2AGTA

Aldose reductase mutant leu 300 pro complexed with fidarestat
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorizing Selectivity Determinants of Inhibitor Binding toward Aldose and Aldehyde Reductases: Structural and Thermodynamic Properties of the Aldose Reductase Mutant Leu300Pro-Fidarestat Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 110
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2agtA00
3WG6A 4DBSA 4RPQA 3GHTA 4WEVX 4IGSA 2DUXA 1LWIA 1AZ2A 3H7RA 1Z89A 4GACA 4PUUA 3UWEA 3DOPA 3LQLA 2F38A 3EB3A 1YNPA 5C7HA 3S3GA 5KETA 3FX4A 4EXAA 3NTYA 1UR3M 3H7UA 3G1RA 2IKJA 4IJRA 3UFYA 3CV6A 3H4GA 4XK2A 1ZSXA 5LIKX 4JTDA 3WBWA 1HW6A 4DBWA 2IPFA 4GIEA 1YE4A 2PZNA 3CASA 2PDJA 2FZ8A 5LIYX 1S2CA 4YVXA 2A79A 1PZ0A 3UYIA 4FALA 2PDLA 1T40A 5HA7A 1SM9A 3BURA 4ASTA 4R9OA 1T41A 5LIWX 3O0KA 2PF8A 4QX4A 4XZIA 3LENA 2HDJA 3CAVA 1R38A 1X97A 2PD5A 2PDGA 4XVDA 3EB4A 4GCAA 1PZ1A 1ZUAX 5LIXX 4PRRA 4XO6A 2FVLA 3R94A 1YE6A 1AH3A 4L1XA 5JH2A 3P2VA 4QXIA 2IQ0A 2PDHA 4JIHA 3UZXA 4PMJA 3CMFA 1XF0A 4LAZA 2F2KA 3UZZA 1RY0A 1XGDA 2PDXA 2IKIA 2CLPA 4XZHA 2IPJA 1S1RA 4JQ2A 2AGTA 1EF3A 4YVPA 5JH1A 3ONCA 2IS7A 2HV5A 3GUGA 1Q13A 2IKHA 2FZDA 2PDKA 2NVDA 2PEVA 2IKGA 1AZ1A 3GHUA 3N6QA 1C9WA 4I5XA 3RX3A 3UZYA 4IJCA 4YVVA 3QKZA 1ZQ5A 1US0A 2BGQA 4ICCX 1Z9AA 2HVNA 2PDMA 2WZTA 2J8TA 5M2FX 4FZIA 1VBJA 2BGSA 3FJNA 1YNQA 3BUVA 3KRBA 3LN3A 4H7CA 3COTA 1XJBA 3BV7A 3CAQA 4GA8A 4JQAA 4ZFCA 2NVCA 1EL3A 4WDTA 5LIUX 3T42A 3D3FA 1J96A 2IQDA 1K8CA 4EXBA 3EAUA 1X98A 2HE5A 4NKCA 1JEZA 1AH4A 4MHBA 4WDUA 1IEIA 2IPWA 4PR4A 1ZGDA 2DV0A 1QWKA 4YS1A 3RX4A 2HEJA 2PDBA 2R24A 4Q7BA 3ONBA 4GABA 2PD9A 4LB3A 4JTRA 3WCZA 4H8NA 5DANA 3WBYA 4JQ4A 1ADSA 3V0TA 3RX2A 3ERPA 4XAPA 3LUTA 1Q5MA 3WBXA 4LB4A 2VDGA 4XO7A 2I17A 1FRBA 4LBSA 3R8GA 1A80A 1AFSA 4WDWA 2PDPA 3M4HA 3N2TA 1X96A 3LEPA 4XZNX 2PDFA 2WZMA 4OTKA 2ACRA 5AZ1A 3UGRA 4GQ0A 2HVOA 1Z8AA 3UP8A 4XZMX 3R8HA 1AH0A 3Q67A 4JQ3A 3LNMA 3Q65A 2ACUA 4JTQA 3R58A 2PDYA 1QRQA 3LD5A 2PDCA 3M64A 4WDXA 3GHRA 4PRTA 2DUZA 1LQAA 1RY8A 4GQGA 2HE8A 3R43A 2C91A 4YU1A 4QR6A 3R6IA 3R7MA 1GVEA 1Z3NA 2FZ9A 3UZWA 3LZ5A 2I16A 2PDUA 2PDIA 1PWMA 1OG6A 2IPGA 4AUBA 3CV7A 2ACSA 2INZA 1MRQA 3VXGA 4F40A 3C3UA 2FZBA 2ISFA 1VP5A 2ALRA 3LZ3A 4XVEA 3V0UA 4JTAA 5HNUA 3V0SA 4HBKA 4FA3A 1PWLA 4Q3MA 2QXWA 1S2AA 1S1PA 4JIIX 3O3RA 1RALA 4JIRA 3UG8A 2ACQA 2FGBA 3V35A 2PDNA 1IHIA 2PDWA 4DZ5A 4DBUA 4PUWA 1MI3A 4QBXA 4L1WA 3MC5A 3M0IA 3G5EA 4XZLX 3V36A 4G5DA 3DN5A 3U2CA 1MZRA 1EXBA 1M9HA 3F7JA 4WRHA 4WGHA 5AZ0A 4HMNA 2PDQA 2BP1A 4LBRA 3BCJA 3LBOA 2PFHA 1HQTA 1EKOA 3GHSA 1PYFA 4JQ1A 3MB9A 4LAUA 2INEA 4JTCA 3B3DA 3LQGA 2R9RA 2P5NA 4FAMA 5HNTA
chains in the Genus database with same CATH superfamily
3SQMA 3E12A 3MWAA 4PUDA 3WH8A 4UTLA 5HK4A 5CGMA 3WIJA 1DTUA 2QCDA 3N14A 3SCVA 1I6NA 3W38A 1FVPA 2B0MA 1X6UA 3NVTA 1H60A 3DFYA 1ZB5A 5K3VA 4HU0A 1TSIA 4UTKA 3O06A 3NSNA 5AYBA 1B4EA 3GIPA 3H4WA 4QJ4B 5CZTA 3IIZA 4O50A 1R2TA 1A3HA 3IVSA 3QZEA 3TXZA 5FCZA 3HFTA 1QPRA 3TC6A 4QISA 5D9MA 2QULA 2J8GA 2ZZ4A 1KRMA 2PP3A 4NIRA 2E6FA 3O0KA 3LA4A 3LENA 5K9XA 2OLSA 1XIMA 5IM51 1R38A 2PDGA 1DJYA 5DXYA 4WOQA 5E0KA 1N82A 3OEXA 1LBLA 3BARA 1UKQA 3NPWA 3DGBA 4QAIA 5G2WA 5K7JA 1P0EA 2PB1A 5D2XA 4ZO7A 2FTPA 1JYNA 4J5NA 5JH2A 2GUUA 2ZZ2A 2WMFA 3RLGA 1S38A 2Y7DA 2PS2A 5C0QA 2OMAA 1GONA 4XBSA 1HO4A 3CQIA 4UZUA 5K4ZA 1UWAA 1VHNA 3VGFA 2PLJA 1MW3A 1XD0A 2X2GA 4UQAA 2JKAA 1EOKA 2IS7A 1E71M 1ENUA 3THDA 4IICA 1LRQA 3STFA 3TR9A 3PZTA 4PBFA 5BZAA 4BEQA 4HMEA 4J35A 3DYOA 1CBGA 2Y88A 3MZ2A 4YVVA 1AL8A 1P48A 5ABTA 3LX9A 3CIVA 1Q3NA 1GZJA 2AQVA 3QLLA 1OD8A 1XDLA 1TV2A 3BQ6A 1V02A 2ADAA 3A6OA 3C2OA 1F05A 4AHOA 3LCIA 2VCAA 3U5YA 3B0VC 2D2HA 3G0SA 1EPVA 3ITTA 4L7ZA 1JPKA 5CG0A 2BY3A 3H6OA 1MUWA 4KIRA 4AEEA 4GA8A 5EU9A 5T8GA 2W5FA 1TTIA 3SGZA 3D46A 2BZNA 2DSVA 1QT1A 1JCTA 3CB8A 4LS1A 3IANA 2A6NA 1AQ0A 3TYUA 1JFHA 2C14A 3TOYA 4WDUA 1OC7A 1H1YA 1SFJA 3WLPA 4HOWA 1JF6A 3ZMRA 1XIGA 1QPQA 3AOFA 3PBVA 4GNJA 1GT8A 1WZMA 2V5BA 2CLOA 4M1RA 3RU8X 1VQTA 1JZ5A 4HCLA 5ABFA 3BMVA 3UNDA 3CQHA 1DPMA 4M81A 3RX2A 1IT8A 2ZADA 1YX1A 3TMQA 4XAPA 4DI8A 4WUIA 2DVTA 4FNPA 5D05A 3GNDA 1DXIA 2ABBA 2VDGA 5CC7A 4XO7A 1SR0A 3ARZA 2ATSA 1GG0A 4WIWA 3CAKA 3LERA 4Q22A 2PLMA 2F9RA 1L2QA 3K2GA 4H19A 4NJHA 1TCMA 7REQA 2PDFA 3VOJA 3N18A 2E9LA 2REQA 1YDOA 3LHYA 2C1IA 4PC8A 2XIOA 4EWND 3GS6A 4AAJA 2GK1B 1VD6A 3NL5A 4PUNA 5I7GA 1D7FA 1E43A 2UV8G 4LALA 5A6LA 1QATA 3MA8A 4CKQA 1SMAA 3EDJA 3LY0A 3T2OA 2I9EA 3CIXA 1ZHAA 3LSCA 4CNTA 3CQKA 2CZ5A 2BV9A 3CH9A 2G4FA 4D6CA 1JFXA 4GE8A 1UD2A 1E6QM 3ITOA 4GNVA 3UWUA 2PDUA 2PDIA 3BANA 5G4WA 5HPOA 1OG6A 3DG6A 3P81A 2GVGA 4DJDD 1OGGA 3MMWA 2J7EA 1P6WA 1XBYA 3MW7A 3VXGA 1BXCA 4UOZA 1QPNA 1XFBA 1NOUA 3AS2A 3AXKA 3E2RA 4IPPA 3RAOA 1VKFA 2ZE0A 3V0UA 5F4SA 1CT5A 1PWLA 4FOUA 3KLLA 4FX7A 4NJIA 4INFA 3CZLA 1O5KA 3Q58A 3VGBA 1XLBA 3CZEA 1F3EA 4JIIX 3VX0A 4JZ5A 1BTCA 3GAYA 4KMQA 5DT7A 2ZUSA 3V5CA 1Q7MA 2E1WA 2V5CA 3V3WA 1OFOA 2PGFA 3WH7A 3T2QA 2VX7A 3G8EA 2Z2BA 4LVFA 2YA1A 4LU0A 3I7SA 1NY1A 3PTMA 4RZ6A 3M41A 2E3ZA 3DN5A 2E25A 4TMBA 1FWSA 3S6DA 2X1RA 4S39A 3PHAA 2BVTA 3ABRA 3KRUA 4K6AA 1G4EA 4AD3A 2AKZA 2BP1A 3S5OA 2HTMA 3NL2A 4ONVA 3LRLA 4LJ3A 2CZVA 4K7VA 2ZA1A 2ZTKA 1V0NA 4MLJA 1NIUA 1OF6A 4BF9A 4HNNA 5GJNA 2RH9A 2J24A 2INEA 1Q8JA 2QMKA 4TU1A 3TH6A 1ZBCA 3FYOA 2WSPA 1J12A 1N55A 2XH7A 1W0MA 4RK8A 3K8LA 1OINA 1V5XA 2XHYA 3E49A 1U1JA 1UPPA 3C52A 4V15A 4MPQA 4B91A 3HJZA 2BNJA 1Q2SA 1VFLA 1KWKA 3LTSA 3AWNA 5ECUA 1VPYA 4N2YA 3DOPA 1CLKA 2WM1A 1WPCA 1YNPA 3GDMA 2NV9A 1ZSXA 4HPGA 2ALDA 4DJEC 3VKJA 1B1YA 1RA0A 3RPTA 3THUA 1TWSA 3EWDA 3FA3A 2VRJA 1J0YA 3GZ3A 1AVAA 3AALA 4JTHA 4OBRA 3BLOA 2FVKA 3TW6A 3SCSA 5A95A 5A2CA 2AMXA 4IMEA 3ARUA 4TTUA 1Q45A 4PMDA 4DF1A 5T91A 2OZ8A 4K8HA 3AMGA 1E0VA 3MWCA 2CBJA 3LPGA 2BTMA 1F8IA 4DELA 4IIFA 3V5OA 2F2HA 3E2VA 3G1XA 3L66A 2W3ZA 3WJZA 5BMWA 1SJAA 3P82A 4D6JA 3GG0A 3P93A 2VM8A 3R0KA 1TWDA 1PS9A 3VKDA 4PTNA 1K7XA 4ZQPA 5BROA 1X8FA 4MWAB 3WN6A 2UY3A 1ECQA 2Y4SA 3L4ZA 4QS5A 3N2OA 1XF0A 4LAZA 4LXFA 2F2KA 3WLKX 1WDSA 1XGDA 5FAGA 2IKIA 4M6VA 4PODA 1UYQA 3H53A 4ZE4A 2XZ9A 3VIKA 1UJQA 3DIPA 1S5MA 3JUGA 4RCXA 1PIFA 3T81A 1XLFA 4DUOA 2CZDA 5IXEA 2D3NA 1FCVA 2JIEA 3QSTA 4RW5A 1EZ2A 4ALDA 2AQOA 2VX5A 2ZRZA 3DHPA 3U4FA 1MDRA 4LNYA 3KOYA 3QY6A 1J6OA 3EA3A 4QNWA 5E0FA 5BXSA 4Z1CA 1W1YA 3EX1A 4JIQA 4UTIA 2HPIA 3WFZA 4ZQMA 3TP4A 3G2GA 3B0XA 1PKNA 2BOFX 2DZVA 3IIPA 3EWZA 2DQXA 3OBKA 4QE4A 1SZNA 4GH3A 3HGOA 4PN2A 3NGJA 2CLEA 2WSYA 4CQ8A 4J3ZA 1U22A 2P3ZA 4D6HA 1UCWA 1NOFA 4AYGA 1QCWA 4JTTA 1B5TA 4G1KA 3WLMA 3CBWA 3T07A 1CECA 1OHLA 3TTEA 1XLCA 3B04A 2TRSA 4IQJA 3D3AA 2WJDA 4U3AA 4GABA 3SCUA 1W3NA 3RM8A 1TMLA 4RXFA 1QPOA 4JQ4A 9CGTA 1DJHA 1O7AA 2OPJA 4N4QA 2V3FA 2VZOA 3ZT6A 3W1NA 1LDCA 4LB4A 4JAWA 1EX1A 3CXOA 1JGIA 3GNXA 4HHMA 3GTNA 4GINA 3KBVA 1AFSA 3LLFA 2OWXA 2QVNA 1VBUA 3ARVA 5J8LA 1IEXA 1KLZA 3LEPA 4MY9A 5MKGA 2W27A 1I4NA 3TSBA 3ARXA 3G3MA 2WZMA 3GXMA 1DOSA 4ZSUA 3ARYA 4Z0JA 3SADA 3ZJ8A 2HBVA 4LSBA 1L2UA 5E9AA 2WC4A 4M29A 2HPMA 4FIQA 1W5MA 1ISVA 1Q65A 1JDDA 3M0JA 4MZYA 4QG9A 3EOSA 1EBHA 4RE0A 2YCJA 2OVLA 1JCLA 3GUWA 3HF3A 4GY0A 4AZBA 5IOBA 1VR6A 3GDRA 3SCRA 3SY1A 3U3HA 3PULA 4AIEA 4AD0A 1LQAA 4GZ7A 4F0KA 1KWGA 4KS0A 2WCSA 1LUCA 3CQ0A 5LSMA 3UZWA 4C6QA 3VD4A 4LUSA 3D47A 1XLGA 1VENA 4GBDA 4M82A 2V63A 3AUJA 3MV11 5GJMA 4JNZA 5CPNA 2VI0A 4BCEA 2B81A 4HKPA 3IJ7A 3W2JA 4KEMA 4O10A 4Y2WA 4FR1A 2SFPA 1OFQA 5G4EA 4BF7A 3VZYA 1VB9A 2XWDA 4R7OA 3CYJA 3CM4A 2QCNA 3OGRA 2QXWA 4Q32A 3AIVA 5JIWA 4NAEB 4WCJA 4PCFA 1QU4A 3A4XA 4FOKA 2OO0A 4DAIA 2IMRA 3S0CA 2XGBA 3VIGA 3NNTA 1D2KA 3KEHA 1Q6FA 4OKDA 1XDJA 1GHSA 2Z1WA 3OLIA 1GUVA 3RIKA 2DSWA 1UKOA 1W5OA 3XINA 1WP6A 3VNJA 2C1GA 4J2PA 2GVEA 2YBTA 3HPAA 1SZGA 4HZ7A 2ZA3A 3FSUA 4EPEC 3HB9A 3L2IA 5CG7A 1RK6A 1L0PA 3WDIA 4JN7A 4HHPA 4G2DA 3URBA 1E9YB 1RQHA 3ZT7A 2A7NA 1XYFA 3EOUA 2JEPA 4H01A 4WD0A 2HK1A 3SBFA 5J5RA 4NASA 4HT3A 3W29A 2DSZA 3GAKA 3OVRA 1UMLA 4A2SA 2VFFA 1KGUA 7PTDA 5DX7A 4LC6A 3SJNA 3WG6A 2O0TA 3BLFA 3BW4A 2PRLA 3BG9A 1WCGA 1E51A 3I3EA 2Y8UA 3FYPA 3UU0A 2CW6A 3AJ7A 5G4HC 3W1TA 1ZBWA 4NI8A 3G24A 3S1GA 3KP1A 1S46A 3RPDA 1QR7A 1JXKA 2XJ7A 4F0LA 3MPGA 3E5BA 1XLLA 3S3GA 4AZIA 1ZNNA 3TFCA 1B54A 4JFSA 3UFYA 4RE4A 5LIKX 2O4MA 1FX6A 4Q7IA 1JCJA 1TA3A 4NT0A 1O1ZA 4S38A 2LLEA 3WK2A 3W6MA 2PWUA 3WQCA 3AS3A 3CMJA 4QTGA 1GYLA 4XIAA 2VR4A 4E5TA 1P1XA 3UESA 4XAYA 2GOKA 4DNMA 4H7ZA 3W7DA 1JRCA 2F6XA 2AQWA 1MW0A 5DY3A 5DXXA 3TX9A 5IBXA 3M07A 1PZ1A 2Q8LA 1BHGA 1MDLA 4CN4A 1WDWA 4WXZA 4U4MA 4O4WA 2JF6A 2C19A 3H2FA 5TNVA 3NQMA 3QC0A 3W70A 4L1XA 1VFOA 1ZAJA 2OO6A 4LUIA 3WUGA 4EWJA 4AWUA 1OBAA 3NAVA 2B7OA 3TA6A 4DZAA 1QPKA 1RY0A 3GR8A 3W84A 2XWEA 2WVTA 1UZ1A 3W7KA 2Y7EA 1XLIA 4Q8TA 4CEXC 2BFGA 3II1A 4CEUC 2PTYA 3FJ6A 1JIBA 1MW2A 1G67A 3RU6A 2Z1SA 2PTZA 2WVSA 3AAMA 1V93A 1BVNP 3WO8A 2WPBA 2QDGA 1RUSA 4KH2A 4QITA 2BXZA 3L68A 3QV9A 5B80A 3RNDA 5C9RA 3TAOA 3H7VA 4Q4KA 4IJCA 4M56A 2JF7A 1Z6KA 1SFSA 5I78A 1U1UA 8XIAA 1RVKA 2Z25A 4IP7A 4AD4A 3S9IA 1B3WA 1AQFA 1KQYA 3VK5A 3KL3A 4P8VA 3LCLA 4JL1A 2E7FA 5EMUA 1WA3A 4AZ5A 1GHRA 3SUWA 3VVGA 4WLCA 1GVYA 1KM1A 4MKNA 4AF0B 4AY8A 4XD5A 3TNOA 3W7LA 2W66A 2DVUA 1QFEA 4WDTA 1X1ZA 4MPKA 4GYPC 4QQUA 1I8JA 1J01A 9XIAA 4H7VA 2J66A 2W4XA 3VDAA 4MJMA 3JW7A 3W7IA 1VFMA 5H1WA 1IE7C 1IEIA 4DUXA 3M7SA 5HPCA 4RX0A 1BF6A 5D38A 2IPWA 4ZZ9A 5DMMA 2WHKA 3WDHA 1ADDA 3ARTA 2EPLX 2TMDA 4P7QA 2ABAA 1HVXA 4O54A 1UA3A 3CPGA 4ZQCA 2UBPC 4IMGA 4XIMA 3H2NA 2Q71A 2E9MA 4FXRA 4L80A 3OVGA 3VGHA 1E70M 1TA3B 4HHLA 4O0ZA 1TV4A 3MUCA 2ZX6A 2QJNA 4UIOA 2OEKA 2I17A 2OX4A 2QCDB 2WQPA 1F7BA 1XL9A 1SJBA 3CUIA 2ISSA 3UJ2A 2DJXA 5KZMA 1VPXA 1QNOA 3THQA 4E0CA 4JXCA 2W92A 4UFJA 1KQZA 2DORA 2HVOA 3SQLA 3UP8A 3APTA 3W76A 1E5NA 1XX1A 3NQ7A 4ADUA 3W1RA 1SQ7A 3WLQA 2RDUA 2VEGA 3WENA 3Q67A 2XGZA 3GR7A 5EMYA 1EB3A 3Q65A 1M5WA 1S2UA 3PC0A 4AG0A 2BGNE 1I0BA 1P5BA 3GIYA 1MEWA 3PNZA 4AIOA 3R2GA 3IJIA 4LEQA 3QEZA 2DIKA 3M46A 3B9AA 4Z2JA 1I0DA 2DEPA 3GVVA 4WHBA 4FEZA 2FHFA 4D8ZA 2VD9A 2VR5A 4Y8EA 4JIEA 1W1ZA 2FLIA 1GOMA 4GZJA 2QCFA 4MKVA 4GBUA 3PFMA 2R1LA 3CTTA 4YMZA 3R25A 4JYEA 4JYFA 4D72A 1PDYA 2ACSA 4C6JA 3ZOAA 4GUJA 2E6DA 3IAQA 1E6PA 1GYNA 3MSRA 5F1UA 2CHRA 3U7BA 2DW7A 3IPWA 1GOIA 2YL9A 3WLHA 3N2CA 3PPFA 2H9AB 3M0VA 3S9YA 2E6AA 3QH2A 3EOOA 4YWIA 3MP3A 2WLZA 1TO3A 4ROPA 3V35A 4Q4PA 2PRHA 4O1CA 3P80A 4JNYA 1IHIA 1SJCA 2D2JA 2WCAA 1E9ZB 4O8RA 1OK6A 4IGMA 1QBBA 2PBOA 2ZX7A 3GYCA 3OLDA 4LVAA 5C9XA 4MNJA 4FNQA 4NL1A 1WBHA 1GOKA 2MNRA 4B2DA 4DWSB 2G3JA 2OJPA 1EYEA 1EJTC 1TX2A 4Q4MA 3N4EA 4H00A 1FHDA 3GXTA 4I8YA 4WRHA 1EBGA 4PUJA 3P74A 5BRBA 5I23A 1W5NA 2OSXA 3IRDA 5I3IA 2C0HA 4CD6A 1PL9A 3PR2A 1X1NA 2ZIDA 3BLDA 2PWGA 2GUBA 5FJJA 3EPNA 3WLIA 2D2GA 1XSIA 3ABQA 1H3GA 1R3QA 4QP0A 4IP5A 1F3TA 4ERGA 1XLHA 4GQBA 4JCMA 1CWYA 2ZUMA 1O12A 4UTWA 3TKFA 3W0KA 4QE5A 1TX0A 1RD5A 1CB2A 3GFYA 2V0TA 4HMCA 3TN6A 5FEWA 3W1UA 3QHNA 4AX7A 5A8NA 3SUUA 4Q8NA 1LLWA 3E6EA 5ABFB 3ELFA 4QQ3A 2JIWA 3B40A 3B8UA 4K39A 5J04A 1J0HA 4ADTA 3IV3A 3A4JA 3ZJ7A 3CEPA 1RZMA 2CITA 1JNEA 4JR5A 3IS4A 2GPTA 2YSWA 3NPUA 1QMLA 2X41A 4A3RA 3WLRA 3Q4DA 2E0PA 3E0IA 2Z4GA 1L6FA 4PTWA 4QJ3B 3GX9A 3WF0A 5FI8A 1PZ0A 3PWAA 1O5QA 2YBUA 3W71A 2QT3A 4MM1A 4NX0A 1K70A 1T41A 3S9ZA 4H8HA 4Q4QA 4F79A 1L6YA 4XVDA 3IK4A 3VINA 2G50A 1J4EA 1ONEA 4QG6A 4HYRA 3B8TA 5CLTA 1HJVA 2P8BA 2ZFAA 4D6IA 2FHCA 3CWNA 4DF2A 1TR9A 2WZHA 2UZ9A 1FDYA 2PDHA 4PFHA 1RH9A 1BKSA 2DZAA 4KCVA 1H41A 5HUOA 3VNIA 2FDSA 3VU2A 3U4AA 3PB0A 1V7YA 2IW0A 1NWRA 3AUOA 2ATMA 2NQHA 3L5LA 3VUPA 3FHQA 1XHGA 2JGYA 2OX1A 1D8WA 2YBVA 4LAMA 4CD7A 5K4XA 4FF7A 4JKMA 4FF5A 4B5SA 2PEVA 2GGEA 1AZ1A 5AHIA 5D9PA 1P7TB 1TELA 1VYRA 1Q6RA 3WK0A 4IGHA 4L5ZA 1A5CA 3W28A 5IHSA 3F4NA 3WMLA 2PU1A 2QF8A 4UFMA 2X40A 3A47A 1LZOA 2HVNA 3GNOA 1BGAA 4Y9OA 4XKYB 3GTHA 4P7RA 3SUSA 3BMWA 2X1UA 5HQMA 2PWVA 4AWEA 5CAKA 2W79A 3MP4A 5FKYA 3URAA 4HSHA 4H2HA 1IWPA 3GNNA 3ZSSA 2B7NA 4PFMA 1XV8A 4UTMA 1H11A 1H1ZA 3W1LA 1HL9A 2G4JA 4O13A 4UC5A 1MUCA 4F0SA 1WAWA 1XLEA 3HGRA 2YGYA 3WF4A 4HYWA 3OP2A 3PWIA 1QNVA 2X2YA 1NWSA 1ZGDA 3EOEA 3NGFA 4S23A 5KZEA 1EP2A 4DO6A 5D37A 1QHZA 5AHEA 2QJGA 2DVXA 4DRSA 2NXGA 2NQ9A 1DVJA 4A3HA 1Y65A 5I3DA 3E96A 3MMDA 4OV4A 1DXFA 4JBRA 5AYYA 2ZUWA 3ZLFA 2FJUB 4A35A 4C6DA 3L4WA 3FFSA 4HPJA 4MJ4A 2Q6ZA 5AB3A 4WGXA 3R8GA 3LOTA 2EG8A 1A5SA 2QVHA 2ZUVA 2OEMA 3F4VA 3CWOX 4AD1A 4I8DA 4OTKA 3KBWA 2R1MA 4RXGA 1K9EA 1KRCC 4C6CA 5HR7A 5E6YA 3RITA 1E1CA 4MOZA 1Z32X 4FOJA 3AFBA 2XIJA 6A3HA 1WYIA 1JI2A 3SRDA 1TUXA 2I14A 2EJ1A 1HP4A 1TRDA 3H55A 4IIEA 1EA0A 3BL3A 3QTPA 4MYAA 3KBSA 4MB3A 3VNLA 3NIYA 3GC4A 4Q4RA 4ZB0A 1W5QA 4WDXA 2DUZA 3BAXA 4GQGA 3JS3A 5ECVA 4C91A 3VI2A 4O1EA 4QR6A 4NJJA 2FZ9A 2V3EA 4WF7A 5D02A 1RHCA 1FXQA 2ESCA 3SM0A 3SIMA 2VMFA 5AC7A 3NZ1A 1HKKA 2A5HA 7REQB 2X0SA 3N25A 5AN7A 4AVFA 4B3KA 4CLMA 1Q4WA 4PEEA 5F2MA 2REQB 2WSRA 5CBIA 5IFPA 5DCBA 3BVJA 3WYZA 2XSBA 3FEQA 2PSNA 2AGKA 3AIRA 3IV8A 2V30A 4EPKA 2QJMA 4NZ3A 3P0WA 2GZXA 1VJZA 1QW8A 2Z28A 4C7FA 1CEOA 3KLKA 1X1OA 3WF2A 5MHBA 3CHDA 1W9XA 1YMYA 1R5YA 5LXEA 5FJRA 2PDNA 5I2UA 4G6CA 1FQ0A 5C54A 4JS3A 4DBUA 3HN3A 2ZXAA 4QBXA 1XH2A 3HFYA 3F5JA 3ARRA 2PWFA 3NM3A 4JKKA 3XISA 3T4WA 4A6GA 1PZ3A 5KEZA 2Q8ZA 1BD0A 1XP3A 3SB0A 1V6XA 4UUIA 1TMHA 2V6AA 5ABHA 1UH2A 3GU1A 2WVUA 4MUPA 2XVKA 3LV6A 2PAJA 1K8ZA 4UFLA 5E70A 3AMCA 1Z42A 1VRXA 3MB9A 4MAVA 3S1UA 3H26A 4Z2GA 2AOSA 3L4UA 3LGDA 1WZAA 4ECLA 3M43A 3NDZA 4HMDA 3HM7A 1M3UA 4I90A 4DBEA 3WUEA 3OHMB 4KRUA 4DBSA 2GVYA 1E4NA 5LGXA 4U3CA 1YYAA 1EEPA 1LWIA 4GRSA 2CLHA 1E15A 1RR2A 3TYBA 5DFAA 4RDZA 4MADA 3WF3A 2NQLA 3VYLA 1ZL1A 1EH9A 3NG3A 4X3ZA 1K4GA 4WVXA 3TC3A 2J7DA 4CNUA 2ZTJA 3FX4A 3MANA 3WD2A 1I2QA 2CWNA 1NDZA 4IF2A 1WKEA 3PUEA 1LTDA 3LTYA 7CGTA 1F6PA 1PKYA 4RV8A 2QIIA 3BW2A 4AWTA 2PGEA 3IAPA 2XM2A 1BGGA 1F3WA 4H6KA 2CNCA 1XR2A 1JZ2A 1KXHA 2ICSA 1CXKA 4C6NA 2KAUC 1P4CA 4ATLA 2YW3A 1Q63A 6XIAA 3UCCA 5CLWA 4AHQA 1HJWA 1E4IA 3L0GA 4HQVA 3S1XA 1WZKA 4XSLA 1B3OA 3GH7A 5KTLA 3TW9A 4E6MA 3S6OA 1SW3A 1EJRC 4P8XA 4DJDC 4QNEA 2TAAA 3E0LA 1PBGA 3M0HA 4LX4A 4FXSA 2YB1A 1UHVA 4JIHA 3TJXA 3VCNA 3WL0A 2Z27A 5BXRA 1M53A 2XN0A 5GJPA 3UJSA 1HIZA 4MFDA 2GVLA 4LH8A 2VEIA 2O7SA 1XIFA 1A5MC 2NUXA 4Y9MA 5FOOA 4Q8UA 3RM9A 1QNSA 3SSJA 1KBBA 1T8QA 1A49A 3DAQA 1KR1A 4YVPA 4LYQA 4Y90A 3ONCA 5HWNA 3NYDA 4YTUA 3PWGA 2XH2A 1T7LA 2OZ3A 2EPMX 1R3SA 4H04A 1UIOA 1M1BA 2EGZA 3U0HA 1P1MA 2YL5A 2QKFA 3QJAA 4HNVA 4UFKA 1VFUA 5EYWA 4RZ4A 3L21A 5CSYA 2O7QA 5BWAA 1Q6QA 4R88A 2C18A 2J8TA 3CB3A 5C71A 2XPKA 1A5NC 3DXIA 4UMAA 3C2EA 4WSJA 3HGSA 5D09A 1JDAA 4Y7EA 3B4YA 1BF2A 4GVIA 1O4UA 1XJBA 2WKJA 4JQAA 1IT7A 5A6BD 4BQ5A 2O9OA 3AIQA 1VFTA 1K8CA 3NYZA 4LYKA 1QNRA 4A3QA 3EAUA 1IWAA 1PCWA 1V7AA 2VNCA 4I9JA 1FWEC 3KS6A 4WKHA 3QZAA 2J47A 4JFVA 4J1OA 3MTWA 4OQVA 3N17A 2EG6A 3NL6A 3SECA 1KBIA 5AC6A 2O55A 2G0WA 3OLGA 3CIWA 4XAGA 1IWBA 1E73M 4LRSA 1SUXA 2GSEA 3W7HA 4H8NA 2RJGA 5DANA 4HSOA 1OG0A 4QDMA 3ARSA 3FIGA 3OVPA 4W87A 2X1TA 4OV9A 2GJXA 4M6PA 3LUTA 4GX8A 3B9DA 1EO7A 1DJQA 1SZEA 4GD0A 1FCUA 3RG6A 4B5TA 2ZDSA 2JFEX 3XIMA 2X0HA 4PA8A 3TLQA 1H4PA 3LMZA 4ZFMA 4Q6XA 1RPKA 2ZBTA 5IDZA 1GWJA 1Y0EA 2DJLA 4CN1A 3S2CA 3W53A 4PUEA 1JZ7A 3I3DA 3LHTA 3RRXA 5KZ6A 4HZ8A 5M03A 2OTDA 2YFNA 1V0LA 4DZIA 1V08A 2BY2A 2HROA 4LS0A 4F3HA 4DYEA 3LNMA 2QLYA 1TTQA 1AMYA 4Q8WA 3R58A 4REQA 5LNUA 2Z0IA 1JYXA 3VOGA 1KGWA 4MYXA 4M7TA 3DECA 3M64A 5FSDC 4MSSA 2FB2A 4J27A 3TQVA 3C86A 1J5SA 3GKFA 3N2XA 4GG9A 4W9TA 1YDYA 2HE8A 1ML1A 2WMIB 2F84A 4GYFA 4TXEA 5BOFA 3S4TA 3SN4A 5HINA 3C2VA 1EZWA 1T0OA 3KOFA 3EXTA 3M0MA 1JYVA 3M7WA 4ZE5A 1UWIA 1JCXA 2G3NA 4C90A 4LCQA 3C3UA 4S3EA 1GORA 1KB3A 3K1GA 3C2YA 2A0NA 1IXPA 3ENLA 3OQ8A 3GC2A 3DG7A 1CB7B 4NUWA 1EIXA 1DQXA 4B5NA 4HBKA 1DBTA 3HPSA 4I5RA 4U2YA 4DYJA 2RJHA 3UGVA 4CQCA 5LKYA 1LRTA 1YPFA 3ZSTA 2CIPA 4P8WA 1ZBVA 4A3UA 1VHCA 5DMLA 4OWGA 3VO0A 3U2EA 4HJFA 4Z1BA 4QS6A 2XN2A 3W37A 1XKYA 4BJHA 1RQBA 4J2MA 3LHVA 5CPOA 2B31A 3IARA 3PS7A 2GQ3A 2VOTA 3WD0A 3MUXA 1SR9A 1YTDA 4XZLX 4G5DA 3TA9A 5DCEA 4F0HA 3W2LA 4PRWA 1QHPA 3ATZA 2HK0A 5CQ1A 1UR2A 3MSDA 3H8AA 2E8ZA 1GZGA 3IJQA 4RE2A 5CGQA 4NXKA 2OCZA 4LNCA 2CLMA 1UWTA 1HGYA 3SR7A 2WYSA 1MFVA 1RPXA 1S2VA 1POKA 1XBVA 2P0IA 2C7FA 1PYFA 2FJKA 3FJLA 3MT1A 3SURA 4W7UA 3WQ6A 5L9FA 1C93A 2R1NA 3NXFA 1TQXA 1UQZA 4K8GA 2R9RA 2GQ9A 3MUY1 5HNTA 4GK8A 1H50A 5KMYA 4XZ9A 3N3TA 3WJXA 1DWHM 3A13A 3C0LA 1ITCA 4IQDA 3UWEA 4NZ5A 3PSWA 1YBQA 2CXGA 3UG4A 2FIQA 3W25A 3K4DA 5JMUA 2YPIA 3ARWA 5D2TA 3WH5A 4EXAA 4CCDA 3G1RA 2OXNA 2BOGX 3E2QA 4C7DA 1W3IA 3ITXA 3DFPA 5H91A 2POTA 3AS1A 4D1IA 3KVMA 3N1AA 4GIEA 2J7GA 3S2JA 4B15A 2VZSA 3WEMA 4PUMA 4MJZA 5E9XA 1HFBA 2ISVA 3W7RA 1V3IA 1F74A 3GW3A 3GH4A 2DGAA 3BURA 4ASTA 5FACA 4L9XA 1UH4A 1VS1A 3EDDA 3THAA 3WBAA 1KXQA 1H0GA 1YXYA 2HNEA 1R0MA 4OE7A 1YHTA 4E2DA 3LNPA 4A29A 3DESA 2WMJA 4IT1A 2DZSA 5HUPA 1M04A 3EX6A 2XU2A 3GD6A 3ZR4A 1O5RA 4IM4A 3H2MA 1OYCA 1XQLA 2D0GA 2PWHA 1BWKA 1FHVA 4IHCA 1KTCA 5A69A 3TONA 3QZ6A 1B9BA 4I9MA 1GQNA 1YIXA 3VGDA 5MF5A 1XIEA 3PFRA 4KFOA 3USZA 4CU8A 3LPPA 4DXKA 1AG1O 2A7RA 1W1TA 3MI3A 4R7JA 4DM1A 1US2A 2OQYA 3B8SA 1ZCOA 3L12A 4GWEA 1DIKA 1EHAA 3AHYA 4ORMA 2G5WA 5EMJA 4YTTA 3QY7A 4E3TA 1CW2A 4U10A 1US0A 3WUFA 2BGQA 5AYZA 3LPFA 3KXQA 2AL2B 4O18A 1L6SA 2GJRA 2IUZA 5IBXC 5FIPA 3HIJA 2UY4A 1CXEA 4MB4A 3NQAA 2VQTA 4MNLA 3BUVA 5HMDA 5AECA 1NQKA 3IUIA 4JL2A 1FY6A 4O4VA 1W9UA 1L8PA 3QPYA 4YYFA 4HNTA 5E6ZA 4JEJA 4QEHA 3TSMA 5CZSA 3QW3A 2V2HA 4MF4A 5I09A 4DWSA 2IQDA 3E3HA 1XWYA 4IL2A 1K3UA 2PTDA 1XBZA 1TTJA 1NWUA 4QGCA 3UEQA 1QOQA 3G3DA 1KFBA 4MUZA 5AHLA 3UG5A 4UBPC 3P3BA 3NDYA 3PVFA 1ZP3A 2WWDA 3ZR6A 4KRTA 4YWSA 3R89A 4HK6A 4B5VA 3WEOA 1YBQB 4X0NA 4J7RA 3C2RA 2INFA 3CC1A 2NWRA 4Q8MA 2JEQA 4AIBA 3N15A 2OWWA 2YA2A 1ADSA 2QIWA 2WJZA 1ECEA 2FKPA 3VA8A 3I4EA 1JCNA 5DT5A 1NF7A 3W73A 4GZIA 1XKJA 6CGTA 1KCLA 3T09A 3AICA 3A4AA 5T9BG 1LYXA 2OZTA 3IACA 2XH0A 4OT7A 5CSSA 2YR1A 5KITA 2HJPA 1GGOA 4MY8A 3I6TA 2V5JA 1UUMA 1UR4A 2HBXA 2J13A 3WH6A 4OVXA 2VEFA 4GOAA 1E56A 1BG4A 3BJTA 1QAPA 3BLPX 3P8IA 4C60A 2E8YA 4Z1AA 3WQOA 2Y7GA 2DIJA 1UD3A 4UFIA 1R46A 2C15A 1AW5A 1EX5A 4HHHA 3KVLA 4R3UA 3OA3A 1DHPA 3IVTA 4R53A 3EKLA 3DYMA 4J3TA 1JGMA 3SN0A 4GGBA 4YU1A 3R7MA 1GVEA 4UXDA 4P2VA 5F7UA 3OPSA 4JFUA 1G4TA 5HOSA 3WKZA 1TCDA 1JZ6A 4CCCA 2I16A 1ZTVA 4XZBA 4BY3A 3ANVA 3NURA 5I24A 3MKCA 1MSSA 1Y5VA 3CV7A 4CN6A 1FWAC 3UETA 3RO8A 1K6AA 2YYTA 5I3JA 4BWLA 5HNUA 1Q6OA 4PMVA 4NRRA 5A6AA 2CKRA 2EO7A 4V1YA 3CU2A 4RL3A 1R7OA 1H61A 5FJTA 2TPSA 2Q3RA 1R9ZA 4MFEA 2EG7A 5D33A 4AMCA 1ICPA 4B9YA 2PDWA 2CLIA 2WKGA 1RXOB 3BTNA 2C13A 4KEVA 3TTQA 3OG3A 3KBJA 5HQLA 2VZUA 3I3BA 4L1WA 4RV3A 1HX0A 3PG8A 1ZFJA 3BAKA 4RDYA 2D3LA 3QMRA 4N4PA 6ALDA 1FH7A 3AI0A 3CZ8A 3GSMA 4ACYA 1C9DA 4F2UA 4WK9A 3OYZA 4B16A 3KTCA 4TQTA 1EXBA 2YLAA 1D3CA 3N29A 1W9BM 3OZPA 4HTYA 5DQPA 3EDKA 3FW6A 3VFCA 5XINA 3NXLA 3A3WA 1XC6A 4ICMA 1M65A 2QPSA 2J7FA 4LUYA 3GG1A 2ZC1A 3AWOA 4LCSA 1GW9A 2V68A 1A53A 1IEQA 1VFSA 4L9ZA 2KZHA 3N11A 1KBLA 4FAMA 3ORWA 2Z2UA 3ZVIA 2NV2A 4RPQA 3MV01 1AQHA 2ZRXA 2WOQA 4WR3A 1EDQA 2PP0A 1W37A 1Y8BA 4ZQNA 3H7RA 4NZCA 1NQ6A 4I9TA 3WH9A 5CKSA 1W3HA 1CGTA 2QPXA 1LLOA 2VDHA 1RSCA 2BVYA 3MHUA 6PTDA 3UZ5A 2GSJA 3CZGA 3UQNA 4J28A 4CUCA 1TPFA 3U48A 3DI1A 3GLCA 1XCXA 1M41A 2GQ8A 3WELA 1SO5A 3CGTA 2PDJA 3G0XA 4GJIA 4IP4A 4N0RA 3R12A 1N8WA 1MYRA 4UTTC 1NVMA 3IIVA 1OT1A 2VELA 4E3VA 4DF0A 1AW1A 1OSEA 1IQ8A 2HDJA 1K7EA 4CGTA 1FWHC 3CT2A 1FDJA 2E1DA 3R1ZA 1PIGA 1F5ZA 3BGJA 3PM6A 3DBNA 4U5KA 3W1MA 3AQUA 4L6OA 2XFWA 4M51A 5HQEA 4CQBA 1W2PA 1YE6A 1AH3A 4JN8A 2XFYA 1BTMA 3HV8A 3FSTA 4BQ4A 3QQ1A 1IXNA 3BLLA 4R9XA 4AFYA 1H49A 3AXHA 2IXUA 1R47A 4LVBA 2J78A 1ZAIA 5EL1A 4QHRA 2BY0A 4JTIA 2E28A 4GJJA 2IPJA 4PMNA 1W3JA 4WY0F 4ADSA 5JH1A 1JAKA 5D2VA 3TN3A 3GUGA 3H54A 1BSLA 2FTYA 2FZDA 3ES8A 3VIIA 5K9CA 4MIMA 3GHUA 4XBKA 2NUYA 3N6QA 3ZLGA 1C91A 1RLCL 3IGUA 1KW1A 1I60A 3UXAA 3BOFA 3UR2A 1UWSA 5A3HA 3P5YA 3S5YA 3VOHA 3FKRA 5LGZA 4GY7A 4NU7A 4D9PA 4KGLA 2VGFA 2VO5A 1KM6A 5C2CA 5U7SA 3SRKA 1G69A 3SY5A 4O1DA 1XIHA 4GFIA 2V5LA 3R10A 2Y62A 5T26A 2Y5SA 3VABA 4O28A 1YNYA 4TV6A 3F5KA 1A5BA 1PUDA 3Q45A 1FBAA 2XM1A 1RJRA 3LCXA 4FMVA 4TO8A 1H09A 2D20A 2WNWA 1GJPA 1AH4A 1YDNA 4MMWA 3VNKA 4ZXOA 2VHLA 4GXPA 5DY2A 4PYSA 1H62A 2Z1KA 1JRBA 2OFJA 1BRLB 4XQ6A 2YDAA 4KPLA 3ZWSA 4JTGA 1UB3A 1L9WA 4AZ6A 3ZWTA 4BA0A 4LB3A 3ISIX 2Z7GA 4PTMA 4O57A 3E2SA 2IXVA 5RUBA 3E02A 4MLRA 3PUDA 3SRHA 5FEZA 8A3HA 4U28A 1P43A 5EB8A 5REQA 4UTFA 4LUSB 2ZUNA 1JD9A 3AZRA 3M4HA 3SCQA 4DJFA 5HDRA 4KCUA 3W26A 1XYLA 2BMBA 3A9IA 4B92A 1CDGA 1G1YA 4HOXA 3WL1A 1TZ7A 4DLMA 1B3VA 5EBAA 1Y5WA 3M0LA 1E6ZA 2NWSA 1LROA 1T99A 3HURA 3I68A 3OW1A 4KWVA 1R3WA 1S5TA 3KP0A 2Y5EA 3E0WA 1J2BA 2PDYA 4FLSA 2EPOA 2GWGA 2PDCA 4C6PA 3R0UA 3T08A 3N2BA 5LXXA 1FKXA 4KETA 4EF8A 1TV7A 3NJ3A 4M19A 4LWWA 3UY7A 4F8XA 1RBOB 1NJJA 3M5ZA 2EBNA 3LZ5A 4CVWA 1LT8A 5FL1A 1JCMP 2UY5A 5CPTA 4AB4A 4AUBA 3NZQA 2VCBA 2VEPA 4RE3A 5AHNA 3H2OA 4ROQA 3B03A 3S46A 3E1F1 2G97A 2VFEA 2WXDM 2A3LA 3WUBA 1I45A 3G1SA 5M3WA 1XYBA 4AW7A 2GDUA 1GVQA 3W7QA 3SAZA 1KFWA 4O1FA 2RGLA 1FCQA 1S2AA 1MQQA 5D8WA 1C29A 3SSZA 6TIMA 5LA1A 1IT0A 3QV7A 3KOXA 2G3IA 3B0YA 3WSUA 3W7OA 1OFPA 4X22A 4P7LA 2XSXA 2EAWA 4LEFA 1TZ9A 5CZKA 2O9TA 2ANUA 4JEQA 1LG2A 4UR8A 3BAJA 2E77A 1EPXA 3UNTA 5I02A 1OIMA 4RJEA 5I3GA 3UR8A 3OB8A 3C3NA 5C9WA 4B2DD 4S1FA 5DMNA 3W2NA 3OODA 1FWDC 4LRTA 3MKKA 2GSHA 4ZOBA 3AXIA 2Z1BA 3NSXA 4S3BA 3EPOA 3QFEA 3D5HA 1OF8A 2RFGA 1AJZA 2VJXA 3OO2A 3WEZA 1F61A 1EUAA 4AY1A 1F4AA 2GL5A 2BHZA 3PPGA 1GVSA 1EIBA 2P10A 3N9SA 3TK7A 1G7VA 4NYYA 3LBCA 3QC3A 3GFZA 3PZOA 2YIHA 3NOYA 4GQRA 3KZPA 3MY9A 4DUVA 1ME8A 1K9TA 3TYZA 1R2RA 3CUJA 2ZZ7A 2V82A 3PBMA 4Y8FA 2NQJA 6TAAA 2WNZA 4HGXA 3WMCA 2GFTA 1TE6A 4MZ1A 2FZMA 2OT1A 1KTBA 2ZX9A 3DKLA 5C7HA 2FMNA 4E4PA 1CYGA 3QYQA 3VX1A 2GJXB 5ABEA 5JXQA 2QCLA 2C0AA 1HW6A 3GXIA 3VIMA 5F2GA 2JALA 3FVDA 2WHLA 4OZOA 4C5YA 2DH2A 1IXQA 1S2CA 4GX9A 4MGGA 3NVDA 4HB7A 1EC9A 2DQWA 2NW0A 2I5GA 3OIHA 4BS0A 2J6VA 4FX6M 4JHZA 2WB5A 3QR0A 4M6UA 4AVOA 1XLDA 4O0QA 1QK0A 4PBEA 1VC4A 1ZRQA 2D73A 5E09A 3TR2A 1KCXA 3EB4A 1MVYA 1CGVA 4L64A 3RMEA 5U4NA 1UR1A 1U1HA 2PMQA 5LIXX 4G56A 1GOWA 3NZGA 3R94A 3QGKC 4IUOA 1WX0A 1Z7AA 3VMOA 2XISA 1RJPA 4DJFC 3TEVA 1H51A 3WMBA 3GXNA 2FQIA 3QLDA 4FR6A 1E6RA 2IQ0A 3UXLA 3HG2A 1DIEA 3P8JA 4R7WA 3URNA 3TTOA 1Z41A 2UY2A 1N2VA 3G8RA 3PZIA 1TE1A 1JZ3A 2Z6JA 2Y8VA 4UB9A 4XZHA 4JQ2A 1CXFA 5LA2A 2ZWZA 2R91A 3F1QA 1KFKA 1JR1A 1OWQA 3DHUA 4L4OA 1OCJA 3H23A 3ZS4A 1Q6EA 4EP8C 4NZFA 3KOZA 3GFXA 2NVDA 2CLLA 3JVAA 3QKZA 3GVRA 4O16A 3TIMA 4ICCX 4AXNA 3APYA 3HA1A 1J6PA 4FZIA 2BGSA 1LF1A 2QUMA 5CPMA 1SO4A 3KRBA 1V6WA 4PTXA 4AXKA 2XVGA 2BVWA 4CQAA 4FHAA 3UZJA 1GOQA 4FSAA 1ODUA 4D6GA 5TIMA 1J96A 3M6DA 5K9DA 2EPHA 1LG1A 3ZQ9A 3N4FA 4QCEA 4B90A 2QCEA 1IZKA 4A8NA 1TJ1A 3PBYA 2FYMA 4PR4A 3CPUA 1W3KA 5C8BB 1V3MA 3A64A 5HMSA 2WM0A 5BOOA 3AHZA 3TC7A 4X2RA 4GQQA 3WCZA 1H7PA 5CZJA 3W1PA 1TPWA 3AZTA 4AIUA 4IX2A 3VILA 1TZZA 3C4UA 5A8GA 1UKPA 1RCXB 3MZNA 3B9EA 3RUBL 3ALFA 1DORA 4WDWA 2YX0A 2XFRA 3T0BA 1X96A 2CPUA 4U5IA 1H5VA 3INPA 1UP3A 1V4YA 1QBAA 1XRVA 1EDGA 2WNQA 1KM2A 1L8NA 3C8NA 2QF7A 1OX5A 3TN5A 5GQBA 1TJ2A 3NOEA 2DP3A 1TJPA 2BB0A 3CJPA 3FS2A 2PA6A 1JDFA 1RCQA 2DDXA 1GYMA 3WQWA 2ODOA 3HOJA 1D9EA 2HMCA 4JTUA 4YHEA 3QRHA 2XINA 2I9UA 5BU9A 4F0RA 1O1HA 2C91A 1R3RA 3VKBA 3ABZA 3UD6A 1TREA 2H6RA 1EXPA 2RHGA 3VGEA 5CSUA 4FI4A 1DTNA 1HTIA 4NAFB 2RDXA 1E1EA 1EOMA 1EGVA 1CTNA 2ISFA 1VP5A 1KFCA 2FFIA 3UR7A 5AOUA 2XIMA 2CHOA 5D2YA 4FA3A 3TV8A 3APGA 4KF1A 1BWLA 2FGLA 5FJOA 4GIAA 3EA1A 3K4WA 4UR9A 2QR6A 5GNZA 2OLHA 4I3GA 1JVNA 3CZJA 4IFKA 3WK3A 1XLMA 1ZJHA 1WUFA 5CEWA 1HGWA 4XD3A 4BI5A 3WJWA 2E5BA 3RLHA 1EJXC 5I00A 3V36A 3MUZ1 3P5ZA 2CZFA 3CQJA 2YDSA 1LP6A 1KR0A 2E5CA 1QVBA 1C8YA 5A1AA 4H9UA 3C56A 4UCFA 1WOBA 4MB5A 2FDMA 1F9CA 2X42A 1CGUA 5TAOA 3MU7A 4B4HA 4ZENA 4BR1A 1PKMA 1YPIA 1R9YA 4S3KA 2IQTA 2O9PA 4JQ1A 2D24A 4X61A 3TQ0A 4DO5A 3NA8A 3GDBA 3NPVA 1JZ8A 2QGHA 3CHVA 5KZDA 3LQGA 2ZUTA 4CNNA 4JN6A 4O15A 3CNYA 3L4XA 4JY8A 4YLWA 5A8QA 5GNYA 1TPH1 5TBOA 4WEVX 4GVGA 3TLLA 3UR5A 4ZQOA 4GACA 4OBTA 4YTQA 4KW2A 1TYGA 1MO0A 3I7RA 4XBJA 2Y89A 3EB3A 3DFNA 1GVFA 4DI9A 3LRMA 1GNXA 3H7UA 3C0JA 3GTFA 1TWIA 1OIFA 3KVKA 2ZUUA 3WNNA 2YLLA 5BOEA 1Y5XA 1S3TC 3T1GA 4CNPA 3LXCA 3W6LA 3CASA 1DE5A 4HNOA 2WMGA 1TIWA 1NTHA 1TIMA 1GKQA 3GWQA 1GQLA 2XDFA 2QHAA 4NRSA 2A79A 3PJTA 3UYCA 1EEXA 4EXQA 2CBIA 1NELA 3N3MA 4NJGA 1XPGA 3UYIA 1R9XA 4GYKA 4R9OA 1ZJBA 2GK1A 5LIWX 3W82A 3BAYA 3ZVHA 3LSBA 3CAVA 1TRIA 4W7VA 3H12A 1PX3A 4GMEA 1E6NA 3WNMA 1V3JA 2VTFA 4CNOA 5JBDA 1GPFA 3OZMA 4FP1A 7ENLA 5JVLA 1DV7A 4AVNA 1KO0A 9RUBA 2X09A 3GYEA 1H7NA 2Y70A 3W6YA 1IF2A 2L5HA 3O1NA 3BLIA 3W7NA 2GJNA 1V8EA 1NM9A 1GKRA 3NO5A 4OU1A 1ISXA 2PDXA 1MEIA 1Q6CA 1S2TA 4G7EB 1AQMA 3O6CA 1W9PA 3OLEA 1S39A 2R8WA 4BI6A 1J18A 1WDPA 1K4HA 3A23A 2D1ZA 4M1BA 5T9CE 2PPGA 1DHKA 4AY7A 1XM3A 3EOLA 4OUEA 3KAOA 1BFNA 3T55A 1OEPA 1AUSL 4C65A 1EFZA 1PB0A 2DT2A 3G0UA 1ODZA 3U8GA 5IFTA 2RAGA 2RDWA 4FXJA 4GJ1A 3RN6A 4LV9A 4S2BA 3M44A 3OVQA 1VBJA 4XISA 3PZMA 2NT1A 1PVNA 3ZXWA 1THFD 4PB5A 1OCNA 3C8FA 2XVNA 1G01A 3KVJA 1UQYA 1Z44A 5J5DA 5REQB 1MWOA 1VLIA 4M8UA 2QS8A 1JYWA 3I6RA 4IISA 1TB3A 4OECA 3BAIA 3DENA 2WJFA 3KCLA 1OYAA 2QJIA 3T42A 4IPJA 1XFCA 1ISWA 2A7PA 3WY1A 3NUKA 1UR0A 4ERAA 4EXBA 3GKAA 3CHCA 1SJDA 3QVQA 2PUZA 4C1KA 1WKFA 1E3XA 3H21A 3W7GA 2Y24A 1WDQA 2FZNA 1TPEA 2X7VA 2G3FA 4GVHA 3VD7A 2X7WA 5I6SA 2DW6A 3UPMA 5FJPA 3MJYA 1UC5A 3EDEA 1BLIA 2PDBA 1K1DA 2HRWA 1LOSA 1EC8A 5EPDA 1MW1A 1UWUA 3OZYA 1N7KA 4UZSA 1HKWA 3PJWA 4GIYA 3MO4A 2VFGA 2EF9A 3ERPA 4IXXA 1EA9C 1PKLA 4UTWC 3HZ3A 4J3UA 1QI2A 3PK7A 2J75A 4Z2KA 3ID7A 3FV9A 1FWBC 4H8UA 1UW9A 4RPPA 4AF0A 3C5QA 1R8LA 2F6UA 3CO4A 2PF0A 2BX7A 4AZCA 3KBNA 1DJXA 3VNYA 1JPHA 2YXXA 3UG3A 4JY9A 1A0DA 1V02E 4L4LA 3EMZA 3POHA 5GVJA 1EJVC 4HTBA 2HVMA 3AIBA 4CD8A 1WE5A 5CPLA 1I2OA 4XZMX 2WANA 1UWRA 5CJNA 3AIUA 2W63A 1RJQA 3EWBX 4JQ3A 4JTLA 3MO7A 2OGYA 4K37A 1XG4A 4MDPA 3ITVA 9XIMA 2QDEA 2VFHA 3FXGA 4U2ZA 2Z29A 2QAFA 1UBSA 3QGAC 2OKTA 3EWWA 1C8VA 3HO8A 1UMYA 1QI5A 1UC4A 1EQCA 4W84A 3LV5A 5CPQA 1HUVA 1MFUA 3AS0A 2J77A 3ZIZA 3R0DA 3N13A 4M0XA 4GLEA 3SI9A 4AEFA 4R33A 2VQUA 3BCFA 1KBJA 4W93A 3BCDA 1EO5A 3A24A 2NLYA 4ZODA 3S2MA 2G41A 2VWSA 3WD3A 4XVEA 4JTAA 1V3KA 3C61A 4E2BA 5DN1A 1LOLA 1NWTA 3DZ1A 2CXEA 1FHUA 1M7XA 2VX4A 4QLJA 3W86A 2NXIA 1E6XM 3VC5A 1K77A 2ACQA 3S83A 2CYGA 3N9RA 3JRKA 3VTRA 4DZ5A 4F9JA 4XKYA 4A2RA 3GH5A 1YPXA 4ZR8A 1P0BA 1MI3A 3MC5A 4W89A 4ZA0A 2WCGA 2ZX8A 4GXWA 3REQB 1D8CA 1G6CA 1H7RA 4NX5A 4L61A 1MZRA 3WDQA 4NNCA 2ISWA 3AIEA 4WGHA 1PZ2A 3AHTA 1RBAA 1K6WA 4Y9AA 3NQFA 3LBOA 4HK5A 3FY1A 4PULA 3QGVA 3O7UA 3SGUA 3EYPA 1UR9A 4YL2A 3PTDA 3U6WA 1XBXA 3DFOA 1TV5A 2E40A 4CQDA 1CENA 6REQB 4GVFA 2R1PA 2TODA 4NNAA 3T9PA 3ITYA 2R6OA 3W7PA 3WLLA 3TCSA 3FJ4A 3LU2A 1RD6A 3DEQA 3L2LA 2XGIA 4BWLC 3IRSA 2YDRA 3GHTA 1AK5A 2WC7A 1AZ2A 1V6VA 1Z89A 3MDWA 5XIMA 1GW1A 2Q01A 4DX3A 1CGXA 2VDIA 4IQEA 2NT0A 4XV0A 3L5MA 4B3ZA 5LNVA 3KRSA 2F7FA 3W3OA 1PTDA 1XYCA 1FFQA 2ZDRA 3P61A 5KETA 4AZGA 3NTYA 3NL3A 3P62A 4J3XA 3ARPA 3H4GA 4D6EA 2MUCA 4O1AA 3VOIA 5E5CA 3AXXA 2TYSA 2WV8A 3G77A 1M01A 3AHXA 3SRFA 1BKHA 1PX4A 4XUGA 5AKQA 8XIMA 4BQ2A 2PDLA 1SM9A 4GXMA 1DIDA 3QOKA 5D9OA 2VXNA 3NQVA 3DG3A 2Z7KA 4PCNA 3GVGA 4JCLA 2EQDA 3FEMA 1FWRA 2XSAA 1GOXA 3LMYA 3VC6A 2CHNA 2HNHA 1OB0A 3W07A 3GRIA 2V5KA 4XUYA 4GNKB 1WUEA 4Q8PA 3MBFA 5FF7A 2OR2A 4PL1A 2YCIX 1JNDA 3MCOA 3LRKA 3HBLA 1B30A 3E0VA 3FYYA 4YIWA 4PSRA 2X1SA 4LY8A 2I56A 3ALGA 2OB3A 3CTLA 3B9NA 3GE7A 4NZ1A 1ZJIA 5HANA 1U30A 3RK8A 2BG5A 4LVDA 4CCEA 5HULA 3SFWA 4NP7A 5I79A 1BYCA 3V4BA 3BLKA 5HXMA 1XW8A 1W1B1 1OC5A 2OOFA 3O16A 4FNUA 4Q4OA 4I5XA 3UZYA 1A5LC 3BC9A 3TWBA 2BOEX 2V3GA 4NAEA 3VE7A 1FWNA 3MMTA 2DIEA 4XAFA 4IPNB 4PSPA 3VZZA 2GGGA 4Z17A 2D0HA 1V0KA 1XUUA 1R30A 1TMQA 1PX8A 3HJEA 3VE9A 3N34A 1EGMA 1K02A 2Y0FA 4W5UA 3UCDA 2YL8A 1NFBA 4D8LA 2C8NA 4ZOAA 1UZDA 2XN1A 2O4QA 3EWUA 3MS8A 1NSJA 1KXVA 4Z2HA 3GDKA 3OA5A 2YJQA 2XYLA 1FWJC 1QDSA 6REQA 4BHYA 2XVLA 4NKCA 4JDBA 2YZRA 4C6FA 3PJXA 4MWAC 1UA7A 2P88A 4PUKA 4QSHA 1OX4A 3LLXA 4IIGA 2Y8KA 3L0KA 4LOCA 1NDVA 2HEJA 1P0DA 3SGGA 1Q2RA 1W31A 3TVAA 4AZ7A 4I7VA 4IH3A 1B9ZA 3AJXA 5AVHA 2PD9A 4REQB 3SW6A 5DBTA 3LHUA 1GQJA 3V0TA 3DDMA 3KHJA 1J8VA 3FNDA 3OJGA 2WMIA 1EJWC 1OFDA 1E9IA 1C7TA 2VRKA 1LJYA 1VYPX 3BOXA 4LC8A 4ORIA 3BWWA 4B4FA 1FRBA 3KL5A 1FWGC 1KM3A 4LGXA 3A22A 1QTWA 2X0YA 3O9NA 3N2TA 2PP1A 3CHEA 3FOKA 3WQ5A 4WX2A 3QMTA 5AZ1A 4Z2IA 2WZIA 2JGQA 1GJWA 1B3XA 4X60A 4J4KA 2V69A 3GDTA 1KTNA 3O0FA 1DE6A 3MCMA 4MAZA 3K13A 2HS8A 1F8MA 3B8IA 4RZ5A 2AL1A 1ME9A 4DM2A 3OHIA 4NSBA 2J7HA 3LD5A 1R3YA 2XTKA 2OODA 3EDFA 1J0KA 3UJFA 4AC1X 2WHMA 1POJA 4EK7A 3QV6A 3BZJA 3R43A 2PE4A 2P76A 4LUJA 1OYBA 4GKTA 4LANA 2IPGA 3W88A 3OU8A 1JI1A 1TPB1 4MZ8A 3C0SA 1BVWA 4URIA 1US3A 1QI3A 3IGHX 2AMGA 1E1CB 5HWJA 3LZ3A 3CH0A 1K9DA 3QBUA 3N04A 3EXSA 3PJUA 2G95A 4Q8QA 4LY4A 3CLMA 2HISA 4GCXA 3N2MA 1WBJA 4F4RA 4QLLA 5E1QA 1XUZA 1S1PA 3LCGA 4GYPA 1NF0A 2ZRYA 1RALA 4JIRA 4M5PA 4K38A 4DYKA 1PJ9A 1VCGA 3E9AA 3B0UX 3FGCA 3W1AA 2A3AA 3HPXA 5GNXA 4PUWA 3GBDA 3GTXA 4FIRA 3UVIA 5EFFA 1K7FA 4KKXA 3G5EA 2QUUA 3B8WA 4ZQRA 2OQLA 4I9AA 3VKAA 1UD8A 1R85A 5C55A 5FAJA 3E74A 5FA5A 5TQLA 3KBMA 1UD6A 1PCKA 2J8FA 3MUAA 4MWAE 1HF6A 2VCCA 5CH9A 4YXGA 1QOXA 3KTSA 4MG4A 5B7ZA 2PFHA 4WQ6A 4AMAA 3MI6A 3OZOA 3WFAA 3EX4A 3W2KA 3B8VA 1T96A 1D3GA 2G8ZA 1DJNA 4OGZA 1WXJA 4D2JA 4XG1A 2BSLA 3PB2A 1P0KA 5HJXA 4W4QA 5G1TA 1EWDA 4AQLA 3TN4A 1TKKA 3CUHA 4ICNA 3RLVA 5TD4A 4GFSA 2DZWA 4LUTB 2Y6ZA 4PUUA 3K8KA 2VFIA 2EPNA 3VD9A 2D22A 4V28A 1B0IA 3NM1A 1OK4A 4Z08A 1J11A 3T0AA 4XTIA 4UQCA 5G2HA 3T0CA 3QF0A 1JPIA 4DJEA 3W23A 4DO4A 2Q02A 3VM5A 1C3FA 2PZNA 2C1HA 4K36A 2Q8XA 2WBKA 3PAJA 5DO8A 1P6CA 4KWWA 3MQTA 4G7EA 3ME3A 1FHLA 4C6LA 2YA0A 5HA7A 3STEA 4DPPA 4BZYA 1E0UA 2ZA2A 1NP2A 3PZ9A 1SSGA 4POCA 1U83A 4M3PA 3WLTA 1X97A 2PD5A 1X39A 1OM0A 4GCAA 1ZUAX 3QOMA 3L4VA 1A3XA 3F2BA 1J0ZA 1JDEA 1HO1A 1FWCC 3HMCA 7TAAA 1HKJA 2I5QA 2WJEA 3F2DA 1SSDA 1OCBA 3JZEA 1AL7A 4C1LA 2VENA 4QXIA 5D03A 2QNEA 3MMUA 5IRPA 4G1NA 1S5NA 4HSNA 3T0DA 1WQ5A 4A22A 3TNBA 3BG3A 2A1YA 3DI0A 1F3XA 5LNRA 4JTEA 2QDDA 4C6BA 3DCPA 2DU2A 2PZ0A 5CJ5A 3TOPA 5D9NA 4FX8A 5H2ZA 4H3DA 5DF0A 4BEUA 1OGBA 1TWZA 3WK1A 1YLVA 3C0QA 2YCLB 3O07A 4JFWA 1A0EA 1DWJM 4UFHA 3ZLHA 1IV8A 3CEUA 1O94A 4KWSA 1B31A 3T4CA 1PEZA 1IIGA 1UP2A 3ZO9A 3CUZA 6XIMA 1FH9A 3OIXA 4K68A 2DUAA 2A3HA 1OABA 1BYAA 1GOOA 1Z48A 3IUHA 2QMJA 4BQ3A 1E6SM 3PUOA 4JKLA 3FLUA 1YXDA 3HG4A 5BXTA 1EC7A 3DYPA 5HJLA 1LWJA 3NZRA 5BCAA 3LHWA 4ZO6A 4GGHA 3GNRA 4RNFA 1BYBA 1SFLA 3M0XA 4RKAA 1S5VA 1W3LA 4NF7A 2Y2WA 4NY2A 4A8LA 3SUTA 3IJ6A 5A94A 3PANA 1C92A 3N9KA 4JGDA 1BXBA 2GYIA 1YDVA 3RR1A 1QJWA 3GO2A 1XYMA 2GDQA 2CFFA 3GC5A 4TMCA 3A5FA 1R3TA 5FL0A 4PMOA 3BQ5A 5E93A 4PB3A 4S3DA 3TE9A 1BQGA 5D32A 4AZHA 4B5XA 4NZJA 4AD2A 3LGEA 5FJUA 1X6NA 4OJYA 4O14A 3LDVA 4YN5A 1UASA 1A5KC 4LVGA 2VEKA 4LBSA 4CD5A 3TJ4A 2QCGA 1V03A 2E9BA 3HPZA 4HPHA 4WOZA 4UWMA 5JBEA 4KEZA 4W7WA 3VKKA 4B3LA 1BEUA 4J40A 3DBPA 1VYSX 5CZ0A 1YKWA 3WQ4A 1G4PA 2A85A 1C7SA 3ABXA 1GQIA 4QJ5B 4ML9A 1RQEA 5F4WA 3R8RA 5HATA 3R8HA 3EB2A 3LXBA 3W74A 2GGHA 3NQCA 3OYXA 1UOZA 4EPDC 3P60A 4PCPA 4G9PA 3VDBA 3GW0A 4PEKA 2EJAA 1I2PA 3EEZA 1XICA 3DERA 5LZLA 3V18A 4E8CA 2B4GA 3NSMA 3V1HA 4HCHA 4H4IA 2XH4A 2WSQA 3K8MA 1XRTA 4MTVA 3PPHA 4LFYA 3GK0A 2D23A 2EHHA 2DT0A 3WLJA 3BH4A 3G1DA 5G1MA 1PWMA 1G7UA 4B9ZA 3B4UA 4JHMA 4MB1A 2QW5A 4F40A 3BICA 2GUYA 3DFHA 3QPZA 4K2SA 1FWFC 2OZ0A 1A5OC 2D0FA 4JTSA 5CC6A 1PO9A 2NSXA 3EKGA 1CLVA 4MY1A 3RDKA 3U7VA 1H0IA 3O6YX 3STCA 4MNMA 1REQB 1M7PA 2YKKA 5BMXA 2FGZA 4IPLA 2YCLA 2FH6A 4LCRA 1TPVA 3GG7A 1PTAA 4ZSTA 1TV3A 1H63A 1E5JA 8RUCA 3EWCA 2EKGA 1RV8A 5A5WA 1X38A 2CU0A 3LGGA 3VCRA 7XIMA 1O60A 2H3BA 4LBUA 3CS2A 3S8HA 1OZQA 4TX6A 1MQRA 3QTGA 3QR3A 1G4SA 4JX5A 3LI0A 2HWGA 4ZL1A 2ZOXA 1FXPA 4QAWA 1ZZMA 3VM7A 1TQJA 5BYWA 3G6MA 1VJIA 1H7WA 3BSHA 3P7YA 3ZM8A 3R13A 4HP5A 3LM3A 3N73A 2OGJA 3MHGA 1I1WA 1N8FA 4PMYA 4PTDA 3W75A 4LBRA 1FP8A 2QUVA 3OOQA 2V2DA 4E2VA 2H8ZA 1W6TA 4EACA 4WY0A 1R7AA 1GPWA 3WLOA 3N6JA 3WD4A 4S3GA 3EPMA 4MDOA 3U9IA 4QDWA 3NPXA 1VPQA 1EJ7L 3M0YA 4KT2A 3W81A 5JBFA 3SQSA 3M5YA 3DFQA 3T2PA 5H6HA 3F2CA 3R5EA 3W7CA 3R11A 3VKCA 2GDVA 4TV5A 1B2YA 1O66A 2VEMA 4IOTA 3WX7A 4CD4A 3ES7A 1KKOA 3CUXA 3CUGA 1KGXA 1EWEA 4JX6A 3IWPA 2PWEA 4XK2A 3HQ1A 1M7JA 1AJ2A 1MMFA 3W9ZA 1XLAA 1F6YA 1GKPA 3PZVA 2QEZA 2D2OA 2G96A 3QYSA 4RLIA 1ITQA 3BGAA 2R1KA 4DBWA 1UOKA 2PTXA 1CGWA 1VEOA 2Z1XA 2WKLA 1HJXA 3G1HA 2OOGA 2R82A 2J79A 4AZCB 1JXJA 1XSKA 3HU7A 2C71A 5A2BA 4ERIA 3M9YA 3UJRA 2CLFA 4LTSA 1V79A 8CGTA 2BXVA 4QX4A 2Z00A 3LPOA 5IDIA 2J9YA 3MSGA 1OFEA 4FLQA 5AHMA 3NWRA 1DQUA 1CXIA 3BPWA 3GU9A 4DXXA 4RNIA 1KLYA 4DVOA 1ITUA 4JYDA 3UXKA 2PLKA 3I7QA 3A21A 1ZU8A 1VCVA 3T44A 1J10A 4CCZA 4LF1A 4WSHA 3CPRA 4DY1A 3UZXA 5C2GA 4PMJA 3G1YA 4UQ9A 3VFLA 4ATWA 3VIPA 3CL8A 2HSAA 1W3TA 4GISA 3VGGA 3KDOA 2I7GA 5A8PA 2PBGA 4I5UA 5A2AA 1W1A1 2E09A 5BRPA 3K5XA 3DFTA 4O1BA 3EWXA 3GXFA 1U2YA 4TIMA 1P6BA 4YCOA 3YPIA 2E5DA 3TCEA 1DKWA 4FNSA 1C9WA 3O05A 3L4YA 1WDRA 3CO8A 4HOZA 4UTUA 1IZCA 3Q2DA 2Y1HA 1RAKA 1DWIM 3W7EA 3HV9A 3ABOA 4JDYA 2W67A 1XLJA 3EMQA 4JOMA 3RGTA 3NZPA 4XB3A 4I6VA 1EJSC 3O63A 4H7CA 4AU0A 1LLZA 1VFHA 3WDJA 4ZFCA 1EHNA 5I03A 1ONXA 1IYXA 2ZZ3A 4O8AA 3KDNA 3USBA 1TJRA 2CWXA 3HGJA 1TVNA 4ZCWA 1X98A 4OOUA 4FPSA 1JEZA 1DWGM 5HBFA 2BHYA 3HQOA 2E4TA 1XS2A 3AYTA 4YS1A 2ZZ1A 1KD0A 2GOUA 4UTJA 4F66A 5D2WA 3WLSA 3ONBA 3VAVA 1AODA 1E0XA 1XIIA 4JTRA 5A6BA 1PE1A 4UNKA 2X1IA 3WBYA 3W72A 1H5YA 1U5VA 2Z1VA 1GVIA 1MNSA 2OELA 2PURA 3RO6A 3TTSA 1BPLB 1IR2A 3PZNA 3WQPA 1L6GA 4K1GA 3DC8A 1F4HA 3BDKA 5JU6A 4CU6A 3PY2A 2WW5A 1A3WA 3GZAA 4I7UA 2C79A 5EFDA 3IJLA 1QOPA 4HA3A 4M80A 1K9FA 1XQKA 3BW3A 2ZCGA 3UA4A 4GQ0A 1X7IA 1EGZA 1OX6A 5I0DA 4CU7A 2YL6A 4JICA 3NDOA 1ISZA 1EF2A 5CCZA 4WJEA 4H41A 3RF9A 3VMPA 3H2EA 3T78A 3W83A 3NQDA 4UTTA 4C7GA 3BO9A 1SO3A 3AMKA 3BG5A 1V6UA 2GLKA 3W27A 1HG3A 1LOQA 3KUMA 3L5AA 3V16A 5JIPA 1KCKA 4BFAA 1SGJA 1FP9A 4F9DA 3H70A 4WZHA 5CXPA 3M5VA 3NEVA 4KERA 4W88A 4GUFA 5DRCA 1F2JA 1W8SA 2GVJA 4I7WA 2C6QA 3SEPA 4IG2A 2ONEA 3D0CA 1WOAA 4PGLA 3EX2A 4MWAA 2ALRA 1D7KA 3N12A 2OYMA 3VIHA 1RCOB 3EX3A 3V0SA 1Q6LA 1SFTA 2P50A 1OFBA 3WNKA 2FPTA 3NR0A 3WLNA 4Q3MA 2BASA 3WNLA 3UW6A 1E1FA 1MXDA 4UTHA 1TVPA 4XZWA 1LQ0A 3DUGA 4Z42C 4HU3A 3W02A 2DZXA 3CUFA 1BWVA 3B05A 5CBJA 1AW2A 3WDRA 1EYWA 2DZTA 3THCA 4ATDA 3MVIA 1HL2A 3EEGA 3LCHA 4OHQA 3A3XA 2J4GA 4ZOEA 4TR9A 3CYVA 3PBGA 5G5IA 1QUMA 4C5ZA 3H4XA 4D6FA 1OCQA 4OUIA 1M9HA 3SCOA 3WQFA 1NDYA 2NZLA 4KWOA 4QG8A 1W17A 1KM0A 4Y9PA 4UMBA 5DELA 1HZYA 2VRQA 4JNMA 2OWCA 3EGJA 1XH1A 1VAHA 4EPBC 5LYRA 1WO2A 1DEDA 1BVZA 1WB0A 2VUYA 3B3DA 3PZUA 4GIRA 2F61A 1X8CA 2VWTA 4US6A 3KCJA 1J5TA 1GTHA 4X2PA 3PTQA 1NAL1 4P7OA 3T8LA 1OGSA 3TU9A 4WXYA 4AH7A 3FCPA 3E5PA 4IIBA 4H9XA 1AD4A 4C6EA 4PB4A 3FXYA 1UBPC 3UY8A 4TVUA 1UD4A 1GCYA 1LQ2A 1GG1A 3T7VA 3AIWA 1ZBKA 2CBVA 1A47A 1J0JA 2VT0A 4IJRA 2ZICA 3LHZA 2ZXDA 4DB7A 5M5DA 1R3VA 3TMLA 3IJDA 1SVDA 4IIHA 1TWWA 3KOWA 4ZBCA 3ZJKA 2Y61A 2QV5A 3SCPA 5I3FA 1A0CA 3OBEA 2ZYFA 3KW3A 1HKIA 3HG5A 2FVMA 1H2JA 1QO5A 3NQEA 3VPLA 3E38A 3VDCA 1LWHA 2AAAA 3WNOA 4FK9A 5CAHA 4FALA 1H1NA 1C8QA 2ZWYA 5A8OA 2JKPA 2ZE3A 1Z69A 2PF8A 3S5NA 1XGZA 3OTRA 4K7YA 4LPCA 4X63A 5HNRA 2DH3A 3IVUA 3VIJA 1NFPA 4Y6GA 3VOFA 1WDDA 3BV4A 2ZKMX 3CV1A 2YB4A 3KL0A 4ACZB 1MUMA 5FJIA 1W1PA 1R6WA 4E8DA 4ES4A 1Q7ZA 2FPVA 3NO3A 4ZTXA 3UPWA 3H2AA 3B0PA 4JHOA 5GPRA 3UZZA 4EOUA 1TFVA 1XYZA 5C6MA 4D8AA 3POCA 1CXHA 4WKFA 1UD5A 3LB0A 2DPEA 5H8PA 2P3EA 1EJUC 2ZXQA 1DWFM 4J9JA 5BWFA 5EMLA 1Q8AA 2VX6A 4DZHA 2AGTA 4DO7A 3TQKA 3DH7A 4DHGA 1V6YA 3WFLA 2HZGA 1W32A 4HCDA 1AA1B 3BK0A 1W56A 2CC0A 3EWYA 4YNGA 2XZ7A 2ON3A 4KIEA 1ZQ5A 1TPC1 1GVRA 2QGYA 4N6FA 4AHPA 2VVSA 5AVNA 3B8DA 3KS5A 4WKAA 3DKJA 2JBMA 4TOQA 1ELSA 4QEEA 1M6JA 2EPKX 4H6QA 4ZTYA 1TG7A 1AD1A 3KFTA 1VFFA 5AC5A 4ML4A 2BODX 1PDZA 3FDKA 1HL8A 1UIPA 4RDWA 1OQFA 2R94A 2WZEA 5LIUX 4IQLA 3FA4A 4F2BA 1ONWA 3GXPA 4C6KA 2J9ZA 2CETA 3W01A 1SW0A 4FXFA 1WXYA 3QXBA 4MHBA 1IEWA 1DP0A 4RZBA 2PGRA 2ZRVA 3C2FA 2P1FA 1PV8A 5EMMA 4FO4A 4QCFA 5A6JA 4N6EA 3TUUA 1VBGA 3RJXA 1GEHA 3AU2A 3O6AA 3QM3A 3BLEA 3PZGA 1UP0A 4J3VA 4HN8A 4I6KA 5D8ZA 5HNNA 4KCWA 3CL6A 3O15A 3GDLA 4H1ZA 1FA2A 2QAPA 2ASHA 2POZA 4M6QA 1IR1A 1NOWA 2VZTA 4LAKA 4AC7C 2CESA 2A4AA 4F0MA 1UUQA 1IIHA 1HXJA 3KM8A 4Z0SA 1LBFA 2O56A 2WK2A 4BK9A 2ZX5A 5G2IA 1KV5A 3LBMA 2NV1A 3WQDA 1YW1A 4XZNX 3CV2A 5SWUA 1F73A 2VC6A 2WVVB 3OG2A 5AC8A 1LL6A 2FB3A 2V8ZA 4PCSA 2BS9A 2A3CA 3UGRA 1OJXA 5AFDA 4GO9A 1Z8AA 3TYAA 1J2WA 4IJBA 1CX9A 3GVWA 4HK7A 1AH0A 4O11A 2W61A 2ZC8A 3W00A 4DAFA 4XTDA 3FKKA 1ZLPA 1BRLA 4WSKA 4PCTA 3ANYA 4L56A 3L9CA 4YPJA 3TXVA 3V7PA 4IFKB 4DJDA 1QRQA 2YXOA 3URQA 3DHFA 3S1VA 4ACZA 4CQ9A 4PRTA 1O6IA 1YQ2A 3KE0A 1NU5A 1RA5A 4W8LA 1XXXA 3R6IA 4P5UA 4N9BA 4OBSA 5I5RA 1IGWA 1ZP4A 3QV8A 1VIWA 3Q94A 5HAOA 4N42A 2DT1A 3WBEA 2WNNA 5MKGB 4IUGA 2INZA 2ZXBA 3MI2A 1X6LA 4C1NA 2FZBA 1Q6DA 1V0MA 3FHAA 4TX9A 3OGVA 2J6XA 2F6KA 4V2XA 4GI6A 1WZLA 1ADOA 3SO7A 4M24A 3SN1A 4WY0B 3TTYA 3VDGA 4RW3A 2JKEA 3SFKA 5DCDA 2WWCA 4US5D 1E3ZA 1LM1A 4XWUA 4JIPA 3TAKA 3O3RA 3UG8A 5BNKA 3FAXA 1PPIA 4XX6A 4KGJA 1K8YA 1QASA 3IJ9A 5C70A 4W8AA 3SDOA 1R86A 4H9TA 3LTPA 1PTGA 3FN9A 2NLIA 1BYDA 4MNKA 4IFRA 2RDTA 4QSFA 2OKOA 1TUFA 2PRMA 2V5DA 1CPUA 4PMRA 5LA0A 4NI3A 1IXOA 3I65A 2J9XA 1OT2A 3GR4A 2VURA 4L4PA 1HVQA 3IK2A 4KWUA 3I4KA 4L6HA 3SJ3A 1SZFA 3TJIA 1GJUA 3L4TA 3M1ZA 2PDQA 1XISA 2I57A 5BU6A 3BCJA 4J3WA 2OEJA 3TROA 1RK5A 3RYSA 4NJKA 3E0FA 1HQTA 4DWSD 3GHSA 1V77A 5KSWA 1B3ZA 4CNSA 2UWFA 3ARQA 5ENLA 4DJFD 4JPGA 2ZVIA 4P61A 1JQVA 3GIQA 4ILSA 1DIOA 3VNDA 1XH0A 3NQBA 4DWDA 2P5NA 2PCQA 1WNOA 1FCBA 3QN3A 4QROA 3CAWA 1KA9F 3VMNA 3W4RA 1NARA 4E38A 4DLFA 1Q4NX 2YCEA 3AISA 1SO6A 4K8EA 2DUXA 2PI6A 3QW4B 3F4WA 2VYOA 3F4CA 3K30A 3W2UA 1XDMA 3B06A 4MVAA 4TX8A 2OLAA 5FF4A 5I77A 4JX4A 2F38A 4X0VA 3M6YA 1E55A 1QNQA 3LS9A 3I6EA 4LF2A 1UR3M 3M5XA 5EY5A 3CV6A 3MBDA 1OC6A 1XIBA 3WBWA 1JPMA 1NP0A 4KCTA 4RDVA 4NVTA 1TR1A 2V81A 2FH8A 1RBLA 3C6CA 2ISDA 4GZEA 3RXZA 1Q7QA 5C5YA 4YVXA 1K8XA 4QRNA 4EE9A 3VIFA 5M17A 1B90A 2B7PA 3S42A 3WQVA 3RILA 1RLDA 4DNHA 2I1OA 4UCGA 1DJWA 3JR2A 1P7TA 1JULA 3TFXA 3TZFA 4C6MA 5EA9A 5M1TA 1X7FA 2HXTA 1KM5A 2FVLA 2QYGA 3NEHA 1VJSA 3DC0A 3SCWA 5I3KA 1U33A 3TW7A 2BY1A 3SZ8A 4B5WA 3W1QA 8TIMA 4TTGA 4IX0A 1FKWA 3BAWA 3T6CA 3WF1A 2JE8A 1KNWA 2E6YA 4NQ1A 2V38A 5DMYA 1KKRA 3QY8A 4LAOA 1GTEA 1S1RA 3DHDA 3N19B 1R87A 1LL7A 4EANA 2VR2A 5F2IA 1O5XA 3W87A 2DY3A 3A12A 3GU2A 4LYRA 2GQAA 3HQPA 4H2CA 4BF5A 3Q37A 4YYCA 1GQKA 5C9ZA 2IKGA 1JUKA 1AJ0A 3GG8A 2C16A 3CK5A 1W9VA 3OGSA 4BI7A 1PHQA 1U5HA 4XSMA 2H9AA 1T6MA 3QR1A 4GO8A 4E8GA 5EBUA 3R4IA 4QE1A 4PH6A 3PF3A 4WJ8A 1UROA 1I2RA 3WDPP 1YNQA 4JTJA 3U5UA 4IMFA 4ZGYA 3RCYA 1BG9A 1A4MA 4W5ZA 1T5AA 1W5PA 3H22A 5C7VA 2W91A 4L1GA 2EEXA 4A05A 2VKZG 3P14A 4G8TA 3RCNA 5TF0A 3RLUA 1ZALA 1OFRA 3CL7A 2ZZ6A 4Q7NA 4S2CA 2C3ZA 2Z2AA 3D3FA 2Y7FA 5AHFA 3PP7A 1HT6A 1A5AA 2RKXA 1FWTA 2HE5A 1OFAA 2EXOA 3T8QA 1W2VA 2OYLA 2QCHA 1KXTA 3WZ0E 4K3ZA 5A8MA 1JPDX 2HQAA 3VD5A 2DV0A 1Q66A 2HCVA 4Q7BA 3PBWA 3K4AA 2OG9A 3UA3A 1ZPTA 4M7SA 1DXEA 4HNUA 4UQBA 1JL8A 4PTVA 2E68A 5KINA 1Q5MA 1O95A 4EVZA 1KV8A 4O53A 1EUNA 1VLWA 4E4FA 4RR4A 1PYMA 2NX9A 3TSDA 4XD6A 1HN1A 4QLKA 5CJMA 2GJPA 3LM7A 1G5AA 4HA1A 4A4AA 1RP8A 1A5UA 4IG2B 3ITCA 3VUSA 4ZEPA 7ODCA 3RMJA 4B5UA 3IUDA 1Y7VA 3ZVHB 3ATYA 3RPMA 3BOLA 2RGMA 3V1PA 3QSRA 1R2SA 2H90A 2VC5A 1JJKA 3T40A 1N8IA 2DZBA 1CNVA 2YOCA 4S3JA 4ZB5A 2NXHA 3GHRA 1TV8A 3TDFA 4NYUA 2VP8A 2WQDA 3KX6A 4G7FA 1P0NA 3V5FA 2VOMA 3NQ2A 1KFLA 1HNYA 1JD7A 5CC5A 4O19A 2ZRWA 4A21A 1SW7A 2W9MA 1MRQA 4TVCA 4C6OA 1MXGA 1QI0A 1S3HA 1KRAC 4P8UA 3KCOA 3TZNA 1J9YA 4UOJA 4GHRA 2VGBA 1W8GA 4NXSA 5FF3A 3MDUA 4H8VA 4Q4SA 4D6DA 5D4YA 2P0OA 1MEHA 2WAGA 1FWIC 3LLDA 3EA2A 5HMFA 3HQNA 2FGBA 3A3HA 3S6TA 1JG9A 3S47A 1V3HA 1QHOA 2VC7A 4AWSA 3VZXA 1I9CB 2VD8A 3M0IA 4LS2A 1QK2A 1EP1A 1CI1A 4PL2A 1XI3A 4UNLA 3VIOA 1XCFA 3U2CA 2X8RA 3B9OA 2YYUA 4H9YA 4O17A 5CC3A 5H8UA 4AEOA 3MP5A 4KFNA 4A8RA 1W1VA 2RUSA 1E72M 3EKZA 3O6DA 3WQGA 2J25A 4H9MA 1MZHA 2VZVA 1TPDA 3F7JA 1DQWA 3S5SA 4O52A 1VH7A 4IFOA 1IEVA 4ZB2A 2X05A 3AYVA 4FNTA 3KWSA 4KQNA 3LCFA 3A9BA 5CBBA 4XKMA 3QFWA 1F07A 1I1XA 4NZ4A 1I75A 2VL4A 1IZJA 1REQA 4LAUA 4JTCA 3JU2A 4LV4A 4QDPA 1QWGA 3M0ZA 2PC4A 1J0IA 2E67A 3L65A 1W1IE 1PSCA 2DT3A 3IGXA 4E2OA 2I5IA 3OBAA 1WKDA 3PSVA 4K1WA 4EAYA 3ECQA 4MWAD 3VNMA 3HMJG 4PE8A 3AXMA 3MYPA 3B97A 3U2ZA 3NQGA 3O2LA 4ZO9A 2DFAA 1KFJA 3WNPA 1ESWA 2X30A 4KBXA 1PAMA 1W91A 1DYSA 3S1WA 2IKJA 3V75A 5JQ9A 1J93A 2YXGA 3RM4A 1VF8A 1UWQA 4JTFA 4GUIA 5BW6A 2IPFA 2FPYA