3RNDA

W116i-oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title Biocatalytic Reductions of Baylis-Hillman Adducts
rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rndA00
2V0TA 4WX2A 3MP4A 4DPQA 1MZHA 4IXXA 5K7JA 4AEOA 1KFJA 7TIMA 2CWNA 2ZZ2A 1Q3NA 4O54A 4HPXA 1QAPA 4UTMA 4DEFA 4Y96A 1A50A 3GR8A 3V1PA 2FPVA 2ISWA 5DY2A 3EWYA 1RR2A 2C1HA 1XBVA 4HKPA 5D30A 3F4NA 1KM0A 2A7RA 1GYNA 2G95A 4UTTC 1TCDA 3O1NA 3MMTA 4HSNA 1JUEA 1DQWA 2EF9A 3UXAA 4EVZA 3BW3A 4OU1A 3E12A 4TU1A 1MO0A 4U28A 2TPSA 4M7SA 3TV8A 3O06A 5I3GA 3E9AA 1VRDA 1VJIA 3M43A 3WK3A 2BX7A 2NV2A 4LWWA 1QCWA 4IQLA 3EWZA 3HGRA 3M9YA 4UTIA 4CNOA 3EXRA 1GEQA 1JCYA 1Q6RA 1Q45A 1W5NA 2CLHA 2QCFA 1ZCOA 4C1KA 2DZPA 2CFFA 5H2ZA 2J88A 5D05A 1FWTA 3LI1A 2FB2A 1FWRA 2BXVA 5LSMA 3GAKA 1ALDA 4M6PA 3RFAA 1I2RA 3VE9A 2R8WA 1R46A 4N6FA 3W70A 4JTUA 2QJIA 5K4ZA 1K7XA 5D37A 3KXQA 4TR9A 2CLMA 4DBEA 4AH7A 1LROA 2A6LA 1UCWA 4KKXA 4Y8FA 1W31A 3UWQA 1PVNA 3W7HA 3UWYA 1VCVA 4JTTA 4Z0SA 3W2KA 1F6PA 2CLKA 3QC3A 5LNSA 3PG8A 3CM4A 2J24A 2CZFA 2PRHA 3M0ZA 4FEZA 5F4WA 2GJNA 2F84A 1DL3A 2WKJA 5AHMA 4NUWA 3GIYA 1SW7A 3TA6A 3TDFA 1R2TA 4K39A 5IBXC 2PC4A 2C0AA 3A23A 1EPXA 5AHFA 5I3HA 3PBVA 1FCUA 3EEGA 4KWVA 3BO9A 3P81A 5C5YA 2V81A 1PL9A 4Z08A 2ISVA 3WK1A 4HNUA 1OFEA 3DHDA 2DJLA 2Q3OA 4MVAA 1H50A 4DF0A 3HB9A 2F7FA 3W2JA 4PH6A 3EX2A 5FI8A 3QW4B 4O12A 3EB2A 3LCLA 2FIQA 1OX6A 1T0OA 3QQ1A 5KSWA 3LBMA 5KITA 3S8HA 5L9FA 4Q32A 4N9DA 2H6RA 1F73A 1JJKA 2Z0IA 5CG7A 1AL7A 2Y85A 4LU0A 4X9SA 3TX9A 3NZRA 3W7OA 5KINA 1FDZA 3FOKA 4XTIA 3TKFA 2TYSA 3M7WA 1ZALA 3M1ZA 2H90A 4I7WA 4LC8A 1RVGA 5HR7A 2CZDA 4MYXA 3O63A 3DHFA 1JQVA 3IVUA 3DKLA 3IGUA 4MY9A 4A2RA 1GT8A 5DELA 3W1LA 1UUMA 2DU2A 4Y90A 1O94A 3F1QA 4RZ4A 1FUYA 1A5SA 3EX3A 2GJLA 4NQ1A 3S5OA 5T26A 2QAPA 5L6UA 1VPXA 4A3UA 3UQNA 1LOSA 3R8RA 3C2OA 4DBDA 1R30A 2QCGA 3BV4A 3W2UA 1I2QA 2HMCA 3OHIA 1KBIA 2NWSA 3B03A 3KOFA 3P82A 3S5YA 1M7OA 4XQ6A 4MFDA 2ATMA 3NL6A 2NX3A 3BLEA 5K9DA 2VFIA 2DZSA 1JUKA 4UTTA 3CTLA 2OX1A 5HWJA 3T44A 4GUJA 4JTHA 2NXGA 1LCOA 1X1OA 2D73A 4UMAA 3L9CA 3MHUA 4FX7A 3BGGA 5CZTA 1Z44A 4ZQPA 5BMWA 1I2NA 3W7LA 4FHAA 1GJPA 1SUXA 2WO5A 3PF3A 2C16A 1K02A 4JIPA 3IIPA 4RXGA 1FDYA 3LHTA 3T4CA 4D2JA 1ZY9A 3SGUA 5MHBA 4YL2A 4UMCA 4HNNA 1LRTA 1OK4A 4UTJA 3LM7A 1B4KA 3STEA 2GQ9A 3S9YA 4UTKA 4O4WA 2W79A 3W2LA 4IPIA 1DJNA 1PV8A 3G1SA 4WOZA 2H3DA 3CT7A 1W0MA 4OBTA 3NQAA 2IQTA 4O11A 3ABRA 3UPWA 4K37A 2DZTA 1ME8A 2E77A 1L9WA 4GUHA 5EA9A 5F1UA 1KFEA 4Z1CA 3M6YA 2RFGA 1XDMA 1SO6A 2AAMA 3ABOA 3EX1A 3MI2A 2VFDA 2LLEA 2WSYA 3L5LA 4RZ6A 5F4XA 3DFSA 1M6JA 2B7NA 2JGQA 3VE7A 4A22A 1XBZA 3MUXA 4LRSA 1LOLA 2ZRWA 3WK0A 1W5PA 3HG2A 3W84A 5LNWA 5LHFA 1KM4A 3BARA 1H7NA 3PB2A 3O6YX 3UYCA 3W1QA 2B7QA 5DY3A 3L0GA 1TYGA 1DORA 3IIXA 2FFCA 1RV8A 3CLMA 3UY7A 3CIWA 5HWNA 4LUIA 2CW6A 3DI0A 3M5YA 2Y61A 4JN6A 3B4UA 1A5AA 5J5DA 3SECA 3E49A 1GTHA 2WOQA 3L5AA 1SPQA 3UWZA 4YMZA 3W74A 1J4EA 5E1QA 3BG5A 4NZJA 1LORA 2BZNA 4NU7A 1L2UA 1W3IA 3TAKA 4EF9A 3G1DA 4MPQA 5AN7A 3TK7A 1H61A 5H91A 1NAL1 4NJGA 1H7PA 1IGSA 4H4IA 3W85A 4X2RA 3W9ZA 1EP3A 1JVNA 1SU5A 5C2XA 3TNOA 1SZFA 3P61A 2YYTA 1VYRA 1JR1A 1VS1A 4O13A 1IF2A 1TPC1 4UTUA 3PR2A 4IWWA 3N9RA 3O15A 3PSVA 4O53A 2GUUA 5G5IA 2ABBA 2WPBA 1P0NA 4ZQCA 1S5VA 4QJ1A 5IM51 5EBUA 3W1RA 1GYLA 4LRTA 3EX4A 1WAUA 1GVRA 3C61A 2E5CA 3S1WA 3NZ1A 1L6SA 5FEZA 4FXRA 5KZDA 5K9CA 1QMLA 5F2IA 2J9YA 3C52A 3W7IA 1YADA 5D04C 1P0KA 1KV8A 3UWUA 2R91A 4E2DA 2NX9A 3QQ0A 2ZRXA 2RH9A 1DBTA 4JNMA 4K7YA 2WNQA 5BOOA 2E5BA 2WQPA 2JGYA 8TIMA 1B4EA 2P10A 1SSDA 3W07A 1C8VA 2PE4A 2QDHA 3GKAA 5HWMA 2VEKA 2V30A 1J2WA 4AB4A 1RZMA 5KZEA 1W5QA 1QNVA 2ZZ5A 3C8FA 4JDYA 5CPNA 4OHQA 4Z1AA 5DBTA 1XBYA 4TO8A 3W7NA 1UJPA 2Y6ZA 3MI3A 2JKEA 1K03A 3CQ0A 4UFMA 4IMDA 3ZR4A 4ZMGA 3MYOA 1W1ZA 4K8HA 3M16A 3LCHA 3LCGA 2OT0A 1WQ5A 2KZHA 1TJPA 3NGJA 1WXJA 4JTSA 1H7RA 2GOUA 1KTBA 4S1FA 3NM1A 2C13A 1G7UA 1XDLA 4LUJA 1KFLA 1TQXA 5KTLA 1NSJA 1VZWA 1AW2A 4RXFA 4O1BA 4IGHA 1TPH1 1QPQA 4JICA 3TXZA 4DO5A 2NXHA 1XFBA 3DBPA 2GVJA 1TPFA 2ZYFA 3FLUA 3KHJA 3QRHA 5EL1A 1KFCA 1ONRA 1M5WA 1H1YA 3MWAA 4EOUA 1I45A 1GPWA 3HMJG 2X30A 3B05A 3TMQA 4JX4A 1AG1O 3QMTA 1NFBA 3FFSA 4ZQOA 1H62A 2O7SA 5EY5A 1KM5A 3DI1A 1SZNA 4UTHA 1EUNA 3RLUA 4AHPA 3C2FA 2WNZA 2WSQA 2B7OA 2PRLA 3NQ6A 1GVFA 1O4UA 3TMLA 3LV5A 4Z1BA 3LTSA 3D0CA 4IPJA 3C3NA 1VLWA 3N73A 3L66A 3HOJA 4Z1DA 3FJ6A 5CPOA 1OX4B 3WJSA 3ABSA 2VFEA 4CNNA 3KRUA 4NNCA 4NX5A 3THAA 1KTCA 3NQDA 3P74A 1TIMA 2CLLA 1P5BA 4LVGA 3IRDA 1S3HA 1KV5A 1BWKA 3C2EA 4O10A 2VFGA 3LRKA 5HUPA 3LHUA 4GC4A 3RNDA 5HJLA 3TU9A 3I7SA 1TV5A 3OBKA 4WJEA 3KFTA 1QFEA 5FF7A 1OYBA 3ZFHA 3W86A 3LTPA 1VH7A 1SW3A 3W22A 3O6CA 5AC8A 2ZA3A 2QJHA 1YTEA 1G4PA 4JYFA 1TPEA 3C2VA 3TR2A 5ABTA 1QOQA 2FQIA 1OFAA 2I14A 4O17A 5C55A 4FIQA 3W73A 1CX9A 4ZL1A 5D2XA 3WJZA 1IXQA 1DV7A 5K9XA 3DAQA 4IMFA 3STFA 4A21A 4M6QA 1LRQA 1JUBA 2GQ8A 3BVJA 3BG9A 2ZRYA 3FKRA 4UFIA 1TV8A 4DO6A 1W5OA 2QAFA 5FESA 5I3FA 1U83A 1MEHA 1RD5A 1B3OA 1DQXA 1IIGA 1ZAIA 2Q8LA 6ALDA 4CQ8A 4BK9A 3FKKA 3TJXA 3W1NA 4XWUA 1PCKA 3QMRA 2XFWA 2X1RA 4MY8A 4J9JA 1F5ZA 4FX8A 4G1KA 5A8GA 4LT9A 2YX0A 3LLFA 5FEPA 4MY1A 4UTLA 5I3JA 3P80A 4WOQA 3IIVA 3I7QA 4ZVJA 2FLIA 3MYPA 1TPDA 2G96A 2G97A 3N14A 5LGXA 3LCIA 2VOMA 5G4WA 4R7JA 2V2DA 1VLIA 1I4NA 1T99A 3MHGA 4BI7A 5AHEA 1Q6LA 1A53A 3IIZA 4S2CA 4GUFA 4JTGA 3GDKA 3SGZA 2YFOA 1SO3A 4M19A 4AWTA 4O16A 1RQHA 5HR6A 1FDJA 5A5WA 3G8EA 5LNUA 3G22A 4O0KA 3VCRA 3W7KA 4K6AA 2Z1BA 4MIMA 4N6EA 3QJAA 3LXBA 3PY2A 2E6FA 4ALDA 1H5YA 2Y63A 3GDMA 1IXNA 5GVJA 1TPVA 3TIMA 3GDTA 1KTNA 4XTDA 5HINA 1YTKA 4GFSA 1J5TA 2R94A 3S42A 3TQ0A 2W0UA 1FX6A 1FCQA 4AXKA 5D2YA 2NZLA 4CQAA 2CZ5A 3PBUA 3TC7A 1B57A 1S5TA 3ELFA 3PUOA 3C4UA 3W1MA 3Q37A 1JCXA 2FJKA 1A5BA 1EIXA 2Z6JA 2E68A 3BGJA 4IMGA 1G4EA 1AW5A 1FCBA 4UFJA 4IMEA 3P8IA 3EKLA 2EGZA 2QR6A 5DLCA 2J9XA 4X22A 3NNTA 5AOUA 3WJXA 3H55A 4MFEA 1OX4A 1G6CA 4FB7A 2VKZG 4LTSA 1FCVA 5LNVA 3EWWA 3TC6A 2HTMA 4MOZA 3HIJA 1FQ0A 4ONVA 3VNDA 1I2OA 1WV2A 4TMCA 2HS6A 3QW3A 4O8RA 3ABQA 1K8YA 3NQFA 1OFBA 1F74A 2VFFA 3INPA 3SSJA 1RQBA 2NV1A 2DJXA 2FB3A 3KAOA 1TTIA 3K30A 3NDOA 3KX6A 4HIBA 4AMAA 4QNEA 3WFAA 3EX6A 3W1PA 4CNPA 2Y62A 3RF9A 3QPZA 1ZAJA 3H54A 1QPNA 4K8EA 1WOAA 1I2PA 1PIIA 4NNAA 1K7FA 3L0KA 3V75A 3QH2A 1LM1A 2C15A 3NO5A 1GVSA 3G1VA 1F7BA 2QCNA 1NF7A 4IJBA 2YFNA 2O7QA 3NM3A 4O18A 1LZOA 5HNRA 1SFLA 5G1TA 1VCFA 1ML1A 1H7WA 1CW2A 4MUZA 3CWOX 1YXDA 3ATYA 2A6NA 2ZZ7A 2WNNA 1AW1A 4UNLA 2JKAA 2XN1A 1SZEA 4UNKA 5D38A 4K36A 4QITA 4POCA 2TSYA 3G0XA 2DZXA 4WUIA 4JY9A 1H1ZA 2YZRA 4JTEA 3UZ5A 3L65A 3PS7A 4O0ZA 4JD4A 4WXZA 1D9EA 1KBJA 1TTPA 5EYWA 2V2HA 1JCMP 2ZRUA 4GUIA 4RK8A 5LHEA 1UBSA 4QSHA 2V9DA 3PG9A 4H6KA 3QSTA 1OFQA 4O1CA 4OE7A 1GVQA 3N34A 1QPOA 4LVBA 3RU6A 2Y7GA 3LTYA 3W71A 3I65A 3KRZA 4QQ3A 5BMXA 5AYXA 3ZS4A 4ADSA 3W76A 1OFOA 1Z41A 5CZ0A 1EP2A 3Q2DA 4N9EA 3S5ZA 3P62A 3TAOA 2E6AA 3PBWA 1KW1A 4UTWA 1EWEA 3W7QA 1XM3A 2QCEA 5U4NA 3MP3A 4UR8A 4IX0A 4WY0B 4IMCA 1PHWA 4WZHA 1C29A 4BFAA 1XBXA 3R2GA 2V5LA 1EWDA 3TQKA 2DZWA 3G24A 2OMAA 3LCXA 3W23A 1YXYA 3PBYA 3SZ8A 3NPVA 3QYQA 1W3TA 4R53A 4X3ZA 3USBA 1KM3A 2ZBTA 1W56A 3GKFA 4QM1A 4TX9A 1XC4A 2V82A 3SJ3A 3LGEA 2C19A 1ICQA 3AJXA 2V8ZA 3HBLA 2BWGA 4YXGA 4M5PA 4YCOA 5AB3A 2Z2UA 3W7MA 4BF9A 2VENA 3STCA 4ADTA 4IXHA 3TUUA 4JYDA 3P67A 5F1VA 2H8ZA 3S0CA 5CKSA 3HPXA 2A1YA 2B4GA 1VGAA 2QCHA 4MKNA 1JRBA 1TV7A 3L2IA 4EIVA 4AAJA 4HSOA 3M5XA 3UPBA 5AHNA 1H51A 2DORA 2YYUA 4KFNA 5DN1A 3W87A 1KFBA 2OT1A 4BI6A 3WK2A 1OYAA 1Q6OA 3DZ1A 5F2MA 4WXYA 2RDTA 1ZAHA 3W7DA 5CZSA 4TMBA 2OCZA 1IIHA 4EF8A 4YLWA 5LNRA 4JXCA 3A5FA 1DVJA 3HJZA 1AK5A 4KWWA 4CCDA 4NT0A 4UMBA 4H3DA 1G4TA 3S1UA 1TO3A 2Q8ZA 4NNBA 3IIOA 4UXDA 2B7PA 1AL8A 1SFJA 2ISSA 2JKPA 3H53A 4LNYA 1D3GA 4MZYA 4CLMA 4HNVA 2ZZ3A 4B5NA 1VHNA 5K2ZA 5D03A 4NXSA 1V7YA 3NYZA 1KLYA 1TB3A 2CLIA 1G67A 3GAYA 4AWSA 3U8GA 3PUEA 2Y88A 2C18A 2JBMA 4P61A 5AHLA 1K7EA 3G1FA 4RCXA 3B8DA 1SZGA 4OV9A 4UIOA 5F4SA 2GQAA 1WA3A 1XL9A 1Z42A 2Y7EA 1W3NA 4AHQA 2VEIA 1ICPA 1OHLA 2E5DA 4HNTA 3OEXA 2YR1A 2WSRA 4HN4A 4JDBA 1O60A 4FNUA 3G3MA 3STGA 4EWND 2YPIA 1JULA 3LERA 3MBDA 3UXDA 1MEWA 4N9BA 3BLIA 1WYIA 2J27A 4XBKA 3NEVA 2ZQ0A 4Q4KA 3MBFA 1D3HA 3IV3A 1BWLA 5D2TA 1R47A 3HGSA 4XKYB 3T7VA 5E93A 4U4MA 2PCQA 3NL3A 2GVGA 2ZRZA 1KM2A 2QCCA 2J9ZA 1IXPA 4LY8A 5D2VA 5BRBA 5C6MA 3AO0A 1HG3A 3BLFA 4LS0A 3ZWTA 4LOCA 2R14A 3TJLA 2NX1A 4UFLA 4AWUA 1TSIA 3W7EA 3DENA 1LBMA 4JGDA 1G7VA 1F05A 2RDWA 3G1YA 1AMKA 3S5NA 4DF2A 1PCWA 5BNKA 3CU2A 5DCEA 2NUWA 1GTEA 3LB0A 4CCEA 4WY0A 3G3DA 2YW3A 3NQGA 3QSRA 2ZZ6A 3I7RA 4K7VA 3N2XA 3UWVA 3W7GA 4QNWA 2ATSA 2GVLA 2E6YA 2FTPA 3OA3A 3N19B 3RK8A 2C14A 2FPYA 3PSWA 5FEXA 3GLCA 5FF0A 1OK6A 2RKXA 3FYOA 2XN0A 2A4AA 1TTJA 1WX0A 4PA8A 1F76A 5DCDA 4KFPA 4PL2A 3M47A 1MSSA 3M44A 1X1ZA 1TPB1 4MZ8A 5LKYA 3W1AA 4P2VA 2A85A 2ZCGA 4JS3A 3GB6A 4GRSA 3N2MA 1EB3A 3L21A 4RR4A 4FO4A 2NUXA 4TIMA 3FS2A 3DFNA 1ZHAA 1TPUA 3LRMA 4FNPA 4LV9A 2EPHA 3S6DA 4RJEA 1IXOA 1XXXA 3A22A 4R33A 3HO8A 2PURA 3PULA 4ZZ9A 3E02A 2AQWA 1WBHA 3HG3A 4N4PA 3LI0A 4GNJA 4RV8A 1LYXA 2G5WA 4AVFA 3W2MA 5BW6A 1PS9A 2FDSA 2A7NA 4N2YA 3P8JA 1QO2A 3HGOA 2CU0A 2ZDRA 3LRLA 1YDVA 4OWGA 1HO1A 5HULA 1EEPA 3VKJA 5AYZA 2ZA2A 4LW7A 1DKWA 4IUOA 2Y7FA 3UWWA 4UFKA 1SO4A 3W7CA 3LV6A 3EWXA 3ZWSA 2W6RA 4Z0JA 4PTNA 1QO5A 3MJYA 5EKYA 2VEPA 5U7SA 1GWJA 2DP3A 2V5BA 3CEUA 4KFOA 1ZFJA 1GG0A 5D02A 3GVGA 1GQNA 3VFLA 4PFMA 3NQVA 4R34A 3G0UA 1BKSA 3NQ7A 1WDWA 3TCEA 3G8RA 4AHOA 1Q6QA 4O52A 4LVDA 1TJRA 1YTDA 2X1UA 3PVFA 1N7KA 2JK2A 3B04A 4XBSA 1EP1A 3W7JA 1R2SA 1T96A 4FNRA 1H60A 4MYAA 4ICNA 1B9BA 4YWIA 1OFRA 1Y0EA 3BPWA 1LBFA 1VYSX 3BW2A 5F2LA 3G18A 4LVFA 5DXYA 1OABA 4XKYA 3M5ZA 5DXXA 1WBJA 3A5VA 3CEPA 3QFEA 5AC7A 5AHIA 1FBAA 3F4WA 1C9DA 1S5WA 4O28A 4DF1A 5EMUA 3NL2A 3LBCA 2B0MA 4UTWC 1OYCA 1T8XA 4A29A 1OJXA 3S1XA 5FF3A 1P1XA 2H8XA 3O6DA 2Y7DA 2XN2A 3PM6A 3UNDA 3L68A 1GG1A 5DBUA 5TBOA 3DXIA 4OGZA 3OVQA 2YSWA 1JCNA 1N8FA 2WV8A 3LXCA 4K38A 1G69A 1OFDA 3IGXA 1UASA 3EWUA 3OG3A 3GNNA 1KM6A 1QOPA 1OVDA 3SR7A 1F6KA 1XUZA 3LHYA 4PODA 4WQ6A 2X1SA 3W1UA 1VC4A 3Q94A 5CPLA 3GK0A 1XI3A 3PWAA 1I8JA 3LHZA 3P5YA 3IVSA 3W7PA 3QM3A 3PC0A 4O15A 1FXPA 2NUYA 3B0UX 2CLEA 4JTIA 4ZQMA 2C3ZA 4IOTA 1TRDA 2X16A 3JS3A 3NVTA 3PB0A 2PRMA 3LCWA 3W1XA 3R13A 4O1AA 3U2OA 4LV4A 3GXPA 3O16A 3RLVA 4GE8A 4UC5A 4MJMA 4HPJA 5HUOA 3FEMA 3PUDA 2C6QA 4QAIA 5FEWA 3RMJA 1R2RA 3P5ZA 1K3UA 3SFKA 3W6YA 3E0IA 4FIRA 5HQEA 3WJWA 3EKZA 4WD0A 4MJZA 1YDOA 3W7RA 3MHFA 2CLOA 2A21A 3OVRA 4JTFA 2V2CA 3TW6A 1UB3A 1HUVA 1UUOA 1W5MA 1W54A 3L0NA 3R12A 1SW0A 4N4QA 2NXIA 3B0VC 3NL5A 1XKYA 1JCLA 3GXNA 3BW4A 3JR2A 3B0PA 1SSGA 3NA8A 3MP5A 4O4VA 1O95A 2ZFAA 3UZJA 1LP6A 2X1TA 4S2BA 2HSAA 5G2IA 3NQEA 4O50A 4PEKA 4CCCA 4DQWA 3NOEA 3W1TA 4NJKA 3DFOA 4RKAA 2ZTJA 4N02A 3EWBX 3DU0A 3LDVA 4O14A 3R89A 2OJPA 3SY5A 3KRSA 2E1DA 5TIMA 3UY8A 1JCJA 1ADOA 3GNDA 4DXVA 2TMDA 4JTJA 5G2HA 2H3BA 1PHQA 1Z48A 5I3IA 2GPTA 4NJJA 2ABAA 3C2RA 3GX9A 4Q33A 4MLRA 1A5CA 4OQVA 2A5HA 1DJQA 2QCDB 2FPTA 3A24A 4C1LA 4LC6A 5AYYA 3W75A 3MI6A 2UV8G 4ORIA 3NPUA 4Y9AA 2VELA 3SI9A 1XCFA 1EA0A 4L4LA 1VHCA 2QUVA 1BEUA 4WY0F 3HPZA 4M7TA 3F03K 3JRKA 1P4CA 5G4EA 4FXSA 2ALDA 3GYEA 2WJZA 3OIXA 1G4SA 5FF4A 2CLFA 5I3KA 5F2GA 3TFCA 3HG4A 4BWLC 3KVMA 4FF7A 4E2BA 1LRNA 3DFQA 3BG3A 1TTQA 3NAVA 3M41A 1OF8A 3HGJA 4RZ5A 3T40A 4CQ9A 4GWEA 3GXTA 3CWNA 4AF0B 1OG0A 5J5RA 3G0SA 4LVAA 5CPMA 1FWSA 1QR7A 1V5XA 2RHGA 1BTMA 1O5KA 3TH6A 3KVLA 3LOTA 3TSBA 3NQCA 1VR6A 1X6UA 1DOSA 1W8SA 2DZVA 4N9CA 1ME9A 1OFPA 1LBLA 3I6RA 2VEMA 4MZ1A 2EHHA 3GDRA 3NQ8A 4O19A 3E96A 3VI2A 1NF0A 3HQ1A 3IEBA 3LX9A 3S1VA 1JQXA 1HTIA 4ZQRA 1H63A 4Y6GA 4FNSA 3G1HA 4I7UA 4DO4A 3THQA 5E0KA 1QWGA 4UCGA 4A2SA 5LZLA 4JTLA 1K8XA 3HF3A 3GR7A 5D2WA 3QF0A 1ZNNA 2A0NA 2QCMA 5IBXA 1CI1A 1PE1A 4JY8A 2QCLA 3W72A 3C0JA 3MO7A 1RPXA 4HHPA 1KFKA 2I1OA 3U6WA 2YGYA 3N3MA 3NPXA 1X8FA 3LXAA 5TQLA 3QMSA 2Y89A 2ZZ4A 3W2NA 2ZA1A 2I9EA 2YXGA 3CC1A 3TROA 1SO5A 1F2JA 1QDSA 3QPYA 3OVPA 4GUGA 3TW7A 3DFPA 3HPSA 3NXFA 5K4XA 3FIGA 1KLZA 3NR0A 3Q58A 3QZEA 5FF2A 2VC6A 3EXSA 4ZQNA 1SR9A 3T78A 2VFHA 1HL2A 1YYAA 5LGZA 4YCPA 4PC8A 3KVJA 4JR5A 5K3VA 3IGSA 1M7PA 1VQTA 1YLVA 3L67A 3NPWA 1NVMA 2P1FA 4HT3A 4E0CA 4FNQA 4NJHA 3L5MA 2HS8A 2DZUA 4ORMA 3CPRA 4I9AA 4L4MA 4NXKA 3A9IA 2ZTKA 3CIXA 1OX5A 3P7YA 1YPFA 5G1YA 3QEZA 5KZMA 1RQEA 1QPRA 6TIMA 2Q3RA 1LLWA 5CZJA 3WJYA 3IVTA 4NJIA 4O57A 1FXQA 1ZENA 1VYPX 2E09A 3YPIA 3TFXA 4QIUA 4JX5A 3GDLA 3NQ2A 1LTDA 4M6VA 5AC6A 4BI5A 3SW6A 5HMSA 4GJ1A 2QCDA 2Z6IA 2YCEA 2P0OA 2ZRVA 5D09A 2NLIA 2YW4A 3TXVA 4NVTA 3CB8A 1THFD 2EAWA 3TSMA 4RLIA 2NWRA 5EPDA 3M5VA 1W37A 1TQJA 4MLJA 1XUUA 1DHPA 4QISA 5D32A 4JYEA 5AFDA 3O07A 1ICSA 3TSDA 4JTKA 2X2GA 3DH7A 3ANYA 3DKJA 4IX2A 4DPPA 1YPIA 4FNTA 4FX6M 4PL1A 1KM1A 3TQVA 4OV4A 1LDCA 5C54A 1GOXA 3LLDA 2Y70A 4JEQA 4OT7A 1TPWA 3G1XA 4AF0A 5SWUA 1E51A 1FY6A 3MW7A 4E38A 5KMYA 3G1AA 4BWLA 3KVKA 4UUIA 2QF7A 1MEIA 1YDNA 1LOQA 3T55A 4JX6A 1L6WA 1TREA 4NZFA 3N9SA 3HG5A 2A7PA 1FWWA 2QUTA 4PCFA 4UFHA 3GZ3A 4LS2A 1FWNA 3PAJA 2QKFA 3FJLA 5D33A 3P60A 2RDUA 4RX0A 3O05A 3TE9A 1YXCA 1H7XA 3O8AA 4DELA 1L6YA 3A21A 1EUAA 2OZ0A 2ZZ1A 2VXNA 3UD6A 3LHWA 1WOBA 3LHVA 4W9TA 1O5XA 1OF6A 3W83A 4O1DA 1VCGA 3FYPA 3P84A 3NG3A 5CSRA 4NX0A 1MXSA 1H7OA 1GVOA 3CHVA 3EXTA 3LCFA 4BR1A 3BK0A 1JRCA 4GXMA 2TRSA 2E6DA 3C56A 2BTMA 3ATZA 4GBUA 4UR7A 1KA9F 5G2WA 3FA5A 5DCBA 4JIQA 3B06A 5CGQA 2QDGA 2QUUA 3SIZA 4LS1A 1TRIA 2BSLA 4XUGA 3C6CA 3DGRA 3NQMA 1EX5A 3DFTA 3W3OA 1ME7A 2EKCA 3W88A 1HFBA 1X7FA 1HO4A 2AGKA 3I68A 2J6XA 5CSSA 1TMHA 1K8ZA 1LLZA 2QEZA 3R5EA 2A2IA 1U5JA 1SQ7A 1NEYA 4ML9A 1N55A 4XZ9A 2CZEA 4I7VA 2BLEA 2YDAA 1GZGA 2QJGA 1ZJIA 4ADUA
chains in the Genus database with same CATH superfamily
4WDWA 4WEVX 2E67A 3QQWA 1W3JA 3U5YA 4IXXA 7TIMA 2CWNA 1CXFA 1Q3NA 4DYJA 1WZKA 1QAPA 3CMJA 4DEFA 5DY2A 3GS6A 3MCNA 4TX6A 1BTCA 3F4NA 5D30A 3SGGA 3G6MA 1GYNA 2CERA 2G95A 3CQIA 3DYPA 4HSNA 1XHGA 4EVZA 2BY1A 4Z2KA 4KMQA 2BNJA 4FOUA 4YS1A 1UWTA 3BAIA 5I3GA 1KCZA 2VCCA 2HBVA 4H2HA 1M65A 2NV2A 4LWWA 1QCWA 2PPGA 3S83A 3R43A 3EXRA 1GEQA 1Q6RA 1Q45A 4P8WA 2CLHA 4C1KA 2DZPA 3CAQA 3L4WA 2I5GA 2X41A 2J88A 1YNPA 5D05A 1FWTA 1R86A 5LSMA 2BXVA 5DF0A 4RUBA 3GAKA 1J0ZA 2E9BA 3RFAA 1CIUA 2PGFA 2VD9A 1R46A 3GD6A 5FL1A 1S2VA 4JTUA 3W70A 5E0CA 2QJIA 3CV2A 3UF9A 3LS9A 2BDQA 1LROA 1W31A 3CM4A 2F84A 2PDWA 1SW7A 3SCRA 3WD2A 5IBXC 2PC4A 4Q22A 1FCUA 3EEGA 4A6GA 4RE2A 3JW7A 3WNMA 1V3IA 4J40A 5IXEA 1B30A 3EDJA 2OLSA 1XC6A 5CLWA 3HB9A 2AL2A 1YKWA 3GBEA 4PH6A 1YMYA 3EX2A 3W26A 3LCLA 1XIBA 2CWXA 1T0OA 4PMNA 3QQ1A 3H2FA 2YBTA 3PAOA 3F7JA 3S8HA 4ZOEA 4MWAC 2G3FA 3ABZA 1AL7A 4EAMA 2Y85A 3NZRA 5KINA 2XGIA 3CYVA 1JL8A 2TYSA 1ZALA 3GE7A 3M1ZA 2H90A 1HKKA 2ACSA 4LC8A 1FFQA 1VFOA 4QDPA 3IVUA 5DELA 1UUMA 4L1GA 4GZ7A 3L4ZA 3VKDA 3S5OA 1EDGA 5T26A 5I02A 2QAPA 5L6UA 4YTSA 4A3UA 2C0HA 4DBDA 3H2CA 3BV4A 4DJFA 2ZE0A 1C8YA 2HRWA 2F61A 3CZ8A 3WQDA 2XWEA 4W5UA 3OGSA 3FSUA 1K6WA 1G9HA 2NWSA 3KOFA 3P82A 3VABA 3MT1A 3GTFA 3GNXA 3BAXA 2ATMA 2CEQA 2NX3A 1UKPA 3GZAA 1JUKA 1KCXA 1BRLB 4P5UA 1E9ZB 3T44A 1KKOA 2NXGA 1LCOA 1X1OA 1HL9A 4Z2GA 2VP8A 1PPIA 3BGGA 2J13A 2OLHA 3OTRA 5FKYA 1TWIA 3PF3A 1NWRA 2C16A 1K02A 3EOEA 5E6ZA 4DJDC 3IIPA 1FDYA 3CQKA 4D2JA 1ZY9A 3MV11 4UMCA 1HN1A 1OK4A 4UTJA 1B4KA 3WQGA 3NZQA 3S9YA 4UTKA 1A80A 1UA3A 4LNCA 2W79A 2BASA 4YN5A 4IPIA 1PV8A 4DIAA 2IXUA 3N2CA 5I00A 4OBTA 4DWSB 3CHDA 4J5NA 4F0MA 1JYNA 4YVPA 1J5SA 1ME8A 1L9WA 1P1MA 4Z2IA 2D0HA 3RO8A 2RFGA 2AAMA 2YCLB 2W62A 3ZJ6A 3SRKA 4ACYA 2LLEA 2WSYA 3L5LA 4XUYA 2JGQA 5LA1A 2GDUA 3MUXA 5BXRA 2A79A 2QQ6A 5LNWA 1NOUA 3VUPA 4KH2A 1VEOA 5DY3A 2ZXAA 5ABGA 1DORA 2FFCA 2VNCA 2AGTA 2CW6A 3DI0A 2AQVA 3BLLA 4IIFA 4JN6A 3B4UA 1A5AA 3WDPP 3E6EA 3CUXA 3SECA 2WOQA 1NJJA 4O8AA 4MTVA 2BZNA 1L2UA 1W3IA 2ODOA 4KRZA 5CPQA 3SUTA 4MPQA 3A64A 3TK7A 4RDVA 3SFWA 3WEZA 4NJGA 5ABFB 3W9ZA 1SU5A 3TNOA 2OPJA 2EPLX 2YYTA 1ZZMA 1VS1A 1KGWA 1HJVA 3PWGA 3M4HA 4J3ZA 2GUUA 5G5IA 5CAKA 1VRXA 3OVGA 4IL2A 5EBUA 1GYLA 4LRTA 3WQFA 1ZJAA 2E5CA 4Q3MA 2WMGA 3CUJA 4IJCA 4QJ5B 1RBOB 2OO6A 2EO7A 1JXJA 2BHUA 1QU4A 5FEZA 5HNUA 4DUOA 4Q8VA 3VGFA 2NQZA 3UWEA 4AX6A 2G4FA 3W7IA 1P0KA 3UWUA 1QHOA 1KBBA 1J11A 2HDJA 2WNQA 3GSMA 1BGGA 3LNPA 3W07A 3QLDA 3XISA 3AC0A 2G4JA 3GG7A 4KESA 4W8BA 7TAAA 1OSEA 4GVGA 3W24A 5HWMA 1J2WA 1RZMA 4J28A 3VYLA 3CZKA 2IPJA 3CH9A 5DBTA 1AH0A 5H8MA 3CQ0A 4UFMA 3MYOA 2OYLA 1E4IA 3EOLA 3M16A 5FJIA 3FGCB 3TZNA 3NGJA 4ZFCA 4JPGA 1KTBA 4HSHA 4LUJA 4U10A 3DYMA 1KFLA 4G1NA 3VMNA 1NSJA 1VZWA 3P0XA 1AW2A 1GONA 1N82A 1WAWA 1TPFA 1JCTA 1KFCA 1JYWA 4AUBA 3RPTA 4B5TA 3TMQA 4JX4A 3ARZA 3C5QA 4S23A 3FFSA 2YJQA 3OP2A 2QZRA 5CPTA 3FHAA 1EUNA 1A5UA 2RJGA 4DM2A 1O4UA 4NI3A 3TYAA 3F5KA 3LV5A 3TMLA 2UY5A 3D0CA 3VOHA 3LZ5A 5JH2A 1OIMA 3N11A 4D6DA 1VLWA 3N73A 4Z1DA 3TYDA 1NARA 2Z25A 3E74A 2XIJA 2PTXA 1UBPC 4XZNX 1SFTA 4IIDA 3RMEA 4F79A 3D3FA 2VUYA 3THAA 1TVNA 1XRVA 1XLGA 3P74A 3IRDA 1C8QA 1BWKA 2PODA 2VFGA 3BJFA 3LRKA 5HUPA 3LHUA 2PTYA 5M17A 3KFTA 4OVXA 1DJYA 1OYBA 4NY2A 3ZFHA 3LTPA 1VH7A 4TX8A 3O6CA 5AC8A 2ZA3A 3QHOA 4F0KA 2QJHA 2NSXA 4PUUA 1YTEA 1GZJA 1QOQA 4OOZA 2VL4A 1OFAA 1QPKA 2I14A 4O17A 5C55A 3W00A 4FIQA 4XG1A 3TP4A 3A6OA 3WJZA 1IXQA 1DV7A 4Q8UA 5K9XA 4C6IA 3MO4A 2O9OA 4IMFA 4A21A 4FLQA 2I17A 1JUBA 3WLQA 2ZRYA 3FKRA 3THCA 4K1GA 1TV8A 4OZOA 8CGTA 1UPMB 3VXGA 1GPFA 1U83A 1DQXA 2Q8LA 3V0SA 1LT7A 3V7PA 4B91A 4BK9A 3TJXA 3W1NA 1V77A 1LQ2A 4RNHA 4B5XA 1G1YA 2X1RA 4MY8A 4I9MA 3GFZA 2BXYA 4PTVA 1UIOA 3BANA 3VOGA 2E28A 3MQTA 4WOQA 1JI2A 5E0FA 1IWBA 1FKXA 2FLIA 2WWDA 3MYPA 1TPDA 1E0UA 3G5EA 4LANA 3GHSA 3WLKX 1QASA 4Z2HA 2VOMA 4GO8A 4A4AA 2V2DA 3MHGA 3IIZA 4ZTXA 4JTGA 3POHA 4PMOA 1FDJA 5A5WA 3G8EA 5LNUA 4O0KA 1XKJA 3VCRA 1DIDA 4HA3A 1E1FA 4V28A 3WLPA 5REQA 2E6FA 4Z42C 1Q85A 5D9NA 3VGDA 3GDTA 1KTNA 3RJYA 2EBNA 1W91A 1UOZA 1FCQA 5CAHA 5IOBA 4HGXA 3B8VA 1A0CA 3RILA 3TC7A 4D6IA 1B57A 3C4UA 4GXWA 3Q37A 1DIKA 2FJKA 3SCVA 1EIXA 3BGJA 2J7HA 1JZ3A 1F3EA 1C91A 4IMGA 1G4EA 4GGBA 4GNVA 2D3LA 4UFJA 1A3XA 2XIIA 3P8IA 3R58A 4GLEA 2VR2A 5DLCA 4REQB 2J9XA 4NAFA 3H55A 4MFEA 1G6CA 2VKZG 1XSIA 3ES8A 4M80A 2OVLA 1FCVA 3OYZA 5A2CA 4GIAA 3HIJA 4ONVA 3HM7A 3I10A 3PNZA 3PHAA 4QE4A 4HJFA 2DJXA 3MZNA 3KAOA 3THUA 1VJSA 1EC8A 3KX6A 1E3ZA 3WFAA 3ME3A 4WDXA 3AMKA 1I2PA 4XB3A 1K7FA 3L0KA 4HA0A 3QH2A 3VZXA 1WCGA 2F6UA 4G9PA 3NM3A 1PKYA 4K2SA 2O7QA 1AQFA 3UJFA 1H1NA 1SFLA 1E5JA 1UH2A 1VCFA 3CWOX 3WUGA 2A6NA 3WF1A 2J7EA 2JKAA 1UD2A 5D38A 2BP1A 2VZVA 4JY9A 1H1ZA 4JKMA 3L65A 5CLTA 2DT1A 1EIBA 1QHZA 2F2HA 1TELA 4RK8A 1PZ2A 2VTFA 1UBSA 4QSHA 5T9BG 3VC6A 1P0EA 3QSTA 1UMLA 3PTKA 1GVQA 3ZT5A 3I65A 3KRZA 1PWMA 5AYXA 4CN4A 1EH9A 1CGUA 2ZADA 6PTDA 3ARSA 2J66A 1EGVA 3Q2DA 4N9EA 3P62A 3BOXA 3TAOA 3LUTA 3PBWA 3VOCA 1KW1A 1NDWA 3KOYA 4FMVA 2QV5A 4MAZA 4GI8A 2JE8A 2WW5A 4UR8A 1EZ2A 5LA0A 1WXYA 4WZHA 1V0NA 5EMLA 4CQDA 1ELSA 3W01A 4E3VA 2C79A 2DZWA 3G24A 3OZYA 3PBYA 3U48A 2IS7A 4R53A 3QXBA 2YXXA 4DJED 2HVMA 3C8NA 3GKFA 3UG4A 2PB1A 1PX4A 3SJ3A 2C19A 1E3XA 4L56A 3AJXA 3VKKA 1W6TA 1R8LA 4JYDA 3P67A 4L9YA 4UWMA 1ITCA 3SY1A 2H8ZA 1ODZA 2A1YA 1VGAA 5HBFA 2PLMA 1XH2A 4EIVA 3A12A 3GTHA 4LH8A 5CG0A 1H51A 2DORA 2XSXA 3QR3A 2OT1A 4RDWA 4BI6A 1BLIA 4IP4A 3PZGA 3ARRA 1L8PA 1Q6OA 3O9NA 3AXIA 4PUEA 2EKGA 1JZ7A 1DJWA 2QPUA 4W7UA 3HZ3A 4EF8A 1E0TA 4JXCA 3HA1A 4W87A 2OODA 3VNLA 1IT7A 3R25A 3IIOA 4UXDA 5T9CE 4CGTA 1AL8A 3MCOA 1SFJA 2VWTA 2ZVIA 4ZO6A 1D3GA 2ZZ3A 2VZUA 1DQUA 1ZL1A 4HZMA 3NYZA 1KLYA 1XGDA 1R7AA 3MVIA 4PN2A 1YDYA 2CLIA 3U8GA 2BOEX 3SY8A 1HJUA 2E1WA 3PUEA 4J2PA 2Y88A 2C18A 2JBMA 1XPGA 3NVDA 2PWEA 4P61A 4AVNA 3G1FA 2POTA 3B8DA 4P7NA 1J6OA 2ASHA 1Z42A 1OEPA 4PMXA 2MNRA 1ICPA 1W2PA 3CO4A 3RITA 4HNTA 1G0CA 1OCBA 2QVNA 3CASA 4NILA 3WBAA 3ARQA 3LMZA 2Y24A 1O60A 2YPIA 4YVVA 1MEWA 1QI5A 5AYBA 3UBPC 2ZQ0A 4GX9A 4CU8A 4Q4KA 3NO3A 2VWSA 3URQA 2TAAA 1NOFA 3K4WA 2QCCA 2NVCA 1GQIA 4C7GA 1HG3A 3GG8A 4R3UA 5HNTA 2C91A 1OM0A 2NX1A 3VIFA 4L64A 4AWUA 3EA1A 3WD4A 1BXNA 3DENA 4QEEA 1LBMA 4DBUA 1F05A 2X09A 2WKGA 2ZWZA 1PCWA 5BNKA 5DCEA 5IHSA 1GTEA 1D7FA 3VCNA 4RNIA 3H8AA 3GXMA 1MW1A 2XGZA 4K7VA 5H1WA 3UWVA 1EJXC 5EMKA 3T8LA 1NDVA 2J79A 3W7GA 4QRNA 2E0PA 3N19B 1PDZA 3RK8A 5FEXA 4B4FA 3AS0A 1OK6A 1J6PA 2RKXA 4B9ZA 2A4AA 2YCIX 1UD5A 3N4AA 1E6QM 3M47A 1MSSA 4H6QA 3T81A 1TPB1 1GUVA 3ITCA 4P2VA 1EDQA 2X05A 3WFZA 2PUZA 1WUFA 3N2MA 3L21A 3AICA 4FO4A 4RW3A 4L4OA 2XH4A 4LV9A 5FSEC 3S6DA 3ARWA 2Y0FA 4H9YA 3WG6A 1T41A 3PULA 1ZJBA 2VX7A 3E02A 3HG3A 1MUMA 3GBDA 5LIUX 1LYXA 2G5WA 4AVFA 3ABXA 3W2MA 1PS9A 4IPPA 1MW0A 4D1IA 3TWAA 4KT2A 1Q5MA 3URNA 1LL7A 1PBGA 4XISA 2CITA 2CHOA 2ZDRA 1PEZA 1EEPA 5IFTA 4IUOA 3V1HA 2Y7FA 1K9FA 4N42A 2X7VA 1LQ0A 4Z2JA 1CT5A 1SO4A 4UFKA 2RGLA 3W7CA 4C90A 2WVTA 4AZGA 1HL8A 2FGLA 5D9PA 3A4XA 4J3TA 1Y5XA 1QO5A 3MJYA 4GO9A 5EKYA 1Q4WA 1LLOA 1RUSA 2DP3A 1QW9A 4S3AA 3VFLA 3UERA 1JAKA 1EJTC 1EJWC 1ITXA 3NQVA 4GOAA 1S2TA 2WC7A 3NQ7A 3TCEA 2PDIA 3BTNA 4YJ5A 2WVVA 4LVDA 5ENLA 1N7KA 3SM0A 2QJJA 2JK2A 3B04A 2OYKA 1EP1A 3RX2A 4FNRA 1H60A 2O55A 4HYWA 2GGJA 4KCWA 4YWIA 1Y0EA 1O12A 1VYSX 3G18A 3GU9A 2VGBA 1IEWA 2REQB 5AVNA 4XKYA 4KCTA 3M5ZA 5DXXA 3IJ7A 1NWTA 4CD8A 5AHIA 2NQ9A 3FXYA 1C9DA 5DRCA 3LBCA 4FAMA 1Q6DA 3IK2A 3QV6A 4KEVA 1EYEA 3P2VA 2GWGA 5FF3A 2ACQA 2VO5A 2CC0A 4NSBA 5CXPA 2V63A 1JEZA 4S3JA 4OGZA 3WZ0E 2QW5A 1JCNA 1N8FA 2GUYA 3LXCA 1I0BA 4E6MA 4QGCA 1XLMA 2I7GA 3IGXA 1UASA 1GJUA 1KM6A 1QOPA 4X9YA 1OVDA 1UWIA 1XUZA 2X1SA 5AVHA 1R6WA 4GIYA 1E40A 2ZUWA 4B15A 5FOOA 1KBLA 4B92A 4MSSA 3PZ9A 1UZHA 1XD1A 1A4LA 2DQXA 1MW2A 1F3WA 3ALFA 3RRAA 1FXPA 3ZVIA 3MZ2A 4P7OA 4M8UA 2XSBA 1TRDA 1VF8A 3JS3A 4ZSTA 1JD7A 2PRMA 3LCWA 4WSJA 2UY4A 3R13A 4LJ3A 4O1AA 2CETA 3T4WA 2IMRA 3M0VA 1Q63A 5JIWA 3BSHA 3RLVA 3ZJ8A 4GE8A 4A3RA 1TZZA 2B81A 3QGKC 1WKDA 1UR0A 5HUOA 2Q6ZA 2NQJA 4ZO8A 5IDZA 4DVOA 1R2RA 4QX4A 4XD3A 4HMCA 3W6YA 4D8LA 1QNSA 3BUVA 2GZXA 1O66A 3MHFA 2OOFA 3BAWA 2VZSA 1C92A 2FMOA 4NIRA 3TN4A 1HUVA 4W8LA 2DSUA 5E9XA 1W1YA 4BQ5A 3R12A 3IWPA 1BYCA 1XKYA 3CXOA 4TUFA 2GFTA 2J75A 1ISVA 1SSGA 3KUMA 3NA8A 5T8GA 4MWAB 4MM1A 4Z2LA 2CXEA 3TTQA 4DB7A 3ZOAA 2HSAA 4PMVA 3ARUA 4FXJA 4R27A 3R7MA 3WQEA 3WLTA 1FTXA 1XSJA 1UHVA 2E4TA 4PBGA 4NJKA 3BSMA 5MKGA 2ZTJA 4N02A 1LG1A 3DU0A 1VJZA 4L6OA 4O14A 2OJPA 4G7FA 3UY8A 5TIMA 1PKLA 4JQ2A 1BYAA 3IJDA 3P3BA 1V02E 3QC0A 4DXVA 1GEHA 2FTYA 4UQ9A 4AD0A 1HKWA 2GPTA 4EXQA 1UD3A 4C5YA 4MLRA 3UZWA 4YIWA 4C1LA 5HMEA 3W75A 3MI6A 1JAEA 3KLLA 2ZVRA 4GI4A 4AZ7A 4NZ5A 2VELA 3VOFA 2BODX 1KBKA 3AYVA 4X2PA 4AZCA 3W81A 1VHCA 1W1TA 1JZ6A 3CHFA 1WDSA 4WY0F 1AH3A 2QGYA 1JPDX 4LAKA 3JRKA 1P4CA 7PTDA 5KETA 4LUYA 1JF6A 1Q8JA 3CV1A 5FF4A 3TFCA 3VZYA 4A8RA 2QLYA 4AZ5A 3M41A 3TYEA 4AF0B 1OG0A 1QR7A 3WBYA 1OC6A 2RHGA 1O5KA 3TH6A 2CHNA 1CEOA 1X6UA 2Q71A 3TR9A 4H1ZA 4A8NA 1Q4NX 1CLVA 3CUZA 3EA2A 1W8SA 3ZR6A 1LBLA 3DCPA 1MRAA 1Y5WA 3BLPX 3GDRA 4O19A 5DMNA 3LX9A 3S1VA 2X0YA 1HTIA 4ZQRA 4Y6GA 1DWIM 5LZLA 4JTLA 5FJRA 4PUJA 3HF3A 3WQ4A 4JCMA 4Q7BA 2CNCA 1ZNNA 3QPEA 2QV4A 2XDFA 1CI1A 2OU4A 3W72A 1RPXA 1EFZA 2YA2A 1E6RA 2YGYA 2HXUA 3NPXA 4HD5A 1X8FA 4ENLA 3UT0A 1AFSA 2YXGA 3CC1A 3VAVA 3LNMA 1QDSA 5C9XA 4KCVA 3DG3A 3FIGA 1KLZA 4ICMA 4C7DA 3QZEA 3RPDA 3U2ZA 4ZQNA 1SR9A 4ES4A 5BOFA 4DAFA 1YYAA 5LGZA 2PSNA 4JFUA 3AHXA 4KIRA 1FWFC 3IGSA 4H7CA 2X0HA 1YLVA 3FYYA 2P1FA 3MKVA 5PTDA 3ZLGA 3ZMRA 1P0BA 4I9AA 1J0IA 3RRXA 1D8CA 2ZTKA 3P7YA 5FJJA 1QPRA 2Q8XA 3EMZA 3NUKA 6TIMA 1B3WA 5CZJA 3VUSA 4HPHA 1S46A 3CT2A 2PLJA 3AJ7A 2R1PA 3OJGA 2P76A 4CQCA 3YPIA 1EXPA 4QIUA 3MMUA 4CUCA 5AC6A 4BI5A 1Q7ZA 5HMSA 1E71M 4GJ1A 5BROA 4F48A 1SJAA 1UH3A 3TXVA 2C71A 1THFD 2EAWA 4RLIA 4PSPA 2NWRA 1T6MA 5EPDA 3TTEA 4H9XA 3Q65A 4MLJA 1HJSA 6REQA 1TMQA 5D32A 1ICSA 4KW2A 3I6EA 4JTKA 2G3NA 1ZRQA 3KCJA 3DKJA 4PCSA 4FX6M 4PL1A 3H6OA 1VP5A 1KKRA 2A3CA 2J7DA 3KWXA 1GOXA 4JAWA 2QULA 2V69A 1C9WA 5C9WA 3WD3A 5SWUA 1FY6A 4E38A 5KMYA 4M56A 2DSKA 2DV0A 4K8GA 1E9LA 5J04A 1MEIA 1LOQA 1S2AA 2PLKA 4JX6A 1FFRA 3B9OA 3W82A 3N9SA 2ZX7A 3NZPA 1E0XA 2A7PA 4MHBA 1REQB 3VKAA 5I78A 2C7FA 4UR9A 3ANVA 1TE6A 3FJLA 1MDLA 3HQPA 5D33A 3VD9A 4RX0A 4HVXA 3L23A 1Q2RA 1A5OC 3UP8A 4XZWA 3LHVA 4XIMA 1O5XA 1OF6A 2PI6A 4O1DA 1VCGA 3NG3A 4LUTA 3WUBA 4KRUA 1UUQA 3LCFA 2G8ZA 2OQYA 4P7LA 3FXGA 3BK0A 1PZ3A 1IQ8A 4GXMA 3BGAA 2E6DA 4PYSA 2PWFA 1KA9F 4QG8A 1RLDA 3B06A 1TMLA 2QUUA 1SYTA 1GKQA 2ZE3A 3LYEA 3DGRA 1M68A 1IT8A 1EX5A 3GW3A 1ME7A 1HFBA 4RPQA 4JHZA 1KWGA 3I68A 5CSSA 1NY1A 1TMHA 5A8MA 5A94A 1IYXA 1J96A 2QEZA 2GK1A 3R5EA 1XLBA 2A2IA 1XGZA 1N55A 2CZEA 4I7VA 2YDAA 1GZGA 3N6QA 3ECQA 3WDHA 3GW0A 4WX2A 1B1YA 4W7VA 1UA7A 2PMQA 4I8YA 3MP4A 1MZHA 4AEOA 1KFJA 2QMJA 3ZO9A 2PWHA 5I5RA 1KFWA 4HPXA 3ENLA 3GR8A 3WLJA 3V1PA 1EPVA 4NF7A 1R3YA 1XBVA 4QS5A 4HKPA 2A7RA 5CC5A 1NQKA 4MB1A 2I5IA 1DQWA 2EF9A 3UXAA 4ROQA 5BXPA 3PTMA 1BVNP 1EJSC 2GGIA 3TV8A 1OT2A 1VJIA 3O6AA 5I3DA 1ISWA 5I7GA 4UTIA 1H0GA 4OBSA 2XPKA 4E2VA 5A2AA 2D2HA 1XIGA 2FB2A 1D8WA 1FWRA 4XZBA 1ALDA 4HHMA 4QCFA 1I2RA 1V3LA 3VE9A 3T0CA 3R8HA 4C1NB 4N6FA 2V6AA 3W6MA 5D37A 1WZAA 1KCLA 3OZMA 1JG9A 1DP0A 1UCWA 4Y8FA 3W28A 3DECA 4Z0SA 2CLKA 3QC3A 2Z1SA 3PG8A 2J24A 3M0ZA 3K8LA 1JNDA 2QYGA 4PCNA 5F4WA 1J10A 3ZVHB 1OGGA 1US2A 1GNXA 3M0IA 1B3ZA 3A23A 3CQHA 5I3HA 1BKHA 4KWVA 4M1BA 3P81A 4EE9A 4QG6A 2ISVA 3WK1A 4DBSA 3VFCA 1IWAA 3DHDA 2DJLA 4HOXA 1EA9C 4DF0A 3GO2A 1U1HA 4HQVA 5AYIA 2OWCA 3ZXWA 1W9XA 3TN5A 1H4PA 1V6YA 3KBJA 4Q4RA 3N29A 2DQWA 2NSOA 1WDPA 3JU2A 1A5NC 5L9FA 2NVDA 2QMKA 2H6RA 5H8UA 1F73A 2Z0IA 4UQEA 4I6VA 1EZWA 3PANA 5HQMA 1Q66A 2OQHA 3WQWA 3POCA 1XWYA 4I9JA 1TR9A 2ZC8A 4JFVA 2VC7A 3EB4A 3OQ8A 3DKLA 2O0TA 1BYDA 3AIEA 4MY9A 3LY0A 4JIIX 7ENLA 3WNLA 3CZJA 3W1LA 4FR1A 1OCQA 4RZ4A 1A5SA 4JIRA 2GJLA 4NQ1A 1M03A 3B97A 1LOSA 1R30A 2QCGA 4KBXA 1E73M 3DIPA 1KBIA 1K9EA 1MW3A 4AIUA 1M7OA 3RR4A 4LX4A 3CV6A 5K9DA 2VDIA 2VFIA 2DZSA 4XSLA 1EF2A 2V5CA 3WLOA 4GBDA 3OA5A 5HA7A 3GXDA 4JTHA 2D73A 2NLYA 6A3HA 2X42A 3L9CA 4ZQPA 4IJRA 1I2NA 1QW8A 1JPKA 4FHAA 2WO5A 3HV9A 4GQ0A 3D6NA 1H3GA 2WMHA 3RM9A 1RVKA 2PGEA 5MHBA 4FALA 2Z4GA 2PDQA 4PMRA 1DTNA 1WZMA 3STEA 1CGXA 5B7YA 3GHUA 3IUDA 1A3WA 1TWSA 4WOZA 1UKTA 3CT7A 4I5XA 2IQTA 4O11A 3UPWA 3AXKA 2XG9A 2E77A 4NZCA 1EJRC 2JIEA 5HJYA 4Z1CA 3M6YA 4G5DA 2BOGX 1BSIA 1QWKA 1GQJA 3ABOA 4Q7NA 3MI2A 3WDQA 1F61A 1RH9A 3VE7A 4A22A 1XBZA 3U2CA 4HA1A 3MV01 2ZRWA 4F9JA 3WK0A 2ZX6A 5LHFA 1EEXA 3BARA 1H7NA 1MUCA 3PB2A 1TV4A 3UYCA 4RE4A 3W1QA 3L0GA 1TYGA 3IIXA 1P7TA 5JBFA 1W32A 3UY7A 3OBAA 3CIWA 3IK4A 5HWNA 4LEQA 2C1GA 1R3SA 3CIVA 1HT6A 1GTHA 3NCOA 3L5AA 3W74A 3QV7A 2IXVA 2PDFA 4LBUA 4ERIA 2PWVA 3S2CA 3RG6A 5AN7A 4S38A 2OWWA 1IEIA 1XG4A 3UGVA 4C6CA 5C0QA 5H91A 4MNMA 4AZBA 1GHSA 3QTGA 3W85A 4X2RA 2PDNA 2AKZA 1JVNA 5C2XA 3MUY1 1SZFA 3P61A 1RJQA 1JR1A 1ZTVA 4O13A 1IF2A 3N9RA 3LD5A 3B0XA 3VX1A 4O53A 2ABBA 2BGSA 1K4GA 3S5SA 2ZUUA 4DZHA 3TYBA 3W1RA 5JXQA 4HNCA 3XINA 4M1RA 3UJSA 1WAUA 1GVRA 3C61A 2BXZA 1L6SA 1Y7VA 1NTHA 1OY0A 5K9CA 3KCLA 1ZBCA 5F2IA 2GJXA 5A8NA 2J9YA 3LPPA 2BOFX 2YBUA 3L2LA 3GVWA 2R91A 3W4RA 2NX9A 2ZRXA 4UZUA 1QI2A 3M07A 5DO8A 5BOOA 2WQPA 3APYA 2JGYA 5JU6A 8TIMA 2ZOXA 1B4EA 1SSDA 1E4MM 2PE4A 2QDHA 4MGGA 1IEQA 2DDXA 3PJXA 4ZO7A 1ZJHA 1W1VA 1W5QA 4A3HA 3G77A 4D6CA 1QNVA 2QDEA 4L80A 4E8GA 3CNYA 1DE5A 2VUNA 2Y6ZA 1OZMA 3SCTA 2G0WA 3ZR4A 4ZMGA 3V3WA 1LWIA 3CAKA 1W1ZA 3F2DA 3LCGA 4FK9A 4JTQA 4PUKA 1VEMA 1H7RA 1JYVA 3NM1A 1UR8A 5KTLA 3M0JA 2QXWA 2BVYA 2NXHA 3NGFA 3DBPA 1GOMA 2GVJA 3KBNA 1V6WA 4YTTA 3QRHA 4DUWA 2YA1A 1YQ2A 3MWAA 2D1ZA 3S2MA 3HMJG 3KBWA 3MJMA 1EGZA 1RHCA 2DZAA 4TVDA 1TX0A 3H2NA 3V0TA 2W9MA 4ZQOA 1H62A 4L1XA 1XIDA 1KM5A 5EY5A 3BSGA 3QGAC 3W6LA 4KCUA 4AHPA 2P0IA 2WNZA 3NQ6A 1UJQA 1AZ1A 4Z1BA 4QEHA 3LTSA 3C3NA 3QY6A 1PAMA 2WBGA 3CUIA 4KERA 4ZR8A 3E3HA 1OX4B 1Q65A 2J6VA 1CXKA 3KRUA 4H9ZA 4MADA 4H9UA 4NX5A 2IKGA 3AZSA 3I6TA 1S3HA 1KV5A 1HVXA 4O10A 4AD1A 1EJUC 3T08A 4DWSD 1PIFA 3OBKA 3GH5A 5FF7A 4Z17A 3W86A 3RJXA 3ZT6A 2WVSA 1SM9A 4GA8A 1G4PA 1Z9AA 4LFYA 4PTWA 1TPEA 1E70M 4DJFC 2FQIA 1P0DA 3NFUA 2X8RA 3DAQA 4HOWA 1JFHA 4M6QA 1E9IA 1LRQA 3WQCA 3BVJA 1S2CA 3BG9A 7ODCA 3EDFA 3AS3A 4DO6A 1W5OA 3FJ4A 3STPA 3RM8A 5I3FA 1WXZA 5C9ZA 1ZAIA 1ZGDA 1RD6A 2BHYA 3RO6A 1PCKA 3KM8A 1VFLA 3GNRA 5E70A 1BAGA 2HV5A 1F5ZA 5CEWA 2WJFA 3T42A 5FEPA 4MY1A 3WF2A 1H2JA 3SSZA 3WMSA 4ZVJA 1XIEA 1EL3A 4DY1A 3VIKA 1HW6A 3WUEA 3PZIA 1OGSA 5CSUA 1XQKA 5LGXA 3LCIA 3EKGA 3GHRA 2WSKA 4R7JA 2FZ8A 5DEZA 1I4NA 1W9VA 1YE6A 3VINA 1BSLA 1GHRA 1NFGA 1VPYA 1TG7A 4GUFA 3GDKA 3RYSA 1GYMA 1SO3A 3E2VA 4KF1A 4M19A 5HR6A 1JI1A 2DIEA 3WLIA 3MANA 4XZIA 2W5FA 3QKZA 3SCPA 3LXBA 3LPFA 3VDAA 1KB3A 4AQLA 4LUSB 5GVJA 1TPVA 3N9KA 4UOZA 3ZM8A 1UROA 4GFSA 2R94A 3S42A 3TQ0A 4EK7A 6CGTA 4AD3A 3CWHA 2VHLA 3GY1A 4CQAA 3PBUA 1JCXA 1KXHA 4FR6A 2Z6JA 3D3AA 3E5PA 1KQYA 3LPGA 1B9ZA 3MUCA 3ZLFA 4MMWA 3WELA 3CPUA 2EGZA 2HCVA 3PZUA 3URAA 2OB3A 4X22A 3NNTA 3WJXA 4FB7A 3FNDA 5LNVA 3EWWA 1OWQA 4C6LA 1GORA 2HTMA 4MOZA 4M51A 3QW3A 4O8RA 4HJWA 4BQ2A 1K8YA 3NQFA 4AZIA 2VFFA 3RHGA 2NV1A 1XQLA 2FB3A 1TTIA 2W63A 1CENA 3K30A 4HIBA 5A2BA 4GY1A 4QNEA 3BAJA 1IHIA 5E6YA 3VDGA 4XVEA 4K1WA 2OFJA 4CNPA 3RF9A 3QPZA 1QPNA 3H21A 2C15A 1VBJA 4MDPA 3RGTA 4C6PA 3S9IA 1ZCCA 1WO2A 1GVSA 1F7BA 2QCNA 1NF7A 1BGAA 2Q09A 3IJ8A 5M3WA 4DJEA 3UR7A 1JDDA 3CYJA 1YXDA 2P8BA 4MJ4A 2ZZ7A 1AW1A 1A5KC 3JZUA 2IUZA 3NJ3A 2G50A 4K36A 2Q01A 3FN9A 4JTEA 9XIAA 4JD4A 5DMMA 1WKYA 4WXZA 1D9EA 5A8PA 3B9NA 1TTPA 3JVAA 2ZRUA 3IUIA 4Q4PA 3SCNA 1ZBVA 3KTSA 2WMIA 3PG9A 4P8XA 2HNHA 3N34A 4I8DA 1TUFA 3W76A 1HJXA 4HK7A 1RBAA 1R85A 5CZ0A 2HXTA 1UH4A 4YTQA 1GQKA 2D69A 3DYOA 3N2TA 3QR1A 1QI0A 4AD2A 3GM8A 1YEYA 3CO8A 4OECA 1K4HA 5U4NA 1EC9A 4IX0A 5BU9A 4NAEA 4L9XA 1FRBA 3R2GA 1EWDA 3PN8A 2D2OA 4JQ4A 3LCXA 3W23A 1YXYA 3M6DA 3SZ8A 4AW7A 3U2EA 1W3TA 4ZO9A 3GR4A 3TNBA 2ZX9A 2ZBTA 2PWUA 3L12A 2GDQA 4TX9A 4S3CA 3WX7A 3HBLA 1U22A 4C6MA 5AB3A 3W7MA 1S5MA 1Y8BA 1QUMA 3NIYA 4ADTA 4CD5A 3GVVA 2PF8A 4HN8A 1ZUAX 4IIHA 2F9RA 5F1VA 3HPXA 5EGRA 2QCHA 4MKNA 1TV7A 3WNPA 5CC3A 1Q7QA 5D9MA 4HSOA 1PKNA 5AHNA 3P93A 2AMXA 1MNSA 4F4RA 2W61A 4KFNA 3W87A 1KFBA 1AJZA 2YKKA 3IUHA 3WK2A 3L7RA 3HQOA 4FI4A 3AHZA 4PULA 3SN4A 3GTNA 2VDGA 5F2MA 1R3TA 4WXYA 2WLZA 1XISA 4A3QA 4IG2A 1T5AA 2A3EA 1ZAHA 3W7DA 3B3DA 2OCZA 3AU6A 1IIHA 1OADA 2OZTA 4MB4A 1PX8A 1I9CB 4CCDA 4UMBA 1X8CA 4H3DA 1G4TA 2AKMA 5LXXA 2D0FA 3QLLA 1B3YA 3L4TA 5A6KA 2FJUB 2MANA 3H4GA 1IR1A 4HHLA 4B3LA 3AMDA 5I24A 4JIEA 5K2ZA 3VD4A 1J2BA 5D03A 3UR5A 2IKHA 1ENUA 2P50A 1W17A 1CGYA 1MDRA 1SZRA 3S47A 1G01A 4XZMX 1K7EA 2BFGA 4RCXA 3UA3A 1DWAM 5F4SA 2Y7EA 4AHQA 2VEIA 4F66A 2PTZA 2VOTA 1XX1A 2YR1A 1S1PA 3STGA 3G3MA 4EWND 3LU2A 3WQVA 3WQ5A 4DYKA 2XVPA 1TV3A 4R9OA 4XBKA 4UQCA 1EBHA 3NEVA 2VGIA 2XZ9A 4GVIA 4GIEA 2J7FA 3D47A 1R47A 3HGSA 4HTYA 3DERA 2PCQA 3NL3A 3A3HA 2ZRZA 3BAKA 2VM8A 2QNEA 3ZWTA 2A3HA 4X0NA 2R14A 3R8GA 2GSJA 3SQSA 3KEHA 4JGDA 1G7VA 4E2OA 2RDWA 3G1YA 1AMKA 3KBSA 4NI8A 4JN7A 4WY0A 1M3UA 4Q8QA 2AAAA 4QNWA 2ATSA 1QNPA 2E6YA 2FTPA 4ERGA 4QR6A 3VDHA 3GLCA 5FF0A 5DMLA 3FYOA 2XN0A 3AROA 3ITGA 1TTJA 3WQ8A 2ISFA 4PL2A 3M44A 2D22A 1WZLA 4E5TA 1TUXA 4TXEA 1FWHC 3W1AA 1FWGC 3MKKA 1ONWA 4MNJA 1RCXB 3GB6A 4KEUA 1EB3A 5CC7A 3GC2A 4OOUA 4WF7A 4O1EA 1LUCB 2WBKA 3A22A 4R33A 2PURA 4AD5A 3LQLA 2VGFA 4GNJA 1CBGA 2IPGA 1VBHA 4FZIA 4CEUC 4AFYA 4N2YA 3P8JA 1R38A 1QO2A 2CU0A 1QTWA 4C6KA 2XYLA 1O6IA 3LRLA 2PDKA 4OWGA 2Y5SA 4FPSA 4MUPA 5CSYA 3VKJA 4C6JA 2ZA2A 4LW7A 4BKNA 2WM1A 4GI9A 3H2AA 4D6FA 4IQDA 2ACUA 2POZA 3EWXA 2UY2A 4BQ4A 1CB7B 2W6RA 1JZ2A 2R82A 4FLOA 7REQA 4PTNA 3AHYA 2IPWA 1GWJA 4AWEA 5D8ZA 3CBWA 2W92A 4PR4A 4F0RA 2YDQA 4DUVA 3CL8A 3GVGA 4HCHA 4U2YA 1JZ8A 3N4FA 4MF4A 1WDWA 1UD4A 3IANA 2XHYA 2DEPA 1W1IE 4O52A 3PVFA 3VIIA 3VCCA 1HJQA 2BVWA 4ZB5A 2XWDA 2GGHA 3MB9A 1R2SA 1RSCA 1HVQA 3IV8A 3M7SA 3BPWA 1LBFA 4IFKA 4C6BA 4HK6A 4LVFA 1BVZA 1ZP4A 4PMJA 4LB3A 2ESCA 3CEPA 3QFEA 4G6CA 3RXZA 3H22A 4W5ZA 4ACZB 4OIFA 3QYSA 3PZTA 1OYCA 5I2UA 3QHNA 3EGJA 4HHHA 1OJXA 1P1XA 2OEMA 1OIFA 4PRWA 4BF7A 2QGHA 2AMGA 3L68A 2NQLA 1JPIA 5DBUA 4GPNA 2EG8A 1ZBKA 2V5DA 3KS6A 1E15A 4QCEA 3FAXA 3EWUA 2V3DA 3OG3A 3GNNA 1F6YA 1M1BA 2FHBA 3TLQA 1KRMA 3AXXA 5IFPA 1TWWA 1VB9A 4WQ6A 3CS2A 5FJPA 2PAJA 2DW6A 1RBLA 3MDWA 1I6NA 4PCPA 1I1XA 1XYLA 4O15A 3WH5A 2NUYA 3ZQ9A 4WSHA 4IOTA 3PZVA 4NZ1A 2X16A 3NVTA 2Z28A 5EMJA 2AOSA 1DWFM 3ITOA 2PBGA 5LYRA 1KRBC 3SEPA 3WEOA 3O16A 2ONEA 5FD0A 4Y2WA 1CXIA 1J0YA 2A3LA 4M82A 3VM7A 3SFKA 3WSUA 3S3GA 3E0IA 3EB3A 3WJWA 3A9BA 3LMYA 1P6WA 3B8IA 2A3BA 1YDOA 1FWAC 4U5KA 1RP9A 1WP6A 4IP5A 2PLCA 4B4HA 3NYDA 3OVRA 1X7IA 3TW6A 1Q2SA 4JL2A 2BVTA 3L0NA 4N4QA 5HATA 4IHCA 3B0VC 3NL5A 3GUGA 3KWSA 1P43A 3BW4A 1CB2A 2VMFA 3B0PA 2W4XA 4GQBA 6ENLA 2PDYA 4O4VA 4Q7IA 3V0UA 4ZTYA 1RCOB 1UWAA 2PU1A 4WKFA 5AECA 4PEKA 4CCCA 3NOEA 5B7ZA 3DFOA 4DRSA 3EWBX 3LDVA 3TZFA 3KCOA 3F2CA 3R89A 4DBWA 2GSEA 3AIUA 1AD4A 3ZSSA 1IT0A 2INFA 4HOZA 2CBVA 2EPNA 5BCAA 3QOKA 5CBIA 4JTJA 5G2HA 3KP1A 2H3BA 4DX3A 1PHQA 4D72A 1FWBC 4FF5A 5A6BD 4NJJA 2FH6A 3DEQA 2ABAA 1PB0A 3C2RA 3GX9A 1XLDA 4Q33A 1A5CA 4Z1YA 3BQ5A 5AC5A 3B0YA 4Q4QA 1J93A 2QCDB 4IM4A 2ZICA 5GJNA 5AYYA 4ORIA 3NPUA 3WH6A 4PUNA 3T07A 1VFUA 4L4LA 3WNNA 4H41A 1FH8A 1XSKA 4AU0A 1JD9A 4GCXA 2PDPA 5BWAA 2J77A 3N6JA 4WLCA 3LM3A 3VOJA 4FXSA 2ALDA 3GYEA 4PMQA 1Z6KA 1G5AA 1VFMA 4CNSA 2H9AB 3T05A 3NAVA 8A3HA 1YBQA 3T40A 3OHMB 3GXTA 3CWNA 3U7BA 5J5RA 2FYMA 1EOKA 4LVAA 3NSXA 3KVLA 1C7TA 4N7QA 3SCUA 3LOTA 5M03A 1GKRA 4MNKA 2F38A 3NOYA 1B54A 5IHRA 2YL9A 4G7EB 4N9CA 2YLLA 1OFPA 1L8NA 3RX4A 3I6RA 2VEMA 4JNYA 1JPMA 4MZ1A 2EHHA 1UKSA 5A6MA 5AY7A 3SCQA 2PF0A 2YIHA 5CGMA 1H63A 3G1HA 3PBGA 4PGLA 3THQA 1QWGA 4UCGA 2UBPC 2ADAA 2Z2BA 3A4WA 3REQB 5DANA 3KTCA 3M0MA 5D2WA 1N8WA 3QF0A 1A5LC 3SBFA 2QCMA 1C7SA 3R6IA 4PTDA 1Z69A 1PE1A 1AJ0A 1AZ2A 4JY8A 1CGWA 2C8NA 2A3AA 3C0JA 3BLDA 1NM9A 3F2BA 5C70A 5TQLA 2BVDA 2ZZ4A 3AU2A 2CKRA 1U5VA 3TROA 3GNOA 2WANA 3AXMA 1UC4A 3QPYA 3TW7A 3HPSA 3NXFA 3MC5A 5K4XA 3U5UA 5JBDA 3NR0A 4M0XA 5FF2A 1MUWA 3ZYZA 2VFHA 4B90A 1HL2A 4LYRA 3PJTA 3KVJA 3LK6A 4JR5A 1I75A 1WNOA 3VU2A 1VQTA 4E0CA 1QVBA 1JNEA 2DZUA 3BV7A 3CPRA 2JALA 3BCJA 1P6CA 4JTAA 1FHUA 4PRTA 3RAOA 1KRAC 3SDOA 2Q3RA 4HBKA 4O57A 1E1CA 3W25A 5M5DA 4UQAA 1ZS2A 3MDUA 2X7WA 2E09A 3T2QA 3H2MA 1R3QA 3AMGA 3BMXA 4JX5A 2QPXA 1LTDA 3RUBL 2XM1A 4RDYA 4XAYA 5EFDA 1F8IA 2P0OA 4PUWA 3T8QA 2YCKX 2Z26A 1G94A 4AMCA 3KW3A 4TVCA 4QJ4B 3AUJA 4F9DA 1LWJA 4L6HA 4IICA 1FWEC 4JYEA 5AFDA 3TSDA 3FVDA 1W3LA 3QZAA 2X2GA 1DYSA 3MVTA 3ANYA 1NP0A 1YPIA 2DIJA 1LDCA 5C54A 5CBJA 3AIVA 4Q8OA 3A3WA 3WNKA 1E51A 3MW7A 4MWAD 4UUIA 3UNTA 5DQPA 3T55A 4GKTA 4PCFA 4UFHA 1FWNA 3PAJA 2QIWA 2QKFA 2PDLA 1ZPTA 4JKLA 4DELA 4PMDA 3BMWA 3A21A 1VENA 4UQBA 1B90A 3F4VA 2G41A 3UD6A 3H2EA 3BLOA 3LHWA 1OCJA 4LBSA 3ARPA 2EQDA 1O1ZA 3P84A 4NX0A 3DC8A 4JHOA 1P48A 1GVOA 3EXTA 3ZT7A 1SJDA 4Q4OA 3KOZA 4BR1A 1LJYA 3UJEA 1H09A 2OKTA 3MMDA 3ATZA 2AL2B 4B5WA 3VM5A 4BZYA 3FA5A 1TIWA 3S2LA 1KCKA 4LS1A 1TRIA 1XLEA 3C6CA 3NQMA 3W3OA 4DNHA 4KWSA 3TYCA 2VVNA 1F4AA 4AEFA 4DJDD 3UCQA 3MSDA 4IL0A 1KXQA 4IPNB 3QKEA 3HV8A 1LLZA 3UR8A 4JZ5A 1SQ7A 1NEYA 1S39A 3IS4A 4XZ9A 1OGBA 1GVIA 4JL1A 2V0TA 3WNOA 4IFOA 2VR5A 1Q6GA 4GHRA 3JUGA 5K7JA 3A4JA 1J0KA 1Y65A 4O54A 4UTMA 1ZSXA 4GY0A 3PK7A 4HU4A 1XG3A 3G1RA 2FPVA 3AHVA 1RR2A 1WE5A 3IPWA 1U33A 1KM0A 1PUDA 2X40A 3AXHA 4UTTC 5GJPA 3BOLA 3RDKA 1TA3A 3BW3A 4OU1A 1IE7C 4H01A 1XRSA 3E12A 4GY7A 4U28A 2G3JA 3AQUA 4AX7A 2TPSA 3WKZA 1FA2A 3P6LA 3E9AA 1VRDA 3E0LA 1W9PA 3WK3A 2BX7A 3VMPA 1JCYA 3I3EA 4J3VA 2QCFA 3HQNA 1ZCOA 4S3GA 1B0IA 1QK0A 3F5JA 2CFFA 1CXEA 1M9HA 3Q67A 1H5VA 3WF3A 3LI1A 2PA6A 1DJGA 3VNYA 3GVQA 4GINA 3WMBA 2CCRA 1Q8AA 4M6PA 3SO7A 1V0MA 1X1NA 3GFYA 5K4ZA 1K7XA 2CLMA 1R3VA 4QS6A 1B5TA 3NURA 4KKXA 3FA4A 1DJIA 3UWYA 3W2KA 5LNSA 2CZFA 2XSAA 2Y1HA 1XCWA 5D9OA 3WQ6A 4FEZA 4CCZA 1QHPA 3H4WA 4MWAE 1DL3A 3J7HA 4JQ3A 4NUWA 3LSCA 1CECA 3TA6A 4XKMA 2IKIA 1R2TA 4K39A 3TTYA 2C0AA 3AALA 1EPXA 5I77A 5CC6A 5C5YA 8RUCA 1JGMA 5GPRA 2EJ1A 1OFEA 2Q3OA 4MVAA 1H50A 3TLLA 3TW9A 4P8VA 4WRHA 5AC4A 5FI8A 3QW4B 2P88A 4O12A 3OW1A 3EB2A 3AS2A 3MWCA 2VX5A 1ONXA 5KSWA 3LBMA 5KITA 4Q32A 3R94A 1T40A 5BXTA 1JJKA 1MNZA 3ITVA 1BG9A 4P8UA 3W7OA 3ANUA 3TKFA 3M7WA 4I7WA 5HANA 4GYFA 2EEXA 3DG7A 5HR7A 2CZDA 4MYXA 3O63A 3SCOA 3DHFA 1JQVA 5M1TA 3IGUA 2DH2A 4NYUA 4A2RA 1GT8A 3UYIA 2VRQA 4LYQA 4BCEA 1UR1A 1BVWA 2DU2A 2RDXA 1TZ7A 4ZOBA 3WMLA 4Y90A 1O94A 3F1QA 1FUYA 2ZWYA 3C0QA 4S3FA 4MPKA 3UQNA 3R8RA 3C2OA 4Y9PA 4KEZA 1JIBA 2C1IA 4HNLA 2HMCA 1L6GA 2CKSA 3EWDA 3OHIA 1OD0A 4E3TA 3GDBA 3B03A 3S5YA 3PPCA 4IPLA 1GQLA 1US0A 3NL6A 3BLEA 3CHEA 3ARTA 3UG5A 4F0SA 3V4BA 1OINA 2OX1A 5HWJA 4CVWA 4GUJA 3WLMA 4G2DA 1CPUA 3MHUA 2OQLA 3OQEA 2P53A 4JTDA 2HJPA 4XD5A 5BMWA 1CZ1A 4DM1A 2OR2A 2G3MA 4I5RA 4XAGA 3SN0A 3BC9A 3VIGA 4JIPA 4RXGA 1L2QA 2J4GA 3P14A 4PUMA 3VNIA 1UP0A 3SGUA 1HX0A 4YL2A 4XK2A 1OC5A 3W27A 4CU6A 2DSZA 2PEVA 1NWUA 3PBMA 4LALA 4O4WA 3DFHA 1V93A 1DJNA 2H3DA 2BB0A 1W0MA 3NQAA 3ABRA 2JF7A 5XIMA 5EA9A 2HE8A 4J3UA 2FHCA 2E9LA 1W3HA 1POJA 1XDMA 1SO6A 3EX1A 4IISA 4RZ6A 3DFSA 1M6JA 2B7NA 1N2VA 4DZIA 1A5MC 4JKKA 3HG2A 1S38A 5TNVA 3EZ4A 5BWFA 1VBRA 1RV8A 2JEQA 3MS8A 4BF5A 1AQMA 2XVLA 3M5YA 2CYGA 4W89A 5J5DA 6XIAA 3E49A 4M6UA 4TOQA 3N12A 2X0SA 3UWZA 4YMZA 3KZPA 5RUBA 5E1QA 3BG5A 1LORA 4RL3A 1FP8A 4WGHA 4F0LA 4NU7A 1OQFA 1M01A 1C90A 1JDCA 3TAKA 3VVGA 1WKEA 4XD6A 4FOKA 3E2QA 4H4IA 3AUOA 3DHPA 4U2ZA 1EJ7L 3CPGA 4HPNA 2YBVA 3HPAA 1XIIA 3U9IA 4GACA 3SURA 1TV2A 2QUMA 3QY8A 1JGIA 1LG2A 1TPC1 1E1EA 4XVDA 5IRPA 2WHLA 1P0NA 1QNOA 4ZQCA 1S5VA 1J8VA 4QJ1A 5IM51 3TN3A 4W93A 4ZBCA 3KTXA 2VD8A 4GI6A 2YA0A 5BZAA 1VFTA 3CTTA 4FXRA 5KZDA 4XO7A 2BY2A 4IQEA 2D2JA 5D4YA 3CV7A 1QT1A 1BPLB 1UR3M 4GYPA 1YADA 5D04C 4AIOA 2GQ3A 1E0WA 2Z2AA 1DBTA 3IACA 4K7YA 1BRLA 2PTWA 4GVHA 4PFHA 1JDFA 2ANUA 2VEKA 1MQRA 2V30A 4AB4A 5KZEA 4S3KA 1DWHM 4H6EA 4OHQA 2O4QA 1XBYA 4TO8A 2J7GA 4F3HA 2BY0A 2JKEA 1K03A 5LXEA 3KHDA 4MG4A 1ADSA 3IJIA 4D71A 4I3GA 3FJNA 1WQ5A 2KZHA 1WXJA 2PD9A 4DWSA 4OBRA 2C13A 1XDLA 4DAIA 1HKJA 1TQXA 2PWGA 4RXFA 4O1BA 1TPH1 2FMNA 3IRSA 4U5IA 3F5LA 5REQB 1QPQA 4JICA 3TXZA 3COTA 1XFBA 3N6HA 2YCLA 3KHJA 2FDMA 1M5WA 2BY3A 4ATLA 1H1YA 1I45A 3B05A 4WKAA 4ZXLA 1AG1O 1T7LA 3FDKA 3VNKA 1NFBA 3O2LA 3TYUA 1SZNA 4UTHA 3RLUA 3L4UA 3OYXA 2XJ7A 3C2FA 2B7OA 1GVFA 3NZGA 3LN3A 1JFXA 1UMYA 5FACA 4O1FA 3L4XA 4IH3A 4IPJA 2J47A 4PBEA 3BXWA 2PDXA 1K8CA 1R9XA 3HOJA 3L66A 4NAFB 2W3ZA 3RLHA 3D46A 3WJSA 3ABSA 4LCRA 3R0UA 1PKMA 4NNCA 2PS2A 1AH4A 2OYMA 4BEQA 3RCMA 5ABFA 3T2OA 3T0DA 1KTCA 3AS1A 3NQDA 1TIMA 1RJRA 2CLLA 3WO8A 5HNNA 1ZLPA 5GJMA 3S2NA 3C2EA 4D8AA 4GZEA 1Q6CA 4GC4A 5HJLA 1JXKA 2EG7A 4WJEA 3BWWA 1QFEA 4YNGA 5JMUA 1SW3A 3W22A 4GKLA 3WH8A 2PGWA 5A6LA 1IGWA 3BMVA 4E8CA 1AUSL 3PPGA 4IGSA 3N04A 3SUSA 4A8LA 4BHYA 4PB4A 4ZL1A 3QVQA 5D2XA 1PTGA 3AFBA 4LBRA 1F9CA 1GOQA 1BG4A 1NIUA 1YW1A 2QAFA 3U4AA 1E6SM 3CMFA 4NP7A 2QJNA 1TWDA 4CQ8A 3QMRA 4ZODA 1UR9A 2VEFA 1PIGA 4J9JA 4LT9A 2YX0A 5CJ5A 3LLFA 1XICA 4UTLA 1K6AA 5I3JA 3P80A 1GW1A 1MFVA 3A47A 3I7QA 4GMEA 1Q6FA 1DXFA 2G97A 3N14A 4M81A 5G4WA 3I4EA 1BF6A 1VLIA 3FGCA 2D23A 1T99A 4BI7A 5AHEA 1Q6LA 1A53A 4S2CA 4KQNA 1C3FA 3CMGA 5D8WA 1KXVA 3SGZA 2OELA 4AWTA 4O16A 2INEA 5EMMA 3G22A 4K6AA 5KEZA 2Z1BA 4MIMA 4N6EA 3QJAA 2HVNA 2ZIDA 4H04A 5CBBA 2D20A 4Y9OA 3CAVA 4DI8A 1H5YA 3GDMA 4IIBA 4LB4A 5HINA 2WWCA 2PGRA 3K13A 1SR0A 3WLNA 2W0UA 1FX6A 4AVOA 4A35A 5D2YA 2PTDA 3P0WA 3DFYA 3UJ2A 3TTSA 5JUVA 3W1MA 2OTDA 4AEEA 1A5BA 2JEPA 3EMCA 3TYZA 3CB3A 3TJIA 2XUCA 4US5A 1AW5A 1FCBA 5AKQA 4IMEA 1P6BA 4DUXA 4CD4A 1FWJC 5AOUA 2HISA 3SUVA 2J8FA 1V3KA 4JOMA 4XAFA 3U0HA 3TC6A 2Y2WA 1FQ0A 4H9MA 2ICSA 2DIKA 4S39A 1WV2A 2VCBA 1QBAA 2O56A 1EF3A 1OFBA 5KZ6A 1F74A 3INPA 3SSJA 1RQBA 2XIBA 4CN1A 4B9YA 5GQBA 3NDOA 4C91A 4AISA 4QBXA 5C71A 5EU9A 2WB5A 5XIAA 3OLIA 3CUHA 3K8KA 3W1PA 4TTGA 5FJTA 1ZAJA 5I23A 1WOAA 1PO9A 1PIIA 4NNAA 1MXDA 2WCGA 3V75A 2ZXQA 1LM1A 3NO5A 3GWQA 4PRRA 1LL6A 2YFNA 2VC5A 1LZOA 3GFXA 5HNRA 5G1TA 2WM0A 3TJ4A 1E4NA 1O68A 1RCQA 3WEMA 1H7WA 1CW2A 4MUZA 4HYRA 1BXCA 1NOWA 1SZEA 1SMAA 4POCA 3BCDA 2TSYA 4W86A 9XIMA 4WUIA 3UZ5A 3IAQA 2Z27A 4TVUA 4U3CA 1HF6A 3IGHX 3SRDA 3PS7A 4FLRA 4O0ZA 3OGRA 4X61A 5EYWA 2Z1KA 3B9AA 2ZUNA 3VD5A 4NL1A 1CLXA 4GUIA 4J3WA 4H00A 5LHEA 4EX4A 3L2MA 4HMEA 1BD0A 1XRFA 4FP1A 3PPFA 4FXFA 1XR2A 5FJOA 3GRIA 1OFQA 5BRQA 4OE7A 4LVBA 1Z7AA 2Y7GA 3LTYA 2NW0A 1IV8A 2WSPA 1QBBA 4IP7A 3W71A 5BMXA 4QQ3A 3ZS4A 3WDJA 5EBAA 2OZ3A 1RY0A 1OFOA 1EP2A 4HZ7A 3S5ZA 3U7VA 3OZPA 4UTWA 2WC4A 1EWEA 1WDQA 3TA9A 3W7QA 1XM3A 3VIJA 2PDMA 3WBWA 3MP3A 3H12A 4WIWA 1GOIA 3O7UA 1UQYA 1C29A 1V6UA 4JCLA 4BFAA 4ROPA 4ZE5A 2V5LA 1UOKA