1ZQ5A

Crystal structure of human androgenic 17beta-hydroxysteroid dehydrogenase type 5 in complexed with a potent inhibitor em1404
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
314
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPNGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 314
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zq5A00
2PDBA 3MB9A 4F40A 1YNQA 2F38A 4L1XA 2PD5A 4JQ3A 3UYIA 3DOPA 3U2CA 1US0A 4DBSA 2PDQA 4XZHA 4QR6A 2IPGA 3D3FA 2FZ8A 1X98A 2A79A 2HV5A 3LQGA 3FX4A 4NKCA 5KETA 2BGQA 2HDJA 4YS1A 4JIHA 3BUVA 1X97A 1S2AA 2PZNA 4DBUA 4IJRA 3FJNA 4XAPA 1EF3A 2PD9A 4PRTA 1YNPA 3GUGA 4JQ4A 3UG8A 5LIWX 4PMJA 4WDWA 1GVEA 2PDUA 5HNUA 2IQ0A 2PDCA 3LEPA 4EXAA 1EL3A 4PUWA 4JTRA 2WZMA 4AUBA 1ZUAX 2PDLA 3UP8A 4GQ0A 2IKHA 3GHTA 4GIEA 4XZNX 1OG6A 2PDHA 3RX2A 4G5DA 1MRQA 3G5EA 3GHRA 5LIKX 3UWEA 5JH1A 2IKIA 2PDIA 5AZ1A 1S2CA 2I16A 2PDKA 3LQLA 3QKZA 4JTCA 1C9WA 3S3GA 4Q7BA 3UFYA 3R43A 3H7UA 2QXWA 4PR4A 3UZWA 4H7CA 1FRBA 2FVLA 4XZIA 4RPQA 2INEA 1T41A 1ADSA 3UZZA 2ISFA 1Z89A 2F2KA 1PWMA 3CMFA 3N6QA 3WBYA 3NTYA 2FZDA 3CV7A 2WZTA 1Q5MA 3EB3A 2I17A 4R9OA 1QRQA 4LBRA 2IPWA 5AZ0A 3GHUA 3C3UA 4FA3A 4HMNA 2HVNA 4PUUA 4LAZA 3O3RA 4XZLX 1YE6A 1S1PA 3LNMA 2NVDA 1PWLA 3V36A 3UZXA 1J96A 3P2VA 4QBXA 3H4GA 3CAVA 1RALA 2ACRA 5LIUX 1M9HA 3R7MA 1YE4A 4YVVA 4MHBA 4LBSA 1AH3A 1AZ1A 2IQDA 3H7RA 3V0TA 2PDJA 5LIXX 4JQ2A 2BGSA 4IGSA 1HQTA 1A80A 4ASTA 2FZBA 1PZ0A 4WEVX 1Q13A 3T42A 2J8TA 2IKJA 4WDXA 3ERPA 4GABA 4WRHA 3CASA 4GQGA 2NVCA 2IKGA 2IPJA 1RY0A 3F7JA 3R8HA 3V0SA 2ACUA 3M0IA 2DV0A 4LB4A 1LQAA 5HNTA 2IS7A 2PDFA 3R8GA 2P5NA 4DBWA 3G1RA 4FAMA 2PDYA 3EB4A 2PDNA 2PDGA 2AGTA 4YVXA 4YU1A 3M4HA 4JQAA 1AFSA 2FZ9A 4HBKA 3RX3A 1XF0A 4WDTA 4XO6A 3Q65A 1EKOA 4QX4A 3BV7A 1EXBA 1RY8A 4XVEA 2PDMA 3COTA 4WGHA 2PDPA 3GHSA 3LUTA 2PFHA 4JQ1A 3RX4A 3R58A 4L1WA 4GA8A 1MI3A 2DUZA 4LB3A 1AH4A 3UGRA 1XGDA 3ONCA 4XK2A 4WDUA 2CLPA 4DZ5A 3R6IA 1IHIA 2R24A 3LN3A 1Z8AA 4XZMX 1ZSXA 3LBOA 3LZ5A 4JIIX 4XVDA 5JH2A 1AZ2A 2HEJA 4EXBA 3MC5A 1PZ1A 3R94A 3O0KA 2R9RA 4ICCX 1K8CA 1XJBA 2C91A 2HE5A 2VDGA 2DUXA 5M2FX 4GCAA 4XO7A 4OTKA 2ACQA 1UR3M 3ONBA 5DANA 3UZYA 1VP5A 1HW6A 2PDXA 1QWKA 3WG6A 3Q67A 3WBWA 3V35A 2HVOA 2INZA 1LWIA 3CAQA 4IJCA 3EAUA 1IEIA 1ZQ5A 2ALRA 3LENA 1JEZA 1MZRA 4QXIA 5LIYX 3DN5A 1PYFA 4LAUA 2FGBA 1R38A 4JTDA 2PDWA 3M64A 3N2TA 5C7HA 1SM9A 4FZIA 3LZ3A 2IPFA 4H8NA 4JIRA 4PRRA 4ZFCA 1X96A 1VBJA 4JTAA 1T40A 2PF8A 3WBXA 4YVPA 3V0UA 1AH0A 3BCJA 3WCZA 4GACA 3BURA 4Q3MA 3KRBA 3LD5A 5HA7A 1Z3NA 2HE8A 1ZGDA 3VXGA 4FALA 1Z9AA 2BP1A 4JTQA 2ACSA 1S1RA 3CV6A 2PEVA 3B3DA 4I5XA
chains in the Genus database with same CATH superfamily
3FDGA 4GQRA 3W1NA 3MB9A 4NU7A 5C2CA 5BU6A 1YNQA 3P5YA 4HNLA 1QNQA 3HB9A 3MW7A 3EX6A 5LNRA 3NEVA 2Z25A 3U8GA 1L2UA 3CUIA 3PF3A 3TQKA 2ZTKA 1KLZA 1TMQA 2CZ5A 5CZJA 4KEVA 4AY1A 4AEEA 4E2BA 4FOKA 1ZBCA 2HDJA 4HK7A 1B3YA 2QVHA 3I3EA 2DVXA 3SUWA 4IP7A 1GZJA 2GDVA 1W1ZA 3EOEA 3RJXA 4UBPC 3M0KA 1KQZA 1ONXA 2V2CA 1OZMA 1W9DM 1PUDA 3OYZA 4ZOBA 2DQXA 1BPLB 2GSEA 3OGVA 4MPKA 1OYCA 2YA0A 5JIPA 4ZO6A 3N15A 3TW9A 3UP8A 3SRFA 3UVIA 4GQ0A 1S5WA 2GZXA 2P76A 3LA4A 3VVGA 4B5SA 3WMBA 2AQVA 3XINA 4O8RA 3GHRA 3Q45A 3LLFA 4TX8A 5AB3A 1EPVA 3CLMA 3NUKA 3WL1A 4IF2A 3MP5A 3OPSA 3ZLHA 5FJPA 4LS0A 3N9KA 3W2LA 4AISA 3PZVA 1DJIA 5AYYA 4AIEA 2FHCA 1H41A 4RE2A 6XIAA 3CTTA 2POZA 3AZRA 4JFSA 2Y2WA 3UZZA 4O0KA 3IIVA 4C6CA 5JXQA 2F2KA 4ZO9A 1E6ZA 4H9TA 3KWSA 3NO5A 2PWVA 4R7JA 2G41A 3OLGA 3QFEA 3UWZA 9CGTA 3M7WA 3WIJA 2YL8A 4GO9A 2F9RA 4IMCA 4Q6XA 2VHLA 1JYWA 4B9ZA 3PC0A 2ZUVA 4H00A 2Z24A 4O1AA 1EJVC 2VRKA 3C52A 1WZMA 3PWAA 1RBOB 3VMOA 2VI0A 3KUMA 1UR4A 1K70A 7TIMA 2NX1A 2GVLA 5HJYA 3PHAA 4K8HA 5IDIA 7ODCA 1R47A 4L9ZA 4IMFA 3GTNA 4B90A 2WO5A 1EB3A 3VIKA 2X0YA 2EPMX 2VFDA 3PUEA 2VDHA 1RVGA 2XG9A 3V0TA 1PDZA 4HA4A 4X0NA 1MNZA 2Y8VA 3A9IA 4S23A 3PJWA 3B0XA 4WVXA 5ABFA 4IPIA 2YDRA 2VDIA 3VZZA 4XKYB 1EOKA 1YXYA 3TW7A 4AWUA 3OIXA 3TN3A 3AU6A 2JFEX 3IJIA 1YXCA 5BXRA 3HJZA 3SRKA 3B97A 1TO3A 3A6OA 1Q63A 5MKGB 1AK5A 3GIPA 2O9TA 3NZPA 3S1WA 1FWRA 3VAVA 3R8RA 4QGCA 4TO8A 4CQDA 4KBXA 4N9DA 1UH4A 5FJTA 4LVAA 1KWKA 2X7VA 3SDOA 1EJUC 3HIJA 4HYWA 2OGYA 3RN6A 4DBEA 4F2UA 3PR2A 3ARVA 2Q8ZA 3BLLA 3RLUA 3F4DA 4J40A 1WZLA 4AU0A 1OX6A 4ZXOA 2O4MA 1I1XA 1Q85A 1XWYA 3RX3A 1TVLA 3EX2A 3SN4A 2Z28A 4Z1BA 3M0HA 4W87A 3S5OA 4E3VA 1ZZMA 4UOQA 2QAFA 5BRPA 1UR1A 4CD6A 3WK0A 2ZYFA 2P0OA 1WKFA 1IYXA 2PTWA 1NQ6A 2VOMA 2DUZA 2HBXA 2RAGA 3VTRA 3UJFA 3H6OA 2B0MA 3IUHA 5GJNA 1XIHA 4K39A 1Y7VA 2FB3A 1EC7A 3GNOA 1AJ2A 1KR0A 1A0EA 5L9FA 5FL1A 4MG4A 2V69A 4AZBA 2HEJA 1M01A 2RGMA 4PMQA 1OIFA 3VI2A 3HG3A 5ABTA 2Q01A 1EQPA 4H8VA 3ARYA 3DFQA 1MFVA 3BVJA 1RHCA 3L7RA 5GQBA 3NA8A 4XO7A 1NDYA 2ZTJA 4MJMA 3SUTA 4A2RA 2G4FA 1TR9A 4LUSA 5DANA 4PCPA 2FHBA 2VZVA 2FTYA 3HPSA 3QQWA 4UCFA 2ICSA 3WG6A 3NZ1A 2BNJA 3Q67A 2WNQA 3QQ1A 3UESA 3SUVA 3SCRA 2WHKA 3N2XA 1OWQA 4O10A 3SFKA 1O60A 3GC5A 3LHVA 3CNYA 4M7SA 5TF0A 1ZLPA 3VM5A 1KXVA 1ONRA 3MV01 2QJHA 4DNMA 3DHUA 4F66A 5F2GA 4F0RA 4DHGA 3VC6A 4FZIA 3PZTA 1R6WA 5AC6A 4PRWA 3N6JA 4JIEA 2XU2A 1X96A 4IICA 1F8IA 2XWEA 1T40A 2Z7GA 2PF8A 3NWRA 3AIQA 4H1ZA 2Q3OA 4AY8A 3JW7A 1B4EA 3OJGA 1EA0A 1GGOA 2A1YA 2Y5JA 3GXFA 4I7VA 2PTXA 3VXGA 3GQYA 3S5SA 5DXXA 3AAMA 5HAOA 3TA9A 3RM9A 3W3OA 1FWCC 4REQB 4ZODA 5KMYA 4Y7EA 1OT2A 3HURA 4C60A 5FJUA 4D71A 4XBSA 4UQAA 2Z6JA 4PCSA 4Z2KA 2ZUSA 1LROA 1CIUA 3CV2A 4FMVA 2PC8A 3W7OA 1WQ5A 2FQIA 1O95A 2V81A 1T8XA 3U6WA 1W9BM 1IWBA 3WN6A 1JPHA 1WDQA 4Z0JA 4DELA 3BUVA 2V5KA 2ZWZA 1N2VA 5J04A 4LEFA 4IJRA 4NHVA 2WSRA 4TIMA 4IFKB 3UBPC 1DPMA 3BOLA 3WLMA 4FXRA 1XL9A 3TAOA 4OKDA 3UXAA 4HPNA 3CYJA 5ABGA 1P43A 1JF5A 1UD3A 3WUGA 2PDUA 2EGZA 3WX7A 1O94A 4ROQA 4EXAA 1N82A 1NAL1 2OSXA 4NVTA 3DI1A 1QHZA 1X8FA 1CBGA 4CD4A 1YTEA 3STEA 4DUXA 4JTJA 3WEOA 1V77A 2EPHA 4EE9A 2IKHA 4X9SA 1O66A 3IJ8A 5EFFA 4JTUA 1IR1A 2FZMA 4IQLA 3FA3A 1S46A 4W85A 3ZLGA 1DTUA 3UWEA 1NJJA 4UIOA 3CTLA 2J6XA 4GUIA 1EUNA 1MZHA 4C7FA 4DYKA 4Q7BA 1TB3A 3H7UA 4Y9PA 1U22A 3WD2A 1LWJA 5C9WA 1TZZA 3WNLA 3ZR4A 4GE8A 4IIFA 4D8AA 4LNYA 4FOJA 1H5VA 4GVFA 4HHHA 3LPPA 4EX4A 3DYOA 3POHA 1GW1A 1T41A 3MU7A 4WK9A 3REQA 2ZZ4A 3O2LA 1WPCA 3GC2A 4JICA 2J9YA 1HGYA 2WNNA 2GGIA 1NM9A 2UY4A 4AZCA 4XKMA 3THQA 1KBIA 3LV6A 1MW3A 3GU9A 2Y61A 3G3MA 4JCMA 5AZ0A 1FBAA 2E67A 4HCLA 5DT7A 1Q7ZA 3VNMA 2YA1A 3O05A 3PJTA 3PK7A 1V3HA 2J8FA 5I0DA 1EO7A 3NL3A 1XM3A 2JIEA 2NW0A 1ECEA 4FIRA 5A94A 3V36A 3DI0A 5CC3A 3V1PA 3S4TA 3WNNA 2E3ZA 2I14A 2J7DA 3OLDA 3WUFA 4GGBA 3BJSA 4Q22A 2JKEA 3POCA 3OVRA 2CLOA 2Y85A 5HJXA 1Q4WA 1EEXA 4ZQPA 4BQ5A 2TAAA 5K9CA 3N18A 3I4KA 5T26A 1XW8A 1Z7AA 8RUCA 3BG3A 1GEHA 3DAQA 1Y5VA 4LU0A 1RLCL 3GY1A 1ISXA 4HMEA 3QBUA 3WH9A 3O9NA 4QE4A 4AX6A 5PTDA 4A3YA 1S3TC 4NXKA 3VZXA 1UD6A 2YCIX 2J6VA 3VD3A 1MFUA 2WYSA 4Q4OA 4PH6A 1Q8AA 4EWJA 2G96A 5M03A 2VD8A 2OKOA 2VWTA 3V0SA 3ZO9A 3NQ7A 2Z1XA 3W86A 3NZRA 4GOAA 4LB4A 2I7GA 1LQAA 3RAOA 2GDUA 2VC6A 1NQKA 2CCRA 4YHGA 3MTWA 3GXDA 3GKFA 2HNHA 1FWTA 1UUQA 1OFEA 3PNZA 1P1MA 4P61A 2VX4A 3UR8A 3PAJA 4AF0B 1X38A 3DFOA 4LF1A 3VE9A 2CW6A 2CKSA 3AMLA 2WLYA 2P8CA 4HKPA 2OSWA 4H6RA 1S2WA 4DQWA 1RY8A 2EPOA 3PANA 4FNTA 3E5BA 3MT1A 3AYTA 2E68A 4JQ1A 1MI3A 5I06A 2PRHA 5I23A 1KA9F 3H2AA 2PU1A 3QEZA 1BEUA 4E5TA 3QQ0A 4UMBA 5AYBA 2AQOA 3STFA 1N7KA 1TPH1 2FGZA 3LBOA 3N14A 3LZ5A 1Q6EA 1HL9A 1XRVA 3CMJA 4NRRA 3MC5A 3PBGA 1GOQA 4F0SA 4PMNA 3KL0A 3WQPA 1A5UA 4J3SA 4KH2A 4O4WA 5FEXA 3H7VA 5CG7A 3CZ8A 1DJNA 3W84A 4O0ZA 3PUDA 1MRAA 1UR3M 2ZX7A 2G37A 4Z1AA 3W6MA 2A6LA 1XSIA 3TK7A 4NJKA 4O1CA 3GLCA 1QO5A 1AL7A 3N17A 4UTJA 3VKDA 3WBWA 4PODA 1BYAA 5XINA 1EDQA 2GUYA 1N8IA 3AHZA 1W56A 4UZSA 1BYBA 1GONA 1SVDA 4RZ4A 1QBAA 1Q6RA 4KCUA 2P1FA 4M6QA 1MZRA 1V5XA 3S42A 4XTIA 3Q58A 3HGJA 1OSEA 2REQA 4HZMA 2WBKA 3M0MA 3N04A 2CHRA 2Z00A 5C7HA 5TQLA 6ENLA 2G95A 4JKMA 4HNOA 2OKTA 2Z2BA 4GJ1A 1ISYA 1MYRA 1XKJA 3SN0A 3VC5A 3MUIA 2DZVA 5HINA 4NZ3A 2ZDRA 3MSDA 1TJPA 3UZ5A 4Q3MA 3H54A 1EBHA 2D23A 3EDDA 3IJLA 4AZIA 5A95A 5HATA 4EAYA 8XIMA 4XAGA 2QCLA 4JL2A 4M56A 4D6JA 3N73A 1JD9A 4PMOA 2PDBA 4HT3A 4U31A 3O0FA 1PX4A 3KEHA 3TYAA 1W6TA 5FF0A 4FNRA 2WKLA 4DBSA 1E43A 3APGA 3T2PA 3WEMA 2OOFA 2LLEA 2INFA 4EWND 3LI0A 3OLEA 5ECUA 4YTRA 4PCNA 3IIZA 1QCWA 1H09A 3BLPX 4X9YA 1X97A 4XZBA 4H6KA 2A3BA 1TREA 2V0TA 5FJJA 1G7UA 3FEMA 2QV5A 2QCGA 1YMYA 2E1WA 3SCPA 1CGVA 2QLYA 1GOOA 1THFD 3DENA 5HNUA 1CZ1A 4A8LA 2ZUNA 3VNKA 1LBLA 1IQ8A 3DFPA 1KXHA 4K1GA 3BGGA 2ZX6A 4TOQA 3WQOA 2HPMA 1HG3A 1V6WA 5C71A 1QO2A 1XLJA 2ZZ2A 2NUWA 4I7WA 1A3HA 3WJSA 1S5NA 5D03A 2XDFA 3OVPA 3W6LA 4H41A 1FRBA 7REQA 1LM1A 3C0QA 1E0VA 1HP4A 2WSKA 2C1HA 1KM2A 1ISZA 5TIMA 2YKKA 1OY0A 1Z89A 3IV8A 1YDVA 1W1A1 3B8UA 3W1QA 4FNPA 3NTYA 4TVDA 2YBTA 1Q5MA 2PWHA 4UQDA 4LAOA 1ITUA 2PGFA 3EPMA 2Z6IA 5IFTA 5GNXA 2X0HA 1ODUA 1MQRA 1ECQA 1VRXA 4MY9A 5CGMA 3AUJA 5AYXA 4O16A 3XISA 4PN2A 4WKHA 3M46A 3VNJA 1SZNA 2A21A 1ZBKA 2FPTA 1X6LA 4AVOA 1QNSA 4ADTA 3CMGA 4Y2WA 1W5OA 1RALA 2OODA 1B31A 1IXQA 1XI3A 2DORA 5D30A 1DJXA 4I9TA 3ZJKA 4C6FA 3P14A 4CNOA 2CLMA 1GT8A 2UBPC 4ZSTA 1LP6A 3TTQA 2V5JA 1A5OC 4ZE5A 4WJ8A 5D9MA 2PCQA 1ZENA 4LPCA 3U4FA 3YPIA 4IGSA 1LBFA 5SWUA 1SO5A 4GZIA 2OZ3A 2Y7DA 2XIOA 5AYIA 4S3BA 4XD6A 3WDHA 1GKRA 1KBLA 4WDXA 4HGXA 3WDIA 3HO8A 4JTKA 3WLOA 3H2FA 1HGWA 1PB0A 4LV9A 3CASA 2E1DA 3SGZA 1A5KC 3T44A 2VQUA 2QDEA 2RDUA 2IPJA 3RM4A 3K8MA 3CH0A 3PPFA 4XZ9A 3E3HA 2B4GA 2QQ6A 3A3HA 3SM0A 4D6CA 5EMJA 1K8ZA 1BF2A 5IFPA 5CC6A 1P0EA 5HWJA 3OBKA 1SW0A 3SQMA 1F9CA 1PCKA 3VMPA 2VEKA 4JKKA 3MHGA 1LLWA 4ERGA 1WYIA 1W9UA 4MZ1A 4S38A 1ZRQA 1ZY9A 4W88A 4IX0A 1SUXA 3AFBA 3CHVA 2P8BA 1CXEA 2QUNA 5EBAA 4JNMA 4UUIA 1FTXA 2NWRA 3ZWTA 3QSRA 1WA3A 2DT1A 2J66A 2E9MA 1S5TA 4UMCA 1BYCA 3KTXA 1LYXA 3BAKA 5DY3A 4MFDA 3GHSA 1VBUA 2EKCA 2Y1HA 1EIBA 3ZVIA 3KZSA 3GDKA 4LNCA 3UXDA 1H50A 1ME9A 1AW5A 2QJGA 1D8WA 3R6IA 4TX6A 2CETA 2B81A 5D02A 3LN3A 2PP0A 2DU2A 3G6MA 1B0IA 4XVDA 4XAYA 1ZP3A 4IIBA 1MQPA 3LLDA 1V8EA 4JEJA 3BQ6A 4ICCX 3ALFA 4TTGA 3CO4A 1XX1A 1D3HA 1F61A 4JDBA 3I7RA 1PEZA 4H7ZA 4IP5A 4IIGA 4GCAA 1C9DA 3VA8A 5AC8A 5CXPA 4QJ4B 8XIAA 1UD5A 3DU0A 3KHDA 2WPGA 2OVLA 1OADA 5DCDA 4Z1DA 4JTTA 2GYIA 2E28A 4GI4A 1R0MA 5BOEA 3ECQA 4ECLA 4AQLA 2E09A 1E4MM 1DIOA 3OGSA 5HANA 3RO6A 5BWFA 1V79A 2INZA 5FL0A 4L61A 2GQAA 4GX8A 3LBMA 1ZNNA 4WKFA 4JPGA 1XLDA 3WDPP 3KLLA 4O52A 4K7VA 2A3AA 2OT0A 2XGZA 1WDRA 3GDMA 1JPMA 4NJJA 5XIAA 2YGYA 1HJUA 2PLKA 3NAVA 4HTBA 1GZ1A 3HM7A 3TTSA 1HF6A 4D8ZA 5BRBA 3APTA 3EWUA 4EXQA 2RUSA 2CWNA 3S6DA 2YR1A 2BY1A 3FXYA 3PTMA 4CEUC 5ECVA 1AQ0A 4LEQA 1B4KA 5CPQA 3AXIA 4QCEA 4K6AA 1RJPA 1YX1A 4GIYA 4XG1A 2J79A 4FX7A 3THCA 3CQ0A 3MI3A 4DZAA 1TPB1 3CHFA 4JHOA 7A3HA 1IEWA 1CLVA 3URQA 4PGLA 4QR6A 2BLEA 4DJEA 1ZBWA 5H1WA 1EP1A 1VCGA 1D2KA 2Z29A 2QYGA 1E6SM 1QK0A 2ZUMA 1LL7A 2WMJA 4E0CA 1KM6A 4J3TA 2NQ5A 2WVSA 1Q6CA 3AIEA 2OGJA 4HQVA 4O18A 1HKMA 2WNWA 1RJRA 2PF0A 2ZOXA 3PY2A 2BVTA 3BG9A 2W3ZA 4Z2HA 1U1UA 1TVNA 1YRRA 5IRPA 1PIFA 1Z42A 4O13A 1R46A 1R9ZA 2B7OA 2I9UA 3LXAA 2XN2A 3LHUA 4O1BA 2DZBA 4UXDA 4QLLA 4GGHA 2CESA 4KCTA 1IEQA 4PFMA 3BW3A 1PSCA 2OXNA 3M5XA 3VKAA 2CBUA 2Y70A 5D2VA 3URNA 4XZWA 5A8GA 2EG7A 4HB7A 1C91A 2W27A 4HVXA 1A4MA 1H0IA 4LVDA 3GC4A 4H9VA 3SRHA 4D6FA 2Z27A 3VIGA 3BC9A 3KS6A 1JDCA 1TA3A 2DJXA 2QCDB 2FVLA 4JNYA 4JHZA 4C6KA 2HRWA 5HWMA 4IMDA 3EXRA 3K4DA 1OC7A 3ZZ1A 1BD0A 4BEQA 2WOQA 3UWWA 4QNWA 3CEUA 3F03K 3WQDA 2NT0A 3HN3A 6A3HA 2PPGA 3AJ7A 1I2OA 4CUCA 2VC7A 4Q4QA 5I00A 1G4EA 1JDEA 4H9MA 4O12A 5F4XA 1UKPA 3AHTA 4NZCA 1O5QA 5BNKA 3ZSTA 3PJUA 3UWUA 2CLIA 3S1GA 3CQKA 3D46A 3GG8A 7REQB 2ZRWA 3HMJG 3THUA 1NY1A 1S1PA 4WSKA 1AL8A 5AC5A 4Q8WA 4W7WA 4YPJA 3ARWA 1BVWA 1SSDA 3DUGA 4WCJA 4GZ7A 3VKJA 2Y7FA 5HMDA 4ALDA 2WLZA 1CEOA 4HNNA 1P0DA 1F73A 2UY5A 3M5YA 4MY8A 3W73A 2OX1A 2VEMA 1LRNA 1XYZA 4CD7A 4AD1A 3KBVA 2BGSA 1I8JA 3PVFA 1WP6A 4MF4A 4JL1A 1VBGA 1LG1A 1AJ0A 4HNTA 1V08A 3NL5A 5AHIA 1J0KA 1QI2A 2HPIA 2QCEA 3WJZA 5A6JA 3DX5A 2J8TA 3EZ4A 3W9ZA 3W00A 5HQEA 1CB2A 3AMKA 3RITA 3EX4A 3WQVA 5U7SA 8CGTA 4A2SA 1DKWA 1E9LA 4BQ2A 6TAAA 1H0GA 3STCA 3TLLA 2CLEA 1HZYA 4IPJA 4IXHA 4L6HA 1FCUA 1GQIA 1XRSA 2PS2A 4OWGA 4A29A 3DYMA 3DESA 1J01A 2HSAA 5E93A 3SO7A 1DHPA 2XIJA 1O1ZA 3G2GA 2WSPA 2BOGX 1X8CA 3DGRA 2G8ZA 2Y89A 2NQ9A 4UTLA 1TIWA 1OFBA 3UU0A 5A6TC 4YVXA 1GVSA 1QMLA 1HVXA 2A7RA 3IEBA 4JNZA 3A64A 3WSUA 1C3FA 3NURA 3W1LA 5JBDA 3ZS4A 3CZEA 2PLMA 1TIMA 4PMRA 2G3NA 1R2SA 3CL8A 1FWAC 1HKIA 4AIUA 1RH9A 3FNDA 4WGHA 3LS9A 3BK0A 1W9XA 1EXPA 1M7XA 2R94A 3W7CA 4LUJA 1NH6A 2HQAA 3LGDA 3MMUA 3WBEA 3MY9A 4J27A 4I8DA 4H83A 2A7NA 2D3NA 1FHLA 4C6OA 1AVAA 4YTSA 5LA2A 3BAXA 3DECA 2PUZA 1TQXA 1TZ7A 4KERA 3U2ZA 1UKSA 1K9EA 2VT0A 1TWSA 3VUPA 4G7EB 1EBGA 2ZZ7A 1JUBA 2VDGA 2F6KA 3CLWA 2WXDM 3A5VA 3HJEA 1M6JA 2ISWA 3GVRA 5CPNA 1CW2A 1XLCA 2EBNA 4C6LA 3Q2DA 5KTLA 1VP5A 1EFZA 1SR0A 4I5RA 1UBPC 1P7TB 3PPGA 1S3HA 4AYGA 4FEZA 3UJSA 3N29A 3GZAA 4K1WA 4MKSA 3CAQA 2BHUA 4HYRA 1UPMB 1US2A 2WSQA 3PNUA 1E1CA 1KTNA 2X7WA 3PZOA 1A5AA 2O7SA 3T07A 1HJVA 1U5HA 3VU2A 4MB1A 3LZ3A 4MWAC 2QPSA 4AH7A 2C3ZA 1H7PA 3THAA 3IIXA 1FFRA 5A8MA 2DZTA 3ME3A 4ZB0A 1HVQA 1MVYA 4N02A 1ICSA 1TRDA 2B7PA 4JXCA 2BXZA 1BRLA 2DP3A 4YVPA 3WBXA 3GTFA 3WFZA 3BMVA 3VIHA 4OZOA 4C6QA 4N2YA 5HA7A 3IJ9A 4F0LA 4DLFA 3M7SA 1UJPA 4JTQA 1BQCA 3BZGA 3CV6A 3H8AA 1HUVA 5DLCA 2WM0A 3KBMA 4XD5A 1R3VA 2W67A 2FHFA 3RCNA 4RX0A 2F38A 4EPDC 4OUIA 4HU0A 1F3EA 1GZGA 3TOPA 3R5EA 4FO4A 2CBJA 1G4TA 3D3FA 2NV9A 2OQHA 3DG6A 2I9EA 5DY2A 1UWQA 1QHOA 3JZEA 3VDCA 1CPUA 4TQTA 1SZFA 4IM4A 4DPQA 4WLCA 2FPYA 2D69A 1Q3NA 2V3EA 1E9ZB 2E6FA 4NYUA 4PTWA 2OO6A 5DCBA 4KWSA 2G3IA 4GK8A 3WY1A 3CM4A 3QC0A 1OFRA 5DMNA 1JYVA 2RGLA 2ZX9A 4DJFC 1UOZA 3UXIA 3VOGA 3CWHA 3GR7A 1C29A 2PDCA 3S9YA 4N9BA 4ZMGA 3ZWSA 2NUXA 3TXZA 3NGJA 1KTCA 1ZUAX 1W31A 3DHFA 1W2VA 2D2GA 2Q8LA 1TV8A 3M0ZA 4UOZA 3WMSA 2PAJA 5E0KA 2HS8A 2PODA 3ARUA 5KZMA 1MRQA 3QHNA 4CU8A 3W7DA 4JTFA 1OQFA 2PDKA 2XISA 4GYPC 4QEEA 2X09A 3UYCA 5I6SA 4U3CA 3NR0A 4B4HA 1QW7A 4JIQA 4DXVA 4D6EA 2QXWA 1GK8A 2WHJA 4D2JA 5LGXA 4LUTB 4PTNA 3FGCA 3LBCA 5GJPA 4CQCA 3SB0A 5A1AA 5FAJA 5A69A 1QATA 2NVAA 4PSPA 4I6VA 4ZO7A 2WJZA 1V02A 1ADSA 3HQ1A 3W37A 3DC0A 1GVYA 1DIDA 4L6OA 1TPDA 3IIOA 1LRQA 4JOMA 1RA0A 3WELA 1US3A 4O15A 1YBQB 2W66A 4MY1A 1GTEA 2OLSA 3NPUA 3CWNA 1DWFM 4Q8TA 3MZNA 2WHMA 4MB4A 1Q65A 4UNIA 2VX7A 3GTXA 3CWOX 2YXGA 3OZOA 4MUZA 1XYMA 2CEQA 4ICNA 1JUKA 4AEFA 3ES8A 3UA3A 2WVVB 3KOYA 4JX4A 1R7AA 2H9AA 3KL3A 3WLTA 3GBEA 3GNDA 1Q6DA 2J62A 3CAVA 2JGYA 3PWIA 2NLYA 1G7VA 3KRUA 3ZJ7A 3BE7A 1R5YA 4IT1A 4YVVA 2DH2A 3EDKA 1FH9A 1WX0A 1POJA 1Q7MA 2DZSA 4EKJA 5CPMA 4NNAA 3THDA 4QSHA 3RLVA 4U10A 1E1FA 1BXCA 4HOXA 2W5FA 5LHFA 3CC1A 1OFAA 1X7FA 1Q13A 3USBA 1M5WA 1KWGA 5H2ZA 3RFAA 3M0LA 3R4IA 2AMGA 3B8DA 3F5KA 3WDQA 1BWLA 3IV3A 2XH7A 3ITCA 4WRHA 3G22A 1AJZA 4O1DA 1KCZA 4NSBA 5T9CE 3A21A 1RY0A 3JRKA 1GQLA 1KRAC 3ZFHA 3BARA 1ZAIA 1RV8A 1XLHA 5G4HC 1SO4A 2XWDA 4PUNA 4AVNA 1W1VA 1KR1A 4HN8A 1TJRA 2NXGA 4H9UA 4QAWA 1FWWA 1M7JA 2H90A 2PDFA 2DZXA 3L4WA 3L4TA 3HG2A 4GVGA 4I9AA 3W0KA 4FAMA 3W70A 3HPAA 3SEPA 3UWVA 1E72M 2PDNA 4RCXA 4S3EA 4IGMA 1UASA 1KKOA 1YDYA 2QEZA 4WDTA 2RFGA 4GPNA 3G6LA 3AXMA 3EPOA 4QX4A 5G2IA 2X05A 3BV7A 3DDMA 1BQGA 1CWYA 1SSGA 1HKKA 2YZ5A 4UTWC 4QJ1A 2NT1A 2P10A 2QPXA 4LB3A 3W7RA 2VFGA 3GH4A 3FJ4A 3NZQA 3LHYA 3MWAA 4MDOA 4R34A 2VRJA 4L4PA 4DI8A 3GG7A 2X16A 1RXOB 2DIKA 4JIIX 1AMYA 3C8NA 4XBJA 5JUVA 2NQJA 4EXBA 1PZ1A 3R94A 3QTGA 2R9RA 4AD5A 1KXTA 1F05A 2NSOA 1K8XA 3SADA 1VLIA 1XJBA 3NSXA 3UPWA 5E5CA 1OX4A 1VFFA 2XJ7A 2OQYA 5FAGA 4HNCA 3BQ5A 2DH3A 4DWDA 9RUBA 5CLTA 3DCPA 4MIMA 1QWGA 1XYLA 3W82A 2ZWYA 1ZJHA 4US5D 3GR8A 3C3NA 3VD4A 2L5HA 1CX9A 4JFUA 1I0DA 3W87A 3CT7A 3H70A 3HG5A 3NQ2A 3M6YA 2XFYA 1IIGA 4MM1A 1EJRC 2VFHA 4WJXA 4ZXLA 3AALA 5I77A 2YX0A 2VURA 2HTMA 3M0JA 5DELA 1DJHA 3BCJA 1WV2A 4N6FA 4GACA 3U3HA 3W7IA 2QCHA 4GWEA 2RH9A 2QCCA 3B9OA 3KRBA 3LD5A 5CSUA 4RW5A 2YL6A 4ICMA 4KGLA 3ZT6A 1Q4NX 2ISDA 4BJHA 4BF5A 3NSNA 1RP9A 1XLLA 3PN8A 3ABSA 4CCDA 1QPQA 2YPIA 3ICJA 4LBUA 1E6NA 4BY3A 2E8YA 4BF7A 3UG4A 1JCXA 5LNUA 4F40A 4LWWA 3TU9A 3TVAA 2ZVRA 2OEMA 2X1TA 4GY0A 4O11A 3MWCA 3WLIA 1RA5A 2E8ZA 3R0DA 3QGKC 1LL4A 2IPGA 3ZVHB 1XIBA 2XM1A 1X98A 1C7SA 3V4BA 1BRLB 3A12A 1D7KA 3WK1A 1G9HA 1UMYA 2CZDA 1DTNA 3PB2A 5LHEA 4DBUA 2ESCA 4MLJA 1CXLA 3T0AA 3WLHA 3O1NA 3LGGA 4IZGA 2OX4A 1J18A 1QNOA 3LU2A 3ZIZA 4JQ4A 4L7ZA 2C79A 3II1A 2IQ0A 1BTMA 4B9YA 1IEVA 3HOJA 2YLLA 5T91A 2VEFA 3BGAA 1PTDA 2JBMA 2CXEA 1PVNA 1ZFJA 3RMEA 4S3DA 1TTQA 2ISSA 5DCEA 4PEEA 3G5EA 2XGBA 4DAIA 3IK2A 2PGWA 3FOKA 1ISVA 4DJFA 3EXSA 4IOTA 4OVXA 2CZEA 3WQ4A 3E38A 1R2RA 2OQLA 3R11A 1OFDA 2YOCA 1KD0A 2CU0A 4W7VA 4MVAA 1R3YA 1KO0A 2I1OA 1OHLA 2ZUTA 3GFZA 3DZ1A 3G0XA 4QP0A 3INPA 2OCZA 1XBVA 4GYPA 1UPPA 1XQLA 4NX5A 3I6TA 5E9XA 3PAOA 3STGA 1A4LA 3SAZA 2E5BA 3R79A 2B7NA 3RLGA 1UC4A 1DQWA 3W75A 3VD9A 4FNQA 5D4YA 4CKQA 2RJGA 3HMCA 1FCVA 2PLCA 3W02A 1CLXA 1K7FA 4KWUA 1SZEA 1VFLA 3GK0A 4FA3A 4MNLA 3UEQA 3WLPA 3SW6A 3CPGA 1RD5A 1AW2A 2X42A 4W93A 2QMKA 1XD1A 3PPCA 1NOWA 2GJPA 4GQBA 3O07A 2BB0A 3VABA 1JCNA 3CUHA 4F79A 3C2RA 5LIUX 1M03A 2FMNA 1JZ4A 1T8QA 2XIQA 4DO7A 2GVEA 4MHBA 4CQAA 1E51A 1RJQA 4LBSA 3DEQA 2X41A 1JNDA 1G4SA 2TMDA 2VRQA 3G77A 4ATDA 1UA7A 1CLKA 1N55A 3E49A 4X61A 4Y9OA 3NYZA 2FZBA 3QM3A 3WF3A 4B5XA 4JTSA 2G4JA 1S38A 2WC3A 3LTSA 5BOFA 1TJ1A 2IKJA 7ENLA 3BANA 4Z2JA 5F7UA 2X1UA 2GJLA 4ZB5A 2WAGA 1QOXA 1KRBC 4TX9A 1O4UA 3WNKA 4GD0A 1TTIA 3MA8A 4PCTA 3WJYA 2DSKA 3W74A 1VC4A 3EXTA 1UD4A 4P8UA 1A5SA 3MBFA 3B8IA 4HK5A 4J5NA 3TQ0A 1CT5A 4N4PA 5HUOA 4LAKA 4MDPA 2R91A 2XM2A 4NUWA 5AHEA 3L68A 1JAEA 3NG3A 3QR1A 4TMBA 2F7FA 4Q33A 3RYSA 4C6DA 3FHQA 2QUVA 1IZJA 3DHDA 4LVBA 2DVTA 1L8PA 3R0UA 4LW7A 5DXYA 2J27A 3VKBA 2RHGA 3CS2A 5I3DA 3VCNA 4EOUA 3WFAA 4TV6A 4GVIA 2ZA1A 2PDPA 5D8WA 4W89A 2FLIA 3WH8A 5K3VA 1XRFA 5A6AA 4NI8A 4FNUA 3JVAA 1OCNA 2VGBA 2PWGA 2GDQA 3VDGA 5BROA 3FLUA 2OOGA 2D20A 2YL9A 4PMYA 1FKXA 2HWGA 2DGAA 2NQLA 3G1VA 4XWUA 4ACYA 1JQXA 1VHNA 1CXHA 5A2BA 2R1LA 4UTWA 2DEPA 5HNNA 3WLQA 3D5HA 3TTEA 2D0HA 2G97A 4QHRA 5D2YA 2ZRYA 3QF0A 5AN7A 3BZJA 3OYXA 3SJNA 5I09A 3VD5A 3FJLA 4MYAA 4QRNA 3M1ZA 1MXGA 2J7HA 4RZ5A 3WBAA 4ZO8A 4JTLA 4RE3A 4DJDC 4CEXC 4IUGA 2VQTA 3AOFA 3IGSA 1Q66A 3AS2A 5AVNA 5GNZA 4EIVA 1RAKA 5AOUA 4BS0A 5KEZA 3URBA 5C70A 2XVNA 3B0YA 3M64A 3IVUA 2VC9A 1WKEA 2X2GA 5D38A 4AMAA 3LG3A 1JXKA 1OX4B 1HKWA 4QDWA 3SIZA 4CU6A 5FF7A 4MLRA 3QC3A 1F3TA 4OFCA 1NEYA 4J3ZA 4GRSA 3WF0A 1AH0A 3WCZA 2HXTA 1C93A 2R8WA 1J93A 3B03A 1N8FA 1ZBVA 3LCXA 3P84A 1RCQA 3I3BA 3QYQA 4JN6A 1AODA 3N4FA 1REQB 4YTUA 4V28A 1POKA 3RRAA 3LERA 4YYFA 4PZVA 3IS4A 4IPPA 4DXXA 2ZUUA 1XPGA 5EMMA 1UWIA 1W3JA 4PC8A 1W1TA 1PDYA 4Q6JA 3CB8A 3TN6A 4JCLA 4JQ3A 1JRBA 1TQJA 4HNVA 4U5KA 4RR4A 3VILA 3FXGA 1M3UA 4PTDA 1XLAA 4S3CA 3PSWA 4B92A 1XQKA 3GXTA 3NDZA 3RO8A 3LQGA 1VHCA 3BPWA 4U2YA 5TNVA 4HHLA 1ZB5A 1F2JA 3R1ZA 3W1XA 2PZNA 4QG8A 4MTVA 1XBXA 3FFSA 1UP2A 4O14A 1TV4A 1P4CA 1SZGA 4QQUA 3GS6A 3TUUA 2WZHA 4MWAB 4K37A 4X60A 1NFPA 4PMJA 2E6DA 1KRMA 1TPVA 2EQDA 3GWQA 4DUWA 3W7JA 2R14A 1SW3A 3QV9A 4JTRA 4NQ1A 1IR2A 1B90A 1AQFA 1GG1A 4GQQA 2QNEA 3GXIA 2GFTA 1U2YA 1LLOA 2PLJA 4XZNX 3RX2A 1RSCA 1XLMA 2FZNA 3SCNA 5LIKX 3TZNA 2QMJA 4UTHA 1W5NA 3WUBA 3PM6A 1IV8A 2QT3A 5FSEC 2C6QA 3QKZA 3PZQA 5FIPA 1B2YA 4NIRA 4E6MA 4O8AA 4RNHA 1UZ1A 4N0RA 2AL2B 5JBEA 3TN4A 4BR1A 1JDDA 3CQHA 1YNYA 1JFHA 3TIMA 4C91A 4EVZA 4B2DD 1WZKA 4G8TA 3ALGA 3CZLA 3NXFA 4RXGA 4PUJA 3GX9A 2BOFX 5D2WA 5MHBA 4QTGA 1DWJM 2P3ZA 2QUUA 5CBIA 3W26A 2VCBA 2ZRUA 4DM1A 1LWHA 2WZTA 3EB3A 5IHRA 3GVQA 4NZFA 2EPKX 4R9OA 4QLKA 4NI3A 3LOTA 1T96A 1GQJA 2YDAA 4LAMA 2PP1A 2ADAA 4GBDA 4C6IA 1KQYA 2V2DA 2C1IA 3NQFA 3S1XA 1VEPA 3P61A 3VNDA 4FXSA 4O50A 5F2LA 2AL1A 1LF1A 1KB3A 4GXWA 1V3JA 1P6BA 4XX6A 3V5FA 1WOBA 1GWJA 5HMEA 2H3DA 1FWGC 1PWLA 2HCVA 5D9NA 3QLLA 1XHGA 1DJYA 3BOXA 1KGUA 1V6TA 3W1AA 1OINA 3OZPA 3DG3A 5BOOA 1AH3A 1W8SA 2VUYA 4Z42C 1XIIA 3QV7A 2PDJA 4AWEA 3U5YA 1E6QM 2P50A 3O16A 3GAKA 4M29A 1ZJBA 1QI5A 2YCKX 1I60A 4M6PA 4HU4A 4QNEA 2WWCA 3B4UA 4AFYA 2F8QA 1TFVA 1XIFA 1UD8A 1JCMP 1BWVA 3OHMB 1C90A 2QUMA 3S6TA 1JVNA 3ERPA 4HMDA 2OR2A 3VOJA 3DFHA 1ADDA 3RR1A 1IXOA 4GQGA 3TC7A 3SSZA 2Q71A 1J5TA 2ASHA 3WQ5A 2D73A 2YLAA 3AIWA 4K36A 4OT7A 3UR7A 3T0DA 1PKYA 1OVDA 3MO4A 4IMGA 3TLQA 2AQWA 3PP7A 3RUBL 2GQ8A 4FLQA 3CHCA 3CUGA 5K9DA 2W79A 3PZIA 3AYRA 2DV0A 3GB6A 3PZMA 4YXGA 3L21A 4CCEA 2J88A 1K9TA 4MUPA 4O4VA 3WD3A 1UWUA 2ZIDA 1LUCA 1X39A 4IFRA 4LX4A 1I1WA 1VPYA 3KCJA 3I4EA 2V5BA 3NEHA 3WMCA 1UCWA 2DSVA 3UVAA 4BHYA 5HR6A 3CIWA 4XO6A 4HPHA 1XCXA 4JTIA 5FKYA 3SZ8A 1K7XA 3NQGA 4L80A 1K4HA 1GHSA 4HPXA 9XIAA 4XVEA 1TELA 3SIMA 2PDMA 4JFVA 1YXDA 4C6BA 2V68A 2PFHA 4IUOA 1WAWA 3EA3A 3L4YA 4ERIA 4QDMA 4PB5A 3H4WA 2G50A 4N4QA 2ATMA 4PMZA 3T2OA 3NL2A 3KBJA 2GJXA 3UNDA 3O6CA 3QHOA 2PI6A 1RK5A 1AZ2A 1OJXA 4JBRA 1BG4A 3G1FA 2GWNA 3E9AA 4GVHA 2ZKMX 3IAQA 3OEXA 4U3AA 1ZJIA 3TV8A 1RQEA 4AZ7A 1QHPA 8TIMA 3MJMA 3S1VA 3KBNA 2VP8A 3L66A 5M2FX 4F0KA 2HXUA 3GO2A 1PIIA 4ILSA 3AUOA 3UGVA 3UCCA 4AZHA 4P7OA 3F4WA 3T4CA 1QT1A 3OBEA 5E0CA 3M6DA 2CKRA 2DZAA 5C5YA 2ATSA 2VFEA 2BVDA 3M41A 2G3JA 1I2QA 5BYWA 3IJDA 2VZUA 1VEOA 2JE8A 3HQPA 5CLWA 4KFOA 2X8RA 5LIYX 1E3XA 1XYCA 4KRTA 3ITXA 2MANA 1SFTA 4UTFA 3KS5A 4C6EA 1R38A 2CZFA 1UR0A 3TAKA 2E77A 4Z17A 2WVTA 3VM7A 1SM9A 1B9ZA 1MXSA 4YL2A 3TC3A 1TMLA 2YCLA 1R8LA 3KOZA 2VM8A 2HS6A 1RCOB 1XDMA 4DJDA 2BSLA 3PB0A 4XBKA 3T78A 3T55A 2WQPA 4FF5A 3GVWA 2FVMA 2HROA 2FJKA 2DT2A 1ZHAA 2RDXA 2ALDA 4UWMA 5C9ZA 4Z2LA 4QE5A 3A3WA 4UQBA 2E5CA 4PFHA 3B3DA 2PSNA 3MVTA 4M80A 5CBJA 3G24A 4XQ6A 7PTDA 4L1XA 2DFAA 3G0UA 5HK4A 4KS0A 1VH7A 4K2SA 3B0VC 3TOYA 4JTHA 2NQHA 4XZHA 3O8AA 1HP5A 3BAIA 1XINA 1OGSA 1V0MA 2A79A 3NGFA 3B0PA 3ARXA 5D33A 3FX4A 3NXLA 4OQVA 4WGXA 4GFSA 1YQ2A 2DSWA 4JIHA 1NDVA 4Q7IA 4K8GA 2BODX 3CUJA 5E1QA 3JU2A 1EF3A 3P7YA 2RDWA 1H7NA 1UR9A 3AROA 1L9WA 4PBGA 4X0VA 4HU3A 1XYAA 2XH0A 5JMUA 3QSTA 1TWWA 3LRKA 2O56A 3IJ7A 5CPLA 1QPKA 3AYSA 3LEPA 4O1EA 5KZEA 3ITOA 2QF7A 4KWWA 1NSJA 4PBEA 3GNXA 4HSNA 4V2XA 1OD0A 2H6RA 3EX3A 1EC8A 3AZTA 2D2HA 1S2VA 3EGJA 5IOBA 4Q8MA 4E3TA 2V82A 5AZ1A 1TJ0A 4LYRA 1E0WA 3ABXA 3ES7A 3TJ4A 4DY1A 1A0DA 4J3VA 3TH6A 2OT1A 5FEWA 1B3OA 1UKTA 3CUFA 3EPNA 5I03A 1PX8A 2E7FA 1IZCA 1X1NA 4EK7A 1BGGA 1YPFA 2DPEA 3MBDA 3QTPA 4UTIA 3S2CA 3N9SA 3KX6A 1FWBC 4DWSC 2UWFA 1O12A 4NAFA 3M43A 4QROA 5F1UA 4MZYA 3PUGA 1TPWA 3ORWA 2Y7EA 4RDVA 1KFKA 1JGIA 1JXJA 3NCOA 1T6MA 1R3RA 4L4LA 1QRQA 3BLKA 5B7ZA 4GYFA 3WF1A 4F48A 3G18A 1DEDA 1LJYA 1H11A 4C7DA 2GK1A 3IVTA 2NX3A 1XLFA 2O9OA 4EPKA 1OD8A 1VIWA 1MUCA 4G1NA 1YEYA 1S39A 3BLIA 1PXGA 1QW9A 3L5AA 1IT0A 5HMSA 4FB7A 3HGSA 3P2VA 2J77A 1GEQA 5C7VA 1ZCCA 1RR2A 1DIKA 3MDUA 3JR2A 4H9ZA 4QG6A 3S83A 4ZSUA 3TONA 1EGMA 1BSLA 5LSMA 3UWYA 2Z1BA 2WBGA 2XSAA 4N7QA 3TR2A 1L0PA 4MKVA 3B8WA 2YBUA 3M9YA 5A2AA 3T42A 1V6UA 4DLMA 1B57A 2VVNA 2OG9A 4NAEB 4TXEA 4XB3A 1IZKA 5G5IA 3KAOA 4B3ZA 1DVJA 1XC6A 2NVCA 4AHQA 3QKEA 3T0CA 1OX5A 1UR8A 5FA5A 5B7YA 3QW4B 1A5CA 1RBAA 4E4FA 3H4XA 3M0IA 1YPIA 3QOMA 1XIMA 4NILA 5TAOA 5F4WA 2GSJA 1OM0A 1F8MA 1OFPA 4F2BA 2YA2A 3LGEA 3NQEA 2BXVA 1G69A 1XF0A 4C1NB 5DMYA 1U1HA 3Q65A 4IMAA 1BG9A 5C2XA 1EKOA 3SQSA 3MUXA 2QDHA 2VENA 4NRSA 5ABEA 2PWFA 1GOWA 1P0KA 4R5EA 5D9OA 1QXLA 2OWXA 3N25A 3M07A 3GU2A 1UR2A 3E5PA 3WLJA 3EA2A 4A3HA 4F9JA 3L0GA 1H7XA 4A05A 4M81A 1GW9A 4OUEA 3N2MA 4ZOEA 3MKCA 1LUCB 1QVBA 2Y4SA 4KCVA 3EOOA 3EEZA 6PTDA 3VDBA 4O53A 4WD0A 2W63A 1D8CA 3RDKA 2TSYA 5AYZA 4U33A 1UG6A 4ATLA 2JK2A 3CIXA 3KBSA 1E4LA 5EY5A 1H62A 2WCAA 2C0HA 3EKLA 3GKAA 1PIGA 4HTYA 3S5NA 1J6PA 4DXKA 4P7NA 3QGVA 1VIZA 3DC8A 3VIMA 4N9EA 4JAWA 3AWOA 3C5QA 1PYMA 3BL3A 4UTKA 9XIMA 2BWGA 3W85A 1HT6A 2ALRA 3GVGA 1JEZA 3IK4A 4FR1A 4RE4A 1O5XA 5FI8A 4DPPA 2DZUA 4JZ5A 5IHSA 3M16A 3HV9A 2VZOA 1NP0A 3RPMA 1R3SA 2QGYA 3VO0A 4MOZA 3UR2A 5K7JA 2OEKA 5RUBA 4PYSA 1K9FA 4JIRA 4A22A 2HK0A 4PRRA 4A6GA 1I6NA 2NXHA 3P60A 3BLFA 3EEGA 3IARA 2Y0FA 4US6A 2WV8A 1H51A 5HWNA 5F2MA 5CPOA 2B31A 1CGTA 3QV8A 1S2UA 2VMFA 1R87A 1ZGDA 3LY0A 4K38A 1QPRA 2EF9A 3ENLA 3QLDA 2YXOA 2VGGA 1HJXA 4WY0A 4Y90A 1M1BA 1XIJA 3IGUA 3BSHA 3TR9A 1QPOA 5CZTA 5AFDA 3LSCA 4LQ1A 5I2UA 5G4EA 3L0KA 2Z1WA 4AWTA 1W3LA 4O57A 2YCLB 3AHVA 3WL0A 1WNOA 3OB8A 4LANA 1B1YA 3K5XA 4XTDA 1KM0A 1H2JA 3UCQA 2ZX5A 6XIMA 3GFYA 3HFTA 4IMEA 4NZ4A 3T09A 1J6OA 1EHAA 3S5ZA 2BTMA 5DN1A 1TKKA 4CVWA 2QJJA 2YW3A 3HQOA 2A6NA 4V15A 1JUEA 4DYEA 3SY1A 4WZHA 2D1ZA 4A8RA 2CBVA 3SR7A 4ZQRA 4CGTA 2W61A 3NVTA 5LIWX 4OHQA 1SJBA 1WZAA 4BWLC 2JGQA 5E9AA 1DXFA 2OO0A 2ZBTA 3KFTA 3ANVA 1EL3A 5CGTA 1OZQA 3BOFA 4AB4A 5A5WA 4JD4A 1DP0A 3W53A 5JVLA 4M1RA 4ATWA 3GHTA 2XPKA 1EUAA 1OG6A 3F4CA 4D6IA 4NJIA 1BLIA 3WNPA 5LNSA 1QJWA 2X2YA 2DSZA 1E70M 3ZQ9A 3UFYA 4J7RA 2TODA 5CQ1A 5KZDA 1YKWA 4R88A 1QU4A 1YIXA 2VEPA 3P82A 4FLOA 1HKJA 1XUUA 2ZZ5A 1OCQA 5BWAA 3AIVA 3CU2A 4IIHA 3GNRA 4UTUA 2C16A 4R3UA 5FEPA 4R33A 2E9BA 4OOUA 5EU9A 3WD1A 2ISFA 5ABFB 3HTWA 3MUCA 4QCFA 1UWSA 1ZAJA 3BJFA 3UY8A 1FDZA 3F2BA 3AU2A 4XIMA 3VIFA 3WJWA 1UQYA 1LOLA 1WXJA 1SFJA 2EPNA 3K1GA 5G2WA 3QPZA 4EP8C 4HCDA 4HMNA 1E6PA 3L2IA 3NDOA 4DWSA 3W1MA 3IIPA 5EFDA 3MSRA 1DJZA 4YLWA 4RLIA 1NOUA 1ZU8A 1JPDX 1U5JA 1RPXA 1V3MA 2E40A 4W8BA 2NVDA 4L1GA 3BCFA 2H3BA 1FXQA 2Z2AA 1XG3A 1WXYA 2VC5A 5A6SA 3GAYA 4LRSA 2GUBA 1JNEA 4ENLA 3WQGA 4IGNA 3LLXA 4EANA 4KESA 1KW1A 3HGOA 1AZ1A 1KM4A 1FWFC 3GBDA 3H7RA 3PBMA 1CGWA 1GKQA 4RE0A 1HQTA 4GI8A 1TV3A 3W24A 3RHGA 2WCGA 3GNPA 2XUCA 2WMGA 3CB3A 2XN1A 5I24A 1AMKA 2PBOA 5CJNA 2AOSA 1FFQA 3I7SA 5BZAA 4JR5A 3S6OA 2CYGA 5CZ0A 4PULA 5M1TA 2O92A 3FHAA 5C2GA 3DFTA 4F8XA 5EBUA 2ZA3A 3UPBA 2PBGA 1G94A 3F7JA 4MADA 4ZB2A 5U4NA 4WSHA 2J75A 4JYEA 4Q4PA 2EO7A 4HZ7A 3W2MA 5HPOA 2Q09A 2F84A 1R30A 3C0JA 4MWAD 1JFXA 3RM8A 3A4WA 3DIPA 4H2CA 3O6AA 4A35A 1GTHA 2ZE0A 4LTSA 3W7GA 1PKLA 4LC6A 4RV3A 4J28A 2ZCGA 1S2TA 1PTGA 3G1RA 3P0WA 4LUSB 1TV7A 2XVKA 2CZVA 3PTDA 1Z44A 4NZ5A 4S3GA 3USZA 3KM8A 4PL2A 1DL3A 4RNJA 4U2ZA 2FZ9A 2XH2A 2XHYA 4K7YA 4DX3A 3PZNA 1JL8A 1ALDA 5DF0A 4LXFA 4M3PA 1UUMA 4DJEC 4DF0A 1PKMA 3EKZA 4RDYA 1EJSC 2WPBA 4FP1A 1LZOA 1K4GA 4XKYA 5D32A 3FAWA 4R7OA 3MUY1 2PC4A 2ZUWA 3VNYA 1ICQA 2J7EA 5LNVA 3RGTA 1XYFA 5LA0A 2OTDA 1OIMA 1Z8AA 3BAYA 1TTJA 1FH8A 1QUMA 4X63A 3K8LA 3FEQA 1PL9A 3TQVA 1H49A 4R7WA 4B4FA 5HMFA 2J9ZA 3QW3A 5IM51 2C91A 4ERAA 1KCKA 2DUXA 4Q4MA 4L56A 2ZRXA 4CQ9A 3SCUA 1J0ZA 3VINA 3HU7A 3GU1A 2VKZG 4D1JA 3UZYA 1M65A 5BU9A 1HW6A 2Z1VA 3QHMA 3JS3A 3W38A 3LM7A 3FS2A 5BXPA 1NIUA 3ZR6A 5C0QA 5G1TA 4Z0SA 4WQ6A 2FVKA 1PYFA 4OBSA 5CPTA 3WQFA 1LL6A 3GIQA 1WDSA 2RKXA 1TCMA 4KFPA 1XCFA 2C14A 2IPFA 3MMWA 4MGGA 1GKPA 2WVUA 4ZE4A 5CKSA 1FKWA 3NO3A 1T7LA 3AIRA 4H4IA 1ADOA 1J0HA 2DDXA 3AO0A 3LCLA 4YYCA 4NL1A 5E6YA 4IG2A 1XIDA 1F7BA 4ACZA 5T8GA 1W9VA 3K4AA 1K03A 2AAAA 2GQ9A 4UQCA 1V0LA 3A47A 3WDRA 2QKFA 3W76A 1S1RA 1CDGA 4Y8FA 3ABQA 4UCGA 2WKGA 3B8SA 3WO8A 4AW7A 2QJNA 2PD5A 4HSOA 3UYIA 3DOPA 5B80A 2NUYA 2PDQA 1W1YA 3E0WA 1DJQA 3TDFA 3UA4A 3EWBX 2QULA 4GY1A 1L6WA 2VYOA 1E3ZA 1F3WA 4HHPA 1IGWA 2FH6A 1FHDA 3G0SA 4LS1A 3EA1A 3L65A 3CL6A 3N34A 1HKVA 3REQB 3AI0A 3T1GA 1TWDA 3KE0A 1K9DA 1H7WA 5DFAA 3H2EA 1YNPA 1NDWA 4WY0B 4AZCB 3UG8A 2A3CA 1GVEA 5KZ6A 3E12A 3HZ3A 3DFNA 1IXNA 2C1GA 2D24A 3QZAA 2PDLA 3C2EA 3AMCA 1UROA 3GW3A 4J2MA 1KLYA 1W32A 3ZXWA 1KBKA 2PDHA 4NG3A 3E0FA 3LK6A 4REQA 2WK2A 3RRXA 3QJAA 1DOSA 1LCOA 2JQXA 4BWLA 2W62A 3IWPA 2W6RA 1S2CA 4ONVA 3E2RA 3CEPA 3KHJA 3S3GA 4JTCA 1C9WA 1EF2A 4P7RA 3SRDA 1XR2A 4LYQA 2RDTA 5DQPA 3VX1A 3ZOAA 4LY4A 1J0JA 2PTZA 3EKGA 4GUHA 4D6DA 4CN4A 1VCVA 4QG9A 5BXSA 3N3MA 3IJ6A 2R6OA 3N2BA 4G7FA 1P1XA 2KAUC 3O6DA 2NX9A 1WXZA 3J7HA 4UFLA 1GPWA 1ZL1A 3WK2A 2ZDSA 1A3XA 1F4HA 1Z69A 3TROA 2V5LA 4IFKA 2VEIA 4FR6A 4U28A 1CI1A 4GUJA 3N6QA 1L6YA 2FZDA 1MEIA 1NTHA 2WMIA 3V16A 4NASA 3R10A 3MKVA 3C3UA 3MCNA 3QY6A 3DYPA 4RNFA 2XIMA 2O55A 4X3ZA 5HULA 1S5VA 4HIBA 1B30A 1I2NA 4S3KA 1HJQA 2XSBA 3LNMA 4IQJA 5BCAA 3GYCA 3W1TA 3IRDA 2F2HA 1X6UA 4RL3A 1YADA 1QNVA 1PTAA 3U2OA 3ARZA 1O1HA 3P74A 4S1FA 3CXOA 1XGEA 2ABBA 1NWRA 3VCRA 4DZIA 2P0IA 3BGJA 4Y6GA 2EHHA 1DE6A 3QR0A 2QCMA 1PAMA 1DJGA 3E1F1 1EGVA 3ISIX 3ATYA 3QRHA 3W7MA 4DWSB 3B9NA 2WMFA 1VFSA 4GJJA 1IXPA 4BCEA 1P6CA 2CITA 1IF2A 3C2OA 4A3UA 1KFWA 5G2HA 4L6DA 4PA8A 2J7GA 1XXXA 1NOFA 3KBWA 3OA5A 3SGUA 3EWCA 1E71M 1TUXA 2XGIA 3L4ZA 5FSDC 1O7AA 2A2IA 1ONWA 4QAIA 2V38A 1M04A 3BAWA 1W3NA 4JTGA 1H5YA 2WZEA 3R0KA 1NWTA 3FDKA 4C5YA 1C7TA 4CNNA 3ZMRA 1XLGA 1G1YA 1CB7B 4OV9A 1KFBA 1W3IA 2G3FA 3DH7A 5HNTA 1N8WA 1OCJA 3GIYA 3E02A 4AWSA 3NVDA 2IS7A 4CNPA 1R3TA 5ABHA 1SO6A 2B7QA 1GOXA 1ZTVA 1GVRA 1WUFA 2CLFA 2P5NA 4DBWA 1OC6A 5H8MA 4FNSA 3U2EA 3KCOA 3EB4A 2WM1A 2ZADA 4E4PA 3OG2A 3AQUA 4B91A 2Y6ZA 1KFJA 2R82A 3C6CA 3L2MA 4GC3A 2G0WA 3QXBA 2OELA 2PB1A 2JKAA 3PZ9A 4LSBA 4MFEA 4J2PA 3WYZA 1OYBA 4AZGA 2F6UA 4ES4A 1GYMA 4KF1A 5A8NA 3UJ2A 1QI4A 3QH2A 2YZRA 3BCDA 3CZKA 2ZC1A 2REQB 4DUVA 3A23A 3S46A 4NJGA 3WLRA 3LUTA 4L1WA 3CYVA 1OK4A 3GDLA 2BOEX 4LS2A 1J0IA 1XGDA 1WDWA 4QDPA 3VOIA 1LDCA 3KL5A 5MF5A 3WMLA 1XIGA 1ZSXA 2IXVA 2QS8A 1ITQA 2ZVIA 3O0KA 3HPFA 2P88A 2J9XA 2CXGA 3VIOA 3S2JA 3CBWA 3P8JA 1NVMA 1QR7A 3RF9A 3VOFA 1JG9A 1LQ2A 1ZJAA 3KVMA 3L5LA 4OTKA 2F61A 2WQDA 3WZ0E 1MXDA 1YDOA 5I3KA 1RK6A 1D3GA 5KINA 3B4YA 4O1FA 2PDXA 4CCZA 4AF0A 5GPRA 1D3CA 3AHYA 4AMCA 3W27A 4UC5A 1SYTA 1JYNA 3MDWA 3FA5A 5CGQA 2V30A 2VELA 3C2VA 3VD7A 3MMDA 1X6NA 4IJCA 3EAUA 3UW6A 4GHRA 2CBIA 3L23A 3PWGA 3S5YA 1KRCC 4M51A 4D8LA 3WH7A 3UD6A 3WFLA 4JTDA 4AD0A 1T0OA 2ZQ0A 4C6MA 3H2MA 2J4GA 1G0CA 3F1QA 3RU8X 3GW0A 1MNSA 2AKMA 1C8YA 4J3XA 1CTNA 2EEXA 4CQBA 4GXPA 4UQEA 3VCCA 4PTMA 1JCJA 3CQJA 1Y5WA 4GH1A 4I8YA 4C65A 2Y8KA 3CHEA 2X1RA 3KP1A 5EYWA 2CHOA 3HG4A 4ZQOA 3A9BA 2VR2A 2JEPA 4JIPA 3E2VA 3IPWA 3APYA 1F74A 2EJAA 3I10A 1UWRA 1TR1A 3PG8A 1V6VA 4H3DA 5JU6A 4B5VA 4DAFA 1JZ8A 5AVHA 3CJPA 2QPUA 4BFAA 1Y8BA 3C0LA 3GXMA 5KETA 1XFBA 4E2VA 3W7HA 1H1ZA 2Y7GA 1VRDA 4IG2B 5KITA 4ACZB 3G1AA 1WUEA 1J0YA 3QMRA 4YN5A 1B3VA 3MCMA 3SI9A 2C7FA 3ARSA 2XTKA 3LNPA 4FI4A 3JUGA 3G1DA 4UNLA 3S8HA 1BFNA 5LKYA 2V6AA 1W9PA 3MZ2A 4PMUA 3A5FA 1K3UA 4OJYA 4HZ8A 1XLEA 1ESWA 5H8PA 2GSHA 5BRQA 4OIFA 3BLDA 3NQ8A 4RV8A 4B5TA 3W28A 1VKFA 1EP2A 3K1DA 1S5MA 1XS2A 1TX0A 4RUBA 3WQWA 1ELSA 2WNZA 1Y5XA 3LTPA 4JHMA 3E0IA 3W23A 2IKIA 3IACA 2QIIA 2OMAA 1EJXC 3I68A 3NL6A 2VGFA 1LG2A 1KXQA 2GVYA 4XISA 2PWEA 5AC7A 1Z41A 1ME8A 1R3QA 5REQA 1OYAA 4KWOA 3W22A 3CPUA 1JAKA 1F5ZA 3EDFA 4JDYA 1OFOA 3NFUA 1W8GA 3TMQA 4B16A 1HL8A 3QPEA 4IL0A 3WQCA 1J5SA 4C1LA 3GG1A 4MPQA 1VEMA 1AQHA 1MW0A 4PB4A 1E55A 3W7LA 3GZ3A 4XAZA 2UY3A 1H3GA 4DEFA 3VDHA 4ZBCA 2BGNE 3T05A 3H2NA 1FWDC 2ZC8A 5E0FA 2GGEA 4HA3A 4XV0A 2DY3A 5DMMA 3M0XA 2HVNA 3PZGA 4PUUA 1XG4A 3OU8A 4HSHA 1CXKA 4J3UA 1UMLA 4W86A 2VZTA 2Q8XA 1TJ2A 4W8AA 2GQ3A 4C90A 3G1XA 3ZYZA 3ANYA 4KEZA 3W2JA 2J78A 1EDTA 4YWIA 4MZ8A 1A3WA 2IXUA 3NOYA 5FJIA 4GNJA 5FCZA 4B15A 4Q8VA 5EMUA 3W7QA 3GTIA 2BVYA 2ACRA 1CECA 1XLIA 1UIOA 3QV6A 3BDKA 2WMIB 1J12A 3RNDA 2J47A 4UFMA 3T40A 4NYYA 2H8ZA 3KWXA 2JF6A 2CHNA 1B3XA 4LUYA 2V8ZA 2Z1KA 3VGHA 4IXXA 1W5PA 1UKOA 1R9YA 2YW4A 1DHKA 1JDFA 2KX9A 4Q4KA 4Z1CA 2BY2A 4LF2A 4DJDD 1TPUA 5I3GA 1EX5A 1SJAA 1I9CB 4UTTC 3S9ZA 4HA1A 2QHAA 4N9CA 3RPTA 3H12A 4LCQA 4IHCA 4Y8EA 4JY9A 4J35A 4C7GA 1E9YB 4HYVA 2JIWA 5C9XA 4Q32A 4GIRA 3N2CA 3TNBA 4I9MA 2OFJA 4TR9A 2X1SA 3I6RA 3TXVA 1E0XA 4PUEA 3EOLA 4GIAA 4UTMA 2ACUA 1WOAA 3RCMA 1X1ZA 3MSGA 4US5A 4H6QA 1FUYA 5IBXC 3I6EA 4FX8A 1TRIA 1E1EA 4ORIA 4QFUA 1O5KA 2GVJA 2YBVA 4FOUA 3T08A 4ZOCA 2BZNA 4GISA 4LVGA 3W81A 4UR7A 1HTIA 2NV2A 5H8UA 3W29A 3GDTA 4NZ1A 3N4EA 5C54A 3M4HA 5DMLA 3PTKA 4ZENA 4X22A 1UBSA 3ITVA 3N1AA 3TYBA 3UT0A 3CPRA 4QIUA 4I9JA 2BASA 2V3DA 4CD5A 1FDJA 1UWTA 3CHDA 1EIXA 2GGJA 1YHTA 1QTWA 2GGHA 3M47A 3H23A 3COTA 5LNWA 4GA8A 4R53A 2QUTA 4QS6A 3M5ZA 4OOZA 1OB0A 2QAPA 3NYDA 4Y9AA 4XSLA 3NJ3A 1ENUA 1K02A 4WDUA 4Z1YA 2E6YA 1IHIA 4UFIA 5D04C 1RPKA 5J5DA 4KCWA 3T6CA 3E0VA 2IUZA 4FF7A 3WKZA 2OZTA 4QM1A 4L5ZA 1QFEA 3VIIA 1HN1A 3A24A 1MMFA 2W4XA 4LCRA 4WKAA 1XH2A 1VFOA 1BVNP 5K4ZA 4HK6A 1AD1A 2Y88A 3G8RA 4ZTXA 1VFHA 2BFGA 4IQDA 3TC6A 3C56A 3L0NA 3TSDA 5A8OA 1GVOA 1PZ2A 1GHRA 4IP4A 3LMYA 3V5CA 5BMWA 1YTDA 3VIJA 3C4UA 1RLDA 3DG7A 3W2NA 1TPC1 1TV2A 2CNCA 5D09A 2AMXA 2DZPA 3C2FA 2WB5A 1OF8A 2PDWA 3N4AA 1R85A 2Y62A 4GYJA 2VCCA 3SUSA 2QDGA 5GJMA 4DBDA 3NQDA 1R2TA 5CAHA 3V0UA 3E2QA 1IIHA 4LY8A 1XGZA 3E0LA 4YMZA 4MAZA 1J2WA 1UUOA 4PEKA 3WUEA 4AYSA 1D9EA 5FEZA 4G6CA 3BAJA 4DO4A 3UG5A 3HPZA 2XH4A 1LT7A 5HQLA 2AGKA 2XYLA 1X1OA 1EJ7L 2BG5A 3H53A 1DXIA 5I79A 4P2VA 1US0A 4FHAA 1XPYA 1JI1A 1Y0EA 4BF9A 4LCSA 4AZ6A 3OO2A 4XSMA 1TA3B 3AHXA 1KTBA 1H63A 4P8VA 4G2DA 4AVFA 3EYPA 4WY0F 4X2PA 3LPOA 3BH4A 2IQTA 1JCTA 3KDNA 3W4RA 1V3IA 2A3EA 3MP3A 5A6MA 2JEQA 2W0UA 2BBFA 3CH9A 2VL4A 4PRTA 3GUGA 3F4VA 3RIKA 4RNIA 4GXMA 1EHNA 1KCLA 3C0SA 2PU0A 4R27A 3RPDA 3NPVA 4O17A 1XLKA 4B5NA 5C9UA 3JZUA 1UYQA 1WDDA 1F4AA 1SMDA 3IAPA 2X30A 3MVIA 1E9IA 3MJYA 2O9PA 3U48A 1QOQA 1O5RA 1UKQA 3LCHA 5CC5A 2A4AA 4QEHA 4I6KA 3KTCA 2ON3A 3OODA 3QVQA 4D6HA 1EEPA 1XH0A 1BKSA 3N9RA 3R43A 4MMWA 1YYAA 3FAXA 1TTPA 3MYPA 1KFEA 1F6PA 4GI9A 4MYXA 1GQNA 1NFBA 3LV5A 1ZALA 4ZQNA 3ARQA 4GNKB 1QI0A 1UH3A 1JR1A 4PUKA 1K8YA 2GLKA 3W1UA 2J74A 4RJEA 1XV8A 3SCWA 5IDZA 3AWNA 4GJIA 3LXCA 4GMEA 4NNCA 5FACA 1V7YA 4GFIA 3CMFA 3LI1A 1R3WA 4S3JA 3CV7A 3GG0A 4FIQA 4XIAA 3BICA 4PTXA 3FIGA 4KT2A 3T0BA 1B3ZA 3DKJA 5HQMA 3EMCA 4GI6A 5REQB 2TRSA 2Y5EA 4AHPA 2DW6A 3PTQA 4MAVA 4AHOA 1MO0A 2VTFA 1PCWA 2YFOA 4KRZA 3SJ3A 3AZSA 2C0AA 3UQNA 3UNTA 4HA0A 3V1HA 1Y65A 5FESA 3FVMA 1H7RA 4H8HA 4XAFA 1YE4A 1IGSA 3KP0A 4IWWA 1OC5A 1V51A 2YCJA 2QCDA 2EPLX 1YLVA 1KBJA 5C9RA 5FOOA 1C8VA 1P48A 4FX6M 1UP0A 4BI5A 1IWAA 3NPWA 5I07A 3W88A 4E8CA 2J25A 5AHFA 2ZZ6A 2YB1A 1FWHC 2VJXA 3TJXA 3EWWA 2P53A 3VNZA 1E4IA 4F0MA 4CCCA 1JCYA 1E73M 2YIHA 3PULA 1BVZA 3SN1A 5FD0A 1TPEA 6ALDA 3W7KA 5EMLA 3UERA 4Q7NA 2PCEA 3TJIA 4WR3A 1BHGA 5CCZA 3QMSA 2FYMA 4TMCA 4F4RA 5I3JA 3P0XA 4UFJA 3OBAA 3SURA 4UTTA 3KXQA 3B9EA 4DRSA 3GM8A 3R8GA 2SFPA 3A4XA 4LFYA 2QW5A 2PDGA 1W2PA 1QPNA 2HMCA 4JQAA 5XIMA 2PZ0A 1VYSX 1E56A 2QIWA 2ZRZA 5IBXA 4BK9A 1NFGA 2CLKA 2VXNA 4AD4A 4DF1A 1UQZA 3TYDA 2VFIA 1W0MA 2BS9A 1E1CB 3VYLA 1LBMA 3VGBA 2JF7A 1XD0A 3QGAC 2R1MA 5KSWA 1VS1A 1VD6A 2XVLA 2PTDA 1VR6A 3AIUA 3KCLA 2Z1SA 4J3WA 4E38A 5M17A 4BKNA 4GUGA 3G1HA 3TSMA 3GH7A 4A4AA 1SW7A 1DIEA 3NQMA 4ZQCA 1MDRA 3VOHA 4YTTA 4P5UA 1A5NC 3G1YA 4N6EA 2EG8A 1OEPA 3CIVA 1B9BA 1FVPA 2HVMA 4H2HA 3P62A 3T9PA 3LCIA 2OSYA 1EP3A 2HZGA 3I65A 2QDDA 3Q37A 4AXNA 2EAWA 5C6MA 3LRMA 3SCOA 3ITYA 1MW2A 3L4VA 3HPXA 5G1YA 1W3HA 1M68A 1ZCOA 4EPEC 1AA1B 5FF4A 2UV8G 3M5VA 3BMWA 3EOSA 1LWIA 2GJRA 2QCNA 1LQ0A 4QXIA 3WLNA 4YWSA 3E74A 1NELA 2WWDA 3E2SA 3M0VA 4L9XA 3A4AA 1FHVA 5A8PA 4IX2A 3AXXA 2CC0A 1FXPA 3L4UA 3HFYA 1TZ9A 4C6PA 5A6BA 4H8UA 4U5IA 4JTAA 4DWSD 1J9YA 2E4TA 1VPQA 1YDNA 4URIA 3GH5A 1CXFA 3BURA 3SCVA 4C1KA 1DV7A 4JYFA 1Z3NA 1OG0A 4G7EA 3B04A 3EWYA 1NF7A 3WDJA 2BP1A 5HOSA 3L67A 4B2DA 3G3DA 2D22A 3OHIA 1ML1A 4K68A 1B5TA 5DX7A 2C19A 4HHMA 3GXPA 4Z2GA 3LHZA 3MYOA 4F2TA 3F4NA 1P7TA 2CWXA 4S2BA 3LCFA 1E0UA 3W1PA 1KC7A 3FGCB 3GD6A 1K6AA 3O6YX 2O7QA 1E6XM 2FZ8A 4A3RA 1RCXB 4W9TA 3BLEA 5DBUA 4W4QA 1Z32X 1JZ2A 2NXIA 2RJHA 3RLHA 2NWSA 2ZXQA 5LZLA 5CSYA 1GPFA 4YNGA 3NQBA 3EMQA 4QS5A 3N3TA 2WANA 3LDVA 4WDWA 2OWCA 2XZ9A 1J8VA 3U57A 4Q8UA 4AUBA 2G5WA 4LYKA 4Q4SA 5JQ9A 5I3IA 3ITGA 5AHNA 4KW2A 1GORA 1W5QA 1EYEA 2Q3RA 2WZIA 1FQ0A 4M6VA 4ZTYA 1KFCA 3EOUA 2H9AB 4ML9A 2BY0A 1JPKA 2O0TA 2ZRVA 4JS3A 2I16A 3EMZA 2ZXDA 4DB7A 4ZA0A 2QVNA 5F2IA 1HO1A 1QK2A 1W17A 3UZWA 4HPGA 1QNRA 1PZ3A 1WKYA 4H6EA 5BXTA 3CGTA 3P81A 1BYDA 4H01A 3K2GA 1I2PA 4XZIA 3KOXA 1NARA 1W54A 2PURA 4RPQA 3GDRA 3V18A 4DO5A 4IL2A 4ZR8A 1U83A 5HR7A 3WD0A 1EO5A 3TP4A 4Q4RA 4QE1A 4JX5A 3V5OA 4ZOAA 2UY2A 1PWMA 4B5UA 1A53A 1KKRA 3BSMA 4MNKA 1EJTC 1CENA 2I17A 2OEJA 3TKFA 5A2CA 3PBWA 3UCDA 2I57A 3ZT7A 2GJNA 5DRCA 3ARRA 4JKLA 4LBRA 3Q4DA 4JX6A 1KCXA 3BJTA 2YYTA 3WQ6A 2O4QA 3NDYA 4XUGA 2R1PA 1YE6A 4FLRA 1U33A 2WKJA 1CGUA 4UNKA 3H26A 6TIMA 2J7CA 4V33A 3UETA 2OU4A 3RJYA 2PTYA 1IT8A 4MB3A 5EMKA 4F0HA 4J4KA 4YTQA 4BEUA 3QPYA 3WH6A 2VCAA 4ZQMA 4ROPA 4LUTA 2W91A 4B3KA 4B5WA 2IQDA 3BXWA 1Q6GA 5LIXX 3AIBA 4W5ZA 1MUMA 3L9CA 1A80A 4ASTA 3H21A 5A8QA 3R12A 2HISA 1YBQA 2WJDA 1FWJC 5CAKA 5DO8A 2OB3A 3AS1A 4IH3A 3N6HA 4C6JA 4GABA 1UP3A 4GY7A 4BI7A 2MUCA 1FX6A 1Q6FA 2QF8A 2J13A 3OIHA 1E4NA 1FCQA 3N19B 4R85A 1GOMA 3W7EA 2UZ9A 4MJZA 4PUMA 4RZBA 5FF3A 1H7OA 2DSUA 2WVVA 1OFQA 1VF8A 3LYEA 2Z0IA 2NSXA 2ISVA 1FCBA 4HN4A 4I7UA 4A8IA 3LSBA 2DJLA 1VFMA 1GNXA 1A5BA 3V3WA 1HFBA 4O19A 4FSAA 1AFSA 4C5ZA 1BAGA 1QAPA 3KRSA 1BXNA 4UQ9A 5CZSA 2VEGA 2FFIA 4KQNA 1YPXA 4X2RA 3N11A 3FV9A 4CN6A 3SBFA 3ELFA 3U5UA 1ZAHA 4E4UA 3W83A 3R25A 4RK8A 3OW1A 4WUIA 1TMHA 4TUFA 3FCPA 5AC4A 4GG9A 4OECA 1MEWA 1WAUA 5A3HA 4AD2A 3IJQA 4E2OA 4DZ5A 2DVUA 2R24A 2A0NA 2XIBA 3P93A 1PBGA 4M24A 5JH2A 4E8DA 3C86A 1R86A 1J10A 5H6HA 1M53A 1TWIA 2PRMA 3T7VA 5AHMA 3WD4A 1XDLA 1GVQA 3SUUA 3TYUA 2J24A 1H1NA 1PHWA 2ACQA 2V2HA 4FS9A 3LPGA 1EWEA 2OJPA 1TPFA 3T4WA 1I4NA 3ZT5A 1BKHA 4BA0A 3LRLA 1R7OA 2A7PA 1PJ9A 4NNBA 6REQA 4Q8NA 3ZR5A 3WQEA 3KDOA 1G6CA 3G1SA 4CLMA 3ZJ8A 3EBVA 2IMRA 3P67A 5CJMA 1Q6OA 3LHTA 3CQIA 3UZJA 2CLLA 2GPTA 3F2DA 2JALA 5I78A 3D0CA 3TFCA 1RBLA 1M7OA 3KTSA 3GVVA 1UZ4A 1VGAA 4NJHA 4NF7A 3AYVA 1NU5A 1Z48A 4U4MA 3IGXA 4HCHA 1FH7A 1VFTA 3TX9A 4B3LA 3NM3A 1ZS2A 1KM3A 3LB0A 4FXFA 4GUFA 1VPXA 4WIWA 3RK8A 2O9RA 1HL2A 4LYPA 3NQAA 4FALA 3OQ8A 1BWKA 4NP7A 3RMJA 1K6WA 1GOIA 3U4AA 2CPUA 4H9XA 4UB9A 4V27A 3MHFA 5EMYA 5C55A 2VVSA 4M7TA 1UH2A 1E0TA 1I75A 1MQQA 4GLEA 3FJ6A 4HJWA 2FKPA 4W5UA 3DKLA 4WF7A 1QOPA 3E6EA 3TJLA 1SQ7A 1EOMA 3A4JA 2YDSA 2ZXAA 5H91A 5LYRA 1TE6A 2Y24A 3IANA 1JIBA 2BGQA 2FFCA 3AXHA 3L12A 4PB3A 4AD3A 4WX2A 5I3FA 1JZ6A 5CJ5A 3WLSA 4TU1A 3PSVA 2VWSA 3FJNA 4XAPA 1VJIA 2PP3A 6CGTA 3OLIA 4GZEA 1NDZA 4GNVA 3LM3A 3VFCA 1SGJA 4XUYA 4A8NA 1SZRA 1JZ3A 4GZJA 3F5JA 1LT8A 5EPDA 4PUWA 5G1MA 1SJDA 4PSRA 3HA1A 1L6GA 5DRIA 3AMDA 3NSMA 1F6KA 3ZSSA 2V63A 3OA3A 5I7GA 3URAA 1BTCA 3AS0A 3M44A 4CN1A 4G5DA 1BSIA 4CD8A 4MSSA 3AICA 4L64A 3NNTA 2I5IA 2R1NA 4IIDA 4H9YA 4BQ3A 4D1IA 4DYJA 2W92A 5F4SA 1VZWA 1ICPA 4UOJA 4XD4A 5CSSA 3WF2A 3VGGA 1EDGA 3K13A 3SY5A 3W2UA 2WHLA 3VMNA 3F5LA 1WKDA 1DJWA 1UB3A 2MNRA 2VR5A 1J2BA 3ZVHA 1V6XA 3VGEA 4P8XA 1VBRA 2PA6A 5IXEA 3GE7A 1TSIA 1A0CA 3WNOA 4HU8A 2VX5A 2DUAA 1TV5A 3WBYA 2GUUA 1FDYA 4I5UA 4W84A 1MUWA 4DJED 4M6UA 2FB2A 2VX6A 1O6IA 2QR6A 3ABZA 5D2TA 3GHUA 1XLBA 3R89A 1F07A 1H1YA 5M3WA 3VK5A 3LTYA 3MSYA 5CBBA 3OQEA 2R1KA 4D9PA 3AXKA 4NY2A 1YTKA 1K7EA 1FWEC 1EYWA 1WDPA 4E8GA 1VYRA 1C8XA 3DERA 4BQ4A 1ITCA 1O68A 3UZXA 2XVGA 1J96A 3GXNA 2CLHA 4TVCA 1TUFA 4QBXA 3OVGA 5LXEA 1HJWA 2VD9A 3KVKA 3K46A 2YXXA 4FLSA 1L6FA 1XSJA 4L4MA 3ANUA 4A21A 1M9HA 3AMGA 1A5LC 3TSBA 4Z08A 3D47A 3W2KA 2XVPA 3SCQA 4HOZA 2V67A 3TWAA 3W25A 1VLWA 2DT3A 3TW6A 5GVJA 4WOQA 1NP2A 1XUZA 2W9MA 1XKYA 1TYGA 3OTRA 2V3FA 1SU5A 3MQTA 4H7VA 1JCLA 3KOWA 1OGGA 4H04A 4W7UA 4L4OA 2XSXA 1E5NA 1FWSA 2WMHA 4D6GA 2WJEA 4AXKA 3WF4A 1B54A 5DT5A 5K2ZA 1OK6A 4GKTA 3UJEA 1V03A 3DFYA 4DI9A 4WXYA 4QSFA 3B06A 3MV11 1PV8A 5HXMA 1EH9A 2QJIA 4FXJA 2VOTA 2DZWA 4ADSA 2XZ7A 4G9PA 3OZYA 3D3AA 3GYEA 1Q6QA 5F1VA 1RQBA 2FIQA 2GVGA 4JTEA 1XH1A 3TZFA 4NT0A 4GCXA 3S0CA 4KEMA 3P8IA 5JBFA 1UJQA 1JF6A 3QN3A 1FWNA 1U30A 1JQVA 2X40A 1GJWA 5LGZA 4WOZA 4ZGYA 5LXXA 1E6RA 3SECA 3RX4A 2IW0A 3GSMA 3V7PA 1AH4A 2WMKA 2G3MA 2FDMA 3ONCA 4EF8A 4XK2A 4GBUA 1U1JA 2EJ1A 3QZ6A 1KGWA 1Q8JA 1V6YA 3QZEA 4Y9MA 4XZMX 1IE7C 3W6YA 2X0SA 4MJ2A 3KOFA 2FTPA 3F2CA 3FYOA 1K8CA 1GUVA 2FPVA 1D7FA 2C15A 2YYUA 1K1DA 2NQZA 1VJZA 2ONEA 4AG0A 3TEVA 4G1KA 1E15A 5EL1A 4EF9A 3CV1A 4RW3A 4S3FA 5EB8A 3L2LA 2XFFA 2Z7KA 4CVUA 3P6LA 4DO6A 3MKKA 3RU6A 4LGXA 4ML4A 2HVOA 3FK4A 3IRSA 4GO8A 5G4WA 2GWGA 1RD6A 4PUDA 2J8GA 4JY8A 4AIOA 4HJFA 1XC4A 1GYNA 1GG0A 3S9IA 3PBYA 5D05A 2EG6A 2WCSA 2C13A 5HBFA 3W07A 4NXSA 2GOUA 4UMAA 3T8QA 1OF6A 4M82A 4QISA 3A22A 3K30A 3CT2A 2J7FA 3DBNA 2BY3A 3HF3A 1FOBA 1VAHA 3UPMA 2VGIA 2YB4A 4KMQA 3OP2A 4UR9A 1T99A 3BG5A 5CPSA 4DVOA 2ZE3A 6REQB 2OYLA 4PL1A 2HE8A 4P7LA 1WBHA 4S2CA 1SFLA 1RZMA 1Z9AA 3WLLA 3IGHX 1EWDA 1IT7A 1V93A 1VJSA 1G67A 1GOKA 4YJ5A 3DFSA 4I5XA 4S39A 2E25A 3VE7A 1TE1A 3WNMA 2VR4A 1XP3A 4AAJA 3KZPA 4JEQA 3V75A 3BMXA 3U2CA 2GOKA 2C18A 3ARPA 1VYPX 2BMBA 2V3GA 3R13A 4RKAA 3BO9A 5JIWA 1CXIA 1V4YA 3QFWA 4RZ6A 4M0XA 1S2AA 3GFXA 3FYYA 4UFKA 3NZGA 8A3HA 3CO8A 3VGDA 1Z6KA 1PPIA 1DORA 1KNWA 2WC7A 2QGHA 2E6AA 1JZ7A 1CYGA 3BLOA 2JKPA 1JZ5A 1TVPA 2QCFA 1GJUA 3CUZA 2J7BA 5CSRA 1EQCA 7CGTA 2WW5A 1G5AA 3NM1A 4YCPA 1OT1A 2BVWA 1NF0A 4F9DA 4Z2IA 1W1IE 1UIPA 5CC7A 2I5QA 1REQA 1NWSA 1VQTA 3FSUA 4YCOA 1TG7A