2AGTA

Aldose reductase mutant leu 300 pro complexed with fidarestat
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Factorizing Selectivity Determinants of Inhibitor Binding toward Aldose and Aldehyde Reductases: Structural and Thermodynamic Properties of the Aldose Reductase Mutant Leu300Pro-Fidarestat Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2agtA00
1AH0A 1S1PA 4GABA 4WDUA 1Q13A 1RY0A 5LIYX 2F2KA 2PZNA 5KETA 2VDGA 2PDQA 3LN3A 3LD5A 4PUWA 1S2AA 4WEVX 1YE6A 1S1RA 4LBSA 1PWMA 4DBUA 2IKGA 4IJCA 3R43A 1T41A 4GACA 2IKJA 3CAVA 3D3FA 4QR6A 2HDJA 3Q65A 3U2CA 2INZA 3LENA 4LB4A 4WDWA 2R24A 3V0SA 3UYIA 1MI3A 1OG6A 1JEZA 3DOPA 4QX4A 3MB9A 1ZUAX 3T42A 2FGBA 2INEA 4ASTA 1IEIA 2HE5A 1YNQA 4JIHA 1EF3A 4PRRA 4JQ2A 3UZXA 4QXIA 5JH1A 1ZSXA 3GUGA 3Q67A 4XAPA 1Q5MA 3FJNA 3UFYA 1VP5A 3UGRA 4WGHA 3RX2A 3BV7A 3P2VA 2PDBA 3C3UA 3CV6A 2PDMA 4I5XA 2PF8A 1AH3A 2IQDA 1IHIA 4EXAA 3CV7A 1YE4A 1HW6A 1R38A 4LBRA 4HMNA 3BURA 2IPJA 3FX4A 1ZGDA 3N2TA 2DUZA 2R9RA 4ICCX 3V35A 3NTYA 3N6QA 2IQ0A 4YU1A 2ISFA 3GHSA 1PWLA 1EXBA 1AZ1A 3M64A 5M2FX 2IPGA 4JQAA 2BGQA 4FZIA 3H4GA 3EB3A 3LZ3A 2P5NA 1M9HA 2ALRA 4WRHA 2PDUA 4FA3A 4OTKA 3R8GA 4YVPA 1Z9AA 1PZ1A 4DZ5A 3GHTA 2PDLA 4GQ0A 1SM9A 4XVEA 2PD9A 5LIKX 4AUBA 3CAQA 2WZMA 1X98A 2HVOA 5HA7A 4JTAA 3UZYA 1QRQA 5C7HA 3ONCA 2A79A 1EKOA 4PUUA 3UWEA 2BP1A 2NVDA 3WBWA 1AH4A 5JH2A 3RX4A 2ACQA 4G5DA 4PRTA 4GA8A 2PDKA 2PDGA 5AZ0A 3R7MA 2PDPA 2I16A 3LBOA 1X97A 2PDFA 1VBJA 1RALA 4IJRA 4XK2A 4XVDA 2FZBA 3CMFA 4EXBA 1GVEA 1J96A 3LZ5A 4YVVA 4GQGA 5DANA 5HNUA 3UP8A 1AFSA 2BGSA 3R8HA 1RY8A 3O0KA 4JTCA 4PR4A 1XJBA 4XZHA 4H8NA 1ZQ5A 3LEPA 4L1WA 1AZ2A 2IKHA 4XZNX 3R94A 2DV0A 2FZ8A 3ONBA 4XZIA 3V36A 3COTA 2WZTA 2AGTA 4YVXA 4XZLX 4JIIX 2PDYA 4DBWA 4WDTA 2F38A 4Q7BA 2PDXA 1MRQA 3M0IA 1LWIA 2I17A 4YS1A 1US0A 4Q3MA 3H7UA 1EL3A 3LNMA 2IPWA 3EB4A 4JQ1A 1ADSA 2PFHA 1XGDA 1MZRA 3G5EA 3RX3A 2J8TA 4XO7A 5HNTA 1UR3M 2PEVA 5LIUX 4NKCA 1X96A 3O3RA 4FAMA 3F7JA 3DN5A 3VXGA 1K8CA 4H7CA 3UZWA 3GHRA 3WBXA 1PYFA 1XF0A 4JTRA 3EAUA 4DBSA 4PMJA 1C9WA 4JIRA 2FZDA 4HBKA 2FVLA 2PDCA 3LQLA 2HVNA 2HEJA 3R6IA 3LUTA 2DUXA 4QBXA 1A80A 2PD5A 2NVCA 3B3DA 1FRBA 4LB3A 4JTQA 1T40A 4R9OA 3H7RA 4JQ3A 1Z3NA 4XZMX 2C91A 3V0TA 3LQGA 2PDJA 4LAZA 2PDWA 3S3GA 4ZFCA 1YNPA 1LQAA 1HQTA 1PZ0A 4L1XA 3G1RA 5LIXX 4LAUA 5AZ1A 2CLPA 2ACUA 3UZZA 3V0UA 4JTDA 3MC5A 3QKZA 4RPQA 2ACRA 3GHUA 4F40A 2HV5A 3BCJA 3R58A 4MHBA 3CASA 1Z89A 2IKIA 5LIWX 2ACSA 4GCAA 2IS7A 3M4HA 2QXWA 3KRBA 3WCZA 2FZ9A 4WDXA 1QWKA 3WG6A 4JQ4A 3UG8A 2PDHA 4XO6A 2PDNA 3BUVA 3WBYA 1Z8AA 4IGSA 4FALA 4GIEA 3ERPA 2IPFA 2HE8A 1S2CA 2PDIA
chains in the Genus database with same CATH superfamily
3A6OA 4DLFA 2V3DA 3VPLA 2MNRA 1Q13A 1RY0A 5K3VA 1SO5A 4ZMGA 3B0UX 7XIMA 5HDRA 3GXMA 4LBSA 2DP3A 1WKYA 2HMCA 1RZMA 1R87A 3RHGA 5FJIA 2YBUA 3T0AA 3P61A 3WL1A 4DPPA 1UA3A 5XIAA 2J4GA 2VEKA 2G3JA 5E0FA 1HJSA 3U2CA 4MB3A 4BF5A 1N8IA 4MLRA 3ARYA 2WHLA 2Z1SA 1GZ1A 1JD7A 2V2CA 5H2ZA 2V5DA 2ZFAA 3E2RA 3CU2A 2XG9A 2E28A 2Y2WA 1FWRA 2FFCA 3UPMA 1WUEA 2QUTA 1I0BA 2RGMA 3G0SA 2GQ9A 2EEXA 4XAPA 3F4CA 3MSRA 1PIGA 3G1VA 5I03A 4KEUA 3TTQA 4IIEA 3WL0A 5LGZA 4S3JA 2Y61A 1BTMA 3WEMA 2WJZA 5AHEA 4IIGA 4JTFA 2ZUMA 5GVJA 2HK1A 3OVRA 3WQPA 4UCFA 3P5YA 4AD5A 4AZ7A 3QY6A 1ZBVA 1ZAHA 1FWNA 3TZFA 4TMBA 4ICCX 3P67A 1XLHA 3W1XA 4G1NA 4J9JA 3UPWA 1IWPA 1XLDA 1ZBWA 1CLKA 3NSXA 1FWSA 1JXJA 2IQ0A 3MKVA 2OEJA 4UR9A 3THAA 3M64A 4JQAA 3VVGA 4PCTA 1TWZA 4FXJA 5AKQA 3VGDA 4ATLA 3CQJA 4W84A 1N8FA 2ALRA 3HJZA 4ZQCA 2CHOA 1TZ7A 2J7HA 1UR4A 4CQ9A 4FB7A 1HGWA 1OGGA 4F0KA 3AUOA 3IRDA 4XVEA 1JNDA 2PD9A 1OEPA 3DG7A 4MWAE 3SM0A 1OX6A 1CB7B 5I09A 3SECA 2FPTA 5EMUA 4M24A 4DO7A 5ABFB 2OZ0A 3W71A 1P5BA 3OVGA 2PMQA 5EKYA 3NG3A 4HPGA 1GORA 2G41A 3Q37A 1OWQA 1ZBCA 4MYXA 4N7QA 4O16A 1CGUA 3AXXA 3LCLA 1H5YA 3B9DA 1BEUA 4IJRA 4LVBA 1FX6A 4ZBCA 2Z25A 3T40A 3BL3A 3OYZA 2QVHA 2OX4A 3NZGA 2PA6A 4NL1A 2GVEA 4RZ4A 1CGTA 3KUMA 4IZGA 1NIUA 4P5UA 3S9YA 5CSSA 4CQ8A 3WEOA 2E67A 6PTDA 3GU1A 2WNZA 4J7RA 4JN7A 1O94A 2E68A 4M80A 1GJUA 3TK7A 3N04A 3W28A 3UGVA 4UBPC 4P2VA 3PBVA 1M3UA 4EPEC 5CAKA 3I3EA 3S2MA 2V6AA 3GVQA 3IPWA 1CT5A 4GVGA 4Y6GA 4WDTA 3BG5A 1M7PA 2ISWA 2RHGA 3BLDA 3PG9A 2F38A 1IR2A 1Q6DA 3MA8A 2E6YA 3QSTA 4GBUA 3TJ4A 4TOQA 1US0A 4KKXA 3ZWSA 3IJDA 4IP7A 1W3IA 1H4PA 1OC7A 5BYWA 3CHFA 4H9TA 4UFIA 2VP8A 3S47A 3MY9A 2DZTA 4H6EA 1T96A 3JS3A 4CU8A 2VEIA 3NQ7A 1G0CA 2W62A 4UFMA 4LEQA 5EBUA 1ZJIA 4IMGA 1UWAA 3TQVA 5DCDA 1W56A 1QXLA 5M3WA 1S2WA 3H2FA 4LRSA 2E8YA 4E3TA 4XD5A 1K8CA 4LAOA 1TTIA 4DAFA 1XH0A 2PLMA 3TN3A 1F2JA 4F0MA 4F66A 4HBKA 2QIWA 4PTDA 1JF5A 4AW7A 4FI4A 1VLWA 1H2JA 4C6CA 5CCZA 3ABQA 3UERA 3U48A 3VIOA 4LUTA 3O2LA 4BF7A 4LB3A 4JTQA 3TYZA 4MJZA 3W00A 3SUTA 3LBMA 3HPAA 1PXGA 2VM8A 4JS3A 1EPXA 3N13A 1ZPTA 2PDJA 3RFAA 2PDWA 3LTPA 3BICA 1SZNA 3CEPA 4YPJA 3R25A 1FY6A 1VJZA 4PL2A 1ECEA 4XAZA 3TROA 4AAJA 5C9ZA 3MZ2A 3NWRA 3VKAA 2V5BA 3T7VA 2CLKA 3SZ8A 3D3AA 4ONVA 4B4HA 1W1ZA 3GQYA 1CXIA 3W37A 1CYGA 2PAJA 2Y8VA 1GOXA 3OLEA 3KTSA 4C5YA 1Z89A 4HSHA 2CYGA 3AROA 1O5XA 5A5WA 3GLCA 3L23A 2QPXA 4J3UA 2A4AA 1F3TA 3QLDA 3A12A 4C1NB 3OG3A 3PUDA 3C86A 4DF1A 1UMYA 3EX2A 1TWDA 3S4TA 1QI3A 4QNEA 3U2EA 1OFRA 3MDUA 4P8UA 4IGSA 3A4JA 4Y9NA 1W2PA 2XISA 1QJWA 5G1YA 4RNIA 4GABA 4PCNA 3W0KA 5J5RA 1VCGA 4RPPA 3A64A 3W02A 4MWAC 2NQZA 2VDGA 3RM9A 2PDQA 3W7PA 4FEZA 2WMHA 1YTEA 5IBXC 2FDMA 4M5PA 2RGLA 1QPQA 3QFWA 3MCOA 4XD3A 5LYRA 1UD4A 1S2VA 3GO2A 5BXRA 2QDGA 1G94A 3AJXA 1KXVA 1W5NA 3GNDA 1JDDA 3GDRA 1FWCC 1KCLA 3LOTA 3FKRA 2J6VA 2PC4A 8RUCA 2GJNA 1Q7QA 3EWCA 2AGKA 2VX6A 3B8TA 3TSDA 3PG8A 3CMJA 1NQKA 2INEA 1KCKA 4K37A 2DIEA 1PVNA 3CIXA 1W3KA 2C15A 4Y90A 3VOGA 3RG6A 4XBSA 1FTXA 2YL5A 4NNBA 3ARQA 4L9ZA 4WJXA 1XLJA 3HOJA 2BLEA 4U5KA 3XINA 2RJGA 1E70M 1JQXA 1PJ9A 1ZL1A 8CGTA 1DQXA 5D2YA 1E6PA 3H53A 3WF0A 3TJLA 1IZCA 1BXNA 3U4FA 3L65A 1FWAC 1EXPA 3K13A 3RO6A 4PYSA 1HFBA 3AYVA 1TVNA 5DY3A 5HR6A 2ZXAA 4NJGA 1ZGDA 2W9MA 1ZJHA 3BGGA 3ITOA 2E5DA 4KRTA 4AIOA 4DWSA 3OLIA 4MMWA 3AAMA 1LZOA 3ELFA 2VENA 3CV1A 1JI1A 1P1XA 4NNCA 3UNDA 9CGTA 4K6AA 1E1EA 4OU1A 2DQXA 3NDZA 2IPGA 5DMMA 2HVMA 2CKSA 1N2VA 1SUXA 1YX1A 4ZOBA 4OVXA 2BOEX 1PUDA 5GNYA 1F4HA 4GPNA 4FNSA 4QEHA 3GG7A 3TR9A 1XL9A 3GM8A 5M03A 5C6MA 4TXEA 2VQUA 1NFBA 5I5RA 2QCEA 4BJHA 4YTQA 4AUBA 4RW3A 4Q8TA 2BTMA 2F7FA 5KZMA 3HM7A 3HN3A 1MDLA 3W2UA 3KE0A 2ZZ3A 4G56A 1RLCL 3TW7A 2NVDA 2ICSA 1F8MA 4WOQA 5CZ0A 4WVXA 3KDNA 2YXXA 1KGUA 4CCEA 3N3MA 4GCXA 3VKBA 4TMCA 3MI3A 3EX4A 1OFQA 2BG5A 4JFVA 4I5UA 3AIWA 1FH7A 3GD6A 3R7MA 3APGA 4TV5A 5HMFA 1J2BA 3AMCA 3E0VA 3QJAA 3O7UA 2Z2AA 4ADUA 1HKKA 2R1MA 4K8EA 2VC5A 3EZ4A 3T0DA 3CMFA 1LT8A 4EXBA 4NI3A 1F7BA 1GOMA 1Q6GA 2DGAA 4ZXLA 3IK2A 3MMTA 2PU0A 1RCOB 4A8RA 3OBKA 5EMJA 1UJQA 1TR1A 2CXEA 3G8RA 1U1UA 2Y7FA 1B3YA 1XJBA 3G6MA 2G95A 3OZMA 1K6AA 4QE4A 8XIAA 4HSOA 4Q4KA 4NNAA 4C6NA 4Q8OA 1UP3A 4DLMA 3TWAA 5FIPA 4GRSA 1U83A 4ACZB 3EA2A 3A21A 4P8VA 4UQ9A 3MUCA 3WNOA 1ISZA 5JUVA 2CESA 3M0IA 4H1ZA 3H7UA 4REQA 3N2OA 2DIKA 3H2CA 3IUIA 3LLXA 2CKRA 2RJHA 3IVSA 3DFPA 1UJPA 1Z7AA 2VDHA 2AL2B 3G1FA 1XDJA 4HNTA 1OCJA 1T6MA 2H8XA 3VILA 3ZM8A 4LYKA 2QUVA 4E4PA 1CNVA 3FJLA 3CS2A 3TMLA 3MUY1 2CERA 2NT0A 3CHCA 3DERA 5D4YA 1ODZA 4DPQA 2ZYFA 2EKGA 4WXYA 1JPHA 4DJFA 4LU0A 3WLJA 3BGAA 3N12A 1VIWA 1TWIA 4Q8MA 4CGTA 1MQRA 2NX3A 3RU8X 4B3KA 4J2PA 1DJZA 1ECQA 3O15A 4QDWA 4K39A 2G0WA 3ZJ6A 4DAIA 2OZ8A 5HATA 1F6PA 5CQ1A 3UEQA 4IM4A 2ZX7A 1T40A 1AJ0A 1H7XA 2NVAA 1RK5A 3WUBA 3DFOA 1TTQA 3E2SA 3B04A 4A22A 1KFWA 3GTNA 3WJYA 5A2AA 4LNYA 1TQJA 4INFA 3TAOA 4RV8A 3G1RA 5LIXX 4TX9A 1AQFA 3DYMA 1E56A 4Q33A 2XVKA 5AHNA 5C70A 4DJEC 2X30A 5IOBA 3BCJA 1PTAA 1YQ2A 4DYEA 1SMDA 2VEPA 3W7HA 3GK0A 5IRPA 3MHGA 1TPFA 2ACSA 5AHMA 3NDOA 5CC6A 2PP1A 4H9YA 3DU0A 2WMFA 4A8IA 4RXFA 1XI3A 3VM5A 4WDXA 4WQ6A 3F2BA 3LHZA 4ZQOA 3PF3A 5T9BG 3K8KA 4ECLA 1SJAA 4L4OA 3FAXA 3LN3A 1SQ7A 1V93A 3TDFA 2YGYA 1EH9A 3GIPA 1IQ8A 2EBNA 2G97A 3SADA 4GUHA 3PFMA 1XKYA 2PCEA 2HS6A 2HDJA 1WBJA 5FEZA 4RZBA 5G1TA 4ICMA 5FJRA 3T78A 2YX0A 3NQMA 1IR1A 4BY3A 1V5XA 2D2OA 2JEPA 3OGSA 4LB4A 1FWHC 3DOPA 2B0MA 4DNHA 4GBDA 1ZUAX 5EL1A 3IV8A 2Z1WA 2Z2UA 4DUXA 4CQCA 3E0WA 3W7RA 1NQ6A 5CBJA 3M43A 4EK7A 2VUYA 5HJXA 4GZ7A 5A6BA 1DWGM 1XIIA 1W31A 2H6RA 3P60A 4L7ZA 4W4QA 3M0VA 2CBUA 4PFHA 3LSBA 4H9XA 1QT1A 3UYCA 2FVKA 3ORWA 2DW7A 2NXHA 2R82A 3VGEA 4D2JA 1SR9A 2OLHA 4DI8A 2HK0A 1XLGA 1VEOA 1S5WA 2IQDA 1BHGA 3IVTA 3CV7A 4Z1CA 4S38A 1JFHA 1HW6A 4PUMA 4UFLA 3BURA 3ITGA 5F1VA 4X2PA 2PODA 3H12A 1TPUA 4R34A 3PBUA 1GW9A 4HP5A 3WDHA 4KRZA 1XFCA 4JTSA 5M2FX 2BGQA 2OKOA 3TQPA 4FZIA 1VFHA 3OA3A 3KVJA 3LZ3A 1ZLPA 2Z28A 1XYCA 3N25A 2O92A 3W1RA 3AZSA 3KEHA 3MCNA 5AHLA 3WMLA 3R13A 2CWNA 2JQXA 3BZJA 4W5ZA 2WNQA 1J0YA 2QJGA 3VNLA 5IDZA 1EGZA 3UR2A 3WUFA 1GOOA 2D3LA 4CVUA 2QUNA 4JTJA 2V67A 1HX0A 2XIOA 4G8TA 3ONCA 2H90A 2OJPA 1H62A 4DVOA 4O12A 3W53A 1S3HA 1FKXA 3ABRA 5AYYA 4DB7A 2I5QA 3S2LA 3AS2A 4FNRA 3JVAA 4MPQA 3M7WA 2ACQA 3NPVA 4PRTA 4HMCA 4C6IA 1XLAA 2ZDRA 4PULA 3W6MA 3W23A 2OU4A 2ZX9A 4EWND 1NDVA 4AIEA 5CPTA 4QJ5B 2PE4A 2VHLA 4NU7A 1X97A 5K9CA 1E6NA 2ANUA 5EPDA 1MQPA 3TXVA 4XUYA 1GG1A 3E5BA 3DZ1A 3JR2A 1UIOA 4JX4A 1UH2A 5FF3A 2GOKA 1GT8A 1UR1A 1H7NA 1W1TA 3V5FA 4JKMA 2GOUA 1GVYA 5BRQA 4HCHA 1W5OA 3P6LA 1U22A 4L1WA 4IP4A 3BLEA 5CPMA 4DXVA 3B8WA 4C65A 1H7PA 5HINA 1O1ZA 4KERA 1C3FA 3EWWA 2AOSA 3CUFA 1SJBA 3DBPA 1XBVA 3NM1A 4JICA 1UC5A 4XISA 2V2HA 4WSHA 3GC4A 3W1PA 1YXDA 3G1HA 4OUIA 4KT2A 1XLKA 1R86A 2UWFA 3MS8A 1JYXA 2BFGA 4AZCB 1HT6A 5DRCA 4QISA 2YL9A 4Y9MA 2BB0A 3VC5A 4AHOA 3KRSA 2VRQA 1EUAA 2GQ8A 2NQ9A 5AYBA 4A29A 3FV9A 4Q8UA 4JHZA 1BKSA 2WMIB 1CTNA 4E2BA 4MB4A 4RE2A 4A3RA 4DUOA 2J47A 2Z7KA 5EY5A 1OFOA 4UR7A 3EPMA 3DG6A 2VGGA 3VXGA 3UZWA 1IGSA 4P61A 3W7LA 3TQ0A 3KW3A 3S5OA 3WQFA 2HZGA 1H3GA 1KRBC 3FVDA 1SZRA 1VHNA 1RD6A 4DJED 2JBMA 4GISA 4CKQA 1ONWA 1R7OA 4D6FA 1QNQA 1DYSA 3N1AA 4W7UA 2Z1BA 1E43A 3QW3A 2ZA2A 2VDIA 3E6EA 2UV8G 3G8EA 3W3OA 4BHYA 2OQLA 3V5OA 5AC6A 3WD0A 4O10A 5DT5A 4S3EA 3VOIA 4CD5A 4X3ZA 2YR1A 1Q2RA 2Z0IA 1J0HA 4D72A 2Z1KA 1XLBA 3L0NA 5HULA 4XG1A 2YKKA 4RE3A 1DWJM 4MKVA 1KWGA 1CGVA 2NUYA 4ML4A 2XIQA 3HMCA 4N4PA 3VZYA 3KS5A 5F2LA 3FA4A 1F76A 1RHCA 5AC4A 2WMJA 1SW0A 2FJUB 3L4YA 1KM1A 1SVDA 2FVMA 2A85A 3GXDA 1JDCA 3NYDA 2PI6A 4A3QA 4ERAA 1L0PA 3NCOA 4UMAA 1QNVA 1QO2A 2XZ9A 1UR0A 2FZ9A 4C91A 1LYXA 1XLEA 4JQ4A 4UNLA 1QNPA 3B03A 7PTDA 4F0LA 4UOZA 1AH0A 3HO8A 1KC7A 1F6YA 1AL7A 2ZQ0A 5HWNA 3QTGA 3MANA 2XGIA 4MY8A 3LD5A 4BQ4A 4WEVX 3EKLA 2CC0A 2IKGA 4O1DA 3SFKA 3DESA 1S5MA 4Q4SA 1RUSA 4CEXC 2X41A 3O9NA 3WLKX 4OWGA 1E9IA 4HCDA 5I3KA 2DT0A 3GZAA 2ZBTA 1WDQA 3F03K 1AD1A 3PAOA 1HVXA 3VIMA 4S23A 5DMNA 4LUSA 3S2NA 2TODA 4OFCA 4H19A 3BAWA 5HXMA 3PPGA 1FWGC 1ONXA 2DSWA 4OE7A 4Y9AA 3EDFA 2DVTA 2FHCA 4IP5A 3UVIA 3UR5A 3W2NA 2HE5A 1S3TC 1ZJAA 4IQJA 3P8JA 4JQ2A 2ABBA 2P10A 4CD6A 1RPXA 4AF0B 2G4JA 2DY3A 3PTKA 1EWDA 2NZLA 4AZHA 3CAKA 4Z2HA 1SSDA 1V0MA 5EA9A 3WY1A 4H9UA 1QASA 1Q2SA 2W92A 4WGHA 4GVFA 4CEUC 2ZTJA 3LERA 4JHOA 1RAKA 1AH3A 1R0MA 4PTXA 4EXAA 4NJJA 3OYXA 3IGSA 4KIRA 1VD6A 2WKJA 1TB3A 1UW9A 1XP3A 4M6QA 5DXYA 5EMLA 1KV8A 3N6QA 3AIBA 5ABGA 2D24A 3XIMA 1PZ3A 1EXBA 3GDKA 3T07A 3IGXA 2TYSA 3KL5A 3WQEA 1VHCA 4N9BA 1DXIA 2Q02A 3NUKA 3WENA 2V2DA 5I7GA 2I5IA 1DL3A 1XRTA 3GTXA 2KAUC 3NYZA 3B0VC 3KBWA 4JN6A 3WLOA 1EYWA 2ZE3A 4JY9A 3C0SA 2WHKA 3B4UA 3B9NA 3NURA 4KFOA 4UNIA 4F9DA 4HHHA 2C1GA 4KWSA 4Y2WA 1Q3NA 3GIQA 2WB5A 3GY1A 1YIXA 4I8YA 3WFZA 4JTIA 3E5PA 1UZHA 1ML1A 3LMZA 3GXNA 3UXAA 1BXCA 4ICNA 4B5UA 2PDKA 3G0UA 4UQBA 4NT0A 3LBOA 5FJUA 1J6PA 4YCPA 4EAYA 2QV5A 3V16A 5BCAA 2BVDA 5LA0A 3H26A 1OZQA 1YPFA 2CBIA 1G7VA 3RM4A 1PHWA 1UOKA 3B0XA 3FDKA 4HPJA 1VC4A 3BWWA 2G50A 2WSPA 3W7OA 5I23A 1I45A 1R2SA 4NQ1A 1XKJA 2WWCA 1AK5A 1FH9A 3PZQA 3R8HA 1OT2A 4PR4A 4XZHA 3O6DA 1OJXA 2OVLA 1EA9C 1XBYA 5FF2A 3PZOA 1A5BA 1BVZA 1CIUA 3N9SA 4DUWA 1X6UA 2VZOA 4PB5A 3TSBA 3HQOA 1X1NA 4BA0A 4U28A 3O0FA 3BAJA 1IXOA 3T81A 4P7OA 1E51A 3Q45A 1GHSA 1ITCA 4FX8A 2VWTA 3K8MA 4M19A 4UMBA 3BC9A 1FHDA 6CGTA 3A3HA 1MRQA 3NEHA 1L8PA 1UKTA 4JTKA 2GGGA 1PS9A 1EL3A 2YOCA 3LNMA 4UTHA 3KOZA 3PBYA 2QCHA 5FCZA 1E5JA 4Z0SA 3GVWA 1XGDA 2DZUA 1DWIM 4GIAA 4GKTA 3OZYA 1X6LA 5CGQA 4POCA 3KRUA 5G2WA 1V02A 1HF6A 4NRSA 5HNTA 3WLMA 5CJMA 3BTNA 1V6VA 1FWJC 3G22A 2VX5A 5K2ZA 2B7QA 2PP0A 3NFUA 1Y7VA 2OGJA 2X8RA 1E73M 4O17A 4N6FA 2F2HA 4WCJA 4AMAA 2QMKA 3QEZA 4Y96A 3GHRA 4IMEA 1KFKA 1WKEA 4V15A 3NOYA 4PBFA 2V5KA 3AFBA 2OYMA 4WY0A 1BYDA 2FPYA 3GSMA 3PSWA 1T5AA 1XYAA 2EKCA 5FSDC 3SEPA 1UWTA 4MYAA 4XB3A 1JQVA 4IIFA 5DELA 1J0KA 4LW7A 5D9NA 4F48A 4OBSA 4YTTA 1P6BA 2AAMA 5HJYA 4ZO7A 4LT9A 2CHRA 1DXFA 3ABOA 2WNNA 1TRIA 3EOOA 5C55A 4MSSA 3POHA 1G6CA 1LRNA 1VLIA 4IMFA 3R0UA 1XYFA 1KQZA 2EG6A 1ODUA 1SFTA 1TRDA 4QITA 2O9RA 2WBKA 3DEQA 1XYLA 3FGCA 3CJPA 3T8LA 3LDVA 1RBOB 3MZNA 4A21A 4A8NA 2XH4A 2V30A 4FNQA 3MMDA 5LKYA 3CAWA 5DF0A 3REQA 3I3DA 3ANYA 1WP6A 1VBGA 1OB0A 2WMKA 3VCCA 3U9IA 3K4DA 4AQLA 4IQLA 3OB8A 4FXRA 1Z44A 5CG7A 1E0XA 3WQ4A 3F4VA 3OHMB 1V6YA 3H21A 2HBVA 2QXWA 2FDSA 3E0LA 2OX1A 4K2SA 3GR4A 4H3DA 4U5IA 4W8AA 4HHMA 1LOQA 4GZEA 1KTBA 4LV9A 1MUCA 3DHDA 3W70A 4H9VA 4TX6A 3PULA 4AX7A 5FA5A 1RP8A 4NJIA 1T41A 4KWOA 1H1ZA 2XM2A 2WWDA 5AB3A 3BSMA 2QJJA 3TN6A 2OZ3A 2HWGA 1D3HA 1XBXA 1MSSA 3URNA 2QHAA 4HOWA 2NV2A 3ABXA 2E40A 4ZO8A 1MEHA 1EP2A 4I6KA 2FFIA 2RKXA 4GQRA 1EZ2A 3QH2A 4I7VA 4RZ6A 4O53A 1FXQA 1HNYA 1FWDC 1T7LA 1HL9A 5GJNA 3D0CA 2JKPA 1WPCA 1TCDA 1YNQA 1RBAA 1XLFA 1I2PA 3U4AA 3ZZ1A 4C6EA 5IFTA 4MVAA 2C71A 2MANA 4S3DA 2DVXA 4XSLA 1PHQA 2Y7GA 3M07A 5G1MA 3ZR4A 1POKA 2V5LA 4EF9A 3GXTA 3GWQA 1XIHA 3IJQA 8XIMA 1JL8A 1R46A 4AG0A 1UQYA 3E49A 3VGBA 2NV1A 2XVGA 4R7WA 3S5NA 1LG1A 3PR2A 3UT0A 4GXPA 3RR4A 3K1GA 1QNSA 4WGXA 1S2UA 3O63A 5BXSA 5F2GA 5LGXA 3VABA 4Y8EA 1KBLA 2R14A 3L7RA 1D3CA 3NGJA 1AODA 4ALDA 2V3GA 2FIQA 2H9AB 2QR6A 2A3BA 5HWJA 1OX4A 1RA5A 4AWSA 4XKMA 3QY7A 3DI1A 3AS0A 5HR7A 1BG4A 1IT7A 4A8LA 3L4XA 1SZGA 3GX9A 3TKFA 3VFLA 4E2OA 1LBFA 3BLKA 2PZ0A 1CENA 1PZ1A 1MMFA 4X60A 1TG7A 4P7LA 3ZT7A 3VNJA 3CAQA 5DY2A 3TTSA 4E2DA 3LCWA 3TYEA 2WZMA 3V18A 3VCNA 2B7PA 4YTRA 2BP1A 2QCMA 3DENA 5CJNA 4AH7A 1H11A 4B91A 3VGFA 2E5BA 7ODCA 2VURA 2QGYA 1L8NA 3MUZ1 6REQB 4G9PA 4G7EB 4DBDA 1G67A 1ONRA 1JIBA 1P7TA 2BODX 4Q4RA 2J6XA 2DZSA 1EEPA 3A9IA 2BDQA 2Y5JA 3W7JA 3NQVA 3PWGA 1AW5A 3LV6A 5A8GA 1QW7A 3T55A 1HJVA 2GLKA 3VGGA 3KX6A 3LCHA 2WV8A 3LXAA 2XZ7A 4GUJA 4HD5A 3BW4A 1KNWA 4L6HA 1Q63A 5I6SA 4LV4A 4WY0F 4M81A 3DGBA 3GS6A 5E0KA 3WLNA 5DANA 3ITTA 3PPCA 5C7VA 3CUHA 3M0YA 3N6JA 5DEZA 2XFWA 2RUSA 1NJJA 1MQQA 1Q45A 2J9ZA 1XIBA 3UR8A 4O8RA 3W7EA 3PZMA 3H6OA 4X22A 1TPH1 3SUWA 4C6MA 2ON3A 4V33A 4HK5A 4HTYA 3BANA 2XH0A 1QO5A 1OYAA 3TP4A 2D69A 1WOAA 3COTA 2AGTA 2X7WA 2WSYA 1SFSA 2ZOXA 1KRMA 1E9ZB 1KXHA 5FL0A 2E9MA 2G3FA 3FOKA 3GNNA 1H63A 3VUPA 2ZUTA 1W91A 3O05A 1LWIA 4S3BA 5AECA 1FA2A 2AMGA 2I17A 3A23A 3WNNA 3F4DA 2ZZ5A 2KZHA 4F0HA 4J40A 5T9CE 3GBDA 3G5EA 4N4QA 3W87A 2HNEA 1HKIA 5FAJA 4D6JA 4H7ZA 4F9JA 2IXVA 2QULA 3PANA 3B9OA 1D7KA 3LI0A 3R2GA 4HSNA 2ZWZA 2QQ6A 3EX1A 5HNRA 4UFHA 2VR4A 4NG3A 4JY8A 3CZJA 5D37A 4S3AA 5T26A 1EQCA 1O1HA 2VZVA 4AD0A 4JNYA 1NDYA 6XIMA 4LAKA 2Y88A 1WBHA 2F8QA 3P80A 4C6DA 2EPMX 3TNOA 3ATZA 3DFNA 4GXMA 3UJFA 3TX9A 2XN0A 3SN4A 1XG3A 1PIIA 3GW3A 2VMFA 4CU7A 4M7SA 1ISXA 3NQBA 1J0JA 2E6DA 3THDA 2RDTA 3TMQA 3GNOA 3IWPA 1T99A 3QQWA 2BS9A 3QV8A 4Y9PA 5BOFA 1UHVA 4MDPA 3KS6A 3WD4A 5DN1A 4O11A 1H0GA 5KINA 3ARPA 4B5VA 1XLIA 2YW4A 3CMGA 1SZFA 3VKDA 1CX9A 1QPOA 2X0HA 1IXPA 2A21A 3KWSA 3UETA 4LYPA 3AHZA 4DBEA 1A5MC 1GOKA 1UUMA 2ODOA 5JIWA 2DSVA 4K1WA 5K4ZA 2WVVA 4DZIA 5K9DA 3M46A 4QCEA 4ZGYA 2JALA 4NF7A 5CC7A 4E5TA 3INPA 3WG6A 3L0KA 4MB5A 2ISDA 3VNYA 2G4FA 1G7UA 3R89A 4H7VA 1SO4A 3O1NA 4NX0A 3ERPA 2ZWYA 2XIBA 1S2CA 3KM8A 4Z1AA 3WNMA 4J4KA 4OGZA 4WDUA 5JVLA 4X9SA 4HMEA 1UUQA 3IANA 2V38A 5FEPA 4Q8NA 4DRSA 1K9EA 3CXOA 3TIMA 1XRVA 1I2NA 3VNIA 4UOQA 2P76A 3LBCA 1LRQA 1DWFM 4HIBA 2QCDA 1RH9A 5F2IA 3GG8A 1TJPA 5E9XA 1RD5A 1AW1A 2B31A 3BE7A 1I1WA 2OWCA 5A2BA 3KP0A 3LENA 5AC5A 3UQNA 2R24A 3O6CA 3P5ZA 3ZO9A 1OD8A 4PTNA 1RQBA 4GZIA 3NZRA 3TA9A 4ZB2A 1B5TA 3VINA 4DZAA 1IEIA 4EAMA 6TAAA 3DI0A 4P8XA 5A6BD 3ZLHA 1WXJA 2Z7GA 3FJNA 4CVWA 2ZX5A 3STPA 1E0VA 5KSWA 2DZBA 3ID7A 2GVGA 3P7YA 3BOLA 2CLIA 4P8WA 5PTDA 2VZUA 3W7GA 1NTHA 3JUGA 2BASA 1UH4A 3K30A 4G6CA 4FSAA 5BOEA 4O0QA 5LHEA 3WELA 1TJ2A 1BFNA 4GI8A 4HNNA 4M8UA 3AXIA 1TPC1 3PBMA 3UW6A 3CIVA 4NSBA 3EWZA 4LUTB 4H8UA 1EC8A 4O18A 1J6OA 3QFEA 4CCCA 3TFXA 1DTUA 2PPGA 4B9ZA 4LYRA 5H6HA 3USBA 1V6WA 1I6NA 4GMEA 5EB8A 2PWEA 2J7EA 4TV6A 1OSEA 4ZSUA 3ARRA 3TSMA 3GH4A 2QCLA 4O57A 4L4PA 5KZDA 4D6EA 2BOGX 4YVPA 5TQLA 3SURA 3P82A 5FKYA 3M5ZA 3ENLA 1JCTA 2OT0A 4HNCA 4Q7NA 1W5QA 5I3IA 3KOXA 5GNXA 3APYA 4PUUA 4UFKA 3UWEA 2E25A 1OGSA 1C8VA 3DIPA 2PC8A 2DZVA 2PTDA 1IYXA 1IXQA 1ME8A 5BWFA 1GUVA 1JJKA 2C19A 1EC9A 4IH3A 2I16A 3GU2A 4BZYA 2A3CA 2A7RA 3AS3A 3G1AA 2J27A 1TJRA 4D6DA 1ZJBA 1V3JA 5EFFA 3ARXA 3SRDA 3B0YA 2V8ZA 3WLRA 5JU6A 2QJMA 4JTTA 1JZ5A 1TFVA 3R0DA 4IGHA 3ZSSA 2NSXA 3UP8A 3PFRA 3IGUA 3IUDA 3RCYA 1Y5VA 3VZXA 3DKLA 2XH2A 3S1UA 1V77A 3EX3A 3ZS4A 2Y89A 3SDOA 3O6YX 4LX4A 1A3WA 1QOQA 1ZY9A 3N34A 2A6LA 3DYOA 1LQ0A 3AXMA 1V3IA 3AZRA 3BLIA 3VU2A 4XD4A 3C8NA 3UXDA 3C0LA 1YDNA 3EDKA 4MWAA 3I68A 5IBXA 3TONA 1JZ6A 1UWUA 3LCFA 3ANUA 4Q8WA 2CLEA 4DO4A 3E0FA 2OYLA 4BS0A 4V27A 4D6HA 3S5ZA 2HCVA 1Y5XA 2E09A 3PJTA 4Q3MA 1WKDA 4XBKA 3TH6A 2OG9A 5BXTA 1E0UA 3GG1A 1R2RA 3L4WA 1HJQA 1CW2A 1UIPA 4IXXA 4LGXA 3TTOA 1XRSA 2EPKX 1DJYA 1K9TA 4W93A 2BMBA 5CC5A 1E6RA 3KDOA 1R8LA 1QNOA 3T8QA 3P0WA 4QLJA 1MXSA 4GQQA 4V1XA 2PP3A 3CBWA 2XGZA 2YXOA 3SJNA 4NKCA 2NW0A 2VFHA 3TQKA 1VCFA 2E6AA 3Q2DA 4C7GA 4FAMA 1CLXA 1GVOA 4KGLA 4DWSB 3DN5A 2GSHA 1E4IA 2HXUA 4GNVA 2Y24A 4P7RA 2FJKA 3SY8A 4JIRA 1UZ4A 4DM2A 2EXOA 1DORA 1GYMA 3CC1A 5B7YA 3PAJA 1MFUA 3OVQA 2XFRA 3VNDA 4ZOCA 4HU8A 4KWUA 3R6IA 1DJWA 1U5VA 3RM8A 3LUTA 5D38A 1P48A 3IK4A 4QG6A 3EA3A 3WQGA 2PD5A 3LU2A 2CLLA 4EF8A 4JIPA 4HZ7A 2FMNA 3PB2A 2SFPA 2YYUA 3GNPA 3URBA 2VEGA 1LP6A 1N8WA 1YDOA 4WZHA 2OXNA 3OVPA 3ARSA 1JPIA 3FJ4A 4C6FA 3WJWA 3H70A 3ITCA 2PGFA 2XFFA 4HN4A 2CIPA 2FB2A 3VNZA 3TTYA 4M0XA 3VK5A 4OV4A 5BOOA 4MTVA 3W7QA 3UJRA 3MC5A 4OBRA 1AA1B 1W8GA 3VM7A 2FH6A 3H7VA 3WFLA 3RR1A 3Q58A 1H7OA 3KWXA 4XZ9A 4Z0JA 3VMNA 5HUOA 6ENLA 5JBFA 1I60A 3WLSA 3TV8A 3KVMA 3IRSA 3GH5A 5J5DA 1TWSA 1A5KC 2V5CA 1XX1A 3KRBA 3L4VA 1JCNA 1TX2A 2IMRA 2DJXA 3H55A 2X16A 1XUZA 3URAA 4DHGA 4MNMA 3ZR5A 1CXKA 3NA8A 1WZLA 1F05A 5FJOA 2F6KA 3WSUA 5TIMA 2QF8A 2A0NA 2PWVA 5BROA 2QJHA 3W38A 4QSHA 1YE6A 1ITUA 1PWMA 1B3XA 4KPLA 5CH9A 4HZ6A 3W85A 4DZHA 1HG3A 1U5HA 1VFUA 2VZTA 2QPUA 3I10A 4LVFA 3R8RA 1W1A1 4GJ1A 3PNUA 2GFTA 1UR8A 2ZZ6A 1C93A 1E1CA 3HURA 4ROPA 5A3HA 1H09A 4A2SA 2P3EA 5TF0A 3GXPA 4U2YA 1XH1A 3OO2A 2INZA 2O7QA 1M7XA 2YL6A 4IPIA 4WDWA 3CYVA 4LEFA 4REQB 3UYIA 4O15A 4QIUA 2FGBA 2WPGA 3NAVA 1GEQA 3HZ3A 2B7NA 4RL3A 1ZP4A 4XUGA 3NVTA 1W9VA 2VKZG 2HROA 1VBHA 4AD2A 5LNRA 3BZGA 4M3PA 1VGAA 1IE7C 3Q67A 1Z32X 4H00A 1OINA 3UBPC 3WLTA 4NX5A 3ZLGA 4U4MA 4XAGA 4D8LA 1Q6LA 4KFPA 4X2RA 1X1ZA 2G3MA 3SCVA 4O8AA 1YDVA 1OBAA 4CNPA 4HN8A 4GWEA 2ESCA 5E93A 3HBLA 3VIGA 4B3LA 1V6UA 1YE4A 3E12A 4U31A 3NIYA 5I3JA 2QF7A 1Y5WA 3L4ZA 3QPEA 1JYVA 1M68A 4JYDA 3NZ1A 3ARVA 3SSJA 1UWIA 2Y7DA 3FSTA 3T2QA 3WDIA 4DXKA 1RCXB 4BWLC 3K8LA 4YU1A 4GIRA 4RUBA 4J2MA 2BHZA 4E8CA 1SR0A 7ENLA 1ADDA 4P7NA 3EWUA 1M9HA 2C79A 3UF9A 3VI2A 3OEXA 2ZXDA 3EEGA 3VKJA 1OADA 1RR2A 1W3JA 4GNJA 5TAOA 3A9BA 4AY1A 1AJ2A 3MKCA 1BGGA 2PSNA 2X1RA 4EKJA 3VE9A 5IDIA 5F1UA 4HOZA 5C54A 3IJ9A 2UY3A 4AYSA 1H1NA 3ZT5A 4L6OA 5AYZA 5H91A 2JF7A 5C9UA 3DX5A 2HNHA 5DLCA 3SBFA 2OQYA 3NO3A 4L65A 4GA8A 2HRWA 3DC0A 4US6A 5GPRA 5C9RA 5GNZA 3SN0A 4K7VA 3WH8A 3TYAA 1P0EA 2WBGA 1UZDA 4XVDA 1W0MA 4DJEA 4ZVJA 1C7SA 1RP9A 1F6KA 2A7NA 4MDOA 1HJXA 4LCQA 4MJMA 1NSJA 1OD0A 3W9ZA 3WNKA 2TRSA 5D30A 1F8IA 2DZXA 2C18A 3V5CA 3OBEA 1MZHA 2DSUA 1W9PA 1UD2A 5FJPA 1EQPA 1SGJA 4JEJA 3H2NA 4CCDA 1J5SA 4EVZA 2PTXA 2D0GA 1KO0A 4YWIA 4F79A 4GJJA 4KF1A 4UOJA 2R6OA 4WJ8A 2JEQA 1GTHA 1DQWA 1KXQA 4Z2LA 3QYQA 3PTMA 2J74A 4HPXA 5ECVA 2D23A 3QXBA 3VOCA 4ATWA 3AISA 2VVNA 3CUXA 1H7WA 4K3ZA 3DCPA 3QV6A 3TW6A 4H8VA 1QBAA 2ATSA 3TCSA 3VNKA 5AVNA 1TV8A 4PMOA 4EPKA 3N73A 3OODA 1EWEA 1I1XA 4BFAA 1NH6A 2DFAA 3A5FA 3SCTA 2A7PA 2EG8A 2YB1A 4GX9A 3BOFA 3GNXA 4JTGA 3CQIA 1XLLA 2ZRWA 1OFPA 1Q6QA 3U3HA 2ZCGA 3LCXA 3EMCA 5HK4A 2QJNA 3HQ1A 1Z69A 4N2YA 3WLPA 3O3RA 1DTNA 3G1DA 4MB1A 1CWYA 1XQKA 4O54A 4MAVA 4PL1A 1D2KA 1LLOA 2NLYA 1AJZA 4LBUA 4J5NA 2FLIA 1ZAJA 2WXDM 3B8IA 2CEQA 2Z00A 2R1KA 2JF6A 4GY1A 4S1FA 1QDSA 3FHQA 3KBJA 1H61A 1RSCA 2PDCA 1OC5A 1QHPA 4L4MA 1LT7A 3DXIA 2DUXA 4J3ZA 4F2TA 2R94A 4UTWC 1OIMA 2CLOA 4J3SA 4S3KA 2CZFA 1NDWA 1JUKA 4JQ3A 3ECQA 1BSLA 4E4FA 4K8GA 1ZAIA 4ZOEA 4XZMX 4D71A 1TREA 3W86A 1O5RA 3A24A 2XUCA 4I9AA 4JDBA 3AUJA 3S5SA 4XTDA 5EMYA 2CLFA 5EBAA 2VEMA 4BCEA 3MMWA 4IFKA 2QYGA 3BK0A 4HQVA 4JN8A 1TV3A 3MHFA 1V3MA 2Y8KA 2QCFA 1XQLA 2HV5A 3R58A 4K68A 1D7FA 4HKPA 2EPOA 1IIGA 2PTYA 5A8PA 2ZKMX 3U5UA 3WLLA 4ROQA 1E1FA 4P7QA 3UJ2A 3DECA 1VBUA 3IAQA 1XH2A 4NZ1A 1WQ5A 4RE0A 1PPIA 2PDHA 3F4NA 4C6JA 3WBYA 1JF6A 4H8HA 3MUAA 1CI1A 4DY1A 4OQVA 4GH3A 3HG2A 1GK8A 2F2KA 3MVIA 2I7GA 3C0QA 2G8ZA 3MUIA 3L9CA 1VENA 1YKWA 4IJCA 4UB9A 1ZBKA 1GVSA 2D2GA 3HTWA 4ERGA 3RNDA 1GQNA 4A3UA 1UWSA 4UTUA 3FYYA 5A69A 3C5QA 2VWSA 4Z2KA 2OWWA 1Z6KA 5FEWA 5XIMA 1XFBA 3IGHX 3PP7A 3LNPA 1QPKA 1QVBA 3QC0A 4PMVA 3SUVA 3W2JA 2GSEA 1B54A 4QX4A 1T0OA 1A4LA 1FWIC 1UPPA 2GJLA 3RPMA 3CQ0A 3D47A 3IJ8A 4PMUA 3B8SA 2YW3A 1YEYA 5CZKA 3GUGA 1CEOA 1IWBA 2P8BA 2OYKA 2X42A 1K77A 1F61A 1YADA 1NELA 2PF0A 3ARZA 2I9EA 1XIJA 3TEVA 1O4UA 1VFLA 3WYZA 3ZLFA 3TU9A 1OZMA 1CPUA 4GQBA 5LXXA 4GO8A 4QG8A 1GPFA 3UG5A 4I3GA 2Z1XA 2X0SA 4XIMA 3N2TA 1PKMA 3BAIA 1FKWA 5T8GA 3W7KA 1UD8A 3MO4A 4O14A 3W1TA 1XRFA 3LPOA 3BJTA 4IPNB 2EPNA 2ISFA 3AHTA 5DCEA 2PWFA 3SSZA 3R79A 1EYEA 3FEQA 2Q6ZA 2W61A 3FK4A 2AAAA 3VDBA 2DZPA 1WZAA 2DORA 1VFFA 2P5NA 4GC3A 1WKFA 4PB3A 4IHCA 3THCA 4UTFA 1QK2A 1Z41A 2ZUNA 5A6JA 2DVUA 1FCUA 1P0KA 3PUGA 3CTTA 1Z9AA 2PWUA 2OT1A 1M7JA 3N2MA 3WQ8A 7CGTA 1TMLA 5BMXA 1SM9A 2EHHA 2OLAA 5LIKX 1D3GA 4AD1A 2Y5SA 1H41A 1UG6A 2NQLA 1OABA 4WKFA 4RDVA 2W63A 1A4MA 3WBWA 3UWWA 1V6XA 2C16A 1X39A 2DPEA 3KXQA 3AU2A 1TPVA 2P88A 3V1PA 1TA3A 4ZL1A 2DT1A 4Q4PA 2D2HA 3QM3A 1JAEA 4JFSA 3B97A 1U1JA 2CITA 4L1GA 1DWAM 2VD9A 3QHOA 1VB9A 1JCLA 1RVGA 1V3HA 5IHRA 3M1ZA 1FDJA 1J79A 3WH6A 2WM1A 1RALA 5G4EA 2E0PA 4DEFA 1R6WA 3DH7A 3GR8A 1HUVA 4O4WA 1R3YA 4DN1A 4ZZ9A 2CXGA 5C9WA 4AZCA 4CNOA 4YJ5A 3V75A 1W1PA 2DUAA 4IT1A 4QG9A 1JCXA 1KQYA 3WN6A 1JZ4A 1XIGA 1NWTA 2YIHA 1F07A 4QFUA 4NZ3A 4J27A 3O0KA 3LMYA 4TTGA 1US2A 4YMZA 4B2DD 3T0BA 2PGRA 2J7GA 2WMIA 2EPLX 4GUGA 3QOKA 3P14A 2IKHA 1SFJA 4GY0A 3TW9A 2ALDA 3BAKA 1MUMA 3QR3A 4LUSB 3JZUA 4EE9A 1QW8A 7A3HA 2DV0A 3GAYA 2Y4SA 2WQPA 4O1AA 1TPWA 1IWAA 4IQEA 1GONA 2J8GA 1F74A 3MSGA 3VC6A 3EA1A 4UQDA 3GVGA 1QI0A 3AHYA 1MWOA 1B3OA 1E4NA 4U2ZA 3UCCA 5CJ5A 2B81A 4LJ3A 4ZO6A 2VVSA 3A13A 3OQEA 4LS2A 2ZRXA 4DQWA 4FMVA 4UMCA 1U1HA 2VYOA 3UU0A 1WA3A 4HHLA 1V0KA 4HNUA 3W6YA 2NV9A 2QDDA 1R9XA 3LGEA 1PB0A 5FJJA 1E3XA 4XD6A 5D2VA 3KTXA 3ZOAA 1CGYA 3L4TA 1ISVA 1MVYA 1Q6FA 3HGSA 3MMUA 4A35A 1GZJA 2WK2A 3H4XA 1PAMA 3QC3A 3KLKA 3Q4DA 4B5XA 4UXDA 1S38A 4QE5A 1K4HA 1Q6OA 3FVMA 1TX0A 2P3ZA 4EACA 4N0RA 4PMJA 1OYBA 4QHRA 1M04A 1V02E 4TVDA 3F2DA 1B2YA 5DBTA 1QCWA 1P1MA 3QZEA 2JKEA 1KFLA 2VC7A 3CHVA 1A80A 1L6YA 3LI1A 3KBSA 3EDJA 1XDLA 3B3DA 3B40A 3WQDA 5I24A 1RPKA 3C6CA 4J28A 1VRDA 4F3HA 4JIEA 1QATA 2PGWA 3VOFA 2XTKA 2BY1A 2HS8A 3NO1A 3S42A 4M29A 4GYJA 1SW7A 1XISA 4L1XA 2OGYA 3WF4A 3UWUA 1K9DA 1VFOA 5D9OA 2ACUA 1YRRA 1X7IA 4ZB5A 1OG0A 5A8QA 3EKGA 3U0HA 3S83A 1TPB1 4F40A 3I7SA 2Y62A 3H2MA 2OTDA 4FOKA 4NASA 1DJNA 2YYTA 3RILA 1XIDA 2W0UA 1FP9A 1PKLA 1KR1A 4AVNA 1BVNP 2IS7A 4NZJA 2QDHA 3G3MA 5E9AA 4RJEA 2V69A 2YDQA 3E2VA 3C2OA 2OZTA 1UH3A 3B9EA 4QP0A 1Q6EA 2F6UA 2QCNA 3ARTA 2GVJA 4RDWA 4O1FA 3VIPA 4MKNA 4RLIA 1E6XM 3KCOA 2E8ZA 5CZTA 5KETA 1RQHA 1HO1A 1MXDA 2BXVA 1HTIA 1TUFA 1S1RA 1CB2A 3N9KA 3R1ZA 3I4EA 4CNUA 1G4EA 1YPXA 1FBAA 3MP3A 1W3HA 2QV4A 1ONEA 2BY0A 4EPDC 2Y7EA 3TN5A 1JYWA 4YWSA 3MTWA 3VX0A 1EUNA 2ASHA 3OGRA 1HKJA 1DE6A 3TA6A 4HNVA 4NZCA 3AWNA 1X8CA 5CPQA 3C8FA 1ZNNA 2AQOA 5K9XA 4D1JA 3NQFA 3EOSA 1O12A 3PUOA 2GGEA 3E74A 1B90A 1GGOA 1EF3A 1OCQA 2DU2A 4O0KA 3TLLA 4ZA0A 4CU6A 4A2RA 4BI7A 1XSJA 4Z42C 3W1LA 4GY7A 2EAWA 4DX3A 1V6TA 1R3TA 2Z29A 2G96A 1M7OA 2FPVA 3SJ3A 1G1YA 2I57A 3GRIA 3SAZA 2XYLA 4OV9A 4I7UA 1O5KA 4KEZA 2PCQA 2XJ7A 4JKLA 1OY0A 1LF1A 4I6VA 3L2LA 1TMQA 2CPUA 1DIOA 1IHIA 3C3NA 4UTIA 3ZIZA 3OW1A 2Z4GA 4WY0B 1E9LA 2XH7A 3RF9A 2EF9A 1BYCA 1A5OC 4LF2A 1X7FA 1GQKA 4KFNA 4X9YA 3WMCA 1EF2A 4BEQA 1BKHA 5E09A 1EIBA 3PC0A 3ANVA 3O07A 5I02A 5DCBA 2WSQA 1TO3A 2X05A 2YLLA 2CWXA 3FEMA 3TVAA 1L9WA 1UKPA 2J25A 4UNKA 3EX6A 1P0NA 2WKGA 1LWJA 4O1BA 2J66A 4AMCA 3TJXA 3BMWA 4RNJA 1REQA 3KBVA 1TMHA 4GC4A 3AMDA 4JCLA 1K70A 1JZ3A 4DZ5A 1H7RA 5LNWA 2C1IA 4H2HA 5AVHA 2GJPA 3FGCB 2Z27A 4KESA 2NQJA 3L12A 1X98A 4FO4A 3W29A 3EYPA 5C7HA 3CUJA 1LTDA 1EKOA 1J0ZA 2VUNA 4NUWA 3REQB 1AH4A 1KKRA 1KCXA 2C14A 3EWXA 3R5EA 2XM1A 3WQVA 4A3YA 4AU0A 4AY8A 2J7DA 4YYCA 1PDZA 4Y9OA 1V4YA 3P3BA 4ORIA 2QW5A 4DO6A 4ILSA 4AVFA 2JGQA 1WDRA 4DO5A 3WEZA 3NQ8A 1TKKA 1MNSA 5D8ZA 3S1WA 1KCZA 2ZDSA 3HGJA 1ITQA 3CL8A 1CZ1A 5KEZA 1RY8A 1LQ2A 3QY8A 4XAFA 3MYPA 3SUUA 4HZMA 3N15A 1SU5A 1ZQ5A 3HPFA 1MW2A 1TPDA 2ZUUA 3LEPA 5U7SA 4AISA 1FWWA 4GYKA 3AQUA 4MWAD 1GTEA 3ITXA 1BWLA 1LUCA 4NY2A 4PZVA 5CSYA 3H4WA 3T4CA 4UTLA 2OSWA 4GK8A 4B15A 3VMPA 3NQCA 4H2CA 4YTUA 3TE9A 3WLIA 3WKZA 3BPWA 4GE8A 4HPHA 5ECUA 3OTRA 5HOSA 3FW6A 2OQHA 4IPJA 2O9TA 3E3HA 1GVIA 1ME9A 4FX6M 1NF7A 4HB7A 4F8XA 5KZ6A 2XINA 4JYEA 2D20A 4K7YA 1XC6A 5F2MA 3LTYA 3AYRA 2HQAA 3ARWA 2YXGA 4ZE5A 3FHAA 4PEEA 2YA1A 3CHEA 2QAPA 5LIUX 1UP2A 3U7VA 2OB3A 4FR6A 2E5CA 4GKLA 1KD0A 4V2XA 2KX9A 4AC7C 3SGGA 2HXTA 3LGDA 1A0EA 4YHEA 3W25A 1AG1O 3AHXA 3WBAA 4H7CA 1GHRA 2ZUWA 2YDSA 1R30A 4JTRA 1YTKA 4ORMA 4LUYA 1RLDA 3NM3A 3CPUA 4JFWA 5D02A 1PSCA 2FZDA 2OPJA 1OX4B 1R3VA 3EWYA 3WBEA 3I6TA 2G37A 2QNEA 1C8YA 4UQAA 4PMZA 3LLFA 5I3GA 4F0RA 4F0SA 1EP1A 3H22A 1BRLA 1KFEA 3RDKA 2XWDA 3M0LA 4I90A 4ML9A 3ZVIA 2DSZA 5CSUA 4MPKA 3U5YA 1EGVA 3CEUA 1OFDA 5CC3A 4Q32A 3K46A 3SRKA 1E0WA 3U57A 1EJUC 4TUFA 3C2YA 2WLYA 3UCDA 1YNPA 2Q09A 3PTQA 1HQTA 5REQA 3WH9A 4HMDA 3CK5A 2BVWA 5AZ1A 3T4WA 3F5KA 4NP7A 4X0NA 3TUUA 3P8IA 4B5TA 1P7TB 4O0ZA 4FXSA 4GD0A 1TIWA 2VL4A 1SJDA 1EPVA 4MHBA 3UR7A 4AFYA 3SGUA 1RV8A 1L6WA 2D2JA 1W8SA 2IKIA 3MSDA 4LTSA 2HTMA 3F5JA 3RLUA 3W07A 1OK4A 1XUUA 2R1LA 3P81A 1GVQA 3M7SA 4RCXA 2INFA 1Q6RA 4RNHA 5CPOA 1KW1A 4PBGA 1G9HA 3QGAC 1Q7ZA 4GIEA 2HE8A 3APTA 4OUEA 3OLDA 4C7DA 4MUZA 3UJEA 2GL5A 1TTJA 1VPXA 4S3FA 1ZU8A 1FCQA 4I5RA 3R43A 1VYSX 1UWQA 4GACA 3WMSA 3GFXA 3CZEA 4NAEB 1VCVA 4CNNA 5AFDA 3IJ6A 3W7NA 1TE1A 4QR6A 1LOSA 4W87A 1VFMA 2VTFA 5CG0A 3KRZA 4PSRA 4FPSA 1POJA 4HCLA 1PV8A 2CETA 1VPYA 4PMRA 2J13A 4GG9A 1KFJA 4UTTC 2QEZA 3RYSA 3HF3A 1LBLA 4HA3A 4FS9A 1R5YA 1LG2A 3GTFA 5M5DA 4GJIA 4ZENA 1GEHA 4MKSA 4OBTA 1K7FA 3CH9A 2BVTA 1GW1A 1B9ZA 1R2TA 4ZQPA 3TCEA 3UXKA 4R85A 1NFGA 4V1YA 4QTGA 4QXIA 2I5GA 3MQTA 3N9RA 1F3EA 4L5ZA 3MI2A 1IIHA 3MT1A 2OOGA 2QCCA 1UR9A 5I3FA 3BG9A 4W9TA 4HZ8A 3AO0A 1JUEA 4FLQA 1P43A 1TWWA 3I6RA 3MU7A 3IIOA 2H8ZA 2VCAA 5HPCA 1A53A 2PDMA 3STCA 2I56A 4A4AA 4E0CA 4AC1X 1TPEA 1IZJA 1ADOA 3W81A 2PRLA 4TX8A 3FX4A 4AX6A 3U6WA 2OSXA 4RZ5A 2DUZA 3NQ2A 5E70A 1HIZA 5AOUA 1GOWA 2CZVA 3WQ5A 3AXKA 2VJXA 3CUGA 5A8MA 3VDHA 1AZ1A 3TZNA 1EC7A 3CT2A 4JZ5A 3WFAA 3UJSA 3TAKA 5I77A 1TUXA 2OELA 3QV9A 4KBXA 1WX0A 3KL0A 2NUWA 4O1EA 4IGMA 3SCPA 5CGMA 3PBGA 2A1YA 1N55A 2CLMA 3H8AA 4JNMA 3W1NA 1B3WA 4C6LA 2XVPA 2HVOA 5HA7A 3GB6A 1Y0EA 3CB3A 2ZA3A 3VNMA 2VX4A 4LS0A 4PUKA 3QGKC 2WPBA 4CCZA 5JH2A 5A6AA 5FF7A 1MEIA 4YTSA 4S3GA 2WVVB 3SCQA 4C1LA 1KKOA 2VFIA 1YDYA 2PDGA 3GAKA 1DIEA 4IX2A 3GNRA 5LXEA 1JRCA 2XWEA 5F4WA 4BQ5A 1YXYA 4C6PA 1M03A 3GDTA 3DFSA 1GVEA 5D03A 1SZEA 4YVVA 3RN6A 3PY2A 3W7CA 1EHNA 1KR0A 2VOMA 3RGTA 3OIXA 2QCDB 1I2QA 1VKFA 4RNFA 4TO8A 5CPSA 2VGBA 3G1SA 2UY2A 2V81A 4MUPA 3CZ8A 3ITYA 2Z1VA 2EQDA 4Q6XA 3T2PA 3B05A 4E6MA 4D8ZA 1XYBA 4XZLX 4J3VA 5DO8A 5B80A 1KTCA 4JR5A 1J8VA 3QMTA 3BCFA 4FNTA 1IEVA 1UROA 1GQJA 3W1UA 1QW9A 4V28A 4JIQA 1UWRA 2YDRA 1KRCC 3FIGA 4Q4OA 2WO5A 3EB4A 3V3WA 1ADSA 3T05A 2BSLA 2A3AA 1J11A 2V5JA 4PUEA 3W88A 3RX3A 2HBXA 3B0PA 1UR3M 1S39A 2REQA 2W5FA 3FYOA 4OZOA 5K7JA 2QUMA 2PEVA 2CNCA 3IACA 3LM7A 2BXZA 4KQNA 2QZRA 1PDYA 4B5NA 6XIAA 3ZJ7A 4EIVA 3IJIA 3KFTA 3ZXWA 3UG3A 3WBXA 4A3HA 5I79A 1O5QA 3QTPA 4N9EA 3TR2A 3LY0A 5H8MA 5CXPA 1C9WA 1Q65A 3I7RA 2GJRA 1OFAA 3W26A 4HA4A 4LRTA 3SRHA 3AIEA 2J75A 1DHPA 3C4UA 3VE7A 3MJYA 4EX4A 3I65A 1JYNA 1HN1A 1I75A 3WJZA 3GE7A 4IICA 1HP5A 2CZ5A 4D6CA 4W88A 3KOFA 3NPUA 3C2RA 5B7ZA 4WHBA 2XIJA 4XAYA 4JDYA 3R0KA 1JUBA 4R27A 1T8XA 2ISVA 3PZIA 2NQHA 3HQNA 3SY5A 3GYCA 3UZ5A 4DJDC 1UKQA 1UP0A 4TVUA 4X63A 4A6GA 1ELSA 2RDWA 1WAWA 1PTGA 1KBKA 5H8UA 5K4XA 2WAGA 3QPYA 2WW5A 4S2BA 5I3HA 4PMDA 2ACRA 3GHUA 5LSMA 3M5XA 2W4XA 1W17A 3N3TA 2ZE0A 4GCAA 1HP4A 2PTWA 1KM5A 1JPKA 4JEQA 4K1GA 2GWGA 1D9EA 3GKFA 2PDNA 2DJLA 4FALA 2OLSA 2WZIA 3GVRA 1FQ0A 1YTDA 2V3FA 3DHUA 2QGHA 1OFEA 2CBJA 3A3XA 4FNPA 3CGTA 4PCSA 3LYEA 3RJXA 4RDZA 4J3XA 3NR0A 3PZGA 3PPFA 3RCMA 3L4UA 1GWJA 3DAQA 1KM2A 2JGYA 3GIYA 4KRUA 4OJYA 1FCBA 1YXCA 3G2GA 4MWAB 1G4SA 3LHYA 5D33A 1MW0A 4NIRA 7TIMA 1MFVA 4ZOAA 3WDPP 5MKGB 4TIMA 1EO7A 4IMAA 4PN2A 4UQCA 2Z24A 4M56A 3V0SA 5EMMA 5C9XA 1MI3A 1OG6A 3PJWA 1JEZA 5I07A 4YLWA 3WO8A 1JCMP 4GUIA 3OIHA 2QCGA 4R53A 2ZRZA 4GUFA 4UFJA 3W7DA 2X09A 2VR5A 3HV8A 3W82A 1GCYA 3VUSA 1KM3A 2WZEA 3WLHA 3NDYA 3NL3A 3UFYA 3CL6A 3NPXA 2P0OA 3T0CA 1AMYA 1FHLA 4LVAA 1QBBA 2IW0A 1GQIA 4AVOA 5DFAA 3C3UA 1NVMA 3L67A 4G7FA 3VGHA 4I5XA 2PLJA 1TV5A 5HBFA 5IFPA 1TIMA 5CZJA 4JCMA 2GJXA 2H3BA 3E1F1 5JBDA 3MV01 3CYJA 1R38A 3VD7A 2WMGA 2WQDA 2ZX8A 4GI4A 1S5NA 3KVLA 4JXCA 3AYSA 4IF2A 1E6SM 1A5AA 4LYQA 5FL1A 1KBIA 2P1FA 1AMKA 3A3WA 1VQTA 4M1RA 5FD0A 3SO7A 2OMAA 3UY7A 2EO7A 4MNLA 2YL8A 4L4LA 3LXCA 1PX3A 1PO9A 1J01A 3HA1A 2VT0A 4CN4A 3AZTA 3BDKA 4LY8A 3PM6A 1BPLB 3BCDA 1F3XA 3O16A 4JTEA 4ZO9A 3L5LA 3DGRA 4GQ0A 4XWUA 4KWWA 1EJWC 1W1IE 3P74A 3WUGA 2OO6A 4YCOA 4HVXA 2A79A 4OKDA 4TVCA 3DFHA 4H01A 5H1WA 1IT0A 1U30A 2O4QA 3QZAA 4GGBA 3PZUA 1K8ZA 3U7BA 1GJPA 1PBGA 3HIJA 3FXYA 4LVGA 2C8NA 4DUVA 4JPGA 4AIUA 3T44A 4DF0A 2D0HA 4B9YA 4DNMA 3AIQA 3WJXA 3H23A 2C1HA 2XVNA 3ME3A 2E77A 4WKAA 3WMBA 3BVJA 1K6WA 4W86A 1FWTA 1WDSA 4C6OA 4D1IA 2PB1A 3MO7A 3KL3A 5F4SA 1E4LA 3AHVA 1A47A 1V0LA 3BJFA 2DH3A 4GQGA 1QR7A 4NRRA 4PMXA 4MZ8A 3W1QA 4UZSA 4QJ4B 1M41A 3F5LA 1LL4A 3S8HA 4D9PA 2YFNA 1CCWB 2GGHA 3GW0A 5AHFA 3KCLA 2YCLA 1E1CB 2B7OA 2XPKA 5XINA 4M51A 4XZBA 4IOTA 3C52A 4NZ5A 2ZUVA 5AYXA 3AICA 2WVTA 3SCWA 2TAAA 3LA4A 4D8AA 1OHLA 2FZ8A 2RFGA 4LY4A 2YZ5A 2VD8A 1FVPA 2GK1A 4QAWA 3G1YA 4DBWA 4O1CA 1RK6A 4CQAA 4AZIA 2D3NA 3QW4B 2CCRA 5E1QA 4ADSA 2ZIDA 3RCNA 1XSIA 3PJUA 1G69A 1BWKA 2HJPA 1XSKA 4D6GA 5D9MA 2IPWA 1Z42A 1FP8A 1LL6A 1SO6A 1XBZA 5ENLA 1YBQB 3MW7A 1HVQA 3B8DA 3KBMA 1VEPA 3ES7A 3S2JA 4EPBC 4G1KA 1A0DA 1PYMA 3MSYA 3W6LA 1F3WA 1GYNA 2E9BA 5M17A 4HU3A 1R7AA 2EJAA 1BVWA 5G2HA 4AHQA 2PRHA 3L68A 4LPCA 3F7JA 1E15A 4DJDD 3CZKA 3UWVA 5BNKA 4BKNA 2YCJA 2BHUA 3UA3A 1GVRA 1LDCA 1W9DM 1EDGA 3HG3A 1DIKA 2WM0A 3CPGA 3S5YA 3LQLA 3PK7A 5FSEC 1NOUA 2HEJA 1W1YA 3GG0A 4MF4A 3BARA 4Z08A 3WQCA 1EOKA 3SRFA 3C56A 3WH7A 2PRMA 2OEKA 3S0CA 3LPPA 1UB3A 4WUIA 3N6HA 3T6CA 4L61A 3C61A 4FLSA 5FAGA 3ZQ9A 4CD4A 1B30A 3A4AA 4KMQA 1J2WA 3TYUA 4BWLA 4CLMA 1P4CA 3UCQA 3QVQA 1VS1A 1XC4A 2J77A 3AU6A 3M47A 3C2VA 2UZ9A 3OJGA 3UZZA 1GJWA 1NOWA 3N4EA 4NZFA 7REQA 1TZZA 2OKTA 2VGFA 2YCIX 4HJWA 2GUBA 3OHIA 4FLOA 5D8WA 1PCKA 3II1A 4GLEA 2ZZ1A 1ZB5A 1NU5A 3LX9A 1J0IA 1EJSC 1QWGA 1NM9A 4PMNA 1RJRA 2V82A 3W84A 4MJ4A 2YSWA 2FTWA 4L6DA 4N9DA 4XQ6A 1WDDA 5TNVA 1QU4A 1OGBA 3NL5A 3LM3A 4AWTA 2HISA 5EMKA 4FNUA 2HPIA 3HPXA 1FWBC 3B4YA 4WLCA 3QHMA 1TTPA 4FR1A 1GNXA 4O4VA 4MFDA 8TIMA 1EDTA 4LSBA 5JBEA 3CIWA 3WLQA 4LCRA 3IVUA 1A0CA 1NP0A 4J1OA 2AQWA 3W22A 3Q65A 1E5NA 2WC3A 5D9PA 4IQDA 3BV4A 3AWOA 2OODA 3HFTA 1JDEA 1E55A 2JIWA 3MWAA 3E0IA 3MB9A 4RK8A 1BLIA 3GFZA 5CEWA 4ZQMA 1WV2A 4Q22A 3SIZA 3N19B 4ASTA 4MM1A 4H83A 3AALA 3WNLA 1XD0A 5C8BB 1ZS2A 4OIFA 2VFEA 1RJPA 2PBGA 4LUIA 3ZFHA 2TMDA 1FH8A 3QYSA 3WK0A 3FN9A 1VP5A 3MP5A 3OU8A 3QV7A 5C2CA 5D09A 5A6TC 2Z6IA 1XW8A 4ZR8A 4LWWA 1KM0A 2A5HA 1K02A 1FWEC 3GXIA 3DG3A 3S1VA 4BI6A 4QRNA 1VBRA 4GHRA 3NQEA 2BY2A 4B2DA 5ABHA 4LBRA 5E6YA 1EGMA 1K1DA 4ZE4A 4YYFA 4HHPA 1L2UA 1J5TA 2C13A 3WX7A 1UA7A 3PPHA 3GHSA 4GYPC 2Q3OA 5BMWA 4S3CA 1KXTA 2BWGA 3K4WA 1MNZA 4KETA 4HA1A 4IIDA 3GZ3A 3WDQA 2VXNA 4KEVA 3NQDA 4US5A 1Y8BA 4FF7A 2DH2A 5LNSA 4IIBA 5ABEA 4GVIA 4PTWA 2XGBA 1TELA 3G3DA 1XCFA 4IG2A 2PDLA 3VIKA 2VNCA 4IFKB 1QI2A 5KTLA 4FF5A 4UTWA 3NVDA 1FHUA 3ZVHA 4PRWA 1R9YA 1GOIA 2VO5A 3O6AA 2W79A 2WJEA 1H5VA 5IM51 3FS2A 3R4IA 2GGIA 4NVTA 1AQMA 4GYFA 1UR2A 3AS1A 3TYCA 1XR2A 4N02A 3CLWA 1SYTA 4HK6A 3E96A 3I6EA 4XKYA 1EP3A 1HL8A 2F6XA 4HT3A 3B8UA 3I7QA 1A49A 3NGFA 3DDMA 4LUJA 1EBGA 4Z1DA 3AJ7A 4UR8A 5G4HC 1XPGA 4AIBA 3NXLA 2V9DA 3VOJA 4E2VA 1OIFA 2BGSA 3KTCA 2DT2A 3NPWA 4NAFA 4EOUA 1A5LC 1UQZA 4JTCA 2AMXA 4Q8QA 3W83A 1JGIA 4PUNA 4WOZA 4Y7EA 2BGNE 1A5NC 1W3TA 1G01A 4QSFA 1AD4A 3DFQA 5DRIA 5C2GA 2WZHA 2DIJA 4JD4A 1FWFC 2QT3A 2FZNA 3RITA 3QMSA 1PX8A 4Z17A 2XSXA 1XS2A 4JIIX 5L9FA 1W37A 1VFSA 1CXHA 4JYFA 4LF1A 4GGHA 3RK8A 1VR6A 3E9AA 3ZSTA 2WVUA 1BF6A 4B4FA 1XHGA 4N42A 4C5ZA 1Q66A 1UBSA 1LLZA 4CD7A 4JQ1A 2FGZA 2F61A 3ZR6A 1FFQA 4DELA 3MDWA 2PFHA 3MBDA 1DIDA 1JAKA 5IXEA 2D1ZA 1XCXA 5E0CA 1XLMA 1BGAA 3WQOA 1QI5A 1W3LA 4JFTA 1G4TA 3S1GA 1YLVA 1C7TA 1M1BA 4N9CA 3J7HA 3C0JA 1X8FA 3A4XA 1UD3A 4H9ZA 3RLGA 3M5VA 1SPQA 1M65A 2WCSA 2YJQA 1JR1A 2E4TA 3ZMRA 1TJ1A 3CM4A 4MNKA 3KCJA 1P6CA 1DJHA 1MO0A 2WJDA 1MDRA 1B3ZA 4GIYA 3EB2A 4U3CA 4LFYA 2FTYA 4N6EA 3UA4A 3IJ7A 1B57A 3NOEA 1DJXA 1SJCA 3QOMA 1EO5A 4W7WA 2VFDA 3IIVA 5AHIA 2CU0A 4XZWA 1Z3NA 3EXSA 1H51A 1CXLA 2XHYA 4FK9A 2C91A 5D2XA 4CN1A 3UWYA 4ZEPA 1TV2A 1HZYA 4X61A 4QNWA 3S3GA 3SCRA 3QBUA 1JCJA 2BV9A 3LHWA 4KEMA 1TV4A 2WSKA 2Y6ZA 1JXKA 2ZRYA 3LXBA 3PBWA 4AZ6A 1TA3B 5BRPA 3CV2A 1M01A 3CB8A 3M5YA 4J3WA 2WCGA 3ALGA 4RPQA 1VIZA 5DQPA 5ABFA 3CASA 4NXSA 3FA5A 4ATDA 3WQWA 4O52A 3BLLA 3HG4A 5FJTA 2J78A 1DVJA 1UC4A 1KGWA 3VDAA 4UCGA 3RMEA 1K03A 1KRAC 1DXEA 3N14A 3BLFA 2TPSA 3BAXA 3C2FA 5DT7A 1Z8AA 1GPWA 1W9BM 2A6NA 3QQ0A 2PDIA 4NHVA 5EU9A 3IV3A 4BK9A 4G2DA 3UXIA 4LANA 2CLHA 4PTMA 4H9MA 5C71A 1V03A 3SI9A 5LIYX 2O56A 4PUWA 5GJMA 1IZKA 2A3LA 1J4EA 3MI6A 4HU4A 4DBUA 3HJEA 3KAOA 1THFD 2W66A 4ERIA 4Q7IA 3TOYA 1DPMA 3WIJA 3ARUA 3WF3A 3LGGA 1Q4NX 1B3VA 2CBVA 4MZ1A 4HTBA 5AC7A 3LPGA 2J24A 3UNTA 1JPMA 1H50A 4CN6A 4MY1A 1A5CA 2P8CA 4W8BA 3LS9A 2W3ZA 3BMXA 5I00A 3L2IA 1OF6A 1ENUA 2X2GA 3T42A 4AWEA 4HU0A 2Y1HA 3BJSA 3N2XA 4IIHA 3S9IA 4U33A 5CLTA 1FHVA 4GNKB 3AMKA 4QS6A 4OHQA 3W7MA 3KZSA 4PE8A 1Q5MA 3SB0A 4IUOA 3AC0A 1J12A 3MVTA 4OOUA 1GKRA 3S6TA 2V68A 2A3EA 3GBEA 1WCGA 1DHKA 4PODA 1W9UA 4AB4A 1DQUA 4HNLA 3BV7A 5DX7A 2PDBA 4LAMA 1YW1A 3RJYA 4BQ3A 2FYMA 1G5AA 1RJQA 1WE5A 4NILA 1L6FA 2MUCA 3SCOA 1VF8A 1JPDX 3ABSA 1EX5A 4NYUA 5JXQA 4FIRA 4QGCA 1PWLA 2NT1A 4XBJA 3K2GA 1L6SA 3SQSA 4RXGA 3C2EA 4B3ZA 1Q85A 1UD5A 4CQDA 5EFDA 1TVPA 3S46A 3UWZA 1VH7A 2VCCA 3W74A 7TAAA 3ALFA 5FEXA 3RLHA 4YXGA 3D5HA 1TSIA 3LK6A 3UZYA 4C90A 1K8YA 3K1DA 2VX7A 4ZCWA 1VFTA 2GQAA 3TLQA 2VQTA 4KWVA 3STEA 1R3WA 1R47A 5CBBA 2XU2A 3EWBX 4G5DA 1ME7A 5DXXA 3ES8A 4JL1A 4EWJA 4QEEA 4GX8A 5JMUA 3E38A 1HKWA 3BAYA 3DUGA 2QIIA 5AZ0A 2ZC1A 3GUWA 2ABAA 3OQ8A 3BXWA 2PBOA 1JDFA 2E6FA 1V08A 3K5XA 1DKWA 3EDDA 2DT3A 3LTSA 3DC8A 3LSCA 3WD1A 3OOQA 4W89A 4E4UA 4E8GA 2FZBA 4F4RA 2G3NA 4B92A 3SCNA 3LZ5A 3RRXA 4C1NA 1E4MM 1RVKA 1EX1A 5HNUA 1ZALA 2ZA1A 4PBEA 1AFSA 2CZDA 5A1AA 3QLLA 3LRMA 4IPPA 4BEUA 4W7VA 4FXFA 3P93A 2WCAA 4IFRA 1IV8A 1PIFA 2TSYA 3FJ6A 3OG2A 1QUMA 1AVAA 4XZNX 1SSGA 2YCEA 4OOZA 4LNCA 1I8JA 3TC6A 4JX5A 3V36A 2WZTA 1NY1A 5RUBA 1IXNA 4FX7A 1LOLA 3FYPA 4GFIA 4KW2A 5I3DA 4LH8A 1ICPA 1VZWA 1DOSA 1SFLA 4PTVA 1TV7A 3IUHA 5J04A 3EMQA 4ZXOA 1E6ZA 4PH6A 1LCOA 1B0IA 4ZQRA 3BMVA 2QUUA 3QGVA 4O28A 1DE5A 3KBNA 1WXZA 4WIWA 3DYPA 1X6NA 5DMLA 5A6MA 3JU2A 4ZTYA 4QE1A 4L9YA 2ZZ2A 3KHDA 6A3HA 3SQLA 4DWSC 4IX0A 2WOQA 4U10A 4W8LA 1H1YA 4ACYA 4NI8A 5A94A 1ITXA 1ZFJA 2ATMA 5A6SA 1E6QM 1HXJA 4WXZA 4ZSTA 1XYZA 3HFYA 3IEBA 1Q4WA 4R7OA 3BSHA 3PS7A 1A50A 2ZC8A 1XF0A 4FIQA 3VIHA 4CNSA 3EAUA 3CT7A 3VAVA 3RLVA 1UOZA 1VJIA 3M0JA 3A4WA 4MAZA 4TR9A 1H49A 3JW7A 4M6PA 4IMCA 1REQB 1EIXA 3CTLA 3TC3A 2C6QA 2GUUA 1ZZMA 1FRBA 1E72M 3GTIA 3UVAA 3HMJG 3W1MA 2OO0A 4L80A 1WDPA 3ATYA 3H7RA 4QDMA 4QS5A 1NAL1 1XD1A 2VC9A 3OZOA 5A2CA 3B9AA 1W54A 3V1HA 2G3IA 4LCSA 1PL9A 4YN5A 3RU6A 2P50A 3GXFA 1LQAA 4RE4A 1OCNA 1PZ0A 4QLLA 3N2BA 4Q4MA 3TFCA 3V4BA 1E40A 2ZICA 3NQAA 3FXGA 2BXYA 3PN8A 1H60A 2CLPA 4KS0A 4XSMA 3PZNA 4HYRA 1PE1A 3HU7A 3V0UA 3L5AA 2VCBA 1GVFA 5JQ9A 3D46A 5TBOA 4B16A 4DIAA 3EGJA 1A5SA 2E7FA 5HQEA 4W85A 1C8XA 2GGJA 2D73A 1JDAA 3PVFA 1ZENA 4IPLA 4FOUA 2ZRUA 2IQTA 2RDXA 4S2CA 3G1XA 3T09A 1XYMA 2UY5A 1EEXA 4QDPA 4RR4A 4XO6A 5A95A 4IJBA 5F4XA 3W2LA 1S1PA 5HPOA 4MLJA 1ESWA 3FLUA 3FKKA 2PZNA 2NQ5A 4R7JA 5H8PA 3L0GA 4PCFA 3NL6A 1QI4A 4JTUA 4XV0A 3TXZA 3FDGA 3IJLA 1LUCB 4HPNA 1XGEA 3CAVA 1ISYA 2FHBA 1VYPX 3D6NA 2GSJA 1B4KA 2E1WA 3IIZA 3WF2A 3G77A 2HPMA 1J93A 2PTZA 5D04C 3P62A 3M0XA 1GZGA 3EBVA 2E9LA 3QR1A 9RUBA 4H6QA 2C0AA 1IEQA 1C29A 1DWHM 3BOXA 4ACZA 4LC6A 3ICJA 4H6RA 5AN7A 5HUPA 1K8XA 3T9PA 1EJ7L 5LA2A 2ZVIA 4JIHA 3QN3A 4H04A 1E9YB 4HJFA 3UZXA 3UZJA 3SW6A 3NO5A 3O06A 1EJXC 5CAHA 5GJPA 2J7BA 2BVYA 4DJFC 3HGOA 1XWYA 1TYGA 3RPTA 3WF1A 2AL2A 3N18A 1KB3A 4WSJA 2ZZ7A 3MKKA 4DXXA 3P2VA 1KM6A 1OQFA 3DKJA 3BW2A 1IEWA 5G2IA 3WJSA 1S46A 3NJ3A 2PF8A 3TYDA 1KA9F 2POTA 2A2IA 4YNGA 3CWHA 4AD3A 5I0DA 1CDGA 5L6UA 2WC4A 2IPJA 3RAOA 1U5JA 2XIIA 1W3NA 4GI6A 3GYEA 1YYAA 3S6DA 1FXPA 1X1OA 1TJ0A 1XICA 3LG3A 1BRLB 4JL2A 1J10A 3M0KA 1NP2A 4IL2A 4O13A 2GDVA 5BU9A 3H4GA 1RA0A 3ISIX 4GZJA 1IEXA 3MWCA 4MJ2A 3TWBA 4Q4QA 3HGRA 1EJVC 3TYBA 1UYQA 3L66A 5REQB 1O66A 4MADA 4B90A 3EOEA 1ISWA 3T08A 4KCUA 3NEVA 5EYWA 2YDAA 2V3EA 4AYGA 4AD4A 2BX7A 4FOJA 1QRQA 1XIFA 1EOMA 4Q8VA 1Q8JA 1C92A 2NLIA 4JX6A 1Z48A 4GINA 4BR1A 3ABZA 3WK1A 2O7SA 1W32A 4QCFA 9XIMA 3NXFA 3M6DA 1JULA 2I14A 1D8CA 3L2MA 3SCUA 3STGA 3T2OA 4HYVA 3IIXA 3GU9A 2X1TA 3CH0A 4HOXA 3VOHA 2NX1A 3EWDA 5G4WA 1KBJA 4PMQA 1J96A 1R85A 3AIRA 2Y5EA 4M7TA 4IGNA 3UPBA 5HAOA 5KZEA 1UKSA 3DBNA 1JZ8A 3PZTA 2ZVRA 4ZB0A 1HKVA 3OLGA 4H8NA 4XTIA 2NSOA 2FB3A 4UTJA 3IAPA 3LLDA 4AWUA 3FA3A 4DWSD 3GTHA 2QVNA 1W9XA 1GOQA 4OECA 3CO8A 4K38A 4E8DA 4Q7BA 1MRAA 4IISA 2XN2A 2XVLA 3VMOA 3KHJA 4QJ1A 3FNDA 3QKEA 2C7FA 2Q8LA 1QOXA 3MYOA 2PLCA 2YA2A 3BLPX 3VIFA 1N82A 1MW3A 1P0BA 2QPSA 1JG9A 3GR7A 4UTTA 3A47A 4PMYA 1KV5A 1MZRA 5BZAA 1O60A 3W73A 2YZRA 3F1QA 2J8TA 3GFYA 4O19A 1YNYA 1RCQA 2GPTA 2PU1A 4I9TA 3VTRA 4PSPA 3JRKA 2OOFA 3S2CA 1DBTA 8A3HA 4M6VA 1NDZA 1S5VA 4DYKA 3EOLA 1X96A 5CGTA 5CZSA 1K7XA 3CUIA 2FQIA 4TU1A 2GDUA 5FOOA 4Q8PA 1PEZA 2BZNA 4RV3A 4URIA 3LB0A 2NWSA 2OFJA 4IMDA 2BY3A 2RH9A 4UC5A 3PSVA 3M0ZA 1LBMA 2CHNA 1EZWA 2X7VA 4BQ2A 1KWKA 3EXRA 3AXHA 3B06A 3HPZA 4JBRA 2Y8UA 3BH4A 2ZZ4A 2WKLA 5LHFA 4QBXA 4Q6JA 2ZXQA 2C3ZA 1YPIA 5IHSA 5FI8A 1TZ9A 1SO3A 3O8AA 1LWHA 1B1YA 3K4AA 2OR2A 4AXKA 3OBAA 1W6TA 4R9XA 3POCA 1EB3A 3CQHA 4L56A 4YHGA 1MEWA 2FMOA 4UUIA 3NZQA 2IUZA 3W27A 4LAZA 2I9UA 4Y8FA 1IGWA 3MJMA 3WUEA 1WOBA 4Z2JA 5BXPA 1QMLA 5BU6A 1MUWA 3SR7A 2YB4A 4GVHA 3W1AA 3PTDA 4NAEA 4ZTXA 4LS1A 2OCZA 1QFEA 4JTDA 4U3AA 1V7AA 4QLKA 4YIWA 4J35A 4M6UA 1SW3A 1PTDA 2WHJA 3CNYA 2W27A 3FY1A 2R8WA 1KGXA 1TCMA 3M16A 5LIWX 4KH2A 2ISSA 3GDLA 2J62A 3M4HA 2DZAA 1B31A 1ZHAA 3NSMA 2AQVA 3MV11 3W01A 3TC7A 4CQBA 1EHAA 4LOCA 2C0HA 1QWKA 1OVDA 3UG8A 3ZT6A 1S2TA 2VGIA 4JOMA 3THUA 1EDQA 3CL7A 1ALDA 3BUVA 2ZX6A 4JFUA 4H41A 4OT7A 4MIMA 4NXKA 1WUFA 1V3LA 2HSAA 1S2AA 1G4PA 2VRJA 1KM4A 4B5SA 4DJFD 2OSYA 4QJ3B 3TOPA 1Y65A 3LCIA 2FKPA 4AHPA 3BO9A 4TTUA 1X38A 3AYTA 2X1UA 3ZWTA 5A8OA 4UTKA 2W91A 3XISA 4CUCA 1NFPA 3ZJKA 1EBHA 5A8NA 3QF0A 2O9OA 2JE8A 3PB0A 3VD9A 2EG7A 1MXGA 5KMYA 3UWQA 1XDMA 1XM3A 5CBIA 4PA8A 3G18A 1VRXA 4FHAA 1WXYA 3VKCA 3DHPA 4MFEA 3GKAA 4FP1A 3SIMA 3CO4A 2GVYA 4PRRA 1BYBA 3EOUA 3M41A 2DEPA 2ZUSA 4ENLA 5JH1A 3BLOA 4I7WA 1LLWA 3CPRA 2REQB 3VFCA 4UZUA 4TQTA 2OEMA 4KIEA 3IARA 3F4WA 4CD8A 4AY7A 3RO8A 1I9CB 4NJKA 3UGRA 4IUGA 3RX2A 3GDMA 5FF4A 5EGRA 3PJXA 2GWNA 3CWNA 4H4IA 1JD9A 2O55A 4AEEA 4UIOA 1OK6A 4QAIA 4HMNA 3ZJ8A