2X2YA

Cellulomonas fimi endo-beta-1,4-mannanase double mutant
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
462
structure length
450
Chain Sequence
ETIAIVDADATAETRSLLSYLDGVRGEGILFGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAYGSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVADLRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWRNADAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVPTTVRVRVGGTDVQSVTVEVAQTVVDTLDLAYDGALWWTAPWSPSTYTVTATATTAAGTLDVTNEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords MAN26A
publication title Rational Engineering of Mannosyl Binding in the Distal Glycone Subsites of Cellulomonas Fimi Endo-Beta-1,4-Mannanase: Mannosyl Binding Promoted at Subsite -2 and Demoted at Subsite -3 .
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 156
structure length 450
sequence length 462
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x2yA01
1C8XA 2X40A 3P0GB 4KJPC 5KSAC 4LNVA 4Y1AB 4FFWD 1OVZA 4FNLL 5FKYA 4YDLB 3WFBH 5SWZE 1QSFE 2F8OA 3OJMB 3HPLA 1F11A 1H15B 1X6NA 1NGYB 1WJ3A 3QDGE 4M7LT 4JQIH 4KKCC 4E2OA 3ARRA 4ZO8A 4MD5A 1MAJA 2DN7A 4KVCH 3T4YB 3VTRA 1KTRL 2D9CA 1S7WA 5LBSL 4GQQA 2BDNH 4IRJD 2Q3ZA 2YOCA 4XI5D 1AQDA 3MV7D 4Z0BL 2GJZA 3MRJB 2WVSA 2XT1B 5ETUA 4M5YL 2DWDA 1UJTA 5KG9B 5AZEH 5BOZG 4OGXH 3C6SA 3GH7A 4P2OB 4PJGA 3VW3L 2YN5A 2A1WH 5TE7L 3QZWG 2J7GA 4G9FE 4CD4A 1EEUA 2LVEA 4A2LA 2DQHL 4BZ1L 2NY1C 3DHMA 3MJ7B 1JMZA 4KV5F 2EDDA 1UWSA 4OZGB 3VMOA 3BAKA 1R24B 1N2RB 2VZTA 3WIHA 1VFFA 2O9OA 4XBGB 1JTTA 5JW3H 5KANG 3QFJB 1FFOB 2VQ1B 2FHCA 3BT2L 3QXDB 1YEEL 4DUXA 3FFCD 2HYMA 1O6IA 5CP7A 5HGDA 3VGHA 3ZM8A 1P84J 1XGTB 1IQDA 5T1LB 1AO7D 1HXMB 5JPNA 3VXRA 1FNGA 1AR1D 4P4KB 4GMTL 1UWXH 3GMNB 1T5WA 4M00A 2PWFA 3OAUH 1KQYA 1YEDB 3HMXA 2BVEA 4WV1C 5F1SA 1U36A 2K7PA 4NQDD 4QXTA 4X99B 1E3ZA 1NH6A 3HZKA 2J2ZA 2X42A 2IANE 4OM1H 1DQTA 4X9BA 2ATKA 1A6UL 1CQYA 4L9LA 1TQBB 2D3NA 3VE0B 2A3CA 2PF6A 3QIBA 5I17A 4W70A 3C09B 5IFPA 4PJXA 2EPLX 2PO6C 1IM9D 3ECBA 3MRKB 5EFIB 2VSCA 5EUOE 2YPKA 3VFGH 5LCVH 3IU4H 1BBJA 1K6QH 4HTYA 1YNLL 4IOIB 3ZIZA 5EN2A 3PXJA 2HWZL 3GMMB 3E6HA 1KC5H 3WH9A 5TFSH 3MGAA 3OPZL 2OSYA 2Y5TA 1F8TH 1WC7B 2I9LB 4W4NA 4U1HB 3OKLA 2YUZA 1U8NA 3SDXA 3H0TA 5J3HD 4F37F 2AI0H 3TP4A 5E7BA 3MODH 1NCTA 4DEPC 4MDPA 1MCNA 1YY8A 4DQOH 4DZBA 3KYKH 5GRXG 5M5DA 1OGAE 1YQ2A 1M6OB 3UAJC 1WSST 4XUYA 1I7TB 2ICWJ 3AOFA 1UCTA 3ILPB 3BVNB 4I9WE 3NH7L 3RO8A 2XVLA 5C07E 1GPOL 1I1AA 5BW7A 3RQ3A 3ELAT 3L4UA 2F9BT 3P30H 3F7VB 5HVHB 5DRZB 4WHTB 5BQ7A 4LCIL 3VWKB 1PSKL 5L0QC 1IAOB 5A2KH 4JGMA 4DM2A 2AEPL 3GO1H 2ZX5A 2XFRA 4Z0XA 4OZ4B 4C4KO 4HV8B 3CCHB 1E5NA 3D39B 4NJAH 2HVMA 5IB4A 2VLJA 1I1FA 1RPKA 4G6MH 4GBXA 1VSCA 3I9GL 1WKYA 2NYYD 2FIKA 1LEIB 3GBNL 2WPGA 1P4IH 3TH4T 4Q9QL 2HLAA 3TA3A 4HAFA 4PTUA 5EBAA 3MV9E 2YRLA 2WZHA 3RIAK 5HDOA 4L9LC 2ADIB 3NIDF 4X6EA 4W4OA 3AIEA 1ZSDA 2FGWH 1T1YA 3QIBC 1W0VA 1V3IA 4UFJA 1RULL 3TBYB 2PWHA 4AM0B 4CW1A 1RZKH 4LU5H 2XUCA 1JPSH 1OGTB 4AZIA 3RGVB 3QZWB 5F9OL 3SQOH 2P43B 3D3VD 5JQ6H 1UR8A 2Z8SA 1VACA 3O3BB 2CIIB 4GKZA 5JIPA 1ZEAL 2VUYA 5KTEH 1ECEA 4E8DA 2EYRB 1A6WH 5F1OB 2NXYD 3WQ4A 4LLDB 4JFFB 4NP4H 3BXNB 3KGRA 5I76A 3VWJB 2DQIH 2HT3D 1X9QA 1SR0A 1IGMH 1KBGH 1NCDH 1ZT7B 3PNWB 3QAZC 1X5XA 4FABH 4GG6B 5E2UL 1DLHA 2HN7B 2VR5A 3HI6L 1QHPA 3TF7C 3THML 1CDYA 3TVMD 4WW1A 4R90L 3SGDI 5E9AA 4FQXD 1YYLH 1MXGA 4ZFFA 2G5RA 1J10A 2A0LD 1S7UB 1VGEH 3U7BA 4ATWA 2CKNA 4NO3A 5KSAB 2GITA 3FO0H 1S9XB 1V0KA 1R3JA 3KXFB 1IKFH 3NIYA 2YN3A 3PUCA 4K94L 1DQLH 1UR4A 2P47B 3POCA 3CX2A 2OR9L 1F4WL 4HQQL 1G7PB 3BPOC 3G5XA 1I1AC 5ACLA 4G9DA 3FAWA 4XVTH 5BW7C 2J7EA 2WANA 2BHYA 4NFBA 4XP5L 4FZEL 3H42L 4HGWB 4XHJD 2KUTA 1JXKA 4HEPG 5HDBE 3D87B 4TPRL 1QNZL 4ONHB 1LMKA 3D3AA 4I8DA 3O0RL 4NYLB 2P5WE 2W63A 2CIKA 2WWKO 1FIEA 1NCCH 4J12A 2XJ7A 4QWWC 4ZE5A 5I79A 5FUZH 1MIEH 4GBXC 4AXNA 4M4PA 3BISA 2BNJA 3MOAL 4UTBL 2C3HA 2DBLH 1QI3A 4GQRA 2NY1B 5F7DA 2WCGA 1A3HA 3TA3C 3DO7B 3FT2B 1FYTD 3IXAA 4O4YH 1LDSA 2FLBT 3PV7A 3BIBX 4PJ7E 3HZYB 1HKKA 4W4OC 3MREA 3A47A 2D2OA 4L1HA 2WP3O 4PJGF 4J8RA 3W6MA 3V7AE 1IM3B 2DTML 1CFSA 4ACZA 3FQTB 3C6LC 5I15L 1A3RH 2QQNH 3AFLA 1OT1A 2C3WA 4XZUB 4EIZC 4PMVA 3WQ5A 4WV1B 4ETQB 3RWIA 1MY5A 1FP9A 1CFTB 1JN6A 3EYOB 5JLZA 1FC2D 3OLEA 5DHVA 4CVXB 3RFZC 5DVNA 5DC9B 2A73A 2EE9A 4LSDA 5EORH 3W6LA 3WF4A 4HF5L 3AIBA 5E24E 2A6IB 1S3KL 1MQKH 1U8PB 2PO6B 1UZ6E 1HIZA 3Q0HA 4W85A 5BMFL 4U3AA 5CPQA 3NCJH 2VVNA 3T8XB 5F8RC 2QV2A 1KXVC 4WNQB 4L3EE 1OSEA 5D1QA 5I1JH 4PD4J 1F11B 3VD4A 2HJFA 5C2BH 4P3CL 4PMNA 3TJEL 4LL9A 4QCFA 3VXSB 1BFVL 3TYFA 3VKKA 2HT4D 2Z8VC 5C0CE 3CMGA 1A0QH 1OD7A 1S7WB 3AY4A 3D9AH 4PJXF 2W0FA 4LCWD 3E3QC 1UH2A 3M07A 1RZJL 5HHOD 3IGAA 3P40A 4DEPB 2GJZB 5I8KL 2OL3A 1KLUA 1KACB 2DWDB 2V6HA 2VLKA 4EOWL 1KFAH 3CLWA 4NOFA 4B16A 4CAGA 4ORZC 4PJGB 3QDMB 1OARH 4LLAA 1NMCB 3T04D 1KIPB 3U6RA 3UO1L 4PJBA 4MPKA 4DVRL 5H37H 1WITA 3OJ2C 2YLLA 1XGUA 3OL2A 4FMFA 3U79A 2R69L 4ODSL 3SJVD 4O02L 3ZYJA 4WY7L 3VDCA 2UZYB 3QPQD 4KHXL 5L0QB 4KZEH 2EDTA 3PZMA 1JHLH 1Q4NX 4LLMA 3BDXA 2JCCE 1T66C 3MO1A 1UXSB 5CP7B 5HGDB 3IRZA 4AIUA 1J1XH 1EQCA 1N6VA 5SWZA 1IQDB 3RY5A 3B5TA 5HHME 1H0GA 5JPNB 1FNGB 3QDGA 5D2NB 1CZ1A 4JM4H 3QRFM 5FYKD 1T5WB 1W9VA 3GXFA 4QXTB 4GFTB 3MUHL 1WB0A 4Z7OE 2V17L 5FDWA 3TZVA 1MWAB 3WF1A 2ATKB 5FIPA 5D70L 1OAQL 2EDXA 5DMGD 5CLWA 4FFZH 2YUWA 4K71C 4L9LB 4RL3A 1XIWA 3GSUB 3NFPB 4JFHD 4DTGL 2ADGA 3QIBB 4PJXB 5INCA 4GRLB 1U0QA 2AK1H 4JFDA 4F2MB 4Z76A 1F4AA 2DDXA 1J11A 2JB5L 1FN4A 3ECBB 2YPKB 4G9FA 1BBJB 1NC2D 4QCEA 1RK0A 1JF5A 5EN2B 3MBED 5D1QC 3PGDA 1FRGL 5E4EC 3E6HB 3HR6A 2AXJA 4IDJH 2Y5TB 5I24A 4MWFA 2GY5A 5INDA 3QAZB 4Y8DC 1U8NB 4U0RC 3H0TB 1M05A 1OGBA 1HSAA 4JZJA 4OZIE 3MUGA 3BH8B 1L0QA 4MB5A 5KN5A 2QTEA 1YY8B 4IBLT 4MNGA 3ULVC 4XMLH 4J1UA 3HI5L 5HI4D 1KEGL 1OAYH 4TVSa 1HQ4A 4M43H 3TH2T 5JO5B 4OFKA 5GPRA 3VI4F 3PZQA 4J3UA 4MDJA 2V5RA 3O4OC 1N3NA 3R06A 5GSRB 4BA8A 2YEZB 5GHWH 3BPOB 1NBVH 1I1AB 4GG8A 3MFFA 2Y8KA 5CEZD 1AY1H 5BQ7B 3D1MC 2P5ED 5BXSA 5BRPA 1RD6A 1HK6A 5BZWA 4OOZA 4XWGH 4HA4A 1DQQA 4LLQB 2JELH 4G6AD 1X5IA 2CRIA 3LSOA 1AIFA 2R0WL 3ARGD 1PKQE 5F7FA 4Z0XB 9CGTA 5HHQB 5L7XH 4IMLA 2QQKL 3U9PH 2QQLH 1EH9A 1HYSD 4NQCE 2ZE0A 2VLJB 1VENA 4MLSA 4OCYL 1RPQA 1INQB 4AMCA 3E2HC 4GBXB 3CTTA 3VNYA 4PRNB 5FUCE 4N1HB 3T0DA 5TQ0H 3V6ZA 1CICC 3JWOL 5DUPL 4FQ2L 1EAJA 5E8NA 4WWKA 1T4KB 4YHEA 3TZVC 1CLOL 4GIAA 2ESCA 1KJ3L 1U9KA 4PTUB 5F1IB 5A2JH 2CLRA 3FOLB 5JUVA 3RL1A 1U8HA 4JR9L 4NIKB 1XIWC 3MV8D 4O58L 1ZSDB 1LK2A 1T1YB 1A7RH 1W0VB 3WBAA 4P5MA 1EHLH 1AJ7L 1OSPH 2JIXD 5FECB 3O2DH 5FGSA 1KJ2H 5MP6H 3C6LB 2BY3A 1G9HA 3OZOA 3FQUA 1CD0A 2VDOL 4PJ5D 4XNUH 1BJ1J 4JANB 5DEGA 1B88A 5F96H 3BH4A 1GIGL 3VD3A 1FVDA 2OXGA 3MLTA 1INDL 4XGZB 1T6VN 5I76B 1A14H 2DLFL 2FYYA 2J62A 4OGYH 4KC3B 4IOSD 4F79A 1RHFA 3STZA 1EFXA 1DLHB 2DOCA 4GJTB 1M03A 2FECL 2VDML 3QA3A 2AJ3A 25C8L 4WHYG 4WW1B 1DE4A 5I3DA 4ZQKA 4ZFFB 5GS1A 3OLDA 3WO4C 3O6MH 5CEXB 4ODTL 4ESKA 3SCRA 4Z78A 3ARPA 2J79A 3SUTA 3ZDZE 3DSFH 1CIDA 1WK0A 5A6KA 1NGPH 3MJ9L 4LBEA 1FP5A 1LE9A 4PB0L 4CN6A 4FG6C 3B9VA 2CRMA 1S7RA 5FYLD 3ZE2F 4G9DB 1DWHM 5GGSA 2E3ZA 5MEPB 3AXLB 4PRWA 1FH5L 2HKFL 4PR5B 3QI9A 1SYSA 2CRYA 3PL6D 1L0PA 2DT1A 4XC3H 2OSXA 2YXFA 4NNPH 3CHCA 5DZLA 3NN8A 3WJJC 2O5YH 4ODHH 2D24A 3EAKA 5T1KD 1US3A 3RIFF 2D9QB 3NIGE 3D2UA 5IT2H 4WGWB 5DT7A 3OAZH 1RJLA 5FYJH 1PY4A 1YY9C 5F7HA 1UUQA 1K2DA 1EHXA 1D6EA 4ODVH 5HDLA 3AUVA 3I85A 3SGKC 5BZDA 5EZLA 3ZO9A 1Y6KR 2M2DA 3QPXH 4M1RA 4L8DA 1ZLVK 3U4EA 2AJVH 2OZ4H 2C8NA 2UZIH 4V1DE 2VXSH 5CZXD 1NMBL 3Q3GA 3CFCL 3GSVA 1ZS2A 3IXAB 2RGSA 1X7QA 2UWEA 1OTUD 2AJZB 4M3JA 3FY1A 4RGNB 4XWOC 5D7SH 5GNZA 2GW5A 4F33A 1INEH 1XH2A 1A02N 1CFSB 1MHCB 4TTDC 3N18A 4ACZB 4WI4A 5IHUL 4IM8A 5T1DH 1ITBB 1H3VA 3DHPA 1ZS8B 4JY6A 4XB8A 4HK0A 3S96A 3JV6A 3W28A 4YHIB 3WS6A 2OLHA 5FOJA 3KL0A 2PTVA 3IKKA 1JN6B 4QAWA 5DHVB 3VGFA 3BRDA 4QLJA 2N4IA 3FO9B 1CLYL 3CNKA 5EZIH 2A73B 5FYJE 5T3ZH 4UBDD 4K71B 4BH7A 1UADC 4KRUA 1HEZA 2JLLA 4FRWA 5CP3H 4UQCA 1AI1L 3QEQE 2HJLA 5GS1C 2W5FA 1MQPA 2WMIB 3VXUD 1GVIA 4UQ2A 3MBXH 1I9JH 5D1QB 1RUPH 5E4EB 3CBWA 1MVYA 2HJFB 1HL9A 5FIEA 1NGWA 3WIHL 2EJ1A 2D03L 1CFQA 2ATPB 1T6WA 5E03A 1DBMH 3TN0D 3AJ7A 4ZFGL 3AXHA 2ICES 2GTWA 4JRXA 1YMHA 3O2WL 3WFEL 2AKRA 5MEOA 2W0FB 1DLFL 3CZFA 3HC4H 2F8VA 4HIEA 2XFXA 5JXEC 2DSVA 3IGAB 1I85A 2YBTA 2YUXA 3OIHA 1LJYA 1KLUB 3T1FB 1WCGA 4HHAB 3PZUA 4NRRA 1VPOL 3HMXL 1KXHA 2VLKB 4X5WA 3F7RA 4M80A 4GI6A 5T3ZE 4U1SA 4ODUA 3M8OL 1TJHL 5AWNL 5IFAL 2YZ1A 1JHKL 3I02A 3RNQA 2CK2A 3VRJA 1D2KA 3KR3H 3VX1A 3WF0A 4OUOA 3U6RB 3L6FA 3R1GL 4DKFL 1MVUA 4KJWC 3O4OB 4X4YB 1Z2KA 1IAKA 2MCPH 3HNSH 5HDQL 3B6SA 3HE6A 3U48A 4L4JA 2NY0D 4OIBA 4YHKH 4X4ME 4P2QE 1CGUA 3O3EB 1DWIM 1CFNA 2XYCA 2X9YA 3O8XC 4QRPA 4MA3A 4WDIA 5IW3A 4HW6A 1B90A 3MO1B 1VJZA 1CT8B 3ZTNH 5I1KL 1I1CA 3OZPA 1HIMH 5SWZB 2MFNA 1JF6A 2XICA 4P9ML 2XM1A 2D20A 4LKCA 1ZT1B 3QDGB 2ENSA 1WCQA 1DBKL 1HINL 3E2HB 4HPHA 1RZKC 5GGRY 3ZL4L 2RR3A 1UQYA 1JTOA 1F90H 3WS6C 3DBXB 1NUDA 1H3PL 1CICB 4ZFZA 1TJGL 2YD4A 1GZPB 5FDWB 3IDXH 4JG0L 5EUOF 2Y06L 4RCAA 3ULSA 5A6MA 2GJ6E 4BS0A 5I1GL 1VDGA 3KYAA 1OAZH 3KZSA 2ADGB 2DM2A 1DQJB 1FNEA 5C09E 4NHUA 3WIFA 5INCB 4WEMB 1OAXL 3U0TB 4Z76B 2ZWLT 3DUHA 3QUMA 4G9FB 3BHBB 2ICCA 5LA1A 2EEXA 5EBMB 4KDTA 4DGVH 3P9LB 1DBAL 4MA7H 3ARDD 1KPVA 3CMOL 1T04A 2BVQA 1VJSA 4MWFB 3PZGA 3BSGA 5INDB 2JCCA 1M05B 3GHEL 4LSPL 1HSAB 2KH2B 5J11B 1CE6A 5KN5B 1I85C 4MNGB 4JO2H 4J1UB 4ALAL 1YN6A 5F89B 1HQ4B 3WO4B 2F53D 1DR9A 3MUJA 3K8MA 5E2VL 3APGA 4XZBA 2BFVL 4PJ9A 4F58H 4NKQB 4ZAKC 3FFDA 4MDJB 2W0PA 3R06B 4HUKB 5IG7B 3E8UL 4NZTH 4GG8B 5FGCE 5JNYA 3WL0A 5BJTB 1JNNH 4HC1H 4NNYA 2BRQA 2FRGP 3VRIA 1PZ5A 4PYSA 2YPLA 5BZWB 1T0NA 4X80H 4QHNA 1OOAA 1DQQB 5IB1A 5FHBL 1Q0XL 1T3FA 4I2XE 4WLCA 2GJPA 4MNQD 4IMLB 3QP3A 1KOAA 3QIUD 4JPKL 3UJTH 3K46A 3AM8A 4U1MA 1T7VA 1B6DA 3QEGH 2J47A 1GGBL 5CINL 5CSYA 1VEPA 2OJZL 1SYTA 1S9VB 3RJQB 1MCWM 3V6ZB 2VX4A 1W1VA 4J3WA 6FABL 1U3HD 3K8KA 5E8NB 3U83A 5IBLD 3CSYA 3BW9A 1HQRA 1V7NH 3RL1B 1U8HB 2ZUWA 2AXFB 4NHCH 1CGSH 2WQRA 1OGAB 1PG7L 4U3CA 4P5MB 4HS3A 4MNHA 2EE6A 3V0WL 4GSDL 4LYRA 2BVYA 4F7CB 3POHA 1BVKA 4TUKL 2YKKA 5K9JH 5C07B 4NN6C 3U7YL 5DEGB 1I8IA 5KANI 4WEBH 1CG9A 3GI8L 1DVFD 1MJUH 3QQ3A 2A3BA 3TNNA 1J87A 4KDTC 2R4SH 3L3IB 5DMIH 4LEXL 3MOBH 2FYYB 3DRTA 1Q94B 4PP1D 5D71H 2R4RL 1PKQA 1XH0A 3G5VA 3SCSA 2EYTA 1A64A 2QPUA 1CWVA 1U42A 1L8NA 3QA3B 3UZEA 2AJ3B 4QT5B 3A4WA 2VR4A 3AGVA 3FN9A 2DQFA 4OB5L 5I6SA 5GS1B 1FH8A 3IS0X 1G6VK 2D1ZA 2VLRA 4PG9A 1V7MH 2B2XL 5EUKA 5T3XD 4Z78B 4PJ9C 3WFDH 5ECJE 4LBEB 1HCVA 3LMJH 4PGJA 2M1KA 4GZIA 1BZ7A 2EEBA 5HDBF 3K2UH 5C92A 5KVEH 2EXWC 3MV9B 1HJVA 5E8OA 2FH8A 3W11D 4YHPA 1LQSR 5DQDL 1K9FA 1C3FA 2FECI 2HT2D 1U3JA 2BC4A 1SYSB 1OM3H 5ESVA 3WDPP 1LL4A 3EOBA 3UR8A 1II4E 1CLZL 2QF8A 1AGFA 2FD6H 4P3WA 3EFDL 4S1RL 5HDRA 1NM9A 5DJ8B 1ZGLA 3SDCA 5FGRA 1HDMB 2CERA 1KENH 4WI3A 3T08A 1RJLB 1Z3GL 3VFSB 1K2DB 4HKZA 1E4WH 2CHNA 1D6EB 4PJ7F 5BZDB 5EZLB 1BQLL 4HMEA 4GAGH 4L8DB 3DX7A 5D7JA 5KVGH 1N5AA 2HJKA 2ZPKL 1RU9H 3GSVB 4D9QD 1ISVA 3MZTA 5E2TH 5TDNA 4IUGA 1MH5B 1MNUH 2Z8RA 4XPBH 5E2JA 1X7QB 5M7QA 2UWEB 3O8XB 1T0PB 1M7XA 4M93C 2L7UA 5H2BA 2J6EH 1IC7H 1G9NH 2UYLB 1TCMA 3IJYB 4ODXA 4DKAA 2XPGA 2DL9A 5IVXF 4JY6B 3S96B 3JV6B 3GMLA 4BUGA 3M1BA 1Q9OB 2DWEB 3MUIA 2VXVH 4PRDA 1UZ6F 4WF7A 4X6FA 1OIMA 4PJFA 2OL3L 3ULVL 1B3JA 4BH7B 2P5WB 1MCLA 2UY2A 3N9GH 5C7XH 1HEZB 1DP0A 3AHVA 3W27A 4YFLF 4MX7A 2HJLB 3PZ9A 2XHYA 4HEME 1YECH 5I74C 5IQ7H 3WNPA 4P2RE 3PWUA 4B3LA 2AABH 2H8PA 5FUCC 5JDSA 3QR2A 1FNFA 1C8PA 1R5VA 2ARJB 1FAIL 1E4MM 3IDIA 2QR0A 1NJ9B 4YLQT 4LVNC 4WW2A 2VXUH 3O9WC 1AP2A 3BEWA 2NW0A 4PJ7B 2GTWB 1BTCA 4OLVL 3B2VL 3QHFL 4QFUA 4HIEB 4OQ1A 5CGYC 4Q0XH 3TIEA 5ABEA 4L4VD 1MCHA 3CFIC 5E08H 3MZGB 4P7QA 3Q5OA 4ODUB 2W91A 1WIUA 1EZVX 3VRJB 3IKCB 4DOHB 3UTPE 1OSZA 1C08A 3ZDXE 2HFTA 2UUDK 4ZAKB 3L6FB 4B15A 4O9HH 4P46C 1LO2H 1IAKB 4PS4H 2JCCF 1K4CA 2DI7A 3MR9A 3CIVA 3NFSH 2P8LA 5IMLA 4K7PY 2AJXH 1XF5B 4CU6A 3PHAA 3OJVC 4ZUTB 1MHEA 1H1NA 3QEQA 4IS6A 1CFNB 3HMCA 2GEEA 1UWGL 4WDIB 2YMXH 3CDFA 1LO5B 3NACH 1BF8A 1OY3B 2NY7H 3IDJA 3VDAA 1VFOA 3NABL 4L3EB 1VIWA 1H09A 4Z7OF 4ONFL 4HD9A 3VCLA 5IW6A 5I8EB 4NKIL 2BOCB 3P9MA 4MHHI 4WUUA 3MLZH 3S2CA 2J77A 1YA5A 3DUUB 4M6NH 4NO0A 1JYWA 5C0CB 2APTA 4ZS7L 1EJOH 1PEZA 3WENA 4ZFZB 5E8EB 4HXBH 2YBRA 1TJIH 5FKAA 5I19L 3ULSB 3BQUD 3MUZ1 5A3IC 2E6JA 3D85A 1G9MC 3L5XH 5DD6B 4E41D 1FNEB 3WIFB 5KS9A 1QLEH 1UGNA 3QOKA 3EYUH 3UTSD 3IS1X 1AFVH 4ZTPH 5AZEL 3AREA 2P49B 4NN6B 2HH0H 4MB3A 3TM6A 4OI7A 4OZIF 4Z7UE 3C87A 4HZ7A 1LDPH 4LHJB 4WW2C 1R0AH 1ND0B 3SGEI 1KPVB 4MJIE 1T04B 1FJ1A 2BHUA 1ERNA 2BVQB 3DVGA 3LPOA 2GQHA 5IHZA 2V2WA 1OB1A 2JCCB 5JW3L 2WXDM 4XP1H 1A5FH 1CE6B 4XCFL 5HHMB 2WSPA 1NEUA 4NKMA 4WHDA 5ECUA 2GI7A 1YN6B 4UTFA 4YN5A 4G6KH 4B9ZA 1FFRA 4FFVD 1VF8A 4PUDA 5EZJB 4PJ9B 3L3OA 4QY8A 2GJJA 3O6FB 1J86A 3FFDB 4ACYA 1S7TA 4X9FA 5D9MA 2WAGA 2CR3A 4APQA 2G4FA 4JVPA 2GHWB 3QG7H 3LN4B 3A6BH 5JNYB 4NNYB 3VRIB 1PZ5B 4LMQE 5DF0A 3BIAX 5C09A 3MC0A 5LXGH 5DJCB 4WO4A 5F7EL 4NUJA 4QHNB 1MIMH 5F8QC 1T3FB 3QHZH 4R3SB 4ZO9A 1YEGH 1JZ8A 3PTMA 2WB5A 5LCVL 2B4CH 3AMLA 1K6QL 2C26A 4Z77A 3TIDB 1V6WA 2QADC 3FKUS 1DUZA 3G9AB 1F4HA 4RFOH 1CBVH 2X4RA 5TFSL 4XH2A 2WM0A 1KN2L 5C0JA 3DURA 2YWYA 4KJQD 4XRCA 1FGNH 5IK3A 4OZIB 1U95B 2A6DA 3F6LA 1JPTH 5E6IC 4HX1A 1JWSB 5JXAH 2PTTB 5E95B 1XC6A 1JBJA 4AD1A 5DJAA 4F37K 1Z6JT 4HS3B 4MNHB 3V4UL 4OTXH 1BEYL 1BVKB 5A6BA 3AREC 4DN3H 5ACMA 2C0HA 1PZUB 2GUYA 1CG9B 5KSUA 3BZDA 4TNWF 3QQ3B 1M7IA 1W91A 4PJIE 1GQIA 4DAGH 3P0VL 4K3JH 3QQ9D 5F9JA 4R26L 1PKQB 4I2XA 3ZDZF 2KQNA 3G5VB 2EYTB 1J0ZA 3GO1L 4WU5A 2X1WL 3GRWH 2FX8H 4W6YB 5HGBA 1EQPA 5C0BA 1AHWA 4IOFD 3LV3A 2ZUUA 4NJAL 4PG9B 2PYFA 2YD7A 1JGEA 5EUKB 1BMGA 5I74B 5IFTA 3PABA 3UTQA 1MRCH 1I8LA 3K4DA 2BFGA 1OP5H 4G6ML 4DWSA 1EIBA 1BJMA 1IT0A 5F70A 3UYRL 1BZ7B 3TONA 5SV4A 4APQC 4LVNB 1P4IL 2DIAA 1N64H 1R7AA 4FMVA 3O9WB 1MWOA 2BX5A 5E8OB 3EJJX 4YHGA 2H2PD 3O45A 4YHPB 2VUOA 3NIGF 4XPHH 1KLGA 3ETBF 4DM1A 2BC4B 4L4TD 3CZLA 5ESVB 3DXAE 4WO4C 4PTVA 3EOBB 2DRUA 4BA0A 4HFUL 2FGWL 1JNEA 1BLIA 1RV6X 3CFJB 1AGFB 1CK0L 1KIQB 1NGQL 4MSWA 3V7MA 4M7KL 5TH2A 2R8SL 4HIJA 1JI2A 2H32H 1RZKL 1KFWA 3GB7A 4OV5A 2X7LA 3MA9L 4WW2F 5GSVB 1ESWA 1XF3B 4HKZB 4CUCA 3EJZC 5KTEL 2W60A 4P46B 4NP4L 5L2KE 2XXCB 1V0MA 4Q9RH 4Q7DA 3N1QC 5EU6A 2VQTA 4AMKH 3WS3A 2JIWA 2HJKB 2XSAA 3QWRA 4U5IA 1UM5L 4WFFE 1QRNA 5TDNB 3AB0C 5JOPD 4IRZL 4PJ8B 5I16A 1H8SA 1HXJA 3X3GL 1NOUA 1YYLL 3BDYL 5T5NG 2WBJA 4YGVB 4ODXB 1GJUA 1ZVHA 1KNOA 2YD3A 3L5JA 4LCCA 1I1WA 2A6JB 2VRQA 1BG9A 5GIRA 1GPFA 1KJ2B 5FF6A 3M1BB 2ZXAA 4NQVB 4J4PA 1RHHA 1U30A 1KIUA 4P4RB 2P42B 2APWA 4PRDB 3X14A 3C08L 3MQIA 5I1DA 4PJFB 5L88H 5SWSE 1LO4H 3HKFA 4YX2L 1AHWC 2JEQA 4D6EA 1T7ZA 2IBZX 4MX7B 2VITA 4EN3A 1RMFH 3W2DL 1GOOA 4J3TA 4OFIA 2H8PB 5JDSB 3L3HA 4G7YH 1YEJH 3WBEA 4DWSC 1NGZB 1U8MB 3IDIB 3VGGA 2QR0B 4OLUH 4V1DB 3NUKA 2R0ZH 4WW2B 3ZYOA 5DFVC 3CIQA 2AK4E 1UM6L 1ZLUH 2VZ3A 4LGSB 3WMBA 4I0PD 1IGIH 4NQSA 4AQ1B 3OXSA 3RBSA 3ZKMD 3E1F1 5EB9A 2WMGA 4XPFL 3TIEB 1V6VA 1BYDA 2ZICA 1DEEA 3SY0A 2Q76A 4AT6A 1A3RL 1H3XA 2EDBA 2QQNL 3DJ9A 4ZUVA 5C0DA 2FATH 4YIQB 1F3RB 5IB3A 3SCOA 1C08B 1R3KA 3PWJA 4FQIH 2AJUL 3RUGA 1JE6A 3UG3A 1AH1A 2P8LB 3AIUA 5IMLB 5GS0H 5GRYA 1GL4B 5T5NF 1BP3B 2J7FA 1MHEB 4GO8A 3QEUB 3QEQB 4IS6B 4LSRL 1T2JA 1K8DA 3QUML 5IW1A 2AMGA 4V27A 2V5CA 4P2RA 1T83C 2WBJC 5I30L 2HAZA 1ACZA 3L5WA 4HKJB 5HHVH 5DYOB 3VCLB 5IW6B 3GH5A 3WUEA 5IR1A 1KCUH 2W67A 1ED3A 2QADB 4WUUB 2H41A 5F1NB 2RGMA 4L3CA 1WZAA 3LKRA 4NO0B 5HI3C 5MEND 1ZVYA 1S78D 3HZVA 1UH4A 7FABH 1Q72H 5HPCA 2CUMA 4IJ3C 4OLXH 4FQJL 5EU7E 5E6IB 2Q8BH 3RDTD 2YL6A 2GIYA 1EO7A 3KPNB 4UNUA 3D85B 1JPST 3TBSB 3CZEA 5EOQH 1JCKA 1ES0A 2NY2D 4P7NA 1EDQA 4WFED 1JYXA 4LLUA 35C8H 5I66A 1KF9B 5F3BB 2V2XB 5HYFA 3AXIA 1AR2A 2DI9A 2O9TA 4K3GA 5EULV 3BH9A 1ZHBA 2W61A 3TO4D 2DSKA 1FG2A 3Q6GL 4AEFA 3WEXB 4H8VA 1OM0A 3G5ZA 5FCUH 3DVGB 3ARUA 4P2QB 1BJ1H 4AK1A 2X1PA 2V2WB 1OB1B 5A8PA 4HH9B 1Z9OA 1KXTA 2IBZY 1JHLL 4XNQB 3A0OA 3EZ8A 5JZ7D 4Y89A 2CDEA 4NKMB 2V7HB 1I7RB 4LP5A 3M46A 1Z5LA 4QHLB 5CEYA 2Z91A 3RVUC 1N0XL 3ALPA 2JF6A 3BIKA 2Y6SD 4MQXD 5E2WH 2DM7A 5CD5D 2BNUA 2NW3A 1FDLL 3SDAD 4Q9BA 2EE2A 12E8H 2XVNA 4MNLA 2GJ6B 3W39A 3G5YA 5JHLH 1LEKB 4HFWA 4QRQB 4XPGH 4V2BA 3VDHA 1TUXA 1JPGA 5C09B 3MMWA 1RURL 4WO4B 4BF7A 2ICWA 5C0EB 1ZANL 2BCKB 1D5IL 5E1AA 4YHZH 2AAVA 1ZHKB 1XF2B 4NM8L 1QW9A 4Z7UA 2Y07L 4OCLC 4LCUB 3U9UA 4Z77B 3DMMA 3KWWA 2O5ZL 3A6CL 3UC0L 4MJIA 1G94A 3S3PA 1G9NC 1C90A 1W1PA 1HKJA 4RBPK 2GDUA 3KPPB 2WHMA 2X4RB 5C0JB 1GW1A 4N42A 4EUPH 4NRYA 3KPRE 2A6DB 1I7UA 4LPWA 2X70A 3DX6B 5D7LE 3WL1A 5D1XB 4ZYKA 1FZOA 3AB0B 2WUBH 2UY5A 2I5YL 3OQ3B 1QI4A 4HIIB 4LKXA 4XMLL 5DO8A 4XP6H 5IVNA 3VIFA 4AL8H 3B9DA 4M43L 3BSZH 4N8VG 2EH8H 5GS2D 4LQ1A 2GK2A 1EPFA 5D7IE 5KSUB 5FGCB 1GGTA 4O2CB 5GHWL 4QXGL 4N90D 2OQJA 5H94B 1NBVL 2CH8A 2AV1B 4HPOH 2CETA 4AW7A 5ESAA 4JFED 1XSKA 5F9JB 1WZKA 3MCKA 1AY1L 4A3YA 4MTVA 4I2XB 4XWGL 5J6GA 4Y2DA 5HGBB 3B4NA 5C0BB 1AHWB 5L7XL 3GSXB 3GBML 2J7DA 3OF6A 2PYFB 1JGEB 3PABB 3T0EE 3PWPE 3UTQB 4U6YA 1PIGA 1V3LA 4DWSB 1EDGA 4QTIL 3PZIA 3SE9H 4TVPH 4O5LL 3W9EB 1NBQA 3UTZA 5JW4N 4JHAH 5F3HA 3CAFA 3IFOB 4NUGH 1JGDA 3O4LE 1KLGB 4V2XA 5GRVK 3VFWA 3MA7A 1BX2A 3L4XA 1P5VA 5IBUG 4PCSA 2YKLH 1QSVA 1A7RL 1EHLL 1B6UA 1P9MC 1OSPL 2K1MA 5TH2B 4B0MM 3LKPA 1KJ2L 5MP6L 3GB7B 5FO8A 2X7LB 3MLRH 1D5MB 2YRPA 4XNUL 4DKEH 3DMMC 1A3LL 4Y1AD 4QNPE 2W60B 4OQTH 4X6CA 1OTTD 1G9ML 4OGYL 3WS3B 2VSDA 4YE4H 2E8YA 1VCAA 2V5TA 3EYVB 3GMQA 4PRID 3AS0A 5DD5H 4C7FA 4OFYA 1WQVT 4TN9A 2C7UA 5I16B 4HKBB 4TVPE 2X4PB 1KSRA 3IDNA 5ICZA 2WBJB 3V6OE 2XQYG 3F6IA 1TLKA 2DMCA 2YC1A 5C0NC 2P7TA 2FIRT 5GIRB 4PJDE 5FF6B 4MVBC 5B22A 3VFTA 2AW2A 1RHHB 2E9LA 1O7SA 3WDIA 3MRPA 2J7HA 3X14B 2ORBH 5MERA 1RP8A 1JPFB 5I1DB 1QBLH 4W84A 3WH5A 4H20L 4S0SD 1UD6A 2MPAL 3QH3A 4Y2DC 4OM0L 4NNPL 3VFVA 4NJ9L 3QFJD 1D5ZB 4EBQH 4LVEA 1RUMH 2VITB 3GSOA 5H35A 4CVWA 1MPAL 3GRWA 5IT2L 4OGAD 1O5DT 2IALA 1U8LA 4QO1A 1B0GA 4KKBC 3L3HB 4K2UL 5T1LD 4HZAA 5DT1H 2N7BA 3BI9X 1CD8A 3QPXL 2D31A 2VI0A 1G7LB 3MJGX 4CU7A 4LSQH 1E27A 1V6XA 4TOQA 4UOW1 4OD1L 1CL7L 3PP4H 3L3JA 3J8F7 1Y6NR 3WL9A 2IPTL 4QRUA 4KZDH 5B4MD 3OXSB 4CJ0A 3QDJD 3ZDXF 5LWYH 5HYJD 2F58L 2YBUA 2AEQL 4JFQA 4N8VB 4PRBA 3JV5A 4M1GH 1YNKH 4AT6B 2VC2L 1SM3H 5D96C 4ZUVB 5T1DL 5C0DB 1PDKA 4U31A 5DMKB 2ZCHH 5FO9A 2UY3A 4NO5A 3BKJH 4IDLA 4K8RL 1W72H 5AUMB 3UJJL 3MRGA 2ID5A 1R3KB 2B4CC 3MRLA 3PWJB 5DQJA 1YN7A 4MXQC 3NFNB 3CZ8A 5C08E 3L4ZA 2BK8A 1CGYA 2EDRA 1SHMA 4K3DL 5EZIL 3HS0A 4FQHA 1TCRA 1K8DB 3UROR 3HN3A 1C16A 1FE8L 3QNYB 4XAKD 1A2YA 1A1OB 3N1PC 4P2RB 2WAHA 4BJLA 1SJVA 3WQ6A 2OK0L 1KIRA 1NFIB 3ARBD 4UIMA 3DGGB 2CBJA 3L5WB 4M1CC 3SEPA 1P69B 5IR1B 2CKRA 4PSPA 1ED3B 4TSBL 4POZC 4N5UA 5ITFB 4K9EC 4FA8A 4PGCA 4C83A 1RIHL 4RISH 3EOAA 2CCRA 3QULA 4PGDA 3VH8G 1WBZB 1BZQK 1H8NA 5F7UA 4CDGC 3I3DA 4GINA 5IBUB 1RZGA 3WXVH 3BO8A 2B1AH 2PYEA 3ILQD 3FRUB 4CMMB 5CFHA 3C8HA 3VWKD 2W0LA 4Z7UF 1ES0B 1TMQA 1MCJA 4UT6H 3UYOD 3TWCH 1KGWA 4LASH 1CZ8H 1RUAH 1J0KA 3IJ7A 4L4PA 1LHZA 1OP9A 2IG2L 4UFMA 4XC1H 4MA8L 1BD2A 3VMNA 1U6AL 1S7QA 2MCPL 3S98A 3QOMA 5C0AE 1HHHA 1QPXA 3LAFA 3G5ZB 3WXWL 4S1SH 4DZ8A 4LOUD 3U0PA 3FW6A 4YHKL 5EH1A 4KUZH 3OKDB 4M02A 1B3VA 4UFLA 4WTWA 2IJ0C 2QL1A 2BVDA 3FO1B 3T3PE 1TG7A 1CXKA 2DBJA 4LRIA 1V02A 4OAWA 2MMXA 2PKDA 4IIQA 1J05B 3EHBD 4P2YA 3D69A 3W0WA 2NW3B 1HKLL 2VIRA 3HTLX 1E0XA 2VX5A 3RGVD 1F90L 1HZHH 3PGFL 2Z92A 4ZUUB 3B2UD 5DEFA 3DVFA 1KLFA 2V9QA 3FRPA 3G5YB 2YWZA 1U91A 3IDXL 4HFWB 4NZUL 1MJJA 3MACH 4EK7A 2HFEB 1K8IB 2VL5A 1ZLSH 2ICWB 2P4AB 1UA3A 3CUHA 4XP9H 4XCYA 1UVQB 3EKCA 2Q6WA 3FAXA 4CD6A 3MXVH 4PMXA 4XAWL 1NAMH 1GOQA 4Z7UB 2V3EA 3OKEA 3U9UB 1J8HE 3DMMB 1CE1L 1CDJA 3KWWB 3HB3C 4MJIB 5A2BA 2FGZA 4Y0GA 2P8PA 3KXFD 1VA9A 1UWXK 1XCQB 4I0KA 1TVDA 4OIFA 5GRUH 1T2QL 4YBHA 5BS0A 4ZXLA 2K7QA 4EE9A 1T1ZA 4H1LH 1I7UB 2X70B 3T2PA 3STLA 1FZOB 4JHOA 4MDIA 4GPNA 1OAKH 1N7ML 1P6AB 3ZKNC 4Z2JA 4PJIF 3CXDH 4R7DA 1C5BH 3WFHA 5EIIA 5KW9H 3MUY1 5C9KA 1ISXA 5ICXB 2XGBA 4F58L 5D6DA 4N5EC 5C8JA 4AYFA 3IXTA 3KJ6L 2MHAA 4FNLH 5AYIA 5GGRA 1KTLA 4L8BA 1IRAY 2CEQA 3IJSB 5ESAB 5L8JB 2AXGA 1ZWIB 2OI9C 3MCKB 3G04A 3KLHC 2NY1D 2E7MA 5J6GB 4Y2DB 2IADA 4JFUA 2Y2WA 5LBSH 5CPSA 3P4MA 3OWEA 4LRIC 4GW5A 4CN1A 3UJTL 1T80A 1XGRA 2EIZB 4EDXA 3AS3A 4M5YH 3BX7C 1YEKL 3QEGL 2DQGH 5DVOA 5JHDA 3KPRA 3VH8B 1FL6A 5EU7C 4KGLA 1QSEA 1F02I 3VW3H 3VPLA 5D7LA 1TXKA 1MFVA 4GRMB 5K9KA 4WFGD 1J1PL 5TE7H 5HVWA 3HRZB 5F3HB 1JGDB 2DQHH 4RAUB 3IANA 2I24N 1KYOK 1CGSL 4W89A 1RIUL 4XV0A 4PMUA 2X0HA 3LKPB 3BD4A 3BT2H 1FL5B 1YEEH 4PJCE 5D96B 2PO6D 4C4KT 2XRAL 5FO8B 1K6AA 4GW4A 4PJIB 1DL7L 3AIRA 3LQZA 4XX1G 1MJUL 3I6LD 1W0YT 2B1HL 4NKOA 4ZS6C 2FDBP 2BSRA 3DV6A 3NCFB 5DD1L 3FB7A 4W7UA 4BQ3A 3HE7A 3H9SA 1QKZL 2FWOA 5DTFB 4WI8A 4H26A 3GMQB 3LRSB 3VXSD 4AG4L 3LRGA 4P5TA 3BDBA 4HUUA 1D6VL 5KSBE 2C7UB 2DKMA 1ZA6A 1A6UH 2Q1EA 4JLRA 4NZRH 4RNRA 1QPPA 4NGHH 1Q6DA 4KI5E 5EG6C 3DETD 1OINA 5D6DC 1HP4A 2ESVA 1VBUA 2GAZA 1S9WA 2YC1B 2O61A 4NM4H 2YS4A 3QDMD 3O4LA 1J1OL 1YNLH 4XVUC 3C5SB 1I75A 3MRPB 3DXAB 5MERB 5IIEA 3KYNA 4XBPA 3FRPG 3MUAA 1OM3L 2I25N 3QH3B 2RBLA 4GZJA 2QHRH 4PRPE 3VFVB 4Z7QE 3AI0A 2IQ9L 2FD6L 2R2CA 2VLLA 1DN0A 3UMTA 2QLYA 4PRAA 3CPLA 3RKDC 4GQPH 5CJOL 4YH6A 3ZHDA 2A3HA 2JJTA 4V28A 4L4OA 1J0YA 1KENL 2AS5M 1B0GB 1RZIA 4Z7VA 3RI5K 4AY1A 1N4XL 4LHUA 1BREA 1ZAGA 1ZGLM 4GAGL 2D31B 2ZUQB 1LK3L 3U1SL 1YNTA 4YK4C 3UEQA 3I75A 3NH7H 4YR6B 1RU9L 4AD2A 1EDTA 4XNMA 4KKAC 4QHKI 5E2TL 1FZMB 3L3JB 1TZ7A 5E70A 3WL9B 3QYCA 4QRUB 2VH5L 4XPBL 1IMHC 1YEIL 4YHNA 2XVPA 1PSKH 1G9NL 4PRBB 2AEPH 3WUWA 5E00A 4PJDA 3AHTA 4S3JA 4GRLD 5CUSH 5CIPH 5FO9B 4HSQA 1YC7A 1TVPA 3HG1D 3FT3A 2DLEA 5SWSB 3HE7C 3S37H 1ZB5A 1F58H 3I9GH 4PCTA 3GBNH 3H3BC 1RK1B 3LEXA 1IEBA 2MQCA 4Q9QH 4FQHB 1TCRB 2DKSA 3KVQA 1U2HA 1KGCE 2J8UE 3IFNL 1C16B 2D0GA 3KPSA 2FL5B 1A2YB 4W93A 1GJIA 5DVMA 2BNRE 4IPNB 1SJHA 2F19L 1YECL 3T4AA 3LHPL 4R4NC 5IQ7L 1RULH 3BGMA 1BGXH 1WE5A 4C56A 4RMRA 2BVOA 2AK4B 3RVWC 3EO1A 3GSWA 5F9OH 2PCPA 4PGDB 3VFUA 5JOFB 1E1FA 1A1MB 2AERT 5CJ8A 5I2UA 1QBAA 1RZGB 4KQ4L 2OYPA 1T20B 2PYEB 3WFZA 2AJYH 1WLHA 1UACL 4I3GA 5EZOH 4Y4KA 3C5ZD 3FN0H 5KSVA 2F8QA 5E2UH 4HWEH 1B3YA 5E08L 3THMH 3PHSA 2VX7A 3BPNC 4R90H 3L5HA 3RVXC 3B43A 3MLPA 4JFTA 4A6YA 1F45A 4LPCA 3EGSB 3IAPA 3G6MA 5C08A 3AMDA 2ED7A 3ZE1E 4O9HL 4QWWD 1OB0A 4W5UA 1S7QB 1HHHB 4PY7A 4U1JA 5C0GA 4G8FA 1C7TA 2AJXL 2OR9H 4OF5A 2OI9B 2DYPA 3U0PB 4JL2A 3ARTA 5JDJA 5C8BB 1IL1B 4KQ3H 3WUFA 4ONOA 3L3KB 4ZFOB 8FABB 4FZEH 3V6OC 3H42H 3KG5A 3NACL 4EUPG 4X6BA 1VB9A 1NC4A 2NY7L 1FO0A 1H11A 3UESA 1F2XK 4YUEL 1NAKL 1VFBB 3O0RH 3D69B 2VIRB 3C6LD 5IJKC 4X0NA 4RZCA 3GMRB 1CFVL 2Z92B 1EJOL 1MW0A 1OP3K 5DEFB 1E0WA 4XCEA 3U5UA 2YK1L 2X4OA 3N11A 3MOAH 4UTBH 4XPTL 4YHOL 2VL5B 4RIRA 5IESL 4HT1L 4XCYB 1ODUA 1SBSL 1QBML 3RIKA 2Q6WB 2EPMX 4M56A 1QLEL 4MZ2A 5D1ZD 1AFVL 7CGTA 2G9HA 4L1DA 5L9DL 1IBGL 2CKBH 2DTMH 4EI5B 2FJHA 3A4XA 3RWJA 5I15H 4LHUG 3WNOA 2V7NA 2LAGB 5KVDL 2GT9A 3BWAA 1TNNA 3ULUC 1T1ZB 1V0LA 3MV7A 4P7OA 1GNXA 3STLB 1WDQA 5D7IF 4R4BB 4Y4KC 1OWRM 5EDXA 5BRZE 5AC5A 4QEGA 2CBUA 4R7DB 5EIIB 3QG6A 4QYOA 3T77B 1S3KH 3WUWG 5ANME 4PMZA 2ARJQ 1U8KB 5A6JA 3VXME 2A2QT 2V5MA 2XY1A 5CBEA 2JEPA 5BMFH 3BUYA 1A7PL 1WWBX 1V05A 2ZCKL 4D0CA 3ROLA 2AXGB 3G04B 4P3CH 3O11A 3L95A 3RVVD 3FFCA 3QUZC 4JCLA 5HI5D 1BFVH 1NANH 1XSIA 3KL5A 2WWDA 4QOKE 3WSQL 1JTPA 1MIML 1PEWA 2DM4A 4FFYL 3DV4A 2WW5A 3L3GB 2XFFA 2PW1A 3CO4A 1YEGL 1OF2A 2NX5D 1J8HA 3RA7H 1HT6A 4GW5B 2Z0BA 2EE3A 5FK9A 1RZJH 1JDDA 1T66D 4RGND 2B4CL 4NQDA 5I8KH 1GYAA 4Y16C 3TCLB 4F9LA 1FYHB 4EOWH 3VJ6B 3KPRB 1PGRB 1FL6B 5M95B 1QSEB 5D7LB 1R6VA 1G5AA 5ADOH 2Z9TA 4YK4B 1H5BA 4DVRH 4X83A 4EDWH 1JP5A 1E6QM 1IM9A 4QNPF 4O02H 4WY7H 1CBGA 1CYGA 4K9EL 5D7IB 1JGIA 2CR6A 4GAJL 3S35L 1CDCA 3LQZB 1WTLA 4B50A 1CDHA 3QSKB 4NKOB 4UDUA 3O2VL 2BSRB 3DV6B 3FB7B 4TNWK 4DAGL 1WVZA 3HE7B 4K3JL 5IEHA 4XI5C 4H26B 2FEEL 5BROA 3GMOA 1O7VA 4DW2H 3QB7C 4EUPB 3GRWL 2V17H 2EDLA 3QNXA 4PJDF 1ZA6B 4JPWL 1OAQH 1F5WA 4OLWH 2GJRA 4JLRB 4RNRB 3T0EB 3V0AC 5IHSA 2Q8AH 4Z2LA 2XZZA 1NGXA 2W07A 4NBZB 5BXFA 2VB5A 3DTXB 3GJEA 2GAZB 4UQBA 1S9WB 2JB5H 1JV5A 4GOSA 5DZOA 4YDVA 1CDUA 3O4LB 3GXMA 2DPEA 1ISYA 1FRGH 2V9TA 2DD8L 3KYNB 1FFQA 3V0VA 3WF3A 1ZHLB 3LKNA 5DK2A 3UBXA 3BAWA 4QHMA 3SN6N 2J5LB 4NC0B 1DN0B 5I73C 1AR1C 1FLRL 1S7SB 4NO2A 2ZUYA 4WTZA 2JJWA 2UY6A 5D9SB 3BPNB 4NRXB 4ZSOE 3HI5H 1KEGH 1QSFD 4JAMA 3SCPA 4LHUB 2H1PL 3KEHA 2VAJA 4WJ5B 1LP9E 5FYLE 3C8KA 1B4JL 3I75B 4AMKL 2CQVA 4G6FB 4L3AA 3PJSB 5FA4A 1XEDA 3C60B 5KSBA 4JDVA 3GSQB 4P59L 4XNMB 1CICD 1OW0C 2E7BA 3AS2A 4ISVB 4YHLL 2MANA 1FSKC 1CU4L 3CGTA 1JI1A 2CPCA 1XR8A 2DM3A 2RFXA 5E5MA 3WUZA 3FCTA 4PJDB 2R0WH 4PJEE 4QXWA 1CGWA 5DJYA 1CS6A 3CVHA 2BVPA 1KCRH 2AP2A 2QQKH 4PJHE 3PWNB 2ZKHL 3V6FA 3OAZK 1IC5L 2J4WL 5SWQA 4E9LA 3A67H 2V5DA 3D39E 3FT3B 3CUJA 4HUNB 1IVLA 4WHCA 1QBBA 4LSUL 1HNGA 5DK0A 3TVMA 4PRPA 3LEXB 1Q9WA 1IEBB 1RZ7L 3B83A 2PC8A 4FQXA 3JWOH 4JCMA 4ZFMA 2IC2A 4FQ2H 4MNJA 2HFFB 1MY7A 3ES6A 4AIZA 3WEMA 3DWTA 1RMFL 2IAMC 4O58H 5C0IA 3QEHA 3T4AB 4MXVE 3HMWH 1LE5A 5DEZA 3BGMB 4Q97A 3D0VA 4G7YL 1LG1A 1EOMA 2BVOB 4O2EB 2CESA 2R0ZL 4AZ8A 3GZAA 2PCPB 1F3JB 3VFUB 4V2CB 2IAND 1INDH 2OYLA 2WINA 1E0OB 2DLFH 3ALWA 4R0LA 1VEMA 2KL6A 3UPAA 4EEEA 4JFFE 3OAYK 4Y4KB 4DCQB 3BP5A 5KSVB 5EFDA 4HH8A 2BSSB 25C8H 4GG6E 1XYFA 2FATL 4M7ZC 5F6HJ 2OM5A 5IV2B 1GSMA 4QGTA 5FB8B 2Z35B 4N8PA 2HVKA 5C08B 4JJ5B 2IQAA 4ODTH 3WMSA 2HP4A 4GUPA 1FYTA 1YY9D 4FQIL 1L0YA 4GKOA 5TD4A 4NF7A 3MJ9H 1JUFA 3T3PF 1Y18A 4U1JB 4PB0H 3PXHA 4G8FB 3VM5A 3QUZB 2IF7A 2PWGA 3L3DA 2FHFA 2BNRA 4NI3A 2DJUA 4UNTA 5FD0A 1FH5H 1NBYA 2HKFH 4Q22A 1MEXL 4H1LG 4X6BB 1NC4B 1OAUH 4LLWA 3SUVA 1FO0B 4KKLC 4FQQA 4G80B 4NFDA 5C9JA 1OGAD 3RPKA 1Y0LA 4CKQA 5HHVL 4LDOB 4XWOD 1E71M 4Y16B 1KCUL 3TNMA 4L8CB 4I9WD 4PLJD 2HT3C 4B7IA 4RZCB 5C07D 4ONGL 1DQML 4NQXA 2ICWI 2X4UB 4K7FA 1JRHL 2JJUA 3BD3A 4RMTA 2Q8BL 1KT2A 2X4OB 1S7VA 1S8DA 4NRSA 3MRNB 1Z0NA 2DQDL 4FQXC 4RIRB 2GJXA 4XB3A 1FNSL 3EO9L 3DIFA 3CFCH 3UBXG 2IMNA 4R2GD 5KBNC 1BGGA 1MQRA 2VT0A 3PDOB 3D48R 1PX4A 3CUFA 2WKGA 4HBQA 2XG5A 1ADQA 4RAHA 3TBTB 2A9NL 2G9HB 5C0AB 1JZ2A 4X4XA 4MAVA 3V52H 2FJHB 2ZOLA 5IHUH 3RWJB 4D6IA 2OWWA 4D0DB 4XHJC 5FCUL 4LCWA 4AIXA 5M3WA 4ZPVA 5HHOA 3BZEA 3MV9D 3VXPA 5MHSD 2NPLX 2PXYA 3MV01 3QT2A 3R0MA 1NWRA 1CLYH 4ELME 2YPVL 3GIZL 5JXED 4N9OB 4LMQI 1JNLL 2D4DA 4OFDA 4PBVC 3FQXB 1NKOA 3QG6B 1AI1H 4QYOB 4H5SA 4BZ2L 1GUVA 1J12A 4PSRA 1HX0A 2I07B 1FL3A 1M7DA 1N8ZB 2AJSH 4BFBD 3KAAA 3SJVA 1BAGA 3NTCH 4R7NB 2COQA 2A74A 2MOVA 3ROLB 1QFPA 4KJWD 1XCTA 3SKMB 3WIHH 3L95B 2J8HA 2D3VA 1AKJA 4N0FA 1T22A 4ZFGH 5BXPA 3O2WH 3LH2L 2EECA 3WFEH 3DV4B 5I73B 2PW1B 1DLFH 2QSCH 1J8HB 3O8XD 2X8RA 4ETYA 1ZBKA 3BLPX 5FK9B 4BH8A 2IBBA 3CDCA 1FH7A 1IZJA 5J4MA 3PWLB 1Q8MA 4XXCC 4PTMA 1E6RA 1QOKA 1IAIM 4P57A 1I8KA 2F54E 1TJHH 2VDQL 5IFAH 5FYKU 1CD1A 1JHKH 5JBEA 2YR3A 1RIVH 1NFDE 2L0DA 1GC1H 1UQSB 5KZ6A 1U8IA 3R1GH 4M62L 4DKFH 5ENWA 4H2CA 1XGYL 4PJCF 2BXYA 2DSUA 3MMDA 1MCSA 1FSKB 3E6FA 5I75C 1LL6A 3T2NH 1IM9B 4F9PC 1CIUA 4XP6L 2P5WD 3NMEA 5HGGS 1NC2A 5ANMA 4PV8A 1PIFA 1WZ1L 3MBEA 3BSZL 1C5DA 4IEFB 4QXUL 5FO7A 3RM4A 4N1EA 4ZXBB 4WVRA 2XFYA 2XTKA 1FHLA 1NAMB 3K0WA 2HT4C 4UDUB 3WE6A 2W9DL 3BSHA 5JW4R 1AXIB 3WEZA 2G5BA 1HINH 3SKUD 3QFDA 2CKBA 3VXRE 5IEHB 3ZL4H 2WIIA 4QOKA 3WQ8A 5DWUL 1XH3A 2VCAA 3GMOB 4KI5F 2BXZA 1H3PH 1FV1A 1TJGH 4C59B 2EDQA 2PXYC 2XN9E 4H1LB 1P6WA 5E8PA 3QNXB 1GOKA 4Y4HD 2Y06H 4BQ6A 4UINH 1P7HL 1MFAL 2YDSA 3DX8A 4HP5A 3S3JA 1ZK9A 5I1GH 1NGXB 2IAMB 3MNWB 5CSBA 2H6PB 5BXFB 2DLGA 3Q5YA 3PZNA 1OAXH 4X98A 3RRQA 1GQLA 3RX8A 4JFXA 2QKIA 2XTLA 5I71C 1BPVA 3QIWC 4JM2C 4WU7A 3SE9L 4Z7QF 4TVPL 4YDVB 5B38A 1NDGA 2FEDC 2P5EA 1BLNA 4ZAKD 1NWSA 2FEEI 4ZTOL 4UR9A 3ARGA 1P2CA 1DBAH 1G0CA 1VKXA 2QJDA 3LKNB 4HK3N 3UBXB 3RX7A 2YKLL 1JGVL 3LMYA 4U1IA 1MLBA 1V3KA 1XF4B 2EXYD 4S1DC 4WCYL 3ZJ7A 3MRCA 4NO2B 3CFEB 1FQ9C 1SYVA 3K4ZA 3SDXE 3IAGC 5IB2A 3U7VA 3S34L 5K9QI 5BCAA 4M7ZB 4L3ED 4JAMB 2OJEA 3OG6B 5E2VH 3WMCA 1JL8A 1C12B 1MQ8A 5EMYA 3C8KB 3MYZA 3K1KC 3VFMA 4FF5A 1E4JA 1MCPL 1MRFH 4AZ6A 3FQWA 3EFFB 5C0CD 3MV8A 5KSBB 4JDVB 1KN4L 2JTDA 2J8GA 3M17B 3AIVA 1WIOA 3EYFA 5I78A 3E8UH 5DD5L 2JIXA 4YXLL 4TSAH 4XMKL 2W0KA 2G3IA 1KV3A 3QWOA 5T33H 3V5DB 1HHKA 3VXTA 2O5XL 1QSZA 2RFXB 4UB0H 4PJ5A 1CLXA 1U3ZA 4RSVA 3MBEC 3MGOA 2ZX8A 5FHBH 2Z1SA 2BVUA 1I3RB 5BO1L 4WFHE 1Q0XH 5A69A 5KOVC 5DJYB 4KK8D 2CD0A 5BXTA 3ULUL 4JPKH 4OT1L 4HS6B 3V6FB 2AAAA 5SWQB 2J8UF 3EYQD 1JGLH 4S11A 2O9PA 4WI2A 1GGBH 5CINH 1B9ZA 2VLJE 3MRFB 3SKOB 2ZXBA 4PRPB 4LFHD 1Q9WB 2YSSA 1V08A 1KR0A 6FABH 3QCTL 3ZYIA 4KK6D 5IMOA 2DTSA 3RL2B 1KXQA 3GMPA 3VXQA 4A6YL 3GJFK 2LQRA 4AIZB 3GSNA 1NLDL 4PB9H 5HHMD 3QEHB 5C0IB 5C6PB 4U7SA 2VZOA 3AHZA 4ZENA 1LE5B 4DVBA 3WO3B 3MSDA 4GSDH 2FR4A 2CGRL 5TF0A 1E56A 2PBOA 4TUKH 3JTTA 3RHWK 1KGXA 4PJ9D 4NWUL 3U7YH 1CLVA 3O6FD 4CRPA 3GI8H 5I1CH 4U1KA 4URIA 1K9EA 4G6AC 4PGBB 4PLKD 3TV3H 3PP4L 3CC5A 3R0NA 3ARGC 2VYRE 2WINB 1FO0L 2VAAA 3C5JA 3P73A 4ZUWA 3CLFH 5T1KA 5IHRA 2LU3A 1HN1A 3LPPA 3ZE1F 3BP5B 3KLDA 2GUOA 3AU1A 4M1GL 1YNKL 2VX6A 1SEQL 2AVGA 1D3CA 4GZEA 1UZ8A 4X9GA 4OB5H 2ZCHL 2JB6B 3RZCB 3WSUA 3BKJL 4Q6IA 2NLJB 2IQAB 3W5NA 4LVHC 1UG6A 4JPVL 4GUPB 2NCMA 4RX4D 2DEPA 3NA4A 1YJDC 3OV6A 1JUFB 5HYSB 1Y18B 1KB5A 1OTSD 3H3PH 3HJEA 2ITDA 3ESVF 4Y4FB 4F7EB 2XZCL 5DDHB 4RA0C 2J8UB 5DQ9B 5GGVY 1QO3B 2BNRB 2JKXA 3AICA 1EEQA 2OXHA 5DQDH 3SKNA 3MLSH 4UV4H 4JZ5A 4OD3H 4KGJA 4IRSD 3N1MC 4LLWB 5C9JB 4FQQB 5GZND 4C54A 1PZ2A 1LQ0A 1CLZH 1Y0LB 1BYCA 4JM2F 2PTUA 2WK2A 4S1RH 1D9KB 1MW1A 3TPUB 1IARB 2R23B 5FUOH 3GBDA 1LWJA 4NQXB 4K7PL 4RISL 1QOXA 4R6UA 4UUJA 1Z3GH 3WD5L 4K7FB 5JPMA 1XGQB 5B38G 3PE9A 1IEAB 5TF1H 1BQLH 1KT2B 1H3UA 4FQLL 3V5HA 4N0CC 3ZSTA 1S8DB 2B1AL 3ARSA 3OMZA 4DK3A 4JQVA 5I75B 1CF8L 2QBWA 2ZPKH 3VXUA 1UYWL 1X5JA 4UT6L 4CD8A 1PLGL 4LASL 1EMTL 4NQCD 5FV1L 1CZ8L 1RUAL 5I1HL 1E6NA 3OXRA 4X4XB 3TN0A 4XC1L 1AXSB 2ZOLB 4B9YA 4Z2GA 3AMKA 1HVQA 2Y1VA 1IJ9A 4JZNA 4F7PA 5GGTA 2R2EB 5HGHB 1NMAL 4ZPVB 3O9WD 3BZEB 2PB1A 4DN4H 3QQ4A 4UNVA 1Q9LB 3LQAC 4TQEL 1J01A 2WHKA 1FOBA 2PXYB 4G8GD 2UY4A 1UOKA 2OL3H 3LN5A 3QXUA 3ULVH 3HLAA 3SCMB 5D5MA 1EGJA 5E9DD 1JXJA 1SBBA 3NJ3A 4OBSA 1IKNC 3U36A 1DN2A 5TPWL 4W81A 3BJLA 4HZLA 3D25A 4H5SB 5HPMB 3B9KC 3F5WA 1KBBA 1A1NB 3W29A 1GH7A 4Q6IC 2J8FA 3S3SA 5CZXC 1A22B 1HZHL 1M7DB 1P6FA 3QIWB 4JM2B 1N5YL 2XWTA 3BPCA 4YO0A 1EO8L 1FAIH 4P46D 1KELH 1XCTB 5J89A 1OTUC 5DRXA 1HOCB 3MRQB 4WHYH 43C9B 3PGCA 1J0JA 1AKJB 2WW8A 3JXAA 3FMGL 4N0FB 1DBJL 4HAGA 2DQTL 4P9HC 1J8KA 5D8JH 4OLVH 3B2VH 1YZZA 4IHOB 2ZSVB 3NZ8A 1GQKA 3QR3A 3VIMA 3ZOAA 3MTRA 4PBGA 1XZ0A 4PJ8D 1T1WA 3CFDB 3K8LA 1RQ5A 2EDYA 5TDOA 4TOYL 1NKRA 4P57B 2EPNA 3ULVE 1U93B 5GRUL 2ZWYA 2CITA 4UBDC 1A6TA 3IYLW 3MPCA 1ZA3B 1P4BL 3IDGA 4PTTA 4XCCL 4QLLA 5BRZB 3PV6A 4JVUA 4Z18A 1OAKL 3KYOA 4JQVC 4PJBE 1Z32X 4W86A 4ZEPA 3KNBA 3SO5A 5A3ID 1KJMA 1QNRA 3HI1B 4D3CL 1NC2B 3JWOC 5ANMB 1C5BL 4LEOB 4PV8B 3MBEB 2FH6A 1IGCH 3VXMB 1C5DB 4Y5VA 5FO7B 4TTUA 3ARDA 3VM7A 1W9XA 4LLYA 1ZLVH 1AGBA 3NABH 4FLOA 4ONFH 2HTLC 2OTUA 1LD9A 1MFDL 2Z31D 5B8CA 4NKIH 3IF1A 1ORSA 4V1DD 1M71A 3K7UA 2CKBB 3L2LA 1QNPA 2WIIB 1UB6A 4QOKB 1HNYA 4ZS7H 5KJRL 3N15A 2EO9A 4PIRF 1QVOA 3MJ8B 4F8TA 1QFUL 1X6LA 2F53A 3RTQC 2VVSA 5I19H 3OKOA 4MXWL 3DX8B 4N0UA 1UM4H 4RMSA 3EBVA 1A4KB 3GUTA 3MRBA 2GK0A 4HWNA 1CXLA 2V3GA 2ZP0T 2F54A 3ZKXC 2DQGL 3FONB 3MOQA 4CCCA 2W1NA 2QKIB 4JFXB 1G0XA 1NFDA 2WYSA 2RHEA 3WD1A 4WU7B 4U6XB 1MOEA 1GOGA 1NDGB 4JFDE 3PDDA 4B53A 4F66A 3FXYA 4NRZA 5FYJD 2W38A 3ARGB 2J12B 1FGVL 1VKXB 4GXUM 3ZHKA 5ACZA 3QIUA 3U2SA 4GXVL 3CZGA 1HVXA 4JAWA 1BFTA 3C8DA 4U1IB 2HTKD 3QEQD 1EBPA 3CVHL 1LP9F 3MRCB 4U3HA 3MRRA 4XCFH 4HCRA 1KCSL 2HFGL 2OJEB 4CCEA 1U3HA 4MNGE 4LVHB 43CAB 4A2MA 2QADD 2NR6D 1KULA 3FQWB 1L9NA 4MDOA 3ABZA 3EJYD 1CXHA 1G7IA 2XN9A 5ABHA 4PJEF 2EDWA 5J12C 1XCWA 3BCFA 5E6ID 2WSKA 4PJHF 1W1YA 4CADA 4HIHA 3QWOB 4NZRL 1EVTC 2H3NB 3D85D 5F7EH 1IGTB 4NGHL 3S4SA 1JZ4A 1UEYA 1DVFA 4NBYB 3JV4B 4Y5VC 5T3ZD 3VDBA 5DFAA 1GOIA 1JNHA 1WWWX 3IETA 3LPFA 3X13B 4FLQA 4U0QB 4UIKL 2IH1A 3G6AA 4JDZA 4NM4L 3I2CL 1H9VA 1NBZA 4Y5YA 3U0WL 3KHQA 5JMRA 2R9HD 4KH2A 2GTZA 2VCBA 4DGIL 2YSSB 3FB8B 4MXVF 5JIHA 1KN2H 4I13B 4P2QD 5TJWK 4KROC 4P5KA 3SE3A 4FXLA 5JOPE 4AZ5A 4NZCA 2QHRL 3VGBA 2P45B 5IGXL 1T7XA 3GMPB 3FB6A 3VXQB 3GSNB 4ZSOB 2H45A 2XKNA 4ZOEA 5DUML 3BMVA 2R39A 3V4UH 1JWUA 3ARFB 1LP9B 1NEZG 1BEYH 1PG7X 3CDGB 4Z2KA 5F88A 1UENA 3F12A 4GKNA 4MD0A 3AC0A 4NDMA 5IBTL 1A9BA 2BV9A 3DUSA 3CFKA 5DI8A 4U1KB 4U4BA 5L2JA 3CC5B 3PG2A 4GG6F 2FCBA 2GJ6D 1D7FA 2VAAB 3P0VH 3P73B 4H41A 1T0MB 4ZUWB 3QIUC 2YZ8A 2Q86B 1QR1A 5T1KB 4JFPA 1FFNA 4PJEB 4R26H 1AD9A 5EO1A 1E4XH 4DGYL 5ABFA 5DJ0A 2EC9U 4YAQA 1N6QL 1TVHA 4PJHB 3FQNA 4UAOC 2CDGA 5CUSL 3B8YA 1EV2E 3B9KB 1GXEA 3WJLA 4Q6IB 3QCUH 2CBVA 1L4IA 5DRNB 3CHDA 4QRSA 5IBLC 3TCXA 5IB5A 2ZUMA 2E6PA 3S37L 3EJZD 1KB5B 1F58L 1MAML 3G08B 3UYRH 2I9TB 1PYWA 3WN5B 1AQ0A 3SE8L 2D7NA 1D5XA 2VRJA 3UR7A 1TENA 1X5ZA 5DJ2B 1GC1C 2JE8A 1ADQL 3HCVB 3SKNB 3OB0H 5D1XD 1CXIA 4UT9L 5GQBA 4HFUH 4KVNH 4XVJL 1CK0H 1NGQH 4M7KH 1DDHB 1BGXL 2R8SH 2VXQL 2MWCA 5IFJA 1UG9A 3REVA 3MA9H 1JFQL 2O9RA 1HP5A 4Y5YC 1KWGA 3H7BA 5JPMB 2X1OA 1G0YR 3MSPA 2FJFA 2DT3A 2WMKA 4TX8A 4KTYA 3SE3C 3WKNA 4PRHE 5IUSA 1BM3L 2AJYL 3CHFA 3JUZA 5ICYB 2EQDA 4K23L 5EZOL 3W38A 4KDWA 1XF1A 3FN0L 1UM5H 4LF3A 4HWEL 3RY6A 1I4FA 4LNRB 2V2TA 4IRZH 3EDFA 4KTDL 5BVPH 5K9OA 2P24A 1H2JA 5I0DA 1G7JA 3X3GH 3BDYH 3KPLA 2UWEE 3OXRB 3THDA 3TYGL 2IEPA 3W11C 1NPUA 3LS5L 1G1CA 4DWSD 5EO0A 4ELMF 4JZNB 4F7PB 4EVNA 1EAPA 4KQ3L 5DFVD 3QNZA 4AY0A 5FYKL 1SVCP 4L4VA 5DC4B 3SURA 3C08H 1R5IA 3VX0A 4YFDB 3KPMA 3IJHB 3RTQB 4DKDC 4MJ2A 3LN5B 5L8KB 1I9RL 5D5MB 3BRGC 1HHIA 3L5IA 5E7FA 3LRHA 3S8WA 2WNWA 2VLMD 3U36B 2W65A 4YX2H 1QG3A 4HZLB 3S4SG 3ZKXB 2W9EH 3F5WB 2CMRL 3WELA 4LIQL 3WJLC 5CD3A 4X6DA 1W9PA 2ZNXA 3W2DH 3WCYA 5ALCL 1U8QB 2V3FA 2XWTB 3H2WA 1MHPL 3RIAF 1EOKA 5EBWB 3PGCB 4PYGA 4AZCB 1UM6H 5J56B 2D7TL 4OF7A 1ZL1A 5AY7A 4H25A 1A4JB 2NNAA 1R3HA 1XZ0B 1A9EB 4JRXE 4LAQH 1NFDF 1T1WB 3OR7A 1V5JA 5T5FL 5JA8B 1NEZB 4XPFH 3NCBB 5E0CA 4UOZA 2WBJD 4QGYA 1TA3A 2CKBL 4HK3J 2EDOA 2X4SA 1I1XA 3O3DB 4QRRE 5K33A 3BQUA 3NVQA 5SX4H 2G75A 2WZEA 4OZHA 4WK9A 5JR1H 5HI3D 2X4QB 2Q7YA 2WBGA 3X12B 4D8PB 1HILB 2IPUK 4DOHE 4JKPL 3IDGB 2AJUH 4ELMB 2FZ3B 3KYOB 3UZQA 3UTSA 3U4BL 4AYSA 5ILTL 1WCBB 5JIKA 1KJMB 3RY6C 5K59E 4YDKL 1GZQB 4LSRH 4JO1H 3F62A 2V38A 1AD0A 3QUMH 4YNYA 1L7IH 3BXWA 1SMOA 4PYHA 7TAAA 4LLYB 4QRPE 5I30H 3PHQA 1G01A 2OTUB 2YHGA 2WQ8A 3HPLB 1M71B 4YQXL 3MROA 3S6TA 1UB6B 3HC0A 4X8XA 3SQBA 4JREC 4MD5B 2PR4L 4KROB 4JIEA 3ALXA 4Z5RA 2E9MA 4FQJH 3TJHC 1T89A 3OKOB 3KYMA 4MMXC 2ADJA 1GOFA 3CXHK 1X44A 3RA7L 3BN9D 1AQDB 4ZDHA 2GK0B 4GXPA 4I4WA 3ZYZA 2DQJL 1FORH 5ETUB 2F54B 2IGFL 1YJDL 2APXA 4HUXA 3WEOA 5ADPL 5M94B 2OLDA 5B3JE 1OT2A 1X5FA 1NFDB 4X7SL 4AJ0A 3C6SB 3UBXI 4N90E 5ADOL 4OIAA 4BQ9A 5HHPA 4JKLA 5EOCJ 3Q6GH 4G42A 4P0DA 3SDXF 4EDWL 4XNXH 4ELKA 2XQBL 3G6JE 2C4FU 1MCIA 2PBGA 2AV7A 1MREH 2C3XA 4KRPC 5EOTA 5ACZB 3QIUB 1XR9A 4M3KB 4N0YL 1TFVA 1IGYA 1EHAA 4MD4A 1VFMA 1CFBA 3BE1L 5LQBH 3MRRB 5I1IL 1MFUA 5I8OL 4PMQA 1P7KA 4UAOB 2DMKA 5AD0A 3BEVA 4JPIA 5CILL 3WBDA 3VXRB 1N0XH 4OIIL 3OKNA 1ETZA 3I84A 3BQUC 1WT5A 5JA9A 1FDLH 1UWIA 1N6UA 2XN9B 1G7IB 2M8XA 4DW2L 3GSNL 5I2IA 3HZKB 4JL1A 4Z8FH 1VFUA 4IMKA 2M26A 4OLWL 2W92A 1HL8A 3SBWA 4MAYA 5E8DL 5FYLL 1RURH 2Q8AL 4UTAL 3DVNA 1ZANH 1ZE3C 2BP3A 3S4SB 2YPLE 3BAXA 3S5LA 1D5IH 3EOTH 2UUDH 5I17B 3IETB 3AIQA 4C7DA 2A9MH 2IH1B 3G6AB 4NM8H 4JDZB 3TBVA 3TLRA 4RGOH 5C0RL 1GONA 2Y07H 2XA8L 4S2SA 3LQAL 1YMME 4Y5YB 2O5ZH 3A6CH 3UC0H 2GTZB 3TT1H 3T65A 1L0XA 4UQ3A 2NW2A 3MANA 3OX8A 4P5KB 3T0WA 2RCSL 1QTYT 3OKLB 3RWHA 4R97C 3L4VA 3SDXB 3AY4C 1T89C 3K3QA 4FFVC 1LF1A 5DMYA 4JRWA 2XKNB 3OG4B 2I5YH 4ZO7A 4Z7NE 1I3GH 2VC9A 1R5WA 1JWUB 3RWGA 4DZBB 1KB5L 5GZOD 2UVEA 3F12B 3BCDA 4GKNB 1E3XA 3ZDYE 1P4LA 2CHOA 1A9BB 4L4TA 3DUSB 4XTRC 2CLVA 4P9HL 2EO1A 5DI8B 4LK4A 3WKML 5DVLA 5IKCA 4QXGH 4CJ1A 4ZOBA 5C6WH 1QR1B 4JFPB 1FFNB 1IE5A 2NY5H 1G0DA 3QXTA 3MRIA 1E0VA 4LSSL 4TULL 2CYGA 5ABFB 5DJ6A 4YAQB 1TVHB 1RZFL 5AG9A 1NSNH 3WDQA 4AZGA 3GBMH 4DFHA 4KJQC 1KCRL 4IISA 1IGJA 2B31A 1NCBL 5IB4B 2OWXA 3A67L 2X4NA 1AQMA 4QRSB 5CWSA 3NA9L 1I1FB 5IB5B 1WT5C 4N8CL 3O3UN 4PG2A 2VLRE 4QTIH 2LABA 1P7QA 2FIKB 1JYVA 1PKOA 1TITA 2EKSA 1TTFA 4O5LH 5L6YH 3OGRA 2HLAB 3PIQA 1D5XB 3N12A 3TA3B 4NQEE 4JHWH 5HYJE 4IMKC 4UT7L 2ED9A 3SBWC 4MAYC 4X6EB 3TTSA 1ZKAA 2WWMC 3HMWL 3S36L 4LYQA 1Y7VA 15C8L 2UZXB 3LKOA 4CW1B 4W8BA 5GGTL 1G84A 3QQ9C 3DECA 1E70M 2CUHA 3ZR6A 4YXHH 3JWNC 5C0ND 3LB6D 3OA5A 1VACB 3H7BB 1A3LH 3ISWA 2YJQA 4GKZB 4MVBD 2FJFB 4OZFA 5I1LA 3IJ8A 3GKWH 3LQMA 1EGJL 1TTUA 4BQ5A 2JALA 1OQOA 1G9MH 3R8QA 2ADFL 1W32A 4U1GC 1U58A 4JZJC 5DJXA 3FO2A 1HHGA 3LVEA 4HULB 1WZMA 1G7JB 1JNDA 3KPLB 3OF6D 4NO3B 2GITB 1LGVA 1R3JB 1MHHA 2H2PC 2XACC 4ENED 3Q5TA 3CVIL 1NWUA 2SEBA 5F71A 4I0PA 4UZGA 2YD1A 5IMKA 3BP4A 3RWFA 3UP1A 4BFEA 4EVNB 3NDZA 2Y9RT 4X5LA 1I1RA 4RDQG 3G5XB 1ZLWH 4XCNA 5F7MC 2NT0A 1I8MA 3RNKA 1OAUL 4H20H 1OLZA 1S7XA 2MPAH 4I3SH 1QUNA 1HHIB 4OM0H 1HJWA 4GRWH 2XZQL 3LKQA 4PJFE 2R29L 4NJ9H 3GNPA 2D22A 3S5LG 5CD3B 2CIKB 5J13C 1BOGA 4LP4A 1MPAH 1UB5A 1HSBA 1UEMA 3UYPA 5FL1A 4K2UH 4PRHA 1WZLA 3VFRA 1A6VH 5CJQL 4MXQD 2QV4A 5F7DB 4KRPB 4WWKC 3GFUA 2HLFC 4OD1H 1CL7H 3NIFE 4G8IA 1EVUA 3O6KL 1TNMA 3ULVF 1PFCA 2IPTH 1R3HB 3JTSA 4U05A 3ZLQC 3MREB 1AMYA 1BFNA 4TVDA 5I23A 2HKHL 5D6CA 2Z8WC 2F58H 3F7YA 4J8RB 5MENA 2AEQH 1TA3B 5BRQA 3V52L 1UWUA 2VC2H 4PJBF 1R85A 2B7DT 3GH4A 3RDTA 3WNMA 4POZD 2G75B 4GRWE 4ZUSA 1E6OL 4K8RH 4GI8A 3UJJH 5I1AA 1B0RA 2G41A 5HGAA 1Q9KA 3P11H 4G43A 2Q7YB 3RWIB 1L6ZA 3HA0A 3N04A 1GRWA 3DXAD 5JLZB 4U1LA 2CRZA 3SGJA 1FAKT 4ODWA 4A3HA 1OD0A 3SDYL 4K3DH 2HVJA 3IT8D 2J1KA 4OCWL 3TO4A 3ALGA 2HG5A 1FE8H 4FHBD 1AE6H 3SDDD 3T3ME 2OK0H 3PHQB 1US2A 1RJZA 2AJSL 2NXZC 3S9DB 5L2KD 3NTCL 4I0PC 3D5HA 4QTHA 4TSBH 3VUPA 5GGUA 2X41A 3ZKMC 3MROB 8A3HA 4E42A 1RIHH 4WFFD 5ISZE 2XVGA 4WUUE 2DF3A 5TE6L 3VO0A 2A77H 1FBIL 4EI6A 3TYFB 3PZOA 3QHMA 2Z93A 5CCKH 4HCRL 4TNVK 4R97B 3QI9C 4P8UA 4U0RB 1N59A 3KYMB 2ADJB 2QSCL 1GHRA 4FXKA 3ZTJG 3SDAA 2G8ZA 1ACYL 4ZDHB 4I4WB 4QRRA 2OL3B 3NIDE 4HUXB 4PMRA 3KHOA 4AD3A 1RAMA 5KS9E 4JZOA 1T03L 1VBRA 2MNUA 4M48L 1RIVL 5DGQA 1GC1L 3N1GC 2IG2H 2MJWA 5DD3L 3PTQA 4G42B 4MA8H 1AGEA 4PJBB 4XVSL 1U6AH 1NANI 3MLWL 5SWSD 5BV7H 3GGWA 1XGUB 4OZFG 3WXWH 2AV7B 5HJ3A 2Y36H 3T2NL 1XR9B 3REWA 1IGYB 4H0HB 4Q58C 1G7MA 4MD4B 4R27A 3H9HA 4LYPA 5CZKA 4LLMB 4DK6A 4MB4A 3SPVA 3RJXA 1ZTXL 3GNML 5AD0B 1MFCL 4JPIB 3OKNB 1ETZB 3RDTC 3UJIL 1WUNT 2AK4D 1OLLA 1HKLH 1C91A 3GI9L 3WFCH 2MKLC 5T3XL 4HWBA 3GZKA 3PGFH 2NY2C 5JORA 3ECQA 5I2IB 3NCYS 1F6LL 2WLYA 3SGJC 3BKMH 2OTPA 2ZX7A 3TZVB 1IC4L 4NZUH 4UINL 3VIGA 3QCVL 4MAYB 4OSUL 1XIWB 4CU8A 2V9RA 3BFOA 4D9RE 3TO4C 4GAFB 3S5LB 3ZKND 1ZMYA 1BFOA 4JFDB 1Z9SA 4XAWH 1FN4B 4JFEA 3N85L 4PP2A 5FM5M 5CMAA 1B30A 2QMKA 3TTQA 3PWVA 1NARA 1L7TL 1RK0B 1CE1H 3G6JA 4KRLB 4MAUL 3PGDB 3NBNA 2JK5A 3T65B 4UQ3B 3QUYD 1T2QH 2NW2B 3C9NA 1P5UA 2E9JA 5FAAA 3KLHD 3RWHB 3DRQA 4U1GB 4JZJB 4ZPTA 3MUGB 5CD5C 4HUWA 3QO0A 1UCBH 3ZT7A 1N7MH 1UZ1A 4H8WL 4UU9A 5SX5K 3QWQB 3RWGB 2WC7A 5GISL 3KPOA 1P4LB 1YEHL 1MRFL 2MQ3A 4KK9D 1ZVSA 1UWQA 3KJ6H 3AZRA 3B3IA 1BOYA 3QHOA 4HOZA 1N3NB 2AOSA 3MFFB 1HI6A 4NQUA 3HE6C 4TSAL 4AWEA 3ARWA 5BXRA 5T33L 2OSLA 3IDYC 1UQZA 3MRIB 4UB0L 2J88H 5GS0D 4U6TA 5CXPA 2V5YA 4Y1AA 5D8ZA 4OKDA 3LSOB 1AIFB 4XP4L 5GJTL 1H0DA 1YMMA 2Y5EA 3MLVH 1GJWA 5J13B 2FJGA 1IGJB 5C0BE 2VABA 5FOOA 1XGPA 1OL0A 5I8CA 2OYMA 2NY4C 4PRIA 1JGLL 1YEKH 4EI5D 1EHNA 1HNFA 3P9WB 5DR5L 4NC1C 1PX8A 1P7QB 3OLGA 4UOW0 4QHUA 4MJ6A 3DHUA 4LARL 3PIQB 1J1PH 2OMNA 4WWKB 1Z9LA 4HBCH 1PBYA 2CLRB 4Y19E 5KG9A 4PB9L 4JDTH 1LK2B 2RQ8A 1RIUH 2WLZA 3SCTA 3LS4L 4U7MA 3LKOB 3H9YA 3D5OF 3L1OH 1YPZA 5D7KD 3FQUB 2XRAH 2HMID 4BUHA 1R3IL 1DL7H 3MJ7A 5EO9A 5I1CL 1FVDB 2B1HH 3MLTB 3TV3L 4OZGA 3W9DA 1R24A 1QHOA 4OZFB 2IMMA 4XBGA 5DD1H 3RGHA 5DJZA 1RVFL 3QFJA 2VERN 1T21A 3ZZ1A 2BMKA 3CLFL 1QKZH 2P46B 2UWEF 4PMOA 3STZB 1EFXB 3DYMA 4AG4H 5DJXB 5EU6E 1XGTA 2VDNH 5T1LA 1D6VH 1HXMA 3FO2B 4R4FL 4TTGA 5LVEA 5KOMC 1QRNE 1DE4B 2DDQL 4RBPH 4ZQKB 2VOTA 4HS8H 4B7LA 3N13A 1KWKA 2NXZB 2WBWB 4X99A 1MFEL 2X2YA 4LGXA 3V2AR 2SEBB 4I0PB 3RWFB 3H3PL 1LE9B 3O6LL 3CH9A 3QDJA 5C70A 3OGVA 4OOUA 4JKWA 1X5GA 4NQEA 5D7LD 1B3ZA 4I5BA 1S7RB 5HYJA 1J1OH 5GGSB 3AXXA 1IFHL 3MLSL 4UV4L 4OD3L 3QI9B 1DFBH 3RNKB 2CXGA 2FX7H 4YGAB 1S7XB 3DX9A 1I3VA 1Q1JL 2L4OA 3LKQB 1EK3A 1MRDL 1ULVA 2IQ9H 3NN8B 4IOIA 4JRYE 2YA1A 1KB9K 4M6AA 2O93L 4M8QA 5CJOH 4CN4A 3GMMA 1BOGB 5FUOL 3D2UB 1UB5B 1FA2A 3DC0A 3AM8C 4BYHA 4D6FA 2GFBA 5HD8D 1WC7A 4PRHB 1N4XH 3BAYA 4F7MA 4HMCA 5TF1L 3VFRB 1PY9A 3P2TA 3HE7D 4S0TD 1S9YA 3U4EB 1LK3H 3U1SH 5KZCD 3ARBA 32C2A 3Q3GB 3GXIA 1QFWL 3RMEA 4HLJA 2VH5H 5A2LH 3JTSB 1YEIH 1A7OH 4YPJA 3T0ED 3PWPD 2G2RA 3F7YB 3ILPA 4EJ1C 1MCCA 1RSFA 3BVNA 4F33B 1V03A 4UV7H 3UEZA 4HWUA 4R4ND 4WKFA 1MJ7L 3RDTB 4HK0B 3VFPA 5K59F 2H26A 2R0LH 3F7VA 4ZUSB 1WP6A 5DRZA 5I1AB 3ZQ9A 1B0RB 1WV7T 3O4LD 3VGDA 4DN4L 1Q9KB 4G43B 3VWKA 3K81A 4XNYL