3RNDA

W116i-oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
publication title Biocatalytic Reductions of Baylis-Hillman Adducts
rcsb
source organism Saccharomyces pastorianus
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rndA00
1WYIA 4XBSA 2GOUA 4FX7A 3S1WA 3W7NA 4I9AA 2NZLA 3E02A 3OHIA 2NUXA 1CI1A 1H50A 2W0UA 1ME9A 1L9WA 4CNNA 3DH7A 3T4CA 1GVRA 3PVFA 3UWUA 3DU0A 3EX1A 4NJGA 4O1BA 1HO4A 1IXOA 2VFGA 1U83A 4YCOA 3LI0A 1TRDA 4UC5A 3TROA 4E2BA 2PCQA 2ATMA 2XFWA 1JVNA 2C16A 5GVJA 5E93A 3G1HA 1GVSA 3RMJA 3PUEA 5ABTA 1QPOA 4BWLA 3LB0A 3PUDA 1OYBA 3E0IA 2C13A 1TV8A 2Y70A 5CPNA 2ZFAA 4LS0A 1PS9A 3LTSA 3B06A 3KX6A 3DFPA 3MI3A 3IIXA 2JK2A 1E51A 1P4CA 3HJZA 3W85A 4CNOA 5G2HA 5FF7A 3LCFA 3GZ3A 5C5YA 1F5ZA 1FCBA 4TMBA 3C2VA 3IV3A 3BG9A 4O8RA 1XBZA 1HG3A 3TSMA 4L4LA 3UWVA 3S0CA 4LWWA 4O4VA 5CPMA 1FQ0A 3MP3A 1B57A 4HNUA 4JD4A 3HB9A 3G24A 4BR1A 3S1XA 1GEQA 4DBDA 3WJSA 4Z1AA 1VHNA 1O60A 4C1KA 1F6KA 5D2XA 1SR9A 2FFCA 2Y62A 5DELA 2J27A 4WQ6A 4FHAA 4ZQOA 2ISWA 1W5OA 1YDOA 1L6WA 1LTDA 5BMXA 5AYYA 1ZJIA 4XTDA 3ZR4A 2GUUA 3ABSA 1LRQA 1LOSA 3LI1A 4ZQCA 4Z0JA 3G3MA 1TSIA 4O11A 2Y85A 3PG9A 3MYPA 3I7QA 1JCJA 1DVJA 1WAUA 3FKRA 3N34A 4KWWA 2BTMA 5LNSA 4U4MA 3TCEA 4YL2A 1EP2A 1DORA 3PSVA 3T40A 2QCMA 1FDZA 1VR6A 4NNAA 3L0NA 1QDSA 2DORA 3CWOX 3FYPA 4M6PA 5LSMA 2E6FA 3CC1A 1B9BA 3O6CA 1KLZA 1A5SA 5HWMA 4QJ1A 1FDJA 1UBSA 4XBKA 1KFCA 5SWUA 4DF2A 2QCEA 2E09A 1MSSA 5LNVA 3LHYA 3M47A 2E5BA 3QRHA 3ANYA 2C6QA 1I2PA 3SFKA 3W2NA 3B03A 2ZZ6A 4IX2A 5AC7A 1FCVA 1FBAA 1XUUA 4O1CA 4POCA 1T99A 4N9DA 3L5MA 3UZ5A 1HL2A 1CX9A 4LVDA 1S3HA 5CGQA 4JYEA 1OFRA 4RX0A 4JGDA 5FEXA 1M6JA 1QNVA 3KRUA 3G1FA 3MP4A 1OFQA 1Q45A 1VQTA 3UPWA 3KVLA 3EX4A 3C4UA 3GXPA 3VI2A 1ME7A 4FIQA 4JTGA 4LOCA 3R89A 4AAJA 1BTMA 1F7BA 3S1VA 5KITA 1QPNA 3EXSA 2TPSA 4NX5A 4MFEA 2OT1A 1QMLA 1QO2A 4O1AA 4UMBA 1JJKA 1ZAJA 1TO3A 1VHCA 4M6VA 2BZNA 2VEIA 4ZVJA 3PWAA 2JKEA 1W3IA 3GNNA 4K8EA 1YPFA 1H51A 4XKYA 4JTFA 3BW3A 1Z41A 3HG4A 3TJXA 1G67A 2G96A 4WX2A 2G5WA 3U8GA 4NXSA 3GVGA 1CW2A 3LRKA 2HTMA 2B7OA 4JTLA 3F03K 4CCDA 3QMSA 4WD0A 3GK0A 5D33A 3ABRA 1H62A 3W1MA 2NLIA 1SZFA 2CLLA 4FX8A 4FNQA 3W3OA 1ICSA 2QUVA 2CU0A 2X2GA 2P0OA 4UIOA 3QSTA 3QJAA 1JCYA 1DJQA 3EX2A 2VENA 3TW6A 2V82A 3C3NA 1KM4A 1AW2A 1GYLA 4LUJA 1PCWA 3P84A 4ICNA 3C2OA 3OVRA 1X6UA 1G4PA 3NG3A 1G4EA 1LBFA 2H6RA 2FPTA 2Z6JA 3CU2A 3WJWA 1KTCA 3LLFA 1AK5A 3TIMA 3NEVA 4RCXA 1PE1A 4AEOA 4CNPA 4YWIA 4PA8A 1TJRA 3IVTA 1I8JA 1OFDA 3P60A 4MZ1A 2FTPA 3VKJA 4HSOA 1FDYA 3G22A 3LM7A 4UFJA 4WXYA 1EPXA 4GUGA 4MIMA 3VNDA 3O6YX 2GJLA 1PIIA 4WOQA 3PC0A 2I14A 3MO7A 3QFEA 4D2JA 2QJHA 1MXSA 3HGRA 1IIHA 1QFEA 4TMCA 3L21A 1ZY9A 1B4EA 3TR2A 3I7SA 2DZSA 3S42A 4MKNA 4UFKA 1AW1A 3MMTA 3BW4A 3W1AA 3CWNA 1ZAIA 4H4IA 1GPWA 3V1PA 1EEPA 3KVKA 3NO5A 4U28A 1X1OA 4BFAA 3LTPA 1UB3A 4H6KA 1R2TA 3G1VA 1IIGA 1KTBA 1I4NA 4A2RA 4ADUA 3W76A 1TTJA 2TMDA 2V5BA 4PODA 3PB2A 4O4WA 5HWJA 4A29A 1C9DA 2A2IA 5DY3A 3A5VA 4HN4A 2H8XA 1YTEA 2X1TA 5D30A 3M0ZA 3T44A 2WNZA 2VEPA 1XC4A 1QCWA 1W5PA 4TR9A 1EB3A 3A24A 1JR1A 4A2SA 2AAMA 3P8IA 1LCOA 3STFA 3NQGA 3UPBA 4O1DA 4I7VA 3O16A 2FIQA 4GWEA 2Q3RA 3EXTA 5DCDA 3WJZA 2QCCA 5AYXA 2YSWA 4MZ8A 4G1KA 4EF8A 2NX1A 3TQ0A 3LHWA 1B3OA 2V30A 3B0VC 1G7UA 1YDNA 1JCMP 3M16A 2I9EA 1A5BA 1OK6A 1OFBA 3GXTA 1VLIA 1JUEA 4LY8A 5D32A 1EP3A 2B4GA 1KM1A 2X1SA 1KFKA 3S9YA 3QPYA 1LM1A 3MYOA 2V2HA 4LTSA 3RK8A 2E6YA 4ZMGA 3SGUA 4E0CA 2ZTKA 4HPXA 4JIQA 3G18A 2TRSA 2GVJA 5K3VA 3RFAA 4DPPA 4AHQA 4K38A 2QR6A 1D9EA 3S5OA 3N9SA 2GQ8A 3W7JA 3DI0A 3Q58A 3W1TA 2VFDA 2FPYA 5CZ0A 4KKXA 3W74A 3M6YA 2C15A 2FPVA 4AHOA 2QJIA 3BARA 1G69A 4HPJA 4JTUA 5FEZA 5BW6A 3GB6A 5E0KA 4CQ8A 3W1QA 4UXDA 4Y96A 1Q3NA 2QDGA 4FNSA 1LZOA 1XDMA 4LW7A 3M41A 4HIBA 1MEWA 2RFGA 1TPB1 1GVFA 2ZZ4A 1PHQA 1XL9A 2QDHA 1SPQA 5KTLA 1FWNA 1KFJA 3C8FA 5C2XA 4UTTC 3TSDA 3MBFA 1K03A 5DBTA 4K37A 1WXJA 3S5YA 1AL7A 3GAKA 3NA8A 1FCUA 4XUGA 3LBCA 5AFDA 1K8YA 4HT3A 5HINA 3UYCA 1DQWA 1P0NA 1RVGA 1JUKA 1ZFJA 1DV7A 1OYAA 3PM6A 3W86A 2AGKA 4LRTA 1YXYA 1ZENA 5F2LA 3FA5A 2VKZG 5D09A 4UR7A 3W70A 1D3HA 1PV8A 1ZCOA 3SSJA 3EKZA 3I65A 4NUWA 5K9DA 3FFSA 3LBMA 5H91A 2Y6ZA 3E9AA 2V5LA 1S5WA 2ISSA 3T7VA 3CM4A 1EUNA 1QPQA 3NL6A 3STCA 1JUBA 1LLWA 2X1RA 4UR8A 2Y88A 3BG5A 3NOEA 1ICQA 4N4QA 3IVSA 3OVPA 4WY0A 3NM3A 1UUOA 5A5WA 4BI5A 2ZRVA 1XM3A 3M5ZA 3BLFA 1IGSA 3R13A 1HUVA 1OX6A 2DZWA 1WBHA 3BGJA 3IIPA 4O50A 4LNYA 1TPC1 1KM6A 5FF0A 5KZEA 2RDUA 3RU6A 3N2XA 5C6MA 1VCFA 2QCNA 5I3JA 4RXGA 4JICA 4UFHA 3HIJA 1H63A 2R91A 3NYZA 4GUHA 3NXFA 3HGJA 3B0PA 3BLIA 3TXZA 4Q33A 2YPIA 3NZ1A 3SECA 2F7FA 1XBYA 3K30A 5CSRA 3GIYA 3IRDA 2C14A 2YYUA 3DHDA 2PRHA 3QMRA 3TUUA 5F4XA 3OG3A 1XDLA 4O13A 4UUIA 1IXPA 3W2JA 1GWJA 5K7JA 4QQ3A 2V8ZA 3N14A 3LV5A 2R94A 1SQ7A 5F1VA 1ICPA 1LDCA 1LYXA 3W72A 4K39A 3W2LA 1H1YA 1OJXA 1VYSX 3EWUA 3YPIA 2ZRUA 3TX9A 3UXAA 2EPHA 3WK0A 4NZJA 3QM3A 3KOFA 1YDVA 3WK1A 2ZCGA 4C1LA 3LHZA 4N9EA 1TJPA 2JBMA 3LOTA 1DHPA 3ZS4A 1A53A 1Z48A 1Q6QA 4LVGA 1YXDA 3CIWA 4QITA 1TCDA 4CLMA 3EWYA 3GDLA 3A22A 3DFOA 4ZQRA 3PB0A 5G2IA 4JTEA 4UTKA 2YW3A 3QSRA 4O19A 1ALDA 1A5CA 3EB2A 3NVTA 3PBWA 3WJYA 3M5XA 5LNUA 3OEXA 4JX5A 1B4KA 2CLMA 2YFNA 4RV8A 4CCCA 3INPA 4LT9A 5AB3A 3P74A 4FNTA 3LRLA 1SFLA 4UFMA 4MY9A 3CLMA 3E96A 3W1XA 4JDBA 1OFOA 5AN7A 2PURA 2QCLA 5FF2A 1K02A 3O05A 4ADTA 4AWUA 5T26A 3W9ZA 2ABBA 3E49A 1DOSA 4OGZA 3GR7A 2OJPA 3EWBX 3DXIA 2QCDA 3NL2A 2WPBA 2BX7A 3TAOA 5LKYA 3GDTA 2Y89A 3TAKA 5AHNA 1VJIA 3TA6A 3BW2A 2V2CA 3PR2A 2NWSA 4LS1A 4JYDA 3V75A 4ALDA 1PCKA 5CZJA 2A85A 3W7QA 1NEYA 1Z42A 3W2UA 4MZYA 3LV6A 3NDOA 3W22A 1K8ZA 1DQXA 3HPZA 5LGZA 4OV9A 2H90A 4N6FA 3TC6A 4N6EA 2FLIA 1O5XA 4NJHA 3TH6A 3UZJA 2CZ5A 1XI3A 3DFTA 3QYQA 4DBEA 2QF7A 3TU9A 5FF3A 1HO1A 2NX3A 3EWWA 3JRKA 3W1NA 1H7PA 4LV9A 3W1PA 5AC8A 7TIMA 3EX3A 5U4NA 3MJYA 2ZA1A 3NPVA 1WA3A 4LVBA 4FXRA 1M5WA 1IXQA 4NX0A 4GXMA 4K7VA 4FNPA 1IF2A 3BV4A 1R46A 2D73A 3LGEA 4FNRA 2CLFA 3NQCA 2NXIA 2CZDA 2C1HA 1FWRA 3DFQA 4UTJA 1LRTA 3HPSA 1YADA 1M7OA 2JGQA 2IQTA 4O12A 3IIVA 3NQ7A 4JEQA 3THQA 3U6WA 2PRMA 3C56A 2A4AA 1VRDA 3B0UX 3BK0A 3ELFA 1SSDA 4JDYA 4GBUA 4K8HA 3L65A 3LXBA 2FJKA 5FESA 3FEMA 3L0GA 4UTMA 4Z1CA 1SZNA 3O1NA 3S5NA 5KMYA 1YTKA 5AHIA 3D0CA 1XFBA 4LVAA 2YW4A 1H7NA 3C6CA 4EOUA 2NX9A 2ZZ3A 4UCGA 3P8JA 3QZEA 3UXDA 2V81A 3TFXA 3U2OA 5D02A 3NQDA 4UFIA 3W71A 4K6AA 3SJ3A 5LNWA 4ORIA 3HBLA 2WV8A 3KAOA 5LHFA 3W23A 4ZZ9A 2OCZA 4AF0B 2GJNA 3L68A 2OX1A 4MY1A 5AHLA 5K9CA 3OA3A 4OE7A 3O06A 3PUOA 4PEKA 2FB2A 3N73A 2ZDRA 5DN1A 4W9TA 3G1SA 4N4PA 2NWRA 1LROA 1Q6OA 4WUIA 2QUUA 3I6RA 4P2VA 1H61A 4JX4A 1DL3A 2EAWA 4JXCA 3W73A 1R2RA 2WNQA 4FO4A 5G4EA 5CSSA 1AG1O 1EWEA 5BOOA 1TPUA 2A7NA 4O28A 5J5DA 1A50A 4RR4A 1TTQA 3P80A 4IXHA 1L2UA 2EGZA 3H53A 1VYRA 3FLUA 4EWND 5D04C 1WDWA 4UTWC 4S1FA 5U7SA 4O57A 3TXVA 4LC8A 3G0SA 3R8RA 1R30A 2YXGA 3LCWA 4N2YA 4O14A 3LX9A 1QR7A 5F2MA 1F05A 5I3IA 1AMKA 1TMHA 5EPDA 4RXFA 2X30A 4I7UA 3M44A 5KSWA 4TO8A 1AW5A 3TFCA 5HUOA 5F4SA 1KM2A 2PRLA 3VE9A 5IBXC 3DZ1A 3L5AA 3W7RA 4YLWA 3G3DA 3DBPA 4FIRA 4Z1BA 1QPRA 4AB4A 3IIOA 1OX5A 2CLOA 1GZGA 1HTIA 1HFBA 2NUYA 1VH7A 3ABOA 3QMTA 3A9IA 2CZFA 5KZDA 4GE8A 3S6DA 4PH6A 1W31A 2J6XA 4GJ1A 4JYFA 2JKAA 4IMFA 1UASA 4M19A 1OK4A 3TQKA 4AXKA 3BPWA 1OFEA 1OX4B 5CZTA 2JGYA 4IMDA 2QAPA 5HULA 4IQLA 1OF8A 1XUZA 4Y90A 3NNTA 6ALDA 3DKJA 1RQHA 3HGSA 3LHVA 2GVGA 4NT0A 5DBUA 5L6UA 1N7KA 4EVZA 3EEGA 1WX0A 2YGYA 5E1QA 1W8SA 3W7IA 1FWSA 4MPQA 2WKJA 3DGRA 3UY7A 1R47A 5F2GA 1OF6A 2WO5A 2RH9A 4A22A 5TBOA 4ZL1A 1K8XA 2BSLA 1JRBA 1OABA 3HPXA 4HSNA 1FWTA 4YMZA 3WJXA 1JULA 4JTSA 3L5LA 3C52A 5EBUA 3I7RA 3QH2A 5I3HA 5LZLA 2YZRA 3CEUA 3PULA 3W07A 2P1FA 2B7NA 3EWXA 3GYEA 4IMCA 1JQXA 3PBUA 2ZRWA 2A1YA 5AHMA 2EF9A 3PG8A 2QCGA 2ABAA 4FEZA 3RNDA 1V5XA 2CLKA 1L6YA 2FDSA 1TPFA 4TIMA 4BF9A 3EWZA 3N19B 3QC3A 1RZMA 3HO8A 2A21A 1JQVA 5HJLA 2LLEA 2HS6A 4NQ1A 4O10A 3OBKA 3GDMA 3HOJA 3F1QA 3NQ6A 1ZHAA 2CLHA 2CW6A 3SW6A 3TV8A 3DAQA 1KM5A 4AHPA 4UTTA 1KM0A 1EUAA 4PCFA 4ADSA 3ABQA 1ONRA 1X7FA 3NAVA 4KFNA 1VZWA 1VGAA 1KW1A 1LBLA 4JTHA 3TC7A 4PFMA 3C2EA 1VPXA 3CT7A 3G8RA 1JRCA 3NL3A 3LTYA 4HNVA 1KFLA 3GX9A 3THAA 1C8VA 1O5KA 1XCFA 2G97A 2ZZ1A 3LLDA 5K4ZA 3NQ8A 3P82A 2E5DA 3P5ZA 3W7OA 3LDVA 4NJJA 5F2IA 1H7RA 1W0MA 2DZVA 3UWWA 3EKLA 4QNEA 4TX9A 1PL9A 4GC4A 2VEKA 1XKYA 3Q94A 1H7WA 5G2WA 1TTIA 4Z08A 2VOMA 4O17A 4OT7A 1MEHA 2DU2A 1OYCA 2B7PA 1TREA 4IJBA 4Z0SA 2JKPA 2DZUA 3HQ1A 1F74A 3W87A 3L2IA 1KBJA 1W1ZA 1SZGA 2X16A 3RLUA 5KINA 1VLWA 1J2WA 1NF0A 2Y7FA 4HNTA 1KTNA 4MOZA 1LP6A 4X2RA 2YDAA 4JR5A 3UWQA 4Y9AA 3G1YA 4JS3A 5J5RA 3W6YA 2Q8ZA 1WQ5A 3P67A 5HMSA 1BWLA 1GJPA 1Y0EA 3S1UA 4NNCA 3QW3A 1RV8A 2GQ9A 1I2RA 2B7QA 3JR2A 3QPZA 2ZYFA 2E77A 5G1TA 5EKYA 5EL1A 4O0KA 1M7PA 2V9DA 4UMAA 4LRSA 4XKYB 3TMQA 3HG5A 4UTLA 3FJ6A 5FEPA 2NXHA 3HG2A 4CCEA 2A6LA 1TB3A 1BKSA 2RKXA 2GVLA 3DI1A 1QAPA 4MJZA 2ZRYA 3NQAA 3LXCA 3PAJA 5D2VA 4RLIA 4MLJA 2ZQ0A 4XQ6A 8TIMA 2WSRA 2HMCA 2TYSA 3DFNA 3KHJA 2O7SA 4Z1DA 1T96A 2A5HA 4DO5A 3R2GA 2YCEA 5EYWA 1W54A 4S2BA 1T0OA 4GUFA 4NU7A 3AJXA 3M7WA 5A8GA 3KRSA 3PY2A 5BNKA 1ADOA 1QWGA 3QF0A 2J9ZA 4GFSA 3L66A 1RR2A 5I3FA 4WOZA 1TRIA 1XXXA 3MI2A 3C2FA 4DF0A 4MJMA 1TIMA 5G5IA 1NSJA 1P0KA 3GNDA 3GR8A 2WNNA 1OX4A 1DKWA 3W7GA 5I3GA 2EHHA 4RZ5A 3Q37A 1P5BA 1UUMA 1XBVA 1LBMA 3MP5A 5DY2A 4LS2A 4OBTA 3IGUA 3TK7A 4OV4A 1FY6A 1QOPA 1TPDA 1GQNA 3RF9A 2NV2A 4NXKA 4DQWA 2CLEA 4FF7A 3M1ZA 4R33A 4O18A 4PTNA 1L6SA 4MY8A 3A21A 4BI7A 4EF9A 3GKFA 3A23A 3FS2A 3MBDA 4Y8FA 1KV5A 4GNJA 4QSHA 1EX5A 1VC4A 1W56A 1N8FA 4K7YA 1W5NA 3ZWTA 4M5PA 3W7EA 2DJXA 3PBYA 3W7PA 5HNRA 1VCGA 2Z0IA 4JY8A 3TMLA 2H3DA 3G0UA 4M6QA 4LU0A 4QISA 3H54A 5K4XA 3DENA 4BWLC 2PE4A 1FWWA 1O4UA 5D2YA 1RQEA 3W7MA 5TIMA 4ZQMA 4FX6M 1F2JA 1FXPA 3M5VA 1W5MA 1LRNA 5F1UA 3QW4B 4IGHA 3MHFA 3EX6A 1G6CA 3AO0A 3T78A 1JCNA 3LCXA 3VCRA 4BK9A 3N9RA 3P61A 1NFBA 1GOXA 3BG3A 5HR6A 4Q32A 5HQEA 3WK2A 1C29A 4IPIA 5DCEA 4NZFA 1G4TA 4JN6A 1RD5A 4K36A 1RPXA 2YYTA 5FEWA 1D3GA 1LLZA 2ZA3A 3EXRA 4O54A 2J9XA 5D2TA 4N02A 4Q4KA 4UNKA 4DELA 3TQVA 1Q6LA 1NAL1 1FCQA 4X9SA 1ME8A 2F84A 3NL5A 3VFLA 4AWTA 3R12A 4MYXA 4JTKA 2VXNA 3L67A 4KFOA 5CPLA 3FJLA 1K7XA 1DJNA 1FUYA 1G7VA 3Q2DA 4DPQA 4QAIA 3IIZA 1H7OA 4AWSA 2NUWA 2CZEA 5EA9A 1VCVA 3O8AA 4LC6A 3STEA 3KRZA 3HGOA 3GDKA 4XTIA 2ZZ2A 4KFPA 2Z1BA 3I68A 5K2ZA 2ZZ7A 3G1DA 1S5VA 1DBTA 2BXVA 2DZTA 3O6DA 4DF1A 3N3MA 2ISVA 1LOLA 1YXCA 3FYOA 4H3DA 3DHFA 3SR7A 4R7JA 4KWVA 1OFPA 4IXXA 1TPVA 3SI9A 2QCHA 4WY0F 2Y7GA 4NNBA 1KA9F 1K7EA 1SW7A 4OWGA 2CFFA 3QQ0A 4XZ9A 5TQLA 5DLCA 1P1XA 1SW0A 4Y6GA 1F73A 2XN1A 1MEIA 5G4WA 2HS8A 2Q3OA 2VC6A 3C0JA 3IGSA 5D03A 5AOUA 4O15A 3QEZA 3HG3A 5L9FA 5BRBA 3L0KA 4M7SA 1JCXA 3NZRA 1WOAA 4RKAA 3OVQA 1RQBA 1KFBA 4DEFA 3MHGA 2DZXA 3G0XA 1TV5A 3H55A 4JX6A 3NQ2A 2ZTJA 3BVJA 3FOKA 3C61A 4XWUA 5FF4A 4DO6A 1GVOA 5AC6A 2GQAA 2CLIA 5D05A 1SW3A 5AHEA 4NVTA 4UTIA 1Z44A 3ZWSA 4HKPA 1SUXA 1O95A 5G1YA 5C55A 4ML9A 2EKCA 3TKFA 4R53A 4QM1A 1WBJA 4PC8A 3NR0A 4UFLA 4BI6A 1ML1A 1KLYA 3B04A 2ZBTA 4UTWA 1SO3A 3NQFA 1S5TA 5DXYA 3KVJA 1I2QA 2OMAA 3STGA 3P7YA 3G1XA 4AMAA 3UQNA 3W88A 2HSAA 3WK3A 3HF3A 5EMUA 2FQIA 3CQ0A 1O94A 3W84A 5IM51 4WY0B 4IMEA 1ZAHA 2X1UA 4DXVA 5IBXA 2J88A 1TQXA 2E6DA 4IUOA 2RDWA 2QKFA 3W83A 1F76A 3B05A 1ZALA 1G4SA 2YR1A 1THFD 4LUIA 3W2KA 4A3UA 4FB7A 4GUIA 4AVFA 2V2DA 3PBVA 1PHWA 1J5TA 2CWNA 3A5FA 3TDFA 3ATYA 1TV7A 3MW7A 5LHEA 3SY5A 4IWWA 2A6NA 5D38A 4MUZA 2DJLA 2DP3A 2UV8G 4LVFA 4WJEA 2ALDA 1TQJA 5CKSA 1FX6A 3UWZA 2WSYA 3TE9A 3CIXA 4JTJA 5DCBA 1EWDA 4JY9A 1TPH1 3MWAA 1H7XA 1V7YA 3LCGA 4CQ9A 4WZHA 2ZA2A 4TU1A 1U5JA 3WFAA 3S8HA 4E2DA 2J9YA 3KVMA 4X3ZA 1EIXA 3IGXA 1YLVA 3KFTA 5CPOA 4CQAA 2AQWA 4B5NA 3G8EA 3NPWA 1A5AA 1GVQA 1R2SA 2C18A 1YPIA 1OFAA 3O15A 4FNUA 2TSYA 4MLRA 4I7WA 3OIXA 3CB8A 1VYPX 3W7LA 1TTPA 2GPTA 2Y63A 4RZ6A 4R34A 3VE7A 1W3NA 1KFEA 1SO4A 2QUTA 3W2MA 3NQVA 4RJEA 4S2CA 4IMGA 3NQEA 3NPXA 3UNDA 2RHGA 1TPEA 3HMJG 3JS3A 2C3ZA 2XN2A 2XN0A 2E6AA 2I1OA 4X22A 1W37A 3TNOA 4GRSA 2O7QA 2OT0A 1TPWA 3BO9A 4OHQA 4ONVA 3FKKA 2VEMA 5AYZA 2RDTA 4PL1A 5D2WA 1I45A 2WQPA 2BLEA 3NQMA 1N55A 1WV2A 2QJGA 2Q8LA 4RZ4A 1H60A 3BGGA 1PVNA 1GT8A 4MFDA 3CHVA 4O16A 3MI6A 3P81A 4O53A 3DKLA 2ATSA 3NGJA 1AL8A 5CG7A 4PL2A 2W6RA 3LCLA 4JTTA 2VFEA 3B8DA 2A7RA 4YXGA 3CTLA 5BMWA 4O0ZA 2A7PA 3O07A 3ZFHA 4JTIA 1W3TA 2Z2UA 4YCPA 3B4UA 3QQ1A 4UTUA 2NV1A 1GTHA 3T55A 4LV4A 5K9XA 3CEPA 1OG0A 3W1LA 4OU1A 5C54A 5AHFA 1EA0A 2QCDB 4UTHA 3GDRA 3NM1A 4HNNA 4QIUA 2QEZA 1NF7A 2VFFA 1OHLA 3FIGA 2W79A 3SIZA 1WOBA 5MHBA 2E5CA 1OVDA 3W75A 1SZEA 4AH7A 4P61A 2YFOA 2YX0A 3LXAA 2WSQA 4J9JA 4NJIA 2J24A 3N2MA 3MHUA 2VELA 4N9CA 1UCWA 6TIMA 4ZQNA 3UD6A 4IX0A 3W1RA 4UMCA 2H8ZA 3IVUA 2VFIA 4NJKA 4DO4A 2ZRZA 1K7FA 5DXXA 2QAFA 2PC4A 2R14A 1K3UA 3W7DA 1GTEA 1YTDA 3LCHA 3P5YA 4QNWA 4GUJA 5D37A 1UJPA 3W7KA 1SO5A 4RK8A 3BLEA 2Z6IA 4JNMA 2ZZ5A 2Y61A 2QCFA 3L9CA 4IPJA 1GG1A 1MZHA 1NVMA 2G95A 1ZNNA 4A21A 4HHPA 3C2RA 3W1UA 4IOTA 3O63A 4OQVA 3LRMA 3GXNA 1SSGA 2E68A 2C0AA 5I3KA 1MO0A 2OZ0A 1FXQA 5HWNA 3W7CA 5FI8A 1SO6A 1YYAA 2NXGA 4ORMA 1TYGA 1JCLA 3LHTA 1GYNA 5CZSA 1T8XA 1X8FA 3F4WA 4WXZA 3TJLA 4AF0A 2A0NA 3M9YA 2E1DA 3G1AA 1I2NA 4FXSA 5LGXA 1QOQA 4JIPA 1J4EA 2WOQA 3MUXA 1LOQA 3SZ8A 1KV8A 3DFSA 2V0TA 3LHUA 2BWGA 1EP1A 3ATZA 2B0MA 1SFJA 2H3BA 3PS7A 4MYAA 4EIVA 4L4MA 3IEBA 4ZQPA 1VS1A 3W7HA 3F4NA 2R8WA 2Y7EA 3PSWA 1LORA 5EY5A 1H1ZA 1KM3A 2C19A 3R5EA 3UY8A 3GLCA 3S5ZA 2ZRXA 4O52A 1GG0A 1IXNA 3M43A 1BWKA 3KXQA 3LCIA 1I2OA 2FB3A 1F6PA 3NPUA 4UNLA 3UWYA 2WJZA 2DZPA 1QO5A 3GKAA 1W5QA 2KZHA 1KBIA 3P62A 5HUPA 3PF3A 1Q6RA 1XBXA 4M7TA 3E12A 3LERA 5LNRA 3TSBA 4N9BA 3GAYA 5KZMA 3CPRA 3USBA 3M5YA 5H2ZA 3TW7A 4MVAA 3SGZA 5F4WA 2VFHA 1X1ZA 1H5YA 2Y7DA 1SU5A 3RLVA 4E38A 5HR7A 1BEUA 2P10A
chains in the Genus database with same CATH superfamily
3IK2A 3HMCA 4XBSA 4CD5A 4NI3A 4L1XA 3KBNA 1GORA 1IZCA 4I9AA 4I9MA 3OHIA 1GOOA 2NUXA 1H50A 2W0UA 3PZQA 1ME9A 3WLHA 3BAIA 4PMYA 5D9PA 4CNNA 3VCCA 3ARSA 3VU2A 3EX1A 1ZP3A 3L4ZA 4DJFD 1LL6A 3VNMA 1U83A 2J77A 1TRDA 4UC5A 4E2BA 2VO5A 5GVJA 4Y8EA 3PUDA 3E0IA 3WDJA 2C13A 4KRTA 2VC9A 2Y70A 2MUCA 3WNMA 2ZFAA 3B8IA 4LS0A 3DFPA 1RK5A 3IIXA 2JK2A 1E51A 3HJZA 1UUQA 3SCQA 4W85A 3AYVA 2PF0A 1J0HA 3VMPA 2ACUA 3BG9A 1WPCA 1XBZA 2WCAA 3W25A 4US6A 4L4LA 3UWVA 4O4VA 2C8NA 3RPMA 3SY8A 5A6JA 3G24A 4BR1A 1XQKA 2EJAA 3VNJA 1U5HA 1VHNA 4OUEA 1O60A 4GKLA 2FFCA 1ZP4A 2ISFA 3SGGA 2F6XA 4WQ6A 1I0BA 4GINA 4FHAA 4GQGA 4ZQOA 1F3XA 3QFWA 4QJ3B 2ISWA 3NFUA 1YDOA 4AD4A 4NIRA 4WKFA 1XIEA 4D8LA 2BFGA 3T0BA 3UR7A 4XTDA 3EOUA 9CGTA 5CJ5A 1TA3A 5A8NA 1LRQA 3LI1A 4Z0JA 3JW7A 3G3MA 4GZEA 4O11A 1TUFA 2PDNA 1JDCA 4JKMA 3I7QA 3FKRA 5LNSA 3IGHX 2W62A 3UJRA 2DORA 3FYPA 1NWRA 1ZTVA 1KLZA 3RN6A 4XBKA 1UBSA 1OT2A 4DF2A 4MB5A 2E09A 5LNVA 3LHYA 3ANYA 4ZOAA 1KRBC 5GNYA 1Z89A 3SFKA 3PZVA 1L8PA 2VOTA 2BY1A 1FBAA 1XUUA 4O1CA 1CGVA 4C7GA 2PD5A 3UZ5A 1QXLA 1RY0A 3GC4A 4M24A 5REQA 5FEXA 1M6JA 4IISA 4Q7BA 4NF7A 6REQB 4PBFA 3C4UA 3CMGA 2CZVA 5CC5A 1WB0A 2WNWA 1ME7A 3TTEA 4JTGA 2VYOA 3R89A 1YEYA 2MANA 3THUA 5A8MA 5KITA 2PDHA 3QR1A 3WDQA 1JG9A 1ZAJA 2OFJA 2GJXA 2D2HA 3OQ8A 3GNNA 4K8EA 3M0IA 3CAWA 3HG4A 2VX5A 4AZGA 3U8GA 4XAZA 4FI4A 2P50A 3GVGA 3VXGA 1CW2A 4KF1A 4JTLA 1YBQB 3F03K 4CCDA 3G6LA 4JN8A 5D9OA 1R3SA 3CQHA 3SSZA 4FNQA 3W3OA 1F61A 1OGGA 2CU0A 3GTXA 4ZOBA 4QBXA 4WHBA 4AC1X 3WMCA 4QLKA 1HJQA 3XINA 3ZYZA 5CSYA 4GQ0A 1CXFA 4IPPA 1AW2A 4L4PA 5HJXA 4GY7A 4QE1A 1X6UA 1G4PA 4DJED 3R25A 4XZHA 2FPTA 4UOZA 3WQ4A 2CBUA 2OZ8A 4AEOA 4YWIA 5C7VA 4RE2A 4MZ1A 2FTPA 5IOBA 2PDPA 1FDYA 1HF6A 1YIXA 3LM7A 4RE3A 4UFJA 4GUGA 2PDBA 2R1PA 3WL0A 3IJDA 2HPMA 2EPKX 1M7XA 3NOYA 3S6OA 3QFEA 3PZIA 2RAGA 4HTYA 5CC3A 1OINA 5IXEA 4JPGA 2XVLA 3HPFA 2DZBA 4ROQA 3A9BA 1EYWA 2OOFA 5AYIA 2VWSA 2AMXA 2VGBA 3TR2A 3I7SA 4Q4SA 3MMTA 3W1AA 3V1PA 1EEPA 3NO5A 2QV4A 3H7RA 4U28A 4U5IA 3VDGA 1UB3A 1UR8A 3MTWA 3G1VA 5FAJA 3W00A 4JL2A 1J6OA 3SQMA 4AW7A 2XWDA 3VKDA 2O9PA 4ADUA 1IGWA 3AHTA 2V5BA 4BQ5A 1ZJAA 4AY8A 1C9DA 3DFYA 3MZNA 2H8XA 3UGRA 1VP5A 3IWPA 3ZT6A 2PFHA 1UP0A 5D30A 3CZGA 4Q22A 3T44A 1TFVA 2FDMA 1V02A 3VUPA 4QG6A 1IT8A 1W5PA 3UVAA 3A24A 1BFNA 3T42A 1XG3A 3VKCA 5M3WA 4JNYA 1E4IA 5M2FX 4O1DA 1XIJA 2FIQA 2AL2A 1I60A 3EXTA 2NT1A 2QCCA 1VBJA 1OD0A 5A6MA 2OWXA 2YSWA 3U48A 4MZ8A 4AYSA 4G1KA 1EGVA 3OW1A 2NX1A 5AC4A 4IFRA 3GVRA 3LHWA 4PN2A 2ZWYA 1YDNA 3VGDA 4Z1YA 4AUBA 1A5BA 2OOGA 1OFBA 1QJWA 4F2BA 2PB1A 2ZVRA 1EC7A 5D32A 1EP3A 2B4GA 2EO7A 1FWBC 2VM8A 1SJBA 4GA8A 3QPYA 3QXBA 3BGAA 3FJNA 3RK8A 3APTA 2BGNE 2HQAA 4JIQA 1QI3A 2GVJA 4DPPA 3WUEA 4HU0A 2DVUA 5E09A 4K38A 4QTGA 1R7AA 3MDWA 2QR6A 3RLHA 4IFKA 4URIA 4YTUA 1D9EA 3S5OA 1JF5A 2DUZA 3COTA 3N9SA 3W7JA 1HP5A 1Z8AA 3SN1A 4ACYA 3W1TA 5TAOA 1QNSA 5CZ0A 2HE8A 3UXKA 2QJIA 3IARA 4HPJA 5FEZA 5BW6A 5CQ1A 1L6FA 1QNPA 1XDMA 3CMFA 5IFPA 3PZNA 3R58A 4LBRA 4KCVA 1FWNA 2D2OA 1Z3NA 1KFJA 2XZ7A 3C8FA 5G1MA 1K03A 4KIEA 4K37A 3S5YA 4J28A 2ZX7A 1LL7A 4HVXA 3GFYA 2CYGA 4XUGA 5DF0A 4QAWA 4HT3A 1XGDA 3EEZA 2CKRA 1DV7A 4IM4A 1KQYA 5CEWA 2IPFA 1WDRA 5D09A 2WZEA 3W6MA 4CN4A 1MW2A 4HPNA 4B3ZA 3I65A 2OSYA 4H6EA 4Z42C 2V5LA 3N2OA 1JAKA 1KWGA 1G94A 1JZ8A 2VEGA 2GK1A 1HJUA 3VA8A 4UR8A 9XIAA 5FACA 3BG5A 1PDYA 3NOEA 4HPHA 3BCJA 3IVSA 1HGWA 4QEHA 4WGHA 4ZO6A 1FOBA 2DZAA 4RE0A 3F4VA 2BY2A 3M5ZA 1U5VA 1OX6A 2ANUA 2QPUA 4RNIA 5FJUA 5EFFA 3VC6A 2VX4A 4LNYA 1TPC1 3OTRA 3MUY1 1YRRA 3HQOA 3RU6A 4E3TA 4JQ2A 4Z2JA 2QCNA 4HOWA 1EHAA 1UH4A 4FMVA 1OZMA 1B9ZA 2WKGA 1BYBA 1Q6EA 1JZ2A 1JEZA 2NQZA 4F48A 4Q33A 3NZ1A 4KH2A 2FHFA 5JH1A 5H1WA 1EQPA 4QS5A 1XBYA 4ZB5A 5CSRA 2X40A 7XIMA 1JZ4A 2OG9A 1OG6A 1EBGA 5F4XA 3OG3A 3NZGA 4LAMA 5I03A 3T09A 4UUIA 5K7JA 1UQYA 4QQ3A 4HHHA 3LV5A 3OZYA 1OC5A 5F1VA 1W91A 3P14A 1RD6A 1EQCA 1OJXA 3ITXA 4LALA 1E5NA 4LPCA 1C9WA 2ZXDA 2ZCGA 2A3BA 1JI1A 1BGGA 3OZOA 1TIWA 2P76A 1TJPA 3LOTA 3LUTA 5A8QA 4C6LA 4H6QA 4AFYA 3MA8A 4HCDA 4M80A 3AIRA 1A5NC 4QITA 4F66A 1TCDA 1UZ4A 1IT0A 3WNNA 4BF7A 4GK8A 4REQB 4WIWA 3KDNA 4H2CA 3MU7A 4UTKA 3IJ6A 3IRSA 3QSRA 4GGHA 4GOAA 1VEMA 1J10A 4AZCB 2VJXA 1QNQA 4JX5A 3B8SA 3U3HA 3SM0A 1TUXA 4LT9A 1R9ZA 4H7VA 3E96A 4AIOA 1X96A 1EDGA 2PDKA 1OFOA 2QCLA 1Y5VA 3UG3A 2V6AA 1AA1B 3W9ZA 3E49A 2OJPA 4ECLA 3DXIA 2NSOA 3ARWA 2BX7A 1R9XA 3ENLA 5AHNA 3VO0A 3BW2A 3UA3A 1RUSA 1VFTA 2F6UA 4PRTA 4LS1A 4JCMA 4QJ5B 2C7FA 2FH8A 1CNVA 1FKWA 1WCGA 1F07A 3S2JA 4FLQA 3IUIA 2A85A 4DI8A 1ECQA 1E72M 3HPZA 3O9NA 3ALFA 3M0MA 4PSPA 4FLRA 2J7GA 3VKKA 5CC7A 1UWRA 5A8OA 2X7VA 4N6FA 3TC6A 1XIIA 1X6NA 2NQHA 1EL3A 3DFTA 4C90A 4X2PA 1FHVA 4XVDA 4CN6A 1HO1A 3EWWA 7TIMA 3VD4A 3B8WA 4QHRA 1RXOB 4LVBA 2WVUA 1IXQA 2DIEA 2XFYA 5I07A 5RUBA 3EA1A 3I4KA 3TVAA 1IF2A 2D73A 1ITUA 2WMIB 1A49A 1YPXA 1UWIA 4IICA 2PP3A 1FWRA 2YCLB 4J3ZA 1YADA 3T08A 2IQTA 3UZXA 1C7SA 2QJMA 1ZSXA 3P0XA 4HMEA 3U6WA 5JBEA 2A4AA 2OTDA 3ELFA 4K8HA 3L65A 3B8VA 7PTDA 5C7HA 2NVCA 3FEMA 3L0GA 2Z4GA 4KWOA 3O1NA 4DYKA 3D0CA 3RPTA 2O4MA 1XFBA 3F2BA 1H7NA 3URBA 4EOUA 5A6BD 2VZVA 3UXDA 2V81A 3U2OA 3AWOA 2WVTA 3NQDA 4CU6A 2PU0A 3L7RA 4PMDA 4DUVA 1IR1A 2XIMA 2BBFA 4A6GA 3KAOA 1BQGA 3W23A 1D7FA 5C8BB 2VQTA 2OCZA 2GJNA 3QV6A 3QZAA 2XYLA 3WF4A 1Q8AA 3KP1A 2PA6A 3OA3A 4OE7A 4UQBA 1QPKA 4W87A 2ZDRA 5DN1A 4W9TA 3G1SA 3UA4A 1EGZA 2QUUA 1JPIA 1EJXC 3I6RA 4WEVX 3KOYA 4JX4A 3AIVA 4AVOA 1DL3A 2EAWA 2WJFA 4JXCA 1AZ1A 4Y9MA 1GZ1A 1UKOA 4FO4A 4FK9A 2X09A 3OHMB 5J5DA 3WNKA 4C6JA 4HGXA 4F9JA 4IXHA 1JPKA 3FDGA 3ES8A 3FLUA 5D04C 4JHOA 1SFTA 3TXVA 6XIMA 4L6OA 1F9CA 3LCWA 1NDYA 5A6AA 4O14A 4YN5A 1F05A 3Q65A 1TMHA 1KFWA 3TFCA 4P5UA 3AXHA 1PTDA 4ZODA 3D3AA 4G5DA 3OODA 3L5AA 4PRRA 3U5YA 3G3DA 2J7CA 3IIOA 2FTWA 1HFBA 3OBEA 1XRTA 2CZFA 1W31A 4JYFA 1KBLA 1UASA 1OK4A 1S5MA 3GG7A 1JDEA 1OFEA 1OX4B 4OVXA 5CZTA 4IMDA 3QLDA 3VDAA 4PCSA 3ME3A 2J8TA 4Y90A 3MZ2A 3NNTA 4LJ3A 3HGSA 5CLTA 3LHVA 2GVGA 4NT0A 1YNQA 1VAHA 3EEGA 2ZX9A 3KCJA 1J2BA 4HSHA 1B30A 3EOSA 4NKCA 2X05A 4GY0A 1R47A 1XLAA 3VGEA 2CNCA 5F2GA 4A22A 5TBOA 2J8FA 4I3GA 4ZL1A 1JRBA 3AMGA 4IJCA 2WBKA 3WJXA 4EPDC 1HT6A 4JTSA 3C52A 2PGEA 1OSEA 4C6FA 1WO2A 3I7RA 5I3HA 2ACQA 1V03A 3E74A 2ZRWA 1YNPA 1WKDA 3PG8A 1Y7VA 3B97A 2G37A 2ABAA 2G8ZA 4OBSA 5HPOA 1V5XA 2CLKA 2FDSA 2NQ5A 5HQLA 4BF9A 5I06A 1R85A 1DIKA 3LGGA 4ICMA 2A21A 1JQVA 1Q8JA 3FK4A 2HS6A 4NQ1A 4O10A 3OBKA 4WKHA 2BVDA 2XPKA 1VD6A 3F1QA 1RJPA 1XLMA 1SZRA 3VDCA 4AHPA 1TA3B 2WMKA 2XUCA 1ONRA 4GNKB 4QXIA 4ZOEA 1X7FA 3NAVA 3QKZA 1UC4A 3AYRA 4UOQA 1EYEA 4PFMA 4ZGYA 2XGIA 1Q4NX 2GWGA 1SMAA 4HNVA 1UQZA 4GFIA 3BLKA 3GBEA 3GO2A 3NWRA 1NWUA 4TXEA 2QMJA 3U9IA 1NH6A 1S5NA 3TYEA 3RGTA 2VZTA 5DMMA 3WLRA 4GLEA 4GC4A 4MAVA 3T0AA 3NUKA 1UR4A 2VZOA 3RCNA 1XLEA 1MNZA 4OT7A 4B5XA 4ZO7A 1UKQA 1M7JA 3AHZA 4IJBA 1JCTA 1V93A 3PZ9A 3LD5A 3EWCA 4JFWA 3W87A 5REQB 4W89A 1W1ZA 2OWWA 2X16A 4DJFC 2J78A 5C71A 1QRQA 4UQDA 1KRCC 1LP6A 3AQUA 4JQ1A 4KEUA 3QYSA 4JR5A 2Y8VA 3V36A 4IL2A 4GPNA 5HMSA 1A3HA 3BV7A 5BWFA 1CLXA 2G3FA 1HVXA 5G1TA 2BVWA 4H7ZA 5GJPA 5EKYA 2QPXA 1M7PA 3H2CA 2V9DA 2GUYA 5XIMA 3HG5A 3AC0A 2VHLA 2W4XA 3BZGA 2NXHA 1SJAA 4DLMA 1UD2A 2RKXA 2GVLA 2HK0A 3TTQA 1QAPA 3NQAA 3VOJA 4R7WA 4MLJA 4P8WA 2ZQ0A 2PLJA 2WSRA 2O92A 3VKBA 3OYZA 1UPMB 3DBNA 4AZ7A 1BSLA 5LIXX 3KHJA 4Z1DA 3T2PA 2AQOA 4ZO9A 4DO5A 2YCEA 4DBWA 4P8VA 3AJXA 4D6EA 2JE8A 3M0YA 2HCVA 3PY2A 1ADOA 1V6YA 2J9ZA 3THCA 2OB3A 3L66A 3VOFA 5LA0A 2J7DA 4WOZA 5AZ0A 1HKJA 1KB3A 2XIJA 4MJMA 3UG5A 1TIMA 3CZ8A 2DDXA 1P0KA 3OLEA 3GXFA 3GNDA 3GR8A 4PUUA 1PUDA 5HJYA 1FVPA 1DKWA 3BJFA 1VEOA 4RZ5A 4LCSA 3VFCA 1PX3A 1TX2A 5DY2A 2FGBA 4LS2A 1A5UA 2GQ3A 1QOPA 3H4WA 1WXZA 2WQDA 4WGXA 4U33A 2GL5A 2CLEA 4AWEA 5HMDA 3M1ZA 1IWPA 1L6SA 1TZZA 2E25A 1VJSA 1OQFA 1SMDA 3MBDA 4Y8FA 5HQMA 1KV5A 4GNJA 4WDWA 1QBAA 1W56A 2D69A 3WD3A 3LNPA 1QI5A 3PBYA 1NWTA 1VCGA 4JY8A 2H3DA 3PZMA 1KGUA 3G0UA 1A5OC 4QISA 4JBRA 5K4XA 3DENA 2F9RA 1XRVA 5T9BG 3AS1A 3NEHA 1ZBCA 4KERA 4FX6M 1F2JA 1J5SA 3M5VA 4S23A 3N9KA 4GZIA 5KEZA 1PB0A 3S83A 4BK9A 2QDDA 1JYNA 4XO7A 1RJQA 5AKQA 3AIWA 3VD5A 5DCEA 1G4TA 2J75A 1IEIA 1PEZA 3T6CA 2AL2B 2ZA3A 3EXRA 4O54A 2HXTA 1TMLA 1IWBA 4Q4KA 4UNKA 2HROA 3KBMA 4DELA 1V6UA 3TQVA 4MHBA 1V3LA 3FJ4A 4X9SA 2WZMA 5HBFA 3EMCA 1E6PA 3R12A 4JTKA 1V77A 1ITXA 4KQNA 3GYCA 3LYEA 1JL8A 4KFOA 1FH9A 2GGGA 3QKEA 1JPHA 1K7XA 5I7GA 1CXEA 3ORWA 3MB9A 4DPQA 3IIZA 3FHQA 2CZEA 2FKPA 3UW6A 3BLOA 3GXDA 4DBSA 3STEA 2GFTA 3FAXA 3CZKA 4DJEC 2J62A 2EPNA 5G4HC 4C6OA 4IFKB 3IJLA 2ISVA 3SR7A 1J96A 2XTKA 3QN3A 1DJZA 2QCHA 3O3RA 1GEHA 3WEOA 1VJZA 1GZJA 2CFFA 1P1XA 4PB4A 2XN1A 3GVVA 1MEIA 3NQBA 4I6VA 5D03A 5AOUA 4XAGA 4O15A 5BU9A 5BRBA 3L0KA 2GDQA 4CVWA 3GXMA 1GOIA 2IKIA 2ZE0A 1RCXB 1N8WA 3G0XA 3H55A 3UZWA 2ZTJA 5T9CE 4DUXA 3FOKA 3CXOA 3EDFA 3WNLA 2BOFX 1E9IA 4J3UA 1GNXA 5BXTA 1GUVA 2TODA 4NZCA 1CTNA 1H0GA 2VGIA 5D8ZA 4ML9A 2EKCA 4UOJA 4G8TA 3GTFA 2EPMX 1HJVA 1UD4A 3NR0A 4UFLA 3HU7A 3MCNA 1Q7MA 2XIQA 4JZ5A 3N6QA 2ZBTA 4GYJA 1I2QA 3G1XA 3LG3A 3UQNA 5I00A 2GK1B 2UY3A 3HF3A 4ZFMA 2NQJA 2FQIA 1V0NA 1O94A 4WSKA 1RAKA 4CNUA 4IMEA 1CXHA 3TJIA 2E6DA 2QKFA 3W83A 1F76A 3RX4A 3B05A 1AQ0A 3P0WA 5I6SA 5E0FA 4V1XA 4QEEA 1AODA 2V2DA 4YIWA 1GPFA 1VBGA 3TDFA 1J8VA 4GXPA 1Q6FA 3WLPA 1HKVA 3MW7A 4HYWA 3SY5A 4IWWA 2A6NA 1TVLA 3BE7A 3UFYA 4OBRA 2PWDA 2UV8G 4LVFA 4L80A 5CKSA 3QHNA 4YVPA 2XZ9A 3TE9A 3CIXA 2ZUNA 5LIYX 5DCBA 2WPGA 2J74A 1GW9A 1L8NA 4Q8UA 1R3YA 4JQAA 4QGCA 3WLIA 1V7YA 1RSCA 3W01A 5I09A 2J9YA 4NL1A 1YLVA 3ARXA 1E6SM 3H12A 4R27A 3U4FA 2YCJA 3OIXA 1EOKA 2Y63A 1B90A 4RZ6A 4Z2IA 1W3NA 3OGVA 8CGTA 1ISVA 1VBRA 3W2MA 4H9TA 2PTWA 4IT1A 1BWVA 2RHGA 2BHZA 2IUZA 2XN0A 2E6AA 4X22A 2YDSA 5A8PA 1TPWA 2PDUA 3BO9A 2J47A 4DZ5A 2INEA 4WDUA 5AYZA 3ZLHA 4AC7C 3EPNA 3ZT7A 4EXQA 4PZVA 2Q8LA 3BGGA 4MB1A 3PUGA 5J04A 1G1YA 4YJ5A 4MFDA 3PNZA 4B3LA 3CHVA 2G50A 3P81A 4O53A 3E2RA 2PDGA 3BXWA 1KKOA 4U2YA 1ZBVA 4JTTA 4CU7A 3MSGA 2A7RA 4JQ3A 4YXGA 3R79A 3M0VA 4ML4A 1F6YA 1EO7A 2A7PA 4O0ZA 4RNJA 1GTHA 2VUNA 1Q5MA 4LV4A 3BOFA 1UZDA 1CGWA 4NP7A 4G9PA 2YDRA 1NWSA 1OADA 2YLAA 3QTGA 3DGBA 3LSCA 1NF7A 3ES7A 3FIGA 3SIZA 3W75A 4Q4QA 3LXAA 4D6GA 4J9JA 1LJYA 2VELA 1UBPC 4N9CA 1UCWA 3JUGA 4O1EA 3EMQA 4Q7IA 3BOXA 2QAFA 2PC4A 1YTDA 4GUJA 3W7KA 4DJFA 3L4XA 3AIEA 2JF7A 1SO5A 2Y61A 4HNLA 1TZ9A 4IPJA 1NVMA 4B5VA 4I5UA 4AIUA 3W1UA 3THDA 3TWAA 1SSGA 5I3KA 2POTA 4W7UA 1Q65A 4XZMX 1PKLA 4BA0A 3CAVA 2POZA 5DEZA 1T8XA 2GDUA 2KX9A 3CIVA 4WXZA 4AF0A 4TTGA 4FXSA 3S2MA 1FH8A 3RLGA 1ZB5A 3MUXA 3DFSA 2V0TA 3PTDA 3KL0A 4CEXC 3PS7A 5B7ZA 1MFVA 3SCRA 1BKHA 3QTPA 4L4MA 1VS1A 1WDQA 4A8RA 3PSWA 1ZBWA 1LORA 1AH4A 5EY5A 3UY8A 3HFTA 4B90A 1E3ZA 3M43A 3U2ZA 3BANA 5DMNA 4H41A 4W8LA 4Z2HA 4UNLA 4P8XA 1NP2A 2SFPA 1QO5A 1YW1A 1W5QA 2KZHA 3P62A 4C6BA 1CENA 4M1RA 1XBXA 5BRPA 4DI9A 1MW0A 1Q6CA 5LNRA 3PJUA 4N9BA 4DRSA 3USBA 3M5YA 4L1GA 3FNDA 1XWYA 3W4RA 5F4WA 3SRHA 1H5YA 4E38A 5ECUA 7REQA 5HR7A 4W5UA 3K4WA 1E6QM 3M0JA 2C91A 3ZR5A 3SUVA 3V5FA 1AD4A 1A5LC 3S1WA 3MV01 2P8CA 4ACZA 1CI1A 2OSXA 2ASHA 3T4CA 1GVRA 3PVFA 1HO4A 4J27A 4O1FA 4YCOA 3GHSA 5B80A 2XFWA 1JVNA 2C16A 5FD0A 3G1HA 1GVSA 2A3LA 5ABTA 4LY4A 4HP5A 4KWSA 2RGLA 3DG7A 1TV8A 1PS9A 3B06A 4DWSD 1SM9A 1LWHA 4RDYA 4MUPA 3LPFA 3FCPA 1FCBA 4TMBA 3EB3A 4NG3A 1W9VA 1NQKA 2X1IA 1E5JA 1P43A 4YTQA 2WCGA 3S0CA 5CPMA 1FQ0A 1V6TA 4J40A 4HNUA 4JD4A 1GEQA 3AUJA 2OYLA 3WQGA 3WJSA 4ZSUA 1F6KA 3CL6A 1XF0A 1BLIA 2XHYA 4QLLA 1UW9A 1WZAA 1W5OA 5JVLA 5DRIA 4QCEA 1ZJIA 3OIHA 1DEDA 4GH3A 3ZR4A 3RM4A 3U7VA 3KM8A 1B3YA 3TLLA 1TSIA 4H8HA 4DJEA 3PG9A 3MYPA 3GD6A 4DN1A 1DVJA 3N34A 4H6RA 4YL2A 5A6TC 3REQA 3BSMA 1EP2A 1DORA 3B9NA 3DHPA 3T40A 2QCMA 1VR6A 2OLSA 4PBEA 4J3VA 3UESA 1OGBA 2E6FA 4LF2A 1B9BA 4J4KA 3MUAA 1CLKA 1FDJA 5SWUA 1KFCA 2GVYA 2P5NA 3JZEA 1PPIA 2E5BA 3K8LA 2C6QA 3FY1A 2XM2A 3C3UA 3WBXA 4H8UA 4Q7NA 4D1IA 1BQCA 4IX2A 1PXGA 5AC7A 1TZ7A 4E8CA 2Y1HA 2Z2AA 4Y9NA 1JYWA 4HNCA 1CX9A 2XFFA 5CGQA 4M81A 1OFRA 4RX0A 1JFHA 1H1NA 4B5UA 5ABFA 1VQTA 4I5XA 3K1GA 3EX4A 4HOXA 3XISA 4DUWA 3ZLGA 4H8NA 1F7BA 2REQA 4GNVA 2CBJA 3LY0A 3S1VA 1HKMA 4OJYA 2V68A 1QPNA 4UR9A 1QO2A 1TO3A 1VHCA 1A5MC 4M6VA 2Y5EA 4O8AA 2BZNA 3WQVA 3APYA 3RXZA 4PE8A 1YPFA 1VFOA 1P0DA 4JTFA 4H04A 3UCDA 3TJXA 4WX2A 1D2KA 1HNYA 2G5WA 3BOLA 4H9YA 1UMYA 2B7OA 2V3DA 3QMSA 1U30A 3VNKA 1AFSA 3TYUA 1KCLA 1ODZA 3FXYA 4L5ZA 2NLIA 2CLLA 1WUEA 3IUHA 1ICSA 2QUVA 1ITQA 2X2GA 1PWMA 3QJAA 3K5XA 1J0IA 1XLHA 2VENA 3TW6A 2AKZA 2V82A 4ZBCA 1E6RA 4S3AA 1HKKA 4U5KA 3P84A 4ICNA 4DBUA 2OKTA 1W1PA 4FOJA 1RALA 1M01A 1B2YA 2PDXA 3TN5A 5E6ZA 3ITTA 2H6RA 4PUWA 3MSYA 4RW5A 2HV5A 2Z6JA 1KTCA 3LLFA 4MPKA 2PTZA 3TIMA 4AYGA 1PE1A 1E4MM 4CNPA 3D46A 3C2YA 3IVTA 3B9AA 3WMLA 5DFAA 4EACA 4KCWA 4UZUA 4WXYA 4MIMA 3O6YX 1DWFM 3GSMA 4FXJA 3PC0A 3MO7A 4Q4RA 4IUGA 2QJHA 3HGRA 1Q2RA 4ZENA 1IIHA 2KAUC 2VRJA 1U22A 3WDPP 3L21A 1ZY9A 1FWEC 1FWCC 3S42A 4MKNA 4UFKA 5HMFA 2HPIA 3CWNA 1O6IA 2HNHA 4H4IA 3WLTA 5BRQA 5EMYA 1AVAA 3URAA 3LTPA 3WQPA 5E5CA 1K1DA 2NW0A 1I4NA 3DDMA 3WDRA 4FLOA 1KRMA 4A29A 3SQSA 1ISZA 2CHOA 3QR0A 5DY3A 1YTEA 2R9RA 3GQYA 1I1XA 3M0ZA 1TV2A 3ZJ7A 2CHRA 2VEPA 2XH2A 1EB3A 3BTNA 1T41A 3STFA 3UPBA 3R1ZA 3RJXA 1ADSA 3O0KA 1M03A 2Q3RA 2XINA 3AROA 5DCDA 1BF2A 2UY5A 1R0MA 3BL3A 4FZIA 5AYXA 3UWEA 3VGFA 3WG6A 3B0VC 1ESWA 2I9EA 1OK6A 2GGIA 3GXTA 2EEXA 1VLIA 2DW7A 1P7TA 4L4OA 1KM1A 1JGMA 2X1SA 1KFKA 5GNXA 1WZLA 1LM1A 3MYOA 4LTSA 2PMQA 1CT5A 2AAAA 2DQXA 3QGAC 4HPGA 4R5EA 3G18A 4YU1A 5K3VA 3RFAA 3PHAA 3UR5A 3VIFA 1M04A 3BAJA 1D8CA 4P7RA 4W7WA 4V27A 3PBMA 1I6NA 3T81A 2GQ8A 3DI0A 4P7OA 2DUXA 3V1HA 2IPWA 3BUVA 4X0VA 3W74A 2FPVA 2HISA 4JTUA 4J2MA 2HBXA 5E0KA 3W1QA 3K4DA 4HHLA 4Y96A 1Q3NA 2QDGA 4G7FA 1LZOA 4LW7A 1YDYA 2RFGA 1GVFA 2ZZ4A 2PTYA 1SPQA 5JQ9A 3IJ8A 3QOKA 4V28A 1UP2A 1FHLA 5C2XA 3P6LA 3WN6A 1X6LA 2Z1KA 1AH0A 4UTTC 3DESA 2OLAA 1EOMA 1GKRA 5DBTA 4GGBA 1NDZA 3PPGA 1YE6A 4C6MA 2WYSA 3GAKA 4PYSA 3NA8A 1FCUA 3GVWA 5PTDA 3MANA 3SEPA 1RVGA 4DM2A 5EBAA 1OIMA 3WNOA 1XYZA 2VUYA 5F2LA 3FA5A 1B31A 4MB4A 3E5PA 1CDGA 1OEPA 1BVZA 2XDFA 3VIJA 3TCSA 1D3HA 1PV8A 1ZCOA 4NUWA 3G6MA 5K9DA 1WKFA 4MB3A 3LBMA 2Y6ZA 5LYRA 2WKLA 4NRSA 5FIPA 3T7VA 4UB9A 3CM4A 1EUNA 1E6NA 5E9AA 1LLWA 2X1RA 4L9ZA 2VX7A 1ICQA 4N4QA 5D4YA 3OVPA 5D9MA 4GJIA 5CC6A 1UUOA 4HK6A 4F0LA 5EMKA 5LIKX 4XZLX 3BLFA 4CEUC 1US0A 5FSDC 3BGJA 4GIEA 1VF8A 3OO2A 3H4GA 2RDUA 4H8VA 3H2NA 1W2VA 3HIJA 5HMEA 2WW5A 3PZOA 1BHGA 3NXFA 3BLIA 1Q2SA 1V0MA 3ZSTA 2NQ9A 2YPIA 3QZ6A 1FP8A 3WL1A 4IF2A 1EEXA 3DECA 3BLDA 2YYUA 3DHDA 3QMRA 3TUUA 1JFXA 1EO5A 4A3YA 1XGEA 8XIMA 3HN3A 1GWJA 1TWDA 2R94A 2VWTA 4BHYA 4R9XA 5AZ1A 1ICPA 3M0LA 1X39A 3W72A 4K39A 1VYSX 4KT2A 4MJ2A 3UXAA 3EKGA 4NZJA 4UQ9A 3QM3A 4UQAA 3KOFA 1S3TC 1YDVA 4PEEA 3WK1A 4A3RA 3T2OA 2MNRA 2Y2WA 4BCEA 3LHZA 5MKGA 1NU5A 2JBMA 5CGTA 4HD5A 3ZS4A 4GH1A 4P8UA 1Q6QA 4LVGA 1XW8A 1YXDA 3CIWA 3HQPA 4CLMA 3EWYA 2XIOA 3A22A 5A6BA 4O19A 3WD1A 4AZ6A 4DB7A 5T8GA 3IANA 3M5XA 4ZTYA 5LNUA 3CH0A 3INPA 3LRLA 2BV9A 3CLMA 4Q8WA 3S3GA 2YDQA 4JDBA 4X0NA 5AVNA 2JIEA 3IJIA 1DOSA 3UYIA 4OGZA 1RH9A 3GR7A 5A95A 2HVNA 3EWBX 2QCDA 2F6KA 3B3DA 3RG6A 3BMWA 3R0DA 3UF9A 3TAKA 4C5YA 3TA6A 2I17A 1CWYA 2PI6A 4YVVA 3WD4A 4IZGA 4JYDA 4E4UA 5DT7A 3P93A 2CITA 5A94A 5CZJA 3W7QA 1V3HA 1Z42A 1ADDA 4MZYA 3LV6A 3RM8A 1K8ZA 4MWAD 4JKKA 3NYDA 3CUZA 3G1RA 5LGZA 3VGHA 4MG4A 1ONXA 5E9XA 4A3QA 2H90A 5TNVA 4C60A 2O9TA 5JBFA 2FLIA 1O5XA 4NJHA 4MMWA 3WLKX 2HZGA 2QF7A 5LIUX 1C3FA 5ENLA 2NX3A 3W1PA 2WCSA 3U7BA 1M68A 3MJYA 3L4TA 4FXRA 1M5WA 3CO8A 1ZGDA 4FNRA 3LGEA 2NVDA 4D6HA 4GX8A 1LRTA 3HPSA 4JEQA 3THQA 2Z25A 4OIFA 4ZEPA 3B0UX 3BK0A 4JDYA 4GBUA 4A8NA 2OEJA 1GYMA 2FJKA 1IE7C 4B9ZA 1XC6A 4GG9A 4Z1CA 1OY0A 3GC5A 3DERA 3M4HA 4UCGA 1IYXA 3P8JA 4L64A 5D02A 2V5KA 3PJWA 4ORIA 3UG8A 3ZVHA 1DP0A 4AF0B 4MY1A 5AHLA 1MUWA 3ZT5A 3O06A 2VCAA 3GG1A 1D3CA 4PEKA 2BNJA 2HE5A 1PYFA 4N4PA 1E1CA 1F8IA 1S2TA 3AYTA 4WUIA 1DPMA 1UD6A 2QNEA 4M82A 2OR2A 1QWKA 1O66A 3KTSA 3GRIA 1LUCA 1E6ZA 1MRQA 1UKPA 1AG1O 7ODCA 4S38A 3CQIA 4Z2KA 3K8MA 4N42A 1VEPA 4ZE5A 1TTQA 3U2EA 1EF3A 2EGZA 3CHFA 4IP4A 4Q8QA 3H53A 1AQHA 5JBDA 1VYRA 1XYAA 4EWND 4UTWC 1HZYA 2HEJA 3CWHA 3VMNA 2BMBA 3R8RA 3F2DA 3ZR6A 3LX9A 4GBDA 4HN8A 4AIBA 3CUGA 2FMOA 5F2MA 2J4GA 5I3IA 3H8AA 2OGYA 4AU0A 3RCMA 3PWGA 4HU8A 1AW5A 5HUOA 1OCNA 5F4SA 1KM2A 3DZ1A 3DBPA 7REQB 4FIRA 1FFQA 3EBVA 4EX4A 1CGTA 2CLOA 1GZGA 3TNBA 2NUYA 1VH7A 3SCTA 1W1YA 3QMTA 2ZXAA 5KZDA 3S6DA 5BOFA 1MZRA 4ACZB 4GJ1A 4IMFA 4M19A 4RNHA 3TQKA 2VRKA 2HK1A 2EPLX 1FFRA 1OF8A 1PDZA 1QTWA 4ZB0A 3L4UA 2WSPA 1GHSA 1R86A 5L6UA 1N7KA 4RW3A 1SYTA 1E9YB 4PTWA 3TC3A 2YGYA 3H22A 4D8AA 3U5UA 3KWXA 3UY7A 4JTDA 3AJ7A 1OF6A 3KTXA 4XAFA 4HMDA 1QATA 1K8XA 3EDDA 1UIOA 3WSUA 3V3WA 1FWTA 2PPGA 2V5JA 4ZTXA 3L5LA 1VB9A 5LZLA 1E0UA 1AUSL 3WO8A 3W26A 2B7NA 3GYEA 4IMCA 1CGYA 1TE1A 1JQXA 4EPKA 3PBUA 5JIPA 5AHMA 1K4GA 2EF9A 2QCGA 4FEZA 5C0QA 1L6YA 3H2FA 1TPFA 3LK6A 1RVKA 3EWZA 3WLLA 1B3XA 4HU3A 3TN3A 5I02A 3MWCA 1ZHAA 2CLHA 3SW6A 3TV8A 1WZMA 4R85A 4UTTA 3VZZA 2I7GA 5I79A 1EUAA 3ABQA 1XLGA 2AQVA 3LNMA 3R0UA 1VGAA 1KW1A 1VFHA 4LUYA 4JTHA 2Z1SA 3C2EA 1VPXA 3CT7A 1EDQA 2ZICA 4HJFA 1FWFC 3REQB 3WIJA 2WMIA 2V63A 3GX9A 1KCZA 4H9XA 1C8VA 1NP0A 1O5KA 2G97A 2ZZ1A 1MXGA 3P82A 1MXDA 1S2VA 3H21A 2E5DA 2D2JA 3LDVA 3O0FA 2XJ7A 4NJJA 4IGSA 3NGFA 5F2IA 2OGJA 3B8TA 1W0MA 3EKLA 4TX9A 3Q94A 1H7WA 5G2WA 1JPDX 4Z08A 3VAVA 3PTQA 1QASA 4HQVA 2IW0A 1TREA 3A4AA 3MKVA 2JKPA 4A4AA 3HQ1A 1F74A 1P6WA 2PTDA 2Y0FA 5CPTA 3RLUA 5KINA 5ABFB 2Z7GA 1K9EA 3UT0A 1KTNA 3VPLA 3KUMA 4H19A 5HANA 2UY2A 3EA3A 3RJYA 1EC8A 2YDAA 2XSBA 4Y9AA 3G1YA 4R9OA 4Q6JA 1K8CA 3UXLA 4NNCA 3NVDA 1RV8A 3JR2A 4DWSC 4FS9A 3STPA 2ZDSA 5EL1A 4O0KA 4UMAA 1E3XA 1I0DA 4LRSA 1JDAA 2J7BA 2Q02A 3TMQA 2DFAA 5FJIA 3C86A 4UTLA 3R6IA 4F0KA 1VFSA 3SUSA 1E6XM 3V5OA 3OJGA 4ZB2A 3A4WA 3DI1A 3VX0A 1P48A 2WHMA 2ZRYA 2XU2A 3OVGA 3PAJA 2NV9A 3FN9A 2DPEA 4XQ6A 2TYSA 1T96A 2OKOA 2W67A 3CK5A 4K1WA 3AIBA 5J8LA 1NARA 1M3UA 4FAMA 3ITOA 4JAWA 5A8GA 3BSHA 3QF0A 3KLLA 4PRWA 1MYRA 1XXXA 1E9ZB 1R3QA 3WEMA 1UD8A 3K1DA 1OX4A 1QHOA 4PUMA 3WQEA 4NSBA 3AIQA 3GHUA 1XBVA 5AVHA 3LSBA 2I5QA 4OV4A 1FY6A 1TPDA 4IIGA 1ZJBA 1GVYA 4MKSA 4NXKA 4MWAE 3EZ4A 1K70A 4FF7A 1V51A 4PTNA 2C71A 2BVYA 4DYEA 4H00A 1HKIA 3FS2A 4H9ZA 4K7YA 2VL4A 1P1MA 4WJXA 2Z1XA 3GDBA 1B3VA 2VRQA 4ZE4A 3W7PA 3VABA 5E6YA 6TAAA 1NFPA 4LU0A 3H54A 2C79A 4LAUA 1QUMA 4IPNB 2PE4A 4QCFA 1O4UA 4BWLC 1EZWA 2VVSA 4ZQMA 1CPUA 1LRNA 1A0CA 3AS0A 2BB0A 4IGHA 2EPOA 4HA0A 3LCXA 4KRUA 3P61A 1GOXA 3BG3A 4Q32A 4GMEA 4HHMA 3WK2A 4G6CA 3T05A 1RD5A 2CBVA 3P2VA 3CB3A 1GJWA 1UYQA 5AC5A 1Q6LA 1NAL1 4ZA0A 1XYBA 2OQHA 3GUWA 3VFLA 3KTCA 3EDJA 4AWTA 2PODA 1TWZA 3N17A 2O55A 3ABXA 4OECA 1CIUA 5CPLA 2D23A 1P7TB 3RM9A 1FHDA 4AZ5A 4H01A 3AMLA 3KS5A 4RL3A 3Q2DA 1NJJA 3O8AA 3LN3A 3KBJA 2BP1A 4XTIA 2QGHA 2ZZ2A 4KFPA 3WDIA 2OYMA 4YWSA 5DT5A 4I5RA 1S5VA 1DBTA 1U1HA 2DZTA 3O6DA 3N4AA 4DF1A 4Z2GA 2HWGA 2P0IA 4L9XA 1KXVA 2PWVA 1YXCA 2AMGA 1JZ3A 4PMNA 1OFPA 4IXXA 3WFLA 4TVCA 4MF4A 4HZ8A 1RJRA 1LQ2A 2AKMA 9XIMA 3CLWA 2TAAA 3QQ0A 5TQLA 4Y6GA 1TR9A 5I5RA 4Q8TA 5G4WA 4FLSA 4A3HA 2ADAA 3GH7A 3UPMA 4MADA 3WUGA 3VIHA 2BVTA 1JCXA 3KLKA 1WOAA 3KBVA 4D6CA 4RKAA 3OVQA 3VMOA 1RQBA 1KFBA 4DEFA 3LMYA 1XIGA 4RPPA 4CGTA 6A3HA 1TV5A 1RLDA 1CZ1A 3BVJA 4LBSA 1FKXA 2W92A 1DXIA 5CZKA 2WJEA 4AMCA 1SW3A 3D3FA 5G1YA 3JZUA 4J3TA 1ODUA 3TKFA 3N2BA 4QM1A 1WBJA 3NJ3A 4L61A 3HURA 3ANUA 4RPQA 2QDEA 4AD3A 3B04A 5LIWX 4PULA 4UTWA 5D9NA 2OMAA 3STGA 4Q8PA 3K8KA 3CNYA 5E0CA 4IMAA 1Z6KA 3CQ0A 1OD8A 2QVHA 4S3CA 5BXSA 4AZIA 4WSHA 5HOSA 2J88A 1DWAM 4IUOA 4QR6A 3IPWA 3MDUA 4LUIA 4QRNA 1E73M 1MDRA 3TW9A 1LQ0A 4LEQA 2ESCA 2QZRA 1J5TA 2CWNA 2FGLA 3ATYA 5CPSA 1LT7A 1TV7A 4DWDA 2XVNA 1NOUA 2FHBA 4IG2A 1XYMA 3V0SA 3TLQA 4MUZA 2DJLA 4AIEA 3IK4A 2JIWA 1TQJA 3VD3A 3VCNA 1GQLA 4BJHA 3WFZA 5CXPA 3SQLA 9RUBA 1YKWA 1TR1A 3S9IA 4Z2LA 4WZHA 4TU1A 3WFAA 4E2DA 3KVMA 1PYMA 4V15A 1XIDA 1ENUA 1ZUAX 3LGDA 3UP8A 4B5NA 3NPWA 1DWGM 3WQ6A 1V0KA 5A2BA 1OFAA 3QC0A 3O15A 4MLRA 3CB8A 4QG9A 2GPTA 4R34A 1KFEA 1SO4A 1KKRA 3NQVA 3AU2A 3NPXA 4G56A 4FXFA 1H3GA 3NO3A 1CGXA 1QNOA 1KO0A 5MKGB 3CHDA 3JS3A 3F5LA 2EBNA 4A05A 2YBUA 3IAQA 5CBBA 4OHQA 4ONVA 4M6UA 4GIRA 5A6LA 1I45A 3PFMA 4FOUA 1N55A 1WV2A 2QJGA 4RZ4A 1RP9A 1HL9A 1FWGC 8A3HA 2OWCA 2PBGA 3AISA 3MVIA 3NIYA 1ZU8A 1W3LA 1T8QA 2Y5SA 4TV5A 3GG0A 2VFEA 1AJZA 1S2UA 4HYVA 3O07A 4JTIA 2Z2UA 4PMZA 4YCPA 3B4UA 4GQBA 3QQ1A 1QW9A 3T55A 4KEZA 4LAOA 4L1WA 3CEPA 2ZIDA 2QT3A 5C54A 1J0YA 1L6GA 1KRAC 2QCDB 3GDRA 1E9LA 3GFXA 4LAKA 2R1KA 3SURA 4KCUA 4WF7A 1SZEA 4P61A 2YFOA 3ECQA 3K4AA 2F38A 4HZ6A 1ZL1A 3N2MA 2DSUA 5M17A 2Z27A 5HATA 3UD6A 3LEPA 4IX0A 1ELSA 3E0FA 3E2SA 4GI6A 1P0EA 2J8GA 3AHXA 2Z1VA 2R14A 3OP2A 5ABHA 5IHSA 2R1NA 1GOMA 3W7DA 3LCHA 4E4PA 3GIPA 4C6IA 4X63A 1XQLA 2BHUA 3PJTA 5ABEA 4RK8A 3BLEA 1D8WA 4XUYA 4JNMA 1S2WA 2QCFA 4W8AA 1B3ZA 1GOWA 1E0XA 1GG1A 2G95A 4A21A 2ZOXA 1LF1A 4OQVA 2R24A 1X97A 3GXNA 2E68A 5CAKA 1MO0A 1TWSA 2OZTA 5HWNA 3W7CA 2NXGA 3QOMA 1C7TA 3PPHA 4DWSA 2DSKA 3LHTA 3H4XA 1U1UA 1HGYA 5EMLA 1X8FA 3F4WA 2PWEA 1FHUA 3TJLA 3F4DA 3V5CA 2D24A 3M9YA 4RDZA 2VD8A 1I2NA 3WMSA 1XGZA 4GY1A 3K46A 4EWJA 1RHCA 8XIAA 5A69A 1SFJA 1Q66A 2H3BA 4LGXA 4MYAA 2WC4A 1SJCA 2Y7EA 5FKYA 1JZ7A 3URNA 3B9OA 1XX1A 2C19A 4B91A 3GLCA 2ZRXA 5EU9A 5XIAA 3ITLA 1GG0A 1XPYA 1IXNA 4D72A 3VZYA 3ZVHB 4S3BA 1FWHC 1I2OA 2WJZA 1XH2A 5CGMA 3EAUA 3PF3A 1JNDA 2ODOA 4M7TA 3E12A 4FPSA 3GH4A 3TSBA 3GAYA 5KZMA 1E1CB 2D22A 3O2LA 2WVVB 3TW7A 1VPQA 1XIBA 2BODX 1B54A 3QY6A 4PB5A 5CPQA 1SU5A 2E67A 3ARPA 1DJGA 2Z2BA 3SCPA 3AZRA 1WYIA 1XLCA 1LUCB 4FX7A 3DC8A 3PANA 3TYCA 3KEHA 4PCPA 3RRAA 1A0EA 1J0JA 1WDDA 2OXNA 1PZ1A 3E02A 1PIGA 4US5D 3C0SA 3NURA 3FXGA 3BJTA 3WENA 4MWAC 3UWUA 3GNOA 3DFHA 2VFGA 4LB4A 4ZO8A 4AISA 3LI0A 3TROA 2PCQA 2X2YA 1Y8BA 5E93A 3PUEA 2E8ZA 2WZTA 2YKKA 4BWLA 1OYBA 1JZ6A 5C9WA 2ZWZA 3UR8A 5MF5A 1QI4A 4IIEA 4LH8A 5GJMA 3KX6A 3MI3A 1P4CA 3GNRA 1I75A 3C0QA 1V8EA 4CNOA 4MNLA 4DNMA 4GIYA 1F5ZA 5EB8A 4ERGA 3IV3A 2QV5A 5DMYA 1HG3A 3ONCA 4C91A 3ARVA 4FSAA 1AJ2A 3CZLA 3CH9A 3ARQA 4DBDA 4Z1AA 2E1WA 3D47A 5D2XA 1R8LA 1SR9A 5DELA 4UQCA 3KBWA 2WC3A 2XVKA 3TTOA 3HM7A 1L6WA 2WVSA 3WBWA 1S2AA 5AYYA 3CL7A 3WH6A 3TYDA 4A35A 2GUUA 1QK2A 1LOSA 2DGAA 3Q4DA 4ZQCA 4JHZA 3PZGA 1PTAA 3H2MA 3CUIA 2ZXBA 4KWWA 2BTMA 5BWAA 4NNAA 3CWOX 4U10A 1IEWA 4M6PA 2QJNA 2EG6A 3CC1A 3T0DA 3O6CA 1A5KC 1JYXA 3CUHA 4J3WA 4QJ1A 3FV9A 1UWAA 3OLGA 2X0SA 2PDLA 4C6QA 3VNIA 5ECVA 3W2NA 5LXXA 3B03A 1REQA 1FCVA 3LMZA 4WR3A 4POCA 4NZ4A 2NT0A 1FWAC 1HL2A 4LVDA 1S3HA 4JYEA 3HV9A 3PBGA 4HCHA 4KEVA 3TA9A 3KRUA 2O56A 3G1FA 4EKJA 4JEJA 1VPYA 3MP4A 4U2ZA 2ZX6A 2DH2A 2GJRA 2E0PA 3KVLA 3OZMA 4LF1A 3VI2A 3CYJA 5T91A 5AECA 4FIQA 4LOCA 3VVGA 4AAJA 1NY1A 1UOKA 1TX0A 3GVQA 1RBAA 1MW3A 2TPSA 4NX5A 4TOQA 4MFEA 4UMBA 4O1AA 1JJKA 1MI3A 2IMRA 4IIFA 3GTIA 4JFTA 2J66A 4YTRA 5LA1A 3PWAA 1JIBA 4EPEC 4GJJA 3O7UA 3L4WA 2QIWA 4C6NA 1H51A 2QF8A 3BW3A 4DLFA 5D8WA 1R3WA 2EQDA 1PZ2A 3XIMA 2IQ0A 2HTMA 4QP0A 2PF8A 5D33A 3ABRA 1XIMA 3W1MA 2QGYA 1J93A 3DUGA 3E0WA 1SZFA 4FX8A 1DXEA 3WQFA 1MNSA 3U0HA 3N3TA 2P0OA 3QSTA 1K6WA 1JCYA 1DJQA 3EX2A 3C3NA 1KM4A 4AEEA 4LUJA 1PCWA 1UH2A 1A3WA 4ATLA 3C2OA 2CXGA 1EXBA 3WF2A 3RITA 4MDPA 1G4EA 4YPJA 4EAMA 5EFDA 1GVIA 1HW6A 2P3EA 4ASTA 3BQ5A 3WJWA 4JFSA 1AK5A 4RCXA 4PA8A 1I8JA 3CT2A 1A4MA 1OFDA 3P60A 2VR4A 2PC8A 4J3XA 4W86A 3VNDA 2A3CA 3EPOA 2Z00A 2GJLA 3AUOA 4WOQA 4IGMA 1ZJHA 3KOWA 4BQ2A 2I14A 5A6SA 1MXSA 1QFEA 3G5EA 4D8ZA 4IGNA 4DX3A 4QX4A 3UNTA 4DJDD 3UJFA 1B4EA 3AFBA 1MVYA 2YZ5A 1AW1A 4KESA 3BW4A 4BZYA 1GQIA 5KZ6A 1GPWA 3KVKA 3W53A 5DX7A 2W5FA 1CB7B 1XH1A 3S2NA 4A2RA 1XFCA 1TTJA 3HZ3A 5CBIA 3LPOA 4PODA 4O4WA 5JH2A 1FH7A 2RDXA 3S9ZA 4DNHA 3A5VA 3E2QA 2X1TA 1JDDA 1W3HA 5HDRA 3EWDA 2WNZA 4JTRA 4DM1A 3K2GA 1XC4A 2E40A 1QCWA 3ARYA 4TR9A 3WLOA 1JR1A 2AAMA 3P8IA 4HK7A 1LCOA 1OB0A 2WMJA 4I7VA 3O16A 3B0YA 4GWEA 2XIBA 4DYJA 3UJEA 3WQ8A 2J13A 1B3OA 3CV6A 3N1AA 1JCMP 4JIIX 3OYXA 2VURA 4LYQA 1HVQA 4HZ7A 3V35A 3BQ6A 1VKFA 3T07A 1S1RA 4PMOA 3S9YA 2V69A 2V2HA 4GXWA 1DXFA 1QVBA 1W9BM 4ZMGA 1XYCA 4W7VA 3SGUA 4HPXA 4E0CA 4PGLA 4I9JA 4XVEA 1BTCA 1R5YA 1DTUA 3ANVA 3VD9A 4LUTA 3KOXA 2C15A 3GB6A 1G5AA 4GQRA 3GM8A 4UXDA 4FNSA 2C1IA 3M41A 5CCZA 1MEWA 4LFYA 1TPB1 2FZBA 1PHQA 1XL9A 2QDHA 1X7IA 1AZ2A 1EJRC 3II1A 4BQ3A 3TSDA 2EXOA 3MBFA 1XYLA 2DIKA 4HZMA 4KBXA 1V0LA 1WXJA 4W84A 1AL7A 2IXVA 4KCTA 1DJIA 4A8IA 3WBYA 5AFDA 2F2HA 3LU2A 1JNEA 1OYAA 4P7LA 3UJSA 1XRSA 2B81A 3N4FA 2AGKA 4LRTA 3UBPC 1YXYA 1ZENA 2I5IA 1LWJA 2PWUA 1KC7A 3W70A 1IT7A 3FA3A 1VENA 4R88A 3SSJA 5CSUA 3CUJA 4TQTA 3DN5A 2DEPA 4B5WA 2AOSA 1HQTA 5H91A 3E9AA 5I2UA 1XHGA 4LUSA 2FZ9A 2HDJA 2PU1A 4IQJA 3IV8A 3STCA 1JUBA 4DZIA 2OO6A 2Y88A 1MRAA 4QSFA 2VX6A 1CYGA 1GJUA 4V1YA 3H24A 4GVGA 4P7QA 4JIHA 1UWSA 1XM3A 4D9PA 2DZWA 1WBHA 4O50A 3IIPA 3LBOA 4KGJA 2W3ZA 1KM6A 3SCNA 4O0QA 4EXBA 5FF0A 5KZEA 3N2XA 2CETA 1VCFA 5C6MA 3ZVIA 5I3JA 4RXGA 4MWAA 4JICA 4UFHA 1H63A 4PSRA 2Q71A 3A64A 4P7NA 5BXRA 2PTXA 2UBPC 3EDEA 3NYZA 4PMRA 4GUHA 3B0PA 3TXZA 1Q4WA 3N18A 3SECA 2CCRA 2F7FA 3H70A 3K30A 4GD0A 4M51A 4F2UA 3IRDA 4C6EA 4L7ZA 1XDLA 4O13A 1HL8A 2VI0A 3N2TA 2OEKA 3SCOA 3W2JA 2V8ZA 3N14A 3DIPA 1SQ7A 3V16A 2DY3A 1LDCA 1TJ1A 1LYXA 4PTMA 3W2LA 1H1YA 3FSUA 4Y9PA 3YPIA 4HMCA 2EPHA 3IJ9A 3PTMA 1EX1A 4IG2B 3SN4A 3WK0A 5KETA 3ZSSA 2XSXA 1MMFA 4AQLA 4C1LA 4N9EA 1VRXA 1A53A 1RK6A 2BASA 1UA3A 4LB3A 1S38A 2Z26A 4PBGA 2O0TA 3GDLA 3CS2A 4ZQRA 3PB0A 3KS6A 3QGKC 1PAMA 2YW3A 2QUMA 3WELA 4XD6A 3UZZA 1J6PA 3NVTA 2HBVA 3EB2A 3GTNA 3WJYA 3AZSA 1B4KA 4ROPA 3VOIA 4CCCA 4F79A 3P74A 4FNTA 1SFLA 5EMMA 3QBUA 4XZNX 4LCRA 2CHNA 3R11A 3S2CA 3W1XA 3QR3A 3N11A 5AN7A 1SJDA 3HV8A 3E3HA 1K02A 4ADTA 4JKLA 7TAAA 2ABBA 2PSNA 2DVTA 1HJXA 3R7MA 4DZAA 3WQCA 2BG5A 1JI2A 3NL2A 3ZJ8A 2IKJA 3RIKA 2G4FA 3GDTA 2Y89A 1X38A 2V2CA 1E4NA 4IPLA 3UZYA 3V75A 1DE5A 1RCQA 4R3UA 4DHGA 4NY2A 3F4CA 3W22A 2JEPA 4EXAA 4CQDA 3KE0A 4N6EA 1RPKA 4Z17A 4EPBC 1NM9A 4RUBA 1K6AA 3MSRA 2BOGX 2ACSA 2DT1A 3JRKA 3W1NA 3EX3A 3OA5A 2O4QA 4XSMA 1H5VA 4K7VA 4J2PA 3BV4A 3BICA 1R46A 3WBAA 2NXIA 2C1HA 3DFQA 4UTJA 2JGQA 3PWIA 1WUFA 3IIVA 3NQ7A 2NQLA 4IHCA 3W02A 2PRMA 4BQ4A 3C56A 4ERAA 1VRDA 3LQLA 2W9MA 2J7FA 2VDHA 2WANA 3LM3A 3LXBA 1LL4A 5ABGA 1DIOA 1XD0A 1RLCL 1UIPA 4UTMA 1SZNA 3S5NA 3SRDA 5KMYA 4Q8VA 5AHIA 1EA9C 2YW4A 3L2LA 3R4IA 3C6CA 2NX9A 3TFXA 3CHEA 4UFIA 3B8UA 2BXZA 4DWSB 4K6AA 4JFUA 5IFTA 2WV8A 3AHVA 3JVAA 5M5DA 3WQWA 4CNTA 4F0SA 2OX1A 3CTTA 2C0HA 3I4EA 2R1MA 4QLJA 3SB0A 5K9CA 2EKGA 1HN1A 4WVXA 3PUOA 4CN1A 1HJSA 2HRWA 4WDTA 2WHLA 4E2VA 2NWRA 1XICA 1LROA 2Y4SA 5HA7A 4P2VA 1H61A 2QLYA 4PMVA 3GC2A 1R2RA 2J79A 2W63A 1DJYA 4GKTA 5G4EA 1EWEA 2GSHA 1GKQA 4O28A 2GUBA 2FVMA 1A50A 5E70A 2D20A 3GUGA 3NDYA 3QQWA 3P80A 2DSZA 4PB3A 4YHGA 3PFRA 4IP7A 4PFHA 4B2DD 3V0TA 3T0CA 1WDWA 5U7SA 3ZLFA 1XCXA