1ZQ5A

Crystal structure of human androgenic 17beta-hydroxysteroid dehydrogenase type 5 in complexed with a potent inhibitor em1404
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
314
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPNGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 119
structure length 314
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zq5A00
2DV0A 2HDJA 4QBXA 4LBRA 2PDJA 2ACQA 3WBXA 2IPJA 1QWKA 1EF3A 1X98A 4HMNA 3GHUA 1YE4A 1RY0A 1ZGDA 3FJNA 1MRQA 2CLPA 2PFHA 1AH0A 2IPWA 1ZSXA 4LAZA 3BUVA 4GA8A 5JH2A 4JIIX 3EB3A 3R8HA 4I5XA 2BGSA 2J8TA 2HVNA 2PDPA 1Z9AA 1AFSA 4PUWA 4L1XA 3LN3A 4YVVA 1XJBA 3UG8A 4JQ3A 4IJCA 1YE6A 4EXAA 1EXBA 1YNQA 1T41A 3Q67A 4GABA 5HNTA 4XZNX 2ACSA 4YU1A 2IS7A 3ERPA 3M4HA 1S2AA 4WEVX 5LIYX 1PWLA 1AZ2A 1X97A 3N6QA 3N2TA 2PDYA 2WZMA 2HE8A 4FZIA 5AZ1A 3LD5A 3EB4A 1LWIA 3GHRA 3MB9A 4JQAA 4G5DA 2PDMA 4ICCX 5AZ0A 4XZLX 4DBUA 4WDXA 2WZTA 4IGSA 2NVDA 1C9WA 1Q13A 4Q7BA 4XK2A 1VBJA 4AUBA 1PWMA 1AH3A 5KETA 4XZHA 1M9HA 1Z3NA 1K8CA 1S1RA 1IEIA 2PDIA 4NKCA 3LUTA 4JTAA 2C91A 3NTYA 2BGQA 1EKOA 4ASTA 3S3GA 1J96A 4PRTA 4JTDA 3KRBA 1XF0A 2PDCA 5LIWX 2PDNA 1UR3M 2A79A 3CAVA 4PRRA 3LBOA 2IKHA 1SM9A 2IQDA 3G1RA 4FA3A 3UZXA 3C3UA 2IPGA 3BCJA 1AH4A 5LIXX 3R7MA 4WGHA 1MZRA 4YS1A 4GIEA 2R24A 3DOPA 4QR6A 1JEZA 5LIKX 4JIHA 3R58A 3R94A 3GHSA 4PMJA 2R9RA 4DBWA 2FZ9A 4PUUA 4QXIA 3V36A 1PZ0A 4JIRA 3EAUA 3WCZA 4GACA 2FZ8A 1OG6A 2I16A 2PF8A 4JQ1A 3V0UA 2PDXA 5LIUX 4EXBA 3LZ5A 2AGTA 1PZ1A 3O3RA 1EL3A 2DUZA 2IKIA 3LENA 4QX4A 2INZA 3Q65A 1IHIA 2NVCA 2DUXA 3O0KA 2ALRA 1PYFA 3F7JA 3RX2A 3LZ3A 4XO6A 5HA7A 1ZUAX 4XO7A 2PZNA 2HEJA 4WRHA 3MC5A 3R8GA 2I17A 1FRBA 3QKZA 4XZMX 2PD9A 3UZWA 5HNUA 3UP8A 1Z89A 2FVLA 4H7CA 4H8NA 2PD5A 2PDQA 3V35A 1X96A 2ISFA 3BURA 4GCAA 2PDFA 3P2VA 3R43A 4F40A 4GQGA 2ACUA 2PDKA 2ACRA 3UZZA 4Q3MA 2FZDA 3UWEA 3LQGA 4WDWA 4JQ2A 3CAQA 3LEPA 3LQLA 2HVOA 4LB4A 2PDUA 4ZFCA 1HW6A 4GQ0A 2FZBA 2PDWA 1S2CA 4JQ4A 1R38A 3ONCA 1Z8AA 1RY8A 3H7RA 2IKGA 3WBYA 3ONBA 3U2CA 1A80A 2IPFA 3R6IA 1S1PA 3G5EA 4OTKA 2BP1A 3UYIA 3VXGA 3WBWA 1ZQ5A 1LQAA 4JTQA 3D3FA 4L1WA 1HQTA 3DN5A 5JH1A 4JTRA 1T40A 3H4GA 3H7UA 1ADSA 4LAUA 2F2KA 3V0TA 3UZYA 2P5NA 4WDUA 4HBKA 1RALA 4MHBA 3UGRA 4FALA 4LBSA 3CMFA 3RX3A 2PEVA 4IJRA 4JTCA 1Q5MA 2IKJA 3LNMA 3M0IA 2HE5A 3FX4A 1AZ1A 1YNPA 2PDLA 3COTA 5DANA 4PR4A 1US0A 2INEA 3V0SA 4XVDA 3M64A 2PDHA 3RX4A 1GVEA 4R9OA 4RPQA 4LB3A 2QXWA 4DZ5A 4XVEA 3BV7A 2VDGA 4FAMA 4XAPA 3WG6A 5C7HA 2HV5A 2FGBA 3UFYA 3T42A 4DBSA 3CV6A 5M2FX 1MI3A 4WDTA 3GHTA 3B3DA 1QRQA 2PDBA 4YVPA 2IQ0A 3GUGA 2PDGA 4YVXA 1XGDA 1VP5A 2F38A 4XZIA 3CASA 3CV7A
chains in the Genus database with same CATH superfamily
2VRKA 2JGQA 5BW6A 3IIOA 3ITYA 4NYYA 3GXMA 4AZ6A 3T0AA 1WKFA 3BV4A 3CO8A 1MW0A 2QAFA 3TOYA 4UBPC 1X98A 4G2DA 4DJFD 5LXEA 2WO5A 4R34A 4TTGA 4ZA0A 4FEZA 5AC8A 3GRIA 4MWAE 3HBLA 4GUGA 4NAFA 1N8FA 2V63A 3M0LA 2E6AA 2J8TA 1EA0A 4JR5A 3HM7A 3TU9A 2CYGA 4PUWA 3LN3A 5LNRA 4EXAA 1DQXA 1T8XA 1LLZA 3E0VA 1SU5A 4R5EA 1JFHA 2QJIA 2NUWA 2PURA 1DWHM 4RX0A 4Q7NA 2ZUMA 3ZO9A 2BY3A 3TCEA 2IMRA 3CZJA 2CKSA 4B9YA 4AHQA 1JZ7A 2BY0A 1B3XA 4NX5A 1FWWA 1X97A 3N6QA 1GQNA 3MANA 3O7UA 1VFTA 3G1XA 4FZIA 4MYXA 4IUOA 3B9AA 2AAMA 5CBJA 4JQAA 3PG8A 1OCBA 4QQ3A 4LV9A 3H21A 5FEPA 2FDMA 4H6KA 1RJPA 3GAYA 1XLAA 3FDKA 3IJ7A 2B7OA 4HD5A 3ZIZA 4QQUA 4EAYA 1C9WA 5JBDA 2J66A 1HXJA 3UG4A 4WZHA 2YA0A 3O16A 1KFBA 3MYOA 4IISA 1CZ1A 3TE9A 3HMCA 4XZHA 2PTXA 4C6EA 3QZAA 1R87A 3QM3A 3S9ZA 2F8QA 3LUTA 4UTWA 2J8FA 3LU2A 4NIRA 1EKOA 4H2HA 5F7UA 1JCXA 1J96A 2HXUA 1KCKA 3DI0A 1VCVA 3LCLA 2E0PA 1X6LA 3W27A 1NWRA 4XIAA 4QS5A 3K46A 1KXVA 1H7RA 1PCKA 3UZXA 4NRSA 3A47A 3INPA 1MWOA 3IJ6A 3NL3A 1E9ZB 4DXXA 2B4GA 2J9XA 4V33A 3WKZA 3HN3A 5ABGA 3M0KA 4Z1BA 4O1FA 3UERA 2J4GA 3AXIA 1HJUA 4QE1A 1V0NA 4JKMA 1S5TA 2ASHA 1FWAC 5EYWA 2J13A 3W23A 1MEHA 1O6IA 2ZXDA 4DBWA 4Y7EA 2OOFA 4UQBA 1UR1A 2QJJA 4N4QA 3ZVHA 3FK4A 2AQWA 5DXYA 1GW9A 4JN8A 4E2OA 4QAIA 2RKXA 1H49A 1I75A 3MSRA 4IF2A 4LF2A 1PVNA 3WD3A 4C6IA 3PNZA 3MDUA 1YMYA 2XHYA 4CD7A 1XG4A 3QY6A 3NZRA 2J7CA 1V6XA 3ZT5A 2ZUTA 3IEBA 3PZ9A 4C6KA 1CB7B 5D2WA 1MUMA 4E0CA 2DW6A 1S38A 1K7EA 3BLDA 2FH8A 3T2PA 3DFOA 4J3TA 3WLOA 4IIEA 1AJZA 2P3ZA 3S8HA 1D3HA 3P61A 1LJYA 2XH4A 3K8LA 3MMDA 1A0EA 4JFWA 3M7SA 4LVFA 5HA7A 1V3IA 4Y90A 2V5LA 2XWDA 4OECA 3I4KA 3OEXA 2ZXAA 4U2ZA 3WBEA 2HNEA 1VFLA 4BR1A 1YBQB 1MEIA 3NO3A 1CI1A 2FVLA 2CXEA 3DU0A 3QHNA 2WPBA 4B92A 2NT1A 4FOKA 4H6EA 4OIFA 3KAOA 1S5NA 3O6YX 3VKKA 3UWEA 2QDHA 3GG7A 3CAQA 1LOSA 3LEPA 7REQB 1CPUA 4PE8A 1UIPA 3BL3A 1JF5A 2QPUA 1X6UA 4AYGA 2XH7A 1K6AA 3KBVA 4KETA 4B3KA 1DJIA 3CHDA 2PUZA 2XINA 4ADTA 1QOXA 1E0UA 3CJPA 5IFTA 4FX8A 5H8MA 1ZBWA 3RUBL 2Z2AA 3VFCA 2FPVA 4S3EA 2G3MA 1R7AA 2VEMA 1TV7A 3GFXA 1JCLA 3H26A 5EMKA 1REQB 4AD3A 3AAMA 1R7OA 4ZENA 1V5XA 2DEPA 3KLKA 1TELA 4CU7A 1JDEA 1J0HA 4M6VA 5TNVA 3A9IA 3N11A 1VLIA 1PUDA 4LUYA 4NL1A 4O12A 2OZ3A 3BMXA 2WBKA 6A3HA 4TIMA 3N2XA 3FN9A 1A5MC 2PDLA 4JCLA 3Q94A 4NZ1A 3T9PA 1US0A 3ARPA 1VCGA 2BX7A 3PULA 1GYNA 3QW3A 1LF1A 3SQSA 1AD1A 1DIEA 5JQ9A 1NOWA 4MFDA 5IXEA 2D3NA 1EF2A 3UZ5A 3V4BA 4HPNA 3WNOA 2DZUA 2VDGA 1W6TA 4U33A 3C61A 3NO1A 4Q4KA 4LX4A 3IIXA 2JBMA 2PLJA 3ITGA 4OJYA 4BEQA 2WK2A 1D7KA 2X16A 3FHQA 4BS0A 1XIHA 1YX1A 1E9IA 3PPHA 1B54A 4H8VA 2JGYA 3GXDA 4QBXA 2O7QA 2EBNA 2EPNA 1XYLA 5I77A 3CQKA 2PTWA 3CB3A 3ORWA 1QNQA 3C8FA 4GX8A 2C19A 1QT1A 4LAMA 3N4FA 4J2MA 4YTSA 2QCDA 1U1HA 2J7DA 4IZGA 1CT5A 5HK4A 2CEQA 3GAKA 1NWSA 3STEA 4DJDC 3AMCA 3TR2A 1RVGA 1SR9A 4LAZA 3GH4A 3JZUA 4AG0A 3OVPA 3FJ6A 3EX3A 4I5XA 1UUOA 1YDYA 2CBUA 4O14A 4A29A 2HVNA 4JTTA 5K7JA 1MNSA 1MVYA 1Q6OA 4CVWA 4Y2WA 2ZRVA 1QVBA 4J2PA 4RL3A 4EWJA 4ZODA 1UZHA 4I5UA 5HXMA 4GVIA 3TC6A 3PBWA 3BO9A 4M1BA 2ALDA 1YIXA 1V77A 3WDRA 2PP3A 2O9PA 2BODX 3SJ3A 4CN6A 2YDRA 1JNEA 2V5BA 4JTIA 4XBJA 1JVNA 4NX0A 4C1NB 3EB4A 3NQFA 2QCFA 1XXXA 3ATYA 3WD4A 2QV4A 5I3IA 3NA8A 2BVYA 5KEZA 2VT0A 3LPPA 4QCFA 3NQAA 1DORA 2NVDA 4DO5A 1Q13A 3VGEA 4LTSA 4ZQOA 2OWXA 3RLUA 1ODUA 3N17A 2CETA 3CHVA 4UOJA 1TWIA 4H9TA 3WZ0E 5M3WA 2BGQA 2BY2A 2FGZA 4ZE4A 3QOMA 4UTTA 4OQVA 1TJRA 4X61A 3TZFA 4F4RA 3UPMA 3GB6A 6REQA 5I3GA 2NX1A 2OGJA 3CIWA 1YPFA 3CAVA 4RR4A 5EBAA 3MSGA 1EJUC 1W9UA 1WZKA 3CZ8A 2NQ5A 4BI7A 1YPXA 1PIFA 1T8QA 5BOEA 3M9YA 3TYAA 4KKXA 4HCLA 1YW1A 3CYVA 4GWEA 1AL7A 2GJLA 2NT0A 2XSAA 4FLOA 2OGYA 3TCSA 3H54A 2GYIA 2J7BA 1PAMA 4HGXA 1LLWA 2E9LA 2G4FA 3AXXA 3F2DA 3VIMA 2A3LA 1BXBA 3URBA 1L9WA 1UG6A 2VYOA 1I2NA 4I5RA 2AKMA 3NSXA 3GTHA 1VIWA 3QR3A 5EMUA 2YL9A 4HSOA 4FB7A 4QJ4B 5LNSA 3CHFA 4D6IA 1TJ2A 4HOZA 5CC6A 1O5KA 1OG6A 2OSWA 4OOUA 1V6TA 4MMWA 3NM3A 1F07A 3MKCA 1KR0A 1I0BA 4PL1A 3K1GA 2GUUA 3I6EA 1PB0A 3M0YA 1OABA 5FJUA 1UHVA 3W7DA 1WAUA 1E15A 1P0BA 3RXZA 5M1TA 3SY1A 3ALFA 4TR9A 4EPKA 4GOAA 2Q09A 7REQA 1TIMA 1W3JA 1NSJA 4LS1A 4QG9A 4FXRA 4LS2A 1ZENA 2W62A 3E2QA 3HPFA 4UTUA 5AVHA 2GGEA 2BVWA 2RFGA 3WDQA 5D2YA 3VGFA 4J4KA 4AX6A 1W32A 1G1YA 3DH7A 3KL3A 3LQGA 3LRMA 1J18A 4JQ2A 3WFAA 5DMLA 1AVAA 1CGTA 3G6LA 3WMCA 2AGKA 3T40A 2XH0A 1HZYA 2OKTA 2NQ9A 1Q7ZA 1EX1A 2YXOA 1NQ6A 3P5ZA 3R11A 4NXSA 5HPCA 3OZYA 4W8AA 2YYUA 4OTKA 1HKKA 1H3GA 4U3AA 1N8IA 4NVTA 2G3IA 2UV8G 4QLKA 3L5LA 5F4SA 1XINA 3GYCA 3W1NA 1FWGC 3FNDA 4N9BA 2HZGA 3CYJA 5MF5A 1UASA 3QMRA 1XLBA 4C6FA 3ZR6A 4PMRA 4LANA 3TR9A 1PPIA 4IXXA 4O4WA 4J9JA 2RDXA 1FQ0A 3VC5A 5G2IA 2NQHA 1ALDA 3LTYA 3M0JA 5DLCA 3WQ4A 5JBEA 5HQLA 2R82A 4F0SA 3ARXA 3MO7A 4L4MA 4AW7A 3NYZA 3W7NA 2V3FA 3ANUA 5DANA 3L9CA 3CL8A 3N25A 2PDHA 2A4AA 3AHZA 3WEOA 4EACA 4PUKA 4YWIA 2YYTA 3MBFA 3SN1A 3KEHA 1WPCA 2AOSA 4US5A 3F4WA 2VENA 3PZTA 3HFYA 5BWAA 4D6GA 4PCPA 1ECQA 1V3MA 1UOZA 2FB2A 3C4UA 3ABRA 5TQLA 1H51A 3FV9A 1K9DA 3IAQA 3A9BA 4K7VA 1E56A 4GQBA 1L0PA 5FI8A 2A3HA 3IIZA 3AUJA 4D6FA 3EMQA 3RCMA 2WJZA 1M68A 4KWSA 5U7SA 4O8RA 4KH2A 4Z17A 3G1SA 4DJEA 3OYXA 3PY2A 1XGEA 3UY8A 2TODA 4E8CA 1TX2A 1QO5A 3M0ZA 3FEQA 5CGTA 1FWCC 3HZ3A 2D0HA 3KBMA 1H0IA 3PPFA 1TMQA 4O16A 1S39A 3AMGA 1OFRA 1H63A 1LOQA 3W71A 3W82A 3HPXA 1M53A 1UPMB 3W1LA 3GNXA 2Y89A 1GZGA 3N3MA 4UFKA 3WJYA 2BOGX 4MDOA 2H3BA 4D8ZA 1RPXA 3R8HA 1XM3A 2BGSA 4O52A 3PSVA 2ZZ2A 5I79A 3JU2A 1TE6A 4C5ZA 2G0WA 1MXGA 4FNSA 1DHPA 2VEPA 4Y9OA 4YVVA 5CBIA 1B4EA 3W1QA 1LORA 2REQA 5CKSA 3NEVA 3BWWA 4KESA 1HNYA 1TMHA 1WKEA 3EPNA 4M8UA 5DXXA 3WFLA 1IXOA 3EX6A 1JI1A 5BU9A 4X2PA 1Z69A 2P50A 2HJPA 2ZKMX 1O1ZA 4RDVA 1QU4A 1A3XA 1J2BA 4PMOA 5F2MA 3UCDA 4QJ3B 3KXQA 3LSBA 3UVAA 3RPDA 3LCHA 2CWNA 3ARSA 2VELA 1WUEA 3NM1A 1CX9A 2VR2A 1WO2A 1ADDA 1EJVC 3A4WA 3FYPA 5FF2A 1NTHA 4TX8A 1OIFA 3RR1A 2OODA 2WNQA 2X7WA 3H2AA 5AHFA 5HNRA 4XQ6A 1YDOA 4XAFA 3MP5A 1T0OA 1Q8JA 1UR4A 4B3LA 1WKYA 5JBFA 1VRDA 4TQTA 1DJGA 3D47A 5F2GA 4N4PA 4GPNA 3WQCA 2GQAA 3W7JA 4RV8A 4IPLA 2JKAA 3EMCA 1VBJA 3SJNA 4AUBA 3W74A 1OCJA 3VOFA 4NXKA 4C5YA 4WCJA 4FXJA 3VGBA 2WMHA 2DDXA 1UH3A 3K1DA 1E71M 2A85A 1TTJA 3TW9A 2ZZ3A 3W2UA 4AC1X 1MMFA 1ZL1A 4JTUA 2Z2UA 3S3GA 1R9YA 1UBPC 2W9MA 1OX6A 3KRBA 3R0KA 4GJ1A 3B97A 1E6QM 4BQ4A 3OBAA 3S42A 3PUEA 2GJXB 1LZOA 2IKHA 4O28A 1FCQA 5M17A 2QNEA 3W70A 1GVFA 1ME7A 3MDWA 5DBUA 1JPDX 3OU8A 4CD5A 4GYFA 1QI3A 3A3WA 1QATA 1CW2A 1R6WA 4XAGA 2YLAA 5G4HC 1XRFA 3SIMA 4FNQA 3J7HA 4O54A 4D1IA 3M44A 4US5D 4WSJA 3P0WA 1GOIA 2B7PA 2GVEA 1LRQA 4UB9A 4RNIA 4XSMA 5FF4A 4DUXA 5DCDA 1WZMA 1ME9A 4QGCA 4EIVA 4F0LA 4BHYA 2OMAA 5HWJA 1IR1A 1UIOA 2A0NA 5CZ0A 4AYSA 1EB3A 2PWUA 3FVMA 3GXPA 1EEXA 1B1YA 1EZWA 3ID7A 3W7LA 4KIRA 2AGTA 4I9MA 3SEPA 4JTKA 3CZGA 5I3KA 4AIBA 3HGSA 2EPOA 1XIFA 4HT3A 3P81A 3AYRA 1J11A 1W3HA 2ZWZA 3ZLHA 1DXFA 3F7JA 2WMIA 3S6DA 3EPMA 2UY2A 3ITLA 3MC5A 4C6LA 3PK7A 3S5YA 3AIUA 2I1OA 1QI2A 4XZMX 3OZPA 3WLPA 3T8LA 1I0DA 1TJ0A 5I06A 3B06A 3LM3A 1I6NA 2PDQA 1VAHA 2YCLB 1ZAHA 3JW7A 4IFKA 2XYLA 5DMMA 3QYQA 3LMZA 3EA1A 1V6VA 2ZX7A 4AZHA 3LNPA 2W63A 5GQBA 3TMQA 3QHOA 1M7XA 3MSYA 3BJTA 1XX1A 1UQZA 1UMLA 1OB0A 1QNVA 2BXYA 2R1MA 4GIAA 3S5NA 3IUIA 1WXJA 1R30A 3BW4A 2R8WA 2G50A 4H04A 3H7VA 4GVFA 3OLGA 2YCIX 2QMKA 1TA3B 4J3UA 4L1WA 2DW7A 1S2VA 2AQVA 3GU9A 4R53A 3CPUA 3IAPA 2WSRA 4ZTYA 5AC5A 1BRLA 1VFUA 5DMNA 3NNTA 1IGWA 2G8ZA 4JX4A 3KVLA 4JN7A 4HHLA 3OG2A 1XDMA 4EPBC 1RR2A 4DN1A 4DI8A 2RDWA 4JX6A 1UZDA 3OVQA 2IKJA 3NQ6A 6ENLA 2Z0IA 1N8WA 4S1FA 3APYA 4PTDA 2VRQA 3ZQ9A 3SCRA 3MI6A 2PZ0A 3ABQA 4CNOA 1SO4A 3EWBX 1SVDA 3RK8A 4JTFA 3LCIA 3COTA 5I0DA 1UQYA 4GXWA 4W93A 5EGRA 5I2UA 4FX6M 3TYEA 3UXKA 3UWZA 3C2EA 1X8CA 2QIIA 3TV8A 2QDDA 5ABFA 2BS9A 1R9XA 1ZS2A 5AB3A 2QEZA 4HCHA 1TR9A 2JF7A 1TPWA 2I7GA 5FJJA 3EOEA 4K1GA 3CM4A 2DZAA 2HVMA 3OIXA 4FX7A 3S4TA 4E4UA 3RRXA 1J6OA 2QUVA 3KHDA 3UFYA 1CXFA 3JUGA 3KZSA 4ERAA 1V7YA 1X7FA 1R5YA 1O94A 3KCLA 4FI4A 3AMLA 1OFAA 1VIZA 1GHSA 2A3CA 4LUSA 3XIMA 1TR1A 1QWKA 5A1AA 4ZB0A 1CWYA 2G95A 4QSHA 2WWDA 4AISA 4ZGYA 5TBOA 4ZCWA 4H9XA 3PZGA 3S1UA 2YR1A 3OVRA 5A6AA 3ITOA 2HK1A 2Z1VA 1EBHA 2DSZA 3LPGA 2WJFA 4JICA 2OSYA 3B0YA 4BEUA 2DPEA 1J0YA 3DC0A 3FDGA 3LHWA 3TOPA 4AVOA 3SUWA 4JQ3A 5FSDC 2V81A 4CNTA 2WWCA 1TO3A 4CD4A 1J5TA 5C9RA 3GKFA 3P60A 2QJMA 1SW3A 1BTMA 3C5QA 4B5WA 1A5LC 1B30A 1H5YA 1H41A 1GCYA 2A6LA 4M7SA 2Z24A 5AVNA 5HOSA 1H2JA 1O5RA 4PUJA 1S2AA 4MFEA 2Q02A 3VIHA 2VDIA 3BOFA 2OQYA 1PBGA 1UH2A 1TPDA 1YXDA 1R0MA 3W1AA 1Q8AA 4KCVA 2X2GA 4ZQCA 4NAEA 2E77A 1C29A 4GNVA 1XLEA 5CSSA 4GK8A 1H62A 3EA2A 1P0KA 4L56A 2JKPA 2J7GA 1R3QA 2VEIA 3DG3A 3V7PA 1XHGA 4HCDA 1N82A 5LNVA 4IGSA 5LA2A 1PYMA 2O9RA 3MJYA 2KZHA 1SJCA 4MOZA 3HG4A 3B8DA 1GOOA 1AQMA 3VCRA 1B9BA 2DT3A 2YBVA 3CHCA 1DYSA 5E0FA 2GWGA 3M16A 3VOHA 2NV9A 4R33A 2ISWA 4S2BA 3GW0A 1M04A 3T78A 2H9AA 4RZ5A 2I5IA 4PMVA 1TB3A 3L68A 1VJIA 4WSKA 2WZEA 1XF0A 1TVNA 1W1YA 2PCQA 1BLIA 1UWUA 2YXXA 3VAVA 1WUFA 4I7UA 1NDZA 1R3YA 2KX9A 3GKAA 4F48A 4MWAA 2BXZA 4ROQA 1YADA 2DVTA 3BAKA 4IUGA 3W1PA 4CEUC 1VGAA 2PA6A 3UJSA 1WB0A 5HQMA 2BVDA 3A6OA 4WGHA 5D2XA 2VM8A 4M1RA 5CZSA 3VE9A 3T8QA 2Y7DA 3LHYA 1S5VA 4Z0SA 4Y9MA 3GNRA 3VD9A 1JJKA 3C2VA 3R58A 4TX6A 1DOSA 4L4LA 5BNKA 2R1KA 5ECUA 4ZR8A 5ABEA 2BVTA 2YKKA 4UQDA 2ZE0A 1I1XA 3W2MA 1O95A 1CXHA 3N4EA 3SCOA 1EO5A 2IXVA 1EA9C 1H7PA 3ITXA 4DIAA 5FAGA 4DBEA 4GACA 2PF8A 1DJQA 2Z4GA 5C5YA 3TSDA 3T0BA 4BI5A 3VPLA 4M6UA 1LWJA 3WH7A 1V6WA 3CV1A 3AIWA 1D3CA 3PPCA 2BMBA 2GDVA 4AD4A 1G4TA 1KB3A 1PX3A 1D7FA 8XIMA 4BF9A 3GR8A 5CCZA 4JDYA 3CH0A 3VIIA 2YCJA 4XO6A 2HEJA 3OQEA 1FX6A 4JYFA 3BG9A 4F0HA 1GJPA 1QNPA 4Z42C 5HNUA 1J6PA 3GH5A 3HGOA 1XH2A 4C6CA 4W89A 1RVKA 3SI9A 1JYVA 1CXKA 1FP8A 4LUIA 3L12A 3II1A 1UBSA 4PCNA 1K8YA 3TIMA 2DJLA 4PBGA 1C90A 2IW0A 5JMUA 1WDSA 3E5BA 1A3HA 1QBBA 2WC7A 1XIDA 6REQB 1XIJA 3TMLA 1E4LA 3PJXA 4WY0A 4HNNA 4RZBA 1SGJA 4KCWA 4OV4A 1W1ZA 3MP3A 4YN5A 4A8LA 3QGAC 3OPSA 2BP1A 3LSCA 5HMSA 1TPC1 3VK5A 5CC3A 1PX8A 2AL2A 3D3FA 3DN5A 3MI2A 1AW5A 4MG4A 1DJXA 5A8QA 4DO4A 3BOXA 3H4GA 3AJXA 3H55A 4NJKA 4PMQA 2J74A 3GDBA 1BRLB 1VC4A 2P0OA 4AY1A 3EEZA 3T2OA 2A6NA 3OGRA 4IP4A 4IWWA 1D8WA 4DB7A 1LBMA 1EJTC 3WQEA 3UJFA 4GIYA 3U5UA 4D6HA 1GGOA 4CNUA 3VFLA 2QCNA 4PUDA 4WXZA 3IGHX 3MTWA 1GVYA 4P61A 3USZA 1DEDA 3Q4DA 4I3GA 4MNMA 4WIWA 3WLRA 3T7VA 1UD5A 3LXCA 1YNPA 2GPTA 1HJSA 4IICA 3GTFA 2X1RA 4XVDA 1LT7A 5A3HA 3G0UA 5DELA 5C2CA 2EJAA 2MUCA 4DZ5A 3WH9A 4PRWA 1EQPA 2EO7A 2HK0A 1KNWA 4EP8C 5H1WA 4NHVA 2A1YA 2VR5A 1G01A 3WQFA 1U1UA 1X1OA 3LLXA 5LYRA 3TSBA 1AQ0A 5HAOA 3W7PA 2WC4A 4DQWA 1SFJA 4WDTA 3NZGA 4Q6XA 1LBLA 3QEZA 3GHTA 3KS6A 3RF9A 1TPB1 1TWWA 4U31A 1E6RA 1H61A 2PDBA 4S39A 3TWAA 3GLCA 1BQCA 1MDLA 3DX5A 1O5QA 4IPPA 4XZIA 3CIXA 1KFWA 2CLEA 3QSRA 3MQTA 2C79A 2QPXA 5DBTA 1HL9A 4IGHA 4JIPA 5DCEA 1WZAA 4LC6A 3T0CA 2VP8A 4AU0A 4L61A 5EKYA 4B5TA 2E5BA 2FPYA 3T4CA 3ZJ7A 1EC9A 3EOUA 3KTSA 2HROA 1XSKA 1GWJA 1CENA 1RD6A 3B8IA 4YWSA 2BHZA 3VM5A 5KINA 4LY8A 4Q22A 5TD4A 3F1QA 3FJNA 1MRQA 3MVTA 3R79A 3GO2A 1GOKA 3BAIA 1NWTA 4PSPA 5EU9A 1T5AA 3EDEA 5D30A 3SY8A 2Y85A 3WELA 1ZB5A 4QIUA 3LXAA 1JCNA 1US3A 1GYLA 3WDIA 3K4AA 5A6SA 3GBEA 5AYZA 5KITA 2PP0A 3BPWA 2ZFAA 9RUBA 7ENLA 1BPLB 3Q67A 2VHLA 2MNRA 2FZNA 4YU1A 3ENLA 2O7SA 4H8HA 1OQFA 2PWHA 3C8NA 4X22A 3E0LA 2PB1A 1J5SA 3GXIA 4ZQRA 3W3OA 7A3HA 2HE8A 2YSWA 4KMQA 2OB3A 2J62A 4KPLA 4C91A 2ODOA 1QPQA 4ZXLA 5F4WA 1PIIA 4XSLA 3OZMA 3MCMA 2J79A 2W92A 3O07A 3TYDA 4ES4A 3URNA 1F4AA 3KP1A 4M19A 1RLDA 4D8AA 1E4NA 4Q7BA 3EYPA 3UESA 1T7LA 2RGMA 3WF2A 6PTDA 4NQ1A 4KERA 4UTMA 3ARWA 3V5FA 1WDDA 3IANA 3MWAA 3CS2A 2OJPA 4GQRA 1WX0A 5H91A 2Q3RA 2C18A 4B2DD 4E2BA 4D71A 2G3FA 3WMLA 3MUY1 4B5NA 1OM0A 4MNLA 4PRTA 4O0QA 3S1WA 4WX2A 2Y88A 2NXHA 3P5YA 3EX4A 2CZ5A 1ECEA 2VC9A 3PB2A 4G7EB 4QG6A 4FA3A 4NZJA 3KDOA 3EOOA 1ZCOA 2VVSA 2WB5A 1HJWA 1GZ1A 1HT6A 5EY5A 3E6EA 3GU1A 4IXHA 1TRDA 2V6AA 1FDZA 5C2GA 4IGNA 2HPIA 3BQ6A 4LNYA 4KWOA 3NQ7A 1PHWA 5FACA 3RMJA 5T8GA 3GHSA 3JZEA 3W83A 1P7TB 2HMCA 1BG9A 1VS1A 4M51A 2YZ5A 3SUUA 3MY9A 1CDGA 3HQNA 3UCCA 1QR7A 2QW5A 4NI8A 2X42A 4LF1A 3PZNA 4YYCA 1BGGA 1HX0A 4W5UA 2J27A 4AX7A 1KBBA 3SCNA 3T0TA 3E2VA 2QGYA 1HJVA 3U0HA 1Z7AA 2QS8A 2XH2A 1UROA 2ADAA 7ODCA 1KM6A 1XWYA 2Z28A 3E1F1 5D38A 1W3TA 1QDSA 2OPJA 3EBVA 1TPEA 4CQBA 1BVNP 1QW7A 5E0KA 2AQOA 1OCNA 4Q33A 1IF2A 1DWIM 4Y8FA 3W6MA 2NVCA 5GNYA 5C9XA 2DUXA 2Y7GA 1XCFA 3WQOA 1B31A 4K8EA 4X9SA 3HTWA 5HMDA 1GW1A 5CBBA 1LRTA 2V9DA 4S3AA 5TF0A 1W0MA 1RP9A 4LNCA 5LA1A 1P0DA 4MGGA 2CWXA 3T07A 1JULA 1Y8BA 4RE2A 1TUFA 3PTQA 1VBUA 3AHVA 1EJWC 1AW1A 1WAWA 2QVNA 2PDKA 1BQGA 4WGXA 2ACRA 4ZO6A 4JTJA 3UZZA 4Q3MA 5EB8A 3NQ2A 1XLFA 4N6EA 1K4HA 1FWDC 1NFPA 3V1HA 3KRZA 1SJDA 1F61A 3OBEA 4GYPA 3SUTA 1GKPA 1KKRA 3AHYA 3KCOA 2DQXA 1O12A 1XS2A 2P0IA 3KM8A 3UPWA 2VVNA 4A21A 3RR4A 5BZAA 5CSUA 3A23A 3HPAA 1KGWA 4JTQA 3GG1A 4OBRA 4WVXA 4KFNA 1HQTA 3LCGA 5AC4A 5JH1A 4GY0A 1JDCA 5D09A 4JTRA 1IZJA 2VTFA 3I7QA 3UW6A 4GFIA 1VFOA 4LVBA 4ZMGA 1E70M 1UWQA 3QN3A 3TXZA 1SZFA 4RNHA 3WD2A 2H8ZA 3NGJA 3BSGA 3SO7A 3FA3A 3OHIA 1W3NA 4D2JA 3QF0A 3CQJA 2C6QA 3QQWA 1DL3A 4JTCA 2XU2A 1XYBA 3OB8A 1DV7A 1F3WA 3LNMA 4DJFA 4MLJA 2POZA 4OUEA 1SSDA 3M0IA 2GL5A 3EWUA 1BG4A 3DFYA 3FAXA 2PLKA 2WVTA 3LX9A 1A53A 2INEA 3BG3A 1XRSA 2EEXA 3V0SA 1XIEA 1TV4A 3N2MA 1O5XA 2BASA 3VABA 3QPEA 2WNNA 4BI6A 1MXDA 3QW4B 4F2TA 1QNRA 3FW6A 2YGYA 2WQDA 1K3UA 3C0QA 1ICPA 5FOOA 3AFBA 3B8TA 3VNJA 1KV5A 2PTYA 4FIRA 4TU1A 2Z1XA 4TXEA 4H1ZA 4YVPA 3GVGA 1WV2A 1NIUA 5FCZA 3E3HA 5GNZA 4GYKA 1AQHA 3TN4A 1EP1A 2X0SA 1T99A 3M0MA 2VOMA 2GUYA 2Y61A 4HP5A 4LCRA 2J6VA 4OFCA 1EJXC 4UTJA 1J79A 1GHRA 3QFEA 3PWIA 2ZDSA 3CMJA 1EF3A 2Z7KA 5E5CA 2DIJA 4R9XA 1XYMA 1LM1A 3UYCA 1OYAA 1B3WA 4RZ6A 1TTQA 4C7FA 1GKQA 1YXYA 3NSMA 2P88A 2V68A 3BAWA 2V5KA 4PBEA 2ZUNA 1FVPA 3ZWSA 1BKHA 3ES8A 5DF0A 2WCSA 3MZ2A 4GCXA 4V1YA 1DKWA 2XIIA 3WLTA 2OSXA 3ZLFA 1EJSC 2ATSA 2CZEA 5I7GA 3W7EA 5CG0A 1Q4NX 2V5DA 2ZUSA 3M47A 3GX9A 4XIMA 2NSOA 4RJEA 3SUVA 1XBXA 1IR2A 4AZ5A 4GI8A 2VUYA 3NR0A 1VBHA 2OEKA 1V6YA 3SRHA 1ZBCA 4O0ZA 3M41A 4GZJA 1E4IA 1HFBA 3AS2A 3PJTA 4DI9A 1YNYA 2WVUA 4N9DA 3AZRA 4UZSA 5BXPA 3M4HA 1M03A 2VWSA 4WEVX 4LVAA 9CGTA 2ZVRA 3F2CA 4WUIA 1TQJA 3DFTA 4G56A 3OOQA 3EB2A 2VO5A 1KXHA 4QTGA 4UQEA 3W02A 3L4UA 3AZTA 1FWJC 4HSHA 3ZZ1A 3NOYA 4MUZA 1L8PA 3VINA 3OLIA 4AD0A 3DESA 1VBRA 3VM7A 2Z26A 3P6LA 1OGBA 2NW0A 1SSGA 3PZOA 5F1VA 1E0WA 1LQ2A 3UQNA 1JZ4A 1C8QA 1RJQA 4UQAA 4ZOEA 3G24A 1EWEA 1QPKA 1FCUA 4PULA 1PWMA 1MSSA 3EPOA 2YDQA 4HNLA 1K8CA 2CLKA 1VR6A 4W8LA 4PN2A 1PX4A 3IIVA 2OU4A 2CXGA 4I90A 3NTYA 1KM1A 3RM8A 2W61A 4KCUA 5MKGA 5CSRA 4JTLA 3CT7A 3VOGA 4O10A 4O1EA 1DJHA 1EYEA 3B8SA 3OLEA 1BTCA 3LBOA 2IQDA 1BD0A 1PKLA 3TK7A 2FLIA 2OT0A 4B5VA 3JVAA 3M1ZA 4X9YA 4F0MA 4Y96A 4UCFA 2D2JA 3T08A 2G3NA 4WXYA 4B5XA 3W1MA 2GVYA 2VGFA 3WLSA 3TC3A 1ZJIA 2BG5A 4GIEA 3GM8A 3B9OA 5AYBA 1PZ2A 2GQ3A 3UY7A 1OYBA 2ISSA 1BWKA 2XGIA 4XUYA 1SQ7A 2MANA 3AC0A 3URAA 3E49A 3HIJA 4ORMA 2VEGA 2Y5EA 4EF8A 4DAIA 4MADA 4A4AA 1A0CA 1DJZA 1QAPA 1NDVA 4FNPA 3G1FA 3EAUA 1XPYA 3WCZA 2J6XA 3DHFA 4Z2GA 5CJNA 3GFZA 1K70A 3PBUA 1IQ8A 3NPWA 1UOKA 4RNJA 1QBAA 3UPBA 5EPDA 4G6CA 5AYXA 4LY4A 2Y24A 5F4XA 4H9YA 4KGJA 1KCXA 2Y70A 2PMQA 3KRUA 4CU6A 3RPMA 3O0KA 1IZCA 4IH3A 2V2DA 2I9UA 2YBTA 4UFIA 3R8GA 2XIBA 5DT7A 4AWTA 5FJOA 1VPQA 3W75A 2DFAA 2B7NA 2B7QA 3S2LA 3WLHA 3K8MA 5HWMA 3P7YA 1ITQA 2X2YA 2VC7A 4B2DA 3RM9A 4HPJA 1J0IA 1DJYA 2D73A 1JNDA 3W01A 1LG1A 3P2VA 3R43A 1CBGA 3WLKX 3SY5A 3UVIA 3W76A 3FKRA 1MEWA 4DHGA 2WVSA 2FZDA 3UBPC 1S2UA 4IT1A 4CQ9A 2QGHA 2Y8UA 3TYUA 1OIMA 2YX0A 3GWQA 3D5HA 4F2UA 2OWCA 2FFCA 4LW7A 1RY8A 4LBUA 4UFLA 3GDLA 1VPXA 5HQEA 2V82A 4I9TA 4CN4A 4GINA 1RUSA 4GVHA 7CGTA 4LC8A 2WJEA 2POTA 4QROA 3GK0A 5D2VA 3SDOA 2CCRA 1KA9F 2XGBA 3D46A 3SQMA 1YKWA 5HJLA 3AYSA 1XQKA 2WZIA 3H7UA 1JCJA 3DHDA 2OG9A 3WNKA 4AF0B 3HGRA 1WP6A 2VX4A 2NXIA 1BFNA 4QM1A 2HRWA 3RU8X 5IHRA 1VH7A 4IOTA 3NGFA 2XN0A 3F4CA 1ZPTA 1XKJA 3RN6A 1FY6A 1QNSA 3GIPA 4MJZA 1MQQA 1LBFA 3NXFA 3LI0A 1A5AA 4O13A 1XLHA 4JGDA 1E55A 1AZ1A 4GYJA 1KXQA 2TSYA 3N9SA 1VYRA 1HUVA 1A4MA 3M64A 2BOFX 3WDPP 2YB1A 1XRTA 1KBLA 1KTNA 4X3ZA 4DM2A 3WEMA 1XYAA 3NL2A 3BAXA 2OZ8A 4RDYA 3PR2A 4QNEA 4E4FA 1VRXA 1K9TA 2PU1A 3S46A 1JDFA 4TUFA 2WNZA 4KBXA 4MVAA 5C7HA 2QUUA 4ONVA 1JCYA 1A5SA 1VEPA 2F6KA 3MW7A 2GSJA 2AKZA 2A7RA 2GLKA 1S3TC 3B3DA 1JPHA 3IVSA 5CJ5A 3SFKA 1OGGA 5DX7A 4J40A 1US2A 1Q66A 3NCOA 3QFWA 1JDAA 3AMDA 3R13A 3ARVA 2ZUVA 1Q45A 4IMFA 2ACQA 4H19A 1L6GA 1CNVA 5FJPA 3O8AA 1JAKA 1QI5A 3GDTA 1ME8A 2QAPA 3FJLA 1G67A 1XD1A 3W37A 1ZJBA 2DIEA 4AY7A 4DPPA 2J77A 5C0QA 2GDUA 3K4WA 4E2VA 1QO2A 3UR7A 1A5OC 1W9BM 3SIZA 3DHPA 1R46A 4I7WA 3OODA 1ZAJA 3E0WA 1HJXA 4AD1A 4YXGA 3PBVA 2E67A 3ME3A 4J3SA 2GDQA 4ADSA 4IMGA 2E9BA 1XJBA 6CGTA 4IJCA 4NUWA 4RDWA 1FHLA 3MP4A 1SZGA 5A94A 4PCSA 1OCQA 2ATMA 3AUOA 3TQKA 4OV9A 2WC3A 3LRKA 4RE3A 1W3LA 1U5VA 1BXCA 4GNJA 3VDHA 3U3HA 3W29A 3ERPA 2OZTA 1XH1A 3LBMA 2D3LA 2RDTA 4Q4MA 1EC8A 1ZBVA 2Z29A 3EWXA 3WQ8A 3WLJA 2WZMA 2X1UA 3QPZA 1VYSX 1LWIA 3A5FA 3GHRA 2OWWA 5I3JA 1IXNA 3MB9A 1NDWA 4PMYA 1DJNA 1F76A 1U30A 5D02A 5AZ0A 5KSWA 1GT8A 1JGMA 3PBYA 1ZHAA 2A3AA 4X63A 2E5CA 1JR1A 3DFHA 3PPGA 4FMVA 3MJMA 5AFDA 1IWBA 4XD3A 4HSNA 5XIAA 1HGWA 4F9JA 5FEWA 3S1GA 1GEQA 2P76A 1CXEA 3R5EA 4DYJA 4NKCA 2VD8A 3I3BA 1Q6FA 3W7GA 4EOUA 3ZT7A 1F6YA 3R0UA 4A6GA 4MJ4A 1UP0A 4GHRA 3CPGA 2PDCA 4QAWA 4BJHA 4PRRA 3MMUA 1R85A 3AU2A 1SM9A 3GUWA 4MZ1A 4AF0A 4M0XA 2HISA 5BXSA 1XL9A 1F2JA 3MI3A 4ERGA 4LCQA 4TV5A 2ZZ6A 2BBFA 3WX7A 3MWCA 1SFTA 4JEQA 1AH4A 5LIXX 5BXTA 3QRHA 2Q6ZA 4YS1A 2GWNA 2CW6A 2XN1A 3TKFA 1VKFA 2OYMA 3VGHA 3BSMA 1XDLA 3DAQA 1ML1A 4K8HA 1AW2A 1K7XA 3QC0A 1F3XA 1PTAA 3PS7A 1ZJHA 5XIMA 2ZZ5A 4PC8A 5T91A 4AVNA 4PUUA 1O7AA 3PZMA 4PCFA 4L1GA 3CWOX 2OKOA 2WHKA 3GC2A 1MXSA 3WUFA 3ARUA 3LGGA 5G2HA 3QR0A 3WK1A 3M0HA 1KLZA 1EH9A 1LQ0A 4JFUA 4HZ8A 1KXTA 1Q2SA 3LCXA 2WMKA 2UY4A 4TOQA 2VURA 2ALRA 3S2NA 3G8RA 5CC7A 4XZWA 1JQVA 2XUCA 1E43A 2PU0A 5C2XA 1NF7A 1IGSA 3O6CA 3W7RA 4H83A 3TNBA 5CJMA 2D20A 5FD0A 2OLAA 3O9NA 3MBDA 4Q4SA 2QJHA 3BURA 1XUZA 2PDFA 4EXQA 2BGNE 3M5ZA 1SFLA 1S2TA 3B0UX 3UETA 4O19A 4KEVA 2G37A 3U2OA 1E5NA 1XSIA 2ISVA 2PP1A 4QJ1A 3VDAA 1M41A 3P74A 1FFQA 1HW6A 1P6BA 2ZC8A 3MMTA 4K8GA 1V7AA 4G7FA 1D8CA 4FIQA 3RRAA 3RLGA 4DF2A 4S3JA 2GUBA 3NQBA 2ANUA 4V15A 3H2NA 1UP3A 3B05A 5XINA 1DPMA 4Z1CA 1H7NA 2O55A 3MKVA 2HS8A 5EMLA 1E6ZA 2WHLA 3IJIA 4RXGA 4AEOA 3A21A 4FF5A 5E9XA 2PBOA 5DMYA 1G7UA 3N73A 1T40A 3PFMA 3S47A 3LLFA 3FA4A 4WDUA 3VNMA 1UKSA 4RK8A 4MHBA 4FALA 4LBSA 3U4FA 3CZLA 3VX1A 5A2CA 1XIBA 3PJUA 3LLDA 4MYAA 3CQ0A 1TJPA 2FH6A 1EGMA 3QQ0A 4LS0A 2CZVA 1QK2A 2W27A 3L2IA 3L4ZA 3BTNA 4POCA 3D3AA 4HTBA 3LXBA 3XINA 3BK0A 2PWFA 3BH4A 1W1TA 1G6CA 4HKPA 3MT1A 3R8RA 4A05A 2D22A 1W5PA 2ZA2A 4PBFA 1S46A 3SR7A 1UMYA 2B31A 2GOKA 3UZJA 1S2WA 4NZCA 4O0KA 3F5JA 4LGXA 2X1IA 3MZNA 2XSBA 1LT8A 3ANYA 4E3TA 2ABAA 4PTXA 1QW8A 4N0RA 4O4VA 3GG0A 5E6YA 4JNMA 2DSUA 3SN0A 2YL6A 4UC5A 2REQB 4DBSA 2FJKA 1I8JA 3VU2A 5I09A 1IT8A 3EOLA 2FPTA 4JIQA 3HQPA 3TA6A 5BRQA 1XGDA 3ITCA 3U8GA 4NJHA 3GNPA 4JHZA 4C60A 4E5TA 3CV7A 2DV0A 1UJQA 3DFSA 1J0JA 2WSQA 2Q71A 1JRBA 2YFOA 4QDPA 3ZYZA 2IPJA 2WMGA 1JRCA 5BRBA 3BLPX 1LOLA 1XLIA 5CQ1A 3TN3A 4A2RA 5HUPA 4BFAA 4DO7A 4BWLC 1VFHA 2NLIA 3GZ3A 3W7HA 1E9LA 1BF2A 2VGIA 4D9PA 4Y9AA 3AIBA 4DEFA 2PFHA 2ZRUA 3E0IA 5C9WA 4R7OA 3E38A 3TJLA 3DGRA 4DX3A 1POKA 2C16A 2VGBA 3N29A 2FHBA 3W07A 3VYLA 1ICSA 2D0FA 2DGAA 2FYMA 4PCTA 1TPH1 2H6RA 3GDRA 1DWFM 2GJPA 1TE1A 2FTYA 2HNHA 3HV9A 1AUSL 1TZZA 4KW2A 3BLOA 4GD0A 1MUWA 3WQVA 3L7RA 2FTPA 5CH9A 1UKQA 5BU6A 2ACSA 2W3ZA 5HWNA 4P5UA 4ZOCA 5I07A 1JIBA 1UR8A 1PDYA 2ZZ7A 1JCTA 1PWLA 4YLWA 3IUDA 2EG8A 1WBHA 3APGA 3UXAA 2FHCA 3KDNA 5FF3A 4UFJA 3WQDA 1LP6A 5D37A 2BHUA 4PTNA 2FQIA 3AI0A 3PG9A 2YCLA 3GBDA 1NELA 2PDMA 3IGXA 2PAJA 3GDKA 3RITA 4ILSA 3LA4A 2WVVA 1GG0A 4ZQPA 2VGGA 1HO1A 2QUTA 3E5PA 3W1TA 4BA0A 3B8WA 5D9OA 1VFFA 3VUSA 4FXFA 4Q4QA 3W2LA 4FF7A 3TVAA 1Z3NA 2TYSA 3DCPA 2G4JA 4AMCA 2GGJA 4ROPA 2G5WA 1IEIA 1I2RA 1W5OA 5HJYA 4XBKA 3AYTA 1J9YA 2RAGA 3CAWA 1KO0A 3HU7A 2Z6IA 3G2GA 2HQAA 1G4PA 5E93A 3VUPA 4JYDA 1MW1A 5LIWX 2Z00A 4JFVA 2FVKA 3DENA 1SPQA 2C71A 3GFYA 3L21A 3C3UA 3F2BA 4HA1A 1ZP3A 2V69A 3BCJA 3Q58A 1LL6A 4XV0A 1F05A 3FLUA 1ITXA 4UNLA 4GVGA 3UG5A 4GBUA 2R6OA 3N2CA 4ZTXA 4P7NA 1KTCA 3HMJG 2O9OA 4A3RA 3GNNA 1UB3A 5CAKA 5JVLA 4PA8A 1BF6A 2DZPA 4MUPA 1Q6EA 4EVZA 3PZIA 4A3YA 4XAZA 3U6WA 5GPRA 4HJWA 1PZ0A 2DSWA 4JIRA 3A4AA 2ZRWA 4HU4A 3MO4A 4ORIA 2P1FA 2WOQA 4HVXA 4Q8TA 3VCNA 5LIUX 5T26A 2E6DA 1OFQA 3W84A 4LRTA 3V18A 1PZ1A 3TDFA 1UC4A 3WQ6A 3EWZA 3REQB 5ENLA 3QMSA 3PAJA 5CPMA 3PC0A 2PC8A 2ZUUA 3EMZA 3QLLA 3FXYA 3AXHA 1IHIA 3EEGA 2JFEX 1XC6A 3WNNA 1Z32X 1BVWA 3B0XA 4U5KA 2CESA 1DE5A 4CUCA 1KCLA 1WXZA 1SW0A 4H7VA 4A8RA 2I17A 3V1PA 4ADUA 2BV9A 4MAVA 1HJQA 1EEPA 1N55A 4NT0A 4XX6A 2VDHA 3W2KA 3W2NA 4A22A 1F74A 4DYKA 5D4YA 2I9EA 5FA5A 4FNRA 7PTDA 1F8MA 5HMEA 2ESCA 5TAOA 3GW3A 2PDUA 1GVOA 4ZFCA 2XIOA 1VB9A 1E1CA 2BY1A 2FZBA 3I3EA 2X0YA 4OOZA 2V5CA 1HKJA 2W67A 3ONBA 1QCWA 5MHBA 2IPFA 4JL1A 1WOBA 3NZ1A 1SO6A 6TIMA 2AAAA 4YCOA 1JZ6A 4J3VA 1RCQA 4GJJA 1UC5A 1GQLA 3VE7A 1F3EA 4TX9A 3OA5A 1F7BA 1REQA 1PZ3A 2DH2A 3LDVA 1F4HA 3L4YA 1FWEC 3H2OA 2PBGA 4HU3A 5D05A 4E8GA 3RX3A 1VJZA 1HKMA 2E28A 4AWEA 2VFIA 4W87A 4GZ7A 4V2XA 4GKLA 2UY5A 3QJAA 4JOMA 1I2QA 1R3WA 1UYQA 1R8LA 4M5PA 3H70A 1J93A 3G1VA 3CAKA 3BLLA 1LL4A 1H1NA 4PR4A 5CPQA 2FKPA 4UCGA 5AHMA 4YHEA 3RX4A 1PS9A 3R10A 3BV7A 3VOCA 1TWDA 1FUYA 1OG0A 1NP2A 2AL1A 1OYCA 4BQ2A 3DKLA 4GC4A 3T0DA 1EZ2A 3WG6A 3PWGA 5HANA 3P8IA 3TQVA 3PN8A 1RBLA 1OWQA 2F7FA 3NURA 2ZUWA 1SR0A 3M46A 1W1IE 5HATA 2FJUB 1MFUA 3KBJA 2PDGA 4LYQA 2V30A 3ZM8A 2HDJA 2P8CA 2E9MA 2V0TA 4LBRA 1V6UA 4ZL1A 1OT1A 2ZC1A 2YDAA 4UMCA 1QHOA 4RLIA 8A3HA 4KFPA 1GVSA 5B80A 2H9AB 3SSZA 3MVIA 4PMDA 3MPGA 5I24A 1NFGA 3BANA 4ACZA 1QMLA 1E6PA 1JZ2A 5H2ZA 1W1VA 3A12A 1OD8A 4GA8A 3UJ2A 5GVJA 3GH7A 5JH2A 1YTEA 4XG1A 2ZRZA 2ZWYA 4W7WA 1BKSA 3AZSA 1B57A 1AFSA 4LV4A 3EKLA 3LTSA 1M3UA 2QZRA 2QMJA 4J7RA 1EP3A 2WSKA 3M5VA 1KGXA 5FEZA 2C1HA 1KGUA 4J27A 3LS9A 1JL8A 2VEKA 3KX6A 4PODA 1PKYA 3IRDA 1L8NA 3GVWA 3DECA 1A0DA 1B5TA 5C9UA 1NH6A 3DYOA 4WD0A 3H12A 5FL0A 2JEPA 4W85A 3TTYA 3V75A 3ZXWA 4XD4A 1U22A 2QIWA 3EDKA 4ATLA 3I7RA 1OFPA 4R3UA 5BRPA 3VNYA 5DO8A 3NEHA 3RJXA 1F8IA 1PKMA 4FPSA 1OGSA 1H7OA 4U5IA 5M03A 2WZTA 3QSTA 4AMAA 4G9PA 1OZMA 1K6WA 1RQEA 1FHUA 4XK2A 3CQIA 3W1XA 5BYWA 4IQJA 2OLSA 3TLQA 4J3WA 3NQCA 3P14A 2ZXBA 2BXVA 4KWVA 2ZX5A 3WF1A 2W91A 2DQWA 4C1KA 3LI1A 1R86A 4KRUA 2I56A 1HKIA 4E3VA 3W7IA 2TMDA 4DNMA 2D2OA 2PDNA 8CGTA 3KOYA 4C6MA 5AYYA 1HKWA 2O9TA 1K03A 3DI1A 1HF6A 4K3ZA 2CIPA 1V3HA 4TTUA 3VDCA 3V5CA 1FCVA 4L6DA 2CERA 2IPGA 1BSLA 1WDPA 1QJWA 4AY8A 3S2MA 2IUZA 2E68A 4IMCA 5DY3A 1A49A 2PGEA 3GD6A 1Z48A 4LUTA 3DOPA 4OKDA 5A8MA 4GXPA 4GYPC 4ZFMA 4KCTA 2XVLA 1GVQA 3VKBA 2J7EA 2DY3A 5A6MA 3WN6A 1EQCA 2OZ0A 3DFQA 4BK9A 4WOQA 1AJ0A 3F4NA 3GE7A 3NVDA 5M5DA 1BYDA 3W4RA 4QXIA 5LNUA 3N19B 1DXIA 4FO4A 1O66A 4OZOA 3KOZA 3N2OA 1OC7A 4GO8A 2EPKX 3BW3A 3KOFA 4ZEPA 1Z6KA 3L5MA 4JS3A 4B4HA 2DT1A 2O56A 2QCCA 2A2IA 4U10A 4DBDA 3VGGA 4LALA 3I65A 1I1WA 1KR1A 4MPKA 3HPSA 5FEXA 2EF9A 2YBUA 4FHAA 5ABFB 2FHFA 5E09A 3RX2A 3HQ1A 3WQWA 4JEJA 1ZUAX 4WJXA 1W8GA 5I3HA 3H4WA 4UMAA 4UQCA 1UCWA 1FWFC 2PD9A 1EGVA 2WKLA 2OXNA 3SCTA 2Y6ZA 1Z89A 3TQ0A 1ZZMA 3OGSA 1PTDA 3N13A 4IJBA 5D04C 5IHSA 1H1ZA 4DYEA 4DUVA 4H00A 5JUVA 3V35A 3G18A 3S1VA 2ISFA 3SN4A 3G0SA 5I02A 1EPXA 4UTIA 4DUWA 2Z1SA 5IDZA 1DP0A 3WH5A 4QE5A 1XICA 2HVOA 4HNTA 1KBIA 4DUOA 4HIBA 3VD4A 4GQ0A 2J25A 2J7HA 2DIKA 3H2EA 3IJ9A 2PDWA 2QUNA 4K37A 2D0GA 1R38A 3ONCA 2DT0A 3WBYA 3QKEA 1E5JA 1EHAA 3U2CA 4GO9A 1TVPA 3CXOA 1M5WA 1ZY9A 1FDYA 4M82A 4XKYB 3BICA 5IBXC 3T09A 4LYRA 4CQDA 3CEUA 5KZEA 1KQZA 3K8KA 3UYIA 1ZQ5A 3VXGA 2WAGA 3WBWA 4CN1A 3WDHA 4PTMA 2ONEA 2JIEA 3WH8A 4QFUA 5BWFA 1W2PA 3EXTA 3OW1A 3HO8A 1XLLA 2F2KA 1P0NA 2CPUA 3P3BA 3NZPA 4QJ5B 3NQMA 2WZHA 3S2CA 1Q6QA 3HG5A 3I6TA 1B3OA 1XDJA 1JG9A 1E0XA 1YTKA 4C7DA 1XPGA 3DZ1A 3O0FA 4U3CA 3JRKA 4J3ZA 3F03K 3MHUA 3VD3A 3FHAA 1P4CA 3AYVA 4X60A 3WK0A 1GVEA 3GS6A 3ABXA 1YDNA 4RPQA 1GORA 1DIOA 1V93A 4RNFA 3U4AA 1UW9A 2B0MA 5IRPA 3QOKA 3W2JA 1BYCA 1J0KA 3GU2A 5I3DA 4LQ1A 2NUYA 3CQHA 4PEEA 5E1QA 2OVLA 4EKJA 2DH3A 2PRLA 1KM3A 3TTOA 2NX9A 3P0XA 3VDGA 1NOFA 1PV8A 5K4ZA 3WLNA 2FGBA 5DY2A 4LWWA 5M2FX 1MYRA 5G4EA 1V8EA 3KRSA 3G1HA 2J75A 1JXKA 3HA1A 3GUGA 4ACYA 4L4OA 1K4GA 2DSVA 3WH6A 2Y7EA 4RE4A 4M6PA 1JQXA 4YIWA 4PUMA 2Y62A 1BVZA 3N14A 4GI4A 3LHUA 4HN8A 3HQOA 3KOWA 2UWFA 3VGDA 2ZYFA 2CLOA 1NAL1 4AC7C 1RY0A 4JHOA 1IT7A 5J8LA 1U5JA 3QY7A 1E3XA 1AA1B 2UZ9A 3B40A 1ONRA 1XV8A 3IVUA 3PUOA 1Q63A 4MM1A 1PEZA 3CK5A 5K9CA 1XIIA 2Q8ZA 1NOUA 4A3HA 1OC5A 3IUHA 2QDGA 2VNCA 3W26A 4JXCA 5DN1A 1V02A 4IL2A 1Q7QA 1MZHA 3CUXA 4S3GA 1EXBA 3MUIA 1ZRQA 1X1NA 1BAGA 1RBAA 1RA0A 1X1ZA 3TSMA 4HA3A 1EBGA 2Q3OA 3KE0A 3AIEA 3UXIA 3MUXA 5LIYX 3CWNA 1JGIA 3RO6A 5HMFA 3ARYA 1DIDA 2OQHA 5A6BA 4DZAA 3LY0A 5BOFA 2FFIA 1FOBA 1NU5A 4DELA 2DT2A 4MY9A 1BYBA 5LXXA 1OZQA 3PZUA 1FP9A 2H90A 4GBDA 2VD9A 4WJ8A 4MWAC 4V27A 3MCOA 3DIPA 2XVPA 2BNJA 1CTNA 3W9ZA 4RDZA 1X6NA 1AMKA 4OBTA 1WKDA 1OADA 2PRMA 1UA7A 4R85A 3VO0A 1NFBA 2PDIA 1ZP4A 4UR9A 3KL0A 4DWDA 4LUSB 5D9PA 1W3IA 4GMEA 4C7GA 1TFVA 2CNCA 1W9VA 3NPXA 3KWXA 4IM4A 4IIFA 3HJZA 1FHDA 1K7FA 1V0LA 1DIKA 3CV2A 4UOQA 1ZCCA 3U57A 3CL6A 2XGZA 3I7SA 4MPQA 3W7OA 1XLCA 3AS0A 3GDMA 1L6FA 1OSEA 3FSUA 1EOKA 3N9RA 5I03A 4MAZA 2ZTKA 2Z6JA 2PWDA 1MZRA 3VMPA 4P8XA 2O92A 1TV3A 5J04A 4BCEA 5EA9A 4S3FA 1V03A 3AICA 3GR7A 1JFXA 4O57A 4UXDA 1RXOB 2PGFA 1QPRA 4PL2A 1H50A 3RILA 1ZALA 3M6DA 4C6BA 4OT7A 4RKAA 1FA2A 5GJMA 1AG1O 4AAJA 1E0VA 3EZ4A 3TQPA 4REQB 3L0NA 5KZ6A 4WY0F 4G1KA 2WNWA 4BF5A 3KTXA 1EFZA 3LPFA 1F5ZA 1W1B1 2IKIA 1GQJA 2G41A 2A21A 3QXBA 2CBIA 2VCBA 2WMIB 3ISIX 4Q8WA 3FY1A 1HO4A 4U2YA 3LZ3A 4H2CA 3UNTA 1UWSA 4WRHA 1VJSA 3PFRA 4FR6A 2P10A 4PFMA 1JPIA 4AD5A 2JALA 3VKAA 2CHRA 3V5OA 1VHCA 4WF7A 3IJDA 4F40A 5E0CA 1SW7A 2R14A 3U7BA 3ABSA 3VNDA 1RD5A 3MHFA 2GGHA 3T05A 1YLVA 3AXMA 1B90A 4CQAA 1DTNA 1TSIA 4CNSA 4LB4A 4FK9A 1Q6RA 3W6LA 3S5SA 4UOZA 3DKJA 3U9IA 1S2CA 3TJXA 2RJHA 4JQ4A 1W54A 3AIQA 2EAWA 4LOCA 5J5RA 3A24A 3H7RA 2GVJA 4D1JA 3PTMA 1JZ3A 4NJGA 4AIEA 4KT2A 4HPXA 1RK5A 4Q8UA 3G5EA 1QNOA 4AIOA 1CGYA 1MO0A 3TX9A 3EKZA 4IMEA 3NDZA 1I2PA 4B16A 2EQDA 1U1JA 4V28A 3T55A 1W1A1 3USBA 3JR2A 2YJQA 1NY1A 1E1EA 3G1YA 3ABOA 4W84A 5LKYA 2P5NA 4R27A 4QSFA 2OT1A 3CO4A 4HHMA 2A3BA 3BVJA 3SURA 1J4EA 2PEVA 4JAWA 1EPVA 6TAAA 2VX5A 1QWGA 2VQTA 2XFFA 3XISA 1XGZA 1E6XM 4N02A 1I2OA 2W79A 1GZJA 3N18A 1R3VA 3QV7A 2ZRYA 3VDBA 1FCBA 4G1NA 1KM2A 3LRLA 4Q8PA 5SWUA 3FX4A 3DFNA 2X40A 3LK6A 1QHZA 1A5BA 4EE9A 3N9KA 1TTIA 3R89A 4DZIA 2WHMA 3FVDA 4LB3A 3VZXA 4AZIA 1S3HA 2PS2A 5AECA 4C1NA 4DWSB 3TFXA 1RCOB 1UUMA 3TJIA 1MRAA 5ECVA 3ALGA 3CV6A 4Z1AA 1MQPA 1E6NA 5CSYA 1R2TA 4QE4A 3VIJA 3PZVA 1V4YA 3UWVA 3LBCA 4K68A 4LJ3A 4C90A 2CKRA 3ZJ8A 1VP5A 4PB4A 3MYPA 1H4PA 3MV11 1F73A 1LUCA 5DCBA 3L4XA 3HG3A 2JE8A 3S83A 3L4TA 5JIWA 2XFYA 1PL9A 3P62A 4LPCA 4AH7A 3HFTA 3LG3A 1MQRA 3NQ8A 2EXOA 1CXIA 2TPSA 1XLGA 3T1GA 2NZLA 5H8UA 5C7VA 5A95A 2X30A 1AK5A 2XIQA 3OBKA 4LFYA 1XCWA 2XSXA 1I9CB 3CBWA 4R7JA 4ATDA 3MA8A 1AL8A 2CLPA 1TMLA 1M1BA 1QPNA 2IPWA 2VR4A 5TIMA 3FSTA 4YL2A 5D33A 5AC6A 3W22A 1A47A 3UEQA 4WLCA 1G5AA 3AS3A 4Z2LA 1H11A 4L1XA 4JHMA 4JFSA 1YHTA 5BMXA 1TTPA 4GRSA 3BXWA 4JTEA 3G3DA 4J28A 2CC0A 4ZO7A 5A6LA 2WMJA 5A8OA 7TIMA 5EMYA 2R1LA 3KBWA 4W4QA 3TFCA 5B7ZA 3BDKA 5T9CE 1BWVA 2PGWA 1WYIA 4CQ8A 1KBKA 3CUFA 3MS8A 3SRDA 4ZQMA 4AWUA 2WLZA 1L2QA 1KD0A 4PTVA 1GJWA 3F4DA 3OHMB 1AJ2A 4XAYA 3W6YA 4I6VA 3DBPA 4LUJA 4NNBA 3DC8A 2VWTA 3UJRA 3FYOA 2E5DA 1JPKA 4RPPA 2SFPA 2W5FA 4WDXA 2LLEA 3UJEA 3WDJA 3WSUA 3LCFA 3VTRA 2WV8A 1TYGA 1DWGM 3DHUA 1WDQA 3R12A 3WBAA 3C2RA 4H7ZA 3GG8A 1UA3A 1GOWA 2E6YA 2FGLA 4YHGA 1QXLA 1M9HA 1IIHA 4MDPA 1S1RA 2OEJA 1B3VA 2WYSA 2JEQA 4ENLA 4DY1A 5FJTA 4M24A 1JYWA 1EHNA 4LH8A 3OA3A 4JTDA 4DXKA 4FLSA 2RGLA 2YCEA 3QVQA 4FR1A 2O4QA 3CUJA 1WA3A 3ITVA 4YCPA 4YTUA 4C6NA 5ABHA 3RCNA 4HYRA 3WK2A 1R9ZA 2ZX9A 4WHBA 4O53A 3ZJ6A 2W4XA 3LHVA 4D72A 2YPIA 1CGVA 2ISDA 2EKGA 3LV6A 1EUNA 2VXNA 4QR6A 4S2CA 5HINA 2VUNA 3E96A 5C54A 1B0IA 1CEOA 1U2YA 4S3BA 4C6DA 1TWSA 2JIWA 2ZA3A 3ZVIA 1H09A 1W3KA 2OLHA 4RUBA 4O1CA 4MB4A 1NJJA 1QOPA 4NILA 1BXNA 1LROA 3V36A 2XIJA 3SQLA 3QLDA 1NEYA 3WNLA 2FZ8A 4UTLA 4JTGA 5DRIA 2PDXA 4Z08A 2Z1KA 4E4PA 2D2HA 3AQUA 2CU0A 5C70A 4H3DA 1XFBA 3AALA 4URIA 2NUXA 2QCLA 1LWHA 3LENA 4FNTA 3TTEA 4DJDA 2C14A 2HWGA 2PWVA 2EGZA 3WF4A 3TYBA 2ZICA 1PCWA 4MB1A 1LUCB 4XO7A 2V3GA 4UTFA 3STFA 4IX0A 5CPOA 2Y5SA 5CLTA 3OQ8A 2VZTA 3UZWA 4L64A 1E4MM 2CFFA 1KW1A 3RGTA 2Y5JA 4HMEA 2DORA 3R1ZA 4H7CA 2BOEX 3SGZA 4KEMA 4AQLA 1SZNA 1THFD 5E6ZA 3RDKA 1GVIA 4ICMA 1A4LA 1POJA 2ZDRA 2PRHA 1EO7A 4U28A 3AMKA 2NLYA 4OBSA 3R2GA 1Z8AA 3QH2A 4K7YA 2IKGA 3FKKA 3PZQA 1W9PA 3WJXA 3ATZA 5G1TA 4I9AA 4PMUA 2V2CA 3POHA 1H0GA 1UWIA 1CGXA 1TX0A 3PTDA 2HBXA 3B4YA 3KHJA 1EDGA 2PCEA 3NVTA 1MDRA 4LEQA 3ANVA 3I68A 4NI3A 1NVMA 3B9EA 2DZTA 3WUGA 3HOJA 3KOXA 2VFEA 1KWGA 4NF7A 5CZKA 1EOMA 4HBKA 3UGRA 5L6UA 3S2JA 3NL5A 4DXVA 2VX6A 2J9ZA 1KLYA 4N9EA 4F79A 3STGA 3L66A 2WKJA 4N7QA 4JZ5A 3RIKA 3M07A 3WNPA 3QPYA 3Q37A 2QHAA 3LTPA 1H1YA 4JTHA 1R3RA 5AHNA 1V79A 4XWUA 3S9YA 3M0XA 1EUAA 5A5WA 4O1DA 4BY3A 2XG9A 1W17A 1HN1A 1T96A 4AD2A 1C91A 2QXWA 5A6TC 2VQUA 1P6CA 1ENUA 3SBFA 5EBUA 2C1GA 3FA5A 3LERA 3FAWA 4FAMA 4DJED 3CC1A 5EMJA 5EL1A 4Q8NA 3JS3A 1KCZA 1LCOA 3D0CA 3KL5A 2NV2A 3VIGA 5L9FA 1YPIA 3ES7A 4P8UA 1KM5A 1AMYA 5F2LA 3IS4A 3RO8A 4BKNA 2YIHA 1TREA 1SJBA 3NUKA 4WR3A 2QJNA 4ZOAA 1V3JA 3PF3A 2DZBA 4IP5A 2F38A 4B3ZA 1SMAA 2GK1B 1WDRA 5CC5A 2ZZ4A 1KFEA 1DQUA 4DO6A 1RHCA 3DUGA 3VIPA 2F2HA 1XH0A 3TP4A 2A7PA 1K02A 4W7VA 2FB3A 1TJ1A 5EFDA 4HMNA 3MHGA 3S5ZA 4JDBA 4QLJA 3CWHA 2FMNA 4ZB5A 3WJZA 2D24A 3C52A 4I6KA 1P7TA 4C6JA 3WEZA 4TMBA 3MSDA 3M5XA 1O60A 1AD4A 1KFKA 1MUCA 5KZMA 1ZGDA 5FJIA 4GH1A 3NDYA 2VC5A 4IP7A 4PMXA 2GZXA 1ZSXA 4C6OA 3NPVA 3HG2A 4OUIA 3T6CA 3CNYA 4JIIX 2PE4A 2IXUA 3QTPA 2XVKA 1KRAC 2Z25A 3D6NA 4HK6A 3N2BA 3TA9A 3AROA 3IK2A 1Y7VA 3P8JA 3QYSA 3W86A 1VEMA 4JPGA 1R2SA 3L2MA 2WW5A 3RHGA 2CLHA 1EYWA 4P7RA 2PSNA 1OX5A 3A13A 2JK2A 2UBPC 2IS7A 1SO5A 2L5HA 1UWAA 3BJSA 4P8VA 3P67A 1W8SA 5HR7A 2C13A 4LYKA 3K13A 1LYXA 2E25A 1ISVA 2FVMA 4W5ZA 3P82A 4G5DA 3S5OA 3AWNA 4HPGA 2XTKA 1XFCA 4HK7A 1WXYA 4KQNA 4UUIA 1D9EA 3DFPA 1ONWA 3W1RA 1HVXA 2HBVA 5DT5A 4CD6A 4XZLX 2QDEA 4Y9NA 4ICNA 1VBGA 2V2HA 2A7NA 2Z27A 2DZWA 1UD4A 2RDUA 3VNLA 1F3TA 5CPTA 2VRJA 1G7VA 3PNUA 1AH3A 5GJPA 2PLCA 1QPOA 3M6YA 1E3ZA 4KRZA 1LDCA 4B15A 4GE8A 3VZYA 2XVGA 3C0JA 1XLKA 2QCMA 1R3TA 4MIMA 4AZCB 1PKNA 2Y0FA 2X7VA 3AWOA 2GSHA 2WVVB 1UR3M 3F5KA 3GR4A 1JCMP 2EKCA 1UP2A 3EWYA 1N2VA 2E7FA 1NQKA 5FIPA 3E0FA 3W72A 3M5YA 3RM4A 2F6XA 3NL6A 3R7MA 2BSLA 3LPOA 1F6PA 3ZR5A 4A3UA 4I8DA 1Y5WA 3QTGA 2FTWA 5BXRA 1Z42A 2PGRA 4P2VA 3THUA 1ITCA 1SZRA 2DZVA 4PMJA 2E1DA 4ZBCA 3VNZA 3CUIA 1DTUA 2FZ9A 4FNUA 3VA8A 3NIYA 2ABBA 5GNXA 3Q2DA 4DF0A 4I9JA 3GVQA 3G77A 3LM7A 1PIGA 3K5XA 3QZEA 4F0KA 1RSCA 5U4NA 1RPKA 3GNDA 4L9YA 2XZ9A 1XRVA 3PSWA 2QCDB 3V0UA 1EGZA 4F8XA 4HNVA 4EXBA 3ZOAA 2EJ1A 2Z1WA 1TPUA 3O3RA 1VZWA 1SJAA 3L65A 3DYPA 3CTTA 1C7SA 2JKEA 4Z2IA 2C8NA 3EDFA 1W2VA 1P48A 3REQA 3K2GA 2YCKX 3TUUA 4J35A 2NSXA 4HB7A 4B91A 4B4FA 4CCDA 4Q6JA 3C86A 2QF8A 4ZO8A 2BZNA 5IBXA 1XBZA 2QCGA 1A50A 1KRCC 3SRFA 3C0SA 3E12A 4C65A 1TCDA 4UTTC 4WJEA 1XYZA 3S0CA 3TXVA 4INFA 4GFSA 1TPVA 5I00A 4QITA 3OVGA 3BLKA 1CCWB 4IFOA 3KCJA 4E2DA 3EA3A 4JBRA 3GTXA 2C7FA 3CUGA 4O50A 2GQ9A 3BARA 3LQLA 3W25A 5I6SA 3G1AA 3YPIA 3RNDA 2CBJA 2WBGA 3K4DA 3QC3A 3GIYA 3FCPA 3FIGA 2WSPA 4Q4OA 3ARQA 4DNHA 1A80A 4Y6GA 1YBQA 3IGUA 5G5IA 1IV8A 4IMDA 4BQ3A 1LQAA 2WHJA 1Q2RA 2G97A 3NYDA 3L4VA 3WL1A 2PC4A 2YA1A 5G4WA 1E40A 3G22A 3SGGA 3MUCA 4HK5A 2OEMA 1V0MA 3KBNA 1FXPA 3N6JA 1JYNA 4CCZA 1K9EA 4GZIA 3A3XA 3PHAA 4YNGA 3VD7A 1QI0A 2HCVA 2WKGA 1EWDA 2NV1A 3F4VA 1V0KA 4PUEA 2YLLA 3HPZA 2VEFA 4I8YA 3S1XA 1Q5MA 2R1NA 4O11A 3AISA 4O1BA 1OBAA 3ZSSA 5A8NA 3IGSA 1IEQA 2EG6A 4GUHA 3WLQA 3PVFA 4IQDA 1W91A 4GX9A 4M6QA 3L4WA 4QLLA 1VYPX 3L5AA 5FESA 4GLEA 2WMFA 4UFMA 4R7WA 3VIKA 3ABZA 3TN5A 1JUBA 1OX4A 2ZA1A 1Y0EA 1E51A 1JXJA 3NZQA 3IPWA 2GVLA 1K77A 1E6SM 4ATWA 4OU1A 2G96A 4O17A 3KVJA 2OTDA 2NWSA 1QRQA 3VX0A 4ML4A 1ZNNA 3EX1A 3VKCA 3TEVA 1SUXA 4GUJA 4TVUA 3A4JA 2I5GA 3OG3A 4Z2HA 3DXIA 4N2YA 4JKKA 3KP0A 3PJWA 3WJWA 2V5JA 1L2UA 2PDJA 4UWMA 3BSHA 4W86A 3HGJA 1B4KA 3WD1A 1SZEA 4A8IA 4AHPA 3O6AA 3C2OA 3I3DA 5HDRA 4ZO9A 3TW7A 4H4IA 5K4XA 5I3FA 4Z1YA 1GQKA 4HMDA 2FZMA 4XD5A 2O4MA 4HYVA 4Q7IA 2DU2A 1MNZA 4HNOA 3EB3A 5AHEA 5C8BB 1TVLA 1FWRA 1IXQA 1OFEA 4RE0A 5C9ZA 4P7LA 3WJSA 3UA3A 4JYEA 3UF9A 3UG8A 5AHIA 1G9HA 4I7VA 2F61A 3KVKA 4KEUA 4L65A 2Y63A 1TCMA 4GABA 1ICQA 3CU2A 3CH9A 5D8WA 1HP4A 3TYCA 1VLWA 3CHEA 4WOZA 2Q8XA 3ZT6A 4EX4A 3WMBA 4QRNA 4LEFA 4YPJA 4D6CA 2JQXA 2FDSA 4A3QA 4DJEC 3DERA 2F84A 1FH9A 1G4EA 4S3KA 3LD5A 4X0NA 1GKRA 3VOIA 3SSJA 1UZ1A 4PTWA 4X0VA 3MU7A 4LVGA 4ZSUA 1UZ4A 4NZ4A 1D3GA 2E3ZA 2YB4A 4NRRA 2HPMA 5A8PA 1Q6GA 2GJNA 4DBUA 3UWYA 4A2SA 3M0VA 3BMWA 3W7QA 4C1LA 5K3VA 3N15A 1EIBA 2H8XA 1FH7A 3CMGA 1EJ7L 2GQ8A 1Z44A 1M7PA 2PI6A 4J1OA 1OINA 2XM1A 1Q4WA 2X41A 4PSRA 5CG7A 3ZS4A 1SO3A 4O18A 1CB2A 4HU8A 4MKVA 3H23A 1YRRA 3BAJA 2OCZA 4JX5A 3RLVA 3GXFA 4BWLA 5DEZA 4IIHA 1KFCA 4BZYA 4KF1A 5E70A 5HR6A 2XFRA 3PP7A 1J01A 4MWAB 3UWQA 4WK9A 3K30A 1SYTA 3MV01 4LCSA 1NARA 4D8LA 3FFSA 4JTSA 3C0LA 1VPYA 1EDTA 1UR2A 3L0GA 4V1XA 5CAHA 4B5UA 4Q32A 1QASA 3SECA 3LGDA 1P5BA 1GQIA 1P0EA 4ZXOA 2V3EA 1BWLA 2JF6A 1M01A 3CZEA 1ZU8A 2CLLA 1H7XA 2DP3A 3UR8A 3UG3A 1TV8A 1ZTVA 4JKLA 4IIGA 3C6CA 1FWBC 4A8NA 1UH4A 4QEEA 4JQ1A 2WXDM 4D6EA 3MUZ1 3LZ5A 2X1TA 3MKKA 2VMFA 1C93A 5LHFA 3FEMA 3ZJKA 4ZB2A 4QX4A 4ECLA 8RUCA 3W24A 1XYCA 3RLHA 2XWEA 4Z0JA 1ZAIA 3PB0A 9XIAA 3QMTA 1PYFA 3ARRA 1XC4A 3C56A 2PZNA 1CXLA 2NWRA 4MZ8A 1CGUA 1QK0A 3UP8A 3IIPA 1RK6A 4XISA 3RFAA 1GUVA 3FYYA 4H8NA 2PWGA 3BZJA 2NXGA 4UNIA 1E1FA 3N34A 4E6MA 4GQGA 1VCFA 1JD7A 3PBGA 3N6HA 3V16A 3WLIA 3BGJA 1WDWA 2EPHA 1OC6A 1WE5A 2D2GA 3W81A 2D69A 4QS6A 4H6RA 1W31A 1WNOA 1XIMA 3IJ8A 1OK4A 4H8UA 1UPPA 3BGGA 5BROA 4FLRA 5BOOA 4NZ5A 3TZNA 3PUGA 4C6PA 1CLKA 2QCHA 3VILA 3DYMA 5K9XA 4IG2B 4UIOA 3IV8A 1VFSA 1W9XA 2QULA 3TW6A 3W0KA 5CEWA 2J8GA 1DBTA 4RW5A 2R91A 4HU0A 3NQGA 4EPEC 2WSYA 4K2SA 1EXPA 3V0TA 1XIGA 5B7YA 3ELFA 1RALA 1H7WA 4IPNB 2CLIA 4MTVA 3OGVA 2VJXA 1ZBKA 3E02A 3AHXA 1HL2A 3CMFA 4O15A 1HL8A 1Q7MA 1TQXA 3G6MA 3B8VA 2VFGA 4QG8A 2ZX6A 5G1YA 2ZZ1A 2ZIDA 4W8BA 1GOXA 2WCAA 3ARTA 4CVUA 2DUAA 5IOBA 4FSAA 4WKHA 4Z1DA 3QR1A 3S6OA 2E4TA 2YW3A 1JAEA 4IPIA 3TTQA 2P3EA 3BAYA 1LLOA 2UY3A 1OD0A 1YXCA 5LHEA 4M29A 4L7ZA 3GTIA 2EPMX 2V8ZA 3EX2A 4AB4A 2E8ZA 3DGBA 2YFNA 3RU6A 1P1XA 3TC7A 1QI4A 2OFJA 4HYWA 4QP0A 1BGAA 5KMYA 4L80A 4OGZA 1X7IA 4MNKA 5RUBA 1MI3A 4MKNA 2Q01A 2DZSA 4HTYA 2BHYA 3DEQA 1JI2A 2OO0A 3BC9A 4G8TA 3U48A 2XN2A 2DZXA 3U7VA 3W1UA 2J9YA 4FOJA 1KWKA 1ODZA 3AIVA 1TRIA 4YVXA 1RAKA 4HMCA 1GOMA 1JDDA 1A5CA 3CASA 3EWDA 3C2FA 1HG3A 1E9YB 1JF6A 1DHKA 2EG7A 3STCA 5KZDA 2ZBTA 2G3JA 1CIUA 5IFPA 1IEXA 1FDJA 3ITTA 1C7TA 2OELA 3AJ7A 3TH6A 4AWSA 1FFRA 3O1NA 3UA4A 1YE4A 1DE6A 3B0VC 3EGJA 4KWWA 4IFKB 4ACZB 1PDZA 1UD6A 3WQGA 4UZUA 1V02E 1AH0A 2I14A 1AQFA 4MSSA 3AO0A 1WBJA 3BUVA 1KTBA 4KEZA 4K6AA 1MFVA 3SAZA 2VL4A 3BLEA 3GVRA 1Q6CA 3E9AA 3NDOA 4L5ZA 3WLLA 3V3WA 3IACA 2VC6A 3EWCA 3H8AA 4L6OA 4NJIA 3ZR4A 3O2LA 3N1AA 4HPHA 5A6BD 3CGTA 2OQLA 1YNQA 5FKYA 1RH9A 2QT3A 4AXNA 4NZ3A 1R47A 2BFGA 1XLDA 4GUFA 4XZNX 3RPTA 4WKFA 2OX1A 3DBNA 3BLIA 2KAUC 4HOWA 3GIQA 4TVCA 2CZFA 1X38A 4F9DA 5CZTA 1XUUA 5AZ1A 4Q4PA 4TVDA 4GUIA 1GVRA 1TV5A 4LXFA 1BEUA 3KW3A 3B4UA 5CPSA 4XD6A 4ICCX 4AFYA 2GJRA 1K8XA 2J88A 2C0AA 1VFMA 4PUNA 4MNJA 1RBOB 4L6HA 1C9DA 1S5MA 5I78A 1FWTA 2TRSA 3AHTA 4CU8A 3THCA 1ISZA 3PBMA 3IRSA 3E2RA 3EKGA 3ZSTA 1RZMA 3UNDA 3NG3A 3EOSA 2R1PA 4WKAA 4MJMA 3S6TA 5F1UA 3LHZA 1F9CA 1YEYA 4MB3A 1GTEA 2WANA 3UU0A 4AVFA 3DG7A 3ICJA 4LSBA 3SFWA 3EWWA 3ZVHB 3CL7A 4QISA 2A79A 3B04A 3T2QA 3PAOA 1EP2A 3TN6A 2BB0A 5EMMA 4RXFA 2XFWA 2V3DA 1UKPA 1TWZA 3N04A 3N12A 1GEHA 4PB3A 3W85A 3BOLA 2CITA 2GOUA 3H53A 2QJGA 4CNPA 4NAEB 4LVDA 3R25A 2YZRA 4NG3A 3UGVA 5LIKX 4CQCA 2X1SA 4M80A 1UWRA 5AOUA 4Z2JA 1WQ5A 3GQYA 2WLYA 3A22A 8TIMA 3WIJA 3P84A 2E1WA 1IIGA 4WQ6A 4Q4RA 4NZFA 1M7OA 4NY2A 2I16A 5J5DA 4REQA 4GG9A 3WFZA 2Y1HA 1LG2A 3WLMA 4AHOA 4IL0A 4QEHA 3WO8A 2PLMA 5DRCA 1HVQA 1CLVA 1BHGA 1EL3A 4GI9A 4E38A 3GXTA 1C8YA 1JPMA 5FSEC 1GTHA 3O06A 1VENA 2XPKA 1F6KA 2QCEA 1YYAA 3R4IA 3RG6A 1LTDA 4F66A 4D6DA 1IT0A 3WUEA 5AYIA 4N9CA 1FRBA 1QW9A 1PXGA 4MB5A 3QKZA 3RMEA 3IV3A 2WM1A 1FWSA 1L6WA 3CLMA 4ML9A 1ISXA 3WUBA 4CEXC 1D2KA 1X96A 4GCAA 2RUSA 2ACUA 2YL8A 2E09A 3OYZA 1A5UA 1UD2A 2Y2WA 6ALDA 3T44A 1IWAA 2HTMA 1PJ9A 3KZPA 1K8ZA 3HB9A 1NP0A 5AKQA 3GC4A 3GC5A 1J0ZA 5K2ZA 1ONEA 5EFFA 2ZXQA 3CUZA 5CXPA 3ECQA 5HBFA 1ISYA 1GG1A 4NU7A 4DLFA 1Y5VA 1NM9A 1ADOA 1W5NA 4M56A 3WD0A 2BLEA 5D2TA 2QF7A 3CTLA 1IWPA 3FOKA 3TYZA 4UNKA 1KRMA 1UJPA 3FS2A 2GSEA 1FWNA 3P93A 4PB5A 2TAAA 4B90A 4D6JA 4TV6A 4G7EA 3SW6A 3PM6A 4UMBA 4H9MA 1PO9A 1IXPA 1KFLA 4ZQNA 4ZOBA 4W7UA 1RQBA 1KV8A 1W37A 2DVXA 5DQPA 4YJ5A 4GKTA 3QV9A 4JN6A 4L9ZA 4OE7A 2HE5A 1JZ5A 5HJXA 4GC3A 4MWAD 1CLXA 3NSNA 1OJXA 2XJ7A 1FWIC 4GH3A 1QOQA 4DJDD 3N4AA 2PPGA 4F3HA 1E0TA 1FKWA 4BQ5A 4Q8MA 1XKYA 4LAKA 1GJUA 1VF8A 2WM0A 4HHPA 4DWSD 4DF1A 3IVTA 3VIFA 3P80A 4XTDA 3UXDA 3BZGA 4UR7A 3WYZA 2YW4A 4XB3A 5JU6A 4HHHA 4DM1A 4TMCA 3GSMA 5A6KA 1G4SA 3WMSA 4IIDA 2ZTJA 3RJYA 3LHTA 1WZLA 2HV5A 4HZ7A 2XZ7A 3I10A 4MJ2A 1ESWA 3T42A 1X39A 1ZLPA 4O1AA 5CLWA 3TROA 3KBSA 4NNCA 5AHLA 3TNOA 4IFRA 1OFOA 4IMAA 4GY1A 3TLLA 4EF9A 3EXRA 4S3DA 3VKJA 2VCAA 3CB8A 1Q3NA 1GOQA 3STPA 5A2BA 3THAA 2IQTA 5FF0A 2HSAA 3IARA 3H2CA 1OF8A 1B2YA 1RV8A 2QUMA 2DVUA 3GHUA 3BW2A 3CIVA 3M43A 4FXSA 4FOUA 5C55A 3RYSA 3GZAA 4U4MA 2F9RA 4PFHA 1VEOA 1U5HA 3KFTA 3BCDA 4IHCA 4F0RA 2BDQA