2BOGX

Catalytic domain of endo-1,4-glucanase cel6a mutant y73s from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
280
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E-2
publication title Crystal Structure of Thermobifida Fusca Endoglucanase Cel6A in Complex with Substrate and Inhibitor: The Role of Tyrosine Y73 in Substrate Ring Distortion.
pubmed doi rcsb
source organism Thermomonospora fusca
molecule tags Hydrolase
total genus 109
structure length 280
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 2bogX00
3VOIA 1OC6A 2BOFX 1OC5A 1QK2A 1HGWA 4A05A 1OCJA 1HGYA 4B4HA 1OC7A 4AU0A 2BODX 1OCBA 1UP0A 1BVWA 2BOEX 4AX6A 4I5UA 3RU8X 3VOGA 2BOGX 1DYSA 3ABXA 2BVWA 4B4FA 4AVOA 3A64A 3VOFA 1TMLA 1CB2A 3VOHA 4AVNA 3VOJA 4AX7A 1UP2A 1OCNA 4I5RA 1QK0A 3RPTA 1UOZA 1QJWA 1UP3A 1GZ1A 3A9BA
chains in the Genus database with same CATH superfamily
4G56A 3PTMA 4ZEPA 3WL0A 1BVNP 4A8LA 2FDMA 4UC5A 1YE4A 1K8XA 2YCKX 1Z9AA 1AH3A 1O7AA 2BY2A 3RMJA 5KTLA 3VCNA 4OECA 4S2CA 2R1NA 1QNRA 3SCVA 1DJXA 2PDMA 1X96A 1RUSA 4YLWA 4R7WA 4PR4A 4GQGA 3SJNA 2YXGA 1EP3A 2XN0A 4J3XA 3HQ1A 2QF7A 1ZBCA 1CGXA 4S3DA 2F7FA 3EEZA 4CU6A 1MW3A 2VFEA 1EC8A 4UQDA 1RCXB 2ZBTA 4W4QA 1V6TA 4MIMA 4LYQA 2V0TA 3EX3A 1JEZA 3DFYA 3TA9A 1O5XA 7PTDA 4RZ6A 4GCXA 2IS7A 5C9XA 3R8GA 2UV8G 2J9ZA 4E2DA 5M03A 5M2FX 4GNVA 2Z4GA 3A24A 1PHWA 2OODA 1KXTA 3QPEA 4PBFA 3OA3A 3A3XA 1WCGA 1QBBA 2XN1A 1UWAA 2A21A 4CUCA 4C6LA 3S9YA 3ZQ9A 4WHBA 3S9ZA 5BMWA 5HINA 4CVWA 2WSQA 2J66A 3B0PA 3CAVA 5C70A 3RFAA 3SY5A 4I3GA 5BOOA 4Z2JA 2NZLA 1F73A 4DJFA 4A2RA 1OCBA 3P8IA 2C91A 3GC5A 3RLHA 4FAMA 3E49A 3W1AA 3FEMA 2PWHA 1H3GA 4ROPA 1OM0A 1XLMA 1J12A 2X0YA 4RXFA 2OT1A 2PDLA 3NZPA 2Y5SA 4GX9A 3FLUA 2I9EA 3RN6A 3RCYA 3OB8A 2JK2A 3ARWA 1BVWA 3G3MA 1KRAC 1CEOA 4PTVA 4QR6A 3LHYA 4MYAA 1XP3A 2WHMA 3IEBA 5CEWA 4IFKB 1DJWA 4X3ZA 1OGGA 3CYJA 1RP9A 4O1AA 3C2YA 2BGSA 3G22A 2CBIA 1QASA 1VRXA 4QQUA 4QAWA 3SCQA 1WZMA 4O1DA 1ZHAA 4ATDA 1UUOA 3RLVA 1O94A 1JRBA 3KOXA 3TJLA 3TH6A 1XLHA 3KUMA 1NWUA 2A2IA 4HPHA 4GGHA 4NJGA 4KCWA 3FJNA 4DO4A 3SIZA 3OU8A 1FRBA 5CXPA 1H5VA 2QPSA 5E0CA 5DCEA 1PIIA 1UMLA 4R88A 1R3QA 3W6YA 5FL1A 3M9YA 1S38A 3EWYA 4FLSA 1QHOA 2C13A 3BW3A 2L5HA 2FPTA 3VIFA 1XFCA 1P0BA 4O11A 3WJYA 3SIMA 3EWXA 3WUFA 5DCBA 1CT5A 3L4UA 4K68A 5LIWX 2WV8A 4JAWA 3THAA 1F6YA 3C0SA 4U2ZA 4S3KA 3DU0A 1UW9A 1UD2A 5FJRA 1MO0A 3QLLA 1B4EA 4QROA 1ME8A 3GXMA 3PZIA 3CT2A 5EMJA 4LVDA 4NAEA 3D6NA 2ODOA 1UP3A 5CGTA 4IX2A 4M19A 3CTTA 1VYPX 4LS0A 1UQYA 1DJGA 2RGMA 3VPLA 2VCAA 4GUFA 4AIUA 4CEXC 2OOFA 3W27A 2C79A 7ODCA 3KOYA 4WDUA 1MEIA 1DOSA 2J8GA 3KL0A 3PBYA 5DF0A 3TP4A 3DC0A 2DVTA 2P0OA 3NQ7A 4MAZA 3CH9A 4TXEA 1J10A 2H3DA 4LWWA 2E5CA 4UR8A 4CD7A 1B30A 4P7LA 2W0UA 3S46A 5HA7A 2PDYA 3H2OA 2QUUA 3BG9A 3W70A 3HBLA 2B4GA 3ITGA 2P0IA 4M7SA 1YXCA 2VEPA 1R9ZA 4JHMA 3NZQA 3W1TA 4DF2A 3N6HA 2ZRZA 2IKHA 4ZZ9A 1NAL1 3M6DA 1WBHA 3WBXA 3CV2A 3KOFA 4WK9A 3OVGA 1IQ8A 2E67A 3VNLA 1ZNNA 4L6OA 3STGA 3CIWA 4XVDA 3C0LA 1ADDA 3H2EA 1VEMA 5IBXC 2X2GA 3AC0A 3KVJA 3A9IA 3W1RA 5AY7A 5LNUA 1QMLA 4FK9A 1Q2SA 5BMXA 1FA2A 1OFRA 3BLLA 5FKYA 1ESWA 1X1NA 4JX4A 1SR0A 1A5MC 3GFZA 3VD4A 1V6UA 3PTQA 4GUJA 2WJFA 2Z2AA 1CGTA 3AJ7A 5I79A 1KM2A 1P43A 5HBFA 1E6NA 5T26A 4EK7A 3EA3A 1R2SA 3CQIA 3F7JA 4D6EA 1EWDA 1VRDA 2NUXA 1F7BA 2WLYA 1F07A 3CIVA 1LL4A 4GI4A 1AMKA 3NQCA 1EX1A 5E93A 2JFEX 3PJTA 1UR8A 4F2UA 3T0AA 1PWLA 3BCJA 3O8AA 5D02A 5A8NA 3TZFA 6REQA 2XM1A 1K02A 2X0SA 3A3WA 1E1CB 1W8GA 1RJPA 1NSJA 2NUWA 2X8RA 3SUUA 4GH3A 3BW4A 4GVFA 2QUNA 4FOJA 1WV2A 5FSEC 1FXQA 1BVZA 4OVXA 3WD4A 4GI9A 4RNFA 1A5UA 4HZMA 1W17A 3I6EA 4AXKA 3ZR6A 1CI1A 1BYAA 3WBAA 3GKAA 5FJPA 3SR7A 4Q6JA 3WBEA 1NFPA 3VD9A 2WSYA 3I3DA 2GSJA 3VOJA 1MRQA 4MF4A 4AZ6A 1XLFA 4KWUA 1FDJA 3PSWA 1U1JA 1B90A 4ZTXA 4K3ZA 2KAUC 3LV6A 3TN6A 4L9XA 3TLQA 3S8HA 4Z2LA 3VDBA 1YEYA 4A4AA 2GUUA 1YYAA 1O12A 3SQSA 4Y9OA 3T8LA 5LZLA 4TQTA 3C0QA 4MWAB 1VFUA 2HS8A 3N3TA 3MC5A 1FWNA 2E9BA 1L0PA 1JZ6A 2BOFX 1OSEA 3EBVA 1LLWA 4EPDC 1PXGA 2ZUUA 3R79A 4UFMA 2P10A 2YX0A 3G8RA 4HNLA 4IUOA 3UZZA 3OGRA 4FNTA 1UA7A 3KWSA 1VCFA 3QXBA 2ZZ3A 1TQXA 4MM1A 4Y9PA 3XISA 4R33A 1DXFA 2Q6ZA 4IM4A 5GVJA 3WMLA 4YHEA 1XIEA 3I4EA 4C6QA 1SU5A 3KRSA 1W9VA 2QJJA 3WX7A 4NAFB 1B31A 4UTUA 3OODA 3RM9A 1OWQA 3O6AA 1V0LA 1XH1A 5D04C 4YWSA 5BU6A 3W76A 5A6JA 1PIFA 2WANA 2V3FA 4IT1A 3TU9A 2W4XA 3VX0A 3S83A 4NJHA 1NARA 1VHNA 3ZJ6A 2E8ZA 1H62A 1U2YA 1IEIA 2ZXQA 3NZRA 2EEXA 5FEZA 3NJ3A 1A5AA 5A6TC 4YS1A 3ZFHA 1LBMA 5E9AA 1SR9A 2AL2A 4O1EA 2ZDSA 2QJMA 3FA3A 3STPA 2X0HA 3TCEA 2DH3A 1IT8A 2EQDA 5LA2A 4GO8A 1YPFA 1Z32X 3K8MA 3RIKA 3YPIA 4HN4A 4QJ3B 5F4XA 3TYUA 8RUCA 3U7VA 1PAMA 3CZKA 1RLCL 3WLPA 3EKZA 2JALA 3R6IA 3B9NA 3NEHA 2ISFA 4NQ1A 2TPSA 3O63A 2PAJA 3TNBA 2Z2BA 3NZ1A 1TV5A 2IQTA 2XFRA 3QJAA 3HPFA 3V1PA 2I5IA 4BHYA 4PMZA 5I0DA 2YYUA 5FJIA 2F61A 2Q01A 3RCNA 4OE7A 1AJ2A 1X6LA 2V5DA 2HRWA 2WKJA 5D9MA 4LC6A 1X1OA 3GC4A 2GOUA 1BWKA 3WF4A 3GYEA 2Y6ZA 3SFWA 1EYEA 4M56A 2YOCA 4WRHA 5CZSA 4BI5A 1TPVA 3FGCB 3DKJA 3T55A 4UTMA 1GZGA 3UZXA 2YZRA 1H0IA 5BU9A 4B5NA 4Y90A 1GTEA 3NQ6A 4UIOA 1IWBA 3U9IA 4S3EA 3QN3A 1CXEA 3LNMA 1D2KA 3L5AA 3NDOA 2UWFA 3F5LA 3RJXA 4DPPA 1QI4A 1O5RA 1YXYA 3EKGA 1AD1A 1MUMA 4FS9A 4UOJA 2E8YA 1ZBVA 5TBOA 1J6OA 1QU4A 2WMGA 1SJCA 5HATA 5HMDA 2IKIA 1XW8A 1LCOA 4WJXA 1B0IA 4IMAA 1OVDA 2R1KA 3UXLA 3DFNA 4MJ4A 1B3ZA 1DHPA 3VVGA 2DSZA 2BDQA 2HV5A 2OU4A 5HWNA 4UTIA 1JGMA 5AFDA 2CPUA 2R1MA 1WAUA 4FNQA 3O6DA 4QQ3A 1DYSA 1NY1A 1F6KA 3UY8A 3R89A 2J7HA 2VX4A 4C6IA 4ORMA 1GVRA 3UJ2A 3M1ZA 5I3FA 3REQA 3M5XA 1VFOA 1HGYA 1VENA 5EPDA 3USZA 4RNHA 4C6BA 2G3NA 1HJXA 2BHYA 5LGZA 3EDDA 4IPIA 4JN8A 4H9YA 1ZS2A 3NTYA 3P3BA 1EYWA 4EXQA 4GIRA 4DWSD 2XIMA 2OWXA 3ABSA 1RXOB 1W1PA 2FJUB 3GS6A 1X6NA 3WYZA 3T0TA 2OZ3A 4G9PA 3NPWA 5IFPA 4XZHA 2P50A 1ZRQA 4HHLA 1M9HA 1AODA 1VLIA 3H2MA 5AYBA 4M5PA 4PB4A 3SCSA 3EYPA 5KITA 1MUCA 3M4HA 2ABBA 3LDVA 7REQA 1VF8A 5REQA 4J40A 1V6VA 3V75A 1MQPA 4JIHA 2WPGA 1LWHA 2PC8A 3AZTA 1A80A 4P7OA 4L4MA 3LGGA 4HNNA 1OCNA 1O6IA 1S5NA 3UZ5A 2VKZG 3NR0A 2DSWA 3W2JA 4IIHA 3L0GA 3CHVA 1X6UA 5EMUA 2VC7A 2XH2A 1QI2A 3VILA 3ZVIA 3GRIA 1TPWA 3PZOA 3NQ2A 3M16A 1FCQA 3D47A 4BK9A 3QGKC 4O16A 1UMYA 4CKQA 5AC6A 1MZRA 1PEZA 2EGZA 3DG7A 3EMCA 4HMEA 2QCNA 2QMKA 4LB3A 3FJLA 3EWUA 4I9TA 1E0TA 4NAEB 1TV8A 3BV7A 4OBTA 1HL9A 3S5NA 2GJXA 7TIMA 2PGFA 3LV5A 5EFFA 3SRDA 3QY8A 1SJDA 4DM1A 4R5EA 4JTIA 4Y9AA 1P5BA 2Z00A 2HJPA 5A69A 5CZKA 1XC4A 1G7VA 2X05A 1LTDA 3M0XA 3U57A 3TMQA 4J35A 1OHLA 4QTGA 1GVSA 1WPCA 3UXAA 4HB7A 2ATSA 4JTCA 1L6WA 2E1WA 4QXIA 5D30A 1V5XA 3ABRA 2ABAA 5A8OA 1AW5A 1Z6KA 3R7MA 3E5BA 1TJ1A 1KCKA 3ME3A 4IIGA 2QMJA 2HBVA 4MY1A 2TYSA 1Q7MA 3CWOX 4FEZA 3V3WA 3GG1A 1KXVA 1EOMA 4LUIA 5DMLA 3WZ0E 1HKWA 2CBJA 3V18A 3C3NA 4EAYA 2OT0A 4IIEA 4DELA 1DJNA 4B5TA 4Q7NA 3AI0A 2QCFA 4YTUA 3RRXA 4KT2A 3W6LA 1FKWA 4RV8A 1K7EA 3I68A 4CCEA 4MWAC 5CC5A 1I4NA 2VFGA 3MO7A 3G24A 4WSKA 4YVVA 4DO6A 5AC7A 4KRTA 2P8BA 4MNKA 8XIAA 5K9CA 3LPPA 3AMLA 1K6AA 4NZFA 4RPPA 3GHRA 3E2QA 2V8ZA 3SURA 2E40A 2WYSA 5CBIA 4M6VA 2I17A 2NQ5A 1XGZA 5I7GA 3NM1A 2ZDRA 1OABA 3LRLA 3T0CA 3K4AA 4HTYA 3ALGA 4Q6XA 1TMHA 5E1QA 1JI1A 5KZ6A 1E55A 3IIPA 1Y7VA 3ZWSA 2CXEA 1DWGM 5H91A 2P5NA 4ZTYA 2G0WA 3PC0A 1XLDA 4CNNA 1E0WA 3BQ5A 3CTLA 2VFIA 2E25A 1EJ7L 1XX1A 3TSDA 4Z2GA 1CGVA 4B92A 4AFYA 4MADA 4U3AA 4PB5A 3QZEA 4AQLA 4XWUA 4TMBA 2PWGA 2CZEA 1TVLA 2PRHA 1UHVA 5D2XA 4XBKA 3T81A 3PPCA 1DJIA 1GYLA 2PI6A 4N6FA 5HULA 3A23A 2WW5A 1VGAA 4O15A 4QJ4B 4DF0A 2GSHA 1E0XA 2P3EA 3FEQA 4XD6A 3VKAA 2NQJA 3ES7A 3OHMB 4JQ1A 3B8TA 3IJQA 4ALDA 3TEVA 3VOIA 3G6MA 4XZMX 4W9TA 1REQA 2WM0A 3QV8A 1H1YA 2YA0A 2PDPA 4AIOA 2NXIA 4DPQA 5BXTA 2ZRXA 1P6BA 3GB6A 3AWNA 2PDFA 2XSBA 2IPJA 1A5OC 1PBGA 2HVMA 1BXNA 4QG6A 4AZIA 5EMKA 5I23A 4DBSA 4J9JA 1YDNA 3INPA 5G1MA 3FAWA 1C90A 1T40A 4V28A 5DBUA 2DZXA 3NPUA 4F4RA 4O52A 2X30A 2XFYA 2OO6A 5HQEA 2DY3A 2ZFAA 4ZE5A 3FVDA 3H2FA 1QO2A 1R85A 3GQYA 3C2VA 2WSPA 1EP1A 3LBOA 2VRJA 1PX8A 3ITTA 2I57A 4AY7A 3P67A 3VGDA 3WFLA 2HTMA 1PTDA 1FY6A 1HJUA 3UA4A 1QJWA 1EDGA 3GTIA 5AKQA 1DHKA 2Z28A 3FAXA 1Q2RA 3WF2A 2ZOXA 3UG5A 4G1NA 5AHIA 3DX5A 3H4WA 4NG3A 3WD3A 1TPDA 3SCTA 4HK6A 3CUZA 4FIQA 5LA1A 2DZTA 1HNYA 2QDHA 4LS1A 4TO8A 1FHUA 3WLRA 2ZUWA 2F38A 3GIYA 1E4NA 1KW1A 3HGRA 4MY8A 4B3ZA 1JQXA 1UD3A 2JEPA 1KGWA 1EJRC 4DJFC 1UIOA 2JGYA 3BDKA 4S3BA 3PFRA 1UP0A 2AL2B 2YLAA 3QGVA 1TREA 3PB2A 3MWCA 3WMBA 1AL7A 1QT1A 1JFHA 2OSXA 2FMOA 1EJSC 5BW6A 3AMCA 1JL8A 4CCDA 5ABHA 3NSMA 5C54A 2ESCA 4W8LA 4A29A 2JKEA 1EO5A 2X16A 3SO7A 4QEHA 2XGIA 4C6CA 1WX0A 4HU3A 1R3VA 5I02A 3OIHA 4FX6M 1UKSA 1F9CA 5I3IA 4NZ4A 4UQEA 3KOWA 2Y62A 2DT0A 1D8WA 1NWRA 2DZVA 4IH3A 3UNDA 1EBHA 4CU8A 3W1XA 2JBMA 1TJPA 3GZ3A 2FHCA 1FHLA 1KNWA 3VINA 4HZ6A 3EPOA 1B9BA 2ADAA 3IGUA 3CL6A 1WB0A 5XINA 4CCZA 4Q22A 4PZVA 4AWTA 1PSCA 4WSHA 4Y6GA 2WBKA 1H7WA 2ZUVA 3FA4A 3VGHA 4AX6A 4PGLA 1L8NA 4IQLA 3K13A 1UB3A 4AWEA 5HPOA 4DWSA 3D3FA 3SCUA 1HKIA 4GX8A 2NSOA 2IPFA 3I6TA 1OG0A 4ORIA 2CNCA 5HWMA 1XDMA 2OX4A 4REQA 1PX4A 3FA5A 1F3XA 1K8ZA 4HA4A 1EJUC 3T1GA 3CO8A 3OPSA 3N2OA 1DL3A 1NH6A 2C18A 4A3QA 4H6RA 3H8AA 3T8QA 4YTTA 3R43A 3WJWA 3AIVA 3RXZA 3ANUA 1W3LA 3TN3A 3JRKA 1X7FA 4ENLA 4O4WA 5H8MA 1R38A 3TAKA 1A0DA 3BARA 2G3JA 3O0FA 1GZ1A 4WKHA 4O4VA 3S2NA 1GQNA 1TVPA 3POHA 1AZ2A 3DERA 3UXDA 4HOZA 1VCVA 1AQHA 1J6PA 1HO4A 1O60A 2CERA 2IW0A 4H00A 2IMRA 3REQB 1XBZA 3S5YA 1DIKA 3TYCA 4Q33A 2VZOA 1TKKA 3UR7A 2PZ0A 3ANYA 2V5CA 4Y8EA 1YTEA 2PLJA 3DN5A 3CB8A 4O10A 1VIWA 3GG7A 3WMSA 2CHNA 1W2PA 3CQ0A 4PUEA 5AHLA 1E56A 1W5PA 4JYFA 5CG7A 1XLCA 2WLZA 5M3WA 1DV7A 3ARUA 3L5MA 2NVDA 1PZ2A 4ZO7A 1TQJA 1HQTA 2EAWA 1JDEA 3V4BA 3GTNA 2Y89A 3QF0A 3N15A 4B5WA 3N4FA 2VC6A 1SW0A 2BVDA 4LAKA 3W22A 5TD4A 1TJ0A 4N2YA 3F2BA 4HPGA 3ICJA 2CBVA 3IJ8A 4FOKA 2DW6A 7REQB 2BVWA 1HKMA 3A21A 5REQB 5LIXX 2GL5A 1EL3A 1FWRA 3H2AA 4H41A 4GFIA 4ZENA 3E96A 4JDBA 3KXQA 1P1MA 2WOQA 2GK1A 1DJHA 4DLMA 3U2OA 2E28A 4OUIA 5KEZA 1M7JA 4I5RA 1T0OA 3IUHA 1JD9A 1BG4A 4WY0A 1F4AA 3LOTA 3E6EA 3LPFA 4WXZA 3UT0A 3AHZA 1HJSA 1TTJA 1BPLB 5AVHA 2IQ0A 3EA1A 3WIJA 1KGUA 5JUVA 3Q37A 3FOKA 4DVOA 3W2NA 2BP1A 3G0XA 3OVQA 4D9PA 4F0RA 2GJXB 1VBHA 1IHIA 4H9XA 1UKQA 1W9DM 4PE8A 2J7EA 1JAKA 2VR2A 2Y8VA 1VJSA 3EXRA 3M0HA 1ISZA 2ZZ1A 4ZO9A 3AZRA 4ZR8A 2PODA 1UH3A 4JPGA 1TPB1 3C2FA 4NY2A 1TRDA 1HXJA 1G0CA 3WEOA 4I7WA 4PBGA 7CGTA 2PMQA 3QRHA 4GQRA 3CS2A 1E6XM 3E2VA 3NL2A 3W7QA 2ZZ4A 2D2JA 3WJXA 1EDQA 5DMYA 1QCWA 2OTDA 2ZRVA 1R7OA 4UNKA 4RDZA 1V03A 3UPMA 1QOPA 3STEA 3WBWA 1B57A 4HNCA 2V63A 1EGVA 2PTYA 5BRPA 3VX1A 1AVAA 5AB3A 5K4ZA 1WXZA 1DE6A 3HGOA 1IWPA 3C86A 4W84A 1NWTA 2ZICA 1DORA 4BR1A 3O05A 5MKGA 3MDWA 3H55A 1TV4A 4PCSA 2J7GA 5D9PA 3NL5A 4H8VA 2V69A 3HJZA 3PFMA 3UEQA 1L2UA 5I78A 3SY1A 1G7UA 1QW8A 1NEYA 4DXXA 3POCA 5A6SA 1VD6A 3M5VA 1QNPA 1GW9A 4BF5A 3HFTA 5AC5A 1XRSA 3RPDA 3HPAA 1POJA 1EF3A 3K30A 4CQBA 3PPHA 4CEUC 4BF7A 1BWLA 4G5DA 4BWLA 3S6TA 4INFA 5FJOA 3VABA 1DXIA 1PL9A 3IIZA 3ABOA 5FEXA 1B4KA 1V3IA 3MJYA 2CETA 4O1CA 4O1FA 5AHEA 4JTSA 2XUCA 1OZMA 3SDOA 2G37A 1G69A 2DT1A 4AD2A 2PTWA 2R24A 5KZDA 2FGLA 3IAPA 3G1XA 1HT6A 2EG7A 3BK0A 4LUSA 1G5AA 1XI3A 3MKKA 1AG1O 2WC7A 4AD3A 4F40A 3P5YA 1EA9C 2AQVA 3GWQA 7A3HA 4IGNA 1UPPA 2XWDA 3BPWA 4ZMGA 4X9SA 4M3PA 4OHQA 1ZPTA 3WQOA 3WD0A 4CD4A 3TMLA 2Z7GA 5CPNA 2YYTA 1VB9A 1I8JA 4W93A 3WG6A 1ZJBA 1R2RA 5GPRA 2NQ9A 3TSBA 1PKYA 2Z0IA 1GKQA 5IDZA 2WNZA 3WN6A 3IV3A 4J27A 4RJEA 3IK4A 2INZA 4LOCA 2OX1A 1G9HA 5DFAA 3EX1A 1LOQA 5FESA 2XVPA 1OCJA 1UKTA 4B9ZA 4X2RA 4JTAA 3CZ8A 1A3XA 3R8RA 4F0MA 3QYQA 4O0QA 2Q8LA 1UWUA 3CBWA 3WQEA 3R0KA 1X39A 5CSYA 4O19A 3TXZA 3OW1A 1A3WA 1JD7A 1JULA 1OYCA 4ONVA 2ZWYA 3M7SA 3GXTA 5AYZA 3BAKA 1GOWA 1CGUA 3I4KA 4S39A 1MW0A 1JPHA 3GDLA 4GQQA 3SJ3A 1EIXA 2O9OA 3W26A 1OGSA 3KX6A 4CLMA 3M44A 3ITOA 4GXWA 4J3VA 4WR3A 4AHOA 3ARXA 1PYMA 1MI3A 1RA5A 1QW7A 1JF6A 1XYBA 1I9CB 3V16A 5HR6A 3ZT7A 2NT1A 2E77A 2PA6A 2BHUA 4L4OA 4UTLA 3APGA 4MG4A 2JF6A 3NQEA 3MP4A 4MSSA 3SCWA 3GW0A 8CGTA 2VUYA 4XAGA 4CNOA 3SCPA 3N19B 4FXSA 2ZRWA 4DYJA 5K7JA 3MDUA 4LXFA 4XBSA 4KQNA 4WDTA 5IXEA 1OFAA 4ZODA 4AHQA 4UQAA 3VKKA 4XSMA 1E6RA 3EDKA 3KLKA 3ATYA 3GXFA 1JR1A 2HPMA 4WJEA 1WYIA 2PP1A 3GNOA 2G8ZA 1Q63A 2EBNA 1US2A 2FYMA 3K46A 3ONCA 3UYCA 2DIKA 5I3JA 2WZHA 1RPKA 1XICA 3W75A 2NT0A 4LFYA 4LQ1A 3IJ9A 3STFA 2OKOA 5DANA 4E2OA 2DQXA 3M46A 1H1ZA 4KETA 2B7OA 4BF9A 2W62A 4JTKA 2PURA 1B1YA 1MXGA 2NV9A 3ZJ7A 2FHBA 2YW3A 2FB3A 4YL2A 5I3GA 4M0XA 3WCZA 4MNMA 2ZUNA 4LTSA 3JZEA 1EH9A 3TJIA 1BGGA 4DZHA 3P84A 2V5KA 3W37A 1YBQA 3QR1A 1PO9A 1XYFA 3WQ8A 3DFSA 3GE7A 1N8IA 4TTUA 2WKGA 5AVNA 3CUIA 1DWHM 4H7CA 4EX4A 1XLGA 3PUEA 1AW1A 3LRMA 1A47A 1OX5A 3W7PA 4DBDA 1JZ5A 5B80A 3WD2A 3AXIA 3BAJA 5BNKA 2HWGA 4X2PA 4HQVA 3S1VA 3O16A 1RJQA 4C6EA 3H2CA 4YTQA 1EXBA 1C7SA 3S4TA 4KKXA 3T2PA 2DZSA 4GLEA 1R3TA 4GG9A 1CXLA 4DWSB 1FWJC 3VO0A 3MHGA 3B4YA 4JNMA 3PBVA 3XIMA 3WLTA 1W1A1 3TN4A 4OWGA 2JE8A 4D6IA 4K7VA 1W3JA 1DIDA 2INFA 4IPJA 9RUBA 3NVDA 4QCEA 1DJQA 2YBUA 4W87A 3EMZA 5LHFA 2ZX6A 4HOWA 2EJ1A 3UP8A 1KRMA 5JMUA 3SUSA 3H21A 4HK5A 4MFDA 1N55A 1H41A 3LMZA 2G5WA 4Y96A 1SO6A 4HNOA 2CLMA 2JEQA 2G4FA 2R82A 4OOUA 3H2NA 3Q4DA 3CJPA 1G6CA 4QITA 4IQEA 1KCXA 5FEPA 1VBUA 2PD9A 1UCWA 3NYDA 1MNZA 4I6KA 2SFPA 1NDZA 3VZZA 4EF8A 3LK6A 5HQLA 2Z29A 2A3AA 3FK4A 4OFCA 4RZ4A 1DEDA 4C6FA 1Z7AA 4HMCA 4D71A 1VS1A 2FFIA 2D69A 3O7UA 3O06A 3NQ8A 4QS6A 4QEEA 3WL1A 4K8GA 1E9LA 3MYOA 4XBJA 5DO8A 4FLOA 1J18A 3U2EA 4GJ1A 4LB4A 2PP3A 1VJZA 4NF7A 3U5YA 4Y9MA 3GSMA 1HL8A 3LG3A 4WUIA 3B8VA 5HWJA 2GVGA 3QR3A 3VKBA 3TJ4A 5K4XA 2BVYA 1OT1A 4XKYA 4GIEA 4GHRA 3N1AA 4R3UA 2JKPA 4U10A 4JY9A 4ZQCA 1LUCB 4UZSA 3TWBA 3G6LA 1C9DA 1UR2A 4Q8VA 1MFVA 3VD3A 3M5YA 4KRUA 4LS2A 3UZWA 3AHTA 3B4UA 3RLGA 2WC3A 3UR5A 3BANA 5B7YA 3UW6A 3PAOA 2GK1B 2G4JA 1S5VA 3A4WA 2QR6A 4MHBA 4NI3A 5E70A 4LH8A 4JN6A 1NQ6A 3E74A 3G18A 4A3YA 3T7VA 5JVLA 2CZ5A 4GY1A 2WMHA 5E0KA 5HNTA 4X60A 3TV8A 5HK4A 2YXOA 3WLQA 4RV3A 2ZWZA 4L7ZA 4C6JA 2DVUA 1YNPA 3AO0A 3ECQA 1TUFA 2DU2A 3C5QA 1US0A 3DAQA 3R0DA 4JFSA 1NP0A 3TAOA 3RITA 4GI6A 5CG0A 1XSIA 1QUMA 4LY8A 4AZ7A 1ZCOA 4RNIA 3T2OA 4O1BA 2P53A 4NXSA 4NZCA 2H8XA 3GHTA 1HW6A 4G2DA 1I2RA 1I2NA 2PWVA 4JKKA 3UWWA 3BLEA 2A6NA 1I60A 3K4WA 2JF7A 4JX5A 4WX2A 2YDSA 4J3WA 3N2TA 4Q4RA 3MSGA 1ZTVA 1CYGA 3NG3A 3CWHA 4RE2A 2WC4A 2CFFA 1KKRA 4LUTA 2OEJA 3T07A 3SCNA 1XS2A 3T44A 1MQQA 1GOXA 4ZCWA 1V0KA 3DYMA 4POCA 3QOMA 3M64A 2CLLA 3W86A 3HZ3A 4ZQPA 3MWAA 2PBOA 3TTQA 1LG2A 1IIGA 3WNLA 1UR1A 2WMKA 3R5EA 4DRSA 1K9DA 1YNYA 2HDJA 5MKGB 4A3HA 1YRRA 3GUGA 3B97A 1SM9A 3MI2A 4GPNA 4IF2A 1KR0A 3BGAA 3W7EA 4JCMA 3EEGA 3A64A 4RE4A 2VT0A 4F9JA 1VPYA 2CZFA 3VIOA 5JH2A 2W63A 4MMWA 3UETA 4YTRA 5I5RA 3IIOA 3GVQA 3ITYA 4ZB2A 3ORWA 1EC7A 1A50A 2XIOA 3ZSTA 4FNPA 3O9NA 3MBDA 2HROA 2Y7FA 4UMAA 4B5VA 4L4LA 2Y7GA 2V2DA 2CITA 2NX3A 2V38A 3OQ8A 3KCJA 4HGXA 4UTTA 3R12A 4AHPA 2VD8A 4FHAA 1JQVA 2CESA 3PTDA 4FF7A 2CZVA 2UY3A 4AYSA 3LI1A 2MUCA 4J28A 1KCLA 3N11A 4HSNA 5U7SA 3EWBX 1Y5VA 4C91A 3LHWA 2YPIA 1NDWA 3ONBA 5LIYX 2I5QA 3WH9A 1C8YA 3AYTA 3S1GA 3TROA 1E5NA 2RJHA 1KTNA 3LMYA 5CZJA 4XAZA 3QSTA 3OA5A 1XLKA 2WZTA 3R4IA 2QGYA 4LUSB 1FWGC 3H26A 4N9DA 3W2LA 1XIJA 3VZXA 3ZLGA 1VFMA 1YHTA 3SCRA 5JBEA 2VRKA 3EXSA 3ZOAA 1V77A 4XVEA 5DEZA 4H9TA 3W88A 2DUXA 3QQWA 3RAOA 1KQYA 5JBFA 3DDMA 1X8FA 4UWMA 2VR5A 2HS6A 3LQGA 1Y5XA 4OQVA 4Q8QA 2OQLA 4DEFA 3PK7A 1O5QA 1WAWA 3PAJA 2VZSA 5FF7A 2EPKX 3E12A 3CAWA 1HIZA 3I3EA 4R9XA 5CPSA 2AMGA 3IUIA 4QP0A 5CKSA 4C60A 3H4XA 4U4MA 1R3SA 4BI7A 1WP6A 3TQ0A 3ELFA 1KQZA 4E8DA 4B2DA 3QC3A 4X63A 1XKYA 1A5KC 3WK2A 3L2MA 5M1TA 1DWIM 2OYKA 1UZ4A 3MS8A 1J11A 4NP7A 5C71A 1NVMA 4AU0A 3PG8A 2PRMA 3EOUA 2VDGA 2VX7A 1KFLA 3OLIA 3LA4A 2D22A 4GISA 3APTA 4WLCA 2BXYA 1W3KA 1ITXA 2VRQA 3AJXA 3OP2A 1V93A 1R3YA 2WMIB 2QCGA 4LV9A 3WSUA 5CPTA 5HOSA 1XKJA 3BZJA 4A8RA 3NSNA 5C55A 1M01A 2QS8A 1XIMA 3W3OA 3IGSA 2Q8XA 5D2YA 4R53A 3LI0A 1CLVA 4IIFA 2VMFA 1BTCA 3RU6A 2ZE0A 4H04A 3CWNA 3WQ5A 1XC6A 4QJ1A 3K5XA 2QDDA 1JCYA 5HMFA 3QKEA 3F2CA 5ABFA 4NI8A 5B7ZA 2QVHA 3KL3A 1VYRA 3BE7A 2EJAA 4HT3A 3BSHA 1Q4NX 4IP4A 1WDQA 2E09A 3T4WA 3N2BA 1KKOA 1QI0A 2GQ9A 1OFOA 1R47A 3LCXA 4JFWA 4AMCA 5C5YA 1ZSXA 3HQOA 3LU2A 2MANA 4MPQA 4HPJA 2VQTA 3NURA 3CHDA 4MJMA 2VWSA 2KX9A 2V3GA 4FALA 3KBMA 3NGJA 2B0MA 3DI0A 3LX9A 3PP7A 3PTKA 4LBSA 5EMLA 4LU0A 1GVIA 4FR1A 3GXNA 4U2YA 3UXKA 2DZBA 5AZ1A 6XIAA 1ZENA 2CC0A 5JU6A 3LTSA 2PDCA 4C6PA 4EVZA 5PTDA 4EOUA 3CLMA 3BJSA 4H01A 4JTUA 3VCCA 4QE4A 3I6RA 3VIKA 1UZHA 4EE9A 3KM8A 3BV4A 1GTHA 3AWOA 5FIPA 4CCCA 4B5UA 1LRNA 3CLWA 1YPIA 3SI9A 1VPXA 1A53A 4GZIA 1V02A 2V3EA 3ISIX 3R8HA 1KBKA 3UA3A 1XIBA 4WD0A 4L6DA 2X1TA 3ABQA 4IICA 4UTFA 3CZEA 2GYIA 2O7SA 1H7OA 1GOQA 3MI6A 6A3HA 5ECUA 2NLIA 1J5TA 3ZVHA 1EC9A 4BS0A 1TWDA 2J8FA 3QR0A 1SZFA 2XPKA 1VKFA 3DXIA 2ISDA 3UQNA 2PWUA 3SUVA 1H09A 1EJXC 1WNOA 2JGQA 1FWWA 1GG0A 1KR1A 1RHCA 4XAFA 1BLIA 1QBAA 1O4UA 3C2OA 4IMEA 3U5UA 4GACA 1XISA 2PD5A 1LBLA 1M41A 2XIJA 1PV8A 3AMDA 2ZTKA 1DWFM 4P7RA 1EPXA 3GR8A 1OCQA 3CB3A 3E0IA 3U2CA 4JBRA 4ZOCA 4PMQA 4B4HA 4I90A 4US5D 4XD4A 4QM1A 4AW7A 3VOHA 4MZ1A 3GXPA 1I1XA 2EXOA 2WKLA 3VOCA 1TCDA 4D8AA 3LB0A 1ZALA 2YCLA 5A6MA 1TYGA 4LEQA 2BWGA 3GBDA 4ZXLA 2E5BA 2GDVA 3NA8A 1PKNA 2FZ8A 1OY0A 4Z1BA 1S2WA 3KL5A 4Z2KA 3QV9A 3L4TA 4DZ5A 2ZXBA 1OF8A 5IFTA 4DNMA 2ZQ0A 4L6HA 3W2MA 1OFEA 3KLLA 4HJWA 2YA1A 3UU0A 1WKFA 4TX8A 2AKZA 3L65A 3RM8A 1JPKA 3F5JA 2G3MA 4CQCA 4F0HA 1NOFA 2HXUA 4JFVA 3ZMRA 4KGLA 5IHSA 3USBA 3PZ9A 1NF7A 1CBGA 3WUEA 3NO5A 4W85A 3SQMA 2YL5A 2AGTA 3WY1A 4AISA 1W5OA 3C8NA 1U5JA 1IEXA 1S3TC 3HMCA 4XKYB 2E6YA 5BXPA 5C7VA 3AXHA 4F9DA 3C6CA 4F0LA 1TZ7A 3DCPA 4I5XA 3ZWTA 3LCWA 3AAMA 3B0VC 3KTSA 4H1ZA 3TW6A 3GAYA 2BXZA 4J3SA 3H7UA 2PDWA 4KEMA 4NSBA 1FWAC 2XTKA 1KTCA 2FVKA 3SSZA 5HJYA 4WSJA 1V3HA 4BWLC 3C56A 1S2UA 3WQPA 1IXQA 5D09A 3KEHA 2D2GA 3BCFA 7TAAA 5E9XA 3CIXA 4S3FA 5D2TA 1XQLA 1LDCA 4NNBA 2CHOA 2QJHA 3WDHA 1CCWB 3W28A 1PDZA 2FHFA 3VGFA 2DSVA 3PM6A 1SZEA 1OIFA 4O53A 2PDGA 2J79A 3L4ZA 3EOSA 5BWFA 1CXHA 1NQKA 1XYMA 3N4EA 5LYRA 4L9YA 2E0PA 5C2CA 3NOEA 4HP5A 1W56A 3OIXA 1O1ZA 1GG1A 3ENLA 1QNQA 5DY2A 4JTFA 2P3ZA 3MZ2A 4ERIA 3W00A 4PSRA 4LSBA 3VA8A 1UG6A 4XB3A 4U33A 5I3KA 3WQ6A 4MVAA 4LUTB 1ZP3A 2VELA 4NU7A 5GJNA 4KWVA 5T9BG 4BEQA 1FWCC 3MO4A 4MZYA 2Z2UA 1WZKA 2J47A 2Y2WA 3V5OA 4O28A 4IPNB 2YW4A 4P7QA 3IARA 3OLEA 2A0NA 2J6XA 3PWGA 2C1HA 1RH9A 4M7TA 3LLFA 3QGAC 1KFCA 1J01A 3W85A 1ICQA 4A3UA 4DJDA 3C2RA 1BEUA 3WEMA 4AG0A 2FZMA 1SFSA 1IR1A 1GPWA 4D6HA 2D20A 2PEVA 4JIEA 2QDEA 3MHFA 4F66A 3M0ZA 3AIQA 1UKOA 2WHLA 3SUWA 4XQ6A 3PJXA 4D1IA 2XGBA 4GNJA 1OC6A 3L4YA 4LANA 3SFKA 1XIGA 1S1PA 1E1FA 3B8WA 4WF7A 3QVQA 4FPSA 3WLOA 3OG2A 2VCCA 5A2CA 1KA9F 2NWSA 3DFTA 3G1VA 3MKCA 5BRBA 1MUWA 4ADTA 3VMPA 1E71M 3AS3A 1K4HA 1J4EA 1UQZA 1O95A 2NVCA 3DHDA 4V15A 4Z42C 5LNWA 3TN5A 4M82A 5DY3A 1WE5A 4L4PA 3S5ZA 3U2ZA 3N6JA 1F8IA 4XX6A 1LM1A 5LKYA 2WNWA 5HAOA 3NQDA 4IFOA 3G1YA 2CLHA 3G2GA 4UNLA 4LBUA 2ISWA 3BL3A 2Y4SA 3FYYA 2YA2A 4HYWA 3KCOA 1K70A 2YZ5A 4GKLA 4DBWA 3UERA 3PZNA 1LG1A 1XDJA 1LQ2A 3GLCA 3TOPA 4H9UA 2BOGX 1E9ZB 3PBUA 3HPSA 3TR2A 2X09A 4FZIA 4IP7A 2F6XA 5FL0A 4IZGA 4DIAA 1C29A 4MKNA 2FTWA 3A9BA 2GPTA 2DSUA 1UUQA 4MUZA 1TB3A 4DN1A 4JIRA 4ZOEA 5KZMA 4E2VA 5C9RA 4Q4QA 3KVKA 2BG5A 1PKMA 1JG9A 4PL1A 3H7VA 1LRTA 4RPQA 3UJFA 4AY1A 4EPBC 5AZ0A 1BYCA 3W7HA 1RD5A 1OF6A 3MUCA 1BQGA 3CZJA 3RJYA 2QCEA 2D73A 3R1ZA 1QI5A 1ZB5A 4X0NA 2Q71A 4ECLA 4JYDA 4OIFA 4FMVA 5G4WA 4IMCA 1T96A 3B40A 1JYVA 3NOYA 4HU0A 1Q6LA 4O13A 3TOYA 5C7HA 2PWEA 5G2IA 1FCVA 1CB7B 5BOFA 2PTZA 1WZAA 1W3NA 3NUKA 4UR9A 2ZYFA 4FP1A 4IFRA 1SSDA 4WZHA 1OFBA 1IEQA 1TPC1 1JF5A 4IL2A 4BFAA 3RYSA 1YQ2A 3B0YA 1VCGA 4B4FA 5F2IA 3WH7A 3M0IA 3PNZA 2D0FA 3AQUA 1JCLA 2C0HA 4GE8A 4UTJA 3NAVA 2XINA 1JZ7A 5BZAA 2PS2A 5CBBA 3URQA 2E3ZA 3CMFA 4N42A 3VK5A 1Y65A 3E02A 3EPNA 3OGSA 3U48A 3W53A 1XD1A 2CWNA 4Z0SA 3V5FA 2D2OA 4BZYA 1V0NA 3IS4A 1HUVA 3TLLA 3WK3A 3PHAA 2J75A 3BLOA 4LVFA 2WCGA 3KBJA 2VL4A 5RUBA 3W4RA 1W2VA 1E0VA 3VIMA 4IISA 1SFLA 4WCJA 3NFUA 5GQBA 1Y8BA 4AX7A 4S3GA 3W82A 5CGQA 2VNCA 1S3HA 1G4TA 3N73A 2NV1A 4AMAA 4KGJA 2Z24A 2EG8A 5D05A 1FH8A 1PZ0A 1HTIA 4EWND 1F5ZA 1W8SA 2BX7A 3RG6A 1Q6GA 1E40A 1T41A 1WUEA 4GJJA 4ZBCA 2DP3A 3CUHA 1E15A 2OZ0A 3KS5A 1RBLA 1AZ1A 1XH0A 3UWQA 5HMEA 3RO6A 2RDWA 1XJBA 4AVNA 3VD7A 1UOZA 3FNDA 3I10A 3EXTA 4US5A 3RILA 1JCNA 4FR6A 1QNOA 5C6MA 3Q58A 4JR5A 5DCDA 3O3RA 2WMJA 3UJRA 5ABTA 2VXNA 1DKWA 2YL9A 3KVLA 3EDEA 4HA0A 2OSWA 3QW4B 3LNPA 4F2BA 1X7IA 4X0VA 4K37A 4D2JA 3V1HA 2OJPA 3VDGA 4IXHA 3IPWA 4ZXOA 3U4AA 3N3MA 3LXAA 4GY0A 5F4SA 2PF0A 2P1FA 3QFWA 1W31A 4UBPC 1Q7QA 4M80A 4O54A 1C93A 3DFHA 3B0XA 3GFXA 1KFBA 1OIMA 1E51A 3HG5A 2A3LA 4GYJA 4P2VA 4C7FA 2H9AA 3SGGA 5AHNA 1AJ0A 1RALA 1VJIA 3SEPA 4AD4A 4L1GA 1GHRA 5I07A 5G1YA 4NRRA 1S5TA 4AYGA 3U7BA 4DAIA 1CLXA 4LUJA 1S2VA 5MHBA 1RQHA 2YCJA 3W1MA 2AGKA 1I2QA 1KLYA 1Z48A 3TONA 3L12A 3F2DA 4PMUA 5CLWA 2CU0A 1HFBA 3LGEA 4GYPA 3SGUA 2XU2A 3VIPA 4CN6A 5HDRA 3CEPA 2YDQA 1MWOA 3L4VA 3EWWA 3TUUA 4XUYA 3W01A 2QCCA 3THDA 3GR7A 3C52A 4P8UA 1VC4A 1B3WA 3OBAA 4Q4MA 2VEIA 2CLPA 2RDTA 2ZRUA 3VNJA 3W7GA 1AFSA 3BICA 4TVUA 1WOBA 3BVJA 4UFJA 4HCHA 2PFHA 1YKWA 5AC4A 2VURA 4L1XA 4WGHA 4IXXA 4BEUA 1DTNA 1EWEA 1BF2A 2Z1XA 4N9EA 4MB1A 2PRLA 5CAHA 3URBA 4W7WA 2PUZA 5J8LA 1H7XA 4FI4A 4FXJA 3D3AA 1K8CA 2XISA 4S3AA 4MNJA 3CM4A 2OELA 4AZGA 1AJZA 2Y1HA 2ZE3A 4W88A 2XH0A 1L8PA 3W1NA 4C5YA 3V0UA 1J2BA 2A85A 2X1UA 2PP0A 4JIIX 1ZLPA 4UFHA 1GQLA 3TYAA 3WDQA 1GW1A 4KFNA 1UBSA 2A7NA 4LAMA 1E6PA 3B3DA 2Q09A 1QPOA 3LM3A 3R2GA 1ICPA 3WF3A 3HQNA 2G3IA 4M6UA 1VFLA 5F1UA 2BFGA 3RCMA 1NFGA 3WUGA 3HN3A 3BMXA 5D9NA 1FTXA 4IGHA 4IJRA 4I8DA 2PU0A 2WB5A 3FSTA 3GU1A 3SCOA 1QPRA 4UTTC 5BCAA 1LOSA 4DUWA 2WNQA 3LENA 4UFLA 4PCTA 2BMBA 1S5MA 3BG5A 3IGHX 2XZ7A 1J8VA 3R58A 3ES8A 3K4DA 2TODA 3N4AA 3A4XA 3UPBA 1EUNA 3G8EA 1XUUA 4RLIA 1W1B1 4EPKA 2Q02A 1SSGA 1GOOA 3MHUA 4C65A 2BHZA 2WXDM 3CASA 1H1NA 2VEGA 2A79A 2J74A 3QZ6A 3BLFA 4PMRA 1UZDA 1XXXA 5AHMA 1O68A 3TVAA 3QHNA 4NIRA 4QBXA 2W79A 1H61A 4BY3A 3KS6A 5J04A 3SQLA 4LT9A 2PDNA 3P82A 2Z1KA 4WKAA 4ZOAA 4XO7A 2QVNA 3GW3A 9XIMA 3QPYA 3G1SA 4F48A 4ML4A 2WSKA 5TNVA 2B7QA 4IMDA 4JNYA 2OYMA 5CAKA 3LBMA 3IJ6A 4FOUA 4PN2A 2WSRA 3DFOA 2WCSA 2C16A 4D8LA 3P60A 3PY2A 2J78A 4D6FA 3K8KA 4IG2A 4K1GA 1CENA 4AD0A 1KBJA 3AHYA 3THUA 2OQYA 4IIDA 4A8NA 4KH2A 2R6OA 3ZYZA 3WQVA 3URAA 3WD1A 1KLZA 3MYPA 4IWWA 5FJJA 4C7GA 5LGXA 1E3ZA 1F74A 1W9BM 1GQIA 1XRFA 2X7WA 2CLKA 1MFUA 3PPFA 1WKEA 2GJRA 2FB2A 2BZNA 3AYVA 5HXMA 1THFD 1HJQA 3H23A 3P93A 3LM7A 5CPMA 1EHNA 1GPFA 3WEZA 4C6KA 1F3EA 1XG4A 4LPCA 4R7OA 4UTKA 3QBUA 5CPOA 2IXUA 1OZQA 1J9YA 3P7YA 3ZT5A 2IKGA 3CAKA 5C9UA 3FV9A 1XIIA 1HKKA 5J5DA 3G1RA 4NJKA 3ATZA 4Z1CA 2E6DA 3S2MA 2DQWA 4JTQA 1JDDA 2F8QA 3GDRA 2GSEA 5XIAA 1BAGA 1C9WA 2DFAA 1G67A 3SGZA 4GJIA 4HPNA 3GXDA 3I3BA 1E4IA 4HHPA 1W1ZA 1FWFC 4H8NA 3SN1A 3ZSSA 1JFXA 2H3BA 3BJTA 5I3HA 1JAEA 4ZQNA 4NUWA 4HD5A 3MMWA 4Q4OA 1BYBA 4DJED 1PJ9A 5FEWA 2OZTA 5AYIA 3NDYA 3GNRA 4NXKA 3NCOA 4J3ZA 4Q32A 4ZFCA 1EO7A 1BQCA 1RY8A 5G1TA 3UR8A 4UTWC 2QDGA 3B0UX 3VCRA 3KRUA 3MSRA 4O12A 5A3HA 4GUIA 3S2LA 4I9JA 3ZJ8A 4LW7A 2XZ9A 4QE5A 5E6ZA 1BKSA 5LIKX 1OJXA 1GVYA 5FF2A 2ZZ2A 1EF2A 2VOMA 4AZ5A 3I7SA 3UFYA 1W1IE 1JCJA 2FDSA 3FCPA 2BVTA 3DFQA 3R10A 3FFSA 2NLYA 3PBGA 5FJTA 1VEPA 3ZLHA 4E3VA 4M51A 5K9DA 3EKLA 5A5WA 3W1LA 4EAMA 3W73A 2V6AA 1FWIC 2DW7A 3BOLA 4HVXA 3DBNA 2ATMA 2V81A 3PWAA 1JZ4A 1W32A 3AIWA 2EPMX 1UR9A 2DIEA 4GBDA 3L0NA 4PA8A 2BS9A 1E4LA 3TYDA 4HIBA 5I6SA 3MMTA 1K8YA 1DWJM 1FOBA 1NFBA 2OLAA 3P80A 4DYKA 2BSLA 2BODX 4P8WA 4H9VA 1GYNA 5FAGA 2WZMA 4JTHA 1IIHA 1TMQA 4ZB0A 2J77A 4YXGA 3CL8A 5D33A 2NXGA 5AHFA 2VDIA 3FJ4A 1UD8A 1RCOB 1OB0A 1VBJA 4TVDA 3R11A 1F2JA 3TTEA 1UIPA 2ON3A 4UCFA 3S1XA 2XH4A 4Q4PA 4FF5A 3T78A 4XAPA 1ZUAX 3N18A 1P0NA 1DWAM 4JL2A 5FF4A 1GORA 3N2CA 1HKVA 1VYSX 4DUXA 4QCFA 3SSJA 2G3FA 3HV8A 1ZY9A 4UXDA 2ZTJA 2XM2A 2WPBA 5D8WA 3Q2DA 4LCQA 3EDFA 3IJIA 4YWIA 1W37A 3GTHA 2VO5A 3ZS4A 4AVFA 1XH2A 1F76A 1EB3A 5JQ9A 2X7VA 1PZ1A 5FF0A 4GC4A 3ARZA 4WXYA 4H4IA 4C6OA 3RX3A 5E6YA 2FKPA 3EWZA 4UQBA 3BAIA 2VOTA 2NSXA 3AISA 2PDIA 1QPKA 3C3UA 2XN2A 2WK2A 3AYSA 2XVGA 3GH5A 1XCFA 1K9FA 2XG9A 4WGXA 2QCHA 4D6DA 2VI0A 2O4QA 4NJIA 1ITUA 4DWDA 3MP3A 1R87A 2DDXA 1V6YA 4W7UA 1T6MA 3BJFA 3AZSA 2QKFA 3P81A 3XINA 3CK5A 2GZXA 1TA3A 4DYEA 3AXKA 4JKMA 1E70M 3VC6A 1JNDA 4IOTA 4IHCA 4ACYA 2C8NA 3R13A 2CHRA 1AA1B 1M03A 3BSGA 1OINA 1ONXA 4E5TA 1J2WA 3MVIA 2GGEA 4PEEA 2XWEA 1MSSA 2OGYA 2QCDA 4PUUA 2FPVA 3GTXA 1S5WA 1IE7C 3MJMA 4P5UA 1MDLA 3L9CA 2CZDA 1BFNA 1XLJA 1QOXA 1VP5A 2PGWA 1R0MA 3F4CA 4RW3A 2H9AB 1PUDA 3CXOA 3CUFA 2DUZA 3IVUA 5D9OA 2UY2A 3GUWA 1AK5A 3BUVA 4GXPA 1CNVA 3EWCA 5XIMA 1ADOA 5E0FA 3BLIA 6XIMA 1TIMA 4Q8PA 3N12A 2ZA3A 4O0ZA 3FDKA 3UF9A 2DSKA 3CQJA 4KRZA 3KTCA 1H2JA 4QLLA 3PZMA 5F2MA 2I16A 4HMNA 4XAYA 3FDGA 4EKJA 5KSWA 3L67A 3EA2A 4TIMA 3G0UA 1QI3A 1E6SM 4M6PA 1KFEA 2MNRA 1RSCA 4AUBA 4B90A 4U28A 4EP8C 4OJYA 4ZQOA 1KFJA 2GDQA 3LCHA 4GVIA 4BJHA 2EKCA 3UGRA 3F4NA 2CBUA 1OK4A 1K1DA 4RDVA 4G6CA 1ZAIA 1UWTA 3WQFA 4LF2A 4Q8TA 3FHAA 4NNAA 4GQ0A 3CV1A 2G96A 3UG4A 3EX4A 4WDWA 2J6VA 5KETA 5GNZA 3M43A 1M7OA 1IZCA 1J0HA 4HSOA 3LEPA 5DQPA 2IKJA 4GA8A 1UR0A 4Y9NA 4OV4A 3GDTA 4FNRA 3DENA 3PF3A 4MDPA 1XYLA 1W3HA 4NAFA 2ZUMA 3IJDA 3KRZA 4RZ5A 1XLLA 3V5CA 3LGDA 6REQB 2FLIA 1EFZA 2QUVA 4N9CA 1AUSL 3VNKA 4ASTA 1NDYA 5EA9A 2C14A 2WBGA 2DH2A 3F4WA 2VEMA 3OJGA 1IXPA 4E38A 3OZMA 4DJDC 3MY9A 2YSWA 1EBGA 4MPKA 4OKDA 5HNRA 2VC9A 3Q67A 1N8WA 2Y8UA 4QE1A 2R1PA 1E9IA 3MMUA 2ALDA 3A4JA 3LCIA 3S6DA 2PBGA 3ITCA 1XSJA 4LV4A 3PS7A 3A3HA 3ALFA 1ONRA 1YDOA 4XG1A 5LIUX 1JRCA 3ARRA 3FS2A 2OEKA 4H8UA 2WHJA 4H6QA 4KIEA 2QV5A 3BAYA 3EOEA 1ZJAA 1MDRA 1YTKA 4HSHA 1UYQA 2V30A 1LF1A 1QVBA 3L68A 2OVLA 3HPXA 1E43A 4R9OA 1K03A 3GVGA 1V7AA 1H11A 2PDQA 1IT0A 2AQOA 4LVGA 6TIMA 2G95A 1U83A 3WJZA 4IQJA 4LRTA 2OWCA 1ISXA 4K8HA 2OSYA 4JXCA 3BOXA 4JS3A 4ZGYA 1E3XA 1PDYA 1B9ZA 4QNWA 3CHFA 3PN8A 1M7PA 2Y61A 1YDYA 1GHSA 2G97A 1C91A 3C61A 4A3RA 1LWIA 3FGCA 1IXNA 1IEWA 4NX5A 4Z17A 3NGFA 3B9DA 1DVJA 4S3JA 1G4PA 4S38A 2B7NA 3C4UA 5EMYA 3IACA 2VEFA 1FHVA 4IG2B 4IX0A 4XIMA 1VFFA 1SZGA 5KINA 2RGLA 3PZVA 1PPIA 3HO8A 5FCZA 4DJEA 3TQPA 3M6YA 4PBEA 1M5WA 4MJ2A 4S23A 1HGWA 2PDXA 4Q7BA 1ALDA 3ZJKA 3CUXA 2F2KA 1FP9A 4OV9A 4DZIA 3LLDA 1V02E 3JR2A 2A3EA 2AKMA 2Y63A 3WBYA 4AWSA 4JKLA 3T6CA 2Z1WA 3KBSA 4AD5A 4IJBA 4G8TA 3UVAA 3NDZA 3WNKA 4L5ZA 5D37A 3GNXA 1PTAA 3QV7A 3FXYA 1S2AA 1WKYA 1JPIA 1RY0A 3BOFA 4LJ3A 4MNLA 1CB2A 4MB3A 3W02A 4CD8A 3VGEA 1W1TA 2PE4A 3UWZA 1PX3A 3K1DA 2PLCA 3FSUA 4XISA 1W9UA 1WBJA 3DFPA 2HNHA 1KGXA 1EPVA 3PANA 5CJMA 1KM1A 3CMJA 2ANUA 4UQ9A 3DOPA 1UPMB 3IUDA 1TE1A 4JEJA 2Y85A 4GFSA 4ADSA 4RZBA 1F3WA 3KBVA 2E6FA 1RLDA 3ABZA 3L66A 2QGHA 1JYNA 3G5EA 2W9MA 2D2HA 2ZXDA 3MUAA 1ZAHA 3BH4A 4JGDA 3SAZA 1B3YA 4IMGA 5U4NA 3NQMA 2ZKMX 3F03K 3B9EA 4O8AA 4UNIA 4UTHA 1GOKA 1ZU8A 4TU1A 1BGAA 4KEVA 1Q3NA 1DE5A 3W87A 2NX1A 1JUKA 1PCWA 3IRSA 1V3KA 2OXNA 3M0YA 1JYWA 5FOOA 2RUSA 3B04A 4Q8MA 3IK2A 1UOKA 2ALRA 2PC4A 1Z44A 2GWNA 1R2TA 1YX1A 2XVKA 5JBDA 1ISWA 4U5KA 4HZ8A 4JYEA 3MBFA 4K6AA 1KV8A 2QPUA 4Y7EA 1V7YA 4JL1A 3JVAA 1KD0A 2KZHA 3WQ4A 3W74A 1F3TA 3GVWA 1CGWA 1R9YA 1WDPA 2UBPC 3GKFA 5A6LA 2YB1A 2NV2A 1BXCA 4A21A 2X42A 2GVEA 4KEZA 1ZFJA 4ZFMA 1PCKA 3LHUA 1GVQA 1LOLA 1LT8A 2G41A 2DPEA 3KP1A 2VEKA 3DZ1A 4E8CA 2EPNA 4CVUA 4PTDA 2QIWA 5CJ5A 3ANVA 1LL7A 4JTLA 4E4PA 1VPQA 1RQBA 2BY0A 3GHUA 3WLJA 4HNVA 1AQMA 4TX9A 3BG3A 1P6WA 2POZA 4L1WA 3SN0A 1RVKA 3G1AA 2I56A 2GJNA 5C2GA 4FXRA 4AEEA 4MAVA 1L6YA 3DG3A 1UC5A 3TSMA 2ACUA 2GQAA 1K6WA 3E3HA 3KAOA 4ICMA 3DEQA 3TFCA 5C0QA 1MMFA 2RDXA 3SZ8A 4GVHA 4I9MA 2VC5A 3QH2A 4HYVA 4G7EA 3SRKA 1L6FA 4M81A 5I2UA 2WM1A 2W6RA 4RKAA 3N2MA 1XLAA 2YBTA 4GYPC 3HJEA 2R14A 2GJPA 1QO5A 4I8YA 1ZGDA 3CH0A 4Z1AA 4B5XA 1SVDA 3W7LA 2WAGA 3BLPX 3W7CA 3P74A 4PRWA 4JQAA 3QEZA 3TK7A 2QW5A 2YJQA 2H6RA 3TC6A 3W71A 1LORA 1CLKA 1W91A 3KHDA 2Y7DA 1KB3A 3WLIA 3CZLA 3FYPA 1DXEA 3VXGA 4PRTA 3S0CA 1V0MA 1UH4A 5G2WA 3O6YX 5CJNA 3DHUA 4IUGA 1SPQA 4GO9A 2CCRA 1J0IA 4ICCX 3W1QA 5CSSA 4HHMA 1I0BA 2BTMA 4JTDA 3OGVA 2EKGA 2GVJA 4KWOA 4RK8A 1TA3B 3AIUA 3EWDA 1TWIA 4C7DA 1TIWA 4H6EA 4QX4A 4P8XA 3TX9A 3K1GA 4BQ2A 3E0VA 5CLTA 5TF0A 4XUGA 5HPCA 4EIVA 3TTYA 2QCMA 1R6WA 1TX2A 2QCDB 4Q7IA 3S47A 1V3MA 4R7JA 3QLDA 4CNSA 1A49A 3HG2A 5FF3A 3GDMA 3OLDA 4GRSA 1YPXA 2ZX5A 3HB9A 4ZL1A 4AZCA 5JXQA 1RA0A 3HIJA 3OBEA 4AVOA 5T9CE 4DF1A 5CBJA 1OX6A 4N9BA 1NJJA 4FNUA 3MKVA 4DUVA 1WOAA 1FFRA 3P14A 2W66A 1PS9A 4OOZA 3VNDA 3VUSA 2O9RA 3A5VA 1MVYA 3LXBA 5IRPA 1W5MA 3P5ZA 4GBUA 4WY0F 1XR2A 3QSRA 2DT3A 1WA3A 5DLCA 4EXBA 1W6TA 4GD0A 3RNDA 3A6OA 1N82A 3UVIA 4PCNA 3VIHA 3CMGA 1TWZA 4NT0A 3NO3A 3BMWA 3WKZA 3P0XA 4B3LA 5IHRA 1P7TA 3UJSA 3MSDA 3ITXA 2ZUSA 3VIIA 1Q4WA 3WDJA 2QAFA 2J8TA 3W1PA 4LAOA 3B8UA 3NEVA 1RAKA 4LCSA 3LQLA 1EJWC 2BOEX 3FKRA 3RU8X 1P0DA 4IGMA 5BROA 4YNGA 1LQ0A 1J0ZA 3LD5A 4UUIA 3LYEA 2XVNA 4MLJA 3RGTA 1G01A 1Q8JA 1UUMA 1E0UA 4XK2A 1QTWA 4W86A 3M0KA 1Y5WA 1WXYA 2W5FA 2PDHA 2VR4A 3BLDA 1TWWA 5CPLA 1KV5A 1GKPA 4Q3MA 3RLUA 3WLNA 3TC7A 7XIMA 1P6CA 1TV3A 3VMOA 1K9TA 4UZUA 3BZGA 4RX0A 2HNEA 5C2XA 2J27A 1RR2A 3PBWA 4LX4A 4H2CA 5M17A 2Q8ZA 4UMBA 5GNYA 1E5JA 3T0DA 4RE0A 1D7FA 3UESA 3GIQA 1H63A 3THCA 1B3XA 1QK2A 1JPDX 3TWAA 3G0SA 1EUAA 1L6SA 1B3OA 2PTDA 4QG8A 1CW2A 4KCVA 1REQB 1FUYA 3TCSA 4FIRA 4DO7A 4QSHA 5JH1A 1XPYA 2H90A 3QMRA 1CWYA 3TTSA 1PIGA 1XHGA 5LHEA 5FSDC 1V6WA 3ID7A 4ACZA 4N0RA 2YLLA 4KERA 4U5IA 2O92A 3ARPA 1V8EA 2HCVA 4AD1A 3WENA 1SZNA 1XM3A 2FZBA 3BWWA 4QAIA 4XZ9A 2C3ZA 2RFGA 1JI2A 3ITVA 3R94A 4DQWA 4WIWA 2CW6A 2IPWA 1UROA 4HU4A 3PJUA 3AALA 3ARSA 1IV8A 4AIBA 2A7RA 4GXMA 3PUGA 1VHCA 3EAUA 4C6MA 1C3FA 3V35A 1S39A 4GABA 3RO8A 1N2VA 4E4FA 2RJGA 4EACA 1ZCCA 5A94A 1IZKA 2F9RA 2VZVA 1TR9A 5TQLA 3DG6A 4QJ5B 4FX7A 1QWGA 4XTIA 3VNZA 3S1UA 2D3NA 1FFQA 1B5TA 1XCWA 4GMEA 2UZ9A 4DXKA 3GY1A 3QKZA 4H19A 2A4AA 3N2XA 4GZJA 1OFQA 1VZWA 1S46A 3W6MA 4B2DD 1EA0A 2CEQA 3UXIA 3G1FA 4NASA 4IIBA 3B8DA 3M7WA 1M53A 4E0CA 4WOQA 1F05A 3KTXA 3WLMA 1DP0A 2X1IA 3S2JA 1SJAA 1GQKA 4S1FA 3NVTA 3WFZA 2QCLA 4JEQA 1E1EA 4P7NA 4V27A 3RF9A 3RM4A 3LTPA 2J7BA 3H7RA 4FLRA 2V5LA 3E1F1 1Q7ZA 1X97A 1HP5A 2FZNA 3JU2A 3PSVA 2Y7EA 3WDIA 3KWXA 4UR7A 3RMEA 4PB3A 4TX6A 5SWUA 2AL1A 5A8GA 2ZIDA 1YE6A 3G1HA 5A6AA 4M24A 5AYXA 1GCYA 5FI8A 2I7GA 3W25A 4Q8NA 3OEXA 3WFAA 4LGXA 2PB1A 1UZ1A 4H7ZA 1JJKA 4DM2A 4ZQMA 1DQXA 2BXVA 2WVVA 3QW3A 3CYVA 4H9MA 4ZO6A 2WZIA 4A8IA 4AY8A 1MNSA 2WHKA 3QOKA 4AEFA 2XFFA 1QW9A 1AQ0A 3VDCA 1MZHA 4U3CA 2QUMA 4D6JA 4LYRA 3W7KA 4EPEC 2FFCA 2O55A 3L7RA 1RZMA 1JXKA 2V82A 4QIUA 2Z26A 4I9AA 1VBGA 3M0VA 1GGOA 2GFTA 2VZUA 3TKFA 2FMNA 1TPUA 5E5CA 4Q8OA 3WMCA 3QV6A 2CKRA 3MW7A 1P4CA 3U8GA 1NOWA 3VKJA 4D6CA 3MA8A 5LNVA 3CC1A 5BYWA 1VLWA 3P6LA 4KWWA 1SJBA 3P62A 4REQB 4WDXA 1LZOA 3GHSA 4QHRA 1TPEA 3S2CA 2ZCGA 3HA1A 3RHGA 1K7XA 3E0LA 3KZPA 1BF6A 1XDLA 4QISA 3S5SA 4GYKA 3VFCA 1XLEA 3GBEA 2OLHA 3APYA 4K38A 4LAZA 3KCLA 3WNOA 4O8RA 4DHGA 3ABXA 2GOKA 3AXXA 3P61A 4NVTA 5CZTA 1SQ7A 4B15A 3B8SA 1E9YB 1IXOA 1FHDA 3TZNA 1XV8A 1A5LC 3LHTA 4LCRA 1OYBA 2R94A 1EGMA 3T2QA 3FIGA 2W67A 4I6VA 2GVYA 1OD8A 1XLIA 3WK1A 3T4CA 3LSBA 1A3HA 5DT7A 2C7FA 4RL3A 3AMKA 4MJZA 4W8AA 1T99A 2HVOA 3I7QA 4PTNA 4L65A 1M7XA 3HV9A 4ILSA 1WXJA 1NTHA 4UQCA 5CC3A 4IQDA 4QLJA 1TG7A 4TMCA 1GKRA 1LL6A 4Q4SA 1SUXA 5HNUA 4ERAA 4PMXA 1KRBC 1F6PA 4D1JA 1P0EA 3VGBA 3S1WA 1M3UA 3GVVA 3HOJA 2ISSA 3LLXA 1XIFA 2ZVRA 4KIRA 3VUPA 2V9DA 2ZX9A 2VGBA 1UJPA 2BV9A 2OMAA 5AECA 4GIAA 1KM0A 1E6QM 3WQGA 1XYCA 2GWGA 1NF0A 3CL7A 4H8HA 1OD0A 5D8ZA 2CLOA 3T42A 3OOQA 2FGBA 3SECA 1CXIA 1W9XA 4LF1A 1K3UA 3TQKA 3U4FA 3S5OA 4G7EB 4NNCA 4LEFA 4K2SA 3KW3A 3HM7A 1NELA 1I1WA 1AL8A 1ONWA 5D38A 4V1XA 5FJUA 4GIYA 2GUYA 4HNTA 2Y70A 2VFDA 4BCEA 1MQRA 3NXFA 1J5SA 1V6XA 3PZQA 1Z89A 1IT7A 1FH9A 2YR1A 1AH0A 3B06A 3WJSA 4HBKA 2AAAA 2F84A 3VM7A 3FY1A 4WY0B 1WDSA 1W54A 2I14A 1KBLA 3GNPA 1R3WA 1TO3A 4Z1DA 2PU1A 2TAAA 1Q85A 2GVLA 3W7DA 3D5HA 4YYCA 2B81A 5ABGA 2Z6IA 3GK0A 1LJYA 2C0AA 3LHVA 5BOEA 4ZQRA 1OFPA 4AH7A 4PEKA 2RDUA 3T05A 3VIGA 1JVNA 1SZRA 1XFBA 3L2IA 4PUKA 1TJ2A 4YCPA 3I7RA 5HUPA 3G3DA 4HCLA 1JYXA 3M47A 1P48A 4I7UA 3WH5A 1C92A 1OADA 3GAKA 3DKLA 4JZ5A 1S2TA 2RH9A 2G50A 4QDPA 3DBPA 1CPUA 5FA5A 3HTWA 4WJ8A 2PWFA 1R9XA 3OQEA 4M6QA 1LROA 2W61A 4XV0A 1XLBA 1Q6QA 4GY7A 2ICSA 1FX6A 3OO2A 4UOQA 2PZNA 4PULA 3MTWA 1BHGA 3EB4A 3M5ZA 2FVLA 4UMCA 4IL0A 3L2LA 1GVEA 3IVSA 3GZAA 4IMFA 5DXXA 2VFFA 2OPJA 4UFIA 3TYEA 4AZCB 5CCZA 2C71A 1ISYA 1W9PA 3QQ1A 1VAHA 3EGJA 3W7JA 4QLKA 3VDHA 1H4PA 4KW2A 1W5QA 4NKCA 3EMQA 1C8VA 1FVPA 4EXAA 1H7RA 3VC5A 3EOLA 3BGGA 1AMYA 3GDBA 1CXKA 1IGWA 4HZ7A 4J5NA 2FIQA 3SN4A 5LA0A 3L0KA 4GZEA 2VD9A 4X61A 2QPXA 1UWQA 2AAMA 3B8IA 1GOIA 1SO3A 3N34A 3E2RA 2QNEA 1QK0A 1XIDA 1Z41A 3KOZA 2BBFA 2OGJA 4WEVX 2OZ8A 1IWAA 4E4UA 1P7TB 3CO4A 2QLYA 4DXVA 3MUY1 3EX6A 1HX0A 1XCXA 1ZP4A 4EF9A 4MY9A 5KMYA 1DIEA 1XD0A 2E9LA 4JHOA 4NX0A 4BQ3A 2EPOA 4O57A 4MKSA 1GZJA 1WZLA 2A3BA 3MT1A 1QWKA 1M1BA 1J0YA 3UCDA 3E38A 2GUBA 1P0KA 1BWVA 3CPRA 1ECEA 3NQVA 1RP8A 2A7PA 4DJEC 4HCDA 4LBRA 1JIBA 4GWEA 4F79A 5J5RA 1AD4A 3VMNA 2Z27A 1AH4A 3TTOA 3MPGA 4DJDD 3PPGA 3KRBA 3TYZA 3LPGA 4JQ3A 3GNDA 1QDSA 1LLOA 3F5KA 1EQPA 5EMMA 1Q65A 3MUXA 1V3LA 4QGCA 3PULA 3AXMA 1X98A 4MLRA 1DJZA 4GINA 4GUGA 2EO7A 1TMLA 5D4YA 3W2KA 2GQ8A 3AUJA 4AEOA 1H50A 3ARQA 3CQKA 4ATLA 3WH6A 2QUTA 1HVQA 1WDRA 4IPPA 3LZ5A 4PTWA 4CD5A 1SO4A 4GNKB 3OHIA 2INEA 1R86A 2PLKA 4ACZB 1FWEC 1VQTA 2VENA 9XIAA 2HK0A 2QEZA 2YL8A 4S2BA 3RR1A 4H3DA 4MOZA 4LUYA 4AWUA 2R1LA 2F6UA 2D23A 1GNXA 5EL1A 4DO5A 3M0LA 5D32A 2J7DA 5I09A 4I5UA 4KEUA 1Y0EA 5A8PA 3OYZA 4C1NA 2ISVA 3HFYA 1A4MA 1UC4A 1ZBWA 5ECVA 2ZA2A 3QHMA 3GG0A 3MV11 4H7VA 1TR1A 3DIPA 4LRSA 4C1LA 1KBBA 4AC7C 2J4GA 3KBNA 3T08A 2VFHA 4YTSA 3AFBA 3NZGA 1XWYA 3W29A 1RK6A 1Q6CA 3COTA 1EX5A 2DZUA 2VCBA 2HEJA 4CQ9A 1IR2A 3RPTA 2CLEA 4ERGA 5DX7A 3WNMA 4Q8UA 4CQ8A 1N7KA 2TRSA 3HGSA 2IUZA 4OGZA 1D3HA 3F1QA 6ALDA 4OBRA 2NX9A 4QSFA 5CPQA 4UTWA 1R5YA 2HE8A 4Z0JA 1OT2A 1PVNA 4S3CA 4MYXA 4N6EA 3ARVA 1TRIA 3BTNA 4HKPA 4LALA 4YJ5A 3UWUA 3PJWA 5G2HA 3MVTA 2J9YA 3BCDA 1H0GA 5D2WA 4NRSA 1IZJA 2Z1VA 4JFUA 1J0JA 4PUMA 3N25A 2X1SA 4NZJA 3H12A 4PFMA 1S2CA 4JIPA 1F61A 1V3JA 3K2GA 1YBQB 4LVBA 4XZNX 1U5VA 5EFDA 2WVVB 1POKA 1KRCC 3CNYA 4A22A 1R8LA 3PUDA 2QJIA 4XO6A 2BB0A 1YADA 2FZ9A 3NL3A 4JTGA 4G1KA 3NIYA 3FXGA 1RBAA 1FP8A 4DI8A 3AIBA 2QT3A 3QQ0A 2ASHA 3IVTA 3OBKA 3CV7A 3II1A 4GUHA 1VIZA 4D72A 3QYSA 4JX6A 1XQKA 3WELA 4UB9A 3RUBL 1YMYA 5HANA 4HOXA 3TW9A 3FJ6A 2XVLA 1I2PA 4J2PA 2VVSA 3V0TA 4MWAE 3T40A 2E7FA 3TC3A 2LLEA 1T7LA 4TV6A 1FWDC 5EB8A 3A47A 8A3HA 1UWRA 2DT2A 1K9EA 3N13A 4GK8A 4PYSA 1XPGA 4O14A 4O0KA 1LUCA 4OUEA 3DI1A 3OZPA 4Z08A 1BRLA 2OR2A 4Q8WA 1JCXA 3D0CA 1ZJIA 1UR3M 3GU2A 4OTKA 4YCOA 5A1AA 4LYPA 3HQPA 5C9ZA 2ZZ5A 3UPWA 3W7MA 4A35A 1W1VA 2IPGA 2ACQA 4PUWA 2EG6A 2Q3RA 3HMJG 3N29A 4RXGA 1NOUA 4MB4A 3V7PA 4CGTA 5KZEA 4PMVA 3TW7A 2A3HA 3KDNA 2NWRA 3LCFA 3DC8A 3UCCA 2IQDA 1YIXA 2J7CA 1F4HA 1ZQ5A 4HNUA 3SBFA 3BLKA 5A6BD 3DUGA 3H24A 1A5NC 3AS0A 3UZYA 3BSMA 2HPIA 5F2GA 3SY8A 5ENLA 4JTTA 1NP2A 4LAUA 3W84A 4UOZA 2ZRYA 3KVMA 2X2YA 1TPH1 1K7FA 4KS0A 2WJEA 1GJPA 1EIBA 1NWSA 2W91A 1TE6A 2HE5A 4W89A 4IJCA 5G4EA 5IM51 4K8EA 2GGGA 1Z69A 2O0TA 1B2YA 3VZYA 3W23A 1ZAJA 5C9WA 1XGDA 1JGIA 4AF0A 4GGBA 4LNCA 5EU9A 1FWHC 1RK5A 1W5NA 3F4DA 4K7YA 2YGYA 4YIWA 4CN1A 5K9XA 3QMTA 1EHAA 1XSKA 1GOMA 2V5BA 3DESA 2XIBA 4WVXA 4ZOBA 5C8BB 4JDYA 4UCGA 4PUNA 2NQLA 2QJGA 3UD6A 2Y0FA 2CXGA 3BURA 4Z2IA 3O0KA 1TV7A 3AROA 3BGJA 4JHZA 2CIPA 3W38A 5DT5A 5HQMA 3KE0A 3ZZ1A 1XF0A 3GU9A 6TAAA 2YCIX 1TUXA 1ZZMA 1WQ5A 5BXSA 1TCMA 1U33A 1QFEA 5DRCA 3VKDA 1C7TA 3ZT6A 2VDHA 3IJLA 5CC7A 2OEMA 2B31A 1I0DA 1CTNA 2XIQA 1JZ8A 5A8MA 1TZZA 4JD4A 3IIVA 2WVSA 1SMDA 5EGRA 3RDKA 3PBMA 4DI9A 3SADA 3GIPA 4QDMA 3AYRA 4MUPA 3TFXA 1SGJA 1U30A 1XYZA 4JICA 3N9SA 1WDWA 4MGGA 3UYIA 1U1HA 5K2ZA 1N8FA 3IJ7A 4YVXA 1BG9A 4AB4A 1UJQA 2JIEA 1Q5MA 3PG9A 3TYBA 1SFJA 4QNEA 1GEQA 4Y8FA 1HL2A 3K8LA 1BKHA 3WNNA 2PPGA 1XRVA 2GGHA 1DQUA 5CH9A 3E5PA 1GVFA 3Q65A 3W7OA 1V51A 1OEPA 5MF5A 5DMMA 3LSCA 2PTXA 1NU5A 3LTYA 2QF8A 3T9PA 4GKTA 3AIRA 3RR4A 2YDAA 1BSLA 2PDJA 1C8QA 5GJPA 1SW3A 2PLMA 4KCUA 1DPMA 1L6GA 3QTGA 4QFUA 4TVCA 1KM5A 4KMQA 1U5HA 1OX4A 2DORA 2GGJA 1JXJA 3HGJA 2VX6A 4QDWA 2E1DA 1ICSA 4RCXA 4JTEA 5JIPA 3W1UA 5HUOA 1Q66A 5I3DA 4PUDA 2H8ZA 3WLHA 4LC8A 2P8CA 1XYAA 4DZAA 2YFOA 1GJUA 4YPJA 4PODA 2J88A 4PTMA 2ZX7A 3FX4A 2Z1BA 1JZ3A 3OVPA 1B3VA 4H6KA 1IYXA 4CU7A 4JQ2A 1QR7A 2VQUA 2BY1A 1MYRA 1LT7A 4PH6A 3MP5A 3RRAA 3PVFA 1BYDA 1D3CA 1NDVA 1GUVA 2D0GA 2BGNE 3UWEA 2YBVA 5IOBA 3S6OA 2XJ7A 1QPQA 2WJDA 1YW1A 3WUBA 4FNSA 4L80A 4P8VA 3CUGA 5TAOA 2VVNA 1KTBA 3ARTA 2D1ZA 4C6NA 3LY0A 1AQFA 3U3HA 3LBCA 4X22A 2WMIA 2V5JA 2QV4A 1KM6A 2DZWA 3LS9A 4ZSTA 4ZSUA 1H49A 5H6HA 3KDOA 1O1HA 4HA3A 2I9UA 4LYKA 2XHYA 1EQCA 5H8PA 4F0SA 1DTUA 3VNMA 3NNTA 1ADSA 1DQWA 2Z25A 1PWMA 3O2LA 1RD6A 2WVTA 3FYOA 3URNA 4R85A 1QRQA 3AMGA 4B91A 1OK6A 1WO2A 1D3GA 4J3UA 3KZSA 2IXVA 4PC8A 1SMAA 1MW2A 3OYXA 1DJYA 5LSMA 3HU7A 3IAQA 1GJWA 2UY4A 4QS5A 1JDCA 2JQXA 4E6MA 2GDUA 3NPXA 4N7QA 1ELSA 2YXXA 2W3ZA 1TVNA 4N02A 4ADUA 3FKKA 1GONA 2QZRA 2OO0A 3VOFA 1OYAA 2FVMA 3UZJA 4JTJA 1ISVA 3NYZA 3GNNA 4PMYA 1ECQA 1LYXA 1VEOA 2WQDA 3MCMA 3QC0A 1BD0A 3QZAA 5A8QA 1TSIA 4OBSA 3VOGA 3UBPC 3A4AA 3UCQA 1Z8AA 1TZ9A 1KM4A 5HJXA 6ENLA 2XFWA 4FX8A 5I03A 5CSUA 3S3GA 2ZVIA 1P1XA 3SW6A 3VI2A 1FXPA 4C90A 3H54A 4IPLA 5HJLA 4WKFA 3VD5A 2PGEA 3LERA 1L2QA 2VGGA 4FLQA 2XYLA 1KWKA 1XRTA 2OYLA 1IGSA 2ZADA 3PR2A 4KF1A 2BASA 2O9PA 3HURA 4TTGA 2F2HA 2WO5A 1M04A 3N17A 4C1NB 5BWAA 1OBAA 4YYFA 1PHQA 3N6QA 2RHGA 1XBXA 2QXWA 3MZNA 4GVGA 1XIHA 4U31A 1L9WA 4CNUA 1H60A 4LY4A 3WF0A 2Y5JA 2DJXA 2YDRA 4RDWA 1PB0A 1UD4A 3SUTA 2E6AA 1ODZA 1DIOA 1QHZA 4GYFA 1KFWA 1H51A 5ABFB 3ZLFA 3N9KA 1HG3A 4GCAA 5CZ0A 2A5HA 4HA1A 4W5ZA 7ENLA 2PDKA 1A0CA 3ERPA 3E0WA 1WUFA 2WJZA 3V36A 4M1RA 4DNHA 5TIMA 4C1KA 4XSLA 5LNRA 2XGZA 3E0FA 2QQ6A 3BAXA 2A1YA 2BNJA 2J7FA 2CWXA 1UKPA 5DN1A 4XD5A 3LCGA 4NYUA 3EX2A 2REQA 2ZX8A 1X38A 3WQWA 1XUZA 4Z2HA 5F7UA 4LVAA 1V79A 2OWWA 1XINA 3WK0A 1J79A 1QNVA 3EOOA 2OFJA 1ZL1A 4X9YA 4QRNA 1CECA 4AZHA 1EOKA 2XSXA 3AICA 2C19A 3L4XA 3HG4A 5I00A 4PFHA 1DBTA 4NYYA 1X1ZA 3E2SA 3HF3A 3GR4A 1TTPA 2VGIA 4DX3A 3VNYA 4JFTA 4IGSA 1VFHA 1MXDA 3RPMA 4DLFA 3GM8A 4PUJA 2VYOA 2VM8A 2Y88A 1RJRA 1T5AA 3WLKX 2QIIA 2QAPA 1S1RA 2POTA 5A6BA 3S9IA 1O66A 3VKCA 1Z3NA 1EEXA 2I5GA 4F8XA 5GJMA 4PCFA 1LQAA 2J24A 3LZ3A 5CGMA 1QOQA 1OGBA 4WOZA 1KXHA 4HK7A 2VHLA 1VFSA 4C5ZA 4CQAA 4P61A 4J3TA 2X41A 3SRFA 4V1YA 2RAGA 3MV01 4MB5A 3ZVHB 3UY7A 1RV8A 2VTFA 3VE9A 4E8GA 5AN7A 3PB0A 1M68A 1IF2A 1FCBA 2JIWA 3BC9A 1E73M 2VUNA 4JIQA 2JKAA 3UGVA 2ZZ6A 2PWDA 4D6GA 1BRLB 3Q94A 4CNPA 4YVPA 1YTDA 2DGAA 4MFEA 1VH7A 4N4QA 2BGQA 3AOFA 1YLVA 5JIWA 2PDUA 3AU2A 2NUYA 3N14A 4MKVA 4A05A 4B5SA 2FGZA 1OC7A 1Q6FA 2HSAA 5GNXA 1JCTA 1KO0A 3AIEA 4XZLX 3G1DA 3LUTA 2W92A 5HNNA 1QATA 2D0HA 3QFEA 8XIMA 3KFTA 4XD3A 5IBXA 1RVGA 4NHVA 2WWCA 4NZ1A 1OQFA 3W0KA 4J4KA 1FWTA 2YCLB 1HJWA 2NQZA 2HMCA 1LP6A 3STCA 2DV0A 3VAVA 3TE9A 5G4HC 4PRRA 5H1WA 1KWGA 3MI3A 4F0KA 1JCMP 1SYTA 2AQWA 2ACRA 4RDYA 4O50A 1SFTA 5DMNA 4PMNA 3EDJA 1U1UA 1ODUA 3W2UA 2WQPA 4EANA 1ONEA 3H6OA 3WDRA 3BQ6A 4AF0B 4J2MA 2WNNA 3SRHA 1UA3A 1LLZA 1W3TA 3DGRA 2YB4A 1YNQA 2V3DA 2HVNA 2O9TA 1PKLA 3MSYA 2A3CA 2BY3A 4K36A 2NQHA 3BAWA 1ME7A 1Q6RA 4B3KA 3FVMA 2DEPA 2J25A 4RE3A 1R3RA 2OB3A 2YL6A 3THQA 2R9RA 4G7FA 2GJLA 1Q6EA 3W7RA 1KCZA 4PSPA 5K3VA 1JDFA 1I2OA 4MWAD 1GWJA 2ZC1A 1UWIA 3GH7A 3MQTA 2DJLA 1CX9A 3S42A 1K4GA 2FQIA 2BLEA 1TV2A 3M41A 1C8XA 3LPOA 4UFKA 2J62A 4L56A 1PE1A 1ENUA 1Z42A 2GGIA 3U0HA 2C1GA 1UASA 3EB3A 3TXVA 1CXFA 2CYGA 3SM0A 2EF9A 1YDVA 4DBEA 4V2XA 4J1OA 1GK8A 3VDAA 4KPLA 4YMZA 4BA0A 5A2AA 3CHEA 1F8MA 3CEUA 4E2BA 2XIIA 4M1BA 3TIMA 2HISA 3CUJA 3DYPA 1FQ0A 4DY1A 4ZO8A 3CQHA 3BMVA 3NXLA 3N04A 4JCLA 4K1WA 4MDOA 4W8BA 3OLGA 2WMFA 2EPHA 1CGYA 3C8FA 4L64A 2J9XA 2NXHA 3WQCA 3A22A 3RX4A 1JZ2A 4JN7A 3GTFA 3B9OA 3WDPP 3GC2A 1ML1A 1D7KA 1KFKA 3D46A 1W1YA 2WWDA 2XSAA 4R34A 3R25A 4FO4A 4URIA 3TA6A 5L6UA 1V08A 3PNUA 3I65A 5T91A 2C1IA 3MB9A 1A5SA 1GEHA 4HTBA 2AOSA 3WO8A 3RX2A 3WF1A 4HU8A 1HZYA 4NZ3A 3VE7A 3CPGA 1GYMA 2X40A 3B9AA 5AOUA 1TTQA 1AW2A 3GFYA 2YKKA 3ARYA 3FN9A 4CNTA 3UWYA 2NW0A 3VM5A 1EKOA 1EXPA 1T8QA 4TR9A 4MTVA 4JQ4A 1MEHA 4LNYA 4O17A 2X1RA 2O4MA 3NQFA 1OX4B 3MUZ1 4FXFA 1HF6A 2YIHA 3JZUA 3UR2A 3PZGA 2OLSA 4L9ZA 5LNSA 4H9ZA 5DELA 3QY6A 3QPZA 1EJVC 2W27A 5BXRA 3MU7A 3UG3A 4HYRA 4RW5A 3CU2A 4AZBA 3HG3A 2Z1SA 1ITCA 5A6KA 4V33A 1HKJA 3WNPA 2O7QA 4XZIA 4XZBA 1UD5A 3AU6A 1A5BA 4EWJA 1RCQA 4GZ7A 1D8CA 3OVRA 2PDBA 2ZZ7A 3KHJA 4PMOA 3VTRA 1RPXA 4A6GA 1H7NA 4FSAA 1R46A 5FD0A 2OQHA 4WQ6A 2ZXAA 3W72A 2OG9A 3M0MA 4IFKA 3TDFA 3EPMA 4IP5A 4PMJA 5EBUA 4L61A 2FTYA 4AC1X 4DWSC 4KCTA 3GVRA 3LHZA