2XGIA

Crystal structure of barley beta-amylase complexed with 3,4- epoxybutyl alpha-d-glucopyranoside
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical genetics and cereal starch metabolism: structural basis of the non-covalent and covalent inhibition of barley beta-amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 193
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgiA00
2WHKA 3CZEA 5A8OA 1RP9A 1WE5A 4JIEA 1B9ZA 2X05A 4UQAA 1CBGA 1QVBA 1GCYA 5I78A 1HJUA 1E3XA 4J27A 1RPKA 1W9VA 1W9DM 2BXZA 1C8XA 3SCWA 1G5AA 5GPRA 1X1NA 1UOKA 3RPMA 3MKKA 3NSMA 3ZR6A 3O9NA 1ISZA 2BHUA 3FNDA 2VO5A 2DGAA 5EFFA 1NARA 3VIFA 1AQ0A 2J8FA 3PZTA 2WLZA 4JHOA 1NH6A 4S3JA 3VUPA 2W63A 4HPGA 1Q6EA 1DWJM 5E0FA 2VR4A 5A1AA 4AEFA 1HKIA 1LL7A 3WNKA 1D2KA 1D7FA 1M7XA 2DSZA 3SCVA 1JL8A 2PWEA 2V3DA 1KR0A 4MB4A 1KFWA 3T2PA 4EE9A 4PBGA 4JKLA 1EH9A 2VX7A 5FL0A 4P8XA 4WF7A 2DEPA 2J25A 3VU2A 1K9EA 4BQ3A 2OSYA 2E3ZA 2EQDA 5A8MA 3K1DA 3VDCA 2VX6A 1EA9C 3MSDA 1PZ3A 1H0IA 1UYQA 4KGLA 4HU0A 2UY3A 1CGVA 4BCEA 4PMDA 4DUXA 1QHPA 1B90A 1JZ6A 4AMCA 1ECEA 1HJQA 3A4AA 4YPJA 4LXFA 1KXQA 1OGBA 1LWHA 1V02E 2WK2A 3VIOA 1JZ5A 3OGRA 1GQJA 4J3SA 2GJXA 5I79A 3QHNA 2O9OA 4V28A 3CZGA 2X8RA 1UD4A 2ZX8A 1FH9A 1MW3A 1VRXA 3BMVA 2YJQA 3ZO9A 3SCPA 2YLLA 3EBVA 3KL3A 2Y2WA 2YKKA 5I5RA 3GNRA 1CGWA 1E4IA 3AMCA 4WK9A 3T08A 5E70A 1NQ6A 2Y24A 3LPGA 5D9PA 2C8NA 3BAKA 3U5YA 2VOTA 4CCCA 1MWOA 3N11A 4A3YA 3CTTA 1QNRA 1V6UA 2XTKA 3W24A 2XM2A 1E73M 1EHNA 1HJWA 4PMXA 4JCLA 2A3BA 1BHGA 1V0NA 3AIWA 3UEQA 2VZVA 2VRJA 3RM8A 1V0MA 3WL1A 3N1AA 4TTGA 3VMNA 3II1A 1WPCA 3WIJA 5D9NA 3N17A 1C3FA 1R86A 2D0GA 1W3HA 2GDUA 1CTNA 3AHZA 2WBGA 4WLCA 1DHKA 1QNPA 2WANA 3VD4A 2WKGA 3D5HA 1J0HA 3WH7A 5A6AA 1E9LA 1ODZA 3NUKA 1CWYA 4QCFA 3GXFA 4HPHA 1GUVA 4URIA 3WMCA 3PZ9A 1P6WA 3L2MA 3UG3A 2XWEA 1GVYA 3GBDA 3L4XA 4D6GA 4XZWA 2PWGA 4DM2A 2QV4A 3AIRA 2VZUA 3S6TA 1GZJA 3RJXA 1MXGA 3G6LA 4X0NA 3UR7A 1E6QM 2WC7A 2ZX7A 1WZKA 2DT0A 2YBTA 4UFIA 2PB1A 4NF7A 3PZIA 1JFXA 2E9LA 2VZOA 1LL4A 3TOPA 4TXEA 2D3NA 3AXXA 3TTQA 2ZUMA 3AS1A 3WMSA 5CSUA 3KWXA 3RDKA 3WH5A 5M17A 2JEPA 2Y5EA 1KWGA 4R5EA 1LF1A 1CIUA 1DWFM 4Z2IA 1W9PA 1V02A 4M80A 3U5UA 3ALGA 3ZM8A 1HN1A 3SCNA 1NWRA 4Q22A 2IXVA 3CHFA 3RM9A 4BS0A 5IFPA 2OWXA 2V5DA 5A6KA 3BAIA 3PZQA 3WQWA 1H1NA 2WVTA 3WF4A 2NW0A 1W9UA 1M03A 1KCKA 3ZMRA 3AZRA 4WKAA 1TCMA 3PZNA 4W89A 3WD4A 4ZXLA 2GUYA 3FAXA 4PTVA 3VDBA 3GH7A 1XCXA 2VX4A 4Y7EA 1KB3A 1UD8A 3MANA 1HP4A 5GNXA 2VRKA 4YHGA 1AMYA 2PWFA 3ARYA 1MFVA 4MNLA 5I23A 1ZBVA 1UKSA 1Q6CA 4U3CA 2VT0A 1M04A 1S46A 3FAWA 1A47A 2BV9A 3CMJA 5KEZA 1DEDA 1PX4A 4JAWA 3K46A 1MYRA 1UH3A 3A3HA 2EPOA 2DQXA 4D6JA 4MB3A 3VGFA 3GTNA 4M29A 3I3EA 1UR8A 4GI9A 1VEOA 4MAZA 3AISA 5AYBA 4AIOA 1ITCA 3WNOA 4AD0A 2ZXAA 4M24A 1IZJA 2V38A 2ZUTA 3W0KA 3BAJA 1CXEA 4UFMA 2G8ZA 3IJ7A 1IZKA 5A2CA 2G3MA 3L4UA 2WMJA 3K8KA 1GOWA 3IANA 4TVUA 4QLKA 2DSKA 2VMFA 5IHRA 1LJYA 1JAEA 5BYWA 1KCLA 2WVSA 1W9XA 5LA1A 3PBGA 1MXDA 3BCFA 2J7BA 3HMCA 4GI8A 2ZOXA 3JUGA 4W93A 4MTVA 5JBDA 1EIBA 2VCAA 1ODUA 1E4LA 1OGGA 2WZIA 4D1JA 2G3NA 1E71M 3S2CA 3NSNA 3WF2A 3KE0A 1I75A 3PZOA 2BVYA 2JIEA 1ESWA 2XUCA 4FK9A 2XVLA 4AYSA 1JNDA 1KXTA 4Z2JA 5IHSA 2G4FA 4L4OA 2XPKA 3BLKA 3DYMA 3WH8A 4GIAA 1J11A 3W27A 5C8BB 3ZQ9A 2GK1A 4U2ZA 1UA7A 3MMUA 3WH6A 4TVCA 4PUEA 3BXWA 3PTKA 2WMIB 2WCGA 6TAAA 3ARSA 4B9YA 2X0HA 1ZS2A 1VEMA 4P7RA 3B9DA 2O9PA 1UKQA 2XIBA 2W92A 1V6WA 1UWTA 1EO5A 3PZVA 5DFAA 1TE1A 2J7EA 3FY1A 3GYCA 1GOQA 2ZWYA 3AHXA 1JF6A 2WCAA 4FMVA 3VIIA 3RMEA 1HKKA 2J7FA 4GQQA 1J12A 2J79A 1CYGA 1E6NA 1H0GA 2FDMA 5I0DA 5CGMA 1KXHA 3K8LA 4BZYA 3AIBA 3VX1A 4B3KA 4FLSA 1JDDA 3ARUA 1O7AA 3OGSA 4H8VA 3F5JA 4ZEPA 3VMOA 3OG2A 1NWUA 1E4MM 2CKSA 3M07A 3SCOA 3AS2A 2YLAA 4B9ZA 2F2HA 2WHMA 1QBAA 3DHPA 1OB0A 2A3AA 2YL5A 4HMDA 1VFFA 4ZE4A 2XGBA 2OSXA 5HNNA 5CQ1A 3FN9A 2EEXA 1LLOA 1V6VA 4W8LA 3AMLA 3SURA 5CLWA 1BVZA 3W6MA 4XB3A 2WHLA 3DECA 4ACZB 4QCEA 3BAWA 1F4AA 4HZ8A 3O6AA 5BXPA 4TX8A 4F9DA 4DUVA 3CIVA 2VZTA 1XSKA 4JZ5A 3CHCA 4JL2A 4UQ9A 3VINA 3VM7A 5HBFA 1ISXA 4K68A 3PTMA 2WVUA 1V3KA 3A4XA 3ZT5A 2YDQA 4AZ5A 2D22A 3QHOA 4JKMA 1J10A 4U2YA 2X09A 1GHSA 3FW6A 4GO9A 4P8VA 4Q7NA 2OSWA 1KGUA 1D3CA 7CGTA 4E8DA 4HOWA 3AMDA 2IUZA 1TA3A 4UTFA 4PMUA 2UY2A 3MMDA 1JNEA 2E8YA 2WC4A 3RO8A 2CNCA 4AXNA 4F9JA 5D9MA 1XV8A 1SR0A 3B9AA 4IUGA 1EGZA 4AIEA 2ESCA 3N15A 4HTYA 4CD8A 2VQUA 4WSJA 5JUVA 2VNCA 1VJZA 2WYSA 5DT5A 4C7FA 2GJRA 2EPKX 2C7FA 4FLOA 3W38A 4S3KA 1CNVA 2V3GA 2EPLX 3FHQA 1HJXA 3WFZA 4DM1A 2Q8XA 3N12A 1UG6A 2CITA 4PMYA 2IXUA 5A95A 3I3BA 1R85A 2PBGA 3QGVA 1OBAA 4OUEA 3T2QA 4XV0A 1G1YA 4UOJA 5LA2A 2WMFA 4P8WA 1PX3A 3CUHA 4Z2KA 1V3IA 2CPUA 1W2PA 1WZAA 4PTXA 5A8QA 4D6EA 1JDAA 1CEOA 2OYLA 1IV8A 3VKKA 1JZ2A 4JFVA 3OGVA 3RIKA 2VJXA 3W82A 2VURA 3QOKA 1XD1A 4H8UA 5A2AA 3CZLA 3POHA 4J3XA 4GI6A 4UQEA 3K8MA 4B15A 1YQ2A 2FHCA 1KGWA 2PBOA 3BC9A 3WBAA 2VI0A 1C91A 2D0FA 2ZXBA 1PIFA 5FCZA 1FH8A 2DT2A 5HPCA 5FL1A 2D20A 4GPNA 4M82A 5A8NA 2J8GA 4MDPA 2VQTA 2DH3A 2W62A 1ISYA 4FLQA 3WDRA 9CGTA 5FD0A 4XUYA 3MV01 5KZ6A 2A3EA 1BSIA 4F79A 2ZIDA 1QNQA 1W32A 3VVGA 3UG5A 1CXLA 1WDPA 4DWSD 4X9YA 4AY1A 1QHZA 4H04A 3CUGA 3OZPA 4PMZA 3GXMA 1UWSA 1OSEA 1GQLA 5DEZA 2JF7A 1LL6A 4JFWA 1BPLB 2ZX9A 1R7OA 4FF5A 5ABEA 4AC1X 1QI5A 3UESA 4ZENA 5AC5A 3AZTA 4UFKA 2QPSA 4WJXA 1DP0A 1XH0A 5EBAA 4LYPA 2VUYA 4U3AA 3EDKA 2V5CA 2ZX6A 4WSKA 1AQMA 3M6DA 1KQYA 1FA2A 1J0KA 1M53A 4D6HA 2ZUUA 1KBBA 4GZIA 4BA0A 1XCWA 5E0CA 2B31A 3AHVA 3MUIA 3WUGA 1E3ZA 4TOQA 3MUAA 1DWHM 5JBFA 4H8HA 3CGTA 2DH2A 2J47A 2WVVA 2CERA 1NWSA 3PZGA 4X0VA 2OWCA 4AZCA 3ALFA 1OD0A 4D72A 1GOOA 1E6XM 3CZJA 3SCTA 3T09A 3GXDA 1MW0A 1KGXA 1TUXA 2VVSA 4AISA 2DT1A 1Q6GA 4CD7A 2A3HA 3WQ5A 3W6LA 3QHMA 4LX4A 3VD7A 4H2CA 4MADA 2EJ1A 1W1TA 3HN3A 5I3DA 1V0KA 4JKKA 2RGLA 2VC9A 3AICA 1TVNA 3EMCA 1GQIA 3U7BA 4IISA 1UQYA 3GDBA 3WEZA 4AZBA 4OBRA 2QHAA 4HMEA 4ZE5A 1EDGA 4AEEA 1CDGA 7TAAA 2V3FA 2J7DA 5BXTA 1UKOA 1MVYA 2GFTA 4BF7A 3GNOA 1VJSA 3BAYA 4AD5A 1V3LA 1WZMA 3LPOA 4U5KA 3VILA 1J01A 3M7SA 1CPUA 2J7CA 1LQ0A 1UR1A 1WB0A 2WKLA 2FGZA 1FP9A 3VNYA 5HXMA 4W85A 1C92A 1JXKA 1ZJAA 1EHAA 1MFUA 4PYSA 5HOSA 3T0AA 4NI3A 1QHOA 1CLXA 1H2JA 1JF5A 5D8ZA 1W9BM 3L4WA 1E40A 5CSYA 1QNOA 3WSUA 1BGAA 2ZUNA 2XFRA 3TTOA 2CBIA 2WWDA 4N42A 4D6DA 1V08A 5IDIA 3SCSA 3MU7A 2AMGA 5D4YA 1ZJBA 4PSRA 1QNSA 3OLGA 3UETA 2ZX5A 3WBEA 1JGIA 1K6AA 2FH8A 2BVDA 2WM0A 3GH4A 1KWKA 3AYSA 1EOMA 1RD6A 1UR2A 2G41A 3IK2A 2GJPA 1JZ3A 1I1WA 5DO8A 4AZ6A 1EXPA 1OIMA 4W7UA 3CUIA 2DT3A 3ZJKA 1WO2A 3RILA 4E8CA 3N04A 1CGYA 3BSGA 3WENA 3T0BA 1V0LA 3HJEA 1XYZA 3TA9A 5D9OA 2QPUA 3AYRA 4MB1A 1E5JA 1TZ7A 4YHEA 3AMKA 4CCDA 2EPMX 5LYRA 3ZOAA 4HA1A 1UWQA 5BRQA 2XWDA 1EO7A 2J7HA 5CXPA 1UD6A 3T0DA 4KRUA 1FFRA 1W3LA 4XX6A 3W53A 1H09A 2TAAA 2YA2A 4UOZA 1HVQA 4UFHA 2ZUWA 1H49A 1FP8A 1B30A 2WSKA 4TVDA 3VD9A 2WNWA 4RE4A 2HISA 4PMOA 1HF6A 2YA0A 1JAKA 1TR1A 4PMVA 6CGTA 3VIKA 4OIFA 1H3GA 2WXDM 4AD1A 2DDXA 5E9AA 5DMYA 1WCGA 5A94A 5AC4A 4W87A 2MANA 1EQCA 1JXJA 3SCUA 3TONA 2XJ7A 3WQ6A 4U5IA 2J77A 1BYBA 1UR9A 1VBRA 3KZSA 3WDPP 4A4AA 3CHEA 3DC0A 4HOZA 1H5VA 3EDDA 1AVAA 3U57A 2XSBA 3SEPA 3VMPA 4D6FA 1E0VA 1F4HA 2YL8A 3MO4A 5F7UA 1R87A 5LA0A 3EMZA 5BROA 1WKYA 4QP0A 2WLYA 2CBUA 1CGUA 4E4PA 2CHOA 3LPFA 3NIYA 3SUUA 5I2UA 2QLYA 1TG7A 2XFYA 4UR9A 3ZR5A 2EO7A 3OLDA 4MNKA 5DF0A 1PEZA 3WKZA 2BHZA 5FOOA 1HVXA 4KGJA 4EKJA 3A6OA 1NOFA 1W1VA 4FLRA 4RE2A 4MAVA 2F61A 2UY4A 2XGIA 4DUWA 2E9MA 1B3WA 2GDVA 4PSPA 1PX8A 5E6YA 4JCMA 4RL3A 3AFBA 3J7HA 1AQHA 4BQ4A 4U33A 1V6XA 4Z2GA 4CCEA 5CPSA 4QLJA 3ZJ7A 3GNPA 3ARPA 1SYTA 3B8SA 1UA3A 3SUSA 4DWSB 3ARWA 1BYDA 2ZUSA 3T2OA 3NSXA 1W3KA 3AIVA 2CBJA 4NRSA 4CD6A 3ZIZA 5A6JA 5ABGA 4XZBA 1ZB5A 2NT1A 4W7WA 2WBKA 1KXVA 2BY0A 5HPOA 1WP6A 1JZ7A 4LQ1A 2BFGA 3DHUA 1GW1A 2WPGA 1Q6DA 3APGA 3WQVA 1JD9A 4ACZA 1FH7A 3ARRA 1BFNA 5CZKA 4NRRA 1HIZA 1U33A 5C70A 1J0YA 1B3XA 2WHJA 3NJ3A 2XM1A 3QOMA 1X6LA 2O92A 1OGSA 4AZ7A 1GOIA 1VB9A 3MUY1 1HL8A 5I24A 3AROA 1E6ZA 2FGLA 3WMBA 3GXIA 5EFDA 5I6SA 1CENA 3ARZA 2WAGA 3VIHA 1DWGM 3VGEA 2YDRA 5BWFA 5JBEA 3D3AA 1R8LA 3AHTA 1HP5A 4CN4A 1GOKA 3FHAA 2C0HA 4M8UA 2EPNA 1E6SM 2VL4A 4V27A 5C71A 1GJWA 4W8AA 3BSHA 4J3TA 3AZSA 2BY3A 1W91A 4U31A 1US2A 5CPTA 1DTUA 1XSIA 3AI0A 1GJUA 2J74A 4NSBA 3OLEA 4GXPA 3UR8A 2RGMA 3SCRA 1HT6A 4LYQA 5HDRA 1GQKA 3OB8A 4OZOA 1H11A 1HXJA 2CBVA 3POCA 3WEMA 1XD0A 1CXIA 1SFSA 1QW9A 4MNJA 2GVYA 1BQCA 3BGAA 3MV11 5M3WA 1LG1A 1M01A 3AIQA 1B3YA 3L4TA 4P8UA 3N18A 3WQ8A 3NDYA 3PHAA 4CUCA 1G94A 1HKMA 4OKDA 3WH9A 1E0XA 1JIBA 4J3VA 2FH6A 3F4VA 5A6BA 3CH9A 4UQBA 3SUWA 2O9TA 5IXEA 4J3UA 3ZT7A 3OA5A 5A8PA 1JYWA 4D71A 1ZU8A 3B9EA 3WFLA 3VTRA 4ACYA 4TTUA 1B1YA 3GH5A 1E6PA 5A6MA 3OZOA 2XVNA 4CD4A 4C7DA 1VF8A 1C8YA 1JYVA 2X0YA 3WL0A 3ARXA 1UWUA 3SUTA 1JDCA 4D6IA 6A3HA 3WELA 2WMHA 2AAAA 2XVGA 4HOXA 2EBNA 3WUFA 1U2YA 1L0PA 4P7QA 2ZXDA 2QMJA 3WNNA 1OD8A 1V3HA 2O9RA 4HZ6A 1A3HA 1NWTA 3BMWA 2J62A 3WNPA 4UZUA 3AHYA 3VD3A 3WEOA 1CXHA 5JIPA 1CXKA 1PPIA 1JI1A 1W3JA 1VAHA 3W4RA 1BAGA 1I1XA 4PTWA 2PWDA 2E9BA 4GZEA 4QLLA 4AZGA 4UNIA 4AZIA 2NT0A 3WD0A 1B3ZA 1UH4A 5ABHA 4P7LA 4MJ2A 3VD5A 2YIHA 2NSXA 4ATDA 1OT1A 1CLVA 3CPUA 2JEQA 4M56A 3KEHA 2DSUA 3RM4A 1IT0A 3RCNA 1HKJA 3AMGA 3ECQA 1E55A 4WKHA 5CLTA 4M81A 3TTYA 4W5ZA 4AD2A 2UWFA 4AD4A 2CYGA 5BXRA 1BF2A 3RJYA 4CU7A 1JYNA 1VENA 3SUVA 1ZBWA 5D8WA 5CG0A 2Z1KA 1VBUA 1OCQA 3VNZA 3A4WA 1X6NA 1MQRA 2BVTA 4GQRA 1JD7A 3VDAA 1QI4A 1EQPA 2CXGA 4AW7A 3EDEA 2BY2A 1OINA 3SIMA 3VIGA 3VO0A 2PF0A 2YL9A 1J0ZA 4OBSA 1QI2A 5BCAA 1BG4A 2HVMA 1FOBA 3PZUA 1E1FA 4IPNB 2ZUVA 4CKQA 1TFVA 2XHYA 8CGTA 1W1YA 5CPQA 5AY7A 1XRVA 1BGGA 1ZL1A 2WC3A 3WF3A 5JIWA 4PEEA 2E4TA 2J4GA 3W29A 2DPEA 3IJ8A 4R27A 5A6SA 3AOFA 2WSPA 4AWEA 3WDHA 1V3MA 3VGGA 3GBEA 3BH4A 3F5LA 4PN2A 5TD4A 5A2BA 1V3JA 1CECA 4AD3A 3VM5A 4GZJA 3ARTA 4YN5A 1VFUA 3WD2A 3IAQA 1EDQA 1DWIM 2WWCA 3EDFA 1CGXA 4CVUA 1ITXA 3ZT6A 1XHGA 1ISVA 1TMQA 3L4ZA 4J7RA 5A3HA 1C7SA 3ZSTA 2WMGA 2CEQA 1WNOA 4N0RA 4CD5A 4B16A 2JE8A 5A6BD 2JFEX 1JYXA 2E0PA 3L4YA 2BHYA 1WZLA 2UY5A 3IAPA 5I77A 3UCQA 3WDJA 1FHDA 4KMQA 1R7AA 1QOXA 3AXIA 1ZBCA 5EMYA 3THDA 3VPLA 1E72M 3SCQA 3NYDA 8A3HA 3CO4A 1VIWA 3ZSSA 2OYMA 1C7TA 5M03A 2VZSA 3EYPA 2GJXB 1FFQA 3CBWA 3CLWA 4EAMA 4CVWA 4PCSA 3TTSA 2G3IA 1E0WA 1MQQA 3ARVA 5ECUA 4MPKA 2XG9A 3FXYA 4UQDA 1UR4A 1K9TA 4PMNA 3BLPX 3L2LA 2WW5A 1XH1A 3WN6A 1YHTA 2WZHA 1UQZA 3DYOA 2V3EA 3CMGA 4D1IA 4OOZA 1V6YA 2YOCA 3ZJ6A 5AYIA 4JFUA 5GNYA 5GQBA 2D0HA 1WDRA 3F5KA 3I3DA 4ATWA 4W88A 4AZHA 4GKLA 5EB8A 3WQ4A 4PTMA 1LWJA 1NOWA 2PC8A 3KL0A 4A3HA 1PAMA 4GO8A 4QFUA 1G0CA 4W7VA 2F8QA 2ZXQA 4H7VA 1B2YA 2WCSA 1UWRA 4JHZA 1J0JA 4IM4A 4Z2HA 4GINA 4UZSA 3MUZ1 4HZ7A 4HP5A 1CGTA 4PMRA 5FKYA 4ML4A 1HJSA 2D24A 4MJ4A 1B31A 1E56A 1US3A 2OYKA 4DWSA 2CIPA 4CN1A 2AOSA 3VIJA 3OBAA 3O2LA 1E1EA 4ZXOA 1GONA 2FHBA 1FHLA 1N82A 1NM9A 4TX6A 3M46A 3N13A 1H4PA 2DSVA 3VIMA 2DIJA 1Q4NX 2XIIA 1TA3B 3VGBA 2BS9A 4UFLA 3U7VA 2PWHA 4AZCB 2JALA 3W25A 4CU6A 2J75A 5DT7A 2X2YA 4UOQA 2W91A 4BQ2A 1U30A 2J78A 4C7GA 1E6RA 1G9HA 2FHFA 1UD3A 2WB5A 4MB5A 3QR3A 1XC6A 5BXSA 1NOUA 1UHVA 2W66A 3WNMA 3WUBA 2XSAA 3EDJA 3PTQA 1J0IA 3HU7A 2GSJA 2D2OA 1BYCA 1L8NA 1JZ8A 2YL6A 4TUFA 2OWWA 1UD5A 1VFOA 2XYLA 3AJ7A 2ZWZA 3BCDA 3CUJA 2CHNA 1XGZA 2BNJA 1GOMA 3ZJ8A 4OJYA 3VIPA 3VGDA 1O6IA 1JI2A 4F66A 7A3HA 1NP2A 1BTCA 5CJ5A 4PUDA 2CETA 4W8BA 2VX5A 3CZ8A 1MW2A 3OLIA 4UCFA 3CHDA 1BG9A 1DWAM 4ATLA 4AIUA 4F8XA 1JZ4A 3MSGA 4LPCA 1C93A 2YBUA 1UKTA 4HA4A 1B3VA 1E70M 1B0IA 1Q6FA 2W61A 1C90A 2BY1A 3E1F1 1XSJA 3THCA 3VDHA 4E2OA 1QPKA 4HA3A 1TVPA 1Z32X 4V2XA 4D6CA 1J18A 1EOKA 4W84A 4LYRA 2D23A 4ZFMA 4IPLA 2GK1B 2WZEA 1RH9A 1OIFA 1E5NA 3K4DA 1WDSA 2YDSA 1Y7VA 4UFJA 1UR0A 1GVIA 1BLIA 3VX0A 3WD1A 5E09A 4L4PA 2QF8A 4B3LA 1LG2A 4Z2LA 2ZE0A 1QI0A 2WMIA 2XFFA 3GZAA 2Y8KA 1XYFA 2Z1SA 2OLHA 3AIUA 2XVPA 1PZ2A 1E15A 2W67A 1HJVA 4BQ5A 1J9YA 1OT2A 4KRTA 4QAWA 3G6MA 1C8QA 2VR5A 1K9FA 1KR1A 3VOCA 4DWSC 2QMKA 4EK7A 1NP0A 4JL1A 1MQPA 5CGTA 1OWQA 4PRWA 4JFTA 2WMKA 3OIHA 3BAXA 1VEPA 4HMCA 2J7GA 4MNMA 4P7NA 3N9KA 2PI6A 2VCBA 3MS8A 3WD3A 3A47A 1GHRA 4RE3A 3PN8A 2G3JA 3UERA 1K9DA 1RP8A 1GPFA 2WVVB 3DYPA 1UUQA 4P7OA 2Y8VA 2E40A 3AIEA 1GNXA 3AXHA 1G01A 1PIGA 4W5UA 3W28A 1HL9A 1UZ1A 1ISWA 2A3CA 2DIEA 3VGHA 3WF1A 3CUFA 1KBKA 3MMWA 2X1IA 1JG9A 5E6ZA 1MW1A 1BYAA 4HU8A 3W37A 3LPPA 1SMDA 2VTFA 3L4VA 1XH2A 4NZCA 2D1ZA 1E4NA 1JFHA 2VRQA 1KQZA 3LMYA 4KH2A 5GNZA 4J3WA 1OM0A 1QW8A 1HX0A 2Y4SA 1PBGA 1SMAA 1GORA 4M1RA 2JIWA 3AS3A 2D3LA 1UH2A 2ZICA 1CXFA 4JFSA 2EXOA 3AQUA 1ZBKA 3WF0A 3EMQA 2E8ZA 3K4AA 4W86A 5FIPA 2XVKA 4WKFA 1VFMA 2CCRA 3CZKA 1WAWA 5IFTA 3WUEA 3WY1A 3WDIA 3PZMA 5M5DA 1EDTA 2BXYA 4LGXA 5ABFA 4EANA 4PMQA 3WDQA 3NDZA 5A69A 3IJ9A 2W5FA 3AS0A 3KL5A 1WDQA 1W2VA 2CKRA 1QI3A 3NCOA 3WNLA 1UD2A 1UZ4A 4KWUA 4UQCA 4WIWA 5BRPA 5ABFB 2W4XA 2YA1A 3W26A 3ARQA 4PCTA 1H41A 3GM8A 3TP4A 2VCCA 2CESA 1BVNP 4H41A 4MDOA 3UG4A 1V03A 4CU8A 4CGTA 1QBBA 4J28A 2DSWA 4QDMA 1E43A 1UKPA 1W1PA 2JF6A 1HNYA 4OOUA 4CN6A 3W81A 2VVNA 1UWIA 5A6LA 1CZ1A 1PJ9A
chains in the Genus database with same CATH superfamily
3CZEA 2FLIA 3S9YA 1ITUA 1RP9A 4IMCA 1R3QA 1ZJHA 1AD4A 2X05A 2PLCA 1CBGA 1JGMA 4YVVA 1QVBA 2GQ3A 4NYUA 3ZVIA 1I2PA 1JUKA 4TMBA 3KFTA 4Q4SA 2HBVA 1JQXA 3B03A 3SCWA 4R33A 2IKGA 3M5VA 3M0KA 3CV2A 4R7WA 3AXKA 3G22A 4O1DA 2GGHA 3NSMA 4IGMA 2PDBA 5G5IA 3O9NA 1ISZA 2V81A 1NARA 1AH0A 2J8FA 4YWIA 2WJEA 3PZTA 3MHFA 2BX7A 1DWJM 1HKIA 2DV0A 3DZ1A 1D2KA 1WV2A 5F2MA 3BDKA 2PWEA 2V3DA 1RJPA 3B97A 4EE9A 5FSEC 4QTGA 1XDMA 5DLCA 1HFBA 1TPUA 3N3TA 2J25A 3EX6A 3VU2A 1FX6A 4ZZ9A 1KM6A 4ZO8A 3IEBA 2Z2BA 2YYUA 3K1DA 1EJ7L 4NXKA 2VX6A 4AAJA 1FKXA 1EA9C 2R91A 2J8TA 3LSBA 3REQA 1UZDA 4KGLA 1FTXA 1XYMA 4GISA 1KM5A 5AYZA 2YB4A 4PZVA 4LC6A 3KX6A 1E9ZB 2WM1A 1B90A 1ECEA 3MO7A 2GSHA 4QITA 3VNDA 1IT8A 4JYEA 4NT0A 1PIIA 3TC6A 1SFTA 4EF8A 3TA6A 4P61A 1KFEA 2YJQA 3ZO9A 1TPWA 4GGHA 4OE7A 1MZRA 3WK3A 3PR2A 3W7RA 5I5RA 3GNRA 3GX9A 2PWVA 3T08A 5E70A 1NQ6A 2Z25A 5D9PA 1CT5A 2C8NA 1A3WA 1TWSA 3CC1A 4BWLC 3UWVA 3W1TA 3A3XA 3C3NA 1MWOA 3N11A 5I7GA 4JTIA 2XM2A 1E73M 4V33A 5LNSA 4D8ZA 3Q94A 3M0LA 2JKEA 3SN1A 4KQNA 4P5UA 3VMNA 4GIRA 1WPCA 4R3UA 5F1VA 5GJMA 4IIFA 1KTBA 3W2UA 1DORA 1XW8A 2GDUA 4IMDA 3AHZA 1DHKA 1QNPA 2WANA 3KAOA 4AVNA 3VD4A 3CYJA 3ID7A 3D5HA 3WH7A 3NQAA 2CWXA 3RLUA 4WOZA 4HPHA 5FJIA 4K8EA 1DJYA 3CWOX 4C91A 2NQJA 3L2MA 3L4XA 1FWNA 1GVYA 1YTKA 4WY0A 3AIRA 5K9DA 1M41A 2VZUA 1GZJA 2V68A 3RJXA 3T4WA 4UB9A 1E6QM 4JTSA 1O1ZA 3LHZA 5LNWA 1WZKA 1OFEA 3RCMA 2DT0A 4MJMA 4S2CA 3W76A 4NF7A 2X16A 1Y5WA 4GUGA 4H6KA 3RMJA 3OBEA 4HB7A 1S39A 3AS1A 5M17A 2Q09A 2POTA 1CIUA 2VFEA 4OVXA 3N6HA 4JQ1A 1RPXA 1HN1A 3KHJA 3BAIA 4MG4A 3N2OA 1AH3A 3UNDA 1M03A 3NO5A 2WOQA 1KCKA 1P0NA 3PZNA 4X61A 2GUYA 3GH7A 4EPKA 3MANA 4ZB2A 2WZTA 2V9DA 1AMYA 1BVWA 3IUDA 4MNLA 4JX4A 3LCIA 3M7WA 4DJDD 4JTTA 4KIRA 3NDOA 1Q6CA 4C1KA 4U3CA 4GKTA 2F9RA 3GG1A 1S46A 2BV9A 2C1IA 1EF2A 3HG5A 3I6EA 1PX4A 2D2HA 4JAWA 1YPFA 1J2BA 3QV9A 1MYRA 1UH3A 4LUSB 2EPOA 3AUJA 3KCOA 4D6JA 1P1XA 4M29A 4M6VA 3W83A 4AHPA 5HUOA 1VEOA 4QDWA 5AYBA 4TV6A 5CC7A 1XIFA 4AD0A 1VRDA 4UFMA 1LRTA 5LNVA 5A2CA 3L4UA 2WMJA 3G5EA 3IANA 4TVUA 3L5AA 1LJYA 1JAEA 1KCLA 2DZXA 1OQFA 3GU1A 4QRNA 5ABTA 4RE0A 4DZAA 1EIBA 2VCAA 4OFCA 1E4LA 4JQAA 1E71M 5LIKX 3EWBX 4QX4A 1QOQA 2G96A 4XO7A 1PYFA 3C2YA 1JNDA 1GGOA 3G1VA 3DYMA 3FS2A 3W27A 5DY3A 1ZQ5A 3G0UA 3QY6A 1O5RA 5C8BB 2GK1A 4GFSA 1UA7A 3MMUA 4PUEA 2WCGA 1XLHA 3ARSA 2X0HA 4Y9PA 1VEMA 4XBJA 3B9DA 2HQAA 2G37A 1UKQA 3OBKA 1D9EA 1EO5A 3PZVA 3GDTA 2J7EA 3GYCA 3NQ7A 3GXNA 3I7RA 4PH6A 1OZMA 4JYDA 1E6NA 1JJKA 4ICMA 1K1DA 3ORWA 1KXHA 4RW3A 4B3KA 5BZAA 1O7AA 4DO4A 4H8VA 1K8ZA 3WJXA 1SGJA 4QJ4B 4ZEPA 1LP6A 1J96A 4IOTA 1KBIA 3GLCA 2WO5A 4DRSA 3VNKA 3BW4A 3KBVA 2IQ0A 4HMDA 2ZRVA 3STPA 2PCEA 2VEPA 1V6VA 1DQWA 3ITOA 1O5KA 3M0VA 5CLWA 3UZYA 1BKSA 1I2NA 1K7XA 1F4AA 4XVEA 1RBLA 3O6AA 2Q3RA 5I02A 3LCHA 4AU0A 4F9DA 4RNFA 1R3TA 4DUVA 3CIVA 4QE1A 4RKAA 1GWJA 2FB2A 2FVKA 3VM7A 1ISXA 4K68A 1LORA 3ZT5A 3A4XA 2YDQA 4DBUA 3VE9A 3UF9A 2ZYFA 4JKMA 4MYXA 4S23A 1T96A 2CLMA 3U0HA 3VABA 4GO9A 1Q66A 3R43A 4NZJA 1K7FA 4GBUA 2OSWA 3QW3A 4Q8TA 4QJ1A 1DVJA 6ALDA 5AOUA 4K38A 2I17A 2IUZA 4PMUA 1F3WA 3MMDA 3RRXA 1C29A 1EX5A 2WC4A 5AYXA 1QNVA 4ZQPA 2YW3A 1SR0A 5JU6A 1NDZA 1EGZA 2Z00A 2QCGA 1DIEA 3MCMA 2Y85A 5D30A 2E7FA 4C7FA 4O10A 2FJKA 1EP3A 4L9YA 4NYYA 2R8WA 2DORA 3EX1A 4S3KA 1CNVA 1SO3A 3SSZA 2GJNA 3AAMA 3N12A 2P0OA 2BGSA 1E9YB 1HG3A 3M16A 2CITA 4R85A 3DG7A 4JTQA 1RCQA 3NEHA 2PBGA 4B92A 4XV0A 3NPXA 3WYZA 1G1YA 3IK4A 1GOXA 3WFAA 1V3IA 3ANUA 3CT2A 3NQVA 2CPUA 1W2PA 1WZAA 1YADA 1HUVA 4L64A 5A8QA 2BASA 2QCEA 2PPGA 3UR2A 1M3UA 3OGVA 2ZFAA 4YMZA 2VURA 3L0KA 4H8UA 3TW9A 5HMSA 2VKZG 3POHA 4GI6A 3S2JA 4B15A 1XLLA 1Q6LA 1YQ2A 3WK2A 3BC9A 3FK4A 2YXXA 2XIMA 2D0FA 6TIMA 5FL1A 1DJNA 5A8NA 3FJLA 1QO5A 1XINA 2DH3A 2IQTA 4I5RA 5FD0A 1FXQA 1H7RA 4XUYA 3MV01 1OYBA 2ZIDA 1QNQA 4E2VA 4JTFA 3UA3A 3EWXA 4AY1A 2OQYA 4ADTA 2V67A 2YFOA 1TV5A 3CUGA 4XBKA 4ICCX 2OJPA 4PMZA 3CL7A 2XH4A 3H2CA 1GQLA 3S1WA 2IMRA 2JF7A 3UYCA 4Y6GA 1B4KA 1TZZA 1U83A 4JIIX 3EA3A 3OQEA 3SRKA 4ZENA 3QN3A 2GGIA 1FKWA 1GVRA 2OOGA 1Q85A 2VC6A 1XH0A 4DN1A 2V5CA 3DFSA 5HWMA 2A21A 1XIIA 5EL1A 1S5MA 5H1WA 5HULA 2RDUA 2ZUUA 1P48A 1XCWA 3K1GA 1K70A 3PK7A 4PR4A 1PHQA 3O15A 4DF0A 4FXFA 3SRHA 4I7WA 1VS1A 4ZQCA 1XYCA 2WVVA 2CERA 1ZGDA 3BOLA 4AZCA 2C19A 2I5GA 1Y65A 1OD0A 3GUGA 3B9OA 3CZJA 4HTBA 3OG3A 5T9CE 1MW0A 1KGXA 1EJTC 4AISA 1NVMA 2Z0IA 2YXOA 4H2CA 4MADA 4M3PA 3B8UA 5IM51 1S5NA 1V0KA 3NPVA 4PUWA 2FPVA 2H8ZA 2GVJA 2PZ0A 1R46A 2NX3A 3EMCA 1MMFA 1DJXA 4HKPA 3JVAA 2Y8UA 4EX4A 4Q3MA 2J7DA 4IPPA 2DZSA 1Z7AA 1UKOA 1BD0A 3R5EA 3GNOA 1IT7A 1KBJA 1QCWA 3G1FA 4HPXA 1XUUA 2BMBA 1C92A 3V36A 4LS1A 1MFUA 2RUSA 5HOSA 4FO4A 1BXBA 3DDMA 1QHOA 4LUIA 5E93A 5CPMA 1L6YA 3L4WA 3TTEA 2ZUNA 2XFRA 3TTOA 3GNDA 3PAOA 1QTWA 2WWDA 4N42A 5IDIA 3SCSA 4ADSA 3HJZA 3QRHA 3OLGA 3WBEA 4OQVA 2FH8A 4WDTA 5J8LA 2Y89A 3DFQA 2V6AA 4GJIA 2OT1A 1PB0A 1Q8AA 4L1WA 2AQOA 1RCXB 1I1WA 4HN8A 4I90A 3NL6A 1GT8A 3S5YA 2DT3A 3ZJKA 3EXSA 2I56A 2OEMA 3RILA 4S38A 3N04A 3TQ0A 1XYZA 1WXYA 5D9OA 1E5JA 2DIKA 2EPMX 4BJHA 5FJJA 3H2EA 5LYRA 1G7VA 6XIAA 1EO7A 3CMFA 5CXPA 3QMTA 4XX6A 3UPMA 1BWKA 2ZRWA 2TAAA 3ZFHA 2Z1XA 1W6TA 4Q8OA 4UFHA 3BG5A 3UWUA 1UR3M 1FP8A 1B30A 4GNJA 2FVMA 1J6PA 4XKMA 1HF6A 4CQCA 2YGYA 5HNUA 3PPHA 3RU6A 4HYVA 4J4KA 3TJXA 3VIKA 2WXDM 1WCGA 2EG6A 2OZ3A 3CAKA 4W87A 2PGFA 3SCUA 5CBJA 3EOOA 5LIUX 4U5IA 3EX4A 3I68A 1B3OA 4FALA 4A4AA 1AQFA 3CHEA 3Q67A 4NAFA 4I6KA 1RCOB 1F05A 4FA3A 3SEPA 2FYMA 4HK7A 2YL8A 5F7UA 1P0EA 2PC4A 3IVUA 6REQB 5BROA 2QDEA 2J9XA 2RDTA 1OYAA 5DANA 4IJRA 3LPFA 1SW7A 2DUAA 3H54A 3LENA 4WGHA 5DF0A 1X98A 3ES7A 1EF3A 4EKJA 4DLFA 2ALRA 1NOFA 5MF5A 4E6MA 3QC3A 1ZAJA 3RLHA 4RW5A 3TE9A 2F61A 1VLWA 2UY4A 3GDKA 3W7IA 1FY6A 5GVJA 3PFRA 3PUDA 5E6YA 4E3VA 3H2MA 4HJFA 2YBVA 1F3EA 3WQPA 5BU6A 3AFBA 1AQHA 4U33A 1V6XA 4Z2GA 3WZ0E 4KCTA 1LOLA 1RA5A 3SRDA 1SYTA 4L6HA 1JPKA 2XIJA 3TYAA 1UA3A 3GFXA 4QG8A 3SUSA 4DWSB 3ARWA 2GDQA 4MWAE 3ZIZA 5T9BG 2R94A 2C15A 4XZBA 1VKFA 4XZIA 2D2GA 4E2DA 4LQ1A 4IGHA 1GW1A 3TUUA 4KF1A 3APGA 2NLIA 4L6OA 1FH7A 1BFNA 1SJCA 4PCNA 3NM1A 1LBMA 1TV2A 2WHJA 4HNNA 1OGSA 4IMFA 1GOIA 4AZ7A 1HL8A 3AXMA 2FVLA 2WAGA 3BZGA 3PAJA 2X2GA 2DW7A 5JBEA 1EC9A 1HP5A 3HFTA 4CN4A 3FHAA 3N4AA 1E6SM 3W1AA 5D38A 4H8NA 2J27A 1D7KA 4AG0A 5E5CA 4IQLA 4U31A 5CPTA 1DTUA 2W0UA 1LWIA 1GEHA 3KRZA 1WXZA 5HDRA 3JW7A 3OB8A 2YYTA 1HXJA 4IQDA 3ZS4A 4MVAA 4Z1YA 1JDFA 3FEQA 1SQ7A 4KEMA 4KEVA 4C1NB 4IIEA 1J79A 1QATA 3HV8A 3AIQA 1IWPA 1A0DA 3NDYA 3O07A 4A21A 2RDXA 1YKWA 1HKMA 2QGYA 5DELA 1E0XA 4J3VA 3S0CA 5A6BA 5HANA 3B8VA 3ZT7A 3G18A 2REQA 2A7RA 1JYWA 1QW7A 4GUJA 3W23A 2ACUA 4MUZA 3V5OA 1E6PA 5A6MA 1T41A 3OZOA 3EKLA 4CD4A 4C7DA 1JYVA 2VC7A 3NO3A 4D6IA 2AAAA 3S5NA 4HOXA 2EBNA 3LGDA 4ICNA 3UWWA 2ZXDA 2QAFA 1K03A 1OD8A 1V3HA 2O9RA 4RR4A 3BMWA 1ME9A 3GG7A 2J62A 2R6OA 3JU2A 3ZWTA 3ZLHA 1KRCC 3GHRA 1CXHA 4DZIA 5JIPA 3RX4A 1TPEA 1QWKA 2E9BA 4AZGA 2E5CA 4AZIA 4AB4A 3WD0A 1W5PA 2O7QA 3VD5A 1VYRA 2YIHA 2HNEA 1XIDA 3S4TA 1KLZA 2OPJA 2ZKMX 3CPUA 2JEQA 2X1TA 3RM4A 3RCNA 1HKJA 3MP5A 1E55A 1J8VA 5CPLA 1H1YA 4WKHA 3ELFA 3LBCA 1W5NA 3E12A 2OT0A 5BXRA 3KVKA 2JKAA 4CU7A 1VENA 4LWWA 4MOZA 2Z1KA 1SFLA 4EACA 2IPWA 3IWPA 5AVNA 4H6QA 3P67A 1O1HA 1JD7A 3VDAA 4K7VA 3PSVA 4NZ3A 1EQPA 4YTQA 3OZYA 1M1BA 1KW1A 3VIGA 3AU6A 4OBSA 5D32A 3DGBA 5BCAA 5DBTA 1BG4A 2FZDA 1OFOA 4ZOBA 1FOBA 1XWYA 4Z42C 4HMNA 1OFDA 2ZZ5A 1BWLA 3CT7A 5AC8A 3W29A 1TRDA 4EXBA 5FJRA 1NQKA 3AOFA 5A6TC 2WSPA 3WDHA 1V3MA 4NI8A 2E68A 3W02A 1EZ2A 1QU4A 2G3FA 3F5LA 3LQLA 3QQWA 4PN2A 5A2BA 1U5VA 3VA8A 4BF5A 4AD3A 5T26A 4GZJA 4Y8EA 3SDOA 3OOQA 4DYJA 1RUSA 1VCGA 3HM7A 1TJ0A 1VFUA 3NQEA 3S2NA 2V2DA 3BTNA 1CGXA 1OG6A 4CVUA 1ITXA 2NV2A 2PD9A 1DIDA 1ISVA 4GA8A 3T42A 3DESA 2WMGA 4I6VA 2GQAA 2CEQA 1AODA 1ME7A 4N0RA 4B16A 3KHDA 3GKAA 1IEWA 2JFEX 3I4KA 1RLDA 2J9YA 1ENUA 3NPWA 3PJUA 2BHYA 2IKIA 1Q65A 3P82A 2PTDA 1KKOA 3OHIA 1FHDA 1QOXA 2J24A 5CZJA 4ZOCA 2ZZ7A 3TROA 2QGHA 4MYAA 1ZBCA 3B04A 3THDA 1E72M 4JEQA 3NYDA 3F03K 3CO4A 3H2FA 3ATZA 1C7TA 3EYPA 2ZZ2A 3NWRA 4DIAA 5BOOA 4EAMA 4BF9A 2AQVA 2PODA 1CB2A 1LQ2A 1OK4A 1AUSL 3IPWA 2G97A 1K9TA 3TCEA 3TX9A 3BLPX 1UQZA 1N8WA 3CMGA 1A80A 4OOZA 3B40A 1V6YA 4GQ0A 2PDYA 4C6IA 1EJXC 4XD6A 2ISWA 4B2DD 4ATWA 3U6WA 2CLEA 3WQ4A 4PTMA 1LWJA 1NOWA 1R2SA 4GO8A 3TYCA 5IRPA 2F8QA 3FVMA 4XO6A 4JHZA 4LEQA 1J0JA 4Z2HA 4FOUA 3KOYA 5CCZA 4ML4A 2G5WA 4KBXA 2D24A 4DELA 4K6AA 1E56A 3GXTA 1DXEA 1CLKA 1SVDA 3KUMA 2V8ZA 3OBAA 2INFA 4ZXOA 1VZWA 1FHLA 3TYEA 1KFBA 2J13A 1G4PA 2ACSA 3P5ZA 3M46A 3T05A 4XKYB 1VQTA 3N13A 3VIMA 1FWRA 3A24A 4MWAB 4UTJA 3KBJA 4LCRA 1Q4NX 1L9WA 3VGBA 3L0NA 2BS9A 4UFLA 2PWHA 4RZ6A 4G2DA 2QQ6A 3EWWA 3TFXA 3W25A 4ASTA 1ZFJA 5AC7A 4UUIA 2V0TA 2ASHA 2J78A 3GTFA 3M0HA 4PB3A 1EWDA 1E6RA 1T5AA 2A6NA 1G9HA 3THUA 1OX4A 2WB5A 2OLAA 1HW6A 3MVTA 4WSHA 3L68A 2PURA 2W66A 2XIQA 4S1FA 2NUXA 4FNUA 1UPMB 2XSAA 1DJZA 2GSJA 1BYCA 4JTEA 2OQLA 1FDJA 1WKFA 5D33A 3E5BA 2YPIA 4JIPA 3B0UX 2CHNA 3H24A 3A9BA 3WQCA 2BNJA 3WLNA 2PDJA 2J6XA 1Y5VA 4JD4A 3VGDA 4XZ9A 5CJ5A 4PUDA 5BOFA 1TREA 2B7PA 3LXAA 4W8BA 3MDWA 2V82A 2EG7A 4HD5A 2NX9A 4XBSA 3CHDA 1BG9A 3Q45A 1DWAM 3T40A 4F8XA 1JZ4A 2YBUA 1RQHA 4G9PA 1N7KA 3ITTA 4PE8A 4XG1A 1C90A 2BY1A 4NNAA 1XSJA 3UXKA 3VDHA 4E2OA 2QJJA 3F4NA 1FCBA 3S3GA 1AD1A 1Z32X 2O7SA 4AUBA 2A7NA 2P53A 1UMLA 1TV8A 3UZXA 2D23A 3L66A 3M0MA 3T07A 4MUPA 1P7TA 3UBPC 1JCYA 1OIFA 5FSDC 3A3WA 4JX6A 4XIAA 3KRBA 3ICJA 4N6EA 1GVIA 3UWQA 3NQ8A 1LG2A 4H7CA 4DBDA 2ZE0A 4XSLA 3D46A 3GZAA 3W75A 2OMAA 1XYFA 2WQDA 4K39A 4AHOA 1NDYA 3QLLA 3AIUA 2XVPA 4L6DA 4PL2A 3G1YA 4G7EA 1O66A 4BQ5A 2RJGA 4Y9NA 1C8QA 1PV8A 2B4GA 2PZNA 1EUNA 3VOCA 4DWSC 1QDSA 2QMKA 4EK7A 3OIHA 1VEPA 4CNOA 2X7VA 3N9KA 2VCBA 3U2ZA 2CXEA 1GHRA 2AGKA 1S2UA 3STGA 1J2WA 3UERA 3IIPA 2W79A 3KOZA 2OLSA 3W85A 2C71A 1RP8A 3TMLA 4KCWA 3C0LA 1A5NC 1UJPA 3VCNA 3DYPA 5G1MA 1W37A 5F4WA 1VFHA 3AIEA 2E40A 1V77A 2Y61A 3MSYA 4NZ5A 3AXHA 2CLPA 1G01A 1YDOA 1FWHC 3WX7A 1HL9A 1UZ1A 1E0TA 1ZENA 1A5OC 3VGHA 3M5ZA 5C55A 3DGRA 1US0A 1JUBA 4C6MA 5E6ZA 4ZB5A 3T55A 2ANUA 1TWWA 3HG4A 4IF2A 1JRBA 2OFJA 2VTFA 2PDHA 4JTGA 4LBRA 1RK6A 5GNZA 3H7UA 4LUTA 1OADA 3QKEA 1IGSA 1Q8JA 2OQHA 4HU3A 3SIZA 2Y4SA 3P0XA 4DJFD 1SFJA 2JIWA 3EKZA 2KAUC 1UH2A 2ZICA 2I5IA 3DBNA 3DU0A 2E8ZA 3K4AA 3QV8A 1NDVA 5FIPA 2XVKA 1VFMA 4DNMA 3PF3A 5DCEA 4C6PA 3WY1A 3R89A 4O0KA 3WDQA 3NDZA 2W5FA 1JCJA 3AS0A 1KRBC 2PAJA 1QI3A 1KCXA 1KM3A 4GD0A 3WLSA 4J2MA 4JNZA 4B2DA 3W26A 1TIMA 3TP4A 1BVNP 3CB8A 4US5A 5D04C 1V03A 4CGTA 3NL2A 1QBBA 4K1WA 2DSWA 1JPIA 1UKPA 2E6FA 4OOUA 2OXNA 3QYQA 2A79A 1L2UA 4OV9A 4R34A 5A6LA 1CZ1A 3UY7A 1PJ9A 2WHKA 1MSSA 5A8OA 3H21A 3BCJA 2F6UA 4UQAA 1NTHA 2A85A 3G8EA 1HJUA 1RPKA 1V5XA 1OVDA 1UC4A 3AYVA 3W73A 1X1NA 2F38A 5EU9A 3LD5A 4KERA 4BI6A 4FNSA 4YNGA 3CNYA 2VO5A 3VIFA 1AQ0A 2NVAA 4L5ZA 3N9RA 3LNMA 1QMLA 3VUPA 2VR4A 4C60A 1TYGA 3WJSA 4QNWA 3D47A 1ADOA 5I3IA 4G56A 2DSZA 4WOQA 3SCVA 1JL8A 1A3XA 3QVQA 2V5KA 4C90A 4ZSUA 3T2PA 4S3GA 5DMNA 2VX7A 4L4LA 2CZFA 5EKYA 4Q32A 4ZBCA 1P0BA 1K9EA 4BQ3A 1A49A 3CAQA 5AYYA 3GG8A 2CZDA 3MSDA 4X9SA 5G4HC 4FX8A 4O16A 3DC8A 5KINA 5AVHA 4HU0A 1KO0A 4IFKA 3UGRA 1TV7A 5TF0A 1TVLA 1ZP3A 3KS6A 3TQPA 1GVEA 4AMCA 5CKSA 1HJQA 3A4AA 4YPJA 1HL2A 1V02E 4WQ6A 3Q2DA 1JZ5A 3QV7A 3RX2A 4ZCWA 3SGUA 3QHNA 4V28A 2ZZ3A 1HO4A 2ZX8A 6ENLA 4NJJA 1VRXA 3BMVA 5ENLA 4J9JA 1J4EA 2BB0A 4WK9A 4LH8A 1W0MA 4XSMA 3FJ6A 1RQBA 1Q63A 2Y24A 4RDWA 3IGUA 3C0SA 4GCAA 2PRLA 4CCCA 4FNRA 4Z17A 3GVVA 3RNDA 4O1FA 6PTDA 2VELA 5F1UA 1QNRA 1V6UA 2XTKA 3C6CA 1XGDA 1HJWA 3U4FA 1BHGA 2VZVA 2VRJA 3RM8A 1V0MA 4Q8WA 4FOKA 3N1AA 1MRQA 4TTGA 1WKEA 3II1A 1VD6A 4DYEA 1KRAC 1ONWA 1G4TA 1TWZA 1CTNA 4CQAA 1K7EA 5AHEA 2WKGA 4E38A 3DENA 2P76A 1ODZA 2RDWA 1CWYA 3E5PA 3BQ6A 1PKLA 1WDDA 4URIA 5TQLA 3PZ9A 3MVIA 3SRFA 3UG3A 3GBDA 3EEZA 4XZWA 4BWLA 4DM2A 2QV4A 4D8LA 3W7KA 4DX3A 3F1QA 1D8WA 4X0NA 4NP7A 1A5BA 3UR7A 2WC7A 3MDUA 4K8GA 2C1GA 5B7YA 2OEKA 3CAWA 3UT0A 3PZIA 1JFXA 2QJMA 2E9LA 3H2AA 4PFMA 4LVBA 3AJXA 3TOPA 3TCSA 1KRMA 5CSUA 3KWXA 3WH5A 3QLDA 4ENLA 3HG3A 5I3HA 1KWGA 2PLKA 1DWFM 1W9PA 2CLOA 3H70A 3KBNA 2Z24A 4KETA 5IFPA 2OWXA 3UR5A 2V5DA 2G4JA 5A6KA 5LGXA 3WQWA 3BV4A 1H1NA 1C9DA 2R1PA 3UZWA 2NW0A 3GNXA 3FVDA 3ZMRA 1R3WA 1TCMA 3WD4A 4PA8A 4QXIA 4PB4A 3FAXA 1G7UA 4JGDA 3C3UA 4Q4PA 4Y7EA 1UD8A 3DHDA 1HP4A 3RU8X 3QW4B 4ZA0A 2VRKA 2C91A 2QCDB 5LXEA 2PLJA 1MFVA 3A21A 3EXTA 3I7SA 3PBYA 2YZ5A 4HNUA 4QG9A 1S5TA 2ZE3A 1A47A 3UXDA 4GH3A 2V30A 4Z08A 3R25A 2Y5JA 3TZNA 5KEZA 1DEDA 3K46A 5HK4A 1EP1A 3WLIA 4G8TA 1U1JA 3A3HA 1GZ1A 2DVXA 2QIWA 2DQXA 2VP8A 4GI9A 1GJPA 4C6NA 3WNOA 2ZXAA 4H9TA 2QJHA 2ZUTA 4KFPA 2BOEX 1SO6A 1Q6RA 4KWVA 1GW9A 3HGRA 4HSNA 3LLFA 3P81A 3MQTA 2VMFA 2ATSA 2WVSA 2I7GA 4X3ZA 1MXDA 3H6OA 2E77A 2C13A 2H8XA 3JUGA 4W93A 2QF7A 5JBDA 4QJ3B 3RXZA 1ODUA 1IE7C 2WZIA 4J35A 3MW7A 1VCVA 3KE0A 3UJSA 3W7QA 2BVYA 1WDWA 4NXSA 1OX4B 2JIEA 3V0SA 2OU4A 4AYSA 3O63A 2XPKA 2VFIA 4IMEA 2GOUA 3DEQA 1KV5A 3NPUA 4GIAA 2YB1A 5C9WA 5HQEA 5AHFA 3BXWA 4C1NA 1VFLA 2QJNA 3SO7A 4P7RA 2VDGA 4Q8PA 1V6WA 3M6YA 3PNZA 1LUCA 3FY1A 5B80A 1U1HA 1IEVA 2ZWYA 4M7TA 2ISDA 1XRSA 1ALDA 2J7FA 1J12A 1YLVA 2FDMA 4C6BA 3AIBA 4YIWA 1V79A 1JDDA 3M5XA 3ARUA 3M9YA 3WO8A 3QPZA 5I3FA 5CH9A 4XD3A 2Y63A 4BK9A 3WLTA 3BJTA 1D8CA 3M07A 1QBAA 2VDHA 3MHUA 3QR1A 5AZ0A 1OB0A 1N2VA 1OF6A 2A3AA 3KTSA 4FF7A 2FMNA 2XGBA 1G6CA 1DIKA 4ERIA 4FNTA 5CQ1A 3FN9A 2ZRXA 1LRNA 3OP2A 1LLOA 3AMLA 3N34A 3SURA 3AWNA 4XB3A 3DECA 3V5CA 3BAWA 4B91A 1EFZA 5BXPA 5E0KA 4TX8A 3JS3A 4A35A 3KS5A 4DBSA 2CLFA 3T0TA 3PBMA 3NL5A 4UTMA 4JL2A 4LS2A 4ZL1A 3QH2A 2QUVA 3VINA 3TFCA 3UWZA 4HNCA 3DI1A 3DFYA 2R1LA 4AZ5A 2D22A 4HNTA 1KA9F 4NU7A 3TJ4A 4U2YA 1REQB 3F7JA 5EMUA 3NQDA 1KGUA 1D3CA 4HVXA 3LZ5A 4RX0A 2GWGA 4E8DA 3S83A 3AMDA 2IPFA 4JOMA 5TBOA 2HXTA 3DKJA 2V5JA 1XRFA 3EOSA 1JNEA 3VOIA 2E8YA 3E49A 3RO8A 2CNCA 1XIGA 3G1RA 1AW5A 2AKZA 1BXCA 4F9JA 1XV8A 4IUGA 3F2CA 2PD5A 2X30A 2ESCA 3VNJA 2NZLA 5FEZA 2HV5A 4WSJA 1YXDA 1V8EA 4UR7A 1VJZA 5JUVA 2ZDRA 3UWYA 2ZZ1A 1RD5A 2C7FA 1F76A 3W7HA 5LIXX 2HS6A 3GUWA 1VJIA 4L61A 3WFZA 2Q8XA 4EIVA 1LROA 3WK1A 1L6SA 4LY4A 4Q8MA 5C7HA 2NVDA 1UP3A 2IXUA 2R24A 3I3BA 4PMYA 5H8UA 1R85A 3TW7A 2VGFA 4H1ZA 5DQPA 2QUNA 1E1CA 4V1XA 1EB3A 3W1UA 3G1AA 1F7BA 4ZMGA 2WMFA 2QCFA 3PSWA 1CEOA 3C2RA 2GSEA 1XLGA 4JFVA 4RPPA 1VHCA 2VJXA 3P0WA 4ILSA 4W9TA 1XLMA 3QOKA 5H8MA 5LXXA 1XD1A 2YCLB 4J3XA 3GDMA 3K8MA 3LM7A 3WBAA 2PBOA 1TSIA 1C91A 4IP4A 5FCZA 3GVWA 4KPLA 4M6QA 3VYLA 4M82A 1EYWA 1LT7A 4QDPA 1XQKA 4AWSA 4O19A 3KCJA 2O0TA 4ADUA 3WDRA 3EX2A 1YBQA 4DZ5A 4S3BA 5C5YA 3W7GA 1BSIA 1A0CA 3DN5A 4PTNA 3MSRA 4FEZA 3UG5A 1WDPA 4DWSD 3VKDA 4JBRA 2I14A 4H04A 3RAOA 1H63A 2Y7EA 4HN4A 1H7OA 3UW6A 1OSEA 4FP1A 3UPBA 3GW0A 5J5DA 1LL6A 2BXVA 2ZX9A 4IGNA 5BMWA 4ZFCA 4O50A 3ZYZA 2POZA 4FF5A 5ABEA 1L2QA 2ADAA 1FDYA 5AC5A 2GVLA 1NELA 3M43A 2QW5A 4UFKA 3WQOA 2GUBA 2VUYA 4U3AA 3EDKA 3R10A 3GC4A 4GGBA 2CWNA 2PLMA 3S1XA 3STFA 5AHMA 5D03A 4POCA 1M53A 3MYOA 3B4UA 4NNCA 2OVLA 2DVUA 3C2EA 2ZVIA 3L7RA 1ZNNA 2H9AA 4A8NA 5E0CA 2B31A 1T6MA 3AHVA 3MUIA 3WUGA 2PTYA 3H55A 4TOQA 4H8HA 3CGTA 4HNLA 3SY1A 2J47A 3GAYA 7REQB 1NWSA 3PZGA 2PE4A 1EPXA 1YNYA 5EBUA 3L67A 1ZTVA 3EKGA 3BLIA 1TUXA 2IQDA 3M4HA 4LBUA 1Q6GA 4O18A 2A3HA 3STEA 3WQ5A 4Y96A 1SZGA 3QHMA 4LX4A 3VD7A 2EJ1A 3TNOA 3DFTA 4JKKA 5G2IA 2VC9A 1W1ZA 5HUPA 3U7BA 4IISA 1H62A 3GC5A 2E28A 4A2RA 3GZ3A 3UZJA 7TAAA 2V3FA 4FZIA 3GD6A 5BXTA 3LCWA 4Q7IA 1Z89A 2GFTA 4BF7A 3W1NA 4ERAA 1V3LA 4DAIA 3GR8A 1CPUA 2VGBA 3NQBA 3SN4A 3A4JA 3DIPA 1UR1A 1JXKA 1EHAA 1BXNA 3PB2A 5EYWA 4PYSA 4D8AA 1JF5A 2GUUA 5CSYA 1QNOA 2PU1A 1JUEA 1QJWA 2PDLA 4M51A 2QJGA 2P50A 2GWNA 3W7OA 2AMGA 5D4YA 1ZJBA 3EAUA 1QNSA 3UETA 1X38A 1JQVA 3T8QA 1Q7ZA 2WM0A 3Q4DA 1RD6A 4H01A 4LALA 5D2YA 2VXNA 4S3AA 1JZ3A 2QR6A 1TCDA 1V6TA 3CIWA 4AZ6A 3AU2A 4KT2A 4W7UA 3KXQA 2QUTA 2XGZA 1K8YA 4KEUA 4RNJA 5G2HA 3IRSA 2PDCA 1Z69A 4GVIA 3TA9A 1SZNA 4MB1A 1TZ7A 4Z1AA 3AMKA 1NJJA 4Y9MA 3ANVA 3ZOAA 3N6JA 5KZDA 5BRQA 1BWVA 3MY9A 4DO5A 1WXJA 3WLOA 4KRUA 1FFRA 4OGZA 4LNYA 3U4AA 2WNZA 1I9CB 3DG6A 3VD9A 4RE4A 2HISA 4PMOA 1JAKA 1BRLB 4F40A 3LV5A 3UJRA 3U2OA 6CGTA 1W5QA 4OIFA 2H9AB 1FCUA 1W8SA 4O11A 3TONA 3QTGA 4A8IA 4YL2A 1PKNA 1GVQA 4O1CA 3WQ6A 3C61A 2X40A 3IIXA 1VBRA 1K4GA 1XYAA 1XG4A 3W9ZA 3O3RA 2QVNA 4CEXC 4IIGA 3BUVA 3DC0A 1W8GA 4D9PA 4CCZA 2QCMA 2CLIA 3GU9A 2IW0A 1UP2A 7ODCA 4D6FA 2YW4A 1F4HA 1HQTA 4GJJA 3V75A 2WJZA 3V1HA 7ENLA 1UB3A 4HSHA 1Z48A 3GTXA 5I2UA 2QLYA 2XFYA 3SW6A 1LT8A 7PTDA 2XZ9A 4GQGA 4HNVA 1PEZA 3C2FA 3EA2A 2BHZA 5FOOA 1GZGA 1HVXA 2QXWA 4KGJA 3HB9A 2VHLA 3A6OA 4FLRA 5CSRA 3BVJA 2DW6A 1R9XA 3ZLGA 2Z26A 2Y7DA 4JCMA 1JVNA 4RL3A 4NVTA 1RZMA 4F4RA 4BQ4A 1W56A 4H9MA 4LAZA 2ZA3A 4F0HA 2VFHA 2E6DA 4BR1A 4DXKA 3ARPA 4L65A 4FNPA 1A5CA 2PGRA 3T2OA 1BYDA 5CG7A 5BU9A 4NRSA 2CBJA 4CD6A 5A6JA 1GVOA 5ABGA 1ZB5A 2NT1A 4W7WA 4BEUA 5HPOA 1OJXA 5AB3A 1DJIA 2Z1VA 1LRQA 4HQVA 1JZ7A 3KRUA 3NQ2A 1Q6DA 1IIGA 3WQVA 2PA6A 1H1ZA 2A3LA 4ACZA 4GG9A 5D05A 1TJRA 4G7FA 3MP3A 1X1OA 4A22A 1X96A 1B3XA 1X6LA 3TK7A 4IFOA 3G1XA 1AL7A 3MUY1 2FGLA 4MZYA 3GXIA 1CENA 4JYFA 1E0UA 2X41A 2WSRA 4C5YA 3BLLA 4HCDA 5I3GA 1GOKA 3GAKA 2EPNA 4V27A 1XIHA 3O8AA 5C71A 1SJAA 3UCCA 4B4FA 4FX6M 4B5NA 1F3XA 1VBGA 4PUKA 1TIWA 5CPOA 4F0RA 3W72A 5JH2A 1LOSA 1XSIA 3MC5A 3TAOA 3AI0A 3F2BA 4PCFA 1GJUA 3FYOA 3OLEA 1U5JA 4IJCA 1HT6A 4IPJA 1VBHA 1GQKA 4FPSA 1K3UA 1H11A 1JPDX 3POCA 2OCZA 4A8RA 1XD0A 4HHHA 1SFSA 3W7DA 1QW9A 2GYIA 3EB4A 2GVYA 4ONVA 1AH4A 1BQCA 2QDHA 3NQGA 3FSUA 3M47A 3MI2A 3MV11 1MUMA 4MKNA 1Z44A 1OCBA 3FX4A 2FZ9A 1G94A 2BGQA 2F6KA 2TYSA 4PULA 3W2KA 1IXQA 2O9TA 3OA5A 5A8PA 3PUGA 3QEZA 3VTRA 1DKWA 1B1YA 3P3BA 4W4QA 1SU5A 3CAVA 1VF8A 3NNTA 1CCWB 2X0YA 3WL0A 1S1PA 3FOKA 2WMHA 3WUFA 4KEZA 3H7RA 3OYXA 2A4AA 2QMJA 4H2HA 4TQTA 3V5FA 1A3HA 1DE6A 2KX9A 1NWTA 2L5HA 8TIMA 3S9IA 1GQNA 1XLKA 4UZUA 1L6WA 1EXBA 3WEOA 1VPXA 1PPIA 2ZBTA 3AYTA 1W3JA 4LVFA 1VAHA 3H4GA 2O4MA 4QQ3A 2PWDA 3FLUA 2NT0A 4DLMA 4IJBA 5KITA 1W1B1 1OT1A 3KEHA 3HV9A 3GR7A 2Z28A 1CI1A 4JQ2A 1KM4A 4LV4A 3AMGA 4UC5A 1EYEA 1TX0A 4GYKA 3TTYA 4EWND 1LQAA 4Q6XA 1BF2A 5F2IA 2B7OA 1WUEA 5HMEA 4WY0F 3WLPA 3ZR4A 3VNZA 3WMLA 2G50A 3PBVA 2PMQA 3MPGA 3T44A 4YJ5A 5FJPA 3UXAA 2BVTA 1F3TA 4IX2A 1GTEA 1SO5A 2BTMA 5LSMA 3P62A 1KM1A 4X22A 1YEYA 1S1RA 2PF0A 1J0ZA 2A6LA 1PSCA 3N4FA 5M1TA 5CJMA 4JDYA 1PDYA 4QG6A 2J88A 3EPOA 1TTIA 5HQMA 3PZUA 3R13A 2ZUVA 2PDNA 8CGTA 2OO6A 5CPQA 1I60A 4R7OA 2ATMA 5F2LA 4AVOA 3W1PA 4S2BA 1Z8AA 3TSDA 5JIWA 1I2QA 3QQ0A 1XC4A 1YXYA 1ZY9A 2J4GA 1NF0A 2EKGA 5FAJA 4G5DA 3V0TA 1BF6A 3IUIA 3PWIA 4MWAD 4AWEA 1TJ2A 3VGGA 4M19A 3CWNA 4Y9OA 2GL5A 1PHWA 4A29A 2OB3A 1UASA 2ODOA 3IS4A 1MEHA 3GE7A 4KIEA 1EDQA 2P3ZA 3EDFA 3BL3A 1IEXA 4J7RA 3L4ZA 1OG0A 1HZYA 4KWSA 4ZQMA 1Z9AA 4CD5A 3CV1A 2BG5A 2PGEA 1O5XA 3C0QA 1H61A 3L4YA 4GE8A 2I9UA 2P10A 2VD8A 1WZLA 2UY5A 3CQ0A 3UCQA 3WDJA 3R0UA 4KMQA 1R7AA 1JCXA 1FWIC 3W2LA 4CNSA 5EMYA 4WXYA 4LVGA 1IF2A 8A3HA 1FRBA 1M7JA 2VWSA 4HJWA 2OYMA 3KWSA 3SJNA 5M03A 4Y90A 3BW3A 4UNLA 4CVWA 3TTSA 1E0WA 1UZHA 4H9YA 1AMKA 3ITLA 3W7PA 1UR4A 1H7XA 4IP7A 3L2LA 2WW5A 5A5WA 3WN6A 2ZC1A 1YHTA 3WLHA 1EGMA 1YNQA 3RLVA 2YOCA 1ITQA 3VDGA 2XISA 3G1DA 5AYIA 2WV8A 3ABRA 4X2PA 5EY5A 1TPH1 2D0HA 3C8FA 3TZFA 4ZO6A 4AZHA 4GKLA 2PP3A 1TTJA 1SO4A 1G0CA 3U48A 3LM3A 2ZXQA 4NJHA 2IKJA 1R3RA 4IMGA 1UWRA 2P3EA 1BEUA 4UZSA 3MUZ1 4HZ7A 3S42A 1A0EA 4PMRA 1DHPA 3WQDA 1PTDA 1HJSA 3N19B 4MJ4A 1RY0A 2NXGA 4DWSA 2CIPA 4CN1A 4RV8A 3VIJA 3O2LA 2RFGA 2DZUA 4JN8A 1NM9A 3QFWA 1S3TC 4TX6A 1QXLA 3PULA 5MKGB 3MCNA 2DSVA 3HF3A 4XAYA 3GHSA 1R3VA 2FZNA 3W1QA 4GACA 5F4SA 2X2YA 4E4FA 1EC7A 3A5FA 4EPBC 1H5YA 4BQ2A 3TIMA 2NV9A 3PVFA 4I3GA 2PUZA 5G2WA 4HCHA 1KM2A 2EJAA 4UR8A 1UHVA 3WNMA 3B0YA 4S3CA 3WUBA 4FI4A 3HQ1A 3PTQA 2PDQA 4WHBA 1P0KA 1JZ8A 5MKGA 2ZTJA 3W2NA 2OWWA 1VFOA 3AJ7A 2ZWZA 3ITVA 3BCDA 2OZTA 1ZSXA 4AHQA 1GOMA 2B7NA 3ZJ8A 5I03A 3C4UA 4Q6JA 1U5HA 2VX5A 3VNLA 5JVLA 1OFPA 3URNA 2VGGA 3THAA 4HYWA 2F6XA 4ATLA 3KW3A 3LBMA 1QPQA 4LPCA 4DY1A 1C93A 4HA4A 3HBLA 3SADA 1E70M 1TB3A 2QDDA 2HSAA 3CH0A 4JICA 1QPKA 1XS2A 1TVPA 1DBTA 3IGHX 4V2XA 4REQA 1J18A 3NG3A 1EOKA 3A9IA 4ZFMA 4IIDA 5DBUA 3T78A 3HPAA 3TXVA 3G77A 2IS7A 4I9JA 4GXWA 4XUGA 2WPBA 1M7PA 3VX0A 5E09A 2E5DA 1D3HA 2QF8A 3BLOA 2CLLA 3QKZA 3RN6A 2WMIA 2J66A 2Y8KA 3FEMA 1EJSC 4MY8A 2Z1SA 3HZ3A 1O94A 2W6RA 3KBSA 2OZ0A 4AFYA 1R0MA 2OKTA 5T8GA 2W67A 4DBWA 4GHRA 2ZZ4A 1J9YA 4KRTA 3GU2A 3H23A 4QAWA 1H50A 4O12A 3C52A 1IEIA 1Q3NA 2NQHA 4ALDA 5DXXA 5KZEA 1AK5A 5LHFA 4R9XA 1OWQA 4PRWA 4JFTA 5FEPA 7TIMA 3BAXA 3FJ4A 4MNMA 4P7NA 3CU2A 5C9XA 3WD3A 4RK8A 2EKCA 3LGEA 9RUBA 2DZBA 1OZQA 1MO0A 3PNUA 4AMAA 1YYAA 3G0XA 4R53A 3H26A 2P0IA 2Z29A 2WVVB 4O15A 1F6KA 3O06A 4HZMA 3C2OA 1WX0A 3MYPA 4C6CA 2PU0A 4CQ8A 3EOEA 3VOJA 3ZWSA 1GNXA 4B90A 3LHWA 3T8LA 1J6OA 2FB3A 2P1FA 5F2GA 5K2ZA 1ISWA 2A3CA 3S1VA 3WF1A 1ONEA 1PCWA 2A2IA 1KBKA 3QV6A 1JG9A 3VZXA 4HU8A 1O12A 2ISFA 5D09A 3L4VA 1XH2A 3N2MA 3W7JA 1JFHA 1KQZA 2DJXA 2VFFA 4GLEA 4J3WA 2Y88A 4C6JA 1M6JA 1PVNA 1QW8A 1SMAA 1GORA 1R2TA 1R5YA 3NXFA 5K9CA 1CXFA 4OECA 5AECA 2CFFA 1S38A 1A5KC 3CZKA 1DOSA 4JTLA 3EB3A 5FF4A 1W1A1 4PBFA 3OQ8A 3AWOA 1F73A 3GR4A 3O16A 3LRLA 4EANA 4PMQA 5A69A 4ZQNA 4MF4A 3KL5A 1WDQA 1W2VA 3GNNA 3NCOA 3WNLA 2QEZA 3H12A 4KWUA 4LY8A 4BI7A 4S3EA 1MNSA 2VC5A 1H41A 3GM8A 1EEXA 4QM1A 4UTIA 3W01A 4MLRA 3UG4A 4CU8A 2CC0A 5AFDA 5GJPA 3CQIA 1I2RA 3RCYA 1W1PA 1XLIA 1HNYA 3W88A 5KTLA 1C8VA 2DUZA 1W3NA 4C6OA 1WE5A 3WLQA 4GRSA 4JIEA 5JH1A 2XN2A 1GCYA 5I78A 3O6YX 3DFOA 3BURA 3PJTA 4J27A 4I5XA 4OTKA 1GG0A 1W9DM 1C8XA 3I6TA 3DERA 2VGIA 1G5AA 3ZVHB 2JBMA 2PDFA 1UOKA 1B9BA 3RPMA 2DJLA 1PKMA 3FKRA 3MKKA 3VXGA 2AKMA 3ZR6A 1DJHA 2ZC8A 2EF9A 3VUSA 1R3YA 1XLFA 3WLLA 2HMCA 4DXVA 4N4QA 4PL1A 4Q7BA 2AAMA 2WLZA 3OW1A 4S3JA 2Z2AA 3OPSA 1Q6EA 5E0FA 5A1AA 1LM1A 1LL7A 2VR2A 3WNKA 1WUFA 3XINA 1D7FA 1AJ0A 1JEZA 1M7XA 5K4XA 2Q6ZA 3UJ2A 1KR0A 1KFWA 2QUMA 3VK5A 1EH9A 5FL0A 4GOAA 4P8XA 2DEPA 4HHPA 3ABQA 1NU5A 1SR9A 3GWQA 1UROA 4WJ8A 2E3ZA 5BRBA 2EQDA 5A8MA 3VDCA 4DXXA 4IXXA 4JN6A 4I8DA 2NLYA 1H0IA 1UYQA 3UXLA 4LOCA 3S9ZA 2UY3A 4F2UA 1CGVA 4BCEA 1Y8BA 4PMDA 4DUXA 2XU2A 3E0IA 1QOPA 1QHPA 1JZ6A 1Y0EA 1OGBA 1K02A 3IIVA 3OGRA 2VEGA 4G1KA 3WLRA 2PF8A 2O9OA 4O8AA 2DZTA 1V4YA 1MW3A 3LS9A 1GVSA 5DRIA 4MSSA 2QVHA 5HJLA 1S2TA 2GQ8A 1CGWA 1E4IA 3W1LA 1DJWA 3LPGA 3P7YA 3BAKA 5C6MA 3U5YA 5AN7A 1EC8A 2HDJA 1OC5A 3GQYA 3W2MA 2BOFX 1AW1A 2C0AA 1OF8A 4EPEC 3CTTA 3FA5A 1JULA 4FXJA 3E2QA 4ROPA 4JCLA 3ABOA 3UEQA 1VBJA 3NFUA 3V18A 3VOGA 5H2ZA 1RALA 3KBWA 3QSTA 2JQXA 4I5UA 3WIJA 1RY8A 5D9NA 3URBA 3N17A 1BKHA 1C3FA 3BOXA 3UFYA 1DXFA 4IG2B 2D0GA 1W3HA 3HPSA 4WJEA 4ZTXA 1VFTA 2R1MA 3CUXA 5A6AA 1E9LA 1LYXA 2OG9A 1N8FA 4QCFA 4XAGA 3USZA 1I6NA 1K4HA 3W22A 1G4SA 4Q33A 1VFSA 4D6GA 4Q4RA 1IEQA 3S6TA 1MXGA 1YBQB 1XM3A 2ZX7A 3VNIA 4UFIA 2PB1A 3NZQA 5CAHA 2ISSA 1LL4A 1T0OA 2CLKA 3QF0A 3P5YA 1K8XA 2D3NA 3AXXA 3TTQA 4A2SA 2ZUMA 4XIMA 4I7VA 4IG2A 3RDKA 4J40A 5FACA 1LF1A 1QPOA 3O7UA 4Z2IA 2D2JA 3ALGA 3SCNA 1T8QA 2C3ZA 2IXVA 3CHFA 4EXAA 5ECVA 4DPQA 2Y5SA 1RBOB 2AL2B 7XIMA 3F4DA 1XL9A 4U10A 4RPQA 3N73A 5TNVA 4N9DA 1PUDA 1W9UA 4GNKB 3AZRA 4WKAA 5H91A 3LOTA 2GLKA 3NAVA 3VDBA 2OODA 3M0ZA 2VX4A 5GNXA 1WQ5A 4YHGA 1XFBA 2PWFA 3BGGA 1A5UA 2BWGA 4H83A 1UKSA 3LHYA 4LVAA 2OX4A 3FAWA 4P2VA 3K13A 3MMTA 4OWGA 1WBJA 3TR9A 3CMJA 1YTEA 1P6CA 1UOZA 5U4NA 3SN0A 3KOFA 2Q02A 3G3MA 3P2VA 3SAZA 3WJYA 1KKRA 3ONBA 4HSOA 2ZRYA 4KFNA 3VGFA 3GTNA 3P8JA 1XKYA 4AIOA 1ITCA 3TLLA 1B4EA 4Q8QA 5J04A 4M24A 1IZJA 1OFBA 4JHMA 2Y7GA 3BAJA 1CXEA 2AGTA 3IJ7A 4V1YA 2G3MA 1PZ1A 1GOWA 2QCCA 3UNTA 4QLKA 3VZYA 1FWCC 3BCFA 2J7BA 3HMCA 3L9CA 4GI8A 4ZQRA 2ZOXA 2FFIA 4MTVA 1AFSA 2G3NA 3W86A 3NSNA 3MA8A 3WF2A 4YVXA 3PZOA 1KCZA 3GW3A 3B8DA 1EX1A 1ESWA 2XUCA 2ABBA 2XVLA 5FF0A 3WBXA 2G4FA 3BLKA 1P1MA 3WH8A 1POKA 1J11A 4XWUA 4ZGYA 4NG3A 3ZQ9A 5FJTA 3COTA 3QGKC 4TVCA 3PTKA 2WMIB 6TAAA 1ZS2A 3GG0A 2XIBA 1UWTA 5HA7A 4MMWA 3TH6A 1TE1A 4O54A 1OC7A 5SWUA 3AHXA 3M5YA 2WCAA 4FMVA 3VIIA 1FHUA 1XYBA 4GQQA 1KTCA 2J79A 3K8LA 4BZYA 3TC3A 3OGSA 1LDCA 3B4YA 3F5JA 1DIOA 3TSMA 3OG2A 1SJBA 1NWUA 3LXBA 3G2GA 1Q13A 3P8IA 4UXDA 5D2TA 2CKSA 3SCOA 3AS2A 4FSAA 4DQWA 3G3DA 3L5LA 2F2HA 2WHMA 1T40A 3DHPA 3IRDA 4GY1A 4FB7A 3FGCA 4E0CA 4INFA 2OSXA 2D69A 4Q4QA 4U28A 5PTDA 3S5SA 2Y0FA 2WHLA 1XIBA 4QCEA 5BMXA 4TV5A 4HZ8A 4ECLA 3WG6A 4LT9A 3RHGA 1D3GA 3NZ1A 3WBYA 4CNTA 3FCPA 5CZTA 4JZ5A 1GK8A 3CHCA 3MZ2A 4RXGA 4XD4A 4UQ9A 4CNNA 3HGJA 3QZAA 5HBFA 1ICPA 3APYA 4LEFA 3B0XA 3OVPA 4LUSA 4IP5A 4JTUA 1J10A 1XDLA 2LLEA 2X09A 1GHSA 3TYBA 1TE6A 3JZUA 4B5XA 1XFCA 3FW6A 3N2BA 4P8VA 5AC6A 5FEXA 7CGTA 3SR7A 3BANA 4HOWA 3E9AA 4QSFA 4UTFA 2UY2A 1XICA 5I00A 3LG3A 4IH3A 1U22A 2B81A 4GK8A 1WA3A 3B8IA 3E0WA 3BW2A 4XTDA 4Q4OA 4TO8A 5L6UA 3GTIA 2WYSA 5DT5A 1Z3NA 3MI6A 2GJRA 1TQXA 1GKPA 1FXPA 3WLKX 4FLOA 3W38A 2V3GA 2R14A 4GYFA 3N9SA 1HJXA 4UTWC 1YE6A 3A64A 3GS6A 2VFDA 1OABA 1Y5XA 4L1GA 4XZHA 1UG6A 1PL9A 4O53A 3R0KA 4HBKA 3KTCA 1AA1B 1DV7A 5DCBA 1OBAA 4OUEA 3TYDA 1XG3A 5A8GA 4UOJA 1W3IA 1PX3A 2GVEA 4PTDA 3CUHA 1K6WA 1KC7A 2XH0A 3EWDA 2E25A 1IV8A 3GB6A 1JZ2A 2O4QA 3RIKA 3LERA 4HHLA 4Z1CA 4M1BA 5A2AA 3MZNA 4UQEA 1KV8A 4WY0B 1A5SA 3C86A 4NY2A 1MRAA 2VD9A 1PIFA 4NX5A 2DT2A 2D20A 3W7EA 3MCOA 5KSWA 1E9IA 4LU0A 4F0MA 2VQTA 1ISYA 4REQB 4LSBA 9CGTA 2Z27A 3P60A 1XIEA 3VKJA 4F79A 2PDMA 3GY1A 3BJSA 1MNZA 1QHZA 3T7VA 1H7NA 3OZPA 3BJFA 1UWSA 5DEZA 4DUOA 4WRHA 1BPLB 4LF1A 1YXCA 5DMMA 1R7OA 6REQA 1OX5A 2DQWA 3GVQA 3OVQA 3UESA 2HCVA 2I16A 3V3WA 1LZOA 3U3HA 4WJXA 2PGWA 3S1UA 5XIMA 4FAMA 4YTRA 1L6FA 4WSKA 1AQMA 3M6DA 4FNQA 4H7ZA 1J0KA 3M0YA 3S1GA 1NFPA 3VC6A 1KBBA 2ISVA 4TMCA 1XJBA 3HQOA 1TTPA 1E3ZA 3C0JA 3MUAA 4EOUA 3R4IA 3G1HA 5HINA 1RJQA 2OWCA 4D72A 1GOOA 3SCTA 3T09A 3GXDA 3IVSA 2F7FA 4H9XA 1FDZA 2VVSA 4S3DA 2BODX 2BGNE 3W6LA 3URAA 5C7VA 1W1TA 3HN3A 1RR2A 3EEGA 2RGLA 4RDVA 1TPDA 2GZXA 3AICA 1GQIA 3M44A 4LTSA 1UQYA 3EGJA 3WEZA 1XPGA 2CHRA 2QHAA 1I8JA 4ZE5A 9XIMA 1CDGA 4IFKB 4NL1A 4F2TA 3SQLA 1IQ8A 3S6DA 3BAYA 3LPOA 4U5KA 5LNUA 3VILA 4C6DA 2J7CA 4LB3A 1EJWC 1LQ0A 3LRKA 3DI0A 5HXMA 4W85A 4NZ1A 5KZMA 3W71A 2Q3OA 3T0AA 3N2TA 4NI3A 1CLXA 1F9CA 3IV8A 1W9BM 5D8ZA 2X42A 3MT1A 4EXQA 3PG9A 3WSUA 2CBIA 2FTWA 2Z2UA 3O0KA 2YCLA 3TYUA 4PSRA 4LUYA 2HE5A 3PBWA 2ZX5A 4LVDA 4B5TA 2PFHA 2BVDA 3GH4A 3AYSA 1EOMA 3R0DA 1UR2A 4B3ZA 3NR0A 4ERGA 3W87A 3O1NA 2INEA 5DO8A 3PUEA 1OIMA 1XF0A 3CUIA 3S5ZA 1XBVA 3NQMA 3L2IA 4E8CA 1VCFA 3CWHA 3HPXA 1CGYA 3Q65A 3WK0A 3WENA 3T0BA 2DZWA 4GUFA 1V0LA 3HJEA 5I3KA 1Q6OA 2REQB 3V4BA 1O68A 4YHEA 1LBLA 1EEPA 3UGVA 4NQ1A 3KDNA 1UWQA 2XWDA 4ML9A 2XH2A 3R12A 3T0DA 1W3LA 4O0QA 1H09A 4GYPC 4YYFA 8XIAA 3QC0A 2ZUWA 1H49A 2FKPA 2WSKA 4TVDA 3SI9A 2WNWA 3XISA 1UUOA 2A1YA 2YA0A 1TR1A 5LZLA 3E02A 2DUXA 5DMYA 5AC4A 2MANA 4GBDA 1EQCA 1JXJA 1PDZA 3TQVA 1PTGA 3O05A 2XJ7A 1F74A 2J77A 2FMOA 1WBHA 4LAKA 2Y1HA 3KZSA 3KRSA 5G4EA 4QE4A 3DOPA 2MUCA 3CIXA 5EMKA 3MO4A 3CM4A 3GHTA 4MLJA 4GVFA 3EMZA 2XH7A 4R9OA 1WKYA 2WLYA 2FTYA 2CBUA 1GYNA 4LNCA 5C9UA 4E4PA 2CHOA 3GFYA 3LCLA 3NIYA 4QE5A 3SUUA 1G4EA 2SFPA 4AX6A 4FX7A 4UTKA 5CZ0A 3ZR5A 4YCPA 1JR1A 3OLDA 3HQPA 3B0VC 4ZVJA 3WKZA 3EWYA 4PCPA 4LANA 1IIHA 3TAKA 1FWWA 4A8LA 4LS0A 2ACQA 4GUHA 4DUWA 2GDVA 4PSPA 4TU1A 1PX8A 4JTRA 1KFJA 4QBXA 4O1AA 2PDKA 3J7HA 1I4NA 4MPQA 2VDIA 5CPSA 3W7LA 4QLJA 3ZJ7A 4JNMA 3GNPA 4XZMX 4HT3A 5EPDA 3WCZA 4N2YA 3TDFA 5HNRA 2ZUSA 1EJVC 3NSXA 1W3KA 4S3FA 4IX0A 4YTSA 2B0MA 1IXOA 1M9HA 3RK8A 1WP6A 4B5UA 3VI2A 5U7SA 3SZ8A 2BFGA 3DHUA 2WPGA 1JD9A 2G0WA 2NXHA 4HK5A 3TN4A 3ARRA 4JQ3A 5CZKA 1BRLA 2PDXA 3JR2A 1J0YA 5HJXA 3NJ3A 2NUWA 4PODA 2O92A 4F0LA 1VB9A 3B8TA 3WMBA 5I6SA 5EFDA 4AEOA 1DWGM 3VGEA 2YDRA 4AIBA 3GO2A 1YDYA 5XINA 3AHTA 4LF2A 3USBA 2C0HA 4M8UA 3ENLA 2HBXA 2NQ9A 3A5VA 1GJWA 5K3VA 3K4WA 3RUBL