2BOGX

Catalytic domain of endo-1,4-glucanase cel6a mutant y73s from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
280
Chain Sequence
b'NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E-2
publication title Crystal Structure of Thermobifida Fusca Endoglucanase Cel6A in Complex with Substrate and Inhibitor: The Role of Tyrosine Y73 in Substrate Ring Distortion.
pubmed doi rcsb
source organism Thermomonospora fusca
molecule tags Hydrolase
total genus 109
structure length 280
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 2bogX00
2BOEX 1QK2A 4I5RA 2BOGX 3ABXA 1TMLA 2BOFX 3A64A 4B4FA 1UP2A 2BODX 1UOZA 4AU0A 1HGYA 3VOHA 3RPTA 1OCNA 4AVOA 1HGWA 3RU8X 3VOIA 4AX7A 1OC5A 3VOFA 3VOGA 1OCBA 4A05A 1CB2A 1OCJA 3VOJA 1BVWA 1UP3A 4AVNA 4B4HA 1QK0A 1GZ1A 1UP0A 1OC6A 2BVWA 4AX6A 1QJWA 1OC7A 1DYSA 3A9BA 4I5UA
chains in the Genus database with same CATH superfamily
1W2VA 3GXDA 3GX9A 2AQVA 2W66A 1NFGA 1PWMA 4TTGA 3W38A 2JF6A 3WMBA 1S3HA 3MB9A 3ARZA 4B5TA 1UA7A 3QZEA 4J28A 4F0LA 4PB4A 5AHLA 4CNSA 4PMXA 4AF0B 4ZOCA 4XTDA 2DEPA 1OYBA 1PDZA 3LOTA 5F1VA 3POCA 3ITXA 6REQB 3N11A 3EB3A 4LYPA 4P8VA 2OO6A 5HMDA 3W23A 2FZBA 2J8TA 3EWBX 5BCAA 2G96A 4UTKA 1KWGA 4Q32A 1EQPA 3OQ8A 1GPWA 1I60A 3CZEA 5E9XA 3S3GA 3NSXA 5K4ZA 4RZBA 3CMJA 1GQLA 1RQBA 2H3DA 2VJXA 1EBHA 4H9XA 2YA1A 3UXKA 3A4WA 2AKZA 3P80A 4GPNA 2BV9A 4NIRA 4Y9NA 4YVXA 3B8SA 3QW4B 4S3KA 1JNEA 3QMTA 3BG9A 4O57A 3M07A 8A3HA 2V3DA 3PPGA 4X2RA 2QUUA 4L9ZA 4DIAA 4FP1A 1ITUA 3QV7A 4LCQA 1J5TA 1AFSA 3THDA 4KS0A 4R7JA 2QZRA 1H4PA 4KBXA 3DBPA 4QSFA 1G7VA 3KP0A 4S3BA 3EA2A 1K7EA 1EJVC 2GLKA 1GT8A 5AZ1A 2PBGA 1DP0A 1IR1A 2QIIA 5A5WA 1G6CA 3WK0A 4ZSUA 4NNAA 4H9YA 1Q6DA 2D2GA 5D9PA 3O2LA 2A85A 3SCVA 5D33A 4Y2WA 3UW6A 1B5TA 3GHUA 4M29A 3AQUA 1W3LA 4R3UA 3WMSA 4NF7A 1YNPA 3CV2A 2FDMA 1V3IA 3PN8A 7TAAA 1V08A 3IJIA 4WLCA 2CIPA 3BG3A 1V3JA 3MMUA 1GVRA 4DWSD 2PF0A 2WNQA 1BYAA 1XL9A 1UP0A 1UKQA 5HUPA 2EXOA 2XINA 2PAJA 1CGUA 2O56A 2G3FA 1H63A 3SAZA 2W61A 2P10A 1MW0A 1K02A 3W7EA 1S3TC 1RA0A 1J0HA 1Q4WA 1U30A 1CZ1A 3AXXA 3P5ZA 5E9AA 5BXSA 2B7OA 1TPDA 2PTWA 1JCTA 3W7PA 1A5NC 2CZEA 2FZDA 4C1KA 3MTWA 3ABXA 1UCWA 3IJ7A 3W1RA 1GOMA 2G0WA 4FB7A 3HQPA 1IGWA 3BAXA 2YDQA 2E6AA 3WBXA 4DYEA 3I7RA 1YDNA 4DF1A 1ICQA 3N34A 3RUBL 1QW7A 1ZP4A 2D2HA 3PBYA 1RJRA 1QK2A 3VUSA 1TELA 3F5LA 2WZMA 4TX8A 2IQ0A 3BLOA 1TYGA 4FA3A 2HRWA 3REQB 2GDQA 3V0UA 5D32A 1EQCA 2AQOA 5A6TC 2ZA1A 4DEFA 3RO8A 4DF2A 1DJQA 2C15A 3ZZ1A 5DMYA 3ZR5A 4O13A 3GD6A 1H49A 4OUIA 3DBNA 5J5DA 3SGZA 4J3VA 3DFNA 4WKAA 1SR9A 1SFLA 5CPNA 3U5YA 1BHGA 2WLYA 1EFZA 2WMIB 3ZYZA 9XIMA 4BWLA 4S1FA 2BY3A 4KMQA 3FLUA 3L66A 1FWBC 1GOKA 3VABA 5BU9A 3K4WA 3KHDA 4O54A 4GQQA 3T2OA 3S8HA 4Q33A 3WF0A 4JNZA 5T26A 3UZXA 2YBUA 4L80A 4OQVA 4UR9A 5IOBA 1YPFA 4JQ2A 3SCRA 3GR8A 4S3GA 4JX5A 3AMDA 1VFTA 3RLHA 4XZ9A 1ADDA 3JZEA 3U7BA 3SY5A 1SYTA 3W7IA 4IP7A 2E5BA 1OGBA 1H5VA 3GC2A 5JVLA 1JZ6A 1ADOA 3WLPA 3BSGA 1R30A 4LOCA 4KIEA 3ZM8A 3C52A 4A3RA 4XX6A 2R14A 5DXXA 4PMUA 1A5KC 3G5EA 5BWFA 1XBVA 1JYNA 1DJGA 2OX4A 1X97A 2BX7A 1D7KA 4DJFC 1MW3A 3II1A 3ITLA 4DXXA 2OKTA 4WX2A 3B3DA 2VC5A 1ODUA 3V4BA 1MYRA 4JICA 4RNJA 3A64A 1G67A 5H1WA 3TQ0A 4UQ9A 1A80A 3UY7A 1TA3B 3L7RA 3AALA 3NAVA 4AZCA 1CGYA 3PPCA 3VOIA 1CGWA 3MP3A 4E5TA 3WL1A 3U5UA 1IXOA 5IFPA 2HJPA 1RA5A 1WA3A 5A8QA 5HWJA 2XWEA 5EU9A 1MWOA 4GUFA 3WKZA 3MI2A 4GABA 2DZBA 1ESWA 2OZ3A 4TIMA 1CB7B 2GDVA 4ONVA 2VKZG 4UNLA 1CBGA 2EQDA 2ISDA 4XZWA 2VFIA 1PVNA 3H12A 2VC7A 5HQEA 2V5KA 1V51A 5DMNA 3BLEA 3OGSA 1OINA 3L9CA 3WBWA 2WM1A 3AS1A 3S42A 3SSZA 3DFYA 2WJDA 2J4GA 1DKWA 4DJDD 2DW6A 1E40A 4C7FA 5AHFA 5DF0A 1UH4A 5IXEA 3IIZA 3MCMA 3GHSA 5DT5A 1FKWA 2PF8A 4DPQA 4BA0A 1OSEA 3IJQA 2FDSA 1ME7A 1QNRA 3OLGA 4I3GA 3ENLA 1TWZA 2W9MA 2GJXA 4QG6A 4O16A 1H7PA 1YW1A 1RXOB 3BUVA 1E0UA 3EEGA 4HU3A 4P7LA 2ISVA 1XLLA 4RNIA 3GXPA 3F2BA 4JTIA 1LYXA 2VX5A 3C3UA 2OEKA 5EMMA 4QSHA 2GGJA 4MKVA 4ECLA 1WXJA 4K7VA 3T6CA 4J35A 3V1PA 2OPJA 3P84A 2BMBA 8RUCA 4PBGA 1EHAA 3QV8A 4B9ZA 4P61A 5H8UA 1Y5VA 1QNSA 3EB4A 1GOOA 4YU1A 1XUZA 1J6OA 2C79A 2TSYA 4J3ZA 1TPUA 3MI3A 4HMEA 2PSNA 3GLCA 5TNVA 1DEDA 2AMGA 4ZXOA 1DJYA 1V6WA 4YCPA 4AUBA 4JYDA 4B16A 2GQAA 5CH9A 4DO5A 2F6KA 1QWGA 4F0KA 2PWGA 2VOMA 5AYXA 1LUCA 5BMXA 2X30A 5M17A 5M1TA 4FPSA 2NVAA 4WY0A 1EWDA 1VCFA 3WMCA 3I3EA 3HG3A 1VHNA 3P0XA 1MXDA 4GCXA 3PNZA 4PH6A 4PUUA 3WQVA 3PZIA 2XFFA 4PTXA 3MHUA 3WLIA 1GKRA 2CLHA 2JALA 4C6BA 2CLKA 4QLKA 2ICSA 3NXLA 3JR2A 3LG3A 3BXWA 4S3CA 3UR5A 1NFBA 2XM2A 4U3AA 1VYSX 4ZOAA 1US3A 2GUBA 1E6PA 2Y4SA 3G1YA 3W1UA 1F73A 4FLOA 4B5XA 1RJQA 1YHTA 2Z25A 2XN0A 4FXFA 3FJLA 1S5WA 1FWTA 4Q4OA 1QAPA 5GNXA 4IZGA 3UJ2A 4GFIA 1LQ0A 3ARQA 1D8CA 2V3EA 3TOPA 4WJ8A 1HUVA 2P5NA 2ZZ3A 1M7OA 3VIKA 2VEFA 2VRJA 4IMCA 3KWSA 4LRSA 2XVPA 3GDTA 4EPKA 3VKBA 4YN5A 4WDWA 3SSJA 1GOIA 3W1TA 4NG3A 3UJEA 2GYIA 4L4PA 1LOQA 1MQQA 1NP2A 1FWAC 1M53A 1VPXA 3T8LA 4XUGA 4WRHA 4X22A 2Q71A 2VEGA 3GSMA 1UJQA 3FYPA 3NGFA 3UCQA 2VD9A 3ZVIA 2GJPA 5CSUA 3H7UA 1W8GA 3PUEA 3W7NA 3JUGA 3VGGA 4F9DA 1UR2A 3FS2A 4UMBA 3BO9A 3VXGA 2WHMA 3BTNA 1ZAHA 3KW3A 4UWMA 4YVPA 3LCHA 1VBGA 2YXGA 3B4YA 3SY1A 3AI0A 1LF1A 3KE0A 1OCNA 3UZJA 2J7BA 3ZR4A 4H7ZA 3Q45A 3ZOAA 1IQ8A 1UKPA 4LS2A 5EMKA 3FAXA 2J7EA 1X1OA 2YCKX 3N3MA 3PJTA 1XYLA 3QMRA 1VS1A 1DPMA 3RR1A 1JI2A 3MUY1 1FX6A 3C0JA 3M5ZA 3TROA 1L0PA 1XLGA 5DBUA 4GXWA 2ZC1A 3RO6A 3IK4A 3UWUA 4LYKA 1VRDA 5CBJA 2BXYA 2P0OA 1T96A 2VCAA 4W8LA 3NYDA 3T81A 1JIBA 4LALA 4Q6JA 3ZSSA 3H2FA 1ELSA 5LA0A 4NZJA 2YCIX 2NX3A 3R2GA 2C7FA 4RZ6A 4M3PA 4Q4SA 5IFTA 1U1UA 2CC0A 4B90A 2ZXAA 4X63A 4CQCA 2GSJA 2J7FA 1JCJA 4AFYA 4OJYA 1UR4A 1IEIA 3TTSA 2WBGA 2YBTA 1PSCA 3LRMA 3M47A 4HHMA 1JZ4A 4O4WA 2VFEA 5AYIA 2B4GA 4AG0A 3O16A 4N6FA 2E68A 3AOFA 2QXWA 1UASA 3EKLA 5CG7A 4PUJA 3M0YA 1W9PA 3A23A 2PEVA 5G2IA 1UZ1A 3CT2A 3QR3A 3NL3A 3QPYA 1T0OA 4S2CA 4EXAA 1W6TA 4K37A 3SIZA 1TX2A 2VX6A 2TRSA 1YE6A 3H4GA 2Z7KA 3DN5A 4L7ZA 3ES7A 3EMQA 1EO5A 3B9DA 3PR2A 2V9DA 1QDSA 1TREA 2QT3A 5HA7A 1CLVA 3UNTA 4I8YA 4XD5A 3CU2A 3UY8A 2GVYA 1HKMA 1UUOA 1JDEA 4E2OA 1O1ZA 4HMDA 4HD5A 2JIEA 3HPSA 8XIAA 3N6JA 5FF0A 3QZAA 3P61A 8XIMA 3PZ9A 4BQ4A 2XSBA 1KFKA 1KGWA 2WVVA 5C0QA 3AHZA 3WELA 3L5LA 5JIWA 2GK1A 1AW1A 3CXOA 3VDBA 4K68A 1W9BM 2BS9A 1ZSXA 3OOQA 4PUEA 1WDWA 2QCHA 3VDGA 3WO8A 1P7TA 3ZT6A 3W6LA 3B06A 3DOPA 1KCXA 2NLIA 3W74A 2ZRZA 4MWAE 3KL3A 3N2TA 1XGEA 3M0HA 3NQGA 1TVNA 1ZHAA 3URBA 3VOJA 5FF2A 3TJXA 4IX0A 3I10A 3J7HA 2QV5A 4XZNX 1SVDA 1EJRC 1WV2A 4JQ4A 5HXMA 4JTUA 1GOXA 4H8UA 1XLCA 3IIPA 4O0QA 3PBUA 4G56A 3EMCA 1EIBA 4C6LA 5DXYA 4ZXLA 2V6AA 3DFTA 4JQAA 1RHCA 4GBUA 1EUAA 1VQTA 2CHRA 3L67A 3AFBA 2BSLA 3NTYA 4C7DA 4OZOA 2DQWA 4XG1A 2O9OA 4MUPA 1FHVA 5CG0A 2E9MA 3OYXA 4ZE5A 3S1WA 4XZMX 3FKRA 3S1XA 5A69A 1NM9A 2OCZA 2AAAA 1GKQA 4JOMA 4L9XA 2TAAA 3WQCA 2BDQA 4LVAA 1H60A 3OZOA 3IJ9A 3QBUA 3UBPC 3C5QA 2YOCA 4XSLA 2BXZA 1M01A 2EKGA 4EIVA 2RGLA 2C1GA 4HMNA 1GJWA 2ISWA 2ZUMA 4ZO8A 3WLLA 1Q65A 4HPGA 1S38A 4EXBA 4QCFA 3UD6A 4C1LA 3AMCA 1JDFA 1TTQA 1V6YA 3HA1A 3ANYA 1XH1A 4KESA 4H2CA 3QYSA 3SJ3A 3W37A 1EUNA 5K9XA 4D8AA 1BXBA 3C2OA 1CNVA 2DFAA 4M81A 1E6RA 3O05A 4Z2JA 1QT1A 3E0VA 3UZYA 7XIMA 1M03A 2VC9A 3FJNA 3NM3A 1Q2RA 1TUFA 1Z32X 3EDFA 2PRLA 2PDYA 3SEPA 4MLJA 3WDJA 3CHDA 4UTLA 3EB2A 3GVWA 3VK5A 3NEHA 3TSDA 4HOZA 3R89A 3RPTA 1JDDA 2PGRA 1Z41A 2VGGA 3VIGA 3MPGA 2DUXA 1CXKA 4ZBCA 3VNKA 3AS0A 3UWEA 4GQGA 2QUVA 1LOSA 3CWNA 4QNWA 5G2WA 3RPDA 3P60A 3TYBA 5JH2A 3WQOA 4EKJA 3L21A 1XIFA 2YKKA 4G7EA 1KRAC 1JXJA 3M4HA 1DXIA 1HT6A 4RW3A 2YB4A 4S3EA 3GYEA 2WZIA 4LGXA 4GINA 5JBEA 3DUGA 1TQXA 2G50A 1ISXA 5FEPA 1XR2A 2IQDA 2ZQ0A 3R13A 5HNRA 3WLTA 1OBAA 4LUTB 4JEQA 1SGJA 4DNMA 1FCVA 2QUMA 2J88A 1DQXA 5CC5A 3NGJA 3WQWA 5A8GA 4IL0A 4RLIA 4B4FA 2X1IA 4KEVA 5AKQA 3ZLFA 1QI3A 2GPTA 4A8IA 3MA8A 3KBSA 3DDMA 4AZCB 2ZE3A 4R34A 3W4RA 1XKYA 3CQJA 4JX4A 4AIBA 4Y6GA 2O4MA 3CUJA 3WH6A 3M5YA 3FGCA 1BKHA 1TQJA 2ZKMX 4AVOA 1K6AA 3WF3A 1B0IA 1NWRA 3LXBA 1OF6A 2ZYFA 1PEZA 4HNLA 1QMLA 3N1AA 3W7MA 1I2NA 3UZ5A 3CHVA 1WDQA 4Z1BA 1NF0A 1TTPA 1KBKA 3CV7A 2G95A 2X1UA 1G94A 2Y0FA 3SO7A 4WHBA 2FTYA 7PTDA 2X0YA 3RLVA 2DZWA 3NQ6A 1EGMA 1XSJA 4UTMA 1NJJA 2WHKA 1XBZA 2JGYA 2VZTA 3B0VC 3F4WA 3GC5A 4IFKB 3SUVA 1MMFA 4Q4RA 4XAZA 2DT2A 3EDJA 2WVTA 2GJXB 3UZZA 4BR1A 3EYPA 1MW2A 3C2FA 2ANUA 3H55A 3XISA 1W3JA 3NL5A 3KBWA 2FGBA 2OKOA 2VI0A 2V3FA 1ICPA 2HNEA 1Z48A 3UWVA 1TX0A 3TQKA 3UNDA 4O17A 3LEPA 1HO1A 3QF0A 4U10A 3W1LA 4RDVA 4EPBC 3NO5A 1VJSA 2WXDM 4YWSA 4AX6A 1BPLB 2V5LA 4C65A 2GWNA 2JKAA 1OF8A 1E3ZA 1GGOA 4LAMA 4EANA 3ATYA 4W87A 2NT0A 3NQDA 4BF5A 3WG6A 5K2ZA 2Z7GA 4C6EA 4Z2GA 3ZT5A 1V3MA 2HWGA 2BWGA 4NRRA 5HPCA 3V0TA 4X0NA 2CLIA 1TVLA 1B3OA 4QJ5B 4UTFA 4KWSA 4PMRA 1EC9A 3EX3A 3KCLA 1ITQA 3USBA 4JTRA 4R33A 2XYLA 4PR4A 1CLKA 4Z2LA 1LUCB 3E0LA 3UJSA 5LA1A 3G8RA 1EDTA 4PTMA 4KGLA 3QXBA 4AWTA 3ME3A 5A8OA 1EXPA 3V7PA 2NX9A 2CZVA 3TFXA 2ZVIA 3VOHA 3PTQA 3WL0A 3EKZA 4YYCA 3KP1A 1ZJHA 2AGTA 3N6HA 4C6MA 1WKDA 3CQIA 3EXSA 3GDRA 5D8ZA 2VD8A 2HQAA 5E1QA 1EWEA 3G22A 4JHOA 2HSAA 3DERA 4X3ZA 2G37A 2YDSA 3GTXA 1BVNP 2Z1VA 1WZAA 5CZJA 1Q5MA 3NA8A 3OGVA 1BKSA 4M80A 1GPFA 4C6KA 1KC7A 3RN6A 3W6YA 2OGJA 2PDKA 1KM3A 3XINA 1JYWA 1E6QM 1VJIA 3ZJ8A 2PZNA 1I0DA 4QE5A 4A4AA 3RYSA 4J4KA 3KAOA 5BOFA 4P2VA 1OFBA 1Y5WA 2R91A 3E38A 3IANA 1OFPA 1X8CA 3C4UA 5I7GA 4FLQA 1IZKA 3K4DA 1W3NA 3CUZA 1H0GA 4DO7A 5K9DA 3VOFA 3VOGA 2YW4A 3W29A 3TOYA 3I68A 3U8GA 2PLKA 1E6SM 3VUPA 3N17A 5JU6A 3WK2A 5CZ0A 2V67A 5A6BA 4DYJA 3UESA 1AQHA 4J9JA 1J93A 2FPYA 2UY5A 4BI6A 2XIMA 1SFSA 2BVYA 5U4NA 3N73A 4LAOA 4G1NA 4B3KA 1XKJA 1FXQA 4GOAA 2DSUA 4IJCA 3NDYA 2PDMA 4GVFA 5B7ZA 2Y7FA 3NG3A 2GJNA 1BSLA 1H7OA 3USZA 1AJZA 4IHCA 4L1XA 1OVDA 1R9YA 2BGNE 4TUFA 3EOOA 3M41A 4GX9A 4BQ5A 2J9XA 4L4LA 2OG9A 3IARA 2WPGA 3W83A 4RK8A 3N4EA 4B5SA 1Y0EA 3W7OA 5DFAA 2QF7A 3WQGA 5KITA 1P6WA 2PZ0A 1J0YA 4HN4A 4HP5A 1BEUA 2L5HA 2HEJA 1SZRA 4LPCA 2FFIA 3RM9A 1X98A 3IUHA 4NSBA 5AVHA 2YLLA 4WDUA 2FHCA 4HZMA 1G5AA 1JJKA 1KRMA 1WKFA 3N19B 2CWNA 1XYZA 3LU2A 3GY1A 1UA3A 4AQLA 3RJXA 3W2JA 1W54A 5EB8A 5E6YA 4C6PA 3E0IA 2E5DA 4IXHA 3MO7A 3DFOA 4ALDA 3G2GA 4FHAA 2IXUA 3WD0A 1POKA 1J0IA 4Q8UA 1O7AA 1RR2A 1DJWA 3OEXA 5H8PA 1RAKA 4YS1A 1IGSA 4ZFCA 5T9CE 4M56A 1F2JA 2V5DA 2P50A 1AZ1A 2ZUTA 3GHTA 1XYMA 3IK2A 4IMEA 4KWUA 1J0JA 3WEOA 4MTVA 3QV9A 4HGXA 1E1EA 1W3HA 1UR8A 2XHYA 4A8NA 5HQLA 3M0KA 3SI9A 2OR2A 3SRHA 4IPPA 4QXIA 4LS0A 1EO7A 4LCRA 1G4EA 1TR9A 1V4YA 2FQIA 2Y89A 1UWRA 3UYIA 4JIIX 1YXCA 2QS8A 4YJ5A 3ITCA 5AC5A 1ITCA 1K7FA 4UNIA 4GRSA 4MY9A 2HTMA 5T91A 1J2WA 4UQDA 1E55A 4GJ1A 4EF8A 2ABAA 3NQFA 2X2YA 3BOLA 2CETA 2FGLA 3TSBA 2GK1B 1ZFJA 1JAEA 1V0MA 1PB0A 3P93A 2CESA 4KFOA 3CHCA 2XIBA 3Q65A 5H8MA 1QW8A 4MJ2A 1W3IA 2NUXA 5BXTA 1X6LA 2H9AA 4MY1A 5ECVA 1W5PA 4G6CA 1PYMA 4EE9A 5JMUA 4H01A 1DBTA 4Z0JA 4E4UA 4S2BA 2VMFA 2GGGA 3WF2A 5C5YA 2FFCA 4FALA 4RNFA 2XVGA 4FX7A 4NJKA 3ARVA 4N0RA 2EGZA 1V3KA 3U2EA 2UY2A 1TTIA 4F2BA 3EBVA 1FTXA 5KTLA 3W71A 4Q6XA 1H09A 1OGGA 3OLIA 5TIMA 4MADA 4D2JA 1JAKA 1OFEA 4ATWA 1JUBA 2OSXA 5EPDA 1IR2A 1MFUA 4IJBA 1XF0A 2Y70A 5D2XA 3M0MA 2YFNA 4DZIA 1P0KA 3TLQA 1ICSA 2PRHA 1OCBA 1Q85A 1V6UA 1EX1A 1O95A 2POTA 4QEEA 3EAUA 1FWGC 1B4KA 3ALGA 3ATZA 3NSMA 2XH7A 2I5IA 1Q6QA 4HZ7A 5CJNA 1UIOA 3A3XA 3H4XA 3M0VA 1P0NA 4JY9A 1HGYA 2PDPA 3IPWA 3KRSA 1Q6GA 4C5ZA 4XIAA 4UNKA 2QUNA 2W6RA 1W1TA 2X16A 1FXPA 1HF6A 1ZZMA 3OA3A 3ISIX 3M7WA 4U33A 2XGIA 2CU0A 4H8HA 4WSKA 3UETA 2O9PA 4MNKA 3BARA 1US2A 4ZTXA 2FZ8A 1PBGA 4B3LA 2H3BA 1AZ2A 2V0TA 3QTPA 3NVDA 1OQFA 3E0FA 1H1ZA 4B5VA 1KCZA 4UC5A 4RR4A 4DQWA 5RUBA 2CLLA 4AVFA 3RCYA 2I5GA 1XWYA 2QJNA 1BYBA 3G1AA 2AKMA 4IQLA 1ISVA 3WBAA 1MXSA 4JTAA 2OZ8A 4GG9A 1TRIA 3DFSA 5I0DA 4JGDA 3TN5A 1F8MA 1KGUA 5HMFA 4UUIA 1E6NA 1LL6A 2NXIA 1UPMB 4MY8A 1A50A 4NNBA 1K4GA 3O6DA 2E8YA 2E8ZA 1MDRA 3W6MA 1EA0A 4G7EB 3LK6A 4DXVA 2ZZ2A 1WOBA 3W7QA 1WXZA 4JDBA 5LGXA 3BAWA 2R82A 3HQOA 4OOUA 5D2YA 1EZWA 3RNDA 4ZB0A 2CBIA 2PDCA 4IUOA 1RUSA 4Z1DA 4UTHA 2PLMA 3WUGA 3W02A 1DWIM 1ZBCA 1XISA 1HKIA 2W0UA 3HN3A 3WBYA 4CLMA 1W1IE 3CWHA 4DELA 3TN3A 3AJ7A 3MDUA 1IIGA 1EGZA 4WGHA 3KBJA 3W70A 4A22A 4CEUC 2B0MA 1LWJA 4GYJA 3L2IA 1VPYA 1QI5A 4GUIA 1VD6A 3T2PA 3VFLA 2VP8A 1J18A 4ZODA 1WYIA 3LHYA 2JQXA 1R9XA 1SSDA 2ACUA 3KHJA 5D09A 3FGCB 4MB3A 1QNQA 3R5EA 5DANA 4MB4A 1UG6A 3GWQA 3PAJA 1KQYA 1SR0A 3F2DA 1OT1A 3BURA 3P81A 4ROPA 4H1ZA 3WNLA 3QGKC 6TAAA 2QVNA 4Z42C 1U5JA 2FIQA 3FYOA 3FVMA 4XSMA 1L6GA 3S2CA 2PTZA 2WSKA 3N12A 4HNCA 1A5CA 1XCFA 2RKXA 2WANA 2NSOA 3TEVA 1VP5A 2DSVA 4KETA 1EEPA 4HCHA 3HGJA 3LPOA 3IACA 4NQ1A 3T8QA 2NX1A 3DHDA 4HNUA 4HQVA 2RDTA 4WSJA 4EOUA 4OKDA 1KBLA 2UY4A 1MQPA 1HN1A 5F2LA 1GOWA 2C71A 1SUXA 1XM3A 1KLYA 3OLDA 2WSYA 3EMZA 4NI8A 1FCUA 2GQ9A 3Q37A 5G1MA 2BOFX 3PFMA 3TYEA 4MHBA 9CGTA 2J6VA 4GY7A 5FJTA 1LROA 3N2OA 4ERAA 4ORIA 4IGNA 1CIUA 1V3HA 3S6TA 3OTRA 3WH8A 3VZYA 3STFA 4ZQNA 1RJPA 1MDLA 2TPSA 3HPXA 4ML9A 1HJXA 2P88A 3BCDA 4AU0A 1BG4A 5DRCA 2VENA 2ZRXA 5FJJA 3T40A 4WJEA 4AHOA 3L4WA 1E9ZB 3CLWA 4CD8A 4I90A 3SUWA 5D04C 1F6PA 3DG3A 1XD0A 1ZCCA 5E70A 4C6JA 1W1PA 3O6AA 4JCLA 3D3AA 3E49A 3NQCA 3DIPA 1ZALA 5LKYA 4PB3A 4ZENA 5B80A 3T55A 2W3ZA 3G0SA 2OWCA 2CKRA 3EPNA 3TQPA 4AZGA 4P8XA 2IPFA 4MB5A 3LB0A 1Y5XA 2X7VA 5HR6A 3T07A 3RCNA 5FF4A 4ZQMA 3H2MA 3JU2A 3W2KA 5HJLA 1EP2A 3KBVA 3VGDA 4H6QA 2JIWA 3LPPA 5ABEA 1JUEA 4CQ8A 1TRDA 5C9WA 3WF4A 3DG6A 3DX5A 3HO8A 3HOJA 3G1VA 1AD1A 3GNRA 1BQGA 3FXGA 2WLZA 2OOGA 3RMEA 1V0KA 2Y5EA 1TKKA 3K30A 2ZRVA 5GJNA 2QMJA 1DQUA 4HTYA 1JZ8A 1QBBA 1E6XM 3LTYA 1R7OA 1G4TA 4NKCA 3NO1A 1FWSA 5LHFA 3CJPA 4GE8A 3UWWA 3HF3A 1KD0A 3OHMB 3QZ6A 4LYQA 1NY1A 5D05A 3AUOA 2HK1A 1Q6LA 3LCWA 4JQ3A 5A3HA 1WUFA 4MJZA 3MDWA 2RDUA 4QLJA 4UQEA 4A2SA 4ZO9A 1ZBKA 4NVTA 5JXQA 1J0KA 3P8JA 3NUKA 1V02A 3KOWA 3F4CA 4JX6A 4FZIA 3R79A 2NV1A 1L8PA 1VBHA 1NOWA 4PRWA 5EY5A 1S1PA 1C9WA 2OJPA 5IBXC 2GOUA 4PSPA 1JZ7A 1WO2A 3IWPA 1JUKA 2OVLA 1OK6A 3WYZA 5C55A 3U7VA 1KTBA 4KRUA 3AIUA 4A6GA 5HOSA 2HBVA 3B9NA 4XD4A 1AW5A 5M03A 4FOKA 3QTGA 2PE4A 3E2RA 5HUOA 1R9ZA 1F76A 3A9BA 4HCDA 3MMTA 3BQ6A 4H00A 4Z1CA 5DN1A 4ILSA 4F2TA 4AD0A 3AROA 3IJ8A 1R6WA 2G3NA 4EF9A 4DBSA 1GZGA 4M6VA 1S39A 1REQA 2Z1XA 1X8FA 3TN6A 4WOQA 4PMJA 1XIJA 4I7UA 5C9UA 4JQ1A 5BXPA 1CWYA 4PMQA 4BHYA 2Q01A 3ECQA 1XYCA 2F84A 4WJXA 3SCNA 5HK4A 4WQ6A 1DWAM 4MNJA 4OV9A 2GSEA 3OVRA 1VENA 5F2IA 3EWZA 3DC0A 1XGZA 4DHGA 4MJMA 3WMLA 1PJ9A 2J9ZA 3Q4DA 3W1PA 1QU4A 3W2NA 2Y85A 1PZ2A 4ACYA 2JBMA 4A3UA 4IPLA 4WSHA 3P6LA 2J7CA 1QRQA 3N4FA 1SZFA 2WHJA 3LM7A 1M41A 3QSTA 2W79A 4N9CA 1V6VA 4RUBA 4AEEA 1S5VA 1JDCA 1G4PA 3V5OA 3NQVA 5I23A 2A5HA 3QPZA 1GQIA 1G4SA 4GKLA 1GTEA 4N4PA 4E38A 4C91A 3SUTA 2REQA 3CAKA 1QPNA 3QGAC 1AL7A 1SO5A 5EYWA 1JGIA 3FX4A 4QG8A 2O55A 1UB3A 3M5VA 4N6EA 1OJXA 2ZADA 1IZJA 3B8VA 1PX4A 3WDPP 1AW2A 1QOQA 3G8EA 1HL8A 4ZQPA 3MVIA 3MO4A 4ZQCA 4H3DA 3VD4A 1ECQA 2BY0A 1NQKA 1BWLA 2RFGA 3B0UX 1I2PA 4A29A 1HQTA 4LYRA 6REQA 3UERA 2XIIA 2C0HA 2OOFA 5CQ1A 4AWEA 3A5VA 1GCYA 1CECA 3E2QA 1VRXA 1QOXA 3OYZA 3KBMA 2WKJA 4P8WA 2PDFA 1OD0A 4GK8A 4GXPA 1FA2A 4PUNA 4RV3A 4INFA 3W1AA 2ZBTA 4UTUA 2Z1WA 2BBFA 3DYMA 2WO5A 4YHGA 2F6UA 2D2JA 1C8XA 1JPIA 1ZBWA 3M6YA 1E1CA 2H9AB 2X1SA 3R43A 3HBLA 3FSTA 4UMCA 6XIMA 1FDZA 3OW1A 1I8JA 4JKLA 4E3TA 4IH3A 3RITA 4DX3A 2V30A 1KXVA 3OZPA 1UZHA 4FI4A 2E77A 1I2OA 3SW6A 1UMYA 3FW6A 4IM4A 1UUQA 2X1TA 1DJXA 2W62A 3LCIA 3TUUA 3LTSA 1PCWA 3TTQA 2QNEA 3VINA 3PTMA 1CX9A 3N2XA 4IIBA 1IWBA 3HQ1A 3MUXA 4FXRA 1BGAA 7A3HA 1J11A 3SADA 2VUNA 1QI2A 3F03K 3NIYA 1T8QA 3B97A 2X40A 1EL3A 2DVTA 4IUGA 4PTVA 1M7JA 3IGHX 4I6KA 1KFCA 4QROA 1CDGA 2HZGA 1GORA 1CGXA 1EHNA 3H8AA 4ZCWA 3ZJKA 3GIPA 2OMAA 2OO0A 1IEXA 4Q4KA 2QCCA 1K8CA 4GXMA 2C1IA 4DJEA 4AH7A 5C71A 1R2TA 3A22A 1RVKA 3LHVA 5CAKA 4CQBA 3ABSA 3EX6A 4PE8A 4TVCA 2PU0A 3CGTA 1EDGA 3GXNA 3IJDA 4K2SA 4XBSA 4REQB 3M6DA 4RXFA 4UFIA 3CB3A 3SGUA 4DNHA 2RJHA 4HK5A 5LIUX 3BZGA 5XIMA 1P0DA 3MUCA 1NIUA 2WMHA 1BVWA 3MQTA 4CN4A 3DGRA 5H2ZA 3DH7A 2WC4A 1WB0A 1C7TA 4LUJA 3W26A 3REQA 1F61A 4ORMA 4KFNA 3ANVA 3URQA 5H91A 1EOKA 4O4VA 1PWLA 1Q6RA 2VVNA 3GVGA 4W7WA 3TR9A 2JE8A 1RV8A 5E0KA 3KLKA 3FAWA 4A3YA 4OBSA 3BCJA 2ZA3A 2XSXA 3DFPA 2YDRA 1VFUA 2WMJA 4GJJA 3PAOA 3CH0A 4LW7A 4Y9PA 5FI8A 4A8LA 2OU4A 2WMIA 3OG3A 5G5IA 4TVDA 4DUXA 3H7VA 1OC5A 4NZFA 4X9YA 1EZ2A 5ABTA 1TPC1 4UBPC 4CN6A 3W7HA 3A21A 3AISA 1FDYA 3IUDA 3GG7A 1QWKA 1RBOB 1CXLA 5DEZA 3EOEA 4BKNA 2V5JA 5REQB 4QEHA 4KEMA 4I5RA 1TV8A 3QQWA 3BH4A 1S5MA 4HSHA 1EC8A 2C1HA 4GLEA 4QFUA 4H41A 4F0HA 3E3HA 3BJFA 4K36A 4UFHA 5JQ9A 5HAOA 5C2CA 4XAPA 4XZBA 1UWQA 3W7DA 1ONRA 9XIAA 3QOMA 4JYEA 3W75A 1MW1A 1XJBA 5CPTA 1V7AA 3PZMA 4ERIA 1IWAA 5D2WA 3HB9A 1GOQA 4E4FA 5G4WA 3VCCA 1FWRA 1F8IA 3DG7A 2G4JA 4B4HA 3LCFA 4WXZA 1QUMA 1J9YA 1F3XA 1TV7A 1PZ1A 5FEZA 1D3GA 4CQDA 3C2EA 3JW7A 1BXCA 2YGYA 3UGVA 4KCWA 3F4NA 4QNEA 2WBKA 3VGEA 3EPMA 2GGHA 3PPHA 2WNWA 3B0PA 2VFGA 3WBEA 4RDZA 4L6HA 4EK7A 2PRMA 3B9OA 3PZGA 1CI1A 3SN4A 1J01A 3F4VA 1Q8AA 4G1KA 3TW7A 1FY6A 5IHSA 3GH5A 4KKXA 5CEWA 3SFWA 3BMWA 3BLFA 1VFFA 4Y9OA 1E56A 2ZRWA 1YKWA 1W9DM 3QQ0A 4QDMA 2VL4A 4IQDA 5CKSA 1WCGA 1KRCC 3AIWA 2OQLA 3PWIA 4O0ZA 3TXZA 3PZQA 1OX4A 3UF9A 6XIAA 2PD9A 5LNSA 2HE8A 2CERA 3U2OA 1OIFA 2PC4A 2ZUSA 1GW1A 2R1MA 3TA6A 1GYMA 3LQLA 4UTTA 1E5JA 4GYPA 4GGHA 5LNUA 5G4HC 1GVOA 4E8DA 3PHAA 4LV9A 4O8RA 4AIOA 3RX2A 2QCNA 4PCSA 5TBOA 3ZLGA 4UR7A 2GOKA 1UWSA 2VZSA 5A6BD 1UC5A 1ISWA 3DYPA 1UYQA 4YLWA 4HSNA 3MT1A 3CQ0A 2HXUA 2CLEA 3GVRA 1AQMA 1HO4A 1FWIC 3L4UA 2F7FA 5FSDC 3M0LA 3A13A 1LLZA 2PWUA 3CS2A 1ZBVA 5GVJA 1JQVA 1TE6A 2D3NA 1N55A 2VQUA 1SJAA 3AO0A 1UZDA 2Y61A 3TXVA 3W7CA 3EOUA 3CZKA 3W24A 2V2CA 5JUVA 4KERA 2WHLA 3VTRA 1FWDC 2AGKA 1UQYA 2WJZA 4RZ4A 1NVMA 2A3LA 4J3SA 3GXMA 1KNWA 3L0GA 1PPIA 3QFWA 3UZWA 4AD4A 5F1UA 3SQLA 4QRNA 5GNYA 3MUIA 3BW4A 1TPWA 3DZ1A 3F1QA 4DRSA 3WD3A 2C19A 1GVQA 3OLEA 2QCGA 3CWOX 1KQZA 3DFQA 4X61A 1XSKA 3N9SA 4HTBA 4PCFA 1J12A 3LHTA 1CXEA 1NSJA 3W7JA 1HKVA 4NUWA 2HDJA 4OHQA 2YW3A 4I8DA 2WZEA 2WMKA 1VEMA 1E4NA 4XVEA 2FMOA 4U5KA 1UD8A 2Q8ZA 1H61A 2ACQA 3NOEA 4NJJA 1TV3A 1I45A 3VNIA 4DBUA 4LUSA 2IKJA 3PZNA 3VZZA 2R1LA 3LLFA 2VZUA 2MANA 1OFRA 4F66A 3LDVA 3BDKA 3I3DA 2Z27A 5IHRA 3W1NA 2DIEA 5FEXA 3MSDA 3KDNA 2NQZA 1ODZA 3AMGA 1PV8A 3N18A 2ALDA 1V0NA 3TA9A 3W7KA 2PS2A 1JZ5A 4C6IA 2FB3A 3ABZA 3AYSA 3U2ZA 3WEZA 1UROA 2HPMA 1PZ3A 1A0DA 3MZNA 5A2CA 1E70M 1QFEA 2D0GA 4HT3A 3E74A 3KUMA 3W07A 4FOJA 2ZUNA 4CUCA 1P1MA 1BSIA 1ZQ5A 2EKCA 5CLWA 1S2CA 1M3UA 3LA4A 4KPLA 1DL3A 1VHCA 3V3WA 4YMZA 5EFDA 5T8GA 3UG5A 3MSGA 1C93A 1ME9A 1U5VA 4O10A 3W7RA 3VPLA 1REQB 3TNBA 1RY0A 1T40A 4DM1A 3UJRA 2WYSA 1M04A 2ZRYA 1JYXA 4CN1A 4FR6A 3M64A 3NCOA 4D6JA 1SPQA 3GG8A 1OIMA 1HP4A 1UWAA 4W4QA 1UPPA 2JK2A 2QCFA 2OZ0A 4JYFA 5JIPA 4WIWA 1EJ7L 2XG9A 3S2MA 2H90A 5F4WA 1X1ZA 4V1YA 3IRDA 3HFTA 1FCBA 3W1QA 1P4CA 2D23A 2VCBA 2ZA2A 4TMCA 3WX7A 3BLDA 3IVSA 3TYCA 1CB2A 4DI8A 4AIUA 3FA3A 1XIMA 3CMGA 3H2NA 3G1FA 4IPNB 5A2AA 3CB8A 3PBVA 1RH9A 2PTDA 1XIDA 4JXCA 1ZCOA 4EACA 3FSUA 2VRKA 3KTCA 4HNVA 4XIMA 3FN9A 1E1FA 1UC4A 3QEZA 2IKIA 3RM8A 4GKTA 1R3YA 2DGAA 1BTCA 3N13A 2PP1A 5AHEA 1OABA 1DWHM 4H4IA 3EXRA 4E4PA 3P5YA 4Q3MA 3YPIA 1Q6EA 3EWYA 4HYVA 3OJGA 4Q22A 1SW7A 1DE5A 3S9IA 3AAMA 3LCGA 1FWWA 2J79A 2DZSA 5HJXA 1BF2A 4D6GA 3CIVA 2V2DA 3UXAA 2PLJA 5I03A 3UG3A 3AS3A 4Y8EA 4XBJA 3WNKA 4W88A 4GZ7A 4OBTA 1V3LA 3KRZA 4HYWA 3GXFA 4I7WA 1EJXC 2Q3RA 2RGMA 1GEHA 3E02A 4IP5A 4FNPA 3RU8X 3HG5A 2B31A 2CXEA 4OUEA 1M1BA 4UB9A 2FVLA 3C86A 3DHUA 3PULA 5C9XA 3W82A 3DC8A 1BAGA 2Y88A 4CCEA 2WM0A 5FESA 3AIBA 4L65A 3UPMA 3RG6A 1LQ2A 5CGTA 2FPTA 3KRUA 5LZLA 2J24A 1IEVA 1YDOA 1JD9A 1E1CB 2XWDA 2J7DA 2DT3A 2EPOA 1AA1B 2E6YA 4AEOA 2PGEA 2DZUA 2HROA 4OGZA 4Q8OA 1VB9A 4R85A 4D8ZA 4EXQA 1EPVA 2OZTA 3VIFA 4AVNA 3PFRA 1FWFC 1TG7A 1HKKA 3QKEA 2WOQA 3PTDA 1C29A 3S1UA 3M46A 4U3CA 2BOEX 3S2LA 1BGGA 3TQVA 4OU1A 2Q02A 4O14A 3CH9A 1SO3A 1TZ9A 4LAZA 3RHGA 3BZJA 4JFWA 4EWND 2WKLA 3MP5A 1H11A 2QUTA 4L61A 1A3HA 1W1ZA 1X6UA 3GBDA 1D2KA 3K1DA 3SUSA 4LF1A 5CPSA 4GNVA 5LIYX 1PS9A 3AWOA 2ZZ6A 4CKQA 2YA2A 4U28A 1TR1A 3CMFA 1DWFM 4BZYA 3EDEA 1XLBA 4GZJA 5CZTA 4RDWA 2EJAA 3LRLA 1VYRA 5FAJA 2IMRA 1XIEA 3NVTA 2X1RA 3AMKA 1SW0A 4A3HA 1EF2A 1YADA 2E0PA 3M44A 4YVVA 4DZHA 1ISZA 3VNJA 4C6NA 1TJPA 1HXJA 4F8XA 3W81A 1SFJA 4CCZA 1W1YA 2D2OA 3TTYA 4MB1A 4J2PA 2A3EA 3WJXA 3MJMA 3LGDA 1LQAA 2ZDRA 4W8BA 3I3BA 4PFHA 3GFXA 2VXNA 3LZ3A 1RQHA 1R7AA 4OVXA 3AS2A 2EG6A 4HHPA 1ONWA 4NASA 1RD5A 4JTGA 4BI5A 4QHRA 3SGGA 2PP3A 3EX2A 4Q4MA 5CC7A 1HL2A 3PG8A 3WQEA 8CGTA 4JL2A 3KOFA 1LWHA 4K3ZA 2X7WA 2TYSA 3ZSTA 1RLDA 4DYKA 4H9ZA 3OBEA 4A2RA 4JDYA 4ICCX 4NJHA 5FACA 3NPWA 1YTKA 2V69A 3L23A 5LYRA 1TJRA 3WK3A 1LT7A 3R94A 4CEXC 3QM3A 2HK0A 1WPCA 4D6DA 4WEVX 1KA9F 3DKJA 4BWLC 2OLSA 3SDOA 3MYPA 4PTDA 4LNCA 5A6LA 1TTJA 1LBFA 2IPJA 2HISA 3BOXA 1OHLA 2VGBA 2F2KA 4R27A 1FWHC 3WD1A 2NV9A 1AH4A 3K5XA 4ADTA 3CO8A 1J4EA 1SQ7A 3WJSA 4OECA 4GYFA 4LUTA 1XRFA 1Q4NX 1FBAA 3R8RA 3G1XA 4MGGA 4OFCA 1GHSA 3T78A 2QGYA 3ES8A 1JL8A 3O1NA 3PB2A 1GVYA 1SO4A 2W63A 1LL4A 1J96A 1GONA 5H6HA 4JIQA 1TCDA 3P82A 3U2CA 3S9YA 2MUCA 4H83A 3GVVA 2A79A 2E67A 1UQZA 1IT8A 1QI0A 4AWSA 1XS2A 3PVFA 2CBUA 3IGUA 2JEQA 3TU9A 2E4TA 3KL5A 4MZ1A 3C0LA 1XIGA 1RCQA 5A8PA 3BW2A 1KWKA 3GW3A 2X41A 5E6ZA 3UA4A 3ITOA 2B7NA 2BHYA 3QYQA 1H7NA 1X96A 3RM4A 3FDKA 1OX4B 2NQHA 3S0CA 1VYPX 5I3KA 3B04A 2XGBA 5E0FA 1GVEA 4IG2B 5KZDA 3CUGA 3G1SA 1FP9A 2WPBA 3LXAA 1UH2A 2OLHA 3TC7A 5A95A 3IIXA 5HJYA 3G0UA 4HA4A 1F4AA 2FGZA 4W93A 1SJDA 1UD5A 4W86A 2J75A 3NL2A 5KEZA 1KV5A 1X7IA 1BF6A 1YTDA 4IFKA 1HX0A 4H6EA 2EG7A 2F2HA 4I5UA 3I6RA 4PA8A 4F0SA 3RX4A 2Y2WA 3IIOA 1QR7A 3FVDA 3WQ6A 5IM51 5DY3A 3LBCA 2WQDA 3BSMA 4BY3A 5BMWA 2QDDA 5DX7A 4M6PA 2P8BA 2H6RA 4W9TA 1IIHA 1A47A 2VR4A 2CWXA 3ZS4A 4YTTA 2X8RA 3H2OA 3VCRA 4NL1A 1EJWC 4XUYA 4JD4A 4XBKA 3K1GA 1W17A 1KXTA 4POCA 3VDCA 2ZX6A 3PWAA 3GW0A 2V5BA 1ECEA 2P1FA 4QLLA 3URNA 4O18A 1MXGA 1W5MA 2R8WA 5JBDA 1QHPA 5D8WA 3OHIA 2QVHA 2Z2UA 4FNQA 4GO9A 1Q2SA 5C2GA 1Q7QA 2ZTKA 1Q66A 3AHTA 3M7SA 5I3DA 1H0IA 4P7OA 1MVYA 4Z17A 3OIXA 3EXTA 2EF9A 2PDWA 3S6DA 4YYFA 2Q8LA 2PWEA 4Q4PA 4AHQA 1ONXA 4B91A 3DI0A 2E1WA 4JTDA 1ZJAA 5KZMA 3TYUA 3GXIA 5HNUA 3O8AA 4LAKA 1YXDA 2PPGA 2VR2A 4MWAB 5HATA 2QPXA 2I9UA 4UTWA 1ZRQA 1J8VA 3FA4A 2R9RA 4K1GA 1W31A 3P3BA 4K6AA 3TWBA 1QO5A 4HK6A 4E2DA 3D6NA 1L8NA 3V75A 2QMKA 1JVNA 3TTEA 1S2WA 1GQJA 1TSIA 4GVHA 2PCQA 4LUSB 2ADAA 2Y5JA 2ZDSA 2HS8A 2P53A 2XPKA 2J7HA 1B30A 1KGXA 2WJFA 4N9DA 2CBJA 3IVUA 1F6YA 3CYVA 2GGIA 4RJEA 3B05A 1A49A 3A24A 3BL3A 4MMWA 1A5UA 4CNPA 2CEQA 3SFKA 1OY0A 1EYEA 1TB3A 3HV8A 4WDTA 2X0HA 3CC1A 2I17A 5LIWX 2YL9A 3QV6A 4U5IA 2DT1A 3TDFA 1O94A 1XH0A 1NELA 2IPWA 3K8KA 2H8ZA 2BOGX 1Q63A 2CCRA 4S3AA 2F61A 3NDOA 2YDAA 4LUIA 2C13A 3NZRA 3A4AA 5AECA 3GZAA 1F4HA 4HZ6A 3UR2A 2OEJA 1N8IA 5KMYA 5I09A 2HNHA 1PAMA 3POHA 2DQXA 1JG9A 4PYSA 5A6AA 1MZHA 3ONBA 3LRKA 1RQEA 4O11A 1M68A 3M1ZA 4Q8PA 3M0IA 4CNTA 2VYOA 2ZZ7A 4JCMA 2VFHA 4PCTA 3GE7A 3PZTA 1JZ2A 1UIPA 1IYXA 2PLCA 2OYLA 3C0SA 3TZNA 5T9BG 1WKYA 3O06A 3GNXA 5BOOA 4N02A 4AYSA 3LD5A 1QPKA 1YDVA 4XAGA 4GBDA 4UFKA 3VAVA 4WD0A 1OFOA 3FFSA 2F6XA 5DRIA 3CZLA 2VURA 3SM0A 2QAPA 3H2AA 4PMNA 1EKOA 1TWSA 2NQLA 3KVKA 3SECA 1K77A 4XKMA 2Y5SA 3VD3A 3KOXA 3MZ2A 3MMWA 1RCXB 4Q8NA 4N42A 1XFBA 3AZTA 1IHIA 2GZXA 4NP7A 4Q8QA 3GIQA 4DJED 3SQSA 1W5NA 4B2DD 1OX6A 1U33A 3HZ3A 3MVTA 4AY1A 3S5OA 4Q8WA 2Q8XA 4GQRA 2EHHA 3NZQA 2I14A 1WDSA 1UZ4A 2GQ8A 2CW6A 3VFCA 3EGJA 4M19A 4LVBA 3QRHA 3R1ZA 5CXPA 4DWSB 5LNRA 2YB1A 1R2RA 4YTRA 5K4XA 2HXTA 1POJA 3DFHA 1B3YA 2DZXA 1SMDA 4HPXA 4ZMGA 3CL7A 1NEYA 5D03A 3FOKA 4E2VA 3A3WA 5CPOA 2PTYA 3W1MA 1MEWA 3N04A 1N8WA 3TAOA 4C90A 2NXHA 1IEQA 5FF7A 4DUVA 2QCDA 2J77A 4CGTA 4JTSA 3MSYA 1UWTA 4QDWA 3ZT7A 3QW3A 4HZ8A 3QHMA 2ZFAA 1Z7AA 3W76A 8TIMA 3VKAA 3LPFA 1QI4A 4M6UA 3B8IA 2EPKX 4LUYA 5IDIA 3ZVHA 3BAKA 4A05A 4BQ3A 3VIHA 1UP3A 4AMAA 3W01A 2WSQA 2E40A 5EBAA 4PEKA 3CM4A 1MO0A 3GTNA 1Z44A 2GFTA 3NZPA 4TV5A 1JF6A 3KWXA 1U5HA 4NXSA 4XVDA 1V8EA 2DVUA 3TKFA 5TAOA 4C6FA 1ISYA 4WKFA 1ITXA 4Z0SA 4KFPA 4HSOA 3IGXA 4HPNA 1HVXA 1W1VA 3QOKA 4M8UA 2Y7GA 1SZEA 4RPPA 4YHEA 5J8LA 2P0IA 5D9MA 3W3OA 1OYAA 2BVWA 4AHPA 3UPWA 1PTAA 4A35A 4PBFA 3CUHA 4J3TA 3UPBA 3W1XA 2PURA 2Q6ZA 2V63A 4WKHA 3KVMA 4ZE4A 1YE4A 3T2QA 1DXFA 1OK4A 2QAFA 3NYZA 2QV4A 3PZUA 4JTTA 4PZVA 1FDJA 1V77A 4QE4A 3TYZA 4B5WA 1LBMA 2Z6IA 3MHGA 4MAZA 2VGIA 3ARXA 4O1FA 1JRBA 2WC3A 3IS4A 4PRTA 1G0CA 2PI6A 1VFHA 3P14A 3BGJA 3BICA 3BLPX 4G9PA 4RXGA 2FZNA 4Q8TA 1QW9A 3WFZA 1GZJA 4N9EA 2EBNA 4DBDA 4O1AA 3MSRA 5F7UA 3PF3A 3GDBA 4QP0A 2QF8A 3MV01 4FOUA 3CZGA 4A8RA 1XW8A 3B4UA 4J3WA 3THCA 2WZHA 3VIOA 3V5CA 3UCCA 3C0QA 2OWXA 3GNPA 4DWDA 3SCTA 4BFAA 2NT1A 3VKJA 1AG1O 4CNNA 3MY9A 3RDKA 1XBYA 1W3TA 4ASTA 3AIRA 1RBAA 5FF3A 1FVPA 4CD5A 4JPGA 1FWEC 3L5MA 1LBLA 1VFMA 3LMYA 3ZJ7A 1HW6A 3BAYA 1W5OA 2BLEA 2VRQA 1U1HA 2BY1A 1Q3NA 1XQKA 1XLKA 3CTLA 2ZC8A 4UTIA 3TMQA 1GKPA 1X38A 2AL2B 1WBHA 4JFUA 1XSIA 3AXIA 3SCPA 2PA6A 1S5TA 2FKPA 2DZPA 3PNUA 3KX6A 4N9BA 4M7SA 5CGMA 4JN6A 4US6A 3GAYA 1B3XA 5K3VA 2UV8G 2Q09A 3MCNA 1ZTVA 3CQHA 3AXMA 3O0KA 2B7PA 2KAUC 3CNYA 5CLTA 4H8NA 7CGTA 4GI9A 2E25A 4HIBA 5MKGB 4D71A 3ICJA 2PDJA 1XD1A 4MFEA 2OSYA 5HQMA 1KCKA 4HK7A 2B81A 3NDZA 2YFOA 3C56A 2ZX5A 1D9EA 5G4EA 4XTIA 1QASA 5IRPA 2QJIA 2V82A 1R3QA 3N4AA 3ARWA 3FA5A 1E0TA 1TWIA 3NZGA 3CYJA 2PB1A 3STPA 5I02A 1FWCC 2PDGA 5J04A 3R7MA 3VI2A 1P5BA 3NJ3A 3CHFA 2D1ZA 4FXSA 4H7CA 5E09A 3HGSA 1AH0A 4BF7A 3CAQA 2Y24A 1FKXA 4NT0A 3WY1A 6PTDA 4IGSA 5M5DA 1VH7A 3C2VA 3O3RA 2ABBA 2E09A 4QJ4B 2X42A 5BU6A 2FZMA 2GSHA 1TMLA 3KZPA 5A6JA 4HJFA 3CIWA 3BJSA 1E4IA 2R1NA 1BYDA 3A5FA 3WQDA 4AB4A 4JTFA 3KM8A 2XTKA 3PSVA 4JTQA 3GUWA 4MPQA 4C5YA 4MUZA 2NQJA 4Y7EA 4ZVJA 2B7QA 3LGGA 3WNPA 4PMZA 2DZTA 4C6QA 3FK4A 3U0HA 4Q7NA 4X2PA 1UMLA 1WZLA 2XIJA 4C60A 1CYGA 1MNSA 1OWQA 2VX7A 4UZUA 1EA9C 3G18A 2CPUA 3BVJA 3OA5A 4YPJA 2QDHA 2E3ZA 3L2MA 1C3FA 3NO3A 4PL1A 2PDIA 1EH9A 4KQNA 1ZB5A 4E6MA 2YIHA 4JN8A 4V28A 2QLYA 3LERA 3WEMA 2NXGA 4E8CA 3H26A 1S46A 3T0DA 3OVPA 1AODA 1V6TA 1DTNA 1SW3A 4U2ZA 3IAQA 3O63A 4TOQA 3RFAA 5E0CA 4XAYA 3GIYA 1YBQA 2GJRA 1T5AA 1QATA 2ZXDA 1SU5A 3RMJA 4PMDA 1EDQA 3WH9A 4FLRA 4DI9A 3MV11 3KRBA 5LNWA 3CPGA 3AZSA 4IF2A 2YZ5A 4JTLA 1F07A 3W85A 1IXPA 2A6NA 2FJKA 3LI1A 4J27A 4RKAA 3N14A 2AOSA 2FH6A 3B9AA 4I7VA 4IQEA 4PUWA 1NWSA 1ZAJA 3OZMA 4MJ4A 4H9VA 1KKRA 1VGAA 4GIRA 4JIHA 5DCDA 4I6VA 1P48A 4PUMA 3CV1A 3EX4A 1XYFA 1E4LA 1QBAA 5FL0A 1CCWB 4B5NA 3SR7A 5AYZA 3H53A 4AXKA 3UP8A 2XVKA 4NZ4A 4GGBA 2QJGA 3PTKA 3BE7A 4KIRA 1ZNNA 3H22A 2Z00A 4HPJA 1H5YA 4RE0A 2YYTA 2VDIA 3APGA 3A47A 3OQEA 2PFHA 3TCEA 3GDKA 3V1HA 3AICA 1Z6KA 5FSEC 2BP1A 3OG2A 1TZZA 5DQPA 5B7YA 5J5RA 4K8HA 1B57A 4AD2A 2WC7A 4YTSA 4ZB5A 2FTWA 2FVKA 1JPMA 5BYWA 1HNYA 4Y9MA 3EWWA 1Z8AA 2XSAA 3R0KA 1YQ2A 1YPIA 3ERPA 4RNHA 1KM1A 4DZAA 4K8EA 3G6LA 1VLWA 3RK8A 4RE4A 2R1KA 4U4MA 2I5QA 2CXGA 1XIIA 4LNYA 3WLNA 4LX4A 2DY3A 3PY2A 3HJEA 1EYWA 4NRSA 1AH3A 1V02E 2Q3OA 3SURA 1Y8BA 5E93A 1PKLA 4O50A 4F40A 1YIXA 2Y6ZA 3O6YX 1NWUA 3NPXA 2J74A 4D6HA 2BHZA 2DH2A 4UFJA 3E9AA 2FJUB 4AZIA 1S2TA 5I2UA 3ANUA 4I9MA 1DORA 3TMLA 3VM5A 5AY7A 1HJSA 1LRNA 2ZUUA 5F4SA 2A21A 5DBTA 1KFWA 1XG4A 3BGAA 4F3HA 3P62A 3AUJA 4KWVA 4D1JA 3NWRA 1BFNA 4IIDA 4L4OA 3CHEA 5AC7A 5CSYA 3URAA 4JR5A 1TIWA 4HYRA 3VMOA 2J25A 2Y1HA 3GS6A 4I9AA 4GX8A 3GNNA 3LI0A 3GRIA 2NZLA 6TIMA 5F2GA 4MM1A 4IXXA 3W84A 5C9ZA 3MP4A 3VGBA 3MW7A 2BB0A 2ALRA 1R3VA 3PWGA 1O12A 3UXDA 3LBMA 1OD8A 2XM1A 1WXYA 4UZSA 3QMSA 5FJPA 3CUFA 1NF7A 4XO7A 4NAFA 1LLOA 4RW5A 3MBFA 4PUKA 3PC0A 2D24A 2Y63A 4UMAA 3CV6A 3IJLA 5I3HA 4J40A 5AHIA 5I77A 4Q7BA 3T08A 2A0NA 4R88A 2PCEA 1MEIA 3S47A 1J10A 4NYYA 2NVDA 3CEPA 4ZTYA 3WLRA 2Y7DA 3EZ4A 4DJFA 4MG4A 2V8ZA 1AMYA 3ARRA 1H3GA 1YNYA 4YNGA 1D3CA 1K1DA 2YLAA 5EGRA 3CPRA 2WMGA 4FIRA 3FNDA 3LHZA 4D6IA 3BLIA 2QCLA 3NM1A 3KXQA 4AD5A 3WQFA 3KCOA 4IICA 4D6EA 3WD4A 3LMZA 2IW0A 4RE2A 2CFFA 3KL0A 1ZLPA 1M7PA 2XH2A 2CZ5A 1JF5A 2PDNA 3GFZA 4NY2A 4MLRA 4QIUA 1C91A 1JFHA 2ZICA 4CVWA 5EBUA 1IXQA 2QCDB 1VCGA 1EPXA 4ZO7A 2OLAA 3MUZ1 3LLDA 2Y8UA 2PODA 3TAKA 4UQAA 4MDOA 1EF3A 4MPKA 3COTA 1UKTA 2JEPA 2QW5A 3T0TA 5BNKA 3KVJA 1JCXA 3ZVHB 4AYGA 4UXDA 7ENLA 3GDLA 4IMFA 4H6RA 1Z42A 1TV5A 3ZJ6A 2YPIA 1DXEA 1FWNA 4LT9A 4GCAA 4YTUA 4JKMA 3WLMA 2Z6JA 4PFMA 1ML1A 2DJXA 3WLSA 3PJXA 2E9LA 2WWDA 1EOMA 2JGQA 3WDQA 1JCYA 2PWFA 2YCEA 3HURA 1KFJA 2DSWA 4O1EA 4JHZA 1OG0A 3UJFA 2CKSA 4D72A 4LEFA 1JPKA 1E15A 3WDHA 1A5MC 3KOZA 1MQRA 1R3RA 4KH2A 1VKFA 2ZXBA 1L6WA 1XLAA 3H24A 1VFSA 3GHRA 1TMQA 1E73M 3MBDA 3N25A 3AMLA 1HJVA 3H21A 3PBWA 1MUCA 1A5LC 4OBRA 3AC0A 2QR6A 4TO8A 2BG5A 5CPLA 3K8MA 4AWUA 3VC6A 3OPSA 1XCXA 2CLPA 3HPZA 3BLKA 3S1GA 4LS1A 4KEUA 3DCPA 3WJZA 3P74A 1R0MA 3BAJA 2A3BA 3PZOA 4TX9A 3PG9A 3ARSA 1N8FA 3A9IA 4EAMA 1NAL1 4ZEPA 5DMLA 1V03A 3R0DA 4WCJA 1W1B1 1UR0A 4DB7A 2VNCA 3G1HA 1YXYA 5GJMA 1B9BA 3KS6A 4AZ7A 1A5OC 1XRVA 1XIHA 4L1WA 5CPMA 2C0AA 3VO0A 5D30A 3TC6A 2FHBA 3GKFA 1XLDA 4HMCA 2WNZA 1I1XA 2EG8A 3TJ4A 1P0EA 2UWFA 4LC8A 3RAOA 4RZ5A 3TYDA 1WZMA 2OQHA 2BY2A 1A4MA 1EEXA 2PDLA 3UR7A 1M65A 1LCOA 2FMNA 3GNDA 1FFRA 4L5ZA 4GISA 1KLZA 3V0SA 4XV0A 1H62A 3TNOA 1V0LA 3U57A 1UOZA 1S2VA 2PGWA 4Q4QA 4LC6A 4C1NB 4QS5A 3GB6A 2BHUA 5CBIA 3VD7A 2VO5A 1JEZA 1B2YA 4REQA 4Q8MA 1YMYA 4DXKA 3FV9A 1FH9A 3B0YA 1UOKA 3B40A 3L0KA 3KTXA 4PMVA 4ZZ9A 3GVQA 1B3ZA 1QNVA 4DUWA 3LTPA 1G01A 2YR1A 2NWRA 3ID7A 1BLIA 2CZDA 3S6OA 1E43A 2D3LA 3TVAA 4FX6M 4H6KA 1BRLA 2X05A 4KCVA 4PMYA 1LRQA 5AN7A 1UR9A 1DQWA 1M7XA 2XH0A 4XO6A 2NVCA 2WW5A 1TV4A 2G41A 3VX1A 3E0WA 4GHRA 1VLIA 4GVGA 1I4NA 1O5QA 1ZUAX 3VKCA 2G5WA 1HL9A 3UT0A 1B3WA 3S9ZA 2XU2A 4DLFA 4QJ1A 1YTEA 3S83A 3MU7A 4AD3A 2IPGA 5A6MA 4MFDA 3I65A 1QVBA 3TE9A 4LTSA 3BANA 3QSRA 3WNNA 2JF7A 3BSHA 2OODA 3TSMA 2YXOA 2QQ6A 3LSCA 3S5NA 1LG1A 4H9MA 4KW2A 3HFYA 5REQA 1KCLA 1DWGM 1QCWA 3GH4A 4XK2A 1PIFA 3CLMA 1XG3A 3B0XA 3O07A 1OFAA 4HBKA 4M51A 4KWWA 1M9HA 1H51A 1PXGA 4ES4A 2HCVA 5BZAA 4XKYB 1UWUA 3PS7A 3UEQA 3VE9A 5LHEA 1A3XA 3H7RA 3EPOA 3SRFA 2GWGA 2GVGA 2PDBA 1PIGA 4GH1A 3NSNA 4HNNA 2CYGA 5CPQA 5DCBA 1TPEA 5C54A 1XH2A 2HS6A 1AQFA 1EB3A 5BROA 3RPMA 3GKAA 2HVNA 2V5CA 3P8IA 4Y9AA 3C6CA 4XD3A 1H7XA 1I1WA 1E72M 2PC8A 5HPOA 1DIOA 1VCVA 2A7RA 3BLLA 1DV7A 1Z69A 2WZTA 1KV8A 1Q8JA 2I7GA 2A7NA 3JZUA 3VIPA 3OP2A 1K9TA 5FA5A 1VIZA 4KRZA 5U7SA 3F5JA 2ZE0A 3AYTA 4JFVA 1OZMA 1LWIA 4FR1A 3SBFA 3SRKA 3CAWA 1H41A 5I3GA 1PTGA 3CK5A 1E0VA 4QGCA 3TC3A 3MKKA 1WUEA 3LSBA 1YRRA 3UYCA 2QKFA 2XIQA 3K46A 3PBGA 4IX2A 1L9WA 3E96A 2G4FA 1DJHA 1WE5A 3ZR6A 1TVPA 2YCLA 4UFMA 3LLXA 4GNJA 3UG8A 1XCWA 3SB0A 2IXVA 3TTOA 5C6MA 3GAKA 2BVTA 4XQ6A 1RPKA 2EPLX 1NTHA 1E5NA 2ODOA 3W2UA 4QE1A 2BGSA 4LVGA 1OZQA 3FEQA 5FJIA 3ZQ9A 2ZTJA 4GWEA 1L6FA 1OX5A 4TR9A 4D9PA 1ZPTA 3A4XA 3R11A 4W8AA 3TW9A 1K4HA 1YBQB 2Y62A 3LENA 1JZ3A 3OGRA 1TJ2A 4HHLA 4U2YA 4BCEA 3WLQA 4FX8A 4PCPA 4HU4A 1JDAA 3QFEA 1NFPA 3QH2A 3DAQA 1EXBA 3L68A 4NHVA 3AU2A 2ZX8A 4HJWA 3EOSA 4GA8A 2ZXQA 2QGHA 4HA1A 3ZIZA 1H2JA 1W37A 4V2XA 3GUGA 2CBVA 1J6PA 3W72A 2HBXA 4O53A 5HWMA 4W7UA 2ACSA 4B92A 3Q2DA 1DE6A 5M2FX 4Y8FA 5LA2A 2OXNA 2ZRUA 1UP2A 1X39A 2XZ9A 4IIEA 4MYAA 2HVMA 1C92A 3TJLA 1NDVA 3AXKA 4IJRA 3NQBA 4JFSA 1JCNA 3L4ZA 4PMOA 2ZWZA 5EL1A 3LS9A 1F3TA 4LY4A 2E6FA 5LGZA 3SZ8A 2DIJA 1Q45A 2WCAA 4L6DA 1TIMA 1DHPA 1X7FA 4TV6A 3I7QA 5AYYA 2W4XA 4BJHA 3CUIA 1WAUA 3RILA 3ZFHA 4Z1YA 2FVMA 1WP6A 5KINA 1K8XA 3QC0A 1HJWA 3KBNA 1W9UA 2OWWA 4OE7A 4Z1AA 2ONEA 3A6OA 1VIWA 4NI3A 3PUDA 3RU6A 3QN3A 2QHAA 3I4EA 3SN1A 1DJZA 2BNJA 5E5CA 3GM8A 1JYVA 1NOFA 1P43A 3HJZA 3BMXA 1PDYA 3G77A 3ONCA 1XPGA 4ZQRA 5A2BA 1FFQA 3I6TA 4GO8A 2YBVA 2R6OA 4S23A 3E1F1 3AYVA 3PB0A 1LJYA 4RV8A 3WUFA 3HPFA 4ZR8A 4M1RA 3QLDA 1K03A 2VEIA 3VIJA 5C7HA 2WAGA 1GG1A 1GUVA 4IIGA 4G5DA 1B1YA 3VILA 1KO0A 2VWSA 3ZMRA 1AD4A 3EA3A 1BD0A 2V3GA 4US5A 1OCJA 2NQ5A 1K70A 4LXFA 1YPXA 3DKLA 4M0XA 4K38A 1RCOB 3WNMA 2W91A 2VGFA 5KSWA 3TCSA 4JIRA 4A21A 2W67A 1W56A 1R3TA 1R2SA 4GY0A 4JS3A 4BI7A 1A0EA 4PCNA 1MUMA 4GUGA 1BQCA 1M5WA 1U22A 2QJJA 4TX6A 3JRKA 1EJTC 1I2RA 4L4MA 1Z9AA 2Y8VA 2VX4A 1C7SA 3G0XA 1ZJBA 1JRCA 4IFRA 2E6DA 5M3WA 1MZRA 4PEEA 1DYSA 1QHOA 4C6DA 3THAA 1P0BA 1B4EA 4NAFB 5HULA 1TPB1 1IWPA 3U3HA 3QY7A 3D3FA 5CC3A 3T09A 2J8FA 4JY8A 5CBBA 2VZVA 4GC4A 4FNTA 1Y65A 3VIIA 2D22A 3T7VA 3JS3A 2XIOA 4HU0A 3ITGA 3S46A 5KETA 3AWNA 3L4YA 4RPQA 5XIAA 2O9TA 2OGYA 3D0CA 3XIMA 2EAWA 1F74A 3PJUA 4JTKA 2WJEA 1JGMA 1DJIA 2DUZA 4CD6A 1RP8A 1ENUA 1UHVA 1YDYA 3W2MA 4OWGA 3M9YA 4BEQA 3E2VA 1E4MM 4NJIA 4GZIA 1E0WA 1TO3A 5XINA 4UOQA 3S5YA 3W7GA 4Q7IA 3CO4A 1VJZA 1ZL1A 1CPUA 1UKOA 1ZGDA 5FJOA 4H8VA 4BF9A 2R24A 2DH3A 4JL1A 2MNRA 1QPOA 2DU2A 1XI3A 3NPVA 1U83A 4LU0A 1R46A 1AJ0A 4PN2A 3IRSA 4FSAA 7ODCA 4JAWA 4Z2KA 1DVJA 3L12A 3AU6A 4IP4A 5FOOA 2XZ7A 2D73A 2DJLA 1T41A 4GI8A 2GGEA 5A8MA 3TIMA 1EJSC 2V68A 4QTGA 3DXIA 4EP8C 3U9IA 3GG0A 4YTQA 5D02A 1Z89A 4E2BA 1XBXA 4S38A 3SN0A 4HHHA 3C2RA 3HM7A 5G1YA 1KTCA 1DIKA 2V2HA 3F7JA 1JXKA 1TV2A 1OT2A 2XH4A 4LBSA 4JFTA 2EJ1A 1JNDA 1WDDA 3NQ8A 4DVOA 1ADSA 1KXQA 3WFAA 4P7RA 3HG2A 4NYUA 3LHWA 1I0BA 3HPAA 1ZS2A 2YL6A 3W28A 2PTXA 2VOTA 4LVDA 3GR4A 2J8GA 1XC6A 2OB3A 4OOZA 5HMSA 5FD0A 3RX3A 2YSWA 2P76A 3G3MA 1KFBA 1V79A 3WDIA 3HU7A 2ZUVA 4WXYA 3BCFA 1CLXA 4P8UA 5AHNA 4CQ9A 5A6KA 4DAIA 3BPWA 5SWUA 1QTWA 1S2UA 4PUDA 4WVXA 3V36A 2G97A 2ZIDA 1CXHA 2QDGA 4URIA 1S1RA 3TYAA 3MWCA 4CVUA 2CHNA 3WQ5A 4WOZA 4K39A 1TE1A 4MDPA 3BW3A 4X9SA 4FNSA 4KF1A 1JCLA 4R5EA 3D5HA 2VFFA 3QPEA 4XZIA 1WAWA 2I56A 2VDGA 4J3UA 4J3XA 4ZOBA 4DZ5A 3APTA 2DIKA 5CZSA 3SRDA 2WKGA 4ENLA 4IQJA 2D69A 1GJUA 4V1XA 2WSPA 2HVOA 3NXFA 3PP7A 3NOYA 4YCOA 3G1RA 3IGSA 3LHUA 3C61A 2VQTA 3BMVA 4F4RA 4JKKA 3VMPA 1ALDA 4NX0A 3JVAA 4JTJA 3WNOA 4WY0B 5TF0A 5CSSA 4MOZA 2P8CA 4AZ6A 3LGEA 4ZO6A 3MYOA 4JBRA 4GIAA 4ZB2A 1MNZA 1T99A 2J27A 4K1WA 1IEWA 3LBOA 1GW9A 4O28A 2WNNA 2O4QA 3QLLA 1KFEA 3GTHA 4W84A 4DJEC 4FNRA 5C9RA 2WV8A 3ITYA 4M6QA 1ZY9A 4YXGA 3T0AA 3VU2A 3AIQA 2DW7A 2ZZ5A 4ROQA 1BRLB 2O9RA 5FIPA 3RF9A 1FWJC 2PMQA 4F0MA 1B9ZA 2CLMA 3R6IA 1XLJA 2OT0A 2ISFA 4AISA 4FIQA 1X6NA 4PODA 3P7YA 1O5RA 1UBSA 3T42A 3RLGA 4H7VA 2OQYA 1AJ2A 1OYCA 5FEWA 2Z1SA 5C2XA 2PP0A 4WZHA 2JKEA 3Q58A 1RD6A 1UR1A 2OFJA 3B03A 4AAJA 3ABRA 2JKPA 4GVIA 2P3ZA 3MKCA 3QJAA 4KGJA 2XGZA 2PWDA 3W73A 1HGWA 4E3VA 5AC4A 1THFD 2FYMA 1I75A 2NLYA 3B8WA 5EMUA 3CQKA 3PSWA 3VDHA 1B54A 3WK1A 3WH7A 1T6MA 1XX1A 4LB4A 4MSSA 3UU0A 3OVQA 5C7VA 1PE1A 4TU1A 3N2CA 4GQBA 1JI1A 4IFOA 3MC5A 4DF0A 4S3FA 1HP5A 3AHXA 3SQMA 1WBJA 3APYA 3LQGA 5HBFA 1PHQA 4PL2A 4M82A 2AAMA 3EWUA 2W92A 1UD4A 2Z28A 3KOYA 4DAFA 4C6CA 3T0CA 3FIGA 3BAIA 4QS6A 3E5PA 1A0CA 4NZCA 4GIYA 2QJHA 4F2UA 1SJCA 2EPHA 4D8LA 1EP1A 1TPFA 4ZOEA 2OYMA 2OTDA 1KM2A 4XB3A 4EX4A 3ZWTA 2OSWA 1PO9A 2OELA 2ASHA 4G2DA 1BWVA 1DIEA 1UR3M 3N29A 4QDPA 4J1OA 4FEZA 1VZWA 4XAFA 2LLEA 3EWDA 1TJ0A 2HMCA 3DI1A 1OC6A 1P6BA 4KRTA 2YL8A 3ZO9A 1PHWA 3QVQA 3WD2A 4F9JA 5EMLA 3M0JA 2RAGA 4S39A 4MKSA 1RLCL 1H50A 2O7QA 3QHOA 3WIJA 5AOUA 2PDHA 4LV4A 2YCLB 5L6UA 1XINA 4WUIA 4NZ5A 4ZSTA 3M0XA 5EA9A 1LZOA 2J47A 3KFTA 2POZA 1C8YA 3QKZA 3KCJA 3GQYA 3GXTA 4L9YA 4ADSA 4Y96A 2YA0A 4IG2A 4E8GA 3V18A 1TMHA 2FLIA 3NR0A 1I9CB 1R38A 1HJUA 1SZGA 1KR1A 3WLKX 3R25A 1KM0A 1GJPA 2UY3A 1UW9A 2XISA 4YL2A 4NU7A 4FF5A 4G7FA 5LIKX 4IMDA 3QGVA 2CNCA 5A94A 4ZQOA 5ECUA 1V6XA 2ZX9A 2D0HA 3GH7A 1Z3NA 3LZ5A 4FF7A 1IV8A 1S5NA 2X2GA 1E0XA 3S5ZA 1MSSA 1XLHA 4IWWA 3L5AA 4GUHA 1K9FA 3DESA 1FOBA 4Q8VA 3BV7A 2UZ9A 1TWWA 1XXXA 2WCGA 5HDRA 1F7BA 4UTTC 4N7QA 4GYPC 3OVGA 3V16A 5D2VA 3SCQA 2E5CA 1LLWA 5HINA 1QHZA 4WDXA 3GFYA 5I3IA 4O0KA 3AHVA 5G2HA 3T44A 2ZCGA 1C8VA 1RP9A 1XQLA 3CASA 3VA8A 2J66A 4Z2IA 2QPSA 1QPRA 1XGDA 2YL5A 5LIXX 1C8QA 1R47A 2QEZA 4KCTA 3LV5A 4MZ8A 2WVVB 4GD0A 3F4DA 2Z26A 3UQNA 2OT1A 1E3XA 4WY0F 3CIXA 5DT7A 3L4VA 1W1A1 1P7TB 4H04A 1FQ0A 4PTWA 4DJFD 2NWSA 4KWOA 3VCNA 3Q67A 4O52A 3HMJG 3VNDA 3TJIA 1NU5A 4DPPA 4PSRA 4MWAA 1QPQA 4A3QA 4Z2HA 4LVFA 5F2MA 2XFRA 2J9YA 1SJBA 3RR4A 3GG1A 4FK9A 1G1YA 1PX8A 1R87A 2DUAA 3TH6A 5BRPA 5BRBA 4M24A 7REQA 1VR6A 2GVJA 1R8LA 3WJWA 5D38A 1GZ1A 1WNOA 3RRXA 1YYAA 4ERGA 2RDXA 3G6MA 1TPVA 3T4WA 4GI6A 4DBEA 3VGHA 2VEKA 1RBLA 1H7RA 4LQ1A 3IEBA 2HE5A 1YEYA 1P1XA 3B8UA 4MWAC 3TWAA 4LCSA 1D3HA 2VT0A 3W27A 5I79A 1LTDA 3ALFA 1XRTA 1US0A 1HFBA 4DY1A 1J79A 4AMCA 5BRQA 3WN6A 1K9DA 1SM9A 2YYUA 1R3WA 3DHFA 2EO7A 3UWYA 2BODX 1CTNA 1E51A 5DY2A 1H1YA 5GNZA 1DIDA 1O5KA 1EIXA 1ZU8A 3QY8A 1E6ZA 1RALA 2A3AA 3NPUA 1O6IA 3EWXA 2GDUA 5DELA 4FLSA 4DLMA 3ABQA 3W9ZA 1RSCA 1XDJA 4D6CA 1GG0A 5I3JA 5D2TA 3G1DA 1MEHA 2Z2BA 1FRBA 2IS7A 2KX9A 4GJIA 1JQXA 5DO8A 1CGVA 3IUIA 3S4TA 2A3CA 3R8HA 1O60A 3BGGA 4EPEC 5GQBA 2WMFA 4H9UA 4HOXA 4TTUA 2VEPA 1W5QA 4W7VA 1O4UA 3LUTA 3NQ2A 1K7XA 2IKHA 4LB3A 3O9NA 2UBPC 3KEHA 1XDMA 4UR8A 1HTIA 1XFCA 3N15A 1JPDX 3ARTA 2QCMA 5HWNA 2P3EA 3RJYA 2CLFA 2IKGA 2NV2A 2J62A 5BXRA 5AZ0A 1KM5A 2Z0IA 3HQNA 1I2QA 1Q7MA 3UVAA 2VFDA 1RZMA 4H9TA 2DP3A 1P6CA 1EP3A 2D20A 1EX5A 3CAVA 1TFVA 5AYBA 5CCZA 1WDRA 3FCPA 4GI4A 4NJGA 3D46A 3BWWA 3OODA 1RVGA 4MIMA 1K8ZA 4P7QA 4KEZA 4J2MA 2I16A 2DPEA 3FJ4A 2E1DA 3AJXA 2GL5A 2R1PA 5AHMA 5ABHA 4Y90A 4KT2A 4L56A 1TZ7A 2YCJA 1EGVA 3QR1A 4Z08A 4HKPA 1PX3A 4DO4A 3FJ6A 1YX1A 1K8YA 3LXCA 1JFXA 2G3JA 2YXXA 2INEA 2QIWA 3FXYA 1O66A 1VEPA 1KBJA 4DWSA 2NUYA 4UOJA 1W0MA 1YNQA 3N2BA 1XV8A 1MRQA 3NQMA 1GQNA 4PULA 2RDWA 4GFSA 1WX0A 4YIWA 4NZ1A 4AC1X 5BWAA 2BTMA 4ZL1A 2PDQA 2E7FA 2CLOA 5EKYA 4F48A 3QR0A 3K2GA 5HMEA 1WDPA 3WSUA 4MYXA 1NQ6A 3KTSA 4HNTA 2XDFA 3TZFA 3EDKA 1PYFA 2NW0A 4DWSC 3HGOA 6CGTA 1CGTA 3RCMA 4AY8A 1A5BA 3MI6A 3SCUA 1NDWA 1MRAA 1IT0A 1GYLA 3OU8A 2GUUA 5MHBA 4EVZA 2INFA 4O12A 4RL3A 1GWJA 1XRSA 2C16A 4XISA 4QISA 1HVQA 3SUUA 4UCGA 2C91A 3WQ4A 3W0KA 1PKNA 1V5XA 3THQA 3STCA 4V15A 1ZJIA 3ABOA 1TUXA 2XFWA 2WWCA 3W7LA 1VBRA 4LFYA 1HKWA 2OEMA 1PCKA 2C8NA 4MF4A 5I6SA 3MCOA 1Q6CA 5HNNA 3VDAA 1IE7C 1G7UA 1UBPC 2WK2A 1NOUA 4DBWA 2RUSA 4O19A 2PGFA 4CCCA 2VZOA 3TN4A 4P5UA 4AZHA 3IIVA 4GIEA 2GVEA 4IGMA 3EDDA 4MNLA 3FEMA 1GHRA 3THUA 2C14A 2VCCA 3GTFA 5ABFA 3HGRA 1FHLA 1F05A 1T8XA 4JIPA 1XLMA 3MWAA 3L0NA 2ZUWA 3HV9A 1N2VA 1SO6A 1XLFA 6A3HA 3A12A 3GDMA 3BQ5A 3WUBA 4C7GA 3SCWA 1DJNA 5I24A 4GUJA 4WR3A 1J2BA 1NDZA 2GQ3A 3C2YA 2FPVA 4LRTA 2DORA 3EEZA 1LRTA 3V5FA 4PC8A 4HCLA 3N6QA 1A53A 5EMJA 3S2JA 3ZLHA 2VC6A 4ADUA 2QCEA 3KVLA 5CC6A 1FCQA 1J0ZA 3AZRA 1XC4A 4WK9A 1TWDA 4EPDC 4D1IA 2SFPA 1A5AA 1AL8A 1L2QA 1WZKA 4OIFA 1AMKA 5AVNA 3CPUA 4QQUA 2ESCA 3VM7A 1OG6A 2G3IA 3O6CA 1ZP3A 1KW1A 4B9YA 1C90A 3FYYA 1AVAA 1O68A 3LX9A 1GVIA 3KZSA 3BK0A 3DECA 3G24A 1TCMA 1Q13A 4GMEA 3H23A 5EFFA 2WQPA 4S3JA 5FAGA 1NH6A 1OCQA 4XZLX 3RLUA 3GU2A 1XYBA 1O1HA 3L65A 5IBXA 1LT8A 5AC6A 4NAEA 2BFGA 4IIFA 1IF2A 4W89A 1S2AA 1DOSA 1ME8A 2AL2A 3A3HA 2XJ7A 1UD2A 2HV5A 3W88A 5TD4A 3UXIA 4MZYA 4JZ5A 5IDZA 2HPIA 2DT0A 4HB7A 4UFLA 2DSKA 4GH3A 4UIOA 3OBAA 3CBWA 4M5PA 3TP4A 6ENLA 1EBGA 3MMDA 4IMGA 5I3FA 3HMCA 1V7YA 3KS5A 5HANA 3O0FA 2O92A 4W5UA 4B3ZA 4M7TA 1A4LA 1L2UA 3R12A 3H4WA 2G3MA 1R85A 4O1BA 4UQBA 4N4QA 3VNLA 1E9YB 4DJDA 1PIIA 3E6EA 2YJQA 2XN2A 1YLVA 1LM1A 3PZVA 1B3VA 5MKGA 1QNPA 2D0FA 2G8ZA 3LYEA 4QAWA 1E9IA 1T7LA 4AX7A 3CL6A 7TIMA 2PBOA 1KBBA 2JFEX 3H70A 5CJMA 3VNMA 1GVFA 3R8GA 2XVLA 1VFLA 2DZAA 4KCUA 4FXJA 3HG4A 1VPQA 4NNCA 4FO4A 3DENA 1W8SA 4CU8A 4I9TA 4LSBA 3STGA 4DJDC 3RIKA 1X1NA 4IPJA 1FHUA 4ATDA 2CITA 3WJYA 3NFUA 2C18A 4HA3A 4D6FA 4WF7A 2V38A 1KR0A 4H19A 1GQKA 2Z2AA 3W25A 2Z24A 3FHQA 3L4TA 3NZ1A 1HJQA 4UTJA 4ACZA 3PK7A 4DO6A 3WQ8A 4J7RA 4GQ0A 1KFLA 3FY1A 1RK6A 3M0ZA 4GACA 4TXEA 1JCMP 1QK0A 4BK9A 2A1YA 1E71M 1QOPA 2PU1A 3M5XA 1AK5A 2EPNA 5DLCA 3TW6A 1OB0A 1C9DA 5JBFA 3ARYA 3W00A 3LM3A 3NQEA 3UWZA 3KLLA 4YWIA 4LEQA 2XUCA 1O5XA 3F2CA 1FUYA 2FTPA 4PB5A 1QNOA 5CZKA 1RPXA 3EOLA 3VYLA 3CZ8A 1ZAIA 1CW2A 5LSMA 1QJWA 1A3WA 5A8NA 2R94A 3VVGA 4O15A 1PUDA 2PDUA 3GU9A 3ITVA 3BOFA 3CEUA 4I9JA 4LJ3A 4R9OA 4QITA 4LANA 1XICA 5HNTA 3UFYA 3TX9A 1UKSA 3VX0A 2PD5A 2BZNA 2Z1KA 1KXHA 1CT5A 1HIZA 2ZX7A 4US5D 1OFDA 2EPMX 2F38A 5D9NA 5I07A 3OBKA 3OZYA 2YZRA 5C8BB 4LWWA 4AF0A 1V93A 1KM4A 2YX0A 4K8GA 1QO2A 4FMVA 3RGTA 4DM2A 2QULA 3VC5A 4CNOA 3N9RA 1WOAA 4E0CA 5PTDA 2FZ9A 4J5NA 5KZ6A 3R4IA 3AHYA 3NNTA 2VUYA 2C3ZA 1HG3A 2A3HA 4MVAA 3W53A 1U1JA 1UUMA 1W2PA 1NARA 3B9EA 3C8FA 3K8LA 1IXNA 2X09A 4DN1A 3GC4A 3TR2A 4FNUA 3CTTA 3UXLA 5D37A 1DWJM 2VR5A 2ATSA 1VBJA 2XFYA 3LPGA 2XVNA 4HOWA 4WGXA 5DCEA 1LL7A 2DDXA 3NURA 4B15A 2Y8KA 2BASA 1DHKA 3VKKA 2VWTA 2VTFA 3MJYA 3C3NA 1ONEA 4JHMA 2DV0A 4XZHA 3P0WA 5FKYA 4O1DA 3DHPA 1R3SA 3OIHA 2NQ9A 4H2HA 2WVUA 7REQB 2KZHA 1VEOA 4W85A 1W91A 4U31A 2QDEA 3GR7A 3PUGA 3SIMA 4C6OA 4FS9A 3E2SA 3U4FA 4AZBA 5GJPA 4UQCA 1FH8A 3UR8A 3PANA 4ZGYA 1OGSA 1RK5A 3I6EA 4X0VA 3H2CA 4OTKA 2A6LA 5F4XA 2ZVRA 4JNYA 4V27A 4UTWC 3EX1A 4GYKA 1K3UA 2FB2A 1XP3A 2AMXA 3WDRA 4PTNA 3ARUA 3GU1A 3RXZA 4JTHA 1W9VA 2BVDA 1NWTA 4HN8A 1CXIA 9RUBA 3ITTA 1BWKA 4RE3A 5A1AA 3DGBA 3HTWA 3TV8A 1J5SA 5ENLA 1F3EA 2ON3A 3BC9A 3H54A 5BW6A 3U48A