2XGIA

Crystal structure of barley beta-amylase complexed with 3,4- epoxybutyl alpha-d-glucopyranoside
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Chemical genetics and cereal starch metabolism: structural basis of the non-covalent and covalent inhibition of barley beta-amylase.
pubmed doi rcsb
total genus 193
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xgiA00
4ZXLA 5BRQA 2QHAA 3UESA 1XH1A 3L4WA 3CLWA 1HKMA 1SYTA 3HJEA 4RE2A 3WSUA 1Q6EA 3WQWA 2X0HA 1Q6DA 1OM0A 2GK1B 4S3KA 4DWSA 1QI3A 1VIWA 2X8RA 3CMGA 3VX0A 1CYGA 2WCAA 3WQ4A 1TVPA 2WLYA 3AXHA 4B9YA 2YDRA 2EPNA 4B3LA 4BQ3A 1ZJBA 4J3TA 3VDAA 3S6TA 4Z2KA 4QCEA 1QNQA 2G3MA 1HIZA 2VZTA 2QMKA 5D4YA 4RL3A 3VNZA 1M7XA 3GXDA 4GI6A 5A8OA 2XJ7A 3OLDA 5M5DA 1KXVA 5EFDA 1JYWA 2EEXA 1W2VA 4F9DA 3LMYA 3AJ7A 1MFUA 5EMYA 1QNOA 1JIBA 3ARSA 1E3XA 4C7GA 3LPOA 1CXFA 1PIFA 1CTNA 2GK1A 2X05A 3W29A 5GNYA 3WD1A 5I3DA 1UWIA 1X6LA 5BXRA 3K4AA 2ZXBA 2W61A 2CHNA 7A3HA 2TAAA 4QLJA 3VGFA 3WD0A 3AIWA 1JDDA 1H11A 1NOUA 4AZ5A 3UG3A 2DH2A 2RGMA 1AVAA 3CZKA 3ARQA 4OBSA 4WJXA 3RM9A 1H1NA 1JZ7A 3SCTA 3VGGA 4AMCA 4FMVA 2ZX7A 2YL8A 3CZEA 3WD3A 2J77A 5CLTA 4RE3A 5I23A 3WF0A 3VGEA 2J7HA 4MAVA 2EPMX 3W24A 1NM9A 1GQJA 5ABGA 4U5IA 1ESWA 1GQKA 3SURA 1E4IA 3NJ3A 1ITXA 2WWCA 3JUGA 3SCVA 1WDPA 2DSUA 5A6KA 3VTRA 1UG6A 1JXJA 2ZXAA 1V08A 2OWXA 1UD6A 3BAWA 4GI8A 3OGSA 2JFEX 1LL7A 3WF1A 2XFYA 2ZXQA 1VRXA 1ZB5A 4KWUA 3CO4A 4D6JA 3VMPA 3AIEA 3HMCA 1U33A 2WKLA 3AICA 1GHRA 2WBGA 3F5JA 2CEQA 4AZGA 2J7FA 2WHJA 4M8UA 4W89A 1UKTA 1L0PA 3AYSA 2CXGA 4JL2A 3IJ9A 3SCNA 4ZENA 1GQLA 1WZLA 2OSXA 4L4OA 1W1VA 1CGWA 1J18A 1WB0A 2PF0A 3VVGA 1PX4A 3F5KA 1C90A 1TE1A 3ARZA 2DSVA 3EMZA 2Y8VA 3B9DA 3DHUA 1US2A 1XC6A 3GXFA 3WKZA 2NW0A 2PI6A 3WMCA 4ACYA 3N13A 3RPMA 1G5AA 4W8LA 5E6ZA 1J10A 3GTNA 1B3WA 4M81A 3ZMRA 4U31A 4HMEA 4PMOA 3WDJA 4J3UA 3VU2A 3PZVA 3T08A 1HP5A 5D9PA 1TUXA 1UKOA 1V0MA 4LYRA 5A6JA 4H8HA 3VINA 4D6DA 4MAZA 1C8YA 1AQHA 1MQRA 3WUEA 2BVTA 4RE4A 1E0WA 2WZHA 1B30A 2VO5A 2WCGA 1BHGA 2JEQA 1SR0A 1UD5A 1LWJA 1VEOA 1WDSA 2PC8A 1H0GA 4DUVA 1PX8A 1R87A 2O9RA 3WF3A 2WANA 4GO8A 2W66A 5DO8A 3ZOAA 1VENA 3QOKA 2O9TA 1ISXA 3PZIA 4W88A 4CD5A 4AZCB 2PBOA 3ARRA 2A3BA 3ARYA 2ZX9A 1XSJA 3UG4A 4MNLA 2QF8A 3VIKA 4LPCA 2WZIA 4PMYA 4TUFA 3VIHA 4KGLA 1UH3A 4J3XA 2ESCA 2VCBA 4LQ1A 3FXYA 1E6RA 2C7FA 4D6CA 4UOJA 4JKMA 2EBNA 1FFRA 5CZKA 2X1IA 3ALGA 3OIHA 1OGBA 3UCQA 2BY0A 2FGLA 3CHDA 5FKYA 3UR7A 1E6PA 3M7SA 2PWDA 3ALFA 4H04A 4MJ2A 1ISYA 1LL4A 4J7RA 5LA2A 2ZUMA 5CSUA 2BY1A 3VDCA 5BROA 3VIPA 1QNSA 2V3EA 1GJWA 3WMBA 3PZMA 1B3XA 2FGZA 1NWUA 2OYMA 1KGXA 1BF2A 2ZWZA 2ZUTA 5BWFA 2ZE0A 3WH8A 2OWWA 3WNMA 4BCEA 3ZR5A 1RP8A 3WDRA 4AD3A 1XYZA 1ZBWA 5D9NA 3T2PA 4HU8A 4HOWA 1GOWA 1TFVA 4UQDA 4HOXA 1CXLA 4XUYA 3WNOA 4X0NA 1JG9A 2D2OA 2VC9A 2YJQA 3OGVA 3WL1A 1H09A 5A6BA 4KRUA 5FCZA 2W62A 2DT0A 5AYBA 1J0HA 4OOZA 1H4PA 3SIMA 1J9YA 5JIWA 8CGTA 3OB8A 2BV9A 2BXZA 4BF7A 4UOQA 3RCNA 1DWIM 3CHEA 2XWEA 5A3HA 3T2OA 4MB1A 1QPKA 3FN9A 2E3ZA 3AOFA 5A94A 3LPPA 1HJVA 2IXVA 2XSBA 3B9EA 4P7LA 1EGZA 2FH8A 4ACZA 3WUGA 3K8LA 1NP2A 2XPKA 2E0PA 2NT0A 1XCXA 1ZBCA 3KZSA 1BYBA 3A6OA 2OLHA 1UUQA 3KE0A 4JFWA 2JALA 2JIWA 2ZUUA 1GOKA 2BHZA 1JD7A 5A8NA 1PIGA 3CIVA 3D5HA 1BYAA 4PMNA 1VFMA 4AIUA 4AZ7A 1GCYA 4FLSA 4BQ4A 2GJRA 2J47A 4YPJA 2BHYA 1UR1A 2CKRA 2E8YA 4U3AA 3AMDA 5E9AA 2D1ZA 4MNJA 3U7VA 1OB0A 2WLZA 1TZ7A 3HU7A 1UKQA 5CPSA 3II1A 4ATLA 1W3LA 1E3ZA 3WH7A 2JEPA 4HA3A 3NDYA 3THDA 4W7UA 1S46A 5A2CA 2CHOA 5FD0A 3O2LA 4CN1A 1JI2A 4CKQA 1W9XA 4NF7A 5CPTA 4D6HA 1WCGA 3WENA 3GBEA 1OGGA 3AIQA 3WEMA 3ZO9A 4M24A 1H49A 4ATWA 7CGTA 1WO2A 3ARVA 4XX6A 4CCCA 4R27A 1GPFA 1V3MA 3M6DA 1WKYA 1MW2A 4S3JA 5E0FA 3A47A 5M17A 2OSWA 3CZ8A 3TTSA 2GJXB 1KWKA 5FL0A 1EIBA 3MKKA 1BGGA 2J7DA 1CLXA 1ITCA 4TVCA 4AXNA 4CUCA 1JFXA 1R8LA 2QPSA 3M46A 4W93A 1CXKA 1IZJA 5BXSA 1TCMA 4HPGA 1BG4A 1I1XA 5CPQA 5A6LA 1XSKA 4Z2HA 2HVMA 2PWFA 5HPCA 2WW5A 1C7TA 2D3NA 5DMYA 4WK9A 4PTWA 2BY3A 4W86A 5BCAA 4OBRA 4OUEA 3IANA 1IT0A 2ZIDA 3VGHA 1BQCA 3VPLA 1E9LA 3OLIA 4CU8A 3VGBA 1W9VA 4NRSA 4MNKA 3BH4A 3W37A 1JF6A 4V28A 3I3DA 3VIOA 1JZ6A 1C93A 3CH9A 4W7WA 2WMJA 1QI2A 3ZJKA 1Q6CA 1QI5A 2CIPA 2O9PA 1JI1A 5AY7A 4PSRA 2VX5A 1DHKA 1H3GA 3SEPA 1WDRA 4MB4A 5C8BB 1MVYA 1KFWA 2DEPA 4Z2JA 1E73M 1B3ZA 2XVPA 3A4XA 3K4DA 5CJ5A 2WVVB 5GNZA 3VO0A 1OGSA 3OLGA 4PYSA 1JYNA 4H2CA 3G6MA 1QW9A 3AXXA 3TONA 3NYDA 4E8CA 3OGRA 5GQBA 4P8XA 3MMDA 4HMCA 1XD1A 3OZPA 4BA0A 5GNXA 1GOIA 3AISA 1BAGA 1JNDA 3N04A 1E4LA 3WN6A 4J27A 1CECA 1UYQA 3QOMA 2ZX8A 4GKLA 5A69A 4DWSB 3W26A 2EPOA 3U57A 1FOBA 3B9AA 4TTUA 2WVVA 1CZ1A 3WH6A 1DWHM 2WHKA 3L2MA 5A2AA 4D1JA 3PN8A 2WXDM 3EDKA 2Y24A 4UFIA 1JF5A 2G3JA 4AZBA 5C70A 2IUZA 1LG2A 4W5ZA 2VRKA 2AOSA 5CGMA 1E6NA 2VUYA 1KXQA 3MS8A 5IHSA 1E6ZA 2VOTA 4WKHA 4AD5A 2WC3A 3DYOA 4P8UA 3EYPA 4EKJA 3WDIA 5GPRA 1K9FA 1QOXA 3UG5A 1J01A 2YL6A 3VM7A 2YA1A 1HVQA 4QDMA 5C71A 5DEZA 3F4VA 2WC4A 1B31A 3POCA 2CYGA 2FHBA 2OWCA 1J0ZA 2ZICA 1W3HA 1EDQA 1J0YA 4GIAA 4OKDA 1E6XM 1GUVA 1X1NA 2JF6A 2WC7A 1UWTA 1CPUA 5A8MA 4H8VA 4DM2A 4JFSA 2QLYA 1HL9A 1G01A 1PJ9A 3WBEA 1EO7A 2X2YA 3ARXA 1CGTA 3TTQA 2ZUWA 1V02A 1C3FA 4DWSC 1W3KA 3PZNA 4AYSA 2VCAA 1UR8A 1O6IA 2DT2A 1UQZA 1BYDA 1A47A 1J0KA 2XVGA 1E6SM 3BC9A 3WUBA 1HXJA 1KR1A 3DYPA 2ZUNA 3NSXA 2BHUA 1BTCA 3WFZA 1JZ5A 1JXKA 1CEOA 3OZOA 2D0FA 2X09A 2FHCA 2XGBA 4ZE5A 4ZFMA 4H41A 4AY1A 2W5FA 4AIOA 4HA4A 1MXDA 3AMLA 4PUEA 1ZU8A 1W9PA 1VJZA 4U2ZA 1WE5A 4GI9A 3B8SA 4WSKA 3AMKA 2J7BA 4YN5A 5IDIA 3BXWA 3EMCA 2BXYA 1V6YA 4HA1A 1VJSA 5DFAA 1FA2A 3BAXA 3AHXA 4UFMA 4CVUA 4BQ5A 3GNOA 2W92A 1JD9A 1MW0A 5ABFA 1MYRA 5A6AA 1E55A 4YHGA 1UD4A 1ZS2A 3AYRA 3W6MA 4Z2GA 2YBTA 5I6SA 5CG0A 3BCDA 3TP4A 3W4RA 1VFUA 1CNVA 2Z1KA 5KEZA 2EXOA 3I3BA 4W84A 1VAHA 2EO7A 3WNKA 3UETA 1GNXA 2ZWYA 4IUGA 3W0KA 3MUZ1 2DQXA 5E0CA 4TVDA 3ZT5A 1W1YA 1HX0A 2V5DA 4GINA 4AZHA 1HJUA 5I2UA 1UD3A 1M04A 5BYWA 2YDQA 2ZUSA 1OD8A 2BVYA 2WHLA 3PTQA 1M01A 5D9MA 2CBUA 3ZT6A 4QLLA 3W27A 4UCFA 1UWUA 3RO8A 2MANA 1BSIA 2VQTA 1U2YA 1OT2A 3MUAA 1Y7VA 1E40A 1CBGA 4CD8A 1EO5A 3W6LA 2A3HA 2X0YA 2V3DA 3CHFA 4KMQA 5CXPA 2WBKA 3AMCA 5E09A 5M3WA 2J75A 5AYIA 2HISA 4UR9A 5ABEA 2A3AA 4EK7A 4J28A 1UR0A 2DSKA 2C8NA 2VRQA 3BMVA 3PHAA 3S2CA 3W28A 1HKIA 3BMWA 1KCLA 4JHOA 1XSIA 2GSJA 2J8FA 5IFTA 4D6FA 1F4AA 3OG2A 3FY1A 3QHMA 3GM8A 2EQDA 1OIFA 1TMQA 1V03A 3CZLA 2WZEA 3DHPA 3OLEA 3QR3A 4V27A 3T09A 4TX6A 1GJUA 3NDZA 4HP5A 4GO9A 1IV8A 3MSDA 3HN3A 4PMRA 1JYXA 4AEEA 4XZBA 1MW3A 3L2LA 5LA1A 1QHZA 4UZSA 2F61A 2J62A 3PZQA 5LA0A 3AHZA 1UA7A 1XCWA 2VVNA 4W87A 1HJSA 1ZJAA 4JFVA 2CBJA 3ZR6A 5A6MA 1HL8A 2VX6A 2A3CA 2XG9A 1LF1A 5BXTA 1CIUA 4JAWA 2YA2A 2YDSA 1XH2A 3N9KA 3RM4A 1M03A 3TA9A 4EAMA 1CLVA 3ARWA 1NP0A 2UY2A 4UQEA 1E1FA 3VD5A 2Y4SA 4MDPA 3MV01 4GPNA 4J3SA 5JBDA 2XFFA 1UR2A 3AROA 1JAKA 2PWHA 1US3A 3SCSA 1C7SA 1H0IA 5BXPA 3WF2A 2DDXA 2WPGA 5KZ6A 4X0VA 3MUIA 3OBAA 3VIIA 4TX8A 4W5UA 3L4UA 5D9OA 3WL0A 1UWRA 1R7OA 4PRWA 2UY4A 4QAWA 3RILA 4F8XA 1V0NA 1WDQA 4ACZB 1EQCA 2ZX5A 2Z1SA 1GVYA 1C8XA 4HOZA 1BG9A 3ZJ7A 1E0VA 1MQPA 4OJYA 3FHQA 3MV11 1G1YA 2F2HA 2AAAA 5D8WA 5LYRA 3N17A 4MDOA 3VDHA 3WDHA 1G94A 3GYCA 3WQ6A 1ZBVA 2JE8A 3GH5A 3FAXA 3W82A 1QNPA 1XV8A 4FLOA 4AZ6A 4GZJA 2C0HA 4PMZA 2E9LA 3AIRA 3LPGA 1AMYA 2PWEA 4CD4A 2VMFA 3SCRA 4Q22A 5A95A 1YQ2A 3CMJA 4EE9A 4U5KA 4URIA 5EFFA 4PN2A 1H41A 4P7OA 1JYVA 1TR1A 4HPHA 4XB3A 2PWGA 2CNCA 4CU7A 2FDMA 4P8VA 1FFQA 4U2YA 4WIWA 3DC0A 4K68A 3BAJA 1MQQA 3O6AA 1WZMA 1WPCA 1EH9A 3CUFA 2F8QA 4QFUA 3RM8A 2EJ1A 4GXPA 5A8PA 1KCKA 2RGLA 5BRPA 3CUGA 3PZOA 1D7FA 4A3YA 1LG1A 3CZGA 5DF0A 4CCEA 1B90A 3WQVA 3K8MA 1B9ZA 4KGJA 3CTTA 4PTMA 3QHOA 2E9BA 4UFKA 5I0DA 4JZ5A 2WAGA 1ZL1A 2CCRA 3PTKA 1UWQA 1W3JA 2WK2A 3APGA 2D22A 2W67A 4MJ4A 1A3HA 1NWRA 4MTVA 1C8QA 3GH4A 1HJQA 1KWGA 4U3CA 4E2OA 1OINA 7TAAA 1BVNP 2ZX6A 4F9JA 3WFLA 2IXUA 1HN1A 3T2QA 1CGYA 3FNDA 1QI0A 3L4ZA 4MNMA 2VURA 2WSKA 4KRTA 3EDDA 2XIIA 1J11A 3L4VA 4WKFA 5HBFA 4M80A 3MANA 1FP8A 1HT6A 2JF7A 5IHRA 2PB1A 3GBDA 4QP0A 3WELA 1VFOA 1I1WA 2DSWA 4TOQA 1CXIA 3VOCA 4AW7A 4WKAA 3AXIA 1EXPA 4JFUA 3WD2A 1UZ4A 3EDFA 4AIEA 3WNNA 3ZSTA 3SCPA 3A4AA 3SCWA 1EHNA 1U30A 3VMNA 3WBAA 4B15A 3U5UA 5A8QA 1BFNA 4DUWA 1WP6A 1W9UA 4IPLA 3WH9A 3ARPA 2CBIA 3L4XA 2Q8XA 4UFJA 2V3FA 3RDKA 1L8NA 3VIGA 1EDGA 2PBGA 3K8KA 1JNEA 3W38A 1W2PA 4EANA 1UHVA 2D0GA 3VILA 5HPOA 1LQ0A 1OCQA 3SUTA 5DT7A 4XZWA 3RMEA 2WVTA 1CDGA 1KXTA 5M03A 4J3VA 2D23A 1UQYA 4LXFA 1PEZA 5ABHA 2DPEA 3T0DA 4PMQA 4UTFA 3AHTA 3CPUA 1NWSA 2VZSA 4JCLA 3UEQA 3MO4A 4UQ9A 1NWTA 3VX1A 2XSAA 1D3CA 5DT5A 1GVIA 5A6SA 5JUVA 1V3IA 1V3LA 3L4YA 1NARA 3EDEA 1W9BM 4LYPA 4Q7NA 5ECUA 3VIMA 2OYKA 3AS3A 5FL1A 1KGUA 2B31A 2WHMA 3AHYA 1AQ0A 2G3NA 3AIVA 2DIJA 4WSJA 1J0JA 3WUFA 4D72A 4MADA 4YHEA 3ZIZA 5IFPA 2EPLX 3N11A 3VM5A 1E0XA 1RPKA 1R7AA 4CD7A 2VNCA 1HKKA 1SFSA 3AS1A 2ZOXA 4GQQA 4CGTA 5I77A 3E1F1 3I3EA 1OBAA 3CUJA 5HDRA 4NI3A 1KB3A 2VX7A 2XIBA 1B0IA 2J7CA 2UY3A 4AISA 1PZ2A 4P7RA 1WNOA 3U5YA 1EHAA 4BQ2A 4C7FA 3BAKA 5D8ZA 1W1PA 2GDVA 4MPKA 4AD1A 3TTYA 3D3AA 5IXEA 1G9HA 3RIKA 1UD8A 1HJXA 2W4XA 1JAEA 3NCOA 1TG7A 4MB5A 3NSNA 1LL6A 3SUVA 3NUKA 3MSGA 3J7HA 4N42A 2WMFA 4L4PA 4NSBA 4UQAA 2WM0A 1QBAA 4R5EA 1SMAA 1E5NA 1HNYA 3EDJA 2BNJA 5A2BA 1H2JA 3IAPA 4GZIA 1F4HA 2WMGA 4U33A 3SCQA 3TOPA 4B16A 2ZUVA 1R85A 3N18A 1RP9A 3KEHA 1V0LA 3A3HA 4AD0A 3EBVA 3VMOA 1K9EA 4H7VA 5ABFB 3BGAA 3BLKA 3K46A 1GHSA 1UR9A 1V6WA 5HXMA 1OSEA 1BLIA 3BLPX 2XYLA 3IK2A 1LWHA 1NQ6A 1W1TA 1W9DM 3OA5A 4CN6A 2J79A 2DIEA 2YL9A 2BS9A 3POHA 5A1AA 2XVNA 2UWFA 3WMSA 4UFHA 2OSYA 3AS0A 2XVLA 4CN4A 1FP9A 1HP4A 2J8GA 3FHAA 1Z32X 2VI0A 3G6LA 4PCSA 4E4PA 4HTYA 2CPUA 4ML4A 3TTOA 4PBGA 1VFFA 4PMUA 4PSPA 2YOCA 3BSHA 1UR4A 4HMDA 5FOOA 1O7AA 4E8DA 5I78A 1XRVA 3AQUA 1D2KA 4AZIA 1E15A 1E70M 4Z2LA 1KQZA 2Y2WA 3WEZA 2QPUA 3WNPA 1PAMA 1XD0A 3VD9A 3KL5A 3N15A 4LYQA 4F79A 3K1DA 1E4MM 3IJ8A 3MUY1 1B3YA 2Y5EA 2FH6A 4NRRA 1UWSA 1UOKA 3ZT7A 1CGUA 3WDPP 1JL8A 1VBRA 2W63A 3VKKA 4A3HA 3SUWA 1VEPA 1XYFA 3AIUA 2YA0A 1EOKA 3ZM8A 1I75A 3WQ5A 3RJXA 2NT1A 4HZ6A 5F7UA 2YBUA 1C92A 1GOQA 3PZ9A 2BY2A 3PBGA 2V3GA 1V0KA 3AI0A 1JDCA 1ODZA 2WNWA 1BPLB 4UNIA 1E6QM 3UR8A 4F66A 3MMUA 4M1RA 2WMIB 5HOSA 2J7GA 5E70A 2WSPA 2VL4A 2YIHA 3CBWA 3FW6A 1SMDA 1GOMA 2YLLA 1JGIA 3T0BA 3GDBA 3ZJ6A 1H5VA 3PTMA 4BZYA 2BVDA 1WAWA 2NSXA 1V3KA 3IJ7A 4ZE4A 2DGAA 1OT1A 4D1IA 4PMXA 1FH7A 2FHFA 1B3VA 3WD4A 3ZSSA 2WKGA 1GZJA 3VDBA 1DWJM 2VVSA 1ECEA 4D6GA 2WWDA 1GORA 2CERA 3BAIA 2WMIA 1M53A 1CXEA 1VBUA 2E8ZA 1EA9C 3VUPA 3QHNA 3SCOA 2WVUA 2XHYA 4P7QA 3GXIA 9CGTA 4UQBA 1CGXA 2J4GA 3WNLA 3CHCA 1E43A 6A3HA 2DT1A 2GFTA 5EB8A 4TTGA 2DT3A 1GQIA 3WY1A 1IZKA 1UA3A 1DTUA 1EDTA 3WF4A 1ISWA 1QBBA 2E4TA 2GUYA 4IPNB 4M29A 4P8WA 4W8AA 1BYCA 1KBKA 1V6VA 4JHZA 3KL3A 3VD7A 5JIPA 4JKLA 5I24A 3QGVA 1QNRA 1E4NA 1KXHA 2VR4A 2J7EA 4H8UA 4D71A 1NH6A 3AHVA 4CCDA 2VR5A 3PZUA 3W81A 4FLRA 4CVWA 4AEFA 4AZCA 1P6WA 4B9ZA 4GQRA 4ZXOA 3AZSA 4W8BA 4N0RA 2UY5A 4DWSD 1V02E 1DP0A 3RJYA 1VF8A 1K9TA 1QHPA 1ZBKA 2WYSA 2YKKA 1NOFA 3BAYA 4QLKA 4P7NA 2VTFA 3ZQ9A 4IM4A 2JIEA 3ZJ8A 2QMJA 1HJWA 1KR0A 1NOWA 1UKSA 2EPKX 3SUUA 3L4TA 3BCFA 1CGVA 3VNYA 1E1EA 3GZAA 2OYLA 2Y8KA 5CQ1A 1CXHA 2VZOA 3FAWA 3F5LA 4PMDA 2VRJA 4XV0A 1QW8A 3CUIA 2YLAA 2G3IA 2CITA 3AIBA 5AC5A 6TAAA 2W91A 3AS2A 3CGTA 2V38A 3GNRA 1EQPA 1PPIA 3AZRA 3IAQA 1KQYA 1GW1A 1W32A 4HZ8A 1DWAM 3MMWA 2WCSA 4ATDA 1WZKA 2CBVA 4JCMA 1BGAA 1OD0A 5CLWA 3AMGA 1XGZA 2CKSA 2VJXA 4JL1A 5FIPA 4Z2IA 2O92A 1UKPA 4C7DA 2BFGA 1WZAA 1MFVA 4PTXA 1V6XA 3THCA 4PUDA 3U7BA 2V5CA 4TXEA 3O9NA 1CENA 1TA3B 1E56A 1DWFM 4PEEA 2WB5A 1E71M 4DUXA 1DWGM 1J12A 4D6EA 1HKJA 1BVZA 2GJPA 4V2XA 3VIFA 1V3JA 3CZJA 4TVUA 4HU0A 3WQ8A 3M07A 2VCCA 1DEDA 4OIFA 1FH8A 1KBBA 3VIJA 4W7VA 1PZ3A 4DM1A 2GDUA 3KWXA 1CWYA 4IISA 4JFTA 1FH9A 1HVXA 4ZEPA 4QCFA 2J25A 3LPFA 5E6YA 2E40A 4MB3A 3NIYA 4CD6A 1JFHA 1FHDA 3W25A 1TA3A 1FHLA 2DH3A 1QI4A 1X6NA 1JZ3A 2CETA 4M56A 3ARUA 5HNNA 4LGXA 2YL5A 1GONA 3SCUA 4FLQA 4NZCA 4J3WA 1TVNA 2WMHA 5JBEA 1JZ8A 4LX4A 1GOOA 2VT0A 2VZUA 2J78A 4AWEA 5EBAA 3AZTA 2CESA 3WDQA 1N82A 2D3LA 1UH2A 1E5JA 3WEOA 1PX3A 2XWDA 1VEMA 4JKKA 3ECQA 1B2YA 1MXGA 3N1AA 4HZ7A 3A4WA 4PTVA 3WIJA 1LLOA 3VD3A 1MW1A 1EOMA 1C91A 3AFBA 5I79A 2J74A 1QVBA 4W85A 4FF5A 1UH4A 2E9MA 4AC1X 4KH2A 4UOZA 3DECA 1B1YA 3WH5A 1Q4NX 1J0IA 3GH7A 4UQCA 4UZUA 2G8ZA 3UERA 1UZ1A 3BSGA 2XFRA 3KL0A 2XM2A 2XM1A 3SUSA 4JIEA 2G41A 4OOUA 2XVKA 2VX4A 5JBFA 1XH0A 5I5RA 2VZVA 2D24A 1LJYA 1W91A 2GJXA 2VQUA 2ZXDA 4FK9A 1Q6FA 3MU7A 2D0HA 1AQMA 3PZTA 2WMKA 1MWOA 3VD4A 2D20A 3DYMA 5TD4A 4PMVA 2XTKA 3GXMA 4B3KA 1V6UA 1RH9A 1HF6A 2GVYA 3N12A 4AD2A 2XUCA 4WF7A 4CU6A 1E72M 1XHGA 3CUHA 8A3HA 5CGTA 3VGDA 1K9DA 6CGTA 4BS0A 2WVSA 1ISVA 2DSZA 1R86A 1QHOA 5AC4A 4A4AA 4UFLA 4WLCA 2A3EA 4GZEA 4Y7EA 3W53A 3PZGA 5CSYA 2O9OA 1UD2A 1KGWA 4M82A 3EMQA 1OIMA 4OZOA 1JDAA 1YHTA 4PCTA 3NSMA 1ISZA 1JZ4A 3T0AA 1RD6A 2G4FA 1K6AA 2AMGA 2XGIA 4X9YA 1PBGA 3GNPA 1OWQA 2QV4A 1JZ2A 1VB9A 4AD4A 4D6IA 1ODUA 5A6BD 1Q6GA 1G0CA 3ARTA 1V3HA
chains in the Genus database with same CATH superfamily
5TQLA 5BRQA 2QHAA 1IWPA 3UESA 3OOQA 1XH1A 1XDMA 3L4WA 3BURA 1Q7QA 2EG8A 3HJEA 3PWGA 4NQ1A 3WQWA 2X0HA 4LAZA 1AW1A 2X8RA 3SQMA 1CYGA 4LW7A 3WQ4A 1T8XA 4LAKA 2POZA 1MDLA 1KFCA 3H53A 4J3TA 2I1OA 4XKYB 1MEWA 4PE8A 4QEHA 4PFHA 3GDLA 3KTSA 2VFHA 4I9MA 2CLHA 5D4YA 4JDBA 3W7CA 4GI6A 3ZXWA 2XJ7A 3C4UA 1KXVA 4Q4OA 4QRNA 3CB3A 3RN6A 2WO5A 3W9ZA 4F9DA 3TVAA 3P0XA 4RZ6A 5EMYA 3ARSA 1RAKA 4KRZA 3M0YA 2HK1A 1PIFA 2X05A 3W29A 3MMTA 3WD1A 3MP4A 3ICJA 3W75A 1XBYA 1VPXA 3I65A 4AFYA 2AGKA 5C9RA 2MNRA 5BXRA 4LAUA 4UIOA 3K4AA 4DJDD 1BWVA 1VH7A 3AIWA 1H11A 2G0WA 2DH2A 3MUXA 3DGRA 2RGMA 4O16A 4AVFA 3ARQA 4J5NA 3IJIA 1X1ZA 4WJXA 2YCKX 1KLZA 3VGGA 4FHAA 2ZX7A 2R6OA 1BXCA 2ZC1A 5CLTA 4RE3A 1PCKA 1FX6A 4MAVA 2GOKA 3W24A 2F38A 2IQTA 4I7WA 2YXXA 3PR2A 4U5IA 1ESWA 4C6MA 1QWGA 2YCEA 3SECA 5CJNA 1E4IA 3NJ3A 1OHLA 2WWCA 2VXNA 5A6KA 1CX9A 3MDUA 3R12A 1VHCA 3G2GA 1HFBA 1EUAA 3GD6A 3R0UA 3VC5A 1V08A 3UD6A 1UD6A 3BAWA 4GI8A 1H1YA 1OFRA 4KWUA 1U1UA 1XYBA 2V5BA 3AIEA 2PEVA 2WBGA 3F5JA 3NNTA 3LERA 3GR7A 3AYSA 2CXGA 1GQLA 3UJ2A 3CIXA 4L4OA 4UNLA 1W1VA 1W5OA 5PTDA 4NT0A 1C90A 3ARZA 1OF8A 3B9DA 2J88A 3DHUA 3KXQA 3E96A 4GXMA 4LVAA 1ZGDA 3RPMA 3RR1A 1ICSA 2ISDA 2QKFA 4HU4A 3AU6A 1J10A 3OZYA 3RPTA 4HK5A 4EPBC 3LENA 2JGQA 2WNZA 4G7EB 3VU2A 4LYRA 1V0MA 3EA1A 2V8ZA 2BZNA 1C8YA 4MAZA 4XISA 4BEQA 4RE4A 1XF0A 2WZHA 2WCGA 3S46A 2PC8A 1WDSA 5CH9A 1H0GA 4O8RA 4X63A 1PX8A 5CC5A 3KOFA 3W2LA 4IMFA 4GHRA 3QC3A 5DO8A 2C3ZA 4O1CA 1XWYA 1ISXA 4W88A 3QMTA 4CD5A 1W37A 1AUSL 3ARRA 3GUGA 2Z1XA 4RCXA 2CLFA 2TMDA 3IJDA 3IS4A 3OVGA 4TMBA 1IIGA 1PE1A 1RV8A 3UG4A 1S5TA 1JDEA 1IEVA 4LPCA 2WZIA 3KZPA 4ZZ9A 1O60A 1YPIA 3P8JA 1E6RA 2ZRZA 1G4EA 3OODA 1UUOA 3OA3A 2X1IA 3ALGA 7PTDA 4HNCA 1DE6A 2CWXA 4K8HA 4H04A 1AH0A 4YXGA 4A8RA 1LL4A 5EMMA 4BI7A 3VDCA 3KX6A 5A5WA 4Q4QA 3RPDA 2FGZA 4Z1DA 4QAIA 2OYMA 2EKCA 1KGXA 3SR7A 2ZWZA 2ZE0A 3WNMA 3LHTA 4BCEA 2R82A 2EJAA 1RP8A 4AD3A 3QZAA 1ZBWA 5D9NA 4WY0B 4INFA 1GOWA 4UQDA 2DUZA 3UZZA 1JG9A 2D2OA 2DVTA 1ITUA 1DYSA 2X1SA 3TNBA 4QDWA 3M5YA 5FCZA 2DT0A 4OOZA 1H4PA 3SIMA 4EXBA 2QDGA 4JOMA 3B0UX 4JTCA 4IPPA 3LLDA 4BF7A 2QCDB 1DWIM 3CHEA 5GVJA 4F0RA 2RDWA 4MB1A 1QPKA 3F4NA 3FN9A 1DIOA 1Z3NA 2PTYA 1HJVA 1QMLA 5MF5A 3K5XA 1KTBA 2FH8A 2J27A 1NP2A 1GKQA 2F7FA 2VGFA 3QGKC 2E0PA 3VZYA 3KZSA 1BYBA 3QF0A 3A6OA 4KBXA 2ACQA 4KIRA 2OLHA 3C0QA 3D6NA 2ZUUA 4K1GA 4S1FA 3CIVA 1BQGA 1EX5A 1Z42A 4AZ7A 1GCYA 3REQB 2J47A 1PWLA 4YPJA 5FF7A 4C60A 1Z44A 3T6CA 1I2OA 3KP0A 2PLMA 2WLZA 5CPSA 3W7JA 4PUJA 4LUTB 4PUMA 2JEPA 4ZQOA 2BSLA 1IR2A 3NDYA 1BTMA 4K8EA 3MDWA 3GR8A 1HUVA 2GPTA 5FD0A 3EX6A 3L12A 1LRTA 3O2LA 4PTNA 1UJQA 3M1ZA 3WENA 3GBEA 1OG6A 3ANVA 2Z27A 2XSXA 1MEIA 3MYPA 2R8WA 1U1HA 2OU4A 2FDSA 1ZHAA 2A0NA 4CCCA 1GPFA 1MW2A 4GABA 5I3HA 5E0FA 5M17A 3A47A 3TTSA 3URNA 1AFSA 2GJXB 4B5WA 2V5LA 1BGGA 2ZRXA 4GGBA 1CLXA 1ITCA 3CQHA 4IOTA 3P5ZA 3W7NA 3KHDA 2QPSA 4NZ4A 1IZJA 4RV8A 1TCMA 3R1ZA 1I1XA 5A6LA 2HVMA 4A8LA 4US6A 2WW5A 1B3OA 1C7TA 3VCRA 2FPTA 1GVEA 5EMKA 2D3NA 4ZA0A 4EWND 1TUFA 5DMYA 2BY3A 5BCAA 4YCOA 3G1DA 1K03A 1QO2A 3VGBA 1FWTA 4NRSA 3DENA 5BMXA 4V28A 2E6DA 3S9ZA 1THFD 1XYLA 4E3VA 9XIAA 2CIPA 4NJKA 3NPUA 3TW9A 3LSBA 4D8LA 1WDRA 5C8BB 3Q2DA 4LV9A 4MUZA 3A4XA 2IPFA 1SSGA 3GNDA 4YS1A 1HGWA 1YXCA 3BOXA 3VO0A 7ODCA 2R9RA 1OGSA 4XO7A 2ZRWA 4YTSA 4IQEA 5HMSA 1VBJA 2E1WA 4Y8EA 2JK2A 1YKWA 1JUBA 2DZUA 1SGJA 4IMGA 1XD1A 3LX9A 2J9XA 1FWDC 5D38A 4S38A 4G1KA 4GGHA 1V79A 2FTYA 1U1JA 2OXNA 4J27A 3M0HA 3DXIA 3B4UA 4DWDA 1M65A 2BASA 1SZRA 5A69A 1WBJA 3W26A 2EPOA 1RQEA 5I3JA 5C9UA 3B9AA 2V82A 3FX4A 3LBOA 3DAQA 1GVSA 3SY8A 2GVLA 5JMUA 3GDTA 4ASTA 3P80A 1JF5A 3C2YA 5C70A 5KZMA 3OIXA 1P7TB 2AOSA 1E6NA 1OY0A 3LEPA 1A3WA 3RMJA 3MS8A 1O5KA 5IHSA 1W56A 4AD5A 3DFOA 3BZGA 3LTSA 3ABQA 3WLTA 5E1QA 3WK2A 1E9YB 1K9FA 2YL6A 4AY7A 1W8SA 4Q4MA 1AQFA 5DEZA 3IIOA 2YGYA 2YFNA 1L6YA 3POCA 1EJUC 2CYGA 2OWCA 2ZICA 1EDQA 1PKMA 2OT0A 4MY8A 4EIVA 3V0TA 3A3WA 5MKGB 3EKLA 1JCTA 3FJNA 1TJ2A 3TSBA 1J8VA 2QLYA 4UBPC 4QXIA 3DG7A 1R3VA 1N8WA 4RJEA 4J2PA 3UXAA 2XIOA 2I56A 4ZB0A 1Y65A 2H9AA 3PZNA 4AYSA 2XZ9A 3ENLA 3W1AA 5KMYA 4MPQA 2DT2A 3AC0A 3L68A 5M1TA 4DXXA 4MJMA 1J0KA 2BB0A 3SO7A 3WUBA 1KR1A 3NSXA 2BHUA 1BTCA 3F4DA 1GYLA 1UR3M 3K1GA 4ZFMA 3CAWA 1B54A 4C6FA 4GJJA 3AMKA 4YN5A 4F0HA 8XIAA 1PYMA 2FIQA 1IXPA 4HA1A 4RDYA 1DQUA 3AHXA 4UFMA 4WXYA 4O4VA 5ABFA 1AD1A 2CLEA 5DMMA 1SW3A 4REQA 3RX2A 4AIBA 4YHGA 1UD4A 4DBSA 5C2GA 1UMLA 5CG0A 3RYSA 3W4RA 1CNVA 3F4CA 1GVRA 5KEZA 2PLJA 1BVWA 1V7AA 4IUGA 4LYKA 5E0CA 2DQXA 1ONRA 4XSLA 4L9XA 3EPMA 4AZHA 4L1WA 3M0XA 1UD3A 2YDQA 3W76A 1DJWA 4BEUA 3PTQA 1M01A 2TRSA 4EPEC 3E0FA 3W27A 2WNQA 2Y7EA 3HZ3A 2MANA 3KDNA 4CNUA 3MP3A 5A6TC 2VQTA 1YBQB 1U2YA 3AWOA 3MUAA 1CBGA 4CD8A 3S6DA 1KA9F 2X0YA 2V3DA 3CHFA 3A22A 3SRFA 2HISA 4ZTYA 5ABEA 3HV8A 3QZEA 2XGZA 1UR0A 3SN0A 2DSKA 3BMVA 3PHAA 4A35A 3LGGA 3E0VA 1HKIA 4GFSA 3E38A 1XSIA 2J8FA 4AXKA 4D6FA 3OG3A 1Z41A 3OPSA 3JS3A 3QHMA 1C9WA 4NL1A 3R8GA 2QCFA 3KRZA 3T09A 3B0YA 2PGFA 3QVQA 4HP5A 4NVTA 3BV4A 2QNEA 3MSDA 4Z1YA 3P74A 2AL2B 1FHUA 1HL2A 3VYLA 3PZQA 5HANA 1R9YA 1UA7A 1XCWA 3WK3A 3B9NA 1YXYA 1A5SA 1ZJAA 1A5CA 3O63A 1DQWA 3RCMA 1A53A 3RCYA 3C2OA 5K9DA 5CZ0A 2CW6A 3BE7A 4NYUA 2GQ9A 1M03A 2FJUB 3TJLA 1XYCA 1E1FA 1K7XA 4MY1A 3LYEA 1I60A 4M51A 3RG6A 2FZDA 2FVLA 3GTHA 1UR2A 2C19A 3M5XA 3PY2A 5G2HA 1LUCB 3WF2A 4C6DA 1A5UA 4O14A 1XUUA 3MUIA 3OBAA 1H7WA 4W5UA 4DJFD 4ML9A 4PULA 4ICMA 1FWCC 2UY4A 3RILA 3NQFA 3PJWA 1IYXA 4F8XA 1Z6KA 4ACZB 4QEEA 2Z1SA 4JTDA 5FJPA 1GVYA 3F7JA 3ZVHA 1XW8A 1S3HA 4GYFA 4LS0A 1JGMA 3K13A 4AY8A 5D8WA 3NQAA 2XN0A 1GWJA 1ZBVA 1UPMB 2JE8A 2GGEA 2QJNA 3W82A 1XV8A 4L9YA 9RUBA 2C0HA 1XLGA 1OVDA 4Q8VA 2PWEA 1QPNA 1YQ2A 1QRQA 2NVAA 4U5KA 1W1ZA 4CLMA 5EFFA 4P7OA 1JYVA 2PWGA 4CU7A 4EP8C 4P8VA 4DJEC 4U2YA 2POTA 1H50A 3BAJA 4DX3A 3SQSA 2VEMA 3PF3A 4DNMA 1EH9A 3RM8A 3P61A 2VR2A 4XD3A 3CUGA 1D7FA 2NUXA 3H26A 1RCXB 4JTFA 1I45A 3CZGA 5DF0A 2FZMA 4IICA 3N29A 3SQLA 1VIZA 4PTMA 3QHOA 2E9BA 2FMNA 2VEPA 3D47A 4GY7A 2WAGA 3W2UA 3TZFA 1W3JA 4S23A 1UROA 3APGA 1OCJA 4MJ4A 3CQJA 1OINA 4MM1A 7TAAA 2ZX6A 1HN1A 5FJJA 3OVQA 5AYZA 3L4ZA 1QOQA 3R2GA 4KRTA 2XIIA 3KBMA 1J11A 4WKFA 1IWAA 3MANA 1FP8A 1RPXA 3WQOA 2JF7A 3CL7A 2PB1A 2X30A 3QV6A 3RX4A 3TJIA 2Z24A 2DSWA 4R7WA 2OZTA 1YE6A 3MI2A 3AXIA 4H9XA 1EXPA 1RBOB 4IMAA 4Y96A 5HQEA 1XLCA 3A3XA 4AMAA 3EDFA 4ZSUA 4YL2A 5F4SA 4QJ3B 3B4YA 1U5VA 3SCPA 3C3UA 2O4MA 3APYA 4GCXA 1U30A 5K7JA 2HBXA 2CLPA 2NXIA 5A8QA 4DUWA 1XIBA 3IARA 1WP6A 1W9UA 8XIMA 1DXFA 2Q8XA 3EWBX 4CQCA 2V3FA 3RDKA 4A05A 1X96A 5CJMA 4JIHA 3ITOA 3NQCA 5MHBA 3WCZA 3NM1A 2A85A 2Y0FA 3G24A 4RK8A 1OCQA 3SUTA 3H7RA 3M0LA 4NKCA 5DT7A 4B92A 3IUHA 1YADA 2WVTA 4YTUA 5ECVA 1CLKA 3SAZA 1FCUA 1F8MA 2DZXA 1VZWA 3IUDA 1RCOB 4J3VA 1ME9A 2DZSA 1H51A 3OP2A 3WLNA 4LXFA 4TIMA 3T7VA 1BD0A 1KCZA 4UTFA 2KX9A 1PO9A 1NWTA 4IGMA 3TQ0A 3GW0A 4G8TA 1D3CA 5DT5A 1GVIA 1V3IA 3DFYA 3TYDA 4LV4A 3EDEA 4FA3A 3QFWA 3UZ5A 4O1FA 1J2BA 2OYKA 3AS3A 4WEVX 5FL1A 2B31A 4UMAA 3HPSA 2YCJA 1AQ0A 3OHIA 1XLKA 4IP5A 1OCBA 3B9OA 1A0EA 2DIJA 3MBDA 4MMWA 1J0JA 3KP1A 3JZUA 3KVLA 3ZIZA 2I5IA 5DXYA 1R7AA 3QRHA 3MVTA 1VCFA 4H00A 1HKKA 1ZALA 1RLCL 3E6EA 4O1DA 2Y62A 5I77A 4JTRA 2OEKA 1OBAA 3NPWA 4ZR8A 1FWAC 1XL9A 1KB3A 2VX7A 3B0VC 2XIBA 4UCGA 5J04A 2J7CA 2UY3A 3LQGA 1D8WA 3RU6A 1WNOA 3LNPA 4ILSA 4AVNA 2P8BA 1QR7A 1IXQA 4QIUA 3NO3A 3TTYA 2OZ3A 3RIKA 1UD8A 1HJXA 2PDKA 2FZ8A 5D2YA 3S2NA 4KCWA 3NSNA 5GJPA 3J7HA 4H6RA 1SJDA 2E67A 4UQAA 4GJ1A 1QBAA 1K7FA 5A2BA 4GZIA 4E6MA 2VP8A 3N18A 1POJA 3A3HA 4FNQA 3VOHA 3EBVA 3VMOA 4AD0A 5CBJA 1GVQA 2CU0A 3BLKA 3K46A 1YMYA 4LB3A 2NLIA 2BOGX 1FWBC 1VBHA 1H1ZA 3QKZA 5K4XA 1MRQA 2DIEA 1VLWA 3P82A 3CWOX 1KFEA 2YDAA 3DKJA 3ITYA 3V18A 2FTWA 3AS0A 3G1VA 3FHAA 2WJFA 5D02A 2BODX 1T8QA 2VI0A 4E4PA 4HTYA 1KV8A 1P0BA 2CPUA 4KCVA 3SBFA 4ZQPA 3TTOA 2P0IA 4DF1A 2GUBA 2Z28A 1UR4A 3ORWA 4HPXA 3WJZA 4HU3A 4DYEA 3TIMA 5I78A 1XPYA 1GQNA 2GVGA 4AZIA 4K1WA 1E15A 1E70M 4Z2LA 4AF0B 1SU5A 1TWZA 2HK0A 4L6DA 1MZRA 4JTUA 1XD0A 4F79A 4QG8A 3IJ8A 3VABA 3O7UA 2YCLA 1KBIA 3WDPP 3IGXA 1JL8A 3K30A 3N4AA 2QUUA 3VKKA 3SUWA 4LFYA 3WQ5A 4X2PA 1N8IA 4PUUA 3H21A 4XQ6A 4C5ZA 2YBUA 3WBYA 3CT7A 1C92A 3WZ0E 2IKHA 1JUKA 4O52A 1GZGA 1TX2A 3PULA 5DANA 2Z2UA 4IQJA 1EC9A 1JDCA 2QPXA 1ODZA 4PRRA 1KFKA 5CPLA 3UR8A 1K8YA 3V4BA 3LHZA 4IH3A 5HAOA 1K8CA 4IJRA 3RRXA 3WQGA 2WSPA 2VL4A 3FW6A 3U8GA 2GJNA 1KM1A 1EPXA 2HNEA 1GEQA 3ZJ6A 2RH9A 3TC6A 4BZYA 1VS1A 3U4FA 1WAWA 1V3KA 2OR2A 5LIUX 4ZE4A 1OT1A 5REQA 5KZEA 4K36A 1D7KA 2RKXA 3GC2A 3W02A 1GW9A 2OJPA 3WD4A 2VVSA 1ECEA 3RLVA 2OODA 3BAIA 3G8RA 1M53A 4BWLC 1KRBC 2E8ZA 4F0SA 3SCOA 2WVUA 5D03A 1H61A 1CGXA 4XBSA 3WNLA 1E43A 3RXZA 1P1XA 2HCVA 4R85A 2DT3A 3WY1A 1KTCA 3MT1A 1DTUA 1GYNA 3WF4A 1EC8A 2INEA 2HS6A 4W8AA 3KL3A 2PDWA 1QXLA 3ZWSA 2F84A 3PFMA 5D2TA 5C7VA 1SO5A 2FFIA 4JKLA 3R10A 5HJLA 2NLYA 2J7EA 1XQKA 3AHVA 5F2LA 3W81A 4CVWA 4Q6JA 4B9ZA 5CPOA 3AZSA 5FA5A 3IACA 4N0RA 2UY5A 2QZRA 3N3TA 3CM4A 4DWSD 1V02E 4PFMA 1QHPA 2WYSA 4L65A 4YWSA 2YKKA 1NOFA 2GOUA 1DIKA 2QMJA 4WX2A 3LCWA 3EB2A 1KR0A 4G9PA 2VFGA 1UKSA 2EPKX 1RVKA 3L4TA 1MNZA 3BCFA 1CGVA 1LT8A 3AO0A 3TN5A 1UMYA 2DZPA 3UWQA 3EX4A 3H2AA 3H2NA 4ERGA 2VZOA 3FAWA 3GU9A 5I07A 4XV0A 3W1PA 2I9UA 2V38A 2ZDRA 2D73A 5CG7A 1FCQA 4JTAA 3HJZA 4GH3A 3GNNA 1QPRA 1W32A 4PUWA 1A49A 2XN1A 5DY2A 1A50A 3MMWA 2WCSA 3OU8A 3UWZA 2G37A 1ALDA 1F74A 4AVOA 4I5XA 3N34A 4Z2IA 2O92A 4C7DA 4QJ5B 2BFGA 3EKGA 2PAJA 4PUDA 4F0KA 4TXEA 3O9NA 3UJRA 3EWCA 1TA3B 3DGBA 4JGDA 3DFPA 4PEEA 1ADOA 1FWGC 2D2HA 1XS2A 3MSRA 4DUXA 1EGMA 1JCMP 5C2CA 4Q8UA 1G7VA 4BFAA 2WSYA 4V2XA 1V3JA 3CZJA 5K4ZA 4HU0A 3WQ8A 3QPZA 1JVNA 4UTTC 4NASA 2QJIA 1KO0A 4KFOA 4DM1A 4BF5A 1YDOA 3ANYA 2ZRUA 1CWYA 2PDJA 4I6KA 4IISA 4JFTA 4NI8A 3EEGA 5FJUA 5DELA 3LPFA 5E6YA 4MB3A 1SPQA 4XZNX 2OKTA 3FVDA 3W25A 1EJSC 2XDFA 2DH3A 3KAOA 1E0TA 3QEZA 1A3XA 4M56A 4O13A 4HCLA 1WQ5A 4FLQA 4ORMA 3W6YA 5JBEA 3T44A 1WDDA 3BJSA 3GIQA 4LX4A 1GOOA 5CSSA 1WV2A 2J78A 3VNIA 1VPQA 3ISIX 3LXAA 1EA0A 2D3LA 5FJTA 1UH2A 3TLLA 1CW2A 1PX3A 1WBHA 4JKKA 3ECQA 1B2YA 5HJYA 2QUMA 1MXGA 4HZ7A 4PTVA 3WIJA 3VD3A 1VYRA 1MW1A 2V2CA 3AFBA 3QN3A 1P5BA 1XKYA 4CNNA 4FF5A 1LT7A 5AHLA 3DECA 5FF3A 1LYXA 3W2KA 5BW6A 2ZKMX 1C9DA 1UZ1A 3BSGA 2XM1A 4WGXA 1XCFA 2G41A 4D2JA 2XFWA 5JBFA 1XH0A 4B5XA 4Q4PA 1M6JA 3HPXA 4LY4A 5HWJA 3WBWA 1LJYA 2ISSA 3IIPA 2Y7GA 3UPWA 1J6PA 3TN6A 3R79A 4Q8OA 4DZAA 2D0HA 2RAGA 4EVZA 1AQMA 3PZTA 2WMKA 4L56A 1SSDA 5B7YA 1NFGA 4MWAB 3IIXA 4B3KA 1V6UA 2W27A 2CLMA 2GVYA 3N12A 4AD2A 1BRLA 4QGCA 4WF7A 4J1OA 1JPDX 1E72M 2QGHA 3IVSA 1TV7A 3BARA 3CUHA 1SO3A 2P3ZA 3TN3A 1K9DA 3UF9A 5TNVA 1O5RA 6CGTA 2WVSA 1ISVA 1UC5A 1WXYA 3FFSA 3O3RA 3BG3A 2Y88A 4GUJA 3BJFA 4GZEA 3VKAA 3PZGA 1J2WA 4GI4A 5CSYA 4YIWA 2O9OA 4GG9A 2WJEA 1AD4A 2QCGA 1KGWA 1MEHA 3LI0A 1OJXA 3WLLA 4RDVA 3GC4A 1JDAA 1YHTA 3HPZA 3L67A 1MZHA 3PM6A 3L0GA 4WDTA 3PSWA 4HKPA 3W7OA 1G69A 3LM3A 3TE9A 1VB9A 2NV9A 3BLOA 5A6BD 3BLDA 1V3HA 4RX0A 4ADSA 1F6KA 2YFOA 1SYTA 3GQYA 3I7RA 2PGEA 2HXUA 2BP1A 3GZ3A 2XINA 1Q6DA 4LAOA 1OM0A 1T41A 2GK1B 1QI3A 1EZWA 3CMGA 5AVNA 4Q4KA 1TVPA 1E1CA 3AXHA 2G5WA 3EKZA 2B7NA 4C6CA 4BQ3A 2ALRA 2ZZ1A 4QCEA 3NFUA 1HIZA 5D2XA 4I3GA 3W1QA 3VNZA 2UZ9A 5A8OA 5M5DA 3QQ1A 4FIQA 5EFDA 2V5KA 3QKEA 4CQDA 3LMYA 1QJWA 1MFUA 2AQOA 1Q2SA 1Q45A 3MI3A 4IG2A 5GNYA 5JQ9A 4IPJA 3G0XA 2ZXBA 7A3HA 2TAAA 4QLJA 4XKYA 1SW7A 4IHCA 2FFCA 4GKTA 2V68A 3UG3A 4M6VA 1OX4B 5KSWA 3CK5A 4KEZA 5LHEA 1JRCA 4Z1BA 1MMFA 4OBSA 3RM9A 2OTDA 1JPIA 3DH7A 4FMVA 3EX3A 3Q45A 1ZJHA 3WD3A 4QS5A 3NQVA 4GNKB 3WF0A 3VGEA 3VE7A 1NM9A 1Y0EA 1GQJA 1A0DA 2P50A 1VCGA 2ZQ0A 2ISWA 5EMLA 3TWAA 1N8FA 4E4UA 1R38A 2V6AA 3W2MA 2ASHA 3U4AA 4S3GA 3VTRA 3W7QA 1JXJA 2ZXAA 3U0HA 3TOYA 4DXKA 4QSHA 3OGSA 3XIMA 1LL7A 1VRXA 3URBA 1ZB5A 3CO4A 1L9WA 1V8EA 4D6JA 3LB0A 3VMPA 3CTLA 3QTGA 5I3GA 1U33A 2WKLA 2CEQA 4UTHA 3A9BA 3FKKA 4LUSA 4YNGA 3MKCA 3MWCA 4JL2A 3SCNA 2VFEA 5E0KA 4ICNA 3ITCA 1RQHA 4UUIA 1J18A 1WB0A 2O55A 2PF0A 1PX4A 3F5KA 3RHGA 3VVGA 1P0KA 3EMZA 2Y8VA 3URAA 1US2A 3WKZA 2NW0A 3S9IA 3G1FA 3W7RA 3N13A 4IMCA 1PWMA 2LLEA 5E6ZA 3BGJA 5C9WA 1O95A 1B3WA 4M81A 2OLSA 1FWWA 1QPOA 2Z1WA 2ZA1A 5FJRA 1FWHC 1FHVA 3PNZA 2OB3A 1POKA 4H8HA 3VINA 4JIRA 4G56A 3WUEA 3L7RA 2PGRA 1BHGA 1WUFA 1XLLA 4M6QA 3USBA 4X2RA 2B7QA 4DUVA 3WF3A 2WANA 3BWWA 2FGBA 3FDKA 3NZGA 3N3MA 4O19A 1VENA 3ZOAA 1TZZA 4RW5A 4E8GA 4F0LA 4AZCB 5HATA 1H5YA 2PTXA 4GYPC 2W9MA 2QXWA 4GYKA 4MNLA 3E0WA 4DIAA 4PMYA 4KGLA 3FXYA 4PUKA 2TPSA 3H7VA 3FEMA 3HGOA 2C91A 2EBNA 4LUJA 3DCPA 5B7ZA 1OGBA 3BK0A 2I5GA 3S3GA 2FGLA 5FKYA 5B80A 4MJ2A 5LA2A 1M5WA 3VIPA 5BOEA 4AG0A 2V3EA 1GJWA 4TU1A 3WMBA 3WLHA 3GC5A 3EXSA 1TTQA 1NWUA 4QQUA 5BWFA 1B4EA 2OEJA 2OWWA 2XISA 3VNMA 3I6TA 3LCXA 3SDOA 3T2PA 1XXXA 1TPDA 5AC8A 3I6RA 1XR2A 1X6UA 1DJGA 4JDYA 1X7FA 2VHLA 3A64A 4XUYA 3WNOA 4X0NA 3NG3A 2ZA2A 3OGVA 1YPXA 1H09A 4NP7A 5LKYA 1J0HA 5DBTA 2I9EA 1J5TA 2BV9A 4C6PA 3EB3A 2AQVA 3T2OA 2HV5A 3DFTA 2PP0A 4ALDA 1H7PA 3G22A 5A94A 2O7SA 4IWWA 1LBLA 3SFKA 3LPPA 4HK7A 2IXVA 2XSBA 3B9EA 4WY0A 4P7LA 2CXEA 3M9YA 3VFLA 1TREA 3GB6A 4UTLA 4FO4A 5J8LA 2NQJA 1ZBCA 4XVEA 4OE7A 4ROQA 1ZFJA 5LIYX 1VYSX 1XYAA 4JFWA 2JALA 1GTHA 3KOWA 1LOLA 1BYAA 4AIUA 4CEUC 2GJRA 3W7EA 1XIHA 3I7SA 2BHYA 2QAPA 1NDVA 4J9JA 4BHYA 4HJWA 2R1PA 3NQMA 1OX5A 4DJDA 3IJQA 4U3AA 2Z29A 3DHFA 4MNJA 3TJXA 1OB0A 2Q3RA 1M7PA 1W3LA 1E3ZA 1WA3A 1ENUA 3THDA 4HTBA 1S46A 4BI6A 1JJKA 5HNTA 2C1GA 1LROA 4FX7A 1JI2A 5CPTA 4D6HA 4FALA 4Q8QA 1OGGA 3WEMA 3QBUA 7CGTA 1IHIA 1WO2A 4F48A 4K7YA 5EA9A 1RBLA 3M6DA 1WKYA 3UXDA 4S3JA 2OSWA 4ZTXA 2DVUA 2DP3A 5KTLA 3NZ1A 1KWKA 5LNUA 4IXHA 1PKYA 4AXNA 4CUCA 1R8LA 1UJPA 4W93A 2OFJA 3M46A 3PPGA 5IDZA 2GSEA 3A21A 4UTWC 4Z2HA 3TJ4A 2BDQA 5HPCA 3BSMA 3TAKA 4TX9A 2E5CA 5KETA 3CB8A 4WK9A 4DF0A 1TPH1 3W84A 3VGHA 4ZODA 3H22A 1ZAJA 3WLMA 3W88A 4LWWA 4MNKA 1PUDA 3BH4A 1DBTA 1JF6A 3E3HA 4LCSA 1VFTA 3I3DA 1C93A 4W7WA 1QI2A 3P60A 2O9PA 1CB2A 2O7QA 3WLSA 4Y9MA 5AY7A 4XK2A 2VX5A 1H3GA 4FF7A 4ORIA 3TLQA 1NU5A 4MB4A 4WY0F 1KFWA 2PDNA 4M5PA 5FEXA 2WSQA 2XVPA 1EZ2A 2VKZG 5CJ5A 4PA8A 3T55A 1IE7C 4TV6A 3YPIA 5DXXA 3G6MA 3CAKA 1QW9A 3PAJA 3RLGA 4DNHA 1AH3A 4XZHA 1K6WA 3SRHA 4CNPA 5JH1A 2O0TA 1JUEA 1TTJA 2O56A 3R5EA 3WLJA 1NDZA 1XLFA 2V69A 1VRDA 3GHSA 5GNXA 3AISA 2HWGA 1JNDA 4JYEA 3N04A 2Y8UA 2ISFA 3WN6A 3UJSA 4QG9A 1CECA 3R8RA 1V93A 2ZX8A 4GKLA 3GTXA 4FNSA 4NNCA 3KHJA 3U57A 1FOBA 3LM7A 4D8ZA 3RF9A 3S1VA 3LCHA 4AEOA 1DWHM 4OWGA 3L2MA 4ZCWA 4D1JA 3PN8A 1OEPA 3EDKA 2Y24A 5XIAA 4W5ZA 5CGMA 3P67A 3C0LA 1EKOA 5LNSA 2X0SA 4WKHA 3QPYA 3NURA 3I4EA 5TBOA 2WC3A 3DYOA 1R2TA 4MWAC 2PDBA 3C2EA 3VXGA 2PUZA 5GPRA 1S2VA 3DDMA 4E2DA 4FR6A 2ZA3A 2DUXA 3BANA 3LTYA 1TJRA 5C71A 3FLUA 3N2TA 3UZXA 4XZMX 4QDPA 3S1XA 2WC4A 4DB7A 3P8IA 4HNUA 2FHBA 2QDEA 1RZMA 5FF4A 2Z7GA 3BLEA 4O18A 1ZUAX 1P7TA 3GY1A 2JF6A 4PRTA 5A8MA 4H8VA 4DM2A 3ID7A 4UTJA 2YYUA 5BOOA 2FLIA 2A7NA 4ZGYA 3DU0A 1EO7A 2X2YA 4FZIA 3ARXA 4CEXC 1V02A 4DWSC 1W3KA 5F2GA 1O6IA 2QCNA 4S3BA 5JVLA 1S2CA 1E6SM 3BC9A 1T0OA 3DYPA 2ZUNA 3Q37A 6ENLA 7ENLA 1JZ5A 3E2RA 3IGUA 1CEOA 2D0FA 4R9OA 2FHCA 4AY1A 4AIOA 4Q32A 1MXDA 3KRBA 3R89A 1AJZA 1W9PA 1VJZA 2ATMA 4U2ZA 1QPQA 4GI9A 3B8SA 4NZFA 4W4QA 4WSKA 2J7BA 1FWJC 5IDIA 3BXWA 2PDFA 1V6YA 3EOLA 4NJGA 1VJSA 3BAXA 1BEUA 4BQ5A 3GNOA 4HCHA 1JD9A 1MW0A 3CPRA 1MYRA 3UBPC 1QO5A 3DZ1A 7REQA 2ANUA 2Y5JA 2PCQA 2YBTA 3TP4A 2Z1KA 1XPGA 2EXOA 4HB7A 4IL0A 4O1BA 4W84A 1VAHA 2EO7A 2B4GA 3UETA 2Z25A 1Q3NA 3LG3A 5M2FX 3LSCA 3UZWA 1A80A 3TK7A 4GINA 1K02A 4G6CA 5I2UA 3GSMA 5BYWA 4HN8A 4HA0A 2WHLA 5D9MA 3GDKA 1PZ1A 3ZT6A 4JPGA 4QLLA 3ITTA 1YIXA 4M7SA 3LXCA 1BSIA 2X40A 3P84A 3QXBA 1DKWA 1Y7VA 2RDXA 2HPIA 2CWNA 2ZDSA 3Q67A 1GOXA 2A3HA 2HVOA 3E5BA 3FGCA 3N2MA 4KMQA 1OF6A 2WBKA 2I17A 5E09A 2V30A 1K7EA 5M3WA 2HDJA 1K8ZA 5HQLA 4PGLA 3W87A 3TXZA 2A3AA 2VRQA 4LSBA 5G2WA 1EPVA 4WHBA 1P0EA 3PB0A 1TPC1 4C6IA 3TTEA 4JYFA 4BWLA 3KW3A 4XD4A 5IFTA 1W5MA 4NAFA 1R0MA 1F4AA 4S3AA 2XIJA 1EFZA 1WXJA 2EQDA 3C6CA 2WZEA 3N14A 4MWAE 4YYFA 3C56A 3OLEA 3QR3A 4V27A 3WQDA 1YRRA 4GO9A 3HN3A 4XZBA 4DO5A 1CB7B 3L2LA 5LA1A 1QHZA 3OYXA 2RJHA 1F61A 1A5BA 4JXCA 1EJWC 4JFVA 4IIBA 1PCWA 1AZ1A 1EB3A 4AHPA 3I10A 2QW5A 2E5DA 2A2IA 3SJ3A 3EX2A 2J6XA 2P8CA 3RM4A 4HHHA 3NQ2A 5GJNA 3UWYA 2UY2A 3MHUA 1VFSA 3VD5A 1GJPA 2Y4SA 3H55A 3MV01 4YVXA 4GPNA 5DCDA 3AROA 5AN7A 2PWHA 3PJTA 1GYMA 1C7SA 4IL2A 2DDXA 3M44A 2HE8A 3O6YX 2JQXA 1ZENA 3VIIA 4TX8A 3L4UA 2BBFA 4KETA 3GVRA 1R7OA 3EWXA 1XICA 2CLIA 4GK8A 1DPMA 4AWUA 4JNZA 1EQCA 3WQCA 1A0CA 1C8XA 3TYEA 5K3VA 4XWUA 1S2AA 3ZJ7A 4OJYA 1MQPA 1OFDA 3EA2A 4IQDA 1G1YA 2Q8ZA 1RK5A 1TSIA 3S5SA 3VKDA 3DERA 3GW3A 5LYRA 4MDOA 3VDHA 3WDHA 5H8PA 2FVKA 3DC8A 1K70A 3WQ6A 3GH5A 4B4HA 2OMAA 5D2VA 1H7NA 3QLDA 4Z17A 4BKNA 2NQZA 4JHMA 4Q22A 2AL1A 3CMJA 5L9FA 4URIA 2X1TA 3B3DA 3O0KA 1TR1A 4XB3A 4A22A 1FFQA 4WIWA 3DC0A 3NVTA 2IMRA 5F2IA 3G8EA 4L5ZA 3L66A 1WZMA 4WCJA 3OJGA 5CSRA 1S1PA 2O4QA 3CUFA 2PD5A 5BRPA 1TE6A 1W31A 1PDZA 3HG5A 3QTPA 4UTTA 1NQKA 4A3YA 4ZO8A 3ITVA 1F05A 2GQ8A 2WQDA 3K8MA 2OOGA 4MOZA 4NIRA 5HUOA 1HKWA 1A5AA 2CCRA 3PTKA 2WK2A 1OK6A 1A4LA 2D22A 2W67A 1C8QA 5CC7A 3PPFA 3MWAA 1Q8AA 3FIGA 4RXFA 1BVNP 1W3TA 1Q66A 1SVDA 3MPGA 1P1MA 1VGAA 3GNXA 1IIHA 1QI0A 1NAL1 2VELA 3VFCA 1XI3A 4GFIA 1O94A 4XG1A 2ONEA 1MI3A 3L4VA 1OZMA 2PFHA 5AYYA 2Q09A 2I7GA 4EX4A 2VEGA 3IVUA 5C0QA 1AJ2A 3ZR4A 3WELA 4MVAA 1I8JA 1K8XA 1CXIA 1F6YA 4O12A 3VOCA 2V9DA 4WKAA 1WKEA 4PC8A 1SFLA 1ZTVA 1UZ4A 1XINA 4AIEA 4H83A 1HO1A 4XIMA 4FAMA 1IEWA 1EHNA 1S2WA 3VMNA 3WBAA 1W5QA 4Z0JA 5I7GA 4A21A 3PB2A 1LLWA 2W6RA 4H2HA 2QUTA 3WH9A 4MGGA 3LTPA 1DVJA 3GAYA 3AXKA 4H1ZA 4UFJA 4IF2A 1VJIA 5BOFA 3GVGA 1W2PA 4QE4A 1XQLA 3CQKA 3A9IA 3TMLA 5F2MA 1ZP4A 4DY1A 2YX0A 3S8HA 2DUAA 4NUWA 2Q3OA 3L0NA 2I5QA 3EZ4A 3W1TA 2GLKA 1BKSA 4HNVA 5LXEA 3UGVA 3T8LA 2CC0A 2E25A 3CV2A 4M6UA 1FKXA 1PEZA 2Z1BA 3QSTA 3GRIA 2QCCA 1W3IA 3MHGA 4PMQA 3UG8A 2GQAA 3CPUA 3WJSA 3GAKA 5CC6A 5A6SA 3KWSA 2YZRA 4Q7NA 3R94A 3B8TA 2QJHA 2HTMA 3R43A 5G4WA 1N7KA 1FRBA 3DEQA 4I90A 4DN1A 3P0WA 3WJXA 4RKAA 4K39A 4MF4A 4WSJA 2J13A 3CEPA 3WLIA 1LTDA 2QUNA 4R7OA 2A6NA 2DVXA 5DX7A 2EPLX 2EF9A 3DBNA 2C13A 1EBGA 4JTQA 4P61A 2KAUC 4A2SA 2PDIA 1R3QA 3HA1A 2RDUA 4U10A 3UCCA 3VNDA 4QBXA 4CGTA 4JIQA 4ZO7A 2D2JA 2EKGA 1JQXA 3TV8A 1SJBA 4PB3A 4AISA 5IRPA 3VAVA 4WRHA 3W00A 1EHAA 2G3FA 3DKLA 1X98A 3W7DA 3D3AA 4GVIA 1M68A 3F2CA 4OHQA 1G9HA 4HYWA 4DJED 4XKMA 3NCOA 4MB5A 4DJFA 2ABBA 3PANA 1A5KC 4JN8A 1LL6A 1DJHA 4H01A 3MSGA 3UR2A 2A1YA 4L4PA 4A2RA 3GR4A 4R5EA 2W3ZA 1E5NA 3RITA 4DO4A 2ACUA 2Y6ZA 3EDJA 3U2EA 1IT8A 4G5DA 3IGSA 4XD5A 4HNNA 2PU1A 4B16A 1RP9A 1V0LA 4DBUA 1K9EA 3FS2A 4H7VA 1JEZA 5ABFB 1HKVA 4REQB 3NDOA 4PB4A 4LC8A 2DQWA 2NX1A 3KBWA 2AKMA 3IK2A 1NQ6A 2P10A 1W9DM 3OA5A 3PUOA 3R25A 2Z7KA 3TYBA 4WDUA 2ATSA 2F6XA 5I3IA 2BS9A 3POHA 4RZBA 5AC7A 3D0CA 4I6VA 4QJ4B 1FVPA 1TZ9A 3QR0A 1HP4A 4I8YA 3LCGA 3N19B 2HQAA 1TTIA 4PBGA 4QNEA 2CZVA 1TIWA 2YOCA 5DY3A 1BWLA 3BSHA 3BTNA 4ZOCA 4DBDA 4HMDA 1OC5A 1O7AA 1BWKA 3LI1A 1PTGA 3AQUA 4O17A 1D2KA 3IIVA 4LUYA 4B5VA 3MO7A 5BU9A 3SGZA 4GIYA 3VD9A 4XBJA 3N15A 4LYQA 4S39A 1PHWA 3CO8A 3GIPA 2Y70A 1B3YA 2FH6A 4C65A 1RLDA 1WAUA 3ZT7A 2PWUA 4LANA 1U5HA 4KEUA 2W63A 4GUFA 1VEPA 1XYFA 3HV9A 1EOKA 5FACA 5CPNA 2NXGA 3RJXA 1Z48A 3TQPA 1DJZA 4GBDA 4UNKA 4HZ6A 3DFSA 3PZ9A 2BY2A 3NQEA 2ISVA 3TSMA 4IMEA 5D09A 1V0KA 5CGQA 3SI9A 3AI0A 4DELA 3QGAC 1BPLB 4GIEA 1E6QM 3V1PA 3TW6A 3CNYA 2WMIB 3QY7A 1ITQA 4KKXA 1NF7A 3SY5A 4LVDA 5HOSA 2R1LA 1XBXA 4JICA 1OC7A 1SMDA 2PDLA 1GOMA 4DLFA 2YLLA 3PS7A 1HTIA 2DU2A 4E0CA 3COTA 4FS9A 1PB0A 4KCTA 2PC4A 4E4FA 2DGAA 5D2WA 3MKVA 2ZZ5A 1FH7A 1B3VA 1FBAA 2PPGA 1DWJM 5CZJA 4D6GA 2CERA 3VE9A 3ABSA 1VBUA 2PDCA 3EWYA 5FEZA 3KOZA 5G1MA 2JKEA 4IPIA 1XGEA 3A23A 3VCNA 3CHCA 2KZHA 2GFTA 5CBIA 1GQIA 3EOUA 4IQLA 1WOBA 4AU0A 1ISWA 2A5HA 1QBBA 1Q7ZA 4IPNB 3ZVHB 1KM2A 3V5CA 2E6YA 3UYCA 1BYCA 4JHZA 1NSJA 2P76A 2OT1A 4LAMA 1XFBA 3GIYA 1NJJA 5I24A 3WLPA 3L21A 1E4NA 3AYTA 5JXQA 1NH6A 1F2JA 1F5ZA 4CCDA 3PZUA 3KTXA 4ZOBA 4ZO9A 4ZXOA 4W8BA 1VFLA 4N02A 3G1RA 3FYPA 4P5UA 1DTNA 3CWNA 3T07A 1YW1A 1C29A 4LH8A 1NEYA 3ATYA 4GY1A 3UVIA 4J40A 4L7ZA 4QLKA 1SO6A 4IM4A 3ZJ8A 2INFA 4MY9A 3I68A 3TQKA 1HJWA 4ZOAA 1EP3A 3U48A 3VNYA 4L6HA 3GZAA 4C90A 3KCJA 2R94A 3B97A 3NEVA 2Y8KA 4AWSA 3M6YA 3ES8A 1KM3A 1FKWA 4HQVA 4PMDA 4ZO6A 2YCIX 4PZVA 2YLAA 4HBKA 4HJFA 5AC5A 3EWWA 6TAAA 3TYAA 3T0TA 1EQPA 2PURA 1XISA 2FZBA 5T8GA 5LZLA 5FAJA 4MFDA 3W71A 4JCMA 4GBUA 3D3FA 3IRSA 1H60A 3URQA 5CLWA 3SM0A 3AMGA 1XGZA 4L6OA 2VJXA 4JL1A 3CAVA 1UKPA 3TR9A 5CZTA 1V6XA 5DRIA 3PUEA 1LOQA 4EACA 3A12A 4LVBA 1CENA 1OYCA 4ADTA 1S5MA 1DWFM 5CPMA 3PFRA 2WB5A 2JKPA 3I6EA 1DWGM 1HKJA 3V1HA 3ZLHA 3SB0A 3VIFA 5LIWX 4TVUA 4OIFA 1FH8A 2E6FA 1YNYA 2D2GA 2FB3A 3BG9A 4W7VA 3DHDA 2Q71A 2SFPA 2GDUA 3KWXA 5K2ZA 4OT7A 1HVXA 1EWEA 2OQYA 1D3GA 2IS7A 4PL1A 4KIEA 5HR6A 1M41A 1TA3A 3PPHA 1FHLA 3UNDA 3QMSA 1Q6LA 1X6NA 3M0ZA 4PB5A 1JZ3A 4A3UA 4LGXA 3PPCA 3R6IA 4J3WA 2WMHA 1XLBA 3GHUA 4UTWA 5IBXA 4YVVA 3CJPA 4H9VA 4E2BA 3VCCA 3LCLA 1X38A 3WEOA 4GISA 2XWDA 1VEMA 4DUOA 2PRMA 1LLOA 3MCNA 3LCFA 1C91A 4HMNA 3LZ5A 4HHLA 4W85A 1DL3A 4S3FA 3AWNA 2E9MA 4KH2A 4UOZA 4NX0A 2VGBA 2I14A 1Q4NX 2RHGA 4UZUA 3M0IA 2G8ZA 3UERA 1DXIA 3L5AA 4JQ2A 4GNJA 1G4SA 1CCWB 3T1GA 4XBKA 3KLLA 3RO6A 3SUSA 4O28A 2OEMA 1WX0A 3VOJA 2DW6A 4AHQA 3PWIA 4TO8A 2D24A 4LJ3A 1ZAIA 4OQVA 2ZZ4A 3CYJA 4FR1A 1AK5A 4ERIA 3KBNA 1MWOA 2CLOA 5HMEA 2D20A 1I2RA 3P3BA 1QU4A 3DYMA 3QYQA 1VBGA 3HG3A 1ZJIA 3W73A 4GVHA 4L80A 2OGYA 3MI6A 2PWVA 5HNRA 3E49A 1I6NA 4AHOA 1DXEA 4KT2A 8A3HA 5CGTA 1UP2A 3PG9A 3HO8A 2G50A 1RXOB 1R86A 3IIZA 2OLAA 4A4AA 2C16A 4MWAA 4CCZA 1BXNA 3NQ8A 1REQA 3L65A 3H7UA 3O15A 3EMQA 4PCNA 8TIMA 4K6AA 1S38A 3IPWA 4F2TA 1PYFA 3APTA 2X2GA 2ZADA 5LNVA 2XZ7A 2G4FA 2OO0A 2AMGA 1ONXA 1EJTC 3PBWA 1PBGA 3GNPA 4D6IA 4HSOA 5DBUA 5AZ1A 5FSEC 1QUMA 1Q6GA 5CC3A 3GVVA 4KS0A 1G0CA 3ARTA 1OADA 4ZXLA 1H7RA 1JQVA 3CLWA 1HKMA 4RE2A 3WSUA 1P0NA 1Q6EA 2PDYA 3EWZA 4FOKA 4DWSA 1VIWA 1HGYA 1ICPA 5AOUA 3VX0A 2WCAA 2XU2A 2WLYA 4V1YA 1Q63A 4H7ZA 2EPNA 1MXSA 4ZSTA 2WZMA 2QCEA 4Z2KA 3CQ0A 4W9TA 2G3MA 3CL6A 2VZTA 2QMKA 4RL3A 2FTPA 4RDWA 2EEXA 1UZDA 1W2VA 3GK0A 5DN1A 1F6PA 5D05A 4RDZA 1JIBA 5C54A 4NNBA 2TYSA 1E3XA 4C7GA 3LPOA 1G67A 2GK1A 3W7HA 3GO2A 1OFAA 1UWIA 1X6LA 5AHIA 2F2KA 3K2GA 5DRCA 2PF8A 2Y7FA 2YSWA 3VGFA 3WD0A 4JR5A 1R5YA 4GXWA 1R47A 4EPKA 3CZKA 1AVAA 1XC4A 2NZLA 1SFJA 4V15A 1EJ7L 3DFNA 3VI2A 4C6QA 1H1NA 2Q8LA 2XN2A 2PU0A 1W1IE 5RUBA 3F4WA 1O5XA 4N6EA 3S5ZA 3RNDA 4JX5A 5FAGA 5ABGA 2Y7DA 4O0KA 3T8QA 1XRSA 4Y8FA 1Q8JA 3SURA 2R1NA 1ITXA 3JUGA 3SCVA 1WDPA 3V5FA 4ZL1A 5G1TA 1UG6A 2OWXA 3F2BA 1JCYA 4RV3A 1XJBA 1K4HA 2GGIA 3TYUA 1F3TA 3U2ZA 2BLEA 4Q33A 2ZXQA 3V0SA 2HE5A 3T4CA 2CZEA 3IJ6A 3HMCA 4CQ9A 1GHRA 2NQ9A 2J7FA 1IZCA 4M8UA 4DEFA 2XH0A 2GSHA 1UKTA 1L0PA 3IJ9A 4ZENA 5REQB 4R33A 2REQA 1RQBA 1TE1A 4GJIA 2DSVA 3T78A 5C6MA 5FSDC 4JTIA 4GMEA 1XC6A 3O07A 4GC3A 4DVOA 1E0UA 1WDWA 1QCWA 3B03A 4ACYA 5LSMA 1F8IA 1O1ZA 3CASA 2Y1HA 1X8FA 2IW0A 2OPJA 4WDWA 1KKRA 3GTNA 4H9MA 6XIAA 3T05A 3ZMRA 3W86A 1WXZA 4U31A 1JPKA 4HMEA 1CT5A 3MYOA 4J3UA 5T9CE 3T08A 1GGOA 1UKOA 3IRDA 3S5YA 4NILA 2VWTA 2BVTA 1E0WA 4F2BA 1B30A 2VO5A 2EPHA 3P7YA 1UD5A 1LWJA 1R87A 2O9RA 4NY2A 4RUBA 1OX6A 2O9TA 4WJEA 2XIMA 2PBOA 9XIMA 1RJPA 3ARYA 1QNVA 1XSJA 4EF9A 4YMZA 1OC6A 3VIKA 1RHCA 3LBMA 3UW6A 1VC4A 4J3XA 1EF2A 2VCBA 4LQ1A 5AKQA 3UYIA 2BWGA 2C7FA 4HCDA 2VDGA 1OQFA 4UOJA 4JKMA 1FFRA 5CZKA 1PDYA 2X41A 2PRLA 2BY0A 3CHDA 2PWDA 1OCNA 3W7IA 3BVJA 4HSNA 1ISYA 2VUNA 4J7RA 5CSUA 1KBJA 1WKDA 2BY1A 3RLUA 3UPBA 5BROA 1HW6A 2OZ8A 4I5RA 1QNSA 1E9ZB 4JY9A 3H23A 3PZMA 2AMXA 3OW1A 1AL8A 2ZUTA 4AQLA 3W1UA 4ZBCA 4DO7A 2V67A 1Q4WA 3M0KA 3G1HA 4MLJA 3PC0A 1KTNA 1MO0A 4HOWA 2FKPA 3NQ6A 4DF2A 1TFVA 1GEHA 4GWEA 3SN1A 5BWAA 1T6MA 3STCA 5A6BA 1EP2A 2W62A 3UZYA 1NVMA 1S5WA 5AYBA 1J9YA 5I06A 5LNWA 1XLAA 8CGTA 1YTKA 1UB3A 3RCNA 2XWEA 1TV5A 5H6HA 4AB4A 2E3ZA 3AOFA 4GVGA 3OEXA 4GVFA 1I9CB 1YYAA 1TIMA 1EGZA 5D37A 4DRSA 3WUGA 1AL7A 1BXBA 2ZE3A 2XPKA 3NTYA 2NT0A 1XCXA 3UJEA 5LIKX 2NV2A 1XLHA 3LS9A 3H2EA 1F3XA 3GUWA 2JIWA 2Z6JA 3B8UA 1GOKA 1JD7A 1PIGA 4KQNA 4PMNA 1VFMA 3BICA 4GX9A 4FLSA 4S2BA 4ZOEA 3NOEA 3GHRA 3CU2A 1UR1A 1VD6A 4HVXA 3AMDA 5E9AA 3I4KA 2J9ZA 3LHVA 2D1ZA 2GGHA 2VDIA 3HU7A 1TZ7A 4P2VA 2BGNE 4ATLA 3HFYA 1VKFA 3C61A 3WH7A 4KEVA 2HJPA 4HA3A 3GYEA 3NO1A 3FV9A 2CZFA 5A2CA 2CHOA 3W7MA 5F1VA 4CN1A 4CKQA 3S83A 1W9XA 2AAMA 4NYYA 3AIQA 3HM7A 1H49A 2WM1A 3BV7A 1QOPA 1S3TC 2VD8A 3ARVA 4LF2A 4H4IA 5BRBA 2R91A 1FQ0A 1V3MA 3NA8A 1IXNA 5FL0A 3KUMA 4XAGA 5A8GA 1EIBA 3MKKA 1XG4A 3OHMB 4TVCA 3M64A 4GZ7A 1JFXA 1KD0A 2NSOA 5BXSA 3WO8A 3DFQA 4HPGA 4GYJA 4XAFA 3LBCA 3MCMA 1BRLB 2A79A 2PODA 4JN6A 4PTWA 4KEMA 4OBRA 3IANA 1IT0A 3G3DA 1BQCA 3CLMA 3WX7A 3VPLA 1SW0A 4I9TA 1E9LA 4CU8A 3VKCA 5C5YA 5C9XA 3VIOA 1JZ6A 3HQ1A 1M3UA 3CH9A 4QQ3A 5XINA 2WMJA 4Q6XA 1JR1A 3W07A 4MYAA 3E5PA 2W0UA 3IEBA 3UR5A 4Y9PA 5G5IA 3B8VA 3V16A 2DEPA 2QR6A 3NQBA 4S3EA 4HHMA 4EPDC 4Z2JA 1E73M 1B3ZA 1R3YA 3K4DA 1XLIA 3C0JA 3H2OA 2WVVB 1PZ0A 1AW2A 3OLGA 3JU2A 5EMUA 4H2CA 3NL6A 4JEJA 2C15A 3M0MA 4Y6GA 3AXXA 1MNSA 4E8CA 4JQ3A 1TPVA 5GQBA 2DY3A 1PTDA 4P8XA 4UB9A 1R30A 3OZPA 1GOIA 1VLIA 2FYMA 3W1RA 2OELA 3QFEA 3H8AA 2B7OA 2UBPC 3NQDA 1UYQA 3QOMA 2V0TA 2VYOA 4O1EA 1JULA 5FF0A 4TTUA 3QMRA 2AGTA 5TF0A 1V5XA 2G96A 4UFIA 5EBUA 4O50A 1QFEA 2G3JA 5AFDA 4AZBA 4LT9A 1LG2A 4OBTA 2VRKA 3TR2A 3DIPA 1SZFA 1KXQA 5CAKA 4AX6A 3IV8A 4KW2A 3EYPA 3FOKA 3O6CA 4EKJA 2QVNA 3WDIA 2PDPA 2DZBA 1QOXA 1J01A 3VM7A 1D9EA 3R58A 1HVQA 4J3ZA 1PIIA 4IG2B 3O0FA 1KRMA 1DJIA 1J6OA 3E2SA 3WLQA 4PTDA 3RK8A 4FEZA 3C2RA 1J0ZA 5J5DA 1W3HA 4IIDA 1PV8A 1R3SA 5EPDA 1GUVA 1X1NA 2WC7A 3E2VA 1EC7A 1CPUA 1O4UA 4HPJA 1HL9A 3A24A 4IFRA 3D46A 1CI1A 4DPPA 1PJ9A 1UP0A 2ZUWA 2H8XA 1C3FA 3GDMA 1AG1O 2QEZA 2VCAA 3P14A 4L64A 3L0KA 1T7LA 3KVKA 4UMCA 2XVGA 1HXJA 3TX9A 3DG3A 4ZQNA 3CC1A 2QJGA 3WFZA 1VR6A 1JXKA 2PZNA 4H9YA 4ZB2A 3OZOA 2X09A 4XSMA 4ZE5A 3SN4A 2QCLA 3NZPA 5LGZA 4HA4A 4RE0A 5I09A 2WJZA 1OFBA 1WE5A 4X60A 3FA3A 4FXJA 5BNKA 3FCPA 1RBAA 1US0A 5AVHA 5DFAA 4KFNA 1SM9A 3SSJA 1F73A 2W92A 3WFAA 1E55A 4LUSB 4Q8PA 2E77A 3AYRA 3W6MA 3CAQA 3B8DA 3KS6A 4Z2GA 5I6SA 1M9HA 3BCDA 1XIGA 3EWUA 5EKYA 1NDWA 1U22A 4MZ8A 3WNKA 4FX6M 2ZWYA 3W0KA 4A6GA 3MHFA 4NJIA 3ZT5A 4RR4A 4CQAA 3BQ5A 2PP3A 4DHGA 3PBMA 1HJUA 4H9TA 3CV7A 3EPOA 4DAIA 2PDGA 1FUYA 1NFPA 3OVRA 4JNYA 4JEQA 3RO8A 1OG0A 2OX1A 1XIEA 2TSYA 1EJXC 2A3LA 1OT2A 4K3ZA 2QCHA 1E40A 3B05A 1IEXA 3GVWA 1KC7A 4GQGA 3BW4A 4ZVJA 3AMCA 1S2UA 1VP5A 4FXFA 4QG6A 3O05A 4WDXA 1EGVA 1YTDA 4KF1A 3UWUA 4EK7A 3QV9A 1XG3A 3NGFA 1TELA 3S2CA 3W28A 1ZAHA 3M41A 4FOUA 1IT7A 4JHOA 2GSJA 4IIEA 4FI4A 2HSAA 3VDGA 4LRTA 2H6RA 1TTPA 3GM8A 4JQAA 3QC0A 3C2VA 4EWJA 1F3EA 4AX7A 4TX6A 1GJUA 1IV8A 3BG5A 4PMRA 3VNLA 1TRIA 3BOLA 1MRAA 2J62A 3MSYA 4MSSA 1KM4A 2VVNA 1VPYA 4W87A 4C1NA 1FWNA 2CBJA 1Y5XA 3CT2A 3UXIA 3GS6A 3ZR6A 4H8NA 2P88A 2A3CA 2XG9A 1LF1A 1W1A1 5BXTA 1R6WA 1OK4A 2YA2A 3NR0A 4O0QA 4MWAD 1ZRQA 1UWAA 1ADSA 3CV6A 1CLVA 1XGDA 3ARWA 1NP0A 2OQLA 3MZNA 3QPEA 1R2SA 4I5UA 4X9SA 3MBFA 2A21A 4ICCX 4XZ9A 1RSCA 2EHHA 5CBBA 2XFFA 1JAKA 1VQTA 3SCSA 3VA8A 2Z26A 2CFFA 3V3WA 4KFPA 4X0VA 5KZ6A 2NQLA 2CLLA 4UTKA 4C6OA 4GUIA 2YB4A 3ES7A 2VM8A 3WG6A 1V6TA 4QAWA 4B2DD 3H4XA 5T26A 1WDQA 3FXGA 2ZX5A 1PKNA 2GQ3A 4HOZA 3B40A 4FXSA 1BG9A 5CKSA 3FHQA 1OZQA 3MV11 4OGZA 1O12A 2AAAA 5AZ0A 1G94A 3GYCA 4L4LA 3C8FA 4JTTA 5I3KA 2NVDA 1XFCA 4PMZA 2E9LA 3IV3A 4A3QA 4LBUA 2Y89A 1AMYA 4CD4A 3SCRA 5FEPA 2HMCA 3P62A 4EE9A 3R11A 4QHRA 3TC7A 4PN2A 1H41A 1F9CA 5K9XA 1YLVA 3S2JA 2CNCA 2FDMA 4BR1A 3H4GA 1UPPA 1J96A 3S5OA 1MQQA 1IEIA 3O6AA 2PDUA 3QSRA 1WPCA 3VKBA 3G3MA 4GXPA 5A8PA 4RNIA 2QS8A 1XUZA 4CCEA 3WQVA 3AAMA 3NM3A 3Q58A 3WQEA