2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
b'KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
4HK5A 3IV8A 3HM7A 2VC7A 3PNUA 4J5NA 3B0YA 3MDUA 2Z00A 1FWIC 3K2GA 3KM8A 4C6MA 3GTXA 2D2GA 3GTFA 4NI8A 1R9YA 4LCQA 4EP8C 1RAKA 2ICSA 3E3HA 1YBQA 4XAYA 3LY0A 3CAKA 3MVIA 3ORWA 2BB0A 3R0DA 4L6DA 4DZIA 4LALA 4KEUA 2VM8A 2VR2A 1WXYA 3GU1A 2DVUA 2FTYA 1GKRA 1V7AA 4IH3A 2E1WA 3T8LA 1NDYA 4YIWA 3GUWA 3UF9A 2AQVA 4GX9A 3JZEA 3LSBA 3MKVA 3E2VA 3GTIA 3E0FA 4KQNA 1V79A 4LAOA 4RDZA 1A5OC 1FWHC 1P1MA 4GK8A 1A5LC 1J6PA 2GWGA 2QPXA 3S4TA 2YB4A 1UMLA 2G3FA 5G4HC 4QS5A 4CEXC 2WJFA 3AU6A 2ADAA 4GC3A 2QS8A 3LGDA 4UB9A 4CQCA 1YMYA 4WGXA 4RDVA 1FKXA 4UBPC 2A3LA 4C6FA 3LNPA 1NDWA 2HBXA 4B3ZA 3TN6A 4RE0A 3URAA 4KF1A 1V4YA 3RHGA 4F0SA 2R1PA 3OVGA 1WXZA 4INFA 2GWNA 1ADDA 1EJRC 3D6NA 2W9MA 4KETA 2VC5A 4KEVA 2GSEA 5CH9A 1ZZMA 3GU9A 1J6OA 3DC8A 2FVMA 2YB1A 1P6CA 4KESA 3LU2A 4RZBA 3S2LA 3WYZA 4KEZA 4XAGA 1ITUA 1YIXA 2Z2AA 3GG7A 2CZVA 2OOFA 2DVXA 4E3TA 4NP7A 1J79A 4EPEC 4G7EB 1PTAA 1FWGC 3MJMA 3EGJA 4GY1A 3URBA 2D2JA 1EJVC 5FSDC 2EG7A 4XD4A 1O5RA 2Q09A 4EPDC 1FWCC 3ICJA 2PLMA 4GZ7A 4TQTA 1NDVA 5HMDA 3FDKA 1S3TC 4WVXA 4EPKA 3ITCA 4Z42C 3LGGA 2Z24A 1BF6A 3T81A 1UIPA 4OFCA 2BGNE 4C6KA 3FEQA 4ICMA 4KIRA 3CJPA 3PAOA 1NDZA 4ZSUA 4H9UA 2ANUA 1E9ZB 3GTHA 3HTWA 3NURA 2Z27A 1RA5A 3MDWA 4I6KA 3B0XA 4IG2B 4D8LA 4CNSA 1V77A 3QGAC 4HK7A 4LAKA 1EJXC 2R1NA 3RYSA 4GBDA 1POKA 4R88A 4XD3A 2OODA 3A3WA 4CQBA 2PGRA 3HPAA 4DIAA 4LANA 4R7WA 4EPBC 5E5CA 4DI9A 5A6TC 2HPIA 3QGKC 2Z28A 3PBMA 4QS6A 4B92A 3LA4A 3K5XA 4QTGA 4C60A 4IFKA 1W1IE 2GOKA 2FFIA 5AKQA 1PB0A 2YZ5A 2O4QA 1EF2A 4CQDA 1A4LA 3MPGA 2R1MA 1P6BA 2P53A 1A5MC 3B40A 3TN4A 4C6JA 4J2MA 1YNYA 3G77A 3OU8A 3A4JA 4DI8A 4B91A 4C6NA 3AU2A 3A3XA 1RJQA 1FWJC 1XRFA 4V1YA 4R85A 3SFWA 4GOAA 2UZ9A 4LEFA 1M7JA 4XD5A 2IMRA 1VFLA 3K4WA 3OJGA 1DPMA 2DVTA 4ERGA 2WJEA 1YBQB 1RK5A 1J5SA 1O12A 1FWBC 2I5GA 2WJDA 2Z7GA 2FTWA 4C6LA 4XAZA 4XD6A 2HNHA 2AQOA 3ISIX 1A5KC 5HMEA 3URQA 4RDYA 4C6IA 1JGMA 1PO9A 4ERIA 4QRNA 2R1LA 4GX8A 4XAFA 4ZSTA 4PCPA 4LAMA 1FWDC 4QSFA 4IF2A 3SO7A 2E25A 1YRRA 3E0LA 3NQBA 4DZHA 4C5YA 2XIOA 1HZYA 4F0LA 4KERA 2R1KA 3RCMA 4C6QA 3IARA 1EYWA 1RJRA 3IJ6A 1E9YB 1EJUC 4ERAA 3O0FA 3GIQA 1XGEA 1K1DA 1ONXA 4JOMA 3LS9A 4L9XA 1I0BA 1R9XA 4H9YA 4WHBA 3EWCA 4H9ZA 2QT3A 4H9XA 4BJHA 2KAUC 4CNTA 2Z4GA 4PE8A 3S2MA 2EG6A 4V1XA 3OOQA 4C6CA 2HPMA 1A4MA 3FDGA 1RA0A 1V51A 3UR5A 1KRMA 2HBVA 4C6OA 3T1GA 3QY7A 2WM1A 4DNMA 3TN5A 1UBPC 3ID7A 1M65A 3GRIA 3OQEA 2YXOA 3EWDA 4BKNA 3UR2A 3UBPC 4M51A 1RJPA 4LFYA 1GKPA 4IFOA 4P5UA 1KRBC 4IGNA 3PANA 4LCRA 3IACA 2P50A 3WMLA 3DUGA 1R9ZA 3MTWA 3IPWA 4IFRA 3S2NA 4H00A 4GYFA 3F2BA 4GXWA 4CNUA 3URNA 4PBEA 2OGJA 4LCSA 1XRTA 3LSCA 3TNBA 3S2JA 4GY0A 3IGHX 2D2HA 4H9TA 4PBFA 2F6KA 5LXXA 4C65A 4GY7A 2Z25A 3OODA 4G7EA 3GU2A 4H01A 3N2CA 3C86A 2PGFA 3F4CA 4C6PA 1KRCC 4F0RA 4J35A 1K6WA 4PCNA 4AC7C 1QW7A 4H9VA 4HA0A 3RN6A 4C6EA 3CS2A 3MSRA 3WZ0E 4IGMA 2OB3A 4C6BA 2AMXA 2HQAA 2ZC1A 1EZ2A 1M68A 3F4DA 1POJA 1FWAC 3PNZA 3O7UA 1IE7C 4G2DA 2PUZA 5FSEC 3UPMA 3BE7A 1UIOA 1I0DA 1RK6A 1K70A 2Y1HA 4DLMA 1FWEC 4C5ZA 1EJWC 2EG8A 1NFGA 3V7PA 4LH8A 3IRSA 3QY6A 2RAGA 2VUNA 4IQJA 4HK6A 3GIPA 4IFKB 4DYKA 1FWFC 3AUOA 3F2CA 1KRAC 4NG3A 2Q01A 4IG2A 2Z26A 4C6DA 2UBPC 3E38A 1ITQA 4B90A 4BY3A 2O4MA 1A5NC 4I6VA 1QXLA 1FKWA 1EJSC 4RDWA 1XWYA 2VHLA 3QY8A 2PAJA 3DCPA 2Z2BA 1GKQA 4QROA 3TN3A 3NEHA 2I9UA 1ONWA 3MVTA 4CEUC 2GZXA 4DLFA 2OQLA 4MUPA 1PSCA 3F2DA 5HMFA 2Z29A 2FVKA 1KCXA 3E74A 1EJTC 4AQLA 4H9MA 4DO7A 2QVNA 4HJWA
chains in the Genus database with same CATH superfamily
3R43A 1GW9A 1XI3A 2PLJA 3DI1A 2OYKA 3CPUA 3UJFA 1A5AA 1EA9C 3LBMA 3W53A 4E3VA 4NI8A 1R9YA 4LCQA 1M01A 1DTNA 3MB9A 2IPFA 4ONVA 5A6BA 3VVGA 2VEKA 1KXHA 4H04A 3G18A 1WXYA 1LQ0A 4BS0A 3GAKA 3KS6A 5HJXA 1GJPA 3HFYA 2X09A 3DECA 3W00A 4E8DA 1A5OC 1XYCA 2DJLA 3SEPA 5JIWA 3ATYA 1LBFA 4FSAA 2CHRA 1OY0A 4M24A 4QS5A 3CYVA 1VEOA 3CUFA 3UJSA 1J4EA 4X60A 4M19A 4GA8A 3BXWA 2CKRA 3RO8A 1J12A 3CTLA 1N8IA 3HG4A 1B9BA 4NYYA 3URAA 1JI1A 3NZGA 2BG5A 4GUHA 2FZDA 3P62A 1QI0A 3WF3A 3AMLA 3MKCA 2WVVA 5HWNA 4FNRA 3NSNA 5FKYA 2BODX 2DSVA 1KD0A 5EMLA 1TPH1 5C9ZA 3TJ4A 3IVSA 3LU2A 4KEZA 4E38A 1W0MA 4HMDA 4NZCA 4A2SA 4NP7A 2DQXA 3QN3A 3CK5A 3MJMA 2ZX8A 4JTGA 1G6CA 4IUGA 1JR1A 4JEQA 5AHMA 2PMQA 3VOHA 3SCWA 2CLFA 4FR6A 2PU1A 2UY2A 3MP3A 2E68A 2PLMA 2PC8A 3L2IA 3NGJA 1UP3A 4RPQA 4D2JA 3AIVA 3MA8A 5I5RA 1MEIA 4Z42C 3L65A 3H7RA 3L12A 3N6JA 3FEQA 1GYLA 1NDZA 1GVEA 2ACUA 1PZ1A 3VDGA 3SQSA 4PTMA 2RDWA 4PTNA 3AMCA 1VBHA 4IG2B 4PMNA 3NVDA 4HK7A 4LAKA 2Q3OA 3WQWA 3OO2A 3PZQA 2F9RA 3K4AA 5BROA 1DWIM 1OF6A 1TWWA 1BYCA 3MHFA 3QLDA 4MM1A 2HS8A 2YX0A 2Z28A 1VFHA 3PBMA 3OLEA 1E9IA 1XLLA 2GL5A 2NLIA 4F4RA 1SQ7A 3H2EA 3BVJA 3GH5A 1WBJA 1VC4A 3AALA 4MOZA 4KWUA 1E6NA 1LWJA 1XBVA 2J7EA 1Y8BA 3AWOA 1OHLA 4MNKA 1YTDA 3INPA 1AH0A 1VFUA 4HSHA 2OWXA 1VF8A 4CVWA 2WCGA 3S1XA 4D8AA 1XLAA 1NFPA 1OX4A 8CGTA 3W1TA 3TEVA 1M04A 2JKEA 3G1AA 3DXIA 2QCGA 4RV8A 4X9SA 1W5QA 4A3QA 3QV7A 3QC0A 1ZQ5A 4NZ1A 1RPKA 2XUCA 1A5UA 4QLLA 3BCFA 3RCMA 3UWUA 1AW1A 2EAWA 3NA8A 4AZ6A 1P0BA 1JF6A 3IAQA 3T2QA 4PRWA 1ZHAA 2KAUC 2XSBA 4BF5A 1EBGA 3S2MA 3OOQA 4MYXA 1RA0A 3V0TA 4DYJA 3JVAA 1RBOB 4AZGA 4AZ7A 3HZ3A 3TN5A 2G3NA 3S6DA 3AYRA 2OZ0A 1OFEA 3UY7A 1U83A 4ATWA 4Q22A 4D72A 1CB2A 1P5BA 3UBPC 4C1KA 5GQBA 1RJPA 2VJXA 4JQ1A 1AQFA 4OJYA 3TZFA 3N6HA 3G1RA 2X30A 6REQA 4A3YA 3S83A 1PBGA 2BHZA 1TPDA 3SCRA 2BV9A 1ONRA 2GFTA 2V3GA 4IMDA 4PBEA 2CC0A 3LSCA 3IGHX 3W26A 3L4TA 5I78A 1E55A 3WMCA 4QNWA 2BWGA 1XBZA 4NXKA 3KW3A 2PI6A 4F0RA 4JTDA 3ZIZA 4O28A 3QQ1A 3MWCA 2BGQA 4DVOA 1XW8A 3EMQA 3QR1A 4K2SA 3L4UA 1F6PA 2RGLA 3SCQA 4OBRA 1W2PA 4W8BA 3S47A 1QRQA 1P7TA 2DZSA 2CLPA 1TVPA 1M7PA 4WSHA 5DMMA 3P93A 2BZNA 1TELA 5GVJA 1OGGA 1KM1A 4UQAA 3VYLA 1PPIA 3UVIA 3SIZA 2XWDA 1DHKA 3N04A 4KIEA 1L0PA 1HJXA 5FEZA 2Y7FA 3VKJA 2YL9A 3O05A 4B90A 1TPB1 1EGZA 3MP4A 3PWIA 4PTXA 1XUZA 3TCEA 3JZUA 1GVQA 4G9PA 3ECQA 3WENA 3MVTA 2O9RA 1PSCA 4KRTA 1SZFA 3QC3A 2X16A 3GS6A 3WLQA 2YSWA 5F4WA 4JNMA 4U5IA 2VX6A 3PNUA 2GDQA 2W67A 3CIXA 1HKMA 3SSJA 4EXBA 1I4NA 3UG3A 4ZQOA 4X2PA 3N12A 3R89A 1PWLA 2X0SA 2FDMA 3OGSA 2YGYA 4MKNA 3CPRA 1YBQA 4GGHA 3LY0A 1SJAA 2W79A 1IXNA 4J3SA 2WANA 3MYPA 3GQYA 3VC5A 3DFYA 4U3CA 4MYAA 3VE9A 3OZYA 4DPQA 1MXSA 2E6FA 4U5KA 1XS2A 1PYFA 3V5OA 5EFDA 6A3HA 2INFA 2IQDA 4R34A 2YXXA 4RDZA 3FAXA 5ABFB 4U28A 4YTUA 3ZLHA 2NSXA 2YB4A 4O8RA 3TH6A 4BQ4A 3TYEA 4DJDA 2E9MA 2ABBA 3OLGA 3AAMA 3GVWA 1UKOA 1H51A 4UBPC 3EWYA 2B7NA 3T4CA 2VX5A 2RUSA 4X3ZA 4RE0A 1J96A 4GYJA 3VCNA 4JIHA 4NXSA 2CPUA 3GUGA 1EJRC 2HCVA 4N6FA 1UWQA 1TRIA 2WPBA 2CWXA 3LCLA 4J1OA 1QO5A 3USZA 4IICA 1JZ4A 5H1WA 1K3UA 4JYEA 4POCA 1AH4A 4MJZA 2C1HA 5JVLA 1FY6A 1QOPA 2OOFA 2G37A 4E3TA 2OX1A 1PTAA 3SUTA 1E51A 2DH2A 3CWOX 3ARUA 2QUMA 4V2XA 4QCFA 3BGAA 4YPJA 3OW1A 3AHTA 3KS5A 2A21A 3EA2A 3EOOA 4H2HA 1UZ4A 4TQTA 3TOYA 4H8VA 2GPTA 1A5SA 4EWND 3MT1A 2C79A 5BXTA 3IANA 4TVDA 3ME3A 2GGEA 2PDGA 3HG5A 1SR0A 2VRKA 5D2TA 3E9AA 4ZO8A 1FXQA 1O95A 2WMHA 5LXEA 1SFLA 2DV0A 1ISZA 3M5ZA 8A3HA 4AH7A 2KX9A 3R94A 1HF6A 1ME7A 3EWZA 4MADA 1GQIA 1FHLA 4N0RA 2PCEA 3W81A 5EPDA 4UTTC 1Z89A 1J0YA 4QQ3A 3R0KA 3U5UA 4QTGA 3QEZA 3GO2A 4OU1A 1ZJHA 5AKQA 2EGZA 3P8IA 1K03A 2X41A 4YWIA 1E0WA 2BY1A 5I02A 2HK0A 2QUNA 4HZ8A 4LC8A 1I60A 1R85A 1ICPA 4GZEA 3AZRA 2VX7A 3AU2A 4UZSA 4MIMA 2XIMA 5H6HA 4LEFA 2IMRA 4ZTYA 1HJWA 1DPMA 1XIBA 3DU0A 2GSJA 1O12A 2Z7GA 4NASA 1JZ7A 3WF1A 2YZRA 3WK2A 4WXYA 1K9TA 4ZO7A 1RZMA 1TWDA 1Q5MA 3NYDA 4XD6A 5D30A 1Z69A 3A4WA 5HMEA 3URQA 2XVNA 4RDYA 4OV4A 2PE4A 2WMKA 4X0VA 4DWSD 1PDYA 2R1LA 2GK1B 3EB2A 4NF7A 4PMDA 2VUYA 3PS7A 3RILA 5DXXA 2FJUB 1YRRA 3SADA 4TUFA 2HV5A 3GW3A 4AX6A 3AHZA 2A6NA 5DMYA 1REQB 2V3EA 4AY1A 1XGEA 4MLJA 3SRDA 3P60A 2WOQA 2E77A 4S3GA 4G56A 2NT1A 2ISDA 2OELA 2Z1XA 3HGJA 2XGBA 3MSDA 3RM4A 4AZCA 3A4XA 4JKMA 3CT2A 3FDGA 2OU4A 3E0WA 1S39A 1WUEA 1OFAA 2JGYA 4I5UA 3VGHA 4IT1A 3OB8A 1JL8A 3GRIA 1H7PA 1M3UA 3ZVHA 3CZ8A 4GKLA 2W4XA 3M0IA 2VC9A 3CL8A 9XIMA 3T8QA 4CD5A 4K1GA 3R5EA 1LORA 1XLMA 3B4YA 5E70A 1MSSA 1RVKA 1OFBA 4DF1A 1FDZA 3GTNA 1BEUA 1JNEA 1F5ZA 1GOQA 4GYFA 2PB1A 4HVXA 3LYEA 5A8QA 3URNA 1IHIA 4WGHA 1QPNA 4JHMA 3RRXA 1TPUA 3LZ5A 2DFAA 3ITVA 2GJXB 2BOFX 2RJHA 3SRHA 3CEUA 1X1OA 2ZIDA 3RMEA 1DV7A 2C1GA 4ES4A 1KTNA 4W84A 4GVFA 3UG4A 3GU2A 1OB0A 3FS2A 3BZJA 1GORA 4Y7EA 1QW7A 3PBUA 4LBSA 2CBIA 1WP6A 1X7FA 4REQA 3LPFA 3BMVA 3PNZA 1FCQA 1CECA 1IE7C 1CXFA 1DWJM 3N14A 2QZRA 1S5VA 1XLDA 1JCLA 1CB7B 5C2XA 3SY1A 1O5XA 1GNXA 1OZQA 3E2SA 1V3MA 2EG8A 3IRSA 1IF2A 1SO3A 3NZQA 2ZVRA 4K68A 3O6YX 1PZ3A 4GPNA 2WMJA 1TPVA 4HNNA 2Y2WA 3ZT7A 4W85A 2DUXA 3E38A 4RNIA 1UD4A 4Y6GA 1A5NC 1BFNA 2D3LA 3W7RA 1XG3A 1GVFA 4KRZA 2F38A 3P6LA 4XISA 1TCMA 2VD9A 3NQAA 1UR4A 1WKDA 4YTQA 4DLFA 1PKYA 2C91A 3GZAA 2Z29A 4OHQA 4AUBA 1L8PA 1QJWA 3H6OA 2OCZA 3KRZA 2QVNA 4B4FA 4HJWA 3A12A 1KBBA 3TAOA 4C1NB 1EXBA 4CCEA 1WAUA 4JQAA 2Z00A 1EPVA 3V18A 3WMBA 1VCFA 2V2CA 5G2IA 1Y0EA 5HR6A 1TV4A 3OBKA 2J7CA 3DG3A 3IJDA 3AIQA 1DWHM 1DJYA 3W82A 1G01A 1X7IA 2JKAA 4L6DA 1VYRA 1D3GA 3GU1A 3BTNA 3GUWA 5CC3A 3OA3A 3T6CA 1OSEA 3LSBA 1IXPA 1UJQA 3SDOA 3UWQA 3OEXA 2NXGA 1GVYA 1FUYA 3ATZA 1EC8A 1A5LC 4AZ5A 1YDNA 3VNKA 1W8GA 2IKJA 1F3EA 4J28A 2WHKA 4EF9A 1RV8A 3WJXA 5A8OA 4YCOA 4CQCA 3THQA 2H3DA 5AYXA 3ZR5A 2ZRYA 1DJGA 3C2FA 4Q8TA 1K7EA 1AZ1A 4P61A 3F4WA 4I8DA 5IXEA 5M03A 4GD0A 3H21A 1AQ0A 2PDJA 3UXIA 3AIEA 3THUA 1H7WA 2XGIA 2FVMA 1W1ZA 3M43A 1LJYA 3CUZA 2Q8XA 2V5DA 1CIUA 3PTDA 5CBJA 1ITUA 2WQPA 3L7RA 4RNFA 3L4VA 3TX9A 4PTVA 3PP7A 1R46A 2WO5A 1HQTA 3MMWA 2V2HA 3UD6A 1ICQA 1EJVC 1FDJA 5FSDC 1MRQA 3W7MA 5D33A 2WJZA 3ZT5A 2JIEA 1PKMA 3W1PA 1JF5A 4HPGA 3NDOA 3EB4A 3U4AA 5HMDA 2VRJA 4F40A 2PCQA 1UKTA 3NR0A 4IXHA 3GDKA 1A5BA 1XYFA 4OUIA 3AIUA 3DERA 4KWVA 5T91A 1TWIA 1TJ2A 1UWAA 1CPUA 5FF3A 5EBAA 1RCQA 1GGOA 1JYWA 3LK6A 3RYSA 4GBDA 3M0LA 4MY9A 4L80A 2V67A 2NWSA 3KVMA 2BFGA 3EEGA 4LAUA 3MV11 2ZXAA 1O1HA 4AXKA 5FI8A 1JPDX 4C60A 4QJ3B 4DXVA 2R8WA 1B3VA 1UKSA 4V28A 1H1NA 1V08A 4FLQA 1PB0A 1E4IA 1EF2A 4IJCA 4A29A 1LT7A 3MSGA 2R1MA 3OGVA 1J0JA 2QDGA 3MU7A 3UVAA 5CZTA 3QVQA 2DPEA 3A4JA 1GW1A 3DDMA 4F0HA 1XRFA 1N8WA 2V68A 1ZTVA 3GX9A 4GIEA 3VIFA 5I3JA 5CC6A 2BXZA 2VYOA 3DBPA 5C7VA 1EUNA 1XC6A 3BAIA 3EA1A 4XIMA 4GMEA 3MKKA 2YDAA 1OG6A 1RY8A 3U2OA 5FOOA 1VBGA 1JFXA 1MZHA 4TMCA 3VFCA 1C8YA 3TVAA 4XZBA 3KZPA 1DOSA 3GBDA 4N2YA 4LU0A 4JKKA 3PSVA 1BXNA 1LRTA 3EXTA 5E0KA 2W91A 4AMCA 1Q6RA 3GIQA 3KFTA 2PF8A 4IIBA 1XHGA 4HYRA 1JRBA 3WJZA 4H9YA 4AXNA 1AJ0A 3TJIA 1L8NA 3SY8A 3LQLA 2DP3A 4LPCA 1RQBA 2EKCA 3ES7A 3SJNA 3TYBA 1BVZA 4PMVA 4DN1A 4IMCA 3REQA 1HKWA 1KM4A 3CTTA 3ARQA 2C15A 1Q45A 2PDXA 2FGZA 4O4WA 1WKEA 4DBSA 2E5DA 1D3HA 4X9YA 3CMFA 3W23A 4M81A 3L2MA 4P5UA 9CGTA 3PZ9A 1OF8A 3BJTA 1JCXA 1W3LA 1TB3A 5BRQA 1W54A 4GXWA 5HATA 4N9DA 3P14A 4ZL1A 1UD6A 3TNBA 1EEXA 4UQCA 3HGOA 3ZJ7A 2Z25A 4GUGA 5CSYA 4G7EA 3LCFA 2DH3A 4HSNA 1EXPA 1UWUA 1CXHA 3A22A 3F03K 1DE5A 3BLKA 1Y7VA 1CXKA 1B0IA 3T9PA 3RN6A 2CZEA 1QWGA 3VD4A 4XKYA 4C6BA 3QKEA 1ICSA 3V0SA 3DFTA 1GQJA 2WM0A 2D20A 3C8NA 3IGUA 2QUTA 4Y8EA 1BLIA 4MVAA 1W1PA 3P2VA 4W86A 1NFGA 2X1IA 2OO0A 3SR7A 4M1BA 3DC0A 4IQJA 1RD6A 1QU4A 4M82A 2QUUA 2OEKA 2VZOA 1R3WA 3AWNA 1TPEA 1IXOA 4ENLA 1IGWA 1KFBA 1E71M 3M0VA 3UWYA 1K9EA 1D7FA 5AYIA 3U6WA 1H7NA 2BS9A 3M7SA 4NQ1A 2XJ7A 1AW2A 1FFQA 1XWYA 3B8SA 3W01A 5HANA 4HJFA 2REQA 5DO8A 1ISWA 1J0ZA 3MMTA 3TN3A 3W71A 2J8FA 4JTEA 3HV9A 1QI2A 2W3ZA 5IDZA 1DXFA 3WDJA 1Q2RA 3VK5A 2QKFA 3C8FA 2CBVA 3W27A 1PAMA 5CQ1A 4J5NA 4GI6A 5BRPA 3H70A 2NV1A 4JTJA 4ZQNA 1A53A 4ZB2A 4JTRA 1VFOA 3L5LA 2ZRUA 4JNYA 2BSLA 2FH6A 5B7YA 4XB3A 2GDUA 5FJTA 1ECQA 4XAYA 1BG9A 3A21A 2YBUA 1ADSA 3RM9A 3WF4A 4RKAA 1JQVA 2FTYA 4L4PA 2QXWA 4A21A 2XN1A 3KXQA 1D3CA 3UF9A 4GX9A 3E96A 2QJJA 3D3FA 3CHDA 3IUHA 3HURA 5BMXA 2PTWA 5EA9A 5HNUA 4PH6A 1XPYA 2HJPA 2XIQA 1Y5VA 4GCAA 3OYZA 2WAGA 3LGDA 4GUIA 5G1TA 2HBXA 5I07A 1GOMA 4ZXLA 2W61A 2VFFA 4L56A 2OT0A 1PHQA 2V5BA 2W9MA 1TMLA 4HTBA 4AWUA 1TZZA 1ZCOA 3THDA 4DAIA 3GU9A 4XWUA 2IW0A 1E1CA 5J04A 4TX9A 1LOLA 4KBXA 2OX4A 1Q6OA 1H2JA 4AW7A 4L64A 4Q8QA 1R87A 2ZUUA 4BA0A 1NEYA 1H0GA 2PBOA 2V8ZA 2QPSA 2WVUA 3LHWA 3VX1A 7TIMA 3FJ4A 3W7CA 3GDRA 3NOEA 3AXIA 1AL7A 1ODUA 3LG3A 3ITLA 4JTQA 1V02A 2OR2A 3V4BA 2ACSA 4WX2A 3FCPA 3NEVA 1KC7A 3IV3A 3ZFHA 1H61A 2H9AA 3TKFA 2FMOA 5HNNA 1UD5A 5FIPA 4ICMA 3CJPA 3PAOA 3AI0A 1XUUA 1XLFA 3CV6A 5GNXA 2O0TA 2BGSA 3GDBA 4ZMGA 3GTHA 1TYGA 1B4KA 1GQLA 5BU9A 1O5QA 4JBRA 3S46A 3M41A 3CWNA 1S2TA 1QBBA 1UA7A 2XVPA 3MC5A 1POKA 3S3GA 4MB5A 4A8IA 1R5YA 3A3WA 3FYPA 1Q6DA 4NJKA 4E0CA 1HKJA 3PBWA 1VB9A 1CGVA 1QATA 3WMSA 3V1HA 5A6SA 4QS6A 3KRSA 1P4CA 4UNIA 4U3AA 2VOMA 4WJXA 1Q7QA 1CGTA 4JQ2A 1TTJA 1KR1A 1JPMA 5BYWA 2F61A 3W7QA 4J2MA 4N4QA 1TA3B 3NQ8A 1F74A 4FOUA 2FZ8A 2GVJA 1EO7A 3IJ7A 4K7YA 4M6VA 2WLYA 5DN1A 2NW0A 4MB3A 2XFRA 2Y70A 3GDLA 3LBOA 4PMUA 4C6LA 3DFPA 1W1A1 3GG8A 1H49A 3ZM8A 4XK2A 3CZEA 3VIPA 3HPFA 3EPOA 5KZ6A 5AHIA 2VO5A 4IF2A 1GHRA 2TAAA 4GYPC 5K4ZA 4C6QA 1BSLA 1RJRA 4GH3A 5LNRA 1UCWA 4C91A 3UZ5A 2VDIA 4HN4A 3PC0A 2YL6A 1P0NA 5LZLA 2JFEX 1MDLA 3TYDA 1P7TB 4UNLA 3V36A 4FNPA 2CYGA 4PMRA 1E0VA 2O7SA 4P2VA 3W2KA 2E5BA 2Z4GA 3K13A 4YHGA 3E5BA 3UNTA 4JR5A 1KCKA 2SFPA 3VGFA 2YCLA 4KGJA 2VGBA 4PB4A 2G97A 4GE8A 4RW5A 1F73A 4DJFD 3GNRA 4OT7A 3QHNA 3SUWA 3C61A 3RUBL 1LLWA 3M7WA 4BKNA 3FHQA 3LB0A 4YL2A 1TFVA 1JZ8A 1KNWA 4W8LA 4HPNA 4NX5A 3TOPA 3RK8A 2E67A 2HROA 3DUGA 2XH4A 4MJMA 1Q8AA 4MFDA 2XSXA 1AD4A 1QNSA 5DX7A 2ZUNA 4NRSA 4GY0A 1AD1A 1WE5A 3AIBA 4WIWA 5IFPA 4U2YA 5FF7A 3BJFA 4GY7A 3TQPA 3SAZA 4DJED 2DY3A 3U0HA 1UQZA 4MY1A 3UGVA 1P43A 3GHRA 2YKKA 4XZ9A 4IGMA 1IZKA 3CZGA 1NQKA 4UXDA 1QK2A 4FI4A 4IMEA 3TXZA 3ITOA 1E3ZA 2ASHA 1V7YA 5LIKX 2XFWA 3TJLA 1I0DA 5BW6A 3ARZA 3W24A 1FXPA 3TC7A 1XINA 3QY6A 4JTUA 4JCLA 4H4IA 3BUVA 3U4FA 4HK6A 1CW2A 3G22A 3UXDA 3O9NA 3WFLA 3FV9A 2HISA 4WKFA 5J5RA 4FF7A 2J66A 4HU8A 1P0EA 2EBNA 2Y88A 2NVDA 2GOUA 2J8GA 2Z7KA 1LZOA 1Q6CA 3LQGA 4URIA 5KEZA 4XBKA 2RH9A 4M1RA 2E40A 4OTKA 2FJKA 4M56A 4H8HA 1FP9A 4OV9A 3NTYA 4KGLA 1Z9AA 1AG1O 3LENA 3WUBA 2E8ZA 2XYLA 5ECVA 1X6NA 3L5AA 1YE6A 2C18A 4X61A 1DE6A 1CYGA 3I3DA 4LUTB 1KV5A 1F6KA 2HWGA 3V3WA 2VC7A 1VEMA 2Q8ZA 1T40A 4HTYA 3TQVA 3V5CA 1KM3A 4A8NA 5CPLA 1QNVA 1TPC1 1H5VA 5JMUA 5HWMA 4R9XA 1Z8AA 3W74A 1VBJA 3KL0A 3H2FA 3TONA 2DIJA 3GLCA 4NVTA 1PJ9A 1K7FA 1XBXA 4E5TA 3KP1A 3MVIA 4LUIA 1UR3M 4PN2A 3WG6A 3W4RA 2VM8A 4S3FA 1UR9A 4DUWA 4Z2GA 4HMCA 4Q3MA 6PTDA 1ONEA 1PV8A 3WUFA 4KQNA 2Y85A 2XU2A 4UTFA 2FVLA 2CCRA 1R2SA 4ZR8A 3EX6A 1V8EA 5D02A 3G3MA 2G3FA 1H7OA 6ALDA 4XZIA 4WOQA 2J9XA 1OD0A 1KM5A 4GYPA 4DX3A 1H50A 1PX8A 4NRRA 2A3LA 4NJIA 1BG4A 4A2RA 1G0CA 1ML1A 3BO9A 2EPKX 1W1YA 5DCEA 2E28A 3TCSA 2GWNA 4B5VA 1OBAA 1SZNA 2EO7A 3VILA 1J11A 4MF4A 4QSHA 4AHOA 1JEZA 1KBLA 3DX5A 1U5JA 1UPPA 3N3TA 3SIMA 3LTPA 3PZTA 4RZBA 2WBGA 7A3HA 2XIJA 3W2JA 1GVSA 5I79A 3ZR6A 5HUOA 1KFEA 4NAEA 3WQ4A 3R4IA 3B0VC 3P67A 3A5FA 4XX6A 1JAEA 1PX3A 4DO5A 1HTIA 1KFJA 5JH1A 3UW6A 4HKPA 2B4GA 1FWCC 3TYAA 3ICJA 4J2PA 4JX4A 3EYPA 4RZ4A 4UTHA 2PTDA 2QHAA 4LYQA 5D4YA 5BU6A 4O1DA 4MNJA 3M5XA 3T81A 2XVKA 3AO0A 1AZ2A 3OIXA 4IQEA 4PGLA 4HOWA 3DKJA 3CHVA 1SU5A 2PRHA 3PBVA 2QR6A 1H7XA 4AWSA 4JN6A 3E2RA 4D6DA 3O6AA 5MKGA 3MO7A 1UWSA 1MNSA 1FWNA 4H6EA 4W8AA 1EOMA 3GNNA 5E6YA 4DI9A 5A2BA 3LLXA 4GI4A 4LS0A 1VIZA 5I24A 4ACZA 2WSRA 4Z17A 4AZCB 1NAL1 2VFIA 4XAPA 3H2MA 3T0TA 1RLDA 3OZPA 3APTA 3FA5A 2J4GA 2V38A 3ZO9A 4U2ZA 3W7EA 4K8HA 3AS3A 3WD3A 1BD0A 1W3NA 3OHIA 3GSMA 5EBUA 1L6FA 1E5JA 3A3XA 2PEVA 3SFWA 5EGRA 5I3DA 4KH2A 3LBCA 2ZX7A 3CV1A 3K4WA 3OJGA 1EHAA 3RCYA 3KRBA 3LEPA 2DZAA 1MO0A 4K1WA 4C7FA 3NPUA 3FKKA 2INZA 1KV8A 1KGUA 4CNOA 4JL1A 1JGMA 3TC3A 2JIWA 2J78A 1PTGA 3QMSA 3M0XA 2XHYA 3N29A 2W0UA 2Z1VA 4AIBA 5CGQA 2WNQA 3JW7A 3F4VA 1DIDA 5C2CA 2CLHA 2VC6A 2E25A 3N3MA 4HB7A 2OZ8A 3AYTA 1J93A 1LG2A 5CPQA 2XINA 3BGJA 2J7FA 2NUWA 2QYGA 4REQB 1QW9A 3T40A 4JY8A 4DZ5A 4ERAA 1K1DA 3H4WA 3W28A 2F2HA 1LYXA 2R24A 3T07A 2YLLA 1Z41A 4K36A 1KR0A 4P7QA 4HCHA 2CLEA 3UWZA 1XV8A 1PIFA 5C9XA 3CIVA 1NOUA 3NQVA 3QQWA 4B15A 3AXMA 1TQXA 3EWBX 4GISA 2QCEA 3UYIA 1UZDA 3VGGA 3COTA 1ZP4A 5FCZA 3SURA 4S3JA 1KRBC 4IGNA 3KP0A 3CV7A 4LCRA 3IACA 1ELSA 3II1A 4JTTA 3N2XA 4W4QA 4YTTA 1XH0A 3WMLA 2EPNA 4BWLA 1HKVA 3GNPA 4UFHA 3W75A 4MPQA 2ZZ6A 4OKDA 3S6OA 4Q8VA 3W7JA 1TE6A 4D6EA 1N7KA 4HHLA 3U7BA 2HVMA 4GVHA 4UMAA 4C90A 1O94A 3VIGA 1IZCA 3T2OA 3CUIA 4RR4A 4DWSC 1XSIA 3H23A 2O55A 2QGYA 3LMZA 3C86A 1PUDA 1HL8A 3NM3A 1UROA 4I8YA 3IUIA 3W29A 4RPPA 2HK1A 3W1RA 4C6EA 4WDUA 3THAA 4NJJA 3DG6A 4UCFA 3FSUA 1H0IA 1FH7A 2JGQA 2VZUA 5DXYA 5LGZA 3BE7A 3N13A 1XLCA 4QDWA 4Q4SA 4GQ0A 5FL0A 1MW0A 1X8CA 2B81A 3AIWA 5LIUX 5JXQA 3W6YA 3OVQA 2WHMA 4MWAC 3SM0A 4R7JA 3QF0A 1ITQA 2D1ZA 2GQ8A 3EX3A 2BLEA 5DRIA 3BAXA 3WY1A 4WK9A 3HU7A 3DEQA 1Z6KA 1TMHA 3EAUA 1FA2A 3U2ZA 1YHTA 4CEUC 2YXGA 4ZQCA 1HW6A 4HA4A 3WJYA 4RV3A 1V5XA 4D6JA 1YPIA 1IIHA 2OZTA 2OGYA 4PUEA 2OKTA 1OK6A 5D9OA 3WLTA 3MDUA 1UZ1A 3T0AA 3QMRA 4UTKA 2DDXA 3GW0A 5H8UA 1W5PA 3PN8A 3UNDA 2GQAA 1F6YA 1UASA 5I0DA 1HUVA 1QT1A 2EPHA 2PTXA 5FL1A 2O9OA 4NNAA 5K9XA 2BX7A 4B2DD 4PB3A 1T99A 4IQLA 4L6OA 5FF4A 2DEPA 3WUEA 4AAJA 1JVNA 1A49A 1OGSA 2DVUA 1GKRA 3F1QA 3PZGA 4YVXA 4CNNA 3MKVA 1MFVA 1NOWA 4Y8FA 1PDZA 3NOYA 2VOTA 1OYAA 5EKYA 2GVGA 3L4YA 1PHWA 3BZGA 5K7JA 3H53A 4KFOA 1FOBA 3N4EA 4LUSA 1ME9A 2HZGA 3CMJA 4JTLA 4DEFA 2OPJA 5KETA 1EH9A 2TODA 3UA4A 4KF1A 4F0SA 3W6LA 3W1LA 4Z2IA 3NSXA 1LLOA 3D6NA 4CU7A 4AZIA 1U5VA 1ZUAX 4RZ6A 1OCNA 3WNMA 4GQGA 1WDDA 3E02A 4FZIA 3TUUA 1DIKA 3KCLA 2FGLA 4JYFA 3VIKA 1EO5A 1VENA 4I9TA 3M5VA 1QTWA 3QFEA 1E6RA 4O10A 1VFFA 2ZDRA 3IJ8A 2P5NA 1XP3A 1OFPA 1RQHA 3PZUA 5AVHA 4FMVA 2D23A 3QBUA 4LNCA 3W25A 3I7QA 2FPTA 4OECA 5AZ0A 4Q7BA 4EAYA 1MEWA 1W32A 1WKYA 4XZLX 1GJUA 1BTCA 4PSPA 3STPA 3JU2A 3N2OA 1S3TC 2EKGA 4WVXA 3TSDA 4UQDA 4IP7A 2QIIA 2Y0FA 4ZSUA 4DWSA 3W22A 4GNVA 5F2LA 1XPGA 2C6QA 1WDPA 2BP1A 4GGBA 4GNKB 4J3XA 3L21A 3NQ6A 4I6KA 4MAVA 1FQ0A 3PTKA 1XYLA 4NL1A 3FAWA 3OZMA 5U7SA 4R7WA 5IBXC 4Q6XA 1Z44A 1ESWA 4LB4A 3J7HA 5KZEA 4L6HA 4UWMA 5EMUA 1OK4A 1CNVA 2J7GA 4O14A 4D6IA 1K77A 4HU0A 3W86A 4DUOA 1OEPA 4AIUA 5B7ZA 4NU7A 4DF0A 1F05A 4DQWA 1WXJA 3ZS4A 3DBNA 3REQB 1Q66A 1PL9A 2VFEA 2HVNA 2PSNA 3RIKA 2P53A 2QJGA 3BMXA 4UMBA 3IAPA 3POCA 4FS9A 3PG8A 1MUWA 4PUJA 5AFDA 5CJNA 1FWTA 3PBYA 4V1YA 4R85A 3GIYA 5HQLA 2FQIA 2JE8A 3P5YA 1XGDA 1L2UA 4YJ5A 2QNEA 4AD0A 1RK5A 3A9BA 1SW0A 2I5GA 5BCAA 2WJDA 2GGJA 1H60A 2YA0A 4J4KA 2QJNA 3KE0A 1SJDA 4O1EA 2VWSA 4OWGA 1PWMA 2WQDA 1DXIA 2J13A 2P76A 4FPSA 4FA3A 1GG0A 1AUSL 4QSFA 1TTIA 2PP1A 4MY8A 3CO4A 4ECLA 5A6BD 3B9DA 4Y90A 3M6YA 1XX1A 4MWAB 3PTQA 2KZHA 3WQ5A 3LS9A 1X8FA 3CYJA 3S2CA 2H90A 2IXUA 2WWDA 2OJPA 4H9ZA 3QQ0A 2QCDA 1UYQA 4C6CA 4NAFB 4P7RA 3KCJA 2PWHA 2Y8VA 1TV3A 1VGAA 4DF2A 3U5YA 4F9DA 4G6CA 1TQJA 1VLWA 1K4HA 1WQ5A 1RPXA 3EWUA 3OQEA 3PF3A 4HZ7A 3LOTA 4D1IA 2F2KA 3RAOA 4FB7A 5AC4A 2DZBA 4UTMA 3VOCA 2VGGA 3FOKA 5C7HA 5FAJA 2REQB 1CLKA 1IV8A 1KM0A 3ZYZA 1TJPA 2A0NA 3PUOA 4RW3A 4B4HA 3ALGA 1OCJA 3OBAA 2AGKA 1JYNA 1AFSA 4KKXA 1DORA 2D2HA 4H9TA 3BH4A 2WHJA 3L4WA 1XDJA 5D9NA 4F0MA 5F4SA 3QV8A 3CMGA 1TPFA 3M6DA 1SZGA 4GO8A 1GEHA 3DFSA 3E49A 4ZVJA 1TX0A 4H01A 3W2NA 5IFTA 1FVPA 4CCDA 3FNDA 3KDOA 1TIMA 4IGSA 1S2UA 4CCCA 1V93A 2NQ5A 4FK9A 2HQAA 2QGHA 3HJEA 2QAFA 3M1ZA 3MUXA 3DZ1A 4XTDA 4LOCA 5J5DA 4L9ZA 4IX2A 2A6LA 1UR2A 1RK6A 1V02E 4DLMA 3PVFA 2GGGA 1ZGDA 5SWUA 2WCAA 4LSBA 5DBUA 3VIHA 3F2CA 2I5QA 3VD3A 1HX0A 4B9YA 5HUPA 5DBTA 1RY0A 1E4MM 3IJ9A 4Q8OA 3KOXA 4K38A 3O2LA 2X40A 4I6VA 4TU1A 3W3OA 5I3HA 1TV5A 5I00A 2BBFA 2UY5A 2PDIA 4P8XA 1DIOA 1ODZA 1RQEA 1F9CA 2I14A 3WH6A 3WD4A 4ADUA 4O12A 1NP0A 4UCGA 3KCOA 4NILA 4FLRA 1Z42A 3GWQA 2ZOXA 3TTYA 1E3XA 5I3FA 3TFXA 3W87A 3SCOA 1EGMA 1J01A 3UERA 5I6SA 3B0YA 1BRLB 2V30A 1VCVA 3KAOA 4UOJA 2WC4A 3U8GA 4ZZ9A 1F07A 1X6LA 3W1MA 4QM1A 3UFYA 3K2GA 3NQFA 1DJNA 1J9YA 1IEQA 3A3HA 4UTLA 1R3VA 4O15A 2VFHA 3GTFA 3VIOA 1OGBA 3CHEA 2R9RA 3P8JA 4M6QA 2ZYFA 2UV8G 3D46A 5K9CA 1GVOA 1XLIA 5EFFA 3SCSA 4A8LA 3QSRA 4IX0A 2GUUA 2ZWZA 2CBJA 5C71A 3L67A 4JIPA 4YIWA 3JZEA 2H9AB 2QCFA 1TR9A 2G50A 2PLCA 3DESA 3MUY1 3W7DA 2QJIA 3LPOA 1VRDA 1SZEA 4QP0A 3DYOA 2ZDSA 3ITXA 2Y61A 4GK8A 4IISA 1E4LA 2Y62A 5LGXA 1UMLA 3N19B 1H4PA 2BVYA 2ZRWA 3N11A 4X0NA 1ECEA 3UT0A 4EOUA 5D37A 3PZMA 1EP1A 1J18A 1V0KA 4UB9A 4CCZA 2A2IA 5E1QA 3I6EA 3GD6A 1OT2A 3B3DA 1NDWA 1A80A 4OUEA 1XCXA 1W9PA 3GXTA 5REQA 1ZB5A 1GG1A 3LPGA 3O16A 3RITA 1BKHA 3M16A 2BY3A 2AMGA 1DTUA 6ENLA 1MUMA 3HO8A 4HBKA 3UPWA 3WYZA 4M8UA 4DUXA 1PTDA 1BQCA 3TU9A 3T7VA 3AJ7A 4H1ZA 3MUZ1 1Y5WA 1CGYA 1UPMB 4O0ZA 3RFAA 3KLKA 3EZ4A 3SGGA 4DUVA 3GXNA 2PLKA 2L5HA 4S3EA 1Q8JA 4LYPA 5A95A 4UQ9A 4FX6M 1UUQA 5HXMA 2IKHA 2FHBA 2G3MA 1AQMA 1BF6A 2GVEA 4GNJA 2VWTA 4RX0A 1W1TA 5LA0A 5FJUA 2ACQA 2HNEA 1TCDA 1JDCA 3RF9A 3FEMA 2WNNA 4Q4OA 3ZZ1A 4P7LA 4D8LA 1RHCA 1EJXC 1ZBVA 1S2WA 2ISVA 2DZVA 3ZR4A 2YBTA 4WRHA 1SVDA 4HNOA 4LX4A 3VCRA 3R8RA 2NV2A 5JBFA 2ISSA 3TFCA 4LY4A 3TW7A 1LOSA 2ALDA 3CL6A 1R2RA 3LV5A 3LA4A 4KWOA 1WZAA 4ZO9A 2YCLB 4LS1A 1DYSA 2RDTA 2HSAA 3ARVA 4KT2A 4GCXA 3O15A 3VDCA 4XUGA 4YU1A 4UTJA 4GZIA 4ZCWA 3NL3A 4HQVA 4PUMA 4ZOEA 2RKXA 2Q8LA 4C6NA 1CX9A 2PDYA 1SW3A 5GJMA 4BEUA 4XD5A 4ZOCA 2XM1A 3VZYA 1PZ2A 4E4PA 3C4UA 4IQDA 4UTIA 3QSTA 1U30A 2OYLA 4JCMA 4D6CA 1GOOA 4L61A 5LHEA 1UQYA 4HA3A 3G3DA 4P7NA 1THFD 4S2CA 2MUCA 3GAYA 1KXVA 2F6XA 1PO9A 3BLLA 2XZ7A 2VI0A 4QRNA 3DGBA 3LHZA 3BLPX 4O1AA 4HD5A 3TNOA 1I2NA 3B8DA 3V35A 4MNLA 3G1SA 5XIMA 3AOFA 4B5XA 3IARA 3KTXA 3UCDA 3BCDA 1E9YB 1ENUA 1UR8A 2G4FA 4FIQA 1XIGA 2OVLA 1SJBA 4C1LA 4HNCA 1VLIA 1Z32X 3SUVA 1GPWA 1KRMA 3L5MA 4C6OA 1TTQA 4M80A 4PL2A 3VM5A 3ID7A 1C8QA 1LCOA 5IDIA 5LIWX 8RUCA 2D2OA 1N82A 2CLIA 1MXGA 3GNXA 4MSSA 2PDKA 1XC4A 4ZQRA 4IFOA 1U1JA 3L2LA 3V1PA 3KHDA 3AHVA 5LA1A 1K8ZA 2VRQA 3H55A 3PUDA 3CQIA 4F3HA 1W1VA 5XINA 2RFGA 4HHPA 2G3IA 5HPCA 2V5LA 1LL6A 1PCWA 2PGFA 1BXBA 5D2YA 3NZ1A 3B9OA 3SUUA 3DH7A 1YEYA 4HA0A 3SCTA 1EJ7L 3EOUA 1UD2A 1Z7AA 3BURA 1PXGA 3N4FA 4LRSA 1JDFA 3BAWA 1E70M 3AQUA 4BF9A 1HT6A 2Y1HA 3RO6A 4TXEA 3AJXA 4C5ZA 3B8TA 5D09A 4M5PA 1TJ1A 1FWFC 4AZBA 4NG3A 3WQVA 4DJFC 3KVLA 4IG2A 2Z26A 2XH7A 1ITXA 1UMYA 2Y8UA 4W7WA 2R14A 1HXJA 3CV2A 1UC4A 3LCIA 1FKWA 3AHXA 1WDSA 2XGZA 2PRLA 3T44A 1MWOA 1WO2A 4A3UA 4YN5A 3BG3A 2PDPA 4JPGA 5EYWA 4FIRA 3GVQA 3R79A 1TJ0A 2V9DA 1G4TA 4GI8A 3KOZA 5TQLA 3P3BA 1FCUA 4JHOA 4TX8A 3UPBA 2J7BA 3PULA 1W9BM 2FVKA 2X42A 1V6XA 1G4EA 4AQLA 4H9MA 3IV8A 3ITTA 2J6XA 4OVXA 1IR1A 2J88A 3W1QA 1B3OA 2P88A 2ZFAA 4DJEC 3GXMA 3PZNA 4C6MA 3GBEA 2OWCA 1NY1A 3NPXA 1DJWA 3DI0A 3QYSA 2D0GA 4QNEA 3N9SA 3FLUA 3P5ZA 3LRKA 3KEHA 2DGAA 3LTYA 2PDMA 2A85A 3C2EA 1Q6QA 1NIUA 1OX5A 1E43A 3WBYA 2C19A 2IKGA 4B5NA 1NWSA 3EX2A 3BJSA 3PJUA 1J5TA 3NO5A 1IXQA 2XFYA 4J27A 3EBVA 4UFMA 1TVNA 3PR2A 4U33A 4S39A 3VIMA 4GFSA 3GH7A 4QJ5B 4E6MA 2FIQA 3PK7A 1QBAA 3B9NA 5C2GA 2VR4A 3B9AA 4GJIA 4RE2A 5MKGB 1H7RA 1CT5A 4QR6A 3W85A 1WYIA 3NO1A 1OYBA 3ARWA 4B5UA 4ACZB 1XH2A 2QVHA 4M3PA 3EMCA 3QV9A 4L65A 3ZWSA 5C9RA 5CZSA 2WMGA 4NZ3A 3O6DA 5AY7A 4F2TA 3GG7A 5J8LA 3OTRA 3H2CA 3O6CA 3PPFA 4XV0A 4E2OA 3W37A 2YCKX 4EIVA 3RR1A 1TRDA 3A47A 3LM3A 4MJ2A 4JICA 3WO8A 2Q02A 2J6VA 1KBIA 3WH5A 4XD4A 3N34A 4AD4A 2UWFA 3RJYA 2CXEA 2PFHA 1XIEA 4Y9NA 5LNVA 4CKQA 3IGSA 1JQXA 2YBVA 2WZTA 1ALDA 3WDIA 2PDNA 1XSJA 2FKPA 3ITCA 5M1TA 1W3HA 1TWSA 5EMJA 4W7VA 3VXGA 1QW8A 5A3HA 3N9KA 4BHYA 3GFYA 3CUHA 4CN4A 2I1OA 3LXBA 3WN6A 3IIPA 1FFRA 2WC3A 3QGAC 3WDPP 3WLOA 2IQ0A 1HIZA 3TW9A 3T0CA 4Y9OA 4DIAA 2ZRVA 3SN0A 5GNYA 1JXJA 2X1TA 4K6AA 3VI2A 3O0KA 1FP8A 2ZX9A 7REQA 3L0KA 2YDQA 1FWSA 3STGA 3TDFA 1XIDA 3CUGA 5A8NA 2TPSA 2W27A 3IJLA 3WDHA 4TO8A 2YL5A 3IK4A 4DWDA 4ALDA 3DGRA 2YJQA 3P82A 1X38A 2A1YA 1OCQA 1VHNA 1HJSA 3M0MA 2WC7A 2ZZ5A 2NVCA 4KRUA 2E7FA 4TV6A 1T0OA 4C6JA 5E6ZA 3SBFA 1ZBWA 2W62A 3IUDA 3BLIA 2ZUTA 3L66A 4GOAA 4ZB5A 2YDSA 1C8VA 1JCJA 1MQRA 2PDFA 3VMNA 2WSPA 4WD0A 2DVTA 1F61A 1ZBKA 3I4EA 1Q2SA 3U2CA 5E09A 2JK2A 3OP2A 1AH3A 1WOAA 3WQEA 2OSXA 4WJEA 4FXRA 4N42A 3TLQA 1VP5A 3VKKA 3S1WA 1MW2A 4ERIA 4FAMA 5LYRA 1YLVA 1R30A 4CU8A 4GXMA 1HGWA 4DJEA 3XINA 2OXNA 1Q6FA 3CL7A 5A2AA 1KBKA 2QLYA 2TYSA 3ZQ9A 3WQDA 4C5YA 3O1NA 4D6GA 1JPIA 3WF0A 1N2VA 1AK5A 4Q8PA 1ZAJA 3NXLA 5FA5A 1UUMA 4L5ZA 2VZSA 4LVDA 3OVRA 2PDLA 2GQ3A 3W7HA 1AODA 5C55A 2PZ0A 1OCBA 2ZZ3A 4I5XA 3ANYA 1Q65A 5DFAA 4IMAA 3QY7A 2VCCA 5HULA 1QWKA 4QE5A 1CBGA 1QDSA 3HB9A 3LNMA 2WSYA 4PMQA 3E12A 3B8VA 4HOXA 1MRAA 1ZAHA 2ZKMX 3UR8A 3EA3A 2W63A 4JGDA 3WFAA 1I45A 2A3CA 2J77A 2P50A 2IPGA 4UZUA 1F7BA 1R9ZA 1TKKA 4XUYA 4KEMA 3S9IA 5CGTA 3ARXA 3IGXA 2E6AA 2V5JA 3QPEA 1S2CA 3NQDA 2ZZ7A 3V16A 1SR9A 4AVFA 4MJ4A 3KBJA 4H2CA 1Q4NX 4XQ6A 2OLSA 1W2VA 1EHNA 1GK8A 3LZ3A 3WLPA 2ZUSA 2PWUA 1J0IA 3N2CA 2BNJA 3F4CA 3AXXA 2ZA3A 2HDJA 2OO6A 4JYDA 2QUVA 4H9VA 3FK4A 3KUMA 1SJCA 3WZ0E 3LCWA 2AMXA 1EUAA 1GCYA 1B3YA 4A3RA 4AFYA 2IPWA 3LLDA 4QCEA 2BDQA 1YNPA 1V6YA 3EDKA 3C2OA 3RM8A 2DU2A 4I7UA 4Z2KA 4AY8A 3TJXA 3BCJA 3GIPA 3GXPA 4IFKB 4NNCA 5HOSA 2C0HA 3LHVA 1M5WA 4MKSA 4Q4RA 1KFLA 1CENA 2JEQA 3CQKA 3HJZA 1JXKA 1XLEA 2HTMA 4DPPA 4LUSB 4GZJA 3LCHA 5HJYA 3GDMA 4QROA 3VGDA 3ZOAA 3NEHA 1UOKA 1CZ1A 1ONWA 4AD5A 2OQLA 2BVTA 2RGMA 4GIYA 3VD9A 3BANA 1T41A 1KCXA 3PAJA 3Q94A 1EJTC 2WYSA 4RL3A 3R6IA 1KO0A 3WH9A 2PDQA 3C6CA 1GONA 3VNYA 1FHUA 1KCLA 1BYAA 1GPFA 5AHEA 4Y9PA 1ISVA 1ZS2A 1IWBA 2IS7A 1L9WA 3OYXA 3K8MA 3HQPA 1K9DA 3JR2A 1IEVA 3N1AA 1M7OA 1J10A 5FEWA 5HPOA 2EEXA 1W91A 3K30A 4MB1A 3CPGA 1SM9A 1V7AA 3QTPA 3ARRA 3T8LA 2JKPA 3CWHA 1EA0A 3WLMA 1H62A 4JQ3A 2GK1A 1H11A 3GTIA 2ALRA 1VJSA 1V79A 4HZMA 3A64A 7ENLA 4J3WA 1EOKA 3DG7A 2QPXA 2BXYA 2BXVA 2GGHA 5CGMA 1SUXA 2R94A 1MUCA 3UY8A 5EL1A 3F5JA 3HG2A 3SJ3A 3PUEA 1REQA 1Q6EA 4D8ZA 1UWRA 1TV8A 1GHSA 1XL9A 2PRMA 3Q58A 1M1BA 3RHGA 3WK1A 1LL7A 2WZEA 1U2YA 3WD2A 4YVPA 1X96A 3M0JA 3WF2A 1NU5A 2WCSA 3WLRA 3TYUA 1XDLA 3CT7A 3FX4A 3L0GA 2PURA 3W83A 1DJXA 3ANUA 1B2YA 3ARTA 3GR8A 1X97A 4XAGA 3KWXA 1XIIA 5BWAA 2DVXA 4JNZA 4PTDA 4R3UA 4QXIA 1GUVA 1KBJA 3GXIA 4GIRA 4S1FA 4ZE4A 4DELA 4FNTA 3G0UA 5AB3A 1R6WA 3HV8A 3NGFA 4QJ4B 1DQWA 3PZOA 4W5UA 2FTPA 3BSGA 5TNVA 3I6RA 5D9MA 4O57A 3WLLA 3P0WA 2C7FA 2BGNE 4C6KA 2V81A 2VMFA 4MGGA 1MZRA 3UJEA 2WVSA 5F2IA 3ONBA 3OPSA 3E2QA 1I2PA 2OMAA 4XZHA 1EDQA 2Z2UA 4MWAD 2DZUA 3FGCB 4EVZA 1HL2A 3CAQA 2EPMX 3BPWA 3H2AA 3EKZA 1LLZA 1GTEA 1XRSA 4O50A 3GM8A 3NYZA 3TP4A 2G8ZA 2ZZ4A 2FPYA 3ZSSA 1E6SM 1V6WA 1OC6A 4YLWA 3WIJA 1ZENA 2VDGA 4HNVA 2FFIA 1M41A 3O63A 5CZ0A 2EXOA 2P1FA 4E2DA 2CEQA 3XISA 3TW6A 4MFEA 3VM7A 3NM1A 2P3ZA 1RP8A 1JCNA 2FYMA 3R25A 2YOCA 1JZ2A 3GNOA 2Q71A 1E1EA 2UZ9A 3MY9A 5G2WA 2D73A 5LHFA 2F84A 2PDCA 4MLRA 4CN6A 4QG6A 3TLLA 4ILSA 4JXCA 2GSHA 1XKYA 2Q6ZA 4LB3A 4HCLA 1OVDA 3H22A 4QISA 5AZ1A 1GYNA 2ZQ0A 2AQOA 3DHPA 4IPLA 4DXKA 5BWFA 1WCGA 3EPNA 3Q65A 3TTSA 3LCXA 1LUCA 2FHCA 3TWBA 2V5CA 1LL4A 3G6MA 1QK0A 2P0IA 3HQNA 1WX0A 2CZ5A 2D24A 2F7FA 3BOLA 4LUJA 1F3XA 5BXPA 3P80A 1XM3A 2NQ9A 1JD7A 1S46A 4K37A 3WQPA 1C7TA 3XIMA 1GEQA 3W7OA 4JOMA 4PMXA 3HBLA 1RBAA 3UWWA 1NARA 2ZXBA 2BOEX 1WA3A 2A3BA 2HPMA 2B7PA 5CPMA 4UTTA 1V51A 1J2BA 5KSWA 1XIFA 4H6KA 4U31A 5CC7A 5AECA 1UBPC 3EKGA 4DM2A 4N4PA 1BGAA 3DKLA 1Q3NA 3BSHA 3ZLGA 4O1FA 4QBXA 2DORA 4Z1DA 1S2VA 2QQ6A 5FJRA 1H1ZA 1VBRA 2J9ZA 4JN7A 1I2OA 4PULA 3PANA 4EXQA 1HVQA 3ALFA 4FR1A 1FH8A 3W1AA 4TTGA 2Y7DA 4EWJA 4HP5A 5C6MA 4QGCA 1HJUA 4U4MA 4PBFA 5LXXA 3TE9A 3KZSA 3SQLA 3CLMA 4FNSA 4EANA 3MI6A 4V33A 2WHLA 2PDHA 3WQ6A 5HK4A 1JUBA 2AGTA 1GQNA 4C6PA 3SCNA 5CZKA 1AL8A 3KBVA 4CGTA 3U7VA 4LXFA 3BV4A 3BW2A 2VEMA 4FHAA 2OB3A 4H6QA 2ZC1A 4LVBA 4IIEA 5ABGA 3WEOA 1HKIA 2PUZA 3WKZA 3SFKA 2HE5A 2ZUWA 4IJRA 4KMQA 4EKJA 4LBRA 7ODCA 4CVUA 1S5WA 4LH8A 3GVRA 2VTFA 4O19A 1W5OA 1JRCA 3G2GA 2E6DA 1KRAC 1PVNA 5HDRA 3CIWA 3EB3A 4K3ZA 4XKMA 4XO6A 3W02A 4HHMA 3UQNA 4Z1CA 2NX3A 2OEJA 4PC8A 2O4MA 1X1NA 4GABA 1YTKA 1EJSC 2G5WA 3RG6A 4AYSA 2PAJA 4FXFA 3AICA 1NJJA 1P1XA 2HS6A 3MW7A 4IIDA 2GZXA 4ADTA 2VVSA 4ZQMA 5CPTA 5CG0A 2ZRZA 2XPKA 5AHLA 3SRKA 3APGA 5LIYX 3KBMA 1QHZA 2DW7A 1OT1A 1T96A 4LYRA 3IVUA 2NT0A 3QOKA 2A5HA 4AMAA 1O4UA 9XIAA 2D2GA 1W9XA 4YVVA 3ZT6A 3ZMRA 1WZMA 2CW6A 2QPUA 3I10A 4GLEA 1ZRQA 1C92A 4DNHA 3CAKA 1VJIA 4J3VA 5I7GA 3PPCA 2VR2A 1EGVA 3VNMA 1WDRA 4D6FA 1LOQA 5A8MA 3IK2A 5I09A 5EB8A 1YNQA 4PFHA 1NF0A 1UH3A 3WH8A 3WLSA 2V0TA 5A8PA 4WEVX 3KVKA 5A6MA 1SSDA 5FJPA 4O18A 1SW7A 3U2EA 1VFSA 3GKFA 4BI7A 1WPCA 3MI2A 3IIZA 1T5AA 5G4HC 3D47A 3GZ3A 5IHRA 1HN1A 1C7SA 2PWEA 5D8WA 4A4AA 1CTNA 2VGIA 3P0XA 5CJ5A 2YL8A 3RX3A 1YQ2A 3Q4DA 3CO8A 3KX6A 2Y89A 4R27A 1FH9A 1CEOA 3VMPA 2MNRA 2PTYA 3LI0A 3HQOA 4I7VA 4EACA 2Z1BA 1EKOA 4WR3A 3KBWA 3RX2A 5A5WA 3U57A 3SGZA 3VGBA 3B05A 5L6UA 2CHNA 3UXKA 3LRMA 1GVIA 5I3GA 3AXKA 4JTSA 5RUBA 2OQYA 4JFUA 5DT7A 3K8LA 3OHMB 3UZYA 3UG5A 3W6MA 3FDKA 3FSTA 3IEBA 4AD1A 2YCJA 1MVYA 3CH0A 3C52A 1R2TA 3LN3A 4JZ5A 5FESA 3NPVA 5B80A 3C0QA 2OLHA 2JF6A 3TA9A 1CWYA 1QAPA 1YDYA 4R7OA 3LI1A 3C2RA 2ATSA 2Z27A 4CNSA 1V77A 2PP3A 3NZPA 1AA1B 1S5NA 2QAPA 3PTMA 2HPIA 3K8KA 1B9ZA 1IT8A 2QDHA 1ZAIA 3PFMA 4WZHA 3QYQA 5LA2A 3IIVA 2CZDA 2IUZA 2ZTKA 4AEFA 4PBGA 2VENA 5GJPA 1A4LA 1P6BA 1A5MC 4HIBA 2Y7GA 1BGGA 3IIXA 3VNZA 1PX4A 1VYPX 4ROQA 2D0HA 1S5TA 4DI8A 4J7RA 1KA9F 4YS1A 1RJQA 2OEMA 2INEA 4Z0JA 5C9WA 2A3HA 2PZNA 2FMNA 4JDBA 4YYFA 4Y2WA 4PMJA 5DF0A 1PEZA 4UMCA 3MCNA 3WL0A 4RJEA 1QHPA 5HAOA 1EC7A 4XAZA 1UBSA 3B4UA 2QMJA 3RNDA 1T7LA 1E0TA 1EQCA 4LF1A 5AC6A 1CI1A 4YXGA 4ML4A 1ZPTA 4PCPA 4O4VA 1VYSX 3DHUA 3V75A 3NQBA 1XBYA 5HNRA 5F7UA 3KOYA 4F0LA 2AKZA 1EYWA 1WV2A 4XTIA 3UA3A 4O0QA 3O0FA 1ONXA 1FWWA 1K8YA 4HCDA 2XISA 1I0BA 1W8SA 4X22A 3VKBA 4I9MA 5DY2A 1QI4A 4PE8A 2AAMA 1C91A 4S38A 1M6JA 1MMFA 5DCBA 2WVVB 3T1GA 1F3WA 3HF3A 4H7VA 3TAKA 3KWSA 4Q7NA 2FB3A 4UIOA 4MZ1A 2J62A 3VCCA 3THCA 5DQPA 2V6AA 3WL1A 3FJNA 3PY2A 5CAHA 1DIEA 5G2HA 3VMOA 3VDHA 1H63A 1DJHA 2PF0A 1QOXA 4M51A 5LNWA 5D04C 4LBUA 4LFYA 1P0KA 5KZMA 1OIFA 4K8EA 3TA6A 4DXXA 4NJGA 2NX9A 1W37A 3MMDA 4Q4MA 4WDWA 1KQYA 5GPRA 2NLYA 4PMYA 4ATDA 1YE4A 1XRTA 3RDKA 1C9DA 2GQ9A 5CCZA 3OA5A 1N8FA 2H8ZA 1QNPA 2NV9A 3CNYA 2A7RA 2NSOA 4AWTA 3OG2A 1ADOA 4EK7A 5A6LA 4K7VA 5ABHA 1S2AA 1KRCC 3T78A 1Q63A 3SECA 3CS2A 5HNTA 3BW4A 1EYEA 1B3ZA 4YCPA 3BOXA 3W7NA 3ZJ8A 1XFCA 2AL2A 1UC5A 2BASA 2YW3A 4G2DA 2ZUVA 5A94A 4S3BA 4N6EA 1TR1A 4PSRA 4PRTA 3WLKX 3S1VA 5I06A 2Z6IA 2GJLA 2VUNA 5H91A 3T4WA 5MF5A 4AD3A 4DBWA 2WMIA 4PEEA 4HOZA 2ISFA 4DJDC 1HP5A 1A0DA 2UBPC 4O1BA 2NUYA 4IMGA 4YYCA 4NI3A 2BVDA 4BY3A 1UP0A 2I57A 3H12A 1QXLA 1DWAM 2I16A 4PR4A 4PRRA 2E4TA 3POHA 5JBDA 1B57A 2EQDA 2OTDA 5CG7A 2I7GA 1OABA 1OX4B 1XDMA 8XIMA 4RNHA 2QULA 3WNOA 4L4OA 5CPOA 3N6QA 3TQKA 1R38A 2WW5A 4GJJA 5H2ZA 3Q37A 1TA3A 2P3EA 1KTCA 4JX6A 3PM6A 5TF0A 4P8VA 2ZXDA 5C70A 3S9YA 4PTWA 1B3WA 3VOGA 2YA2A 1O6IA 1C8XA 2IXVA 3WD1A 5BXRA 3ZSTA 3E3HA 3NL5A 4HN8A 5AOUA 3S5NA 1KXQA 4DYEA 2D22A 4DZIA 1QPRA 2ZCGA 4Z2LA 1UG6A 3T55A 1E40A 1NDYA 3Q67A 3W1XA 1XQKA 2AQVA 3QLLA 2DSWA 2PU0A 3PWAA 5M5DA 3E2VA 1IR2A 4YTSA 1FWHC 3RLUA 3RU6A 2W92A 1J6PA 1CXLA 2I9EA 1OIMA 1YADA 4NHVA 4UOQA 3WLIA 1U5HA 3AU6A 3LX9A 2QS8A 1YMYA 1JFHA 1TUXA 4WGXA 4RDVA 1FKXA 3WQ8A 1XYBA 3LUTA 4B5TA 1SPQA 1H1YA 4LC6A 2X7WA 3WDRA 4ORMA 2JALA 4S3AA 7REQB 1NSJA 4AVNA 6REQB 4HNTA 1OD8A 4IOTA 4FOKA 1XISA 2VEIA 5CH9A 2FB2A 3LERA 2TRSA 3N17A 1FTXA 5A8GA 3A4AA 3VZXA 3GC4A 4ZFCA 4CD4A 2G0WA 1J79A 2EHHA 2XFFA 3M0HA 1I8JA 2DZTA 3WELA 3URBA 4O53A 1VPYA 1GOIA 4MZ8A 2CIPA 2FH8A 4ZA0A 1A0EA 3AMDA 2Q09A 2J47A 3S42A 4EPDC 4Z2JA 4JTFA 4M6UA 3EWXA 4ZFMA 3KHJA 1NDVA 1W5NA 2ZADA 1GOXA 4MDPA 2QIWA 1T6MA 1KWGA 4IL2A 1AJZA 2GJNA 2A7NA 1OADA 4X63A 4NSBA 2VEPA 2G3JA 4Q8WA 4H9UA 1QASA 1XG4A 1QMLA 5A6KA 4IP5A 5BOFA 4UUIA 2VD8A 3BLFA 4DAFA 3FXGA 1BVWA 1R3SA 3WDQA 1Q7MA 3MDWA 1GJWA 4LV9A 2OSWA 3CLWA 3KBSA 4B5SA 4R88A 3HPSA 1ITCA 4HT3A 3W9ZA 2CFFA 4EXAA 4WY0F 1D2KA 3TQ0A 3AS2A 3T09A 4XO7A 1NWUA 2YLAA 3FJLA 1W6TA 3EDJA 1Z3NA 3CUJA 1W1IE 3NZRA 4Y9AA 3RXZA 1RALA 4C7DA 3FIGA 3G0SA 1Q13A 3TN4A 4ZGYA 3GVVA 2FZ9A 3JUGA 3R11A 3WFZA 3BDKA 4PEKA 1UWIA 4I3GA 4I9AA 2XSAA 1JCTA 1M7JA 1US0A 1SZRA 1YBQB 1H41A 3DHDA 4MZYA 2PWVA 1H5YA 1VIWA 3A6OA 4LUTA 3IVTA 1W9VA 5M3WA 1GVRA 1O68A 3NQEA 2YFOA 1TV2A 2WK2A 3WLHA 2V82A 4LEQA 1U33A 1W56A 1BKSA 4O17A 1E73M 1IEIA 2PA6A 1K7XA 2OSYA 4LAMA 5CSRA 5AC5A 3CHFA 3VIJA 2XIOA 2ESCA 4KERA 4GQQA 4IIFA 1LWHA 2O92A 2JEPA 4UQEA 3ABZA 2DUAA 2ZX5A 3LDVA 2XVGA 1M03A 4PODA 3TROA 4PUWA 3NL2A 3W07A 1A3XA 1KKRA 3VD5A 2B7OA 1A4MA 3OBEA 3UR5A 1P48A 3CZJA 3AZTA 3RPDA 2HBVA 5BZAA 2VR5A 3WK0A 4DNMA 4OOUA 2OFJA 1W31A 1M65A 4IL0A 2YXOA 3G0XA 2XTKA 1CDGA 5HA7A 1U22A 3EDEA 1OG0A 1W1B1 3DFOA 1PKLA 1QNRA 3WX7A 3D0CA 1HL9A 5G4WA 4ML9A 3QRHA 2B0MA 3RR4A 1VS1A 3SN4A 3QOMA 2B31A 2NX1A 1XCWA 1XLKA 2AQWA 4GVGA 1UKPA 3CHCA 1V0NA 4G7FA 4ORIA 2OT1A 4O13A 3GYCA 3I65A 1XLJA 4IPNB 1E0XA 2PWFA 2FDSA 3MSRA 5FACA 4JFVA 5CKSA 4YTRA 1EZ2A 1RCOB 1D7KA 1M68A 3V0UA 2Y24A 3SB0A 3LTSA 2ZZ2A 3WBEA 1OC7A 3O3RA 3MCMA 1F8IA 5AYBA 4EAMA 3ABSA 5DRCA 1KQZA 3L4XA 3RLGA 4Z1BA 2ZTJA 2D69A 1KGXA 1PCKA 1MI3A 1XCFA 4JN8A 4D71A 1W3TA 4ZENA 3VO0A 4TMBA 3R10A 2Q01A 3WQOA 3VDAA 2J74A 5JIPA 3EOLA 3QY8A 4HU4A 2A3AA 5IM51 1IIGA 5C9UA 1X98A 2I9UA 4RE4A 3BOFA 4KFPA 2VVNA 1M9HA 1JZ3A 4AISA 2FZMA 3GNDA 1XYAA 5XIAA 1KFCA 2QDEA 3VUSA 5LNSA 1BQGA 5FJIA 3PBGA 1FWIC 3SN1A 5A6JA 1S38A 3CBWA 4NZFA 3RLHA 3B8IA 2CBUA 4EP8C 3EPMA 3QR3A 3HQ1A 4AIEA 2Q3RA 2XIIA 3P74A 4M0XA 1IT7A 3MJYA 3BSMA 1XLGA 1XYZA 4E8GA 4KEUA 4TVUA 5LKYA 3A23A 3VOIA 5LIXX 1BXCA 1EWEA 4QHRA 4IPIA 3VFLA 1KW1A 4GI9A 2Y5SA 4LT9A 4M7TA 2VZTA 1D8WA 4QLKA 2EJAA 3ANVA 4LAOA 4W7UA 1J2WA 5GNZA 4ZOAA 2CETA 3QH2A 5HMSA 5F4XA 1XXXA 1XGZA 4CEXC 4LGXA 3ZVHB 4AU0A 4B3ZA 4QQUA 3BWWA 3CC1A 1MQPA 3I3BA 4WLCA 1I1WA 2QF7A 4P7OA 2GSEA 5AC7A 1BTMA 2GLKA 2H8XA 3CU2A 4GO9A 3WD0A 2PDBA 4A8RA 3HN3A 3SCUA 1P6CA 1IEXA 1FX6A 1G1YA 1VH7A 3IRDA 4XG1A 3AS1A 3T0DA 4JTIA 1B5TA 2FZNA 1OJXA 3RMJA 1MYRA 1TVLA 5T9CE 3MBDA 4LTSA 4CD7A 1OFQA 3F4NA 4GY1A 3APYA 1BSIA 3I3EA 2BY2A 1O5RA 1GZGA 5E9XA 1CXEA 1SSGA 2VDHA 4CN1A 3WNKA 4JIQA 2C0AA 3VIIA 2I5IA 3DHFA 5CLWA 2DT1A 2ZA2A 1O60A 1UIPA 4JAWA 1KFWA 5JH2A 1LUCB 7CGTA 3UESA 4S3CA 5G5IA 3NURA 3UWVA 1E6ZA 1NH6A 2P0OA 1UW9A 1DJQA 2DUZA 2QJMA 3VTRA 3U48A 2XN0A 2HXTA 5G4EA 1YTEA 2R1NA 5GJNA 2BHUA 3NO3A 3W70A 1XRVA 3HPAA 1RLCL 1HJQA 1TX2A 1UA3A 1U1HA 2X2GA 2CERA 4LANA 3G24A 4BQ3A 5LNUA 3LGEA 2R6OA 2PWDA 4KCUA 3QFWA 1DQUA 3WNNA 3WNLA 4GUJA 4ZQPA 5AYYA 1TZ9A 4KWWA 3CASA 4MMWA 5BOOA 2GOKA 3PZIA 3VOJA 2YZ5A 2O4QA 3SI9A 3T08A 3KL3A 4BEQA 3MZNA 3PHAA 4A35A 5K3VA 5D03A 5EY5A 2BHYA 1JDAA 3NXFA 4XZWA 4C7GA 4B91A 2QV5A 3RRAA 5A1AA 4F2BA 1FWJC 1JAKA 1ZJAA 3MUAA 1DWGM 4GJ1A 2V5KA 3MSYA 1ZFJA 2HNHA 4IP4A 1LROA 1BPLB 3GH4A 4US5D 2AAAA 2J79A 2PPGA 3R12A 2WXDM 3M4HA 4QAWA 4XAFA 3M07A 1UWTA 4FNUA 4US6A 1ZY9A 1FDYA 1KM6A 1RH9A 1EC9A 1R47A 3EDFA 1HZYA 4N9EA 5DT5A 1V3IA 1OINA 3TMLA 3E0VA 4NIRA 3BL3A 3TIMA 3B97A 3F7JA 3IJ6A 3W84A 3U9IA 1W3KA 3LMYA 1TJRA 4PUDA 3W7PA 4L9XA 1KKOA 4ACYA 3W73A 3MWAA 1GOWA 2QT3A 4H9XA 3OGRA 3UXLA 4UC5A 1V3KA 5TIMA 3H24A 3CGTA 4A22A 3NQGA 3N15A 3E6EA 4HGXA 3VUPA 1MEHA 1L6SA 3TV8A 3UR2A 5D2XA 1EFZA 4AVOA 4IJBA 1OFRA 3W76A 3M46A 4JFSA 1L2QA 1VQTA 3FFSA 1R3YA 1H3GA 2WVTA 4L4MA 4GQRA 3PPGA 5HR7A 2Y7EA 3GHUA 3B04A 3JRKA 4MUZA 3IPWA 3S2NA 3EOEA 1B54A 4LCSA 4FO4A 3UWEA 4WCJA 3EMZA 3WCZA 1AQHA 2C14A 2CZFA 3NJ3A 5JQ9A 2QEZA 4EF8A 3OODA 4JL2A 2CHOA 3SRFA 1LP6A 3W1NA 1C93A 4DZAA 3GFZA 1V0MA 2ZVIA 2WV8A 1NOFA 4AC7C 1LBLA 2P8BA 1YDOA 3ABOA 3WJSA 7TAAA 2VKZG 5AC8A 2F8QA 3CAWA 1XD1A 2RJGA 1POJA 4HYVA 1FHDA 4AX7A 2ZE0A 3ERPA 3O7UA 4WSKA 2ZA1A 2FFCA 1UJPA 3PB0A 4CNPA 1PIIA 4AEEA 1K8CA 3LLFA 1OZMA 3V7PA 1XH1A 3NCOA 4CQ9A 2C8NA 3I7RA 1WB0A 4DYKA 4JFTA 1DQXA 3ZJ6A 4UR8A 1V6VA 2ATMA 2E0PA 3RGTA 4MTVA 4AEOA 3LPPA 5DY3A 3GC2A 1ZBCA 2J8TA 3DFNA 3HA1A 1QPOA 1T8XA 4PFMA 1X1ZA 2DZPA 2VHLA 1IZJA 2QV4A 1VJZA 3WUGA 3G1DA 2V3FA 3AC0A 4IMFA 1L6YA 4WOZA 3C5QA 5HJLA 4LJ3A 4RNJA 1OWQA 3F2DA 3E74A 5KZDA 3DAQA 4GVIA 4ZE5A 1NP2A 2OOGA 2GJRA 4PUNA 3GYEA 3GHTA 2Y5JA 1Q6GA 1UD8A 1TV7A 5A6AA 2BOGX 4QE4A 1JCMP 1WOBA 4Q6JA 4TOQA 4OOZA 1RAKA 1QNOA 2ICSA 4F79A 3CQHA 3ITGA 3R0DA 2GVYA 3Q45A 2GUBA 4LALA 1VEPA 3QJAA 5L9FA 4IH3A 2W66A 2DSZA 2XWEA 1NF7A 1NWRA 4D6HA 3IIOA 1LBMA 3DIPA 1N55A 2VFDA 1P1MA 1JI2A 1SO5A 3VNJA 2CU0A 5CLTA 2ADAA 5U4NA 4MWAA 5DCDA 3BK0A 3WSUA 4NKCA 3SGUA 2VCBA 2X0YA 4Q4PA 1PIGA 1V4YA 3WQCA 4ZEPA 2R1PA 1DHPA 3OVGA 4QITA 5EMMA 2H3BA 4NAFA 4AG0A 1K6AA 4KETA 1ISXA 3FVMA 3GKAA 3D5HA 4H8UA 2VC5A 1XICA 1ZZMA 4W88A 4QLJA 3NAVA 2ODOA 2E9BA 2PDUA 3S2LA 3USBA 4L1GA 2E6YA 4RXGA 1PS9A 1YIXA 1VD6A 1IYXA 4G8TA 5ABEA 4G7EB 1KTBA 4LYKA 2DSUA 5C5YA 1FWGC 5E9AA 1EDGA 4LS2A 1H09A 3NQCA 4HMNA 2D2JA 1BAGA 3W7GA 4RLIA 2VXNA 3WEMA 5FJJA 4XKYB 2E9LA 3W38A 2OWWA 2F6UA 4QFUA 3T0BA 1QPKA 2NQJA 3G5EA 1Q85A 1HFBA 4N7QA 4O16A 4PYSA 4LVGA 2AL1A 3W7LA 4MG4A 1TO3A 3O06A 3EDDA 1OFDA 4JIIX 3UZJA 2ANUA 2DW6A 1A3WA 3K4DA 4GUFA 2XIBA 3STFA 1AVAA 3AZSA 4TVCA 3EWWA 1RBLA 4W9TA 4F0KA 3DOPA 8XIAA 2CLOA 4OQVA 1RUSA 1V3HA 2PGRA 2YA1A 1ZALA 3I4KA 5AN7A 3CM4A 3KOWA 4BZYA 1BYDA 1I2RA 4ICCX 4B92A 1EWDA 1FHVA 3NIYA 1O5KA 3TYZA 3BQ6A 2C13A 4I7WA 4BK9A 4FXSA 2Z1KA 1GTHA 5ABTA 1MFUA 3ES8A 3MUIA 4Z1AA 3UZZA 5MHBA 5E0CA 4WF7A 1UOZA 4R9OA 3QKZA 4Y96A 3G77A 3OU8A 1K9FA 3VC6A 1VKFA 4H6RA 1M7XA 4XZMX 3C56A 1VFLA 1WKFA 3NQMA 4ZOBA 4ERGA 1CGXA 5CSSA 2MANA 2NXIA 1CGWA 4OBSA 2PWGA 4LWWA 2QCCA 1IGSA 4H7ZA 2X7VA 4GACA 3GR4A 4PL1A 1BRLA 1V6UA 1OX6A 4GX8A 3N73A 4GXPA 4NUWA 4Q4KA 4Y9MA 2WKLA 2CLLA 1DJIA 1I1XA 3MHGA 1OYCA 4OE7A 4W93A 3FA3A 3N2BA 5ECUA 1S1PA 3QW4B 3HIJA 2JF7A 1EJUC 1JUKA 3HMCA 3IS4A 1QCWA 2C16A 2AL2B 3GHSA 1YPFA 1NTHA 4FLOA 4QIUA 3UCCA 1XIHA 4S2BA 4WHBA 1VFTA 5IBXA 4PMZA 2G4JA 3M9YA 4BJHA 4H83A 2WBKA 4X2RA 1EZWA 1SMAA 4Q7IA 3ZLFA 3H54A 2H6RA 1V03A 2WZHA 1CXIA 5CBBA 3WBAA 3M0ZA 2D0FA 1ISYA 2WMIB 3L68A 3QZEA 1E1CB 1GZ1A 1GZJA 3H2NA 1W3JA 2VQTA 4L1WA 3OQ8A 1XLHA 3GXFA 3EWDA 4LY8A 3F5LA 1VZWA 3BAYA 3QHMA 2A4AA 1XJBA 3CAVA 2VX4A 2WB5A 4QG9A 1MW3A 4CQ8A 3MTWA 1EIXA 2Y5EA 4H00A 3HGRA 1WDWA 1O7AA 3F2BA 1Y5XA 3M5YA 2OGJA 2WMFA 3LHTA 1W3IA 3RJXA 1R3TA 3LXAA 4GQBA 3KL5A 2F6KA 1QI5A 1E6QM 5I77A 1JYVA 5KTLA 2YIHA 1C9WA 3W72A 3DFHA 4WDTA 1J0HA 4Z1YA 3VZZA 3BICA 3N18A 1K6WA 5E0FA 3NUKA 5PTDA 1LTDA 3D3AA 1LWIA 2QDDA 4F8XA 3AUJA 3CZKA 1LT8A 2PD9A 4AY7A 2CESA 3VGEA 3H2OA 1JZ6A 4GHRA 5FSEC 3UPMA 2ZE3A 1QR7A 4DRSA 4LQ1A 1YXDA 3N2TA 1EJWC 4XSMA 1Q6LA 1G69A 6XIMA 3BMWA 4DBUA 2I17A 3AROA 2E5CA 5TBOA 3PWGA 1FCBA 1WZLA 4C6DA 3NFUA 1S3HA 1SFTA 6XIAA 2DZWA 3FJ6A 5CJMA 3ITYA 4RK8A 3FVDA 1VHCA 3PJWA 4WY0A 3UETA 4OBTA 2ZX6A 4JEJA 1HVXA 1HO1A 3DCPA 2Z2BA 1GKQA 4CU6A 3TR9A 3QW3A 2W5FA 4MNMA 1EL3A 4LUYA 4PCSA 3GK0A 3UU0A 2GYIA 5IHSA 5HMFA 4PZVA 3STEA 1B4EA 2YR1A 3A13A 4HK5A 3BGGA 3G1VA 4B5WA 1JJKA 4AF0A 1D8CA 3PFRA 1LRQA 1YX1A 4LNYA 1Q7ZA 2GVLA 2QCMA 5T9BG 1TWZA 1PYMA 4JTAA 3E0IA 1GT8A 2VP8A 5T26A 1US3A 3STCA 4ZBCA 3MP5A 2BTMA 2E1WA 4V15A 1DKWA 5M17A 3ZVIA 3WNPA 3E0FA 4PCTA 2EPOA 4L7ZA 1ME8A 4FOJA 2YFNA 1AJ2A 1NWTA 3PUGA 2VT0A 4NZJA 2WJFA 1RSCA 3ABQA 1DEDA 1QOQA 1GQKA 5KITA 4C6FA 2A79A 4P8WA 2WZMA 3N4AA 4JS3A 4JQ4A 3RLVA 1R86A 4INFA 1D9EA 3VKAA 1G7VA 3BAKA 3C0SA 4KEVA 1ZSXA 3HMJG 4CUCA 3LM7A 2P10A 2VQUA 3AMKA 2PODA 3C3UA 2UY3A 3DC8A 4TR9A 5BRBA 5FJOA 4GKTA 3HGSA 3AXHA 2Z2AA 4RZ5A 1YYAA 2DZXA 3NDZA 3EGJA 2J27A 4UTWC 4CD6A 4M6PA 1L6GA 1KLZA 3LHYA 6TAAA 3VU2A 1SMDA 4DB7A 3PJTA 4XZNX 3UZWA 4K39A 1V0LA 2ZZ1A 4F48A 3LCGA 3LGGA 2Z24A 6CGTA 4LF2A 4OFCA 3MANA 4KIRA 1EEPA 4ASTA 5D9PA 3TZNA 1UKQA 1MXDA 4DJDD 3K1GA 5CBIA 3GFXA 5DMNA 1A47A 1RA5A 3B0XA 3BW3A 3NVTA 3GR7A 2YPIA 1V3JA 1Z48A 3TSBA 5ENLA 4XD3A 3H7UA 3L4ZA 3AFBA 2OODA 3AMGA 3MI3A 1LG1A 1EQPA 5E5CA 1R7AA 4H41A 1JDEA 1J0KA 3QGKC 3H7VA 3K5XA 4B3KA 5C8BB 4JTHA 4W89A 4AYGA 3TTOA 3MMUA 4N9CA 1VPXA 3PB2A 4H8NA 1VFMA 4PUKA 1B3XA 1XFBA 2Z6JA 4QDMA 1VRXA 2C1IA 1XQLA 3GXDA 3T42A 1E0UA 3T2PA 3O07A 3B0UX 3WLNA 2WNWA 3QTGA 5CPSA 3WJWA 4PCFA 2EF9A 3HPXA 3KVJA 4BWLC 2DT2A 4KPLA 1VR6A 3R1ZA 4GH1A 1KGWA 1FWBC 1S1RA 4QAIA 4R33A 1E72M 3WLJA 3WQFA 1VCGA 3FHAA 3C3NA 3TXVA 1R7OA 3DYPA 3T05A 4F66A 5CAKA 5C0QA 1BWLA 2DSKA 1EP2A 1YXCA 4RUBA 1TTPA 4FLSA 1NVMA 3VKCA 5D32A 1FWDC 2Y4SA 4W5ZA 3E0LA 4O1CA 4J9JA 4UFIA 2BMBA 1PE1A 1DL3A 4ATLA 4WSJA 3P7YA 1P6WA 2QJHA 3SY5A 4CQAA 1JDDA 2BVWA 4AHQA 4UFLA 3GVGA 3OVPA 5F2MA 2V63A 3UCQA 3BC9A 2ON3A 2RHG