2AGTA

Aldose reductase mutant leu 300 pro complexed with fidarestat
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorizing Selectivity Determinants of Inhibitor Binding toward Aldose and Aldehyde Reductases: Structural and Thermodynamic Properties of the Aldose Reductase Mutant Leu300Pro-Fidarestat Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 110
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2agtA00
2R9RA 1AZ1A 4JIIX 1RY0A 4JIHA 2BP1A 2ISFA 4DBWA 4DZ5A 2I17A 3UZWA 1A80A 4PUUA 3H7UA 3CAVA 4JQ2A 4JTDA 2PDIA 1PZ0A 2PDHA 4YVPA 3R8GA 3LN3A 2PDFA 2PDGA 2F38A 4GACA 3MC5A 4JTRA 3CASA 5JH2A 5AZ1A 1T41A 4NKCA 2BGSA 1VBJA 1Q5MA 3BURA 2FZ8A 3LEPA 3BUVA 1FRBA 4EXAA 3LBOA 4LAUA 2PDBA 2ACRA 1Z89A 3WBXA 1ZQ5A 2FZ9A 3P2VA 4DBUA 3VXGA 4YVXA 3RX2A 1QRQA 4XVDA 3GUGA 4FALA 3N6QA 2FVLA 3LD5A 1US0A 3LNMA 2IQ0A 3LZ3A 2PDXA 2HEJA 3R8HA 1M9HA 3UP8A 3LENA 1Z3NA 1EKOA 1AH4A 4WDWA 4WDTA 2C91A 2PFHA 1EF3A 2HDJA 4XVEA 1R38A 4GQ0A 4ZFCA 3EB3A 3UFYA 2ALRA 5M2FX 2WZTA 3Q67A 1MI3A 2HE8A 4XO7A 2WZMA 1YE4A 4JTQA 2VDGA 1YNQA 5KETA 1X97A 1S2CA 2FGBA 1IEIA 4LB4A 2I16A 2DV0A 2IKJA 1X98A 3H4GA 4G5DA 2CLPA 3V35A 3ERPA 3GHSA 4XZHA 1J96A 4LAZA 3UZZA 2HE5A 1OG6A 4LBRA 3GHTA 4JQ1A 3CV7A 3EAUA 3GHRA 2IS7A 1Z9AA 2PDNA 3B3DA 3FX4A 4OTKA 3G1RA 5HA7A 4EXBA 4PUWA 3R6IA 1UR3M 4XO6A 3R94A 3Q65A 1LQAA 2FZBA 2IKHA 2BGQA 3ONBA 4IJRA 4XZNX 1AZ2A 3EB4A 1XJBA 3UWEA 4JTCA 1PYFA 3V0UA 4JQ4A 3UZXA 5DANA 4GIEA 4PMJA 2PDKA 3CAQA 3COTA 4FAMA 3R7MA 4WGHA 2IPWA 1T40A 3LZ5A 2A79A 2IPFA 5LIWX 4HMNA 1RY8A 2NVCA 3O3RA 2ACQA 1YE6A 3RX4A 2PZNA 4GQGA 1IHIA 4MHBA 3BCJA 4WDUA 3BV7A 4GABA 1VP5A 2J8TA 3M0IA 4ICCX 4YS1A 4H7CA 2PDWA 2PDJA 2IKIA 3C3UA 3WG6A 2F2KA 1RALA 2DUXA 1SM9A 1S2AA 2QXWA 1HQTA 2PD5A 5LIUX 1S1RA 1K8CA 1ZSXA 4HBKA 1YNPA 2PDMA 4XAPA 3WBWA 1ZGDA 4DBSA 4XZMX 2IKGA 4JTAA 3WCZA 4Q7BA 2ACUA 2DUZA 3KRBA 3UZYA 4WDXA 3LQLA 2NVDA 5JH1A 5HNTA 3S3GA 1AH0A 1XF0A 3F7JA 1MZRA 1PWLA 2HVOA 2HVNA 1Q13A 2PF8A 2PD9A 3ONCA 4JQ3A 4LBSA 1X96A 3QKZA 3V0TA 4IJCA 3R58A 4Q3MA 4QXIA 2HV5A 3FJNA 1MRQA 3N2TA 4XZLX 4JIRA 3U2CA 2PDLA 3H7RA 3CMFA 4FZIA 1PZ1A 5LIKX 2PDUA 4FA3A 4H8NA 4LB3A 4IGSA 3UGRA 1EXBA 3MB9A 2P5NA 4I5XA 2FZDA 3DN5A 3LUTA 4L1WA 3RX3A 4PRRA 3CV6A 4L1XA 2IQDA 4QBXA 1Z8AA 4QR6A 3UYIA 3V0SA 2AGTA 4RPQA 4XK2A 5C7HA 3WBYA 5LIYX 3UG8A 1JEZA 1ZUAX 2IPGA 3V36A 4YVVA 4GCAA 5HNUA 5LIXX 2PDPA 1LWIA 1XGDA 4JQAA 1QWKA 4R9OA 2R24A 2INEA 1AFSA 4PRTA 4YU1A 3O0KA 3LQGA 1GVEA 3M64A 1ADSA 3GHUA 2PDQA 2PDCA 4WRHA 4AUBA 3G5EA 3R43A 4PR4A 1C9WA 2PDYA 2PEVA 4F40A 1PWMA 4QX4A 3T42A 4ASTA 5AZ0A 1AH3A 2ACSA 3DOPA 4WEVX 2INZA 4XZIA 3NTYA 2IPJA 1S1PA 1HW6A 3M4HA 3D3FA 4GA8A 1EL3A
chains in the Genus database with same CATH superfamily
2X05A 2IXUA 4JIHA 4IPPA 3P7YA 1QPNA 2QGYA 3UPWA 2NZLA 1KFWA 2C18A 4DX3A 1J0JA 2WBKA 3N14A 1EC8A 3AWOA 4PUUA 3KHDA 4MWAC 4Q6XA 4M7TA 4AZ6A 5DMMA 5DBTA 1MDRA 2PDFA 3OBEA 3P14A 1TA3A 4F3HA 4ZMGA 1K7XA 4E3VA 4J35A 2VQUA 3AXHA 4BCEA 1TVLA 4AWSA 2Q8ZA 8XIMA 3T7VA 1HNYA 5CH9A 4NZJA 2Z1VA 4IX0A 3PZNA 3LBOA 3KCOA 1TJ0A 1ZQ5A 3W1MA 1NWRA 2G96A 4ZQCA 1UZ1A 4N4PA 1VFTA 4J7RA 2QKFA 1H0IA 4HTYA 4ICNA 3E0VA 4QG6A 5CPNA 3WQOA 3O0FA 3CTTA 4WJEA 4HHHA 1D7KA 3RYSA 3BAYA 3NEVA 5C9RA 3KTXA 3OYZA 1V6XA 1W32A 2HPIA 4UNKA 1UD6A 1B4KA 4Z1YA 1OJXA 3N6QA 3T40A 1QMLA 1HVQA 2FVLA 3NJ3A 3NCOA 4HKPA 5ECVA 2C71A 4RL3A 3PUEA 2VXNA 5FSEC 2EG6A 1CLKA 3U6WA 3P60A 3W1TA 2WHKA 1H1YA 4LV4A 1H7PA 4GIAA 2C91A 1TRDA 3WEZA 4PODA 2HDJA 4B16A 1XBZA 1ISZA 3NDOA 3TTOA 3MI6A 4N7QA 2EJ1A 4TVCA 3V5CA 1KNWA 3WD3A 3CO4A 3KM8A 4FP1A 2JE8A 2A7PA 3B0XA 1NDVA 3M0JA 2W91A 1ITCA 3UEQA 3RFAA 3WL0A 3NNTA 4Q8PA 1CTNA 3KL5A 2C3ZA 2XIMA 4GYFA 2ODOA 1AJ0A 1IEXA 1LLZA 4LJ3A 4B5NA 1YKWA 3U4FA 6ALDA 1F73A 2ZQ0A 3PG8A 3V35A 2RUSA 3W7PA 2OSWA 3L4ZA 4AX6A 1QO2A 3GM8A 1R7OA 4E8GA 2G3IA 4ZQPA 2DQWA 1OG6A 5HDRA 2WVVA 5LXEA 4J28A 4LC6A 2IS7A 1Q2RA 2D22A 3UESA 2XIJA 1EUAA 2WC3A 3DFPA 3C2RA 4MY1A 3RHGA 2BGQA 1D9EA 4EKJA 2ZXBA 2Y1HA 1E40A 4XZNX 3WQ6A 3OBAA 3VGFA 2XH7A 4AEFA 1TR9A 3G1FA 4W7UA 3RMEA 1FH8A 2CZVA 3WLIA 2R1KA 3GLCA 4LX4A 4JQ4A 2P8CA 3IGUA 2VZOA 1KBJA 3UZXA 5LNWA 2ZUWA 2W79A 3BAJA 2GLKA 1M7XA 4JCLA 1VRDA 3K8LA 1JI1A 1O1ZA 3IEBA 3G8RA 3CEUA 1W3HA 1NQ6A 5HWNA 3H26A 1SJAA 2JIEA 4H9ZA 3IJLA 3OIXA 2JF7A 4V1YA 4LAKA 1GORA 3S42A 3W6MA 1MMFA 2GWGA 4GQGA 5GPRA 5HNNA 1UWRA 3IRDA 1XLGA 1GEHA 2WVSA 2YW4A 1KFBA 4H7CA 1KRCC 4HA3A 2XTKA 3ZYZA 4A8RA 1DIOA 1SMDA 4ES4A 4XBSA 4ZOEA 4FLSA 1GW1A 3P0XA 1XD1A 4I90A 1Q3NA 2VZTA 1K4GA 1K4HA 2QDEA 1K8CA 1UROA 2KX9A 2YSWA 4YIWA 2V68A 3EOUA 1IF2A 4UTIA 2VKZG 3O15A 2HJPA 5FA5A 4HYVA 4BFAA 4TMCA 1K3UA 2QMKA 1PIGA 3DI0A 4J40A 3ZLGA 3LQLA 5I7GA 3S3GA 1PTDA 4JTIA 3T78A 2EF9A 3S1XA 1HJWA 6XIMA 3PWIA 3V1HA 2H9AA 3PUDA 4C6DA 5KMYA 4G1NA 1YXYA 4HNVA 3URAA 5BOOA 4O14A 3V0TA 3ZJ6A 3AIUA 3AWNA 3ABRA 3N2TA 2OEMA 4UTKA 2X1SA 1H2JA 4HJWA 4OBTA 5AOUA 1VIZA 5LXXA 2VOMA 1T7LA 2WMGA 5C71A 1J9YA 4H2CA 3AXMA 1KFKA 2OO6A 1T8XA 1FWEC 1TIMA 1SMAA 3CH0A 4B5UA 1QO5A 4UQ9A 3KWXA 1UR4A 1XSKA 4DO6A 3AXKA 4B5VA 1MFUA 3NZPA 3GIPA 3AHTA 5HR7A 4K36A 1U5VA 1JCLA 1ZB5A 3WK2A 3BW3A 1M03A 3SRHA 4DPQA 4GNVA 3F4WA 3GWQA 3O6YX 3W1UA 3KRZA 4LALA 1I2PA 3SCVA 4PMRA 4KEMA 2FHFA 1QWKA 1EFZA 2R24A 1TX2A 1W3NA 1AFSA 3S2MA 1H50A 3HURA 2EG8A 1GVEA 3K5XA 5B7ZA 3N9RA 3WMLA 5A94A 3W7GA 3CQKA 7REQB 1KBKA 3CAWA 3NQCA 5TNVA 5FIPA 4PMQA 4XBJA 2GQ8A 4XIAA 3BW4A 1RBOB 4J2PA 1YX1A 3W28A 5BXSA 1GG1A 4NNCA 5EB8A 2PCEA 4LVFA 2MUCA 4M6PA 2ISWA 1S5VA 5CSYA 4BI6A 4UCGA 2DIEA 2VDHA 4DWSA 1RPXA 4DJDD 1B57A 4LUTA 3IUDA 2BGNE 1DJYA 3S5YA 3VNJA 1VCFA 2AAMA 3W75A 1W1B1 3QH2A 4IIGA 5D2YA 3L0GA 4XAZA 2JKEA 2Y7DA 2WMHA 3PTDA 1TE1A 5C70A 1NU5A 2CLHA 3N6JA 3CNYA 3N3MA 3P67A 4IM4A 1UR8A 4FLOA 1OVDA 3G22A 1W0MA 5D37A 1A5KC 4Z2IA 5G4HC 2WQDA 4LS1A 3I3EA 2E1WA 1Q6RA 1DWHM 1Q5MA 3ZO9A 5AYXA 3OZMA 3ZLFA 4W86A 1GZ1A 4OT7A 3W38A 1CYGA 4GINA 2PDBA 1Z89A 2WNNA 1JPMA 5C7VA 4QNEA 5DQPA 4ML9A 3SEPA 1Y7VA 2XU2A 2VCCA 1QRQA 3O06A 5HNRA 1Q7MA 2GJPA 1W3IA 1OM0A 2E6YA 2W4XA 1B9ZA 2VGGA 3VMOA 4DNHA 4DQWA 1H4PA 3H21A 2QCGA 2KAUC 3FA4A 4IIDA 4BQ2A 5HMFA 4QHRA 3GFYA 4MJMA 1NELA 1US0A 2O9RA 1ZAHA 1YTDA 2XSAA 2ZXAA 3M7WA 4IIBA 3WF1A 4NJIA 1XDLA 4GYPA 3W74A 3FFSA 3WLNA 4LRSA 5KZMA 4LNCA 4LRTA 4ZFCA 7ENLA 2W67A 2TSYA 2VMFA 1EP1A 1HP4A 3E0IA 4C6QA 4J3UA 3K13A 3Q67A 1KTNA 3IIVA 4TO8A 3GNOA 4PB3A 3RO6A 4H9MA 5CG0A 3GU2A 4IG2A 1SFJA 1P43A 3WLHA 4RZ4A 1GVIA 3SZ8A 1S38A 4X22A 3WLJA 4A3RA 3NVTA 1PS9A 1X97A 3HJEA 1BVZA 3L4VA 1QI5A 5CGTA 4JFWA 5CEWA 1EJSC 4U3CA 2PLKA 3TCSA 5GVJA 3DHFA 2BHYA 1UR2A 4RE3A 1R3SA 2VRKA 5I3GA 4DBEA 2OGYA 3N12A 3WQEA 2FTWA 4Q22A 4KCVA 2XFFA 1Q2SA 2W9MA 5A6JA 1TTIA 1OY0A 2G0WA 3W7KA 4WY0A 1OCJA 5CZKA 2YPIA 3IJ8A 5CC7A 3T07A 1LQ2A 1WKDA 3AIWA 5BU6A 4IJRA 5A1AA 4NYUA 1S3TC 1LRQA 1HKKA 4W4QA 1W3TA 2R8WA 1YTEA 5FAGA 4JTCA 5MKGB 4ZOAA 1KRMA 1LP6A 4CD8A 1JCXA 3QMTA 4IX2A 4KESA 3FIGA 4U10A 3N4EA 5DANA 1EJRC 3DFNA 2OG9A 3VIKA 1E72M 3EDKA 3FW6A 4FNPA 1Y65A 1S39A 1Q85A 3KLKA 5IBXC 3TSDA 5JU6A 3W86A 1H7NA 3TN6A 2XINA 4UR7A 3PZMA 2WCAA 5AHIA 1KQYA 2YCIX 5DY3A 3WMSA 1NARA 3ARVA 1PEZA 3BLFA 4WSKA 4DJEA 2I9EA 3UT0A 2J8TA 2VVNA 4HNNA 5DN1A 1YPXA 1KA9F 3G2GA 3OGRA 1RAKA 4CCZA 1PX4A 3SGGA 3GTHA 4F9DA 4O15A 1SM9A 1ZCOA 1C7TA 5DFAA 3SCTA 4YYFA 2VZVA 1SW0A 4MIMA 4S1FA 5LIUX 1CIUA 1MW3A 2HWGA 4XG1A 3TP4A 5JBDA 1XYLA 1NH6A 3F5JA 4XAFA 5AVHA 1GJWA 2PDMA 2B7PA 2JF6A 4XAPA 4D6EA 3WBWA 1H60A 1ZGDA 5D04C 3VMPA 3DFYA 3U2OA 1E15A 3TQVA 5C55A 3PWGA 1DYSA 3UZYA 2NVDA 2HK1A 1UH4A 1ZAJA 1AH0A 4MWAE 4CCCA 2UWFA 4Q7NA 1X6UA 4ILSA 4ZCWA 3W7LA 1PUDA 3WX7A 3DYMA 1HT6A 1LM1A 1XLHA 4ZQMA 3LPFA 1JPKA 3TW7A 1VF8A 2DZWA 4C1NB 5CBIA 3I7SA 4O50A 3F03K 2G97A 2BHUA 5FACA 1JDEA 1PJ9A 1K6AA 1TPH1 1UB3A 2Z1SA 1EDTA 4H3DA 2Y63A 1P0DA 4OFCA 1UUOA 2ZWYA 4YHEA 1WZMA 2VEPA 1OCBA 1BKHA 2B0MA 2Z1KA 5D9OA 2NV2A 1FWSA 4XK2A 3DC8A 4QLKA 4GJ1A 3BWWA 2V82A 1H7WA 3AHXA 2NQZA 2ZIDA 4HIBA 1X8CA 3HGSA 3IJ6A 3TSBA 3HN3A 1P6CA 1A53A 2FZNA 3ITXA 3L4YA 4PRTA 4MNMA 4NHVA 2DSKA 4H19A 3KBSA 4G1KA 2RGMA 3WJXA 2P3ZA 3KRUA 2NV1A 3AS2A 1IGWA 1P1MA 3MO4A 3U48A 1WKEA 3G5EA 4X0VA 1EC9A 4GISA 4UFIA 2JEQA 3IVTA 2X30A 2CZEA 4GO8A 5GJPA 3M0KA 4LS2A 5G5IA 3NXFA 4NJJA 4RXFA 2BX7A 3KHJA 1FCUA 3E5PA 2J4GA 1XIDA 3U57A 2GL5A 3EPNA 3WQGA 2E9BA 3R25A 3G3DA 3OYXA 3WQ4A 3FJLA 3M4HA 3ARUA 3C6CA 4IGNA 5BRQA 1GVRA 2F6KA 3QHNA 5A8NA 1K9DA 3LBCA 1EA9C 2PDIA 3VGGA 3SW6A 5K7JA 3UETA 2DORA 4A4AA 1SO4A 1J6OA 4Y2WA 1XINA 3TC6A 5A8OA 2G8ZA 5LNSA 2PGRA 1FFQA 4IFOA 3W7RA 1VB9A 1UZHA 4M1RA 1C3FA 3TJLA 3XIMA 4DJFD 5BW6A 3AUOA 2O55A 2TMDA 3BURA 3DCPA 1W2PA 1Q6LA 2VEFA 1UKPA 4YPJA 4AYSA 4ML4A 3SM0A 1FP9A 2NLIA 4P61A 1MQQA 4WOQA 4W8LA 3B8VA 3NO1A 3P93A 1AUSL 2F61A 4TX9A 2XHYA 1Q4WA 1A50A 5IFPA 2GDQA 3DBPA 4REQA 1EGVA 3HV9A 3NQDA 3UWVA 3PJUA 3LLDA 3C5QA 4KKXA 2HPMA 1R3YA 2CBVA 3JVAA 3I10A 1E55A 3ZLHA 1V3LA 3IIXA 3CPUA 3ZJKA 3LD5A 3MP4A 3B03A 1PO9A 1FCBA 1NFPA 4UMBA 1HP5A 4Q4QA 2VYOA 3GG1A 5LNUA 1DORA 3TOYA 3OTRA 1EF3A 2ZZ3A 3KP1A 3ARXA 3NG3A 1VFMA 3FN9A 3CUXA 3I65A 1PYMA 3OLDA 4G2DA 1ENUA 1A4MA 1MQRA 3VIOA 3CJPA 2J7GA 4HHPA 1MI3A 4QCEA 1KV8A 1GTHA 3P3BA 3P5ZA 3MKVA 1G1YA 1LCOA 3W29A 1KXTA 4GI8A 3M6YA 4E3TA 2E9LA 1MYRA 1MDLA 1A5CA 2BASA 4W5ZA 4Y9NA 1TV7A 2FGBA 4GKTA 4W84A 4I8DA 1W91A 2VVSA 2XN1A 1HXJA 4M5PA 4AZ5A 4A2SA 4YJ5A 2DJXA 3B0PA 2J7DA 3GHSA 5MF5A 1KV5A 2QS8A 1NVMA 2VWSA 3PZTA 3GDMA 4QDPA 1E4MM 3VGBA 4BA0A 2QAFA 5H8PA 1XD0A 4GCXA 2OX4A 1ICSA 1TX0A 1B3VA 3NZRA 1TZ9A 3B3DA 4OTKA 3VUPA 1X6NA 3PZ9A 5I0DA 3ECQA 1AZ2A 2DPEA 4RJEA 1LL4A 1TZZA 4Y90A 3LS9A 3OA3A 2DT2A 3M5YA 2F84A 2J74A 1XQLA 1PKNA 1DJXA 3BZJA 2NW0A 4MWAA 2J7FA 1TTPA 3V7PA 2HSAA 3TX9A 5BRPA 1E3XA 4XZWA 2XUCA 3ZM8A 3C2OA 1QOXA 3IGXA 3BSMA 1WAWA 4HMNA 1RLCL 1JZ2A 3KVJA 3UZJA 2OFJA 3QMSA 4BI7A 1PDYA 4KETA 1ZPTA 3BJTA 1VBGA 3GX9A 3MYPA 1Z32X 2QCEA 3T6CA 3T81A 2F6UA 3GDBA 3F5KA 5HJXA 1JCNA 3MMTA 5FJTA 3H6OA 1RCXB 1EHAA 3QOMA 4M81A 5M17A 2PP3A 3W1PA 2Q09A 4HPJA 1V3MA 3OW1A 4MOZA 1HQTA 4NL1A 3CM4A 2JEPA 1W9XA 5DXYA 4KH2A 2KZHA 4EAYA 3LDVA 3HGJA 2RJHA 3TU9A 2HNEA 2ESCA 1QI4A 3MBFA 2GWNA 4HA4A 1LL6A 3R0UA 2DUZA 3G8EA 5HNTA 1VHNA 1HKWA 4AIUA 3L4WA 3RLHA 2IW0A 3NQ2A 1OD0A 1TV3A 1PWLA 3NSNA 1WNOA 4FX8A 4IMDA 4FXFA 2E8YA 3BQ6A 5ABFA 4UZSA 1FOBA 4AWUA 4KPLA 3S9ZA 1XW8A 4JL1A 1OFDA 2PRLA 5G4EA 1M6JA 2YR1A 1D8CA 2PDLA 3EEGA 4EPKA 2HTMA 3IK4A 1BG4A 2G4JA 3DG7A 2BNJA 3SQSA 1XFBA 2J66A 1JUKA 3AIBA 3HQOA 4GVFA 1UQZA 3KZSA 5ABFB 3GW3A 3DENA 4JTJA 5EBUA 4GY0A 2CZFA 1F3EA 1BSIA 3IIOA 1GOMA 1VENA 1AQMA 3E5BA 4DWSD 1I0DA 3USZA 1YDYA 1ZUAX 2X0SA 1RJRA 2C0AA 1YXDA 4KEZA 1C91A 3UZ5A 1VJIA 2PWFA 4OBSA 4NU7A 2VJXA 1SVDA 3QBUA 4QLJA 9CGTA 1WX0A 5E93A 4AF0B 5D05A 4AYGA 1OB0A 3W2JA 1VPQA 4MNKA 4AZCB 2VNCA 1VGAA 4JX4A 3WQ5A 5ABTA 1B0IA 5E09A 3JZUA 4DUXA 5CJNA 2D69A 4NVTA 2PU0A 1U5HA 4GBDA 2XGIA 2Q3RA 1E9IA 3WLMA 3LTYA 4MAVA 3KOWA 3GRIA 3TTEA 2QCHA 4JEQA 2IPJA 3PC0A 4KFPA 4R33A 4ACZB 2D73A 2WCSA 1EDGA 1O4UA 4TTGA 3K4AA 1EL3A 3LXBA 1SR0A 2XGZA 2XVNA 1QPRA 1LLWA 4DBWA 4IJBA 3VU2A 3WZ0E 1FA2A 2PTDA 4WQ6A 3UCDA 4WKAA 1WCGA 1M04A 1SFSA 3EKGA 3EXTA 5BXRA 4JTDA 1XKJA 3L66A 1EHNA 3PNUA 1BG9A 1FTXA 1XLDA 1HF6A 4YHGA 3SUVA 3LNPA 4MWAB 2ZFAA 2C79A 3TN4A 4NJHA 1F8IA 3ZFHA 4EVZA 2GUBA 5CLWA 3PPHA 2V67A 2TAAA 3BO9A 4QIUA 1EUNA 2ZUMA 5HPOA 5MHBA 3QV8A 3FJ6A 4XD4A 2CIPA 2ADAA 1R3RA 2Y7EA 1DE5A 1PTGA 1LBFA 1KCXA 2GJNA 4CN1A 3B4YA 1P0EA 2B81A 2RDTA 3GW0A 1VJSA 4KWWA 3WLLA 5TD4A 1TPUA 3VCCA 1FDZA 4K38A 3HPFA 3RX2A 4EOUA 1W3LA 1TYGA 5HOSA 4UR9A 4E4UA 4AISA 1GKQA 1BKSA 2DIKA 4I8YA 1F6PA 1W5PA 3PBWA 5EMYA 3OLEA 5G1YA 1GJUA 2DH3A 4R7OA 1P0NA 2PDXA 2HEJA 1MQPA 3QGVA 3UGVA 3ZVHA 4M6QA 2JBMA 2OCZA 3AC0A 4WDTA 4C6MA 4E8CA 2ZUVA 1R38A 4DJEC 2HK0A 1C29A 4W9TA 1GG0A 3CMGA 3O63A 4C6NA 4R3UA 5HMDA 2WZTA 1O5QA 2I14A 2W63A 3GZ3A 4S3JA 3ZVIA 4ZO7A 4XO7A 4PCPA 2FGZA 1EC7A 1PXGA 4L4OA 5H6HA 4PGLA 1A5LC 4ZEPA 3CO8A 2HNHA 2GYIA 2QEZA 3BMVA 1Q4NX 1W2VA 1V6UA 1Z42A 3LCFA 4CVWA 4UUIA 3M41A 4QG8A 4R7JA 5IRPA 2IKJA 1WP6A 2D2GA 3T1GA 2QF8A 4HD5A 1VFUA 1O60A 4MZ8A 2F6XA 3UZZA 4BEUA 4IH3A 3SUTA 1G9HA 2YZ5A 4TTUA 3EWBX 4WLCA 3BVJA 3VIMA 4BQ4A 1KBLA 4IMGA 3PPFA 1MXSA 1TV4A 1AMKA 3L4XA 3WSUA 1AK5A 4DO4A 1W54A 1AW5A 1JG9A 3SN4A 2IKHA 4H9TA 5SWUA 3S1UA 3ABOA 4P7OA 3GNPA 3P6LA 4CD6A 1EH9A 1E1CA 3WN6A 5E9AA 1XLFA 3V0UA 4AH7A 3AIVA 3M5XA 4QDWA 3VFCA 2E7FA 4PCFA 5IHRA 3LRKA 1MXGA 4UB9A 5JXQA 3C61A 4FNQA 5CKSA 5E0KA 1WUEA 4FAMA 4WIWA 1EWDA 3CIXA 1VS1A 1TTJA 3TQKA 4ZTYA 2H90A 2YGYA 3Q58A 2WNZA 3W02A 5LIWX 3OLGA 1E9ZB 3OB8A 1A0DA 1U5JA 2Z24A 1HL8A 2I57A 1W1ZA 3NM3A 1XYMA 1JULA 1G01A 2QCDB 1JPHA 1TMLA 1ZBVA 5T8GA 3W7OA 2Z1WA 4HOWA 3QY8A 3CZEA 4TVUA 1ONRA 2AMGA 4ZOBA 3WUFA 2ZKMX 2PWGA 4J5NA 4JGDA 3VTRA 1DJHA 1REQA 2A85A 5F2MA 2AKZA 3KX6A 1S1RA 2PA6A 2FHBA 3TFCA 2O4MA 5DELA 4BJHA 3H2EA 1F3TA 4IIFA 2DJLA 3A4AA 5LGXA 1W5QA 4S3GA 4G56A 4Q6JA 4OV9A 2VO5A 2AQWA 4HU8A 4GOAA 1OX4B 5HQMA 5JH1A 4OOUA 4JDBA 4RZ6A 4C1LA 1TUXA 3WF0A 1MZRA 3MYOA 2W66A 3QPZA 3DGRA 4OOZA 3VNDA 1XDJA 1QBAA 3C2EA 5ENLA 1HKJA 4S23A 3R58A 1XLCA 1CLXA 5C5YA 3LERA 1GTEA 1CI1A 1MRQA 2WAGA 2FMOA 3QPYA 3NGFA 1XICA 2DT1A 2YYTA 4JIRA 4I6VA 4CD5A 2CERA 4FZIA 3W01A 1XISA 4C1NA 3LM3A 3ZR5A 1LROA 4P7LA 4QJ4B 4N9EA 5C2GA 4QRNA 4L1XA 3SR7A 4XKYB 2ON3A 4QBXA 4FHAA 1ELSA 1Z8AA 3G0SA 5GQBA 3WD1A 4F2TA 2O9OA 4FF7A 4ATWA 2YB4A 4NQ1A 1QXLA 1V7AA 4DZHA 4JCMA 3OVGA 3GFXA 1G4TA 2WANA 3NQEA 2FLIA 4WK9A 4B3LA 3O05A 1FWRA 4OU1A 1GJPA 3WQWA 2BFGA 3L5MA 4WJXA 1F61A 5BU9A 3IJ9A 1ODZA 1R5YA 3ZMRA 4H7VA 1J5TA 4LAMA 2HQAA 2VOTA 3P0WA 1CWYA 1BWLA 1F76A 1P5BA 3VKCA 3VD4A 1XX1A 3STFA 3B9EA 1BWKA 1UBPC 4M8UA 4BWLC 5BCAA 4Q4MA 4GH1A 5KITA 4JS3A 3PTKA 1U1JA 3U2ZA 2WJZA 4LVAA 1K8YA 1S1PA 4UIOA 4P7QA 2L5HA 2ZDSA 3FHQA 1QATA 4EF8A 1B5TA 3GTNA 5F2LA 2FJKA 4OBRA 5CZ0A 1GYLA 4HJFA 4MJZA 5BOFA 3N11A 3W7EA 4M80A 3GXMA 1XRSA 3AMLA 1DXFA 5E1QA 3GVGA 3OG2A 4YVPA 4IPNB 1EEPA 4AZBA 1A3XA 3I68A 4O13A 4QQUA 4JTRA 3L23A 5FEXA 1TMHA 2QZRA 2BGSA 4Z1DA 1E0VA 1S5WA 1YRRA 4WUIA 4HPXA 1JF5A 2J79A 5DLCA 4KRZA 3UVAA 2YDSA 3BUVA 3LHUA 3WH9A 4IP5A 3AJ7A 4O12A 1UBSA 3RITA 2AL2B 1JDAA 2ANUA 2GVYA 2WHJA 3W72A 2XZ9A 1D8WA 1BXBA 3WO8A 3LI0A 1WKYA 5BRBA 1DIEA 3VCRA 4E4PA 1DP0A 1XPYA 5AYYA 1RPKA 4YN5A 2REQB 2VURA 1OX4A 1JAKA 1Z44A 4YMZA 3TZNA 3MKCA 1J79A 2PLMA 3FDKA 5BZAA 1X38A 2VEIA 2ISDA 4AMCA 1GYMA 2XVLA 4CU6A 4RNFA 1RVKA 3UNDA 5AC5A 4LUSB 3PSVA 5G2IA 3MJYA 4JIQA 2VGBA 3S5SA 5A6LA 1KCKA 1W37A 2BS9A 4YWIA 3EB3A 4GY7A 4NSBA 2VHLA 4HOZA 3BLKA 3E49A 1NWUA 3N73A 2HE8A 3ZQ9A 3L21A 3N4FA 3QGKC 1O6IA 2BVYA 4HP5A 2VM8A 2VDGA 4JBRA 4P8WA 2WQPA 1KFCA 4A8IA 3UXLA 2NQ9A 3NQVA 4RDYA 3DYOA 4AQLA 3S1VA 1X98A 1BXCA 2ZYFA 4DRSA 4KEVA 1ZAIA 3TC7A 3ERPA 4OHQA 2PTXA 4F2BA 3OQ8A 2WW5A 1OC6A 5K2ZA 3APTA 5C8BB 4OECA 4K3ZA 2XIBA 2J24A 4PUWA 2EG7A 2ALDA 4PMUA 3VIJA 3W22A 4MJ2A 3AUJA 4M0XA 2FIQA 4FXSA 3F4DA 4CQCA 4MNLA 3EB4A 1XJBA 1RD5A 1RXOB 2ZUTA 4MG4A 2TPSA 3STCA 3EKLA 2P88A 1TPVA 3WJYA 2NV9A 4O4VA 3LCLA 1RQBA 4LVGA 3AZSA 1KGWA 4O19A 3FSUA 4C6JA 2OMAA 4Z42C 2YL9A 3QHMA 2MANA 1O5XA 2Y6ZA 3VGDA 2A0NA 2AKMA 3MWAA 3H53A 2CXEA 1YE6A 3CWNA 1UUMA 2PZNA 2X1UA 3BCJA 4WDUA 2V5CA 1VBRA 4HYRA 5D02A 2YW3A 1JQVA 4K7VA 3VYLA 1EIXA 5HMEA 2DT0A 3BDKA 1VLIA 1WBHA 1TE6A 1TPFA 4KERA 2NXHA 4IP4A 4MFDA 5D9MA 4ERAA 2A3CA 3KWSA 2A7NA 2WM0A 3H7VA 4NZ3A 1V6WA 4YTRA 4AEOA 3QQ0A 1FKWA 3W82A 3H2CA 3ZVHB 2D2HA 3PS7A 3SCNA 1VYPX 1M5WA 2ZADA 1OSEA 3WY1A 1Z69A 2YDRA 4PN2A 4QTGA 1GKRA 2F8QA 5H8UA 2BMBA 1DWIM 5AHNA 1WO2A 2PUZA 4HGXA 1KW1A 2Y5EA 2HVNA 3ONCA 4JD4A 2DZUA 2D1ZA 2R1LA 4IMCA 1FX6A 3V75A 2E25A 9XIAA 4ATLA 3VVGA 3WQFA 4NNAA 2QYGA 2BSLA 1QTWA 4UXDA 7XIMA 3DYPA 1QBBA 3P62A 4H6KA 1T96A 3NUKA 1K9TA 1WUFA 2CLFA 3SRDA 3IGHX 1QNSA 4HNCA 3W7HA 5C9WA 2HBVA 4KIRA 1CDGA 3TW6A 1BRLA 3QJAA 3SN1A 3V0SA 2I56A 5C7HA 3NPUA 3WBYA 2BY2A 5FD0A 1AQFA 4Q8NA 1SW7A 2NT1A 3RXZA 2G3MA 1C8YA 1MNSA 3QV6A 4X0NA 3SI9A 3TXVA 3IV8A 1TUFA 4ZO9A 1J5SA 4F0MA 3D6NA 2PMQA 3IJ7A 1GHRA 3BLPX 1JJKA 4H6EA 4PL2A 2OLHA 2XM1A 1QCWA 4E6MA 3K4DA 3MZ2A 1LOQA 1P0KA 1MXDA 3N34A 2QHAA 3R43A 4PR4A 4JIEA 1RUSA 1CXIA 3QFEA 5G1TA 2DW6A 3EOEA 4AD1A 4N6EA 3M07A 4JFSA 1RCOB 4O1AA 2JGYA 2GVLA 3FEQA 3WKZA 3DOPA 4PCSA 1UWTA 2E4TA 4XZBA 4E5TA 3OGSA 2AMXA 3WNOA 1W8SA 4RKAA 1V3HA 4GA8A 1F8MA 2R9RA 1EP2A 2P53A 1RJPA 5FF2A 2ZBTA 4J1OA 1Q6CA 3MUCA 4HVXA 1KFEA 4JEJA 1GQIA 4ZSUA 4DUOA 3B9DA 3BXWA 1PZ0A 3UWYA 3G0UA 1PE1A 3HG2A 3S0CA 3K1GA 1IWPA 2J9ZA 3R8GA 1RHCA 2WYSA 4JNMA 1A4LA 3UNTA 3AYSA 3PY2A 1TJ1A 3MC5A 1E4IA 1E9LA 2Y70A 1FWJC 5EY5A 2VR5A 3PANA 4A35A 2OKTA 1L8PA 1V8EA 4NX0A 1E0TA 3JS3A 2EQDA 5AYBA 3MUAA 2VFFA 4HCHA 4LTSA 4EANA 1LT7A 5LYRA 2WCGA 1QNPA 3GH4A 4XD3A 3W53A 1UUQA 2E5DA 3WBXA 3O6DA 1WA3A 1ITQA 2PC4A 1PZ2A 3W9ZA 1RP9A 4DBUA 3FXGA 4RE4A 4D6CA 2HXTA 5J5DA 2V38A 1M7OA 3JRKA 4H7ZA 4DXVA 1K6WA 4FALA 1ZU8A 1B4EA 3HB9A 4IXHA 3FOKA 3O7UA 1ZRQA 5KZEA 3C0LA 1P6WA 3UD6A 3M16A 3NPXA 2O9PA 3WK3A 4JN8A 3TONA 1EBGA 4WDWA 2WJDA 1RH9A 2FTPA 3IK2A 4CQ8A 4WZHA 1KFJA 2YBUA 5I06A 4KWUA 5HAOA 1UCWA 2Z28A 3CL8A 4Z1BA 3DI1A 2BXVA 4KRUA 1J01A 3UJSA 3INPA 3ES8A 2W61A 4GHRA 3NL3A 4O0KA 1TB3A 4ZO6A 2VCAA 4PCNA 5HWJA 3S9YA 1PHWA 4S3EA 2OWXA 2VR4A 1UOKA 4NYYA 5XINA 2F7FA 2I5QA 5F1UA 3IPWA 1LYXA 3WLPA 4RV8A 2O0TA 2QGHA 4IGMA 1OZQA 4X63A 3WFLA 2PGWA 2I9UA 3S6OA 4B3KA 1DIDA 3E96A 1VQTA 3KDNA 2QDGA 4PH6A 1V0NA 2V81A 1ME7A 3TQPA 4BQ3A 1GVOA 3A21A 2YBTA 1XCXA 2FHCA 3OQEA 3RLUA 3OP2A 1L9WA 4R88A 1GKPA 3PSWA 5I00A 2XGBA 1QK2A 4PB5A 1DXEA 5E9XA 4UQDA 3S1GA 4LYRA 2Q71A 4PTVA 4GIEA 4I9AA 4HSOA 4YTSA 4PMJA 4G7FA 2OPJA 3CAQA 2XSXA 1SQ7A 5LHFA 1BRLB 4FLQA 1XIMA 2EEXA 5ABHA 3VNZA 3VE7A 4AZHA 1B3OA 4U28A 3SGZA 2VGIA 3MUIA 1E9YB 1OADA 4NZFA 5I78A 4ZODA 1QI2A 4Y6GA 5DX7A 1YDVA 1WBJA 1BGAA 4QQ3A 4AX7A 3BV7A 4EPBC 3FA5A 1H3GA 1ZBKA 3AHZA 3VOJA 2GFTA 3UW6A 1O68A 1QI0A 3PZGA 2GGHA 3W71A 2VX7A 3EYPA 3VD9A 3TQ0A 4M6VA 3P74A 3BAKA 2FDSA 2OT1A 3NZQA 3KS6A 3FKRA 2QR6A 3QPEA 3U8GA 3BL3A 3KW3A 1D7FA 1I2QA 5CZTA 2X1RA 1KM2A 1BVWA 3ZSTA 5J5RA 1KR0A 2H3DA 4F2UA 5IM51 2CLIA 1NF0A 3H12A 1GQNA 4JKKA 4M1BA 3AYVA 2ZXQA 3BAWA 1X1ZA 4XSLA 1VC4A 4EPDC 2HV5A 1IYXA 4R27A 4GC3A 3CL7A 5U7SA 2C15A 1KBBA 4MB1A 4JN6A 2BG5A 1ZCCA 3RPMA 4CNTA 3AMGA 1KBIA 3SUSA 4FA3A 1P7TA 4H8NA 1MZHA 1DOSA 3CWOX 5C54A 5FEZA 3B06A 3RCYA 1XYFA 4PMNA 2FMNA 1ZNNA 5EL1A 5LZLA 3UYIA 4C65A 3OVPA 2PC8A 3CZGA 4O17A 1OGSA 1JEZA 4MUZA 5C0QA 1LLOA 4H2HA 5D8WA 4H8VA 3L2MA 4YVVA 1LWIA 1EJ7L 2P3EA 5GNZA 5G4WA 1OIFA 4S2CA 3M0LA 4PTXA 2P0OA 4Q8VA 1XIBA 3FK4A 4FIQA 2FZMA 3W7CA 3GG7A 1ZALA 2WZIA 4AUBA 2R94A 3I6RA 4GVHA 5REQA 4XAGA 3M5VA 4NG3A 2EXOA 3KCLA 2CHNA 2RHGA 2PE4A 1UKSA 1DTUA 3W1QA 2YDAA 1SFLA 1OFQA 3R0KA 1NM9A 2DZTA 2C19A 3W37A 2YCJA 3R1ZA 1VJZA 1NDWA 3V18A 6REQA 3QVQA 4HNOA 2ZVIA 4MYXA 1D3CA 5CGQA 3W2NA 4JXCA 1M7PA 3PJXA 1XLLA 4N2YA 5BXPA 3GO2A 1CXKA 1JZ4A 1KB3A 1M41A 2CCRA 4IP7A 4DZIA 2I17A 3A22A 3WH8A 4Z2GA 3H7UA 1FCVA 3CAVA 3DFSA 4W7WA 4S38A 1OCNA 3W1NA 3OZOA 3IWPA 1XSJA 3V3WA 3WNPA 3VILA 4XQ6A 4AWEA 4CQBA 5HK4A 3XINA 5G2HA 1S46A 3BQ5A 5IDIA 3M44A 5U4NA 3K2GA 1VBJA 4FLRA 1L6SA 4H00A 3NR0A 3EX6A 3N4AA 1V93A 5KZ6A 3UJRA 3NO5A 1RLDA 1W5MA 4DM1A 4B2DA 2ZOXA 1TKKA 1PBGA 2I1OA 4RUBA 3CUFA 4MVAA 2DZXA 4H9YA 1DWFM 4DO5A 1TRIA 1A3HA 3VXGA 1HJQA 1EA0A 4TU1A 4O1FA 2ATSA 4XVDA 2AL2A 4W8AA 2ZWZA 4H8UA 4AZIA 2BY1A 4LCSA 1QPQA 4DNMA 4PEEA 5HANA 3O6CA 1HJXA 3NVDA 1KCZA 4Z1CA 4KWSA 3E0LA 4V1XA 3G77A 1OHLA 1QASA 1I45A 1O1HA 1GQJA 1PKMA 2PFHA 3AYRA 2D0GA 4CEUC 3DZ1A 5I02A 1GPWA 1OK6A 3C8FA 3B9NA 4HCDA 1POJA 2WSQA 2CPUA 3LV6A 2PS2A 4M29A 3W7DA 1O5RA 1JL8A 3C3NA 1XFCA 4BZYA 1F4HA 1QHOA 2E77A 1OX5A 3RLVA 1S2CA 1EPXA 7REQA 5I3IA 3WQDA 1KXHA 1BF6A 2E3ZA 1R8LA 4N4QA 4AZCA 2J27A 2CLPA 1RJQA 3GTFA 2V0TA 1H62A 2OB3A 4ZQNA 1YLVA 3DFOA 1XIGA 5LHEA 1BSLA 3GC5A 2VFEA 1QNOA 1XBXA 1XUZA 3UBPC 4PTWA 4W8BA 3G0XA 3UG4A 5CSUA 4QP0A 3UYCA 2QT3A 2ZTJA 3ZWTA 3WL1A 2PBOA 4LVBA 3A24A 1TIWA 5DBUA 2WSPA 3GH5A 4W87A 4FR6A 1RK5A 4K1WA 5C9UA 3E9AA 5EA9A 1R3TA 3NZGA 4Q8TA 4PSPA 1XC6A 3SCSA 1SJBA 2QDHA 5CQ1A 2ZUUA 3CQIA 1TJRA 1H7OA 3BANA 4JTFA 3EWYA 3VE9A 1VKFA 1MEWA 2W6RA 4LYKA 3DU0A 3SADA 2ZX7A 4U4MA 3GXNA 3VOHA 2E5BA 3RX4A 2ASHA 4ROQA 2XWEA 4E2OA 5A6KA 1UWSA 2XG9A 1VEMA 3EWZA 3T05A 4ICCX 3VNIA 1FWNA 4CN6A 2DSUA 1UYQA 4BY3A 2VFDA 5CZSA 2J7HA 3FY1A 1S2AA 1UA3A 2VX4A 1Q6FA 1KLZA 5I3FA 1MWOA 1BVNP 2FVKA 4GVGA 3QY6A 2R91A 1U83A 3HM7A 1OFRA 2XDFA 4Y7EA 5AYZA 1JZ3A 1HKVA 5LKYA 1IZJA 3TH6A 3KRBA 3WBEA 4Q4OA 4LEQA 1TCDA 1ZP3A 4FXJA 2TYSA 4J3SA 4LT9A 3ENLA 2CZ5A 1Q13A 5CPOA 2HCVA 1XUUA 2NWRA 7ODCA 2DUAA 4YWSA 1SR9A 4Y8FA 3AFBA 2GSHA 4NZCA 4GMEA 5A6BA 4CNNA 4XZLX 2PTZA 1KTCA 4M56A 1WXYA 3CXOA 4CNUA 2WNWA 1ME8A 3CYVA 3MHUA 3CMFA 3P5YA 3TYDA 3TAOA 1R9XA 1ICPA 1CECA 2GVJA 5HUOA 3KRSA 4U5IA 4C6CA 2Y5JA 2JFEX 3H23A 3PFMA 4J3WA 1IXQA 4HOXA 4PMYA 5FAJA 3T09A 3UR8A 4WSJA 4EF9A 3DIPA 5CAHA 1C8QA 1NWSA 3W07A 1FWHC 4KGJA 3VO0A 3MI2A 2QJNA 1YEYA 2C1GA 1YBQB 4GKLA 1XP3A 3UQNA 2PLCA 4IL0A 1FHLA 4ZFMA 5HATA 2DH2A 1UZDA 4XV0A 4ZXLA 3N13A 4CN4A 2Z6IA 3VM7A 3F2BA 3LRLA 3SY8A 2JQXA 1YW1A 2WVUA 4I3GA 1JFXA 3THDA 3ZT6A 1V0LA 1A5MC 1V77A 2E6AA 5ECUA 4ORMA 2QUUA 3PBVA 1IT0A 2GJXB 2J75A 4ZO8A 5EBAA 1GVQA 4IF2A 5AZ0A 3NQBA 1SSDA 4G8TA 4Q4RA 4JFUA 3W7NA 1XSIA 2VZUA 4YCOA 4UFMA 3VIGA 4AF0A 3A47A 1BF2A 1QVBA 3WMCA 2BY3A 1NIUA 5A6BD 3NTYA 1XLMA 2X7WA 1THFD 1QJWA 1HW6A 1MUWA 3M1ZA 5PTDA 1DPMA 2WSRA 4KGLA 2WJEA 5AHLA 3WBAA 5LSMA 4WCJA 3KXQA 4CNPA 5C2XA 4UOQA 1V4YA 1WDWA 1V3KA 5FJUA 1FWIC 1A80A 3BH4A 3NGJA 4KWOA 3CB3A 3MWCA 1E6QM 4XD6A 4Q33A 2CZDA 4LPCA 2E40A 3EPMA 1QT1A 3QMRA 4H01A 2BY0A 2MNRA 5EMKA 4OQVA 5HINA 4ZB2A 3CB8A 1F3XA 5G1MA 2O7SA 1YDNA 3CASA 3VNMA 5AZ1A 2GQAA 1WAUA 4QSHA 4LF1A 4NXSA 1AQHA 4J4KA 1Q8JA 2D23A 4UZUA 2ONEA 1P0BA 2XH0A 5F7UA 2DSZA 2A1YA 3CL6A 5TAOA 4CU7A 5AY7A 1M3UA 1PDZA 3SCOA 2ZDRA 4LAUA 5BMXA 4ZB5A 4MDPA 2J8FA 1UWQA 3CUIA 4MSSA 1H61A 3P2VA 4UTTA 2WC7A 1S5TA 4D6DA 4HYWA 3NPWA 4IPIA 4UOJA 2XH2A 2WMKA 2JK2A 3QM3A 4JHZA 4IMAA 1V0KA 2OVLA 1W9BM 4O57A 5I09A 1HTIA 4E2BA 3K4WA 3WQ8A 4P7RA 4N9BA 1LUCB 2C1IA 3HFTA 1PSCA 5E0CA 3R8HA 2CBIA 2Z25A 2V8ZA 1AVAA 3DG6A 4IG2B 3V4BA 3JW7A 4DJFC 3AU6A 2PWUA 2EJAA 3EOLA 4BR1A 3E1F1 4XSMA 3KS5A 2YKKA 4FK9A 1RCQA 4QE4A 1WOAA 3UF9A 1QI3A 2OYKA 2WWCA 2XZ7A 4MDOA 1HKMA 2XVGA 3FGCB 2E5CA 5DRIA 4WXYA 1FP8A 1KWGA 1FDYA 2WZMA 8XIAA 1EPVA 4NRSA 1ECEA 3ZOAA 3FVMA 2XISA 1RV8A 3EXSA 3F2DA 3VZZA 1UQYA 2DGAA 1EB3A 1OT1A 3NQAA 1VRXA 4JR5A 4LQ1A 3RM9A 1P4CA 1XLAA 2YCKX 3WNLA 4HN4A 3HU7A 3QR0A 1JQXA 4UMAA 3DESA 3SAZA 3GNDA 3GHTA 4KMQA 1AL8A 1M7JA 3EAUA 3GHRA 4AHQA 4H8HA 3BZGA 1W1YA 3HG5A 4YTQA 5K3VA 2VELA 4BF9A 1SGJA 4S39A 1J0KA 3VX1A 2BDQA 2R1PA 2RDUA 1D3HA 4RX0A 4LAOA 4GPNA 8TIMA 4YNGA 3UR2A 2DZSA 4GIYA 3O16A 1DJNA 1E56A 4FX7A 4QG9A 4DELA 2ZA2A 1K77A 2YL6A 3NYZA 2OELA 1M68A 5F4SA 4J2MA 2ZVRA 4HT3A 1UP0A 2OO0A 2GUUA 1UW9A 1I2NA 1WXJA 4NY2A 4ZTXA 3VIIA 1FKXA 4MGGA 4HK5A 4JFVA 4RNIA 3CHEA 3BG3A 2NX3A 2Z4GA 3LZ5A 3KVKA 1FWDC 3HQNA 3C2FA 2RKXA 2ACQA 1VBUA 3MKKA 1YIXA 3TYUA 1N7KA 1LTDA 3NL5A 3KOZA 4MHBA 3KL3A 4GABA 7PTDA 2FVMA 2NQHA 3PK7A 3W1XA 2A3EA 4ZVJA 1UC5A 2FQIA 3EDFA 1PCWA 3TOPA 2PDJA 2DU2A 1RALA 3TR9A 1TWZA 2YCLA 3DHPA 3NQ7A 1ECQA 2PD5A 4BS0A 3E3HA 1JCJA 1P1XA 6ENLA 5DT5A 3LG3A 5A2AA 5A3HA 4XZMX 3GC2A 3VGHA 5CAKA 1KO0A 1NOUA 2J78A 1GHSA 3DAQA 1TVPA 1SZFA 1CXEA 3I7RA 3LX9A 4WDXA 1KLYA 2ZZ7A 3DKJA 1DJGA 1BHGA 5A8GA 3SSJA 3M0XA 4AD5A 3QSTA 4XTIA 4GI4A 2CLOA 4LUIA 4XUGA 1UD4A 5KTLA 3TJIA 3V16A 4LBSA 4IGHA 3CIVA 4Q3MA 3MBDA 4A3QA 1L8NA 3ARTA 3ARQA 4FEZA 4UQBA 3FYPA 4MB5A 1I2RA 1E4NA 4RXGA 3LBMA 4LUYA 4K8HA 3ZZ1A 3K8KA 3ITGA 3NQFA 4DVOA 1NP2A 1OFEA 1Q6GA 1LRNA 4OE7A 5A8MA 3DN5A 3D46A 2W62A 2EKGA 4HU0A 1R86A 1FBAA 2H8ZA 3GXFA 3WK1A 3F4CA 4W89A 3H70A 3O6AA 4O8AA 3N1AA 3WUEA 1XS2A 4A6GA 4O28A 2ZC8A 4DAFA 2C13A 1S2UA 3WFAA 3ZXWA 1OQFA 3E2VA 3WH7A 2JGQA 1G67A 3QV7A 1O66A 1JF6A 4R9OA 3VUSA 2INEA 4L9YA 3SQMA 3QXBA 5RUBA 2E6FA 4MY8A 1UMLA 1UWUA 1QU4A 3U4AA 1Q65A 2OSYA 5H8MA 3M9YA 3VDBA 2D3LA 2J7BA 1FXPA 2CLKA 1BD0A 3PNZA 4EAMA 3OJGA 1IZKA 2VX6A 2ZUSA 1WZLA 3RAOA 3CGTA 3VMNA 3B0UX 4AWTA 4AD3A 1PIFA 4QX4A 4PTMA 1H09A 3BLDA 3NA8A 1HG3A 3I6EA 4BF5A 4AVOA 3ANYA 1AH3A 4RDWA 4C7DA 4UTFA 2VI0A 3NSMA 1N8WA 4Y9PA 4D6HA 3TROA 1K70A 5IBXA 3A6OA 1B1YA 5DY2A 3STEA 2WHMA 1NP0A 4N02A 2YA1A 5K9XA 3VDAA 1CGWA 3CPRA 3K46A 3TXZA 3DH7A 3MDWA 5A8QA 4UFJA 1TCMA 4PC8A 3TUUA 4RNJA 1AW1A 2YJQA 1QR7A 5AVNA 4WY0F 1WZKA 4K8GA 1TWWA 3QY7A 1NQKA 3MP5A 1JYWA 4DF2A 1V51A 4S3BA 5CPTA 1IQ8A 3WDQA 3HJZA 2J13A 4HMDA 5KINA 1WPCA 5JH2A 4C5ZA 4NKCA 2NQLA 3T2OA 2ZA3A 3T0BA 3PTMA 4L4MA 1S2TA 2OZ3A 2YDQA 1AJZA 1JCTA 1FRBA 3RGTA 1GQLA 1A5BA 5I5RA 3C2VA 1IR1A 2FYMA 3G1AA 3WDJA 3U2EA 4GYJA 3GAKA 2CKRA 3A23A 2CLMA 2DY3A 1UC4A 4KFOA 3EWXA 4X2RA 3WIJA 1XGEA 3EB2A 2V3FA 1Q66A 4U2ZA 2ZX8A 4MF4A 3TTYA 2HROA 1IWAA 2GDUA 1KRAC 3LNMA 3QFWA 2IQ0A 3LZ3A 4MKNA 1SZNA 3ITLA 4IFKB 2YZRA 3SURA 3LXAA 3S47A 1X39A 1EKOA 2ZZ1A 1J11A 3RNDA 4H4IA 5EGRA 4IQJA 3C52A 3GYCA 3M43A 3TWAA 4AB4A 1TFVA 1OYBA 1VD6A 4MKVA 4REQB 4XVEA 3LRMA 3RO8A 3GNNA 3E2QA 3F4VA 3PB0A 4US6A 3TEVA 5M2FX 3H24A 4L4LA 4LOCA 3GTXA 2P1FA 3RN6A 1ISWA 1KM5A 1R3QA 1WDPA 2Z2AA 5I23A 4EWND 1W3JA 4KF1A 4AW7A 3QEZA 2VUYA 1EZWA 2DIJA 4LB4A 3VKAA 2VP8A 1EZ2A 1RA0A 4GI6A 2PP1A 4PSRA 1U2YA 1XIEA 4QNWA 3VM5A 3BLIA 4TX6A 2ZRUA 3ZR4A 3TA9A 2BB0A 3OBKA 4DM2A 4N9CA 1W1IE 4EIVA 1QNQA 5LGZA 3HV8A 1UA7A 4NF7A 1XWYA 3FX4A 3S8HA 4LNYA 2VEGA 4GQQA 4JAWA 3R11A 4MYAA 3AS1A 1M01A 2OJPA 3Q4DA 3PG9A 2G3NA 2AQOA 2DVTA 3QSRA 4D1JA 5CJMA 1ONEA 2AQVA 4GG9A 4XKMA 1OFOA 1O94A 2POZA 4BK9A 4R53A 3AYTA 2GOKA 1DWAM 4Z0JA 3U7VA 2JKAA 3CYJA 2PWHA 1N82A 2AOSA 3UXAA 4NAFB 3SRKA 4XZ9A 4XBKA 2YXXA 3NQ6A 2EBNA 3COTA 3IUIA 3CU2A 2C14A 3S5OA 3IJQA 4CGTA 5HXMA 2Q8XA 1FHVA 2NWSA 1CZ1A 1MNZA 4NX5A 1X6LA 1JRCA 2YXGA 3WELA 1U1HA 3A13A 3LK6A 1CLVA 2GVGA 2R1NA 4IOTA 3MUXA 4HK6A 3L5LA 1E1FA 1U22A 1CGYA 4NAFA 2Z2BA 1GWJA 1XH0A 4PYSA 2OWWA 3M0IA 1X8FA 2YB1A 3LXCA 3MU7A 3URQA 3CH9A 2OOFA 1JZ7A 1V08A 3GR8A 2DW7A 4FI4A 3RG6A 2OTDA 3CUHA 2QDDA 3D5HA 1PB0A 4PMVA 1LZOA 1ISYA 1G69A 3FYOA 2O4QA 1JYXA 3VC6A 4N6FA 1HZYA 1ICQA 3MVTA 3A5VA 1Q7ZA 1C7SA 4C6PA 2D3NA 1HIZA 5ABGA 4GO9A 4Z2LA 3WLSA 3GDRA 3ZR6A 1BTMA 4J27A 1PKLA 3HQPA 5IHSA 4A05A 4LY8A 2WMFA 3VOCA 3CQHA 3UJ2A 3W83A 3VK5A 1SYTA 1HO4A 4EK7A 2PD9A 1VFLA 3CV2A 4WF7A 3UVIA 4TVDA 3P61A 5FSDC 4IJCA 3QQWA 3T8QA 5REQB 3U2CA 5A5WA 4B90A 4PULA 1R7AA 3TA6A 1BFNA 5CLTA 3R13A 3MTWA 2JKPA 4J3VA 1IWBA 2G37A 4MADA 2DSVA 5BXTA 2G5WA 4IZGA 4HZ7A 3G6LA 2ISVA 4XIMA 3RR4A 2Z29A 2Z7KA 1CB7B 3VNYA 3KFTA 4I9TA 2IQDA 4P7NA 3I7QA 1GEQA 5D32A 5DCBA 2PU1A 4PTDA 5LIYX 5AC6A 2V5BA 1JR1A 4OKDA 1RP8A 3V36A 1GW9A 1S3HA 2E67A 4MTVA 3AISA 3NQ8A 4JIPA 4B92A 1XGDA 3VDHA 1NDYA 4O1DA 2QVHA 4GLEA 4B4FA 1OINA 4L61A 4M3PA 3GDTA 3DKLA 2RDXA 3GBEA 1RK6A 3POHA 2PDCA 2QJJA 3BG5A 3PZIA 5FESA 4ZSTA 1Y5WA 2WWDA 3OLIA 3HIJA 3NOYA 4DYKA 1H7RA 1UG6A 1IEVA 1JYNA 3H22A 3CEPA 3NL2A 4AAJA 3JU2A 2WBGA 3QYSA 2AAAA 4O16A 2ABAA 3GB6A 4GK8A 4UQAA 2Z27A 4G6CA 1YPFA 4RZ5A 2INZA 3FAWA 1NOWA 3PB2A 2O7QA 3BAXA 3EWUA 3QKEA 4Q8WA 1DIKA 3TVAA 6CGTA 3N6HA 3SN0A 2OSXA 1AZ1A 3AI0A 1OFPA 3EX3A 1QW9A 1F05A 4TV5A 4UWMA 3RLGA 5D2WA 1KR1A 3PUOA 2B31A 3RM8A 3UCQA 4OV4A 2D2JA 5T91A 3S5ZA 4AD2A 3NSXA 4GUFA 3ZIZA 4LBUA 2PODA 2PDHA 1RQEA 3BW2A 1A0EA 1VYSX 3LN3A 1HVXA 4JICA 1K7EA 1YYAA 1VAHA 3DG3A 4JTUA 4B5XA 2X2YA 3TLQA 4N0RA 2ZX5A 3MHGA 1T41A 1GCYA 2RFGA 3RPTA 3MSDA 3N17A 1LORA 3DUGA 4O0ZA 3VOGA 4NP7A 2ZRXA 3TE9A 4AD4A 2C1HA 5HJYA 4GD0A 3UY8A 2DZVA 3KOXA 3HA1A 1LRTA 4LS0A 5JBEA 1QHZA 1P6BA 2ACRA 1IT7A 1AW2A 4ZQOA 1BAGA 3UWZA 2FB2A 1RVGA 5FJPA 3M0YA 1LBLA 1B3YA 3PVFA 4PUKA 1W17A 2VGFA 1GOIA 4J3ZA 3ZJ8A 2G50A 3C0QA 4IL2A 3VI2A 1ODUA 1UPMB 2V63A 2XFRA 4X3ZA 4V33A 4PUMA 4BKNA 2B4GA 4Z17A 2R82A 3GVRA 4NXKA 4C1KA 1KGXA 4KBXA 1MO0A 5FL1A 1EIBA 3LENA 4ORIA 1TPC1 4UNLA 3DEQA 5M1TA 1NDZA 1XM3A 2XSBA 3CT2A 2VT0A 3AXIA 3UWQA 2YFNA 4BWLA 1TV5A 4S2BA 4AFYA 2VDIA 3UXKA 4MB3A 1OABA 3P8IA 4GGBA 4OWGA 4PUJA 3F2CA 4AC7C 1DHKA 2H3BA 1YE4A 5KEZA 3M46A 1R46A 2EPKX 1EBHA 1KM0A 2QIWA 4RK8A 3TN5A 5KETA 1W9DM 5M03A 3L67A 2BBFA 1N8IA 3AMCA 2I16A 3WYZA 4DWSB 4RLIA 4E2DA 1FCQA 4QJ5B 4IUOA 3MCNA 3BE7A 3E38A 5EYWA 4UTWC 1DHPA 2QCCA 4JTEA 4HPNA 4GJIA 1J96A 1J0IA 1VFHA 2OXNA 2PWEA 1E1EA 2PDNA 3KEHA 5AC4A 2VEKA 1SJCA 3SO7A 3G1RA 4O1EA 4GQRA 3WNMA 4AMAA 4ATDA 1WZAA 2X16A 2OZ0A 3L4UA 2J8GA 8A3HA 1R9ZA 4GZIA 3TYZA 1IR2A 1ZZMA 4EX4A 1G4PA 1Q6EA 8RUCA 1DJZA 4ACYA 1QNRA 3SCQA 3I6TA 2YBVA 4RPPA 3VDGA 1TV2A 3QF0A 1D2KA 3SUUA 1FH9A 4NAEA 1B54A 5DCEA 1Z7AA 2VC5A 3AXXA 2IPFA 2OGJA 4C6KA 4Z2JA 4XKYA 1FWCC 3IANA 2DFAA 4GUGA 3LGDA 5K9DA 1BLIA 2QIIA 1BXNA 3L5AA 1V03A 4M7SA 2XIQA 4I6KA 1VP5A 1ONXA 4A8LA 1IE7C 3K1DA 2BWGA 1A3WA 2GSEA 2OYLA 1Y5XA 4O4WA 1IXNA 2QF7A 3CZKA 3CUZA 5CC6A 2WM1A 3ELFA 2EO7A 3BC9A 3IAQA 2I7GA 3V5OA 2HXUA 1Q7QA 6TIMA 4AIBA 4IQLA 3CS2A 1BPLB 2E1DA 4GGHA 3C56A 4PL1A 2E09A 2QNEA 1US2A 2ACUA 2BXYA 2R1MA 4YCPA 4O8RA 4ZB0A 5GJNA 6XIAA 1HJUA 4JQ3A 4H83A 1H1NA 3JR2A 1T0OA 2VFIA 2B7NA 4QAIA 4KEUA 5FI8A 2QUMA 1UJPA 2VWTA 2YCEA 3BAIA 2XWDA 1Q8AA 1FWFC 4JYEA 2Z7GA 1JI2A 3W2UA 1OGBA 4UTWA 3RX3A 4PRRA 1X7FA 5DMNA 1MW1A 2WOQA 7TIMA 4UFHA 4IISA 1EO7A 4HPHA 5DO8A 1QFEA 4RPQA 2WVTA 1Z48A 2WO5A 3SIMA 4EE9A 3P80A 2AL1A 3T44A 1H0GA 4JNZA 3WDPP 2PTWA 1CT5A 1W9UA 4A2RA 3PZUA 2OKOA 4R34A 2CHRA 3PFRA 3HPZA 3PWAA 3B8TA 4Q4PA 5LA1A 2Y7GA 3TTQA 3W7JA 5CZJA 1HGYA 1R9YA 3AMKA 3LQGA 4KCTA 3HGRA 3S6DA 3STPA 1JGIA 3GYEA 4Z1AA 3VFLA 2O9TA 3KBMA 3C2YA 4M51A 3A4XA 4C60A 3ATZA 2BVTA 3KOFA 3MUZ1 2W3ZA 4F40A 5A2CA 2CKSA 6REQB 3IJIA 3P82A 2ZTKA 1J8VA 4UCFA 1MW0A 3TSMA 3VINA 1K9EA 1C9DA 3T42A 2ABBA 3WH6A 3NOEA 1KWKA 4O52A 5AB3A 1G0CA 3A9IA 3CBWA 4UOZA 3BSGA 1R47A 3VKJA 4IPLA 3CUJA 1J12A 3IIZA 3GZAA 3WQCA 4J3XA 1Y5VA 3O07A 4E38A 1F2JA 3EWDA 1YHTA 1ZJAA 4JIIX 2XN0A 4EWJA 2J62A 1L6WA 4D6JA 4IFRA 3UZWA 3T0CA 4HN8A 2W27A 3CZLA 4B2DD 5M3WA 3KVLA 5JQ9A 1FWAC 4MUPA 1F9CA 4H6RA 1XKYA 2NUWA 3SCRA 4XAYA 2F38A 3EA2A 4X9YA 3B8UA 2X1IA 3BGJA 4GC4A 1RBAA 1DV7A 1ME9A 1ISVA 1H49A 2QCLA 4GUJA 4L6HA 4YXGA 2PZ0A 4QLLA 3USBA 1XH2A 5DEZA 4EXAA 1WQ5A 3TYEA 1TPEA 3JUGA 4LH8A 4GNKB 4TUFA 3BGAA 3G1VA 3HMCA 3TLLA 4DYEA 1H1ZA 3E2SA 4IHCA 4GNJA 1KM4A 1TWIA 2I5IA 2CYGA 5BROA 4O1BA 4R9XA 5D9PA 3NYDA 3S46A 4L80A 3N2XA 3PM6A 1IXOA 2Y88A 3CHVA 3CQJA 5H1WA 4ONVA 1SZGA 1X1NA 4K6AA 3HF3A 4U3AA 1Z3NA 2Y61A 1GOQA 3N04A 1T99A 4F66A 4WJ8A 1K8ZA 2CNCA 3B40A 4ERGA 3W1AA 1WKFA 3LTPA 1AL7A 1XLJA 5C9ZA 3TIMA 3N2BA 4MB4A 3BOXA 1RD6A 4PB4A 1ADOA 1TO3A 1TPDA 2VZSA 1UJQA 3H2OA 4ICMA 2PPGA 1VFSA 2PRHA 1RA5A 4Z08A 3L0KA 2EPOA 2WHLA 3H2NA 3FJ4A 5EMMA 3RCMA 1IT8A 1HJVA 5HMSA 1YNQA 3R12A 5AC8A 3D0CA 1XYAA 1IEIA 1DE6A 3PP7A 5D2VA 3IRSA 1FHUA 1O95A 3UJFA 4XZHA 1R30A 3E6EA 1K7FA 2CFFA 2HE5A 4EACA 4LBRA 4GX9A 4NJGA 4B91A 4AZGA 3M0HA 4ZL1A 2EHHA 3CZ8A 1IEQA 2E8ZA 3W7QA 1BEUA 4KRTA 3TYCA 3W70A 3UWEA 4KCWA 4LU0A 1XXXA 2QJHA 1XIHA 1NTHA 5HQEA 4LUSA 4CQAA 3CK5A 1F4AA 3N3TA 4CQDA 3FHAA 2C16A 1VLWA 2PDKA 3ARYA 1J4EA 3PZOA 1ALDA 2YYUA 1A5AA 3VOFA 4WGHA 1WE5A 2IPWA 2WZHA 3O8AA 1W1PA 4JDYA 3TKFA 4TIMA 2NVCA 4K8EA 1L6GA 2A2IA 1R2SA 1AODA 4RNHA 2ICSA 1ZLPA 2FFIA 3RU8X 1NSJA 4BI5A 1IHIA 1H5YA 1OYCA 1PL9A 4J9JA 1E1CB 2XJ7A 4AHOA 3EA3A 2A3BA 3C3UA 1V6TA 4FR1A 4ADUA 2XN2A 1S2VA 5C9XA 1C8XA 3N2MA 2WVVB 3OGVA 2QJMA 1EQCA 1TVNA 3VC5A 3RR1A 1YNPA 1E3ZA 1DKWA 3TYBA 1UPPA 4L64A 2VC7A 3GNRA 3MZNA 3UPBA 1SPQA 2G95A 3ES7A 1BTCA 4QE5A 2EPMX 2D24A 1TPB1 1TWDA 2CC0A 3VZYA 3AJXA 4Z2KA 4Q8QA 1XF0A 2VFHA 3QC3A 4HZ6A 3BCFA 4FB7A 1E4LA 2WSKA 3DHDA 2OEKA 5AKQA 3FJNA 3A4JA 2OQHA 3PTQA 1SO3A 1XBVA 2F2HA 4U33A 1ZBCA 2CBUA 4CNSA 2YCLB 5IFTA 1P7TB 2ZICA 4TX8A 1I60A 4M19A 1UIPA 1XLKA 3F1QA 3ABXA 4HHMA 2ZXDA 4F0LA 3HQ1A 1OC5A 4HU3A 4QISA 4AIOA 5XIMA 4I5XA 2BXZA 5H2ZA 3LUTA 4QGCA 3VNLA 1E43A 1TELA 3S4TA 2ZA1A 4K1GA 2FTYA 3ZS4A 3GUWA 2AGTA 1QW8A 4ENLA 2CWXA 4Y9OA 3R2GA 3T8LA 1B30A 4C6LA 5LIXX 3N2CA 3B8IA 4GXMA 3W1LA 1DQUA 3HPXA 3EOSA 3ORWA 4YU1A 4DO7A 4JNYA 4US5D 2XM2A 3FEMA 2GGEA 3VX0A 1AMYA 1N8FA 4TQTA 4UTUA 2QPUA 3FYYA 3GHUA 4QEEA 4MAZA 1H11A 1X7IA 1OD8A 2C7FA 4S3CA 5F1VA 1QPOA 1C9WA 2PDYA 4HMCA 4WKFA 1I6NA 1GUVA 3EX2A 3UERA 2J47A 2UV8G 3OHIA 2V5LA 1FHDA 1AQ0A 4QSFA 2Y62A 3AOFA 3H4XA 1V7YA 3PR2A 5D2XA 1SJDA 3LGEA 5BOEA 4ZBCA 5GNXA 3H54A 4XZIA 1GK8A 3GDLA 2PWDA 3WDHA 3AQUA 4MLRA 4LANA 4MMWA 4X61A 5G2WA 4JTSA 3BMWA 3L68A 2NX9A 1JAEA 1PX8A 2VC9A 3KAOA 3CC1A 5EU9A 5J8LA 5E6YA 3RMJA 1QK0A 3AHVA 3RM4A 3KBVA 2WMIB 3TCEA 2NVAA 5CC5A 4NZ4A 3UXDA 1KRBC 3VPLA 4DY1A 3GU9A 3PJTA 4JTHA 2OZTA 4GACA 4ZE5A 2H6RA 4IPJA 3SB0A 1NY1A 4PTNA 3MSYA 3FXYA 4LGXA 4JTKA 5A95A 5CPLA 3LTSA 4MFEA 3RJYA 4ROPA 2GQ3A 2Y8KA 2ZX9A 2BVDA 4C90A 3WQPA 3VNKA 1MEHA 5EPDA 3VKDA 3UR7A 3KBJA 2D0HA 4S3KA 4L9ZA 2GZXA 1R2RA 4QEHA 3NZ1A 1N2VA 1XIJA 2FH8A 4JKLA 3XISA 2O92A 2HZGA 5AHFA 1FWTA 1O5KA 2GQ9A 2IXVA 1UD2A 3CLMA 2OYMA 1JDDA 5CXPA 1LWHA 1QOQA 3OIHA 3W1RA 2BOGX 1DJQA 1FXQA 1W6TA 4XISA 4NUWA 3AS0A 4B9YA 1RZMA 2DZAA 4M24A 1YTKA 1XH1A 1QWGA 1IZCA 3L9CA 3LCIA 4P8VA 2NXGA 4B3ZA 2YA2A 3RJXA 2WKGA 3MMWA 2PGEA 3QLLA 2Q6ZA 3R79A 4HZMA 2QV4A 5D30A 4GQ0A 1DWGM 3N29A 1YNYA 3IGSA 5I79A 3M0VA 1CEOA 1KGUA 3TNBA 1W9VA 4RR4A 2QQ6A 1JUEA 4AVNA 3I4KA 1JPDX 1GVYA 2WJFA 3RPDA 3W00A 4JTQA 4Y8EA 1DXIA 2OODA 3GBDA 2CLLA 1UD8A 3A64A 3HTWA 1KKOA 2G41A 4HNUA 3ZSSA 3LLXA 1IIGA 2BV9A 4UTLA 1XLIA 5L6UA 3AZRA 1TQXA 3WJZA 3S2CA 4Q8MA 1G7UA 4U2YA 1AD4A 1I2OA 1PX3A 3W7IA 4BF7A 3QZAA 4PFHA 2PURA 3NAVA 2DQXA 4JQ1A 1EWEA 3RRAA 1Z9AA 3MV01 1ZHAA 3EWWA 3AROA 3HG4A 4DXKA 6TAAA 1LQAA 2FZBA 3ZWSA 3ONBA 2DVUA 2XPKA 1M65A 2FGLA 3RUBL 3I3BA 1KM3A 4DLMA 4EPEC 5AC7A 1ZTVA 3VD5A 3VIFA 1PIIA 1XG3A 4JZ5A 2WPBA 3KUMA 4JY8A 3EA1A 3UCCA 1GZGA 1UKOA 3GR7A 3CZJA 1UWIA 4IICA 4AY7A 1S5MA 4WY0B 2OLSA 1B3XA 1EYEA 2QMJA 3U0HA 2R14A 5I24A 3HO8A 1HUVA 1GYNA 4F79A 3GG0A 1T40A 3T4WA 2HS6A 1EQPA 3V1PA 1E6PA 3WF3A 1F6KA 5LA2A 2WSYA 3QZ6A 1KD0A 1XBYA 3G1XA 4DN1A 3IV3A 1XYBA 4JHMA 1XL9A 1JDCA 5B7YA 2Y8VA 2PSNA 4LYPA 4A3UA 9XIMA 3A3HA 3B97A 4YS1A 2V2DA 1VEPA 2NXIA 3ALFA 2RJGA 3LGGA 4JHOA 3GSMA 1EYWA 4W85A 4PEKA 1A47A 1V6YA 4PUNA 1JXJA 4AXKA 1ZSXA 1XQKA 1XLBA 1LJYA 3H55A 1ZFJA 2XH4A 4QROA 3T55A 2V5KA 1E0UA 3E12A 4Q7BA 5CSRA 3MDUA 1ZBWA 3W2KA 1CENA 2XIIA 3SCUA 1XGZA 3M6DA 3EMCA 4HTBA 4QDMA 3T0DA 1QHPA 1UMYA 4DB7A 2J9YA 4HHLA 1GZJA 3WF2A 3QW3A 1MSSA 4PUEA 3UU0A 3WLTA 3DXIA 4FS9A 1W1VA 2Y5SA 3MI3A 5FEPA 3A4WA 5FEWA 2XFYA 1UD3A 4OJYA 1JRBA 4WOZA 2BLEA 4V2XA 1EXBA 7CGTA 4OUEA 2CITA 3RIKA 1OGGA 4JOMA 3GXIA 5D9NA 3O9NA 3A9BA 2AGKA 4QR6A 4YTUA 2JIWA 2ZZ5A 4P8UA 2NQ5A 2XFWA 2NX1A 4FNUA 4QS5A 3UG8A 3CUGA 3S5NA 4Q4KA 5HNUA 5HWMA 3QYQA 2PDPA 4LXFA 4H9VA 5MKGA 3L65A 5CPMA 2WZEA 1VPXA 3F4NA 3OVRA 5CG7A 1VFFA 2UZ9A 1TSIA 3LHVA 2PDQA 3FKKA 3W88A 3ME3A 3MT1A 5D38A 2OLAA 2CLEA 3BJSA 4FNTA 1GOKA 3VAVA 4NRRA 1UOZA 1B2YA 5FOOA 2Q3OA 3CWHA 4XX6A 5TF0A 3KLLA 4UR8A 2VTFA 2GK1A 1OF6A 1JZ6A 3T0AA 1B3ZA 4X9SA 1C92A 3QTGA 1EJVC 1T5AA 3TR2A 3WF4A 3W2MA 4GJJA 3K30A 2Y2WA 1G94A 3ANUA 1MVYA 3W2LA 1AG1O 4QAWA 1T8QA 4H9XA 3YPIA 2BP1A 3IUHA 1VEOA 5TBOA 1N55A 1YPIA 4NAEB 3AICA 3BPWA 2NUYA 2ZX6A 3NO3A 2VCBA 3KZPA 1VIWA 5LA0A 1I8JA 4ADTA 3CIWA 3WD0A 1JGMA 4TMBA 2PDGA 3FCPA 3M0ZA 4PFMA 2V3DA 3CLWA 1KXQA 3QTPA 2POTA 4PCTA 1EJUC 1R85A 1R3WA 3W25A 1W31A 5BMWA 3PBMA 4AEEA 3OHMB 2FPVA 1ADDA 3UR5A 3BLOA 1UHVA 1Q63A 3PBUA 1V0MA 1XIIA 5AHMA 3WENA 1SU5A 3G1HA 5I3DA 3TK7A 2P10A 1DWJM 2Z1BA 5HPCA 5I07A 1Z41A 3IAPA 2WNQA 3GD6A 5FJRA 1UZ4A 3CHFA 3EX4A 4R5EA 4JX5A 1ZJBA 2ZUNA 2E0PA 4DUWA 5K9CA 2HS8A 1Q45A 1A5NC 3W85A 5E5CA 1R0MA 5BNKA 3TNOA 3GIQA 1V02E 3B9AA 4JKMA 4X2PA 1DJWA 4DI9A 3RDKA 2V30A 2YX0A 3L7RA 5A6SA 3UP8A 4DJDA 3KVMA 1AH4A 3GY1A 3G3MA 2OQYA 2W92A 1E6RA 1FWGC 1OF8A 5BWAA 1F07A 3PZVA 3PBGA 4URIA 3UFYA 4C6EA 1YXCA 2OR2A 5IDZA 4MJ4A 3SCPA 3VZXA 1H5VA 3NDYA 3Q37A 3R89A 2X40A 3RU6A 2Z1XA 4W5UA 3AU2A 4WR3A 4GBUA 2A3LA 1JNEA 3GQYA 1DQWA 2UBPC 3AHYA 5E0FA 2WKJA 4G7EB 2DV0A 3WDRA 3GNXA 4L56A 3SRFA 4PZVA 2BODX 3PF3A 4JTGA 1LDCA 3IACA 2P50A 4D2JA 2VD9A 5D2TA 1EGZA 6A3HA 2W0UA 3GC4A 1TZ7A 4U31A 1E6SM 3CHCA 2PAJA 2YL8A 3EWCA 2J77A 4EXBA 3NURA 2A5HA 3HPAA 4DZAA 4WD0A 1REQB 4HK7A 4O53A 1U1UA 3ZT7A 1TREA 3QHOA 1SO6A 3SQLA 3P81A 3QZEA 1NJJA 3NEHA 3N15A 4TV6A 3M47A 2IMRA 2DZBA 3SIZA 1AD1A 2CU0A 1JFHA 2WLZA 2BTMA 4JTLA 3EX1A 3MY9A 1JZ5A 2TRSA 2YLAA 2ZCGA 3UG5A 4UQEA 3R7MA 3CQ0A 3W0KA 4KS0A 2DT3A 4UC5A 5E6ZA 1XI3A 3ARRA 3VIPA 1ITXA 3A3WA 3BCDA 4MPQA 4ZE4A 3DX5A 3D47A 1UIOA 5DRCA 3HFYA 3DC0A 2G3JA 4HQVA 1OFBA 4DUVA 4ZGYA 4L65A 3OZYA 4PMOA 4O18A 2PDWA 1L6FA 1LBMA 4IFKA 4FOJA 5CBBA 2OEJA 4LV9A 4CLMA 2C6QA 3LPPA 1FQ0A 3PUGA 4KQNA 3W87A 4H9UA 3OODA 3ALGA 3LM7A 3AAMA 4LEFA 4LC8A 3KE0A 4AXNA 3VKBA 2WLYA 2A6LA 4NIRA 1UP2A 3AIEA 5CGMA 4HA0A 4ZA0A 4I7WA 4PBFA 4C7GA 1DEDA 5CPQA 3U7BA 3N18A 1WB0A 2HVMA 2HVOA 2GGGA 4RW5A 4IMEA 4OVXA 1MW2A 1WV2A 2VC6A 1NOFA 3QKZA 2QCFA 2ZRVA 4IQDA 3GKAA 1K8XA 1SSGA 1EO5A 3HBLA 3MANA 4L4PA 5EFDA 3CPGA 4IMFA 1HX0A 3TMLA 5LIKX 1I75A 2BHZA 1UP3A 3R5EA 1YADA 4P5UA 2FKPA 5A6MA 1HKIA 1Q6DA 3PJWA 5DT7A 2GOUA 3SECA 4S3FA 1J6PA 2Z6JA 1IXPA 4LF2A 4ZQRA 1EGMA 2ZRWA 4AC1X 4IIEA 4Z0SA 4FOKA 1VHCA 4GFSA 3TFXA 1EEXA 3MP3A 4GXPA 2WMIA 5DMYA 1LF1A 5F2GA 3B8WA 3C4UA 4D1IA 4O1CA 2V3GA 4TXEA 4CU8A 1DBTA 4I9JA 3ARPA 4HSHA 1UD5A 3QR3A 3AS3A 2EKCA 2EAWA 1E71M 3WEOA 3R8RA 3HMJG 1ADSA 1CGTA 3ARZA 3WLOA 3MPGA 4GFIA 1XC4A 3NQMA 3REQB 4B4HA 3WLKX 5A69A 1IEWA 3BK0A 4K39A 5H91A 2OU4A 1MUMA 1G7VA 3EOOA 4B5TA 4YLWA 1B9BA 4V15A 1ISXA 3FGCA 3PPGA 4LVDA 4A21A 1F74A 1PHQA 1O12A 1CXLA 4Q8UA 5FF0A 4ASTA 2CHOA 4MZYA 5I2UA 2Q01A 2YLLA 3LCHA 3GVVA 3IS4A 1CNVA 3LPGA 1ZY9A 3L0NA 2DVXA 3ABSA 3ABQA 2YOCA 1SZRA 5A2BA 3S1WA 1OT2A 1NAL1 2QVNA 1FDJA 3LOTA 1RY0A 1LQ0A 2ISFA 4CCEA 2PRMA 3LV5A 3TWBA 3ISIX 2YFOA 1E70M 6PTDA 5AHEA 4JQ2A 2J7EA 1UKTA 2WK2A 1QAPA 5M5DA 2EPNA 3FS2A 2DDXA 4ACZA 3PPCA 3UY7A 3VKKA 4F0SA 2DSWA 3T0TA 3SJNA 4F0RA 3GE7A 3NXLA 4XWUA 3ARWA 5I6SA 3A3XA 1QDSA 3PZQA 5I3JA 1JCMP 1HN1A 1ZL1A 2FZ8A 1HL9A 1KM1A 2QUTA 3Q2DA 4AD0A 1K1DA 3KDOA 1KC7A 5CJ5A 1EX1A 5FF3A 4HCLA 1JXKA 1XRTA 3IVSA 3RCNA 3SSZA 2OOGA 2TODA 1C93A 4A3HA 4M82A 4OIFA 3EPOA 4Y9AA 4YTTA 4DF0A 3ITCA 3UJEA 4WHBA 2ZZ2A 4WGXA 5HR6A 3POCA 1E73M 2VD8A 5IXEA 1J2WA 1WOBA 3WUGA 1F6YA 2FFCA 5HBFA 3RILA 3TAKA 4AG0A 3I3DA 4I9MA 4QFUA 3WJSA 2QLYA 3G24A 3QQ1A 1DQXA 1MRAA 1LOLA 3RF9A 3N9KA 3HGOA 1J2BA 3W6LA 2ZE3A 3DERA 4G9PA 1JDFA 2PI6A 1DJIA 4F4RA 4KCUA 2E68A 4FO4A 1X1OA 4L1GA 3W81A 1JUBA 1BWVA 4L9XA 3GH7A 2Y8UA 4NT0A 2A4AA 2J88A 4K7YA 2UY3A 4RCXA 3T4CA 1CCWB 2PTYA 4DJED 1HL2A 3Q45A 2ISSA 1PKYA 4FSAA 1J18A 2X8RA 3EDEA 3MUY1 3D3AA 2WPGA 1VH7A 3PAJA 1I4NA 3G18A 2CETA 4V28A 3H4GA 4E2VA 3V5FA 3ID7A 4C6BA 5C6MA 4GRSA 3TN3A 4IXXA 2WC4A 1YBQA 4DIAA 1MUCA 3O2LA 4NZ5A 4D6FA 3OPSA 4KW2A 1XDMA 4D71A 1BYDA 2VRJA 3LCWA 3TDFA 2X7VA 5HA7A 4ZOCA 1Q6QA 3GK0A 3REQA 1RR2A 3R94A 4D6GA 1EP3A 1NF7A 2INFA 2B7OA 3OG3A 4HNTA 4GE8A 3SJ3A 3LSBA 3MJMA 4J3TA 1IIHA 2V2HA 1L6YA 4JTTA 1J93A 1EDQA 5K4ZA 4DPPA 4IQEA 2YIHA 1JVNA 3CMJA 2CESA 1QUMA 4DAIA 2BOFX 4W93A 1XYZA 3DDMA 2A79A 3WEMA 1OCQA 3AALA 1OYAA 2V6AA 1U33A 1RY8A 4F9JA 3P8JA 2X0YA 4LY4A 2XIOA 2C8NA 3GXDA 5AECA 1QNVA 1MFVA 2GSJA 2A6NA 4Q32A 4AY8A 1M1BA 4DJFA 2E9MA 1JD9A 2B7QA 4PA8A 1AJ2A 5TQLA 2VRQA 4LCQA 5BWFA 1KFLA 1OBAA 3MCMA 2Y4SA 2RH9A 3N2OA 4WX2A 3WG6A 4D8ZA 1GGOA 1JIBA 2DUXA 2F2KA 1JNDA 1H7XA 4KFNA 1OG0A 2GUYA 2OX1A 2R6OA 2Z26A 5C2CA 1JCYA 1PAMA 5DMLA 1W3KA 1K9FA 4HNLA 4D9PA 1TG7A 4FNRA 4P8XA 4DBSA 1L2QA 1BGGA 2IKGA 3WCZA 2A7RA 2EPLX 3EDDA 1TPWA 1FVPA 3W84A 1V5XA 3LHTA 1WDQA 3R10A 3TTSA 3MQTA 4MWAD 5A6AA 1YQ2A 3TV8A 2G3FA 4B9ZA 1EJXC 3WK0A 4HPGA 1CXHA 2CEQA 1QPKA 2HMCA 3H2FA 1UR1A 3ANVA 2Y0FA 1XCFA 3EBVA 3H2AA 3PBYA 5E70A 3IJDA 4QXIA 3BLEA 3BJFA 3WD2A 4PMDA 4Q4SA 2Z0IA 1BYBA 4A29A 2GDVA 3VGEA 5FJJA 4UBPC 4DWSC 2CW6A 4OUIA 1PZ1A 2UY4A 4D6IA 4LB3A 4IGSA 3UGRA 2D2OA 3MB9A 2P5NA 5GJMA 4H1ZA 3C8NA 4L1WA 5CBJA 1E5JA 1OIMA 1E0XA 1RBLA 4Q7IA 2XVKA 2BVWA 3UG3A 1BQGA 3CT7A 4LYQA 4JX6A 4FX6M 1OC7A 3ITVA 1EJTC 2Y7FA 3U3HA 1G6CA 4YYCA 2FB3A 1YDOA 1J0ZA 3EEZA 3THAA 1ITUA 3LPOA 4HU4A 3N9SA 4GY1A 4UNIA 2PBGA 1PZ3A 2NLYA 1WXZA 4LCRA 4KT2A 3IIPA 5FJIA 4BQ5A 3O0KA 1TJPA 4CKQA 5HULA 5F4XA 3WDIA 1F5ZA 1NWTA 3P84A 4C6OA 3OVQA 3VIHA 4WRHA 4GZJA 4EP8C 1LG1A 4K37A 1FWBC 2V69A 4F48A 2VL4A 4DJDC 4YL2A 2PEVA 4US5A 3BSHA 3OO2A 4DEFA 3KTSA 2CXGA 4E0CA 1CBGA 1NEYA 3TZFA 3ARSA 3WH5A 1JYVA 1TJ2A 1UASA 1V02A 1H41A 2Y89A 1W56A 3UA4A 4WSHA 3B0YA 2GVEA 1D3GA 3D3FA 4NI8A 5CPSA 2HBXA 2QCNA 4AVFA 4GZ7A 3KBWA 4S3DA 4GYPC 4NI3A 4FMVA 1VFOA 2PWVA 4E8DA 2UY2A 1W1A1 4L6OA 3UWUA 1QOPA 4CQ9A 3FNDA 1XHGA 2QJIA 5K4XA 1WYIA 4UQCA 2ATMA 3B9OA 3FAXA 2CWNA 2E28A 4G7EA 4NASA