2HBXA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 118
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbxA00
1FWGC 1V4YA 4P5UA 3G77A 1A5KC 4DZIA 3PAOA 4HK7A 2CZVA 1YBQA 3GU2A 2KAUC 4F0RA 4WGXA 1J6PA 1O12A 4CEUC 2Z25A 3QY6A 2UZ9A 2DVTA 4H9TA 1FWCC 2P53A 4IF2A 3MJMA 4H00A 2VUNA 2HBXA 1V51A 3FDKA 3IJ6A 1M7JA 3LSBA 1POKA 4V1XA 2VR2A 3N2CA 4DO7A 4L6DA 4G7EA 3GUWA 4CQBA 4OFCA 3GTFA 1K6WA 3GU9A 1JGMA 1XGEA 1NDZA 4LALA 1ITQA 2E1WA 4KEVA 3TN6A 3QY7A 3B0YA 4DZHA 3S2MA 1M68A 3QGKC 3WYZA 4ERIA 3AU2A 1UMLA 1EF2A 4BJHA 3RN6A 3URNA 3S4TA 1KRAC 3LU2A 4DYKA 4C6IA 3MVTA 2OQLA 3E0FA 3OVGA 3TN3A 4C6BA 4DI9A 1RJPA 4NG3A 3CJPA 3GTHA 3GIQA 2I9UA 3GTIA 2Z27A 4LEFA 1GKRA 1A5NC 3UBPC 4C5YA 2Z2AA 1RK6A 1V79A 3PNUA 4XAFA 3F2DA 3GIPA 1KCXA 5AKQA 4F0SA 1PB0A 4YIWA 3PBMA 2R1PA 4MUPA 4PE8A 3E38A 3T81A 3RHGA 4RE0A 4QRNA 1V7AA 2VC5A 3JZEA 2AMXA 4GX9A 4CQDA 3S2NA 1K1DA 3GG7A 1EJTC 1DPMA 1FWJC 2FVKA 3F4CA 3F2BA 4C60A 4RDWA 4GY0A 4IQJA 2OOFA 1XRFA 3D6NA 2Z24A 3O0FA 4IG2B 4LAMA 1PTAA 1S3TC 3ICJA 3QGAC 4R85A 3FEQA 2WJEA 4GZ7A 4B91A 2A3LA 4HA0A 3TN4A 2UBPC 3BE7A 2AQVA 1P6BA 4INFA 4B92A 1HZYA 1J5SA 1BF6A 4C6PA 4GY7A 4DLMA 2QPXA 3S2JA 2R1KA 2D2JA 4D8LA 3GTXA 4KESA 4CNSA 1P1MA 4KETA 5LXXA 4C6EA 3URAA 2E25A 4RDVA 4H9MA 4EP8C 3O7UA 4AQLA 1NDVA 4HK5A 1PO9A 3NEHA 4J5NA 4HJWA 2Y1HA 4QS6A 4ZSTA 4UBPC 4IFKB 2DVUA 1ADDA 2Z4GA 3E3HA 3T8LA 3LSCA 4H9ZA 4RDYA 4H9YA 3ITCA 2BGNE 4R88A 3AUOA 3DC8A 1R9ZA 4RDZA 4DI8A 1RK5A 3F4DA 2AQOA 3K4WA 4C6LA 2PGRA 3ID7A 5FSDC 4XD5A 1I0DA 3OJGA 1QXLA 4KQNA 2YZ5A 3T1GA 2FTYA 4KEZA 4NI8A 4GBDA 4J2MA 5E5CA 4ERGA 2RAGA 2OODA 4G2DA 3KM8A 4M51A 3HPAA 3A3WA 3URBA 1NDYA 2GWGA 1FWFC 1RA5A 4C6DA 4C6KA 4GYFA 4ICMA 4DIAA 4IFRA 2OGJA 1A5LC 1EZ2A 4R7WA 1UIPA 1UIOA 2GSEA 1FWAC 4F0LA 1EJUC 1NFGA 1V77A 4IFOA 4B3ZA 2PUZA 1E9YB 2EG8A 4LCQA 3RCMA 1KRBC 4KEUA 3DCPA 2W9MA 5HMEA 4ZSUA 3IARA 4DNMA 1RAKA 1QW7A 3WZ0E 1A4LA 1RJRA 2Z26A 4KF1A 1RA0A 2Z28A 3MKVA 3R0DA 4GK8A 4GOAA 4C6CA 2QT3A 3UPMA 2FVMA 4QSFA 1KRCC 2D2HA 3SO7A 3A3XA 4KIRA 4QTGA 1A5OC 1ITUA 3OODA 2Q09A 2QS8A 1ONXA 2ICSA 4B90A 3E0LA 3EGJA 3LY0A 4LANA 4QROA 3HTWA 4EPEC 2GWNA 3EWDA 1YBQB 3IACA 1FWIC 4H9VA 4NP7A 2GOKA 3TN5A 2EG6A 3B40A 1ONWA 3LGGA 2DVXA 1IE7C 2VC7A 4IG2A 3GU1A 3LNPA 4WVXA 5A6TC 4C65A 4H9UA 2O4QA 4XAZA 1EYWA 4G7EB 4C6MA 2R1LA 1M65A 2OB3A 4I6VA 1YNYA 4PBFA 3NURA 2O4MA 1R9XA 2EG7A 4XAGA 3CAKA 4LH8A 3UR2A 3F2CA 2PLMA 2VHLA 4EPDC 1POJA 1WXZA 2R1MA 2Z29A 3WMLA 4C6QA 3UR5A 3TNBA 4CNTA 3S2LA 3URQA 3RYSA 1KRMA 4C6FA 4WHBA 3OU8A 4GXWA 1FWEC 2QVNA 3PANA 3LGDA 1YMYA 3DUGA 2Z7GA 4BY3A 3SFWA 2FTWA 1R9YA 3E74A 2P50A 4EPKA 5HMFA 2FFIA 3AU6A 4C5ZA 4TQTA 1P6CA 2HBVA 1EJXC 4BKNA 1VFLA 4XD4A 2HPMA 3UF9A 2WM1A 2I5GA 3MSRA 1K70A 4IFKA 1YRRA 5G4HC 5FSEC 2ADAA 1FKWA 3IV8A 4KERA 4PBEA 1A4MA 2F6KA 4UB9A 4IGNA 4LAOA 1J79A 4PCPA 4ERAA 1GKPA 1A5MC 2G3FA 3E2VA 1I0BA 3GRIA 3MVIA 4QS5A 2ZC1A 2D2GA 5HMDA 4C6OA 2R1NA 3MDUA 3FDGA 3QY8A 1GKQA 1NDWA 4LCSA 4Z42C 3K5XA 3OOQA 2VM8A 4XD3A 2WJDA 4C6NA 2YB4A 4IH3A 3K2GA 3IPWA 1XWYA 3MTWA 3ORWA 2XIOA 2Z2BA 1FWBC 4E3TA 1EJRC 3NQBA 3LA4A 3C86A 3MPGA 3MDWA 4CNUA 1O5RA 2Z00A 5CH9A 3V7PA 1EJWC 1UBPC 3LS9A 1ZZMA 3IGHX 1FKXA 4I6KA 2ANUA 4HK6A 3EWCA 4GC3A 1EJSC 2PGFA 3A4JA 4J35A 2YXOA 4IGMA 4PCNA 3ISIX 4DLFA 1YIXA 1W1IE 4V1YA 1WXYA 4CQCA 2YB1A 3HM7A 2PAJA 2Q01A 1PSCA 1XRTA 4GY1A 4GX8A 4LCRA 4RZBA 4EPBC 3OQEA 1E9ZB 2HNHA 3IRSA 4XAYA 2WJFA 4LFYA 4JOMA 2HQAA 3CS2A 4H9XA 4H01A 4C6JA 4L9XA 4CEXC 2HPIA 1RJQA 2GZXA 2IMRA 4LAKA 4AC7C 1J6OA 4XD6A 1FWHC 3B0XA 2BB0A 1FWDC 1EJVC 3PNZA
chains in the Genus database with same CATH superfamily
4O0ZA 1C8YA 1BPLB 4P5UA 3ITGA 1PKLA 2PDKA 2W91A 2ZTJA 4JTCA 4DWSA 4HIBA 2ZUWA 4JYFA 1N8IA 9CGTA 3UPWA 5H8PA 3PPFA 3LSBA 1PWLA 1LWHA 5LIXX 1Q6QA 4O8AA 3QOMA 1JXJA 3M0JA 2W5FA 5I77A 3KCOA 5HINA 3PUDA 4GFSA 1S2CA 3BLEA 1I6NA 1FVPA 2D73A 2XWDA 4JQ3A 3S4TA 4EAYA 1VPQA 3U2EA 2D0GA 4IIBA 3H54A 4U5IA 4ZENA 4E4PA 2WVUA 2KX9A 4MKSA 5EMLA 3TR2A 1ZU8A 1R2SA 4FB7A 1Z41A 3W87A 4C5YA 3CTLA 1V79A 3PNUA 2QDDA 5BRBA 3ARTA 4D6IA 2CITA 3L2LA 3R8RA 3U7VA 1YE6A 1JUKA 1B3VA 4UOZA 1XF0A 4ZODA 1V7AA 1E0UA 4CQ8A 1EUNA 4OOZA 1VFSA 2OQYA 4JX5A 5A8QA 3H4WA 3ME3A 4DELA 1DXIA 4RDWA 1WOBA 4H4IA 4R3UA 5K3VA 3O0FA 3TJIA 1B9ZA 1W3KA 1PTAA 1VBRA 3T0TA 3FYOA 4L1GA 3CNYA 3MCMA 4W84A 3SN4A 3UZJA 1LOQA 2A7NA 3VGDA 5G2HA 4QGCA 1MXGA 3TTSA 4HMEA 4DLMA 3EBVA 4XIAA 4GNVA 4QNWA 2PLCA 2PPGA 5M1TA 3PP7A 5CZTA 1OM0A 2X42A 2G37A 4GNKB 4H3DA 4NY2A 4ALDA 2VR4A 3T44A 1PHWA 3B4UA 2WVVA 1GEHA 3ES8A 5E70A 2A7RA 3NEHA 3NSNA 3TKFA 4Q7IA 1H60A 1G4PA 3GXPA 1OZQA 5E9XA 3OGRA 5BROA 2Z4GA 3OBEA 2OT0A 3SZ8A 1LBLA 4XZWA 4H9YA 1N8FA 2YDQA 1O5QA 2DIJA 2FGZA 1EX5A 4UNLA 1JCJA 3F4DA 4DWSD 3WSUA 1DE6A 4W8LA 3BAYA 1S2UA 2PGRA 1Q85A 3PFRA 5BMWA 3QC3A 5LIWX 2YZ5A 2ODOA 4WDUA 3EA1A 3FAWA 3KW3A 4J2MA 4C1KA 3THAA 4G7FA 1XQLA 1QO5A 5AOUA 3FHAA 3MW7A 5M5DA 3G8EA 4C6DA 3GZAA 4FXSA 4JX6A 4Q8TA 4JTFA 2GVGA 2FZ8A 4R7WA 1WCGA 4YYFA 2IPWA 3IJDA 3L2MA 1CLVA 3MANA 1KCLA 4JXCA 3VMNA 3LRLA 3VOHA 1Q6RA 1JAKA 3AYTA 2WWDA 3JVAA 1R3YA 2P88A 5K9DA 3NL5A 3SW6A 5HWJA 1RAKA 4AZ6A 1TWSA 3CHFA 1TPH1 3WZ0E 3N2OA 1JDCA 4IZGA 1MFVA 1RA0A 4O13A 4CVUA 4IJBA 4ACZA 4GK8A 3CAWA 4GOAA 1IEIA 1SZEA 2H8ZA 1GNXA 3GFZA 3UXAA 1ITUA 1RBOB 2QS8A 1ZUAX 4TO8A 3OHMB 1GOQA 3O07A 2JE8A 4NZFA 3PUOA 5CZ0A 4QROA 1XLJA 4LUTB 4M19A 5DBTA 1GHRA 1E15A 2PDMA 4NP7A 3NNTA 5A2AA 4O8RA 5FJPA 1RCXB 2ZZ2A 2QPSA 2G3NA 3Q4DA 1OSEA 4PMYA 3GU1A 1AJZA 1P1XA 3LNPA 4XAZA 1NOWA 1OT1A 1B90A 5EBUA 1EP1A 5F2GA 4JIPA 3AHYA 2REQA 5HJXA 2PWDA 3W74A 7REQB 1Z9AA 3UWQA 1EPXA 3FJNA 2WAGA 4YTQA 3RYSA 4OJYA 2BXYA 3UCDA 2HV5A 4B5SA 3M5XA 1SZFA 3ZJ7A 4EPKA 1UZDA 3GC4A 2JGQA 4TQTA 1JG9A 2WCSA 5AB3A 3MSGA 3MT1A 2C3ZA 4DQWA 3JUGA 3WD1A 5E09A 1GYNA 1QPOA 2I16A 3CZGA 3D3AA 2PF8A 4LYRA 2RFGA 3IVUA 4AZ7A 8A3HA 3E2VA 1GW1A 3DESA 5CBJA 2ZUUA 4S3CA 1EIXA 2IW0A 1HO4A 2PP1A 2X1RA 1X6LA 2PFHA 3AS2A 1CXIA 2VO5A 1ZENA 4IH3A 3FJLA 1CDGA 4HNOA 1YQ2A 1MEWA 4NUWA 3STCA 5FAGA 4EE9A 3TMQA 4GZEA 3KTCA 3VOIA 4LY8A 2DGAA 2OQHA 4DJEA 4BK9A 4X61A 2QV5A 2ESCA 1KBKA 1WV2A 3GNRA 1EIBA 3EWCA 4GC3A 1T0OA 5H6HA 1C29A 3EXSA 3M0YA 5FEZA 4U5KA 1ME8A 5F2LA 2J77A 4DX3A 2XM2A 4MADA 5C9XA 4G6CA 1E6ZA 3RGTA 1TTPA 3HMJG 5CKSA 3H2AA 5AYBA 2DEPA 2FJKA 4MY9A 4EX4A 3WNMA 5CPLA 4X2RA 1EJVC 2WSRA 3VM7A 1QI2A 1JYNA 4Q8UA 1FDZA 3TNOA 2PF0A 4KPLA 3UESA 3M44A 5DY3A 1RCQA 3HFYA 2CCRA 3WQ4A 5H2ZA 2UZ9A 3JW7A 5DEZA 4OVXA 4V1XA 2CBUA 2XSBA 1TWZA 2I1OA 1HJWA 2GJLA 3H7VA 1DJNA 1H4PA 1LQAA 3WQFA 3GNXA 5I7GA 3W84A 2HVNA 4Y90A 3ABXA 3GYCA 4ERIA 3E96A 3TWBA 3C0QA 5L6UA 4TTGA 3IS4A 4K68A 1TVPA 1ISZA 3EWUA 1V3MA 2V5CA 1HIZA 4UZSA 4LUSB 3FFSA 1OIFA 3VD9A 4DNHA 3TN3A 3LM7A 2ZRWA 4RLIA 5A2CA 1R2TA 2ZZ7A 4D8AA 3F4NA 3USBA 1JL8A 3SGUA 3KXQA 2O9RA 4QE4A 1J0JA 3CHCA 1H7XA 1IR2A 3QYQA 4JQAA 4M6VA 1F4AA 5CC6A 4S3FA 3WLKX 3PBMA 1YXYA 4O16A 2BY3A 1THFD 5GJNA 3R8GA 1S5VA 4L61A 2AMXA 4A3HA 4XBJA 2XISA 1WUFA 2B7OA 3ELFA 2E0PA 2DW7A 3C2OA 3KRZA 1SFLA 3P0WA 1CB7B 3KVLA 1EKOA 1C93A 2OOFA 4RXFA 4PR4A 4UTWA 5GPRA 1VP5A 4TX9A 4QQ3A 2PDPA 4Q4RA 4J7RA 5BOEA 2E40A 4DY1A 2YBTA 3TA6A 4NZJA 3AAMA 2OX4A 3VOGA 3TSDA 1JR1A 1AL7A 4GMEA 3OA3A 4B92A 4J2PA 9XIAA 1BF6A 5FF7A 5A6BD 2HXUA 4N9CA 3WBXA 5HA7A 3LCWA 2V68A 3MO7A 3TTEA 4BA0A 2IXUA 1I4NA 4HPHA 1JF6A 3E12A 1X6UA 3DXIA 2V3GA 3DG6A 1XPGA 4DZ5A 3BAKA 4KMQA 4JIEA 4J5NA 2VFIA 2OEJA 3GXNA 3PM6A 4XX6A 3GVVA 1CPUA 4UBPC 1GHSA 3VABA 4XZLX 4BI7A 4GIRA 1S5MA 5IM51 1UPMB 3ANYA 1H11A 2P0IA 2WMFA 3CV7A 4O52A 3VFCA 1G01A 1H1ZA 3T1GA 4O1FA 2QF7A 2BHYA 2OZTA 2TAAA 3E1F1 1AQFA 2CHNA 3EX4A 3MV01 4CN6A 2NWRA 3WLTA 1KW1A 3W1QA 4DAIA 3H26A 3PSWA 1DWFM 2X0HA 4M29A 1A5LC 1AG1O 4PMRA 1J8VA 2BVTA 3VNKA 5DCBA 4CNNA 3M0IA 1YDYA 3BLLA 3G1SA 3WELA 4L65A 1SR9A 1W17A 2QVHA 2PURA 4IFOA 1BKHA 1G4SA 2PUZA 1H3GA 3L4XA 1OX4A 3VNMA 4GE8A 3L67A 4IJCA 5DFAA 3SRDA 3T2OA 3LQLA 4PA8A 2W9MA 4OBSA 3H23A 2V2HA 1X1ZA 2PWUA 3WLHA 3SURA 4FALA 4K36A 2GQAA 3SADA 3EPOA 3HO8A 1R47A 2GGIA 3L9CA 1XLBA 1NAL1 2OELA 1IF2A 1P0KA 4M0XA 1JPMA 1W1VA 4K7YA 1VJIA 1VKFA 1WKFA 3KBVA 3VKBA 4QSFA 5CC5A 4LUYA 3AIUA 3ZSSA 3W07A 1ZAJA 3OGVA 4L80A 5D9NA 2IPJA 2V2CA 3OVQA 3U2ZA 4UCFA 1MDLA 4QSHA 3IJIA 1UR4A 2GDUA 4PMOA 2WHKA 5FJJA 1A3WA 4GA8A 1PJ9A 1XUUA 3PVFA 3NYDA 4WVXA 5BZAA 3GHUA 1KXQA 1CIUA 5FIPA 4LYPA 3KS5A 3G0XA 3MUCA 2YGYA 3MI6A 3IK4A 2DZVA 4WDTA 4ZQCA 1PDYA 2ACUA 4G1KA 1M53A 1DQUA 2E9BA 3EKGA 2ZA2A 4ROQA 3R6IA 2WHMA 2WKLA 3T9PA 1YYAA 4BY3A 2P50A 1CGWA 3NPUA 3PBUA 1X7IA 4MIMA 1LLZA 2ZX8A 3HGSA 4JGDA 5IBXA 2ZX7A 1LZOA 1C9WA 5LIUX 4LAUA 4HQVA 1J11A 1SVDA 3C3UA 1WX0A 1OWQA 4QFUA 2YPIA 3CBWA 4RV8A 1VFOA 1QATA 1O95A 4AEEA 3AJXA 4K7VA 3G1VA 2PGEA 4O0KA 2DZAA 1WZAA 2DUAA 1GKQA 4LCSA 4LB3A 3W83A 1SW7A 3IJ9A 1B3ZA 2RGLA 3OZMA 3S1VA 5AZ1A 2W6RA 4W85A 4HN8A 1P6WA 2VVNA 4NL1A 2J9ZA 2NSOA 3ZJ6A 3GVWA 2EPMX 1XLLA 3CAVA 4E2DA 4ZEPA 2OT1A 3QMTA 1PL9A 2TYSA 1NF7A 2ZICA 4LWWA 1FCBA 3TC3A 3VPLA 4HZ6A 2HVMA 4P8XA 1PBGA 5DX7A 3MJYA 3KL0A 1YDVA 4P7QA 2EO7A 4WJEA 3RG6A 2ISFA 2PDJA 6REQB 4HK6A 2OZ8A 4GZIA 3W0KA 1J2BA 3WF4A 4W5ZA 4A05A 3IANA 2JKPA 1GOIA 1M5WA 4NNAA 4WKFA 2VOTA 4UTFA 1SFSA 1K03A 1EEPA 3N34A 1ZBWA 4DJEC 2ZA1A 4GQBA 4L4LA 4A8LA 4IT1A 5ABTA 4CCZA 2ZXDA 1ZL1A 2IMRA 2WNWA 1KBBA 6PTDA 1J4EA 2OYLA 2FHCA 1CT5A 2VZVA 1FXQA 4O1CA 5BXRA 3L0NA 4B9YA 1MWOA 3MUAA 4MMWA 2V69A 3GU2A 1DTNA 2GVJA 5U4NA 5A6JA 2G4FA 1XLKA 4AZCA 2GK1A 3PBVA 5EMUA 4HNVA 1FHDA 3BLOA 4S3BA 3QF0A 3MY9A 2WK2A 3GUWA 3PZOA 4AF0B 1K6WA 2VWTA 4QITA 1FP8A 4L6OA 2OG9A 4TV6A 3ARUA 4TUFA 3LYEA 3S2MA 4LYQA 4GPNA 3WYZA 2NQHA 3LHVA 3N11A 2VT0A 3RLHA 2OKTA 3KLKA 1VCVA 1PUDA 1VCGA 2FZBA 5BW6A 2YW4A 5D03A 1XBXA 3GR8A 3VKAA 4X9YA 5EL1A 2V30A 1CEOA 3QMRA 5DBUA 1TPFA 4FPSA 1HKKA 3BW2A 2Z1VA 5D2WA 1CXLA 1SUXA 1F6YA 2G4JA 1MFUA 1CGYA 4IUOA 1OFBA 1KNWA 4LEFA 1MW2A 4PGLA 1GKRA 3TTYA 2D3LA 5FACA 3M0MA 4IIFA 1O60A 4W88A 4X9SA 1TV5A 3T0AA 1K9EA 2BHUA 2INZA 4RE0A 1DQWA 4JEQA 5FJTA 4UTLA 4AAJA 4YWSA 1R5YA 1FUYA 3U6WA 5MHBA 3PJUA 1X1OA 2DDXA 5G2IA 2WC4A 3F2BA 3W7RA 3E2QA 1LL4A 1QI0A 2F7FA 3UWYA 1W3HA 2ZRVA 2X1IA 3SCPA 3T0BA 1Z44A 5CG0A 3DDMA 2YA2A 4DHGA 3TFXA 8XIAA 3UG4A 4DZAA 5E9AA 3QHOA 4XVEA 1V02A 2RGMA 2EPHA 2WMIA 1YTDA 3GC2A 4N0RA 1QASA 4XG1A 5F4XA 4DWSB 1UKSA 2PEVA 3QPZA 1VFUA 4UTWC 3PUEA 2YX0A 4S3JA 3WDIA 1KGWA 3KVKA 3W37A 1EP2A 1Q13A 3JZUA 2E7FA 3DOPA 3MKKA 1SMAA 1IGWA 3KAOA 2WVTA 4IX0A 3W81A 1XCXA 3S6OA 4U2ZA 3WDRA 3CZJA 3L5AA 3QOKA 3S2CA 4A3YA 3SB0A 3LHTA 3BCDA 2ZTKA 4F2UA 2HNEA 2BFGA 3VGHA 3N2MA 3AUOA 4O1BA 4AEFA 3LOTA 4DI8A 3J7HA 4O15A 1YTKA 4PUUA 4JHZA 3TU9A 4S3KA 1VENA 2ZX5A 5D37A 3OJGA 4AD5A 4KQNA 3SGGA 2BP1A 4R5EA 2OODA 1BGAA 1XSIA 3HPAA 3OVPA 1CYGA 1H7NA 1J0ZA 1UR0A 4GRSA 4XZIA 1LWIA 3VDBA 1JZ4A 4XTIA 2PCEA 4F0LA 1PEZA 4KFPA 5CGTA 1KKOA 1O66A 1F6PA 1LYXA 3ITLA 4YPJA 5CJMA 4CKQA 3DHFA 3NG3A 1CCWB 1T41A 4ZBCA 4QE5A 3MKVA 4MNMA 3P61A 5C7VA 4U2YA 2CLKA 2TSYA 2H3DA 4AXNA 4HCDA 4UTTA 1VYPX 2P3EA 3W2LA 1PVNA 2YJQA 2GGEA 1ZBKA 3EXRA 3AHTA 2QKFA 3NVTA 3NWRA 4UR9A 1F76A 4FOJA 5BXTA 3M4HA 4MNJA 2IQDA 3IGUA 3GR7A 5M03A 1UPPA 2OJPA 2RDUA 3UQNA 4Q4QA 2WVVB 1ONWA 3RILA 1WAUA 5C2CA 3GX9A 3C4UA 1XFCA 1A47A 3VILA 3M0HA 1UZHA 2DZPA 2DT2A 4KFOA 2J7EA 4GJIA 5J5RA 1AODA 3I4EA 3N19B 4PMQA 4FI4A 3TNBA 1IWBA 4N9DA 2NUWA 3URQA 4UIOA 4AY7A 3NZRA 4UC5A 1A49A 4IMCA 1VF8A 2CBIA 3H7UA 1S46A 4H6KA 3A3HA 1C91A 2AKZA 3HG5A 1K9DA 1U5VA 5FF3A 4DO6A 3WJZA 3SUTA 4NNBA 1GOXA 1EJXC 4H1ZA 2WM1A 1ALDA 1RQEA 4FEZA 3UU0A 3BOXA 1A0EA 2E8ZA 3GAYA 1J10A 4UFHA 3QR1A 4UB9A 1SPQA 4REQA 1NELA 3H2MA 3MVIA 3ARSA 1KFLA 2JBMA 2J7DA 1ZJIA 3K5XA 3VOFA 1VHNA 1P0NA 1Q6LA 4MJ4A 4O4VA 1K6AA 2FHBA 2YB4A 3ERPA 1AH3A 1S3HA 3OHIA 1UWQA 4N7QA 2XTKA 3TW6A 3QN3A 5K4ZA 3FX4A 3I3BA 4QE1A 2C14A 1F8MA 4CCEA 2VNCA 3NQBA 3P82A 4GC4A 4AVOA 3W7KA 2PGFA 1TPDA 3TR9A 5HXMA 4HMCA 1OQFA 1L2QA 3TV8A 5EMYA 1CNVA 2VELA 2YB1A 3MP3A 4PUDA 4XB3A 2Q01A 5I0DA 1K3UA 1PSCA 4J3UA 4Z1DA 3Q65A 3RPDA 5M17A 3GD6A 1W2PA 3LZ5A 4JOMA 4Q6JA 1AL8A 4UNIA 4CEXC 4PUMA 1FDJA 1FWGC 2J9YA 4HHPA 1UD4A 2DSVA 4QCFA 4DO4A 4WGXA 3W2KA 3U5YA 3QY6A 1ZBCA 4UTMA 3LLDA 1A5UA 4IF2A 3WMCA 1GZ1A 4YTSA 1XYMA 4EXBA 1QPQA 1MZHA 1VB9A 3G3MA 2QJNA 4JNMA 1XGEA 5AC6A 1UWIA 1BAGA 1H1NA 3A4AA 1V3KA 4YJ5A 3OTRA 3UYCA 2V63A 3G2GA 1EDGA 3K46A 1M68A 2E9MA 3EOSA 1UP2A 3AU2A 2QGHA 3NO3A 1US2A 3CH0A 3SECA 4JDYA 6ALDA 3MVTA 3QM3A 3M07A 3W01A 2XFRA 1M03A 1NEYA 3LTPA 1TB3A 2BGSA 3HB9A 1BXCA 1E72M 4N4PA 1A53A 3L4UA 3RX3A 1C9DA 5I3DA 3GDTA 1MI3A 3UBPC 2IKHA 4RUBA 2OO6A 4Z1AA 3GIPA 1AZ2A 1KCXA 4M1RA 2PDYA 5B80A 5MF5A 3B4YA 1EL3A 4JFWA 3RHGA 1XBYA 4QRNA 1E6PA 2HEJA 4ILSA 3CUHA 3UA3A 3NO1A 3DZ1A 3C8FA 3NDYA 2D69A 4X0NA 2Y7DA 4KCTA 4PBGA 3QR3A 3RFAA 3REQA 5M2FX 4UQ9A 2DZUA 4ZVJA 1S2WA 3LPFA 3MWAA 3N6HA 1XKJA 1TVNA 3VD5A 3DYOA 1H5YA 4OTKA 1IWAA 1OK4A 3ZSTA 1EQCA 2NT1A 1TPWA 2A3LA 1JPIA 3OLDA 1U22A 2WYSA 4AD2A 1OFPA 3T08A 3TLLA 3S2JA 1LCOA 4D6HA 1DJIA 1UA3A 4O54A 3DFQA 1ZTVA 3PG8A 3RRAA 2CEQA 2P10A 1EC8A 1PS9A 2Q8LA 4HYWA 1EEXA 4TTUA 3WD4A 4EXQA 3BXWA 3T4CA 3BLFA 2EPOA 3C6CA 3CIVA 1GEQA 3LHUA 4AQLA 4HK5A 3TDFA 5GNXA 2X8RA 3IIOA 4B3LA 3TZFA 3DGRA 3KEHA 2E6DA 2E68A 3E3HA 3T8LA 3OLEA 3IAPA 1DHPA 4F40A 5A6SA 2ZBTA 1TUXA 2O55A 3BUVA 1CECA 4WX2A 1XV8A 5KZMA 2Y70A 1HUVA 1ZAIA 3O16A 4MOZA 1GVEA 1I9CB 4UTHA 2G96A 1WUEA 3DFTA 1S5WA 2V3DA 3NDOA 5CJNA 2A21A 3EDFA 2FB3A 1O7AA 5AHLA 4UOJA 1FWFC 1QHOA 2R24A 3RUBL 4GYFA 1GPWA 1HX0A 4RR4A 1HF6A 4E8CA 5E0FA 5CLTA 4RE2A 2RUSA 1UIOA 1EDQA 6CGTA 3MA8A 3CHEA 1DWHM 2VRQA 3V1HA 1LUCB 7XIMA 5MKGA 1E0TA 4LS2A 3W70A 5HMEA 4LV4A 4B9ZA 5CCZA 1UWRA 1V6WA 3SDOA 1XYBA 2PTYA 3AFBA 4H2HA 4HP5A 4S2CA 3WH7A 2QAPA 4M8UA 2VC6A 3LRMA 4W7VA 4F66A 1VHCA 4QTGA 4MKVA 3OODA 1ONXA 4XKYA 3ZOAA 2PB1A 4N6EA 1W1YA 2QDEA 2J66A 1AQ0A 3P8IA 5CSUA 4RKAA 2OO0A 4UTTC 3LGGA 1A0CA 4H9UA 4R7JA 1BXNA 1EYWA 4C6MA 3WDJA 1GZGA 4N42A 2E9LA 4L4OA 1OJXA 3NL3A 3EX6A 4PTNA 4JQ4A 2E5DA 3NL6A 3S2LA 2WKJA 2VP8A 2F8QA 3PUGA 4JTAA 3NOEA 4ZR8A 4MWAA 1QAPA 1FP9A 3KFTA 2Z7GA 4AYGA 3SFWA 2O56A 2DQXA 4S39A 3ZR6A 4DO5A 1P43A 3W1NA 2DZSA 1CXKA 3MSRA 2WLYA 4CUCA 3B9EA 4WK9A 3UERA 3EWZA 3BDKA 1FKWA 4L9YA 3ZVHA 3B9OA 2DT1A 4GACA 1E5NA 2WNQA 1GONA 3M0XA 4DB7A 2YXGA 3LBCA 4LBSA 3RXZA 3MMTA 3N4AA 3KBWA 2DZTA 4AIOA 2VM8A 1JDAA 3CUXA 4QEEA 3LXAA 3MSDA 2C71A 3VAVA 4KWWA 3RIKA 3NA8A 4GUGA 4GCAA 3GC5A 2G8ZA 4OECA 2VFGA 4ZO6A 3N04A 1HXJA 1MMFA 3XISA 3BJTA 3KE0A 1HFBA 1ZGDA 5LSMA 4DRSA 2OSWA 1SQ7A 3N4FA 2W62A 1UBPC 1ZZMA 1UH4A 3PBWA 4KGJA 1EJSC 1XCFA 3PJTA 1FH8A 3NQGA 1GK8A 1JD9A 3FYYA 5EU9A 5A6LA 1PPIA 2X16A 3QZEA 2HE5A 4LCRA 1HKIA 1ISXA 2TODA 2XH4A 3FKRA 4XZHA 2FTPA 3WLIA 2ZIDA 1JGIA 1G67A 4NAFA 4AC7C 5D8WA 1H0GA 3VNJA 1R3TA 4H7ZA 4O57A 1REQA 2C19A 1A5KC 4RNIA 2DT0A 1I2OA 1I2PA 4HK7A 1KLZA 1XD1A 2VDIA 3U5UA 1H63A 2GFTA 3AIBA 2J8GA 2A6NA 2Z1KA 4ICNA 4PRWA 4IGHA 3WQ8A 1XH2A 2FYMA 4AIEA 4BFAA 2DPEA 2WMKA 2FPVA 1POKA 2VR2A 3FY1A 3N2CA 5T26A 3RU8X 2WVSA 2HZGA 1W1B1 4DYJA 3GFYA 2CLPA 4LALA 1W9PA 4DZHA 3GBDA 3W88A 5HR7A 3CHVA 1UMLA 2WPGA 1OGGA 3GB6A 1JCTA 1UD5A 3R1ZA 1E56A 2YYUA 3HA1A 1NOFA 1SMDA 4H2CA 3VYLA 2HXTA 1W5MA 3BH4A 3P93A 3PJWA 4NAEB 1PTGA 2VWSA 5KEZA 3W29A 4JFSA 1XG4A 1F4HA 3U7BA 3MO4A 3RPTA 3GTIA 3BQ6A 3GIYA 2WANA 3OYZA 3V35A 3AWNA 1PTDA 4NXKA 1M01A 1AZ1A 4LS0A 1UKOA 5AKQA 4XV0A 2ACQA 3N2XA 4NIRA 4LU0A 2VJXA 3GNPA 1B3XA 4HNUA 4GX9A 1HQTA 3W2JA 4PFMA 3MHUA 2QUMA 4F48A 1XKYA 2EJ1A 1ZCOA 1RCOB 3THDA 3OO2A 1JYVA 3ZS4A 4M7TA 1ZALA 5HOSA 3HV8A 5TAOA 3C8NA 1ZFJA 2E6AA 2Z24A 4IG2B 3ABZA 3LCFA 5GJPA 3BURA 2QMKA 2B7NA 4AD0A 3KZSA 3TQ0A 1W31A 5A5WA 4W86A 3QBUA 2YKKA 5E6YA 3E5BA 2D20A 3HZ3A 3WLOA 4JN7A 1TTQA 1BRLA 2RJGA 1B57A 3N2BA 3B06A 1BYDA 1GGOA 3AZSA 2XH0A 4AZCB 2GK1B 3M5YA 3AXXA 1YPXA 4Y96A 4RNJA 3RRXA 3O8AA 4X60A 4DVOA 4R33A 3B9AA 1VAHA 2IQ0A 4QEHA 1PHQA 2E4TA 3R12A 4RL3A 5EB8A 1ME9A 1JDEA 4NYYA 4ZOAA 1TE6A 3CL6A 3MHGA 1K9TA 4H9ZA 4Y9PA 2BGNE 4OBTA 3F1QA 1E4LA 1F07A 4PEEA 4IL2A 1F3TA 3I6RA 3EPNA 7ODCA 1BTMA 1G9HA 5D09A 3HQNA 1SW3A 4JTEA 3ITVA 2R6OA 2CU0A 5AC7A 4NI8A 4GBDA 4XK2A 2C0HA 3N9SA 3TXVA 4JAWA 1F3EA 4J3WA 1JZ2A 4FSAA 3URBA 1OCJA 3W26A 2Y5JA 3WFZA 1RPXA 4EWJA 2VMFA 1FFRA 3CPGA 2ACRA 1ZRQA 1Y5VA 4D1JA 1U5HA 5I06A 3PZNA 2VFFA 4B3ZA 5F1VA 4UMAA 3VIFA 4JIRA 3WX7A 1KM2A 4G5DA 5A6AA 1ISVA 3GXDA 1BWKA 3LPGA 4YTUA 1IXNA 3V5OA 4FOKA 3SCUA 2OOGA 3ARVA 5CLWA 1JYXA 4FNSA 1DYSA 3LTYA 2YXXA 3R0DA 5J04A 4ZXLA 2GQ9A 1A5CA 3UD6A 4PCTA 4I5RA 2WMIB 3C56A 3BAWA 3EDEA 2Z2UA 4NJGA 4M7SA 4KIRA 4BQ2A 4N9EA 3HOJA 1UUQA 3ARYA 3WUEA 2LLEA 1ZQ5A 3T0CA 3EWDA 3W7QA 1OX5A 1OFAA 1VBGA 2GOKA 4YXGA 4HYVA 2EG6A 2YL5A 4AUBA 4AZBA 1H41A 1G69A 3AYRA 1E3XA 4GO9A 4I7VA 2J7CA 2Y7GA 2AMGA 3H2FA 5FEPA 3WKZA 1AQMA 2NQ9A 4K3ZA 4LJ3A 4ATLA 2Q8XA 3NQ8A 5LA2A 3DFYA 1SJBA 3ABRA 1GCYA 3PZMA 2R1MA 3O6AA 4C6QA 3IAQA 1PCWA 1ZLPA 5GJMA 4DF0A 3WY1A 1N2VA 1OG0A 1VS1A 4GISA 4UQCA 2W3ZA 1IV8A 2C91A 3N18A 3ZMRA 1UZ1A 4DBUA 3EWYA 3BLPX 5HMFA 1H1YA 2YL8A 1D2KA 3HQOA 4MJZA 3C52A 1E51A 1U33A 2FDMA 3GW0A 4MWAC 5G2WA 1RP8A 1NWRA 1KR0A 4GZJA 1UC4A 1A4MA 4E2BA 1J79A 1JQVA 5CC3A 1BFNA 2ZC1A 2Q3OA 2BY1A 3FDGA 4JTDA 3S1WA 3NZQA 1YPFA 1LLWA 3OOQA 4DBWA 1SO5A 4BF9A 4C6NA 1Q6CA 1EH9A 1TX0A 2WXDM 1W9XA 3UWEA 1HJUA 4JNZA 5REQA 2V82A 4YWIA 1R38A 3C2EA 4DF1A 2XFWA 3NZGA 1BVZA 1HJSA 1GQNA 4WOQA 4EANA 5CH9A 4GIAA 2AL2A 3W7MA 4B5VA 1QUMA 3A4JA 1VBJA 1GOWA 2VUYA 4MB5A 2VZSA 2Z7KA 3BAJA 3A13A 4CQCA 2EHHA 2A4AA 5CEWA 3EB2A 3W1UA 3K13A 1HGYA 5C9WA 4IPLA 3SSJA 2VZOA 1TWIA 4PYSA 1DVJA 3PTMA 2DFAA 4ROPA 2PC4A 4L9XA 2H9AA 2HPIA 1JUBA 1VFHA 4Y7EA 2BHZA 1V4YA 3VM5A 4HNCA 3N14A 1FXPA 3QYSA 3WUFA 1H2JA 4XIMA 3VK5A 5BXPA 3S3GA 4OU1A 4B5NA 1J6PA 1QCWA 4WLCA 4HU4A 2FGBA 5I6SA 4GVIA 3FXGA 3T2QA 5A69A 3AHVA 3HPZA 1IZCA 3DN5A 1V51A 1AW2A 1M7JA 3JR2A 3GTFA 2YYTA 1XDMA 5PTDA 1XIIA 3SAZA 3CZKA 3LHYA 4REQB 2WV8A 2C1HA 3EOOA 3PZ9A 4CD8A 2VD8A 1R30A 3LU2A 2PC8A 2CNCA 4FXRA 4JFVA 3USZA 1NP2A 5A2BA 2GOUA 1OD8A 1X97A 3CQJA 4H6RA 1IEWA 1SZNA 5JMUA 2RH9A 3WLLA 3P14A 3AMKA 2WC7A 1O5XA 1ONRA 2Z1BA 3NAVA 1A5NC 3WLRA 3KOZA 3UETA 3OQ8A 1AJ0A 3ANVA 4XSLA 2BBFA 2DSUA 4IX2A 6A3HA 4PB5A 4W5UA 5ECVA 3VE7A 5HJYA 4U33A 3QRHA 3TQKA 3ZM8A 4MAVA 2VL4A 3CZ8A 4RZ4A 4GCXA 1VRDA 3S6DA 3PZIA 2GGGA 4GIEA 2HROA 3UJEA 5E6ZA 3VGFA 2PTXA 1S3TC 4NJIA 4CNOA 2FH6A 2VFHA 1DHKA 1CW2A 1JQXA 3ARPA 4DUOA 1SR0A 4WKHA 5TF0A 3UY8A 2YR1A 4J3XA 4M80A 5AYYA 3W72A 4FP1A 2V3EA 2D2JA 1D8WA 4EWND 3R7MA 1RQHA 2WCAA 4LC6A 3RM4A 4KRUA 1D3HA 2BGQA 2YLAA 4JKLA 4WGHA 4D72A 5A3HA 1H62A 1FHLA 1LRQA 3TAOA 2GQ8A 5D9OA 2HVOA 3FSTA 4JD4A 2ZUTA 2AAAA 1J0IA 4FR1A 3RMEA 4A8NA 3VMPA 2WMHA 2DJXA 2NV1A 4A3QA 3SCVA 2NV9A 3SUUA 5AZ0A 3K4WA 2D24A 3TAKA 5EBAA 1QXLA 1WXJA 4MNLA 3PR2A 2XIIA 3WDQA 4FNTA 4C7DA 3LBOA 1AMKA 5J8LA 1W5PA 3ATZA 3AUJA 3SM0A 4X63A 1I75A 3H70A 1K8YA 1F2JA 1TV3A 2W79A 1QBBA 3VNIA 1J0HA 3PZUA 4ZB2A 4KCVA 4DF2A 4BF7A 1DKWA 3OEXA 4KEUA 2WSYA 4JTQA 3EWWA 1UUOA 3REQB 5JUVA 1RHCA 2AKMA 1R3SA 4DN1A 4KF1A 1JYWA 3AISA 1H09A 1H51A 3UJRA 1JZ3A 1ISYA 1XL9A 2VTFA 4LW7A 1JZ6A 2I17A 4E6MA 2NZLA 3UT0A 3HFTA 3UVAA 1UOKA 4XZBA 3UZ5A 4GUFA 2XSAA 1A5OC 3HJEA 3OW1A 1TQXA 3D3FA 2A0NA 4HB7A 3E5PA 3TVAA 1DP0A 2GWNA 1MW1A 1YBQB 4MDPA 1FWIC 3VCCA 3JU2A 4GKLA 3T09A 5ABFA 2BTMA 1EQPA 3N3TA 4GWEA 2PCQA 2J8FA 5IDIA 2DUZA 1EB3A 2OB3A 1YNQA 1PV8A 3M0ZA 2EG7A 2MNRA 4UFMA 5GNYA 3ZJ8A 4AZGA 3VNZA 1V8EA 1EA0A 1TX2A 3WNLA 4JEJA 4NZ1A 2QW5A 1OF6A 2B4GA 1OFDA 2HK0A 2XU2A 3ABOA 2WPBA 3HG2A 4JTLA 3SCNA 4LAZA 1VJZA 3T6CA 3GLCA 1DE5A 2WSKA 4DJDA 1FCUA 1P6CA 4E4UA 5CPNA 1ZBVA 3VIGA 3WUBA 2CPUA 1B4KA 3VZYA 5AHEA 1DJXA 3STFA 2NVCA 1CBGA 2QYGA 2YBVA 3V3WA 1PYMA 3R58A 3A21A 3V75A 4GG9A 1SJDA 3UR8A 2HTMA 1NWUA 1GKPA 5MKGB 3S6TA 2XG9A 2HDJA 1SZRA 2WHLA 4QS5A 2D2GA 4C6OA 3L4YA 3QY8A 1XFBA 4Z42C 3FK4A 2BY2A 5DXXA 3G1HA 2G95A 3V5FA 4D6EA 1KLYA 4GXMA 3W75A 3FJ4A 5G1YA 2G3MA 3GS6A 5LIKX 4Y6GA 3L7RA 4X3ZA 3VX1A 1A5AA 3L12A 2I5QA 4N2YA 3DECA 4HOZA 5D38A 1KM5A 5C9UA 2VCBA 1P7TB 1TRDA 4CQAA 5IOBA 4AWTA 2CFFA 2CLMA 2F61A 1GTHA 4HZ7A 1OFRA 3G18A 1BHGA 4DLFA 1JIBA 4BZYA 1B31A 4RX0A 3SUWA 5EGRA 2ZUMA 3UA4A 3R43A 2OYKA 3BSMA 3BC9A 1JZ5A 1B3OA 2HQAA 3CS2A 4H01A 1TWDA 2XN1A 1TJRA 3VDAA 2EF9A 4MLRA 1PZ1A 4XD6A 3M0VA 4AY8A 2QJIA 3IVTA 4AVFA 3P67A 5C9RA 4MWAB 1PKYA 5G4WA 1E1CA 4DZIA 1WBHA 5I23A 4ZO8A 3EYPA 2KAUC 1GQLA 4AX7A 1GTEA 3NIYA 3FA5A 2QJGA 4CEUC 4A2SA 3GDMA 3TYCA 4S3DA 5ECUA 2NX3A 4GHRA 5T9CE 1Q6EA 4L6DA 3TIMA 1P0DA 2C1IA 1E1FA 5TQLA 4UFLA 2PRLA 4M5PA 5I5RA 2BVDA 4V15A 4MB4A 3CLWA 1TIWA 1W56A 1A5SA 3W7NA 2ALRA 4BEUA 4P7RA 4AC1X 4OGZA 3URNA 4O0QA 1KRAC 5B7YA 1XQKA 2GJXA 2ISSA 2YA0A 4YS1A 2DUXA 1VFMA 3LMYA 1CI1A 4O1EA 3N2TA 5IHSA 3UXIA 3W71A 1IZKA 1XYCA 1BWVA 4NQ1A 4MPQA 1W2VA 2Z27A 1XXXA 3CQHA 4PN2A 1JULA 1P0BA 4PTXA 4E38A 3UYIA 2J9XA 4HGXA 5DLCA 2NXIA 1UG6A 2PDQA 1AH4A 3QW3A 1QPRA 1PZ2A 2NX9A 4J27A 2ZE0A 4G9PA 2VC5A 1H5VA 1EWEA 5CPMA 3GR4A 4IQLA 1HVXA 4G8TA 1TTIA 4QJ5B 1ODUA 4IIEA 3CQKA 3WL1A 5D04C 4DJFD 4JDBA 4O1AA 1EZWA 1VC4A 5AC8A 1UW9A 1Q63A 4S3GA 4GZ7A 2C16A 1WA3A 2E5CA 4LEQA 1REQB 3OP2A 2QUNA 1XSKA 3N1AA 1NQKA 4AX6A 3O63A 3EMCA 3R2GA 1TWWA 5FL0A 3UG5A 1HP4A 3THCA 2DY3A 3I4KA 4C6EA 3Q45A 2J75A 1FQ0A 4B2DD 4H9MA 3LI0A 1NDVA 3WQDA 3GDRA 3AMGA 1OVDA 4OE7A 3M46A 1JZ7A 4ASTA 3K1DA 2UY5A 3B8SA 1MXSA 1K4HA 3BTNA 4HD5A 2FVLA 3MP5A 3S5YA 4XAPA 2DSZA 5HAOA 2Q71A 3ID7A 3SUVA 1AMYA 1RPKA 3TJLA 1P48A 3G1FA 1Z42A 3WN6A 2DH3A 3W3OA 1B5TA 1OFEA 3EX1A 3L4VA 4ICMA 4JX4A 1UMYA 3CLMA 3U4FA 2H3BA 1UIPA 3A22A 5IFPA 3QGVA 5LNRA 2I57A 2YDRA 2A85A 3Q37A 5EKYA 1E9YB 2CXGA 2QCHA 4JN6A 5AC4A 1KRBC 1XLMA 1X1NA 2GL5A 2G41A 3PB2A 4K6AA 1J2WA 5LHFA 1Z48A 3ZXWA 3U8GA 4GABA 4KKXA 2D2OA 1OIMA 3GBEA 1CZ1A 2CLIA 3DFPA 4H7VA 2XFFA 4JYEA 2PA6A 2ZZ3A 1BRLB 3FXYA 1DIKA 3EDDA 1MQPA 3M16A 5U7SA 3GNNA 3GNOA 1W9UA 1AQHA 5HNRA 5CAHA 1KV5A 2IKIA 3KWSA 3HTWA 1OCQA 4H04A 4WRHA 4QDWA 4IM4A 2F2KA 3N29A 3QQWA 3E49A 2DVXA 3KVJA 4ZA0A 2VGFA 2XDFA 2F38A 3T42A 2P1FA 4NX0A 4ZO7A 1U1UA 3THUA 3R89A 3WENA 3AALA 5KMYA 2D22A 1Y65A 5EMMA 1EGZA 1R2RA 1Q8JA 4TU1A 3VUSA 4CNTA 1TR9A 1WDDA 4IMAA 4IXHA 1C92A 4O17A 1KRMA 2VI0A 2HS6A 5D32A 4DBEA 1FRBA 3SQMA 3DUGA 3AHZA 4ML9A 1GJWA 1WQ5A 1KXVA 5KINA 4E5TA 5J5DA 5HUPA 4AD4A 3PZQA 1TJPA 3MP4A 3QC0A 2O9PA 3JRKA 3R13A 2IUZA 1CGTA 1V5XA 3QEZA 4ECLA 1YLVA 4FXJA 5FSEC 1W32A 4DJDC 4PBEA 4XVDA 2DP3A 3NFUA 3ARQA 4LAOA 3EDJA 4WZHA 4M3PA 3FIGA 3VNLA 2AOSA 2OLHA 3NZ1A 1J9YA 4K8EA 1TE1A 1XS2A 1Q6FA 5FI8A 3DHPA 2OTDA 4I3GA 2GQ3A 2FH8A 3VI2A 2B81A 3AYVA 2ZVIA 3S47A 3T55A 4PC8A 4Z1CA 3QTGA 1F5ZA 4LPCA 3QPEA 3HQ1A 4K2SA 1UWUA 3N13A 3G3DA 3C86A 2GJPA 1JXKA 2OEKA 2BSLA 5IXEA 2F2HA 3NR0A 1DIOA 5I3FA 1GT8A 4P7NA 4CGTA 1WDRA 4W87A 2Y63A 3WO8A 3KUMA 4Q4SA 3B8VA 3VKKA 2CBJA 4AXKA 1YXCA 1X98A 3VGEA 1TRIA 4HPNA 3CV6A 2D1ZA 5I3KA 3E02A 4I8DA 4NNCA 3P3BA 4YTTA 1ZB5A 1KM6A 2YL6A 1LQ0A 1XJBA 3DYMA 3VVGA 3WQGA 1TVLA 3WBEA 3PAOA 1IR1A 1EOKA 2VQUA 1JI1A 2QCMA 3DHDA 4KFNA 3QLDA 2P53A 1D9EA 2DSWA 2XVPA 4TXEA 1ENUA 1TJ0A 4GI8A 1B3YA 3SY1A 4H6EA 3W25A 3UGRA 3C2YA 7A3HA 1NDZA 5CZJA 3WQOA 3B0YA 2CLFA 3QGKC 2V5LA 3VIMA 4E4FA 5T8GA 4J40A 4A3UA 3ZT5A 2V67A 4W89A 5IHRA 3GXMA 3S8HA 2BVYA 3ECQA 3CQ0A 4D2JA 3TW7A 4MTVA 4JTKA 4DI9A 1XPYA 3ANUA 5CSYA 3L0GA 4HHHA 5DQPA 2BLEA 4CD6A 5REQB 3N73A 2PI6A 1DV7A 1RK6A 2PMQA 4WD0A 2X05A 4YHEA 4YTRA 2GVLA 2WJZA 4F0SA 3DERA 1BVWA 3A5VA 1C8QA 2AL2B 4NF7A 5F7UA 1OCNA 1Z8AA 4MUPA 2VEPA 1LBFA 1E0VA 2BY0A 1K1DA 3L4ZA 4Z2KA 2FJUB 4FX7A 3WLSA 3CMGA 2WCGA 1XGZA 5D05A 4O1DA 5I02A 4AH7A 1DIEA 5F4SA 4OOUA 3IGXA 5LGZA 4J9JA 3BLDA 4NXSA 3WK2A 5FL1A 3WLMA 1GZJA 1EF3A 2DIKA 3UW6A 2H9AB 2Z1SA 1P5BA 3W53A 1NSJA 4ZQMA 3W1LA 4Z2IA 4RCXA 5FJIA 4Q8NA 4OV4A 4QLJA 3TYEA 1V03A 1L9WA 5A6KA 3NM1A 3UZYA 1MRQA 4JHOA 2AQVA 1P6BA 1HZYA 1VR6A 2BOFX 3VA8A 2XZ7A 4B4FA 4W7UA 2GVEA 2BZNA 4D8LA 2OVLA 3IJLA 3S9ZA 1UUMA 2BOEX 1I2QA 3ABQA 1P1MA 1XLDA 3UP8A 2ZA3A 2QCLA 4S3AA 1W1A1 4GKTA 2W0UA 1ISWA 5DF0A 5FJUA 3BMVA 3T4WA 4W7WA 2GVYA 1HN1A 3SGZA 1U2YA 1VCFA 3O2LA 3W7OA 1TPUA 4Z1YA 4R88A 3WF0A 3R5EA 4JICA 4KS0A 4EAMA 4RDZA 3HG3A 3B9DA 4TVUA 1V6VA 5DY2A 4M24A 1E73M 2E6FA 1SO3A 5LA0A 1Z7AA 2FPTA 1VIZA 2J6VA 3WD0A 2BXVA 3LX9A 4LB4A 5E5CA 1OD0A 4G2DA 7TAAA 2GWGA 4I7UA 2FQIA 3DI0A 1VLWA 1DBTA 3T40A 4LF1A 4AISA 1T99A 2Y89A 3A4XA 3F4VA 5B7ZA 3QV9A 4W8AA 1Q45A 2ZUSA 4PULA 5FA5A 2X2YA 1HGWA 3IARA 2WLZA 4YMZA 1CENA 4CNPA 4XZNX 1UQZA 1NP0A 2O9OA 3VIHA 3GNDA 4KWVA 1KR1A 2PSNA 4O28A 3UPMA 1DJQA 1Z3NA 1PE1A 4AG0A 4LT9A 3QKEA 3STEA 1LBMA 4M6UA 2ICSA 3W4RA 2Q09A 5A6BA 1YDNA 3IWPA 1P4CA 3WNKA 3GXFA 3LY0A 3W7PA 4FIQA 3MV11 2CYGA 5HPOA 1GVSA 3CIXA 1LL6A 3WQWA 3PHAA 3IIPA 2GDVA 2VX7A 3VD3A 4WXYA 4G7EB 1EHNA 4NZ5A 1M65A 1LP6A 5I00A 4QXIA 2YFNA 1MW0A 4XAGA 1UR2A 3CAKA 2Z1WA 3IGSA 1VEOA 4ADSA 1EWDA 2PLMA 2A6LA 4DWDA 3ZLGA 2A3CA 1IWPA 4V27A 3DFNA 4GXWA 4MYAA 1XBVA 3A12A 5FOOA 3UZZA 1MSSA 3G6LA 2VZUA 4L1WA 4GNJA 3ITOA 4G56A 2JF7A 5H1WA 3B0PA 3VZZA 4DWSC 1L0PA 3CV1A 4ZQOA 1UR9A 4E8DA 5F2IA 2QUUA 1TZ9A 1V6YA 3A5FA 3V1PA 4QCEA 1AW5A 1LJYA 1FWRA 3CH9A 2QHAA 3LK6A 4KERA 1E5JA 3P62A 4FLOA 1EBHA 2Y61A 5BRQA 3DEQA 3CMJA 1L6GA 3GRIA 4LUJA 3B8IA 3TQPA 4XD3A 4CLMA 3H53A 2WJDA 3RLUA 3E9AA 3RDKA 4KT2A 1S39A 3LQGA 1D3CA 3EA3A 2V0TA 3IPWA 3EWXA 3ORWA 4UQBA 3GDKA 3WFAA 4IGSA 2CWXA 3TEVA 1SO4A 3TMLA 4M6PA 2V3FA 3WJXA 3EA2A 2HISA 3H2OA 4UMBA 1QI3A 3E2SA 3WNOA 1HT6A 1FKXA 1LUCA 3QW4B 1UWSA 4HYRA 1PIIA 3VIKA 4J35A 1KFCA 1Q6GA 2ZWYA 2QGYA 3HM7A 4UZUA 5ABFB 1Y5WA 4PUEA 4IL0A 3QVQA 1E9ZB 1RQBA 4W4QA 3UEQA 5JVLA 3A23A 3CZLA 2WJFA 5IFTA 4OT7A 1F05A 2V5JA 4C6JA 1JEZA 2Q6ZA 3WMBA 3QZ6A 1GORA 1RR2A 4EOUA 3MBDA 3PNZA 2PD9A 1BQGA 3VXGA 1WDPA 2ZZ4A 1SFTA 2CZ5A 2O9TA 2YIHA 3PZVA 4DBSA 4D6CA 5D4YA 3P2VA 1V0NA 1YADA 4KRZA 4RPQA 2ZDRA 3I10A 5HJLA 1UH3A 2OZ3A 4DO7A 4WQ6A 4LGXA 3L23A 1I1XA 3W1AA 4LNYA 2BOGX 1OY0A 1ITQA 4NASA 5G1MA 2WOQA 2PDBA 5D2XA 2J7FA 4WDXA 2XN2A 4XISA 3BJSA 4C6IA 1KKRA 3BO9A 1W5NA 4GQRA 2VX5A 3CHDA 5D8ZA 1O68A 4LX4A 5FD0A 1UCWA 3I3EA 2J88A 4NG3A 4GLEA 2B0MA 1D8CA 3W2MA 1S1PA 3BSHA 3V5CA 3R25A 1KV8A 1UH2A 3RX4A 5I3IA 1E0WA 4UTKA 3F4WA 4Z0JA 1QOXA 3R94A 3A6OA 2Z2AA 3AO0A 2DZXA 2EEXA 1TQJA 2J7BA 4P61A 4O18A 2C8NA 1TJ1A 4PE8A 4PTMA 5G1TA 3KRUA 1V0MA 3UG8A 2OMAA 1DL3A 4F4RA 1J96A 3DFHA 1GWJA 3G1RA 4DPPA 4AY1A 1XRFA 1LT7A 1XIJA 1KC7A 4CVWA 3M1ZA 5I03A 1RSCA 2JIEA 4LVBA 3KTXA 4ORIA 3ENLA 5BYWA 2H8XA 3GHSA 3R10A 4QJ3B 3W2UA 4R27A 3NXLA 5FJRA 4WJ8A 2UBPC 1E1CB 4CU7A 2XINA 1JFHA 1J5SA 3MU7A 2G0WA 1W1TA 2XM1A 4GY7A 2PDGA 2VXNA 3W1MA 5A95A 3VCNA 2F9RA 4CCDA 4CNSA 4PUKA 1VYRA 1UR8A 2ZXQA 3TOPA 3TTQA 3APYA 3G1AA 4LSBA 2V5KA 1PO9A 1ESWA 4HSHA 4C90A 4ZSTA 1EUAA 1VZWA 1U83A 4IQEA 1OK6A 1EXBA 3HG4A 5AHIA 1F3XA 3ZWSA 1A3HA 3OIXA 2X41A 2ASHA 1PIFA 2GJXB 4X2PA 1J93A 4OV9A 4M81A 4C6LA 4EF8A 3GE7A 3UFYA 2ABBA 2I9EA 1W3NA 4C91A 2ZRUA 5LNVA 2FDSA 5FF2A 4JN8A 4HJFA 2X7VA 3OLIA 3BJFA 4Q7BA 3SFKA 1DEDA 1U1JA 4ERGA 4ZZ9A 2WC3A 3KM8A 3MZ2A 1NDYA 4ORMA 3W73A 4YNGA 4DPQA 4C6KA 2X0SA 3N3MA 1J5TA 1GW9A 1V6TA 1EZ2A 3LEPA 4D6FA 1XIEA 1VBHA 4M56A 1NFGA 3TC7A 1ICSA 3DYPA 4LBRA 3NXFA 3K30A 2NVAA 2GDQA 4LCQA 1MW3A 2PE4A 4NAEA 1R0MA 5C8BB 4I90A 4K1GA 5JIPA 3IIZA 2BS9A 3EWBX 3W1PA 3NQDA 3DKJA 5CSRA 1YHTA 2FVMA 2PS2A 4JTSA 2BMBA 3GZ3A 3IJ8A 3WLQA 3K4DA 2ZQ0A 3CZEA 1XLIA 1S2AA 3PK7A 1ITCA 3NZPA 1RY8A 2ATSA 4JIQA 3GH5A 5CZKA 1A3XA 3B40A 3C0LA 3UR7A 3S9IA 3ONBA 3PS7A 1MUMA 4IG2A 1KTCA 1LG1A 4Q7NA 4C65A 3DKLA 1VYSX 4OQVA 4LYKA 4GYJA 2ATMA 1VH7A 3AIWA 1TPEA 2ZCGA 1R9XA 1MEIA 4HCHA 1JI2A 5AN7A 3K4AA 3F2CA 3PWIA 1V0LA 4TOQA 1POJA 1JCXA 3CC1A 4YVVA 4ADUA 3OU8A 3KWXA 2P8BA 3O15A 4OIFA 3SCWA 1FOBA 1L8PA 1SYTA 1YMYA 3FGCB 3UXDA 1VEMA 5AYZA 4C5ZA 3AIVA 2PTWA 1T7LA 1WPCA 3GVGA 1ZCCA 4KWOA 1R86A 1EYEA 2I5GA 3KL3A 4ZTXA 3SIMA 3U2CA 4R7OA 4IOTA 2VRJA 3AIQA 1ML1A 2PWEA 3H12A 4HBKA 1QDSA 1NH6A 4PMDA 3L0KA 4NVTA 2O7SA 3O9NA 3M0KA 3HF3A 2JKEA 4F2TA 4HPXA 1KWKA 4QX4A 3DFOA 1GVRA 4H83A 2GJNA 4AZIA 1O1HA 4GH1A 2OLSA 5LNWA 3RJXA 1IIGA 1Q7QA 1EPVA 3WD2A 2Z1XA 3S5OA 1YTEA 3ZYZA 3MPGA 4CNUA 1Q6OA 2ZKMX 4QISA 4BS0A 1M6JA 1I1WA 3APGA 1FH9A 4CCCA 1PIGA 1YPIA 5TNVA 3P80A 4PCNA 1YIXA 4V1YA 1WXYA 3GXIA 4PRRA 5JBEA 2A2IA 2RHGA 1XRTA 1H0IA 2HNHA 3LCLA 4GD0A 5CSSA 4XAYA 5F2MA 4N02A 1KFEA 4YN5A 2X09A 4GUJA 3WJYA 2GZXA 2PBOA 1ZS2A 1XIFA 2ZZ6A 4ATWA 4US5A 2BB0A 4XBSA 4WSKA 3G77A 5HWNA 4A8RA 1OGSA 1FCVA 1AK5A 1XYZA 4ZB5A 1LDCA 3ONCA 1LOLA 3C2RA 1M7PA 3PBGA 1YEYA 3W02A 2VURA 3MJMA 5EA9A 3NGJA 4OFCA 4O50A 3BG5A 1Q2SA 3H2CA 3FS2A 2XGIA 4L7ZA 4PCSA 3CEPA 3PULA 1M1BA 1EF2A 1V3JA 1XYFA 1OFOA 1GJUA 4HU3A 1FWTA 1NWTA 3COTA 4IUGA 3I7QA 5HATA 3DH7A 4C7GA 5BXSA 4MNKA 4WSJA 4L1XA 4CD5A 3C5QA 1VD6A 1E71M 3I65A 3CB8A 4OZOA 2GGHA 1UKPA 1HG3A 2V8ZA 3O0KA 4UUIA 1CGVA 1W5QA 4JFUA 3F7JA 4UQAA 3ZVIA 4FMVA 3TQVA 3S5SA 1R3QA 2P0OA 1L2UA 4ZQNA 4Z2JA 3F5KA 3L2IA 4PCFA 2FMOA 1YNPA 2UY4A 1TPC1 1UD3A 4NZ4A 2VYOA 1A0DA 4AU0A 1TCMA 2I5IA 3NPXA 1JUEA 5K7JA 3VIJA 1QPKA 4FOUA 2HSAA 3BANA 4LAMA 3CM4A 3HMCA 1W1PA 3QLLA 2OU4A 3VZXA 3QGAC 1TKKA 3EKLA 5AHNA 3NTYA 1UJQA 3FYPA 3WFLA 1Q5MA 6XIAA 5C70A 3VNYA 3BZJA 3LGEA 1W3TA 5FF0A 3DAQA 2R1KA 1OEPA 2PTDA 4IWWA 5DMLA 1V02E 3EB4A 2QCFA 3TJ4A 2AQWA 2IKGA 1FHVA 4B16A 4JIIX 1EGVA 5TBOA 1SJCA 1BG4A 1T96A 2BASA 3XINA 1UROA 2YCEA 2B31A 3PSVA 1W6TA 2ISWA 4US5D 1Z69A 4KRTA 5D02A 3ITCA 3TYAA 1ITXA 3B9NA 3ZIZA 1QK0A 3EMZA 2EKCA 1R7OA 4LUIA 3F5JA 1JDFA 5TIMA 4US6A 3T05A 2ZWZA 3KS6A 4Q4MA 2XUCA 4A6GA 3TROA 2PWHA 2XGZA 4IMDA 3IUIA 1O1ZA 2QIWA 3N9KA 3BGGA 4U4MA 1GQIA 1BVNP 3A3WA 3LG3A 3QHNA 3OPSA 3NSXA 5DN1A 2G50A 2OGJA 2HJPA 1A80A 5IBXC 5HQEA 5LNSA 3BV4A 1L6FA 4GJ1A 3C2VA 3ITTA 3DG7A 1MNSA 1R46A 4PMVA 3GDLA 2QPUA 4BCEA 3EOLA 3LCIA 3PWGA 3U2OA 4RE4A 4BQ5A 4NJHA 1KFJA 4PL2A 4PMNA 3S42A 4IMFA 3VD7A 3O6DA 4HCLA 1NTHA 3H2EA 1KRCC 2RJHA 2DORA 2A3EA 2XPKA 5JBDA 2G5WA 3UWZA 3EGJA 1HKMA 2XZ9A 3ZQ9A 4URIA 1E9IA 5CZSA 2FFCA 2VC7A 1CTNA 4BI5A 2J6XA 4FNPA 3BOLA 1XIMA 3QV6A 3LI1A 2NVDA 2P8CA 4N9BA 4J1OA 3HJZA 1IIHA 1HJQA 4DBDA 1YNYA 1NWSA 4PUWA 2O4MA 1LF1A 4YYCA 4HNLA 2XFYA 5KZ6A 1WXZA 3PG9A 3GG8A 1UOZA 1UP0A 1TFVA 3LMZA 3BMXA 1GG0A 2J7HA 1IEXA 5BMXA 3II1A 2HBVA 2BG5A 1E4MM 3E6EA 1U5JA 5GQBA 1WOAA 5EFDA 2NUXA 3NO5A 4IJRA 3NQAA 1C3FA 2VDHA 5FKYA 1KBLA 3HN3A 1ZJHA 4O19A 1TO3A 4GI9A 4B5TA 3NOYA 3S46A 4Z08A 5T9BG 1A50A 4EK7A 1LT8A 5DO8A 3ZWTA 2CZDA 2NQLA 1G4EA 4J3VA 1IXQA 5HR6A 2OCZA 2R1NA 1TZZA 4K8GA 2ZZ1A 1YW1A 3RITA 1QOQA 3HBLA 2OGYA 3GK0A 4G1NA 4PMZA 3AOFA 1XG3A 4PZVA 2YA1A 3GHTA 3MWCA 3HQPA 1US3A 3BLIA 2YCJA 3TX9A 4CU8A 1F61A 3D0CA 4TIMA 3LLXA 2VGBA 1XLEA 1FWBC 4JPGA 5AYIA 1E9LA 3FOKA 1F7BA 2Z6IA 4BF5A 1FH7A 2V5DA 4YL2A 2E5BA 3V7PA 1EJWC 4D6JA 4D71A 1KM0A 2Y0FA 1DQXA 3V0SA 2ANUA 1M7OA 2VZTA 3UNTA 1XH1A 1W1IE 3M47A 4IP4A 3F03K 2PAJA 4OWGA 3SCSA 5AHFA 3B03A 4HT3A 4PB3A 3IRSA 5EMKA 1PX4A 3VUPA 4NRRA 4TX8A 3XIMA 2J62A 1S5NA 1XLGA 4JY9A 3EDKA 3SBFA 5AY7A 3AS3A 3G24A 1M9HA 1XDLA 2VCAA 2BVWA 2CZVA 1YBQA 3NQ6A 5JXQA 4A35A 5D9MA 4HU0A 2PWFA 1OINA 4WOZA 1FWCC 4HA3A 2POTA 3MUZ1 2CW6A 2NLYA 4F8XA 2POZA 1XIGA 2WSPA 3OB8A 3KBJA 1G94A 3P60A 3QHMA 4KEVA 1XP3A 3FJ6A 4ZOCA 3QSRA 2R8WA 4S3EA 5A8OA 2CESA 1IGSA 3SSZA 2NXHA 4WR3A 4ZCWA 4BJHA 2GUUA 1H7RA 3ARZA 3RLGA 3BWWA 3FA3A 1N82A 3WCZA 3LDVA 1V3HA 3PWAA 3L5MA 2NQZA 3EX2A 2VEMA 5KZDA 5TD4A 1LQ2A 1QNQA 3W9ZA 3KL5A 4MSSA 2E77A 1T6MA 2X1TA 4PB4A 5BU6A 4MF4A 4U31A 5LIYX 9XIMA 3GH4A 2OZ0A 2EKGA 1JDDA 3FNDA 1JJKA 4LF2A 4XAFA 4R53A 2AAMA 1J0YA 3LHWA 1W9BM 3PTKA 4M82A 2R1PA 1NOUA 2QDHA 3T81A 3WJWA 1OABA 2NWSA 3HGRA 3S2NA 4Q8PA 2FB2A 3PPCA 3ATYA 2QMJA 1GYMA 3CUFA 1TREA 3W7GA 4AWEA 1JAEA 4W93A 4GY0A 4IQJA 3CK5A 3S1GA 2ZE3A 1Z32X 4JTUA 4GQ0A 4D8ZA 4L5ZA 3T0DA 4O10A 5EY5A 3H7RA 4Q8WA 4PTDA 2R91A 3AROA 4ENLA 2PDLA 2EPNA 5I09A 3ALGA 5C55A 1P7TA 3S83A 1JPDX 4L56A 3A64A 4C6PA 3ZT6A 3JS3A 1RVGA 4BI6A 1OF8A 2ABAA 4Y2WA 3WG6A 1SM9A 2QQ6A 3N17A 4KESA 3IIXA 3M7WA 4AZ5A 2Z6JA 5I78A 4BQ4A 3D46A 1HKVA 3IJQA 4EP8C 1OB0A 3GQYA 4Q3MA 2Y1HA 3V16A 1LOSA 1ADDA 5AVNA 2CERA 4PFHA 1TTJA 3UZXA 2R9RA 3R8HA 2YCIX 2GSHA 2MANA 3LM3A 5DMMA 3SY5A 1WE5A 1KO0A 2VX6A 3ZLFA 2YW3A 1SJAA 3W00A 1C90A 1JZ8A 3T07A 3WH5A 4MM1A 4YLWA 1EC9A 1ICQA 5HULA 2O92A 3CYJA 1I2NA 1T8QA 1AFSA 1EC7A 1RA5A 3CTTA 3ITYA 2HRWA 3PY2A 1GUVA 1C7TA 1LRNA 1Q4NX 1ZPTA 3DCPA 5HNTA 1W9DM 1DJYA 2HK1A 1M7XA 2ZXBA 1IHIA 4DXXA 4HZMA 1MVYA 4IHCA 4P2VA 3A9IA 2Z26A 2DIEA 2VFDA 2B7PA 4BR1A 3WQ5A 1BGGA 2P5NA 5DRIA 1I8JA 5T91A 4KCWA 3B3DA 3CPUA 1Q65A 1GYLA 4ICCX 1XYLA 2JEQA 4EVZA 3VDGA 1BLIA 2GSJA 4I5XA 3WQ6A 2AL1A 1J0KA 3QTPA 2INEA 4DJED 1Z89A 3FAXA 4EPEC 4NJKA 3O3RA 2G97A 5BU9A 1GVYA 4NSBA 4EIVA 2JKAA 2DV0A 1BSLA 3BG3A 4L4PA 2O4QA 3W28A 2WKGA 1JF5A 3VGGA 1F3WA 4KGLA 3DU0A 2OWWA 3K8MA 2CZEA 3GKFA 3DGBA 4XWUA 2XN0A 4IMEA 2QV4A 4B5UA 3AS1A 2J13A 5AC5A 3WQVA 3WMLA 3KHJA 3B0VC 4HHLA 3TCSA 1VIWA 5LXEA 4HTYA 2Y88A 4WHBA 1QTWA 1OBAA 1ONEA 1CXFA 4UXDA 3EZ4A 4YVPA 1HL8A 2EJAA 2ONEA 1AH0A 4RPPA 4H8NA 3EMQA 4BKNA 2A1YA 4A8IA 1VFLA 3LZ3A 4FS9A 3WH8A 5XIAA 4MWAE 3MUXA 4I9JA 4XUYA 4Z2GA 3MUY1 4XTDA 7TIMA 4IPIA 3E0IA 4LVDA 2F6KA 2PU1A 3VIOA 2WHJA 2XIJA 2ZRZA 3WLJA 2G3FA 1E4IA 4QM1A 1I0BA 3TCEA 1H7PA 5HMDA 3EX3A 1NDWA 1TELA 3W76A 3OBAA 4F9DA 5KETA 2FZDA 1ZSXA 3W7EA 3P84A 1XLCA 3K2GA 2Y8VA 1PX3A 2CC0A 2QDGA 2IKJA 3PTQA 4I9MA 3TONA 3W6MA 1OADA 5I79A 4C1LA 4KEMA 3H4XA 1XBZA 1VFFA 2DJLA 4PEKA 2E09A 4XZMX 5DT7A 1QVBA 2FHFA 2NLIA 2OPJA 4MFEA 4HMNA 4F0HA 4JNYA 2OEMA 3HURA 3KRSA 2XHYA 4AVNA 3WK0A 1RBAA 1MUWA 2Y85A 4UFIA 1TV4A 2XIBA 1IXPA 3IVSA 3M5VA 1JCLA 4KW2A 4RZBA 3OQEA 2QZRA 1TPVA 2UV8G 4MLJA 1VPXA 4UR8A 5I3GA 2WMJA 5FF4A 3WEMA 4R9OA 2QUVA 3WD3A 5GNZA 4KWUA 1RJQA 4Y8FA 4LAKA 3C2FA 3OZPA 4UWMA 1FWDC 4RJEA 1N55A 2QULA 1ICPA 2Y5EA 3WDHA 1D3GA 3SUSA 1UQYA 3EPMA 4F0RA 4NZCA 1TIMA 4IMGA 2E28A 3MUIA 4OUIA 3KLLA 1LL7A 2QAFA 2I14A 1EO7A 4A4AA 5IDZA 1TJ2A 2ZUVA 5H8UA 1OC5A 2PODA 4HMDA 1QNPA 2DT3A 2E1WA 2Y6ZA 3VOJA 1B54A 2QLYA 2XVGA 3R0KA 1O4UA 3O6CA 3QH2A 4LVAA 3EAUA 5FAJA 5A8GA 4RE3A 1UC5A 4WF7A 5CPOA 3B8TA 4JTGA 1X6NA 3ZO9A 3BAXA 3BVJA 1ZP4A 1K7XA 3R4IA 4JS3A 5A1AA 2PDHA 1QNSA 2QCCA 4HSNA 3GXTA 3CJPA 3GTHA 3HIJA 3MMDA 2BNJA 2AGKA 3KBMA 3PZTA 1XC4A 2TMDA 5E0CA 1HL2A 2VENA 1DXEA 1W1ZA 1EOMA 1QPNA 5IRPA 1KGXA 5HNUA 4K39A 1OC7A 6TAAA 5A8MA 5HBFA 4ZOBA 3AXHA 3AS0A 3P0XA 1NARA 3NQEA 3HGJA 4A3RA 3IIVA 1VEPA 1K9FA 3V0UA 3GG7A 2IPFA 2FVKA 3SRHA 3DG3A 3TLQA 1K77A 2ON3A 2XVKA 3KOXA 2EGZA 2PP3A 3RM8A 3D6NA 1OX6A 3I7RA 1GQJA 1OT2A 1AD4A 3B0UX 1UP3A 1O5KA 1Y7VA 4GQQA 4QAIA 4UCGA 4X0VA 4B91A 2YSWA 1SU5A 2XVNA 3TN4A 5CBBA 5CAKA 1CX9A 2WBKA 3E0WA 2IQTA 2H6RA 5KZEA 1KBJA 5A6MA 3LCGA 5I24A 3KBNA 3G8RA 3UGVA 4J3TA 1BWLA 3URAA 3GVRA 1TSIA 1UWAA 2E25A 3MKCA 1ADOA 1UR1A 1OHLA 3RJYA 4H19A 1XHGA 3SI9A 3S9YA 4DM1A 3AXIA 3BGAA 4IFKB 2DVUA 2VQTA 5C71A 3SCOA 5DCDA 3AHXA 3UWWA 1W3LA 2PRHA 5I2UA 1R9ZA 3L65A 5XINA 3RX2A 2AQOA 4YCPA 1OG6A 2CXEA 3MC5A 4WXZA 5FSDC 4I9TA 4Z2LA 3CWHA 3NGFA 2PDNA 1R85A 2XVLA 2GJRA 5HQLA 2PWGA 1MDRA 3H22A 2RAGA 3HU7A 2SFPA 5AYXA 2GLKA 3G22A 4GVGA 3QFEA 3KCLA 2O0TA 3MCNA 5DMYA 4JTTA 1WZKA 3DC0A 5CGMA 3SR7A 3GWQA 2VC9A 4WY0A 3W7IA 1QW9A 1CB2A 5LNUA 3VNDA 2I7GA 3RCMA 1M41A 3NQFA 1LWJA 4XBKA 4KCUA 4CN4A 3N12A 3MQTA 3W22A 2ZXAA 1TMLA 3TSBA 3TZNA 3FN9A 3GAKA 1S1RA 2PDXA 1IZJA 3VD4A 1W37A 1TUFA 2WWCA 3WF3A 2OYMA 3W1TA 1S5TA 1IT0A 4WCJA 1CXHA 4GBUA 4L9ZA 1CWYA 2D2HA 2WZHA 4Z1BA 5HDRA 3T78A 4DUXA 3OG2A 4CD7A 3UXKA 1DJHA 1XGDA 5LZLA 4B5XA 2JFEX 2XSXA 3WK3A 3W7JA 2FIQA 3FSUA 4QJ4B 3NYZA 2R14A 3SEPA 2VOMA 1MEHA 2QF8A 1PKNA 4AIUA 3BCFA 1T40A 3W6LA 3DI1A 1GOOA 4LH8A 4XZ9A 3C0SA 3WH6A 2VHLA 4EPDC 1MQRA 4GVHA 3PAJA 1XINA 2W63A 4IISA 3GW3A 2HCVA 1D7FA 4XO7A 1DJWA 3PANA 1XIHA 1V0KA 3FKKA 2FTWA 1JRBA 4ZE4A 4GH3A 4ZFMA 1JD7A 3M43A 8TIMA 4HNNA 2CZFA 2HPMA 5SWUA 1XLHA 1ZJAA 2J27A 5E93A 3FLUA 5C54A 5BWAA 2W61A 1F73A 3G1DA 3KOWA 3WNNA 2PGWA 4Y9NA 3P74A 1RVKA 2OXNA 4GXPA 1EP3A 1U30A 1KXHA 2WZMA 4TMBA 4RW3A 5D2VA 2BX7A 6ENLA 4PMUA 4BEQA 2F6UA 4QG8A 1UD6A 3KX6A 3KDNA 2XWEA 3R11A 1KFWA 3SJNA 2GYIA 3PF3A 3UWVA 1EA9C 4MFDA 3BG9A 1CXEA 5H91A 2QNEA 3B05A 4QLKA 2YZRA 3MTWA 1QNVA 1LTDA 2XIOA 1GJPA 2Z2BA 5AHMA 4LNCA 3VU2A 1US0A 3LA4A 4AW7A 4ZMGA 3SCRA 3VOCA 4I8YA 3TOYA 3LS9A 4I9AA 5F1UA 2UY2A 3WLNA 2CKSA 2NX1A 2XH7A 1BQCA 3STPA 2EPLX 2CHOA 3W24A 1TV7A 1GVFA 4ACYA 1V3IA 1SGJA 3OBKA 1LROA 2VRKA 4DUVA 1R87A 3POHA 4QBXA 3E2RA 4Q8OA 5G4EA 3KVMA 1J6OA 5CJ5A 5HANA 1FWHC 2D0HA 1KQZA 2FMNA 1UKQA 2DW6A 4AHOA 1B1YA 1N8WA 5FJOA 4RK8A 1Q8AA 2Z25A 5EFFA 1UD2A 1S2VA 1XLAA 5I3JA 1GVIA 4G7EA 4CQBA 4L6HA 3NQ2A 2EQDA 4JQ2A 2Q8ZA 2FZMA 5CBIA 1MNZA 2V5BA 5E1QA 4TVDA 2WQDA 3TN6A 5I07A 2PZNA 1IT8A 3TH6A 1FA2A 3CPRA 1BSIA 2Y8UA 3N4EA 1J18A 2FZNA 4Y9AA 3BICA 3DX5A 3HV9A 1X39A 3E0FA 2YOCA 4F0MA 3MB9A 3UJ2A 3W2NA 1B3WA 3ALFA 3O1NA 3CWNA 5A8NA 3GIQA 2I9UA 4V28A 4U28A 1WDWA 2WW5A 4ACZB 3UCCA 1DWGM 1JCNA 2JALA 2L5HA 3CU2A 3PB0A 3M5ZA 3E38A 4FA3A 5C5YA 1IQ8A 2ISVA 2RDXA 1DPMA 3ITXA 2J79A 2OLAA 4UTUA 2D0FA 3H8AA 2ZX6A 1LG2A 3CQIA 2GUBA 4HHMA 5AVHA 1H50A 4AWSA 4FK9A 1JPKA 4H8VA 3FEQA 4U3CA 3FHQA 5EPDA 1E70M 3I68A 5BRPA 4H8UA 3WLPA 2REQB 5F4WA 4NU7A 1K02A 4L4MA 3H2NA 4H7CA 1MUCA 3G0UA 1BYBA 2VCCA 3TW9A 3RU6A 4LQ1A 1BYCA 2YCKX 4GI6A 5DCEA 1IEVA 3DBPA 3VTRA 4KETA 5LXXA 2VEFA 3B8WA 3VFLA 4U10A 4FXFA 1RD6A 1VLIA 1XCWA 1VRXA 4JQ1A 3O7UA 4TX6A 4XKMA 4ZXOA 1QI4A 1WYIA 1TA3A 1ECEA 5D9PA 4IP5A 4FAMA 1WO2A 1LM1A 4TV5A 1K8ZA 2NQJA 4HA4A 1PXGA 1DJGA 2NUYA 4V33A 3VCRA 1WP6A 2XIQA 4LBUA 4XSMA 1TV8A 3CB3A 3BGJA 3CO8A 1I0DA 2X30A 1R3WA 3W27A 4GVFA 2FTYA 3GSMA 3PBYA 2CLLA 3AI0A 1VQTA 2A79A 4HVXA 2WBGA 4DIAA 4BQ3A 4MVAA 2FZ9A 1PZ0A 3MI2A 1V77A 4O53A 1TCDA 1XUZA 4QIUA 3GUGA 1G1YA 3WNPA 3S0CA 3RR4A 3I6TA 4GGBA 4QG9A 3CT2A 4AHQA 3TTOA 5JBFA 3RPMA 3VO0A 3AQUA 1SFJA 1HJXA 1A4LA 4DJFA 2JGYA 2C1GA 5DANA 1OYCA 5JIWA 2HWGA 2Y7FA 2Z28A 1YX1A 2A7PA 3SQLA 3WBAA 2GUYA 4C6CA 2QT3A 3V18A 3LV5A 2WMGA 1Q3NA 3HPXA 3L66A 1BG9A 3N6JA 1ZJBA 1KFBA 3SO7A 1CLKA 1KGUA 2VDGA 4B90A 2I56A 3GG0A 3E0LA 1WKEA 2V2DA 4ES4A 3N15A 3MYOA 2R82A 3WH9A 5HQMA 4Y9MA 4KBXA 3NQMA 2BDQA 3U48A 3VMOA 2QJMA 4B2DA 1RUSA 1F9CA 1IE7C 2E1DA 1DORA 1E1EA 4FF5A 3RCNA 1LORA 3LD5A 2QCDA 4GINA 4PBFA 1E0XA 3TFCA 1KB3A 5C9ZA 3FVDA 1NJJA 3CL8A 1SO6A 3LCXA 1W3IA 2W66A 2Y62A 1H49A 3RK8A 1PX8A 3AWOA 1G4TA 3FV9A 1BEUA 3LGDA 4Y9OA 3TA9A 4DAFA 1E6QM 3IUHA 1VPYA 4WEVX 4QG6A 1RH9A 1Q4WA 4MYXA 2ZDSA 1P0EA 1OYAA 3A47A 1E40A 2J8TA 4ZOEA 1E6SM 2NT0A 1QWKA 4KH2A 5G4HC 2ADAA 1UJPA 3O6YX 4IGNA 2JK2A 1XI3A 4PCPA 1BYAA 4ZB0A 4AFYA 1A5MC 1W8SA 4UTJA 4Q4PA 3TYUA 1QO2A 3LNMA 2QUTA 4UFJA 4KWSA 3MMWA 3SCQA 1VBUA 2RKXA 3VKJA 3AMDA 2OWXA 5CPTA 4FNUA 4B15A 3RR1A 3MDWA 1O5RA 2A3HA 4PH6A 3QKZA 1FBAA 5C7HA 4HTBA 2J78A 2YCLA 3KP1A 3RF9A 3EB3A 4IGMA 3MZNA 1K7EA 3G0SA 2Y8KA 3ISIX 1QHPA 4V2XA 3F5LA 2J74A 2X7WA 5E0KA 5DXYA 3W85A 4Q8VA 4GX8A 1DWAM 2J4GA 4Q8MA 3FVMA 2BODX 4J28A 1W3JA 4GYKA 2FGLA 2VEKA 2ZFAA 3KBSA 3VC5A 4WSHA 2VEGA 1Q6DA 4MHBA 3FCPA 1EDTA 1XLFA 1V6UA 2R94A 2PLJA 4JL1A 2CLEA 3B0XA 3WQEA 1NU5A 2G3JA 3V4BA 1EBGA 2V9DA 2ZVRA 2NXGA 2GGJA 3FEMA 5FEWA 3TSMA 2ZUNA 4K1WA 3H6OA 3ARXA 1I2RA 1O12A 3V0TA 1X96A 1DOSA 1K7FA 4H00A 3QPYA 1YDOA 5LGXA 2HBXA 1QNOA 2O7QA 3FDKA 3IJ6A 4K37A 2E6YA 3CV2A 2HS8A 3QSTA 3GVQA 3FW6A 3GU9A 1JGMA 2WB5A 3INPA 1KFKA 4CD4A 1XISA 1WAWA 1EXPA 2GPTA 1XM3A 2Q02A 3C61A 1OYBA 3RN6A 1KCKA 3W6YA 3PZGA 1QMLA 1OX4B 1Y8BA 4FLRA 4PMXA 2RDWA 3OVGA 3FGCA 1G5AA 5LHEA 4MB1A 1EO5A 4B5WA 4QDPA 5M3WA 4GGHA 1RXOB 3W7HA 2WZIA 1ME7A 3F2DA 1M3UA 1EHAA 3GFXA 5ENLA 2J47A 1PB0A 2IXVA 3VDHA 4BHYA 3BPWA 3P7YA 3U0HA 1ELSA 3QR0A 3M6YA 1EJTC 4LRSA 1E3ZA 4W9TA 5A8PA 1FWJC 1V93A 3VGBA 1GVQA 3WK1A 4XQ6A 4C60A 1ZHAA 4JZ5A 2VX4A 3LRKA 4IIGA 4GUHA 5HMSA 4MJ2A 4MZYA 4YCOA 3TUUA 5HUOA 4XUGA 1F74A 2CHRA 3C3NA 2J25A 3A4WA 3UPBA 4PTVA 1NQ6A 4HA0A 1UD8A 3BE7A 4INFA 2UY3A 1Q2RA 1FTXA 4QAWA 4UTIA 3GTXA 4FLQA 4MDOA 3LV6A 3Q2DA 5KTLA 3VKCA 4NYUA 4E8GA 2VGGA 4Z17A 4RDVA 4GUIA 3NM3A 5XIMA 2F6XA 2IS7A 1IT7A 5K9XA 1B0IA 4RZ5A 4NKCA 4UFKA 2W4XA 5EYWA 3LXCA 3DC8A 4AEOA 1JFXA 1RK5A 7ENLA 4Q32A 2QCEA 4L64A 8XIMA 4AWUA 4MWAD 5D30A 1KWGA 1EJ7L 2QR6A 4KEZA 3N6QA 1RP9A 2PP0A 2Y4SA 3TK7A 3DENA 2OR2A 4HPGA 4J4KA 4DXVA 8RUCA 4K8HA 3GYEA 4IFRA 5BOFA 2EXOA 3L21A 3TYBA 3VX0A 3GG1A 4B3KA 2TRSA 1Y5XA 3RNDA 3BQ5A 3CUZA 1EJUC 4E2VA 3LLFA 1BD0A 1U1HA 3W1XA 3SJ3A 3G1YA 3NQ7A 3P5ZA 2W92A 3BMWA 5ABHA 4UQDA 1QU4A 1CGXA 3HPSA 5ABGA 4DNMA 3A9BA 1QW7A 2V38A 1DWIM 1X8FA 2OSYA 2Z0IA 4PL1A 4Q4OA 4FHAA 2HMCA 4C1NA 3O05A