2AGTA

Aldose reductase mutant leu 300 pro complexed with fidarestat
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Factorizing Selectivity Determinants of Inhibitor Binding toward Aldose and Aldehyde Reductases: Structural and Thermodynamic Properties of the Aldose Reductase Mutant Leu300Pro-Fidarestat Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2agtA00
2R24A 2DUXA 3R43A 2PEVA 4JQ4A 4JTRA 2VDGA 3WBWA 1YNQA 1QWKA 2HE5A 4L1XA 2IKJA 5LIYX 4JQ2A 5DANA 4IJCA 1MRQA 1ZSXA 3GHUA 3BUVA 4GA8A 4AUBA 1K8CA 5AZ1A 3LNMA 2A79A 1X96A 4PRTA 4G5DA 3V0SA 4GCAA 1AH3A 4XZHA 3R8HA 1VP5A 2ACSA 2J8TA 3ONBA 1PYFA 2WZMA 4I5XA 2IPFA 4L1WA 5LIUX 3LN3A 3WG6A 1SM9A 2IS7A 3DN5A 1MZRA 1FRBA 3LENA 3UZWA 1T41A 4JTDA 3V35A 4XO7A 3UZXA 2INEA 4R9OA 2IPWA 1XGDA 3U2CA 1Q5MA 4DZ5A 3M4HA 1XJBA 2BGSA 2WZTA 4FA3A 1RY0A 2PD9A 2PDMA 3G1RA 3EB3A 4NKCA 3UP8A 4YVXA 2BGQA 3H7RA 4JTAA 3D3FA 5LIXX 2PDUA 1PZ1A 3COTA 5JH2A 3LZ5A 5C7HA 1AZ2A 2HVOA 5LIWX 2I17A 3CASA 3FX4A 4FZIA 4OTKA 4XVDA 1S1PA 4XZNX 2ACQA 1GVEA 3LQGA 3WBXA 3R58A 4YVVA 4ICCX 4DBUA 5KETA 2PDPA 2ACRA 1AFSA 3UFYA 4JQ3A 3QKZA 2PDNA 4XK2A 3CAVA 3H4GA 5M2FX 2DUZA 2FVLA 4GQ0A 1T40A 4HMNA 3P2VA 4LB3A 2PDWA 1ZQ5A 4Q7BA 1LWIA 1XF0A 4H8NA 4WEVX 4QXIA 4XO6A 4GQGA 4YS1A 4PMJA 3MB9A 3RX4A 5HNUA 3UWEA 3LZ3A 2PZNA 1A80A 3N6QA 4HBKA 2PDJA 4XZMX 2C91A 1IHIA 4JTCA 3O0KA 2PDKA 3UG8A 2IQ0A 4QX4A 4PUUA 1YE4A 2QXWA 1Z89A 4YU1A 3RX3A 4WDXA 2PDBA 1Z9AA 2PDQA 1US0A 3Q67A 1QRQA 1Z8AA 4JQAA 1EF3A 5JH1A 2PF8A 3WBYA 4LAUA 4ZFCA 3LUTA 4PRRA 3G5EA 1S1RA 3BURA 1RALA 1X97A 2PDCA 2HV5A 5HNTA 1JEZA 4PUWA 3V36A 2ISFA 3F7JA 2FZ8A 5AZ0A 1LQAA 4LAZA 3EB4A 4XVEA 3BV7A 3B3DA 4IJRA 4PR4A 3T42A 2FZBA 3GHRA 2F2KA 4QR6A 3NTYA 3V0TA 2PFHA 4WRHA 4LBSA 1EKOA 1Q13A 1HQTA 1Z3NA 2FZDA 3R7MA 4GIEA 3CAQA 4XAPA 3R6IA 2PDHA 4RPQA 2ALRA 2R9RA 2IKHA 3RX2A 3GHTA 3KRBA 1UR3M 3UZZA 1ZUAX 4F40A 4WDWA 3WCZA 3ONCA 2I16A 4MHBA 1AH0A 4DBSA 1S2AA 3N2TA 1YE6A 2AGTA 3ERPA 4JTQA 3UGRA 1OG6A 3V0UA 2IPGA 2FGBA 4IGSA 4QBXA 1ZGDA 4FAMA 4JQ1A 2PDLA 2ACUA 2DV0A 1YNPA 2PDXA 2IKGA 2BP1A 3CMFA 4GABA 3LQLA 1EXBA 2HDJA 3FJNA 2FZ9A 2PDYA 4GACA 3CV6A 3DOPA 4Q3MA 1ADSA 4WDUA 3S3GA 4JIRA 1EL3A 3BCJA 2NVDA 1PWMA 4EXBA 3VXGA 3R8GA 1AH4A 2HEJA 3O3RA 3CV7A 4YVPA 1PZ0A 2NVCA 4DBWA 3M0IA 1R38A 3GUGA 3LBOA 2IQDA 5LIKX 2PDGA 4JIIX 3LD5A 2CLPA 1HW6A 4ASTA 4XZLX 1VBJA 3Q65A 1RY8A 4EXAA 3GHSA 2IPJA 4LB4A 2P5NA 4WDTA 3EAUA 2PDIA 4WGHA 4LBRA 1M9HA 3UZYA 2HE8A 3LEPA 4JIHA 4H7CA 3M64A 2PDFA 3MC5A 5HA7A 3H7UA 3C3UA 2INZA 4FALA 1IEIA 2IKIA 1PWLA 4XZIA 1J96A 3UYIA 1X98A 2F38A 3R94A 1C9WA 1AZ1A 1MI3A 1S2CA 2PD5A 2HVNA
chains in the Genus database with same CATH superfamily
4RKAA 5C5YA 1OJXA 1E55A 3DFSA 1SU5A 5HMDA 1BPLB 4A8RA 4PBFA 3KBSA 3GVRA 3LI0A 4DWSA 1YADA 4TTGA 2D3LA 3SJNA 3MYPA 1DQUA 2J9YA 2B7NA 1G4TA 2Z0IA 3G1FA 2D23A 3I6RA 2BDQA 3STFA 1V3KA 4KQNA 3WQFA 2QR6A 3FHQA 3ECQA 3BMWA 2Y7EA 3W84A 2WWDA 1WQ5A 1V3MA 2WQDA 3S5OA 3NQ6A 3LS9A 4HNLA 3PR2A 4FO4A 4L1WA 3TUUA 4QLLA 3E12A 4TO8A 4DF0A 2YKKA 1M04A 5B7YA 1ME8A 1GGOA 1QOPA 3HPSA 5D9OA 2FVKA 5DMNA 4KF1A 1FWNA 2AL2A 4BS0A 1SJDA 3G24A 4AWSA 2EBNA 3GTIA 3VNJA 1U5HA 4FLOA 1YXDA 1MW2A 4NZFA 4YHGA 4PL1A 7CGTA 4JTEA 3QW3A 4JTUA 6A3HA 4QHRA 2GJXA 2IMRA 2J62A 3VIFA 1TIWA 3HM7A 1EEXA 1IGSA 4TMBA 3TW7A 1H2JA 2G95A 3WQWA 4V33A 1WAUA 2DT2A 3A3WA 3D5HA 1G01A 1BKSA 2AQVA 1EYWA 3U2ZA 5D9PA 1YMYA 1UD2A 4ZXOA 4Z2JA 3M0ZA 4FZIA 2V3DA 3QV6A 3V18A 4GUGA 5AHMA 3W7PA 2QCDB 1S1PA 3RPMA 4MDOA 2FQIA 4US5D 3BOXA 4GBUA 1CBGA 3N18A 2VCCA 4DBUA 4TVUA 3GU2A 4UOZA 2P76A 2ACRA 1E6XM 2ABBA 3MVTA 4UTMA 2RDWA 2WMIA 5D02A 3WKZA 1UZHA 4GIRA 5EGRA 3PUOA 5C9ZA 1AD1A 3XISA 2WB5A 4JFWA 3SCPA 4D6FA 4QTGA 3IUHA 2XGIA 3VK5A 3EDFA 1T40A 5C9RA 3GC5A 3IS4A 1DVJA 1CT5A 3SRFA 3P2VA 1EUNA 2BY3A 4QSFA 4RZ6A 1J11A 4C1NA 4WKFA 2CHNA 1SZEA 4C6JA 1GTHA 1XLDA 1AMYA 3OGRA 2VQTA 3XIMA 4QXIA 2TYSA 4QNEA 5HAOA 3ALGA 3VIJA 1JNEA 3S1WA 4G1NA 4QLKA 3TC3A 2PZNA 4KWSA 3UG8A 2QDDA 2I1OA 3NQEA 1Q66A 1CX9A 1MW0A 1Z9AA 1KBBA 2RJHA 4MZ1A 2D2HA 3K8KA 3NZ1A 4XD5A 2XM1A 4WKAA 1DIDA 1IF2A 4ZB0A 4NP7A 4LAUA 1LL6A 4UOJA 3TAOA 4QNWA 3IGSA 4UTTA 1R5YA 1FDZA 4G6CA 1QU4A 4HK5A 3LBCA 1FHVA 1KM1A 4M81A 4K6AA 5DT5A 1LQAA 1IIHA 4HNOA 3EB4A 2NZLA 4H19A 3SGZA 4JNYA 5ABGA 1XH2A 4UR7A 5EFDA 3B04A 3THUA 1SPQA 2OQYA 4HCHA 2YA2A 1DKWA 2QGYA 3TJLA 1OX4B 2DORA 4H6RA 3N19B 4CN4A 3G1DA 2VKZG 3SM0A 4C65A 2PWEA 4IP5A 4Q4KA 3R7MA 5PTDA 3UG4A 2V5JA 2DIKA 2WJZA 3UW6A 4QCFA 3GVWA 4FOKA 1WKFA 4LS2A 5J5RA 4UNIA 4EANA 1N55A 3VE9A 4IIGA 3IGHX 2GDUA 2I56A 1I6NA 1QBBA 8A3HA 1VS1A 2Z2UA 3UCQA 1X1ZA 2ZUUA 1YE6A 2AGTA 1LM1A 3L0GA 2XINA 2QIIA 5CBBA 1E4NA 4L9XA 1NWRA 1O5XA 1ICQA 4QBXA 5BMXA 3NPVA 2VC7A 5BWAA 3T0DA 4N6FA 1GQNA 4GKLA 1LOQA 4D6GA 2G4FA 4HMEA 5MHBA 1LRNA 1JCLA 1KTNA 2EEXA 4KIEA 1F9CA 4PULA 3O6AA 3B4UA 4AD3A 3E96A 1AL7A 2J7BA 4JIRA 3K1GA 1EL3A 3MTWA 2G5WA 3M0HA 3MJMA 2V0TA 1FWGC 2VYOA 1OQFA 4DI8A 2GL5A 4AZBA 1AW5A 2V2CA 4LU0A 2E3ZA 4A3RA 1K7FA 2XH2A 4RK8A 1JZ6A 2GYIA 5A5WA 3H24A 5EY5A 3BMVA 2QKFA 3RJXA 1DBTA 3W7EA 2PDGA 4UFIA 2CZ5A 4DJFC 4FEZA 5I77A 4KFPA 1HW6A 1SJAA 1H4PA 4PCSA 3JUGA 4EXAA 4KW2A 3ITVA 4M82A 4NVTA 2NV9A 4P7LA 1JPKA 1CIUA 2P53A 4LBRA 4CQAA 3VUSA 1OADA 2J4GA 4GRSA 2IQTA 4NRRA 4LFYA 5I23A 2VEGA 3B8UA 4RE0A 2JIEA 1EWEA 2MNRA 3F4VA 3L2MA 2J79A 3FGCB 3UYIA 1TJ2A 4ZB2A 4JKKA 3KBJA 3MANA 1OHLA 3ITGA 4MJZA 3UR8A 4HOXA 3S4TA 4DVOA 1DPMA 4ZTYA 2B4GA 2X7VA 5BXSA 2DSUA 3QOKA 3NSNA 2BGNE 1JD9A 2WLYA 3WH9A 4EF8A 3F4WA 3KFTA 2W27A 4JTRA 3W7GA 4DBEA 4JDBA 3MCOA 4PODA 4M51A 4NXSA 4AIUA 5LIYX 1XDLA 3ANVA 2E1WA 3F2BA 4YIWA 3DU0A 3EX6A 3BXWA 2J78A 1WPCA 1A3WA 2OO0A 1EH9A 1ZJBA 2C1GA 1AH3A 4XZHA 5D4YA 3QW4B 2X1IA 2NT0A 5CZ0A 3R8HA 5LA1A 1NVMA 2DIJA 4PUMA 2QF8A 3QTGA 4XKMA 5HDRA 5LIUX 2GPTA 3UNDA 4GZ7A 4A21A 1TA3B 3DN5A 3HV8A 4J4KA 3VOFA 1TWDA 3MMTA 4NZCA 5M17A 4XKYA 1PDZA 4MNLA 1WXJA 1DP0A 5DY2A 4P2VA 3URQA 3OYZA 1V93A 4RXGA 2OTDA 1A5CA 5CZSA 1DQWA 5ECVA 2OLAA 1UR0A 2PC8A 3KLLA 4K2SA 1UA3A 3AYTA 4ZOAA 4AWEA 4IPLA 4D6CA 3E1F1 4W85A 3EWZA 1F6YA 2OVLA 3IJIA 3MVIA 1S5MA 2KAUC 1TTJA 3QR1A 1F74A 3WQ8A 5C7HA 1ITXA 1AZ2A 5LZLA 2OOGA 2PU0A 3CTTA 4AD1A 2HPMA 1WDSA 2R91A 1A0CA 2UY3A 3ELFA 2O9RA 3W7NA 5I7GA 2PPGA 3TTEA 3CPUA 3TIMA 2VX7A 3ITXA 4UQAA 4ML9A 4AX6A 3W7KA 1B57A 2D69A 1ZCOA 2PDPA 4MFDA 3P0WA 4HHLA 4KGJA 4QE1A 2EKGA 3G3MA 1Q8JA 1HN1A 2V5CA 3KWSA 4WX2A 2PU1A 2BOGX 2FYMA 3U5YA 5FSEC 4QAIA 2RDXA 4UTTC 1WDDA 2ISWA 5FSDC 2J47A 4MKSA 1IXOA 4HMDA 3HFTA 3O7UA 3W2MA 2PDWA 3GDMA 2YBTA 5JIPA 5I78A 1T6MA 1BRLB 2PWUA 1K6AA 4RXFA 4I8YA 4XO6A 4L9YA 4GBDA 3C0LA 3S2JA 1EIXA 3UR7A 1P6BA 4P7RA 1EXPA 2POZA 4Z1AA 1OBAA 4F0SA 4LVDA 1A80A 1BXNA 4MNKA 3C2VA 3VTRA 1G5AA 2E6FA 2F61A 3HMCA 2XIIA 4G8TA 3LPOA 1PB0A 1ZP4A 1Z89A 4KCWA 3EDKA 2XIMA 4MJMA 2ZZ1A 3M5YA 3FW6A 4I9TA 4KFNA 4RDYA 4MLRA 3A12A 3ZS4A 1OC6A 2WSPA 5G2HA 4LSBA 1XR2A 3WH7A 3TSDA 4LYKA 4LVFA 1NDVA 1TB3A 1UCWA 3QRHA 4KCUA 2PF8A 2PTDA 4GXWA 3DYOA 5D30A 3IVTA 1LQ0A 1PJ9A 2OGJA 4QDMA 4JY9A 4C7GA 3BJSA 1UP2A 3AHXA 3IWPA 1RBLA 3P6LA 5KITA 2NT1A 1JEZA 3IV3A 3CHFA 3MMWA 3CU2A 4F0MA 4GQRA 1CENA 2ISFA 3PPCA 2VZOA 3CZLA 4W5ZA 1WV2A 1EJTC 3B9DA 4S39A 3URBA 1VPQA 4Q4SA 4H83A 3H2NA 2ZTKA 3DHPA 1V3LA 4ZQPA 1VFUA 3PK7A 3CQIA 3AS1A 3GO2A 4J2MA 4LBSA 1DWIM 1T0OA 1Z42A 2V69A 3UVAA 3KLKA 3WNMA 4RPQA 2ALRA 2G3IA 2Q01A 5A6BD 3GZAA 3PZMA 5AVNA 4F40A 1PX4A 4HJFA 2YR1A 1VLIA 3PZTA 1VFOA 5J8LA 1F3XA 1NDYA 3NQFA 2FH6A 3ERPA 2RGLA 1UH2A 4S3FA 1GG1A 3KL3A 3GU9A 3URAA 1R46A 2JBMA 4I90A 1XLFA 2VX5A 2OLSA 3FHAA 1A4MA 2W63A 2OYMA 2YLAA 1MNSA 4JBRA 4KWWA 3AUJA 5I5RA 3N25A 1B3VA 4KFOA 4R53A 5BROA 3HJZA 4Q22A 3UBPC 3PTKA 2R1MA 5CPOA 3R0DA 3L4WA 2WW5A 4JNZA 3DAQA 1X1OA 3OG3A 5ABEA 3KVKA 4FXJA 3S3GA 5DO8A 1ZL1A 3BARA 4HKPA 2NUWA 4PGLA 1XDJA 3VXGA 1SGJA 1VBRA 2YL5A 3OIHA 3WDIA 1QNPA 1LQ2A 3HPAA 1OFEA 2NW0A 1QW9A 4MM1A 1SO4A 2QAPA 4LF1A 3UESA 2NLIA 3GH7A 3C8NA 4XX6A 2DP3A 2CLPA 5G5IA 4XZLX 1SW3A 4KESA 3S6OA 3WENA 1VCFA 1UWUA 2WK2A 1L0PA 1FCBA 1CI1A 3DFNA 4U3CA 4WDTA 1IWBA 4PMVA 4DWSD 2CFFA 1FWCC 1P1XA 1OCBA 5M3WA 4IH3A 4YTUA 5HA7A 4BI7A 3SCRA 4DO5A 4DI9A 4J3SA 5BOFA 4GYPA 1KLZA 2EPLX 1R9XA 3R0KA 1TO3A 2JKEA 1TV2A 1REQB 2XGBA 3MZ2A 5I3IA 4JHZA 1HKWA 5F4XA 2Y0FA 3IGXA 4X2PA 4JL1A 1JZ3A 4HP5A 1K70A 3L2LA 1YPFA 1ALDA 4RW5A 2E7FA 2VDGA 3WBWA 1GWJA 4FS9A 1QWKA 5HULA 3MP4A 2W79A 3IJ6A 2R1PA 1XBZA 3TTSA 2JE8A 1KV5A 3BCDA 4TOQA 4GO8A 3TN6A 3HG2A 3GHUA 1H5YA 4C6CA 1TPH1 1TTQA 3H2EA 5D8WA 1OY0A 1TWIA 2A79A 4PRTA 4PFMA 1UJQA 4DXKA 3RAOA 3QHOA 1E3XA 9RUBA 4GI8A 3IIOA 2G96A 5AHFA 1V0NA 3UJ2A 4EWJA 3MMUA 1P0KA 3S1GA 2ZRUA 4MNMA 2GWNA 1XRFA 1HF6A 1GYNA 3C2FA 3R89A 3RGTA 4Q6JA 4O0QA 4H9VA 1AQ0A 5FJOA 3ZT7A 3W6YA 2Y8UA 2OT0A 4N9DA 1TJPA 2GQ3A 2WZTA 3FA3A 2PBOA 1A0EA 2ZX8A 4Z2IA 3WBEA 1FQ0A 3ITLA 4FX6M 4WIWA 3BG9A 4BEUA 1KM5A 5TQLA 3CAWA 1OVDA 2J66A 1KM3A 4LUSA 3FKRA 4HSNA 1E56A 3DFHA 3NDZA 3EMCA 1ESWA 3N2XA 3LXCA 3GTNA 4Q8PA 2RH9A 5IHRA 1XH0A 2DVUA 4HHPA 3W7OA 2HNEA 3FSUA 3PZ9A 4GUHA 4RLIA 1OIFA 4LYQA 1DYSA 1TE1A 2VZUA 5K4XA 3W85A 4R7WA 2OPJA 4AD5A 5D04C 4GKTA 1HTIA 5T91A 3AXIA 1XISA 3I10A 2ATSA 4A3YA 2XN2A 4OIFA 3I68A 4O12A 4RE3A 1Q65A 3LXBA 2CCRA 3LHWA 3GY1A 4LT9A 4JQ3A 1UB3A 2CBJA 3C52A 3QKZA 4CCEA 3CAVA 1WBHA 2CLHA 3F4CA 4EKJA 2HNHA 4GI6A 1VPYA 1KKRA 3GTFA 1XLBA 2VX6A 2CLLA 2Z7GA 3VD3A 1IYXA 3UA3A 5A6AA 3SUUA 3SADA 1VCGA 2PTZA 1LWHA 1JPDX 1S2WA 1WX0A 3GDBA 2VOTA 4N4PA 2HQAA 5D03A 1ZB5A 3VNLA 5CJ5A 3M0VA 4E5TA 3QVQA 1FWIC 3MP3A 4NQ1A 1IHIA 3WF1A 4R88A 3V3WA 1K8ZA 4MOZA 3W73A 2EPOA 1TV4A 2E67A 4LAOA 1C91A 1EGMA 4AWUA 1QK0A 3F4DA 1G94A 3W4RA 3BAWA 2PSNA 4C6EA 3V1HA 4HNCA 1MVYA 2VD8A 2NQJA 3EGJA 4JTSA 1WBJA 2VRKA 5CXPA 2G4JA 4ZL1A 1G0CA 1RV8A 3CLMA 3LLDA 1PTDA 3S83A 4B3LA 2AOSA 1H7XA 2XUCA 1R85A 5C0QA 1O95A 3PFRA 1BGGA 4V1XA 1V08A 1P4CA 3SN0A 5CGMA 3T42A 3DHDA 3AAMA 1EC7A 1DWAM 5JMUA 3PUDA 4IPNB 1W3NA 1H0GA 2OQLA 4YYFA 4PBEA 3WLNA 3L2IA 5I3DA 3BLIA 2VEKA 1FFRA 1GK8A 4IIHA 3GU1A 3E0IA 4QG9A 5D2XA 1KCKA 1H41A 3N11A 1OM0A 1OYAA 3MUCA 4JYEA 1DJQA 2WHLA 4V1YA 3ZLHA 1EO5A 1ADDA 5AC7A 4GY1A 3NZRA 1K4GA 5CPQA 3VC6A 2ZKMX 3LBMA 4XZBA 5JU6A 3NOEA 1W5QA 1GJUA 1DJGA 3BICA 3GH5A 5G4EA 1UR8A 4CEUC 4ZQRA 2WKLA 4XG1A 3V0UA 1FFQA 3ATZA 3KBMA 2F7FA 1EA0A 3EEZA 1R2RA 3OVPA 3W3OA 4AHQA 3SCVA 4FAMA 4AZCB 1R6WA 5JXQA 4GNKB 3VIKA 1S2UA 2HBVA 3LQLA 4MYAA 4M6UA 4DY1A 1A5SA 1WZKA 2W5FA 3E0WA 5C2CA 3UYCA 3MUZ1 4FI4A 5A95A 4AC7C 1W56A 3CYVA 2I5GA 3W0KA 3B8VA 1KTBA 5BXTA 1ZBWA 3G1VA 3RMEA 3FAWA 3CUGA 2R82A 4C1KA 4IF2A 4YVPA 3TWAA 1FHDA 5D8ZA 1EOMA 1HP4A 2QUVA 4E3TA 5A8MA 3HQPA 5DMYA 5XINA 1XIFA 4W8BA 3KRSA 1UKPA 4AB4A 3GR4A 1EC9A 4ASTA 4AXKA 2YZRA 3CLWA 1KGXA 4X9YA 1SUXA 4W93A 1KCZA 2GSEA 1KFKA 3MI3A 4JTHA 4YJ5A 3CZGA 4S38A 1XP3A 3OP2A 3W72A 3VFLA 2FHCA 3O8AA 4PMOA 4WOZA 3H7UA 1QK2A 3LMYA 1EB3A 4Y8EA 1BF2A 4E0CA 1RCQA 3NGJA 3QLLA 3IIPA 1R3WA 2CLMA 1TPDA 4GJJA 1BTCA 2HMCA 1FWSA 2F38A 1XSKA 4J3ZA 2VGBA 1Q6GA 5BOOA 5AHNA 4GQBA 1SFLA 5LGXA 3MPGA 4KCTA 3K2GA 3VGEA 1UR1A 4L61A 3ID7A 4JN8A 4XWUA 2XU2A 3WJWA 3LHYA 2PEVA 4B16A 2WSKA 3FVDA 3VILA 4PCFA 3VMOA 3LPFA 1HX0A 2ZXQA 2Z24A 4ACYA 3AYSA 4X9SA 1ONXA 4JQ2A 3CZ8A 3SRDA 1MRQA 1ZSXA 3VKAA 1CB2A 1SW0A 1XUZA 3AZTA 3NEVA 1ELSA 4AVNA 1LORA 3GIQA 2G3NA 5HOSA 4K3ZA 1ISXA 4CLMA 3KEHA 1KV8A 3SQMA 4GY0A 1JXKA 2WBGA 2ESCA 3QTPA 2ZZ4A 4HGXA 1KD0A 1H1ZA 1FA2A 3A5FA 4JDYA 3QF0A 3PNZA 4DF1A 3GVVA 3WLTA 4NX5A 3W2JA 1EJVC 1ZCCA 4XUYA 5E6YA 4FNUA 3SN4A 2QJJA 4K36A 1ZRQA 5FIPA 1X7IA 4Z1CA 3S1UA 3G2GA 3UZXA 2FPTA 2YX0A 3VIPA 2FFCA 2HCVA 4Q8WA 4M7SA 4EVZA 4Y9NA 4FF5A 2BX7A 1J8VA 3IIXA 2VX4A 2E77A 2GWGA 1F8MA 5C8BB 2J7DA 2J75A 4DBDA 3F5KA 1RSCA 3WX7A 5A8QA 1UD6A 1WP6A 3SY8A 1E6NA 3DFPA 3W29A 4D6HA 1Q6LA 2VFEA 3PANA 3LMZA 3W2KA 1FKWA 4G7EA 2Y8VA 4DO4A 2FGLA 4OTKA 1TCMA 4YTTA 3MMDA 2JF7A 2QUMA 3HQNA 3U8GA 3WBXA 1AD4A 4R3UA 3SY1A 2ZXDA 1TJ1A 3H8AA 3VIHA 1YPXA 2F6UA 3GIPA 2QCFA 3MZNA 1TPC1 5I24A 5I0DA 4IFRA 4AZ7A 2GLKA 1TTPA 3VDAA 4GGHA 1YDOA 1X8FA 1NQKA 1R9YA 2BBFA 2B7OA 3FA5A 4LALA 2OX1A 2FJUB 1E6QM 3M1ZA 1T5AA 2W4XA 4UTLA 8RUCA 3M0LA 1E43A 4MUPA 1XF0A 3ME3A 3PTMA 3VNMA 3FGCA 5DRIA 4A29A 5AC8A 1Z6KA 4LC8A 2X1RA 2XIOA 3JU2A 3APTA 1XYBA 4A8LA 2DDXA 4IX0A 5HQLA 1BWLA 3CAKA 3W6MA 4HT3A 1E0VA 4LC6A 4XZMX 7TAAA 4QFUA 2CETA 3IK2A 1JPMA 1D7FA 1XBYA 1LBFA 5FF0A 2NXHA 3KX6A 2NX3A 4PCPA 2Q8ZA 3TW6A 3KE0A 1E4LA 4FLRA 5EKYA 1DXIA 1US0A 2VR2A 4INFA 2QLYA 1UC4A 3GKFA 3H54A 5AN7A 4ERIA 3UT0A 3ITOA 3RPDA 2WVVB 3S5SA 4J35A 1SSDA 3OEXA 1KM6A 4ECLA 1YX1A 1E0WA 1JCXA 4WY0B 4HPJA 4I6VA 4LJ3A 1VEOA 4AD0A 4B5VA 1OD8A 4CNUA 3THQA 1CXLA 2WC3A 2ASHA 1S39A 3WJSA 4HPHA 4QIUA 1O1HA 1FY6A 2A85A 2F9RA 3KDOA 3U7VA 3S46A 2XH7A 1JCMP 1TA3A 1V6VA 2W66A 3VDHA 3NCOA 3C0SA 2VGIA 1YDNA 3P60A 4PMZA 1ZJAA 1KXTA 4IFOA 2WC4A 5DXYA 3FDKA 1RVKA 4YL2A 2HBXA 4MZYA 2PFHA 3GSMA 5BNKA 1JULA 3UJRA 3T05A 4H6KA 1SR0A 4AQLA 1HL8A 1AVAA 3A5VA 1EX5A 2PCQA 3GH4A 1ONEA 3CH0A 3SAZA 1EP2A 4O15A 4LCRA 3WJYA 2CITA 5DT7A 3H2MA 1E4MM 2IKHA 1QO2A 1RA5A 1FH8A 1OZQA 3ONCA 1S2AA 5BOEA 3IGUA 4KMQA 3WQDA 3BZJA 3GC2A 4W84A 1LF1A 1DJZA 4JX5A 3G0XA 1NIUA 3KL5A 4XTDA 2PLJA 3O0FA 2A6LA 1O7AA 1JAKA 1BWVA 1K6WA 3PS7A 3E49A 4JQ1A 1R7OA 2IKGA 4RUBA 3SZ8A 4O14A 2BP1A 1RXOB 1LG2A 2PZ0A 3P93A 3N4EA 4K1GA 4IPIA 5D2WA 4MLJA 2VI0A 2FPYA 3TDFA 3LM7A 5MF5A 5LHEA 3UY8A 3OGSA 3FA4A 1EJWC 3WK3A 2PWDA 3N3TA 1DEDA 1JIBA 2QCEA 4IUGA 1LUCA 3OLDA 4EAYA 1D2KA 3P3BA 2CBUA 1DJIA 3PUEA 3G0SA 2BSLA 3K8MA 3ABRA 1WXYA 3HG4A 4JIIX 1LZOA 1S38A 4TIMA 3P80A 3LD5A 4UCFA 3SRHA 1CGWA 4ZOBA 1GHSA 3QKEA 2WCAA 1MFUA 5IM51 2R94A 4DB7A 2DPEA 5A6JA 3WD1A 4WGHA 5JQ9A 3I7QA 4ADTA 1RLCL 4YWIA 2VC6A 6ALDA 1R3SA 1FWHC 2BZNA 1M7XA 2CLIA 4GUIA 3LRKA 4MF4A 4UQ9A 1NOWA 4PC8A 4GG9A 1OT1A 4P8WA 5DX7A 1EHAA 3BW3A 3DIPA 3WJZA 1AG1O 1Z44A 3LLFA 2CWXA 3EDDA 3MHGA 4FP1A 3U2EA 3MBFA 4HPXA 4JOMA 2QDEA 3L4ZA 4OBTA 3A6OA 3SCUA 3VC5A 1KTCA 3TC7A 4CD8A 1QTWA 3N13A 1JJKA 2DZVA 5HUPA 3RIKA 3VNZA 1V02A 1XC4A 3TYDA 3UY7A 3A9BA 4JTLA 1H1NA 1SJBA 3L4UA 4ZXLA 3LNMA 1W91A 2XG9A 2V30A 4GIAA 3G1XA 3L4XA 3WDRA 1FP8A 1UMLA 3E2RA 3TN4A 1R87A 3NO3A 1KC7A 1YRRA 1A5NC 1HJSA 4D6IA 2KX9A 1KBKA 4NNCA 4W8LA 1QJWA 1IR2A 5I09A 3G6LA 2D2JA 1TIMA 4J3WA 4BJHA 2YL6A 4TX8A 4AYGA 3UZWA 4IUOA 4GUFA 5AYZA 3A4WA 1OFBA 4XO7A 1MEIA 5CCZA 4GC4A 4S3EA 3R25A 3EWXA 3M4HA 4PB4A 1GYMA 2E6AA 3A3XA 1IWAA 3N6JA 3G1RA 3BOLA 3HZ3A 5KMYA 4IFKB 3IAPA 3MSYA 1PO9A 3IUDA 2WXDM 3FKKA 4WSKA 5HR6A 3H7RA 2CLFA 3GBDA 1F05A 2Z27A 3TSBA 3CQJA 1Y0EA 3K46A 3L21A 4JTGA 4P7OA 1QW8A 3AIUA 4W9TA 4DWSB 4LV4A 4LYRA 3GNNA 3H6OA 4ATDA 3W86A 4DPQA 1XQKA 2ACQA 5KSWA 3LQGA 3DH7A 5FF4A 1QAPA 4AEFA 3R58A 5TIMA 4XQ6A 5FKYA 2C14A 2QF7A 3GDTA 5F2LA 3AXHA 1F2JA 4F0RA 2I5QA 1LYXA 4IGNA 4RL3A 5EBAA 3PC0A 2VUYA 1CGUA 1XFCA 2CXEA 4AYSA 3OO2A 1XYZA 2HJPA 5IDIA 3TOYA 1YXCA 4HN8A 4W88A 1EHNA 2AL2B 1V6WA 3M9YA 4GQQA 2YA0A 3P74A 4WEVX 2WO5A 5AC5A 3IJ7A 1KA9F 2RHGA 5CZTA 3PUGA 1J18A 2J9ZA 1E6ZA 1W0MA 1ODUA 1NAL1 3WUGA 1Q2RA 2QT3A 4HBKA 3FLUA 5CPSA 1W3KA 2GJXB 3BSHA 5JIWA 4R27A 3NL3A 1XXXA 4QX4A 3VNDA 1JG9A 3GM8A 4L6OA 3IANA 2WCGA 4WDXA 3RX3A 5TF0A 4K8GA 3QC0A 3OBAA 1JDFA 4X63A 1LT8A 1TRDA 1A5LC 3ORWA 2YDRA 3CUFA 3HGSA 3B8SA 1DXEA 4YHEA 4DUXA 3PZIA 3QPZA 1D3HA 2RFGA 3DC0A 3W7QA 3APYA 4KBXA 1RALA 4DWDA 3M41A 1TQJA 5HATA 1BG9A 1GPFA 2E9MA 4F79A 1XIDA 1W8GA 3CIVA 3K4AA 1OGGA 1TX0A 1L6FA 1BYAA 2NQ5A 4ALDA 4UTUA 3SSJA 4BQ4A 2WMIB 1SQ7A 2Z00A 3GKAA 3B3DA 3WIJA 4TVCA 5H6HA 2NVAA 3ARSA 1O1ZA 1Q4NX 3TR2A 1W5OA 3W07A 2GUYA 2ZDSA 2XGZA 1EKOA 1UZDA 2HPIA 4C1NB 4EF9A 1GOWA 2PWFA 4N4QA 3T08A 1E1CB 2O9PA 2BXVA 3CQ0A 3KRBA 2OEJA 3N3MA 3GZ3A 1LBLA 3HV9A 4PTVA 3SCSA 1BWKA 2ZX5A 2V3EA 4W5UA 4GPNA 5KZ6A 5I3JA 2V9DA 3TN5A 2J7CA 2VD9A 3QGVA 5CGTA 4AVOA 3RCYA 1QPQA 4B91A 2X1TA 2O7SA 5FESA 4H6QA 4ZO9A 2HK0A 2VR5A 4A3HA 1XLHA 2W0UA 3BLFA 1ZGDA 4DIAA 3ARXA 1N7KA 3LHTA 3INPA 1YNPA 3LM3A 5CC5A 3PPFA 4OKDA 4YWSA 5A8NA 3FJNA 3STPA 3C6CA 3DOPA 3AYVA 3HJEA 5KZEA 2WMHA 4EXQA 3KBNA 2DVTA 4EIVA 3E38A 1O12A 4XUGA 3TLQA 4UNLA 2C19A 4C6QA 5I3HA 3R8GA 3LA4A 3CHDA 1FWRA 4F48A 1BG4A 1HJQA 1R38A 2QNEA 1S2TA 3A9IA 4CNPA 3FIGA 1KBLA 5K9CA 1VFLA 1RA0A 4DPPA 5GNZA 1HGWA 3T2OA 3GXDA 3VD5A 3AUOA 3H70A 4RCXA 5FJTA 4KPLA 4P8VA 2V3FA 2XZ7A 1W3HA 4WD0A 2ZC1A 3VZZA 3AS3A 3LRLA 1AW2A 3N9RA 2YCLA 4PTXA 1LG1A 5HANA 4H7CA 4I5RA 1ZPTA 1ENUA 2ZZ6A 5CZJA 3GXFA 3BQ6A 1TPEA 1JUKA 4WKHA 4FALA 2E40A 3CUIA 1SZRA 4NZ3A 3QH2A 1XBXA 4Z2KA 3UWUA 3GNPA 2JEPA 3APGA 4O17A 4ILSA 4DN1A 3TR9A 2V68A 3WD4A 3WH8A 3T8LA 2QJNA 2C1IA 1GJPA 3VM5A 3PN8A 1L9WA 4MUZA 1VPXA 4DXVA 1VBUA 1OK6A 4QM1A 2A3LA 1OF6A 5DCBA 1GQJA 4FF7A 2AKZA 4K38A 4IQEA 2QQ6A 4GA8A 4YYCA 5TD4A 5HMSA 2C7FA 3VMPA 2DT0A 5A8PA 4Q4RA 4Y9OA 5DMLA 1KRMA 1RPXA 3NIYA 3BCFA 4I6KA 1JVNA 1E9IA 1EQCA 4F9JA 2H9AA 4GNVA 2VR4A 2P10A 3F4NA 2DSKA 4RX0A 1C8VA 4JEJA 1JUBA 2FTYA 3WNOA 3VDGA 1E71M 1MZRA 1WO2A 4NYUA 4M1BA 1L8NA 3CL6A 3UD6A 4EOUA 3TU9A 5D9MA 3J7HA 4Z17A 4KWUA 3V35A 4YTRA 2P50A 2AQOA 5EU9A 4WCJA 2OGYA 3THAA 3T1GA 5AB3A 3C61A 2J7FA 1IEVA 5C9XA 4FA3A 1OFRA 2W92A 2YXGA 2YOCA 4GH3A 4OV9A 3S5NA 3AIBA 1QR7A 1I0DA 3FV9A 4PA8A 1SO3A 3AHZA 3MY9A 1OZMA 4URIA 3NEHA 3B0UX 2Z4GA 3GXTA 1AQHA 1QI3A 2BXYA 3IARA 4HA3A 1PIIA 2GGHA 5G1MA 4I9JA 4RDVA 5LIXX 1ONRA 2VL4A 3R5EA 4IIDA 3II1A 3BANA 3G22A 3RN6A 4W7VA 1UUOA 1AK5A 1EIBA 5A2BA 1W1PA 3L68A 4GCXA 1KBIA 3BOFA 4L5ZA 3NZGA 2PCEA 2ZZ5A 2CLEA 4QJ5B 2DZPA 4MSSA 1S5VA 3EMQA 7A3HA 1R3TA 3N9KA 4LX4A 2ZWYA 4IL2A 3KS6A 1ISVA 2ZUNA 1X39A 3GG0A 1DHPA 4PB3A 4Z2GA 3GTHA 1PPIA 1V7AA 1NM9A 7REQA 2PS2A 2XDFA 2R8WA 4QDWA 3ZZ1A 3T4CA 3QC3A 4BI6A 3Q94A 1QASA 3AMKA 1Q3NA 1H0IA 5FD0A 4GI4A 4IMEA 4IHCA 2BY1A 4XKYB 3RILA 4MNJA 2J9XA 2QEZA 4HOWA 5K9XA 1GVYA 1TJ0A 2YCJA 1XSIA 1K03A 4LCSA 1QPKA 3C2OA 3KP1A 3EKLA 3TJIA 3A22A 4PTWA 4AVFA 3C2EA 3L12A 1GORA 3DX5A 3U0HA 1RLDA 2PP0A 3BW4A 1H11A 3WQCA 3M0JA 3KVMA 2WYSA 4PH6A 1POKA 4ZEPA 2PDBA 1HNYA 4V15A 2G37A 4XB3A 4QJ3B 2ZE0A 4L80A 4JQAA 1BXBA 1RBAA 3KXQA 3HPFA 4J3UA 4HCLA 1XG3A 4NZ1A 2ZVRA 3ZYZA 3MSGA 4PRRA 1JF6A 4NJJA 1J9YA 4LVBA 1U33A 2C79A 3B9EA 1PZ3A 3BLKA 2ISDA 4IICA 1V3HA 5HNTA 3NZPA 5CBIA 4XBJA 4M29A 2EHHA 3F7JA 2FZ8A 3ATYA 4GVIA 2OSXA 3TK7A 3S2MA 4LAZA 3BAYA 2G0WA 4GI9A 3FCPA 1KGUA 3DERA 4JN7A 3BSGA 4MY9A 3BL3A 4KH2A 4LGXA 4POCA 3B0YA 3KRUA 2A0NA 3S47A 5HMFA 4M24A 1RH9A 1VJSA 2VCAA 2EF9A 3PJWA 4Q6XA 2OB3A 3EPNA 3BGGA 3KHDA 3N17A 1H50A 3GHTA 2B81A 4ZQCA 4PN2A 1I8JA 3M16A 4U31A 2X40A 1UH3A 3N15A 3V5FA 2PTYA 1F3EA 2JKAA 3WQ6A 3R12A 3SUVA 2BFGA 1VD6A 3TZNA 2YSWA 4Q7IA 1ONWA 2VJXA 5JUVA 1R8LA 1CTNA 4EPBC 1RK6A 5AYBA 3AI0A 1WE5A 1ODZA 4UCGA 1IXQA 5IFPA 1YBQA 4NJIA 3UR2A 2OELA 2WHMA 3GUWA 2X09A 3IJ9A 2ZTJA 3GVQA 4DYKA 3GYEA 4KEZA 1UIPA 2E9LA 1YDYA 2BASA 2DVXA 3TYAA 1M1BA 4QJ1A 4FXFA 1GKQA 3N73A 4YTQA 5F7UA 3UZJA 3AROA 1XKJA 3BCJA 3POHA 1E73M 1RHCA 5LA0A 4OU1A 4A8NA 5BYWA 5H1WA 3CEPA 1XS2A 2WNZA 3QPYA 5HINA 3L23A 1X6UA 4QISA 2DT1A 1KR0A 5K4ZA 1TMLA 1VFSA 4TX9A 3FN9A 2WVSA 4CQBA 2AKMA 5F2IA 3QYSA 3IJLA 1MXDA 4DXXA 2Z25A 4JEQA 1PKNA 3QMRA 3PBVA 3CZEA 3G77A 4IP4A 1BTMA 1FWEC 2IPJA 4WLCA 2PI6A 4ZBCA 2JEQA 3N2OA 3KVLA 5T8GA 3IV8A 1M9HA 3ZJ8A 1KRCC 1XRSA 2OT1A 1HO1A 5HQMA 3TQPA 2H3DA 3CIXA 4WSHA 5HWMA 2QCGA 1LROA 1RP9A 5HK4A 3ZVHA 1LWJA 2WMGA 3AU2A 2A3AA 1FCQA 2VEFA 4WY0A 5CG7A 1TELA 3W37A 1S2CA 1SYTA 3LDVA 2GVJA 2GZXA 1QNOA 4LBUA 2NQHA 3VKKA 4Q4QA 7PTDA 3RLUA 3BG3A 3WQOA 1SFTA 1XIGA 4H9YA 1BYDA 3VZXA 1V4YA 3CBWA 3KS5A 4B5SA 4EACA 1QO5A 1W1YA 2AL1A 5LXXA 2XFRA 3SDOA 6REQA 4IG2A 4OECA 2O0TA 1IR1A 2CXGA 1HL9A 3IPWA 1Z41A 4EP8C 1LBMA 2QJIA 2VT0A 4C6KA 4LS1A 1W1B1 1P7TA 3NM3A 3UA4A 1H7OA 1M68A 2YCKX 3NQ7A 4U5KA 2VCBA 3ARUA 3K5XA 3TCSA 2V8ZA 2WZMA 1QOXA 3B9AA 4JR5A 2TODA 5AYIA 3LN3A 3ANUA 1SM9A 1XDMA 4H01A 1QNVA 2F84A 2CBVA 1ZY9A 2V38A 3FYPA 1L6GA 1KWKA 4GLEA 3U4AA 5EYWA 2OWWA 1Q6QA 4CQ9A 2GVEA 3CUXA 1HVQA 3AWNA 3R11A 1K7XA 3LGDA 1ZLPA 1TKKA 2J6XA 4UQEA 3NVTA 3MKCA 5KZMA 5BXRA 1GQKA 3PAOA 1HJUA 2PDMA 4Z42C 5DBUA 5CQ1A 5HUOA 4LF2A 1VAHA 3GRIA 4AAJA 1J01A 4JNMA 1UC5A 2E25A 1ITQA 1UMYA 3MW7A 3R13A 5CEWA 1FHLA 4U2ZA 3MJYA 3DGBA 3GWQA 3IVSA 4J1OA 1ZAIA 3DZ1A 4P7NA 1K7EA 3P0XA 2Z7KA 3ABXA 2VXNA 5SWUA 4FLSA 3WF3A 1FH7A 3GG1A 1KM4A 2GGEA 4ZSTA 1GVEA 4FB7A 4O4VA 4C6FA 3KOYA 1M7OA 5KETA 3ZFHA 1ZENA 3QMTA 2AGKA 2C71A 2ZZ3A 4XD6A 2D20A 2CHRA 3H4GA 4JYDA 4DNHA 1M6JA 5C2GA 3S2LA 3USBA 1NFGA 3W71A 5E5CA 2P8CA 2V5KA 1V3IA 1UWIA 1V77A 4K7YA 4ORMA 1J0IA 3RM4A 2BLEA 3TKFA 1LWIA 4DZIA 3BE7A 3GW3A 2YGYA 3N2CA 3EWWA 3EX2A 3S5ZA 3CWHA 1ZJHA 1V02E 4ZVJA 3MO4A 3MB9A 3QPEA 2ZCGA 4OFCA 3UWEA 5BW6A 1GZGA 3KZPA 1GQLA 5AHEA 4WUIA 4JTCA 2VC9A 3QY8A 1NWTA 3RR1A 1Q7ZA 2IQ0A 1ZS2A 3KTSA 2QXWA 5XIAA 4IMGA 4OT7A 4LUSB 1B3WA 4GY7A 1RD6A 4HK6A 2P8BA 1J0JA 2XM2A 5A8GA 2B0MA 2XWDA 1TX2A 4XD3A 2QUUA 1D8WA 4M8UA 5D05A 3GTXA 2P3EA 2PGRA 1P1MA 3T07A 4MG4A 5LNSA 2H90A 2ONEA 1S1RA 4QGCA 4C6IA 3SCOA 1O94A 4AY8A 3CH9A 3B4YA 1JI1A 3OYXA 2NXGA 2D73A 3USZA 1SSGA 4M7TA 3P81A 4QDPA 3O06A 3O16A 3K13A 4A2RA 3NA8A 2Y2WA 1F5ZA 2QUTA 4AEEA 3VMNA 4OZOA 2X1SA 2D0GA 3MV11 1XYCA 3SY5A 2OMAA 3NQCA 5CSUA 1BVNP 3PSVA 4U3AA 5REQA 1PX3A 4WJEA 2PDHA 4IFKA 4HTBA 2H8ZA 3H2AA 3VCCA 4CKQA 3CZKA 3LI1A 1XM3A 3VIIA 2XIQA 2ON3A 2X16A 4MWAA 3O63A 1V79A 4CQCA 2ZUVA 3C4UA 5FEWA 5T26A 4WXZA 1AJ0A 1JRCA 3I3DA 1A3XA 1OG6A 1XCWA 3OBKA 1RBOB 1A5AA 5BCAA 3QZEA 2WPBA 2A5HA 5A1AA 1XSJA 3WN6A 2ZRZA 1KFWA 1Y7VA 1S2VA 3MBDA 2J7EA 4MAVA 4PUEA 1G7UA 2X0SA 1W1ZA 4RE2A 1H60A 4UR9A 2OKOA 4ROQA 4XD4A 4AZHA 1OFQA 3L4YA 5I02A 2I9UA 1ZFJA 2ALDA 3HN3A 4I9MA 4OBRA 3B03A 2WV8A 4EE9A 2JKPA 2VOMA 1MEHA 5CSYA 2R1LA 3REQB 2OZ8A 1XW8A 3KOWA 3WUFA 4C1LA 2PB1A 3VX1A 5DRCA 5C71A 2VQUA 3GUGA 3W76A 2ISSA 1XC6A 5LYRA 1VB9A 2QIWA 3RMJA 3WH6A 4PMNA 3EBVA 1TV8A 3AU6A 1VBJA 1YKWA 1TV7A 3PZQA 1NELA 4LB4A 5EA9A 1VBGA 2EG6A 4QAWA 1VFTA 2PBGA 4RZ4A 4GHRA 4NNAA 1TPFA 5HBFA 5RUBA 5JBDA 3SRKA 4LANA 1H7PA 1K3UA 4AZ6A 2INZA 2P88A 1TFVA 4GZEA 5CSSA 3GC4A 2IKIA 2O55A 1B3OA 4CCDA 4TUFA 1C7TA 4C6NA 3H21A 3R94A 2TMDA 3HFYA 3WLJA 5H8PA 5BRBA 1PX8A 3FNDA 4L7ZA 3UVIA 5HJYA 3TZFA 2R24A 2QDGA 3R43A 4CD4A 4GE8A 4RW3A 4NUWA 3EX4A 3TYCA 3WLMA 4BF5A 3VKJA 3BV4A 3MUAA 3VOCA 1ICPA 3N9SA 1JZ4A 4J3TA 3SO7A 3MCNA 2C0AA 2X1UA 4HYRA 3E2VA 3FVMA 4WOQA 4F0KA 3TMQA 3G1AA 3WNLA 1RJPA 1DE5A 3OLIA 1E1CA 2ACSA 1PYFA 4IIEA 4RDZA 1B90A 1RVGA 4IOTA 4KWVA 3KM8A 1ITUA 3P8IA 5E0FA 3DCPA 4UBPC 2HS6A 4GVGA 3NPUA 1VKFA 1E9YB 1JGIA 3W1QA 1DIOA 1E6RA 2Z1XA 2O4MA 4L56A 2BVTA 4TXEA 1MUWA 1QNRA 2QMKA 2TSYA 3BLEA 5IBXA 4OWGA 2ZVIA 4KIRA 4Y90A 3DYMA 5A6LA 1UA7A 1VZWA 2PAJA 3AIQA 4GISA 2GSHA 4FR6A 2GVLA 4HZ8A 2EPMX 3AOFA 2VEPA 4LXFA 1DWGM 2VMFA 5LGZA 4X0NA 3W1RA 3A4XA 1U5VA 5I00A 4NT0A 1FWDC 3EB2A 4S3KA 2I5IA 2I9EA 2POTA 4NXKA 1J6PA 3BAIA 2Z26A 3GNXA 1BEUA 1L6WA 1DJHA 1VEPA 4X60A 1P43A 1EC8A 2V81A 2YCEA 4KEMA 3OZYA 3BJTA 3UWQA 2YBVA 5JBFA 2Z6IA 4L4MA 3RXZA 1OYBA 3EKZA 4PCTA 1R3YA 3AS0A 3DKLA 2V67A 3R8RA 4YN5A 1EF2A 4DLFA 4ERGA 4LUJA 4N7QA 5DY3A 4HMNA 5KZDA 1C7SA 3OZPA 1PKYA 1M03A 3RF9A 4F0LA 4J5NA 4I9AA 3TXVA 3DENA 4YS1A 4A22A 4O10A 4UTJA 3FOKA 3RX4A 3N1AA 2FB2A 1TG7A 2C91A 2NSOA 4UTFA 1WKYA 3OODA 3VZYA 1YNYA 1UH4A 1FXQA 4JYFA 2Q6ZA 2Y4SA 1G1YA 1OB0A 1RD5A 1TPVA 3G1HA 3GR7A 4MVAA 3D46A 4DJDD 1BQGA 4UFJA 5E70A 4MWAC 4X2RA 4B5WA 3LUTA 4G7EB 3SUSA 1BAGA 2E1DA 2V2HA 2PDCA 5I79A 1TMHA 4DWSC 4HMCA 1LOSA 1HT6A 3I3EA 2UV8G 2A7NA 1OG0A 4JXCA 2DJXA 2V63A 3WBAA 3RDKA 3ZXWA 2ZC8A 3VU2A 4EPDC 5EMKA 3OLEA 4MTVA 2Z6JA 4MMWA 3TOPA 3WDJA 5I6SA 5EMMA 2J7GA 2WSQA 3GHRA 2F2KA 3LHZA 3OZMA 1E6PA 4D6EA 1QW7A 3L66A 2GQ9A 3JZUA 3UJSA 3TYUA 2DW6A 4LUTA 2GK1A 1DHKA 1A4LA 4WVXA 1EJRC 1Q6EA 1HQTA 1WCGA 3GFZA 2FZDA 2R14A 1QVBA 4LW7A 4JTIA 4N02A 2C3ZA 1JUEA 4GNJA 1GEHA 4WGXA 4M80A 5F2MA 2E68A 2Q02A 1OFOA 4R33A 2I16A 3Q58A 1JF5A 3U5UA 3WLPA 4BWLA 4GVFA 1I75A 2GDVA 3S9YA 1JXJA 3LCLA 4RZBA 4BEQA 4JTQA 2ZUWA 2DGAA 1J5SA 3Q4DA 3AXXA 4B2DA 2KZHA 4O8RA 2DSZA 1PTAA 3EA2A 4N9EA 2E5BA 3TAKA 1UKQA 1PXGA 2XISA 3LCXA 3W22A 2H3BA 2YYTA 5A6KA 3UPWA 4OVXA 2L5HA 4IISA 1W32A 1EOKA 1QNQA 3QY6A 3DXIA 1A47A 4BHYA 4S2BA 1Q4WA 2Z1SA 3V7PA 3THDA 2Z28A 3HU7A 4FOUA 4RNFA 1I1WA 3ES7A 3WEMA 2FZNA 3M07A 3EA3A 1Y8BA 1QMLA 2XVGA 4ZOEA 1KQZA 1HJXA 2FTWA 3EPMA 3H7VA 1SZNA 4N9BA 4MB3A 1E51A 2BOEX 1OCQA 3GHSA 3LSCA 1O68A 3RM8A 1FXPA 1TV5A 4D8LA 3DG3A 3GDRA 2ANUA 2A21A 3EDJA 3PSWA 4E8DA 5FL1A 3LV6A 3SECA 2V6AA 2XYLA 4TQTA 4F0HA 5CH9A 4O11A 1W17A 1E9LA 4DO7A 1KXVA 2D0HA 4TTUA 1F76A 2PF0A 5AHIA 1X7FA 3KZSA 1KCXA 3AIWA 1DJYA 3ARWA 3QY7A 4HU4A 4NNBA 3B9OA 1FH9A 1J0ZA 4LEQA 1ZTVA 4C90A 2VTFA 4K39A 3O6YX 1CXKA 2DUXA 1PEZA 3PWGA 1LLWA 1VEMA 1QXLA 5C70A 3W1AA 3NL5A 3CNYA 2DH3A 3VDCA 1FWBC 2RGMA 1W54A 4BK9A 1ZJIA 1Q6FA 1S5TA 1XYLA 3SURA 4PEEA 5FACA 4IJCA 3W7CA 3VIMA 1CECA 1UWRA 3OLGA 2ZRVA 4RPPA 3MA8A 4CNNA 1X96A 3QSRA 4Q4PA 1C3FA 1LUCB 4HIBA 1SO6A 2J8TA 3ONBA 1BKHA 4BQ3A 3CV2A 3A64A 3RFAA 3W01A 1DL3A 3C56A 1KXHA 3KCLA 4QEEA 3WJXA 1TPWA 1FDYA 5D2YA 2NQZA 1GPWA 2QGHA 3DFOA 3AZRA 1XUUA 5GNYA 1JZ5A 1DORA 1OX6A 4ZCWA 3LENA 4MB4A 5F1VA 1DIKA 4AU0A 5D2VA 1V6UA 1J4EA 4R9OA 3U2CA 1AW1A 1KQYA 3LCWA 3IJ8A 3F03K 2PTXA 3WL0A 3GX9A 5H8MA 1DTNA 2NV2A 1NDZA 1UBSA 5HJXA 3I4EA 3N34A 5AOUA 1F3TA 4HZ7A 1QPNA 3EOLA 4GK8A 2ZXBA 3VNIA 3QGAC 4P5UA 2E09A 3T40A 3W9ZA 3COTA 2EQDA 2CWNA 4WZHA 2X7WA 3WLLA 3W88A 3VCRA 3TYEA 4O1EA 4A3UA 2EPNA 2FVMA 5C9WA 3WLQA 1ICSA 1W3LA 4KRTA 3I6TA 2E5CA 2V3GA 2ZXAA 4RZ5A 4H3DA 4WSJA 1R30A 3VKCA 3M5VA 3W23A 1XIJA 1QWGA 1NP0A 2A3HA 4MY8A 3LCGA 4KWOA 2FH8A 2YXOA 3E9AA 3RRAA 3EDEA 1K9EA 3FYOA 3PBMA 1TCDA 1FVPA 5IDZA 3G1YA 3LG3A 4JS3A 4JX4A 3GFXA 3W53A 1WOAA 4AW7A 2NLYA 3NR0A 1ZQ5A 3AFBA 5DLCA 1MNZA 1KB3A 4DUWA 5A2CA 3RK8A 3I4KA 2CZVA 1Z32X 2PWVA 2GGGA 4Q4OA 3V4BA 3KHJA 1QBAA 3FJ4A 3BAXA 3N6QA 2GGJA 2QAFA 2PDKA 2PGEA 3WQEA 4PUUA 3PBUA 3R2GA 1KKOA 1VYPX 1G6CA 2OO6A 2IUZA 4IM4A 3MI6A 4Z0SA 4IPJA 1UJPA 1HGYA 4CU7A 1OYCA 5CBJA 1ZALA 4PBGA 1XCFA 3WBYA 3NYZA 3MP5A 2VFDA 4B4FA 3PAJA 1E9ZB 3BO9A 3ZT6A 3QBUA 2WKGA 1GVFA 3PZVA 4PUWA 5DCEA 3ZSSA 8CGTA 4G2DA 1J79A 5HNNA 3IK4A 1GVSA 5MKGA 5M5DA 3LCHA 4Q32A 4CN1A 2OZTA 4MWAD 3VINA 1VFHA 1MWOA 4NSBA 1FWAC 3EYPA 4OQVA 4HZ6A 1PCKA 4XZWA 1LLZA 5IHSA 4HSOA 1OGSA 3IRDA 3CB3A 4LV9A 4TR9A 3CMJA 3NTYA 1K9FA 3VD4A 5FI8A 1JYWA 2WAGA 3UR5A 4HTYA 2E8YA 4H9ZA 4AIOA 1NOFA 4DO6A 1R0MA 1KBJA 2QUNA 5KTLA 1CXFA 2D22A 4QQUA 1XV8A 3GAKA 3LXAA 1NFBA 1VH7A 4LAMA 4H1ZA 3FEQA 1EP1A 4H9UA 1GVOA 5H91A 5ABHA 5I03A 3A3HA 2X0YA 4F3HA 3ARTA 1Q8AA 2YDQA 4O1FA 3W7RA 3N2TA 5FF3A 1EBHA 3WEOA 1AJZA 2Y6ZA 4BF7A 4GZIA 3CGTA 3UGRA 3QV7A 3VO0A 3WLOA 3PG9A 1QNSA 2O4QA 1KM0A 1TR1A 3EA1A 2VVSA 3BH4A 1PTGA 5GVJA 2ACUA 1XLCA 3WK1A 1RP8A 4IPPA 3TYBA 5AYXA 4JCMA 1A53A 3WD0A 4GJIA 4NG3A 1AQMA 4DZAA 3QHNA 4GACA 4I5UA 3WF0A 1A3HA 4HJWA 1XHGA 5FJJA 5A8OA 1D7KA 4EXBA 2OX4A 4CNTA 4CVWA 2AQWA 1WDQA 1Z48A 3E2QA 1R9ZA 1Z69A 1GKRA 3AIVA 3CPGA 4P7QA 4C91A 3O3RA 4M6PA 2QV4A 3M0IA 1UR2A 1VHCA 1MZHA 3ZQ9A 1TPUA 3Q37A 1GW9A 4JAWA 4GH1A 3S42A 2EAWA 3PZOA 4QSHA 1ZNNA 5FEZA 2WMKA 3CZJA 3Q65A 3EOUA 3GAYA 2VDIA 5IFTA 4Y9AA 1YPIA 1RK5A 3Q45A 1Q7MA 2P5NA 3BTNA 4UMBA 1L2QA 3CUHA 1U2YA 3V16A 2GUBA 3LEPA 4U4MA 3WO8A 4F2UA 1EO7A 3PJUA 4O4WA 3WK0A 2DU2A 2F6XA 3L0KA 2VZSA 2Y7GA 1J96A 4FPSA 3B0XA 4B9YA 3K4DA 4QEHA 2GDQA 3ITTA 1MI3A 1U83A 3TEVA 3K30A 5FAGA 2E28A 2OXNA 1HJWA 3AALA 1KFEA 2UY5A 4JQ4A 5CAKA 4TV5A 4XSLA 3UEQA 1TYGA 1IWPA 1B2YA 3QXBA 4MYXA 1G69A 3B97A 1E1EA 1G9HA 1KW1A 4LH8A 2HXUA 3GNOA 3BUVA 4MWAE 3MHFA 3LV5A 3DEQA 3P14A 3RCMA 3Q2DA 4H7VA 1XLJA 2NWSA 3FDGA 5AKQA 4Y6GA 4JIEA 4EAMA 3I6EA 4KRZA 4ZOCA 3VKDA 3NQ2A 3UGVA 3IIZA 4IQJA 3EXRA 4UIOA 2DH2A 3HQ1A 1R3VA 3WQPA 3STEA 4MZ8A 1GZ1A 3WDHA 2QW5A 4O1BA 1E40A 4REQA 2YL8A 1NF0A 4UZSA 3M7SA 1T41A 2YCLB 4L4OA 3IUIA 4PMUA 4A2SA 1F61A 3WQGA 3T7VA 2VNCA 1O6IA 3D0CA 1MXSA 5FOOA 1FUYA 4S3BA 3W1UA 3GNDA 3FS2A 4DUOA 2FHFA 4KS0A 3CWOX 4H8HA 3ZIZA 4YVXA 1KFLA 4AWTA 1R3RA 4O18A 2XSBA 2CU0A 4FOJA 2J77A 4GGBA 2QJMA 1V0LA 1Q6RA 2D0FA 3REQA 1Q2SA 2ODOA 5LNWA 3CUZA 2X05A 2R1KA 4N9CA 4IP7A 2A3CA 3DHUA 3C2YA 3W7IA 3RJYA 3QJAA 3EX1A 1CLVA 2FHBA 4A4AA 3KCOA 1JQVA 4C7DA 3GVGA 1B9BA 3O9NA 3ZR4A 4YVVA 1TZZA 1Y5VA 1AMKA 4GC3A 2H9AB 5DEZA 3VNKA 2WQPA 3GDKA 1R3QA 2FVLA 4GQ0A 1TJRA 4NY2A 3DI0A 1DV7A 1FKXA 2XPKA 4DJFA 2FKPA 4TU1A 3NJ3A 4L9ZA 3WSUA 3HOJA 4GYJA 2G50A 4LNCA 2J8GA 1ISYA 2BHYA 3WLIA 1UUMA 4L6HA 2Q09A 1FHUA 1GT8A 2X0HA 1J6OA 4UFKA 3M0YA 2VO5A 1JL8A 3LSBA 3PJTA 4M56A 1SR9A 4C6LA 3QQWA 5U4NA 3V1PA 1I4NA 4XIAA 4GYPC 1LCOA 4QE5A 1EQPA 2PE4A 3GXNA 5BMWA 1EJSC 2GOKA 3QFWA 2X41A 4KT2A 2XN0A 2V5DA 4WK9A 2VEIA 3VX0A 1KRBC 1MSSA 1EDTA 1EJ7L 1BSLA 3L7RA 4H04A 4ZFCA 4ZE4A 2GGIA 3TYZA 3UNTA 4X61A 4AD4A 4NJKA 2XIBA 4H6EA 4UMCA 3B06A 2HV5A 1QHOA 4DRSA 3BLDA 4D8ZA 1WZAA 4NJHA 3OVGA 4O13A 4N0RA 1R2SA 2WNWA 5DELA 4DM1A 4IT1A 4EPEC 5D38A 1F8IA 3WFAA 2CW6A 1E72M 2WSRA 3DDMA 4PR4A 7REQB 2YXXA 4FX7A 1JNDA 4QR6A 1XBVA 4S23A 3CS2A 3O1NA 2W61A 4LY8A 1UHVA 4ZTXA 5F2GA 3ARVA 3H2OA 4WRHA 4K1WA 5E9XA 1A5KC 4LWWA 4B2DD 3RO8A 2QCNA 4WY0F 3HF3A 2ZX6A 4EPKA 2VVNA 2ICSA 2GJNA 5GJPA 2XVPA 6XIMA 3W7HA 2YB1A 2R9RA 1QPOA 4TX6A 5D37A 4YPJA 2QZRA 4EK7A 4HHHA 1UBPC 3LNPA 3VE7A 3E0VA 3MKVA 2XSXA 1ZP3A 1NU5A 4HN4A 2CKSA 4DBSA 5FA5A 3SEPA 4WJXA 3UJEA 3RUBL 1BYBA 2DQWA 2Y8KA 3VIGA 1QCWA 1V0KA 4F8XA 3A4JA 3AXMA 1BQCA 1QI5A 1MQPA 3G6MA 2Y88A 2ZE3A 4D72A 1KLYA 4N2YA 3W24A 4K68A 2PDXA 1P6WA 4OUEA 1TTIA 4DYJA 1B30A 3TFXA 3BAJA 3AS2A 4Q3MA 3VGFA 1ADSA 4WDUA 3NO5A 1YIXA 4XAFA 4HZMA 4PMDA 3TVAA 5D09A 4E4FA 4KGLA 1TMQA 1F4AA 4CD6A 1XYAA 4HU8A 1J0KA 2WZEA 1BGAA 1N8WA 2DIEA 3UETA 4NAFA 3WD3A 3NAVA 1JFXA 2NVCA 1IZKA 4LRTA 2YPIA 1Z7AA 2CIPA 2IQDA 1A49A 3NDOA 1HKKA 3NL6A 4XAYA 3BLPX 4PTMA 4BR1A 3E5BA 1GOMA 3TSMA 3NWRA 1W9DM 3XINA 3R0UA 5CPLA 5T9CE 4I7WA 4FNRA 9XIMA 1OCJA 3NPWA 5FF7A 5FJRA 3MC5A 5BWFA 3LHVA 2WZIA 4LYPA 4NZ5A 1RPKA 2WNQA 3GS6A 5EB8A 2X2GA 2QCCA 3OA3A 1M3UA 1C9WA 1E3ZA 2GJLA 2DZWA 1IXPA 1VBHA 1CGTA 2QJHA 1O5KA 1YBQB 3E3HA 4RJEA 3GDLA 1DJXA 4JFSA 2YFOA 3GG8A 1N2VA 1MW3A 3UG3A 3MI2A 1TUXA 1M01A 2QULA 3VI2A 3SFWA 1G4EA 1WUEA 2HE5A 4L1XA 4E6MA 2IKJA 1V8EA 2B7PA 3IIVA 3S1XA 3ABOA 3CJPA 2D2OA 3F2CA 2YDSA 4XISA 2AMXA 4AZ5A 4FXRA 4PEKA 4J28A 4JHMA 1CXHA 3VPLA 1PHWA 5C54A 2PGFA 4HYWA 2JALA 4A6GA 1RUSA 3MDWA 2R6OA 1UP3A 1H7RA 3AMCA 1LL4A 4O54A 3TV8A 3PBWA 3SCQA 2UZ9A 1DJWA 4JX6A 4W4QA 3STCA 3CL7A 1HFBA 5GJNA 1J5TA 1EDGA 6TAAA 3CV1A 2XFYA 2G3MA 2Z2AA 4MADA 4H2HA 4I7UA 4AZGA 2CYGA 3SB0A 3O6DA 2QPUA 2MANA 4QG6A 1IEXA 3RPTA 4DZ5A 2XH0A 1HKMA 2D3NA 2CHOA 3ZVHB 3MCMA 1HZYA 3SW6A 3CC1A 5F1UA 3B8TA 1EPXA 4PSRA 2BHZA 1RCXB 3T2PA 1J2WA 3W1PA 4BZYA 3PFMA 3URNA 1JDCA 3BJFA 1NH6A 2YW3A 4ICMA 1CDGA 1XI3A 2FZMA 1TWWA 4DLMA 1BLIA 2HK1A 2VC5A 4AISA 3VABA 4DUVA 2P0OA 2HVOA 3EOSA 1MQQA 4JPGA 4HOZA 2W6RA 2I17A 6REQB 3M5XA 4IG2B 4Y2WA 1H3GA 4AX7A 4XZNX 4KEUA 1W6TA 3GXMA 3ARRA 1P0NA 1P7TB 4AMAA 4MJ2A 2GVGA 4UFMA 4UQCA 3ZWTA 3TROA 4JTTA 1W9PA 4NHVA 1DQXA 4F2TA 3PVFA 4R7JA 3RG6A 1S5NA 2G41A 4GYKA 1YW1A 3EWBX 1GVRA 4Z0JA 3IRSA 4LB3A 1V0MA 2VUNA 2W3ZA 4PSPA 1W9BM 5G4HC 3HPXA 1GNXA 4ZO7A 3T2QA 3WQ4A 3WEZA 1VHNA 1CCWB 3NURA 4MB5A 1I60A 3PB0A 2GJPA 5HNUA 1IE7C 1TREA 2VGFA 3FJ6A 2YL9A 2REQA 3P8JA 3SGUA 5B80A 1XH1A 1TR9A 3ABQA 4CNSA 4G9PA 4JFUA 1MW1A 3EX3A 1L2UA 1B3XA 4MIMA 5DXXA 1Q7QA 1VRXA 5EMJA 4YU1A 1GYLA 3NQGA 4E8GA 4HQVA 3G8EA 1E0UA 5J04A 2Y62A 4DZHA 2EGZA 5E93A 4LAKA 1EF3A 3T4WA 2WJDA 1K77A 1SW7A 3UPMA 4NZJA 5KINA 3ARYA 2CEQA 1YYAA 4HYVA 1T96A 3UG5A 1ZHAA 1V6TA 3T6CA 1X97A 2CNCA 4ZQMA 2OJPA 4QRNA 3A13A 3LHUA 4BKNA 3OW1A 2RDTA 3BLLA 2VRJA 3R79A 1KXQA 1H7WA 3BV7A 4PTDA 4DF2A 1DWFM 1JZ2A 1OIMA 3QHMA 4CVUA 2A3BA 1UR4A 1P48A 2YLLA 3UXDA 4MPQA 4Y8FA 1UOKA 3MV01 3BDKA 3KOFA 4UQDA 3SSZA 2BV9A 3CQKA 2WHKA 1JD7A 1VJZA 1Q13A 2NX9A 5K7JA 1UPMB 4DM2A 4XAPA 1CLXA 4ACZA 4PMXA 2X2YA 3L9CA 4MKVA 2JGYA 2NSXA 5F4SA 1QUMA 4QS6A 5BZAA 1XG4A 4UR8A 5E6ZA 2VFIA 1EJXC 2V5LA 1JGMA 1MMFA 4XAGA 4P8XA 3TLLA 4AY7A 6PTDA 1VJIA 4S1FA 1W3JA 2GFTA 3WQ5A 4H8VA 2E5DA 5J5DA 3TTOA 1US3A 1FP9A 2FGBA 3TQ0A 3U9IA 3W27A 2E8ZA 4S3AA 1HIZA 2PLMA 4UFHA 4BA0A 5CJMA 2C1HA 4OHQA 2INFA 3SQSA 2EXOA 3CO8A 1EXBA 2HDJA 2BVYA 2PDYA 4JTJA 3CV6A 5K9DA 1QATA 3HGRA 4NYYA 2YA1A 3EPOA 3L4VA 1EZ2A 1XLLA 2JQXA 5CPTA 1H63A 3SUWA 2V2DA 1HXJA 3L5AA 1HL2A 3S2NA 3UXAA 1D9EA 1SFSA 1KRAC 3T0TA 2DSWA 4UNKA 3DBNA 1XX1A 2I7GA 1AUSL 2Y61A 4ICNA 2NUYA 4DBWA 1W3IA 1NOUA 2NQ9A 1Y5WA 1SMDA 3B8IA 4MFEA 4B5UA 1IGWA 3NQVA 2ZWZA 2Q71A 5REQB 4R34A 1GCYA 3NQBA 1U5JA 1JI2A 1FDJA 4FIQA 3KBWA 1W1IE 2C16A 4JY8A 4NRSA 3K8LA 3T9PA 4EX4A 4JIHA 3NSXA 1DE6A 2WC7A 1RQBA 4MWAB 4C6OA 3DFYA 2J74A 1UUQA 1B9ZA 4ZENA 3RITA 1GOQA 1V03A 3PTQA 4RNHA 3VGHA 1EYEA 8XIMA 4CUCA 3EWDA 2XWEA 3FJLA 2QCMA 2XFWA 2J7HA 1UG6A 3AYRA 3S5YA 4U28A 3QSTA 4H9MA 2VURA 1YNQA 4LCQA 2FPVA 3AQUA 4A05A 3OIXA 2FMOA 4IL0A 4I7VA 2DSVA 1OK4A 4ZO8A 3NXLA 1R47A 4UC5A 5U7SA 2OODA 4JL2A 2HS8A 5AZ1A 1WDRA 2Q3RA 1NWUA 2ZBTA 3UWVA 4GXPA 2ATMA 2C8NA 2Q8XA 2Y63A 1K1DA 4ZSUA 1VP5A 1EWDA 1PIFA 1UQYA 1YEYA 4PUKA 1IIGA 2QJGA 2NX1A 5HWNA 3IJQA 5AY7A 2BMBA 3CMGA 4WHBA 2OOFA 1FRBA 3MSDA 5C7VA 4IZGA 3AMGA 1LT7A 2HISA 3FYYA 3VYLA 2I57A 3TTQA 3LTSA 1Q5MA 2E6YA 2Y7FA 3M47A 3OB8A 4ZB5A 4OV4A 4PTNA 3VIOA 4QITA 3SBFA 4CD7A 3EB3A 4QQ3A 1DOSA 1GOKA 1JCYA 1GOXA 3ZR6A 3C0QA 2CLOA 3UP8A 4AZIA 4DHGA 4RV3A 3WUEA 2BWGA 3OU8A 1ZBVA 4XIMA 4B90A 1NARA 3N6HA 3QZ6A 4Q7NA 4DJFD 2ZQ0A 3ANYA 1W1TA 5A94A 3VFCA 1MEWA 4ES4A 5I2UA 4AY1A 5IXEA 3FX4A 4PFHA 3ZSTA 1C29A 3MSRA 4FNQA 4X0VA 3NGFA 2NV1A 1POJA 4S2CA 1XKYA 4ZFMA 1VRDA 4ICCX 1FOBA 5T9BG 2BB0A 1ECEA 3H2FA 4B3KA 5H2ZA 3NM1A 1I0BA 4LVAA 4HPGA 5XIMA 1GHRA 3M6DA 3QYQA 2CBIA 4JKMA 2PRLA 4J2PA 2WBKA 3N4FA 2O9OA 2Z1VA 3P62A 1A0DA 2GSJA 3UXIA 2A1YA 2BVWA 2WLZA 3IJDA 4Q7BA 3CQHA 3PPGA 1KNWA 4H8NA 4EWND 4ZQNA 3OBEA 2QDHA 2PWHA 3CPRA 1CXEA 1NP2A 3DFQA 3PWIA 4GO9A 4IX2A 3TTYA 3LCIA 5FCZA 3CO4A 5HMEA 4U10A 1W8SA 3STGA 4JKLA 1KFBA 1YE4A 4AH7A 4I8DA 3CT7A 4XZ9A 5LNUA 2BODX 4UTHA 3Q67A 1JZ7A 4ZGYA 3ZT5A 2NQLA 4NAEA 2WOQA 1Q6DA 3EKGA 4AEOA 4C6PA 1IT8A 3WDQA 1Y5XA 4DJEA 5EPDA 3GXPA 1SJCA 5AECA 3CXOA 3UXKA 4AF0B 4FXSA 1HKJA 4XVEA 3CHVA 3TNBA 3FSTA 4J27A 1RJQA 4O0ZA 4Z2HA 4JCLA 4AIEA 1S3TC 3JR2A 4FSAA 1OSEA 4WQ6A 3W38A 3W81A 1G7VA 4CCCA 4W89A 3CK5A 3KTCA 3P84A 1ML1A 3DBPA 4C7FA 1UYQA 1N82A 4NJGA 5D32A 3E0FA 3S9ZA 3DESA 1JFHA 3BQ5A 2P0IA 4L6DA 4NZ4A 4PZVA 3V5OA 3W1XA 3A47A 1TRIA 3CWNA 4KKXA 2DT3A 1ZAJA 3WFZA 4DAIA 3GK0A 3H53A 3P5YA 1S5WA 3ARQA 2DUAA 4JD4A 4WDWA 3BC9A 3SCWA 3IAQA 4LRSA 2W9MA 4IJBA 4LS0A 2GVYA 3KWXA 4UB9A 1OF8A 4J7RA 3C5QA 5GPRA 1VLWA 4J9JA 4V2XA 4IGSA 4O1CA 1F73A 4PUDA 1I1XA 3VD7A 2YB4A 3D3AA 2PDLA 4H4IA 3RLGA 3WFLA 3UQNA 1CW2A 5EMLA 1B0IA 3N12A 3KVJA 2ZADA 1I2PA 3H55A 3O05A 3GIYA 3LGGA 1JPHA 3CL8A 1BSIA 3WMCA 2FZ9A 3CTLA 1J2BA 2BOFX 1M53A 1E1FA 2BG5A 5BRPA 2XHYA 4C6MA 3T0CA 4BQ5A 3UWZA 5D2TA 2IXVA 1EP3A 1N8FA 2VZVA 3TW9A 4O16A 2GUUA 1FWWA 5A6MA 4L1GA 1RJRA 4B92A 4LUTB 2GK1B 5B7ZA 5ABFB 2A4AA 1BFNA 3C8FA 2OQHA 5AC4A 1TSIA 1I45A 1GOOA 4UXDA 3CHCA 3ENLA 1BD0A 1K8YA 1UW9A 1PE1A 1W2VA 5JBEA 3OQ8A 2GOUA 2E9BA 1MDRA 3M64A 2DEPA 2FDSA 2PDFA 3GE7A 1UKOA 1PWLA 3W6LA 2PLKA 2OU4A 3UXLA 3WDPP 2VWTA 1Y65A 1WDPA 4JFTA 4ZR8A 4HNTA 3EZ4A 4PRWA 2XVNA 3WMSA 1I2OA 3CB8A 3AXKA 1XIHA 5L9FA 3BG5A 3TH6A 3LTPA 1TQXA 3NDYA 4ONVA 3ITYA 3ALFA 2ZZ2A 3RR4A 3K4WA 4S3CA 4PMRA 4UFLA 3N14A 3OZOA 4PUJA 4HPNA 3S0CA 2DZTA 2QCDA 1M7PA 1OABA 4AUBA 3D47A 3KW3A 4CGTA 1RQEA 1K8CA 3OVRA 3I3BA 4RDWA 1OCNA 3U48A 3BVJA 3V0SA 4P61A 2ZA2A 1IZCA 3KL0A 3VUPA 2EPKX 1T7LA 1XYFA 3EWUA 4QJ4B 4L64A 2ZRWA 1WB0A 4UTKA 4PB5A 5HQEA 2O92A 4CCZA 4BF9A 2WM1A 3GFYA 5HR7A 4JIQA 1PHQA 3WMBA 2OKTA 1WAWA 1JDEA 1BVWA 3MWCA 4HA4A 4GOAA 2OYLA 4WXYA 2QCLA 5CC7A 4YCOA 2WM0A 3C0JA 5CPNA 2PP3A 1OINA 1ISWA 3TMLA 3W25A 1VIZA 4YCPA 1WA3A 5FJPA 3MUIA 3LYEA 4MJ4A 4UZUA 5ECUA 1B1YA 1C8QA 2BGQA 5A6SA 3SN1A 4DELA 6ENLA 2PODA 5HXMA 4R7OA 1V6YA 3W1MA 1SFJA 1JYXA 1LRQA 2BTMA 1MFVA 1I2RA 1J10A 3F5JA 3BPWA 3TCEA 3ZJ7A 3HB9A 4K37A 4AIBA 1EJUC 4DJDA 4O19A 4LUYA 1H7NA 1XD1A 2C15A 4D1IA 1WKDA 4W86A 4QLJA 2DJLA 1E4IA 2PRHA 2Q8LA 3G0UA 2Y1HA 3HURA 5CC3A 2A7RA 4FIRA 1PKLA 4DQWA 3PBYA 3M43A 3K1DA 1X1NA 4AMCA 4M6QA 4DJEC 1PUDA 1OX4A 4NU7A 1U1JA 3H26A 1XIBA 1EDQA 4GJ1A 4Z1YA 5BU6A 5BXPA 1BVZA 5I3GA 2OZ3A 3WUBA 1PSCA 1CGVA 1B54A 4Y9MA 4O28A 3VA8A 5LNVA 4JN6A 1H61A 1MYRA 4O1DA 4IWWA 3FFSA 3AWOA 1WXZA 1TWSA 3ES8A 1GVQA 3NYDA 1HKVA 1XLKA 2O7QA 3NQAA 3WNKA 1P0DA 4JZ5A 1NQ6A 4XBSA 4IGHA 4A35A 2R1NA 2YW4A 2PDQA 1U30A 4G7FA 4JTKA 4D2JA 3KUMA 2ZX9A 1AA1B 1WKEA 3OQEA 3TJXA 1XIIA 4E8CA 1B4EA 4O57A 1IT7A 1KO0A 5D33A 3EOEA 1G67A 5E1QA 2PP1A 3OHMB 2CZEA 1X6LA 1GW1A 5TNVA 3MUXA 3DG7A 5LHFA 1SZFA 4UWMA 2NXIA 3PJXA 4ZA0A 5C6MA 4OJYA 3WH5A 3OHIA 5FF2A 4B3ZA 1NEYA 4JGDA 2HZGA 3V75A 1PV8A 3CT2A 1E15A 3OGVA 3UPBA 2VWSA 3B9NA 3S9IA 2J27A 4GUJA 3GBEA 3IACA 4GWEA 1GTEA 3W1LA 1XQLA 1ECQA 2DQXA 2EG7A 3F2DA 3CAQA 4LUIA 4H2CA 4O52A 3W00A 2QVHA 1B31A 2G97A 3MS8A 4HSHA 1LL7A 3KCJA 3WNPA 2AAMA 2A7PA 3KOXA 2OCZA 3WZ0E 3ABZA 4UUIA 4JHOA 3M6YA 2ZOXA 3NVDA 3BW2A 5CGQA 3BMXA 4AFYA 4W8AA 4CQDA 2EPHA 3NO1A 2IPGA 3RHGA 2YDAA 1H49A 4L4LA 4Z2LA 1UZ1A 3C2RA 4IMAA 2WMFA 4S3GA 3FAXA 4FNTA 3HMJG 2XVLA 3M46A 1FBAA 2DW7A 3L4TA 3I7SA 4AG0A 2RKXA 2OSWA 4HA1A 1GUVA 5MKGB 2ZIDA 3G18A 3IEBA 1D8CA 3A21A 5G1YA 5FJUA 4HNNA 2WWCA 4BCEA 1YTEA 2VGGA 3DI1A 4O0KA 3D6NA 1AH4A 4W7WA 6XIAA 1M5WA 2HSAA 2PWGA 1EPVA 4AXNA 5A69A 3TFCA 1B3YA 2CPUA 3LBOA 1XICA 3AJ7A 3HBLA 2WVTA 4NI3A 3E5PA 1CYGA 1GEQA 2QCHA 3AHVA 1N8IA 3RLHA 5G4WA 4ATLA 2W91A 5A6TC 3GG7A 4XAZA 3W2NA 2Z2BA 4JTFA 1RY8A 1SVDA 3ZLFA 1P0EA 3CYJA 2PMQA 3YPIA 2IXUA 3WYZA 3EAUA 2FFIA 4GD0A 1W2PA 3ICJA 7ENLA 4HU3A 3WELA 4NIRA 3A23A 1FX6A 1MDLA 2GQAA 3GQYA 3FK4A 4XZIA 3TC6A 3FXGA 3RO6A 4MY1A 2XSAA 4CQ8A 4E4PA 2BVDA 2OFJA 1AZ1A 3NL2A 1RCOB 4Q8TA 1VYSX 1V51A 1XRTA 2ZUSA 4MPKA 1JYNA 2G3FA 1JZ8A 3EWCA 3PB2A 1W31A 1JPIA 4WR3A 3QR0A 4J3XA 5E0CA 2X30A 3JW7A 3AC0A 3OTRA 3F5LA 3C86A 4PCNA 3W75A 4FX8A 1J93A 1UP0A 5DANA 3O6CA 1V3JA 1J12A 3BGAA 3PPHA 4H00A 2QYGA 3KAOA 4C5ZA 1XLMA 3DUGA 1FCUA 3WNNA 3GD6A 4G5DA 4OE7A 3M0KA 3W2UA 1UPPA 3H23A 4GCAA 1TVPA 3EWYA 4OOZA 4B15A 1LLOA 1LOLA 4E38A 4DJDC 4Q33A 2UBPC 1XINA 2Q3OA 1DWHM 3NG3A 4HNVA 2HTMA 2VFFA 3P67A 3WD2A 5EFFA 3U3HA 4QROA 1BRLA 5CAHA 1OFAA 2ISVA 5C2XA 4E4UA 3G3DA 2JF6A 1MUMA 3PM6A 4B4HA 2INEA 5CPMA 3PZGA 1XGDA 3HGOA 3QQ0A 1C8XA 1UD3A 3GW0A 2BGSA 2YCIX 2PD9A 2C18A 2YBUA 1DWJM 2ZRXA 4P8UA 2RDUA 1O5RA 3N29A 4K8HA 4M1RA 3DC8A 3L67A 4C6BA 3L5MA 1UWSA 4RV8A 4Q8QA 1ZBCA 4NL1A 3EXTA 4JTAA 3D3FA 3V5CA 1XLGA 2PDUA 1PZ1A 3NOYA 4PYSA 3SGGA 5LIWX 2BY2A 1NF7A 3CASA 3M5ZA 3ISIX 3AHTA 3WQVA 3EOOA 1SO5A 1C8YA 4NX0A 3KBVA 4LEFA 3UJFA 2RJGA 1H09A 4ATWA 3O07A 3SI9A 4ERAA 2MUCA 3N2MA 3HG5A 1ZAHA 1GQIA 1VF8A 3HG3A 2VELA 1IEWA 2OEKA 4KETA 1CGXA 4QG8A 2PDNA 4QCEA 1I9CB 2A6NA 4E3VA 3WF2A 1UKTA 1US2A 3N04A 5CJNA 2DUZA 4CU6A 3S6TA 3P61A 4RR4A 3VOIA 1V6XA 5TBOA 1RZMA 4ML4A 2AMGA 2CLKA 5M03A 4REQB 2Y7DA 2D2GA 1E5JA 4S3JA 4RNJA 2F6KA 4FK9A 4GQGA 3DFTA 4DJED 1UKSA 4A3QA 1V5XA 1GONA 5IRPA 5AFDA 5DF0A 2PDJA 3WY1A 1FTXA 3POCA 1TZ9A 1C93A 1X6NA 1KR1A 3W70A 1O66A 1WNOA 3W1NA 4GXMA 1W9UA 3RRXA 2FJKA 3WF4A 2G3JA 4PMYA 2ZUMA 1Z8AA 2WPGA 3LPGA 2DZAA 1W5MA 5DFAA 3S2CA 5I3FA 3THCA 3G5EA 4IGMA 3WMLA 4YXGA 1V7YA 5K2ZA 4XTIA 4ZE5A 2GQ8A 1TZ7A 1JDAA 4DNMA 1TE6A 1NJJA 4RE4A 2WJEA 4Z1BA 5AZ0A 1X8CA 3VD9A 3NQMA 1VR6A 1FWFC 3AISA 1XL9A 4NILA 3LLXA 2PA6A 2V5BA 4UTWA 4IMDA 4FR1A 1TPB1 3MDUA 2D24A 3TXZA 4M6VA 3V0TA 1KWGA 1D3CA 1LTDA 3VM7A 2I14A 4Y9PA 4H8UA 2H8XA 4PMQA 2DZBA 1G4PA 4OOUA 3VCNA 3BWWA 5M1TA 4GIEA 1ZBKA 1LP6A 4U5IA 1VYRA 5G1TA 1JCNA 1ISZA 3RX2A 4XV0A 3WLSA 3P82A 3WCZA 3LPPA 4MHBA 1NTHA 1UQZA 3NQDA 3VNYA 1AH0A 1M65A 1CB7B 2WVUA 4MAZA 1G4SA 5AVHA 3MO7A 1UZ4A 1EGVA 1KFCA 3RYSA 1KFJA 1F6KA 4B5XA 4HHMA 2CZFA 4KEVA 5L6UA 4F2BA 2XJ7A 1MQRA 1REQA 3I65A 3GNRA 2VENA 1CNVA 1X38A 1U1HA 1ITCA 4BY3A 1DTUA 5E9AA 1THFD 5CLWA 4TV6A 1UROA 2YJQA 2J8FA 3T44A 2E6DA 2PGWA 2ZDRA 2Y5JA 3CMFA 1XGEA 3VGBA 2HWGA 1R86A 3HTWA 3SIMA 2XIJA 1HP5A 5EMUA 3E2SA 3TJ4A 3E02A 4FMVA 5CZKA 2EJAA 4Z08A 1PWMA 1OC7A 3VOHA 4CD5A 4XBKA 1CLKA 4AHPA 3MKKA 2TAAA 4W87A 4GMEA 3LU2A 3WLKX 2JK2A 1K4HA 1PVNA 1Q85A 3A24A 1JRBA 4AHOA 3TX9A 2C13A 1GOIA 3P5ZA 5LIKX 4Y96A 3NUKA 2ADAA 2ZA3A 3GYCA 4ZODA 1XIEA 2J25A 3SIZA 3P7YA 3LY0A 3MUY1 1WOBA 4D1JA 3B05A 3UZYA 2FB3A 1XFBA 3QEZA 4DAFA 1W37A 3C3UA 1QI0A 4E2DA 1IEIA 4V28A 8XIAA 4F4RA 1X98A 1NWSA 1MUCA 3DGRA 3PNUA 2D1ZA 3ZLGA 1KM2A 2CKRA 2PD5A 1ME7A 4X22A 3PZNA 1XLEA 1XPGA 4N42A 5GNXA 4AF0A 5AC6A 1I2QA 2Z1WA 5GJMA 5CG0A 5EMYA 2FIQA 3E0LA 4UOQA 1GG0A 3TE9A 3LGEA 3RNDA 2F8QA 1UWTA 2VHLA 2HVMA 3VGGA 2J13A 3OPSA 1TUFA 1EZWA 2BXZA 1O4UA