3RNDA

W116i-oye1 complexed with 2-(hydroxymethyl)-cyclopent-2-enone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalytic Reductions of Baylis-Hillman Adducts
rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rndA00
4L4LA 1L6YA 4MOZA 5AN7A 3OBKA 2E77A 2DZTA 4B5NA 3ZFHA 1XUUA 3UZ5A 4P61A 3W88A 2GQ9A 1C8VA 1LDCA 2ZRYA 5DCEA 3DHFA 5F2GA 1FQ0A 5DLCA 3NQMA 5DXYA 1LRNA 4WJEA 1TQJA 4N02A 5D37A 3W83A 3THAA 1BWKA 1PE1A 3W87A 2GJLA 3LHZA 5H2ZA 2DJLA 1X6UA 3QFEA 1KM1A 3WK0A 3O6YX 3RU6A 3GR7A 1LORA 3VI2A 1HO1A 2YPIA 3BW3A 5D03A 3NZ1A 1JCMP 3G8RA 3TW7A 5LGZA 3EXTA 3IRDA 3PSWA 1LLZA 3LLFA 5C55A 2ZCGA 3N34A 1KM5A 3B8DA 4OWGA 4AF0A 1PHWA 2I1OA 2ZZ3A 3Q94A 5EKYA 3C2OA 3HGOA 2Q3RA 4RZ5A 4LS1A 4HIBA 3HGRA 4H4IA 4QQ3A 1WOAA 4QJ1A 3W1TA 3W7JA 4DQWA 4HNUA 1ME9A 1O4UA 3JS3A 2AAMA 4PL1A 1XM3A 3G3DA 4AEOA 4EIVA 2CU0A 2PRMA 1TTIA 5DCDA 5CZSA 4MJZA 5D32A 1FX6A 4BWLA 4KWWA 2BTMA 2ALDA 4CNNA 3CM4A 1SU5A 3ZWTA 5HJLA 1O60A 4N9BA 3I7RA 3L0KA 3EWBX 1Q45A 2QCGA 4Y96A 4CQAA 1MEHA 2DJXA 1SO4A 1NVMA 1MZHA 2CZDA 2BXVA 4JS3A 4MUZA 3EXSA 4I7WA 1EUAA 1YXYA 1OX6A 1TV8A 4UTKA 3IVTA 1W5PA 1GYNA 1S5VA 3C3NA 3TE9A 3W2NA 2A6LA 4YXGA 4CLMA 4O18A 4WX2A 4IGHA 1CX9A 1NF0A 2NX1A 1QCWA 3QMSA 1EA0A 2VFIA 3UY8A 2QAPA 1KA9F 3IIPA 1EP1A 3L0GA 1R47A 1QNVA 1W56A 2KZHA 3W7CA 4JYDA 1L6SA 1SW0A 4BK9A 3PUDA 2CLOA 4EF8A 4NT0A 2V2CA 3M7WA 2VOMA 4ML9A 3UPWA 4S1FA 5E0KA 2HS6A 3G0UA 4ZQCA 1LRTA 2V2DA 2OJPA 3GR8A 3R89A 2ISVA 1PVNA 3UYCA 3MYPA 1WQ5A 4C1KA 2V2HA 2A2IA 1X8FA 3PBWA 3P5ZA 5I3GA 1TMHA 4IMFA 1OF8A 3EWYA 1FDZA 1VLIA 1W5MA 2QDGA 3W7IA 4JYFA 2YX0A 3R2GA 3IIVA 1L9WA 2FDSA 2WSRA 5HQEA 2DZVA 3RNDA 3UXDA 3CWOX 3HGJA 2Z6JA 1KM3A 4PFMA 1KFCA 1WA3A 1KFKA 2B7QA 3LCIA 1AW5A 3WJSA 3S5ZA 1OFBA 1QR7A 2J88A 5CKSA 3CTLA 5I3KA 2PRLA 1FY6A 5EY5A 4ALDA 1TPC1 3W86A 4AWUA 1OX4B 3HGSA 1W3TA 2EGZA 4QM1A 3D0CA 1BWLA 4ZQOA 3C4UA 4PC8A 3I68A 3MMTA 2JKPA 2OCZA 2FJKA 2G96A 3S8HA 3ABRA 3IEBA 1OK4A 2OT1A 1KM2A 1H60A 2JBMA 1JCXA 4O19A 2E6YA 4ZMGA 3NL5A 4O13A 3MWAA 3F4WA 3NQFA 4JDBA 3CIXA 4ZQMA 4RV8A 2ZA3A 3PY2A 3W72A 2I14A 5CG7A 3A5VA 3PM6A 5BNKA 1JUBA 1G4EA 5G1TA 4DO5A 1KM6A 5DY2A 4BI5A 3W7HA 1GTHA 3M9YA 3SSJA 1AW2A 4UFHA 5GVJA 3M5ZA 4FNPA 4MJMA 3CC1A 1HTIA 1F5ZA 1TYGA 5G2HA 4XZ9A 1TTQA 3NPWA 5KSWA 1FDJA 2QF7A 4JTGA 4JY9A 3A22A 4UR7A 4NNCA 4RXFA 1G6CA 1UUOA 4K8HA 4AWSA 1ZJIA 3UWZA 3KRSA 3DAQA 1P4CA 3LHVA 1TPEA 1X7FA 1Y0EA 5BW6A 1S5TA 3O63A 3IVSA 1IF2A 1DQXA 1OYCA 1XDLA 4JGDA 6ALDA 1OFOA 4FNSA 3G8EA 2EPHA 3LTYA 2E1DA 4RX0A 1FCBA 3P61A 1C29A 1QOQA 5G2IA 3RLVA 1DHPA 3SW6A 3G1XA 5AC8A 1QWGA 3ATZA 1TTPA 3DI0A 3P82A 3MBDA 2FPYA 5KINA 5D04C 2YYUA 3P5YA 1F7BA 1I4NA 1OX4A 4R33A 1W0MA 3QSTA 4DF1A 5ABTA 4HPXA 4DBEA 3O15A 4K39A 1XCFA 3RLUA 2NWRA 4RZ4A 2ZDRA 3EWXA 3ABQA 4JICA 5D33A 4H6KA 1AL8A 1DJNA 1G4PA 3SJ3A 3THQA 4ORIA 2CLFA 3MI6A 4UMAA 1Q6QA 2NXHA 1RQEA 1XBXA 3O05A 1DKWA 1FCUA 4O17A 5FF2A 4UFIA 3NQVA 1E51A 1QOPA 5C6MA 3ELFA 1EP3A 3LCWA 3TQVA 3NG3A 2J9XA 5FF7A 1TPVA 4LVGA 4M19A 3W1UA 1OVDA 2WPBA 3L66A 1H7OA 4GNJA 4PEKA 2BX7A 3MHGA 4NJIA 4O53A 2LLEA 2V9DA 1FWWA 4UTMA 3TXZA 4P2VA 3EB2A 5E93A 1OG0A 2ATSA 3DFQA 4PCFA 2Y7DA 4O16A 5C2XA 1LOSA 1YTDA 3GNNA 3NO5A 5I3FA 3QPYA 3PULA 3R5EA 2VFFA 4NJJA 1H61A 2ZRVA 2YGYA 1OFPA 3L2IA 3QH2A 1QMLA 3TJXA 4OT7A 4GUJA 1NSJA 1I2QA 3RK8A 5D02A 3GDLA 1JULA 1DL3A 3EX6A 4PTNA 4YMZA 4OV4A 5KITA 1KFLA 2VEKA 3A5FA 1I45A 2QCEA 1ALDA 2GVGA 2O7SA 1BTMA 1ZAHA 2ZRWA 3P60A 1VH7A 1HUVA 4KFOA 3G22A 3BVJA 1OJXA 4S2BA 4Z1AA 3MHUA 5HUPA 1AG1O 3UQNA 3G1HA 3IVUA 5DN1A 2NUXA 1J5TA 1SO6A 1K8ZA 1SFLA 1H7NA 1DV7A 4O1DA 3S1VA 1LOQA 4K6AA 3GXTA 2O7QA 2WKJA 4DXVA 1IIHA 3LBMA 2QJGA 2WNNA 1DORA 1PCWA 5D2WA 1DBTA 1WBHA 3PB2A 2VEMA 1TJRA 1HG3A 2GJNA 3HG5A 2NV1A 3W7OA 1Z42A 1W8SA 5LKYA 4CCEA 3B04A 3DKJA 3B05A 3GK0A 2JKEA 3BV4A 1OYAA 3LX9A 4IMGA 5K9XA 2XFWA 1OFEA 3TH6A 3KVJA 5KMYA 2ZA2A 2QCDA 3TW6A 3N19B 4O4WA 2FB3A 2NXIA 2Z0IA 2DZUA 3FJLA 4M6PA 1UCWA 5I3JA 3TMLA 1EWDA 1UBSA 2C18A 1SW7A 2E5CA 3KVMA 1IXQA 1OFRA 2CLMA 3B0PA 1GWJA 4EOUA 1R30A 3NQCA 4WOQA 4LRTA 2CZ5A 3W7LA 1YYAA 4JIQA 2NUYA 2B4GA 3LV5A 5HUOA 2V0TA 1VYRA 2EAWA 4BF9A 4IJBA 1ADOA 5FEXA 4K7YA 4UTTA 1H1ZA 2VFDA 1T8XA 3HG2A 3DI1A 4MPQA 3TC6A 5DELA 3QC3A 4MY1A 4UXDA 3QRHA 3FKKA 3I7QA 2QUUA 2TYSA 4O8RA 3O6CA 4JTIA 4FXRA 4K36A 3CEUA 3UWYA 2QCMA 1AW1A 1GVSA 3GXPA 2X1SA 5BMXA 3MO7A 4JTFA 1OYBA 2P10A 1SO5A 4J9JA 5J5DA 4GXMA 3OHIA 3F03K 1ZHAA 3EX3A 3C2EA 1JQVA 1A5SA 1GVOA 1WAUA 2JK2A 2G5WA 4X3ZA 3QMTA 3O8AA 1KLYA 2V82A 3DH7A 2ZYFA 4JY8A 5BRBA 1EUNA 3O16A 3IIXA 3MI3A 2NX9A 1SFJA 3AJXA 4UR8A 3G0XA 1MO0A 1L2UA 1H7RA 1A5AA 2X16A 3TU9A 3LHTA 2QDHA 1SW3A 1Q3NA 3UWVA 2YR1A 5C54A 5EA9A 1F74A 1U83A 3HF3A 3NZRA 4UMBA 3TR2A 4GWEA 1LP6A 3P80A 3F1QA 5G2WA 3W76A 5LHEA 3P62A 4O1BA 4NJHA 5HINA 3TQ0A 1GYLA 3DFTA 4MYAA 4QIUA 2XN2A 2X1RA 3G0SA 4O57A 1OX5A 4X2RA 2EF9A 3PBVA 4HPJA 4HHPA 3NQ2A 4Z0JA 4CNPA 3HQ1A 1TB3A 5IM51 1ZAJA 5AHEA 3NPXA 5H91A 1SPQA 2ABBA 1KFBA 5K3VA 3NNTA 4BWLC 3M6YA 4CCDA 3WK3A 1EP2A 1G7UA 4R53A 3TV8A 2NXGA 4IOTA 4JEQA 5AYXA 3NQDA 5MHBA 1YTKA 3LV6A 1WXJA 5KZEA 1A5CA 2QJHA 4RCXA 3N73A 4UTWC 1V5XA 3G1AA 3MBFA 3B06A 2ZFAA 4O0KA 3O6DA 3W22A 3S5OA 4FF7A 4LU0A 2F84A 4WY0F 1TPFA 1FXPA 1EEPA 3U8GA 3LBCA 4FXSA 1KW1A 4O14A 3P8IA 5I3HA 3W7KA 5TBOA 4WUIA 1LBLA 1QO5A 3W7GA 1SQ7A 4A21A 1H7PA 2A1YA 2QR6A 1F73A 4QNWA 1H63A 3WK1A 1RV8A 1KBJA 4XUGA 2VC6A 3LHWA 1JRCA 1K7FA 3FJ6A 2ZZ6A 1ZAIA 5D38A 1H51A 3PBYA 4TR9A 4O11A 3W1AA 4POCA 3S1UA 5AC7A 3I6RA 3M41A 3M16A 1F6KA 4FEZA 4Z1CA 2I9EA 1VHCA 4KWVA 2YFOA 4YCOA 1T96A 4N9DA 1NEYA 5K4XA 5CPMA 4JXCA 4NU7A 2QEZA 2A7RA 1RQBA 3R13A 3QF0A 4DO4A 4MY8A 4G1KA 3S6DA 4FNQA 3TIMA 3W7NA 1G4SA 4LV4A 5IBXA 4N4PA 1LRQA 1W3IA 1S3HA 4N4QA 3IGXA 5HWNA 1GJPA 4IXXA 1FWNA 4ZL1A 3K30A 3W73A 3A24A 3C56A 3P67A 1W31A 3EX1A 4Z1BA 3HPXA 2GPTA 4LT9A 2ZZ5A 4ZQNA 1KLZA 4HNTA 5FESA 2HTMA 2G95A 2D73A 1I2NA 1EX5A 2E6AA 3LDVA 3OVQA 4RKAA 4NZJA 2BWGA 2QAFA 4AH7A 3FA5A 1FWSA 2QCDB 3Q2DA 5EMUA 3I65A 1TREA 4WY0B 2CWNA 1KM4A 5C5YA 3TAKA 5D2YA 5IBXC 1TO3A 4Y8FA 3GZ3A 4A2SA 2YCEA 3M0ZA 3NL6A 3W74A 5EYWA 3U6WA 3GXNA 2J6XA 4UTLA 1PL9A 3NYZA 1M7PA 2A6NA 1VC4A 2ISWA 1FCQA 4LS2A 4IXHA 5F4WA 3LI0A 4WOZA 2CZEA 4I7VA 3RMJA 2AGKA 3TAOA 3VKJA 1GVRA 3HPZA 3TFXA 5HR7A 3QYQA 1X1OA 3R12A 3W1LA 1ICQA 4IMDA 4K38A 4O12A 4RLIA 2Y85A 4KFNA 4A3UA 1CW2A 5K2ZA 2CLKA 1GG0A 5D2XA 3TROA 2V5LA 4NVTA 3TXVA 3G1SA 4M5PA 3TX9A 2H90A 3W1RA 2ZTJA 3BK0A 4ZQPA 3PS7A 4I7UA 1GEQA 4IMCA 2J24A 1JR1A 4NX0A 2HMCA 4UTUA 4JNMA 3C8FA 4NJGA 4Y9AA 4IUOA 1JCJA 3S5NA 1ICPA 1DVJA 4XKYB 6TIMA 4NX5A 4OE7A 1G7VA 3NQAA 2FPVA 4LUJA 1W3NA 1XDMA 3S9YA 4HT3A 3L5AA 3QZEA 3PSVA 5A8GA 4FNUA 4Z08A 5LNWA 4HN4A 3R8RA 2C19A 4PA8A 1FDYA 1ZFJA 4WXZA 1ONRA 1FBAA 1VYSX 3W7QA 3W1XA 3ABSA 2J9YA 4OHQA 1YTEA 1HO4A 1S5WA 4O54A 5G4EA 3LXBA 3L0NA 2TPSA 5CZ0A 3VE7A 1K8XA 5HMSA 3KOFA 2R91A 1P5BA 1LBFA 1GTEA 2B0MA 1EPXA 5LZLA 5AYYA 4FX7A 3O06A 2FTPA 3M44A 4K37A 4YWIA 2F7FA 3W2KA 1FUYA 4IWWA 3EEGA 4GBUA 3TFCA 3CIWA 4AHQA 2Y63A 4MZ8A 4DF0A 5K7JA 2FPTA 1JCNA 3L21A 4LC8A 1GG1A 1SZGA 1MSSA 1TRDA 4Q4KA 1THFD 1TPWA 1KTBA 3UXAA 4O52A 3IIZA 5D2VA 5FF0A 4TIMA 4WQ6A 4ZQRA 3W7EA 4Q33A 3PC0A 1XL9A 4UNLA 4IMEA 3LB0A 2A7PA 3N14A 2ZZ4A 3LTSA 1TJPA 2RDTA 3SI9A 4H3DA 1QPOA 1SR9A 1TRIA 4LTSA 5L6UA 3W7RA 5BOOA 1Q6RA 2Q3OA 5LHFA 4FB7A 1K7XA 4AVFA 4XBKA 3CHVA 3GKFA 1N7KA 2PC4A 5DY3A 4UFJA 4JIPA 3B4UA 2VENA 3EKZA 2CLEA 5F2MA 1WOBA 3UPBA 3P7YA 4KFPA 5F2IA 3CLMA 1W5QA 1K02A 4D2JA 3G24A 4AWTA 4MZYA 1EIXA 1TPUA 1KV8A 2YDAA 2A5HA 5CPOA 5KTLA 4MFDA 2RKXA 2ZZ1A 3P74A 1PCKA 4O4VA 3M5XA 3GX9A 4GE8A 3W75A 2GVJA 4JTLA 2BSLA 3NQ6A 4UNKA 5SWUA 3CU2A 5CZJA 4FIQA 1QDSA 4JX6A 2B7OA 1YXDA 3TK7A 4BR1A 3EXRA 1TQXA 8TIMA 2VFHA 2V5BA 2DZPA 1TTJA 3TUUA 4NNAA 5AHMA 4FX8A 2BZNA 5CZTA 1W5OA 4LVBA 3ABOA 3E02A 3EWZA 2Y6ZA 4O15A 3W85A 4NJKA 3SECA 4MLRA 1OFQA 3IIOA 3DFOA 4GUHA 5AOUA 2R8WA 5AHIA 4CCCA 5KZDA 1ZCOA 4JTEA 4IPIA 3FEMA 1WYIA 5TQLA 1TV7A 1YLVA 3FLUA 2ZRXA 5AHNA 4U4MA 3O07A 2G97A 4UTHA 3PB0A 3C2RA 1N8FA 4ADSA 3OVPA 4DPPA 1NAL1 1FWRA 3PG9A 4ORMA 4TMBA 2V81A 4MZ1A 1KBIA 4BI6A 2QCFA 1RZMA 4AXKA 4AB4A 3EWWA 3BGGA 4XKYA 4ZVJA 2Y88A 3EX2A 4MLJA 4EWND 3M5YA 4C1LA 3TC7A 4JYEA 3GDRA 2V30A 2Q8LA 3KFTA 2DZSA 1C9DA 3M43A 4GC4A 5I3IA 3DFPA 4XBSA 2VEPA 3T44A 3P8JA 3E0IA 3OA3A 4L4MA 4RXGA 1A53A 2YZRA 3TSMA 5D05A 3LOTA 5FF4A 3A21A 3TJLA 3VNDA 1VRDA 2ISSA 5LNUA 5U4NA 1GVFA 2VELA 2HSAA 4E38A 2CW6A 1TPDA 1EWEA 1SO3A 2NV2A 3PUOA 3N9SA 4UIOA 4YL2A 3UWQA 4RZ6A 4N6FA 4UFLA 5LNSA 1TCDA 3S0CA 4JX4A 1ICSA 3MUXA 1V7YA 3C2VA 4BFAA 1TPH1 1AMKA 2UV8G 4IPJA 5DBUA 5F1UA 4OU1A 5LNRA 3SGZA 4QISA 3HMJG 1LOLA 3LI1A 1Q6OA 3NM1A 4WY0A 3MP4A 4HNVA 2X1UA 4XWUA 2Z6IA 5AYZA 1OABA 2C15A 1G4TA 5HNRA 1GT8A 4DPQA 1HFBA 2FQIA 1JRBA 3JR2A 3W70A 3W07A 3A9IA 3AO0A 4HSOA 1D3GA 4FHAA 4DO6A 3C52A 3ATYA 1OF6A 4A29A 3HG3A 2C13A 2WQPA 3KRZA 1F76A 4A22A 1YDOA 1GQNA 2QCHA 4MFEA 1RD5A 2QCLA 4AF0B 4ZZ9A 2QUVA 3NEVA 3PWAA 3ZR4A 3T78A 3LRMA 4N2YA 5FI8A 4MIMA 1VJIA 1LLWA 3UWUA 2C1HA 3G1DA 3QJAA 3NOEA 3FYOA 4K7VA 1NF7A 4N6EA 1PS9A 2YW3A 4I9AA 2TRSA 2ZZ7A 3PR2A 5K9CA 2QJIA 1Z48A 3DBPA 4RK8A 3NPVA 3STFA 1LBMA 3W7PA 5CSRA 1IXOA 1LCOA 3V75A 1VPXA 1H50A 4LNYA 4O0ZA 4LOCA 1W5NA 3L5MA 2ABAA 5DBTA 1AL7A 2GVLA 3GIYA 4XTDA 3T7VA 3PF3A 2YSWA 1XXXA 3HBLA 3EKLA 2AQWA 1KTNA 3FFSA 2GUUA 1KM0A 2A21A 5FF3A 3DKLA 1JJKA 3DHDA 3CPRA 1W1ZA 3HG4A 3HPSA 2A85A 3N3MA 3BW4A 5AFDA 2Y70A 3OVRA 3BLIA 4HKPA 2CZFA 3HOJA 4A2RA 1KFJA 1Q6LA 3MI2A 4U28A 1DJQA 2RDUA 1XUZA 3M47A 3LRKA 3WFAA 3GLCA 4R34A 1WV2A 2P1FA 2VKZG 4LY8A 1WBJA 3KVKA 2YXGA 1H7WA 3BO9A 3GNDA 4UUIA 2Y61A 3L68A 3WJYA 2NLIA 3S1WA 3MHFA 2ZQ0A 1ME7A 1U5JA 1XFBA 2A4AA 1M5WA 3FS2A 3W23A 2Y7EA 3NL2A 3E49A 4OQVA 3TKFA 3DXIA 1K8YA 3PUEA 4JTKA 3C2FA 5K9DA 4TMCA 2DZXA 4E2DA 2TSYA 3LXCA 2VFEA 1VZWA 1O5KA 2H8XA 3KVLA 1FXQA 3N9RA 2Y7FA 5F2LA 2ZRUA 5EPDA 3SGUA 1LZOA 1VGAA 1I8JA 1B9BA 1UUMA 3GYEA 4LW7A 4GRSA 4CNOA 1YXCA 5J5RA 3S42A 5G5IA 2RHGA 4W9TA 4FX6M 4FIRA 4GFSA 1B4EA 1A5BA 3IV3A 2B7NA 2ZRZA 3I7SA 5LGXA 2CFFA 3TNOA 3W1PA 4PL2A 3G18A 5AC6A 1YPIA 4GUIA 4JDYA 2NX3A 5LSMA 2QUTA 1XBYA 2YW4A 3B0VC 3W7DA 3B0UX 5F4SA 2OZ0A 3DZ1A 5D09A 4Q32A 3LGEA 5EBUA 3S5YA 4HSNA 1OFAA 2FLIA 4WD0A 4GJ1A 3L9CA 3NDOA 1H62A 4AAJA 3DENA 4GUGA 2P0OA 1IGSA 4UCGA 4UMCA 1LYXA 5CPLA 3IGSA 4OBTA 4FO4A 3MYOA 3E96A 1WX0A 2C6QA 1VLWA 3LCFA 1I2PA 1SSDA 3QMRA 1HL2A 4JX5A 4O1CA 5L9FA 1YPFA 1XKYA 2E5DA 3EX4A 4Y6GA 4KKXA 1VS1A 4UFMA 3LM7A 4QITA 5AB3A 4OV9A 3UZJA 2OX1A 5LNVA 3TDFA 1G69A 3LERA 4FNRA 1UJPA 5CGQA 3W1QA 2X2GA 4NZFA 3BLFA 1XC4A 4TO8A 3CB8A 1FCVA 4O28A 1PHQA 1SSGA 4JN6A 2PCQA 3CQ0A 1YDNA 1O95A 3GAKA 3LCGA 4QNEA 3BW2A 2C14A 4EVZA 1R46A 3VE9A 4Z0SA 3QPZA 1F05A 1BKSA 3BLEA 3WJXA 5HR6A 1VYPX 4NNBA 1B3OA 3STEA 4CQ9A 1IXNA 1QO2A 4Y90A 3TQKA 5DCBA 4R7JA 2A0NA 3PVFA 3UD6A 4IX2A 3BG5A 1JVNA 1B4KA 3P84A 3C6CA 3NPUA 1P0KA 3V1PA 3HJZA 1QAPA 5U7SA 3CT7A 4LWWA 3LCHA 1VCVA 2QCNA 2QKFA 3LCXA 3LXAA 1QPQA 2H6RA 2OT0A 3GDMA 2C3ZA 4WXYA 4NUWA 3N2XA 3GDTA 1BEUA 2OMAA 1X1ZA 3L5LA 2W0UA 3BGJA 3FKRA 4EF9A 3NXFA 2DORA 1OK6A 3NAVA 1D9EA 1IXPA 1SZNA 4M7TA 3USBA 2XN0A 1JCYA 3RFAA 3TSDA 4JTSA 2W79A 4MVAA 4O10A 4ICNA 3EWUA 5E1QA 3GB6A 5D2TA 1RQHA 3KRUA 4N9CA 4M7SA 3QSRA 1F6PA 3W2UA 3GKAA 3FIGA 1D3HA 1ME8A 5K4ZA 2FFCA 4XQ6A 5G4WA 1ZY9A 4O1AA 1JQXA 3G1VA 3YPIA 5D30A 3W9ZA 1Z41A 3KXQA 3JRKA 4Z1DA 4YLWA 5AHLA 1R2RA 2GQ8A 1LROA 5CSSA 4N9EA 2H3BA 3LHUA 4JR5A 2WNQA 2WV8A 1TV5A 4IX0A 4PODA 2ATMA 4LVAA 2CLHA 1M6JA 3W2JA 3G3MA 1KFEA 3IGUA 1TIMA 4JTUA 3VCRA 2PRHA 2A7NA 1AK5A 4WZHA 5T26A 4BI7A 2ZA1A 3ANYA 2WO5A 1H1YA 1KV5A 5FEWA 4E2BA 3NQ8A 3W2MA 4NXKA 1JUEA 4AHOA 1SUXA 3BPWA 4TX9A 5FEPA 3STCA 2E68A 3W84A 1T99A 2TMDA 4GUFA 2WOQA 1O94A 1ZNNA 4QSHA 3MP3A 1OFDA 3A23A 1L6WA 2YYTA 4UC5A 3NVTA 3MP5A 3INPA 3H54A 1TPB1 3ZS4A 4UTTC 1IIGA 2Q8ZA 3B03A 1SZFA 3LTPA 1ZENA 4LV9A 3UWWA 3NM3A 2X30A 3Q58A 1GPWA 3GVGA 1J2WA 4QAIA 1Z44A 1QPNA 2J9ZA 4RR4A 3KAOA 3WK2A 3W1MA 2JGQA 3LHYA 4IQLA 3TA6A 3FYPA 4M6QA 3W71A 3DFNA 2V8ZA 4LUIA 2Y7GA 2IQTA 3LRLA 3VFLA 1H7XA 3G1FA 4ADTA 4O50A 3STGA 3FOKA 5HULA 4TU1A 3GDKA 3N2MA 3L67A 3DU0A 1P0NA 2RH9A 3U2OA 3WJZA 2PURA 3CEPA 4HNNA 4NXSA 3BG9A 1XI3A 3L65A 4UTWA 1DOSA 1VCGA 3C61A 3M1ZA 3CWNA 3OIXA 2VEIA 2Y62A 2NZLA 3HO8A 2C0AA 3NR0A 4AHPA 4LVDA 2J27A 4M6VA 7TIMA 1YDVA 3SY5A 1WDWA 3SZ8A 1MEWA 4E0CA 3QQ1A 3Q37A 5AHFA 4DEFA 3GAYA 3UNDA 2WJZA 2C16A 4X9SA 1NFBA 4DBDA 1T0OA 4DF2A 1PV8A 3MW7A 3M5VA 1ML1A 2PE4A 3NQGA 1W54A 3PAJA 3T4CA 3TCEA 2ZZ2A 1K03A 3MJYA 4DELA 1JCLA 2EHHA 1RPXA 3E9AA 2ZTKA 2EKCA 4LC6A 2W6RA 1VCFA 4LVFA 3NGJA 2RFGA 3H55A 5CPNA 1PIIA 3NQEA 4PH6A 5F4XA 4JTTA 3UY7A 4X22A 1QFEA 3HB9A 2B7PA 3BARA 3G1YA 3W7MA 4ONVA 1A50A 2FIQA 3OG3A 4ADUA 2Z1BA 5F1VA 1RR2A 5HWMA 3NL3A 1RVGA 2CLLA 3PBUA 3BG3A 3C0JA 4MY9A 5A5WA 1F2JA 1OHLA 3WJWA 2Y89A 2E5BA 3QW4B 4XTIA 3TMQA 3H53A 1EB3A 1M7OA 2GQAA 3S1XA 2NUWA 1I2RA 2R94A 2NWSA 2E6FA 2E09A 3KX6A 2FB2A 3LLDA 4UFKA 1R2SA 1GOXA 1N55A 1XBVA 4LS0A 2XN1A 4OGZA 5BMWA 1UASA 1KTCA 2QCCA 3OEXA 1VHNA 1SZEA 3TSBA 5TIMA 3HIJA 1QPRA 4JTJA 1VR6A 1H5YA 2HS8A 5HWJA 1ZALA 3NQ7A 2VFGA 4MKNA 2DZWA 2WSQA 1LM1A 2E6DA 2WNZA 1K3UA 1GZGA 3O1NA 2R14A 1G67A 3W1NA 2JKAA 5EL1A 3QM3A 1CI1A 2DP3A 2JGYA 2BLEA 4JD4A 4UTJA 1W37A 2H3DA 3QW3A 2X1TA 1UB3A 2ZBTA 1DQWA 1I2OA 1TSIA 3DFSA 1XBZA 3F4NA 3PG8A 1JUKA 3P81A 4YCPA 1K7EA 2DU2A 1FWTA 4JTHA 1B57A 3W2LA 3DGRA 3QQ0A 3ZWSA 2H8ZA 3KHJA 4K8EA 1O5XA 5G1YA 1MXSA 3W6YA 3SR7A 4S2CA 3RF9A 2YFNA 1R2TA 1LTDA 1J4EA 1GVQA 2CLIA 4UTIA 2VXNA 4FNTA 4AMAA 4RJEA 2Z2UA 4LRSA 4MYXA 5KZMA 3SIZA 1P1XA 3QEZA 1YADA 1VQTA 2WSYA 5FEZA 4CQ8A 3T40A 4NQ1A 5DXXA 2RDWA 3T55A 1MEIA 3W3OA 3NA8A 3LCLA 3SFKA 2GOUA 3E12A
chains in the Genus database with same CATH superfamily
3ZFHA 4L6DA 3W88A 1A47A 4F8XA 3J7HA 1C8VA 1LDCA 5DXYA 3KHDA 4N02A 4WVXA 4PUEA 2XDFA 4ES4A 3BSHA 2GJLA 3CXOA 5BXSA 1FKXA 2YCLA 1LLOA 4W85A 1OCJA 3GW3A 3BLOA 3O6YX 4GACA 3WLKX 4TX8A 3T81A 2INEA 3QFWA 1KFWA 1EA9C 1RCQA 1JCMP 2PBOA 3EXTA 5HNUA 4C6QA 4IJRA 2W27A 2ZCGA 3E38A 2FZBA 4OWGA 4AD4A 1UKSA 2F6UA 4Z2HA 2ZZ3A 4D6FA 1FRBA 3Q94A 5EKYA 3C2OA 4Q8WA 5EBAA 2Q3RA 3VA8A 3I3BA 4LS1A 4AZHA 1F07A 5C9ZA 2E8ZA 4QQ3A 1HKVA 3BCJA 4E6MA 4QJ1A 3W7JA 1O4UA 1GZJA 1QASA 4H41A 2WMIA 3AYVA 1JZ7A 2O9RA 4BWLA 1JYWA 4CNNA 3ZWTA 1SJBA 4Y96A 4CQAA 4BQ5A 1SO4A 3EXSA 5LYRA 3W4RA 3RCYA 1OX6A 1TV8A 2E7FA 4D6CA 1V0KA 3RJYA 4AX7A 3GTNA 2IKHA 3NQBA 3ARZA 3B9EA 1JYVA 3QLLA 3IJ9A 4LEFA 2ZADA 1QCWA 1KA9F 4DUOA 1EP1A 4MHBA 2OFJA 1R47A 1QNVA 2KZHA 2X8RA 3W7CA 4JNZA 3VOFA 1TUXA 4NT0A 3UNTA 3UPWA 2VOMA 2EPOA 4ML9A 4DM2A 3G0UA 4ZQCA 3ARQA 2J79A 4GXPA 3KEHA 1M53A 3TYAA 1WQ5A 5BCAA 1XF0A 3SFWA 2PD9A 4OECA 4MMWA 3WDPP 1X8FA 2QF8A 3VD9A 1TMHA 2Y5SA 3M0KA 3EWYA 3VGEA 4DLFA 2WNWA 3S46A 5E9XA 1AQMA 5DEZA 1XCXA 5EU9A 5HQEA 2WM1A 3RNDA 3HGJA 5CC3A 2Z6JA 1J93A 3LCIA 2ZE3A 1O7AA 4JKLA 1UP2A 2J88A 5CKSA 3CTLA 4LUSB 1EJ7L 4YTRA 1ZTVA 1TPC1 3N12A 1OX4B 4EPDC 5M1TA 1W3TA 1JZ8A 1BWLA 2GGEA 3EEZA 4PBEA 3C4UA 1M01A 2F38A 4E3VA 3THUA 2OCZA 2WK2A 1X8CA 4GJJA 2XVKA 2ESCA 2A3LA 2PDHA 3WYZA 5CH9A 3TN3A 3S8HA 3ABRA 1VFTA 3AS0A 4IFKA 2C71A 3WNPA 3KW3A 3WMLA 5BU6A 2EG7A 4U3CA 2JBMA 4ZMGA 2E6YA 3ITGA 4KPLA 4GMEA 1EGZA 1DQUA 3F4WA 1XLIA 4IJCA 3AMCA 4RV8A 2ZA3A 2R1NA 2ZWZA 2V3FA 1DWHM 1RLCL 3PY2A 4M0XA 3W72A 2I14A 4TV5A 3W53A 5BNKA 2TODA 3UFYA 2P88A 3W7HA 2PMQA 3M9YA 4LAZA 3M5ZA 3C86A 4MJMA 4FF5A 4JQ1A 1YE4A 3QXBA 4JY9A 4JTGA 1RP9A 4NNCA 4RXFA 4DX3A 1Q6FA 1G6CA 2OSWA 3TWAA 1L8NA 1V3MA 1P4CA 3LHVA 2EJAA 2OGYA 5BW6A 4UOJA 5CAKA 4LSBA 4HU0A 3K1DA 1TV3A 3M0JA 3VGBA 3SQLA 5FL0A 2WJDA 1C29A 3ATZA 4DLMA 4M8UA 3BE7A 9XIMA 5D04C 1WKFA 4C6NA 1OX4A 5CSUA 3QSTA 1VP5A 1X6LA 2V3EA 3TR9A 3O15A 2NSOA 3PTQA 4U10A 4DBEA 1W1YA 2E9LA 4M29A 4LBUA 2DZAA 1XCFA 4E2VA 2NWRA 4RZ4A 1BAGA 3H12A 4Q8QA 4WKHA 1DJNA 1PWMA 3R25A 2CLFA 1E9LA 3O05A 2PDXA 5FF2A 1MQRA 4UFIA 5AC5A 3TQVA 3NG3A 3BTNA 1NIUA 1X7IA 4LVGA 3ENLA 4HNCA 3B9NA 4GNJA 1B3ZA 2LLEA 1A5MC 2V9DA 3WQFA 2NLYA 4P2VA 1L6GA 1E55A 2ATSA 3DFQA 1NP0A 3GNNA 1XSKA 3NUKA 5I3FA 1XPGA 1LWIA 4Z1YA 3PULA 3R5EA 1ZLPA 1M41A 2VFFA 1ZU8A 4HCDA 2GOKA 2ZRVA 5REQB 4NP7A 3L2IA 1QMLA 1R38A 5CAHA 1NSJA 1I2QA 1KGWA 2V68A 5A2AA 2OG9A 1JULA 5FSDC 1DL3A 2L5HA 3EX6A 1E9IA 3EWCA 4J3WA 3AU6A 4OV4A 5KITA 1KFLA 1A5OC 3CLWA 3A5FA 1I45A 3SN4A 1ALDA 2EG6A 1V51A 2ZRWA 3P60A 4LYQA 1R8LA 1YNPA 4XIMA 1GUVA 3UR2A 1UD4A 4MWAD 3MHUA 1AG1O 3UQNA 5DN1A 2NUXA 3XINA 4HTBA 4EP8C 1HT6A 1DV7A 3SCQA 3S1VA 4DYEA 5GQBA 1W3HA 4RPQA 3WQ4A 4E8DA 4K6AA 1IIHA 1MUCA 1DBTA 3I3DA 3HG5A 2NV1A 3W7OA 4V15A 1AD1A 4ERGA 3RLGA 3B04A 3LYEA 3LX9A 3VCNA 5K9XA 2CZVA 4C6LA 2R1LA 4KEUA 3LENA 2QCDA 3TW6A 3ZM8A 2Z0IA 5C0QA 2DZUA 1UCWA 3IRSA 3B9OA 5I3JA 1SW7A 1EDTA 1ZB5A 4GVIA 1C3FA 1DJGA 4NY2A 2CLMA 3B0PA 4GQBA 4EOUA 3GH5A 2CZ5A 1NM9A 1GOKA 1Y7VA 4GG9A 4FOJA 4JKKA 4DJFD 4B4FA 2PDYA 1QK0A 1GK8A 1UWTA 3DI1A 4MPQA 3TC6A 3ARWA 4GZJA 3QC3A 3FKKA 4XK2A 4M80A 4O8RA 3UWYA 2QCMA 3MKCA 2X1SA 5EMYA 3MO7A 1MQPA 1RA0A 4MADA 2PWEA 2DT1A 3O0KA 4FALA 2V5JA 1EEXA 7A3HA 3F03K 3EX3A 3C2EA 2JF6A 1GVOA 3MVTA 3O8AA 1XIFA 2V82A 3DH7A 2DH3A 1ENUA 1EUNA 4HNOA 3FAWA 3HU7A 1SFJA 2I16A 1S2CA 1NWRA 3CIVA 5DF0A 2X16A 3TU9A 1S1PA 2VZTA 4TQTA 1RCOB 4PB4A 1J5SA 3S47A 2YR1A 2VNCA 4MUPA 5C54A 2HDJA 3BOFA 3NZRA 3TR2A 3SDOA 3BAWA 4GWEA 3E2SA 1RSCA 1UQYA 4NJHA 5HINA 1MVYA 3CV6A 3DFTA 2FZ9A 2XN2A 2X1RA 2EF9A 2ZUVA 4CNPA 3HQ1A 4RDVA 4ROQA 1ISXA 1EFZA 4PUKA 3CHEA 3A13A 1PEZA 2X0YA 3UG3A 4GVFA 2BDQA 4R53A 3TV8A 2NXGA 5AYXA 4M81A 3VCCA 1WXJA 4H6QA 1MDLA 2G3IA 4RCXA 4HYWA 1VIZA 4HA3A 4C7DA 3MBFA 3B06A 3WQEA 4EX4A 3S5OA 3PUGA 2D2JA 1UZ4A 3AXHA 3U8GA 4FXSA 4NI3A 3GR4A 4A3YA 2H9AA 2INZA 1TA3B 3AIEA 4RNHA 4QNWA 1JZ3A 1T5AA 4UWMA 2CKRA 1AFSA 3LHWA 1Z3NA 1ZAIA 5D38A 4TR9A 2ZOXA 4KCTA 1E9YB 4OOZA 1VFUA 3W1AA 3S1UA 2ZC8A 3I6RA 1VHCA 4YCOA 2WYSA 1NEYA 4LNCA 5K4XA 1RBOB 4C1NB 2QEZA 3AYRA 1IZCA 1DXEA 3QF0A 2E25A 3T2QA 4Y9NA 2B31A 4WJ8A 4N4PA 4CD6A 5HWNA 2Z2BA 4R9OA 2CETA 1FWNA 1EQPA 3VDCA 4DXXA 1GVEA 4IGMA 3W73A 4XAZA 3A24A 1WB0A 3WN6A 3HPXA 4LT9A 4HNTA 3PWGA 4W86A 2G95A 2BHZA 3CUZA 3HFTA 2HCVA 3WF1A 4MSSA 4NZJA 2BWGA 2YCLB 4AH7A 2QCDB 1WDDA 1KM4A 4E4UA 5C5YA 5D2YA 1B30A 4Y8FA 4LUYA 1R3WA 3M0ZA 1A3XA 3U6WA 4R5EA 2J6XA 4UTLA 3NYZA 1KRBC 4B90A 3KP1A 3L4XA 1PB0A 2ISWA 5F4WA 4HK5A 3TONA 3HV9A 2AGKA 1KXHA 5HR7A 4LB3A 3T8LA 3CV1A 5I09A 2WZIA 3R12A 3VDBA 1KR1A 4RLIA 2CLKA 4DYKA 3BCDA 1Q6EA 5D2XA 4XD3A 1W9UA 4NVTA 3TXVA 2PDUA 3TX9A 4JHMA 2XWEA 4I7UA 3JZUA 4WCJA 4CU7A 3CQHA 4JNMA 4NJGA 4IUOA 1NQ6A 3CT2A 1ICPA 3VDHA 5G1MA 6TIMA 4NX5A 2W3ZA 4I6VA 3NQAA 1H1NA 2IMRA 2Q09A 1W3NA 5HNTA 3S9YA 4F3HA 3PSVA 2E28A 5A8GA 4H1ZA 2ZX8A 1K4GA 4PA8A 1Z69A 2XU2A 1XIBA 4PMOA 4DVOA 1A5UA 1ZRQA 1FBAA 1OT2A 5I7GA 4R88A 1HKKA 4OHQA 1Q7ZA 1YKWA 3QBUA 2IPGA 1I0DA 3AIRA 3WNLA 5FJRA 5CZ0A 4PMDA 1K8XA 5BXTA 5E6ZA 3VIOA 1LBFA 4OTKA 1EPXA 5AYYA 1EJVC 4RE4A 3EA2A 1RBAA 3W2KA 1FUYA 1UKPA 3MV11 4Y2WA 4DJDD 4AHQA 5CC7A 5JMUA 4C5ZA 4LC8A 4PMVA 1KTBA 4AZCB 1HKJA 3UXAA 4O52A 5FF0A 1B31A 3DECA 3W7EA 2YCJA 3HURA 3LB0A 1KNWA 3VUSA 4GYJA 3LTSA 3B3DA 3R0UA 3W7RA 3SAZA 1K7XA 4H8VA 1N7KA 1ITXA 4JQ4A 3Q65A 2G3JA 2CLEA 5F2MA 1WOBA 3UPBA 1M04A 2PWVA 3P7YA 5FAGA 3BUVA 1JDDA 2VDGA 2PDQA 3SUSA 1TA3A 1VBHA 2GJXA 4DUVA 5HMDA 4AWTA 1KV8A 3OGVA 4LAKA 3POHA 2WC7A 5CPOA 3URAA 4O4VA 1VKFA 3GX9A 3C0LA 5ABHA 2GVJA 3PK7A 4UNKA 3CU2A 2Z7KA 1QDSA 3S6TA 1HL8A 4HMCA 1TVNA 4P8XA 2PGWA 4GD0A 3IJLA 4MNJA 1QRQA 1YXDA 3TK7A 2I17A 4PGLA 3QN3A 1W91A 1YQ2A 3TUUA 4B5XA 4H9MA 4US5A 2NQHA 4OUEA 3BCFA 3ABOA 2Y6ZA 3ITXA 3UJEA 4M51A 3GVWA 4NJKA 5AHIA 4AIUA 3FJNA 3U57A 4C90A 1LQAA 4QDMA 3HJEA 1VRXA 2OYLA 1YLVA 2PTYA 4AD0A 6ENLA 1EJXC 1XSIA 3O07A 2VD8A 2G97A 4DPPA 3BOLA 4TMBA 2V81A 4MZ1A 1KBIA 2QCFA 2PB1A 4AEFA 5E6YA 3DX5A 4AXKA 3EDEA 5CBJA 3GYCA 4XKYA 3KBJA 2Y88A 3EX2A 3DN5A 4W88A 4C1LA 5CC6A 4JYEA 1C9DA 3KBSA 1R3YA 2ANUA 2VEPA 4O0QA 3WUGA 4L4MA 1CXKA 2YZRA 1VFOA 3AISA 2ZICA 3H4WA 1VBGA 3TJLA 5LXEA 1PBGA 3WFLA 1U30A 3LGGA 1EYWA 1RPKA 3P0XA 1GGOA 1SO3A 3BURA 4YL2A 2V69A 1WUFA 4UFLA 1TCDA 5HANA 6PTDA 1XH1A 4MWAB 4DAFA 3T05A 4H00A 1OT1A 2ZUMA 3C2VA 1AMKA 4C6IA 2Y24A 4QISA 1BWVA 1QNRA 3LI1A 3WEOA 1Q6OA 2CLPA 4B15A 5CLTA 4WY0A 3QOKA 1JF5A 5CZKA 4ZCWA 5TAOA 4Y9PA 1BSIA 1CECA 1G4TA 5FAJA 2CHRA 1QW8A 4L4PA 1JRBA 3CZLA 3ARUA 3ZIZA 4ZOCA 3AO0A 5BXRA 4IIDA 3QY8A 3ATYA 3B0YA 2ZX9A 4PB3A 3CAQA 3GTFA 2JALA 1YDOA 1GQNA 3GHTA 1OGBA 4H8UA 3LD5A 1ZBKA 4PSRA 3ZYZA 3T78A 4JFUA 4B4HA 1E4IA 2OEKA 2VGBA 1LLWA 3UWUA 4MNMA 3QJAA 5C71A 4C65A 4C60A 3EA3A 2YW3A 2TRSA 3EDJA 3PR2A 5K9CA 1QNOA 4GIAA 3WBXA 1DWAM 4LBRA 2OOGA 3NPVA 1QW7A 4HYRA 1T7LA 4TXEA 3W7PA 3FXGA 2PCEA 4Q8MA 4O0ZA 4FSAA 1W5NA 3L5MA 1MYRA 2GVLA 3GIYA 3PF3A 5AKQA 1B0IA 2IQDA 2YSWA 3VMOA 1KB3A 1WZAA 3RPDA 1V0LA 2YBUA 1JJKA 1KXQA 1I1WA 3N3MA 2F2KA 1U2YA 3HOJA 2YJQA 1L8PA 3D5HA 1Q6LA 3MI2A 3W38A 2PBGA 3LQGA 1XUZA 3GTXA 3M47A 2GL5A 3WFAA 5RUBA 1GOWA 3M0LA 3N6JA 1WV2A 3FYYA 2J7EA 2P1FA 2VKZG 3ORWA 3U4FA 3L68A 2NLIA 1Y5VA 3ZSTA 1XFBA 4ATWA 1ITUA 1OIMA 3CYJA 3CUJA 2J7FA 4OQVA 3TKFA 1H0IA 3PUEA 1SMDA 3C2FA 1E9ZB 4TMCA 4CEXC 1VZWA 3SGUA 5EPDA 1LZOA 2FMOA 2PLJA 3GYEA 2ZUWA 4LW7A 5DRCA 4GRSA 1YXCA 3VOGA 3SN0A 2HVMA 3MKVA 4J27A 4AU0A 5G5IA 2RHGA 4W9TA 4FX6M 4FIRA 4GFSA 1B4EA 3LZ5A 3TN5A 3W1PA 1B1YA 3G18A 3EKGA 3KWXA 4GUIA 2NX3A 1XBYA 2KAUC 3KBWA 1WAWA 2PD5A 4H9UA 5F4SA 2E3ZA 3MUZ1 3KL3A 4UZSA 4IIFA 3U0HA 1UPMB 2VX7A 4Q32A 3NIYA 2CYGA 2AMGA 3LGEA 3AXIA 3VNYA 3GDBA 5ABFB 4BF7A 4AIEA 4NRSA 3WD2A 3NDOA 3DENA 1IGSA 4UMCA 1LYXA 3IGSA 4L64A 3MYOA 1P7TB 3SCPA 2C6QA 2POZA 1A0DA 1SSDA 3QMRA 1C91A 1G5AA 1GZ1A 4JX5A 1XKYA 4H9ZA 4YVXA 2YBVA 1TMQA 4UFMA 1AZ2A 2OX1A 3CB3A 1UJPA 2HROA 3W1QA 1E70M 1FTXA 5C2CA 1FCVA 2ZUUA 4JN6A 3KTCA 5EGRA 3CQ0A 3M07A 3A4AA 4HOXA 4W5ZA 3LCGA 4QRNA 4IQDA 3L4YA 3PPGA 1OD8A 3QPZA 4AYGA 3BLEA 5HR6A 4DJEA 1XLFA 2ZUSA 3FK4A 4HBKA 1B3OA 1L2QA 1J0ZA 1E3ZA 4Y90A 3H7UA 4IX2A 3BG5A 3DDMA 3P84A 4GVHA 3V1PA 1P0KA 4H7VA 1QAPA 2O9TA 4X9YA 3IUDA 1V0MA 5U7SA 1UZDA 1VCVA 2QCNA 2CBJA 2C3ZA 2NQ5A 4G2DA 3ZLGA 2W0UA 1DIOA 3BGJA 3AFBA 4EF9A 4KETA 1UMYA 1OK6A 3KDOA 1J18A 1IXPA 3M7SA 4QLJA 4M7TA 3QVQA 3USBA 2QT3A 2JFEX 3RFAA 2HBXA 4JTSA 2PDCA 4U2ZA 4ICNA 5A8PA 5E1QA 4L56A 4GQGA 4U5KA 4OFCA 3GKAA 4UOQA 1D3HA 1ME8A 4WJXA 4XQ6A 1ZY9A 1KC7A 4CKQA 3KXQA 9RUBA 3V4BA 4A05A 2BY0A 1LROA 5CSSA 2H3BA 2HQAA 3VD3A 1E0TA 4PODA 3Q45A 3PPCA 4LVAA 3WQVA 2CLHA 1M6JA 4MB5A 3G3MA 4IP5A 4AVNA 1MFUA 5A95A 1OCNA 3VCRA 2WMHA 3N4EA 2PGRA 3R8GA 3F2DA 5AECA 2ZA1A 5D8WA 2WO5A 3RCNA 2YCIX 1KV5A 4GKLA 2CHNA 4EAYA 4A3QA 4CNUA 4M3PA 4DBUA 4TX9A 4P7LA 3RX2A 2V5DA 2WOQA 1O94A 1OFDA 4H8NA 2YYTA 2DGAA 1KCZA 3CUHA 4GYPC 5I02A 4G6CA 3NVTA 3H2AA 3MP5A 3DC0A 1TPB1 3NDYA 3D3AA 3LNMA 3ZS4A 4UTTC 4GZIA 3M0VA 3B03A 2NQZA 3NM3A 3Q58A 3TTOA 5ECVA 4XSMA 4M6UA 4DHGA 2J9ZA 4RR4A 3WELA 3KAOA 4IF2A 4HU4A 5IFPA 4BQ2A 2JGQA 4W7VA 3TA6A 4IQLA 2V8ZA 2W4XA 3C2YA 4B2DD 3SQSA 1S39A 1N8IA 2IQTA 3RM4A 1E0WA 3WH9A 1H7XA 1P6WA 5JBFA 3A4XA 4H04A 1XP3A 2HZGA 2ISFA 2OKOA 4WEVX 3GDKA 3L67A 5DFAA 1J79A 3CEPA 4W7UA 2FH6A 2OEJA 3U48A 3C61A 2Y62A 2NZLA 3WLQA 2C0AA 1O6IA 3BQ6A 4M6VA 1QI4A 2IKJA 5HA7A 1MEWA 3SZ8A 4N0RA 4E0CA 3GXMA 4F9DA 3OO2A 2HISA 3V5OA 2IQ0A 1HIZA 1E1CA 2C16A 4L6OA 3L23A 3VNLA 1BG4A 1S2UA 4AWEA 1V6YA 3PAJA 5CJMA 4NRRA 2EHHA 3JUGA 3E9AA 1S2VA 4ICCX 1MNZA 6XIAA 3B40A 1PIIA 3NQEA 3UY7A 4DAIA 4AC7C 3JZEA 5I00A 4GNKB 3PZTA 5C7HA 3OG3A 3ZXWA 2Z1BA 1RR2A 3WLJA 4JAWA 1XLCA 3BG3A 1F61A 2YOCA 2QXWA 5A5WA 3LPOA 1KWKA 3AHXA 1OHLA 3TMQA 1OADA 1EB3A 4IPPA 2PTWA 1F8MA 1ELSA 1IEXA 3DGBA 1I2RA 3BAXA 2AQVA 2R94A 2NWSA 2E09A 3KX6A 3VXGA 3NSNA 1CGTA 5C70A 3XIMA 1HJVA 4OGZA 5BMWA 2QCCA 3IS4A 3THCA 3HIJA 4JTJA 1VD6A 3VKKA 2O9OA 3SUWA 4RW5A 2FH8A 1UC4A 3UJRA 2DZWA 3VABA 1K8CA 2R14A 5I6SA 4XZIA 2X09A 2AMXA 2JKAA 3AZSA 1UZHA 1XRVA 1UR4A 4JD4A 2X7WA 4AZIA 1W37A 2H3DA 3QW3A 2X1TA 1UB3A 2DVTA 2ZBTA 4D71A 3K4AA 2Z29A 1V02A 1R3VA 3PG8A 1FKWA 2B81A 3P81A 4E8CA 2IXVA 2J7BA 1POKA 3GTIA 3PTMA 1V02E 3PWIA 9XIAA 3DGRA 2G0WA 5T8GA 3WD3A 4K3ZA 4UQCA 3KHJA 5G1YA 1MXSA 4QQUA 1FWBC 2YFNA 4PUNA 1GVQA 4IUGA 3W6LA 2VI0A 2VX6A 2VXNA 3B8VA 4AMAA 4RJEA 3HPFA 3SIZA 1YADA 4CQ8A 5FEZA 2XHYA 3EDDA 4UR9A 5LA1A 4JNYA 3ITLA 4MGGA 1CENA 2DIKA 3W3OA 1MEIA 4QHRA 4MTVA 5JH2A 1T6MA 2XISA 3E3HA 3WQGA 2GOUA 3E12A 4DYJA 4DZAA 3UZ5A 4P61A 2W5FA 2GQ9A 2UWFA 2WWCA 5DLCA 3VDAA 1TQJA 3WH7A 5D37A 3W83A 4P5UA 3THAA 5A6TC 1BWKA 1M68A 4C6KA 3LHZA 4J3UA 5FJTA 2G37A 4UTFA 5LA2A 3QFEA 1HP5A 2ZXQA 1KM1A 3WK0A 2QGYA 3RU6A 2XGBA 3GR7A 3VI2A 4S3AA 3CV7A 3BW3A 5D03A 4HHLA 3CAWA 3NZ1A 1GVIA 3G8RA 3GC5A 3ITOA 1OSEA 4US6A 1POJA 3U2EA 4ZO8A 1KM5A 1XIDA 3B8DA 4AF0A 2QPXA 3H21A 5JIWA 4D8LA 1UR8A 5C9UA 3HGOA 4AG0A 4RZ5A 2A3AA 1I0BA 4HIBA 3AU2A 1BXNA 4JTCA 4YPJA 3ONCA 4RZBA 4DQWA 4HNUA 3TYDA 1ME9A 3NSMA 1XG4A 3T09A 1U5HA 4EIVA 2PRMA 1DE5A 3VD5A 2D2OA 3NFUA 3TYUA 4MJZA 3AZTA 5D32A 4AZ7A 4HCLA 2ALDA 2G8ZA 2GUBA 3GXDA 2J6VA 1O60A 2X0HA 3ZJ7A 1JFHA 2QCGA 4KCUA 4NL1A 2VYOA 4LH8A 3BMXA 4EE9A 2DJXA 1NVMA 4MUZA 1IEIA 3ZR5A 1MXGA 4I7WA 1EUAA 2VUNA 4A3HA 3IVTA 3N6HA 1JAKA 1M65A 2A6LA 1HZYA 2PWHA 2VT0A 1GPFA 4R7OA 4IGHA 1FH8A 2NX1A 2JF7A 1ISVA 2QAPA 2WHJA 3IIPA 4QTGA 2XZ7A 1W56A 3DFHA 4BQ4A 4E3TA 3MB9A 3F7JA 1TZ7A 5A6BA 2POTA 4EF8A 2VRJA 3RO8A 3N9KA 1RJPA 3BV7A 2V2DA 1BLIA 1E1CB 2MUCA 1V6XA 2OJPA 3VNKA 5FSEC 1TZZA 2ISVA 3CQKA 1PVNA 3UYCA 2VR5A 2GFTA 3CQIA 1RP8A 5KETA 2A2IA 3RPTA 1BVWA 3P5ZA 5IFTA 2BB0A 3WLTA 2XZ9A 4FS9A 4IMFA 1OF8A 4IPLA 1S5MA 2FMNA 2BY1A 2YKKA 1AODA 1VLIA 1W5MA 4REQA 3GXIA 3R2GA 3BC9A 1TE1A 1A3HA 1XJBA 1L9WA 1F4AA 3UXDA 1TMLA 3B97A 3LPPA 3CWOX 2RGMA 1EXBA 1F6YA 2CBUA 4PFMA 4A35A 1FA2A 1XYMA 1ECQA 2OYMA 3KZPA 1FY6A 3A64A 2WSPA 1YW1A 3B0XA 5TD4A 1NDWA 4DJDC 4AWUA 1XGZA 4QM1A 1QNSA 3I68A 3MMTA 3GNOA 2C91A 1VEMA 1A5NC 2FJKA 2FGBA 1R7AA 2GJPA 1XLLA 1F9CA 2OT1A 2Z27A 3U4AA 5M5DA 2ZVIA 1J10A 2OU4A 4AD5A 1RY8A 1JCXA 3G2GA 1EQCA 3QZAA 2E8YA 4NI8A 4EPBC 4S3EA 4XVDA 2JIEA 1P1MA 3NQFA 2PZNA 3SQMA 3MUY1 4JDBA 3CIXA 5LA0A 1K77A 3T0BA 4FAMA 4PTVA 5CG7A 3WD1A 1JUBA 1G4EA 1KM6A 5DY2A 4BI5A 1GTHA 4Z2GA 1OQFA 2OPJA 4UFHA 3CC1A 4XB3A 1HTIA 1F5ZA 1TYGA 2G41A 4Z2IA 1V7AA 3NPWA 1Z8AA 2GDUA 1DJYA 4GYFA 3C5QA 4ACYA 2MNRA 1J6OA 1ZJIA 3CWHA 1XGDA 1VBUA 1TPEA 2OGJA 3RGTA 2DT3A 3IJDA 3ALGA 1IF2A 3BAYA 1DQXA 1ONXA 3HM7A 4MKVA 1OFOA 4FNSA 1HGWA 1QI3A 1RH9A 2GDVA 3WMCA 4RX0A 4KF1A 3UG4A 5G2IA 3RLVA 2PLMA 3G1XA 5AC8A 1IR1A 1JIBA 2QUMA 4ASTA 3T2OA 4D8ZA 1UD8A 3E0FA 3MBDA 2UY5A 2FPYA 2WHMA 1WZLA 3RAOA 4GFIA 4C91A 3VIMA 4UCFA 3AXKA 4FXJA 4ZSTA 2CCRA 4U3AA 1XH2A 4KRUA 2OZ3A 4BQ3A 2WCAA 3RLUA 3NGFA 3ABQA 4JICA 5D33A 3R0KA 4H6KA 1G4PA 3SJ3A 1MUMA 3MI6A 3RU8X 5I79A 1XBXA 4K2SA 1DKWA 1ZCCA 4AISA 1XC6A 3R7MA 1QOPA 2CXEA 5C6MA 2J9XA 1BXCA 5FCZA 1TPVA 4J1OA 3N2BA 3W1UA 3A12A 2WPBA 2XYLA 1NOWA 3L66A 1IT8A 4PEKA 1HW6A 4NJIA 4CUCA 1ZBWA 3FDKA 3F5LA 2QJNA 3G6MA 4A8LA 3AS2A 4O16A 2WKGA 2WCSA 4TV6A 4GQ0A 4ZENA 3NO5A 3UR8A 1H61A 2E9BA 4QFUA 4Y9OA 2DH2A 1W32A 1OFPA 5I03A 3QH2A 4C6FA 4R9XA 2OB3A 3H23A 4GUJA 5D02A 4Y9MA 1HJXA 4U33A 2C1GA 4YMZA 3FXYA 4C6PA 1AMYA 2GVGA 1ZAHA 3VOIA 4UBPC 2CBIA 1OIFA 4KFOA 3G22A 5E0CA 1OJXA 5MKGB 3WMBA 2PA6A 1FFQA 3IVUA 1JEZA 2V5KA 1J5TA 1SO6A 1K8ZA 1SFLA 1H7NA 4O1DA 4PFHA 4DB7A 4DXVA 4G56A 1BF2A 4NAEA 1OCQA 2WNNA 1JPKA 5D2WA 4ZE5A 1TJRA 1HG3A 2VR4A 2GJNA 4LUSA 4A8NA 1MDRA 1Z42A 3VYLA 1W8SA 3I4KA 1MRQA 1A80A 5I5RA 1GHSA 2VC5A 5GJNA 3DKJA 1KRMA 3OBEA 3FHQA 3HMCA 1X38A 1AJ2A 2BNJA 1EF3A 3QY6A 1PJ9A 3TH6A 3MO4A 4Q7IA 1US3A 3KVJA 4KW2A 1AA1B 1BGGA 2ZA2A 1S5NA 3ZJKA 5ABFA 3FVDA 3RX3A 4H01A 3CS2A 4WDTA 3E5PA 4I9TA 1OCBA 4R3UA 3T4WA 3TMLA 4IMAA 2C18A 5EB8A 5LIUX 2ZXBA 1IXQA 3S3GA 1OFRA 2G3FA 3RRAA 1GWJA 4WOQA 3VOCA 3R4IA 3AROA 1PKYA 3PFRA 3CL8A 2B4GA 4HPHA 1DPMA 5CCZA 4X63A 2V0TA 3FSUA 2VWSA 2YB4A 2HRWA 1REQA 4K7YA 1H1ZA 3HA1A 1R3QA 5DELA 1V6TA 1V3IA 2QUUA 4JTIA 3CEUA 4PRRA 4WF7A 2PU0A 1UH4A 4S3CA 4NG3A 3VIHA 5EFFA 5FKYA 4IZGA 2P10A 4KBXA 2J7GA 2OQLA 4AFYA 2Z26A 4J9JA 4GXMA 4KCVA 3OHIA 3D46A 3MKKA 5A6SA 1ZHAA 4I90A 3PANA 3I6EA 1A5SA 3IV8A 1WAUA 4X3ZA 3NZQA 4GPNA 3WH5A 1K9FA 4IQEA 1J0IA 1DWFM 4JY8A 5BRBA 3IIXA 3MI3A 3DOPA 4AZ5A 3UEQA 4LYPA 3AJXA 1P0DA 1EZWA 1KQYA 1X98A 4PMXA 7PTDA 3HF3A 4DZ5A 2QLYA 2J78A 4UMBA 3AWOA 3ZOAA 1LQ2A 4H83A 3W29A 1A4MA 5LHEA 3T42A 5C8BB 1X1NA 3GXFA 1GYLA 3T0CA 3HN3A 4O57A 4GC3A 4HPJA 4HHPA 3NQ2A 1FWDC 4IIGA 5IM51 1E4LA 3OYXA 5AHEA 3AIVA 2ZKMX 3NPXA 2CHOA 2BOEX 3GBEA 3EOEA 1KFBA 3ZO9A 2HV5A 4GXWA 4FXFA 4Z17A 3WK3A 4MNKA 4IOTA 4JEQA 1YTKA 3H70A 2FZ8A 4LBSA 1QOXA 2BS9A 2PWGA 3N73A 5EMJA 4JL2A 1V5XA 4L1GA 2NQJA 4OBSA 1FP9A 2EEXA 2V5CA 3FCPA 1Q85A 1BFNA 1EOMA 1HVXA 2ZIDA 4YJ5A 5BOEA 1KW1A 4O14A 3SCNA 4L6HA 4WUIA 1CLVA 2VVNA 1S1RA 1R9YA 2G3MA 2WHKA 1H7PA 3W7GA 1F73A 3WX7A 4UQBA 3WK1A 3NWRA 2DPEA 1JRCA 3GU2A 1K7FA 1O5QA 2ZZ6A 4CN6A 2VM8A 4XZNX 5H6HA 3F2CA 3WUBA 1DXFA 4HHMA 3M41A 3UA3A 1F6KA 2G4FA 3SN1A 4KWVA 4IICA 1UKQA 4GYKA 4RNJA 4S23A 4ZOEA 5CPMA 1LT7A 1S3TC 4NU7A 2BXZA 1RQBA 3PPHA 3EBVA 4DO4A 4MY8A 3DG7A 4S3BA 3S6DA 4ILSA 1WZKA 4LV4A 3W82A 5IBXA 1YBQB 2CXGA 3LGDA 2OSXA 4LANA 1S3HA 1ZBCA 3IGXA 1GJPA 4ZL1A 1TCMA 4YVVA 5J8LA 1E40A 3P67A 4KH2A 5CPQA 3EX1A 4Z1BA 2GPTA 2WKLA 1IYXA 3W28A 1KLZA 3SCUA 5FESA 2PUZA 2VO5A 3U3HA 1I2NA 2CIPA 3RHGA 5CBIA 2E6AA 1UPPA 3UXIA 2QAFA 4B3LA 3TZNA 3R1ZA 1PIGA 2CWNA 3TAKA 1J8VA 2EJ1A 1VBRA 3GZ3A 1V6UA 5JIPA 1M3UA 2Q02A 1HP4A 1FCQA 2FGZA 2CZEA 4I7VA 4QBXA 6A3HA 3VKJA 3QTGA 3TFXA 3QYQA 1D8CA 2W92A 1ICQA 4ERAA 3ARPA 2ACUA 1KRAC 3IUIA 1V3JA 4KFNA 7REQA 2D2HA 1XYCA 1GG0A 1IZJA 1YBQA 4JFTA 3TROA 2V5LA 2A79A 4CD8A 3CZGA 1FWEC 3G1SA 4IIBA 4M5PA 2WJFA 1GEQA 4IMCA 1S46A 4C6MA 4UTUA 1JCJA 5A3HA 1DWIM 1VPQA 1LUCA 1W6TA 3PNZA 4XG1A 1XDMA 4XZMX 2XIJA 4HT3A 2I9UA 6CGTA 3WO8A 5LNWA 4FNUA 3R8RA 3WENA 1FDYA 4KIRA 1Q6DA 4WXZA 1ONRA 2OO6A 1VYSX 3W7QA 4DWSA 3V0TA 1EC7A 2R9RA 4YNGA 3DERA 1YTEA 1BF6A 3K8LA 5G4EA 1EOKA 2DW6A 2YXXA 3PJUA 1JL8A 5HMSA 3KOFA 3URNA 3EAUA 4YTUA 5JBEA 5LZLA 4FX7A 3O06A 3QY7A 3VMPA 5D9MA 3M44A 4YWIA 4JL1A 2O56A 2F2HA 4IWWA 3EEGA 3WLNA 2BOFX 3TQPA 4IGSA 2Y63A 5K7JA 1ODZA 4LPCA 1GG1A 1SZGA 2PP1A 4Q4KA 1R7OA 1TPWA 3A47A 1A5KC 4L1XA 3IIZA 3NOYA 4ZQRA 4WQ6A 4F66A 4GOAA 4Q33A 4IMEA 2RUSA 3IGHX 2AL2A 2CBVA 1I75A 3N14A 3WDJA 2FKPA 1SR9A 1TRIA 1YE6A 3PZVA 2Q3OA 4XBKA 1JFXA 4PMRA 3S2LA 3ZLFA 4AD2A 2A3CA 5DY3A 4UFJA 3CL7A 4JIPA 2AAAA 2VCCA 2VWTA 2VENA 4RPPA 3DFYA 1TWSA 3EKZA 3WH6A 3ZQ9A 4HJFA 4Q6XA 3EB4A 4D2JA 3V5CA 3KWSA 4MZYA 4KESA 2PP3A 3GH4A 4FOUA 4PUDA 2YDAA 2A5HA 4MFDA 3LEPA 1UR1A 2Y1HA 3ZT6A 1YMYA 3W75A 3BJTA 4JTLA 1J2BA 5SWUA 2PWDA 3LUTA 4BR1A 3EXRA 2V5BA 1Y5XA 1ZP3A 4Q8PA 5CZTA 4TUFA 1W5OA 4EPKA 4XKMA 3R58A 3EWZA 3POCA 2V6AA 2DFAA 3V7PA 3W85A 3SECA 4MLRA 1GJWA 3BANA 1GCYA 1TR9A 3ARSA 2R8WA 5C9WA 1CNVA 4GIEA 4Q4QA 3PP7A 4JTEA 1UKOA 4IPIA 1WYIA 2GQ3A 3OLEA 3UP8A 3FLUA 4LF2A 3UZWA 4B5WA 2DEPA 4U4MA 1B54A 3C2RA 4ADSA 2YA1A 1FWRA 3AYSA 4DNMA 4JTDA 1W3KA 1SVDA 4BI6A 1RZMA 3IJ6A 2GSJA 2YIHA 3M5YA 1FHUA 2DDXA 2V30A 2Q8LA 2J7CA 3KFTA 4G1NA 1KWGA 1E6NA 4GC4A 4HOZA 5I3IA 4EPEC 3K4DA 4DJDA 3VIKA 3T44A 3E0IA 3AC0A 4RXGA 4GVGA 4IGNA 2J7DA 3W02A 3QHOA 3WLOA 1VFFA 2DQWA 3CZ8A 5LNUA 3MUAA 3NCOA 4E38A 3OOQA 1TPDA 2AL1A 1E56A 2WWDA 2R1KA 3PUOA 2NV2A 1T8QA 3CZKA 4XUYA 2W66A 1TJ2A 1ICSA 3MUXA 4Q7BA 1KCXA 3B4YA 3PTKA 4IPJA 5F1UA 3I6TA 5LNRA 3GG8A 1TWIA 3KTXA 3HMJG 1IHIA 3AUOA 1LOLA 3UXKA 1OC5A 2YL6A 2FVLA 3MP4A 4ZEPA 4HNVA 2Q01A 4XX6A 2WVUA 5AYZA 4NYYA 1C8XA 1TG7A 1OABA 4MWAC 1RJQA 2FQIA 4M24A 3K1GA 4HA1A 4HMDA 1AVAA 4FHAA 4DO6A 1A5LC 4MAVA 3JU2A 2A3HA 3ANUA 5HATA 3H7VA 2FTWA 3PWAA 3F5JA 2Y8UA 3LRMA 5FI8A 4FLQA 1CXFA 1VJIA 3HZ3A 3G1DA 2PTXA 3FYOA 1NF7A 1TV2A 4N6EA 1PS9A 1NDVA 2OELA 2ZZ7A 4AZBA 4HPNA 4L4OA 1Z48A 2EBNA 4Q3MA 4RK8A 3AQUA 1LBMA 1CZ1A 1VPXA 4AZCA 4LOCA 1ZJAA 1E73M 3UVAA 1AL7A 4XTDA 3T7VA 1WKDA 4JFSA 3E0WA 3EKLA 2AQWA 3P6LA 2WMJA 1W1A1 5FF3A 3CPRA 3HG4A 3HPSA 2A85A 1IEWA 2PDFA 2P50A 2OWCA 1IQ8A 4LAOA 1H0GA 5IXEA 1XGEA 1DJQA 1VIWA 1FWCC 1XYFA 1ZQ5A 3LRKA 5FJIA 2WW5A 1E0XA 3B8SA 1SJAA 1RXOB 1EPVA 3LM3A 3OU8A 1VFLA 4MB4A 4WLCA 2D0FA 2YXGA 1H7WA 3GNDA 2QVHA 2AKZA 4UUIA 3WJYA 3MHFA 1KD0A 2VX5A 1ME7A 3WF2A 4E8GA 1AH4A 3BOXA 2PGFA 4IP7A 3R79A 3ARRA 5E5CA 1MMFA 1ISYA 2VFEA 1O5KA 1ZBVA 5CEWA 1WDQA 2IPFA 4GINA 4Z2LA 3FGCB 4XVEA 2ZUNA 3GY1A 1B9BA 1UUMA 3MMWA 1LWHA 4CNOA 2XINA 1LL4A 3AIUA 1OB0A 4HU8A 4GH1A 1W1TA 2J66A 3IV3A 2B7NA 5LGXA 2CFFA 3CAKA 1YPIA 4JDYA 3CASA 2QUTA 3B0UX 3C3UA 1JYXA 3DZ1A 7ENLA 2YL8A 1A4LA 4WD0A 3M6DA 4GUGA 4AEEA 4MKSA 4UCGA 3FY1A 3WLRA 4REQB 4B5UA 3ZJ8A 3WLLA 1VLWA 3GVRA 4BJHA 3ARTA 5L9FA 1HKWA 1CEOA 2BVTA 1YPFA 1V8EA 3LM7A 4QITA 5AB3A 1J0YA 4G7EA 2XVLA 3UG8A 1IWPA 4FNRA 3PNUA 1W3LA 1QBBA 3CAVA 1IWBA 4UQDA 3MU7A 4NZFA 1XIMA 1NOUA 3DG3A 3UXLA 5HPCA 3DYPA 3AIBA 4TVUA 2V3GA 3AHYA 2PCQA 4U5IA 4ERIA 1O95A 4MWAA 2X1IA 4QNEA 1EHNA 3BW2A 3VE9A 1EGVA 1XINA 1BYDA 3CMJA 3N29A 1BKSA 1E72M 1VYPX 4D72A 4Z2KA 1QO2A 1ZUAX 2ZVRA 5LIWX 3TQKA 8A3HA 2ACSA 3PVFA 4MB1A 1YX1A 1B4KA 1EZ2A 4FOKA 2XJ7A 4F9JA 1FWHC 3LZ3A 1FOBA 3HJZA 1EJTC 5D9NA 4DN1A 4GA8A 4WGHA 3A6OA 5A6LA 2QKFA 3LCXA 3BWWA 3LXAA 2H6RA 3SSZA 2OT0A 1YNQA 3U7VA 3N2XA 5E0FA 3GDTA 1BEUA 3L5LA 2XFYA 3NXFA 1D9EA 3TTYA 4NZ1A 2XIOA 4YHEA 2WC4A 1PDYA 3H4XA 3TSDA 3OZOA 3EWUA 4N9CA 3KRUA 3W00A 3W24A 4JIEA 3QSRA 3FIGA 3WQPA 1NH6A 4C6OA 1V4YA 4O1AA 3G1VA 4BEQA 4XAPA 1Z41A 3W9ZA 3HTWA 1KKRA 4Z1DA 2IPJA 2BG5A 2VHLA 1R2RA 1HN1A 3UA4A 2GQ8A 3GO2A 2YCKX 1EC8A 2QNEA 5FIPA 3LHUA 4KGLA 2WNQA 1TV5A 4IX0A 3A4JA 1VFSA 2OWWA 3L4WA 2F9RA 1I1XA 5XIAA 5HOSA 3RN6A 2A7NA 4BI7A 1UWAA 4L9YA 2GGGA 4O8AA 1K4HA 4ACZB 3GFYA 1H1YA 4GZEA 1A3WA 4CD4A 1LT8A 2D3LA 3NQ8A 3W2MA 1JUEA 1ESWA 1NWUA 2E68A 3GNXA 1F3XA 1T99A 2WBGA 4GUFA 4QSHA 1ZNNA 5D4YA 3A23A 1Y8BA 1Q4WA 3SBFA 4RDYA 5BZAA 3NDZA 4KERA 3EOSA 3INPA 1GNXA 5AVHA 1IIGA 4LB4A 2Q8ZA 4P7RA 2FFIA 3GVGA 4QAIA 4YU1A 3R6IA 1W2VA 1W9XA 3EDFA 4EKJA 1GORA 2XH7A 3WF3A 4EAMA 3WK2A 1I6NA 3JW7A 4WDUA 3PPFA 1BYCA 3LHYA 3W71A 1XRFA 2Y7GA 1XISA 3VFLA 4WK9A 1OZMA 4O50A 3VNMA 4E4FA 2WVVB 1J0JA 1ONWA 3N2MA 2BXYA 3DU0A 2RH9A 1D8WA 4K68A 1BGAA 3BG9A 1XI3A 2VRQA 3GU1A 3CWNA 3OIXA 5C7VA 4LX4A 4TOQA 3HO8A 2VRKA 3D6NA 1XV8A 2UBPC 1WDWA 3QPEA 4MB3A 3U9IA 3PBMA 4DEFA 2BY3A 1JG9A 3FHAA 3UNDA 2WJZA 4PTXA 2P3ZA 1T0OA 1ML1A 2I5GA 4AY7A 2HXUA 3UR7A 1DJXA 4JOMA 2ZZ2A 1K03A 1MQQA 1UG6A 5A8OA 3GFZA 3WCZA 1RPXA 2EKCA 4LC6A 4LVFA 4Q8OA 1AUSL 3H55A 4ATLA 4FLRA 1FWAC 3HB9A 4JIRA 1PYFA 2O55A 3IJIA 2BP1A 2FIQA 4HZMA 2J77A 4I5XA 1JPHA 4QP0A 1V0NA 1HL9A 3ZLHA 1CTNA 3N2CA 2CLLA 4A8IA 3NVDA 2UY3A 1GONA 1F2JA 3QW4B 4G5DA 5JQ9A 5GNXA 1E6PA 1M7OA 2NUWA 3ITVA 5CG0A 1N82A 3B8WA 2VCBA 3PAOA 3SRHA 2FB2A 1XD1A 3F4VA 3TJIA 4ECLA 2PZ0A 1N55A 1XBVA 2VURA 2XN1A 3V1HA 1UASA 3LPGA 1VHNA 4QDWA 3S1GA 1PKLA 1RALA 4S3DA 1DIDA 1W9DM 2Y4SA 1IR2A 3BICA 3NQ7A 2VFGA 4MKNA 2WSQA 2C79A 1LM1A 4KWOA 2E6DA 3DESA 1K3UA 4KWUA 1G67A 1XLKA 2XG9A 4AY1A 3EOLA 5A94A 5EL1A 3RLHA 3KLKA 3SB0A 2BGSA 3UYIA 3VO0A 1SFTA 1IT7A 2J4GA 2QUNA 4IP4A 3LBOA 4ZB0A 2FVMA 1UR2A 3DFSA 3F4NA 4TVDA 2QV4A 1B57A 3W2LA 3SR7A 3GVQA 4PEEA 3R10A 1JI2A 1R2TA 1UWIA 1LTDA 2ACRA 5HJYA 5E09A 1RD6A 2WCGA 1SGJA 2PGEA 3OP2A 3RUBL 3UBPC 1P1XA 4JN8A 1DJHA 2WVSA 5DXXA 1XRSA 2PC8A 3LCLA 3VIPA 4CGTA 4GY0A 4MOZA 4NHVA 1E71M 2E77A 2DZTA 2J47A 4P7QA 3VU2A 3QKEA 5DCEA 5AC4A 1FQ0A 4ZXLA 3W87A 2DJLA 1X6UA 1RA5A 4TVCA 3GM8A 4S3JA 4W4QA 4HPGA 5HBFA 3LSBA 3IRDA 2EKGA 5CPTA 3PSWA 2EQDA 5CXPA 5C55A 3N34A 2X0SA 1HX0A 3IJ7A 4HK6A 4J2PA 3E2RA 1RVKA 3IARA 1WOAA 1YDYA 4B5VA 3JS3A 3PZ9A 4PL1A 1XM3A 3G3DA 5AZ1A 3H26A 1J01A 3PN8A 4AEOA 1D7KA 2CU0A 1DHKA 1TTIA 5CZSA 1OGGA 1FX6A 2I5QA 4Q4RA 2BTMA 2FZNA 3CM4A 5T9CE 3MUIA 3T6CA 3BJSA 3I7RA 3H2CA 1M9HA 3L0KA 3EWBX 3BAIA 2PTZA 3SRKA 1IZKA 4BHYA 1MEHA 4FLSA 4R7WA 4JS3A 3W0KA 3VOJA 4J3VA 1YXYA 4UTKA 1W5PA 3C3NA 4C1NA 2F6XA 3TE9A 3W2NA 4YXGA 5ABEA 1LWJA 4WX2A 1CX9A 1NF0A 1M7JA 2VQTA 2GUYA 2OTDA 3RITA 1UWUA 1EA0A 3S2NA 3LLXA 1C7SA 2DV0A 3L0GA 3LNPA 4NYUA 3PUDA 3GVVA 1SJDA 5HPOA 2QW5A 3TOYA 4US5D 3M7WA 3UETA 4HD5A 1B3VA 4LJ3A 5E0KA 3U7BA 3NEHA 3SCTA 4DI9A 3RYSA 3GFXA 4DJFA 3MYPA 3TOPA 1VEPA 5EMKA 2ONEA 2V2HA 3RM8A 4L65A 2CWXA 3PBWA 2Q71A 2VGGA 5I3GA 3RG6A 1X97A 3MSGA 1CPUA 1FDZA 1QUMA 5DMYA 2FZDA 2W91A 3OA5A 3W7IA 4JYFA 3HQOA 2FDSA 3TCSA 4WGXA 1CGXA 3QQWA 4HJWA 1H11A 4DZIA 1WA3A 3M0XA 1KFKA 1MNSA 1PWLA 1AW5A 1RAKA 3WJSA 3S5ZA 1OFBA 3W37A 5TNVA 2PRLA 3PTDA 2BGQA 2PFHA 4NZ3A 5H1WA 2RGLA 1UZ1A 3HGSA 3D0CA 2PS2A 1HKMA 4ZQOA 5I23A 4PC8A 3AUJA 3AMDA 3ITCA 3AJ7A 3T0TA 3MSRA 4C7FA 3IEBA 1EC9A 4YHGA 3CZEA 5FOOA 4PB5A 3E1F1 4O19A 2PPGA 1AQ0A 4DJEC 4LAMA 3NL5A 4GY1A 3I4EA 1CXIA 1MI3A 1C8QA 4QG8A 3A5VA 3PM6A 1RY0A 5G1TA 3AS3A 3IJQA 3L2MA 1KCKA 3L4ZA 4PULA 1MZRA 2XIQA 3TEVA 3MZNA 1DJIA 3N3TA 5HMFA 4XZ9A 1JZ2A 1TTQA 4DWSD 2GVEA 2QF7A 3A22A 5G4HC 3BMWA 2DIJA 3KZSA 1PZ1A 3VKBA 3OYZA 2GK1B 3H6OA 3KRSA 1XYLA 1GKPA 2I57A 3DAQA 1X7FA 3DBNA 4PTMA 1S5TA 4LGXA 1V3KA 3O63A 3IVSA 1EF2A 1M7XA 3WLPA 1OYCA 1F3EA 2WQDA 4NIRA 2HE5A 3LTYA 3FEQA 2CITA 1FCBA 1EBHA 2I5IA 3REQA 1QOQA 3SW6A 4R85A 1UIPA 3SRFA 3DI0A 3OJGA 2D69A 2SFPA 4GBDA 5HK4A 2RJHA 3P5YA 5KZ6A 1F7BA 1W0MA 2V67A 4X0VA 3FDGA 5ABTA 4HPXA 2XFFA 4DO7A 4GO9A 3CHFA 5A6AA 2Z25A 3U5YA 4P7NA 4JCMA 4V27A 3EWXA 4UMAA 5BRPA 1CB2A 1FCUA 4O17A 3NQVA 3LCWA 4X2PA 3KUMA 2ZXAA 3IACA 5FF7A 1U33A 2DIEA 1Q63A 4GI8A 3NURA 3VNJA 2BX7A 3SUUA 3MHGA 3WKZA 2QS8A 2PSNA 3EB2A 2D0HA 1RHCA 4XZLX 5E93A 3S2MA 4PCFA 2Y7DA 4IFOA 5C2XA 3FVMA 3QPYA 4WRHA 5CPSA 2YGYA 2NT1A 3S5SA 2VC9A 5A8NA 4IH3A 2Z1XA 1W1IE 2ON3A 4W5UA 3TJXA 4QG6A 3RK8A 5AYIA 2XWDA 1I60A 1BSLA 2PDLA 3ZVHA 4PTNA 2BODX 1PX4A 4XZWA 5DANA 3AAMA 1UWQA 2O7SA 3BAJA 1EDQA 4LUTB 1EJRC 1VH7A 4QAWA 4ZR8A 4JFWA 3BVJA 1W9BM 4KWSA 5ENLA 1ZGDA 3RMEA 3G77A 5HUPA 1DJWA 1EDGA 3OHMB 1BYBA 4C7GA 3LPFA 1T40A 1J11A 4PRTA 4WIWA 3UGVA 2GVYA 5JUVA 1H09A 2YBTA 3NO1A 3FGCA 2Q8XA 3GXTA 2WKJA 4WHBA 3LBMA 1PCWA 3PB2A 1C90A 3APGA 3V16A 4EXQA 4JTQA 4CCEA 5LKYA 1HVQA 4HN8A 3TC3A 2VP8A 3WDQA 4JN7A 4O1FA 3GK0A 3GHSA 2OZTA 3PFMA 1OYAA 2VZSA 1Q5MA 4AY8A 3GZAA 4J4KA 3GSMA 1EJUC 1VJSA 5KMYA 2FHCA 2V63A 3MQTA 3S9ZA 3KOYA 2NXIA 5J04A 5C9RA 1TUFA 3DIPA 4M6PA 4IFKB 6REQB 1E6XM 1EWDA 1UBSA 4LF1A 2IKGA 4S3GA 1SZRA 1KRCC 2XH4A 3JVAA 4XO6A 1EYEA 4IFRA 1CBGA 1Q7MA 1R30A 3NQCA 3RRXA 3W7LA 4F48A 4NSBA 1YYAA 4JIQA 1Z7AA 3QC0A 2WSKA 5HUOA 3GC4A 4LAUA 1XLGA 1VYRA 1ZSXA 4PBFA 1ADOA 5FEXA 4UTTA 4KT2A 2VFDA 4JEJA 3TP4A 3LY0A 2X2YA 4EWJA 4MY1A 1OEPA 4UOZA 3BAKA 3DG6A 2TYSA 1NELA 1PZ2A 3MCMA 3AHVA 3T07A 4A8RA 1P48A 4J40A 3UWEA 1AW1A 2PTDA 3MDWA 1C7TA 3K2GA 1ODUA 3L4UA 5BMXA 4JTFA 1OYBA 2EPLX 2QGHA 3N4FA 1XG3A 2YLLA 1OY0A 4DBWA 3LS9A 3QMTA 3P0WA 4GI4A 4RDZA 2X7VA 3PZQA 1KR0A 4UR8A 3G0XA 1MO0A 3REQB 3VILA 2I56A 1HXJA 1REQB 2WZEA 1Q3NA 3UWVA 1F74A 4OOUA 7ODCA 3PJTA 2Z7GA 2WZMA 3P80A 2OO0A 3F1QA 3GG7A 4IIEA 4IT1A 3WL0A 3LSCA 2BFGA 3TQ0A 3TTQA 2YLAA 1PKNA 4MYAA 1OX5A 5LXXA 4Z0JA 3GD6A 3N11A 1TB3A 5H91A 1UP0A 3KBNA 2CPUA 3OGRA 1NARA 2WMKA 4XISA 4LY4A 2QZRA 2VTFA 2XVGA 3GHUA 3OODA 4F0MA 3LMZA 5E70A 3N2TA 4BWLC 2O9PA 3AMGA 3M6YA 2VZOA 3LQLA 1XIJA 1UR9A 3H22A 3LV6A 2ADAA 3UZYA 2OR2A 2NQLA 4ICMA 3WF4A 2GSEA 5KZEA 2QJHA 4H9TA 2XGIA 3FJ4A 3N17A 3G1AA 3LA4A 2ZFAA 3O6DA 3W22A 2ALRA 3WUFA 2R1MA 3TYCA 4FF7A 1LG2A 4LU0A 4OVXA 2FVKA 1LQ0A 4WY0F 1TPFA 4IL2A 1FXPA 1EEPA 3T8QA 3W27A 3V0SA 4GIYA 3SCSA 5I3HA 1Q8JA 5TBOA 3DHPA 2R1PA 1SQ7A 4GIRA 4AW7A 3FA3A 4W87A 2QR6A 1B90A 3VIIA 2Z28A 3GNRA 1GJUA 1NY1A 1RV8A 1KBJA 1TJ1A 2QJJA 4XUGA 1HJQA 2UY4A 1GKRA 1H51A 1UA7A 3PBYA 1XKJA 5HQLA 5AC7A 4LEQA 3M16A 4ENLA 4Z1CA 3M46A 2YFOA 1JI1A 3EPMA 1T96A 4N9DA 3UJSA 5I2UA 1C92A 1V08A 3N18A 4PMZA 4JXCA 1U22A 4IG2B 5HNNA 3R13A 3VX0A 1K70A 2WBKA 4FNQA 4GI9A 4PRWA 4QXIA 3TIMA 3WDHA 3MC5A 3KLLA 1LRQA 1W3IA 1DJZA 4NAEB 3WZ0E 1GW9A 4IXXA 5AYBA 1FH9A 3K30A 4E5TA 4D6DA 2PLKA 2OX4A 3V35A 5KEZA 2ZZ5A 2WMIB 1UH2A 3EOOA 4ZQNA 3M0YA 1KQZA 2DUZA 4ZXOA 2FHBA 4L7ZA 1EX5A 4I9JA 3H2EA 3VGGA 3CV2A 3LDVA 1WDRA 2EPKX 4RKAA 1JGIA 2HEJA 1FWSA 3I65A 3K13A 2J75A 4BF5A 4HOWA 2PF0A 1TO3A 2BVYA 4AQLA 4WSKA 3K8MA 4IG2A 3EB3A 3NL6A 3W74A 5EYWA 1E6SM 1PZ0A 2X41A 2YDQA 3S4TA 4LS2A 4IXHA 4WOZA 1JPMA 5EFDA 1H3GA 2E4TA 1NFPA 3TWBA 4PTWA 1R5YA 3TAOA 1GVRA 3HPZA 2GYIA 4I5RA 4A3UA 1CW2A 4DIAA 2G3NA 4WR3A 1FFRA 2DT2A 4NAFA 4H2CA 2ZTJA 3BK0A 3PS7A 1YEYA 1JR1A 1UA3A 4NX0A 2HMCA 3Q67A 2YB1A 3C8FA 4Y9AA 4I3GA 1XQKA 3S5NA 4QG9A 2VC7A 3B8IA 2O4QA 1CWYA 4OE7A 1G7VA 3R43A 1JDAA 3L5AA 1E6QM 3QZEA 4Z08A 4GCAA 1TWZA 2QDDA 7XIMA 1IWAA 1MUWA 4FZIA 1ZFJA 4PUWA