2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
5FSEC 1BF6A 1NDZA 3DCPA 4IG2A 4ERAA 4C6FA 2QVNA 3E74A 1FWAC 1XGEA 1O5RA 3LU2A 4WVXA 3ID7A 4DIAA 4AC7C 3QY7A 4C5YA 3LSBA 4L9XA 1VFLA 2PUZA 1ADDA 1ONWA 2IMRA 4DNMA 3OU8A 2O4QA 3B0YA 5HMFA 1FWGC 2GOKA 1FWIC 2VC7A 4IQJA 4C5ZA 4EP8C 4HK6A 1RAKA 2OQLA 3OQEA 4PBFA 3S2MA 4H9MA 1POKA 2FTYA 4R7WA 4H9XA 4CNTA 3LGGA 4AQLA 1XWYA 4XAFA 1NDWA 2WM1A 3E0LA 1J6PA 1KRAC 3WZ0E 2YZ5A 4WGXA 1I0BA 3URNA 2I9UA 1V4YA 3QGAC 5CH9A 4XD6A 1FWCC 1EZ2A 3URBA 2VC5A 4ZSUA 1PB0A 4NI8A 4LFYA 3TN5A 4B90A 4C6CA 1GKPA 3IARA 4PE8A 4XAZA 5E5CA 4KESA 4BKNA 4LAOA 1PSCA 4DLMA 2RAGA 4KEZA 2PGRA 4CQBA 4ZSTA 1A5OC 3MPGA 4C6NA 2WJDA 2ICSA 2QS8A 4V1YA 2PAJA 3A3WA 3UR5A 2I5GA 3O0FA 3PAOA 5HMEA 5FSDC 2GWNA 2Z2BA 2FVKA 1RJRA 3KM8A 4L6DA 3NURA 2XIOA 3TN4A 4GXWA 3HM7A 1POJA 1P1MA 4HK5A 4QS5A 3WYZA 1RJPA 3PANA 4XAGA 2Z27A 2OODA 4TQTA 1QXLA 2Z2AA 3OVGA 4DZHA 1A4MA 3A3XA 2BGNE 2A3LA 1A4LA 4E3TA 3UPMA 4KQNA 4C6BA 1J5SA 3GTXA 1EJXC 2YB4A 1RJQA 3UR2A 2FFIA 4QRNA 3EWCA 2DVTA 1W1IE 1WXZA 2GZXA 2Z7GA 4KERA 1YBQB 1M68A 3CAKA 1R9XA 2ANUA 2Q09A 3LGDA 2HBXA 4PCNA 1RK6A 2FVMA 4IFOA 3GU2A 3IACA 3K5XA 1FKWA 1P6BA 4YIWA 4V1XA 3SFWA 3GTHA 1RA5A 3R0DA 3F2CA 3JZEA 3PBMA 2F6KA 4BY3A 4GK8A 3ICJA 4GOAA 4WHBA 1M7JA 2EG7A 4G7EB 5A6TC 2QT3A 3K4WA 4CQDA 2PLMA 1O12A 3B40A 3LS9A 2EG8A 1NFGA 1FWFC 3MSRA 4KIRA 3D6NA 3E2VA 4XAYA 4GY1A 3MVTA 1K1DA 1K6WA 4XD5A 1M65A 3TNBA 4Z42C 4IH3A 3FDKA 2O4MA 4R85A 1EF2A 3IJ6A 2DVXA 4IFKA 3RHGA 4EPEC 1E9YB 3GTFA 4C6LA 4HA0A 2OOFA 3GIQA 1XRFA 4CQCA 3HPAA 1R9ZA 1JGMA 1FWHC 1ITUA 3OOQA 1V79A 1PTAA 3G77A 3LNPA 4UBPC 4KEUA 4I6VA 4DZIA 4R88A 3MDWA 4GY7A 4H9YA 3OJGA 4M51A 3AU2A 3F4CA 3S2LA 3T81A 3URQA 4J5NA 3CJPA 4KF1A 2D2HA 2YB1A 3EGJA 2VUNA 3BE7A 4HJWA 4XD4A 3OODA 3O7UA 2D2GA 4QROA 3AUOA 2OGJA 3MDUA 4KEVA 2KAUC 3A4JA 4F0SA 1V7AA 2Z00A 1EJUC 3LA4A 2R1LA 3MTWA 4LALA 1FWDC 3QGKC 4D8LA 2Z28A 4CNUA 1A5NC 1RK5A 1UBPC 3GIPA 2Z29A 5HMDA 4RDVA 2Q01A 4RZBA 4LANA 3GRIA 1EJVC 4C6QA 4LCRA 2PGFA 2Z26A 4LCQA 1EJWC 2VHLA 2AMXA 4EPBC 3CS2A 2FTWA 3RCMA 3T1GA 1KCXA 4INFA 3GTIA 3GG7A 1ITQA 4C6OA 4C6PA 4QS6A 3QY8A 5LXXA 4RDWA 2HPIA 1S3TC 4H9ZA 2W9MA 3T8LA 4LAKA 2GWGA 2AQVA 2R1PA 1YIXA 1K70A 2D2JA 2DVUA 4H9VA 4UB9A 1V51A 4H9UA 3GUWA 4KETA 4GY0A 4MUPA 4B3ZA 1J6OA 2Y1HA 1GKQA 3ISIX 4ERGA 1EJRC 2AQOA 4C6MA 1FWJC 4DI9A 3NQBA 3FDGA 4NG3A 3ITCA 4CNSA 2WJEA 2R1NA 1A5KC 1E9ZB 3UF9A 3RN6A 4IG2B 4C6EA 4IFRA 4IGNA 3K2GA 1KRMA 3E38A 2HNHA 3F2DA 4RDZA 2HQAA 1FWBC 1YMYA 1ONXA 4DLFA 3S2NA 1I0DA 4LEFA 1KRBC 4GX9A 1FWEC 1R9YA 3EWDA 4G7EA 3IPWA 2Z4GA 4IGMA 1EYWA 2E25A 3ORWA 3DUGA 1NDYA 2R1KA 5G4HC 3TN3A 4I6KA 2ZC1A 1ZZMA 3E3HA 4EPDC 4RDYA 3FEQA 3LSCA 3MKVA 4GC3A 3URAA 4P5UA 3SO7A 3F4DA 3IRSA 1A5MC 3TN6A 4DYKA 3NEHA 2VR2A 4G2DA 4F0LA 4C60A 2E1WA 4J2MA 2Z25A 3IV8A 3IGHX 4H9TA 2UBPC 2OB3A 4B91A 3MJMA 1YBQA 2HBVA 2Z24A 1WXYA 4J35A 1QW7A 3GU9A 3MVIA 3PNZA 4H00A 1YRRA 4PCPA 2P50A 2YXOA 1IE7C 2GSEA 3S2JA 4C6DA 4C65A 4JOMA 1EJSC 4GBDA 1UIPA 2CZVA 4NP7A 1KRCC 4PBEA 3UBPC 1PO9A 4EPKA 4LH8A 1P6CA 3PNUA 4LCSA 2ADAA 1EJTC 1J79A 4QTGA 3F2BA 3HTWA 4IF2A 4LAMA 4C6JA 2BB0A 4CEUC 1V77A 1A5LC 1NDVA 1FKXA 1XRTA 2G3FA 4C6IA 3RYSA 4GYFA 2HPMA 2P53A 3N2CA 4OFCA 4C6KA 4HK7A 3AU6A 4GZ7A 1GKRA 3DC8A 1UIOA 3V7PA 5AKQA 4ERIA 4ICMA 4B92A 2UZ9A 3B0XA 3WMLA 3LY0A 3C86A 3S4TA 2WJFA 2R1MA 4RE0A 4GX8A 3QY6A 2QPXA 4CEXC 4DI8A 1YNYA 4QSFA 1DPMA 4IFKB 4H01A 1UMLA 2EG6A 1HZYA 4BJHA 3E0FA 3GU1A 2VM8A 4DO7A 4XD3A 1RA0A 4F0RA
chains in the Genus database with same CATH superfamily
3GBDA 4QCEA 1LLZA 4IG2A 1GOIA 1B57A 4ADSA 1XGEA 4AEEA 3W7KA 2E09A 2WAGA 3CWHA 4E8GA 5LA1A 3BJFA 3Q94A 3MUZ1 1EUNA 2ZADA 2FZDA 3QZ6A 1BVZA 1V08A 2GDQA 2ISVA 5G5IA 4C5ZA 1K02A 3NZPA 1J0YA 1E0UA 5FF7A 4CNTA 2OSWA 4BQ3A 4AQLA 4QG6A 3LENA 3VO0A 1JG9A 1IF2A 3CL8A 3QPZA 3EEZA 3TFCA 1PXGA 3S5ZA 1E4NA 1W5PA 3B8WA 1V7YA 1GVEA 1JPKA 3VTRA 3PBUA 5IFTA 4PCSA 3WELA 4MB4A 3W76A 4MF4A 3QV7A 4CU7A 1NSJA 1P0NA 3UZZA 3P62A 2YZRA 2QCDA 2HISA 2REQB 1JPMA 5CG7A 1XQKA 3LCIA 3PPFA 3WFZA 3CLMA 4L6DA 1TV7A 4XZMX 1YNQA 1E6ZA 4LVAA 1JYXA 3JW7A 1DIOA 3G1SA 1C9WA 1UZ1A 4X0NA 3NPUA 3UA3A 2R24A 1G0CA 3BG3A 4M81A 3KRUA 1J5SA 3MKCA 5C6MA 3TC7A 2OMAA 2A5HA 3OVPA 2QEZA 4H4IA 3CAVA 3HZ3A 1GONA 3L4ZA 1JZ6A 5HAOA 2WO5A 1Z32X 2ZUSA 1W1PA 1UP3A 5FF3A 4NU7A 3S5OA 3VUSA 1W56A 3ZSTA 2GJXB 2R91A 4CQDA 3ARQA 4JEJA 1LF1A 5KITA 1AW1A 1FWFC 2D69A 3G5EA 4XAYA 1WE5A 1NOFA 1K6WA 1DQUA 1TJ0A 3K13A 3RM9A 3AIUA 4AWSA 1D7FA 4HD5A 1VGAA 4DF2A 4RNIA 4JXCA 1ONEA 1OF8A 5IHSA 1S2AA 3ZR4A 3O6DA 2C1GA 4H6EA 1FWHC 1C90A 1V79A 1K8XA 1V3HA 3A6OA 3HQOA 4DJDA 4XZBA 3TYUA 3OJGA 4S39A 4AIUA 3I7QA 3OHIA 3URQA 4UTHA 2NVAA 3P14A 3GVVA 4GIYA 3GDKA 3G1DA 4Q32A 2OGJA 1ITCA 8XIAA 3S5YA 2WBKA 2WC4A 3FAWA 4US5D 3QKEA 5JU6A 4AU0A 3BCDA 4CNUA 2J7GA 1LZOA 2OLSA 2BS9A 3HPZA 3PZUA 4L9YA 1V3LA 4WKFA 1OY0A 4EIVA 5CKSA 2PGFA 2GVEA 3HB9A 3GR4A 4LAZA 3RPDA 3RMEA 1O94A 3UQNA 2NVCA 4DPQA 3IUDA 1F3WA 1JD9A 2ZOXA 4R53A 4YS1A 4H9ZA 2J4GA 2W9MA 3PPGA 3DKLA 2WHLA 3VA8A 5TD4A 4UC5A 2YOCA 2PRHA 3WQ4A 1UWIA 3W1TA 2WXDM 1XLGA 3ARPA 5K9CA 3H22A 4LNCA 5BOEA 2GYIA 4PRRA 3WEOA 3LTYA 4WY0F 1Q6GA 2WLYA 3W6LA 3U2EA 1E9ZB 4QAWA 3CBWA 4IGNA 3EDFA 3WLIA 1RV8A 2XSAA 2VTFA 1TX2A 4ZO6A 4AZCB 2UY4A 3VIPA 2OSYA 3N18A 1XPYA 4D6FA 3NZQA 1PX8A 1W5MA 2J62A 1BXNA 1PKYA 2VGIA 2IKHA 3M6DA 3WH6A 3S0CA 1U5HA 5M3WA 1GOXA 3FSTA 1GWJA 5JIWA 1DWHM 4D6EA 1FP9A 1I45A 3SCPA 4CQ8A 3MP4A 1IIHA 2VR2A 3ARZA 1SSDA 1FOBA 3M0IA 1ZBKA 3LXCA 4XBJA 4O11A 2YIHA 4JQ1A 1IEQA 1WP6A 3MVIA 4GWEA 4UFLA 2YDAA 3WLHA 1YNPA 5C2CA 4O1EA 1NFBA 2DP3A 4Y90A 2WKLA 1UUMA 2VCCA 2Z6JA 3FK4A 3UG4A 1ZPTA 4EPKA 1JZ3A 3LQLA 2PTYA 2DH3A 2QGYA 2WSYA 4ATDA 3V18A 5REQA 5DT7A 3GH4A 1X39A 2YDQA 2FH6A 1E71M 1OC6A 4JIPA 1TPH1 2VWSA 1M01A 4DUVA 4JBRA 4HK7A 3L2LA 4ZQPA 1CYGA 3O15A 2YLLA 2ZA3A 1QMLA 3PBGA 5I3IA 4G7FA 2UV8G 1TWWA 2DUZA 1K77A 1G4SA 2HDJA 2ZDRA 1TR9A 4HYWA 3MWCA 1G4TA 2ONEA 2XVGA 4EXBA 1SZRA 3QVQA 4DI8A 3VGGA 4JFVA 4S3CA 4O10A 4AD3A 4H01A 2W67A 4ZTYA 2B4GA 1SZGA 2OKOA 1MO0A 4LBUA 1QOPA 2YCLA 4KT2A 3KW3A 1PIIA 3BCFA 2HS6A 4ZOCA 1KCKA 1O6IA 3LV6A 3QMSA 1Q63A 1VH7A 1NP2A 4AY7A 3EMQA 3LSBA 4DVOA 3ITXA 4I5XA 1AJ2A 5FEPA 2PWFA 3GC5A 3U5UA 3B0UX 2GOKA 1T0OA 2PGWA 1HL8A 5AOUA 1Q4NX 3PSWA 3AS3A 3OYXA 4EP8C 4DM2A 1BYBA 3HMCA 4GVIA 4Y8FA 2FTYA 1QI4A 3DERA 4S3AA 4XVEA 4RE2A 2B81A 5CJ5A 4XZNX 3K4AA 2MUCA 2I9UA 3K4DA 3QGAC 4Q3MA 1PB0A 4QGCA 4LOCA 4C6CA 3T8QA 1GKPA 1V0NA 1K4GA 1XD0A 4M7TA 4QBXA 3W1XA 2H90A 4H6RA 4KEZA 4B5WA 4Q8PA 2WVVB 1KBKA 4PL2A 3L4VA 2QS8A 3UR5A 5HANA 4PSPA 3BQ6A 2WLZA 2Z2BA 3LLDA 1S5MA 2FVKA 4W93A 1CLVA 1VFTA 3H2MA 3HM7A 1ICSA 1P1MA 4MNMA 3RO8A 3XINA 4CD5A 1CI1A 3WJXA 3UNTA 3C2RA 3HJEA 2TYSA 2WC7A 5DRIA 4B4HA 3UPMA 2E1DA 1W9VA 2PP1A 3DHDA 2BV9A 1VRDA 2NLYA 4QRNA 3YPIA 5FCZA 4PUJA 3RCYA 1IV8A 3C3NA 1G5AA 1G1YA 2JGQA 4F48A 2WSRA 1P1XA 3QW3A 4DZ5A 1PX4A 1XF0A 1AMYA 3EA3A 4JNZA 4XO6A 4LYKA 1H7WA 4J2PA 4PGLA 2XIIA 2VWTA 3LS9A 5C55A 3BDKA 3QLDA 4O4VA 1XW8A 3MVTA 4CN6A 1BYCA 4ATLA 2INEA 5BOFA 2OZ3A 3GNNA 4F79A 4U2YA 3NVDA 5EBUA 2CC0A 3QV6A 4GKTA 3FHAA 3GHUA 2ZUUA 3NQCA 1YQ2A 2G97A 4MNKA 5D32A 5G2WA 3VDHA 2ZRWA 5EYWA 2PF0A 1R8LA 2QKFA 1ITUA 4LBRA 5CPNA 3LHWA 3S1GA 3A64A 2WHMA 3KOYA 4KW2A 3AU2A 3S2LA 1FA2A 3TOYA 3GXIA 5CLWA 4IUOA 3LBCA 3M6YA 4QJ5B 4ORIA 1IR2A 1QWKA 3BE7A 5JH1A 3VGBA 1F2JA 1GUVA 1ALDA 3H53A 1FWTA 1YX1A 2PCQA 3LA4A 3Q4DA 5AFDA 3TX9A 3O6YX 2VX6A 4FEZA 4GVFA 4E3VA 4UTIA 6PTDA 3GIYA 2PTXA 4WXZA 1FH7A 4RZBA 4E4FA 4TVDA 5G2HA 1DBTA 1P0BA 4FXFA 3KOFA 4UMAA 1RVGA 1WBHA 3LB0A 3UVAA 1G7VA 1TG7A 1UD4A 4RR4A 5G2IA 2OJPA 1TZ9A 3I7SA 1JVNA 1DIEA 3TTOA 3BLLA 1EA0A 4IPJA 1JPDX 4O8AA 2NSXA 5LXXA 3PZGA 3PY2A 5F4XA 4W8BA 3VOJA 3SFKA 4GIEA 2XH7A 5DF0A 3TJLA 1OZMA 2FJUB 3LRKA 5I3KA 3WQOA 3PZQA 1B5TA 2YW4A 1OX6A 1YXCA 3QHMA 5T9BG 4B3ZA 3U3HA 4BS0A 2DW6A 2C15A 2J79A 3I3DA 2HVOA 4LT9A 1CZ1A 4M1BA 3ITCA 3OBKA 3R7MA 1LTDA 3QHNA 1KLYA 2XYLA 5AECA 4UTUA 1SW0A 4E5TA 1TVNA 3VC6A 2ZWZA 4O50A 4IJCA 3QYSA 1R9YA 4J3SA 1DJXA 4NJKA 3TCSA 3K8KA 4O4WA 3RLGA 3KBVA 4LRTA 1FUYA 1TELA 2Y8VA 1AK5A 3SO7A 3G8RA 1F6PA 4CD8A 3NEHA 4G2DA 4JYEA 1KFEA 2O0TA 2V63A 4JNMA 3SY8A 3W74A 3L4YA 2Q3RA 3ZT6A 2YL6A 3ZMRA 2IXVA 3QBUA 4ALDA 2V8ZA 3IJ7A 4H00A 2CEQA 3L5MA 3FV9A 1F74A 2O9TA 3ARWA 3PHAA 3UEQA 1T5AA 3OO2A 2HVNA 4R33A 4HSHA 3PN8A 1XUUA 3CHDA 3CMJA 4LJ3A 1GOQA 3OZYA 2BVDA 1SPQA 1V77A 1TPB1 1SJBA 3MYOA 4B4FA 2QQ6A 3THAA 3AU6A 3SUTA 3P6LA 1IQ8A 4RUBA 5FF4A 2YDRA 5GNYA 4O13A 4GUIA 4M6UA 1RUSA 1M6JA 3WMLA 1FDYA 3SM0A 1UWSA 3C86A 2QZRA 3EXTA 2GVYA 2XVNA 2ZUWA 3W7PA 4CLMA 4QXIA 4LUTA 3EA2A 3BOFA 2WZEA 3CZJA 3SBFA 5C70A 1LL7A 4IFKB 1UMLA 4KWSA 4I5UA 3ABZA 4IQEA 3KOXA 2AKMA 2PD5A 4MHBA 3C0LA 1H62A 3QMRA 1TJ2A 3H2NA 1O66A 1Z9AA 4O1DA 2E6DA 4GUGA 1BTCA 3LHUA 2E7FA 4LUIA 4XO7A 3R89A 5AYZA 1X8CA 1TVLA 3IVSA 4C5YA 2ZBTA 4X9SA 3CYJA 1VIWA 3B0YA 1J0HA 3SCQA 1FWIC 4FA3A 3WDPP 3SSZA 3OP2A 3E0IA 3P67A 1R3QA 4KFOA 1PL9A 1LQAA 5AZ1A 4XK2A 4PBFA 1G4PA 3S2MA 4F2UA 1DKWA 3NJ3A 3BSGA 3V5CA 5LIXX 1HJXA 2WKGA 4AIOA 3SECA 1XHGA 4NAEA 2OX4A 1GQNA 5EKYA 1KGUA 3K30A 2W0UA 5E5CA 1WCGA 1W9XA 4BKNA 2AGTA 4D6IA 4ZSTA 4Y6GA 4N9CA 2WJDA 4NYYA 1DWFM 3PPCA 4D2JA 1ZB5A 3FYYA 1OQFA 1IR1A 4A8NA 1G7UA 2V6AA 1OIMA 2QJIA 1YPXA 3T07A 1LT7A 1Z42A 4YVXA 1WNOA 1WQ5A 3W22A 3THDA 4AD5A 3VIMA 1UG6A 3CUIA 3V5FA 2ZE0A 5DCBA 5KSWA 3W53A 3OVGA 4DZHA 2PDCA 1K8YA 4MIMA 3QC0A 1ME9A 2ABBA 1JCJA 2YB4A 1J11A 1AH0A 4XZIA 4JTUA 1I60A 4IGHA 3TR9A 3V0SA 4JQ2A 2Z7GA 5I79A 4RPPA 4E8DA 4FO4A 4BF9A 1XXXA 2VKZG 2DUXA 2PCEA 3BGJA 1RK6A 1UA3A 2GQAA 1XFCA 1W8GA 2VVNA 3ZO9A 3TYAA 1M7XA 4GBUA 1NF0A 2RDWA 4GK8A 5A6TC 5BZAA 1SYTA 4EKJA 3RU6A 3PSVA 2NV2A 1UR4A 3B9EA 3TW7A 3MSRA 4HIBA 3E2VA 3GVGA 3PZOA 4HPGA 1Q45A 5D9MA 1OCBA 3SRHA 3LDVA 1V6TA 3TNBA 1K3UA 3ZVHB 5L6UA 3FCPA 3HBLA 2DIJA 4H8UA 4X63A 3R0UA 3CQ0A 5I3DA 5E1QA 4JTDA 1UPMB 4X2PA 3U2CA 4BI6A 2EO7A 2EHHA 4CQCA 3WKZA 4AD4A 1AUSL 4RLIA 3RIKA 3W84A 3QLLA 5HJXA 3AO0A 3TMLA 3TYDA 1EQPA 5EMYA 4J5NA 4KF1A 3TLLA 4UFHA 2YCEA 4HJWA 3CIXA 5D02A 8XIMA 3HG5A 1TWIA 3FN9A 4JTQA 4J3VA 4PA8A 3NXLA 1B9BA 1JZ7A 4MAZA 5I24A 2VENA 5CZKA 3W7QA 5JUVA 2PWGA 3NYDA 3W1PA 4UTJA 1DWIM 3QMTA 1PWLA 1MSSA 5HMDA 3S8HA 1Q2SA 2VELA 3P7YA 4ML9A 3UT0A 3EDJA 4UR9A 4CVWA 4GACA 4O28A 1P5BA 2ZX6A 3FY1A 3WLOA 3TSDA 3BLPX 2VFHA 2QUUA 3GG7A 5JBDA 1HP5A 4C6PA 4O19A 1E1FA 2Y7GA 2DZTA 3T2QA 4BF7A 1V3JA 5IRPA 2VDHA 2J66A 1EDQA 2VURA 3AHTA 3T2OA 4GZIA 4HNLA 1GJUA 2Y88A 1YE6A 3ARRA 3TNOA 5U7SA 3EWYA 1MI3A 4QDPA 4MADA 4PMOA 2FMNA 5CPLA 1GK8A 4H6KA 5DXXA 4DI9A 4D8ZA 2BDQA 1RP8A 3NQEA 5XINA 4CNSA 3OW1A 2XH2A 4K1WA 4V33A 1BG9A 4JIHA 2H6RA 4D6DA 3N3TA 3RN6A 1A5CA 3GZAA 3WBWA 1Q8AA 1WDRA 4KBXA 3K1DA 4HOWA 1KXTA 4HCDA 3S2NA 1QPRA 4GUJA 2CKRA 1LQ2A 1ZGDA 3SSJA 4JFUA 1GYMA 4NT0A 1I2NA 5LA0A 4YYFA 3GC2A 1IEIA 3MMWA 5KTLA 1GJWA 1TPWA 2VFFA 3W72A 1A3XA 4PB3A 4YWSA 5GPRA 3H2CA 2FHBA 2ODOA 2X1IA 3IRSA 1CTNA 1X6LA 1XLDA 4M56A 3KCLA 4MNLA 4WCJA 4NNBA 2Z25A 1A5UA 4FB7A 2WZMA 3T55A 2YA0A 1S39A 1XFBA 3EXRA 3MJMA 4B91A 3PWIA 1T40A 3VMOA 1Q65A 2C79A 1F07A 1QK2A 2VEFA 3PWAA 2WMJA 1C8QA 2QR6A 4UTKA 4H04A 4OQVA 2ZYFA 3BTNA 4QJ3B 4AZGA 3CTTA 1I2QA 2DQXA 1GJPA 2IKGA 1E51A 3WL1A 1XLLA 3O07A 1T96A 1HJWA 1NELA 4QEEA 2DT3A 4FX8A 4IF2A 4HZ8A 2P8BA 4C6JA 2EQDA 2XH0A 5M1TA 1E55A 1NH6A 3LPGA 3UR8A 1BQGA 3WF1A 4M1RA 4WKHA 1JD7A 2BY0A 2R82A 4GI6A 3KBNA 2A6NA 5C0QA 4OU1A 3RUBL 2WW5A 4PUMA 1BXBA 1UB3A 3N34A 1TWDA 1LWJA 1KXHA 1QFEA 1EPXA 4QJ1A 4J28A 2XIBA 2GJXA 3E74A 4XUGA 2X05A 5M5DA 5DBUA 1H7RA 1TV3A 3RAOA 1ADDA 1PS9A 1HN1A 2VFEA 3ANYA 1H09A 3CPUA 5FEZA 2ATSA 4A8IA 2DY3A 2OQLA 1XLAA 1PX3A 1BGAA 1LQ0A 2CYGA 4AH7A 2Z2UA 3G1AA 5G1YA 4WJXA 2Q8XA 1KNWA 4TR9A 2QF8A 4Y9PA 2UWFA 1PZ0A 3VAVA 1J6PA 1GEHA 1V3MA 4JTGA 1BD0A 5CH9A 3VCCA 1OYAA 3C8NA 1JCXA 1KM2A 2V3EA 4IMFA 4ZEPA 2VCBA 2A3CA 3BG5A 2QYGA 1H2JA 4FPSA 1X7FA 4LAOA 2A0NA 4DWSD 3ZT7A 1YE4A 2NT0A 1A5OC 4PN2A 3L65A 3NDOA 3QR0A 4W84A 3O63A 3DHPA 3EDEA 5AYBA 1GHSA 1D9EA 3DIPA 4MTVA 3NIYA 1P4CA 3FJ4A 1TTJA 4GGHA 4GXWA 1FDJA 4QG8A 4REQA 4OIFA 2BGNE 1XLMA 2RKXA 4O1AA 5BNKA 5HOSA 4Q8OA 3G1FA 4C6BA 3QZAA 4JQ3A 3LYEA 3AQUA 4AZBA 1MNSA 1R3TA 4U5IA 3RX3A 5AYXA 2VZTA 5ABEA 4PCFA 3S1VA 2PRMA 3VMNA 1QI3A 3C0QA 2QPSA 2EJ1A 3KZPA 1LRQA 1RD6A 4M19A 5A6JA 1EZWA 2WZTA 3LPPA 1SO6A 4EACA 2BP1A 5CEWA 4ZOAA 1EJ7L 2PSNA 3UERA 2NQ9A 3NAVA 4Z2IA 1MUWA 1XUZA 3QM3A 2OSXA 2ZUTA 5FF0A 3AICA 4M6PA 1Z48A 3R13A 1DWJM 3U5YA 3MV11 3ITGA 4Z42C 1WDQA 2O4MA 3B9AA 2JE8A 1QNQA 1RD5A 2DVXA 3TQ0A 3NQFA 3UWEA 3GH7A 2ZZ1A 4Q8QA 4X61A 1NY1A 1R0MA 1UD5A 3EOUA 2HXTA 3HFTA 4GI8A 3LHVA 3BPWA 2GK1A 2VEGA 4O1CA 5D37A 4PZVA 3OYZA 3LMYA 1DJZA 2PLJA 4Z1CA 3CIWA 1MZRA 4PODA 4KRTA 5HNTA 4Z08A 4I9JA 2O92A 1JYNA 4ICCX 2ZICA 4MLRA 3N13A 5HR7A 3IJIA 1YTEA 3NFUA 3CV1A 1KQZA 1TPC1 2PDUA 2VUNA 2FYMA 3B03A 3LCHA 2VGGA 5HUOA 4JTLA 3A4JA 1LT8A 5FJIA 1EYEA 4YXGA 3O8AA 3N73A 3NM1A 3NYZA 4E0CA 4F0HA 1WKYA 3RRXA 5I77A 2B7QA 2FB2A 2CLLA 2G37A 1UBPC 4HPXA 3VD4A 4V28A 2VQUA 2XISA 2IXUA 1QATA 5C8BB 3BQ5A 2J8GA 1TTQA 4NF7A 2Y5SA 4GQGA 4B16A 1UR9A 2GGIA 4JL2A 1ITQA 1BSLA 3NA8A 1VFMA 1XH1A 4HA3A 1E6PA 2CLPA 5C2XA 2J7EA 2QJMA 4HZMA 2WQDA 1GQLA 5RUBA 1SGJA 4H8HA 4TV5A 4PUEA 4LGXA 4ML4A 1YKWA 4G6CA 2DZXA 4XZHA 4AZIA 1QW8A 2L5HA 5D05A 2VCAA 5H1WA 3CV2A 3ZT5A 4M7SA 4D8AA 3PF3A 3OBEA 5FEWA 3C2YA 2PLCA 3C61A 3IJLA 5LGXA 4W5ZA 5IFPA 1YDNA 4QHRA 1Y0EA 4B2DA 1W1TA 4G56A 1BVWA 2VQTA 2JFEX 3UF9A 4GZJA 3PC0A 4IG2B 5ECVA 4IPLA 3V1HA 3KZSA 2HNHA 2X2GA 2A6LA 3SW6A 4XTDA 1Y5XA 1UR0A 3W7JA 5IDZA 4DLFA 1TSIA 3RO6A 3JR2A 4G1KA 3UD6A 1AQFA 3GW0A 4WRHA 3T0TA 5BW6A 4FLRA 4US6A 4J27A 3GFZA 1NQKA 4Z2KA 5EY5A 5BXSA 3E3HA 3C3UA 3OHMB 2CITA 1U33A 2DZUA 4RDYA 3PB2A 4GC4A 1ZY9A 2W61A 3F4DA 4C60A 4FX6M 3OG2A 1B90A 1EDTA 4LC6A 4H9TA 2HZGA 1LBMA 2EKGA 4ZE4A 3APTA 2Z24A 2P3ZA 2BY3A 2FIQA 3UPBA 4ZR8A 3WUBA 1CGXA 3IUHA 4C65A 2WYSA 3DFTA 3WNOA 4FIQA 5E6ZA 4F4RA 1PKLA 3CUXA 1RHCA 4W5UA 1P6CA 3PNUA 3TWBA 4L4LA 1MMFA 1XSIA 4N6FA 3VC5A 3UPWA 4CN4A 1Z69A 1GOOA 3LPOA 3N9KA 4N42A 4R7OA 4AWUA 3MO7A 2WNQA 5FAJA 1CECA 1SUXA 4IMEA 1W9UA 1IHIA 3ABQA 1QRQA 2NVDA 4FK9A 1C3FA 3MUIA 2R1MA 5K9XA 1KA9F 1UASA 5FAGA 1F8IA 3BAXA 4E2BA 3BICA 5D38A 4IPNB 1IYXA 1J93A 3V36A 3DGRA 3POHA 1QI2A 1HKKA 1HZYA 1IZCA 4IXHA 3WNLA 5FSEC 2OYKA 5K9DA 4XV0A 3W00A 5I2UA 4MJZA 3M64A 4JTAA 3NQVA 1PPIA 3TDFA 3H55A 4FX7A 5T26A 1ADOA 5A2CA 4GYKA 3ZYZA 1Q6OA 3F4NA 1HKWA 2ZIDA 2VC7A 1UD2A 3ARXA 3CMGA 2PEVA 3H7UA 5CSYA 1DWAM 3NWRA 4AMCA 3AMLA 5JBFA 4AF0B 4NJGA 2Z1SA 4R7WA 3KFTA 3G6MA 2VUYA 3P8IA 1H49A 4BFAA 3VFCA 1XWYA 3N3MA 1WB0A 2ALDA 1NOUA 3TTEA 1VCGA 4KPLA 3RK8A 5IOBA 5MKGA 4AVNA 2NX3A 1S2TA 1B9ZA 3AMKA 3LEPA 1QCWA 3URBA 2C1IA 1SFTA 2DJXA 2DJLA 4YMZA 3F5KA 1JZ4A 1LJYA 7REQA 4PMZA 4B5XA 5F7UA 2Q3OA 3BC9A 2JK2A 3SCWA 4FSAA 1FHVA 4IT1A 1AL8A 2ZCGA 1UWUA 3QEZA 3N19B 3PUGA 3G1XA 3QPYA 3EX2A 1RQHA 2ZWYA 5CJNA 4FOKA 1KBJA 2ACRA 4OOZA 3K46A 5E0FA 4A21A 1Q6EA 3A22A 5HXMA 1C29A 4HHHA 2DT0A 4WIWA 4LV4A 2WMGA 5ABFB 2E6FA 3LQGA 2W79A 1ZS2A 2OODA 3QXBA 4W85A 3IS4A 3LOTA 3WJYA 5A1AA 2IPFA 2OEMA 1I9CB 1KQYA 4NHVA 3N6JA 4RV3A 1A4LA 1Q7ZA 3GTXA 4S2CA 1HQTA 3BAIA 4TX8A 4AC1X 1X98A 2Z7KA 2GQ3A 2FMOA 2AOSA 3JVAA 3P5YA 3JS3A 4PCNA 1MFVA 3IACA 4D71A 3M9YA 4L64A 3U6WA 2XIMA 3WENA 3PBMA 4BY3A 3S1UA 2NW0A 4C7DA 2R94A 2VL4A 3NQMA 8CGTA 5E93A 2HMCA 3ZM8A 4MB1A 2EEXA 3N9RA 4HN8A 4JTTA 4NXKA 4OUEA 1EIXA 4H7VA 4DUOA 3AC0A 3RLVA 3EPOA 3EOEA 2OO0A 2G50A 4HA0A 3NZGA 3M5YA 2HK0A 5G1TA 4HHLA 1HIZA 2GQ9A 1R30A 4JDBA 3DFHA 3M0LA 2H8ZA 1PTAA 2GJLA 2XZ7A 3I6TA 4UBPC 1LORA 3FW6A 1SJAA 2ISFA 1XP3A 3DHUA 5HATA 1W2PA 1KLZA 3C5QA 3G1YA 3WQFA 2RUSA 4O54A 1T7LA 2V81A 4H3DA 3WD4A 3W2MA 3V35A 1VFSA 4W88A 3GDMA 3M7SA 1EJUC 4F3HA 2YCKX 4I7UA 2E9MA 1L6FA 5EMUA 4RDVA 3VFLA 1MW0A 2Q8LA 1BEUA 1VFHA 1DWGM 3Q58A 4NZCA 1E56A 4X0VA 5C71A 2VHLA 3A3HA 4MMWA 1LBLA 3MP3A 3HGOA 2ZZ2A 2OELA 3GTIA 3UY8A 4BEQA 4B5VA 2I5IA 4E6MA 1E4MM 1TB3A 3SI9A 1R47A 3GAKA 5CPOA 1SR9A 4Q22A 4OOUA 3ARYA 4Q8WA 1AH3A 4H9UA 5I07A 4GY0A 1WKFA 4JIRA 3CB3A 5A8GA 1M5WA 3FYOA 4DBUA 3DX5A 2PTWA 1JYWA 3R58A 3WLNA 3Q2DA 1LM1A 2R1NA 5I06A 2YKKA 4QIUA 1OHLA 2E67A 3BMWA 3GG0A 1TQJA 2I16A 2XSXA 3BURA 1KFWA 4S38A 2BWGA 1FWBC 5GJMA 1GORA 4C1KA 1ZAJA 1BYAA 1FVPA 3A24A 2XG9A 3TTYA 4LEFA 2GVJA 3RDKA 4IGMA 3N2TA 4R27A 3AMGA 2A7NA 3BW2A 2VRKA 2PZNA 2EF9A 2VFIA 1WAWA 1E9IA 5BWAA 3M5ZA 2PP0A 2F9RA 1HKIA 5AVNA 4MPQA 1UZHA 1T8XA 1A5MC 1OIFA 1AG1O 1CGUA 1DTNA 1S2VA 4S3JA 4A6GA 1YDVA 2E9LA 4KFNA 4LVGA 3W7LA 1R2TA 2INZA 1YW1A 1WYIA 4A8RA 4PCTA 4L65A 4MG4A 2FGZA 4YCOA 1ZJIA 3S1XA 2XTKA 2AQWA 1BHGA 2KZHA 4RNFA 1CB2A 4HHPA 3NNTA 1JCTA 1EIBA 1PO9A 1L9WA 1Z89A 2DZPA 4L9ZA 3WBEA 1CCWB 3KRBA 3UJFA 3U4FA 2Y89A 3WDQA 3KP1A 3OIXA 4XUYA 3B06A 3P81A 1W3IA 2B7PA 5T91A 1CT5A 1X7IA 3DGBA 3IJ9A 1D2KA 3S5NA 4L1XA 4JHMA 4ORMA 1MXDA 1M7OA 1ECQA 1HKMA 3TR2A 2XIJA 4N9BA 3BV7A 3U9IA 2P88A 1XLEA 1C8VA 4Y96A 2XFYA 2XN0A 3I6RA 3S4TA 3EXSA 4S2BA 3CV7A 2IUZA 3L4UA 3QY6A 3PZIA 1THFD 2J9ZA 5CC5A 1SJCA 3CGTA 2YFOA 2BGQA 4DAFA 2AMGA 3VVGA 4GI9A 4EWJA 1CDGA 4GINA 1W3HA 4PTMA 1RLCL 3E0FA 1NTHA 3QGVA 2QNEA 4JTCA 2CESA 3WO8A 3OGSA 5A8MA 3ARUA 4FMVA 5FESA 1R3WA 1EQCA 3ID7A 3STGA 1VFLA 4IJRA 4JX5A 2IMRA 4WQ6A 3WNKA 1S3HA 1LCOA 1FFRA 1UZDA 3DOPA 1BGGA 3MCNA 4JNYA 3B9OA 3WH5A 3VNZA 2XDFA 3AIEA 2J9YA 1SU5A 3R8HA 4H9MA 3AIQA 3UCCA 3M0ZA 2O7QA 4GYPA 4QEHA 4PEEA 1EEXA 4DWSC 1TX0A 5GJNA 3T0AA 3T6CA 3VCNA 3URNA 1V4YA 4JTRA 3NPWA 4JZ5A 4ZSUA 5A6MA 1GOWA 3QV9A 1A47A 4RE4A 1WZLA 1BWKA 2X7WA 3E0WA 5B80A 3DI0A 3F5LA 4NZ5A 3O6CA 4DLMA 3A12A 1WDPA 5JQ9A 2O7SA 2ZRYA 3PJXA 1NU5A 3AZRA 3A4WA 2ICSA 4DXVA 5AC8A 5LKYA 4DHGA 5CPSA 1JF5A 1AMKA 1OD8A 2G8ZA 1S5VA 3NVTA 2Z1KA 1LUCA 4AHQA 3TTSA 4JTIA 4LS0A 1Q66A 1ZHAA 2YGYA 3CM4A 2OR2A 2PDIA 3ANUA 3SQMA 3QTPA 5F2IA 3RG6A 3MJYA 1PEZA 4Q7IA 1ZP3A 2A3LA 4KKXA 2ZRUA 3I7RA 1BVNP 7TIMA 2YDSA 1EUAA 4ZODA 2XGBA 1V5XA 5HMSA 1MEWA 4FS9A 4LUSA 1FX6A 1R9XA 4GXPA 2HBXA 2CBVA 4PTXA 3R10A 3F2CA 5I5RA 1Q8JA 4K8HA 1FBAA 1B2YA 3GLCA 1TPUA 4WUIA 4OBRA 2UY2A 3A9BA 4BI5A 2HEJA 2X2YA 2BHUA 2IW0A 1XI3A 5J04A 1ZALA 4XBSA 4KIRA 3D6NA 3GNDA 1U1UA 4Q6XA 1R3SA 4GY1A 1K1DA 3HQNA 3SR7A 4UZUA 4UWMA 2C91A 3PK7A 4WJEA 2G3IA 3E5PA 2YL5A 3GWQA 3MSYA 2HCVA 1GPWA 1ZNNA 3AXXA 4PFHA 4W7WA 1I1WA 2D22A 2BXYA 4UNKA 2DFAA 3W37A 4B5NA 1CBGA 4O53A 1GZGA 4MWAE 1G69A 4KEUA 4I6VA 4QR6A 4AHPA 5JH2A 2DV0A 1R7AA 1CPUA 4BQ2A 3MQTA 3TYZA 3OQ8A 3R6IA 1JQXA 3B8VA 3HG2A 4XD4A 4WEVX 3THCA 1R6WA 2ABAA 3MDUA 4PMDA 4KEVA 3L2MA 1GOKA 1QWGA 3T05A 1TYGA 6ENLA 4OECA 3AIVA 4PMQA 2HV5A 1MZHA 4CU8A 4RCXA 5CC3A 1YHTA 3JZUA 1Q6FA 1E9LA 2D20A 3MB9A 3OGVA 1RK5A 4I9AA 2X0HA 4YL2A 4PTDA 2J7DA 2OFJA 4K8EA 1FCUA 3TAKA 2D2OA 4DBEA 1MQRA 2WJZA 3H4WA 5BXRA 1HXJA 2Z1WA 3PTQA 3W2KA 3Q37A 4ZXOA 4AZHA 5DMYA 4JQ4A 2BFGA 1A3WA 1KKRA 3WQPA 5IM51 3P2VA 2WMKA 1NWUA 3KWSA 1S3TC 1G01A 3WJWA 4QAIA 2TSYA 2PTZA 4H8VA 4M29A 4NNAA 3AUJA 2A4AA 4ZFCA 5LNRA 4EF8A 3R5EA 5A8PA 1QVBA 2BNJA 4A3YA 1SZEA 1GVFA 1VBRA 2H3BA 4PMJA 4RJEA 3DESA 1MQPA 3KBWA 1SFSA 2J8TA 3K2GA 4KWUA 4XSLA 2HQAA 3UG3A 4TMBA 1JNEA 3FGCA 3SCVA 4K37A 2EPKX 2C0AA 3LRMA 2HRWA 5MF5A 1EOMA 4V15A 3EWDA 1DJNA 2BSLA 3UESA 1FH8A 1KO0A 3LTPA 4Q8NA 3MUAA 4DJFC 3H12A 4WDTA 1XLFA 3HGRA 1DJWA 3PZNA 1EGVA 1KFJA 3W1AA 1XIGA 3TN6A 2OYMA 3VCRA 2RGMA 1U83A 3G0UA 2V3DA 3S1WA 4M3PA 4J2MA 1F7BA 1VBJA 3IGHX 1M3UA 5CSRA 1EX1A 1J9YA 2ZRZA 5AZ0A 5HQEA 4Q4KA 2NQHA 1BWLA 4IL0A 3WH9A 3PB0A 4A3QA 2IPJA 2WZIA 4GNKB 1S5WA 3LPFA 3E96A 4MWAD 4EAMA 3GO2A 3N9SA 4N6EA 1F73A 3WK2A 1IXPA 4UR7A 5HQLA 3UBPC 5LHEA 1OCQA 2XHYA 2DSVA 3WQWA 2R8WA 3AISA 3LRLA 2X0YA 5DQPA 3W9ZA 3WLKX 3VX1A 3EWBX 4LSBA 5LYRA 1KFKA 2VZUA 1Y65A 4LS2A 2ZFAA 1XIBA 1FFQA 1UIOA 2GOUA 3FAXA 1OD0A 1UOKA 2YYTA 2NQZA 7CGTA 3M0KA 2NQLA 5F2GA 2PDGA 4HZ6A 6XIAA 3LY0A 1C7TA 1SO4A 4LEQA 3WQ6A 7ODCA 2QPXA 1UJPA 1UPPA 3L66A 3ABSA 4LV9A 5CZJA 3UU0A 3BWWA 2R14A 4UXDA 1S2CA 1I75A 3VMPA 3GU1A 1V03A 2C0HA 2OGYA 1DJQA 2PF8A 3DCPA 2C19A 3WFLA 2YA2A 3E6EA 4ZO7A 3SRDA 2FLIA 3OVQA 1O5RA 4RKAA 1XG3A 1ISVA 3MCOA 1OEPA 4AC7C 4LVDA 2HE5A 2QDDA 3PG9A 3G3MA 2ZKMX 3LCXA 3H26A 2G3NA 1F9CA 4JS3A 4UFIA 1VIZA 5EGRA 4MLJA 2HS8A 3DFOA 3KRZA 4L6HA 1DIDA 3C56A 2X16A 3G1VA 2W4XA 4AWEA 4QLLA 3W7HA 4PYSA 4H9XA 3LGGA 1JAKA 1XIHA 1J5TA 4ICNA 3TE9A 3BANA 3WZ0E 2IQ0A 4GE8A 4DJDC 3W75A 3N2XA 3G1RA 1NJJA 5LNVA 1EF3A 1LL6A 4TVCA 5M17A 4Q4QA 4CQBA 2FDSA 3B4YA 3U57A 1KM0A 4C6NA 4A05A 4P7OA 5FF2A 3EKLA 4PMVA 1TRDA 3PAOA 4YVPA 4L4OA 4NAFB 3V1PA 1MRAA 3NZ1A 2DZWA 4UQBA 4DO6A 3M7WA 3S46A 4LB4A 1YPFA 4DJFD 3M4HA 2I1OA 4HK5A 2NV9A 1KCLA 1VEMA 4W7VA 2OPJA 2OWWA 1A4MA 1XR2A 4B3KA 2OT0A 4UOQA 4HHMA 1SSGA 4MB5A 1O1ZA 1JNDA 3S5SA 3WX7A 2FFIA 1GZ1A 3H54A 3VIHA 1YBQB 3CAKA 2QDHA 1VZWA 4L1WA 1JI2A 1UKQA 3BL3A 4N9DA 1EHAA 4TTGA 2Y5JA 2D1ZA 3IIOA 2NXHA 3NL5A 1R7OA 4A35A 1T6MA 3ITOA 1QNOA 3TVAA 2FJKA 1PAMA 3V16A 2PLMA 3M07A 1JEZA 1R85A 1V02A 1O12A 1IWPA 5DCEA 3R4IA 3HV8A 5C9UA 1F61A 2VDIA 4KRUA 4XISA 1JQVA 2OZTA 3AXMA 4TUFA 1CXHA 3EZ4A 2WKJA 4MGGA 4E4PA 4BR1A 2GVGA 3B8TA 2EGZA 2FZBA 4HCHA 4LB3A 5HINA 1UH2A 3CUGA 4WDWA 5U4NA 3RFAA 3HPAA 5A8QA 1NEYA 3B8DA 3OOQA 1GCYA 5CGMA 3ONBA 5I3GA 1GW1A 1ODUA 1VAHA 2GDUA 3BV4A 1LDCA 4H9YA 4J7RA 1L6YA 4BWLA 2J47A 3MCMA 3TQVA 2VXNA 3CJPA 4A3UA 4KCTA 2V2DA 4R9OA 4JKMA 1V8EA 5DXYA 2QIIA 3FKRA 1AODA 2XVPA 1UWRA 1BFNA 2W92A 3BZJA 4BQ5A 1NP0A 3C0JA 1PWMA 1WV2A 3TAOA 4U5KA 1HJQA 2WB5A 3RX2A 1FWDC 1UUQA 1N82A 4QQUA 1JZ2A 1L6GA 1W9DM 1VRXA 2CETA 4WF7A 3BGAA 2G4JA 3AYRA 4KRZA 3TQKA 4AY8A 1XC4A 5M2FX 4EANA 2AMXA 2ZTKA 1E0XA 3TZFA 4INFA 5HWJA 1V6YA 3WLMA 1TE1A 3QY8A 3VNMA 4RDWA 3VNKA 3GDBA 3IIXA 2V5KA 3W29A 3UXAA 3MHUA 2D2JA 4UB9A 3VGHA 1C8XA 1UR1A 4XG1A 5HR6A 3KCOA 4MUPA 3AYSA 4NRSA 1VFUA 2PBGA 1WDSA 3UJ2A 4AD2A 2AAAA 5AHEA 4ERGA 1PYMA 3OB8A 1YXYA 4ZL1A 4MFDA 3GS6A 5I03A 4NG3A 2WJEA 2GUBA 2VT0A 5H6HA 1TPVA 2ZXDA 3NEVA 4MY9A 1ISWA 3S9YA 1KRMA 3E02A 1TCDA 4I90A 4RDZA 3DH7A 4RXGA 3ZVIA 3T2PA 3TYEA 1CWYA 5HBFA 4UZSA 2J74A 2E25A 4AXKA 3ORWA 1GTHA 1TMHA 4DEFA 4GJ1A 3LZ3A 5DRCA 2RJGA 1ZLPA 1PCWA 3EX4A 1QT1A 3PBWA 3TWAA 3NO5A 2CHRA 1JFHA 3HO8A 5C7HA 1KKOA 1XIMA 1PDYA 5CZ0A 3OA5A 1TO3A 1EL3A 5A8OA 1F4AA 2NT1A 2WC3A 4MZ1A 3N17A 1W3TA 2GVLA 3TLQA 3ZSSA 3GE7A 2Y4SA 3AYTA 2Z1VA 4O18A 3RCNA 2D3NA 4PCPA 2YL8A 3TP4A 3FYPA 4NI3A 3BOLA 3AS0A 1C91A 3EA1A 1TV8A 2QMJA 4UTMA 2JF7A 3M44A 1K9TA 4LCSA 1U5VA 2BVTA 4M24A 5CLTA 4M80A 3W1RA 1WOBA 4HJFA 2ZXBA 2JQXA 1FKXA 5D4YA 1JJKA 3VDGA 4JTSA 2P53A 3PBVA 4N9EA 4BF5A 3GKFA 1K9DA 4B3LA 4B92A 1P0DA 1ITXA 2E8ZA 5C2GA 2OOGA 5CBJA 1BKHA 4HU3A 4OE7A 3CZ8A 4I9TA 1T41A 4PULA 6TAAA 4ZQOA 3B97A 4RL3A 4WDUA 1QBBA 4U33A 2EG6A 2FZ9A 1EGZA 5CC7A 4GQ0A 3L0GA 3KBMA 1SFJA 2ALRA 3VIGA 2CWXA 3ARVA 1XIIA 2ZVIA 1NARA 4KWWA 1S1RA 2X40A 4X2RA 4P8WA 3WDHA 2BOFX 1QO5A 1Y5WA 2P0OA 5J5RA 2YJQA 4IQJA 3BSMA 1SM9A 3CV6A 1X1OA 2EKCA 5D2YA 4FXRA 4MOZA 1RAKA 3GDTA 1J8VA 1QU4A 3TOPA 5KZMA 5IBXC 2GUUA 3UJRA 3W3OA 1HF6A 3P80A 2O9RA 2WM1A 1QI0A 2ACSA 4E38A 2QJGA 2RDXA 5AC6A 1I0BA 2P10A 4LBSA 2F2KA 2FGBA 1RXOB 1DP0A 4B5TA 2X0SA 5F4SA 1I2RA 4NKCA 5CAHA 2OZ0A 3GR8A 1W5NA 1PSCA 4GZEA 4Q8TA 3CHFA 3PAJA 3WH7A 5BRBA 4JN7A 2DZAA 3L4XA 4F9DA 2Y61A 3A3WA 3O0FA 4BQ4A 3QSTA 2FPTA 2CU0A 1YDYA 4MWAA 2DZBA 1OFAA 2EPOA 2CHOA 1E0TA 3TN4A 2WBGA 1N8WA 1C9DA 1U1JA 1A49A 1Q7QA 4HCLA 4PSRA 5D03A 3UGVA 3W2JA 3WLTA 3W28A 4XAGA 2PODA 4MZYA 2Z27A 3WD0A 2Z2AA 1C92A 3A3XA 4GUFA 2GL5A 3NL6A 1VBGA 1KFLA 1V6XA 9CGTA 2Y63A 1RJQA 1TMQA 1W37A 5AYIA 4KERA 4GO9A 3KTCA 2ANUA 1HJVA 2Q71A 3QRHA 4QQ3A 1XISA 3AHYA 1XLCA 2GJRA 3BMXA 4LVBA 3H21A 4Z1BA 1M03A 4UCGA 3EOLA 1H63A 2F6KA 5AYYA 1MEHA 1L6WA 1B1YA 2P1FA 2RJHA 3K4WA 3CNYA 1HGYA 5M03A 2XZ9A 1IXNA 1XLKA 4NY2A 3IVTA 1QPQA 3GXTA 4IMGA 2VEIA 4AD0A 1M65A 1K4HA 1M7PA 7XIMA 1IEWA 3FDKA 4R85A 3BJSA 5A5WA 2JF6A 3CZLA 4HKPA 5CSSA 1FHUA 1EXBA 2Y8KA 5REQB 3PR2A 3MS8A 5KZDA 2RDUA 3HURA 1F3TA 5A3HA 4IP7A 3IWPA 4KCUA 2ATMA 4NZ4A 3OG3A 4JYFA 4HPNA 3R2GA 3LUTA 1AW2A 5D9PA 3IK2A 3R25A 3ZJ6A 3ITYA 3GKAA 1HG3A 3LNPA 1GEQA 4DZIA 1QTWA 4PMUA 5C54A 4YJ5A 5JBEA 2E9BA 4M51A 4S3EA 1AL7A 1H7NA 5BRQA 1I8JA 3M5VA 2HVMA 3C2OA 2OVLA 3MV01 5GQBA 2D2GA 1DVJA 1C93A 1O5QA 1TA3B 2ZRXA 3GHRA 1Q6CA 4JTEA 5HDRA 1HNYA 1XH0A 3AWNA 2A7PA 1W0MA 2PDKA 1JUEA 2R1LA 1RPKA 1W6TA 4OGZA 4IM4A 1EP3A 1OB0A 2ZRVA 2TMDA 5LNWA 3SGUA 5BMWA 4V27A 4LCQA 1EJWC 1M41A 3VGEA 2YW3A 3SRKA 3WF3A 4JL1A 1KXQA 2VRJA 4Z1AA 4C6OA 4OBTA 4NSBA 1VYPX 2WCGA 4QS6A 5PTDA 2G41A 1UROA 3T8LA 2GWGA 1YIXA 4U3AA 4CQ9A 1GOMA 3L21A 1KBIA 5HNRA 3EWUA 3GUWA 1CXFA 4GCAA 2BZNA 4WGHA 5CG0A 1GKQA 1Q6RA 1LWIA 1TQXA 1G6CA 1X96A 4MAVA 3QFWA 3T08A 4ZZ9A 3TCEA 4QJ4B 2QUNA 2QDEA 3T4CA 3SCTA 5LA2A 1QASA 4Q4PA 3IEBA 4AIBA 3KWXA 2YFNA 3R8GA 4C90A 2DIKA 2BGSA 2WVVA 1MW1A 1H7XA 1YMYA 3WL0A 4KFPA 1P0EA 1WUFA 1WDDA 3MZ2A 4POCA 1J18A 4EAYA 4JTFA 3WLRA 3IPWA 3E9AA 4DJEA 1E1CA 1REQA 1JL8A 2R1KA 3QOKA 1EA9C 3VNLA 4PRWA 3MBFA 1RR2A 1IT7A 4QLJA 3WF4A 1IT8A 2VR5A 1D8WA 3GZ3A 3UW6A 4S3BA 1AW5A 4GC3A 3URAA 4FXSA 4AISA 4NRRA 2MNRA 4LUJA 3VIKA 2XU2A 4LYQA 4MB3A 1VYRA 1ZTVA 1FHDA 3GH5A 3E0VA 1TE6A 1XLIA 2FKPA 4N4QA 2YXGA 4J35A 4Z0JA 3AHVA 2GQ8A 4HOXA 2Y2WA 3R12A 3KDOA 3H2AA 4GH1A 5L9FA 4N7QA 5E0CA 5CSUA 3KL0A 4Q6JA 3GYEA 1KRCC 1OK4A 2F7FA 4ZCWA 3KCJA 3ARTA 1S38A 3W7MA 3ARSA 3VOFA 3BO9A 4PB5A 4J1OA 3TH6A 4FNSA 1WA3A 4Z0SA 3U7BA 3PWGA 2XINA 5E6YA 2CLMA 2AL2B 2JKEA 4GNVA 2A3BA 1PHQA 4X9YA 4PTWA 3MO4A 1FWRA 5I3JA 4ERIA 2YX0A 4ICMA 3W26A 2UZ9A 3TMQA 4DM1A 2A3EA 3B0XA 1X1ZA 4MM1A 1GVOA 5CXPA 3R8RA 5FJOA 1IZJA 3N2BA 4AEOA 1I2PA 3WF0A 1XSKA 1VEOA 4D1IA 3DG7A 4CCCA 3NQ2A 2VX5A 4Z1YA 1TJPA 3EKZA 1KWGA 3DAQA 1ML1A 3SQSA 3VIJA 1Q6DA 3WUGA 2PWDA 4UOZA 4JQAA 4DF1A 3EDDA 1A50A 2E77A 1X1NA 2PURA 5J8LA 2OXNA 4L9XA 4AF0A 3EPMA 3TA6A 1UYQA 2FVLA 3QJAA 3LCGA 1W17A 4GNJA 2XFWA 5JVLA 2FFCA 1MUMA 2VD9A 3RU8X 3SCUA 3ERPA 4NJIA 3HN3A 1F76A 1EGMA 1LG2A 3FVMA 3B04A 2FHFA 1NM9A 4HMCA 3DHFA 4IIEA 1EC9A 4IIGA 1UMYA 3ANVA 1PKMA 1BTMA 3QF0A 4LFYA 3GXPA 4TTUA 4E2VA 3FA3A 3B0PA 2CBJA 1HO4A 4KESA 2V5JA 2D23A 3KX6A 1R2RA 4NZFA 3I3BA 4YVVA 1SQ7A 4V1YA 3L4TA 1D8CA 4UQCA 2FB3A 5HMEA 2F38A 1WUEA 2ACUA 1RJRA 1VYSX 3VUPA 4K6AA 1VJIA 2J7BA 3JRKA 5FL0A 1T99A 3H6OA 3W71A 1RJPA 3W7OA 1GYNA 3W0KA 1N2VA 3GFYA 5EPDA 4TQTA 1J0JA 3E12A 1NQ6A 2I17A 4L61A 2Z1BA 3W27A 3WQ8A 3A21A 3F4WA 2C16A 4KQNA 3L23A 3I4EA 3C2FA 2QVHA 1CXEA 2PDLA 1TV5A 4GQRA 4AZ6A 4I8YA 1GTEA 2GLKA 1DEDA 3OBAA 1GVIA 2WVTA 2PDYA 4G9PA 1ZFJA 4CQAA 4S23A 4MNJA 3QHOA 1HJSA 4FF5A 3TJXA 3VOIA 1P0KA 1IEVA 2CNCA 4HA4A 4B15A 2Y0FA 3BAWA 3ICJA 3JUGA 3WFAA 4TIMA 3VM5A 2JIEA 5CAKA 4GD0A 4C7GA 4NL1A 3MANA 1NFGA 4O17A 4ZOEA 4DUXA 2V69A 3KVJA 3DXIA 3QW4B 3UCQA 3UY7A 2PDQA 1JDAA 1XLHA 1E70M 1EP2A 4EPEC 4PUDA 2J77A 1TREA 4JGDA 1B3YA 4RNHA 3GIQA 4UTTA 4DZAA 2W62A 2A21A 2VFGA 1R9ZA 1F05A 3GK0A 2QAPA 1TR1A 1DV7A 1H1ZA 1OJXA 1K6AA 3EB4A 1JXKA 1O4UA 3IAPA 3LX9A 3KP0A 1XRSA 4IJBA 3K1GA 4DWSA 4F0KA 5EMMA 2D2HA 3NOEA 4FNRA 4MY1A 4P7QA 3GXFA 3G18A 4JFTA 1F3EA 3VIOA 2IKIA 3CTLA 1E4LA 3NL2A 1E15A 5BU9A 1PIFA 2QCGA 3KTXA 1WO2A 2O9PA 4ZA0A 3W7IA 2XPKA 2X1RA 2ZX7A 3ZVHA 3RJYA 3QGKC 5GJPA 3GIPA 4URIA 2Z29A 1AD1A 1PJ9A 4UQDA 3UCDA 1OT1A 4AG0A 3H70A 3LI1A 1TPEA 3EWXA 3VIFA 4FAMA 3C2EA 1SMDA 2ZVRA 4HNOA 2QV5A 3T1GA 2YA1A 4H41A 3VABA 3ATZA 4BK9A 6REQA 2PRLA 5AB3A 3SEPA 1F4HA 2DPEA 3KS5A 4N02A 5H8MA 1PCKA 2X1UA 3IV3A 3CASA 1D7KA 1ICQA 5TQLA 1EJRC 3W85A 1UKPA 3H23A 4HT3A 4OKDA 4IHCA 1UR3M 3LCLA 1DE5A 1JF6A 3CZGA 3WLJA 1LOLA 3SN1A 1ODZA 4HGXA 4D6GA 3VKCA 3WD2A 1ELSA 2VNCA 2XGIA 4YTQA 2CZ5A 3RXZA 4CCDA 5G4HC 1ZJHA 2J75A 4K39A 4QE5A 4IPIA 3MWAA 4KCWA 1E1EA 5AHIA 3KVMA 3MKVA 1W2VA 3IV8A 1Z8AA 4J40A 2PS2A 5HQMA 3L0KA 3PVFA 4Q4MA 3UP8A 2OU4A 1UZ4A 1YBQA 3D47A 2Y85A 3IRDA 1B3WA 4C7FA 1UD3A 2BVYA 3D46A 1JAEA 3HA1A 5A6SA 5I09A 3IJDA 1QBAA 4Z1DA 1BYDA 5K7JA 3SRFA 5HJYA 1OADA 3BAKA 5HK4A 3EDKA 3RM8A 2PI6A 4B9ZA 3E2RA 4UMBA 2D0HA 1BKSA 4PBEA 2CZFA 3NR0A 3W23A 2Y62A 4NZJA 1JCMP 5XIMA 2J24A 2YBTA 3M16A 4FXJA 1KV8A 2HNEA 4WXYA 1V6VA 4U10A 5E9XA 3FA5A 3QH2A 2IPGA 4AYGA 1S1PA 4JN8A 5DO8A 1IEXA 1MXGA 1WBJA 4O1BA 2PP3A 4GZ7A 4C1LA 2C18A 1NOWA 3OZOA 3WLLA 4BI7A 2J8FA 3NPVA 1DIKA 4AX7A 1U22A 4QCFA 3S3GA 3QPEA 1TPFA 2DZVA 1PYFA 1HO1A 2GJPA 2VOTA 1OK6A 4H7ZA 1UBSA 3M0VA 3EYPA 4CEXC 1K7XA 4OHQA 4QSFA 5D33A 1LBFA 2ZZ7A 5BCAA 4A3HA 4FLOA 2V68A 4AX6A 1W5QA 5C5YA 3FX4A 1XBXA 1QNVA 1SW7A 4Q4OA 2VM8A 4DO7A 2GDVA 3APYA 2CXEA 3UG5A 5H91A 1NF7A 1ZCOA 5AHNA 4KEMA 4JY8A 3CT7A 5HPOA 4C6FA 1BLIA 1QHPA 3OLGA 3DYOA 3W73A 3UYCA 1RCOB 3TC3A 2PUZA 4L4PA 3VD5A 2O4QA 5HMFA 2V67A 4IUGA 1B0IA 1UUOA 3F5JA 5A6BD 2YCIX 3RM4A 3CAWA 3MHGA 4REQB 1R5YA 3ZLHA 4NIRA 1Y8BA 1TVPA 5F4WA 3DG6A 1KRAC 2Y24A 4YTRA 1OX4B 3I4KA 2YZ5A 5AN7A 1MFUA 1M9HA 5HWNA 1RP9A 1H1NA 4M6QA 3QYQA 4XTIA 4J3TA 2DT1A 3PTDA 3VKJA 3OEXA 3DKJA 4L1GA 3WQCA 2PGEA 4WY0A 4CN1A 1OFOA 3BLKA 3GSMA 2G3JA 4ADUA 4KWOA 2CWNA 3INPA 4W8LA 3AS1A 3F03K 1POJA 1YXDA 1JPIA 4WY0B 2DIEA 2YBUA 4FNTA 1LROA 1DJIA 4KH2A 3WQVA 3LNMA 3RR1A 1CENA 3S2CA 2C13A 1B3OA 1CW2A 4OUIA 2LLEA 2GZXA 4KS0A 1K8ZA 3BGGA 1M68A 5K3VA 3D0CA 3LZ5A 2OQHA 3FKKA 3T0BA 1VEPA 2WVUA 4IFOA 2J9XA 3ENLA 1GYLA 2OT1A 1G9HA 3JZEA 2F84A 4HBKA 1VR6A 3AI0A 2EG7A 3GBEA 2E4TA 1G4EA 3PS7A 1UA7A 1X8FA 1ZBVA 3UZWA 2E5DA 4TVUA 3O05A 3DZ1A 3WDIA 2PBOA 3D3AA 2XN2A 3I6EA 4JHOA 2V5CA 4JCMA 3RF9A 5LIKX 1IXQA 2YCLB 4PMRA 4Q4SA 3O16A 9RUBA 1XRFA 2JGYA 3PG8A 4IMDA 3AZTA 3CEPA 1E4IA 4GVGA 3HPFA 1KM3A 2BODX 4Q8MA 2E8YA 3VNJA 1U1HA 3H2FA 2BOEX 3TK7A 4G8TA 4RXFA 3EX6A 2VD8A 2POTA 3HPXA 2PU0A 3IGUA 4HTYA 4NNCA 2XVLA 1TJRA 3IVUA 1R2SA 1F5ZA 2ASHA 1MW3A 1IT0A 4LALA 3NSNA 4JEQA 3T4WA 1XV8A 2JIWA 3QFEA 4WKAA 5JXQA 2J7CA 3CXOA 3M43A 1KR1A 3LG3A 3GNRA 4NX0A 3VD3A 1AZ1A 1W3JA 5FOOA 4ZB0A 1YDOA 2TPSA 3QR1A 3NQDA 3HIJA 4ZQNA 3H8AA 4LAKA 2XJ7A 2YCJA 4H9VA 1OYCA 1E43A 3DFSA 4JDYA 1XBYA 1JDDA 3G0XA 4G1NA 3SCOA 4TMCA 3QR3A 4DBDA 2CLIA 1E0VA 1H51A 1AZ2A 1VPYA 4P2VA 1BXCA 2PB1A 3HMJG 3IGXA 3N2OA 4IWWA 4IP5A 3GG1A 5T8GA 4JTKA 2H9AB 3F2DA 1JGIA 3LTSA 1ZRQA 3ABOA 4HMEA 1KRBC 3POCA 3W02A 3LXAA 5CBIA 4NAEB 3Q45A 4XX6A 1NDYA 4HOZA 2VZOA 4R3UA 2XWEA 4K7VA 1QO2A 1K7EA 4UQEA 3W7RA 2WM0A 4DELA 4W89A 2J6XA 4FP1A 1NWSA 3TYBA 1RPXA 3N6HA 3DECA 4GRSA 4MZ8A 1PE1A 2DT2A 4PUNA 1PHWA 4YLWA 1KTBA 5EA9A 1LLOA 3V75A 3VNDA 1H0IA 4NJJA 3GU9A 1GVSA 3OVRA 1UR8A 4GH3A 1TUFA 1CGTA 2O55A 2YXOA 5FIPA 4C6DA 3VNIA 3VE9A 5CJMA 2HXUA 2WPGA 2WCSA 4CNPA 5CZSA 1H61A 1E5JA 1XDMA 2R6OA 3MUCA 5AHLA 4L80A 4F0MA 2OCZA 2KX9A 5HNNA 2TAAA 2V0TA 4R34A 2G3FA 4FNQA 3A13A 3E5BA 1IIGA 3W1MA 3DC8A 4UMCA 4WOZA 2QF7A 5K2ZA 2FPVA 1R87A 4GXMA 3S9IA 3KEHA 3VDAA 3KTSA 5D09A 2VX4A 5AY7A 2Y8UA 4QITA 4IX0A 3W7DA 4WX2A 4Q33A 3V4BA 1EB3A 4ZE5A 3FHQA 1KD0A 6XIMA 1ZAHA 4S3FA 4GLEA 1JXJA 1TA3A 3VZYA 1Q13A 1RALA 3USBA 1GZJA 1FWAC 3LU2A 3NO3A 3WQDA 1JDCA 3WD1A 5BROA 4YHGA 1QOXA 3VDBA 2F61A 5T9CE 3U7VA 3PZ9A 1W5OA 3VZZA 1OCJA 2E3ZA 3CUZA 5I0DA 1B31A 3TXZA 4XZWA 3OA3A 3TXVA 1HVXA 5D30A 1ENUA 3GNPA 4S3GA 3VOGA 5LIUX 1NDWA 4CVUA 5DEZA 2F6XA 3W4RA 1XCFA 3SJ3A 4PTVA 2BVWA 2W6RA 4UR8A 3S42A 3I65A 4AYSA 1W32A 1L6SA 1EZ2A 3C52A 1XG4A 5CCZA 1JCYA 1E6QM 3B8UA 4NAFA 1Q85A 4JFSA 1KFBA 1X6NA 4FIRA 1MXSA 4AB4A 4IOTA 4RK8A 3ZZ1A 1LRNA 2PAJA 2B31A 3O0KA 3VOCA 4UTWA 4AZ5A 4WK9A 4MDOA 3K8LA 1HUVA 1ISYA 4U3CA 3GYCA 3MYPA 3NQ7A 1GVQA 2B0MA 2VEKA 3C2VA 3ALGA 1R38A 2FZ8A 1W1VA 5A2BA 3RPMA 1CGWA 4O16A 3PANA 2BX7A 4Y9MA 1DXFA 1QXLA 2GSJA 5I3HA 4CD4A 4F9JA 3CH0A 3EKGA 4E3TA 5DY3A 1JR1A 1OWQA 1PKNA 1EXPA 1EP1A 1KW1A 4JD4A 3UR2A 4GQQA 1W1IE 3BK0A 3TUUA 2XSBA 4CCEA 1BF2A 5CPQA 3N12A 3H7VA 2WNNA 2FVMA 3RLHA 2MANA 4DAIA 4YIWA 1P7TB 4K1GA 2DSUA 4A2SA 2BLEA 3P74A 4DBWA 2NX9A 4G7EB 1JUKA 7TAAA 3LBOA 3NQ8A 3B40A 3SCSA 3VINA 4G5DA 3NO1A 4WSJA 5DMLA 1CLXA 4XD5A 3HGSA 1OINA 1OVDA 1VP5A 3WK3A 5HNUA 3C8FA 4DWDA 4K3ZA 3ZR5A 3GTFA 2PPGA 2OEJA 3VYLA 1WKDA 3G24A 4GGBA 1MYRA 3IIVA 1XICA 4B2DD 1JGMA 3CHCA 5D2TA 3BARA 1BWVA 3GXMA 3PPHA 3RNDA 4O0ZA 3CIVA 2NSOA 1AH4A 4GVHA 1PZ3A 1FCQA 3CO4A 3W2LA 3TROA 1XGZA 3DFQA 1VF8A 3KRSA 3P82A 4QROA 3N4EA 3U0HA 1Z6KA 2OWXA 3CC1A 2GJNA 1LL4A 4KCVA 1V7AA 4QE1A 4JKKA 3TC6A 3W01A 2E0PA 2BXZA 1Q4WA 3IIZA 4O0KA 1VHCA 4BCEA 4LUSB 3MUY1 3VIIA 1ZUAX 2PTDA 3Q65A 1H60A 4Q8UA 5CPMA 2FHCA 1SJDA 3ES7A 4MY8A 3T40A 1WXJA 4IX2A 1KCXA 4Z17A 1Q2RA 1KTNA 1XIJA 4Z2GA 4RE3A 3L4WA 3GDLA 1NFPA 1Z7AA 2V38A 4JTJA 1DL3A 3NXFA 3MP5A 3OLDA 1J0ZA 2BXVA 1XPGA 2DSZA 3ITLA 4RZ4A 5BXTA 1H0GA 2WWDA 3U48A 5CPTA 5FA5A 1CLKA 1JULA 3NUKA 4PR4A 3RMJA 3WQ5A 3HFYA 2Y1HA 4GMEA 1K9FA 3GNXA 3IJ8A 3NGFA 4LF2A 2EAWA 2NUWA 4JIEA 4IIHA 1FP8A 3GHSA 2NUYA 5FEXA 5BXPA 2A3AA 4C6EA 2QUVA 3LBMA 3E38A 3WSUA 1VJZA 1S2WA 3W24A 1R3RA 1XGDA 1O60A 2QGHA 1OM0A 3DU0A 4ZO9A 3XIMA 2OKTA 3PTKA 3T0DA 3PJUA 3V0UA 3TTQA 1V6UA 5AHFA 5TNVA 2J6VA 4OV4A 2H3DA 4KGLA 4JCLA 4EPDC 1W31A 1AA1B 3DYPA 2J27A 4P5UA 3B05A 1HP4A 1E3ZA 4D6HA 3SIZA 4TOQA 5FJTA 3LI0A 3APGA 2XIQA 1H50A 1SFLA 3AXHA 1J96A 1XDJA 3FNDA 1Q6LA 4JKLA 3T42A 2ZC8A 2OZ8A 3FS2A 2ACQA 4JOMA 4DQWA 1EJSC 3GAYA 3ECQA 2AKZA 2F2HA 3WK0A 3H2OA 3O1NA 4MWAB 3VPLA 1ME8A 4U31A 4DJED 3VILA 3NOYA 2JEQA 1UWQA 3GC4A 4CUCA 1OG6A 5H8PA 4N2YA 2VJXA 2PDFA 1ISXA 1NDVA 3PFRA 1BPLB 1VPQA 1XRTA 5EFFA 3PJTA 3PUDA 3UYIA 4OFCA 3KUMA 5DY2A 3R0KA 3DDMA 3MMUA 1N8FA 3GR7A 1HKVA 4P8VA 5GVJA 4O8RA 2CERA 1DQWA 3EMCA 2JKAA 2VO5A 4E2DA 3WBXA 2QJNA 4ECLA 2CLEA 1QDSA 1LYXA 1ZU8A 2OX1A 4RV8A 3W07A 1VC4A 1CNVA 1RBLA 3UG8A 5EU9A 4JAWA 1HT6A 2A7RA 2Q8ZA 3LD5A 4UNIA 1LWHA 3AWOA 4W4QA 3C6CA 2GGEA 3UZ5A 1GT8A 1W9PA 3P0XA 4WDXA 5HPCA 1E5NA 4NILA 2D0FA 4OT7A 4ZO8A 3P5ZA 5GNZA 1E72M 2EPHA 3USZA 4DIAA 1JFXA 1ONWA 1HVQA 3C4UA 3CQIA 2VC6A 3LM3A 3UWVA 2PC8A 1UQYA 1TTIA 3W2UA 4GPNA 3AROA 4FALA 3W70A 2NZLA 4QX4A 3DBPA 1JDFA 4TX6A 3AIBA 3E0LA 3KS6A 3PUOA 4H83A 2C3ZA 1PZ1A 3AJ7A 2XUCA 1WZMA 2XGZA 3NQAA 1XX1A 4NI8A 1BSIA 3FFSA 1SZNA 2YBVA 2ZXAA 3CUHA 2RAGA 2ZDSA 1A3HA 3SADA 2WVSA 5F1VA 4YTTA 1Q6QA 3CHEA 4YHEA 4LQ1A 1RH9A 3TJIA 2OLHA 4RW3A 2GWNA 2IPWA 3IGSA 1MNZA 5IXEA 4AFYA 1OFPA 3BAYA 4I7WA 3WNNA 4ZQCA 2EPMX 4W87A 4IIBA 3SCNA 1RQBA 1JRBA 4Z2HA 1REQB 3TV8A 4AWTA 3E1F1 5ENLA 2Z6IA 1W1YA 4W9TA 1XYZA 2V2CA 5CGQA 3PTMA 1B3VA 4WD0A 4CCZA 1B4EA 3WBAA 4K36A 3AZSA 1XLBA 4O52A 4Q4RA 3LHTA 5D9OA 3T7VA 3SFWA 4V1XA 4O12A 3GTHA 3HU7A 1E1CB 2VGFA 2RGLA 4YTSA 4Y9NA 1KM1A 1AD4A 2CBIA 2QAFA 3WLQA 2J7FA 1EEPA 4MDPA 2Z0IA 3UZXA 1OX4A 1EHNA 3W86A 2TRSA 4DXKA 3SN4A 4WJ8A 1QHZA 4YTUA 4IH3A 4P61A 3G3DA 2CHNA 3VI2A 4CKQA 1QPNA 4TX9A 3T9PA 3LHZA 4YPJA 2X8RA 3W1NA 1X38A 5D2VA 3QQWA 4AEFA 1H7OA 1ICPA 2VVSA 4A2RA 4XIMA 2YR1A 1EBHA 1LUCB 5LHFA 4ZMGA 1QUMA 5ABTA 3VM7A 4OJYA 3T81A 3QC3A 4WSHA 4GHRA 5A69A 2OO6A 1WDWA 3GD6A 3OZMA 1OFEA 4K68A 3OIHA 4GFSA 3WCZA 3AUOA 3STFA 1UKTA 5AHMA 2NX1A 3FJLA 2Z00A 5C9ZA 4R5EA 1V3KA 3UJEA 1A5NC 3P61A 4BZYA 1OZQA 1XCWA 2WWCA 2Q01A 4LANA 1EJVC 3I3EA 3W6MA 1J0IA 2Z26A 1DHPA 3SZ8A 1L8PA 3A23A 3HOJA 4EOUA 3CS2A 2CBUA 1SO5A 4JX4A 3G0SA 3DYMA 4KMQA 1UH4A 1O68A 2JALA 3VD9A 4LC8A 5AC5A 3UGRA 1MEIA 2HPIA 2C1HA 3QKZA 4NYUA 4HPJA 4I5RA 2F8QA 3D3FA 1K70A 2DVUA 2DH2A 2IS7A 4MUZA 1S5NA 3DC0A 1CGYA 1L2UA 3OLEA 1J6OA 4AZ7A 4FNPA 3UWUA 3KOZA 4ZTXA 3PZTA 1OFQA 2OLAA 1A5KC 2GPTA 1B30A 1UJQA 3FSUA 2NV1A 4HSOA 4HNUA 5ABGA 1O5KA 2V30A 3REQA 3ZLFA 3TIMA 3G1HA 5KINA 2PWUA 4NVTA 1EPVA 1HW6A 3ZWSA 1FWEC 1KXVA 4NUWA 1DTUA 3E49A 2WCAA 3HG4A 5G1MA 1AJZA 3NG3A 4LUTB 4DX3A 1GQIA 2WMFA 3TN3A 4UTLA 3EOSA 4MYAA 1ZZMA 4WOQA 1R3YA 3BUVA 3EAUA 3VOHA 5I23A 1P6WA 4DYKA 1HL2A 3SUWA 4Y8EA 3M0MA 1RSCA 8TIMA 1UWTA 1V02E 2VMFA 4AMAA 3R11A 4HMDA 3W6YA 1OT2A 1YYAA 2OB3A 5ABFA 3CUJA 1PIGA 2HBVA 1WAUA 5EMKA 3F7JA 3IIPA 3MC5A 4CD7A 3II1A 4O14A 1CXIA 4OWGA 1EOKA 2XVKA 5E09A 1QOQA 2CZVA 5EMLA 1MRQA 2Y6ZA 4QTGA 4S3KA 3QOMA 3NCOA 2I5QA 1VBHA 1R86A 7A3HA 4CEUC 3W7GA 1A5SA 3VGFA 2C14A 3N6QA 4GYFA 4XVDA 1ISZA 1KBLA 3MHFA 1J01A 4FNUA 4J3ZA 5AKQA 1Y7VA 4K8GA 2PWVA 4MJ4A 3L2IA 5MHBA 3BMVA 3VDCA 2AL1A 4O15A 3HQ1A 1FRBA 3WUFA 3MI3A 1PUDA 2V5BA 1TUXA 3CL6A 4RNJA 3UFYA 5BWFA 1TTPA 4D6CA 1TRIA 3SURA 2B7OA 1LRTA 1KC7A 1K7FA 3O2LA 1TIWA 2VP8A 1DPMA 3ABXA 4BJHA 3NZRA 4ILSA 1RA0A 5DN1A 3MKKA 1NDZA 3EEGA 1D3GA 1QJWA 2QVNA 2HWGA 3LHYA 4IICA 2ZA2A 3QY7A 4PMXA 3MSDA 2VZVA 2ESCA 4DNMA 1G67A 4RPQA 3OU8A 1FWGC 3F1QA 1JUBA 4RW5A 1TFVA 4WR3A 1OG0A 1U5JA 2W27A 3COTA 5LZLA 4XWUA 3WD3A 3BLEA 3EBVA 2RDTA 3V5OA 5D8ZA 3GXDA 1DXEA 3UNDA 3M41A 4NXSA 1OGGA 2VFDA 3FXYA 2ZZ5A 5HA7A 1XLJA 3UWQA 3HQPA 4UTFA 3VGDA 3FEMA 4X3ZA 1KR0A 4ZVJA 3CWOX 1FWCC 1XM3A 2VC5A 2XFRA 3M47A 1Q7MA 2CZDA 5DBTA 3FIGA 1SR0A 1LOQA 2POZA 2PDPA 2JEPA 3GTNA 2PGRA 1V0LA 3MPGA 3L5LA 1J2WA 3N04A 1KTCA 1GVYA 3LCWA 2WMIA 1W1B1 1ZBCA 4NX5A 1JZ8A 4KWVA 4HU4A 4R9XA 3A9IA 1KFCA 3LGEA 4QS5A 1EC7A 4X60A 1PTGA 3SUUA 4CNNA 5CQ1A 3KLLA 2A2IA 2FZNA 1AQ0A 1EJXC 4D9PA 4DWSB 1YADA 4BEUA 3EWWA 3CO8A 4UFMA 1DXIA 1XDLA 3GW3A 3AALA 1B54A 3LMZA 4GIAA 3SY1A 5BU6A 3UR7A 4QDMA 2CLOA 2CXGA 4FLQA 4DRSA 2EXOA 4L5ZA 1TPDA 2VYOA 2FGLA 4WHBA 3CQHA 2QJJA 1A0CA 1OYBA 3MU7A 1JRCA 3ES8A 3ZOAA 1CB7B 2RHGA 4EE9A 3HGJA 3WH8A 1OCNA 1H1YA 4AUBA 1J2BA 1E9YB 1W3NA 4FR6A 2R9RA 1S46A 6REQB 3BXWA 3HV9A 3RRAA 4OBSA 3BOXA 3M5XA 3TZNA 3AOFA 3CAQA 1JPHA 3G77A 4DJDD 2PE4A 1VPXA 4H2CA 3ITVA 1RZMA 4IIFA 4XZ9A 3TSBA 2QV4A 3T44A 4QSHA 1W1ZA 5A6BA 3MBDA 5TF0A 4UNLA 2C71A 3ZXWA 1QAPA 4O1FA 1UD6A 3NQGA 3WG6A 3MI2A 2WSKA 3SY5A 1Y5VA 2G5WA 3BH4A 4I7VA 1FWNA 2WANA 2Z28A 3BSHA 2ZUNA 1QPOA 4XZLX 1FWSA 4UUIA 3WEZA 3OPSA 4HU8A 4MKVA 1P7TA 1EKOA 4D6JA 4HN4A 4ACZA 4C6QA 3MMDA 4P7RA 4LCRA 2WMHA 1YTKA 4F66A 4XBKA 3TA9A 3VZXA 1IWAA 1ZJAA 1ECEA 1J10A 3BAJA 1KCZA 3M1ZA 5IHRA 1RCXB 3THQA 4PRTA 3WUEA 2G4FA 1XBZA 2CW6A 2QCDB 4QE4A 4BA0A 2DDXA 1KBBA 1NAL1 4DUWA 6CGTA 1CXKA 3VKBA 3BG9A 1E40A 3OGRA 3KXQA 4ATWA 1W1A1 2HK1A 3UA4A 2QHAA 1UCWA 1RVKA 3I10A 1I1XA 4N4PA 4KETA 1XH2A 4L4MA 5I7GA 2XWDA 3DENA 4JFWA 4PBGA 1W54A 2AQOA 1UC4A 3M0HA 3NDYA 3NQBA 4NZ1A 3WF2A 2P0IA 4HNTA 1K8CA 2VEPA 2VOMA 1I6NA 2G96A 1LG1A 3KOWA 1NWTA 4AD1A 4DNHA 4I3GA 5HWMA 4AY1A 1TZZA 5MKGB 1SVDA 1ONXA 2NWSA 1FXPA 1CX9A 2YXXA 4U4MA 4OTKA 4ZFMA 4TXEA 5FJUA 4G7EA 4ROQA 3XISA 4XQ6A 4NJHA 4LY4A 5EBAA 1XYFA 3NTYA 3EX1A 4HPHA 4PB4A 4DB7A 2VC9A 4MSSA 2DSWA 4Y7EA 5LXEA 3P84A 4GYJA 3FEQA 1DORA 2BY2A 1YPIA 1ZP4A 4LRSA 2TODA 1PDZA 3AIRA 3TW6A 1TWSA 4NZ3A 3WMSA 1VENA 2PZ0A 2PDMA 3GUGA 4E4UA 1QW7A 2QPUA 2PA6A 5FKYA 2P50A 1UP2A 4IMAA 4W7UA 3SGZA 2GSEA 1QR7A 3S2JA 1VKFA 3B8SA 5HUPA 1HX0A 1XQLA 5IDIA 4LH8A 3PJWA 2ADAA 1F6KA 3WK1A 3WDRA 4XB3A 1A80A 4LAMA 2PMQA 2BB0A 1A5LC 1GHRA 2GGJA 4MPKA 3WY1A 4DBSA 1BRLA 1JDEA 1XJBA 4MJ2A 1GKRA 1DHKA 1WZKA 1US0A 6TIMA 5DMNA 4CD6A 3UWZA 2D3LA 5EB8A 3GDRA 4YYCA 3RPTA 1ONRA 3T09A 3B9DA 1MDRA 2WJFA 3P0WA 1QK0A 4RE0A 4FOJA 6ALDA 1Q5MA 4EXQA 5D04C 4AW7A 1ME7A 3W88A 1F8MA 2CLKA 2DUAA 3WNMA 3ZR6A 3CU2A 4J4KA 4XD3A 4XKMA 1IGSA 3CK5A 1BF6A 2XM2A 1AQHA 4ERAA 3G22A 7REQB 1N7KA 3OTRA 2Z1XA 1O7AA 2XH4A 3G2GA 3BJTA 4JYDA 3N11A 5F1UA 1J0KA 1C7SA 3PFMA 3NQ6A 4GUHA 4N0RA 3LM7A 3CHVA 2J88A 4J3WA 2FH8A 2D24A 2Y7DA 1DE6A 1LOSA 4HK6A 4MKSA 1S5TA 3FJNA 2WNZA 1AFSA 4H19A 4ZXLA 2J78A 4Y9AA 1O5XA 5DX7A 4A29A 3KL3A 5H2ZA 4XAFA 4LYRA 4D72A 4RZ6A 3P93A 1AJ0A 4FLSA 1E6SM 4LVFA 1ZCCA 1XYBA 5C9RA 3TJ4A 3QQ1A 1B4KA 4WGXA 2W66A 3B4UA 3CEUA 4A3RA 4HU0A 4QM1A 3IJQA 2QMKA 4PE8A 5I02A 4XAZA 2BASA 1KM4A 4A22A 3DI1A 5I3FA 3ATYA 1SMAA 3M0XA 2W5FA 5BMXA 5SWUA 4HVXA 1EWEA 5B7ZA 5FSDC 3HF3A 3OLIA 2OTDA 2I56A 2AAMA 1B3XA 2NLIA 2XIOA 4GFIA 3L7RA 4DY1A 3O6AA 4DJEC 3GG8A 3TFXA 1X97A 3N14A 3P60A 4UTWC 5E9AA 2WK2A 2P8CA 4H1ZA 2O56A 4PTNA 4PUWA 4RX0A 2CPUA 4ZOBA 1Q3NA 3O3RA 3HPSA 3P3BA 2E28A 1JZ5A 3M0JA 1UQZA 1CGVA 3MA8A 2I57A 4DN1A 1OFBA 3GFXA 4H8NA 2Q09A 2V5LA 3GU2A 3K5XA 2I7GA 1FKWA 1KM5A 3NPXA 3ZS4A 1US3A 3GVWA 3LLFA 3A4XA 4OVXA 3THUA 4GOAA 1XKJA 3Q67A 2IQTA 3SAZA 4LS1A 5I6SA 3LCFA 5ABHA 1SO3A 4UQ9A 4OZOA 2A3HA 3W83A 3CH9A 1E6NA 1DYSA 4MWAC 3L68A 4EK7A 3IJ6A 2PDWA 2P5NA 3M46A 5LGZA 4LPCA 5K4ZA 1BG4A 3IANA 1JI1A 3WIJA 2OOFA 2UY3A 2X42A 2ZX9A 3UXLA 4YU1A 1XYAA 2PDBA 2F6UA 4H6QA 2PWHA 1CXLA 2JBMA 4FOUA 4K2SA 4DXXA 1UD8A 1IWBA 2QLYA 4CU6A 4GCXA 4GO8A 1RY0A 4MJMA 3F4CA 2VDGA 2EPNA 8A3HA 4P8UA 4I9MA 2PFHA 3B8IA 4AXNA 1FY6A 3EGJA 2QIWA 4ZGYA 2NQJA 2D73A 3OODA 5XIAA 3GVQA 4QNWA 1DJHA 4ZENA 4V2XA 2C8NA 1MWOA 3LLXA 4PC8A 4HA1A 4D8LA 3LV5A 5A8NA 1FWWA 3E2QA 3GB6A 4JIQA 2W63A 3ABRA 4B9YA 2BMBA 4WZHA