2AGTA

Aldose reductase mutant leu 300 pro complexed with fidarestat
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Factorizing Selectivity Determinants of Inhibitor Binding toward Aldose and Aldehyde Reductases: Structural and Thermodynamic Properties of the Aldose Reductase Mutant Leu300Pro-Fidarestat Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2agtA00
1SM9A 4XZIA 4DZ5A 4L1WA 3UP8A 3R43A 4WEVX 4AUBA 4LBRA 4EXAA 4JIRA 1X97A 2ACRA 3QKZA 2HE8A 2FZ8A 2PDBA 2PDIA 3R94A 4XZLX 1Z3NA 1C9WA 3EB3A 4ZFCA 5JH2A 1Q13A 1AFSA 2HV5A 3LZ3A 3N2TA 2PDKA 1PZ0A 4QXIA 3MC5A 4GCAA 1EF3A 2DUZA 4NKCA 4PUWA 4WDWA 4GA8A 1Q5MA 1Z8AA 4PR4A 1XJBA 1EKOA 3R8GA 3LN3A 4PRTA 3GHTA 3ONBA 3CV6A 2FZ9A 3VXGA 1S2AA 3U2CA 1ZGDA 2BGQA 2WZMA 1LWIA 2INEA 4R9OA 2HVOA 3GHSA 3CMFA 2ACSA 4XO7A 4YVVA 2PDCA 3BCJA 4GACA 4JTAA 3UZZA 1UR3M 1IHIA 1S2CA 3R8HA 2PZNA 3BURA 3LQLA 5C7HA 2NVCA 3R58A 4XVEA 1T40A 1RALA 5LIXX 4XZHA 1LQAA 4H8NA 2IS7A 4Q7BA 2I16A 2BGSA 3WG6A 4YU1A 1VP5A 3ERPA 1OG6A 2IQ0A 4JTRA 1S1PA 4HMNA 3T42A 4LB3A 4GABA 2DUXA 2ISFA 3RX2A 1QWKA 2R9RA 3R6IA 4PUUA 2IPGA 3COTA 2FVLA 2PD5A 1GVEA 3LNMA 3P2VA 4OTKA 2PDGA 4YS1A 3LENA 2I17A 2PDMA 3LUTA 4DBSA 1ZQ5A 1ZUAX 2HE5A 3NTYA 1MZRA 4I5XA 4JIIX 1YE4A 4DBUA 5LIUX 1Z9AA 5HA7A 3KRBA 2C91A 2DV0A 2NVDA 4FALA 2PDYA 4F40A 1XGDA 2FZBA 1YE6A 2BP1A 1HW6A 2PDUA 3G5EA 2IKIA 1PYFA 5HNUA 2IQDA 4WDUA 2P5NA 2PDWA 3H7RA 4JTDA 3D3FA 2ACUA 5AZ0A 3CASA 1AZ2A 1XF0A 3F7JA 1X98A 2PDPA 4H7CA 3BUVA 1US0A 1ZSXA 1PWMA 4FZIA 5LIWX 2IKHA 2PDFA 1M9HA 3M4HA 1AZ1A 1T41A 3LBOA 4EXBA 1J96A 4Q3MA 4G5DA 3V0UA 2HEJA 2PF8A 1QRQA 5AZ1A 2FZDA 4IJRA 5LIKX 1A80A 1K8CA 4XZMX 3H4GA 4RPQA 2PDXA 4WRHA 3LD5A 2IPFA 2HDJA 2CLPA 3UYIA 1X96A 1JEZA 3V36A 1AH3A 1AH0A 3RX4A 3FJNA 4ASTA 4JTCA 3UWEA 2AGTA 2PDNA 2QXWA 4IGSA 3EB4A 1RY8A 4WGHA 1HQTA 4IJCA 4QBXA 1S1RA 4QX4A 2PDQA 3V0TA 3FX4A 3M0IA 3UZXA 4PRRA 3Q67A 2IKGA 2ALRA 2F2KA 1EXBA 1YNPA 3MB9A 5LIYX 4JQ4A 2HVNA 3WBXA 2PFHA 3GUGA 2WZTA 2PD9A 3LQGA 3UFYA 5M2FX 3GHUA 4MHBA 3G1RA 2FGBA 4GQGA 2PDHA 4QR6A 4GQ0A 1IEIA 4YVXA 1Z89A 4LAZA 3DN5A 5KETA 1MI3A 1PWLA 5JH1A 4JQ3A 3M64A 4LB4A 4XAPA 3UZYA 2PDLA 2A79A 3Q65A 5HNTA 4JQ2A 4XK2A 3UZWA 3R7MA 4L1XA 3LEPA 1R38A 1FRBA 1ADSA 4JQ1A 1MRQA 4JQAA 1EL3A 4XVDA 4WDTA 3H7UA 3O0KA 4ICCX 3C3UA 2IPWA 3B3DA 3DOPA 4XZNX 1YNQA 3EAUA 3WBYA 3RX3A 3CV7A 3V35A 3WCZA 3UGRA 3CAQA 2VDGA 4HBKA 3ONCA 1RY0A 2PDJA 2R24A 3CAVA 4WDXA 2F38A 5DANA 3O3RA 3S3GA 4GIEA 4LAUA 4PMJA 1PZ1A 3GHRA 4XO6A 4JIHA 2PEVA 2IPJA 4JTQA 2IKJA 3BV7A 2ACQA 4YVPA 4FA3A 3WBWA 2INZA 4DBWA 3LZ5A 4LBSA 1VBJA 4FAMA 3UG8A 3V0SA 1AH4A 3N6QA 2J8TA
chains in the Genus database with same CATH superfamily
1SM9A 4B5TA 6PTDA 1RH9A 1U22A 4JTJA 2C13A 4LBUA 4L1WA 5A6SA 2TMDA 3OVQA 3GNNA 4Q8MA 4MSSA 3N3TA 1RPXA 1MUWA 3R94A 4DUXA 3EOUA 1Z3NA 3QLLA 3WLNA 2AQOA 3GG8A 3N6JA 1YDYA 1TX2A 3C4UA 3VGBA 2P10A 3C61A 2PCQA 1LUCA 1TJ2A 1EH9A 1KXQA 3HA1A 3IGUA 3P81A 1F05A 3CZJA 5JXQA 3EXSA 1YMYA 3CO8A 1GPWA 1HTIA 3FDKA 1VPXA 3WQGA 3H2NA 3KBVA 3GHTA 5BXRA 1HKMA 2OX1A 3QBUA 2VELA 3F4DA 1ZGDA 1LWIA 3A4WA 1ME9A 3C0QA 3S0CA 1KR1A 1VFOA 5FKYA 1F8MA 3B97A 3GC4A 3BQ6A 4MF4A 2NV9A 5A6KA 2JEQA 1SU5A 4PRWA 1F6KA 1G6CA 2IUZA 4GACA 2VEGA 1I1WA 1UKPA 2QPXA 5GJNA 2Z2BA 3EMQA 4Z17A 1PKNA 3TEVA 1FH9A 3APTA 4GXPA 5M5DA 3UT0A 4D6HA 5C7HA 4IH3A 2RH9A 5B7ZA 1Y5VA 4ZQMA 4LUSA 4MPQA 1E9IA 2Y8KA 3WJWA 3DIPA 1RALA 4M80A 5LIXX 4QNEA 5E9AA 5HK4A 3WQCA 2GDVA 2XGZA 3UWYA 1FHVA 3GFYA 5HATA 5AECA 4YU1A 4KCTA 1ME8A 2FH8A 5FJPA 2P53A 5REQB 4V33A 3NOYA 1BKSA 1OG0A 5DT7A 5D33A 2H3BA 3FNDA 2Y7DA 5LXEA 1PCKA 3P93A 8XIMA 4DWDA 4BA0A 1PIGA 2G5WA 2NQJA 4IIEA 4MNKA 3UR8A 3WY1A 2Y70A 3BJSA 3SDOA 1FCVA 1AMYA 2X1IA 4R27A 4TO8A 3EDDA 1BYAA 1ODZA 4IMDA 1ZQ5A 3EPMA 2ISDA 3B4UA 3CH9A 3ECQA 4US6A 5EU9A 3VOFA 1DWFM 1MEWA 3S47A 1KM4A 2OWCA 1D8WA 3II1A 3C0LA 3K8LA 4MAZA 1QOXA 3P5ZA 1U83A 4XD5A 1JPMA 3N12A 4NRRA 1YE6A 4HHMA 5BMXA 4XBKA 4G7EB 3W1NA 5AHEA 3BVJA 1EUAA 3KTCA 4HB7A 4B90A 3HG4A 3MI2A 2CLMA 4KCUA 4UNIA 1OYAA 4LY4A 5LA2A 3KDOA 3WQ4A 1ELSA 3WN6A 1P5BA 1HJWA 3OGVA 5D9PA 4MNMA 5F4WA 4L4LA 3F03K 4IFKB 1TTJA 3KE0A 3TU9A 2NT1A 4QE1A 3DHPA 3MVIA 4O17A 1C29A 3LBOA 3EGJA 2R8WA 4W9TA 1JZ8A 3W2KA 1DYSA 3NYDA 1DWHM 1QRQA 1PTAA 3DHDA 1K9TA 5TD4A 1SW3A 4IJRA 4NNAA 4OFCA 1LG2A 2V3EA 4XZMX 2NW0A 3NO5A 1OADA 1E71M 3DEQA 4K8HA 3GX9A 1XQKA 4UC5A 5E9XA 2V5DA 2QCDA 4AB4A 3SRKA 4ZFMA 1E5JA 1DPMA 2AGTA 3M0MA 4CNUA 4L80A 1HJQA 4LOCA 3PJXA 3C2FA 2O9RA 3G1DA 1V6VA 1GGOA 1HQTA 4OVXA 5CLWA 2VZOA 5F1VA 4UBPC 4IQEA 4PRRA 3TN4A 2O92A 2QCEA 2BXVA 1BFNA 5CPOA 5FJJA 3C5QA 5CZ0A 2CHRA 4MB3A 1UZHA 5C2GA 2J13A 4TUFA 3AXIA 2BHUA 3TJXA 3SN4A 3PG9A 4WCJA 3VD5A 1VPYA 3CLWA 3PZQA 4O0KA 4UOZA 4AF0B 3LQGA 3NGFA 3G24A 3GRIA 4OOUA 5C9XA 1YLVA 4WK9A 2X1UA 4Q4OA 3ZLGA 1TV4A 3WL1A 1H1YA 5DXXA 1C9DA 3KWSA 3STPA 4S3JA 2QGHA 1K3UA 3N4FA 4H00A 4BQ3A 1MI3A 3QZ6A 1QI0A 1XDMA 2C6QA 1O6IA 3F4WA 2WSKA 3PFMA 2DZBA 4XAPA 1Z7AA 3I68A 3DDMA 1VR6A 5LSMA 1AK5A 4L1XA 3W1RA 3CZGA 2HPMA 3E3HA 2QAPA 3PPGA 1IYXA 2Q8LA 3R0UA 3HMCA 3QLDA 2OMAA 2VRJA 3VVGA 4P7RA 3BJTA 1KFKA 1JZ2A 4PMRA 2HK1A 4DWSB 2GSJA 5C54A 4JZ5A 3KRZA 4L9YA 1B4EA 2ABAA 3EXTA 4I7WA 2UZ9A 4DPQA 1XS2A 4P8VA 4IPNB 2BY1A 4B5SA 1TE6A 2BV9A 2PDJA 2R24A 3D46A 4UR9A 3SADA 1E3XA 4LT9A 4PMZA 1Q2SA 4ZL1A 2DDXA 3N2XA 1TJ1A 1UZ1A 3JU2A 4NYUA 7ODCA 1QPKA 4AZCA 2E6DA 2X41A 3U4FA 3IV3A 2IXVA 5H8MA 2PGWA 1PB0A 1LZOA 1ZB5A 3H7VA 3GDBA 2VWSA 6ALDA 3H2CA 3OPSA 5LXXA 3ISIX 3VTRA 6TIMA 4MKNA 4MYXA 1A4LA 5HNRA 4B3ZA 2FJUB 2GZXA 5I6SA 4WY0B 1VBJA 1OZMA 2DVXA 4FAMA 4AG0A 3ZLFA 2R1NA 1TELA 1I45A 5EA9A 3BQ5A 2X42A 3VD3A 4AUBA 3AC0A 1YIXA 1KNWA 1ONXA 4H9ZA 3OOQA 2ZXDA 1E6ZA 4OV9A 4ROPA 3W28A 2BHZA 3KXQA 5DT5A 1P0NA 3JW7A 3B8UA 5IDZA 3G8EA 2YKKA 1ICQA 2OOGA 3VIOA 3G0XA 3TONA 3EWUA 5G1MA 1A3XA 1NFPA 1VFFA 5AC6A 5J5RA 1OCBA 3LN3A 3AYVA 2GOKA 1WDSA 1AODA 5HQEA 2C14A 1TJPA 5T9BG 2A3CA 5D2VA 2H8XA 2PBGA 3GHSA 4WIWA 4O8AA 3EWZA 3CMFA 1QBBA 3PN8A 1LLZA 2BVDA 2GVEA 2PDCA 1UIOA 4Z1YA 4NYYA 4YNGA 4GG9A 3WJSA 1BEUA 5ABHA 1FHUA 3DFYA 5D9NA 5KZEA 1L6WA 1AJ2A 4CN1A 2Z26A 1VD6A 3I10A 1JGIA 1BSLA 3VX0A 1FA2A 5BW6A 5CSSA 5FCZA 1LQAA 1FP8A 1C7SA 5DY2A 4FP1A 4XBSA 3NSMA 4AC7C 4LV9A 4NJHA 2H90A 4MTVA 1WDWA 2IQ0A 3L68A 3NQBA 4HZ8A 2Z1KA 4DHGA 4EOUA 2VVNA 2OKTA 4FLQA 1TZ9A 3P61A 1SW0A 4B3KA 3MBDA 2GJRA 3M6YA 5B7YA 3CU2A 4QFUA 3S4TA 1REQB 4MWAA 4QS5A 3COTA 3ARQA 2DZXA 4CKQA 1ZJIA 2QGYA 3WQEA 1VBHA 2PZ0A 1J0IA 3QY8A 3BCDA 3VMNA 4GGBA 3K1GA 1BXCA 3AICA 4M7TA 3QQ1A 1Y8BA 3EWCA 4I5XA 3TOYA 4GPNA 2XIIA 4MZ8A 1Z9AA 2ZUVA 4D6IA 2EF9A 4IISA 4UQAA 1JGMA 1XGDA 5MHBA 2BOEX 2WMKA 1TTPA 2WLZA 1NOWA 4HA4A 1VIZA 5CXPA 4KW2A 2PGFA 4AZIA 1GCYA 2ANUA 4MZ1A 2O4QA 4LAMA 1G1YA 1T5AA 4B5VA 4HNTA 1VZWA 4DQWA 3HGRA 3SUSA 2HQAA 2IW0A 3VNLA 1JCYA 4WY0F 4EX4A 2ZIDA 3KL3A 4LH8A 5EMJA 4JTUA 1PWMA 2IMRA 3TXVA 4DUWA 2ATMA 2VTFA 3OG2A 1W17A 4G5DA 2GYIA 2DPEA 4KFPA 2NXHA 1JPDX 4ORMA 3L65A 4MG4A 3K2GA 1JZ5A 2YCLA 4S38A 3R0DA 5DY3A 5F2LA 4RPQA 4WRHA 1TSIA 4P5UA 1EJRC 2CLPA 2CLOA 3WMCA 4J9JA 3LNPA 2DQXA 2PTDA 2ZA3A 3MUCA 3CZEA 2ZADA 1QU4A 3TZFA 3TC7A 3EB4A 1H50A 5I77A 3HU7A 3CXOA 4HZMA 1FTXA 1G69A 3KOYA 1C8VA 1XIHA 2CETA 4S3BA 3Q67A 1R8LA 4RCXA 1XIIA 4RPPA 1KBLA 1EGMA 3RRAA 5M1TA 2YBTA 4MB5A 1YTEA 5C5YA 3NQ7A 1NU5A 2ISWA 1BYDA 3IAQA 1FH7A 5DN1A 3M0VA 3ZVIA 4K36A 4RZBA 1A3WA 4INFA 2PDHA 4LS0A 2OODA 4DM2A 3NSXA 1V3KA 1GQIA 1JUBA 4H9UA 1KV5A 2A3AA 1UWTA 1JRCA 2VC7A 2DZSA 3LCFA 2CW6A 3LCXA 4X22A 3WLPA 3RM4A 4MNJA 1UP0A 3EX3A 2DT3A 2R94A 3ZSTA 2EJAA 1B3VA 2Y8VA 4ERGA 2AL1A 3HTWA 4JQAA 1G5AA 3M43A 3N4EA 1C90A 1SZGA 3NO1A 1H41A 4LV4A 3B03A 3CUGA 5LGZA 4WKFA 3B3DA 3DFQA 1OFPA 1IZCA 2ICSA 1YHTA 4HN4A 1AW5A 3T08A 1OWQA 5HWMA 5AB3A 2V81A 3MP5A 5M3WA 4UR7A 3T05A 1O5KA 5H91A 2JQXA 1L9WA 3S46A 1JZ3A 1BHGA 3A21A 4OOZA 3LB0A 3PHAA 5ENLA 2P8BA 3U4AA 4C7GA 5EMYA 3LERA 3IVUA 2YZRA 2PWFA 3O8AA 4MJ2A 4NASA 1XR2A 3AIBA 4E4PA 1QO5A 1YYAA 4AIEA 3K4DA 1PV8A 4IGNA 3LX9A 3KVMA 2UY2A 3LCGA 3NVDA 3LTSA 2ALDA 3PBWA 5CQ1A 5J8LA 1OQFA 2P88A 1A5LC 5KEZA 4LVFA 3A13A 4JDBA 5CJMA 2D2JA 3RIKA 3TC3A 3NOEA 1POKA 3OO2A 1LBMA 1MRAA 1LL7A 1D2KA 2J8TA 1V3HA 1VFSA 5H2ZA 4Q4SA 5CPQA 2BZNA 4EXAA 5DCBA 2I5GA 1IXPA 1VHNA 3IK2A 3CMGA 3UPBA 1FWRA 2C79A 5I00A 1C9WA 5I3FA 4ZFCA 4C60A 1DQXA 4ZSTA 3GXIA 4W8LA 4HK7A 2Z1VA 3SGGA 4ZQOA 4DJFC 4Q8WA 4B5WA 1XH1A 1UCWA 1YXDA 2WPBA 4NI8A 2P0IA 3MDUA 1BWVA 5I79A 2HVMA 3CQJA 2EPKX 4HU0A 3M9YA 3BGJA 3Q37A 4TR9A 3VC5A 3PWAA 1LL4A 3FYYA 2VNCA 3A5VA 3PTQA 1L6GA 1UH4A 2EGZA 2J78A 1R7AA 1E4IA 2Y5SA 1IHIA 4C6IA 2VUNA 2WNNA 2QJNA 1B3YA 4E38A 2EJ1A 1RK5A 1ZCOA 4LJ3A 1BD0A 3ZT6A 1R3TA 1BVNP 3A3XA 4YHGA 3AFBA 1TZ7A 3BLFA 5C9UA 2VUYA 4HSHA 3TUUA 1R87A 1H51A 1V3IA 1EFZA 1TG7A 2XU2A 1TWZA 1P0DA 4PUKA 1RCQA 2C7FA 4OZOA 1ZFJA 4AWSA 3WUGA 4UTHA 3B0YA 2DSWA 3BAIA 4GK8A 3MO4A 2CPUA 1XDLA 3RLHA 4KT2A 1S1PA 4NZCA 4LAKA 4KWWA 1SO3A 1O1HA 2VURA 1T8QA 4JHZA 1FWWA 4EE9A 4GZIA 3WF4A 3MHUA 3G18A 4UTWA 4LAOA 4EF9A 3HB9A 1N8WA 3S9ZA 4D9PA 1H11A 5LGXA 1VKFA 4ADUA 3G3DA 4FHAA 4HP5A 3GD6A 2C18A 4QJ1A 3UJEA 2YLAA 1KTNA 2WWCA 4NXSA 3TN5A 5LIUX 3EB2A 3MI6A 4W7WA 4O54A 1QPQA 4LC6A 1CLXA 1WPCA 4E2OA 1MEIA 2QDHA 3Q4DA 3UG4A 3I3BA 1X6UA 2OT1A 5C71A 1OHLA 1OEPA 3VKJA 3WNLA 4XTDA 1TQXA 2P5NA 4GYJA 1Q85A 3RJYA 3MYPA 4IXHA 5BOFA 3D0CA 4H41A 3SR7A 1YBQB 2DORA 8A3HA 1NF7A 4N02A 1UB3A 2GPTA 4GJJA 3L0NA 2X05A 2RGMA 1J10A 3GIQA 4LALA 1UKTA 1ZCCA 5LIWX 1R5YA 5KTLA 4CQDA 1PDYA 3NZRA 3LY0A 3GG7A 1AZ1A 1JDFA 4HQVA 3VMOA 3GWQA 3SAZA 3HPAA 4P61A 2EKCA 3OBKA 3AYRA 3V0UA 1KWGA 5AN7A 3OJGA 2PTXA 4YWSA 1TB3A 1RCOB 3MJMA 1Z41A 3ARXA 3UJRA 3K8KA 1J18A 3KLLA 3PPFA 1HT6A 3FJ6A 3PSVA 2FFIA 1SW7A 2OG9A 4A8IA 3FA5A 4U10A 1X96A 1CGTA 3BO9A 2VFEA 2F9RA 1AH3A 4EXQA 2OTDA 1UR9A 1K9FA 2J7DA 3LV5A 4JS3A 3P67A 3R25A 4NNBA 2WQPA 3NWRA 1C93A 3M07A 1GZJA 1VHCA 4TMCA 4HZ6A 1S2TA 4Z1CA 5FIPA 1WKEA 1RVGA 2QLYA 4W93A 3V0TA 1BAGA 2O9TA 4LNCA 5KZMA 3VOGA 4W87A 1CWYA 1MWOA 2VT0A 3TFCA 1B3OA 4ML4A 2CKRA 5D2TA 3H54A 5EL1A 1RD6A 5BRPA 1ZHAA 1TPUA 5CZJA 3GUGA 2NV1A 2OXNA 2Z1BA 3OIXA 1QDSA 1X6LA 2QNEA 3T2PA 2V8ZA 2G3MA 2PGRA 1Z89A 1JD7A 4ATLA 3BAKA 1PS9A 3R11A 3LRMA 4CCZA 4JQ3A 3WDRA 3PUOA 4CU7A 2WNQA 1TJ0A 1UC5A 3LDVA 3UZYA 3THCA 3EYPA 3CTTA 3R0KA 3PPCA 4R7OA 3LPPA 1OM0A 4F4RA 1R38A 2XYLA 3ZIZA 1PSCA 4Z2IA 5G4HC 6REQB 1LJYA 1BYBA 1VFUA 4R53A 5EGRA 3NQVA 1WUEA 1E43A 4QG6A 4YL2A 4QRNA 3GH5A 1AW1A 2BB0A 3W7QA 3W7RA 4F0SA 4FXFA 3C0SA 4RK8A 4AC1X 5CJNA 3V35A 4QEHA 1SR9A 3PM6A 2H8ZA 2GDUA 4MAVA 1A50A 4XX6A 4ECLA 3G8RA 3H70A 1RY0A 4QLJA 3GUWA 1NDVA 2E68A 4D6EA 1SFTA 3IANA 3WNPA 3SRDA 2DGAA 1R47A 1U5JA 3E12A 2WWDA 5G2IA 5AYZA 2PEVA 1XSIA 3GXTA 3B04A 3S1WA 3SIMA 5DO8A 3KBSA 2WYSA 3FXGA 1NJJA 1JYXA 4LSBA 3PG8A 2GGEA 2ZC8A 1TV7A 4QQ3A 3MP4A 2VVSA 2VHLA 3J7HA 1JIBA 4PSPA 3T9PA 2GQ9A 2W0UA 1OC5A 1XSKA 4NP7A 3GQYA 3PBGA 4HN8A 1TE1A 3G22A 3VOCA 1JF6A 3WDQA 1YXCA 1XLEA 3SZ8A 1BGGA 4A8NA 1O94A 1TYGA 2V0TA 2XGIA 3IGXA 1X97A 4K6AA 1K8XA 2HNEA 1MW1A 1NM9A 3QV6A 3PZGA 1SUXA 1ZP3A 6XIMA 1SJCA 4DJFD 1B9BA 4GCAA 2ZUTA 4IPLA 4NKCA 1I2RA 2D2HA 1WDQA 4A35A 4FOJA 4I90A 1SZFA 1H1NA 4D71A 1JULA 1YDOA 2DQWA 1SZNA 1PJ9A 1RQHA 3ABOA 3NQAA 1Q6LA 2D3LA 2EPLX 3EKZA 3S42A 4Q6JA 4Z1DA 3VIGA 3NQCA 4FNPA 5DEZA 2J9YA 1DXEA 5FD0A 4C5YA 3DHFA 2C0HA 4PMNA 4L61A 1SZRA 1YRRA 2CFFA 2ACSA 2ZKMX 5F2MA 2QUVA 3BCJA 5A6TC 1OJXA 1UP2A 1QNQA 3PBVA 4FLRA 3UZZA 3TTQA 4O0ZA 1IWBA 4DYJA 3RF9A 4ZENA 1SPQA 3KHDA 3OZYA 4UQBA 4NX0A 4OJYA 3IJ7A 3W6LA 2BLEA 4XVEA 2HISA 1ZL1A 1WB0A 2D3NA 1IGWA 3MV11 3PJWA 4QIUA 2IS7A 3PFRA 3GLCA 4HNNA 1L2UA 1Z32X 5GQBA 1DE5A 4HU3A 3DGRA 5E6YA 4JTRA 3GXFA 4N6FA 2QUUA 3WD0A 4H01A 1V02E 4UMBA 1CPUA 1EUNA 2PAJA 4AXKA 1JCMP 3PTMA 2YDRA 3ZS4A 1EEPA 2QPSA 4HOWA 4C6EA 1LUCB 2VEPA 5HMEA 4DIAA 3LNMA 1VYRA 3WUBA 2Z27A 1BQGA 3BSHA 3C2VA 3VNDA 3L4XA 1GJWA 1I9CB 3WLMA 1CIUA 2VC9A 3CZ8A 1S2VA 1VLIA 3UJ2A 3UR2A 1IEQA 2BXZA 4ERAA 2VD9A 1JPIA 2PDYA 3ZSSA 4ZBCA 3TX9A 1XPYA 3AO0A 3SCWA 8XIAA 1B3ZA 4ZR8A 3VD7A 1M1BA 3GDTA 4GO9A 4HZ7A 1EOKA 3DG7A 4Q33A 3ATZA 3P7YA 3M41A 2WVSA 3QY6A 1MYRA 1ZAHA 2VL4A 4X61A 3T55A 5AZ0A 4K39A 1XF0A 4LUSB 2WMGA 8CGTA 1ECQA 1E0TA 3W71A 4HOZA 2WKLA 2V2DA 3M16A 9XIAA 4D1JA 2YCEA 4GJ1A 4ZQCA 3GG0A 4Z1AA 2PMQA 4CGTA 2PPGA 3AHXA 1OC6A 3N19B 3W00A 4O1BA 2MUCA 3NM1A 1KGUA 1GYMA 5AC8A 5FL1A 4B15A 3G2GA 3WDJA 1ADDA 3WK3A 2QCLA 3OIHA 2E1DA 5T9CE 5FOOA 1J12A 1CXIA 2FQIA 4HPGA 4AMAA 2VR5A 4E4UA 4X0NA 2HSAA 2XPKA 3BAYA 1TWSA 3UYIA 5A8MA 4WSJA 1HVQA 1RBAA 1GYLA 1G9HA 3CO4A 5D2YA 2VX5A 4M51A 3IV8A 2FDSA 3BL3A 1MO0A 1W3JA 3H12A 3P60A 4XD4A 1R0MA 4ZB0A 1U30A 3TYEA 4DI9A 4UTMA 3FGCB 1DJXA 1AD4A 2ALRA 1XLGA 4RDWA 4EIVA 1RZMA 4POCA 2VCAA 3HO8A 1ISVA 4OHQA 4QE5A 1HJVA 4WKAA 1VJZA 4NXKA 1SJBA 3HPXA 1XFCA 3FYOA 3UFYA 3V7PA 1K03A 2A6NA 3DKLA 1NF0A 5E0KA 1OABA 2QCMA 5K9CA 4QR6A 5CZSA 1V0NA 3CMJA 3SCPA 3RGTA 1YPIA 3BW4A 1UWRA 4A8LA 3OLGA 2V5JA 1VLWA 3HBLA 4DY1A 3CEUA 4Z0JA 3UVIA 3ANYA 3RHGA 4RUBA 1QPRA 4JQ2A 3VGFA 2RJGA 2CU0A 5FF0A 3SIZA 2QCDB 4DO7A 3QMSA 1OINA 3BZJA 3V5FA 1L8PA 2GUUA 4GQRA 2G8ZA 3OW1A 1NDYA 3F1QA 2WCSA 2TSYA 2UY4A 2QAFA 4C7FA 4RNHA 3RPTA 4D6FA 3AMGA 1ISXA 2CC0A 2GJLA 1SGJA 4KRTA 5CSUA 1PIFA 2BBFA 3IVSA 5C9ZA 4G56A 4QQUA 1TA3A 2VGFA 4BF9A 4ZXLA 3U2EA 4RXFA 4GIEA 3M5XA 3DG3A 4H6EA 3KTXA 3QW4B 1TUFA 4UTTC 1HKKA 3E96A 4M0XA 3GFXA 1SO6A 2JFEX 2QMKA 3N34A 3FSUA 3IIVA 5E6ZA 4Z2KA 1YX1A 4AWEA 3SCTA 7REQB 3RU6A 1D3CA 4DBWA 2PC8A 3APYA 1LOLA 1JZ7A 3CEPA 3T07A 3ICJA 1QOPA 2QS8A 1AH4A 1LBLA 2OYMA 3REQA 1I1XA 1I8JA 4DZAA 4EWND 4HMDA 1X1NA 2Q09A 4CQAA 2EAWA 1G4EA 4JIRA 3KWXA 2D2OA 2FZ8A 4ILSA 3CUJA 3GXDA 1S5VA 1W1ZA 1AL7A 1HIZA 4N2YA 4KCWA 4KQNA 3UWQA 4PBEA 1PZ0A 2J79A 2G4FA 3ABRA 5F7UA 3STGA 4JDYA 1H5YA 1PX8A 4AYSA 4GA8A 1HJUA 3AJ7A 3B9NA 4NZ5A 1Q5MA 3E2RA 1LL6A 3TE9A 4C65A 3POCA 4WXZA 3AROA 4L5ZA 2VMFA 4XKYA 3CV6A 4H04A 1O95A 4H2CA 3WF0A 2VZTA 1W0MA 3HV9A 3A22A 4QSFA 4HCLA 3HZ3A 1TPH1 4AZCB 3H2FA 2BXYA 4R33A 1CB7B 1R3VA 3RM9A 3NL3A 1ZBKA 1NVMA 3U57A 2RHGA 3L4YA 4IHCA 1E6PA 1DIOA 3VABA 6A3HA 5GNZA 1QO2A 1HL9A 2WW5A 2NVCA 3M0JA 4U28A 4EK7A 1K1DA 5ABEA 1ML1A 3HMJG 4H8NA 1GHRA 3ERPA 1S2UA 4GYKA 4JYEA 3HOJA 4N7QA 4LRTA 3P6LA 3QW3A 1EWEA 4B5NA 1K7EA 1KM5A 4DZIA 5D03A 5E09A 2BG5A 1TX0A 3N1AA 1E9ZB 3S5OA 4DO4A 2ISFA 1B3XA 4C7DA 1V3JA 2J62A 1F4HA 4JX4A 2D0GA 4XD6A 3NQEA 2OCZA 4PTNA 3W38A 3GIYA 2SFPA 3UXAA 1KFCA 3G1XA 1M7XA 1G0CA 4YS1A 3CNYA 1GYNA 1UKQA 4H8UA 3TCSA 3PZIA 4NIRA 3ME3A 2B7NA 3G0UA 1A5KC 4MUPA 4D2JA 3A23A 3TJ4A 1SMAA 1NARA 1SYTA 3UU0A 3WEMA 4A6GA 2VGGA 1XKYA 3W7CA 3WYZA 5A3HA 1H1ZA 2Y88A 3NL6A 4B91A 5F2GA 4V2XA 4BF5A 3G5EA 1W3KA 1AQFA 4X9SA 4DWSC 4IPPA 5H6HA 2YGYA 2KZHA 3GVRA 4NZFA 5TAOA 4TQTA 2E8ZA 2NSXA 4G6CA 1H7PA 3ZT7A 5HXMA 4E2VA 1P0BA 2HWGA 1LLWA 2Z28A 3EX4A 3S1XA 3VMPA 1NP0A 5DMMA 4KRZA 3RAOA 4GD0A 4ZGYA 1AMKA 1U5HA 3LCWA 1DXFA 1M03A 1EDQA 3FV9A 1NEYA 3KAOA 4H19A 3VUPA 1FWJC 2PWGA 2ZRXA 3CZLA 4PMVA 3WH6A 1V6WA 2PF8A 3WQ5A 2Z4GA 1RCXB 1DWJM 3HG5A 4A2SA 2QYGA 2OQYA 1QVBA 4GKTA 2HMCA 1XLDA 4MWAB 4PSRA 3CPGA 3N2BA 2ZZ2A 5T8GA 4XV0A 1M5WA 1EGVA 3DHUA 2YLLA 4O50A 1PXGA 4KCVA 3W25A 4WR3A 2J27A 5HUPA 2VWTA 3WQPA 3W07A 4DJFA 1W8SA 2J8FA 4JTCA 3ZVHB 1X39A 2HXUA 4TV6A 2FFCA 4EWJA 1JAKA 1AW2A 2Z1WA 1TWWA 2AOSA 3VIFA 1O12A 1GQJA 2C16A 1JI1A 3B8SA 4IJCA 3MUAA 4KIRA 1EDTA 1J5TA 4O1FA 4E3VA 1UUOA 1HGWA 5HINA 2OZ8A 4GVFA 1WAWA 1IXOA 3BLPX 3N2MA 3B4YA 3BWWA 4JKKA 5CPLA 2O0TA 1D7KA 3QOMA 3BG9A 2WZTA 2Z1XA 3VNZA 3FKKA 1T6MA 2D2GA 4MY1A 4BHYA 3CHEA 2NLYA 1TO3A 4JN8A 4XWUA 5HPOA 1UR1A 4UMCA 4AX6A 1ADOA 4WSKA 2OYLA 2QV4A 4GI9A 2JIEA 4PTWA 4LAZA 5EFDA 3C8NA 1F3XA 5ECVA 3CB3A 3QGVA 2WBKA 2OPJA 2YCLB 2A79A 4Q6XA 4IP4A 4AD1A 1W1YA 1E73M 1RJRA 1LRTA 1H0IA 4PN2A 4NRSA 3S2NA 3U7BA 4B9ZA 5FSEC 4W88A 2HPIA 2OX4A 1EL3A 4P8XA 3URNA 4DLMA 3WF1A 4H3DA 1GT8A 1R7OA 3IJLA 1TPFA 3ARRA 4HYRA 2CLIA 1TUXA 4JIPA 1OF6A 1ICPA 1EJUC 4CD7A 3W7JA 4J3VA 3POHA 3U6WA 2J6XA 2W27A 3UZJA 3KVLA 4KWSA 1EP1A 3CAQA 1R85A 3LSBA 2CERA 3GC5A 3HGJA 7CGTA 2F38A 1DTNA 3GR8A 2BY3A 2ZQ0A 4J3ZA 1ZBWA 2W4XA 2ZRZA 1FCUA 4ICMA 4C6FA 3PZMA 2IPJA 3LM3A 4PUNA 1E4LA 3FXYA 3VIIA 2JEPA 2WHLA 1UW9A 3TYAA 1K6WA 4IGMA 3VDBA 2FMNA 2EG7A 3R4IA 3VIHA 1ZLPA 2INZA 4IWWA 1F8IA 3AI0A 4G1KA 1MEHA 4W85A 3W73A 4FXSA 4R3UA 3S2CA 3V0SA 2ZUUA 1GOWA 4AQLA 3FCPA 4XZIA 4I7UA 4L65A 3WK2A 4ROQA 3IJIA 1JZ6A 3UP8A 1C91A 4JTSA 1HG3A 3AIVA 3BLLA 4M19A 1RD5A 1FP9A 1JCLA 2PCEA 3VIKA 4XSLA 4CD5A 2ABBA 5JH2A 1Q13A 1UKOA 1HZYA 1AQMA 1I2PA 1V6UA 2ATSA 4RDVA 4S3DA 4ZCWA 1XUZA 4PB4A 1EKOA 3R8GA 1B0IA 3KCJA 2VFIA 3DZ1A 1JDAA 2V3FA 3BW2A 4ZO8A 1S2AA 2P3EA 3LXBA 1EHNA 3AMLA 4CVWA 4LS1A 4GIRA 4H7VA 4NJKA 3TLLA 2BHYA 2WSPA 1OX5A 4PH6A 4AD5A 4CD4A 2JGQA 5F2IA 1V51A 4JTLA 1Q66A 3GW3A 2OO0A 4XO7A 3NQMA 5AY7A 3PWIA 5LZLA 4TIMA 4OT7A 2WMFA 3V1HA 2DUAA 3S5NA 2QV5A 1G01A 4ZOEA 5IOBA 3GIPA 5C7VA 3WIJA 4LXFA 3TNBA 2WANA 4FK9A 5G2HA 2CWNA 5KZDA 1TVPA 1Y7VA 1V8EA 3NQGA 1R9XA 3NQDA 3WBEA 4IUOA 4J4KA 4O0QA 4O12A 5CCZA 4PTVA 4GABA 4UTKA 4RE4A 2J4GA 1ITQA 5CG0A 3HPZA 2A3HA 3QEZA 4F48A 3TTSA 2J88A 3W6MA 2CITA 5H1WA 3RLGA 3M44A 3QMRA 3IJQA 3SGUA 1Z48A 3IK4A 4RW3A 1CEOA 4QG8A 1JD9A 4TV5A 3NIYA 1C8XA 3BK0A 1AQHA 3CPRA 1KO0A 4O15A 5LNRA 1WBJA 3VIPA 3K1DA 4M8UA 2VZVA 2ZZ4A 3TW6A 2XVPA 2CBUA 2NV2A 4DWSD 4DXXA 4UFKA 5D02A 3UY7A 3E0VA 1DQWA 1A5NC 2HS6A 4H8HA 1KXVA 1NDZA 2OO6A 3AHVA 4O28A 1E40A 4RZ6A 5TIMA 3ZYZA 1S3HA 1OT2A 3P84A 2WMIA 2C8NA 1LRNA 1XG4A 2YW4A 2P50A 4HU4A 5B80A 1MQPA 3BMXA 1BF6A 1IGSA 4HIBA 3GW0A 1W3NA 2GVLA 1XIDA 1V79A 2XFWA 2EG8A 4RR4A 4IIBA 3KP1A 5D04C 1GVSA 1SSDA 2CLLA 3TAOA 2MANA 2PA6A 4HMEA 5JBDA 1H49A 3W7EA 1FWIC 3S6OA 1IR2A 3WQVA 4XG1A 1GVQA 1MW3A 3LBCA 4CNTA 1F76A 5A2CA 3MMTA 4QP0A 5HULA 1VEMA 4QISA 3L5LA 1CGUA 1UJQA 3T4CA 1LM1A 1R30A 3U5UA 2FDMA 4H2HA 1KRCC 1XYFA 5E70A 3S83A 1EF2A 2PWDA 2WVUA 3T40A 2QUMA 4MFEA 4YLWA 5FJOA 4O57A 4OUEA 3TDFA 2CZFA 2PDQA 2XM1A 3WQWA 3AWOA 4OU1A 3SJ3A 3TP4A 5BU6A 1U2YA 1WE5A 4HNCA 3UXIA 4XD3A 1Z69A 1ITUA 5G1TA 3MKVA 2O7QA 4C6CA 4E6MA 1DWIM 4XTIA 3AS3A 4DX3A 1QMLA 2PD9A 1N55A 3MTWA 4ZO7A 3NPWA 3VIJA 4BQ4A 3RK8A 4LFYA 5C0QA 1H63A 3W3OA 4QAWA 4FEZA 2EBNA 3T0TA 4FNQA 3K46A 4RXGA 5IDIA 3E9AA 5BU9A 3AU6A 1FWEC 2PDLA 3Q65A 2HK0A 4A29A 2WMHA 4Z0SA 3L23A 5I24A 2CZVA 3VGHA 1FRBA 3ITCA 1MRQA 2QMJA 2C19A 1CGWA 1E9YB 4NZ1A 3L7RA 5CLTA 1FWAC 4PEKA 4A21A 4AAJA 3AHTA 4JTHA 4XZNX 4GY7A 2E5CA 1LT8A 5HBFA 4V28A 4OKDA 4GI4A 1G4SA 2EPOA 2B7QA 5FEWA 3EBVA 4J35A 1RR2A 1EX5A 3EWBX 2EO7A 3TH6A 3STFA 1Z42A 4MLJA 4JFWA 3AUOA 2NWSA 3EA2A 4HA3A 3LI0A 3IUIA 1E51A 5FA5A 5AYXA 1WZLA 2DJXA 2WLYA 4GIAA 3S3GA 4C1NB 3ZWTA 1EA0A 4Z08A 1E1CA 1UZDA 1XV8A 4QDMA 3W7GA 4GUFA 4JAWA 4W7UA 5GNXA 1QAPA 3CC1A 4GIYA 3PTKA 2L5HA 4RJEA 4FA3A 1XC6A 2R1PA 3WH9A 1D7FA 1EXPA 3PZVA 3KS6A 1OFAA 2B0MA 4AW7A 3VNKA 3UNTA 3BG5A 1CBGA 2ZDRA 3R10A 1N82A 1YQ2A 1PTGA 6TAAA 2FKPA 3IJ6A 3KLKA 3O06A 3FSTA 4OBTA 1CXHA 3UWVA 4LY8A 1HJSA 2XN2A 4ACYA 1UWAA 1ZENA 3FDGA 3CHCA 4DZ5A 3CIVA 1EWDA 1W31A 1XIMA 3B9EA 2OR2A 3TTYA 3UJSA 2ACRA 3ZJ7A 3HURA 1W3LA 4O14A 4XZLX 3ARZA 3NZGA 2JKPA 1OFOA 4CUCA 4GVIA 5FEZA 3MC5A 2VGBA 3QSTA 4JKLA 3BOLA 2ADAA 4QCEA 2YZ5A 3VDHA 4XISA 3SUTA 1HO4A 3SCNA 1MSSA 3ONBA 3PAOA 4O10A 3TYBA 3L2IA 2FZ9A 4W7VA 1UHVA 1BG4A 3U2CA 3UA3A 4NVTA 1Q6EA 2INEA 4D6CA 1O5XA 4X3ZA 1XCWA 4GJIA 3JZUA 4J28A 4URIA 2PC4A 2BNJA 1GEHA 3EWDA 4KPLA 1M6JA 1W3IA 5I5RA 1X8FA 2P8CA 4A3HA 3EZ4A 3V5CA 1CNVA 3Q58A 2KX9A 3M7SA 2ZVRA 3T6CA 4Q8TA 3R12A 3DC8A 5D2WA 1V0LA 1FWSA 3R58A 2RDXA 4BR1A 2QCHA 2YBUA 5RUBA 1GUVA 5EBAA 4ZTXA 1A0DA 2E6YA 1PE1A 1K70A 2Z0IA 5I3JA 2PRMA 1MW0A 1LRQA 3P62A 2QUTA 1OGBA 3MYOA 4NY2A 1A4MA 3RX2A 1I2OA 2W92A 1VFTA 1UD5A 4I9AA 1NOFA 2A6LA 1OCNA 3QHOA 5TF0A 5DBTA 1GVEA 3HF3A 3WFZA 1ENUA 4B16A 5REQA 2PS2A 1WKDA 3UJFA 4D6JA 1EHAA 2J7EA 4D72A 1JFXA 2YOCA 1D3HA 2D0FA 3UERA 3GVWA 3QZAA 1IF2A 3ID7A 3QYSA 5I3HA 3KRBA 1UD4A 4WKHA 4BF7A 1C3FA 2CZ5A 3BZGA 4LTSA 3PBMA 5A1AA 4Y2WA 2G37A 4WXYA 2OZTA 2YCJA 3W1MA 2A7NA 1EPVA 2XIOA 4M56A 2Z2UA 3MSGA 1KFWA 5K7JA 3CB8A 2XGBA 1GVIA 3LG3A 3SN0A 3PZTA 3LHWA 2FGZA 3TQKA 3VCNA 3VNIA 2E5DA 1K4GA 1OF8A 2VM8A 4UTFA 3FYPA 5LNSA 2QCFA 3AIRA 4H7CA 1ZZMA 3WMSA 1VPQA 1JFHA 2FZNA 1JDDA 4QGCA 4G7EA 1KFEA 3BANA 1M7PA 4ZOCA 4Q3MA 3RUBL 2ISVA 3KRSA 3FS2A 5IM51 3KUMA 1M04A 3HN3A 3T0CA 2X2GA 1TV2A 3B8TA 4F79A 1V7YA 1V5XA 1TMLA 3CPUA 3ZR4A 2X1RA 1XD1A 1Q6RA 3S8HA 1TRIA 3H4GA 4XZ9A 3W22A 2G95A 4IFKA 2XSXA 3WF3A 5FSDC 4LQ1A 3UCQA 3T81A 4DLFA 1W8GA 1NFBA 2GOUA 2A21A 4FR6A 3STEA 3MCMA 3LLFA 1C7TA 4JY8A 2NSOA 3V36A 5A6LA 3NXFA 1WXZA 3FHAA 3L5MA 3CAWA 1EGZA 2QJIA 3O6AA 3K8MA 4ZOAA 4IP5A 4JOMA 3RR4A 2P0OA 1ITXA 2BVWA 1TJRA 2A5HA 1QBAA 4XSMA 1QHOA 3RPDA 4JFUA 4CEUC 1DHKA 1ISZA 1S1RA 4RE2A 3THAA 1BRLA 4Q4QA 5IHSA 1E1EA 4LF1A 1B30A 2HBVA 1UH3A 1DJQA 1WOAA 3PR2A 3UR7A 5IXEA 4AZHA 2ZDSA 4L6DA 1FVPA 4JN6A 1YNPA 1PIIA 3DESA 3B8WA 3JUGA 4O4VA 3CQKA 1JXKA 4ERIA 1ZU8A 3EX1A 3L2LA 1HKVA 1GJPA 2FYMA 5AHFA 4DF2A 1WNOA 5JBFA 5KITA 3EPOA 3H53A 5E1QA 1D3GA 4GQ0A 2C3ZA 1HJXA 3WMBA 3UW6A 5KETA 3E0WA 2DZAA 3HQOA 1XCFA 3VGDA 1OFEA 1G67A 4JFTA 4H9VA 4LS2A 4F0RA 2WK2A 3B40A 3W24A 3DCPA 4YYFA 3AJXA 3B0VC 3BLDA 4KH2A 3RM8A 3O63A 3W1XA 3TW7A 3C3UA 2JF6A 4D6GA 1E1FA 1XW8A 1X7FA 2R6OA 3W4RA 3W26A 3OEXA 1W1A1 5A2AA 4IQJA 1U33A 1XKJA 3W27A 4V1XA 2J9XA 4OV4A 3CWHA 3VNMA 1JDCA 2Q01A 2Y85A 4ZO6A 3LK6A 2Q8XA 4DF1A 3VNYA 5BZAA 3TZNA 1OC7A 2YW3A 1CXFA 2YR1A 3WELA 3EOSA 2BTMA 4NQ1A 2ZA1A 4DWSA 2FVKA 4XO6A 5HQMA 4CQCA 3A5FA 4YTQA 4YVPA 3KVKA 4E4FA 2CHOA 4BK9A 4GI6A 4M6UA 4L6OA 1EA9C 3CAKA 1Q7MA 2GVYA 1PDZA 2FTWA 1TZZA 2X8RA 2Y62A 3GU2A 4AHPA 4Z42C 3N2CA 2PODA 2PWHA 5HWJA 4S23A 4GYPC 1M3UA 1XC4A 1E0UA 2AQVA 1MXDA 1AUSL 2FIQA 3AUJA 4G1NA 4DUOA 1T99A 3G1AA 3QMTA 4ONVA 3RILA 3K13A 2CIPA 3NZPA 3KRUA 3ZMRA 1XCXA 3RCYA 3TN6A 5FF7A 5HPCA 2NX3A 4N9DA 3GXMA 1PL9A 1H7XA 3L12A 4A2RA 3BSMA 3MBFA 4NUWA 1ALDA 3VOHA 2OFJA 2ZZ6A 5EKYA 3B8IA 3DECA 2EEXA 1AA1B 4CCDA 3FA4A 2Y7EA 1OD0A 3PBUA 1TA3B 2HVOA 2VEFA 4KFNA 5I07A 3S2LA 3E5PA 4NL1A 3G0SA 1EX1A 2WKJA 2CCRA 3Q2DA 1YTKA 2ASHA 1JCNA 2WQDA 1Q8AA 2OKOA 4IMCA 4QITA 4CNNA 8TIMA 4Y9MA 2HJPA 1XD0A 4V1YA 3AHZA 3BOFA 4KMQA 4L9XA 1JQXA 2Y8UA 3BLKA 4FX6M 1S5TA 3W2JA 3PZOA 2I16A 4UWMA 4WGXA 3PB2A 4PCNA 3LHYA 4C6LA 4Q8PA 3XISA 3LM7A 3UYCA 4PMYA 1JRBA 4KETA 2OGYA 4MJ4A 3QPZA 1R3YA 1CENA 4GE8A 4F2BA 4CCEA 1EYWA 3GBDA 3W1AA 3DFSA 4DVOA 4PUJA 3EOLA 3SSZA 4GO8A 4QLLA 3P0XA 4N9EA 1F4AA 1L6SA 3VD9A 3CHFA 3U3HA 1FOBA 1XLLA 4AZ5A 4TVDA 1JG9A 5AYBA 1GK8A 3M0KA 4FXRA 3S6DA 1P6CA 3H21A 1TTIA 5CC6A 2X7VA 4QJ4B 1A5BA 3TXZA 1S5WA 1K7XA 1P0KA 1REQA 1B57A 2YFOA 4TVCA 2BP1A 5D09A 4XAZA 3CZKA 1ZJAA 2V69A 2IKIA 4A3YA 3WLTA 3TWBA 3RPMA 2J74A 1EC7A 3FK4A 2PLJA 2HRWA 1GHSA 1FWGC 3D3FA 3A4AA 3W7LA 1Q2RA 1DWAM 4JXCA 2WOQA 4J7RA 4MVAA 3PSWA 4DYKA 1ZP4A 3W70A 4PODA 2PLKA 3BUVA 5G4WA 3DG6A 4S3CA 2PDFA 1LWHA 4JEQA 2W91A 1DJIA 3WD1A 2AKZA 2D73A 4GUJA 1KB3A 4BI6A 3I7RA 2YXGA 5D30A 3KOZA 2ONEA 1GVOA 2FZDA 3G1YA 4IL2A 5JQ9A 1Y5WA 2VRQA 4JNZA 1EYEA 5EYWA 3HPSA 1V08A 1XLCA 3AZTA 1EJXC 1ZTVA 4W5UA 4AVNA 1P7TA 1XDJA 4RKAA 1A5MC 4Y6GA 1QW7A 3LS9A 4Z2GA 2DZWA 2RDWA 3VINA 3W53A 4Z2LA 1F3EA 1BVZA 1S2WA 1A53A 2AGKA 1OFDA 2YL5A 3CT2A 4ACZB 1KTCA 3UBPC 3VX1A 1NWTA 4HGXA 5L6UA 2XFFA 1E55A 1UR0A 4MJZA 1EQCA 1SFSA 3IACA 3AXKA 3TKFA 2DP3A 1ZBVA 3SUVA 1JAEA 1JI2A 4GZEA 2I7GA 2YXXA 1E15A 4GKLA 3C52A 4YN5A 3AHYA 4NNCA 5BOEA 3U5YA 2OZ3A 1TR9A 4JTKA 3TSMA 3B05A 2OZ0A 3F5JA 4TXEA 5JUVA 3L21A 4RNJA 5AHMA 3HFTA 2A7RA 1JUEA 4GQGA 1EJWC 1TPVA 5JU6A 1H60A 1GONA 3BH4A 2EPMX 4HYWA 1NAL1 5MF5A 2V30A 4AX7A 2XSBA 5EY5A 3W2LA 2PLMA 2WM1A 1ADSA 5GVJA 4XUGA 2XHYA 4JR5A 3QR1A 3VDCA 4MNLA 4V15A 4D6DA 2X0HA 3E0LA 1FFQA 3ES7A 1WDDA 1WKFA 4LX4A 1CT5A 4B9YA 1JCTA 1FHLA 3OB8A 1A49A 4GI8A 3B8DA 5FAGA 3PC0A 5CKSA 3AU2A 3TNOA 1G4TA 1LDCA 1GW9A 4LF2A 2ZUWA 2ZBTA 3S5SA 1Q7ZA 4QJ3B 4IT1A 1J93A 2EPNA 1Q3NA 3MWCA 4PMJA 3VC6A 4U2YA 2Y5JA 2X30A 3LGGA 3E38A 2G50A 5AKQA 3ALFA 4R85A 1Q7QA 3FJ4A 3V75A 3AS2A 4L4PA 1MFUA 4HTYA 2A85A 1JNEA 3T7VA 2CKSA 3N29A 5JIPA 2V6AA 2VYOA 1DBTA 2Z6JA 2JIWA 3EX6A 3A9BA 1KC7A 3LCIA 3MUZ1 2F8QA 1JZ4A 3NPVA 2CZEA 1KD0A 1HKWA 3H2EA 2FMOA 4NU7A 3BAJA 3OLIA 4HMCA 3MVTA 4M5PA 4REQB 4O19A 3CIWA 1PUDA 1BKHA 3KDNA 4LBRA 1S3TC 1ISWA 4EVZA 1H3GA 2WC3A 2VFHA 1J11A 2YDAA 1H61A 4JFSA 2FB3A 4IMFA 1KM1A 1L0PA 3N18A 5BXPA 5FEPA 3OA5A 3W81A 2J77A 4XZBA 4QCFA 3B06A 1RVKA 2VEKA 3VZZA 3NXLA 4AEFA 1Z8AA 2P3ZA 3OLEA 4KWUA 2UV8G 2BWGA 2R1LA 4ZMGA 4AXNA 2Z6IA 3GBEA 5ABFA 3C8FA 1BPLB 3S1VA 4BFAA 4M6PA 2GWGA 1EDGA 4RDYA 2WSQA 4NJGA 3UCDA 2P76A 2QKFA 4MLRA 3RG6A 2NT0A 3P74A 5D38A 2W9MA 1TV5A 1BVWA 3BURA 2XH0A 3TC6A 2NXIA 4HA0A 3VO0A 3BMVA 2B7OA 3ZLHA 1ONEA 3NG3A 3USZA 1R2SA 4DN1A 3N3MA 1KLZA 4PUEA 4MDOA 1UROA 3CWNA 1NSJA 1U1UA 1VRDA 4J3TA 2E6FA 3RNDA 1V93A 1VC4A 3LRLA 3EEGA 5DLCA 2J47A 1RV8A 4A3RA 1UWUA 2XVNA 3SGZA 3TQ0A 1WZAA 2YA1A 3ZO9A 4AEEA 2OWWA 5CC7A 3LHUA 2XN0A 1MW2A 2IPGA 2DZPA 1EQPA 3PTDA 4UB9A 4WQ6A 3CYJA 4YTSA 5I06A 4HHHA 4J27A 2FPTA 2G4JA 4HT3A 3N04A 1GZGA 1MMFA 3SCUA 3B9OA 3D6NA 3LUTA 4X0VA 1FKWA 4K37A 2WJFA 3H4WA 4JIIX 2PE4A 4IMAA 4RV8A 4O18A 2FLIA 4K8EA 3MT1A 3CTLA 3MJYA 4F40A 4MM1A 1KCXA 1LOQA 3E49A 4J2MA 3W2UA 4GQQA 5FEXA 4UFIA 2CEQA 1MUCA 4OQVA 3AXHA 3PNZA 1TWDA 2Z00A 4L4MA 3VAVA 4MB1A 4YPJA 3W02A 3H7RA 4JL2A 2AL2B 1VCGA 3S5ZA 2Z1SA 3H2OA 2PU0A 1HL2A 3IUHA 1E56A 2OQHA 1XLAA 1QT1A 4PCPA 5DQPA 1IT8A 1DEDA 3SY5A 3MZNA 3LPFA 4O4WA 2F6UA 3WDIA 3GAYA 2G3NA 1X98A 2B31A 4UTUA 1BWLA 5XINA 1R2TA 2VENA 4GISA 3WD3A 4ZXOA 2O9PA 4FZIA 1GW1A 1HP5A 2B7PA 3LPOA 3N6HA 4PUDA 4PA8A 1RLCL 2QEZA 3BOXA 5A69A 1XH0A 4BQ5A 1ICSA 3QOKA 3PZNA 1KFLA 1V02A 3F4NA 3MSYA 4O1AA 3QV7A 5AZ1A 1AG1O 1FHDA 4JICA 4JYFA 3W7OA 3DFHA 4DPPA 3GY1A 1EIBA 2PDXA 5DRIA 5EPDA 1XX1A 3K30A 3LD5A 2TPSA 3HGOA 2HDJA 2XWDA 1AL8A 2B81A 3TJLA 2V5LA 2HXTA 1XIEA 1EP2A 3QR0A 4Y9OA 1C8QA 1IZJA 4LCQA 3OG3A 3BCFA 2QXWA 1QW8A 1UOZA 3GDKA 2J8GA 2BASA 3CL6A 3GDMA 2V68A 3VOIA 1KM0A 3MY9A 4OIFA 3IWPA 1H7RA 4GHRA 3URAA 3S2JA 1WZMA 4PCSA 2YBVA 1ZALA 2UWFA 3L5AA 3VFLA 3L9CA 1NFGA 4R7WA 4BY3A 4WHBA 4JCMA 3WBXA 1PYMA 2POTA 1HXJA 1FKXA 3DERA 2OLHA 2NUYA 4R88A 5DMLA 2H9AA 3RO6A 2X0SA 1G4PA 1H4PA 4BQ2A 1KWKA 4UQ9A 3N25A 1FY6A 3WMLA 2ZX9A 3CUIA 3GH4A 3WDHA 1W6TA 4AYGA 1FDJA 3GB6A 3OTRA 4OUIA 1TVLA 4I7VA 4LB4A 3KBJA 5C2XA 3N9RA 1R6WA 1F6YA 2WVTA 3IEBA 3SUUA 1LP6A 4NG3A 2DZVA 1XBYA 1I6NA 3FY1A 1DKWA 4MB4A 3WLSA 5TQLA 3W88A 3YPIA 4XVDA 1OFRA 3GXPA 1EP3A 2TAAA 3N15A 3O0KA 1TMHA 1XFBA 4JX5A 3EAUA 3A9IA 1XUUA 3L2MA 4CD8A 1UR2A 3NQ6A 1KBBA 1JUKA 4Q8QA 1DJNA 3LV6A 5CH9A 1DIKA 3FEMA 3ONCA 1B4KA 3URBA 1YNYA 3N14A 1VEOA 1OYBA 1EBHA 1OY0A 1RA5A 4IMEA 2DW7A 5GNYA 3RMJA 4HKPA 4ZODA 4ZE5A 5FL0A 1I60A 2VX6A 1J0ZA 3CHVA 1PZ1A 3LI1A 3W72A 3V16A 4NX5A 4JIHA 2ZXAA 3JVAA 3T8QA 1IWAA 1P48A 2NX9A 2OU4A 3BV7A 1WXJA 4M81A 3MCOA 2ZRVA 1XBVA 1Q6FA 4ZZ9A 3H23A 1ESWA 3G1FA 3CL8A 4OBRA 1UR8A 2VEIA 4E0CA 1F07A 1TTQA 4WOQA 1UR4A 1YTDA 2G41A 2DY3A 4HPJA 4GBDA 1W37A 1UUMA 3Q94A 4ICNA 4ZTYA 3GVVA 3WJYA 2J66A 4NI3A 5H8PA 4F3HA 4HVXA 1E70M 3WNOA 1UKSA 3SRFA 2PDIA 3NDOA 1L6FA 3LXAA 2QCGA 4XAFA 1B90A 4ORIA 1AFSA 2EPHA 1XLBA 1TFVA 3TR9A 4UTJA 4UFMA 2FPYA 4DJDC 1VFLA 4JN7A 2FVMA 3W2MA 3JZEA 3AMKA 4P2VA 4H9MA 2DVTA 3LLDA 4JTIA 3A3WA 4P7OA 2DSUA 4LPCA 1KGXA 3VM5A 1KM2A 2WZMA 3LMZA 4M24A 3PPHA 2R1KA 2ZRYA 2PP3A 3O07A 4MADA 3ATYA 4I6KA 4YCPA 3CM4A 3THUA 2WZIA 1RLDA 3DGBA 3N9KA 5HNNA 3NQ2A 1XP3A 3U48A 3T0BA 3EWXA 1EOMA 3R8HA 4FNRA 3WH8A 3VK5A 4A22A 3EDKA 4PB5A 2CLHA 2BSLA 1XLHA 1UPPA 3MWAA 4RE3A 2V3GA 4UTLA 4DI8A 2OSXA 2X09A 4A4AA 3QM3A 1T40A 2JALA 3VU2A 3UR5A 1A0EA 4IIDA 4JTEA 1G7UA 2BGSA 3SW6A 1OFQA 1F5ZA 4NHVA 5KSWA 1W9PA 2GGHA 4LVDA 4DB7A 4ES4A 2XN1A 2OLSA 5D37A 4H9YA 1J9YA 1FXPA 3TIMA 4W89A 3W83A 1F7BA 4R9XA 1J6OA 3O1NA 4LUYA 3QF0A 3E2VA 3RITA 2DUXA 3QN3A 3ZJ6A 4CQ8A 3W74A 3GTNA 4LVGA 5CGMA 5HMDA 1PAMA 5AYYA 4PUMA 2QDDA 4H9TA 4UOQA 3SRHA 1UQZA 1Q45A 1UWIA 4RX0A 4XUYA 1XLFA 1GOOA 2PDGA 3QQ0A 1J01A 2I17A 2PWUA 2RJHA 2YYTA 2E40A 5DX7A 4IQLA 1YW1A 5A94A 5CPMA 1XYMA 2ZICA 4J3UA 1TPWA 3FEQA 3DBNA 4NAFA 1GG1A 2PLCA 3PP7A 3IGSA 3GE7A 2WZHA 4LANA 3WK1A 2VDHA 3NZQA 1F74A 1X1ZA 4P7LA 5CZTA 1PYFA 1O1ZA 4MMWA 5FJRA 5MKGA 5IRPA 2CLKA 3G1HA 4WDUA 2GJPA 4MGGA 4JIEA 2Y89A 2VQTA 2C1IA 3TLQA 4AZ6A 2Y63A 2I56A 1EO5A 2X40A 6CGTA 4IG2A 3NEVA 1VENA 2IKHA 4M6VA 2QPUA 1Q4WA 3L4WA 3M4HA 4DBDA 4EKJA 1DTUA 4ZSUA 4GUGA 4GYPA 1IIGA 2XFRA 2HEJA 3QY7A 4HHPA 1Q8JA 1DIDA 3HQ1A 1L6YA 4FS9A 2W62A 5I02A 3U0HA 1E4MM 1P43A 1DWGM 1T8XA 4LGXA 1UPMB 4H1ZA 3SJNA 1TV8A 3DU0A 2QIWA 1KFBA 3UXDA 2ZE0A 1ITCA 2YL8A 3VKKA 1X7IA 2RFGA 2WVVA 4S2CA 4JYDA 4YJ5A 3RCNA 4EPDC 3RX4A 4ASTA 1LT7A 3H2MA 1HP4A 5CPSA 2HROA 1C8YA 2PDNA 3RDKA 4WD0A 1HKIA 2QT3A 3WH7A 4EACA 5AHIA 1QNOA 4H7ZA 4Q8UA 4WGHA 1V6YA 3TYZA 1O60A 2V38A 2WO5A 1V3MA 3B0XA 3UZXA 3H8AA 2RGLA 2IKGA 1ZS2A 2A0NA 2F2KA 2Z24A 2VGIA 4LC8A 1PEZA 2ZC1A 4MUZA 2YPIA 1W3TA 4D8LA 2VOMA 1CLKA 2DH2A 2PRHA 4KF1A 1IEVA 3L67A 2O4MA 3IIOA 1BXBA 2C1HA 2VX7A 3WNKA 5KINA 5FESA 3FGCA 1A5CA 1BTMA 4FNTA 2WJZA 4TTUA 3MQTA 1IEIA 1QOQA 3S2MA 4KGLA 4C1KA 2A7PA 1FUYA 1V7AA 2W66A 3L4UA 4U2ZA 2REQB 5DELA 2NWRA 1M68A 2QVNA 1R3QA 3RMEA 4CEXC 4S39A 3WNNA 1WYIA 1NELA 5BXSA 3IJ9A 3OP2A 4Y9AA 1VBRA 1UA3A 4IXXA 2D20A 4DXKA 2YDSA 2E77A 3FJLA 1XYAA 1V77A 3TMQA 4WDTA 1TWIA 1WAUA 3U9IA 1W5PA 1O4UA 1SMDA 1SVDA 2PU1A 2DT0A 4A3QA 4YTRA 3P0WA 3MV01 2IPWA 1K8ZA 2GQAA 3L4VA 2CESA 3SURA 1M7OA 3AISA 2A1YA 2HZGA 4HSOA 1VQTA 1IIHA 3PUEA 4US5D 3SI9A 1BRLB 4LW7A 4WDXA 4G2DA 3OVRA 3ITLA 3B0UX 1YDVA 2CBVA 4PMUA 3UG3A 1QPOA 1W5OA 3DI0A 4LAUA 1XM3A 4PMDA 3FN9A 2J7GA 3ARTA 4IJBA 4JTQA 2EXOA 3E02A 3DKJA 3IIZA 1NWRA 3EX2A 3O6YX 4G9PA 4Y7EA 1BTCA 1DJGA 1QI5A 1T96A 1TIMA 1A5AA 1I0BA 3WBWA 5FACA 3IRDA 5E5CA 3OVGA 2W67A 3VUSA 3GVGA 2OSWA 3NL5A 3R79A 3NM3A 3BV4A 2J24A 3KP0A 1IT7A 1JR1A 4GY1A 4MJMA 4UFJA 2Z25A 5C55A 3NQ8A 4NZ4A 3KOWA 4FNUA 4UQEA 1VCVA 2NQHA 1LTDA 7REQA 4GX9A 1GPFA 4GLEA 5E0CA 2CLEA 1MQRA 2FGLA 4HA1A 5I2UA 1KKRA 4DJDD 3PANA 3TSBA 1UMLA 4WDWA 4OGZA 3ITTA 1QI4A 4X63A 2AAMA 1OGGA 4KEMA 4I8YA 1PKYA 7PTDA 7XIMA 3INPA 5DMNA 3SFKA 3GAKA 2BX7A 4X60A 4ZO9A 1NH6A 2FTYA 4R9OA 3EXRA 3FLUA 3T09A 4LCRA 4CNSA 1SR0A 3WLHA 1J4EA 2D24A 2J7FA 2VP8A 4W84A 3BLEA 3C6CA 2YB4A 4JL1A 3F4CA 4HSNA 4QJ5B 4JTAA 2PURA 1LORA 3A6OA 1R46A 2ZX7A 2PZNA 3H6OA 2NZLA 3N11A 1IZKA 4F0LA 2PI6A 2V82A 3T2QA 3AWNA 3ITOA 3C2YA 2C71A 1OIMA 3UY8A 2GWNA 3R1ZA 3E5BA 2VZSA 3RN6A 4PC8A 1SJDA 1EB3A 4XZHA 5K4ZA 4Q7BA 2VZUA 3GC2A 1QWGA 2PWVA 2J9ZA 2I1OA 4OECA 1EIXA 3BDKA 1BQCA 4MIMA 4I6VA 2J7HA 4EPBC 1WA3A 3QHMA 2QDEA 3ELFA 4DO5A 1BGAA 2WB5A 4GXWA 1Q6GA 3C86A 4RL3A 2R9RA 2CXGA 3W7KA 2Z7KA 1YEYA 2R1MA 3W7NA 4E5TA 4WJEA 2Y24A 3V18A 4KESA 2PD5A 5HJYA 4DJEC 4B4HA 2ZX6A 4MDPA 1SZEA 4CVUA 1TPEA 4DBSA 3CGTA 1HNYA 3NA8A 4IOTA 3SFWA 5C9RA 4HTBA 1ZAIA 3SM0A 3KZSA 3RFAA 4M6QA 1XH2A 2C91A 4HJWA 4QTGA 4FR1A 4Y8FA 4FALA 2XIBA 4MKSA 3GYCA 2PDUA 5CGTA 3TW9A 5DRCA 3MKCA 5HNUA 3UPWA 3GU9A 4C6QA 3C56A 2XVKA 1GG0A 3W75A 1E0XA 3WLJA 1W91A 4UNLA 3MZ2A 3KTSA 3AIEA 4GC4A 3CASA 2YCKX 3WFLA 3F7JA 1P1XA 4HPXA 1WBHA 2ZTKA 5K2ZA 2PDPA 2ZZ1A 3ZOAA 3W7DA 3P8IA 3VFCA 1ISYA 3LBMA 3WD4A 3I65A 2J25A 4BS0A 4PBGA 2UY3A 2OSYA 3M0HA 1LOSA 2OQLA 3ZZ1A 1N7KA 1XL9A 2ZX5A 5I3GA 4LYKA 2WPGA 1GOXA 2E4TA 1W1TA 4GRSA 3A4JA 3NL2A 1XHGA 1R9ZA 1W1VA 1OB0A 5A8PA 4Y90A 2I14A 3THDA 3L0KA 3GR7A 4LEQA 3ITXA 4OBSA 3ZWSA 5A5WA 1RP8A 4KFOA 3AXMA 1WCGA 4Q4RA 2Z29A 3W9ZA 5SWUA 4JTFA 2AQWA 1QTWA 4JGDA 1B54A 3ITGA 3AMCA 2F84A 2YL6A 4G8TA 3UNDA 1MFVA 2XWEA 5C9WA 2O56A 2QJHA 5XIAA 1S39A 1OVDA 4S3GA 3VKCA 1RAKA 3SN1A 3H24A 4HCDA 3TR2A 3TYUA 3GNXA 3DUGA 2PTYA 5J5DA 4RW5A 3ZVHA 2YX0A 4FOUA 4F66A 5LA0A 2Q3RA 3CH0A 2BMBA 1EC8A 2WCAA 4DNMA 1KCLA 1XLMA 3W82A 3KEHA 5GPRA 3RYSA 3EDEA 1GEQA 3T0DA 4IPIA 3MDWA 1E5NA 4JBRA 2GSHA 5XIMA 5M2FX 1EZWA 5I3IA 1OZQA 3LTPA 5HOSA 3BGGA 3DFPA 3FAWA 1A5UA 2XZ9A 2GL5A 5CG7A 3DN5A 3QTGA 4NJJA 3UGVA 1PWLA 3BJFA 2PUZA 3W86A 2QQ6A 3UZWA 2PP1A 1SFJA 5FJIA 1VS1A 3R5EA 2DW6A 1P7TB 3N73A 4O11A 5JBEA 3S5YA 4K1GA 2CZDA 1UD6A 1I2QA 2DSZA 1RP9A 2VQUA 5I03A 1EJVC 3E6EA 1MNSA 1JYNA 1WXYA 5DCDA 4AVFA 1ZRQA 3DOPA 3QYQA 2NXGA 1EBGA 3CUXA 4BWLC 2VOTA 2DVUA 4DEFA 5HMFA 2A2IA 3NUKA 1NQ6A 3GNDA 3IJDA 3UGRA 5CBBA 1W5QA 4F9JA 2VDGA 2RKXA 5CSRA 4UTIA 4AHOA 3W01A 5AHLA 4QSHA 4LYRA 2IQTA 3GNOA 2GK1A 3VE7A 3RXZA 4F0HA 4C6BA 1UASA 3O16A 3GHRA 4LCSA 4PL1A 3W1TA 3O6DA 5D2XA 4GVGA 2HTMA 4FOKA 1B9ZA 3DXIA 3OYXA 3TJIA 2ACQA 5PTDA 1HFBA 1OT1A 1DL3A 2CYGA 1QXLA 4J40A 3W87A 3A4XA 3QJAA 4DZHA 3LXCA 3LHVA 1H7OA 1XPGA 1UIPA 1VAHA 2DEPA 4IUGA 3N6QA 5IHRA 3VPLA 1UA7A 2F7FA 4DYEA 2XISA 2A3LA 2Y4SA 3ARPA 3TWAA 5LYRA 1OBAA 1ONWA 2DIEA 3P3BA 7ENLA 3CYVA 1MNZA 3VCCA 1B2YA 3VE9A 1W56A 1THFD 5D05A 3HQPA 2BDQA 1WZKA 3TYDA 1TKKA 1J0HA 4UOJA 3R2GA 4O1EA 4Q8OA 3KCLA 3KBWA 1RJQA 3O2LA 3N13A 3NPUA 3H2AA 4JPGA 3XIMA 1W1B1 2V5BA 3VXGA 3GNRA 3QPYA 3ARSA 2D69A 4JD4A 5GJMA 2FJKA 1J6PA 4RNFA 2Y7GA 4MY8A 4UCGA 3ALGA 1XG3A 3WEOA 5A6JA 1OD8A 4MYAA 2Y6ZA 3GS6A 4L9ZA 1XBXA 3MMWA 1V4YA 1AQ0A 4IL0A 3OODA 3TN3A 3OYZA 4AD0A 1QUMA 3KL5A 4LVAA 4D1IA 4UMAA 2GJNA 1GOMA 1A47A 3MA8A 4Z2HA 3OBAA 1UQYA 4IICA 4ALDA 2Y0FA 4WJXA 1VP5A 2I9EA 3BICA 2GVJA 3OGSA 2OJPA 4HU8A 3MU7A 2GUBA 2DFAA 4HMNA 4BCEA 4LRSA 5CBJA 2WBGA 4M1BA 1I75A 1CCWB 1QWKA 5JVLA 5LNVA 1XYCA 4DJED 1KCKA 4A05A 3KOFA 4QS6A 3P2VA 4C6OA 4W8AA 3LENA 3MCNA 5LNWA 4PCTA 3FW6A 4JNYA 2UBPC 1UD3A 3CLMA 3NDYA 3NQFA 2DV0A 1UOKA 5ABFB 3SBFA 4E2DA 1K4HA 3UQNA 4US5A 1MVYA 1FWHC 2I57A 5BNKA 2IQDA 4GNKB 2PDWA 2XINA 4K7YA 2Q71A 4J3SA 4CN4A 2VFGA 1MDRA 4GVHA 4D8AA 3EDFA 1B3WA 4M82A 4FLOA 4UZUA 4PGLA 2FTPA 2X1TA 4GWEA 4J3WA 3RR1A 4RZ4A 3GM8A 5CEWA 5E93A 1JPHA 4R7JA 3GYEA 1T41A 3WQFA 1RBLA 4EAMA 4EXBA 5AC7A 5ECUA 5T26A 3ZM8A 1ZBCA 3WF2A 1E6XM 1QNSA 4UQDA 2EKGA 4D8ZA 3FA3A 3W84A 1XGEA 1RHCA 3DH7A 1OFBA 2WJDA 2JK2A 4W8BA 2J6VA 1DJWA 4CQ9A 2V5KA 2ZX8A 4GH1A 4EPEC 4GZJA 4LWWA 1KXTA 1XLKA 3UA4A 4IIHA 4C6MA 3NSNA 3STCA 4X9YA 1A0CA 2RUSA 4IX2A 1AD1A 3ARVA 1H0GA 3AIQA 2HNHA 3NAVA 4DJDA 1AVAA 3C2RA 3VYLA 1UZ4A 5CPTA 1H5VA 4JTTA 2E8YA 1JCXA 2BGNE 1Y65A 3U2ZA 1Q6DA 3HIJA 4XKMA 3EKLA 2BOFX 3KFTA 1SO5A 1UBPC 4CCCA 3NJ3A 2NQZA 3GDRA 3FX4A 1ECEA 4PMXA 3TCEA 1JL8A 1Q4NX 1M7JA 3AS1A 3NFUA 1A5SA 1VGAA 3VDGA 4EANA 1EXBA 1XYLA 1WUFA 1S46A 2OGJA 2V9DA 1KKOA 3GZAA 4EP8C 5LIYX 3CQ0A 4JQ4A 2HVNA 4L4OA 1FCBA 4R34A 4KS0A 4ZQNA 3SQSA 4DRSA 1OK6A 1CXEA 1VRXA 2B4GA 3E0FA 1OX4A 3W6YA 2VCCA 4FF7A 1ZNNA 1ONRA 3ENLA 3LGDA 1MXSA 4AY7A 4MHBA 1KFJA 3KBMA 4TOQA 3NZ1A 3AZRA 1K9DA 1SQ7A 1LQ0A 1KM3A 5C2CA 3AAMA 4Q4PA 5IFTA 3GTHA 3ZJKA 8RUCA 4RV3A 5C6MA 1KM6A 1O68A 2PBOA 4DF0A 3PZUA 4E8DA 4Y96A 2ZZ3A 5HNTA 3I7SA 1HL8A 3H26A 4IMGA 1P6WA 4IF2A 4PTMA 1DORA 4K7VA 3IIPA 4I3GA 3F2CA 1X6NA 4YWIA 1EC9A 2H3DA 4KBXA 3H7UA 1XIJA 4ICCX 5DMYA 4EF8A 1DE6A 5G4EA 5M17A 1YNQA 4DELA 3G6LA 5FJTA 5BWAA 1FDZA 3C0JA 3SQMA 1C92A 3EOOA 1BLIA 3TK7A 1FWCC 2OYKA 3WCZA 1TCDA 2YYUA 4I5UA 3WK0A 4HBKA 4MZYA 1HO1A 3MUY1 1XRVA 3W7PA 5A6BD 2OVLA 3FVDA 5DANA 4J3XA 5EMLA 2DIJA 3O3RA 2FHBA 2NUWA 2EG6A 2ODOA 2WHKA 2GJXA 4TX8A 3ZFHA 3HJZA 3WZ0E 3AIUA 4IIGA 2J7CA 2IKJA 5LA1A 2CBJA 4PE8A 4NAEA 3CBWA 4HJFA 4QLKA 5BOOA 4GOAA 4O1DA 2BFGA 5AOUA 2H9AB 5I78A 1BYCA 1NDWA 3IUDA 3W1UA 1I2NA 5G5IA 4DM1A 1QNRA 5TNVA 3W1QA 4CNPA 1XRSA 4C1NA 3ARUA 4IP7A 4AISA 3P8JA 4B3LA 4QE4A 2ZE3A 1W9BM 3R43A 4WEVX 4QDWA 4V27A 2XIMA 3OZMA 2X0YA 4NSBA 4XIAA 2DZUA 4N4QA 3EB3A 3HV8A 1GOQA 2VO5A 4MWAE 3TOPA 3LZ3A 3RLUA 2PDKA 1AJ0A 1UP3A 3EA3A 4GC3A 4PTDA 4AHQA 4XQ6A 3G1SA 4AD4A 4PUWA 2F6XA 4E8CA 1GQLA 4PR4A 1NQKA 3NR0A 3MMDA 2A3EA 4WX2A 1VFHA 2ZUSA 4C6NA 3GTIA 5BMWA 3HPFA 3M6DA 1XRFA 4LUIA 2BVTA 2VFFA 3A47A 3U8GA 3V4BA 2W3ZA 2PSNA 2Q8ZA 2E6AA 5CBIA 4LU0A 1DIEA 2UY5A 1P1MA 3OQ8A 1VJIA 2P1FA 2V63A 4WJ8A 1M65A 2C15A 3QFEA 4E8GA 2W61A 3USBA 4ZB5A 2RDTA 4ENLA 1JXJA 4B4FA 2ZRWA 3VD4A 1YPXA 3AZSA 2VI0A 1DHPA 1XLIA 4HNOA 1OG6A 4JHMA 1LROA 3TA6A 5BWFA 3D3AA 2QDGA 4AD2A 6ENLA 3VCRA 4B2DD 4RLIA 3GK0A 2FB2A 1FX6A 1WDPA 4HD5A 3WLLA 1BF2A 3PJTA 1VCFA 3R6IA 3ZJ8A 5C70A 3EMCA 3OQEA 1OYCA 5I3KA 4YXGA 3QVQA 5A95A 3LA4A 3WQDA 1F61A 3O6CA 3KW3A 4AZ7A 3MI3A 2HE5A 1IXNA 4HK5A 3MW7A 3PNUA 3I6EA 1HKJA 1IQ8A 3IS4A 2ZWYA 3GNPA 1FWTA 4I9TA 5A8QA 2EQDA 1E72M 2Y1HA 2VKZG 2FZBA 2VC6A 2VEMA 3DFOA 1GNXA 1UH2A 1X8CA 1KBIA 2GDQA 3BXWA 4BI7A 3APGA 1GVRA 4H6KA 1TPB1 2GQ3A 1IEWA 2XM2A 3ZR5A 2OELA 1Q6OA 2INFA 1R3WA 4GXMA 2ACUA 3NURA 3DBPA 1KW1A 5I23A 1AZ2A 2JKEA 2I5IA 3OHMB 4ZEPA 5AHNA 3TTOA 1ZSXA 2ZXQA 1E3ZA 1JYVA 2Y5EA 1M9HA 1NWUA 4KWVA 3UWZA 3I4EA 1J96A 5HDRA 2GFTA 3PUDA 1B1YA 1RK6A 4C6DA 3LMYA 4P8UA 1V0KA 1HN1A 4KKXA 5A2BA 4C6PA 5LIKX 1K8CA 4A8RA 3LU2A 1ZY9A 2QF7A 2Y7FA 3WFAA 3NEHA 1J79A 1D9EA 5BRQA 1J0YA 1RXOB 3NVTA 1VB9A 3TSDA 3G77A 2IPFA 1K7FA 4JTGA 1YXYA 3DYOA 3QZEA 3S9YA 1CXKA 3NPXA 3FJNA 4NAFB 1KXHA 3CT7A 3W1LA 3OLDA 3OVPA 5EB8A 7TIMA 1PHWA 3P5YA 4PCFA 4K38A 1H2JA 2W79A 1KRBC 3K5XA 4J5NA 4AWUA 2I9UA 3SECA 4F2TA 1UD8A 2G3FA 2Q3OA 4MOZA 4QX4A 3VIMA 3WKZA 3QFWA 1FH8A 5MKGB 1V6XA 3PK7A 2CHNA 1KR0A 1RQEA 3EKGA 1WQ5A 3G1VA 4H83A 3UEQA 5EMMA 2Y2WA 3SO7A 4OE7A 2PFHA 3O9NA 3LYEA 1XYBA 1KV8A 3HM7A 3SCOA 4IG2B 2DT1A 3UPMA 3EOEA 3VM7A 2A4AA 1J0JA 4LUTA 3G3MA 1J2BA 3IGHX 3SEPA 2WAGA 5IBXC 1LF1A 4FI4A 4JHOA 2DZTA 2E9MA 3N9SA 1TPC1 4U31A 4X2PA 2RDUA 4YVXA 2AMGA 5CSYA 2QHAA 2X1SA 4YYCA 3L66A 2NUXA 3E1F1 3M64A 5DXYA 3CL7A 5T91A 4FO4A 4IM4A 3N17A 1FBAA 4AY1A 1E4NA 1WX0A 2O9OA 1JDEA 1GKPA 2VDIA 3LEPA 4JQ1A 4QNWA 1Q6QA 1BXNA 4S3KA 4LEFA 2ZYFA 2WVVB 5AVNA 3VKDA 4DJEA 1F2JA 3N2OA 5KZ6A 1IT0A 3M5VA 2V67A 3HFYA 3RO8A 3QC0A 5GJPA 1SJAA 2V2CA 2ZXBA 4NILA 2XH2A 3NNTA 3RX3A 1QHPA 2D0HA 3LSCA 5HR6A 2H6RA 1K02A 3S9IA 3RLVA 3WX7A 1RA0A 2ZFAA 4HCHA 1H7NA 3CAVA 5D9OA 2WC4A 3E0IA 1OK4A 4F0KA 3MSRA 2XH4A 3TQVA 3MP3A 5HJXA 5BXTA 3VZXA 3D5HA 3LOTA 3WJXA 3WD2A 3MMUA 4W4QA 5I7GA 4UUIA 1PX3A 4XB3A 5M03A 2GSEA 1TIWA 3NYZA 5FF2A 3AYSA 1A5OC 2E09A 4WUIA 3TYCA 3WJZA 4KERA 1CGXA 1R2RA 1QHZA 4CQBA 2DSKA 1ZAJA 1SFLA 2E3ZA 4QDPA 4DNHA 4N0RA 2IXUA 2ZA2A 2VC5A 1QI3A 4UIOA 2V3DA 3UG8A 3CWOX 1W2VA 1ZPTA 3UZ5A 1UC4A 1TREA 2XSAA 4PMOA 4H8VA 1CI1A 4YHEA 3WQOA 4IFRA 3JR2A 2HE8A 2X7WA 1ME7A 3T0AA 3WH5A 2YIHA 4I9JA 5BROA 2WNZA 3GXNA 1LBFA 4GUHA 3WSUA 1BG9A 4FNSA 4N6EA 3T78A 1QI2A 1EF3A 2DUZA 4LNYA 1TMQA 2V5CA 4ML9A 3O0FA 4PRTA 2WJEA 3BGAA 1KRAC 4A3UA 3I6RA 1Z6KA 2BGQA 5LKYA 1PKLA 1GQKA 5AVHA 3BTNA 3AYTA 1XIGA 2FZMA 4UTTA 1K9EA 2JKAA 2Z2AA 4K2SA 1W1PA 3TQPA 3P14A 3ABZA 1CB2A 4KRUA 4ATDA 3DFTA 3MHGA 1QNPA 4GX8A 1UR3M 4KIEA 2QVHA 4GUIA 3PUGA 4LYPA 3CJPA 4IX0A 1I0DA 4Q32A 2O7SA 4KGJA 4JCLA 3PJUA 3BPWA 2QR6A 2XTKA 4K3ZA 1WO2A 3PAJA 1XINA 1MUMA 2E9BA 3GKFA 1KTBA 2XH7A 1RJPA 3EWWA 4HOXA 4R5EA 3SQLA 3WLOA 1YKWA 3W7MA 2WHJA 1CW2A 4KEZA 4TX6A 1NWSA 2NQLA 1UWSA 4FX8A 1E6SM 3THQA 1JNDA 1TQJA 1LG1A 1XRTA 4IZGA 1DOSA 1S38A 1OCQA 4AY8A 5BCAA 3WLIA 5AC5A 1KLYA 4G7FA 5C8BB 3NDZA 4I8DA 4OTKA 2GQ8A 2PDMA 4PMQA 2ZZ5A 5HAOA 3I4KA 3LHTA 1MZRA 3W7HA 1JF5A 2V2HA 3I7QA 4U3CA 3SCRA 3BLIA 1SSGA 4BWLA 1W9VA 1GJUA 3A3HA 3S1UA 3VOJA 1WOBA 2NVDA 1WV2A 4O8RA 3ZQ9A 3N4AA 5K9XA 2BY0A 1KRMA 4FSAA 3XINA 4YTTA 2NQ5A 2QUNA 2OB3A 5ABTA 3H22A 4K1WA 2VX4A 4F9DA 4GZ7A 3WLQA 2W63A 5A6BA 2AMXA 4JIQA 9XIMA 2O55A 4PBFA 4QM1A 2WMJA 5K9DA 5CZKA 1H09A 3K4AA 3VKAA 3S6TA 1MQQA 4M7SA 1PBGA 3OZPA 3UCCA 3OA3A 4AF0A 1W9DM 2BODX 4B92A 3QPEA 4UFHA 4F8XA 2NQ9A 3CQHA 4IIFA 3KX6A 3BMWA 2RAGA 1F6PA 4K8GA 4UXDA 1DV7A 2OT0A 3MSDA 4CU6A 3GVQA 2DSVA 2R14A 1O7AA 1Q6CA 5H8UA 4WLCA 2OLAA 2ZZ7A 1W9UA 3GKAA 4GINA 1RQBA 4HYVA 1VFMA 3F5KA 3O15A 5CAHA 3T1GA 3IRSA 2ZOXA 1ODUA 1UG6A 4Q7IA 2J75A 5JIWA 1DVJA 3I3DA 3WENA 1UJPA 1LYXA 1JVNA 5G2WA 1JCJA 4C91A 3GDLA 3AOFA 3M0YA 2VJXA 3UXLA 2JGYA 1H7WA 1Q63A 4WZHA 1OIFA 4ZOBA 1OSEA 2LLEA 1POJA 3WQ6A 3DX5A 3E2SA 4BKNA 1FCQA 1KA9F 3GG1A 1XISA 3MUIA 3ANVA 3AMDA 3NCOA 3B8VA 4FIRA 4ACZA 1QW9A 2BY2A 3BE7A 3C2OA 3UESA 4LUJA 4ZQRA 4HHLA 2G3JA 3P80A 1GTEA 1K6AA 4DUVA 3GHUA 1FWDC 1RPKA 3TROA 3W85A 1LCOA 3PULA 1CDGA 1XSJA 5U7SA 4WY0A 3W76A 3KM8A 4YIWA 1GZ1A 1IV8A 4DXVA 5CC5A 3PY2A 5D4YA 7A3HA 2WC7A 4U5IA 3M5YA 4B2DA 3PVFA 2GUYA 3FOKA 1K8YA 4UFLA 3AALA 5IFPA 1PZ3A 3MUXA 4L1GA 2FPVA 2ON3A 3F2DA 1V6TA 2WKGA 3QQWA 1MDLA 2W6RA 4KEUA 3RCMA 2XDFA 1HUVA 2DJLA 1L8NA 3UD6A 2E5BA 2E25A 4UR8A 2QCCA 3CV7A 2XVLA 4H4IA 2YSWA 1UWQA 2QW5A 1Y5XA 3W0KA 3HG2A 4QEEA 2D23A 5CC3A 2OEMA 3QTPA 1FFRA 3QSRA 4LYQA 4EPKA 3AQUA 5D32A 1NY1A 4QHRA 1EZ2A 1QFEA 1YDNA 4AIUA 3F2BA 5HJLA 1PHQA 4F0MA 3QV8A 3REQB 2WSRA 4S3AA 1CZ1A 4L64A 2C1GA 3S1GA 4AIOA 1VBUA 4XAYA 3AXXA 5BYWA 1CGYA 3QGAC 4WF7A 2XZ7A 4I5RA 1KGWA 1GKQA 3TTEA 3GTXA 2YA0A 4FMVA 3GSMA 4QG9A 3ZXWA 4Y8EA 3V1PA 4PYSA 3PF3A 4PZVA