5C6MA

Crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
247
structure length
247
Chain Sequence
MSDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAGDTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFELVKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAGADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAGGVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNLLHTLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Shewanella halifaxensis
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
total genus 100
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c6mA00
2CWNA 3SGZA 4N6EA 4UFMA 1VH7A 3QMRA 3PS7A 2FB3A 4LOCA 3OEXA 3W1LA 2ZRXA 3TQ0A 2I1OA 1Q3NA 1L6SA 4OQVA 3T4CA 5KINA 1P4CA 1ZY9A 4JX6A 4HSNA 3NQAA 3UNDA 4EWND 1ZENA 4ML9A 2GJNA 3LTSA 5F2GA 4R7JA 2FLIA 1GQNA 1SO6A 1TMHA 4QIUA 2OT0A 2YW4A 3W74A 3W85A 1GVRA 4FIQA 3M5VA 5F2LA 1E51A 1VCFA 5IBXC 1XUUA 4WD0A 3FOKA 4MUZA 2ZYFA 5A5WA 1WBHA 1OFDA 3TSDA 1JJKA 5AHIA 4JIPA 3HJZA 3EXTA 4KWVA 3EWBX 4O0KA 4YWIA 3W3OA 4RKAA 1FXPA 1F2JA 1LBLA 3LTPA 1FXQA 4XQ6A 4FF7A 5D2YA 3W7LA 4LWWA 1TPVA 5I3GA 5KITA 1SW3A 2QCFA 4GJ1A 1H62A 4S1FA 4O50A 3NQ2A 4K38A 2WNQA 3C4UA 1W54A 3E0IA 4M5PA 1OFOA 1R30A 3S6DA 5AYXA 5EA9A 1JRBA 2QJIA 2R91A 1I4NA 2ZA2A 1NF0A 3GNDA 3LCFA 2YSWA 1B9BA 3O16A 2GQAA 4O18A 2ZA3A 3LBMA 3DFOA 1J4EA 1LCOA 3W9ZA 3W7EA 3M47A 3SY5A 5HNRA 1I45A 1SSDA 4AF0A 3L9CA 3LRMA 2V5BA 3HMJG 4NXKA 2F7FA 1QCWA 3BO9A 2NUXA 3E02A 4HT3A 3TFXA 4Z1CA 3L66A 2X1RA 2EAWA 2A5HA 5FF3A 3UPWA 5J5RA 4N9CA 5AYZA 2W6RA 2X1TA 3NG3A 2X1SA 3DAQA 1KLZA 5FEPA 5DELA 5GVJA 3MP4A 1AW1A 1AK5A 1EP1A 4GUIA 1V5XA 2Y63A 3W22A 3KVKA 1W5MA 2R14A 4JTUA 4L4LA 2NLIA 4FX6M 1G6CA 3WK1A 3R2GA 3LHUA 4WOZA 5AYYA 2J6XA 4ADUA 2FJKA 3CC1A 2C0AA 3UWUA 4PEKA 2WSYA 1FQ0A 3L5LA 3NQMA 4O53A 3GZ3A 4L4MA 5DCDA 5AFDA 5C2XA 1IIGA 3NDOA 1LOSA 2EHHA 2X1UA 1M5WA 4K8HA 1JCLA 4Q33A 3RMJA 1XBZA 3TSMA 5HR6A 3MO7A 3SW6A 1EPXA 3MP5A 4UMBA 3IRDA 1RVGA 2H3DA 3S1UA 3FKKA 4WY0A 3L0GA 5LGZA 2ISSA 4OT7A 1WA3A 4JTKA 1TTQA 2ZTKA 4HSOA 3L21A 4FO4A 3PF3A 4C1LA 5K9DA 3W87A 3QPZA 4K7YA 4UUIA 2NXHA 4O1AA 1GWJA 3W71A 1K8XA 4ZQRA 1NAL1 1BKSA 4Q4KA 3S1WA 5L9FA 2YZRA 5LZLA 4X9SA 1FWTA 4DQWA 3IV3A 4JTGA 5IBXA 3H55A 3T40A 5HULA 1B4KA 5C54A 3WFAA 1KTBA 3GIYA 3TROA 1TV8A 5HUOA 1VHCA 4C1KA 2B7OA 1PS9A 3FFSA 1R46A 1R2RA 1SFLA 2QUUA 1DJQA 1OG0A 5TQLA 3T78A 5C55A 2OZ0A 2CLFA 4NT0A 4CNNA 5AHLA 3M5ZA 2NV2A 4FXRA 1TPWA 3DI1A 4DBEA 3N9RA 2PE4A 2QCLA 3Q37A 4XKYB 1PVNA 5AC8A 4OE7A 1YLVA 3CIXA 4I7WA 3DFSA 3HIJA 4NJKA 1O5KA 1UASA 1C8VA 5K2ZA 4S2BA 4K6AA 2NX1A 4DO4A 3OVPA 1A5BA 1KBIA 4QAIA 3N2MA 4TIMA 4MZ1A 4UTKA 1OVDA 3LBCA 1Z42A 4TR9A 3NPVA 4GWEA 3ABQA 3BGGA 2VFHA 1NVMA 5DBTA 4Y9AA 3B0UX 3KXQA 4ORIA 4FEZA 1GZGA 1GEQA 1VS1A 3A5VA 2CZFA 2DZSA 5HR7A 4CCEA 2A7PA 3N73A 3ABOA 3RNDA 1THFD 1DQXA 2X16A 1EP2A 1LM1A 3MYPA 3VI2A 3P81A 3JS3A 3GKFA 5D2VA 1WXJA 2VKZG 2Y7FA 2WQPA 3MHUA 4LU0A 1UBSA 3E96A 4PODA 1JQXA 3R89A 3G1VA 2GQ8A 3GAKA 1KW1A 3M0ZA 3TAKA 3FJLA 3M5YA 1VYPX 2ZZ5A 3BW4A 3CEPA 3R8RA 1VCGA 3N3MA 3P5YA 1K7EA 2E09A 2VFEA 3BK0A 1ZAJA 3LGEA 3LLFA 3MJYA 4IXHA 2FPTA 1V7YA 4EVZA 1PHQA 5CKSA 1XFBA 2QJHA 3ZFHA 5CPMA 3PG9A 5SWUA 3G3DA 3WK2A 2H3BA 1TPFA 3P8JA 1HL2A 4R53A 3B0VC 3QZEA 2V5LA 2CLMA 2Z6JA 3NVTA 1SZEA 5MHBA 4QQ3A 5KZEA 3Q2DA 3E49A 1S5WA 1RR2A 2FPVA 2ZRUA 3SECA 1JR1A 4HNNA 1OX4A 2E5BA 1SR9A 2JGQA 2VEKA 1LOLA 3GB6A 5ABTA 4MIMA 5EPDA 4UTLA 3PG8A 1FUYA 3O6DA 4UNLA 4AVFA 1XDMA 3G8RA 1YDVA 1PHWA 1F7BA 3CTLA 3TSBA 4IX2A 5D33A 3WJXA 4W9TA 2WKJA 2XFWA 5DY3A 3DXIA 4XBSA 5G2HA 3RFAA 3T7VA 4K36A 1TPB1 3PB0A 3HOJA 4AHPA 2CLHA 3W7GA 5C5YA 5D02A 1LYXA 8TIMA 1QO2A 4KKXA 4PH6A 5AHFA 1LDCA 4HIBA 1GYNA 2ZDRA 4AWSA 1IXOA 2E6YA 4QNEA 1LRNA 3VKJA 1IIHA 4O28A 3ATYA 1HTIA 2RFGA 3A22A 3SZ8A 3N34A 3HGSA 1XBXA 4A29A 3TE9A 3W86A 4EF8A 3CM4A 3CU2A 4WUIA 4A3UA 1O95A 3G0XA 3W7IA 5FF0A 3TW7A 1SW0A 5F4XA 1KM2A 1YDOA 2JK2A 1W1ZA 3LOTA 1GVOA 1H51A 1K7FA 4UC5A 1ICPA 1VQTA 1ICQA 3ATZA 2NX3A 3EWXA 3H54A 1SUXA 4NX0A 3TC6A 2B7NA 2PRLA 2PC4A 2XN0A 3P74A 3G1DA 3W1UA 4GNJA 4HPXA 3BG3A 3N19B 1W3TA 3W1AA 3O1NA 1PL9A 2RDWA 1QMLA 3OG3A 3G1XA 3TK7A 1ONRA 3QMTA 4HNVA 1ICSA 3QQ0A 3RU6A 2Y70A 4Y90A 1Q6OA 4Z0JA 3W7CA 3CWOX 1JRCA 2HMCA 3L0NA 3W7QA 3NL2A 5F4WA 3BV4A 5G4WA 4UTWA 3RK8A 3G22A 2B4GA 2HS6A 1DOSA 3TV8A 1WX0A 4JNMA 1VZWA 3S5YA 1MZHA 4YCPA 1K03A 1H63A 2G96A 1CI1A 4XWUA 4UTHA 2WNZA 4HKPA 3SSJA 5FI8A 1WQ5A 5D2XA 3G1SA 4RJEA 1HG3A 3E12A 4CQ9A 1FCVA 1FCUA 1PIIA 5KZMA 3W7JA 3LCHA 2ZZ2A 2GVJA 3W88A 2NXIA 3QSTA 3FKRA 4UTTA 1F5ZA 3HPSA 5CG7A 5I3IA 3C56A 3DHDA 4ALDA 4LS1A 5A8GA 5KMYA 3JRKA 2PCQA 2ZRVA 5DY2A 1TYGA 1W37A 2Z2UA 3V75A 3MUXA 3OBKA 2CZDA 3DI0A 1P0NA 1FDYA 4JTSA 5EKYA 3STGA 3W07A 2UV8G 2C18A 5F4SA 1OFPA 3TMQA 4O4VA 4KFOA 1F76A 3O07A 1MEWA 3KAOA 3HBLA 3EB2A 1ZCOA 2CLLA 2C6QA 3DENA 3VFLA 3F1QA 3L2IA 2OCZA 1UUMA 3PBYA 3NPUA 3STEA 3TJXA 1W5QA 4IQLA 4UFKA 2FDSA 3C2EA 1MXSA 3GDKA 4DF1A 2BX7A 4O17A 3FYPA 1XDLA 1TPC1 3RF9A 3W2NA 1BEUA 3AO0A 4UFIA 4JEQA 3EWZA 5D04C 1LOQA 5LGXA 4Y8FA 1KFJA 3TJLA 1K02A 3W1PA 3NNTA 3O6CA 3WK3A 3PBWA 4JTTA 4CQAA 1EUNA 1AW5A 4LT9A 4RK8A 4RZ4A 1FWWA 3DFTA 1RD5A 1LLWA 3KRUA 3NQVA 2OJPA 3LHWA 1L6YA 3QRHA 2XN2A 4RV8A 1XKYA 4GUFA 3L65A 5AHNA 2ZZ7A 3ELFA 2P1FA 2WPBA 5LKYA 2OX1A 4OV9A 3T55A 4EIVA 4NNCA 3SFKA 1LROA 4WQ6A 3PR2A 3HG4A 2A21A 5D37A 1KM1A 2VFFA 3IVTA 1TTPA 3KVMA 1YPFA 2Y61A 4LVBA 4MZYA 1XUZA 4EF9A 3W73A 1I2QA 1LBMA 4DBDA 5HQEA 3LXBA 4LUIA 4ZL1A 1FY6A 1QAPA 4QITA 4LVFA 1UB3A 2H90A 2GVLA 3LCGA 4JYEA 5KZDA 3KRSA 3GK0A 1S3HA 2W79A 1OJXA 5CGQA 1KLYA 2YR1A 2GQ9A 1G4SA 1K3UA 1MO0A 3S5NA 1L2UA 5LHEA 3EEGA 3QEZA 3HQ1A 4N9BA 1JQVA 1W5OA 3M43A 3VNDA 3QW4B 2DZUA 1W8SA 1FBAA 3DZ1A 1IXNA 4MLRA 4FX8A 2QJGA 2C19A 5CPNA 3ANYA 1BWLA 4O10A 5H91A 5CZJA 1J2WA 1OK6A 4GFSA 3W7KA 4JYDA 4BF9A 2A6NA 2RDTA 3M41A 5G1YA 1ZAHA 2YYTA 2QCMA 4FX7A 4ZVJA 5LSMA 2Y85A 4UMAA 2G95A 3BARA 2V2CA 1X8FA 2V0TA 3UXAA 3UY8A 1KM0A 2E5CA 3W1NA 4MY8A 4LC8A 1QOQA 3HGJA 1O5XA 3GXTA 4BFAA 2W0UA 3W23A 1WBJA 2Q3OA 5LNVA 2TRSA 3IGUA 3I7RA 3I65A 3TUUA 3NM3A 5FEXA 2ABBA 1LRTA 5HMSA 5EL1A 4RXFA 2WSRA 1UUOA 3LHZA 5I3FA 1FDJA 4LV9A 1R2TA 4M7SA 5HWNA 3USBA 2G97A 3F03K 1I2OA 3OIXA 4LS0A 1H60A 1R2SA 2A1YA 5I3JA 1TCDA 2VC6A 4Z1BA 1A50A 3BVJA 1AG1O 2J9ZA 3PULA 2CZEA 4O19A 4WXZA 4XZ9A 4ADTA 3KRZA 5BNKA 5D09A 2FPYA 3R12A 2FTPA 5BOOA 1LTDA 1GTEA 2NUYA 4TO8A 4H6KA 1OK4A 4GC4A 5AC6A 1NEYA 2EPHA 4DO6A 1N55A 2J9XA 3O63A 5AHEA 1N7KA 3S5ZA 1ZFJA 1JUEA 3OHIA 2I14A 3B8DA 5FESA 3I68A 4FNPA 1S5TA 2ISVA 3G8EA 4X2RA 4Z1AA 3NQGA 1QO5A 3W1MA 1IF2A 4GUJA 4H3DA 4CNOA 3PVFA 4M19A 1CW2A 2DORA 1H1ZA 3HGOA 5D2TA 1ZJIA 3NQ7A 3HB9A 1DVJA 4YMZA 3DBPA 4JXCA 4RXGA 2QEZA 1NF7A 4JIQA 4NNAA 2ATMA 4M7TA 2PRMA 3EX3A 3BW3A 4ADSA 4ZQCA 3L5MA 2ATSA 1H5YA 4UTMA 1O94A 3THAA 1QFEA 3TDFA 3W7OA 4YLWA 3LHTA 2EKCA 3ABSA 4GBUA 5G4EA 3BLFA 1GT8A 1IGSA 2ZBTA 1AMKA 1DHPA 2VFGA 5LNUA 1TQJA 4NX5A 4RX0A 5D03A 2GOUA 4H4IA 3EKLA 1KA9F 4YL2A 1K7XA 3NQCA 4FNQA 3QSRA 1FWSA 4LW7A 5AB3A 5TBOA 3CIWA 3F4WA 5AHMA 4HN4A 4IPIA 1GTHA 3U6WA 1LORA 3TH6A 3TNOA 4CNPA 2C3ZA 5HUPA 4CCDA 2OT1A 4RZ6A 3HGRA 3BG5A 4EOUA 4IGHA 2VFDA 4JTIA 4FNTA 3UPBA 1GG1A 1XL9A 2DZWA 1KFLA 3QJAA 3GNNA 3B05A 1GYLA 1H7PA 4AWTA 1KM5A 4PFMA 1F6KA 2O7QA 5LNWA 5G2IA 3Q94A 4WOQA 1WOAA 2Q8LA 3MHFA 2A2IA 3C3NA 2TYSA 4PC8A 2G5WA 4GUGA 4NQ1A 1C29A 2WV8A 1LBFA 2WO5A 1X7FA 4O0ZA 2D73A 1QPQA 1YXCA 2NWSA 4BWLA 1Z48A 4Y6GA 2NUWA 3HG3A 4E38A 4PL2A 3G1YA 4WY0F 2GJLA 3TXZA 1DQWA 3W2LA 2I9EA 5FF4A 3BW2A 2E6DA 4BI6A 4O4WA 3W72A 1W0MA 4O12A 3W7NA 2Q3RA 3W2JA 3EX2A 2V8ZA 4LS2A 1TPEA 1L9WA 3QYQA 1WDWA 4NJJA 2QUTA 2J9YA 3GLCA 2J27A 3CHVA 4LRTA 1XI3A 2TPSA 1OX6A 5E0KA 2WOQA 2Z0IA 2E6AA 4AB4A 3F4NA 3T44A 3NL5A 4JTFA 3R5EA 4O54A 1EB3A 3QC3A 3O8AA 1Y0EA 1TJPA 3GXNA 4MZ8A 3FYOA 2V9DA 2EGZA 3EWUA 3LI1A 4MY1A 2NX9A 4CCCA 3P61A 1YXDA 3NPWA 3W1TA 3LI0A 3QM3A 1Z44A 1PE1A 1YADA 1TB3A 1T99A 1TSIA 4IOTA 4XTDA 2JGYA 3FS2A 5D2WA 3TCEA 3NEVA 1SZGA 3BLEA 3QPYA 1U5JA 3PM6A 2ZQ0A 4OV4A 3S1XA 1X6UA 3NOEA 2ZZ3A 4LY8A 4JTEA 1RPXA 3CLMA 2JKPA 5F1VA 2ZRYA 4MYXA 3MMTA 3THQA 3EXRA 4PA8A 1QNVA 4YXGA 4UXDA 1JUKA 1KBJA 4XBKA 5AC7A 1P5BA 4RZ5A 5K4XA 4N9EA 1SPQA 1SO5A 1OFBA 1LZOA 2E77A 1GVFA 2QCNA 1M7OA 1TTIA 1H61A 3MW7A 3NPXA 4UFHA 2TMDA 2XN1A 1DL3A 4IJBA 1Z41A 5KTLA 2BLEA 2Y88A 1O4UA 3C52A 3TAOA 5LHFA 2QCCA 3NQ6A 4RLIA 4B5NA 4N4PA 1B57A 3HG5A 2IQTA 3WK0A 4WX2A 5LNRA 2QCDB 2RKXA 3P5ZA 1G4PA 3P62A 4DPPA 2VXNA 4R34A 2OMAA 1RQBA 3L5AA 1B4EA 3W83A 3TKFA 1XBVA 3GAYA 5CZ0A 5TIMA 3UXDA 2R8WA 2Z6IA 1A53A 2VELA 4G1KA 3L67A 1G67A 1OHLA 3LDVA 1DV7A 4X22A 4FIRA 1OX5A 2QCGA 2RDUA 4JGDA 1RZMA 2QF7A 3TX9A 4AHOA 3HF3A 4DEFA 3TA6A 2YDAA 2YYUA 2QDHA 3C61A 4KFNA 2CLEA 3KX6A 3GDMA 1MSSA 1YPIA 4MKNA 3W1RA 3HPXA 2QAFA 4O1CA 3GVGA 4ZQPA 3AJXA 3H53A 3U8GA 4AMAA 3PSWA 3W7MA 3CEUA 3GDLA 2A4AA 5BRBA 5K4ZA 3LX9A 3IIPA 4I9AA 3IEBA 4AF0B 2YCEA 1I2NA 3M44A 2KZHA 1KFCA 4GE8A 2E6FA 3ZR4A 2B7QA 4BK9A 4CLMA 1AW2A 3MP3A 3C2FA 3S0CA 1VYRA 3E9AA 3PY2A 1OX4B 2CFFA 2WJZA 1T0OA 1GPWA 4NJIA 3A9IA 1TRIA 1EWDA 3DH7A 2Q8ZA 3NA8A 5EY5A 4OGZA 4NVTA 3EX1A 5CPOA 2P0OA 4HHPA 1B3OA 1EP3A 3LHVA 4JTLA 3EWYA 4MY9A 3M7WA 3UWWA 3C6CA 2YFNA 2ZZ6A 2BSLA 4E2BA 3A23A 4MVAA 3NQEA 1FCBA 2JKAA 5HINA 4AWUA 2DJXA 4NZFA 3HO8A 1TQXA 4AH7A 1SQ7A 3DU0A 4D2JA 3FA5A 1YTKA 2C15A 2VEMA 3MBDA 2E5DA 3A24A 5G5IA 1F74A 1D9EA 1A5SA 3NR0A 3B03A 2A7RA 4JDYA 3I7SA 4DELA 1TPH1 3SI9A 4DF0A 2NV1A 4N4QA 1X1ZA 3B0PA 4Z08A 3I6RA 2VOMA 4XTIA 2ZFAA 3BGJA 3TXVA 3A21A 3MBFA 2RHGA 3EWWA 2YW3A 4HPJA 4S2CA 3WJSA 3QQ1A 1Q6QA 3S9YA 1QOPA 3W1XA 2CLKA 2ABAA 1ALDA 4OHQA 2E1DA 3P60A 1JCXA 3UWYA 3NM1A 3W84A 1QWGA 3R13A 5C6MA 4NJGA 2B0MA 5BMXA 1D3GA 1YYAA 3P80A 1OYAA 1ZALA 4WZHA 2FIQA 2EF9A 3WJZA 1F6PA 1PV8A 2C13A 1JCNA 3LERA 3KVJA 3P82A 3WJWA 1N8FA 4JY9A 3W7DA 1A5AA 2DU2A 3NYZA 1LRQA 1IXPA 4WJEA 3S42A 2A85A 1FCQA 5J5DA 1EIXA 1DORA 2YFOA 5EBUA 3B04A 4JY8A 4DPQA 1VRDA 1UJPA 1TO3A 1FWRA 4LNYA 5G1TA 1H7WA 1TIMA 3G1FA 3NL6A 3G18A 5U4NA 3G0SA 4FNRA 4WXYA 4OBTA 3W2MA 4I7UA 4BI5A 5H2ZA 4O15A 3UWVA 2QDGA 3MI3A 3EKZA 2ZTJA 3U2OA 2CZ5A 2E68A 1QDSA 5CZTA 5D32A 2A6LA 3KVLA 4ICNA 2BXVA 2WNNA 1TV5A 2HTMA 3W6YA 3OA3A 1OF8A 2J88A 3ZWSA 3UWZA 1W3IA 1HO1A 3GYEA 3UD6A 4MJMA 1J5TA 4JTHA 1WYIA 4UFJA 3IIXA 1FWNA 5DBUA 1DJNA 2P10A 5DXXA 4N9DA 1I2PA 3BPWA 2DZTA 3TW6A 4ZQNA 3PAJA 3DGRA 4MOZA 1F73A 3UY7A 2VEIA 1OFRA 5CSSA 4X3ZA 4Z1DA 1G4EA 4JX5A 1KV5A 4MPQA 1T8XA 3DFNA 5E93A 3TQKA 3YPIA 2V2HA 3PUEA 4BI7A 3GDRA 3LXAA 1OYCA 3GR7A 2RH9A 3IVSA 1GJPA 4GUHA 3OVQA 1C9DA 4LTSA 5F2MA 4R33A 3IGSA 3FEMA 1KFBA 3PUDA 3PWAA 1XXXA 1X1OA 1HFBA 1W3NA 1OFEA 1TRDA 4I7VA 3W70A 2FB2A 2CW6A 1BTMA 3K30A 4JYFA 3M5XA 4MJZA 2QR6A 4N2YA 3KHJA 4TMCA 1H7OA 4AAJA 2V2DA 4ORMA 4AEOA 1ZHAA 4TU1A 5G2WA 3QW3A 5EYWA 2R94A 3INPA 4O11A 1QPRA 4PCFA 1S5VA 2GVGA 3IVUA 3A5FA 1KM6A 1SFJA 3W75A 5D30A 4TX9A 2Y89A 1VJIA 5IM51 1PCKA 4GXMA 3IIZA 4O1DA 4FHAA 2O7SA 4MFEA 4U4MA 5DLCA 5FEZA 1JCJA 3CWNA 5D38A 2GUUA 2FFCA 4Z0SA 3QMSA 5CSRA 6ALDA 1FDZA 2ISWA 4LRSA 2LLEA 1KM3A 3UZ5A 6TIMA 4YCOA 5KSWA 1EUAA 1H50A 2HSAA 1OF6A 2CLOA 1OFQA 4UTJA 2PURA 4FXSA 1VGAA 1SZNA 3ZS4A 2FQIA 4NU7A 4QNWA 3P67A 3S1VA 5L6UA 1R47A 4A22A 1MEIA 3G0UA 3NQFA 1VR6A 2ZZ1A 3NGJA 3O05A 1EEPA 3B4UA 3IGXA 4ZQMA 3LLDA 1G69A 4QJ1A 1AL8A 1GOXA 2BZNA 2ZZ4A 3LXCA 1DBTA 4JR5A 3MI2A 4IMFA 3RLVA 4U28A 3O15A 4UTWC 2ZRZA 3WJYA 3LHYA 1GG0A 3NO5A 2PRHA 3STFA 3TQVA 4DO5A 1YTDA 5AOUA 3FJ6A 1LLZA 3SGUA 2HS8A 1SO4A 4M6PA 1I2RA 1H7RA 1G4TA 1LP6A 1H1YA 2BWGA 5K7JA 3P84A 5LNSA 1UCWA 3PBVA 4MYAA 1FX6A 3QH2A 4K39A 4IMCA 4N02A 3LV6A 4KWWA 5HWJA 2DJLA 3GKAA 4IMDA 4LUJA 4UR7A 4MLJA 4QSHA 3LRLA 3PB2A 4IMGA 3CPRA 5T26A 3VCRA 3LCWA 4LV4A 1A5CA 1PCWA 3W76A 5F1UA 1W5NA 3FIGA 1QR7A 4E0CA 1JUBA 1OABA 1EA0A 1W31A 4O8RA 2QCHA 3V1PA 5DCBA 1ME9A 1WOBA 1VYSX 1VPXA 2AQWA 3PUOA 4Q32A 1SSGA 4K7VA 4O1BA 2A0NA 3PC0A 4A2SA 1VCVA 4JICA 1F05A 3O06A 5EMUA 4IUOA 1XBYA 1DKWA 4O14A 3ABRA 2QAPA 3NZRA 3NZ1A 4BR1A 1W5PA 3LV5A 3TC7A 2Y62A 1JULA 2CLIA 4JN6A 2VFIA 1Q6RA 2C16A 4HNUA 3UYCA 4J9JA 3SJ3A 3G1AA 3M1ZA 4RR4A 3G1HA 3C8FA 2B7PA 3GX9A 4O13A 3OVRA 3HPZA 4K37A 4UTTC 3VE7A 4P2VA 3VE9A 3DFPA 2JBMA 2QKFA 1OFAA 3LB0A 1Q45A 1TJRA 3GXPA 1G7UA 3I7QA 3M9YA 4JD4A 4HNTA 2YX0A 1XM3A 1XC4A 1D3HA 3EX4A 1U83A 4UCGA 5FF7A 5FEWA 3LCIA 3STCA 4XKYA 1MEHA 3NQ8A 1P0KA 4IXXA 5HWMA 4P61A 3DHFA 4ONVA 4M6QA 1I8JA 2BTMA 2Y7DA 4ZQOA 3DFQA 1YDNA 2DZPA 4LC6A 1CX9A 3NAVA 4JDBA 3UWQA 3C2OA 1HUVA 3TR2A 4UTUA 3O6YX 3M6YA 3ZWTA 1SW7A 1ME7A 3QFEA 2H6RA 1GVSA 5U7SA 2F84A 1ML1A 2DP3A 4UR8A 1SU5A 1H7XA 1H7NA 3IIVA 3W7PA 1HO4A 4O52A 1VC4A 2YGYA 3PBUA 1W56A 2YXGA 5DXYA 3Q58A 3N2XA 5K3VA 4UIOA 4LVAA 5K9XA 1IXQA 1NSJA 2X2GA 2V81A 4UFLA 1JVNA 2V30A 3CQ0A 3CT7A 3W7RA 4NUWA 1KM4A 5BMWA 3NQDA 1ME8A 4DXVA 1XCFA 3P8IA 4MFDA 2ALDA 3W2UA 2TSYA 3LRKA 3W7HA 4IWWA 3KFTA 1GVQA 4BWLC 1KTNA 3BLIA 3MHGA 2ZRWA 4QM1A 3W2KA 4Y96A 2X30A 1VLIA 5CPLA 1WAUA 5DN1A 5DCEA 1T96A 1K8YA 2NZLA 3C2RA 3LM7A 3EX6A 4NXSA 3KOFA 2NXGA 2ZA1A 4UMCA 1NFBA 4IX0A 5I3HA 2QCDA 2Y6ZA 2ZCGA 5I3KA 1O60A 2AAMA 4XUGA 4UNKA 2YPIA 3C2VA 3G24A 2H8ZA 1KFKA 2V82A 3MI6A 5FF2A 3LCXA 3GR8A 3UZJA 3N9SA 4E2DA 3IIOA 1JCYA 2C1HA 3M16A 2C14A 1RV8A 4CQ8A 1SZFA 4A2RA 3LCLA 5F2IA 2QUVA 4M6VA 4RCXA 2JKEA 1L6WA 4QISA 3P7YA 3PSVA 2A7NA 1KTCA 2DZVA 2GPTA 4K8EA 1VHNA 3HG2A 4PL1A 4ZMGA 1YTEA 3TFCA 3S5OA 3W1QA 3NL3A 5E1QA 4A21A 1EX5A 4AHQA 2Z1BA 4TMBA 4O16A 4IPJA 5D05A 2VEPA 3DKLA 4AXKA 4NNBA 1VLWA 1SO3A 1ZNNA 4OWGA 3GDTA 4JX4A 4NJHA 1Q6LA 3MYOA 4KFPA 2VENA 3D0CA 3S8HA 1ADOA 1WV2A 1M6JA 4PTNA 2DZXA 4O57A 2J24A 5HJLA 1JCMP 3DKJA 1P1XA 3MWAA 3NXFA 4LVDA 4DF2A 3TU9A 4IMEA 1RQEA 4GRSA 4JTJA 7TIMA 5AN7A 3RLUA 1G7VA 1TREA 1QPNA 1RQHA 3TIMA 1ZAIA 4OU1A 4FNSA 1QPOA 4WY0B 1EWEA 3LTYA 4FNUA 4LVGA 3N14A 4UTIA 1TV7A 2CU0A 3L68A 2H8XA 3EXSA 1AL7A 1TPUA 3JR2A 4ZZ9A 3L0KA 3G3MA 5K9CA 2AGKA 1KV8A 4POCA 3B06A 1M7PA 2NWRA 4NZJA 5BW6A 5CZSA 4FB7A 2Y7EA 3BG9A 1TTJA 2WSQA 3C0JA 3QF0A 3FLUA 3SIZA 1KFEA 3TMLA 1YXYA 2Y7GA 3UQNA 4JS3A 1OYBA 1K8ZA 4N6FA 2QCEA 3CB8A 1BWKA 1TPDA 3SR7A
chains in the Genus database with same CATH superfamily
2DSUA 3OLDA 4N6EA 4UFMA 2EJAA 3PS7A 4LOCA 2ZRXA 1LG1A 2WZTA 3JZUA 1BHGA 4OQVA 5KINA 1P4CA 4JX6A 1E9IA 4HSNA 2O9PA 3UXKA 1ZENA 4ML9A 2WKGA 2BOEX 3LTSA 3T42A 1TMHA 4FIQA 3AS3A 3UR8A 5F2LA 3H2CA 1E51A 3UJSA 1XUUA 4WD0A 1HJQA 3TSDA 1J0HA 1JJKA 3HPAA 2HQAA 4O0KA 4LX4A 3WCZA 3W3OA 4RKAA 2HBVA 1F2JA 4J27A 4JKLA 3LTPA 3LGGA 3M46A 1M1BA 1AFSA 3ISIX 4LWWA 2QCFA 1OD0A 1H62A 4S1FA 2WNQA 3AMCA 2ICSA 3APTA 4CD6A 1RA5A 4EAMA 3UGRA 1R30A 2ACUA 4KMQA 1EDQA 5AYXA 3WQDA 2BHUA 1DXIA 4CD8A 2R91A 2YLAA 2ZADA 2EBNA 2ZWYA 4X2PA 2P5NA 4QEHA 2GQAA 4QLJA 2ZA3A 2PDXA 2XVGA 2D23A 4LNCA 4HA1A 2W92A 5HNRA 4INFA 2HNEA 2V5BA 1QCWA 2RGMA 3SRDA 3T0AA 3E02A 1XSJA 3SQSA 2FH8A 1GQLA 4ROQA 4F48A 2PPGA 3DC0A 2EAWA 4XZHA 1V0LA 3JVAA 5I0DA 2AMGA 2PF0A 5J5RA 4N9CA 1Z8AA 3IJ9A 3BCJA 3VIJA 4LAMA 5DELA 3MP4A 3IUIA 2Y63A 4GHRA 1JF5A 3W22A 1L6FA 1KNWA 5EMJA 2XIQA 4LYKA 3FX4A 3N13A 5BCAA 1ZJHA 2PDFA 1G94A 3VAVA 3AZTA 4KWUA 1US0A 4Q7NA 4Z42C 4CEUC 3GU2A 1FQ0A 3E0WA 3L5LA 3NQMA 3E0LA 4YPJA 3FY1A 4H19A 1V8EA 3DUGA 1ENUA 3NZQA 5AYIA 5C2XA 1IIGA 4HU3A 3QYSA 1Q2SA 1HNYA 2J47A 3NDOA 3DECA 2EHHA 4PRTA 3M4HA 3ARRA 3VNZA 1F8IA 4PUNA 3TN5A 1JCLA 3BICA 4GH3A 3TSMA 1IT0A 1UZDA 1YBQB 3SW6A 1LUCA 3MP5A 4UMBA 5CSUA 1OGSA 2A3CA 4MB5A 1V6YA 2OYMA 1WA3A 4JTKA 1TTQA 1PWMA 3L21A 1A5UA 2OKTA 5E6YA 3MS8A 4QCFA 1W1IE 3LLXA 1DJYA 2R9RA 3E0VA 3T8QA 1ITCA 4L4OA 4O1AA 1GWJA 2HISA 1NAL1 1BKSA 5A69A 1XCXA 3TYEA 1UWTA 4JTGA 1O7AA 5HULA 3KL0A 1B4KA 1KTBA 3GIYA 1MFVA 3QTPA 4C1KA 2ZXAA 1L2QA 1PS9A 5C9UA 1SR0A 3FFSA 1RA0A 1ITUA 1TUFA 1SFLA 4GVGA 1OG0A 1QNOA 5I02A 1EO7A 1I60A 4PB3A 4NSBA 1NFPA 4W7VA 2NV2A 4DBEA 5JU6A 5IRPA 5A6JA 2GJRA 1B3VA 2VZOA 3Q37A 3B8WA 5AC8A 1V93A 1KRCC 3CIXA 4I7WA 2WVVA 1Q85A 1O5KA 4K6AA 3OVPA 3VOJA 4NILA 1E4LA 3GBEA 3UGVA 3OP2A 1NOFA 3MU7A 7PTDA 4TV6A 4HD5A 3AIRA 4PUWA 5DEZA 1HGYA 3BGGA 2VFHA 2VGIA 4Y9AA 4OJYA 1WZAA 2C1IA 4ORIA 1GZGA 2HVMA 2D20A 2UY2A 1EA9C 4NZ4A 1PYFA 3ABOA 2X16A 2QHAA 1LM1A 1FH9A 3MYPA 4LJ3A 1Q4WA 3JS3A 3BJFA 4OTKA 2Y7FA 4LU0A 3UNTA 1KW1A 3TAKA 3FJLA 3P0XA 3LPPA 3EPNA 3R8RA 1VCGA 3MSDA 1X96A 4WEVX 1R5YA 1GVIA 1ZAJA 2CETA 3BC9A 2FPTA 2GDVA 4EVZA 2E4TA 4JFUA 8RUCA 5CKSA 1XQLA 1V6UA 3QV9A 5CPMA 1MYRA 4LCRA 1DJZA 5SWUA 3EOEA 2VCCA 3G3DA 1QRQA 1UKQA 2YB1A 2PGWA 4R53A 2DZBA 3QZEA 4FOJA 2Z6JA 5I3DA 5KZEA 3Q2DA 1RR2A 4Q4SA 4YJ5A 1JYNA 5FA5A 1VRXA 4ZFCA 5EPDA 4HTBA 4HTYA 4JPGA 3SCWA 1PHWA 2XFRA 5CAKA 1F7BA 1IQ8A 2VNCA 4W9TA 3ZJ8A 2OKOA 4DB7A 5M3WA 1W3KA 3UJ2A 4D6IA 2I17A 2XJ7A 3P14A 4AHPA 2J7FA 3QLLA 1NWSA 2C0HA 1R3QA 3MCMA 3VKJA 3A9BA 1IIHA 1UA7A 3SZ8A 4OOZA 3HGSA 3W86A 4EF8A 4U5KA 4A3UA 4WUIA 1VBRA 1PX4A 1V77A 2OG9A 4HMNA 1BG4A 2JK2A 3KP1A 1QHOA 1H51A 1CGXA 1ICPA 3U2CA 4AU0A 3H54A 1SUXA 2BS9A 2PRLA 2PC4A 3H2AA 3BG3A 4D6DA 4Z2GA 4Q8QA 2VX7A 3SUTA 2Y1HA 1PL9A 2E9LA 2G3JA 3AIEA 5CBIA 1YIXA 1ESWA 3HPFA 2WC7A 9XIMA 3G1XA 3CL8A 3UESA 3EDFA 2Y70A 3AIWA 1Q6OA 3W7CA 3QR1A 1CT5A 1RALA 3W7QA 1PZ0A 4KRTA 3NL2A 3WG6A 5PTDA 3VKBA 4KETA 3V3WA 1VZWA 4AMCA 9RUBA 4LCSA 4S3BA 3OLIA 2G96A 1CI1A 3A12A 1ZBWA 1ZJAA 1WDRA 1NDYA 4OFCA 3VIOA 3NUKA 1WQ5A 2GZXA 1E9ZB 3ZT6A 4RJEA 1KBBA 2D24A 1H0IA 4PCPA 1UR9A 3SY8A 4EPDC 1BF2A 4PB5A 5DQPA 1CDGA 1TX0A 4UQ9A 1F5ZA 4KIRA 1ZB5A 5CG7A 1NIUA 1U1JA 2JIWA 2E3ZA 3ECQA 1DJWA 8A3HA 4KEUA 4YYCA 4RPPA 3TOYA 3OZOA 1FDYA 4JTSA 4PFHA 4L6DA 2VR4A 4CU8A 4F0KA 5F4SA 4KFOA 2P50A 4D6EA 1UKTA 4Z2HA 1KQZA 1KCLA 3DIPA 3HBLA 2Z27A 4Z2IA 3AC0A 1HIZA 3VFLA 3DENA 3F1QA 2XDFA 2ZUVA 3L2IA 2OCZA 1TV2A 1W5QA 4IQLA 2POTA 1HJWA 4O17A 2BX7A 3A47A 3PZTA 3W2NA 3S2NA 3AO0A 4UFIA 1N8IA 1LOQA 2J7EA 3I6EA 1Q4NX 3O6CA 4LYRA 3WK3A 1AW5A 4RK8A 4R7WA 3F4CA 1GNXA 1L6YA 2XN2A 3L65A 2AOSA 2JIEA 3WD0A 2WPBA 2ZX8A 1XLDA 2OX1A 4I8YA 4NNCA 3SFKA 1BVZA 3QR3A 3C0SA 2OSYA 2VJXA 4WQ6A 2NSOA 3PZUA 3PR2A 3PUGA 9XIAA 1YPFA 2Y61A 1OC6A 1XUZA 4EF9A 1XFCA 3GHRA 2P76A 1LBMA 1TJ2A 5HQEA 3LXBA 3HQPA 4ZL1A 1FY6A 1POJA 2GVLA 3QV7A 4TXEA 1SM9A 3KDNA 2VZUA 1S2UA 3AOFA 2QPUA 1J0IA 2DT2A 3H8AA 1WDDA 1A3WA 3S5NA 1L2UA 5IDIA 1B90A 4DYKA 1Q2RA 4JTQA 4KWOA 5H8PA 2X09A 5DANA 2DZUA 3OU8A 4M81A 2ANUA 3OLEA 1MZRA 1IXNA 3DYPA 3WF1A 2HBXA 3GR4A 3WENA 1EH9A 4EX4A 2CBIA 4JYDA 5A6SA 2RDTA 5G1YA 1ZAHA 2I7GA 2YYTA 2E9BA 4B5UA 2V2CA 1NM9A 3UCCA 4GIEA 4MY8A 1XLIA 1QOQA 4LC8A 4FLQA 1J5SA 4C6IA 3NXLA 1O5XA 3DN5A 3BLLA 3VABA 1SZRA 1NJJA 2GK1B 2GSHA 3CQIA 3I65A 2NQ5A 3KCOA 2YA2A 5HMSA 3VU2A 5I3FA 2BGQA 4H6QA 4LV9A 1R2TA 2EG6A 3B8SA 3BMVA 5ECVA 3VD3A 4IISA 1AG1O 2J9ZA 3PULA 2CZEA 5BNKA 4XZ9A 5D09A 4Q8UA 1LTDA 3M0MA 2BB0A 5ABEA 1OK4A 1S2AA 2OQYA 2EPHA 5DX7A 4YHGA 3GQYA 4GYFA 3PJTA 1IZKA 3H24A 1N55A 2J9XA 1XRFA 1N7KA 3FW6A 3BLOA 5FESA 3I68A 1GKRA 4L6HA 1RJPA 3TWAA 3NQGA 4XZLX 5MF5A 2KX9A 4GUJA 3PVFA 4UQDA 1CW2A 5BRQA 3GW3A 4LF1A 4PCTA 3QFWA 4ERGA 1ZJIA 3NQ7A 1DVJA 4YMZA 2ISDA 3WZ0E 3DBPA 3B9EA 4JXCA 4RXGA 4GQBA 1NF7A 1QXLA 4NNAA 2PRMA 4H2CA 4LAOA 1TVPA 4PSRA 1A0EA 4ZQCA 1EO5A 2V5CA 2PBOA 4PEEA 4BQ2A 1QUMA 4UOJA 1GT8A 5EMLA 1IGSA 4Q8PA 1BGAA 3AQUA 1B1YA 2R1PA 2GOUA 2GL5A 2PDMA 4BF7A 1KA9F 3W27A 3NQCA 2PU0A 3BOFA 4LW7A 3AJ7A 3ITOA 5TBOA 1V03A 4HN4A 4PBFA 4IPIA 3VMNA 3U6WA 1HKVA 3D47A 3M64A 3TQPA 4PRRA 3TNOA 1G5AA 1RK6A 1YW1A 1O1HA 4RZ6A 2DUAA 1FWGC 4I6VA 4ZB2A 4V1XA 3UPBA 3LD5A 1GG1A 3UFYA 1H11A 4PSPA 1B9ZA 2PDLA 3N1AA 3SUVA 2C91A 1GYLA 2WZEA 4AWTA 2CITA 3NDYA 5FJOA 3RYSA 5XIAA 1OD8A 1UZHA 3KBVA 3PTMA 2R24A 3MHFA 2TYSA 3GNRA 3FJ4A 3DHUA 3FVDA 3N12A 2WO5A 1F3TA 4B3LA 4PUKA 3HG3A 2QXWA 4E38A 4PL2A 4WY0F 4G2DA 3ABXA 2I9EA 3A13A 3BW2A 2DGAA 3QOKA 5E5CA 1AJZA 3NFUA 3W2JA 3EX2A 1FHVA 1WUFA 1E5NA 2VO5A 2WK2A 4D9PA 1BXNA 4FOUA 4IPPA 2J27A 3P93A 2NLYA 2JEQA 2TPSA 3E2VA 4GFIA 3T9PA 2WOQA 2Z0IA 4HB7A 4JZ5A 4ZO8A 3QC3A 3O8AA 4K1GA 1TJPA 4MZ8A 2V9DA 3KDOA 2EGZA 1PSCA 3NURA 3DBNA 1E6XM 3W1TA 3CJPA 2F38A 5JBEA 2BY1A 3QM3A 3SN0A 6PTDA 3BZGA 2XIJA 1F07A 3FS2A 3W82A 5A8NA 4AZCA 1S5NA 3PM6A 4OV4A 3NOEA 4P7OA 2ZZ3A 4JTEA 1JZ4A 3BLDA 5JH2A 2ZRYA 4MYXA 3APGA 2GJPA 2JEPA 2ZX6A 1QPKA 3WQ5A 1KCZA 1JUKA 5FACA 1LWHA 1SO5A 1QW8A 1V6XA 1GZ1A 1M7OA 1E0UA 4WVXA 3NPXA 1UHVA 4FA3A 4GX8A 1HVQA 1IHIA 1JEZA 4IJBA 2J8FA 3WQOA 2BLEA 3TTSA 3IJIA 3RIKA 3C52A 1X7IA 2QCCA 4B5NA 1ONXA 1CWYA 2PWUA 3JW7A 2V6AA 2IQTA 2O4MA 1QHPA 1JZ3A 1UBPC 1SMDA 3GDBA 1G4PA 3P62A 3OGSA 1B30A 4R34A 4YU1A 3LQGA 3W83A 3S3GA 3H2MA 1DWAM 1F4HA 3EPOA 2R8WA 1PIFA 1FA2A 1V3HA 2VELA 4C6OA 1W8GA 5FJUA 2NQZA 4JGDA 4AHOA 2EKGA 3TA6A 2YDAA 2YYUA 2QDHA 1N82A 3WQGA 3C61A 4KFNA 3T8LA 2CLEA 3KX6A 4PMYA 3SJNA 3W38A 4MKNA 3HPXA 4PULA 4E8CA 4O1CA 4DIAA 3CEUA 5T91A 1GONA 2J4GA 3A4WA 3LX9A 3KS5A 3RPMA 3J7HA 3IEBA 2YCEA 2KZHA 4F2TA 4UQBA 4A3HA 1KFCA 3ZR4A 1R7AA 1AW2A 4IL2A 1ELSA 5GNZA 1GPWA 3ANVA 4XVEA 2G50A 3GY1A 5CPOA 3LNMA 5CPQA 1B3OA 3IRSA 2WMGA 4MY9A 3UWWA 4FZIA 2YLLA 4PMRA 2YFNA 1XF0A 1FCBA 4YTQA 4AWUA 1IT8A 1R9XA 2FTYA 3V7PA 1TQXA 4A6GA 2WZMA 1SQ7A 2V68A 2AKZA 3DU0A 3FA5A 2C15A 2E5DA 1U1UA 2FHFA 3CYJA 4DELA 4I6KA 1TPH1 2FMNA 3H4GA 4DF0A 4US5A 1V3IA 4N4QA 4HHMA 2GQ3A 1VIWA 3T08A 3QXBA 4IIFA 3ES7A 3PTDA 4S2CA 3KE0A 2RDXA 4LB4A 1Q6QA 3S9YA 1QOPA 1A5LC 2CESA 1TMQA 3GZAA 2VD8A 1FP9A 2YIHA 3KW3A 3MV01 3ID7A 2HE5A 1CGUA 2OELA 2VX6A 3VIGA 5C6MA 5BMXA 1YYAA 3OBAA 5TD4A 3AXIA 3WJZA 4QBXA 1F6PA 1PV8A 1XISA 2C13A 4AIUA 1OC5A 4JY9A 2FZMA 3W7DA 2E7FA 4S3AA 4WJEA 2EEXA 1CLVA 2A85A 5J5DA 5BXSA 1F61A 4HK7A 2X7VA 3B04A 1NELA 4EPEC 1TO3A 4LNYA 1FTXA 4HZ8A 4XIMA 3NL6A 4PE8A 2VR2A 1E6PA 4P7NA 5H2ZA 4KT2A 3R11A 1XIDA 1OBAA 4GLEA 3MI3A 3FCPA 2O92A 3U2OA 2D22A 1R87A 4GISA 2A6LA 2BXVA 4MAZA 2WNNA 1DWFM 3W6YA 1IEIA 1W3IA 4JTHA 1WYIA 4UFJA 3IIXA 4H9UA 2VUNA 3T09A 3VZXA 1P7TA 3IPWA 2P10A 1EGVA 3F7JA 1EJ7L 3W4RA 2VEIA 2XISA 1EHAA 4ATWA 4JX5A 1KV5A 4C6QA 3TQKA 3LZ3A 4BA0A 3DOPA 1RCQA 4AFYA 3IANA 2V2HA 3GDRA 3STPA 1KFWA 3DFYA 4W8BA 2HV5A 3IVSA 5DMNA 1KRAC 1W3HA 2VDHA 3IGSA 3VOFA 3U9IA 3QHNA 2E67A 3PUDA 4J3XA 1MRAA 2WBGA 1XXXA 4JQ1A 1HFBA 1TVLA 7TAAA 1M53A 3W70A 3S2JA 2E25A 2VX4A 3AISA 3K30A 2QR6A 4W87A 4ZB5A 1ISXA 2OLAA 4AEOA 3CLWA 1FKXA 2I56A 3WH9A 1QNSA 2I16A 4XVDA 2R94A 1S1RA 1QPRA 1S5VA 2GVGA 3EZ4A 3IVUA 3A5FA 1SFJA 1CLXA 5D30A 2BXYA 2WCAA 1W2PA 4TX9A 5CSYA 3VGGA 3OLGA 3IIZA 3W0KA 1W3LA 4O1DA 4I9TA 1FWAC 3OYZA 5DLCA 5LYRA 4C6EA 4S23A 2FFCA 2G4JA 6ALDA 3QMSA 1E0XA 3QHMA 4C65A 4DJEC 1JPDX 1RLDA 2YZ5A 1HX0A 1Q5MA 3EPMA 1EUAA 2B81A 4W88A 3XIMA 1OFQA 2PURA 3GXFA 1JYWA 1NU5A 2H9AB 2BGSA 4QNWA 3P67A 1UR2A 2O9RA 2WM0A 2ZZ1A 3O05A 1EF3A 1Z7AA 1G69A 3FJNA 2P8CA 4DN1A 1Y8BA 3TYCA 3WQFA 1UWRA 3LXCA 4HU8A 1BYAA 3MI2A 4IMFA 3O15A 1AH3A 3GTXA 2ZRZA 2W9MA 3NO5A 4WGHA 3TQVA 3U3HA 4IQJA 1I9CB 1UD3A 1YTDA 3FJ6A 1A4MA 3SGUA 1VFOA 3SAZA 1R7OA 4Q8MA 5CJ5A 3FAXA 1UCWA 1XGZA 4IMCA 4ATDA 1UD5A 2G41A 3DDMA 7REQB 2WBKA 2OZ3A 3ZOAA 4LUJA 4UR7A 1Q7ZA 4MLJA 4QSHA 3LRLA 4IMGA 4B2DA 3CPRA 1I1WA 4LV4A 4MB4A 3F2BA 1ISZA 1PCWA 2DDXA 4P7LA 3VGDA 3TYDA 3WMSA 3FIGA 2IW0A 3BE7A 1EA0A 1W31A 1DIOA 1JDFA 4C6PA 1WOBA 3W29A 3L4UA 2CEQA 4K7VA 3KBSA 3VDGA 4H8UA 4A2SA 4CN6A 3WDQA 1VCVA 4JICA 1N8WA 1Q8AA 3O06A 3V16A 5EMUA 4IUOA 2ODOA 3NEHA 3RM4A 3SADA 4O14A 2FVKA 3ABRA 3H23A 3VCCA 2J79A 3ZVHA 4HGXA 2ZOXA 1CPUA 2CLIA 3IV8A 2DQWA 1KGUA 2D2JA 1CXIA 3SJ3A 5LIYX 4RR4A 3DFHA 4QXIA 4PMQA 3GX9A 2WMFA 4ICMA 1A3XA 4S3EA 4UTTC 1W1B1 2BOGX 3HPZA 4K37A 1IEXA 3VE7A 1HKWA 1OFAA 3U7VA 2PP1A 3VIPA 4A8LA 4GMEA 1XM3A 1CEOA 3EX4A 4YS1A 4UCGA 1VF8A 2WMIA 4MWAA 5C7HA 2VTFA 5I06A 3STCA 4XKYA 3E2SA 1MEHA 4MG4A 3NQ8A 2POZA 4IXXA 5HWMA 1Q66A 2HEJA 1I8JA 2BTMA 2VVNA 2Y7DA 3W6LA 4ZQOA 1GGOA 2Q71A 1NH6A 3CZEA 2EPNA 4L9YA 4XO7A 1CX9A 4JDBA 4C6MA 4H7CA 3AU2A 2DUZA 4LUYA 1OZQA 1ME7A 3F2DA 2H6RA 3AIUA 4OBSA 5U7SA 3VNLA 1CENA 2DP3A 1Q13A 3B40A 4BCEA 3ZM8A 2P3ZA 2REQA 1W56A 3PBUA 3VC6A 3N2XA 2NQHA 2PTZA 2YCIX 1AVAA 5CBBA 4QDMA 2V81A 1PPIA 4A3QA 3GSMA 4B5SA 4EANA 3WO8A 3W00A 2GWNA 3ZQ9A 2J77A 4Q8OA 5BMWA 1ME8A 4DXVA 3P8IA 4LBSA 4M1BA 3KFTA 2DUXA 1KTNA 3MHGA 3K4DA 5CPLA 3IAPA 4LUTB 4DJED 1T96A 4MNKA 4XD4A 4HMCA 1I75A 5LIKX 4Z17A 3MMWA 3D6NA 1U5VA 5I3KA 1B3WA 1WDPA 4XUGA 1WPCA 5I79A 1AUSL 3KS6A 4DJDC 3C2VA 5A6BD 4GBDA 1KFKA 2V82A 3MI6A 3GR8A 1JCYA 3M16A 4NG3A 4CQ8A 2REQB 3F5KA 3TNBA 3QV6A 1DWHM 1NWUA 3HA1A 4JQ2A 2PP3A 4RCXA 3PSVA 1ITQA 2BODX 5DRIA 1XD0A 2FZBA 5E6ZA 4PL1A 1A4LA 1YTEA 3S5OA 2X1IA 3W1QA 2YDQA 4WCJA 1OSEA 1X6LA 1BXBA 1V7AA 2Z1BA 4AHQA 4O16A 1E40A 1NWTA 1UH2A 3O7UA 1ZBCA 1SO3A 1ZNNA 4OWGA 3BMXA 3V35A 1DXEA 3VCNA 3U2EA 3ZXWA 1WV2A 3TN3A 1XRVA 1XLBA 2DSZA 1EJRC 2HK1A 1JGMA 2HCVA 2E8YA 2AQOA 4NYYA 3NXFA 4A8RA 3BCDA 2OU4A 4JTJA 3WH6A 3CUGA 1GW9A 1NDWA 1U30A 4Q4QA 1QPNA 1GVYA 1T5AA 1OC7A 4AUBA 3VINA 1QTWA 1EWEA 4MWAC 2CERA 1XYCA 4LVGA 3AALA 3ARXA 3I3EA 3TZNA 1XLCA 2CU0A 1V6VA 2H8XA 2VZSA 3I4EA 4LYQA 3G3MA 4EPBC 1AQFA 2VC7A 3DEQA 1RVKA 1FWCC 4IIGA 1TTJA 3C0JA 1R3YA 2UY3A 1KFEA 3TMLA 2WSKA 4EK7A 1KXQA 3VDCA 1RJRA 1K8ZA 2Q6ZA 2QUNA 3S2CA 2QCEA 3SR7A 1XINA 3WNNA 1NP2A 2CPUA 3UXIA 2F6UA 4PYSA 3T0CA 4RE0A 3EYPA 4CU7A 5I07A 1GOWA 3CS2A 1L6SA 1ZY9A 3R4IA 3VNMA 1LQ2A 3NQAA 2CIPA 4N42A 3UNDA 5CC7A 3WL0A 1CXHA 1DTUA 2OT0A 3W74A 1GVRA 3M5VA 5IBXC 1XJBA 5A5WA 5HNTA 1E71M 1JYXA 1LLOA 3XINA 3DC8A 3S9IA 1EZ2A 3SUSA 1FXQA 4QJ3B 4XQ6A 3H12A 3KL5A 1NY1A 1TPVA 5I3GA 5JH1A 1G01A 4XK2A 3NQ2A 2W67A 1J18A 1AZ1A 5HMEA 4M5PA 5REQB 3S6DA 5HPOA 2XFFA 5EA9A 3GRIA 4LAKA 4KQNA 1OCBA 1X8CA 1NF0A 3GNDA 1U22A 3LCFA 2CCRA 1BRLA 2YDSA 1VBGA 1GUVA 1JF6A 3DFOA 1J4EA 3TLQA 1LCOA 3W7EA 3M47A 1I45A 1SSDA 4GQGA 4AF0A 3GG8A 1WDSA 4NXKA 1K6WA 2F7FA 3BCFA 1WUEA 4TVCA 5I09A 2XPKA 4Z1CA 4ZO6A 1ZLPA 2GUYA 5CQ1A 2X1RA 4ZE4A 3ITVA 3BOXA 2A5HA 4PUEA 1XIHA 4C7DA 4D6CA 5FF3A 3UPWA 4W7WA 3WH5A 4X63A 2W6RA 2X1TA 2X1SA 1KLZA 4IP7A 3VM5A 4GUIA 1VBJA 1W5MA 2R14A 4JFVA 2PODA 1OWQA 1M41A 2WWDA 5C8BB 5C9XA 3GIQA 3LENA 3WLSA 1TCMA 2J6XA 3MT1A 2FJKA 3N4EA 4DWSA 1UWAA 3OPSA 5A6KA 4O53A 3GZ3A 4L4MA 5DCDA 3AIBA 2WM1A 3WDIA 3L23A 1LOSA 2PSNA 4F8XA 1M5WA 4K8HA 3RMJA 1EHNA 5HR6A 1FWJC 3WQCA 1EPXA 4KWSA 3M0LA 5GPRA 1RVGA 3FKKA 3L0GA 5LGZA 1NQKA 3BLPX 2EJ1A 1SVDA 3VNKA 2WJFA 2XZ9A 1UP3A 4AD5A 5K9DA 3W87A 3FSUA 2CWXA 4UUIA 4AVOA 4CQDA 3W71A 2VRKA 4ZQRA 5ECUA 3THDA 3MUY1 3PZ9A 4ZOBA 1F6YA 2YZRA 3AXMA 4X9SA 2OZTA 5IBXA 3ME3A 4IG2A 3T40A 1H1NA 1GKQA 5GJNA 2GGHA 5C54A 2WHLA 7CGTA 3CPGA 1TV8A 1VHCA 4GINA 4N0RA 3U7BA 1M9HA 2ZUUA 4ACZB 3MC5A 1R46A 3CL6A 3URAA 4IP5A 1IV8A 1DJQA 3FA3A 3H2FA 3W01A 3JZEA 2OZ0A 3SCUA 4ACZA 4L1XA 5JXQA 3GFXA 5A2BA 1PVNA 2PC8A 3DFSA 3HIJA 5K2ZA 3H7VA 2MANA 2X7WA 1OZMA 4BZYA 4DO4A 2NT1A 1W9UA 5HAOA 1KBIA 4QAIA 3N2MA 4H01A 4UCFA 4TIMA 1KGWA 3O6AA 1EJXC 1V02A 4TR9A 3NPVA 2QV4A 4GWEA 3CL7A 5DBTA 3OA5A 1HW6A 1W9BM 2J7BA 3KOXA 1GOQA 3WH7A 3B0UX 3UPMA 1GEQA 2OSWA 3H7UA 2CZFA 2IPFA 3GTNA 1MI3A 5HR7A 4H7VA 3WX7A 3MZNA 2VRQA 2VKZG 3MHUA 4C6KA 1UBSA 3E96A 3FNDA 3R89A 4OKDA 3URNA 4HSHA 2ZZ5A 1PAMA 1O12A 1XCWA 3N3MA 2MNRA 5D8WA 2E09A 2VFEA 1MUCA 1JPKA 3LLFA 2FDMA 3MJYA 4IXHA 1V7YA 2DT3A 4ZOCA 3EWCA 5LA1A 5LA2A 2QJHA 3MSRA 5TAOA 1SFTA 3PG9A 1XX1A 3OW1A 3P8JA 1HL2A 3VOHA 3B0VC 3IUDA 3CUHA 5IXEA 5E9AA 5MHBA 2O9TA 4QQ3A 2Z2BA 2Z28A 3R0DA 3ITXA 1JR1A 1BVNP 1SR9A 4NZCA 1E5JA 4XSLA 2VEKA 4MIMA 3PG8A 1FUYA 3RM9A 4AVFA 5D9OA 3EKGA 3G8RA 3II1A 3TSBA 1C91A 2EPLX 4AISA 2JQXA 2XFWA 4HMEA 5FSDC 3EOOA 4CKQA 3T7VA 4JFWA 5I03A 2D0GA 1HJUA 3W7GA 5C5YA 1Q8JA 3TEVA 1LYXA 4PH6A 3GC4A 1LRNA 2R1LA 4O28A 1XSIA 2RFGA 3CBWA 2GSEA 4BEQA 2J8TA 3QGAC 4XAZA 4P7RA 3G0XA 1QI2A 3TW7A 5C2CA 4V33A 1SW0A 4OIFA 5F4XA 4KRZA 2FTWA 3MWCA 4PMNA 4DZIA 3LOTA 1XPYA 4XZIA 1M03A 4UC5A 2VGGA 1VQTA 1ICQA 3UJEA 3TWBA 1J6OA 3ATZA 1CLKA 2NX3A 3TC6A 1CCWB 4NL1A 3PN8A 3N19B 3USZA 3NSNA 1R9ZA 1UZ1A 1IWAA 3O1NA 1QMLA 4GYPC 2BV9A 2QULA 4MJ2A 3TK7A 2ZX9A 2E9MA 4HNVA 3OOQA 4XV0A 3FGCB 3RU6A 2A3HA 2J13A 1JRCA 1EFZA 2HE8A 2HMCA 4J3SA 3T0DA 2Z25A 3QTGA 5F4WA 5CGTA 2WWCA 4W93A 3RK8A 2ZVRA 4MNJA 2HS6A 3VIHA 1MZHA 2QIWA 4QS6A 4WDXA 4XWUA 4QLKA 4UTHA 4GABA 3UP8A 3SN4A 3G1SA 3UBPC 2PDHA 2J62A 1FCUA 1PIIA 3UETA 4ZCWA 1EYEA 3W7JA 4CD5A 3R58A 1VJSA 1RLCL 4RZBA 4C1NA 2F2HA 2NXIA 1CZ1A 3T81A 3QSTA 1FOBA 3WQWA 2EPMX 4OOUA 2WHKA 4UTTA 5I3IA 2P3EA 3C56A 3DHDA 4L64A 1CXLA 4P5UA 2ACRA 3R94A 1UQYA 2ZRVA 3SCTA 4QE5A 8XIMA 4G7EA 3E1F1 3QC0A 3SUUA 3W07A 1J6PA 1EIBA 1TELA 1BKHA 2FYMA 4IGNA 4DZ5A 3SCVA 1MEWA 1QWKA 3UG8A 3KAOA 1JPHA 3VTRA 2X0YA 2C6QA 3O2LA 3BAJA 3STEA 3NPUA 2IMRA 3TJXA 2J7HA 3GDKA 4IQDA 1KRBC 1AJ2A 2FFIA 3FYPA 3IK2A 2XH0A 3WQEA 4R5EA 3RF9A 5D8ZA 3MUIA 1HL9A 5D04C 3NO1A 3NNTA 1UP0A 3PHAA 4MSSA 4JTTA 4RZ4A 1W9VA 4KCVA 2OJPA 1XW8A 1XKYA 4GUFA 1TIWA 3ELFA 2GJXA 1JCTA 3N2CA 5JBDA 5LKYA 2W61A 4OV9A 3T55A 3TYZA 4A3YA 1TZZA 2DSVA 3SO7A 6TAAA 1LL6A 3HG4A 1PZ1A 5D37A 1PDZA 1KM1A 2VFFA 2VI0A 3IVTA 5LXXA 1TTPA 3KVMA 3RXZA 2ASHA 4RW3A 4U3AA 4UOZA 3CIVA 4MZYA 1KR1A 2J7GA 4PMOA 1IEVA 3ARQA 3QHOA 4LVFA 5ABFB 3WLMA 1EF2A 1QI4A 2Z1VA 3EOSA 1N2VA 1DE6A 1V6WA 2G37A 2WVTA 1S3HA 3RR4A 1KLYA 1O1ZA 1QK0A 2YR1A 2GQ9A 3K4AA 5LHEA 3EEGA 3RO8A 1JQVA 1W5OA 1YNPA 3HZ3A 4ZBCA 4QEEA 2UBPC 3DG3A 1FBAA 2PD5A 3DZ1A 3QOMA 2D0HA 1GCYA 5E9XA 2ISFA 3W7KA 3CUZA 2XM2A 1LWIA 3V0TA 4EXBA 4ZVJA 2QCMA 2Y85A 4UMAA 2VZVA 2OB3A 4F2UA 2VDGA 4M8UA 1X8FA 2V0TA 1RUSA 4YYFA 1PZ3A 3UY8A 2XSXA 3B0YA 1GYMA 1AA1B 3NCOA 4B3ZA 3QKZA 4UZUA 3W23A 1WBJA 1OCQA 3IGUA 3I7RA 1OGBA 1PKMA 3NM3A 1TR1A 5FEXA 5HXMA 2ABBA 1ONWA 3L4TA 4RXFA 4F0HA 1H41A 2HRWA 4KH2A 1FDJA 3H2NA 4YVXA 2G97A 1F8MA 4DY1A 5GNXA 1H60A 1R2SA 2A1YA 1RAKA 3BH4A 1TCDA 2NQ9A 1CGYA 3TZFA 2VC6A 4Z1BA 5CPSA 4CD7A 3I3DA 1LG2A 4WXZA 3KRZA 2Q8XA 4MDPA 4PUJA 2FPYA 3LMYA 5BOOA 1W1A1 7REQA 2NUYA 1XS2A 3WMCA 2FKPA 1XHGA 2PCEA 5CZKA 3OG2A 3IJQA 2YBTA 4E4UA 4HOXA 1ZFJA 1JUEA 3B8DA 4FNPA 2ISVA 4MPKA 3MB9A 4X2RA 1XIEA 5RUBA 3W1MA 1IF2A 4QGCA 4QRNA 1JFXA 1W17A 3BOLA 4JKKA 4DJDD 1W32A 4M19A 3SB0A 3CO8A 3A64A 1Z3NA 4H9TA 1YDYA 4TTGA 5DMYA 4NKCA 1J0YA 3WH8A 2QEZA 2ATMA 4M7TA 1TFVA 4PBEA 5H8MA 1EZWA 3L5MA 4YLWA 3LHTA 4DX3A 2XWEA 2ADAA 3ABSA 5G4EA 4GY7A 4XAGA 3G6MA 3LUTA 4ZOEA 2DIKA 5HNUA 4RX0A 3UR7A 4H4IA 4HBKA 4YN5A 2XGBA 1E4IA 1BVWA 1FWSA 1PTDA 3CIWA 3F4WA 1CTNA 1OY0A 1IYXA 1AQ0A 4CNPA 3LPOA 4FK9A 2C3ZA 3CUJA 4RDYA 2HVOA 1UD8A 4CCDA 4DJFD 4EOUA 1MW0A 1XL9A 2YOCA 3V5OA 1QBAA 3MMUA 1O6IA 3QJAA 1KFLA 2DZWA 1V4YA 1H7PA 2ON3A 1X38A 1RCOB 1F6KA 4V15A 4WOQA 4AWEA 2XHYA 1S2VA 3C3NA 4PC8A 1C29A 4Q4RA 1X7FA 3UYIA 1UIOA 3RDKA 2YL9A 1QPQA 1YNYA 3DX5A 1ZTVA 4BWLA 1Z48A 1TR9A 2NUWA 3E38A 4PCNA 3W2LA 4KW2A 2IPGA 4B16A 4BI6A 3PPFA 4XKMA 3G2GA 2NSXA 3WNOA 2WVVB 3CTTA 3R0UA 3W7NA 4P8WA 4PBGA 2ZUMA 2YA0A 3MQTA 5B7ZA 1TPEA 1L9WA 3E5BA 3CQJA 3N3TA 1WDWA 2PS2A 1JDDA 1XG3A 4LRTA 4W4QA 4E8DA 1HP4A 5E0KA 1YMYA 2HWGA 2X42A 1FH8A 2R6OA 2BXZA 3EWUA 3LI1A 2NX9A 3CUXA 4CCCA 3AROA 1YXDA 3AUOA 1B0IA 4IOTA 1Z44A 1YADA 1T99A 3PBMA 3U5UA 5D2WA 2YJQA 1SZGA 3RGTA 4JIRA 4IJRA 3S1XA 1UR3M 3UJFA 1X6UA 2PTDA 4LY8A 4MB3A 3MTWA 3H4XA 4F2BA 3THQA 5EMYA 2PDCA 4QDWA 3THCA 3VZZA 4DBWA 1MW3A 1W1TA 1QNVA 4IZGA 4UXDA 2WJDA 4XBKA 3L4ZA 5K4XA 1MDRA 1LT8A 3T4WA 1RBAA 2BASA 1TTIA 1NDVA 4Y9PA 5D4YA 4CQCA 5KTLA 2AKMA 4Z2LA 3URBA 2WYSA 3GU9A 1DXFA 1B57A 3WK0A 5LNRA 1A0DA 2QCDB 1XLFA 3P5ZA 3R0KA 2VXNA 6ENLA 1E4NA 3ZJKA 4JEJA 1RQBA 2QMJA 4GYJA 3VD5A 3L5AA 3TKFA 1XBVA 3FDKA 1VFSA 1UQZA 1Q6DA 1W3JA 4X0NA 5AKQA 1AMYA 2Z6IA 1US3A 4G1KA 4MGGA 3O0FA 3L67A 4EE9A 3WQVA 1OHLA 2DV0A 1E3ZA 4X61A 4FSAA 2PTYA 1RZMA 1UPMB 4PUMA 3PJXA 4E5TA 3S47A 4DEFA 1DJGA 1XH2A 3AICA 1PO9A 5A8MA 1XICA 3GDMA 2FMOA 4DUVA 1EC7A 3AXXA 5FL1A 1A5NC 3WEOA 4RV3A 3M44A 4IIEA 1V0MA 4NIRA 2ZUWA 1ODUA 4BK9A 1L0PA 1P6BA 3MP3A 1JPIA 3C2FA 4E3VA 2PU1A 3S0CA 3BQ6A 1VYRA 4NAFB 3E9AA 3QY6A 2OYLA 1Y5XA 2WJZA 3RMEA 1T0OA 2PFHA 4NJIA 1TRIA 2Q8ZA 4HYWA 4OGZA 3UA4A 1BFNA 2PB1A 4HHPA 4HYVA 2OFJA 1QNQA 3EWYA 3M7WA 3SCOA 3A23A 4QG6A 1JZ2A 3UG3A 1T7LA 3AYTA 1KQYA 2DJXA 4NZFA 1POKA 4AH7A 1J79A 2RJHA 4W8LA 1Q6EA 4GK8A 4WF7A 1A5SA 3B03A 4JDYA 3EAUA 2W66A 3ARYA 2DPEA 5CJMA 4F0LA 1YE4A 1X1ZA 4D6HA 3B0PA 1V0KA 1R85A 1R6WA 2ZFAA 3BGJA 3SQMA 3KWXA 3A6OA 3N2TA 2V69A 2CLKA 1ALDA 4QG8A 4HK5A 2VDIA 4OHQA 3N17A 3P60A 3UWYA 3NM1A 1QWGA 3R13A 1TJ1A 3S9ZA 1D3GA 1ZALA 1WAWA 3QV8A 1JCNA 3KVJA 3P82A 4Q7IA 3SRKA 1N8FA 4S3CA 3NYZA 2PWEA 2ZUNA 3K4WA 1FCQA 5A8QA 1OEPA 2A3LA 5EBUA 4C7GA 4JY8A 2WMHA 1FHDA 1VRDA 1UJPA 1DYSA 1FWRA 5G1TA 1TIMA 1E3XA 3G18A 4AC7C 1R3WA 1ZBKA 1ZGDA 3WDRA 3V4BA 3AIVA 2GGJA 2HJPA 1CGTA 4O15A 4IP4A 3VX0A 1P0EA 1QJWA 4F3HA 1XLEA 3EKZA 2W3ZA 3N04A 2CZ5A 3GVQA 3GWQA 2E68A 1PIGA 4DUOA 5D32A 4YNGA 3MV11 3OA3A 6CGTA 1OF8A 3PWGA 3ZWSA 2VCBA 1HO1A 4IICA 4MJMA 2PDWA 3NSXA 4P8XA 3DCPA 2CHRA 2X2YA 6XIMA 3MUZ1 5DBUA 4ZE5A 3WBAA 1DIEA 4FLSA 1I2PA 1PUDA 2DZTA 3CYVA 2IKJA 3DGRA 1GOIA 4ERAA 1Q65A 4Z1DA 4C1NB 4US5D 1T8XA 1UOKA 3DFNA 3NZGA 5E93A 1WCGA 1YPXA 3LN3A 4FI4A 1BLIA 3LXAA 3GTIA 4B4FA 3GR7A 1B5TA 1GJPA 4GUHA 1E6SM 4JCMA 4QROA 5GJPA 5F2MA 4BQ5A 2A79A 4WKAA 1VP5A 3FEMA 5EBAA 1PZ2A 1X1OA 1PB0A 4NAEA 1IEWA 1TRDA 3L2LA 1E1CA 4QJ5B 2CW6A 3F4VA 3WBYA 3B9AA 4DAIA 3NSMA 3ITYA 4TMCA 1H7OA 4AAJA 3QVQA 4ORMA 1ZHAA 3KZPA 1VIZA 2BNJA 5GJMA 1FWHC 2Z26A 3RITA 4RNHA 1W1YA 2XGZA 3BTNA 3W75A 2R82A 4AEEA 1VJIA 3H26A 4G6CA 2WC4A 1UMYA 4FHAA 3WFLA 3CUIA 4MFEA 1JCJA 2GUUA 4Z0SA 1FDZA 2X40A 2QDEA 4R7OA 1DJHA 4LRSA 1PYMA 5M2FX 4XZWA 4HZ6A 3UZ5A 5KSWA 1H50A 1LJYA 4ROPA 2CLOA 5KEZA 4UTJA 4Q8NA 2A3AA 4FXSA 1VGAA 3KOYA 4BY3A 2FQIA 4NU7A 3S1VA 3UR2A 1R47A 5I5RA 3NQFA 3G0UA 2D3NA 1VR6A 3ZJ6A 4QS5A 1EEPA 4BEUA 1FWBC 2WPGA 3RU8X 1FVPA 1DBTA 4JR5A 4U28A 1J01A 1LL7A 2BDQA 3LHYA 1GG0A 2UWFA 2CKSA 2PRHA 3SFWA 1UC5A 1LLZA 4GA8A 1SO4A 4M6PA 1LP6A 1H1YA 2BWGA 2HZGA 3PBVA 4K39A 3QH2A 4N02A 1WZMA 3GKAA 4IMDA 3EOLA 3ZIZA 3SY1A 3UCDA 2WVUA 4E4FA 5C9ZA 2FGBA 3AYVA 4F0SA 4J3WA 4XG1A 1TWWA 3OB8A 4ZSUA 1WZLA 4E0CA 5C71A 3V1PA 5GNYA 4F79A 1ME9A 3N2OA 5A2CA 2O9OA 1VYSX 2XSAA 4OUIA 1VPXA 3PUOA 1SSGA 1EX1A 3ZJ7A 3CASA 4L6OA 3WF0A 2FZNA 1H2JA 3HQOA 1DKWA 3BXWA 3OVGA 3BANA 1E56A 4WHBA 3NJ3A 1OCNA 3NZ1A 3MCNA 4BR1A 1W5PA 3LV5A 3TC7A 2Y62A 4JBRA 4W86A 4J9JA 4XX6A 1M68A 3M1ZA 3G1HA 3C8FA 2B7PA 1AODA 1HKJA 4EKJA 4GQRA 3M0HA 2OR2A 5JQ9A 3GBDA 3CMJA 2ZICA 3VE9A 3U2ZA 5IDZA 2WZIA 4XO6A 2AL2B 1Q45A 1TJRA 4GO8A 1G7UA 3QPEA 3FAWA 4HNTA 4XD3A 1UMLA 1DWIM 4GC3A 3D3AA 4I5XA 3B8IA 4GI9A 5FF7A 1BXCA 5H1WA 3WUBA 3QZAA 3GC5A 4D8LA 1P0KA 1NOUA 1EPVA 3PP7A 3WQ4A 2YCLA 2C79A 5CJNA 4LBUA 1HVXA 4PCSA 3DGBA 1YNQA 3ITGA 3C2OA 3TR2A 3M6YA 1RP8A 3ZWTA 4JHOA 2QMKA 1GVSA 4GKTA 4J1OA 3NOYA 4MAVA 3W7PA 1VEPA 1A0CA 2YGYA 3GHSA 4B92A 1J2BA 4XAYA 2ZXBA 2NV9A 1NSJA 2YBVA 3CGTA 1XIBA 2PAJA 4C5YA 2V30A 3REQB 2RUSA 3S6OA 3FEQA 4F9JA 4NUWA 2J7DA 3Q45A 3H21A 4JNZA 4XIAA 1TKKA 1D7KA 4MFDA 4RNIA 3W2UA 4IMAA 5XIMA 3N15A 3LRKA 3LEPA 4IWWA 1GVQA 4LEFA 2NW0A 1JZ7A 1RJQA 4UQEA 3WYZA 2ZRWA 3N6JA 4LUSA 3T2OA 3EDEA 2NZLA 3LM7A 1W9PA 5I77A 3EX6A 3KLLA 4IGSA 5I3HA 2Y6ZA 4GG9A 4H7ZA 1O60A 1Q7QA 3WNKA 5KETA 2J6VA 5DRCA 3AHVA 3UZJA 3I3BA 3N9SA 1RV8A 3VILA 2I5QA 1OINA 3LCLA 5F2IA 1L6WA 1S2TA 4QISA 4L7ZA 1RP9A 2P53A 3P7YA 1WDQA 1KTCA 1J11A 2GPTA 4B5TA 2ZX5A 3HG2A 4ZMGA 3ZR5A 3TFCA 2OO6A 4DUWA 1UZ4A 2CKRA 1E70M 4JQAA 2VQUA 4TMBA 2O56A 4NAEB 5D05A 5LIWX 4TUFA 1IE7C 3BWWA 4AXKA 2DVUA 4NJHA 1Q6LA 1R8LA 1R3RA 1TWIA 1AQHA 4QE4A 2BFGA 4PTNA 4W84A 2DZXA 4MB1A 4O57A 3F4DA 5HJLA 4W8AA 5HJXA 1FFQA 3DKJA 1K70A 2RJGA 4IMEA 2CBVA 5AN7A 2PUZA 4A8NA 3WLLA 1ADDA 1TREA 4HNCA 3TIMA 4XISA 1ODZA 4WGXA 1QPOA 3FSTA 3SCQA 1O66A 4XB3A 1G9HA 4JFSA 4FNUA 1VENA 2WHJA 3Q67A 4UTIA 4WJXA 3EXSA 4FXFA 2GVEA 4I9MA 3BUVA 2WLYA 3JR2A 5K9CA 1Z9AA 3VOCA 5BW6A 4REQB 3BG9A 4ATLA 1FKWA 2Y7GA 3UQNA 3AUJA 4JS3A 4PR4A 1OYBA 4N6FA 4GIYA 4QR6A 3CB8A 6A3HA 3D3FA 2CWNA 2HXTA 3NYDA 3SGZA 3QR0A 4DJFC 4NASA 1VH7A 3QMRA 2FB3A 4AZGA 3OEXA 3W1LA 3M6DA 3NDZA 2QW5A 2INEA 4PN2A 4UB9A 2CXEA 4EWND 2GJNA 3HM7A 5F2GA 4R7JA 2FLIA 1GQNA 2DEPA 4EXQA 4QIUA 2YW4A 3W85A 4AZHA 1VCFA 3FOKA 2ZYFA 1WBHA 4EP8C 3VOIA 4JQ3A 4B4HA 3HJZA 4YWIA 1FXPA 1LBLA 1JAEA 3ZVIA 3KM8A 4EWJA 3H2EA 4AX6A 5D2YA 1SW3A 3VNIA 2F6XA 4AC1X 2X0HA 3QQWA 5BRPA 1OFOA 1PBGA 1IWBA 1E1FA 3K8LA 1JRBA 4ES4A 1KRMA 4O1EA 4MWAB 5A6LA 2YSWA 4Q8WA 2I5GA 1B9BA 4NAFA 4J7RA 3FHQA 5HANA 3OODA 2DVTA 3UW6A 2CHOA 3LBMA 3U4AA 5HDRA 1OADA 2YXXA 5A6AA 4PB4A 3SY5A 3AHTA 1V6TA 3HMJG 2NUXA 1OG6A 3EMQA 3TW9A 1CB7B 3KTCA 3ZO9A 3IK4A 3WN6A 5C9RA 1HJXA 1GZJA 4MDOA 1JZ5A 3RX2A 1HL8A 3KUMA 3M0YA 3DAQA 1X39A 3TN4A 1C9WA 5FEPA 4C90A 4F40A 1U5HA 2QYGA 1AK5A 1EP1A 3KVKA 3CH0A 2NLIA 3T2PA 4FX6M 4J3ZA 3GG0A 3WK1A 1U33A 5J8LA 3R2GA 5AYYA 3CZKA 3UWUA 1MVYA 4M82A 4JN8A 1WNOA 2SFPA 1OT1A 4IIDA 2PDNA 2GDUA 4RNFA 4LEQA 1UKSA 3CPUA 1ZJBA 2X1UA 5CAHA 1XIGA 1KXVA 1XBZA 1AQMA 3EA2A 4DM1A 4I9JA 3T0BA 4H00A 3S1UA 3E74A 4WY0A 5ABGA 2ISSA 3MSYA 5TF0A 3T05A 3HJEA 4W89A 1KCXA 4F0MA 3TYUA 4HSOA 1F4AA 4F0RA 3PF3A 4E6MA 2OO0A 5CEWA 1V0NA 5HBFA 1VBHA 3S83A 2PA6A 4Q4KA 4NI8A 4C6JA 2OVLA 5LZLA 3E2RA 4KEMA 1FWTA 1QI5A 1YEYA 3IV3A 2QPXA 3A4JA 3CV7A 3TROA 3O3RA 5HUOA 1BPLB 2B7OA 3R8GA 5CPTA 5A8PA 1SYTA 3W26A 2IKGA 1J9YA 1FRBA 2VM8A 3RJXA 1XGEA 5TQLA 3AMKA 1HP5A 3T78A 5C55A 2ZVIA 1M01A 3C5QA 4NT0A 4CNNA 4AZIA 1E15A 3M5ZA 1TPWA 3N9RA 3SIMA 4HVXA 1J96A 2WZHA 4XKYB 1ZPTA 1LUCB 1CYGA 4OE7A 5C9WA 3LQLA 4NJKA 3L4WA 1UASA 1C8VA 3TTYA 1TWSA 4PTWA 1M04A 1A5BA 4R27A 2GLKA 4MZ1A 2FHCA 1VFLA 4UTKA 1OVDA 3LBCA 1Z42A 4XAPA 3PNZA 2WVSA 3WEZA 3OBEA 5DT7A 1XYMA 2PDIA 3WNPA 4LY4A 1EOMA 3K2GA 4L9ZA 1H0GA 4FEZA 3THUA 1VS1A 2YCKX 1LL4A 1J8VA 2OWCA 2DZSA 4GI6A 1YBQA 1TA3A 1PKLA 2A7PA 3N73A 2VX5A 1THFD 2AQVA 1EP2A 5FOOA 3NIYA 1MQRA 1UA3A 3VI2A 1MQQA 2V63A 2HXUA 2WQPA 1JQXA 3BMWA 4W5UA 3KCJA 4HPHA 2D0FA 5CC5A 3BW4A 1M65A 3ALFA 4E8GA 3P5YA 3BK0A 3LGEA 4FPSA 1K1DA 1PHQA 2XU2A 4W5ZA 2YB4A 4JTDA 3ZFHA 3SBFA 2D2HA 2V3FA 3U57A 2CBUA 3POCA 4CVUA 1TPFA 3SRHA 4GCAA 2V5LA 2CLMA 3NVTA 3GS6A 1NQ6A 3MMDA 1P7TB 3E49A 1S5WA 2ZRUA 4QQUA 1FH7A 4FAMA 1OX4A 3LNPA 1S2CA 2JGQA 3IJDA 4TVUA 5FJIA 1LOLA 3GVVA 5ABTA 4UTLA 1DTNA 3BJTA 2XH2A 3UJRA 1B3ZA 4UNLA 2Z1KA 3ENLA 3W81A 1E55A 4KCUA 2BY2A 2QQ6A 3IS4A 5TNVA 5HPCA 2GSJA 3CTLA 3WJXA 4UR9A 3MUCA 3MZ2A 4XBSA 5G2HA 3RFAA 2BY3A 3PB0A 1Z89A 2CLHA 3L4XA 1JDCA 1QU4A 4KKXA 2ZX7A 1I1XA 4HIBA 3G77A 1GYNA 3PWIA 2G8ZA 1YRRA 3ZT7A 1IXOA 2E6YA 1JI1A 1HJSA 1QVBA 4QNEA 1HTIA 3SEPA 4JCLA 4KERA 4HHLA 1C92A 3N34A 4WIWA 4OECA 4A29A 2VVSA 3U5YA 3CM4A 3CU2A 2X8RA 3IACA 1RH9A 3W7IA 1HGWA 3CK5A 5FF0A 1Z69A 5A95A 2OQHA 3N11A 1MFUA 1W1ZA 1GVOA 1KXTA 4BQ4A 4ERIA 4DAFA 1BG9A 3UEQA 1IT7A 2WB5A 5CG0A 7ODCA 4MNMA 4TX6A 2XN0A 3P74A 3G1DA 4GNJA 5KZ6A 1LQ0A 1QASA 1ONRA 4W85A 3QMTA 1ICSA 3L0NA 4DHGA 3LSCA 1BYCA 1YQ2A 3Q4DA 5G4WA 1TA3B 1DOSA 4JNMA 3S5YA 1M7XA 2Y5EA 4YCPA 1K03A 2XSBA 1XYBA 3KZSA 2WNZA 1OCJA 3SSJA 5FI8A 3APYA 1GJUA 4FLOA 3E12A 2V3DA 4HOWA 4CQ9A 1FCVA 1PTGA 5KZMA 3LCHA 3VNJA 4GCXA 2NQLA 2OODA 4ZGYA 3QKEA 2HPMA 2WW5A 3IJLA 1B3XA 4IH3A 1Q6FA 1XD1A 2J75A 4FALA 5FJPA 2ZC1A 1KWKA 1QOXA 1TYGA 1QT1A 5AC5A 3V75A 3MUXA 5A3HA 3O0KA 2CZDA 1KC7A 1UUQA 2BVTA 4IFRA 3AFBA 5EKYA 4JHZA 2WSPA 2UV8G 2C18A 2JF6A 1OFPA 3TMQA 4F9DA 1F76A 5E09A 3O07A 5BWAA 4U33A 4JHMA 5E70A 2CLLA 1XLLA 1SFSA 2GJXB 4G8TA 4GI8A 3HURA 1UUMA 3PBYA 4AD4A 4UFKA 3FXGA 1KXHA 3N6HA 2FDSA 3C2EA 4DF1A 6REQB 2DQXA 2CLPA 2O55A 1XDLA 5A6MA 1BEUA 3HV8A 4IIBA 4PRWA 5LGXA 4Y8FA 1KFJA 3W1PA 2V5JA 3H70A 4B15A 1VEMA 2WMJA 1EUNA 1FWWA 2DH2A 2DFAA 3KRUA 2V3EA 4RV8A 3SCSA 2WCSA 3T0TA 4RNJA 8CGTA 4YTRA 3PPCA 1ZL1A 4X60A 4MUPA 3FYYA 3R7MA 4TVDA 4EIVA 5M03A 4G9PA 5AZ1A 5DF0A 2PDBA 4GD0A 3AYSA 4CCZA 4G56A 1CNVA 4IHCA 4LVBA 4RDWA 5JUVA 5G4HC 5EGRA 3N25A 4DBDA 3WEMA 4QITA 3LCGA 4JYEA 3EDJA 4LALA 1GHSA 5KZDA 2PP0A 2VHLA 3KRSA 4D72A 4AZBA 4KF1A 2W79A 3WLOA 1OJXA 5CGQA 4GZIA 7ENLA 1G4SA 1K3UA 1C93A 1BQGA 1PEZA 4N9BA 3ZMRA 2R1MA 3QW4B 1RD6A 4O1FA 4MLRA 5ABHA 2QJGA 2C19A 5CPNA 4LCQA 4WSJA 3I4KA 4GVFA 3GYCA 4GFSA 1WKYA 4IPLA 3VKDA 2FHBA 4GX9A 2X05A 4BF9A 2A6NA 4AIEA 3QZ6A 5MKGA 4GY0A 2JF7A 4FX7A 5FAGA 5LSMA 5EB8A 3VK5A 3EA1A 3BARA 4JOMA 4Y7EA 1JZ6A 3UXAA 4GIRA 3PZQA 3PFMA 3I6TA 1E4MM 3W1NA 3SRFA 4WR3A 3HGJA 3OGRA 4BFAA 3SDOA 1B2YA 2W0UA 1XLKA 1NOWA 3WLIA 2TRSA 3TUUA 1OT2A 3GTHA 2EQDA 5BOFA 5D9NA 1LRTA 4UQCA 1EXBA 4HJFA 1UUOA 5FIPA 4AZ7A 4M7SA 5HWNA 3USBA 5JIPA 4LYPA 4XZBA 3OIXA 1T6MA 3NZPA 5I3JA 5AY7A 4R3UA 4H9XA 2W91A 4ZO7A 3GHTA 3AI0A 2VEFA 3WFZA 4DWSC 1GTEA 3CB3A 4TO8A 3B8TA 2G3IA 1PDYA 4GC4A 5AC6A 4TQTA 3CWHA 4DO6A 2QV5A 3O63A 3S5ZA 5FSEC 3Q65A 5DMLA 3AYRA 5I24A 3CHCA 1QO5A 3W25A 3GU1A 4D6JA 3M0KA 4H8NA 4CNOA 4UBPC 3ARPA 4GI4A 2GDQA 3PJUA 5A94A 2DORA 1H1ZA 3VPLA 5HA7A 5AZ0A 1P6CA 4B5XA 2GFTA 3HB9A 3VMPA 4NYUA 4JIQA 3MKKA 2XIBA 3EX3A 4AG0A 1VFUA 2I57A 3BW3A 2W4XA 5REQA 3THAA 4Q22A 1QFEA 3GM8A 3W7OA 3KBNA 2P8BA 2EKCA 3IGHX 3POHA 2HVNA 3CQKA 4GY1A 1AMKA 1DHPA 3R25A 2ZUTA 4YTUA 5LNUA 4NX5A 5CCZA 4HCDA 3DERA 2IKIA 2MUCA 4YL2A 1Q6CA 4WSKA 4HU4A 2PD9A 2ZXQA 2GUBA 3AHXA 4YWSA 3MKCA