3H26A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h26A00
4S3FA 3V5OA 4S3EA 3TZFA 3TYDA 3MCMA 4HB7A 1AJZA 4DB7A 4DAFA 4D9PA 1TWZA 4DJEC 4G9PA 4S38A 3BOLA 4C1NB 2YCKX 2YCLB 2DQWA 3H2OA 3H24A 3MCOA 3H2FA 4PZVA 3TYAA 1Q85A 4S3AA 4NL1A 3TYUA 2E7FA 4NILA 4S3CA 4MWAE 4MWAB 1AJ0A 4MWAD 2DZAA 4DJFA 4S23A 4CCZA 2Y5SA 2Y0FA 3TYBA 3TYEA 1Q8AA 4S3BA 4NHVA 2Y5JA 1Q7QA 4DJDC 3BOFA 3K13A 4DJDA 4S39A 2H9AB 4D8AA 1AD1A 3H26A 4DJED 1TX2A 2VEFA 4O1EA 1TX0A 4C1NA 1TWWA 2YCLA 4DJFC 3TR9A 3H22A 1Q7ZA 2H9AA 3H2NA 4S3DA 2YCIX 3H2EA 2OGYA 2VP8A 2BMBA 4MWAA 1AJ2A 5JQ9A 1Q7MA 4DAIA 3TZNA 3H2AA 1Q8JA 4DJDD 3NOYA 1F6YA 3TYCA 4D8ZA 3TYZA 3H21A 3H2MA 1EYEA 4O0QA 1AD4A 4DJEA 2DZBA 3H23A 3MCNA 2YCJA 4MWAC 3H2CA 4O1FA 4DJFD 2VEGA 1TWSA 4NIRA
chains in the Genus database with same CATH superfamily
3P8IA 1F5ZA 1H7OA 3MCMA 3PZ9A 2GVJA 2NV2A 3G6LA 4WOZA 4AWTA 1ZP3A 4B2DD 2XDFA 3MS8A 4DNMA 3VKAA 5CPNA 2WC4A 1PE1A 1JVNA 1JPHA 3NQAA 1XISA 1IIGA 1GZGA 3TN6A 2HROA 3GXFA 3BQ5A 1VHCA 2HXUA 7ENLA 1BFNA 2VFEA 2XVGA 3GUGA 4DJFA 3M5XA 3B05A 3P80A 1SJCA 1TPWA 1YE4A 2WNQA 4ZENA 5J5DA 1FCVA 1FWBC 3KL3A 2YL6A 1FHVA 2Z28A 4CD6A 4UQBA 1YYAA 2GUYA 2NXGA 3CIVA 4GIYA 4N02A 3GXNA 3STEA 4AHPA 1Q6QA 2XN2A 1B9BA 6XIMA 5D03A 3VNYA 1SR9A 2WZIA 2AMGA 4GGBA 4J40A 1BEUA 2QYGA 3A12A 3SRDA 5HNRA 1W9BM 1VD6A 4IQJA 3H21A 4JYFA 1LLOA 2Z2UA 4C5YA 4AX7A 3VIGA 5ABEA 4Y90A 1RQEA 4QJ3B 2DU2A 3UR2A 2J6XA 3MMTA 3SB0A 1ONRA 3GKAA 3GH4A 3W07A 4JFUA 3SRHA 4JTTA 2ZRUA 1SMDA 4FR1A 3KCLA 4LU0A 3E9AA 1THFD 1G67A 2B4GA 4N4PA 4M24A 1QI3A 1JYWA 1MXSA 4C1NB 2GGEA 2WW5A 5C6MA 3HPZA 4MAVA 4N9BA 4FMVA 3DIPA 3AHYA 1T40A 3TXVA 5KZEA 3GNDA 4NXKA 3TP4A 4CNSA 2OYKA 4XAYA 4S23A 5LHEA 5D2YA 2NX9A 3EX4A 3GNXA 5C71A 3KWSA 4Z2GA 3A4AA 4PL2A 3P93A 5CGMA 4YMZA 1VZWA 1YADA 3WQCA 3TN3A 4DWSD 1GONA 2ZVIA 1T8XA 3GTIA 4XAZA 2XVPA 2CEQA 3ARYA 1TPEA 5AZ0A 2BHZA 3KW3A 3NPVA 2EO7A 3IGHX 3O63A 4TVDA 2IQTA 3WJYA 2Z0IA 5F2IA 5I77A 1UD2A 5JMUA 3PJWA 4KEUA 1J0IA 1SQ7A 3IUIA 1TVNA 1X39A 4PRTA 4NI8A 2R94A 4GPNA 1BF2A 3E49A 5EMJA 5A6BD 4AD3A 2GK1B 1GORA 1HVXA 2HS6A 3FFSA 3VI2A 2CLEA 4EWJA 3CB3A 3P60A 3W53A 1X8FA 4AY8A 4E8CA 2HNEA 3M0JA 1JPMA 3O8AA 1PX8A 4HA3A 3WUEA 3RX4A 2OKTA 1C8XA 4M6QA 1A5AA 4NL1A 4QJ4B 4UTUA 2XINA 3UY7A 2YBVA 4MMWA 4IH3A 1CGXA 1B54A 3ATZA 3C3NA 2WVVA 1W2PA 3NQBA 1DJGA 3WFAA 1CT5A 2DVXA 4RDWA 3UWQA 3QFWA 1SZGA 3KTXA 1ZCOA 1DV7A 1H63A 2UY3A 4AW7A 3UJSA 3DHFA 4IJBA 4W5UA 2V30A 4MZ1A 4RE0A 1X96A 7REQB 3B97A 4RNHA 4H7CA 1PL9A 1OX6A 2VP8A 3REQB 4YS1A 3M47A 4LUSB 1AL8A 5EB8A 4UFHA 2VQTA 4LYKA 1E43A 4L64A 2FB3A 2X16A 2KAUC 4Z2IA 2XSBA 4C6DA 2ZZ4A 3FXGA 2VWSA 3N6QA 3ZJ7A 3GIYA 1UBSA 3W7IA 1PZ1A 3BAJA 3QKZA 4HSOA 3DFSA 3OVRA 2ZZ1A 3B4UA 2BVTA 4GBUA 3PTMA 4AQLA 1S2VA 2RGLA 3PPCA 2ICSA 2YBUA 4H9VA 1DWGM 1XPYA 3SBFA 3CHDA 3S6TA 1IGSA 2QPUA 3RLHA 1UZ4A 4KCUA 1EP2A 3N25A 3W1RA 3KDNA 3CZJA 2WKGA 3HV8A 3USBA 4BI6A 4MWAB 1FWDC 1LUCA 3N2OA 3H7RA 1XGEA 1S3HA 3IV3A 3KAOA 2ZRYA 4IGHA 1JG9A 4JHZA 4DWDA 4P8UA 1UD5A 1R9XA 4U33A 1EQCA 4Q33A 3FN9A 2OTDA 2V6AA 3GX9A 3C52A 4B2DA 4N4QA 2A6NA 3R0DA 3W2JA 1F3XA 4A3HA 1EO5A 1T8QA 5KSWA 1C93A 2CXEA 4GG9A 6REQA 1F4HA 4DO6A 3TAOA 1VP5A 5CBIA 4HNOA 1TR9A 2V9DA 5C9RA 1LWJA 1UR2A 1RVKA 1K7FA 1L0PA 3EWWA 2G3NA 3GHUA 1S46A 1FFQA 1Q4WA 2D23A 3F5KA 4AHQA 4C6MA 2YL9A 3E0VA 3V75A 5LIKX 2C7FA 1JZ4A 1QPQA 5CPOA 1NF0A 2DPEA 3QOKA 3WK0A 3EOEA 4HHHA 6PTDA 1S5WA 1TZZA 1C7SA 3VOJA 4BI5A 3BZJA 2P8BA 1NEYA 3EDDA 3TU9A 1JZ5A 4EAYA 3LM7A 1GUVA 2O4MA 2PI6A 2PU1A 3EDKA 2E6AA 3GG7A 1ZNNA 3EA1A 4W8AA 3W7RA 5MF5A 1T5AA 3MJYA 1XP3A 2QUVA 2VT0A 1KKRA 4HYRA 2CLHA 4PMYA 1YPFA 4F48A 1JZ8A 4MB1A 4UNLA 4B3LA 2PLJA 2BNJA 3W87A 5HNNA 1G4SA 4DM1A 1AG1O 4F9DA 3SCSA 3UXAA 5HDRA 4Q4PA 5C9ZA 4C6KA 3PZQA 4OBRA 1JJKA 2XFWA 1YTDA 1Y5VA 3R0KA 4WR3A 4UTIA 3GTHA 4NNAA 3W82A 4Z1AA 3A22A 3LA4A 1K8ZA 4FXJA 3UPWA 1Z44A 4B91A 1L6WA 2YL5A 1HP5A 3DYOA 5CSRA 1XYMA 4LVFA 1R3TA 1NWTA 1SJDA 2ANUA 3BAWA 1W1PA 1N8IA 3SQMA 1KR1A 1QOQA 3RM8A 3Q67A 5CEWA 1H2JA 3V5OA 1V79A 1PXGA 1GKQA 2F8QA 4BQ5A 4WSHA 1RCOB 2F6UA 3NSXA 5I3JA 1BWKA 1Z42A 4O19A 3QOMA 2QVNA 1D3CA 5FACA 1IEWA 5I5RA 4PTWA 1J01A 3ABRA 4L9ZA 3BV4A 2HE8A 2VFHA 4EPEC 2ZZ3A 3BDKA 1Q6OA 2OEJA 4LEFA 3VGBA 1V02E 4AVOA 3GDLA 1BG9A 1B90A 1G4EA 4D6JA 4R88A 1V3IA 4L5ZA 2F6XA 2FGZA 3ZJ8A 1M9HA 3TUUA 2VVNA 4DY1A 4CCEA 4I9AA 1IXPA 4BCEA 4XZBA 4DVOA 4Q7BA 3UWUA 5IFTA 1QHZA 4LH8A 4ZOEA 1QK2A 4GC4A 5E1QA 1E1EA 3TYCA 1XYAA 3N34A 1XYFA 3VMNA 3S5ZA 2TRSA 2YLAA 2VUNA 5E9AA 1EXBA 4AD4A 3O06A 3DGBA 3KL0A 4Z08A 1B3ZA 1J5SA 3QQ0A 5CLWA 4A05A 1TQXA 4JQAA 3WLOA 2Y2WA 3FEQA 3JRKA 1PKYA 2H8XA 3T8QA 2WPBA 3IK4A 5E6YA 3LB0A 4QDMA 2JIEA 1J0YA 2ZOXA 3G8RA 2BASA 4K1GA 3G1SA 4A8NA 3W28A 5I06A 3URNA 2DW6A 1JFXA 1HGWA 1OX4B 4QG9A 1B31A 1XC6A 5G1MA 1HVQA 3GYEA 3IV8A 2WVUA 4AWUA 5C8BB 1R3VA 4NHVA 2GGHA 3W7HA 2FZ8A 5HQEA 3ECQA 5BW6A 3BC9A 2Q02A 1PUDA 4YWIA 3B8DA 3VOFA 3RK8A 1TX0A 3NAVA 4HTBA 1TO3A 4LTSA 5JUVA 1YKWA 4WX2A 1W3KA 2XH2A 3JVAA 3PJTA 1CLVA 4J27A 1RY8A 3STCA 1BSLA 4O1AA 1RZMA 5C9UA 3EAUA 3QQWA 1JGIA 1HJWA 4G2DA 3SIZA 3MBFA 1Q7MA 1J8VA 1Q5MA 3E5BA 3JR2A 3RGTA 4RNIA 4E2DA 4MJ2A 5TD4A 2CZ5A 1CPUA 4XZMX 4ZQCA 3U7VA 3R94A 2ZX9A 4GZEA 3EZ4A 2DZBA 3AWOA 4FS9A 1NP2A 2W61A 3MPGA 4X0NA 1W8SA 3P5YA 4LGXA 3KZSA 4AH7A 2F6KA 2AAMA 3PANA 3AMDA 4XKMA 4NJJA 2CHNA 1S2AA 5D8ZA 3WLMA 4C6JA 2HQAA 2PD5A 2RDUA 3AXMA 3DH7A 1DVJA 3IGXA 4IG2A 1Q85A 3DFQA 3ENLA 4MB3A 4FALA 2Z00A 3MSDA 3ARUA 5BNKA 3P8JA 1H09A 3WH8A 1ISYA 1WP6A 3B03A 3BK0A 1ADSA 1BVWA 1YXDA 4JTDA 5BXRA 2CETA 2DH2A 4Q22A 2V63A 1U22A 4UTMA 4W7UA 4IPIA 4JTGA 3DDMA 1TUFA 4E5TA 2YGYA 4Q3MA 1EJXC 5HMEA 1E6QM 4UUIA 1X7FA 2HRWA 3BAIA 2ZRXA 2CLIA 4RDYA 1QUMA 1JXJA 3GXIA 3LV6A 1ADDA 1I2RA 3M64A 3OBAA 2CBIA 4JHMA 3UVIA 2HTMA 4K37A 1A5BA 2E8ZA 1KBBA 3EGJA 3RCNA 5G2IA 2X7WA 3W1AA 3RU8X 4JTHA 3E96A 2GOKA 2R6OA 3NSNA 3TMLA 4ZQOA 1PEZA 2BGSA 1QI5A 4JN6A 2G95A 1M04A 1XWYA 3VCCA 1OD0A 3AMGA 3VVGA 3W7GA 2QEZA 4MFEA 4EF8A 4H7VA 4WOQA 3RX2A 4Z42C 5AHLA 1BD0A 3DESA 3WEMA 3TYDA 3ZVHA 4Q4MA 1W1YA 4NAFA 4RPPA 5KEZA 4Z1YA 4GVIA 1UZHA 4EX4A 4PZVA 4Q8TA 2FHFA 3EEZA 2JEQA 5EU9A 4YN5A 4ML4A 4JXCA 2QJMA 4DXXA 1LM1A 4JYDA 3VOHA 3WX7A 1M41A 4MF4A 1E1CB 3GZAA 3DFNA 4C7GA 1QAPA 2IPFA 3CH0A 2PS2A 1PWMA 1ZSXA 3DI1A 4JD4A 2YB4A 4NXSA 1MI3A 4GX8A 3PBUA 1K9DA 4U4MA 1Q7ZA 3H2NA 1XIEA 1W91A 3U57A 1I2PA 3IJDA 1T99A 1Z8AA 2VFFA 4X61A 1QW7A 3W1MA 2RHGA 4WSJA 1TELA 2FTPA 4B3ZA 1GQIA 2BGNE 3BLPX 4J7RA 1L6FA 5K4XA 1PCKA 1ONXA 4NG3A 3AZTA 1ISZA 1PKMA 1LOLA 1LOQA 1YXCA 2J9YA 4UOJA 1QNOA 1LT7A 3U6WA 3RITA 3LHTA 1VFSA 1YPIA 4IFRA 5AHFA 3T78A 4A8RA 3ARVA 1OGSA 4O52A 3VD3A 5BRQA 1MNSA 3WH7A 1XH1A 3S2MA 1ME8A 4K7YA 4X3ZA 4AZCA 3F2DA 3OQEA 1PIIA 4Y9OA 5I3KA 3N17A 2J8GA 5BRBA 3LSCA 1C90A 4LF1A 3I6EA 3AS2A 4M82A 5I78A 2PLKA 1LORA 1KRAC 1UR3M 2E25A 3WLNA 2GSJA 3GDRA 2Z25A 2V2DA 1JAEA 3IJQA 1PDYA 3E2VA 4S39A 4B4HA 2ATSA 1OYAA 5HWJA 4ADSA 3KBMA 4I7VA 4OOUA 2WB5A 3S1VA 1HQTA 1PX4A 1XICA 4IJCA 3WJXA 4YYCA 4FO4A 2V3FA 2XJ7A 2P5NA 3L4VA 1AW5A 1GTHA 1ZY9A 3QV7A 3VKBA 4PEKA 2ADAA 2CHOA 1H0GA 2PDKA 3N73A 1N82A 3N15A 3RIKA 2DIJA 4H7ZA 1VYSX 5IDZA 1UHVA 3T2QA 4H1ZA 2DSUA 3BLOA 4I7WA 3IJ8A 1UUOA 3SQSA 2Z1KA 1CTNA 1XGDA 2NQHA 7TIMA 1XIMA 1OIMA 3WL1A 3KBJA 4NRRA 4UQ9A 3K4DA 5CJMA 2PDWA 4BA0A 5A3HA 4YL2A 4NAEA 1PSCA 1IXNA 3BOLA 4O4WA 2AAAA 1XBXA 1J6PA 3N6JA 1EHNA 2FIQA 3ZJ6A 1PYFA 5LXXA 3I10A 1BKHA 4AZHA 4L9YA 4PMDA 4IMEA 4JNYA 1GZJA 1W1B1 2Y8KA 4LAKA 2VCBA 5CC7A 1SO5A 4PMJA 4Z1CA 3AAMA 4LS0A 1OB0A 2PUZA 4IP4A 5FL1A 3U8GA 1I9CB 4XAPA 1XKJA 1GEHA 1FH9A 2ISDA 5F2LA 5CCZA 4BS0A 4JL2A 4Q8VA 3N3MA 2G50A 1F74A 3TJXA 4AD2A 4PSPA 2EHHA 1AQMA 1DTUA 3DI0A 4QSFA 3MJMA 4GQBA 4PE8A 3HPFA 3LS9A 4CQDA 2D0GA 3ZWTA 1FWCC 4KCVA 3T1GA 2ABBA 3SW6A 5I79A 1TVPA 5FOOA 1MW3A 3VKKA 3UP8A 2W67A 3N2CA 1SZNA 1DYSA 1L2UA 2ZTKA 4XTIA 2YCJA 5K9CA 5AVHA 4PR4A 3AS0A 1K9TA 4DN1A 1AQHA 4QFUA 4AAJA 4WJ8A 4G7EA 5LXEA 4UCGA 1OFRA 5LYRA 4PCSA 4IIFA 2E0PA 3WD1A 4BJHA 4C6LA 1FWIC 3FS2A 5T26A 2QW5A 5CGQA 1SR0A 1RV8A 2VM8A 3PWIA 2WMIB 3BURA 3CUXA 1A5MC 1XBVA 3BGJA 3VPLA 2QUUA 1S1RA 2G0WA 3NO3A 5I02A 5D2WA 1MEIA 1LDCA 3RR1A 1JCNA 3CJPA 4XZWA 4GC3A 3NQ6A 4W7WA 1B5TA 2HBVA 1ICSA 1WKFA 3SCRA 3UXDA 1H60A 4AZ5A 1HO4A 2XFFA 3AIQA 4FLSA 4HGXA 3G1HA 1C3FA 1KM5A 5B80A 2W62A 2WMKA 1CENA 1WOAA 2GJXB 2UBPC 3P74A 2FPVA 1T41A 1ZJIA 1J11A 3GDMA 2EQDA 4GCXA 1M53A 4XO7A 2R1LA 2E28A 4AVFA 4F0HA 2DGAA 1R8LA 3ZMRA 3VGEA 3R6IA 3SFWA 2QJGA 4PUKA 4WD0A 5A6AA 1TTQA 4QNEA 2XIIA 4QM1A 3ZIZA 4Z1DA 2J8TA 2VI0A 3G2GA 3H8AA 1UBPC 3HGOA 2FZNA 3AOFA 1POKA 4WK9A 1GTEA 1Y5XA 1EJSC 4CQCA 4N42A 2C8NA 4FLQA 3NM1A 1CCWB 1RD6A 1BGGA 1QMLA 1TA3A 4JNZA 4ACZB 1V08A 1IWBA 3UR7A 4OZOA 1VCGA 2V5KA 2BVYA 4D72A 1W3HA 4URIA 3ZR5A 1ZAJA 4J3VA 1E0UA 1P5BA 2GUUA 2WLZA 3TE9A 3QZAA 4W88A 5BXTA 1TPVA 3SR7A 1NFBA 2WKJA 3E0FA 5D38A 5FCZA 3QY6A 4S3BA 1YEYA 3LZ5A 3P0XA 3OIHA 4W4QA 2DW7A 2YW4A 2BXVA 1GKRA 2GUBA 2VC9A 5J04A 1XIDA 3ZSTA 2YCEA 3F4WA 1W32A 3M0ZA 3I3BA 3EWXA 2GYIA 3PUGA 1O5RA 1NWUA 1OX5A 1Y65A 4EXAA 4MADA 4B9ZA 1GKPA 4TMCA 2Y85A 3PBGA 3GSMA 1QDSA 1OCBA 3P0WA 1L8PA 4LRTA 1XRTA 4EANA 3GRIA 1DIOA 2PF0A 3TZNA 1E4LA 4XB3A 2KZHA 5EPDA 1M7OA 2ZE0A 3GNPA 3LLDA 4POCA 3UYCA 3GHTA 3F4VA 5CC3A 3NZPA 4XTDA 3H2CA 3S5NA 2NW0A 2YLLA 1VF8A 2WHMA 1LLWA 4XD3A 3H6OA 3KTCA 3AIRA 3GQYA 2PDFA 4J3SA 2R9RA 5HOSA 4KWVA 2OZTA 3KCJA 4UTWA 3ABSA 3WBYA 4HZMA 3L68A 2HVNA 2OODA 4V1YA 3RCMA 4QXIA 3THUA 3UGRA 1VFHA 1H7XA 1IZJA 1TSIA 2I16A 4AZ6A 2QGYA 4PTXA 3BJFA 4EP8C 1XD0A 2OT0A 3OYXA 4J2PA 4B5TA 1QFEA 3SJ3A 1SGJA 1XW8A 2WNWA 3EXTA 1OZMA 1MMFA 1RCXB 1NM9A 3HA1A 4LCRA 1S2TA 3I3EA 4TR9A 1Q3NA 2CLOA 3MQTA 3ISIX 1KNWA 3VE7A 2E9LA 4LV4A 4JIIX 3KP0A 3CHVA 4XX6A 3RPMA 5KZDA 1E3ZA 1M68A 4ZVJA 2AL2A 3CBWA 2Z1XA 4LXFA 5EMLA 3PTDA 3DYMA 1MW2A 3UG8A 1UP2A 1TR1A 5AHIA 3NOYA 2GGGA 1GOWA 3IIXA 3GDTA 3W7OA 2VO5A 3TNBA 2JKAA 4E8GA 3QYQA 2V8ZA 5AN7A 4BEQA 5I23A 3NO1A 2DP3A 3KCOA 1FDYA 2EJ1A 2P50A 5GPRA 3NURA 1H62A 3AU2A 1UKSA 1YBQB 4R27A 1OFDA 4XBJA 2CESA 3DC8A 3ZOAA 2GK1A 6ENLA 4UZUA 5AECA 4XIMA 3RPTA 1PIGA 2DT2A 4NQ1A 1J0KA 2ZE3A 1DL3A 1WX0A 4RUBA 3UXKA 1VPXA 1M65A 4RCXA 1XLLA 2E9MA 1LRQA 3BANA 1VBRA 4LUTB 3LY0A 3NSMA 3H4GA 4M1BA 5IOBA 2XM2A 4TIMA 2OWWA 2XISA 5HQMA 3UFYA 1LBMA 2I56A 2QLYA 4UOQA 3BCDA 4IIDA 2QJHA 2NVAA 4DBSA 3AO0A 4JYEA 4IPLA 4GO8A 2I17A 1KGXA 3KM8A 3WSUA 4XZHA 5M1TA 3OBKA 5HQLA 3E38A 3VGHA 5C70A 7REQA 3ICJA 3M6DA 1W3IA 3UWEA 2FHBA 3WLLA 3GBEA 3STGA 3UWVA 4HBKA 1WV2A 2VX6A 3WK2A 2QPXA 4YJ5A 1QOXA 4GWEA 3PZTA 4X60A 4LUSA 2RDXA 5AC7A 1VFOA 1WKEA 2ZYFA 4JAWA 3EOLA 2AKMA 3PG8A 2VGGA 1GVIA 2VCAA 4QJ1A 3G1RA 4HA0A 1IEVA 1UH3A 3W2KA 1ZJAA 1W9UA 2HBXA 4IL0A 4UR7A 4MAZA 4DAFA 4PC8A 2DJLA 4I9JA 4D9PA 1XUUA 1IV8A 3W6LA 3L67A 2UY4A 2BFGA 4FF5A 1W9XA 3S3GA 1JYNA 2Y88A 4C1KA 4NJHA 1A5KC 2GFTA 3MI3A 5I0DA 3UCDA 1FTXA 2GOUA 3TMQA 3W76A 1JRBA 3IACA 2B31A 2WKLA 4KF1A 1VPYA 2C0AA 4TU1A 2PGFA 1A5SA 3PZGA 2BXZA 4K7VA 4P8XA 4XUYA 3BXWA 3VNJA 2WOQA 2ZX5A 4GYPA 1TUXA 3EXSA 1QJWA 2RJHA 2FPYA 4LAZA 5HJXA 4BK9A 1E6XM 1UA3A 5CPMA 4NJIA 3DFHA 1FH8A 4LB4A 2DZVA 1SO3A 4Q6XA 2GVLA 4QS5A 4L80A 2WM1A 3GUWA 3W3OA 4FX6M 4RW3A 1E55A 3IGUA 4U31A 4U2YA 2XGIA 2CPUA 2I5GA 4CN6A 5A95A 4IIEA 1KC7A 3A5VA 3BMVA 2Y7GA 3WF4A 3WMBA 1AD4A 2CC0A 4AIEA 1U5HA 5KINA 7ODCA 4Q4OA 3B3DA 5CSYA 1OQFA 3HPXA 4DZHA 4WDTA 1EJVC 2XSAA 4I9MA 3ABQA 4KFOA 4S3GA 3WQVA 1TPFA 3WNPA 5K3VA 5DMLA 3GVQA 1VFTA 1DIDA 4X2RA 3DFTA 5D33A 1CB2A 5JIPA 4JY8A 2E40A 2H6RA 1MQQA 1J2WA 4JTQA 3A3XA 4MYAA 3GW3A 2PF8A 4HSHA 4LY8A 3OGRA 3FJNA 2F61A 4J28A 5T9CE 3UT0A 4ZXLA 1W5QA 3UWYA 1A49A 4JFVA 4HHMA 4AU0A 2BV9A 2CLFA 3OLEA 1IF2A 3OZMA 4GYFA 3NNTA 1JF5A 2NWRA 1ODUA 3GH5A 5J5RA 4N9EA 1JDDA 2PD9A 2QUTA 3UGVA 1BGAA 2ZKMX 3P82A 2A3BA 4H9ZA 4D2JA 2PTZA 3TR9A 4BEUA 1GPFA 4J3XA 2A2IA 3KOXA 3VDAA 2QR6A 3A4JA 4NZCA 2E6DA 3SM0A 3MUXA 3OQ8A 4JX4A 1SJBA 1XIBA 3TC6A 1FVPA 4RE2A 2XPKA 1ADOA 2CKRA 3TCEA 3H2MA 3ZM8A 1QPRA 8RUCA 1XV8A 1UKTA 4CUCA 3QZ6A 1XLFA 2VD8A 4HU4A 2CZEA 1OFEA 2WVVB 5ABFA 4N6EA 4FB7A 1EB3A 2WNZA 4R53A 4JTFA 4YIWA 1K6AA 2DIKA 1OADA 2DDXA 4NJKA 2DSKA 1LG2A 1GCYA 4G9PA 2OG9A 4OECA 1ZAIA 3ITTA 1UOKA 4KRZA 3S2CA 3WENA 4ZXOA 1E5NA 3NGJA 4FHAA 4UQEA 3NL2A 4UTTC 1UD8A 4GD0A 3C2YA 4A6GA 3UZJA 4K36A 4MNMA 4LYPA 1JDEA 1IT0A 1ZP4A 3HG2A 4JEJA 4QIUA 4YNGA 4C6NA 4YYFA 1XIFA 1DPMA 3WFLA 1OZQA 2UZ9A 3LRLA 3W1PA 4L7ZA 2VEFA 4CCCA 3GE7A 1SO4A 5FJTA 1NJJA 3CV7A 4QG8A 3T44A 1HKVA 4JICA 1UZ1A 1L2QA 4MY8A 4LS2A 3D3AA 4UMAA 5DBUA 1A5CA 1SU5A 4LV9A 3TC7A 1L8NA 3MSYA 3OGSA 5C7HA 2BDQA 2OZ0A 4AF0A 2BODX 5AHEA 1EDQA 1UH2A 1GYNA 1XRFA 1J6OA 4Q8WA 4V28A 4HCLA 4GUIA 3LLXA 1LUCB 5FSDC 5KMYA 2IXUA 3KS6A 4F4RA 4RLIA 2J66A 3DKJA 4FNPA 3UQNA 4AZGA 1K77A 4MJMA 1PZ2A 4F0LA 4ML9A 4GH1A 1IR2A 5TNVA 2PGEA 5XINA 3S8HA 2DZTA 4GZ7A 4C6FA 3GD6A 2HK0A 3VX0A 1K8XA 4QEEA 3SGUA 5A2CA 1W5PA 3R8HA 2O7QA 1KFKA 2ZCGA 1OC7A 2ZIDA 2DVTA 4GBDA 3RO6A 6REQB 2E09A 1IHIA 1EC8A 2YYTA 2OCZA 5HK4A 3VO0A 2I7GA 3CAVA 3D46A 4Z2JA 2V3EA 4FR6A 4FXSA 1OJXA 3A6OA 4D8AA 1IT7A 1F9CA 2X1TA 4H8UA 3NDZA 2FHCA 3WF3A 5BU9A 2FKPA 3FGCA 4MTVA 4RE4A 4MZYA 2VGFA 1WZMA 2IPGA 5I3GA 9XIMA 1D7FA 2IMRA 3CQ0A 3N4AA 2WPGA 2VRQA 3CL6A 1E9ZB 3E12A 2EKGA 1TJ2A 4QS6A 1VYRA 1B9ZA 2E1DA 2WVTA 1WAUA 1L6YA 3RLGA 4CKQA 3M7SA 1VS1A 4YPJA 2VMFA 3FJLA 4DYJA 3T05A 1ZS2A 2PP3A 1CXHA 5BZAA 4I9TA 1FCUA 5I2UA 3QH2A 2HWGA 2ZTJA 3NQCA 4XUGA 4X9SA 5E70A 3C0SA 3GO2A 3EB3A 2X1RA 3EWCA 2XSXA 2PWHA 4N7QA 2GPTA 3N9RA 5A8GA 3C8FA 3IVTA 3G8EA 2IKJA 3QY7A 3WD2A 1HXJA 4DX3A 4H2CA 3WJSA 2YR1A 1T0OA 5A94A 5LNVA 3BAKA 1I1WA 1P1MA 1DJYA 5EYWA 1NOWA 4GXMA 3UJEA 4GH3A 4CQBA 3U3HA 3C0JA 1WZLA 3A23A 2BY3A 3NFUA 2POZA 4WXZA 4AHOA 1GHRA 1ICPA 1RBLA 2W9MA 1Z89A 4H8NA 4LUYA 4B5WA 3ZQ9A 4OT7A 1X38A 2D20A 4TV5A 1XYLA 3VZZA 4LANA 1DJZA 2DFAA 2OJPA 2Q01A 1ONWA 4QDWA 4UR9A 4AIUA 3KVLA 4JTRA 3UW6A 3E0WA 2VVSA 3W25A 2CWXA 3HTWA 1VEOA 2C79A 3SDOA 2X1IA 1KFLA 3ZLHA 1C8YA 5I3HA 3ELFA 1ISVA 1TRDA 3UJ2A 3TWBA 4W84A 1EZWA 5CKSA 1K7XA 1OABA 2PDGA 1OYCA 3DG6A 1OGBA 2XUCA 3T08A 3AJ7A 4H6RA 2GQ9A 3AUJA 2FVKA 3WQWA 5FF7A 3V0SA 3GTXA 2VX5A 2OX1A 1JDCA 3SGGA 3TV8A 2D1ZA 3VDBA 4LW7A 3B8VA 3VNMA 3LV5A 3N11A 3LCXA 4IZGA 4A22A 1XLIA 3ARSA 3MY9A 2CLPA 4S3EA 3AIWA 3VILA 4O17A 1PB0A 4DM2A 4Z2HA 4M1RA 1DJWA 2D2JA 5BXSA 1E6SM 3PUOA 4LQ1A 2R8WA 2OGJA 3DC0A 3WDIA 1K4HA 1XR2A 2E3ZA 4ZQMA 1JUBA 4A3QA 1Q45A 2CLLA 1QASA 1HGYA 7A3HA 3DG7A 1XD1A 2A4AA 3NM3A 2OQLA 2HS8A 1UD4A 1GT8A 2CBJA 2PEVA 4HKPA 3DBPA 3S2JA 4B5VA 2A21A 1E1CA 1OYBA 5HJLA 4GABA 4JX6A 1KQZA 2YCLA 3M0MA 3RM4A 3H22A 4AB4A 2FLIA 1DBTA 3RJYA 3W75A 2NZLA 3NGFA 1M3UA 2JF6A 4LF2A 1CBGA 4RDVA 2ALRA 5HULA 1DIEA 4OBTA 4DAIA 1V77A 4AXKA 3Q4DA 1V3JA 3N19B 2OYLA 1GVEA 4YTTA 3MC5A 1S5TA 3S2NA 3O16A 4LB3A 2YPIA 3CH9A 3LDVA 1TTIA 1TWSA 1Q6GA 3P61A 5FSEC 5E0KA 3WNLA 2R14A 4OWGA 2NUYA 3O3RA 4Q4RA 1XX1A 2J6VA 4MUPA 1CGUA 4TMBA 4EAMA 1OC5A 1VLIA 5JXQA 4I5RA 3WY1A 2QCDB 4L56A 4RZ5A 3TYAA 3VIFA 5CQ1A 1QPNA 4GJJA 3HG4A 1DQWA 5FL0A 3K1DA 4KBXA 4LX4A 1H49A 1F05A 1RLDA 1J9YA 3GR8A 3P62A 4MNJA 2C15A 3TJLA 2WV8A 3MSGA 3BH4A 5GNXA 3W0KA 3GIPA 1W56A 1WDDA 4F0RA 4Z17A 3IJ9A 4QAIA 3VNKA 1KLYA 3LX9A 3W2LA 1IEIA 3URAA 3RYSA 3LSBA 1J0JA 2ISSA 1EP1A 4JTIA 3HGJA 1PTDA 3DHUA 1XH2A 1KQYA 1PTAA 1CLKA 3CZKA 4PTMA 3M5VA 4F9JA 4IG2B 5HJYA 2Z2AA 5EA9A 4JTAA 4HNLA 3QSRA 4LUJA 4JCLA 2ZVRA 1OFBA 3EOOA 2CFFA 1UUQA 1CXFA 4E3VA 2VZUA 3USZA 4Z2KA 2GWGA 4E6MA 1M7XA 5KITA 1VJIA 1MDRA 3T4CA 1OWQA 2AOSA 1IIHA 2XN0A 1R2SA 1T96A 2WK2A 4IPPA 1JZ7A 2Y7EA 4NSBA 3UWWA 3MCOA 1G4PA 2JE8A 1XRSA 2OWCA 1RY0A 1EJRC 4NILA 3OU8A 2BB0A 4KH2A 3CTTA 4D8LA 1BXBA 1W0MA 1RSCA 3A9BA 3B4YA 2MANA 2PGRA 3G1XA 3QHOA 4JKMA 4RK8A 1JCJA 4TX6A 5FJPA 4Z0SA 4AD0A 1KCXA 2PPGA 4O50A 3W1LA 1DWJM 3W6YA 3W84A 4NVTA 3WMLA 4U2ZA 3UVAA 3EDFA 2W66A 1GZ1A 4KEMA 3ZVHB 4UNKA 1G7UA 8TIMA 1U1UA 5LHFA 4GY7A 3S1WA 3PTQA 5G1TA 5IBXC 3NQ8A 1ME7A 3R7MA 3DECA 3GS6A 3N2MA 4L6OA 1DORA 4F0KA 3M6YA 3XINA 4A3YA 5A5WA 3BSGA 2HMCA 3TAKA 3EOUA 1BKSA 4L9XA 1U5VA 3E0LA 4YLWA 1VH7A 1E9YB 3JS3A 2FGLA 3KBWA 2X2YA 3ANUA 4XK2A 5A2AA 1BWLA 4HSNA 2DZSA 3NL6A 2OZ8A 2XYLA 3VA8A 3TW7A 5HMDA 1ODZA 1GNXA 1SFJA 1FCQA 3UPMA 1B3WA 2XVLA 1QNSA 5CGTA 2WMIA 4OUIA 4GI4A 3UCQA 3WH6A 1QO5A 4CU6A 4FX7A 4DBUA 3N13A 3O6CA 4D6FA 4KEZA 3S1UA 1UR0A 5DXYA 3GB6A 1JR1A 5DY2A 3ARTA 5CJNA 4F2TA 4BR1A 1DXIA 4DUWA 1D2KA 2X42A 4O18A 4A35A 3IJLA 1JCYA 5AVNA 3ZT7A 1XIIA 4CGTA 3ERPA 3CS2A 4PRWA 4CCDA 4M29A 3ZVIA 3NWRA 1FWAC 5D2VA 3H12A 2TPSA 1ESWA 2Z4GA 3RJXA 2UV8G 9XIAA 4XKYB 4AZCB 6XIAA 3M5YA 1K7EA 4JX5A 3D47A 2ZUVA 5B7YA 5H8MA 4GXPA 2A79A 2PDCA 2OFJA 5LNUA 1WUFA 2F38A 4MDPA 1WUEA 4HOXA 1XSJA 1DHPA 4IMAA 4MYXA 4HU0A 3L23A 1VJSA 3LHYA 5I7GA 1M6JA 4DB7A 5TIMA 2ZICA 1R6WA 3SY8A 4DQWA 2WC7A 4OUEA 8A3HA 2VEMA 4BKNA 2WMJA 2FDSA 4NUWA 4PMQA 5T91A 5K7JA 5DO8A 3BW3A 2WCGA 2EKCA 4M80A 1UC5A 5DCEA 4OQVA 3GNNA 5JIWA 1CYGA 1TPB1 4FEZA 2Y1HA 2CU0A 2VENA 4QR6A 2C19A 1I2OA 2C1IA 1FWGC 1Q65A 4JKKA 4YVPA 2PDHA 1A3WA 3AHTA 4C5ZA 3SAZA 3K5XA 3BLDA 3RRXA 4CD5A 1Z41A 5LIYX 5I00A 2PDPA 3V5CA 3NZGA 4OHQA 1P43A 3MP5A 1A3XA 3BG9A 1NDYA 1SPQA 4JIQA 2B7NA 3WLKX 4ATLA 1UROA 1FH7A 3BCFA 2G96A 3NDOA 3FNDA 5M5DA 3MUIA 4GACA 4C1LA 4FOKA 1P6CA 3C2VA 2G4FA 2OLSA 2BBFA 4KWUA 4UFMA 1Y5WA 5DT5A 3WZ0E 4FXFA 2J27A 3O2LA 1XLEA 1HKMA 2JBMA 4PUMA 3ONCA 1ZUAX 3OEXA 2G3IA 2EJAA 2ZXBA 4PULA 5BOEA 3L4ZA 3VKJA 4GVHA 4TX9A 3UZXA 1UP3A 2Z1VA 3H7UA 4LYRA 2QS8A 1MXGA 1YMYA 5MHBA 3K30A 3LENA 4WCJA 5CPLA 1VFFA 3W1XA 4P7QA 3QMRA 3GTFA 2AL1A 4ZO8A 3CHCA 1S38A 2PZ0A 2Z6JA 1GG1A 1TPC1 1ZJBA 5LNSA 1TPH1 3NQGA 1PJ9A 1NDVA 3TJ4A 3J7HA 3HGSA 3MTWA 4WY0A 1UC4A 5I09A 1C7TA 2J7DA 4P8WA 3GAKA 3VE9A 3ZSSA 2ZWYA 1E56A 2VD9A 4QROA 1RALA 4G1NA 4W8BA 1EA0A 1VCVA 3T42A 1K6WA 1DJHA 4UTLA 2DUXA 2BLEA 1CI1A 2WHJA 3AYRA 2QPSA 4E4FA 3NVTA 1I45A 2VR4A 2PLCA 1E6NA 1XYBA 2F7FA 1A50A 4E4PA 3S42A 5F1UA 1V93A 2A7PA 4I90A 3WLHA 3IS4A 3HFTA 4EE9A 3ZS4A 5JU6A 5LA1A 1QOPA 1E70M 3F4NA 4UFLA 2ZBTA 2XVKA 2I5IA 3WLSA 4ZR8A 3BG3A 4PB3A 3GKFA 3LNMA 1IZKA 3HG3A 4MY1A 2Y8VA 4IGNA 1UD3A 4DI9A 3L65A 4X2PA 1DJXA 2W27A 1IEQA 4XVEA 4MLJA 2ZZ2A 3MUAA 3GU1A 3KZPA 3NUKA 5BWAA 5C5YA 2GSEA 1TV4A 2ZXDA 2E6FA 1NOUA 4ADTA 5CPQA 4N6FA 2YDAA 1M5WA 3N2XA 2CLKA 4GOAA 3SFKA 4HA4A 5FIPA 2Q3OA 1D3GA 2G4JA 3WQGA 4V1XA 3O0KA 1CB7B 3IEBA 2TSYA 3OZOA 3MHGA 2PDUA 2P10A 3LGGA 3UG3A 3B8WA 3S9YA 4GNVA 1SZEA 3GXDA 3H26A 4Q8NA 1KWGA 4NNBA 3RAOA 1QCWA 1XCWA 3VD5A 1FFRA 1YQ2A 1UWQA 1ME9A 3AS1A 4GHRA 3K1GA 1EDTA 5F4XA 2PWUA 1TA3B 4GIAA 1XS2A 3GFYA 2ISWA 3QR0A 4N9CA 4C6BA 1VEPA 2J74A 3PWAA 3SJNA 2G3JA 2ZZ5A 4GIRA 3SCTA 5D32A 3MMWA 3IK2A 5AYIA 3WNMA 4AMAA 1H7NA 1I0DA 4KFPA 4TV6A 3THAA 4OKDA 3UESA 1OCNA 4M3PA 3PB2A 1S39A 1HL9A 1KRMA 3WMCA 5ABHA 3A64A 1VYPX 1QI0A 1X1NA 4JZ5A 2TMDA 3I68A 4S38A 1EF2A 1P1XA 4GJIA 2YA0A 2DQWA 3NJ3A 3POHA 3VOCA 4XQ6A 4ZO7A 2D2OA 2IQDA 1RPXA 3VK5A 1CZ1A 4MKVA 1O6IA 4AX6A 1EC7A 1M7JA 4FI4A 3B40A 1TTPA 2CIPA 3LCGA 4EWND 2ZX8A 2VC6A 5A8PA 3RMJA 4AZBA 3N9SA 2E5DA 5D04C 4NP7A 4Y8FA 4ADUA 1AD1A 3IJ7A 1NFGA 1QHPA 1PCWA 1YDYA 3KTSA 2X09A 2GSHA 4ZOCA 4PUWA 4JY9A 4HP5A 2QCCA 4YTSA 5A6MA 4A3UA 3QPYA 4MHBA 1KTCA 3CWHA 5HINA 3I65A 1UWAA 1MFVA 4AC7C 1Q8JA 3QV6A 1XJBA 1E6RA 3SZ8A 1XLKA 1RA5A 4JHOA 4K38A 3GNRA 3TTEA 1REQA 3MT1A 3WQFA 4QSHA 1MEWA 2A3AA 1GG0A 4BFAA 1BYBA 5IRPA 1C9DA 3TQ0A 2GGJA 2QF7A 3HV9A 3THCA 1ZENA 1QWGA 2CNCA 4QBXA 2QUMA 3P67A 5PTDA 3OYZA 4PMUA 1H5VA 1U30A 4JFSA 2E5CA 4PA8A 1RQHA 4UZSA 4DYEA 5FJUA 2VOTA 3W85A 3WQ8A 3FXYA 4Q4QA 2AL2B 5K9DA 3KLLA 3MP4A 1H41A 1N2VA 4Y9MA 3CQIA 4ROQA 5FAGA 4ICMA 2G3MA 3FVDA 3TYEA 4HU3A 3K4WA 4DWSC 4EPBC 1MUCA 4RDZA 3FLUA 1WQ5A 1SM9A 1OFOA 1Q6CA 3M0XA 4GYPC 1I75A 4O15A 3NYZA 1DWFM 1XLGA 3VC6A 3DHPA 4KQNA 3PK7A 3SGZA 4JTLA 2VEIA 3IAPA 3TSDA 3OZPA 1VB9A 3RMEA 3TN5A 3NVDA 3HQPA 5A6JA 2J13A 4E8DA 5I3DA 3V7PA 4QISA 4H9TA 4BY3A 4UQDA 1JDAA 3FHAA 3VXGA 4PSRA 1W9PA 2OXNA 3LPPA 2ZZ6A 1EXPA 2ZXQA 2OOFA 1A80A 1EYEA 2UY2A 4L4LA 1MDLA 2HISA 3S1XA 2EG6A 2R1NA 3CZGA 1EJWC 1W3JA 3DOPA 4MM1A 2QDEA 2BHUA 2XG9A 1RHCA 1NSJA 3VNLA 1AODA 2R82A 1WDPA 4A2SA 1BLIA 3EB4A 4OGZA 3ALGA 1U83A 5CG7A 4FNRA 3K8LA 3U4AA 5C2GA 2PDXA 3SUSA 3TYUA 4S3CA 3I4KA 4Z1BA 1LBLA 2F9RA 3QGVA 1OT2A 4OVXA 4ONVA 3LCFA 4PBFA 3LI1A 1DJNA 2WMHA 2UWFA 2ZFAA 2P53A 1R9YA 2PZNA 3FIGA 2H3BA 2CW6A 2H9AB 3QGKC 1CXLA 4D6GA 2VC5A 1JF6A 3EMQA 2Z2BA 3W86A 4TX8A 2NQJA 4KIEA 2V3GA 4O13A 2C1GA 3I6RA 2J7GA 4M81A 4HPXA 3WJWA 1K4GA 4ZE5A 3TW6A 7CGTA 4HMCA 3EDEA 3VD7A 4KERA 3BL3A 4PFHA 1I4NA 4EVZA 3W72A 3BW2A 1EO7A 2VQUA 4KWOA 3O07A 2QVHA 1H61A 2YDRA 3H70A 1UB3A 1G4TA 4A8LA 5DN1A 2XIQA 2PRHA 1EH9A 1BYCA 2MNRA 3URBA 3IVSA 3AWNA 2XTKA 1U5JA 4DUOA 3B8IA 1FWJC 1EYWA 1F3TA 1OG6A 1VQTA 2VZVA 3QRHA 3KVMA 4H9UA 4LC6A 3GVWA 4R7OA 3QVQA 5EMMA 3CPRA 3PS7A 3W7KA 5CG0A 4D1JA 3FEMA 3TEVA 4O0KA 4XZLX 3AMLA 2DT1A 2OKOA 1BPLB 3VFCA 4NKCA 2PB1A 2DZUA 3SCOA 3RPDA 1A4LA 3KDOA 1XBYA 2DH3A 1B4KA 2OEMA 2V5JA 1OT1A 4PCTA 3PNUA 2ISFA 1U1JA 2PTYA 1XDLA 4Q32A 3OO2A 3WNKA 1XF0A 3GDKA 1BQCA 2B0MA 3LCHA 1S5NA 2QV4A 3BCJA 4LBSA 1G5AA 3BGGA 4Y96A 2WWDA 2PP1A 3R25A 5F4SA 1JI1A 2O9PA 2OLHA 2WJZA 3PBWA 3AIUA 3UA4A 3QKEA 3W2NA 3CTLA 2Q8XA 3AYTA 1TE6A 5C7VA 4MOZA 5E5CA 1EIBA 2I5QA 3O6DA 4FF7A 3W88A 4Q4SA 1CEOA 3PFRA 3L5AA 5XIMA 4V27A 2P1FA 2O9OA 2O56A 3CWNA 1ZAHA 1V3KA 4WQ6A 3N29A 2J7CA 1AK5A 1WO2A 3ANYA 3C8NA 1FXQA 1ZBCA 3R89A 1F07A 4AEFA 2HVOA 4RZ6A 1K03A 4FNQA 3EKGA 4UTTA 4GKTA 3B0YA 5GJPA 1US2A 2OQYA 2QJNA 3XIMA 3KRUA 4ZQNA 4XV0A 5CC5A 2O9TA 1ML1A 3GG8A 1TKKA 4AFYA 5CXPA 3Q45A 2IUZA 1R87A 2A1YA 4ATWA 1IXOA 1I0BA 3V4BA 4WKFA 1D8CA 4L1GA 2ACSA 1S5MA 1AJ0A 2PDQA 3LCIA 5KZ6A 1C8VA 1KXHA 1EKOA 2GDUA 2CITA 3APGA 2J7FA 2F84A 1QBAA 2V82A 1EUAA 5IDIA 3DZ1A 2QKFA 3ZLGA 2D2HA 3HJEA 4MPKA 3BLEA 4JCMA 1XH0A 1Y8BA 2P0OA 3FAWA 3V3WA 1QNVA 2CLMA 1L9WA 2QQ6A 5ABFB 1YNYA 3C5QA 2E77A 1NH6A 3VOGA 3LBMA 2HXTA 4GLEA 1XUZA 4GRSA 4OBSA 4AEOA 3TLLA 4ZOAA 1DQXA 5CPSA 4CEXC 3HU7A 1ISXA 4W86A 2RFGA 3B9OA 4ES4A 1EBGA 1GOIA 2KX9A 1DWHM 1OVDA 3QC3A 5M2FX 2X1SA 3QW3A 4IMCA 2OEKA 3CLMA 5LSMA 4I7UA 1R85A 3ID7A 2AQOA 3W1UA 1VIZA 4AVNA 1TV3A 1W8GA 3C56A 4ZO6A 1UWIA 4HNNA 3EWZA 5BXPA 2WQPA 4IM4A 1B57A 3QR1A 2FMNA 1AVAA 1NQ6A 3E1F1 4DRSA 4YCPA 2W91A 4ZZ9A 1C92A 1E15A 3SIMA 1W5MA 3QV8A 2WMFA 2PODA 2V2HA 1O4UA 4E2VA 3LM3A 1JL8A 4W8LA 4G1KA 5HR7A 3OHMB 2YYUA 4ZO9A 4WDUA 2VFGA 4GCAA 2C71A 1WE5A 4AF0B 2Y24A 3WO8A 4UBPC 5HUOA 4DJDA 5DLCA 3ABZA 3MDUA 1E5JA 3RUBL 3FV9A 2YB1A 4GI6A 1O1HA 4WSKA 3KP1A 4J9JA 5GNYA 2VZOA 1WYIA 2XM1A 1WDWA 5LIUX 2WSQA 3F4CA 3V1HA 3SUWA 3C0QA 3CUGA 5LZLA 1J12A 3ZLFA 3MYOA 4IICA 3VD4A 1F73A 3MU7A 4IHCA 3FA3A 4Q8UA 1RJPA 2VTFA 3CL8A 3M44A 3BPWA 2ZUMA 1DE5A 2WVSA 3AJXA 3CAKA 5REQA 3B9EA 1UWSA 2GGIA 4K39A 3WQPA 1RBOB 3GIQA 3MV11 3OP2A 4HIBA 4EACA 3NQ7A 4J3UA 4REQB 1F8MA 3GM8A 3E02A 4LJ3A 5LGXA 4XSLA 1WA3A 3G0XA 1GOXA 4CVWA 2R91A 4NI3A 3PSWA 2INFA 4DJEC 3FGCB 4I5UA 1RK5A 4XD6A 4HMDA 1ONEA 4A2RA 2WJFA 1VCFA 1BTCA 1OGGA 1FX6A 3T0CA 3LK6A 1V7YA 5LGZA 1KFCA 2E7FA 1DWAM 3EKZA 2QCDA 4LS1A 3IPWA 3WUBA 4HJWA 2QHAA 3W4RA 3LMYA 4ZB0A 3RFAA 4UWMA 1CGWA 4B5XA 1A0DA 4GXWA 4AZIA 5A8QA 3VIJA 4FPSA 1G6CA 1RQBA 5BOOA 1KW1A 1R3RA 3W7DA 4HD5A 2VURA 4JFTA 1G1YA 4H3DA 4UCFA 1QW8A 3G1YA 1E0VA 3G18A 4DUVA 3GAYA 1ZCCA 4LAMA 3KBSA 1TCMA 2JQXA 3S9ZA 4AD5A 3NYDA 1N7KA 5J8LA 1HL8A 1Z69A 4JBRA 4JIRA 1Z48A 1S2WA 3TOPA 1JFHA 3PAOA 1ZGDA 3WF1A 3CNYA 2WZEA 3N12A 5H6HA 3W74A 3T81A 2CZVA 1BYDA 2RAGA 4WRHA 2QT3A 3VDHA 5AYYA 4LAUA 1LL7A 1TREA 5I07A 5EY5A 3VNIA 3CAQA 2Y0FA 1HO1A 2J78A 5D37A 3GHSA 4JQ4A 4M7TA 1AZ2A 1DOSA 4M6PA 1GOMA 3AFBA 2P8CA 1LZOA 3U48A 4AD1A 2ZRVA 4TUFA 3PY2A 1X6NA 1E1FA 5T9BG 3NL5A 4HJFA 3OLIA 4MNKA 4FNUA 3D5HA 1PAMA 2VHLA 3KOFA 4PN2A 1EOKA 1GWJA 4LBUA 2OGYA 3FYYA 1UD6A 4XZIA 2C1HA 2ABAA 1AJ2A 2QCLA 2QCNA 2YFNA 5JQ9A 4QLJA 1KLZA 3KS5A 2WXDM 3TC3A 3BAXA 1F6YA 4PMZA 3R13A 5G4HC 3QC0A 1F76A 3E2QA 3WDHA 3ARPA 2X41A 3WG6A 2WSPA 2NVCA 3WUGA 3WBEA 4N0RA 4DELA 4CNOA 3WYZA 2CKSA 1EIXA 2WJEA 3WK3A 4C6CA 2A3LA 3EWYA 3QF0A 1KXQA 4N9DA 1UMLA 3IRSA 2X2GA 1HKJA 3TWAA 2YCLB 3H2OA 3UPBA 1P6BA 3CM4A 3T07A 5DMMA 3HOJA 4LVBA 4V15A 2OVLA 4BQ3A 1NP0A 1XLHA 1HL2A 3G1VA 1JZ3A 2YXGA 3MV01 4MY9A 4IIGA 3VX1A 3HF3A 3UA3A 3TYBA 4OV9A 5EL1A 3WIJA 1W3TA 2QJJA 2FZMA 3SCUA 2QCMA 4YTRA 4RZ4A 3BJSA 2PTDA 4HHPA 2OO6A 3CQHA 4JTJA 2HK1A 3QW4B 2FFCA 3L4YA 5FI8A 4ZB2A 1TMHA 3R79A 3GW0A 4KCWA 1JPKA 2B7OA 4H9MA 3PM6A 3R1ZA 3OLGA 4O1CA 3UWZA 3ATYA 1TZ9A 3GVGA 4WVXA 5FEPA 3SCWA 1VENA 3PN8A 5HWMA 3M0VA 1WBJA 3VM5A 3UZYA 5KTLA 4AEEA 4KGLA 3PPFA 4C7DA 1ELSA 1WKYA 5AHMA 2O9RA 5FF0A 3EPNA 3EPOA 3TKFA 1CIUA 3B8TA 3CV6A 1IYXA 1Q13A 4XKYA 4NZFA 2Z27A 1UP0A 2B7PA 3QBUA 3L2IA 1KBIA 5C55A 3FX4A 3PPHA 2OT1A 1YDVA 4UFIA 3PG9A 2FB2A 4GI9A 2BSLA 4YTUA 2DSWA 1JULA 1E0XA 1KTBA 1US0A 5DXXA 3RDKA 3BOXA 2CCRA 1YNQA 3D6NA 3VKCA 3H4XA 4DYKA 1JZ2A 5FKYA 1W1A1 3G1DA 2E67A 3AMKA 2Y62A 4GA8A 1UWRA 4D1IA 3UBPC 3T6CA 5CZTA 3PZUA 3ITYA 2PDNA 3B0UX 4M7SA 2EXOA 3HQOA 4DO4A 3CV2A 3EWUA 4H00A 3W83A 4HPJA 5D2TA 1FWTA 4CU8A 2GQ3A 1DJIA 2PDLA 3BSMA 1KWKA 4U28A 1ZBKA 1NELA 3K13A 4Z0JA 2VJXA 2TYSA 1H4PA 2OELA 4JS3A 1A53A 2AMXA 3U2EA 5JH2A 3NCOA 4QDPA 3WQEA 5HXMA 4BF9A 5IBXA 2QULA 4HQVA 3H7VA 1F6PA 1P0EA 2YBTA 4ZB5A 1V3MA 5D9MA 2VDHA 5EMYA 4DLFA 1BVZA 4TTUA 4F79A 3MANA 1GJPA 1F7BA 3FCPA 1R9ZA 4C6QA 4PUJA 5GQBA 1XL9A 3FY1A 3PTKA 4Y2WA 3LNPA 3W7QA 1QI4A 1GVSA 3NL3A 1TWDA 1FP8A 2QMJA 3IIPA 4W7VA 5AY7A 4MG4A 1K70A 3AU6A 5IHRA 4AZ7A 1RUSA 5CZSA 1N8WA 4J3WA 2EG7A 1MW1A 4IMGA 4I5XA 4ZFCA 4Y7EA 1U2YA 3FK4A 4DZAA 1EBHA 4PB4A 2YXOA 3BMWA 4GQQA 4JTUA 1YNPA 2QDGA 2Y5SA 5ECVA 1LQ0A 5FD0A 1WXYA 4QCFA 2ZUUA 1J5TA 1D7KA 4D6DA 1LRTA 3CIXA 3AIVA 4PMXA 3N3TA 2DEPA 1TIWA 1DXFA 1GHSA 4HYVA 3V18A 5G2HA 3U2CA 1XHGA 1FDJA 2PMQA 1JD9A 4ORIA 1O5XA 2AGTA 1UIPA 2YCIX 1CNVA 4LAOA 3U9IA 1H51A 3AXIA 2BOFX 3G3MA 4D6EA 4LYQA 1K8YA 2QXWA 1UKQA 3CHEA 4KFNA 4D8ZA 2QMKA 3FYPA 2PBOA 3FAXA 3HMCA 1EZ2A 3M9YA 2PDIA 5DEZA 5K4ZA 4FIRA 1XYZA 2VRJA 1V0NA 2L5HA 2VRKA 4V33A 1IEXA 3MSRA 1JAKA 3MZNA 2VKZG 3TOYA 4PTVA 8XIMA 2H3DA 1RVGA 1JI2A 3WD4A 3SADA 1V6YA 4PTNA 4FX8A 3MI2A 3NR0A 3E6EA 1R3YA 2FQIA 1HNYA 3TW9A 1EJ7L 3CZEA 4CN1A 2OU4A 2DORA 3EDJA 3OPSA 1KXVA 2EPHA 3ES7A 4GGHA 1W54A 3LHUA 1JXKA 4GUGA 1QR7A 2EAWA 4S3KA 3APYA 4L6DA 4IPNB 3WUFA 1XQKA 5HMFA 3W81A 2X7VA 1I6NA 1XLMA 2WHLA 3LQGA 4GUJA 3WDQA 3DG3A 7PTDA 4LRSA 1CX9A 4ENLA 4E3TA 1FCBA 1SZFA 1A4MA 1WZKA 5LNWA 5G4EA 4P7RA 1F3WA 1X8CA 3G24A 2DT0A 3TDFA 2A85A 3ZR4A 6CGTA 1WAWA 4KESA 5FEXA 1QBBA 3M0YA 4PMNA 4AXNA 4IQDA 5F4WA 3CK5A 4MWAC 1FHUA 1GJUA 2FGBA 3ZZ1A 4W9TA 2GQ8A 3BMXA 4RNJA 3SSJA 1KFBA 3NEHA 1DJQA 1AQ0A 3UY8A 1GQKA 3RRAA 1TPDA 1JZ6A 4CNUA 3GG0A 2VDIA 3DENA 3VABA 3KHDA 2ZRZA 2P3ZA 4PUDA 5MKGB 1R0MA 4O8AA 3NPUA 1NU5A 5TBOA 1JCXA 4JTEA 3UNTA 1FHDA 5EBAA 2PFHA 4GVGA 3U7BA 3EYPA 3F5JA 4YVVA 2NSOA 4HN4A 1K02A 3DHDA 3GVVA 3L4WA 4QQUA 4MPQA 2BS9A 1KGUA 4RNFA 2FZ9A 2HPMA 3OA3A 4FA3A 4GQGA 1PKLA 2ACQA 4RJEA 4BI7A 1VBUA 4HVXA 3KRZA 3N14A 4NASA 1VC4A 4HCHA 1OK4A 3Q37A 3WD3A 2Q8LA 2ACRA 1KFEA 1PIFA 5CZKA 3ORWA 1LP6A 4NZ4A 4K8GA 3R5EA 2NV1A 2Y4SA 2REQA 2BOGX 3RCYA 1UJQA 1LT8A 4O14A 3E2SA 3HM7A 3MZ2A 5IFPA 4H6KA 3EB2A 3UXLA 1PDZA 3AS3A 1Y7VA 4TOQA 3N04A 4NZJA 4O12A 2JALA 4MFDA 1CXKA 4P7OA 2ZX7A 2V69A 4R3UA 3UG5A 2QDDA 2O4QA 2X05A 1UW9A 3SRKA 4OTKA 1W1IE 3ITGA 1RLCL 2VZSA 3P2VA 3W73A 4YTQA 4WY0B 1OF6A 4MKSA 3WMSA 3O7UA 3FVMA 3WKZA 4CN4A 4WF7A 1IQ8A 1YXYA 2WYSA 2BP1A 3IRDA 1X1ZA 2V38A 3VNZA 5C54A 1I8JA 1IR1A 5A8NA 2ACUA 3LGEA 4UMBA 3LTSA 1XQLA 4E2BA 1SW3A 3RN6A 4NNCA 2VR2A 4WGXA 2PCQA 4M5PA 3ITLA 2XU2A 4WHBA 1NVMA 3S9IA 2FFIA 1XIHA 4A29A 5AZ1A 4GZJA 1GQJA 1UKOA 1Z32X 3GC4A 3ME3A 4O53A 3K2GA 2WC3A 1TWWA 1KM3A 1LOSA 4UTHA 3N1AA 2BWGA 1JNDA 3HGRA 3WH5A 4TTGA 3STFA 4S3JA 1XG4A 2EPOA 3H2EA 4QNWA 5D09A 4BHYA 4DPPA 1BWVA 4UTJA 3W26A 1CXIA 1MVYA 2W4XA 3TNOA 3H2AA 4HA1A 1TJ0A 3W23A 4JPGA 4LCQA 3LCLA 3GBDA 3PR2A 3ALFA 1LF1A 3POCA 4Y8EA 3M46A 3R43A 1KRBC 4MJZA 2NUXA 1HJQA 2NVDA 4LWWA 1EGMA 2INEA 3ITVA 2E8YA 2RJGA 2VR5A 2INZA 3RNDA 4S2CA 2D24A 1V3LA 2OOGA 4IISA 1YX1A 3VC5A 4AY7A 4FNSA 2WSRA 5E93A 2XIBA 4NZ5A 3TTSA 3C86A 4H6EA 1XLBA 2VWTA 3L4TA 1XBZA 5IHSA 3GC5A 2O55A 3SUUA 3RR4A 1NDWA 2FPTA 5XIAA 5DRCA 3EX3A 1PZ0A 2HV5A 1OIFA 1AH3A 1MEHA 5BMWA 2RDWA 5HUPA 1DKWA 1A5LC 2OB3A 1W31A 1B30A 1J79A 1UQZA 1P4CA 2CBUA 2E1WA 3IJ6A 1PPIA 3W22A 2QCEA 2JKPA 4RV3A 4B9YA 1H7RA 1NWSA 2H9AA 1A5NC 2GJNA 4KRTA 3KOYA 2IPWA 3ARXA 4ZCWA 4HNVA 3W9ZA 1W2VA 1P0BA 4R5EA 4U3AA 4EPKA 5FAJA 1ENUA 3KWXA 3CZLA 3THQA 4UTKA 3TR2A 2VFDA 3FDKA 4OFCA 5AC8A 3BTNA 3CV1A 3FOKA 1J2BA 3KRSA 1MZRA 3RG6A 1FWHC 4I8DA 5BCAA 5CSSA 1UQYA 3STPA 2AQWA 1UOZA 1LCOA 1XSKA 1OG0A 1XG3A 2BOEX 4RE3A 1TWIA 1JD7A 3O9NA 1PS9A 2W0UA 4UQCA 3OVGA 4DWSA 4NYYA 3TIMA 1PWLA 2EGZA 3NQEA 3WLQA 2PURA 2YDQA 4IFKA 3INPA 4XVDA 4IOTA 4IJRA 3QPZA 4AIBA 3VKDA 4EK7A 3MI6A 3R2GA 4CCZA 4DZIA 2PDJA 2WM0A 4X0VA 3V35A 5LA0A 1S2CA 4JFWA 1E73M 1AFSA 3M1ZA 3Q58A 3RLUA 1HKWA 2VCCA 1H50A 3SEPA 2Z6IA 5DMYA 3L12A 3PF3A 2WO5A 4P61A 1REQB 1OY0A 2XH4A 4QGCA 4AMCA 4O57A 5A6BA 4UNIA 2PTXA 2ZC1A 3QLDA 2F2HA 2ZWZA 4O11A 2OSYA 3NPWA 4R7WA 1PHQA 2O92A 1CXEA 3QY8A 3JW7A 1E0TA 3WDJA 4LNYA 3KE0A 5HPCA 3CYVA 1U33A 2POTA 1J93A 3G3DA 3CEUA 3NXLA 4DF0A 3TTQA 1J0HA 3EMZA 3I7QA 3SCPA 4HPGA 5L6UA 3SCNA 3P81A 3W01A 4MUZA 3VM7A 3ZYZA 1QT1A 4JDYA 4H8VA 2NX3A 5F2GA 1F61A 1GW1A 1AMKA 4Y9NA 3H54A 5K2ZA 5A8OA 3WEZA 4ZTXA 2NWSA 5E6ZA 3WBWA 3TLQA 1LYXA 5H8PA 4QE1A 3UG4A 4CD7A 1EPVA 2V2CA 3LD5A 3R11A 4TO8A 2Q71A 4NZ1A 1FWNA 2HPIA 3UNDA 2V68A 1SFLA 5AC5A 1HN1A 3UXIA 2PU0A 1G7VA 3E2RA 4S1FA 2Y5JA 1HJSA 3R8RA 1O68A 3O15A 4CVUA 1R3WA 3RM9A 3LTPA 3O6YX 3MKCA 1JQXA 2C3ZA 3B9NA 1ZPTA 2Z1WA 2BY1A 2BVWA 4UOZA 4JQ2A 3KUMA 3QR3A 2XHYA 4DJED 4YVXA 4GKLA 1DP0A 4GI8A 3RILA 3BLIA 1X97A 5DRIA 1MYRA 1SW0A 3S6OA 1BAGA 4DF1A 1OF8A 3FW6A 4U5KA 6ALDA 1B4EA 4PRRA 2Q6ZA 2R1KA 3RX3A 4C65A 1YDOA 4EXBA 1WCGA 4LY4A 4AUBA 1NTHA 5LKYA 2J7HA 4EXQA 3G0SA 2FZBA 1XCFA 2V5LA 1W5NA 4IT1A 1R46A 4PMRA 3VAVA 2NLYA 4NX5A 3GXPA 3VOIA 5A6LA 3WLRA 3T0AA 1I2NA 1KM1A 2HNHA 2Q8ZA 2Z29A 3KXQA 2J9XA 1GOKA 1QHOA 2PSNA 3XISA 3VMOA 1RBAA 2YCKX 3CUHA 1YTKA 3LPOA 1J10A 3URQA 1EL3A 1E9LA 2PC4A 1ITXA 3LCWA 4IIBA 2CZDA 1KB3A 3W7PA 4UFJA 4PYSA 3DBNA 4CQAA 3LLFA 3IUDA 1FY6A 1JYVA 2EPLX 3BLFA 1GVRA 4GFSA 3T09A 3NQDA 3COTA 3WN6A 4GISA 3WLPA 3E3HA 3NTYA 1ZB5A 3HJZA 1Q7QA 1ZALA 2Z1BA 1H1NA 4X22A 4CQ9A 3ZJKA 1EPXA 3DKLA 4B16A 2GDVA 3VZYA 1EEPA 1OD8A 3G77A 1C29A 4DPQA 1TTJA 1M7PA 3BLKA 3BGAA 3WQDA 2QNEA 1E9IA 4C91A 3C4UA 1UR1A 4JN8A 2OSXA 5JH1A 4Q8MA 1QRQA 5G4WA 4OJYA 1S2UA 2W79A 4H19A 1XDJA 4GNJA 4TQTA 1B3VA 3VIHA 3P14A 1MWOA 4ACYA 3T0TA 3LHWA 4XSMA 3DYPA 2CERA 1E0WA 1VAHA 3NDYA 1UUMA 3LU2A 1IWAA 3MWAA 4RL3A 4DO7A 3ZT5A 1MRQA 3VIIA 3F7JA 3VTRA 3O1NA 4W85A 3SY1A 1WB0A 4M6VA 2A5HA 4O4VA 3CUFA 3SURA 3R58A 5LIWX 3L4XA 4C7FA 1UCWA 1KCLA 3S83A 4S3FA 3GG1A 4B92A 2QF8A 5FEZA 3BUVA 3A4WA 5JBFA 4ZL1A 2D2GA 4ROPA 3AROA 4W93A 4BQ2A 5FF2A 1YPXA 3WDRA 5EKYA 2VEPA 1NFPA 1IGWA 4I6KA 4PODA 1XYCA 3MA8A 5EGRA 3C2OA 4REQA 1KGWA 2YZRA 2HZGA 4GYJA 2Q3RA 1G9HA 2I57A 4IMFA 3ARQA 3L9CA 1AQFA 1XGZA 5HBFA 3C6CA 2X8RA 3T7VA 3WLIA 2B7QA 4UQAA 2GJPA 2IPJA 3NEVA 3S4TA 3QEZA 4C6EA 1JUKA 4XD5A 5AKQA 5GJMA 4DJDC 3W7CA 5CH9A 3IIOA 3APTA 1PX3A 2NUWA 1H3GA 4WGHA 4ATDA 3OW1A 3OBEA 1E4MM 3S47A 4AIOA 4FXRA 4FP1A 4KMQA 3HN3A 2WMGA 3FKKA 1NIUA 3V5FA 4QLKA 3A5FA 3QXBA 2HJPA 1MNZA 3OTRA 1R2TA 4M8UA 4R9XA 1UWTA 3SUTA 1TB3A 3LXBA 1FWEC 3EBVA 1F8IA 4K8EA 4KKXA 2DUAA 3K8KA 2JKEA 5H1WA 4IXHA 1VEMA 4GUHA 2J7BA 5SWUA 1H5YA 3G1FA 3ZFHA 1BTMA 3CT7A 4IIHA 1Z7AA 4ZEPA 1GOQA 1LG1A 1HW6A 2NT1A 3B04A 4ZSUA 1UR8A 1GYMA 2DQXA 3L66A 2I1OA 1RR2A 1DQUA 3BZGA 1R86A 3FA4A 4M0XA 3HB9A 2DSZA 3AMCA 3VINA 3LG3A 2CWNA 3A47A 2DV0A 2PCEA 2V5DA 3A3WA 3I7RA 1EFZA 4LNCA 3LN3A 2CYGA 1K3UA 1PV8A 5HATA 3M0KA 3LRKA 3T2PA 5HAOA 3MKVA 4IQEA 1OFAA 1FOBA 3HFYA 3PFMA 1ICQA 3WEOA 2J8FA 2JGQA 4HNUA 1EC9A 3MP3A 2DZAA 3CLWA 1B0IA 4FOUA 4E0CA 3GR7A 1P0KA 3C0LA 1UASA 2HEJA 4KPLA 1QPKA 4DHGA 4TVCA 3MHFA 1T6MA 1ISWA 1SFSA 3EKLA 4ERGA 1OBAA 2QUNA 4MB4A 2XWDA 3VDGA 2ODOA 2EF9A 5D02A 1X7IA 2ZA3A 2ONEA 2AKZA 2F2KA 3MUY1 3VU2A 3UF9A 1JIBA 4J5NA 1AL7A 3BQ6A 2V5CA 4GYKA 3L5LA 4QE5A 3CASA 4EOUA 5C2CA 4CNTA 3W1QA 1ZTVA 3GVRA 1UJPA 1EX1A 1UPMB 3B0PA 1P0DA 2ALDA 1G94A 4DJEA 3GYCA 1WDSA 1G01A 3PVFA 1P0NA 4WEVX 1TV5A 3ZWSA 4W89A 3LPGA 2ZRWA 4KWSA 1TJ1A 1S5VA 4XZNX 3W38A 4H41A 3IARA 3LRMA 4RXGA 4AG0A 6TIMA 4PUNA 3LI0A 2V3DA 3WNOA 4MGGA 3V0UA 1Q2SA 4R34A 1SYTA 3GC2A 4QLLA 1CLXA 1CDGA 3M0LA 5BYWA 3I3DA 2DIEA 1P7TA 3NIYA 4QHRA 1XXXA 1H1YA 2G41A 3T2OA 1EF3A 2PWVA 2XFRA 3NQ2A 2X40A 3GH7A 4CLMA 1SSDA 1D8WA 2IQ0A 4J35A 1PO9A 1ZZMA 4XWUA 4C6PA 4BWLC 3S5OA 3W27A 2WQDA 4PTDA 4QE4A 3TH6A 1FBAA 1XC4A 4H2HA 3P5ZA 1EP3A 3B8SA 5A1AA 5REQB 3P3BA 1EGZA 2PTWA 4IWWA 1BRLA 2YSWA 5DANA 4UC5A 1W1TA 1FWSA 3AISA 2OZ3A 5EBUA 3S5SA 3ARZA 5H2ZA 7TAAA 2WJDA 1V7AA 5HNUA 1GQLA 5HA7A 2XWEA 4HMNA 4KCTA 1VRXA 3F4DA 3FSTA 2C6QA 2D69A 2OR2A 1ZHAA 3MCNA 1AW1A 1M03A 4FAMA 4NIRA 1XRVA 4CQ8A 2J47A 5GNZA 1FKXA 1GOOA 3BICA 2FVMA 3B9AA 1L6SA 5FJJA 1R2RA 3BARA 3F03K 1TWZA 1TV8A 4K1WA 2Y70A 3MO4A 1VFUA 4H8HA 3IWPA 3M0HA 1NY1A 4WZHA 1K1DA 4JQ3A 5F2MA 1XCXA 4IF2A 2J77A 3UU0A 3B9DA 2EEXA 3NO5A 2OQHA 2YFOA 3HZ3A 3K4AA 5IXEA 3S6DA 4DI8A 1KFJA 4L4MA 1IE7C 1OK6A 2NSXA 2YOCA 5D9NA 4LBRA 1ZJHA 2X0HA 3T40A 1JPIA 3PUDA 4EKJA 3A24A 2HDJA 4QCEA 4B5UA 4S3DA 4CNPA 2GJLA 2RGMA 3VMPA 1Q66A 4GIEA 3UZWA 1Q6EA 1QXLA 3HIJA 4Q8QA 1DEDA 4JIHA 1KKOA 2VC7A 3AALA 3MB9A 4YXGA 2Z7GA 1ITCA 4W5ZA 3KL5A 4LPCA 1VBHA 5LIXX 1XFCA 2VFIA 4P2VA 2C14A 3DU0A 2ZQ0A 5HPOA 3W7MA 3GDBA 3DFPA 3VFLA 1CECA 1SZRA 2FVLA 2TODA 2A6LA 3C2FA 1YTEA 4G8TA 1A47A 4TVUA 2X0SA 3WQ6A 4A3RA 3R4IA 4DIAA 3OG2A 1POJA 1BG4A 1EQPA 1K8CA 3WQ5A 3VGDA 1FUYA 2D3NA 1FQ0A 1Q6LA 5D8WA 4PCPA 4BZYA 4IXXA 5CZJA 3C2RA 4GINA 3MBDA 5DCBA 2OSWA 3CAWA 4MWAD 3WFZA 2VX7A 1V6TA 4ZA0A 1SUXA 5EMKA 4D6HA 1XINA 3WELA 2YW3A 3E74A 1RP9A 1TVLA 4GQRA 1SMAA 1A5OC 2A3HA 3AXKA 2XZ9A 4AY1A 2YA1A 2JF7A 3W37A 3N6HA 1VIWA 3VZXA 4JEQA 3W02A 3L21A 4FOJA 1CGVA 4XAGA 1JDFA 3MMDA 2BY0A 4R7JA 7XIMA 4PH6A 5FJIA 4PBGA 1MW0A 1SSGA 4G56A 3WJZA 1ALDA 3OHIA 1RJRA 4JOMA 4B5SA 3QYSA 1KM0A 1PVNA 2PDMA 3F2CA 2YIHA 2R1PA 3OJGA 4ILSA 3KVJA 2Y7FA 4D71A 2J9ZA 2Y6ZA 1JYXA 3A3HA 1U1HA 4P7LA 4XD4A 4H9XA 4UFKA 4ZODA 2IKGA 3V16A 1JCTA 3OIXA 4UXDA 4JTSA 1XI3A 4HOZA 3AIEA 1J96A 1TCDA 1SFTA 4S2BA 3IGSA 3LBOA 5A8MA 1J4EA 1Q63A 5DFAA 3R10A 1VRDA 4KWWA 4ZBCA 5E9XA 4MZ8A 2ZDSA 2GJRA 3WF2A 1ZBVA 5G1YA 1S1PA 1UWUA 3QV9A 1NOFA 1MSSA 4XAFA 5C9XA 1EEXA 3CHFA 4G6CA 4LFYA 3N9KA 3AXXA 5AYBA 3BE7A 3W7NA 2JGYA 1AH4A 3M7WA 4QQ3A 3CUJA 3TQKA 4C1NA 4DJFC 3PWGA 2J62A 4PMVA 1V0LA 5K9XA 4P8VA 3QN3A 2XFYA 2VXNA 4ZQRA 1X1OA 3EA2A 1EJTC 1W3NA 4HOWA 3W2MA 3A4XA 4OIFA 1JEZA 2CXGA 4WIWA 1F6KA 3TQPA 4JIPA 3NOEA 2JFEX 1C9WA 4O0QA 3O05A 2OX4A 3EX2A 4HCDA 4IGMA 2A3EA 3R0UA 2YL8A 2QCGA 4K68A 1B1YA 3GU9A 4E4UA 1VFLA 3AXHA 1BQGA 1DTNA 4LC8A 3CO8A 3PULA 3GLCA 4P7NA 4O0ZA 3SCQA 1NDZA 4IQLA 2VX4A 4MVAA 2WNNA 4A21A 3H4WA 4GX9A 5I3IA 1ZFJA 2PGWA 1GVYA 2J4GA 3KLKA 2IW0A 5FA5A 4IUGA 4S3AA 1KCKA 3CQJA 4EIVA 3W7EA 1PBGA 4CEUC 3TFXA 2CBVA 2ZC8A 1AMYA 3BG5A 1BXCA 2XIOA 3VCRA 5JBDA 5MKGA 1HIZA 3SN4A 3L0GA 3M41A 1RCQA 3MWCA 3CC1A 4FZIA 3GFZA 1KBJA 1YW1A 4PBEA 4IGSA 2J88A 4G5DA 3NZRA 3F5LA 1Q6FA 3NA8A 1WZAA 5A6TC 3MDWA 1VHNA 3PJXA 5I6SA 4MNLA 5KZMA 1Q6DA 2EG8A 2RUSA 4GMEA 5AB3A 1O1ZA 4ZTYA 1WBHA 3M0IA 1TQJA 3FHQA 3S2LA 3GR4A 3TTOA 4HZ7A 2QV5A 4WDWA 3ABXA 1XKYA 2FH8A 3IANA 1VFMA 3VIMA 4O1FA 1WDQA 5D9PA 3KRBA 3U4FA 2YKKA 4ZFMA 4DBEA 3UD6A 3SN1A 1WOBA 4HB7A 3DN5A 4O8RA 3REQA 4LVAA 2TAAA 1HF6A 1MO0A 1TRIA 2XH7A 1NQKA 5ECUA 3CIWA 2FJKA 3NQVA 3HO8A 4IFOA 1YE6A 4UIOA 3BLLA 4U10A 5TF0A 3PSVA 1QO2A 3TVAA 5AOUA 2WWCA 4US5D 4ZGYA 2QAPA 2YA2A 4KIRA 1YIXA 1KR0A 3GXTA 3UR8A 3L0NA 2BTMA 2V67A 2WBKA 3QJAA 3B06A 4IX2A 1Y0EA 4ERIA 2Z24A 2C18A 1RA0A 3M16A 2YDSA 4QP0A 3ZT6A 4GVFA 4F8XA 3DERA 4RV8A 3W24A 3MYPA 5DCDA 4DBDA 2NX1A 1QVBA 3V1PA 4INFA 2XVNA 3PNZA 4JN7A 4MWAA 4GE8A 4KGJA 1JUEA 3IVUA 1JCMP 4HNCA 4NYUA 2J7EA 3THDA 1XPGA 3U2ZA 1C91A 1XLJA 2FMOA 5AYXA 4ZQPA 4W87A 3AIBA 1TZ7A 3LXCA 1E71M 3GK0A 2BG5A 3WH9A 3UZ5A 3SRFA 4PEEA 2VEGA 1QWKA 1A5UA 5H91A 5CJ5A 3VYLA 1H11A 2QIIA 1FWRA 4DLMA 4X9YA 1J0ZA 2YX0A 3KVKA 3SN0A 1PKNA 2RDTA 5CZ0A 3TTYA 4XG1A 3SUVA 1KV5A 4QAWA 1XLCA 1XM3A 3CUIA 4I8YA 1SVDA 2G3FA 3KOZA 4Q7IA 5C9WA 3NQFA 1EHAA 1Q4NX 1V6UA 1OSEA 1JPDX 1LRNA 3QMTA 2DZPA 2G97A 4OE7A 3PAJA 1W1ZA 3IIZA 1L6GA 2A7NA 3FJ6A 1MZHA 2AQVA 2E4TA 4O1DA 3HBLA 1OC6A 2HCVA 4K6AA 3UYIA 1OCJA 4IUOA 3LBCA 2IKIA 3SSZA 3U5UA 3FDGA 4HZ6A 4JIEA 4GO9A 4HN8A 4O16A 1RXOB 2A0NA 3JZEA 1TPUA 1HJVA 2V81A 1R7AA 5L9FA 5I24A 1NWRA 3FJ4A 2PWFA 1H1ZA 3DX5A 1PZ3A 3BVJA 2ASHA 2PWEA 1HJXA 1JRCA 4G7FA 3KBVA 2DZWA 3MUZ1 4WKHA 3EX6A 3I6TA 4L4OA 2QIWA 1TYGA 3QGAC 4J2MA 3RXZA 1A0EA 5ABTA 1MRAA 1TG7A 2VL4A 1KRCC 1GVQA 5HNTA 4LT9A 4Y9AA 1EDGA 5DY3A 2NQZA 3VIOA 1NAL1 2R24A 3KX6A 3W00A 3TZFA 1ITUA 2E6YA 4MIMA 5C0QA 3DUGA 3UERA 4YWSA 1HZYA 3OA5A 4XIAA 1QK0A 1EJUC 1JNEA 1ZLPA 2RH9A 3W2UA 2NQ9A 4WDXA 1KV8A 2G37A 2IS7A 1AZ1A 3E0IA 3MW7A 4RR4A 3GU2A 1MUWA 3TA9A 5M03A 4GJ1A 1Z9AA 4K2SA 2PWDA 2REQB 3LHZA 3RLVA 3KEHA 1B3XA 3HQ1A 4UTFA 3DGRA 3W29A 4GQ0A 2NXIA 1UG6A 4CNNA 4H01A 3NXFA 4CU7A 3AYVA 3OB8A 1TV7A 4GK8A 2Z26A 5CLTA 2PWGA 1KFWA 3CYJA 1VGAA 1HKIA 4AISA 1MUMA 3GHRA 3CEPA 3WLTA 4JR5A 1KM6A 4NF7A 1JQVA 3LHVA 2WZMA 2DVUA 3BSHA 3EX1A 3S5YA 1W5OA 2WHKA 1US3A 3PZVA 4Q8OA 5A69A 3CT2A 2GLKA 4R85A 4JNMA 3F2BA 2VELA 4P5UA 1UZDA 3OVPA 3W71A 1OINA 3I7SA 3A13A 3CMGA 4I3GA 4RW5A 5HANA 1RJQA 1EGVA 3PPGA 3ANVA 1X98A 2G5WA 5AC4A 3W70A 3CMFA 2EPMX 4C90A 3TFCA 1PHWA 3II1A 2BZNA 1OM0A 2FDMA 4L65A 1CWYA 1Z6KA 1RPKA 3MKKA 1AJZA 1LWHA 2PDBA 4Q7NA 4XZ9A 1GVFA 2WBGA 3BAYA 4ZE4A 1QI2A 4M51A 4ERAA 3QTGA 4ECLA 1LL6A 1QNRA 4QRNA 3IUHA 3K8MA 3D3FA 3D0CA 4OU1A 2OO0A 3JU2A 3HPSA 5JVLA 4WY0F 4M19A 5T8GA 5FESA 1KM4A 1ITQA 3EWDA 3NPXA 4HK7A 4FSAA 3RHGA 4PL1A 1UH4A 2DZXA 2H8ZA 5DBTA 3WD0A 3O0FA 3TX9A 3QMSA 3EXRA 1YHTA 3UETA 3VD9A 4WLCA 4OOZA 3SECA 1HFBA 3PBVA 4HPHA 4QG6A 3S0CA 2ZXAA 3RO8A 1E40A 1O5KA 2QZRA 3WLJA 4AC1X 4HPNA 3AHVA 3OZYA 1OX4A 2WANA 3L5MA 4US5A 2VUYA 2WSKA 3WNNA 1LBFA 3B8UA 4RPQA 3EMCA 4DJDD 3L2LA 4L4PA 4EPDC 3UEQA 3NG3A 2ESCA 4F66A 5EMUA 1KA9F 4PMOA 3CB8A 3UJFA 4R33A 1AA1B 3M5ZA 2B81A 2A7RA 1UIOA 2J75A 1V5XA 4FIQA 3DEQA 4KRUA 1DE6A 3TROA 1E6ZA 4L1XA 1H0IA 3HPAA 3DFOA 1KO0A 2PBGA 3YPIA 3WDPP 3VGGA 3TONA 3WF0A 1GJWA 1R5YA 2QDHA 5AYZA 2Z1SA 1UR9A 1YDNA 3CQKA 4JTCA 1JCLA 3VIPA 1E4NA 1JGMA 1V6VA 4IPJA 4DEFA 3EOSA 3TA6A 4F0SA 1O95A 2HVMA 2ON3A 2FZDA 4IP5A 3ITOA 1LJYA 3BV7A 5FJRA 3T55A 4TXEA 4B90A 3AZRA 3MHUA 4Q6JA 5CBJA 1E4IA 1HTIA 3QHNA 5DF0A 4O1BA 1MFUA 3OVQA 4HYWA 2PRLA 2ATMA 1ZRQA 1BXNA 2O7SA 4MLRA 3PBMA 3AUOA 3U2OA 1EUNA 2JK2A 1K9FA 2BMBA 2J25A 3LYEA 5U4NA 2WLYA 4V2XA 1V51A 3N2BA 5AHNA 3SCVA 1RH9A 3WK1A 1IXQA 4PCNA 4DWSB 3TSMA 4Y6GA 1R3QA 3TSBA 3MVIA 4AYSA 4H9YA 4WJXA 3FKRA 4IFKB 5CAKA 1O12A 4WJEA 3L4UA 3OGVA 3VDCA 4XISA 5E09A 1R47A 3M4HA 4ICNA 3MVTA 5EFFA 3ITCA 3ZR6A 3LXAA 4LCSA 3G0UA 2GZXA 4JDBA 3PC0A 2VGBA 6TAAA 1E3XA 5CAHA 4WUIA 1WPCA 3WL0A 2PE4A 3CWOX 2VEKA 4HMEA 3SY5A 5BMXA 2J24A 2XIMA 2FJUB 2IXVA 4KS0A 1H7WA 1BF6A 2PDYA 1HJUA 4O54A 2P0IA 2P88A 3CMJA 1KBKA 5KETA 5F7UA 1MXDA 1E51A 2WCSA 3CGTA 1FHLA 2NQLA 4MJ4A 1HKKA 1TMQA 2BXYA 1DWIM 2Z7KA 4HHLA 4HK5A 4O1EA 1YLVA 1XLDA 3V0TA 4DO5A 3DXIA 4QTGA 1VKFA 3GTNA 5G2WA 2O0TA 2WSYA 2NT0A 3IIVA 3SQLA 2FTWA 1UA7A 3P84A 2PRMA 3S1GA 3PB0A 2ZUSA 4M6UA 1V6WA 3KHJA 1B2YA 4NRSA 2BX7A 2VNCA 1WNOA 1ZQ5A 2HSAA 2GVYA 1SJAA 4D6IA 1A3HA 1V8EA 2ZDRA 4KEVA 3K46A 2OYMA 3L0KA 4CD8A 1RAKA 3C61A 5A6SA 2NQ5A 2I9EA 1V0MA 4YU1A 4MB5A 3LGDA 1V4YA 1R30A 2ZA2A 1Z3NA 5JBEA 4LALA 5D4YA 3G5EA 3ITXA 4J1OA 3G22A 4IMDA 2ZUTA 1TFVA 1QNQA 2G8ZA 1QW9A 4QX4A 2GWNA 4O28A 1I60A 2QCHA 1F2JA 1EA9C 1LLZA 1W3LA 1XSIA 3M07A 2J79A 4AYGA 1KTNA 3CU2A 3FYOA 4BF7A 1ECEA 1ZBWA 4DXKA 1ZL1A 3VUPA 1QPOA 5LA2A 1W1VA 3UZZA 4HU8A 3GY1A 5D2XA 4LOCA 2GDQA 4LUIA 4DUXA 1VBJA 1BVNP 3B0XA 2PAJA 4IX0A 4U3CA 4WKAA 4Y9PA 5HMSA 2WZHA 3Q65A 2YXXA 1GQNA 2QCFA 1W17A 3LOTA 4UMCA 4X63A 3ABOA 4L61A 1XLAA 1MQPA 3C3UA 5M17A 3RF9A 3WQ4A 3Q94A 2Y61A 1V3HA 1W9VA 3ARWA 1EWDA 5A2BA 4FLOA 1A0CA 4ORMA 4AWEA 4K8HA 3ES8A 2R1MA