3RNDA

W116i-oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title Biocatalytic Reductions of Baylis-Hillman Adducts
rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rndA00
1OFRA 3LCLA 3C2FA 4CCEA 3MHFA 3F03K 1H1ZA 2OMAA 2VC6A 1H61A 3PBYA 4FB7A 3NZRA 4W9TA 3GK0A 1QPRA 2X1RA 1TTPA 1ME7A 1FUYA 1L6YA 1G4EA 3P60A 1NF0A 1NEYA 4GUFA 3T4CA 1CW2A 4AHOA 1EPXA 4LTSA 2ZA3A 4XTIA 3KFTA 1UB3A 3CB8A 4ADUA 1Q6LA 3E96A 1OK4A 1LLWA 3FS2A 1TCDA 3LCHA 1VRDA 4XUGA 1H1YA 3U6WA 3AO0A 1KFLA 1LOSA 4G1KA 3F4WA 1GTHA 1H63A 3FYOA 3M5XA 1VGAA 3MUXA 3NPWA 3IIXA 3IIOA 1JCNA 3W1AA 3TROA 2GVJA 1KTNA 1RZMA 3HG5A 3TUUA 5F1VA 3QW4B 4AWSA 4JN6A 3UD6A 2UV8G 4PODA 4MZ1A 3W85A 4MKNA 3G0UA 1NAL1 3A23A 3JRKA 4UFJA 1ZNNA 4ZQRA 4RJEA 3ABOA 5HQEA 1KM6A 3I6RA 2Y7GA 1LBFA 4UUIA 3ZR4A 3GDRA 3OVPA 3TSBA 4M7TA 3W73A 3UWYA 3GDKA 3NQCA 4N9DA 3OVRA 1SUXA 2G96A 3QPYA 4JTTA 3PUDA 2RDWA 2ATSA 3R5EA 3WJXA 1X1OA 2E1DA 2Y63A 2YYTA 3BW3A 3RLVA 1QPOA 3AJXA 1OABA 5HMSA 5TIMA 3UXAA 3P61A 3N73A 3KRUA 1PCWA 3HIJA 2V5LA 3USBA 3NPXA 3W1PA 4RZ4A 3L5LA 3P74A 3LGEA 1JCLA 4TX9A 2BLEA 4UTWC 4XQ6A 5EPDA 5AB3A 3LOTA 3TAOA 5HR7A 4A22A 2ZRYA 1W3TA 2XN1A 3LCXA 5G2WA 2ZCGA 1SO3A 4FO4A 1MXSA 2V82A 3FKKA 4TIMA 4UTWA 4ZQCA 1RV8A 2ZTKA 4Y8FA 3SY5A 4ALDA 4WQ6A 4YL2A 3W7MA 4OV4A 4R34A 4FNQA 4OQVA 3M6YA 3Q2DA 5F1UA 4MJZA 3UWZA 1DQWA 4YCOA 1W1ZA 2ALDA 1XFBA 3EX2A 4QM1A 3NM1A 1VLWA 2E5CA 3O05A 3EKLA 1EEPA 3NQVA 3E49A 1FCUA 4WOZA 3YPIA 4FNTA 3ABQA 4MUZA 3NNTA 4PEKA 6ALDA 2C1HA 3MHUA 2YW3A 4JTJA 3S5YA 1NFBA 2FPYA 1GZGA 4NJKA 5HNRA 1F6KA 4HKPA 1OFQA 4RXGA 5HR6A 3NXFA 5K3VA 3UWQA 2WKJA 3OIXA 1FWWA 3P5YA 3TSDA 3FIGA 2NLIA 3PG9A 4UTKA 5IBXC 5DY2A 2HTMA 5DCBA 1SQ7A 3HGJA 3CT7A 1K8ZA 1JRCA 5IBXA 3MMTA 3L67A 2H90A 3GXPA 1TSIA 2ISSA 2QCDB 2WPBA 1BEUA 2A85A 5L9FA 4WJEA 4KWVA 1LDCA 2C13A 1QPNA 2NV1A 1AW5A 3M16A 1GT8A 3LRKA 1QR7A 1QDSA 3EX4A 5I3IA 1VCGA 4JIQA 3R12A 1TPWA 1RVGA 1H7WA 2D73A 3TIMA 3EXRA 4BK9A 1OK6A 1SU5A 3FA5A 3G8EA 1PVNA 3PR2A 4O28A 1VYRA 1R2SA 4LRTA 1W54A 4K8HA 5ABTA 4O10A 4UTHA 4UNLA 1K3UA 5F4WA 3O15A 2GQAA 5CPMA 3KRZA 5CZTA 2NXHA 3CQ0A 3MP4A 2A7NA 4E0CA 3TNOA 2DZTA 2GJNA 5DCDA 4GUIA 1OHLA 4JX6A 1WV2A 1FWTA 4KKXA 4NQ1A 5AHFA 1KFBA 1JJKA 5C6MA 4R53A 3S42A 5A5WA 3RMJA 4N2YA 1I2QA 1Z48A 4ZVJA 3IIPA 3L0NA 2GVLA 1L9WA 1KLYA 4JGDA 3W2KA 1LM1A 3L68A 1LORA 3FJLA 3A9IA 4NU7A 3MBDA 1GTEA 1LRNA 5LGXA 3LHUA 4Y96A 2F7FA 1I2PA 1QPQA 3WJZA 1LROA 2FPTA 2H8XA 1P1XA 2JBMA 4GXMA 4Z1DA 2C15A 3W7LA 4GFSA 2QCCA 3TA6A 3U2OA 4DBDA 4AHQA 4HN4A 3NQAA 4LRSA 4RXFA 3DI0A 2HMCA 1JRBA 1VCVA 4I7UA 1R2RA 3GKAA 1M7OA 1F2JA 3P81A 2A2IA 4H3DA 4QAIA 4OGZA 4O0ZA 1N55A 5C5YA 4K7YA 4N6FA 1G7UA 2R91A 5AHEA 1TRIA 4DQWA 5DXYA 3O6YX 4M19A 4O12A 4DEFA 3W7EA 1L6WA 1KM2A 4O4VA 3TFCA 4IGHA 3QZEA 1IIGA 4LS0A 1TRDA 5CZ0A 3S5NA 1M6JA 2Z0IA 3S1VA 1KW1A 4YCPA 2NZLA 4ADTA 4DO4A 2QF7A 2DU2A 2VFDA 3S6DA 1OFDA 1F5ZA 3H53A 3STEA 5HINA 1OFPA 4E38A 5G4WA 4MLJA 3EX1A 3G1AA 3L5MA 3LRLA 4EVZA 1UCWA 3TW7A 1XBZA 3LCIA 4DO5A 2XN0A 3E12A 3LB0A 3W7CA 1JR1A 4FXRA 3UPWA 4RK8A 5AHLA 3MYPA 2CLIA 4QIUA 4LV4A 5HWJA 3HMJG 5EL1A 3SFKA 2Y70A 5G5IA 4JIPA 1FDYA 1EB3A 3NL2A 1KTBA 3W7PA 3NQ7A 3RK8A 1QOQA 2DZPA 3LI0A 4K39A 5G2HA 4M5PA 5D30A 1W3IA 2E09A 1DBTA 2Q8LA 1IXNA 2PRLA 1BWLA 1WA3A 2Z6JA 4OWGA 1J2WA 2A0NA 3SIZA 2ZDRA 4HNNA 3M47A 1YADA 4ORIA 2H8ZA 4HPJA 2OT0A 1AMKA 3I68A 4MPQA 4UR7A 4DBEA 2ABBA 3LTYA 2DZUA 1VCFA 3IVSA 2AGKA 2TPSA 5IM51 4DXVA 3P7YA 3R89A 5BRBA 2Y88A 3TSMA 1ZAIA 1V7YA 3P82A 5KZDA 1S5WA 4O13A 3NL3A 2OZ0A 3P80A 1DV7A 1JUBA 3L0KA 1A5BA 3DAQA 4OU1A 3N9RA 3CIWA 4N9CA 1F76A 2DORA 1WOBA 1B57A 1PV8A 1YTEA 2YGYA 1LP6A 4PTNA 3Q94A 2X1SA 4JXCA 3C2EA 1ICQA 1OVDA 3IGUA 3UY8A 4AAJA 4O18A 4UR8A 1W5PA 4JEQA 2QR6A 2YXGA 5D2WA 2FTPA 4E2BA 3NZ1A 4JS3A 2W0UA 2CLOA 1HTIA 3PULA 2V30A 4FNRA 1T8XA 2ATMA 1GVOA 3T40A 2FDSA 4MVAA 5KITA 1F05A 4JR5A 8TIMA 3UQNA 1JQVA 3O07A 4UTTC 2EF9A 4LC6A 4LU0A 4O17A 2EHHA 4EWND 4GUHA 4O16A 3TJLA 1QO2A 4UTTA 1FBAA 1Y0EA 2NWSA 2Z1BA 4YWIA 4M6QA 3V1PA 4K8EA 4UXDA 1SW7A 3QC3A 1GWJA 4LT9A 1FCQA 5AOUA 3FEMA 4H6KA 1F74A 1XDLA 1FQ0A 1IGSA 2CLMA 4GBUA 5D38A 5D2YA 1EA0A 3LRMA 3LX9A 3HQ1A 1H62A 2GQ9A 4UTJA 2FB3A 2GPTA 1W5NA 3UXDA 3EWZA 4N9EA 4UTMA 1PHWA 3EWUA 3R8RA 5CKSA 1LYXA 2B7OA 4LC8A 4L4LA 5KMYA 3LV5A 3M41A 4JDYA 5K2ZA 1GPWA 4O57A 2YZRA 3VE9A 5DLCA 4Z0SA 2J9YA 3QPZA 2ZRUA 1WDWA 2Y61A 1XUUA 1DOSA 4ORMA 1KLZA 4JYDA 3VKJA 1XBYA 3W2MA 5CPLA 3T44A 5AC8A 1FXQA 3HG4A 2WO5A 3U8GA 5TQLA 3NR0A 2CW6A 3MI3A 4O8RA 3MI6A 1M7PA 2V9DA 4ONVA 1I8JA 3FLUA 4OHQA 4RCXA 3C4UA 3LXCA 1W3NA 2H3BA 3QM3A 5F4SA 3THQA 4BI6A 2RDUA 2QJGA 5CSRA 2RHGA 2Y85A 4CNNA 1YYAA 1I2NA 4AF0B 3W74A 2VEPA 4ZMGA 4JTUA 3QQ0A 1QO5A 5F4XA 1K02A 3DU0A 1VS1A 1Z44A 3IEBA 1T0OA 4QQ3A 2BWGA 4O1BA 3CEPA 2Q8ZA 3NQ2A 1P4CA 5FF4A 4P61A 3EX3A 4A2SA 3O8AA 3C2RA 3TX9A 1OF6A 4O0KA 5D09A 1OX4A 3HPSA 4KFNA 3BO9A 4XKYA 2QJHA 3BARA 3PUEA 4NX0A 5HJLA 3W1MA 4DPQA 4TU1A 1ZFJA 2RH9A 2RDTA 2YR1A 4PFMA 4N9BA 5DBUA 3PBUA 1OX4B 2BX7A 4JTGA 5FEZA 3LERA 5EA9A 3W1UA 1Z41A 4TMBA 3F1QA 1OX6A 3W2LA 1UBSA 3NOEA 4NT0A 3WK1A 1ZENA 3O63A 3W07A 5C54A 2NX3A 2ISWA 4WX2A 1PHQA 3ZS4A 4FX7A 1KV8A 4LNYA 3W83A 4Z1AA 3KVMA 5TBOA 4BF9A 4O1AA 3NL6A 1Q6QA 4JTFA 3BW4A 3L21A 3QF0A 3KHJA 2JKPA 1FX6A 1SPQA 4FF7A 5EY5A 4BI5A 2B4GA 3RF9A 3PAJA 2R14A 5D02A 3NO5A 1LOQA 3TQ0A 2PCQA 1FCVA 3ABRA 4OBTA 5BOOA 2YPIA 4IPJA 4NNAA 1A5SA 3LHYA 2TSYA 3ANYA 3W7IA 1PS9A 1OFOA 3H55A 4O11A 3G3MA 3G0SA 1O95A 3LM7A 2YFNA 3GNNA 1IIHA 2X30A 1AL8A 1H7XA 4FIQA 5HUOA 3DZ1A 4U28A 3QH2A 1RQBA 1FWRA 1OYBA 1IXOA 3DFPA 1T96A 1TTIA 2NXGA 1TPDA 3UWWA 2FQIA 1YXCA 1GQNA 2ZZ6A 1RQHA 3W7NA 2CLEA 3TW6A 4CQ8A 2Z6IA 3EB2A 3NM3A 4FX6M 2LLEA 2V8ZA 3SJ3A 3NQFA 1G6CA 3W1QA 5CPOA 4MYXA 5HWMA 2CZEA 2DJXA 3STCA 4S1FA 3TKFA 1W37A 2F84A 3GVGA 3HB9A 3A21A 1KA9F 5AHIA 1WX0A 4KWWA 2J6XA 3TMQA 1N7KA 5BNKA 4IX2A 1VPXA 4IJBA 1SSGA 5AHMA 1TREA 2XFWA 4AMAA 2CU0A 2A4AA 4J9JA 1HUVA 3W7GA 2JKEA 3NEVA 3TH6A 3ZFHA 2CFFA 3TXZA 3FKRA 4H4IA 5EBUA 1QOPA 3NQDA 1MZHA 3QFEA 4FNPA 4DF2A 1GVFA 1K03A 4MY8A 2P10A 3GKFA 4HSOA 1U5JA 4JD4A 4LVFA 4DO6A 1ICPA 5F2GA 5CGQA 1DJQA 2CWNA 3B05A 1K7EA 2WQPA 4GNJA 1FY6A 1KBIA 1KM0A 1ZJIA 2ZRVA 1UUOA 4JY8A 3W1RA 3MJYA 4PA8A 3G1DA 4FHAA 5AHNA 5K9DA 4JX5A 7TIMA 1Q6OA 1RQEA 3B8DA 2VFEA 2G97A 1XCFA 2E5BA 4C1LA 3E0IA 2CZDA 3ABSA 4CCCA 5F2MA 2ZA1A 3NQEA 1H60A 3DXIA 4BFAA 5KZEA 3L9CA 3TDFA 5K4ZA 5HULA 4IMGA 3T7VA 3WK2A 3DFTA 1KM1A 4IXXA 3PBWA 4ZQOA 4UFLA 4MZ8A 3LLDA 3UPBA 3MYOA 2ZYFA 1R2TA 4YMZA 3W71A 1TIMA 4R7JA 1QWGA 4XBKA 1Q6RA 2QCGA 1YDNA 4FIRA 4M6PA 4QITA 2CLFA 1YLVA 4JX4A 3GYEA 3Q37A 3NVTA 4X22A 4UFIA 2FB2A 1AK5A 2ZZ3A 1MEIA 1W0MA 2QCNA 3SR7A 3NAVA 2OX1A 4UFMA 2A1YA 5LNSA 1UASA 4K37A 3E9AA 1EP2A 4R33A 1K7FA 2VFFA 4O50A 3LTSA 2VFHA 4Y6GA 3TU9A 2W79A 1CX9A 1H7NA 1SZGA 3TMLA 3S0CA 2VEMA 4JTEA 4FXSA 4S2BA 3PWAA 2YFOA 1BWKA 1YPFA 5MHBA 1EWDA 1KM5A 4QJ1A 3L5AA 1TV5A 2QDHA 2C3ZA 1I45A 5E93A 4XZ9A 5E0KA 3TV8A 3C61A 3O06A 4GRSA 2HSAA 1F7BA 3FFSA 2ZA2A 3EX6A 1AL7A 1ME9A 3GDLA 4X9SA 4QNWA 1AW2A 4FX8A 2EPHA 3CLMA 4Z1BA 5K9XA 2DJLA 5D2VA 2A6LA 3W87A 2DZVA 4MOZA 2QDGA 3LHTA 5LGZA 4I7WA 2AAMA 4BR1A 3GXNA 3MP3A 3W2JA 4FEZA 3PF3A 4GC4A 1W5QA 4WD0A 1SSDA 4MFEA 5CG7A 1H51A 4K36A 1C8VA 2V2DA 5CSSA 4UCGA 5I3KA 2C18A 5I3GA 1TPB1 1JQXA 2C6QA 3CWNA 4POCA 3T78A 4UMAA 1JCYA 2GVGA 2ZTJA 4DPPA 6TIMA 1IXQA 3UZJA 1OFEA 1SO6A 2A7RA 3G1FA 4N02A 3M7WA 3KXQA 3UZ5A 4P2VA 3OHIA 1GYLA 3TR2A 1WXJA 1JUKA 3GAYA 2X1TA 5AYYA 2PRMA 3MO7A 4RZ6A 3CTLA 3ATYA 3IIZA 1IF2A 4GJ1A 4WXZA 3PC0A 4IMDA 1R46A 3W1LA 4NJHA 4PL2A 4D2JA 5LSMA 4MZYA 1GYNA 4GWEA 3QMRA 3W70A 1MO0A 3W7RA 3W84A 3QQ1A 4TO8A 3KRSA 3PM6A 4AEOA 3S1XA 5EKYA 2EGZA 1YXYA 1AG1O 3EWBX 2GUUA 4WUIA 1PCKA 1XBVA 1V5XA 4UTUA 1KBJA 3BG3A 3H54A 4EF9A 1JVNA 4EF8A 3QJAA 5KTLA 2PE4A 3WK3A 1C29A 1ML1A 1SFJA 4JTLA 4NJIA 1DJNA 1EIXA 2VENA 3WK0A 2A5HA 4JTIA 2V2HA 1H7OA 2EKCA 3N3MA 3I7RA 3W88A 1KTCA 4JTHA 1YDOA 4IWWA 2QCLA 1JULA 3BGGA 3DH7A 3B0UX 3I7QA 3QW3A 3W2NA 3C8FA 1VJIA 1B4EA 1YTKA 4BI7A 4Y9AA 4AVFA 2WNNA 3ATZA 2WNZA 1XKYA 3MWAA 1EUNA 4Q33A 3DGRA 3S1UA 3KX6A 3HG3A 1TV7A 1LBMA 1LCOA 1VYPX 2B0MA 3W7DA 3T55A 2ZZ5A 3G8RA 3NQ6A 2H6RA 2QEZA 4RKAA 1XBXA 4ZZ9A 4O15A 5SWUA 1YDVA 3M43A 5DXXA 3C0JA 4MJMA 3EWXA 3HGOA 4XWUA 2VELA 3N2XA 1TB3A 4ADSA 1X8FA 1Z42A 4AH7A 3BVJA 1YXDA 2YSWA 2CLKA 1GG0A 3L66A 1IXPA 4NZJA 3N34A 2E6FA 1KFKA 4CQ9A 4JNMA 1NSJA 2ZZ7A 3WJYA 3G1SA 3M5VA 1TV8A 4WZHA 1O4UA 3TJXA 3KVLA 3G0XA 1QCWA 2BSLA 3CPRA 2OJPA 2BZNA 5LZLA 5AC6A 1ME8A 4AB4A 3BK0A 3QYQA 3SI9A 1SO5A 3TK7A 3DENA 3SGZA 4MFDA 2ZRZA 4LS2A 4MLRA 2C14A 1WQ5A 3BG9A 4LOCA 3HF3A 3S8HA 2PC4A 4CNOA 2BTMA 5AC7A 2VEKA 1G67A 1HG3A 1SR9A 4JY9A 5FF3A 3W75A 3PY2A 3TE9A 5LNWA 1P0NA 5K4XA 4YLWA 3GX9A 5D05A 1GEQA 5AYXA 1ONRA 3W72A 3LV6A 5F2LA 2ZBTA 1SO4A 3RU6A 3O6CA 4ICNA 4O53A 1QFEA 2H3DA 3ZWSA 4Q32A 5I3JA 1EX5A 1EWEA 1ZALA 3RNDA 3BV4A 1K8XA 1QNVA 1FDZA 1J4EA 1S5VA 3LBCA 1R47A 1ZAHA 3E02A 3GZ3A 4CLMA 3I65A 4K7VA 1N8FA 2VFIA 2JKAA 2V0TA 2B7NA 1OJXA 1XI3A 4GUJA 2NWRA 2J88A 3G18A 2HS6A 3A22A 4OT7A 2G95A 3BG5A 3PG8A 4ZQPA 3IIVA 1KM4A 1TO3A 3M1ZA 1U83A 4NZFA 1XL9A 5AYZA 4IMCA 1VH7A 3BLFA 1KFCA 2J27A 1EUAA 3DFNA 3W9ZA 3VE7A 1H5YA 2O7QA 4MIMA 3OBKA 1LRTA 3W7QA 3N2MA 3M0ZA 1X6UA 5D04C 1VHCA 3LCWA 2QAPA 3LCGA 4LVBA 3EEGA 3P67A 4WXYA 4Z08A 1O5XA 3LXAA 3EXTA 3S5OA 2WSYA 3NDOA 4NX5A 3M5YA 3LHZA 3L2IA 3MI2A 5GVJA 3IVUA 3MW7A 2Z2UA 5U4NA 1H7RA 4ML9A 3B06A 4CNPA 2I1OA 3DI1A 5D03A 2WSRA 2Q3OA 1O94A 2ZZ1A 5H2ZA 4XKYB 3BW2A 5DCEA 3TAKA 4AWUA 3GAKA 5D2XA 3CU2A 2JGQA 2X1UA 1F73A 2NX9A 5L6UA 1JCJA 2C19A 1W31A 3S9YA 4O1CA 4UFKA 1G7VA 3LI1A 4YXGA 3F4NA 3PBVA 4UTIA 3G24A 2DZXA 4LVGA 1DKWA 3QSTA 1JCMP 2Y7FA 2CLHA 5G4EA 2AQWA 3G1YA 5U7SA 3HPZA 2V2CA 3S1WA 2ABAA 2BXVA 1VR6A 1VZWA 2I9EA 3M5ZA 1VYSX 4FNSA 4JDBA 3SZ8A 4ZL1A 4BWLC 1ZAJA 4X2RA 3W22A 1KM3A 2ZFAA 3DFOA 1RD5A 3C52A 3HG2A 3GLCA 1H50A 2VKZG 3R2GA 3N19B 3OG3A 4HT3A 2B7PA 3NQMA 4AHPA 5KINA 3HGSA 4BWLA 2TYSA 2QCEA 2J9XA 4XBSA 2E5DA 1TTJA 2ZZ2A 2Q3RA 5I3FA 3GDTA 4RLIA 1A53A 4Z0JA 3QSRA 4S2CA 2NX1A 1ZY9A 1DHPA 2RFGA 1KV5A 2WSQA 2PRHA 3GIYA 3P62A 1TQJA 2QUUA 4GE8A 3LHVA 3UYCA 3WJWA 3HGRA 2NV2A 3MP5A 1VHNA 2V5BA 1GVSA 4HHPA 1XC4A 3KVJA 3P8JA 2FIQA 2E77A 1HFBA 4N4PA 3GNDA 4UTLA 3L65A 1VQTA 1SZEA 2WNQA 4O14A 4ZQNA 4NXSA 3FOKA 2E6DA 3ELFA 1ZHAA 4X3ZA 3RLUA 3CEUA 2RKXA 1HL2A 4O4WA 5FEXA 3W1XA 3G1XA 3HPXA 5FF2A 5LNVA 4CCDA 2E68A 3FJ6A 1QMLA 4GUGA 1VC4A 1WBJA 5CPNA 2X2GA 3NQ8A 4IMEA 4NVTA 1G4TA 4JICA 4HPXA 5DY3A 4EOUA 1UUMA 1TPC1 3HO8A 2NUXA 4NNBA 3VFLA 4NUWA 2VXNA 2Y7EA 4HNTA 1OFBA 3DBPA 5HUPA 4LUJA 3LTPA 1LZOA 2QCDA 1FXPA 4LS1A 4B5NA 3CM4A 1DVJA 1P0KA 2GQ8A 3O6DA 3R13A 3DKLA 1G4PA 5E1QA 3PUOA 5C55A 5HWNA 3JS3A 4LWWA 3GR8A 2G5WA 1ZCOA 3W1NA 3V75A 1CI1A 2Y6ZA 1YPIA 1JCXA 1PL9A 5LHFA 2WJZA 2IQTA 3KVKA 4L4MA 2QCMA 5EYWA 1D3GA 1ALDA 3B4UA 1BTMA 3LBMA 5AN7A 2DZWA 3IRDA 3PVFA 1X7FA 3HBLA 1A5CA 1TMHA 2NUWA 1XM3A 3UNDA 3SSJA 4XTDA 5D32A 1A5AA 1JUEA 1LTDA 3TXVA 4Z1CA 2YYUA 2PURA 1TPH1 1LOLA 1P5BA 4M6VA 3P5ZA 3ZWTA 2I14A 1K8YA 1TQXA 4O54A 3SGUA 3N14A 2Y89A 1OYAA 1WYIA 5G1YA 3QEZA 4NNCA 3G1HA 1RPXA 3STGA 3O1NA 5KZMA 3TCEA 3W7OA 3MHGA 3A5VA 2WOQA 3NYZA 4K38A 4QNEA 3SW6A 5D2TA 4WY0A 2Y62A 3HJZA 5K9CA 3G3DA 1XXXA 2GOUA 1SW0A 2QJIA 4QISA 1W56A 1OYCA 3GB6A 3BLEA 2QUVA 1GVRA 3INPA 1MEHA 4WY0B 4QSHA 2QUTA 1B9BA 4UC5A 4MY9A 2YW4A 3Q58A 2C0AA 1WOAA 5BMXA 1WBHA 3W3OA 1QAPA 4HNVA 2FLIA 1KFJA 4A29A 1XDMA 1A50A 2A6NA 1PE1A 2XN2A 3PS7A 4IPIA 4KFOA 4IOTA 1RR2A 3L0GA 1FCBA 5G1TA 4CQAA 4EIVA 4OV9A 4DF1A 1AW1A 1W8SA 4UIOA 3VNDA 1TJPA 3IGXA 4ZQMA 3W23A 1TPEA 3S5ZA 1YTDA 5FEPA 1FWSA 2JGYA 3K30A 4I9AA 4C1KA 3QRHA 3THAA 2ZQ0A 1F6PA 1LBLA 4RX0A 3CHVA 1OX5A 1TPUA 3KOFA 4DELA 1O5KA 3OA3A 2ZRWA 3CC1A 4E2DA 3PB0A 3W7KA 1I2OA 1GJPA 2R8WA 3HOJA 5DN1A 1NVMA 1L2UA 2YCEA 2VFGA 1T99A 1BKSA 1S5TA 5CZSA 3LLFA 3TQKA 3A5FA 3DKJA 2NUYA 1LRQA 3W76A 3M44A 3NL5A 5FF7A 3LHWA 1W5OA 4I7VA 4MYAA 4OE7A 2E6AA 1UJPA 1R30A 4HIBA 3STFA 2A21A 1SZNA 4JYEA 5FEWA 1ADOA 4NXKA 3W2UA 2J9ZA 4IMFA 3M9YA 3WFAA 3UWVA 1XUZA 4JTSA 5CZJA 1SW3A 3G22A 1H7PA 5BW6A 1MSSA 2DZSA 1TPVA 1B4KA 4RR4A 5H91A 5A8GA 4KFPA 3VI2A 3DHDA 4FNUA 3DFQA 2P0OA 1FDJA 3NGJA 3B0VC 4JYFA 2Y7DA 4PL1A 3EKZA 5KSWA 4LVAA 3OVQA 3NPVA 3DFSA 1ICSA 3NQGA 4IXHA 1DQXA 5D37A 1C9DA 4UMBA 3NG3A 3EWYA 1O60A 1FWNA 4Y90A 3PSVA 4WY0F 4TR9A 4DF0A 3PB2A 3W86A 2OCZA 4O52A 3I7SA 2CZFA 2VEIA 2FJKA 2YDAA 1GVQA 3EXSA 1OFAA 4N4QA 4M7SA 1D9EA 2QCHA 2YX0A 1GOXA 1HO4A 2TRSA 5T26A 1PIIA 2GJLA 3B03A 2CZ5A 3TFXA 3WJSA 3RFAA 3P8IA 4LVDA 5J5DA 3NPUA 1TTQA 4JTKA 1K7XA 1Q3NA 4AXKA 1LLZA 3QMSA 5LNUA 3W6YA 1Q45A 2QKFA 1NF7A 2WV8A 2HS8A 2O7SA 4RZ5A 4LY8A 1S3HA 2JK2A 4LV9A 5I3HA 3QMTA 5EMUA 2FFCA 1WAUA 4UFHA 1SZFA 1X1ZA 1G4SA 3IVTA 1TYGA 5J5RA 4NJGA 4A2RA 4U4MA 3GR7A 3LCFA 1SFLA 5LKYA 2CLLA 3IV3A 1DL3A 3B04A 3G1VA 3VCRA 1MEWA 3C2VA 4Q4KA 1W5MA 4N6EA 3C2OA 3P84A 4IQLA 2ZZ4A 4WOQA 4A21A 1TPFA 2P1FA 2KZHA 4HSNA 1OF8A 3IGSA 3KAOA 2A7PA 2TMDA 1TJRA 4UMCA 3EWWA 1EP3A 5FF0A 4LW7A 3TC6A 4MY1A 3A24A 2C16A 2E6YA 2ISVA 1D3HA 4IUOA 5FI8A 4PCFA 3CIXA 2J24A 3NA8A 1EP1A 4IX0A 3C56A 2QAFA 3UY7A 2V81A 2ZRXA 3O16A 5FESA 3OEXA 3C6CA 1G69A 2EAWA 1B3OA 1J5TA 3BLIA 1KFEA 4TMCA 3GXTA 1M5WA 3TC7A 4HNUA 2X16A 5AFDA 2DP3A 4O19A 5C2XA 3W7HA 1L6SA 3DHFA 3W7JA 1VLIA 4LUIA 2B7QA 2NXIA 3BGJA 5K7JA 2VOMA 1DORA 3BPWA 4AWTA 1OG0A 2W6RA 4K6AA 4PH6A 3N9SA 1I2RA 4A3UA 1GG1A 4RV8A 3W1TA 5LNRA 1E51A 5D33A 4NJJA 3SECA 5DBTA 3CWOX 3LXBA 4PC8A 1I4NA 3D0CA 3PSWA 5DELA 3C3NA 4AF0A 3B0PA 5BMWA 1HO1A 5G2IA 3FYPA 3LDVA 3JR2A 2FPVA 2R94A 4UNKA 3UWUA 1THFD 2QCFA 2OT1A 3GDMA 5F2IA 3TQVA 4O1DA 5LHEA 3MBFA
chains in the Genus database with same CATH superfamily
1AJZA 1XYMA 3C2FA 5GJNA 4BS0A 3ZLFA 2IQ0A 1DWJM 2HE5A 4QJ3B 4HOWA 3LN3A 3I3BA 4W9TA 1QPRA 1OEPA 2X1RA 2OO0A 1JF6A 1ME7A 2X2YA 1L6YA 1NF0A 3VMOA 4FA3A 5I07A 1W32A 3POCA 5I09A 1PSCA 4I90A 3WKZA 2ZXBA 4LTSA 2ZA3A 3AHVA 4ADUA 1A5LC 3PP7A 2OQHA 2WJEA 3PAOA 2EXOA 3FS2A 2FH6A 1V6YA 4U2YA 2V3FA 3KM8A 5BZAA 4XUGA 3MJMA 4G1KA 4A8LA 1GJUA 3DBNA 1GTHA 5CC3A 3NPWA 3WX7A 2P8CA 1NP0A 2GVJA 1KTNA 3HG5A 1WKYA 5F1VA 3QW4B 4JN6A 3UD6A 3P14A 2WMKA 4ZODA 4WDUA 2PU1A 4JFUA 3G0UA 2BHZA 4UFJA 2DT2A 4LYRA 5HQEA 1KM6A 1ZGDA 2Y7GA 3RX3A 3GDRA 5LIWX 3GDKA 4N9DA 2G96A 4MNLA 3QPYA 3AROA 4HZ8A 2EJ1A 4C6IA 1X1OA 2Y63A 2YYTA 3V5FA 3BW3A 3HPAA 1QPOA 1G94A 2WMFA 2JF7A 3PWIA 3LSCA 3L5LA 3I3EA 3LGEA 1JCLA 1W1B1 4JN7A 4XQ6A 3ONCA 2VRQA 4L9XA 3TAOA 4Q4OA 6REQA 2FZ8A 5HR7A 3W6MA 3IAQA 1MMFA 2O56A 2RGLA 5G2WA 1SO3A 2V82A 3AJ7A 4UTWA 1VENA 4ZQCA 5M3WA 1ZTVA 3RIKA 4ALDA 3W7MA 4OV4A 2OWWA 4R34A 3M6YA 3CQKA 4C6JA 4MJZA 4HU4A 1T41A 4NZCA 4AXNA 2PODA 3GNOA 4WJ8A 5E6ZA 3E49A 4BZYA 4H00A 5GNXA 3BJSA 1KR0A 3TYDA 1LL7A 1NFBA 1GZGA 4NJKA 3VZXA 2Z2BA 2ACQA 1FWWA 1NWUA 4DJFC 3P5YA 3O9NA 3PG9A 2PWFA 5DY2A 4DXXA 5DCBA 1XLBA 4U3CA 5BWFA 4H8NA 1JRCA 5IBXA 4J28A 4WJEA 2NV1A 2PSNA 4KH2A 1AW5A 3M16A 5I77A 1Z32X 3EX4A 3BSHA 5I3IA 2YL5A 1ITQA 2WANA 3NZPA 2J78A 2D73A 3WUEA 3EXRA 1OK6A 3VPLA 3FA5A 1PVNA 3P6LA 2W61A 4EXAA 1R2SA 2HVMA 4K8HA 3L2MA 4UOQA 5A6LA 4UNLA 3WZ0E 3HTWA 4M81A 4I8DA 1FH8A 4OUIA 5CZTA 1TR1A 1BF6A 3K2GA 3CQ0A 2A7NA 3TNOA 2DZTA 2GJNA 5DCDA 4HTYA 3A47A 1XC6A 3KW3A 4NAEA 3ARWA 5A5WA 3RMJA 4N2YA 2ZUNA 1VEPA 4V27A 1I2QA 3T9PA 2XSXA 3N13A 1I0BA 5D9NA 4PB5A 2GYIA 3BXWA 2NQ9A 1XISA 2GVLA 1L9WA 1EEXA 1GW1A 3QHMA 4JGDA 3W2KA 1K6AA 4ZXLA 1PXGA 2PLMA 4NAEB 1NARA 4K68A 4CN1A 1LRNA 4RV3A 3BTNA 3WJZA 1RCOB 1V02E 4JQAA 4KQNA 2JBMA 2C15A 2YA2A 3W7LA 2QCCA 3U2OA 4DBDA 4JHZA 2NQZA 3B3DA 1MVYA 4H9MA 1UD8A 3KBWA 4KIRA 5FJJA 3BV7A 4P8VA 4I7UA 3NQBA 5ABEA 3JVAA 2PZNA 1A3WA 2V6AA 3BZGA 4H7CA 3VKCA 4O0ZA 5C5YA 4K7YA 1J0ZA 4AZ6A 4DEFA 3AALA 2J7DA 3DEQA 4RUBA 4ACZB 1H41A 4FOKA 5M1TA 1V77A 1IIGA 2CIPA 1I9CB 1MW2A 3U7VA 4ZGYA 3EWDA 1TRDA 3AHXA 4H9UA 3S5NA 3WBAA 2ZKMX 3S1VA 4RE0A 2XJ7A 1T8QA 3S6DA 3NFUA 3IK4A 4ZO6A 2GVYA 3H53A 5HINA 4PUMA 3WO8A 2YOCA 4XK2A 3GTIA 4DZ5A 5B7ZA 2V5JA 3LRLA 3GRIA 1G1YA 4DO5A 3AU2A 3CAVA 3E12A 4PUKA 4UQ9A 1P0DA 3HMJG 3TTSA 4JIPA 4V33A 3MKVA 4Z2GA 3NL2A 1KTBA 1V6UA 3W7PA 3R1ZA 3RK8A 2GK1A 2HISA 2VCAA 4G7FA 1U2YA 1V6WA 4M5PA 1Y5XA 4NY2A 1DBTA 2D0HA 4P7RA 1PX3A 2CETA 2PRLA 3CIVA 1YHTA 4DNMA 1WA3A 1VF8A 3SN0A 3KOYA 3ID7A 4V1YA 3NZGA 2Z6JA 2GK1B 5C70A 1B0IA 3TOPA 2OT0A 1HXJA 2FKPA 4MPQA 3UG5A 4B5TA 2ABBA 2ACSA 2WM1A 2AGKA 4DXVA 1CPUA 4NYYA 5BRBA 2Y88A 4LAUA 4ZA0A 3GVRA 4KEVA 2OZ0A 3LUTA 3ERPA 1YQ2A 3CUGA 1A5BA 3W6LA 3N9RA 4N9CA 1F76A 3NSNA 2X1SA 3FXGA 4CD6A 1LLOA 1Q6GA 3WH5A 3WDHA 3UY8A 4AAJA 4PB4A 2PWUA 2X7WA 2YXGA 4ERGA 2BXYA 3NZ1A 3Q4DA 4JS3A 1HTIA 3UXKA 2V30A 1JI1A 1UZ1A 3T40A 2W5FA 1NDWA 2QPUA 2OX4A 2XIMA 2XTKA 3PTMA 3GG0A 4UTTC 2FMNA 1S1PA 2G8ZA 3BE7A 2E9LA 3EWCA 4O17A 2EHHA 4W5ZA 1SJAA 3V16A 1W9VA 3URNA 4MWAC 2BOEX 5C7VA 1QNRA 1PZ3A 2PDWA 4Q7NA 4UZSA 3GIQA 4J5NA 4K8EA 3Q45A 1SW7A 3POHA 3FV9A 1EJWC 1EDQA 1M68A 1IGSA 2CLMA 5D38A 3R0KA 1Q7MA 2GPTA 2BGSA 2CESA 3UXDA 1KXTA 3EWZA 4KETA 4N9EA 3TTYA 4RNFA 2QGYA 3VNYA 4UTMA 2ACRA 3S9IA 1LQ2A 3EWUA 1B1YA 4L4LA 1UKPA 3LV5A 1HVQA 2J7BA 4JDYA 4Y2WA 4CD4A 3WH6A 1GPWA 7XIMA 2PGEA 2YZRA 5DLCA 4Z0SA 3QPZA 3QY7A 3VKJA 3E2VA 1E1CB 1FXQA 2ZVIA 3FGCA 2GGJA 4CVWA 5E6YA 4CD8A 1CB7B 2C1GA 5C9XA 1CXEA 1CXIA 4RNIA 2DV0A 3T0AA 2B81A 1W3KA 4L4OA 2RDUA 1LUCB 3FK4A 1MRQA 3FGCB 2Y85A 4ROQA 3VOCA 4I3GA 3VTRA 2VEPA 1QBAA 4ZMGA 4JTUA 3ABXA 5HNUA 4HJFA 3VZYA 2OLAA 3ZT5A 5CJNA 1KKRA 5CXPA 1FHLA 2QF8A 3EEZA 4AZBA 4YU1A 2VTFA 4P61A 2WWCA 1FWIC 3O8AA 4JHOA 1UH3A 2OGJA 4O0KA 2XM1A 3AZRA 4KFNA 4YWSA 1VPYA 3PUEA 3W1MA 4GVHA 3FHAA 1Z89A 1HKIA 3ZMRA 4RDZA 4I8YA 1KNWA 1UP0A 3MMDA 5EA9A 1V3JA 1J01A 3F1QA 2HV5A 4GLEA 3NOEA 4NT0A 3WK1A 3W07A 3U9IA 2ISWA 4AIBA 3NCOA 1KV8A 3M0IA 4LNYA 4D8ZA 3T1GA 3SFWA 3QXBA 3NL6A 1B3YA 1Q6QA 3QZ6A 1ZCCA 1OCQA 4AIEA 3NVDA 2JKPA 4FF7A 2FGZA 2HRWA 2B4GA 1JPKA 4QE1A 2R14A 3F2DA 4DWSA 5D02A 1LOQA 4HGXA 1E4MM 1UBPC 3A12A 2HDJA 3PPHA 3GUGA 3SRFA 1TX2A 4ATLA 4OBTA 1F3EA 4P7LA 4UR9A 1HF6A 4US5D 1OFOA 4O11A 1QUMA 3ZR5A 4DWSB 1O95A 4BQ3A 2YFNA 3MZNA 4MNJA 1KR1A 3GNNA 3NEHA 1EDGA 5HUOA 2OSYA 3HURA 3VD4A 4MKVA 4C6LA 4DBWA 1RQBA 4PTMA 1T96A 2NXGA 1TPDA 3L23A 2XFFA 3OVGA 1RQHA 3W7NA 1BQCA 2DPEA 2I9UA 2QZRA 3BCDA 1JL8A 3VA8A 2V8ZA 4MB3A 2VMFA 3SJ3A 3BOFA 3NQFA 3KLLA 3W1QA 4MYXA 4C90A 1ELSA 2WZEA 1XP3A 2J7CA 3F4DA 5G1MA 3AS2A 3FEQA 2V3DA 1X6NA 1R0MA 4TVDA 4JTRA 2JQXA 4IX2A 2FFIA 2XFWA 4AMAA 5HQMA 2YKKA 1F3XA 2A4AA 2YL8A 3W7GA 1YX1A 3ZFHA 2X0YA 2CFFA 2PDGA 3FKRA 4H4IA 3WNKA 2P88A 1XLMA 3VFCA 1GVFA 1K03A 1L8PA 4JQ2A 3AICA 1NOUA 4LVFA 3ICJA 3DG7A 1K7EA 1FY6A 1KBIA 5JUVA 1ZJIA 4C7FA 1EJXC 1QHOA 4CD7A 3W1RA 1R3QA 2X7VA 1SGJA 5H8MA 7TIMA 1DWGM 5BXSA 1FWJC 5DF0A 1RQEA 1P7TA 1XCFA 3K5XA 4ZEPA 4C1LA 3WD3A 2QIIA 4B3LA 2ZA1A 2VZOA 2PWEA 1E43A 3L9CA 4M56A 1KM1A 4IXXA 2PPGA 5DT5A 4WKFA 2TAAA 4UFLA 1P7TB 1M1BA 3VD7A 3W71A 3EZ4A 3WQCA 1QWGA 4LJ3A 4XBKA 3N2CA 2CBUA 4JTCA 1YLVA 4JX4A 3GYEA 1MFVA 3ES7A 4IUGA 2ZUMA 1AK5A 1MEIA 1X8CA 3FDGA 4ZO9A 2OX1A 1IEVA 5LNSA 1UASA 3E6EA 2D2OA 5EMKA 1V93A 4DVOA 4R33A 4GO8A 4O50A 3VVGA 3LTSA 1TJ0A 1VIWA 1XG4A 4Y6GA 2ZUTA 2BHYA 3TU9A 1HL9A 1CX9A 4DJFD 1SZGA 1RUSA 1WUEA 3MV11 3SJNA 4OOUA 4FXSA 3PWAA 4WR3A 1FWGC 4L9YA 5FAGA 3BLOA 1BD0A 3G1RA 2QDHA 4UQCA 3EYPA 4AIOA 4AZCA 4XZ9A 2C1IA 5DANA 3O06A 3TTOA 4GRSA 1F7BA 1IR1A 4PYSA 1GW9A 3B9NA 1AL7A 3ISIX 3GDLA 1JDCA 2FZNA 4Z1BA 5K9XA 3HV8A 2A6LA 3W87A 3IUDA 5AZ1A 3I4EA 2X40A 1NELA 4MOZA 2QDGA 4UQEA 1BWVA 3W2JA 5DMYA 3PF3A 3UESA 4PCTA 2CNCA 1PJ9A 3WEOA 2QJJA 5CSSA 5I3KA 4POCA 1M3UA 4UMAA 3CBWA 1GGOA 4HB7A 3UZJA 3PHAA 2A7RA 4CEUC 4N02A 3URQA 1GOMA 3AIRA 3KXQA 4H7ZA 4UZUA 5DMNA 4S3JA 1GYLA 3UFYA 3MO7A 4RZ6A 3CTLA 2PEVA 4GJ1A 4PL2A 3VKAA 5JBDA 4W8LA 2VT0A 1MO0A 2EKGA 1V03A 3QQ1A 5IDZA 1W6TA 2Z1WA 4EAMA 3LG3A 4U2ZA 1KCZA 1YXYA 2GUUA 3PTKA 1J12A 4WUIA 3TYEA 7REQA 3SEPA 1XBVA 1H0GA 4UTUA 3CUZA 3V4BA 1V0LA 3BG3A 2WVSA 4IFRA 1QHPA 2PE4A 4J40A 4MGGA 2Z7KA 3UYIA 2D23A 1H7OA 4PULA 2EKCA 2VURA 1IGWA 2F61A 3CV1A 3I7RA 1AH3A 3NTYA 7REQB 5ENLA 4J2MA 1AODA 3VYLA 3EDJA 3RCMA 3B0UX 4J3WA 4BJHA 5A1AA 1W1PA 3DESA 2GLKA 3ATZA 2E0PA 2VRKA 2WNZA 4MB4A 3LPOA 1EUNA 3AUJA 3DGRA 1CCWB 3S1UA 3TYCA 3KX6A 4GACA 2VP8A 3RPDA 4RZBA 3KL0A 1VYPX 3GM8A 1KRMA 3NQ6A 5H6HA 4RKAA 4ZZ9A 3UJEA 4HHHA 3C0JA 3N6HA 3HGOA 4LCSA 2J47A 3OLEA 3NDYA 2QHAA 1S2CA 3U7BA 1X8FA 2Z29A 5FIPA 2PBGA 2QQ6A 1YXDA 4HNOA 4LH8A 2YSWA 4KF1A 2J7FA 4V15A 3L66A 1IXPA 1UWSA 4PUUA 4NZJA 3S47A 2F2KA 3ARQA 3N34A 4CQ9A 2RAGA 3G1SA 3M5VA 4WZHA 3TJXA 4FF5A 4CQBA 4C5ZA 5HAOA 3SCPA 3SGZA 4MFDA 2ZRZA 4XZMX 4LS2A 2J74A 4LOCA 3WQ8A 5I79A 4NIRA 1Y7VA 2VX7A 2BTMA 1SR9A 3PY2A 3TE9A 4M0XA 5LNWA 4QQUA 5CGMA 5D05A 4U5IA 3LV6A 1X6LA 2OEKA 2ZBTA 5F2LA 1SO4A 4I9TA 3RU6A 4NI8A 4MJ4A 3O6CA 3PZOA 3UG4A 4E3TA 4FLQA 2QIWA 4FR6A 3ZWSA 1EGMA 1UWAA 3RNDA 3BV4A 1W3JA 3QGAC 5A6JA 4S3FA 1FDZA 3LBCA 2PDFA 3S2LA 1R47A 3GZ3A 4CLMA 5BWAA 4K7VA 4EP8C 2VFIA 5TF0A 3V35A 2JKAA 2B7NA 1OJXA 1XI3A 2Z1VA 3LU2A 1WZAA 4ZQPA 2QPSA 3M1ZA 1A49A 1CXLA 1NIUA 3MZ2A 1XL9A 1XYZA 4IMCA 4DNHA 1UKQA 2J27A 3W9ZA 3DFNA 1PKLA 1H5YA 4HN8A 2O7QA 3OBKA 3UPMA 2X09A 3W7QA 1N8WA 1GOWA 2YIHA 3U3HA 2J75A 1FHVA 4Q22A 3LCGA 2QAPA 3U2CA 1TVNA 3EEGA 4MWAD 4WXYA 4HNCA 3EXTA 3S5OA 3H22A 3M5YA 3LHZA 3N15A 2Z2AA 1JYXA 1CGUA 2I1OA 2J7HA 4A4AA 2A3LA 2Q3OA 5H2ZA 1CYGA 3BMVA 1ZJBA 5HNTA 4QCFA 2EQDA 3GFYA 4GQGA 5L6UA 3EMZA 1JCJA 3S9YA 1NWRA 1KCLA 4UFKA 3PBVA 4UTIA 4IH3A 4JOMA 2DZXA 4LYKA 1S5NA 1KFWA 2CLHA 3MUY1 5C9UA 3QC0A 3G1YA 4QEEA 5U7SA 1GQJA 3E0FA 1VR6A 2I9EA 2QVHA 2WZTA 3SZ8A 1ZAJA 2WZHA 2ZFAA 3DFOA 3GLCA 3UG8A 4ASTA 4D72A 3N19B 3BL3A 2B7PA 1QTWA 3I6EA 2BGQA 4BWLA 4GMEA 4F40A 2TYSA 1E6XM 2QCEA 4XBSA 2E5DA 4GYPA 5I3FA 2ZZ2A 4H2CA 4RLIA 1A53A 1J6OA 4QG8A 3AZTA 2NX1A 1ZY9A 1DTNA 1W2VA 1EJTC 4LAKA 1TQJA 2IS7A 1AQFA 3FDKA 5F7UA 1TMQA 1VHNA 1HJSA 1DQUA 4LB3A 3KVJA 3P8JA 3C3UA 2E77A 3CZEA 1SVDA 3GNDA 4UTLA 2YLAA 4CGTA 3A4WA 3GW0A 1SZEA 2WNQA 3GIPA 4O14A 4AY7A 4X3ZA 2GGIA 1HVXA 3RLUA 2FVMA 4H04A 2W3ZA 2J8TA 1W9PA 4CQDA 2O0TA 3G1XA 3HPXA 1BGAA 1TE6A 3WDJA 4CQCA 1E71M 7PTDA 1QMLA 3ARRA 2BFGA 1CGVA 2X2GA 4IMEA 3VIMA 1EBGA 4HPXA 3VU2A 3H7UA 3HO8A 4NUWA 2VXNA 2Y7EA 3ZJ6A 1QNPA 2Q09A 3LTPA 4LUJA 4E8GA 1XLGA 3WUBA 4KRZA 3DKLA 1XR2A 4AQLA 4JHMA 4XD6A 1DHKA 1ZCOA 8XIMA 4PB3A 3M46A 3KOWA 4HD5A 1T7LA 4J7RA 3AWOA 5I00A 3KVKA 3CUFA 3FAWA 2E8YA 5AYIA 3WIJA 3XINA 2BVYA 1ALDA 2ZE3A 1BTMA 2UY5A 5AN7A 2EG8A 5A8QA 2JEQA 4G6CA 1A5CA 1V79A 3ITXA 1ZJAA 3RITA 5D32A 1JUEA 2BHUA 4IL2A 2YYUA 1TWIA 4W4QA 3RPTA 3PZQA 3ZT7A 3VXGA 3O7UA 5CBIA 1QK0A 4O54A 3OZMA 1RD6A 5CBBA 1WE5A 2Y89A 3N4EA 1OYAA 5E9XA 3H21A 4NNCA 3G1HA 1RPXA 1C3FA 3STGA 2XVLA 4LFYA 5KZMA 3VDAA 4IFKA 4EPEC 5E9AA 2WOQA 4ZB0A 3ANVA 4NAFA 3DG3A 4ZR8A 1VFOA 1ODUA 2YXXA 3SW6A 4WY0A 4PRTA 1BXBA 2PWDA 3OZPA 5K9CA 1NU5A 3G3DA 5HJYA 1WDDA 2OG9A 3TQPA 1XXXA 3ENLA 1SW0A 3CK5A 4L1WA 1W56A 1OYCA 5FD0A 3CL8A 4NP7A 2NSOA 4NAFB 1UOKA 3AMDA 4WY0B 3DC8A 5I06A 1B9BA 4MY9A 3OLDA 1R9ZA 2C0AA 1QAPA 4HNVA 1W91A 2FLIA 1AD1A 3V0UA 1PE1A 1AQHA 3W4RA 4IPIA 2O4MA 2OB3A 4PN2A 5G1TA 4CQAA 3H70A 3VNDA 3W23A 1YTDA 2R1NA 1HIZA 5FEPA 2JGYA 4I9AA 1VEMA 3QRHA 3BQ6A 3K4WA 4RX0A 4GI9A 4A6GA 3KOFA 4PCPA 4B5SA 5BXPA 3ES8A 3PB0A 3RM8A 5FCZA 1RA5A 1W1IE 4MTVA 5DN1A 1L2UA 1SJCA 1PDZA 1T99A 4LANA 1BKSA 3PANA 2J7EA 3MQTA 3DKJA 2NUYA 5CPQA 3M44A 1V0KA 3UA4A 2E40A 2AKMA 5FF7A 3LHWA 3CYVA 4IG2A 3STFA 1JEZA 2PA6A 3ME3A 1ADOA 4E4UA 4NXKA 2VI0A 2J9ZA 3L4VA 4RL3A 2CCRA 3LZ5A 4W5UA 1XUZA 1SW3A 2FMOA 1BYCA 3ALGA 1WZKA 1MSSA 1XIDA 3ABZA 4J3XA 4RR4A 4PRRA 1FFQA 1QI3A 4JYFA 1VJZA 2FGBA 4LVAA 3NPVA 3HQPA 2WSPA 2HNEA 4H8UA 1DQXA 1V4YA 3E0LA 3S2NA 3GVVA 4EX4A 1FWNA 5C2GA 1LL4A 2HWGA 1PYFA 4Y90A 1KRCC 3S2MA 3PSVA 4IP4A 4WY0F 3W86A 4MWAE 2OCZA 4O52A 1WAWA 2JIEA 1B90A 3WLTA 1OQFA 2VEIA 2FJKA 2YDAA 2RJHA 4N4QA 2BGNE 1OG6A 2QMKA 4MSSA 2TRSA 1JD9A 2GJLA 2XM2A 1BLIA 1IZJA 1XKJA 5LNUA 5PTDA 2J79A 3B9DA 1Q45A 7ODCA 2QKFA 1NF7A 4GPNA 1GOQA 2PTXA 3SIMA 1S3HA 1XD1A 5I3HA 1AJ2A 4M6UA 2FFCA 1M65A 1SZFA 1JGMA 1OCNA 1U5HA 1X1ZA 5J5RA 4H8VA 1ONEA 1PIFA 2W4XA 2YCIX 1NWTA 2Y2WA 3ZOAA 2X0HA 4M3PA 1X7IA 3IV3A 1DL3A 4FALA 3LY0A 3M0HA 4G9PA 3WLNA 1TPFA 2P1FA 2KZHA 2Y8UA 3VIFA 3IGSA 2A7PA 3QY6A 5C2CA 2ZXAA 1NDVA 2E6YA 2ISVA 1D3HA 4IUOA 1EJRC 2DT1A 3B8WA 1GQKA 2ZX9A 2J24A 1ONWA 3MPGA 3EGJA 1BGGA 1Z7AA 2ZRXA 3O16A 1E1EA 5D9MA 3TW9A 5C71A 2WMHA 2GSEA 1EO7A 5FESA 3EOUA 3RR4A 2X0SA 2X16A 5AFDA 1B3ZA 2D0GA 1VLIA 4LUIA 3A4XA 5K7JA 1I1XA 4AWTA 1TCMA 1XHGA 3CZ8A 1IEWA 1GONA 4JN8A 4JFWA 1E51A 5AC5A 4NJJA 4S3AA 3SCRA 1CGYA 3SN1A 3U5UA 5DELA 4WDXA 2VDHA 3ITTA 1XD0A 1VFTA 3LEPA 3B0PA 5BMWA 2WVVB 2QJNA 3MUAA 4REQB 3TVAA 3IJDA 3GDMA 1UZHA 1W9DM 4O1DA 1YRRA 1OFRA 2X41A 5HPOA 3MHFA 4GVFA 3KRBA 1W1VA 1VPQA 3LPGA 3NZRA 3WLHA 4CNTA 2WHMA 2CKSA 4C6PA 1TTPA 3WF3A 1SM9A 3VDGA 2AOSA 5FJUA 1E56A 3CQHA 1NEYA 5FJRA 3T4CA 1HW6A 2OOFA 3QBUA 3GTFA 3KFTA 1UB3A 2ZX7A 3M64A 1JGIA 2WYSA 3QKZA 2V67A 3N18A 1TVPA 3NUKA 2GUBA 4Y7EA 4C7GA 2XSBA 3PZUA 2VC7A 3FYOA 1BYDA 3M5XA 4NSBA 4GQQA 5JH2A 1JCNA 4L61A 3WY1A 4UQDA 3TUUA 5A8NA 3W85A 5AVNA 4C6MA 3QR0A 5I6SA 1XW8A 1UYQA 1ZNNA 4HK5A 1R7OA 2HPMA 4DLFA 1LBFA 3OVPA 3TSBA 3RG6A 4PBEA 4AUBA 4RNHA 3BDKA 4GK8A 1SUXA 2OEJA 4HYVA 4JTTA 3T6CA 4DWDA 3PUDA 4IP5A 5GNZA 2RDWA 2VCCA 1IHIA 2E1DA 1RALA 3E0WA 3RLVA 3AJXA 5GPRA 2P3ZA 2DY3A 3A3XA 5TIMA 5FJPA 3N73A 2GDQA 1R8LA 1PCWA 3USBA 4BEQA 3AIEA 3NPXA 3W1PA 1UKSA 2FDMA 4F66A 2BLEA 1FWHC 2J7GA 4XZHA 5AB3A 2WMIB 4A22A 1Q66A 3U5YA 3RHGA 3FKKA 1RV8A 4JTAA 2OPJA 2VR5A 2V69A 4FNQA 4OQVA 1E0UA 4QE5A 3UWZA 4YCOA 1A0CA 4PCNA 3LNMA 1UR0A 2YBTA 1RK6A 2E5CA 2WC7A 3EKLA 1H0IA 3VX0A 4FNTA 4B15A 2C1HA 4DM1A 3GU1A 3WLIA 1CT5A 1A47A 2YW3A 1PTGA 1CEOA 3T0BA 3T05A 3FW6A 2ZOXA 4RXGA 3V5OA 5I7GA 3AIQA 3UWQA 3GXIA 4Y9OA 3OIXA 5I78A 2WAGA 3T4WA 3HMCA 5ECVA 3KOXA 3AYSA 4DUOA 1IEIA 3UCCA 2HTMA 2IXVA 4NRSA 2CLPA 3PNZA 4PRWA 1XRSA 3W37A 2QDDA 1O66A 3L67A 2H90A 1FWBC 1TSIA 2ISSA 2QCDB 2WPBA 1BEUA 3N4FA 3GXPA 1F3WA 4FMVA 4KWVA 1EJSC 2XG9A 1GT8A 3ARTA 2W27A 2HJPA 4H6RA 1VCGA 3R12A 4AC7C 1XINA 1XJBA 1GCYA 1SU5A 4O28A 2WLZA 1VYRA 1LWHA 4KERA 4XZIA 3QPEA 5ABTA 2WBGA 4HCDA 5F4WA 2GQAA 5CPMA 3UR7A 1J5SA 2ZUWA 4JFSA 4ZB2A 1MDLA 3TA9A 1FVPA 3MP4A 2NQLA 1TZZA 3AOFA 4GZEA 4NQ1A 1BKHA 1KFBA 3GSMA 5C6MA 1KKOA 3JZEA 1Z48A 1W1A1 3BAIA 4QTGA 3VOIA 4ZVJA 3WLKX 2A3BA 3L0NA 3KZSA 3N11A 3L68A 4ZOCA 2E28A 5A6BA 3KL5A 1LG2A 2WCSA 3A9IA 1EF3A 5DT7A 3MBDA 1GTEA 4ZSUA 1TZ9A 3EA2A 5LGXA 3LHUA 4Y96A 4PTXA 3H23A 3NIYA 7CGTA 3GFXA 2FZDA 2FPTA 3RX2A 1P1XA 1SYTA 4GXMA 4Z1DA 4X9YA 4GFSA 3TZNA 4KWSA 2EEXA 3QV7A 1Z6KA 4LRSA 3DI0A 4J3UA 2HMCA 1M01A 3WENA 4GZIA 1R2RA 3H7VA 5GJMA 4KCUA 1MUCA 3P81A 4H3DA 4K1GA 1E15A 4QAIA 1R3YA 4OGZA 1TE1A 2P0IA 2Z27A 2R91A 3O6YX 3RCYA 4V2XA 1M04A 1KM2A 3TFCA 2ZXDA 1KC7A 4DJDA 2ALRA 4LS0A 1VBGA 1KGXA 3PZMA 5CZ0A 1EBHA 4B9YA 2Z0IA 4YHEA 2PI6A 1N82A 2PWVA 4YCPA 2NZLA 4ADTA 1LL6A 2QF7A 1PX4A 2DU2A 2NT1A 4L6HA 1XLJA 1F5ZA 2R1KA 2NV9A 3STEA 1RJRA 3F4VA 1R6WA 1OFPA 5G4WA 4MLJA 5JQ9A 5MKGA 1A3XA 2G3FA 4YNGA 3AMGA 4ENLA 1P1MA 3ZJ8A 1WDRA 4Q4PA 1K6WA 1X98A 4IGNA 3TW7A 3LCIA 3CGTA 4RK8A 5AHLA 3UWEA 3MYPA 4LV4A 1FDYA 1AH0A 4LF1A 1R38A 3OLIA 3A3HA 3R94A 2PGWA 4K39A 1W3IA 3PTQA 4GHRA 1Y5VA 4EANA 4S3DA 3FX4A 1V8EA 5CCZA 1AUSL 1ITCA 1DWAM 4CCZA 4GNVA 1J2WA 2ZDRA 1TG7A 1YADA 3M0KA 4ORIA 2H8ZA 2PU0A 1EOMA 2VZVA 3OLGA 4UR7A 2DZUA 1YMYA 5REQA 5A8PA 5A8MA 4C91A 4HSHA 3P7YA 3R89A 1IWBA 1V7YA 3P82A 4FZIA 1ISXA 3P80A 1E1FA 1JUBA 1UIOA 3CIWA 5REQB 2DORA 1KBLA 1PV8A 2RUSA 2YGYA 4AEEA 3HJEA 1E4NA 3C2EA 3IGUA 4O18A 4UR8A 2CBIA 4JEQA 2OFJA 3VDCA 4E2BA 5A95A 3OP2A 1E70M 3B8IA 1CGTA 3PULA 2WKLA 1T8XA 5CC5A 2ACUA 4H9TA 5KITA 4GX8A 4JR5A 8TIMA 3UQNA 4GNKB 3O07A 1LG1A 4LU0A 1XLFA 4IL0A 3U4AA 4NILA 2Q6ZA 1W17A 3WELA 4R9OA 3WLQA 2P3EA 2NWSA 2IKIA 4YWIA 4M6QA 4BKNA 4IQDA 3VGHA 3RR1A 3JU2A 1J8VA 2QW5A 3EOSA 5ABGA 4MJ2A 6PTDA 4CKQA 1JXJA 3FEMA 2QS8A 4H6KA 4GINA 1F74A 3VNIA 1XDLA 1FQ0A 3KDNA 1Z69A 2WCGA 4PSPA 5D9PA 1A5UA 3LRMA 3HQ1A 4UOJA 3TP4A 1H62A 2GQ9A 5C7HA 2XZ7A 3FNDA 3IS4A 2R6OA 1TUFA 2G50A 2PTYA 3N2TA 3KWSA 3T09A 1E5NA 3HN3A 3UF9A 1QPKA 2DT3A 4ZB5A 4O57A 3VE9A 4H6EA 3UT0A 1RA0A 1WDWA 4UNIA 3RYSA 2Z7GA 1KLZA 4ZXOA 4D1JA 1XBYA 4BF7A 3HG4A 5JXQA 4LUSB 4YVXA 4C6QA 3NR0A 2Q8XA 3MI3A 2V9DA 1I8JA 5AZ0A 3T8QA 4BI6A 2CZVA 4U31A 6TAAA 3UR2A 1EGZA 4CNNA 4AF0B 3W74A 4S39A 1UD6A 4AZHA 3KL3A 3VCNA 1P6BA 1QO5A 5F4XA 3DU0A 1Z44A 3IEBA 4QQ3A 4PGLA 2BWGA 4O1BA 2D0FA 2DUZA 3AXHA 4F4RA 4C6EA 3C0LA 3EX3A 4I6KA 4A2SA 1YW1A 3C2RA 3E38A 4ES4A 3TX9A 3E5BA 4JPGA 1OGGA 1OY0A 5D09A 3HPSA 5C8BB 2WVTA 3BO9A 4XKYA 1W3HA 1CZ1A 3CAQA 1W2PA 3BARA 1O1HA 4NX0A 5HJLA 4DPQA 4YVVA 1Q6CA 2RH9A 3BSGA 1UR2A 4L5ZA 4N9BA 2BX7A 4IF2A 3LERA 4E8CA 3CHCA 1I6NA 3W2LA 5A6KA 3O63A 4GIRA 5C54A 4FX7A 3DHUA 3W83A 1EFZA 4HU3A 4D6EA 4Z1AA 5TBOA 1JZ6A 4O1AA 4H8HA 3AHYA 3KHJA 1DWFM 4BQ5A 2PF0A 5EY5A 3AHTA 4YYFA 2EBNA 3PZTA 1K4HA 3I10A 3TQ0A 3K8MA 1UWIA 2OZTA 4A35A 3VINA 3ABRA 3V3WA 5BOOA 4IIHA 2AL2A 1A5SA 3T07A 1GOOA 3LHYA 2JEPA 2TSYA 3W7IA 3H55A 1TV3A 1ZP4A 3CMFA 1DIEA 3FXYA 3AI0A 1GVYA 1M53A 3B9AA 1Q6FA 1IIHA 4US6A 4J3SA 1EH9A 1ZBCA 3OGSA 1AZ1A 1V3IA 2AL2B 3AC0A 3DZ1A 1ZBKA 3QH2A 4QROA 1FWRA 1OYBA 3BJFA 3DFPA 3VOHA 3K1GA 2AAAA 4HBKA 4G2DA 2D2JA 2EPNA 2ZZ6A 1V6TA 3VDHA 4FX6M 1XQKA 2CBJA 3NSXA 2OKOA 1ZB5A 3KOZA 5HWMA 4D6CA 2DJXA 8CGTA 2PDBA 4AVOA 4AZ5A 3HB9A 1CBGA 1E73M 1IE7C 3PJUA 1WX0A 1E9LA 4XD4A 1N7KA 1J0IA 2J25A 4FPSA 4D6JA 2FVKA 4AEFA 1CB2A 3ORWA 4ERAA 1RCXB 1TREA 1EJUC 4R7WA 2INFA 2CU0A 2VDIA 4MB1A 2FZMA 1C7TA 2HROA 2VUNA 3TH6A 1XIJA 4QR6A 1PKNA 1ONXA 4LAZA 2J66A 3RO6A 3O6AA 1O1ZA 3QFEA 4FNPA 4DF2A 5DQPA 3HV9A 3GKFA 1U5JA 2ISDA 4JD4A 3TLQA 2E25A 4DO6A 4MNKA 1ICPA 1QRQA 3B05A 1IV8A 2QULA 1JIBA 1UUOA 4HA4A 2CHRA 2Y5EA 1JDAA 5K9DA 3COTA 4JX5A 3DECA 1Z9AA 2Y24A 2XYLA 2XINA 3B8DA 2G97A 2PDJA 3QTPA 2P53A 3E0IA 1JDDA 2D2HA 3SADA 3BUVA 5KZEA 4IMGA 1EC7A 3UU0A 1V3MA 3USZA 2ZYFA 5EU9A 3BCFA 2UY3A 1PB0A 4YMZA 1TIMA 4GJIA 3OQ8A 3TZFA 1XH1A 4FIRA 4M6PA 2QYGA 4EPDC 3CZKA 3NVTA 4X22A 2BMBA 3B9OA 2QMJA 2CITA 2FB2A 2ZZ3A 2C91A 1XGZA 1E3ZA 3SR7A 3CJPA 1JZ5A 4UFMA 1OGSA 4O1FA 4GC3A 5AY7A 1IZKA 1EC9A 3D6NA 4E3VA 1BWKA 5MHBA 1IEQA 3OBAA 2I7GA 2C3ZA 1XG3A 1VEOA 4HHMA 4Z2KA 4RPQA 2PLJA 2DVUA 3TV8A 3VILA 4XZWA 3SCQA 1ME9A 3T0CA 1HNYA 3WF1A 2WVUA 2DJLA 2WMGA 3LHTA 5LGZA 1HP5A 4FEZA 3VNMA 4GC4A 5HNNA 1SSDA 3MANA 3FHQA 1L6GA 1N8IA 4K36A 1C8VA 2G4FA 3V7PA 4RPPA 2OKTA 3CWNA 1JQXA 1ZSXA 3T78A 5J04A 1SO6A 3G1FA 1XGEA 1MQPA 2W62A 3B0YA 1E72M 4P2VA 4HHLA 4QJ5B 4R3UA 1LQAA 1UA3A 1WXJA 2X1TA 3U2ZA 5AYYA 1RHCA 4GI4A 4WXZA 3IJ9A 4Q6JA 1DJXA 1QW8A 4NJHA 4D2JA 4DJEC 4MZYA 1GYNA 4TXEA 3QMRA 3W70A 3W7RA 5A6SA 3W84A 3I3DA 2V5CA 1B3WA 2XU2A 4AEOA 3T0DA 3S1XA 2EGZA 5M5DA 2VR2A 3TJIA 3BLKA 3MVTA 3FN9A 1PCKA 4WJXA 1KBJA 3H54A 1V51A 5T9CE 4EF9A 1WKEA 2QV5A 1C29A 1ML1A 1SFJA 4JTLA 4AY8A 1DJNA 3OA5A 2VENA 3CL6A 1VBUA 2DSUA 2V2HA 3W88A 4F9DA 4NRRA 4IWWA 2QCLA 1JULA 3BGGA 3W2NA 5M17A 1VJIA 2X42A 4LGXA 1YTKA 4BI7A 4Y9AA 4XIMA 3VKBA 3MWAA 3VNZA 4IZGA 3U2EA 3M0XA 2HXUA 3W7DA 1EF2A 3C0SA 1Y65A 2H6RA 3VIKA 1XBXA 4XAFA 3QOKA 1EQPA 1K9TA 3FVMA 4XWUA 3SSZA 4NHVA 1Z42A 2V68A 4XSMA 1ZJHA 4JIEA 3CH0A 4DX3A 3LLXA 3AXMA 2FYMA 1GG0A 2BY2A 2WCAA 2J77A 4AISA 4CN6A 1O4UA 2OJPA 5LZLA 3OHMB 4C60A 1ME8A 4X63A 3F7JA 3QYQA 2VZSA 2E1WA 1SO5A 3TK7A 3KLKA 4Q4SA 1HKWA 3GUWA 2A79A 1WQ5A 3LENA 4FXFA 2DGAA 2GJRA 1G67A 4JY9A 4ZE4A 3ITOA 3EDDA 5K4XA 6XIMA 1W9XA 3VM7A 2VX6A 1GEQA 2WHKA 5AYXA 2PDXA 3W72A 2F9RA 1RBOB 3WMSA 4NL1A 4ICNA 3BZJA 4H6QA 4O53A 1QFEA 2H3DA 3EDEA 1CIUA 4Q32A 4LCQA 1Q4WA 4U10A 1EWEA 1ZALA 3VC5A 1Z8AA 1J4EA 1S5VA 1LWJA 3CLWA 2DSKA 4AD1A 3VM5A 3T0TA 3L2LA 1UWQA 4ZO8A 4XD5A 4C1NA 3VIHA 4GUJA 3A22A 4OT7A 1Q4NX 3BG5A 3IIVA 4HZ7A 3F5JA 3PZNA 1TO3A 3ZJKA 4NZFA 5A2CA 4PMNA 3QR3A 1CDGA 4C1NB 1FKWA 1EUAA 3SUUA 5GQBA 4PUDA 4L56A 4P7QA 1LRTA 4JAWA 3N2MA 1EDTA 1SMAA 3M0ZA 5JMUA 2IPGA 2XVGA 4LVBA 4CUCA 1M7XA 1OC7A 4L80A 1O5XA 1WZMA 4QDPA 3NDOA 1E9YB 1EX1A 3VCCA 2QJMA 3VABA 3W26A 1TVLA 3F2CA 3L2IA 3MI2A 3IVUA 5U4NA 3LA4A 4CNPA 3IPWA 4Z2JA 7TAAA 3PJWA 1BYBA 3E1F1 3DI1A 2WSRA 2D69A 2GUYA 3ZVHA 2I56A 4GVGA 3TAKA 1XLCA 4AWUA 2FGLA 2GJXB 1DWIM 1AH4A 1PZ1A 3LYEA 4WSHA 3TN5A 1A4LA 4FOUA 4JNYA 2C19A 1W31A 1XS2A 4D9PA 3HU7A 2WC3A 3F4NA 3ZVHB 4GJJA 1R5YA 2KAUC 1E6ZA 1DKWA 4YTTA 1D3CA 4Y8EA 3PJXA 3GC2A 5G4EA 2WC4A 2AQWA 1KXHA 3S1WA 3M5ZA 1HJVA 4YVPA 4FNSA 4JDBA 3WLOA 4ZL1A 3AYRA 3M0LA 1KM3A 1RD5A 4DN1A 4HT3A 4F0RA 1W3LA 4PZVA 4AHPA 2Y4SA 1C90A 3EOLA 2J9XA 3MB9A 2GQ3A 3PWGA 1TTJA 2Q3RA 4HZ6A 3GD6A 4OOZA 3W25A 4S2CA 2J13A 1DHPA 4JFTA 2WSQA 4ZBCA 3P62A 4QFUA 4RDWA 2QUUA 3UYCA 3IJLA 3MP5A 3R0UA 1E40A 1GVSA 1TELA 2R82A 3L7RA 3IAPA 2FIQA 3SDOA 3PN8A 1QOXA 1VQTA 3E2RA 2XVPA 2ICSA 2GGHA 1ZHAA 3EMQA 4FAMA 4B16A 2G3JA 5A2BA 3D47A 3MWCA 5GJPA 3V5CA 5FF2A 5LNVA 5CC6A 1HKMA 4MPKA 4FK9A 3QY8A 4IIGA 4QSFA 3FJ6A 1WBJA 5CPNA 1UWUA 1SMDA 4NVTA 1KD0A 1G4TA 4HOXA 5FSEC 4EOUA 5I03A 1HL8A 3REQA 1TPC1 4I5XA 1OFBA 3DBPA 5HUPA 3VGGA 2AMXA 2WKGA 4WRHA 2D24A 3MS8A 1XRFA 2XIQA 4LS1A 1DVJA 4Z17A 1P0KA 3SAZA 2GQ8A 2B31A 5CQ1A 5E1QA 3REQB 5C55A 2VQTA 2JIWA 5HWNA 2RJGA 3VGFA 3S83A 1DJIA 5EBAA 1UH4A 3W1NA 3BJTA 2OEMA 1WDSA 2XH4A 3B40A 4IIDA 4XVDA 2YLLA 1CGXA 2Y6ZA 3D3FA 1ZS2A 4GY0A 1JCXA 4XKMA 4UTFA 3EOOA 5XINA 3RU8X 4L4MA 1D3GA 1K4GA 3B4UA 3CO4A 3IRDA 4JKMA 1Q63A 2OQLA 1XV8A 4LUYA 3KUMA 1MNSA 2OOGA 1UKTA 2XIIA 4GKLA 3UNDA 3SCUA 4XD3A 4D6GA 4F0LA 1R86A 3RJXA 1LOLA 4M6VA 4KEMA 3G6LA 1PAMA 4GO9A 1RJPA 1WYIA 1ZRQA 3QEZA 3CZLA 1Q65A 4RE4A 3GG8A 4LPCA 3TCEA 3W7OA 3CWHA 3A5VA 4K38A 4PUWA 1NQ6A 1QK2A 3Q65A 4XZBA 3UNTA 1JPDX 3SUVA 1TFVA 2QJIA 1I60A 1FRBA 3GBDA 4LUTA 3WNMA 3IK2A 2UBPC 3INPA 4AMCA 1GVEA 4KGJA 1XLHA 4UC5A 2YW4A 4ZSTA 1YBQB 2WK2A 5BMXA 2DT0A 4WLCA 3WQ5A 3M07A 4OTKA 3S6TA 2QLYA 4ACZA 2PDKA 4OIFA 5BYWA 1J0KA 1XDMA 4LUTB 1A50A 3PS7A 2KX9A 3SCVA 1R87A 3UR5A 3M0JA 1NM9A 5HMEA 1RR2A 3L0GA 4I5UA 4H9XA 1OINA 4OV9A 4DF1A 4UIOA 1R9YA 1TPEA 3S5ZA 3SCOA 3VD3A 1DXFA 2HVOA 1FWSA 3LPFA 4IJCA 3THAA 2ZQ0A 2Q02A 1BF2A 1TPUA 1O5KA 3CASA 4E2DA 3CC1A 2ADAA 2R8WA 1GJPA 1H49A 1NVMA 3WDIA 2YCEA 1BSIA 1S5TA 3A5FA 1GOKA 2Z26A 1PKMA 1XYFA 3ZLGA 4A3HA 4OE7A 1MQRA 2W63A 3N2OA 1UJPA 4WDTA 1R30A 1UR8A 3QN3A 4HIBA 4ATDA 5FSDC 4H7VA 1J93A 2FTYA 1E0TA 3W2UA 3WFAA 1U1JA 2JF6A 1UWTA 1H7PA 5BW6A 1TPVA 1VKFA 3VI2A 3DHDA 5LIKX 1FDJA 4PL1A 1FHUA 1ADSA 1MNZA 3MV01 1HT6A 1WXYA 1ICSA 3TN4A 1GORA 1HN1A 3C86A 5D4YA 5D37A 1C9DA 2XIJA 3FJ4A 3NG3A 4L9ZA 1S2VA 3H12A 1E6RA 4R85A 4KT2A 3W24A 4G7EA 1IT8A 2GZXA 3UETA 2CZFA 3VOJA 3WQ6A 3EXSA 3ZXWA 3NDZA 2YX0A 3MDWA 3H6OA 1EPVA 1GOXA 5T26A 2CZ5A 3WJSA 4Y9PA 3RFAA 4G7EB 5T8GA 4OFCA 5J5DA 4U5KA 4JTKA 1K7XA 1Q3NA 4AXKA 3QMSA 3TYAA 2FTWA 1XLIA 8XIAA 1QATA 3NJ3A 1WKDA 2WZMA 4IPNB 4RZ5A 4LY8A 4Y9NA 4ZE5A 5EFDA 5EMUA 1WAUA 4UFHA 3F5LA 1GQLA 3KCLA 1G4SA 3R0DA 4GY7A 4MNMA 4QBXA 1YE4A 3SO7A 1Q7ZA 4Q4RA 4A2RA 2ESCA 2WW5A 4RNJA 3LCFA 2Z1KA 4IP7A 4ICCX 4WEVX 1TIWA 1MEWA 3NXLA 1W5MA 3N6QA 4A21A 2CERA 4HSNA 4DJED 5IFPA 1TJRA 1U5VA 1EP3A 2VRJA 3GTNA 4MY1A 3OIHA 2C16A 1UR9A 1SZRA 3ARYA 2H9AB 1S2WA 4R9XA 3GH4A 4PCFA 3CIXA 4AG0A 2ZX5A 1S5MA 1FWEC 2V81A 3PPCA 2D3LA 2EAWA 1O12A 2RDXA 3BICA 1J5TA 1KFEA 4OBSA 3GXTA 4AD0A 1B30A 3TC7A 3VUSA 4O19A 4BHYA 4TX6A 2GSHA 2FHCA 3LMZA 3QV8A 3W7JA 5MF5A 3VOGA 2B7QA 1E1CA 2NXIA 2ZVRA 3BGJA 2Z25A 3BPWA 4GYKA 1OG0A 3FSUA 4M1RA 4A3UA 2I5GA 3UJ2A 4RV8A 3W1TA 1CXKA 5D33A 2X8RA 1F61A 1LUCA 5JIWA 3PSWA 3C3NA 1VBRA 2VVSA 2VNCA 4UNKA 3UWUA 2C7FA 4DUXA 2GGGA 5F2IA 3TQVA 3O3RA 7ENLA 3LCLA 4US5A 5FJTA 4GGBA 4CCEA 2PGFA 4C5YA 1R3SA 1H1ZA 5I24A 3PBYA 4FB7A 3UJSA 2FHFA 1FUYA 3SCSA 4INFA 2DH2A 2E8ZA 3S9ZA 3WH7A 4QG6A 3MSGA 4PMYA 4IMAA 1NP2A 1GUVA 4XTIA 3CB8A 9XIAA 1Q6LA 3CMJA 3E96A 3DX5A 3ALFA 2XGBA 1YKWA 3MUIA 1LLWA 4KS0A 1FWAC 4M24A 4YIWA 1VRDA 3WNPA 5E0CA 3OBEA 1C8XA 3E2QA 2DVXA 1LOSA 1H11A 3F4WA 4Q8VA 3WQFA 1XSKA 4GA8A 1T6MA 1VGAA 3MCMA 4TOQA 3W1AA 4D6DA 3PJTA 4V28A 1A5OC 3WUFA 1RZMA 2OTDA 4LBRA 4LEQA 2UV8G 1HZYA 4W93A 3A23A 3JRKA 4J3ZA 4RJEA 1TWZA 4IISA 3CS2A 4M7TA 3UWYA 4EK7A 2PFHA 3NQCA 1QNOA 3OVRA 1O6IA 4H9VA 1H1NA 1U33A 3R5EA 3WJXA 5AVHA 2IKGA 2CBVA 3SQMA 1WXZA 1VP5A 2P8BA 1A5KC 1OABA 1ECEA 4GOAA 4B90A 4M82A 3UXAA 4WSJA 3P61A 3MSYA 3S46A 3HIJA 2V5LA 1UPPA 3P74A 3BLPX 4UTWC 5EPDA 3LOTA 3LCXA 4Y9MA 1MXSA 2ZTKA 3E5PA 4YL2A 5CLWA 4HZMA 1E55A 1K70A 3Q2DA 4YHGA 1DQWA 1W1ZA 1C91A 3NM1A 1EEPA 1FCUA 2XVNA 4YN5A 3E3HA 3YPIA 4PEKA 1P43A 3VX1A 4JTJA 3S5YA 4A05A 4MG4A 5HNRA 1F6KA 7A3HA 5HR6A 3GWQA 4QLLA 2WKJA 2C79A 3XIMA 4L1XA 3TSDA 3FIGA 3PPGA 4LEFA 4OVXA 3WQPA 5IBXC 1RVKA 3RLHA 4XZLX 1LWIA 1XCXA 3CT7A 1K8ZA 5HANA 1PZ2A 2FH8A 2BODX 5T9BG 1WZLA 2A85A 4Q8NA 9RUBA 1LDCA 4JNZA 3N25A 4JZ5A 4HA1A 3BGAA 4GIAA 2MUCA 1TPWA 3THUA 1RVGA 1H7WA 2ZUSA 3GDBA 4BK9A 1JF5A 1KXQA 3VOFA 9XIMA 4FR1A 1XLEA 3PR2A 3S2JA 2BVWA 4EAYA 1W54A 4O10A 4UTHA 4GI8A 3R79A 3KRZA 4AC1X 3ITVA 2A3HA 5H8UA 3UCDA 2NXHA 1DWHM 1OHLA 1GNXA 1WV2A 2G41A 4JX6A 1FWTA 4KKXA 5AHFA 5IRPA 3S42A 1TWSA 3FA4A 1UA7A 1ISYA 1KLYA 1LM1A 1GKQA 3PZ9A 3FJLA 3CQJA 3TYBA 4LF2A 4QG9A 4LXFA 1QPQA 4DBSA 2IKHA 3TA6A 2PP1A 1Q6DA 3NQAA 5M2FX 1KWKA 1UMYA 1JRBA 3QKEA 1GQIA 3H2MA 3WLPA 3NURA 4D6HA 4H01A 4HP5A 3WF4A 1G7UA 1TRIA 4JIHA 5DXYA 4L65A 4M19A 4O12A 5XIMA 4D1IA 2CPUA 1O5RA 3W7EA 1CNVA 4LSBA 4O4VA 4IGHA 3RPMA 4WVXA 1B9ZA 3QZEA 2PDHA 1CECA 1M6JA 4LYPA 1UC4A 3C0QA 1LF1A 3B8VA 4R5EA 2GDUA 2J4GA 3CPUA 1KW1A 4H1ZA 1CXFA 3RXZA 4DO4A 3RN6A 1CLVA 2VFDA 1OFDA 1Z3NA 2INEA 1GKPA 3OYXA 2F6KA 3L5MA 4EVZA 3QLLA 1DIDA 3LB0A 4FXRA 2CLIA 5EL1A 3CUIA 2VM8A 3TJ4A 3NQ7A 1DJWA 1QOQA 1OZQA 4QS5A 3TWBA 4QLKA 5D30A 5A8OA 2EPMX 2Q8LA 1IXNA 3U4FA 4IIFA 3RGTA 2ODOA 4GD0A 4OWGA 2A0NA 4Z2HA 3V1HA 4HNNA 1UIPA 5KZ6A 2F8QA 3T42A 4HPJA 3BAKA 1AMKA 4K8GA 4B4FA 4DBEA 1L0PA 3LTYA 4NF7A 3MC5A 1JPMA 2TPSA 1E0VA 4HVXA 3TSMA 1ZAIA 1FKXA 5KZDA 4PMXA 2ZXQA 4HU8A 4O0QA 1TV4A 1DV7A 5LIYX 3DAQA 1GEHA 1IEXA 2HCVA 4GH3A 4KRUA 4H9ZA 3PFMA 1LP6A 4PTNA 1WKFA 4JXCA 1OVDA 3BANA 8A3HA 1KBBA 4AD4A 1UG6A 2FTPA 1SJDA 4B3KA 1RP8A 3A4AA 3MDUA 1V3KA 4FNRA 1F05A 3CNYA 2EF9A 4LC6A 4A3YA 4CD5A 1BSLA 4ML4A 4O16A 4F2UA 4UTTA 1FBAA 4AX7A 1GYMA 3UEQA 1JDEA 1RJQA 3RRAA 2NQ5A 1FCQA 4C65A 4LAOA 3T08A 3W02A 1WDQA 2R24A 4GBUA 1K9FA 4TUFA 1JFHA 1EA0A 3LX9A 4Q3MA 1W5NA 2OGYA 2OYKA 3WL1A 2INZA 2PP3A 4MWAB 2YCKX 3OZYA 3R8RA 5CKSA 2B7OA 4LC8A 5B80A 5ABFA 5D8WA 3LM3A 2OSWA 2YCLB 3M41A 3DIPA 4UBPC 2NVDA 3BMXA 4GCXA 1WB0A 2J9YA 5I2UA 2ZRUA 1QBBA 1XUUA 1S3TC 3RM4A 1DOSA 4ORMA 4JYDA 1XYAA 3WDPP 2DQWA 3W2MA 5CPLA 4PEEA 1IWAA 5ABFB 2WO5A 2PDLA 2YBVA 3U8GA 4F48A 2YA0A 1XIEA 4O8RA 3WBWA 3MI6A 1M7PA 4Z1YA 4ONVA 4OHQA 3C4UA 3LXCA 3EDFA 1E6QM 1W3NA 1HJWA 1C8QA 2H3BA 3THQA 1B3VA 5BOEA 3SY8A 2QJGA 1V6VA 1G01A 3K8KA 3QGKC 1I2NA 3PZGA 3BOLA 3MT1A 4OKDA 3ZZ1A 4GIYA 1NWSA 3IUIA 1K02A 1VS1A 4RE3A 1J11A 2PZ0A 1T0OA 9CGTA 1NTHA 3CEPA 2PF8A 5FF4A 3ARSA 3RM9A 5H1WA 1IWPA 3HA1A 3TNBA 4XO7A 2BNJA 1OX4A 5BU9A 1IT0A 2QJHA 4PR4A 2VGBA 1ZFJA 3P0XA 3N17A 1L2QA 1LJYA 1MYRA 4Q8MA 4FP1A 4WKHA 1POJA 4QE4A 5FL1A 1LQ0A 2BP1A 5DBUA 3PBUA 4H83A 1OX4B 4JTGA 4Q6XA 3W1UA 1L6FA 5CPTA 1UBSA 3AXIA 1S38A 1TR9A 1EHNA 3AAMA 4IPPA 2PTZA 1UWRA 2V63A 3BLLA 2NX3A 2WB5A 3PPFA 3F4CA 3KVMA 4BF9A 4EPBC 3GTXA 3NO1A 4DWSC 2HBXA 5HA7A 3BW4A 3SRDA 1HKVA 1VBJA 4BI5A 3RF9A 4QLJA 4WGXA 3PAJA 4BQ2A 3F5KA 4KIEA 3NO5A 1YDYA 4UQBA 2PCQA 1V7AA 1FCVA 3QV9A 3B8SA 2YPIA 4IPJA 4NNAA 1US3A 4GQRA 4U33A 2HEJA 4QEHA 1J0HA 1VAHA 3M6DA 1TX0A 2EPLX 4W87A 2X30A 5KEZA 3B9EA 3GH7A 2WBKA 3QHNA 1XGDA 1DJGA 4FIQA 4F8XA 1IQ8A 4HU0A 4U28A 1X1NA 1IXOA 3L4WA 1TTIA 2FQIA 2D2GA 1GQNA 5A6TC 2NW0A 3TW6A 4D8LA 4CQ8A 1NFPA 1UUQA 1AVAA 3WL0A 3MA8A 3A6OA 1E5JA 1QI0A 2BG5A 1G6CA 3BAYA 3OODA 6REQB 3OGRA 5GNYA 3STCA 1NJJA 2VC5A 3S3GA 4L6DA 3BAXA 1YNYA 3CMGA 3LK6A 4KWWA 3TMQA 5BNKA 1UOZA 4IJBA 2DIEA 1BG9A 5FL0A 3RCNA 3W81A 3WMCA 4WF7A 1FFRA 2C71A 3WD1A 1YPXA 3L4ZA 4CNUA 1QOPA 2ZIDA 3NQDA 4GZJA 5RUBA 3VK5A 1D7FA 2P10A 4E6MA 1OSEA 4BF5A 4J1OA 5CGQA 3GHSA 2CWNA 1I1WA 4MDPA 4GNJA 1KM0A 2ZRVA 3UGVA 5LXEA 3MJYA 1MXGA 3WD4A 4I9JA 4FHAA 2D1ZA 1TJ1A 4AY1A 1H09A 4W7UA 4KWUA 2VFEA 2VCBA 1VJSA 2E5BA 5EFFA 3ABSA 5F2MA 3OTRA 3NQEA 1PYMA 4TTGA 1H60A 3CYJA 5K4ZA 3ARPA 1A4MA 3T7VA 3WK2A 3DFTA 3PBWA 4ZQOA 3BMWA 3LLDA 3UPBA 4ROPA 2FZ9A 3A64A 1DTUA 2NVCA 1BXNA 4ZO7A 4ILSA 4R7JA 2A3EA 1UR3M 2PDYA 3GFZA 3E74A 2DQXA 2CLFA 1ZPTA 3KTXA 4PSRA 3M4HA 1IYXA 3Q37A 3ZSTA 2O9OA 4FLRA 4UFIA 2YB4A 2WXDM 1E0XA