5C6MA

Crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
247
structure length
247
Chain Sequence
MSDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAGDTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFELVKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAGADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAGGVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNLLHTLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Shewanella halifaxensis
total genus 100
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c6mA00
5U7SA 4K39A 5D30A 1B9BA 1OF8A 1KFJA 4O13A 3GB6A 4UNKA 3FFSA 4NUWA 3R2GA 1LRNA 2CU0A 3NQGA 3LX9A 4K36A 3L0NA 1L9WA 3O16A 4PCFA 3PR2A 3JRKA 4IX2A 5D04C 1SQ7A 5KSWA 3Q94A 3LHZA 2VFHA 3PUEA 4OV9A 1XUUA 4WOZA 3QC3A 3DFTA 1M7PA 3NQMA 2VC6A 1CW2A 3TKFA 1EUAA 4Y8FA 5MHBA 3G1YA 4UTWA 3KVKA 1KFKA 1TTPA 3EXTA 3N73A 4QSHA 2EF9A 1ADOA 4MLJA 3W7DA 4JTHA 3GNNA 4GBUA 3LHUA 1S5WA 1OX4B 2J9ZA 1F6KA 1OJXA 1LOSA 3EKLA 1Q6RA 4DO6A 4TX9A 3HF3A 1NAL1 3QMRA 4HHPA 2Y7DA 2A85A 1SO4A 1LBLA 1GTEA 3HGSA 5F2LA 1TV7A 1ME8A 1H50A 3BW3A 1TTJA 2DORA 4DF2A 2LLEA 4KWVA 2R14A 4GUFA 1WQ5A 2VFEA 2YR1A 4JYFA 1S5VA 1TPFA 3BG9A 1GTHA 3ZFHA 4NZFA 1KM2A 4A29A 3G1AA 3S1WA 2ISSA 2NUYA 3N2XA 4IXXA 1W56A 2E6DA 3TV8A 4JNMA 1OFQA 3FYOA 5KZEA 4JR5A 3Q58A 1K7XA 4O0KA 5SWUA 4WY0B 2ZA3A 1G4SA 2QCEA 2PRHA 4OWGA 3W72A 1HG3A 3LGEA 1JCXA 3JS3A 2X1UA 4IMEA 2ZRWA 5G1YA 2Y7FA 4L4LA 5HQEA 3DI1A 1K8YA 4MPQA 4JN6A 4NXKA 1W3IA 2QJGA 4LS0A 3QEZA 1A5CA 5CSRA 3LLDA 3G3MA 4ZQCA 2A5HA 1H5YA 2XFWA 4JTKA 4K37A 2CLHA 3CHVA 3EX1A 4PEKA 3P62A 3M1ZA 3QSRA 2Y61A 3N19B 1YTKA 2FIQA 4M7TA 1XXXA 3P84A 3W7OA 1TJPA 1H7XA 4Z08A 5I3IA 1CI1A 2GPTA 4X2RA 3C2EA 5CPOA 2ZZ5A 2EAWA 3OA3A 3S5ZA 1FBAA 3TUUA 1SZFA 3KX6A 1SW0A 1TV8A 5DY2A 3VNDA 4AHOA 2ZDRA 2O7QA 2PC4A 2NXGA 1I2PA 1EX5A 1H7OA 3TSMA 5BNKA 4ML9A 3W75A 4UNLA 1A50A 3TAKA 4DBDA 4EF9A 3S9YA 1ZFJA 3NPVA 2Y89A 1NF0A 1J5TA 4QNEA 2OZ0A 3ZWSA 4EIVA 3NL5A 4NJHA 4TIMA 1M5WA 1UB3A 1OFEA 1RQEA 2P0OA 2E5BA 3TXZA 4HKPA 3TA6A 1FXPA 4N4PA 2QEZA 4M5PA 3MI2A 2QCHA 1KBJA 1EEPA 2V2DA 5HUOA 4YCPA 5ABTA 3S8HA 4O4WA 4BF9A 3E02A 3BK0A 3LB0A 5G2HA 1X8FA 3Q37A 4CQ8A 2H6RA 3UWZA 5LGXA 2HMCA 1EPXA 1I4NA 5FF3A 2B0MA 3QW3A 4P61A 2Z0IA 3EWWA 3PB2A 4PC8A 4M6QA 4X3ZA 4I9AA 1GEQA 3BVJA 3DH7A 4MZ8A 4DXVA 3L67A 2ZTJA 1H61A 1X1ZA 3PG9A 3W73A 4FIQA 4ZQPA 4M6PA 3G0UA 2XN0A 2X16A 3R12A 1ZAIA 2YXGA 3HPZA 3BGJA 1PHWA 3LRKA 3NL3A 4N9EA 2BTMA 1H51A 5DBTA 4N2YA 4NU7A 4O0ZA 4LNYA 4Q32A 3LERA 3G8RA 4KFOA 3T44A 5C54A 4JIQA 4X9SA 1XUZA 1XFBA 1YYAA 3ZWTA 2C18A 5J5DA 2OCZA 1K02A 3W3OA 2D73A 1JCJA 4MJMA 1PS9A 4LVBA 3OIXA 1FCBA 1ZNNA 3BLFA 2FPTA 3DFNA 1X7FA 4DO5A 1TPWA 2ABBA 3DI0A 3E9AA 3UD6A 1LTDA 4CCDA 1CX9A 2C16A 2E6YA 3R5EA 1GVQA 1NSJA 3QZEA 4K7VA 3STGA 4LV4A 3MP4A 3P8IA 4HN4A 1ME7A 4IMDA 4O54A 3R13A 3W9ZA 5C55A 1NVMA 5KINA 1KM3A 3QF0A 5F4SA 3FEMA 1VH7A 5LNVA 5D37A 3HJZA 3QPYA 4UCGA 2Z6JA 3W1QA 1H7PA 3W2LA 1W5NA 2Y85A 2WSQA 4LT9A 1QDSA 1TPEA 2Y7GA 1ML1A 2NUWA 5F4XA 3YPIA 3WK0A 3NOEA 5KITA 1HO1A 3EWUA 4I7WA 4ZL1A 1EIXA 1EB3A 3O06A 3SW6A 3L9CA 2CLEA 3C6CA 1XM3A 2OJPA 4N9DA 1DHPA 2C15A 4MVAA 4UFHA 2CZ5A 4UIOA 1F73A 2RH9A 3BW4A 3W70A 2R91A 3T78A 3NQDA 3KVJA 2WJZA 5BMXA 1XDLA 4MFEA 4PTNA 1RZMA 1KM5A 5CPMA 3W1MA 3LHWA 3A22A 1LP6A 1VCGA 2GQ9A 1VR6A 3BLIA 3PWAA 3IGSA 2Z2UA 4AF0A 2V30A 2DZUA 4O57A 1G6CA 3G1SA 1S5TA 3EXRA 4QNWA 4UXDA 5EPDA 4LC8A 1VLIA 3NQFA 3FLUA 4RCXA 4TO8A 3NAVA 5F2MA 3SIZA 1MEWA 3QMTA 1D3GA 4OBTA 3RLVA 1O94A 3FKRA 3W22A 2WV8A 3C4UA 5D2YA 5HINA 3GDLA 2YGYA 3LCIA 3W1LA 2PCQA 3WK2A 2ZBTA 1DV7A 3W71A 3I7SA 3W23A 2YW3A 3A5FA 3PVFA 3WK3A 3LXCA 3UQNA 4MKNA 4DO4A 3IVTA 1DBTA 1XKYA 2RDTA 1VPXA 3NQEA 1KTBA 1N8FA 3IVSA 2Q3OA 4IPJA 1LZOA 4QISA 3LTPA 5K9CA 1P4CA 3U8GA 3IRDA 1ZAJA 2QCMA 2VELA 1ZJIA 1LOQA 1XCFA 4O53A 1AW5A 4JDYA 1OFAA 2E68A 1HO4A 1H1YA 3EXSA 3BLEA 1SFLA 4QITA 3E49A 4GJ1A 1EWDA 4C1LA 4FX8A 3KRZA 3G1HA 5HNRA 1VHCA 3TK7A 1E51A 3QSTA 1K3UA 1L6WA 2AQWA 4FNPA 4LVGA 3SY5A 1XI3A 3W88A 3NNTA 3P60A 4UUIA 4LVDA 1WA3A 3IGUA 4RZ4A 1TQJA 1K03A 3U2OA 5I3HA 2VEIA 3TX9A 4RKAA 3L0GA 4XWUA 4M6VA 3MW7A 2WSYA 4YL2A 5HJLA 1VZWA 3S1UA 2NX3A 1PV8A 5IBXA 5K9XA 4XZ9A 5E1QA 4FHAA 3EX6A 3I65A 2A6NA 3LLFA 1FY6A 3GK0A 2ZZ2A 3IGXA 4FXSA 3STFA 1DJQA 5CZ0A 3W85A 1VQTA 4PL1A 5LNSA 3H53A 1QO2A 3L5MA 1GVSA 5AHEA 1KLYA 2NWSA 3SJ3A 3OG3A 1XBZA 3LXAA 2Y70A 1H7NA 2E6FA 3UXAA 4MLRA 1BWLA 1SO5A 1GVRA 2WNQA 4O28A 4YMZA 2C14A 1KFLA 2EKCA 1YXYA 3W76A 1MEHA 5D2XA 3MP5A 4UFKA 5D02A 2BZNA 1GPWA 4YWIA 3W2JA 3TH6A 2V81A 1SFJA 2E1DA 4NJIA 2G5WA 2HS8A 1ICSA 1WOBA 2TPSA 3RMJA 5KMYA 3QMSA 1GOXA 3W7JA 2IQTA 3MWAA 1O60A 1B4KA 4OU1A 2R8WA 4K8EA 3G1DA 4NX5A 4E2DA 5HULA 1JUEA 2ATMA 5T26A 5KTLA 3DXIA 2QKFA 4UFIA 1QNVA 1W1ZA 2KZHA 2Y88A 3TU9A 4LU0A 4QQ3A 1WOAA 3I7QA 1I2RA 1EP1A 5D2TA 3ABRA 5CKSA 1NEYA 3W7HA 1SZNA 2W0UA 3WJSA 1VYRA 4JD4A 3W7MA 1RQHA 3GAKA 2A0NA 4UTUA 3AJXA 5FI8A 1SU5A 2BLEA 3DFQA 3LHYA 4FO4A 5CGQA 4RZ5A 2DP3A 1YXCA 1NFBA 4O52A 8TIMA 1TTIA 3V1PA 4JICA 2ABAA 3N3MA 2CZDA 1KM6A 3LHTA 4IQLA 3G18A 3C8FA 1OX5A 1T8XA 3LCGA 2DU2A 4EOUA 4RLIA 4XBKA 4LW7A 1K7FA 2DZSA 4DPPA 3C2OA 2B4GA 2ALDA 3QH2A 4ICNA 1PCWA 4WOQA 4O16A 3W6YA 2QCDB 4GE8A 3PBYA 3FS2A 4MOZA 1EP3A 4O15A 4EF8A 1IXOA 1EWEA 3O6CA 3QPZA 2ISWA 3H54A 1HUVA 2NXHA 5LNRA 3HGJA 1QFEA 3B0VC 3TSBA 1PVNA 4O11A 2VFDA 2QF7A 1KA9F 1AW1A 1YPFA 3CQ0A 3VFLA 4K7YA 5IBXC 4WY0F 3W7EA 1SZEA 2CZFA 5LHFA 2X30A 4PH6A 2Q3RA 4JXCA 3M0ZA 1FDZA 4WZHA 1A5BA 2WNNA 1G4EA 4RXFA 4UMAA 2C3ZA 2NV2A 5H91A 1MXSA 3N2MA 3EX3A 4R33A 4JDBA 1YDVA 3MHGA 1FCVA 4ZQMA 3FOKA 2YYTA 1V7YA 1B4EA 4B5NA 4DF0A 3UWVA 4LC6A 1OYAA 4RZ6A 3GDTA 3O6DA 1M6JA 2V5LA 4MFDA 4E2BA 3DZ1A 2TYSA 5F2GA 4JGDA 4LRSA 2Y7EA 3S1XA 3UYCA 2WPBA 1G7VA 3GAYA 1Q6OA 5BOOA 3EWXA 4A21A 3LCHA 3W07A 1U83A 3A9IA 4XTDA 2OT1A 4IWWA 4K38A 1T99A 4Z1BA 1XC4A 3M44A 3NGJA 1FWWA 2VKZG 4MY9A 1GQNA 2Q8LA 3NVTA 1D9EA 4FB7A 2Q8ZA 2JKPA 4HT3A 4JTTA 2JK2A 1JJKA 2W79A 3P7YA 4MYXA 4KFNA 1DJNA 5AHMA 2P1FA 1YDOA 5K4XA 1WAUA 4BWLC 2TMDA 4ORIA 1W5OA 5HWJA 2V82A 3EWZA 5AC7A 3NQ2A 3TMLA 3W1AA 2GVLA 4NNCA 5FEZA 3TJXA 3PSWA 1VLWA 3PUDA 2QAFA 3C0JA 3WFAA 4ZQRA 1N7KA 4HIBA 3LV6A 3SGUA 3BV4A 3NA8A 2HSAA 4YLWA 1OYCA 3CLMA 1W31A 1G4PA 3OVQA 4TR9A 4BI6A 2ZZ4A 2F7FA 3T4CA 1FCQA 3INPA 3GR7A 1I2NA 4S2BA 5EBUA 4O4VA 3UZJA 5CG7A 3W74A 4BFAA 1H1ZA 1TPUA 4WXZA 1F5ZA 2E5DA 1QPNA 2ZRVA 2TSYA 3HQ1A 1IIGA 2WSRA 1KM0A 4RR4A 1QO5A 3W1XA 3HPSA 1W3NA 2W6RA 4FIRA 3P67A 2A1YA 4OHQA 1TPB1 1SW3A 4J9JA 4IJBA 1I45A 1OK4A 3NEVA 3P5ZA 3BW2A 1VYPX 3RF9A 5LKYA 4ZMGA 1P5BA 5FF0A 4TMCA 1P1XA 3GYEA 3MJYA 3FJ6A 1R30A 5GVJA 3PBWA 3CTLA 3LI0A 4WD0A 4O1CA 2NLIA 3L0KA 4NJKA 2WKJA 5G1TA 3S5YA 3C56A 4JS3A 4Z0JA 4AH7A 1TQXA 1IXQA 3TW7A 2OMAA 3EWYA 5HWNA 1LDCA 4HNNA 5D2WA 3AO0A 1TIMA 3W1TA 2H8ZA 2V8ZA 3ATYA 3MP3A 4LV9A 5I3GA 4BR1A 1ME9A 2Y62A 3HO8A 3HGOA 3PM6A 1AK5A 2QJHA 1KTCA 1MSSA 2OT0A 3MHFA 4D2JA 1SPQA 3P8JA 4N4QA 3F03K 3W7GA 3MO7A 4FNSA 1FXQA 2P10A 3VKJA 1WBJA 3F4WA 1F05A 4IMGA 4JY8A 4UMCA 4WQ6A 4CQ9A 1RQBA 3DHFA 3M41A 4XKYB 3OBKA 3HB9A 2ZZ1A 1GVOA 3LCWA 3DGRA 4ZVJA 3HGRA 2O7SA 1QOQA 1Q6LA 2DZVA 4O14A 1TPC1 3LBCA 5F4WA 2YX0A 4AAJA 3HBLA 4BK9A 3DFSA 2VFFA 3G0SA 1AL7A 3LDVA 5I3FA 4Y9AA 3CU2A 3MBFA 5TQLA 2XN1A 2ZRUA 3P81A 1XL9A 1LYXA 2QCLA 3MYPA 3TR2A 3SZ8A 3W7PA 5AOUA 1SR9A 2DJLA 5F1UA 3M5XA 4GC4A 1G67A 1OVDA 3C61A 4JTIA 1RPXA 1O5KA 2ZZ3A 1YTEA 5BMWA 3KRUA 1GVFA 1BEUA 4FEZA 4JY9A 4LS1A 2YZRA 1LLWA 4H4IA 1TMHA 4NJGA 3TROA 3W7CA 3W1RA 1VCFA 3PAJA 2NUXA 1K8XA 1PE1A 4ADTA 3I6RA 1L2UA 1ZY9A 4OGZA 5DLCA 1TO3A 4RJEA 2QUTA 4H3DA 1GYLA 2GVGA 2H8XA 4POCA 1S3HA 2G97A 3G22A 1OX4A 4UC5A 4Z1DA 2QAPA 3W7LA 3M5VA 3B4UA 2ZFAA 4IOTA 2CLIA 2GQAA 3VI2A 3KHJA 1X1OA 3LTYA 2NX9A 1H60A 1TPDA 2X1TA 1KW1A 3GXTA 4N9CA 3H55A 1QR7A 4AHPA 1DOSA 3FJLA 3O05A 2ZRXA 4AB4A 3OVRA 1F6PA 5BRBA 5E93A 5G5IA 7TIMA 5U4NA 1D3HA 1Q6QA 1IGSA 1JUKA 1HTIA 4A22A 3FA5A 4U28A 3KVMA 5AHNA 3UWYA 1OHLA 2C6QA 3IVUA 6ALDA 3KOFA 3A21A 4O1BA 2BX7A 5D33A 2NZLA 2E09A 4Y90A 4AXKA 5A8GA 4XBSA 2A2IA 1A53A 5K4ZA 1OX6A 3CEPA 2B7QA 3UY7A 3W7KA 1AL8A 3TNOA 3ABOA 4LVFA 3USBA 1W8SA 4JIPA 4MZYA 3RU6A 4QIUA 4NVTA 4UTJA 3R89A 2VEPA 3LI1A 4WY0A 3O07A 5K2ZA 3G3DA 4AEOA 2RDUA 1SW7A 5I3KA 2BXVA 3EB2A 1JRCA 3M7WA 1O5XA 4QAIA 1KFCA 4PA8A 2A7RA 1OFPA 1KTNA 1OG0A 2NV1A 1L6SA 3S6DA 3UWWA 3QFEA 1LRTA 2I14A 5FEWA 3TIMA 1KM1A 3C2VA 3GX9A 2JBMA 2CW6A 1W0MA 4LTSA 3W7NA 1KBIA 5FEPA 2ZZ6A 4Q4KA 3NZ1A 5AYYA 4MZ1A 5AYXA 1GG0A 1OK6A 2GJLA 2F84A 1X6UA 5D2VA 3UPBA 1T0OA 4HSNA 4UMBA 2VFGA 4LWWA 1P0KA 5EY5A 1EA0A 3DKJA 2WQPA 1AW2A 4DF1A 5DXYA 3TC7A 3TSDA 3WJZA 3UNDA 1C8VA 1EUNA 4RK8A 3R8RA 4LUIA 2JGYA 3QQ0A 4PL2A 5HUPA 5D09A 3GDKA 4MYAA 5J5RA 1DVJA 1L6YA 2A7NA 2QUVA 3M6YA 1I2QA 3L21A 4O1DA 1R46A 1HFBA 3SSJA 5DCDA 4AMAA 2GOUA 5BW6A 4FNTA 2B7NA 1C29A 2YPIA 1OFDA 4O50A 1H7RA 2H90A 2J9XA 3W7IA 2QCFA 3TMQA 2GVJA 2C13A 1R2TA 1F76A 1VCVA 3W7RA 3S42A 4UTHA 1VS1A 5LNUA 2V2HA 2GJNA 4N02A 5KZDA 2QUUA 2X1RA 1KV8A 3PF3A 3TDFA 4O10A 3UWQA 1Q3NA 1YXDA 3KXQA 2EHHA 4UFMA 1ZHAA 2G96A 1DQXA 3KRSA 5IM51 3SGZA 4JTFA 4DELA 1GZGA 4IXHA 4JX4A 1BWKA 2V5BA 3W7QA 3C2FA 1SSGA 4P2VA 3TQ0A 2QR6A 2FPYA 2Y63A 1KV5A 1MZHA 4FNQA 3WJWA 1QAPA 2WO5A 1Z42A 3L5AA 2J9YA 1N55A 3B05A 3S1VA 4BI5A 3M5ZA 1FWSA 3NQVA 5E0KA 4ZQOA 4S2CA 4BWLA 1JQVA 3B0PA 4EVZA 1W5MA 1OF6A 2ISVA 3TE9A 2VOMA 1J4EA 1IXPA 4K6AA 3NPWA 3QRHA 2YFOA 1JCLA 3CT7A 5TIMA 1WDWA 2YSWA 4HPJA 2CFFA 3N9RA 5EMUA 5LZLA 2ZQ0A 3O15A 4NT0A 4ZQNA 3P61A 3IIXA 2Z1BA 3G1XA 4KFPA 4OV4A 1OYBA 5C6MA 1KLZA 1SUXA 3NQ8A 3PBVA 4PODA 4EWND 5AFDA 1VHNA 4Z1CA 3B8DA 4WX2A 4ALDA 5LSMA 3TFCA 1YADA 2PRMA 2QJIA 1JR1A 1RD5A 5L6UA 1DORA 4O18A 1OFBA 3P74A 2VFIA 3LBMA 4GFSA 3GKAA 3NZRA 4Z1AA 3LCFA 2CLMA 2TRSA 4UR8A 1KFBA 3ABSA 2GQ8A 1XDMA 2JKEA 3HG3A 5G2WA 2V9DA 4ADUA 1GYNA 2YFNA 3LM7A 3A5VA 4QM1A 2V0TA 2FQIA 4UTKA 1W5QA 4UFLA 1FWTA 3LCLA 4O17A 2Y6ZA 2ZCGA 4A3UA 4QJ1A 4JTUA 5D38A 3NR0A 1W37A 4KWWA 1Z48A 1GT8A 3EX4A 4AF0B 3UXDA 4E0CA 2UV8G 1HL2A 4DPQA 3HG2A 4LRTA 1VGAA 3WK1A 5K7JA 1GWJA 3FYPA 2ZRZA 3IIOA 4NJJA 3SR7A 3TXVA 5F2IA 1W5PA 4MUZA 4NXSA 2VENA 1LBMA 1K8ZA 4N6FA 4I7VA 4YXGA 1YLVA 2VEMA 1YPIA 2YDAA 3TFXA 2H3BA 1FDYA 3SECA 4FNRA 1TJRA 4Z0SA 1GG1A 4MIMA 4UTTC 1Y0EA 1QWGA 2B7PA 4CCCA 4GWEA 2HTMA 4K8HA 4G1KA 1LCOA 3THQA 1JCYA 4HSOA 4AWSA 4JEQA 3KAOA 3NG3A 4CNOA 4UFJA 3MMTA 3FIGA 3DFPA 2BSLA 1MO0A 3TAOA 1TYGA 3NQCA 3LOTA 1C9DA 3T55A 3TW6A 1PCKA 3PC0A 3QQ1A 3EEGA 4I7UA 1W3TA 3WJXA 1Q45A 1RV8A 3IEBA 3I7RA 2JKAA 3CM4A 1V5XA 5DN1A 4C1KA 2ZZ7A 2HS6A 3D0CA 1TPVA 3NDOA 3EKZA 2V2CA 3BG5A 3CIWA 5FESA 1PIIA 3A23A 5K9DA 3T40A 2PURA 1TRDA 3CIXA 3W86A 2NWRA 2FB2A 1VC4A 2A4AA 2DZXA 4NX0A 1FDJA 2RDWA 2FPVA 3MI3A 1TCDA 1XBXA 1ZAHA 1TV5A 4XTIA 1H63A 3QYQA 4AWUA 3PG8A 2J27A 4H6KA 4CQAA 4XUGA 1DQWA 4JTLA 3M47A 3W84A 1H62A 1AG1O 1WV2A 3A24A 4LVAA 4FNUA 6TIMA 1UJPA 2GUUA 3G1VA 4UTMA 2ZYFA 3GIYA 2QDHA 2FJKA 5HR7A 1SO3A 3L65A 3O8AA 4UTWC 4O8RA 3B03A 2NXIA 1LOLA 2C0AA 4GXMA 3ZS4A 3RK8A 3ZR4A 3W2NA 1SO6A 1DKWA 5CPNA 3B04A 3OHIA 3GZ3A 4DQWA 1SZGA 5AC8A 4JYEA 4IMCA 5KZMA 1KFEA 3M43A 3PB0A 2YCEA 1QPRA 4CNPA 3MUXA 5C5YA 4WJEA 1LROA 4GUGA 3TC6A 1FWRA 2Z6IA 4U4MA 3U6WA 2DZPA 4WUIA 1QPQA 3NPXA 5AC6A 3PBUA 4O19A 5TBOA 3ELFA 2J6XA 3O63A 1NF7A 4GNJA 5AHLA 4A2RA 3GLCA 3LRMA 2YW4A 1WXJA 4LOCA 4WXYA 1ZENA 5G4EA 3W1PA 2QCNA 3P82A 3TQVA 3BO9A 4OE7A 4R53A 4M7SA 5DCEA 3SI9A 5EYWA 2I9EA 5D05A 3MHUA 4R7JA 4JYDA 4XQ6A 5EL1A 4HPXA 1QOPA 4RV8A 5AHFA 4OT7A 1B3OA 1JCNA 2RFGA 4X22A 2ZA1A 2EGZA 4IX0A 5AHIA 1TB3A 4JTSA 4HNUA 1GJPA 1RVGA 5EA9A 1R2RA 2E6AA 5D32A 4LUJA 1LM1A 1ZCOA 4IUOA 2DZTA 3PUOA 1EP2A 3BPWA 5DCBA 1TPH1 1G7UA 3HG5A 1BKSA 1JULA 3UZ5A 5CZTA 1TRIA 1LRQA 1DL3A 2ATSA 3N9SA 3L66A 2CLOA 3CB8A 1T96A 5CZJA 1UUMA 1LBFA 3LHVA 3P5YA 2A6LA 4YCOA 3L5LA 3B06A 5DXXA 3ANYA 4CCEA 4UR7A 4E38A 5LHEA 1J2WA 3EWBX 4IMFA 3LTSA 4Y6GA 5DELA 2QCGA 3NQAA 2FB3A 4BI7A 4AVFA 4N9BA 3JR2A 5AN7A 1JCMP 2CLFA 3M9YA 4ONVA 2DJXA 3IIVA 3DBPA 3OEXA 3BG3A 3DU0A 3EX2A 2QCDA 3E0IA 4UTIA 4FF7A 3N14A 3O1NA 3HPXA 3CWNA 5L9FA 3N34A 1ICPA 3UY8A 1R47A 1AMKA 1UASA 2AGKA 4LY8A 4IGHA 1B57A 3DAQA 4RX0A 1PHQA 3NXFA 3UPWA 1IIHA 2B7OA 1VRDA 3GVGA 3NL2A 5EKYA 2YYUA 5H2ZA 1ONRA 3BARA 3TQKA 1O4UA 5FF4A 3VE9A 4HNVA 1WYIA 3LCXA 3HOJA 3IIZA 1JQXA 5HMSA 4JTJA 4MY1A 3GDMA 1Z41A 1JUBA 5CSSA 3VE7A 1OFRA 1FWNA 2E77A 1UCWA 5AB3A 3DFOA 3NQ7A 3ABQA 1FUYA 1YTDA 1QMLA 2JGQA 3F1QA 2AAMA 3C3NA 3IV3A 1OFOA 2J88A 4NNBA 2FTPA 4ZZ9A 1ALDA 3GKFA 1UUOA 4NZJA 3L2IA 3TJLA 4NQ1A 5DY3A 1P0NA 1PL9A 3G1FA 3QJAA 4MJZA 3B0UX 2QDGA 3CPRA 5DBUA 4S1FA 1R2SA 1VJIA 4NNAA 3FKKA 1FCUA 1LORA 3NL6A 3RFAA 3PSVA 5G2IA 4JX5A 2ZRYA 2PE4A 3GNDA 2EPHA 3MYOA 1SSDA 2OX1A 3C52A 3QM3A 4JTEA 1WX0A 4O12A 3S5OA 1UBSA 4LS2A 3CWOX 4PFMA 5CZSA 3TCEA 4HNTA 3RNDA 1VYSX 3IIPA 4Q33A 4GUHA 3GDRA 5LGZA 3KFTA 3NM1A 3S0CA 1ZALA 4TU1A 1F74A 5FF2A 3STEA 4FXRA 3MI6A 3S5NA 2R94A 2CWNA 2A21A 2I1OA 2NX1A 3OVPA 2CLLA 3NO5A 1F7BA 3WJYA 3E96A 4Y96A 1IXNA 1JVNA 2G95A 1JRBA 3W2UA 4N6EA 4KKXA 2J24A 4UTLA 4ADSA 1O95A 3G0XA 3G24A 3L68A 3GR8A 3K30A 1G69A 1I2OA 3F4NA 3C2RA 3PULA 1XBVA 1K7EA 3W1UA 5G4WA 4L4MA 5FEXA 5FF7A 4GUIA 3NM3A 3ATZA 4R34A 3PS7A 3MBDA 1TREA 2X1SA 3P80A 3NPUA 5HR6A 3HG4A 1ICQA 1QPOA 3GXPA 3I68A 2QCCA 4W9TA 1A5SA 4DBEA 5I3JA 4ORMA 4FX7A 3T7VA 3CEUA 3BGGA 3VCRA 3HMJG 3W2MA 1OABA 4RXGA 1THFD 3GXNA 3LV5A 2XN2A 4JX6A 3HIJA 3G8EA 4O1AA 3W1NA 2BWGA 5A5WA 1WBHA 3W87A 1XBYA 1M7OA 1FQ0A 1TSIA 3RLUA 2VEKA 3NQ6A 4A2SA 4FX6M 1KM4A 4UTTA 3M16A 1YDNA 2CLKA 5C2XA 2PRLA 5LNWA 1LLZA 3DHDA 1F2JA 1A5AA 4OQVA 1QCWA 3CC1A 1H7WA 4CLMA 1FX6A 3W83A 3DENA 3QW4B 5D03A 1IF2A 3E12A 4CNNA 4TMBA 2A7PA 2FLIA 3KVLA 4M19A 5K3VA 1Z44A 5CPLA 3LRLA 2ZTKA 2FDSA 1U5JA 2C19A 2E5CA 1MEIA 4IPIA 3W2KA 2RKXA 2VXNA 2DZWA 2WNZA 3V75A 4MY8A 2X2GA 4AHQA 3STCA 3Q2DA 3LXBA 1BTMA 1I8JA 3THAA 3PY2A 3SFKA 5F1VA 1W54A 3DKLA 2ZA2A 4GUJA 2RHGA 1G4TA 3NYZA 5AYZA 4DEFA 2CZEA 2FFCA 4GRSA 3O6YX 5HWMA 2H3DA 1RR2A 2C1HA 4JTGA 2WOQA 1TTQA 4XKYA 3M5YA 3UWUA 4AWTA
chains in the Genus database with same CATH superfamily
3BURA 5U7SA 4K39A 3GB6A 4A3YA 1WKFA 1LRNA 2O56A 1XLGA 3L0NA 2H9AB 1L9WA 2PF0A 2F6KA 4TTUA 3S9IA 1JXKA 5CC3A 4H01A 4IX2A 4MKVA 1VAHA 4WSHA 3PUEA 4QCEA 4WOZA 1T7LA 3NQMA 2VC6A 1CW2A 3G1YA 1KFKA 1OCJA 2EF9A 1SVDA 3EB3A 3KWSA 3GNNA 1A5NC 1OJXA 3HV9A 1O1HA 4JHMA 3EKLA 1Q6RA 4DO6A 3HF3A 1W91A 3HTWA 4HHPA 4ERIA 2Y7DA 3UVIA 2NSOA 3CZKA 4F8XA 3D3AA 3FHAA 3VIIA 2YDRA 4DF2A 2WSPA 2YA1A 4Q8TA 2WMHA 4KWVA 3GHTA 3VD3A 2POZA 3QOMA 3DCPA 5AC4A 1WQ5A 3I3BA 4JYFA 1Q63A 1TPFA 4NAEB 3RDKA 1GTHA 1KM2A 4A29A 3VILA 4QG6A 3S1WA 2NUYA 4E4FA 1W56A 1EZ2A 1OFQA 5KZEA 3IAPA 3EPMA 4WDXA 4GQGA 4PMVA 1CECA 4E2OA 1W3HA 4V1XA 1G4SA 1SJCA 3UF9A 3KTCA 1VIZA 2X1UA 4IMEA 2ZRWA 1NOWA 3FW6A 4TVDA 5G1YA 2Y7FA 4L4LA 4EXQA 3DI1A 1X96A 3L4UA 3IV8A 4FLRA 1H49A 2WKLA 4NXKA 2WK2A 1GKQA 1GUVA 2YLLA 3PZ9A 4FLSA 4CNSA 1EC8A 1WKEA 3AIWA 2A5HA 1XQLA 1H5YA 4E2VA 5A6JA 3CHVA 1JZ6A 2Y61A 3CXOA 1YTKA 1AH4A 1BXNA 5JXQA 1TJPA 1H7XA 4Z08A 1EJRC 3D6NA 1KB3A 2GJRA 4X2RA 3WH5A 3C2EA 5CPOA 5CSYA 5T9BG 3OA3A 3TUUA 3KX6A 3CV6A 2J6VA 1TV8A 4AHOA 2WSKA 4CCZA 2NXGA 3IPWA 1UR8A 2FHBA 1QWKA 2WVVA 1ISXA 2XIQA 4GI9A 3WX7A 1BYAA 3C86A 1V77A 3MKKA 1QXLA 2E28A 4O8AA 3NPVA 2Y89A 1UC4A 3WQ4A 4MWAA 3WLLA 1F61A 1XP3A 3ZWSA 2O0TA 3T0BA 2QYGA 2ODOA 4NJHA 1JAEA 3TXZA 4LGXA 4AD4A 1GOQA 8CGTA 3E1F1 3S8HA 1TR9A 4BF9A 3SB0A 1HNYA 2NW0A 1ENUA 5G2HA 1US2A 2H6RA 3UWZA 5LGXA 3TYEA 4GD0A 1SM9A 1SZRA 1EC7A 5EMYA 2DY3A 3EWWA 4X3ZA 5T9CE 1PX4A 1GOOA 4MZ8A 4MDPA 3W73A 1X1ZA 1LUCB 4JQ2A 2ZXAA 2DIJA 2X16A 3R12A 3RGTA 4I9MA 4J3WA 1QI2A 1TG7A 1U1HA 4B4FA 2EKGA 2PAJA 1CNVA 3RR1A 2BTMA 4WCJA 4XZBA 3JVAA 4NU7A 4LNYA 3RO6A 1DXIA 3PTMA 2F61A 4KFOA 4JIQA 3LSCA 4H6EA 4W5ZA 1RBAA 2OCZA 1K02A 3DG7A 5CJNA 2D20A 3BLFA 3UT0A 3U7VA 4DO5A 4S3JA 4L4PA 4X61A 3ZJ6A 3WNPA 2ABBA 3E9AA 3UD6A 1CX9A 2OYMA 3SRDA 3DYOA 5BYWA 4Q7NA 1GVQA 4WHBA 4X63A 4LV4A 3NSXA 4HOWA 4IMDA 4J3UA 3UG4A 1VKFA 1E1CA 3QF0A 4XZLX 3VNZA 3WENA 3FEMA 1VH7A 5D37A 2WNWA 2E8ZA 3HJZA 3QV8A 2Z6JA 3W1QA 3W2LA 4MDOA 3CZLA 3QLLA 4AZIA 1QDSA 1LG2A 4HCHA 2NUWA 2GSHA 3QHOA 5A6LA 2UWFA 3NOEA 1HO1A 3VOIA 4DVOA 1P0DA 4EK7A 2OEJA 9XIAA 4HMNA 4XAFA 4ZSTA 3H2EA 4DRSA 3ABXA 4N9DA 3USZA 2Y2WA 4HD5A 1E6NA 4UFHA 4UIOA 2RH9A 5FL1A 1H4PA 3W70A 2XIBA 1WPCA 3NQDA 4WKHA 1NJJA 2WJZA 2DSWA 2X05A 1EH9A 5AKQA 3WFZA 1VCGA 2DVTA 1VR6A 3PWAA 3UR5A 1FWDC 1TWIA 4YHGA 4KBXA 1GKRA 3VGEA 4AIEA 3EXRA 3QN3A 4L1WA 5H8MA 3WF0A 1VLIA 3FLUA 3F2CA 4TO8A 4QJ5B 5F2MA 2E3ZA 4DJED 3RLVA 4DUOA 4IG2B 3PZUA 3C4UA 5EFFA 5HINA 3H26A 3W71A 3ANVA 2YW3A 2DSKA 2WWDA 3CMGA 4HNCA 4ATWA 4MKNA 3IVTA 4PRWA 4A3RA 1DBTA 1ZJAA 1FKWA 3DFYA 4QISA 3U8GA 2VR4A 5A95A 4C7DA 1GJUA 3AHYA 5BOEA 1XCFA 2YXOA 3ID7A 4YTUA 1AW5A 4JDYA 4CGTA 1HO4A 4EXBA 1IEXA 1K6AA 4PTDA 1Q7ZA 4QITA 1E9ZB 2C1IA 3E49A 5HANA 3K5XA 1KBBA 4GJ1A 1MUWA 4C1LA 3V0UA 4B92A 3LPOA 1E51A 1LWJA 3QSTA 4JQ3A 5D4YA 3U2ZA 4GI6A 2Z1SA 4UUIA 4LVDA 1WA3A 3W81A 3QGAC 4RZ4A 3B8UA 1QK2A 3IJ9A 2NT1A 2CHRA 1IV8A 1AODA 1X1NA 3SCNA 4RKAA 4GVFA 1O68A 4MNJA 3MW7A 1UWTA 5M17A 4YL2A 1JNEA 4XZ9A 2PDYA 3GNPA 3IGXA 4H1ZA 1VEOA 4DNMA 1DJQA 3W85A 1QO2A 3L5MA 2BS9A 2QS8A 4Q4QA 5DF0A 3KBVA 5A6BA 2Y70A 1XYCA 4MLRA 1BWLA 1SO5A 3K4AA 3WN6A 4YMZA 1KFLA 4W85A 2EKCA 2VX7A 1MEHA 5D2XA 3WF1A 4XAPA 1B3YA 2RUSA 1Q65A 4QBXA 4AISA 1GPWA 3MMUA 3W2JA 1QASA 3ABZA 4U2YA 1SFJA 2ZADA 4HA4A 4C6FA 1WOBA 2TPSA 1RBOB 1GOXA 1XGEA 1B4KA 4X9YA 4OU1A 2R8WA 3R0UA 3XIMA 3BLPX 2FGZA 5HULA 1JUEA 3NXLA 1UWQA 2OB3A 2QKFA 1QNVA 2KZHA 4JFTA 4LU0A 3I7QA 3ABRA 3EAUA 3CZGA 3V0SA 1NEYA 3W7HA 4CN1A 1SZNA 3WJSA 1LQAA 2V67A 4JD4A 2G41A 1M53A 4WGHA 4C6OA 2BV9A 5DFAA 5LIXX 3AJXA 5FI8A 8XIAA 4RZ5A 5IRPA 1TTIA 4JICA 2ABAA 3LN3A 4H7ZA 1UD4A 4NYUA 4IQLA 3W6MA 1KWGA 3LCGA 3HPFA 3S5SA 3KL5A 4LW7A 1K7FA 3ZLHA 3LZ5A 4WOQA 4O16A 1AQFA 1VFMA 3CQHA 3W6YA 3EA3A 3PBYA 4QS5A 4QEHA 2RJHA 1EP3A 4O15A 4MOZA 1B1YA 1EWEA 1MQPA 3CIVA 2J7BA 3SCSA 1BG9A 1HUVA 4GIAA 3RX3A 3HGJA 1PVNA 2P0IA 5EMJA 1HP4A 4KWUA 1QW7A 1FWBC 1KCLA 4JEJA 2YXXA 2I5QA 2MANA 2CZFA 1ZJBA 1FDZA 3VKKA 3QTPA 3AOFA 3OBAA 4YU1A 1XJBA 3G1RA 1MXSA 3N2MA 1P0BA 2YJQA 4H8UA 4MAZA 4OTKA 4R33A 4US6A 4C6LA 2BY2A 3MHGA 3W24A 2PBGA 2YYTA 1B4EA 2BB0A 1JZ5A 4E4UA 1OYAA 2R1KA 1Q6CA 3F4DA 1I75A 1M6JA 3O6DA 2V5LA 1GNXA 4MFDA 3GU9A 4XISA 5MKGB 4E2BA 1KGUA 1H5VA 3DZ1A 3GIPA 5F2GA 3DUGA 1XICA 3CH9A 4RDWA 1C8QA 3BWWA 3QY6A 4A21A 3WQGA 2FMOA 3W07A 3A9IA 3GHUA 1MVYA 3AMGA 1OGBA 4K38A 3ZT5A 1T99A 4S39A 4UB9A 2VKZG 3NVTA 2XM1A 1DTUA 2OZ8A 4EXAA 4O1EA 2JKPA 1YX1A 4I6VA 3W28A 1F07A 4C7GA 3WDIA 4KFNA 1YDOA 5GJNA 4ORIA 3R94A 3W1AA 5ABEA 4NNCA 3TJXA 3A4AA 1P7TA 4KEZA 3PSWA 1C90A 3TYCA 3GU2A 1R3RA 2Z1XA 1B3XA 2FZDA 4JHOA 3BDKA 2NSXA 3AAMA 1OYCA 1KXHA 1WKDA 3QZ6A 1G4PA 3OVQA 3OIHA 2ZZ4A 3W37A 3KZPA 4O4VA 3CZEA 4DWSD 1H1ZA 3MUCA 5HAOA 3WUEA 2GDQA 2TSYA 4DZAA 3SO7A 1KM0A 4RR4A 1QO5A 3WMBA 2XHYA 2QF8A 2VP8A 3GVRA 2D0GA 1IT8A 4P8VA 1TPB1 8A3HA 3NEVA 1DWIM 2PS2A 1KNWA 4S3GA 3RF9A 1XPYA 3PN8A 3MDUA 3OTRA 4TMCA 3F5KA 3ITGA 3MY9A 5GVJA 3PBWA 5G1TA 3S5YA 2WKJA 6A3HA 3S4TA 5CJMA 1TQXA 3E0VA 4MAVA 5HWNA 1LDCA 5D2WA 3W1TA 2PGEA 2QV4A 2H8ZA 2V8ZA 2HXTA 1F6YA 3WO8A 1G94A 3WH9A 5FIPA 3HO8A 1F3XA 3PM6A 1JEZA 3WF2A 1XQKA 3CK5A 1NU5A 3WIJA 4PMYA 4Q4PA 3CUXA 1OSEA 4BJHA 1FXQA 2P10A 1R38A 4JY8A 3QOKA 1OY0A 1UQYA 3OBKA 5M1TA 1G9HA 2ZUNA 2AGTA 2PDUA 2ZUWA 2J79A 3A4WA 1GVOA 3AYRA 4ZVJA 2CIPA 5AYBA 1QOQA 5HDRA 1JF5A 4O14A 2O9PA 5F4WA 3S1GA 2YX0A 3EA1A 3ZR5A 3SRFA 2XFFA 5DRCA 1XIHA 4Y7EA 4UQEA 4Q8PA 4JTQA 1AL7A 3LDVA 5I3FA 3L2MA 2AAAA 5TQLA 1SFTA 5GPRA 1UG6A 3PPCA 2KX9A 1JYWA 3SZ8A 4GH1A 1OBAA 3ARZA 4HU4A 3ME3A 1OWQA 1KRBC 3C61A 1RPXA 4A8IA 1S1PA 3KRUA 4LS1A 3S2MA 4IPNB 2YZRA 3WNOA 1LLWA 2DZBA 3HQNA 3MMDA 3W1RA 1OT1A 1XLKA 3PAJA 4J40A 1F8IA 5IDIA 4ADTA 3RJXA 4AZHA 3I6RA 1L2UA 2Y4SA 4OGZA 4PUKA 1XH1A 5DLCA 2WZMA 4PMRA 1GYLA 3SQSA 2WPGA 3H2CA 2PDXA 2QAPA 3TLQA 3ARTA 2CLIA 2ZXQA 1X1OA 3KHJA 2NX9A 2V6AA 3C2YA 3CQIA 4S3EA 9RUBA 3I4KA 2DH2A 3FJLA 4S3BA 1V6UA 3OVRA 1F6PA 4I9TA 4HMEA 2X09A 7TIMA 2HE5A 1J8VA 3BC9A 2V5DA 1EHNA 1HTIA 2QPSA 4LY4A 3E5BA 3SUUA 3RRAA 3SADA 3KHDA 4M81A 3KVMA 3UWYA 1PKLA 4MPKA 3A21A 3WLJA 2BX7A 3NUKA 2PC8A 2NZLA 4Y90A 2X7WA 4XBSA 1QBBA 4M3PA 1GEHA 3CAVA 3W7KA 4IJRA 2F2KA 4KPLA 3RU6A 1JAKA 3LI1A 1CXIA 2VGGA 3CHEA 3EA2A 2PDHA 4IIDA 1V51A 4RL3A 2EEXA 1KD0A 3M7WA 1RUSA 4QAIA 4A8NA 1L6SA 3QFEA 1QNOA 1FWFC 3C2VA 1OD8A 2G3MA 5I06A 5G4HC 3AUOA 4R7WA 2WMKA 3QVQA 4Q4KA 4PTWA 3N15A 3NZ1A 2WVVB 4H9XA 4AY7A 4AQLA 1MW0A 4XZIA 2DSZA 3APTA 2XDFA 4HSNA 1GZJA 2VFGA 1VD6A 1P0KA 5EY5A 1EA0A 1DP0A 1J79A 4PEEA 1W9DM 3TSDA 3WJZA 1GOKA 4EACA 1EUNA 1IWBA 1QRQA 3OGRA 4IPPA 5J5RA 2WC3A 1A3WA 2YBUA 3C0SA 3CS2A 1FRBA 4AMAA 2GOUA 2FH6A 5FACA 4J4KA 4C60A 2O9RA 2DW7A 2VYOA 4Q8NA 2H90A 3WKZA 2QCFA 4XIMA 2X0HA 1R2TA 3W7RA 2P3EA 1AD1A 2J77A 3EPOA 3TCSA 2QUUA 1UP2A 3HV8A 4QEEA 3WDQA 1PKYA 3TDFA 3PZOA 1Q3NA 3DG6A 1QNQA 1O5QA 4JNYA 2DIKA 2EHHA 3K4WA 3ES8A 4UFMA 1DQXA 3CWHA 3VD4A 4CD8A 4DELA 4NI8A 5BROA 4ZXOA 4BY3A 1CEOA 3W7QA 3C2FA 3QR0A 2QR6A 4AIOA 2ACQA 2CERA 4FNQA 3WJWA 3U9IA 2WO5A 2WWCA 1GQIA 4HB7A 3TVAA 4HYWA 3M5ZA 1FWSA 3NQVA 5E0KA 3T42A 1W5MA 1O66A 2AL1A 1LG1A 2VOMA 1J4EA 3LMYA 5E0FA 2VEGA 2YSWA 1AFSA 4D6EA 5EMUA 1HX0A 1X8CA 2NVCA 1E40A 1RA0A 2G0WA 2ZQ0A 3BOLA 4D6IA 2UBPC 4NRSA 3P61A 4XAYA 3G1XA 3RCYA 4MNMA 1SUXA 4EWND 1GQLA 1ITCA 3SN0A 1JYVA 5E70A 1E1CB 4B5WA 5L6UA 1HF6A 3VIFA 1OFBA 1QT1A 4Z42C 3IJ8A 2VCBA 5CAKA 4QRNA 4KT2A 3ARPA 4L61A 1E6ZA 4H9UA 4DN1A 1WXZA 3LCFA 1BF6A 1O5RA 3FY1A 1PTGA 3POHA 2ZC8A 2HRWA 4BF5A 3ARXA 2MNRA 4AD0A 2V3DA 3PZTA 2FQIA 4Q8OA 1EJ7L 1BVNP 4O17A 2ZCGA 4MHBA 4A3UA 5D38A 1W37A 4GXPA 3U4FA 2YDSA 1EJWC 1GQJA 1GT8A 1Q13A 2UV8G 3O0KA 3HG2A 4DPQA 1VGAA 1GWJA 3FYPA 1US0A 1H11A 5C70A 2ZX7A 4OBSA 5F2IA 3MSYA 3XINA 5DO8A 3UPMA 3A4XA 4GYKA 2J7GA 1U30A 4I7VA 4C1NA 1YLVA 3WNNA 3HQPA 4J2PA 3TFXA 1RY0A 1PB0A 4Z0SA 1GG1A 2XVNA 4CCCA 3K8LA 2HTMA 4G1KA 1Y5VA 3KAOA 4W93A 1TMQA 3AU6A 4ACZA 1BF2A 3LOTA 2W3ZA 3LYEA 4HJWA 3LU2A 3PC0A 3QQ1A 4ASTA 9CGTA 1GPFA 3EEGA 3WUFA 4I7UA 3LA4A 1UA7A 3GS6A 3IEBA 1I0DA 2JKAA 4W8LA 1XIDA 2IKHA 3C5QA 3ZOAA 2XWDA 4QR6A 4K8GA 5IFPA 2XJ7A 2CHOA 2VDIA 1P6WA 3WDRA 5LXXA 3VX1A 3BG5A 3OPSA 3L12A 5K9DA 1BG4A 3MVIA 2DZXA 3LD5A 4NX0A 4YN5A 2ON3A 3MI3A 1XBXA 1ZAHA 3VD7A 1IZCA 2DUZA 4B15A 1W9VA 3QYQA 4DJEC 4H6KA 3GNOA 1UMLA 3W84A 1PEZA 1ZTVA 3P2VA 4LVAA 4KRZA 3OP2A 1UJPA 3ITYA 3K8MA 2XIMA 4QE1A 1RLCL 4GZEA 2O9TA 1OC5A 2FJKA 1SO3A 1EGMA 2ISFA 2NXIA 4LPCA 3P0WA 4MGGA 1LOLA 1S2AA 7REQA 4ACYA 2XIOA 1Q4NX 3CUGA 2A3CA 2P53A 1PWLA 2G4FA 1W1TA 1UZDA 3M43A 2YCEA 3QV7A 4DJFD 4UOJA 1ZBWA 5EMKA 4WJEA 3OZYA 4U4MA 2NQLA 2DZPA 1MZRA 4DHGA 3PBUA 3GHRA 2FGBA 3IANA 5AHLA 2YW4A 4U33A 2OELA 2WHKA 4TX8A 5I7GA 1HT6A 4B2DD 4ERGA 1BVWA 1W1PA 2WLZA 4XQ6A 3CO4A 3IJ6A 4HPXA 4X22A 3FEQA 2EGZA 3VIGA 1TB3A 4JTSA 4TOQA 3LGGA 4G7EB 2PZNA 2WCSA 1ZBKA 5XIAA 4GCXA 3F5LA 3AS2A 4GVGA 1EP2A 4F3HA 2DH3A 5DCBA 2NVAA 2ZUVA 4AY1A 3K1GA 4LJ3A 5E6YA 1BKSA 1JULA 4XD6A 3PZQA 1DL3A 3G6MA 2ATSA 3N9SA 3L66A 4RE0A 3LHVA 3P5YA 2A6LA 1IWPA 3L5LA 3B06A 2YL9A 4Y6GA 2PWUA 5DELA 3PWGA 2VNCA 4FXFA 1D3CA 5AN7A 4HA0A 1CGYA 4F2TA 3GO2A 3W26A 4GI4A 2QCDA 3IUDA 4UTIA 3WLHA 6TAAA 3OU8A 3P14A 1DQUA 3N14A 3O1NA 3HPXA 1E4IA 1ICPA 1AMKA 4GYJA 7ODCA 4RX0A 3VNKA 3GVGA 3NL2A 5H2ZA 1EYEA 3HN3A 4F9JA 1O4UA 5FF4A 3VE9A 1TZ9A 2VM8A 4Q22A 3GDMA 2IMRA 5CSSA 4JAWA 4XB3A 1E6RA 1JI2A 1EYWA 1XIGA 4XD5A 3VX0A 4H9MA 1YTDA 3AIVA 2JGQA 3APGA 3AMDA 4LCSA 3CO8A 3IV3A 1AQHA 1OFOA 3T2OA 3BAIA 4I9JA 4ZZ9A 2QDDA 3KBSA 3ORWA 5ENLA 4IP7A 1JPDX 1VF8A 4IQEA 3TJLA 4JFWA 5DY3A 1JDDA 1PL9A 3VABA 2Z28A 1V0LA 2Z25A 1VJIA 1LORA 4GQRA 3PSVA 4GMEA 2VQUA 3G2GA 4JX5A 3ZO9A 4PRTA 2JEQA 5I0DA 3M4HA 3MYOA 3ENLA 1BD0A 3C52A 4DLFA 3V1HA 3WLPA 3ERPA 1UBSA 3GZAA 6REQA 3EWDA 1P43A 5CZSA 4C6JA 1P7TB 3JW7A 3GDRA 5LGZA 4B5SA 1ZALA 3MI6A 2R94A 2BHYA 4XUYA 2RJGA 3N6HA 3A3HA 3BJTA 2CLLA 1F7BA 3U5YA 2PWDA 4MJ2A 4LFYA 3E96A 1IXNA 1JVNA 1E0WA 2G95A 4LNCA 1NWUA 3W2UA 4N6EA 4KKXA 1IZJA 1RCOB 6XIMA 3G0XA 3G24A 3ARWA 4OZOA 1PZ3A 1UA3A 3C2RA 4M82A 3PULA 4KWSA 3AZRA 4FOKA 1J0JA 1XYFA 3RO8A 2ZXDA 2X1SA 3NPUA 1OQFA 1CGVA 5TF0A 3WNLA 4KCUA 1AMYA 3HURA 4DUWA 3BGGA 3VCRA 2YBVA 3ITXA 4RXGA 3LV5A 1ZUAX 3G8EA 2OLHA 3E2VA 1WBHA 3AS1A 4IP4A 4RNFA 3EDKA 1FQ0A 1TSIA 2BBFA 4WGXA 3NJ3A 3M16A 4KCVA 3UG3A 2PRLA 1H09A 3KUMA 4P7RA 3M64A 1H7WA 4QS6A 1FX6A 3W83A 1W3LA 4CQBA 5A6KA 2PB1A 4CNNA 2BGSA 4TMBA 4G2DA 1XCWA 2ZTKA 1GZ1A 1DWFM 4A6GA 3W2KA 1HKMA 1ZB5A 3T07A 4DWSC 4MY8A 2ZVIA 3H21A 2OODA 3DGBA 3PUGA 2DVUA 3STCA 2W5FA 1BTMA 5F1VA 1W54A 2ZA2A 4GUJA 1HQTA 2CZEA 4GRSA 3MCOA 3OGSA 4DBSA 5MF5A 3WEZA 3ARUA 3BQ5A 5AVHA 1D7KA 4D1JA 3VVGA 2REQA 1B9BA 1OF8A 1KFJA 4O13A 3KS5A 3FFSA 3NQGA 4DJEA 4GIEA 4JIHA 4AZ7A 4FP1A 2C1GA 2YCLB 3PR2A 3JRKA 4AWEA 3QV6A 3V4BA 2VFHA 4OV9A 1BAGA 4C6DA 3HU7A 3DFTA 1TX2A 4Y8FA 3LNMA 3KVKA 1TTPA 4NP7A 3W7DA 2GSEA 4A35A 2WW5A 1S5WA 1IZKA 2WZHA 3Q65A 2BVDA 3LLXA 3QMRA 3GW3A 3QPEA 3BCJA 4TVUA 3SN1A 4QROA 2FKPA 1MFUA 1ME8A 3WZ0E 4NAFA 3EEZA 1XS2A 2R14A 3IGHX 1NQKA 4E8GA 4ZB2A 5CAHA 1XRFA 3BCFA 3BG9A 3VPLA 3KWXA 3TTEA 3R0DA 2P8CA 1OB0A 2ISSA 4H2CA 3TV8A 3CJPA 4JR5A 3WMCA 4L80A 1V3JA 4F2UA 2VD9A 1JDEA 3GC4A 4JTDA 4YS1A 4OWGA 2FJUB 3OQ8A 3W72A 2XH0A 3LGEA 1JCXA 3ZR6A 3U5UA 2XVKA 3WLNA 3DOPA 4MPQA 1C93A 3GVVA 1ZLPA 1EZWA 1A5CA 2DIEA 2J7DA 5LYRA 4JTRA 3G3MA 2QGYA 3PWIA 3DBNA 3EX1A 3M1ZA 3N19B 2FIQA 2O9OA 1F3WA 2XZ9A 3GBDA 3P84A 4L9YA 4P7NA 3W7OA 3SEPA 4QTGA 1CI1A 2GPTA 2WM0A 1QNSA 2EAWA 5CEWA 1FBAA 1SZFA 3LMZA 2PSNA 2O7QA 4GVIA 3COTA 3NVDA 4ML9A 2DT3A 1MWOA 4D9PA 4UNLA 1A50A 3TAKA 3S9YA 3RCNA 1ZFJA 3VO0A 2CCRA 1EDTA 1KFWA 1NF0A 1R9ZA 1J5TA 4YNGA 2OPJA 4BS0A 3NL5A 4TIMA 1TWZA 3E0FA 3IJDA 1UB3A 2P0OA 4ZR8A 4PMUA 3VIHA 4AG0A 2R24A 3TA6A 2QEZA 4M5PA 3CZ8A 4DM2A 3MQTA 1KBJA 5HUOA 2NQ5A 4YCPA 3GTHA 3E02A 5H1WA 3BK0A 4TQTA 3LB0A 1X8FA 3Q37A 4CQ8A 3TP4A 5LA1A 4HVXA 1W9XA 2Z0IA 3PB2A 4PC8A 4I9AA 2BDQA 1ISYA 3BVJA 4MSSA 2OEKA 4XIAA 3L67A 1UD6A 4KCWA 1H61A 3PG9A 4ROQA 3EOUA 1FOBA 3HPZA 5EMLA 1U2YA 1ZZMA 4KEMA 2QIWA 3NL3A 1TWWA 3C3UA 4N2YA 3LERA 2QQ6A 3G8RA 3T44A 4QDMA 1GYMA 3ZWTA 1YYAA 4U10A 3TTYA 1JCJA 4P8UA 3A3WA 4UZSA 2FPTA 3SCTA 4YVXA 3DFNA 1FWJC 1TPWA 4A3HA 3T09A 3SUVA 2C16A 3R5EA 2QMKA 3EDFA 1NSJA 1UKTA 4K7VA 4HN4A 1ADSA 3FA4A 3R13A 3WMLA 5C55A 4GQ0A 1NVMA 5KINA 2HXUA 5HBFA 2PD5A 2E9LA 5LNVA 3IARA 4OOZA 4UCGA 1BYDA 2Y85A 4XAZA 3ARVA 1ISVA 1TPEA 2Y7GA 2DT2A 1I0BA 2H9AA 4IGNA 1TJ2A 3IK2A 1J12A 4I5RA 2VRKA 3EWUA 2GOKA 3N1AA 4ZL1A 1EIXA 4MB1A 1EB3A 3O06A 3SW6A 4FPSA 2O4MA 1EEXA 4I8YA 3C6CA 4PBEA 3QR1A 3A13A 2CZ5A 2XG9A 4R5EA 1BYBA 4GJJA 4QP0A 1HJVA 4J35A 1GJWA 2J7HA 4MFEA 4PTNA 4C1NB 1KM5A 3H4XA 2FHFA 3OZMA 3A22A 1LP6A 2GQ9A 3VINA 2WMJA 1SJDA 1G6CA 5A2AA 2HK0A 2X1IA 4QNWA 2EPKX 4UXDA 5EPDA 4LC8A 4RCXA 1K1DA 3AYVA 4J3XA 3SIZA 1MEWA 1D3GA 4M1RA 1XLAA 3FK4A 1OGGA 5CPTA 2WHJA 3BE7A 4DWSA 2QJNA 4ACZB 3I6TA 4HZ7A 5ABFA 4GY7A 2YOCA 3I7SA 3W23A 1YNQA 3A5FA 3UQNA 1JZ2A 2PTWA 1EJUC 2FH8A 1JL8A 5G1MA 3SQMA 2RDTA 3NQEA 1KTBA 1N8FA 4Z2IA 2WMIB 4IIHA 3GY1A 1G01A 3LTPA 3BGAA 3WLSA 4QHRA 2VELA 3CYJA 1XG3A 3O6AA 1QHOA 1V3KA 1OFAA 4HJFA 1M04A 2GGIA 4DLMA 4AD1A 4Q3MA 3PJUA 3WLRA 2NT0A 4DWDA 1SFLA 4IIFA 1MQRA 1K9FA 2PBOA 4S3AA 3G1HA 4Q8UA 2C7FA 3TK7A 4NYYA 1K3UA 3SY5A 1XI3A 4GQBA 3W88A 3P60A 5HA7A 3VCNA 1TQJA 1DXEA 4F9DA 1EHAA 1XLBA 2ZX5A 1K03A 1LF1A 1UR3M 1UMYA 2VEIA 3TX9A 2CBJA 2XH2A 3AIBA 1FWHC 2VX6A 4Y8EA 2WSYA 1VZWA 5IBXA 4C5YA 4LUYA 7REQB 2J25A 2QDEA 1J5SA 3LLFA 5H6HA 2ZZ2A 3N4FA 2FHCA 3V16A 1R9XA 2PDPA 1VQTA 3H53A 1JDFA 5AHEA 1KLYA 4RNHA 4ILSA 1ECQA 4L4OA 2E6FA 3AS3A 1T41A 4Q8VA 3BSMA 2WNQA 1U5VA 4OFCA 3W76A 1D7FA 3WEOA 1OEPA 3MCMA 3VYLA 2BZNA 2VI0A 3LEPA 4CNUA 2QLYA 5CC7A 3L4TA 4NJIA 4ENLA 2HS8A 3RMJA 1F4AA 1O60A 4OUIA 3DESA 3T8LA 4NX5A 1QTWA 4RDZA 2ATMA 2I5IA 3DXIA 4UQCA 2A3AA 1DHKA 1DIEA 1XLLA 4ZSUA 4LAKA 3GXMA 4JCMA 5JU6A 5D2TA 2HV5A 1K4GA 4TX6A 1WDSA 2D22A 2ZDSA 2PUZA 3LPFA 3WBWA 1RQHA 3H7VA 3W0KA 4UTUA 1DPMA 3CAWA 1E43A 1TVLA 4QXIA 4W8AA 1G5AA 4DJFC 2CZDA 4ZFCA 1KM6A 3LHTA 5FJIA 3C8FA 4NRRA 3LPPA 2YDQA 4EOUA 4RLIA 1BXBA 3WDJA 2WBGA 5DT5A 1DIKA 2WMGA 2B4GA 4ZBCA 1PCWA 2J7FA 3EOSA 4Q8MA 3SFWA 2QCDB 3IS4A 1TVPA 3FS2A 4JN8A 4EF8A 1GOIA 3N29A 1W32A 3RG6A 4LCRA 4O11A 5I23A 2VFDA 1KA9F 4QJ4B 2XINA 3CQ0A 5M03A 2BY1A 1SZEA 1PZ0A 5LHFA 1J6PA 1O1ZA 2X30A 5HNUA 2Q3RA 4JXCA 1FH8A 1TV3A 3LNPA 2WNNA 2FMNA 2NV2A 4IL0A 5H91A 4AX7A 3EX3A 1DJHA 3MJMA 1FCVA 2V3FA 3RJYA 3UWVA 3Q4DA 4RZ6A 3GDTA 1AUSL 4Q7BA 2TYSA 2PI6A 3CTTA 1OIMA 4LRSA 3UYCA 5AY7A 3HFTA 3C8NA 1G7VA 4X0NA 4F66A 5EFDA 3UETA 5FJPA 1XYZA 3M46A 3VD9A 4AZCA 1W9UA 2ZE3A 5EU9A 2VMFA 3B4YA 1XC4A 3NGJA 3U2EA 1GQNA 1Z89A 1Q8JA 1D9EA 6REQB 1KXVA 2Q8ZA 1J10A 2D2OA 2QUMA 3CHDA 3CUHA 4JTTA 1FWIC 3H8AA 3W02A 2J13A 3P7YA 1CLVA 1DJNA 2P1FA 1R8LA 4HNLA 3PK7A 5K4XA 4BWLC 2BP1A 2TMDA 2V82A 3AHTA 3WMSA 3HZ3A 3O2LA 3NQ2A 3T6CA 5BCAA 1TZ7A 3ZM8A 3PTDA 5JUVA 2QAFA 3ZQ9A 1UWRA 4ZQRA 1N7KA 4HIBA 3WSUA 4S3DA 3VIPA 3I10A 3NA8A 4HYRA 4YLWA 1V93A 2PA6A 4W7UA 3CLMA 2C0HA 4BI6A 4IL2A 4W89A 3BLLA 3T4CA 1FCQA 3HA1A 4XSLA 3UJ2A 3GR7A 1I2NA 2VZVA 4S2BA 4W7VA 3WQDA 3KOWA 2VL4A 1PDZA 4V27A 4BFAA 4K68A 4BEUA 2E5DA 4GINA 3HQ1A 2VRJA 1EDQA 2WSRA 2J47A 5JBFA 1DEDA 4FIRA 3GTIA 3BMXA 3VNJA 2A1YA 1E1FA 4J9JA 3AYSA 1I45A 3R10A 3BW2A 3UJRA 4BA0A 2IQ0A 3WBXA 3ITTA 4LF2A 4WRHA 4ZMGA 3SSZA 1HL8A 3CMJA 4D1IA 1YKWA 4WD0A 3L0KA 4NJKA 1V3HA 4JS3A 4Z0JA 1IXQA 2OMAA 1DWHM 3AO0A 3OO2A 2HBVA 1WKYA 4JOMA 3ATYA 1QI0A 5A8QA 2YCJA 5I3GA 3TONA 4IP5A 3HGOA 4LAZA 3P8JA 3F03K 3W7GA 4AX6A 3MO7A 1P0EA 4ZOEA 2OSXA 2FVKA 1F05A 4WQ6A 2OOGA 3M41A 2WANA 1ZBVA 2ZZ1A 1W2PA 5E9AA 2W67A 1UZHA 1K6WA 3LZ3A 2REQB 3FGCA 1Q6LA 3LBCA 4UCFA 4IZGA 1AVAA 3TWBA 4AAJA 4BK9A 1TUXA 1UKPA 4GQQA 1GW1A 3VKAA 1R86A 4D6HA 2WCAA 4AVNA 4IMAA 4Y9AA 1ONXA 4JCLA 2WLYA 2PWVA 4XV0A 1UIOA 1FA2A 2NLYA 2EO7A 4Z17A 3TEVA 1UQZA 3CAQA 2A3BA 1XL9A 2QCLA 1XIJA 2X41A 2D23A 1SR9A 4INFA 2NQ9A 2DJLA 5ECUA 4DNHA 2XUCA 1G67A 1UKOA 1JPKA 4JTIA 4OKDA 3WQCA 4ZA0A 1GVFA 4FEZA 4JY9A 2YL8A 4H4IA 1TMHA 3PZIA 3WQPA 4ZO6A 1VCFA 4FZIA 2NUXA 4R3UA 1K8XA 4L6HA 1PE1A 1V3MA 2JE8A 3FYYA 4LXFA 2VD8A 4RJEA 1FP8A 4H83A 3WYZA 2G97A 4Z1DA 3G22A 3CUIA 3BL3A 1HJQA 3B4UA 4F0SA 1KBLA 3VI2A 3LK6A 3TYAA 2V69A 1H60A 4A8RA 5E9XA 3BXWA 4WVXA 1QR7A 4JQ4A 2E7FA 5BRBA 1B31A 5E93A 3MO4A 3PFMA 5U4NA 1T5AA 4P8XA 1Q6QA 3PANA 1A4MA 4N0RA 1R0MA 1JCTA 4Z2KA 2JEPA 3ANUA 4U28A 3G77A 1OHLA 3IVUA 6ALDA 3WQEA 2BFGA 4O1BA 4YTSA 5D33A 4ZO9A 4AXKA 4YIWA 3R6IA 3WH6A 4TXEA 3CQJA 3UY7A 3TNOA 3USBA 1IEIA 3CL6A 4MZYA 4QIUA 3L4YA 4UTJA 1DXFA 2VEPA 4WY0A 3O9NA 4NY2A 4AEOA 2RDUA 3BSGA 1JRCA 1N82A 4DJFA 3VC5A 2RGLA 1KFCA 1OG0A 1TUFA 2ZVRA 2CBUA 2I14A 1QI3A 1XIFA 4GA8A 2JBMA 1GVYA 5ECVA 4LTSA 1OGSA 5DMYA 1W1IE 5FEPA 3RYSA 5B7YA 1CGUA 5AYYA 4V28A 1BFNA 1GG0A 2IPJA 2DSVA 1X6UA 1W3JA 5D2VA 3UPBA 4B2DA 2OGYA 3SRKA 4UMBA 4RNJA 4L6DA 3BJSA 3V7PA 4F0HA 4PCNA 2P5NA 2WQPA 2DSUA 1AW2A 3TC7A 4QGCA 1VIWA 4F2BA 3RPMA 4RK8A 4QLLA 5D09A 4PL2A 2VGIA 4AZBA 3GDKA 4MYAA 2VC9A 1DVJA 2A7NA 2QUVA 5JMUA 1I2QA 1TV2A 2XISA 4FNTA 2B7NA 2X7VA 4UOQA 3KCLA 3MTWA 1OFDA 3RXZA 2XIJA 1NDWA 3FDGA 2VR2A 3E0LA 4P5UA 5DRIA 2ANUA 2Y1HA 3TYBA 4N02A 5KZDA 1P48A 1KV8A 3PF3A 4MB5A 3MUY1 3A4JA 2INEA 5C0QA 3KRSA 4WDUA 3NYDA 4MWAE 1UW9A 3SGZA 3WUBA 1BWKA 5DMLA 2DQWA 2V5BA 2VJXA 4P2VA 1WO2A 4GKLA 1KBKA 2FPYA 3EDEA 1A5MC 1MZHA 3WL1A 2VZSA 1VPQA 4J3TA 1P6BA 1RVKA 1QAPA 1YHTA 1FHDA 3N6JA 3RLGA 1RP8A 5FOOA 4PTVA 4WKFA 4MWAD 1GOMA 2PCEA 4GX8A 3B0PA 4Y9NA 4BWLA 1OF6A 4QDPA 2ISVA 4IFKA 3QRHA 3FN9A 3NPWA 1KRMA 3THUA 2YFOA 2OVLA 1JCLA 3CT7A 3ITCA 3QC0A 3S3GA 1VENA 1XLFA 2OEMA 3N9RA 5LZLA 4O0QA 1M68A 3TZFA 2NQJA 4PCTA 3BV7A 4ZQNA 3BQ6A 2Z1BA 4KFPA 4OV4A 1POJA 5C6MA 1KLZA 3PBVA 3V35A 5IDZA 4WX2A 4ALDA 7A3HA 3TFCA 3T4WA 2J62A 2ACSA 1JXJA 1US3A 2FFIA 4O18A 4JFUA 2VFIA 3BLDA 4GFSA 4WJ8A 4F0LA 2Z24A 2WZEA 5HJYA 1A0CA 4GVHA 2A79A 3SIMA 2QXWA 3DFHA 1UH2A 2GVYA 2TRSA 2OQHA 2CETA 1IT0A 2D24A 2JKEA 3SURA 5REQB 5D9MA 2Z26A 1JIBA 1GYNA 2YFNA 3UCCA 3A5VA 4QM1A 2V0TA 3ZIZA 3U7BA 5A1AA 4UTKA 1V8EA 1FWTA 5XINA 3AS0A 4QJ1A 4JTUA 3D3FA 1IGWA 1Z48A 3EX4A 4E0CA 3R7MA 4LRTA 3VOGA 3BANA 3WK1A 2ZRZA 1DTNA 5J8LA 2PDIA 3TXVA 1W5PA 1AJ0A 2GGHA 1K8ZA 3N3TA 4LQ1A 4PBFA 4N6FA 4Y9PA 2DEPA 4GO9A 3H2OA 2VEMA 5LXEA 4DWSB 2YDAA 3KCJA 4IM4A 5ABFB 2H3BA 3SECA 1XGZA 3DEQA 4FNRA 1Y0EA 1QWGA 1DJXA 2B7PA 4HQVA 3P6LA 3MT1A 3N2OA 4A4AA 3THQA 3VDBA 4AWSA 1E6XM 4I8DA 4HZMA 4L1XA 4ZGYA 3FIGA 2R6OA 1LWHA 4HPNA 2BSLA 1MO0A 3TAOA 2ZKMX 1C9DA 1PX3A 2ZX6A 4TV6A 3VKDA 1R7AA 3NTYA 3MZNA 4MADA 1Q45A 1FHVA 2DW6A 4ZCWA 1JZ3A 1UR1A 3HMCA 2ZZ7A 3GVWA 4CD7A 3D0CA 1TPVA 3RMEA 1GORA 1E71M 3TZNA 1PIIA 3A23A 3BAJA 2FGLA 4MM1A 3CIXA 1VFTA 3W86A 2NWRA 4B3KA 2A4AA 1Q8AA 3NIYA 2RDWA 2FPVA 2OG9A 3UXLA 3A3XA 1QBAA 3EWCA 4GNVA 4MF4A 3SCUA 1FH7A 4XUGA 4JTLA 2GGEA 1H62A 5AC5A 1WV2A 1Q6DA 3F5JA 4FNUA 5FJUA 4C6CA 1PKNA 3G1VA 4UTMA 5CBIA 2ZYFA 1DWGM 3GIYA 3UJFA 1KC7A 2GGGA 5JH1A 5HR7A 4O8RA 3B03A 2OYKA 1R9YA 4G7FA 4GXMA 2E67A 3ZS4A 4G9PA 1SO6A 1EKOA 1DKWA 4GGBA 4H9VA 3NSNA 3LM3A 2CC0A 3B04A 3WUGA 4F48A 2ASHA 5AC8A 4JYEA 4CN6A 1PIGA 1EC9A 1QPRA 4HOXA 3MUXA 3EDJA 4GZIA 1LROA 4B5TA 1XG4A 3TC6A 1FWRA 2Z6IA 3WNMA 4WUIA 1ADDA 1JYXA 1QPQA 3NPXA 3A47A 5AC6A 4O19A 3UJSA 3BAKA 1FWGC 3GLCA 2YZ5A 3VIKA 3MS8A 2PPGA 4WXYA 3QGKC 1ZENA 2BGQA 1WUFA 1QVBA 3W1PA 1QW8A 3BO9A 4R53A 3WQ6A 4KETA 2XGZA 3SI9A 4IF2A 3TN6A 3VDHA 5D05A 2DUAA 5AHFA 1B3OA 3AQUA 3UJEA 3CQKA 4GZJA 2ZA1A 1B3VA 3TTQA 4IX0A 4M0XA 2OQYA 3Q45A 2CZVA 3ALFA 1GJPA 3CUFA 2J75A 1UD2A 1LM1A 3DIPA 3UERA 4D72A 2PTZA 1BHGA 3II1A 3BPWA 3DX5A 4L65A 5GNXA 4O1FA 4XZMX 1YDYA 2QJJA 1G7UA 4PSRA 1E4MM 3XISA 3HG5A 3N4AA 4XBJA 4QX4A 4MNKA 3VAVA 4Q4RA 4ML4A 3WELA 4G1NA 1TRIA 4ZXLA 1KWKA 5H8UA 1MW3A 4XZNX 4YPJA 2CLOA 3CB8A 1UUMA 4UQDA 2FTWA 3NWRA 3T08A 4E38A 1VBJA 4XK2A 1J2WA 4IMFA 2QCGA 2GQ3A 1E0UA 4PB4A 2CLFA 3W00A 2DJXA 1UWUA 3IIVA 5BRPA 3DU0A 4REQB 1JZ4A 3BH4A 3RR4A 2E0PA 3E0IA 4FF7A 1GHSA 3WD0A 1N8WA 2JIWA 3N34A 3UY8A 4PTXA 3TTSA 5DX7A 4LY8A 3NQBA 3DAQA 1PHQA 1E72M 3T0DA 1EXBA 2PP1A 3TQKA 1WYIA 3THDA 1YQ2A 5BXRA 4JTJA 4MY1A 3QQWA 1T40A 3MB9A 1HJXA 4S23A 1Z41A 1JUBA 1OFRA 1XCXA 5IOBA 2FZ9A 3CPUA 5BOFA 1V3LA 1AD4A 3ABQA 1FUYA 2VUYA 4DAIA 5C9UA 4AZCB 3MV11 3F1QA 3C3NA 1J0ZA 3NEHA 3GKFA 3L2IA 4NQ1A 5A94A 3QJAA 3G1FA 4MJZA 3FCPA 4TV5A 4S1FA 1QI5A 3NDZA 4C6KA 4HU3A 3PFRA 3GHSA 4J7RA 3IACA 1BVZA 3WBYA 4NNAA 1UH3A 3H7UA 3NL6A 2XSAA 4BQ5A 2D3LA 3GWQA 1QNPA 2PP0A 4MB4A 1R3SA 2I57A 1SSDA 2OX1A 3QM3A 3MUAA 3R8HA 1J2BA 1TWDA 2D2JA 4LS2A 1Q85A 4R7OA 3NGFA 4PFMA 4HNTA 3RNDA 4WDWA 1A0DA 1HJSA 4GUHA 1GHRA 1HN1A 3KFTA 3DC0A 3K8KA 1K77A 1F74A 5FF2A 3FXGA 3STEA 1PO9A 3S5NA 1F3EA 3A64A 2DT1A 2I1OA 2GJXA 2DDXA 3VK5A 4C90A 3S2NA 1ZL1A 1ECEA 1JRBA 1NOFA 4R9XA 2HNHA 3S9ZA 3M6DA 2DFAA 1UKQA 1BYCA 1G69A 2Z7KA 1I2OA 3F4NA 3VIJA 1ZP4A 3S47A 2J8FA 1K7EA 3P3BA 3W1UA 5B80A 4C5ZA 3NM3A 1J9YA 1XD0A 3EDDA 4R34A 2V38A 4L9ZA 3CYVA 3LG3A 4AW7A 3PNUA 3U57A 3HG4A 3B0YA 1DWJM 3GXPA 4OOUA 3KBJA 3A6OA 1RK5A 3EMCA 5I3JA 3H4WA 3H7RA 4NKCA 2HVNA 1PXGA 1AA1B 2RGMA 3BAXA 3TWAA 1SYTA 4O1AA 3W1NA 2BWGA 3QKZA 3W87A 1RJQA 3UG5A 1M7OA 3VNYA 3GTNA 3RLUA 3GQYA 4FX6M 3WBAA 2CLKA 5EB8A 2HVOA 1F2JA 4OQVA 3JZUA 3QW4B 3ARRA 3URBA 2WXDM 4QG8A 5D03A 3E12A 1X97A 1R3WA 3KVLA 4S38A 3GH7A 5LIUX 4M8UA 1Z44A 1GKPA 1V6WA 2IKGA 2PWGA 5CZKA 2C19A 3KS6A 4LYPA 2DZWA 2WNZA 2W62A 3V75A 2BY3A 4NG3A 3FGCB 4AHQA 1A80A 1FVPA 3OLEA 3Q2DA 3LXBA 1I8JA 4YTRA 3SFKA 3T2PA 1XLJA 2EJ1A 2RHGA 1X6LA 2PTXA 3VCCA 5AYZA 2FFCA 4K1GA 2H3DA 1HVXA 3MANA 3MWCA 2WOQA 4ZTXA 1TTQA 1RSCA 3M5YA 3E3HA 1XIMA 4AWTA 3KTXA 2XU2A 4G7EA 3UR8A 4RE4A 5CBJA 2CU0A 3LX9A 4K36A 1UOZA 3SUTA 3GBEA 3O16A 5A8PA 3NURA 4L9XA 2UY4A 4CU8A 3WQ8A 1SQ7A 3Q94A 4F79A 1MUMA 3T1GA 3QC3A 1M7PA 2EQDA 4AD2A 1SJBA 3TKFA 1EUAA 5MHBA 4LANA 3N73A 3N25A 5T8GA 2Z00A 5A3HA 1ADOA 4MLJA 5A6TC 3PZMA 4JTHA 3ALGA 4GBUA 3LHUA 5TNVA 1CXKA 2J9ZA 1F6KA 3IRSA 1LOSA 2WVTA 4D6GA 3S46A 4HHMA 2PGWA 1E0TA 4TX9A 4ZOBA 1NAL1 4LYRA 2CXGA 3N17A 2A85A 5C2GA 1MDRA 3HGSA 1WB0A 5F2LA 1TV7A 4ZB0A 3BW3A 4HK7A 1UHVA 1TTJA 2JIEA 4GK8A 2LLEA 4LAUA 5CC5A 2VFEA 3GG8A 7TAAA 3OVGA 3GNRA 1HL9A 2WHLA 1B54A 3G1AA 5KETA 3ZLFA 3N2XA 2E6DA 1EJVC 1CWYA 4JTAA 4R85A 4XSMA 1C8XA 2OFJA 3RILA 4O0KA 3SUSA 4DZ5A 1IEQA 1XRSA 4WY0B 2ZA3A 5HXMA 3UZWA 2PRHA 3VGGA 1HG3A 3AHZA 3JS3A 3PPGA 1K8YA 1D2KA 3C0QA 3WH8A 4JN6A 3OLDA 1ZS2A 2QJGA 1HKIA 3QEZA 2XSXA 4AFYA 1VBUA 3VOFA 2EPOA 1OINA 1QK0A 4JTKA 2AMXA 4K37A 3H22A 3P62A 2HDJA 3QSRA 3MC5A 3FJNA 1KGXA 3UNTA 1XXXA 4ZO8A 1ZSXA 2VVNA 2B31A 3GG7A 5C9WA 1T8QA 1RY8A 1VJZA 3E2QA 4DO7A 2ZZ5A 3ICJA 1NP2A 1Z8AA 4MTVA 3VNDA 4QFUA 1UWAA 3T81A 3BLKA 2PC4A 4GH3A 3CMFA 4NZ5A 4B9YA 5I5RA 1I2PA 1ZRQA 4GJIA 3EMZA 3TSMA 4A3QA 3V5CA 4PUUA 4DBDA 4PBGA 5B7ZA 1X38A 5LIYX 4ZTYA 3W82A 4PFHA 2X2YA 2GVEA 1M5WA 1OFEA 1RQEA 2E5BA 4AU0A 1E73M 4ICCX 4YTTA 3AMLA 2QCHA 1EEPA 2BG5A 3FVDA 2BOEX 1JF6A 1WZLA 4O4WA 1NELA 5CC6A 3D47A 3VC6A 3KDOA 1A5OC 1VJSA 1I4NA 1TV4A 4GKTA 2B0MA 2ZOXA 2P3ZA 3MUIA 2VWTA 2WVSA 3TTOA 2QHAA 2UY3A 2Q09A 3DH7A 2YCKX 4PGLA 4W4QA 1TVNA 1MUCA 2ZTJA 4HK6A 3R4IA 4FIQA 3MPGA 1R6WA 3OOQA 2YXGA 3H2FA 1EA9C 4AEFA 3LRKA 1EJSC 4IFKB 3OJGA 5HATA 5ABHA 4JIEA 1S2CA 3NSMA 3M0XA 4Q32A 4GYPC 2QIIA 3S2CA 1UPPA 4X9SA 1E6PA 2GLKA 2C18A 2B81A 5J5DA 3O3RA 4Q4MA 3H70A 3CPGA 2D73A 1EJXC 4MJMA 4LVBA 3OIXA 1CPUA 4E8CA 1LTDA 4CCDA 2ESCA 4AY8A 3UESA 2OZTA 1KQYA 3QZEA 4RV3A 1J96A 3MP4A 3P8IA 4IQJA 1E0XA 3W9ZA 4HHLA 2VGFA 2CEQA 1OD0A 3VNMA 3MUZ1 1LLOA 3QPYA 4HMCA 4LT9A 1ML1A 5HNTA 3BTNA 2YCLA 3YPIA 3I3EA 3NFUA 5KITA 2I16A 3PPFA 3LUTA 2OWCA 3R79A 4HSHA 3L9CA 2CLEA 4GIYA 1RP9A 5TD4A 1L6FA 1XM3A 1NWRA 2OJPA 3IJQA 1DHPA 1F9CA 2C15A 3BW4A 3TOYA 1IT7A 2A3HA 2R91A 1C7SA 3VD5A 3T78A 3KVJA 5BMXA 3R1ZA 1TFVA 4ZO7A 2WAGA 1H0IA 4NL1A 3ZVHB 5CBBA 3W1MA 3VDAA 2MUCA 2YLAA 3IGSA 3MSDA 4BQ2A 4AF0A 2DZUA 2W66A 2QPUA 3OYXA 2VOTA 5A6MA 1S5TA 3TW9A 3TN4A 1YE6A 2Y24A 3F4VA 3B8VA 4OBTA 5CG0A 4E4PA 3FKRA 1QI4A 3W22A 4C6MA 3V5OA 2WV8A 3CUJA 5D2YA 4H7VA 1PX8A 2YGYA 2XVGA 3LCIA 4LUSA 3W1LA 2ZBTA 1DV7A 1EFZA 4AZ6A 3RM8A 5AECA 3PVFA 2HJPA 3WK3A 3N18A 1ITXA 3LXCA 2BXYA 4ZB5A 4DO4A 1R3QA 4L1GA 2Z7GA 1XKYA 3M0IA 2OGJA 2QULA 3IVSA 2Q3OA 1UR2A 4IPJA 2XZ7A 1RA5A 3RCMA 1P4CA 3IRDA 1ZAJA 2QCMA 4XD4A 3B0XA 4CUCA 5ABGA 1LOQA 2WJEA 4UR9A 4PMOA 2E68A 4W88A 1H1YA 3EXSA 4WIWA 5I3DA 1GW9A 2Y8VA 2XH7A 1EWDA 3C0LA 4PE8A 3MDWA 1J18A 1UP0A 3HQOA 4HMDA 3UWEA 1L6WA 4FNPA 1JPMA 4HHHA 3AIRA 4K1WA 5IXEA 2PDGA 4FR6A 4Z2HA 2G50A 2JFEX 3U2OA 5I3HA 1M03A 4XWUA 4IPLA 2QPXA 1W9PA 1RCQA 3IK4A 3NDYA 4M6VA 3A9BA 2NX3A 1PV8A 5K9XA 5E1QA 4FHAA 4M51A 3EX6A 3I65A 1NWTA 2A6NA 3MKCA 4MMWA 3GK0A 4FXSA 3STFA 5CZ0A 3OZOA 2YKKA 1V6YA 4ZODA 3SJ3A 2NWSA 1YEYA 1XBZA 4F0MA 3LXAA 1H7NA 3OLGA 3SAZA 3BAWA 4QQUA 1GVRA 2ISDA 3AFBA 4UWMA 3VTRA 3K2GA 1V79A 1YXYA 3MP5A 1S2VA 1U1JA 4UFKA 1DJWA 5D02A 1S1RA 2VQTA 2ZE0A 5XIMA 4E3VA 4R9OA 3TH6A 4DJDD 3SM0A 4UNIA 4AC1X 1NARA 4GFIA 1ICSA 3AXMA 4GYFA 3W7JA 3MWAA 3WLMA 3G1DA 4AIBA 4PTMA 1CGTA 4H19A 1EF3A 1B3ZA 5KTLA 5T26A 2EPNA 1XC6A 3VKBA 5CGMA 1AQ0A 1HXJA 2Y88A 2GK1B 4QQ3A 1DE5A 1HJUA 1I2RA 4PCSA 2VC5A 3AWNA 3TJIA 2W0UA 2D2GA 1VYRA 1NDVA 3W7MA 4N42A 1KCZA 5D9OA 4PR4A 2A0NA 4Y2WA 3DFQA 3LHYA 1W17A 2I56A 2DP3A 1YXCA 2FZMA 2BODX 4H8HA 1NFBA 4O52A 2W4XA 3V1PA 3PTKA 1NTHA 4CD6A 4PUNA 3KBMA 1OX5A 1T8XA 2DU2A 2OR2A 4XBKA 2XM2A 4B9ZA 2DZSA 4DPPA 1OC6A 2PZ0A 2ALDA 1MFVA 4KEUA 4ICNA 2WJDA 3WQFA 2VUNA 4F0RA 4GE8A 4U3CA 2PWEA 1K9TA 2BHZA 4DI9A 2GFTA 3QPZA 4IIEA 3H54A 4MUPA 2NXHA 5LNRA 2PMQA 3B0VC 1OG6A 3HJEA 2QF7A 5A69A 3GXFA 4BF7A 1AW1A 3F4CA 1YPFA 7ENLA 2WYSA 3VFLA 3WG6A 2VC7A 1JYNA 2BOGX 2QNEA 2WQDA 5FSEC 1FH9A 1U22A 1CLXA 4PH6A 4I90A 4FLQA 3ZT7A 2EBNA 2J7CA 3M0ZA 1K4HA 3EKGA 4WZHA 1A5BA 1G4EA 3T0AA 4RXFA 4DUXA 1ELSA 4J27A 4JDBA 2OOFA 4OVXA 3SCRA 4ZQMA 3FOKA 5HNNA 2E40A 3TR9A 1V7YA 4DF0A 4NZ1A 4GY1A 5A2BA 1KGWA 1MNSA 1X7IA 2BNJA 2Q6ZA 4JGDA 2ZC1A 1TX0A 3S1XA 3QHMA 4H9YA 2YCIX 3ONCA 4IH3A 1HKVA 2DVXA 1JD9A 3RRXA 1Q6OA 1B5TA 3LCHA 4DB7A 1OCBA 4XTDA 4FMVA 3M44A 3RPDA 3LSBA 4LBRA 4GYPA 5J04A 1UWIA 3D5HA 3VKCA 1A4LA 1J6OA 4AUBA 3VM5A 4DXXA 4HT3A 1XRVA 3HFYA 4JN7A 4MYXA 3FXYA 1E1EA 4GIRA 2PLCA 1UZ1A 2GJXB 1W5OA 3PZGA 3CB3A 2G8ZA 3EWZA 3MA8A 3OODA 4C7FA 3KBWA 1LL6A 1UC5A 5AC7A 3TMLA 2WMIA 3GH4A 1Y5WA 3KBNA 1QUMA 5DMNA 3W25A 3SJNA 3LV6A 3SGUA 2J66A 2HSAA 3NO1A 4UQAA 5CLWA 1W6TA 2G3IA 2V3GA 2CITA 2F7FA 1EO5A 3N6QA 1XINA 4LF1A 4DM1A 2CKRA 4HYVA 4OBRA 4Q6JA 5EBUA 3PBMA 1V02E 2WC7A 4HN8A 5CG7A 1OCNA 3W74A 1TPUA 4PUJA 3KOZA 4WXZA 1F5ZA 1QPNA 2ZRVA 2AOSA 1IIGA 5FD0A 3W1XA 3HPSA 1AZ2A 1W3NA 5FJOA 4DXKA 1MW2A 1NOUA 4CEUC 4U3AA 4ROPA 3KOXA 2CWXA 3P67A 1VRXA 4OHQA 4X2PA 1CGXA 1JG9A 2HQAA