2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
1HZYA 1YIXA 3B40A 1V77A 3ITCA 1FWEC 2EG7A 1A4LA 4KIRA 1A5KC 2DVUA 4LEFA 4H9VA 3RYSA 4LANA 2VC5A 1XWYA 4H9TA 1RJQA 1EJTC 1GKRA 2YZ5A 3WMLA 1WXZA 2Z00A 4PBEA 2Z26A 1UIPA 1J6PA 2D2JA 2Q01A 3GTIA 2Z29A 4LAMA 2Z2BA 3T8LA 1WXYA 3URQA 2A3LA 2GZXA 1FKWA 4DZHA 2VM8A 4C6BA 2G3FA 4NI8A 2VHLA 4GXWA 2GWGA 2PGRA 3A4JA 1EJSC 3HPAA 1YBQB 2AMXA 3SO7A 1RJRA 4B92A 2Z25A 2DVXA 4ZSTA 2I9UA 1RA5A 4BY3A 1POJA 1EYWA 1I0BA 1J79A 3MPGA 1I0DA 1EJRC 2FFIA 3GU9A 4HA0A 4CQDA 3MDUA 4ICMA 3LGDA 1M68A 3UF9A 3UR2A 3F2BA 4LAOA 4GX9A 1FWCC 2ADAA 3F4CA 1GKQA 4PCPA 3CS2A 4CQBA 4CNSA 4DYKA 4H9ZA 3A3XA 4C6QA 4M51A 1QW7A 1RK6A 4KF1A 1ADDA 2BB0A 2PLMA 2R1NA 2ICSA 4UBPC 3GRIA 3GU2A 5CH9A 4BKNA 2Z4GA 3PNUA 4KETA 2WJFA 3DC8A 3GTXA 4WGXA 4G2DA 4QS6A 4GBDA 3MJMA 1EJXC 2PUZA 3S2JA 4C6MA 2WJEA 1KCXA 4KEVA 4ERAA 1KRAC 4QRNA 3MTWA 4RE0A 3N2CA 4R7WA 4HK5A 1FWFC 4MUPA 4R88A 4RDZA 3O7UA 3K4WA 1K6WA 1ZZMA 3RN6A 1A5LC 1FWIC 1RJPA 1NDYA 3OOQA 4B90A 4KERA 3MVTA 3IARA 3PANA 4C6CA 1FWDC 1QXLA 3IPWA 4C6OA 2FVMA 4BJHA 4DO7A 2HNHA 3DUGA 3EWDA 3PNZA 3RHGA 3IRSA 3ORWA 1KRCC 1V4YA 4LAKA 2AQVA 1A4MA 3S2NA 2YB1A 3QGKC 3FDGA 1NDVA 5HMEA 3AU6A 2QVNA 3TNBA 2D2GA 2PGFA 4I6KA 4CNUA 2HBXA 4KEUA 1RK5A 3TN3A 4QTGA 4GX8A 1K70A 2FTWA 4HJWA 3E3HA 2WJDA 3LU2A 2OODA 4ERIA 1V79A 4RZBA 4P5UA 4YIWA 2FVKA 2GOKA 3RCMA 2Y1HA 3GU1A 3NQBA 4F0SA 4XAZA 3F2DA 2P50A 3FEQA 3GIPA 4GY1A 3QGAC 4B3ZA 4C60A 4F0RA 3GG7A 4I6VA 1PB0A 1E9YB 4WHBA 4J35A 2R1PA 5AKQA 1EJWC 2ZC1A 2RAGA 2UZ9A 4DI8A 4LCSA 4XD4A 2GWNA 4XD6A 4IFKA 2F6KA 3MVIA 2VUNA 1BF6A 1EZ2A 1S3TC 1YBQA 3MDWA 4HK6A 1PO9A 1R9ZA 1UMLA 4ERGA 4G7EB 2UBPC 3D6NA 3URBA 1RA0A 2OB3A 2Z27A 3SFWA 4V1YA 4GYFA 4DIAA 3O0FA 4L9XA 1EJVC 1JGMA 3B0YA 3NURA 2DVTA 2EG8A 1FWHC 2Z2AA 4DNMA 2E25A 1VFLA 3FDKA 1FWAC 4F0LA 4DLFA 3IACA 3IJ6A 2EG6A 3ICJA 1ITQA 4PBFA 1K1DA 3OVGA 3URAA 4EPKA 4Z42C 2R1LA 3E0LA 3E74A 4DI9A 4GC3A 4D8LA 2Z28A 4EP8C 2OQLA 3WZ0E 4EPBC 1V7AA 4E3TA 1FWBC 4IFKB 3UPMA 4GY7A 4C6LA 3EGJA 1PTAA 2VC7A 1NDWA 1ONXA 3A3WA 1KRMA 4IFOA 4C6DA 2O4QA 3IV8A 4PCNA 4ZSUA 1A5OC 2WM1A 3QY6A 4H9UA 1RAKA 1EF2A 3GUWA 4XAFA 2QT3A 4IH3A 4IGNA 3CAKA 1O12A 1P1MA 2XIOA 3LS9A 1YMYA 4KQNA 2ANUA 3MSRA 1ITUA 3F4DA 3S2LA 3PBMA 3KM8A 4KEZA 1IE7C 4DLMA 2D2HA 4IFRA 1YRRA 4V1XA 3ISIX 4C5YA 3R0DA 3LA4A 1O5RA 2W9MA 3OQEA 4C5ZA 1ONWA 4GOAA 1A5MC 3CJPA 4C6NA 4LALA 3DCPA 3PAOA 1POKA 3BE7A 1J6OA 1E9ZB 1FWJC 1KRBC 2GSEA 4DZIA 4WVXA 3QY7A 4C6PA 2OGJA 3GTHA 2R1MA 2YB4A 1FWGC 5FSEC 4RDWA 2PAJA 2KAUC 1J5SA 4EPEC 4R85A 4HK7A 4H00A 4LH8A 3AU2A 4GY0A 2QPXA 3TN5A 3AUOA 4H01A 4IF2A 4KESA 3B0XA 4C6FA 4CQCA 4NG3A 4C6IA 1M65A 2R1KA 4CEUC 1NFGA 4J5NA 2P53A 3TN4A 2VR2A 3HM7A 4L6DA 3GIQA 3LSBA 4IG2A 4IGMA 2IMRA 3OODA 5G4HC 4INFA 2FTYA 1UBPC 1V51A 2AQOA 3S4TA 2I5GA 4H9XA 4CNTA 4C6EA 1XRTA 3GTFA 3T1GA 1W1IE 2Q09A 2E1WA 4RDYA 4RDVA 3WYZA 1M7JA 2HPIA 4LFYA 4H9YA 2BGNE 2HBVA 3E0FA 5HMDA 4IQJA 3ID7A 4C6KA 4XAYA 1FKXA 3K5XA 1XGEA 3E2VA 4XD3A 4CEXC 3LSCA 1GKPA 3K2GA 3JZEA 3S2MA 2O4MA 2YXOA 3LNPA 3URNA 1YNYA 4LCRA 3UBPC 3E38A 3OU8A 1DPMA 2HQAA 4QSFA 4UB9A 5LXXA 2Z7GA 1P6CA 4XD5A 4AQLA 3T81A 1UIOA 3LGGA 1R9XA 2OOFA 1EJUC 4H9MA 4QS5A 1PSCA 4LCQA 4J2MA 1NDZA 3LY0A 4IG2B 4OFCA 4G7EA 3NEHA 3C86A 2CZVA 4XAGA 5E5CA 2HPMA 3QY8A 1P6BA 2Z24A 4EPDC 1XRFA 3HTWA 4PE8A 5HMFA 3V7PA 1A5NC 4GK8A 4C65A 1R9YA 3UR5A 4JOMA 4TQTA 5FSDC 4B91A 4C6JA 3TN6A 2QS8A 3G77A 3OJGA 4GZ7A 3IGHX 3F2CA 3EWCA 4QROA 3MKVA 4NP7A 4AC7C 5A6TC
chains in the Genus database with same CATH superfamily
4P8UA 3HG4A 2NSOA 3U5YA 3PJUA 4KRTA 3NQMA 4NNAA 4MY8A 3UJRA 2YPIA 4L1WA 1W2PA 3BV7A 4HA3A 3A47A 2BFGA 4U3CA 1ADSA 1RJQA 1XLCA 1ZUAX 3R13A 3MSDA 5E0KA 3WMLA 4YTUA 3TLQA 3TLLA 2FGLA 4GWEA 4LAMA 2VGBA 4I8YA 4C7FA 3P74A 1KV5A 4LB4A 3DI1A 2VHLA 4OBTA 1UHVA 1OX4A 3N9RA 1H7PA 4BI5A 3BL3A 4AMAA 1RBAA 1B3YA 5D37A 1B3XA 1I0BA 4AZCB 1HJWA 3V75A 2FFIA 3LGDA 4GX9A 2CITA 4WGHA 1ZLPA 1KBKA 4TV6A 2PMQA 2FYMA 4QCFA 1RBLA 5REQB 1O6IA 3IIZA 1QCWA 4YCPA 3SURA 3ABRA 1X96A 5CJNA 3T40A 3MJYA 1TKKA 1AK5A 2DDXA 4WGXA 1A3WA 2QCNA 4EKJA 1TVPA 3KEHA 1PVNA 1EHNA 4QRNA 4DNHA 3O6DA 3S5NA 2ZUTA 4FLQA 4PUWA 3TONA 1YXYA 5D04C 3L0KA 1K6WA 2WW5A 3RXZA 1V03A 1B4KA 3TZNA 3UXKA 4B90A 4MMWA 3LZ5A 2ABBA 3CPRA 2POTA 4PMQA 1TV7A 3HGRA 1UPPA 1JYVA 1QTWA 2NLYA 2OWCA 1OABA 3B9NA 3HG5A 3TKFA 1A4MA 5JUVA 3S2NA 2V2CA 2GK1B 3EWYA 5IHRA 2C1HA 4IISA 3TN3A 4F4RA 4PB5A 4PGLA 2ZZ5A 3W7OA 3TFCA 1W3KA 1X1NA 3S9ZA 3S9YA 3ENLA 3GIPA 1F9CA 3NEVA 5JIPA 1BGGA 3CHFA 4FMVA 4PC8A 1Q6RA 1TQXA 2R1PA 3QW4B 3N29A 4B3LA 4K39A 4I5RA 1Q3NA 1L0PA 2XFRA 1BWLA 2CLOA 4IGSA 2XPKA 1VJSA 4YTSA 1LWIA 1DIEA 3RCYA 4Z1BA 1DTNA 3LHYA 4D6JA 1GORA 3URBA 2PTYA 5J04A 1LM1A 3AS1A 3SFWA 8TIMA 3OVRA 2HS6A 4OZOA 3VIHA 7REQA 3ZQ9A 1DWAM 3FAWA 4DZ5A 2ZZ3A 2QMKA 3MUZ1 3IWPA 4ALDA 3WDPP 1KV8A 3ZWTA 2OR2A 3IIXA 1LUCA 1IEXA 2EF9A 1XS2A 4N9EA 1FWNA 4HMEA 4EAMA 2I5QA 1XV8A 3G3MA 4XUYA 4PBFA 5A69A 2CLPA 1DXFA 4I9TA 3GG0A 3S5OA 3R12A 1TCMA 4IPPA 5T9BG 3M16A 3DBNA 1XPGA 1R3TA 1DJHA 3EOSA 3KDOA 3EGJA 1XGDA 2NXHA 2VC7A 5HNNA 5LNSA 1HP5A 2FJUB 2J13A 2FDSA 3P60A 4QCEA 1BWVA 1QPKA 4XTIA 3AHYA 4TVUA 2Z1BA 1TMLA 3MYPA 4ROPA 4KMQA 2OT1A 1FVPA 3U8GA 2W6RA 3W2LA 1LWJA 4GG9A 2QT3A 2G97A 4V33A 4P8WA 1YYAA 3TQ0A 2PLKA 4RKAA 3SCSA 3EXSA 1TO3A 1BWKA 1FUYA 2ZXDA 1OGSA 3VMPA 4TX9A 3KRSA 3ISIX 1W8SA 1T96A 4UQDA 1FQ0A 3IJ8A 2NX9A 3TXZA 2D23A 1IXQA 3T78A 3PAOA 1J6OA 4GUGA 3GC4A 4D6IA 1H11A 1KCKA 4I7UA 4NIRA 4X3ZA 6CGTA 1NARA 4XO6A 3OHMB 2C18A 3BMVA 4UTMA 4IF2A 1M65A 1DJWA 3VNLA 3SCNA 1SJBA 1HJXA 1H0IA 1OADA 5D2VA 4IG2A 1EDGA 1H09A 3QBUA 1FH8A 3GFZA 3VNJA 1YDVA 1XIEA 1UKOA 4RDVA 2B7NA 1YNQA 2WAGA 3WYZA 3QOKA 5C8BB 2HWGA 3VKAA 2BGNE 4UQEA 1ZFJA 5HMDA 4GJJA 2X8RA 1WDQA 4JFVA 3MMUA 5DBTA 3T0TA 2QPUA 3VC5A 1G4TA 4IICA 3IGUA 3SCRA 2P0IA 3LXCA 3ZLGA 3E38A 3ZJ6A 5HWNA 3LM7A 1I8JA 4NL1A 1LQ2A 4XD5A 1V6YA 3EKLA 3NQVA 2BDQA 3QV6A 1EJUC 1SW7A 2Z6JA 3M64A 2VRQA 4S3FA 4MG4A 1UD8A 4CCEA 3PB2A 4J2MA 1SJAA 4FR6A 3W7HA 1P5BA 2VO5A 3MMTA 1P6BA 3HTWA 3RM8A 3JUGA 1XIJA 4YYFA 4TQTA 2YJQA 1FH9A 3EEGA 4M6QA 1IZCA 3NL2A 3CUGA 2FGBA 4BCEA 1QI4A 2RDUA 2O9TA 4PR4A 3EX6A 3FS2A 3U9IA 3B40A 4B16A 1XBXA 2HXTA 4WXYA 3B9OA 4UC5A 4I90A 1TYGA 1A4LA 4KIRA 4QAWA 4URIA 9XIAA 4P61A 3WH8A 4J4KA 1C8XA 1MWOA 4HPXA 1VS1A 1EP1A 3CZ8A 3NWRA 3FGCB 2XN1A 4HZMA 3WF0A 2IQ0A 1J6PA 4MY9A 1E43A 3A6OA 5REQA 3D46A 1E3ZA 5AC7A 3L4YA 2VZSA 2NXIA 3P8JA 2VZUA 2VEPA 3V5CA 1CGUA 5B7ZA 3UPBA 3S6DA 4LRSA 4NI8A 2PGRA 3WNLA 2VDGA 8RUCA 3HPAA 1GJPA 1J18A 1O1ZA 1W5QA 1JZ3A 1CCWB 1SZFA 1EPXA 2E9BA 2UY3A 4MM1A 1ZJHA 5T26A 3GU9A 4HA0A 1KFLA 2J47A 1MRAA 5H8PA 4E4PA 5JXQA 2CLHA 4JIEA 3NAVA 4PODA 3S1VA 1WYIA 4CQBA 4JIIX 4L4MA 2XYLA 4H19A 1LRQA 3CV2A 3FSUA 2PS2A 1AQHA 1ADDA 1B31A 4AHQA 4ATWA 1PKMA 4PBGA 4JS3A 3CMGA 4O53A 3BH4A 4LJ3A 2QDEA 2DH3A 3HOJA 1LT7A 3NO3A 1UMYA 5C54A 6PTDA 3A9IA 5LIKX 3E0WA 4W7WA 1OD8A 1R7OA 3VDCA 4AAJA 3RJYA 5JVLA 2XU2A 4D1JA 1QU4A 3AALA 1R8LA 1LT8A 1RJPA 4C1KA 1NJJA 1T41A 4OBRA 3VZZA 1HJQA 2RKXA 3MA8A 3ORWA 3CZEA 1Z7AA 4B4FA 1VFFA 1TPC1 3DHUA 4GMEA 5E9XA 3VGEA 2V38A 3U4FA 1D3CA 4N0RA 3TNBA 1PIGA 1UQZA 2CC0A 3NNTA 3FXYA 1K03A 2NW0A 1QFEA 1XLFA 3RITA 3N2MA 3RPMA 3GD6A 1V79A 3MSGA 3WQ4A 2XDFA 3NOEA 4F0SA 4D6GA 1XSIA 1OCNA 2PF0A 2BBFA 3MV11 1PTDA 3QGAC 4QJ3B 3UG8A 1UH3A 1W37A 2QQ6A 3WQDA 3CLWA 4J3SA 2VZOA 1XI3A 4O18A 4KWVA 3W88A 3NSMA 3GYCA 3P81A 4NJKA 1GVOA 1ME8A 3L4XA 4HN4A 4R7OA 4EWND 2YA0A 4HU3A 1OX6A 1NM9A 3ARZA 1E71M 3ABOA 4HCHA 2CCRA 5DMNA 1GGOA 4ZTXA 1LF1A 1K8ZA 4ZGYA 2VL4A 1EC8A 1Z41A 1UKPA 4PCFA 4DNMA 2Q3RA 2DIJA 2FMNA 2PB1A 4KEMA 3DENA 3IACA 2Y62A 1ITQA 4H3DA 1MQPA 5AHEA 4EPKA 4GQGA 3UESA 3E74A 1TV8A 1JJKA 2PTDA 5LYRA 2QCEA 3W82A 1W9PA 4JTDA 2J9YA 3K1DA 4AX7A 4E3TA 2XISA 1AJ0A 4B3KA 2NV2A 3MI6A 2WQDA 3UR7A 2DU2A 2BNJA 2Z1KA 1YKWA 3H2CA 1IT0A 5FACA 1H4PA 1MUCA 4PUDA 1GPFA 2WMJA 5G2WA 4HMNA 4M0XA 4K2SA 4BF5A 1E40A 1Z89A 2F6UA 4QDPA 1JF6A 1W1B1 2ANUA 4MWAA 3PWGA 3F4DA 3WQGA 1AJZA 2BG5A 3W7LA 4CN1A 3FKKA 1CWYA 2WOQA 4ZQOA 2HZGA 3LTPA 1OCQA 4KCWA 2V67A 2CBUA 8XIAA 4O16A 3TUUA 4LALA 4LYKA 1E9ZB 4KPLA 3R0UA 3V36A 4HN8A 3SJ3A 3FIGA 2HV5A 3WK2A 4H00A 1ZQ5A 1BSIA 1DIDA 2WZHA 2B7PA 1HGYA 3BG3A 4AHPA 3TVAA 5FJOA 3BMWA 4MZ8A 1BRLA 1EGMA 1PEZA 1UBPC 5BWFA 1UZHA 4AZBA 2WNZA 1E6XM 5D38A 1WP6A 2YKKA 3VKKA 1UZDA 2BZNA 5HNUA 4OHQA 3LHVA 3FYOA 3WNNA 1L2UA 4PUKA 1SR9A 1DWGM 1HQTA 4FIQA 3QM3A 4XD3A 5D09A 1E73M 3S2MA 4IPNB 2GUUA 2GDQA 5XIMA 1DJNA 3H4GA 1K9EA 3T2QA 1DPMA 3N2XA 4ZOCA 5CSRA 2YL5A 3Q58A 2DZWA 3EXTA 4UCGA 4Z2GA 4NHVA 1XFBA 1Z42A 3GXMA 1JI1A 2OOFA 2Y7FA 5JIWA 1FOBA 1XDJA 3TC6A 3H7UA 2DZSA 1XYAA 3C86A 3NO5A 1Z9AA 1NEYA 2WQPA 5DMMA 4EPDC 1CEOA 4JYFA 3TA6A 1FXPA 3W7GA 3L23A 3FK4A 4WD0A 1H0GA 3OJGA 4QISA 3GNPA 3ZM8A 4Q4RA 2A2IA 3MKVA 1KBLA 4KT2A 3BAIA 2WPGA 4GNVA 4MFEA 2X30A 5HQMA 3MUY1 4MJMA 4MB5A 2XH0A 1S2UA 1B9BA 1JIBA 2OJPA 3ARVA 1VFTA 2YCJA 4JX6A 2X7VA 5A6KA 3CPUA 5CZSA 1XSKA 1GVSA 3PJWA 1B90A 2ZX9A 4DZHA 4AH7A 1O60A 5HNRA 3F7JA 2CIPA 4I7VA 4E5TA 3G1SA 3BSMA 3MCMA 3WQVA 4DF0A 1WKYA 2J79A 1IR2A 1KFKA 4PMJA 4FI4A 2A3EA 1WBHA 4O19A 1RD5A 4RL3A 3GWQA 1M6JA 1XG3A 5EL1A 1I0DA 3WLIA 1F4AA 1DXIA 3SUUA 4ICMA 3L68A 4H7CA 3JRKA 4PTNA 1K8CA 1WZKA 1XUZA 1ENUA 4WDWA 1IZKA 3HIJA 2D3NA 5F2GA 4RZ4A 3MCNA 2WJFA 2X1TA 3DC8A 2OTDA 2PLCA 3G5EA 3NDZA 3WLOA 5JBEA 1F8IA 4CCZA 3MJMA 3THQA 1D7FA 1AW2A 3WQEA 1OFBA 2FDMA 3PUEA 1QPOA 2FHCA 3OZOA 4BI6A 3B0PA 3OG3A 1MSSA 2REQA 2V2DA 4JTKA 5GNYA 4CUCA 3SGZA 3BSHA 3O6CA 1WDDA 1E9LA 1C29A 1CXEA 1I2RA 1F3TA 3ZS4A 3PZ9A 3QF0A 2RDTA 1MEHA 1XBYA 2OEMA 4UNLA 2YLLA 3SBFA 3VIPA 1OFRA 4CNUA 4OUIA 4NXKA 4AC1X 5F2IA 1K70A 4UMCA 3QV9A 4ERIA 1Y0EA 4NF7A 1HGWA 3NDOA 4GNKB 4HZ6A 1DIKA 1SZEA 2CYGA 2VDIA 1ZRQA 5EA9A 1OIFA 3GDKA 4L6OA 1TPUA 1RVGA 1W1YA 2DEPA 4WKHA 5HMSA 3N9KA 4IUOA 5K7JA 1NIUA 4J35A 5AKQA 4DUWA 3W07A 5KITA 1FHDA 3GVWA 4DI8A 4LCSA 3ZVHA 3MVIA 1J0ZA 5E6YA 4XBJA 3FN9A 2JBMA 5CPTA 3VZXA 3KBJA 3PBGA 4WCJA 3WLQA 3PZNA 2NX3A 3UCQA 4E8DA 4RNFA 4A3HA 1REQA 3QJAA 3LCGA 2HTMA 2YCLB 4FPSA 2V0TA 5CPOA 1FWHC 1V3IA 1VFSA 2DSKA 1AFSA 3TX9A 2MNRA 1J8VA 3KRBA 3OYXA 3HFTA 1IWBA 3UZ5A 3AHZA 4Z42C 3E0LA 3GVVA 1E1EA 2J88A 2I17A 3D0CA 4PB3A 5G1MA 2R91A 4EP8C 3QFEA 4WY0F 3WDIA 3W73A 4JTHA 3W9ZA 3W1UA 2EJAA 2PBGA 3O63A 3SB0A 2G37A 4HOWA 4S2BA 3ALFA 1PX3A 1Q6FA 2EPNA 4JTRA 4EWJA 1QATA 3AMKA 4ZSUA 1JZ8A 2J7DA 1ZNNA 1CXHA 1VBGA 4KGJA 4IGNA 1N2VA 1QNSA 3QV8A 1P1MA 2XIOA 1WV2A 3GZAA 5CBBA 1XL9A 1K7EA 1LG2A 2H8ZA 4KEZA 3AZRA 2RH9A 1K3UA 3AAMA 4WOQA 2GGEA 3DG7A 3OLIA 4A6GA 2YCKX 3PZUA 3PZMA 3NQ8A 1MDLA 2WSYA 2YDRA 4GH1A 1ONWA 1BYCA 2GVEA 2VX5A 4TR9A 1TMHA 3QY7A 4FA3A 5I03A 1E15A 5U4NA 9XIMA 2A3AA 7ODCA 5A6BD 1VRXA 3RF9A 3WQ5A 3AU2A 1XKJA 3IUIA 2ZX6A 4LEQA 3GAYA 3FVDA 3BAYA 4LWWA 4O1FA 4ECLA 3KS6A 3AIUA 4ZR8A 3LV5A 1CDGA 3SCWA 1ITXA 2ZZ4A 3KAOA 2AQOA 3LPFA 1EH9A 4W5UA 4XK2A 4LTSA 2E1WA 1ZBVA 3KRUA 4JYDA 1GZJA 2HPIA 3KZPA 3QLLA 2XSXA 3ZFHA 2WCSA 2NVAA 2BMBA 3ALGA 3PB0A 4IQJA 3W87A 4JTIA 3AO0A 3DAQA 1FKXA 2MUCA 3M6DA 5I2UA 3BC9A 5A6LA 2YXOA 2YOCA 3LNPA 3URNA 3A23A 3EDEA 4XSLA 4XWUA 3IIPA 4XZWA 3GY1A 5LNRA 1VCFA 2FMOA 5AHFA 1VC4A 1VD6A 1ISYA 2PA6A 2WZIA 1BTCA 1W5MA 3QMTA 3GDTA 4QGCA 2PDGA 1X7FA 3WDJA 2GQ8A 3MW7A 3LENA 1TJ2A 4AG0A 3E49A 1ZTVA 5IRPA 1KLZA 4ZQNA 5H1WA 2YZRA 4JNMA 1PYMA 1XRSA 4Q8UA 3RK8A 4I3GA 1HNYA 3MKCA 2GSHA 4JN7A 4ENLA 2WLZA 2O0TA 3WLKX 4IIGA 2XIIA 2I7GA 4ADUA 3L2IA 4QE1A 3UFYA 4L4OA 2J6XA 4HU8A 5BXSA 3PUGA 1ZS2A 2J9ZA 1JCXA 1XICA 1A5KC 3LLXA 4AHOA 1S1PA 4FXRA 1EYEA 2PWUA 1SYTA 2ZICA 3WG6A 4KWSA 1QI2A 2Z26A 3PTDA 2GUBA 2F7FA 4JTSA 1QNVA 3URQA 4PZVA 4XZLX 1PKYA 4L5ZA 1ZB5A 2YCIX 1QNQA 4GXWA 2H90A 1M04A 2GWGA 4AZ7A 5C9WA 3H70A 2YSWA 2OO6A 1CXLA 5CSUA 2POZA 3GH4A 4QSHA 1NVMA 3II1A 3BLKA 5A94A 2C14A 1XP3A 2E6YA 3F2BA 4LAOA 4ZENA 3GYEA 3H6OA 4YYCA 1EBHA 2QMJA 4EXBA 1TWIA 1HX0A 4AIUA 3V0UA 1OM0A 2PDKA 2NZLA 5CG7A 3RDKA 1VF8A 3W76A 3WQOA 1H41A 4LYPA 4JKKA 2GQAA 3G1RA 2GSJA 4G2DA 5FEPA 1Z32X 2J7HA 2ZUSA 3QPYA 3E6EA 4Z1YA 4A2RA 2WJZA 2V3GA 3WUBA 1JFXA 4PMUA 1CIUA 4ACZB 3IVTA 1V3LA 2XVGA 2ZVRA 1WDPA 4CD8A 1XLHA 4JTEA 4UOZA 4CKQA 4ML4A 3EA3A 2PURA 4KERA 4DJED 8CGTA 3MVTA 3PANA 1FWDC 1FWWA 2ZRZA 4BJHA 3LDVA 4M7TA 4W8BA 1KRCC 1CYGA 4B2DD 3G18A 4DXVA 1V4YA 4AVFA 3GR7A 4YS1A 2GJXA 2Y7EA 1KM2A 3QGKC 1XLDA 3AU6A 4UR7A 1NQKA 2X7WA 3H2AA 4LB3A 2WZEA 1PX8A 2ACUA 3WFZA 1OC6A 3L7RA 3SRHA 2D24A 3FEQA 1A5BA 1SO5A 5I00A 3KVMA 3WBYA 4TVCA 3PG9A 3FFSA 3GNRA 3VKCA 3CV6A 3EMCA 4UZUA 1E6RA 3L5LA 4X0NA 1Y7VA 1Q63A 3EDFA 3BG5A 2J78A 1WUFA 5K4XA 1XF0A 1EC7A 4WRHA 3ZYZA 4GUJA 2ZXAA 1N8WA 5CPNA 1EA9C 2X40A 4WZHA 2DIEA 5BXRA 5HWMA 3VINA 5FAJA 3EWZA 3IUHA 1SMDA 4HKPA 4PSPA 3ZZ1A 3C6CA 5LIYX 1VENA 2BSLA 2Z2AA 2C19A 3EOOA 3QH2A 2O7QA 5DXXA 2QYGA 3PJTA 1NFBA 3GX9A 2XGBA 4LXFA 4MKNA 3GC5A 3WLHA 1U1UA 4D8LA 5AC6A 4OV9A 4K8EA 1UD4A 3JS3A 4P7RA 3ATYA 1TZ7A 1JGIA 1F05A 4IFKB 3M5XA 3VGDA 4GY7A 2ZX7A 5LHEA 1HJSA 5BXPA 3A3WA 3KBSA 2DZBA 2Y5SA 4RZ5A 4P8XA 4O14A 3E2SA 3H2NA 3FY1A 4AFYA 3B0VC 3RFAA 1U5VA 4O28A 4FS9A 1B9ZA 1OYBA 4UWMA 3UZXA 4M6UA 1XLEA 5D2TA 2QCDB 2BOEX 3KM8A 2CZ5A 2Y85A 2YFOA 4N4QA 1XDMA 3GXDA 4V1XA 2WXDM 3AYSA 3CASA 1V6TA 3NR0A 2OZ8A 4KW2A 4MOZA 3FA3A 3NG3A 4H83A 2NQ9A 3LTYA 4Z1CA 1Q85A 2YB4A 3AHXA 5FJPA 3W0KA 1HVXA 1OHLA 1Q5MA 2GDUA 3PSWA 3AUOA 5CGMA 4CQCA 4NG3A 4UQBA 1IGWA 3G3DA 3ARRA 3HGSA 4PRTA 2P53A 1BYBA 1GZGA 3GIQA 4JBRA 1PIIA 2VC6A 4ZA0A 3EDKA 4MUZA 3W38A 2HVOA 4Y9AA 4IGHA 3GSMA 4XZBA 3M41A 4IIDA 1ISVA 5AOUA 4XAYA 1MQRA 1RALA 1MNSA 2VCAA 1J01A 1GVIA 4C7DA 3ECQA 4N9DA 4AMCA 3PPHA 1WAUA 1MMFA 2TODA 3TYEA 1L2QA 1DVJA 5BYWA 3VFCA 4C91A 1R9XA 1E1CB 1MZRA 3KVLA 1R2RA 4R3UA 1V08A 3ZLHA 1ZBWA 1QI3A 4H2HA 4U4MA 4L65A 4KWUA 4PL2A 4YNGA 1A47A 1L6FA 2VGGA 3SFKA 3WCZA 1HIZA 4AEOA 1MZHA 4MZ1A 2Y6ZA 4H6RA 3WQWA 4FNSA 5AFDA 3EDDA 2PWGA 3O1NA 3TJLA 1KM6A 3Q45A 3TK7A 1YDYA 1H7NA 4XZHA 4NAEB 1EJ7L 4D1IA 4AIBA 2V5KA 5FL1A 1N7KA 5F4XA 2G50A 3A64A 4J2PA 3TTYA 2PDPA 1D7KA 2OZTA 3CWHA 3O06A 5C6MA 1EIXA 3RM4A 3BGAA 1E6SM 2VQUA 3IJLA 2YZ5A 3KCOA 1XBZA 1KR1A 2NLIA 5D9PA 3EOUA 1QI5A 2XTKA 4GPNA 4HA1A 5AYXA 3QYQA 3MUCA 4P7NA 1FKWA 2QUMA 2VENA 3GG1A 3GBDA 1JL8A 5DELA 1QNPA 4W7UA 4JHOA 3SADA 3R6IA 1OF6A 4FOKA 1X98A 3TAKA 2ZZ7A 2AL2A 2DP3A 2PDBA 4GA8A 3NPVA 4HYVA 2AMXA 2FPYA 4JTGA 4ZSTA 5JMUA 1RCQA 2ONEA 3PBYA 4PTVA 3WBXA 4RXGA 4CQDA 3VPLA 3AISA 1M7PA 3GVQA 1S1RA 2REQB 5LZLA 2X1UA 2W5FA 2X2YA 4EXQA 2VXNA 2PDLA 3M0IA 4JTQA 3WX7A 1UZ1A 4ML9A 1UC5A 1SJCA 2ICSA 1KKOA 4GISA 4IX2A 3GRIA 3QSTA 4YPJA 2Y5JA 2INZA 1A50A 1DWHM 3NZQA 3QQ0A 1OFQA 5K3VA 2GQ9A 4GBDA 4YL2A 3G0XA 2QUTA 1EJXC 2WJEA 1HP4A 1Q8AA 1NWTA 3ZR4A 2IW0A 1EKOA 4TO8A 4RE0A 5HA7A 3DN5A 3RM9A 1DJZA 3LHUA 3K4WA 1WPCA 2J24A 1WUEA 3TQPA 3UZWA 4FALA 3GG8A 3LCIA 1K77A 1ODUA 3OLEA 1R0MA 1XC4A 1TSIA 4JTCA 1DV7A 3CHEA 4DAFA 4V27A 4R7JA 3EDJA 4FAMA 3VGGA 3USZA 2DZAA 1NDVA 7TAAA 2D2GA 2PGFA 2XGIA 4QTGA 3W22A 3MO7A 2YR1A 1GG1A 4O8RA 3O05A 4B3ZA 1DBTA 1PWLA 3NZ1A 4DPQA 1YEYA 2WKGA 5KEZA 3PHAA 3TOPA 3PZTA 3UWEA 1M5WA 2ALRA 2QCLA 2ZA1A 4UFLA 5AC5A 4Q7IA 2ZC1A 3K1GA 4JDBA 4WOZA 4IIFA 2V9DA 3GIYA 4P7LA 2GQ3A 3W29A 3CYJA 4ZQMA 2WCGA 4N9CA 1XH1A 1UMLA 2PRMA 3TMLA 4NAFB 5AYIA 4DWSA 4UQ9A 5EU9A 4EVZA 2PDXA 1ME9A 3NQAA 4GNJA 1OG6A 1TPVA 4WF7A 1DWFM 1DE6A 3PFMA 1TJ1A 3HPXA 1RZMA 2Z7KA 1YX1A 2BS9A 4RCXA 1ESWA 3N2BA 3TYCA 4GUIA 2HSAA 1W5PA 4ZOAA 1UD6A 4ZMGA 3NZPA 2HS8A 4FR1A 1BGAA 1DIOA 3OA5A 1J10A 4IMDA 1TV5A 4LW7A 4D6CA 1S3HA 1ZJAA 1VHCA 4C6LA 2WHLA 2XH7A 2VFEA 3LPOA 3S5YA 1NOWA 2R82A 3MUAA 3BCJA 1F73A 2FZDA 4JDYA 2VP8A 4QIUA 3V5OA 1C7SA 4HA4A 2AQWA 1FWRA 1LL6A 2ZDRA 1OK6A 2CU0A 4GYPC 4LS1A 3EBVA 4H4IA 2ACSA 3WLMA 5HPOA 2OOGA 4J3WA 3LG3A 3VIIA 3RLHA 1R47A 4L56A 1EDQA 4DYEA 3CH0A 3GHSA 3N11A 1UG6A 4JIHA 2PD9A 2QV5A 4AISA 4C6PA 4HPJA 1F6PA 2IUZA 1FWGC 4QQUA 4UTWA 2KAUC 3UERA 3NIYA 5I02A 3T7VA 4MJ4A 1A5CA 1F74A 3IJIA 3U2EA 2QPXA 3SDOA 2Y61A 3KBMA 1ICSA 4CQAA 5D9NA 4C6FA 2R1KA 1XC6A 4CEUC 3N19B 3SR7A 3TYAA 3P8IA 3UXAA 4QJ5B 4FF5A 3W7MA 3MUIA 4IGMA 2IMRA 1OWQA 2OYLA 3C61A 2G3JA 2Y4SA 1B54A 1XG4A 3G1YA 1HKJA 2A85A 5EYWA 3WD4A 4LSBA 1M7JA 2C91A 3L5AA 3N6HA 4NZ4A 3NQ7A 2DJXA 3CMFA 4YU1A 4ADSA 1U83A 5KTLA 4FP1A 3LI0A 3T4CA 4FNTA 3K2GA 2EBNA 1TPFA 1XBVA 4JN8A 1XYBA 4GZIA 1E6NA 3S2CA 4UB9A 4XKMA 5G2IA 4HP5A 2OT0A 2VZTA 1P6CA 3WLNA 2V82A 4HMCA 2WMGA 4O54A 1Y65A 1PSCA 1KBBA 1WQ5A 5DRCA 4RNJA 1KGUA 2P8CA 5FAGA 3M0HA 4J3UA 3GB6A 2ISSA 3Q2DA 4FO4A 1KFCA 1JQVA 5D33A 2VC9A 3QZ6A 4IZGA 2X1SA 4Q4OA 2CNCA 2V30A 3OZYA 5JH2A 4YVXA 1LUCB 1I60A 4MKVA 1PCWA 3FYYA 4GQQA 1TJ0A 1AQ0A 3O9NA 1HZYA 2DZUA 3K30A 3CB3A 3LUTA 2PU1A 3YPIA 3AYRA 1Z69A 1D9EA 3VNMA 4DBUA 1JR1A 4NAEA 4S3DA 3W2UA 4F0MA 1UKSA 3L2LA 3EB4A 3PTKA 5KSWA 3N2OA 2JK2A 1R85A 3FOKA 1OT2A 3ABSA 2OX1A 3N13A 4CLMA 3TXVA 2PU0A 4HTYA 1KC7A 2DQWA 4X0VA 2XH2A 4HSHA 1E4LA 3UETA 1EFZA 2ZX5A 2DIKA 3TV8A 4POCA 2YBUA 4PULA 3HQNA 2XSAA 5F2LA 1ONRA 3KCLA 4DJFC 3REQA 1U30A 2F84A 2E67A 2QGHA 4BY3A 1POJA 2ZIDA 2VKZG 4KRZA 1TPH1 3GXNA 2AGTA 4NASA 3MI2A 1QT1A 1VHNA 4C6QA 3M5ZA 1DJQA 3AXKA 3M0LA 1Q65A 3LGEA 2EPKX 3DEQA 5TF0A 3GHUA 1UH4A 1SZGA 3LRLA 1HL9A 2CBIA 2PE4A 2Z4GA 2P5NA 1ZSXA 1TVNA 2A3HA 4IPJA 5I78A 2FGZA 2PRHA 4W9TA 1JZ6A 1N8IA 2XZ9A 1B3VA 3DGBA 4DWSD 1SPQA 4ZO9A 5A8MA 3D3FA 1A5LC 1GYMA 4JEJA 1TUXA 3ZWSA 4RPPA 2ACQA 1WZLA 4D9PA 3MI3A 3NOYA 3RMEA 3WH9A 1QWGA 2E09A 1HKMA 2EKCA 1MNZA 4TOQA 1XFCA 3R2GA 3W6MA 1B57A 3CWOX 4JCLA 2WJDA 4JQ1A 1DL3A 4RZBA 4I5UA 1TB3A 1W5OA 3RCMA 2Y1HA 1DQXA 2HDJA 3R89A 4I9MA 4MJ2A 1TR1A 1UUQA 3IK4A 3WN6A 2NWRA 4Q4MA 3CB8A 5LSMA 3D3AA 1XH0A 5AY7A 1S2CA 3QHOA 4FNRA 2RAGA 2BY2A 5KETA 2GDVA 1UR2A 4XD4A 1KTCA 3XINA 5E0CA 4IFKA 1QBBA 2WVUA 1DOSA 4XX6A 2QVHA 1VBJA 4DB7A 1RA0A 1EPVA 2XIMA 5BRBA 5H6HA 2JIWA 3IIOA 4GUHA 3P0XA 3O0FA 3NQEA 1CENA 1Z8AA 2YLAA 3N6QA 3N3TA 3UYCA 4FK9A 2V5JA 4W8LA 2VEFA 1OX4B 1PDYA 2OQYA 3M5VA 3VKJA 5G1YA 2QCHA 1RY0A 2WK2A 1LG1A 2GJRA 3QTPA 3UD6A 4HZ7A 1EXPA 3TYZA 3LCHA 1W3NA 3H7VA 2FKPA 4EPBC 1W2VA 3M0XA 4NZJA 3EKGA 3ITLA 1FWBC 4MY1A 1QMLA 4I9AA 5AC4A 4P7QA 3G2GA 4ZODA 1I2OA 5C7HA 4ATDA 2EHHA 2V3EA 2DQXA 4R27A 1UUOA 4NJGA 1P0EA 1MDRA 4PCNA 4UFJA 4IHCA 1M7XA 2FH8A 2A5HA 2H3BA 5MF5A 3GS6A 5E70A 3UNTA 2OX4A 2FPTA 1YPIA 3U2OA 4LY8A 2E6FA 4JN6A 4R9OA 5C9UA 4B4HA 3BO9A 3KL3A 3TWAA 5AHMA 5LA1A 1WX0A 3SQLA 1XH2A 5AYBA 3RJXA 4IFRA 4C5YA 1W9UA 3WIJA 2BODX 1H5YA 3NFUA 1ISWA 3TEVA 4DWSB 3OQEA 4C5ZA 3THUA 2YGYA 3PBUA 3CJPA 4IMEA 3BK0A 1BKHA 3N14A 1CLVA 2GSEA 2ZWZA 1E9IA 3AXIA 1E5JA 3CUXA 2WVVB 3LHTA 4OECA 3SI9A 2QJJA 3W6YA 3M7SA 3N15A 3WMBA 1YTEA 5F2MA 4EIVA 4IIEA 1HUVA 3LZ3A 5EBUA 3R5EA 4LUJA 1AMKA 4LS0A 1RVKA 3LCXA 2I5IA 4TX6A 1O94A 3AIWA 4XKYA 1VIZA 2UY4A 2VR2A 1LRNA 3LSBA 4KCUA 4GCAA 3OODA 2ZA3A 4LOCA 3GXPA 5H8MA 1H5VA 3AOFA 3BSGA 3DI0A 2BASA 1OINA 1R5YA 2RGMA 3SCUA 3R4IA 1VFMA 3WQCA 5K4ZA 4WSKA 3REQB 3CL6A 1H1ZA 1RV8A 3KOXA 5HUOA 3BZGA 3KS5A 1CI1A 1FHLA 1LOQA 1OFEA 5CZKA 4TMCA 2YA1A 1S46A 2IPJA 1TVLA 5LNUA 5JU6A 3OU8A 1JFHA 1RD6A 2ZZ2A 1YNPA 2EXOA 3POCA 1UIOA 5BMWA 4WXZA 5ABGA 4HNUA 3IAQA 1JPDX 1UH2A 3MBFA 1TA3B 3EX2A 3ZOAA 3WJSA 1SZNA 1HXJA 3NEHA 3SEPA 2CXGA 4QQ3A 3QEZA 1ZJBA 3DH7A 2O9PA 4Q7BA 4CGTA 1Z44A 3HG2A 2WNWA 1TV2A 4JGDA 3BW2A 3O8AA 1IF2A 2XM2A 4ZO6A 3CGTA 2INFA 1LROA 4RZ6A 3WF2A 5HXMA 4J7RA 4LUTA 3PF3A 3W7PA 2IXUA 4UFKA 1V77A 3ITCA 1CPUA 4BQ3A 5H8UA 1X6LA 5CC7A 2CHNA 2E5BA 3MMDA 1TWWA 3RX3A 5E09A 3QW3A 1GKRA 1IEVA 5XIAA 4OVXA 4DXKA 2AL2B 4CNNA 3GC2A 1UQYA 2PRLA 4WSHA 4DM1A 1GONA 1VQTA 2E0PA 4ZB5A 2G3FA 1KCLA 3DG6A 2INEA 4QE4A 4B92A 5FOOA 2OLAA 3SECA 3UU0A 1VR6A 2Q6ZA 1DE5A 4AYSA 3R8GA 1H50A 3FW6A 2WBGA 3W7NA 1JYWA 4JAWA 1UWUA 1US2A 3AYTA 4W89A 4UTLA 4O15A 3H2MA 3A3XA 2WWDA 1TPWA 4DVOA 1K4HA 2BB0A 3TCSA 4JIPA 4BKNA 2EEXA 1M03A 3RRXA 3ZR5A 1S39A 1NH6A 1HKWA 4E8CA 2V2HA 2VR5A 5A2CA 3G24A 1FY6A 2Z1SA 1KCXA 1HKKA 3H2FA 1BSLA 5MKGB 3T2PA 3LX9A 5C2XA 3PUOA 1TJRA 1O5QA 4GIAA 4N6EA 3S1GA 1KKRA 2XM1A 3CUHA 5LNWA 3IS4A 1JYNA 3W4RA 1E4NA 1QXLA 3IPWA 1UCWA 1MFUA 3A4WA 2C0HA 2C7FA 5GNXA 3GHRA 4LAKA 3PWAA 1EA0A 4LV9A 2CWXA 3KZSA 2YB1A 4WUIA 4J1OA 2PCEA 1YDOA 3FDGA 3O0KA 4HOXA 4U2YA 3TIMA 2PWFA 3H2EA 3GDMA 1AH3A 3UJSA 4M8UA 3MV01 1J9YA 4WJEA 4AD2A 1DHPA 4WDXA 3P84A 5LIUX 5GJPA 3QYSA 1J2BA 3C2YA 4TX8A 4F9JA 2WVVA 1E0UA 3GG7A 5BW6A 3VNIA 1ZGDA 4QJ4B 4DELA 4HNCA 2BOFX 3JR2A 2EJ1A 1EQCA 1V6UA 1FP8A 4U28A 1HJVA 4AX6A 3A4AA 3SGGA 1QRQA 3OLDA 1T6MA 3CHCA 3ITOA 2GWNA 1GQNA 2BVYA 4R33A 1GJUA 3KWSA 3ZIZA 1D8CA 7REQB 2J4GA 4BEUA 1JPKA 3AFBA 2O9RA 4W4QA 3WLSA 4DIAA 2ISVA 3NURA 1AODA 1B3OA 2WPBA 1M3UA 1HKIA 2BXVA 2PDNA 4ZE4A 3Q65A 3P93A 4LRTA 2HK1A 4B9YA 2PDIA 4UTWC 3EYPA 4F0LA 3MANA 4PMYA 4DWDA 1WB0A 5IFTA 1CGYA 2ABAA 3FAXA 4PSRA 2YXGA 2QV4A 1DWJM 2E5DA 4NZFA 4HPHA 3A5VA 4NAFA 4AU0A 1V7AA 2ZTJA 3UWUA 5HK4A 1ICQA 1NTHA 1KFEA 3H2OA 2PCQA 4LNYA 3CZLA 2DZVA 1GYNA 1OT1A 3UZZA 4K8HA 2PC4A 1JUEA 1G4SA 2AGKA 1P4CA 3WJXA 1I1WA 5LGZA 2R14A 5C2GA 3TE9A 3VVGA 3BW3A 3UWQA 1V3KA 3SQMA 1ISZA 4ORIA 3PBMA 1S5TA 3N12A 2ZWYA 4AVNA 3KLLA 4IMGA 2A79A 2EPOA 4MKSA 1CGTA 3UT0A 4S39A 3NUKA 3HJEA 3TAOA 1PHQA 3LA4A 4WDTA 2DT1A 5FEZA 3OG2A 3QQWA 4GOAA 1UASA 3BCFA 1UJQA 3DCPA 4Z2KA 2GJPA 4JYEA 3KOFA 3S0CA 1TUFA 1GWJA 3G8EA 3SY8A 4MLJA 4US5D 3HMJG 2XVNA 1JDDA 2VX4A 5D32A 2IQTA 4YVPA 3RLVA 4O1DA 5JH1A 1NFGA 2NUXA 3BGGA 4A3YA 3S47A 2G3MA 3WEZA 3ZSTA 4GE8A 3MMWA 1G6CA 3AS2A 4LC6A 3LLDA 1BQGA 5G4HC 3OP2A 1L6SA 1V51A 2Q71A 3FHQA 4LUSA 1A3XA 4AZ6A 1Q4WA 3SN0A 3U5UA 5CC5A 5IDZA 2GGJA 4IM4A 4US6A 1Q66A 2HBVA 4GC4A 2CPUA 1KTBA 3W23A 1TTQA 1IEIA 1S2AA 1EUAA 1ONEA 4ICNA 2ESCA 4X9YA 1T8XA 4RR4A 1KQYA 1XSJA 5FI8A 3UBPC 4S2CA 4I5XA 1JEZA 2HQAA 1JF5A 3ZSSA 3KP1A 1G7VA 4AQLA 3CH9A 3V0SA 1L9WA 3MP4A 3IGSA 3V1PA 4EAYA 3DFNA 4LCQA 5A6SA 2WC7A 1M53A 4E6MA 3CXOA 4DBSA 4WIWA 1RCXB 2CZVA 5CG0A 3QY8A 1D3HA 1NY1A 2A4AA 4BF9A 5DO8A 2OMAA 3CZJA 3T42A 4N6FA 5AYZA 4PE8A 1G7UA 1W17A 1P0KA 1BG9A 5D2XA 1JCLA 1GEQA 4B91A 3B8TA 3QTGA 3TN6A 1OBAA 4FX7A 2DV0A 3EWUA 2YYTA 2P3EA 4B5TA 4B2DA 1GPWA 3VX1A 3AMLA 3ITYA 1RLDA 2ZRWA 2E8ZA 2BLEA 4Y2WA 4H9VA 4A8NA 4OUEA 1RY8A 3CLMA 1JAKA 1P7TA 3VOCA 3I4EA 3HF3A 4JTUA 4ADTA 1WDRA 4HNVA 1ZL1A 5AECA 1IQ8A 1XLIA 3O6AA 4N4PA 4ACZA 1XLAA 3JVAA 2GZXA 1SGJA 1Q6CA 3HZ3A 4D72A 1DYSA 3RR4A 4A22A 4UTTA 3OW1A 3JZUA 1I9CB 4DO4A 3GBEA 3SO7A 7XIMA 2DVXA 4IJCA 4Q8WA 2WSPA 2W62A 2XSBA 1EYWA 4ONVA 3MPGA 3GXFA 2E28A 1M68A 4H6QA 1V93A 1QW9A 2QXWA 3G6LA 1FFRA 5A6JA 5DQPA 4CCDA 4IJBA 1VP5A 5DRIA 1LLOA 5EMLA 1HL8A 3QV7A 3ARQA 3OZPA 3TR2A 3WNKA 2BP1A 3XISA 1QOXA 3GDRA 3JW7A 2HK0A 3BUVA 1V02E 5I3FA 1QAPA 3H4WA 2CZFA 4UTJA 3V1HA 3CO8A 4BZYA 5D05A 1MEWA 2PUZA 4DBWA 4J3TA 4AY7A 5SWUA 1WOAA 3LPGA 2YW3A 5T8GA 3RRAA 3VIKA 4KFPA 4AY8A 4R88A 3TH6A 3V0TA 1RH9A 2FIQA 1FWIC 1G5AA 2SFPA 4NNCA 1EUNA 1VJZA 1MW1A 1IR1A 3GNOA 3U48A 3VIJA 1O5XA 2EPHA 1W3JA 1ZBKA 1SFTA 2NV9A 3ARXA 2W27A 5IM51 5A6AA 1E0TA 1LBFA 1LJYA 3CTTA 4O13A 3M0KA 3CMJA 2CBVA 3ZXWA 1JUKA 4ICCX 4QNEA 1W54A 3QSRA 1X6NA 3L21A 4RE4A 4D6FA 2RDXA 2FVKA 1KM4A 2V3FA 2VNCA 1GHRA 4XAZA 2JIEA 1BTMA 3IJ9A 4GCXA 2AAAA 1FCVA 1R3WA 4F0RA 4I6VA 1PB0A 3DYMA 1REQB 1OX5A 3MWCA 1UR9A 4CVUA 3PAJA 1Q6DA 1XHGA 3KOWA 3P82A 1QUMA 4R34A 1R3YA 2V5DA 4C1NA 3ARYA 4ZXOA 1ALDA 4Q22A 2E6AA 3TW6A 2DW6A 5CJ5A 2G5WA 3VMOA 4HK6A 1KM1A 1KA9F 4U5KA 1IGSA 5TIMA 5FESA 3ME3A 1Y5VA 1V3MA 3TMQA 3S42A 1MVYA 1OC5A 3VKBA 3WH7A 3WQPA 4LUTB 4ZO7A 5DF0A 1GEHA 3VD3A 3PUDA 1P0DA 3N17A 4ACYA 4QE5A 1JUBA 3O3RA 4LT9A 1ZENA 3GNNA 2VDHA 3TFXA 1VFLA 2DZPA 3VZYA 4MPQA 3GE7A 4RE3A 5KZMA 1H51A 2YX0A 2J6VA 3F4NA 2OELA 3M46A 1F07A 1QK0A 3V3WA 2DT3A 2Z28A 3N1AA 1YW1A 3ZMRA 1RXOB 5A6MA 4JR5A 2XZ7A 4L7ZA 4MWAC 5LA0A 4BWLC 5BWAA 3CM4A 4KCVA 3FXGA 4D8ZA 3EOLA 1JYXA 2B7OA 4GD0A 1XGZA 2HISA 3UZJA 3SCPA 2E68A 1B4EA 3C2RA 2WM1A 4LPCA 2AKZA 4BI7A 1OCJA 3WENA 4ZQCA 1UR0A 2VX6A 1TMQA 1OCBA 1UWIA 4ILSA 3VOFA 4RW5A 5A3HA 1IWAA 3WMCA 2V81A 1P0BA 3UG4A 1DJIA 1GOQA 4PYSA 3BV4A 1X8CA 2FZBA 3I3DA 1W5NA 1O68A 1VIWA 4D6EA 1PZ1A 5CZTA 1GVEA 2PP1A 3ZT7A 2GJXB 1EP2A 4MVAA 4UTUA 4HNTA 1W1ZA 5HNTA 2HEJA 3EX4A 1JPHA 4W85A 2FFCA 1EGZA 2FZNA 1S2WA 2J9XA 3JU2A 4M6PA 4Q4SA 1JRBA 3R58A 4RV3A 4GYKA 3BAKA 3NSNA 4BK9A 4PRWA 3H7RA 1RLCL 1O7AA 3H8AA 1QI0A 2WMKA 1VPQA 1XLBA 2DSVA 4DZAA 4AY1A 2PZNA 4YHEA 3F4WA 4INFA 2OKTA 2J8TA 4O11A 1LQ0A 1XRTA 3NPUA 2H8XA 3TR9A 2AKMA 1IEQA 3ATZA 3P62A 4NSBA 3KBVA 5AVNA 4XIMA 1FX6A 3VOHA 2OZ3A 3BAJA 1EEXA 2ASHA 4WKFA 4GO8A 1I6NA 2ISWA 3VA8A 3DC0A 1KR0A 3BAXA 3STEA 2X09A 3JZEA 2B7QA 1EX1A 3C2FA 4H6EA 4J9JA 3L9CA 1O66A 1S38A 4JQAA 3IGXA 1UKQA 1O1HA 3NQ2A 1E72M 5EBAA 3RX2A 1UC4A 5GPRA 4RE2A 4DUOA 4OWGA 3DECA 4O17A 3KTSA 1S5MA 5HULA 3CU2A 3NJ3A 3B9AA 3N4EA 2IPFA 3BLFA 1OC7A 3W2MA 1XRFA 4FF7A 3V7PA 4M7SA 4C65A 3ARUA 2Y70A 3GK0A 1EF3A 2WHJA 3ITVA 1NF0A 5AZ0A 2C13A 4HD5A 2CLEA 5I3JA 2QCFA 8A3HA 1DJGA 4RUBA 1G4EA 3KVKA 3NCOA 2PBOA 3DBPA 3RPTA 1PZ3A 2WWCA 3R43A 4MTVA 4BEQA 4X22A 1EJTC 1WXZA 2IKGA 4DJFD 3UGVA 1UIPA 1LYXA 8XIMA 3GTIA 4LVBA 4CQ9A 4L9YA 2DZXA 3UJ2A 3ZJ8A 4W88A 4UTTC 4XZNX 3SCOA 3C2OA 2E9MA 1PE1A 3W81A 1J93A 4GXMA 3T6CA 2IKHA 4NJIA 4S3AA 3W1XA 5A2BA 2I9UA 1E0WA 4NRSA 3QHMA 5A5WA 3UWVA 2FPVA 4O1CA 5L9FA 4L4LA 2C0AA 2PP0A 3DXIA 4PUMA 2X0SA 3CS2A 4DYKA 4JY8A 4N2YA 3M4HA 4Q8TA 2A21A 3LLFA 3MP3A 3W7QA 1I75A 4EACA 3GTXA 3KUMA 3LN3A 4QS6A 2BHYA 1WXJA 1E0VA 1OSEA 2RHGA 5HATA 3E5PA 3W26A 4OU1A 4K6AA 3EWWA 5EY5A 4ASTA 4ZBCA 3GTNA 4ORMA 3ZLFA 1GZ1A 3KE0A 3PSVA 1RSCA 1ITCA 4GJ1A 1VYRA 1G0CA 5C70A 1W9XA 2VT0A 3WL0A 2FVMA 1VFUA 2O7SA 2HNHA 1XYCA 3I6EA 5MHBA 4XG1A 4GVHA 3FJ6A 2QIIA 1EQPA 4DRSA 3I3EA 4XZIA 3R8RA 3USBA 4EF8A 4C90A 4Q8PA 3VCRA 5LIWX 2QJIA 2WYSA 2G3NA 2HJPA 5GQBA 4G6CA 3SIMA 3U6WA 1YPXA 3WF3A 5D2WA 4HB7A 4HPGA 3OPSA 2BV9A 4S3KA 2VGIA 3QRHA 5ENLA 1YTKA 4F2BA 2VVNA 3WNPA 4WHBA 3SUWA 5BCAA 4AD4A 3ERPA 5BZAA 1F6YA 2CETA 1EC9A 3U2CA 4NX5A 2BHUA 1E1CA 1UR4A 6XIAA 2R24A 5FJRA 1VEPA 3GW0A 3BVJA 3BJSA 3FKRA 2DUAA 1DHKA 1R9ZA 1SZRA 4QXIA 3GNDA 4JZ5A 4M1BA 1JCMP 3D5HA 5TQLA 4Z08A 2YCLA 3K46A 3THCA 1GOXA 4MSSA 2VOTA 4FHAA 4JL2A 3DFOA 1V3HA 2Y8UA 2LLEA 1AL7A 3W28A 4H04A 4UFIA 3QLDA 4FLOA 1IXOA 1AD1A 4G1NA 5CBJA 3ABQA 4NJJA 3IV3A 3BQ5A 2JKAA 4EXAA 1JDAA 4NYYA 3WO8A 2TYSA 4JQ2A 3ANYA 4GC3A 4W7VA 3V5FA 1BPLB 4LVGA 1UA3A 1VZWA 3E0IA 4GFIA 4HNNA 4MB3A 1WDWA 3MU7A 2QUUA 1FXQA 1G01A 2ZYFA 3HO8A 1MXDA 1OB0A 4CD4A 1DEDA 1TV4A 3PBVA 4GH3A 3UEQA 3E0VA 1XW8A 4X63A 3VYLA 4KGLA 5IBXC 3KP0A 3NXLA 2BTMA 4OOZA 1OYAA 3HQ1A 3SSJA 2OLSA 4RNIA 3VK5A 5DMLA 5CC3A 3GUWA 2EKGA 4MYXA 1PIFA 3HQOA 3LS9A 3ANUA 3MSRA 1C7TA 3UXDA 1P1XA 1Q6GA 4PRRA 3WFAA 5EFFA 4OGZA 3F4VA 4PMZA 1EXBA 2CBJA 4DJDA 5CEWA 2ZUUA 2E40A 1UYQA 4DAIA 4M1RA 3VIFA 1Q7QA 2VJXA 3WF1A 1OD0A 4JL1A 3FCPA 3H24A 1V5XA 1LORA 2P88A 3O2LA 5I0DA 2G4FA 2DORA 1KRBC 3GTHA 2Q02A 2CLKA 1XIFA 2PAJA 3TCEA 3BLIA 3BLOA 3L12A 4GY0A 3NPXA 1W31A 3VILA 4NU7A 2D0HA 4AEFA 3K8MA 3B3DA 1M41A 4O1BA 2X41A 1S2TA 4YLWA 3WLTA 1ZAHA 4Q8MA 1LOSA 2GVGA 2GYIA 3HPFA 4CQ8A 3P80A 1RHCA 1B3ZA 3W53A 1DXEA 1LQAA 2IXVA 3TSDA 3B9EA 1VYSX 5I3HA 2B81A 4IXXA 4HCDA 3U7BA 4E2BA 3OYZA 2VOMA 3CUIA 1XJBA 3C3NA 1PUDA 3PC0A 4IQDA 3TTOA 1V0LA 4K37A 1V6WA 2QAPA 3UYIA 5XINA 4NT0A 4J28A 2J7BA 1O95A 2FZ9A 2MANA 2OPJA 3FV9A 4GYJA 3SGUA 4MIMA 3W7JA 2GOUA 2OLHA 4OFCA 1NWRA 1H49A 1LL7A 2PDJA 3RU8X 1NP0A 1UKTA 3W6LA 4UFHA 3MKKA 4DYJA 1HG3A 2X1RA 3SCTA 1TIMA 4U2ZA 4U5IA 4PEEA 2QS8A 1E4IA 4PTDA 4QROA 1E0XA 3F03K 4AC7C 5A6TC 3AIEA 2VD8A 4IMFA 3GFXA 4O8AA 1TX0A 3VIMA 4PMXA 3WSUA 3P6LA 3VUPA 4RXFA 5ABHA 3LXBA 5HJLA 3RYSA 3CIWA 5E6ZA 1YADA 1OVDA 4GABA 5TBOA 4I8DA 4OTKA 4TUFA 3NTYA 3QKEA 5G4EA 4RLIA 4F9DA 2DSUA 3LV6A 2D2JA 1CGWA 2OEJA 4LNCA 3T8LA 1JD7A 1U5JA 5HQLA 1UWSA 5LKYA 2NUYA 4LBUA 3HG3A 3S5SA 3ZVIA 2AMGA 1QPRA 2NX1A 3B4UA 3CV7A 5HQEA 3L65A 3K8LA 2G4JA 1EJSC 1EOKA 1EWEA 2F9RA 3T09A 4Q8QA 2V69A 4ZTYA 3IVUA 5FEXA 3NXFA 1TRDA 4IPIA 4JX5A 1ZY9A 1XLMA 4G8TA 2C71A 3UR2A 5D4YA 3W7CA 3F4CA 4ZQRA 3WBWA 3VNZA 1MRQA 4Z1DA 4PMRA 3W85A 2RJGA 1UOZA 1RK6A 3BOFA 3W25A 5D9MA 1KBIA 5TAOA 1H7RA 1JAEA 1VRDA 4GI9A 3GU2A 3M0JA 3M9YA 4UMAA 1VBUA 1QHPA 1HVQA 2RFGA 1PV8A 5E0FA 1UD2A 1XD0A 4Z0SA 1LLWA 3MTWA 5LNVA 1EDTA 3AWNA 5A8OA 1X38A 4MUPA 1TG7A 2NXGA 4TXEA 4FXSA 4QHRA 1LCOA 2QW5A 3RUBL 2PF8A 3QGVA 5G1TA 1GG0A 2YDAA 3L4TA 4PH6A 2V5LA 1SFSA 1W3LA 2Y89A 3EWDA 3PNZA 2WKJA 2YYUA 3C52A 4Q3MA 3THDA 5HJXA 4K36A 2AQVA 3DHDA 1H2JA 3F5LA 4ZB0A 4HJFA 4GVGA 2ZZ1A 2Y7GA 4PEKA 5I3GA 1T0OA 1U1JA 2RDWA 1SW0A 2W0UA 3VDHA 6ALDA 4GLEA 4TIMA 4AD0A 4XBSA 4WQ6A 5DCBA 2CERA 3OBKA 3ELFA 3LU2A 2PDMA 4RV8A 4AVOA 4P5UA 3WNMA 3EPMA 3N3MA 5D30A 2BY0A 4YCOA 2WV8A 1F7BA 2PTZA 4MB1A 1QHZA 1J0HA 4R53A 2ZRVA 1U5HA 2PWVA 1C9DA 4NVTA 4FZIA 1WE5A 7A3HA 4K8GA 1KXHA 2ZE3A 5LXEA 1Z3NA 4D8AA 3H54A 2GUYA 3UA4A 4IIHA 1AUSL 3HFYA 1OFDA 1YQ2A 1QHOA 2ZDSA 3W7EA 2X0HA 1PTGA 3VM7A 1JXKA 2OEKA 4QEHA 4M24A 2E9LA 1BVNP 4PTXA 2WMFA 1GCYA 3HGJA 3QR3A 4A8RA 3QPZA 2OB3A 2Z27A 2ZFAA 4V1YA 2PTXA 3T55A 2DVTA 2OO0A 2DH2A 3CAVA 3MBDA 3NGFA 1NSJA 4U31A 1XIHA 3W7DA 5G4WA 1GHSA 4DJDC 3FDKA 2E4TA 4XO7A 4Y90A 4C7GA 1US0A 4G56A 1VJIA 1ZU8A 3OVGA 3URAA 3UA3A 3P67A 5JBFA 1OY0A 3LBOA 4A3UA 1ZCCA 2XIBA 4R5EA 1TZZA 2O56A 3AZTA 3UPMA 5M03A 3BLPX 4Y9OA 2J7CA 4QFUA 4YXGA 2PDUA 5FKYA 4ZL1A 1C8QA 3G1XA 1XXXA 3W71A 1SFLA 4A4AA 3AMGA 4H9UA 5A1AA 1XYLA 1YE6A 2P8BA 4PFMA 3CZKA 4WEVX 3CV1A 1JNDA 2VZVA 3A13A 5T9CE 3UJEA 5ABTA 3GKAA 3WEMA 1IE7C 3VTRA 3PPFA 5G2HA 1HJUA 3TOYA 1BRLB 1HFBA 3UJFA 3GVGA 2J75A 4S3CA 1Q6LA 1W1VA 3F5JA 1F6KA 3H53A 2JE8A 3SN4A 3O6YX 1KGXA 2O9OA 4WY0B 3QC3A 2CLIA 3BE7A 4PUNA 3VE9A 4ZXLA 4UQCA 1TR9A 4RDWA 4S3JA 1JDCA 3CYVA 2VEIA 2F61A 3B8IA 4B5WA 3W86A 2ZUNA 1W9DM 6XIMA 5FEWA 1XCXA 2D0GA 1IIHA 3HM7A 3DU0A 2G8ZA 1DTUA 5JBDA 4L6DA 5I79A 3WBAA 5H91A 4BQ5A 2FTYA 3W37A 4K1GA 4KCTA 4LBRA 4N42A 2WM0A 3B06A 4C6EA 5D9OA 1EL3A 2JEQA 3ES8A 4LFYA 3MS8A 3HURA 4JNZA 4RPQA 4O50A 1L6GA 1C91A 4MNLA 4XTDA 4S23A 5C9RA 3M7WA 4ZEPA 3DOPA 4LY4A 1GKPA 5M1TA 5ECVA 5KZ6A 4LVAA 2GFTA 4QSFA 9CGTA 3BLLA 2VD9A 1HL2A 5EKYA 4PCTA 1UWTA 6A3HA 2BWGA 4JFWA 1VPXA 2YBVA 2QAFA 3W00A 1X6UA 5EMUA 6TIMA 4B5UA 1IHIA 1XDLA 1WAWA 3QPEA 4AZ5A 3SY5A 1AG1O 2GGGA 4MWAE 2XUCA 3M0MA 5DBUA 2Y8KA 5HMFA 2CXEA 4Q8VA 1A5NC 4E2OA 3UG5A 3N73A 5FSDC 4LAZA 4L4PA 2NSXA 3WUGA 2WSQA 4GZ7A 3IGHX 3F2CA 3RU6A 1UWRA 4Z17A 3EZ4A 2VTFA 1RR2A 2OCZA 3QR0A 2VFGA 4XZ9A 2ZUVA 1CGVA 3VAVA 2J8GA 2IS7A 2QDDA 5CPQA 3U3HA 3GM8A 4AF0B 2Y63A 4W87A 3ZVHB 3DYPA 4G7FA 4HU4A 2E6DA 4MF4A 1QWKA 1KFWA 2Z2BA 1WXYA 2VMFA 3DHPA 3G0UA 3LB0A 4O10A 3VOIA 3QOMA 3L66A 2CLFA 4BS0A 4MAVA 4C6BA 3AMDA 2HCVA 1C8YA 2CW6A 2IPGA 1XQKA 4WX2A 2GGIA 5HUPA 4DJEC 3LMYA 2X2GA 5A8PA 1CXIA 4Y9PA 6REQA 3KTCA 2QEZA 1UWAA 3PZIA 2VFFA 3WFLA 4HGXA 1F2JA 3W1RA 4HCLA 1EJRC 1UROA 1X1OA 1BQCA 2GPTA 2J62A 5HOSA 5K9CA 1GKQA 4DHGA 1VKFA 5FF3A 3ITGA 1PZ0A 2EQDA 1R86A 3TDFA 4UXDA 2F38A 1EBGA 4KF1A 5GNZA 1YE4A 5CH9A 3WDRA 3XIMA 3PPGA 1QOPA 4DXXA 2FHBA 4HYRA 1LRTA 3WD2A 4FLSA 3NQ6A 3S2JA 1KRAC 2WSKA 1W91A 1GTEA 1Q7ZA 1KBJA 4MADA 1Q13A 4F2TA 5C9ZA 3V16A 2XINA 2OWWA 1ZZMA 1EEPA 2VEMA 2EPMX 4LF1A 2PDWA 3IARA 5I23A 1H63A 1RPKA 2GL5A 4XQ6A 3CHVA 3MSYA 1VGAA 3GHTA 3G1AA 5FD0A 4CCCA 3UZYA 3K13A 2ZUWA 4EOUA 1ADOA 1JCTA 5A2AA 2VFDA 4QAIA 3CTLA 3PJXA 1AVAA 1KFBA 4FNQA 3HA1A 4KWWA 4FX6M 2EO7A 3RCNA 4GRSA 4UQAA 3W02A 2WANA 1PKNA 2R9RA 3B05A 1ICPA 2OFJA 4KEUA 4S3BA 2PP3A 3STCA 3DFTA 3AXMA 1TWSA 1TTIA 3Q4DA 3LCWA 3C8FA 2VRKA 2WVSA 2P50A 5AZ1A 3HPZA 4UOJA 4E2VA 2RJHA 3W1LA 5I06A 4V2XA 3HU7A 4JKMA 3PULA 2ZXBA 5FF4A 1CW2A 1RP9A 1R38A 4F0HA 3BMXA 2UZ9A 3RPDA 2C1IA 3GXTA 5CXPA 3C8NA 4XD6A 4KH2A 3C56A 1KWGA 2VRJA 1EZ2A 4AF0A 1YBQA 3Q94A 2DUXA 1WCGA 3G1FA 4G7EB 3FNDA 3D6NA 4I9JA 3P5ZA 1S2VA 5M2FX 1QPQA 2VFHA 1P6WA 3OGSA 4O1EA 4O1AA 1J96A 4L9XA 2W61A 4P7OA 1VCVA 4GKLA 4L1GA 3HJZA 4CVWA 5F1UA 2XIJA 4MNKA 1CXKA 3VE7A 4PTWA 2QPSA 3L0GA 2E8YA 4FIRA 3C3UA 4HHLA 3VABA 4LAUA 5HPCA 3OGRA 3L67A 4LC8A 1W3HA 1K1DA 3W7RA 1FCBA 2G95A 4HIBA 5BU6A 3UCDA 1E6PA 2BXZA 4CU6A 2X1IA 1K9FA 1WDSA 4JY9A 3CUZA 3R7MA 4O4WA 1I1XA 7TIMA 1PTAA 1NDWA 1TTPA 3BG9A 4F3HA 4HOZA 2PZ0A 1JZ5A 3VNKA 4XVEA 2WMHA 2VVSA 4TTGA 3QY6A 5CPLA 1TE1A 2QULA 1F5ZA 1OFAA 1OG0A 4IH3A 1A5SA 1O12A 5GJMA 1IXPA 1OFOA 4KQNA 1QBAA 2DJLA 1ITUA 4XAPA 5I24A 3S5ZA 3NA8A 3B03A 3OHIA 3LCFA 2W3ZA 4UNKA 4MWAB 5BRPA 3WELA 1CX9A 3U2ZA 3GKFA 1SJDA 3CNYA 3WQFA 4JTJA 2C3ZA 1AH0A 1PAMA 4TVDA 2DT0A 3B8UA 3PK7A 1A5MC 1U22A 1IIGA 2NQJA 1JQXA 3L5MA 3G8RA 3M07A 1TPEA 2F2KA 1R6WA 4J27A 1QNRA 3APYA 3C4UA 3BICA 2JEPA 5AHIA 5I3DA 3A22A 3NM3A 1A0DA 3CL7A 3THAA 3HV9A 5LHFA 3SJNA 2NT1A 3G1DA 4XISA 2DSWA 3ONCA 2Y8VA 2FZ8A 4NZ5A 5T91A 1NU5A 1RQHA 2OWXA 4IMAA 4HSNA 3VDGA 1M9HA 1W32A 4Z2IA 2WC4A 3KVJA 1ZPTA 2FZMA 3QXBA 3I3BA 2WMIA 1TE6A 3M0YA 3TW7A 3POHA 3GR8A 1A0CA 4F79A 2ALDA 2FLIA 4UTKA 1PYFA 3LGGA 2A7RA 4Q4QA 1BYDA 5K2ZA 3GLCA 4X2PA 1UB3A 4K7YA 3LY0A 2YL9A 4AIOA 1WKDA 5CLWA 2OG9A 3CUJA 1PPIA 1SFJA 2DT2A 2PI6A 1YPFA 4QX4A 1SO3A 1M7OA 4L6HA 1N8FA 3F5KA 5DFAA 4GK8A 1NFPA 1R9YA 3LHZA 4QM1A 3LPPA 3SIZA 3B04A 5EMYA 4C6JA 1EIBA 3QMRA 1K02A 3S6OA 3AIBA 4RX0A 1T7LA 3EWBX 3VDBA 3BOXA 2R94A 3C0SA 1TZ9A 2VURA 2J25A 1BLIA 2EG7A 1RBOB 1IEWA 1JPIA 4N02A 2HNEA 3FA5A 4DBEA 5D03A 4YWIA 5HBFA 2AOSA 2FJKA 4AWEA 1UR3M 1J0IA 4IP4A 5DN1A 4US5A 3W83A 4QLJA 2VM8A 3L2MA 3L4ZA 3A9BA 1TCDA 1V0MA 4GKTA 2P10A 1GW1A 1TWZA 3DESA 3VM5A 1D8WA 1A53A 4JTTA 2HVNA 3VXGA 3C0JA 4GQRA 3A4JA 3CT7A 1O5KA 3NQCA 3MCOA 1GVRA 1XR2A 4JD4A 1C92A 3RGTA 2VYOA 5HJYA 2ZC8A 1JI2A 3UGRA 2PDFA 1QDSA 1KLYA 5C71A 1FWCC 4AIEA 2IKJA 4A3RA 1KCZA 4H9ZA 3Q67A 4JTFA 3AYVA 3LTSA 4GJIA 1GQKA 2E5CA 3EWXA 1OZMA 1B0IA 1SO6A 1RQBA 4ROQA 1F61A 4LUSB 4YJ5A 4LQ1A 1XKYA 4OJYA 3ZR6A 2PC8A 3NQDA 4HTBA 5DXYA 4JTLA 5BXTA 3ES7A 4LU0A 3RN6A 3W75A 4J3ZA 4QJ1A 1JDFA 1V6VA 4PA8A 2E7FA 1P7TB 3SUTA 4A35A 1J4EA 3FJ4A 3DYOA 4F66A 4DO7A 4BR1A 2ISFA 3K8KA 1MI3A 1YDNA 4MDPA 3T08A 1L6YA 1GQLA 1XM3A 3EPNA 4QITA 1BYAA 4H8VA 5AHNA 1WKEA 2I9EA 3INPA 1GOOA 1XUUA 3C2VA 3MO4A 3UP8A 3SY1A 2JFEX 4GI4A 5I77A 1RK5A 3NL6A 2YL8A 3LRMA 3NYZA 4HJWA 2OODA 4LUIA 3VGBA 2GOKA 3GU1A 4TMBA 3NQBA 5CCZA 5EGRA 1H60A 5CBIA 3STFA 3WK3A 3MUXA 2DPEA 4H6KA 2X0YA 4H8UA 3T05A 3TC7A 4E3VA 4BWLA 3S6TA 1A0EA 1SR0A 3CHDA 1JDEA 4IXHA 1HO4A 3IEBA 3M47A 3A21A 4FOJA 3A12A 2RGLA 3M5YA 3OLGA 3TP4A 1RUSA 5FA5A 3VC6A 3CQKA 3ARSA 4ERGA 3W84A 3W1AA 3W24A 3EKZA 4K7VA 2Y88A 1YLVA 3AJXA 1H1YA 1K7FA 4H8NA 4LYRA 5F4WA 1U33A 3PTQA 3H22A 1VPYA 2FB3A 2CESA 3BPWA 5IFPA 3QHNA 1UR1A 2YW4A 1XIIA 2PEVA 3LQLA 2H3DA 1ZAJA 2IKIA 3FYPA 5C2CA 3VMNA 4BQ4A 3M44A 1M01A 3ICJA 3UVAA 2VX7A 5I5RA 5HR7A 3B8VA 3IJQA 4GINA 5BRQA 1VBHA 4HQVA 3ZJKA 3EEZA 4BFAA 2HE8A 3M1ZA 2Z1VA 3PWIA 1Y8BA 3WZ0E 5GJNA 1K9TA 5IBXA 1DJYA 1GVQA 3I6TA 4O52A 4JXCA 4L9ZA 3WK1A 1W1TA 2TSYA 4NUWA 1W8GA 3KX6A 3GH7A 3OQ8A 4RJEA 3G1VA 1YXDA 5FIPA 4O0KA 1IWPA 1MYRA 5CGTA 4ZOEA 2A6LA 2OSWA 2YIHA 3OBEA 4FX8A 3LXAA 2WBKA 3MB9A 3LYEA 2CZDA 1LLZA 3PPCA 2D2HA 1CLXA 1UD3A 4EANA 1ECEA 3SRFA 1VBRA 3GAKA 3N2TA 4YMZA 2HMCA 2WMIB 4IP5A 1FRBA 4DPPA 1UJPA 3AS3A 3OVQA 2VCBA 1GVFA 1SQ7A 5ABEA 2G3IA 5DEZA 4EPEC 4R85A 3CAQA 4H7VA 3CWNA 1I2QA 1UPMB 1BXCA 1U2YA 2ZUMA 3O16A 3B0XA 1US3A 2J7FA 5KZDA 4U33A 3RILA 2VCCA 5M17A 3T8QA 4HVXA 1TRIA 2UY5A 3T9PA 3CQ0A 3W70A 5EB8A 3CL8A 1NOUA 3T1GA 4B5NA 1W1IE 4UR8A 4GGBA 4OQVA 2H6RA 1BVZA 1W9BM 2P0OA 4AYGA 3ID7A 4C6KA 2PDCA 5J5DA 5DT7A 2VFIA 1QO2A 5DMYA 2CZEA 1N55A 1XYMA 4CEXC 5BU9A 4IT1A 3NDYA 3OB8A 3OEXA 4CU7A 4DWSC 5C5YA 1AD4A 3FLUA 4L1XA 1OIMA 5RUBA 4GZEA 3FSTA 4DJEA 2OVLA 2A3BA 2BY1A 3TSMA 1JRCA 4B9ZA 3O15A 2CLLA 4H1ZA 1ZP4A 4DN1A 1B1YA 4QLLA 1MO0A 3B8WA 2CKSA 4QS5A 5CLTA 3BW4A 4DUXA 1MUWA 1FWSA 2QJMA 4IWWA 4M29A 1EHAA 1ZAIA 1E70M 1H7OA 3TROA 4GBUA 4Y6GA 1TPB1 1H1NA 2J74A 5BOOA 1CLKA 4N9BA 4FB7A 3AROA 1UP2A 4AZGA 4IQLA 3G77A 4QNWA 1J0KA 3W2JA 3QC0A 4ZE5A 4NP7A 3STGA 3T44A 3WF4A 2FHFA 5DLCA 3WEOA 1J0YA 1YIXA 1NELA 3K4AA 3S3GA 4IL0A 1EWDA 3CQIA 3N04A 2Q8ZA 4CN4A 2DVUA 4LEFA 1AL8A 5AN7A 4Q6JA 4LANA 1XWYA 4JTAA 3AMCA 3LEPA 3EMQA 3TJIA 2Z00A 1E56A 4P2VA 3BGJA 3WUEA 4UR9A 1OYCA 2Q01A 1MXSA 2QIWA 3I7SA 4WY0A 3W1QA 4M6VA 5IXEA 4Q32A 2A3LA 2JGQA 3DERA 5K9XA 1QVBA 5EMMA 3WKZA 4GUFA 2QNEA 3EB2A 4V15A 1K6AA 2GJNA 3S1UA 1JXJA 4S3GA 4A3QA 4MYAA 1V3JA 4BQ2A 2QUVA 1YBQB 1RJRA 1XIGA 1WNOA 4JHMA 4ATLA 2DUZA 4HYWA 1RA5A 4Q8NA 1N82A 4YWSA 3T0BA 1K9DA 2CFFA 3ZJ7A 5TD4A 3AIRA 4H41A 3DFSA 3MY9A 5MKGA 4PFHA 4Q33A 3CEUA 1A3HA 4BF7A 3QR1A 1PBGA 1VB9A 4FXFA 3SN1A 3OGVA 4W86A 4AD1A 2WKLA 1R7AA 1IT8A 2P3ZA 2V8ZA 2ZADA 1WA3A 4BHYA 2W66A 4U3AA 3ZT5A 5I7GA 4GXPA 3CK5A 2ZRXA 1R46A 4AWSA 4KEVA 4QDMA 3V35A 3LBCA 1MXGA 3W74A 1KW1A 4Q4KA 1W3IA 4LV4A 4HK5A 1FWFC 4RDZA 1XLGA 2J7GA 3MT1A 3O7UA 3PTMA 3D47A 2DZTA 1V02A 3NVDA 1WO2A 2EGZA 4RNHA 4MWAD 4U10A 1KXVA 3IRSA 1JG9A 1BHGA 5BOEA 4R9XA 5ABFB 2O55A 3BLDA 2PWHA 4JHZA 1UWQA 3W3OA 2BXYA 3WD1A 5A8NA 1J11A 4WJ8A 5DT5A 4JIRA 3DKLA 3AXXA 1TIWA 4MNJA 4REQA 4WLCA 1D3GA 1XLKA 3ITXA 1QPNA 4B15A 1Z48A 3AWOA 3E1F1 3R79A 1Q6OA 3A4XA 1K8XA 3BURA 2KX9A 4CN6A 4K38A 1X39A 1VH7A 2B4GA 3E12A 2F2HA 3MP5A 2ZX8A 2QCDA 4IMCA 1MEIA 3WLLA 4H2CA 2XJ7A 1BEUA 4O4VA 3GNXA 2UY2A 3GR4A 3VDAA 3FJNA 1TV3A 4GFSA 2PDQA 3AI0A 2UBPC 3KTXA 4XZMX 1TA3A 1TX2A 3WD0A 2ODOA 1GTHA 1B2YA 1FHVA 1JULA 1EJVC 1JGMA 2BOGX 2J66A 4CU8A 3GH5A 9RUBA 4NQ1A 2D22A 4GIYA 1ZCOA 2A0NA 3C0QA 1GVYA 1S5NA 1NOFA 3CO4A 4LBSA 4ZVJA 4GQ0A 1VCGA 4UIOA 1WBJA 1F76A 2XN0A 3KL5A 5IDIA 4YTRA 3CC1A 3U57A 1R3SA 4MNMA 3TJXA 3W1MA 2WLYA 4AW7A 5I09A 1JZ2A 3IJ6A 4KWOA 1KQZA 1EGVA 3PG8A 2A1YA 5E9AA 5FF0A 3O07A 1E51A 2GVLA 1A80A 2XGZA 1LL4A 2VQTA 3TU9A 4JX4A 4AWTA 4CD5A 4GZJA 3BJFA 3FGCA 1D2KA 3AIVA 3OZMA 1IXNA 2WNNA 1W56A 1MW0A 3OVPA 4IL2A 1FTXA 1C9WA 2O4QA 4K68A 4IUGA 1A5OC 1JZ7A 2WHKA 1H3GA 2OYMA 2VGFA 2EAWA 1X8FA 1SSDA 3PR2A 3CAKA 2D69A 4XBKA 5HINA 7CGTA 1L8PA 3U7VA 3GDLA 5ECUA 1XRVA 3S2LA 3BJTA 1LBMA 2Z2UA 2BVWA 1VFOA 2QR6A 3ZT6A 1W1PA 2TPSA 1BKSA 1LOLA 1TFVA 3KRZA 4WJXA 3VNYA 4A2SA 3KW3A 2NQHA 1ECQA 1YRRA 4Y9NA 1QR7A 4CD6A 1EOMA 1O5RA 4E4UA 1HF6A 1YHTA 4QP0A 1ZHAA 4D6DA 4C6NA 1KM0A 5LGXA 4WVXA 2YXXA 2NT0A 3SM0A 4DX3A 1R30A 3N4FA 4YTTA 2CKRA 2QCMA 1BXNA 3A5FA 5EMJA 1W3TA 2B31A 4LH8A 2XFWA 2QF8A 3IJ7A 1KFJA 1FFQA 2VEKA 4H01A 4KESA 1Q45A 5IHSA 3UNDA 4J5NA 4OOUA 1M1BA 2PDHA 3UY8A 4JFTA 1CBGA 3HB9A 3B8DA 1H7XA 3PN8A 4Q8OA 4IOTA 1EZWA 2I5GA 4H9XA 3RX4A 3AHVA 5DANA 4S1FA 4X61A 1O4UA 2DSZA 4IIBA 1F3EA 4Y7EA 3UWZA 3E0FA 1GK8A 4M56A 1V0KA 4G1KA 4JIQA 1BG4A 4RK8A 1VEMA 2ON3A 4F2UA 2W67A 3HGOA 3WMSA 2ZTKA 4AXNA 5LXXA 2XHYA 1XYFA 5PTDA 1B3WA 3EA1A 2W92A 4H9MA 2P76A 1TELA 2Q3OA 4D6HA 1B5TA 3DFYA 1MW3A 2GK1A 3WLJA 5C7VA 2DW7A 4UZSA 2PODA 2HPMA 1OEPA 4Z1AA 3T2OA 3DFHA 2QCCA 1AQFA 4B5SA 2DFAA 2ZOXA 1FH7A 1WOBA 3EMZA 3RMJA 1W0MA 3LERA 5LIXX 3EX1A 1LTDA 3VU2A 2WNQA 3B8SA 2VC5A 3QN3A 4H9TA 4JKLA 5HANA 3E2RA 1RCOB 3UY7A 1QASA 4KFOA 5AC8A 2PTWA 2HE5A 3WUFA 4YHGA 2BX7A 1LWHA 3ARTA 1Q2SA 5CZ0A 2V5CA 3W01A 2D1ZA 2AAMA 2R8WA 4K3ZA 3SW6A 5J5RA 1VYPX 5HWJA 4WDUA 4AUBA 2I57A 4HZ8A 2IQDA 3G22A 5BOFA 2GVYA 3FHAA 1F8MA 3VGFA 1NP2A 3PBWA 2DGAA 3MDUA 3UF9A 4AD5A 5E93A 1DP0A 1J5TA 3EA2A 4NNBA 3VFLA 3Q37A 4PCPA 5G5IA 1Y5WA 3CQJA 4B5VA 1PKLA 5CKSA 1J0JA 1QW7A 1T5AA 4QBXA 5I6SA 2PLMA 2R1NA 5JQ9A 5IOBA 3E02A 5A8QA 1I4NA 2A6NA 4HSOA 3PNUA 4M80A 1LBLA 3G1HA 4UUIA 3I65A 3QQ1A 4C6MA 1RQEA 2VELA 1ZP3A 4MDOA 2NQZA 1AJ2A 1NDYA 1A5AA 3DFQA 3OBAA 4LS2A 5EFDA 4FXJA 4NYUA 1FWTA 3TA9A 1C90A 2UWFA 3NO1A 3RAOA 4Z0JA 3L4WA 4ZCWA 4TTUA 4HPNA 3MZNA 3KOZA 4DY1A 2NVDA 4GGHA 4PL1A 4M82A 5HMEA 3AICA 1C8VA 4I6KA 4QEEA 3KHDA 4HHHA 2H9AA 2HBXA 2PSNA 6ENLA 5M3WA 4AZCA 1H61A 4GX8A 2FTWA 4NILA 1XD1A 3FVMA 4YIWA 1DKWA 5FCZA 4J3XA 5A95A 5D2YA 4GY1A 4C60A 3B4YA 2NV1A 1S5VA 5FF7A 4N7QA 3FA4A 5H2ZA 3U4AA 1EJWC 5L6UA 1WZMA 4A05A 4W93A 4C1LA 2XVKA 2NQLA 1VAHA 2W91A 1TPDA 4L80A 2WHMA 2VUNA 3RLGA 1BF6A 3PZOA 3GXIA 1XCWA 4PUUA 3MDWA 2I16A 2ZXQA 1OGGA 4ZOBA 1HW6A 4W84A 2Z6IA 2G41A 2VEGA 4GYFA 5DX7A 3PS7A 2EG8A 3FX4A 1ZBCA 3ABXA 4XB3A 1T99A 1VEOA 4DJDD 1I2PA 4AXKA 4HBKA 2BVDA 2HVMA 3DFPA 1R2TA 3WNOA 4DLFA 2RUSA 2R6OA 1W9VA 4A29A 3BARA 1SSGA 2D2OA 1A5UA 4DBDA 3STPA 1DQWA 4IP7A 3WQ8A 3IAPA 4QR6A 3F1QA 1SU5A 3WLPA 2YA2A 1Q6QA 5ABFA 2NVCA 4OE7A 2E3ZA 1GNXA 1C3FA 3RO6A 3AXHA 4F48A 3WBEA 4LYQA 4J40A 4IFOA 3TC3A 2A7NA 1Q4NX 1P0NA 1EF2A 1PX4A 4JFSA 3W1PA 4FLRA 4XAFA 3E96A 2OZ0A 1XCFA 3TTEA 4ZB2A