2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
4XAYA 1RJPA 4CNSA 3LSCA 4H9MA 2WJDA 3A3WA 4I6VA 1M7JA 2A3LA 4DI9A 4C6QA 1RJQA 3K4WA 4CQBA 4IFKA 1GKPA 4WGXA 4LCQA 2EG8A 1ADDA 1GKQA 2Z2AA 4HK7A 4C6IA 2E1WA 4R88A 1EJVC 2Z26A 1O5RA 2PGFA 3IV8A 2KAUC 1YBQA 3KM8A 3QGKC 3SFWA 1EJSC 3IRSA 3S2MA 1JGMA 4RZBA 3SO7A 4HA0A 4EPDC 4C60A 2R1PA 4EPBC 2VC5A 4XD3A 4P5UA 4C6FA 3AU2A 2HQAA 2VR2A 4PE8A 4G2DA 2F6KA 4QS6A 4ERAA 3F2BA 1J6OA 2OGJA 4XD5A 2HPMA 4HK6A 1R9ZA 2R1MA 5HMEA 2Q01A 1P6CA 1FWHC 4B3ZA 4G7EB 2OOFA 1FKXA 3OU8A 3AU6A 2R1LA 3MDWA 4V1YA 3GTXA 3IACA 4OFCA 3TNBA 2Z28A 1YMYA 1ONXA 1A4LA 3T81A 3TN4A 2WM1A 3GG7A 3F2DA 4ERIA 1NDZA 4RDYA 4C6NA 3B0YA 2UZ9A 3CS2A 2PAJA 2GZXA 2VHLA 3ITCA 4GZ7A 4PBFA 5E5CA 4C6LA 2WJFA 4F0RA 3O7UA 1HZYA 3F4DA 4NP7A 4C6PA 4CNUA 3K5XA 1V7AA 1FWGC 2Z27A 1GKRA 1V77A 2I9UA 2WJEA 3OODA 3ID7A 4XAFA 3UR5A 4WVXA 3HTWA 4B91A 4GXWA 5HMDA 4CNTA 1KCXA 4LAOA 1PTAA 1EZ2A 1UIOA 4DNMA 1PO9A 3PNUA 1BF6A 4IG2B 2VUNA 1EF2A 3E0LA 4PCNA 4MUPA 4H9XA 3EWDA 4E3TA 2D2JA 3WZ0E 3F4CA 3QY7A 4J2MA 1A5KC 3A4JA 4XAGA 3OQEA 4GX9A 1FKWA 1J79A 1FWBC 3FEQA 1VFLA 3G77A 4GX8A 2FVKA 2Q09A 4H9YA 2FFIA 3ISIX 4Z42C 3QGAC 3LS9A 2D2HA 2UBPC 4C6BA 3F2CA 4H00A 2DVUA 2VM8A 4H01A 3LSBA 4C5YA 4C5ZA 2GSEA 1UIPA 3V7PA 3HM7A 2QS8A 4XD4A 4RDVA 1V51A 4YIWA 1WXYA 1NFGA 4KEUA 2VC7A 4F0SA 4LFYA 4QTGA 2Y1HA 5FSEC 3TN5A 2RAGA 4QS5A 1I0DA 4DIAA 2FVMA 4IGMA 4J35A 4LAKA 1EJUC 1EJTC 3GIQA 3MSRA 3LA4A 3S2NA 4UBPC 4GBDA 2R1NA 3K2GA 4ERGA 2Z25A 3OOQA 3PBMA 1M68A 4LEFA 1I0BA 4CQCA 1V79A 2Z4GA 4F0LA 2FTYA 1XGEA 3C86A 1ITQA 3RHGA 4C6MA 1A5OC 2I5GA 2P53A 3QY8A 4DYKA 5CH9A 1R9YA 4HJWA 3IPWA 1FWJC 1ONWA 2FTWA 4ZSUA 3NEHA 1V4YA 3IARA 2YZ5A 2IMRA 3BE7A 4KQNA 4KIRA 3OJGA 2BB0A 2PLMA 4CQDA 3ICJA 2GOKA 4IQJA 2HBXA 4KF1A 3E3HA 2XIOA 2CZVA 3URBA 4KEVA 4UB9A 4H9ZA 4C6OA 3GTHA 1DPMA 3T1GA 2ZC1A 2GWGA 3D6NA 3JZEA 4LALA 4DI8A 3LU2A 3MTWA 3UPMA 1POKA 1XRFA 4B92A 4TQTA 1A5LC 2Z24A 3FDKA 3S4TA 2PUZA 1UBPC 3DC8A 1PB0A 1FWFC 2HBVA 3E2VA 2BGNE 4H9VA 2OODA 1XRTA 4GC3A 3UF9A 3A3XA 3S2LA 2GWNA 1KRCC 3LNPA 3TN3A 1YIXA 3B40A 5FSDC 4L9XA 3PNZA 1RJRA 3GIPA 3LY0A 2EG7A 4AQLA 5LXXA 3MPGA 4IFRA 3WMLA 4QRNA 1NDYA 2Z29A 1FWAC 3AUOA 3HPAA 1RA5A 4G7EA 1POJA 1A5NC 3OVGA 3GRIA 3E74A 3CAKA 2D2GA 3T8LA 2AQOA 1YRRA 1S3TC 4GY1A 4WHBA 3E38A 3O0FA 4INFA 3DCPA 4QSFA 2Z00A 1RK5A 5HMFA 4EP8C 2O4QA 1K6WA 3UR2A 2P50A 4JOMA 4DLMA 4ICMA 5G4HC 5A6TC 1KRMA 2W9MA 1M65A 3MDUA 1P6BA 2DVTA 1A5MC 4R7WA 4EPKA 4XD6A 4C6DA 4IF2A 1P1MA 2ICSA 3ORWA 2G3FA 4IGNA 5AKQA 3S2JA 2PGRA 1NDWA 1K70A 2EG6A 1W1IE 4BJHA 4IG2A 2HNHA 4CEUC 4DZHA 3URAA 4KERA 4DLFA 1K1DA 3IGHX 3LGDA 2E25A 3RCMA 2QPXA 1RK6A 4LCSA 3B0XA 1O12A 4J5NA 4PBEA 3QY6A 3RN6A 3DUGA 4EPEC 1UMLA 4NG3A 1R9XA 4LH8A 1QXLA 2ADAA 4H9UA 4CEXC 1FWIC 2QVNA 4C6CA 1FWDC 4RE0A 4RDWA 2DVXA 2Z7GA 3N2CA 3MJMA 4R85A 1ITUA 1WXZA 4GYFA 1EJXC 4XAZA 4AC7C 3PAOA 3RYSA 2YB4A 3GTIA 1NDVA 2OQLA 3MVTA 4GK8A 1E9YB 1PSCA 4IH3A 1E9ZB 4LANA 4NI8A 2Z2BA 4IFKB 1IE7C 2AMXA 4QROA 2ANUA 1YNYA 4C6KA 3EGJA 1EYWA 2AQVA 3NQBA 2O4MA 4LCRA 3GUWA 3MKVA 4V1XA 1YBQB 4GY0A 3NURA 4KEZA 4BKNA 4I6KA 1J6PA 1FWEC 4GOAA 4H9TA 1KRAC 3GU1A 3GU2A 3IJ6A 4IFOA 3CJPA 4DO7A 3WYZA 1A4MA 4RDZA 4LAMA 1FWCC 4PCPA 3LGGA 4D8LA 1XWYA 1ZZMA 4DZIA 3MVIA 3TN6A 1EJRC 4C6EA 3GTFA 4B90A 1J5SA 2YB1A 4GY7A 1KRBC 2HPIA 1EJWC 3FDGA 3UBPC 3E0FA 2R1KA 2YXOA 4BY3A 1RA0A 4ZSTA 3EWCA 4C65A 2QT3A 4C6JA 4KETA 3GU9A 4KESA 4L6DA 4M51A 3PANA 4HK5A 1QW7A 1RAKA 3URQA 2OB3A 3URNA 3R0DA
chains in the Genus database with same CATH superfamily
4AHOA 1M7JA 3BLFA 4G7FA 4LS2A 5F4SA 3TK7A 5CGMA 4CQBA 2AGTA 4RZ4A 3Q67A 4FLOA 4ATDA 2ODOA 2P8BA 3L66A 3GDKA 3QW3A 1ADDA 3KCLA 1XG4A 1K02A 3IV8A 3IIXA 5HINA 2ZFAA 1XLKA 4O1DA 3WQDA 2HV5A 1XF0A 4FF7A 3SY1A 4Q4RA 3UXDA 4QDMA 4CVWA 1AMYA 1VEPA 1TPUA 1DJIA 4GACA 5BXRA 2RGLA 1UH3A 3RK8A 1DJNA 1OD8A 3NQ2A 2QJJA 4L1WA 3A9BA 2JALA 3TNBA 3W1AA 4KFOA 4MMWA 4O1CA 2RHGA 3SRKA 2HE5A 1W8GA 4PN2A 1K7FA 3W7KA 3F2DA 2VUYA 1DJXA 1I2PA 3CV7A 4TX9A 3U3HA 3E1F1 4F0RA 4H3DA 4K38A 2VELA 3WCZA 2CWXA 1CTNA 2IKHA 2NQZA 3O6AA 1XLLA 3REQA 2H8ZA 2Q3OA 3T2QA 1XC4A 1OC5A 1VCVA 2BG5A 3WH7A 2ZYFA 4MNLA 1FWGC 1LLOA 3MYOA 1OFDA 4RLIA 3USZA 1DBTA 4IPJA 6PTDA 4K1GA 1PZ2A 4QDPA 4N9BA 1TYGA 2A3EA 1D3CA 3E12A 3TA6A 3WJWA 4AVFA 2C71A 3ANVA 3E0LA 1AH3A 2YR1A 7XIMA 2VI0A 2C1IA 3P14A 4O57A 3PULA 3QY7A 1B3OA 4J2MA 4QAIA 3P0XA 2BMBA 4ILSA 2XM1A 1JDAA 1EXPA 4X2PA 3DFQA 2EPMX 4AHPA 2UBPC 1XSKA 4NY2A 1UWQA 1JPIA 3IWPA 4PCTA 1V0KA 3FYYA 1SSGA 4GZJA 1M3UA 3SSJA 3KOYA 4M82A 3GBEA 1GG1A 4HD5A 4LX4A 2ZZ5A 3JUGA 2ZRXA 3TR9A 1E9LA 2OEKA 2Y7DA 1F8IA 4JKMA 2A1YA 4F0SA 4LFYA 2B7QA 2W67A 2W79A 2OKOA 3VOJA 4XWUA 5I24A 3UVAA 4WDWA 3NGJA 1O5KA 3CPUA 2J27A 1JFXA 1EJTC 3WQPA 3LA4A 4WKFA 1RUSA 5LKYA 5CC6A 3QJAA 1G4EA 2Z25A 3QGVA 2DPEA 2DUZA 3V5OA 1YNPA 2NQ5A 5CQ1A 4Y7EA 1EL3A 4XTIA 1F2JA 3WKZA 4ZB2A 3KZSA 1KWGA 4ZFMA 1XYZA 3QY8A 1QHOA 2OLSA 1R9YA 4HJWA 1NM9A 4DWSA 1QUMA 2DW6A 2ZZ6A 2QDEA 5BXSA 3CXOA 4I7VA 1EEPA 1TMHA 4O19A 4QNEA 2BB0A 4E2OA 3I10A 1BYCA 2PDHA 2HBXA 1Q6RA 3ZM8A 3MHFA 2QCDB 1TWSA 4GVIA 3BSMA 1MW0A 1HL2A 4WY0B 1KBKA 3C8FA 2J66A 4NXKA 4R3UA 3FJ4A 4MDOA 1VPQA 4AZGA 1WDRA 5C54A 2V2DA 2CWNA 4IIDA 1RP8A 1WBHA 5JH2A 1ECEA 1AJ0A 1KXHA 4F3HA 1XRTA 2A3AA 1V3MA 4NJGA 4E2DA 3G18A 2GWNA 1PL9A 5E09A 4D6CA 2Y63A 1E73M 4HN4A 4PEEA 3QOMA 1VJZA 3BAKA 4ZOAA 3TC7A 4AQLA 5FEWA 2Z29A 3ITYA 1W1PA 4G7EA 4O10A 1JUEA 1Y0EA 2GGGA 5A2BA 4I5XA 2G4FA 1LOSA 1BGGA 3GNRA 1WDQA 3V3WA 4NRSA 1V08A 3S1WA 3MSYA 4IIGA 4PMOA 1BXCA 2YLLA 2I14A 2ZVIA 3VDCA 1TMLA 5EGRA 1E1CA 3RPMA 4A21A 2L5HA 3WD0A 2WNNA 3F4WA 4Z2HA 1BXNA 3SR7A 4DHGA 2CKSA 3SRFA 4UFLA 3L23A 4RR4A 4R9XA 3WMSA 3IVSA 4WJ8A 3G1YA 4ZMGA 4KCWA 2BXYA 1KA9F 5PTDA 3AHZA 2O55A 1QWGA 1XJBA 2XH7A 3SUVA 4AIBA 1VFSA 2ZA1A 4FB7A 7REQB 4PTXA 4RPQA 4A2SA 3HU7A 3WMBA 1VYRA 4JKKA 4LCSA 1JI1A 4EPEC 4P8UA 1OT1A 3B9EA 3SZ8A 3NO1A 1CLKA 3P74A 3I6EA 4CEXC 2WMFA 4LYQA 4RE2A 2J47A 1XSJA 5E6YA 2I57A 1E9IA 3VTRA 2OXNA 4UWMA 1ECQA 4MSSA 1EQCA 1QPQA 2BVWA 4AY1A 3SUTA 2E5CA 2PDNA 3O9NA 3B4UA 2XGBA 4O1AA 3KOXA 3SCTA 4DPPA 4HPHA 3E96A 1FTXA 3EDJA 4NZ3A 3N04A 3WYZA 1I2QA 2P0OA 1A4MA 4PCPA 3DFYA 3GY1A 1X8FA 2OX4A 4UR8A 2QQ6A 4C1KA 3W88A 2R14A 3GHUA 1HO4A 4AEOA 1NWRA 2DY3A 1YYAA 4JIIX 3VKDA 3WF4A 1XISA 1QPKA 3BZJA 5DT5A 3ZIZA 2WC3A 4ZGYA 3NO5A 1J2WA 6A3HA 2VFFA 5DT7A 3URNA 3R0DA 4XQ6A 3C8NA 1C9WA 3CLMA 2GOUA 4ZFCA 3GDRA 2WVVA 3DEQA 3A4AA 4LTSA 3RILA 2G8ZA 3QKZA 4QXIA 2GK1B 4A8LA 2OYKA 4HSNA 5AHMA 2QVHA 3VNZA 2INFA 1R2SA 1JD9A 3DHDA 2HVOA 2R1PA 2OT1A 2J7CA 2HQAA 2OU4A 3RLVA 4CCEA 2IQ0A 3DXIA 4UTTC 2EBNA 1W3HA 4ERAA 4WUIA 3VD5A 1PBGA 2Q01A 3K1DA 3T07A 1M04A 1PEZA 2VQUA 3AU6A 4XB3A 3NDOA 1QW8A 3SN1A 3KE0A 1R3RA 4C1NA 2HEJA 4KRZA 4KGLA 4H7VA 3M7WA 2MNRA 3ARTA 3SGZA 3V5CA 1KQZA 1S39A 3AJXA 8RUCA 4I7UA 3WF3A 3NQEA 4K8HA 4BCEA 1YW1A 2WV8A 1L8NA 4CNUA 2XIBA 1WA3A 1TPH1 3OODA 2WMIA 2C79A 1A5AA 3L4UA 3AICA 1XR2A 3H2EA 1NQKA 3KCJA 4MKSA 1UIOA 4DNMA 3AXKA 4MWAA 1ADOA 3CASA 2VVNA 3FGCB 3K4DA 5LIYX 2AKZA 3VNYA 3GAYA 2AGKA 2OPJA 1L6FA 2NXGA 4N6FA 5GVJA 5BOEA 3VDBA 4XG1A 1J96A 2PDMA 1AMKA 1K8XA 1SO6A 1OX5A 1VRXA 1ONEA 1KCLA 2ZDSA 3S3GA 3W25A 3RAOA 1B54A 2BS9A 3W1NA 3JRKA 3HQPA 2DVUA 2V38A 4TVUA 5G4WA 1JYXA 4H7ZA 4MLRA 7A3HA 1G6CA 1F4AA 1TPFA 1F07A 1XIBA 3AO0A 4RDVA 4YVPA 1V51A 4YIWA 1X1OA 4YWIA 3NXLA 5A8PA 2WSKA 3II1A 3BVJA 1UZHA 8A3HA 1WOBA 1HQTA 2IKJA 2V82A 4XUGA 1ZGDA 1UP2A 2E6AA 2VP8A 1YADA 1GVSA 2A85A 1GOKA 4ZQMA 3W2KA 8XIMA 4GH3A 1LWJA 3Q37A 2Y2WA 3WQOA 1H51A 5DMMA 3C0LA 4ATWA 3DGRA 1LCOA 1IR2A 1JL8A 5EKYA 4CQAA 4LVAA 1YE4A 1FBAA 3WH8A 4A35A 3RUBL 2BP1A 4ZSUA 3VIJA 1V4YA 3G24A 1F76A 2IKGA 3RITA 4KIRA 2B31A 1WKYA 5G4EA 3ICJA 3T8QA 4UB9A 4M80A 3KXQA 5HA7A 3FIGA 1GEQA 1T96A 5L9FA 2XGIA 4U2YA 4ZO8A 2GWGA 4IICA 4F4RA 4GYKA 3OYZA 4PL1A 1BWKA 1KC7A 1JXKA 3S4TA 3O06A 4GUIA 4U4MA 3ARYA 1JCNA 1DP0A 1W1VA 5HBFA 5CG0A 3R94A 3OQ8A 1K9DA 3GBDA 4L9XA 3RJYA 3MCMA 4PUUA 4IFRA 3WMLA 3M0ZA 5EFFA 1RBLA 5ABFA 4J28A 2CXEA 2DIJA 5FL1A 3GM8A 4H2HA 4S3DA 1UOKA 4UUIA 2Z2UA 3PZUA 1KNWA 3FCPA 3OTRA 2ZZ7A 3H7UA 3UYIA 1QHPA 4L1GA 2QF8A 1KXTA 1QT1A 2VURA 2VX6A 5HOSA 1EOMA 3OZMA 1VCGA 1QDSA 3L2MA 1SU5A 1KBLA 3AHYA 5CLTA 1OC6A 1MFUA 4WDUA 4BHYA 9RUBA 2VEKA 4E8CA 3HZ3A 1Z44A 3KTSA 3L65A 3G1DA 4N9CA 3EOUA 1VFUA 2XHYA 1CZ1A 4JTTA 3L5MA 4NAFA 3PJWA 2J62A 1FWIC 1A3HA 2WZMA 4RE0A 1EX5A 3KHJA 4WXZA 3WD3A 3QHMA 1H2JA 5IHRA 3BGJA 3SRDA 4G8TA 4HPXA 3Q2DA 2WANA 1MDRA 4MHBA 5M1TA 5EBUA 1HXJA 4ZQPA 3ELFA 3W76A 4QM1A 1LUCB 1M03A 1HKVA 4W88A 4PULA 1XBXA 4HZ7A 1XHGA 3NQBA 1CYGA 3TC6A 1E70M 4JTGA 2OLAA 1Y65A 1W8SA 4PMUA 4V1XA 4OVXA 1Z48A 2TMDA 3VNIA 1TVNA 4A3QA 3VCCA 3BGGA 3EB4A 4XO7A 2J9XA 4IFOA 1WAUA 3G1RA 3W6MA 2CW6A 3ENLA 4AZBA 1UCWA 3G8RA 4LVBA 5KZMA 1QK2A 3NPVA 4Q22A 1DXIA 2G96A 2F8QA 2CLFA 5F2MA 3NQGA 4WKHA 2X0SA 5AC7A 1V0NA 1EC7A 3VIOA 4C65A 2IS7A 1G67A 1XLAA 1Y5VA 5GPRA 1Q63A 4L6DA 3SCNA 3RLUA 1SFLA 2YL6A 4ZR8A 5LGZA 4KEMA 3UZXA 3ZXWA 3H7RA 5EY5A 1W54A 3PSWA 4HNUA 1TUFA 4RXFA 1EEXA 1W2PA 1ZNNA 4CNPA 2ZZ4A 3NJ3A 3DFTA 1JYVA 1AODA 2YA1A 1NFPA 4AG0A 1EWEA 1LRNA 3S6OA 2KAUC 1VEMA 3OA3A 3GDLA 3W7EA 4HA0A 4XKMA 3WDIA 2PEVA 4DAFA 4GQ0A 2AL2A 2GPTA 3QH2A 4I8YA 1ZP3A 2CBUA 3LBMA 3PPHA 4PE8A 3TC3A 5DRCA 1MXGA 3GXFA 1UOZA 2VFGA 3H7VA 4FMVA 1QI5A 4GVHA 4ORMA 1X97A 1UWAA 3WUFA 3JU2A 3OU8A 1MW2A 3SUWA 3N73A 3A3HA 5AC8A 2Z28A 2YDSA 3WFZA 2QEZA 2GVGA 4G5DA 1WB0A 1FWNA 3DZ1A 5EMMA 4DBDA 3T42A 4LYKA 3QZAA 4R34A 3L0GA 3MBFA 4CN1A 4CD7A 2QNEA 3NQMA 4C7FA 4S3CA 1GYLA 3O7UA 4YYFA 3N34A 1YXCA 2HXUA 2XN0A 3SI9A 1YHTA 5A3HA 3T0CA 1BVNP 3V0SA 4WZHA 4PTWA 3CO8A 4WVXA 3B8TA 2PU0A 3BAXA 4GUJA 4PYSA 3WEOA 4KPLA 1IV8A 3DG7A 3UETA 5D02A 4L64A 3ARSA 4M56A 1WYIA 1JZ8A 2CXGA 3TZFA 4HMDA 4XAGA 5TAOA 4UOZA 1GHSA 4KH2A 1QRQA 3RLGA 4O12A 3HGOA 2VJXA 4HMNA 1E1FA 2RDTA 1R2TA 3HFYA 4IXHA 5XIMA 1BWLA 2DT2A 1F61A 4NF7A 4I8DA 1P0EA 3AS1A 2E6FA 3RR1A 4M5PA 4I5UA 1YDYA 5HDRA 1T40A 4JKLA 2IW0A 4UTLA 1UIPA 3I65A 4HYWA 2E40A 1D3GA 3DH7A 4XD4A 1WXYA 4GJIA 1WX0A 4JHZA 1EOKA 2VD9A 3VIMA 3BTNA 4JQ2A 1EUNA 3GC2A 5JU6A 4O4WA 4J35A 4UR7A 4ZE5A 4HZMA 3S2NA 4UBPC 3VINA 2R1NA 1F7BA 4HCLA 3U5YA 4E4PA 2VX5A 1V79A 3LCWA 4XBKA 1XLEA 3A5VA 1GEHA 5F2IA 1XYFA 2W61A 3RHGA 1ZCOA 5J5RA 4US5A 4NL1A 4REQA 3I4KA 3SIZA 3RX4A 2ISWA 4Q4QA 4ZQNA 4HYVA 1MUWA 3CHFA 3QOKA 4BF5A 1V8EA 2GOKA 2X30A 3O07A 5DN1A 4HNLA 1A50A 3IAPA 3Q94A 7ENLA 4X9SA 3FW6A 2IUZA 2ZC1A 2I5QA 2WWDA 3W82A 4HMEA 4AEFA 5G1YA 1CWYA 1X96A 1Q7QA 4MB3A 1H1NA 2QJMA 1PB0A 1FHDA 3WLSA 3HN3A 1DQWA 3UA4A 4GC3A 3CUFA 3CPGA 3O63A 3PBVA 3T78A 1IXPA 1O60A 3ZVHB 2ACUA 4JCLA 5AB3A 2GQAA 4M81A 2DSVA 4RE3A 3GWQA 5FF7A 1A5BA 4B9ZA 1J0HA 4D2JA 3HQNA 1W5QA 2AQOA 2HTMA 2HE8A 3W7CA 5CLWA 1AZ1A 3QC3A 4QJ4B 4FLQA 4QSFA 4JBRA 3PZGA 5DY2A 3EX6A 4RXGA 1GYMA 2EKCA 1T7LA 3CHCA 4QR6A 5I78A 3W1LA 1FH8A 1XBZA 1A5MC 2PD5A 3LUTA 4E6MA 4C6DA 3QC0A 2DV0A 1VC4A 4CU6A 2YA2A 4JY8A 3GXTA 2VX4A 1QNVA 2XIJA 4GNJA 1W1IE 3BICA 4O1EA 1FWSA 4ATLA 1B3XA 1OZQA 3N6JA 1U5JA 3WJXA 4DWDA 1O94A 2Y8VA 1MEIA 3NWRA 5G1TA 1K1DA 2WBGA 4IIFA 1TR1A 4OBSA 4YJ5A 4JIRA 3WQ4A 4H9UA 4JYFA 1A3XA 2XSBA 3TYDA 3NQDA 2PPGA 2AQWA 5MKGA 2PRHA 1CXKA 1X39A 3LHYA 4Y8EA 1BKHA 3RYSA 2C18A 5HJLA 3TUUA 3UGVA 3ONBA 3VZYA 3NPWA 3EOEA 3DFNA 1DWJM 5BYWA 3K4AA 2AQVA 4N7QA 3W1UA 3WQGA 3GW0A 3NVTA 4KEZA 4BKNA 3G0UA 1EA0A 4MG4A 1HUVA 4M29A 4BF7A 3QZ6A 3GH4A 1WZAA 2XH4A 3WL1A 4H6QA 4W4QA 4RDZA 4MNJA 3VIHA 4D8LA 2RDWA 4NX5A 4EANA 5I77A 1XS2A 2NWRA 5GJNA 1B30A 3W72A 3ABXA 1EJWC 2PDWA 5AHIA 3LDVA 2R1KA 4J4KA 1CB2A 3D3FA 3VNJA 4MADA 5F2LA 1ICPA 1YPXA 3SQMA 3CZEA 1BAGA 1UD4A 4ZTYA 5AZ0A 4HOWA 3AZRA 4FIRA 1Y8BA 3W6YA 4AHQA 2Z1KA 2VD8A 2NQLA 4BQ4A 1O5QA 4DZ5A 3BANA 1CI1A 5C55A 4J9JA 4JX6A 2KX9A 4TVCA 3EB3A 4V27A 4RV8A 3GD6A 3ATZA 2R82A 3P67A 4A3HA 3OIXA 3MU7A 2INEA 3M0VA 1EJSC 3KOZA 3SO7A 3VM7A 2YCJA 3L4ZA 2QGYA 2R9RA 1VEOA 3FEMA 3WNOA 1QPOA 3BLLA 1NF0A 1QJWA 3A6OA 1XINA 4P7OA 3SURA 4HK6A 2QJIA 5F7UA 1UUMA 3UJSA 3EOOA 1P6CA 2YSWA 5TF0A 3ZMRA 4DUWA 2DH3A 4IPIA 4DXXA 1N8IA 1CNVA 1X6LA 2VOMA 3SGUA 3U2ZA 2XG9A 2WM1A 2Y8UA 1VS1A 2W62A 3CHDA 4ECLA 3OHIA 3B0YA 5C7HA 1GYNA 3ARQA 1M5WA 2GZXA 3VFLA 4PBFA 5E5CA 2OEMA 3HG2A 5LA2A 1AD1A 2WO5A 4MJ4A 3M43A 2A6NA 1C7TA 4FXJA 1SZFA 1WZLA 2G37A 2H8XA 3ID7A 3H55A 3WDJA 4FF5A 4ZO7A 3LV6A 3OGVA 4UZSA 1GQKA 1MFVA 2Y7GA 2OX1A 3EWBX 4E0CA 3L21A 1XLFA 2REQB 3WLIA 2F2KA 3WG6A 3JS3A 1AQMA 4MM1A 3O2LA 2GQ9A 1TX0A 3M41A 3IVTA 3THUA 1SW0A 2PDIA 3VNKA 2NSXA 4GX8A 4JIPA 4H9YA 1XLJA 4DXVA 3VGBA 3N14A 1B9BA 5JH1A 2FJKA 4JTRA 4LUJA 1NEYA 3VABA 4H83A 4HYRA 1G9HA 2O92A 2XN1A 3B8WA 1U30A 1RD6A 3H4XA 3A23A 1Q8JA 3AXMA 3BARA 3TSDA 2J7EA 3NQCA 1OGBA 5CCZA 4W8LA 2JIEA 2PDKA 1AG1O 5I3DA 5AHEA 4IIHA 3U9IA 1SFTA 3BOFA 4S23A 1UKOA 4ERGA 1LG1A 4PMVA 3EX1A 1Q2SA 4HPGA 1NOFA 4ZL1A 3OEXA 1HNYA 1T0OA 2E09A 4Q8QA 1QPNA 2V3GA 4GABA 1EJ7L 3LXBA 4Q4KA 2C13A 2PURA 3MP5A 2Q71A 3S9ZA 3N19B 2G3MA 4S3BA 3B03A 5EPDA 3UEQA 4M1BA 4KEVA 4S3AA 3RM8A 4C6OA 3GTHA 1FHVA 3TIMA 3CU2A 2WKGA 3KAOA 3R2GA 4XZNX 3W1RA 1H5VA 4XISA 2P3ZA 3OLGA 4PB3A 3DC8A 3P81A 1HP4A 2J7FA 1UR9A 1RR2A 4XKYA 4LQ1A 3KVMA 3LCXA 5FEXA 3BV7A 3S5ZA 3PWAA 3RPDA 4GIAA 4NT0A 4UFKA 2VENA 4AZ6A 1FCBA 3O6YX 1WXJA 3IUHA 3B9OA 3NZGA 5TQLA 1ODUA 3WFLA 4S3GA 2GQ3A 3N4FA 3IJQA 3AMKA 3U57A 1K3UA 1UR0A 1BYDA 4AYGA 1CGTA 2EO7A 2VFDA 4D9PA 1FXPA 3MW7A 4XVDA 1HGWA 3PBYA 2ATSA 1VB9A 2X8RA 3MUY1 4JQAA 4X22A 4DBEA 2P50A 3NQ8A 3GQYA 2OGYA 2V0TA 4QITA 3QN3A 3KTXA 2ZE0A 3NL3A 5F2GA 4F2UA 4AX6A 1XIEA 3WQ6A 5FIPA 4FLRA 4MJZA 2D1ZA 3IJ9A 2ZX6A 1GW1A 1ZBCA 1KKRA 5AKQA 4AWEA 5H1WA 1JCJA 3TQPA 4HKPA 1FWTA 4R9OA 2GVLA 3GDBA 3KRSA 1CGWA 3VD3A 2VRQA 3VNLA 3FA3A 1RK6A 3OBEA 4QIUA 4PBEA 2Q02A 5LHFA 3EAUA 2Z1XA 1PKMA 2QMKA 5HNTA 4NZ4A 4Q8WA 1FWDC 4H1ZA 5IDIA 5IM51 3GXNA 4LEQA 5AN7A 2Y4SA 3LYEA 2WM0A 3E5PA 4Z1YA 4M24A 1EJXC 3KDOA 1O5XA 4YTUA 4Z2JA 2ZRVA 3UR8A 2EGZA 3NDYA 3RDKA 4QG8A 3THCA 2Q8ZA 3OA5A 1J0IA 4AYSA 5AZ1A 2GJLA 5C71A 3TOYA 1F73A 3LERA 3DBNA 4A4AA 2DDXA 1HO1A 4M7TA 4O52A 5E0FA 1RLDA 4UCGA 3N17A 1JZ3A 2XFYA 1REQB 3HBLA 3GG1A 3PZOA 3TZNA 1YQ2A 2WLZA 4B90A 2PRMA 2X1IA 2YB1A 2G3JA 4Z17A 1TTIA 1KRBC 4ICCX 3UG3A 1CXLA 3GXDA 3KWSA 2QT3A 4CQ9A 1FCQA 1N8FA 2CITA 2WXDM 3MV11 4KETA 3GU9A 1H50A 3EXRA 1E40A 3GR8A 4XZBA 5A8QA 3W01A 3S83A 2I5IA 1HGYA 3TTSA 5K2ZA 3EPOA 3KS6A 4DJFD 2H9AA 4W9TA 4GQQA 3W07A 4G1KA 3REQB 2QCFA 4HN8A 2Z2AA 4HK7A 1AVAA 1EJVC 1MZRA 4WX2A 4R7OA 4YYCA 1K9TA 4IJBA 4RJEA 3SFWA 3M44A 3S2MA 2YFOA 5HNRA 4AY8A 2BBFA 3PPFA 1S2VA 4AY7A 4JFTA 1OK4A 1LLWA 4PTDA 2FQIA 5CAKA 2ZUVA 2YKKA 3H6OA 4G2DA 4QS6A 2RJGA 2TRSA 2WK2A 1PZ1A 3ARXA 4J3ZA 5HMEA 3QSTA 1W9VA 1TE6A 1Q6FA 1XIIA 3C5QA 1FKXA 1G4SA 1XW8A 3AHVA 4O17A 2V2CA 1V5XA 3AIRA 3RMEA 5AFDA 1A4LA 3N18A 4AZ5A 3ONCA 5DXYA 3SIMA 4EAMA 3P8JA 3ITGA 3TJIA 1GOOA 3MANA 1MXSA 1YXYA 1Q6CA 4QLJA 4NILA 1TWIA 2XPKA 1PYFA 2IPWA 3ZT7A 4DO6A 2ZXAA 2POTA 2O9RA 4U28A 5LIWX 2VOTA 4WDXA 1V77A 2CZFA 1LOQA 1XX1A 1WZMA 4Z1CA 2XU2A 3LM3A 3TA9A 4DJDA 2ZXBA 4CNTA 3W2JA 1Z7AA 2OWCA 3Q4DA 3T4WA 1UWSA 4K8GA 2ZKMX 4FOUA 1US0A 2VUNA 5BROA 5C6MA 4R27A 3VGHA 3VPLA 1GORA 4TVDA 2ZICA 4BI7A 1KM5A 4ZBCA 1FWBC 2NQHA 4DWSB 5CPNA 1PYMA 3N15A 3N2OA 5J5DA 2HDJA 4NNCA 2WQDA 4OOUA 3GXMA 2XFFA 4B15A 1I4NA 3R89A 1IR1A 1H41A 4AXKA 4W5ZA 5HQEA 2E68A 3B0UX 2C91A 3BAWA 4AZ7A 4IPLA 4LW7A 5DBTA 4AF0B 3S5NA 1TMQA 4B5NA 1D3HA 4KGJA 5TIMA 4AD5A 4AW7A 4L7ZA 4F48A 4WRHA 3QTPA 3NZRA 4DF0A 1H09A 4ZTXA 1W9PA 4V33A 1O95A 1Z32X 4XSLA 4MKNA 3VD4A 1TUXA 3F03K 3UCQA 4DEFA 5JBDA 5KZEA 5I3GA 4BA0A 1VPYA 2ZUSA 2ZDRA 4AC1X 1TV5A 4NASA 2H90A 4DB7A 2WSQA 2PI6A 2C6QA 2A3HA 3BLDA 2WAGA 4OV4A 4QAWA 5CH9A 1DE5A 1G7UA 4MNKA 3IARA 1K77A 3WK2A 3EDEA 5A5WA 1RCQA 4JAWA 4TTGA 5GNXA 4KWUA 1PIIA 3HG4A 2VGFA 3BAYA 3TCSA 1RZMA 2EF9A 5U7SA 1H7XA 4I9MA 1KLZA 1E1CB 5AYYA 4LJ3A 4QEHA 1ZQ5A 3S0CA 1GTEA 3UJRA 3WLMA 2B4GA 5BOFA 1XRFA 1RQBA 3A12A 4TQTA 3RGTA 1UQZA 2CIPA 4GGBA 2YL8A 2VVSA 3FFSA 3QLLA 1XLGA 3CT2A 3QXBA 3E2RA 3AXIA 3SGGA 2X1UA 4D1JA 2ZADA 3M4HA 5A8GA 3W7QA 1RJRA 1W3TA 2V2HA 1DE6A 4NUWA 1EHAA 2QCCA 4QRNA 4UQBA 3C56A 1UH2A 3VGDA 3H2MA 3BG9A 4UFJA 4JYEA 5DCDA 5T26A 2EEXA 2QIWA 3FJ6A 3DYMA 4UQAA 3HQ1A 2X1RA 2QR6A 3WUEA 3F4VA 1H3GA 1XIDA 5LNWA 4YVVA 1X7FA 1ZALA 3BC9A 2QLYA 4DWSD 1EC9A 3QQWA 2DZWA 5LZLA 5H8MA 3BG5A 4GFSA 3TLQA 1WZKA 1CGYA 3WLKX 1DHKA 2ZQ0A 1QO2A 2CLPA 2G95A 4JEJA 5F4XA 3K30A 3R0KA 3P84A 2OQHA 1THFD 1OT2A 2OZ0A 4B4HA 3WENA 1F6YA 1GWJA 2E25A 3LGDA 4Q7NA 3B0XA 1UMLA 3B8IA 3M0LA 2YW4A 2F9RA 3CYJA 5F4WA 3QZEA 2V5BA 3LK6A 2C15A 4GXMA 4W84A 4CLMA 4GI8A 1WDWA 3PAOA 1B1YA 4R5EA 2WVVB 4I3GA 5A94A 1OYBA 5EBAA 3VKBA 3H2NA 2FJUB 4MB5A 4NI8A 2PD9A 4FX6M 4X9YA 1DJQA 4GLEA 3FXGA 2VFIA 5CSSA 3QPEA 1EX1A 4UCFA 1K03A 5FJJA 2D0HA 5CBJA 4AVOA 5DX7A 2DJLA 3I7RA 1FWEC 2X1SA 1E0WA 3KP1A 2VWSA 2FHCA 1TV2A 1VHCA 2ACRA 5CGQA 3PAJA 3QPYA 1EJRC 3CAWA 5D38A 1ZBKA 4GVFA 3PK7A 1C9DA 3NL2A 1QI0A 2E5DA 4OBTA 3A5FA 5K7JA 2PLKA 2CCRA 1I6NA 3F1QA 3UP8A 2XINA 4C1NB 5J04A 3LGEA 4HK5A 2DT0A 5CC3A 1DEDA 4S1FA 2FZMA 1RJPA 3LSCA 3C2OA 2QUMA 1E3XA 3UWWA 4F0KA 3BV4A 5HWNA 1OY0A 4H7CA 4H8NA 1MW1A 2E1WA 2O7QA 1OABA 5DY3A 3I7SA 3WH9A 1YBQA 4E8DA 3DDMA 3KM8A 1JDFA 5JBEA 1JGMA 3TNOA 1SM9A 4JX5A 3UWEA 1OX6A 4JEQA 4MWAB 2G50A 3KUMA 3INPA 1E6PA 3RF9A 1FX6A 2ESCA 2X41A 1UR2A 2EPHA 4RNFA 5JBFA 3PJUA 1NY1A 3UG8A 1RSCA 4LVFA 2VFHA 3BUVA 3KP0A 4IP7A 5KEZA 3LTSA 5DMYA 3DFSA 2R1MA 1EDGA 2O0TA 3WSUA 1KTBA 3IJIA 3ZYZA 2X2YA 1IWBA 2TAAA 1ONXA 4BR1A 4IMCA 2RDXA 3MYPA 3C0JA 4H6EA 5CG7A 1VKFA 3QF0A 2RH9A 4C6NA 1S5WA 2PSNA 1JUKA 2PAJA 3M5YA 3BK0A 1P0BA 1PJ9A 2PDPA 3E2SA 2BNJA 3OZOA 1X8CA 2OZ3A 4PMYA 1FDYA 3CIXA 4JIHA 4NHVA 4DWSC 3O1NA 1QMLA 3MWCA 5KINA 1P7TB 2HK1A 2BASA 4RX0A 3SCQA 4S3FA 3P60A 4LBRA 5A6AA 1JZ2A 1T99A 5AVHA 4LUSA 3TJXA 2XYLA 4CU8A 1FXQA 4Z2KA 4DELA 1WCGA 2POZA 3BMWA 2PODA 1W2VA 4TX8A 3SQLA 4AX7A 1UPPA 3APTA 1VBGA 3BXWA 1LL4A 1B3YA 3NSMA 1FKWA 1OFQA 2VDGA 4TO8A 4NJKA 4O11A 3AIVA 3P5YA 1GCYA 4WGHA 4Z42C 1D7FA 1X1NA 5K9XA 2D2HA 5XINA 1SW3A 2G97A 2V81A 2WMHA 3WUGA 4H00A 2IKIA 1EH9A 2F61A 5FJIA 2HJPA 3WDRA 1H5YA 1OBAA 1CX9A 3T0TA 3MP4A 4C5YA 4UZUA 1H7PA 2YYUA 3GTNA 3RG6A 3NQVA 1AA1B 1H61A 1PZ3A 2D23A 3CQJA 3IUDA 1RH9A 3LMZA 1EDTA 4ZE4A 2Y1HA 1TFVA 1M7XA 3T44A 1KBJA 1EFZA 3CZGA 4AD3A 5FF2A 1QTWA 3UG4A 4GYJA 1EUAA 2OZ8A 2Y61A 1V3JA 4HU8A 4A3UA 1NOWA 2G4JA 1G4TA 4QQUA 3LPFA 3F4NA 4L9YA 3IJLA 1FWWA 5TD4A 3EWXA 3SJNA 1QK0A 4F0LA 2OYMA 1ZJBA 2NVAA 5EU9A 3FLUA 4CQ8A 1ITQA 1XG3A 2JQXA 1R0MA 3CWNA 4IGSA 3RNDA 5G5IA 2BFGA 4B3KA 4MWAD 3NEHA 1U5VA 3D3AA 1PPIA 4ZOEA 4K7YA 3T9PA 4W7UA 2XVPA 1W1TA 1XV8A 3URBA 3SCSA 1AL8A 3T0AA 5BW6A 3CV6A 1GUVA 1DPMA 3RM9A 3VOCA 3VMNA 4RV3A 1X1ZA 4K6AA 1EBHA 1HKWA 2DORA 4W7VA 1QBBA 3QR3A 4D6HA 1UH4A 4PSPA 1VGAA 1RVKA 2PTDA 1ISWA 4D6GA 4JTHA 2GGJA 4JNMA 2HWGA 3PSVA 4YHEA 2Q6ZA 4LUYA 3DYPA 1LQ2A 4O1FA 3B40A 1UP3A 1HKIA 5FJPA 4U5IA 4CU7A 1FWAC 3HPAA 1H7RA 3UNTA 3L4TA 2FPTA 2Z6JA 3T0BA 3MS8A 4G6CA 1IEXA 2D2GA 4UNIA 1C29A 3NDZA 4GY1A 4OT7A 4OGZA 1CT5A 4UTTA 3GH7A 3RX2A 1RP9A 4MAZA 3MDUA 2ZIDA 1UJQA 2D20A 1OHLA 4WLCA 3UG5A 4IM4A 3IK4A 2NT1A 2WB5A 1XIGA 3TDFA 5I23A 5D9NA 5LA0A 1L0PA 1U83A 3XINA 1TJ0A 1XL9A 1K8CA 4IHCA 1FVPA 3PF3A 4B3LA 4GG9A 5A6KA 3KDNA 2J6VA 4J3VA 4L65A 3IRDA 1R38A 4HHHA 1XP3A 3SCUA 3STFA 4FEZA 4KFPA 1F5ZA 3W2UA 1KKOA 1KWKA 4LH8A 2ADAA 1JUBA 1NTHA 3HQOA 1VBUA 4RDWA 3ITTA 3IS4A 3U0HA 1DWFM 3LRLA 1WXZA 3CUJA 3MJYA 3FYPA 4P8XA 3GTIA 2QUVA 2QDGA 3MVTA 4N0RA 3EWUA 3N4EA 1W3KA 4PUEA 1QNSA 3LQGA 1A0DA 4Q4OA 4PUMA 3GXIA 3G1VA 3RX3A 3A13A 1YNYA 1LQ0A 1H49A 3EGJA 2V5JA 3V18A 3TJ4A 1GQLA 3G2GA 2MUCA 3ARPA 3KEHA 3MI3A 2C1HA 3S42A 3UZYA 3VIKA 3LLXA 3QR1A 1E51A 1WO2A 3Q58A 3UXKA 4ZXOA 3UESA 3DKLA 2J77A 2XUCA 3AIBA 4KWWA 1GNXA 4G56A 3RXZA 4H19A 1J5SA 3VNDA 2BOGX 1JZ7A 5I6SA 3EBVA 2DSWA 1I2RA 2GJNA 3ALFA 3B9AA 3IIZA 2VZVA 1B9ZA 4BK9A 5D2VA 3OIHA 3H70A 4JL2A 4QG6A 4HGXA 4MWAC 1IGWA 1J4EA 1GTHA 2WNZA 1Q85A 3K8LA 4YWSA 2DZPA 2DZBA 3IIPA 5D2XA 1RPXA 1BKSA 3G1AA 2PLCA 3KFTA 1OCBA 2PWFA 1HFBA 1ZUAX 1GVYA 4TOQA 2EG8A 4GYPA 2PWVA 1E0TA 5KITA 2YX0A 2R24A 3TYUA 3AXHA 4WDTA 3VUSA 4UMAA 4RZBA 1KR0A 4EPBC 2BGQA 1VYSX 3HPXA 1QPRA 3QFEA 4IX0A 1S5NA 3O6CA 4NYUA 3TYZA 3S1GA 5C7VA 3GO2A 3E49A 1BLIA 2Z0IA 3F2BA 2FTPA 2YYTA 2PTYA 4HTYA 4MGGA 4PMDA 5HUPA 5E0CA 2XM2A 4LOCA 4B3ZA 3ME3A 5CC7A 1WDPA 2QUUA 2E6DA 4IPPA 3IACA 3WLOA 1GGOA 4D6EA 1GVIA 4QLLA 5JVLA 4UNKA 2WHMA 3VGGA 3GG7A 2DIEA 4YCOA 3QQ1A 3GZAA 5I79A 2V3DA 2V3EA 2PMQA 2EKGA 2D73A 1HT6A 5MHBA 3BJFA 1UUOA 2CZEA 1GKRA 4MIMA 1HKKA 3M5ZA 4WSKA 1RPKA 3GVRA 3BOLA 4Q4PA 5HMDA 1H1YA 1OX4B 1TJ1A 1TPB1 4D71A 1TSIA 4Y9NA 1XFBA 5HPOA 1EF2A 1JI2A 3U7VA 3GNOA 4E3TA 2PZ0A 1A5KC 2ZUTA 2OQYA 3N9KA 2C1GA 4HTBA 1L8PA 1QI3A 3W4RA 3GDTA 4H8UA 3W7DA 3H2CA 1F8MA 4REQB 3E9AA 1N82A 4D72A 2AAMA 4GQRA 4AH7A 3SB0A 3W7IA 1Q66A 2J9ZA 1GG0A 4LY8A 3P8IA 5BU6A 2FIQA 4H4IA 3W74A 4ADUA 2NQ9A 1U22A 2GFTA 3ECQA 5BRQA 1SR0A 2QS8A 5FI8A 1SMAA 4KEUA 3EKLA 3G1XA 5HNNA 3TJLA 1ISZA 1JCYA 1SFSA 1EDQA 4DAIA 5FCZA 2A7NA 1EO5A 1PKNA 2WW5A 2CZ5A 3L0NA 1JPMA 4JGDA 3RLHA 3HF3A 4ICNA 3G22A 2OMAA 5DANA 2P88A 4FALA 1XGEA 2DIKA 1ZTVA 2QJGA 3VOFA 2J25A 3S9YA 3E0IA 1TWDA 4MPKA 1W5MA 2EQDA 4JIQA 1Z9AA 1E5NA 4RK8A 2FGZA 2VEMA 1UROA 1G4PA 4ML9A 4YVXA 2OO6A 1P0KA 2J78A 1HJQA 3WH6A 1IF2A 3AWNA 1OFOA 4N02A 5EMYA 1HJXA 3LU2A 4B92A 4GRSA 4Y8FA 3DBPA 3BL3A 4K36A 4UQDA 3T09A 2F84A 4WEVX 1G1YA 2BGNE 3SCRA 2OEJA 2VEFA 3KZPA 3MBDA 4J7RA 2CHRA 2W6RA 4DYJA 1YX1A 3QLDA 1EGZA 3PNZA 2EPKX 3UCCA 1VJIA 3OLDA 1AH0A 1KFBA 2D22A 1TZ7A 1VIZA 2BOFX 4QJ3B 3BGAA 1S38A 5FESA 3R11A 1UA3A 1A5NC 2BZNA 5MKGB 2YDRA 4XZWA 3LCFA 2FDMA 2BTMA 4U31A 4NX0A 4I90A 1ITCA 4GI9A 5IHSA 3FA4A 3NXFA 5HMFA 3T7VA 5FJRA 3CBWA 3HGRA 1FP9A 1GHRA 4PMJA 4XSMA 3TVAA 1Z69A 2IPJA 2OTDA 4XUYA 1DXFA 2W9MA 1S1RA 1U1UA 1XYCA 1AW1A 5CGTA 1VRDA 3A22A 1Y5WA 3HOJA 3FYOA 5FD0A 2VCBA 3DFPA 3ITOA 1TV3A 3EX2A 1UC4A 2Y5EA 3E6EA 3TAOA 1QW9A 2XGZA 3SFKA 1ZRQA 1SJCA 3MA8A 3WQVA 4F9JA 1E4IA 1NSJA 2TYSA 3AC0A 1JIBA 3HPZA 3N3TA 1LWIA 4JTKA 1YE6A 3P82A 4AIUA 2WKLA 3W2NA 2I7GA 2WCAA 5CJ5A 3WNLA 3BOXA 2A0NA 5DELA 3CUGA 2Y85A 1K4GA 3N2XA 2E0PA 1QXLA 4GUHA 4YTSA 2DVXA 4JHOA 3N2CA 2PA6A 3NL6A 4AZCA 1OVDA 3DKJA 4GYFA 3C6CA 1T5AA 4OUEA 4X0VA 3VGEA 4UTUA 1OCQA 2CLOA 2CU0A 1E9ZB 1DJZA 1OFBA 3CQHA 4PSRA 4QROA 4N9EA 3GKFA 4HPJA 3SCWA 2BOEX 3KHDA 3CTTA 2GJXA 3QRHA 2WC7A 3I6TA 4DO4A 3GUWA 1RY0A 2TODA 4KRUA 2VZSA 5H91A 3GIYA 2CBVA 2ISDA 2ZX5A 4RW5A 5A1AA 3UXIA 2B7PA 4CD6A 3MZNA 4IX2A 4J3TA 4WKAA 5AC6A 1D9EA 8TIMA 3AXXA 1PAMA 3PPGA 3CZLA 3M5XA 2FMOA 3UBPC 2YXOA 4BY3A 4ZSTA 1GQIA 3IAQA 3EWCA 3G0SA 4O8AA 1Q8AA 4JN7A 4PH6A 3EXSA 2XVNA 2QUTA 3URQA 1BYAA 1OG6A 4ES4A 3VOIA 3O16A 2WJDA 4O15A 4OJYA 4JR5A 4HU3A 3VDHA 5B80A 3LHZA 3NZQA 2DJXA 2D3LA 5H8PA 3GDMA 5I3IA 3O05A 1I75A 5D8WA 4CGTA 2WMJA 4K1WA 4RZ6A 1ZJHA 4UTMA 4N4PA 4C6FA 1EQPA 4LAUA 3I3EA 3FK4A 2ZWYA 4IMAA 3N2BA 1J6OA 1WV2A 1TPC1 4FNPA 3V36A 3XIMA 2ZRUA 1UD2A 2GUBA 3M07A 1AQHA 4JFWA 4JTSA 4MB4A 4YTQA 2PRLA 3IGUA 1OSEA 1PIGA 4UIOA 1IXQA 2OELA 4DRSA 5HQLA 2X2GA 3NM1A 5CC5A 4LC6A 2FKPA 2J7HA 2Z7KA 3T81A 3TN4A 2JF7A 3GG0A 3N29A 4JN6A 3KWXA 1F3WA 2YBTA 4P2VA 5REQA 3T40A 4ERIA 2VO5A 4KT2A 4EX4A 4AEEA 2ZE3A 3CQ0A 1MNSA 4AVNA 1VBJA 4PL2A 3GAKA 3QW4B 1R3WA 1T6MA 2XIMA 1GOMA 2IQDA 3GKAA 4L9ZA 1PKLA 1FUYA 4QHRA 1FA2A 6ALDA 1ZBVA 5I3FA 3OGSA 2WHJA 4S3JA 1EZ2A 2WCSA 1HJUA 3PNUA 2F6XA 1TE1A 4JQ4A 4PCNA 1YDOA 4O50A 4JN8A 3A4JA 3PJXA 1BG9A 3EA1A 1R3VA 4W85A 3VE9A 2FVKA 2PWDA 2XSAA 3T0DA 1UASA 1C92A 4ALDA 3ES8A 3VK5A 5EMUA 2FZNA 3ZR5A 3LSBA 1OEPA 4GO9A 2ISSA 1LUCA 4C5ZA 3DFHA 2E9BA 1DQUA 2GSEA 2TPSA 1JCTA 5D2TA 5IFTA 4K3ZA 4RNJA 4TXEA 1CGUA 2XH0A 5IXEA 2VR4A 1H0GA 4PUDA 3C2RA 4GIEA 4OOZA 3S5SA 3C61A 4ZODA 1J8VA 1E6QM 2B7OA 3K46A 3D0CA 5DXXA 3AJ7A 4LEFA 3WJZA 3R25A 3RIKA 1AK5A 4G1NA 1IWAA 1QOXA 2WKJA 3ABOA 2AOSA 2W92A 1MEHA 1E15A 1I1XA 3WELA 3S6TA 2X1TA 1UC5A 2W0UA 2GYIA 4AISA 1NVMA 1Y5XA 5FAJA 4ZVJA 3HV9A 1XH1A 5CPQA 1IEVA 4AIEA 1UYQA 3WEMA 4PTNA 1KO0A 1QFEA 3WL0A 1XLCA 3H4WA 1KXQA 2YA0A 2GVEA 2Y88A 3ATYA 3WNMA 3VIGA 4O54A 1GVQA 3GNXA 4H9VA 2OODA 3UA3A 2QCNA 1PTDA 1P6WA 1Q4WA 5I06A 1KRCC 4UTKA 5C9XA 5T9CE 2X0HA 2VEIA 1VLIA 1CCWB 1RA5A 4GJJA 3ABQA 3KS5A 3OVGA 4Q8UA 3GRIA 2A5HA 3T8LA 4AD0A 4XZLX 2UV8G 3TMQA 5EMLA 1J18A 5A6TC 2A3CA 2V6AA 3T05A 4M6PA 3M16A 3S5YA 2P10A 3AS2A 5BMXA 1MQQA 4WY0F 2QJHA 2WYSA 1IEQA 1EP2A 3S2JA 5FJUA 5LNVA 2WSYA 2J74A 4KIEA 1JVNA 1H7OA 5FJTA 3WQEA 1F6KA 2QXWA 3FJNA 4KERA 1VD6A 5DMNA 2GVJA 4Q3MA 1OFAA 1BHGA 1HJSA 3WQWA 2Y8KA 2JFEX 4XIMA 1FDZA 2EAWA 2DFAA 3CL6A 1XIJA 3TROA 2WMGA 2PDCA 1ITUA 4RE4A 1I60A 1Z89A 3W81A 1W9BM 4AD2A 1GPFA 1X98A 1UKSA 2UY5A 2VZOA 3GSMA 3L2LA 4BWLC 3VIPA 3GX9A 1E6RA 4CD5A 3W7MA 4TR9A 3TKFA 2A7RA 4H2CA 3GVVA 2WPBA 2YGYA 1XIHA 2PDGA 2DUAA 1NWTA 3F7JA 1O6IA 1VFOA 3CJPA 3ZQ9A 3NYZA 1V7YA 4FR1A 5G1MA 1XI3A 2TSYA 3N3MA 2QCEA 3UR7A 3W27A 3QHNA 3W24A 3H53A 4M3PA 1W37A 4AZHA 1UA7A 3O15A 1BFNA 3UQNA 1AJ2A 3ARRA 1EPVA 2ZTJA 9XIMA 4U2ZA 3NM3A 1WQ5A 1RAKA 1RD5A 4DF1A 3TQ0A 4HZ8A 2G0WA 4I9TA 3W1TA 1C8VA 3WDHA 1QOQA 5EFDA 4DI9A 2C0AA 1GVRA 1Q3NA 3OYXA 4Z0JA 2E6YA 2XWDA 3NL5A 3BG3A 3B8VA 4EXQA 2QMJA 1BXBA 3BCDA 2PGFA 2CEQA 2WNQA 4B16A 4XZHA 3IRSA 3H22A 1NELA 3KOFA 3ZR6A 1LL6A 3T08A 2Y5JA 2VC5A 3TQKA 3NA8A 2ZA2A 1QBAA 1OFPA 2BY3A 3N6QA 1TPWA 2CLLA 4L6HA 2Z1SA 2OGJA 3CAQA 4OQVA 1SUXA 1TVLA 1H62A 5FOOA 2BHZA 5LIKX 4YTTA 2X09A 1QAPA 1IXOA 2FZDA 4GINA 2J24A 3CUZA 3TTQA 4P7RA 1JEZA 3VMPA 3BJSA 4OFCA 2NLIA 3B9NA 2FHFA 1HN1A 5A6BD 1JQXA 2VEGA 1IIHA 1XYAA 2PWHA 3BO9A 5H8UA 4K39A 3FKKA 4PFMA 1GOIA 3HJEA 1WDDA 3UJEA 1MSSA 3QMSA 2V69A 1HZYA 3WK3A 4C6PA 4HA3A 4S39A 2OJPA 4NJIA 5B7ZA 5DCBA 2GLKA 3OG3A 4LAOA 3NOEA 4IG2B 3SUSA 1YTKA 5EA9A 4KCTA 2ZXDA 2BVYA 4TUFA 3A9IA 4Q6XA 5IBXA 1ZAJA 4ACZA 1XLBA 4RNIA 1MUCA 3K1GA 2FFIA 3PZQA 3YPIA 4Y9MA 4C6BA 2KZHA 2VCCA 3CT7A 2OKTA 1DV7A 3OPSA 4H01A 2J8FA 4MB1A 1E0UA 2HCVA 1YNQA 1I9CB 1XKJA 3KLLA 3CV2A 5I3JA 3GC5A 3I68A 2EPNA 1R5YA 1I0DA 3V4BA 3T2OA 2QZRA 2DSZA 3BLPX 3CWHA 3P93A 1XLHA 4OIFA 4JNYA 1XYLA 3UCDA 3VX0A 3SEPA 2DQXA 4JTCA 3OOQA 1M68A 5T9BG 2QCMA 3D46A 3MHGA 1LORA 4WIWA 4JY9A 3OHMB 1LYXA 3VM5A 4HNNA 1EC8A 4KS0A 2DEPA 1A5OC 1LP6A 3GYEA 3H23A 1JNEA 1MZHA 2PP1A 3UXLA 4GCAA 2IMRA 2HISA 3OJGA 4E38A 4RW3A 3CMJA 4UR9A 4D8AA 2IQTA 3E3HA 5DCEA 2XIOA 4BI6A 4RNHA 1SZRA 1I8JA 4HPNA 1S1PA 2DZXA 4BZYA 1P5BA 1WUEA 4GO8A 1EWDA 2MANA 2WMKA 1TB3A 3D6NA 2ACSA 3ZJ7A 4GCXA 3BLIA 3LHTA 4NZ1A 3ZLFA 2Z24A 3LX9A 1D7KA 5GNZA 4ONVA 3VOGA 3NG3A 1ZLPA 1UWTA 2HBVA 3NQAA 3EMQA 3DU0A 2CFFA 3W1PA 3CTLA 4DUVA 1RY8A 3W02A 3LY0A 1NP2A 4GH1A 3FHQA 5TBOA 3THDA 3KLKA 4K2SA 4FIQA 4XBJA 4RUBA 5ECVA 5CSRA 1JAKA 3WD2A 3GC4A 2Q8LA 5TNVA 1JJKA 1CB7B 3QBUA 4TX6A 4L1XA 4DM1A 2BV9A 3OLIA 3R5EA 3PP7A 3ZLHA 3IEBA 2O4QA 1B0IA 4QSHA 1WKFA 4DLMA 4FLSA 3SADA 1R3SA 1XQKA 4HJFA 3RO8A 1UD6A 3R6IA 4PB4A 2CPUA 1KM2A 1P43A 1J10A 3SN4A 4E8GA 4WCJA 4EPKA 5JQ9A 5I07A 3DHFA 2PDYA 1QNPA 1OF6A 3TSMA 1V02E 3UU0A 4IGNA 1B90A 2Y7FA 3KRZA 2VRKA 1UHVA 4NIRA 4EWJA 2EHHA 2GUYA 4KW2A 2C19A 4EOUA 5HANA 2NV1A 2YCLA 2BGSA 5EYWA 1O12A 4AD4A 1IGSA 3S5OA 3BWWA 1XPGA 3LBCA 3MUIA 3PUOA 2V67A 3VILA 4A3RA 2CLKA 2XJ7A 4R85A 1Q6OA 4KBXA 3T2PA 3CUIA 3VCNA 1SO4A 3NZPA 5D33A 4WQ6A 4IH3A 3QYQA 1ML1A 4Y9PA 3GR4A 4ADSA 1VHNA 4QQ3A 3L2IA 3MKVA 1YBQB 1T41A 3GG8A 3NURA 4I6KA 2EJ1A 2JGYA 5A2AA 3R0UA 4XZMX 1JCLA 1XRSA 4X2RA 2BDQA 3IJ6A 4GISA 3G8EA 3AAMA 3P80A 4POCA 4Q6JA 3LGGA 2IXUA 4D6FA 1OD0A 4C6EA 1BQCA 3HV8A 1VAHA 1V03A 3WK0A 2YBUA 3KW3A 4Q8TA 4AZIA 2ZXQA 1WNOA 3FDGA 2A6LA 2YJQA 1BSIA 3PC0A 1RA0A 4KCUA 4JFUA 4QGCA 2OFJA 2R8WA 3W83A 3DENA 5CBBA 3H8AA 1ME9A 5I03A 4DY1A 4CKQA 5GJMA 4O28A 3M5VA 3PM6A 1RJQA 2J8TA 1UPMB 2NWSA 4BS0A 2XVLA 1ZFJA 8XIAA 5HJYA 3TOPA 3FY1A 2CZDA 3ZFHA 1O5RA 4YMZA 2J8GA 5M5DA 4FXSA 2G5WA 4C90A 1M1BA 3QGKC 3TAKA 1KD0A 3GE7A 1GVOA 3W7NA 5E9AA 1N55A 4LUSB 1ODZA 4GIYA 3UNDA 4GWEA 3L4VA 1K8YA 3N12A 1K8ZA 4XD5A 4H04A 3BW4A 1KM6A 4DJFA 1UZDA 3DG6A 5DFAA 1FWHC 3N9SA 1BRLA 4O0ZA 3A64A 3R4IA 4JQ3A 3CB3A 3MDWA 3OVQA 4M0XA 3K8MA 2EJAA 3ARUA 1Q6DA 3M0JA 4Y90A 1YMYA 3ZO9A 3ZWSA 1DWAM 1Q6LA 3OZPA 4H41A 5FACA 3P2VA 2UZ9A 4JPGA 3WJSA 3PVFA 3W29A 4C6LA 4HMCA 3LPPA 3R8RA 4QP0A 1R3YA 2BHYA 4MKVA 5BNKA 3EA2A 1H63A 4NP7A 3A4WA 3MI2A 5KTLA 1V7AA 1VJSA 1BSLA 2WJEA 1LWHA 4XAFA 4YHGA 5CBIA 4B91A 4AXNA 2Z1BA 1FRBA 3MMTA 1BPLB 2JF6A 3W70A 2DU2A 3UZ5A 2QCGA 3B05A 4AWSA 4A8NA 1QU4A 4H9XA 3EWDA 3SY8A 2BXVA 2XFRA 3JR2A 3F4CA 1TG7A 1IZCA 3C52A 1KM4A 3WBXA 1UR4A 3OQEA 4JTIA 2Y24A 3WDQA 3G1FA 3FEQA 3G77A 4DQWA 3LRKA 3QGAC 3CZ8A 3DOPA 4LVGA 4DVOA 3U8GA 3ZOAA 2ZWZA 2NX9A 4J3UA 4UQEA 4OUIA 3MUCA 1VZWA 1A80A 5D37A 3UJ2A 7PTDA 5C9UA 4M6VA 4OWGA 1FH9A 4NJHA 3VVGA 1UKQA 3IGXA 5I2UA 3PB0A 3KVJA 4DJEA 1TREA 1QWKA 3W7JA 1J0ZA 3AS0A 2AMGA 3TN5A 4BEQA 4P7LA 5FEZA 4MF4A 4QE1A 1MVYA 1XM3A 1REQA 1EJUC 3GIQA 1DVJA 1LTDA 1UD3A 2JEQA 2Y89A 3OVRA 4BFAA 1AQFA 3CUXA 3NIYA 4GNVA 3K2GA 3QV6A 3WX7A 4XX6A 1Q7ZA 2VTFA 2A7PA 5I09A 1W9XA 4C1LA 1E6ZA 4NYYA 1JF6A 4X61A 1AFSA 4H8HA 1TA3A 1ZAIA 3AQUA 4HOXA 2VFEA 2WVSA 4PA8A 2Y6ZA 3TU9A 2FTWA 3BPWA 1EGVA 4PODA 3LHWA 1KBIA 2YZ5A 4WOZA 5JMUA 3MKCA 4IP5A 1UG6A 5BCAA 2VDHA 3EDDA 5K4XA 2DSKA 4HB7A 2VR5A 1XDJA 1S46A 5HNUA 1EB3A 3QYSA 1EGMA 4JTUA 4W8BA 4EF8A 2QIIA 2PE4A 1ZL1A 4LALA 1BEUA 3L4YA 1E43A 2VRJA 1CGXA 3PFRA 1ZAHA 4L80A 3WDPP 4DN1A 1MQPA 3NPXA 3DHUA 1MI3A 3QKEA 3W7HA 2QV4A 4WOQA 2DH2A 3LTPA 1AH4A 2BY2A 4AWTA 1F9CA 3OBKA 4W87A 1S5VA 4TV5A 2B7NA 1R3QA 1DTNA 2PTWA 3ABZA 1EP3A 3H2FA 4LS0A 4DF2A 4HCHA 3ZJ6A 1YRRA 1S3TC 5LGXA 1GZGA 1SPQA 3E38A 4QX4A 1B4KA 1HF6A 1TZZA 4INFA 4R7JA 3RJXA 4D1IA 2Z00A 3MCOA 3CMFA 3MP3A 4D6DA 2JKPA 4ZQCA 3UW6A 1KCZA 3GHRA 3CL7A 3ZWTA 4Z1BA 3UR2A 2BLEA 1G69A 2OLHA 1TWWA 2UY4A 2X16A 1KRMA 3CC1A 1VBRA 3LCGA 4IL0A 3B8UA 1VPXA 4R7WA 4NAEB 1JR1A 4TU1A 4IF2A 4PMQA 4IMFA 3BAJA 1UR8A 3M6DA 4LRTA 2ICSA 3D47A 2NXHA 2Z1WA 2VNCA 4NU7A 4JDBA 1UD5A 5BOOA 1BTCA 2I17A 3VNMA 2JK2A 1A3WA 1VBHA 3CQIA 1KBBA 5D04C 3COTA 4NXSA 4Z2GA 2VZUA 5E6ZA 1T8QA 4GI6A 1AD4A 2WLYA 1V6XA 3ZZ1A 1WDSA 3STCA 2W63A 3RCYA 3BJTA 3BW2A 4F9DA 3H12A 2BY1A 2O7SA 2Z7GA 1UWUA 3W22A 3TTYA 4UFIA 1U33A 3M9YA 4LUIA 5AYZA 4AC7C 2I9EA 4AF0A 1VFTA 3CHVA 1XIFA 1DIDA 1IE7C 2FB3A 3ITXA 1E6NA 3CMGA 1TCMA 3S1XA 4PMNA 2HVNA 1PDZA 2XIIA 2DSUA 3VMOA 2PLJA 3VKKA 1QI2A 3QTGA 1OCNA 3ARVA 1V6YA 1HKJA 2QJNA 1KRAC 1CPUA 3R13A 1M9HA 2C0HA 1SSDA 3JZUA 3W1QA 1P4CA 4LY4A 2VGBA 3T4CA 3TN6A 2QULA 3G0XA 4GUGA 4Y9OA 4MLJA 4DUXA 4PZVA 1TV8A 2DT1A 3TTEA 3QV8A 3CPRA 3E0FA 3EEZA 1EIXA 2FZ8A 1VQTA 4IMEA 3F5KA 4E4FA 4PUKA 1XGDA 4IMGA 2OWXA 4BQ2A 4MYXA 3RM4A 4U3CA 3AMGA 2ZUUA 3POHA 4W8AA 4ZEPA 4LSBA 4OKDA 2J7BA 2PBOA 4MZYA 1PHQA 2A3LA 2WZIA 3K4WA 3C2VA 3RO6A 5D8ZA 4OZOA 3EDFA 7ODCA 3FAWA 1C8QA 4YCPA 4L4LA 1MRAA 3VCRA 4C7DA 2FH6A 2E77A 3AYRA 3PBGA 1FHLA 4QEEA 1A5CA 4XD3A 2VXNA 2PF0A 4UMBA 5IOBA 3SRHA 1B31A 5LXEA 1BVWA 1EA9C 1GVEA 4UTWA 1OFRA 4EIVA 1HG3A 5DEZA 2PDUA 1JNDA 2WBKA 4K68A 4GC4A 1R7OA 4YNGA 3GXPA 4W7WA 3LB0A 3HA1A 1DL3A 4V28A 3AHTA 3BSGA 3EYPA 4HBKA 3MHUA 1CDGA 3W6LA 4GZ7A 3MSDA 4AMAA 5HR7A 2WJFA 2Z1VA 4P61A 1Q7MA 1CLVA 3K5XA 2FFCA 3ZSTA 3SM0A 3SDOA 2PGWA 3BLOA 3BW3A 4LUTA 4MY8A 4S3KA 3WD1A 3WBEA 1H1ZA 4NZCA 4ML4A 2QHAA 1CXEA 5C5YA 1CENA 4UTIA 6ENLA 1TV4A 5C9RA 5CPTA 3WFAA 4UMCA 1E1EA 1QHZA 1IIGA 2WC4A 3O8AA 4AAJA 1K9FA 3MCNA 3MO4A 1GQNA 1XBVA 4NZFA 4P7NA 3RFAA 3F2CA 3TP4A 1OQFA 1W3IA 5CXPA 6TAAA 1F3TA 5LNSA 4LNYA 4PMXA 1FFQA 2Y0FA 5ABGA 4N9DA 2DZUA 4PFHA 3B9DA 1W1YA 3NSXA 1W31A 2VC7A 4XTDA 4NVTA 2W4XA 5AY7A 2VL4A 4QS5A 1J12A 3N1AA 1J0YA 4Z08A 4L4OA 5A6LA 2WWCA 1V93A 3SCOA 1O4UA 3MC5A 2A2IA 5DBUA 1V02A 3EPNA 4W5UA 4GBDA 4LV9A 3M6YA 2BVDA 1H60A 4O1BA 3TWBA 2HK0A 4LVDA 2C14A 1SQ7A 1A47A 4ZQOA 1NQ6A 5ABEA 4DYKA 2DQWA 1ONWA 3NOYA 1SZNA 1NFBA 3CWOX 3PN8A 3MMDA 2PDXA 1V3KA 4O53A 4KF1A 1L6GA 2CZVA 1WPCA 3RPTA 3PG9A 3VKCA 3NR0A 2BODX 1XRVA 1KM1A 3L68A 2E8ZA 4UNLA 3RU6A 1GJPA 1TVPA 5D9MA 1ME7A 1I2OA 2GVYA 4U3AA 2CESA 3ZT5A 3I4EA 2OT0A 4WJEA 1XPYA 3PZIA 4U33A 3S2LA 1KGUA 4OU1A 2GGHA 3LNPA 3OP2A 3WF2A 3AS3A 5KZDA 3DAQA 3SCPA 1W17A 5CSYA 3MPGA 3VDGA 5A6MA 5LIUX 2B0MA 3UY7A 3E74A 1JCXA 5LIXX 4AZCB 3PUGA 1DOSA 5KETA 4MYAA 5M2FX 3GNDA 1RK5A 5ABTA 1SJBA 1C3FA 2QV5A 3V1HA 1A0EA 1LM1A 1VF8A 1Z41A 1PX8A 3CB8A 4LPCA 1E72M 4UOJA 1JZ4A 2PZNA 2DVTA 2GJXB 5CZJA 1IZKA 3W53A 4XD6A 3CK5A 1P7TA 4HNVA 2FZBA 3ANUA 5EMJA 1P1MA 3WQCA 4DUOA 5CJNA 1DJGA 1WBJA 2CYGA 3ALGA 3AHXA 4NZ5A 2WPGA 1IT0A 3WQFA 1CXHA 1NIUA 5CZ0A 5RUBA 4HCDA 2WVTA 2AL1A 4F2TA 2YXXA 5EMKA 4AIOA 4LV4A 1QASA 4GYPC 8CGTA 1S5MA 1RQEA 3QY6A 1JRCA 4NG3A 2G3NA 3C2FA 5EL1A 5G2IA 2PDLA 3H2OA 2ON3A 4LC8A 4J40A 4DBWA 1XYMA 1PCWA 5AYBA 1IT7A 4B2DD 1W9UA 2IPGA 3P7YA 2Y70A 1GPWA 1E9YB 1S3HA 1XD0A 1PSCA 4HT3A 3QFWA 3FSUA 2GDUA 4N6EA 4G9PA 1LF1A 4ZCWA 3K13A 2O4MA 1B2YA 1TQJA 4HNTA 3W38A 4WSJA 3NFUA 3PWGA 2VC6A 3AZTA 2DUXA 4GOAA 3APGA 3DERA 2H3BA 3F5JA 3VI2A 3W23A 3OLEA 3B04A 3L0KA 3MMUA 3CH0A 4LAMA 1V0LA 3EZ4A 2W91A 3AIEA 5KMYA 1B5TA 5E70A 3W1XA 4GY7A 4KWSA 1X38A 1KM0A 1UJPA 5MF5A 1B3VA 2V9DA 1KFJA 3M0IA 3FJLA 2OYLA 1QNQA 2PFHA 3CIWA 3PUEA 4HIBA 3LZ3A 4KFNA 1OCJA 3AFBA 1TJ2A 3NZ1A 4XVEA 1JPKA 3CNYA 4X3ZA 1JZ5A 1QATA 4UC5A 4XAYA 5REQB 3EWWA 4FXRA 1IXNA 3JW7A 1R47A 3AIWA 4I6VA 3UERA 4CVUA 3PS7A 2P5NA 1MQRA 3KBNA 4FZIA 4WGXA 1TKKA 3C0QA 1GKQA 3L4WA 4R88A 4JS3A 3U5UA 2QDDA 3SW6A 3M0HA 1MEWA 3I7QA 3MSGA 3EKZA 3PPCA 4UFMA 3EXTA 1K9EA 3DECA 5XIAA 1ISYA 2WCGA 4BI5A 1E4MM 1CXIA 3W9ZA 3N11A 1Q5MA 2FHBA 4JD4A 4B5WA 5BMWA 2FVLA 2CETA 2F6KA 4XIAA 1EF3A 1J9YA 2AKMA 3APYA 3MUZ1 3IANA 3UPBA 2A3BA 4G7EB 3TFCA 1W3NA 3WLPA 1R2RA 2R1LA 1MNZA 4BQ3A 2PDFA 2YDAA 3LN3A 4PUJA 3HPFA 2ZCGA 3SECA 1JG9A 1M7OA 4HVXA 2ZRZA 4DNHA 4WR3A 5FF4A 4EWND 3CS2A 3DFOA 1H7WA 3EX4A 4CNOA 1X6NA 3LV5A 4C91A 3TWAA 4GD0A 4RZ5A 2OG9A 3WLLA 4L4MA 4IQDA 3ITVA 3TR2A 1WOAA 4PUWA 3UR5A 1ZBWA 4GXWA 3LPOA 3G3DA 2ZUMA 1JFHA 1KCXA 1MRQA 5AOUA 1HTIA 1PTAA 4GI4A 1BF6A 5AHNA 3UZWA 3U48A 3KX6A 3WF0A 4UQCA 3W3OA 1GZJA 2ZVRA 4OV9A 4H6RA 4F0HA 2XVGA 4LU0A 3QHOA 4J3SA 6CGTA 1SGJA 1JF5A 5CZTA 2Q09A 3HFTA 2ZUNA 4RKAA 3GW3A 1U5HA 4M7SA 3S47A 4A2RA 3NYDA 1PZ0A 2C16A 2WSPA 2NVCA 3WK1A 2PU1A 5HK4A 4LRSA 2VM8A 1O1ZA 1QO5A 1LT8A 4D6IA 1LLZA 4TMBA 3WJYA 3VOHA 5D9OA 1ALDA 3BDKA 4NRRA 1V6VA 4MFDA 1NFGA 1TR9A 3VIIA 4NQ1A 4OECA 1Q2RA 3S8HA 2P76A 1NAL1 4Y2WA 3UY8A 3UVIA 2WQPA 4Q8PA 2RKXA 4JHMA 4X60A 4GZIA 1YDNA 4FXFA 1FWRA 3GNPA 5EB8A 2GSHA 4OHQA 2XVKA 1ZU8A 4S2BA 3QSRA 3AMCA 5CPSA 1YTEA 3LLDA 2ZC8A 3W87A 2GDQA 3TV8A 2ZTKA 4NSBA 4F66A 5K3VA 4S2CA 2YXGA 4JFVA 2O9PA 2E8YA 2CLEA 3TX9A 2RFGA 5FAGA 1O68A 3JZEA 4JYDA 3GYCA 2XDFA 1DJYA 1L6SA 1SJAA 3FDKA 3CM4A 1TPDA 4IJRA 2NXIA 3UF9A 3A3XA 4UQ9A 1A53A 1W6TA 1R6WA 3WIJA 3UZJA 3QV9A 3G6MA 1TQXA 2XZ7A 3AISA 3MI6A 3UD6A 4R33A 4MY9A 5LXXA 6REQA 3LCHA 1LRTA 3MZ2A 2E67A 3AMDA 2ACQA 2OO0A 2E1DA 3PZVA 5IRPA 2HROA 3TMLA 2DZSA 4IISA 4JOMA 3KBSA 4PBGA 2D2OA 2WOQA 2QPUA 4H8VA 3W73A 2PF8A 4ASTA 3CQKA 3EWZA 1XCFA 5AHFA 5F1VA 2DZTA 1HW6A 2YDQA 1B3ZA 4GZEA 2CLMA 4IQEA 3ORWA 3GFYA 1W3LA 1NP0A 5D05A 3L12A 2PDJA 1JDEA 1OX4A 2WMIB 1IHIA 1K70A 3BLEA 3LPGA 3ERPA 1OINA 1L2UA 2F6UA 2G41A 1OGGA 4A22A 3RCMA 1V3LA 1V6WA 3V0TA 3ANYA 4PTMA 3DUGA 1GT8A 3M7SA 3H4GA 2AAAA 1NARA 4US6A 2NUWA 4NJJA 2FGLA 5T8GA 3LXCA 3N2MA 2Q8XA 1TO3A 4U5KA 7CGTA 3TW6A 1M7PA 2OCZA 2Y7EA 3N6HA 4JNZA 1BQGA 4GK8A 1KV8A 3L4XA 1G5AA 3HURA 5E93A 2LLEA 5FF0A 1JPHA 3SN0A 1R85A 5K9CA 3A21A 1GJWA 3P0WA 1NF7A 3GUGA 4FOJA 3PTKA 3O6DA 1KV5A 1YPFA 4MOZA 2CLIA 1H0IA 2WJZA 1GQJA 4FX7A 4QLKA 3P3BA 4PUNA 4TMCA 4OBRA 4DO7A 1MUMA 4NI3A 5AC5A 3LHUA 1H11A 4HHMA 1XWYA 2X0YA 3UGRA 3UWUA 4FP1A 3C2YA 4O0KA 1SR9A 4N42A 1T8XA 3W7PA 3BQ5A 3SQSA 5M3WA 1GONA 1XKYA 2VDIA 1F74A 4IJCA 3UWYA 2QCLA 4JXCA 4ZQRA 1ESWA 4C6JA 4MY1A 4KESA 3C2EA 3PANA 3UYCA 1OYCA 3B8DA 4GKLA 2HZGA 1E56A 4HSOA 4MTVA 3C3UA 1XCWA 4C6QA 3NTYA 4IFKA 4ZXLA 4DO5A 4WXYA 4A8IA 4K37A 3G6LA 3UFYA 1XXXA 1Y7VA 2E9MA 1PWLA 3R12A 3U6WA 4C6IA 2J13A 4E5TA 1WAWA 3G1HA 1B4EA 4RL3A 2IPFA 4MZ8A 5AC4A 3IK2A 4W93A 1XC6A 5GNYA 3F5LA 4JICA 4Q4MA 2YOCA 4MUZA 3OB8A 3CLWA 3TCEA 3KRBA 1AUSL 1LZOA 1IYXA 1ZHAA 1DKWA 1BD0A 1SZEA 3RRAA 3T6CA 4ACZB 2YCKX 3LLFA 3NVDA 3WLHA 1CW2A 2OOFA 5ABFB 4L4PA 4FNUA 1DWGM 5A8MA 1K6AA 1KCKA 2E5BA 3ZJKA 5LHEA 1EP1A 1J5TA 2FLIA 2E9LA 1AW2A 3KBMA 4HHLA 3IV3A 3BAIA 3EB2A 5HWJA 1Q6GA 3V1PA 2OR2A 3O3RA 3PUDA 4FPSA 3IGSA 4Y6GA 3GZ3A 3VYLA 1DIEA 2HS8A 1KFLA 1GOWA 4IUOA 2YW3A 3AYTA 1N2VA 3R58A 1ONRA 3LRMA 3KOWA 3IJDA 1TELA 2FYMA 3Q65A 1TX2A 1LBFA 4LB3A 3WBAA 4L6OA 1CGVA 3ES7A 5CPMA 1G94A 3VZXA 1F6PA 3UPWA 4MUPA 4PRTA 2JBMA 5I0DA 2GGIA 3BLKA 3M46A 4GX9A 4GKTA 3DGBA 1RBOB 1V3IA 1NOUA 4NAFB 1VFLA 2V5LA 3GVWA 1L2QA 5FKYA 4UFHA 3LS9A 2YFNA 1FH7A 5FA5A 3ZSSA 3HGSA 3KBVA 2X40A 4WSHA 3UJFA 4FNQA 2WNWA 2UY2A 3NQ6A 1L6WA 1ELSA 1I45A 3V7PA 5DO8A 3WNKA 2CHNA 4ZO9A 1ENUA 3S9IA 3TFXA 1D8CA 3BURA 2FB2A 1LT7A 2FH8A 4IGMA 1LBLA 4PTVA 1ITXA 4F8XA 4N4QA 4W89A 4LAKA 5H6HA 3DESA 1JULA 2VGGA 4YLWA 1VFMA 2X7VA 4QDWA 4PR4A 5C2CA 1I1WA 1ZS2A 3LENA 4JTLA 1S2TA 1I0BA 4HNCA 3LZ5A 2RGMA 1FOBA 3U7BA 4BWLA 3GR7A 4XO6A 1E4NA 1FFRA 4IOTA 3C86A 2DP3A 1VH7A 3HG3A 4LT9A 2I5GA 1DQXA 1FWJC 3OGRA 1ICSA 2VKZG 1PV8A 4B5VA 4MJMA 4LGXA 5AYIA 4CQDA 3PG8A 4Q4SA 4KWOA 1YEYA 3EMZA 4ZO6A 4GNKB 2D24A 2OSXA 4H9ZA 1RV8A 3WLTA 4DYEA 4BEUA 4Z2LA 4ROPA 2QDHA 1DTUA 2ABAA 1F3XA 1TZ9A 3UPMA 3RMJA 3STPA 4NNAA 2QF7A 4XZ9A 4CCDA 3HG5A 3W37A 4F79A 3VC5A 1PUDA 2XZ9A 2XSXA 3H26A 2NVDA 2FMNA 1PX3A 1XICA 2XIQA 4TV6A 1MDLA 2AL2B 4RCXA 3M0KA 4DXKA 1V6TA 2A21A 1UP0A 1SMDA 4IP4A 2VCAA 1E0VA 1B3WA 2YCLB 1GJUA 5I5RA 5CZSA 2DW7A 1LROA 3H54A 2XH2A 4EACA 3IVUA 4FI4A 2RDUA 4Y9AA 1E55A 5KSWA 3VC6A 1RALA 4L61A 2EPOA 1DIOA 3VDAA 4DPQA 4JCMA 1UKPA 1K6WA 1TIMA 3TYEA 2QCDA 3J7HA 1J0KA 2C7FA 3NQFA 2CHOA 4WY0A 3WUBA 4FX8A 3PHAA 3WNPA 5A95A 2YCEA 1P6BA 1D2KA 1UB3A 4V2XA 4ZOBA 5T91A 1KXVA 3NAVA 4GHRA 2CBJA 2E4TA 1Q13A 3UT0A 4O0QA 1ZSXA 2J75A 1SO5A 2EXOA 4CN6A 4BJHA 2C3ZA 4LB4A 1VFHA 4FA3A 4J27A 4Q8VA 2PBGA 4NZJA 2V8ZA 5JXQA 1EZWA 3IGHX 4IPNB 3E0VA 4J5NA 3VKJA 2ATMA 1R9XA 3WLRA 1GOQA 2J7GA 3JVAA 2BY0A 2QVNA 3KL5A 4JDYA 4AU0A 4JX4A 4I5RA 4PRWA 2ZZ2A 5G2HA 2GJRA 2PC4A 2WSRA 3DX5A 1HP5A 2YB4A 1SO3A 3TYBA 2D69A 4LANA 4E4UA 3PZMA 3CL8A 2PGEA 3RR4A 1UZ1A 4FO4A 4E2BA 3BMVA 2AMXA 3DC0A 1BYBA 3S46A 3TXVA 4PMZA 5C8BB 3S6DA 1UBSA 2F38A 4HZ6A 3R8HA 2D3NA 5BZAA 1ZENA 1HIZA 4GA8A 1R46A 2DZAA 3EWYA 2HNEA 5A6JA 3KRUA 3H2AA 1A49A 2GUUA 3CHEA 1W1ZA 3M64A 4Q8NA 2QPSA 3DG3A 1ZZMA 3QMTA 7REQA 1MXDA 3W7RA 5A8NA 1DJWA 4LYPA 4GXPA 2GJPA 1XFCA 1BRLB 4EAYA 1OJXA 3BMXA 3FOKA 4LF1A 4P8VA 4M51A 3FS2A 4Q8OA 3FX4A 3KL0A 1IT8A 4CNSA 4H9MA 5D2YA 4X63A 1PHWA 3BQ6A 1GKPA 4I7WA 5IBXC 1W1B1 3W2MA 3DN5A 1OADA 1FCVA 5BRBA 4KMQA 3DHPA 2YLAA 3SUUA 6XIMA 3MUAA 3BH4A 1F05A 1MO0A 4IWWA 1GW9A 2BWGA 3KVLA 3N13A 1R30A 4C60A 3AYSA 4IGHA 2E3ZA 4P5UA 1PCKA 2A4AA 3AU2A 5A8OA 2ONEA 3AWOA 1YKWA 2HPMA 1R8LA 3WF1A 5BU9A 1RXOB 3K8KA 1JYNA 2WZTA 1JYWA 3RU8X 4NNBA 3PWIA 1DXEA 1XGZA 4Z1AA 2PC8A 1NDZA 2QW5A 3TONA 4D8ZA 1TTJA 2PDBA 4QJ5B 1TIWA 2HMCA 3HMJG 1LG2A 2QAPA 4QBXA 1OK6A 2GK1A 1JDCA 3OBAA 5CPLA 5CJMA 1UUQA 5SWUA 2E7FA 3C3NA 4FSAA 1E3ZA 5D09A 5JIWA 3W1MA 3QVQA 1ZCCA 9XIAA 3VAVA 1W5OA 2QCHA 3AIQA 1R3TA 3QMRA 4B9YA 1DIKA 3GHSA 1H4PA 4NKCA 5A6BA 1W32A 3WQ8A 4IUGA 4YL2A 3SCVA 4AMCA 1J0JA 1ZJAA 1US2A 3B3DA 1SJDA 2YPIA 1TA3B 2B81A 3G1SA 4CNNA 4YTRA 4HP5A 5JIPA 1EKOA 1W5PA 4Q7IA 3ARWA 2V63A 1EPXA 2ZRYA 2ZUWA 2PCEA 4MZ1A 5D4YA 5B7YA 1VR6A 3C4UA 3IIOA 1AZ2A 4YPJA 3EX3A 3USBA 3VO0A 1AJZA 4IXXA 1XUZA 5L6UA 4B5TA 4JTAA 1O7AA 1H7NA 3A4XA 4US5D 4P7QA 3LOTA 4DBUA 4QTGA 2RAGA 3U4FA 5C2XA 2J9YA 4FNRA 3PBWA 5AHLA 3MSRA 1W0MA 4ACYA 2ZX7A 3EKGA 4PCFA 3WO8A 3GVGA 1S2WA 1J01A 1E6SM 1WKEA 1R7AA 3FGCA 4J3WA 2UY3A 2FTYA 1LL7A 3WLQA 3MUXA 5KZ6A 4ADTA 1P48A 2WZEA 3OZYA 3IPWA 3CZJA 1FHUA 1MWOA 4HQVA 3BE7A 3THQA 4JTQA 2G3IA 5IDZA 3TW9A 5AYXA 4GE8A 3IIVA 1EBGA 3UZZA 3HGJA 2ZZ1A 1FDJA 2RUSA 1RHCA 3T1GA 1KR1A 4CD8A 4DI8A 2V68A 3MTWA 1S2AA 2R94A 1A5LC 3S2CA 3KBJA 1C91A 2CLHA 1EO7A 4O16A 3VX1A 1GZ1A 1UBPC 4V15A 3THAA 5LNUA 4WD0A 2JGQA 2GSJA 1KFCA 3M0XA 1M53A 3P62A 3LHVA 4DJED 1SZGA 1E0XA 3U2CA 5GJPA 3RRXA 5BRPA 5C70A 1KTCA 3LMYA 3GIPA 3V5FA 2WHLA 2EG7A 1PX4A 4E3VA 5I02A 1VIWA 5I00A 1NDYA 3H21A 5D30A 1POJA 4R53A 4GMEA