2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
b'KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
molecule tags Lyase
source organism Pseudomonas fluorescens
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
4G7EB 3C86A 3E2VA 4LAMA 1P1MA 4KQNA 1HZYA 2QT3A 4LCRA 4R88A 2OODA 2DVUA 3T1GA 3K4WA 3LSBA 2Z4GA 4QS6A 3N2CA 1A5LC 4RE0A 4UBPC 4XD4A 3LU2A 4LCQA 3WMLA 1FWIC 4HJWA 1A5NC 3GTFA 4HA0A 2O4QA 4HK5A 2OB3A 3IARA 3JZEA 1XRTA 4KERA 1V79A 4IFRA 3D6NA 4DIAA 3LY0A 3F4CA 4DYKA 3MSRA 4PCPA 4ERGA 2Z00A 4WGXA 3QGAC 4Z42C 3OVGA 2PGFA 4CEUC 4LANA 1KRBC 3ID7A 4KEVA 1PTAA 4QS5A 3HM7A 5HMDA 4XAYA 4C6KA 4C6QA 1DPMA 3IJ6A 4H9XA 3T81A 4UB9A 4JOMA 3LGDA 3AU2A 4RDVA 4GK8A 2P53A 3G77A 2Q09A 1EJVC 1UIOA 3R0DA 4CNSA 5HMFA 3MPGA 1PO9A 2R1LA 4H01A 4D8LA 4B3ZA 4R7WA 4H9YA 3F2DA 4DZIA 1POKA 1K1DA 4GYFA 4IFOA 1FWEC 2WJDA 4BJHA 3GIQA 4ICMA 4KETA 4F0SA 1RK5A 1JGMA 1KRMA 3AU6A 4IH3A 1YBQA 1A5OC 3URQA 2AMXA 4IG2A 4NI8A 2BB0A 2FFIA 4GC3A 3CJPA 3S2NA 4ERAA 4H9ZA 4QTGA 3LS9A 4LALA 1XWYA 1RAKA 1M68A 1ONWA 4H9UA 2Z27A 4C6BA 4XD3A 2E1WA 2PUZA 3PBMA 3F4DA 4PE8A 1EJUC 5AKQA 4C6JA 3OOQA 1GKQA 1NDWA 2YB1A 3ISIX 3MKVA 2PLMA 4LH8A 3A4JA 4C6DA 1ITUA 1RK6A 1YMYA 3E3HA 3GU1A 2EG7A 2R1NA 1FWFC 1E9YB 4V1YA 2EG8A 4INFA 3KM8A 1P6BA 1S3TC 1ZZMA 3O0FA 3OJGA 1YIXA 4PBFA 1O12A 4QSFA 2FTWA 2I5GA 3A3XA 4GOAA 4IQJA 1FWAC 3OODA 3T8LA 3QY6A 3HTWA 1E9ZB 3EWDA 1YRRA 4IF2A 4M51A 2YXOA 1KCXA 2Y1HA 4C65A 3LNPA 2VUNA 3GU2A 1IE7C 3E74A 4IFKA 2Z24A 1RA0A 2GZXA 1FWGC 2OGJA 4EPKA 2ANUA 4CQCA 4EP8C 4NG3A 3UF9A 3URNA 3NURA 4G7EA 4EPEC 4C6FA 1K70A 3IACA 4LCSA 3IV8A 3QGKC 1QW7A 3GIPA 3PNZA 3S2LA 2Z25A 4C6EA 4H9VA 4KEUA 2XIOA 3CAKA 3OU8A 2HPIA 3GG7A 4J35A 3MDUA 4AQLA 4NP7A 5CH9A 3BE7A 4LFYA 2VM8A 2VC5A 1PB0A 4I6VA 3HPAA 2D2GA 4EPBC 4LEFA 3ITCA 4RDYA 4V1XA 3F2BA 5A6TC 4R85A 1EJXC 2WJEA 4LAOA 1EJWC 3RHGA 4GX9A 4CQDA 2ADAA 1J5SA 4P5UA 2QPXA 2GWGA 3GU9A 1J6PA 1FKWA 2AQVA 3AUOA 3B40A 3IRSA 4WVXA 3F2CA 1RJPA 4KIRA 4J5NA 4XD5A 4AC7C 2Q01A 3QY8A 4IGMA 4DLFA 1R9ZA 2ICSA 1BF6A 1XRFA 4BKNA 4C6NA 5FSDC 1XGEA 4H9TA 3S2MA 2P50A 1NDYA 2FTYA 3GTHA 3ICJA 4C5ZA 3DCPA 1A4MA 4G2DA 1A5MC 2UZ9A 4F0RA 4PBEA 3S2JA 3SFWA 5FSEC 1KRAC 5HMEA 4MUPA 4RDZA 2Z2BA 2R1PA 4ZSTA 4DO7A 4HK6A 4H9MA 1UBPC 1R9YA 1POJA 1RA5A 2GOKA 2IMRA 4B92A 2WJFA 1A5KC 4H00A 1I0DA 2A3LA 1GKPA 3URBA 4B90A 4C6PA 1ONXA 3WZ0E 4WHBA 3PAOA 3QY7A 3GTIA 1A4LA 3E0LA 2VR2A 4XAGA 2R1MA 3LSCA 1M7JA 1VFLA 3GRIA 3TN6A 1EJTC 3UR2A 3URAA 4DZHA 2HQAA 2F6KA 4KEZA 1FWDC 2DVTA 3EWCA 3NEHA 1M65A 3MTWA 2UBPC 1FKXA 4C6LA 2HNHA 3IPWA 3MDWA 3MVTA 4E3TA 3IGHX 2FVKA 1GKRA 4IFKB 2ZC1A 1YNYA 4CNUA 3OQEA 1RJQA 3FDGA 4C60A 1PSCA 4GXWA 2WM1A 3FEQA 1J6OA 4DI8A 2Z2AA 4L6DA 1EYWA 4ZSUA 1FWBC 4XAZA 3DC8A 4I6KA 4TQTA 1V77A 1WXYA 4RDWA 4RZBA 3GTXA 3DUGA 4L9XA 2E25A 1FWHC 1NDVA 1ADDA 1W1IE 3E38A 4EPDC 3B0XA 1FWCC 4PCNA 4QROA 3S4TA 2Z28A 3LGGA 4C6IA 3O7UA 3UPMA 2R1KA 3B0YA 1EJSC 4DNMA 4C6OA 5G4HC 1P6CA 3TNBA 4KESA 4LAKA 4CNTA 3RCMA 1J79A 2O4MA 2VC7A 3TN4A 1UMLA 2D2JA 1R9XA 3ORWA 2HBVA 4OFCA 3CS2A 2GWNA 3MJMA 1WXZA 1I0BA 4XAFA 2Z7GA 3K2GA 3E0FA 4DLMA 2AQOA 1YBQB 4CEXC 4QRNA 3PANA 4GY1A 2OOFA 1FWJC 2PAJA 4GX8A 4GY0A 2HBXA 1K6WA 3NQBA 4GY7A 3RYSA 2I9UA 1V7AA 3K5XA 2EG6A 4IG2B 3RN6A 3UBPC 3A3WA 3V7PA 2PGRA 4GBDA 4GZ7A 5LXXA 1EJRC 1EF2A 4CQBA 2Z29A 1NDZA 1V51A 3GUWA 2OQLA 2GSEA 2VHLA 2QS8A 2DVXA 2HPMA 2W9MA 2KAUC 2RAGA 2D2HA 4BY3A 4ERIA 3TN3A 1RJRA 2QVNA 1V4YA 2YB4A 4B91A 1QXLA 3TN5A 4DI9A 4C6CA 1UIPA 4HK7A 2CZVA 1EZ2A 4F0LA 4YIWA 4J2MA 1O5RA 2BGNE 4IGNA 2Z26A 2G3FA 3EGJA 3PNUA 3MVIA 3FDKA 3SO7A 4XD6A 2YZ5A 3UR5A 4C6MA 3LA4A 4C5YA 2FVMA 5E5CA 1NFGA 1ITQA 1KRCC 3WYZA 4KF1A
chains in the Genus database with same CATH superfamily
2BY1A 2D22A 2XIJA 3DHUA 5EL1A 2ACRA 2HZGA 1T0OA 3PK7A 3W73A 4HJWA 1PV8A 1EX1A 1US3A 3TSMA 3G1VA 5M03A 2Z1SA 2VZVA 1CX9A 4AZGA 1NH6A 3GDKA 1MZRA 4JEQA 3W75A 1AW2A 2CC0A 3MSRA 4XKMA 3PFRA 1XW8A 2YYTA 4E2OA 1ML1A 3PUDA 4HNTA 4LANA 3UWQA 3L4YA 4IP5A 3VUPA 1UZHA 3RXZA 1D3HA 4Y2WA 1E56A 4ZQNA 1TUFA 4TIMA 1KFKA 4UFIA 2XH7A 1CB7B 1UUQA 1IHIA 4V15A 5KZEA 4W93A 5EFFA 5EA9A 5HMFA 1F3TA 1MUCA 1WKFA 2R1LA 1MEWA 4GNVA 3PF3A 4X9SA 4QG9A 4AEEA 1K1DA 1UUMA 3U57A 5E0CA 4QG8A 3CT7A 4IQDA 3AZTA 4DNHA 2W91A 3L5MA 3AU6A 1XJBA 4Y9PA 1IWAA 4NI8A 2BB0A 3H2EA 1GHSA 5K3VA 1XIJA 1YDVA 3BZJA 1KM1A 1BRLA 4JL2A 4LALA 2FZMA 1SJAA 1VFMA 4WY0A 4AVOA 9CGTA 4AWUA 4AYSA 4QQ3A 3S5NA 1NQ6A 4UFMA 1M9HA 1GUVA 4YYFA 5HXMA 4JQ1A 1DIOA 3TDFA 2EG8A 4Q22A 3N2MA 4AG0A 4ZOCA 3NO3A 1JPDX 2H9AB 1ZZMA 2I16A 5D4YA 3FLUA 1YIXA 4FZIA 4QHRA 4IT1A 4XTIA 2I5GA 2OLAA 5CGQA 3HTWA 2YXOA 3G6MA 2IW0A 3WQ4A 1OB0A 3BLPX 4DF2A 1HNYA 4BI7A 3HG2A 1JZ4A 2WHMA 5DMNA 1KCKA 3CWHA 3UG5A 4JKMA 4KPLA 3JVAA 1QO2A 2IQDA 3CH9A 4JHMA 2CEQA 3G1YA 1DWFM 3NAVA 1OT1A 3LHWA 5GJMA 1C8QA 1CNVA 1K8YA 4TTGA 1WBJA 4F3HA 2DZXA 2WQDA 2D23A 2GK1B 1DORA 3WLRA 1TTIA 2VFIA 4WGHA 1BQGA 4EPBC 2VZOA 4V1XA 1BWVA 2C6QA 3F2BA 3OBKA 4OV9A 9XIMA 4GH3A 5L6UA 2FZDA 2NX1A 2QGHA 3BLFA 3VZYA 3S47A 4MB3A 2VNCA 1UD4A 3UY7A 1ZPTA 3U48A 3TMLA 4FOUA 1PVNA 3EYPA 4I8YA 1GOQA 2D1ZA 5AHNA 4LT9A 3CUHA 3GXPA 4ACZA 1XUUA 1M7XA 4QEEA 3VO0A 3B06A 1LRNA 2V81A 3TC3A 2WVVB 1PJ9A 1NQKA 4MB1A 2DY3A 1JGIA 2BY3A 1PE1A 2Z2BA 4ZSTA 5A6LA 3O0KA 3I4KA 2HWGA 2WO5A 4WJXA 2GUUA 1W9DM 3KOYA 2PDPA 2PF8A 4PB4A 2A3LA 5HJXA 2XUCA 4ZQPA 4WHBA 4NZ4A 4D6GA 1SM9A 4PL1A 2R1MA 2VEIA 4S3AA 3NL3A 4NZ3A 2J8FA 1OYBA 2VEPA 2WYSA 1V08A 5A6SA 1RBAA 4GLEA 3TFCA 5CEWA 1K9EA 4UFJA 1X6UA 2PDNA 3MDWA 2PODA 4PL2A 3C2EA 1SUXA 3ZWTA 1PXGA 1AJZA 2ZC1A 3VIJA 2PPGA 3VDBA 4JHZA 4QAWA 1JDFA 1BQCA 3ZR4A 3BARA 4YPJA 4JFUA 5G1TA 3LENA 3MI2A 1NWTA 4QG6A 1DXFA 1AQMA 3BSGA 5SWUA 3S1GA 4B5VA 3L0GA 3IUHA 3FIGA 1FWHC 1NDVA 4GIAA 3AISA 1GOXA 4YVXA 4DVOA 4KFOA 1N55A 1VFSA 2WZEA 3MKCA 3SURA 4IXHA 3AQUA 4UCGA 2G95A 4WKHA 4R7OA 5TIMA 3AS2A 3MHFA 1ZGDA 3B4YA 2G3MA 5KMYA 4BF9A 2IKIA 1H62A 1OFBA 1E4IA 4E4UA 5CSYA 1BVWA 3PBVA 4OFCA 3DC0A 1JD9A 4HHMA 4NJKA 2PC4A 4ROPA 3W23A 4AZIA 1XH2A 4Y9OA 4P7LA 6ALDA 3SADA 3CPUA 1B3OA 1K6WA 2XVLA 3LM7A 1GQLA 4GI6A 2J6XA 1FWSA 3V7PA 5LXXA 4GZ7A 2E6DA 2J7DA 1XINA 4LYPA 3GUWA 2CU0A 3CV6A 1K8XA 2A3BA 1O1HA 4W89A 3M6DA 3UCQA 3P62A 1XL9A 1VD6A 5D8ZA 2YB4A 3NQDA 3S8HA 3G1RA 3OB8A 4QJ1A 2EKGA 3NQCA 3A47A 4HN4A 3QBUA 1UA7A 1MFVA 1O94A 1UASA 3LTYA 4PMUA 1EUNA 1E0VA 1NOFA 5LGZA 3O06A 3W72A 3I7RA 1PEZA 4O11A 1LBLA 1MO0A 1NAL1 1Z7AA 3LXAA 5D9PA 3G3DA 2YL6A 1F5ZA 5JBEA 2F7FA 2VOTA 3L4XA 4TVDA 1LDCA 3UZZA 1SFJA 2A6NA 5C55A 2JQXA 4X63A 1V79A 4ILSA 4DYKA 3WKZA 2PWVA 1D3CA 3GNXA 4MFEA 1TPVA 3DHDA 3STPA 5A8PA 1PTAA 3BL3A 3VOIA 5D2XA 3BMXA 1JYVA 3NDOA 5CPLA 2PLJA 4I7WA 4D72A 3AU2A 1J93A 2EGZA 4LS0A 3U4AA 2PLCA 1KXVA 1TTPA 4IMEA 3VCCA 1E5JA 1BD0A 1PKNA 1XCXA 4H01A 4D8LA 4G56A 6CGTA 3UY8A 1UC5A 1BRLB 1FWEC 4GMEA 5K4XA 3ARPA 5C2XA 3HN3A 4YCPA 2GJPA 1L6FA 5CGMA 4XAPA 2GDQA 4HN8A 1E3ZA 3WSUA 4AIUA 5EU9A 4EKJA 1I2RA 1RY8A 2XIIA 1S5NA 4N7QA 1JF5A 3N2XA 1D2KA 3V16A 3RFAA 1QPNA 1F8MA 3SRDA 1SR9A 4GVHA 2F8QA 3PZUA 1R3WA 5G4WA 4IIFA 4ZR8A 1OFAA 3FX4A 1RAKA 3RPMA 3NQAA 2H8XA 1VYPX 2OKOA 3VKDA 2YA1A 1SSGA 4DJDD 1OIFA 3WFLA 4AY1A 3OLDA 3TJXA 2WZHA 1QATA 1ZHAA 3GU1A 3W2UA 1GVOA 2P5NA 4DO6A 3EXRA 4PMRA 4UR7A 4ZO8A 1QTWA 3BAWA 3NEVA 2D69A 3OODA 5D9MA 3W2KA 2OCZA 4GYJA 4AFYA 2Y5EA 1I2OA 2TODA 4J1OA 1LUCB 1XLMA 3BLEA 4Q4OA 3FXGA 4JTCA 2C79A 3IRDA 3NURA 3LQLA 1VQTA 3W88A 4LCSA 3QGKC 3WLOA 3DGRA 1TPH1 3P60A 4XISA 2BOFX 4RJEA 5AHIA 4AQLA 3QHOA 1N8WA 1U2YA 3N17A 3VNZA 1YPIA 4F0MA 2A3AA 3IJDA 1OY0A 5K9CA 3RLUA 3LCLA 2PDLA 3ITVA 1EDTA 4HHHA 2QDDA 3SCNA 3VMPA 1XISA 3S3GA 2PTDA 4W85A 1N7KA 4G5DA 4X61A 2PRLA 3CV7A 3NVDA 2BODX 3TCEA 3QFEA 4L1WA 4PMZA 3AYVA 3M0MA 2J13A 1VH7A 2DZAA 1PX4A 3CUZA 2Q01A 1VP5A 5A8NA 4HMEA 2JKEA 5FSDC 1VYRA 3APTA 1E4NA 1TV7A 3QQWA 2HE8A 3S2JA 3LNMA 4FF7A 4LS2A 3C3NA 4AHQA 4PTDA 5K7JA 1AG1O 3EX3A 3A23A 1VC4A 1UR3M 5AC7A 5H8MA 2PDUA 2CLLA 4KH2A 1JF6A 3WQ8A 1EGMA 2BHUA 3QOMA 4PMOA 4QE4A 3NGFA 6PTDA 2I1OA 5LIXX 2AL2A 3W27A 3MS8A 1H7RA 3GFZA 2WXDM 5HQMA 3V36A 1QUMA 3UFYA 1E51A 3N11A 3TN6A 1JFXA 3EMZA 3UR2A 4J28A 4PMQA 4ZL1A 2Z7KA 5CPNA 2D0FA 1O95A 1OYAA 2VX4A 1OG6A 3PR2A 1YTDA 3QFWA 1YDYA 1GVIA 3MMWA 5D2WA 3WNPA 3RITA 4B3LA 4LV9A 4L4LA 2Z2AA 2VI0A 4FI4A 4E4FA 1TX2A 3K8KA 5I3KA 3ALGA 2QQ6A 4L9XA 2Y8VA 4HA4A 1WO2A 1WAUA 4B2DD 3WIJA 1CGVA 1XH0A 3UJFA 1Y5XA 5A1AA 2XZ7A 2QCEA 2B4GA 4C6IA 5E1QA 4C6OA 1VBGA 2B7OA 3A6OA 4ZO7A 2X2GA 1EP3A 3F03K 1EKOA 1EC8A 2PDWA 2G3IA 1U1HA 4FS9A 2I17A 5FJIA 4H41A 4GD0A 4GO8A 3STCA 2AKZA 3UD6A 3NNTA 2DSVA 2QZRA 3ZM8A 4Q4MA 5F1VA 3EXSA 1IXPA 2V82A 2JK2A 2REQB 2XVKA 1XD1A 1WNOA 5AHEA 1VFTA 3SBFA 3TTYA 3TYAA 3UWEA 2ACUA 4I7UA 4UFKA 4F2BA 2AMGA 4RW5A 1HTIA 2Q3OA 1YADA 2VHLA 4KCWA 3PG8A 3RG6A 2AL1A 2BOGX 2ZZ1A 1DE6A 4FR1A 3VABA 1UZ4A 3LUTA 3GIYA 3LRMA 2V5CA 2XG9A 4ORIA 4DY1A 2OWXA 3C61A 3GR7A 3TVAA 3HPFA 2BGNE 2OSXA 1LM1A 2QIWA 5FJUA 1JXJA 1GW9A 1DWIM 1RHCA 3BICA 4QE1A 3CHDA 4X2RA 1TQJA 3M0KA 4NZ5A 4DJDA 1XLIA 4ZXLA 3GG1A 1RALA 1CLKA 2PLKA 2DFAA 1P1MA 1BFNA 3SN1A 4Y8EA 3RLVA 1JD7A 1W3KA 4RW3A 2O92A 1TVPA 4E38A 4HCLA 3HG5A 4LUIA 3L4WA 1TZ7A 1ZUAX 2TMDA 5LYRA 4POCA 1UD8A 5CBIA 4H04A 2DPEA 3OGRA 2HVNA 3IVUA 4IFRA 3L7RA 3KAOA 1UB3A 4YTQA 5XIMA 4M6UA 2YYUA 3VA8A 1H5VA 4WDWA 3R79A 2W66A 1TREA 4BQ5A 4URIA 4Z42C 3W24A 4QGCA 4HOWA 2C1HA 2H3BA 2P3ZA 4ZB0A 2QULA 5D02A 1F9CA 5LNSA 3VYLA 3EX4A 1KWKA 4PTWA 2IPFA 3N4EA 4WJ8A 3O6CA 4F40A 1T99A 5I3JA 3BW4A 2Y63A 3S1XA 1R3RA 4EAMA 3CXOA 3CUGA 5A8QA 1XLBA 3W1QA 4K38A 3C0LA 4KT2A 2FQIA 5CZSA 1UKQA 1W1B1 4NIRA 2GQ9A 4AWTA 1I1WA 3NM1A 4GUFA 4HMNA 4JY9A 2VMFA 5CSSA 2XINA 1VF8A 5EMMA 3SUVA 3TROA 1M68A 2PS2A 1UOZA 3NPVA 4H2CA 4P7QA 4AMAA 4GNKB 3WFZA 4H4IA 1G9HA 2E9LA 1BG4A 3ARTA 3QTGA 3OOQA 1HT6A 3QYSA 2BXZA 4A4AA 1U83A 4OT7A 1RK6A 4A35A 1Q66A 3VAVA 2G4FA 4QM1A 3HFTA 3VE9A 3T0TA 1UKOA 1KFCA 2OO0A 5I02A 5BOEA 4Z2JA 4F4RA 4IF2A 2B31A 2X0SA 1WKDA 4GJIA 3ITLA 3NO5A 1BYCA 1E6PA 3UF9A 3FY1A 5BROA 3TEVA 3W38A 4HSOA 1I2QA 4HNOA 3UA3A 4WK9A 4JTTA 5DANA 3TKFA 4ICCX 4Z17A 1V6XA 1B3YA 4XKYA 3ZO9A 3BE7A 3REQB 1OC7A 4QLKA 2C7FA 4PCTA 4Q4QA 3OPSA 3U5YA 1A49A 2WJEA 2J62A 1DHKA 1BWLA 1Q4NX 4N9CA 4TTUA 3MSDA 2RH9A 4IX2A 4M6PA 2V3FA 1FWTA 3TJ4A 3P61A 4JTQA 2Y7DA 1X1NA 3UWWA 2VC6A 4JNYA 4O28A 1T96A 4AC7C 4IGMA 1F7BA 1WV2A 7REQA 2A7PA 3M0VA 1XGEA 2YDSA 2CFFA 3MO4A 2PFHA 2VENA 3WBXA 4RNIA 4AUBA 1HJXA 5G2WA 4Q8QA 3SFWA 5JIPA 5I07A 4S2BA 3AO0A 1EPXA 1YLVA 3KEHA 4DF0A 1W9BM 1PDZA 1I0DA 4XX6A 4NU7A 5FL1A 4NJIA 3THUA 4NSBA 1DWHM 2OMAA 4XK2A 3SSJA 1W1VA 1VFLA 3GR8A 3KOXA 1G4SA 3LB0A 4WJEA 5T8GA 3STFA 1X38A 4ZQCA 2IUZA 2PDJA 4PCSA 4DZHA 1F3WA 2XN0A 4R53A 1X8CA 3FJ6A 1GTHA 5FIPA 1H0GA 1HL2A 1XH1A 3NQ8A 3ONCA 4FA3A 3NQ7A 3VNLA 3B0UX 5HNNA 2XH4A 4WLCA 4GXWA 4M56A 5I06A 3FEQA 3L2MA 3FA5A 3VIGA 3WN6A 1TSIA 3VMNA 2FZNA 3D0CA 1EJ7L 3VOFA 1R3TA 2F38A 1V77A 4MHBA 4RDWA 2FZ9A 4JX5A 4ECLA 3SGUA 3QC3A 3CIXA 4JIHA 4L9YA 3NOEA 1W1IE 3G1SA 1DVJA 2EPHA 3T0DA 1E6SM 1VIWA 1Q3NA 1VBRA 2G97A 4HIBA 4LYKA 4QP0A 1TPDA 1JVNA 1PHWA 3AAMA 3OBEA 3MKKA 2Y24A 4QCEA 3LYEA 4MZ8A 5XIAA 1M6JA 1A3XA 1YPFA 1XLEA 2O55A 2Y85A 4O1EA 3WDIA 1WOAA 3W26A 3BLKA 3ITTA 3WJYA 1ME7A 4HOXA 2O9TA 3P67A 4GGHA 3AJXA 4QISA 4JN7A 1K7XA 1PCWA 2WSQA 2YL9A 1XIBA 2J27A 4K7VA 2ZZ7A 4US5A 1IEVA 2ZXBA 3PHAA 1A5BA 3FW6A 2J9YA 4U3AA 3PFMA 4GVGA 3GVGA 2D2HA 4IX0A 4NASA 2OJPA 4OE7A 1TJ2A 3S5OA 1L2UA 1L0PA 2MANA 4C1NB 4YS1A 1QOPA 1X96A 3QEZA 1Z6KA 1XGZA 1Q7ZA 2R82A 3FHQA 3GTNA 1CGWA 1L6SA 4EAYA 1Q85A 4ZGYA 2O56A 3FDKA 5HMSA 5A8MA 1XYCA 3D47A 4DPQA 3NXLA 8XIMA 5PTDA 1TV8A 1PUDA 1UP3A 1HZYA 4QDMA 5I79A 1G4TA 4XVDA 3R0UA 4P2VA 1TFVA 3PN8A 3QZEA 2VVSA 3C8FA 3QLDA 4XTDA 2ZRYA 3GZAA 4RUBA 2YOCA 2R14A 4DIAA 4QSHA 1MI3A 2GJXA 1MUWA 2R94A 3LTSA 1N8FA 4D6EA 4IPPA 1GPWA 1Q45A 3W7RA 3UCCA 1DWGM 3SCOA 1OF8A 3B97A 1KTNA 2ZZ2A 2VZUA 5BW6A 1K9FA 4M3PA 4JYEA 5A6BD 4ZQOA 2VEGA 3DFYA 1IQ8A 2PD5A 2PWFA 1TMHA 4IGSA 4AD5A 4J3UA 5D04C 1B90A 2ON3A 3L0NA 1TPC1 5KZDA 1ONRA 3SUTA 1O60A 2PWGA 4MUZA 2HRWA 4KETA 4GQRA 3DH7A 1QCWA 3G0UA 3MZNA 3QMRA 5CCZA 4FX6M 2PWHA 4M5PA 5CKSA 1KM5A 3TH6A 3J7HA 3APYA 3SIMA 3W1XA 4PMDA 4NY2A 4Y9MA 6REQB 3CIWA 3W7DA 3A4XA 5DN1A 4NHVA 2GLKA 3D3AA 3QMTA 1UWQA 5GNYA 2VQUA 4LWWA 1TMQA 4B9ZA 3SCRA 2HVMA 4LBSA 2YB1A 2ZC8A 4G7FA 1MEIA 3EWZA 3BAKA 5FACA 3VKJA 3E3HA 2R1NA 4GQQA 3ITXA 3ES7A 1F4AA 2NV1A 2XSBA 3ABQA 1QI3A 4NZCA 5IHRA 1HIZA 1UQZA 3H70A 2GVLA 1EXBA 3ITYA 3KTXA 3BW3A 4L9ZA 3GX9A 5AC8A 4V33A 2E3ZA 3IJLA 1HW6A 3WLPA 1FDJA 1IE7C 3CT2A 3F4WA 4IFKA 3KOFA 3EDFA 5LIKX 1XFBA 1UH4A 1LOLA 1TZ9A 2BXYA 4AHOA 3W1UA 3FN9A 3EX1A 1GVYA 4C6FA 1WCGA 3LOTA 3IIVA 5HATA 5JH2A 2PP1A 3QLLA 4UWMA 1UUOA 3CWOX 4PZVA 4IQEA 3LCHA 1PB0A 2BS9A 5AVHA 4ES4A 3B8IA 1B3ZA 4GE8A 3MY9A 3R13A 1ZU8A 1OCBA 2OT0A 3PBGA 4BR1A 1TG7A 2QHAA 4I9TA 4GX9A 4PMJA 2DH3A 4P5UA 1FTXA 2GWGA 1ZBWA 3MMDA 4JNMA 1JDCA 3CZKA 3EB4A 4KWWA 1A5UA 1OSEA 5CPQA 2DZTA 2RGLA 3BCFA 1N8IA 1NDYA 1WB0A 1AH0A 2ZKMX 5M3WA 4PBEA 2BXVA 4GACA 2RDTA 1GWJA 2NV2A 2ZA3A 5FF4A 1LQAA 4UUIA 5HMEA 3EWWA 3OP2A 1RQHA 1POJA 5FJJA 4NNAA 2NVAA 1FHLA 3NPXA 4M81A 3VNKA 4O14A 1T40A 2EXOA 2C13A 1Q6EA 2NQHA 4FHAA 3RO8A 3C52A 4LSBA 1JR1A 4D6IA 3T4WA 1NTHA 3W0KA 1QWKA 1C93A 3TIMA 3B8SA 4LQ1A 4MNKA 4FPSA 2E8ZA 2VKZG 3HO8A 3SB0A 3PZQA 2EF9A 5CC3A 1KLYA 2VELA 4KEZA 3WELA 4HB7A 4XKYB 4B5WA 5FF7A 3MVTA 3WMSA 3WLJA 5JBDA 3GLCA 1EPVA 3DYPA 4MG4A 4WUIA 4DI8A 1U1UA 3VCRA 1P0EA 1JI1A 4XAZA 1I6NA 2B81A 4I6KA 4AZBA 1H7OA 2GPTA 4GA8A 4YXGA 2E25A 3CH0A 1Y65A 3SRHA 3GNRA 3WFAA 4PMXA 1FCVA 3UW6A 1MW3A 3B0YA 3VGFA 1YNQA 3NDZA 4A2RA 1AQHA 4U2YA 4AVNA 1P6CA 4ADUA 1QI4A 3UT0A 3M16A 4KESA 3MUY1 1ZJHA 4LBUA 5I09A 3CASA 2PI6A 5TBOA 3GK0A 3N29A 2D2JA 2PZNA 1QBAA 3LLXA 3CO4A 1F6PA 1SZFA 5CPMA 3MJMA 4B16A 4XAFA 4DLMA 2AQOA 4GFSA 1V3LA 4ALDA 2VT0A 3W6MA 1MRAA 5E0KA 2VGGA 2I9UA 1GVRA 2AGKA 3UBPC 3NDYA 2INFA 3SY1A 1DP0A 2WZIA 1EF2A 3CTTA 3MJYA 1V3KA 4PRTA 1S2TA 2Z29A 8A3HA 3C3UA 2PU1A 3LERA 4GFIA 2RKXA 3BV7A 1W3LA 5FF0A 4GUIA 2BTMA 3OW1A 3ZJKA 5BOFA 1Q2RA 5FD0A 3QW4B 3GHRA 3M44A 2XTKA 5HANA 2FGBA 2YPIA 1KV8A 2VURA 2XU2A 1RQEA 4S3GA 2FKPA 1ZENA 2YA2A 1XCWA 4DJEA 2Z26A 2DZVA 1FCUA 1EDQA 2YZ5A 1OD0A 3UQNA 5BOOA 3UA4A 4BHYA 5KITA 3B0VC 3I6TA 4QE5A 4GCAA 2BG5A 3C86A 5LNUA 2ZXQA 1TE1A 3GXNA 1DTUA 2HK1A 1OFEA 4O53A 1WPCA 3QOKA 2BZNA 1E1CA 4FNQA 1TV2A 1TWSA 1ISYA 2WPBA 4XD4A 4F66A 1T5AA 3WMLA 1E1EA 1RPKA 3GTFA 2O4QA 4UXDA 4ML4A 3IARA 4PMYA 3EEZA 1E3XA 3NYZA 3VINA 3DN5A 2GYIA 2ISFA 3ELFA 4UZSA 4BF5A 2W62A 3WLNA 2PDHA 3MV11 4EACA 1QRQA 1W31A 3MZ2A 4JDBA 4WOZA 3RM8A 3CUIA 3TXZA 4ERGA 3KTCA 3GSMA 1Q6GA 4I9JA 3TC7A 2QMKA 3QGAC 1EEXA 2QUNA 3ARVA 3PULA 1Q6QA 1S39A 4FNRA 2DIEA 1HKIA 5REQB 3AFBA 3UWUA 3E1F1 1KXQA 1B0IA 3GG0A 2BV9A 2EO7A 4QLLA 1TIMA 1AZ1A 1G0CA 4UB9A 1F4HA 1XKYA 2NLIA 1PO9A 1VHCA 3SY8A 4GINA 4O4WA 2XWDA 4H9YA 8CGTA 1XR2A 1F05A 2NX9A 3DDMA 3Q37A 1TQXA 4GYPC 3L4UA 4J27A 1OX4B 1SSDA 2VFDA 1NELA 5I7GA 3QV6A 2OWCA 4IG2A 4M80A 3L9CA 2ZTJA 4GC3A 3THQA 4ERAA 1VB9A 4ZODA 3ZVIA 3IIXA 1V02A 2IPWA 5FEWA 4KRZA 3W7LA 3QMSA 1RCQA 4D6HA 1IR1A 4A21A 5C70A 3WNLA 2PLMA 4W8AA 1SVDA 1BXBA 1A3HA 1MXSA 1NWRA 2IPJA 3VCNA 1V8EA 2QDGA 3TJLA 1FH7A 2POTA 1G5AA 2J8TA 5JU6A 4CVUA 1PTDA 1C3FA 4PUJA 4NVTA 1XHGA 1W5QA 4OKDA 2GQ8A 3W71A 4H83A 1ESWA 3A4AA 1TMLA 1N82A 3TC6A 1XLDA 3TUUA 4W88A 1FWGC 4NUWA 5CC6A 4LF2A 3GD6A 3W25A 2ZRVA 3QN3A 4R9OA 3MB9A 5ABGA 1DJXA 2P0IA 1GEHA 2R91A 4ZQRA 4UTMA 2BASA 4UTLA 4HOZA 3N6QA 1P7TB 1M03A 2V38A 4PUUA 3WDQA 2YCLA 5EMUA 3VD5A 4GI4A 3EA3A 1VJZA 2DUZA 1EC7A 4B2DA 2EPLX 3LV5A 1E70M 4H19A 1HO4A 4G1NA 1CEOA 1A5SA 3LK6A 3BDKA 1VCVA 3N4AA 4K1WA 5K9DA 3KCJA 1NJJA 3PZGA 2ZA1A 1UCWA 1LWIA 3M6YA 2TPSA 1J6PA 2MUCA 1OABA 3F2CA 1RJPA 4DRSA 4AAJA 1R9ZA 5CSRA 3S2MA 4AY7A 1QW8A 4C5ZA 4YTTA 1ECQA 1UH3A 1SW3A 1J0ZA 3SCVA 5A95A 5AZ1A 3WH6A 5CAHA 1DQUA 3MW7A 2I57A 4UFHA 4MMWA 4HK6A 3O16A 3D5HA 4M7TA 1XIDA 4O52A 1TJPA 1LLZA 4RCXA 1MVYA 2VEMA 1QNVA 2HISA 5CZ0A 4LPCA 2CZDA 1RUSA 2Q8LA 2YXGA 3VGGA 1DJQA 2VRQA 1UWIA 1GPFA 3VDGA 1JQVA 4JTEA 5C9XA 1M3UA 4DJDC 4LF1A 1XYAA 2HQAA 2ZUTA 5JH1A 4NT0A 3IJIA 3BOFA 2QCDA 2PCQA 3NEHA 2F2HA 3LPPA 1DJZA 1J0IA 3HG3A 2X2YA 3IGHX 3H24A 4IOTA 3BOLA 3OVRA 5JXQA 3OQEA 3RMEA 1KCLA 1TWDA 2V30A 3MCMA 4LYRA 1DKWA 1W37A 3WLHA 2Z1KA 1F8IA 2CBJA 3M5ZA 3N13A 2QW5A 5BRBA 4F2TA 3GR4A 4B4HA 4LBRA 1R86A 3M0XA 1JPMA 3AIUA 3TW6A 3A3HA 4K8EA 3HFYA 5HUPA 2OSWA 1ELSA 3N9RA 4UQCA 4CNOA 3ABRA 1GORA 3A4WA 1B54A 4H3DA 4OWGA 5EKYA 1SZGA 2WC7A 3NA8A 1KFWA 3CHFA 3W7GA 5DMYA 3N2TA 4Q6XA 3FV9A 2X0HA 1RR2A 2DU2A 5H8UA 1KB3A 3WQDA 4CD6A 1YXYA 4FSAA 4Q4RA 4FX7A 3UXLA 3ERPA 3LTPA 1NWUA 2RUSA 1XYLA 3PAJA 3CMFA 3NQBA 4GY7A 4CU7A 4GJJA 2ZRZA 3PP7A 4AMCA 3LHUA 1R30A 3W6LA 1S2UA 2C1IA 4RE3A 5DT7A 2NLYA 4DYJA 3PUEA 4KFPA 4MAZA 4BEUA 2E28A 3C2YA 4P7OA 3WF0A 1H0IA 5AECA 1ITXA 3PZIA 2Z1WA 2Y0FA 4LY8A 1IXQA 4C6CA 4HK7A 4GIRA 4O1BA 1H63A 4DBWA 1WQ5A 1FUYA 4HKPA 4WXYA 5HPCA 2DZWA 3QKZA 3T05A 3U6WA 1OWQA 1FVPA 3H12A 4MAVA 1B2YA 2XISA 2CLHA 3AYTA 3L2LA 4KCVA 4WIWA 3UVIA 3GKAA 2FH8A 2PURA 2NXHA 4KQNA 3CK5A 3FK4A 2UY2A 4PA8A 1TV5A 3R10A 1FXPA 2DSUA 5C2CA 1LF1A 3MU7A 2VRJA 3W2JA 2ZFAA 4QNWA 1QWGA 1LUCA 5BCAA 4KERA 1NEYA 2HEJA 1MNZA 1V6VA 3WL1A 3W2LA 1XPGA 4ATLA 2NZLA 4WGXA 4Q8VA 4IIHA 1OT2A 4CEUC 1BKSA 2ZRUA 4NRRA 1UP2A 3UWZA 1KRBC 4PTXA 2YBUA 4L6HA 3HM7A 3T0BA 3UCDA 2V3GA 1QOQA 3O2LA 2Q6ZA 3NIYA 5A6MA 1XIEA 3TX9A 3W07A 1A0CA 1YDOA 4H6KA 1F73A 2CITA 3T6CA 4JTDA 2DIKA 2IKJA 4RNHA 3CHEA 2PSNA 5CJMA 2CZ5A 1JCYA 5CJ5A 4B3ZA 1OF6A 1I4NA 4OHQA 3QPZA 5HOSA 1VFHA 1POKA 3GIQA 1BPLB 1NWSA 3WD1A 5DBUA 1WKEA 1Y0EA 3GH7A 1W2PA 3HZ3A 4TX9A 4IH3A 1UPMB 2C91A 5KETA 1UQYA 1E4LA 3FOKA 3CJPA 3T9PA 1EBHA 3P8JA 3G1XA 1KLZA 1ONWA 1R2RA 3RDKA 2CKSA 2DUAA 1W3HA 2ZWYA 2PUZA 3VD3A 1LROA 1EJUC 2JEQA 4HHPA 2YBTA 1WA3A 5A94A 1V7YA 3LMZA 2QPUA 3I6EA 3UERA 3GWQA 3HF3A 1E9YB 4V1YA 1YYAA 3O6YX 1FOBA 1HFBA 5C9ZA 1JNEA 4O19A 1FFRA 2XPKA 5FF3A 4O1DA 3LXBA 5DMMA 4K68A 2GJNA 1IR2A 1EXPA 3KRUA 2Y1HA 1XS2A 2PGWA 1LP6A 1MDLA 2GGIA 1UWUA 4UFLA 1VFOA 4CQCA 4EP8C 1FA2A 3W7HA 1VIZA 3FKRA 3V5OA 4NXSA 3S6TA 3HMCA 2E8YA 4C7DA 3AICA 1GOIA 3U2ZA 1CLXA 4IPNB 2WKLA 4H9VA 1GK8A 2HPIA 1OZMA 4JFSA 2Y7FA 2QDEA 2XM1A 3WLMA 4PR4A 3WLSA 3CQIA 4DBSA 4LX4A 3DIPA 4G1KA 3VKCA 4MY8A 5M1TA 5C5YA 3LXCA 4Z08A 3LV6A 3RJXA 2Y5SA 4FO4A 2CXEA 2GUBA 4LXFA 2QPXA 1HKMA 5D33A 4WR3A 3AUOA 1AL7A 1VFUA 1UP0A 1Q6FA 1QHPA 4J5NA 2E68A 2MNRA 1GTEA 1XRFA 2INZA 3MI3A 4XZWA 4C6NA 4K1GA 4H9TA 2FTYA 1K4HA 2J7CA 1MW2A 3BAIA 3HGJA 3Q2DA 4Q33A 3W7OA 5LHFA 2P10A 1I2PA 2RDXA 2R1PA 1S1PA 4DO7A 1XICA 3UG4A 2WNWA 1R9YA 3SJ3A 2F6XA 5ABEA 5G4EA 4MJ2A 3ARSA 1S2VA 4H00A 3KBMA 1JCTA 4A3QA 1E9LA 2XGIA 2Y4SA 1JEZA 4MNJA 4C6PA 3B8DA 1EWEA 3GTIA 1YTEA 3GC4A 4BQ3A 2C0AA 2GQAA 1O5QA 4DEFA 1XPYA 3WUEA 1SO4A 4Z1CA 2EBNA 1PZ0A 5AYIA 3BXWA 4XV0A 2YL8A 2Z1BA 3BVJA 4GIYA 1RVKA 4Q4SA 3HQNA 1TTJA 3EWCA 3IVSA 3BPWA 1M65A 3MTWA 1VR6A 4JTLA 3L12A 3UU0A 1LRTA 1F2JA 2J7EA 2TSYA 3KP1A 3DFNA 4NYUA 4CNUA 2VZSA 3G1AA 3RIKA 2C8NA 3M0YA 5C9WA 2OR2A 3PY2A 3UNTA 4OZOA 4P8VA 1OC6A 4M0XA 4N4QA 4Z1YA 2NQ9A 1TTQA 4ZFMA 2SFPA 2V3DA 2ZDSA 4OECA 1LL4A 1KV5A 1Z8AA 4JY8A 2OT1A 4R3UA 4K39A 4XSLA 3TZFA 1UD2A 2CWNA 3AMKA 4NKCA 3VM7A 4MB4A 4NILA 1EO7A 4UTJA 3SCUA 3TAOA 1UJQA 1K8ZA 3EMQA 5U4NA 5I6SA 3ZLFA 2CLPA 4DWSA 4XUGA 4FALA 1EO5A 1WXZA 5J04A 3REQA 4KCUA 1F61A 3IV3A 3PC0A 1PZ3A 2VFEA 1K8CA 5I77A 3EDEA 2XFYA 2EG6A 1EQPA 2G41A 3VFCA 5A2AA 1SQ7A 3JR2A 2QCCA 1QHOA 1CZ1A 4HPGA 1ZBCA 4O54A 2Z0IA 2GJLA 4W87A 1LT7A 2ACQA 4MJMA 5LNWA 5I3FA 1W17A 1G94A 2D20A 3GHTA 1EA0A 2ISWA 2QNEA 3RX4A 3QZ6A 1CXIA 3WDPP 4LC6A 4DI9A 6TIMA 2X40A 4DAIA 3GS6A 3W1MA 5DCBA 1KKRA 4JTUA 2VX5A 3H54A 3SEPA 1QO5A 4QDWA 2VX7A 3EGJA 4L4OA 1W1YA 3OQ8A 4JX4A 4XD6A 1G7UA 1KNWA 2FVMA 3O8AA 2I5IA 3EKLA 1ISWA 4O12A 3QV9A 1NFPA 3DOPA 2CWXA 3ZYZA 1XIGA 4K37A 4HYWA 4ADSA 4HA1A 2Z4GA 5CZTA 2REQA 5HR6A 1Q8JA 4W7WA 5XINA 2BGQA 1IT0A 2WKJA 3PWIA 1HKKA 5K9XA 3VGDA 2V69A 2HROA 3W1LA 4OV4A 4S23A 1QT1A 1P1XA 4MGGA 2W79A 2X1TA 1HL9A 3NZGA 3E2SA 4IUOA 5E70A 5D03A 1R3QA 3CO8A 4U2ZA 2OWWA 3CQ0A 3LBMA 1V5XA 1V3IA 3AIVA 1DTNA 3K4AA 2YIHA 1UBSA 1R87A 2PTXA 1J18A 4XAYA 2YCLB 3MANA 4W8BA 4CLMA 3W86A 2Q09A 2X42A 3NJ3A 2VFHA 4K7YA 2XM2A 4R7WA 4FXRA 4PBGA 2VFGA 2NUYA 3CTLA 4DJED 3PZOA 1UWRA 1FHVA 3ZT7A 5ABFB 3DI0A 5T91A 3TYUA 1IF2A 3NQEA 2XDFA 3B8UA 4MPKA 3AHTA 1DHPA 3URQA 5A2CA 3KLKA 1IT7A 3AZSA 4YTUA 4UTHA 1PIFA 3UGRA 4QITA 4U33A 2ZE0A 2VD8A 1QNRA 5E6ZA 3PPCA 3L67A 3GAKA 3M5YA 2JF6A 1XYFA 3CZEA 3VMOA 4MF4A 2QVHA 1XLKA 4A3RA 3KW3A 3O07A 2C16A 4DX3A 4JKKA 3VIOA 1GJUA 2F84A 2VOMA 2RJGA 3STGA 3GM8A 2J66A 2C1GA 1UYQA 1ZLPA 1AW1A 4F48A 2ZZ4A 4KGLA 2DT3A 2YFOA 4YVPA 4W9TA 4WCJA 1D8WA 1BSLA 4O4VA 1YRRA 3KUMA 5CAKA 1XM3A 2RGMA 3FSTA 2ZVRA 1GHRA 3E2QA 4PTNA 5KZ6A 2QJNA 1V93A 4HTYA 3PNZA 3MMUA 3AIWA 4DUWA 1VKFA 3L66A 2ZX6A 3ZT6A 3PUGA 4AD3A 5LGXA 1M1BA 3MDUA 4ATDA 1JCMP 2GGJA 1JAKA 3RU6A 4TV6A 3PG9A 2V3EA 3NXFA 4RR4A 2OYKA 1Z44A 4ZQMA 4R85A 1LQ0A 3E12A 4FK9A 1W9PA 5I23A 3WG6A 2ZUUA 1K77A 4DXVA 1C9WA 4J3WA 2GVYA 1IXOA 5B80A 4RLIA 5I3HA 2XSXA 2AQVA 4G9PA 1J01A 1HJVA 4CGTA 1US0A 1Z89A 2WHLA 2J6VA 4UMCA 1OQFA 1OCNA 2ZICA 1JPHA 1XIMA 3GKFA 4ZE4A 1BF6A 3GY1A 3UJ2A 3PTMA 1NY1A 3GXTA 4MWAA 2UZ9A 2WANA 3TP4A 1XBYA 3PBUA 4LU0A 1CECA 1H1ZA 3EX2A 3VOHA 4JQAA 1RA5A 2CBVA 3ATZA 3P74A 1A5KC 1K9DA 3K30A 2CCRA 3N6JA 2AOSA 1HKVA 4GZEA 4WRHA 4PMNA 1MWOA 3WZ0E 3W7JA 4WKFA 1K7FA 2CYGA 4D6JA 4CD5A 1JCLA 4CN4A 1RBOB 3NQVA 1M7JA 3HJEA 4ZO6A 2WLYA 3EDKA 3TYDA 3GNOA 2YCIX 3OZOA 5H91A 4UMAA 3EWBX 3URAA 2J79A 2V68A 3HGOA 3ALFA 3WH8A 2NQJA 2PRMA 3MBFA 4YCOA 1W3IA 2FJUB 3AS3A 4C6LA 1L9WA 3P6LA 3PPFA 4ZA0A 3DKLA 2CERA 2WMIA 5C6MA 2RFGA 3I7SA 3M7SA 5KSWA 1JZ5A 1AL8A 1OX5A 1J10A 1Z42A 1PHQA 1G69A 4JR5A 4TMCA 3C0JA 3R89A 4IMDA 3GTXA 1H5YA 4JN6A 1OC5A 3KE0A 2OYMA 3LPGA 2DDXA 3B8WA 4GUJA 1MMFA 1KBKA 3S4TA 2DUXA 5AHMA 1IEQA 5AY7A 1ODUA 4FNPA 4DNMA 3H2OA 1GVEA 1QHZA 3W7PA 4UTTA 4IL2A 4B15A 4C1KA 3R94A 2A1YA 4G8TA 3IGUA 4UZUA 1DJYA 3VC6A 1UMLA 1JZ3A 1ICSA 1H51A 1R2TA 3CS2A 3E9AA 4CKQA 4WDXA 4XBJA 1JQXA 2PDKA 1QNOA 4OBSA 3QR3A 1QPOA 4JFTA 4D8ZA 3AXKA 3B9AA 1KFBA 2WMHA 4OGZA 4DXXA 4BCEA 3BH4A 4RL3A 1SMDA 3VM5A 4N6EA 3RYSA 4B3KA 1CXHA 4J3SA 2XFRA 1H41A 3OYXA 2XVNA 3PTQA 2H90A 3C2FA 2YDQA 3ABOA 4DWSC 1P6WA 1G4EA 1Q7MA 3TN3A 3WQPA 1T8XA 3FVMA 2V2CA 3K1GA 3EWYA 5E6YA 3WMBA 1H4PA 5MHBA 1WDRA 1J5TA 3P0XA 1ADSA 4YIWA 2IQ0A 4J2MA 3L4ZA 1QNQA 2OPJA 3R1ZA 1PX3A 4RZ5A 3S6DA 4O17A 5DCDA 5D2TA 1H61A 5I3GA 1L6GA 4R27A 3CHVA 1I8JA 1QMLA 1EQCA 3R0KA 2NQLA 1GCYA 2QT3A 4Z0JA 2GJRA 2OZ8A 4NNBA 4QS6A 1A5LC 3IGSA 4A3UA 4LJ3A 5D9OA 4HA0A 3IK2A 4LY4A 1I75A 1A50A 2WW5A 4LUTB 1VLIA 1W8SA 3VILA 1ZCCA 1OGSA 4QR6A 1ZCOA 2XGBA 4JTAA 1OGBA 1NF0A 3W7EA 3DG3A 4EXQA 3CGTA 1UR9A 4HP5A 1EX5A 1UHVA 4KEVA 3S0CA 4PCFA 4JS3A 3PZVA 3W7IA 2PWDA 3ZSSA 2X1UA 1UWTA 4C6QA 5A8OA 3IJ6A 2Z1XA 1XYBA 2P53A 1XG3A 2WVTA 3FAWA 3SCSA 4IPJA 5E09A 3VGHA 4M6QA 5T9BG 5GNZA 1VHNA 2OTDA 5AN7A 3TQKA 3ARZA 5IOBA 3VPLA 3M9YA 1SR0A 4IFOA 2W61A 4GYFA 2CBIA 1CXFA 1PAMA 3GXFA 5AZ0A 4H8VA 5CLTA 3TWAA 1LG2A 3R5EA 2ZUVA 1DXEA 1C7TA 2EHHA 1DJHA 4YWIA 1FP9A 3PB0A 1FWNA 2FMNA 1J9YA 4LRTA 1UWAA 1UZ1A 4QCFA 4QTGA 1T41A 4H9UA 4MWAD 3M47A 4W7VA 3AIEA 4XD3A 1B9BA 2X7WA 3TMQA 3TR9A 3TE9A 5HDRA 5ECUA 4OVXA 3W87A 2PDCA 3GDRA 4C6DA 4UR8A 3BAJA 1BG9A 3H2FA 1PIGA 3SN0A 3A5VA 2QPSA 2QF7A 2OKTA 1XCFA 3GH5A 5C8BB 4GOAA 1M41A 1E55A 3TTEA 3WF1A 1OG0A 1FRBA 3SCWA 3VVGA 3PPHA 4KFNA 1R46A 3LRLA 3A13A 4GVIA 1KGXA 4XZLX 1I60A 2QJGA 1BWKA 1O7AA 2Y7EA 3CMGA 4MYAA 2HMCA 1GVFA 5C7HA 1KC7A 5GNXA 2B7QA 4PODA 3SQMA 4F2UA 1J12A 2WBGA 2XIOA 2WVSA 5HPOA 2HXUA 2YX0A 4TX6A 1LBFA 2TAAA 3CMJA 4GISA 3UZXA 1SYTA 3KVJA 3UJSA 4FNSA 3IJ9A 4RDYA 2IQTA 3N12A 3OZMA 3L68A 3W2NA 2UY5A 3V18A 3RHGA 1RZMA 3CB8A 2Q8ZA 1J5SA 3UG3A 5JVLA 1XFCA 3IRSA 1ALDA 2YKKA 4XD5A 2OZ3A 3HQ1A 4DUVA 3KOWA 3AOFA 1P0BA 4YNGA 4QLJA 4Z1AA 2ZRXA 2ZVIA 1ME9A 3CUJA 1TV3A 4J3XA 4G2DA 1KXTA 2R9RA 2DV0A 1F6KA 3AUJA 2P1FA 3NR0A 2C71A 3LGEA 2C19A 5IFPA 4AEOA 5AOUA 3B0PA 3OYZA 2POZA 1JZ6A 3WQEA 1AH3A 3BC9A 1GKPA 1LRQA 3N3TA 3FGCA 3S5SA 1TVNA 3KS5A 1ONEA 2OEMA 3LSCA 4U31A 3HV9A 1UR4A 3UZWA 3W02A 4EIVA 3N34A 2X0YA 1A5CA 2QF8A 4YHGA 4Z1BA 3LLFA 3TQPA 2V63A 3EOLA 1DE5A 1KBJA 3PJTA 3WLIA 3UVAA 3BG5A 1H7XA 4O8RA 2NXGA 3L4VA 1Z41A 1VJSA 1MUMA 3UR7A 3BGGA 2OELA 1D3GA 1K03A 1PZ2A 2E09A 1V6WA 4HMDA 3NG3A 2BGSA 4I7VA 3GFYA 1LQ2A 1KD0A 2JKPA 1AUSL 3BLLA 3SW6A 3WDJA 5D09A 1AMYA 2F61A 1GQIA 2VEKA 4GQGA 2VZTA 4ENLA 5A6AA 3WLLA 4DO4A 3O7UA 1B3XA 3NSMA 4IQLA 1HP5A 4JTRA 2Y2WA 1DXIA 3PVFA 4ZCWA 4DJEC 1RY0A 3A5FA 1VLWA 3LD5A 5REQA 1THFD 4YTRA 4AHPA 4H6EA 3V1PA 4HNVA 3OVPA 2ZX8A 3ORWA 7PTDA 3V1HA 3V3WA 2PZ0A 1E0WA 3WF2A 1F74A 3K2GA 3AMCA 4BWLA 4CEXC 3FYYA 3PANA 4KKXA 3OHIA 1NFBA 1J0KA 3K8MA 1FWJC 3I7QA 4GBUA 1AODA 4S2CA 2HBXA 1CB2A 3BZGA 4Q8MA 3UEQA 1QJWA 4GBDA 1BYBA 2OOGA 4H8UA 3Q65A 2Z1VA 1V0NA 4ZOBA 3VNIA 4OUIA 1AVAA 3IK4A 4JD4A 1V51A 2VD9A 3BLIA 3NTYA 5ABFA 1VZWA 2GSEA 5U7SA 2INEA 6XIMA 1NU5A 3UPWA 1BXNA 1T6MA 3L0KA 2JBMA 1QXLA 3TYEA 4BEQA 1SJBA 1Y8BA 2UWFA 1SO6A 3UZ5A 1MXGA 5HQLA 4LVDA 3CBWA 1O1ZA 1GOWA 2HJPA 1O5RA 1I45A 4DELA 3GVVA 2BVTA 3LX9A 3WQFA 1GYNA 4WY0B 5E5CA 3EX6A 4D71A 2FPTA 4L61A 3V0TA 3RM9A 4UOZA 4KF1A 1XQLA 1W6TA 2FTPA 4AD2A 4HA3A 4HZ7A 3C2RA 4LVGA 4ZOEA 2B7PA 4LCRA 3NO1A 4R88A 1IWBA 3VIKA 3W7QA 1A3WA 3N73A 3N9KA 4ZB5A 5CGTA 4D9PA 2HK0A 5DCEA 3JZEA 1P43A 1GEQA 2A7NA 2FPVA 3C0SA 3N2OA 1W1A1 4P7NA 5A2BA 1IEIA 3BOXA 2ZX5A 4E5TA 3F4CA 2XIBA 3ZQ9A 1BGAA 3B3DA 1ZB5A 2WC3A 2Z00A 1PPIA 4JIPA 2VQTA 2BY0A 3B4UA 4S3DA 2ZOXA 5CG7A 4DF1A 3EB2A 4GO9A 2R8WA 4Q8WA 1OJXA 5H2ZA 2E1DA 3W28A 3LGDA 4RDVA 1C8XA 3BJSA 3G77A 3LLDA 3CUXA 4UCFA 1NVMA 3R0DA 3TLLA 4CN6A 4PULA 3T09A 1SFTA 4WY0F 4DZIA 1EA9C 3VTRA 1X39A 4NAEB 1KWGA 3R2GA 3EAUA 4GCXA 1IXNA 5LZLA 4IGHA 5G2HA 3G8EA 4YL2A 4ASTA 5FL0A 3MUXA 1Q5MA 3K13A 4P61A 3W85A 2ZA2A 3DFQA 4AYGA 4L5ZA 5LIWX 4ACZB 4MDPA 1KM3A 3BQ5A 4HU8A 4QFUA 3K8LA 4BF7A 2VRKA 5DRCA 1PCKA 4GPNA 2E1WA 3BURA 2DT0A 1V0LA 4KWUA 4RNFA 2IKGA 3ISIX 5AYYA 3F5LA 3IJ7A 3A4JA 1ITUA 1YMYA 2G8ZA 2EG7A 2P0OA 2IPGA 1FWFC 3DFHA 3WJSA 5DF0A 4X0VA 3P2VA 1DJIA 1WYIA 4JBRA 4DBDA 3QKEA 5KEZA 2JGYA 2W3ZA 4RXGA 4IMCA 2NXIA 1AD4A 3GC5A 3ZVHB 3T8LA 1S46A 5DY3A 1E9ZB 5D38A 4M51A 3R11A 2RDWA 4MY1A 3ZOAA 3WH7A 1RA0A 3ZZ1A 2NWSA 4EPKA 3B9EA 3G3MA 1RLDA 1YDNA 1HN1A 5JIWA 1DQWA 2QV5A 2Q02A 1WBHA 3URNA 5CPOA 4EPEC 5F4WA 2OX1A 4IHCA 3CQKA 4O0QA 2YDRA 4IMGA 2ZE3A 3HPXA 3HGRA 3GIPA 4PYSA 4L80A 4YWSA 3RX3A 3T0AA 3MCOA 3ZXWA 1DJGA 1L8NA 3CPGA 3EOUA 3R8GA 1Z3NA 3M7WA 1CYGA 5AC4A 3KP0A 3WF3A 1J4EA 1TA3B 1WOBA 3C5QA 4I6VA 4RPQA 1TR9A 1JDEA 4F79A 4UC5A 3D3FA 3MUIA 3AIQA 2WHJA 2ADAA 2CHOA 3M46A 3EEGA 3GU9A 3WJZA 4DM2A 4DWSD 4JFVA 1WZKA 5DO8A 4BZYA 3I10A 4HYRA 3P7YA 1E40A 1OZQA 4XIMA 4MWAB 3AWOA 4MY9A 4CCEA 2EPKX 4H6RA 3NPUA 1HKWA 3OZYA 2J7HA 3BWWA 3NZ1A 4MUPA 1AH4A 2GOKA 1UPPA 2IMRA 5I5RA 4JTKA 1GJWA 1OIMA 4IP4A 2WJZA 1ONXA 5FEZA 3H7RA 2Z2UA 3PAOA 3QY7A 1G7VA 3DHPA 3GHSA 1A4LA 3LCWA 4XAGA 1SMAA 2W0UA 4M8UA 3UP8A 1V3JA 1LBMA 3BO9A 4UR9A 2WCAA 4JQ2A 1CW2A 3GXDA 3CU2A 1XLFA 4REQA 1GQKA 3DKJA 1BHGA 3COTA 1KQYA 4GKLA 3OLIA 4E3TA 2ZYFA 5F1UA 1AZ2A 4AEFA 4Q8TA 2VGBA 3WNKA 2CHNA 1VFFA 4RE2A 3W1NA 1K3UA 1E73M 2VGFA 3W53A 3RCNA 4V2XA 4KCTA 1YTKA 3CAQA 3PUOA 4EWJA 1C7SA 3GBDA 2YW3A 1WZLA 4DWSB 3LEPA 3KVMA 1H11A 3AWNA 1V6YA 3TYBA 1NP2A 3WUFA 2XGZA 2Z6IA 2D3LA 3W84A 3S9ZA 4DN1A 1KGUA 2YR1A 3P5ZA 2B7NA 3CL7A 3DGBA 1I2NA 5FAJA 5EMYA 5AB3A 3AXMA 4JTHA 2X05A 5CC7A 4S3JA 3DENA 1I0BA 4GC4A 5JMUA 3DI1A 1QAPA 5D9NA 1WZAA 2PAJA 3AHZA 5J5DA 2VUYA 1GG0A 2J7FA 1CGXA 3ZLGA 3WD0A 2X30A 3MP3A 4K6AA 4XBKA 3UG8A 1EBGA 5AHFA 4HT3A 1HQTA 5FESA 4E2DA 1AA1B 3RUBL 3VOGA 3L4TA 2W4XA 3DFTA 4Y96A 2NWRA 2OQLA 2DVXA 2W9MA 3SJNA 3VUSA 3AIBA 1CENA 4M7SA 1TPB1 4GUGA 2P88A 4S3CA 3SCQA 1G4PA 2ZX9A 3ARWA 5G1YA 3MQTA 4LVBA 2CZVA 4IM4A 4MZ1A 2CETA 2F6UA 3ITGA 1RXOB 2XYLA 2X16A 3M0JA 3MVIA 3OG2A 1IGSA 2OLSA 3SRFA 3BGJA 3EPNA 3MV01 1HJUA 3WYZA 1H60A 3N14A 1UA3A 1H7PA 1BVZA 4G7EB 1TWIA 4LAMA 3ARXA 2CLIA 4BQ2A 3UXAA 4IIEA 1M7OA 3F4VA 4LC8A 5IXEA 1XIHA 5GPRA 1OYCA 4XZ9A 3V5CA 2GQ3A 4JCMA 1M04A 5FF2A 3P81A 4ZEPA 3LY0A 4I5RA 2FZBA 3NM3A 3N2BA 4L56A 4WF7A 1B1YA 2YL5A 1QK0A 3M0IA 1UWSA 2A5HA 1TRDA 4HPHA 3IAQA 2PTWA 4JIRA 4AH7A 5KZMA 4LNCA 2A4AA 1KFEA 1BF2A 3GDLA 5IRPA 3MYPA 1TIWA 4CN1A 3UZYA 1JFHA 3IUDA 2BVWA 4S39A 4K2SA 4PUWA 3TCSA 3VFLA 2C15A 3BSHA 3IEBA 1ZJAA 3DYMA 3MPGA 3TU9A 5M17A 1AJ2A 3A22A 3KX6A 4DAFA 2WJDA 2PDBA 2OEKA 3RM4A 2ZADA 3LI1A 2HXTA 1PYFA 3TONA 2D0GA 1KRMA 4CCCA 1W56A 3W83A 2NSXA 4ORMA 4D2JA 2OVLA 1HXJA 4GRSA 1AK5A 1CXEA 3NL5A 1ZAIA 3CL6A 2V0TA 2QGYA 4MNLA 1S3HA 3O6DA 2CNCA 1WZMA 1V3MA 4A3HA 5HNTA 3A9IA 5RUBA 4FOKA 1JCJA 2X09A 4C90A 3PBMA 3WD4A 3CB3A 2JE8A 4Q6JA 4ZBCA 8RUCA 2O7SA 1DJNA 1UKPA 2EQDA 9XIAA 1XQKA 3OHMB 2XN1A 3C2OA 3VNMA 2BFGA 3R25A 4IMFA 2Q8XA 3WEOA 4NAFA 3G8RA 1U5JA 3KM8A 4BS0A 4UOJA 3W01A 4EXAA 5TNVA 4UTWC 4V28A 1V6UA 4PBFA 2BHZA 2ONEA 4CUCA 3ZSTA 2OEJA 2GOUA 4AZCB 5F4SA 3LBOA 4QAIA 1Q6RA 3LNPA 4ATWA 3LHTA 3VNDA 5GJPA 3U7VA 2R6OA 3WK0A 1U1JA 4NRSA 2ZDRA 4RV3A 4I8DA 5G1MA 3WQCA 4EF8A 2QR6A 4LV4A 3W74A 2WMKA 5FCZA 3OGSA 4AF0B 3WLTA 3JUGA 4Q3MA 4KW2A 4HNNA 3SQSA 3C2VA 2QCDB 4IJBA 5T26A 2C3ZA 1T8QA 2G0WA 1QOXA 4HJFA 4W86A 3F7JA 5HUOA 1S5WA 4LEFA 1B5TA 1RBLA 4FXFA 1UR8A 1OFOA 3QGVA 5EY5A 3T7VA 1J2WA 1GJPA 4HVXA 3KLLA 2E9MA 4HU4A 1JCXA 4QNEA 5CC5A 4ZE5A 4MADA 4KIRA 3BANA 3M0LA 3USBA 1TO3A 3QY8A 2BNJA 2VEFA 1ZFJA 1BEUA 4JIQA 1TPUA 1B3WA 3OO2A 3SUUA 1BAGA 2XVPA 1IGWA 3VOJA 3TW9A 1KRAC 1ZP4A 1XLAA 3VK5A 2ZUNA 1O4UA 1ENUA 1CGUA 1A53A 2WJFA 1C9DA 5CQ1A 5A6KA 3MHGA 2D24A 5DXXA 4XUYA 1YE4A 4RZ6A 2AL2B 4RZ4A 5LXEA 3H2CA 3XIMA 4UMBA 3W00A 1XDMA 4NZ1A 1OHLA 4GI9A 2VCCA 3NQFA 4U5KA 2DQXA 3EPOA 5HA7A 1VEOA 3ANUA 1DIKA 1EP1A 2DZSA 4FLOA 1FKXA 5AYXA 3TW7A 3LHYA 2EKCA 1LLOA 4QQUA 1OM0A 4IFKB 1UD6A 1RJQA 1IEXA 2ZUMA 4PN2A 1NARA 3SQLA 1EB3A 3M1ZA 4MKSA 1E9IA 1YEYA 3UYIA 1FY6A 3DC8A 3I65A 3PJXA 2ZQ0A 1EDGA 3WJXA 1JAEA 3W2MA 3IJ8A 2DW7A 2D0HA 2ISSA 3SDOA 1ADDA 5BWAA 2P8CA 5FOOA 1IV8A 1FWCC 5AC6A 2I5QA 4O1CA 2Z28A 2E5CA 4A8NA 2ABAA 4NAFB 1KFJA 1RP9A 3CM4A 1E6NA 4MPQA 5LA0A 5AYZA 4DBEA 5BXRA 4LAKA 3SFKA 4HNUA 1J79A 1HVQA 1SW0A 3QR1A 4I9AA 2FFCA 4PB3A 2GWNA 1X98A 3IS4A 3MUCA 4IIGA 1FCBA 3WD3A 2R24A 1SZNA 1KBLA 2XJ7A 1LJYA 1OEPA 3NGJA 1CXKA 4L64A 2OOFA 2E7FA 2C0HA 4R9XA 3B9NA 3W7NA 5HR7A 3ZJ7A 3WBEA 1IIHA 1BTMA 2J7BA 3RCYA 3DFPA 3BV4A 3RU8X 4DJFA 1OFPA 2YJQA 5C71A 2KAUC 3CC1A 1WX0A 4M24A 2X1IA 4ADTA 4UTWA 4OU1A 3TOPA 4WEVX 3V0UA 2EPOA 1Q6CA 4F0LA 3QC0A 3G1DA 2J75A 3HQOA 4P8UA 5TAOA 3CPRA 4RPPA 1GGOA 1ZTVA 1C91A 3PNUA 2ZCGA 3N15A 4MTVA 2V2HA 2CXGA 4GXMA 1ZNNA 3SCPA 4B5NA 3LG3A 5JBFA 2ABBA 3KOZA 4PUKA 3GQYA 3CV2A 2FB3A 3LSBA 4UTIA 3N2CA 4UBPC 3RLGA 1UOKA 4DHGA 2I14A 4O0KA 1TPWA 3TQVA 2NT1A 1X8FA 3CIVA 4XBSA 1JDDA 4NF7A 1V02E 3DERA 4XG1A 3H2MA 1XRTA 3BCDA 4B5XA 2XFWA 3WK3A 5B7ZA 5TQLA 3LN3A 1JNDA 5F7UA 4JTJA 3MYOA 2QIIA 1W0MA 1GOOA 1OINA 3F1QA 4CQ9A 3WLKX 4Q8PA 4JTGA 3N25A 7XIMA 4I90A 1ODZA 2WAGA 1LL7A 2X8RA 4GZIA 1WP6A 3LCGA 4FXSA 2O9PA 1FX6A 5E93A 3B05A 2XIQA 4JOMA 3UNDA 4K3ZA 5E0FA 3AZRA 1XRVA 2WB5A 1BLIA 3PSWA 4GKTA 2E40A 2QUVA 1W9VA 2OG9A 4CNSA 2RJHA 5C0QA 1NOUA 3EDJA 1U33A 3G18A 3K4DA 1E43A 4YMZA 4QXIA 3F2DA 5FJTA 1HJWA 3IAPA 5DFAA 1TZZA 3ME3A 4NJHA 2WMFA 4O16A 3ZIZA 1H7NA 1EHNA 1E0TA 3LCXA 1TCMA 4AC1X 3WL0A 4AW7A 2P76A 4Y9AA 3H21A 4M82A 3GB6A 3KHJA 4H7VA 3GFXA 1ZL1A 2D73A 2ESCA 2XWEA 1LWJA 3CHCA 3RILA 5JQ9A 2DZBA 1WAWA 2J7GA 3CZLA 2E6YA 4YYCA 3VDCA 1MEHA 2DSKA 5AKQA 2ZUSA 1VEPA 4C6JA 4GIEA 2ISDA 1GKQA 2RHGA 1FH8A 3OLEA 3VZXA 4S3BA 5H6HA 2CPUA 3WQOA 1R7AA 3TFXA 2J9XA 4JEJA 1SO3A 3H22A 4P8XA 3MWAA 1J96A 3HU7A 4AX6A 1ZJIA 3RLHA 4MKVA 4Y9NA 2WBKA 3WDRA 1HO1A 5DEZA 4IUGA 4B5UA 2J9ZA 4GWEA 2DSWA 2BY2A 3AYRA 1FWAC 4CD4A 3AXIA 1W3NA 4IIBA 2VUNA 1X6NA 3DFSA 2ANUA 1JPKA 5ENLA 4ZTYA 2J74A 5AVNA 2WPGA 3IACA 3KS6A 1Y7VA 4F0KA 1C29A 3R6IA 1SFSA 3AYSA 3VIPA 4C6EA 3UJEA 1UKTA 4A05A 4KWSA 5IBXA 4ZZ9A 5BXTA 1SGJA 4J35A 1E0UA 1WDDA 1ISVA 1P7TA 3VDHA 4E2VA 3HPAA 3I68A 4MM1A 4J4KA 2CESA 2WZMA 1EJXC 2YDAA 4KRTA 5AHLA 4E2BA 1YW1A 3AHYA 4IWWA 2UV8G 1XF0A 4M1RA 1FKWA 2J88A 5J8LA 3EOOA 3WK1A 4AX7A 3MUZ1 3TWBA 1NOWA 3RNDA 1GVQA 3S2CA 5CBBA 2XH2A 3S1WA 1O68A 1NP0A 2PGEA 3GDBA 1H09A 3NZRA 3QF0A 4QDPA 5TD4A 1A4MA 1A5MC 2J4GA 4H8HA 1ZP3A 4NYYA 1E1FA 3AROA 3INPA 4PB5A 2DQWA 3TK7A 3WQ6A 3ZLHA 2DP3A 2QUMA 1FHUA 4ICNA 4HCDA 1GZ1A 3W3OA 3STEA 3AMLA 4QJ5B 4JKLA 3UPBA 2YA0A 3VGEA 4KGJA 5LSMA 4MSSA 2Y8KA 4EANA 3DX5A 4JN8A 1G6CA 3RX2A 1M5WA 5HJLA 1TWWA 3DBPA 3KCOA 1US2A 2UBPC 3KRSA 3MMTA 3WBAA 1OX6A 1O5KA 3UXDA 1XD0A 1XLHA 3S83A 1G67A 4DQWA 3W70A 1YX1A 1PWLA 2AAMA 3TTOA 3PS7A 1FWBC 4LNYA 1NSJA 1WDSA 1E4MM 5G5IA 4N6FA 4P7RA 2O9RA 1XSJA 1JRBA 3PB2A 2IKHA 4H6QA 3D46A 1P4CA 2G4JA 2R1KA 1R2SA 4YVVA 1ZBVA 2V67A 3RRAA 3CV1A 1KBIA 4WXZA 3V35A 3EDDA 2X1SA 2O4MA 3KBJA 2OLHA 1WUEA 3R8HA 4QEHA 4MOZA 3HMJG 1PL9A 3G6LA 4GXPA 1YBQB 1DWJM 4GH1A 5BU9A 4LYQA 3N6HA 4GY0A 1QR7A 2J47A 3QTPA 3EWUA 4Z2HA 2EAWA 4WZHA 1MSSA 3K5XA 1F6YA 3BLDA 2VL4A 3UYCA 3YPIA 1O5XA 1Y5WA 3NSNA 4S3KA 1GYMA 4LEQA 4XZIA 5BXSA 5LNVA 5CZJA 1H2JA 1L2QA 3FFSA 4N0RA 4PGLA 2FGZA 3Q45A 3WNMA 2FDSA 2RAGA 4IJCA 3HG4A 1XDLA 3C8NA 4LB3A 2E6AA 4U5IA 3JW7A 2PEVA 3T0CA 3TN5A 2WWDA 1V0MA 3RK8A 5C7VA 2QXWA 2AAAA 3ARRA 4EX4A 4AZ5A 4Q32A 4FP1A 4AD1A 3EMCA 3SO7A 5DY2A 4CCZA 4KS0A 1R7OA 1E72M 1EYEA 5FEPA 2WMJA 3B8VA 3T2QA 2BLEA 3E2RA 4UTFA 4Y6GA 3N04A 4XWUA 1BYDA 1KM0A 4LUTA 4RE0A 2HE5A 4D6CA 3PPGA 3DESA 5AC5A 2NV9A 3QQ0A 5BU6A 1FWIC 1Q6LA 1MNSA 3BAXA 4O1FA 4AZCA 1VPYA 1X97A 3S5ZA 3CYJA 2P3EA 7TAAA 4PCPA 3ZJ8A 1U5HA 5KINA 8XIAA 1PKMA 5HULA 5BYWA 3ZMRA 4BQ4A 3W29A 4MYXA 2AKMA 4WSJA 3MCNA 3WBYA 4YN5A 2CLMA 3DBNA 3ES8A 2QJIA 1WDQA 1KM2A 1R3VA 1K02A 5A8GA 1EIBA 4GABA 4LUJA 3ZR5A 3N9SA 5MF5A 1UIOA 3GYEA 3FYOA 1TPFA 1DIDA 1RQBA 4LOCA 1H50A 3WNOA 4F9JA 4D6FA 3AS0A 2D2OA 1CXLA 1GYLA 5EMJA 2PDIA 3DZ1A 1K9TA 4JX6A 2ZZ3A 3AIRA 2WSKA 2A3HA 1XUZA 4GUHA 2VGIA 1TB3A 1P48A 1AFSA 5H8PA 1EHAA 4FNTA 1A5OC 2VVNA 3PZMA 2AMXA 3DU0A 2Q3RA 3IJQA 2F2KA 4JTSA 1TJ0A 2G96A 4UNKA 3FXYA 1JULA 3CWNA 1E1CB 4Z2GA 3OIXA 3T2PA 3M0ZA 4REQB 1EGVA 2Z27A 4C6BA 3G22A 2FZ8A 1PX8A 2VDGA 1GVSA 1OFDA 5I3IA 3MKVA 4X22A 3WEMA 3GC2A 1NM9A 2ASHA 3PBYA 1GONA 4Q8UA 3O15A 3SM0A 4O57A 2OSYA 2J8GA 4QSFA 2E67A 2HS6A 3ANYA 4IQJA 1SPQA 4HQVA 3WY1A 3NOYA 3EWDA 1VPQA 2W27A 4DPPA 2CIPA 3E74A 1UD3A 1LL6A 4NG3A 1TCDA 4Q4PA 1F3EA 1SU5A 5D05A 3T55A 4O50A 2E77A 2Z25A 1YNPA 2OYLA 3KL3A 2QMJA 3GXMA 2PWEA 1YQ2A 4NP7A 2FHBA 1SJDA 3TZNA 2G5WA 4CVWA 1J11A 4LFYA 3GNNA 1HVXA 2VC5A 1UKSA 3OLGA 1W1PA 1G01A 4LAZA 4J3TA 2GVGA 3WCZA 2WK2A 1OFQA 2XSAA 4FMVA 4LUSB 4A8IA 4M29A 3W9ZA 4AIOA 4KRUA 3DEQA 5BRQA 4W4QA 3C4UA 4IPIA 3GG8A 1EFZA 5EPDA 3QHMA 1HP4A 1MDRA 3TNOA 3M0HA 2WCSA 4WVXA 4DBUA 1H1NA 4GYPA 1HL8A 1R8LA 4X9YA 3SI9A 5LIUX 4UNLA 4L1XA 2QLYA 1QPKA 2P50A 1LCOA 2BVDA 2VR5A 1ZJBA 3L5LA 1UG6A 4H8NA 1CIUA 2FYMA 2DSZA 4E8GA 1C90A 5HAOA 2PDMA 4OQVA 3HBLA 1L6YA 3MBDA 4O1AA 3CEPA 2JKAA 2C14A 5IDZA 2XN2A 3B9DA 3FA4A 3VIFA 1PYMA 3QH2A 3KTSA 3V4BA 1KCZA 4A22A 4UQBA 4TOQA 3DYOA 3UJRA 4B5TA 3CL8A 5A5WA 1CT5A 1HJSA 2XVGA 3BTNA 2DVTA 1LZOA 4AU0A 1I1XA 2RDUA 3KL0A 5DLCA 1BTCA 2CLOA 4N4PA 4D1JA 4FF5A 4E4PA 2FVKA 4ZXOA 2Y62A 5GQBA 1U22A 3TA6A 5CZKA 3QPEA 3FDGA 5J5RA 1S2AA 2E4TA 4C60A 1UD5A 1AQ0A 2JGQA 4ZSUA 2FLIA 2DZPA 3TR2A 2PDFA 5ABHA 1EUAA 1OCQA 4TQTA 4S3FA 1WXYA 1ZS2A 5D2YA 3T8QA 3MUAA 1FBAA 1PIIA 2AGTA 1CGTA 1JIBA 1D7FA 4L6OA 1S2WA 5EGRA 5LA1A 4A3YA 3LGGA 1XLGA 3UPMA 5BNKA 2WNNA 5DQPA 1SZEA 1EJSC 4GNJA 3P93A 4BI5A 3RMJA 2V2DA 4WDUA 4ZVJA 1MQQA 3TNBA 2WWCA 2WVUA 3XINA 1KM4A 1DV7A 1DQXA 2CZFA 5IFTA 1ISZA 4W7UA 4S38A 2PDXA 4IMAA 4LS1A 5FI8A 5IDIA 2Z7GA 3E0FA 1XSIA 4DJFC 4HZ8A 2GGHA 4L65A 3KXQA 1BVNP 2ZIDA 2NUXA 1KTCA 4HZ6A 3POCA 3Q94A 3KBSA 4TVCA 1E6RA 1V7AA 4NAEA 1VS1A 3RR4A 5IHSA 2PGRA 1W3TA 4MNMA 4XO6A 3T40A 3SSZA 2YFNA 3QYQA 4QIUA 4HU3A 1B30A 2VO5A 1P0NA 1UMYA 2QVNA 4TVUA 2V5JA 2QUUA 1BGGA 1ZY9A 4LAUA 4IZGA 4PRWA 1C92A 2DZUA 2ZXAA 3R12A 4UTKA 3IIPA 4C6MA 3LA4A 2NVCA 3S5YA 5BWFA 4C5YA 5I00A 1NFGA 1Q13A 3F5KA 4X2PA 5D37A 3AMDA 1ICQA 3RR1A 4BFAA 4FNUA 1XX1A 1TYGA 4TUFA 4DUOA 4IISA 4J3VA 3MP4A 4J40A 4N42A 3P82A 4F0HA 3T1GA 1S5TA 5LHEA 5C9UA 1S5MA 3O6AA 3LU2A 3VC5A 2V9DA 7TIMA 4DZAA 2OB3A 1H3GA 4A8LA 4NZFA 3SUSA 1BSIA 1XIFA 2BP1A 1EF3A 1YHTA 1RV8A 1TKKA 3RO6A 4KWOA 2VWSA 1TJ1A 2E9BA 2V5BA 1EIXA 2YLLA 2E5BA 2YZRA 1REQB 4FX8A 4JFWA 4J9JA 2WSYA 3R4IA 1F07A 3ID7A 3K46A 4GJ1A 5FJOA 4Z2IA 1M01A 4C6KA 5A3HA 1R3SA 3KDNA 3CLMA 2O7QA 1UH2A 2YXXA 4GK8A 1QNPA 5GJNA 2I7GA 3BQ6A 3EA1A 3T4CA 4XB3A 3V0SA 4J7RA 3LPFA 2DJXA 3PZ9A 4B4FA 5LA2A 2FGLA 3EPMA 3KZPA 5A6JA 3QM3A 1BYAA 5BZAA 1W2VA 2J24A 2QCMA 3KDOA 1KKOA 2WC4A 1PTGA 2JFEX 4NJGA 5CG0A 4FEZA 6TAAA 2ZXDA 3ZVHA 3AHVA 2ZX7A 3VKBA 3U8GA 5IM51 4E3VA 3G0XA 4A29A 4DWDA 3FSUA 2PCEA 2I9EA 3ZJ6A 4EK7A 5B7YA 1G1YA 3LS9A 1R85A 7ENLA 3UESA 3AALA 3ZS4A 4JIEA 3G1FA 1CTNA 3GH4A 2EEXA 5EYWA 1DL3A 5ABTA 3RGTA 2WZTA 2Y5JA 1NDWA 3FVDA 4HTBA 5JUVA 2W63A 2A79A 4JNZA 4LH8A 2Y88A 3QQ1A 2YGYA 4LTSA 3QV8A 3UGVA 3F4NA 4INFA 2NQZA 3AJ7A 1S3TC 3QRHA 1W91A 3W22A 1VRXA 3POHA 2QJHA 1C8YA 4Q8OA 4A2SA 3L65A 1EEPA 1K7EA 2ZRWA 3U2CA 3H4XA 5HWNA 3AXHA 3W1PA 4PSPA 4IL0A 1UROA 2GZXA 2VDIA 1SJCA 3UWVA 3WQ5A 5MKGB 4MZYA 3TTQA 4G7EA 4RX0A 3T44A 3IV8A 1X6LA 3HQPA 3W37A 1GW1A 1GT8A 1RLCL 3S2LA 3Q58A 2FPYA 5I78A 5CJNA 1HKJA 5F4XA 4KEUA 1ZAJA 2YCJA 4UQ9A 4A6GA 2Y70A 4EF9A 5CH9A 3M07A 3KWXA 5F2IA 2VM8A 3LQGA 2EPNA 1ZRQA 1FXQA 5A6TC 3H8AA 2GK1A 2X7VA 1CPUA 4TX8A 2PRHA 4QJ3B 1UC4A 4ZOAA 1EL3A 4JCLA 2Y61A 3B40A 1OX4A 4A8RA 5AFDA 3PWAA 1VCGA 2QDHA 4AF0A 2CLEA 1KM6A 4IP7A 5KTLA 1YXDA 1GOKA 2BDQA 4CD7A 1WUFA 1VBHA 1P5BA 2QCFA 1FP8A 5K4ZA 1Q4WA 4AZHA 3W76A 3DCPA 2ZTKA 5FSEC 2NT0A 4XVEA 2BWGA 1C8VA 3AXXA 3IGXA 4RDZA 2KX9A 3DHFA 4LVAA 1UBPC 2E6FA 3LCFA 3S46A 3H23A 2NQ5A 2V5DA 5CXPA 5A6BA 4NI3A 1LOSA 2PMQA 3GO2A 2JEPA 3E0LA 3TSDA 5LIYX 5TF0A 3A64A 2WNQA 4JXCA 3FJLA 3NYDA 2G3NA 1A5AA 4JTIA 1A47A 1ECEA 1EJTC 1FQ0A 3SIZA 3LMYA 1V03A 3P0WA 3LZ3A 4LRSA 1MW1A 2PBGA 2L5HA 4U3CA 3LM3A 2HNHA 4UQAA 3KRZA 3S1VA 4HSNA 4N02A 4QBXA 1OVDA 1KTBA 1JYWA 4V27A 3EWXA 3GE7A 2WM1A 3ARUA 2C18A 4L6DA 2NW0A 1EYWA 2VDHA 5HQEA 1TVLA 1EH9A 3A12A 3H2AA 3TYZA 4RZBA 3N1AA 3PTKA 3DUGA 2ZBTA 5EMKA 4R33A 2QCNA 3G5EA 2XIMA 4N9BA 4AISA 4ZTXA 3BAYA 3CZ8A 1LWHA 4W84A 2HDJA 4HPXA 4S1FA 5CSUA 3ECQA 4U28A 5DMLA 2OFJA 1MZHA 1KR1A 4HNCA 3DXIA 4UOQA 4AWEA 1XYMA 1XBVA 4PRRA 1DYSA 3GZ3A 4JQ4A 3S9IA 4CNTA 1Q7QA 2HNEA 3RCMA 4PUDA 2VC7A 4C1NA 1KR0A 1JXKA 3EB3A 3VX0A 4FIQA 1A80A 1HX0A 3GYCA 3M4HA 5D30A 2HV5A 4OJYA 4GY1A 1QI0A 2V6AA 2DH2A 1MXDA 1K6AA 1DOSA 2QAPA 3OIHA 4NNCA 4CCDA 1F3XA 3K1DA 4PTVA 4MIMA 1RH9A 1XXXA 1FH9A 5ECVA 1JL8A 3GDMA 3U2OA 1EJRC 3DFOA 3HV8A 2HPMA 2ACSA 4ONVA 2PTYA 4S3EA 3QV7A 5LKYA 3SN4A 3R43A 1IWPA 3HB9A 3W82A 1VENA 1EZ2A 4LVFA 2X41A 2Y8UA 4PMVA 2QUTA 1IYXA 2ZUWA 7CGTA 4IGNA 3ZFHA 2PP0A 3CNYA 1J0YA 3RF9A 3FJ4A 2NX3A 1LYXA 3TXVA 3FHAA 3RPTA 2QKFA 3C0QA 4FLQA 2ATSA 3LBCA 3KHDA 3UETA 3WEZA 2YW4A 4MKNA 1QFEA 3XISA 4WOQA 1KFLA 3BW2A 2OODA 3GW3A 1TPEA 1VRDA 2CW6A 3AC0A 2CLFA 3USZA 3W6YA 4AIEA 1V0KA 2FHFA 4WDTA 1J0HA 2QCGA 4NZJA 1SO5A 3QR0A 4RV8A 4Z2LA 4CD8A 4CQAA 4HK5A 2JIWA 2CLKA 3I3BA 5HINA 3D6NA 2WV8A 5AYBA 4PEEA 1Q6OA 4CQ8A 4PUNA 1W32A 3THAA 2XHYA 4C7FA 3H55A 4N9DA 4F8XA 1W8GA 3H4WA 3KZSA 2G50A 4HCHA 6REQA 2PDGA 1AW5A 3GVRA 1ZQ5A 2V5LA 1L6WA 2BBFA 1B4EA 3T81A 2O9OA 3I3EA 3KCLA 2HS8A 1EJVC 1Z69A 1WDPA 3Q4DA 1MYRA 3VXGA 4KEMA 4OBRA 1JYNA 1RVGA 2YSWA 2GUYA 4K36A 4BJHA 3VU2A 3NL6A 4ICMA 2TYSA 4UTTC 4F0SA 2UY4A 1XP3A 1JGMA 2IXUA 2B0MA 4PFHA 1RPXA 1RP8A 4GGBA 3QXBA 2A3EA 3G24A 3IANA 3QPYA 1VCFA 2OZTA 5K2ZA 3SGGA 3BMVA 2EJAA 2FHCA 5EBUA 4AD4A 3EA2A 1X7IA 5F2LA 3SECA 3GVWA 1Z32X 3UXIA 4BA0A 1JUKA 4PE8A 1R38A 4XSMA 1LTDA 4OOUA 4PEKA 3F5JA 4CNNA 1GQNA 3SAZA 4JZ5A 4YU1A 1SZRA 3VNJA 3EKZA 3MI6A 4YJ5A 1KBBA 1Q2SA 2G37A 4JHOA 5HK4A 3JS3A 1XSKA 1J2BA 1P6BA 1XYZA 2YLAA 3A24A 3I6RA 2CHRA 3NQMA 1O12A 4AXNA 2FTWA 1IZJA 1Q65A 5E9AA 3QY6A 3WD2A 4C65A 3WBWA 2HVOA 1OADA 4MWAE 4WSKA 1B31A 1QDSA 1JZ2A 1LLWA 5G2IA 2BSLA 4OOZA 4I9MA 1NIUA 5HBFA 4JYDA 2VFFA 1Z48A 1UR0A 1Q8AA 3OU8A 2A0NA 4E6MA 4OBTA 1XGDA 1QK2A 3ITCA 4W5UA 5T9CE 4DYEA 4GQBA 1S1RA 3WH9A 1JRCA 1EJWC 1ISXA 1PZ1A 4Q7IA 3HIJA 5FKYA 1I9CB 3E02A 4TXEA 2JALA 2VTFA 8TIMA 4GVFA 4H7CA 3KWS