2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords MAN26A
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
3V4VL 3C2SA 3MREA 4P5KA 1D5MA 5JIHA 4MX7A 4ZS6C 3KPRA 5AG9A 1AKJB 2VQ1B 2VC2L 3AIRA 3FKUS 4I48A 3DO3A 2F74A 4PJDA 1FE8L 1XGYL 4G6FB 4ELME 3UTSD 3NDZA 4IMLA 1E27B 1L9MA 1XF4B 3VU2A 4NQXB 3VFMA 1FH5L 1HKFA 4YZFF 5D2LF 5T1MB 4Q6YA 4RBPH 5EU5B 2EEDA 4EANA 2XVKA 4GXPA 2D31B 1N26A 1BAFH 1NQ6A 1TZGH 2VUYA 2EC9T 4WNQB 3D87B 1FP5A 4CN6A 2W66A 2CIIB 2LU7A 3FT3B 4MCZB 5F8RC 1P1ZA 4L1HA 5HYSB 3TV3L 3WFBH 3TCXA 4KI5C 5FO7A 2R56L 4JO3H 2HTLD 3O4LB 1CK0H 3DJ9A 3UERA 5A8PA 3GMMB 1NEZG 1NH6A 3NZHL 1XD0A 5TGBA 3G6DL 4OI8A 1KF9B 4OLYL 5MENA 1QR1B 3OZPA 4YXLH 3FQXB 1JAKA 2C3GA 1JDDA 4O2CA 5IKCB 2DJUA 2NNAB 3E2HB 3M17B 4PV8B 3T8XB 4X4MA 1WIUA 2LVEA 1RUAL 4JRYA 4TUJA 5BRQA 3TNMA 2D4FA 1H15B 2GYSA 3NN8A 3WD5H 4PGBA 4F8QA 1S7VA 2DIAA 2YKKA 3ZM8A 3ECQA 1TJGL 1B30A 5FKYA 2DQHH 5E4EC 4I0PD 4PRDA 4M7LL 4WI6A 3IYLW 4BELD 5DHVA 3V0WH 1OCWH 5F7YC 3GMPA 3WNMA 3D69B 3DV6B 2OYMA 1IAOA 1NGZB 3ZDYF 2VXVH 3UESA 5IHSA 2C3VB 5L0QC 3B6SA 4ACPA 3OX8B 2V3EA 1IT0A 2OZ4L 3MV7D 3VFGL 1NP0A 2C4FT 2DQGL 1ES0A 4XHJD 2WQ8A 2R2EB 5D1XC 3S6CA 3VIFA 5I1JH 4L4TA 4MQTB 4RGNE 4JFQA 1SJVA 1UEMA 5AEAA 2J88H 4FRWA 3FOLA 3PWPB 1WIPA 5D2NC 5D4YA 3QWOB 4DGIL 1U8JA 1JHTB 3SURA 1VEPA 4M7ZB 2A6DA 4Y5VA 4PJIA 1KLGA 2X1XR 4PGCA 4OQTA 2JJSC 4KMTL 5IVNA 4P4RB 4S1RH 5F1IA 2E4TA 5JXED 5FECB 4RMUA 4OD1L 1Q0XH 1NLDL 1MIEH 3BXNB 4PEEA 4MPKA 1U8QA 2NY0B 4RE2A 5J13B 2X0YA 1V6YA 2WVTA 5F9OH 1JTTA 1MW3A 1O5DT 4KTDH 3FO2B 3U48A 2YA1A 4PBVC 1JI2A 3F6IA 3E8UH 2AXHA 3NPZB 4NKIL 4GINA 1CICB 1H3TA 2P24B 1NAMH 1UJTA 5FYJE 4HIJB 4O2FB 4Q9RL 1UZ1A 5EORL 5C86A 5I75C 2DN7A 1EV2E 2J1KA 3MODH 1KGWA 3GBNL 4XUYA 5D70L 4ZXBB 1BAFL 4OZOA 1Q9OB 3NCCB 2EIZB 4P46B 4U1MB 4KXZI 4JFVA 5DRXB 5CJ5A 3BQUB 2WPGA 2WBJC 1TJIL 1FL5A 3V0VA 4MJIB 3TV3H 3WFBL 5E7FA 2XVGA 3KWWB 3AZSA 2H32H 1X6NA 1BQHG 3AGVA 5BRZE 1Q9WA 3RWIA 3PV6B 3SCMB 3WS6C 3QB7C 5I1HH 3MLUH 4GAFB 5H35A 1FORL 3IDNB 5FUCE 5A3IC 2NTFA 4Y89A 4GRLC 5HDBF 5AWNH 1B0GB 3AZRA 3LRSB 1CF8L 1U42A 2PR4L 5F7LB 5F3HB 3GSRA 1R3KA 5J11B 4EUPA 3PTKA 2ZKHH 2FEDD 3VXOA 3S8WA 2QLVB 1OBAA 4OJFH 4WWKD 1JPGB 2J12B 3O45A 3U36A 3J7HA 3KLHD 1TJGH 5LQBL 2Q20A 4WUKL 5TQ2H 3UTPE 5DJCA 3WSQL 3SKJL 2ZNWA 1FCGA 4M7LH 5FDWB 1BFOB 4XBGB 1LWRA 4XGZB 1IEHA 4TVSa 3O3EB 1JGEA 1N0XH 4Z7UE 3N15A 4GKLA 3RWDB 3CLFL 3I85A 2A9ML 4QRSB 5DC4B 5J6HB 2AQ3A 1CI5A 4OD3L 2G41A 3RMEA 1T7WA 2P5WD 3U9UA 3WQ8A 3UAJD 3MO1A 3DYPA 2ENSA 5IW1A 4UUJB 2VJXA 5BZDB 3AIEA 5K93A 3VXPB 2R29H 1SEQH 2EH8H 5E08H 1ZT1B 2ZP0T 1EO8L 1IVLA 4XCNA 2E7CA 3IJ8A 2F61A 4JANA 5C0GB 3MLXL 3L4YA 5JXEA 2APXA 5EA0L 2BNJA 5JW3H 2IANE 1VENA 1JPGA 2E7LC 2VO5A 4GUPB 5KJRL 1ETZA 5H94A 1H3PL 5EU6E 4AZIA 4NDMA 5E00B 4U2YA 2GTZB 4F8XA 2NXZD 2NY6D 1E72M 4KI5F 4PV9B 2Y7QA 2YD4A 2D31A 1NM9A 4XC1L 1OW0A 1ORSA 4J3UA 4B15A 4D0DB 3VW3H 4AIEA 2VLKD 3Q1SL 1EAJA 4DWSB 4D6FA 3X11B 1CEOA 4ZODA 1OGAE 4MNGA 4Y2OA 1RZIB 3QEQA 3BP7B 3CFKA 2MCPH 4H7VA 4AEEA 4E41B 4Y88A 3E3QE 3PGCB 1JV5B 1YMMA 2ZCKH 3MSDA 3D3VD 4M5ZL 5JQ6L 2ADJA 1A21A 3NGBB 2X4NA 1VGKB 3GXFA 1ZBKA 4Z2LA 1W0VB 5E4IA 1FQ9C 4JFPA 4NO5B 4O2CB 2BRQA 5IKCA 4WLCA 3CFEB 1V02E 1FNEB 5E56A 3I3BA 1TJIH 5ALBH 1VDGA 1G1CA 1FL6A 5DVMA 4OFIA 3VGFA 3QUXB 5I1HL 1D6VH 2LABA 3N50A 3GMOA 3P0GB 3W5MA 5EC2B 4JY6A 4BZYA 4I13B 1UD6A 4Z7UA 3NZ8A 2YD6A 3DGGB 2DDQH 3QXVA 1MPAL 1CF8H 3Q2CA 3BSZL 4OM0L 5FGRA 4HXBL 1IAIL 2PR4H 3VIPA 1WC7B 5ACMA 4HCRL 4JFOB 4CU7A 1RULH 3DROA 1XGUA 4TRPH 3BH4A 1DQTA 5EIIB 3H9SD 1WVZA 5HVGB 2EDQA 3HPJB 1OIMA 1HOCB 3QPXH 5JIWA 4P7NA 5FA4A 4ZFGH 5DMJB 2B39A 1TQCB 4QRUB 3BEWB 3RL2B 2P8PA 1AY1H 3I84A 5I66B 5KVMC 4MJIA 3S3JA 1CDGA 4BFBD 3BXWA 1N6QH 2YDQA 3WUFA 5ISZD 3BAKA 3SQOL 4XPAH 1ZU8A 4KROC 3NTCH 2VXSH 5EH1A 1X7QB 5C0AA 2ZXBA 4UIMA 5BXPA 3QWQB 1CFVH 1NFDF 4NQDB 3Q5YA 5IMLA 4XBPB 5SWSD 4V28A 4PJAA 2QQLL 2EE6A 4IRSD 3GSNA 1S7VB 1NCWL 5FYKE 5BVJA 2F54D 1OD0A 3OLIA 2J4WL 3DSNA 1J10A 1F8TH 4LLVB 3DROB 4OM1H 3SDYL 3MLXH 5IFJA 2H3NB 5GNXA 3CPLB 2VR4A 2AJSL 3MRRB 2IANB 4KMLB 2H8PA 2UYLA 3VTRA 2XN9D 5C0BB 4QAWA 4NZRL 1CICA 12E8L 3KPTA 1NC2A 4CD8A 2HJKA 1KB5H 1T1WA 3QI9A 4X7TB 5IM7A 4W4NA 1FAIH 4W8LA 1UCTA 1YY9D 1DBAH 2PF6A 1W3LA 4L4VB 4FQ2L 1Q9OA 3S37L 3HE6A 3EO9L 4X4XB 4H5SA 4Z2JA 1JDAA 5DQJB 4PJ5D 2WVVB 1AJ7L 1OSEA 1VEMA 4GAGL 1HH9A 2GFBB 5JBEA 2IQAB 5C07E 1KELH 5T1KA 4LGXA 2VNCA 2A6DB 1Y0LA 4Y5VB 2FHBA 3VGBA 1K3IA 5SX5H 1PSKH 4CVZB 4LHUG 3TOPA 1HI6A 1T7ZA 3FT4A 1P69B 5D9SA 2B1AH 3O6FB 4MXVE 1MRDH 2QHRL 4DGYH 4AZCA 3EKCA 1Q38A 2DJ4A 4X80H 4C7GA 1L6ZA 4OIIL 5DFWH 4HW6A 5ACZA 3G08A 3A6BH 1FVEA 2BSED 3N1AA 2VURA 2P5EB 4DAGL 3TYFA 4KGLA 1VPOH 1LVEA 1U91A 2A0LC 2DDQL 2Q76B 3FQUA 1FLRH 3WNPA 4JLRB 2Y8VA 3FFDB 5DJ6A 3R0MA 1TPXC 2HVMA 3PZNA 2WAGA 2W0LA 3ES6A 4JPVH 4D71A 5A6AA 3L3IB 4BQBA 4E5XA 3SCOA 4JKKA 3MCLL 3KPNA 5FGCE 4HFWA 4CVXA 1MFVA 4I2XB 2D24A 5B39A 3BPNC 3O2WH 2VERN 1A4JA 1YMME 3CZJA 2WKLA 4L4VD 3VXUB 2QF8A 3FB5B 2VZSA 5D9SB 4G9FA 1SJXA 3VXQB 3RTQA 3L3HA 4LLQA 3I50L 5DC9B 5IOPA 1UUQA 1AY1L 1OT2A 3QNZB 4JFHE 2X4RB 4GG6F 1T83A 5CILL 2G3NA 1MJUL 5SX4I 4MA8L 1KR0A 2VXSL 1WJ3A 1E6OH 4PJ7F 4RRPG 3KYKH 2D20A 3RWJA 4W70A 5IFJB 1PVHA 5DJXB 2NR6C 2XY1A 4PJ5E 1NBZB 1CN4A 4YFEA 5IW6B 3EYUL 2P8MB 5AD0B 3FL7A 5B8CC 4FNLH 2DQEL 4F7CA 1GGYA 1XT5A 4J3XA 2I60L 5FGSA 1IFHH 5T3XE 4NC1C 3ZE1F 1XF1A 5K9QI 3WF0A 2FEEI 5HGHA 4XVJH 4AIXA 4AM0B 5IBLD 4BK5A 3EUUA 3PF2A 2R0WL 3GB7A 5C0BE 3W2DH 4NZRH 3LSOA 3FXYA 4G9FB 2DIEA 1BOGA 5JW4N 4F7MB 1QFWM 4RX4A 1VFBA 5GJSH 4WSKA 5BXFA 4LU5H 5CEXB 4ONOA 4WHCA 4X6DE 4P3DA 1LJYA 1G6RB 2PUQT 3RWCB 2YRLA 3NPSB 3UJTL 5LYRA 2DLTA 1NCCH 4NKDA 3SE8L 3U0PB 4TQEH 4CD5A 4PB0H 1JK8B 3WFHB 1HL9A 3LEYL 4QTIL 1AO7A 2DL9A 3DARA 1G7MB 3BT2H 1ESWA 4H8UA 5KANI 4J3SA 3S5LG 4H88L 4YBQC 1KELL 1AR2A 4JRWA 5HYIA 1IGIL 1YECH 4NO3B 2DSUA 1FVEB 4TNWF 4ZD3L 4JPIA 1PSKL 3OLGA 1ZV5A 4PTTB 5FHAH 2AOSA 3ULVF 3N85H 4K3EL 5HHME 5J1TC 3A67H 1HXJA 4DGYL 5IK3B 1V8HA 1JNLH 1AD9B 2OXHA 1AGCB 3JUYA 3CX2A 5CD5D 3RPIA 5LJYH 4PMVA 2WHMA 3LQAC 2WAHA 3CHEA 2WWKO 4EN3A 3RZCA 3A6BL 2OTUA 2VAAA 3FFCE 4HG4J 1W8OA 4DAGH 2MKLC 4O02L 4I3SH 3MGOA 1IAMA 1OY3B 1NLBH 4JFXB 4K8RD 4XNQB 1T1XB 1FLRL 4NUGH 1DLHA 5DJDA 3BHBA 1T5XB 4ONHB 3MLZL 4JPVL 4K23L 4NZDA 4NGHH 3MCLH 1A6UH 1V3IA 2X4NB 5IB5A 2V5TA 2DL2A 4HUMB 2XOTA 4NP4H 1GIGL 3CFEA 4CCDA 1FG2A 2DM3A 2HWZH 3U7BA 1CDJA 1UZ4A 5BO1L 5BS0A 3BN9C 1NCNA 3WIFB 1GORA 3WCYA 2VLJB 3CSPA 4PCTA 2AJYH 4XNUH 2CSPA 1G7HB 5D93B 3OXSA 3VD9A 2IAND 4J7RA 4JFDB 5D8WA 4LAJH 4MA8H 2AV7A 3IF1A 3QHOA 1QBLL 1KN2L 1OTTC 5D96C 3C5JB 1SVCP 1N6UA 3CFDA 1JZ2A 1GXEA 1JF5A 5DVKA 1Q72L 4XCFL 1WC7A 3H9SA 2IFFL 3W28A 4S1SH 4XAWH 3BPCA 2EZ0C 2DQFA 4AD5A 5DT1L 1BM3L 2VLKE 4FNLL 2DQEH 3STLA 3B5HA 1T5XA 4XX1E 1A1MA 2I60H 1IFHL 43C9B 4H41A 5A95A 4BSWB 4U6YA 3S2CA 2C7UB 1DBJL 1Q6GA 2BXZA 4DCQB 4UB0H 1NDMA 3GHEL 4I0PA 4N0YH 2J75A 2LE9A 5T5FL 1MSPA 2N4IA 2XA8H 1X5JA 4H8HA 3AHVA 2AJUH 3HC3H 1YNLL 1WDPA 4L4OA 4N8CH 3MRMA 2FJGA 2X1PA 5JZ7C 4APQA 1XH3B 4KVCL 3AU1A 5HDOA 5GZNC 2KQNA 5DJ2A 5E95B 5IT2L 4PG9A 4Z8FH 3WF4A 4NN5C 4X4YB 3IDIB 3QDGA 3RUGB 3F7RA 3EYSL 3O3DB 2F5AL 4TVPL 3GIZH 4XVTH 3KPMA 1EQPA 4D72A 4ZFOB 3AXIA 1EHNA 2E0PA 1UWRA 1ZGLM 1DANU 2M26A 2ESVB 2KUTA 3HC4H 1YECL 3EJZC 4X6FB 2YSSB 4Z7WA 5CSUA 4GKOA 1C92A 1XGQA 4JRXD 1FCCA 4LQFH 3H9HB 4U1GB 3G5YB 5I3DA 3TBVB 4ETQA 3ORJA 1UZ8B 4PGEB 1L0PA 1U0QA 4MJID 4MLSA 3NFNB 4S1DD 3UXFA 4BQ9A 3QHZH 1XR9B 2H26A 2EDRA 4GRWF 3N1GC 1LNUB 2EDWA 3WFCH 5C08E 1RD6A 5D72H 1IMHC 4HPHA 1ORQA 3S3SA 3VXRD 2D7NA 2RQ8A 4AZ8A 4Z7NE 2SEBA 1NLBL 1AD0B 3VG9B 3LMJH 2MPAL 4Z7QF 5EFIA 3SDCB 3UX9B 2CIKA 3KS0H 1WE5A 4LCIH 4PLJC 4KKNA 5GNZA 5BRZD 4NQVA 3PDGA 4ZUTA 1UA6L 4EZMA 2ESVA 4KK8D 5DJXA 2NY0D 3SCPA 1RUQL 1QRNB 5CJXA 3MOBL 5E0FA 5SWZD 1ROWA 3VXSA 1EFXA 1AGCA 3OAYH 2VLJE 3QQNA 4NHCL 5DD5L 4KDWA 4WO4B 4WHDA 5EU6A 3QG7H 1UWTA 3JTSA 4BQ3A 1TZHB 2CUMA 1MFUA 1A1MB 1T4KB 2UUDH 3VE0A 3WF1A 1FO0B 1UH3A 3MNVB 4R0LA 4QYOA 1LO0L 5L8JB 2R1XA 3CZKA 1IAKA 2BC4A 4DCQA 5ADOH 2XYCA 3RI5K 2Z0BA 4KZEH 1A1OA 1KPRB 4XZUA 5C71A 5CP3H 5GGQL 3BH8A 3PWPD 1BM3H 3BH9A 4K3DH 4PGBB 1ISYA 4YPGB 4PRNA 4UQ2B 4JCLA 2ZUVA 3FN3A 3D9AH 4S0SD 5FCUL 4PN2A 4M4PA 1HSAB 1G7IB 3VIJA 4UT9H 5MERA 2VCAA 3WEMA 2FB4H 4KGJA 4D9QD 3CVHH 3L4UA 1QVOB 3BGAA 1NGZA 3WLBA 3HZVB 5DWUH 1CQKA 3EMQA 3N1FC 1G7HA 4AG4L 2CO6B 1MHCA 4AD2A 1QLFA 3BOVA 4TVPD 3MJ9H 4CADB 4M8QA 2ZWLT 2EYRA 2O5XL 2YBRB 3BGFB 4KVCH 3RGHA 2XNAB 4Y1AE 4WO4C 5IT2H 3MLYH 4NT6B 4WTZA 4Z77A 1ONQB 2DLHA 1P84K 4Z7VF 2F5AH 4TVPH 3GIZL 2W0KA 3NFNA 1ZEAL 1E4WL 3O2VL 1MXDA 1OQOA 5JZ7D 2NY1D 1SJEA 2CESA 2E9IA 1EO7A 3MGOB 4OGZA 2CRIA 5JBDA 4ODVL 3AICA 1J1OL 2FIRT 3BHBB 5E6IB 4Q9BA 1BBDH 1V5JA 4LKCB 3ARDD 2JKXA 5CHNB 1CZ8H 3C60C 2X0HA 3QHZL 3T0ED 1YPZF 1V0KA 3SCVA 1KUMA 4EDXB 4L1DA 3BP4B 5FYJU 2P24A 4ZUUB 5DUML 3Q6GH 4JGMA 1GOQA 1EFXB 1IC1A 1AQMA 3LMJL 3GRWL 4H25A 2YN3A 4UQ9A 1PW3A 3WEXA 2FX9L 2BXYA 4AEHH 4LYQA 3W0WA 3TZVD 3RZCC 4I2XE 1J86A 1Q94B 2GUOA 4EKXA 2WMIA 3FONB 1KQYA 3KYOB 3QFDA 1SM3H 3VXME 5F7UA 1KIPB 2G60L 3WUWG 5E5MB 1MWAH 1H8NA 5DD1L 1M7DA 2W1NA 3DIFA 5ANMA 5HPMB 5AZ2H 2P44B 4PJIB 4OZHA 1MCOH 4GQ9H 1I7RA 5JR1L 3ELAT 1AGFB 2GHWB 4PP1D 2MWCA 3RKDD 2ICWI 1FBIL 3GSQA 2D22A 3OZOA 1N59A 5HHOB 2YL9A 1CD8A 1CLOL 4NF7A 2VUOA 2QKIA 5C08A 4Y8DC 3KJ6L 3SDXA 5GGRY 1HP4A 5F97E 2ICWB 5EU7C 3RWEB 3ZT5A 1DJSA 5I15H 4NWUL 5GNYA 3WUGA 5JTWA 3T4AA 5HGDB 3D9AL 4IDJH 4MJ6B 4Y2DA 1MXGA 3ESVF 1CDCA 3P30L 2PTUA 4KRPC 2CKNA 4OF8A 4HPGA 1MLCB 3KPMB 4XB7A 1DWJM 4PMOA 4HK3N 4IOFC 2I27N 1U8NB 3KLAB 5DWUL 5EZJA 4PJEF 2CJUL 2CBUA 1CG9B 5AYUL 4RL3A 1A6VL 2PETA 1P5UA 2CKBA 2IPTL 4HWUA 1R24B 1SFSA 3T2NH 5B8CB 1N5YH 3ROOA 4POZD 5D93C 3L2MA 2ZCHL 3X13A 1WZLA 2VRKA 4N8VB 3EFFB 5ITFA 3UG4A 4GRMA 2OSLA 3OJMB 4PREB 5L88L 1EO5A 4HWBL 1FFOA 5C9JB 1YY8A 3IDGB 2WMKA 3P3YA 2YHGA 2IQ9L 1C5BH 5F1IB 1G9MC 4P9HC 4HIHA 4CMMA 1MAJA 25C8H 1EEYA 2SEBB 3H9ZA 5I1IH 3HS0A 1OP5K 5DDHA 2JB5H 5E0CA 1EXPA 1HXYA 3JXAA 5BXSA 3V4UL 2N56A 1BFVL 1I3RA 4FMFA 5DT5A 3UTTD 3MYJB 4K94C 1K8IA 1ZS2A 2WCSA 4Y4FD 2EYRB 1A1NA 1QI5A 1GGIH 2CBJA 4WUUE 5FK9B 3PABB 4GG8B 1BG4A 4WVRA 2HRPH 3KYOA 2Y72A 3HB3C 3QFDB 4FTVA 3MV8E 4HLJA 4LF3B 3WUZA 2JF1A 1U3ZA 2C3VA 3UTSB 3HHRB 4RDQF 4XMPH 2VL4A 4NQCB 2F53D 3RJYA 3SQBA 1WT5A 3GRWH 3VI3E 4QRRA 1IEBA 3WBEA 4LPYA 1F90H 4QHUA 1YQ2A 1QPPA 1W2PA 4XAKE 3EDJA 5EPMA 1KXTB 4J4PC 2R8SH 3MRGA 3KVQA 5IFPA 4J12A 1S9YB 1WT5C 4M56A 1ISXA 1QR1A 4PYGA 3NSXA 2BNQB 3QUXA 1KV3A 4FQQA 4HKJA 1EDTA 3EGSB 1JIBA 3IAGC 3DGGA 4Y16C 1FO0L 4F33B 2Y36H 3SCQA 1FBIH 2CPUA 4Z6AT 4M6NL 3SIMA 4RQQB 1GZQB 2VLRB 4EI6A 5EOCL 3BP6B 3QDJB 1YYML 4RFNB 3TPKA 2Y24A 3AJ7A 4X5XB 2JJTC 4U6VH 5ABDE 1SYSB 4YXKL 3BAWA 5BWFA 4WI3A 5SWSA 4GKNB 3L7EB 3UG3A 3ALFA 1F4YL 4MWFB 5LA0A 5ANME 5FF6A 1RP8A 2ORBH 1F6FB 1B3WA 1DN0B 1QLEL 1PFCA 4HC1H 2M1KA 1CTNA 2PNDA 2EEXA 3OX8A 2A77H 5IG7A 3DO7B 3WKZA 4NI3A 3KXFB 1PZUB 3U7WH 5T3ZD 5HPMA 2NX5B 4Q9QL 4P4KA 3KPRB 2HT4D 1AO7E 5MP6L 4NZTH 3PZ9A 2FLRT 3MZGB 3LEXB 3IU4L 2F54E 5EUOE 4FXLA 3B9EA 1HL8A 1MCSA 2VL5A 2CKBH 3P9WB 1TDQA 4TN9A 4EI6B 5I0ZA 4CN1A 3HI1B 2X1OA 2DT0A 3S3PA 1G7QA 3MXVH 5IMKB 3NABL 4X6DF 1E40A 4TUOA 1R7OA 1P4LB 4N5ED 3BRDA 5I8EB 3MO4A 2GJ6A 1PBYA 2UYLB 1AXTH 4BFIA 2WWMC 2X89D 2VDRL 4W68A 1A7QL 4FLRA 4GO6B 4UQ3B 3JV4A 2B31A 5HD8D 1T03H 5SX4H 2JCCA 1T7YA 3SGJC 4LLUA 4PRPE 3B9KC 5IVXE 1NEUA 4J6RL 3GI8H 3GK8H 1GGIL 2QR0B 2QADB 3QEQB 4NRZB 4V27A 4IRJB 4KUZH 4LLDB 3VI4F 3G6JE 1G7PA 2BP3A 2UVEA 2Q86B 2F58L 3VFPB 5T1LD 4YX2L 1U3HD 3ROLA 2HFFB 5KVFH 3LN9A 4ALAH 4PMYA 3V7AE 3K2MC 4Y19A 1MI5E 4F15B 3A6OA 1X6LA 2EYSA 3HZMA 3ZHDA 4TUOB 4K7PL 1TCRB 2J7GA 4M1DL 4ZFZB 3ZDXF 4H8WC 1JFQH 4GAJH 3SDXF 4R96A 3BZEB 2R8SL 1T6VN 4NM4L 3EDFA 4Q2ZA 3GSVB 3TIDA 3RVVC 3HJEA 4D9RE 4CJ1A 2GTWA 3REVA 1G6RH 4B53A 5C2BL 1B0GA 1O6IA 3BDYL 1OT1A 2CMRL 3OGOE 3UBXI 2NW0A 1LDSA 3G9VA 3TVMC 4ETYA 5E00A 2BOBA 3QIUA 4YDIL 4KQ3L 3VINA 4EAMA 5IWLC 3C5ZB 1MFAH 4H25B 3QWOA 3C9NB 2DLFL 3QDGE 4PJAF 5AUMB 1INDH 1NGPL 3U7AA 1Z3GL 2X9XA 2BDNH 1FLTX 3SJVA 3FQXA 4PRAA 5D7JB 4RNRB 3OPZH 3WS3B 4JVUA 3ILQD 3PHQB 2FH6A 5C09E 4OV6F 4JRYB 4OI7A 3QGVA 3BIAX 1IM9B 3OKLA 1QI0A 2BVPB 1QSVA 2Z93B 5GS0H 1CLZL 2A77L 4H04A 4KDTC 4PRHE 3APGA 3KPOA 1YEGL 2HT3C 2OLHA 4QY8A 5DURD 2ICCA 1R5IA 1FDLH 5DQDL 3GH7A 5CZVH 3FO2A 1HDMB 2PTTA 4JM2D 4BQ2A 4OZGA 2X6MA 2YBUA 4P9HH 3QA3B 1C8PA 5KAQG 1KJ3H 5EBWB 5KEZA 1UR0A 1EGJH 4MDIB 3SE4C 1TQCC 3HAEA 3P0VL 4XPTH 5KVGL 5HGDA 5GJTL 3VFRA 3G6JA 2VMFA 2KBGA 2FHFA 4FQ1L 2GTZA 4BH7B 4R5EA 1Q6FA 3F7PC 1VFFA 1P4BL 4XP5H 4HS8L 2G5RA 4LAQH 4MJ4A 1QI2A 4JZNA 3CZEA 2VDRH 4DN3H 4GBXD 1BF2A 3LIZH 1UQSA 1VA9A 2XTLA 4XXDA 1NPUA 1S8DA 4J4PD 4FQCL 1FJ1B 1YPZB 3MV01 3MMEB 4Y16A 1REIA 2VITA 2OK0L 1UM4L 3WSUA 1G6RA 2D7OA 4XPFH 4HP5A 3OKOB 1QQDB 3EFFA 3GI8L 5EOTB 4L9LC 3SGEI 5E8EA 1UM6H 2MANA 2WQRA 2FL5A 4YX2H 3C8KB 3WN5B 4JPKH 6A3HA 2VWEC 4GRLB 2XXMB 3LKQB 3AS0A 5TE4L 1B90A 5CEZH 4HUNB 1CIDA 2PYFB 5D1QA 4ALAL 1J1PL 1GOOA 3WQVA 4GI8A 2P5ED 1XCQA 1RP9A 3CGTA 2VSDA 1BFOA 3RAJL 4HTYA 5K9KA 4Y5YB 5ESAA 2ATPA 3BIKB 3MLSH 3HRZA 4G6ML 1M4KA 1CDBA 1GOIA 1IGML 4P46C 3LEVL 5ICZA 4PJAE 5C2BH 5A2BA 4XPBH 3VXMB 4FLOA 1V05A 5MHSD 5HGHB 2CIIA 2RAMA 5DLMH 3CZLA 5KG9B 4MAYD 1HWHB 5AZEL 5DEGA 5ID1B 1XH1A 3PWPA 5FAAA 4YDIH 4KQ3H 5ILTH 4LRIA 1R3IL 1G9NC 3GMMA 4LGRB 2HT4C 2XQBH 3S5LA 5B39B 1Q9WB 3RWIB 2R2CA 2XZQH 4NPYA 1WICA 5CEXA 3UDWC 1HT6A 2J8FA 3VI3F 4Z95H 1FP8A 1LMKA 1NGPH 1QEWB 3AXLA 1D5ZB 1TZIA 1S7WA 4RGOH 1FG2B 4L3CA 2B0SH 3QO0A 3BUYB 4RAVA 1QSED 2CEQA 3OPZL 5HDQL 3FTGA 3WIIL 3FY1A 3HPLA 2IALB 3PJSA 4FK9A 4Z2IA 2PWEA 4P3CL 4JRYE 1V08A 3QDHA 5EBLB 5ICYB 5JHLH 4G8GD 1WV7T 4R27A 3ZL4H 5GS0L 2JE8A 3EOTH 1DSFH 2GKIA 4IMLB 4ODSH 1FDLL 1SBBA 2AS5M 2HFGL 2E6QA 1DUZB 3C6LA 1FHLA 4JJHA 4NFBA 4QXUH 4IM8A 1BJ1H 4IRSB 5FO9A 3C6SB 4N0UB 2Z31A 1DZBA 2BCKA 5SWSB 4JJ5B 3RY6C 4ZXBA 4WENB 1MFDH 4RISH 1BF8A 5LCVL 5DK0B 5T5NG 4W5ZA 1B3YA 5GZND 2D3VA 4TSAL 4QWWD 3QQ9C 3ZT6A 5ISZB 4R4NC 1R6VA 4NFCA 2Z4QB 4G8GA 4BUGA 4GKSA 2X09A 2DH3A 2Y2WA 5F8QC 1FZJB 1GPOL 1A4JB 2R23A 4JRXA 1E0XA 2BMKA 3LIZL 5HGBB 2J77A 4ENED 2GITA 4AXNA 4NUJA 5DC0A 1UCBL 2YKLH 3UROR 4AMKH 5FECA 1VKXA 1YZZA 5GGTH 2H2SC 1E4NA 3U0TB 3FQTB 4F3FA 4Y5YA 5JHDD 1XAUA 1ADQH 1UM6L 1IEAB 4P2CG 2YOCA 4YGVA 1VF8A 3FZUC 1U58B 3DPBA 4JPKL 5M03A 4WFED 1DL7L 4U0QB 5JOFA 1FVCA 1VGEL 3EFDL 1F42A 1EBAA 2JIXD 4AIZB 3MV9A 3QCUL 3W0KA 3RX7A 1UEYA 5F7WC 3B9KB 5DRWA 3QNXB 1KEMH 2J7FA 1YNTB 4O9HH 4KDTA 4X98B 1IGMH 4JGJA 4O51B 4V2XA 1MNUL 2GJZA 2Y5TB 3CCHB 4P4KD 2EDLA 3KYMB 2ITDB 3QXWA 3FFDA 3BQUA 3AREA 5I1AB 5JPMB 1XGTB 4YHNA 5AZEH 3LRGA 4E41D 2ZPKH 5T1DH 3UBXB 4QT5A 2WWKT 1PJ9A 3I9GH 3LKOA 2J6EL 5KS9E 5D7SH 2OJEB 2XZQL 4M7ZC 3GNML 5DJ8B 5F93C 2F15A 1EJOL 3QIUC 2PXYB 1HDMA 1H1NA 4KI5D 1RV6X 4RGOL 1II4E 2HTLC 3U7YL 5I16A 3IU3B 3CDGA 1GHRA 5DZOA 2OXGA 2WBWB 1XF2A 5F1KC 3QEGH 4IRSA 5IROA 5FO9B 3U4BH 1V0NA 1X5HA 1IKNC 1ZJAA 5EUKA 1C12B 1TENA 3VXMA 5CSYA 2WMGA 1PBGA 1BAGA 2YSSA 3EOTL 4Z7WB 4C56D 2B8OT 2EKSB 4UINL 2B4CH 1JGLL 5EU3A 5C0AD 4OZHE 4XH2A 5DO2D 2HFGH 1GW1A 3RJXA 4QXUL 5D2LA 3MQIA 2R9HC 2PWFA 4KY1L 1PLGH 4G8GB 3BSHA 5DJAA 3MACL 2E9MA 2D9CA 1U6AL 4U6YB 2V7HA 3RDKA 4ZOAA 3KLDA 1M05A 3OGRA 1YNKH 1JI1A 1HIZA 3AXLB 2JJSA 2GVYA 3VWJB 4RMQA 4YC2B 3O6FA 1KJ2A 3Q3GB 1S5HB 1EXUB 1KCSH 4LIQE 1IM3B 5BXFB 4MS8C 4AZ6A 1N7MH 3WN5A 3V52L 5CUSL 4MLIA 2PYEB 1FNLA 3X17A 2NY5L 4OLVH 4PYHA 1UYQA 3G08B 4X7DC 3KL0A 4ELKA 2FGLA 1HIML 4YBLC 1YEHH 2VX6A 4HK0B 4R4ND 5FEBA 1UR1A 3PG2A 1WBYA 3NMEA 1KCUH 2NY2D 2MKWA 1SJHB 1FFNB 5ESVA 2DBJA 3P9MB 4HHAA 1ADQL 4MJIE 5HDRA 3G6JB 4JFED 1CFNB 5H37H 3EYOB 5DJAB 1JPST 5DTFB 3FW6A 1VGEH 2UY2A 3OR6B 1ZHBB 1US2A 2OSXA 4QRUA 3QXUA 1XH2A 1UZ8A 3CUIA 2YD1A 4JFEE 3Q3GA 1RZGB 4OZGF 3THML 3O6MH 4O9HL 2BNUA 1I9JH 5DMIL 5BV7L 4PMNA 4FQXD 2BVOB 4MB5A 4NN6C 1IGCH 2GITB 5EZIH 3OKOA 1G7LB 5E2TH 1W72L 4OLWL 2QPUA 3FCTB 2XY2A 4HKZB 1NMCC 1LE5A 5I1DB 1BFNA 4R7DB 1KFAL 1TETL 4WV1B 2V38A 5T1DL 3C60A 5T3ZH 3LKQA 1T66D 3W26A 3HUJE 2UVFA 3V5DA 2F8XC 3QULA 4UFIA 4PRHD 1NFDE 1XCQB 1CFNA 2FATH 1UFUA 3RVTD 5E03A 1LLOA 3VFNA 4UDTA 1EJOH 1QLRA 5JIPA 1QNPA 1K4DB 5D9NA 3N1MC 5C09D 1KYOK 4LCCC 5HGAB 1EBPA 3F7YB 3QSKB 2B1HH 3RTQD 5SV3A 3TWCH 4KKBC 4LIQL 3TBTA 3OKEA 3TJHD 5IHBA 3JVGC 1CFSA 4PYSA 4JN1H 4XP6L 1GZPB 3IDYB 3CHFA 1RZIA 3MRLA 1JGLH 5EO0A 3TTQA 4C56E 5CSZB 2VDQH 3CU1A 4XNMB 4OF6A 3VH8B 3CUFA 2AXGA 1BJMA 4M8VA 1TFVA 1T2QH 1RY7B 4KHTL 3FRPG 3S37X 4ELMA 2ED8A 1EVUA 1DFBL 1XR9A 1PLGL 4I18B 2E27H 3DRQB 15C8L 3GO1H 2IBGA 2O5ZH 4LGSB 3V4VH 4M6ML 1YJDL 2DKSA 5DFVD 4GQQA 1SMAA 1WTLA 5IHLB 2AEWA 4MNHA 1WCBB 2DSVA 3T0VA 3PWNA 1N3NA 2VC2H 3WUWA 1JGUL 3MRMB 1HYRC 1QOXA 4QOKA 1FE8H 2XZCH 2X1WL 5EC2A 2EJ1A 1FFNA 4XNZC 3V7MA 3V52H 5EZJB 4E41E 4IM4A 4OLUL 3CIQA 1QP1A 4YQXL 4QFUA 1NL0L 2OR9H 1YEIL 1TZGL 3IKKA 5E9DB 5GRXG 1UWEL 5IM7B 3SKUD 4N8VA 4UTAL 3I2CL 1KIQB 3MBEC 3CFIC 1A14L 1I8IA 2FDMA 2AK1H 4LVHB 3TZVC 3O4LE 5I1AA 5CJOH 2NY4B 5CCKL 1JPFB 3BEVB 2GY5A 4HXAL 3T1FB 4K3JH 4ZPTB 3MJ8B 1MEXL 3G6DH 3QNZA 1B4JH 5ABGA 1NGQL 3MLRL 1M6OA 2NW3B 3LPOA 3W24A 1NJ9A 4S2SB 3DX6A 1GOGA 1T3FA 1JZ5A 5T1LB 3AMLA 1J0KA 3IGAA 4NQDA 1UYWL 1BZ7B 5I17B 4ZFMA 2ZZUT 2EC9U 5F7FA 4Z7OE 1W72H 4OLWH 3GTNA 4I3RH 3H42L 3CFDB 5FK9A 2MFNA 3ARWA 4U1JB 1RFDL 5I19L 3FB8A 3C09B 5GSVB 4DW2H 4JCMA 3SBWA 4QF1A 2WMPA 1MFCH 4MAUL 5EWIL 5FYLH 2B2XH 1TVNA 2R4SH 5D1XA 2WZPD 2PC8A 1Q1JH 2BNRB 5IESH 3OBAA 4QCEA 2EKSA 1W0WA 4OUUB 2VXVL 5TPWH 2JIXA 1R24A 2COQA 2E7BA 4LHUD 5IB4B 4KK9C 1B1YA 3LSOB 3TA3B 3AROA 5L2KB 4XNQA 4F9LC 3X12A 3S96B 4XC3H 2OYLA 4H1LA 1AE6H 3I3DA 1AI1L 3WFLA 1KOAA 4V2BA 2YL5A 4IPNB 4MA3A 1CNVA 3IDJA 5DD3H 1QHOA 4QRRD 5E6ZA 4OZHF 2GI7A 1BFSA 2VVSA 3AU1B 1Q9LB 1M03A 3U0PA 3H7BA 4WFHE 4U1HA 4AD4A 3IFOB 4L8BB 1KBGH 2I9TB 3LKOB 3TYGL 2NX5D 2RCSL 3BIBX 1MAKA 3LY6A 4M1CC 3AREC 2OJEA 5FDYA 4W86A 2DMKA 4JFHD 5IIEB 4QF1B 2O5ZL 1ZVHA 4Y2DB 1WB0A 1TVBB 4CMHC 4WK9A 1DWIM 3PWVB 5D7LA 5IQ9B 3P0YH 5JHDA 5IBUG 4HPYL 1YMMD 1QI3A 3UR8A 2APTA 1OAXH 2DQIH 4GLRH 1R86A 3BN3B 4JE4B 4H0IA 4QGTA 4M6OH 2DB8A 4P2QE 3ARZA 1WWBX 4HQQH 2EE9A 1A0QH 4DFIA 5EORH 4YR6A 3TVMD 4M7JH 3AOFA 1C3FA 2WMIB 4Q6IC 5J3HD 4GZJA 1VEOA 4YQXH 5IEHB 1NC4B 1ZE3C 5KOVC 4QNPE 1Q9LA 5D70H 2OR9L 3LMYA 3MRJA 2OSLB 1UWEH 2YPVH 1FC1A 4UTAH 3MCG1 4R26H 3BD5A 3KNBB 4TX6A 2WXDM 5C9JA 5DFVC 3FOMB 3LPPA 3UTZB 3CC5B 4PG2C 5DGQA 1JHLH 3IAPA 4N9OB 4PJFB 4M7LT 4ZQKB 4RMVA 3QCVH 3DVGA 5C0CB 5E6IA 3CH9A 3MLUL 5CCKH 1U8MA 3NCYP 5AWNL 1R3JB 3CUPA 1B4JL 1X44A 3L9RA 4NQCD 4ML4A 3QFJB 5E24E 2V5CA 3D25B 4JG0L 1ODUA 5E1AB 1UYWH 4PJBA 1A3RL 1EHLH 5F7NC 4MCZA 4Q9CA 4KK5D 2GDVA 4OJFL 4YC2C 4YR6B 3TJHC 4U7MA 3DXAE 4POYA 2CRZA 2MOVA 3WFZA 3VXUE 1H5BB 3JWOL 2DI7A 4WI5A 5LQBH 2W9EH 3UDWA 5I19H 3STLB 3WSQH 4K7PX 4FOMA 3QXAA 1FN4B 4NO0A 4P3WA 3QDAA 1XSKA 3MRQB 1ACYL 4TVUA 3KEHA 1CFSB 3DVNB 2APWA 3JUZA 1LNUA 4GO9A 4XVUC 4Y4KC 4UU9A 1R0AH 2NQCA 1ORQB 3WQ6A 3RI5F 4WY7L 1D9KA 3IJSA 3Q5OA 4O5LL 1G9HA 3GSXB 5MEPA 3HZVA 4MB1A 3SOBL 1T7VA 1UKPA 1SEQL 1CXLA 1UXWB 1V3KA 1CGTA 2R0KL 3B2UD 4Z7WE 5D7LB 5IQ9A 4J4PA 4FXGA 5C7XH 1LO5A 1XCTB 1S78D 4BCEA 3VFTB 2WZIA 3V5DB 4LP4A 2BERA 4MAZA 3GBEA 3MBEA 2FLBT 1QFUH 3JTSB 1EUTA 3GSOA 4M5YH 2ATKB 1Q8MA 1EHXA 4OLXH 1XH0A 1IJ9A 4R4BA 1LO3L 4XC1H 1BJ1J 2C4XA 5HGAA 3CMJA 4WW1B 4UOW0 1T2XA 2NY3B 5E8NA 4OAWB 3PN8A 1WQVT 1U92A 2BVPA 2Z93A 1WFNA 1HN1A 2P5WA 1P9MA 4UQ2A 3ULUF 1C1EH 3QISA 1XIWD 2Q8BL 4HQQL 2Y4SA 1EHAA 5CAYB 4JFTA 4U1LA 2DOCA 4PJFA 5DEZA 2C7FA 4WFGE 2YA2A 2PTTB 4M5ZH 5H2BA 4HBQA 1K8DA 2DS4A 3V6ZB 2P46B 4TPRL 3BZ4A 1ND0B 3LQZB 4LVNC 1E0WA 1WZAA 1JF6A 3T0EE 4R26L 2BJMH 2YEZA 1CR9H 3OKKB 1CDIA 1XH3A 3GHBH 5TE7H 5TF1H 4YHYB 1WFUA 4XCYB 1IAII 2DYPD 2IPUK 3O4OC 1A6WH 2NLJA 2Q87A 1AQDA 1T1ZA 4QHMB 3TTYA 3DMMB 1KBBA 4FQHA 3PL6D 4JZNB 4OSUL 1QR4A 2AABL 5HHPA 1JZ6A 2AV7B 3IF1B 4L4TD 3O9WC 2RHEA 5I1GL 1AC0A 3MRKA 1T04B 5F72S 4FXKA 4NWTH 3TBSA 2BSSB 1SMDA 2G75B 1RULL 1V7NL 4IRJA 3ZSTA 3RNKA 3GGWB 4IBLT 2V6HA 5C3LD 4QP0A 1UWIA 3N13A 5F89A 5GGRB 3JWOH 2DRUA 3LRHA 5GRVK 2DQHL 5GSRB 4ZFGL 2XKUA 4K7PY 5E6ID 3VXRA 1CT8B 1T89C 4GOSA 4LLWA 1KQZA 3V0WL 3M17A 4JFDE 1E70M 4XCEB 4L9LA 3CH8A 4FG6C 3RVWC 4B7LA 3D2UA 1KLUB 2ICWJ 1VFAA 1OD8A 4O58L 2HFEA 3M8OL 4LEOA 3N06B 4PGDA 3CZ8A 4FQQB 5F6IB 2ZWZA 5GS1C 3EYVB 2VSCA 3SOBH 3MBEB 4AIUA 4ONGH 5F7DA 5I1JL 1HSBB 4CNIA 3MRBA 3C2AH 4NRXB 1UB5A 1R5VB 2P5WE 3BP6A 3QDJA 2ADIA 1XMWA 5DR5L 1GVIA 1F8TL 2YUVA 4IIQB 1A9EB 4HJJH 2V2WB 4N90D 2AJSH 3QUKA 4MXQD 4B9YA 3LDBC 3SPVA 1KYOJ 4ZUSA 5AUMA 12E8H 3C6LD 2V17H 3FT3A 4OUUA 2R2EA 2FSEA 5GS0D 4S1RL 3CMOH 3C8DA 3P9LB 1AGFA 4WW2F 4UQEA 4NKMA 1FAIL 2V2TB 1DQQA 1AR1D 3UTPD 1W1PA 4OD1H 1C8XA 1MCNA 1Q0XL 4J3OC 3H7LA 4UTFA 2YZ8A 5E99H 3S37H 5JOPE 4XI5C 5E8EB 1K5NA 1P4IH 1UWQA 4KTDL 1HXYB 4JEGB 3UPRA 1PQZB 3QIBD 4GAGH 4EXKA 2VLLA 1HSBA 3ZYIA 4CNIB 3IVKA 4EUPB 3RVXD 3F58L 2ZUSA 4P2YA 3J8F7 4Y4FB 1SR0A 4KJPD 3VDHA 3UTTB 3QUKB 2W9DH 2WC3A 5IMOA 3MUAA 1ZA6B 3BAIA 3WEXB 3VFWA 5AY7A 2JK5B 3MXWL 2W63A 1QRND 2MHAA 2E9LA 4MNQE 4U2ZA 2ED9A 2ZUNA 4R4BB 2YA0A 4DGVH 4Z0BL 4CVWA 1KXTA 4QLLA 3MJ7A 4EVNB 3ULVD 2F53E 2G2RA 4QOKD 5EFDA 5F89B 4YDJB 5GGRA 3G5ZB 1BQLH 4P46A 1RAMA 1C8YA 3L3OB 3QCTH 4YO0A 5DD0L 4NRYB 3VXRB 5D7JC 3O6KL 3HMXH 4HT1L 4XCCH 3CPUA 4UUJA 5FV2A 3TPUA 1FNEA 2XACC 4MNMA 4LBEA 1V7NH 2YR3A 3FMGL 4KRLB 3FB6B 1FP9A 1Y6KR 2OR8A 4LSVL 5MEPB 3BN9D 1KULA 4LOUC 1XYZA 4P4RA 4LSPL 5D1XD 4P7LA 1PZ3A 3GSNH 1JNHA 2VQUA 3BPLB 3RBGA 5EN2B 2OQJA 3C6LB 1N0XL 2YD3A 4FQJL 3U1SH 5E0QA 4GBXA 1IC7L 3DMMA 4PTUB 3CZFB 4RCAA 4UIKH 4OD3H 4ZNEA 3M8OH 1DWAM 4UOZA 1G0DA 4W6WB 3QEHA 1A22B 5C92A 4JN2B 1S7UB 1FGNL 2DMBA 1PY4A 4LRIC 4NNYA 5BRPA 3MBED 4X6DA 5JIKA 3NFPA 2JJTA 4RA0C 2IAMD 5E08L 3AHXA 4KAQL 1NBYB 3F62A 2Z8SA 4NQTA 2GSIA 1PZ5B 3MUGB 4HJJL 3ZE1E 5EA0H 5HYJB 3OG6B 4JM4L 5JW3L 1JBJA 3F7VB 2DT2A 3WHE1 1I7RB 2VABA 2BVYA 5IHUH 1B6UA 3Q6FA 4R8WH 3PWUB 4UCFA 4PRDB 1FL5B 3UYRH 4HF5L 2DTMH 3CMOL 1GSMA 1BYCA 4YZFE 5CPQA 4G42B 3DURB 5EULV 5LGKA 3TC9A 5IQ7H 5HHXL 1E6NA 1VSCA 1NCTA 4C7FA 2HLFD 3LQZA 1ZTXL 4U3HA 4FZ8H 3IT8D 4U33A 4W8AA 3BYYA 1P4IL 4UR9A 4UQ3A 3IJHA 3SE8H 4TQEL 1U95B 5DSCB 5DMGD 3BISA 3LEYH 3WN6A 2X9YA 5CGYC 4FFWC 1NC2B 2OI9C 4L4TB 4FF5A 2H6PB 4OZFA 1IGIH 4YDVA 5IROC 4FQHB 3DTXA 3FAWA 3D0LA 1UD2A 4LF3A 2WCGA 2W07A 1CLYH 4BS0A 3GM0A 1D3CA 3KPNB 4NNPH 3FFCD 3N85L 2UWEE 4K3EH 4OGYL 5TGBB 4BZ1H 2GK0B 1NCBH 2W9DL 3SUVA 4X6CF 4A3HA 3EMCA 1X5AA 3WL9A 1A9BB 2UUDK 2QADC 4TTGA 3GBDA 3GMNA 4XPGL 5IB3B 2CGRL 3VFUB 3VXQA 5DO8A 4DGVL 5EC1B 5EMYA 3L3JA 4FN0A 1T0NA 1UT9A 2HG5B 3D48R 3L3KB 1CU4L 1B0RB 3LS4L 3SE4A 2R2HB 1NANH 4G80B 3BSZH 3BP5B 3GNOA 4PJ8A 5ADPL 1E4XH 1XIWB 4KRUA 2KKQA 2XIBA 1QRKA 3HMXL 1I3UA 4NGHL 3RDTC 2IALA 4HCRH 3O3UN 1EMTH 4F3FB 3MUHL 2XKSA 4LNRB 4LARH 1GIGH 4NCC2 2CR3A 3DXAB 3HR5B 4PJ8D 5AYIA 4P2RE 5GQBA 1V0MA 3L4WA 1OAQH 1JDCA 1NSNH 2EDNA 5HVFB 5K9KB 3KPLB 5LVEA 1W32A 3QO1B 1V02A 1K9FA 2ADIB 2ZX9A 2HISA 2OWXA 4EBQH 5HI5C 3SQOH 3PHQA 1OL0A 2XPKA 1IC7H 5HHOE 1IBGL 1U8JB 4L4JA 5GXBB 5D7LD 3I75B 3VD5A 1WSST 1ZBWA 2GJ6D 1IZJA 4FHBD 1I8MA 3U9PL 4JFYB 5DT1H 5F9WB 3Q6FB 1FGNH 5FO8B 5EPMB 3OSKA 3T8XA 3KZSA 4RGNB 2BFVL 1WWWX 3IKCA 5F1OB 2EXWD 4M62L 5IWLA 4MZ3A 4NZCA 4OM1L 3SDYH 3AI0A 5HYJE 2XWTB 1OLZA 4QTHB 4N0YL 4WGVB 5DYOB 1KPVA 3MRFA 5H8DA 4KROB 1XF3B 5T5FH 1LL6A 3QO0B 4D9QE 3LAFA 3GMQB 4KUCD 1RSFA 2VLLB 1YEDA 3UYRL 2EDBA 5FCSH 4YUEH 1HQ4B 4UFMA 3T0AA 1BVKB 3CFBB 3D1MC 4MD5A 5I30H 2E3ZA 5HHXH 4OCSL 3KLSA 4FQ2H 1K6QL 2Y07L 5F6HI 4JAWA 5E70A 3SUTA 3UR7A 3RUGE 1U3YA 1A1NB 1CDHA 1DUZA 3SGDH 2B20A 4XVTL 1AJ7H 3VD7A 5MENE 3OZ9L 3QXTA 3HG1A 1A9BA 1BP3B 4DEPB 4LLDA 2ESVE 3HC4L 5CMAB 3HPJA 2AJ3A 3WO3B 4ZUSB 3SPVB 3X3GL 1H09A 1TA3B 4G7VL 1BSIA 4OGAD 1PDKA 4JHAH 4TNVK 2X4PA 4NNPL 1LWHA 4OGYH 4BZ1L 3B43A 1JNDA 3FB5A 1KB5B 1DQJA 5CGYD 4UTBH 3L5HA 4UNUA 1LE5B 1F4XH 4XPGH 1CGUA 3W11D 1YN7B 4JRXB 2VLMD 5GGUA 3V6OC 3WFCL 1FHDA 3BXNA 1EOMA 1UXSB 2HMIC 3A0OA 2V7NA 1CU4H 3EGSA 4JO2L 3LS4H 4KWUA 1QNRA 4YGAB 2IADA 5JIIA 3T4YA 4Z5RB 3QNYB 2WNGA 3D18B 5GPRA 2WLZA 5DZNA 2OM5A 4EI5D 2PO6D 5JOPD 4HV8B 4LDEB 4JDVB 3S4SA 4ZSOB 2K7PA 2BOCB 3KJ4B 4H20L 1PG7L 1YMMB 5JORA 1QRNE 2Z91B 1ISWA 1TA3A 2VXQH 4JN2A 1EAPA 5L2JA 1V03A 2GK0A 4ATWA 1BVLB 2AXJA 2JCCE 1VGKA 1WFTA 1GZPA 3F6LA 4CW1B 3EOBB 4KUCF 5D7JA 1MH5B 1OB0A 4UQAA 3CH1A 3T3PE 2AXGB 1EJ6A 3CU7A 1G5AA 1PZ5A 3MUGA 5EO9A 2XI9A 3B3IB 2NY7L 1E6OL 2GT9A 2NY3C 3CCHA 4NJAH 5K9JL 3ARFB 4M00A 4KZEL 2PBGA 5GRVL 1DDHA 1LF1A 3WFDL 3WS6A 1HKLH 1SBSH 2FEDC 5GGQH 2HJFA 3O6LL 2VZ3A 2QL1A 3QAZC 4N8VG 3IFPB 3NACH 3AMGA 3F5JA 2FJFA 5FCUH 5EBWA 1H11A 5EBAA 2FB4L 4YXHL 2X7LB 2RGLA 2CK0L 2VCCA 5F7HA 3GYCA 1JRHH 5I8OL 4X9BA 2AKRA 1P84J 5A40E 3DV4A 3RA7H 2EO7A 4HIJA 4O2FA 5BV7B 4DM2A 2EE2A 1HHIA 2XWBB 4HBCL 3PL6A 5BJTB 4PMDA 3W38A 3JWDC 1HKKA 3HFML 3TBYB 2F54B 4ZUWA 4OCSH 5C3TA 4DZ8B 2H1PL 3QDGD 8A3HA 3MLYL 1UD8A 4MXWH 4MA3B 3OR6A 2OTPA 4K3GA 1ZSDB 4OCRL 1XGZA 3PGDA 4P5TB 3BKMH 4NQDD 3NIDE 3OZ9H 1ZEAH 4JB9L 4JL1A 4Z2KA 3B9DA 1FG9C 2ZOKB 4UOQA 1PEZA 4PB9L 1JYNA 3RWCA 4LEXH 4ZTPL 3NCFB 1DE4B 1J1OH 4B50A 4JO1H 1YMHB 3A67L 1S5HA 1SMOA 2RFXA 1J8HD 1Q4NX 2Q1EA 1H8SA 5J56B 4YHYC 3VXOB 5D5MF 1FV1A 4U1JA 3MCKA 4JFDA 4PJ9B 2DT3A 4PLKC 4XTRC 4ELKB 5DJZB 4F9DA 3PUCA 4OBSA 2YUWA 3GZAA 4JO2H 2D4DA 2WZHA 2DM2A 5DJ0B 4R0LB 3Q6GL 2IG2L 4HWEL 3X11A 4QRQB 4ZOCA 5KTEH 3ZKXB 4OKVB 3Q48A 3MLZH 3GUTA 2FR4B 1A6UL 2QBWA 1OGSA 3GRWA 4OFKA 2VAAB 1U8PA 1T0MB 4NP4L 4DK3A 1MCDA 1PG7H 1YC8A 1DUYB 2ICEA 5TH2B 4JM2A 5HGBA 1I1AA 1RH9A 1ZHBA 2BHUA 5IHZB 4U1GC 4X6CE 3OAZH 3QZWG 4MMZC 5HI4D 3WDJA 5D9MA 2PXYA 1DWFM 4XNUL 5J1AB 1W2VA 4OD2A 3LN4A 1P5VA 1BVZA 2WCAA 5JR1H 4BSVB 2IF7A 4JANB 5C0GA 3BDXA 2ARJA 3L9RB 2XWTA 3VRIA 3AVEA 5FFLA 2G3JA 4P7RA 2QQQA 5HDBE 3SUSA 5HHVH 1ACZA 4PJCA 2AAVA 2IANA 3PTMA 1B3JA 4XAWL 3O6LH 4JZOB 1KBKA 4X6BA 4HOXA 4M81A 1A7RL 2VLKB 3B9VA 2AMGA 4FG6D 5DJ6B 3B8SA 3BZFA 1NGXB 1E28B 4JJ5A 2J7LA 5C09B 5C70A 2BNRA 2J6EA 4O4YL 5TFSH 1GOWA 3WDQA 1T0MA 1BFTA 1UZ6F 2RB8A 1ZHNB 4U1NB 1JHKH 2C3XA 1AD9A 1OWQA 2NTSP 5ESQB 3BKJH 1QA9B 4KROD 5DS8A 5HJ3A 5I8CA 2HKHH 4RFEA 3BLPX 3L3HB 5DXWA 4RAHA 3TF7C 4N8CL 3VXUD 4HBCH 4JVPA 3VD3A 4HFUH 5IVZA 3QWRD 4Y16D 1QBML 3MGTB 4UIMB 5D1QC 2A3EA 3JV0A 1HI6B 4JFXA 2FBOJ 1QNOA 1DE4A 2CH8A 1MUJB 3OB8A 3MJ8A 2FJHA 1D9KC 4U1HB 4AZCB 5D5ME 5IB2A 1OGGA 2Z8WC 1E55A 4ZUUA 2J74A 5DJYA 4JZOA 5GGUB 4F9LA 1F3JA 3FB7B 1KEGH 3VX1A 2MMXA 4JFFA 1Y6NR 1CXEA 4HS3A 2A1WL 2GDUA 1P7QA 3SDCC 5BMFH 1G9NH 5MEQB 1IL1B 1WTGT 5D71L 2G9HA 5DMYA 4HMDA 2GK1A 5IGXL 1M71A 3BAEL 4PY7B 4UOW1 4XP9H 4ZFOA 2GJPA 5FHBH 1W9DM 3L3GB 4WU7B 5IBUB 1W9VA 1RZGA 4TSCL 3U4EA 4M24A 2Z92B 5DMKB 2CYGA 3VD4A 4KJPC 4E8DA 3FRUB 4P2QA 5INCB 1X1NA 2VH5L 1N5AB 4LVHC 2E8ZA 4EUPG 2EDDA 3U0WL 4NQCE 1OCQA 5KTEL 2MPAH 4XXCC 4QT5B 1NMAL 5I6XC 3K8MA 1F90L 4U3AA 3OAZK 2CLVB 2ICWA 2EPOA 2R23B 4KHXL 3VKKA 4F9JA 2VLME 1AHWA 6TAAA 2O93L 5I2IB 1RUQH 1JZ4A 4DZBB 1KIRB 5GS3A 1LEGA 5C0CA 3UP1A 3WKML 3BUYA 3GJFK 1JTPA 2BVQA 3WIJA 3D39E 5MEQA 2DQXA 1CXKA 3IFPA 5DZLA 3V6FB 1I3GL 3E6FA 5C0RL 5GGVH 3U5YA 2JELL 3CPLA 5E2WL 4Q74A 3TYFB 2DQCL 3PWVA 3ILQC 1CICD 1YUHB 2F9BT 1UB6A 2GUOB 5EOCH 1UWGH 2J62A 3MV9B 1EEZB 1ONQA 4YXKH 2R2BA 4ZYKA 1FZOA 3ULUD 5SWQB 1A7RH 1H2JA 2GJ6E 4YH6A 4MNJA 5I6XB 1E71M 1C5DA 3OA5A 4NJ9L 3IRZA 1A7OH 5JMOC 3DIFB 5ANMB 4PJGF 1OWWA 1DHKA 3TTOA 4PLNC 2Y1VA 1QLEH 3IDYC 1CXIA 4DUVA 1MW1A 5DQJA 5IB1A 4AZGA 4MS8D 1FOBA 4RWYL 5LBSL 3PZMA 3BKJL 5H2BB 1WCBA 2F5BH 3D2UB 3CHDA 1HNYA 1CGYA 1AO7B 2CXGA 3QZWB 2AQ2A 4LPTA 1TIUA 1ODAA 2CDGA 3TT3L 2IAMB 5EUOB 2X44D 5C8BB 3H7BB 4L9DA 5SWSE 1JFXA 3ZHLA 5M95B 1F13A 1KCVH 3W81A 4YPJA 1DCLA 5JW5B 1BYBA 1RJLB 2FJFB 4XP1H 1IC5H 1EGJA 1YEJH 4AD0A 3CUPB 3QR2A 1R3LB 1A6TB 1QHPA 1E4WH 5JDSB 4GRWB 2CR6A 4YFLI 3UTSA 3PP3K 1I1RA 5DJZA 5DVOA 3HLAB 1ZWIB 4ZS7H 3MRKB 2WWDA 4QHUB 4DTGH 1MREH 3IDXL 3K2UL 4Q22A 1I3VA 4R90L 1H5BA 4LPWA 5I1KL 3SY0A 5IGXH 3L3DB 3BAJA 5ITFB 3W82A 2P7TB 4M4RA 1D5MB 4CVXB 4AH2B 2VAJA 3RX5A 2CIPA 1B2YA 4QHKJ 1X5XA 1MCLA 4HCRA 1N2RB 3RIFF 1T3FB 4KUZL 4MSWB 1S9XA 4HX1B 1JD9A 2H2PD 5IJVB 2J79A 4XZWA 4XZUB 3OKYA 1E27A 5DUMH 1GVYA 3KAAA 3RIAK 3MFGB 3V6ZA 4N0CC 3WIFA 1ZT7B 5CHNA 4XVSL 2LFGA 1JG9A 5MERB 4AEHL 1OOAA 4GKNA 1JFQL 4GAJL 1NP2A 2EPMX 4WI8A 3BJLA 4QHNB 1G84A 2JCCF 4DK6A 1G6RL 3WKMH 1K4DA 1S7QA 4EN3D 2VZUA 3S34L 3D39B 3H9HA 3QFJA 1B6DA 4ZO9A 1Q0YL 1MCOL 5TQ0L 5GGVL 3EYOA 4LOUD 2OTUB 5CEZE 1FL3A 1OGAD 2WB5A 1CLOH 5ICXB 5EO0B 5D6CA 4WGWB 4JDZA 1HCFX 4HWZA 3NA4A 5TF0A 4ERSL 5I15L 1SJEB 2R0ZH 3PHOB 1LK2A 1G7QB 5I6SA 2BVOA 1JUFB 2AV1B 1O7AA 4IDJL 1ZLUK 1C93A 1AHWB 1LK3H 2HAZA 3IGAB 3HUJA 1N59B 5HHOA 4A2LA 2MQCA 1N6VA 4YHLL 1FNGB 3PZGA 1OSZA 4EI5C 4J28A 1AR1C 1SY6L 2UZXB 4RWYH 5DJYB 5EOCJ 4ODHL 3E6FB 4Y5XB 3DSFH 3OKKA 1CFTA 4UT7L 3MYJA 3WV0A 3ARTA 3BP4A 4OZ4A 1LEIA 1HJUA 4WWKB 3TT3H 2Z9TA 2X4TB 1E1EA 4OV5A 4OF5A 4NRXA 3PP3H 2E9BA 1MVYA 1A6ZA 4IHOB 3P0VH 1M71B 4XPTL 3CD4A 3FT2B 4WUUA 3CFCL 3K1DA 5L2KA 1YEJL 4I8DA 4HWBH 4YFDB 1GRWA 1V3LA 1FYTD 1Q94A 4LCWA 1OF2B 5JLZA 3ULVE 2IQ9H 4ZPVB 3EJJX 5FYLE 1I8IB 2FGZA 1TPXB 4NKMB 1XYFA 4AWEA 3GH4A 3QHMA 5CJQL 1KTKE 3IDXH 4M48L 3V6OA 1CL7I 1S9YA 5DHYA 3GH5A 3TNMB 2CPCA 4PJEA 4FQCH 5I1KH 3QRGH 2V9RA 5L9DH 2OK0H 4F79A 3SDCA 3RFZC 1R5WA 4JY4A 3VDCA 4R2GD 4OCXH 4N8PA 4PS4H 2XXCB 4KTEL 2I9LA 5D1ZD 5DO2C 4MNHB 4HUWA 2X4TA 4X4YA 4S10A 2ZCLL 2CHOA 2G3MA 2HRPL 4QXTB 4PBGA 4GBXB 4UT6H 2I07B 4QOKB 3WEOA 1JWSB 4H8WL 1LHZA 2VXUH 4LSRL 2OSWA 4MAYC 4BFEA 1WISA 3VIOA 2Q6WA 4M80A 3DMMD 2A74A 3VFOB 4MJ2A 1CWYA 3DHPA 5CD5C 4N0RA 3W25A 3WQWA 4X7SL 5JLZB 4RMSA 1HKIA 4YHZH 2KQMA 2FX7H 2FX8H 2OMBA 3RVWD 3QQ4A 2I24N 2RJMA 2O61A 4UU9B 5TE6H 5T33H 4CBPA 4XWGH 5EIQA 2ADGA 2F19H 1VFMA 43C9A 3KHQA 1B0RA 1Q0YH 1KIUA 1U8HB 5TQ0H 4DWHA 1JVKA 4QY8B 3PP4L 4KRPD 3EBVA 5GGSB 2XQBL 1JN6A 2HYMA 4ATLA 3AQUA 5FUOH 4X0NA 2Q8AH 4DKAA 3WH7A 4U6VL 4NZJA 4OGXL 4PJ7B 2GCYA 1RVFL 4Y5XC 4KMQA 4WW2A 2I07A 4ERSH 1DBMH 1W0YT 4Z7QE 4TTUA 1RURL 2A74B 2ORBL 4MADA 4QHNA 4AD3A 3RWHB 4QCFA 4P7OA 4UFHA 4YHLH 3KPPB 5A2KH 1HX0A 1NEZA 3WMCA 1SQ2N 4OQTH 1GYAA 4LYPA 1SY6H 1S9WB 3ARQA 3C5ZD 3MJ9A 1UD3A 4FQLH 4WW1A 5L6YH 4V2CB 4WO4A 3VUPA 5CLTA 1EVTC 4JKMA 2A6KA 1UWXK 5C0AE 3K8LA 1BEYH 5CEZD 3AIVA 1U92B 2OMNA 5MP6H 4PPTA 5KSBA 3PDOA 3AS1A 3IU4H 1BOYA 1LP9B 1CENA 4ZO7A 4PRPA 1FVDB 5IVXA 4RAUB 1QHZA 2MNUA 3DUHA 1MRFL 4AH2A 3THDA 4KV5E 1QVBA 4OLZL 4DEPC 1MHHB 2V5MA 1CBVH 3IJSB 1KNOB 2FGWH 3ZE0E 1A4KB 3B83A 1G7JA 1EUUA 2EH7L 3SGJA 3GXIA 2C26A 3QDMA 2V5SA 4EN3C 2VKXA 3QEUA 4ZAKD 1WEJH 4BSJA 1S3KH 4P0DA 4TSBH 2WHKA 3DXAA 1PQZA 5IIEA 2P43B 1K9TA 4Z76A 4M7KL 1LEIB 3U6RA 4KTEH 3R0NA 4XWOD 1FGVL 2HKFH 3O41B 4HWNA 2DPEA 2DI9A 3BYTA 1I85A 2F58H 2KH2B 2V5DA 2ZCLH 1R3LA 2DQDL 3F5WA 1OAZH 1NUFA 4UT6L 3EFDH 4FS0A 3L2LA 4OQ1A 1D5XB 5J9PB 1KCLA 4UFLA 1UGNA 2MCG1 4GXUM 2D2OA 1NCAH 4X8JB 2DSZA 1KXQE 4XP4H 5CGTA 4M1GL 3KL5A 2WMFA 4M1DH 5C0CD 1UQZA 1MJJB 3BQUC 4HEPG 4L8CA 2I25N 5IB3A 3PGFL 2V5RA 3MJ7B 1KPRA 4EVNA 4KKAC 1E73M 1IE5A 1MNUH 4WI4A 2FBJL 3G6JF 5T33L 3BDYH 3EOYG 1CLXA 1GQIA 5KVEH 3KPOB 4KK8C 4LLYA 3S88L 1R3HB 4P2OB 1MJ7H 4JY6B 1S9XB 1MCEA 4KRMB 2GY7B 3HE7B 1DQMH 4FABL 3N04A 3V7AG 3EBAA 5HPOA 2J6EH 3CX5K 3JWDL 5L8LB 2IXUA 4O00A 4R7NB 4KKLD 1T1ZB 4QHMA 3MV9E 1J8HA 3CX5J 2ZIDA 3F5WB 3TIEB 4MDPA 3HR5A 3P4OA 5J89A 4K55A 4HK3J 4CADA 3SDAC 4AQ1B 5BOZG 4ORGB 1RURH 4FMVA 5I77A 1WWAX 3ET9F 4X4ME 4Q6IA 4IHOA 3U4BL 2J7HA 3DOSA 3QQ4B 3CFKB 4I3GA 1P7QD 4KZDH 5I66A 4FQXC 4D1JA 5I8KL 3O9NA 3U30C 3QDJD 2EICA 2VDPH 3G5XB 3O8XD 4NCDA 4MX7B 4TOYH 3DVFA 2QSVA 3AISA 4OZHB 4LKXB 3IRPX 5DQDH 2YD8A 3CJJA 1PKQA 3HI5H 5CZVL 2C3HA 3GJFB 1QEWA 5DQ9B 1RUPL 4W8BA 3Q0HA 3V8CA 5MHSE 4ZTOH 5AAWA 5A16B 4FZEH 4HWZB 4N9GA 3NPSC 4ONFL 5IP4A 3MRDB 3OKNB 3RGVB 3TA9A 3A6CH 5GJTH 4TUFA 3FO0H 1IEAA 2DQJH 5EZOL 2AK4A 3O9WD 5I75B 3L4TA 2YEZB 3NZ8B 3TA3D 4GG6A 1BIIB 4ZQKA 4HGMA 2XFRA 5L7XH 5J11C 1HHGB 4HUWB 1RIHL 4LAQL 4UQDA 3RWHA 5MI0C 4L8SB 3AYRA 3T0WA 5CUSH 4NC0B 5TDPB 4LNRA 5LG1A 3HRZB 4JG1L 3VCLB 1F4AA 1S9WA 5J8OA 2CCRA 1A6AA 2NW2B 1KXVC 2CERA 1YPZE 2PW2B 1W9PA 4QRTB 5DHXB 5I1CH 4XGZA 3E6HA 4X8JA 2X40A 2ATKA 3QO1A 4M7KH 4UDUA 4CU8A 1RZFH 3GM8A 1MJJA 5KANG 4WUUB 5T3XL 3RWGA 3W9DB 2IUZA 3AXHA 4WF7A 4OFDA 4PJFE 4ZFOL 3VXNA 1WBXA 1PIFA 2WMHA 3AUVA 3K46A 3MV8B 4LX4A 1UQSB 2FO4B 5CEZL 4IOSD 1H0DA 4P2QD 4D0CA 1NCDH 3ARFA 4W5UA 3WL9B 1IC4H 3HMWH 5D2NB 3INUL 4PIRF 1S7WB 2O26U 2VIRA 5CJXC 5IMLB 1FIGL 2HLAA 2X4SA 4R6UA 5EG6C 4KKCD 2X4UB 3OJDB 1QOKA 4XPHL 2ENYA 4EI5A 1R8LA 3HPLB 3PJSB 3B5TA 4WJ5A 1DEDA 1B2WH 1US3A 1I75A 4RX4D 1TVHB 5L0QB 3WHXA 3ZKND 2CDEA 4GRLA 3WIHL 4A3YA 1OPGL 2OI9B 4XPBL 3F5LA 1T5WA 2A73A 2R1YB 3SKNB 3OG4B 5GRUH 1NC4D 1EDGA 2BNQE 2GSGB 3EJYD 3G04A 2BVEA 4NSKB 1U91B 1JPTH 4WFHD 1J11A 2NLJB 5T3ZL 1CD0A 4OI9A 3H3PL 3QNXA 2QR0A 4NRZA 5E4EB 3ULVL 1OTSD 4L4PA 4N42A 2WV3A 3QDJE 2PTVA 4Z9KB 4DWSA 5IBTL 2W0FA 3KPQB 3GKWH 5BXTA 1AP2B 5DK0A 3WXVL 4X4XA 1I1CA 1DQLH 4YO0B 4A6YL 1MJ8L 2B1HL 3WJLA 3FHAA 3WIIH 1DQQB 4LIQH 1J0HA 4KK6C 3OHXB 3SDDD 2NZ9D 4HA1A 4XP6H 4W87A 2OLDA 3KXFE 1DSFL 3MBXH 1QPKA 1I1YA 3QPQC 1AHWC 4TOYL 2A9NL 5E8OA 1KACB 4P2OA 5KSVB 1BD2A 1U95A 3HI5L 3JTTA 3O3AA 4YBQD 4L5FL 3HNVL 2EBNA 1GC1C 1ZHKB 3UAJC 3QUML 5DT7A 2DWDB 3DVIA 4L29A 2FZ3A 1XZ0B 1NARA 4ONFH 5C0FB 3V4PH 5L2KD 3TO4C 2XQYG 4K2UL 2E9WA 3FO0L 5EZOH 1HILB 1LDPL 4LHUB 3VXTA 2XRAH 4KQ4H 3ULSB 1QFPA 5L7XL 3RY5A 4C83B 1J5OL 1P6AB 3DI3B 3TN0C 3NIYA 5ESQA 5D7KD 4MAVA 4YEEA 1NBYA 3G9AB 4OLUH 1LL7A 5HYQA 5DI8B 1ZGLA 4O51A 1NAMA 1IKNA 3AHZA 3R4DA 5FA4B 1T20A 1FZKA 1UCBH 2YKLL 3EOBA 5CJBA 3W39A 3O2DL 3HZMB 4OF0A 4P8XA 5IW3A 2AK4E 1R5IB 3RNKB 3G6LA 4PRPB 5IVXB 2HJLA 4AYSA 4GG6E 1FNFA 3RZWA 1E6SM 3BKYH 3STZB 1CL7L 3REVB 5CIPH 4MDIA 4HKJB 1W2KT 2OL3L 3VIIA 4K3JL 3RWJB 1MI5B 1MEXH 1Q9KA 2LQRA 1YMHA 5DSCA 4PRID 3NIGE 5JOEA 1MYRA 2VN7A 1IT9H 2AEIT 5D7IA 1J1XL 4LSSL 4ODWA 4U1SA 1UXSA 4B3LA 3QIWA 4PY7A 5FA3A 1B2WL 4MQSB 1BTCA 5C8JB 1OARL 2XGIA 4CU6A 1JGVL 2DQUL 3WIHH 5ELIA 1ZA6A 1A7NH 5LA1A 2VRAA 1U41A 3BZDA 2XV6B 4RZCA 3ARBC 3RIFK 3DX7B 5C0IB 2YPLB 3ULVC 3HNSH 2WP3T 1MFCL 4MAUH 3MO1B 5EWIH 5FYLL 3DNKA 5DS8B 3F65A 3I9GL 1GUVA 1Q1JL 4KPHH 1XD1A 2GSIB 2C1PB 5D8ZA 3O11B 4HJGB 3PXJA 3BKCL 3ILPB 5D7SL 4CKVX 2GJZB 3NIFE 2Y5TA 3W6LA 3STZA 3IDNA 5D6DA 2XTKA 3QUXC 3UJIH 1OM3L 4CAGA 1FIEA 3UO1L 3VNZA 3ARDC 3X3FH 3WD2A 4NKDB 4ZOBA 2R69L 1U9KA 1I1FB 3AC0A 5EBGA 1I9IH 1E4KC 3KYNB 4KK9D 2YRZA 1AI1H 5E5RB 1WGOA 4PTXA 1MQRA 4OCMC 3QEGL 4YHOL 1TVHA 4Y8AA 3H3KA 2YDSA 4JO4H 1MCJA 3OWEA 3WLWC 1DQDH 2F8VA 4LXFA 2KPNA 4KRPB 1KCRH 1ORSB 1ITCA 3MBXL 5FL0A 3QHFL 1PGRB 1I7UA 3QUYA 3TYGH 2YLAA 4NSKA 4ZO8A 5T3ZE 1OD7A 3GMPB 4PJCF 1OB1A 5E2VH 4PSPA 1NFIA 4ZENA 3SCNA 2X5PA 4G8FB 4OFPA 3DHMA 2L4OA 4GW1B 4EN3B 2IFGA 5BQ7A 3MV11 4M03A 5I9QC 1RIVL 3P0YL 3UMTA 2EIZA 4U1MA 1KB3A 2YL8A 4HZ7A 2BY1A 4UAOB 1LDPH 2HT2D 1I8MB 2QQKH 1U3HC 2LTQC 1KCSL 5IB1B 3GUTB 2NZ9C 8FABA 5DA0B 4ELMB 1E6RA 3QUMA 2F54A 4DOHE 1KJVA 4RRPA 2VI0A 3U7VA 1IM9A 1A0QL 4HUXB 4BQ4A 2FO4A 3TO4D 1FL6B 4QXWA 2UWEF 2YD5A 2O9RA 5F96H 4D94A 4ZFFB 2B5IB 3RIKA 1W91A 1HJXA 1RZKC 3NIDF 1PX8A 4GW5B 3QI9D 2Q7NA 4D6IA 1KCUL 1N3NB 1ZBCA 4MA1C 3MRDA 3OKNA 1KFWA 3MFFB 1JHLL 4JFFB 3O45B 1QFOA 3U36B 4FFVC 1P7HL 2ZICA 4P59L 2J8GA 1W72A 1E0VA 2A83A 4TUKH 4G43A 3NZHH 3K81A 4XBGA 3FN0L 5GRJH 5CKAA 2W61A 5BYWA 1L0QA 3E0GA 4LCWE 5TDOB 4NN7B 1BGGA 4M8UA 3MV8D 1SJHA 2X1IA 3RJQB 4Q7DA 4Z7NF 3MRHA 4AZ7A 4OCYH 5FM4A 3QEHB 1RUAH 3EW3B 5IFAL 4DUXA 3U4AA 3QUYC 4P5TD 3WD5L 2X2YA 4OIBA 4Y4HB 2AEPH 3HE7C 1WITA 3U83A 4WDIB 4ZAKC 3OF6A 4UAOC 4NM8H 1BIHA 3WIHA 3V0VB 1KFAH 4WJXA 3OGVA 1BOGB 3EOAB 4MCYB 1PX4A 4JHZA 4ONHA 3KJ4C 4HIEB 4FTVD 3DRTA 1ACYH 2EDKA 2BSRB 3HG1D 3LB6D 4IS6A 3D2UD 4XCNB 1IZKA 5IB5B 5LWYL 1R0AL 3UCQA 3WH8A 2WSKA 1BD2B 3JTTB 2W91A 4JPWH 1FH9A 2EIDA 3CSYB 2BVQB 3DURA 1F2XK 3FO1A 1NUNB 4AIZA 4OZGB 1BVNP 4WV1A 2WKGA 2R69H 4O5LH 3PWJB 4EJ1C 4MVBC 4GBXC 3UYPA 1OP5H 2OYKA 5CQ1A 5DGRA 5ID0A 4ZUWB 3C5JA 1KCRL 4EKJA 3KYAA 2AJZB 2D0FA 3TH2T 4AT6A 1UB6B 1B0IA 4M6AA 4JREC 4K8RL 1X5FA 3TEUA 5KSBF 3EYFA 4LHQB 5C0EA 4RIRB 4YHNB 2G4FA 2H45A 5IFHH 2E27L 3IETA 4M5YL 3TCLB 4GQPH 4WHYG 5E8PB 3KNBA 4P2RD 2OYPA 1GC1L 1YJDH 1NLDH 4ZG1A 4HX1A 1QFHA 2FECL 1IGYA 3TBWA 3VH8A 3RVXC 2HJLB 4HIIB 1JGUH 4F37F 1XRVA 1FFPA 4LFHG 1QVOA 2AJVH 1V0LA 1H5BC 3BRGC 2CLVA 4TNVF 2B7DT 4I5BA 4P23A 4R97C 2BVTA 5CEYB 2DI8A 5JMRA 4LLVA 4YAQB 1SVZA 4PRHA 3HE7D 3L95B 4IMKA 1C12A 1XIWA 3GBNH 2K3TA 5E1AA 5GGTA 5TD4A 5JA9A 4P2OD 5IVXF 2VDKH 1EK3A 2UZIL 4GS7B 4J2XA 4CUCA 4XX6A 3MYZA 3CFBA 4KK6D 2BJML 5TF1L 1CR9L 4LSUL 3CNKA 1W3JA 1KCKA 4LYRA 4QLKA 1J0IA 3S98A 1VB9A 4URIA 5JORB 4UFJA 4CCEA 4AD1A 1OW0C 5KG9A 3LKSA 3CLEH 5KSAD 4HU8A 2CD0A 1FORH 1KTLB 2JIXB 3LPWA 4D6DA 4OSUH 5IEKB 5D6CB 1QFWI 1H4PA 4PJIF 4PJXE 3TFKC 3WMSA 3VGAC 2NXYC 4GRLD 5I5RA 2EDFA 3DRTB 4HIEA 4U3CA 2VDNL 3RKDC 1KG0A 5A43C 1FZJA 2X4OA 3W37A 4OCYL 2UV3A 3H0TB 1N2RA 5IFAH 4Y1AD 5CSBA 4XMKH 5A8OA 2XFXB 3IXTB 4NUJB 4WI9A 3T0EA 3CZGA 5F70A 1YDPB 1XCWA 1J0ZA 1I1AD 4A2MA 2APFA 4NM8L 4LQ1A 3SKJH 3TO4B 1ZT7A 5I16B 3F12A 3OAUH 1IKFL 4I18A 2B2XL 3DX6B 2R4SL 2FYYA 4NRRA 2EPKX 4ZAKB 3B8YA 1Y18A 1MHCB 1CD1B 3MRFB 4Z7UB 5ESVB 2UY3A 1FVCB 4EQ2A 1TVBA 1OINA 4NN5B 3CXDL 3LN5A 2YBRA 5KW9L 4D6GA 2A38A 4H2CA 1UC6A 1INQB 1IAIM 4JPWL 4O58H 1AMYA 2PI6A 3ZR5A 1KXQA 1I85C 3TH4T 1TQBB 4MD5B 4P23C 1HYSC 1HEZB 2X4QA 5J7CC 1AE6L 4ONGL 3SO3B 1VESA 3ULUE 4X6FA 4G6AD 4MQ7A 3LKRA 3QG6B 2EH8L 1KG0B 2EQDA 3U5UA 4X4ZA 4AY0A 5GZOC 2J78A 4X9GA 3L7FB 3TT1H 3DETD 4TVPE 5MEOB 4ZS6D 4PD4J 4K8RH 2Z4QA 5KJRH 2M8XA 4L3AA 3OKDA 1IILE 1MCCA 2V17L 1KJVB 2UZYB 2ZG3A 3WD3A 3CMGA 1V7ML 1L6XA 4G8GE 1DLFL 2Y6SC 1QSEB 1HSAA 3SGKA 4JRYD 3TTSA 2LAGB 3CC5A 4NIKB 4R4FL 5B38B 4HUKB 2XPGA 5DK3A 3VW3L 1TR1A 5KVDH 5FYKU 1K2DA 4UDTB 1ZANH 5CBEA 1IL1A 1YEKH 3CDGB 1T6WA 4K71C 3KPPA 3NSNA 1VIWA 1DR9A 2P45B 2A6JA 2X7LA 4FTVE 5F88B 5BZWA 1RIUL 1E4KA 2YD9A 2YWZA 3QUYB 1QNQA 3U4EB 2ZCKL 3C8HA 2R4RH 2UZIH 1AQ0A 2GFTA 5HJ3B 5I8CB 5HBFA 2D03L 4GW1A 5FUCC 3VXSD 4ZE5A 4Q58C 3MXWH 2XG5A 4YHEA 3AMCA 3R1GH 4AK1A 3QBTB 4JAMB 2P1YA 4LCWD 1C08B 1BHGA 4JRXE 3X14A 3O8XA 3FFCB 1OM0A 4ZNCD 5IHZA 3IDUA 1P6FA 3QI9C 5ERWA 1D6VL 1Q6DA 1EZVY 1WCGA 1KJ2B 2YD7A 4JFWA 4MCYA 2HA1A 1FFPB 1MHEB 4BH8B 5IB2B 3NCJL 4YPGA 1QBBA 2RR3A 5DD0H 4YXLL 1LK2B 2NPLX 3GSXA 4WTXA 3RILA 4I5BB 2VDNH 4HT1H 2YS4A 4WHTB 5ECJE 1Y18B 4ZFFA 1L0YA 2JTDA 1A3RH 1CXHA 5E8DH 2EDXA 4WTZG 3LN5B 4GW5A 2RFXB 2BVUA 4FFZH 1QLRB 4BUHA 2W9EL 3LPGA 1MAML 4P99A 3DX8B 1HXMB 3GSNL 5JW4Q 5EUKB 1WCQA 3IDMB 4FQJH 4XPAL 3DV4B 5KAQF 3VMNA 3HNTL 3BD4A 3MLVH 3X14B 3WYRA 3DYOA 4OCWL 4TNWK 4WY7H 4XHJC 3MRGB 2XWBA 4X6CA 5K59F 3OLEA 1CGXA 2FR4A 1RUML 2OZ4H 1QYGL 4G6KH 2J4GA 5E8NB 2K1MA 1OF2A 4F37K 4KAQH 1HJVA 1A7BA 3DUSB 4PJBE 2QTEA 3BE1H 1GOMA 4F80A 3TT1L 2Q7YA 5B3NA 4XB8A 5DJ2B 4PJCE 4LKCA 1QG3A 4OD2B 1J87A 4PJ7A 1IQDA 2HFEB 4LEOB 3FOMA 4YK4C 1XCXA 1S5IL 1CWVA 1MCWW 2E7LA 1ZTXH 4UNVA 1DBKL 2DQTH 2V9TA 3TFKD 3H9SB 1ZBVA 43CAA 2EDOA 3HC0A 2PO6B 5J6GB 4PJGA 2VZOA 3E8UL 3MNZA 5B21A 1C1EL 4CJ0A 1YN6B 2VLRD 5ABEA 3JSSA 3D85B 4JIEA 4L4TE 2W59A 3W9EB 5CLWA 3IJ7A 2IWGA 4CGTA 3HZKA 3L7FA 2R0LL 3GB7B 3MODL 4IJ3C 4NBYB 4XWOC 4C4KO 1QA9A 2GIYA 3B9AA 3RBSA 2B1AL 3T1FA 1A3LL 3QXAB 3RDTB 1NCBL 2CNCA 2ZXDA 5SWZB 2FWOA 4HGKC 3GHBL 4X80L 1BG9A 5HHMD 3TONA 4JFFE 5B38A 2EO9A 3CBWA 2R15A 1JF1B 1IRAY 2VKWA 3FCTA 4GT7A 4HKZA 4Y1AA 2XFFA 4JQVC 4PG9B 1V6WA 1MCWM 3WL1A 1VPOL 1TITA 4TYUA 2VR9A 3CFJB 2ADFH 5TDPA 3NCJH 1Z9OA 3JV4B 4F58H 2A0LD 4NKQB 5F7DB 4NWTL 3ZQ9A 5BVPL 2V5YA 1NFDA 1A47A 1K3ZA 1X3DA 3EDEA 4G6JL 2DQFB 4QLJA 3KPSB 5EBMB 1RPQA 3P2TA 3L3DA 3OGSA 1MAMH 1OAQL 3L4VA 4QDMA 1NSNL 4OOZA 2YC1A 5GS1A 4JAMA 2QMKA 1WAWA 3PXHA 1PKQB 2IPKA 3RWFB 4EBQL 1Q6EA 3OKMB 4EE9A 1IBGH 2PWGA 3VO0A 5T3XD 4LASH 3OJDA 5DRZB 5HBBA 4HAGA 4PLOB 1J12A 4OZGE 2A3BA 2QLYA 3II1A 2CDEB 1KNOA 4S2SA 3MOQA 1T89A 2WW8A 2BY0A 4DZBA 1XC6A 3QDMB 5GRYA 1JPSL 5GRWA 1EO8H 4HPOL 1K8DB 4PJBB 5J0BA 5DR5H 2XIIA 4FLQA 1EEUA 1VFAB 2EXYD 5CBEB 4MD4A 2JJWA 1BX2A 3KXFD 1HJSA 1FHGA 4PRIA 1TQBC 1TG7A 3D0LB 1H3PH 1HXMA 2GK2A 3ZO0A 2PXYC 1C5CH 3S97C 4KH2A 4LGPB 3WBAA 1HHHA 4YUEL 1MFEL 3KL3A 2Y25A 2Q8XA 5E2JA 5ABHA 1FA2A 4Z0XA 1S7TB 1K6QH 2Y07H 1H0IA 5E99L 4GMTL 3EHBD 3L5XH 3OQ3B 4Z2GA 4X7FC 2DQTL 4K71B