5C6MA

Crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
247
structure length
247
Chain Sequence
b'MSDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAGDTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFELVKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAGADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAGGVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNLLHTLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Shewanella halifaxensis
molecule tags Lyase
total genus 100
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c6mA00
3PB0A 3QW4B 1FWNA 3M5VA 2RKXA 4JYFA 3W7MA 2CLFA 3DXIA 1ICPA 1LBLA 1R2RA 3G22A 4FNTA 3FJ6A 5IBXC 4I9AA 3C0JA 3EXSA 1LP6A 1ZAHA 4K37A 4WOZA 1G7UA 3O06A 2FPYA 4N6FA 1W3NA 5F2GA 3TX9A 4LV9A 3TNOA 3WK2A 1I2RA 4ADSA 1P1XA 1SR9A 1UB3A 3W7PA 2CZDA 1BWLA 4UUIA 5HR6A 3HGSA 4FXSA 1KFKA 4MLJA 3UPWA 1XBXA 1YXDA 3R13A 1AMKA 2FQIA 4O17A 1T99A 1VYPX 4LW7A 4JY8A 3EWUA 1GEQA 3RMJA 3OG3A 3W75A 5DN1A 1FWSA 4BF9A 1JCLA 1FUYA 1C8VA 3S1UA 2CZ5A 3ATYA 3LB0A 1EPXA 2A6NA 3PY2A 3NQCA 3TROA 3RNDA 4CQ9A 4ONVA 2GJNA 3UPBA 2ISSA 3GXPA 3NVTA 4LVAA 4O50A 1Q3NA 5U7SA 2E77A 3BW2A 2QCCA 1ALDA 4Y9AA 4UTHA 4R33A 2GQ8A 3I7RA 2EF9A 3NL6A 4YWIA 4TMBA 1EEPA 4Z0SA 3BG3A 1XBZA 1ZENA 2GVLA 4O1AA 3LCGA 3PSWA 3LM7A 1X8FA 2JKEA 1S5VA 2V2HA 3G0SA 1QNVA 3HPZA 3S9YA 3LXAA 2YR1A 2ZCGA 3HO8A 5D32A 5A5WA 2B7OA 1I2OA 1I2NA 3TMQA 3TAOA 1CW2A 3TC6A 3H54A 3E0IA 1Y0EA 1HTIA 4WUIA 4CCDA 1YDOA 4LRTA 1WV2A 2VOMA 5LNWA 3DZ1A 2V9DA 4S2CA 3DFTA 4AWSA 1NAL1 1D9EA 4RCXA 3NZ1A 3RLUA 3WK3A 3W2UA 2ZA1A 3F4WA 3V75A 3MP4A 5H2ZA 3KVMA 2VC6A 3HGJA 2Y7DA 4LS1A 4DO5A 1VCGA 3LX9A 1F2JA 3VI2A 3R5EA 3HG5A 1TTJA 3UXDA 4TIMA 1TTIA 4IQLA 2DZXA 1TV8A 1LYXA 5CZTA 4OE7A 2J9YA 1FQ0A 2ZZ7A 3B06A 4HNNA 2A2IA 1TPEA 2YGYA 2BX7A 1Q45A 3IIVA 3BK0A 2AQWA 1YPIA 4FF7A 4JN6A 4LT9A 5BRBA 5AC7A 4HIBA 3T55A 3ZR4A 3S1WA 4MJMA 1NSJA 4C1KA 3ANYA 1A5BA 1K02A 3IIXA 4L4MA 3W23A 3GKAA 4I7UA 1M7PA 2OT1A 4R34A 3QQ0A 3W1RA 1QMLA 2CLMA 4Y96A 1GJPA 1QOPA 5HWJA 3KVKA 3DI0A 4YCOA 3VCRA 3CIXA 4ZQCA 1LORA 2BLEA 2FB3A 3SY5A 1HUVA 3OVRA 4KKXA 3A22A 5AHEA 3GKFA 5I3JA 1P0NA 5FI8A 5EKYA 3H53A 4U28A 4UR7A 3EEGA 5A8GA 3W1MA 4MZYA 1TPB1 2PC4A 2YZRA 3P67A 4PEKA 5LNUA 1W3TA 1Q6QA 2VEMA 5HWNA 2C13A 3P5ZA 2W79A 1ZALA 4PFMA 3UZJA 2CLKA 1UUMA 2I14A 3BG9A 3CWOX 5G1YA 4DBEA 3W1NA 3OIXA 3BLIA 3JRKA 4RZ6A 2X1RA 2WKJA 1BTMA 2YYUA 3NPUA 1SSDA 2FPVA 1K7EA 3O6DA 3W2JA 4IPJA 1MEIA 3B05A 3QRHA 4OGZA 5DELA 3C3NA 4A29A 4FB7A 5HJLA 1C29A 1H60A 2BXVA 1DKWA 1EP1A 1P5BA 2G97A 3NPVA 4GUHA 4LVDA 4UFIA 3C4UA 3TA6A 4TR9A 3HGRA 5C5YA 3P8JA 1UASA 4R7JA 3NL5A 3FYPA 4ZQNA 2A4AA 1A53A 2PURA 4DF0A 5LNRA 3GLCA 4FO4A 1QFEA 2CU0A 3IV3A 5L6UA 3A5VA 4D2JA 4P2VA 3CWNA 5K9CA 2GVJA 1ME8A 3C8FA 1JCNA 1O60A 5G2IA 1TPC1 3MYPA 4O8RA 2DU2A 4MY8A 5EL1A 4K7VA 5H91A 3W7QA 5LZLA 4AAJA 3NXFA 3QFEA 2EPHA 2FFCA 3IIZA 3FLUA 4WQ6A 3R89A 4MY1A 4QSHA 1K8XA 2V81A 5C2XA 3LHUA 4LRSA 2VEIA 1GVRA 3STGA 2V2DA 4OBTA 1S5WA 3LHWA 2J9XA 3TC7A 1R2SA 4GXMA 5DY3A 3WFAA 1GOXA 2P1FA 4UNLA 3CEPA 4GJ1A 1CI1A 5FF7A 3LCIA 4CNNA 2ZZ4A 2V0TA 3CQ0A 3ZWTA 3AO0A 2Y89A 3SFKA 3HG2A 1W5QA 1W5PA 4HSOA 4O0KA 4ZL1A 4FIRA 1UJPA 2FIQA 2JGQA 2VFEA 3NQ2A 3BGGA 3QQ1A 3DENA 3O63A 4UTWA 3LHTA 2ABBA 2OJPA 3DHFA 2NV2A 3UYCA 4KWVA 2A7PA 1S3HA 4KFNA 3W7CA 5AB3A 3MW7A 3EX4A 2J24A 3QM3A 3GXNA 1XUUA 5CPNA 1IXQA 4GRSA 4ORIA 3GB6A 4JICA 4NU7A 2H8ZA 2PRMA 5FF3A 4XUGA 1OK6A 1GYLA 3QMTA 4ZVJA 2Y7EA 5LGXA 5AYYA 3W6YA 4U4MA 4MPQA 4H6KA 3W1QA 4DF2A 4JTSA 1A50A 4LTSA 3M41A 4KWWA 1H61A 3W9ZA 5I3FA 3QMRA 5CSSA 3W74A 4JNMA 3GNDA 4N4QA 4MKNA 5BNKA 1X1OA 3FKKA 2F84A 1WDWA 2GQ9A 5I3GA 1LZOA 4R53A 2WO5A 1OFRA 4WY0F 3BLEA 5EA9A 4IMCA 1LOLA 3LTSA 1DV7A 2E6FA 2QDGA 3EWZA 1DL3A 2I9EA 1YYAA 3TMLA 1JQXA 2ZFAA 3TW6A 3O15A 4K7YA 4PCFA 5F2LA 4P61A 4MZ1A 3HQ1A 1GTEA 4NVTA 2RFGA 5D2WA 3EB2A 3G1HA 3NO5A 3TCEA 3RF9A 4E0CA 1VHNA 4JIQA 3GYEA 4O16A 5F1VA 1W5NA 1H7NA 3IIPA 1JR1A 3KVLA 4AF0A 1EWDA 3B8DA 1KM6A 1QO5A 5CPMA 5FEWA 4FNRA 1O95A 3FOKA 4UFMA 3NQFA 1XM3A 1TPDA 4UXDA 4JR5A 3FS2A 4ZQMA 1OX4B 3W86A 1SU5A 5K4ZA 2WOQA 4AB4A 3G8EA 3IRDA 4OV9A 4UTTA 2V82A 1D3GA 1NEYA 5BW6A 3QJAA 3DFQA 3NQVA 4EIVA 1A5SA 3T7VA 3GR8A 4OV4A 5LNSA 1OK4A 5KZDA 2Z1BA 3KAOA 3CC1A 2B4GA 1FCUA 1KLYA 3LHZA 3NEVA 4NUWA 3DBPA 4NXKA 1MXSA 3HPSA 3T44A 4LS2A 1SUXA 5EY5A 3HB9A 5G2WA 2HS6A 3LCHA 1P0KA 1SW0A 4O14A 3DFNA 5LGZA 2H8XA 1RQBA 1TTQA 1ZHAA 4HKPA 4WY0B 5KZMA 1OFEA 5C54A 1KM4A 2NX1A 3KFTA 4N02A 4JTTA 3E9AA 1KM3A 4NJIA 5AHFA 5C55A 1BEUA 4JTHA 2NUYA 1ZNNA 2J88A 4S1FA 1KM5A 3TFXA 1FDZA 2PE4A 3VE7A 1L9WA 3QSTA 5HMSA 2YYTA 1A5AA 1XUZA 4GUIA 3DAQA 4N6EA 1L2UA 3TV8A 5D09A 1YTKA 4B5NA 2C0AA 3T78A 3W83A 3N9RA 4N9CA 1O5XA 1RVGA 4M6VA 3S5YA 3BLFA 1VZWA 1LOQA 4YXGA 4NNAA 5K3VA 1J5TA 2HTMA 4XQ6A 1SZNA 2XN1A 5HUPA 4GUGA 2ABAA 1LLWA 3BGJA 4JX4A 3KXQA 3CLMA 2C1HA 2DORA 5CPLA 3SZ8A 1TV7A 3C61A 1WX0A 4H3DA 4ZZ9A 5J5RA 2NXIA 3UWUA 4IMEA 2QAPA 3PVFA 3MP5A 3UXAA 5DBTA 4JYEA 2AGKA 4MZ8A 3G1AA 2ZRZA 4A22A 5HNRA 2Q3RA 2DJXA 5KITA 4MFEA 4XKYB 1YTDA 1T96A 5DCEA 4DELA 3L67A 4HNVA 2ZZ3A 3STEA 5GVJA 2ZBTA 2F7FA 5L9FA 4OHQA 2YW4A 2NUXA 1SQ7A 3KHJA 1SZGA 4HT3A 7TIMA 1FX6A 4N9DA 2VELA 4N2YA 3NGJA 3FEMA 3M5ZA 2EGZA 1F5ZA 3W7OA 3NPXA 1W31A 3TSBA 1G7VA 1X1ZA 4XTDA 1IXOA 1YXCA 3B4UA 3WJSA 3EX2A 1FCVA 1W54A 1YLVA 3W1XA 4HSNA 2NV1A 3E49A 5FEXA 2TRSA 3LI0A 1TRIA 2TSYA 3LRMA 3P61A 1ME7A 3HPXA 4O4VA 4LC8A 2DZSA 1F76A 2A7NA 1RZMA 2ZZ6A 5G5IA 1B9BA 3C2OA 3L66A 2BSLA 4EOUA 3P8IA 3LI1A 1XFBA 3O05A 3OEXA 2QCEA 1M7OA 2RDWA 1AL8A 2WNQA 5C6MA 2QJIA 1HO1A 1K8ZA 1E51A 3L65A 1ZJIA 3W1AA 3BW4A 1KA9F 4UTUA 1WA3A 3MI3A 5G4EA 4DXVA 3HMJG 2DZPA 4XWUA 5D04C 1A5CA 3DGRA 1THFD 4IMDA 3DU0A 3HGOA 5ABTA 3PG8A 5TBOA 3L5LA 3LERA 3A21A 1OJXA 2X1TA 3TXVA 1I2QA 1FDJA 1YDVA 3ATZA 4RXFA 5AFDA 2GQAA 1N8FA 4ADUA 1GVOA 1Z48A 3GVGA 2QCDB 5D03A 2E6AA 3W7JA 3PG9A 4RKAA 3P74A 1I8JA 1F6PA 3ABRA 1HG3A 3DKLA 2KZHA 1LOSA 4M6PA 3USBA 5LSMA 5EPDA 3L5AA 3B0PA 1F05A 2VXNA 3N9SA 4L4LA 4IJBA 4O28A 3S5NA 3NG3A 3HG4A 1RPXA 1VQTA 3PB2A 3I7QA 4NNCA 4YMZA 4JTGA 3TH6A 3FKRA 3PBVA 2H3DA 1AW2A 1OX6A 3QEZA 4J9JA 2J9ZA 3PBUA 4QITA 3NQ6A 3CM4A 4BR1A 1TPWA 3VKJA 2NLIA 4XBSA 3R8RA 2C15A 2ALDA 3EWWA 3P5YA 3VE9A 2E6DA 1H1YA 3GAYA 1KBJA 4MYAA 1DVJA 1G6CA 2BWGA 3M0ZA 4O10A 4ORMA 1S5TA 1ZCOA 3LDVA 4MY9A 1ME9A 4HPXA 1R2TA 4WXYA 1EP2A 1XBVA 1GVSA 2G96A 1JQVA 3AJXA 2C14A 1J4EA 1WYIA 3L0KA 2XN0A 4UTWC 3LBCA 3UD6A 3ZWSA 4IMGA 2ATSA 2PCQA 5D2XA 2WSQA 2FTPA 5D30A 2V30A 3EKZA 4IMFA 4CLMA 4QQ3A 3QH2A 1YXYA 1SFLA 2NUWA 3TXZA 2CLHA 2E5CA 5AHIA 2VENA 2A5HA 3S8HA 1TSIA 5AHNA 3T4CA 3NQ8A 2DP3A 4RX0A 3N19B 2Z2UA 3GX9A 2YXGA 3W71A 3LV5A 5TIMA 5D37A 2ZZ1A 3E96A 1XDMA 4KFOA 5KMYA 1ML1A 4RR4A 2NZLA 4ZQPA 3FA5A 1PV8A 2WV8A 5F2IA 4UCGA 2Z6IA 5D02A 1H7XA 5E0KA 4IXHA 3DFPA 3BW3A 4O52A 4JXCA 3GDMA 4BI7A 1VS1A 2Q3OA 4I7VA 5AN7A 4O1CA 1OF6A 4WJEA 3QZEA 1VHCA 3UWVA 2B7QA 4AXKA 4A2SA 3O07A 1NF0A 4HHPA 2ZA3A 3PR2A 1LRTA 3NM3A 1PCKA 2QAFA 4UNKA 3P84A 1W1ZA 1FXPA 1K7XA 3LHYA 3UZ5A 1XI3A 4JS3A 4OU1A 1KFLA 4NJJA 1TPVA 3DH7A 2V8ZA 3L0GA 1DORA 3NL2A 4LU0A 3W7IA 1NF7A 4QJ1A 3TK7A 2ZDRA 5AHLA 1VR6A 1WQ5A 4O4WA 3W84A 4GWEA 4M7TA 3GDRA 3ABSA 3N2XA 3THAA 4MOZA 1FCBA 4UTTC 4UR8A 2GOUA 4DPQA 1RD5A 4O15A 3Q37A 3L21A 3PUEA 3GAKA 3NZRA 3W2MA 3D0CA 1SO5A 5HR7A 4JTFA 4QAIA 3BG5A 4K38A 3IGSA 3M47A 4PL2A 4HNUA 4JYDA 5AC6A 3Q94A 5FEZA 4UTJA 1AL7A 3LCWA 1OG0A 4RJEA 1XDLA 3I65A 4JGDA 3F1QA 2QJGA 4RK8A 1G4TA 2NXHA 2E1DA 4NX0A 1B57A 5DCDA 4NZFA 4NNBA 2NXGA 2OX1A 3TDFA 5DCBA 3W3OA 2QDHA 4Z08A 3G24A 1W56A 4PTNA 3MI6A 3SIZA 1VPXA 2HMCA 3R12A 5MHBA 4JDBA 2WQPA 4UMAA 5D38A 4DO4A 3UQNA 4K39A 4JIPA 3QPYA 2VFDA 4ZMGA 5FESA 2HS8A 3IGUA 4JTUA 5CZ0A 1VRDA 1VH7A 1JUEA 4MIMA 2FJKA 2RH9A 2YFOA 2VFIA 1TYGA 4MVAA 2AAMA 1RQHA 5LKYA 1GZGA 3LXBA 1QWGA 1SPQA 2UV8G 1OYBA 2DZTA 2WSYA 1W37A 3PM6A 2QUUA 4Y6GA 1B4EA 4LUJA 3LCXA 3SGUA 1SFJA 1W8SA 2A7RA 3SW6A 3UWYA 4Z1BA 3KRZA 3O1NA 2CLEA 2QCMA 1KFJA 3SECA 4LOCA 3STCA 1PS9A 4FEZA 3WK0A 3TIMA 1I4NA 1GWJA 1XC4A 3OVQA 2P0OA 4PL1A 1LROA 2DZUA 2ISVA 2R8WA 3W70A 4QISA 1DHPA 2QCHA 4Z1DA 3UWZA 1QR7A 3FFSA 4A3UA 1TPH1 5HULA 3S42A 4TU1A 3JR2A 1DOSA 4RXGA 2E5DA 5CPOA 3N14A 3GDKA 1JRCA 1LDCA 1JCYA 4FX7A 3C2FA 1H63A 4IX2A 1R30A 1TQXA 1IF2A 2QCLA 2ZYFA 3BVJA 3GDLA 1WBJA 2QJHA 2Y6ZA 2G5WA 4O54A 3W85A 4O53A 3ZFHA 4E38A 4Z1CA 3NQMA 3BPWA 4QNEA 2C18A 1TJRA 2PRLA 1RR2A 2Y7FA 1KTBA 2R14A 3P7YA 1Z42A 2BZNA 1MEHA 1H5YA 1ZAIA 4LY8A 4ML9A 3Q58A 5CZJA 1DQWA 3CEUA 2V5BA 1EUAA 1QPNA 3BV4A 2VFFA 3EWYA 1RV8A 4MLRA 1GG1A 4LV4A 5CZSA 1Q6OA 1U5JA 5T26A 2CZEA 3MHGA 4X9SA 4UFLA 5AYZA 5BMWA 1KM0A 3U8GA 1PHQA 4GE8A 4JDYA 4Q4KA 2JKAA 4UTMA 3GXTA 3MBFA 1O94A 2NX3A 4MYXA 3UY8A 4WX2A 2YDAA 1UBSA 3S1XA 1FDYA 4WZHA 3W7LA 2A0NA 1KFCA 3PAJA 1WOBA 2X30A 2QUTA 3KRSA 3MO7A 3CT7A 1W5OA 2Q8LA 3C2VA 3FJLA 1BWKA 3PUDA 3P62A 3SGZA 5LHFA 1P4CA 3UNDA 3FYOA 4WOQA 2CWNA 1MSSA 2QR6A 2VFHA 3G18A 1H7OA 3H55A 3HJZA 1H1ZA 2H3BA 3U2OA 3PBWA 3NA8A 4FNUA 3CIWA 3YPIA 4OWGA 2Y62A 1TIMA 2TYSA 4AH7A 1OFPA 4GBUA 2OCZA 1FBAA 3GK0A 4PC8A 1NFBA 1OVDA 1KTCA 3TQVA 3W7NA 1Q6LA 2YCEA 3TSMA 2X1SA 4XZ9A 6ALDA 3WJYA 5I3IA 4QIUA 1L6SA 5CGQA 3NL3A 1IIGA 4AVFA 4GUJA 2G95A 2B7PA 1OFAA 3N73A 1X7FA 4EF8A 2A85A 1QDSA 3HF3A 4UTIA 3NYZA 2QCNA 3M16A 3NOEA 4UIOA 4GUFA 3E12A 4LUIA 2GPTA 3M43A 5HINA 3BO9A 1G4SA 1TV5A 1EP3A 2H6RA 2PRHA 5DXYA 4TO8A 3LLFA 1MO0A 4BWLA 3T40A 5D05A 3E02A 3L2IA 3L9CA 3NQGA 3TFCA 8TIMA 4RLIA 1JVNA 3G3MA 1XXXA 4UTKA 1ADOA 3HG3A 4HNTA 2X2GA 1FY6A 5G2HA 1UUOA 1KFEA 2DJLA 3W22A 1Z41A 3EKLA 4LNYA 4I7WA 3PC0A 4UTLA 4ZQRA 1JULA 1IXPA 1WXJA 3ABQA 3THQA 2Y61A 5BOOA 2W0UA 4CNPA 2FDSA 3TR2A 3P60A 3W07A 4FNSA 3SSJA 2JKPA 4NXSA 3DKJA 3LBMA 1FCQA 1XCFA 3G0XA 3PF3A 4CCEA 3BARA 3A5FA 4RZ5A 1OX5A 1T8XA 1KTNA 4LWWA 1SZEA 1TREA 2X16A 2EKCA 1HL2A 2YPIA 3RFAA 3N2MA 3W88A 1PHWA 5J5DA 1KV8A 1G67A 4LVBA 4JX6A 3C6CA 3HOJA 5KINA 3INPA 1ICSA 4LC6A 4ICNA 1WBHA 5AYXA 4K8EA 1L6WA 1QCWA 2YSWA 1QPOA 5K7JA 2GVGA 5I3KA 1EWEA 2A21A 3Q2DA 2CW6A 3TAKA 3IGXA 1BKSA 3IVUA 2YW3A 1KW1A 2FLIA 1VLIA 1M5WA 5AC8A 5DXXA 3O6YX 4HN4A 1ICQA 1SSGA 1JRBA 1VCVA 2JK2A 3SJ3A 1PL9A 5EYWA 1OYCA 3L68A 1IIHA 4AHPA 5DY2A 4UMCA 5D2YA 5FF2A 4K6AA 4XTIA 3S5ZA 1XKYA 4A2RA 3MI2A 3W76A 3SR7A 1PIIA 1V5XA 1VC4A 1N55A 3F4NA 3GR7A 1EA0A 3OHIA 3NQAA 4IGHA 2HSAA 3MP3A 5E1QA 1TJPA 2NX9A 4PH6A 3WJWA 2QCGA 5KZEA 5U4NA 1K8YA 3KVJA 4JX5A 3TQKA 2C16A 2JBMA 2O7QA 2X1UA 1OX4A 3GIYA 1JJKA 2O7SA 3W1UA 3QSRA 5CG7A 2A1YA 4DO6A 2OMAA 1J2WA 1H62A 2D73A 5K2ZA 3CB8A 1TCDA 4N4PA 2ZRXA 2E5BA 3VNDA 3EXRA 3N34A 5EMUA 1R46A 2OT0A 4JEQA 3PSVA 1DBTA 1W3IA 5K9XA 4AWTA 2XN2A 2ZZ2A 4M7SA 3LV6A 1IXNA 4AHOA 3OBKA 1EB3A 3NR0A 4AF0B 1SO3A 2CLLA 1MZHA 3UWQA 3W1PA 4W9TA 5CKSA 3FIGA 3C2EA 3NAVA 3LHVA 1TB3A 4JD4A 4WY0A 5F4XA 4EWND 3LCLA 1ZFJA 1K7FA 1ZAJA 2V5LA 1VYRA 2A6LA 4PA8A 5E93A 3LGEA 1JCMP 1ONRA 3G0UA 1AG1O 2FPTA 1YADA 3EX1A 1VYSX 4EF9A 3B03A 1TTPA 5G4WA 5IBXA 3KOFA 3M7WA 1KLZA 3SI9A 5G1TA 3I7SA 3CPRA 4Y90A 3CTLA 3UY7A 3ZS4A 3W1LA 1EX5A 1JCXA 2QCFA 3TQ0A 4IPIA 3MBDA 2Y7GA 3PWAA 1U83A 3QC3A 2P10A 4JTKA 3PS7A 2EHHA 4NJHA 2CFFA 1TMHA 3NDOA 4CCCA 1QO2A 1OHLA 2RDTA 4OQVA 1JUKA 1QAPA 2VEKA 1H51A 1TPFA 3DHDA 1QPQA 3EX3A 5F4WA 1VJIA 3O8AA 4FHAA 4E2DA 3HIJA 3MMTA 4LS0A 4JTIA 4RV8A 1OFBA 2Y63A 5LNVA 3VFLA 3A9IA 4ALDA 3QMSA 4HPJA 1LCOA 1YPFA 4MUZA 4XKYA 5SWUA 1F73A 2GJLA 1D3HA 4M5PA 3GNNA 1TRDA 2BTMA 2C3ZA 4O11A 3TJLA 3CHVA 2E09A 3G8RA 5AOUA 2ZA2A 2Z0IA 4NJKA 3S5OA 3TU9A 3IEBA 4QNWA 3EWBX 1VCFA 2EAWA 3NNTA 6TIMA 3KX6A 1FXQA 3MHFA 2ZRUA 4JTJA 3MHUA 2V2CA 3C52A 3NQDA 1W5MA 3UWWA 1V7YA 1MEWA 2YFNA 3WK1A 1L6YA 1O5KA 5F1UA 4TX9A 1N7KA 3B0VC 3A24A 2YX0A 4X3ZA 5FEPA 3TE9A 3I68A 3PULA 4DBDA 1G4PA 4NT0A 3W7DA 1H7PA 2WJZA 3EXTA 1M6JA 3M6YA 3HBLA 3S1VA 1H7RA 3P80A 1WOAA 5IM51 4NJGA 3M9YA 2QUVA 3B0UX 4GNJA 2ZRVA 3G3DA 1KV5A 3NQEA 4IX0A 4M19A 1RQEA 3W1TA 1O4UA 1SO6A 4UMBA 1GYNA 4LVGA 4DF1A 1F6KA 3LRKA 1YDNA 3P81A 5CSRA 2Y70A 5KTLA 3M44A 4DEFA 3C2RA 3PUOA 1GPWA 3G1VA 3OVPA 1FWWA 4JY9A 2LLEA 4Q33A 1H7WA 1LBFA 1OFQA 5DBUA 3G1SA 2VEPA 4CQAA 2WNNA 4BK9A 4UFHA 5BMXA 3QPZA 1I45A 1ZY9A 1SW3A 3IVTA 4WD0A 2B0MA 2H90A 3L0NA 2E68A 3W2KA 1AK5A 3O16A 4QM1A 1TQJA 1KBIA 4KFPA 4UFJA 4O19A 4GFSA 1C9DA 4YCPA 3MYOA 2ATMA 5F2MA 4AMAA 4Z0JA 2Q8ZA 4FNPA 2Y88A 2I1OA 5F4SA 2VFGA 3EX6A 1DJQA 3TUUA 4RZ4A 3GZ3A 3CU2A 3S6DA 4K36A 3STFA 3IIOA 4NZJA 1GVQA 2CZFA 5FF4A 1OFOA 3M5XA 5AHMA 5K4XA 3JS3A 3MWAA 4C1LA 2QCDA 2R94A 3M5YA 2J6XA 3ABOA 1NVMA 1T0OA 1GVFA 3F03K 4O1DA 5HWMA 4YL2A 4O0ZA 3KRUA 1LM1A 1IGSA 1Z44A 2CLIA 3QF0A 4IOTA 2ZTJA 3S0CA 2E6YA 4A21A 3W7HA 2RHGA 4BWLC 2Y85A 3MJYA 1SW7A 1I2PA 1DJNA 3LRLA 2QKFA 1H50A 3LXCA 3L5MA 1G69A 5DLCA 4BI5A 4Y8FA 4IWWA 4FX8A 1KM1A 3NM1A 5D2TA 1R47A 3W7RA 4M6QA 1OF8A 1UCWA 3LTPA 2W6RA 1TO3A 4ZQOA 3WJZA 1F74A 3W7KA 1JCJA 1WAUA 2TPSA 3G1DA 1F7BA 2WPBA 1SO4A 2B7NA 1XBYA 1PE1A 4MJZA 4Q32A 3GDTA 4FIQA 2TMDA 1X6UA 4TMCA 1DQXA 4G1KA 3U6WA 2J27A 4ADTA 5KSWA 2JGYA 2VKZG 3TSDA 1KM2A 2C19A 2ZTKA 5LHEA 3LCFA 3DI1A 1QOQA 4IXXA 3W7GA 3W7EA 1G4EA 3W73A 1GTHA 1QPRA 1VGAA 4FX6M 1FWTA 2GUUA 4DQWA 3DFSA 3TJXA 2ZRYA 4PODA 4X22A 1EIXA 2DZWA 5EBUA 4BFAA 2DZVA 4O18A 1PVNA 1Q6RA 5HUOA 3I6RA 4XBKA 4H4IA 5D2VA 4S2BA 5D33A 3W87A 1LBMA 1OFDA 3IVSA 4OT7A 4JTEA 3N3MA 1K03A 3RLVA 2CLOA 1CX9A 3G1FA 3P82A 3RU6A 1LLZA 3RK8A 1KFBA 3ELFA 1TPUA 1FWRA 2NWRA 4IUOA 1VLWA 4YLWA 1B3OA 4UC5A 3W2LA 3K30A 4N9EA 1OYAA 3LLDA 4AEOA 3LTYA 2ZRWA 5HQEA 4LVFA 4O1BA 2Z6JA 3M1ZA 3TKFA 3QW3A 4K8HA 2IQTA 3C56A 4NX5A 3NQ7A 2OZ0A 2QEZA 2XFWA 5K9DA 2WNZA 4AWUA 1GG0A 1OABA 1PCWA 2ZZ5A 2RDUA 4JTLA 3R2GA 4CNOA 3TW7A 4E2BA 1GT8A 3W72A 4FXRA 3OA3A 1HFBA 3EWXA 4EVZA 2ZQ0A 1GQNA 5I3HA 4DPPA 1AW5A 3A23A 3MUXA 3LOTA 4AHQA 3V1PA 3O6CA 1EUNA 4GC4A 4WXZA 3DFOA 4X2RA 1SZFA 4BI6A 3WJXA 1AW1A 3PBYA 4O57A 1B4KA 3W2NA 3B04A 1JUBA 2C6QA 3G1YA 4N9BA 2NWSA 1XL9A 1W0MA 4NQ1A 2WSRA 3QYQA 1YTEA 4UFKA 3G1XA 3NPWA 4O13A 1LTDA 2ISWA 2QF7A 1LRQA 4FNQA 2FB2A 5TQLA 4CQ8A 4Z1AA 4MFDA 4POCA 4O12A 5FF0A 2R91A 1HO4A 1K3UA 1LRNA
chains in the Genus database with same CATH superfamily
1IWPA 3QW4B 3NEHA 1L8NA 4JYFA 4W85A 2CLFA 4MKSA 3G22A 3GU2A 3FJ6A 4MWAC 1LP6A 2FPYA 1W3NA 1EIBA 4LV9A 3QV9A 1P1XA 1SR9A 2FYMA 1BWLA 4L4PA 3C0LA 5HR6A 5M5DA 4ES4A 3R11A 2QHAA 4MLJA 4I3GA 4NKCA 4QSFA 3H7UA 3LUTA 4JY8A 1XLGA 3FY1A 1GEQA 1HKMA 5DN1A 3CV7A 1QBBA 1JCLA 5BWAA 1M04A 4LUTA 2J13A 1EPXA 1TV4A 3CMJA 3VDBA 4ONVA 3IK4A 5AYIA 2ZXAA 3NVTA 1XV8A 5U7SA 2E77A 1U30A 1AUSL 4UTHA 4PUKA 1UH3A 1O66A 2GQ8A 5G4HC 4Z0SA 1XBZA 2VUNA 1X8FA 2JKEA 2FGZA 4Z2GA 4K3ZA 1MRAA 4ECLA 1S5NA 5FSEC 3HPZA 2QYGA 1M01A 1TMQA 2XFYA 5TF0A 1I2NA 3KP1A 1CW2A 4ASTA 3H54A 3KE0A 1X6LA 4RDVA 1A5OC 1CGXA 4KQNA 4RCXA 2OQHA 2Z4GA 3WK3A 2ZA1A 2A79A 5D9MA 5CGTA 3WG6A 4DO5A 1F2JA 4QJ5B 2Z24A 3L2LA 3VIOA 1NFGA 4MWAD 1CGTA 2Y8KA 3FNDA 5CZTA 1FQ0A 2ZZ7A 3B06A 4HNNA 2ICSA 4CQDA 1UPMB 2YGYA 3UG5A 4KIRA 2XIJA 4ZXLA 4BQ3A 3UU0A 4CQCA 4D8AA 1QT1A 4JN6A 3EYPA 3QGKC 4L65A 2CKRA 3UG4A 1KO0A 2XIOA 2ZX8A 4D6EA 4C1KA 1RBAA 3LYEA 4DJDC 3TN5A 3ANYA 1A5BA 4PSPA 3GKAA 1M65A 2WMJA 4OJYA 2WC7A 4XAPA 2ACUA 2CLMA 4RDZA 4Y96A 4IG2A 4KETA 1GJPA 1RH9A 4Q8NA 4PMJA 1QOPA 3UFYA 4R85A 3E0LA 1EGZA 4ZQCA 2FB3A 1GNXA 5JU6A 3OVRA 4KKXA 5AHEA 3ISIX 1WZAA 5GNXA 3T0AA 2J6VA 1PTGA 3OW1A 1XP3A 5CJ5A 1DWJM 1UZ4A 5A8GA 2VT0A 3H2CA 4JHOA 5AC4A 1ZP4A 4FR1A 1T6MA 1HJQA 1TPB1 3MC5A 4GY0A 2YZRA 1B5TA 3NTYA 2I56A 4PB4A 3ZLHA 2XWDA 2VP8A 3THUA 1HKKA 1SGJA 1UUMA 4UOZA 3VIHA 4ZB5A 2R6OA 1WDDA 3BG9A 1QJWA 3MCOA 1W9XA 4F0KA 1ESWA 4JFVA 1UQYA 1GHRA 3NPUA 3O0KA 1WKYA 2FPVA 1K7EA 1TUFA 3W2JA 3O6AA 1J6PA 3VIJA 5HJLA 3ZR5A 4C6NA 3ARYA 3TONA 3WBAA 1O5QA 4AD0A 3JZUA 3QKEA 4GUHA 2G97A 3NPVA 4TR9A 3SY8A 3P8JA 2PDWA 3QHNA 4DF0A 3GLCA 3CYVA 4FO4A 1QFEA 5L6UA 3PTMA 4D2JA 2PUZA 1V08A 4Q8PA 4F2BA 5CC5A 1ME8A 4Z2KA 1O60A 3P6LA 5G2IA 1W9DM 1TPC1 3MYPA 2DU2A 5H91A 1GOMA 3XINA 2J7DA 3SADA 1MW0A 1V03A 1K8XA 4KRTA 1D3CA 1QXLA 3RPDA 2V81A 5M2FX 3WD2A 2VEIA 4F9JA 1VBGA 3HA1A 4DJDD 3SEPA 2HV5A 2J9XA 3EMCA 3WFAA 4GC3A 1I9CB 2W66A 5FF7A 4RNJA 2ZZ4A 2ZC8A 4WSKA 1PIGA 3T2QA 2XVPA 3AO0A 3SFKA 4KS0A 1YBQB 3RN6A 1W5QA 2Z2BA 1P48A 4ZFCA 6CGTA 1WDRA 2HE5A 1ODZA 3BGGA 4V27A 3LHTA 2ABBA 3DHFA 3TQPA 2NV2A 3OHMB 1S3HA 1UH4A 2PSNA 1RPKA 3MW7A 3EX4A 4N7QA 4GRSA 1VFUA 4WIWA 2ZXQA 3ZLFA 2H8ZA 2PRMA 1GYLA 3B0YA 4KCUA 2Y7EA 2WC4A 2VRJA 4B3KA 3W6YA 2BY1A 1BG9A 4IQEA 1A50A 2CBIA 3M41A 1S3TC 1MYRA 4UCFA 4PBEA 3LMYA 4KWWA 1BF6A 3VTRA 1R9XA 3QMRA 1UKPA 3UZWA 3WMSA 5BNKA 4WDUA 5CC6A 2GGJA 2QS8A 2D2JA 5I3GA 1RD6A 1XRVA 2WO5A 4PMDA 5EA9A 1K77A 3LTSA 2D20A 2A3CA 5CC7A 3GFYA 2E6FA 3EWZA 2I9EA 3USZA 4C6EA 2BVWA 5DMNA 4P61A 1GTEA 4NVTA 2RFGA 3G1HA 3NO5A 3RF9A 4B5XA 2VO5A 5AC5A 4E0CA 1SFTA 2XIIA 2FVMA 4P8VA 4DXKA 2DZAA 2I5QA 1X8CA 5A8MA 4FNRA 1O95A 3WF4A 2J78A 4HCHA 4UXDA 4JR5A 4ZQMA 1BAGA 4IFKA 4Q8TA 2VZSA 4H00A 4QLKA 5HQLA 3M0YA 2DT2A 2V82A 3MDUA 1NEYA 6A3HA 1ZP3A 2OKOA 3DFQA 1A3XA 3T7VA 1OK4A 4HB7A 5KZDA 3KAOA 1FHLA 1UC4A 3CC1A 1FCUA 3IUDA 1E43A 1SJDA 3FEQA 1ZCCA 3H2OA 1U33A 1MWOA 3LCHA 1SW0A 3L4TA 2PZNA 2REQA 2G0WA 5KZMA 1OFEA 2DPEA 2WJEA 2GWNA 4N02A 3JVAA 2BGNE 4B9YA 2DSKA 1KM3A 4NZ1A 5AHFA 3FYYA 5C55A 5BOFA 1Y7VA 4JTHA 4Q8QA 2J88A 3TFXA 4DO7A 1EJXC 5FKYA 3QSTA 2G41A 7CGTA 5ABEA 4HMEA 1KRCC 4NI8A 1BGGA 1UUQA 4GUIA 4E4UA 4UQEA 4LXFA 4RNIA 4ZB2A 2C0AA 1V6WA 3W83A 1PEZA 4M6VA 4PCNA 1A5NC 3S5YA 3BLFA 2FTYA 1VZWA 1OWQA 4DBSA 3D47A 4NNAA 1EZ2A 4JQ3A 5K3VA 2HTMA 3H21A 4GPNA 4GUGA 1HVXA 2DORA 3C61A 1O5RA 4H3DA 1QHZA 2NXIA 4Z2LA 3WLQA 3MP5A 4JYEA 3B9OA 2GJXA 4UZSA 1UR0A 4Y9PA 4GY7A 3KBMA 1Q7QA 4LANA 1MQQA 4Z2JA 4HNVA 2ZZ3A 4HYWA 2ZBTA 4GYPA 1CXKA 1KRMA 3ENLA 4LF1A 1SQ7A 3M4HA 4GIAA 1PO9A 5CSYA 1VBUA 1V3KA 1A3WA 1XW8A 4KGJA 1QATA 1CXFA 4N9DA 1DXIA 1E1FA 4HU8A 4UQCA 5LXEA 1Z9AA 3W7OA 3NPXA 5HNNA 3B8VA 3H7VA 1YXCA 1WDPA 1XCWA 1W54A 3HQPA 3W1XA 2NV1A 1OADA 3E49A 1MMFA 1DJIA 1UR9A 1T40A 1AFSA 4LC8A 4QLLA 3CK5A 3OTRA 2XH4A 3GHSA 1B9BA 3C2OA 1HKWA 1DHKA 4RE4A 3WDHA 4AFYA 4XO6A 3OGRA 3OEXA 1VRXA 1AL8A 5CAKA 4RPQA 4U10A 2QJIA 2C71A 3U5YA 1RCOB 4LQ1A 2C91A 2HXTA 2XIQA 1ZQ5A 4B5UA 1I0BA 3BW4A 4UTUA 5FJPA 5G4EA 3PBGA 1D7KA 3RM9A 2E25A 2BXYA 4AG0A 1M41A 3U57A 4D8ZA 3HGOA 2OQLA 4BQ4A 2VUYA 3L5LA 5IOBA 3PZGA 1OJXA 3TXVA 1I2QA 4Q4OA 4HSHA 4TOQA 3AC0A 4RXFA 4P7NA 4QXIA 3QR0A 1UQZA 2WM0A 1E6SM 3VIKA 3GVGA 3V7PA 5A6BA 1B3YA 1HKVA 2YBUA 2QMJA 3PNUA 1F6PA 1HG3A 3DKLA 2KZHA 3GC5A 3H70A 6ENLA 3UNTA 3RAOA 1VF8A 1BQCA 3KCOA 2XH0A 3KWXA 4L4LA 3AMLA 3S5NA 3OB8A 3PB2A 3I7QA 1JXKA 2DW6A 4IGSA 4Y9NA 3R79A 4JTGA 1FA2A 2PWGA 4ZOEA 2AKZA 4QITA 1RLCL 3NQ6A 5IHSA 3CM4A 3WH8A 1S2TA 4JFSA 2PTYA 5BCAA 3GVRA 3GBEA 1DVJA 1G6CA 2BWGA 3M0ZA 3HV9A 3LDVA 1A5MC 4U2YA 4GH1A 4HPXA 3W01A 1Z8AA 2BGSA 3P93A 1J0KA 2IKIA 4WEVX 1I60A 4JBRA 3AYSA 3M0KA 1JQVA 2C14A 4XISA 7XIMA 1HT6A 2YB1A 4UTWC 3LBCA 3BCJA 3SY1A 5D2XA 2YCLA 3HFYA 4CLMA 3VC5A 4EWJA 3ZJ8A 2E5CA 2WVTA 3QVQA 1TSIA 2B31A 4NG3A 3NQ8A 3WNLA 5HNTA 2Z2UA 3DX5A 2X0YA 5D37A 4PB3A 4H9ZA 2V3DA 3ANVA 2YLLA 4HU0A 1H7XA 5E0KA 4YIWA 2X40A 3FW6A 4FXFA 3RYSA 2FZNA 2CNCA 3LPPA 1PAMA 1C9WA 3VD7A 4MAVA 4ZR8A 4FA3A 2Q3OA 4XZWA 5AN7A 4O1CA 4LCSA 3FA3A 4K8GA 3D6NA 4AXKA 1QNRA 3KDOA 2PGEA 5A6AA 1GUVA 1BYBA 2WZHA 3IJ8A 3VIMA 5C9XA 5D9NA 3LHYA 3EGJA 1H11A 1KFLA 1JDDA 4JKKA 1I6NA 5JMUA 3NL2A 4HN8A 3TK7A 3TW9A 4OOUA 4XZIA 3CUIA 4O4WA 5A6MA 3R0UA 4DYEA 3NUKA 3GDRA 3N2XA 4PTVA 3THAA 3MKCA 3CQIA 3RO6A 1IE7C 5C2GA 2XGZA 2WB5A 3Q37A 1J0YA 2PDIA 1YEYA 5HR7A 2J25A 3GWQA 1CBGA 2P53A 3CHEA 3NQBA 1AL7A 4A05A 1XDLA 2AL1A 3I65A 3F1QA 4WJ8A 4QG9A 3QC0A 2NXHA 4BEUA 3I4KA 5DCDA 4NZFA 2NXGA 2OX1A 1U2YA 3VKAA 1ZZMA 1W1IE 4Z08A 3G24A 1W56A 3T9PA 3VOHA 1VFOA 4JDBA 1TZ7A 2WQPA 4EX4A 3F4DA 4I90A 3OQEA 1UKTA 4GQ0A 2W61A 2ZUTA 3V1HA 1LQAA 4V28A 5FESA 1FWFC 2HS8A 2WJFA 1E15A 4JTUA 3T07A 3KTXA 1T8QA 1FWAC 1JUEA 2VX6A 1QUMA 2VEFA 1JDEA 2VFIA 1XIMA 4MVAA 1U1UA 4JIHA 1JFHA 1U22A 4AD4A 2PU0A 1DJZA 2E9LA 2UV8G 5CC3A 4GO9A 2PDGA 4GVGA 2WSYA 3PM6A 2BFGA 3K4AA 4Y6GA 3KTCA 4LUJA 3LCXA 3OVGA 5I07A 3UWYA 4J2MA 2QCMA 1S2WA 1IWBA 4LOCA 4JOMA 4DLMA 3WK0A 2VZVA 1I4NA 4ML4A 3WLJA 1LROA 2DZUA 2ISVA 4AU0A 3UWZA 1DHPA 3C8NA 3GVVA 2EPLX 5HULA 4ZO8A 3ZMRA 4RXGA 4JQ4A 3N14A 1H63A 4AD3A 2QCLA 3VMOA 1K6WA 2Z7KA 1WBJA 2QJHA 3O3RA 3FV9A 5AZ1A 4DZAA 1DWIM 2O56A 2C18A 3TNBA 1TJRA 1MNZA 1E4NA 2E1WA 3P7YA 4N0RA 5KZ6A 4ML9A 3CL7A 3BAXA 3Q45A 2Y24A 1A4LA 2YCIX 2V5BA 4DJED 1RV8A 4XSLA 4MLRA 1GG1A 5CPQA 2HPMA 4H19A 3U8GA 1RSCA 4GE8A 4JDYA 3E1F1 3T08A 1IT8A 2JKAA 3GXTA 1W1B1 3WO8A 1V3MA 3MBFA 1O94A 2PWUA 1QI4A 4AY8A 1D8WA 1FDYA 2FDMA 2VI0A 2WWDA 3SB0A 3W7LA 1KFCA 3FCPA 1NDVA 5HOSA 3G6LA 3P62A 3SGZA 5LHFA 2A3EA 1Q8JA 1P4CA 3FYOA 1ADDA 1X6NA 4LYRA 2E67A 2NQHA 5D9OA 4WJXA 4P5UA 3G18A 1MQRA 4DBUA 3N4FA 1CYGA 1RVKA 3HJZA 3WEOA 2H3BA 3IJLA 3NA8A 1EPVA 4FNUA 1FRBA 4OWGA 2P5NA 2X42A 3V5FA 1JPIA 1E40A 2OCZA 3GBDA 3GK0A 2UY5A 4H9YA 1TR9A 2VGBA 1KTCA 3EOSA 3GS6A 3SSZA 3KOYA 4WK9A 2YCEA 3TSMA 3WLOA 4XZ9A 5BXSA 4QIUA 1V3HA 5CGQA 3NL3A 1IIGA 4IMAA 2QDDA 4E4PA 4AMCA 2VURA 2CEQA 3QBUA 3WDIA 3G6MA 3L4ZA 2WWCA 3M16A 3CNYA 4BQ2A 4LUIA 4AZ6A 4W7UA 4PBFA 2W5FA 3T8LA 1YDYA 2J79A 3FDGA 3W82A 3TYCA 1SMDA 2H6RA 5XIMA 1DXEA 1XYMA 4TO8A 3DC0A 3W25A 3GW0A 1K4GA 1GW9A 4CEXC 3BZJA 4RLIA 3VABA 4DM1A 1ADOA 4J3TA 3BJSA 2X2GA 4LFYA 5G2HA 3A64A 4Y9OA 1UUOA 1KFEA 1UD5A 2DJLA 2GJPA 1ZJBA 1IXPA 2BBFA 3GYCA 3AIWA 4G2DA 2ZIDA 3AYTA 1EZWA 5BOOA 2XTKA 1J9YA 4MUPA 1B3VA 3TR2A 3MKKA 3P60A 3SSJA 4JFTA 2IKGA 3G0XA 3UPMA 3TR9A 2WMGA 4RZ5A 1OX5A 3PZIA 3CHDA 4FAMA 1TV2A 2WNWA 1HNYA 3VD5A 3N2MA 3W88A 1XLMA 4PMUA 1JAEA 4DUWA 1TUXA 4LC6A 1LWIA 1WBHA 4K8EA 3GC2A 1ITCA 3WQCA 2YSWA 1RAKA 1HIZA 5K7JA 3KZSA 2PDPA 1YPXA 2GVGA 4TX6A 5I3KA 3ZYZA 4BQ5A 1EWEA 4QG8A 1JAKA 3OLEA 3VA8A 3OLGA 2FLIA 3UJSA 3CZKA 3NGFA 2JQXA 3O6YX 3T05A 1AJ2A 1M7XA 5BRPA 1W1A1 5EYWA 4B5TA 4O1FA 3BTNA 4D6FA 1E0WA 5D2YA 4AW7A 4XTIA 1XKYA 3DG7A 3MI2A 4ATLA 1PIIA 3PAOA 1V5XA 3EDKA 4IL0A 2J7BA 2OOFA 4U2ZA 3NQAA 3B9AA 3GH7A 1YNYA 1V0MA 1WE5A 2PBOA 3WJWA 1EX1A 5U4NA 5A8PA 4G1NA 1O7AA 4ZTYA 4JN8A 2O7SA 3W1UA 3QSRA 4DO6A 3QGVA 3CZEA 3OBEA 3FDKA 5K2ZA 3B9EA 3CB8A 3W6MA 4X61A 1IEVA 4HMNA 3GG0A 3TCSA 3AXKA 3MUY1 1A5KC 5I24A 5AVNA 4M56A 2OSYA 2R1LA 3OBKA 1WDSA 3AUJA 2FMOA 4GZJA 2CLLA 3W1PA 5CKSA 3UA3A 3FIGA 2XIMA 3NAVA 2QDEA 4BJHA 5F4XA 4YVXA 1ZFJA 4V33A 2A6LA 3LNMA 4JKMA 1SFSA 2FPTA 1YADA 1RCQA 5JH2A 3WUFA 1DJXA 3EOEA 1G5AA 3U7BA 3PJTA 4L9ZA 3UY7A 3W1LA 1PX8A 4UQ9A 2BHYA 1Q2RA 5A3HA 4IP7A 2DUXA 3PJUA 1IV8A 2CFFA 1UR2A 3NDOA 2YDQA 2BY3A 2G3IA 4QDMA 3GTIA 4GQRA 3RPTA 3E3HA 4H7VA 3HIJA 3MCMA 4XAYA 4GKTA 4YHEA 3VGGA 4LS0A 3KL0A 2V5KA 3UZYA 1OEPA 4ALDA 4HYRA 4H41A 1LCOA 1YPFA 1F73A 1W32A 5JBFA 2XVLA 2XHYA 3U4FA 2BTMA 2C3ZA 3OIHA 2X09A 2E09A 4FR6A 1IR2A 5AOUA 2ZA2A 5HDRA 3ZQ9A 2X8RA 4LGXA 1FH9A 3O2LA 1VCFA 5REQB 1S2VA 1FXQA 3MHUA 1XSIA 1C8XA 3N12A 3N3TA 2WLYA 1V7YA 2YFNA 3GNRA 3C5QA 4JN7A 3IWPA 1WXYA 1H2JA 3B0VC 2YX0A 5FEPA 4S23A 4HZ6A 1R3QA 1BVWA 5E09A 4IPPA 2YB4A 2W92A 4F0LA 1EQPA 3LK6A 1DIDA 4NJGA 1AJ0A 3M9YA 3U5UA 4MM1A 1ZU8A 4C1NB 1SO6A 1YDNA 3P81A 2Y70A 3LY0A 5KTLA 3RX4A 4NF7A 3OVPA 2NSOA 1MUWA 1LBFA 3RJYA 4IPLA 5DBUA 3G1SA 1UWUA 4A3RA 4GGBA 2OWCA 4B4FA 2GK1B 1ZY9A 3CH0A 4WD0A 3QTGA 2WHLA 1AQFA 1PKMA 1HJWA 2DH2A 4GCAA 1TQJA 2WM1A 4JTAA 4O19A 4PBGA 5HQMA 5F2MA 2BG5A 2Q8ZA 5F4SA 2VFGA 3EX6A 3TUUA 3QZAA 2CHNA 1IQ8A 2G4JA 1IWAA 3MUIA 3VVGA 1WB0A 3IARA 3RR1A 4C6FA 5A8OA 5C71A 2AKMA 2J6XA 2BOEX 1B31A 1J0ZA 1T0OA 4YJ5A 4KEMA 2XVGA 1GVFA 3MVTA 2D1ZA 4KRZA 4PMQA 3U0HA 1IGSA 4YS1A 4DN1A 4UB9A 3SUUA 1FWBC 3QF0A 2ZTJA 2OO0A 4A3HA 4A21A 2I17A 4BWLC 2I5IA 1SW7A 1I2PA 3L5MA 1G69A 1EGVA 4IWWA 3NM1A 1UD8A 1OF8A 1UCWA 2W6RA 3BZGA 3WJZA 3VZXA 1S5MA 3G1DA 3ZO9A 3IPWA 1DJWA 3GUGA 1Q6EA 2ZICA 1XBYA 1XGDA 3GDTA 3AS0A 9XIMA 3HM7A 4UTFA 2J27A 4R88A 3KWSA 2PPGA 4HA1A 2VKZG 2ZTKA 1XQLA 1TV3A 2WW5A 4JTQA 1MFUA 2O55A 3W7EA 3W73A 1GTHA 1IEQA 1SM9A 2ZVRA 4WGHA 1VGAA 1E9LA 1CXHA 2GUUA 2DW7A 1E9ZB 3TJXA 2PF8A 2NQ5A 4C60A 1EIXA 3NO1A 5EBUA 4TV6A 3II1A 3CH9A 4OTKA 5A2CA 1PVNA 5HUOA 1H3GA 3I6RA 2VVSA 3H12A 5EMYA 4FOKA 1OD8A 4LAOA 2QPUA 4JTEA 2WSKA 5CJMA 2CLOA 1MQPA 3AWOA 1UZDA 2HISA 1RLDA 1TPUA 1FWRA 3A6OA 2NQ9A 1A0DA 4O8AA 3PK7A 1O1HA 5BRQA 2PC8A 1MFVA 4US6A 1E6ZA 3M1ZA 3IJIA 4K8HA 1OIFA 4P7RA 1CWYA 3C56A 5K9DA 1OABA 1KCLA 1PCWA 3U3HA 1R3YA 4CNOA 5DEZA 3TW7A 4E2BA 1GT8A 3AU2A 4FXRA 4GIYA 1HFBA 5A2AA 4EVZA 2J62A 4IIBA 3CUXA 2DY3A 4H2HA 4GFIA 4DPPA 3MUXA 3LOTA 4AEEA 4U3CA 3O6CA 4MNMA 1MXGA 1SZFA 3DIPA 1QI2A 3PBYA 3OG2A 5HJXA 2WBGA 3W26A 3EB3A 1PZ0A 3IJ6A 4HU3A 3WYZA 3FVDA 4RW5A 4G5DA 4JPGA 3F4VA 2ACQA 1W0MA 3IJDA 4NQ1A 2WSRA 3QYQA 2YDRA 3EOUA 4O13A 2Z00A 2GSJA 5HAOA 3GUWA 4LX4A 1W3KA 3CZLA 2VC7A 1LRQA 5TQLA 2FB2A 4CQ8A 2PDMA 4Z1AA 3QYSA 1G0CA 4RZBA 4NP7A 2XH2A 1GHSA 1V7AA 2R91A 3D3AA 4PULA 1ZJAA 3WF1A 2MUCA 1ZB5A 5FAJA 3M5VA 4LUSB 1BYAA 4YVPA 1JDCA 2RKXA 3QLLA 1HF6A 3W7MA 4EXBA 1H09A 1XKJA 1XSKA 1LBLA 4FNTA 4DIAA 5IBXC 2FGBA 3C0JA 4HHMA 3C2YA 1ZAHA 4WOZA 8CGTA 4N6FA 5F2GA 4LNCA 2IQ0A 3W7PA 2VJXA 3C0QA 2NLYA 4C7FA 3HGSA 4JL2A 3UPWA 1FHUA 4MAZA 4DYJA 1E1EA 1JYWA 3URNA 1PTDA 4HMDA 2V5JA 2BVTA 2GLKA 2FQIA 4O17A 4LW7A 4F0MA 3EWUA 3M6DA 3RMJA 3OG3A 2OG9A 3HN3A 1FWSA 1FUYA 1Q65A 3S1UA 3B8SA 3B97A 1GZ1A 2A6NA 3NQCA 3B4YA 4NZ4A 4LVAA 1M53A 3NZQA 2PDUA 1UJQA 1XGEA 1QOXA 3I7RA 3G1RA 4QE1A 1PZ1A 2GVLA 1TWSA 4JFWA 3CJPA 4YTQA 2V2HA 1EF2A 3G0SA 4MNKA 2PD9A 1I0DA 3BXWA 3GZAA 2J47A 3S9YA 1VIZA 5JUVA 3LXAA 1ZUAX 2YR1A 4X60A 3ARRA 1CT5A 5D32A 5A5WA 3TMQA 3TAOA 3CUZA 1HTIA 5MF5A 4CCDA 1XYCA 2GUBA 1YDOA 2FFIA 2JALA 4S2CA 3DFTA 4ICMA 2VGFA 5TNVA 3TTYA 3OP2A 1NAL1 1MUMA 1XISA 3K5XA 5IDIA 4F2UA 1T5AA 1CDGA 3WFLA 3V75A 3MP4A 4LPCA 1UD2A 2WCGA 1ZL1A 4ZA0A 2VC6A 3LLXA 2Y7DA 2GL5A 3LX9A 3QV7A 1US3A 3R5EA 3HG5A 1TTJA 4TIMA 2DZXA 1TV8A 3BUVA 2BX7A 1Q45A 2AQWA 2AGTA 3AU6A 3QLDA 4FF7A 2YOCA 5BRBA 3V36A 4U5KA 1GONA 3P3BA 2ZKMX 1UPPA 3QXBA 5I23A 4G9PA 2OX4A 2X0SA 1K02A 1UYQA 5HXMA 1Q2SA 2OT1A 3BAJA 3S4TA 1XYFA 3W1RA 3SCQA 3ARQA 1VENA 3KVKA 1W1PA 2ACRA 4D6CA 2Y1HA 3SY5A 1HUVA 3TA9A 4RW3A 4PSRA 3KOZA 5I3JA 3AZTA 5FI8A 3COTA 1UROA 3H53A 4U28A 2DIEA 3LN3A 1Q6CA 4HTBA 1VIWA 5LA0A 1OGGA 4F40A 3W1MA 4MZYA 2PC4A 2RGMA 2EXOA 2QPSA 3NVDA 2BNJA 4WRHA 2VEMA 3MMUA 3L4XA 2C13A 1S1PA 4F4RA 3ITTA 4IJCA 4P8UA 1GVEA 4F79A 2Y8VA 1TWIA 2O4MA 3CWOX 4DBEA 1FWDC 3W1NA 3OIXA 5LXXA 3BLIA 4RZ6A 4WCJA 2Z1VA 2WKJA 2JEQA 3N25A 2YL6A 3SRDA 4IPJA 3MDWA 3QRHA 1DPMA 4A29A 3QV8A 3VDGA 1ITUA 3ES8A 1UHVA 5A69A 3H2AA 3AIEA 3NDZA 1DKWA 3DYPA 4FI4A 3C4UA 3HGRA 5C5YA 3U48A 4IICA 2PDNA 3FYPA 4I8YA 1A53A 2PURA 5M1TA 1GKQA 2OEJA 2NVCA 1KR0A 3H2EA 3KLLA 3CWNA 5K9CA 1JCNA 4H9MA 2WQDA 4QX4A 4O8RA 1E0UA 5EL1A 4K7VA 1AQHA 4AAJA 1C7SA 3QFEA 5GJMA 2R82A 3R89A 4RNHA 4QSHA 3AZSA 3CQJA 3ZSTA 3N18A 3ZZ1A 1P0BA 1LL6A 4PRWA 3LHWA 3NJ3A 2DGAA 1GOXA 2P1FA 4I6VA 4GJ1A 2VWSA 1CI1A 3LCIA 2AMGA 4UBPC 1C91A 3H2MA 3TN3A 1NWTA 3CQ0A 2VD9A 3CAKA 1ONXA 1W5PA 1UC5A 5FCZA 3OZOA 3QV6A 5A6JA 4O0KA 1LUCA 2WMHA 4FIRA 4B16A 4KPLA 3NQ2A 2G3JA 3DENA 3O63A 2WVVB 2VX5A 4UTWA 2FVLA 2OJPA 2XM1A 3UYCA 1LWJA 5EFFA 1EOMA 4F48A 1V3JA 5AB3A 1TWZA 2QW5A 3GXNA 1XUUA 5CPNA 1IXQA 4FP1A 2OLSA 2BOFX 4ORIA 2PWFA 3GB6A 5EGRA 4JICA 4H9XA 3DYOA 3UYIA 4EXQA 3NDYA 4D6HA 4ZVJA 3S2MA 3V16A 5LGXA 1V6TA 3WD0A 2E7FA 3T2PA 1UR1A 2JF7A 4JTSA 3DEQA 2DSZA 2Q8XA 1HP4A 3W9ZA 5CSSA 4CD8A 2CIPA 4N4QA 5C8BB 1X1OA 3H6OA 3KUMA 2F84A 1WDWA 3R94A 2OU4A 4R53A 3BLEA 4PMRA 3WUBA 4GVFA 1LOLA 2QMKA 1DV7A 2QDGA 3ONBA 1D7FA 2FHCA 4S3GA 4OZOA 3B0XA 3BQ5A 4G6CA 4REQB 4H7CA 4HA4A 2ZFAA 3TW6A 3O15A 3WY1A 8XIMA 2YCKX 1XH2A 2RGLA 5E0FA 3EB2A 1VEOA 3MU7A 1GJUA 1VHNA 5GJPA 5DO8A 3RO8A 1ISYA 1H7NA 1KM6A 1QO5A 1S1RA 2AL2B 3FOKA 1EYWA 4UFMA 4FOUA 4X0NA 3FS2A 3RCMA 1W1VA 1SU5A 3FVMA 2OLAA 4H8NA 3WCZA 4OV9A 1IEXA 3BCDA 3WQOA 4D72A 3QJAA 3NQVA 4EIVA 5LIWX 2Z1BA 3WF3A 3SUTA 2B4GA 1KLYA 1MXSA 2D23A 2XUCA 3P14A 4BCEA 2HS6A 2X41A 5HMEA 1W3JA 3DHUA 3PZ9A 1RQBA 1F8IA 1JD7A 9RUBA 5C54A 1A5LC 3KFTA 1OSEA 2PDBA 2Z26A 2EO7A 3S47A 3I3EA 4X9YA 4S1FA 2W63A 1TCMA 3VE7A 1L9WA 4A8NA 5HMSA 1M9HA 3IACA 1WAWA 3CL6A 3DAQA 4N6EA 2DFAA 3TV8A 1PKLA 2IPWA 1CNVA 3N9RA 4N9CA 1O5XA 1RVGA 3ID7A 2J7EA 5B7ZA 3R8HA 2FGLA 2DVTA 4YXGA 4IIHA 3ORWA 1J5TA 1K9DA 4XQ6A 3ITCA 5H8UA 3KXQA 3UBPC 2C1HA 5CPLA 2J8TA 3RCNA 5J5RA 3W0KA 1KXVA 2P8BA 3PVFA 3UXAA 4H6RA 5DBTA 1NDWA 2AGKA 1E73M 3G1AA 1UWSA 4A22A 3T81A 2DJXA 1LT7A 4XKYB 5DCEA 3UVIA 4C1NA 3L67A 3HQOA 1PTAA 4DHGA 2F7FA 2QIWA 4OHQA 4UNIA 5L9FA 2Q01A 2YW4A 1A3HA 1SZGA 1CGYA 4HT3A 5I09A 4JNZA 1JZ6A 3N29A 4CD7A 3FEMA 4LYKA 2VX4A 2EGZA 2VOTA 4LALA 4WGXA 1GJWA 1IYXA 3TSBA 1X1ZA 1XLDA 4J5NA 1IXOA 2PP0A 2DIKA 1FCVA 4HSNA 5FEXA 3WLIA 3CQHA 3LRMA 4ICCX 4C6MA 3P61A 5BXRA 2DZSA 2XDFA 2BP1A 4H04A 1RZMA 2ZZ6A 1RUSA 1A47A 3W28A 3HV8A 4RE3A 3L66A 2BSLA 1BHGA 4EOUA 4CN4A 4AVOA 3CMGA 4W86A 2YL8A 4B4HA 4XVDA 2RDWA 2WNQA 2GVEA 4LJ3A 5C6MA 1M03A 1HO1A 1OB0A 4CVWA 1P0DA 3SCRA 5CH9A 2Y4SA 3MI3A 3NZPA 3AXHA 3JUGA 3SCNA 3EEZA 3LSBA 1DIKA 4HNLA 3RRAA 1A5CA 3LPOA 4IMDA 3BMXA 3BOXA 2PTDA 4JHZA 3TC3A 1VPYA 3A21A 2P76A 2Q71A 2X1TA 3FAWA 4R5EA 4R7OA 4FSAA 5C9RA 4QP0A 3VUSA 4IF2A 4D6DA 3MANA 4ADUA 3ZR6A 4IZGA 3PG9A 4RKAA 3ZVIA 3P74A 1I8JA 3VKKA 5EU9A 4UQBA 3W24A 3LENA 4M6PA 5EPDA 3L5AA 1A49A 3B0PA 1F05A 2F61A 3OODA 4O28A 4AX7A 1VQTA 1PB0A 3E2RA 2YZ5A 2PDQA 1VB9A 1E4MM 2WPGA 1EC9A 1AW2A 1QI3A 2OGJA 4J9JA 2ZXBA 2Z1KA 2INZA 3V18A 3VKJA 2EBNA 2E6DA 1H1YA 2D3NA 3DOPA 1GOQA 3AOFA 1RXOB 5FJOA 5JVLA 1ZCOA 4S3KA 4MY9A 4AYGA 1EP2A 1GKPA 3N6QA 1MW3A 1GVSA 2G96A 3T4WA 1T7LA 4OBRA 3UCCA 2XN0A 2VZOA 1VEMA 2XWEA 1VBRA 1GOKA 4IMGA 1V0KA 1DTNA 4CU8A 2FTPA 4IMFA 1W9BM 1F3EA 3QH2A 1YXYA 3ARTA 3TXZA 2E28A 4OUEA 1VBJA 2VENA 3THDA 5C9ZA 3EKGA 4ROQA 3PUGA 3T4CA 2FZ9A 2BVDA 3F5JA 1UMYA 4I5RA 3ZVHA 3NSXA 3GX9A 3NFUA 3W71A 4W88A 3LV5A 3XIMA 4GJIA 2YIHA 4KFOA 5KMYA 4IFRA 1PV8A 2WV8A 2RAGA 4H1ZA 5E0CA 1TFVA 2I16A 3BW3A 4JXCA 1V4YA 3SUSA 3PWIA 2DV0A 5E70A 4I7VA 2E8ZA 1KQYA 4FALA 1GKRA 1DJGA 3OGSA 3UWVA 3AMCA 2WVUA 4QEHA 2Y0FA 2DQWA 3IJ7A 1CGWA 1K70A 1JDAA 3SCPA 2TAAA 1LRTA 3NM3A 2QAFA 4UNKA 3P84A 1XH0A 4Q4SA 1K9TA 1POJA 3UZ5A 3TYZA 1TPVA 1XINA 1TE1A 2ZWZA 1BYCA 2WAGA 4LU0A 1EJWC 2HXUA 2VL4A 4QJ1A 2OWWA 3DECA 3CIVA 2INFA 3WNKA 1AH0A 4LUSA 4BZYA 5IHRA 1PYFA 4US5A 3DERA 3PUEA 3L21A 2GFTA 3KS5A 4YTRA 3W2MA 3KS6A 4E5TA 1D2KA 2XZ9A 3OLDA 4Z2IA 1YRRA 3IGSA 3M47A 4ZOBA 1VD6A 1XIDA 1HX0A 3Q94A 5AC6A 2KAUC 1HXJA 2V68A 3VX0A 4D9PA 1G4TA 2E1DA 2XISA 4NX0A 4LCQA 1A80A 4ERGA 5GNYA 3VPLA 3EZ4A 3RM4A 3G77A 3IJ9A 2QULA 1DYSA 1VPXA 3EDFA 3B9NA 3R12A 3T8QA 5MHBA 3ES7A 4QG6A 4UMAA 3UQNA 5A94A 4R27A 4JIPA 2QV4A 4X2PA 3VGHA 1ZLPA 4H8VA 2C0HA 2GSHA 1VRDA 4LEQA 4ZTXA 1VH7A 3TJ4A 2VCCA 4MIMA 2IQDA 2YFOA 1TYGA 4GI4A 1MZRA 4BF7A 3LXBA 1QWGA 3AMGA 4AZCB 4D1IA 7ODCA 2DZTA 3EMZA 3VK5A 3VCCA 2PP3A 2QUUA 4YTSA 2ADAA 3VD3A 3AS1A 1B4EA 2EPNA 1SFJA 1PDYA 1OY0A 3SW6A 4HZMA 4H6EA 3PN8A 3STCA 1PS9A 4K68A 3TIMA 4PL1A 5JH1A 2XH7A 3BL3A 4Z1DA 1ZBKA 4J28A 1JGMA 4JQ1A 3JR2A 1DOSA 2D2OA 1AA1B 3QN3A 4RE0A 4F9DA 3EPMA 1NWUA 4PUNA 4CGTA 4W84A 4HHHA 4IX2A 3BVJA 3UVAA 4CQBA 1R85A 2Y6ZA 4O54A 3ZFHA 3N2TA 3WMLA 5FL0A 4MJ4A 1EF3A 2PRLA 2Y7FA 6REQB 1KTBA 1DP0A 3RHGA 1MRQA 1Z42A 4Q3MA 3WMCA 4J40A 3CV2A 1H5YA 3Q58A 5CBBA 2VQUA 5CJNA 5CZJA 1YNPA 3CEUA 1EXPA 3UEQA 2Q02A 1UZHA 5T26A 4OKDA 2YL9A 3DC8A 4AXNA 1NTHA 5BU9A 4DBWA 1DXFA 3PTKA 2F2KA 4B9ZA 2J7CA 4WX2A 1UBSA 4LBRA 1ECQA 2X30A 3TWBA 3KRSA 1W5OA 3MY9A 2Q8LA 3C2VA 2OVLA 5LIYX 3K46A 2CITA 2YJQA 1Y5WA 2QVHA 3V3WA 3JU2A 3S1GA 2CBJA 2QZRA 3CV6A 3WD3A 3OZYA 2TODA 1JYXA 4S38A 3WH5A 2R1KA 3N9KA 3YPIA 1TIMA 4DWSC 4AH7A 3CTTA 3KCLA 4GBUA 3W29A 1PWLA 4LH8A 2C8NA 4TVDA 4KEUA 1NFBA 4XAFA 2X1SA 3WJYA 1F3TA 5I3IA 1L6SA 4AVFA 5KETA 1BKHA 4H8HA 4V2XA 4GUJA 4GNVA 3BMVA 4UWMA 2G95A 1LQ0A 2B7PA 4WKAA 1OFAA 1OCNA 1QVBA 1X7FA 4I9TA 4WDWA 2I5GA 4M51A 4EPDC 3K8KA 3E12A 2GPTA 5HINA 3V35A 3P2VA 5A1AA 1EJVC 3LNPA 1UOZA 1REQB 3LLFA 2VQTA 1N8WA 4BWLA 1RA0A 3WQWA 3L9CA 3NQGA 3I3BA 1WPCA 8TIMA 4ZEPA 1JVNA 2ONEA 3SCWA 3G3MA 4UTKA 1JGIA 1HN1A 2XVNA 3VIIA 4JTCA 2C79A 5DRIA 3EKLA 3PC0A 4JCMA 4UTLA 1S39A 4GLEA 1JULA 3ABQA 4OECA 2ZX6A 1RBOB 1P43A 2W0UA 4KF1A 4CNPA 2FDSA 2NT0A 3AHXA 3W07A 2WVVA 4I9MA 2JKPA 1XIBA 4CN6A 1UP3A 4N42A 1FCQA 1XCFA 2YLAA 4F0HA 4CCEA 5I78A 3WLPA 3A5FA 5HPCA 1PKNA 2X16A 1TREA 2EKCA 1X98A 1R6WA 2GYIA 5J5DA 2XFRA 4LVBA 4H7ZA 3C6CA 3OA5A 2VDHA 4ICNA 4G7FA 3CMFA 1QPOA 2UBPC 3RJXA 1B90A 4X0VA 4DWSD 4HNCA 4L6DA 3S6TA 4F8XA 3Q2DA 3B8WA 3TAKA 3IK2A 2YW3A 1KW1A 1VLIA 2EJAA 4YYCA 5FJTA 5DXXA 5HJYA 2G37A 5HK4A 2AOSA 1CXLA 4S3FA 1OYCA 4REQA 3BAWA 3GXDA 3DDMA 1E6NA 4AHPA 3KHDA 4UMCA 5FF2A 4H9UA 4H01A 3OU8A 2E4TA 1EOKA 1VC4A 4GX8A 4MF4A 1XYZA 3OHIA 1UKQA 2HSAA 5E1QA 3VOJA 3OLIA 4M1RA 2AL2A 1JD9A 2VEGA 4PH6A 2JIWA 2QCGA 5KZEA 5JBEA 4XAGA 1JF6A 4XD4A 5EBAA 5CG7A 1G9HA 2OMAA 1JXJA 5JIPA 4N4PA 4AC7C 1XG3A 1E6RA 2IPFA 2XYLA 3AS3A 2ZRXA 2QUNA 2VDIA 3VNDA 3RMEA 3N34A 2XINA 1TVNA 1EA9C 3FXGA 1KCKA 1W3IA 3W4RA 2ACSA 5K9XA 2ZZ2A 1IXNA 4AHOA 3NR0A 4AF0B 1SO3A 3UWQA 1G1YA 2XJ7A 3HPAA 4Q7NA 4EWND 1K7FA 1UG6A 4PR4A 3PJXA 2V5LA 4PA8A 3LGEA 2Q6ZA 4NILA 4AZ7A 1NDZA 4EF9A 4HJFA 3WDJA 1XLFA 3AHTA 5IBXA 3BH4A 3I7SA 5DF0A 2YKKA 3CPRA 4LAMA 3CTLA 3ZS4A 1EDTA 5GNZA 3ZM8A 4IPIA 3MBDA 2Y7GA 4JIEA 1BQGA 1E6XM 1OT2A 3PZVA 4NJHA 4GXWA 1R0MA 4W8AA 4OQVA 2RDTA 1VJIA 4E2DA 6XIAA 3B9DA 1MNSA 2J8GA 4JTIA 4RV8A 1C90A 2Y63A 4I9JA 1EEXA 3VFLA 3ABZA 2VMFA 2POTA 3WUEA 3UXKA 3SUVA 3LQLA 4HPJA 4MUZA 4XKYA 5SWUA 4DUVA 3GNNA 2GDUA 2W3ZA 3NSNA 1EHNA 3TU9A 1W3HA 2WMKA 4WR3A 2EAWA 3NNTA 3AIBA 2ZRUA 4E4FA 1AH4A 2V2CA 3MO4A 3UWWA 5I79A 1L6YA 5F1UA 4S3EA 2VGGA 2XPKA 4ZE5A 4JNYA 2PDLA 3TE9A 1WDQA 3W7DA 1H7PA 4W7WA 1KXTA 1JNEA 1H7RA 4WKFA 3W6LA 5IM51 2HK0A 3NQEA 3U2EA 1RQEA 3W1TA 4UMBA 1GYNA 2PI6A 4LVGA 3WQGA 3MSYA 2DUAA 3PUOA 1GPWA 3QQWA 4DUOA 4JY9A 2LLEA 4Q33A 1H7WA 2BDQA 1Y65A 1V6YA 2E8YA 1ISVA 2VEPA 4CQAA 2V67A 2WNNA 3VC6A 4UFHA 3FA4A 4J3SA 2VM8A 3ARXA 5I00A 3CWHA 3PZMA 2XGIA 3QPZA 3BLDA 1RBLA 3GIPA 1SW3A 1BYDA 3GNOA 2QT3A 2B0MA 1TVPA 4A8IA 3BSHA 1VFFA 3BJFA 4ZFMA 1XC6A 4P8XA 1KBIA 1C93A 4KFPA 1IZKA 4KERA 1EH9A 4H9VA 1P7TB 4GFSA 1EDGA 4I8DA 1C9DA 4YCPA 3A4XA 4HPNA 4AMAA 3O9NA 1J5SA 4S3AA 7TAAA 1AMYA 4FNPA 2Y88A 5CCZA 4HZ8A 1DJQA 1HJUA 2ZUMA 3GZ3A 3SCUA 3CU2A 2DZBA 4K36A 3STFA 1GVQA 4Q4QA 1N8IA 2CBVA 4K1GA 1UWRA 5K4XA 3MWAA 3TTQA 1V02E 4LUTB 2R94A 3I4EA 4C1LA 4ZE4A 2D69A 3ABOA 5I03A 3F2BA 1R8LA 3U9IA 4O1DA 4GZIA 1P6WA 4O0ZA 1LM1A 5DRCA 1Z44A 2CLIA 1KCXA 4IOTA 4OVXA 2E6YA 3W7HA 2PLJA 2Y85A 3MJYA 3N13A 4PB5A 5AY7A 2P50A 2QKFA 1UR3M 3K4WA 1PDZA 3EMQA 4BI5A 3N2CA 3DESA 3WN6A 3TYBA 5D2TA 3OQ8A 4LAUA 4M0XA 4R9XA 4ZODA 5DMMA 4C6CA 3UXIA 3W7KA 1JCJA 1YNQA 1WAUA 1F7BA 2W9MA 1SO4A 4C6LA 4C6BA 4TVCA 4DWSB 1PE1A 4Q32A 1J0IA 1BD0A 2FHBA 3SQLA 3UXLA 3VZZA 4TMCA 2ZUNA 2JGYA 3LCFA 1QOQA 2F2HA 4IXXA 2ON3A 1G4EA 2I9UA 3GY1A 5XIAA 1QPRA 3OJGA 4L6HA 4J27A 4DQWA 3R10A 4X22A 4PMOA 3W00A 3BQ6A 4W87A 5M17A 3LG3A 3TTOA 4XBKA 3PANA 5D2VA 1R3SA 2D24A 4S2BA 4IGMA 1IT0A 1LBMA 4RNFA 1OFDA 5BROA 4PZVA 3RLVA 4HCDA 1F3WA 3P82A 7REQB 3ZJ7A 1LLZA 3SCTA 1UA7A 3F2DA 2ODOA 3ELFA 3LPFA 3WBWA 5BU6A 4IUOA 1J10A 1VLWA 4GZ7A 4U5IA 4YLWA 4MADA 2P3ZA 3W2LA 4M8UA 4I5XA 3LLDA 3SBFA 2JIEA 4LVFA 1LT8A 1G01A 4C6OA 3QW3A 4DB7A 2QEZA 4Y2WA 1WZKA 1GG0A 4P7QA 4H83A 3VNIA 1TJ2A 3W72A 3OA3A 2ZQ0A 3FXYA 1FWGC 1AW5A 3AHZA 3R0DA 3VNLA 4GOAA 3V1PA 4PTMA 3QY6A 5A6KA 1EUNA 1AVAA 2BV9A 4GC4A 4WXZA 3RIKA 3DFOA 3GD6A 3WJXA 3UG3A 2EPOA 4QRNA 5T91A 3GO2A 4DZHA 2OEMA 2J66A 2VX7A 3T2OA 3WD1A 3G1YA 3TN4A 5EFDA 2NWSA 4M81A 1YTEA 2QUMA 1YX1A 2D2GA 1NDYA 1UP2A 1LTDA 2ISWA 2PDJA 2QF7A 1UD4A 1WKEA 1W17A 3ITYA 4MFDA 5FF0A 4MB5A 3H24A 1E55A 3K4DA 4J2PA 3VOFA 2PDCA 4XD3A 4W89A 1Z7AA 4K1WA 4A4AA 2X0HA 2I57A 2WZEA 1ICPA 1F07A 1YMYA 4I9AA 3RLHA 2BB0A 1S38A 4AIEA 2VR2A 2FHFA 1PSCA 3TNOA 1QHPA 4ADSA 1UB3A 2CZDA 4UUIA 3E0VA 2YA2A 2RUSA 4DZIA 4QS6A 4FXJA 1KGUA 5AKQA 1DTUA 4PUEA 3SCSA 4AZCA 4QAWA 5E5CA 1YXDA 3R13A 1T99A 4YWSA 3GU9A 4XUYA 1R3VA 1C3FA 2WMIB 5HPOA 2EG8A 5A8NA 2CZ5A 1XRSA 3BAKA 1LG1A 3LB0A 2IS7A 3PY2A 4CQ9A 1FP8A 2GJNA 3VIFA 4L1XA 3P0XA 3AALA 3CHCA 3IUHA 4MB1A 3FHQA 4HP5A 3QFWA 4W8BA 3TWAA 3BW2A 3RDKA 3BANA 4E8CA 1PBGA 5E9AA 1KKRA 2PAJA 4HPHA 1E4IA 1XD1A 3KOWA 3NL6A 2EF9A 3CXOA 3C86A 3LGGA 3WLRA 4O1AA 3PSWA 3NYDA 4IIDA 4KWSA 1UWIA 3JZEA 5H6HA 1QNVA 6REQA 3EA1A 5ABGA 3UCDA 4J3UA 3UA4A 3HO8A 3H8AA 2B7OA 1I2OA 1POKA 2MNRA 3DFHA 3Q4DA 1JPKA 1GEHA 2HPIA 3DZ1A 1VKFA 1D9EA 3B3DA 1TMLA 3RLUA 3QTPA 3W2UA 3T1GA 2L5HA 1F4AA 3DN5A 4GQQA 4NRRA 5MKGB 1FH8A 3HGJA 4LS1A 3UZXA 1DIOA 1VCGA 2PGRA 3CB3A 4GVHA 1TTIA 4IQLA 4TX8A 2BVYA 2J9YA 2O4QA 3HQNA 4WSHA 1CXIA 1QNSA 2XZ7A 1YPIA 2QXWA 4PUUA 3T0DA 4LT9A 2RDXA 5AC7A 1LF1A 2Z2AA 3E38A 5DT7A 4MJMA 3T55A 3ZR4A 3S1WA 3LZ5A 1NSJA 1SMAA 3RX3A 3I6EA 4GCXA 3W23A 4L4MA 3SJNA 1QWKA 2PWHA 1HJSA 3E2QA 1R5YA 5LA1A 4R34A 4HOWA 3TLLA 1F9CA 1QMLA 2NSXA 2FVKA 3GG7A 1FWCC 2X1IA 4YHGA 5HWJA 3NIYA 3VCRA 5JQ9A 5RUBA 3D5HA 3ZXWA 3LD5A 2WANA 3SN0A 3A22A 3ARZA 1FOBA 2BY2A 5EKYA 3EEGA 4O1EA 1KGXA 3AXMA 2AMXA 5F7UA 3VD9A 2DH3A 4J35A 2V38A 4PEKA 5CXPA 4KT2A 1QASA 1ZSXA 2W79A 4E2VA 4IFOA 1MUCA 4IIEA 1S2AA 4PFMA 4DAFA 4LCRA 2CLKA 1V0NA 3N11A 3PNZA 2I14A 3GQYA 3UZZA 3PZUA 5G1YA 3M0VA 1OC5A 3BAYA 3HJEA 1XLJA 3VMPA 2GVYA 2X1RA 2DT3A 1BTMA 5A95A 4Y7EA 2YYUA 1SSDA 1Y5XA 3KL5A 3O6DA 3ITXA 3B05A 2GGIA 4OGZA 1E70M 3C3NA 5DELA 1XYAA 4FB7A 1REQA 3GM8A 1AD1A 2OSWA 1C29A 3O0FA 1GCYA 1AZ1A 2BXVA 4F3HA 1EP1A 1P5BA 2WKGA 1CXEA 1BTCA 4YYFA 5BZAA 4B2DD 1UASA 4ZQNA 1HKJA 5LNRA 1EJRC 3WD4A 4P2VA 3RM8A 2QLYA 2GVJA 3EWDA 1MDLA 1F6YA 3UJFA 3R6IA 2A3BA 2PGFA 4ENLA 4MY8A 5LZLA 3W7QA 2CERA 3NXFA 2EPHA 4MY1A 3SCVA 1JZ3A 3S9IA 4QLJA 5C2XA 3LHUA 4LRSA 4PMZA 5DT5A 2RJGA 4YVVA 1GVRA 3MA8A 3Q67A 1KBBA 3POHA 4OBTA 1S5WA 1R2SA 5DY3A 1Q4NX 3HURA 4E8DA 3V5OA 4CKQA 4CNNA 3ZWTA 1S46A 3CL8A 3HG2A 5FJJA 4HSOA 2V63A 2FIQA 2VFEA 2WZMA 3QQ1A 2CBUA 3L4UA 1WP6A 2A7PA 1QBAA 2J24A 3QM3A 1JPMA 4NU7A 5FF3A 2OYLA 1ZBVA 1OK6A 3M46A 3QMTA 4CNSA 2QGHA 3QR1A 3NURA 4U4MA 3NOYA 2XGBA 3I3DA 5GQBA 4DF2A 2IUZA 4J3VA 4YTTA 4GI8A 1JZ8A 2HK1A 3W74A 4JNMA 3GNDA 1NP2A 3DBNA 2OQYA 3MV01 3CAVA 3FKKA 2GQ9A 1NQ6A 2NQLA 1PZ3A 3B40A 4IMCA 1CLKA 3S9ZA 1L2QA 1ELSA 2V6AA 1LLOA 1LQ2A 3TMLA 4PCFA 4IM4A 2E0PA 2JFEX 1E5NA 5D2WA 4PGLA 4E6MA 3TCEA 4O16A 5F1VA 1W5NA 1TA3B 1UD3A 3IIPA 3PTDA 3ARWA 4AF0A 2Y5SA 2XSXA 1F3XA 3B8DA 2PS2A 5CPMA 5FEWA 3ABXA 3B8IA 3POCA 4GHRA 1PPIA 1XM3A 2EPMX 1OC6A 3GVWA 3T0TA 1OX4B 3W86A 1RK5A 3EDJA 1XCXA 4L7ZA 5K4ZA 4I6KA 2DQXA 1L6FA 4GIEA 3G8EA 3WDRA 1QW7A 2OSXA 2VD8A 1VFSA 2ISFA 2PDHA 5BXPA 1A5SA 5LIXX 5EB8A 5J8LA 3WLKX 2OFJA 3WH7A 5ABHA 4NXKA 3NEVA 4NUWA 3HPSA 4DAIA 4LS2A 3R8GA 1SUXA 3HB9A 5JBDA 5G2WA 2HNHA 2EG6A 1P0KA 2QF8A 1ECEA 2GDQA 1GOWA 1ZHAA 2GGHA 4HKPA 4PFHA 1V6UA 1KM4A 3A3HA 1E6PA 3BOLA 4NJIA 3AS2A 2QJMA 2NUYA 4YPJA 1ZNNA 1FDZA 2PE4A 2WMFA 1XX1A 3WKZA 1XUZA 4F0SA 3WBEA 2G3NA 5D09A 2QNEA 4B5NA 1Q6GA 1NH6A 2C1IA 1NWRA 3QY8A 4QEEA 3RITA 2O92A 3VGBA 2HEJA 1NQKA 1SZNA 2XN1A 3HTWA 4JTDA 2PFHA 2ABAA 2XSBA 4QHRA 1LLWA 3BGJA 2PTXA 1FHDA 1EDQA 4QFUA 1TV7A 4ZZ9A 1OD0A 3KLKA 1VEPA 1RP9A 5LIUX 4IMEA 3IRSA 1XPGA 4MZ8A 2ZRZA 1N2VA 5HNRA 2Q3RA 4BEQA 5KITA 4MFEA 1T96A 3M0XA 4Q7IA 5GVJA 5FACA 2NUXA 5M03A 2PF0A 3KHJA 1HP5A 2PZ0A 7TIMA 4W8LA 1FX6A 1T41A 4AIBA 1ENUA 2VELA 4N2YA 4EP8C 1UH2A 4PUWA 1NIUA 3S3GA 1W31A 1CPUA 3B8TA 2EKGA 4S39A 2Z28A 3TYDA 1PKYA 1YLVA 3VOIA 1F8MA 2Z1XA 4P7LA 3WIJA 1UIOA 3U2ZA 1BG4A 1YBQA 1ITXA 4AISA 5CLTA 2ZDSA 1P7TA 1F76A 3VMNA 3CT2A 2A7NA 5G5IA 2WCSA 3L4VA 2IKJA 1G94A 1H41A 3P8IA 4DUXA 4MG4A 3ARPA 5EMKA 1P1MA 4LYPA 2IXUA 4B3ZA 4BA0A 2X7VA 3HPFA 1E51A 3W1AA 5I3DA 2QGYA 4IP5A 1A0CA 4XIAA 1KA9F 4MDPA 1CGVA 1WA3A 3KL3A 1V3IA 4DXVA 5JIWA 2MANA 3HMJG 2DZPA 1RALA 4W5UA 3EPNA 4XWUA 1THFD 2G3FA 3S46A 2Y5JA 2BS9A 3DU0A 2O9PA 1BPLB 4XZLX 1RK6A 5TBOA 3N17A 4XVEA 4WDXA 2NW0A 3EDEA 1AJZA 1B3ZA 1YDVA 3B8UA 3ATZA 5LYRA 1LG2A 1OBAA 3K2GA 2F6UA 1N8FA 1GVOA 1Z48A 2NQJA 1IEWA 5D03A 2QCDB 2E6AA 3BJTA 5HA7A 3ABRA 1W91A 1XS2A 3USBA 4AUBA 4DWSA 1BLIA 1JZ4A 2OB3A 2VRQA 3NG3A 3HG4A 2PD5A 1XG4A 3FKRA 4QDWA 4C6DA 4WF7A 2J9ZA 3PBUA 3GVQA 3N4AA 1XIGA 4BR1A 1TPWA 2NLIA 2P0IA 1IZJA 2D0GA 4W7VA 3P5YA 1ZJHA 3ME3A 4O10A 4ORMA 4RUBA 1S5TA 3QZ6A 3BLOA 5FSDC 1R2TA 2V3FA 3WL1A 2A3HA 3BSGA 3OYZA 3UD6A 2INEA 2ATSA 7REQA 2WSQA 3LSCA 1J6OA 5D30A 2V30A 1S2CA 3EKZA 3L23A 7PTDA 5A2BA 3GHTA 4JTRA 2NUWA 3UCQA 4A6GA 5AHIA 4MNLA 2HDJA 4QE4A 2HJPA 3ECQA 3S8HA 3LMZA 5KEZA 4JEJA 2DP3A 5TIMA 4EK7A 2ZZ1A 3E96A 2Y8UA 1XDMA 1Q6DA 4G7EB 1E4LA 1ML1A 3TZFA 4RR4A 4ZQPA 3FA5A 2BMBA 4UCGA 5F2IA 1Q8AA 1J11A 2DDXA 4IISA 3QPEA 1KCZA 5CEWA 3AMDA 4O52A 3GDMA 2W62A 1EQCA 1VS1A 4TV5A 4WJEA 3QZEA 3N1AA 1J01A 2ZOXA 2UZ9A 4A2SA 1ISZA 3O07A 4HHPA 3WUGA 3KBNA 3NSMA 1BXNA