2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAN26A
publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
2EO7A 3U0PB 3WE6B 1LE9B 1GUVA 4DUXA 1KACB 1SMOA 2PYEB 1I1RA 2VB5A 5D2LB 5INCA 3I6LD 2BVOA 1CICB 3L3KA 2BNQD 1FL6A 2WW5A 3V7AE 2ADGA 2VDML 2VDPH 3AU1B 4MS8C 4XGZB 1PD6A 1EFXA 3MLUH 2NW2A 4PYGA 4MSWB 3CHCA 4LU5H 5KG9A 5ICZA 3EYFB 6CGTA 3AFLA 4OCWH 1XCTB 2ENYA 2RFXB 4P9ML 3UTPE 1I3RB 4OSUL 4ODSL 3T1FA 5EMYA 4LCWD 3KL3A 1G6RL 4M4PA 3EOTH 1R3KB 4GH7B 1MCNA 1NGXA 4TUOA 4WW1B 3O2DA 1FP8A 1MEXH 1WAAA 5CD5C 1PQZB 3VINA 4PJ7E 4WY7L 2EC9T 5IGXL 4RFOL 4G43B 1X5KA 1EBPA 5I0DA 4OIBA 4RGNB 3SJVD 1QRNA 2FIKB 2HT2D 1E27B 4X6BB 5FYJD 5C2BH 1KCRH 1ZGLB 2X8RA 1LO4H 2HKHH 1DQJB 1GH7A 4UDUA 4AMKL 5EIIA 2WVVB 1YEJL 1HHJB 1W2VA 3KWXA 3ARPA 4F33B 3QEHB 5F1KC 4JFFB 5HXMA 1GJWA 1DANT 4WO4D 3C2AH 1X4XA 1K6QH 2BRRH 5HDRA 3WO3B 4NRXB 3VGAB 2FSEB 3GM0A 2WNWA 3OB0K 1WDRA 4NQCA 5EOCH 1OB1A 2CHOA 2XZZA 1PVHA 4IDJH 3H7BB 4F8QA 3FO9A 3WYRA 2ZICA 3M46A 4AZHA 2Y07L 1ISZA 5I78A 2GTZA 4X98A 1WWCA 3UC0L 4PJDE 1NWSA 4K23L 3MUY1 2QQLL 3IDYB 3KE0A 1FYTB 1GOHA 1G7JB 3PTMA 5I6SA 3H7LA 2Q76B 4JFPB 4ETQA 2ORBL 1V3IA 2HRLA 1NAMA 1W1YA 4XTRC 3B9KD 15C8H 3MRCA 2IPUG 1QR1A 3PZTA 1O5DT 5KS9B 1U8NB 1RUPL 2F54B 5J56B 4U6XA 2NY5H 3GSNL 4GRWF 3OKMA 3N1MC 1MHCA 4LSQL 5DJ8B 2AV1A 3G5ZB 4U1JB 4QHKI 1H8SA 2DWDB 1JZ8A 3O3DA 1CU4L 4JM2F 4GG8A 3G6JF 1IT0A 3RKDD 1RK0B 4Q9CA 4X5XA 2Y24A 1XF5B 3LEVH 3JWOH 5I30H 1RHHA 4QHNA 4W87A 3WQVA 4PRBB 1KXTA 2G75B 4UAOC 3P30H 5E94A 5GRJL 2VRQA 4Y4HC 1JP5A 3HZMB 1KSRA 3BT2L 4JFEB 2EPMX 3L3DA 2VRJA 5M17A 4PJBE 5D7LB 2J7CA 3MLWL 3WQ4A 1EXUA 1E4XH 1HWHB 2YBTA 1KTLA 4P59L 4PREB 3THMH 3NBNA 5A8PA 5BVPH 1N5AA 2IQ9L 3R1GL 2XRAL 4P9HH 1Q9WB 1WEJH 2VL4A 1KJ2B 3MGAA 1ETZB 1ODZA 2WZHA 3G08A 3T1WA 2F74A 1L8NA 2ID5A 1S7SA 3I2CH 3MS8A 1FRGL 1J0YA 4LFHG 1NMAH 3WV0A 1MRCL 3W2DH 1JFXA 4H26A 4J23A 1HSBB 1XGTB 1QSEA 4L5FH 4YPJA 3IFLH 1X7QB 4NRYA 5IQ9B 2EE2A 3CPUA 1YN7B 1IL1A 3C6LD 5E6IB 3S34L 1KQYA 5E56A 1U58B 2CK0H 4G8GB 2AJ3A 2XT1B 4PJ7F 3CZJA 1KBBA 3P4NB 3ARYA 4X6EB 4BUHA 3HMWL 5IMLA 1AFVH 5IF0B 5CEXA 2M2DA 3SDYH 2X6MA 3G9AB 4PYHA 2BCKA 3VFSA 4GSDH 5L2KB 3L1OL 2W59A 2XKNB 3DXAE 5L6YH 1HN1A 4KVCL 2D7TL 3UTTD 4S11A 2XSAA 2JELL 4FTVA 3TOPA 3IDGA 4KMTL 3WFHB 3W24A 1S7WA 3GBMH 1IAOA 5T1MA 1LWHA 1FG9C 4GJTB 3WEXB 2LU3A 2F53B 1X5YA 3BSZL 3OKEA 4FHBD 3QAZC 1AXIB 5C0CD 3ARED 5TDOA 2D9QB 4CJ0A 4FQCH 2NY6C 2CBJA 3CFKB 4PBGA 4X6CE 1N6QL 3F62A 4OGAC 5ITBL 3BO8A 4JZ5A 2OTWB 1A2YB 1QNZL 4FLOA 3L6FA 4UOW0 4H41A 2ITCA 5C3LD 2WKLA 5FIPA 1INDH 3SGJC 3R0NA 3MO1B 4PJCA 1LO2L 2FGWL 3GBNL 4OZOA 4Y4KC 3QRGL 4HUUA 5E5MB 1TNNA 1HINL 3N1AA 5GS0H 1B2YA 3K4ZA 1C92A 3VDBA 3CVHB 4XRCB 4NN5C 4L8BB 3BN9C 4P5TD 3U2SB 4FQJL 2C7FA 4JKPH 5AZEL 5DURD 3VJ6A 1FV1A 5DD5H 3MBXH 4LOUD 4ZO9A 2DYPB 4RMUA 1T0NB 1T1YA 1FH9A 1E6OL 5BS0A 1J86A 2E8ZA 4I1NB 1JPFB 4PJIB 5EO1B 1W1PA 3KS0H 2CGRH 4P7RA 2ATPB 3V6ZA 5IUSA 2HMID 2Z35B 1KTDA 2AVGA 2BY2A 3OLGA 3TN0B 2C4XA 1T4KA 3MV11 4ODTL 1CGUA 4PMZA 1X5HA 3BWAB 2J79A 5B3JE 2AJZA 2X09A 2O93L 4HIXL 2UY3A 1WQVT 4CVZA 4UU9A 1WAAE 2VNCA 1FAKT 4JFQA 4PP1C 3ZT5A 4AG4H 3MCLH 1UA6L 4FQLL 2JIXA 3NZ8B 2XN9B 3RVWD 1NLDH 1OGSA 3BZEA 2WNGA 1YMHA 5T5FL 1X5XA 3QWOA 4D9LL 2FJFA 2K7QA 3JUZA 1RVFL 2HVKA 2H32A 1F90H 1QRNE 3UJIL 5F7DB 2VVNA 4Q6YA 2HP4A 2OYLA 2QSCL 4PV9A 4ACPA 4TQEL 4LEXL 1DWHM 2ZWLT 2YD9A 4HH8A 3NABL 2G60L 5MP6L 32C2A 3OPZL 1JPGA 3ZHKA 1IQWH 3GMRA 1KJ2L 2VIRB 2X7LB 4WRLA 3CUHA 4M7LH 2MHAB 3ALXA 5H37H 4NQCE 5C86A 2XFYA 2HRPH 1OWQA 3BPOB 2VN4A 2NX5B 5DDHB 4PPTA 2BVTA 1L0XA 3ZJ8A 3RX7A 2YL8A 2ZUVA 5DT5A 2X0YA 4PRPA 3RILA 5C0DB 4HV8B 2HFTA 2W07A 2VL5A 4HUXB 3H9HB 3RU8L 4P2CG 1W8OA 2YPVL 5BW7A 2I26N 4W89A 3B8SA 1XZ0A 4XB7A 1UWIA 3GNML 5ILTL 2ICWB 1Q6DA 2FDMA 4M6NL 4GAYA 5DJ2B 4FOMA 1UH4A 2OWWA 2CKRA 3B3IA 2IALB 2O9TA 4OCYL 4KJWD 1JZ6A 1E4MM 1JNEA 5EOCJ 5LJYH 1A0QH 3MJ9H 3HE6B 5IFAL 3QUKA 2CESA 1DLHA 4PSPA 1E4LA 2WXDM 1SY6A 1V3MA 3HG1A 4N8CL 3RVXC 3INUH 1RFDL 5IB3B 4GRMA 1KGUA 4NQSA 2Y4SA 3ZIZA 3P4MA 1P7KB 4P8UA 3CFEA 1U92B 4LK4A 1J0JA 2R15A 3L5WB 5DJZA 1J05A 1FPTL 4OGYL 1INQA 1S5HB 4JFDB 1FIGH 2PW2B 4H8WC 3BPCA 3FN3A 4UV4L 4RQQA 2B4CH 4AZGA 35C8L 5IDIA 3ARGA 2AJUL 3FFDA 1EOKA 1KUMA 3TIEA 4JFOB 1KNOA 2AEPL 1I1FA 2YKKA 3KYOB 4U1NB 4BUGA 4YFDB 5JA9A 1FSKC 5M3WA 4JM4H 4X4ZA 4PMUA 4UQBA 1IQDA 1ZA6A 2V38A 3GXFA 1XSIA 1ND0A 1OB0A 2AERT 5FOJA 3CVHL 4S3JA 3IFOA 4P46D 4Q6IB 5DD1L 3SHSA 4N0UA 1B9ZA 2R1YA 2ZPKH 4AYFA 2DEPA 1S9KC 4QCFA 4G6KL 2EDTA 1UR4A 2Y9RT 4LSRL 4UR9A 1A7PH 3C60C 2W0FB 3IDMA 3T04D 1H15A 4PRIA 2YD5A 4A2LA 5JW4N 1W3JA 1M7DB 3FB6B 5TDNA 1AP2A 1ZVSA 2AK4A 5JR1H 4KXZH 1QSEE 4MB4A 3VGFA 3KPRA 4OCSL 3EYPA 5BXSA 3WHE1 5EUOA 3MV9B 5IP4A 5EOTB 5B3JF 3PV6A 2V3EA 1BQHG 3IU3B 1K8IB 1JUFA 3MRHA 4O5LL 4Y4FC 5CZKA 3FFCD 5CIPB 2AJYL 4KPHH 3PXHA 1AGEB 4YNYB 4DKEL 5C0EA 5HHMB 4I48A 4Z0XB 5T1DL 4DN3L 2EH8H 4OD2B 2FBJL 4LPCA 4EDXA 4U1SA 5BRPA 1H0DB 4JRWA 1NOWA 2VLRA 1HYRC 1GOMA 4ZQKA 1H8OA 1A1OA 1TQCB 1G0YR 4FTVE 4YDVA 3TGXA 4Q7DA 1BQHA 3TZVA 5IHLB 3FQRA 4NN6B 2VDLL 5HI5C 1J5OL 4K68A 2VZ1A 1KYOJ 4PLJC 4QCIA 4ELMA 1EEUA 4NRZB 1UT9A 3BH8A 5DUBB 3DX6A 4UTFA 4YHNA 1HHKA 1RJYA 4NC2B 4C4KT 4ZS7L 1GHFL 1S9VB 1YEHL 4RFNC 3HRPA 5CFHA 2EDWA 4JZNB 4NYLA 3AIQA 4N9GB 3U7WH 4PJCE 4PMNA 1PW3A 4LCCA 4PLKC 1CLOH 4S1RL 5KOMC 3FMGH 2X4RB 1LEGA 3OJDA 4JFXB 4K7PY 5GGRY 4BFIB 5AC5A 3EYQD 5KEZA 1M1SA 3BPLC 4U2ZA 3TA3D 1VGKA 3MNWB 3O4OB 2XWTA 2VO5A 3HS0B 3N18A 1OAZL 1B4JL 3J7HA 4AK1A 4CMHB 4F2MB 1HXYB 4AIZA 3N85L 4DKAA 4OQ1A 5TE6L 3MLRH 1RZ7L 2OL3B 4HFWA 1VGEH 3OR6A 1K9EA 2ZX7A 2EXWC 1FYHB 2WHKA 3HR5B 5BS0E 3CSGA 4MNHB 3GKZA 1FZJB 4CJ1A 1GL4B 3PDOB 2IANB 1M71A 5AG8A 5DUML 1J7VR 4XNQA 4M9PA 5B3NA 4MAZA 3QP3A 1IFHH 1HQ4B 1SJXA 2FHBA 5E8DH 4F79A 1V6VA 1CDYA 3QH3B 2E9BA 4L3EB 3ARFB 3G6LA 4HS8H 4AZ5A 4L8SB 1ES0A 2IH1A 1NCAH 4RL3A 5EU3B 1G9HA 3L4UA 1JIBA 2UWFA 5GZOD 3D3VA 5I5RA 1I8IB 1CL7H 4EUPB 4OZFH 4K8RL 2MQ3A 4Z7UF 5E08H 5ETUA 1JHLH 3GKWH 1KPVB 3CX5K 5JZ7D 3TVMD 1IM3A 4HDIA 3RWJA 2MMXA 3LAFA 4URIA 3MJ8A 3KS0J 5EIVA 1KENH 5DYOA 1NSNL 1JF1B 1FL5A 3VWJD 5SX5H 3OGRA 4HAGA 1BF2A 1QLRA 2V2WB 3ZHDA 1KGCD 2AOSA 5FM8A 1MI5D 2ZUNA 1MXDA 1BZQK 1BQCA 3Q5OA 3LKQB 4IHOB 4B0MM 1B3WA 5D7KD 3WF3A 1XGUA 2WHLA 3SPVA 3VXTA 1ONQA 1YEIH 2X10A 1EQCA 3V4VL 4L4TD 2W60A 1SM3H 5GRUL 2ZSWA 3LIZL 4PRPE 2Y1VA 5K9KA 5D1XA 1TA3B 5HYJD 3BC9A 1NOUA 2ADIA 1HILA 3O2VH 5F9WC 4NNXA 1U8OA 1A4KB 1FJ1B 3RGVB 3FQTA 4H8WH 5JO5A 3U4EB 3VOCA 4PUBH 3MV7D 3HC4L 1WZMA 3CH1B 4Y2OA 1XR9B 4NM4L 4CGTA 3PTKA 4XXCA 3BCDA 2CPCA 3HJEA 1ZS8A 4D2NA 4MVBD 3BAYA 3UR7A 4W4OC 4CRPA 3UP1A 1Q0YL 2IAMB 1DJSA 1E28A 5K9QG 2A3HA 5ABEA 2VDNL 5CWSA 4OD3H 2VX7A 3IDUA 3PQYD 5B4MD 3UPRA 3HCVB 2I9LA 2CLZA 3HG1E 2VX4A 4NBYB 4JKLA 4NF7A 5CSGA 2PO6A 2CLRB 5I76A 4MADA 3FHQA 1H5BC 2DJ4A 3KLAB 5EBLA 3VXMB 4HD9A 1QBML 4BQ6A 4PJ8B 5KVEH 4CVWA 5D1QA 4Z7OF 3C6SA 3SCRA 3MA7B 3GMQB 3F6IA 1FH7A 4MNKA 4GRLC 2ZUQC 3RDTA 1KB5H 2HT4C 2O9PA 3FO1A 2FJGB 1KN2L 1W0YT 3AYRA 2V9RA 1EFQA 3C5JB 3B9EA 4RDQG 1RIVL 1NLBH 1CFBA 4EOWH 1H11A 4N0UE 4XVSH 4ZYKA 2BVDA 3ULVF 5HHNB 3RUGB 2OL3L 2VXTH 2VLLB 4XB3A 1ROWA 2LVEA 1JXKA 4KI5C 4KQ4L 5GS3A 2IADB 5FECB 5T5NG 3OXRB 3KL5A 3SUSA 2A0LD 2CSPA 1KPUB 2C5DC 4PRIE 5FUOL 3QEQB 1I9JH 1QSVA 1ZLUH 1C8PA 1D5IL 4PMOA 1IGJB 3KPRE 3OF6D 3LEYL 1DBKL 4ZFOB 1MQKH 3IDNB 2J12B 4RWHA 2J7GA 3WKZA 2YKLH 4LCWB 1R24A 1UWXK 2D3LA 5D1ZA 4Q9BA 4FN0A 4DWSA 4JFZL 4PY8J 1TETH 5JHLL 4KUCD 2OSLA 5F1SA 2ZX9A 5C08D 3IJSA 1SQ2N 4QRRA 4I0PD 5DT1H 1OSZB 4XCCH 1N0XH 1PZ5A 2EH7L 3SDAC 4JN2A 3LPFA 3O2DH 3Q6FB 4PJAF 3CPLA 5KSVA 4CADB 3ARDA 1IM9A 1R86A 4KRPB 3SDXA 3VG9C 5DHVB 2Q86A 3TPUB 4YHLL 4APQA 4E8CA 3N11A 3RBSA 2B20A 2AAAA 5D4YA 3I50L 3TESA 4QXUL 1KIPA 4KMLB 5F7LB 1BHGA 4MB1A 2YUWA 4FZEL 4PMQA 5D2NA 1JGLL 4J6RH 1UG6A 3BIKB 4M5ZL 1FZMB 4F9PC 4LCUB 4WO4B 4EI5A 3ULUF 3AB0C 1QW9A 5CBAB 4P2QD 3MJ6A 5DVNA 3P73A 3A4WA 5F7KC 3H9SE 3DX8A 2QQNH 4XPAH 3O3EA 4L3CA 1R5IA 4DQOH 1ZOXA 4WCYL 1GGBH 1UADC 5F3HA 5JBEA 5DK0A 2Y06L 5HDOA 4JB9L 2WVTA 2AI0H 3QCVH 2YRZA 3X12B 4G8IA 3OQ3B 5EO9A 2QMJA 1T5XB 3NFNA 3IETA 1WDQA 1VPOH 3HZYB 3UTOA 1K2DA 5CJOH 2FEDC 1NAMH 3B9KB 3JTSB 1JWMB 1KPRB 4LARL 2XJ7A 1RPQA 4TULL 4ERSL 2DLFL 3QXAB 3LN4A 5TQ0L 4GW5A 3I6KA 4UOJA 1E4XI 4X7SL 2WHMA 3TBTB 5DJYB 4F7MB 1KEGL 2XICA 1NFDF 1QFWL 1UM5L 4KY1H 5I1JH 5FGSA 1N82A 2EBNA 3WNNA 4MNJA 4ZOEA 1WC7A 3KLHD 2DPEA 3D3VE 4IRSD 2XG5A 5KN5B 1KEMH 4JO2L 3K80A 3U7YH 1UB6A 3E2HC 5F6IC 1MF2H 1U91A 2HAZA 1S9XA 5JA8B 3PHAA 1Q94A 4N90E 1C5CL 5IM7B 3L4WA 4NBZB 3SGEH 3OAYK 4UBDC 3SURA 4OAWA 4J3OC 3RQ3A 2W66A 4D1JA 4AZBA 3UTQA 3DSNA 3PHQA 5HVHC 4PCSA 2VKWA 4WU5B 3MNZB 4XVJL 2BHZA 4AH2A 5I2IA 2VXUH 6FABL 2J8FA 3U4BL 5HDQH 2W9EL 3SDCC 4DGYL 3VXOB 5JLZA 3REVB 2X4TB 4E42A 4QF1A 4MCYB 4OKDA 3K74B 1HHIB 1BTCA 1N5YL 3ZDXF 4BH8A 5JOPD 4YIQA 2A6JA 2DM7A 1YNLH 3RVUD 2D31A 5J89A 1H0IA 2OJZL 5E1AA 3FOLA 3RWFA 4HZ8A 4L4OA 2MWCA 4ZFOL 2XPGB 3V2AR 1EEQA 2VC2L 3VFUB 5BXPA 2XY2A 4RE4A 4PGJA 1D5MA 4QRQA 1S7XA 3C6LB 3MBEA 1UXSA 1WZ1L 1TMCB 1E6JH 3ARSA 1KELH 1F3JA 2ZE0A 5AWNL 2V5DA 1OGAA 3GSUA 3P77B 5CMAA 2HG5A 3KEHA 3VGHA 4HGWA 4U1HB 2Q8BH 2WKGA 5IWLC 3EUUA 3CK0H 1G9EA 4MD5A 1A6UL 4X0KA 4YK4C 1I7TB 3GI8H 2XWJA 3GIVB 1RIUH 1AHWB 3O2WH 4FQXA 1IC4H 1LD9A 1WT5C 2LTQB 5I1EH 2XNAB 1XGYH 1VFAB 1Q9OA 3DTXA 3WFEH 4LQFH 1KLGA 3NAAH 1N64L 1P4IL 4GXUN 2DT2A 1QUNA 3L2MA 3TYGL 3FOMA 5C0CB 3MKKA 1PX4A 5DLMH 5CEYA 1EERB 1OAKH 4R90L 3H9ZA 1GAFL 3BPNB 2Z91A 5ACLA 1CE1H 4DAGH 3DPBA 4NPYA 5I18H 2G9HA 3U57A 3LQZA 4KUZL 1ZLVK 1MJJA 5DMGC 3T65B 3OKDA 4GG6B 1E73M 2YR3A 5IK3B 1QPXA 4XCEA 1J11A 4ZUTB 3TTOA 2X4NA 3QQ9D 1UOKA 4LSVH 2OQJB 4OZGA 3PWUA 4P5TB 3NCJL 3IVKA 4ZENA 2W9LA 1DE4B 4F7EA 4CD6A 2FX8H 4G8FA 1A3HA 3T0AA 2X9WA 4LBEA 2VX5A 3VRLE 4FQQB 2FWOA 1JJUA 1UC6A 5GISH 1LP9F 1FH8A 3DECA 1F58H 2NY1C 3KLSA 4H88H 5EC1B 3D25A 1DQQA 1OCQA 3DHJA 4M6OH 4WWKC 1U8JA 5E2VL 4KHXL 1MELA 4JPWL 3QDJD 4I5BB 3EYVA 4YC2C 5J13B 3D2UA 2EEXA 3SO3C 4IOSD 5DD6B 4MNMA 4UT9L 1JYVA 3SCVA 5MI0B 4P49A 4LCCC 1KIQA 4PRDA 4QRRE 4F3FA 2BRQA 3CMJA 2J62A 1ACYL 1JNLH 4HIHB 2BMKB 4W8LA 4Z7NF 2GITA 2CIIA 4LLYA 3BH9B 3L3IA 3EHBC 2VISA 2ZUWA 4U3CA 2DQHL 3SDXE 5I15H 4BZ2H 5E0FA 2R1XB 4EKXA 3WQ8A 2I60L 4M00A 4KZDL 3WUWG 5HYFA 2NY3D 3RWEA 2ZOKB 1GJIA 2H32H 1JZ2A 1DQDH 3CSPA 3F7RA 3O8XA 2DD8H 4O2EA 4WI2A 5I1LB 4U3AA 3BQUB 3M45A 5D2NE 2G2RB 3MOBL 2CRIA 4I3GA 2X1PA 4DVRH 4GAJL 1U93B 1U8IB 3WHXB 4Z7WF 4Z77B 3PZNA 3SEPA 4ELKA 1XGPA 1J0ZA 1WFTA 3R8QA 4I13B 2GJRA 2NTFB 3NIFF 2K9UA 4C57C 1RZ8B 4G6JL 4OUUA 4P2OD 4TUJA 3MRPB 1MIEH 4JPIA 3CUIA 1T20A 1NMBL 1U2CA 2DMCA 1C08B 4W6YB 2WCSA 5M03A 1T6WA 4BKLB 4MD4B 5FUZL 4KH2A 3ZDYE 4ZS6D 4LVNB 1IGCH 3DV4A 3T4AB 1MHEA 4HUNB 3BRGC 2GYSA 3OR7A 2AW2A 4ONHA 4D94A 2XWEA 2WBJA 3WNLA 3RIFF 2R2EB 4ZAKD 5DA0B 1S7TA 4KKLC 4Z2HA 1UGNA 1PG7W 2EDQA 3EDKA 4C7FA 3H3KA 1OARH 2YRLA 3JVGA 3TBWA 5CD3B 4MA3B 3WO4B 4ATLA 2KKQA 2AQ3A 4PY8I 3B5HA 4R26H 3LZFH 4TRPH 3RIFK 2YXFA 4WFHE 1BYAA 5EBWB 1E72M 3HHRB 1E4IA 2DQFB 1SY6H 3FO0L 4OZHF 1JGVL 3PWLB 4EVNA 5JORA 4AW7A 4UZUA 4LSPH 4H8VA 5D1XC 5ESAB 2QHRH 1LO3H 1F4WH 2OTUA 4KAQH 2DLTA 4S2SB 4NO0D 2OZ4A 5FOBA 4CU8A 4N9OB 5FV2A 5IMKB 1OAYL 1AI1H 2RCSL 2M26A 4WJ5A 4GBXD 2VLMD 4KXZI 5BJTB 1WKYA 3C8DA 4ZODA 1QKZL 3PP3K 1QSZA 3ZTNH 4Z76A 3ZZ1A 4IMLA 3OWEA 1WBXB 1IC7L 4IMKA 4KRMB 3HUJA 5DUPH 4I2XA 3P9WB 3GHEL 5C70A 3UAJD 3WNOA 1NDGB 1SJEB 4HBCL 3RWCA 3TBYB 4YE4H 4P46B 4LLDB 3EOBB 3DRQB 2DQCH 3SBWC 3GRWA 3MLXH 5KANI 2HVMA 5I3DA 2V6HA 3TJEH 1MREH 3IJHA 1JMZA 4HU8A 4K9EL 4XPTH 1FN4B 1FLRH 3ZR5A 4R7NB 4RGNC 2VWEE 4HH9B 4RDQF 1EMTL 4TTDC 2IXVA 3AY4C 3G6AA 4PGZA 2VX6A 2JB6A 4LEOA 3JV4A 1JTOA 4H1LG 3FB7A 2Y5EA 5HDBF 3NYDA 1TZIA 1J1OL 2DN7A 3QSKB 5D1QC 4TOYL 1HL8A 4LLAA 3VVGA 2LQRA 2DF3A 1MWAA 1IEAA 2Y36L 4I77L 4YQXH 3TBVA 5M94B 1DQLH 1DDHB 3FFCB 1EZVX 3NIGE 1OGAE 3H0TA 3I75A 1UXWB 3L3HA 3LKSA 5ADPL 3GSQB 4JN1H 1IGFH 2C3GA 3BKJH 1L7TH 4UILH 4XCFH 1JMXA 2PW1A 4H1LA 3KGRA 4OFPA 4PTMA 1I8IA 2UY2A 1FHDA 2ZJSL 3IDYC 2E0PA 2D1ZA 4KRTA 1CE6A 3Q1SL 1IC5L 4HUKB 2CDGA 1YC7A 4S1DD 1ZHKB 3K7UA 4XBEL 3DMMA 4WIQA 5KAQG 5FYJU 1TCRA 4L9LA 5IB2B 3A4AA 4OT1H 5E8EB 4N0CD 3IKCA 2D7NA 5D1ZC 3LRSB 4PG2A 1LDPH 5EU6D 2NPLX 1I7UB 4M8QB 1TVDA 1MIML 3SE3A 3ZDYF 1KJ3L 5F96L 3FQXB 2MTPA 3V0VB 1VFMA 2NY0D 4KKBD 5C07A 2Z4QB 4C54A 4XPHH 1OIMA 2WUBH 4G5ZH 1DWJM 1GJUA 1BLNA 4TUKL 4XP5H 4OZGE 5D8JL 2NLJB 2PTUA 1R3JB 3S5LA 1MY5A 4X9YA 2GJJA 4LLMB 2EDNA 3MMEB 5HJ3A 1FJ1A 4NO3B 5I1GL 2UY4A 2PYFB 1P7HL 1ZL1A 1NGZB 5J6GB 3VDHA 2Y72A 2IQAB 1FVDB 3P9LB 4KK5C 2EPOA 2IBBA 1BG4A 4FLRA 1R7OA 3NMEA 3TNMA 4P4RB 4NZUL 3S37L 1IAIH 2I07A 3PUCA 2DMKA 1VIWA 3HPLB 1WCBB 2X2YA 4ZXBD 1JCKA 1OM3L 2MCPH 2B1HL 2R0WH 3KWWB 4HK0B 1BZ9B 2G3JA 1BFVL 1RIHH 4MNGB 3W0WB 1H5VA 5CJQH 1G7HA 3ZKMC 2PXYD 3GSWB 1OP5K 3HZKB 3K1DA 1RZGB 1AKJA 1E4WH 1CFVH 4NQEB 3TVMB 4KJQD 1I1AD 1C5DA 1K5NA 3NACH 4FFWC 4HXAL 2CRZA 1HKKA 2ARWA 1W1TA 2F19H 4QXGH 1N4XL 1ZV5A 2NZ9C 5CS7A 5E6IC 3WS3B 1W91A 5IVZB 5LAXA 1AC0A 1OTUD 3VWJB 5E7BA 3RL2A 2J77A 5MEQB 1RJCA 3W11D 4MJ6B 1MI5B 4XZBA 4WV1A 2RGLA 4LPWA 1FVEA 1YMMA 5DWUL 1XR8B 2DLIA 3C5JA 2EYSB 4M43H 4XCYB 5CHNA 2XOTA 3ZHLA 3GZAA 3BVNB 4GMSL 5C0NC 3MROA 3QWRD 5LGHH 3WXWH 1AGCA 5GS0D 1V0LA 5BV7L 2GK0B 5FUCE 4DK6A 1CXEA 2BHUA 2BNQA 2E7MA 5D7SL 2CLVB 1EO5A 5LKNA 2IC2A 1NC2D 1OP9A 3LKRA 2OR8A 3MV7B 1KULA 2OK0H 4PTTB 2IPTH 1RJZB 3EOAA 4JDTH 4XWGL 1R3LA 2FRGP 1HH6A 4F7CB 1N6UA 4M62H 1U3JA 3QI9D 4XNMB 5IHZB 3FZUD 4X4YA 2F8QA 1KJMB 1MQPA 2YUZA 2V3DA 1G7LA 5DI8A 1V6XA 3RA7L 2EYTB 4E41B 4RBPK 3LPPA 5FD0A 3PQYB 4RWYL 2MJWA 1CXKA 4U31A 1XYFA 4R5EA 3MRLA 1T83A 3SO5A 4H2CA 4LIQE 4UIKH 5E4EB 8FABA 3OHXB 1VESA 1K6AA 3AIWA 3SJVA 1EA9C 4HG4K 4JY5H 1TPXB 1YEKH 1Y18B 2ZKHL 4NWUL 1MFEL 3B6SA 2DDQH 3O6MH 3TNNA 4R4NC 2DLGA 4DGIH 3B2UD 3GSRA 5DRNB 1FFPB 4JZOB 4G7VL 4NJ9L 1IJ9A 3TN0C 4CBPA 3P3YA 4M48L 4Y16D 1NAKL 4I2XE 4X83A 5CAYB 2ZCHL 5TE4L 5KVFL 1IAMA 5C9KA 1HNGA 5GZNC 4UDTA 4F57H 4HHAB 4RSVA 1FNGA 4QYOA 2OLHA 4YLQT 2YJQA 5GIRB 2RBLA 2JCCA 4FQXC 1XGQB 4M6ML 2P45B 5L8KB 3EGSA 5GRVL 3U4AA 1QQDA 4KJYA 4MJ5A 3BKCH 5EBMA 2R4RL 4LRIC 1ZU8A 1EO8L 1JZ5A 3QNZA 4B53A 1OGGA 3HNTH 2GHWB 2W9DL 1C1EL 1MSPA 1I4FB 1ADQL 5EZLB 1SMDA 5CEZL 1WNOA 1RP8A 4X9GA 4QHMA 5IG7A 3WIJA 5I73B 4I0PB 3M07A 2Y6SD 3PGCA 4D0CA 1KWGA 3W5MA 4DKFH 3FQNA 5IQ7L 1HOCB 1MQRA 1HXMA 2WK2A 1OPGH 1HH9B 1IMHC 1F6LL 3X14B 5H35B 1UWTA 3QXWA 4OLUH 1S46A 3F7YB 1W32A 5LXGL 4YXHH 5D93B 4UT6H 4AYSA 1FG2A 3U7AA 3DIFA 1UKPA 1N8ZA 4GAGH 4L8CA 2W38A 4U49A 3QIUD 4I18B 3STZA 3FQUA 4JM2D 1NJ9A 2BY3A 4G80B 2HKFH 5CG0A 4F7TB 2DQUH 1S7RA 2GJZB 1U8QB 2BOBA 1F4XL 1TZHA 1BFOB 1PJ9A 1QFPA 4ALAL 2VH5L 4NBXB 4NRSA 1WDSA 1SEQH 3VRJB 1Q9KB 2K7PA 2DLHA 3TCXA 3CXHK 4O58H 4ZSOB 1ZK9A 2VT0A 4YJZL 5C07E 1AO7A 3I3DA 4J4PC 5DFWH 5EU4A 2IWGA 4U7MA 3RAJL 3LSOA 3QO1A 3GZKA 1NBVH 1YY9D 5ICYA 2PF6A 1RURL 1I85A 4MDJB 4PJHF 2YC1A 1OF2B 4Y2DD 4MTVA 2AQ1A 3MLSH 5E9DA 2Q8AH 4QLKA 2BNRD 4NQUA 5HSFA 5ITFB 3SGEI 3TO4B 5FL0A 3KPNB 1J1PH 1AXSB 1FC1A 1T7YA 2R23A 1MAML 4PN2A 3P77A 3DO3A 5CZVL 3UTPD 4OQTA 1VFBA 7FABH 3RPIB 4QLJA 3D48R 4GKNB 1NCBH 4DW2H 2R2BA 4Q6IC 2ERJB 5ESQA 3KXFA 3IDXH 2Z93A 3IDJB 3CUPA 4OTXH 1HT6A 1D5BB 5TF1H 3UTTA 4P7NA 5I74C 4KK6C 2BOCA 1TJGH 5I17B 1MNUH 3IFNL 1I8MB 2BSED 3IJYA 3U0TB 4PUEA 4WI8A 5JTWA 4X8XA 1YUHB 3VH8A 4HFUL 4GXVL 2NZIA 3AREA 2J8UB 4EIGB 3WNPA 3L5XH 1D3CA 1XF1A 2VMFA 3JV0A 4WFEE 4KK9C 1BOGA 5KVDL 4M7JH 3NZHL 3WFCH 5L9DH 4U6YA 3QHFL 5ANMB 1U6AL 1JPTH 5I9QB 3LV3B 3PWPA 5GJSH 3RTQA 5BXRA 3S96A 3DO7B 1V6WA 1YMME 2A3BA 1HDMA 4R7DB 1BYDA 1QFHA 1RZFL 4IRJA 5K9OB 1RZJL 4FXGA 1A14L 2A74B 3UG5A 5HGBA 2V5TA 3VXNB 1TQCC 2FECI 3CJJA 4JPVL 1HK6A 2BNUA 2EIBA 4KFZC 1K4DB 3I6LE 2H45A 4K3EL 4XB8A 4NN6C 1E15A 5FXCH 5T3ZD 1JFHA 3D85A 1GQLA 3ZJ7A 4OV5B 4ZEPA 1AIFB 4OZIE 4YBQD 4TNWF 1D6EB 5B8CB 2D0HA 2YBRB 1CG9A 3WIHA 3PZGA 2BFVH 3WLWD 3HMXA 5A2BA 1UM4H 3CZFA 4ENEC 1MFCH 1NFIB 5GGTA 2SEBA 1QFUH 3WY1A 1S9YA 2D3NA 5IB1B 1GPFA 2KH2B 3MRIA 3TT3H 2WMKA 4TNWK 1SVZA 1S7QA 1XF4A 2BSTA 4DZBA 4KK8C 3GSOB 4GKLA 4QT5B 3LS4L 1A5FL 3DUSB 4CN4A 3BW9B 3D0VB 4OF6A 1NBZB 2HLAA 5GS2D 4S3KA 2N7AA 1P2CA 5JBDA 3LPWA 4X8JB 1VEOA 1JGEB 3ROOA 1HF6A 2HT3D 4WHYG 4CMHC 1Q6GA 5F3BB 5D5MB 4DGVL 4UQEA 1X5LA 1IEBA 4NWTL 3SJVE 4U1GB 5FYJE 4B16A 3SKJH 2YD8A 5I1AB 2RIKA 2XSBA 4ZNCD 4XMKH 4Q74A 4JRYA 4XAWH 1JYWA 4M8VA 5DQJB 4LRNH 1MUJB 3FB8A 3MGTB 3U1SL 3JV6B 1AJ7L 3AS3A 2CRMA 3BZFA 3HFML 4UQ2A 4WU7A 5IEHB 1Y0LB 2C7UB 5I1KH 4NM8L 1B30A 2QV4A 3VIPA 1URLA 3ARFC 2A6DB 3QQ4B 5B38B 4NZTH 1KB9K 2GT9A 4L8SC 4GQ9L 1ORSA 1X6NA 1LE5B 5J0BA 4XMLH 4KTDL 1NDMA 3B5GA 3MRDA 1O0VA 1U8MA 2VE6A 2AS5M 1NARA 2Z92B 3VMPA 1XYZA 3UYRH 3VFVA 4BK4A 2QHLA 5CILH 2X05A 1BM3L 5J11B 1B3XA 2C26A 2VR9A 3P40A 2VJXA 3QG7L 2EQDA 3QDHA 3DETC 4IS6A 3HC0B 3KPMA 1QLFA 2X4OB 3UTSB 4RRPG 5BQ7A 4LYQA 4XX1E 1G6RA 4PJ9B 4ODVH 3QDJB 12E8L 4AEFA 2YLLA 1RZIA 2VABA 4PG2C 4B9ZA 1PZUB 5FYLE 1WE5A 1XCQB 3HMCA 4U3XA 4L3AA 2W4XA 2OI9B 3R06B 3G5YB 1TVHB 3NCOA 3RGHA 1LVEA 1CENA 4HWNA 2EIZA 3T4YA 5CLWA 5F93C 4UB0L 4P5KB 4RRPA 2PWHA 1CT8B 3LQAL 3QUXD 3WS6A 2P24B 3E3QE 3QUZD 3DXAD 4XP4L 1DUYB 3TTYA 1DBAL 4OF5A 1KLFA 5A6KA 3RWIA 1FL3A 1LEKA 5HGAA 4U6VL 2R69H 1T04B 3KAAA 1ECEA 3SGKC 3LDBB 2PN5A 1N2RB 2DBLH 3VFMA 4OI9A 1PSKH 4KKCD 1BVNP 1U95A 5F7EH 5I8OL 3KPOA 5C0JB 1I9IH 3UCRA 3UZVB 2R4SH 1NP2A 3EDDA 3K46A 2IAMC 5FCUH 4J2XA 4E2OA 2CXKA 3MRGB 2C3VA 4Y4FD 4P2OB 4YBLB 4PGCA 2UY5A 3BP7B 1Z6JT 5FL1A 3BDYH 1AO7E 4WI7A 2VSCA 3O9NA 5KSBB 3GB7B 1FIEA 5EN2B 2O61A 1IKNA 2DIAA 3TFKC 4JO3H 5I75C 2H8PB 5HYIA 4PJ8C 1ZGLM 1A7NL 5E9DE 4PBWD 4ZAKB 4XH2A 3ZLQC 2XIDA 4PJXB 4HUVB 4ACZA 1CD0A 1EFXD 4PTUA 1OWWA 4HQQH 3VI3E 2CKNA 1E6XM 3K2MC 4LDEB 4CNIA 3GI9L 1CEOA 4OLYL 3O45B 3EYSH 5BOPA 2ARJA 5CGMA 2DSWA 1ODUA 3W39A 4TX8A 1NCWL 3KXFE 1GVIA 4AT6A 4B3KA 5DEFB 3VKKA 3KYKH 4Y1AA 1FGVL 3ZR6A 3UTTE 4TVPH 1QVOB 3VMNA 1ZA3A 2Z31D 2XVLA 3JXAA 4LIQH 2RJMA 1CFNA 5DJCB 3EFDH 4JY6B 1F11B 4HAFA 4MDPA 4NZRL 4PJFA 4HC1L 1KCVL 1QA9B 4NO0B 3DC0A 2X4SA 1AGDB 3S98A 1T21B 2OZ4H 2N56A 4GBXB 1QRND 4NDMA 5E8EA 1CD1B 1G0DA 4YWGL 1U8LB 2C4FT 1HJWA 1RSFA 5INDB 3EYOB 2DH3A 5I1HH 4GW1B 3RMEA 2YZ1A 5HHOB 5ERWA 5MENA 3ZT6A 4M8QA 3PHOA 3PWPE 1CLYH 3L95B 4MAYB 3LQMA 3RZCA 5E8OA 2DKMA 5HHXL 4QRTB 3CIQA 5E2UH 4OD1L 4R3SA 4NQCD 1MCPH 4POZD 3GRWH 4AZ6A 3TA3A 3EJZD 3LMJH 4LKCA 1VRXA 1YEFH 4NHUB 3SCMB 4IJ3B 2E7LC 1NMCC 2HT2C 1C12A 2OJEA 2V9QA 5D71H 3WIFA 3E8UL 4AL8L 3DHUA 3MMEA 2XG4A 4K3DL 3FN0H 2A1WL 3MLYH 5C09A 4AEIL 5TDPA 1RHFA 3QCTH 2B1AL 4Z95L 2KZ1B 3QA3A 1UD8A 1EGJL 1ZTXL 4NQXB 4N0YL 4KI5F 2E7CA 4Y5YB 5I66A 4G42A 4WW2F 1I7ZB 4P7LA 4WO4C 4RMTA 4CMMA 4JHAL 2V7NB 2W5FA 1I7RA 1MWAH 2DQGH 4MJIB 2P5EA 2J5LB 4JHBA 3M8OL 4Z78B 3TONA 1G0CA 5LCVL 2UVFA 2PKDA 5FK9B 1OLLA 5IVXF 1JYXA 4D6FA 3KNBB 4H1LH 2WC3A 5IEKA 3CMOL 1WIPA 4PJGB 4WKHA 2BJML 4U1MB 2NW3B 3JV5A 3QISA 5IV2B 1EVUA 3OLIA 3PDGA 3PIQA 1TITA 4HCRL 4M4RA 1C7TA 3DROA 1K4CA 2XXCB 1P1ZA 3LOWA 2FX7H 4JDVB 4PRAA 3B9KC 4P48A 4JRYE 2YHGA 5F7FA 1BGXH 1GGIL 2VDQL 4N0FB 4NHCH 4LLWB 3BESR 4JJ5A 4MJ2A 1MFDL 2D22A 5EU6B 3GO1L 3AROA 4LCIH 3IKKA 5JBFA 4L8DA 2D03H 2G5BB 3SCOA 4LSUH 3BH4A 1TZGH 1P6AB 3VIMA 3RKDC 4J3VA 4PRHA 1IAII 4FFYH 1VFUA 2NY0B 1KIRA 4L4TA 4R0LB 3VD4A 2AEIT 2P8LA 1S8DA 5J3HD 3WUFA 2P7TB 4J1UA 4PGDB 3DRTA 2VDPL 3O41A 4XPFH 2CLVA 5HYJA 2PTTB 3VX1A 3WJLC 4NC1C 3MLUL 4LU5L 4YDJA 3ARUA 1B1YA 4LF3B 3AUVA 4OCWL 2IXUA 2HJLA 2WC4A 2GTWB 4QTHB 1NWUA 1MCOH 1QSED 3MRMA 1JYNA 2VZ3A 3EOTL 2E9WA 2J8HA 1YQ2A 1W9VA 4LPVA 2YD3A 1MCFA 3CUJA 3ZKSD 3QPQD 1MEXL 2ZG2A 4NNYA 2EEBA 3VI4E 3CDGB 1WPCA 4LFHD 5DJDA 4ZXBB 5LGJA 1BAGA 4L4VD 1MFVA 2KBGA 3WFLA 5HGDB 3GMMA 3LN9A 2CIKA 5C2BL 2PXYB 3CGTA 3MRFB 5I8CA 1LEIA 1KCRL 1LO4L 4RAVB 3V52H 4DUWA 3QO0B 2HKHL 4R4FH 5K59E 3HAEA 4ZE5A 2Y2WA 2YPKB 4F15B 3MU7A 5GNZA 2O9RA 4D8PB 1XF3B 1JWSA 4HPGA 1YEDA 3C6LC 1MFNA 2VCBA 4IRZH 5E0CA 3PNWA 5JNYB 3C2AL 4YDLC 2BRRL 1K6QL 4ZUUB 3UZQA 3PWNB 1HVQA 3NSXA 3WD1A 5EOCL 1G9NH 4M61A 3KYAA 2X1OA 2ZUMA 4IEFB 1WJ3A 5E6ZA 4JEGB 3ME0A 4JQVA 3V5DB 1A6ZB 5EU5A 2VAAA 2X40A 2V17H 3K3QA 4LNVA 1AHWC 3CTTA 5CLTA 3AXHA 5HDLA 1P4LA 1P5VA 2LTQC 4PTXA 4PYSA 5IKCB 3RY5A 4X7TA 3T3ME 2UWEA 3AREC 1HJQA 3BSGA 5JQ6L 5IBLD 1MFAL 3BPNC 3O4LB 1KGXA 2NY5L 2EC9U 2JIWA 5BS0D 5J6HB 3TBSA 1VJSA 4XPGH 5K9QI 5FYKL 5C08A 2YWZA 4RFEA 3QI9B 3BZDA 1PEWA 4JR9H 1EVTC 2WV3A 4QXTA 5H94A 3BGMA 1HOCA 2HFEA 1YPZB 1KWKA 4IRJC 5C0AB 1B3ZA 1HVXA 4EBQH 3LEVL 3JWOL 5I30L 1OWRM 4Y1AE 4P5TC 2CXGA 3P30L 4R4BB 4Y8AA 1Q9LA 5FGRA 1UD2A 1MVFA 2WWMD 3DBXA 2HFFA 4LOUC 3P4OB 1Z3GH 4K9EC 2JIXD 4ORGA 4X6FA 5FYJH 3TC9A 4PJFE 3TM6A 2FX9H 4BM7A 2UYLB 5D6CA 4JFYA 1E4XL 1Q38A 2HMIC 2CMRH 3NDZA 2ITDA 3THML 5C92A 4W88A 4P9HL 5MI0C 1QRKA 3LPGA 2MCG1 5MENE 4P2QA 2DQEH 5K33A 5AUMA 3U9UB 1WEJL 3VFPA 4C59B 3AIRA 1IILE 1C3FA 5T1LA 5D72H 1KLUA 4EXPX 2N4IA 1JPST 3I2CL 5F7UA 1XCWA 4QRUB 1NMAL 4CN6A 3RVWC 2Q8XA 3F5KA 3W2DL 3DI2B 4UIMB 3ULUD 3EO1A 4JAMA 1W0WB 4L5FL 2IG2H 2JTDA 3D69A 5F71A 3IFLL 3OIHA 3W27A 4JG1H 5TH2A 1E6RA 3HPJB 5GSRA 1G9MH 4QNPE 3FHAA 4PRPD 5C09E 1PX3A 1D6VH 4GOSA 3FT2B 4Z0BH 2J7DA 2UY6A 4ONFH 4PG9B 4DFIA 5FEBA 3L4VA 2P5WA 3VCLA 3NIYA 4Q22A 3GUTA 3UESA 1N3NA 5HVGB 4X0VA 4IIQA 1AFVL 4JLRB 5FYLH 4HPYH 2P5EE 3D0LA 4FLSA 1OAXL 2M1KA 5E00B 4KRLB 2YMXH 3QXDA 5TFSH 4OZ4B 5L6YL 3ZKQD 4XC1H 1UVQB 1RP9A 4NKIH 3GBML 4IRSA 4OCMC 5GGVY 1R3IH 3OKNB 3L3OB 1GOKA 1ZEAH 2DI9A 2GSGA 4W86A 3I3BA 1GC1H 2DI8A 2CDFB 3QIUB 3GMLB 2XFXA 3MGOA 4WI9A 3ALFA 3M6DA 3RWGA 3X3GH 1BF8A 2RAMA 2Z8SA 4U1IA 4X6DF 1INDL 3FRUB 4KJWC 4LAJH 4Z7VF 4LKXA 2DIBA 3WO4C 2JJWA 3ARGD 3BYTA 2ZNXA 3V4PH 4A3YA 5ISZD 3WF2A 1G7MB 3W5NA 5DQDH 5GS0L 4NSKA 1XF2A 5DR5H 1XH3B 3FJTA 1A1MA 4PRHE 3G6MA 3W0KA 1CFTA 4ZPTB 5F9JB 1FFOB 4JKPL 3HE7A 5FHAH 3WS6C 4QHLB 2YSSB 1DEEA 3MBXL 5DD5L 3WD5H 3T0DA 2VLJA 1BBJB 1M05A 5HYJE 3BI9X 3IGAB 1HHHB 1U8KA 1FE8H 5SWZA 3BGFC 3CH9A 3VXQB 1T6VN 3IAQA 2V2XA 2IH3A 1A7RH 5TQ2H 3QAZB 3KPRD 2ZZUT 43CAA 4AY1A 5D7IA 1IAKA 4ZTPL 4EK7A 1T1WB 2I5YH 2NY6B 4XCNA 5JW4Q 4P7OA 1YN6B 3TV3L 4OQTH 4F37F 3OAUH 4P46C 4YXLH 1UR9A 3EZ8A 4ZUSB 2W62A 4AG4L 3MCLL 1O7SA 4JFEE 4G8EA 3L3GA 3VD7A 1CGVA 1HKLH 1NLDL 3QXUA 3Q5TA 2YD4A 5D5MA 4RISH 1YPZF 4F37K 3DURA 5I1DA 4NN5B 3VFNA 2P8MA 4XAKD 5D2LF 3TZVD 1F13A 2GJXA 4KKNA 3ULSA 4YAQB 1X1NA 3I9GH 5CQ1A 4ODBD 5F97E 1IQWL 43C9B 2DQDL 5K93A 4M7LL 5EDXA 2F9BT 2HRPL 4UQ3B 1DWAM 2XIIA 2NY2D 2J47A 5CSBA 5DJAA 4NC0B 4WNQB 5DZNA 5DK2B 3H9SD 2WYSA 4RX4A 4X4XA 2W65B 3ZOAA 5ICXA 2ICES 1T1ZA 4BS0A 25C8H 4PJDB 1WBYA 1UKQA 5D8WA 3EHBD 3SUUA 1A9EB 2UWEE 2VRKA 1L4IA 5DRXB 1EIBA 1DFBH 4X99B 2GAZA 3CUFA 2HN7A 1A3RL 1FLTX 1S7VA 1CF8H 4PY7A 5BZDA 1QNPA 3BEVA 3HMXH 2OLDA 1UJTA 5GGTH 4YPGB 1A0QL 3MJ9L 1OGTB 4MCZB 5C08E 3IS1X 4AZ8A 1PG7H 2I27N 3BRDA 3AXXA 2J7EA 4WTXA 1EAJA 4HBQA 3EYQC 3IFPA 5FO7B 3INUL 3L7EB 5DS8B 1BEYH 3NGBB 3TA3C 4U5KA 5HHVH 3WSQH 2UZXB 3B5TA 3APGA 1T5WA 5T1KA 4NFBA 5BOZG 4YHPA 4OZFB 5LA0A 1FIGL 4UFJA 1AQHA 3D3VD 1JNNH 3CCHB 4NQVA 2H2PD 4R2GD 1YEEH 1XIWA 3A6OA 1U8PA 3O3AB 2B4CL 2ZXDA 1KXVC 4JG0H 1SYVA 2QSTA 1NCTA 3EFFA 4ZNEA 4XI5D 3L9RA 2E6PA 4G3YL 4N90D 4PJBB 3QZWG 1S9WB 1H0GA 3BZ4B 4JM4L 1KN4H 1IGYB 1CXFA 3W9DB 4NCDA 1UZ6E 5DZLA 3RY6A 5B39A 2XYLA 5DJ6A 4WHYH 4NKDB 2BXZA 2WIIA 5GGSY 1V7MH 2ZPKL 3OAZK 5KS9F 2GUYA 4WUUD 3TT1H 3VXUA 1CPUA 4KMQA 3F7VB 2BY1A 5GZOC 3V5HB 1GZPA 1YJDC 4HF5H 1A7PL 4P3DA 4GKZA 3QZWA 1FH5H 1M7IB 4NO2A 2ZSVB 5JR1L 3PWVB 4TUFA 5M7QA 5JZ7C 4Q9RH 1QFWM 3TVMC 1JVKA 3W25A 1OD9A 1G7IA 2VR4A 2CUIA 1A7BA 4CUCA 1EH9A 3VWJC 4MD0B 4CL7A 4QRSA 2V7HB 3WH6A 4LPYA 2Z9TA 4HZLA 2P5WE 1CVSC 4KPHL 4ZE4A 4UFMA 4P4KD 3QHNA 1U3ZA 2EH8L 4KDTA 4ZXOA 3TA9A 1NEZB 1K85A 3OZPA 1AD9B 3SCSA 1CFQB 5D4QA 4U3HA 5DJ0B 4HMEA 1NGWA 5BZWB 3VRIB 2WCAA 1A6TA 5A2FA 4UNUA 3LKOA 3GSVA 4RFOH 1GVYA 5EFIA 1QPPA 3QUXB 5JOFA 4HX1A 2KZWA 3ESUF 3QUZB 3DXAB 1H3TA 3MODH 2DWEA 5EU7E 3WUEA 5E0QA 3VX0A 3HNSH 1P4BH 3KYNA 2PO6D 5I6XC 3L7FB 3RJQB 4M1GH 4KRNA 2ZIDA 3AGVA 3U7WL 3BP4B 2DIJA 4LNRA 4X6CB 4MVBC 5ACZA 1CLOL 2CHNA 1KB5B 3FMGL 3MZTA 4JKKA 3TEUA 2Y07H 4Y4FB 1SMAA 3RDTD 5B4MC 4KHTL 2EXYD 1WZLA 4OLZH 5E4EC 2VXQH 2X4QA 4J8RA 5FKPA 3MLRL 2ADJA 3R8BB 1VGEL 3MJ7A 5INCB 1TVBA 1TPXC 2CUMA 2VLJE 2BVOB 3L3KB 3QUYA 5SWZE 3VFRA 4LSDA 1FL6B 1RUPH 2ADGB 4L29A 2QBWA 5L8JB 1IFHL 3BAIA 2WLZA 1EFXB 5E09A 2NW2B 4E9LA 1OAQH 5E8DL 5KG9B 5ICZB 4QGTA 3T1FB 3RI5F 3T08A 4HS8L 4YZFF 4DWSD 3EBVA 4JQVC 3SCQA 1W8NA 1NANH 1NGXB 1NCUA 4GUPA 4Y5XA 1CL7L 3C2SA 4TUOB 4CAGA 4A6YA 3AHZA 4NP4H 1RZJC 1JHLL 3GKWL 3ZDZE 4JDZA 3FAXA 3RI5K 2A0LC 3ARDD 1IM9D 2IBZY 4X5WA 2J25A 4APQD 3T8XA 4MA1C 3RFZC 1XCXA 1KENL 2X9XA 1QRNB 4ZFFA 2PWDA 4XT1C 3P2TA 1BJMA 1LL7A 4UDUB 5IT2H 3C5SA 5EIIB 1US3A 1E4KA 3LH2H 3RWHA 2LAAA 3O11A 4TVDA 3R1GH 4PJIF 1A6VH 4I0PC 2V2TA 3AXLA 2G5BA 3EO0A 4FMKA 3WD2A 4EI5D 5EC2A 1YEIL 4Q2ZA 1T2JA 1LWRA 4JKWA 1QSFA 1AVAA 4NQCB 1OB1B 4OCXL 1SM3L 4GO9A 4DZ8A 5EG6C 3FO9B 1G84A 3KZSA 3GM8A 3GEWB 3O2VL 4X7FC 2GTZB 2PTTA 4UV7H 4X98B 5AYUH 4I18C 5D9SA 3THCA 2ZUSA 4H8WL 1OP3K 2X1QA 4PUBL 5CJBA 3Q48A 3QJHA 2A3EA 3WH9A 1YYMH 3IXTA 3TCLA 1B0IA 4ETQB 4P2YA 1RUAH 2VLKA 1NAMB 2X70A 3ZTJH 3BRFA 3RX8A 1RD6A 3EOYG 3H9YA 5MEOB 3RDKA 3HMWH 1BJ1H 3MRCB 1CQKA 1QR1B 1YY8A 2EDHA 5DMKA 4OD3L 3KPQA 4U6XB 3OKMB 2B5IC 1MHCB 2HA1A 1PEZA 2AV1B 3CLFH 5DQ9A 1TR1A 4EN3D 3C09B 4WFHD 2BVYA 3O3DB 3U36A 2EDDA 1YJDH 4GG8B 4PFEA 3W6MA 4ZG1A 3KPSA 4X5XB 1HNYA 1YEGL 3SE4C 1CDGA 1I1AA 1RHHB 4QHNB 5KVEL 1KXTB 2ED7A 1GOGA 3N1QC 5E94B 1EAPA 1HKIA 4ZNEE 5F9WB 2DTSA 3UBXG 1KB5L 4F66A 3GYCA 1EDQA 1U9KA 2OMBA 3RNQA 4OBSA 4HULB 5HYQA 6TAAA 4PJEA 5MERA 3ARZA 3DV6A 1EXUB 3SKUD 1MLCA 4NOBA 2ERJC 5EBAA 1NLBL 2VQTA 4EOWL 5IR1A 3MMWA 4X0NA 4XVSL 1BYBA 1KTLB 3VXUE 2VXTL 1XSKA 4LGRB 5J9PB 3KLHC 1U8HA 3QWRA 1N5AB 1GQJA 2WMJA 5DFTA 2EO9A 1EQPA 2E3ZA 4IRSC 4UZGA 2XFRA 5IB5A 5FB8A 4RMRA 3UBXA 1G6VK 4W7UA 5EU7C 3G08B 3QDMA 3NN8A 4WI5A 1MJ8H 2F74B 1QHZA 1S7SB 1NC2A 3KHQA 4H26B 1MQKL 2YKLL 1QSEB 1W2KT 4L3EE 2DMBA 1HX0A 4XNZB 2YD1A 3T77A 1R5VA 4PMYA 2HJKA 1RUKH 4NRYB 1IL1B 3GNOA 3MBED 4HMCA 5DT1L 1GPOH 1N0XL 4XCCL 4F8XA 2D7MA 4M7ZC 2AJ3B 3ABZA 3O2DL 3OZOA 1OGAD 3I6GA 1NGYA 4JRXD 5A2AA 3CFJA 5IMLB 1MCWM 4FQLH 1ZSDA 5CEXB 3ARTA 2R0KL 1F4HA 3RVUC 3VFSB 2BCKB 2BY0A 4DUVA 3O9WD 3RHWF 5GGRA 2EIEA 4JPKH 4AZCA 3UJIH 1LMKA 4FTVB 4LVHC 3IDGB 5B8CC 3MCKA 4J6RL 2YEZA 3HAEH 1S7WB 3BFOA 1IAOB 5T1MB 1C8YA 2D23A 2G60H 4WI4A 3OKEB 3RHWK 4ATWA 5TDOB 3HLAA 3PL6A 2ED9A 4Y16A 4MAVA 4UINH 1VEMA 4XPAL 2QQNL 2OR9H 4P23A 1HNFA 3BO8B 5FAAA 5C7XH 3BP6A 2J74A 3L6FB 2ITCB 4DQOL 1YNKH 4PJCB 2W0LA 3ILPA 2D3VA 1FORH 4HUUB 3NSMA 4X9BA 2AI0L 4HA4A 1KJVA 3QCVL 2VTFA 4OF8A 3H6JA 4XVTH 3MXWH 3H42H 1VPOL 5FA3A 4KI1A 3AMGA 3WL0A 5CJOL 3FT3A 4RGOH 1TCMA 3KHOA 1NAML 3VJ6B 4LSSH 1VBRA 1FV1B 2AV7A 5DFVD 4L1HA 1AQMA 1T1YB 5BS0B 2XZCL 1T22A 5I16A 1LGVA 3I3EA 4MXQC 1XGRA 3V7MA 4JGJA 3V6ZB 3BE1H 4XC3H 1KTDB 4Q0XH 2WPGA 4NRRA 4MAUH 1XEDA 5C8BB 2CD0A 1T4KB 2W0PA 3QQ9C 5HY9A 1KEML 3U7YL 3QRFM 4CVZB 5AYBA 4KGLA 4UU9B 1MF2L 4JFQB 4WHDA 4HKZA 3M7SA 1KV3A 5J11C 3QIUA 1RK1B 2JIXB 4JM2A 3BZEB 2BVEA 1YMHB 3G6JA 3QWOB 2FJFB 2HVKB 2H32B 4V1DA 4JANB 4FABH 2M8XA 1F5WA 3K4AA 2VXUL 3O8XD 5HDQL 4NQTA 4F9DA 3LN5A 4PV9B 2C9AA 2GY7B 4PMDA 2GSIA 3CH8A 1RZKH 4WFFD 1BIIA 2OI9C 32C2B 1JPGB 2CBUA 4H8HA 3GMRB 1RQ5A 1DL7L 1LO5A 1VDGA 2HLFD 1CTOA 5IIEA 1AGFA 1MLBA 1QSFE 1TJHH 1YNLL 4IOFD 5JW4M 1H41A 1GCYA 4QP0A 2EPKX 3RJYA 1WO2A 2NY3C 1KTRL 3TIDA 1NCCH 4Y2DA 1KG0A 4PRPB 2VRAA 3RPKA 3BUYA 4W6WB 4UQDA 2VXSH 1X4YA 2BNRA 5KVGH 1MQ8A 3LDBC 3MV8A 1KELL 5E99H 3SKOA 2VL5B 5C0BD 3OGCA 5FHBL 2APFA 1H3PH 2VQ1A 2WBJD 3OSKA 2VLKE 3QHZH 1ODAA 4GLRH 1XZ0B 4MLIA 1MAKA 3QIWD 3GH5A 1LDSA 4GAYB 3PF2A 4FF5A 2Q8BL 4M24A 2GEEA 3B3IB 3CK0L 2FECL 5BO1H 4P2OC 3GI8L 3R4DA 2J7HA 1RIUL 2F15A 4YBLC 3O2WL 1HKJA 3TYFA 1GZJA 4EIZC 1IC4L 1SJHA 2BVQB 3T2NH 1BZ7A 5I1EL 3QUKB 1XGYL 1DLHB 4PJ7A 1VA9A 4ZS6C 5KSUB 2VUYA 3WFEL 3NAAL 4L9DA 2FH6A 4YR6B 4WTZG 1L7IH 1ZT1A 3HG1B 3IYLW 1HP5A 3KPSE 3QIBD 3WEZA 4GRMB 4KTYA 4NQSB 3P4MB 3EMZA 3CFEB 1OAKL 1BBDH 2BZDA 1CXIA 4ZAKC 5DJZB 3VXRA 1J05B 3DHPA 1CE1L 3BPCB 3AHXA 4HLZG 3FTGA 4RQQB 4DAGL 4N8VG 1BJ1J 1DQML 3ARGB 4GS7B 5I18L 3FFDB 1JGDA 3TIEB 5SV3A 1KNOB 5EZOH 1I1FB 4PJEE 5HGGS 5L8LB 1C16A 3GNPA 1M6OA 3RL1A 5J57B 1IQDB 1ZA6B 3VFWA 2J6EA 4LSVL 1ND0B 4LHUG 1B4JH 3IFOB 1T7XA 2FX8L 2XHYA 2ZCLH 4N0UB 2FLBT 2R1YB 2YL6A 4BQ4A 3ZM8A 3DX7A 1TMQA 4PUDA 4N8VA 2FJHA 3VIJA 3QDME 3MUGA 5GISL 2NYYD 1F58L 4H88L 4AQ1B 4M6OL 3IDMB 4GBXC 1H15B 1LK3L 4PRIB 3VXPA 4FQHA 3JUYA 4BYHA 5TDNB 1FFNA 1AP2B 1ZVSB 2AK4B 3U9PH 4GIAA 3O6FA 3WNMA 2E7BA 5ABFA 3DI3B 3KPRB 3T3PF 4LHUA 5EUOB 4HWEH 1GGCH 4LHQB 2DL9A 5BWFA 1ZLWH 5EZJA 3UAJC 5M95B 1W9XA 3UX9B 3PV6B 2HTLD 1JNLL 3ZL4H 2IMMA 2B7DT 1JUFB 4OFKA 3MRHB 3ELAT 5HI3D 5F1NA 5C0EB 5I15L 4I48B 4K8RH 3UTZA 4BZ2L 2ATKA 3PGFH 4JHWH 1SBBA 4DOHB 4EDXB 4IJ3C 1DSFH 2Y8VA 2L4OA 4U1SB 1N59A 5A16A 3S36X 1ZANH 2VLRB 3E6HA 4LASH 1DQDL 4JQXC 2DD8L 4ZQKB 1A1OB 4QXWA 1G7PA 4YDVB 2AJVH 3RUGF 1BQHB 3TZVB 3OJVC 3MLTA 1UEMA 3FQRB 5D7JD 4Y5YC 4UOQA 3E0GA 2EKJA 4QCIB 4ELMB 3DMMD 4WKFA 3BH8B 4AM0A 2J88H 3DX6B 1EHAA 1F97A 1CWYA 4C83A 4YHNB 1I1YA 1HHKB 1RJYB 3RX5A 4QHUA 2NY5C 4I4WA 2ZOLA 4YC2B 4NKDA 1OT1A 3ECQA 2H1PH 1MIEL 2NY2B 3U46A 4NYLB 4OCRL 4XP1H 5JPMA 4LCCB 2FO1A 3LS5H 5GGUA 3OJDB 1LEGB 1IGCL 2DSZA 3JWOC 4S1DC 2GJPA 5C07D 1O7VA 5JOEA 1VGKB 3ZQ9A 2XWTB 4BQ5A 3UJJH 4RAUA 2PBOA 3EKCA 4UTBH 4N0CC 2JKXA 4HFWB 2P1YA 3OR6B 1IGMH 4NM4H 1OARL 3KPLA 3I02A 3MLVH 2G41A 4R26L 3LZFL 1M71B 4HS3A 4TRPL 4NQDD 5FO8A 1JDAA 1G0XA 1A21A 2UUDK 2VDNH 3FRPG 3O0RH 1BG9A 5TE7H 1FBIH 1S3KH 2XI9A 4KKBC 2NY0C 4D6CA 1SY6L 4IDLA 4R0LC 3RNKB 4RMWA 1TE1A 3QNYA 3N9GH 4S0TD 4LSPL 3AHVA 2QHRL 2IH1B 1ES0B 1LO3L 5JW3H 1F4WL 4KAQL 5GHWH 4HWZA 4QTIH 5DVLA 3D3VB 1R7AA 4R2GB 5T33H 5ETUB 3WIIL 3G6JE 3T0EA 4YFLI 1AKJD 3BEWA 3ZTNL 4KTEH 1HYSD 4V1DE 2G3IA 4ZXLA 1IM3B 5GS1A 5DUPL 1BQUA 1F8TH 4HDIB 1UG9A 5E6YA 3RWJB 4M1RA 3MJ8B 4WFED 5DYOB 2BS9A 1FL5B 1KR1A 1EDGA 2DQCL 1QLRB 3MRBA 3MLXL 3RM8A 1RIVH 2X4PA 4NUGH 3SE8H 4ZXBC 4IPNB 3TJEL 1MREL 4RZCA 1LILA 1YMMD 4XPTL 1FLRL 1XGUB 4KQ4H 4BELD 2G3NA 3MYJA 4UTAH 4JQIH 1VKXA 3SPVB 2PXYC 3VXTB 1ONQB 1AQKH 4RGMB 4F15C 1QVBA 4KJQC 4CD5A 1I1AC 2Z8VC 2W60B 2C1OA 4XXDA 1DBKH 1EO7A 2ZSWB 3PGDA 5K9KB 5D1XB 1OTUC 5BXTA 4NGHH 2BNRE 4PP2A 2EEDA 1SEBA 1HILB 1RU9H 2ADIB 4YQXL 4K2UH 3MV8E 4NNXB 2XTJE 4OFYD 1DQLL 1U8OB 3W11C 1YYLH 3QR2A 1D5XA 3FQTB 5JO5B 4BH7A 3WD0A 2WM0A 4JN1L 3GJEA 1WP6A 4XCFL 3BKJL 1L7TL 1R3HA 2HVJA 4HUMB 4OM1H 3TTSA 2ESVA 1HJXA 1ZS8B 4HU0A 4G6MH 3V79C 4ODWA 4OKVA 3NFPA 4K3GA 1WV7T 3F12A 4BFEA 5GS0C 1YDPA 2RHEA 1E28B 3QPXH 3T2PA 5CWSB 2Z31A 5CXPA 2X42A 3UPRB 1EHLH 1N7MH 2E5EA 2I9LB 2CLZB 1RUQH 4LXFA 1V03A 4D9QE 4HKBA 5JIIA 4JVUA 2VCAA 2PO6B 5I76B 5C6TH 1XH0A 2AEWA 4ONGH 1CTNA 1UZ8A 3VXRE 3D9AH 5EBLB 1UQZA 3DGGA 3AIVA 4DM1A 3QI9C 5D1QB 3FZUC 3C6SB 2DKUA 5BRZA 5DVOA 3RDTB 4XPHL 3OKOA 1BP3B 2WUBL 3FO1B 3OKKA 4G5ZL 4A4AA 1CZ8H 4XP5L 1RV6X 1NANI 1W72A 1F4AA 1DWFM 2IGFL 3CAFA 4HIEA 2YA2A 4LVEA 4ZYKB 3CX2A 3IT8D 5T3ZE 4NT6A 4BF7A 5CBEA 1AQDA 4MQXD 3GMPA 1QEWA 2GFBA 4POYA 3ES6A 4JIEA 4WEBH 3B2UC 3VW3H 3QG6A 1VACA 3CFDA 2Z1KA 1JGUH 4TULH 3CHDA 4HEPG 4B41A 1J9YA 5MEOA 1P69B 1Q0XH 4Y16C 1UACH 2BERA 5E9AA 1NKRA 1IAIL 1R24B 5D1ZB 3VFOA 4MQ7A 3VWKA 1UYQA 4DWSB 5FYLD 2OSLB 1I1XA 1ZLSH 1I9EA 1YZZA 2MCPL 3IJSB 2E9LA 1A22B 2DTMH 4QRRB 1IC1A 2R0WL 4CD4A 1RIHL 2GKIA 5CJQL 1PZ5B 1PDKA 1MOEA 4A6YH 4JN2B 1LWJA 5HPOA 2ICWJ 5KSVB 5BVJA 3CPLB 2YDSA 4FZ8L 3LKNA 1E4WL 1CFVL 4WHCA 1E1FA 3ARDB 1IM9B 4GG6F 3SDXB 3NACL 1F3RB 3QQ3A 5F1IA 2Q86B 3ZYOA 4XZUA 4APQB 5JDJA 3CVIL 2F19L 4P3CH 4QXGL 2O26U 2QJDA 5ECJE 3VUPA 4BFBD 4AEHH 5IBUG 2MFNA 1VADA 1KIPB 5EZIH 2X4UA 3KJ4B 1H4PA 5D2NB 2CUHA 2LU7A 4Z7UA 3BKMH 4LMQE 3QYCA 4J3SA 4DGYH 1X44A 4OJFH 1ITXA 3N13A 4M43L 2Y6SC 2J8OA 4YFEA 2C3WA 4EI5B 1JAKA 4LPXA 3DYMA 4K3JH 5LGHL 3WXWL 5J9PA 3P73B 4JVWA 3DX8B 1SYSA 3PWJA 3O3EB 4L3CB 1R5IB 4X80H 1AO7D 3QIUC 2WINA 2WW8A 3ECBA 5F3HB 4JM2C 5DK0B 5ALCH 4Q58C 1PYWA 2OK0L 3D6GA 1SHMA 4JDTL 1QYGH 2B4CC 4G8IB 5EO9B 3NFNB 3IETB 4D3CH 1KC5H 1UKOA 5E9DD 1K2DB 4M62L 5IW1A 3WMSA 1BECA 1YNTA 4O2FA 4W93A 1C5BH 4I8DA 4H20H 3VXSA 1XH2A 2BX5A 4H5SA 3LN4B 4GW5B 3I6KB 3ROLA 2QQKH 3BLKA 4L4VA 4HEME 2WVSA 2NXZD 4UIKL 4D71A 1IKFH 2QLYA 1YY9C 3KXFD 4JY5L 1FNSH 4HPOH 1BVZA 4GXUM 1N64H 4GMTH 1YEKL 1P4IH 1WC7B 3B9VA 5HYSG 2EDOA 3BD4A 3BISA 2DDQL 3O6ML 4UT7H 4Y2DC 4DGIL 5JPNA 1UB6B 4ZDHA 2NR6D 4PTWA 3CNKA 2OSXA 1GAFH 1U91B 3T0EE 4H25A 1R6VA 1S9XB 2EIDA 1GQIA 2W63A 1Q94B 2DT3A 5ID1A 2RGSA 4NN7B 1ZHNA 4OAWB 2HH0H 1R87A 5DJXA 1INEH 3UTQB 3PHQB 4E5XA 3GMOA 5HYSA 4AH2B 3PZQA 4F57L 5I2IB 3SCUA 5F9AC 4AD2A 2WZEA 1VJZA 1T2QH 1EEYA 3PWPD 5DRZA 3SKMA 4V27A 3RTQD 5JLZB 4E42B 1GOWA 4QF1B 1N6VA 4HKXA 1RUMH 4WDIA 1KF9B 4IRJD 5DC0A 4CCDA 4BH8B 2WHJA 4Y88A 3F5WA 4YIQB 2A6JB 4YGAB 5FA4A 3I85A 1VHPA 2D31B 2QR0A 5SX4H 3RVTD 3HNTL 3EO9H 1BPLB 1OT2A 5E1AB 3FOLB 3RWFB 3D85D 5CEZE 3CO4A 3WF1A 4O02H 1OQOA 1RULL 4MWFA 3REWA 3O3BA 1D5MB 4QRQB 2CKBA 1S7XB 3MBEB 1UXSB 5JHDD 3W0WE 4OF0A 4DKFL 1E71M 2EICA 4TYUA 1OPGL 1F3JB 1U3HA 5TF0A 1OGAB 3GSUB 5CMAB 2ESVE 4OLUL 2HG5B 5EORH 4HGWB 2CJUH 4YXHL 4UT6L 5EPMA 4GZJA 2I60H 4GAGL 4MD5B 2P8PA 4X0KB 1MH5A 2X44D 2XWJB 3NFSH 2ZX5A 1BYCA 5IMOB 1UYWH 4KVNH 3C08H 4K7PH 1RK1A 4FQXB 4MDIA 4F80A 1XD1A 1LD9B 5F9OH 4HIIA 4YBQC 1PFCA 4DWHA 3QXTA 4EI6A 5J7CC 3QULA 2QADD 5E4IA 2HKFL 4PJAA 1Q9OB 2QKIA 4JANA 3WLWC 2DQUL 3DTXB 5CKGA 3MYZA 1KLGB 3M1BA 4OF7A 4M02A 4HS6A 2VDOH 2WBKA 3FOMB 4JRYD 3VNYA 3MCG1 3CHFA 2H3NA 5CEYB 1SEQL 2NY4D 2Z91B 4Z7QF 2TAAA 3SUWA 1BSIA 3CZ8A 1E9LA 5BRZE 4DTGH 4H0GA 2YS4A 3KPPA 3OB0H 4J7RA 4M8UA 4NPYB 3NGBC 3QHTC 2G9HB 3LQZB 1MJJB 1NBVL 2HT3C 5A94A 3OKDB 2DL2A 4JO4H 4XCEB 2DRUA 2X4NB 5JW5A 2GFTA 3IJ8A 1DBMH 4PBVC 3MLSL 4OZGB 2Q8AL 3PWUB 1G94A 1AMYA 3IVKB 5SWQA 4F7EB 4G8FB 1AQ0A 3VFTA 4LBEB 1BX2A 3SDDD 1J1PL 3JZ7A 3H3PH 3HTLX 3D1MC 3JWDC 2FWOB 4HWUA 1DCLA 3HI1A 4C7GA 3D25B 1DQQB 7FABL 5I2UA 3AVEA 1U8JB 1NCBL 4DW2L 2AAVA 3WL1A 3EYVB 3A47A 3D2UB 3IDXL 4FS0A 1SJVA 4OTXL 1EGZA 3BAEH 1A47A 1I8KA 3AMKA 5TF1L 4KV5F 2A73A 2BVQA 4KROD 1KIQB 1TJGL 4PRDB 4F3FB 3W28A 2BVUA 1MNUL 1I8LA 1JNDA 2R9HD 5JXEA 5EO0A 5KSUA 4XP6H 5AY7A 2GITB 4YR6A 2CIIB 4LLYB 3L3IB 4GRWH 1JHTA 4UQAA 2VISB 1V3JA 4FXKA 4MX7A 2WP3O 3UJTH 1NFDA 3L5XL 3MMUA 5KSAA 4JAWA 3CSYA 3V4UL 3VGBA 3RWEB 4M7JL 2R0LL 3WFCL 1HL9A 1X5AA 3O8XB 4O2EB 5L9DL 4Y5VA 3W37A 1TVNA 1JPTL 4Z7UE 5GJSL 1OW0A 5FGBC 1UR2A 5ISZA 3EDJA 4GLRI 1AGBA 3VD3A 5ABDE 1MCQA 1XFPA 4ELKB 1XGPB 2GY5A 3WL9A 3OZ9L 4YHOH 2IUZA 3QUXC 1ZHBA 5GRVK 1LF1A 2L0DA 2X89D 4OUUB 3QUZC 1J8HA 4TUJB 3MOAH 4GKOA 2W61A 4K71B 4JPIB 2DJSA 1T20B 4HZAA 3MACH 2WMIA 3UEQA 5LA2A 4CCCA 3MQIA 5I74B 1FGNH 5H2BA 1YA5A 2BFVL 3RZWA 3DV4B 1MFCL 1MHEB 1OAUH 1QFUL 3OR7B 1A1NA 2QPUA 4PBXA 5GS1C 4ONHB 4KKCC 4DM2A 2WBJB 1JFQH 4RA0C 2ICEA 2V5SA 5L0QB 1S7TB 4W8AA 3NA9L 1I9RH 2KPNA 2A6KA 3VA2C 4HMDA 3VE0B 3CMGA 3BHBA 3VXSE 2FD6H 3TBWB 2V5YA 3V6BR 4L4VE 5DC4B 1JWUA 4OGXL 1I3GH 1KCSL 4HCRA 1A7OH 3GK8H 1UWRA 3SKJL 2Q7YA 4Y1AD 3NCBB 3CIVA 3CZLA 4EVNB 4XAWL 3U79A 5JORB 2Y23A 4IOIA 4WENB 4LRNL 4PR5A 4OLVH 5DK3A 4B7IA 2OSWA 3AOFA 2OTUB 4N1CA 4ESKA 4DN4H 3SIMA 2NT1A 3PABA 5FOBB 3HKFA 3VM5A 4WJ5B 5I1KL 2OYKA 1U42A 2GJ6A 5KVMC 1GZQA 3F5LA 4NZTL 2PYED 5F96H 4Z76B 3AI0A 4IMLB 3D87B 3ZSTA 3HUJB 4K94H 5DXWA 4I2XB 4XMLL 5MEND 1KXQE 3EJJX 2B31A 3H9SA 4Z7OE 1HSAA 2WWCA 1CFSA 1CICD 4XNXH 3RWCB 3MSGA 2J6EH 3UYRL 4AC1X 4PMXA 1E4NA 3RZCD 5CILL 2Z31C 1QI4A 3B9AA 4ZFGL 4YHZH 2JF1A 4E0RA 3OA5A 4HLZH 3ZSSA 5T3ZH 3IJHB 3KDMA 2WSPA 3U7VA 3ARBA 4XP9H 4ODVL 1ACZA 3G6AB 2JB6B 4NCC1 1XV8A 4LEOB 3ULVE 5C09D 3JV4B 4OUEA 2XY1A 3LKPA 3FB7B 5C9JA 3ZE1F 1TZIB 4AIUA 1IGTA 4C55A 2JF7A 3O6KH 2VVSA 4TXEA 3SGDH 2F8VA 3SKNA 1MWAB 1IEAB 4L4JA 3TBVB 1LP9A 3WQ5A 1OM3H 3H0TB 3I75B 4POZC 4YHKH 3L3HB 2P5ED 3RNKA 4F9LA 5GS2H 3EJZC 3LKSB 4PEEA 2CR3A 3ZO0A 2KDGA 3QEGL 4AZIA 2PW1B 4H1LB 4HWBA 4K7FA 5ID0A 3ZE0F 3NUKA 2FHCA 2R69L 2O5YL 4JFFD 1CE6B 1L6ZA 4HKJA 2CDGB 2AK1H 1DVFA 5D7JB 2DBLL 4PJAE 1PSKL 5F7WC 3G5VA 3RRQA 4M1DH 3DMMB 5F7EL 2F5AH 2FCBA 1I9IL 1TCRB 4GZIA 4L9LB 2NY7H 1LO0H 4AZ7A 2R4SL 3JWDH 5FCUL 3IKCB 3DSFH 3W9EA 1CBVH 3U6RA 1B0WA 3MSPA 4WUUA 4GMSH 4GI6A 4PJ5A 4JFVA 1FP9A 4F9JA 3BDYL 2V5MA 1FYTD 4MXVF 4KUCF 3C09C 4LGXA 1W9DM 3PXJA 5BV7H 4Z7WA 2O9OA 2FO4A 2D9CA 4TSCH 3ULUE 4PRHD 4JO3L 5C07B 3WENA 1MJUH 4YBHA 5AG9A 1BLNB 2CQVA 5I71B 1EZVY 3WQWA 4KRUA 2F54D 3S5LB 4HJGA 5AC4A 1VFOA 1HCFX 3HU7A 4HQQL 5HJ3B 4CVXA 4P4KA 4B7LA 1HHGA 2AABH 4ISVA 4UOW1 4LYRA 2VDRH 4DCQA 1R5WA 1ISXA 4TVPL 3TNMB 3QWQB 4LIQL 2I07B 5J3HC 4R8WH 3EFDL 3ZO9A 4JFED 4QY8A 2IPKA 3QOKA 4NIKB 3FO2A 2OZ4L 1G7HB 4B5EA 2O5XL 4XBGA 1NFDE 4I0CC 4O00A 2MQ0A 4G9FA 1AKJB 1CDJA 2C3XA 3MFGB 1IBGH 4XNZC 5I1HL 5I75B 1MRDL 1HQRA 1QI0A 4OZHA 1WZKA 1C5DB 1K5NB 1V6UA 1CR9H 3GSXA 4M48H 1BGAA 3H2WA 5LAXB 3QPQC 2ZCHH 3RL2B 3EDEA 5ISZE 5FGCE 3MR9A 5E2UL 1KBKA 1MCPL 1Q1JH 1MCLA 3GRWL 8A3HA 1OOAA 4WV1B 3LMJL 4N5ED 1FVEB 1YEFL 4M6MH 1YMMB 1BOYA 5CHNB 2A9MH 3UTSE 3Q3GA 5D71L 1MHPH 4JY4A 4J3TA 1J8HE 1HIMH 4UQ9A 3BOVA 5GGQH 3FN0L 3MLYL 3MROB 2I25N 3QCTL 1AGCB 2JJVA 4GQPH 4MLSA 3POHA 3K8KA 5MEPA 4G8GD 2BNQB 2JFEX 3ZDXE 3VD9A 1QBBA 4P0DA 3W6LA 1MWAL 2C3HA 3OJ2C 3LKRB 1HI6A 1TJIL 1CGSH 1M03A 5F9DC 1UQSA 2J8UF 2R1WA 3EOAB 4NZJA 5L2KD 1R3LB 1XT5A 1HH6B 3OKLA 1A6WL 4TTGA 5C6WH 4X4YB 3MRJA 3P9MA 3QBTB 4LGSB 3FQWA 3ARXA 1G7LB 5DI8B 4ZPVA 4V2BA 7TAAA 1PPIA 1FC2D 5BYWA 3MRLB 2FX7L 3GDBA 3FCTA 4OM0H 4XAKE 8FABB 5IBLC 1BLIA 1NMCB 3SJVB 4JFTA 2BSRA 3UDWA 1BGXL 1BQLH 1NWRA 4NHCL 1FNHA 3D3AA 1I1CA 2YUVA 5C0IA 1CNVA 3B6SB 3SY0A 3ILQC 3TNNB 3WD3A 3GSRB 4LCIL 2WB5A 2GJ6E 4QRPA 2D03L 3C9NA 4LSUL 1TZGL 4F58H 4YHMH 1IZJA 4FFYL 1E6QM 1F6AA 5JMOC 4OUOA 4UFIA 1QTYT 4O2CA 5T1LD 4AD5A 2X1XR 4UDTB 2WWMC 4XPFL 1W72H 1NBYA 1IT9H 1FNGB 4PJXE 4QYOB 4P2RA 3T0WA 2JCCB 1FNFA 3EGSB 2VZSA 1QQDB 1MCOL 4KJYB 4MJ5B 5CPSA 3C5ZD 5EBMB 2P44B 2JB5L 3G6DH 5D5MF 4BZ1H 3TO2A 1RPKA 4TSAH 1MAMH 1SFSA 5JIWA 4U33A 3N04A 5GNXA 3QNZB 4GW4A 4N1EA 3DGCR 4E4PA 2PNDA 3WEMA 2YA0A 2P5WD 5IBTH 2ZOXA 1LP9E 3MNVA 4QHMB 5IG7B 5H37G 4EN3A 4FP8H 5FCSH 1J12A 4B50A 1E5JA 4D0CB 3PGCB 5SV4A 2E27H 3FQNB 3ULUC 1HXMB 2DT0A 3V52L 4FMFA 4R4FL 3O2LA 4ZFZA 2APBA 3P0GB 5E8NA 3S4SG 5GPRA 2HJFA 2DOCA 1FG2B 4IRZL 3DIFB 3LD8C 1N8ZB 4Z7NE 4L8CB 3DUHA 3ZYIA 1KTKE 3UROR 5E2WH 3STZB 2AP2A 3FQUB 5BW7C 3BUTA 5IOPA 1G9NL 1QOKA 1O7AA 1NJ9B 1J10A 3QDGA 2PC8A 4MA7L 3CLEH 1S7RB 2BOBB 1TZHB 3OXSA 3S4SA 5AAWA 2V17L 1WFUA 5A8QA 4WUUE 3PZUA 1ZBKA 4PJ5E 1I8LC 3NCEB 4Z7WE 4XHJD 4Y4HA 3V0WH 1S5IH 2X1WL 3A4XA 4HP5A 4WGVB 1AO7B 1WTGT 4FG6D 5EU4B 4BQ3A 3HE7D 3LSOB 3QO1B 3NIFE 4MJIE 2UV3A 5ICYB 3TP4A 2VLJD 1C7SA 4PGEA 3UEZA 5FYKE 2YC1B 4XPGL 1BVLA 5IFHH 4Y5VC 3RM9A 5E9DB 5SWZD 3HE6D 3ARGC 4GS7C 1IZKA 2DM3A 5ABGA 4AXNA 4JR9L 4HUWA 1IARB 3F7QA 1DTUA 4YDLB 1T03H 1BREA 1GHSA 1S7UA 5TPWH 3B2VH 3MRKA 2R23B 4EBQL 1MPAL 4JRXA 1ZVHA 1VFBB 5JXAH 1DUZA 1FZOA 5I1IH 3CU1A 1A3LH 2NXZB 2BDNH 4X7DC 5GSVA 2FBOJ 2R2BB 1MVYA 5ESQB 3QUMA 3JTTA 3O9WA 2HTKD 1Z3GL 3KXFB 4K8RD 5KJRH 2Z93B 1EUTA 3CUPB 2PUQT 5IMOA 1V3KA 2G3MA 5FYJL 2JK5A 2FX9L 3UTTB 2BOCB 1MFBL 3VFGH 1Y6MR 4S1SH 3UBXI 3BXNA 3IJYB 4FQ1L 1D5ZA 5BRQA 5KSBF 2GVYA 2CMRL 5SX4I 4FFZL 3VH8B 3V7AG 4G9FE 1CECA 4OZHE 3AREB 2DQEL 4NUJA 1AR1D 3AM8A 1BOGB 1Z9OA 3V5KA 1OCWH 4QCEA 5D72L 4Q97A 1XAUA 4PJXF 4S0SD 1IV8A 4U6YB 5GRYA 4MXQD 3PWPB 2ENSA 4RA3A 5KANG 3RTQB 4LLQA 4TPRH 3S96B 5JIKA 4AQOA 1HDMB 5ALBH 1AH1A 2IG2L 4IRJB 5EOQH 4FXGB 4Z8FL 4JG1L 3ARQA 3DHMA 5HGBB 4RX4D 5L2JA 1D6VL 2BNUB 3TZVC 4DKDC 1FNEA 5DURB 1Z0NA 4QOKA 4Z0BL 1ZJAA 4ONFL 2K1MA 4ODXA 3D85B 3BAKA 3VIOA 1J0HA 1LNUA 4YDKH 2XZAH 3ULVH 1PKQA 4M03A 4Y4KA 5HHMD 3MRRA 2PB1A 1CG9B 4ZOAA 3L4XA 4YDIH 4EE9A 4HPYL 3CZFB 2CBVA 3L5JA 1UWXH 5TGBA 2YMXL 1MCBA 2CKBH 2SEBB 5TFSL 5FKYA 1JK8A 2NY2C 1OY3B 1S9YB 1BD2A 2BV9A 5HDBE 4XC1L 3DUUA 1NCDL 3MRIB 1F00I 4NKIL 4G9DA 1S7QB 1XF4B 2BSTB 3OX8A 4DZBB 1R3IL 1JGIA 3WXVH 5A1AA 1ZEAL 2A77H 2BVPA 2HLAB 3EMQA 2WBGA 1GC1L 3K81A 1DN0A 1P2CB 5I1CH 3NTCH 4WUKH 1GYAA 4U6VH 3ROOB 3X3GL 5T1KD 3S3JA 1KXHA 3PP4H 1MCSA 4M1CD 1IEBB 4ODUA 3ZKXB 4X7EC 1XIWD 4S1QH 3IXAA 3KYMA 2DSKA 4JRYB 3V4PL 3KR3H 4BSVA 3QJFA 1DZBA 5DQDL 3BXWA 2NT0A 1T3FA 1T80A 3FB8B 1B0RA 4QRPE 3PV7A