2XGIA

Crystal structure of barley beta-amylase complexed with 3,4- epoxybutyl alpha-d-glucopyranoside
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
487
structure length
487
Chain Sequence
b'VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical genetics and cereal starch metabolism: structural basis of the non-covalent and covalent inhibition of barley beta-amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 193
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgiA00
1J9YA 4LYPA 1G9HA 2PWEA 1X6NA 3ARTA 3AJ7A 3I3DA 4U2ZA 3ARUA 4W89A 3AMCA 2V3DA 3A4AA 3OGSA 1UOKA 1GCYA 2VUYA 4X0NA 1KB3A 1BQCA 3K4AA 1D2KA 3J7HA 3LPGA 4RL3A 1DP0A 3WL0A 1UUQA 2VZUA 5GNXA 1XCXA 3FXYA 3GXIA 2OYLA 4M29A 5JUVA 1PZ3A 3VGGA 2YBUA 3IJ7A 4D71A 3GNRA 3L4WA 1BPLB 1E15A 3ZJ6A 4PTVA 4UTFA 2BVYA 2CITA 2J74A 1V6VA 2G3IA 1XRVA 3WQ6A 5GNYA 3ZT6A 2VI0A 1C90A 1JXKA 2BY2A 3FAWA 1R8LA 3EDJA 1RH9A 3AHYA 1C8XA 2XVPA 4CVUA 1QI5A 3ARXA 2BHZA 1DTUA 3WDJA 4DM1A 1NQ6A 3G6MA 1V3LA 1MQRA 2OWCA 1GVYA 1KXHA 5C71A 2J79A 2VURA 4B15A 5JBFA 1HJVA 2VZTA 3WD4A 3W28A 1E0XA 1I1WA 4OJYA 2CHNA 1B3XA 3ARQA 2QPUA 1J0JA 4J3WA 4F79A 5I2UA 4J3SA 4KRTA 1ZBKA 2WKGA 4CCDA 3VIFA 2PBOA 1BHGA 4DWSD 2G8ZA 4UOJA 2XM2A 2WPGA 1IZKA 5BROA 3VIOA 3OZPA 3HJEA 4EANA 5E6YA 3VTRA 3GNOA 4E2OA 1W1YA 4XX6A 1HX0A 1PIFA 4WSJA 4W84A 1UQZA 1B3YA 3VDCA 1CGTA 3MSGA 1OINA 3RPMA 3SCWA 3NDYA 3VD7A 4ATLA 1HP4A 4MTVA 3PBGA 4QLLA 1QBBA 2ESCA 1L8NA 1XH1A 3ZJKA 3FW6A 1HKJA 2DQXA 4QCFA 3VIPA 3WUFA 3GBDA 1E4MM 2BY1A 4DWSC 3CUHA 1MW1A 2WVSA 2VQUA 4GIAA 3FHQA 3DHUA 4UQAA 1OBAA 3MV11 4DM2A 1JYWA 2J7HA 4BQ5A 4ZXOA 3VINA 5ABHA 3GYCA 3WNLA 4AWEA 1UYQA 4UR9A 4KH2A 3VX0A 4P7OA 3GM8A 2DT2A 5CGMA 1VRXA 4W7WA 1ZS2A 1DWJM 3CBWA 3SURA 1V0LA 4RE4A 3UR7A 3JUGA 3SCNA 2XSAA 2X0HA 3SUVA 2BFGA 2WMJA 1E5NA 2WMIA 4HZ7A 4PMXA 2Y2WA 4B16A 5C70A 3LPPA 4AZ7A 5HXMA 3TONA 3WMCA 3POCA 5I77A 1W32A 1JDCA 1VB9A 4AD1A 3W27A 4F8XA 5A8PA 3F4VA 2O9OA 3I3BA 3VUPA 2XYLA 4M80A 1HVXA 2WANA 1BGGA 3LMYA 4CUCA 3WUEA 2PC8A 1E72M 3WD1A 1KWKA 2DT3A 1UD4A 3GZAA 3VD3A 5CXPA 5FL0A 2A3CA 3WDHA 2O9TA 2DSKA 1KBKA 4D6HA 4OOUA 1CGWA 4LGXA 1JNDA 1W1VA 3UR8A 2E4TA 3BMWA 5EFDA 3A4WA 3QOMA 4F9DA 5GQBA 3WENA 3K1DA 3HN3A 3F5KA 4N0RA 3T0DA 4D6IA 2DH2A 1FOBA 3NSNA 2GJXA 2BNJA 5DT7A 4P7RA 1PZ2A 1CPUA 4HZ8A 5AC5A 5AYIA 1XYZA 1KR1A 2VZOA 1TMQA 1F4HA 3WQ5A 1J11A 1M03A 2PWFA 5M17A 1B0IA 1ZBWA 5LA1A 3CZGA 1GOKA 2XHYA 4UOZA 2XIBA 2X09A 1CDGA 3QR3A 3BSGA 1WZMA 1HKMA 4HZ6A 3W38A 2X8RA 3AS0A 1NP2A 1VJZA 3POHA 1HF6A 2RGMA 3FN9A 3NYDA 1V6UA 2VTFA 1UG6A 4LQ1A 1KR0A 1HL9A 2ZX9A 3TOPA 4AIOA 3QHNA 1LG1A 1W3JA 2WCSA 3T2QA 2YKKA 1EGZA 3VDBA 1J0HA 1TZ7A 3O9NA 1MQPA 3BSHA 2CERA 2BXZA 4FK9A 4J28A 1C91A 4ATWA 1WKYA 2QMJA 2WC4A 1R7OA 1XH0A 3SCQA 4UQEA 4JFWA 2XVGA 3ARZA 4WK9A 2D22A 2BY0A 5HOSA 2E8YA 2Y5EA 1JG9A 1UR4A 5JIPA 3THCA 1E56A 3WN6A 3WFLA 2WLYA 2ZWYA 3MSDA 2WBKA 5BRPA 1CYGA 4W86A 1FH9A 2ZX7A 2VT0A 5F7UA 2VMFA 4X9YA 4AZIA 2WZIA 1LJYA 2WNWA 3KL0A 1ISYA 3BMVA 4A4AA 3PTMA 1JYVA 4W88A 2A3BA 1IV8A 7TAAA 5M3WA 1XSKA 3B9DA 3ZT7A 5LA0A 1JF5A 1JXJA 1BTCA 1UA3A 2GK1B 2J8FA 1W2PA 3VIGA 3AHZA 1MVYA 3BH4A 2DDXA 5E9AA 2CYGA 2PWGA 1VBRA 1HJUA 2ZIDA 3WNPA 3A4XA 4CGTA 4NZCA 3ARWA 1YHTA 4CCEA 3OG2A 4EKJA 1CXKA 2DT0A 3VIHA 1TUXA 2AAAA 3SCSA 1OT2A 1NWTA 2IXUA 1UWIA 2VRQA 2DIEA 2J25A 5BXSA 3KE0A 1CTNA 4JFVA 2AOSA 3ARSA 4JKLA 3MMUA 3B9EA 3ARRA 2WHKA 2VZSA 2Y4SA 1EH9A 3RIKA 1H09A 4UFMA 2NSXA 2YL5A 1BG4A 1E1EA 1E71M 2XJ7A 2HISA 1X6LA 4XUYA 4BQ2A 4KRUA 4HP5A 3MUIA 3WMSA 4TVCA 5JBEA 3KZSA 3CHFA 4M8UA 2V3GA 2ZX5A 2QF8A 1PX8A 3PTKA 4H7VA 1BVNP 2FHBA 1UWQA 4P8XA 4P7QA 3UG5A 4TTGA 2E9BA 3AYRA 4D6JA 2FHCA 2ZE0A 1WDRA 2PBGA 2ZX8A 3WD0A 4Q22A 1NH6A 4AZCB 2ZXAA 2F61A 1GOOA 3DECA 4IUGA 2YLLA 2J62A 3VOCA 2ZUWA 1XGZA 1FA2A 3PZTA 4LPCA 1SMAA 2MANA 4D72A 1FH8A 2G3MA 4OBSA 1WZAA 3CHEA 1QNOA 3WH8A 1E9LA 3CHCA 3SUSA 4JZ5A 5A95A 5EB8A 3DC0A 3ZR6A 4D6CA 1LL7A 3OGVA 4JKKA 2AMGA 4GZIA 1BAGA 4L4OA 3RILA 1BYCA 1W1TA 3WH6A 4R27A 3EYPA 1SMDA 2W91A 3WMBA 4H04A 1E6PA 4AZBA 1ZBCA 3U5YA 4NSBA 1VEPA 3DYPA 4TVDA 4FF5A 1QVBA 2EXOA 1V6WA 3NDZA 5KEZA 3CUFA 5FOOA 1E1FA 1UD5A 4V27A 2CCRA 2J4GA 5E70A 1U2YA 4B3KA 2Y24A 1VFOA 5FKYA 3RM9A 2CPUA 2JF7A 4GI6A 1GVIA 2F8QA 3EMCA 2UY5A 3WEZA 1C92A 4XV0A 1OIMA 4PTXA 3CUGA 3CUJA 1FFQA 1PAMA 1BG9A 3T08A 5EBAA 1GUVA 5CPTA 1XCWA 5ABFB 4D6FA 2UY2A 1K9DA 3W81A 1WDPA 2XUCA 2BVDA 1DWAM 4QAWA 4ZE5A 3ZT5A 1I1XA 3MU7A 4YHEA 3TTYA 1NWRA 4V28A 3VIIA 1KQYA 3AISA 1GNXA 3CUIA 3VNYA 4W5UA 5HPOA 5E6ZA 1JD9A 1PEZA 1N82A 1E73M 3VO0A 3GXDA 4R5EA 3GH7A 5CG0A 2WC7A 3WNOA 1CLVA 2GJPA 1VBUA 3VMPA 4QLKA 1DHKA 1E55A 1US2A 2EPLX 4GZEA 1NP0A 4AD0A 1HN1A 5I6SA 3OGRA 1EHNA 4BQ4A 4MB1A 1JZ7A 2WMHA 1JF6A 1E70M 1H1NA 5DFAA 3ARVA 5D9NA 1XC6A 1RP8A 3W4RA 5DMYA 4JHOA 2VVSA 1BF2A 4MJ4A 2JE8A 1WNOA 5A2AA 2JEQA 4BF7A 1FFRA 1O6IA 1Q6FA 3IAQA 1OD8A 1EDTA 3WY1A 5DF0A 2BS9A 4AD5A 5A6MA 3FAXA 4M56A 4AC1X 3OIHA 2XPKA 1MW0A 3PZOA 1R86A 3NUKA 1GONA 1Q6DA 2W62A 4KGJA 2B31A 6CGTA 2GVYA 5KZ6A 4XB3A 1H11A 4UQ9A 4A3HA 1MYRA 1EDGA 2J75A 1CGXA 1UWSA 1LQ0A 3AICA 5CSUA 3NCOA 2W61A 5A8NA 2D0FA 4HOZA 3RM8A 7CGTA 2WB5A 1XD0A 2OSXA 4GQQA 4PMYA 1UR1A 1OM0A 2WHLA 3GBEA 4S3JA 1V03A 5A6KA 2XGIA 4GO8A 1CIUA 2EJ1A 4OIFA 3W6LA 4FLRA 1EDQA 2JIWA 2YA1A 3ARYA 1IT0A 2CEQA 1W9BM 2ZUVA 1ZJBA 4CVWA 1JDAA 3SEPA 3WQVA 3F5LA 1W3HA 3HMCA 4TX6A 5A8MA 4Q7NA 4C7FA 1SR0A 5DEZA 2IXVA 4MNKA 3T2PA 2GSJA 1W1PA 4UQBA 3VD9A 4PYSA 3L2LA 3WUBA 3AIUA 1E3XA 4HU8A 3EDDA 1LWHA 1SFSA 1KFWA 1VENA 5D8ZA 3E1F1 2G3NA 2V3EA 3OLIA 4C7DA 1UR0A 1EO5A 3AMDA 5IDIA 1E6NA 3AHXA 3S2CA 2WMIB 1BVZA 1L0PA 3G6LA 2JEPA 2J7GA 3L4VA 6A3HA 2BY3A 3N13A 3II1A 5I0DA 2D0HA 3VD5A 1VFUA 1JD7A 1ZL1A 1LF1A 4E8DA 3B8SA 1O7AA 1DWGM 2VOTA 4CD6A 1H5VA 1EOMA 1JL8A 1CENA 3VPLA 1ZBVA 4JCLA 1V3MA 3CH9A 4LYRA 1W3KA 3EMZA 1G5AA 1E6RA 4FLOA 3AZTA 1MW3A 1C93A 1DEDA 1LG2A 2XVKA 2VX6A 3SCRA 1WE5A 2FH8A 2XTKA 3M07A 3FHAA 1CXHA 1JZ8A 2ZUNA 5A6JA 4BQ3A 3N11A 4ZE4A 3KEHA 4AMCA 3IJ8A 4XZWA 2WYSA 5CJ5A 3MKKA 3PZIA 4OZOA 4PEEA 1ZJAA 2GFTA 1AVAA 3ZR5A 3W0KA 1E40A 4EE9A 1OD0A 2Q8XA 5EFFA 2DSVA 2WAGA 5DO8A 4CU8A 2PWHA 4JKMA 2CKSA 1UKOA 1CZ1A 4PMNA 3NSMA 4PMOA 4D1IA 3AS3A 4NF7A 4W7VA 1UH2A 1GZJA 4PUDA 2YLAA 4K68A 1QHPA 2EPNA 2D20A 1QNSA 3PZGA 2VR5A 1E6XM 1R87A 1GOWA 2DPEA 4GI9A 3N1AA 2W4XA 4W5ZA 4AW7A 2XG9A 4WKFA 4P8WA 4C7GA 4H8UA 4M81A 1DWIM 4IISA 5A6BA 4GQRA 3VVGA 3RJYA 2X2YA 1UA7A 2WVVB 2QV4A 3OB8A 4MB4A 2EPMX 3MUZ1 4ACZB 1V0NA 1HL8A 5BCAA 3GH4A 1QW8A 3MV01 1CXEA 4TUFA 4LYQA 1ITXA 4OBRA 3VGDA 3GNPA 2JALA 1EIBA 3WDRA 4UNIA 1UKSA 4FLQA 3DYOA 2EO7A 3RM4A 3WL1A 1JZ4A 1WDQA 3THDA 2CKRA 1JZ6A 1KGWA 3BLKA 3WSUA 2EQDA 3BC9A 3BGAA 1GQKA 1Z32X 1XSIA 3AIEA 3L4XA 3UESA 1UKTA 2VC9A 3VDAA 4JAWA 1C7SA 2DT1A 1J10A 3VNZA 4UZSA 3ZJ8A 3VKKA 1R85A 4N42A 4LXFA 4PMDA 2ZXQA 4PN2A 5LA2A 3W25A 3HU7A 3LPFA 1M7XA 3WQWA 3BAKA 3L4ZA 4M24A 2YBTA 3WNMA 1V08A 3GXMA 1VJSA 1G0CA 2CBIA 4QDMA 4V2XA 2FGLA 4E4PA 2VQTA 4E8CA 3CLWA 1EA9C 2PWDA 3MUAA 1JZ2A 1KCKA 5CPSA 1TFVA 5A1AA 3CZJA 1KWGA 3DHPA 5JIWA 1WCGA 2OYKA 4AY1A 4HA4A 1GJWA 2FGZA 1OGSA 3MS8A 3AHTA 4RE2A 5BRQA 1ISVA 4TXEA 1BSIA 3SUWA 4J27A 2WM0A 3VX1A 2E9LA 3BAWA 1PX4A 2VCCA 5IHRA 2BHUA 3BXWA 3WDPP 1C8YA 4CKQA 1CGVA 1G94A 1HP5A 1TG7A 3O2LA 4IM4A 4AXNA 4PRWA 3N9KA 2NW0A 4CN1A 2FDMA 5A8OA 3RO8A 1CGUA 2Z1SA 5IXEA 2OYMA 3UETA 3WDQA 1W2VA 1UR9A 3U7VA 1NOUA 3ZM8A 4F9JA 3OZOA 9CGTA 1B3WA 1E5JA 2WWCA 1AQHA 1V3JA 1LL4A 2WW5A 4HOXA 3TP4A 1MFVA 1TA3A 4D6DA 3TTQA 3MMWA 3WUGA 4FLSA 1UD3A 1JDDA 4UQDA 5BXPA 2A3EA 4Z2GA 3T09A 4OOZA 3N15A 1NOWA 2WMGA 5CSYA 4AISA 3CZ8A 3WIJA 1HT6A 2E3ZA 1B3ZA 1W9UA 3QHMA 4MNMA 4P7LA 3ZJ7A 5M5DA 3U57A 3WQ8A 1OCQA 1FP8A 1H0IA 5A3HA 1QI2A 4PMUA 3AXHA 4KWUA 1CWYA 2VCBA 4Z2IA 2JF6A 1UHVA 5AC4A 2WCGA 1W9VA 1UZ4A 2V5DA 4QLJA 3UEQA 4HPHA 1HXJA 4OKDA 2NT0A 2X0YA 3AFBA 4HTYA 5A2CA 2VZVA 2Z1KA 5M03A 2GK1A 4MB3A 5I23A 1FHLA 4UZUA 3BLPX 1RD6A 2D24A 4IPLA 2ZICA 1PBGA 1FP9A 1QW9A 2XVNA 3UG4A 1MXGA 2VX5A 4W7UA 4CD4A 4CN6A 4X0VA 2ZX6A 4CCCA 4EK7A 2XGBA 3K46A 1ZU8A 3APGA 4PMVA 1AQMA 1VEMA 2DH3A 3ZOAA 3L2MA 2A3HA 3K8MA 5BWFA 4H8HA 4HMCA 1E4NA 1WO2A 2WBGA 1US3A 2A3AA 3PTQA 4WKHA 4MPKA 1D3CA 1GOQA 4W87A 4J3UA 3WD3A 3AMGA 8A3HA 2XVLA 5A2BA 1CXIA 1GPFA 4DUWA 2J7EA 2D3LA 3SUTA 4UOQA 2UY3A 3W82A 5HBFA 3TTSA 2VO5A 3AHVA 1FH7A 1K9TA 3AIVA 1J12A 4TTUA 3S6TA 3T2OA 3WF0A 5A8QA 3W29A 5GNZA 2FH6A 4DWSA 2XM1A 4NRRA 3WF4A 2QPSA 1BLIA 5FL1A 2QHAA 3K8LA 4QP0A 3O6AA 2HVMA 4B9ZA 4GPNA 2EEXA 1UD8A 2VRKA 2F2HA 1CECA 4GKLA 1CNVA 2WMKA 1K9FA 4AZCA 4CU6A 3CO4A 1X1NA 1W9XA 4UFLA 1HJXA 2YDQA 3GDBA 1VEOA 4MNLA 3WF3A 1SYTA 2J8GA 4CN4A 1MFUA 1XHGA 2J7DA 4HU0A 2C0HA 1UZ1A 3N17A 5IFTA 5D9MA 3AS1A 4QFUA 2O9PA 3ZSTA 4HMEA 4D6GA 3PN8A 3L4UA 2YDRA 1K6AA 5BXRA 1QNPA 3KL3A 3AMLA 3CHDA 1M53A 2IUZA 2C8NA 1JI1A 2CBJA 3UCQA 2YA0A 1I75A 1J0ZA 1WDSA 3WELA 3KL5A 1V3KA 3IANA 2WSPA 3IAPA 1CXLA 1KBBA 1QI3A 2WKLA 2G4FA 3U7BA 3W24A 8CGTA 1C8QA 2DGAA 4U3AA 1XSJA 1UKQA 3MANA 3A6OA 1E4LA 5A69A 4AZ5A 4F66A 5D4YA 1G1YA 1GQIA 1J0KA 1Y7VA 3WNNA 1B2YA 3KWXA 2BVTA 5GPRA 1MQQA 2WVTA 1VAHA 1KQZA 2D3NA 1BYAA 3TA9A 3D5HA 4W85A 4MAZA 3WFZA 5ABFA 1EO7A 4W8BA 4U31A 1UR8A 1GW1A 4W8LA 4A3YA 3W53A 1OT1A 1B3VA 2UWFA 5FIPA 3VGBA 3NSXA 3BCFA 5LYRA 4URIA 2VCAA 3VMNA 3PHAA 4W8AA 5A6SA 4HMDA 4ML4A 4JL1A 2E9MA 5AY7A 2EPOA 1CEOA 4HPGA 4P8UA 3SCUA 2XFFA 5CGTA 4Z2JA 5A94A 1QPKA 2ZUUA 4LX4A 3W6MA 3BAJA 4QCEA 3DYMA 1B9ZA 2J7CA 3CTTA 3BCDA 2CBUA 3LPOA 1JYNA 1UKPA 4J7RA 3VMOA 1UWTA 1V0MA 1GHRA 4HOWA 1G01A 5CLTA 2J7FA 5ABEA 3VM7A 1VIWA 1Q6EA 2VX4A 1Q4NX 1ODZA 3CZLA 1J0IA 5I3DA 1JI2A 3FY1A 5C8BB 3AOFA 5A6AA 1HIZA 1BYBA 1UWUA 5EMYA 4PUEA 1XH2A 1B30A 1JAKA 3QOKA 5D8WA 4UFHA 2CNCA 2PB1A 4AEFA 1H2JA 3N18A 1NWUA 5HDRA 5IHSA 2XFYA 3ALGA 1VF8A 1UH3A 2X1IA 1ISWA 5TD4A 1UWRA 4WKAA 3L4YA 3W37A 4JL2A 3UERA 1QNRA 1RPKA 1W9DM 3WH7A 4RE3A 2UY4A 2WHMA 2DEPA 3M7SA 1ODUA 4PTMA 4TVUA 3ZQ9A 1W9PA 3W26A 4J3VA 1BGAA 4P7NA 1V3IA 4PMRA 1E0WA 2OSYA 2DIJA 4XZBA 5D9PA 4J3TA 2GUYA 2O9RA 4BZYA 2CIPA 1XV8A 2YIHA 1B1YA 5CQ1A 2G3JA 4PMQA 3AYSA 1MXDA 3VIMA 1ISZA 2D23A 4H41A 3WH9A 1KXTA 3SCTA 3WDIA 1YQ2A 2W92A 4H2CA 3I3EA 1UQYA 4CD5A 4B3LA 2ZUSA 4UFIA 3SCVA 2GJXB 2VX7A 2WZEA 2D1ZA 4IPNB 4ZENA 3AIBA 1ECEA 3ARPA 3AIQA 4PCTA 4UQCA 1V6XA 4DUVA 3IJ9A 3VGEA 3FNDA 3T0AA 2OWWA 5ECUA 5HPCA 2G41A 1H0GA 4CD8A 1UH4A 5E09A 5CLWA 4UFJA 4WF7A 2GDUA 1GHSA 1B90A 1B31A 1CXFA 3K4DA 3UG3A 4KMQA 1TR1A 4AYSA 4U2YA 1AQ0A 3AIRA 1OWQA 4PCSA 3SUUA 3WF2A 2ZXBA 3WH5A 3SCPA 1GQJA 1GOMA 3WQ4A 1HJSA 3AXXA 3ALFA 2WC3A 3AROA 3WBEA 5I24A 1A3HA 3AMKA 1MWOA 1V6YA 4Z2HA 5I5RA 4MB5A 1JZ3A 4WIWA 2OLHA 2ZWZA 1EXPA 4EAMA 4BCEA 2XSBA 5CZKA 5A6LA 5I78A 1QNQA 3MO4A 1EQPA 4GXPA 1JNEA 1R7AA 2CBVA 1KCLA 3GH5A 2OSWA 1GORA 3WBAA 1K9EA 4S3KA 1JZ5A 3AZRA 3RMEA 1HJQA 3ZO9A 1S46A 3VD4A 1E0VA 2J47A 2JFEX 2Y8KA 3GXFA 1ESWA 3U5UA 3PZNA 4OUEA 2W67A 4JFSA 1KXVA 3L4TA 2PF0A 3EBVA 4ZXLA 3A3HA 1H4PA 2V3FA 2CESA 5E0CA 1E6ZA 3CZEA 1J0YA 1DWHM 4PBGA 1CBGA 5FCZA 3ECQA 4MDPA 1P6WA 5AYBA 4Y7EA 1KGUA 1TA3B 5D9OA 4CD7A 3OLEA 1E4IA 1JYXA 4AD2A 1GQLA 1BYDA 3CIVA 1JFHA 3RDKA 2W5FA 1ITCA 4GI8A 2EPKX 3CZKA 2EBNA 1V02E 2GDVA 1HKIA 2WVVA 1J01A 4ACZA 4HA3A 2ZOXA 1JGIA 3ZIZA 4GO9A 1PX3A 1HVQA 4L4PA 2VL4A 1WB0A 3AS2A 4JFTA 2CXGA 4PTWA 4Z2LA 2YA2A 2YL8A 1QI4A 1FHDA 2XFRA 1HKKA 1NM9A 1TCMA 4M1RA 3VILA 4D1JA 2XIIA 4U3CA 1VFMA 3ZSSA 4JIEA 1MW2A 1U33A 3TTOA 4JCMA 2WHJA 2BXYA 1VFFA 1NARA 3VDHA 4BA0A 4H8VA 4YHGA 3M6DA 2WCAA 3SCOA 3WF1A 1PJ9A 2YDSA 2OWXA 1CGYA 1PIGA 4AZ6A 2CETA 2VVNA 1GOIA 2XWDA 1E6QM 3RCNA 1ZB5A 1NWSA 3D3AA 2YL6A 4ATDA 1PPIA 2V38A 3VIJA 3PZMA 2V5CA 3PZUA 3PZ9A 1H41A 3T0BA 5BYWA 2WSKA 1C7TA 2GJRA 2O92A 4MJ2A 1XD1A 4MNJA 4WLCA 3OBAA 1E43A 1JFXA 1QBAA 2E40A 2PI6A 1OSEA 3CPUA 5CPQA 5I79A 1H3GA 4W93A 3VGHA 3AI0A 1E6SM 3CGTA 4YPJA 4AD4A 4NRSA 1JIBA 2TAAA 3M46A 4MDOA 1QHOA 1J18A 2X05A 4U5KA 5A6BD 7A3HA 4BS0A 1UD6A 1EQCA 1Q6GA 2XWEA 4WJXA 2VNCA 4DWSB 4MADA 1LWJA 4TX8A 2W63A 3WNKA 3EDKA 4P8VA 3VIKA 2D2OA 1WPCA 3ZMRA 4DUXA 4U33A 2VJXA 1OGGA 4GINA 1W91A 4PSRA 2ZUMA 3BAXA 1OGBA 3B9AA 4KGLA 4GZJA 5BXTA 2D0GA 3WD2A 2ZUTA 1WAWA 3BAIA 1GJUA 3WKZA 1QHZA 1Q6CA 3AQUA 4ACYA 1UD2A 2WMFA 4AEEA 1DWFM 1TVNA 2E8ZA 1XYFA 1F4AA 2YOCA 1OB0A 4AZGA 5JBDA 1RP9A 2J77A 3SIMA 1ISXA 2W66A 4UFKA 1TVPA 1C3FA 1TE1A 3WEOA 1A47A 2VRJA 2QLYA 4D6EA 2JIEA 4WSKA 1KGXA 1NOFA 3VM5A 3IK2A 4CU7A 1BFNA 1EHAA 3MMDA 4FMVA 1CLXA 3BAYA 3EDEA 3QHOA 1V0KA 5ABGA 2DSWA 2WVUA 1H49A 3MUY1 1U30A 2VR4A 2J78A 2YL9A 4YN5A 3NIYA 1QOXA 5E0FA 3RJXA 3AIWA 1M01A 2J7BA 4MAVA 1JAEA 4AIEA 2BV9A 3OLGA 2WZHA 4U5IA 2DSUA 1KXQA 1AMYA 5FD0A 1WZLA 4JHZA 2FHFA 1EOKA 3OA5A 3F5JA 2C7FA 3A47A 4UCFA 1D7FA 5IFPA 3PZVA 4ZEPA 1M04A 2YJQA 4AD3A 2WLZA 3EDFA 2E0PA 3K8KA 3VU2A 1LLOA 1W3LA 4ZFMA 1WP6A 4J3XA 3WEMA 1HNYA 4NI3A 1HJWA 3NJ3A 3QGVA 2WK2A 3CMGA 2NT1A 2QMKA 2WWDA 1E3ZA 3CMJA 3GTNA 4PMZA 4AZHA 1WZKA 1OIFA 1V3HA 4AIUA 2RGLA 4HA1A 5HNNA 4B9YA 1V02A 4TOQA 4Z2KA 4JFUA 2CHOA 3AXIA 1UR2A 2WXDM 1QI0A 3N12A 2BHYA 2Y8VA 2ZXDA 4M82A 3OLDA 4PSPA 3AZSA 1IZJA 2DSZA 3PZQA 1LL6A 6TAAA 3EMQA 3VGFA 3N04A 5DT5A
chains in the Genus database with same CATH superfamily
3MB9A 1W3NA 1YKWA 2IMRA 1FXPA 4YNGA 5D32A 3W23A 3ARTA 2Y6ZA 1TWWA 3L0KA 3ARUA 2X1TA 5AHLA 4K8EA 2G97A 4OE7A 2H3DA 3ERPA 2VUYA 4X0NA 3WK2A 1ZJHA 3K4AA 4PTNA 1H62A 4N6FA 4Q8MA 2RFGA 4TO8A 2VZUA 2CZEA 2L5HA 1XCXA 3O8AA 2Z1BA 2OYLA 1KRMA 4C5ZA 3OQ8A 1V79A 3L4WA 1A5MC 1E15A 2ALDA 1FKXA 2QCDB 4UTFA 2BVYA 1TTPA 3AYVA 4ERGA 4GUHA 5GNYA 1XI3A 2ZC8A 2DZUA 1VH7A 1XFBA 3V5FA 4NNBA 4GUJA 4B5UA 1R8LA 3A9BA 2NV2A 1ZZMA 1RH9A 3AHYA 4O4VA 4C90A 2Y70A 3ARXA 3KRSA 2BHZA 1DTUA 3L5LA 2H8ZA 4WRHA 1GVYA 5G2IA 1EX1A 3IJQA 4B15A 2E6YA 4EOUA 2NLYA 4YLWA 1KM1A 3C86A 1B3XA 1YPFA 3LYEA 3PS7A 4F0HA 2QAFA 3VIFA 3W00A 4UOJA 4DWSD 2XM2A 2WPGA 1IZKA 3PBMA 1U5VA 3VIOA 1FTXA 3HJEA 1UUMA 1FDZA 3VTRA 3GNOA 4FIRA 2PGEA 2REQA 1UQZA 5D05A 3MSGA 2OMAA 1PKNA 1SO6A 3HQNA 3RPMA 1FWSA 3GAYA 4ATLA 1G4SA 4QLLA 3TX9A 3QQWA 1K8XA 2A1YA 4HMNA 1HKJA 4G8TA 3UZWA 3G1SA 4DJEC 3C0JA 3GBDA 1XM3A 3CUHA 1H7XA 2VQUA 4GIAA 1R3QA 2WJZA 1Y65A 3DHUA 2ZRUA 1J5SA 2GYIA 1RJPA 3MV11 4Q8NA 1WUEA 2IKGA 1DYSA 3WNLA 5M1TA 4KEMA 1VLWA 2D2JA 3CQJA 4UR9A 5HWJA 1WOAA 4W7WA 1A0EA 3CBWA 4ZL1A 3T42A 3UR7A 3RN6A 3SCNA 5K9CA 3SUVA 3Q4DA 1PZ0A 3W7RA 2WMJA 2DJLA 3BVJA 3ATZA 4B16A 5C70A 4QQUA 4UIOA 2P8BA 3VKJA 2QDGA 3LV6A 5I77A 3V0UA 4AD1A 1JPIA 1VJIA 2ON3A 5D30A 2PDUA 4IP5A 5FSDC 3VUPA 3B4YA 4EACA 4M80A 1HVXA 1PHQA 1BGGA 3LY0A 4MLRA 4DB7A 3NTYA 1KWKA 3VD3A 2G37A 2CZVA 5FL0A 4ADUA 5C2GA 2O7QA 4GYPA 4D6HA 3M0MA 4L6DA 1O5QA 1CGWA 3M41A 1JNDA 3GUGA 4S3GA 4WSHA 3V4BA 1OEPA 2PTDA 1W1VA 1XFCA 1XGEA 2E4TA 5EFDA 1EBHA 4F9DA 5GQBA 1AW1A 3F5KA 4N0RA 4IJRA 4WGHA 4IPJA 4YTSA 1FOBA 1QOQA 2Y5JA 1O12A 2BNJA 5DT7A 3T81A 5AC5A 1PZ2A 3W71A 1TE6A 5AYIA 4HKPA 2HTMA 1KR1A 1F4HA 1PB0A 1J11A 2PWFA 2PF8A 3GQYA 3EWUA 3WLSA 3A5FA 3CJPA 3UBPC 2XHYA 4GCXA 2X09A 3FA3A 1TJRA 4DXVA 1HKMA 1PTGA 4OFCA 3W38A 3M0LA 1R38A 4RJEA 5I3IA 5EMUA 3W73A 1VJZA 2RGMA 3IUDA 4XD4A 2D2GA 1HL9A 4OTKA 4AIOA 3QHNA 4BI6A 1LG1A 1W3JA 2Q8LA 2ZZ4A 4OVXA 1EGZA 1TZ7A 1QASA 3PANA 1A5OC 1US0A 3F4DA 2QMJA 5H8UA 1YTDA 1XLCA 3WZ0E 3SCQA 3CB3A 4C6DA 4UQEA 3ARZA 4WK9A 2PTXA 2BY0A 5C55A 1FCBA 1JG9A 5JIPA 1R2SA 4WEVX 3THCA 2WBKA 4DRSA 1J79A 1EC9A 4B2DA 2Q09A 5F7UA 3MT1A 2DU2A 2QCEA 5KZEA 4AZIA 2OT1A 4L6HA 1KC7A 5LGXA 4A4AA 2A3BA 1VD6A 3VA8A 1XSKA 1C29A 4XD6A 3UY8A 3AHZA 1MVYA 2GJLA 4AC7C 4JGDA 2PWGA 3BK0A 3R10A 2AQOA 1SO3A 4CCEA 3H4XA 1CXKA 3HGSA 3VDGA 2AAAA 2HV5A 3C2VA 1GKRA 2VENA 2DIEA 5CC5A 1CCWB 1XL9A 4JKLA 2C1HA 5MKGA 4MM1A 4F40A 1XDLA 5FJIA 1YDYA 3GX9A 4D8AA 1XYLA 1H09A 3QR0A 2NSXA 3QZEA 4H9YA 2YL5A 4GBDA 1E71M 5F2MA 2HISA 4K8HA 1ML1A 4XKYA 3C6CA 1DQWA 4BQ2A 4HP5A 3MUIA 4CEXC 2V69A 5AZ0A 7ENLA 4PZVA 4TVCA 3TN6A 3CHFA 3W74A 2ZX5A 2QF8A 1PX8A 1RR2A 4P8XA 4TTGA 1VHCA 1QO5A 2Z7KA 2FHCA 2XZ9A 2ZX8A 4AZCB 4CNUA 3OOQA 3DOPA 4MKSA 1X6UA 5HJYA 2XIOA 2YLLA 3BW2A 1TV4A 4JIIX 1S1RA 2J62A 4IIBA 1GVFA 2ZUWA 1XGZA 3PZTA 3G1XA 3C2OA 3WLMA 4IX0A 1FH8A 2OB3A 1E9LA 4JZ5A 1OX6A 4G2DA 3DC0A 2Y62A 4D6CA 1LL7A 4KRZA 4JKKA 1IR1A 3GG7A 4L64A 1O95A 1M65A 3WH6A 1YLVA 2Z0IA 1XLKA 3G1FA 3ZVIA 3T8QA 3WMBA 1E6PA 1VBGA 4UCGA 3THUA 4NYUA 4FF5A 4IZGA 4TVDA 5EMLA 5JH1A 4H9VA 2EXOA 1V6WA 2B7OA 1DOSA 2Z2AA 5LZLA 3CUFA 5FOOA 3UWWA 3MCOA 1MI3A 4B3KA 1YADA 3UJSA 1VFOA 3C0QA 5FKYA 2HSAA 3RM9A 5C9WA 5DQPA 3EPMA 4XV0A 5AHMA 4KIEA 4M6VA 3W1MA 1PAMA 1PXGA 4D2JA 3T08A 3E2RA 3M6YA 4WY0A 3CL7A 3QQ1A 1WDPA 3Q45A 2XUCA 4WZHA 1TTJA 3R7MA 2BVDA 1DWAM 1IEQA 3TN5A 4ZE5A 1VR6A 5IBXA 4A22A 4U10A 1QK2A 3EA2A 4Y6GA 1EP3A 3CUIA 2YCLA 3IGXA 1NY1A 4ZQNA 1IE7C 5E6ZA 4HJFA 1N82A 2DZBA 3GXDA 4JEQA 3T7VA 4R5EA 5CG0A 1CLVA 1VBUA 4IT1A 1DHKA 1K03A 1FUYA 4A2RA 2EPLX 2NVDA 1HN1A 1EHNA 3LLDA 3DCPA 4NIRA 5DMYA 4LYKA 4MUZA 2CLMA 1BF2A 1HGWA 1XIGA 4ASTA 3R5EA 3KP0A 1PO9A 2JEQA 4BF7A 1O6IA 3IAQA 4AY8A 2OOGA 4AD5A 5A6MA 4AC1X 5AHIA 1V7AA 4L61A 2NQZA 3P80A 2W62A 2WPBA 2XSXA 1SW7A 4NZ4A 2J6XA 5CKSA 5HNRA 1EDGA 2J75A 1LQ0A 1W5MA 3CT2A 3M0YA 1L6GA 3S2JA 1ADDA 3TQ0A 2QYGA 2W61A 2REQB 4HOZA 3V35A 1L6WA 6REQB 3KHDA 2HCVA 1UR1A 1KV8A 3LTYA 1V03A 4MSSA 2XGIA 4OIFA 3LBMA 3NQBA 2JIWA 1IT0A 2JGYA 4CVWA 3EB4A 3WQVA 2QGYA 3F5LA 1FWEC 4Q7NA 4I90A 1OADA 2IXVA 1W1PA 1ONEA 3EOSA 3L2LA 3WLKX 4MLJA 2OZTA 4YTRA 3FJ6A 1LRNA 3IIXA 3UA3A 3UYCA 3AMDA 1BVZA 3OBKA 4L6OA 3MBDA 3S5NA 3N6JA 1L0PA 5CC6A 2NWSA 3W1TA 3N13A 3DG6A 5I0DA 3T6CA 3W7PA 5D2YA 1NU5A 2D0HA 1VFUA 2IQ0A 1JD7A 2WJEA 4NU7A 4LH8A 4E8DA 1DWGM 2ZZ5A 4A3QA 3VABA 1H5VA 3CH9A 4IFKA 1W3KA 2AQVA 4PULA 4Q4QA 3AZTA 1K02A 1MW3A 3BL3A 3NXFA 1DEDA 4O57A 2FH8A 3P5ZA 3M07A 1A80A 1CXHA 4CEUC 4JQ2A 3RF9A 4ZE4A 1IZCA 4AMCA 2WQPA 3IJ8A 4NZ3A 3PZIA 4OZOA 1ZJAA 1PVNA 2C0AA 3PAJA 4K7VA 1E40A 3SQLA 2PA6A 3C2RA 3SRHA 1PE1A 2DSVA 2WAGA 1TZZA 1L9WA 4JHMA 4O14A 3OP2A 4JX6A 1Q63A 4PMNA 4S3AA 4NF7A 4AG0A 1UH2A 4PUDA 2YLAA 1SUXA 1GVOA 1XLEA 3YPIA 3VNJA 1GOWA 2DPEA 2FFCA 4GI9A 4W5ZA 3W7NA 3QW4B 1PYFA 4WKFA 4C7GA 4FO4A 4FSAA 1RHCA 1UA7A 4TV5A 4MB4A 3P62A 4E2VA 2EPMX 3MUZ1 4ACZB 3CV6A 5BCAA 1ZY9A 1QW8A 3MV01 4O52A 4O11A 4PODA 4TUFA 3W02A 1ITXA 3TE9A 2GOKA 3VGDA 1VFTA 1EIBA 1XBYA 5HWMA 4NG3A 1VPXA 1AD4A 3PUGA 4REQA 3RM4A 4LJ3A 1OF8A 4FNSA 4O28A 3THDA 2CKRA 1KGWA 3WSUA 2BOEX 3BC9A 3NQVA 4EF8A 3SBFA 1XPGA 1J10A 1JR1A 3DXIA 4UZSA 2V81A 3ZJ8A 1R85A 4LXFA 5EU9A 3B0UX 4PN2A 5LA2A 3W25A 2D2HA 3W87A 1I8JA 2YBTA 2R14A 3WNMA 3L7RA 5AN7A 4QDMA 1AH0A 3LTPA 1EA9C 2OR2A 3MUAA 1W8SA 1KCKA 2R8WA 5A1AA 3L68A 1FHVA 1EJSC 2QUTA 2UZ9A 2BGQA 3PBYA 3DHPA 5JIWA 4IJCA 3T0TA 1O5RA 3TSDA 3I65A 3AXKA 3URNA 3MUCA 4DBWA 2Z26A 3SUWA 1TQJA 3DFSA 4LANA 3U2OA 2P3EA 4GMEA 4HHLA 4Y90A 3GG1A 3RO6A 3KTCA 3SQMA 4O8RA 4ZO8A 2VCCA 3CM4A 2WNQA 2A7RA 4LVBA 1DIDA 5BRBA 1G94A 4IM4A 4AXNA 3A64A 1DBTA 1CGUA 1P48A 4LUJA 1F8MA 3FA4A 3TYUA 2Z1SA 3EWBX 4GE8A 3F03K 3UETA 1ALDA 1W2VA 1FWDC 3OO2A 3ZM8A 2OXNA 3BJTA 1KTCA 3MWAA 3SN4A 4GYJA 1R3RA 4D6DA 2OEMA 2PP0A 4DPQA 2Z6IA 3GTHA 1JDDA 1GJPA 2QT3A 4UNLA 1V6TA 1IXOA 5MF5A 4OOZA 3N15A 3H8AA 1KFLA 4AISA 3FS2A 3QC3A 2H9AA 1KO0A 1B3ZA 3QV7A 2X16A 1LQ2A 4P7LA 1XRTA 3ZJ7A 5M5DA 4O10A 1XBVA 3SM0A 3LI0A 2OVLA 3U57A 3S1WA 1LUCB 1OCQA 5FEWA 4C91A 5EGRA 4KWUA 1SJBA 4GQGA 5AC4A 2WCGA 2MUCA 3VOJA 1W9VA 2C79A 1UZ4A 2V5DA 1W6TA 4F48A 4PRRA 5E93A 1M5WA 4FF7A 3VZXA 1T40A 5KSWA 4RNHA 2P10A 5I3KA 2VYOA 5I23A 2VWSA 2PE4A 3FK4A 2HVOA 2YPIA 3ZWSA 3PK7A 1P7TA 1EZWA 3ITOA 2VX5A 3H2AA 4CN6A 4X0VA 4LNYA 2PC4A 1ZU8A 3ZOAA 5F1VA 1W56A 5BWFA 3PY2A 1WO2A 4UR8A 2O56A 5KINA 4W87A 1SU5A 4UWMA 3AMGA 2XVLA 4IMDA 2D3LA 5JMUA 3LXBA 5D2XA 4QNEA 2OO0A 3NGFA 3IRDA 3DG7A 4TTUA 3T2OA 3WF0A 2PGFA 5A8QA 4GX9A 4IP7A 4INFA 4DWSA 3LXAA 4Z17A 4DHGA 2UV8G 1XR2A 2DIKA 4B92A 5AHFA 1J6PA 3O6AA 1C9WA 1OY0A 1D8WA 2HVMA 4GPNA 2EEXA 1UD8A 5BOFA 1V8EA 4YS1A 4CU6A 4AYGA 2VGBA 1OVDA 1W9XA 4UFLA 2OELA 4JEJA 3GDBA 4LS0A 1HO4A 4D9PA 2J8GA 4ZOEA 4C6CA 2A79A 3GVWA 1GK8A 1XCFA 1XHGA 3BPWA 4FXSA 4F3HA 3N17A 2OZ8A 4HMEA 2PLCA 3EXRA 2YDRA 5BXRA 3DGRA 1J2BA 2IUZA 2C8NA 1V51A 3Q94A 1LT8A 1YBQA 2DVXA 1I75A 2C16A 4C6QA 3UZJA 2WKLA 5E9XA 2QW5A 3W24A 2ACRA 2DGAA 4Z1BA 1XSJA 4OV4A 4I5UA 3LLXA 3CASA 2YB4A 1I2QA 3E74A 4F66A 4KCWA 4HHHA 4L9ZA 4F2BA 3GDMA 1B2YA 2AGTA 5GPRA 1MQQA 4AF0B 4ZBCA 3IIZA 1F2JA 2D3NA 1UJQA 1BYAA 3UR5A 4PFMA 1KKRA 4C6MA 4LAMA 1NIUA 4IUOA 5ABFA 2Z25A 1BTMA 1UR8A 1GW1A 3MHUA 1Z6KA 1B3VA 2BMBA 4RV3A 4ZQPA 3PM6A 5FIPA 2F38A 3ZYZA 2C14A 5LYRA 1V5XA 2PTZA 4AX7A 4W8AA 4DXKA 5A6SA 3W1LA 4GGHA 3H2CA 1CLKA 4KEZA 1UBPC 4MZ1A 3QY7A 3EWDA 3GDLA 2E9MA 3RCMA 3NURA 1CEOA 2OGJA 4P8UA 5HULA 2AMXA 4Z2JA 5A94A 4GFIA 3T05A 2ZUUA 4LX4A 3AXMA 4GNJA 3DYMA 1B9ZA 3E38A 2BGNE 3E5PA 4HPJA 3ZWTA 4DBSA 1W5OA 3LPOA 1HUVA 5CPNA 3VMOA 4XUGA 4MWAD 3KLKA 3QYSA 4IGSA 4IFOA 2IKIA 3KOWA 3USZA 5CLTA 2QXWA 3C56A 3QGAC 3HA1A 2E5DA 2VX4A 3BLLA 1GEQA 1ODZA 3CZLA 3SECA 4ZFCA 1T7LA 3H7RA 4MY9A 1ZFJA 4RW5A 1XX1A 3OYZA 4MG4A 5D8WA 2INEA 1XIEA 1TZ9A 4IIEA 1JCYA 3MDWA 2GVJA 1DJHA 3JVAA 3N18A 1NWUA 1F73A 3ALGA 2P0IA 1UH3A 4Q32A 1KLZA 1RPKA 4IG2A 1TTQA 4XD3A 3DC8A 3STFA 3PFRA 2GVGA 2UY4A 4RE3A 1PZ1A 2WHMA 4DYJA 3NVTA 1ODUA 3G0SA 2Z27A 4FXRA 2I5GA 1W9PA 1A4MA 2ZDSA 4EPBC 1E0WA 2DIJA 2OSYA 5D9PA 3WLRA 3NQ6A 4LCQA 4AMAA 4A8RA 2CIPA 2GGIA 3B40A 1H61A 4BJHA 3OYXA 5B80A 2GWGA 1KCXA 3C4UA 3WDIA 1R6WA 1YQ2A 1H1ZA 3NM1A 1AZ1A 1XIHA 4WXYA 4JDYA 3WK0A 4CD5A 4B3LA 4JN8A 2Y7FA 3W1AA 1XYCA 5FACA 3W2NA 1QMLA 1XPYA 4JTTA 3AIBA 1ECEA 3WJYA 2BSLA 3IJDA 1V6XA 4OWGA 4TR9A 4UQCA 4DLMA 4DUVA 3PJTA 3VGEA 1GT8A 1MZRA 3T0AA 1TQXA 3EA1A 1ME9A 2G41A 3NQ8A 5T9BG 5FSEC 1QFEA 4CD8A 5AYXA 3N2CA 4UFJA 3S6OA 1ZGDA 1B90A 3GU2A 4IH3A 1W1A1 3AJXA 1IXPA 1IEIA 3U2CA 3MYPA 1UZHA 1EGMA 4PCSA 3G24A 3SCPA 3V5CA 4X60A 2FKPA 1K77A 4HN4A 5HNTA 5CZTA 2A6LA 3HG5A 4FOUA 3F4NA 5I24A 4DNMA 1MWOA 1V6YA 4JQ3A 2H3BA 4WIWA 2OLHA 2GSEA 1AQFA 1EXPA 2XSBA 5CZKA 2YZRA 4ZZ9A 3UXAA 4YL2A 4BWLC 1JNEA 1R7AA 3GH5A 2G96A 3QPEA 3DI0A 3DU0A 3ZO9A 4ZTYA 3GXFA 1ESWA 3N2OA 1A5NC 4XIMA 1HO1A 1KXVA 1EEPA 4LAKA 1LORA 2YSWA 4DBEA 4L65A 1K4HA 5AC7A 3U8GA 4GQBA 4PBFA 6XIMA 3OLEA 4PR4A 7REQA 4EXAA 1BYDA 1UWAA 1OK6A 1JFHA 2VC5A 2W5FA 3LUTA 4FP1A 3W22A 2H9AB 4J2MA 2DUXA 3E02A 1GYMA 2VP8A 4NUWA 4RZ4A 1HVQA 2YX0A 2H90A 3AO0A 2VL4A 1WB0A 2A4AA 4G5DA 3U48A 3AS2A 4B5XA 4PTWA 3HPFA 1JVNA 4AVNA 1AA1B 1KM6A 2Z1WA 2XFRA 4LUTB 3D47A 4IXXA 2OPJA 2FZDA 3A23A 3GC5A 4JCMA 2BOGX 2WHJA 4B5NA 3PJXA 4EVZA 4JTLA 4BA0A 4YHGA 3M6DA 3SCOA 5C9ZA 3WF1A 4YCPA 1WKFA 4BI7A 1DJIA 4FOKA 4IQEA 4X61A 1JCLA 3CIXA 3RCNA 4KETA 4JTGA 3ELFA 1M1BA 2Z29A 3VIJA 4M7TA 3PZMA 1VFHA 2GUUA 2NXIA 3OEXA 1G4TA 2O92A 2GJRA 4PE8A 4HCLA 1QBAA 4S2CA 2C18A 5CPQA 4KF1A 4WJEA 3AI0A 1E6SM 3NGJA 1P43A 4AD4A 3TYEA 1JIBA 3ZS4A 2TAAA 4PH6A 3EOEA 1QHOA 3TW6A 3ANVA 2X05A 2BODX 4BS0A 2OEJA 1UD6A 2ZRWA 4XO6A 1EQCA 3L5MA 3WQPA 2BASA 1X7FA 4ZA0A 4NL1A 4DWSB 4TX8A 1VRDA 4H3DA 6ALDA 3EDKA 4ILSA 4P8VA 2ONEA 3RR1A 2D2OA 4R88A 5T91A 4GINA 3SY1A 3B9AA 5F2GA 2D0GA 3N4AA 5KTLA 2ZUTA 1TWDA 1GJUA 3WKZA 4FNQA 3LRLA 1OYAA 4GYPC 1AL7A 2DV0A 1BXBA 3VOGA 2E8ZA 1F4AA 2VEFA 1VPYA 1RP9A 2J77A 4HNNA 1TVPA 2NX1A 3NR0A 4D6EA 4DJDD 1YBQB 2R91A 2VM8A 3SAZA 4UBPC 1EHAA 4EPKA 1CLXA 3BAYA 1ITQA 1V0KA 4IIFA 5U7SA 3W7DA 2E25A 2Q3RA 2YCJA 2DSWA 2Q02A 2GQ8A 2J78A 5HQLA 1ZENA 3NIYA 1QDSA 5LXXA 3K1GA 2J7BA 3GYEA 3V36A 3TSBA 2CHRA 4Q7IA 2FHFA 4JYEA 4U28A 2QJJA 2C7FA 3KCJA 3A47A 3SN1A 1QR7A 3E5BA 4BEQA 4DYKA 3VOFA 1BD0A 4IXHA 4QJ3B 3RAOA 2WLZA 4AD3A 3LS9A 4Q4KA 1LLOA 2VEPA 2F9RA 4J3XA 3WEMA 1HNYA 1Y8BA 4NI3A 3NJ3A 4MY8A 3QGVA 3CMGA 2WWDA 1E3ZA 4HYVA 4PMZA 1V3HA 1O5XA 4HA1A 4B9YA 1V02A 4H01A 3CB8A 4Z2KA 4CQ8A 2I5IA 4JFUA 1X98A 3AXIA 1UR2A 2WXDM 4XTIA 1QUMA 1L6FA 3S1UA 3S2NA 2Y8VA 3EAUA 1DVJA 3NFUA 3GVQA 3JRKA 4NJIA 4JTCA 2DSZA 3PZQA 4E0CA 2POTA 4DPPA 3N04A 4L4MA 5DT5A 4LYPA 1DJXA 1VP5A 5C7HA 1GW9A 4H9UA 1DIKA 1XLMA 2AKZA 1X6NA 3ONBA 4FS9A 1IXNA 1NFBA 4HNOA 3KZPA 3A4AA 2VFFA 1UOKA 1LOSA 3CYJA 5A6TC 3RLHA 3J7HA 4DI9A 3PP7A 3L12A 3WL0A 1RCXB 1UUQA 5GNXA 5GJMA 3FXYA 1AL8A 4M29A 3VGGA 2FPVA 3GNRA 3O0KA 5TF0A 1U1JA 8TIMA 4PTVA 1WA3A 3W7EA 2ZADA 3QVQA 1V6VA 3UU0A 1ZTVA 1XRVA 3UNTA 4DO4A 1FBAA 2DZXA 4L4LA 1Q7QA 4IG2B 1C90A 2BY2A 3FAWA 1I45A 3HQPA 2Z24A 1C8XA 4WD0A 4JOMA 1BWKA 2ZA2A 3G6MA 2Y61A 5KETA 1MQRA 4LBSA 1B4KA 3B06A 3HZ3A 2V8ZA 1MUMA 4I6KA 1R46A 1EWDA 2FVMA 2XFWA 5I3HA 1FWAC 3AU2A 2P3ZA 3P61A 1QPNA 2Y1HA 3ARQA 2QPUA 4F79A 3ABOA 5FF0A 4J3SA 4S3CA 4YVXA 4DJED 2WKGA 4CCDA 1BHGA 3EX6A 2G8ZA 5KMYA 3EGJA 4AVFA 4EANA 5E6YA 4H9TA 5AFDA 1RVGA 1I6NA 4HCDA 3GIYA 4E2OA 1QOPA 1RK5A 3QSRA 5CC3A 4KWSA 4JTSA 4ALDA 1W1YA 1HX0A 1KFBA 3OQEA 3VDCA 4LB4A 4AIBA 5IDZA 1TCDA 4A2SA 1R3TA 3SCWA 1W5NA 1JCNA 5CZSA 4AAJA 3LHWA 1L8NA 3GFYA 5DRCA 3S83A 4BEUA 4QCFA 3S6DA 3LERA 1REQB 3M4HA 2FTYA 1YMYA 1BRLA 4G7FA 4GC4A 2BGSA 1OBAA 5IOBA 2J7HA 3TZNA 4PTDA 4ZXOA 3W7MA 3REQB 4NXKA 2PMQA 3Q67A 3H4GA 4AWEA 2HE5A 3CWHA 3KAOA 1DXEA 4KH2A 3H55A 5CGMA 1VRXA 2R1KA 1W0MA 3HO8A 1RQEA 3QJAA 3JUGA 1HW6A 3TR9A 3V0SA 2HDJA 4WXZA 1MO0A 3IV3A 3PUDA 4WQ6A 5LXEA 1AJZA 3IGSA 2Y2WA 2GGEA 3QQ0A 3LPPA 1FY6A 4EWND 4LVFA 3TONA 2ZRZA 3WMCA 2Q01A 2QUUA 3WQEA 2PGRA 4IIGA 4B91A 1VIZA 5A8PA 2J6VA 4EXQA 1HG3A 2AL1A 4MVAA 2VXNA 1QPRA 2GDQA 3S47A 3UGVA 3R8HA 1E72M 3WD1A 2JKPA 2ISVA 5DCBA 1W5QA 4CNSA 3QTPA 2A3CA 3RU6A 3WDHA 7ODCA 3N34A 3MJMA 4AVOA 1VCGA 4Y96A 2C1IA 4ZCWA 3K1DA 2DVUA 4AX6A 3NSNA 1EL3A 2GVEA 3CV2A 2ZVIA 5HUOA 3TJLA 4RNIA 4P7RA 1CPUA 4HZ8A 3APYA 3ZVHA 1TMQA 2YCKX 1M03A 1B0IA 4GUFA 1QWGA 5LA1A 1GOKA 1S5NA 3SRFA 1CDGA 3BSGA 3KHJA 1WZMA 3MI2A 2ZQ0A 1NP2A 3LNMA 1LOLA 1W3TA 3FN9A 1V6UA 3TROA 1UG6A 1S2TA 3GNNA 4CQCA 1TMHA 2WCSA 3T2QA 1ADSA 1DHPA 3XINA 2YKKA 1J0HA 3B8DA 4RPPA 2CERA 3VKDA 1R2RA 2Q3OA 1EC7A 1XIDA 1R7OA 2VEIA 3S5ZA 3ITXA 1NJJA 4EPEC 4JFWA 2D22A 2E8YA 2FMNA 4WDTA 3AC0A 1R3SA 3MDUA 3ZZ1A 5LNSA 2VDHA 3SW6A 2WLYA 2ZWYA 1CYGA 2HNHA 3TSMA 3L67A 4R53A 2VMFA 4X9YA 3IARA 1POKA 3KL0A 3T1GA 1IV8A 3KBMA 1T96A 7TAAA 3SGZA 4N6EA 3HG3A 3B9DA 5LA0A 1JF5A 1S5WA 1JXJA 2HRWA 3DBNA 1UA3A 3O1NA 2J8FA 3VIGA 1GG0A 3BH4A 5E9AA 2CYGA 2B4GA 1VBRA 5CH9A 2ZIDA 3A21A 4CGTA 3OIXA 4LBUA 3OG2A 4EKJA 5C9RA 2YXXA 2Z1XA 3VIHA 1TRDA 3SCSA 2FPYA 1OT2A 1VYSX 4GYFA 1E1CA 1UWIA 3RCYA 1XLHA 2AOSA 1QRQA 5TAOA 3URQA 3MMUA 3B9EA 4O0KA 3DDMA 2RH9A 1SPQA 5G2WA 2I5QA 3CAQA 2E5CA 5HK4A 3THQA 4UFMA 4N02A 2YR1A 1H1YA 1P0NA 4XTDA 4XUYA 1S5TA 2NXHA 3RYSA 3WMSA 3BARA 1EJXC 4H7VA 1HL2A 1BVNP 3WLIA 5U4NA 1UWQA 4P7QA 2E9BA 3AYRA 4CQDA 3PPGA 3IIPA 2ZE0A 4NJKA 1WDRA 1H7OA 4LUYA 4Q22A 4LS2A 2ZXAA 1GOOA 4TV6A 4GCAA 4J2PA 2X2GA 1G4EA 1HGYA 3FYOA 2HE8A 3UWYA 3C52A 2PD5A 1JCJA 2EF9A 2AAMA 4LPCA 3VXGA 2MANA 2OCZA 3EWWA 4LCRA 3UPWA 4B5VA 2G3MA 2YCEA 3A24A 1OG6A 5A95A 3ZR6A 4B5SA 2P5NA 2AMGA 4GZIA 1KD0A 2CXEA 3M16A 4L4OA 5AECA 1YXYA 3GKFA 4CNPA 3H2EA 3AWNA 1MDLA 1XWYA 4NSBA 1VEPA 3P8IA 1QVBA 1TELA 2O55A 3TUUA 1AD1A 4S3BA 3TIMA 2V0TA 5E70A 1U2YA 4JYFA 3U2EA 3O15A 2D73A 1J5TA 4GI6A 3TQKA 1KRBC 3FJLA 1C92A 1OIMA 4PTXA 4J4KA 2TODA 4H6QA 1DV7A 2GLKA 3TAKA 1SJCA 4Z1AA 1DJWA 4QJ1A 3HQOA 1M68A 1DTNA 3WLJA 4QAWA 3IACA 3MU7A 1F61A 4YHEA 3TTYA 4KW2A 1NWRA 4V28A 4BI5A 3VIIA 1S39A 4S23A 1I60A 3EXTA 5HPOA 4OQVA 1JD9A 1I0DA 4HPNA 1E73M 3VO0A 3D46A 3GH7A 1JUBA 3F2DA 1XLLA 4NQ1A 1US2A 1J93A 2IPFA 4GZEA 1NP0A 1CI1A 4GZ7A 4FX7A 4GIYA 1JF6A 2QUMA 1H1NA 5DFAA 1A5KC 1KKOA 3ARVA 4CNNA 3I4KA 4ES4A 4LNCA 3M0VA 5TNVA 4MJ4A 3W1XA 2JE8A 1ONWA 4NZ1A 1O68A 1TX0A 1YPXA 5DF0A 4GABA 1W31A 1P0EA 4CNTA 3R0DA 2XPKA 3VNIA 1MW0A 1UW9A 2Z28A 1Q6DA 2JGQA 4KGJA 4US6A 6CGTA 3AUOA 4XB3A 4N4PA 1H11A 4A3HA 1MYRA 4IF2A 1X8CA 4L5ZA 2CWXA 3NCOA 1FHUA 2D0FA 1U1HA 1TREA 3AWOA 2YXOA 3RM8A 1EGVA 4M0XA 3PG9A 1XD0A 8XIAA 3W72A 4GQQA 3GBEA 5D09A 2O4QA 4ROQA 3W07A 5EMJA 3ITCA 1K3UA 4C1NA 3S46A 4AXKA 1CIUA 2XISA 4IGMA 2EJ1A 3DG3A 4JX4A 5KZDA 1S2VA 2C3ZA 4C6JA 4P5UA 2CEQA 2ZUVA 4H7CA 1LBMA 3SEPA 1SZFA 3DX5A 2DZVA 2PDBA 5A8MA 4DELA 4YWIA 4PB4A 1OFBA 5DEZA 2J24A 4QS5A 3B03A 2E6FA 3G5EA 4PYSA 4XZLX 4HU8A 1SFSA 3VNDA 1A4LA 5D8ZA 3E1F1 3GC2A 5HANA 4AH7A 3UZ5A 4IGNA 3P0XA 4AWUA 2V3EA 3OLIA 1DE6A 1P6BA 3TMLA 3U9IA 5IDIA 3AHXA 3S2CA 1P6CA 3G6LA 2JEPA 4MPQA 1ZAIA 5DMLA 3II1A 3B8VA 1D3HA 3VD5A 1JRCA 1QNVA 3RXZA 2FJUB 3W9ZA 3BLOA 1NDWA 3DKJA 4JQAA 3NZRA 4FR1A 3R89A 4CD6A 4HU4A 4XVDA 5BWAA 4KIRA 2OEKA 2R6OA 1ZPTA 3KCLA 3EMZA 1G5AA 5HR7A 1C93A 1LG2A 4E4FA 2XTKA 3NA8A 2ZZ6A 2GGHA 3FHAA 3JZUA 1KM2A 2E1DA 5G4EA 2ZUNA 5A6JA 3N11A 3VKAA 3D0CA 1LQAA 4GY7A 4XZWA 5CJ5A 1UPMB 3MKKA 2PAJA 5BZAA 3W0KA 1OD0A 5EPDA 2PWHA 3W7KA 3KTSA 3KLLA 1XW8A 4PMOA 1IWBA 3I10A 1S3TC 2Y7GA 1EP2A 3MHGA 2W27A 1PWMA 1ZAHA 1QHPA 2EPNA 3IVTA 4KESA 2Q8ZA 3B9NA 1WKDA 4QG8A 1R87A 4LU0A 3N1AA 1EF3A 1JJKA 4G1NA 4AB4A 2W4XA 2PEVA 3VE7A 4H8UA 2V2DA 3BICA 5CPLA 3VVGA 3LHTA 2X2YA 3VKBA 2WVVB 2NLIA 3BJSA 4KFOA 3NQDA 2PODA 2QCFA 3PAOA 2QGHA 1HL8A 3NOYA 5F4XA 3WDRA 1SZRA 4UNIA 2HS8A 5K7JA 4ZSTA 2QNEA 1LP6A 4LFYA 4FLQA 1PKYA 2EO7A 4GBUA 1JZ4A 4QGCA 5JH2A 1NVMA 4WX2A 2EQDA 4GVIA 3BLIA 3LDVA 1GQKA 4R9XA 1XSIA 3AIEA 3UESA 4XBKA 3LK6A 2VC9A 3VDAA 1OFRA 3QGKC 1GEHA 5HMSA 4N42A 4PMDA 1ZLPA 1M7XA 4DJDA 3W1QA 3QLDA 5G1YA 4M24A 1VJSA 3S0CA 2FGLA 4E8CA 2VDIA 3CLWA 1J8VA 1JZ2A 4K1GA 3FYYA 3MP4A 1B9BA 3TC7A 3SR7A 4QXIA 1KWGA 4QDPA 4I9TA 2C15A 1OF6A 1WCGA 3FSTA 3SJ3A 1GJWA 4AUBA 3AHTA 5BRQA 1ISVA 1TSIA 4Z1YA 2OU4A 2J13A 2VWTA 1GKPA 2BHUA 5D37A 1F3TA 1HP5A 1TG7A 1O1HA 4PRWA 3VFCA 4CN1A 2FDMA 1OG0A 3T44A 2J27A 3KDNA 2CLPA 3OHIA 1EIXA 5IXEA 3KVJA 3LZ5A 2XN1A 3B05A 1TRIA 1UR9A 1OC6A 4F9JA 5C5YA 2NQHA 4YTQA 3SADA 2WWCA 4MYAA 1SO4A 3DN5A 2ICSA 5XINA 4HOXA 1WXZA 1LROA 2V5LA 1C9DA 4MFDA 3TTQA 1PYMA 3O7UA 4EIVA 4LW7A 3CZ8A 3QR1A 3WIJA 2E3ZA 4MNMA 4MWAB 3MCMA 3QMRA 4JQ4A 3FCPA 3LCHA 3MZNA 2KZHA 1HQTA 3DHDA 1EJRC 3RGTA 5D2TA 3FKKA 1NFGA 5JQ9A 3ZLGA 1KW1A 2VCBA 2JF6A 3GVGA 1MEWA 1T6MA 3G0UA 1FVPA 3CMFA 3ITGA 1ZP4A 3GVVA 3UEQA 2X0SA 4OKDA 1VQTA 2NX9A 4QX4A 1DJYA 2NT0A 3PFMA 3N25A 2OOFA 3AFBA 5M03A 2Z1KA 5I07A 4UZUA 1RD6A 2D24A 4IPLA 1OZMA 1EJWC 3WLPA 1XYMA 2XDFA 3EWZA 3DI1A 1MXGA 3DZ1A 3W1RA 2V68A 2ZX6A 2BOFX 3K46A 5HR6A 4OHQA 2CLFA 2A3HA 3K8MA 4E2DA 2DZPA 4H8HA 3TWBA 5HQMA 2WBGA 3O06A 4I3GA 3PTQA 4Q3MA 4ZQOA 1GOQA 3NQEA 2PSNA 4FIQA 3RPDA 4LT9A 1CXIA 3DFPA 4IMFA 2UY3A 2OX1A 4DQWA 3TTSA 2HJPA 3AHVA 3CL8A 4NAFB 5J5DA 5CSRA 4FHAA 3L9CA 3S5YA 2HBXA 3S6TA 1Z48A 4DJEA 4DBUA 4U4MA 2XM1A 5J8LA 1BLIA 4E3TA 2QHAA 3K8LA 5EYWA 5FL1A 2J88A 3MQTA 1OFEA 2VRKA 4XZHA 1CNVA 2WMKA 4AZCA 5TIMA 3CO4A 2EHHA 2ZE3A 4S2BA 3F2BA 4K38A 1ZHAA 3O16A 1EWEA 1VEOA 4MNLA 1SYTA 3WLTA 1R47A 4A8NA 2J7DA 4HU0A 1UZ1A 2DY3A 3CAWA 1JGMA 3KOFA 5D9MA 3M0XA 1VFLA 3GWQA 4HZMA 4D6GA 2GWNA 1QNPA 1M53A 2YB1A 3GFXA 1JI1A 3TLQA 1IT8A 3WELA 1V3KA 2WSPA 3RG6A 2V6AA 1KLYA 5LNUA 3NWRA 1C8QA 5T8GA 3BLDA 1TV5A 1UKQA 1N8WA 3MANA 4C1NB 3MCNA 4CQBA 1E4LA 1ICSA 5A69A 1P0DA 3I7SA 1JPKA 3BLFA 5D4YA 4XIAA 1ZCOA 1J0KA 3VCRA 4DZ5A 5DXYA 3MI6A 1FCQA 1V93A 3TLLA 3B0XA 2YCIX 1LLWA 4GNKB 4LS1A 2WVTA 1VAHA 3QMTA 1KQZA 3TC6A 4B5TA 3TA9A 3MPGA 1A0CA 4W8BA 1X38A 3W53A 4HNTA 2UWFA 4S3EA 3VGBA 3NSXA 4URIA 4MJMA 4N2YA 1R0MA 4I9JA 5AY7A 1EA0A 3UWQA 3LHYA 5D2VA 1M3UA 5CGTA 5E5CA 2JQXA 3W6MA 3BAJA 4QCEA 1VBHA 2CBUA 3A5VA 4C6OA 2G3FA 1E9YB 2JKAA 1Q45A 3G1AA 1GVSA 2VUNA 1V0MA 1H63A 1F3WA 4M7SA 4LY8A 1G01A 4GUIA 1IR2A 1U5JA 4HPXA 2ZRVA 3QSTA 1VIWA 1UB3A 2X40A 1J0IA 1GVEA 1JI2A 3NZQA 3FY1A 4IMEA 3AOFA 1Q85A 3UVIA 1H7RA 3NO5A 1Q3NA 4HSOA 4J9JA 4PUEA 5LNVA 1B30A 1WXYA 1JAKA 2CNCA 2PB1A 1YTKA 3BANA 3HG2A 5IHSA 3OVPA 4FXFA 4V1YA 5LNRA 2X1IA 5AC6A 1DXFA 1BEUA 3W37A 3IIVA 1W9DM 2YXGA 4HK7A 3WH7A 2UBPC 3LRKA 5LHFA 6REQA 3E3HA 2DEPA 1FWNA 3M7SA 4PTMA 4TVUA 3L2IA 3NXLA 3V1PA 1G69A 4PMRA 1V3IA 3P81A 4S39A 3VC5A 5HWNA 3LA4A 1OFDA 3TQVA 1B1YA 4QBXA 4PEKA 4PMQA 2P53A 4C6FA 5FAJA 3VIMA 5HJLA 1ISZA 2D23A 4JN6A 3VFLA 4ZQRA 1KXTA 2R1LA 2ZKMX 2QAPA 3I3EA 4NX0A 4OECA 2QS8A 4QROA 4UFIA 1KTBA 2GJXB 3ENLA 2WZEA 2D1ZA 5C54A 1AMKA 1AH3A 4O1CA 4A8LA 1FRBA 2PDYA 1F76A 3QZAA 1MUWA 3B3DA 3OVQA 2OWWA 1TV2A 5HPCA 2NUYA 5C7VA 1H0GA 5EKYA 2VD9A 1UH4A 5E09A 3VOHA 4WF7A 2GDUA 4M5PA 2DZSA 1GHSA 2Y7EA 3WQDA 3K4DA 3QFWA 4JS3A 3UG3A 1DJZA 4KMQA 1TR1A 1AQ0A 2RDUA 3AIRA 3KOZA 3GR8A 4LSBA 4WGXA 5CBIA 3M7WA 3WF2A 3WH5A 1IEWA 1GOMA 3ALFA 3R43A 4JXCA 3P3BA 4MWAE 3NO3A 2GPTA 4PL1A 3HFYA 2INZA 5I5RA 1JZ3A 1MZHA 2C1GA 2F6KA 1POJA 3M44A 2QKFA 4EAMA 3ONCA 5A6LA 4XWUA 1QNQA 3LX9A 3MO4A 4ICCX 1S2AA 2XH7A 4GXPA 3O3RA 4QJ4B 5K4ZA 2Z1VA 3M0IA 3NZ1A 2NSOA 2AKMA 2VFDA 3H70A 1G4PA 1SZNA 5FF2A 1FCUA 2J47A 3BGGA 4DF1A 3UW6A 4UTMA 3U5UA 4H6RA 4JFSA 3L4TA 2PF0A 3EBVA 3TCEA 4ZXLA 3A3HA 4XAZA 3U2ZA 5HATA 1KFCA 3KW3A 3R79A 3GIPA 2Z4GA 1J0YA 5FCZA 2E1WA 1P6WA 4DAFA 5AYBA 1KGUA 4L9XA 1RXOB 5D9OA 4CD7A 2NV1A 3EEGA 4AWSA 1GQLA 4RXGA 4GGBA 2E77A 3CIVA 5FJPA 2FZ9A 1ITCA 4LF1A 5I06A 4US5D 1TO3A 2HK0A 2PS2A 4ACZA 3SRKA 3IVSA 4GY1A 2ZOXA 1JGIA 4OT7A 3GNDA 3ZIZA 1H51A 3N2BA 2PUZA 1SFTA 1PX3A 3C8NA 4L4PA 2IKHA 1B57A 1DORA 5GJPA 4LVAA 3ZXWA 3RPTA 3MP3A 3TXVA 4XZIA 2IKJA 1TCMA 4M1RA 4C6NA 3RFAA 3M5VA 2C91A 4H8VA 2QJIA 4HSHA 4GD0A 2OWXA 1CGYA 3CXOA 2CETA 4I8DA 2VVNA 1GOIA 1P0BA 1E6QM 2GJNA 1ZB5A 3T4WA 5D38A 4HIBA 3RX2A 3D3AA 2ZC1A 4ATDA 1PPIA 3KM8A 2V5CA 3CUXA 4FB7A 3T0BA 2DJXA 3C61A 2WSKA 4MJ2A 3CUZA 1PDZA 3OBAA 5I79A 2E40A 4PCNA 4XSMA 3A4JA 4HCHA 1H60A 3LM3A 5AZ1A 4NRSA 2VFGA 1V4YA 3M46A 7A3HA 3DH7A 4JTEA 2NX3A 2XWEA 4WJXA 3UYIA 2IS7A 2IW0A 3WBWA 2VNCA 2BZNA 1LWJA 1P5BA 2W63A 3DFTA 1RLCL 3VIKA 4NZJA 4DZIA 2BDQA 1GWJA 1L6YA 1LRQA 1OGGA 4W4QA 1IXQA 2B81A 2QUNA 1W91A 3P84A 2ZUMA 1OGBA 4C1KA 3CS2A 4GZJA 5K9XA 2R24A 1M7JA 3XISA 3AQUA 1UD2A 2Z6JA 3SDOA 2PDPA 4QNWA 4AEEA 1DWFM 3LBCA 3TH6A 3CK5A 4G9PA 2PZ0A 1OB0A 2FTPA 1WDWA 1QU4A 3E49A 5KITA 3DFOA 3THAA 3DIPA 1C3FA 3WEOA 2VRJA 2QLYA 4MKVA 3SN0A 4UTHA 1KGXA 3VKCA 1M7PA 1BFNA 2QQ6A 1LUCA 3LCFA 2PU0A 4QRNA 5AVHA 5K4XA 4BHYA 2NUWA 4ZB2A 2VC6A 5ABGA 1Y5WA 5HINA 1U30A 1QOXA 5E0FA 1JPHA 4H9MA 3AIWA 4MAVA 3QZ6A 1EOKA 1TB3A 3OA5A 3F5JA 4GNVA 1Q2RA 3LCLA 3KWSA 1K7EA 2OG9A 1T8QA 4UCFA 1D7FA 1EUAA 1E9IA 5IFPA 4J40A 4ZEPA 3N4FA 1M04A 3PUOA 4A3RA 5HMEA 2NVAA 5TQLA 3S9IA 3K2GA 1WP6A 4OGZA 1A5BA 4H8NA 4WOZA 3HBLA 2WK2A 1JUKA 1WQ5A 3GTNA 4AZHA 1H5YA 3H54A 5G4WA 1UC5A 2CHOA 2G95A 3QV8A 1QI0A 3MTWA 2ZXDA 4UMBA 2QJMA 2CFFA 4QS6A 3BTNA 1IZJA 2A5HA 1SSDA 3KBSA 3EMQA 3CWNA 3PNZA 3VGFA 3BMXA 1J9YA 1ZRQA 4O54A 3WQOA 2A3LA 4PUJA 5FJJA 2PWEA 3AJ7A 3ITVA 3I3DA 3PPFA 3S1XA 2JBMA 3URAA 4U2ZA 4JNYA 4XSLA 3AMCA 4NYYA 3OGSA 4GACA 3WK3A 1BQCA 4NJJA 1D2KA 1DP0A 3GXIA 5JUVA 1PZ3A 4DYEA 3IJ7A 3W70A 2QJHA 3GB6A 1YX1A 2CITA 1IEXA 2J74A 4GI4A 2G3IA 2H8XA 2ALRA 3NPVA 2VI0A 4MGGA 1O94A 2INFA 3K13A 2PURA 3UT0A 3T8LA 2FZBA 3R94A 4Q7BA 3S4TA 2BBFA 3WMLA 2XINA 4CVUA 1QI5A 3WQGA 4PB3A 3RK8A 3HQ1A 3TTEA 3C5QA 3ES8A 3EB2A 1TWZA 1KRAC 3PBUA 1KXHA 1RA0A 3P74A 4FXJA 2VURA 5JBFA 3OODA 1NF0A 1E0XA 1UASA 3SFWA 1J0JA 4J3WA 1KA9F 1IQ8A 4XG1A 4AF0A 3G1HA 3H7VA 5PTDA 3HGRA 1XIJA 2CWNA 3CQKA 3G8RA 4Q6XA 4Q8TA 1T0OA 4JNZA 4ZQMA 1PUDA 3GS6A 2VELA 4LB3A 1LLZA 2OFJA 2QCCA 4NY2A 1PIFA 4WSJA 3RU8X 4W84A 1B3YA 3C0LA 1CGTA 1RBOB 4RXFA 1K8ZA 1JQVA 4JDBA 4E38A 1VLIA 3G1VA 5EY5A 3VD7A 2QDHA 2I1OA 3FDGA 3EKGA 1HP4A 4MTVA 4P61A 4WR3A 4JPGA 1P4CA 2ESCA 1XH1A 3ZJKA 3WK1A 1JPDX 3MZ2A 1X1OA 2DQXA 3VIPA 4XAFA 1E4MM 2BY1A 3NPUA 3MA8A 2ISFA 2GUBA 1F07A 2WVSA 1UROA 3FHQA 1M6JA 2DW6A 1F74A 1PTDA 1M41A 4DM2A 1ONXA 4BQ5A 2OQHA 3VINA 4L80A 1TPFA 3V7PA 3GYCA 2ISDA 3T55A 5AYZA 5DLCA 2WJDA 4P7OA 3GM8A 1ZUAX 1ZS2A 1DWJM 4LEFA 1SR9A 4CLMA 2O7SA 1V0LA 3HTWA 1EEXA 2QF7A 3UY7A 2OLSA 2XSAA 2X0HA 2BX7A 4JTRA 3GDKA 1XISA 3EEZA 2WMIA 4HZ7A 2A6NA 3N29A 3P6LA 1CB7B 1J6OA 3G0XA 3POCA 4C60A 1W32A 1PKLA 1EFZA 4DJFC 1W54A 3F4VA 4O19A 2O9OA 3I3BA 4F2TA 5H91A 2XYLA 4DIAA 3TEVA 3W7HA 4E2BA 2WANA 4WUIA 4XBSA 2DT3A 3GZAA 3IRSA 5CXPA 4Q4OA 5DANA 1JUEA 1KBKA 3H24A 3PWAA 3BOFA 3CV1A 4OOUA 5EA9A 5JXQA 2X30A 1XYBA 5C9UA 3TA6A 3UR8A 3NL3A 1YPIA 3LG3A 2TYSA 3BMWA 3VCNA 3A4WA 3QPZA 3QOMA 3E96A 4FZIA 1OCNA 2DORA 3T0DA 4ZOAA 5K9DA 1Q66A 3LM7A 3WQCA 2A21A 5CC7A 2PDHA 3K30A 2G5WA 1XYZA 3GW0A 2OZ3A 1ZBWA 1KCZA 4UOZA 4P2VA 1QATA 1E0TA 2X7VA 1Y0EA 4HZ6A 1IWPA 2V5BA 4RZBA 3SSJA 3NYDA 3PNUA 4NJHA 4RDWA 1XRFA 2ZX9A 1ICQA 3H6OA 2PTYA 3XIMA 3VDBA 1P1MA 3O9NA 4OUIA 4QEEA 1MQPA 3BG9A 2BXZA 4FK9A 4ATWA 1LM1A 3A9IA 3BSMA 2VOMA 1XH0A 1AJ0A 5K2ZA 3QC0A 4IOTA 1TV7A 1E56A 1UMYA 2VFIA 5G5IA 2QVNA 5T9CE 4A21A 4H00A 3KOXA 3S3GA 1XF0A 3TV8A 4W86A 1FH9A 2ZX7A 3CQIA 3B4UA 1QPQA 2WZIA 3Q2DA 1VYRA 3O07A 2Y5SA 1ISYA 3BMVA 1JYVA 1PTAA 3V1HA 4X2PA 3ZT7A 4KWWA 1HZYA 2ZFAA 3DBPA 3UCCA 2GK1B 3SI9A 3EX2A 1I2OA 1KM3A 2ZTKA 3OTRA 4IQJA 1SGJA 4K3ZA 3WNPA 4NZCA 3HGJA 4GOAA 1XLAA 1YHTA 4K8GA 1DQUA 2PTWA 2QDEA 3JZEA 3CYVA 2F2KA 3FDKA 3M5XA 4PUKA 4Q8PA 5BXSA 1CTNA 3ARSA 3OVGA 3NL2A 3ARRA 2MNRA 4ZOBA 3WJZA 2WHKA 2VZSA 4KCUA 1EH9A 5MHBA 3RIKA 2P0OA 1QT1A 5RUBA 1E1EA 2XJ7A 4CNOA 5HQEA 4RDYA 3WO8A 2QCNA 5BW6A 3B9OA 3BW3A 4FNUA 4M8UA 2V3GA 3DFQA 4I5RA 4O50A 1CX9A 3UG5A 1VC4A 2VD8A 5DCEA 4MIMA 3LXCA 2I9UA 4LUTA 3RLVA 1AUSL 3GAKA 2F61A 3GUWA 3B8UA 4UXDA 2DUAA 3W2MA 3FGCA 5REQB 2Y63A 5D03A 2POZA 4HD5A 1GYNA 3CTLA 2ZYFA 4LC8A 3L23A 4H6KA 1Y5VA 3DFNA 3VOCA 1FA2A 3C0SA 3OBEA 3P82A 3EX3A 4UTWC 3WYZA 5F2LA 4D72A 5BU6A 2XH0A 1WZAA 3WH8A 3CHCA 4JIHA 5EB8A 3G1YA 1BAGA 3VNKA 1OFOA 1W1TA 3PJUA 4XZNX 4R27A 3EYPA 1SMDA 2W91A 1FWHC 4F0RA 1ZBCA 1XJBA 3DENA 4YTTA 2EGZA 3R8GA 1IEVA 3BG3A 5KEZA 3VNLA 3LHZA 1PDYA 4V27A 4ZODA 2CCRA 3NPWA 2J4GA 2TSYA 2Y88A 1MEIA 2Y24A 3L66A 1SZGA 3H26A 1DIOA 2CPUA 2AGKA 2JF7A 4B5WA 3UWEA 1GVIA 3A12A 4DJDC 2F8QA 4ZR8A 4K36A 3CUGA 5FJRA 4DLFA 3CUJA 4UC5A 1FFQA 5FJOA 5EBAA 1GUVA 1XCWA 1EJUC 1K9DA 2QDDA 3W81A 4NJGA 3IGHX 3ZT5A 3ANUA 4F2UA 1I1XA 3W7CA 2F6XA 2RJHA 3BURA 1F3EA 4K7YA 1HTIA 1M9HA 4KPLA 1KQYA 1Z42A 1GNXA 4IIDA 4BK9A 3NM3A 3MJYA 3ABRA 4M19A 2BP1A 1NAL1 1U1UA 4X22A 3ZLHA 2WC7A 3H12A 3WNOA 5BNKA 3VMPA 4QLKA 1E55A 5CZJA 9RUBA 2Y85A 4AD0A 5I6SA 3OGRA 1JZ7A 1E70M 1K1DA 3V5OA 2OTDA 4AQLA 5D9NA 1XC6A 1RP8A 3W4RA 3KDOA 3WBYA 3TYDA 2VVSA 3OZYA 3IUHA 4GIRA 1KTNA 4O0ZA 3MHFA 4Q4RA 5A2AA 2HS6A 4V1XA 4HTBA 4G56A 7PTDA 1UBSA 1OD8A 1EDTA 2BS9A 3HG4A 3FAXA 4M56A 4UMCA 2V67A 4BWLA 3W2UA 1B5TA 3PZOA 3VCCA 3NUKA 2LLEA 2GVYA 5KZ6A 1GPWA 2E7FA 2B7QA 4UQ9A 1RVKA 1UWSA 2RJGA 1K4GA 3LSBA 3AICA 4L1GA 4KFNA 5CSUA 7CGTA 3NZGA 1O4UA 1PS9A 1A5SA 2OSXA 2WHLA 1GGOA 3R6IA 4S3JA 1VGAA 3NYZA 5D02A 1XGDA 3C8FA 2NZLA 1XUUA 1JULA 4W9TA 4DNHA 5GVJA 4AHQA 3W6LA 4FLRA 1EDQA 2YA1A 3ARYA 4J3ZA 1W9BM 2ABAA 3W3OA 3T07A 4UUIA 4YYCA 1UMLA 1W3HA 3HMCA 3G77A 4PMJA 3KTXA 3N9SA 5FEPA 3LMZA 1Q13A 1SJAA 4R34A 3OG3A 1PL9A 2PDKA 3WUBA 3AIUA 1E3XA 3EDDA 5H1WA 1KFWA 1SVDA 2G3NA 1FDYA 2V82A 4LTSA 1XIIA 4C7DA 1UR0A 1EO5A 3LRMA 3VAVA 4JICA 1E6NA 3MKCA 2WMIB 2VKZG 4LBRA 3L4VA 1YDNA 3UD6A 6A3HA 1XLDA 4US5A 2SFPA 5DN1A 1ZL1A 3PJWA 1LF1A 2QR6A 4LC6A 1BXCA 3H22A 3B8SA 3APTA 1O7AA 1DQXA 1FWGC 4GJIA 5I03A 2X1SA 3TYCA 3IJIA 1EOMA 1CENA 2WSRA 2ZTJA 1ZBVA 3VPLA 1W17A 2ODOA 2PDGA 3SGGA 4LYRA 2CLIA 2EG6A 1UIPA 5CJNA 3UPBA 4FLOA 2ADAA 3SCRA 2XVKA 4O1FA 1WDDA 1D8CA 3EZ4A 3IIOA 5L6UA 4G1KA 1JZ8A 1I2PA 1MXSA 4O1DA 1YTEA 3STCA 1RCQA 3KEHA 2BG5A 2WYSA 4C6IA 3D6NA 4JD4A 3FXGA 3UQNA 3IJLA 4JTUA 1AVAA 3OW1A 4ADSA 1IHIA 3H7UA 4G7EA 4LUSB 4EE9A 2ABBA 3W6YA 2Q8XA 1OFQA 1ME7A 5DO8A 5HA7A 4YU1A 1CZ1A 5FEXA 1ZJIA 3G1RA 3NSMA 4D1IA 3AS3A 1I9CB 1RPXA 4QQ3A 1IGWA 4K68A 4PFHA 3L65A 3UNDA 2OQLA 4AFYA 1MDRA 3QY8A 2QULA 3E0VA 5CCZA 2VR5A 5I3GA 5DY3A 2PLKA 2C19A 4A6GA 2XG9A 4ZB5A 4P8WA 1SW0A 4XISA 1DWIM 1KFKA 3IJ6A 2X1RA 4GY0A 2XN0A 4X9SA 3KS5A 4EX4A 1B4EA 3NPXA 2QV4A 4H19A 1REQA 6PTDA 3GH4A 1IWAA 1A5UA 4GX8A 1YDVA 4OBRA 3REQA 2JALA 1QK0A 4JQ1A 2FVKA 3VOIA 1UKSA 1XXXA 4PC8A 2ZZ7A 2FLIA 3AYTA 1WX0A 1M7OA 3A3XA 3OPSA 3OJGA 3BGAA 1YE6A 3N19B 1GZGA 1Z32X 3L4XA 4LAUA 3SY8A 3FJNA 5D33A 4QG6A 4I9AA 3SO7A 3M0KA 3P7YA 3C3NA 4DAIA 3VKKA 2CLLA 3G2GA 3PWIA 1AJ2A 2NQ5A 3R25A 3WQWA 3HU7A 3BAKA 1V08A 2QEZA 1NSJA 1XLFA 3I6EA 1G0CA 1OZQA 2CBIA 4V2XA 4E4PA 2VQTA 4N9EA 4LRSA 3K5XA 2PWDA 4LAOA 3BZGA 2DW7A 3CZJA 3QLLA 5HUPA 1DE5A 2FGZA 1OGSA 3MS8A 1BSIA 3TFXA 2WJFA 3TZFA 2WM0A 3VC6A 2QPXA 2E9LA 1PX4A 1AK5A 3B97A 2IPJA 3EB3A 3LGDA 5IHRA 3WDPP 4CKQA 5C6MA 3O2LA 3N9KA 3MY9A 2NW0A 2WSQA 1RUSA 3TKFA 3RO8A 4O15A 2E68A 4Y9PA 1BSLA 4RR4A 2OYMA 3WDQA 3U7VA 1NOUA 2NVCA 3FGCB 5DXXA 3OZOA 9CGTA 3BQ6A 1B3WA 1E5JA 1YW1A 2FB2A 3Q37A 1G7UA 2WW5A 2GGGA 3TP4A 1TA3A 5I7GA 3PG8A 3MMWA 4F0MA 3WUGA 4FLSA 4RPQA 2R1PA 1UD3A 4UQDA 2A3EA 4Z2GA 4EP8C 1NOWA 2WMGA 1J4EA 3OVRA 1HT6A 1W9UA 3QHMA 1F8IA 3UJRA 2YYUA 5KZMA 3WQ8A 2VEGA 3WLQA 1H0IA 1LZOA 3LN3A 1Q7MA 3L21A 3WLOA 1XLBA 1TUFA 1CWYA 1UHVA 4EPDC 3N4EA 4XVEA 3TK7A 5LIXX 5FJTA 2WZMA 1LOQA 2EG8A 2HEJA 3NQAA 3PSVA 5K3VA 4HPHA 3TVAA 3CL6A 2FDSA 2FZNA 3W7IA 4Q4PA 3HJZA 4Y9AA 2X0YA 2VZVA 1PIIA 1FHLA 3LGGA 3FKRA 2Y8UA 3BV7A 4UTJA 1QW9A 1XINA 3UG4A 4W7UA