1ZQ5A

Crystal structure of human androgenic 17beta-hydroxysteroid dehydrogenase type 5 in complexed with a potent inhibitor em1404
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
314
Chain Sequence
b'QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPNGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
total genus 119
structure length 314
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zq5A00
4JQ3A 1AH0A 4FALA 1X98A 4LBRA 3LN3A 3LNMA 1X96A 4L1WA 3WBXA 3WCZA 3LQGA 2FZ9A 2IQDA 3S3GA 3UZWA 4XO6A 3V0UA 3R58A 2BP1A 5LIXX 3FJNA 4R9OA 4I5XA 3F7JA 1LWIA 3LQLA 2WZTA 4LAZA 4OTKA 1T40A 2PD9A 2PDGA 4PRTA 3GHUA 4ICCX 4LBSA 1MZRA 3GHSA 4DZ5A 2FVLA 4H7CA 3RX4A 2PDCA 2PDLA 3CMFA 3EAUA 1US0A 4DBSA 4JIIX 1AH4A 4EXBA 4NKCA 4HMNA 2NVCA 5HNUA 2VDGA 4JQ4A 1XGDA 5LIYX 2ISFA 2HEJA 3P2VA 3WG6A 1Z9AA 5LIUX 1AH3A 4WDTA 4H8NA 2IS7A 4XZHA 3QKZA 4IGSA 4FAMA 5LIWX 1GVEA 3LD5A 3DN5A 3T42A 4LB4A 3M64A 4Q3MA 3FX4A 3ONCA 3WBYA 4XK2A 1EL3A 4WDWA 5AZ1A 1EF3A 4LAUA 4YVPA 4PR4A 2C91A 5KETA 1EXBA 3UWEA 4DBUA 1Z3NA 4DBWA 1MI3A 3U2CA 3R8GA 1QRQA 1VP5A 1YE6A 3O3RA 2FZBA 2F38A 2PDUA 1XF0A 4QXIA 2R24A 1HQTA 1XJBA 2PDIA 4PUUA 4JTQA 3BURA 4WDUA 4YS1A 2DUXA 3BCJA 2P5NA 3O0KA 4JQ2A 4WDXA 2IPWA 3LENA 2IPFA 2F2KA 1S2CA 3G5EA 4PMJA 1HW6A 4JTDA 1AZ1A 3EB4A 2R9RA 3BV7A 4GIEA 4JIHA 1JEZA 2DUZA 2PDWA 1Z89A 4YVXA 2PDHA 2AGTA 4WEVX 3DOPA 4GQ0A 4QBXA 5HA7A 3V0TA 1RY0A 1FRBA 2FGBA 4L1XA 2INEA 3N6QA 5DANA 5M2FX 2IQ0A 1YNPA 3UZYA 1X97A 4JTCA 3V35A 2ALRA 3R43A 3CAQA 3LZ3A 1ZGDA 3H4GA 4GA8A 3UYIA 3EB3A 2PDMA 3Q65A 1PWMA 3GHTA 4XO7A 4QX4A 1S1RA 4XVDA 4MHBA 1RY8A 4AUBA 4XZIA 2ACSA 2IPGA 4JTRA 3M4HA 2ACQA 3V36A 2HE8A 3CASA 4F40A 1J96A 3UZXA 4Q7BA 5C7HA 3UGRA 3NTYA 3R7MA 1EKOA 4GCAA 2IKHA 1T41A 1YNQA 4GABA 1PZ1A 2PF8A 2PFHA 3CAVA 4FA3A 3UZZA 1ZSXA 2IKJA 3ERPA 2PDXA 3MB9A 2IKIA 5JH1A 4HBKA 4YVVA 4WGHA 4XZMX 3UP8A 4IJCA 2ACRA 1Z8AA 1RALA 1AFSA 2I17A 4JTAA 1Q13A 4PRRA 3KRBA 3R94A 3B3DA 1K8CA 3Q67A 4ZFCA 1VBJA 3VXGA 2FZ8A 4XZNX 2BGQA 3C3UA 1LQAA 3LZ5A 4LB3A 2PDBA 1R38A 2WZMA 3LUTA 4GACA 1S1PA 2PDPA 3GHRA 1M9HA 1PZ0A 1AZ2A 4GQGA 2QXWA 2INZA 2BGSA 4XAPA 1UR3M 1S2AA 2PDJA 1OG6A 2NVDA 2PDYA 1MRQA 4QR6A 3LEPA 1PYFA 3R6IA 2IKGA 2PDQA 5JH2A 2PDFA 2IPJA 4FZIA 5HNTA 2DV0A 1A80A 4JIRA 4XZLX 2PEVA 3GUGA 3RX2A 2I16A 2J8TA 3H7UA 4YU1A 1QWKA 1ZQ5A 2PDKA 4ASTA 2CLPA 3ONBA 4IJRA 3D3FA 4WRHA 2PZNA 3V0SA 2PD5A 1IHIA 1SM9A 2HVOA 4XVEA 2A79A 2FZDA 2HDJA 3CV6A 4G5DA 3BUVA 4PUWA 3WBWA 2HVNA 3M0IA 4RPQA 3UFYA 3MC5A 4JQ1A 1IEIA 2ACUA 1ADSA 2HV5A 1PWLA 4EXAA 3R8HA 3CV7A 3COTA 4JQAA 1Q5MA 3RX3A 3N2TA 2HE5A 1ZUAX 1C9WA 3H7RA 2PDNA 5AZ0A 5LIKX 3G1RA 3LBOA 3UG8A 1YE4A
chains in the Genus database with same CATH superfamily
5I79A 4ZZ9A 2O55A 1BEUA 3W71A 5HNRA 4L1WA 5AECA 4JTHA 1I2QA 1K4GA 3TP4A 4KEZA 3A47A 5BWFA 1N7KA 2PLKA 4C7GA 2XWDA 2V5JA 1O95A 4W8AA 1Z41A 4HZ6A 1H3GA 2D2JA 4DJDA 1JJKA 4L4OA 5FJTA 3NQCA 2WZTA 5CEWA 4WK9A 3PBWA 4GI4A 1B2YA 5DT5A 4MFEA 4Q8PA 1V3IA 5DCEA 5ABHA 4S3FA 3VD9A 3VD7A 4A2SA 3TMLA 1CCWB 4C7DA 2Z2BA 1FBAA 4X63A 3B8VA 1DJNA 1HUVA 3VIPA 3MW7A 1HP5A 3TWAA 4F3HA 2IQTA 1E73M 1QNPA 4GXWA 4JTIA 1YTDA 2ZZ2A 1WO2A 1E6SM 1TTIA 1X6UA 3GB6A 3KOWA 5CZ0A 1GJPA 1DJYA 4M24A 3VINA 2ISFA 5ABFB 2ZA3A 2OWXA 3TEVA 4X2PA 1Z9AA 3QHMA 2WMHA 3O15A 2Y24A 2GK1B 3CUZA 4GYFA 5CAHA 3AALA 3DYMA 4ZL1A 5LIWX 4FX6M 3QLDA 1CEOA 4PUJA 1CGTA 3C2OA 3HFTA 5BOOA 4C6KA 4FNPA 3K1GA 1RCQA 3ZT6A 1EDTA 1RQBA 2YIHA 5GNYA 2W0UA 1JYXA 3W1PA 3TAOA 4AZ7A 3LM7A 3I6EA 5JBDA 2FHCA 1MI3A 4U5IA 4YWSA 3S5OA 5AC8A 2ZOXA 3URQA 4Y96A 3BWWA 1UUQA 3RDKA 5MHBA 3MZ2A 4TIMA 3B4UA 1HQTA 1XJBA 1KFWA 2PDIA 4JTLA 4PUUA 3UNTA 2WZEA 4UQEA 1FX6A 3GDLA 1NOUA 1H5YA 3W87A 3UXKA 1DIOA 5T8GA 1WDWA 3URBA 3MV01 3FY1A 1E1CA 2P5NA 1MXSA 1OIFA 3B05A 1PJ9A 5FA5A 2A21A 5HPOA 4ES4A 1ZRQA 1KFBA 3W7HA 2WSPA 2B0MA 4AZHA 5G5IA 3W6LA 2C13A 3P84A 3BV7A 5BOFA 4Q7NA 1BSIA 2VWTA 3PTDA 3AS0A 1TJ2A 2AGTA 3A13A 3MU7A 4UMBA 2QJNA 3GAKA 4PB3A 3CS2A 4KESA 1TR1A 3LGEA 8XIMA 4WOQA 3N13A 4WY0B 2CBUA 4GISA 2QCHA 3HGRA 2QKFA 4J5NA 3NQGA 2Y7GA 2ALRA 2WVVA 1RJPA 1OY0A 4A8RA 1IIGA 1R3SA 1W91A 5IDZA 3B9NA 3FS2A 1S3HA 3WLHA 5BYWA 1XRSA 2PDMA 5IM51 1H61A 2HS8A 1OF8A 3VPLA 2NWSA 3WEMA 1VS1A 4LRTA 1A5LC 1Z42A 4XZIA 3EA3A 2KAUC 4KIRA 3K1DA 4KFOA 3H8AA 3WMCA 3GXPA 3KXQA 4LRSA 3F2BA 1VEOA 2GOKA 1V0KA 4MWAA 1KO0A 4ROPA 1U33A 3GDKA 2V5BA 3G3MA 3TIMA 3N9RA 3MV11 4NAEA 1A5BA 2JKAA 3VUSA 1EJUC 4ZXOA 1EOMA 4F2BA 3KS6A 3RPDA 3UESA 2FIQA 2IKIA 4ONVA 3W7PA 7CGTA 2ZC1A 5F1VA 4REQA 4GIYA 4W84A 1M53A 2ACRA 2G3IA 2ISVA 5BROA 2F6UA 3WK1A 5I78A 3TOPA 5DMYA 1XQKA 3LBCA 1BYDA 2QT3A 3DHPA 4L9YA 4DPPA 4O13A 1RCXB 3ZSTA 3QY8A 1WDQA 4Z1CA 2BGQA 3HGOA 4LX4A 4N4PA 3LUTA 4GACA 3WIJA 4GC3A 2HQAA 4OBTA 5EPDA 2D20A 4L6HA 1WBJA 4PTDA 6ALDA 1KQZA 3T9PA 3UPBA 3UGVA 4CQAA 3BJTA 4X2RA 3KHJA 3C0QA 3CUXA 3FVMA 2XIOA 1SW3A 2XVPA 3OVGA 4GI6A 2J6VA 4OWGA 1P7TA 4LV4A 3C5QA 1S2WA 1RBOB 3N6HA 3PZOA 3LEPA 1FWTA 3F03K 2VFEA 3R6IA 3RLUA 1NQ6A 1QNVA 4C6CA 1W5PA 1KCKA 1GHSA 4Q8MA 1U22A 3GUGA 1YPXA 2NQJA 3IK4A 3RX2A 3B8UA 4RK8A 5KTLA 4QNEA 3O2LA 4IQEA 3ME3A 3ARWA 1SFLA 3NA8A 4AYSA 1AD4A 5B7ZA 3N3MA 1TTPA 3QY6A 3ZLHA 3KVJA 4F8XA 1RJQA 4DZIA 3DXIA 3GTIA 3N11A 3AWOA 1I0BA 3T0BA 4C6FA 1UWUA 2XN1A 2X1IA 4IIHA 3WBWA 3U6WA 1GQJA 5FL0A 4F0RA 2ISDA 5XIAA 3I7QA 4CGTA 3G1YA 1VH7A 3WK3A 1CGYA 2XM1A 3GTHA 2O0TA 2V0TA 1OD8A 2WSKA 4KEMA 3T7VA 2R14A 1XFCA 3ABRA 4PBGA 2J7GA 3OZMA 1L2UA 1KW1A 5LIKX 3G1RA 1C7SA 4FNQA 1UD8A 3CPGA 3P67A 3WQ4A 2BY1A 4GVIA 1YHTA 3STFA 1D7KA 2VMFA 1KXQA 1QWGA 4R7OA 1CIUA 1OABA 4R27A 3CZKA 3LXCA 3P93A 2PWGA 2GDVA 1US3A 2RKXA 3MUY1 1CX9A 5EBUA 2HZGA 1GW9A 4PMXA 1BG9A 1OZMA 3C0LA 1XDLA 1IT8A 4JFUA 3NXLA 1E55A 5EKYA 4MDOA 3SCPA 2JF6A 3TC7A 5F2IA 1K02A 2NX3A 1M3UA 1R87A 1G6CA 4JFTA 1IIHA 5D9NA 3SIMA 3WMBA 4BQ4A 3NQ6A 5CPLA 2BTMA 5LXXA 2V68A 2C15A 5AFDA 4GYPA 2ZE0A 3C61A 4KRZA 3WL0A 3LRLA 1CYGA 1WZLA 4O8AA 1TJPA 2HEJA 4JTEA 4N42A 3QC3A 3IRSA 2VD9A 1FWIC 4H3DA 3S6OA 1YEYA 3KAOA 1YDNA 3UA4A 4BKNA 3UVIA 1CGVA 3N4FA 1KM1A 4HCHA 3MKVA 2Q8XA 1HGWA 2VFHA 1PKLA 4EWJA 1L8NA 2PCQA 3FKKA 3N4AA 1JAKA 4IMGA 3A3HA 3IUDA 2GVYA 1M65A 1MYRA 4GZEA 5CSSA 3LK6A 4ECLA 2ABAA 3AIBA 3ARZA 5LNRA 4UOJA 1HKWA 4G7FA 4UTKA 1KR0A 3ALFA 2TAAA 3DYOA 1EC7A 4A8IA 5A95A 4DYKA 2J78A 1IGSA 4LJ3A 3MI6A 3O0KA 4YXGA 2YFNA 2Q02A 3GDRA 2Y5SA 2OX1A 4F48A 4IXXA 1DEDA 4RPPA 4Q6JA 5DXYA 1O5XA 1P6WA 3MANA 4GXMA 4DVOA 2R9RA 3ZSSA 5CG0A 3DKLA 4RZ4A 3CO4A 4DYEA 4YHGA 4RV8A 4WCJA 3HV9A 4KMQA 4PBEA 1QPKA 4I7VA 2RHGA 4L61A 1EBGA 4GNJA 1Z89A 4YVXA 3WD0A 4NNCA 3NPWA 8RUCA 2OO6A 1YXYA 1VFFA 3V0TA 2X0SA 4YTUA 4HD5A 4U3AA 2FHBA 3W53A 1PTDA 1LOLA 2BS9A 4LV9A 2WMGA 2B7QA 3GU2A 1QBAA 5D02A 3R43A 4S1FA 4N9BA 4TO8A 3CZLA 3LZ3A 1P4CA 4PN2A 3L66A 4MADA 4E38A 4PB4A 3PG9A 3RUBL 2OU4A 3EB3A 2I1OA 4JBRA 3KOYA 5CG7A 4JCLA 3U5YA 1BWKA 3EWWA 5FJUA 3S5NA 1OFOA 5L6UA 1TE6A 4FR6A 4W5UA 1TFVA 3F4NA 2ODOA 3KCJA 3CYJA 4M19A 2QEZA 3W75A 3VGHA 3RU8X 4B5SA 1HNYA 3UWYA 1J01A 2J4GA 2E6FA 3G0UA 4XD6A 3M0LA 3BG5A 1XWYA 1Q7QA 5CGTA 2JKEA 3I4EA 3IIZA 1V3JA 3B8WA 3PN8A 3M1ZA 3HQ1A 1CGWA 4IQDA 3ARYA 3CAVA 1O68A 3GIPA 4F2UA 3HMCA 3OG3A 5FI8A 4YVVA 2CBVA 3TZNA 4IJCA 1EC8A 3VDCA 4E4FA 3DYPA 4K37A 1R9YA 1TVPA 3OJGA 4O1BA 2Q3OA 4CD4A 5HWJA 1I75A 1WYIA 2I57A 1XBZA 2FZ8A 4FO4A 2CLLA 1TRIA 3BLPX 1TTQA 1KRBC 3V75A 1EO5A 2AGKA 4LB3A 3PJXA 4J3TA 3H22A 1W17A 1R38A 1Y5VA 4OOZA 1ZJHA 2YSWA 2DT0A 1QNQA 3UWWA 2V69A 1C7TA 1D3HA 3O16A 2FPVA 3LS9A 4XB3A 4BY3A 3C86A 1F9CA 4TX6A 3BW3A 2OXNA 3A22A 4RCXA 1FH7A 2HBXA 4A3QA 1E1FA 2CWNA 4US5A 4FOKA 2X30A 2QLYA 2NSOA 4HMEA 4B15A 4ADUA 1IF2A 3EDKA 1ADDA 2QULA 2C7FA 2GUUA 3WD4A 4C6BA 4N7QA 2DSVA 4I6KA 1JFXA 4OBSA 2BZNA 1ZBVA 4N02A 2PUZA 2J88A 3L4WA 1AG1O 1FHVA 4IZGA 2XVNA 1MEWA 3YPIA 1WDDA 1X1NA 4QRNA 1TJ1A 1TIWA 2WMKA 3UT0A 4P5UA 3REQA 3AMDA 3SI9A 5CGMA 4L64A 3DHDA 4DO6A 3T40A 3NOYA 2DVTA 4EIVA 2BG5A 2OEMA 3QV7A 1SZGA 3CV2A 3ITOA 3B0VC 2VX5A 4O28A 1R3WA 3FEQA 2GPTA 4ILSA 3BUVA 4PUWA 4NILA 3TW6A 1IYXA 1P0EA 1A50A 1UR2A 3KHDA 3TTOA 3GVGA 2QCEA 1DJZA 3TH6A 2XSAA 2BHUA 1HJWA 1LORA 1BLIA 1MQRA 5E70A 2O7SA 2BFGA 2PRHA 1E71M 5LGZA 1W9DM 4GFSA 1D8WA 1CXIA 4LUSB 3VABA 2R1NA 1AH0A 1GQNA 4MWAE 1Q6RA 2QF7A 2POZA 4CLMA 4R34A 1PBGA 5FJIA 4GY7A 3E2SA 2HBVA 4P2VA 3W02A 1GOMA 5ABEA 3R58A 3KS5A 1Q63A 4WF7A 4S3JA 5LIXX 1GORA 2XPKA 2Y5EA 4AVOA 3OYZA 3F7JA 3CHDA 2EF9A 4O1AA 2ATSA 3CC1A 1U5JA 1XCXA 4GX8A 3WLLA 3GHUA 1EP2A 1TCDA 1XC6A 3QMTA 1LRTA 4UR8A 1OZQA 3BMWA 2G0WA 2QDHA 3HG3A 4MG4A 2O92A 1WOAA 4I9JA 2WMIB 1DKWA 4ICCX 1MZRA 1GK8A 3PUOA 3VNLA 1XIMA 1UC5A 1EQPA 5FIPA 4MYAA 4JS3A 3ZQ9A 2GUYA 1K1DA 2Z6IA 1AH4A 3CNYA 4KCTA 4AG0A 2PSNA 1XSJA 3GDMA 5D2WA 2WHKA 3KRUA 3EX3A 1U1HA 3P6LA 4H19A 3WUEA 3S1VA 3N18A 2GVJA 4E2BA 3WMLA 2QNEA 3VIJA 4H6KA 4I8YA 1FCVA 3N14A 4H4IA 3NYZA 4M0XA 4O4WA 3V5OA 4ZMGA 4JTGA 4CQCA 1QNOA 3LI0A 3FX4A 3OOQA 2TPSA 2QCDA 2P10A 1EL3A 1YPIA 3U2OA 4NP7A 1XR2A 2X1UA 3UJRA 4C6IA 3TQVA 3S42A 3UWEA 3ZS4A 1M01A 2NV1A 4GYKA 4TQTA 5I0DA 4A3UA 2CNCA 1VP5A 1QFEA 3M0ZA 1KKRA 4PMZA 2VCAA 1XF0A 1M7PA 3HG5A 4H9VA 4FNSA 1Q45A 4JKLA 1FWFC 1UZ4A 1R3RA 1X8FA 2QUVA 3EEZA 5C2XA 3CWHA 3K2GA 4LC8A 4WJ8A 3G8EA 7A3HA 4XTIA 1HJVA 1FH9A 3WDIA 1H7WA 4HZ8A 3MY9A 4X22A 3UWZA 1BTMA 3TQKA 4WSKA 4DWDA 1AZ1A 2YBTA 4AD2A 4UMCA 4K68A 3WFZA 1V6XA 3UY8A 3IV3A 3DG3A 3F2CA 4GI9A 3W82A 2J25A 4QG8A 5JIWA 1UA3A 3FFSA 4DJFD 4PYSA 1FHLA 2EKGA 3GIYA 1TPDA 1J6PA 2YB1A 4NUWA 2OODA 3UD6A 3U2ZA 1A3XA 3IWPA 2PGEA 3QTPA 1FXQA 4GQBA 4E3VA 1XLGA 4URIA 1X97A 2CLHA 3WLPA 4J3ZA 3V16A 2ZUNA 1ZGDA 3MJMA 1LJYA 7ENLA 5CC7A 1AODA 1XYBA 1A47A 1AA1B 4M8UA 4GWEA 3HN3A 1GOKA 3G22A 4JHOA 5CC5A 4F0LA 1BYCA 1LL6A 2VP8A 1S1RA 1NFGA 3MP3A 5K4XA 3WD3A 2BXZA 2WM0A 5HUPA 4LU0A 5HINA 3M4HA 3TONA 1PUDA 2G3JA 3WO8A 1A5KC 3HG2A 4GYPC 4NZJA 1MUCA 3O06A 4MTVA 5KEZA 3VCNA 4I90A 4KRUA 4LVDA 2CZDA 1XIFA 1BSLA 4IPIA 4S3KA 1RV8A 3RN6A 4B3KA 3N3TA 4LYKA 1WZMA 3FYPA 4HBKA 1KFLA 3P81A 1ZAHA 1JGIA 3QGAC 1VRDA 4Y8EA 2Z26A 3T44A 3TYBA 3ZVHA 2E5BA 1XLBA 2FPTA 1K8CA 1FHUA 2Y7FA 4K1WA 1EOKA 5KZ6A 3LCIA 3H23A 4M1RA 1WKEA 1NWSA 2VCBA 4QFUA 3ITYA 2QV5A 1S1PA 1PV8A 5AOUA 4DLMA 4Q8OA 2DY3A 1PZ0A 1XIJA 2XISA 5HMSA 1W3IA 3AMGA 3TOYA 2XZ9A 1EH9A 2BGSA 1B31A 4CUCA 5EMMA 1JYWA 1C29A 3NSMA 3G1SA 2JGYA 1E6XM 4QR6A 5CSYA 2WVTA 1HX0A 4PCFA 3CQIA 1XYZA 2PDFA 1JCTA 4HJFA 1EB3A 4JY9A 1A80A 4XZLX 4ZO7A 2GWGA 3RJYA 1PEZA 1M1BA 2YA1A 1JZ4A 1TX2A 2VHLA 4HKPA 1RSCA 4GNKB 3QRHA 5L9FA 4G2DA 4ZQCA 3UJSA 1KM5A 3ABSA 4H01A 5IFTA 1SO6A 4HHHA 4GJIA 1SZRA 1T0OA 3BCDA 1K7XA 3KDOA 4MLRA 2Z1BA 4IIBA 4BEUA 1MW2A 5LA2A 5A6AA 1J0ZA 1U2YA 2VELA 3IIOA 3M0IA 4NZ4A 4DYJA 3M6YA 4LPCA 1H0IA 3RILA 4RNHA 4DXVA 5AHNA 3VCRA 1XYMA 4LWWA 3LPFA 2NVAA 4EXAA 3R4IA 2FZNA 3RGTA 1UKOA 4A21A 4O1CA 2J8GA 5I00A 3GS6A 2PBOA 2J77A 3AZRA 3MVTA 2AKZA 1DQWA 5BRQA 3C0JA 3T8QA 4XZ9A 1YE4A 1FWGC 1T5AA 3STEA 1Q6OA 4LALA 3ZM8A 2BVDA 4XKYA 2IQDA 1ECQA 4O52A 2GK1A 1DJWA 4GXPA 2NSXA 2DT1A 4ADTA 2BP1A 3E0VA 5FF2A 5HPCA 4ZA0A 2ANUA 2H6RA 3JUGA 4AEFA 4NAFB 2WK2A 1SMAA 1VAHA 3IGXA 2YLAA 3QKEA 3RO6A 3SAZA 1UWQA 4DB7A 1N55A 1BGAA 3EX4A 3UPWA 2H3DA 4PMRA 3DECA 1E70M 4O11A 5REQA 3EDFA 4ERGA 1CXEA 3IANA 3QF0A 1W2VA 2FMNA 3WELA 2NVCA 3E0WA 5HNUA 4JQ4A 5D4YA 5E6ZA 1N8FA 4B5XA 1V3LA 3B04A 1N82A 3P2VA 4JEJA 2YXXA 3L67A 3BAYA 3WK0A 3NZ1A 1TWIA 1VEPA 1Z69A 2IS7A 4HTBA 3AZSA 3ENLA 4C6MA 2YBVA 1TV3A 4IGSA 4H7ZA 3S6DA 1KV5A 3VILA 4WXYA 3QYSA 4P8WA 2Y7EA 3M64A 1F61A 4AXNA 3ONCA 1OJXA 1ISXA 3ARUA 4GIRA 4UZUA 1FFRA 1ME9A 4M6PA 4PR4A 3AIVA 2PWVA 2Z27A 3O6CA 1Z3NA 3EMQA 3INPA 1MW3A 2O7QA 3T2PA 1E9YB 3DFSA 4PTNA 1W8GA 3MUZ1 2PDUA 4R85A 1LG1A 1VJSA 2RDXA 4JXCA 3W7KA 1K8ZA 1H1YA 3M0XA 4MNJA 3LDVA 3RXZA 1GUVA 1XCWA 1G94A 3ALGA 4UXDA 4Q4PA 1RA5A 5C6MA 1S2CA 2J7DA 1H5VA 1ELSA 5D04C 4JTDA 3N9KA 1D2KA 1SW0A 2OO0A 1VF8A 1GVSA 2PB1A 3M5YA 5A6BA 1K77A 1IXNA 3MMUA 4GIEA 4K2SA 4NYYA 2PDWA 3QSTA 2PDHA 1NDZA 2QMKA 4HPNA 1V02E 2QQ6A 1S46A 2VDHA 3PB0A 3NL5A 3P82A 3TTQA 3ZR4A 4PCSA 3LG3A 4QITA 5MKGA 1Q6LA 1PKYA 1VPXA 4ZFMA 1RY0A 1CBGA 4B91A 2VKZG 2PZ0A 2DFAA 4QQUA 1PIGA 1T8QA 1R86A 2J7FA 4Z08A 4GO8A 1WX0A 4XUYA 3SCUA 3W29A 3BH4A 3GR4A 1XFBA 3EWYA 4C60A 3PBGA 2ZXDA 3MCNA 4AXKA 3GC5A 2EG8A 1I2NA 5IXEA 5CSUA 3KBJA 3HTWA 3OHMB 3UXIA 1RHCA 1XG4A 2NUXA 3LV5A 1OX4A 3TN6A 1NF0A 2CEQA 2REQA 5BMWA 4MNMA 3AMLA 1DWIM 4NAEB 1MW0A 1E1EA 5C8BB 2OWWA 4GI8A 5XIMA 3KVLA 4POCA 1ME7A 3QPZA 1BQGA 3AZTA 1TPWA 4PCPA 2YYTA 1TVNA 2IXVA 4FXRA 4WJEA 1V6TA 2QDDA 4L5ZA 1H60A 4HU3A 5EFDA 1QCWA 3P0WA 8A3HA 4Y9NA 4ZO6A 3F1QA 2GDQA 5DMLA 2BNJA 2VNCA 3AHVA 1S5WA 4XZNX 4GZ7A 2PS2A 3RPTA 5I3DA 4CD5A 4Z2KA 5CZTA 2PDBA 4GUGA 1UPPA 3SSZA 4O1EA 2GVGA 1LRNA 4FXSA 3SECA 5JQ9A 1TREA 3CPRA 3OHIA 4JNMA 1JDCA 1X38A 4CCEA 5I03A 4YCPA 4MY9A 3TTYA 2X1SA 3EWCA 1V3KA 4WXZA 4QGCA 1H0GA 2J7HA 4V15A 5F4WA 1SJAA 4M81A 4TX9A 1UWRA 3MKCA 1OSEA 1TV2A 2DP3A 1JCYA 3TC6A 2FPYA 4UTIA 2I7GA 2WNZA 1F5ZA 4Z1BA 2Z6JA 1ITCA 2C0AA 2BXYA 3TMQA 1VFUA 4OECA 1S5MA 3LHWA 3UZJA 3L7RA 1PAMA 4IP7A 4IP4A 1BAGA 1EPXA 4W8LA 2ZZ3A 4HGXA 4AIEA 4RNFA 1OT2A 3KP1A 2P76A 4O16A 1RQHA 4ERIA 3MCOA 1XIIA 1I2OA 2MANA 4DO4A 4GUHA 2PI6A 3RCYA 4RUBA 4RE0A 3UR7A 3UR5A 1XG3A 1FFQA 2TYSA 3D5HA 4HQVA 1KXHA 3GLCA 1ME8A 3SY8A 3H2OA 3FIGA 4MUZA 1GZ1A 4S3GA 5KSWA 4H8UA 5K9CA 3EXSA 2ADAA 3P60A 2HXTA 4US5D 5H91A 4J3WA 4EPEC 3UU0A 1I4NA 2YGYA 3E0IA 5LNVA 5BMXA 3CL6A 2W3ZA 7ODCA 3UG8A 1JDDA 2G95A 4JQ3A 3PZ9A 4XBSA 2J9YA 1EUNA 3GIQA 4YYCA 2PRLA 4DEFA 3AS2A 4IPNB 2OQYA 1S5TA 4HOXA 4YWIA 1QBBA 4HYWA 4H83A 2R94A 4MYXA 9RUBA 2VM8A 4KKXA 2WMJA 3VZXA 4O57A 2HK1A 2CWXA 2GQ3A 4QE5A 3PAJA 4P7QA 3GG8A 5FSDC 3RK8A 3S1WA 1W5OA 4NAFA 4CVUA 2E1WA 4FB7A 1K6AA 1V7YA 2E5CA 1QAPA 1ALDA 4QDMA 4A22A 3NOEA 1VYSX 3VGGA 3NDYA 2EAWA 4PUKA 5JMUA 3IAPA 1W1ZA 1ZZMA 5GVJA 5FF0A 1Q6QA 3TXZA 4Y9MA 2Z28A 3CH0A 4PEEA 3M0YA 3S83A 3N34A 4AU0A 4DHGA 1QDSA 1GZGA 4AD1A 4L7ZA 4S2CA 3GNRA 5EA9A 4BQ3A 1J12A 3AXXA 1NIUA 4M7TA 5DQPA 1LUCB 4IMAA 1CI1A 4Z2GA 1CXHA 3BLDA 3MUCA 4QNWA 4JEQA 2YZ5A 1BQCA 3UCQA 3PTKA 5DCBA 4X0NA 3HQPA 3WBYA 4C6NA 1EDQA 2YR1A 1AMKA 3QSRA 2ZC8A 3I65A 5AZ1A 1RJRA 3VIMA 1OFQA 1UR0A 1ISWA 1G4TA 4R53A 2EXOA 2FQIA 4I5RA 1QVBA 1JQXA 1KCXA 1BXNA 2WM1A 4WKAA 3TQ0A 1TJRA 3R8GA 4DBDA 1TPFA 2VX6A 3PR2A 4CEXC 1H50A 5CPNA 4AEOA 1WZKA 1KTNA 5LNWA 1VFTA 1LT7A 3OU8A 3RAOA 4JTQA 1F3EA 3HG4A 2C1GA 4MY8A 3OZPA 2TRSA 4J3SA 1N8IA 2ZUWA 1GVYA 4BEQA 1B57A 3UPMA 1RUSA 4OZOA 3P5ZA 2F2KA 1Q6FA 3GZAA 3BMXA 4N0RA 4YTQA 1EP1A 1HKKA 4MJZA 1HKMA 1EJSC 4DF0A 2P3EA 4CU6A 4GFIA 3QPYA 1ZAIA 1UD3A 3GVRA 1H51A 1G4EA 1K6WA 2FFIA 1H7XA 1O1HA 4NASA 3V1HA 4QDPA 3NM3A 3BLIA 2RJHA 1LOQA 1ODZA 1XH2A 2GVEA 3VIIA 2VC7A 1BF6A 1PX4A 3MDUA 1NJJA 2INEA 2V5KA 3H54A 3OBAA 1DQXA 3E6EA 1B5TA 4S3EA 3ZT5A 4LQ1A 3WLRA 5EYWA 4I7WA 2QGYA 2W4XA 3MA8A 3QLLA 3GXNA 3AC0A 5CXPA 3V1PA 5EU9A 3TWBA 4GCXA 3ZIZA 3WQPA 3GHTA 3G1XA 1XLEA 1GEHA 3TYEA 2PMQA 4E4UA 1OGSA 3NZPA 5A5WA 1F05A 1FDZA 4XVDA 4IFKA 2YLLA 1UUOA 1DIDA 2E7FA 2ACSA 3V36A 3VOJA 4F40A 2WNQA 3SR7A 1DQUA 3UZXA 4PMVA 4A3YA 5FOOA 2E6YA 3B9EA 3ZWTA 4XIAA 3UJEA 2DIEA 3B03A 3PUEA 2FMOA 4IFKB 1AQ0A 2Z2AA 4MZ1A 5JH1A 2WV8A 1E6RA 1O1ZA 3MSRA 5C70A 2D73A 1DJXA 3SIZA 3KRBA 4FXJA 3A24A 2BXVA 4K39A 3UWQA 1YXDA 1VHNA 2V3GA 3Q67A 4KS0A 3THUA 4DWSB 1NVMA 3KW3A 4XD3A 3D47A 1JPHA 5C71A 4XWUA 3ZR5A 2MNRA 1LQAA 4AZ5A 1MO0A 1O5KA 3HURA 2A7NA 2BOEX 1WUFA 2Y7DA 1HL9A 4WOZA 3SRHA 1XLKA 3TSMA 1HO1A 1UROA 1AZ2A 4J2PA 1V4YA 2FYMA 3EWUA 2JALA 3WQ6A 4CD7A 4O17A 1VJIA 2H8ZA 2W91A 1E6QM 2PDYA 3SCNA 4GJJA 5A8MA 4PMNA 5BU6A 2IKGA 3U7BA 4NZ3A 1WE5A 5HNTA 1G9HA 3E0LA 2QW5A 2PEVA 1ZJAA 3I3EA 3QHNA 4G6CA 2DZXA 3W26A 2Q8LA 2Y4SA 1V51A 2GSHA 3DFOA 4JFWA 5ECUA 2XZ7A 3A6OA 3CU2A 5CPMA 3ZVIA 1XH1A 4O18A 1YYAA 3FXYA 4AEEA 1TE1A 4MNLA 4GNVA 4GKTA 3V0SA 2PD5A 4FXFA 1J5SA 1EHAA 4NZFA 3V7PA 1SM9A 3IGUA 3ARPA 4H9ZA 5HJLA 1FY6A 5FEPA 4XVEA 1DPMA 1G5AA 2OYKA 2HDJA 1XI3A 3GYCA 4RPQA 2QCGA 1TV8A 3EOOA 1RBAA 3EMCA 4MM1A 4Q4RA 1LZOA 3HF3A 1A0CA 3SJ3A 2Z4GA 4IPJA 5A6JA 4M6QA 4S3AA 2PLJA 5TF0A 1UZDA 3BXWA 2YCJA 4HIBA 2FVMA 1GKPA 3NQFA 3N2TA 3G3DA 3LTYA 1J2BA 1DYSA 1YDVA 5E0CA 1LLZA 2CERA 4IMCA 4DWSD 5H1WA 2CLMA 3LBOA 4AX6A 2PC8A 4GBUA 1H7RA 3WDJA 1R2SA 3N15A 4MMWA 2ZRWA 2QV4A 4EAMA 4H7VA 3CHVA 2HNHA 3WBXA 2G5WA 1W5QA 3W2JA 4ZOAA 3GKAA 2WKGA 2P0IA 4RDVA 4B5VA 1NU5A 2QMJA 1LWHA 2AL1A 3T81A 4Z17A 4KWUA 1JZ8A 1LL7A 4XBKA 3VA8A 4AIOA 4U10A 3BAKA 3QQ1A 1MXDA 3SBFA 1SJDA 4ZSTA 3PJWA 1QT1A 4NNBA 2GGHA 1YPFA 4OTKA 2VX4A 4AY7A 1OFBA 3FCPA 1JYVA 1AK5A 1Z7AA 4UFJA 3GVVA 3KE0A 1GOWA 4A3HA 6PTDA 3GHSA 2YL9A 2A3HA 4GY1A 4P61A 3S9IA 3MPGA 2V3DA 2PDCA 6CGTA 1QO2A 3KCLA 2X41A 4ADSA 2XFFA 3QH2A 5AHIA 3ITCA 4QSFA 2VEKA 5CBBA 3DDMA 4F4RA 4TV5A 4RR4A 3QJAA 1JDEA 3OW1A 5KZDA 1B4KA 1TMLA 3TDFA 2WSYA 1IT0A 2R1MA 3OVQA 2QJMA 2ZX7A 3E96A 5FJJA 3SURA 4LYPA 2NQ5A 2TSYA 5CJMA 2VC6A 1GVEA 3KL0A 1JCLA 5H2ZA 4ALDA 4Q3MA 2OT0A 1PIIA 4DF1A 3JW7A 1C93A 3W7IA 5BNKA 1QOQA 4MAZA 4ZGYA 3VI2A 3TR9A 3M47A 2XFYA 4HVXA 2XGBA 1PZ3A 2XN0A 2VZVA 2C91A 2GVLA 4HA4A 3TW7A 2Z1XA 1UP2A 4C7FA 4J9JA 4PL1A 4FS9A 1YE6A 1KRCC 2UZ9A 3VKCA 2WSQA 4JKMA 1SW7A 4PUDA 4D2JA 1LQ0A 4W4QA 1W5MA 1FCQA 3MSYA 2RGLA 3OO2A 4PTMA 5LA1A 1A0EA 3MBFA 3N2OA 4X0VA 3VGFA 4KPLA 3TNBA 5ABFA 1B3VA 2QAPA 1BWLA 3KWXA 2PP3A 2Y70A 4Q8UA 1EA0A 4WDXA 3WEZA 4MZYA 1HJQA 4MUPA 2AOSA 3SCQA 1I2RA 4IFRA 3H2FA 3QGVA 4JOMA 1LBFA 5CSRA 2RGMA 3WJZA 3W2NA 3D6NA 1DOSA 3NVTA 2EQDA 1CXFA 4ZQOA 1ZCOA 4WEVX 2WQDA 2ZRXA 4FOUA 4ZR8A 3W7DA 4GRSA 1H63A 4M29A 1J0KA 2PLCA 1EX5A 4RE3A 2CHNA 3U4FA 1YNPA 1NWTA 2PTYA 2A6LA 3GQYA 2A0NA 1F6YA 2YYUA 2EPNA 4HNCA 4O50A 1F73A 3GO2A 2VRQA 3VGEA 3RJXA 4HCLA 4N4QA 1SSGA 4NZ1A 1I45A 3L0KA 3V5CA 1QXLA 2VVNA 3K8LA 4FMVA 3W1QA 1TZ9A 3CWNA 3II1A 3KLLA 1E4NA 3B06A 2ACQA 4R33A 1YMYA 3DI0A 4CN4A 1V0MA 3FEMA 6REQA 1K9FA 3CT2A 1TQJA 1XSIA 3W76A 4H41A 4E2OA 4O19A 3DUGA 1F2JA 3TR2A 4HK7A 4HPGA 1KCLA 2WCAA 3CQJA 2CPUA 3FDGA 1HL8A 3NIYA 3O1NA 4Z2IA 3NO5A 2XH0A 4DIAA 2RAGA 2P8BA 5G2IA 1DIEA 1S38A 4XISA 4AVFA 5E9AA 1Z8AA 3SCOA 1Q13A 3S6TA 3P62A 3TZFA 3TN5A 3VIOA 1TV4A 3SN0A 2EJAA 4O4VA 1QMLA 4H9YA 5TNVA 1LQ2A 1XS2A 4K6AA 3GC2A 3CQ0A 1QI4A 4JFSA 4JTJA 4HHPA 4A35A 5I02A 3V5FA 1Y65A 4EF9A 4PA8A 2BVWA 5DXXA 4IX2A 5I3JA 1RD6A 5IRPA 2XH7A 2C1HA 3WUBA 1F8MA 4MWAB 4C6OA 3M44A 4BQ2A 3F5JA 1FWJC 3N29A 1AW1A 1EIXA 5HUOA 3LHVA 4GZJA 3BL3A 5D9MA 1E15A 4Q6XA 2RJGA 1LBMA 1KM2A 1XIEA 1LCOA 3T4CA 1XD1A 3ARVA 5AHFA 2UV8G 3F5LA 1DWJM 1I0DA 1KBJA 4JIRA 3H26A 1TPVA 1FCUA 1SZEA 1VRXA 4BI6A 1PDYA 3WQOA 3H7UA 3W1LA 3W7GA 1ZQ5A 2RH9A 3FGCB 4KH2A 3G1VA 2ZA2A 3HGJA 3OQEA 3KBVA 2ZBTA 1MNZA 4DAFA 1CPUA 5BXSA 1KBKA 3FLUA 4J3VA 4L56A 4UC5A 1IE7C 5A6MA 1FXPA 1IZJA 2ZXAA 3SUUA 2NV2A 1GJUA 4J7RA 5DCDA 4QJ5B 4JQ1A 3G0XA 1GVFA 3PC0A 4B2DD 1F74A 4DO5A 1YDYA 1R3VA 2C3ZA 2OFJA 4EPBC 3ANYA 2NQLA 5CPQA 3WYZA 1NARA 1Q4NX 2QUUA 5CGQA 1P0DA 4IF2A 4DNMA 1ZAJA 4FPSA 3THCA 3VO0A 2WO5A 3CJPA 2CLKA 1C91A 4A8LA 3A4WA 4CNOA 1KBIA 3UZ5A 3LN3A 3LNMA 3N4EA 2ABBA 2E6AA 2C18A 4QEEA 2FGZA 3AUJA 2INFA 3KL5A 2XU2A 1VIZA 3MMDA 4UTWC 1V5XA 4KW2A 1VENA 4E2VA 1E43A 2FGLA 3P8JA 1IXPA 3S9YA 4TXEA 3CO8A 1QPRA 3H2AA 1TUXA 3QZ6A 1VD6A 3QR3A 1PIFA 3IJ8A 1EGMA 2I14A 3FGCA 4LBSA 3BTNA 2WSRA 3ZLFA 2W66A 5CJNA 2L5HA 3CPUA 5A2CA 4G8TA 5DX7A 4JR5A 2GLKA 2BX7A 1RP9A 2A3EA 3WQFA 4Z0SA 4LY8A 3WEOA 4EXBA 4HMNA 3W24A 1NWUA 1R2TA 3S0CA 1OHLA 2QUNA 1JFHA 4J35A 4Q32A 4GINA 2EG6A 1REQB 4LUTB 5E0KA 2YDSA 3WY1A 5LKYA 1CLVA 4AQLA 3LXBA 3AWNA 4LAKA 1KBLA 1AD1A 5C55A 4ORIA 3S2LA 1EWEA 1FWEC 1DWGM 5GJNA 5IBXA 3PPGA 4UTFA 2DGAA 3PNUA 3WBAA 3LX9A 1EA9C 1BRLA 3V3WA 2RDTA 3CZEA 3SZ8A 3NPXA 1FWRA 3WLNA 1TX0A 3AI0A 4Q4MA 2DU2A 4LAUA 4YVPA 1L6SA 2E40A 2G37A 1G4PA 1LUCA 2C71A 6XIMA 4AIBA 3PTMA 2CXGA 2OT1A 1QRQA 4B3ZA 2VR5A 1TWDA 2PCEA 2E68A 1BYBA 4QXIA 4FP1A 2AQVA 1L6FA 1Q8JA 2J74A 3MYPA 1KWKA 3SCSA 1XYFA 1XBYA 1IEQA 3ZJ8A 3SUSA 1V93A 1DTNA 4A3RA 1EFZA 3KBNA 5F2LA 5FJOA 5DRCA 2IPWA 3LHYA 2HS6A 4LFYA 3SCWA 3CIVA 2W27A 2ZRUA 2PC4A 2WNNA 4LNYA 4REQB 1DWHM 2QCNA 3BV4A 4JX5A 1X1OA 4ICNA 2FZMA 3ZLGA 4LC6A 3E2QA 1QI2A 2W9MA 4S3CA 1W3HA 2H8XA 3G24A 1H4PA 3GTFA 3IIVA 3A12A 4DXKA 5DANA 3EOSA 3WUFA 1IZKA 3R11A 4CCZA 1XKYA 4F79A 3U3HA 2NT0A 1H09A 3G1FA 1WA3A 4JIQA 3TFXA 3TXVA 1UWTA 4QX4A 1M5WA 4XUGA 5AY7A 4MHBA 4S3BA 4XSMA 2OQHA 1TMQA 4JDYA 3VFLA 4B92A 3CTLA 5C7HA 2J9ZA 3CUJA 4PUEA 2VYOA 3FW6A 1UIOA 3A4JA 5DMNA 1IT7A 4NYUA 2CZ5A 1DXIA 5DFAA 3AXIA 2GGGA 3GBDA 3NEVA 1KLZA 1GQKA 4NRRA 4RDYA 2PWFA 4BFAA 4AIUA 3WLMA 3MB9A 5FJRA 1FKWA 5A3HA 3CLMA 3IJQA 4XG1A 4GH1A 3G2GA 4OUEA 4WGXA 1XLLA 2E09A 3NR0A 3UXDA 3B3DA 4CVWA 3VIFA 4DLFA 3EX1A 2WYSA 3ZZ1A 1OK6A 1UD6A 6XIAA 3N6JA 4PULA 4LANA 1JUBA 3LZ5A 1NDWA 1W2PA 4KWVA 3JRKA 3VDAA 4LYQA 3S2JA 1PKNA 2UWFA 4G7EA 1GPFA 4Q4OA 5FEZA 4EXQA 5HWNA 3B0PA 3S5ZA 5AHMA 1B1YA 1DV7A 4AX7A 5M3WA 3KZSA 1FP9A 2WZHA 3ATYA 4DJEC 5AB3A 4AZ6A 1B54A 4PC8A 5GPRA 3IAQA 3WH7A 3CHFA 1OYCA 4E8CA 1UR3M 5FEWA 4MKNA 3CTTA 3KOZA 1OG6A 1VC4A 4NJHA 3WD2A 5IHRA 3BICA 1HTIA 3UG5A 5JBFA 2CESA 4DN1A 4IWWA 1Q65A 3OIXA 2Y8KA 2W92A 3ES7A 2CLEA 1RLCL 3UBPC 2IPJA 3IJIA 2AAAA 3F2DA 3DESA 2OTDA 3BSMA 3POCA 5LZLA 3NSXA 2DT3A 3O9NA 5A6BD 3MHFA 4C6LA 5A6KA 3RLGA 5KITA 4P8VA 1K7FA 4L65A 4MJ4A 2XVKA 4KWOA 2XM2A 1MWOA 2G3FA 3D46A 4WRHA 2PZNA 3WLSA 4AD3A 2NXGA 1QJWA 3ZT7A 1W1B1 2VEPA 3KZPA 1BG4A 3UVAA 3WJXA 4H6QA 2E6DA 4KEVA 4JHMA 2J24A 3LI1A 3WNMA 1VJZA 1EQCA 2E25A 2E67A 1U5VA 3I3DA 3OP2A 3UFYA 1F76A 3CL7A 2Z2UA 4MWAC 4UCFA 3LM3A 5DY2A 1QI5A 2ESCA 2HV5A 1PWLA 3DC0A 1K7EA 2PWEA 3W25A 3QXBA 3R8HA 5HR7A 3U9IA 4HA3A 3B9DA 3RFAA 2GWNA 2GYIA 5AVHA 4HNVA 3SUVA 5LGXA 4HNTA 1W1TA 1AJ2A 2WMFA 2CITA 3EX2A 3I3BA 1XRFA 3A4AA 3FDKA 3NZRA 5CC6A 3VKAA 1JD9A 3MS8A 1XLIA 3TJLA 1X96A 5GJPA 2D24A 3TYCA 3KP0A 3U5UA 4FX8A 1W54A 4X3ZA 1TELA 3LERA 2WVUA 3WK2A 3VDHA 3VNYA 1KTBA 1UZ1A 1CDGA 3IJLA 1H1ZA 3IJ6A 2WOQA 3LYEA 3OPSA 1UD5A 1Z32X 2X09A 2WCGA 3M0VA 2YXGA 2V2HA 4UFKA 1PPIA 3VVGA 2PWDA 5DEZA 1XYCA 1B3OA 3M0HA 3UR2A 3LSCA 4QSHA 3SY1A 3DKJA 2ZUTA 3A23A 3I6RA 4XAYA 5EL1A 3L12A 4H7CA 4LF2A 4MB5A 3FA5A 3EAUA 3M5ZA 1V02A 3NUKA 3P3BA 1EIBA 1UC4A 3DENA 5A69A 1LBLA 1LLOA 5DF0A 1JZ6A 3C4UA 3AYSA 3RPMA 2RFGA 2Z7KA 1MFUA 1P6BA 5D2XA 1O5RA 4LUJA 1QW8A 3ABQA 1J6OA 3IVTA 4DJDD 4N9DA 1AH3A 5E9XA 4HOZA 1HXJA 3W00A 3IS4A 1J0HA 3K8KA 4H8VA 1BRLB 4EE9A 1QATA 3C2RA 2YX0A 1Q2RA 2GOUA 4RZ6A 3LD5A 3LLDA 4KT2A 3W7MA 5IFPA 1VPYA 3N2MA 2OCZA 2F61A 1IR1A 1A3HA 1ZU8A 2DPEA 4M80A 4RL3A 1E5NA 1LRQA 2OMAA 2J66A 1BD0A 5DELA 5LHEA 3FN9A 1YADA 4Z1YA 3TX9A 4DBUA 1JZ2A 5C54A 1VFOA 3C0SA 3SFKA 2F38A 2UY4A 2HWGA 2VC5A 3PSWA 3ZOAA 2GJNA 1EWDA 1NFBA 1ZBKA 3R12A 3GU1A 4TTGA 1LLWA 3W73A 1Q3NA 5J5RA 4Z1AA 3BCJA 1XICA 3IUHA 3DFYA 5G4WA 1I60A 3LENA 2IPFA 1UKQA 1O6IA 1TUFA 1UR4A 4L4PA 3OVPA 2A7RA 3VE9A 4AD4A 5I23A 4D1JA 2X0YA 4GE8A 3NQDA 5A94A 4QAIA 1ESWA 2GZXA 3N2BA 3B8DA 2DUZA 3W6YA 1C8QA 3LCXA 2I5IA 1KRMA 3M7SA 5TD4A 3MUIA 1D7FA 1WPCA 5H6HA 3FJ4A 4WHBA 4FNRA 3U2EA 5G2HA 1UQYA 3KCOA 3R8RA 4QTGA 4WZHA 2XH4A 4JTCA 1VLWA 1UH3A 5G1TA 3CAQA 1EUAA 3H4GA 3S2MA 3EOUA 1XIDA 4FOJA 1UASA 1PWMA 3SADA 1QPQA 1V6WA 2E9MA 2A3LA 3VNZA 2CZVA 2PPGA 3W22A 1YW1A 1FWDC 2OKOA 2ZZ5A 2IPGA 4YPJA 3RR4A 4JKKA 2KX9A 4FLSA 2Y2WA 2D23A 4P7RA 3QFEA 4K36A 3R89A 1VGAA 2PP0A 3C8FA 4PH6A 4GLEA 3LCGA 3RHGA 4GABA 4PMDA 2WLZA 3QV9A 3CZ8A 4XSLA 3UZZA 3JZEA 2Y85A 1Q85A 4PUNA 1JI2A 2A1YA 4E3TA 3AXHA 1V08A 1NTHA 4O0QA 3HQOA 2NXHA 5T26A 1UKTA 4IXHA 4AZBA 3WLOA 4LVBA 1VLIA 3XINA 4Y8FA 4KCUA 3H53A 2JBMA 3PTQA 1O66A 5CKSA 4UTMA 1TWZA 4D6FA 3NVDA 4HNNA 2GJRA 3C3UA 1JUEA 4ZO9A 3R0UA 5A6LA 1GOXA 3N12A 1S3TC 4AHPA 1XL9A 4AD5A 3BAXA 2ZDRA 1E40A 1I1XA 4RE4A 3K13A 1TWSA 4FHAA 2PDPA 2E77A 1FWSA 5M5DA 4D6JA 2ASHA 1KGUA 4B9ZA 2INZA 1ICQA 4GGHA 3OIHA 4MPKA 1UR9A 4ZOCA 3M43A 3C2YA 3TK7A 2B7PA 1TYGA 2HK0A 4NG3A 5BRPA 2DVUA 3PBMA 1CECA 4UBPC 1SJBA 2H3BA 3IJ9A 5H8MA 1GOQA 4PCTA 5A2AA 3EX6A 4ZTXA 3STGA 1AW5A 5D2YA 4YHEA 3W84A 3OLEA 1E0UA 2ZE3A 3GY1A 3CM4A 1QTWA 3W1NA 5I2UA 3W1XA 3WNPA 2FTYA 3VZZA 3EYPA 2E8ZA 1IHIA 1NH6A 3HA1A 1UW9A 3ZXWA 1GJWA 2EPKX 1M68A 4HMDA 1SPQA 3CV6A 5HMDA 2VZUA 4X9SA 4E2DA 4NI8A 4JL2A 2J7CA 1REQA 4MVAA 1SJCA 1K03A 3EPNA 7TIMA 1DVJA 3AFBA 4WR3A 3UNDA 1S5VA 4K1GA 1JUKA 5K4ZA 4JZ5A 4LXFA 3O63A 4J3UA 5A8GA 3T55A 4BWLA 3CQHA 2ICSA 4RXGA 4WLCA 2LLEA 2ZX8A 1E0TA 4UQ9A 3MZNA 4KGLA 4QJ3B 2BOFX 4W9TA 2YL8A 1OGBA 1T96A 4LBRA 4ATDA 1MNSA 3MMTA 3HPXA 2HPMA 3LCFA 4UFHA 1P0BA 5FL1A 2WHLA 1SU5A 2A3AA 3WLKX 2OSYA 4LYRA 3HBLA 1LWIA 1W6TA 1UP0A 3S8HA 4D72A 4GK8A 2Y89A 1ONWA 2ZRYA 4DQWA 3WSUA 1ENUA 1R5YA 3EZ4A 2PWHA 4IGNA 5EMKA 2RDUA 4GZIA 4D6IA 2VFFA 2C1IA 2NZLA 2E4TA 4B9YA 5CLTA 3SQSA 2YCKX 1T99A 3MMWA 3AS1A 1ISYA 1M7JA 1F6PA 1JPIA 4I7UA 3SB0A 2O4QA 3AO0A 3DZ1A 4DY1A 4NKCA 1VBRA 3KDNA 1TR9A 1C90A 4R3UA 5LIYX 4CU7A 3PJTA 4RLIA 1S5NA 4CCDA 1TTJA 1MMFA 1AUSL 2XJ7A 3WG6A 3Q4DA 4P8UA 3PUGA 2CETA 2VZOA 3MHGA 4H8NA 4JTTA 4MNKA 3FSUA 2CLOA 3FHQA 3QKZA 1GG0A 3NCOA 1HGYA 1QR7A 2WANA 4AZIA 5EMJA 4OGZA 4GMEA 1CTNA 3CGTA 1VHCA 5G4HC 1NP0A 1K8YA 5HANA 2Y88A 1XHGA 5D37A 2XVGA 1ZNNA 3UG4A 2BODX 1FCBA 1EXBA 1RXOB 2OPJA 2XDFA 2FDSA 4YTTA 2VGIA 1MQQA 3DFPA 3S46A 3O3RA 3E5BA 4RXFA 1QO5A 1KM6A 1IEVA 5REQB 4ZQMA 4IIDA 2R24A 4Y9AA 3LLXA 1DHKA 3SCVA 4HPHA 2WJDA 1E6PA 3OQ8A 1VR6A 4M5PA 2FLIA 4BF7A 4GO9A 4D6CA 4EKJA 1BXCA 1XLHA 1VKFA 4H6RA 4DJED 4YN5A 3FYYA 1G69A 4PMJA 5DY3A 1Y8BA 4MGGA 4CNSA 2DZAA 2PP1A 3ITLA 3SY5A 3VNDA 3EWBX 1A4MA 1E0XA 3PK7A 3BAWA 2BY3A 1SMDA 3E5PA 4ZENA 3GXDA 3DOPA 2UY2A 1DXFA 3J7HA 1O94A 3WN6A 1XPYA 3C6CA 2QCFA 1WNOA 2FGBA 8XIAA 2ALDA 1LTDA 3FXGA 4W5ZA 5M2FX 1QW7A 3GRIA 1UHVA 3I6TA 4NX0A 1F4HA 2A6NA 1FDJA 2HCVA 2J9XA 1XLCA 2DZVA 2NX1A 1Q66A 2JIWA 5KINA 2OB3A 3PZUA 2Z00A 5AC6A 3AMCA 3CUGA 3W7RA 3PUDA 3VM5A 3U0HA 7XIMA 4YTRA 4LOCA 3ZYZA 5EBAA 1ZLPA 1R8LA 4QIUA 5GNXA 3NSNA 3B40A 3TCSA 4DJFA 3JS3A 4PODA 4HYVA 1OFDA 1RZMA 4B3LA 3UXAA 1J96A 3T2OA 1EEPA 4AZCB 3NTYA 1Z44A 3W7CA 4J27A 2IKHA 3PPCA 4Y2WA 3ZWSA 1FDYA 1YNQA 1PZ1A 1SGJA 2XIMA 4Z42C 4G1NA 2G3MA 4AHOA 1O12A 4KQNA 1JQVA 1ZSXA 2IKJA 3KUMA 4MB3A 2XSBA 1IR2A 2VEGA 1QU4A 4XZMX 1XLJA 9XIAA 3PJUA 1EJTC 3R94A 3L68A 4K3ZA 3QMRA 4BHYA 1Q6CA 4ZFCA 4QG6A 5HXMA 3HMJG 2ZZ1A 3VOFA 4Z2HA 3SRFA 4E5TA 2Y5JA 1NF7A 4CD8A 1K8XA 3VK5A 1P7TB 4K7VA 1VFSA 5HBFA 3GXTA 1KGWA 4CCCA 1SYTA 4GQGA 3S1GA 3PB2A 3MTWA 3I10A 3V18A 3KBWA 3VIGA 1EJXC 2B81A 4FX7A 2FH6A 5CH9A 4XIMA 4TV6A 1KFEA 4X61A 3RNDA 3F4DA 3A5FA 2HVMA 1J10A 4ATLA 1UMLA 4FIQA 4QEHA 3MP4A 1HZYA 4HZ7A 2DQXA 4LGXA 1LL4A 2XSXA 4KBXA 4JDBA 3QPEA 2DT2A 4PMYA 1XBXA 2VUNA 3WLQA 2QPXA 2R6OA 2VQTA 2D1ZA 4C1NA 3ONBA 3D3FA 1KXTA 4YJ5A 3N2XA 1OIMA 1X39A 1MDRA 1EX1A 1GOIA 1UD2A 3E9AA 3GG0A 1OYBA 1UA7A 1A5UA 1LROA 3G8RA 4U2ZA 2Z1VA 3OA5A 3VKKA 1A3WA 3QQ0A 1MW1A 4FLQA 2AMGA 1YDOA 4EACA 4I9AA 4ACYA 3VGBA 3BLKA 1VBGA 2EJ1A 3QBUA 1SO4A 4GKLA 3O07A 4ZQNA 3RX3A 4Q4QA 2HNEA 1DHPA 4IISA 3H12A 3LHTA 2PDNA 3GFXA 2D2OA 5D30A 1A5MC 5DBTA 1V0LA 4Q22A 4HNOA 4HU0A 3K4DA 1X98A 5A1AA 1CXKA 1L6WA 4GYJA 1UKPA 4NIRA 1CENA 4YNGA 1TV5A 3DHUA 3RYSA 3UZWA 3VD4A 3FJNA 3BVJA 3VIHA 5LSMA 1VBUA 4C1LA 5EFFA 1TV7A 5LXEA 5C9RA 2YW3A 4IMFA 1HO4A 2OYLA 1SR0A 1AJ0A 5CC3A 1T40A 2PD9A 3OBEA 4BCEA 4Q8TA 1GYLA 1HIZA 3TNOA 1NP2A 2NLIA 2DEPA 1CGXA 4ZB0A 5F2GA 3I4KA 4CU8A 1YX1A 2QCCA 1UQZA 3QN3A 3FJLA 4S3DA 1P1MA 4UTJA 4IICA 1HVXA 3CMFA 3PZTA 3K46A 3GH7A 4MAVA 2ZCGA 3CBWA 2E28A 1R7AA 4FK9A 4MFDA 4IQLA 3U4AA 1B30A 3NM1A 8CGTA 3IJDA 5HAOA 1W3KA 2WBKA 2E9BA 2W5FA 2GFTA 2V30A 3B8IA 1U1UA 4EAYA 3HPFA 2BVTA 2BV9A 5HMEA 3FYOA 3PBUA 5LIUX 2G97A 3SW6A 3VOGA 4KRTA 4WDTA 2XGIA 2FVKA 3W86A 2QS8A 1GNXA 3DN5A 5C2GA 3M5VA 3W1TA 4IG2B 2W79A 4TX8A 1E56A 2A5HA 2QDGA 3QMSA 1A49A 3L23A 2QUMA 4GVHA 2AKMA 1LT8A 4B5NA 3E38A 2J8FA 4B5TA 4NI3A 3NO3A 5TQLA 3XISA 2V38A 4DUOA 1WB0A 2Q6ZA 1KCZA 5HJYA 1O5QA 1JIBA 5A8OA 3KRSA 6ENLA 3CIXA 2X7WA 1ONXA 1X1ZA 1GVOA 1VEMA 3HFYA 1HFBA 5I06A 3GM8A 2J13A 1VCVA 2DDXA 3AYTA 1XLFA 3C2FA 2OSXA 2VDIA 4HU4A 2OR2A 2PRMA 4JQ2A 1EYEA 5FAGA 4HCDA 1FWCC 2QJIA 2XIQA 1HW6A 3WQVA 4LTSA 5DN1A 1MZHA 1HJUA 2HTMA 3R79A 5K9DA 5HQMA 4FSAA 5CPSA 1JEZA 2RDWA 3PP7A 1K9EA 3GKFA 4IMDA 4JY8A 2NX9A 1ZBCA 3DFTA 3H4WA 3LMYA 3S4TA 3DU0A 4QCEA 1U1JA 4MWAD 4LCSA 2GJXB 3RMEA 3CUHA 5T9CE 3HO8A 5FSEC 1J9YA 3P14A 3DG7A 3NPUA 1VPQA 5GNZA 3PBVA 1R3QA 2F9RA 2V5DA 5A8NA 1PX3A 4S39A 4MY1A 1KLYA 4DAIA 1V3HA 4QHRA 1HT6A 4UQAA 7REQA 1TB3A 4D8AA 2PGWA 4XO7A 2VL4A 2XHYA 3AIRA 4O8RA 3TA6A 5J5DA 3BCFA 3O6YX 2C19A 2ZICA 3W81A 3NQEA 4AUBA 1F3WA 3H2MA 4Q8VA 1J5TA 2VUYA 1J4EA 3ITGA 2CKSA 1J11A 1AJZA 3LHZA 5FESA 3E2VA 5EMYA 4ZE5A 3PSVA 2IMRA 1XIBA 1XISA 2V81A 3AICA 4H2CA 1WKFA 3B97A 2PF8A 2QVNA 1EXPA 4UB9A 4EX4A 4WSHA 3NURA 4QROA 3GW0A 5FEXA 3UF9A 1RH9A 2HSAA 1B3XA 1RR2A 1XDMA 1XRVA 4PTXA 2RUSA 2V5CA 3TKFA 5BWAA 2X16A 1UD4A 3W6MA 1UWAA 3IIPA 4H2HA 1XGZA 1WAWA 1JF6A 2VFIA 3TQPA 4AWEA 2CKRA 3P61A 3R25A 4TVCA 2TMDA 4KETA 4UTTC 1QASA 1BYAA 4KF1A 3WDQA 3VC6A 1JULA 3GHRA 4XAFA 3EGJA 4AF0B 1GPWA 4QCFA 3WFLA 4UOQA 3EWZA 4YIWA 3BDKA 3HPZA 1ZHAA 4LSBA 3BANA 1W1A1 5ECVA 4XAPA 3UWUA 4AY8A 3GR8A 1AL8A 3K5XA 1OEPA 2JQXA 3KOFA 3NXFA 2PDJA 2F8QA 1GTEA 4GUIA 4B90A 1FWNA 1PYFA 1IEXA 4MDPA 3UXLA 2D2HA 1K4HA 4KFPA 2OZ8A 3UJ2A 1R85A 4W88A 5BU9A 1UPMB 4CEUC 3JR2A 3R5EA 2DJXA 3R13A 1BFNA 2E9LA 1AQMA 4B4FA 1A5CA 1QWKA 3TN3A 4WUIA 4UOZA 2DZBA 1J0YA 2ON3A 1SFJA 1B0IA 1F7BA 3RCMA 4RV3A 3UWVA 4I6VA 2ZKMX 1WKYA 3WKZA 1EJVC 3AJXA 2ZFAA 5GJMA 4AMCA 5IOBA 2HVNA 3QW4B 3LA4A 2A7PA 1MEIA 1TMHA 3QFWA 2YFOA 1IGWA 1VFHA 3L21A 1PYMA 4F0MA 1EBHA 1JZ7A 4OFCA 1E6NA 2CBIA 3COTA 3W0KA 3BMVA 2QF8A 1Q5MA 9XIMA 4HHMA 4EPDC 1CW2A 3N17A 4LF1A 3W27A 2D2GA 1M41A 3LRMA 2C79A 2GQ9A 3H7RA 4W85A 3A21A 2W62A 3O05A 4C90A 1S2UA 4BZYA 3M6DA 1SO5A 2YXOA 3WCZA 3FAXA 3P0XA 1JCMP 4WKHA 4W89A 3RCNA 1TWWA 2R8WA 3A64A 4Q8WA 3V0UA 2ZXQA 3TAKA 1F6KA 3TUUA 3C52A 4R9OA 4PRWA 2D69A 2WQPA 4Y9OA 1XLAA 3E74A 3LQLA 4LAZA 1IQ8A 4JN6A 3WNNA 3W7NA 1MEHA 1M6JA 2PDGA 4E4PA 4MJMA 4UR9A 3EXRA 4KEUA 3URNA 3P5YA 2P53A 2G50A 1YIXA 3PZMA 3GG7A 3DI1A 2BB0A 3T0DA 3SDOA 3REQB 5CZJA 1YXCA 5E93A 3W37A 5K7JA 2CHOA 2P8CA 3TVAA 4DF2A 1UR1A 2J7BA 2GUBA 5CZSA 4L4MA 1YTKA 4NX5A 4OV4A 4ZVJA 4JIIX 3HZ3A 2B7OA 1FWHC 1XW8A 2QJHA 2VVSA 1PCWA 3RLVA 3WNKA 2VDGA 3PS7A 4D8LA 1TPUA 1AMYA 2D3NA 2MUCA 2VJXA 3PHAA 3GAYA 4O0ZA 3SN4A 3W3OA 2JEQA 2DSUA 3FSTA 3PZGA 1XINA 5F4SA 4LS2A 4IUOA 1RVKA 3CEPA 3QY7A 1AL7A 3FV9A 4LB4A 1RAKA 5C9UA 1XBVA 1UB3A 1WXYA 4YL2A 3S1XA 4XK2A 2WZIA 1TO3A 4JTUA 4RE2A 2XYLA 4HPJA 2OZ3A 1VQTA 2QIWA 3STPA 1CLKA 2F6XA 2X05A 1U30A 1SZFA 1W56A 4IFOA 4L80A 1E1CB 1KTCA 3QQWA 4ZCWA 5JVLA 2BBFA 4LS1A 3BZJA 3GW3A 4Q4KA 3BW2A 3KTCA 3L4UA 2AQOA 5LHFA 1JI1A 4WD0A 4IIEA 4RZ5A 4W7WA 2OEKA 2BASA 2R82A 1X7IA 1E3ZA 4ACZA 1I6NA 1ZS2A 4WKFA 3NDZA 2QZRA 3BPWA 1LDCA 1ZJBA 3SQLA 4OIFA 1TG7A 1X6LA 4MB4A 1BVZA 2F2HA 4DI8A 1W1VA 4G9PA 5I09A 3G6LA 1IWBA 4LT9A 3G0SA 2QPUA 3PPHA 1GG1A 5U7SA 1JRBA 1A53A 3CAWA 1LM1A 2FTPA 4Z2LA 2GJPA 3EXTA 3AJ7A 3NGJA 1KXVA 3H24A 3BO9A 1TKKA 2IQ0A 1V79A 4NY2A 3W2KA 4IOTA 1LF1A 3WL1A 1AW2A 1Z6KA 3MP5A 3MWAA 1E0WA 5M17A 2V2CA 1UOKA 1KKOA 2CLIA 3DAQA 4QLLA 1ONEA 1IV8A 3BJFA 4AHQA 1BKHA 1DWAM 1J18A 4KIEA 3GXMA 5HNNA 2ZUVA 5C9ZA 3W38A 2HROA 5CBJA 1J93A 1M03A 2F7FA 4JTRA 4JTFA 2HE8A 4FNTA 3WFAA 2YJQA 2VZTA 3W9ZA 3UGRA 5F4XA 1W5NA 3G77A 3R7MA 3W7JA 2I9EA 2XTKA 5AHEA 1GOOA 3AYRA 4ATWA 1T41A 3EBVA 2CIPA 4Y9PA 3B8TA 1UUMA 2ZZ4A 1FWWA 3BLFA 3O6AA 1P1XA 2PFHA 5I3HA 2EPLX 3VMNA 4CKQA 2YB4A 3VNIA 4U28A 3L4TA 1FUYA 3BARA 3BOLA 4MLJA 3BSGA 1W1IE 4G7EB 1JZ3A 1AFSA 4Z2JA 3PM6A 2EG7A 1LWJA 4K8HA 4U31A 3BC9A 4CQDA 4AWTA 3OGSA 1Q7MA 5A6SA 3DC8A 4RNJA 1VBJA 4F2TA 3E2RA 4AYGA 2OVLA 1WBHA 1LP6A 2R1LA 1JL8A 3WF2A 1GWJA 3QOMA 2HRWA 1O7AA 1HL2A 1OX4B 3EKZA 2DUAA 4I9TA 5AYBA 1YNYA 1IWPA 3VUPA 2XH2A 1M9HA 1ZJIA 3H7VA 4YLWA 2NUWA 4AH7A 3LXAA 3UEQA 1HKJA 4JCMA 4C6JA 4UTTA 1OX5A 3WNOA 3LPGA 1QI3A 3HQNA 3LTPA 1FHDA 1IZCA 4K7YA 3S5YA 3TJ4A 2OZ0A 3TSBA 1RK5A 3AQUA 4EK7A 2ZZ7A 4C1NB 4O10A 3QV8A 3SN1A 3GUWA 1KFCA 1L8PA 1M7XA 3ITXA 3WQGA 3IJ7A 4FZIA 1HF6A 2Z1WA 3NG3A 4XQ6A 5MF5A 1U83A 3IUIA 4P8XA 1PTGA 3WH9A 5H8PA 3GDBA 3VU2A 5C7VA 1HN1A 2I16A 4TVDA 3U8GA 2DSZA 5IDIA 3LRKA 4NL1A 1G4SA 2PDKA 4IX0A 4ASTA 1W9PA 1GQIA 2CZFA 4S2BA 1SFSA 5C5YA 1SR9A 1S39A 1P6CA 4DRSA 3LHUA 3FHAA 5JUVA 3MUAA 2HVOA 2A79A 3MUXA 1WAUA 4D6DA 3IEBA 3QW3A 2QR6A 3U48A 2VQUA 2I5GA 2A2IA 4F0HA 4XV0A 3WJYA 2BSLA 1IEIA 3UYCA 4PTWA 2DZSA 5M1TA 2XIBA 3PZQA 3FKRA 3OLGA 1MVYA 4QG9A 3PNZA 1P48A 3KEHA 4HK5A 3AHYA 3ABXA 1NEYA 1PDZA 3C2VA 1C3FA 1GVRA 3G18A 4GQQA 4LH8A 4H8HA 4LUTA 3JZUA 3PWIA 5BCAA 2QYGA 3ICJA 5BXRA 2J47A 1CLXA 4PEKA 1P0KA 4XO6A 3TFCA 1EJWC 4OUIA 2OOGA 3URAA 2D0GA 4H9XA 1YLVA 3QR1A 3QHOA 5I3GA 4I5XA 4V2XA 4G1KA 5AYXA 1ZBWA 3MWCA 2PAJA 1W3JA 4P7LA 3CYVA 1XYAA 1XC4A 5KZEA 4CN6A 2ZDSA 2CBJA 1EO7A 1GONA 1OBAA 3LGGA 3APYA 4NQ1A 2ZADA 2HMCA 3GXIA 1DE6A 3VMPA 4QLJA 3SCTA 3VTRA 2J79A 3S2NA 1QNSA 4V27A 2XUCA 2Y6ZA 4QJ4B 3T0TA 3GTXA 1NSJA 4H9UA 4IJBA 3T6CA 2GDUA 4DUWA 1GZJA 1V77A 3EA2A 3OLDA 1VZWA 4M6UA 1GYNA 4HA0A 3UERA 1THFD 4RZBA 2B7NA 1PL9A 2CFFA 1OQFA 4O1FA 2O9RA 4KFNA 2OYMA 1HKVA 3MSDA 2G41A 4FAMA 3FOKA 4A05A 4Q33A 3TYZA 4U3CA 5HWMA 5G4EA 1VYPX 3NQMA 2FH8A 4WDWA 2WAGA 3ABOA 4DUXA 1NDVA 5J8LA 3POHA 2NQZA 3PANA 4TR9A 1BPLB 3GG1A 3U2CA 1HP4A 5K3VA 3N25A 1W37A 2OZTA 2DZTA 4L1GA 3RM9A 3NL2A 5DRIA 2YPIA 3N19B 1TZZA 4HZMA 1ZY9A 3N1AA 4UFLA 5FACA 2YOCA 3KL3A 3MQTA 4JTSA 1KM4A 4AB4A 4LAOA 3U7VA 2DUXA 2EBNA 1ITQA 3W7EA 3T09A 3QZAA 1L9WA 1V03A 3DGRA 4LY4A 2SFPA 1JPMA 1X8CA 2H9AA 3EOLA 3WENA 3PY2A 3B9AA 3LGDA 4B4HA 3DEQA 1UZHA 2NQHA 2P0OA 2J27A 1EPVA 2R91A 2QHAA 3TSDA 3WF4A 3GC4A 2UY3A 2XVLA 3EDJA 5AVNA 4WIWA 2QJGA 3EKGA 3MI3A 3H6OA 4GVFA 3THQA 3Q58A 1CWYA 4F9JA 3KTXA 3HOJA 3PWAA 1B4EA 1R3TA 3AOFA 3V4BA 3V35A 2I56A 3CK5A 3N2CA 3AIEA 5D38A 3PFRA 4XAGA 1MQPA 1RK6A 1TSIA 4PL2A 6REQB 3RRAA 1P43A 5I3KA 1DJIA 3PF3A 4GJ1A 3CZGA 4GQRA 2Q3RA 4ZOEA 4FF5A 1TPH1 4RDZA 4IGMA 1GGOA 3VGDA 2ZWYA 2GGJA 1J0IA 2Y63A 1GYMA 4L4LA 2E1DA 1XCFA 2DH3A 1KBBA 4E8GA 5LNUA 4UCGA 4GCAA 4ML9A 3TJIA 3ZMRA 4FR1A 4US6A 1WP6A 3NWRA 4L9ZA 4JYDA 4AZCA 2VEMA 4MKVA 3VM7A 1DORA 1GTHA 4ERAA 1GKRA 3GBEA 2OSWA 3CMGA 3TYAA 2NUYA 3MJYA 2OQLA 2HISA 3KX6A 2I5QA 3EPMA 3UP8A 1EGZA 4PE8A 3GWQA 5G1YA 1GQLA 4EVZA 3VD3A 3W7QA 4UUIA 1WV2A 1PZ2A 2W67A 1DBTA 2DW6A 3TYUA 3WF3A 4A2RA 2OX4A 3BGGA 2ZZ6A 1NWRA 5EMUA 5KMYA 2HXUA 3GTNA 1OFPA 2W63A 3A3XA 3ANVA 2VI0A 1EJ7L 4V1XA 4U5KA 5EY5A 4HSNA 4JD4A 3W85A 1OFRA 2VEIA 1MDLA 2A3BA 1PVNA 3WNLA 1EC9A 2PWUA 4B2DA 5D2TA 1JYNA 4R7WA 3XIMA 1XUZA 4R9XA 1H49A 5PTDA 2C16A 1WDRA 2Y0FA 1PB0A 4D1IA 4M56A 2D0FA 5FF3A 3CMJA 3LCHA 3BK0A 4JFVA 5HATA 1OCNA 4U2YA 4D6EA 1FH8A 1QUMA 1MUMA 1B3YA 2WB5A 4AF0A 5AYZA 3GH4A 2JE8A 1RQEA 1UBPC 1OFAA 2G8ZA 1E0VA 4FLOA 1G67A 2EEXA 1R2RA 4JTKA 4CNNA 4MSSA 3QGKC 3WLIA 2YDAA 3DFQA 1CGUA 1J0JA 3VX0A 1ZP4A 1R6WA 1EYWA 5GQBA 2DIJA 3H70A 1GT8A 3GE7A 1OADA 5D09A 2OGJA 1YRRA 1ZENA 1ZP3A 4UNIA 3RITA 2X1TA 3EDDA 2DSWA 5HMFA 1H1NA 3EEGA 3IARA 3BLOA 1SVDA 3BLEA 5C2CA 4IIFA 3L65A 3CXOA 1RP8A 2EGZA 1HKIA 4BJHA 2HE5A 5ABTA 4KWWA 1C9WA 1CB7B 4O14A 4LUIA 1L6GA 2WKLA 4FALA 4O0KA 1Q7ZA 1QI0A 3WDRA 4W7VA 2YCLA 1JPKA 1XXXA 3K4AA 4EF8A 3PFMA 1KM3A 3GX9A 1IWAA 3K8MA 5D2VA 1C8VA 2ZRVA 1TJ0A 3SUTA 2W61A 3ISIX 1OM0A 3NQ2A 4J40A 4K38A 3T1GA 3U57A 3ES8A 3HPAA 2A85A 4XKYB 5D8WA 1D3CA 2FDMA 3NNTA 3VKDA 3T78A 2BY2A 3AXKA 3M0JA 2QUTA 3G6MA 1B90A 5D33A 3S2CA 1JVNA 5HQLA 3B8SA 3CL8A 4B16A 3W88A 2BLEA 2V5LA 3UCCA 2FVLA 5HR6A 4M51A 3RX4A 4JX6A 2B31A 3WMSA 1ECEA 2VD8A 2XGZA 2VWSA 3I7SA 4BF5A 2WJEA 4K8EA 4ZB2A 3LMZA 4CQ9A 3QTGA 3F4WA 3APTA 5DO8A 1XGDA 1WDSA 3TC3A 4HMCA 2V2DA 5I6SA 4UQDA 1B3ZA 4NXKA 2PU1A 1F4AA 4LBUA 1E4LA 2F6KA 2QIIA 3IGSA 3QV6A 1X7FA 3P8IA 3NEHA 4J1OA 3ECQA 2FJUB 4C91A 1R3YA 3AHTA 3W2MA 3W70A 2VRKA 3VNJA 3WD1A 1IEWA 3DGBA 4NF7A 3EKLA 2Y8UA 4LNCA 1IXOA 5T9BG 1CB2A 2FZBA 3W28A 4XKMA 1ZCCA 4O12A 1BVWA 4B5WA 3EOEA 3UW6A 4LEFA 2WC7A 2J7EA 1OFEA 2Q8ZA 2E5DA 1EZ2A 4AISA 5TAOA 3WF0A 4FF7A 2EO7A 3MVIA 3G1AA 1EP3A 4PUMA 3NO1A 2G4JA 4AD0A 1SFTA 3M16A 1M7OA 3W72A 1T7LA 1XQLA 1TIMA 4EP8C 4Q8QA 3D3AA 1XGEA 4HA1A 2BY0A 3ZVHB 3BE7A 4QJ1A 2O56A 3DG6A 1PCKA 4DWSA 4ZXLA 2BMBA 1ITXA 3GFYA 1PKMA 4KCVA 3W1MA 1KGXA 3GNPA 2XFRA 1I8JA 3CHCA 3IRDA 4P7OA 1KQYA 2X40A 4J2MA 4LVAA 2JK2A 3LY0A 4PSRA 3W7OA 1D8CA 1FVPA 4D71A 1YBQA 3QM3A 4GIAA 4OU1A 4HN8A 4UTLA 3W1UA 3ITVA 4KCWA 3M9YA 2WCSA 5F2MA 4U33A 1JR1A 4GH3A 3L2LA 4XZWA 1F3XA 3A9IA 4GPNA 1EJRC 2VENA 3OVRA 2WHMA 4PBFA 5KZMA 4J28A 3L4YA 4EOUA 1G01A 3LTSA 1EHNA 1E9ZB 3UETA 4A8NA 1V3MA 4QQ3A 2ZUSA 4XD5A 2ZA1A 3PULA 3SCRA 2EKCA 2Y62A 4RKAA 2XWEA 2AAMA 3B0UX 1R9ZA 1M04A 1JDAA 4JICA 5HDRA 3MSGA 3ZR6A 1A4LA 3IV8A 3QYQA 2X42A 3LOTA 5MKGB 4F9DA 2G4FA 4OE7A 2QGHA 4TU1A 3VKBA 2WPGA 1BF2A 4DPQA 2AL2A 5AHLA 1C92A 2R1KA 2D0HA 2BWGA 1RALA 4QE4A 2OJPA 4PRRA 3S47A 1JGMA 1ZB5A 4L9XA 1OX6A 2B4GA 3H2CA 1V6YA 1OINA 4UTUA 3TA9A 1YQ2A 3ANUA 5FCZA 1NOFA 1DJHA 3USZA 2WC4A 3VZYA 3ZJ7A 1QHOA 1POKA 3UJFA 2E3ZA 3AIUA 5DMMA 2C8NA 2WZMA 1PSCA 3VOCA 1GKQA 3HU7A 3LCLA 5B80A 2Z25A 4NJGA 3T2QA 4NZ5A 1W3TA 1Q6DA 4F0KA 5CAKA 2QXWA 4DUVA 4IPPA 3S1UA 3WDHA 2VCCA 3A3WA 5I5RA 1RCOB 1F8IA 3WJSA 8TIMA 4PB5A 4W86A 2FTWA 3A5VA 5CLWA 1KWGA 1NQKA 4WY0F 5LYRA 4HSHA 3TTSA 2PDQA 3H55A 4FNUA 2Q09A 3QVQA 1UOZA 1ISZA 4LCRA 1QHZA 2I9UA 1N8WA 1S2TA 1JXKA 2C6QA 3GH5A 5FD0A 4JN8A 4H1ZA 1CZ1A 1I1WA 2BOGX 2NV9A 3TW9A 2AMXA 1VB9A 2WPBA 1QK2A 4OT7A 2ZTKA 3OGVA 3OZOA 4OKDA 4EWND 1Q2SA 4ZTYA 5AYIA 3RIKA 4R5EA 3WQCA 1D9EA 3AHXA 1V6VA 4H04A 5G1MA 3GFZA 2ZWZA 1XRTA 4UFMA 1R0MA 4G5DA 4WJXA 1GW1A 2VZSA 4HJWA 4QLKA 1BTCA 3FNDA 3NQAA 3SM0A 7PTDA 2ACUA 1ADSA 4JAWA 4NJKA 4DJFC 2WMIA 1Y5WA 1Z48A 3KWSA 3OA3A 2DZPA 3L4ZA 2WJFA 1KRAC 3OODA 4I3GA 3M46A 4C1KA 3VYLA 1N2VA 4DO7A 1MXGA 2FHFA 1AQHA 3LLFA 5BOEA 4DXXA 4BR1A 1V8EA 2DZUA 4AC1X 3BLLA 4UZSA 5K2ZA 1E3XA 1OD0A 4LS0A 1D3GA 3GNNA 2ZXBA 2ZYFA 2XIJA 3E1F1 4N6FA 3WQEA 1W1PA 2QPSA 2VFGA 1UKSA 2YCEA 3BAJA 3ZO9A 3TROA 1E5JA 3WQWA 1A5OC 3RRXA 3SRKA 4C6EA 4PRTA 4P7NA 1VCGA 3WQ5A 5A2BA 4JNZA 2ZRZA 4KGJA 1E51A 1PXGA 1UWSA 1ZPTA 1XX1A 2DH2A 4NRSA 1NDYA 2ZX6A 2PDLA 5C0QA 2NWRA 4V1YA 3UG3A 3VX1A 2PE4A 2Y1HA 5IHSA 3AAMA 4OOUA 1TZ7A 4WVXA 1ISVA 1JRCA 1GVQA 5T91A 4V33A 3BAIA 3LV6A 3IK2A 3MKKA 3KFTA 3L4VA 1G0CA 3GZ3A 3TV8A 4DM2A 4IL2A 2O4MA 3FA3A 1VFMA 3H2EA 1EDGA 3L2MA 2X2YA 1R46A 4PGLA 3IGHX 3ARQA 4XZHA 3VD5A 1FWAC 1P5BA 1JDFA 3K30A 2PTXA 4BQ5A 4NNAA 3AXMA 3TLQA 1QPNA 3CUFA 2WWDA 2V6AA 2DZWA 4YMZA 3VOHA 4HP5A 3MO7A 5KETA 2E8YA 5E5CA 3GYEA 4DBWA 4CNUA 4UFIA 4ZQPA 1H7PA 3F4CA 2PLMA 3C2EA 3NL6A 4WY0A 2H90A 3KVKA 2O9TA 4GC4A 2X1RA 2VOMA 3HM7A 4RJEA 4DZHA 3SSJA 2OKTA 4XTDA 2C14A 4HN4A 1AVAA 1K9TA 3BURA 1TVLA 5D05A 4YS1A 4IGHA 4V28A 4F0SA 3HPSA 3TYDA 1Q6GA 4J4KA 1A5SA 3O6DA 5TBOA 3DH7A 1E9LA 1Q6EA 3VE7A 3PZIA 4MKSA 5HQEA 4YTSA 2PTDA 5JBEA 5CZKA 3N9SA 5I3IA 1UYQA 3PBYA 2NT1A 2GJXA 1KM0A 3L4XA 3UCDA 4AMAA 3IPWA 4TTUA 1ICPA 4PTVA 4AFYA 3M5XA 3SRDA 5C9WA 2PODA 3E02A 1DJGA 1C8YA 1VBHA 3C3NA 1KFJA 2CHRA 2VR4A 4X9YA 1XKJA 5HA7A 2IW0A 3NPVA 4IIGA 4PMOA 1FRBA 2W6RA 1IXQA 1PTAA 3GNDA 3RMJA 4TMBA 1P0NA 4Y90A 5AC5A 5AC4A 4JX4A 2PGRA 3UZYA 1GVIA 4DZAA 1NFPA 4JIPA 1I2PA 3NQ7A 3LSBA 3GXFA 3UYIA 3A9BA 4M1BA 2J62A 2V63A 4I9MA 2PURA 3AIQA 1S2VA 3P7YA 4PMUA 1J79A 3BG3A 5E09A 4IQJA 3RG6A 1SZNA 5ENLA 5HK4A 1RY8A 1XD0A 3LPPA 1SQ7A 4O54A 2PBGA 1OT1A 1XM3A 4MOZA 3VOIA 1FP8A 5D32A 5JU6A 1ICSA 1NM9A 1W9UA 3AS3A 1F07A 3H21A 3QOKA 4OV9A 1H7OA 1TCMA 3IACA 1DTUA 4BA0A 5AKQA 1OWQA 1XUUA 3GR7A 3WH6A 1F3TA 1FOBA 3WDPP 2VTFA 3VNMA 2REQB 3NFUA 2ZX5A 1DIKA 3RR1A 2P1FA 3FJ6A 3E12A 2I17A 1JD7A 3L2IA 1KD0A 2DSKA 1HG3A 3BG9A 1VFLA 3TLLA 3TTEA 2NQ9A 4UTWA 4QS6A 1VYRA 2GJLA 3EPOA 1JG9A 4DJDC 4N6EA 3LNPA 3VCCA 2P3ZA 1WCGA 3NQ8A 3L5MA 3R1ZA 3A4XA 1JXJA 4LCQA 2Z7GA 1CT5A 4Q8NA 4W93A 2O9OA 4GY0A 2V82A 4MB1A 1W0MA 5DBUA 4Y6GA 3CZJA 3RU6A 3WZ0E 5CBIA 3OB8A 3CB8A 4BI5A 3AISA 3SEPA 1WZAA 2NXIA 2NVDA 4QISA 1PE1A 1H7NA 2HJPA 1FQ0A 3T4WA 2VFDA 4NVTA 2DV0A 3CLWA 5BW6A 1HVQA 2VXNA 3M07A 3B9OA 4H00A 2JGQA 1C8XA 3ID7A 3T08A 4NHVA 2V67A 3BGAA 3AYVA 1POJA 2J8TA 1V7AA 3ARRA 4IPLA 2ISWA 4YU1A 4ML4A 4E6MA 3R0KA 1JAEA 2X8RA 3BQ6A 4IJRA 3BOXA 1DP0A 3DBNA 3GU9A 3WH8A 2YA2A 1H11A 4MZ8A 1WKDA 3APGA 2AQWA 2VC9A 4UWMA 5DT7A 3CB3A 2PU0A 3N04A 2FZDA 4NU7A 1HJXA 1JPDX 2YDQA 2VOTA 2OWCA 3WQDA 4IUGA 3N73A 2JEPA 4LUSA 1JCJA 4C6PA 1T6MA 4OQVA 1ZTVA 2YCLB 1XH0A 4RW3A 3VNKA 5FAJA 1B9BA 4AAJA 1H2JA 4UQBA 3NZQA 4FIRA 1XLMA 1LOSA 4HNLA 5JIPA 3LU2A 5XINA 2QCDB 3DCPA 3ABZA 3B4YA 4IH3A 1HJSA 1TPB1 3SQMA 3UY7A 3PZNA 3LQGA 4RW5A 2FZ9A 3S3GA 1UJPA 3HJZA 4PFHA 2VGGA 4ORMA 3DFNA 4HTYA 3Q94A 1T8XA 3NL3A 2Z24A 3GNOA 4HT3A 2IXUA 2QDEA 2G3NA 1TPC1 5BZAA