2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords MAN26A
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
4RMSA 3SCTA 4BQ5A 1DDHA 3WXVH 4ZS6D 5FOBB 4MDOA 2CKBA 2DM3A 1S5IH 1S5HA 3S5LA 2FB4H 1QFWM 3L7EA 4XCNA 4ALAH 5A2CA 5BXFA 1I7ZB 1EZVX 5IFHL 3RHWF 5TDNA 4N8VA 3UBXG 2EYTA 5E9DE 1AIFA 1KWGA 4E0RB 3O6FA 4AMCA 1LP9A 4FMKA 4P2YA 3FO0L 5FB8A 5H2BB 3MRRA 5GS0D 4EK7A 1MHPH 2ZSWB 4HZAA 2Z91B 5D6CB 4M7LH 1V08A 4FFVC 1NGZA 3FFDA 5KVMC 4HZLB 3LKOA 3TZVB 1ZGLP 5HGHB 4P2RD 2DQIH 1QQDB 2J4WL 1AQHA 2B0SH 5I1KH 4X6CE 4RGOH 1N59B 3C5SA 5FV2A 4JFTA 4OJYA 1QO3A 3RWJB 4Z7WF 2EYSB 4GS7C 4PJ9C 1CGUA 4HEPG 3VFUB 2VZVA 4MVBD 4C7FA 4JREB 4E0RA 1A47A 4U7SA 1RZGA 4MCYB 4JFFA 3RIAK 3D0LA 3FRUA 4ONFL 3QHTC 3PZGA 5EMYA 5C0DA 1FQ9C 4R4FL 4EZMA 4HHAA 2QADC 5DA0B 2FX9H 4DWHA 1IM3A 4KK5C 2OWCA 1MPAH 2FX8H 4O5LL 5IB2B 2H1PH 4PY8I 4FQCH 3WYRA 1HJVA 2WWKT 3RQ3A 5CLWA 4M7ZC 2G41A 1YEIL 5IFHH 1LO0H 4G5ZL 3WLBB 5CP7B 5MEOA 4OCMC 5FF6A 4P2RA 4YHKH 4UILL 1JNLH 4X7DC 2LU3A 4PJGE 3MLPA 3K80A 4M00A 4WUUB 2VZOA 3X11A 2Z93B 1IV8A 2WAGA 3WBEA 2DKSA 4GW5A 3I02B 4HUUB 2I25N 3G5XA 1LEGB 4W7UA 2A1WL 4QLJA 3IGAB 1FHDA 2NTFB 4RAVB 1N0LA 2EPLX 3SGDH 4X7TA 3MREA 1AI1H 2V7HA 4D2NA 2CLVB 1TVHA 4MB5A 3AHXA 4OOZA 2XG4A 2QL1A 5IWLA 1YYML 3TGXA 3OKNA 2X1PA 2UY7A 4D3CH 3MU7A 5D5MF 1J1PH 2VR5A 2PB1A 5A40E 3L3GB 3GJFK 4P2OD 2W0PA 2D7MA 3MRFA 4HGKC 4Y8DC 2ZXBA 3F7PC 5HHOD 2PTUA 3BUYB 1B2YA 4E41B 5TDPB 3N1PC 2F8QA 3PWPA 5EUOF 3MCLL 4OCRL 4WFFE 3VIGA 3HPJB 2ORBH 5D1QD 3W5NA 5DVKA 3QUYC 1SEBA 3WJLA 1T4KA 4BH7B 4WCYL 3MANA 4LNRB 1GXEA 5I75B 1XEDA 2H26A 2ICCA 2BSRB 5JTWA 3GSXB 2IFFL 2CGRH 3D0VB 3W29A 1GZJA 4LBEA 3TT1H 1V0MA 4EVNB 4NO3A 1D2KA 5FDWA 3F7VB 1FFPB 1E9LA 1FO0A 3UTSB 3VFGH 3EJJX 4U6XA 2F9BT 1DBAL 5JBEA 1RSFA 4KJYA 1C90A 2GJ6D 3IVKA 3BAEL 4MWFA 1CS6A 2VNCA 3NIDF 4HUWA 4FK9A 1MFUA 4L3EE 4ZODA 2E8YA 3AAZA 4BFIA 4U1NA 12E8H 5FKAA 1NGPH 5MP6L 3NDZA 3PZ9A 5J11B 3R8BB 2K7PA 3SHSA 3K2UL 3OR6A 1OP3H 4Y4HD 1NDGB 1JPSL 1LDPH 4D9RE 1S8DB 5KSAD 4N1EA 4AIOA 3TPKA 4I48B 1OP3K 3E6HA 4QYOB 4QXUH 2W9DL 2DSZA 4LQFH 3BDYL 4N0RA 3V4VL 1QI5A 1WEJH 3I2CL 3KXFE 2FATH 3QWOA 2AJXL 2Y6SC 4LMQE 1KN4L 3WEZA 4MA7L 1FGNH 1GC1L 4M8QA 1OD9A 1VGKB 3FB8B 5A3IC 4HV8B 2HLAA 2DGAA 4MXQD 5BROA 4NWTL 1KB9K 4UAOB 3DX9B 1U3HC 3MYJB 4NI3A 3SURA 4Y16B 5GNXA 2JJVA 2PCPA 3GKWH 3TA9A 5GQBA 5J1AA 1A3LH 3GXMA 1IGFH 4F7TA 1L6XA 1V6WA 2XZAL 5B8CA 2NT1A 5I78A 4XCEB 3RAJL 4DM2A 1WZKA 4HUXB 2J75A 1UXSB 1F97A 1G0CA 4JANA 4RZCB 5DD0H 2A6IA 1MF2H 2CUMA 1DL7L 1JV5A 3OKNB 2W60B 5GHWH 1IGTA 5C0JB 2WYSA 3WE6A 1TG7A 3MNWA 5E8NA 3TO4D 3UJTL 2ZUNA 1O7VA 2EIDA 2MQ0A 4QHKJ 5FCUH 4Y4HC 3R4DA 1E6OL 3Q5YA 5C08B 4I5BA 1WFOA 4MAYA 1FA2A 4PJ7E 1ZB5A 1BIIB 3AHYA 5IGXL 4D0BB 4Q6IB 3DHUA 5CAYB 2DRUA 4KJPC 3BD4A 1UG9A 1IKNC 3KPPB 2PYED 4LPUA 1A3HA 3O45B 4LOUD 5HDOA 3NSNA 2ZXAA 3WE6B 1NLDL 1RJZB 3EDFA 2VOTA 1ZA3B 4IBLT 4P2RB 3KG5A 3X14A 1MJ7L 5KVGH 3PNWA 4OLXH 3H9ZA 3BZ4A 1TJHL 3BEVA 1HKIA 4YN5A 3QXDB 5LXGH 1CT8B 1ZTXL 4V1DA 2W65A 2XN9D 4K2UH 1MQPA 5FFLA 3OAYK 1H5BC 5ADOH 4I4WB 4L8SC 5GRXG 2V5RA 4M43L 4GO6B 3ECBB 2DH3A 2ID5A 3DECA 4CD4A 1J9CT 3O6FC 4XWOD 4F8QA 3N1GC 4WFEE 1UM5L 3QIBD 2HFFB 3QULA 2DS4A 4W93A 1AFVH 1G9MC 1BEYH 1X6NA 1T1YB 5EDXA 5FO7A 5BQ7A 3LV3A 1W3KA 3N1AA 3WO4C 4FQLH 4Z78B 1ZGLM 1OCWL 3AREA 5I1AA 3EOBA 1KIRA 1JHKH 4O9HH 4WSKA 2Z0BA 3RX5A 4HPGA 4UDTB 3B2VL 4BA0A 1I3GL 5F96H 3PV7A 3PL6B 3H6JA 3PZTA 4UIKH 4LCWD 3STZA 1S9XB 4PJIA 4JJ5B 1UWXK 1UKTA 3LEXB 3BGAA 2CKNA 1QBLH 5B38A 4HCRA 4YX2L 1BFTA 2XG5A 3BW9A 1A9BB 3GSQB 2X4NA 3ULVC 3ARGB 4QXWA 4H2CA 1CLYL 3NZHL 2XVKA 2A9NH 3O6LH 4NUJA 1I1AC 1A0QL 5D72H 1M6OA 2CH8A 1EV2E 3SCMA 4MA1B 1TFHA 3MLRL 4C4KT 2YL5A 1U6AL 4BFBD 1DQQB 7CGTA 1SJXA 1G7HA 2J6EH 4APQB 1CICC 2G3NA 4LSRH 2VLLA 4B3LA 1OAUL 1NARA 2VO5A 4LSUH 3BH4A 4URIA 3PGFL 3U7VA 3O4LE 1IAII 3TV3L 1QA9A 5EIIA 4XP5L 3JSSA 4LYPA 1TVNA 1EAPA 4WY7L 5AZ2L 5CWSA 4PGDB 5FECB 5CIPH 5JLZB 3QDJD 2OWWA 1LEKB 4G7VH 1E0OB 4C56E 3PABB 3KL0A 4LSVH 2Z91A 3DUSB 1C7SA 1RZFH 2VDKL 3SJVE 1EDTA 3PHQA 4DN4L 4GG6A 3TH4T 1I7TA 1FZKB 4OZFB 4TQEH 5ANMA 2ESVE 4XXDB 1T5XA 4OM1H 1P1ZA 4Q6IC 3TCXA 1QHOA 4I0PA 4LCUB 2WWCA 1RURL 4NZDA 1J8HA 1HEZA 5CCKL 3SJVD 1HYSC 3BXNB 2HISA 5JHDD 2RIKA 4MXVE 4AD0A 4GRLB 5EU4B 3ALPA 1DVFC 2IBGA 4ODSL 4OD3H 3V52H 3N18A 5BXTA 5GZOC 3MLTB 3WO3B 1KTRL 4PJDF 4CDGC 3DVNA 3HRZA 4IMKA 5DJ0A 1A64A 5E1AA 4UTBL 1DWFM 4OCWH 4HCRL 5LCVL 3QWQB 4Y7MA 1I8IB 1BPVA 4I4WA 3RNQA 5KSAB 4OQ1A 4Y2DA 4KHTH 1L7TL 1PVHA 1N6QH 3ETBF 3FB5A 2VE6A 3O2WL 4HX1A 4Q9RH 1Q9OA 4M24A 3MRMA 5EU6D 4PJHE 2PW2A 4M7ZB 2QLYA 1IAOA 3WNKA 1MCWW 3NZ8A 2B8OT 1AXIB 5C0BE 1HXYB 3RNQB 4K7PH 4LPWA 2BOBA 3WD0A 4NZTH 1WV7T 5HYIA 4YH6A 3ZE2F 3HMXH 4JRYD 4M1GL 4NWUL 3SDDA 1WT5A 1ZBWA 2AJUL 4JGJA 1I3RA 4TUKH 4NBZB 4PMNA 2C9AA 3RKDC 3QXTA 4M61B 4Z7VE 1CL7I 2X9WA 4X8JB 1Q6FA 2D24A 1K9TA 5DD3H 4I9WD 1CL7H 3MMUA 2BMKB 4F9JA 2G3IA 4GBXB 2J7DA 3W11D 4DWSD 3QQ3A 4LBEB 2J4GA 1TMQA 1F58H 4QHMA 4Y1AE 1EJOH 2J7FA 3POCA 3D87B 5A6BD 3WUEA 3CPLA 4FTVE 2AP2A 5DHVB 1ZLVH 3F4VA 1QPXA 2IG2L 1OINA 4W4OA 3VGEA 5BS0B 3QT2A 5KOVC 3WSUA 1WLHA 2WUCL 1RH9A 1HE7A 3DURA 2R1YA 2R8SH 4LLQB 4N0CC 2N56A 3NUKA 5GGSB 1PSKH 1U8JA 3SQOH 2VQ1A 2XYLA 3G5ZB 3GM0A 3TA3A 2PKDA 2WQRA 3GMOB 2V2XA 4OLXL 3CVHA 1J8HE 4I3RH 1E6NA 3K2MC 2BNRE 2L7UA 3NCMA 5E9DB 3FAXA 3MRCA 4KMTH 5GZNC 5TQ2L 4PREA 3IDMA 2CLZA 4KI5F 4YHZL 3U7WL 1Q9LA 1QNZL 3B83A 5GRYA 3O41A 5JQ6H 2C3XA 2PBGA 4R9HA 4BM7A 1HEZB 1UD3A 3GMPA 1SJHA 2VCBA 3GK8L 1QSEE 3NAAL 3OXSB 4QRRB 5HVHB 1T7YA 3GSUB 2HKFL 5GGSA 3VFMA 2EIEA 2YPVH 1KTDB 1KJ2A 3MRBA 2JK5B 2VUYA 1U91B 2X4TB 4TOYH 3HE7A 3WUZA 5FUOH 4LP5A 3T4AB 1DWJM 4TRPH 2R1XB 1A6TB 3ZDXE 3RWJA 4GKNB 4P7QA 1JGDA 4YXHL 3DMMD 2VXTH 4BZ1H 5CMAA 4M1CC 4LYRA 2QF8A 1T5WA 4P5TC 4R7DA 1QRNB 1E3XA 3AIWA 1PJ9A 5A95A 5BRZA 4KI5D 5FA3B 3CU1A 3P11H 3SCWA 1ERNA 3VD7A 4P2QD 3W6MA 3KGRA 4BKLA 4OZFA 4OUUB 2UY3A 4OQTH 2EJ1A 2FLRT 3LEVH 1CI5A 1WEJL 4XMPL 3RWGA 2V38A 4EAMA 2OTWA 4HQQL 5JXAL 5L7XL 5D93C 1GOKA 3BDYH 1FHLA 3C5ZB 1U2HA 4UI2A 3LPWA 2QHRL 1C5BH 4HXAH 3IAQA 5DGQA 1OWQA 5K33A 2GUYA 5FYLE 5H35B 2KZ1B 2X4OB 3CDYA 5FUCE 3HE7C 1DE4B 4JY4A 1MI5B 3F58L 4NNXB 4LSQL 3TYGH 3RHWK 1QLFA 3N15A 4OF5A 2ICWJ 3JWDH 1JMZA 3VGAB 3GNPA 1AGBA 2BHYA 3S2CA 2CITA 2WW5A 3GSWA 1CLZH 3OBAA 1UWEL 4K8RC 2X05A 4P3DB 3WV0A 2V7HB 3HHRB 5D8ZA 5SWQA 3ARBC 4Y5YB 1TA3A 4N42A 1HJXA 3G08A 3RWGB 1I7UA 4DVRH 3TBYB 4M48L 5JDSB 4K7FA 2MCPH 2WCSA 3OAYH 5F7HA 2CCRA 4D8PA 2J8GA 3LV3B 1QOKA 1MJ7H 4MB4A 4PJ9A 3O8XB 1K2DA 2WNGA 4J6RH 4J3VA 4PD4J 2FD6L 3X3FL 3AS0A 3HC4H 4GO8A 3LQMA 3SGJC 1J8KA 3I84A 3VOCA 1NBQA 4V1DD 4ACPA 4Z7NF 3VFTB 2HFGL 4I18C 3TZVD 3BI9X 1NFDF 1FV1A 5FYLL 4MSWA 2D0FA 4HWZB 5GS0L 2WVUA 3QIBA 1HXMA 2EDLA 3RL2B 4KV5E 4TX8A 4KZEH 4XNZB 2C4FU 1EO8H 1J1OL 3SCMD 3PWJA 3VWJD 1XFPA 2YD5A 4YR6B 4G6FB 1XF1A 2OJZL 4H8HA 4WVRA 2UZYB 3VXNA 1YNKH 1QNRA 4MSWB 4XMKL 2V3GA 2YPLD 2GKIA 2WHJA 1BBJB 4IM8A 3H3KA 5DMGD 1XGTB 4X6DE 5D5MA 1G0XA 3OR7A 1D5ZA 1D6EA 2JB5H 3HZKA 3VFSB 4H41A 4HZLA 5CJ5A 3KWWA 5BZWA 5DT1H 4QF1A 4QWWD 4JRYA 4CVXB 3TC9A 5CEYA 3EUUA 5CEZD 5MHSD 4ZNEA 5K9QG 4W8BA 3G6LA 4L5FL 1W72L 1KBKA 3VGBA 4U1LB 3Q48A 3ARYA 1K6QH 4MA3A 4YHKL 5HJ3A 2F8VA 1AHWC 3DIFB 3MLWL 1YEHH 4NO0B 2YC1A 1HVXA 2EEDA 1JRHH 3O11A 4HPYH 3GIVA 2X4NB 2CPCA 4W68A 1CFBA 1RZ8B 1E27B 4JM4H 2V2TA 2NY2C 1U8PA 2DTMH 1F2XK 5C07E 2XN9A 2B5IC 2DIAA 5GIRB 3C6SB 4F80A 4WI4A 2CK2A 3V6BR 2Y8KA 4P7OA 5BS0D 3BIAX 1Z0MA 4YO0A 2OYPA 1FFNA 4OF8A 1NGQH 4XPBH 3SQBA 5BW7A 4N0FB 4FLSA 4CU6A 4MAYB 1MXDA 4F7TB 3O4LB 1KENH 2HMIC 3CAFA 1F00I 2ZX7A 5E6IC 3HZYB 2GTWB 3FNDA 1YC7A 1ACZA 1F5WA 3KE0A 3RCNA 5D71L 4Z7WA 3EDDA 1T1WB 1MHPL 4RZCA 2J88H 4QCIB 2WMHA 4JKMA 4L4JA 2PO6A 1A1OA 2VDNH 5IT2H 3MRPA 4PLOB 2AS5M 1T1XA 1GL4B 3MODH 5C0IA 1U41A 1WITA 5DRNA 1FIEA 4J4PD 2XTLA 2ZUYA 3SE3C 2PXYC 2DSWA 4ZXBB 3VXRB 3BSHA 4XPGL 1JFXA 3MLXL 1BBDL 5D7JB 1PW3A 3SUTA 1X6LA 1J87A 2EDTA 1P1ZB 2ESVB 3NFSL 1KGUA 3G04B 1QVOB 3TJHD 5C0GB 4NO3B 1UKSA 2EKSB 3MUJA 3QPXL 2CO7B 2WINB 1A02N 4JHOA 1HH9A 2JIXB 2Q87A 2WSKA 3U9PH 1ZHKA 5ACLA 4LCCB 4ENEC 4MWFB 1DJSA 3EMQA 2ICEA 3WIFA 3WL0A 3GJFH 4M1DL 4XAKD 1OP5K 1NM9A 4HS3B 5IMOB 2K9UA 2XQBH 4P48A 4QTHA 2FJGA 3D85A 1SR0A 1MUJA 2IC2A 3ZKQD 4JZJA 2X2YA 3WDJA 2E7HA 3C6LA 4XPHH 2CETA 2Q76B 4Y4KA 1ND0B 1Q1JH 4YNYA 3G9VA 1GAFH 1PY4A 2FEDC 4OIBA 4MJ2A 2UVEA 5DJ2A 3LQAL 1CVRA 4FZ8H 3SDDC 1OTTC 1XD1A 4XBGB 1JGLH 4JHZA 5LCVH 3UTZA 4PJEE 2HFEA 5DJDA 1EEUA 3W0WB 1R3IL 5BO1H 1Q38A 3GMLA 1WISA 2B2XL 5HHPB 3WH6A 4P2OA 1VGKA 4JFHE 5JIIA 1AD9B 3QDAA 3BH8B 1ND0A 4BF7A 1T7WA 2YUXA 3CPLB 1FNEA 5I66A 3HS0A 5EZJA 2MHAB 3AS3A 4HA1A 1U8KB 4OLZH 1YECL 1BFSA 4FQXC 2XUCA 5JW3L 2ZOLA 5HHQB 2LQRA 1UH3A 5F8RC 4IRJD 1W1PA 1MLBA 3FONB 4NC2B 4IIQC 3EYPA 4OGYH 2GITB 1SYSA 4R0LB 4MNQD 4PTVA 4NQDD 4XVSL 4P8UA 2V2XB 2R9HD 2YD4A 3MCKA 4CKQA 3KL5A 4PJ8B 2D9CA 5EA0H 2O93L 3NIGF 1E0VA 3AYRA 3D9AH 3L4UA 2P1YA 1MCSA 3V6OE 3LEXA 3MACH 4NQCB 4JFZH 4XCFL 4P4KA 1D5XA 1GCYA 3IAPA 1JUFA 2FRGP 3GXIA 1BZ9A 1TLKA 4RGNC 4NC1C 5SWZA 1YJDL 2NCMA 3QHOA 4HWNA 3MJGX 3H8NA 2WVTA 3BWAA 2EQDA 2VZUA 4L9DA 1DN0B 1URLA 3BKML 3MJ9A 2NX5E 3E0GA 1UENA 2ZCHH 4HJJH 4LEXH 2X09A 3JWOL 4Z76A 2C1OB 5FO8A 5I23A 1MWOA 4BFEA 1RUQL 1B2WL 3LKSB 4OIIH 1HKJA 3VWKC 3LN4B 4OI8A 2DWEB 2X9YA 1L0QA 5INCA 2P5WD 3QEGL 1GW1A 1QLEH 1M7DA 3FAWA 1FFNB 4F7MB 5M7QA 4CVZA 5CILL 3B9KC 1UEYA 3QEUA 2NTSP 3VIJA 2DQCL 4ODXA 4GFTB 4L3EB 1MFVA 3PL6D 1TDQA 3VM5A 3SN6N 3HI5H 4YE4L 1OCWH 3IF1A 5T3XE 1QHZA 1AGFA 1V0LA 4TUFA 2AK1L 2DWEA 5E00A 1KLFA 4P0DA 4PS4H 5FGBC 4HKXA 4YHML 4JKPL 1OARL 1IL1A 2NY4B 1ODAA 2I5YH 4PRAB 4EXKA 1MAKA 5A2JH 4WEMB 2CESA 3RL1A 4LCCC 5KSUB 4XGZB 2Z93A 2G3JA 1XGUA 1YA5A 3N12A 1F13A 4RGNE 2OJEA 5ETUA 2R0WH 3JV4A 4PJDB 3OB8A 2V3DA 1RU9L 5C0CB 1HSBB 5CPTA 4J3TA 1M05A 4OOUA 4C54A 2AV1B 3IDUA 5A2KH 5L88H 4YDLC 3L2LA 1RFDH 5BWFA 2Y06L 3GH5A 2ZKHL 3DJ9A 5EH1A 3L4TA 3TTYA 1GAFL 3CX5K 4BS0A 4Z2KA 5K9JH 4G3YL 5J9PA 1I4FA 4XNYH 2RR3A 4UQ2A 2AJYL 1FL3B 5IIEB 4G6AD 1EZVY 3LKRB 2Z31A 3VD3A 3PABA 4U1GC 4U1HB 2I5YL 2IALB 3HUJE 2QLVB 1W8OA 4HIXL 3A6CH 3TN0D 3F65A 5HVHC 1WTLA 4WFGD 3QUZD 1BTCA 4OZ4A 3ROOA 3SOBH 4YE4H 5I8CA 3RTQA 3OLEA 2BSRA 3MBXH 1LVEA 3T04D 2APVA 1RUQH 1U95B 1CD1A 2DQHL 3TBVB 1HKLL 3LKQB 5I16B 3VX1A 1K6AA 3NSMA 1SVZA 1PYWB 2F54A 4ZO8A 3UCQA 1ZWIA 3CIVA 1WFTA 4RE3A 4XB3A 3FQUB 5JIHA 4X80H 3RL2A 3IJYB 3NFNA 2FATL 2X4SB 3SDCC 3IANA 1XIWA 3BGMB 3SGEI 1IGJA 3BKMH 4LQFL 3QUMH 1BHGA 3KZSA 5INCB 1U58A 2J88L 5FDWB 3H0TB 1MWAA 1XGZA 4ODVL 4RMVA 4Q9BA 1AY1H 1XGPA 1C5DA 5ID1B 2CRIA 3LEYH 1AE6H 3V8CA 1T0NB 3OR7B 3DBXA 2WZIA 1TIUA 4S3JA 2BNQB 3ET9F 1KACB 2YSSB 1MCNA 2VYRE 4HFWB 1A2YB 1OTSC 4M6OL 3NPSB 4JFXA 2ZUUA 1BAFH 4MDIB 3BQUB 4Y2DC 4IHOA 2ZUVA 3KPOB 2V7NA 4P49A 5SWZB 5IHBA 2DQUH 4QNPF 2VH5H 5GSVB 2HT2D 2YKKA 3FO1A 4LAQH 1MHEA 3AFBA 4YFLF 3MLVL 1LD9A 1EXUA 1T7VA 1XV8A 2YEZB 3F5JA 4PMVA 4YDVA 2A83A 4GAGH 1DQLL 4UT7L 1X5FA 1KCUL 4HEME 4ZAKA 5EZOH 1KIPA 4PMDA 1KPUA 2V2WA 4ETQA 1GZPA 1TVHB 4DZ8B 1VRXA 3C5ZA 3CXHJ 2R1XA 2Z92A 2XJ7A 4R96A 3LKSA 3EO9L 3GMQA 2WWKO 4G80A 5T1LA 1JHLH 4PMUA 1H8NA 3M6DA 1UKOA 2DI9A 4FLQA 2R0ZH 1WDSA 3BO8A 4PJCE 1GJWA 3FOMA 3IDNB 2OZ4H 3ME0A 4X5LA 4HMEA 5DUML 1TA3B 2VL5A 1OW0A 4WNQB 4GXPA 4AIZA 1B0GB 4U1GB 1ORQB 1FC1A 3M7SA 4E8CA 3ZHLA 5E8PA 3BRGC 5L2KB 3O81A 3MNZA 3BSZH 3V9FA 3AI0A 3O8XA 3WNOA 5T1MB 3M1BB 1VA9A 3RUGA 4NHCH 3C2AH 3GJEA 2HLFD 1NFDB 3RIKA 4GI6A 2LTQC 2V3EA 1FBIL 4KJYB 4I2XA 2B4CH 1AO7B 5SV3A 3QEQB 5BZDA 3AFLA 1MFEH 5E7BA 3N06B 4PBVC 3ZLQC 3QA3A 4PRBB 2DM4A 1NFKA 4GAJL 4KTYA 5F88B 3SDAC 5D2NE 1V0NA 5I8CB 3D0VA 5DJZB 4JY5H 2X89A 5D7LE 2X1QA 3O6KL 2ARWA 1DQLH 2HT4D 3DVGB 4UT7H 3O9NA 1I85C 2YN3A 1YYLH 1UJ3A 3BH8A 1T3FB 1NPUA 3VWKA 3C8KA 3OGSA 4NQVA 5CBEA 1IC7L 1JF1A 4YJZL 5C8BB 5FUZH 2DOCA 2DYPB 3SDAA 2O5XH 3PP4L 4ENED 3I6KB 4TVPL 1X4XA 3IFNL 1E4WL 1JNEA 1I1AA 2DQDH 1T5WB 3P73A 3GBLA 1WPCA 5KVFL 1R5IB 1JP5A 3OZ9H 1FZMA 1UWXH 3LEYL 5EC2A 4MAZA 5GS1C 5F21B 4PY7A 4O2FB 1C92A 4GG8B 4L4OA 4AENA 4M7LL 3THMH 3ISWA 1PZ5B 1J0HA 5E9DA 5GRUL 2Y5TB 3RGVB 4FQHB 4F2MA 4EUPA 3DRTB 3QUYA 1Y18B 1FVCB 4K55A 5FO8B 4MD5B 4ZPVA 1W72H 1PZ3A 2NY1C 1OGAD 4L8CA 3VI3F 3ARBD 2P5EE 4BSWB 4N0UE 2YBUA 3QZWB 2R2HA 4PJDE 3BZDA 2PC8A 1TVBA 4FNLL 4PLKD 3WQ5A 4I3SL 4UQ3B 5IHUL 1JN6A 1FNSH 4GMSH 3RRQA 1OIMA 4PJ8A 2HTKC 3VGGA 4LYQA 3QXWA 2C4XA 3RA7L 1P7KA 3UX9B 4MJID 3CBWA 2DLHA 3F7YA 3VFOA 2LE9A 4I13B 4O2EA 4ZUSB 1UG6A 4LLUA 5C0IB 2QQNL 4MD5A 5FYJD 4AZ7A 4EI5A 5I74B 5IB1B 4FFZH 3OAZK 1BZ7A 3I9GL 5EUKB 1W0VA 4PG2A 4QOKE 3TO2A 4N0FA 3VRJA 2PR4H 2DWDA 4U49A 1FZOA 4W6XB 4YHEA 2GSIB 4WNQA 3O6ML 4JPVH 4L8SB 1E6QM 1TJGL 3QJHB 1OVZA 4UFMA 5CZXD 3RWHA 4IRZL 1FCCA 2UWEB 4WFHE 1II4E 1ECEA 4ZUWB 2GJ6B 4WKHA 4ZQKB 1U8IA 2NW3B 4BJLA 4ODTL 1ZK9A 3UTZB 3AS2A 2IPTH 1EEZB 4PRPD 4QT5A 4KVCH 3MRIA 5IBTH 3RU8L 1WWAX 4PGBB 3LSOA 4NQEE 1NFDA 4XP6L 3P40A 2GSJA 4J6RL 4AEHL 5DTFA 5HVWA 3RVUC 5LKNA 4XC1H 5IF0A 1H3PH 4S10A 5HGAB 2K3TA 4APQA 1O7AA 2WUBH 4HG4K 5T1MA 3WS3A 4RBPH 5IMOA 4QY8B 4UV7H 3T08A 4H26A 3JWDL 2AJUH 2DSUA 3MC0A 5EOCJ 4DGVL 1C3FA 4NOFA 1QLRB 3ZJ6A 2GTZA 3CFJA 1H5BA 2P42B 1UR9A 5C07B 4DAGL 4CCEA 1QLEL 3FQRA 2BOCA 4XT1C 4P4RA 5C08D 2R29H 1QSZA 3GNRA 2V3FA 4UIMB 1MCFA 3TNNA 5A16B 1OBAA 3WDPP 1GGTA 3H42H 3W0WA 3L95A 1A7OL 1VSCA 3E6FA 4Y19D 4JB9H 2Y72A 4GXUM 3HR6A 4DOHB 3RTQB 1LQ0A 5HGDA 4W86A 4X5WB 3SEPA 5BRZE 1KEML 4Y7EA 5IBUB 4AW7A 4J12A 4LIQE 3WN5A 3QAZC 3VFPB 4H26B 2NY6C 4FZEL 1MEXL 2R4SL 1JZ3A 2MOVA 5DVNA 1TMCB 3EZ8A 2R0KH 3SDXA 3EYQD 2YK1H 3ZHKA 3CFKB 4L1HA 4NKIH 2DBJA 1YEDA 1DANT 5FYKD 5HHNB 4WTZA 2WIIB 2BVEA 4R3SB 2PYEB 4QRUB 2Y07L 4X6DB 3ARDB 3VWJC 2QPUA 3W53A 1AO7D 4M03A 4TRPL 4X6EB 3PZMA 5BYWA 1R3KB 3NGBC 1FSKB 5A3HA 3L3KA 2ZICA 3WN5C 1QBMH 3QO1A 2D31A 5F44A 1MJ8H 4Y4KD 3HI6H 4LDOB 4N1HB 1HZHL 1U8QA 3GXDA 1B0IA 1CICA 3CIQA 3ULVD 2WBWB 1FGVH 3V5HB 4YUEL 3W4RA 4XP4L 5HYSG 1LNUA 1YDPB 1FIGH 3SO3B 3V7AG 4NBXB 2GK1A 1BQLL 2YXMA 3KPRD 5IW6A 5DQDL 3U30B 3ARFC 1NDMA 4XPTH 5GGUB 5DVMA 5AZ2H 1AKJA 2VXQL 4ZUUB 3ARDA 3B6SA 7FABH 5ACZA 4DN4H 4BUGA 5AYUH 1R3KA 4LLVA 4D0CA 4PJAE 1TQBC 4R2GB 2PTTB 3AOFA 5EO1B 3RJXA 3MRIB 4U7KA 5SWSE 5E94B 1OTTD 3OG4B 5C0AE 3SUSA 3GMRA 2EC8A 3RP1A 3VI4E 3RDTB 1INEL 2J8HA 4ACYA 3VUPA 4FTVA 3OPZH 1XGYL 4Y88A 1GUVA 3F7YB 3VFOB 4UDTA 4ZG1A 3S34L 2EDHA 3CFBB 1ODZA 4Y1AA 1E4XL 3AMLA 4LSRL 3R0NA 4Q58C 2D7QA 4RFEA 3T0WA 1MEXH 5DURB 1R0AH 1MWAH 2WBGA 1V7ML 3REWB 1CR9L 3RIFK 2RHEA 4P23C 5FB8B 4ZXOA 4GMTH 1XF3B 1D9KB 3L3OB 4W70A 5C0AD 2WBJC 2J5LB 4DW2H 5MERA 5T1KD 4K7PL 4GW1B 3MROB 1QBLL 1K4CA 1HSAA 2JJSA 2VSDA 4OZ4B 3ROOB 5J1TC 5E5RB 3T2OA 2VXUL 1A7NL 2HT2C 3TA3D 3QIUC 4IDJH 1KC5H 3CHDA 2ADGA 4FXKB 3KDMA 4DN3H 1L7TH 4DGVH 5GNYA 1BF8A 5ADPH 3B5GA 3ALFA 5E0CA 2ADFL 4Q2ZB 5IF0B 6FABL 3U46A 3Q1SH 5HGAA 4Z7OE 4ZE4A 4WWKD 5DD1H 4PJFB 1FNGB 3CVIH 3U9UA 1I7UB 4J3WA 3JTSA 4F7PA 1M53A 3C8KB 2J25A 2DL2A 5C0JA 4HWEH 2OX5A 3T0EB 4HCRH 1INEH 2BVYA 4DWSB 2VKXA 3P0VL 4NO5A 4BQ3A 3CJJA 2YD2A 5M94B 5HVFB 4KRPD 3FQTA 3GMMB 3GZAA 4IRSB 4M6AA 3CXDH 1YEJH 1F6AB 2FO4B 1UACH 1R5VA 3CDGA 2W0FB 4Z8FL 3RILA 1YEFH 4AWEA 4F2MB 4P5KB 5BCAA 5JW4Q 3SUVA 3RGVC 2IH1A 2OL3B 1RZFL 2EXYD 2B20A 4MNGA 4NUGL 4WWID 2C1OA 1IM9D 1UD8A 5DDHA 4F7CB 1K9DA 2FZ3B 1UWUA 3AIBA 5IVXE 3L4ZA 1JRHL 1BQHG 5BOZG 3WUWB 3UTTD 2W65B 3GTNA 1F02I 5B3NA 2KH2B 4I1NB 4BYHA 1NCCL 3L5WA 4QRQA 4EBQL 3QRFM 1G6RL 1AQKH 1FRGH 5SWSD 4GZEA 4XPFL 3U2SA 2Y1VA 5JW4R 4RMUA 3VIPA 3BAXA 3P4LA 2H6PA 1TXKA 2MJWA 1DSFL 2YA1A 5FOJA 4JPWL 4A3YA 4XMLH 1NFIB 2FIKA 5IJKC 4NRZA 3U7BA 4LSUL 4IRJC 2J7GA 3O6FD 3S35X 4K3JL 4ZDHB 4OLWL 4D6EA 2Q6WA 1ZEAL 1FGNL 1GC1H 3MS8A 1U91A 2R0KL 5LGJA 1NWUA 1CFQB 2F5AH 2GHWB 1A0QH 5JZ7C 1YMHA 3QUYB 1CLXA 1KN4H 4NT6B 1W8NA 1B0WA 3GI8L 2ZCKH 5CEZE 1IFHL 4HUXA 4YHLH 2LTQB 3IU4L 4ODUA 5KBNC 3VXSE 1NBYB 2E4TA 3OWEA 5DC9B 1KPVB 3CZGA 4HHAB 1S7WA 5EWIL 3ARGA 3TJEH 1BEYL 4EN3B 1BYCA 2ZP0T 2L4OA 1UH2A 5EBAA 1TTUA 1HJQA 1OGGA 3REWA 1W9UA 2EDEA 1FE8L 3BT2L 3WKMH 3CDCA 3BD5A 4ELKA 4P9HC 4MJ6A 4OV6F 4WKFA 1K8IA 2DLFL 1A9EB 1WBYA 2QQKH 2XWEA 4YWGL 1NSNL 4KKCD 3ARZA 5JPMB 1K3IA 1T03H 4WTZG 2SEBB 1AFVL 4L4VA 1W9XA 5DF0A 1M4KA 4M48H 4OI9A 4LLWA 3PWVA 3BKYH 5JOPE 1KF9B 5CEZH 2XWTB 4UTAL 2FR4A 1Q9LB 4FQXD 2HTKD 4XPTL 2NY4C 1P6WA 32C2B 1KLUA 5C3LD 2FSEA 2CGRL 1BFOA 5HDBF 4I2XB 3MRGA 5C0BD 4QHLB 1KPRA 1F90H 3ARRA 3P4MA 4X7FC 3RY6C 4KVCL 4G42B 4Z7UB 1WBXB 3V0AC 4Y4FD 1KCLA 5HJ3B 5LGHH 3JTTA 3KHOA 2FDMA 1VENA 4K3EH 5I2UA 5IEKB 4J8RA 2J7CA 1D9KC 5DS8A 3BIBX 2UWEF 3ARGC 3UDWA 5F7YC 4YNYB 3UO1H 5I8OL 1ZU8A 1J1PL 1Z9SA 4RGNB 3QQ9C 4LSTH 3PJSA 3DNKA 4MHHG 2R2BB 4UBDC 4N68A 5GGQH 1T21B 2EO7A 4XNQB 2W67A 4Q22A 1N7ML 3M1BA 3C5ZD 5JUVA 3UTSA 3IJSA 4CADA 1ZS8B 1OAQL 3SCVA 4LPYA 1JD7A 3OAZH 1N82A 4MAVA 5I1IH 3QOKA 2ATPA 1J0JA 1HP5A 3S88L 1XSIA 4LFHG 4LNRA 3HE6C 5DRZA 3MXWL 3TH2T 2E7CA 5C08A 3SUUA 3UPRA 1JDCA 2A77L 5HHNA 1KJVA 3KJ4B 4LGRB 1DLFH 5C0AB 1E6ZA 1B4JH 1UWQA 2VKWA 4P4KC 3CFIC 1A1OB 3SKJH 2APWA 5HYJA 4PJAB 4JB9L 4M5YL 5I17A 1A6UL 1YEIH 2ZX9A 2BVTA 2EH8H 5FUOL 3CDFA 3A3HA 2FECL 3H42L 4GRWH 1QOXA 2AJZA 4LK4A 5EZLA 2YPVL 1JNLL 4MQ7B 5BV7L 2FX9L 3UZVB 4YDVB 4P5TB 3ZIZA 3SCMC 3QDJE 3AVEA 1F45A 4ZNCD 1BYDA 1RZ8A 4UU9A 1HDMB 2A9MH 4ZOCA 3UERA 3UBXB 4OIAA 3EAKA 1Q72L 3BN3B 3KPPA 4JQVC 1FPTH 1U8LA 4P7LA 4XCYB 1M7XA 5E24E 5IR1B 1AJ7H 4WI7A 3VILA 4XP1L 4PGJA 2ZXDA 3VFMB 3QWRD 4RA0C 2DQIL 1FORH 3VWJB 1UFUA 1YEKH 2QJDA 3GSNH 2PYEE 4WI2A 3QDMD 1XF2B 5IHZA 2XTJC 4OF0A 5JA9A 3DV6B 1BFNA 4PJ5E 1WF5A 1WC7A 3W37A 2E40A 4NQCA 1A3QA 1INDH 2VLRD 4GW4A 3TBTA 2PXYB 1P7QA 5L9DL 4JAWA 3EOTH 2Z35A 3UBXA 3D25B 5FEBA 4P4KD 4Y5XC 3QO1B 4RMWA 3P77B 5HYQB 3BP6A 1EBAA 5F3BA 2ZUSA 5KSBF 4X0KB 4X9IA 2QKIB 4MJ5B 2DN7A 4OZFG 1S5IL 4PPTA 3WF0A 1SY6L 1VADB 3ZT6A 4UAOC 3VMOA 2X70A 4P3WA 4JQVA 3WMSA 3TEUA 2WWMD 3P4MB 2GJ6A 3K4AA 5MEQA 1BG9A 3BAJA 5TDOB 4R26L 4HGWA 4QXGH 3BE1L 6TAAA 1EJ6A 4G6AC 3HG1D 2PWGA 1ISVA 2Y36L 3RMEA 5DR5H 3C5JB 4WU7A 3VD5A 2WWDA 5C0ND 1YY9D 1OAKL 3KYNB 3KPLA 4GUPA 4HUVA 2ENYA 3LN5A 3PXJA 4KRNA 1NGYA 4ZFFB 1XGQB 5KW9L 1EOKA 4YDJB 2ZX5A 3ZJ7A 1P2CA 3IJSB 4NJAH 3VDBA 2OR9L 1R3HA 2X4RA 3NCYP 5FA4A 3D5OF 4P4RB 4HK0A 3AMGA 3T0VA 2H2SD 4IRJA 2X4TA 5C2BH 5I30H 1GCFA 2FJFA 4KY1H 3A6CL 3HMWH 4HIXH 1FP5A 3EYSL 5DS8B 4NRYB 1ZT1A 4KFZC 1I75A 5CBAB 5BRZB 3SDXE 1E1FA 2GYSA 4HC1H 4W8AA 2NY3C 1VEMA 3O3DB 3AJ7A 1RD6A 1CLOL 1ZMYA 4IPLA 2NZ9C 3P0GB 4UT6L 1SYSB 2NY1D 1BFOB 2BX5A 3H9SA 4IJ3C 4WHDA 3HNSL 4JJ5A 4LVEA 1NLBH 5ICZA 3UETA 4F3FB 4FQ1H 4EXPX 3MRDB 4DGIL 4PRID 1MFBH 5AWNL 5A6SA 3RWCB 2OLDA 4X4YA 3L5XL 1KN2H 3OZ9L 5H35A 4M93B 5ANME 4PMYA 1KULA 1FVCA 1RURH 4WUUA 1CQYA 2DQUL 1OTSD 2FX7H 2W60A 1H3UA 1CENA 5K9OB 3ZDXF 2JIXD 2MANA 2WBJD 4XNMB 4BQBA 3VG0L 5EU4A 5I1EH 2HH0H 4PUDA 1PX4A 3L5JA 2VH5L 3N17A 4OB5H 2ZOLB 4P5TA 5C6WH 2XTJB 5HHQA 4UQ9A 5HI5C 1S7UA 4FQIL 1AY1L 5A43C 3AICA 4IOFD 1GHFL 1KBGH 4QNPE 3OIHA 4PJCF 1AR2A 5GGTH 3RPKA 4MNLA 3AGVA 4Y16C 2K7QA 2ZX6A 3MSGA 5C86A 1Q72H 5I1CL 4JZNA 1QSFB 3GSOB 3O3EA 3OX8B 3WFDL 4PP2B 4XBEH 3O45A 4ZXLA 1OSEA 5CGYC 4QRRA 3FL7A 2AXHA 4ZQKA 4PG2C 2P5WE 4XB8A 3U4EB 1PBGA 1VCAA 4ZS7L 2N4IA 1I9IL 5JR1H 4MX7A 1ZHKB 4NNYB 3FN3A 4Z76B 1T0NA 3CUJA 3KLHC 3NH7L 2JJSC 2PTVA 2R1WB 3ALXA 5B4MD 5KN5A 4JG1L 4NDMA 1A6UH 2VDMH 4RDQF 5ICYA 1QEWB 4G8EB 2FJGB 3D85B 4OT1H 2ED9A 5JBFA 1NGWB 4YXKH 2FDBP 2AKRB 1B4RA 5DUBA 3TP4A 4BUHA 4ZNEE 1OGAA 5JO5A 3CC5B 1GC1C 1MQKH 2O9PA 4H88H 2VN4A 3BSZL 2FHBA 5HI3D 2QKIA 3C2SA 1UEMA 5F96L 5IV2B 1LE5A 4J3SA 2GJJA 5AD0A 4HWBA 2NY5H 1LK2A 1MJJA 4L8DA 2O61A 5JUEH 4L4TB 5GS0C 3G5ZA 4RGND 3K4DA 1NAML 2IMNA 1ADQA 1UJ3C 2E7MA 2VDOL 3EKCA 4JKWA 2ZJSL 3OG6B 5GGQL 4KDTA 1OSPL 3VFSA 4OV5A 4PTUB 5EU7E 1DUZA 3RPIA 3LDBB 2Y06H 2FNBA 2EC9U 3OKLB 4PJDA 2C3GA 2ENSA 4PRHD 3WSQH 1I8IA 1Y6MR 4N8CH 1ZBVA 1Q0YL 4N90D 5C09A 2F5BL 3QDJB 5E2TH 4GINA 1RVFL 4LHUB 4YHIA 4OGAC 3IB4A 5EZOL 3SBWC 1KCUH 1E27A 1P7HL 1E6SM 1FNHA 1Q0YH 1EQCA 4PLJD 5KG9B 3VIKA 2IWGA 1MCPH 1EEYB 3KJ6H 3RWIA 5IMKB 3VA2C 4Q0XH 3F7RA 5BXFB 3ZTNH 5J7CC 2CKBH 3P9WB 1KPVA 4NQCD 3UPAA 4QOKB 5BRPA 3L5HA 3IFLL 1NWSA 5IQ9A 4Z5RA 3AIRA 3Q2CA 3Q5OA 4NP4H 3GMMA 3WNPA 3CFDB 1WCQA 1R3IH 3L4WA 4OAWA 4M02A 3LHPH 3QDGA 4ZMAT 2R2EB 5A69A 1NAMH 1A7QL 3EJYC 1BAFL 1M01A 3WKML 2J77A 1UD2A 1QRKA 5JUEL 3V7MA 2XPKA 3D3AA 3WO4B 4K94H 4YK4B 1H41A 3T0XA 2NXYB 1OSPH 3JV5A 1NMAH 5DD0L 5CJQL 2ZJSH 3QXAA 2ZUWA 4NQEB 5GISH 5AG8A 5A94A 1Q6CA 1JPTH 2F53D 3MR9B 2M8XA 1FLTX 1DBJL 1UB6A 4YDKH 5EU6E 5FCZA 3IDJB 2F15A 5J56B 2ZUTA 4NQUA 4ODBD 1MFCL 3WLBA 2E9BA 2VVNA 5BOPA 4M82A 3P0YH 4M6NL 4PP2A 2ED8A 3C09B 3NA9H 3VI3E 4RISH 4NWTH 3BP5B 1BVKA 2F5AL 3FZUC 1CG9A 5A2FA 4KKBC 3ZTJG 1KPUB 3BAKA 1BQCA 2ESCA 2OTWB 2EDDA 3CFEA 3E6FB 3QCVL 4ODWB 3AXXA 2AAVA 3DMMA 3EYOA 3MBXL 4AL8L 2JKXA 4HOZA 3VFUA 2DT3A 4R5EA 2JJWA 3QUKB 4BQ9A 4HW6A 4XNMA 3C60D 1I1XA 3AXLA 3B3IB 1RUKL 3MA9H 5B4MC 1C08A 2XQYG 2ZG3A 1T6VN 2OSLB 4J1UA 1P9MC 3ROLA 3F5KA 4GS7B 35C8H 4PJ9B 3MODL 4Z77A 5I1LA 1C16A 3WUGA 2XZQH 1QG3A 5DRZB 1I8LC 2BFVL 1GZPB 3NN8A 4PV9A 3IGAA 3MV9B 3SE8H 1XH0A 5IEHB 2NY1B 4WW2C 1ZHBA 2NQCA 5KS9A 4WFED 1JPTL 1EDQA 4JHWL 4UDUA 1A6WH 3LHPL 3O2DH 1NC2B 3PWNB 1Q0XH 4E5XA 2A3CA 3WBDA 1I1CA 4H8WL 2D4FA 5ERWA 3VFNB 4AY1A 4GH7B 2OL3H 3FO1B 1Q9KA 5MEOB 1MY7A 1Q8MA 3HE7B 2BXZA 4P2OB 1L8NA 2AW2A 4WO4C 3IS1X 3KJ6L 3DX6A 1UZ8B 3P9LB 3CMGA 1KTKE 4JFOB 4Y4HA 5F7DA 1T66D 1BOGB 2GFTA 5DEFB 1TZGH 3DETC 4MD0B 4AIXA 5KTEL 3D6GA 1RK1A 3BQUD 3HNSH 2ZNXA 5JW3H 3W9DB 3P30H 4JRXE 2PXYA 1CEOA 3GBNH 4AMKL 2JIWA 4HPHA 3VJ6A 5AWNH 3MLWH 5L6YH 1Q6DA 3OHXA 3PWPE 1CLOH 1EAJA 2R56H 4HAFA 1F8TH 2DJ4A 4LHJB 1A9BA 5ERWB 3VFNA 2OM5A 1NLBL 3OV6A 4P46D 4QF1B 4LVHB 3TYFA 1ZKAA 1KLUB 4PRIB 3GNMH 1BX2B 4Z0XB 4L5FH 1Q6GA 5EBLA 2FECI 4RQQB 4C4KO 5C2BL 1GOHA 4X9GA 2ZOXA 1U93B 3FN9A 1LL4A 2GAZB 4FXGA 4HC1L 2IPKB 4G9FE 5HHVH 4YK4C 5DQJA 1DWAM 2IUZA 4D3CL 3ILQD 2H32B 2AEWA 5F97E 4ZFGH 4ZE5A 3MLZL 3A6BL 1QLFB 3HAEH 4D9LH 4PJHA 4TVPE 3U9PL 4QT5B 4GLRH 2BVQA 4MJ5A 1EGJL 3MV7D 3QWOB 2OR7A 1FZOB 1VESA 3ARFA 5KW9H 4ATDA 2PW1A 4K71C 4G8IB 3QR3A 3BPOC 4H88L 3DARA 5DRWB 4U6TA 1N0XH 5E2WH 2AI0H 3AIUA 5DJXA 5GRVL 3TO4C 4HU8A 1DVFA 4U0RB 3IXAA 4XPGH 5C0AA 1A4JA 5K9KA 5KSBB 1Z3GL 5F7UA 2DLGA 4XXCA 2X4QB 5I6XC 3U7YL 5ESAB 1MCEA 1HNFA 3NGBB 5J1SC 1XSKA 1NC4B 3U57A 3B8YA 3V0WH 4P46C 1OB0A 1MPAL 2FX8L 1US3A 3HC4L 1UC6A 4YGVB 5L2KE 3X11B 2WWMC 1ZVSB 3NIGE 1FAKT 2FHFA 4QLRA 1MI5D 1MSPA 2D0GA 2LABA 2VISB 5I8KH 3ZKMC 1KENL 4WJXA 4Y5VB 4M56A 1RJLA 4YXLL 2OYKA 3ILQC 4H8WC 1K3ZA 4XCEA 3LZFL 1I1AB 4GXVL 4LHUD 4XX6A 4NQDE 4NNPH 5JMOC 4XGZA 4XNUL 3NTCL 2X4OA 4U1KB 3BP4A 1BQLH 4NKOB 4OFYA 1G1YA 1J9YA 2R4RH 1BREA 4G8GE 1CDUA 3HKFA 5E09A 2A9ML 4ZPTA 3S4SB 3MV8B 2YPLB 5T3ZE 5LA2A 3UYPA 1A6ZA 1IQWH 1TVDA 3S36X 5C0CE 4KI1A 1KT2A 1MJ8L 4N9OB 3U83A 1HHJB 3SDCB 3HLAA 1CGYA 3CD4A 1HHGA 5DI8B 2BNRB 3BDXA 4HPYL 1VKXA 4KKCC 4KAQH 2VZTA 3LMJH 3INUH 3VXQA 5DWUH 3DETD 3Q0HA 5BV7H 2XM1A 1S7VB 1WDQA 4LRNH 4JL1A 1N26A 1A22B 4J2XA 4GRWF 5HHMD 2X1XR 5J1AB 4ZD3H 1UADC 4WO4B 5BXPA 5JW4N 1U3YA 1G7JA 3V7AE 1TZHB 1PX3A 3RGVD 3OLDA 1PG7H 3DV4B 5EFDA 3GJEB 2D3VA 5DJCB 1YNKL 5TH2A 1I8MB 5C92A 4HZ8A 3GB7B 3GI9H 3ORJA 4AZHA 1N7MH 2VLKD 5DI8A 3WIHH 4Z7UA 3CMOH 5DEZA 1AH1A 3PIQB 4QHKI 3TIEA 2AKRA 2MKWA 3WS6A 5DRXB 3TESA 2DDQL 1S7QA 3DO3A 2VDQH 3NACL 1PKQA 5CP3A 5C09D 1E4NA 2X4UA 3ZR6A 2R29L 1UR0A 1UH4A 4EVNA 1YUHB 1UD6A 3NAAH 4KRMB 2FR4B 3GK8H 4CD8A 3CX2A 4AYSA 1FP9A 1RZKH 2CKSA 4NQED 5JORA 2F53B 3TIEB 4MNKA 2Y5EA 4CKVX 4MS8C 1ZT1B 4N5EC 2XPGB 5CBAA 2WINA 3HUJA 5GS0H 1FN4A 1T2QH 2XKUA 4PRPA 1I8MA 2C7UB 1NAMA 2W63A 4UNIA 4P3CL 5I19L 5I24A 1E6JH 5CGYD 4WWKC 1PG7W 4BQ6A 5D7JA 4F79A 5BVJB 5DK3A 2X8RA 1P2CB 4CNIA 3QI9C 3H9HB 3UTTE 2ZCLH 2FD6H 1VJZA 3FQNB 3EIFA 2YRZA 5DRWA 2ESVD 2ZG2A 2YUWA 2EH7H 1JYWA 4AZ8A 1TZ7A 5A6MA 2IBZY 3CFBA 5D4QA 1JI1A 4FTVD 1YNLL 5HHXH 4PYHA 3UZQA 3BZEA 2DSVA 4QEGA 5CJBA 2WIIA 4B53A 1CU4L 4OUEA 4N8VG 1N2RA 4RA3A 3QIWA 5D1ZD 3MGTA 1W3LA 5AC5A 4WIWA 2QHRH 2BY2A 4HKBA 5DJ8A 4NF7A 1UB5A 5LG1A 2ITDB 5MENA 3QPQD 4NM4L 5ALCH 2HTLC 1SHMA 3VXSA 1CGSL 2AXJA 1TNNA 4AD2A 4OQTL 4P9ML 5FYJE 1YEHL 3BP5A 3IU4H 3V5HA 3BW9B 1JGEA 5ANMB 1FZJB 3OGCB 4MNHA 3QNYA 2QSCL 1WBZB 1ZLWK 5I1JH 3M45A 2R2BA 1JGVL 4BSVB 3TTOA 4HMCA 1UYQA 4OM0L 1GOMA 5I9QC 1FVDB 2FH8A 1ITBB 4O51B 3FB5B 4RAVA 4OGAD 2VAAA 3P11L 2MWCA 3D39B 4PG9A 5B22A 1QFHA 1KCRL 3FT2A 3WJJA 4Z6AT 4KJWD 4R3SA 5CKAA 4TNWF 4M81A 5DVOA 4UQCA 2VXTL 4BZ1L 1P84K 2IH1B 2OL3A 3H2WA 3LOWA 2MCG1 3LMJL 1D6VL 2NNAB 1IAIH 5HVGB 3QAZB 5DQ9B 3TFKD 1OAZL 2DT1A 5FGRA 3FQTB 5D7IE 4EOWL 3V6ZA 5I1IL 2AJZB 2HKFH 3ARXA 3H3BC 3CUPA 3T2NL 2RFXA 1ZT7B 4QDMA 4KK6C 1BD2D 5IESL 4IIQB 1C16B 5GGTA 2Q86A 4ONOA 1X5AA 4ELMB 4TULH 3MXVL 4AYFA 3CXDL 4AD1A 1UZ1A 4WHTB 5IXEA 1HXMB 4I0PD 4UFKA 4TUOA 3V4PH 1KGCD 4YHZH 1UM6H 3ARDD 4NPYB 5IMLB 3ZQ9A 2XT1B 2G9HA 2O5XL 2I07B 2O5YH 2P49B 3QFJD 4DFHA 1P6AB 1YUHA 2MMXA 1JD9A 2LU7A 4PREB 1P4LB 3FZUD 2F74A 2GJXB 4C57C 3RVTD 1LK3H 3QWRA 3OZOA 1CE1H 1FHGA 3T77B 3V6OC 1K4CB 3BT2H 5HPMB 4AC1X 5EU7C 5T5NG 3RVWC 4NN7B 4AD4A 1S9KC 3OKKA 1IC5H 3VIOA 1CWYA 2XXCB 4TUJB 1M7IB 3BP6B 4PR5A 1KR0A 3BX7C 5D7LA 1M71B 3BZFB 3F8UB 2VABB 1F58L 1G9NC 1BOGA 3TM6A 5I5RA 3X12A 3VX0A 4XNZC 1U95A 1F4XH 1FBIH 1WCGA 4LLAA 3ZKXC 5IHSA 4DW2L 1A6AB 2BJML 3Q6GH 5T3XL 1BQSA 3N9GL 5I2IB 1RP8A 1F2QA 3W24A 5CHNB 5FAAA 5HI5D 2H32H 1I3UA 3RZCA 1GGUA 3IDXH 2XWJB 1HILB 3MV8E 4XWGH 3LS5H 1JHKL 4O9HL 1YMMD 4WGVB 5GJTL 5ISZA 3WD5H 5MI0B 4M3KB 3WQ8A 1R5VB 3CDGB 4H1LB 3HNVH 4LGXA 2W91A 5C09B 4JDVB 1NUNB 1NCTA 3CLEL 4O2CA 1VBRA 2WHKA 1GOOA 3RWEB 5E4IA 3OXRB 4OZIB 3CFEB 4GRWE 4IDLA 4ODWA 4N90E 4OKVB 3NABH 2DM7A 3RVWD 4PJBB 2BVQB 1JHLL 3GZKA 3KR3L 4I77H 4K3HA 4UMGA 4B7IA 3CLWA 2CIPA 3BOVA 3P3YA 1XR9B 3E3QC 3UTSE 4JO1L 4JY6A 3IK2A 3OXSA 3NFPB 1SBSL 3T65B 5JOEA 1OD8A 3JTSB 4F7PB 4IPNB 2XHYA 4LASH 3VH8G 4XX1G 3K46A 5E1AB 1NP0A 4HJ0C 5IOPB 1KYOJ 5B39G 5DFVC 3T0AA 4GSDL 5IEKA 5HI3C 3TN0A 1N3NB 1JZ4A 2WNWA 3DXAE 5KSBE 5E08H 1QBML 2W0LA 4OD2A 3TNMA 2J7BA 2AVGA 3BLPX 4YUEH 1AGFB 4K3GA 4WY7H 5EIQA 1I8LA 5HI4D 5INDB 3EZJB 2R2CA 1CFQA 1R5IA 3UTSD 1GRWA 1XCTB 3HB3C 3WFEH 1A1MB 2A6KB 3V0VB 5TE4H 4WENB 2X40A 5CSBA 3S37X 1FNLA 3MA9L 1R7AA 5J6HA 1IE5A 5F8QC 5JPMA 4XVTH 3MREB 5F9WB 2D22A 1DQJB 1BQHB 2VDRL 5F72S 1FFPA 5A1AA 3CVIL 1LO5A 5DD1L 3ZR5A 1E0XA 3VXQB 1QYGH 1HKMA 3UTTB 1DBMH 1BX2A 3DVFA 4Z0XA 2R4SH 3G5YB 5F88A 5EB8A 2VRKA 2YDSA 2Q1EA 4FQXA 5ADPL 2UUDK 2LU4A 4L4VD 1KEMH 1W2VA 2BMKA 2YOCA 3HS0B 4XHQA 3NA9L 4G6ML 4HUKB 1MHCB 3M17B 2DQHH 3HNTL 2BJMH 4M62H 1AP2A 7TAAA 1RIHH 1BJ1H 4WWKB 1KXQA 4PFEA 1H8SA 3AISA 5BZDB 1HHKB 3OR6B 3DSNA 1KJ2H 4KZDL 4DKEL 3KYOB 4EN3A 2AK4D 4JFFD 4PTTA 3GSQA 1RJYA 4NKMA 5IB4A 2VQ1B 1NMAL 4GMTL 4Y4FA 1J5OH 2XKSA 4PV8A 2XWDA 5FO9B 1HIML 5ALCL 4PJXB 4S2SA 1SMAA 1QZ1A 2EKJA 3NVQA 2R1YB 3JUGA 2EXWD 3QDME 5DT7A 5DLML 1RMFL 3KPMB 3NCOA 2FGWH 4KUZH 3MRHA 4CD6A 4U6XB 1BD2A 1RZKC 4KVNL 5D70H 5B38G 1QSVA 5CFHA 3DX7A 2DLEA 2DQJH 2W38A 4P99A 3S34H 3L3KB 4XVJL 1DBAH 5BJTB 2HG5B 1S9WA 5D8JH 5KVGL 5E6ID 4BH7A 2IPTL 4Q0XL 2VLJD 3MNVA 1GIGL 1XGRA 4ZPVB 2OK0L 2EPOA 4W4OC 5HNNA 3L3HA 3H3PL 5CPQA 5MENB 1UM4L 3CLFL 1WVZA 2FWOB 4JY6B 1PKOA 4TTDC 5IGXH 1KLGA 2R0WL 3O6MH 2A6IB 2VXQH 2XQYK 4MNGE 3MV9D 1V6VA 1I7ZA 4NRXB 4X0NA 3BRFA 3KJ4C 1MW0A 1YMME 3S97C 3UJTH 3U2SB 4XXDA 1NC2D 3WH8A 2ZUXA 4EOWH 3BCFA 4Q9QL 3CH1B 1TTGA 4R7DB 1R3JA 3L3IB 3QQ4A 3V4UL 1W32A 1I9RH 1UJTA 4PJHB 1RUML 1G6RA 1LD9B 4PRWA 2YPLA 1FNAA 4Y16D 1WCBA 4H8UA 5FCSH 1A3LL 3HTLX 4P46A 1HVQA 4Y1AB 2R23B 5H37H 4FLOA 3N13A 4AZIA 2WVVB 2Y07H 2I9TA 4I3SH 3QFJB 1D7FA 3FJTA 3S4SG 3MRNB 3BGFC 3HB3D 5AUMA 5C0GA 2ERJB 1XR9A 3SE4A 4MA7H 4QTHB 1FNSL 4GMSL 3QUXA 3MV8A 3CGTA 3MRKA 4RRPG 2F58L 4QXUL 5KZCB 4TTDD 2E9JA 5ENWB 4UZSA 1I8KA 3ULUH 1YMMB 3V2AR 4XV0A 3LB6D 4QFUA 3C5ZC 1IQDB 2FL5A 4RMQA 1WZAA 3C9NA 1T1WA 4WWKA 3CZLA 2NR6C 5DJAA 4E9LA 3V5DA 2WMJA 3QHMA 5IVXA 2J7LA 4JDZA 2VMFA 3STZB 3H7BA 1JNJA 2CBUA 5JNYB 3F12A 1EERB 3MUY1 1JWMB 3KLAA 2JALA 2VZ3A 3LN5B 1XF2A 4Z9KB 1KXVC 1PY9A 4M5ZH 4RE4A 3UTQB 2IALA 3UCRA 3C60A 5IUSA 1S7SA 4BK5A 1FH9A 1ZHBB 2OQJA 4WI8A 5KSAC 3EFDL 4WHTA 2EH7L 2YD3A 2PO6B 2J8OA 4KRUA 1INQA 4RGOL 5C0RH 3ECBA 2GK2A 4YXLH 1HHJA 4U1HA 1YNLH 5HHXL 1FYTE 2BOCB 3FQRB 5IM7A 2CXKA 3VNYA 4JY5L 4OCSH 2APTA 4TUJA 1A7PL 4X0KA 4YAQB 1CD0A 3MFFA 4D0CB 2FEEI 2G60L 4WIQA 1DN2A 5TDPA 3HFMH 1GSMA 1U9KA 3S37H 1JNHB 3L7EB 1XIWC 1OLZA 4WU5A 4NT6A 2EDQA 1A6AA 1H15B 3U36A 1C1EL 3A4WA 1JFQH 4CADB 5ICYB 4PBGA 4POZD 4Z7QF 2DMCA 3ARTA 5KEZA 2XA8H 4YBQC 1T2QL 3AQUA 1QSEA 3DUSA 2A0LC 1VGEL 4IRZH 3MUZ1 4FQ2H 1NCNA 2WBKA 2IQ9H 5D5MB 4MLIA 5MI0C 2RGSA 2PYEA 4QRUA 1OF2B 4OLUH 4PJBE 5HYFA 1T66C 1V05A 4D6GA 2A6JB 3GI9L 4U1LA 5EBLB 5F9AC 1MCCA 1F4HA 3KYAA 5GSRA 4HFWA 1K8IB 2XIDA 1PDKA 1JGEB 1XGPB 5ID1A 4BQCA 1S9XA 3QSKB 4OBSA 4PJIB 2WC7A 1FZMB 1CICB 3JWOC 3OXRA 4OZIA 1C12B 2E9WA 3QEUB 4WW2A 2JEPA 3UXFA 4DEPC 4MD4B 5E8EA 1NOFA 2VQUA 2ATKA 4LRNL 3RA7H 3FQNA 3RDTC 1UB5B 3CCHA 4H0HB 2DSKA 2YEZA 3S6CA 5F7WC 2FWOA 3UG3A 1KCSH 4FQCL 4JFFB 1L9MA 3AXIA 3LD8B 4GG6B 5A16A 3IT8D 2V5YA 4POZC 1WO2A 4X7CC 5IVXF 3PUCA 4S1DD 2NW2B 2DLTA 5EORH 4LSSL 5A2IH 3BRDA 4I18A 3SJVB 4GBXD 1J0ZA 1S9YA 2VLKB 4KC3B 12E8L 1BZ9B 4XNUH 3VMPA 4BQ4A 1LG2A 2HT3C 3WF4A 4R4FH 1AGEA 1AGBB 4NCDA 3CSBA 3MUHL 4MTVA 4S0SD 4JCMA 3OF6A 1MVFA 3RY4A 3QI9A 2BFGA 4JY4B 4L8BB 3BN9C 2NY3D 1CFNA 5DYOA 4URTB 3ZE0E 3GRWA 3TBYA 3IFNH 3WCYA 4AZ6A 1Q0XL 4DKFH 4O51A 3T09A 1FDLH 3TT1L 3D39E 3CSYA 2ADIA 3FRPG 3WS6C 1F3RB 3QUML 2F53A 2ARJB 3PNWB 4XC3H 4IS6B 1I1YB 3LSOB 4ZUWA 2F74B 4HJGB 3RBSA 4DTGH 2XWTA 3CUGA 3MMDA 2WXDM 3TN0B 3I6LD 4PRPE 2NY0C 3FMGL 1BGGA 1TZIB 2WK2A 2QEJA 1OY3B 1SEBB 3SDCA 1UCBL 4GAJH 4Y4FC 4LGSB 3OX8A 3RVVD 4L4VE 4OV5B 1WZ1H 1EEYA 3WIIL 4RFOL 4UZGA 4NHCL 1LO5B 1DLFL 1MRFH 4RAHA 5DSCA 3NCCB 4J1UB 1Q4NX 1GNXA 3MXWH 5DZOA 2VURA 2V5DA 1FJ1A 4XCNB 3V6ZB 2C3VB 3KPQB 4JDTL 5CUSL 4Z0BH 4M7KH 5F1NB 4G8FB 1ETZB 1FFRA 3LDBC 4GKZA 4R96B 1HX0A 3FB7B 4BQ2A 4GW4B 5EOCL 3PWUA 5KZCD 4IOSD 2NLJB 2NX5D 3QUZB 4DQOH 4XAWH 4Q9QH 1R24B 3FT4B 2X5PA 4JO2L 3O8XC 2Y4SA 4J3UA 1T7XA 5IFJA 2GCYB 1AC6A 4V2CB 5FYLH 4U1NB 1UXWB 1P5VA 1ITCA 3QHFL 1G9ML 4NFBA 1JYNA 1SJHB 2G5BA 1H0DA 4JM2A 3WH9A 5GJSH 5JORB 3D39D 3KXFA 4O5LH 2BHZA 4U3XA 3ES6B 4GG8A 1UWGL 3WMBA 4GJTB 1VEPA 4NN6B 2GCYA 4FQHA 1KTLA 5BS0A 2ADGB 1FZJA 3OGCA 2BY3A 3FFCA 1JDDA 3AHTA 3ALWA 4H7VA 4XVJH 4MXQC 2WKLA 5EU5A 1OSZA 5E2TL 1U3HD 1IM3B 4J3XA 3FHAA 2PN5A 5AZEH 4CVZB 2B1AL 2JCCA 4LVOB 5F6IB 5DLMH 4JLRB 2UWFA 2ZX8A 2ZNWA 5EB9A 3HI5L 3GHEL 4N5ED 3MYZA 3D3VE 1J18A 1DTUA 5F1IB 3S8WA 1U8HB 3BZEB 1NWTA 4WHYH 1NCAH 4NKDA 1XGRB 1QP1A 5TPWL 3O8XD 1IGMH 4UB0H 1NP2A 4LEOA 5CD5D 3BN9D 1MELA 3KPSB 4PMRA 2AJVL 4C56D 3LRSB 4G8IA 3LPPA 2DQCH 4UINL 3PHQB 5E5MB 1R5WB 2CSPA 4LSPH 5TQ0H 2IH3B 2BRRH 3BKCH 3GMRB 1XSJA 4EDWL 3QB7C 5TDOA 2QSTA 2JJTA 2F61A 3RWDB 4M7JL 4MLSA 4WI9A 4FQPA 3AS1A 2P24B 3OKDA 2UZIL 5DK0A 3BKCL 5BV7B 5JMRA 4D6FA 1WIUA 4RIRA 2CDGA 4X99B 5HYSA 1MCWM 4LPTA 4JKKA 5D1XB 3ZDZF 2WMFA 2AQ2A 3W5MA 4OF6A 2WM0A 4MJ4A 1CDYA 1JPFA 1S7XB 4GO9A 2EE2A 4JPIA 1WWWX 1WUNT 3D9AL 3FY1A 2VDLL 3DI2B 5TE6L 2Q8BH 5J3HD 1QI4A 4YDJA 1G6RH 4OGXH 1NCCH 4EBQH 4S1QH 5IFAH 3NPSC 3BAWA 1IGCH 1XYZA 1M03A 2LFGA 3GSNB 4FQIH 4PJGB 2OI9C 3E2HB 4XCYA 1T20B 4G6JH 4LLQA 1MREH 1JGIA 3OZPA 2Y2WA 1T4KB 5F9DC 4NSKA 2EDFA 2MTPA 4Y4HB 5F7DB 3U4EA 5ICZB 2HKHH 3MUGB 4XH2A 5KSVA 2WMIB 3K7UA 1J0IA 2B7DT 2VLME 4HLJA 4IMKC 3NIYA 1NC2A 4E5XB 5I74C 2JF6A 1UWRA 1JNHA 1F6LL 1FYTD 1GHRA 2UUDH 3QI9D 4AIZB 1BLNB 5DJYA 3ULSB 4JN1H 4N8CL 2A3AA 2PF6A 1QVBA 1Y6KR 2XSBA 4UFLA 3TPUB 2NY3B 4X6FB 3HI1A 2EC9T 2QR0A 2R8SL 1RJZA 1JBJA 4Z95H 1X5IA 1QRNE 1QNOA 4HT1H 4EI5C 1YPZA 2DICA 3W9EB 1CFSA 2HRLA 4RMRA 3CZFA 3QHFH 2XWJA 5TFSL 5JW5A 4JN2B 1RMFH 1UR4A 1IT9L 3VFPA 4IISA 5D2NA 2ZZUT 4TXEA 2BSED 2DQGL 1FH5H 1ZLSH 3C6SA 2QV4A 3E3QE 4XWGL 1UA6L 2WP3O 1WAAE 1PAMA 2CXGA 3EYSH 4OZHE 4ORGA 4EKXA 3SGKA 3VGAC 43C9B 2OTPA 4JFPA 4O02L 1VERA 3BPCA 2GT9B 4YXKL 1EHNA 4RFOH 1HWGB 2VDLH 5TE6H 4JO3H 1KTDA 3E1F1 4WUKL 4MQXC 3HE7D 3CHCA 3VXPB 2MQCA 3BKJL 2DF3A 4G6MH 3NFSH 1CR9H 4PJ9D 1LJYA 3MRPB 4WV1C 3VRLF 1QBBA 3DX9A 3M8OH 4JFXB 5LAXB 5KG9A 1JV5B 1MAMH 4C55A 1RULL 2VC2H 2X4QA 4K8RD 3ROLB 4N5UA 3QUYD 1AVAA 2HVJB 3WL1A 4YFEA 5BZWB 5D96B 3HZYA 3MSPA 4OI7A 1UCBH 3K3QA 3FCTA 3LIZL 2QADD 6CGTA 3W25A 4X4XB 1JCKA 3B9DA 5F9OH 4ZFOA 1X4ZA 1CTOA 2XVNA 1UVQA 4OAWB 3KLSA 4F9LC 2Y25A 1HJWA 1OM3L 4HS6A 4F7MA 4P46B 2E3VA 4XBPB 4XBEL 1OLLA 4P2QE 4APQC 4EN3D 4GAYA 2AK4A 3IJ7A 1WK0A 3ARSA 4LHQB 3T0EE 1G7JB 4CD7A 2HVKA 1HH6B 3W0KA 3MV9E 5GGTL 5C9JA 1QR1A 3GIVB 3DWTA 1C8QA 2Y9RT 3G5VB 5E00B 4R97B 4OBRA 5HYEA 2DQEL 3GMNB 3QBTB 4ODHL 1NCBL 2WZHA 5D1ZA 1GYAA 1TUXA 3FKUS 1DBKL 4XP4H 2AEPH 1QKZL 4LSSH 4XPBL 5ENWA 1UVQB 3C8DA 2Y5TA 2O5ZL 4JREC 1CK0L 3BZ4B 5CKGA 4CMMB 1F3DH 1PPIA 1BVNP 3WS3B 3JV4B 1BQUA 1JAKA 2DTML 4X8JA 3FHQA 1DFBH 2XRAL 4FFYH 3GB7A 4JO1H 1YNTA 3TWCL 3V5DB 1E5JA 3MJ7B 2DI7A 3U82B 4ZYKA 4NC0B 2MNUA 4LCIL 4HSQA 4D8PB 4PSPA 3WKZA 3MRNA 3VI4F 3KL3A 1UGNA 5DGRA 3NABL 1LO2L 3OL2A 3S9DB 1I8KB 4XPAL 4UOJA 3QUMA 3CLEH 2D20A 5FD0A 1MHHB 3V6FB 5ID0B 3DV4A 5DUPH 5I30L 1GONA 3SPVA 3SY0B 5T3ZH 2Q86B 2DQFA 1V3MA 4QXTB 5D9SA 5IWLC 5IHLB 1E4KC 1U8LB 2FO1A 1B3VA 4BSJA 3EYVB 4Y19B 3SCQA 1EVTC 5J4MA 4TSCL 4Y2DB 5DHVA 3HMWL 3WEOA 4A4AA 2ED7A 4WFFD 3POHA 5DJZA 4KROD 4NN5C 5FYJU 3I6KA 3VTRA 1IEBA 3HCVB 3QIWB 1NCWL 1W0VB 2DWDB 4M8UA 5A6BA 5FGBA 2VSCA 2MFNA 1IZKA 4TPRL 5D1XD 4RNRA 3Q6GL 5T3XH 1PX8A 1DLHA 4HIJB 1EO8L 2IQ9L 5E8DL 4FQQA 1SY6H 3WIIH 3EYVA 5EZJB 1Y0LB 1KSRA 3KYKH 4KKBD 2RGLA 2G60H 1L7IH 4K23H 3QOMA 1E4XI 1C8PA 1LP9E 1EA9C 4Y5VA 4X5XA 1CXEA 1RUPH 3RDKA 2I60L 5GSRB 4S2SB 3I3BA 1VF8A 3BUTA 1CYGA 3PHOB 4AT6A 2D7TH 1JTOA 1NCDH 4ATWA 2VDPH 4HG4J 5DFTA 1FL6B 5JOFB 4L29B 4JM2B 3L5WB 1UWEH 4QRQB 1EO7A 1NAMB 1RIUH 2DQXA 3MRBB 5C09E 3F5LA 1AR1C 2H8PB 1FFOB 3MBEB 4M1CD 4FXLA 2VDNL 4NFDA 4L4TE 5F7EH 4AZGA 3KAAA 1Z5LB 2XOTA 2PNDA 3TVMD 3U7AA 1I7RB 3MA7B 3EO0B 4PJHF 4R2GD 4YQXH 3DRQB 4PB9H 2AAAA 3EFDH 1KJMB 2G4FA 3VO0A 2E7BA 1P9MA 4WSJA 1W9DM 5FM5M 3N85L 1YMHB 4JEGB 2EXWC 4ZO9A 1GORA 1MFDL 4ZAKD 5DK2A 5FGSA 3CFDA 5FA3A 4NZUH 2CBVA 3LEVL 4A6YB 3ZJKA 4H20H 4JZOA 4DUWA 3BAYA 5HPCA 5EPMA 4NNYA 4TSAH 1XR8B 2EE6A 4YHLL 4FN0A 2QSVA 5JPNB 4KJQC 4TUOB 2EH8L 3QP3A 5D7JC 3CMOL 4RGMC 4LAJH 1ISWA 1HCVA 2P5WB 4O00A 2EZ0D 2IPUG 3WUWG 4U1MA 3ZO0A 1RIVL 1RZJH 1ZE3C 2AABH 3ILPA 5D1QC 1G7LA 3SDDD 1F4WH 1R3LA 5GGRY 3OKEA 4ML4A 5SX4H 4NCC2 5JNYA 4PRIA 4CBPA 4M80A 4JQIH 1YN6A 2R69H 1LILA 3JUYA 3FFDB 4RQQA 1X7QA 4I0CC 1X5KA 3DGCR 4UNVA 1H3GA 4MB3A 2KDGA 4PJFE 4K3DL 3OJ2C 3I6LE 5J9PB 1RHHB 1DP0A 4F8TA 2A77H 2OJZH 1K2DB 1DSFH 4OD2B 5CD3A 5ECUA 2X70B 3MOAL 4LLYA 3D39A 3W39B 3B6SB 5HGGS 2WBJB 5L2JA 2E27H 3DGGB 3QIBC 1E4MM 3QXUA 3OJVC 1EEZA 1VHPA 1KJ3L 3S5LB 1MCRA 4NO2A 2CDEA 4HK0B 5BVPH 1D5IH 2VQTA 3SDYL 3C6LB 4ELME 5C0CA 5DYOB 3KPNA 4EIZC 2GK0A 3GSVB 5I1HL 1U3HA 1LEIB 3UO1L 1QNZH 3WNMA 1NGPL 4NUGH 1AKJD 2LVCA 4N0YH 4KRLB 5D2LB 1M7IA 3N04A 2HJFA 2Y23A 5D1XC 2BP3A 3HC0B 3T8XB 1DEEB 5EBWB 4QRRD 3KLAB 4NRYA 5FYKH 3KWXA 2HRPL 3W9EA 2XFRA 1D5MA 1EFXA 5AYBA 1UM4H 3CLFH 2YKLH 3CUFA 4LCYA 4YR6A 3T77A 3IXTB 5B3JE 2OK0H 4PB9L 1DLHB 1NSNH 2NMSA 1YHTA 2FGWL 1FL3A 2FZ3A 1KJVB 5IIEA 3CSPA 3GO1H 1A8JH 4Z7WE 3X17A 3DYPA 5DJYB 3ULSA 3HC0A 3T8XA 3TIDB 1GGBL 3QJFB 2IANE 3TYGL 1ZLUK 2RB8A 3RZCB 3BP4B 4NZCA 4M8VA 15C8L 4U3AA 4LU5H 1HNYA 2NT0A 1L7IL 4K23L 5SWSB 2EDXA 4YAQA 1Z3GH 1EJOL 1VFOA 2ADFH 5KSVB 3EYFA 2WB5A 2CIIB 4M5ZL 3WFZA 5ITBH 4GKNA 2QMKA 1NGXA 4ZFZA 2W0KA 4CVWA 4P23B 2OCFD 3K8MA 5JIPA 1X5ZA 4TTGA 3OKKB 1T2XA 1RQ5A 4CN1A 4JO3L 1EX0A 2VXUH 3OMZA 3C2AL 1QFUL 2YC1B 1TITA 5IMMA 4U31A 4U33A 3DRTA 4X6CA 3RWFA 2YSSA 3OKLA 1GH7A 1VIWA 2CYGA 2AXFB 4W84A 3FCTB 1E4LA 2A6DB 1BM3L 4Z7UF 5SX5K 2X41A 3R06B 4KHTL 1BYAA 1U58B 3G6DL 2DQTL 4GRLA 4XVTL 4YXHH 3AIVA 5GGVY 4OFDA 4WK9A 1UQSA 1V03A 4HUNB 3RY6A 1I1YA 4FMVA 3OLIA 3LQZB 1AMYA 1HL8A 4I0PB 1D5ZB 4LCUA 4NRXA 2IGFL 3V52L 5IW6B 3U6RB 3WD3A 4NCC1 1LO2H 3ZKSD 1IKNA 1QI0A 3TO4A 1SYVB 2GT9A 1BFVH 1QFWH 1ED3B 3L5IA 4AH2A 2HA1A 4P2RE 3RVVC 3IDYC 4XPFH 1JWUA 2IH3A 4G8EA 1W0WB 3V95A 1XF4B 1NWRA 4M6MH 2NR6D 3G5YA 1DANU 3UJJL 2P47B 1X5JA 4QGYA 2W9EH 4HC1A 5TQ2H 1YEFL 3RWHB 5HGHA 4BA8A 4GSDH 2OSWA 4GAYB 4Y0GA 2YXFA 1I9RL 4MQSB 1NGZB 3PWVB 3TO2B 5GZND 3D3VD 1QKZH 4YEEA 4HGMA 5JXEC 2XY1A 4LSVL 4XCCH 2CJUH 2VXVL 2MPAL 4U5KA 1PSKL 3SQOL 4IM4A 3KXFD 3STBA 3QFDA 3CZEA 1G6RB 1HF6A 1SYVA 5EIVA 1NBYA 5CIPB 4S1QL 3HMXA 4PRNA 3ARGD 4Y4FB 5C6TH 1KFAL 1YQVL 1I4FB 3RZWA 3H3PH 3QIBB 3K0WA 1CFNB 4UBDD 2AOSA 2DI8A 3KLDA 5CSZA 3WEXA 5I3DA 3OTTA 1NFIA 4ZAKB 2C1PB 5AYQA 1E3ZA 2G5RA 3W11C 1RHHA 5L2KD 5D72L 1S3KH 2YIHA 2X0HA 4HKZA 1U6AH 2YDRA 1CN4A 5D1XA 3MNVB 1HJSA 2GTZB 3CFJB 4AXNA 1A7NH 1LEGA 5ETUB 4L4PA 5KS9B 1MI5E 4HKBB 1UXWA 3C87A 4RISL 1I1RA 1LP9F 1TZHA 4QHLA 1BMGA 2VUOA 2IAMD 3QEQD 1I3GH 1AO7E 4XX1E 4YGAB 2PO6C 3SCUA 3BXWA 2OSXA 4PV8B 5FHAH 1UKPA 1GPFA 1LE9A 1FVEB 5JHLH 5CGTA 4AG4H 2C3VA 2XXMB 3KPQA 3U0WL 4AISA 4M43H 1JPGA 5I17B 3LD8C 1A7QH 3RO8A 3VXTB 1RI8A 3VH8A 3ESUF 5TFSH 2E6PA 1QNSA 3VIIA 2WUBL 2XPGA 4IRSA 1DVFD 5DFAA 2B31A 1ZLSL 3THCA 5F6IC 2ITCA 4D6HA 2R56L 2VCCA 3VDCA 4NRRA 2F19L 2W0FA 2XGIA 4NSBA 1GGIH 2HN7B 4A2MA 3VXRD 3QH3A 1DN0A 3CX5J 4UNTA 3D48R 3MRHB 4QRRE 1ZS8A 1IEAB 3V4PL 1E43A 1H15A 3U36B 2DIBA 2UY5A 1BGAA 1KB5H 3DVIA 3BPNC 1TVBB 3I75B 5I8EA 4GLRI 1BVLB 2CLZB 2AV7A 5HGBB 2NYYD 2HKHL 3DPBA 1ACYL 2YLLA 3TVMA 5EFIB 3R8QA 2E6JA 1OGAB 3L1OL 1P7KB 1OSZB 1N5YL 3PZVA 3O3UN 4AEEA 5CLTA 2UYLA 2D7PA 1HZHH 4NRZB 3UTPD 5FCUL 5MEND 4OZGB 5HGBA 2AK4B 2WIMA 2FIRT 5EC2B 4ZOBA 3HPLA 4NHUA 5KS9F 4QLKA 2YPKB 1OAUH 3O9WB 1H3TA 2CUHA 4BELD 5DMIH 1T0MB 1X5GA 5CILH 1JFHA 1KQYA 2WCAA 4WDIB 1I1WA 4FOMA 4D6JA 4ZFFA 1RZIA 2WKGA 1L6ZA 2SEBA 3QEHA 1DUZB 3FN0L 4KWUA 1A7BA 4PJEF 5HYJD 5HHME 1CXLA 4K07A 5MEQB 3L4XA 2Q8BL 4JVWA 1H8OA 2EKSA 2FGLA 1I85A 3HPLB 2YK1L 4OZGE 4R90H 1FH8A 1HYSD 3I2CH 1F3DJ 3MLRH 2B1HH 5I1JL 4UR9A 4WEBL 5EUKA 5D7LB 3IFPA 1IAMA 3VA6A 5EUOB 3TBWB 1JGVH 1JPSH 1LDPL 4QRPA 3BCDA 1T0PB 1CGSH 2AJVH 4I8DA 3VDHA 1JTTA 2XFXB 2NY2D 2L0DA 2QPSA 3QA3B 5E9DD 4R6UA 4UV4H 1ZHNA 2JB6B 1HCFX 4YIQA 2X10A 4EDWH 4JPKH 4FABH 4L3AA 5GISL 4CMMA 4TVSa 1SYTA 1LO3H 5D9PA 3K2UH 4NQDB 1NC4D 4NM4H 3IJHA 3DVGA 4EIGB 3CZ8A 5IW1A 3HE6A 2HMID 3EHBC 5HXMA 2DDXA 1HINH 2IJ0C 3IU3B 3OQ3B 5ABFB 2B1AH 1VB9A 2XNAB 4X8XA 3PP4H 1EFQA 2P44B 3WD2A 5ABEA 1CDCA 1RUAL 2RQ8A 5IVZB 3NCJH 2E9LA 2OLHA 4AQ1B 5KJRL 4CVXA 5FDYA 2VRAA 3RIFF 4OKVA 3PV6A 5DMGC 2E8ZA 3O3DA 4JFPB 2WC3A 1MVYA 2DLIA 1GVIA 1V3LA 3EYFB 2HJKB 2Z31D 4QRTA 1ZBCA 1ZVSA 2ITDA 4XP6H 1QRND 4L3CA 1BBJA 4YFLI 1AXSB 1TJHH 1TTFA 1BVZA 3LKQA 3CNKA 4KGLA 2AQ1A 2EO1A 4R7NB 3FRPA 3KYKL 1JGLL 3IRPX 5TGBB 2QQLH 4P5KA 2DB8A 3FO9A 5D96C 4GI8A 4DM1A 3MLUH 2VDQL 1T7ZA 1XD0A 1MQRA 1AXSA 3JVGC 1HHIA 2PR4L 1HYRC 1YY8A 4YO0B 5I1AB 3IFOB 2BNQA 4OCYL 1KWKA 4DEPB 5IEHA 2CQVA 3IDGA 3D69B 3HR5B 3KPRB 4OZHA 5T5FH 4NHUB 3VGHA 5EO0A 4B9ZA 1MRCL 4EDXB 5C07A 2YWZA 2A1WH 4GXUN 3GRWL 1OOAA 2D03L 3PTMA 3KPOA 2P8PA 4R7NA 2PTTA 1M04A 1G94A 1OAXL 2BNQE 1C91A 5E5UB 5FKAB 4Q6IA 1B6DA 1GVYA 1PD6A 4RAUB 4KH2A 1B88A 4JFOA 4PMXA 4G5ZH 5DQ9A 1YPZE 5DUPL 3FO2A 2YDQA 3FW6A 5E8NB 3VM7A 3M17A 1HOCA 1MCHA 1MHEB 1J8HD 3I75A 2P5ED 5I8EB 1X7QB 1DDHB 5L8KB 3OJDB 1UZ8A 3GEWB 3R1GL 1IQWL 4MNHB 1G9HA 1P4LA 3QIUB 5JHDA 3L3DA 2IXVA 2EDRA 5KSUA 3RL1B 1OTUD 3VRIA 4HS8L 1R8LA 3E2HC 3NFNB 2DJSA 3DV6A 3FO2B 4MXWL 1DWIM 3MFGB 2IQAB 3L7FA 2BDNH 2AEQL 4XRCB 2DQDL 1FDLL 1CDJA 1D9KA 1W72A 3L3OA 5FK9A 4BQ8A 5L9DH 1IL1B 1F4YH 3O0RL 3IDNA 5L0QB 3MUAA 1WAAF 4YPGB 4F33A 2AJSH 2ZSWA 3NCYS 3SGKC 3NFPA 3D2UD 1MCKA 4W88A 1IC7H 4U1SB 1RZ7H 1WBZA 4NQCE 4ZUVA 3N85H 4PMZA 4P2OC 4DFIA 3BVNB 3DX8B 3QG6B 3HUJB 4QOKD 5GXBB 1RZIB 3QQ3B 5EOTA 1WWCA 3LKPA 5F1OB 3KPSA 1BZ7B 4E4PA 1EEQA 5JBDA 3RWIB 1YYLL 5I0ZA 4X0VA 4Z78A 4KRPB 2ICEB 1W2PA 1X5HA 3PQYB 2EDKA 4W6YB 1JPFB 1S7XA 4XXCC 5EO1A 3GH4A 4PRHA 2ICWA 2ZE0A 4QRPE 3VGFA 1FYHB 1O7SA 3GHBL 3MR9A 3QDJA 1RUPL 4MZ3A 3DSFH 4OJFL 3WFBL 4HS8H 3VFWB 5DMJB 4K8RH 4XAKE 1XCQB 4HPOL 3EYQC 3PHOA 4AT6B 3MBED 4WHYG 3RWCA 3SKOA 5HDQH 1B6UA 1CICD 5D2LF 3S96B 4CU7A 4U2YA 3EMCA 2V9TA 1Q94A 2BVPA 3VRLE 4WF7A 4OCRH 3A6BH 1JPST 3MRCB 3QHNA 4HIHA 4OZHF 1IC4L 3KPNB 4LRIC 4WLCA 5EN2B