2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAN26A
publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
5GIRB 2DJSA 3TFKC 2VABB 4PJHF 1HSAA 4U31A 4I2XA 2VLJB 5AZ2L 3OZ9H 2GJXA 1DBJH 4UQ2B 4GXVH 5FFLA 3VRIA 3ULVD 3F58H 1P4IL 4L9LA 1JRHH 4AEIH 1R7OA 1B3VA 4NKOA 4WHYG 1VFBB 3WHXA 3VDAA 5IWLA 4PGDA 1UZ8B 4Y2DA 3O9WC 3MANA 3VGDA 3UTSD 3T2PA 4CVZB 4WUUB 4NDMB 4FFZH 1IQWL 1UJ3C 4XC1H 4D1JA 3HKFA 2YS4A 3RWHB 4EBQL 1FG9C 2DQDL 3N1GC 5F9OH 2IXUA 3NN8A 2D0FA 4WDIB 3TVMD 1UHVA 2W07A 5E6IB 1UR2A 3KPRE 4J3WA 3QPXH 5DJ8A 4FZEH 5A6SA 4I4WA 5ANME 1W8OA 3L3GB 4OCXH 4JFYA 4KKNA 2P44B 2LTQB 3VXQB 3WO4B 2E9LA 5EUOA 3LCYA 4P2RD 2RGLA 5EUKB 1J8HE 5C0JA 1WSST 4C83B 3OB8A 1A6PA 3BAWA 5SX4I 4M4PA 3BDYL 4LSTL 1EUTA 5JOFA 5EDXA 2LU4A 1KJMB 3ZZ1A 1JGIA 3OKOB 1I7TB 3BC9A 5CJOL 5B8CB 2DQXA 3TO4A 1AXSA 4C56E 2YEZB 1PKOA 4JM2B 3GGWB 1DSFL 5MENB 1WITA 4HU8A 3RRQA 3RVWC 2AXJA 3MR9A 4F8XA 5IW1A 2XA8L 1U95A 3KPQA 3T1FA 3SGKC 4H26A 3REVA 5DHYB 1A6VH 4K8RL 5D8WA 3DMMB 3MLYH 1ZBCA 1BVZA 5D96C 1U6AH 1B0RA 5EBWA 1MCEA 3ULVE 4I3RL 5E5MB 5ABHA 3JUYA 2DWEB 3GBEA 4PJHE 5GS2H 5I19H 1CFNB 2J78A 2G9HA 4N8PA 2PW1A 1I1AA 1BFOB 3FN3A 4N9OB 3D3AA 2CDFA 4O51A 4EDWH 1PG7W 1UXSB 3NDYA 3GO1L 3UTSE 4V1DD 3SO3C 4N0FB 4LVEA 4OM1L 1ZHLB 3JXAA 1OWQA 3O9NA 4OD2B 5D1XA 4N8VB 4FQJL 3ESVF 4MX7A 2W65A 1AD9A 3VWJC 2QR0B 1DR9A 1JG9A 4TUFA 2ZIDA 4RGMC 4PLJC 5FYJH 3K7UA 2V5MA 3BT2L 2XSBA 4P2RE 3WFDH 4ZTPL 1QNPA 2CSPA 2QADD 1PSKL 2R2EA 2WMPA 2BVOB 3O6LL 2XYLA 4ZFZA 4S3KA 1SMOA 1XIWB 3TBWA 4MNHB 5F9AC 2FB4H 1YEHL 3LN5A 4LLDB 4OFYD 4P49A 2VI0A 2C26A 1CDGA 3QAZC 5F1NA 4NGHL 4PJIA 5J06A 3GM0A 5LAXB 2HVJB 1H0DB 4OZHB 4FK9A 2O5ZH 5D7JB 1UWEH 3AY4A 4NRYB 1LO0H 4K8RD 2J8UA 3ULVH 2D03H 4ZQKB 4P2YA 1AKJD 5DQDL 1CCZA 3LQAC 3GI8H 3WLBA 1PIGA 1QI3A 3PG2A 1H3UA 5D4QA 1G0YR 3GMQB 5C0BB 5I1GL 3SGDI 2I5YL 4GKLA 3GHBH 4K7PH 2FGLA 2NY0D 5J89A 2FCBA 1UQYA 4Q0XL 5JPNA 2R4SL 3AYSA 4U1HA 4PJFB 4EIGB 2EDLA 3WEOA 3OJDA 3APGA 3KWWA 2I07A 1QKZL 1W9UA 1HEZA 2O5XH 1UT9A 1PKQB 5D2LE 4Z7QF 3W25A 2XV6B 1JF5A 4E0RA 4V1DE 4Q9QH 1A7QL 1MWOA 3CSYA 3HAEA 4W4OC 3S3PA 4UDTA 3HC4H 5F7HA 1IARB 3SE4C 3NFPA 3S37L 2XN9B 5CS7A 2EDHA 4JREB 1US3A 3IS1X 4QTIH 3WD1A 1TVHB 3WH8A 1YQVL 2APFA 4Z9KB 5FB8B 1KXQA 4UNUA 5DR5L 1NOWA 2HA1A 3B6SB 4LVNC 2GFBB 3EDDA 2ZWLT 2QV4A 1FBIL 2NY3B 4Y16C 1R7AA 2A3CA 3QYCA 1BMGA 2VL4A 5D93C 4W93A 5AZ2H 2C1PA 3P9WB 2GJ6D 3RTQC 4W7UA 4K9EL 4BKLB 2V7NA 1SYVB 1XCWA 1IL1A 2JB6A 4BH8B 4P9ML 4FQXB 3C5ZB 5I17B 5E8PB 5IEKA 2VT0A 5EG6C 5HVHB 5CEXB 3POHA 1UR9A 1FGNL 3OWEA 5DJ0B 4HKZA 3QOKA 5A1AA 4H1LA 2Q3AA 1E4XI 3HI1A 1KBGH 3HR6A 4PJ9D 5KSBE 4RAVA 4HW6A 5DUML 1NBYA 5ITFA 4QO1A 2Y4SA 1E0XA 5DRZB 5JBFA 2FJGB 1I3VA 1IAOB 1MCBA 1YJDL 1DCLA 1U8IA 4XTRD 3LAFA 4FNLL 4APQD 4FFWC 5EN2B 1WTGT 1BBDL 2ZOLA 1T5XA 2X4PA 1NOFA 5GJTL 5FDWB 1ES0B 2XWJA 2MQCA 4Y4FD 1GIGH 4LSTH 1MQKL 3DX7A 3QFJB 4Z7QE 1FC1A 2OSLB 3P0VH 1LO2L 3F8UB 4JQVA 3KR3L 4WWKA 3IDJB 2FJHA 1UQSB 1DSFH 4Z2HA 3L4WA 1X5AA 1JMZA 3BJLA 2PYED 2Z8RA 3QPQC 2XA8H 1HJWA 3D2UD 3PL6B 2FHFA 3LQMA 5KOMC 4MCYA 1IV8A 4AD1A 1IGYB 4K8RH 4A3HA 4AK1A 3VXTB 1LL6A 3CPLB 1HIZA 1MW1A 1VIWA 4YLQT 5SX5H 1G7IA 4MGXA 1G1CA 2JJSA 2GJ6E 3ZMRA 4M43H 3BESR 3Q6FB 3MV11 4HPYL 1KB9J 3EMZA 1Q6CA 1MY5A 4BQBA 3IS0X 2G75B 3OJVC 1RK0B 3FQNA 3GMRB 4ERSL 3VX0A 4P3DB 5A6BD 2EDTA 4WU7B 3KPPA 1JFXA 1BQHA 4KJWC 1BD2A 4I0PC 3B2VL 3BN3B 5EPMB 4R2GB 3BPLB 2D24A 5HHPA 3D3VA 4J12A 1XF3B 5I1KL 1UCBH 5D6CA 3EBVA 2PCPB 3QUZC 2VDPL 5E4EC 4HWUA 5T1LB 3LHPH 4ZTPH 2XZAH 3ELAT 1HWGB 1D5ZB 1PSKH 4TTDC 1BF8A 3O6LH 4G42A 1MSPA 3SGEI 3QXWA 5I1DB 3U0WL 4OD3H 3JV5A 2AJYH 1H3PH 3IXAB 4P2OD 4Z7VB 4PJAF 5I71C 2HJKB 3G04A 2V9QA 2IEPA 1GJUA 5DURD 3MRKB 3RPIA 3ZTNL 3BX7C 3WFEL 5D1QC 3VFTA 4WEBL 4AG4H 1CLYL 2X41A 3IU3B 4PTVA 3QXDB 3SKNB 4NN5B 1C92A 2JIEA 4WTWA 1Q9WA 3O2VL 4HOXA 4OZFA 5LGHL 3OR6A 2I5YH 3NDZA 2Z92A 2HFEB 5KSAB 5BYWA 2XIDA 3M45A 4MNQA 2WVUA 4FQCL 4LVOC 4Q0XH 1EZVY 5E9DD 2R4SH 3UTQB 3AXLB 3JVGA 4P8XA 4Y5XC 4Z7OF 2WMHA 4UFHA 1NARA 3G08A 1W0VA 4KVCL 4RAUA 3TO2A 3QDJB 1LEKB 1JGEB 3UROR 4XPBH 1ZBKA 1EV2E 4TVPH 1A7QH 5CPSA 2ICWI 4XPGL 4Y89A 1RIUH 1T5WA 3CDCA 2AK1H 3S37H 3C09B 4WGVB 3IANA 5FYKL 5E09A 1DE4A 1UD4A 4NZUL 2ADGA 2O92A 3WXWH 5DC4B 1CDUA 2XXCB 1YQVH 4JPKL 3GIZH 4U05A 3AFBA 3T08A 3QIBB 1MUJA 4MS8C 1TTFA 2ZG3A 4OF3A 5DHVA 2D9CA 3MLVH 1J1OL 4C4KO 3LKSA 1FBIH 4QTHA 1E4MM 1KPRB 3LOWA 3VWKA 3PQYB 3EYQC 4D0CB 5KN5A 2EJ1A 3MLUH 2HTKC 4POUB 3MGTB 3L3OA 3RCNA 4PRAA 1JPGB 4NBXB 4K9EH 3CZGA 3W9DB 1FYHB 2VXQL 4OLWL 1KLGA 3HE6D 1J86A 4M61B 4M7KL 2VZVA 1FORL 2DS4A 1EDTA 3CX5K 4JO2L 3CVHL 2YD8A 3OJ2C 3RDTD 2FJFB 2VE6B 1TZIB 4PJAE 5F70A 4PJ8C 4H0HB 4JGUA 2ICWJ 2YL9A 5HHOA 5C71A 2IQAB 4DKDC 3JWOL 2AKRA 1ZV5A 3B9KD 2XZQL 5FOJA 5J12B 3WSQH 3QDGB 4YO0A 3MRPA 4TRPL 5E9DE 4CU7A 3L6FA 2A6IA 2ZUWA 4HZLB 1YJDH 1RPQA 3TA9A 1S7SB 3D9AL 4KK5D 3BFOA 4FNLH 1RK1B 4N0UB 2J47A 4ZAKB 5TQ0L 5F1KC 1FFOB 3SDYL 2G41A 3S36L 1BBDH 3QUML 5GJTH 3QWQB 5FYKD 1C7SA 1E28A 4Z7OE 1IEBB 4XAKD 5IG7A 1FZMB 1MQKH 2DLFH 1SM3L 4S10A 3T8XB 4WJXA 3CZFB 3AHXA 4NPYB 1E40A 4E41D 3PWJA 4M5YL 2EC9T 3STZB 1KCKA 3RUGF 1H49A 4IISA 4KWUA 3VDHA 1EO8L 5ICZA 1M7XA 2BSTA 3WIJA 3CXHK 1E4WH 4RQQA 5A16A 2F54D 4WKAA 4Z7NF 4AJ0A 4U1SA 2X4OA 3ARDD 2N56A 6TAAA 3QCTL 2A3AA 5D7IF 1JHTA 4KKBC 3CO4A 1IGIH 3VU2A 2OX5A 1G6RL 3C08H 3VG9C 1AD0A 1QNRA 4Y5YB 2PO6D 1I3RB 5FM5M 4UNVA 5KAQF 1QLEH 3MLTA 4HT1H 3WIIL 1I7ZB 2FYYB 2BJML 4QT5A 3A6CL 1T2XA 2X8RA 3OX8A 1HYSD 1P6FA 3VDCA 4IIQA 2X5PA 3AREA 4M7ZB 3B2VH 2J8HA 1A4JB 4S0TD 4Y4HD 3SDDC 1IM3A 2HLFC 1NFDF 2ZUXA 4YBQD 3Q3GA 4HC1A 4ODWA 4KH2A 4FTVB 4OLZL 1AGDB 5EC1B 1FV1A 3QRGH 1EJ6A 4YHNA 3OF6A 4PJEF 1JWSB 1LK2B 1BBJB 4L4TB 1G7HA 3VIKA 4JFWA 3ALFA 1JNLH 5FYKE 3IVKB 4WJ5B 4PJCE 4RWYH 1E0VA 4XAKE 1VB9A 4GRMA 1IGJA 2HT3D 4CRPA 3BKYL 5DT5A 1LE9A 4E41E 1KC5H 4JRXA 3OGCB 5C09A 4LNRB 3TZVA 2RQ8A 1QBLL 4GAYB 4OQTL 4G7YL 4WEBH 2Q76B 4X98B 1CFTB 1CLYH 2V5TA 4MD0A 2X0YA 2VDOL 2YUXA 1LWJA 1FYTA 4NO0D 1BQCA 2F54E 2C3GA 5LGHH 5IFJB 5DVMA 3U9UA 4L3EA 4I48A 2BSSB 2VUYA 3PZOA 4XHJC 1GCFA 3BSZH 1VDGA 5HGDA 2Z35B 3SCMD 4XBPB 1MI5D 4Z7NE 5D7LD 3V4VL 4PJGF 3GJFA 3HNSL 3MLSL 3O4OB 4XC3L 3VFSB 1DL7H 4G7VL 4MZ3A 1AE6L 3UBXG 1UWUA 3UZVB 2PR4L 3DI3B 2UZIL 1HJSA 1XCTA 4TPRL 4XPGH 3V4PL 5ADPL 4CMHC 4J7RA 2PBOA 5BQ7B 1M7IA 2O61B 4GBXD 4P9HH 5AUMB 1RSFA 3B9VA 2WVVB 3VGAC 1EIBA 5DYOA 1NUFA 3D0VB 4JPKH 4ZFOA 5CGYC 3VFNA 1J12A 3O6ML 3OIHA 5KSVB 2GCYA 3DX8B 5DS8B 3KPOA 5ESAA 1MIML 3UYPA 4JFDA 1JGVH 3S5LA 1J1OH 4DVBB 3PGDA 15C8L 1NFDE 3ZYZA 1W3HA 2FLRT 4NCC1 1OIMA 2X44D 3GMOB 1GW1A 1A4KA 4CU8A 1ZT7A 3DSFL 1QFWL 2XJ7A 3KVQA 1YN6A 2UWEB 4JPIA 1RZKC 1ZWIA 4X9IA 5I2IB 2AEPH 1J87A 4PV9A 4UIMA 3D39B 3QO0A 4NBZB 4OZIA 1RZGA 3VM7A 1UWXK 4GFTB 5FM8A 2BS9A 2P47B 2XGIA 4JJHA 1OWWA 4TNWF 1EDQA 4OLWH 3HUJB 5FYJU 5B4MD 4ETQA 5BVPL 4M7KH 2EXWD 1WF5A 3MFGB 4JO2H 5EO0B 4PFEA 3CVHH 3C60A 3SCVA 1M7DB 3E6FB 4AIEA 3SKMB 3W2DH 5I6SA 1WP6A 4YHYC 3WJJC 3FB6B 1MVUA 4R0LB 9CGTA 1UD6A 2OXGA 5GIRA 3VFWB 4NWTL 4KRTA 3V0WL 2CBUA 4YDKL 4DFIA 3DOSA 1QSVA 5DO2C 4TRPH 4UQ2A 3ZDZF 4LLVB 2HG5B 5ENWA 2ZX7A 2A6DB 1R3IL 2CO6B 3T2NH 3QO1B 5I1AB 5I75C 1VFBA 5TE4L 4M7LT 4CDHA 1CXLA 1UZ8A 4GQQA 4CD5A 5TQ0H 1MAMH 2XICA 2EO9A 3SDYH 3LVEA 4XBGA 3QUMH 5JHDB 2DMCA 4WO4A 2DT3A 4CVZA 3EKCA 4NDMA 2XWEA 1AO7A 5E08L 4IRZH 4PJGE 1SM3H 4LK4A 1HIMH 2VKWA 3CUIA 4PY8I 2ZUUA 5F7EL 5E6IA 2NY1B 5FO7B 4M5YH 1FN4B 5ICXB 3KG5A 3PZMA 3ZKXB 3B5TA 4PB0L 5ETUB 3L3GA 4U7SA 1K5NB 3VXQA 4QLKA 4IRSB 5EUKA 1V6UA 1OAXL 4P7QA 3IFNL 3WH9A 3MV8D 4ACZB 4HWBA 3V5DB 5GRZA 3ARTA 2VZ3A 3CC5A 5IFTA 2YUWA 3P9LB 4IEFB 4KK9D 1KPVB 2XFFA 4UNTA 3NA9L 4Z2IA 4H8WC 1I7TA 2VLKB 2VC9A 2D7QA 5B8CA 1Q0YL 3QG7L 3L7FB 4DGVL 1S7RA 2Z4QB 3ARBD 3H7BB 4RBPH 4GO6B 5HPOA 3WIIH 2Z1SA 1U3HB 4QGTA 2BOCA 1EGJH 4HA1A 2QSQA 3A6CH 2XZCH 2JEQA 3RVTC 1PBGA 2JLLA 1YEIL 5IVXB 1BFVL 4G6KH 4D9QD 2VX6A 5DHYA 2AXHA 1U3JA 3W81A 5HYJA 2IMNA 2OJEA 5BXSA 2H41A 5BXPA 2ZOXA 2WVSA 5JIWA 1BEYH 2YC1B 2IUZA 4WI4A 3HE7C 4MMXC 3G6DH 5LBSL 3HCVA 4HBCH 3MKKA 2ITDB 2P8PA 4TVCA 4EN3D 1X4ZA 4AZBA 4ONGL 1M03A 4LCUA 4UI2A 4KZEL 5ILTH 5CJBA 3JWDH 2NY7H 3KYOB 2ERJC 2QPSA 4N0FA 4JFPB 1BOGA 4G9DA 1ZHLA 2VLJD 3O8XC 2A3EA 4ZOCA 3V0VB 2QF8A 2O5YL 3U4EB 4FMKA 1CDYA 3BKYH 1VESA 5DC0A 1C8PA 3MBED 3QIUC 35C8L 1YPZE 4JL1A 4K3GA 5IHBA 1S7UA 3CX2A 3GMMA 3X17A 1F11B 3DV6A 4OQTH 3U7VA 4G7YH 1KYOK 1DVFB 3NIDE 1L0QA 1R3KA 2CK0L 2VDOH 2XPGA 4WUUD 5EBGA 2YL6A 3DVIA 1V7MH 2BVOA 1PX8A 3M17B 3DX6B 2GFTA 4U2YA 1M05B 4MNHA 3GZKA 2XTJC 3N0PB 3DUUB 2GUOA 2DM2A 2OL3H 3QNZA 1KIUA 1JWMB 4EOWH 1K9EA 3V4VH 3R4DA 1AGEB 5D7JA 4J3VA 4XC3H 4HUXB 1AE6H 4PR5B 2NX5B 1BIIB 4LOUC 2UZIH 4D9QE 1I8LC 4MXVF 2VKXA 3PHQB 3I6KB 3GMQA 4TNWK 2W38A 5C0BA 1PYWA 3EO0B 3PNWB 5EZLA 1NUDA 3FMGH 4NFBA 2FECI 4K7PY 4CUCA 3N9KA 4FQ1L 3HPJB 4JM2D 5MEND 2J7HA 3TN0C 1JZ4A 1PQZA 2WWDA 1SYTA 3LSOA 4R97C 1PKQA 2YA0A 4LBEA 3QQ9D 4HKJB 4K3HA 5TE7H 2B1HH 3DMMD 2FL5B 3GSQB 3V8OA 1LL7A 3AMGA 2W0FA 2VLJE 4MWFA 5A2KH 1VRXA 4W70A 1OT2A 2YDRA 1WFNA 5BS0B 3HMXL 3BAIA 1B6UA 4PMYA 3M1BB 5FB8A 3OAYH 4JFTA 5K9KA 4TX6A 1G9HA 4Y7MA 5DSCB 3MRQB 4OSUL 2Q6WB 2UYLB 4MADA 1E6PA 2GFBA 4WUUE 1BLNB 4IHOB 4IOIA 2EIEA 3IKCA 1BYAA 1NGYA 4NWTH 4Z8FH 5FCUH 1DBML 5KJRL 4YGVB 5LJYH 2QBWA 3G5VA 3FN0L 1N82A 2OJZH 3OAYK 1OTUD 2H1PH 3GMNA 4LSRH 3FQTA 5FIEA 1HQ4B 4BH8A 1D3CA 1QUNA 4KDTC 2EPOA 4G6FD 1KLFA 3NH7H 5ECJE 4XWGH 2Y06H 1Y6MR 1XIWD 5BRPA 5BW7C 4NRRA 2J88H 2UY5A 2P8LB 3BZEB 4M62H 25C8H 1WZLA 5CUSL 4S1DD 3QG6A 4GO9A 4ACPA 1CZ8L 4ALAL 2WMGA 3CDFA 3BQUC 3MRIA 1W32A 3FAWA 4UOW0 4MXVE 4ZXBD 5MENE 4TSCL 3UR7A 3B4NA 4YHOH 2WBJC 4KHXH 2FO1A 1AFVL 3WD4A 1QR1B 4D72A 5B3JF 2HFTA 1GAFL 5TGBB 5KANG 5IB2A 4LRNL 3B9EA 3PP4H 3QCVL 4JFHD 5FDWA 4UOJA 2X10A 4NC2B 2X4SB 5GS0C 4FZ8L 1HSBB 5BZWB 3MLRH 1WJ3A 3NA9H 2XTKA 3TIDA 2WK2A 1JAKA 2OSLA 1Q0YH 4L8SA 1E27A 5K93A 4DGVH 2HVKB 2L7JA 3OLDA 3IDJA 1UQSA 5JXAL 3GSUB 1IVLA 1GC1H 3CFKB 1CVSC 5J6GA 1I8MB 3Q5YA 1YEIH 4JN1H 3ALPA 4R90L 3CU1A 4J4PC 4QYOB 3U4BH 2BNQB 1BFVH 1AXIB 2E27H 4HWZB 2G60L 3CDGA 3JTSA 5AC5A 2IH1B 2XN9D 4PD4J 1F58L 3EAKA 3ARXA 3CPLA 3ARFD 4JFQA 2Q7NA 4NUJA 4PIRF 4U3AA 4PTUA 1A6ZA 1JF6A 1R3LA 2R2BB 4WFGD 3ZYJA 4X6BB 3Q6FA 4IJ3B 3EYFA 3BKJL 2ATKB 1S7WB 1F97A 1PZ2A 4ONGH 3ZKMC 1RK0A 2AP2A 1D9KA 3G6JB 4F7TB 4LL9A 2WHKA 2XM1A 5HTSA 2OWCA 4ZOBA 1T6VN 2J6EA 1GRWA 4DKAA 5EORL 1P2CA 4F33B 4LPTA 2JF7A 3RGVB 1LQ0A 2RCSL 4HG4J 1QFWM 4HFUL 4X4ME 4OZHE 5HDLA 4U1LA 2BY1A 3LS4L 1XF3A 4X6DB 4FQXD 3C5ZD 3QEQA 3AQUA 2M8XA 2PCPA 1OGBA 1OD8A 4M81A 3RNQB 2CK0H 5BRZA 2AGJH 1D5ZA 1H5BA 2BNRB 4RWHA 2UWFA 4U33A 4WTXA 4JFHE 4P2QB 4I5BB 3WD2A 4NJAH 2D7NA 3UTTD 3MACL 4JL2A 3FFCB 4J27A 3O45A 1S5HA 4DEPC 3WKML 2WMKA 3IXAA 3NSNA 4LKXA 2OTWB 4PJFE 3BAEL 1P5VA 1IC4L 2NY6B 2DEPA 1PKQE 4N8VG 3CH9A 1A9BA 3IU3A 3UEQA 3SKNA 1KCRH 1OCWL 1VERA 4QP0A 5A8NA 2IF7A 4ISVA 1NL0L 3GXDA 5ABFA 4XNUH 1S7XA 3QFJD 5E2VL 2XN9E 3KLDA 1OTTC 5KSAA 2MQ3A 4UTBH 2WUBL 3VRJA 4X5XB 4XI5D 4L8BA 1OSZB 4XZUB 1GOGA 2ZICA 4MLSA 2WWKT 5CIPB 2P5WD 4WFGE 3BIKB 5D2NB 3RHWF 1HF6A 3AIUA 3AXLA 1H41A 5DJYB 4OI8A 1KIPB 1KG0B 1ZKAA 1VFAB 3X14B 1E4KA 5DRXA 2WP3T 1BSIA 3PL6D 4ZYKB 5DJAB 1NMCB 2R29H 1LEKA 1JGEA 2J5LC 4NQSB 1TMQA 1XD1A 3WQ5A 5C0CB 3ZDYE 3U7YH 3MLWL 2VDKH 5CKGA 4Y19D 2J8OA 3FOMB 1HWHB 3BAJA 3CMOL 5ISZB 4YDLC 3RL1A 2XKNA 3BO8B 1XGQB 3BGFB 2R1YB 2RJMA 3HMXH 3IDIB 3T3MF 2ZZUT 4WK9A 3LD8C 4GRLD 1Y18B 1UGNA 2CEQA 3PDDA 1P7KA 4JO1L 3QIBA 2WPGA 5DMGD 1EMTL 3NABL 1D5MB 4UFMA 1KPRA 3RNKB 2J75A 3GNMH 5L9DL 3N1QC 5FGBC 1GOQA 2F8QA 4Z0BL 3WD5H 3UEZA 2YD7A 5CWSB 1DBMH 5I8CA 1OGAA 1CNVA 1I1FB 3FN0H 1E1FA 1D5XA 4PTTB 2IPKA 4XB3A 5EU6B 5CCKH 3U46B 3I02B 1XH0A 4R9HA 2VIRB 3O9WD 1CIUA 4PCTA 5BXFB 5T1LD 2JJVA 3TYFA 1JTPA 3QIWA 2FJFA 1TZIA 1YYMH 3DURB 1Q6DA 3MYJB 5DD6A 5HXMA 1JCKA 3G5XA 3EFDH 2YR3A 3QFJE 1LK3L 2WIMA 5CUSH 5IP4A 4I3GA 1R3HB 1TVBA 2R1XB 4GZEA 4IOSD 4ALAH 4YGAB 1MCHA 1A1OB 4HZLA 5C08D 3V52L 4TSCH 3UR8A 1S7SA 3V6FB 3M7SA 4U3CA 3ZJ8A 3E6HB 1CLOH 3WD3A 4N0UA 4QKXB 1AFVH 2KL6A 4CJ1A 4MA1C 1A6AA 3KJ4B 2GHWB 1GAFH 1X5HA 3BZFB 3VOCA 1H3VA 4WW1B 4F9JA 4CD6A 1CXFA 1T4KB 4ZPTB 4KAQH 1MW2A 5C86A 2E9IA 4G8EA 1IEBA 5E8NB 3ZR6A 4KI5C 1FZMA 3AROA 4FZ8H 1J1PL 4XXCC 5FYKU 3ZT7A 1JDAA 1QVBA 3GXFA 1XF2B 3CZFA 3MLXH 5JHLL 4XCYB 4HH8A 1JZ6A 2E9BA 2GKIA 3HRZB 1ORSB 2H2PC 5CSGA 3KYAA 5JXAH 3SUUA 4AZIA 1ZSDB 1U3ZA 3QDJD 3H9SA 4F7EB 4B15A 3W38A 1WBXB 1MFNA 5CLWA 1AR2A 1FZJB 3OPZL 1FNLA 3T3ME 2VXSH 2G60H 4ZUUA 1NEUA 1T03L 1UZ6F 2QKIA 1F58H 1RIHH 4KK6C 3WDPP 3MYZA 3UTPD 3CZEA 3SDAA 1NDGA 4AZ6A 3TTQA 1SQ2N 4GT7A 3SCNA 1QLFB 3A4WA 3O6AA 1W0WB 1NFKA 2VJXA 5J11B 2B2XL 3PDGA 3IDXL 3BKJH 2HT2C 3M46A 1BZQK 3RZCB 3T0EB 2Y9RT 4PGEB 5F7NC 1UA6H 5FM4A 3VRLE 3FO1B 5IJKA 5CBEA 1W1VA 5MI0C 3LZFH 4UMGA 1MHPL 3PQYD 5EORH 4PRNB 3U48A 1PX4A 3WKZA 2RCSH 3RU8L 3TGXA 1A4JA 4Z7VE 4PLJD 3CHEA 4M5ZH 2DWDA 4WNQA 1MHCA 1DQTA 4RFNC 4FTVA 1Z6JT 3STLB 1AGDA 5GS1B 3KPSA 4JZ5A 1TZHA 1F4YL 4M3KB 5DUPL 3PHAA 4P4KA 1OHQA 4HGWB 5ECUA 4YR6A 1TVDA 3QWRD 3OR7B 3IVKA 3VIPA 2JF1A 3RHWK 2ARJB 2Y24A 1WZ1L 1FH8A 2VQUA 4LRIC 1I7RB 3QDGD 1KCUL 4UBDC 5C07B 3WKMH 3IETB 8CGTA 2NXYC 2WMJA 4P23C 3OKNB 3CFEA 1U8PA 1IC4H 4HULB 4WV1C 3VFRB 4ZAKD 3WBDA 3WMBA 3F7VA 2XFXB 4TUKH 1CFTA 1R5WA 3QDJE 4WI6A 4JR9L 4GKOA 1OCWH 3E8UL 1NL0H 1JRHI 2DI7A 5IFJA 2E7HA 3CFBA 1PZUB 1AMYA 3D0LB 5ADOL 2JELH 2BSSA 5IBUB 2Z35A 4WI9A 3HR5B 1SYSA 1ZE3C 2BHYA 2DB8A 4YHML 1LJYA 4WUKH 1OINA 4P46B 4UTAH 4XZWA 4UQ9A 3PQYE 4PJ7B 3VJ6B 2YD4A 3MLWH 1P9MA 4MJIB 3OHXB 4Y4KC 4GAGL 4L3CA 2YPLB 1TQCC 3MFFA 3CMOH 2R2HA 2EXYD 4PRID 2WVVA 5A95A 2J1KA 4KTEL 4ZUSA 2PBGA 2CUHA 2MPAL 4HIHB 1F90H 4JO1H 4XXDB 3DX8A 1WKYA 4PMNA 4ZE4A 4Z7WB 3PZNA 1KXVC 3WBAA 3NABH 3O6KH 4Y16D 4DVBA 1JYNA 1GOHA 8FABB 2MNUA 3GSVA 5L9DH 2JJTA 4GZIA 2WNWA 4Z0BH 1N0LA 1RJZA 2ENSA 3F5WA 5KG9B 3RTQD 1EAPB 4HS8L 4Q7DA 3QDGE 2HVMA 5I2IA 1N8ZB 3D39A 3UX9B 3Q5OA 3CNKA 2D23A 2VLLB 4AD0A 3HUJA 2VMFA 4MQ7A 1MWAH 4L4TD 5FKPB 2DT0A 4DUVA 2BHUA 1M7DA 3E6FA 3TT3L 4P5MB 1VFOA 1J11A 3SQBA 1NAKH 3AS2A 4R0LA 1C3FA 2PXYA 1LK3H 2VAAB 3IJYB 3AZTA 3UERA 3S34H 3SQOH 4XH2A 2YWZA 4KPHH 4RGNB 5F7YC 3WKNA 1A1MA 1D5BB 2H6PB 3AZRA 1QYGL 3Q5TA 5L2JB 5IHLB 3V52H 4FFWD 3B83A 2A6DA 4KU1A 3QO1A 1VJZA 3ZL4H 5FO8B 4XVUD 2IADB 3ALWA 5GSVB 1FZKB 5KS9F 1MHHB 4U2ZA 2BDNL 2DAVA 4AMCA 3M8OL 5JHDA 4JJ5A 4GINA 3QHMA 2IAMA 5F1SA 4OIAA 4LSQL 1I8IB 2ZUQB 2EE2A 5KTEH 4JN2B 4EDXA 5JHLH 5EU7C 1IKFL 5E99L 4PRIE 1JZ2A 2AJ3B 3TNNB 5ICXA 1C93A 2HT4D 5IVNA 2J7DA 3P77A 2CPCA 2BXYA 4XP5L 3GH4A 4QXUL 1EHNA 4IRSA 5BV7C 3DBXA 5C2UB 2DD8L 3G6AB 3LQAH 4Z7UF 5DD3H 1CTNA 1T03H 1NGZB 3P9LA 4MLIA 4R4ND 3DX9B 5EWIL 2VLKA 4FTVE 4DCQB 2GK0A 3L7FA 4J3UA 3H7BA 1W72H 5FF6B 2HTLD 5C9KA 1U3HA 3SDXB 3FO2A 4L4TE 4X7TA 2VCCA 4GG8B 4U6XB 4O9HL 1YEDB 2E0PA 3F7YB 4KJWD 2WC3A 2DSWA 1HH6B 4FFVC 2BOBB 3VXSB 2JK5B 2WNGA 5KZCB 3TV3L 4JANB 3HZMA 3RU8H 3CHCA 3UG5A 4XHQA 2YBUA 1EXUA 4F9PA 5ID0B 3TJEH 1FL5A 3EJYD 1GSMA 3LV3B 3QUZD 4JZOB 4OBSA 4R6UA 1NCDH 1Z0MA 1F4YH 2NYYD 3L5XL 4TTDD 3NCCB 2ITDA 2GI7A 4XMPL 3FTGA 2J4WL 1X5FA 1FSKB 4TVDA 4RISH 4AEEA 1U58A 1CECA 4NQDB 3ALXA 3GXIA 1J05B 2OMBA 1X5IA 4GMSL 2G5BB 5TDOB 1KCUH 3SO5A 4X7SH 3U4EA 5D1QD 1VFUA 4FXGB 3CZKA 4M7LH 4OCYL 4PY7A 3UZQA 4LGXA 1U93A 4BQ4A 1MRCL 5I8KL 2DBLL 5DO8A 1F11A 4GW4B 1IAIH 4RSVA 2X1PA 4ZXLA 2H3NA 2RR3A 4ZOAA 4JR9H 1R0AL 3SUSA 3E8UH 1GOIA 1YQ2A 2P48B 4LU5H 4F2MB 5ICYB 3M17A 5DTFA 5MEOA 3IFLL 5ADOH 3DUUA 4MVBD 4RFOL 3LKOB 4UR9A 5A6JA 1ISYA 1QSFA 1RZ8B 4Z7UE 4KFZC 3MROB 3MXVL 1RIVL 1O7AA 2IPTL 5HNNA 5GJSL 1EQCA 4PR5A 3ARWA 1R8LA 3AHYA 5L0QC 4I13B 1QHZA 1BIIA 4HXAL 5GRWA 4YEFA 4JAMA 1W1PA 1BAFL 3PHQA 2UWEE 4GAGH 1WFUA 3EO0A 3PNWA 1N5AA 5F1OB 1V6XA 2Q7YA 4ODTH 4R7DB 2EDQA 5TPWL 2EIDA 5GGVH 3QZWB 2PWHA 4KTEH 1O0VA 3HUJE 3U36B 4O00A 4JKPL 1F6LL 5HHXH 1IT0A 2MPAH 3ARUA 4TULL 5CJ8A 3CCHA 4M1RA 2HJLA 1TQBB 1I1CA 1I4FB 4JRWA 1KULA 3A4XA 5IB4B 2CXGA 2ITCA 2XRAH 4HKJA 4YXHH 3EYQD 3CSGA 3KL0A 3WE6B 3GSQA 4ZS6C 3TOPA 1F8TL 5DD1H 3RUGA 2LU7A 1T21B 3IAGC 2VDML 4HS8H 3AISA 4XP9L 1JPST 2AVGA 1ZAGA 3SJVB 4AENB 1HHGA 1BM3L 4H88H 1WZKA 4O2CB 4LAQL 1WC7B 1VJSA 3M1BA 4XMLL 5E94B 3I2CL 3ZT5A 1YNLL 1KCLA 5DSCA 3MRQA 5GGSA 5JHDE 1TCMA 3TT3H 4LX4A 5D7IA 4AM0B 3QNXB 4WU5A 1J8KA 2XG4A 2V2TA 3L5JA 1BLNA 1HVQA 4XWOC 2A6JA 3EYOA 2XI9A 3PZGA 3VIGA 4DKEL 1QA9A 1RJLB 5JW4M 4YGVA 1JFHA 1U8QB 1OTSC 4NZDA 1QYGH 3WIFB 4YFLF 1OL0A 1G0XA 4W68A 4QXTA 3NCMA 2YD3A 4ZENA 1ADQA 1KJ2B 3JV4B 1DVFD 4Y88A 1WT5A 5IVZB 3RKPA 5GGQL 1C8QA 2WWMD 4EAMA 4N90D 2W9EL 4WRLA 2FGWH 4J3TA 1KOAA 3CUHA 1E5JA 2BDNH 1L6ZA 1CK0L 3M8OH 2J79A 3BIAX 4JFED 4PLOB 4BFIA 3FO0L 2AJXH 3EUUA 2A83B 3BZEA 2GT9A 5I74C 1QR4A 1N4XL 3NFNA 1LP9B 3TYGL 4PJEA 4C59B 1WDPA 5F96H 3KYMA 1Q4NX 4PJXB 5EB9A 1KTDB 5IKCB 4JFFD 1A0QL 2E3VA 2ZOKB 4XNZB 4FFYL 1RUQL 2Q8AL 3REWB 3SDCC 5IV2B 3G6MA 4OBRA 4XP5H 2NX5D 1ONQA 1QR1A 5IVXE 2DD8H 1F4AA 2LQRA 2QLYA 3VE0A 2YL8A 1FVCB 2X4SA 3KDMB 3ILPB 3MX0A 4LSSL 2R0LL 4MA8L 4KK8C 1B0WA 1EGJA 3O4LA 1ZHKB 4NZCA 3QR2A 3GSUA 5JO5B 3CFKA 3QDMA 3TA3A 1WNOA 4UNIA 4JRYD 3AVEA 1I8MA 4P8WA 4QYOA 1UYWL 4LSDA 3CMGA 1FFPB 3RIFF 4HWZA 4MZ2A 2IH1A 1EEYB 1NMBH 6CGTA 3MRCA 5BS0D 1WAAE 2AEQH 1RZFH 1UWGL 4JO4L 5DK2A 1Q9LA 2G3IA 1Y0LB 4X6BA 3HZVB 4WI5A 2FX7L 2R8SL 3L5XH 5BXRA 1ZEAL 4N90E 2YBRB 4U1KA 4LHUD 1HVXA 3G5YB 4XMPH 4F57L 3L3KB 4F7TA 3G6JA 5HGHA 3RBGA 2J4WH 4MQXC 3RY5A 1JDCA 1HXJA 4QOKA 2LVCA 5LYRA 3BWUC 4JFEE 2GUYA 2CGRL 2IMMA 4F33A 1KF9B 4FS0A 4HQQH 4NQCB 5SX4H 1MFBH 3JSSA 1PW3A 1ZHBA 3MRJA 43CAA 5KVFL 3OZPA 2W62A 4YZFF 4CJ0A 2QEJA 2CLRA 1MRCH 5CHNB 2DBLH 1LO3L 2DDXA 2X40A 1DQJB 3O2WL 5DUBB 2NX5E 3GMPB 3VA2C 2KZWA 3RL2B 3RNQA 4JEGB 3AXHA 5K9OB 1JNEA 3S9DB 4OM0L 3ZR5A 2Y36L 4P2QA 4JKLA 2VDNL 4OGAD 4F37F 1QI5A 5IHZA 32C2A 3MJ9A 4JKKA 2DJUA 5T1KB 1X1NA 4RFOH 4X9HA 1DWAM 4JZJC 1NGWB 4PRHD 1LWRA 3PWUA 2W66A 4RNRB 2BRRH 2GSIB 1KR0A 4FLRA 2X42A 3O3DA 2FX8L 1LEGB 3P11L 3HU7A 4W87A 4JQXA 1N3NA 3H9HB 2V3GA 2IPTH 4JRYE 5JXED 5DK0A 4U3XA 1MFCL 3SGJC 1HKKA 4KRPC 4YBLB 5GRVK 4HXAH 2H45A 3P4OA 4F58L 4W8BA 4K3EL 5I73B 1WCGA 2JCCF 4ZUTB 1AQDB 2VXUH 3TEUA 1I1RA 1UM6L 2IH3B 5BS0E 5MEPB 4TN9A 4TNVF 1OSZA 5FCSH 4PRPB 3AGVA 5CIPA 4JKPH 3BIKA 5D2NA 4TULH 4M93C 3DRQA 3S36X 1GJWA 3PTMA 1KIPA 1KG0A 4KC3B 1VFAA 3X14A 4ELKA 4LDLB 2DSVA 2ESCA 1J0ZA 3B9AA 2BNQD 3K8LA 4GKNB 5DJAA 1II4E 1HXMB 1RMFH 4HH9A 3LH2L 4NQSA 5C0CA 3WNKA 3HI6H 3P9MA 1KENL 1XGTB 3WQWA 3FCTB 4XP9H 3FOMA 2V5RA 5I1JH 5ISZA 4HTYA 3BO8A 4WHCA 1BM3H 3S35L 3O2DH 5ACZB 1DP0A 2CDGA 4LAQH 1Y18A 3B2UC 2C7FA 3PZIA 3S4SB 4ZFGH 4YDJB 1T80A 4PJ5D 3RQ3A 1R86A 1EFXB 2GVYA 5GGUA 1YMMB 5DDHB 5A69A 3ZLQC 2VITB 2WSKA 4RMQA 3VFGL 2PN5A 4UILH 5D5MB 2EZ0C 4LLWA 3RGVD 4IUGA 4NHUB 4O4YL 4QRPA 2X4QB 4X6CB 4NQEB 3SGDH 3ECBB 3VNYA 3ULVC 4Y5VC 3ZJ6A 3GI9L 1I1FA 1YEKL 2APXA 1PY9A 2VZOA 2BXZA 3QJFA 5EU6A 1TMCB 2XY1A 3I02A 4M48L 3FNDA 5BXFA 2W9EH 3THDA 1WZMA 3ZYIA 2CK2A 1KGWA 2BNRD 2I24N 1CK0H 1ZA3A 5DRNA 3ZE2E 3TVMC 3DSNA 3FO0H 3N1FC 1ITCA 4D8PA 4JFSA 5I1IL 3BLKA 2EH8L 3FFCD 5C0RL 2EC9U 3O6FA 1QPPA 1NOUA 3TYGH 1R3HA 1EHLH 2R1XA 4EUPH 1CICB 2DYPA 4D3CL 2CMRL 3QI9B 1W9DM 1A1OA 1A0QH 4PP2B 4FFYH 4PMQA 3QEGL 3V6FA 3RIFK 5CD5C 4L5FL 3BKML 2J7EA 2XFRA 2EDRA 2BNQE 1C5BH 4N42A 3BZFA 1RZIB 2EPLX 3DO7B 5I8EB 2NNAA 1DEDA 3WO3B 1A7RL 3OKKA 4U7KA 4ML4A 5E8NA 3CH1A 3NIFF 4LSSH 2R0LH 4HMDA 3GTNA 3L5WB 3JUZA 4HUUA 4J1UB 3HRZA 1ORSA 3LDBC 3RVTD 4ODSH 1ZSDA 4QRQB 5DMYA 4PG9B 1WFTA 3OKMB 3IJ8A 5CAYB 3X13B 1J7VR 3SCTA 4F7EA 4AXNA 3CK0L 1CG9A 1WBXA 1FZJA 5KVGH 3QQ3B 1UYWH 3O3BB 3GSRA 5IQ7L 3OB0H 3WL1A 2R0KL 4PMVA 4HJGB 4DTGL 2VDRH 3STBA 4CW1A 2V5SA 5FHBL 1UA3A 4JO4H 5JPMB 2H32H 2BSED 1QLFA 3QJHB 4X6DE 5JUEL 1G7MB 3FB5A 1W2PA 3BUYB 3T0AA 2ATPB 1HHJB 4P5TB 4F37K 4F57H 5C6TL 1L7IH 2BNRE 3PABB 4GZJA 7A3HA 3OB0K 1R3JB 2YXFA 4P2QE 1SY6A 3L95B 1NPUA 4Z6AT 4GI9A 1HJVA 5MEQB 4KROC 4L9LC 3WNPA 5D72L 3FFCE 1VFFA 3PJSB 2GK1B 3QIUD 2CD0A 3ZE0E 2CH8A 5KVFH 1RZKH 4A2MA 4FXLA 5DT7A 2VYRE 3V79C 5BMFH 3BSGA 2DDQH 4G6JL 1LO3H 5FDYA 2QADC 1G5AA 3STLA 1PD6A 2DLTA 3O2WH 3AMKA 3QUYB 5E00B 4MAUL 2E4TA 1OBAA 4Y2OA 5C7XH 1I9RH 4HGWA 4XNXH 1NANH 4ZD3L 3GKZA 4XCEB 4TNVK 2Y36H 1MCPH 3OR7A 2ARJA 5DF0A 4CD8A 4HIEB 1QP1A 1OF2B 5DI8B 4ZNCD 5CJXA 3ME0A 5J13C 3NOIA 2ADIA 5C07A 4EK7A 3IETA 1BFTA 5LCVL 4K8RC 3B5HA 1WIPA 1WE5A 3KPTA 1QFPA 3VFRA 2XFXA 1AHWC 12E8L 3MV7D 3GJEB 3GIVB 1MFCH 2ZSWA 5EIVA 4FG6C 5CPQA 2NY0C 2NLJB 4K3EH 1WICA 1Z9LA 4HDIA 3TO4C 3SBWA 3NCOA 2APVA 2VZTA 1T04B 5ISZE 1JIBA 2ILLA 4MDJB 4JHWH 1OD9A 3D0LA 3RZWA 5B38A 2CIIA 4Y7EA 5A8OA 5EOCJ 1AGFA 2AW2A 4QY8B 5A43C 4MD4B 1VFMA 2X9XA 4NUGH 3LEYL 4LSUH 4GS7C 3RA7H 1XF5B 1DWIM 4QXGH 4P46A 2Y5EA 2VVNA 2UY6A 4W5UA 3S97C 3VJ6A 1B88A 4MXQD 1KENH 4MJIA 3BW9A 3OHXA 1JVKA 3U0PA 2YPLA 3R06B 4WLCA 2C3HA 3S98A 2VXTH 5EU6E 5I77A 1I1AC 4LCCC 4S2SB 1S9WB 3FAXA 2GSJA 1CWYA 1VACB 2QHLA 1LILA 1WCBA 4J6RH 4UU9A 3RZCD 3T0ED 3AOFA 2OTUB 4RA3A 4XXDA 1NCAL 4Z7WA 2W9DL 5D1XC 6FABL 3BWAA 2R1WA 3RI5F 1RH9A 2Y1VA 1DBKL 4QLJA 8FABA 4BYHA 1WBYA 2HFGL 1DFBL 4ELMF 1FVDA 3GI9H 1EAPA 4C4KT 1BJ1J 1JNNL 1QPKA 3F65A 4JFOA 5I23A 4FQIL 5JBEA 4M48H 1VAHA 1QZ1A 5HPCA 1T0MB 3MV7E 1U3YA 4F7CB 4G9FD 1AQMA 4U6YB 4P5MA 2YK1H 4DKFL 4NRZB 4JY4B 1SVCP 2F53B 5I1IH 1SR0A 5C0RH 2WSPA 3RWCA 4XTRC 2IG2L 4APQC 2H6PA 3ROLA 4Q6IC 1N2RB 5L2JA 2V5CA 4FABL 5HHNB 3HNVH 1BJ8A 2XA3A 3QEGH 4LVHB 1MFAL 5L8JB 3HMWH 2WHJA 5D9NA 4I18C 4OF7A 1BQSA 3GNRA 2IADA 4RX4D 3ZTJG 1FOBA 2XPKA 4O5LL 3GSOA 1B0GB 3H9ZA 3WV0A 3FOLB 5D1ZB 1OAUL 4DWSB 3VGGA 2EIBA 2XNAA 5EOQL 2G2RB 2GK2A 1UB6B 4YHEA 2BP3A 1NCBH 2DQTL 4HUVB 2AJ3A 4HCRH 4WIQA 2VX5A 1NC4A 3T0EE 3C6LA 1LDPL 2CUMA 1AH1A 4OCWL 5T5NF 3G9VA 2YHGA 4OFDA 5DGQA 1XD0A 3UZEA 3OXRB 5IQ7H 3KXFA 3G6AA 3HI5H 1H4PA 2NXZC 5C0AD 1UD3A 2R0KH 4D6HA 2WLZA 1KYOJ 3MODL 3Q48A 1NGZA 4MSWB 3VXOA 4DTGH 4GMTL 5EBAA 1AIFB 5FHBH 1YMHA 1DDHA 4DCQA 4PBWD 4HAFA 4ODVH 1KGUA 2FZ3B 5FF6A 4H0GA 4JLRB 4XRCB 3JZ7A 1OM0A 3MXWL 1XAUA 2VCBA 1CF8H 1FVEB 3NAAH 3VFPA 4G9FE 1YEDA 4PRWA 1YJDC 1ZVSB 1NJ9B 1GGTA 4OJYA 3VXSA 4TVUA 4ESKA 4NI3A 5F6IB 1JPSL 3OG2A 2IANB 2FDMA 5C07E 3HG1A 2HFFA 3R8QA 4CDGC 1V08A 3BPOC 1MFDH 2CKNA 3ES6B 1ACYL 3H42H 1INDL 2F15A 3LV3A 5A2IH 5BJTB 2DGAA 4G6JH 4HXBL 4D0BA 5HYEA 1QFWI 4KRMB 5C8JA 4S11A 1QRNB 4D71A 3MUHL 2F9BT 3MV9D 3E3QE 3MRNB 4PJDB 5D70L 4DJMA 3KYKL 4P2OC 3FT3B 2ZX9A 4TTUA 4NQDA 5GGTL 3LPGA 2YPVL 4YDVB 1J05A 5H37G 1N5YL 5FL1A 4YWGL 1ETZB 3WFHB 4N0CC 3MRBB 4M6NL 4NKDB 1Q94A 2C7UB 1MRDH 2EPKX 1RHFA 3I6LE 4J8RB 3RM4A 3IU4L 1NGQL 3IK2A 5IB3B 4PJ7E 4QRRB 2ZCKL 3QH3B 4ONOA 3U30C 2BY2A 5H35B 3IXTB 1NLDL 1UJ3A 1JAEA 1G7LA 5ICYA 1FNSL 4JQVC 4MCZA 1JD7A 3ARGB 5EZJB 1P7QB 1YYLH 5C0AE 3SEPA 5E24E 1FA2A 2CKBB 4Z5RA 5C3LD 4UAOC 1W9XA 4UQDA 5DJDB 1MCOH 3PF2A 2W60B 1UEYA 3LKOA 3KLAB 1NAMH 1DANT 3RI5K 5LWYH 4MMZC 2NW2B 3SE9L 1NWUA 5JNYB 3O3AB 5BO1L 1IZKA 2MCPL 3CBWA 1R6VA 3AAZB 1EEZB 3V6OA 4LASL 1E73M 5C70A 3G9AB 3OMZA 2Y23A 3NZ8B 4KTDH 5GZNC 4R26L 2XGBA 5SWQB 1AXTH 2F5AL 3OKEA 2NZ9D 5KANI 1GOWA 3T4YB 5D7SL 1BPVA 5GS0H 3QHOA 3QUXB 2WXDM 3QQ4A 1T7YA 1MH5B 3QZWA 3S96A 3WEXB 3U36A 2A2QT 2WUCH 1YNKL 2O9OA 2W9LA 4AD5A 1HSAB 3TCXA 4HPHA 1NCAH 4I2XB 3BCDA 1BZ7A 1I4FA 3DV4B 4XAWL 3PTKA 5IB4A 2OYKA 3RJDA 3SGKA 1DBKH 4G5ZL 1FH9A 3MV9E 3VRIB 5KZCD 5IBUG 5E5UB 3SHSA 2DF3A 2NPLX 5C0FB 1KTLA 2BVDA 2MHAA 4L4VA 4NKOB 3WHXB 4X5LA 2HFGH 1DFBH 5EU3B 4PGDB 1PJ9A 4RGNE 5GZOD 4Y2DB 2APBA 3I84A 2D9QB 3HE6C 3PHSA 4MJ5B 4YHIA 5FUCE 3THCA 3F5LA 4RDQG 4QLLA 2IFFH 1MWAA 4FQIH 4N1EA 5A2CA 3NPZB 1JHLH 4MDIA 1LE5A 1EERB 2EYRA 3OLGA 3NN8B 4Y1AB 2ICWB 5HHVL 5DJ8B 4DKFH 3B9KC 1KGXA 3QNXA 2CBVA 4I4WB 5E8EA 1GJIA 4PMRA 1NEZB 4JFYB 1BG9A 4UFLA 3VWJA 3RM9A 1D6EB 4L8CB 1RJLA 2IG2H 4KK5C 1U8QA 4Z2KA 1XF4A 5C0JB 4OLUL 2XQYK 3WIFA 4FABH 4KI5F 3VINA 3L9RA 1KJ2A 4LMQE 5FA4A 2AXGB 1WWAX 1CE6B 2Z93A 1BGXL 3AB0C 3SCRA 1CWVA 2M26A 4UV7H 3GXMA 2KUTA 4CVXA 4KI5D 3L2LA 1G7PA 1OAUH 5GS3A 4WW2C 1BREA 2C3WA 1MCIA 2A0LC 5EOQH 1W3KA 5A2FA 3DHMA 4YDIL 1TFVA 5CJQL 3UO1L 1OSPL 1DBBH 1NDMA 1LP9A 3ZHDA 2H2PD 3KPQB 3UESA 2R2CA 3QBTB 5IKCA 4YHKL 5DJZB 1LDPH 4MB3A 3SDXE 1E71M 2WINB 4LSVL 3FFDA 2GDVA 1DLFL 1B0RB 5EBWB 3ARDC 4KK6D 4YHZL 1J18A 4ODUA 4NBYB 1FVCA 4UFJA 4YK4C 3MODH 3WIHL 4RGOL 4GRWF 1U2CA 2G9HB 2OZ4L 4DK3A 2PW1B 5F7MC 4O51B 3N12A 1W72A 2HT2D 1CQKA 4A6YH 1P5UA 1FPTL 4BSVB 1QNZH 3JWOC 3RY4A 1I85C 1HYSC 3A3HA 3WHE0 3QWOB 4MX7B 5JO5A 2W65B 3ILQD 3SCOA 4Z0XB 4MPKA 2NMSA 4LARH 1MPAL 4CN6A 5GGRA 2FEDC 2YA1A 4W4OA 3WCYA 2ESVA 3WBEA 2A73A 4NQDE 5CEZH 2F58L 1JPSH 3SE4A 1FFPA 1MYRA 1L6XA 4OI9A 1EEYA 3BP5A 5TFSL 3WLWD 4WHDA 1IT9H 3PHOA 3ARSA 2AV1B 4HIIA 2DQJL 3SJVD 2AMGA 4JG1H 4OD1H 3CVIH 5DD5H 3AIQA 4ZFZB 4HXBH 5EBLA 1HXYB 1Y0LA 3TBWB 5AD0B 3AIRA 5ALBL 1AVAA 3SURA 4K68A 2W61A 2YBRA 5DLMH 1WISA 5I0DA 4PJIB 2ZX5A 1IGCL 1V02A 3KYKH 2HT3C 1G0CA 3HNTL 3T09A 5GGTH 3V8CA 2YPVH 1N5YH 5J1AA 2J8UB 3UETA 5JTWA 3LN4B 2X1QA 1I1XA 4YWGH 5T3ZL 1KBKA 1WEJL 1PIFA 2XIBA 5H8DA 4ZS7L 4M6NH 1NSNL 3PZTA 1K6AA 5CHNA 1WPCA 2G3MA 1EUUA 4PJBF 4F15C 1AJ7H 3V6OE 1R5IB 3AMLA 2QHRL 1QHPA 3DUSA 4QHKI 5DUBA 4PJXF 4AZCB 1NGQH 1HL8A 3VIJA 2EDYA 2ZCKH 5I16A 5K9OA 2NY2B 4LLMA 4P48A 4P99A 1NLDH 4U1HB 4DW2L 4OJFH 3CIQA 3EGSB 1U8OA 1IKNA 3KWWB 3D18B 3DXAA 3VFMB 1HEZB 1CDIA 3T3PF 2I9TB 3SCMC 1B3WA 1ND0B 3BQUB 4HWEL 3AHVA 1Z32X 4OKVA 1G9ML 1FFNA 1BYBA 3MOAH 4BQ2A 1H3GA 1DQDH 3HAEB 5IHUL 4UDTB 3V95A 2GSIA 3WDHA 1UWTA 3NFPB 2JIXB 1GGIL 1TENA 3O2LA 4KMTH 1RURL 4QNPF 1P4LA 4Y4KD 1UR1A 3D1MC 3IDUA 2EE9A 4GBXC 4R26H 4H41A 2F5AH 4V2CB 4ZUTA 4OZGF 2AEIT 3BZ4A 1XCQB 2WHMA 3PP3H 1AQDA 3SJVE 1MIEH 1KN2L 2IH3A 5E6ZA 4I0KA 2CKRA 5MEPA 5KS9A 4K71B 5C2BH 2APTA 4NCDA 4F80A 4I77L 5HGAA 2AJVL 1YNKH 1IC5L 4IIQC 4PYGA 3H6JA 4XPTL 5ID1B 2XT1B 2NW0A 5IFAH 4XAWH 4KDWA 3WH6A 2ZPKL 4PG2C 2V7NB 5BV7L 1V05A 5DZNA 5T3ZD 2JB6B 3PP3K 4LLQA 3NSMA 5HVWA 5E8DL 1XGTA 4G8GB 3WFZA 3FCTA 3X3GL 4Q9CA 5IEKB 5B4MC 1VEOA 2EXWC 5T33L 3X11B 3HMCA 3CUGA 2X70B 5ACZA 3NFSH 3NIGF 3D69B 4H1LB 1SHMA 2FBOJ 3HI1B 4X7EC 3IDYB 3S4SA 3QDAA 4MXWL 4RAVB 4YDJA 1UJTA 5ITFB 5D71H 4F7PB 1G01A 4W5ZA 3QZWG 1YMMA 2B1AH 4M9PA 1LMKA 5DEGA 4NQCD 4GRWH 4HA3A 4I0PA 1U8IB 2R9HD 3MTRA 3BLPX 4PJBE 1JP5A 2V7HA 3ECBA 4NJ9H 4NQEA 1HJXA 2PC8A 4PJXE 4U1NB 1W9PA 3RWFB 2ZOLB 4OLUH 4F79A 1FCGA 3L3JA 2DQCL 2XWJB 3UCQA 4LDEB 4HEME 4HD9A 1IBGL 2WQRA 1F3DJ 5GRJL 4M1DL 4OOZA 3INUL 4IS6B 3RILA 1GGBL 2MOVA 1QQDB 3H3PL 1UR0A 1BGXH 3V7AG 4Z95L 2ICES 1FGVL 2IWGA 3W28A 4WWKB 1FNGA 2DQGH 5T1KD 3WXVH 4JY5L 4NN7C 3BD5A 5CJQH 3UO1H 1MFUA 4NSKA 4GG6F 3ZE1F 4MCYB 4YHKH 5HI3D 4PP2A 4JHAL 2VLRA 1WTLA 1M71A 1KB5L 4LSVH 3MU7A 3BHBA 2E7CA 3R1GL 5IROC 4V2XA 1D5IH 4YHZH 2Y07L 4KK9C 1J0KA 1RZIA 2DQHL 1E70M 1C5CH 5T3ZE 2JKXA 2GJRA 4RGOH 2OZ4H 2VO5A 5MERB 3O3UN 4B16A 4PRPD 3CZJA 3HPLA 3DYMA 5ESVA 4Y5XA 2EDXA 3KPPB 1YY8A 4DOHB 1BQHB 1Z3GL 1JD9A 3LQZA 4RMTA 4O02H 4QRQA 1V02E 3OGVA 1NC2A 2J5LB 3X13A 1EEUA 1MPAH 1H09A 1NWSA 5AZEL 1HKMA 1OM3L 5HDBE 2EKSA 3QQ3A 4NQCE 3D3VB 2F58H 1CDJA 5HHPB 2XQBL 5D6CB 2EE6A 4YHGA 4XVSL 1E55A 1A9EB 1PG7X 4ATWA 2VDQH 5I9QC 2JJWA 4B3KA 1TFHA 5GQBA 1PZ3A 4NZJA 5JPMA 4EN3C 3U1SL 1CL7L 3H3BC 1F2XK 5ALBH 1TNNA 5A2JH 5IJVA 2F5BL 3VIFA 1EFXD 2ATPA 4P5KB 4W8AA 4ODHH 1CQYA 1IGCH 2DIAA 2WANA 3RPIB 3HNTH 5MEQA 3VFTB 4K3DL 3MBEC 4GSDL 3NGBB 3PJSA 5D8ZA 4YFEA 3SE3A 4EI5B 2YZ8A 2XVNA 2YRPA 1FO0B 3U9PL 3OAUH 1UCTA 5DJ2B 1NSNH 4FQLL 3BRGC 4OZFB 2Q3ZA 4PS4H 3OR6B 4C54A 2EBNA 2Z92B 1NCCH 4PJ8A 2QHRH 4MNQB 2RFXB 1HKLH 1V0LA 4ODXA 4U1JA 2GAZB 5E6IC 3ZE1E 4DW2H 3GSNB 1KQYA 5DEZA 2HLAB 5GPRA 1W0VB 3E0GA 4HIEA 4UB0H 1OF2A 4LPWA 1IMHC 2LTQC 3WO4C 1GOMA 1CICD 2XUCA 4PRPE 4NRXB 4I8DA 4HWEH 3QI9D 3R8BB 3TWCL 1GQIA 5EOTB 5IHUH 1X9QA 4NQVB 3F62A 2IQ9L 1DE4B 4DQOH 3PGFL 2ADGB 1O7SA 3GJEA 3MLPA 3GIVA 3CZ8A 5B8CC 2NLJA 2HKHL 4MA7H 3CXDL 3VMOA 4X9YA 1MUJB 1TZGL 2E7BA 4JM2C 1T04A 2ICCA 5DHVB 2PTVA 1KN2H 1MJJB 4Q9RL 3LKSB 1G84A 5FK9B 4BA8A 2MFNA 3VWKB 2AK4B 4QY8A 3RVXD 1Q72L 4XPTH 1FCCA 5KN5B 1MJ7L 4CVWA 3DMMC 5HJ3B 4BZ1L 1CPUA 1U8LA 5F88A 4ZS6D 1BFSA 1XF5A 5D5ME 4QRSB 5BV7H 4X6CE 1EAJA 4LPVA 2R15A 3VMPA 5E8DH 1TXKA 3VM5A 2AJSL 4FLSA 3O2DA 3R06A 3MUY1 4W7VA 5T33H 2FBJL 5F6HI 3MCLL 4J2XA 1EDGA 1S9WA 4AZHA 3OGRA 5IMOB 4P5TD 4Z76B 4ETYA 4QFUA 4ZEPA 1V6VA 4ENED 3MA7A 2GJZA 3PN8A 5IW6B 1EPFA 4JHBA 4AIXA 5IMLA 3MRPB 4AT6A 5DQJB 3TTOA 3SDDA 2XWTA 5DFWH 1A3RH 2DLIA 1BQLH 2E8ZA 1OTUC 4HS3B 3V2AR 1C16A 1CFVH 2VLMD 3TESA 3VIMA 4HUWA 1SJEB 2DQCH 1CE1L 4U1IA 1E28B 2EEAA 2ZXBA 4JFZH 4M1DH 3INUH 3QUYD 1GGBH 1XIWC 3W39B 3MRLA 3KLSA 1T0MA 1SBSL 1PFCA 2FO4B 5H94A 5A40E 1GZPA 4Z95H 5E2UL 1YA5A 1FGVH 4F7CA 1W1YA 3PWJB 4UT7L 4S1DC 2MWCA 3EOBB 4NRZA 2X89A 4HGMA 4B53A 4EUPA 3S4SG 5AC4A 3LS5H 1V8HA 1X6LA 5F6HJ 4ZXBC 3TBTA 5ICZB 2EO7A 5D7KD 2BSTB 3OA5A 3IFPA 1A47A 5A16B 1F6FB 5HHNA 4U1SB 2X4OB 1G6VK 2ZUNA 1KB5H 2MTPA 1JHTB 4OF6A 3DARA 3R1GH 2Y07H 1CFSA 2ZKHH 1AD0B 1T7VA 2DQHH 3P2TA 1F3JA 3MLTB 5I15L 4KK8D 4X5WA 2Y7QB 3I3EA 4H8VA 2W0KA 2CRYA 5CLTA 4W84A 4G3YL 5AWNL 3AREB 1GGCH 1Z3GH 1UH4A 4PBVC 4PGJA 2EPNA 1IM3B 2YLLA 3NIYA 1I9IL 1FRGH 5AZEH 2G8ZA 3Q3GB 1OM3H 4ODWB 3GRWL 1IAIM 4JREC 3ARFC 3OXRA 1MAJA 3T2OA 2XQBH 5CINH 2A9NL 2H32A 2VLME 3B9DA 4CN1A 3BP4A 4GI8A 1AIFA 3U1SH 1CL7H 5I30L 2Z31D 3K2UL 2ENYA 2NY3C 4FQQA 4JHZA 2F5BH 2J2ZA 2JCCA 4MQXD 4GRMB 1MEXL 3D48R 4JLRA 2E3ZA 4XRCA 4UT9L 1ZK9A 3O41B 4RMSA 4TXEA 3WENA 1LE9B 4FRWA 3MUIA 1YUHB 5C09B 1ZVSA 1NJ9A 5ABEA 2VC2H 2HMID 4LGRB 3W5MA 3CUFA 3MS8A 3IJHB 1E4XL 4HIXH 3IGAA 3WF2A 4OT1L 1MY7A 4KXZI 4FQXC 3C5ZC 3OQ3B 4PBXA 1FYTB 4LLYB 4FQLH 5HVHC 3VW3L 5ITBL 4W85A 4LP4A 4TX8A 3U9UB 4L3EB 3VIIA 4R8WL 4I48B 3WJJA 1A6TA 4BK5A 3MRNA 1AC6A 2P1YA 3C2SA 2F53D 4PJDA 3FT3A 3D25A 2WYSA 2H26B 4PRDB 2BVEA 2QSCH 2Q8XA 2IBGA 3RPKA 1BPLB 2HN7A 3WFHA 1NGXA 1NP2A 1B4RA 5GSRA 3BXNA 3UP1A 4RIRA 4NKDA 5JA8B 4XP1H 3FW6A 1M7IB 2YMXL 3Q0HA 4J8RA 2IJ0C 1OAKL 5DYOB 2EDBA 5AAWA 3KPRD 2CR3A 1FC2D 5D1ZD 4DWSD 3FKUS 5H35A 2D0HA 3CXDH 4XI5C 3MJ7A 3ULUC 3AJ7A 1EBAA 1P7QA 1ZLWH 2C5DC 3KPOB 3HC3H 4JFDB 3BEVA 3S5LB 4AMKL 1KT2A 4Q9RH 1HCVA 1NCWH 1I1YA 2AERT 2Z8WC 3KLAA 3VXUB 4LCWD 3ZKND 1JFQL 3PL6C 4IRJD 5JQ6L 1ERNA 1CR9L 1ZGLP 2NW2A 4URTB 3IJ9A 3FY1A 4KMQA 1T1XA 3LKRA 3GKWL 1TJGL 3HC0A 1YN6B 4JPIB 3D85A 4X4YB 4BZ1H 1MW0A 1ZWIB 1ISWA 1EEZA 4PV9B 3QO0B 4POZC 4UIMB 4OZIB 4QAWA 1RZGB 3T1WA 1IAMA 1ZLWK 3NZ8A 4C56D 5CSYA 5SWQA 4ETQB 3MUJA 1IRAY 3MA9L 1ZS2A 4S0SD 3C60B 1B90A 3BVNB 2FBJH 2CKBL 1MH5A 5DMGC 2DLEA 1MVUB 2Y72A 4K7FB 4WEUD 4X7CC 4N0YL 1MAKA 2CIPA 4JPVL 3W0WB 2EZ0D 1K8DB 3DV4A 4WHYH 2SEBB 1NP0A 5LGKA 5ENWB 4R2GC 2F53E 3BPLC 4X4ZA 5C0FA 2IAND 3A6OA 1E4NA 4X80H 4ZO7A 1FNHA 5L8KB 3QHFL 5EU3A 3TPKA 4TUJA 4Y8AA 4MJ5A 3BH4A 4XBGB 1PGRB 4XCFL 4NKMA 4WO4B 3HE7A 4JKWA 3MBXH 4I3SL 2B5IB 4MAYD 1AO7B 1QRND 2A74A 4C58B 5SWSB 4KJYA 2X05A 3NZHL 4XBEH 1YECH 5AYQA 1KJVB 2CESA 4D94A 3H2WA 5E2UH 3EJZD 4Y1AA 2ICWA 4UT7H 1CGVA 1RULL 4GAJL 3O8XA 4JPWH 1ITXA 2AS5M 1WCQA 4KV5F 1NEZA 1P1ZA 3V5HA 1D6EA 5L2KD 4L8CA 1AI1L 2K1MA 4NN5C 4LCWE 1EHAA 4EXPX 5CD5D 3CC5B 3NTCH 2AXGA 4B50A 1LNUB 5FKAB 1CE6A 1J1XL 4QRRD 5KSAC 5EA0H 1CU4H 4O58L 1S7RB 3ARGD 2YN3A 5CZVH 4X4XA 1L0PA 2YA2A 4Y0GA 5JIHA 2BOCB 2BC4B 3U79A 5C6WH 1U2YA 4HCRA 2DI9A 2XM2A 4X8JA 4X6EB 1IC7L 1QSEA 4HUMB 1H8SA 3W9EA 4DWHA 1M04A 4WTZG 1RU9L 5DJZA 3W11D 5C92A 5HYJB 1ED3A 2OJEB 3MSGA 5GNYA 1Q1JL 5M17A 2WINA 5D2LF 3C09C 1GZQA 3GRWH 4XVTH 2IANE 2BV9A 2O9PA 5CBAA 3HCVB 1FHGA 2P8PB 2A9NH 3QUXD 3U57A 3QIBC 4LCUB 2W0PA 1UZ4A 5B21A 3RWIB 5A8PA 5IOPB 4CAGA 5I30H 3TN0A 3K2UH 5FHAL 1OP3K 4BSVA 1BOGB 2PNDA 4ZNEE 1QRNE 2NTFB 2Q20A 4G9DB 1HOCB 3FO9A 3QXTA 4UV4L 4YFLI 3MSDA 1JGUL 1TA3B 3QWOA 4LPCA 1AQKL 2Y25A 4KROD 4Z0XA 3DGCR 1H15A 3GMMB 1S7UB 2AI0L 1CXIA 1P53A 3DV6B 2P43B 4Y2DD 4LF3B 2Q86A 4NM8H 4E5XA 1KSRA 5DD0L 2WCAA 2YUZA 4OT1H 3ZOAA 1RUPL 5L2KE 2AV1A 3O81A 1R3KB 3SOBL 2XPGB 4NP4L 1FL6A 3BP6A 1OB1A 2VAJA 2BVUA 1HXYA 1JNHA 2GTWB 4KV5E 5EUOF 5AD0A 1OQXA 4JG0L 4JHOA 3DTXA 5J9PA 1J9YA 4QLRA 4QRRE 2GUOB 1DQML 3QNZB 5D6DC 2BMKB 1HH9A 1RZ7L 5J12C 7FABL 3VGHA 1HHKA 3TTYA 2TAAA 3S35X 1TNMA 4X9BA 4NKQB 1HX0A 5KSBF 4RRPA 4XB8A 4M6OH 3A67L 1FE8L 3LN4A 1ZANL 4ZAKC 4BQ9A 1T89A 3KHQA 2G3JA 3CGTA 1PVHA 2OP4L 3B3IB 4M8VA 1KB9K 3PV7A 4GXPA 1PYWB 3JBG7 2IC2A 1R24A 5EZLB 2YMXH 4FG6D 3SY0B 3VG0L 4ELMA 1R5IA 4AZCA 3TO4D 1T66D 4HKXB 1B30A 3QP3A 3NVQA 4QHMB 1PPIA 1L9MA 2NY5C 1PQZB 3EGSA 4F9DA 3D18A 1NAMA 2V17L 3LSOB 1TPXB 3VFMA 3I85A 4AMKH 2I9TA 3CHDA 5JDSB 1ND0A 4LBEB 3MGOA 3BCFA 1XR9B 3BQUA 3BE1L 2WBJA 5JQ6H 1MCWW 2W0FB 2J12B 4I2XE 4MWFB 3D87B 5AYUL 1TJIL 1FG2B 2JIXA 4ONFL 4XGZA 4YH6A 2DJ4A 4UFIA 3ZYOA 2Q8BH 1KELL 2EXYC 3JWNC 4Y5YC 5K9KB 1B1YA 1V6WA 1I1AD 1MJUL 1XCQA 3NCFB 3GBML 3VIHA 5DMJB 5IB5B 3UG3A 2YXMA 4QHLB 1XT5A 3VNZA 4IOIB 4W6WB 4JIEA 3IKCB 5D1XD 4XX1G 1U8MA 1NGYB 1NBQA 3AICA 3GYCA 2WW5A 5JORA 4U1GB 4Y1AE 5ID1A 2JIWA 3JUGA 3G5VB 4M7ZC 4J4PA 5E7BA 2DKMA 1KIQB 3GMNB 3NPSB 1P4IH 1MCDA 3FQTB 4XCCL 2YKKA 4AY1A 5EUOE 4QCEA 5F89B 4B9ZA 4G8GA 4XCFH 3X11A 1BZ9A 4L8DB 4YN5A 4NWUL 1BWMA 2X70A 5IFHL 3C6SA 5F7FA 3D69A 1IQWH 2HJFA 3IAQA 4EBQH 2DQDH 5HHMB 3QG6B 2P7TB 2Z1KA 3AXIA 3H0TA 4YPGA 1B2WL 4F7PA 3EJJX 1FH5L 4HAGA 3MRIB 4K2UL 5HGGS 2Y8VA 4PMOA 2ZNWA 3BDXA 4JM4L 4MNGB 5A2LH 1AI1H 4WF7A 4U1NA 3RWFA 2C4XA 4XVUC 5IB2B 1K3ZA 4LPXA 1IFHL 3BDYH 1CLZL 2VB5A 4IS6A 1QQDA 5SV3A 1K6QL 5L8LB 3TIDB 3BRFA 5CJOH 5DVNA 2NY2D 4M6ML 3IRZA 4QRUB 4L8SB 1E27B 4O58H 3UJIL 1H3TA 1AY1L 2CNCA 2ICEA 3FQXB 4RE2A 1CBVL 5J6GB 4KZDL 2HT4C 3IDNB 3O4OC 1S7VA 1NANI 2F61A 5SWZA 3VUPA 4M03A 3JTSB 3CDGB 1NEZG 5I24A 1YEEL 1GQLA 3T65B 4JFQB 1Q1JH 4NUJB 4OOUA 4PTUB 1HDMB 1A6ZB 2NXZD 1R3LB 4R4NC 4OCNC 4I3RH 1DN0A 4H04A 3GBNL 3EYFB 4XP4L 5ANMB 5I6XB 4UDUA 4A6YA 5JBDA 3MMDA 5MERA 4DM1A 5IMMA 1D9KB 4HLZG 1WLHA 1H8OA 2P8MA 2HTLC 1VHPA 3GO1H 4NN6B 4ZFMA 3DYPA 1P2CB 5E2TL 4OM1H 2JJTC 2WMIA 3GH5A 1CD1A 5KBNC 1JGUH 3KS0H 4FQJH 4PJIE 4LLUB 5FECA 1UEMA 4Z77B 4U1LB 3L5IA 3BN9D 3QEQB 3S88L 2J8UE 3EJYC 5DD0H 4QCIA 3BT2H 1A9EA 2CITA 5BRZB 4NP4H 2EO1A 4DN4L 2NYYC 4KI1A 1H5BB 3BP7A 4MDPA 2G3NA 1RP8A 1YEHH 3S3SA 3NJ3A 4HF5L 2EXOA 2C3XA 1F3RB 3GUTB 1L9NA 4P5KA 1PAMA 1S5HB 3O45B 1DQMH 4X9GA 1CENA 1JNDA 4NGHH 4LKXB 7FABH 4S3JA 2LE9A 1T1ZB 1I75A 1T6WA 5JLZA 5JZ7C 1KLUA 4PJHB 4N0CD 1A9BB 2ZUMA 4EI5A 3FRPA 1ZANH 3C87A 4NT6A 2BK8A 3MO1A 5DQDH 1FO0A 2N7BA 4ISVB 5ABFB 5DJ2A 1S7XB 5I1GH 2JALA 4NYLB 1J9CT 2E9MA 3BPCA 5LKNA 3VRJB 1G9NC 4L8BB 2VQ1A 2RFXA 4PLKD 1QI4A 5JW4Q 4WWKD 2GAZA 1KXQE 4TOYL 5BVJA 3GSNA 1S9XA 2NY1C 4MQSB 4MVBC 1C8XA 1M1SA 2HLAA 5DRXB 2Z9TA 1QKZH 1JYWA 4JO3L 3WUWB 4XMKL 4FMVA 1DHKA 4NRXA 4IBLT 2ZX6A 3BE1H 4IRSC 3EO9L 2RB8A 5EOTA 1QNSA 4D6CA 4N5EC 1INQA 4ZTOL 1XR8A 5AYUH 4IOFD 4NQVA 3VXRA 2EEBA 1A2YB 1TJIH 1EK3A 4YHPA 2LABA 2PYFB 5GZND 2XKNB 4M1GL 3RL1B 5M7QA 1M6OA 5FCZA 2F19L 3TH4T 1JMXA 2P45B 3VD3A 1UD8A 1K4DA 1NCTA 1KELH 1S3KL 3CJJA 2CDEA 5JMRA 4XXCA 5DR5H 5E95B 1P7KB 1V3IA 1ZS8A 2WBGA 1MJUH 2B0SL 1W9VA 3QT2A 5M94B 5DJXB 3GBMH 1X7QA 1YEFL 1MJJA 2W91A 4IMKC 1FNFA 3D6GA 1BD2D 1U8KB 5FK9A 2AK4A 4KGJA 2VZSA 2VRAA 4TQEL 5I8CB 1OGAB 1DWGM 5HJ3A 1AGBA 1D5XB 4HA4A 5JA9A 4KUZL 2IPKB 1KFWA 3D3VD 4QRSA 1MLCB 3BGMA 4F7MB 4F9PC 3HAEG 3K2MC 4HOZA 2B7DT 5TQ2L 4P9MH 3TYFB 4ZODA 3QIWB 2WQ8A 5EULV 5DD6B 1FGNH 3QEUB 1SFSA 3OKYA 3KL3A 3G5XB 3EBAA 5K9QI 3W27A 5IMOA 3T4AA 4Z76A 2IXVA 1TVBB 1RUML 5IW6A 5DUMH 2VWEC 4CBPA 5E2WL 1B31A 1FH5H 5DQJA 1ZBWA 3NYDA 1HKFA 4PJCF 3NUKA 4JM4H 1MLBA 4HS3A 1A7OL 1A6AB 5TF1L 1ZMYA 3WUGA 1DVFC 3BJ91 4WW2F 3MV01 2WWMC 3DNKA 1WDSA 5F7UA 1SJEA 1NGPL 4OFKA 4G8EB 4MNQD 3RX8A 3MRDA 4O2FB 1KCSL 3W39A 1K6QH 2DQIL 2FO4A 4HS6B 4M6MH 5IT2L 2UV3A 1LO2H 3P0YL 3UJIH 2A0LD 1MCJA 4EZMA 5CD3A 3KR3H 1NBVL 4LRIA 4H1LG 3B5GA 2W0LA 3EOBA 4M02A 3TT1L 5IIEA 1CBVH 1LEIA 2C1OB 3VXMA 3H9SB 1KTRL 5IEHB 4QWWD 4D6IA 4P23A 4QDMA 4DOHE 4WV1A 4CU6A 4J3XA 1BD2E 5D9SB 4TTGA 1BAGA 4ZUUB 2R0ZL 3FHAA 2QKIB 1LHZA 4G8FB 4L4OA 3SDAB 1NDGB 4QEGA 4NHCL 2FRGP 5BOZG 1HINL 4ZFFB 5BRQA 3D3VE 3GBNH 2BX5A 3WS3B 4HPYH 2V2XA 3RAJL 2Y7QA 1UR4A 4BH7B 5CBEB 1KXHA 3SPVA 4QRTA 4ERSH 1CGWA 3VWKD 3KHOA 4AIOA 4DGIL 3VFUA 3WL9A 1E15A 4UQ3B 3TBYA 3UTZA 3ZDXF 2FEDD 4NQXB 2DWDB 4WNQB 4HZAA 1MHCB 4BM7A 2D20A 3BKCL 3KPLA 5I1KH 3UCRA 3KPSB 1FIEA 3S88H 1S7QB 1TZHB 2VDPH 1T0NA 4MQTB 2DH3A 5EU5B 2CERA 3DROA 4P4KB 5CG0A 3A6BL 5HHOD 1PZ5A 4YR6B 43C9A 1VEMA 1JBJA 1GCYA 3SN6N 1KXVA 1CD9B 2NW3B 4HF5H 1YEJL 4M00A 4MNQE 3BOVA 4OZGA 2D0GA 4HJJL 3AHZA 3U0WH 1N59B 3O41A 2NT0A 1T3FA 1MCQA 5K9JL 5E9AA 3CFEB 1YUHA 1IM9A 1U8PB 3ZTNH 1BQHG 2WIIB 3WFEH 3UTOA 1QVOA 1O7VA 4HC1L 3F7VB 3IJHA 4G43A 1R5WB 3QFDA 2WKLA 1PBYA 2ORBL 1ISXA 5CP3H 3O2VH 3SCQA 4LLYA 2JEPA 5BOPA 5EC2A 4PPTA 3CFBB 4L4PA 4Q2ZA 5A6AA 2DTML 3D5OF 4PJ9B 4FQCH 4OGAC 1MVFA 1OP5H 4YE4L 4ODBD 5F1IA 2CHOA 1ZXQA 1GGYA 5F9JB 3VDBA 4UZUA 2H26A 2QQKL 1DANU 4KVCH 4PRDA 2ZX8A 4CCEA 2ZSVB 4MB4A 1SYSB 4NOBA 1UUQA 1KUMA 3DO3A 1U30A 4I18B 4YC2B 5JXEC 4ZTOH 1CXEA 2WP3O 4GQ9L 4Y4FB 4L3CB 1HZHL 5IFPA 1OP5K 3MFFB 4POYA 2EDNA 2R2HB 2J7CA 1A5FL 5FYKH 1B0IA 4NZUH 4XNMA 3S8WA 1X6NA 2F19H 3OAZH 4OFVA 4ZUSB 3DGGB 1CBGA 3AM8C 4OZFG 3WEMA 4W88A 5HYSA 4OTXL 3SE8L 1UWXH 2B0SH 5I0ZA 1QW8A 3ZDXE 1YEFH 3Q2CA 2PYEB 1N64L 5HHOE 3MJ6A 5BXTA 3D2UB 3GSVB 1H11A 2J77A 3ARED 4I0CC 3VXUA 5HDQL 1ITBB 1RJZB 2APWA 3F5WB 4G80A 2DSZA 1FP9A 4X4YA 3OAZK 2KQNA 3RY6C 1TUXA 5A6LA 3QHTC 4WSJA 2FWOA 2BVYA 5ALCL 4GG6A 4IM4A 1SJHA 2VXQH 3BZDA 1OIFA 4C7DA 4F9LA 3OF6D 4UT6L 1C91A 4BFEA 4ZFOL 5F3BB 4IJ3C 1FORH 4MQ7B 3QISA 3MOBL 3BVNA 3I9GL 5LXGL 1OLLA 4HU0A 3LRGA 3QULA 2PUQT 2E7LA 3E2HB 4W6YB 2PXYB 3JWOH 4K7FA 1WIOA 4PP1D 1RUMH 4XH2B 3RGVC 3W0KA 2A9ML 3W0WA 1A1MB 4XNQB 2XZQH 1K8DA 2SEBA 4JRXD 5C09D 3TZVD 4JDZA 1WGOA 3D9AH 3EYVA 3MMEB 3EIFA 1SVZA 3LB6D 4K94L 1FYTD 1EVUA 3S36H 1MQRA 4LMQI 4JJ5B 2FDBP 2OSYA 1G94A 1FH7A 1YPZF 2EDDA 5TDPA 4L3ED 2DN7A 2IAMB 5SWSA 4OLXL 5TDNB 3C9NA 1ZGLB 3NIDF 4EDXB 1KJVA 3PWPA 4G6ML 2C4FT 4FQ2L 4NNXA 4OIBA 1V7NL 3P0GB 3P77B 5FUZL 4ZDHA 2NY6C 4XNYL 5E70A 1EO8H 1ZLVK 2DLHA 4JQXC 4NC1C 4PJAB 1A64A 3DBXB 4WY7L 2R0ZH 4W81A 1JV5B 2NY4B 4V27A 2VX4A 4OCMC 3EW3B 3MRFB 4AEHL 1LNUA 3QCTH 2JFEX 5FKAA 4NHCH 1NQBA 1G6RH 1ROWA 1TVNA 2GK0B 5D2NC 4YXKL 4JFDD 1U36A 3CFJA 2BJMH 3PZVA 2BC4A 3FO2B 4X7TB 3TONA 4X6EA 3NCYP 4KJQD 4DGIH 5TF0A 1NMCC 4LEOB 5J0BA 2KKQA 3HZMB 1GPOL 1M4KA 3HZKA 4PY8J 4HWBL 2FHCA 1EXUB 1QOKA 4JRXE 5C09E 1FL5B 2E6JA 1X5XA 5I1CL 2P5EA 3BGFC 3OV6A 3CLEL 1HILB 4GLRH 4OLZH 4R96A 2XSAA 4FP8L 5HYQA 3C60D 3SKUD 2DRUA 1FYTE 3FTGB 5HVGB 3RWIA 4P3CL 1M01A 2K9UA 5TE6L 5IOPA 2VXVL 1U58B 4L3EE 1QFHA 2NTFA 4GJTB 1HOCA 3MOQA 1OAZL 1TA3A 2GEEA 4L29A 1E3ZA 5C0NC 4PY7B 4HKBB 3NACL 2K7PA 1U93B 3WMSA 4P7NA 3V7MA 4LGPB 1QBLH 3UPRB 4B9YA 2CBIA 3FT4B 4LF3A 4UOQA 2H3NB 4WO4D 1PX3A 4R27A 4KQ4L 3RDTB 2Y5TA 3PIQB 1OCQA 1AO7D 4MA3A 4PGCB 4TVSa 3VFVB 1C1EL 5DTFB 3P40A 1TJHL 2GTWA 4AD3A 5MEOB 1RY7B 5E6ID 5GNXA 2BMKA 1QSFB 1BFNA 4GKZA 3MUZ1 4JFDE 4PD4K 1BGAA 4PTXA 3HNSH 3MLSH 3L1OL 4G7VH 2D7TL 3KJ4C 3W4RA 4H25A 2FNBA 2PR4H 4DAGL 4JM2F 3B3IA 4U6VL 4JAMB 2NCMA 4TPRH 3V4PH 3MCG1 5ADPH 4GQ9H 4X6FA 1GNXA 1N5AB 3SY0A 4OZIE 1BG4A 2Q7YB 1UH3A 1ORQA 4HKXA 4E41B 3CCHB 4QHMA 2CJUL 3O6MH 4OTXH 3SE8H 2HJLB 1MIMH 1BX2A 3UJTL 4HG4K 2ITCB 5JDSA 15C8H 3GJFH 1XR9A 4P4RB 1RZJL 4OGYL 2J7BA 5KW9L 3SDCA 4D6GA 2G5RA 3MRGB 5HYJD 3RUGB 2F54B 3DSFH 1QFWH 3VCLA 1FG2A 3L5HA 4MXQC 2OBGA 1C12A 1VA9A 3OKLA 3RWDB 1HHGB 5ALCH 1NQ6A 2YJQA 1S9VB 1KEML 3CVHB 4UT6H 2PO6B 5BVPH 3TNMB 1C7TA 3GJFK 4PV8A 5GGSB 3RZCC 2X4TA 1B4JL 4NO2B 1ZT4A 3T0EC 2GJJA 4A3YA 5I18L 5D7IB 5IB5A 4WU5B 2V2TB 1VBUA 1AO7E 4QHLA 3AMDA 3DRTA 3WQ6A 4LFHD 4AZ5A 2A6JB 3EYOB 4CD7A 4C7FA 1PLGL 1QA9B 3V0WH 4YDKH 3S5LG 4Y4HB 3CD4A 4FLQA 1NLBL 4XPHL 3C5JA 2DMKA 2DQEL 5F7DB 4RZCB 1KIQA 4QXTB 1R3IH 3L4VA 4WSKA 5TE4H 5F89A 3QUMB 2X4UB 5GS1C 4U4BA 2O93L 5DT1L 3EOTL 1GORA 4M24A 1NFDB 3BI9X 4N8CL 2JF6A 3HS0A 4L8DA 4OZHF 4U6HB 1T83C 4BFIB 5E03A 5E08H 3LMJL 2GT9B 2PW2A 3FB8A 3NFNB 4PJEB 3TC9A 4G6MH 5A2BA 2P7TA 3KYMB 1DBJL 5F7EH 4GXVL 1CXKA 5F9WC 4FQ2H 4AD4A 5IBLC 4AEIL 1QO3B 1V7NH 3CUPB 4PB0H 5D7JD 2ZUTA 1V0MA 1P6AB 4XNYH 4MNGA 1ONQB 2FH8A 5FOOA 1OAXH 3IFNH 5C0DA 2LAGB 4PJFF 5C0BD 3VE0B 3F12B 4DFHA 2GQHA 2MKWA 4NO0B 5HYJE 3L7EB 3E3QC 2RHEA 3SBWC 5FXCH 4LYPA 2OYPA 2GJPA 3QPXL 7TAAA 4FZEL 4QRUA 4L3AA 1KWKA 1K9TA 3QG7H 3O4LB 4LHQB 4KGLA 2H2SC 4OCXL 4YXKH 1GPFA