3H26A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h26A00
4D8ZA 3TYDA 1Q7MA 2YCJA 3TYAA 2VEFA 4O0QA 2H9AA 4MWAC 4HB7A 4DJFC 4DJEC 4MWAE 3NOYA 1TX0A 3H2EA 4NL1A 1F6YA 3H2FA 3H22A 1TWWA 1Q85A 4NIRA 4S3FA 2YCLA 4S3AA 4MWAA 4C1NA 1Q8JA 3TYEA 1TX2A 3TZFA 4S39A 1AD1A 4NHVA 3BOLA 3BOFA 4CCZA 2OGYA 4D9PA 4D8AA 1AJ2A 3TYZA 1Q8AA 4MWAD 5JQ9A 4DJFD 4DJED 4S23A 3H2OA 3TZNA 2DZAA 4S3EA 3K13A 2Y0FA 4DAIA 3H21A 4O1FA 2Y5JA 4S3DA 2BMBA 1AD4A 1TWZA 2DQWA 1Q7ZA 4DJDC 3H2NA 3MCNA 4DB7A 2VP8A 2YCIX 3H2AA 2YCKX 1TWSA 3V5OA 3H26A 1EYEA 3MCOA 4DJDA 4G9PA 1AJZA 4S38A 3TR9A 1Q7QA 4DAFA 4O1EA 4DJDD 2E7FA 3TYCA 2H9AB 4S3BA 4S3CA 3H24A 3TYUA 2VEGA 3H2CA 2Y5SA 2DZBA 3MCMA 3H23A 4NILA 2YCLB 3H2MA 4PZVA 1AJ0A 3TYBA 4MWAB 4C1NB 4DJFA 4DJEA
chains in the Genus database with same CATH superfamily
1KM6A 1NWTA 3TYDA 1OFOA 5FJOA 4ZB5A 3V35A 4PYSA 3WEZA 5K9CA 4LUTA 1QNSA 5REQA 2PCEA 4IIEA 1W3NA 4F66A 3VC6A 2QMJA 4AG0A 1IZKA 2Z26A 3QZEA 7A3HA 2WSPA 5AHFA 1UPMB 4GPNA 3R43A 3G2GA 4ZB2A 1NVMA 3WNLA 4C6BA 2DW7A 3OIXA 4DJED 1V3MA 1KQZA 3QTGA 2HSAA 3EMZA 2FTYA 4LCSA 1PXGA 1AMKA 1XDMA 3EKZA 4RCXA 2Z1WA 3PBMA 2DQWA 3WK1A 3PTDA 4WY0F 3VX0A 2C0HA 2PGRA 4XK2A 4HPJA 2XFWA 3TC6A 4AY7A 1UKTA 1TWSA 1TZ9A 1HJVA 4M6UA 1OGBA 4CD4A 4NAFA 3FW6A 4AXKA 1KFBA 4IGHA 4H04A 4H1ZA 3PNUA 3NIYA 3HJEA 4TV6A 1NTHA 1VFLA 2O4MA 2IKJA 2D1ZA 4AD2A 1TQJA 4C90A 8CGTA 4ZO8A 4WD0A 3PZMA 3VIIA 4GLEA 3TKFA 1J0ZA 5XIMA 4JEJA 5CZKA 1O5KA 1KRCC 1GHSA 1OX5A 3ZJ8A 1OADA 1UIPA 2B81A 2C1GA 2WBKA 2ZQ0A 4QP0A 1HVXA 3ARWA 4PUJA 3WIJA 1XYFA 2YCLA 1J9YA 2CXEA 2AQOA 1XRSA 4NX5A 4JKMA 4XUGA 2G95A 3WN6A 3KOXA 2WHKA 3CV2A 2OLAA 2GVYA 1KGUA 3W1XA 5C9ZA 3O1NA 3UJ2A 4KWVA 2FPTA 3DKJA 1LLOA 3OZMA 4PMOA 1AK5A 1TVLA 1V8EA 3WLNA 2VZSA 2YLAA 4ZBCA 4Z0JA 4MF4A 1PCKA 4LX4A 2QF8A 2CKRA 3CHEA 4I7UA 4TOQA 3EB2A 1DJGA 5AYBA 3PB2A 1SZFA 4Z0SA 1XV8A 2BWGA 1W5NA 2XVGA 2BSLA 2PI6A 3ARQA 4GYFA 3BJTA 3MYPA 5TAOA 1ONWA 4YMZA 4N9CA 1OG6A 3UG4A 3T2OA 1RQBA 3WUFA 1H09A 4AHQA 3DERA 3ZLFA 3IJ9A 2VFHA 3A22A 4R34A 4LB4A 1XH0A 3GTHA 3R0KA 3MYOA 4QS6A 3GXMA 3WLMA 2OQHA 4BCEA 1E6ZA 1EJVC 2WMJA 4PBGA 3MO4A 2PDLA 4O16A 2P1FA 3M43A 2XWEA 4PUUA 2DY3A 2R1KA 3HGSA 4JTIA 3HMCA 3SADA 3A6OA 1W3IA 2ZUUA 1M7OA 4LS0A 2P0OA 5F2MA 1DJXA 2C3ZA 4QDPA 4GQBA 3UWQA 3VFLA 3HJZA 2IUZA 2DH2A 1QO5A 5BXRA 1U30A 5FJJA 4AD5A 4WCJA 3LV5A 1OYAA 3AIUA 1KW1A 4ICMA 1K6WA 4LH8A 5HAOA 1J0JA 3EMQA 3W7DA 2PDQA 1H7WA 3DDMA 3FHQA 3SIZA 4UTWC 4M51A 1KM3A 4H9TA 5GNXA 1GVIA 3VNIA 3PZUA 2I16A 3MSGA 2GK1B 2AGKA 1EP2A 4F3HA 4M0XA 1XRTA 2DT0A 3UZYA 2PZNA 2XVNA 1BGGA 2V3FA 4GJJA 1Q2RA 3TSDA 3AIQA 3PFRA 1WXJA 1KQYA 3A4WA 4IXXA 1EP1A 1ZBKA 3K5XA 4AXNA 2Y61A 5FA5A 4LAMA 4S3GA 4KS0A 4GI4A 2QV5A 3PF3A 4PCPA 3QOMA 2ZXQA 3M5XA 4DZAA 4IX2A 1S1RA 1SR9A 3CL7A 3NPXA 3WG6A 5JIWA 3VU2A 4N9BA 1BYBA 5D02A 3ZVIA 1QI3A 2XSXA 4L61A 1V3LA 1KCKA 1PJ9A 1TPDA 4DNMA 1HZYA 4JTJA 1HGWA 4BR1A 4B5XA 2Z25A 3W73A 4MKNA 1XP3A 1B9ZA 3CAQA 3LXBA 5FEXA 2DSZA 1JF5A 1XH1A 2WJDA 4NZFA 3TV8A 1AZ1A 2Y63A 2PDGA 4MAVA 3NEHA 4GCAA 1JCJA 3WNKA 1OBAA 3BAIA 1GJUA 4NP7A 4KIRA 1HTIA 3FKKA 3V0SA 2QHAA 4EWND 1C90A 4QFUA 1GNXA 4OJYA 1VFUA 4C7GA 4H7VA 1EPVA 1N82A 3KBJA 1EYWA 3NYDA 4LYKA 3ABRA 4G56A 4ZMGA 4MNLA 1FWJC 1VZWA 3ZT6A 1E73M 2FB3A 3VFCA 1U5HA 4QNEA 5IXEA 3LHVA 5FKYA 4CQ9A 1FWRA 1TYGA 5EL1A 4W7VA 1MXDA 2BOFX 3D3FA 2VP8A 2AMXA 3F1QA 4DWSB 4CNOA 1JUEA 4P8VA 4LU0A 1RZMA 3C8NA 3KM8A 4RE3A 4E8DA 4QTGA 3IAQA 4L5ZA 4IF2A 3WLHA 1PDYA 3BAJA 1TRDA 4O57A 3CH9A 2ASHA 4UTLA 4HZ6A 4PUNA 2OX4A 4Y7EA 4AZCA 2F38A 4UMCA 1FWAC 3U4FA 2ZA3A 5DT7A 1GQJA 1MYRA 2XIOA 1CTNA 2ZRUA 1UD6A 4F2BA 4PMZA 4J3UA 3KCLA 2DV0A 1TJ1A 2POTA 3GYEA 5HNRA 1GYLA 4C6QA 3IUDA 2POZA 3TH6A 1RV8A 1QPOA 3RJYA 3ITYA 1S2UA 2DSKA 3M5VA 2C7FA 2FGLA 4HNTA 1Y5XA 2XM2A 1E9LA 1J18A 4W7WA 2VL4A 1OFRA 4LUJA 2XU2A 4NL1A 1QCWA 5H8MA 2J79A 3PB0A 4J9JA 4EF8A 2YOCA 3BK0A 5AC5A 3STCA 3ARSA 2H3DA 1JCTA 5JXQA 3ZYZA 2ZX5A 1KRAC 3F4DA 2Y8VA 3MUCA 3V75A 5HULA 4UQCA 1X1NA 5H6HA 2CESA 2KAUC 3M47A 3ARRA 2PDIA 1TWZA 4HMEA 4HT3A 1GW1A 1GG1A 1W17A 3P0WA 3N2MA 4WXZA 1O12A 4YHEA 4A3RA 3LSBA 2JIEA 3G3DA 1EJXC 4B3KA 5G5IA 3PC0A 1YTDA 2PDJA 1KM1A 3LHZA 3CQKA 2ZXAA 3NQGA 1IQ8A 4JIIX 2PODA 5HQMA 2A3BA 3E96A 4B4FA 3BLLA 3IVTA 4ZQRA 4IG2B 3ZOAA 3DOPA 4P7NA 1CXLA 1S39A 3E49A 3NTYA 3VKJA 3FJ6A 3M4HA 2DEPA 1WDPA 4KEUA 4HK6A 1VF8A 4QROA 4ZODA 1TIMA 1DJZA 4DWSD 2Y88A 1B3WA 4WK9A 3O9NA 2YZ5A 1L6WA 4A21A 1JPHA 3BUVA 3FKRA 3URNA 1ZRQA 3TW9A 3NQAA 1MI3A 1WAWA 1V0MA 1N8WA 1CPUA 4NNBA 3EPNA 3LEPA 5CG0A 1LBLA 3KVMA 1KRMA 3MI6A 1DBTA 2V8ZA 1W91A 4R5EA 1GZJA 4D6GA 1UD2A 2BODX 3CPRA 3AXIA 3S1UA 4IL0A 1G7VA 4V2XA 3N17A 2QCHA 2UY5A 4PMVA 4JX4A 4W7UA 1Q6CA 2A4AA 5D2TA 1XBYA 1REQA 4HA1A 4DF2A 1HKMA 4HCLA 1JZ7A 2WOQA 1NIUA 4DEFA 1AZ2A 2WMHA 3QQ0A 3EXRA 1BG4A 4EF9A 3CNYA 4IMGA 1GONA 2OSWA 3MCOA 3RO6A 5A6SA 1J79A 3U7VA 3OQEA 3VGFA 4LYRA 1L6FA 3PBVA 4HN8A 3K2GA 5BU6A 2JGYA 2FYMA 4UB9A 5A3HA 4AX7A 3TC3A 1VC4A 5CZTA 4ERIA 2EBNA 1YX1A 2ISVA 3U9IA 3GNPA 3MI3A 3E5PA 3OHIA 2QR6A 1PO9A 1NELA 2ZZ6A 2A3EA 1T5AA 1OC7A 3PAJA 3CQHA 4U31A 1XLLA 3QW3A 2JF7A 4IPLA 1BYCA 5D9NA 1D7KA 1HJXA 4M56A 3RUBL 1XIDA 3CH0A 4FNQA 1NDWA 4NZCA 2A6NA 5E0CA 1K77A 6XIAA 3BAYA 4P2VA 2ZXDA 1UA3A 4XAZA 2GSHA 4JQ2A 5CZJA 4ADUA 3PBUA 1YPIA 1XC6A 2A3AA 1NF7A 1TMLA 3LN3A 4YCPA 2TMDA 1E40A 4JICA 1QHPA 3H53A 3TLLA 4DUVA 1Q2SA 5D9OA 5HWJA 3MKCA 1E3ZA 1W6TA 4F9JA 3JZEA 1UZDA 1UR4A 2W27A 3NDOA 2WZMA 2FJKA 4P7QA 4TVCA 4CCDA 4J3WA 4IWWA 4LV9A 3W84A 2JKAA 3IS4A 4OBRA 4RZ6A 3S5SA 1BWKA 1BXNA 3T40A 5HANA 3QQ1A 4LVFA 2QVNA 4CVWA 3CTTA 1PHWA 1FWTA 3QLDA 5BROA 3TMQA 4LRTA 4Q7NA 4HQVA 1O5XA 4GYPA 3USZA 3OA5A 1W5PA 1B4KA 1J10A 2V63A 2VT0A 2X2GA 2QUNA 3CU2A 2FPVA 3BQ5A 4QJ4B 3DHDA 3JZUA 2YA2A 4OZOA 5D04C 2QCGA 3T08A 1VLWA 4C6MA 1QI0A 3WLKX 1X8FA 1QJWA 4OVXA 2IS7A 3L65A 2VKZG 3UWZA 5MF5A 1M03A 1UH4A 1N8FA 4NUWA 4CD5A 1OGGA 1K1DA 4PRWA 5AC8A 1S5WA 1NQKA 3EX4A 4IJCA 4PUEA 5HMFA 1KFWA 5JBEA 3VOCA 1G4EA 2BMBA 3U2ZA 5C8BB 3EX3A 2QAFA 1B3ZA 3C61A 3H7VA 3QQWA 2RDUA 1CT5A 2HE5A 4YYCA 1X6UA 1FH7A 1A5SA 1V0KA 1XR2A 5LSMA 3RCMA 5G1MA 3C2OA 1VHNA 1K3UA 4J2PA 3RAOA 2IKIA 4HA0A 3T4WA 4ZXLA 3ZWTA 3NPVA 3T0DA 3BLPX 4MZYA 4H9ZA 5AHLA 5FD0A 2ZUNA 5BNKA 4TX9A 3G1YA 3GW3A 4C6CA 1VKFA 4DJEA 1NP0A 3U7BA 4DUXA 4JFVA 1PX8A 1MUWA 1CXKA 3PBWA 2E5CA 5EA9A 1HW6A 2OZ0A 5A6AA 2VTFA 2C6QA 3CUZA 1WKEA 1XW8A 1C9DA 1A47A 1BXBA 1U1JA 3VI2A 2OX1A 4MWAA 4ML9A 3DZ1A 2GGJA 3VIGA 1EH9A 5IHRA 3L9CA 2X1SA 2WM0A 1MW0A 4JYDA 3W4RA 5FESA 2ZX6A 1UH2A 3OIHA 1X39A 1BVZA 1NDYA 1Y0EA 4YS1A 3UGVA 1HJUA 1UR3M 3SRHA 2H8ZA 3QY6A 1WX0A 4UNLA 1XLFA 1F74A 4QRNA 3NFUA 1Q65A 1US2A 5G4HC 1QNRA 3UR8A 2X30A 3RPDA 4DX3A 4IQDA 1Q45A 5L9FA 4G9PA 5FI8A 2R8WA 2VX5A 1T6MA 2J25A 3F5KA 3PAOA 3T9PA 4B5NA 3RX2A 2C15A 5HMEA 3W2UA 1DQUA 4H7CA 4O1CA 1H50A 3T09A 1FWNA 4V15A 1T99A 4TQTA 1RSCA 1TTIA 3TLQA 5EYWA 3HIJA 4K36A 3BCFA 2GDVA 4F0LA 2R1MA 2QPUA 3S5ZA 1BAGA 5HR7A 2H9AA 1ZQ5A 4P5UA 1Z44A 2NW0A 5DMMA 1UWIA 1RPKA 2WVSA 3UWUA 4GE8A 2VR4A 5I07A 1Q8JA 3C5QA 2QVHA 1DIOA 3CZGA 4Y9AA 2GL5A 3WJWA 4JL2A 2RAGA 3VM5A 3R2GA 4J3ZA 1QI5A 4IMDA 1XJBA 3F4WA 1UR9A 3PBYA 1UJQA 4HPHA 1GVEA 2XWDA 4Q8VA 5AYZA 5I3GA 2J88A 1HL2A 4QQ3A 1RJRA 2GJRA 3CZKA 4Y9NA 2D23A 4UC5A 3S5YA 1LL7A 3VAVA 1YTKA 1RAKA 3R1ZA 5K9DA 1SPQA 4A3HA 4W5UA 4MLJA 2PZ0A 2Y2WA 2CEQA 1V02A 3UNTA 4IIHA 1AQMA 3T78A 2QGHA 5IRPA 4MKSA 4YVPA 4L64A 3N04A 1UWUA 1QR7A 4XWUA 4R9OA 4JTDA 1T8XA 1WDRA 2PU0A 1FTXA 3W81A 3FV9A 5GPRA 4DELA 1IT8A 3TQVA 4RUBA 1PSCA 3KBSA 3B0XA 4AYSA 4IMCA 1PIIA 1R3RA 4FR1A 2BGSA 4LVBA 4BWLA 1R3QA 2PDCA 2AKZA 2BHYA 3VCCA 1E6QM 2G96A 3WDHA 2CU0A 2ZZ4A 1PE1A 4HPXA 2W92A 3QKZA 4XZIA 5JBFA 5G2HA 5J5DA 5MKGA 3OPSA 2ABBA 1FWBC 4OV4A 4H3DA 3A4AA 2WC3A 1WCGA 3AS2A 1TPFA 1ZS2A 1JDFA 3GVRA 3UCQA 3W1NA 3NVDA 4ONVA 6ENLA 3NZRA 1U22A 3OGRA 4D6CA 3K46A 5HR6A 7ENLA 4J2MA 3LPGA 1H60A 2E68A 2XN1A 4QHRA 2FZMA 3GBEA 3OZOA 1IXOA 2XINA 3EKLA 3HG4A 1TMQA 4AHOA 2J78A 2VD8A 2V6AA 3RILA 3WH7A 1OWQA 2J9ZA 1KGWA 2D2GA 4WKFA 3U57A 2P8BA 4GABA 1YXDA 3NQEA 2TAAA 4NAEB 4HNLA 3HPZA 1W8SA 1RH9A 5F2GA 4YJ5A 4Q8OA 3RRXA 1O1ZA 3ZO9A 5GQBA 1E5NA 3S6TA 1HKKA 2OZTA 2GOUA 4CNUA 4TU1A 2VI0A 1BSLA 4D8ZA 4WLCA 1A5MC 4MB5A 2F6UA 2YCJA 4I5RA 4ERAA 2VWSA 3LA4A 4J4KA 2DQXA 4CCCA 2OB3A 1Q85A 1OFQA 2WVTA 2WW5A 1E51A 5DY2A 5CXPA 1CECA 2E3ZA 4MTVA 4PR4A 1P0DA 3VDCA 1S5MA 1XLEA 4A8NA 4AW7A 5J5RA 3SGUA 1RQHA 2VEMA 1WBHA 4OTKA 4Q4SA 4C6LA 4E4FA 1CW2A 5CGMA 5A6TC 2GK1A 3DESA 3GW0A 1ZGDA 1FA2A 3B3DA 2WMFA 3E9AA 2DUAA 4A3QA 4DHGA 2HWGA 2CKSA 4UR9A 2RDWA 2YL5A 2OSYA 5C7HA 1MEWA 2W9MA 3BDKA 5BRBA 3KRSA 3QM3A 5I7GA 2ZDSA 5D2WA 1DJNA 1Q6FA 3P14A 1JYNA 2ADAA 3XINA 4W84A 5FIPA 3L4ZA 2FMNA 1WUEA 2HVOA 5D09A 1UA7A 2BVWA 3VA8A 5CJMA 2YL8A 3MCMA 1KM0A 1PIGA 4B2DD 2G5WA 4RNJA 1MDRA 3GM8A 4MNKA 3PZ9A 1VBHA 3LZ5A 2C19A 3Q67A 4MY8A 2QDGA 3RLVA 3PN8A 3AJ7A 3EXTA 3BH4A 1JZ3A 2RJGA 2WAGA 5F7UA 2IKGA 2OEMA 4PULA 4ZSUA 3C3NA 4DO4A 3W1UA 3T2PA 4XZMX 4G1NA 4DI9A 4UQAA 5KZEA 2QMKA 3F03K 3TQPA 4PUDA 1IXPA 2ZYFA 2Y85A 1UWQA 2JBMA 3PWAA 6PTDA 3VNMA 3GDTA 4F4RA 2DZAA 2Z6JA 2XGIA 1ONRA 3OYXA 1GCYA 1D9EA 3A12A 3K8KA 2ODOA 1K7XA 4DYKA 2V82A 1TUFA 1UCWA 1GVYA 5AECA 3BLKA 4N02A 5LNRA 3B05A 4LY4A 1I1WA 4A3YA 3NCOA 1NEYA 4D71A 4EXBA 4U28A 1OSEA 1GK8A 4IMFA 1TA3B 3PG8A 4LUSB 3U0HA 1TVNA 1MW2A 3FOKA 4LNYA 1VYSX 3KBVA 1UW9A 1EB3A 3LCXA 1E6XM 4UTIA 5FEPA 1KXVA 4FXFA 2DDXA 2DJXA 1W3KA 1BLIA 3TWAA 3VKCA 3M0YA 3TONA 4DO5A 3UJFA 3N4FA 3W76A 3EWYA 5CSSA 4JN8A 1Y5WA 3V0UA 3L4WA 4IGNA 3UESA 4DZHA 3LHYA 4IHCA 3C2VA 1YRRA 3DFHA 3VCNA 4YCOA 3C2FA 3K8MA 3BMVA 4UZSA 1XIJA 3AXHA 5HA7A 4O53A 1EOMA 2V67A 3OJGA 4P61A 3VILA 2O9OA 4N9EA 2D0FA 5LIUX 4WGHA 2V3GA 3GFZA 3NEVA 1M5WA 1YKWA 4JTEA 1MZHA 4FOJA 3HGOA 3E74A 1TPVA 4TR9A 3O06A 1EFZA 1XWYA 3R0UA 1BYAA 4ZXOA 3MS8A 3SR7A 2GJNA 3F4NA 1EF2A 4NASA 4OHQA 2GUUA 2ZZ7A 1TV2A 1VRXA 5EBUA 4CUCA 3VOJA 4XBSA 4IP4A 3N19B 3QF0A 2VRQA 4XTDA 2HVNA 3KTXA 2ATSA 1MFUA 1HFBA 3I3BA 4DAFA 4PTWA 1TIWA 2VDIA 2ESCA 2DORA 2OEJA 4M1RA 5ENLA 4G7EA 4ORIA 1UROA 2ALRA 3M0IA 3DKLA 3G18A 3VGBA 1N8IA 4WY0A 2HISA 3H2MA 4PTNA 2PB1A 1AW1A 1JCNA 3ZT7A 1M01A 4AWUA 4H9XA 5AVHA 6TIMA 3OLDA 3GG1A 2ZUMA 4AF0B 2NXGA 1KRBC 3C3UA 4YIWA 3S1VA 3HG3A 4GYPC 1SUXA 5D8ZA 2F2KA 1E6NA 1GQNA 1NF0A 3CPUA 4M6PA 4X2RA 1SJCA 3L4XA 3VUPA 4ZE4A 4FNUA 5DFAA 1XUZA 3HV8A 3AICA 1W2PA 2BHUA 3P8JA 1OK4A 1P0BA 4V28A 5DELA 4WF7A 4RR4A 4GJIA 2Y5JA 3P5YA 3AMCA 4WOZA 4AC7C 1S46A 3QHNA 1WV2A 2A7NA 4PUKA 4O8AA 3U6WA 5KTLA 6CGTA 4ATWA 1KFKA 1YYAA 1D8WA 2GGIA 4GIEA 3CASA 2ZUWA 1LP6A 4ATDA 3QMSA 3S1WA 1K4GA 1NOFA 4N6FA 4AVFA 3WDQA 2J7EA 4HPGA 3A3XA 1BPLB 2E9MA 1UQYA 3VVGA 1JUKA 4QJ5B 3UR2A 1R87A 1TV7A 4JQAA 3RF9A 3UXIA 2D20A 4QBXA 3AXMA 4JHZA 3QZAA 2CERA 3M0MA 3GLCA 2VEFA 1H7RA 1UASA 4LJ3A 2JKEA 3W7EA 4KGLA 4DJEC 1DORA 1JPMA 3R6IA 1J8VA 1WZAA 4N6EA 2E0PA 5IDIA 2QUMA 3R5EA 5HMDA 1YPFA 5TNVA 1CXEA 3UQNA 2QCMA 2ZVIA 3SCPA 1MWOA 1W9UA 1UBSA 3U5YA 3I6TA 4Y9OA 1JPKA 2VDHA 3T0TA 2PWHA 1Q5MA 2D73A 3F4CA 3EDDA 3BV4A 3CAKA 5F4WA 2PAJA 2EO7A 4AZGA 1VBRA 3MB9A 1PZ1A 3WNMA 3ENLA 3CT7A 3VDBA 3WKZA 4HYWA 3VUSA 3BLFA 4DIAA 5CC7A 3RR1A 3QHMA 4AYGA 1GVRA 2WMKA 2AAAA 2J7DA 4BI6A 3MHUA 1KWGA 1ME9A 4WDXA 2EQDA 5C7VA 2D69A 1VP5A 3A9IA 3T55A 4NZ5A 3I68A 4ZGYA 3WELA 4YNGA 2XFYA 2QUUA 3VDGA 4M81A 1GWJA 1OZMA 1EO5A 2ISDA 3N4EA 2OYLA 1G5AA 1XL9A 1O94A 2NQZA 4PMJA 1SZGA 3QV7A 5AC7A 2RGLA 2GWNA 3G1HA 1RVKA 1XIHA 4ML4A 2HS8A 1MNSA 3EWWA 2R6OA 4HZ8A 4MLRA 3OYZA 2BNJA 4WR3A 2VR2A 1W3HA 1A5CA 2VC5A 4C6IA 1E1FA 4ACZB 3WQOA 1Z6KA 2Y7FA 3CPGA 4GK8A 2F9RA 3WMSA 1FRBA 3NNTA 4JD4A 1EJWC 3ALFA 2PD9A 4YPJA 4IFRA 2F7FA 5G2IA 3OODA 1AJ2A 3UYIA 3DHUA 8XIMA 5AHEA 3WBWA 2BV9A 2CC0A 5DQPA 5TBOA 3RLGA 3BURA 2HDJA 1Z8AA 4DBWA 3QPYA 5C9UA 2IW0A 3IJ7A 3WQ6A 4HA4A 1ML1A 3WNNA 3THAA 1VEMA 1QOPA 2WNNA 3BW2A 3CUFA 4LGXA 1XPGA 2C13A 2X1TA 2Q71A 5C2XA 3STEA 4UTUA 4AEEA 4ASTA 1RCXB 4L1GA 2W63A 1C8YA 1US3A 3SY1A 2YDQA 1ADDA 4JFUA 2PURA 3TX9A 4UFKA 2ATMA 3GC2A 3TYUA 1WZMA 3IJ8A 4KIEA 3NUKA 4PUWA 1JULA 3K8LA 2QDEA 3V4BA 3AAMA 1KR1A 4F0HA 3UWVA 1C92A 3AZTA 4NY2A 1NY1A 1FDZA 5DCDA 2CXGA 4XB3A 1CXHA 3L2IA 2Y89A 1KTBA 1WNOA 2YDSA 1OFPA 4IT1A 2OO6A 2OSXA 3EWCA 1A0DA 1Z7AA 3LX9A 1BQGA 4BWLC 1DJQA 4PL2A 1Q6EA 4XUYA 3TYEA 3WQ4A 2J6VA 4ZTXA 1ISZA 4X22A 1YXCA 6A3HA 5CJ5A 1H41A 2Z2AA 2WBGA 2EJ1A 4XD5A 1W9XA 1PKMA 4D8AA 2O9PA 3SSZA 3SEPA 3WNPA 3PK7A 4QG9A 3PANA 3S1GA 1IR1A 2FQIA 1H1YA 3H54A 3M44A 1EKOA 3OB8A 1C3FA 3N6QA 1YTEA 2PFHA 4DUWA 3QMTA 3W7GA 4NJIA 1KKRA 4D1JA 4W88A 2J8TA 2WPGA 2EEXA 4I9AA 3V5OA 1E9IA 1DIKA 7REQB 1R8LA 1VGAA 5E0FA 1CWYA 4O12A 4ZQMA 3Q4DA 1KGXA 1UOZA 4CCEA 2PDMA 2V2CA 1GOIA 3BOXA 1KV5A 1GTHA 2PDUA 5B7ZA 3NQVA 4KMQA 1KM2A 5REQB 1TKKA 1XD0A 2DVUA 1RHCA 4D6FA 1WBJA 3Q58A 1X1OA 4BQ5A 4PMDA 4KFOA 2JE8A 1QOXA 1R2RA 1ADOA 3PTQA 3W88A 4PB4A 4S3JA 4AUBA 3RM8A 5DX7A 4H9VA 2YW4A 1LRQA 2QT3A 4PA8A 3I7QA 4TVDA 3ZSTA 1SM9A 1DJIA 1YQ2A 5C2GA 1WE5A 1ZSXA 1TCMA 1SSGA 3QV6A 2PDBA 2J7HA 2WWDA 4Z2JA 3CB8A 1PYMA 4GRSA 3DUGA 3GDBA 1BRLB 1LRNA 4X3ZA 2VQUA 5EY5A 4ADTA 1M68A 1B90A 2VYOA 4B92A 4NAFB 4PGLA 1VIWA 2YBVA 3JW7A 3N34A 1XIBA 2YZRA 4PCNA 4Q6XA 2OLSA 1T41A 3C8FA 1XXXA 2CBVA 2I5IA 1RCQA 1XDJA 2P8CA 2VDGA 1QXLA 1QPKA 1RALA 4U3CA 1YADA 1S2VA 1NQ6A 4GVIA 2P76A 3CBWA 1M6JA 2PC4A 2PDHA 5IDZA 3TN5A 2PTXA 2DSVA 3T1GA 2PEVA 4HHHA 4JIEA 4ROQA 1TPWA 3WMBA 4OBTA 3UXAA 1WDDA 1XH2A 3VABA 3RYSA 3ZFHA 3ID7A 3SRFA 1DXFA 2YCLB 1AUSL 3GD6A 3O15A 2EPNA 4AD3A 3TYAA 3IJ6A 1H63A 3W37A 1G69A 1XIIA 4DYJA 1UWSA 1XG4A 4FSAA 5K7JA 4NXKA 2QDDA 1ITXA 1EEPA 4ZZ9A 2ZRVA 1A5BA 4MNJA 4C1NA 2EAWA 1IE7C 2V3DA 4UTHA 3N4AA 3S9ZA 1HUVA 3KWSA 1CDGA 1O5QA 1UD3A 3OVPA 3VIKA 1FOBA 3WCZA 5A69A 2VURA 1UR1A 2BVTA 5CEWA 1KFJA 5HJXA 1B3OA 2IPJA 2P0IA 1JZ4A 3UETA 1V6UA 4LWWA 4Q8MA 3V3WA 3N2XA 1OFAA 2D22A 3A24A 4E5TA 4B2DA 1Z9AA 3U8GA 3WD0A 4Z2GA 3IIOA 2A21A 2A7PA 2XIBA 4EVZA 2J7FA 2R1NA 5ECVA 4HJWA 4DWSC 3RMEA 2CETA 3QFWA 2V5JA 5DCBA 4H2CA 4LAKA 2CLOA 4J40A 2G4FA 1QU4A 3LM7A 2QGYA 2ZFAA 4UQDA 3AHVA 3DAQA 2VUYA 4YVXA 2Z00A 4UTMA 1I8JA 4MFDA 1YE4A 1PV8A 1LBFA 1ME7A 3MSYA 3APYA 1TJPA 1EPXA 3MANA 3P5ZA 3ZXWA 4EWJA 3MUY1 2CLEA 2CBJA 3WFZA 2PDWA 1C9WA 2B7OA 3ITLA 4I8YA 5EMJA 5DT5A 3LSCA 1NM9A 4AB4A 1PVNA 1ZAIA 5FF4A 1QDSA 4KQNA 4A6GA 4BA0A 1JYWA 4KPLA 4MJ2A 3UZXA 3LCIA 2DVTA 3OG2A 1H3GA 3BE7A 1DWGM 3IGHX 2G3NA 1U33A 3CEUA 4IQLA 3M0VA 1BG9A 3NGFA 1SMDA 1BWVA 2GQ3A 3OGSA 4ACYA 3M0KA 4BFAA 3RJXA 3RNDA 2ZICA 1FWIC 3NZPA 3LLXA 1H2JA 2PWEA 4DB7A 4DBUA 4UCFA 2PLKA 1ADSA 1R38A 5MHBA 3N2OA 4MM1A 1QK0A 3GG7A 4UXDA 2UBPC 2P88A 2V5BA 5B80A 5FL1A 2ZTJA 4DJDA 1MSSA 4IXHA 3I3DA 4JFSA 4L1WA 3GKFA 3SUTA 3NM3A 3TXVA 4MGGA 1GPWA 3ARXA 5I3FA 3BANA 2GSJA 1JGMA 1OCNA 1R9XA 3AYRA 1RBLA 2CWXA 2PWFA 2Y5SA 3PTMA 3SIMA 3GDLA 2FKPA 3MQTA 1B2YA 1PZ0A 1RA5A 2ZA1A 2WSKA 4WKAA 1Q7MA 3IGUA 1HO4A 4GVHA 2PTZA 3V0TA 1KM4A 3V5FA 3WDIA 1A49A 4N0RA 5FAJA 1JNDA 1GTEA 5DXYA 1EA9C 2VEIA 2OJPA 3HM7A 3VZZA 3UCDA 4WKHA 3OZYA 2B4GA 4NIRA 1KA9F 2CHRA 2WHJA 3IPWA 1AL8A 3N6JA 3RLUA 2ISSA 4YTQA 1NWUA 3TNOA 2J47A 3SZ8A 3KP1A 4QGCA 2OWCA 3T07A 1QO2A 1E6PA 3GG0A 1C93A 3P2VA 2EPHA 4B9ZA 3VM7A 3WH8A 4JQ4A 4ZSTA 7TAAA 5D05A 3CUXA 3LOTA 5HQLA 2WNQA 1XSKA 2Y6ZA 3KE0A 3WL1A 4X9YA 1NDVA 3MUZ1 5F4SA 2XFRA 4L1XA 4AFYA 1JJKA 1TA3A 4IIBA 3WK0A 1EZ2A 4A2SA 1CGYA 5C70A 2Y4SA 4LUSA 4AD4A 5CPNA 4GFIA 1IEQA 2R82A 1HKVA 2FHBA 2CZDA 3AHXA 3PR2A 4J27A 3M6DA 2V2HA 1AMYA 3L4VA 1GOOA 3E3HA 5E70A 4YTSA 1TV4A 3S6OA 3PUEA 3OW1A 1S38A 1UUQA 5TQLA 4GUHA 3S1XA 3EA2A 4OGZA 4DBSA 1VFHA 3KRZA 4BI5A 2INEA 4LBUA 3NVTA 5KMYA 3QZ6A 4PMXA 1WUFA 3WLQA 4K38A 2EXOA 4MUZA 3GHUA 3UD6A 3NM1A 1FP9A 1GUVA 1ZL1A 3RU8X 1FCUA 3RRAA 5IHSA 4I3GA 1RBAA 1E71M 4OQVA 4EAYA 3CL8A 4CQ8A 3KL3A 5LYRA 3B0PA 4JNMA 3N2TA 4PEEA 1DQWA 1OD0A 9XIAA 2C79A 2Z1BA 3FXGA 4AC1X 1FVPA 3L5AA 2EKCA 2EKGA 3T4CA 4CN1A 3UWYA 2J13A 4JEQA 1YNYA 3O7UA 4LNCA 4ZA0A 3BMXA 2X2YA 3R8HA 4Z2HA 2OQLA 3WLLA 1YNQA 3PS7A 1CCWB 2VENA 3CO8A 2G4JA 5FJIA 4M19A 4D8LA 3B8TA 2VFGA 4Y8FA 4YTUA 3LI0A 2GQ8A 5A8PA 5HXMA 4JKLA 3AFBA 2Q02A 3NWRA 4S3CA 3B9AA 2UZ9A 3H4WA 6TAAA 5JUVA 4H6QA 2V5DA 2OYMA 5GNYA 1FBAA 4IP7A 1GVSA 3WUBA 3F2DA 2FTPA 3V5CA 5DEZA 1PIFA 2PUZA 9RUBA 2RDTA 3N15A 2Z4GA 2WK2A 1PDZA 3FFSA 1PZ2A 1OB0A 1REQB 4TMBA 3C0JA 3QKEA 3W1TA 4WJ8A 8RUCA 3PJUA 4DWDA 3BJSA 4HIBA 3BGAA 1O66A 4V27A 3L4YA 1TTPA 3P61A 3FLUA 1IIGA 3MVTA 3TN3A 1H49A 1KFCA 3T8QA 3I7SA 4R3UA 5D32A 2NQ5A 3W72A 4RE2A 3KFTA 2I56A 3TFXA 4L7ZA 3W6YA 5I77A 2XHYA 1N55A 4Z1AA 1NSJA 1BD0A 4FF7A 2P5NA 3M46A 2QKFA 3R12A 4JHOA 3WF0A 5A2BA 1H62A 3UPMA 1POJA 5CBBA 2DJLA 2BY1A 1RCOB 1DVJA 1KXHA 1QI2A 5A6MA 2D3NA 3GXTA 3EKGA 1LBMA 3DI1A 1XLKA 2GDUA 3TQKA 4DZIA 3O6DA 4ERGA 2PS2A 4KESA 1OT2A 3EDJA 3KLKA 3VOIA 3VNYA 4ZOCA 1ZNNA 1XSIA 4ZEPA 1H7XA 1VYRA 1S2CA 4RJEA 5IBXA 4PH6A 5CAKA 5I3DA 1PX4A 3DBPA 2QJNA 5DBUA 3VK5A 2WCGA 2X1RA 3NQDA 1V6YA 4GI9A 4OUIA 4AY1A 1XLMA 4GGHA 3K30A 2EHHA 1AFSA 1BXCA 4O8RA 4JTGA 2RHGA 2XDFA 6REQA 4ZO9A 3B9DA 3PPCA 3WJZA 3BQ6A 1JI2A 3NOEA 3BTNA 3MHGA 1EOKA 5LA0A 2QIWA 3SUVA 4XAPA 4D72A 1VENA 4X61A 4DJFD 3LS9A 4F2UA 1N2VA 1FHVA 4QAWA 3U2OA 3QJAA 3BICA 2WKJA 4AMAA 4FX7A 1HO1A 3WH9A 2ISFA 2WV8A 3ANVA 5A6JA 1EO7A 2IXVA 2ZCGA 4J3SA 4I6VA 5M5DA 2J77A 4PSRA 7ODCA 3H26A 2D2JA 4PL1A 1AJZA 4QE1A 1F3TA 3O6YX 1UHVA 4NI3A 3MWCA 3NG3A 4Y96A 5CG7A 3UY8A 4REQA 2E7FA 3MZNA 1IEXA 3NL5A 2ACQA 2YA1A 4HK5A 3PVFA 4Z2LA 2W5FA 3LRMA 1JRBA 1XIGA 2QLYA 2EF9A 3MW7A 2FH6A 3WMLA 3HTWA 5KEZA 3L67A 4L80A 3E0WA 2BG5A 4HA3A 3QV9A 1YDNA 3MZ2A 1X97A 4R7WA 4HZ7A 3BAXA 4WEVX 4HBKA 4QCEA 1JPIA 3TTQA 3AWOA 5CH9A 1EC8A 4PMQA 3EOOA 3M7SA 1XLIA 1TX0A 3AYTA 2QJMA 1G9HA 4C1LA 2B0MA 4GCXA 1SW0A 1UWTA 3WQFA 1I9CB 2PDYA 4NZ3A 4EAMA 4ORMA 3W6MA 3H8AA 4DF1A 2YGYA 4IZGA 3EEZA 4XAFA 4X2PA 3OQ8A 3HQPA 4Z1CA 4US6A 4GH3A 1E72M 3K4WA 2WYSA 3N13A 1FXQA 3L2LA 5BXPA 2XUCA 3VD3A 2H6RA 2FPYA 2QULA 3ELFA 3VDHA 4Z2KA 4B5UA 4RXFA 3LGGA 3N2BA 5HATA 4I9TA 2G3JA 1JL8A 1CZ1A 4ZE5A 1KBIA 5LHEA 1PL9A 1H1NA 5D2YA 4XO7A 3XISA 3CHCA 4XO6A 3UP8A 1G0CA 4Q4OA 3LDVA 1JFHA 4MYXA 3NAVA 4XKYA 3W27A 5AVNA 5IM51 2BOGX 1YW1A 3B8VA 2NX9A 4JNZA 3B9OA 4IUGA 1GQIA 4O28A 4H8UA 3QOKA 1X1ZA 4XIAA 4GA8A 4H6KA 4CN6A 2EPOA 4MZ1A 3VNDA 4MY1A 2Q8ZA 4MWAB 3MBFA 2QCEA 4CNNA 1WKDA 3NQ8A 1CNVA 3L68A 2OEKA 1OYBA 1G01A 3HN3A 2QCCA 1B57A 4H9YA 2PA6A 3ONCA 5DRCA 5A8NA 3CT2A 1UYQA 1GVOA 3D47A 3W2KA 4CQDA 1LT7A 1R2SA 3NQ6A 4LY8A 4Q8QA 2NV9A 1T8QA 1UKQA 5HWNA 4HCDA 2PDXA 4K7VA 5KZMA 3O8AA 3EPOA 3N18A 1BKSA 3AMLA 2YDAA 4C6DA 1AH4A 3K1GA 1OCJA 3BSHA 5EBAA 4GXWA 1IR2A 3P81A 2UY2A 2C0AA 1OEPA 4PBFA 4GO8A 2DU2A 4GVFA 4LALA 3PZNA 2A2IA 1A53A 1IEIA 1P5BA 3P80A 1DKWA 2W66A 3C2YA 3CUGA 1IZCA 5ABEA 1HL9A 2VJXA 3Q45A 3PP7A 4R7OA 5U4NA 4NVTA 4KW2A 3LTSA 3GXDA 4Z42C 4PUMA 2V9DA 3N1AA 5AYXA 1V6VA 4D6EA 1LLZA 3D5HA 1AH3A 4E3TA 2H9AB 5BOFA 5HPOA 4IQJA 2BXVA 3CAVA 1H1ZA 1W3TA 1Q6DA 5CLTA 3KTSA 3OGVA 5G4WA 3QW4B 4ILSA 1V6TA 3N6HA 1QHOA 3RMJA 4OOUA 3KRBA 2BLEA 3AYSA 2VRJA 3FYPA 4NJJA 4JX6A 4HB7A 1UBPC 1YPXA 1H61A 1UZHA 3K4AA 4JPGA 1ME8A 1FXPA 1P48A 2YFNA 1AODA 1ZPTA 3W82A 3LZ3A 3H2FA 3QPEA 3EWXA 1S5VA 4F9DA 1MRQA 4GKTA 3VIHA 4PFMA 1AD1A 3N2CA 3ZVHA 3BLDA 1B54A 4GO9A 1BRLA 4N42A 4O50A 4MWAD 2REQB 2X42A 2DGAA 1OM0A 4AZIA 4KF1A 3B8IA 4HNVA 1WB0A 1K03A 4XSMA 2X0SA 1UUMA 4XTIA 1TPB1 1EGZA 3NSMA 1E4IA 2WXDM 4KKXA 3CIVA 1E9YB 1IWBA 2HRWA 4FLOA 3MV11 4AVOA 5KZDA 4LYQA 3AMKA 3E2SA 3Q94A 4EXAA 4UCGA 3VOHA 1DTNA 3GG8A 3GUGA 3H4XA 3ARVA 2J74A 3VTRA 2NLYA 2FVLA 2VOMA 1DWFM 4NRRA 4CU6A 2TSYA 4NJKA 3FDGA 4IFOA 2QJIA 2GGGA 3ZJ6A 4Q4PA 2YLLA 4RK8A 3GE7A 1TWDA 4N7QA 5BXTA 2DZVA 2QDHA 2XJ7A 3WD3A 3REQB 2X8RA 3NDYA 1RLCL 5MKGB 2J75A 2NX3A 4BHYA 3SW6A 2XPKA 4DN1A 3IAPA 3M41A 4UFMA 2NUWA 1OG0A 3FGCA 4N4PA 4KWSA 3B40A 3QYQA 4WDWA 2A1YA 1R85A 1F8MA 3FJNA 1GEHA 4FNSA 1TUXA 3SDOA 3SRDA 4LVDA 2PCQA 4S2BA 2XH2A 3L66A 3GXFA 1GOKA 1KFLA 3TIMA 1AH0A 2XVLA 1XYLA 2VFIA 4IIGA 1OFEA 1LDCA 3UGRA 4GMEA 2XN2A 1GOWA 3NSXA 4NJGA 3LCFA 2E5BA 2QNEA 3AMDA 3GTIA 1FFRA 2ZZ2A 2GWGA 2QW5A 1E6RA 3GC5A 1FH9A 2VFEA 3FNDA 2EPKX 3O2LA 2BGQA 3ZM8A 3QVQA 1UQZA 1NJJA 1UZ4A 1IT0A 3A21A 3LCWA 3EZ4A 3HZ3A 1YHTA 1ISXA 3NR0A 4IICA 3KHJA 1JDAA 4WQ6A 1XICA 3G1FA 4O1EA 4JQ3A 3EWBX 1F7BA 5BMWA 3H2CA 4Q7IA 4WX2A 4BF7A 3FXYA 1IWPA 3E0LA 3H7UA 4MJ4A 1ZJBA 3ATYA 1IGSA 2C16A 2Z6IA 2WO5A 4DLFA 5LNSA 3S47A 1E0VA 1OIMA 4J3VA 1SGJA 3TSMA 4GY1A 2CLKA 1ZTVA 1TO3A 3GH4A 1AQHA 2OKTA 3H2EA 3LENA 3CIWA 1HKIA 3VMOA 4GKLA 4BJHA 3GAYA 3LRKA 4M5PA 1LF1A 4RDWA 4WJEA 1G67A 4K1WA 2YJQA 3S2NA 1DWJM 2DIKA 1F76A 1LL4A 4WSKA 3WK2A 1JIBA 3WJXA 1XYBA 3HFTA 5E5CA 3UXKA 1CGUA 2XM1A 2YL6A 4IP5A 3CEPA 5SWUA 1JF6A 4PSPA 3A4JA 3O0FA 3NL2A 1K7FA 3AHZA 3HQ1A 1KFEA 4HN4A 1EC7A 2VMFA 3BZJA 4ZQNA 4DY1A 3CUIA 2MNRA 2G3IA 1F5ZA 4PB5A 4W8AA 4U5IA 3QMRA 3NXFA 5FF0A 3GFYA 4AIUA 4RXGA 4DO7A 2Z28A 3G6LA 1TREA 3CTLA 3ZWSA 4GVGA 3IJDA 4QE5A 3Q2DA 3NQBA 5EKYA 2CHNA 3WLPA 3G1RA 3T0AA 4E2BA 2CZVA 1TV3A 5D37A 4E2DA 1TJ2A 1BTMA 4HHLA 2FHCA 3CLWA 5D2XA 3AROA 2JK2A 3CYVA 3GYCA 4JTKA 3RM4A 1W1PA 1HIZA 1LTDA 4O0QA 1V4YA 4KT2A 2WKGA 1LQ2A 1XUUA 3RPMA 4JIRA 2W0UA 4XSLA 3G0XA 2D0HA 3KVLA 2XGBA 1K6AA 2NV2A 1M9HA 2BHZA 4BKNA 1XLJA 3KZSA 4HHPA 1RA0A 2W67A 1W37A 1RD5A 1Q8AA 1EX5A 1JCXA 3WJYA 5C9WA 5CZSA 3WLIA 4Y6GA 4DF0A 3LBMA 2I5QA 3H21A 3E1F1 2ZRYA 5AHIA 4RPPA 3T2QA 1TPH1 4RPQA 5AKQA 4FZIA 1EZWA 1WA3A 3SAZA 5T9BG 2G97A 1KD0A 3NL3A 2NUXA 3FSTA 5LNUA 4XVEA 1VIZA 1OY0A 3G8EA 8TIMA 3P67A 4L4PA 4PE8A 3KUMA 3UBPC 1O7AA 3KX6A 2ZC8A 3MMTA 1UKSA 1W54A 1Y65A 3F4VA 2E28A 1LWJA 5GJNA 4IH3A 4TX8A 5CGQA 4OOZA 3FEMA 3PUOA 5KETA 3NQ2A 1RK5A 3R0DA 1WOAA 3GBDA 4C6PA 4I8DA 2TPSA 1L8NA 5IBXC 2BVDA 3VDAA 1D3HA 4DXVA 4CVUA 1TG7A 4OKDA 4EXQA 2ABAA 4JYFA 2WKLA 3N12A 1MXGA 5GJMA 1GOXA 1KBLA 1U83A 3BWWA 1JD9A 2HBVA 3K1DA 4CCZA 2D2HA 4NJHA 4RW3A 3L0GA 4LOCA 4CNSA 3QR1A 1Q66A 2KZHA 2QUTA 4FR6A 3SUWA 4MMWA 1U2YA 4Y8EA 4H9MA 3ORWA 4A22A 2ACSA 3VOFA 2X1IA 4ZQOA 4H6RA 1DWIM 4XISA 1KKOA 3UA4A 4G7EB 2ZTKA 3G6MA 1XG3A 3CQJA 2RUSA 4WY0B 3SN4A 2E9BA 3ZQ9A 3GU1A 4GXPA 4JKKA 2YL9A 2TRSA 3P74A 2WANA 3GO2A 3IACA 4H2HA 3UZJA 5HJYA 4JIPA 4PMNA 4GBDA 3TTSA 1AW5A 4O1DA 3HURA 3CM4A 1UB3A 3WLSA 3GH5A 3INPA 3UZ5A 3ATZA 4CQBA 5I3HA 4LT9A 4DJFA 1B1YA 5I5RA 2OGJA 3TOYA 4QAIA 3DU0A 2ZADA 2OPJA 5RUBA 5FCZA 1VH7A 5M2FX 3KEHA 1EWDA 4U2YA 4MWAE 5JH2A 4C6OA 5BXSA 3NL6A 3LHWA 2Q8XA 3NQCA 3RN6A 3OHMB 1BFNA 1FHUA 1EXPA 4HJFA 4R88A 1I45A 1KXTA 4ZO6A 1ICSA 4H8NA 4M29A 1EDQA 3VMPA 2V68A 4IPIA 1E4MM 3HMJG 5FF3A 3BOLA 1W1YA 1MEIA 2RGMA 4KETA 3IJLA 3ME3A 2E25A 3TZNA 2QJJA 3W7RA 2V5CA 1CGWA 1ECEA 2G3MA 3NURA 1NP2A 3J7HA 1J0KA 3W7PA 2INZA 4TTGA 4UTWA 4HZMA 4UFIA 1T0OA 3G8RA 2YXGA 4M82A 1X8CA 1OVDA 5TD4A 2ZRZA 3UNDA 2J24A 2DT3A 5LIYX 4M8UA 4CU8A 3W1MA 4Z17A 4FAMA 3UU0A 5FF2A 4Q3MA 4QLJA 3USBA 4AAJA 4MB4A 2Z29A 4PTDA 4RE0A 3BLOA 1MQQA 3W75A 3SQSA 1HXJA 3GDMA 4XD6A 4QM1A 4UTKA 4NILA 2FDMA 1E1CA 4GISA 3B8UA 4P8XA 1ZAHA 4U4MA 2PE4A 4MVAA 3NPWA 4A8IA 3C2RA 3MPGA 5EFDA 1A80A 1WYIA 1GHRA 2GLKA 4UQEA 1C29A 3OBAA 2WJEA 2E77A 2YYTA 4EK7A 4JYEA 1BF6A 2E6DA 4ALDA 4HNNA 4LRSA 1E43A 3FX4A 1YE6A 2DIEA 1B4EA 1GT8A 1W31A 1W1VA 4W4QA 3H2OA 3W6LA 5FACA 2WLYA 1O4UA 3R4IA 2QCDA 3MP5A 1W9PA 1OX4A 3WQDA 4EPKA 5LIXX 2CYGA 3HBLA 3W1QA 4Z1BA 3ARUA 2Z1KA 2I1OA 1V02E 1CGVA 1T7LA 1H5YA 3TTYA 4D6DA 5KSWA 2HMCA 1SR0A 2Z1XA 2E4TA 3KWXA 3MT1A 1Q3NA 1AL7A 5KZ6A 2FGZA 1HT6A 4QX4A 1XIFA 2R14A 2I14A 1DXIA 1ZU8A 3LQLA 4UUIA 4JBRA 5JH1A 2A85A 3KAOA 1TWIA 4HU4A 3CV7A 3DGBA 3ZT5A 3UY7A 2PWVA 3QBUA 1HP5A 5FJUA 2I9UA 4HSOA 1JXJA 4IIDA 3MMDA 2IPWA 4YTTA 5DBTA 1W9BM 3TC7A 4DRSA 3R89A 3QC3A 2Z2BA 3TDFA 2Y8UA 2F6XA 2WNWA 3V16A 4OBSA 4FLRA 3RG6A 4L6DA 4LXFA 4CEUC 1JZ8A 4LS2A 3B03A 2SFPA 5I24A 4NF7A 3WD4A 3PULA 5EFFA 5F4XA 1PBGA 4MHBA 1P0NA 4RLIA 3OVRA 5BMXA 3U3HA 4JS3A 5EB8A 1GORA 4BQ4A 3CUHA 3UXLA 1FWDC 3OTRA 4K39A 3ABOA 3SM0A 5XINA 4W93A 2XIJA 2VFDA 2FVMA 3WQCA 2GPTA 2V2DA 1UR8A 4QJ3B 4IJRA 3VXGA 3WBEA 2V0TA 2XGZA 1GJWA 2MUCA 5I23A 4K68A 3B4YA 4K7YA 2GFTA 4JY8A 1JR1A 1QATA 4TXEA 5T26A 2PGFA 2XVPA 4GIAA 2CNCA 1H0IA 1L8PA 5T8GA 3KBNA 3LBOA 3PNZA 4IMEA 4XZWA 3WSUA 4HCHA 2VCBA 4JTRA 3CK5A 1J2WA 1OC5A 3ABZA 5LGXA 3LTPA 4R85A 1VRDA 3C56A 1F6KA 5HNNA 4CU7A 4GG9A 5C55A 1GKPA 2PC8A 3SN0A 3A5VA 3H12A 3Q37A 1V6XA 3N3MA 4WDTA 3HG2A 3S2LA 2VFFA 1DJHA 2GUYA 2HQAA 1PEZA 4FX8A 2FB2A 2QYGA 1B3YA 3G1XA 1Q63A 3P84A 3MTWA 4V33A 4EX4A 2OOFA 3ITCA 3KDNA 5F2IA 4B5WA 1ECQA 5K4ZA 4TVUA 1EHNA 1NWRA 1KV8A 4DXXA 1SO3A 2FFIA 3BARA 2FGBA 3NQFA 2WZHA 3II1A 2R1LA 1E4LA 1GOMA 3PPHA 3G1AA 1A4LA 3LYEA 1JZ5A 4GQRA 1K8YA 1JQVA 3QGVA 4GX9A 3W7JA 1BVWA 3UEQA 1J96A 3CLMA 2NQLA 3A64A 4GNJA 3URAA 3P0XA 3TEVA 2VEPA 4UR8A 4HMNA 5DANA 3P62A 2NQ9A 4CKQA 4YVVA 5D9PA 4JOMA 5HMSA 2J8FA 2VR5A 1PKLA 3VNKA 2PP1A 4Y9MA 2ZA2A 1X38A 2YW3A 4GZ7A 4M7SA 4E8CA 3IIPA 3GC4A 3HV9A 3EGJA 1Q7QA 3HFYA 2PGWA 1MW3A 4DYEA 2B7QA 1HNYA 1ZZMA 1ZY9A 4DNHA 1W1A1 1QI4A 3OLGA 2OKOA 3UR5A 1XCWA 3DCPA 1LT8A 3MY9A 1F6PA 4CNPA 1L2UA 3RX3A 1SZNA 1NOUA 4IISA 2Q6ZA 3TU9A 3SQLA 3TYBA 4F0KA 3QY7A 4GQ0A 4YL2A 4Z2IA 5CSRA 1LROA 3P82A 4AD0A 1CXIA 1MDLA 3IWPA 1I4NA 1UKOA 1NU5A 3LK6A 2Q01A 4QEHA 3WDPP 4DBEA 1D7FA 1ZENA 5ABGA 4Z1YA 5EU9A 2JKPA 1ONEA 1LJYA 4QG8A 3ZLGA 2DVXA 2C14A 2HXUA 3WNOA 3KOFA 4PTMA 4O4VA 1XYZA 1R6WA 2QV4A 1XINA 3AJXA 4HVXA 2REQA 3TA9A 3NZQA 9XIMA 2B7PA 3LPPA 5JQ9A 1ICPA 3LV6A 3OLIA 3PZIA 4JCLA 3EDEA 3M7WA 4AWTA 1VEPA 3LERA 5AC4A 3ZIZA 2R91A 4LVAA 4L65A 3KXQA 1CEOA 3TE9A 2VM8A 3THQA 3CL6A 4TX6A 4MG4A 3CJPA 4LYPA 4YTRA 4YN5A 3IRSA 3UYCA 1JZ6A 3I7RA 1XFBA 3O3RA 3TJ4A 2Q3RA 5JIPA 1GZGA 4ZB0A 2O92A 4JQ1A 2G0WA 1EBGA 2GGHA 1LWIA 4W86A 4G7FA 3IIVA 4JCMA 1F9CA 4RZ4A 3AUOA 3VMNA 2NV1A 1DEDA 3VD9A 2PTWA 1X7IA 2X40A 2FHFA 3H24A 1S5TA 1SMAA 4JY9A 1FDYA 3VKBA 4UMBA 1CIUA 2XH7A 5LIKX 3REQA 2WWCA 3AIBA 4C1NB 2OOGA 4IOTA 1W3LA 2CCRA 3CS2A 1R3WA 3T8LA 5HPCA 4JDBA 4FF5A 5HOSA 4GUJA 3RR4A 2ZVRA 4YYFA 4A35A 3H55A 2FLIA 3KTCA 3O63A 1H7NA 3D46A 4F0MA 2VQTA 3R94A 4C60A 3KOWA 2E5DA 5H2ZA 4TO8A 1SZEA 2FH8A 2BP1A 3MSDA 3WQPA 4I6KA 2YB4A 1B31A 4ZO7A 2XH4A 4FIRA 1K7EA 3TNBA 4NYYA 4JTUA 4A8RA 1YIXA 3DFTA 3MUAA 4LPCA 1BYDA 2PLJA 6ALDA 3AMGA 2ZRXA 2HPMA 1J6OA 4LQ1A 2YBTA 3WMCA 1S1PA 1O68A 1D3GA 1JAEA 2O55A 3TCSA 2CBUA 2BY0A 1EXBA 2Z7GA 4GHRA 1AQ0A 4A4AA 5D03A 1MVYA 4HYVA 2PF0A 3T42A 5C6MA 1F61A 5DMYA 3SCNA 4NU7A 3EA3A 2D0GA 3KDOA 3OBEA 1VPQA 2O0TA 4L6HA 1DTUA 1EIBA 1TPEA 2OVLA 3IGXA 3JU2A 2IQ0A 4AIEA 1Z48A 3WFAA 4FNRA 1VJZA 4O17A 3DHPA 5FOOA 3NQ7A 4Q22A 3TROA 4POCA 1XKYA 1EJ7L 3R58A 1XHGA 1AA1B 1IEVA 1W5OA 4PB3A 1SFTA 2OWXA 3H7RA 2PDFA 2Y24A 5AZ1A 4ZOAA 2P10A 4HMDA 2EPLX 3AS0A 3GS6A 1OGSA 2J7GA 4MIMA 4M24A 3I65A 2NWRA 1OINA 3QHOA 4B15A 2I7GA 1RUSA 4MSSA 2IXUA 4CQCA 5A6BA 1FWSA 5HNUA 2YR1A 1LG2A 2Z27A 1JYVA 2V30A 2HROA 3UWWA 3W3OA 1UWRA 2OG9A 2IKHA 3RFAA 3P6LA 1VFSA 4JTFA 3HG5A 1QRQA 3MV01 4O1AA 1G7UA 4F40A 1J5SA 1IGWA 3LRLA 1W1TA 2WNZA 3NZ1A 3LG3A 2W6RA 1CGTA 5F2LA 5FSDC 2F84A 1QFEA 3LI1A 1I2RA 3HGRA 2DW6A 3W1LA 4WJXA 1XQKA 3GVQA 2IMRA 4KCVA 1RD6A 5EPDA 3EXSA 1ITCA 1QTWA 4C5YA 4XV0A 3QY8A 1I2PA 4P8WA 1FHDA 4FPSA 3N9RA 1AG1O 1EGMA 2WSYA 2ACUA 1KCZA 4G8TA 4P7RA 4B9YA 3PJWA 3SCVA 4ZL1A 1IT7A 4ECLA 4HNOA 2W79A 4ATLA 3EPMA 3BAWA 3DC0A 1XIMA 1R47A 4DJFC 3ITOA 1Q6OA 3LD5A 3VNZA 3QYSA 3WO8A 1B3XA 2J7BA 5DCEA 2A3CA 3UZZA 4E2OA 3KHDA 3DG3A 3SUUA 4B4HA 1G6CA 5CQ1A 1L6GA 4Q4RA 4Q8NA 1PS9A 2Z0IA 2D24A 2CBIA 1R86A 4LF1A 5CSYA 3KRUA 3NZGA 5J8LA 3OP2A 1JI1A 1HP4A 2X41A 1LCOA 2OWWA 1HG3A 4ZTYA 1UIOA 1HVQA 4GGBA 1LZOA 1BTCA 3MVIA 1ISYA 4BS0A 1R3VA 4ICCX 3BGGA 4GZJA 3GAKA 5EMMA 3M0JA 4A05A 4PODA 1V3HA 1XS2A 3NQMA 1B5TA 3P7YA 2A79A 3QH2A 2VX6A 3FCPA 4GQQA 1K9FA 2G37A 3AIRA 1EWEA 2ALDA 3B9EA 1P6BA 4LBSA 4XZNX 1K8XA 4JAWA 4DJDD 1D2KA 1SO4A 3BCJA 1W56A 3LLFA 1KBJA 5KINA 2Z2UA 3NO3A 4GI8A 3S6DA 2OZ3A 1G1YA 5CJNA 3WY1A 1LOLA 4FLSA 3GDRA 3MUXA 4KRUA 2X05A 3FVDA 4KGJA 1W32A 5GVJA 4HSNA 1JYXA 1VFFA 1J12A 3AYVA 1E56A 3EOSA 1PX3A 2TYSA 5CC5A 1P4CA 4FK9A 3BGJA 1P7TB 1R3TA 4H8HA 1YBQA 4NZJA 3TZFA 3BZGA 2VZUA 1NAL1 3DN5A 3FA5A 2FZ8A 1ELSA 1WZKA 4D9PA 4C65A 1MZRA 1CB7B 3MMUA 4AZ7A 2A6LA 2HTMA 4UTJA 3WQ5A 5HUOA 4KEVA 3CXOA 1A5LC 3L4UA 3W25A 2DZWA 1JEZA 4LC8A 5FEZA 2X0HA 4U2ZA 4WXYA 2VX4A 3NA8A 1U5JA 3W7HA 1V0LA 3AIWA 5CBJA 4IX0A 3W70A 4CEXC 4HOZA 1EYEA 4LBRA 5AN7A 4H83A 1RJQA 1NARA 5LNWA 4AZ5A 3G5EA 3E38A 4IQEA 2Z24A 1E4NA 3FYOA 1XQLA 4G1KA 4MDPA 4KFNA 3QSTA 4M80A 4E6MA 2QCNA 1JDCA 1HL8A 1SVDA 2HVMA 1MUMA 4L9YA 1SW3A 3E0IA 1X7FA 4LUYA 4X63A 4H00A 3SCTA 3L2MA 4H7ZA 3G22A 3EDFA 1F8IA 3ICJA 2UY3A 2C1HA 2H90A 3S8HA 3E02A 1O6IA 3UW6A 1EDGA 5U7SA 5CPQA 1UG6A 2FZ9A 4JXCA 3LNPA 1BSIA 2AL2B 2CHOA 1R9ZA 4GC4A 3EX1A 1E15A 3WF1A 3TOPA 4KEZA 4W85A 4Q4QA 4U10A 3QLLA 2JGQA 3WUGA 2E1DA 4I7VA 1Q6QA 1Y8BA 1FHLA 2WVVB 3MA8A 2FZBA 3LY0A 4CD7A 4S23A 2DT2A 4A29A 2NZLA 3UCCA 3HPAA 3IANA 1V6WA 2J62A 3OLEA 4UNKA 1FFQA 3IGSA 1TPUA 3A3WA 1XYMA 3LCLA 1VPYA 1YMYA 1R7OA 3ABSA 4D1IA 1H5VA 1WP6A 2PRHA 1H4PA 4EACA 3DECA 2ZUTA 1YNPA 3A5FA 3FSUA 4RDZA 4S3KA 4LC6A 3BPWA 4DO6A 3IV8A 4H6EA 1SW7A 4S38A 5A8QA 4AHPA 2OCZA 4I5XA 3B0UX 3RM9A 4LV4A 2QCFA 1O5RA 2DZSA 4LSBA 4XAYA 1OABA 3T7VA 2X16A 1H51A 3ES8A 4IMAA 1PCWA 4LVGA 3C0SA 1P1MA 6REQB 3H23A 3LB0A 3GR8A 1ISVA 4Q8WA 2O9TA 4JN7A 5DMNA 1DJYA 1I2OA 1QVBA 3BLEA 1DE5A 1Q6RA 3W2JA 1DE6A 3V36A 1R3SA 2EGZA 4MWAC 1E0UA 2VEKA 3EX2A 3OA3A 2VRKA 5HWMA 4B16A 2WSQA 2BBFA 1XM3A 3IIZA 2ZC1A 3QXBA 2QJHA 3R7MA 1Z42A 1WXZA 3ANYA 1V03A 2WVUA 4FLQA 3W2LA 3L12A 1JUBA 1MUCA 3SY5A 3M6YA 4Z08A 1DL3A 3A3HA 2IQDA 4Q8PA 1FWHC 5BOOA 1ZBCA 3L7RA 1UPPA 5T91A 4URIA 1QW8A 4JR5A 2VO5A 1B9BA 4NXSA 4MJMA 2CLIA 5G4EA 4BF9A 3SUSA 2CZ5A 2GGEA 3GUWA 4REQB 2YKKA 3GNNA 3L0NA 3I6EA 2DT1A 1YLVA 3UR7A 3SBFA 1DOSA 1FUYA 1I6NA 2G3FA 4FXRA 3WH5A 5D30A 1KR0A 3W83A 1SJBA 4WHBA 3DEQA 3TN4A 5HQEA 1OK6A 2Y70A 1S2WA 1BKHA 4P7OA 1LWHA 4Q33A 1K70A 3IVUA 4LAOA 1OCQA 4QR6A 2J9XA 2YCEA 3BG5A 5CC3A 4H4IA 4MUPA 3MKVA 3GHRA 3KCJA 4U3AA 3C4UA 1IXNA 4RX0A 4K3ZA 3URBA 2OR2A 4RDVA 1G4TA 2CIPA 2WMIB 1CXFA 5DRIA 1Y7VA 2PP3A 1Q6GA 4EP8C 1IWAA 2VWTA 2HNHA 3EA1A 3GZ3A 3SY8A 3CHVA 1GOQA 3MBDA 2RKXA 3HPSA 1JG9A 1EUAA 1TFVA 1NWSA 4AZBA 4TUFA 3PSWA 4D2JA 1FH8A 3OEXA 3IJIA 4M6VA 4H19A 3UXDA 1GQLA 3DENA 4KCUA 1S5NA 2QIIA 4C5ZA 4XKYB 4E4PA 2PMQA 2F6KA 3IEBA 3ANUA 4Q8TA 3SJ3A 3TN6A 2CLFA 2XN0A 2GVLA 5K3VA 3W7CA 4XQ6A 4HPNA 3DYOA 4NRSA 3NSNA 2YXXA 4PBEA 5AHMA 2Z7KA 3H6OA 1YEYA 1LUCB 4O1BA 4AEFA 2CWNA 3LGDA 3ZZ1A 3O07A 1LYXA 1XCXA 2I57A 3GSMA 3NO1A 1PWMA 3PG9A 2BY3A 1EF3A 1TR9A 3WENA 4JGDA 1R9YA 1JD7A 2CPUA 3GZAA 5I6SA 4AQLA 3EOLA 3WBXA 1F4HA 3W22A 3AISA 1CX9A 1V3KA 4XD4A 1K9TA 1PUDA 2LLEA 1DIDA 2JQXA 1E9ZB 2WSRA 5LNVA 3VE9A 4RKAA 3UPWA 3P3BA 3DXIA 7CGTA 1WKFA 2J8GA 4QLLA 5CPSA 1HGYA 4C1KA 5XIAA 4NZ1A 2X09A 3N9KA 4G2DA 1XI3A 3DIPA 1JPDX 1GKQA 3WH6A 3WK3A 1BHGA 3UG5A 3S2CA 1IHIA 2DZUA 1OZQA 3VD5A 4HKPA 5HJLA 1W0MA 3M0XA 4ZQPA 3GXIA 1UJPA 1FKXA 1EGVA 4S3DA 4Q4MA 3TFCA 1QHZA 5DLCA 1ZALA 4O0KA 4JTTA 4IIFA 3RXZA 4PTVA 3R11A 2PBGA 3QRHA 3JUGA 1DV7A 2J6XA 1M65A 1XCFA 3AXXA 1OC6A 3RITA 2VHLA 2GVGA 3UVAA 3GWQA 5CKSA 3P8IA 5CSUA 3AWNA 4MJZA 3SO7A 3PJXA 3DYPA 1SJDA 3KBWA 2G41A 1XGDA 4D6HA 5J04A 2AKMA 1W5MA 1SSDA 1GVQA 1J5TA 1JCMP 1OFBA 1Z69A 3LBCA 1SFLA 3M64A 3SURA 2XIQA 3IIXA 1J11A 5CZ0A 2PBOA 2QAPA 1C8XA 1XLGA 1P6CA 3SCWA 3ZVHB 4OFCA 2L5HA 3G1DA 2HZGA 4GI6A 4Q4KA 3EBVA 2WPBA 3W7KA 1OX6A 5C54A 4WZHA 1R7AA 4PMUA 1XX1A 3WQGA 3KS5A 4LB3A 1TWWA 1QWKA 1DWAM 1F73A 2PLMA 2YIHA 1TR1A 3SECA 3NDZA 4FNTA 3WEMA 4W89A 3FN9A 1PHQA 3LLDA 4LFYA 7TIMA 1XLHA 4W87A 2VC9A 2FFCA 2AGTA 2ZUSA 2HK0A 4MAZA 2WCSA 2YXOA 3DG7A 3H4GA 1DPMA 3HF3A 4MNMA 4OUEA 3BW4A 2ZE3A 3CHFA 4AZ6A 3W2NA 4GY0A 3HB9A 4C6NA 3DFNA 3OG3A 3S2MA 2YCIX 4HOWA 2ZX7A 4M1BA 4QLKA 4GOAA 4OU1A 4P7LA 3VYLA 1EQCA 3OVQA 1RQEA 4EOUA 1J93A 4GXMA 4LTSA 4JX5A 4UR7A 2NQHA 4HSHA 1TELA 1DJWA 3M5ZA 1UOKA 4ZR8A 1ZAJA 5LKYA 1K8CA 3MU7A 4MB1A 1SYTA 1GKRA 3GU9A 1OF8A 3D0CA 1VYPX 3TUUA 4BI7A 4GUFA 3ARPA 3EAUA 5F1VA 3A13A 2BXYA 1FKWA 2G50A 2W62A 3GXNA 3KL5A 2ZIDA 3FGCB 2ZWZA 4J28A 5A1AA 2RFGA 1CGXA 3GFXA 3PJTA 1XYCA 3GNDA 3B8SA 3AI0A 3I6RA 3UWEA 4EANA 5HUPA 5BYWA 3DH7A 1DYSA 5A8GA 4LEQA 1V51A 1PTDA 3TWBA 4V1YA 5M1TA 3EOEA 1DHKA 2QJGA 2Z1SA 1T40A 3WYZA 1U1HA 3RK8A 1BWLA 4GWEA 4N2YA 4RW5A 2NVAA 1ZP4A 3AS3A 2DZTA 5FSEC 4X60A 4R7JA 3PZOA 3MJMA 1IIHA 3W7IA 1A5UA 2EG8A 4PRRA 4LW7A 3RO8A 1R0MA 3C6CA 4CD8A 5DMLA 2X7WA 4DQWA 5AZ0A 4GZEA 3H2NA 5DF0A 3GTXA 1J0YA 4HNCA 4QQUA 4NI8A 2KX9A 4PCFA 3XIMA 2CW6A 2XG9A 3GY1A 3BAKA 4XAGA 4PMYA 4CNTA 3LMYA 4E8GA 3LHUA 2BZNA 2RJHA 3GVVA 1MNZA 3CYJA 1KM5A 4E38A 3EMCA 4MB3A 4J3XA 1JDEA 2VVSA 1VR6A 2CFFA 1V3JA 3RDKA 4FHAA 1SU5A 4Q32A 2NLIA 4W9TA 3DC8A 1RR2A 5FEWA 3AU6A 4KH2A 3L5LA 3WL0A 3V1PA 5D9MA 1JDDA 1OT1A 1K9EA 1EA0A 1CBGA 2ON3A 2YA0A 2NWSA 2W91A 2V69A 1XBZA 4TV5A 1J4EA 2NVCA 5E09A 2QF7A 1W1B1 3ITXA 3M07A 4HHMA 4I9MA 1VAHA 1KTNA 3P60A 3VINA 1KC7A 3TP4A 4CQAA 4S3AA 2Y8KA 3SCUA 1GW9A 3RCYA 2ZKMX 3R79A 3W28A 2R24A 3PTKA 4BF5A 3I10A 4F0RA 2JF6A 3NXLA 2W61A 4GD0A 5BWAA 5I78A 1FCQA 3RPTA 1ZBVA 3PZQA 1RVGA 2NQJA 1EP3A 4JTSA 3HU7A 3T05A 2NT1A 1M53A 4GFSA 2ANUA 2OQYA 3FHAA 3E0VA 3VNJA 1KCXA 2ZOXA 3VNLA 1SZRA 4W8BA 3AOFA 1AVAA 2VGFA 1X6NA 3VC5A 1OQFA 3H70A 3IUHA 1E3XA 2WM1A 1LG1A 5HINA 3BLIA 2E6FA 5HNTA 1M7XA 2XTKA 3CMFA 1UP3A 4LANA 1AJ0A 5ECUA 4UOQA 1SFJA 2VZTA 3GKAA 2YSWA 4GJ1A 1XKJA 4J5NA 4EE9A 4ZOEA 1TQXA 2Z1VA 1RY8A 1GEQA 2CLLA 1FWWA 4UOJA 5F1UA 5G1TA 1D3CA 4O14A 3G1SA 2JALA 4NZ4A 4FXJA 1OCBA 2WZTA 1VS1A 2VX7A 1G94A 4S39A 3APTA 4H9UA 5A8OA 1YDVA 1R30A 4AVNA 2BVYA 3EDKA 4DXKA 2BASA 4LCRA 3PUDA 3B0YA 1UD4A 2W4XA 4J7RA 3V18A 1OYCA 1YDOA 3W1AA 1AD4A 3TSBA 3PPFA 3ITTA 4D6JA 4KBXA 5BU9A 4Y2WA 3KOZA 1V3IA 1WZLA 1PYFA 1RP8A 3ZR6A 5A8MA 5C0QA 4HTYA 1JGIA 1A5AA 2R1PA 2NSXA 2VC6A 3OO2A 4O10A 1VCGA 4PCSA 4WSHA 1H7OA 3WX7A 3FVMA 2BS9A 1Z89A 1FP8A 4B5TA 1A0EA 4XZ9A 5E6ZA 3WQWA 3NGJA 1UUOA 4HMCA 3FA3A 4TTUA 2YB1A 4QSHA 4Q7BA 2O56A 1C91A 5TF0A 4BY3A 2OTDA 1US0A 2PSNA 2ZDRA 2ZRWA 1Q6LA 5EMKA 2GZXA 3QV8A 4AIBA 3UG8A 3WBAA 5A6KA 1P7TA 2CLMA 3QN3A 1A5NC 1P6WA 2PTYA 4MPQA 1ZCOA 1TX2A 1RY0A 4RDYA 4NHVA 3RLHA 5CPTA 4CLMA 1H7PA 2XZ7A 3POCA 4RZBA 5CC6A 3SCQA 3ZLHA 3P93A 4UQ9A 3PSVA 3WLJA 4D6IA 2W3ZA 1EQPA 1O60A 4CGTA 3FAWA 1G4PA 3KP0A 5I00A 3ITVA 3UA3A 4INFA 2R9RA 5D2VA 4HNUA 4K1GA 4QDMA 1EEXA 3N25A 2Y7EA 3GHTA 2DPEA 4DUOA 1OHLA 2NXIA 4B91A 2HPIA 5DO8A 1TRIA 3URQA 1V5XA 4DPPA 2Q3OA 2PTDA 1Q4WA 2ISWA 3VGEA 1QOQA 3A4XA 2O4QA 1JVNA 1CYGA 1R46A 4DWSA 4GNVA 4H8VA 2BGNE 3NPUA 4JZ5A 1J2BA 1EHAA 1RXOB 3GR4A 2XZ9A 1HX0A 5L6UA 1GPFA 3VCRA 4GINA 5LXXA 1F4AA 3ES7A 3UJEA 2I9EA 1W2VA 1KBKA 4C91A 1RBOB 2VCCA 1TMHA 1F6YA 1S3HA 3OZPA 2AL2A 3MMWA 2B31A 2PGEA 4IPJA 5E0KA 3SGGA 1MQRA 1VLIA 3F5JA 4GUGA 3IK2A 2F61A 3OU8A 3WQVA 3WEOA 4H01A 2OGYA 4K2SA 5E9AA 3OBKA 2WVVA 1Q13A 1VEOA 2ONEA 1H11A 2EJAA 4B5VA 1R3YA 2VD9A 5I06A 5H1WA 4PEKA 4KFPA 1XRFA 3W26A 3LTYA 4MKVA 3AHTA 4HD5A 3W7MA 2XYLA 1XSJA 1Q7ZA 1V08A 4JTHA 3CC1A 2INFA 4MZ8A 5D8WA 4ICNA 4KRZA 3U48A 3TCEA 1DP0A 1F2JA 1EUNA 3W9ZA 2ZZ3A 5A5WA 4XG1A 1E1CB 4XVDA 5IFPA 2AQVA 3QGKC 5I79A 3N3TA 2ZUVA 2WLZA 4EPDC 3MDWA 4KCTA 1UD8A 1P1XA 5BOEA 1A4MA 1GYMA 4M6QA 4NYUA 2JEQA 1XLDA 2OMAA 4RV8A 3C0LA 4IG2A 3VIMA 4A8LA 2VVNA 1ITUA 4W8LA 2OT0A 4UFLA 3EWUA 2YPIA 3W7LA 2BDQA 3IJQA 1K02A 4O11A 4B90A 1I0BA 2QCDB 1C8QA 1OF6A 4QS5A 1NFPA 1UC5A 1OX4B 4LUIA 3BCDA 1DWHM 1SO6A 1PB0A 4QNWA 3UJSA 4AWSA 1TV8A 2GVJA 3VGHA 3TW7A 1A3XA 3F2CA 4IUOA 4MOZA 1UH3A 2OXNA 5FAGA 4QSFA 1ZP3A 1RK6A 4J1OA 5JMUA 3R13A 4YWIA 1W3JA 4DLMA 2OELA 3HQOA 3MP4A 4WOQA 3WBYA 3A23A 1AQFA 3AS1A 2Y62A 3WFLA 1KCLA 4JDYA 3B8WA 5LHFA 4WIWA 2PWDA 3U2EA 1FDJA 2PF8A 2H8XA 2ZWYA 3SFKA 3UT0A 4GYKA 3DX5A 4IFKB 4FOUA 3ECQA 4E3VA 4UMAA 3E2VA 1V7AA 3BV7A 4ES4A 3SCRA 5ABFB 1HN1A 2VELA 1I60A 4I5UA 1XLCA 5FL0A 4IPPA 3MKKA 4ZQCA 4MADA 5AB3A 1KB3A 3ZJ7A 4W5ZA 4A3UA 2FMOA 3GQYA 4DM1A 2WMIA 1FCBA 4KWUA 5A95A 1P43A 4UZUA 4K8GA 1TTJA 1MRAA 4UWMA 3ZR5A 1TV5A 4QCFA 1UC4A 1NH6A 2GQAA 4R9XA 4N9DA 1M3UA 4IGMA 4DPQA 4LEFA 3F2BA 3G1VA 1TPC1 3DG6A 4B3LA 2Y5EA 2OT1A 3W2MA 3W01A 2DUZA 1QNOA 4JN6A 5IFTA 2PLCA 4JFWA 1CI1A 4I90A 2V81A 4LCQA 3R25A 3Q65A 4HP5A 1LQ0A 1XGEA 4AZHA 3FAXA 1E0XA 1TVPA 5CCZA 1TZ7A 3KBMA 2UY4A 1QWGA 2Y7GA 2YCKX 4Z1DA 1L6SA 1LUCA 4P8UA 4XIMA 1TSIA 3TTEA 2YDRA 3VIPA 3PZGA 4ZFMA 2PRMA 4PN2A 4FS9A 1AW2A 1QASA 2GUBA 4ZFCA 3A47A 3ERPA 1TTQA 2WCAA 4YLWA 4M3PA 3D6NA 5AC6A 5M03A 4KERA 1IEWA 3KS6A 3VGDA 3IUIA 2P50A 3LUTA 1RLDA 2V5LA 4OIFA 1XDLA 3O16A 2QS8A 3UVIA 1QMLA 3AIVA 3BSMA 3FK4A 1HJSA 4JIQA 1GVFA 3CMGA 3W71A 2PD5A 3IK4A 1FX6A 3LPFA 4MFEA 5AY7A 4QJ1A 4UTTA 3WQ8A 1WPCA 2PWGA 3F7JA 1IYXA 1QNVA 3L5MA 4WDUA 1KLYA 1UKPA 3AXKA 3W87A 4OE7A 3FA4A 3GU2A 2RDXA 1ZJIA 2BOEX 3W86A 3ZJKA 5GJPA 2RH9A 4L4OA 2NSOA 1JCLA 3ZR4A 3UJRA 4NKCA 5M3WA 2O7SA 4O52A 4HK7A 5D33A 1K8ZA 1WDWA 3AO0A 3C0QA 1TZZA 1IZJA 1YDYA 4KWOA 1LRTA 3PFMA 1EL3A 1VCFA 2HK1A 5BW6A 3JRKA 2XVKA 2JIWA 3O6CA 1Q4NX 4O19A 3BG3A 4K37A 4K8HA 2DSWA 3GNXA 5G1YA 3RGTA 1XBXA 4C7DA 4NSBA 2FIQA 4XZLX 1QPNA 2I17A 2E9LA 2E6YA 3DFQA 5ABTA 3HA1A 4JHMA 4S3BA 3E6EA 3FIGA 4US5D 5HBFA 1B0IA 3MSRA 3QC0A 4HTBA 1GJPA 3CV1A 4FB7A 4C6FA 4X0VA 3LNMA 3UG3A 1JZ2A 2H3BA 2VGBA 5CPLA 5JBDA 2F2HA 2J66A 3IARA 3M16A 3WF4A 4DM2A 3KVJA 1LORA 3E2QA 3DYMA 3GIQA 3VIOA 4UFJA 3CWNA 8A3HA 3VD4A 1XD1A 2XIIA 1QPQA 1X96A 2EG7A 2VNCA 3T81A 3B9NA 2X1UA 4WGXA 1EJUC 3SB0A 1KNWA 3CQ0A 5BCAA 3AHYA 1LOQA 4IPNB 1POKA 4HGXA 1BGAA 4XX6A 4HU8A 4EPEC 5EMYA 4GIRA 1ZBWA 2WMGA 3ONBA 3K13A 4UNIA 1IF2A 2Y0FA 2OU4A 1C8VA 4R33A 1M7PA 5BRPA 2WJZA 3WF3A 3GVGA 4NG3A 4DJDC 3MCNA 3S2JA 1Z32X 5CLWA 1Z3NA 4FA3A 4AY8A 4YWSA 2YFOA 1HJQA 1EX1A 4O13A 3T0CA 1WDQA 3S42A 1VBGA 1PTAA 4Y90A 3NJ3A 4L9XA 3VKAA 4ZENA 2GVEA 4NX0A 2GJXB 5I09A 1FWEC 1KWKA 2VOTA 1HKJA 3S3GA 1TB3A 1QW9A 3BJFA 3JS3A 3KL0A 2A3LA 4GBUA 3O6AA 4FALA 4HYRA 1UWAA 3W1PA 2DZBA 4FNPA 2A5HA 1JCYA 3CZEA 4C6JA 3M0ZA 4BEQA 1RPXA 2DZXA 3JVAA 3SN1A 3G0SA 5CAHA 1QBAA 2XSAA 3GRIA 5BWFA 3OVGA 3R8RA 1T96A 4TIMA 5I02A 2P3ZA 2WHMA 4JTAA 3LXCA 1HF6A 4X0NA 4LUTB 4O0ZA 4GNKB 4UOZA 1PKNA 5AFDA 3KW3A 1TE1A 1LLWA 1L6YA 2WQDA 3ARZA 3ZMRA 1ONXA 1W9DM 3ABXA 4JIHA 2E8YA 1J6PA 1P0EA 3EEGA 3EYPA 5EMLA 4KCWA 3TYZA 2ICSA 4QIUA 1QT1A 4IGSA 4XZBA 4QE4A 4LF2A 3KVKA 5GNZA 4WSJA 4B5SA 2HBXA 2PDPA 5H91A 3VD7A 2ACRA 3UFYA 3WD1A 1CLXA 3O0KA 2QPSA 4FMVA 4S2CA 4DZ5A 5A2CA 4HOXA 1I75A 5E1QA 4GY7A 1A0CA 3AALA 5H8UA 4K8EA 3W00A 2G8ZA 2PDNA 5I3IA 1UD5A 1E0TA 1VFOA 3EB3A 2VCAA 2VUNA 4OECA 5I03A 5E9XA 5LZLA 4QEEA 4G5DA 1PTGA 2GSEA 4BK9A 3SGZA 4LAUA 2BXZA 1VCVA 4L4MA 4NNAA 3BC9A 1A5OC 1UP2A 3GIYA 4RNIA 5IOBA 4RZ5A 3LHTA 5CPOA 3S9YA 1ODUA 1FY6A 2HJPA 2CITA 3QEZA 1ALDA 3FYYA 2AOSA 3NOYA 4GX8A 2PP0A 3UF9A 4L6OA 1O1HA 3DI0A 3F5LA 2WC7A 4NT0A 1KBBA 1QNPA 2X7VA 4L9ZA 2Y1HA 3ITGA 2CLPA 4O15A 4UBPC 3ARTA 4PFHA 6XIMA 4JNYA 2YYUA 1RP9A 2C1IA 1KTCA 3MP3A 5LGZA 3DFOA 1JQXA 4O1FA 2VC7A 3PM6A 4OT7A 4QG6A 3CO4A 3B06A 3RHGA 3MJYA 4RV3A 2HE8A 4RNHA 5A6LA 3VO0A 2QPXA 5C71A 1VBJA 5C5YA 1EIXA 1E1EA 1TJ0A 1WDSA 4XBKA 2WB5A 3SFWA 4NNCA 3G24A 2QQ6A 4FP1A 1IXQA 3W24A 1W1IE 2O9RA 1E55A 1FCVA 3G0UA 3TYCA 2C91A 2QZRA 3W85A 4EPBC 3WF2A 1JAKA 3UPBA 2VXNA 1JFXA 4G6CA 1WO2A 4O18A 3VIFA 5HK4A 1DQXA 1MFVA 1K9DA 3LU2A 2WHLA 3C86A 2QCLA 3I4KA 3CUJA 4NAEA 3MC5A 1A3HA 1UR0A 4I9JA 5CBIA 1OIFA 2GOKA 3FJ4A 3CWHA 4M7TA 3ABQA 1ICQA 3IVSA 2EPMX 3TMLA 4OWGA 3N29A 4JL1A 4DBDA 1CENA 1QBBA 3SRKA 3AIEA 3LCGA 2WC4A 3TAKA 1QW7A 2NXHA 1A3WA 3BXWA 5LA2A 2ZXBA 4WVXA 4ROPA 5A6BD 4XD3A 4DVOA 3GR7A 5LXEA 1ITQA 3W23A 2E6AA 3SSJA 1Y5VA 3GVWA 4DI8A 2NVDA 4GH1A 2UWFA 2OFJA 3LPOA 4H41A 1BQCA 1ZJHA 4HU0A 1QPRA 3M5YA 8XIAA 4JTCA 2HV5A 3EX6A 3SCSA 5ABHA 3M9YA 4BZYA 4R27A 4MYAA 3CZJA 1W8GA 4BEUA 1VPXA 4QDWA 1QK2A 3CWOX 1XC4A 2NX1A 3UERA 3MWAA 2FJUB 3EOUA 1OD8A 2PDKA 2FTWA 4Q8UA 3KOYA 4XBJA 4CD6A 3B04A 2AQWA 3TJXA 1F07A 4QISA 1L9WA 1NDZA 1MQPA 2CZEA 1W1ZA 3VKKA 3BW3A 4FX6M 1YBQB 1O95A 4EKJA 2UV8G 2IPGA 4FOKA 2DIJA 3NO5A 3R10A 1L0PA 1H0GA 4BQ2A 3SJNA 3AQUA 3BO9A 3TW6A 4XZHA 1QUMA 4S3FA 2C18A 3VKDA 1X98A 1VHCA 1XISA 3KCOA 1ODZA 3N9SA 4UIOA 2BY2A 3AC0A 5AYIA 1P0KA 4GZIA 1A50A 3BOFA 1FWFC 3O05A 1S3TC 2XIMA 3COTA 1V79A 3S5NA 5E6YA 3PPGA 1UR2A 4KRTA 5AYYA 3M0HA 1F3WA 1WKYA 2QEZA 4U5KA 3S5OA 1FWCC 1M7JA 3H2AA 4K6AA 4F79A 2OYKA 4PCTA 3POHA 4JFTA 1V0NA 2JEPA 5A94A 3RCNA