2BOGX

Catalytic domain of endo-1,4-glucanase cel6a mutant y73s from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
280
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E-2
publication title Crystal Structure of Thermobifida Fusca Endoglucanase Cel6A in Complex with Substrate and Inhibitor: The Role of Tyrosine Y73 in Substrate Ring Distortion.
pubmed doi rcsb
source organism Thermomonospora fusca
molecule tags Hydrolase
total genus 109
structure length 280
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 2bogX00
1UP3A 1UP0A 4I5UA 4AU0A 1GZ1A 2BOEX 1OCJA 4B4HA 2BOFX 3RU8X 3VOFA 1UP2A 3VOIA 1OC5A 3A64A 4AX6A 1OC6A 1DYSA 1OC7A 3ABXA 1QK0A 3RPTA 4I5RA 3VOGA 1HGWA 4AVOA 4AVNA 2BODX 4B4FA 1CB2A 2BVWA 1OCBA 3VOHA 1TMLA 2BOGX 3A9BA 4A05A 1UOZA 1HGYA 1OCNA 1QJWA 4AX7A 1QK2A 1BVWA 3VOJA
chains in the Genus database with same CATH superfamily
1GEQA 1PTGA 4HVXA 5C70A 1F7BA 1OVDA 5JH1A 2HK0A 3TQKA 7ENLA 5I78A 5F2IA 3MWAA 3KTXA 2XUCA 1IT8A 4B5TA 1BEUA 2BP1A 2VD9A 3SQMA 3MUZ1 4N6EA 3OIXA 3GTFA 2I5QA 5D2TA 4QDPA 3WMLA 4ZSTA 3BZJA 2O9TA 1ITQA 1DJNA 3SQSA 3YPIA 3LLXA 3BARA 3E1F1 3P8IA 3PM6A 4UMBA 1X1ZA 1XINA 1OFQA 4FLOA 1JYVA 1IEIA 1RK6A 2HMCA 2VC5A 1LQ0A 1VZWA 3N6QA 4KCWA 2QHAA 1Q6FA 4UFIA 3QLLA 3QY7A 2XVKA 1CLXA 2XYLA 2VZVA 3T81A 1JG9A 3R5EA 1X6NA 2ON3A 3E0WA 1RCQA 4L7ZA 3UWVA 4S3FA 2QF7A 1OX4B 3TC3A 2P5NA 2UY2A 3DIPA 2BXYA 4ZL1A 1WAWA 4XZMX 4H6RA 4HHLA 1R46A 1A5BA 3CHVA 4DRSA 3GXTA 4GH1A 1GUVA 2CFFA 1VRDA 5D8ZA 3BLEA 5A2BA 4QE4A 4MMWA 3F4WA 3P6LA 4D6FA 3UETA 1L6WA 4L9ZA 5HDRA 3IEBA 1W91A 3OODA 2IW0A 2NUWA 3ABRA 4V33A 3NYDA 3C0LA 2QJGA 1EJSC 4ZVJA 4W86A 2ZUNA 1WXJA 4S3JA 3WLKX 3S4TA 3GZ3A 5HWJA 3GTXA 3WD2A 1VFMA 4RCXA 1GOQA 2QNEA 1NDVA 1ALDA 1ITCA 2ZZ6A 5D38A 5I3GA 4RDWA 3QXBA 4RPQA 2FH6A 2QXWA 3QHOA 9XIAA 3VCCA 4ZMGA 5A3HA 5FJRA 4FMVA 3G1FA 4PTVA 4S3CA 4W7WA 3LBOA 3IUDA 1XH0A 2E5CA 2IQTA 2VDIA 1R2TA 1XLBA 4X0NA 2A2IA 1B30A 3TAOA 5JBFA 7REQB 2G4JA 3R1ZA 4FS9A 3W7MA 1JQXA 3SRDA 3MC5A 4AHQA 3VGHA 4A8LA 1JZ5A 3ARUA 3QFEA 1BVNP 2AOSA 1D3GA 3SGGA 4LY8A 1YPXA 1E51A 3WH7A 4MJ2A 1FXQA 3GD6A 3A5FA 4N42A 1XIJA 1A0DA 1XW8A 1FXPA 2ISSA 2HPMA 3PTMA 2FZ9A 4U2ZA 5A8GA 2I16A 1SVDA 1OF6A 3GSMA 3G2GA 3SGUA 3W01A 5G2IA 2ISDA 3ITTA 2F8QA 2J74A 2P8BA 4AZ5A 1KRAC 1G5AA 1US3A 1D9EA 4E38A 3L7RA 2PLMA 3W7CA 1M65A 2WSQA 1CLVA 4OTKA 1JDFA 1RJPA 1XRTA 4W7VA 2RDXA 1IXQA 2DH2A 2NLIA 1UWSA 1XM3A 3LTYA 2BTMA 1UKOA 3TW7A 1H61A 1OYCA 2ZFAA 2ZC8A 1P5BA 1W8GA 5KETA 5ABTA 2QCDA 2PDGA 1RLCL 1B31A 3LHYA 2ACSA 3CAVA 1QHOA 4O16A 2O9RA 3PWGA 5H2ZA 4A3YA 3KOFA 5H91A 3JU2A 2FKPA 1NWUA 4GA8A 2CXGA 3WJWA 2I9UA 1NOWA 5C5YA 1W56A 2G96A 4KCUA 2IQDA 3AS0A 2C18A 4LQ1A 2EPOA 4GY7A 4W5ZA 1ZTVA 2QCGA 3WF2A 3IJ9A 3U57A 4Y8FA 4F2BA 4GNJA 1FKWA 3RPDA 1TA3A 3W2UA 1VBUA 1TYGA 3L2IA 2YW3A 2JGYA 1GVIA 3GFYA 3SUTA 2QCHA 2PRHA 1LOQA 2ZA1A 4KW2A 1K8YA 1WP6A 3QQ1A 4WQ6A 2G5WA 5CC7A 3VZXA 5JUVA 1RP8A 3TNBA 2IUZA 4AIOA 3D0CA 3KP1A 2QKFA 3P0XA 3A9IA 1YDOA 4LVGA 3HV9A 4TTUA 1RZMA 1POKA 4UTFA 4N9BA 2V3FA 2YSWA 2NX9A 3U9IA 2B7QA 3KTSA 1I8JA 3PZTA 4Q22A 4ZQOA 4BQ4A 3SFKA 2WMFA 1J0HA 1G7VA 1DHKA 4FXRA 9CGTA 4GY0A 3SZ8A 4JFTA 1KFCA 4HMCA 3DAQA 3CPUA 3AXKA 4QXIA 1CZ1A 2X30A 1A4LA 1QI2A 3I7RA 5FJOA 3RJXA 5FSDC 1GCYA 1DXFA 4IMEA 1TELA 4JQ1A 3UR5A 1UQZA 3QPEA 3L0NA 1O1ZA 2D0FA 2FB3A 4MLRA 2PWUA 4PMXA 2QPXA 3I4EA 3IGHX 2BVYA 4E4FA 2P76A 2QEZA 2WC4A 4WKFA 1D3CA 3UJ2A 4JIRA 4HA1A 1FCVA 3H4GA 4LEFA 1RA0A 1G4SA 1WZMA 2BY2A 4JTSA 1KTCA 1FHUA 1O94A 2DQWA 2IXVA 4X0VA 3QJAA 2P3EA 3VIJA 4NRSA 3VUPA 2NLYA 1VLWA 3N2TA 2DSKA 3TV8A 1KWKA 4ZOAA 1HKIA 4XG1A 4CCCA 4DNMA 4A6GA 5LXEA 4FNTA 1SGJA 5LHEA 4DIAA 3LHVA 2CYGA 3MT1A 3NIYA 4Y9PA 1K03A 4W8LA 1FX6A 4X9SA 3H2NA 2F2KA 1GOOA 1RVKA 2XM2A 5DXYA 4PMQA 4F0LA 1IYXA 1XYLA 1XGZA 2WO5A 3ZVHA 1H0IA 3EWBX 1SZRA 4GIRA 2I17A 4P7RA 3UZZA 3FEMA 3NQFA 2PTDA 1KFLA 4DZHA 4Z1YA 2GVJA 1EFZA 3IJIA 2AL2A 3PAOA 5K9DA 4JTDA 3UXLA 4HSHA 3AHTA 3V3WA 1XJBA 3FIGA 4KMQA 4CQ9A 3W7QA 2R9RA 3TR9A 5C6MA 2OTDA 2E68A 4XVEA 3R0UA 2Y7EA 3VYLA 5LZLA 3QBUA 2YCLA 4XD4A 2WAGA 3HQ1A 3T8LA 1U1UA 5T9CE 4ZQRA 4NX0A 2REQB 2BHUA 4AVFA 4OWGA 1EF3A 4OHQA 4PE8A 3ELFA 2ACUA 3AYVA 5IOBA 4ZA0A 3M0XA 3UR2A 3H2FA 1NFPA 3ZM8A 2PD5A 3DHFA 3WUEA 4N02A 1XLLA 3LOTA 3F1QA 1XRVA 3UG8A 4DLMA 4NSBA 2QCEA 3W7HA 4ECLA 1UD4A 1OFBA 3PZOA 4W8AA 3MVIA 2CW6A 4FXJA 5BMXA 3RRXA 4HMDA 2Z0IA 3NVDA 1JCXA 3AHVA 2G3NA 4RE3A 4FI4A 4MWAB 1YTKA 4O4VA 4QAWA 3TR2A 4FHAA 4DX3A 2BHYA 2NVDA 3TP4A 1JQVA 1KB3A 3IUHA 3UXAA 3TJIA 5ABEA 4AX6A 5I24A 2VEFA 5JH2A 3EPMA 1GONA 3GH4A 1MXDA 2VFFA 2VWSA 2PDPA 1E5NA 1K8CA 5H8MA 3VKCA 1LT8A 2NQ5A 4US5D 1JIBA 2BY0A 3HN3A 1E70M 3QC3A 4FZIA 5CXPA 4HHMA 5CGTA 2NVCA 3FAXA 5HQMA 1E4NA 1AUSL 1GW1A 2J79A 3LG3A 2BOGX 3UPMA 1PKYA 3FA4A 1TZ9A 4Q8UA 4AZCA 5XIAA 2PAJA 3TIMA 3LERA 2X2GA 3M0YA 4UQCA 3W1AA 4H6KA 4UTKA 3E49A 3V35A 4PBEA 3K13A 1W1IE 3BC9A 3T6CA 2JK2A 1UD6A 3DFNA 1P7TA 4XSLA 3VDGA 3O07A 1TG7A 4MADA 4GGBA 4Q4QA 3H2OA 1CWYA 1KNWA 1P4CA 1TPB1 4DJEA 3NPWA 1R9XA 3FVDA 1UJQA 1DV7A 3AHYA 3V0TA 3QMSA 5HA7A 3VX0A 1S2AA 1JD9A 1KBIA 1AMKA 2VENA 1IEXA 3G1XA 1AD1A 4KWOA 2O9OA 1W9PA 2YXXA 3EOLA 4Q8QA 3AMGA 3DXIA 1EJVC 3WQGA 3BLDA 1U83A 1HKMA 3TH6A 3E38A 3G6MA 1PS9A 5HXMA 1O4UA 4H9XA 4R9XA 2GWGA 2LLEA 3LQGA 5FKYA 1EH9A 3FGCA 4HTBA 3UCCA 4XV0A 4GG9A 4X2RA 4UQDA 3GAKA 5CPMA 4NZ1A 2ZX7A 2A3AA 2Y5SA 1FHLA 2X41A 2OX4A 1DIDA 4JGDA 3F5JA 2W91A 1JF5A 1LQAA 3HF3A 3O05A 3SURA 1ZZMA 1TX0A 2AKMA 3H2AA 3FS2A 4GACA 3RDKA 2NUYA 4QNEA 1ONEA 3N9KA 1D7FA 3VOFA 3TEVA 4XAGA 4D6JA 3EA2A 1S1PA 4UXDA 1XIGA 4WCJA 3T4WA 3DU0A 2MUCA 3GHUA 2ZUWA 2PGEA 3B0PA 3QMTA 1UYQA 4OU1A 3AUJA 5D9PA 4XO6A 3FDGA 4OKDA 1ODZA 3HG5A 2TYSA 4PUJA 1JCNA 4TR9A 2C13A 1KA9F 3NNTA 3RITA 2FYMA 5HK4A 4LYQA 1L2UA 1A0CA 4C6QA 1EQCA 3OHMB 4GJ1A 2NZLA 1O5XA 4KIEA 1ML1A 3CZ8A 1BAGA 1N7KA 3W0KA 2CNCA 1V79A 1LM1A 3ANUA 4E4PA 2BMBA 3NQ2A 3PPGA 4U5KA 3WLNA 1RBLA 1XYFA 4QS6A 5LYRA 1XLKA 3KBVA 3WLLA 4NZJA 4CD5A 5KTLA 1ZHAA 3F2BA 3LXBA 1JUBA 3RK8A 4YTSA 3BW4A 3VGDA 2D0GA 3ES7A 5LHFA 3LCWA 1LZOA 2V67A 2X1IA 5HR6A 4PTNA 1R87A 2PFHA 3DKLA 2DT0A 3U0HA 2BX7A 4NG3A 2E8ZA 3VOJA 1H50A 2IPFA 1B4KA 2QZRA 4JNMA 2Q3RA 2H90A 2J13A 4JIQA 5DY2A 3CHEA 4DZAA 3C8FA 2R6OA 2FIQA 2WYSA 3W2LA 4W87A 7XIMA 1XLIA 3PF3A 1ZSXA 1ADDA 4KETA 4A29A 1G4EA 3GG1A 3B4YA 4FPSA 4AD4A 5A6BD 4K2SA 1EWEA 2BBFA 4PTDA 4C6DA 4BI6A 2ZRUA 3NYZA 1IE7C 1UUQA 1NVMA 2Y85A 4C6JA 1YLVA 1W5NA 3VMOA 3NR0A 1EZWA 2V5JA 4L9YA 1PPIA 2DSWA 4TX8A 1TREA 5ABFB 4CUCA 2ONEA 2YKKA 3VE9A 2XIJA 4S39A 1TRIA 2GGIA 4K8GA 4REQA 3VNKA 1EGMA 3G6LA 3V1PA 4F9JA 2Z2AA 1KKRA 3FHAA 4Q6XA 1XLMA 2E3ZA 1TO3A 4C91A 4C5ZA 6TIMA 4L6HA 1C91A 3ITOA 4Y96A 3AUOA 3BAXA 3O1NA 4V1XA 4EWJA 4MWAD 5BXSA 3WJXA 3LTPA 4LAKA 3CZEA 3RLUA 4HPHA 3M47A 3UZ5A 1O12A 4UOZA 1A5OC 2PP1A 3MTWA 4U33A 4HPXA 2FMOA 3TMQA 2EJAA 3VMNA 4AHPA 1E9YB 1K02A 1CYGA 3HJEA 1XBXA 3WMBA 1J93A 5AB3A 3AOFA 5KZ6A 2D22A 3Q65A 3VA8A 5C9WA 1MMFA 2HEJA 4A3UA 2QCNA 1GW9A 1KXHA 4LVFA 1XIEA 1K6AA 3LEPA 5EU9A 1QMLA 1C92A 3VNJA 4AG0A 1QFEA 3A4AA 4ZBCA 4X3ZA 1DIEA 2Z27A 2W79A 1DJHA 3N18A 3UFYA 3L4YA 3ZSSA 2JKAA 4AMAA 3TXVA 1TWIA 4AY8A 2VEGA 2MANA 5F7UA 1XYBA 2FZNA 3PTQA 4NXKA 5BXTA 2Q8LA 3U5UA 1CBGA 1FH9A 1J18A 1J9YA 1DL3A 1UR4A 3QV8A 1ZP4A 1EO7A 2PDXA 4MZYA 4YCOA 3VILA 2OR2A 4MGGA 1XIIA 5A6JA 5C0QA 3VX1A 5C7HA 1MUWA 4NAEB 3BLKA 3L4XA 5KINA 1ISYA 3KZSA 5BU9A 3H21A 1RVGA 3T0DA 4JTGA 3MMUA 1TQJA 4P8UA 1MW0A 2PRLA 4E2OA 4BF5A 1SZGA 2ZZ3A 3ZT5A 1KW1A 5BWAA 4DN1A 2TMDA 4DY1A 1Z8AA 4QDMA 1F3WA 2HDJA 3VKDA 3UEQA 3KVKA 3EX6A 1W3IA 5LNUA 3BLLA 4GVFA 5AZ0A 7PTDA 4GYPA 3HFYA 3IJQA 4B5SA 5JBEA 4YTQA 4LS0A 3VE7A 3HPZA 1PX8A 3L23A 1OD8A 1EXPA 4LBUA 1NOFA 1N8IA 3BQ6A 4O8AA 1GVOA 1IEQA 1O60A 4EKJA 4LPCA 5LGZA 2GGJA 4J28A 3A3WA 3NOEA 4MWAE 1GTEA 3KVLA 2YZRA 3ITGA 5EYWA 2E6FA 4EX4A 4UTTA 1XFBA 3C2VA 3W22A 3CHCA 3EEZA 2QJIA 2ZUVA 2CZVA 4KH2A 3N12A 5M03A 3EX3A 1EJ7L 3VK5A 3KBMA 4ZB5A 2GGGA 3L5AA 1XG4A 5EMMA 2CHRA 2ZRWA 1IT7A 3GK0A 3VDCA 1OZMA 2HE8A 3W1XA 4N2YA 3S2JA 4HK7A 2Q3OA 5CAHA 3ZFHA 4PSRA 3UA4A 5G5IA 3H24A 4CVUA 2Y8UA 3CV1A 4D6GA 4MZ8A 1OABA 2J4GA 2ZDSA 3PWAA 3UBPC 4B5WA 3PB2A 2J7BA 2E8YA 3LHZA 3TYBA 3QGAC 5FJIA 5FAJA 3SUSA 4QR6A 2PTZA 2FZMA 1IT0A 1L6SA 3BL3A 4DM1A 2YGYA 1D8WA 1M53A 2GFTA 4ROQA 4DEFA 2X16A 3DG6A 3IV8A 3MZ2A 1OBAA 3MSRA 4DQWA 5IHRA 3W37A 3AMDA 5A6SA 3HPSA 5LA2A 5J5DA 4NAFB 4H01A 1KFEA 2TRSA 2GJXB 1EOMA 3SSJA 2OELA 2AGTA 2ALRA 3BSGA 4AF0A 4IFOA 1E6NA 3CWNA 3UNTA 4LB4A 2I14A 5CC3A 1XFCA 4YPJA 1OWQA 5EA9A 1F8MA 5A5WA 5AHFA 1DTUA 3LSBA 4NZ4A 4US6A 4MAZA 2VM8A 1LORA 5IM51 5HJYA 5FCZA 3B04A 1Z3NA 4JY9A 3N3TA 2DZUA 3V4BA 4HA0A 2WSPA 1XI3A 3S8HA 4G7FA 3EKLA 4C6FA 3IIZA 4IXHA 1OD0A 3LX9A 3AU6A 3THQA 2V82A 2GL5A 1KGWA 3SECA 3WEOA 1I0DA 3MP4A 4AXKA 4L80A 1HO4A 3U5YA 1PAMA 4YWSA 1GZ1A 3HMCA 5D05A 2OWCA 2D69A 1V6TA 3CXOA 3PUEA 1OGGA 3N4AA 4XKYB 2HVMA 4O0ZA 4M7SA 3SRFA 3RHGA 4KFPA 3WKZA 1VS1A 3KRUA 1Q85A 4PUWA 4DUWA 3EKGA 3KZPA 2O92A 1WA3A 3NWRA 4JQ3A 2BXZA 3WQEA 1V6YA 1I45A 1ZAJA 2GZXA 3P8JA 3C3NA 2Z26A 1OFEA 3H23A 1E4IA 3SR7A 3HG4A 1PBGA 2VP8A 2A7NA 2D3LA 1MXGA 4Y6GA 2W61A 1JAEA 4OV4A 4D6HA 4JTCA 4V2XA 2OO0A 4H3DA 4JX4A 4ES4A 2YIHA 3GXMA 3AJXA 3OIHA 1IIHA 3JR2A 3DYMA 1Z41A 4TUFA 2YLAA 2VX5A 3H6OA 1CPUA 3F4DA 4ALDA 3WNPA 3K5XA 2VCBA 1GZGA 3C8NA 1ITUA 3PFMA 3S5ZA 3LRKA 1PHQA 3WLIA 1P1XA 1YBQA 5BOFA 4JN8A 3IAQA 1C8XA 4XK2A 4YVXA 2V2DA 4J27A 4TTGA 3QYSA 2PDYA 2VDHA 3WQ6A 3NQ7A 3I4KA 2BHZA 2GSEA 3S5YA 3C56A 4PCNA 3RG6A 1BWKA 4YWIA 3DDMA 1TMLA 3L12A 4TV5A 2WHJA 5D9MA 1P48A 1SO3A 4TVUA 3BLOA 1I6NA 4AMCA 1XIDA 2VR4A 4AIUA 3UWYA 4H6EA 1YXYA 4HCHA 4IIHA 3FA3A 3LU2A 1UIOA 4FOUA 1OF8A 5AVNA 1UMYA 1ZCOA 1E0WA 2OGYA 4RNJA 4EVZA 4J5NA 3WD3A 5E6YA 1JYWA 1BG9A 1PE1A 3K1GA 4KWSA 3RYSA 4LU0A 1BVZA 2D73A 3B0YA 2OWXA 2PRMA 2V5DA 3RCNA 3LCLA 4QG9A 2VMFA 3E9AA 3TW9A 5EMKA 3W07A 4Y90A 5AKQA 3MDUA 3W23A 3AIWA 4JL1A 3OGSA 8RUCA 3V5CA 4Z42C 1J0KA 1GVQA 3GXFA 3PZQA 5EGRA 3F2CA 2YDAA 1ICPA 4B3LA 5A8MA 2QPUA 4DI8A 4ZOBA 3FCPA 4BWLA 4JBRA 3LA4A 1LWJA 1YDNA 3WNKA 3D3FA 2XFFA 3BMWA 5G1TA 2DZPA 2OZ0A 4RV8A 1G6CA 4HPJA 1W5MA 3M4HA 2PWVA 4S2CA 1CCWB 3RFAA 1PZ0A 1DKWA 2A5HA 3BURA 3O6AA 3MU7A 3TTEA 1IGSA 1EBHA 4NNCA 1TVNA 3H7RA 3M0JA 3AROA 1ZQ5A 1FVPA 1H51A 2QJMA 3MMDA 3DI1A 3NAVA 2PCEA 4WDUA 3BLFA 3QQWA 2PC4A 1DWAM 4HN8A 3W1PA 1WQ5A 3EOUA 1K6WA 1KO0A 1G01A 4KCTA 3NVTA 1R2RA 1H60A 1S3TC 1XLGA 3GVWA 3FX4A 1QW9A 2QUUA 2C6QA 3RR1A 1XIHA 3UESA 4DAIA 3VM7A 3RU8X 3S6DA 4OOUA 3TTQA 2DT1A 4M0XA 4TOQA 1FP9A 3VIMA 1QTWA 4GZ7A 3KE0A 3WH6A 3S9ZA 3FA5A 5EMJA 4DXKA 2R1LA 4ZODA 1NM9A 1M5WA 4PL1A 4UFKA 3E0FA 3WBAA 4RE0A 1F4AA 3FJ6A 2PDIA 4KF1A 4HSNA 5FJPA 1WYIA 2O4MA 3E2RA 5FEZA 1HKKA 4MB4A 1FQ0A 1VYSX 3VINA 5ENLA 2ZQ0A 1G4TA 3ENLA 2ZZ2A 3W2JA 3W28A 2YCIX 1XBYA 4WOZA 5HINA 3PBWA 3WD0A 1GG1A 4M82A 3VD3A 3LS9A 5C2CA 4CQ8A 1Z89A 2J88A 2AAAA 3R4IA 1VFFA 2O55A 2TSYA 2IQ0A 2VC9A 1UZHA 2QR6A 1HX0A 3VABA 2CXEA 3EKZA 4AU0A 1M04A 2ZX8A 4U5IA 1DE6A 2WNWA 1CEOA 4Y2WA 3UYIA 1Y65A 3W75A 1K8ZA 1Q63A 4IQEA 4JHZA 3VIIA 3O6CA 3CMGA 3S5SA 2XFWA 1KBKA 2J8TA 4GISA 5FJJA 5KZMA 2JF6A 2QCDB 1P43A 2IPJA 1FWSA 3VC6A 3PS7A 4G6CA 2VNCA 1S2TA 4XZLX 1UZ1A 3CUXA 3GVGA 4LRTA 2DY3A 3IJLA 4B90A 1K9TA 3UD6A 1E1CA 4N9DA 1K9EA 3EBVA 3T2PA 3B9AA 4XBSA 2D2HA 3DC8A 4BQ5A 4MSSA 4GMEA 1G69A 1J79A 2E1DA 3BGJA 2QJJA 4N4PA 4GQQA 1HJUA 1HN1A 4AEFA 3ARQA 1BLIA 4IPIA 1TA3B 4PN2A 4MTVA 4MY1A 1A3WA 3ZLHA 2OSYA 2C71A 4N0RA 4S2BA 3L68A 2A3EA 2GUBA 1ISXA 2VUYA 4JTQA 2HE5A 4HJFA 3LPFA 5I3KA 4QSFA 1PTAA 1FH7A 4HNNA 1H62A 3GNRA 4N9EA 1VHCA 4CU6A 1X96A 1PUDA 4AISA 4J9JA 3POHA 4A8NA 4G1NA 3S6TA 1B3YA 2OGJA 3LSCA 5FOOA 3L2MA 4CNOA 3N11A 4PMJA 5AYYA 5GPRA 3EEGA 4WDTA 4S3DA 3GB6A 3CYJA 3O06A 3UZJA 3AZSA 3WH9A 4XD3A 3VZZA 3WENA 3O63A 3AZTA 4NIRA 1U1HA 2TPSA 1XLCA 3L66A 3MBDA 1TMQA 1QDSA 4HNVA 1SJBA 4GXPA 1V0KA 3Q4DA 4PMUA 1UD8A 3W6LA 3GR4A 3BGGA 1PCKA 1EUAA 2CBIA 1MW1A 4FX8A 1B9BA 3SY1A 2EPLX 2PTWA 4NJKA 2ABAA 1XLFA 3OZPA 2E9MA 3D3AA 2XISA 3APTA 3GLCA 3G22A 1JNDA 1KM4A 4IGHA 3BSMA 1EF2A 4E4UA 4ICNA 1HIZA 3LMZA 3NL5A 4GZIA 3I7QA 4IM4A 1QOXA 4HU0A 4NU7A 4W4QA 1FBAA 1GQNA 1UBSA 2ZRXA 2VZUA 5DO8A 5ECVA 1V3HA 1DEDA 1UR9A 1TE6A 5F2LA 2Y8KA 2X1RA 3SQLA 9RUBA 3BLIA 2DSVA 4HYRA 1T99A 5D4YA 1GVEA 2Y89A 4PZVA 2Z25A 4Q6JA 3WQWA 2YDRA 4O19A 3MUXA 4PEEA 3ONBA 2JBMA 2W66A 5BU6A 5EBAA 2VRJA 3S1WA 1H7OA 3WEMA 4U3AA 4WY0A 1JGMA 4GI8A 1NDZA 3W2NA 3UG4A 1ECEA 2F61A 3EX1A 5A6AA 2X0SA 1GYLA 4K8EA 2CC0A 4W89A 1BXNA 1UKPA 5J04A 2HISA 4L6DA 1HGYA 1EWDA 4YHEA 3SCTA 3ZVHB 3W7LA 3PR2A 3JZEA 4DUXA 1SFJA 1YTDA 1O5KA 2WVUA 4KFOA 2ACQA 3GS6A 1DPMA 4BI7A 3UJFA 3C6CA 2AL2B 4IL2A 2VO5A 1XSIA 1XV8A 3BMXA 1TPVA 1W31A 4TVCA 2E77A 3PK7A 2ZX9A 3DFPA 1MQRA 3KBWA 2G41A 2YA2A 3KP0A 5DF0A 2ODOA 4QJ4B 5MKGB 3ES8A 1QUMA 1IEWA 1ZJBA 2YCLB 3TA9A 3W70A 4FF5A 3WNNA 5I5RA 5HR7A 2W5FA 4I6KA 2PUZA 4H4IA 1NELA 3NZRA 1H5YA 2R24A 2OXNA 2QYGA 1NDYA 1HJSA 3NDZA 4L61A 3N4EA 3K1DA 1FY6A 1ZJHA 3TJXA 2YOCA 5D30A 4UCGA 2DUAA 4AZIA 1X6UA 3NPUA 3CQ0A 1KXTA 3MJMA 1UWTA 3T0BA 1J0YA 3LGGA 2Q6ZA 1UR3M 1DWFM 4BF7A 5M1TA 1ONRA 3IIOA 4O52A 1O66A 4M1RA 1FWCC 3GTNA 3M9YA 4H83A 4ACYA 4FEZA 4RNHA 1JCYA 1BD0A 3M41A 4CNPA 4PB4A 3NZ1A 1DXEA 4XD5A 1JPDX 1ZLPA 2BVWA 3PWIA 1ZCCA 1BWLA 4W88A 3VD4A 1HFBA 3AISA 1DIKA 3EWZA 1UB3A 1DJGA 4QS5A 1XLJA 4Y7EA 1OC6A 2HV5A 2YL9A 4JAWA 4AWUA 4ZR8A 4XZHA 3W7KA 3CJPA 2OQHA 1JGIA 4QG6A 3BV4A 3DFTA 3EDJA 2EJ1A 2A21A 4PMZA 3GH7A 1SZNA 1JXKA 2GYIA 3P0WA 6XIAA 4C6EA 4XO7A 2DFAA 3CB8A 2WKJA 3GH5A 4QISA 1BFNA 2E25A 4AZCB 5I00A 3T0CA 4GI4A 3QSTA 1LTDA 7CGTA 3LPPA 5RUBA 2J6XA 2ZUSA 3BAYA 3HQPA 3E96A 3M7SA 5DMLA 1XYAA 4O53A 1QBBA 2F84A 3PVFA 2WCSA 2ZKMX 4GC4A 4UR8A 1P7TB 3AS2A 4BY3A 3GXIA 3SN0A 4M3PA 4P7QA 1TPUA 2V3DA 3MYPA 4NJIA 2PEVA 4F3HA 4Q8MA 4HKPA 3WN6A 4DWSA 4NHVA 2WKLA 3SJNA 2WOQA 3BE7A 1VP5A 2Y8VA 3AFBA 3PB0A 2ZZ1A 4CNTA 4CN6A 1NU5A 2EG7A 3GVVA 4XWUA 3Q37A 3L4WA 3CWOX 2QVHA 3M0IA 4O1AA 3CV2A 4RZ6A 2Y4SA 3M0ZA 3LRLA 4QHRA 4HSOA 3R58A 4Q7IA 2PCQA 4R33A 2P1FA 3EOEA 1I2NA 3ZQ9A 4ZO7A 2CETA 1KLYA 3TJ4A 2Z1XA 1WKEA 2HXUA 1GVYA 1KLZA 1E6XM 3NQGA 4K38A 2DZTA 4Q8WA 3WLMA 6XIMA 4DB7A 3AIBA 3FGCB 3EPOA 4KRZA 4A05A 4LNYA 1E1FA 1XUUA 4JQ2A 3NDYA 4AD3A 4M5PA 4D1JA 4AWSA 3U4AA 3W7OA 1EDGA 1JUEA 2REQA 1ISZA 1FCBA 5BRPA 1AH3A 3PUGA 3M5VA 3LUTA 1K4GA 4MB1A 1K9FA 1W1VA 4IPNB 4XZNX 4EF8A 2WHKA 3C2RA 3WLSA 1HF6A 4EK7A 3M5XA 4RDYA 5CQ1A 3CHFA 3MO4A 2RKXA 3CL6A 2ZYFA 3KOZA 2E5DA 1QNOA 4CCZA 4MPKA 4LXFA 5A94A 1NFBA 1F6YA 3MKVA 1QATA 4YTTA 1PX3A 1WDWA 5LIXX 3MKKA 4DJFA 2F2HA 1O95A 3ZJ7A 3F03K 1BGGA 1VHNA 1V7YA 3CT7A 5I3DA 1YXDA 3OQEA 1TWZA 4MNMA 2GDUA 3WDPP 3A21A 2A85A 1K7EA 5DRIA 3S2NA 3S5NA 4AZ6A 5LIUX 4UTWC 1XIFA 3CGTA 1TX2A 4V15A 3W7DA 1GZJA 1UC5A 1H3GA 1YXCA 3B8UA 5KSWA 4QEEA 1OEPA 4HJWA 5FL0A 4IFKA 1GEHA 4DF0A 1JCJA 3QQ0A 1TTJA 1AQ0A 3UXDA 3SCVA 1HVXA 3LCIA 2XVGA 1FWEC 2XN1A 3VOGA 3W1MA 4DO7A 1QOPA 3WDIA 1MSSA 3HV8A 3GC2A 2RDTA 2GUYA 2BGNE 3TYDA 1S2VA 1XKYA 1OCJA 4J35A 2W6RA 4HP5A 4LF2A 5FA5A 3LCHA 1PDZA 4IWWA 4QLJA 3AXMA 3L5MA 4UQ9A 3PJWA 2VXNA 1EC7A 3OTRA 1PKNA 1QXLA 2RAGA 2QF8A 3DECA 4QBXA 1S46A 4IG2A 4I9AA 1W3TA 3TJLA 2ZDRA 2PBOA 1E0XA 4LVBA 3R8RA 1J6PA 2VJXA 2OFJA 5HMFA 5L6UA 1V08A 5DLCA 3RCMA 4XBKA 3E5PA 1ZY9A 3PUDA 1C7SA 3T0TA 1M03A 1B4EA 2V6AA 3MI6A 3XINA 2IPWA 1FWBC 4Q3MA 3KUMA 4BI5A 3TKFA 3G8RA 2F9RA 3PBGA 2A0NA 3N14A 4W93A 4DM2A 2GWNA 4PL2A 4PEKA 2VI0A 1FWHC 3UJSA 3VOHA 3EGJA 1W54A 4YTUA 1X7IA 2YCEA 3LHWA 4DJDA 3N13A 4LYPA 2PC8A 3ZR4A 3UWZA 3SCSA 4K1WA 3DFQA 5TBOA 2Y7DA 3QHMA 1GYNA 1P6WA 2AAMA 1JF6A 3DI0A 3KBSA 1CTNA 1GOIA 3TN5A 4M6PA 1IIGA 2G50A 5JIWA 1H41A 1OCQA 4ORMA 1P1MA 1YDVA 2WMHA 4DBEA 3C86A 2X8RA 1HNYA 2XH2A 3MQTA 1YE6A 4Q4KA 1RY8A 4C6OA 1GKPA 3L5LA 5F1VA 3IUIA 4GJIA 3SW6A 1EEXA 2E1WA 2OWWA 1MZRA 3WQPA 3AIRA 2E4TA 2ICSA 2NV9A 1MNSA 4Q4OA 3H4XA 3ZLFA 1V3LA 3QOKA 1UKQA 2XWEA 3IIVA 1T40A 4LCSA 1A5KC 2QV5A 1AL8A 1DORA 4RK8A 5CPNA 4R5EA 1VBRA 1FDJA 1LL6A 1XQKA 1LT7A 4B3KA 4DNHA 1NF0A 4IQDA 1C8YA 4G1KA 1L8PA 1VBGA 1V3JA 2WVTA 2WPBA 4WHBA 4RNIA 3NM3A 2GQ9A 3CQIA 1VAHA 3KFTA 1RK5A 2CESA 4QROA 1WNOA 4JDBA 4HCDA 4WEVX 3GY1A 3ZO9A 4OT7A 4DJED 4LAMA 3GC4A 1WZLA 3A9BA 4LT9A 4B3ZA 3AALA 1WE5A 5HJLA 3THAA 4MFDA 2UWFA 1EPXA 5K7JA 5CBIA 2JGQA 3KL5A 2QAPA 2CWNA 3MBFA 2GOUA 3L0GA 2RJGA 3Q45A 1VCFA 1XUZA 2VX6A 1PDYA 1KV8A 4JS3A 1A5SA 3WIJA 2D23A 2FZDA 2E7FA 1I1XA 1OFRA 2Y70A 3CHDA 1NWSA 4GCAA 2DIJA 4P8WA 4I7UA 3KL3A 2F38A 5MHBA 2DIKA 3ZJ6A 2XGBA 3A22A 4B91A 3H4WA 2ANUA 5DCBA 3GR8A 2F6UA 2R1PA 5HANA 3P7YA 2MNRA 1RALA 4QDWA 2VYOA 3BVJA 4D6CA 2FFIA 2B7PA 1E4MM 2SFPA 3MHGA 3W3OA 1VQTA 3SCPA 1OYAA 3W7NA 1UH2A 4FR1A 3OPSA 4RKAA 1JZ8A 3RF9A 3M6DA 1GTHA 3KS6A 1J0JA 3LN3A 4P61A 2YFNA 2GOKA 4UZSA 1ZL1A 3JS3A 3MWCA 1KR0A 3SCRA 3QKZA 4F0SA 2WZHA 2Y5JA 2INEA 3S0CA 1DWIM 1TJ0A 1E72M 1C3FA 4I5RA 3GDTA 2O56A 2W92A 4E2DA 1R3TA 1TSIA 2C14A 1N82A 3THCA 1JFXA 4JTFA 5BOOA 1L0PA 5I06A 3QC0A 2GJRA 2RJHA 3G1HA 2GJLA 3A13A 1UR8A 3AHXA 3EMCA 4C6PA 1B9ZA 3AWNA 4K3ZA 3FY1A 7TAAA 3WCZA 1ZBVA 1E9ZB 2FHFA 1XWYA 3LRMA 1YADA 3Q67A 4GVGA 1XQLA 2JIEA 3O0FA 2UY5A 3W25A 4FIRA 1PB0A 2HRWA 5GVJA 3NGJA 4AF0B 1ME8A 1H7XA 3S2LA 2WQDA 2X0HA 2CLKA 3K46A 4CQAA 3NO5A 3QGVA 2QIIA 1ZPTA 2VR2A 4DYEA 2WC7A 5HNRA 3W85A 1UOKA 3T42A 4H9VA 4NVTA 5DMNA 5HQLA 3CQKA 4JL2A 1Q6EA 2BNJA 4AD2A 1MW2A 2J24A 2ZZ7A 4QLKA 4LUJA 1S39A 3OZYA 1XLAA 3DC0A 4WZHA 4R27A 4DHGA 5CGQA 3RM4A 2QJHA 2EG6A 2C91A 2YFOA 3OVGA 1ICSA 3MUIA 3V5OA 3KRZA 1W6TA 4AZGA 4QJ1A 2PDNA 4EPEC 2HQAA 2I1OA 2CLLA 1T6MA 3AICA 4KQNA 3OGRA 2XH7A 2WZIA 3VIGA 2GUUA 4R3UA 4MUZA 4NYYA 3AIUA 3M07A 3DHDA 2Z4GA 4D8AA 4RX0A 4ZGYA 4H2CA 2VGBA 4KEVA 4LEQA 1A80A 4ZEPA 1VJSA 3WK1A 1GG0A 3FJ4A 1XLHA 1J6OA 1J5TA 4N4QA 4B4FA 4B2DA 4YTRA 3MSGA 5HUOA 1G94A 2RDWA 3REQA 1G1YA 3SSZA 4TXEA 1XPYA 3BAIA 4P8XA 3W86A 2NT1A 4BHYA 4J3ZA 2RGMA 1A5MC 5FESA 2J78A 1I2PA 1RSCA 2Q02A 4HHHA 5EFFA 3GHRA 3M1ZA 1N55A 2OX1A 1EDTA 1CB2A 5F2GA 1W17A 2TODA 1LBMA 4Z2HA 4JYDA 4AIBA 3VGEA 3GM8A 2ZXQA 3CBWA 3N9SA 1DQWA 3GR7A 3WLTA 4LC8A 4Q4SA 1C8VA 1A5LC 2NSOA 4KESA 4Q4RA 2VVNA 3NL3A 8A3HA 4LAOA 2IXUA 5FEPA 4QFUA 1F74A 3D46A 1PVNA 3EX4A 3PUOA 1BGAA 1YRRA 4MY9A 3RM9A 5BW6A 2YBUA 2Z6IA 3CZGA 4O13A 2XIMA 1PX4A 2WC3A 2ZRZA 4J2PA 1KCLA 3TOPA 3QRHA 4YHGA 2Y0FA 1I2OA 2VEKA 4C6KA 1TV5A 3TCEA 3M44A 4MKVA 2DW7A 3DCPA 1CIUA 3TQ0A 1UBPC 4PTXA 4LBSA 1NSJA 4QIUA 1WUFA 2WNQA 4UFMA 2ADAA 1QNRA 4F40A 2VRKA 2QDEA 1L6GA 3FHQA 3HB9A 1KM2A 4HZMA 4NF7A 1VYRA 4AEEA 1VCVA 2WNNA 2DT3A 4AYGA 1EC9A 1WPCA 3LCFA 4DWDA 3A4XA 4U31A 4IMAA 4HNLA 5E0CA 1VIWA 1FWNA 3OEXA 3T8QA 2BY3A 1TTPA 5HMEA 1JAKA 2I5GA 4IIDA 4AQLA 4WK9A 5A8QA 2AGKA 1R3QA 4JIHA 1RY0A 1Q7QA 3SUUA 4XKYA 2PDBA 2Z2UA 3GZAA 3QPYA 1XC6A 1FCQA 3WJZA 3TLQA 1HP4A 4BEUA 4J3XA 1AK5A 2I56A 3H55A 2HWGA 2Y63A 2E6DA 4GVHA 3VKKA 2WM1A 1REQB 1H09A 5IDIA 1YYAA 3UGVA 3AAMA 2JKEA 4JCLA 4C1NA 1QNQA 2VEIA 4DZIA 4O15A 3UR8A 2P53A 1MFUA 5IFPA 1U5JA 4HMNA 2Z28A 2NQHA 2E6YA 5A6LA 4Z0JA 1GGOA 2HPIA 1BXBA 4JFVA 3EMZA 5C2GA 3S9YA 3IPWA 2PP0A 3K2GA 5AC5A 1XLDA 4OBTA 1ZB5A 5BMWA 1AQFA 2XSXA 4GJJA 4G9PA 4DF1A 5KEZA 2D24A 2QJNA 2D0HA 1O6IA 1P6BA 2FGZA 4WSKA 3LK6A 1X7FA 3PAJA 3AS1A 4WX2A 4GWEA 2PF8A 3UWQA 4LX4A 1AJ0A 3QGKC 3CQJA 5E9XA 4GE8A 2DVXA 2HNHA 4AUBA 1SSGA 1FDZA 1NOUA 1RQHA 4O1FA 4NJGA 2W67A 4ZXLA 1UW9A 3T78A 5AC6A 2GDQA 2OEKA 1Q2RA 1KGUA 5EFDA 5AYBA 3OYXA 2XVNA 5AZ1A 1LLOA 3GAYA 3IK4A 4BJHA 4URIA 3VTRA 4AWTA 1FH8A 3BZGA 4EF9A 3G18A 4G8TA 3M43A 1WZKA 3DKJA 3I3DA 4MNJA 5FJUA 5HNNA 4CVWA 3VPLA 3AZRA 1BRLB 1VF8A 4LVAA 2BSLA 1BQGA 5FF7A 2PDCA 3VD7A 3G3DA 3VI2A 4LFYA 3LGEA 1THFD 3CV7A 3I7SA 2X7VA 5C9RA 1TJRA 4O1BA 3VC5A 3GBDA 2FH8A 4PC8A 4CEUC 4PFHA 5HWMA 2ZXBA 2EPMX 3MUCA 1XYMA 1DJZA 1E1CB 5LA0A 2VFEA 2Y7FA 5ABGA 3N6JA 3GU9A 3L0KA 7ODCA 2VZSA 3PZIA 2ESCA 2C1GA 5FF3A 1GOWA 1GYMA 4HYWA 1SO4A 2Y1HA 1WKFA 2QGHA 4PCSA 3OLDA 4U3CA 2J8GA 4DAFA 2X7WA 4ZXOA 4ENLA 4NZCA 5F4SA 4LNCA 2A7RA 2W0UA 1F5ZA 3LLDA 4WGXA 4R85A 3WBXA 1KCZA 4UUIA 4Q8VA 1VKFA 1YW1A 3IIXA 4S23A 1EX1A 3TC6A 4Z17A 2HROA 1EB3A 2BY1A 4NYUA 3NL6A 1RJRA 3DESA 3RM8A 1NP2A 4GI6A 3BJTA 2WPGA 1VPQA 1X8FA 2PDMA 4XAFA 4L1WA 4IX2A 1EQPA 3M0VA 1Q6RA 3AXHA 3UWUA 3QMRA 3AXXA 2WCAA 4PBGA 4GQRA 4ADSA 2QULA 4XZ9A 1SR9A 4ICCX 2ABBA 4JZ5A 4WD0A 4DPPA 1AL7A 2WZEA 2PDUA 2XPKA 1ME9A 1L8NA 4RE2A 3H22A 3ZJKA 1XISA 3O8AA 3MCOA 3VNIA 3HM7A 1ZENA 2DZSA 3HU7A 2CITA 1L2QA 1NY1A 5CPSA 1TPH1 3ZSTA 3E0VA 5HMDA 3N2BA 1JCMP 1D2KA 1XKJA 3VO0A 3WDQA 1MXSA 1J0ZA 2GSJA 1LG1A 3T1GA 1YKWA 3JUGA 4UFJA 2PWEA 1RCXB 4HK5A 1X98A 2NQ9A 4JPGA 3DG7A 3B4UA 4FLQA 4ZO8A 1OZQA 1JDEA 2NWSA 4G7EA 2PPGA 1GQIA 4AD0A 2J7DA 4WF7A 3BCJA 4UNLA 2XZ9A 1W9VA 4Z2JA 4NXSA 4R7JA 3QEZA 4MKNA 4GINA 4GBDA 3LNPA 3CUZA 3NQ8A 4HCLA 3C61A 4WY0B 3A4WA 1JRCA 4G56A 2QCMA 2ISFA 4L4OA 5CPTA 4D8LA 3VD5A 2Z1VA 1IZKA 5BRQA 4K39A 3E2SA 2X42A 2QMJA 1M6JA 1BSLA 3TLLA 5D2XA 3R12A 5CBBA 4C1LA 1M1BA 3BPWA 2GJPA 4DVOA 1IXNA 2OEMA 3UYCA 1EJRC 4DBDA 4ADUA 2CBVA 1Q4WA 5I3IA 4P7LA 4YXGA 3BG9A 3MZNA 1EO5A 4JDYA 2WLYA 4C7DA 4RL3A 3ZIZA 5D04C 3VZYA 1F9CA 1WDQA 1MQPA 4CU7A 1VFSA 2YR1A 1R5YA 4RUBA 3ZYZA 3KCOA 3W74A 5F4WA 2ATSA 2J9ZA 5EY5A 4IPJA 3H12A 3OHIA 3G8EA 3UERA 2ZX5A 4GYJA 4YNGA 4IZGA 3INPA 3GWQA 4DBUA 5IRPA 4CN1A 3M0MA 3WLPA 1EDQA 1DE5A 1OFAA 5H8PA 5LIWX 3SI9A 4S3BA 1XRSA 1HL2A 1B3XA 2WM0A 4IGSA 3WELA 3AWOA 1F05A 1LG2A 4NI3A 3O15A 3UA3A 3UY8A 1KXQA 4D2JA 3OLIA 3TSBA 4IXXA 1EP1A 1UOZA 1B2YA 1RUSA 3OZMA 3SRKA 3C3UA 1FCUA 3PC0A 3GE7A 1C8QA 3ZT7A 2D2OA 2DVTA 1Y7VA 4NNBA 4NQ1A 5CSRA 1KKOA 1WV2A 3TYEA 1YIXA 1YQ2A 2CLFA 1V3MA 3LI0A 3KTCA 4A8RA 1HKWA 2Y6ZA 4LBRA 1NJJA 2QLYA 3ANYA 4RZ5A 4M24A 5LNWA 3KCJA 1BTMA 1QAPA 1UP0A 3QZ6A 2Z6JA 3DG3A 1IXOA 4IQJA 5BROA 4TU1A 3J7HA 4LY4A 2QT3A 1S5NA 3R43A 3UWEA 2CHNA 3VNDA 5E93A 4IP7A 3V0UA 4CQBA 3CMJA 3GG8A 2OLSA 2WLZA 5DCEA 5I7GA 4PH6A 5I3HA 5JIPA 2CZFA 3GTIA 2EGZA 1Y8BA 4BQ2A 1KRCC 1UMLA 2A6LA 4OOZA 4TMCA 1OB0A 3B06A 1SW0A 4TO8A 1TR9A 4LC6A 2EQDA 3OVPA 4C6IA 3F2DA 1TJ1A 4ILSA 2NT0A 4ERAA 3ABOA 3SADA 5T26A 4JEQA 4XVDA 1FWFC 1S5MA 1UZ4A 3IK2A 2OT0A 4H2HA 3P62A 3CUGA 3PZGA 2YYTA 1F6PA 2HCVA 4DWSB 2GGEA 3RX2A 2H6RA 1UH4A 4Q8TA 3QFWA 4EXBA 3LCGA 3IJ7A 2ZC1A 3EB2A 4XUGA 1RP9A 2YJQA 3GHSA 4QLLA 3R8GA 3STFA 1GPWA 1RCOB 3QV7A 3LYEA 1K9DA 4GY1A 3WNOA 4KFNA 1V0MA 5EB8A 2P50A 3VIOA 1V03A 5HAOA 4IJCA 4IPPA 3MHFA 8TIMA 3CIXA 1MQQA 1E55A 1JPMA 4K36A 3W73A 3W7RA 2XDFA 3WQCA 3CM4A 4JQAA 3N34A 1DWGM 4POCA 5LKYA 3ZLGA 3RMJA 4S1FA 1NFGA 4QE5A 4JEJA 3KWSA 4H04A 2B31A 4CCEA 4TV6A 3W7GA 4GUHA 3FVMA 3SCQA 5I77A 3U2EA 5MKGA 3GRIA 1EGVA 5E70A 3PBYA 5LGXA 1JULA 4AVNA 3PNZA 5AYIA 1GOMA 2HNEA 3LM7A 1OT2A 6REQA 4I90A 3L4UA 4OQVA 3K4DA 4G5DA 1V3KA 4LVDA 2QDDA 1OIFA 1PO9A 4IIGA 1JCLA 5CEWA 3DFHA 1E0TA 2YL5A 3EDEA 4EAYA 3U48A 1QT1A 1Q6CA 3MO7A 2RDUA 1IV8A 2P3ZA 1W5OA 3PZ9A 3QZEA 4A4AA 4HNTA 2YCKX 4L56A 2BS9A 3S42A 1QK0A 2A1YA 1O5QA 2XIBA 5D32A 5CZTA 3S47A 1WDSA 3TOYA 3W71A 1GORA 4KWUA 3I65A 1XC4A 2WANA 4FXSA 5K9CA 4LUSA 2VC6A 3B8IA 4E5TA 3GNXA 3AYSA 1A5AA 1H1ZA 5AHNA 4PSPA 2H8XA 2VEMA 3HJZA 4M19A 3S46A 8CGTA 3BAJA 3IWPA 5IBXC 3W7PA 3ARYA 2OYLA 3SCWA 2J66A 5D9NA 3VUSA 2A6NA 5LNRA 1VFTA 3C2FA 3OB8A 1FRBA 3UG5A 1EA9C 1L9WA 2Y7GA 3ARTA 1AH4A 2FVKA 4R53A 1GJWA 4MLJA 3WG6A 3VIPA 1XBZA 3BUVA 3ANVA 3NTYA 4IFKB 1VFUA 2C8NA 2FJKA 1QBAA 4HU8A 1IR1A 2R1KA 5A6KA 1C90A 3T7VA 2DGAA 2TAAA 1U1JA 3DYOA 5A1AA 1XICA 4FAMA 1QRQA 2EO7A 3O0KA 4LANA 1CGVA 3BW3A 3RN6A 3LBMA 2OB3A 3EX2A 3MSYA 2B7NA 4DPQA 2XHYA 3GG0A 5XINA 3BQ5A 4LS2A 1F07A 1Y5XA 4FLRA 4JY8A 1W0MA 4IG2B 1WUEA 2NXIA 1HZYA 3HA1A 2P10A 2AKZA 3WFZA 2AQVA 1BSIA 4UQBA 3LQLA 4C6BA 5H1WA 4KEUA 5DXXA 1DHPA 3SM0A 1QO2A 3ARXA 4V27A 5CC5A 3AMLA 1V8EA 3BXWA 5LNSA 3EWCA 1E15A 1QPOA 5REQA 4NKCA 4GNKB 3SY8A 4O28A 4WDWA 3FOKA 3MVTA 3CS2A 4IX0A 3T2QA 2CLIA 4PUDA 3CWHA 2WV8A 4B5NA 3KRBA 3BICA 2AMGA 3GVQA 3DENA 1T96A 1DQUA 3PP7A 1F76A 4JTIA 5I3FA 4TVDA 3SN4A 1TVLA 4GUIA 1A47A 5AFDA 5C9ZA 4DXXA 4WSHA 3MCNA 5JU6A 4U2YA 1WOBA 3P5YA 1GHRA 2X1UA 1VENA 4Y9OA 4PTMA 3GC5A 4HT3A 2UY4A 4YVVA 1YNQA 5C8BB 4GO8A 2ZE0A 5KITA 1V0NA 2F6XA 3RO6A 1TTQA 3I3EA 5FF2A 3VGFA 3BK0A 1KR1A 1Q13A 3QN3A 2NWRA 3QLDA 2QIWA 3FKKA 2J62A 3GG7A 5CBJA 1P0NA 3N17A 3MUY1 2CBUA 4WXZA 2PF0A 4CQDA 2D2GA 2OOGA 3V0SA 4JIEA 1QU4A 3DBNA 1ZP3A 3P2VA 3MY9A 2FQIA 3APYA 1W5PA 4FXFA 5EL1A 3BCDA 3NEVA 4FOJA 3WQ8A 3EWDA 3DFSA 4I5UA 3EWXA 3B8TA 3URNA 4HOZA 3V36A 3ALFA 1V6VA 3BANA 4MWAC 4UMAA 5A2CA 4Y8EA 1H7NA 1M9HA 1I9CB 4F2TA 3AIEA 2VX4A 3N15A 3ABSA 1ISVA 1W3HA 4AH7A 4I7VA 3T55A 4E6MA 1AG1O 4UIOA 1Q6DA 1YPFA 4E0CA 1R47A 1U5VA 4DWSD 4GI9A 1DOSA 4HOWA 3Q94A 5DBUA 3P82A 1XYZA 1R85A 1C9DA 3GX9A 3V75A 6A3HA 1XS2A 1XDLA 3HBLA 3P5ZA 3DOPA 4LV9A 2I7GA 1E71M 4HN4A 5AHMA 4UR7A 4H8HA 3T09A 3VU2A 4RXGA 4Z1DA 1JI2A 1VEOA 2PZNA 3GXPA 1WB0A 3CO8A 1DWHM 5G4EA 1H7WA 3C0JA 4E8CA 1VR6A 3UZXA 2Z7KA 4GQ0A 2FPVA 2Q8ZA 4FNRA 1RJQA 3OA5A 4AZ7A 2VT0A 1S5WA 3WH5A 2J7EA 2VZOA 3OU8A 5EBUA 3N2XA 4JFWA 3WDHA 1GK8A 1NDWA 3P74A 3WFAA 4Z1CA 3TWBA 2PLKA 3M64A 2ZE3A 4BEQA 3UW6A 2GJNA 2C15A 2NQLA 3UCDA 1X6LA 1F3XA 2QV4A 3BWWA 7A3HA 3CC1A 2FPTA 2V8ZA 4M81A 1K8XA 2HVNA 3FN9A 1KM0A 2QW5A 4L1GA 5D09A 3T0AA 4B5UA 3KXQA 4PRWA 3UPWA 2EXOA 3F5KA 3AC0A 4C7GA 3WQ5A 4F0KA 4DJFD 3XISA 3E74A 1LF1A 1RBOB 2PWGA 3COTA 4XSMA 4WY0F 1I2QA 3CPRA 3T05A 3M0KA 4JHMA 4GUJA 3ARSA 3OQ8A 3OBKA 3AHZA 5BZAA 3QW4B 2VVSA 4GX8A 1OX5A 1Q7MA 3HMJG 4CD4A 3ITYA 3N2MA 1OADA 3CUHA 5DCDA 4IP5A 2PMQA 2AL1A 2RGLA 2PU0A 3JZUA 3ONCA 3UJRA 3LV6A 4H00A 1H49A 3CV6A 1W1A1 4NX5A 1WZAA 1FOBA 4IJRA 1A3HA 1Q7ZA 1BKHA 3SCUA 3CEUA 4O57A 1VFOA 1FFQA 2YL6A 3R94A 1O5RA 4OZOA 2C3ZA 2OOFA 4J1OA 1CXHA 1UH3A 1EOKA 1NAL1 3LZ5A 1BXCA 4P8VA 1JJKA 3LB0A 3KW3A 1RA5A 3V18A 3FJLA 2WB5A 1CXFA 3IGXA 1EYWA 2WSKA 3NA8A 1ZJAA 4ZOEA 4WJXA 2FTYA 3V5FA 4DYKA 3S5OA 3WYZA 2PDQA 1VCGA 4LUTB 1SJCA 3APGA 3WQFA 1V6XA 3GKFA 1KFJA 2OYKA 2QUNA 2BLEA 2H3BA 4BFAA 3REQB 2DP3A 2BWGA 2WMJA 3MDWA 4HK6A 4LCQA 3CO4A 5DMYA 2WK2A 4GPNA 4KERA 1IR2A 1ZBKA 3UXIA 4C60A 3GUGA 4DJDD 1GJUA 4Q4PA 1DYSA 4IMDA 1C93A 2IKJA 1TCDA 1UKSA 1TUXA 4MAVA 2GVGA 2BB0A 5M2FX 1W9BM 3URAA 3PZUA 2C1HA 4FSAA 4FOKA 3USBA 3VIFA 1WOAA 3E02A 3DGBA 4LYKA 4C6MA 3AJ7A 2R14A 2E09A 3KWXA 2CLPA 1E6PA 3DX5A 2RFGA 2OLHA 5HOSA 3PBMA 5E5CA 4JX6A 4S3EA 2IKGA 3VKJA 4X61A 3W1NA 1WKDA 4I3GA 4UTIA 4ATWA 1JZ4A 4JTUA 2UV8G 2XSAA 1AD4A 4IMCA 3ZZ1A 2YB1A 2Z1BA 4HYVA 4QTGA 3A3HA 1HW6A 1OG0A 2CWXA 3E0LA 1JFHA 2CLOA 2V5KA 1G0CA 1XLEA 1TRDA 3GIYA 3O6DA 2XIQA 3ZVIA 5AOUA 3UCQA 2V3EA 2POTA 1FUYA 4KGLA 5TAOA 3WH8A 3MYOA 1XCFA 2VCAA 5IXEA 2A3LA 2WW5A 2Z1WA 2FLIA 2O7QA 4H7ZA 1Q6LA 1HQTA 1JCTA 1M7JA 4MJZA 1HL8A 1K3UA 4IIBA 3RO8A 2ZA2A 4F79A 3H26A 1SZEA 4TMBA 2WWDA 1PXGA 4UTUA 2QMKA 3II1A 1OM0A 4GVIA 3WLJA 4GKTA 2O7SA 5FJTA 3URQA 4INFA 4GO9A 4IGNA 2PDLA 1VB9A 2E9BA 1GVFA 1W2PA 3R6IA 4W5UA 2YPIA 2ISWA 3GYCA 3R13A 3ZMRA 4LSBA 3WLQA 2WJFA 1FWIC 4KWVA 4DLFA 1YNYA 3HPAA 3RRAA 4C65A 4CNNA 3N29A 3AMKA 4OJYA 2XVPA 3U2ZA 4OUEA 4AFYA 4NILA 4MJ4A 4EAMA 1LLZA 3BOXA 4D71A 1KXVA 1I4NA 1C29A 4ZB2A 5E9AA 3UP8A 1US0A 3A4JA 1KM3A 4HD5A 2EHHA 1SW3A 3NSMA 3PNUA 3CPGA 4HMEA 4C1NB 3T4CA 1QPQA 2PS2A 1EIXA 3S2CA 3KVJA 4HZ6A 1E6ZA 2PTXA 3TMLA 1OC7A 1VC4A 2E0PA 5DQPA 1Q8JA 3OYZA 1CENA 3S83A 4EPKA 4YCPA 2R1MA 3PPCA 2NX1A 2G3JA 5DELA 4D8ZA 4Z1AA 2EEXA 2Z7GA 3TYZA 2HK1A 1SFSA 2DEPA 2YBTA 2OYMA 2ZVRA 5HULA 2FB2A 4FNUA 3RNDA 1F3EA 1VGAA 4ZQNA 4NUWA 5CSSA 4J4KA 1PHWA 1SSDA 3W38A 5AY7A 1WXZA 3NUKA 4Q4MA 1CT5A 1VPXA 4UCFA 3CNYA 1UIPA 1W9DM 1Q2SA 2XZ7A 3BJFA 1BG4A 4UOQA 1W1B1 4OIFA 3B9NA 4NI8A 5EMYA 1V6UA 4YIWA 4WKHA 3RPMA 1EJTC 5DEZA 1LLWA 4JKMA 4J3UA 2V9DA 4PULA 2CCRA 3T08A 5G1YA 1E9IA 4GYKA 1SYTA 2BFGA 3R79A 3QHNA 1R38A 1KBBA 1XSKA 2FHBA 1JDCA 5AN7A 2F6KA 4WR3A 4IISA 1V4YA 4X60A 2DV0A 1WKYA 5PTDA 3U7VA 3NL2A 1DTNA 3GFZA 3LY0A 2WHLA 1KM5A 4MY8A 1XL9A 3M46A 2H9AB 4MUPA 2DORA 4ADTA 3LHUA 1ELSA 4NZFA 1XG3A 4PUNA 2Z24A 2WVSA 1UJPA 2W27A 4C6CA 4WOQA 2VFGA 2QPSA 1VYPX 2YCJA 4Y9AA 4QQ3A 1J2WA 4Q7NA 1JZ7A 1HJQA 2Q71A 1TV2A 3S9IA 3EAUA 2P8CA 2O9PA 1UD5A 3MMWA 3G1RA 4H9MA 1XBVA 4B2DD 3RXZA 1TJ2A 1J4EA 3TDFA 3WLOA 5MF5A 1OC5A 2A79A 4ZQCA 2P0IA 2IMRA 3BOLA 3F4VA 4QNWA 1LUCA 1TR1A 3LZ3A 2DPEA 4KBXA 1QI5A 3MS8A 1REQA 2GVLA 2BGSA 2R8WA 1HTIA 2EG8A 3TWAA 1TPDA 1YEYA 1CDGA 2Z00A 4ICMA 3S1VA 3BOFA 4R9OA 5LA1A 2VGGA 4GGHA 5DBTA 5D02A 4O10A 1V7AA 4G2DA 1QW8A 5AC7A 3BO9A 1NWRA 1A5CA 1JPKA 3N2OA 4CCDA 5G1MA 4FF7A 3ARWA 1S2WA 1JRBA 4BCEA 4RV3A 2FHCA 3TTOA 4PUEA 3CZJA 2ASHA 4CLMA 5DN1A 1V51A 4M56A 1UWRA 4HPGA 1XCXA 2ACRA 1YDYA 2C16A 1H7PA 3VNZA 3AS3A 3SCOA 1WDPA 4KS0A 3GIPA 3UGRA 2WVVA 2YLLA 2ZUUA 3NZQA 1DVJA 4ZFCA 3E2QA 4YL2A 3W27A 4O8RA 5E6ZA 3C52A 1WDRA 1LCOA 5DFAA 2NVAA 5FEWA 1QI3A 3PULA 3HZ3A 1MEIA 3SJ3A 1D3HA 1FP8A 4IL0A 1I60A 1KQZA 2YL8A 3W88A 1H5VA 5C55A 2ZTKA 1XDMA 2OQLA 3IVUA 3PTKA 4W85A 5A69A 2A4AA 2X1TA 1E6SM 4ZENA 1A4MA 4Y9MA 3GDKA 3G77A 3W9ZA 3UQNA 2V69A 3BW2A 5JXQA 1SFLA 3KVMA 4H19A 2FFCA 1JDAA 1Q3NA 6TAAA 1EHAA 2ZWZA 3SUVA 3KX6A 4G7EB 1V5XA 4HNUA 1EKOA 1J0IA 5BNKA 3I6EA 1X97A 1IWPA 4WLCA 2UY3A 3MJYA 1EC8A 1BRLA 3IJDA 2DZAA 4JHOA 3VDHA 3W7JA 4RLIA 2JFEX 1I1WA 1TVPA 3QKEA 5CG0A 2V5LA 3M0HA 4K37A 4LF1A 2NW0A 4TIMA 2YBVA 2OVLA 3FW6A 3F7JA 1TPWA 3UU0A 3IANA 1O7AA 2YZ5A 3D5HA 3TVAA 3HG3A 3O3RA 3B9EA 1BQCA 3CK5A 1RHCA 1KCXA 3IVTA 2PP3A 3ISIX 2VX7A 3H54A 2C79A 3HPFA 3HGOA 3G1SA 4JIPA 1TCMA 1WX0A 3E0IA 4BF9A 1OJXA 2B4GA 4DO4A 3ECQA 4S3AA 1QCWA 1QJWA 3U2OA 3O2LA 2EKGA 2Q8XA 1RV8A 1VFHA 3IJ8A 2J8FA 4B16A 2FDMA 2NX3A 2GVEA 4I9TA 3GXDA 5GNXA 3I10A 4JICA 3EXRA 2E5BA 5H6HA 3QW3A 4LALA 4B5XA 1TE1A 3JW7A 1EPVA 5DT5A 4KGJA 4WJ8A 3TFXA 4JNZA 3FJNA 3Q58A 2PA6A 3W7EA 4QJ5B 4H8VA 3D6NA 2EBNA 3H7UA 1H1YA 4IIEA 3NQ6A 3OG2A 2B0MA 1LWHA 2E40A 3LD5A 5T9BG 3URBA 1E0VA 3TU9A 5J5RA 2ZTJA 1NH6A 1VEMA 2XIIA 1Q4NX 3VM5A 1NQKA 1F61A 2INFA 5C9UA 4JTEA 4GUGA 3LM3A 1A50A 1P0DA 2OSWA 4GC3A 5G2WA 5GQBA 1J8VA 3L21A 4J3WA 1XR2A 4UZUA 1DIOA 4UTWA 1ZBWA 4AZHA 3OGVA 2XINA 3VIKA 3OBAA 3SGZA 4PFMA 2OT1A 3FFSA 6PTDA 1B5TA 5HATA 1K7XA 1KTNA 1FDYA 1ENUA 2DH3A 4E8DA 4Z1BA 5KMYA 3MPGA 3GVRA 4AX7A 5HJXA 1W1ZA 4NJJA 1NF7A 3IRSA 2O0TA 4AYSA 4FLSA 2H3DA 4EPBC 4XX6A 4LCRA 4IICA 1XDJA 1OHLA 2J7GA 3PG9A 4JN6A 3GNDA 1PZ1A 4LAZA 4C7FA 4CD6A 3TCSA 3K8LA 1PYMA 4D1IA 4IFRA 1J10A 1C7TA 2ZVIA 5EPDA 1B57A 4NT0A 3FXGA 2ZBTA 1A0EA 2WMIA 4GLEA 3VFLA 2HSAA 5HPOA 1OIMA 3CL7A 3M5YA 1BF2A 4EANA 4KIRA 3HIJA 3TFCA 2PODA 4D6IA 3L4VA 1B3WA 4FR6A 3OLGA 3RR4A 4F9DA 1ZS2A 3UY7A 4MF4A 4QE1A 1XIBA 3L2LA 4V1YA 2XH0A 1UWUA 4PCFA 1MUCA 3WEZA 1TWWA 4FNQA 4K8HA 2WJDA 1UUOA 5CPLA 1H4PA 1S38A 4LWWA 4S38A 3GU1A 3OJGA 1UCWA 4CQCA 2ZOXA 2X0YA 4NJHA 3EXTA 2PGWA 1PIFA 1RR2A 2FGBA 1QR7A 3U7BA 5JBDA 4GD0A 5I02A 1E3XA 1EJWC 1V77A 3K8MA 4D72A 2J77A 1EXBA 1O1HA 3SRHA 3KHDA 4Q8NA 4RR4A 1I75A 3UJEA 1S5VA 1US2A 4MKSA 3W87A 3BV7A 1V02A 1TWDA 3CLWA 3LGDA 1J11A 6REQB 3THUA 2HTMA 3NJ3A 1IZJA 5AVHA 3LNMA 2WSYA 3K4AA 3P61A 1X1OA 3O7UA 1BYCA 1FWTA 1E40A 1PEZA 1NTHA 3OVRA 1RLDA 4UR9A 3STGA 4XTDA 1M68A 3M16A 4LJ3A 3HGRA 1LBLA 1OYBA 3M5ZA 2FTPA 4RE4A 2DZWA 2NV1A 5CLWA 3P80A 2VL4A 2QS8A 3B05A 1F4HA 4K68A 3SFWA 3DUGA 1QHZA 5DANA 4UNIA 4H7CA 4LUSB 4U4MA 1JDDA 4C90A 3EB4A 4ZTYA 1SUXA 3ORWA 4ML9A 2Z29A 4OUIA 3FYYA 3GW0A 4HTYA 3WL1A 3ARPA 3L4TA 4OE7A 4DF2A 4E2BA 5A2AA 3SUWA 4AY7A 3C0QA 3GDRA 4HB7A 4FP1A 3KOWA 3NSNA 4F4RA 1BTCA 1YPIA 3NURA 3TQPA 1JZ2A 5CZKA 4Z08A 3KLKA 1BPLB 3MI2A 3OLEA 3TSDA 5T91A 3PFRA 5IDZA 3N04A 3C2YA 5A8PA 3FDKA 3TYAA 5CLTA 2DSZA 4JKKA 1JD7A 1WBHA 4UTMA 3CH0A 4X9YA 2PWDA 2IS7A 2WJZA 1EA0A 3VMPA 3BSHA 3GTHA 5HNUA 4PUMA 4NL1A 3QSRA 3DBPA 3WNLA 4MHBA 2Q01A 2VOTA 1UUMA 2VHLA 4QJ3B 3KDOA 4HNOA 3NEHA 2OO6A 4E3VA 4ATLA 5G4HC 1T0OA 5EKYA 3HOJA 4IUGA 3WUFA 5D37A 1CLKA 3JVAA 4N9CA 3ATYA 4I5XA 4MVAA 4W84A 3TTSA 1DP0A 4ERIA 1KC7A 2V5CA 4IMFA 3BDKA 3MCMA 2XGZA 2R1NA 5HQEA 3PBVA 3A6OA 3WQ4A 3ZR5A 4EE9A 3BG3A 4IGMA 1MW3A 2EAWA 4QP0A 5REQB 3L67A 1B3VA 4CNSA 2VFHA 4PA8A 5AHLA 5I2UA 2A3HA 2GK1A 3TYCA 3N73A 1MFVA 1EGZA 2A7PA 5FACA 1NP0A 3RLHA 4HA3A 5AC4A 5FD0A 2BOFX 4O14A 1WXYA 4ZE5A 2WBGA 2INZA 5LIYX 4P5UA 5BCAA 3BTNA 4AXNA 4DO5A 3B0XA 1P0KA 4J3TA 1BHGA 4J3SA 3BAWA 3CL8A 4QG8A 5CZ0A 1SR0A 5B7YA 1KCKA 3ATZA 4B5VA 1JI1A 2X2YA 3LPOA 5I6SA 3HTWA 3HQOA 1UA7A 3VKBA 1YTEA 3MV11 4PMDA 5DX7A 2W63A 4M7TA 1GOKA 4EXAA 3KCLA 3WJYA 3SO7A 3W72A 3NQCA 4R7OA 1E3ZA 1ECQA 4J7RA 2GVYA 1T8XA 3WO8A 4K1GA 3WMCA 3R2GA 1K4HA 3B40A 3W6YA 3NXLA 4CD7A 4I9MA 3VDBA 3SBFA 3Q2DA 3QF0A 4PRRA 1VBHA 4MIMA 1W9XA 3GU2A 2QUVA 1POJA 5ABHA 1T7LA 3WBEA 3FEQA 4QRNA 4PUKA 3UF9A 5A6TC 5D2YA 1R30A 1MDLA 2I5IA 4Y9NA 3W7IA 4DI9A 1KBJA 3CMFA 1SMAA 3MSDA 1XH2A 1H63A 1BYAA 3FK4A 3QTPA 5AHIA 4UWMA 1R9YA 1FWJC 2BODX 1UR1A 3FAWA 1HP5A 1TV3A 1MO0A 3MMTA 2OZTA 3MA8A 4JR5A 5DMMA 4NRRA 5F1UA 3BMVA 3UZWA 3VXGA 5FF0A 5BWFA 2CIPA 3QTGA 2ZZ4A 3VKAA 1ESWA 3H53A 1K77A 4FA3A 3HPXA 1YHTA 1KRMA 2PURA 5CJNA 1MRAA 1Y0EA 4B9YA 3TW6A 2FDSA 1QVBA 4RZBA 4XIMA 3OOQA 3NZPA 2J7CA 2X1SA 2CZEA 1TMHA 1V6WA 2EKCA 2DUXA 2FVLA 1V0LA 3UG3A 4CD8A 4H6QA 4QQUA 3I3BA 4NZ3A 3DZ1A 4MNLA 1K7FA 1TV7A 4M1BA 3H2EA 2HS8A 5T8GA 3N3MA 2GQAA 1FFRA 1QW7A 1I2RA 4W7UA 4GXMA 4LB3A 3LENA 3NPVA 2ZZ5A 1OCNA 3B9OA 4IHCA 4OFCA 1KM6A 1R7AA 3VVGA 3WK3A 3LTSA 3OO2A 4DJEC 1QHPA 4J3VA 1BKSA 3BGAA 2HJPA 1DQXA 1EUNA 3RX4A 4HZ8A 4JN7A 1CGXA 1UPPA 4H9UA 1Y5WA 4Z0SA 3MP5A 2VRQA 1NQ6A 3RUBL 4MPQA 1SMDA 2XN2A 2HS6A 3LCXA 1A5NC 4GX9A 1GVSA 2FJUB 1E6QM 4CU8A 1FHDA 3OG3A 5TF0A 1UWQA 3DN5A 3W26A 2DZBA 3AU2A 3P60A 3TC7A 3KBNA 1L6YA 4HA4A 5M3WA 3NDOA 1KWGA 1XPGA 4UTHA 2WNZA 3EXSA 1S1RA 4UQAA 1PSCA 4WRHA 3R0DA 3IARA 1TB3A 5LSMA 2G4FA 5XIMA 3GO2A 3VAVA 4D6EA 2IKIA 3NZGA 1TZ7A 5FEXA 1EEPA 3B0VC 3RLGA 3KRSA 3ABQA 6ALDA 2UZ9A 1W3LA 3HFTA 3TTYA 2WHMA 3F4CA 4DO6A 3TZFA 2Q09A 1Q5MA 3RU6A 2HVOA 4K6AA 2BGQA 1PYFA 1UWIA 4NP7A 1RQEA 1NARA 3NSXA 1FKXA 2I9EA 5E0FA 4JFSA 3HGJA 4PB3A 5AYXA 1V3IA 3A47A 2QUMA 5CJ5A 3UXKA 2VUNA 2UBPC 5C54A 1AFSA 3UZYA 1KM1A 1GVRA 4JQ4A 4WUIA 4ROPA 3W00A 3USZA 3GYEA 5I23A 1MUMA 1R0MA 2CZDA 1F73A 1ISWA 3O9NA 3PPHA 5I07A 1I0BA 1OSEA 1LYXA 5C9XA 3LV5A 4UTLA 1XSJA 2PU1A 1CGUA 4WJEA 4W9TA 3NXFA 2JEQA 3WL0A 3ABXA 5D8WA 4HU3A 2NXGA 4Q8PA 1U33A 3IRDA 3S2MA 2ZADA 1U5HA 3FNDA 4AWEA 5CCZA 1RH9A 3A3XA 4PTWA 3ICJA 2QDGA 3EWWA 3NOYA 5GNYA 1OINA 3TSMA 4GIYA 3A23A 4I8DA 2ZA3A 1UASA 1IXPA 2OJPA 1LL7A 1DWJM 3MI3A 2XWDA 4FO4A 3GW3A 4KWWA 3BG5A 4KT2A 4GRSA 4ACZA 1IQ8A 9XIMA 1A53A 2QVNA 4Q32A 4YJ5A 1QI0A 4HIBA 1GQJA 4B4HA 1J5SA 1BYDA 2PDFA 1OFPA 4PUUA 1RAKA 3PY2A 3TYUA 4A2RA 2V3GA 3TA6A 1UD2A 1F2JA 4AIEA 2VWTA 3RLVA 3DERA 3GDMA 1A5UA 4GZJA 3WQVA 1JNEA 1FTXA 3RGTA 3WQOA 1Z6KA 3EYPA 2BOEX 4C6LA 2G0WA 4MM1A 4PR4A 2PDJA 3TAKA 1U22A 4DELA 2YB4A 1Q65A 1P6CA 3WFLA 2P0OA 3G1AA 1ZAHA 2DW6A 3G5EA 4GH3A 2VCCA 1Q45A 4MFEA 2PZ0A 1EYEA 2JALA 3F4NA 3AI0A 3TX9A 5BYWA 4I9JA 1EP2A 5DT7A 2G95A 1F3TA 4TX9A 1CXKA 3W1TA 1UHVA 3PG8A 4GKLA 1OFDA 1UC4A 3DFOA 3GDBA 1ADOA 3LDVA 4M6UA 5JMUA 4KKXA 1AW5A 3GNOA 1HKJA 5B80A 2QUTA 3EWUA 2C1IA 1TQXA 4P7NA 3GQYA 5CSYA 4IUOA 3ARVA 1TPC1 3HGSA 3KHJA 3NM1A 4QCFA 4UTJA 3ID7A 1GPFA 2R82A 4ATDA 4JTLA 4MYXA 3W82A 2DZVA 1MI3A 1UP2A 3RCYA 3A64A 4M29A 5HWNA 1T41A 5DY3A 5A8OA 3VIHA 3RPTA 3VDAA 3CYVA 3QOMA 2XH4A 4GUFA 5D2WA 1Z69A 4GBUA 1SZFA 2FVMA 4PMYA 1OQFA 1B3ZA 3VNMA 1BYBA 3W53A 2C0HA 3WSUA 4HHPA 1UG6A 1PIGA 3NG3A 1MNZA 2G37A 3W24A 3WLHA 1TZZA 3R7MA 3QV9A 2DIEA 3R8HA 3SY5A 3FXYA 3WUGA 2E28A 2PWFA 2OPJA 3N2CA 3FSUA 4IJBA 4LUTA 4LH8A 2VFIA 4IH3A 1HT6A 3W1UA 2XGIA 4XUYA 3OA3A 4H9ZA 3P93A 4IQLA 4D6DA 2BDQA 1RXOB 3PHAA 3C4UA 1MEWA 1JZ6A 4LV4A 2BG5A 2L5HA 2RHGA 4L65A 3K4WA 5C2XA 1W1TA 5D2VA 1SJDA 4GYPC 3PZNA 1LOSA 4Z2IA 2R91A 2BASA 2WXDM 1VFLA 2V30A 1LJYA 3KOYA 3NO3A 3TZNA 3RAOA 3MANA 1G67A 3DFYA 5BXPA 4NY2A 4XAZA 1VJIA 4GQGA 5TIMA 2WMGA 4ZQMA 3ERPA 2VTFA 1TIWA 4UTTC 4JYFA 1AMYA 3CT2A 4XD6A 1Q8AA 2YDSA 1OT1A 4WGHA 5KZDA 1ZFJA 1CXLA 1FWDC 5F4XA 4MB3A 2PE4A 4MJMA 2PGRA 3FYOA 4O17A 5GNZA 5D9OA 4DUOA 2XSBA 1JVNA 5CPQA 3HO8A 1EZ2A 4M51A 3TXZA 5SWUA 1C9WA 4JTJA 1VD6A 3G24A 4O11A 4GOAA 1UP3A 3AIQA 3STEA 2JIWA 1VJZA 4P7OA 3WF3A 3G1DA 4ORIA 2E9LA 2FTWA 2DJXA 4LYRA 4IOTA 3WF0A 1IEVA 4RXFA 4GFIA 4CN4A 4YYFA 1H2JA 2XTKA 3R25A 4A21A 2ZRVA 2EPNA 6ENLA 4DBSA 4HPNA 2W3ZA 4HU4A 2OMAA 1OX4A 3U6WA 4B92A 5BOEA 3KOXA 3QYQA 4O1EA 1X38A 3IACA 1RPXA 1YNPA 3PN8A 4U28A 1M7PA 2V5BA 2WWCA 3U2CA 4JKLA 2WZTA 3SN1A 4XZWA 2DT2A 2Y88A 2JE8A 5AC8A 3QR1A 2W62A 3N9RA 4XZIA 2VEPA 2Y62A 3DGRA 1EJXC 1GQLA 4K7YA 4N6FA 1IHIA 2POZA 2Y5EA 4F0RA 3AXIA 4X22A 3UVAA 3LXAA 3CU2A 3CAWA 4FNPA 1KRBC 4AC1X 2JQXA 3O16A 1QO5A 1AA1B 1CNVA 4Z2GA 2NXHA 1LUCB 2WSRA 7TIMA 4GYFA 1Q6QA 3TE9A 3N19B 4OV9A 4CGTA 1M7XA 3G1YA 3SIMA 5I3JA 3UPBA 3W02A 1VEPA 5U7SA 4YN5A 2IKHA 1GNXA 2VQTA 3HG2A 3JRKA 4FX7A 1HJXA 5IFTA 3BJSA 3MHUA 3W4RA 3EA1A 1TUFA 1ZAIA 4Q7BA 4KRTA 2OZ8A 3QM3A 4YLWA 2HXTA 4UFHA 5M17A 5IHSA 3UNDA 1AW2A 4XAPA 2HBXA 1ZU8A 1W2VA 1OGSA 1OGBA 2QCFA 3R89A 4RJEA 2WVVB 7REQA 3PSWA 1E73M 2OLAA 3N1AA 4A35A 1PIIA 6CGTA 1FWAC 1WO2A 3CZLA 4J2MA 2GLKA 2O4QA 4XISA 1HJVA 3WX7A 5HPCA 4BZYA 3DHPA 1LOLA 1M01A 1TIMA 3EMQA 3CH9A 3QV6A 3BAKA 3B0UX 2OODA 3EOOA 4RDVA 2C7FA 3FKRA 1OY0A 3RX3A 4UMCA 4EACA 3C2EA 1GWJA 5K2ZA 2QDHA 3I6RA 2AQOA 1KD0A 5J8LA 1NEYA 3VCNA 5C71A 3EDKA 3P67A 4LTSA 1KQYA 1LROA 4HQVA 2J25A 4L4LA 4GCXA 4US5A 3POCA 3MB9A 3W84A 1G9HA 4GABA 3TONA 3GKAA 4W8BA 3WLRA 2ALDA 4F0MA 1UZDA 1XIMA 3B9DA 4WIWA 1ADSA 1QNPA 2AMXA 1KBLA 1VPYA 3ZXWA 3N6HA 2J7HA 1KTBA 2H9AA 1W9UA 3VGBA 1WAUA 4LUYA 4JTKA 3NQEA 2JF7A 3QY6A 4OBSA 4ERGA 3MP3A 3QY8A 4PMOA 4EXQA 4H9TA 3AYTA 1CGWA 1JEZA 3M6YA 2YX0A 3ALGA 2VURA 5E1QA 1CB7B 3UT0A 4AEOA 2G3MA 3DYPA 1VRXA 3LI1A 1Z32X 4DBWA 1XH1A 3IS4A 1CI1A 2AQWA 3KDNA 4BKNA 3GXNA 5HMSA 2YA0A 1IGWA 4MDOA 1D7KA 3W29A 1HJWA 3GNPA 1EBGA 3EOSA 4B9ZA 1SW7A 1UR0A 2QCLA 3NQMA 1W1YA 2VKZG 2PLCA 1ZALA 4O1DA 4IIFA 2ATMA 2PSNA 1DJXA 1ODUA 4RZ4A 1B3OA 5K4XA 4BWLC 5CJMA 2XVLA 4X63A 3S1XA 3ZOAA 4FALA 1ICQA 1JXJA 2KZHA 3IJ6A 4TX6A 2C19A 4HNCA 2Z1SA 1AH0A 1O68A 2CBJA 1MYRA 2R94A 1T5AA 4CNUA 1FWRA 5IBXA 2WJEA 1R3YA 4JTHA 3PANA 3UVIA 1GT8A 3RILA 4XQ6A 5CAKA 1NWTA 4HBKA 1EIBA 3WK2A 1KV5A 1YX1A 3P3BA 3LPGA 3AYRA 3SAZA 3TN6A 3ITVA 3NPXA 4OGZA 4X2PA 1G4PA 1JL8A 3WMSA 1LWIA 5F2MA 5A95A 4ZCWA 4QCEA 2XIOA 1W32A 2V0TA 1SPQA 1IWAA 3M0LA 3NQDA 4S3KA 3A5VA 3EDFA 3ZS4A 1A3XA 3CASA 2J6VA 2E6AA 3WDJA 4FK9A 3ARZA 4PMVA 4F8XA 2QQ6A 1IWBA 1K1DA 3KBJA 1XGDA 1P0BA 2VDGA 1ZRQA 3IV3A 1ZNNA 4FIQA 4R7WA 4F48A 3PJTA 2WMIB 5I09A 2X05A 4QITA 4PGLA 2BZNA 1ITXA 4RNFA 3G0SA 3GFXA 2GGHA 1QWGA 4PMRA 2J75A 5FAGA 1LBFA 1TV8A 4ZO6A 1FWWA 1N8FA 3WBYA 1GOXA 1F6KA 1ZBCA 2E67A 3U3HA 2Y61A 1G7UA 2JKPA 3WD1A 4JTRA 3PSVA 2NUXA 1RBAA 4CEXC 2IPGA 4R88A 2PGFA 3BH4A 3ITLA 4UNKA 1XXXA 2ZCGA 2VELA 2VGFA 3H7VA 1DJYA 4JTAA 5CGMA 1E6RA 3F5LA 2XFYA 1OK6A 3R0KA 1CECA 1YMYA 4GIAA 4XB3A 2EF9A 3CEPA 4H8UA 4RW3A 1QNSA 2HZGA 5A6BA 2GSHA 4M8UA 2PWHA 1SJAA 1H7RA 1R3WA 2QAFA 3IAPA 3H2CA 3C5QA 1EJUC 3ABZA 4L6OA 3T9PA 1RPKA 1XGEA 1CGTA 3GUWA 1KGXA 2V63A 1CXIA 2G8ZA 1A49A 2FZ8A 3WZ0E 3H8AA 5JQ9A 4A22A 4QAIA 4GFSA 2BV9A 3W1QA 4MNKA 3PJUA 3H70A 2GQ3A 4H8NA 3VNLA 1VH7A 3SDOA 5DRCA 4Q33A 1E0UA 1RD5A 3S1GA 3TN3A 3A24A 3B03A 2ZICA 4WSJA 2NSXA 1Z9AA 4AD5A 2FGLA 1QPNA 3NCOA 1SO5A 2OKTA 3G0UA 3O6YX 4MWAA 2A3BA 1KFWA 3WQDA 2PTYA 4GXWA 1HG3A 1R3VA 3W81A 3ARRA 3CIWA 1CW2A 4O50A 1E1EA 1Q6GA 5EMLA 3PPFA 5HBFA 1N8WA 3T40A 4GQBA 1JZ3A 1W3NA 5E0KA 1HXJA 3W1LA 1J12A 4NZ5A 2X09A 2ZRYA 2XG9A 4DZ5A 3ITXA 4EP8C 4JIIX 1H1NA 1B1YA 2V2HA 3NQAA 2JEPA 4YYCA 1XD1A 3STPA 4E8GA 5K3VA 4OVXA 3V16A 5EMUA 4J40A 1J96A 2NQJA 1WBJA 1KFKA 3WNMA 3XIMA 4V28A 1W3KA 1UKTA 2CKSA 5CZJA 1LL4A 3WY1A 2WQPA 1QPRA 3R10A 5K9XA 4XAYA 5TD4A 4KPLA 4IPLA 1RQBA 1N2VA 2G3IA 4EWND 4A3HA 1MZHA 1QOQA 3FLUA 2V68A 2DJLA 1UPMB 2J9YA 4L5ZA 1E5JA 3EA3A 1B90A 2VOMA 4QM1A 1AQMA 1JPIA 3WF4A 3CTLA 1TV4A 1H11A 4YMZA 5FSEC 2DU2A 1MWOA 1W1PA 1OX6A 1U2YA 4OECA 3AMCA 3SCNA 1SM9A 4IP4A 4UFLA 4PYSA 1M41A 3R11A 5L9FA 2GPTA 3THDA 4S3GA 4YU1A 3CAKA 1BF6A 3K8KA 1Q66A 3AIVA 2J7FA 5CKSA 1XRFA 4ZB0A 1R6WA 5FIPA 3QH2A 2YW4A 1E4LA 4QGCA 2Z2BA 3HQNA 1E56A 4KRUA 3QR0A 5FL1A 2W9MA 4XIAA 3VGGA 5I79A 1LQ2A 2VFDA 4MZ1A 2YXGA 1DXIA 4REQB 3CUFA 1PL9A 2VZTA 4AW7A 2GK1B 1AJ2A 1FHVA 2XU2A 4AHOA 2ZXAA 5K4ZA 2PDHA 2DQXA 3H2MA 1OCBA 2CZ5A 3CAQA 3ZT6A 4WDXA 4EIVA 1H0GA 2PD9A 2DDXA 3S1UA 1UROA 3B97A 3QPZA 1L6FA 2Y2WA 4AB4A 3EWYA 3KLLA 1DJWA 2YYUA 4JCMA 5GJMA 4ZTXA 1QASA 2WMKA 2XN0A 1PJ9A 2J47A 1JYXA 3B8VA 1AW1A 3L65A 5CH9A 3P81A 4UQEA 1DBTA 1TPEA 3NGFA 5GJPA 4IF2A 1J2BA 3UR7A 4I6VA 4JYEA 1TTIA 3V7PA 1M3UA 3E5BA 3NQBA 4A3RA 3MW7A 4ML4A 4EOUA 2Z1KA 2ZWYA 4MB5A 2X40A 1R7OA 4O18A 3M7WA 4Z2LA 5JVLA 1PWMA 4AZBA 3LHTA 8XIAA 2BVDA 1P0EA 4WKAA 5B7ZA 2DZXA 3ZWTA 4M6VA 5LIKX 1EL3A 1MDRA 2CLMA 1M7OA 1F8IA 2ZX6A 3AQUA 3W2KA 3QZAA 1GKQA 3L4ZA 1HKVA 1B0IA 4GZEA 3RMEA 4JOMA 5BXRA 1S5TA