2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
b'ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAN26A
publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
5FO7B 1T2JA 3VXOA 5SWSD 5CD3A 5A6MA 5F9OL 3MUGB 5DRWB 1HHJA 2VDKH 3SCPA 4KZEH 3F7VA 1V0LA 5TDNB 4MJ6B 1TJGL 1U8OA 1LO4H 3D2UA 2YZ8A 1DQTA 4U1NA 1NGYB 1G1YA 3HB3C 3C09C 4U1GC 4ZNEE 4ZTPL 4XMKH 2QQKL 2WHMA 2AJYH 3QIWA 5GZND 4YXKH 5BRZB 4L5FL 3LS5H 2W59A 2JB5H 2OX5A 3MTRA 4K23H 3C5SA 1XV8A 4TVPH 3GSXA 2QSCL 2ZIDA 1OARH 3F6LA 3DX6B 1KNOB 2D7TL 4WDIA 3IRZA 5I1AB 1NAKH 3PBGA 5C8BB 4G8EB 3QJFB 2GYSA 4NJAL 5FUZL 4ETYA 5E6ZA 3VD3A 1U8HA 2BNQA 3OKNA 1U0QA 2FWOB 4M43L 2QTEA 4XPBH 3C6LD 1MHCA 4FQCL 3CPLB 1KIQB 2Y25A 1FNFA 3JWNC 4JM2B 5GGVL 5DMJB 3RIAF 1JHTA 3DNKA 2NY6D 3RNQA 4OOUA 2XWJB 1ERNA 3BKJL 4YHKL 4WGWB 5I8KL 3RDTA 2RAMA 3HC3H 4XPAH 3D0LA 3SQOH 4AZ5A 4BF7A 1OD9A 1CK0H 1ORQA 3BN3B 3F12A 4L8BB 3ZYOA 2DI8A 5J56B 3NCOA 2AK4B 2HWZL 1C3FA 4U6XA 1ZTXL 4HA4A 1GC1L 1OPGH 1QEWA 5DJXB 3HU7A 3V0VA 3QUYD 3WL9B 1FA2A 5B4MC 1IC7L 3H2WA 2DN7A 3HE7D 3RO8A 5E6IA 3HCVA 1E4LA 5CP3A 5KS9B 4QGYA 4JZNA 3GBMH 3MOAL 4ZFZB 1HIZA 4QXTA 2ZWLT 1E43A 1A6ZA 4WNQA 3TTOA 2OXHA 4XRCA 1YPZF 3WENA 2R4SL 2AEWA 4AD1A 1HYRC 2F5BL 2VLJE 4NKMA 4XAKD 4Q2ZB 4J6RH 4NQEE 5IQ7H 2IFFL 2JALA 3GJEB 1Q0XH 4G6JH 4K7PX 3VH8B 1EO8H 3QAZC 1DN2A 4MD4B 5DJAA 1I8KB 2YD4A 2JLLA 3MRIB 4UV4L 3SE3A 2OSXA 1RJZB 1R5IB 3QZWG 5LA2A 4OB5H 3U46A 4W6WB 4PY7B 4Z18A 5EMYA 1I1CA 3VI3E 4PJDB 2IBZX 2WUCL 1F97A 3UG4A 43C9A 1JF6A 3QJHB 2R2BA 3DXAD 1HSAA 3MNWB 2OYPA 4P2QE 3G5XA 1NCUA 4KKBD 1OAQH 3VM7A 5F8QC 1UH3A 2LABA 1MELA 4K94H 1AHWB 4QY8B 5ERWB 4ATLA 3HUJF 3DO7B 2Z1KA 4JQIH 4CMHC 3SCUA 4OM1H 3K4DA 4FQJH 1UXSA 1IGFL 5DUPH 4P23D 4HT1L 4K55A 4LHUA 4XBPB 5C0CE 4FTVB 5JW5B 1SEBA 4F33B 4UZUA 1XC6A 1TZIB 3TH4T 3EO0B 1QNRA 5GRWA 3MR9A 1V3HA 2WP3T 3QDMD 3P73B 5BYWA 2J12B 3CXHK 2CRMA 1EXUA 3B9DA 3JWDC 1XSIA 2OQJA 3MGAA 3VXMB 4M8VA 2GJ6E 3TVMC 1VFAA 4NC2B 2A6DA 2H41A 1I1XA 2NW3B 5KN5B 4GLRI 5M7QA 1T1ZA 5IK3B 1JNDA 4JFEE 4S1DD 3WE6A 3VE0B 2X4RA 4PRDB 5L9DH 1MHHB 1HSBA 4P3CH 4WEBH 1E0WA 3VMNA 4DFIA 4FMFA 4OLWL 3WFZA 5BZWA 5F6IB 5K9QG 2R56H 4V2XA 1ZT7A 4PGCB 2MJWA 3ZTNL 2OMNA 1VFBA 3N13A 3ZJKA 2FGWH 5TE4H 4HS6B 4M48H 3CO4A 4WWKD 2AV7A 2ED7A 3T4YA 4R4FL 4F9PC 1W8OA 2CLVB 1AP2A 2FHBA 1OBAA 4AK1A 1MRFH 5BMFH 4XXCC 1MF2H 3CVHA 3TCLA 4L3EB 4XPHL 4L9LC 1GW1A 1JYVA 2G3JA 3DIFA 4NGHL 3GHBL 3MUAA 2DI7A 1S7TB 3FY1A 1H5VA 3X13A 4Z0BL 5E2VH 5B8CB 1BJ1J 4YK4B 2BXYA 5T1MB 1FZMA 4FABH 3VWKD 4M81A 1HI6A 3FONB 2ZPKL 1ADQH 1DBAL 3IFPB 4PJFA 3A4WA 3UETA 4WUUD 4G80A 4GOSA 4QFUA 1XF2B 4YLQT 4BYHA 5FHAH 5I1GH 2PXYA 1ZV5A 4GQQA 3GSQA 1OSPL 5MEQB 3B9AA 1JZ2A 4LSQL 3PWPD 2DWEB 3HLAB 4M5ZL 1UWGH 3RIFK 2H8PB 3BQUD 4K3EL 4OIIL 4JPKH 3RWHB 5EPMA 5KVFL 4L4TE 3REVB 3QXAB 1TVDA 1N5AA 1SM3H 1WC7A 3C6SA 4MWFB 3QHMA 1MRCL 4S11A 1IC5H 1BFVH 4KJYB 3QUMA 5CILL 5IHZA 1I8LA 3C2AH 2J4GA 1I9RL 3F5JA 4HIXL 4PJGA 3FQTA 3OKOA 5ITFB 4L8CB 5GISL 5KAQF 4AIEA 5BVJB 1MJ8L 2VDQH 3ARBD 2OWWA 3O6KL 1N5YL 2X0YA 3GNPA 1ZA6B 3QO0B 5DC0A 3MRLA 3QRGH 3QHOA 4WFHE 1S5HB 2R2HA 2D03L 3HC0B 1CECA 4X4MA 1F3DH 1KCLA 5EO0B 5J0BA 2MTPA 4ALAL 2NX5E 1QFUH 3UTQA 1F4YL 1UENA 5DHYB 5GHWH 1H3TA 4LQFH 1HINL 3NABL 2P5WE 3WF4A 5BV7B 3T0VA 2J79A 1OM3H 2RFXB 4HK0B 3WN6A 2BCKB 2EEXA 1FIEA 2WMIB 4LVOC 4H8HA 4OCRH 5IF0A 2WBJB 5FYKE 5J1SC 1BD2E 1LO3L 2L7UA 4H25B 4TUFA 1FBIL 2R1XA 2RGLA 1A1NB 2P43B 1FYTD 5LYRA 4WJ5A 4O02L 4MNGA 1X5HA 5EU6E 1HXJA 4M1GH 1T2XA 2JKXA 1US3A 3CFDB 4C55A 5E99L 3DYPA 5DK0B 4MJIA 2Y7QB 4YBLC 1CXLA 2P8PA 5ETUB 1F2XK 4J8RA 1SJEB 4AEIL 1T0NB 25C8H 2C4FU 5C0FB 4KRLB 4YDLB 5ID0B 2F8XC 3DROA 2W1NA 1MCOL 3UPAA 1CYGA 4QOKB 2H2PD 3I50H 3OKEA 4UQEA 2VITA 4LDLB 3CK0L 5BXTA 3SKUD 1HNGA 4IHOA 4E41B 4P2OB 4JPIB 4M1DH 3PQYE 1JRHI 1M53A 3AFBA 4OZ4B 4J3UA 2Z31D 4HMDA 4OFDA 4S3JA 1MY5A 2VZOA 1MI5D 3VFPA 3HMWH 3MBXL 4QHMB 2BSSB 3QDHA 3UTZB 3QEUA 2WVVA 1JMZA 3D0VA 4NZRL 4ODBD 1E6RA 3T0EB 4RGND 4JFXB 3EO1A 1RUQL 5J13B 1CGXA 1HEZB 2JJTC 4QRRE 3BRFA 5FO7A 1T1YA 4V27A 5D96C 1JXJA 2NTSP 3ILPB 3FZUD 3MUGA 5DRWA 2X9WA 4FFVC 4NFCA 1XIWD 4QNPE 5TDNA 1K8IB 4LPXA 1NMAH 5FYLH 3UEZA 4DZBB 4EI5B 4RE3A 3TYGH 4MJ6A 1G84A 1DJSA 2XA8L 1BQLH 5D70H 4PB9H 3SJVD 2E9IA 1NGYA 1P4LA 2HH0H 4XH2B 4GRLB 4IPNB 1T03L 3O6FD 4UT9L 1T89C 5IESH 5FDWA 4JQXA 1KGCD 5BRZA 5CPSA 2VN4A 4HJJH 5D7SH 1II4E 1YMMA 3MCKB 4AZBA 4OFYA 3UJJH 4BELD 3DX6A 1KNOA 2N7AA 5CMAA 1N0XL 5I1AA 3QDJB 4ONGL 4LSPL 3OJMB 4G8EA 3QJFA 1NWTA 2E40A 3UERA 1K6QL 5GRZA 2EDYA 4HUXB 3VGFA 2VABB 1IBGH 5KVGH 1J1XL 4YDVB 1N6QH 2YK1H 4NUGH 5MEND 3FO1B 2BOCB 5JLZB 3CPLA 1KIQA 2D0HA 3JUZA 4NQDE 4HG4J 4JM2A 4GPNA 3SO3C 3CDGB 3H9HB 5AYIA 4OQTA 5CIPA 3QDMB 5HGDB 5F7EH 5KSAD 3WQ8A 3BUYA 2VDLL 1EEQA 2CIIB 1CLXA 3VFRB 2E7MA 4B0MM 5DVMA 3ULVE 3L4ZA 3VFWA 4L8BA 2IPUK 3IJ8A 4HF5L 4NQXB 1H8SA 4KAQH 2AK4A 2DBLH 2C5DC 3VFOA 2CDGB 2VDMH 3BYYA 3MSDA 4S1RH 4NO3B 2CIPA 5DJXA 4MDIB 4GW1B 1I1AD 5HGAB 3K4ZA 5ADPH 4XHJC 4YN5A 4JAMA 5DD5H 1WISA 5KS9A 3HMXL 4ZFZA 3MROB 1G9MC 15C8H 4K71C 4RNRB 4FFYH 3BE1H 3FQXB 4H0GA 3VXRB 3RKDC 1LO0H 3V4PH 2ADIB 2D7QA 4Z7UF 1CWYA 4Q2ZA 2ZOXA 4DOHE 3NDZA 1W72L 2B5IB 2NTFB 1U41A 3GJEA 4GG8B 4XNUL 3WD5L 3VH8A 2EC8A 2EPLX 2P47B 4PJHB 4HX1B 4MD4A 1A1OB 3RAJL 4Z7WB 4XZWA 1I8KA 3LKNB 3WIHH 3MRIA 4NRXB 4PJXB 3UAJC 1RJZA 4ML4A 1R5IA 2ICEB 3MO4A 5ABFB 2NY3D 3O8XB 4JY5L 4PJDA 2XKNB 3FO0L 4JR9H 3AI0A 2QR0B 1ND0B 3FCTB 3QJHA 1MNUL 1VGEL 3MNWA 2ZSWB 1I7TB 4LLVB 3KLDA 2GK2A 3KYNB 5FHBL 1AHWA 1GHFH 4QY8A 5ERWA 5KEZA 5J6GB 5ILTL 4BUHA 3MJ6A 4YFLI 4DTGH 4JDVB 1AJ7H 4XBPA 1PKQB 1MAML 4FTVA 5JW5A 4OFIA 4DM1A 1F8TL 4F33A 4ZDHB 4H41A 1PZ3A 4M1RA 1TZIA 3DOSA 3EO0A 5DFVD 5EN2B 3JUYA 2O5ZL 4FFWD 2RCSH 3GGWB 3QQ3B 5CZXC 4FQ1H 3OZPA 3QXUA 3P73A 4WIQA 1R87A 3SHSA 4Y1AD 5B3NA 5FM8A 1KOAA 4JG1H 4AG4H 1FG9C 4QDMA 3NFPB 5CGYD 1A6PA 2DQJH 2NW3A 5KN5A 4WFGD 3QFJB 5IK3A 2X89D 4NUJB 1A7RL 2DAVA 2O5XL 4N0UB 2PR4H 3VE0A 4PRDA 1MHHA 1A6UH 1X6LA 1QHOA 1AO7A 3BDYL 2CO7B 1YNTB 3MRDB 1NARA 3VRIB 3QNZB 1GOQA 4ZAKB 2ICWI 5ENWB 5E9DD 1A3RH 4PGCA 3RZCC 4WFED 3LQAH 5I18H 1UCBH 4FXKB 1EEUA 1PX3A 1FNSH 4HS6A 3AFLA 3HE6D 5I78A 5JW4N 5DGQA 3VRJB 2CLVA 1RY7B 2VQ1B 1AQKL 3AJ7A 4KJWD 1IAKB 2FX9L 3QIUD 2BMKB 2G2RB 4MXQD 5JHDD 3VVGA 2JELL 3PZUA 4L3EA 2VH5H 5HHPA 1PD6A 1SYTA 1HHKB 4NNPH 3N0PB 1QKZL 1S7TA 3NTCL 1FNHA 3I75B 4QHKJ 5B8CA 4JFFB 4DUVA 2FX8L 1R3KB 3UX9B 4XNZC 3BESR 4YWGH 3FRUA 4UQAA 4TUJB 4BZ2H 3IFPA 5LWYL 4JFTA 4W70A 4GUPB 1JRHL 1O0VA 4U1KB 1UWUA 3REWB 3IDNB 4MVBC 4KC3B 5MEQA 1GJIA 2XVLA 3UTSE 2DWEA 3VGAC 3HLAA 1V7NL 4DW2H 1TPXB 1CEOA 1MAJA 5EOCL 4GKLA 2H8PA 4NFBA 4O9HH 3VIFA 1G5AA 2YHGA 4PGEA 4GKSA 3RWHA 4WHTB 2CJUH 1I9JL 5C7XL 3CDFA 1JTTA 2IALB 5A2AA 3REVA 3QXAA 2Q3AA 3ULUH 2XQBH 4MWFA 5JO5A 4M6ML 4YZFF 2W92A 4OLEA 2UVEA 3SQBA 4ERSL 4E8DA 5ANME 4NZUH 1YEEL 5FGSA 5LGHH 2F15A 4GAJH 3P0YL 5I6XC 5LBSH 1SR0A 3OKLB 1A0QL 4PD4J 4WSJA 4L8CA 2OL3H 5DVLA 5IW6B 5BVJA 3RGVC 5T5NG 1BWWA 1QD0A 2P42B 4YE4L 4UQDA 4LCWD 4ZFFB 1BEYH 1ZA6A 3QO0A 3WS6A 4W68A 3VI3F 3HC0A 3T3ME 2I24N 4R4BB 2I9LB 5F6HJ 3AZSA 4PJIA 3V6ZB 4ONFL 4R7DB 5DHYA 3SDDB 3RIKA 3KPSD 3HC4H 4L8SC 5JNYB 3DSNA 4ZXBC 5KVEL 2OMBA 1LWRA 2RFXA 2DKSA 3QUXC 4HK0A 3UPRB 4PTVA 2BCKA 5D1QD 4FLQA 2WMIA 4XCCH 3E3QC 1MQ8A 3EOBB 2LE9A 3VCLB 2WBJA 1L8NA 3P4MB 5JBDA 1G7LA 1Y6KR 2F19L 1A1NA 2YWZA 1MLCA 3F65A 2DQCH 2IGFL 2YS4A 4FP8H 1RP8A 2WCGA 3BAIA 2VLRD 1H49A 5SX5H 3DGCR 3CBWA 1UR4A 3VIIA 3GRWH 5D2NC 2W62A 3CFDA 5DK0A 3HMCA 5AWNL 2Y7QA 4UOQA 2YPVH 3H9SE 4X6EB 1U36A 1UWQA 3BZFB 4TVPE 5ETUA 4LYPA 1SJEA 1T0NA 1PG7X 5C0FA 5ID0A 1KYOK 4JEGB 4JRYD 3SDAD 1GAFH 1U58A 1Q1JL 4M82A 3QUKB 1ACZA 4OF3A 4E41A 4P2OA 2ZUMA 1XFPA 4NOBA 2DQGL 4KRPB 4M1CC 4KQ4H 1QBML 2J62A 4OZ4A 3AU1B 5E5MB 4R90L 1INQA 4GS7C 5I19L 1G6RL 3MBED 4MNJA 1GOFA 3RVTD 1KXHA 2OSLB 2A9ML 3G9VA 3UTZA 4JFYB 1YEDB 4MNHA 1FNGB 4L1DA 3ZR6A 1LO2L 3NSMA 1KTLB 3T77B 5BROA 4I3SL 4PTXA 4MYWB 3T0EA 2XZCL 4JFXA 1BM3H 2HTKD 3TWCH 3ILPA 1JXKA 4OLZH 3ZTJH 1H0IA 2OYMA 3CFJB 4DZBA 2W0KA 3K2UH 4GXUM 3MLUH 4OD2B 3VIGA 1J87A 1UGNA 1IGTB 1VFOA 1AI1L 3WUBA 3L3JB 3O2DL 4XH2A 4JO3H 4GRLA 1AXIB 3CCHB 1F5WA 3F7YB 1YA5A 5T1KB 4NKDB 5HY9B 1U2HA 4QXGL 5KSBE 5GRUH 5K59E 1C8XA 3WFCH 3V8CA 5IVXE 2CQVA 2X4UB 1ZT1B 4HXAL 2NY3B 3MCKA 2WCSA 1MH5B 5D1ZB 1LHZA 2ERJC 2DQEL 4HLZG 4MAVA 3WUZA 4U5IA 1GYAA 4RSVA 4YIQA 4HUXA 3BRDA 4H20L 2VABA 1LP9B 4YDVA 3SDYL 4B50A 4NZTL 3FO1A 1JDCA 1EDGA 3DJ9A 5I1KL 3O6MH 4M7LH 4P23A 5JLZA 4L1HA 3RP1A 1X1NA 4JO4H 1NGQL 2LQRA 3WIFB 4YX2L 3CDGA 5FYKU 3H9HA 3TN0D 3QDMA 5HGDA 3UJTH 4Y1AB 4IJ3B 1MCEA 1B2WL 3QI9D 1ODZA 3VWJB 3GSVA 3VFRA 3FTGB 4GQ9L 1BPVA 1L0XA 1MREH 4NQXA 3SKJL 1TVNA 3SUVA 2CDGA 1TFVA 1KXQE 5GPRA 5A16B 1YNKH 4FQ2H 1XGRA 4NO3A 5HVHB 1FJ1B 3GBEA 1HQ4B 4FZ8L 4MDIA 4NQCB 4GW1A 5DFAA 5HGAA 4UAOB 4BA8A 5K9OA 4DK3A 3DVGB 1E4IA 2YD5A 12E8H 1KUMA 2RIKA 1HHGB 4ZFOB 1DBJH 3MROA 4UFJA 1M7DB 1FGVH 5CEZL 5HHVL 4RNRA 5C3LD 3FQXA 3VXRA 5GS1C 5JOFB 4Y4HB 5HHMB 4XC1H 3DVNB 2ADIA 2WUBH 5EFIA 1BYBA 2JJUA 1YYML 3JUGA 2NTFA 4P9HC 3PG2A 1PZUB 1ZA3B 4GG8A 5I2IB 3NBNA 4OLXH 1C1EH 2BFVH 4HX1A 4W4NA 4Z7WA 3LKNA 4Z5RB 4HAFA 1BFNA 1E4XH 4NRXA 4PJXA 2DM4A 4L3AA 1QYGL 1CE1L 1BFSA 2ZKHL 4OD1L 2XKNA 1WAAA 4MADA 1BWMA 2QR0A 5ALCH 3FCTA 3P77B 2ZSWA 1I7TA 2NY5H 1I3GH 4LLVA 1F4XH 1QBAA 3KYNA 3T1FB 2EPNA 1DUYA 1TJHH 4HKJB 3MXWH 4NZCA 3AB0B 4GG6E 2XN9B 5J6GA 3DX9B 5IMMB 1WICA 4PJBE 5E4EC 4P3WA 4RDQF 4C59B 1KB5L 1PKQA 4JDTL 4J12A 3AS2A 4TVDA 1RZFH 5GIRB 1FP9A 3BQUA 3EO9L 3QCVL 2VMFA 2FBJL 3HKFA 3GGWA 1QOXA 3QQ3A 8CGTA 4EEEA 1V6YA 3ARED 3LD8B 2QADB 4LRNH 5ESQB 3WJJC 5CP3H 5TGBB 5DT7A 3FFCD 5EZOL 2PYED 3IFOB 4YDJB 3H8NA 3JWDL 3QFJA 1G01A 5MI0C 1WWAX 4NUJA 4N0UA 5EZIH 3WXWH 4P2CG 1PY9A 4QWWD 1P4BL 4XBEH 1YNTA 5SX4I 3VRIA 3ARBA 3QNZA 3W11D 3ARYA 3G6JA 5GQBA 1A7PH 4ZAKA 2AJUH 4G6KL 3P30L 3W53A 4Q22A 5ENWA 5J3HC 4W7WA 3ORJA 4I9WE 3NACL 1OLZA 2XTKA 5HD8D 4FXKA 3U7YH 3LS4H 4DWSC 1T7ZA 3VRJA 1DUZB 4OJFH 3O6LL 2VQ1A 1WB0A 4NRRA 1IAKA 1HL9A 2BMKA 2AEQH 2RGSA 4FOMA 5I1JH 1NCAH 2EKSA 3KS0J 3OL2A 1FNEB 1HHKA 4NWUH 4PTUB 4ZQKB 2FSEA 3MOBL 1OQOA 4MA8L 1AMYA 2NLJB 5JXED 3I75A 1CE6B 4KJPD 4JFFA 1JZ8A 1R3KA 1HNYA 1B3VA 1AKJB 4TUJA 1YEGL 3HPJB 2GKIA 3LSOB 3LEXB 3TIEB 2HMIC 3HNVH 3MXVL 3EYOB 3U2SB 1IQWL 4KVNL 4U1KA 3CUFA 3REWA 3FHAA 5HYJD 5JHLL 1UQYA 1P4IL 1OTTD 4BH8B 2BRRH 3T8XB 4KROC 4HJ0C 5CP7B 1L9MA 5EBWB 3ARDB 3WNLA 1CDIA 4WHTA 4B16A 5HXMA 1RZIB 3FN0H 4N8CL 2IALA 2C3VA 3BKCL 2D7PA 5DD1H 2QHAA 2EC9U 5A2JH 3V79C 3NFNB 3KL0A 2HT4C 3NVQA 3VXPA 4U1SB 3WKML 3MV7D 5F3HB 4XT1C 3SN6N 3OKLA 1HKMA 4PTWA 5F1KC 4PRID 4PUBH 5E6YA 4OGXL 1UKPA 5IW6A 2QHRL 2E9BA 4O58H 4APQC 4ZFFA 4GZJA 2AK1H 3CVHH 1QLFB 4XUYA 4IRJD 1GGCH 4KGLA 4MXVF 5C3TA 3RVXD 3S6TA 5CPTA 3QNYB 4OQ1A 5I71B 4H8VA 4R4BA 3RNKB 4HG4K 1T22B 2WW5A 4R7DA 4OT1H 3SDDA 2WAGA 3EYVB 1H3PH 4EXPX 5JNYA 1BLNB 3RBGA 3C87A 1Z9OA 2XGIA 3SCRA 1QO3B 3UPRA 5KZCD 2EDJA 3VX1A 4G9FD 3RI5F 1LLOA 2NY2B 1IGYB 3SJVA 2ENSA 1A6WH 2VLLB 2E8ZA 3VCLA 2NY1C 1SY6L 3P4MA 3CX5K 2EPMX 3E6FB 3M07A 5FYLE 3BAWA 5GSVB 4M7KL 4RRPG 1U3HB 5EC1B 4KWUA 1CGWA 2YUWA 3KJ6H 4QT5B 5FM4A 4Y7EA 1EFXB 4J23A 5GNYA 4HKBB 2UY6A 2RR3A 2PTUA 2Y06H 5D9SA 4MA1C 4MQ7B 1PAMA 1OM0A 4RGMC 2P5EE 4RFEA 4X6EA 5D7KE 4EVNB 3BZFA 3E2HB 1BVZA 1FGNH 4CVXB 1Z5LA 1G6RB 3V2AR 1R5VB 2NY7H 2YMXL 3ZDZE 3VNYA 4M4RA 1R3HB 1HKJA 7A3HA 1IGIL 3QUKA 1ODAA 5DDHB 2I25N 3QHZH 1A4KB 3AU1A 5E5MA 4FQQB 2J88H 3OHXB 3UBXI 3IF1B 2YA0A 1F90L 5J11C 1TJIH 4ODVL 4PSRA 3RZWA 2OSLA 4LLYB 4JFYA 35C8L 1FNGA 4LP4A 3T77A 1XMWA 4GW5B 4X0NA 2GT9B 2G4FA 2WHKA 3QPQD 4HWEL 1JZ5A 3B5TA 1W3LA 4UT6H 1AFVH 1CU4H 1WJ3A 3CFJA 1QLEH 1X6NA 4PB0H 3V4VL 4Z7NE 3C09B 4U1GB 4GAYA 4MHHI 1O5DT 4K3HA 1Q0YL 4OD2A 1NWRA 2A38A 3H7LA 3WHE0 3CIVA 1IGTA 4OF7A 5E9AA 3HAEG 4UFHA 2DQTL 5FL0A 4Q0XH 2V7HB 3CCHA 3F7YA 4PLKC 5T1KA 5JW3L 2ADFL 5HY9A 3Q3GB 4X6CB 3MV8B 1A3QA 4YO0A 2F61A 1U8IB 4O4YL 1AQDB 2BNRE 3BN9C 1FAIH 5EDXA 3DUSB 2X4UA 3GM8A 1ZT1A 3PZIA 1MH5A 3E6HB 5D1ZA 1ZS2A 2CPUA 2ICWB 1AQ0A 2W67A 4OTXL 1G7MB 1KN2L 4RL3A 4ZSOA 1DL7H 1LP9A 1U42A 1WIPA 2UVFA 1IKNA 4AWEA 4UTBH 3VRLE 4KZDH 2HISA 2EH8L 3WIFA 1AXTH 1J9CT 2NY4D 4W93A 2MQCA 1YQVH 5TE7L 4Y1AA 3QDGB 2IF7A 4K3DL 4QTIH 3WUEA 3VWJA 1LQ0A 3WLWD 4JZ5A 2ESVB 2WMFA 4LIQH 4C56D 1LL7A 4XP5H 1OCQA 1N0LA 1NGPL 5A16A 1A7NL 2IAMC 1J10A 4KHTL 1BJ1H 5L2KD 1FJ1A 4TNWK 1HQ4A 4NQCA 7FABL 1W72A 5A1AA 3UR8A 2J6EL 3GH7A 3O9WC 4R27A 4NKIH 1HHGA 4RMUA 4UBDD 4ZFOA 2BDNL 3QSKB 4ORGB 1OGAE 2YUXA 1E5NA 2WCAA 3L1OH 5JOFA 4Y4HA 2EIZB 3ZM8A 2EE6A 3DVNA 3GI8H 3PJSB 2UUDK 3QAZB 3WDHA 1G9ML 1DBMH 4EI6B 1DQLL 4PD4K 1ZA3A 4LHJB 5I2IA 5JHDA 3SCVA 4CJ1A 5CUSL 3MV9B 2MCPH 5IGXH 2Z8RA 4Z5RA 5FOBB 2XACC 4MQXC 1KXVC 3DYOA 2A6JB 2FIRT 1KB5B 4LNRB 5AYQA 2XVPA 5GS2D 2V2XA 3VGDA 3P77A 4CMHB 4GMTH 5GS0H 3VD4A 3GZKA 3T1FA 3O2WH 4E4PA 4R7NB 4HKJA 1Q6EA 3AMKA 4OQTH 2VDRL 3DX9A 2CXKA 4IRZL 2AXJA 2MPAH 2X5PA 3UTPE 4TSCH 3DECA 4LNVA 4P2RE 4MJ2A 5GIRA 4B7IA 4CW1B 4MA7L 5BZDA 3MYZA 4TVCA 2X6MA 1A7QH 1PFCA 4P5KB 4P8UA 4AW7A 4KI5D 1A7OL 3QPXL 3QEQE 3TVMB 1EQPA 1NUFA 1E6OL 4P8WA 3M8OH 1G9HA 5ESQA 4J4PA 1HN1A 5TGBA 1B4RA 1CFVH 3ARZA 2BRQA 2QPSA 3IFOA 4YDJA 3VG9C 5IW3A 2N56A 1QSVA 3ULUE 2XM2A 1JFQH 2AGJL 4W4OC 4WTWA 2OSYA 2GIYA 3LB6D 3ZKND 1FH5H 4HPOH 1ZHKB 2IQ9L 4U31A 3OQ3B 5KSBF 2WVUA 3TV3L 1NBZB 2A9NH 5IVXF 1Q94B 1MQKH 2HVJA 4ZS7H 5H35B 4CGTA 4KK8D 3ULSB 1JNLH 1OAKL 3KE0A 1E0OB 3TBTB 3RM8A 4L9LB 1DUZA 1INDH 3IKCB 2UY4A 1CT8B 1E27A 3MRMB 2Y2WA 1AE6L 1QUNA 3HZKB 1EERB 2PO6D 3OAUL 4LKXB 5C0AE 1FNEA 4PTUA 4ZQKA 2V5TA 3FN3A 1KJMB 1JPSH 1LEGB 5LJYH 4R6UA 3GK8H 2D4FA 1CN4A 2DQIH 2FX7H 3KDMB 4UIKH 4V28A 4HZAA 1TZGL 1CE6A 5D1QA 3DV4B 1KLUB 2OJZL 5AEAA 2W0PA 1AKJA 1KIPA 4V1DD 3WO4B 3LSOA 1T4KB 3LEXA 3TIEA 4CU6A 5ITBL 1U3JA 2UWEB 3EYOA 1FL6B 1K2DB 4PRPE 1B3WA 3WEOA 1U8LB 5DD0L 1ZEAL 3IJHB 2VLRA 4BH8A 2EO9A 2J7GA 3T8XA 2D20A 5CP7A 2CLRA 5A3HA 4M7ZC 5C09E 3QFDA 2ICWJ 2BXZA 5IUSA 1OF2B 1F13A 3V6OE 4DQOL 3BXNA 2IANE 2D3NA 3NFNA 4WO4C 1KTRL 4AC1X 1WBXB 4U1SA 4W5UA 1RMFH 1WT5A 2W60B 5F3HA 4GKNB 1CFNB 3PP4L 4WI5A 2CBUA 1M71B 1QSED 1LWHA 4ZUVB 5C07E 5M5DA 1TITA 1K9EA 1UWEL 2QEJA 3WH8A 3DV6B 5DD6B 1ZBKA 1MQRA 2F5AL 3GKWH 3P40A 4FQXC 1LG1A 4OM0L 4PP2B 1HIMH 1QFWL 1QLFA 5KSVB 3MCG1 3Q6GH 1F6AA 3QNYA 3RNKA 4KFZC 2VWEC 1T22A 1YYLL 4I0KA 4OZIF 3RM9A 5C0NC 1R3IL 1KCUH 3D1MC 1YEIH 3EYVA 1IGCL 4MLSA 5DFTA 4ZOAA 2FH6A 4BJLA 2X09A 3NOIA 1BLNA 3QDAA 4LVOB 2XY2A 2EIBA 4PJ9C 4UQ9A 1QO3A 1GHRA 2VZ1A 3DHJA 2XTJE 3JSSA 5DHVB 3X3FL 4CVWA 3PIQB 1IGYA 2HVMA 3TJHC 2VLLA 3GJFB 3E6FA 3CHDA 1W3HA 2ZG3A 5GSVA 1D6EB 5C0RH 5J1AB 2R29H 1U3HA 3GBNL 4NBXB 4QT5A 4FQIH 4YBLB 1EFXA 5ABHA 3D48R 5EUKB 4R3SB 5IFHH 3F8UB 5EUOE 1ISXA 2Q3ZA 2V9QA 4MQ7A 2Z1SA 1CDUA 2ICES 2CK0H 1ZU8A 2CYGA 4EVNA 4QAWA 2XG4A 5EA0H 1R3LB 5CPQA 4FNLL 4JQVA 2Q7YB 4GMSH 4CVXA 3IFNH 1G6RA 5C6TH 1R5VA 2H6PA 4RGOH 4WW1B 2DQXA 3T0BA 4HJGB 4G43A 1R3HA 4JAWA 4UR9A 5DDHA 4Q9CA 5SV4A 1OLLA 1A4KA 4H5SB 4FQQA 4QTHA 1BGGA 4ODHH 3OHXA 4FG6C 1OB1B 3IF1A 1Q72H 5DQ9B 2UWFA 2DPEA 4UILH 5C2BH 4LLYA 3LH2H 2XG9A 4QRUB 3QXTA 5BV7H 3VXSE 4Y5VC 4AZGA 5D96B 2VSDA 4GW5A 1KJVB 2GT9A 3QULB 3V7MA 1A22B 2ZNXA 3ALFA 1OAZH 2BC4B 3O2DA 4ZPVB 4TUKL 2COQA 3GH4A 2F53D 2A77L 2JIEA 4JHWH 5F3BA 5F71A 4D72A 2DLEA 3W0WD 1MWOA 5AY7A 4AZ7A 1IEBA 1S7XB 4BQ5A 5TPWH 3MRQB 4NKOB 2IBGA 3VDBA 5HDQH 2V9TA 4HMCA 5I15H 2C4FT 2JB6B 2V7HA 1QRNB 5F96H 5F1OB 4X6CA 3MV8A 4YC2C 4TXEA 1DBBL 1U8IA 3MA9H 4Q7DA 4S1SH 2CUMA 1AQDA 1JYXA 5FUCE 4U6VH 2EE9A 3MZTA 1BG4A 3WS3B 4NHCH 2W9DH 3MPCA 5D6CB 3P0VH 2EIEA 1MHPH 3BX7C 3E6HA 4NM4L 4M8QB 5D2LF 2ICWA 1S9XB 2ESCA 5KTEH 3LIZL 2BNQE 3INUL 3QB7C 1G7MA 3EHBD 4HD9A 3SGJC 1AQHA 2D9CA 2D3LA 4HU0A 5EH1A 4JG0L 3AMGA 3SO3B 1KULA 3M7SA 4MNQB 4X9HA 4M1CD 1A9BB 4EK7A 1TLKA 2P48B 3THDA 1C7SA 4OCYL 4OOZA 5F9OH 1CFBA 3MGOB 4BQ8A 4ODTL 5ACZA 5T3ZL 4JVWA 1TJGH 3KPQB 2R1WB 1LGVA 5E70A 5F7UA 2ESVA 4MDPA 1FZOA 3HR5B 4ZTPH 3BIBX 3PZTA 2QQKH 3MOQA 1FFOB 4I77H 4L5FH 4NQUA 1MXGA 1P6WA 4GBXC 5LA0A 2X41A 1E73M 1TVPA 1MCQA 3HFMH 1S9YB 2QSCH 5CXPA 2MMXA 2FRGP 2VDOL 4K71B 5CEXB 3EYUL 3TPUB 2D7TH 1JGVL 3SCMC 1CGTA 3UO1L 2XZQL 4ORGA 2XWEA 3TCXA 3OXSB 4NJAH 3EW3B 5FUZH 4PJ5D 3AHYA 4G3YL 3DMMD 4ZO6A 1BPLB 2EIZA 4M43H 3PJSA 1KEMH 3HS0B 4FQCH 1OAUL 4XPFL 4EI6A 5ISZD 3BMVA 5GGVH 2DQHH 4X6BB 5KW9L 3MV9A 3O3AB 3QXVA 5SWZB 3ZDZF 3U0TB 4ODSL 1KN4L 3DRTA 5FOBA 1A64A 4P9HL 1E6XM 3BKJH 5A6LA 2A6JA 5I8KH 1KB5A 1RUKL 4LNRA 2UUDH 4N1HB 5I0DA 3KYKL 4ESKA 5BXFB 4KK9C 2HWZH 1JUFB 4OCNC 3V0WL 3ZR5A 1EH9A 1ZTXH 4LARL 4R7NA 5T3ZD 1V6UA 4RRPA 1PYWB 5I9QC 3POHA 4HIEB 4HFUL 1RUAL 2AP2A 3KYOB 5AAWA 4MXWL 3MOAH 1SYSB 4CW1A 1E3ZA 1IFHL 1MJUL 4KH2A 4P5KA 2R4SH 2DSUA 3WMSA 2F5BH 1ZANL 3GIVA 5M95B 3N06B 1FH9A 2WMGA 1P7KB 2IFFH 1K85A 4Z7NF 3STBA 1A2YB 2H32B 1T04B 4WSKA 4UV4H 1J01A 2NXZC 4PRIA 4W81A 3GNML 5JQ6L 1EIBA 1F4AA 4WJXA 4PR5B 3RZCB 3PZ9A 2WUCH 2R2CA 4DKEH 5JOPE 4GXUN 2YN5A 1FVDB 4D2NA 2EYSB 3N12A 5IFAL 1NBZA 2DT0A 4D6HA 4F9PA 4OUUB 3N04A 1WBZA 1Q94A 5H35A 4O51B 2BY2A 1L7IL 4AENB 5KAQG 3NCCB 1WO2A 2R69L 4XXCA 3PL6C 3ULSA 3NZHL 3QIBC 1IGFH 3TBTA 4OIFA 2C3GA 4L9LA 3IKCA 3W4RA 4HC1L 1AQMA 1JE6A 1CT8A 3WEZA 4RE2A 2VZTA 5BJTB 3HZKA 3WLBB 4G8IB 3K1DA 5BS0E 1E6JL 1YMHB 2AKRB 3MJ9L 4XNZB 1KJMA 3D9AH 1LEGA 2EXWC 3KDMA 4PMUA 4D3CH 3UBXB 3RJQB 3DV4A 4PJFE 3WD0A 4LSSL 1JGUL 1T4KA 1YPZB 3VGAB 4HPHA 3KL3A 4Y4KC 3GM0A 2UWEA 1FL6A 1K2DA 1N64L 2ADGA 1U8LA 3D6GA 4DUXA 1JPTL 3IJHA 4OLWH 1FOBA 3TGXA 3UC0L 2OLHA 4JB9L 5HPMB 2ARJQ 1V3KA 1OF2A 4IRSC 5F7HA 4R4FH 4X4XB 4RBPH 5INDB 1BYCA 2DJSA 4MNMA 1JI2A 5I6XB 2PTTB 5HGGS 5IEHB 3EMQA 4PJGE 3IDUA 5LQBL 1WBXA 1YEJL 4XPHH 3V4UL 2W60A 2D23A 4LU5L 3L5WB 3RGVB 1F3JA 4NGHH 3HUJB 1IT9L 3GHBH 3PXHA 4GKNA 1CFNA 3RWGA 4MCZB 1M71A 2QSTA 4Z0BH 4X7CC 2VXSH 4ZUVA 1U91B 4OZGF 43CAB 4EOWL 5A2FA 3DV6A 1ZVYA 3CUGA 1JWSA 1DBAH 2GEEA 3GSNL 3O4LB 2ENYA 3PWLB 1K8DB 4NNYB 4PP2A 4X4ME 5GGTL 1CLOH 5MERB 4BA0A 2MKLC 2HKHL 2FEDC 1NLBL 1OP9A 1OSPH 2DD8L 4LP5A 3EJYC 4L8SB 4LSQH 4PJEE 3OLEA 4M5ZH 2W65B 3HG1D 4F80A 4ZXBB 3DTXA 3GMLB 4ELMF 2DTML 3T0DA 1SY6A 4D6CA 1UFUA 4KKCD 3W5NA 3QUXB 4YXHL 5C9JB 3S5LG 1IJ9A 1AD9A 5AC5A 1KC5L 4JQXC 5E0CA 2VUYA 4AD2A 1FN4B 1MRCH 1RIUL 1UUQA 5TDPB 3HRZB 4JM4L 2MFNA 4ZO9A 5DHVA 1W0YT 5GGRB 3ZJ8A 4MNKA 3PIQA 1A14L 4IMKC 1T0PB 1UQSB 3GJFA 5CLTA 5I1EH 3PE9A 3SPVB 4O5LH 4HIXH 1D6EA 5J1AA 2EXYC 4Y19E 5D2NB 4U3XA 4U0QB 1AIFB 1MJ8H 5A8NA 3MNZB 2W9LA 4MJIE 5D5ME 2FB4L 4HZ7A 4RAHA 1N5YH 2YD2A 5EUKA 1SMAA 4KHXH 3AROA 4R3SA 5FCZA 4AEHL 5BXPA 3UZQA 3B9KD 1WEJH 1UOKA 3RIFF 1DQDL 4JRWA 1FL5A 2Q7YA 2WQ8A 3ZL4H 4K8RH 5HI5D 2HT2D 1GZJA 3KGRA 4HJGA 1F4YH 1QTYT 5DRZB 1OAXH 5I8CB 3N9GL 3NABH 4GS7B 4XTRC 1BG9A 5DA4A 2AXHA 1ZVHA 1EHLH 4I0PC 2FGZA 4N0FB 4D1IA 4H5SA 4DN3L 2YBRB 4BQ9A 1OB1A 5DQ9A 2NCMA 3G6DL 4C56A 3VGEA 4PMQA 2VRJA 1LO3H 4D71A 1FBIH 4WI8A 1T20B 1EQCA 3PF2A 4QRUA 2EKJA 2JJTA 2DJ4A 4O02H 4YHYC 5T3XL 5DD3H 4YFEA 1OTSC 1KB9J 1KJVA 4LIQE 3QULA 3CZKA 3A4AA 3R0MA 1UVQB 3I9GL 4LMQI 2CERA 1GUVA 2BC4A 3EBVA 4ZPVA 4TX8A 5E99H 1I8MB 3LCYA 1VADB 2F8OA 4V2BA 1GOIA 1VBRA 4XVSL 4PREB 1BOGB 4JFPB 3CLEH 2YL6A 4WW2F 1FP8A 2F2HA 4L3CB 2IC2A 4AEIH 5DFWH 1S7XA 3C8DA 1LMKA 2JTDA 3V9FA 1T89A 3MRQA 5I76B 2JB6A 4MB5A 4W89A 2OTWB 1Q38A 2EYTB 1QRNA 4Y8DC 5BRZE 1UB6B 5M03A 4FQLH 1LL4A 2ERJB 3EOYG 3W81A 3QQ9C 4KJQC 2V5DA 2CHOA 3RWCB 5D6CA 2G75B 3BGAA 3IDJA 3AHTA 4M8QA 4JN2A 2AXFB 1FG2A 4OI9A 1D9KC 3H3PL 4LFHG 2X9YA 4WVRA 2HAZA 2BS9A 5KSUA 5C6PB 3CMJA 1RUQH 2M8XA 2ILLA 2P8LB 1XGTB 4MNQA 3DETC 1A9BA 2CDFB 2DL2A 1I75A 1K3IA 2QSQA 2Z4QB 1LDPL 4WKHA 3VI4F 5HNNA 1B2YA 1F11B 4NCC1 1KQZA 4KUCD 3KPQA 6FABL 2CGRH 4GXVH 2R1WA 2NY0D 1T83C 5C86A 2J6EA 4OJYA 3KS0H 2GSGB 3U6RB 2AK4E 3B2VL 3ARFD 3HR5A 1T03H 3G9AB 4UT9H 1S7RA 1U2YA 1G6VK 2YPLB 4QLKA 1G7PB 1YY8B 3MRHB 2PWEA 1FFOA 2XZZA 1HE7A 1UJTA 2PWHA 2HT3D 3Q6FB 3B2UC 4PV9B 1D5BB 1S9YA 1T7XA 5CEXA 1QA9B 5FKPB 3TPUA 5GS1B 5TF0A 1JF5A 2WKGA 2VLJD 5FM5M 4LSPH 1C5CH 1EMTH 4NQED 2OM5A 1JGEB 1A6AB 1K6QH 4GLRH 4Y8AA 5LCVL 4KY1L 3QQ4B 4HGWB 5L8KB 1CDJA 1CICD 5H2BB 2XI9A 3L5IA 5L7XL 4ZODA 1J1XH 5EUOF 2RGMA 4Y7MA 1UD4A 3OKDB 4LPCA 4JO1L 5CCKH 2D7MA 2GITB 3FXYA 2VQTA 1FLRL 1EUTA 3HZVB 4X6BA 3CZJA 4GI6A 3CC5B 1NGXB 5I0ZA 4WU7B 5FFLA 3O3AA 3S5LB 2B20A 3C60D 3U0TA 5I1HL 2M1KA 4P2QD 4PJDE 1EGJL 2VDLH 4GSDL 2BVOB 3BP6B 2R0ZL 3H9ZA 3FO9B 1F58L 5IVOA 5BXFA 4HF5H 3GBDA 5A8PA 3NPSC 5GGUB 1JUFA 5E4EB 3RWEA 3IS0X 5C0CD 5B39G 1PYWA 5KOMC 1AGEB 2JCCB 4HIEA 4M02A 3ZQ9A 4FTVE 2NPLX 2BZDA 3RWFB 2VURA 4HLJA 5EWIH 2Y07L 1UD6A 3KYOA 1IQDB 3KYMB 1SYSA 4MNLA 1EO5A 2IFGA 5F9DC 3APGA 4X9YA 3TO4D 3MREB 3MRRB 3MANA 2GJ6D 3IDYC 3VIJA 3HTLX 4TX6A 3VXME 1MWAL 3RVVC 5FCUL 1KFWA 4JFED 4BM7A 4PS4H 2X1XR 4C7FA 5MI0B 1P7KA 1UZ8B 1WBYB 3WD5H 4YAQA 4H0IA 1A2YA 3SKOB 3RAJH 2BJML 4XCFL 1T04A 2YSSB 1U93B 3ZDYF 3O9WD 4X0KA 1HDMA 3V5KB 3WHXB 3BIKB 4JY5H 4TN9A 5DJ2B 3RZCA 3T08A 4U1HB 3VFTB 2JIWA 2IG2H 1FVDA 2EYSA 4ZOBA 1MNUH 3NDYA 1QLRB 3P9LB 4DWSB 3F58L 1Q9WB 1Q9OB 4KTYA 4JPVH 2FATL 4OUUA 4JL2A 5FHBH 1J05B 4FFZL 4O51A 2ZXBA 3VFVA 2ZG1A 3MODL 2JJSC 1B88A 2YLLA 4TUOB 4OSUL 1MAMH 5CQ1A 4L3EE 1LK2B 1CG9B 2ZJSL 4W87A 4L29B 4WKAA 4OCSL 2EE3A 5BJTA 3CPUA 1YUHB 3K81A 4G8IA 3WLBA 1YMHA 1JNHB 1RJYB 4YUEL 3CZLA 2AKRA 5GZNC 2FJGB 1UR9A 1DVFD 1EEZB 1NBVL 4CVZB 3DI3B 3U7BA 1WWBX 1ZS8A 4QRTB 1JFHA 4PYSA 5HYSG 4Z2IA 1UA3A 3GNOA 1HOCB 3Q48A 1W9PA 4R96B 5DK2B 4O2FA 4GKZA 1A7RH 1YPZA 2O5XH 4M93C 3W26A 2E6QA 1IC4H 2FGLA 3OGVA 4GO9A 4KROB 3BDYH 5FYKL 1P7QD 1GPOH 1T5XB 1H2JA 1G0CA 4PTMA 3C6LC 3U9PL 1R6VA 3KNBB 3AISA 5F7NC 1EO7A 4P59L 5HPMA 3S6CA 1BYAA 2CO6B 4PRAB 3OF6A 2I26N 2Y23A 2HRLA 2NY6C 4X4XA 5INDA 4UQBA 3CH9A 2PTTA 1FZKA 5ECUA 3GSNB 3O41A 5IEHA 1B90A 4AIZB 3LPWA 2YXMA 4DCQB 5GGVY 4FZEL 2JELH 4B53A 2O93L 3D69A 3RGVA 3L5WA 4FQPA 3HUJA 3WFBH 4J28A 4PMDA 2QV2A 3MRKB 4NJ9L 4APQB 3WSUA 1VACB 4MCZA 1R7OA 1U91A 4NO0D 1IZJA 2FX8H 1BF8A 3RJYA 43CAA 3QUYC 4XGZA 1H41A 3HE7C 2QBWA 3O4LA 4NNYA 3PWLA 2B2XH 4UTAL 2NX5D 5LWYH 5MERA 5DT1L 5DSCB 4S2SB 2G8ZA 3T0AA 1JRHH 4Z8FH 1JN6A 4LEXL 1V02E 2P5WD 4L8SA 4LVNC 2W65A 5FUOH 1V7NH 1HNFA 2XYLA 3GMLA 4LPWA 1H3GA 1B0RA 5IT2L 3KR3L 5BW7C 1EAPA 2RB8A 3BP5B 4LDEB 5C9JA 1JNNH 4HQQH 1QR4A 5C7XH 4MAYD 3TO2B 5FYKD 3RILA 1XGQB 1DSFL 2NY1B 1BD2D 1FN4A 4M6MH 3FJTA 4ERSH 5TDPA 3HRZA 4AMCA 3A6BL 5GGRA 2VVNA 3VXTB 1U3YA 1HX0A 1YEEH 1PQZB 2AQ2A 3H7BB 3NH7L 3P0YH 5EU6D 2EC9T 3SPVA 4QEGA 2Q8AL 1A0QH 4KKBC 2Z93A 4XP9H 4C4KT 5D2NA 2DWDA 4OGYL 4F8QA 4JGUA 4MA1B 3J8F7 3PP3H 4NCC2 1ETZB 2YUZA 4RGMB 3MNZA 4JKPL 4YE4H 4P23C 3UYRH 3ZT7A 4JVPA 4M3KB 1S8DB 2CRZA 3PDGA 1XYZA 1V3MA 1GC1C 5B39B 3RPMA 4MDOA 3UJIL 4QOKE 3POCA 1EHNA 3ZE2F 5GRVL 1T66D 3PQYD 2EDOA 4ONFH 4YQXL 4E0RB 2J8UB 4E41E 3O45B 5T1LB 1G7HB 4JKLA 5I8CA 5K9JL 1FVCB 2R0KL 1NFDF 5JDSA 5CBEA 5KVEH 2PCPB 3MRBB 1QACA 5C0EB 4S1DC 1FYHB 1HKLL 2A83B 4FQXD 4N0FA 5J11B 1PLGL 3SURA 2YBRA 4PGDB 4XWOD 1X5FA 5C71A 7CGTA 2J25A 5A8QA 1YJDL 2Z8VC 2C7UB 5EOTA 3MU7A 2F19H 3T0EE 4QRRD 1FO0L 1T20A 4NC1C 2IGFH 5HPCA 3TH2T 5B38G 1G7JB 2WYSA 4Z7VB 4WWKC 1UVQA 3JXAA 4TNVK 1LE9B 4FMVA 3ZOAA 4LXFA 4PJ9D 4XMLL 1LQSR 1I8MA 4S0SD 5HHNA 3N1MC 2WLYA 5AWNH 2ZCHL 4G7YL 4PREA 1BOGA 4JFPA 2APBA 4YEFA 3RX8A 3DVIA 5EBAA 1P5UA 1DQMH 3RM4A 4GAGL 3QNXA 2HP4A 4UIMB 3MACL 5I76A 1H5BB 3BP7B 2A0LD 3ROOB 4XV0A 4AD4A 1FNAA 5ISZA 3LQAC 2OTWA 3VWKC 3HI6H 2Y8VA 1NC2B 3P2TA 5MP6H 2J78A 1UB6A 3CTTA 4R90H 5I19H 1G6RH 1OT1A 2KQMA 3FB5A 1JYNA 3L4XA 1RURL 3LHPL 4JZJC 2DI9A 3RWCA 3QDJE 2G75A 1TTUA 3RKPA 4PJCB 3MMUA 3RL2B 2A9MH 2XSBA 5DZOA 1IM9D 3AS0A 2V7NB 4JANA 1E5JA 4MB3A 4H1LG 4NQDD 2XZCH 4HWNA 1ZT4B 1RJLB 2P8LA 1XGTA 2B1HH 3OPZH 5DTFB 1XSKA 2GI7A 2AEIT 4JHOA 2V17L 1OWRM 5HGHB 3B9EA 2VT0A 4HCRL 2Z4QA 1MCFA 4PJEF 4Z2LA 1F11A 1R5WB 4ACPA 4Z77A 2GJ6B 3ULVD 4P7QA 4G6FB 5EORH 4PLNC 4RDQG 4P9ML 4MAUH 3CIQA 2ZX5A 2WMPA 2AEPL 3ARBC 2DM2A 3O2DH 4G6ML 4NQVA 3U6RA 2GSGA 2IAMB 4XX1E 5BCAA 4QO1A 3MRCB 4TULL 3FRPA 2YPLA 1G7PA 1YY8A 2FHFA 4U1JB 1RIHL 1RAMA 4EN3D 3O9WB 3ME0A 4LAQL 5IV2B 4IM8A 3Q6FA 4HXAH 4PV9A 1D5BA 1WFOA 3BZEB 2C7FA 2DF3A 2V5RA 5J7CC 4OFPA 2DQEH 5GS1A 4DEPC 3VXRE 5JIWA 4HHAB 3BJ91 3F5WB 5EBMB 1X5LA 2LU4A 2MQ3A 1JGEA 1A6AA 2ZUYA 4G8GB 3QQ4A 5D5MF 1XF4B 4H20H 5HYQB 5H2BA 1UHVA 4OZFG 4AZ6A 3ARQA 1GGIL 5EU5B 3SDYH 3LPPA 4NZTH 5I1KH 3OKDA 1ESWA 3RJXA 5IMOB 2ITDB 4LVEA 2GITA 4PJHE 5EU3B 1NGQH 4Z7WE 3V52H 1XH0A 3HZVA 3CC5A 1NGXA 1QNPA 4WU7A 4EKJA 1DDHB 3S5LA 1HXMA 1WAAE 3GXIA 1WQVT 4ZOCA 1B2WH 2ORBL 4RAVA 4PJAF 4G9DB 3BP6A 4GQ9H 4D0DB 3OJDA 2VAJA 3VD5A 3DBXA 3FO9A 3VD7A 3SKJH 2ZXQA 2ZUSA 2CPCA 1PZ5B 4XAWL 5GGUA 4F8XA 1X4XA 3UPCA 2HLAB 4R0LC 4FZ8H 1FH7A 1MWAB 1AGEA 1GZQB 2GK0A 1PKQE 2JCCA 5JTWA 1J8HB 1UD3A 3P11L 3QA3B 1QHZA 1YNLL 3RWFA 2P44B 3BAJA 1OCWL 4L4TB 1XEDA 3O3DB 2H2PC 4NC0B 5T1DH 1IQDA 1BVLB 3KYMA 5CEZH 2PTVA 5HHVH 3MREA 3MRRA 5HDBF 2CIKB 3WJJA 5IHLB 2Z31C 3SE4C 1YYMH 4IIQC 5HI4C 4BQCA 2BHZA 5JMRA 3VG9B 3IVKB 1QSEE 1UZ8A 4PBWD 3HNSL 1WBYA 3QFJE 4GBXD 3U0PB 3BRGC 4HDIA 3STLB 1MIML 1T6WA 4N0UE 3CZFA 5JDJA 3GMOB 3SKOA 5I30L 1NCDL 1GGYA 1AGDB 1MFBL 2AJSL 2YSSA 1J7VR 1U93A 4RA0C 1U92B 4LL9A 1QYGH 6TAAA 3V5KA 4MD5A 4RGNC 5A2BA 3WHXA 4OD1H 3BIKA 1GOMA 5DJ2A 4HC1A 5BOPA 4OLYH 4U1HA 1CZ1A 2N1KA 2VRAA 1QLRA 3P9LA 3TYFA 4ETQB 2B0SL 2IEPA 3SOBH 1BMGA 1Q9WA 1Q9OA 3KYAA 5A3ID 1IC1A 5JA9A 3WQ4A 1J05A 3FZUC 5D4QA 3MJ9A 1XIWC 4YHIB 1KGWA 5B38B 2ZX9A 1FORL 5ESAB 3WHE1 4QF1B 1KB5H 3WEMA 4TUOA 4JDTH 2P8MB 1PSKL 5DYOA 1LK2A 1CG9A 1M04A 1MCHA 4L29A 5B3JF 3O6FC 1YUHA 3VW3L 2FBJH 3JBG7 3UYOD 1JNHA 1RJYA 4X7SH 1N82A 4JFFE 3N15A 1HWGB 2FJGA 4L4VB 2YD7A 1EEZA 3PTMA 3D85B 4QRTA 1NKOA 4UNTA 2L0DA 2VDPL 3A6OA 1CXFA 2Y72A 2GK1B 2R8SH 1HOCA 3T04D 4R96A 5DK2A 4OFKA 3JWDH 1QVOB 1IT0A 3UTSD 2J7DA 1BFTA 3GXDA 3X3GL 1P4BH 4M7ZB 2F8QA 5AD0B 2A74B 2DICA 2H2SD 5IR1B 4KK6D 1NFKA 1T5XA 2E9MA 3I6LE 4Q97A 3X14B 3FOLB 4G6KH 3RIAK 3P30H 1AGBB 2JIXD 5I66B 1S9KC 3NACH 3WCYA 1TR1A 3B9KA 4PRAA 4Y88A 1T3FB 4H1LB 2XOTA 4WO4B 5KSAC 3CH1B 3NZ8B 3O6LH 3KWWB 1E4WL 3LS5L 1RHFA 3GSNA 4TVPL 1YY9D 4UOW0 4CRPA 3L4TA 4BZ1H 5GGTA 4AIZA 4DCQA 5M94B 5B22A 1OARL 3W2DL 1B0WA 2HYMA 5L6YL 4Z2HA 3STZB 1VEPA 3MOBH 4MA8H 3MRKA 1VACA 4FQXB 1E40A 4Y2OA 3HI5L 3W38A 4XCEA 4ZFMA 5J4MA 2EPKX 2QF8A 1NOFA 1KFAL 1I1AC 2Y36H 4AM0B 4GQRA 5DC9B 2Q8BH 4FK9A 3PL6D 1U30A 1NQBA 4TTDC 5DSCA 4S2SA 5CFHA 1ZHLB 2MANA 5BWFA 1YEFH 5KG9B 3KPRB 4U1NB 1IQWH 4KVNH 5C0IB 1UA6H 5CS7A 2AJXL 5JHLH 3FB6A 3QEHB 2NYYC 4G6AD 4YPJA 5FL1A 1P4IH 3FO2B 5JIPA 4HBCL 2WV3A 4RMWA 3P4OB 4I3RL 3BP5A 2PC8A 4MJ5B 4XPAL 1MJJB 3MQIA 2G3NA 2XY1A 4N8CH 4YR6B 3TO2A 4W84A 3IXAB 1MFEL 3BKCH 4P5TD 1XGQA 4OZFB 3IETA 4WDIB 3GMRB 1OPGL 3VXTA 3EZ8A 5BVPH 3H7BA 4RX4A 3EMCA 1CIDA 1R86A 4NO5A 4BS0A 4OGXH 5FUCC 3V8OA 1DHKA 2B4CC 2QHRH 4JVUA 1EOKA 3TA3C 3H9SD 1ETZA 4TVPD 4QRPB 5D1XD 4J6RL 3EGSB 1S8DA 5I74C 5IQ7L 3BT2L 4KGJA 1UZ1A 4S0TD 5DFVC 3FT3B 2O9OA 4HPGA 3AYRA 1EO8L 4FFWC 4PJ7E 5B39A 1U8MB 1ORQB 5IJVB 3WELA 2XXMB 4PBGA 4AZHA 4ZS6D 1GZPB 3BISA 3ROLB 4E0RA 3O45A 5T1LA 1G7HA 3TT3L 4QGTA 5C6WH 1FVCA 4PMRA 1YN7B 3LKQB 1FO0B 4ZYKB 5TFSL 2X4QB 5CGYC 2A3EA 2PCPA 3MRBA 3WH7A 5C0EA 3QGVA 1VSCA 5GS3A 4UV7L 4PGDA 1L7TL 2AI0L 4JQIL 1SY6H 4Y5VB 2C7UA 4D1JA 3EJYD 4NKMB 4M7KH 1UWRA 2DYPD 3K4AA 3BC9A 2WXDM 3CZEA 1Q6DA 4Z2JA 3HE6C 4GKOA 1LE9A 4JFDB 5DHVH 3LDBC 5FV1L 4KJWC 4Q9QH 3GJFH 1S3KL 3OMZA 3QIUC 4MXQC 2Z35B 3AVEA 3O4OC 3RUGB 4OIBA 3N17A 4UIMA 1CR9L 2YMXH 3RVUD 1VIWA 4FXLA 3TBYB 5ICZB 3RTQD 3BP7A 3ROOA 4YC2B 3VXUB 5T33L 3VFNB 4WEBL 2J8HA 1S7VB 1NC2A 2OYKA 5I16B 1Z32X 5CINL 1A5FL 4ZUTA 5DMGD 4LHUB 3NIDE 3AMCA 4EAMA 1U8KA 1HHIB 3OZ9L 5K9QI 2FGWL 1V8HA 4GIAA 1M6OB 3IJ7A 4ODVH 1ECEA 1VGKB 5HYSA 3CFEB 4PJCA 3RL2A 1QNOA 3VNZA 1BHGA 2YBUA 1MRFL 2V7NA 4KVCL 3V6BR 1LP9E 2C9AA 5E00A 3W27A 3BPLC 2AAVA 1ZT4A 1VFAB 1S7WA 3GSUB 4XTRD 2A6DB 1RJLA 1D2KA 4NSBA 4PRHE 5DTFA 4HWEH 4I0PD 2X70A 5HGHA 5AAMA 1P5VA 1EK3A 1UM5L 4YFDB 4P5MB 1BLIA 3MUIA 5A6BD 3CFKB 3V4VH 3K2MC 1ACYH 1R5WA 1CD1B 2GJ6A 4JPWL 1ZBCA 1SVCP 1Q0YH 1BSIA 5FHAL 5I1GL 1CGYA 7TAAA 4JJHA 1ZT7B 4JRXB 1WVZA 4WHDA 2D7OA 4GBXB 2EH7L 2ADFH 2AV7B 4JREC 5TQ0L 2W0FB 4O4YH 1PPIA 1CVRA 4RQQB 4P49A 4U1JA 1BTCA 1O6IA 4LSVL 1HJWA 3O9WA 4PRNB 5IV2A 3TCLB 5IJKC 3SCMB 1KLGB 3BZEA 4PN2A 1SM3L 4U6HB 1GGUA 4Q6YA 4D94A 4RMVA 4HWUA 1IC5L 4YHLL 1E4KC 3OG6B 3F5WA 4HHAA 4OTXH 4U0RC 5EBMA 5HHME 5HYFA 6A3HA 4G8GA 3CXDL 1KN2H 3SUUA 5FOOA 1XF4A 3C2AL 1EGJA 4JZOB 5HYQA 2NXYD 2XXCB 5EU5A 3LPFA 1V3LA 5IB3B 5SX4H 3WN5A 5IMOA 2ITDA 5F6HI 3EDKA 2PXYB 5EU3A 1KXVA 3GSQB 4YHZH 1YECL 2EH8H 1INEH 4Y2DD 1DWIM 1FFNB 1CXIA 3T65B 1GGBH 1DDHA 3FT4B 5GJTH 1Z2KA 5TE7H 2ARWA 3NA4A 2F54B 4K3DH 5KVDL 1DVFA 4G9DA 1Z0NA 1NCNA 4H8WC 5IB4B 4Y4FC 5I9QB 3FW6A 5GHWL 2XN9E 1NGPH 5LAXA 4LQFL 1B31A 2R0WH 1A7NH 2AJVL 2NZIA 4KHTH 4C58B 1NC4D 2HLAA 2E3ZA 2J2ZA 3QUMB 1MWAA 1GZQA 1J8HA 5DI8B 3QA3A 1LK3L 1UD5A 1F00I 1CPUA 2J6EH 4L4TA 3SDAC 1KPVB 3F7RA 3O3DA 2BDNH 2QHLA 1JGLH 1Y0LA 1S9WB 2VLKE 3U1SH 4MMZC 3S3PA 2MCG1 3WUGA 4HGMA 2R9HC 1G9MH 3IVKA 3MBEC 1DQLH 2R2HB 1CF8H 1FCCA 3U0PA 2NXZB 2BP3A 3TT1L 4W4OA 3BFOA 3STLA 5CUSH 3GMOA 1AGDA 5IFJB 2DM7A 2VQUA 1U92A 2XV6B 1CQYA 2OP4L 3SGEI 4XNXH 3KLAB 4I9WD 4I5BB 3EDJA 2VVSA 2HTKC 4AD0A 4ETQA 4TNWF 3QIBB 2WZHA 3BSZH 3LRGA 3QUZD 3I84A 5IF0B 1WIUA 5B38A 3K46A 4TSAL 3RWDB 5ESAA 4IRZH 5ABGA 1I4FB 5HHOB 4QF1A 2R1XB 5JR1H 2P8MA 5DURD 2GUYA 2I07B 4WJ5B 3BIAX 4KI5F 1CLYH 4MA7H 1T1WB 4MNGB 1AY1L 4BZYA 2VB5A 5J6HB 2H3NA 1SJHB 2B8OT 4PYGA 4MAYA 4IOFD 3QPXH 4L4VA 1BD2A 4B5EA 3AIVA 1OSZA 1NANI 2GFBB 3D85A 1J5OH 3PDDA 4Y4KB 2P8PB 2GK1A 2J7HA 1RZKC 5EU6A 3BD4A 1QVOA 5CLWA 3ARGD 1RIVL 1K9TA 2VX7A 4JQVC 1UZ6E 3U7AA 5D7LB 5AD0A 2A74A 5IR1A 5FYLL 1GOWA 2QLYA 1GOGA 2IQ9H 3X14A 3TTSA 3FOLA 4IRSB 2FO1A 3TV3H 3L5HA 1AGBA 3NJ3A 5I66A 2H32H 5DS8B 3F4VA 3LRSB 2BERA 5E4IA 3S97C 1IGJB 1T3FA 5DO2D 4H1LA 4WO4A 1OAKH 3TN0C 1MJ7H 3GB7B 3NZ8A 3KWWA 2D31B 4X9FA 4X98B 2WWMD 3QI9C 1NLDH 4Z7OE 3D0VB 3I3DA 1AE6H 4F3FB 5H94B 2XSAA 3WD3A 3OAUH 4Y16D 3SCQA 5EU7E 5FDYA 1T1YB 3NFSH 3ZSSA 4PJHF 4FQXA 2PWFA 5LG1A 1TQBC 1TZGH 5FXCH 2HJLB 1H3UA 1J0HA 2OJZH 4AM0A 5BQ7B 2PW1B 5KVGL 1N6QL 2YK1L 4NUGL 1OOAA 1WAAF 5CKGA 1WSST 3DUHA 3T4AB 1ZHLA 4QRRA 5KG9A 2DLHA 2NNAB 3KPRA 1G7QA 4P4KD 1W91A 5C0IA 1P4LB 3WL0A 1N2RB 1FLTX 5DD0H 2V5YA 1AR1D 3QEHA 1ZEAH 3BI9X 1D3CA 3Q1SL 3FO2A 5AYUH 5FDWB 5F7EL 3FQRB 5FGBC 4PJ9A 5DR5L 3P4OA 1UM4L 4MJ5A 5I1LB 1MJJA 3D39B 4C4KO 1WGOA 1UACL 1XCTB 2B39A 4CBPA 5A2LH 4YR6A 1YMMB 4DQOH 3IXAA 3SBWC 1NMBL 4JCMA 3ZZ1A 4N8VG 4MCYB 4TPRH 2VX4A 5FYLD 3TTQA 4OZFA 5CMAB 3R8BB 4F9LC 1GJUA 3GMRA 3AQUA 1P6AB 2ZUWA 3VG0H 1E71M 4UZSA 1URLA 1CBVL 2YL5A 1AD0A 2VYRE 1DP0A 5IVXB 5DD5L 5I8OL 4X7TB 2VO5A 3CFCL 4UFMA 3I2CL 3PP4H 4LYQA 5E08L 2YDQA 2P5ED 1WAWA 1LO0L 5D7KD 3V4PL 3TTYA 4OV5B 2F5AH 3K8KA 4QRPA 3EGSA 4OM0H 3VD9A 5CIPB 2G5RA 5K9KA 3BUYB 4YHGA 2VR5A 1MCIA 1C5DB 1NDGB 3FT3A 3OBAA 4LCYB 3CD4A 4UNVA 4R2GD 2ATKB 1WZ1H 1U8MA 3VFWB 5IJVA 3QCUH 4J3OC 4HIJB 1YYLH 5D7IF 1S5IL 5ALBL 5I1CL 1GZPA 3VFOB 3I6KB 3JV5A 4YJZL 3AREC 1QSFB 4I0PB 1R3IH 3ROLA 2YIHA 1IGCH 5GRJL 3TH3T 4JR9L 1YN7A 3LKQA 1FO0A 4ZYKA 2VJXA 2X4QA 1NWSA 3I02B 2XFFA 4JAMB 4IBLT 4DVRL 3GSWA 5C08B 1M7XA 1HH6A 4M6NL 3X3FH 4QWWC 2QKIB 1KJ2L 3L5JA 5ICXA 3BVNB 3FMGL 4Z76B 2OS7A 4JFUA 3W11C 4YHYB 2EDQA 4Y5VA 1CGSL 3S37X 1BZ9B 5C9KA 3MUJA 3GBNH 3FQNB 4N8PA 5HD8C 4N0CD 2RCSL 4P46D 3ZHKA 2CKRA 1Z9SA 3D25B 4CVUA 2EEAA 4JFDA 4LGPB 4GRMB 1KXTB 1B3YA 5A95A 5I23A 5T5FL 4P48A 1EBPA 2Z35A 3NCYS 1RUPL 4NQTA 2X9XA 3RUGA 3R0NA 3QG6B 1TMQA 3DGGB 3U83A 2KDGA 5JXEC 3MLYH 3TBYA 5ICZA 2GHWB 4KJPC 2H9GB 4JJ5B 3VXUA 2BNRD 4X6CE 3MV8E 3VFNA 1MVUB 1A1MB 2OLDA 1S7VA 3VXNB 5I16A 3CVIH 5I79A 2JJVA 4OV6F 1GQJA 3OIHA 3BHBB 1A3RL 3AIWA 2VUOA 4NDMB 3LQAL 5I18L 1HHIA 1UWTA 2P4AB 1QFWM 4OZIB 2E7CA 1D9KB 1M6OA 1OTTC 3SGJA 1VGKA 3CFEA 4HCRA 2DMBA 2OXGA 5DJCB 1CIUA 3O11A 2W9EL 1S46A 2X4NA 3MFGB 1KELL 1XZ0B 2A73B 3I6GA 3P9WB 3ZE0E 1MFVA 2BSTA 1EBAA 4XVJH 3GSUA 4PMOA 5DMKB 4TUKH 4YEEA 1CFSA 2QMKA 5HYIA 1AGCA 2A77H 3GEWB 2ED8A 2HVKA 3C5ZD 3O2LA 1AO7B 4P5MA 5D9MA 4LQ1A 3TJEL 3CFKA 2YD6A 1T7WA 1ZJAA 1F6FB 3QDGE 1CD1A 2IQAB 5I73C 1SFSA 2ZSVB 2ESVE 4IDJL 4JRXA 5CEZE 3ZE1F 1N6UA 3HI1B 4GBXA 1WLHA 5K93A 5MHSE 2W0FA 3VIKA 5HGBB 4IRJC 1JIBA 3RVXC 4O9HL 4RQQA 1BAFL 3UDWC 3O2VH 4Z7QF 3MRPB 4PRNA 2DEPA 3RDKA 1OGAD 3SCMA 1KLGA 5GZOD 1CZ8L 5HHPB 4U6HA 4X5LA 3SUTA 4NM4H 3IDXL 1CD9B 3BAEL 5FYJH 2LAAA 3LIZH 2V2WB 1IKFL 1ZLWH 1X5YA 2OZ4A 4AY0A 3INUH 3THML 1NFIB 4AH2B 4GAJL 2WMJA 2DSKA 4H88L 4JZOA 5LBSL 4JG0H 2E7HA 3FRUB 1KG0B 1GPFA 5IB3A 2FHCA 3IAQA 4OCYH 4PJ7F 3MV9E 4TOYL 1J0JA 4W8LA 2BHUA 3KZSA 1FFNA 3T0XA 1E4NA 2DJUA 3T65A 4KDWA 1BEYL 3FT4A 1EZVY 3NCJL 3VMOA 4GQPH 3UTTB 2Z92B 1EVTC 2JF6A 4ATDA 2F54A 3NPSB 1OINA 3A3HA 4PGEB 4GKSB 3ZYIA 4N42A 3DLQR 4M24A 1FDLL 5IB4A 4S1QL 4OUOA 5C0BB 1U8JB 5JO5B 3UTPD 5E8NB 2XIIA 4P2RD 2DT2A 3DARA 3MCLL 2CRIA 5DI8A 4W85A 3V7AE 3EYUH 1KPVA 2O5YL 3QEQD 5A6AA 1JGVH 3IDYB 4XCCL 3UO1H 2X0HA 3UCRA 3TZVD 1A4JB 1I9EA 2E3VA 3U7WL 2F74A 3TEUA 4G3YH 1S9WA 1GRWA 2XVGA 2FO4B 1CGUA 1MCRA 1ZL1A 3W9DB 2DQCL 1WDPA 1OAUH 2UZIL 4XPFH 1MY7A 4U1IB 3ULUD 3MSGA 1RHHB 1NJ9B 5D2LB 3D3VE 3ALXA 5F1IB 5KW9H 5IDIA 1EV2E 3GRWL 4AT6B 3SY0B 4M7LT 4ODSH 5IFJA 1KN4H 2WANA 1QI0A 4PJIB 4P9HH 2YPVL 5SWSB 3KLAA 2YPKB 4I5BA 3KYKH 2F58L 2KBGA 3QPQC 2ITCB 3MRFB 5EB8A 1JHLH 4JFHE 5SX5K 3PL6A 3QIBA 1EJOH 3V0WH 4LARH 4MX7B 1JF1B 4M29A 3RWDA 1RUAH 3WKZA 1G7LB 5C0AD 3SKMB 1ZLUH 1I4FA 5HHOA 5L0QC 3QHFL 1MLCB 4LSDA 1P84J 1UKOA 1K5NB 2I07A 5TE6L 1T1WA 1IFHH 4LOUD 2A6KB 3QZWB 5J6HA 4ZE5A 1I9IH 2V3EA 1SJHA 4MZ2A 4RFNC 4MZ3A 4QYOB 3PN8A 1V3JA 4NN7C 5A40E 3BPCB 1ZANH 5CBAB 1CLVA 2GFBA 3NMEA 2C1PB 4M93B 1B0IA 4Y4KA 4PRPD 5EB9A 1O7AA 4OI8A 1DBKH 3SDCD 1QBLL 2UWEE 3F7QA 4DVBB 4W6YB 3C6LB 1U58B 3M1BA 4Z6AT 1KCSL 4P7NA 5H37G 3T2NL 3GNMH 5D7LA 2YKKA 2LU7A 2X05A 1J1OL 5C09D 5EBGA 3WH6A 4CNIB 2DMKA 3W6MA 5IFAH 2XICA 4IRSA 4GRWF 2NY6B 1INQB 5HI4D 1BFOB 2IAND 4JO3L 2NZ9D 2K9UA 5DS8A 3W9EB 4YDLC 1L7IH 3LRSA 4OBRA 2NY4C 1RH9A 2R69H 1J8KA 1IGJA 2BNJA 5DVKA 3NZHH 3LEVL 4R26L 3GB7A 5BO1L 1FCGA 4HC1H 2D31A 4X98A 4MNHB 3NCYP 3S8WA 5IKCB 1CGVA 3WLWC 5I75C 4F3FA 5B21A 5LGJB 5C07D 5H94A 2IBBA 1E6JH 1TVHA 4NHUB 3QUYB 1V7ML 1CBGA 3MJ9H 2V38A 3HE7B 3PHAA 3PTKA 3RWJA 4DKFH 2HJLA 1KB3A 5BQ7A 4P57B 2PW1A 4LSSH 1JGUH 1O7VA 1XGYH 2V2TB 3L6FB 4UBDC 2CETA 3T4AA 4LVNB 2DLFH 4QHUB 5JPNB 4OCMC 3ZDXF 3QHTC 2DYPA 2NNAA 5DWUH 1N64H 1N2RA 3R1GL 3KPPB 2XPGA 4XP4L 3N1QC 1KR1A 3S7GA 1W32A 1JPTH 5D93C 4ZPTA 1DEEB 3FQRA 3UC0H 4OCXH 4JB9H 2CUIA 2XTJD 5I1LA 3TIDB 3D39A 1XCTA 5CG0A 1CS6A 5E0FA 4M03A 4J1UB 4IMKA 4MCYA 4D6JA 3DXAB 1YNKL 5KSBA 3L3IB 4L4PA 4YIQB 5LQBH 3VINA 3V4UH 1YEJH 1R0AL 1U8QB 2FR4B 5IVXA 4LU5H 4OZHF 3CDYA 3WFEL 4X8JA 3VFGL 1NCTA 4X7TA 1IT9H 5F7FA 1DBJL 4P23B 5F8RC 1WCGA 2BY1A 3ES6B 1KBKA 4EOWH 1ZAGA 3B43A 4XC1L 1NUGA 4OV5A 4DAGL 3GSNH 2DIJA 5GGTH 2B4CL 1C5DA 1NDGA 4LCYA 1NLBH 3GSVB 1C16B 2WC3A 4OLXL 2GCYB 4KI5C 2ATKA 1S7QB 2DD8H 3NAAL 1ONQA 3JWOH 1KJ2B 4HIJA 4RFOL 3KLHD 3I6KA 4LRIC 2DTMH 1QSFA 4I0PA 3H3KA 1V6VA 1XGRB 3EYQD 3O0RL 4EBQH 3DURA 2PB1A 3I02A 2AABL 3CZ8A 4WUKL 5K9OB 1YHTA 2R39A 1DWAM 1F4XL 5C08A 3RMEA 3W25A 3MXWL 5D71L 3VIPA 4TTDD 5KJRL 5E0QA 2QKIA 4ZEPA 3BVNA 4X9GA 3VXSD 3LB6C 4Z76A 3ZKNC 1KXQA 4PMVA 4YHEA 2NYYD 4WWKB 2GJZA 5EFIB 1BZ9A 1BAGA 4AD5A 1S78D 1JJUA 4NWTL 2FLBT 1J0KA 3FQNA 2Q86B 1IM3B 5E8OB 2BVPB 4Q9RL 2EPOA 4KK8C 1PW3A 3D25A 1XSJA 4GRMA 1G7IB 1KXTA 3D2UD 3ZO9A 1BVKB 2DRUA 1OGSA 5F7MC 4HXBL 4N0YL 2PO6C 4G8FB 2J8GA 1DQDH 3JV6B 3LOWA 3VWKB 3QG6A 1TA3B 1XR8A 3DGGA 4OZGB 3S9DB 4WUUB 1P1ZB 1IEHA 1QRNE 2G9HB 1DUYB 1P2CB 2H9GA 1D5ZB 4JJ5A 4XNYH 3N9GH 2XWDA 1MVUA 1A1MA 3TFKD 3VXNA 3TA3D 5HOSA 1A7PL 2AJUL 2YUVA 4JZJB 1RZJC 2QV4A 3BHBA 3PWPB 4Z7OF 1KQYA 4NDMA 4AZ8A 3S88H 1F02I 5CZVL 2BNQD 4XMPH 3U7YL 3HHRB 3BQUB 4ELMB 4ENEC 4OZIA 1D9KA 2Z0BA 2GQHA 3G6DH 2CSPA 5I77A 1E1EA 4OJFL 5IOPB 2VXUH 4M5YL 2B1AL 5DJCA 3OA5A 5T3XH 1XZ0A 1W2KT 5J9PA 2A73A 4M7JL 4MNQE 3JVGC 3I9GH 3ZKMD 2BSED 5DMKA 1DFBL 5FO8B 1QPPA 2DL9A 3RDTD 2YL8A 4CKVX 4JO2L 4XVSH 4KDTC 1T83A 3G5YB 3ARBB 3G6JB 3KG5A 2IQAA 4KMQA 2XQYK 3EOAB 2ZSVA 3HNVL 1Z9MA 4FLOA 4N9OB 1Q9LB 1SEQL 5A69A 2YRLA 4NP4H 3HI1A 5F9AC 3UZVB 1EJ6A 4R97C 1EX0A 3QXWA 5HGBA 4RE4A 4K2UL 3NA9H 3MRPA 4DEPB 1NEUA 1GNXA 4POZD 2EKSB 1GVIA 1NKRA 3KPTA 5DD1L 4CAGA 2FSEB 3A47A 3CMOH 2V2WA 1MFDL 2GJPA 1NFIA 4AH2A 3H3PH 1JZ3A 3MV01 2IPUG 4RISH 3G6AB 2WLZA 2JF7A 4U4BA 3U4BL 1KG0A 2WC7A 2GJRA 3B8SA 1QNQA 3KXFE 4GFTB 1FYTB 3AM8C 5SWZE 3CFIC 5GXBB 3WQWA 3GI9L 1I3VA 1LDPH 4KUCF 4AMKL 2AK1L 3G08B 2EBNA 1N7MH 4NRYB 3OG4B 3UTTA 2DH3A 2Z92A 3IFLL 4LAJH 3T1WA 1OWQA 1SQ2N 5JIHA 5DEFB 3B2VH 3MFFB 2C3VB 4R0LB 3CU7A 3NIGE 2DTSA 4C57C 4IOSD 4MGXA 3B6SB 5C0BA 1U8JA 5F7YC 3X12A 5E8NA 4HULB 2IADB 1FRGH 4H8WL 3VXPB 3IDIB 5C09B 2A3CA 5GGRY 4YFLF 2AERT 1AR2A 1VFUA 2Z31B 1JYWA 1T7YA 4IIQB 4MDJB 4TRPL 1A4JA 5LCVH 3WF1A 4KY1H 3SE8L 4LHQB 3VFSB 1MI5B 1LDSA 5L7XH 1VJZA 2FO4A 1KCVL 4HPYL 3W9DA 2OR7A 1N26A 2MNUA 4U1IA 1FIGL 1RHHA 2EDHA 4KUZH 5D72L 1NJ9A 5D2LA 5EO9B 3G6MA 5F1IA 4RGNB 5CHNA 4AT6A 3B5HA 3SY0A 4NYLB 5JOPD 1P6FA 5I1HH 2Y06L 4XB3A 5DK3A 1CDHA 1EGJH 1SJVA 4GSDH 5SWSA 1MVFA 1QNSA 1GXEA 2YPKA 3GSRB 3EOTL 1F58H 1XIWB 2ITCA 3MRFA 4K3GA 1BZ7B 4X99A 2DIEA 2JJSA 5E7FA 2DQUL 4MX7A 4HUUA 1NCWL 4AEEA 3SJVB 1JF1A 1U8NB 4ZUUB 2JK5B 5BS0D 3SKMA 3CFBB 3O6FB 4ODXB 2Y07H 3WFDH 2VC9A 4XVTH 1TENA 1K5NA 2DSVA 3ZE0F 4D8PB 2J5LC 4HS8L 2A6KA 3QZWA 3CXHJ 2XPKA 3U57A 2AQ1A 4QYOA 1B0GB 4RAUA 4Y4FD 1TDQA 3BPCA 1MWAH 4NN6C 5CBAA 5D9SB 5HJ3B 1Q4NX 4CN6A 2A1WL 2C1PA 4RFEB 3PUCA 5SV3A 2XWBB 4PPTA 2BJMH 4XCFH 1Z5LB 1FFPA 2BVYA 4YXLH 1AFVL 4DVBA 5MENB 2Z8WC 3C6LA 2MOVA 3EHBC 3TBSA 1L6XA 3QG7L 1Y18B 5DQJB 1RZKL 3SDXE 1UWXH 4CNIA 1TIUA 4K07A 3F58H 1V05A 5HSFA 2ZUQC 5KSAB 1BFOA 2DKMA 2R9HD 1HKIA 4Q0XL 3W9EA 1ZGLM 3PWUB 3MODH 4EUPG 4OSUH 1K9DA 1FAIL 5IKCA 3PABB 3GFUA 3HUJE 4OCSH 5LGJA 1XCXA 4LCIL 6CGTA 1RSFA 5HHXH 5KANI 4NHUA 4YUEH 1BQHG 1I1AB 3QUYA 4JDZB 3HE7A 1KENL 2A3AA 3N18A 1NBVH 4PEEA 4KMLB 3O4LE 4M00A 4P57A 4ZE4A 1MW1A 4ISVA 2IUZA 1ZSDB 1RFDH 2V2TA 4GAYB 1PVHA 4U1LB 1HT6A 3L6FA 1E15A 3SGDH 2DIBA 4QHUA 3NPZB 5JPNA 4KZDL 4U5KA 1E6QM 1X5JA 1AXSB 2UV3A 1JDAA 4WI9A 3DMMC 5AG8A 5BW7A 2EDXA 3IU4L 3KPPA 4NIKB 2J8OA 4K9EC 1D5XB 4OLVL 3CLFH 1ISVA 3MLRL 4DGIL 4P7RA 2E27H 1YQVL 3U9PH 1DEEA 4YO0B 4IISA 2HJFB 4P59H 4LIQL 3CUIA 4BCEA 3TIDA 4YDKH 3UCQA 2HRPL 3MLSL 1MRDL 3NCFB 4J1UA 3AXHA 3TONA 3KPNB 3DXAA 4NZDA 2V3GA 3MYJB 2WWCA 4Y19D 4B3LA 4JLRB 3L3IA 1OW0C 1KR0A 2APFA 4Q6IC 2LVCA 4ZSOB 2FR4A 1U8QA 3BO8A 5D2NE 4MJID 2Y9RT 1W2PA 3MC0A 4NJ9H 2QLVB 4H1LH 5DF0A 3ES6A 5I74B 3L1OL 5IROA 3GI8L 2ZX6A 1KWKA 1JPST 3PZGA 3L5XL 4HW6A 4GI8A 5E8EB 4AL8L 4UTAH 1F4WH 3WF2A 1LEIA 1C16A 4LEXH 2GCYA 3T2PA 3ZIZA 1S7QA 4FS0A 5IGXL 1I1YB 5IVNA 1KJ2A 2XHYA 3NCEB 5I2UA 5IT2H 1AC0A 3BKMH 3KR3H 2PF6A 4A2LA 3AXIA 3T3PE 2QL1A 4PRBB 3CHEA 2GSJA 1W72B 1OTUD 4GMTL 2BSRB 3VJ6B 1MFAL 5E9DB 3PTQA 4JCLA 3NH7H 4WI2A 4WWKA 5HVHC 3HE6B 2Q8AH 1A6TB 3ARVA 4HUWB 1X5IA 3WUWG 4OZOA 3LDBB 2Q86A 1IM3A 5E8OA 2BVPA 3QIUB 4OZFH 1UR8A 5JHDB 4RWYH 4JKPH 2LU3A 3AAZA 1LG2A 1G7IA 4A6YL 1BVKA 2VNCA 2ZCKL 3O4OB 1TZ7A 2D7NA 3K80A 1G9NC 1NOWA 4X7FC 4F15C 3RX5A 1DEDA 4G8FA 4Y5XA 3JV6A 3UJIH 4R9HA 3DX7B 3VWKA 2V2XB 5BRZD 1TA3A 1UR2A 4OZGA 5ELIA 2HJKA 4LSTL 4WUUA 1P1ZA 5FYJE 1C8PA 1MXDA 2G9HA 3NSNA 1P2CA 1D5ZA 5K9JH 3G04B 2R0KH 4OFYD 3BCDA 4BQ4A 5DJZA 4JZJA 2QQLL 1HKLH 3PWPA 1PLGH 2K1MA 3V5DB 2VZ3A 2WBKA 5BZDB 2GAZB 4AEFA 4ELMA 1HWHB 2XA3A 2CXGA 5JUVA 2VDNL 4LEOB 5FA4B 1INDL 5IOPA 3EYFB 3BPLB 3DWTA 1FO0H 4JM2D 5GS0D 4WV1C 1OB0A 1WZKA 1IE5A 3CUJA 1CCZA 1CLZH 4QNPF 1MHEB 1NUNB 4U6YA 1N4XL 2WK2A 5FO8A 4XMLH 2DSWA 2JF1A 4G7VH 4RMQA 4I13B 1UG6A 3S3JA 2CNCA 2A3HA 4AIOA 5I24A 3OZOA 2EIDA 3G5YA 4PJ8C 2AK4D 5FGRA 3PZVA 1P9MC 3EOAA 3ARPA 4LCWB 4JREB 3MACH 4EUPB 2X42A 3OR6B 1Q9LA 1ZE3C 2HVJB 5JW4R 2YPLE 4GO8A 4R8WL 1JDDA 4PMNA 1NBQA 1C91A 3X17A 4WRLA 4DUWA 5FKYA 3DO3A 2GTWB 5JZ7C 4IM4A 4P8VA 3RPKA 1BQHB 5JXAH 3Q0HA 1E27B 4NI3A 1KCKA 1RURH 5D6DC 4U0RB 3LHPH 3KPSB 4O2EB 4PGJA 1CDGA 5HDLA 1V0NA 1NFDB 2ZE0A 4KKCC 4TNVF 1U33A 5IP4A 5JBEA 5D1QB 1D6VL 4M56A 2PWDA 1RMFL 3G6AA 2G5BB 4Q9BA 1FH8A 3VGGA 1J0YA 1NCBH 3Q5OA 1KIPB 5MEPB 1CENA 4XWGL 2HA1A 3KLSA 1XCWA 5C0AA 2ZXAA 5E24E 2GSIB 2V17H 1RVFL 1FYTA 4DGVL 2OR9L 4HCRH 3ULVF 1H15B 1M05B 3GKWL 5CSUA 3G08A