3OQ8A 2GGJA 1RY0A 3NL3A 4E4FA 2CEQA 4HHLA 1NARA 1R9ZA 4IPIA 2PBOA 4FZIA 1EO5A 1OFRA 2PZ0A 2OTDA 4FOJA 2J6VA 1IXOA 3O2LA 3M41A 3ARTA 3U5UA 3AXIA 3S2LA 3WG6A 3DAQA 3HU7A 4XKYB 7XIMA 5GVJA 2UY3A 3WD0A 1SZRA 4YVXA 3FHQA 1NF7A 1VBGA 2J8FA 1V0KA 5CAHA 1I0DA 4M1BA 4UOZA 4MSSA 3UWEA 5H6HA 4ZOAA 4CU7A 3PWAA 2BB0A 1V7YA 3EX6A 4GX9A 3TUUA 4LVFA 1XYAA 1WYIA 3OLDA 4XIMA 4Y9MA 1UR4A 3ICJA 5K9XA 1IWBA 1UPPA 3ZOAA 7REQB 1LOSA 1XSJA 1XDJA 3K1DA 2Y6ZA 4B4FA 5KZEA 1B9ZA 1O12A 2PRLA 3BH4A 3LU2A 5HUOA 1H50A 2WPBA 2BV9A 4QS5A 2DGAA 3R89A 5K3VA 3SCRA 4FHAA 2Y0FA 3B04A 2DT3A 5D2YA 5HBFA 4UFLA 3THUA 2A7RA 1HO1A 4IIHA 5I79A 2W66A 3L4XA 4PRRA 2HRWA 1KM4A 1X7FA 1SO3A 2HPIA 4EX4A 3NG3A 2HZGA 3UGVA 4DAIA 1JPMA 2PU1A 2Z1WA 1R8LA 4M29A 4XZMX 1HJQA 3S6TA 3AOFA 1OZQA 1JL8A 4F2UA 3W00A 1PZ3A 4ZODA 3MDWA 2QDHA 5I5RA 2YXOA 1GVOA 1QNQA 2G3MA 2PDWA 1XSIA 2A3BA 1I2NA 2GQ3A 2QUUA 1L6SA 3QTPA 2NSXA 3WYZA 3PP7A 1E1FA 1XDLA 2VRKA 3NSMA 4ES4A 5C9ZA 3VNZA 3L4YA 3I6RA 4F9JA 2NT1A 3PULA 3DERA 2YCJA 3VNJA 2UY2A 1UW9A 2VKZG 4Q3MA 4TU1A 3UP8A 4P8UA 1YEYA 1WA3A 4I7VA 4LXFA 1XYFA 3KWSA 4QEHA 4HTBA 1ISVA 1ADDA 4YYFA 3B8VA 3VOFA 2R1NA 2VEMA 3UERA 4UTTC 4JN6A 1HTIA 2O7SA 1J79A 2CETA 1HGYA 3S2NA 4K68A 3H53A 3KEHA 4F0MA 3W7GA 1E6PA 5E70A 4DYJA 1V7AA 3T2QA 2GFTA 3BAWA 2Z0IA 4GRSA 5CH9A 3L4UA 3B8WA 1OC7A 1ADSA 2A4AA 4PA8A 4HMEA 3QM3A 2QYGA 1G69A 2E68A 4Q7IA 1TPB1 1E0WA 3WLTA 1V3IA 4LOCA 3AICA 5IBXC 1RQHA 2R94A 2V0TA 4FIRA 4XK2A 3HQOA 3LCHA 1LROA 2C0HA 1AL8A 4YYCA 2ZFAA 2XIBA 3SJ3A 5BROA 2YSWA 3WD4A 2ISFA 3W1TA 2HMCA 3W1RA 1B9BA 2WOQA 4M19A 1PJ9A 2GWNA 1YIXA 3LM7A 4DZAA 1ITUA 1DHKA 3P67A 4O1CA 4FA3A 2FH6A 2OLSA 3F2DA 1AJ0A 4E38A 1SO5A 3NQEA 3IIOA 3W25A 3Q94A 3W7HA 3WDJA 2VYOA 2KX9A 3TYZA 2PZNA 1V3LA 2VOTA 4WUIA 1BQGA 3T4CA 3H70A 1RXOB 5CPLA 1FKWA 3UW6A 1NDVA 1E0UA 3MDUA 4G5DA 5BMXA 1UBSA 4FNPA 2WZEA 4S3BA 4RNFA 3LMYA 3WQGA 4LV4A 3A5FA 2C14A 1SFJA 1R2RA 2OVLA 1W3IA 4DZIA 4UTWC 5FEZA 1O6IA 1NP0A 3MQTA 3ITTA 1QTWA 3RJYA 1CW2A 3ZR5A 3R58A 1UQZA 3ABXA 4AHPA 1TZZA 3QC3A 3IV3A 4X63A 5CEWA 4HNCA 2DT2A 4GI6A 3AZRA 5BZAA 5DCBA 4XO6A 3UXAA 4DIAA 3B4YA 4HYRA 3BAYA 3R8HA 1GOXA 4Q8NA 4WK9A 4C7GA 1QI4A 1F7BA 2PDFA 1PHQA 1VYPX 3AWOA 5JMUA 1JGMA 4EXAA 4HPJA 4P8VA 2VX5A 1GVIA 5DRCA 3PUDA 2PDCA 5L9FA 3CB3A 1CBGA 3OVQA 3UR8A 3PHAA 3KOFA 3MKCA 2RKXA 3H7RA 4RUBA 4J1OA 2YCLA 1OEPA 4S3JA 1RA5A 2FHBA 1M7PA 2YDAA 5LGXA 2CLFA 3O1NA 4HD5A 2EG6A 5AB3A 1E71M 2TMDA 3L4TA 3W1NA 3MY9A 4M8UA 3UJ2A 5A6KA 2WZMA 3OVPA 5HANA 4AHOA 4MFEA 6ALDA 1JXJA 1XIEA 4PB5A 1W37A 2QCDB 1QOPA 1WZAA 2B81A 1B3XA 4UCFA 2VDGA 1G6CA 3TU9A 1VPXA 3EX4A 3U6WA 2O9OA 1WOBA 1XIDA 2FVLA 3B9DA 3IJIA 3L4ZA 2WKGA 5FJUA 3HGJA 4YVVA 1YADA 2YYTA 3VKAA 4NJJA 3KOZA 1L8NA 2QCGA 4OBRA 3T44A 2WVUA 3B9NA 3D46A 3BDKA 3K8LA 2QIIA 1OINA 1CPUA 2Z1VA 1Q45A 1NEYA 1KTBA 1J96A 1J8VA 2I16A 2X7VA 4X0VA 3LN3A 4EANA 3APGA 4M80A 3G1VA 4H8UA 3K4DA 1QW8A 2QUMA 4UXDA 4HK7A 4JTRA 3ZIZA 1V5XA 1XL9A 2G4JA 5C7HA 3BLDA 3TW6A 4AZCB 3RLVA 4DBUA 2QJJA 1TJ2A 1R3VA 2V63A 4W85A 2Z1SA 2D2GA 2FTWA 1FWAC 3H2CA 3PTQA 2BBFA 1EX1A 4PC8A 2V68A 3EB4A 4ZOEA 3MJMA 2ZICA 3SY1A 1VFLA 4JXCA 1OFEA 3UXDA 3EWUA 3S5OA 1LRNA 2GSJA 2VENA 1CECA 4CU8A 3COTA 3ARWA 2R1PA 2IKHA 1LG2A 1MWOA 2PF0A 4O4WA 2DORA 5K4ZA 4C6QA 3FA5A 3JUGA 3RM4A 4UOQA 3W72A 4KH2A 2D73A 2B7NA 3P5YA 4I9TA 3GH7A 3GR8A 3UJEA 3SJNA 5E9XA 1JZ3A 1YXYA 2BS9A 3DCPA 2QUVA 5FL1A 1R3QA 3ARPA 2C3ZA 4L1GA 3ARYA 3HMCA 4UTHA 4EPDC 3VKBA 2VFHA 3CUZA 4HHMA 1J93A 1UKSA 3WF2A 1ZBKA 1IYXA 2A3HA 3WDPP 1F05A 2ZADA 4DI9A 1TPEA 2HQAA 2PP1A 1TIWA 3GNXA 2E0PA 3N2MA 3SI9A 3OZPA 2D0GA 5KINA 3BQ5A 3PB0A 4GKLA 4B3KA 4O0QA 4DWDA 2FMNA 4MB4A 2WVVA 4LC8A 2PP0A 2R82A 3GG7A 3GTXA 5CPMA 3GTFA 5CCZA 1FFRA 1YE4A 3V0UA 2EPNA 1TR9A 1KGWA 2G3JA 1GZGA 3VX1A 1H1ZA 3W07A 4KEZA 5HJXA 2Y5JA 2FPVA 1KM0A 3BOXA 7ENLA 3E12A 5JU6A 2BY1A 3G2GA 3B03A 1T5AA 1TZ9A 4NAFB 4C1KA 2FTYA 3EWWA 1TWIA 4GNJA 5CZKA 5H91A 1NTHA 3WJXA 5I77A 2DZBA 2O55A 3FJ6A 1R3RA 4G1NA 3NQCA 3BJSA 3VIFA 3KOWA 3ITGA 3NL6A 1IWAA 2E1WA 4KWUA 3QYSA 2NQJA 4O54A 1KLYA 3VD3A 4S3DA 3VIPA 1QDSA 4Z2IA 2J47A 1J12A 2QJGA 4JDBA 2E8YA 3EWZA 4L6OA 1LWHA 4DO4A 2IQ0A 3MP4A 4ZO6A 1Q6DA 4QDMA 3GIQA 3W6YA 4A3YA 1B54A 1FWSA 1MI3A 1DORA 4ZCWA 1ZCCA 2QJIA 3UQNA 2GUYA 1YNPA 1SZFA 4HP5A 2Q09A 4C6FA 3AYRA 1XLHA 2Y5EA 3A64A 4C1NA 3M0HA 4I9JA 3PR2A 4RDZA 4HNVA 2XDFA 2VC9A 4KCTA 4V27A 1F3WA 3WK3A 3F4VA 4ZMGA 1E4IA 4DLFA 3K4AA 4MHBA 3GLCA 1GTHA 5T9CE 3N4FA 1B2YA 3WDIA 3GDBA 1O1HA 3ANUA 4JIRA 2YKKA 1EQCA 1X39A 3WLJA 4GJ1A 2Z6JA 4R33A 3W88A 3IARA 1XCXA 2QVNA 1OYCA 2X41A 3ARQA 5LNVA 6TIMA 1C3FA 4GYPC 1Q63A 4JY8A 3BCDA 4LANA 4ERIA 3MBDA 5F4XA 3PZQA 1A5MC 1W0MA 4GISA 1A4MA 1BD0A 1GW1A 2GK1B 4NZCA 4TUFA 1E1CB 4FI4A 4FX7A 4LUSB 1C8QA 2QPXA 2JEQA 1TPUA 2V5CA 1ZUAX 1MW3A 3MWAA 1N8FA 4DZ5A 1PEZA 4J2PA 4M24A 3USBA 2XIJA 4OKDA 2PTWA 1QJWA 1IE7C 1MZRA 3PAJA 1Q6EA 1OWQA 4MY8A 5GPRA 3HV9A 1XD0A 1ZJHA 2ZA2A 1SR0A 3TR9A 1UG6A 3WBEA 3EPNA 3CL8A 2XISA 3TMQA 4J3TA 2O4MA 5C9XA 5LHFA 4FALA 2PWDA 4LQ1A 5A8QA 4WJXA 4QJ3B 3WQ6A 2PI6A 4QM1A 5AHLA 3B4UA 2XH4A 2WJEA 1EWEA 4NJGA 5CPOA 3W7IA 1W3JA 3MCNA 2HBXA 4P7LA 4IQJA 1BXCA 3ZT6A 3KE0A 1O5RA 2QJHA 3MUAA 4GQQA 3NPXA 2TYSA 4NRRA 1UASA 1OVDA 2WBKA 2XGIA 4IWWA 4NILA 4XAPA 3L5LA 1UMLA 4FSAA 1HT6A 1SJBA 1EUAA 1TQXA 4JEJA 1MFVA 3BG5A 3VIIA 3KS6A 4CNSA 2PC4A 2W6RA 5TAOA 2WV8A 2IPJA 4IMEA 3BANA 3LSCA 1AH4A 1UKQA 4DUXA 2YZRA 4D6EA 1LYXA 3ABSA 3WJYA 3TTSA 2J4GA 4JKLA 1XLDA 1JYVA 2Z6IA 4QJ4B 5HMDA 2BGQA 1OC6A 4W93A 3BOLA 2PGFA 3KX6A 3MS8A 4WJ8A 1D9EA 4BS0A 3KHDA 3VNKA 1IHIA 3J7HA 4HN8A 1TWDA 4JCLA 3GO2A 2G95A 2NVAA 3TTOA 3W3OA 2QF8A 2G3IA 5A8PA 4G56A 4F3HA 3UZZA 3GXDA 5HWJA 2ABAA 5KZ6A 2OX1A 4Y2WA 4B5WA 1ZL1A 4ZQMA 3C8FA 5LIYX 3LGGA 4AFYA 3ZVIA 4E3VA 2BSLA 2Z00A 3PAOA 3T78A 4FIQA 4IMAA 1EIXA 1X7IA 4GX8A 3UBPC 3G5EA 1K7XA 2DZWA 1NF0A 2ZUMA 3ANVA 3N15A 1UWQA 4U4MA 1JD7A 5CZ0A 4HPHA 4K37A 3TLQA 1GOMA 2O9PA 3QV9A 2XG9A 3B40A 5KETA 2J7CA 4IX0A 3WD3A 3PTKA 4B3LA