3H26A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h26A00
1TX2A 3BOFA 3TYBA 4DJED 4MWAC 3H22A 3TYCA 1EYEA 1AD1A 2YCKX 3TZFA 2VEGA 1TX0A 3TR9A 4MWAA 4NHVA 1TWZA 4S3CA 4D8ZA 3H2MA 4DJEA 2YCLA 3H21A 3TYEA 4DJDC 4DJFC 2Y5SA 2BMBA 1AD4A 3H23A 4MWAD 2YCJA 4DJDA 4DAIA 3TZNA 4C1NB 3NOYA 3H26A 3H2CA 3MCNA 1AJZA 4NILA 4DB7A 2YCIX 1Q7ZA 4DJDD 1Q8AA 1Q7QA 4S3AA 3H24A 2E7FA 4S3DA 4S23A 3MCMA 4O1FA 4S3EA 2Y5JA 2H9AA 1F6YA 3H2OA 4O1EA 4G9PA 4DJFA 1AJ2A 2DZBA 1AJ0A 1Q85A 5JQ9A 4D9PA 3TYUA 2DQWA 2YCLB 3H2NA 4NL1A 4DAFA 4O0QA 2VEFA 4S38A 1TWSA 4DJFD 2Y0FA 2DZAA 2OGYA 1TWWA 4D8AA 3H2AA 3V5OA 2VP8A 4S3BA 4HB7A 4S3FA 3H2FA 4MWAB 3TYZA 1Q8JA 3BOLA 1Q7MA 3TYAA 4DJEC 4NIRA 4C1NA 4CCZA 3MCOA 3H2EA 3TYDA 4S39A 2H9AB 4MWAE 3K13A 4PZVA
chains in the Genus database with same CATH superfamily
1LQ2A 2Z1VA 1QBBA 4MWAC 1WUFA 4HSOA 2VEKA 2XH2A 4DELA 5ECUA 3I4KA 4KCTA 4IXHA 2J7BA 2VC6A 4GLEA 5CLTA 4AXNA 4PTMA 1T0OA 4NAFA 1HNYA 4CNNA 1I4NA 3L21A 4LEFA 1EX1A 3M7WA 1O66A 4GIAA 3MPGA 3SW6A 1VENA 1JDCA 3GC4A 3RNDA 3K46A 4F2UA 2E7FA 1GHRA 3EWCA 2BLEA 3PZVA 4H9MA 4LUSB 3GHRA 3L4TA 4KETA 1V03A 3XISA 2YL9A 2ESCA 3B0YA 4XAFA 3VUSA 4UQ9A 3ARPA 2WOQA 4DVOA 4QG8A 3LYEA 1KM1A 2Y24A 5BNKA 4TR9A 3IGUA 3EYPA 2GGHA 4JX5A 2PRMA 1K7FA 4YL2A 1H51A 1TRDA 4H6QA 2ZRWA 3VOIA 4TVCA 2Y62A 3TJXA 3PZQA 1EGVA 4PUDA 4AHQA 2VR5A 2A2IA 3WBYA 4JIPA 2C8NA 1IXOA 2WSPA 3RM8A 2V2HA 3I7QA 1PIIA 2BP1A 2J7CA 2ZUSA 1UZ4A 4DPQA 5GJNA 4NRRA 3DHUA 1EQPA 3PP7A 1VEMA 2A1YA 3NFUA 1A80A 3MS8A 3GZAA 3MUAA 3WDIA 3QFWA 3IVUA 2UY4A 1OX5A 1KKOA 1Q4WA 1QI2A 3W7IA 3WLJA 3D6NA 1RJPA 3AOFA 2FJKA 4JQ2A 3IEBA 4L1XA 4I3GA 5B80A 3TWAA 1XCWA 4B5XA 4O18A 5LNUA 5DRCA 1IZJA 3UWZA 3I7SA 3W28A 2PBOA 2G4JA 3GXMA 3UZXA 2HVOA 1JZ4A 3HV9A 2JGQA 1PL9A 2WSYA 4OUIA 4J2PA 3IWPA 2Z1WA 2F6KA 4U5KA 2XFYA 1YPFA 4AZ5A 1J5SA 5DMYA 4AY1A 3IV8A 1TYGA 4L5ZA 4JTQA 1ME8A 2WQPA 2EPHA 3LD5A 3SCWA 4L9XA 1JDAA 1J12A 3W83A 2AGKA 3IK4A 4OTKA 5DT7A 3M0KA 1AMKA 2JIEA 4PZVA 4IQDA 1UP0A 5IDZA 4LUSA 3P8IA 2W5FA 3NSXA 1OFOA 1CZ1A 1WXZA 5EMLA 2CLFA 5D9PA 3GYCA 3PZIA 5A6BA 2QPUA 2D2HA 3LHTA 2Y7DA 2GYIA 4J9JA 3BMVA 4LU0A 4AMAA 3CTLA 3LHUA 3SJNA 1YPIA 3G24A 5HNUA 2HQAA 4GUJA 2P53A 5HA7A 1YLVA 1TVNA 4JCMA 1TTQA 3B04A 4U28A 4WSKA 4DM1A 3ISIX 5BOFA 1ZAHA 2EHHA 4MF4A 3PVFA 2IS7A 3VIFA 1DJIA 4UTFA 3TJ4A 2WZIA 1XLKA 4XTDA 2VL4A 3A4JA 2DQWA 3WNKA 5FJPA 1R9XA 3W2KA 2Z24A 4X0VA 1M03A 3R11A 3QGKC 4Y2WA 3GQYA 4R7OA 4W88A 5CAHA 3ABRA 3VNDA 4BQ2A 3ABOA 4JBRA 3DFQA 2XYLA 3T55A 3FJ6A 2VZVA 3EAUA 2WPGA 2WMGA 3FDGA 1UD6A 3PZNA 4XZHA 1HL2A 1EQCA 1W9VA 1NWRA 3B8TA 3W7QA 2EBNA 1DQWA 1F8MA 2KZHA 4YTTA 2J25A 3KAOA 4GUHA 5E9XA 4M24A 4P7LA 3NZRA 2VRJA 3RJXA 3GK0A 3WO8A 4S2BA 3AC0A 1DL3A 3NNTA 1JF6A 1VJIA 2PF0A 3WSUA 2PGWA 1Y65A 2YFNA 3B8DA 1E5NA 1ODUA 1IR2A 1XLGA 2PS2A 1PHQA 3M5VA 3NGFA 3D46A 4NJIA 2PURA 3FA5A 1MEHA 3WY1A 3CAQA 1YKWA 3PBWA 1GOOA 4FMVA 4QXIA 2VEMA 3WDPP 4GBUA 4US5A 4GRSA 1I0DA 1SZEA 1LT7A 1M68A 5MKGB 2YL8A 1B90A 4QTGA 3NQMA 4GE8A 3GY1A 5CLWA 1QK2A 4E2OA 5FJTA 3VDBA 4X9SA 4RCXA 3MBFA 4WY0B 1SJBA 3T81A 1KBBA 3B9AA 3E2SA 3GTFA 4B5VA 1QW9A 2DP3A 3WL1A 4PRTA 3J7HA 1HJXA 4H9XA 2NV1A 3OOQA 4XVEA 2I5QA 2YB4A 1V7AA 1DOSA 1EJXC 3FYPA 3VXGA 4J3WA 1HGWA 4N9DA 1OSEA 1JNEA 1GG1A 1FP8A 2DV0A 4OKDA 2WV8A 1TV3A 4O14A 2J6XA 2B7QA 2Z2AA 1C7TA 3K4AA 3WNPA 1KM5A 4REQB 1XLIA 1XS2A 3QY8A 2Z29A 3H70A 3RILA 4WR3A 5E70A 2OG9A 5D2XA 3MSRA 1XBYA 3W73A 3CM4A 1AK5A 2QDGA 4GIYA 1LBLA 4JQ4A 1RP9A 2PCEA 3GH4A 8CGTA 1W9PA 3CQIA 3P67A 1JVNA 2CXEA 3KHJA 1XLLA 3BCFA 4PR4A 3TQPA 1L2QA 1ENUA 4FLOA 3BICA 3PZTA 1PVNA 3N14A 1OGSA 4Z17A 2IQ0A 1Q85A 3L4YA 3PG8A 3N13A 2CHOA 3A9BA 4M6PA 4X9YA 1SFJA 5AOUA 2YDAA 1K02A 4QS5A 4FOKA 4RKAA 4NZFA 3P0XA 1HJWA 2JQXA 3RAOA 4GO8A 3WMBA 1PHWA 2FVKA 3TEVA 1FFRA 4XX6A 3WQ8A 2GJXB 2ZZ4A 3L4WA 3ZWTA 1WPCA 5AC4A 4AF0B 4A3YA 5CG0A 3UR5A 1CIUA 2YXOA 2J66A 5JBFA 4LTSA 2BV9A 3VKAA 1REQB 1QO2A 2J4GA 3WLTA 3GC2A 3G1SA 1H60A 3FA4A 6A3HA 3MWCA 2HK1A 1CCWB 3O6YX 3GB6A 5ABFB 3KBJA 3NUKA 4A8RA 1TCMA 3GNXA 3TSBA 3W1XA 4ERGA 1UWSA 2Q8ZA 3S1WA 1JCNA 1OGBA 3SY5A 5BW6A 5MKGA 1XSJA 2BS9A 4C7GA 1MEIA 2VEIA 3DX5A 2VM8A 2BY0A 4M6QA 3MMUA 4Q8TA 4UR8A 2XIQA 5FJOA 1PS9A 1NVMA 2A3AA 3PULA 1HW6A 5HPOA 4C1NB 4AY7A 1FOBA 4DXXA 3FIGA 3VNIA 4WY0A 2C91A 1SMAA 1CI1A 2YA0A 3CLMA 3VNMA 4NUWA 5I3JA 1IXQA 2Y8UA 4MZ1A 3U5UA 1TELA 1GOQA 3EXTA 1VPYA 1I2QA 3VZZA 1M9HA 3MMWA 4W84A 2FDSA 4JCLA 3GW0A 4HNOA 3QHMA 1RCQA 1H5VA 3GRIA 3HPXA 2PDWA 3NWRA 3RX3A 4REQA 2OO0A 4QBXA 2QHAA 3ATZA 2QKFA 4G1NA 2NUYA 3ITXA 5DY2A 4JTFA 3KP0A 2VVSA 5CPSA 1R86A 3S4TA 5F7UA 1V0NA 3B0XA 2D1ZA 2JALA 2XJ7A 3CH9A 1E9LA 1Z8AA 2RDXA 1VLWA 4LALA 3AALA 3PY2A 2G5WA 2P8CA 1K8ZA 1NQ6A 2WLZA 1K70A 1EYWA 4H04A 4AWSA 1NH6A 3PTKA 5TF0A 1PYMA 5EMYA 2VTFA 3E12A 4UQCA 1IWAA 3SI9A 1YBQB 3G1VA 1KBLA 4UTUA 2QV5A 3CQKA 2GVGA 5AN7A 3MMTA 3GNOA 2PDKA 4E2VA 5JU6A 4JFTA 1HXJA 3W74A 4KWOA 3PHAA 4DUXA 1LOQA 2X0HA 3VGHA 5HOSA 3F1QA 3GXPA 2GJXA 4NX5A 2GGGA 5A6KA 2E77A 2PFHA 2DZSA 2OTDA 5HR7A 4Q6XA 5JVLA 3VGEA 3WLSA 1DVJA 3W3OA 5IDIA 4RR4A 3WH8A 3RLHA 1Q6LA 4KWVA 3GBDA 1E1FA 1REQA 1PDZA 2G0WA 2XH7A 4AY8A 1H41A 3PJWA 1WP6A 1YDOA 4KEMA 1OX4A 4B3LA 1OCJA 1X7FA 5FACA 4ML9A 2QT3A 2R1LA 2UWFA 1B5TA 3LNMA 2WNQA 5M03A 1IZCA 3STGA 1B9ZA 5LSMA 4CN6A 2PU1A 1JR1A 1G4SA 2A7RA 3CHEA 5D9OA 3UJSA 4H19A 4C1NA 3K1GA 1AQMA 2C14A 4FEZA 1YDNA 3BMWA 5LA1A 1KV8A 5AYZA 4QHRA 1PZ0A 3QHNA 2JKPA 2RHGA 1R38A 1V6TA 4PMUA 5FAGA 1FDYA 1TJRA 1ISZA 1X7IA 3VMNA 3WBAA 2IPFA 3AU2A 4O8AA 2POTA 1E4LA 1K7XA 3EBVA 1JZ8A 4H2CA 4TVUA 3XINA 1JFHA 3U2CA 1W2VA 3LG3A 4IMDA 3PUOA 2VJXA 3EX3A 4DJDC 3MUY1 1GYNA 1Y5VA 1H1NA 4BEUA 3UR2A 2CIPA 1EC8A 1XLCA 4DQWA 2QUNA 3BG5A 3UFYA 4GVIA 1WBHA 1RH9A 2VWTA 3GXNA 3V7PA 3FSTA 5CBJA 2ZADA 3WL0A 1C8XA 4AAJA 3O8AA 4KFOA 3AIEA 3ZZ1A 3W29A 1BWLA 1JGIA 3ZFHA 4O8RA 1KFEA 4JDBA 4C5ZA 4XAPA 2RFGA 2YJQA 3CLWA 1CXHA 2W67A 1GOKA 3R1ZA 3WQCA 3PSWA 2ZDRA 1MEWA 1HTIA 4U2ZA 4K7YA 1P1XA 4IGNA 3MP3A 3GVWA 3SCPA 4IJRA 3UR7A 1QOXA 3EDFA 2GL5A 3W2JA 2QJNA 2JF6A 3STFA 1PB0A 2HNEA 2POZA 5G4WA 2Z2BA 3WELA 4KEVA 4DRSA 2G97A 4KEUA 4LUJA 3FFSA 1YQ2A 3O6CA 4JZ5A 3F4VA 5KTLA 2J9YA 4S3JA 2HZGA 3DECA 1EYEA 1U5HA 4A05A 4GH3A 4EWJA 2ACRA 1A5MC 4YCPA 5AZ0A 4KESA 4L56A 2ZBTA 3Q94A 4B92A 4CEXC 3GIYA 1F05A 4E5TA 2KX9A 3TVAA 1XXXA 3SURA 2PBGA 3GO2A 1HO1A 2VXNA 4LUYA 3WH5A 3LHZA 3WYZA 4PUNA 4HPJA 8XIMA 4O53A 3MI3A 3S9YA 3MYPA 4IUGA 1DE5A 1M3UA 2ZUTA 2VVNA 1W56A 1GTHA 3DG7A 1ZQ5A 2QJJA 2WAGA 1RZMA 1ODZA 1ZENA 1FCVA 2E9LA 3HB9A 3GLCA 1J0IA 9CGTA 4XZNX 3MW7A 1TPDA 2WWCA 1UKQA 4DF0A 4ZB2A 5XIAA 3THCA 2GUYA 4P5UA 2ZIDA 4M56A 1UYQA 1GK8A 3ORWA 3OZMA 5XIMA 3ABSA 3IGXA 1F3XA 4W9TA 3NO5A 2O55A 1F73A 4XBKA 2X1TA 3QZEA 4TX8A 2D69A 3CL6A 1ZAJA 3EXRA 1WXYA 4H9YA 3LENA 2TODA 2GVEA 2HS8A 1L0PA 2J78A 3MB9A 5I3GA 1LL6A 1V7YA 1JEZA 9XIMA 5FEPA 1MW3A 1S38A 3E9AA 1S2VA 3TIMA 2EPNA 3PUEA 1KBKA 4U10A 4A35A 1XIBA 3ZO9A 2HV5A 1EO7A 3NOYA 4RZ6A 2QUTA 4A8NA 5EFFA 1AA1B 3TSDA 1AW5A 1JXJA 4Q4KA 3WDQA 5C54A 4MPKA 2Z6IA 1TUXA 2JGYA 4KCUA 4LB4A 1K03A 2PDLA 4J1OA 1ZZMA 1QR7A 2QIWA 4TX9A 5D32A 2OMAA 2ZA3A 4HJWA 5FL0A 3W38A 3PZMA 1IZKA 3S5OA 2NVAA 4HBKA 3TNBA 1KO0A 2FMOA 3GVQA 3S6OA 2DT2A 4J4KA 4HN8A 4G8TA 1TPB1 1WX0A 5EL1A 1LRQA 1P5BA 1E70M 5HR6A 4YXGA 4ZTXA 3TNOA 1QU4A 4ZOEA 2IKHA 4I7WA 1CX9A 2PDQA 1GQNA 1PUDA 4RK8A 3ALGA 4MUZA 1LG2A 1LRNA 2FKPA 2A6NA 3WD2A 3WMCA 3MT1A 3QOMA 2GOUA 3FHQA 1TB3A 2X1UA 7A3HA 1G94A 1KXQA 4M6UA 3A47A 2QCCA 3P8JA 3WF1A 1VJSA 1N8WA 2FGZA 2WMIA 1X1OA 3G1RA 4B5UA 3H21A 4NJHA 4UTLA 1U5JA 3S2CA 3MUXA 4V1XA 4E4UA 1MW1A 1A5SA 3AXKA 4JHZA 1SFTA 3T2QA 1IGWA 3PANA 1XLMA 2ZRUA 3GX9A 4C6NA 2FDMA 4RXGA 2QCNA 3IIZA 3FS2A 5AVHA 3L67A 1ME9A 1PKNA 1MYRA 5CSYA 1P48A 3ARYA 4O4WA 1C29A 3HGSA 4LF1A 2ISDA 1QRQA 5LIYX 3MVIA 3PZUA 1T5AA 1DIDA 3QQ0A 3IJ6A 1TCDA 2CCRA 2PD5A 5ABEA 3F7JA 4XBJA 4EPDC 4FO4A 3UZ5A 2V30A 1OG6A 2CNCA 3LBOA 2QUUA 2D2OA 1YRRA 2J8GA 1Y5XA 4ADSA 1H7XA 3M43A 1SO4A 4AMCA 4PMXA 4G6CA 2VWSA 2Z1BA 6PTDA 1T8XA 4OIFA 1SM9A 4LAZA 1Q2RA 4E8CA 1ZU8A 3ITYA 5F1VA 3NIYA 2YDQA 1UKSA 3SCQA 1JNDA 3W7NA 4I9TA 5AYBA 4R53A 3V16A 2GJNA 3LOTA 3W1TA 4QLJA 1Q6CA 3BLPX 2CLHA 1GGOA 3U2OA 5IFTA 3CEPA 3UZJA 4BF9A 5LNRA 2PF8A 1FCQA 3OLEA 3QLDA 4P7NA 1OT2A 2E40A 3BARA 3EMZA 1M65A 3CIXA 3Q37A 3S3GA 1DTUA 3LY0A 2CITA 1KQYA 2GJLA 5ABGA 3ZR5A 3WBEA 2YYUA 4YVPA 4N4QA 1DYSA 5E09A 3W00A 1R0MA 4O10A 5LZLA 2Y63A 4PL2A 3SCRA 4Z1AA 3E1F1 1HP4A 5C2CA 1XD0A 3AIVA 4MOZA 4HCDA 4JXCA 1V02A 4L4MA 3DERA 4NZ4A 4PUJA 4MYAA 2X2YA 1JULA 1V77A 2WHMA 1THFD 2E5DA 3WD3A 4DZHA 3AAMA 2ZRYA 1YX1A 3LA4A 1ITQA 1KTCA 4LNYA 1WZKA 2Q8XA 2FH8A 5EU9A 4Z1DA 4DI8A 3GDKA 3KOWA 4HTBA 1OM0A 5A6JA 4MNKA 1WDQA 5HBFA 2WVTA 5CC6A 1O6IA 2ZRXA 3NSNA 3MQTA 4FK9A 2QW5A 1U1HA 1PX4A 1VFLA 2ADAA 3UZWA 1I2PA 1T6MA 3P61A 4EIVA 5DCDA 4QDWA 2YZRA 1S5TA 4H01A 3HF3A 1FWDC 4U3AA 3VK5A 2V2DA 3MI6A 3W75A 1E0UA 3W1NA 1HX0A 1JI1A 4IQLA 3V0SA 3EMQA 1E6XM 1U1UA 2ZZ3A 4BZYA 4UFMA 3EB2A 4CEUC 1G4EA 3PAOA 3MI2A 1GYMA 1FWHC 3N6QA 4IX2A 5KZ6A 2HNHA 3A21A 4JTKA 3NEVA 4XKYB 2VX6A 2QIIA 3ITOA 1QOPA 4HQVA 1RP8A 4GYFA 4AWEA 2GGIA 4WJEA 2OWXA 5FF2A 3BUVA 3FKRA 4LVGA 3L68A 4LH8A 1IWBA 2Y5JA 3MUZ1 5F2MA 1E73M 5CCZA 4GI4A 2D2GA 3R13A 5A8OA 3Q45A 2OQYA 2RUSA 1VFTA 1BF2A 1AQHA 2I56A 2DSVA 4HA1A 1DXFA 3CYVA 4PMVA 6REQB 1IEXA 1WKFA 3NL2A 1ZJIA 5EFDA 1TE6A 3ZJ7A 1UR1A 2JF7A 1OJXA 3U48A 3M07A 3SO7A 2HVMA 4LY8A 3ZT6A 1H11A 2OGJA 1DJHA 1GVRA 1IEVA 3CL8A 1OQFA 3E38A 5I00A 1VP5A 1OWQA 1F8IA 3P84A 3A9IA 3UCDA 3KUMA 2JFEX 1TV7A 1E0XA 3WFLA 1BEUA 3OA5A 5D8WA 3CUGA 1FHVA 2Y7FA 1RK5A 4XBSA 3UW6A 3MUIA 3ZVHB 3QV6A 4C6JA 5AHEA 1J0HA 4PMNA 4XZMX 1CGWA 3USZA 4HYVA 4R33A 1QNQA 1Q45A 5FIPA 4GY1A 3D0CA 4QGCA 5HQEA 3NQ6A 4ZSUA 1ICQA 3WG6A 1KCXA 4E2BA 4Q4SA 3N04A 4WDWA 4EAYA 3AZTA 4IPJA 1PJ9A 3BTNA 4GK8A 4MZYA 4Q4PA 3T05A 3PJXA 2V8ZA 2DIJA 2WW5A 3MHFA 5DMLA 1ZHAA 3GM8A 2J6VA 3N9RA 4NSBA 4ZO9A 4IPNB 3VZYA 2VDGA 1BTMA 4AVOA 1PCWA 4FB7A 1K6WA 6TIMA 1TWSA 2WBKA 2WZMA 2DZAA 3U0HA 1KWGA 1VD6A 3DFOA 4O28A 5H2ZA 3AMLA 3MHGA 3BCDA 3CUHA 4K8GA 1RPXA 1BPLB 4CUCA 4ZQMA 3CK5A 3RO8A 3NSMA 5LKYA 1YIXA 3GG0A 4GKTA 4HKPA 3BL3A 4KWWA 3M0LA 5TAOA 3FKKA 4GZ7A 2X16A 3TMQA 1TVPA 2XN1A 1MQQA 5A94A 2OLSA 3GR7A 1A3WA 5MHBA 1W1PA 4HHPA 1YPXA 4HOWA 1PWMA 5CG7A 2RJGA 3BZJA 4YTQA 1XIEA 4Y90A 1XIDA 3SIMA 2OYMA 6REQA 3AWNA 3MBDA 1SZNA 3M0JA 3TN4A 1YE4A 1VFSA 5BU6A 5I3FA 2ISSA 1OFPA 4PL1A 1YDYA 2OOFA 1JXKA 4HJFA 5LIKX 4MPQA 6ALDA 1QHZA 3NEHA 1K8XA 1UIPA 2PB1A 2OQHA 1UMLA 1TZZA 3GAYA 1XLBA 2HTMA 3HOJA 1JCYA 3U2ZA 4M8UA 2ZOXA 3OLGA 2B7NA 2QF7A 1X1NA 3EDJA 2VEPA 4Q8WA 4J35A 1OYBA 1R9ZA 2XIBA 3C3UA 2QZRA 3T2OA 3W1PA 4D8AA 2OB3A 1V4YA 1ZL1A 4HU3A 3TDFA 4GX9A 1V51A 4F9JA 1H7PA 3T8LA 4KEZA 3F2DA 1KM0A 1JUKA 3QH2A 1JG9A 3B0VC 4W89A 1KW1A 2DZXA 1KBIA 1J8VA 2YGYA 1UWTA 4DI9A 4BWLC 1T41A 4AX6A 3FHAA 3GFYA 3THDA 2TPSA 1MO0A 2VZTA 3NPWA 3QTGA 4IGHA 2DUAA 4PTDA 4K38A 3HGRA 1OC7A 3QM3A 3KFTA 3WNLA 4HMNA 4U33A 3CUFA 3ANYA 1K9FA 4ERIA 3LRMA 1E72M 2ZVIA 1W5QA 1Q65A 2WZEA 3TQ0A 3C0LA 1X8CA 4V27A 4BWLA 2EKCA 4MNMA 1ECEA 2C1GA 4HMDA 4NF7A 1SZGA 1EJUC 3KWSA 1ZPTA 4HTYA 3VKJA 1ISYA 1KFLA 3VOHA 4RNJA 1NTHA 4J3ZA 1OFRA 3N2OA 4ML4A 3BPWA 1XPYA 3IJQA 3OP2A 3KLLA 3VM5A 2EGZA 7XIMA 3IANA 2FPVA 3DFNA 3QV8A 3QV7A 3RLUA 1QI3A 3GU2A 1KLZA 2Y8VA 2IW0A 2ODOA 4MNLA 4S2CA 2C18A 5FF7A 5T26A 4PMRA 3SFWA 3OO2A 1N55A 2EG7A 3SCOA 5FJRA 1TREA 3THUA 5HK4A 1R3YA 1W9XA 3TC7A 1NFBA 2Q09A 3OYXA 2W6RA 1OIFA 1X98A 1SSGA 1OF8A 4YCOA 3WZ0E 3TN5A 2XIJA 1EKOA 4D6FA 3IS4A 2CZDA 1XF0A 7ENLA 1KBJA 4HZMA 5U4NA 1HKVA 2H3BA 1PDYA 1Z89A 3PM6A 4F8XA 2REQA 4MB5A 2ZRVA 4UQEA 3CZJA 1FTXA 4C5YA 3TR9A 3SGZA 4KFNA 3TXZA 1ZBKA 1CB2A 3EKZA 1GOIA 4B9YA 4RW5A 2PTZA 4H3DA 1R3SA 1RD5A 3IVSA 1EF2A 4W5UA 2NQHA 3A4AA 4TO8A 2QUVA 4G7FA 4FXSA 1ME7A 2Y4SA 2L5HA 3JS3A 3B8VA 3AUOA 4JTHA 2F84A 3QBUA 1XRVA 1OEPA 5AHFA 3AMKA 1J0KA 4A4AA 1A0DA 3GXDA 3NPVA 2WKJA 1IV8A 3H54A 3AYRA 1QI0A 4OUEA 4IIFA 4YYCA 4KQNA 1GVSA 3VGGA 2G96A 5CZTA 3AFBA 2J7HA 3SSJA 1VC4A 2VI0A 2F38A 4M3PA 1SO6A 3NQCA 5D4YA 3TX9A 3PR2A 3S2JA 1M04A 5D03A 3WQDA 3V1PA 3UU0A 3GVRA 3SDOA 1FVPA 4ASTA 1AZ2A 1BVZA 1ZLPA 4E8GA 3GHUA 2QAPA 3W2NA 3P80A 3GVVA 3W7PA 3OQ8A 2G50A 3TJIA 4GZIA 3EDDA 3R0DA 4AEFA 1VBHA 1ONRA 4A22A 3P82A 2FVMA 2PC4A 5DF0A 1TO3A 3TYDA 3A5FA 4MKVA 1IQ8A 1SVDA 3POCA 3GUWA 1R9YA 2DZWA 3FXYA 4JTUA 3OG3A 1XFCA 3QXBA 4YTUA 4AHPA 4DLFA 1YTDA 4JN8A 4WEVX 1TR9A 5C6MA 3C5QA 1PZ1A 2FZ9A 1E3ZA 1QPKA 1JYWA 3LPFA 4GI8A 3UA3A 2Y61A 4RDYA 3NL3A 3IJ7A 3KLKA 3BG9A 1U30A 1I2OA 3QY7A 3FVMA 2PI6A 4IPPA 4G5DA 5IM51 2BSLA 3WLLA 3GBEA 4FXFA 3N2MA 4QEEA 4UTKA 1O1HA 3B8WA 3BANA 5LGZA 1IF2A 2YIHA 3TTEA 4S3EA 3W27A 5K7JA 4GQQA 3S5SA 4PCNA 3WF4A 4W93A 2YSWA 4WGHA 3T0BA 1X1ZA 1TQJA 2HROA 2VC7A 5JUVA 3VGFA 2ZXDA 1NF7A 1L2UA 3TLLA 4ZQCA 1KCZA 4ZE5A 3ZR4A 2F2HA 1WQ5A 1E6NA 4TV6A 5K9DA 1P1MA 1UZ1A 1CBGA 1WUEA 1W37A 1C92A 4IIBA 3RU8X 1XG3A 1QNPA 1ML1A 2INEA 4HNLA 2Z1XA 3ARWA 4FZIA 2WSQA 3S9IA 3ARQA 1M01A 3VCRA 3VIIA 1KWKA 1AH0A 1JUEA 3OPSA 4B5TA 4HHLA 1ESWA 3P60A 2CYGA 3DC0A 2ZZ5A 1N2VA 5KINA 1R2SA 5CPNA 3G0UA 3OLIA 4LRSA 3BCJA 3GWQA 4DJFC 1V3JA 4N42A 3WH6A 4AZHA 3V3WA 3VTRA 2QCMA 1QTWA 5IFPA 3ARUA 3TK7A 3WLPA 1H1YA 1S2UA 1VYSX 3LN3A 4YTRA 4PUWA 2XH4A 1DV7A 1L6SA 3FYOA 3WUEA 3DH7A 3TSMA 4IOTA 3KOXA 3DFYA 1ZFJA 4C6CA 1DTNA 1Z69A 3SFKA 3S2LA 3PK7A 3GR4A 4G9PA 4DJFA 1RSCA 4GHRA 5EMMA 4R88A 3OGRA 1XQKA 3ZLHA 4CU7A 5HULA 4XQ6A 3JRKA 1I9CB 4MY9A 1FRBA 3FA3A 3UWUA 3H4WA 5HJXA 2VMFA 2BVYA 1R7OA 5LNWA 3B9DA 2AQOA 3N2CA 2QMJA 2VT0A 4UTMA 2WKLA 2QEZA 4HSHA 4IIEA 4O1BA 1NOFA 4DWSB 1VGAA 3R94A 3AS0A 3L5AA 2DZPA 2PE4A 1I45A 4ZXOA 5C9WA 1R3VA 1H7WA 3TCSA 2AL2B 1W3JA 2NZLA 1Q6FA 3PG9A 3QV9A 4IX0A 4YVVA 4K2SA 4OZOA 1W0MA 2Y8KA 4PMYA 4PCSA 1JJKA 4QDPA 4HU4A 3V18A 1L8PA 3SN1A 1EJRC 1VAHA 2VELA 3SJ3A 5REQB 3R2GA 1TR1A 2V9DA 5AHMA 4C6MA 3QC3A 2CU0A 1J6OA 3KCOA 2QCLA 4W7UA 3ZVIA 2DEPA 4XAYA 2BY3A 1M1BA 4UQDA 1LL7A 3GZ3A 5KSWA 4W87A 2FH6A 3NYZA 3E0IA 3AS2A 1JD9A 3P5YA 1KB3A 3NM3A 4Y6GA 2CLEA 3UVIA 3LCXA 5AVNA 4GNJA 1B0IA 4ICCX 3SRFA 3W6MA 3N12A 1JPDX 4JTIA 4XWUA 2VUYA 4LS0A 4UNIA 2P0OA 3IV3A 3KBWA 2GQAA 1FWTA 1QO5A 3LHYA 4UC5A 4N4PA 1D9EA 3FEMA 3QW4B 3H4GA 5A5WA 2Q01A 2RJHA 4IG2B 3WLKX 1NOUA 3MYOA 4FHAA 2XIMA 3O07A 1NF0A 2O7SA 3OYZA 3UEQA 1JD7A 1H4PA 5I7GA 3BURA 4AD1A 3SQLA 1TWDA 2ZTJA 3LHVA 4DWSC 3NQGA 2AQWA 1CB7B 3H12A 1FWEC 1W3KA 3S1VA 1KGXA 1ZJAA 2XN2A 4A8IA 2DT3A 2FVLA 3SBFA 3G18A 4AZ6A 4PFMA 1CEOA 2PU0A 4H41A 1XSIA 5J5DA 3LDVA 4I7VA 3UR8A 3VABA 1HL9A 2CWXA 3BLLA 3RHGA 3EX2A 4AEOA 1QPQA 5E93A 4DWSA 2GOKA 4LFYA 3MDWA 2R6OA 4HU8A 1V6UA 1B3XA 2B31A 2B0MA 3SGUA 1JPIA 4EKJA 4DXKA 4F48A 2AL2A 1WCGA 1V3LA 3M6DA 5E9AA 3UWEA 1UIOA 1GQIA 3QKZA 4ERAA 5A8GA 2X41A 4ENLA 3NQ8A 3PTDA 2ONEA 1RQEA 4D2JA 1UD5A 2P3EA 3N29A 4WCJA 1FCUA 3BSHA 5CEWA 5REQA 5HATA 1WDPA 2GSJA 1VB9A 4QE4A 4F0RA 2DJXA 7TIMA 1K7EA 1H0GA 4ZTYA 2QR6A 1SSDA 4E0CA 7PTDA 3VOGA 3GIQA 3ZJ8A 1R3TA 3R43A 5CJNA 4IH3A 1PTAA 1XC6A 3CQHA 2QDDA 3S2NA 1LP6A 4F0KA 4DUVA 3R10A 4QAWA 4KRZA 3BW4A 1VBRA 4D6IA 3H26A 3CV7A 4BEQA 4KH2A 2ZUMA 3VZXA 3UXLA 4X3ZA 1R87A 3NXFA 3LNPA 4Q8NA 5A6MA 4IG2A 2Y2WA 4WUIA 2RKXA 4TTGA 3O1NA 4GFSA 3MKCA 2C19A 4XTIA 1F4AA 3A23A 3G6LA 3WMSA 3MU7A 2F7FA 3VOFA 4V1YA 5F1UA 3TCEA 2UY3A 1GKRA 2YCEA 3LBCA 4GD0A 4OHQA 5DCEA 1ITUA 5CBBA 4JNMA 2DZVA 1FWGC 5CKSA 5F2IA 1XD1A 2OX4A 1FH7A 1JCXA 4JX6A 2I17A 2QAFA 3MY9A 3OZOA 4ZXLA 4RL3A 4UCGA 1A53A 3OIXA 4XAGA 3UVAA 3QYSA 2RDUA 2YOCA 4IHCA 1SO5A 1AFSA 4G56A 3K13A 5LGXA 4YLWA 4P2VA 3IK2A 3W26A 2CESA 4KMQA 3B4UA 3TKFA 4GCXA 1MRAA 4POCA 3VMOA 4FR1A 3TAOA 4MDPA 2V67A 4W5ZA 1UW9A 4Q8QA 3KE0A 4AC1X 3UNTA 5TBOA 3CMJA 4HCLA 1GJPA 4QAIA 3C0JA 3LXAA 1EO5A 3AIBA 4HNUA 3DESA 3E0FA 2QPXA 2VGFA 3QVQA 3WLOA 1UQYA 3N73A 4AQLA 1YNYA 1HJUA 3GKAA 4IFOA 3ANVA 2OT1A 1GONA 1Z7AA 4MADA 4D8LA 1E43A 3EPMA 4OU1A 1JQVA 2Q8LA 1CT5A 1S3TC 4NZ3A 2FHCA 3RF9A 2HSAA 1OABA 4I5XA 3SRKA 3WEOA 2NV9A 3OEXA 3VAVA 4Z2GA 2WBGA 1KTNA 4INFA 3ABQA 4LV4A 3Q67A 5A2BA 2XVLA 2GJRA 1ZSXA 3NG3A 3AUJA 5A8QA 5FEWA 1MQPA 3DHPA 5HNTA 5LIXX 1PTDA 2NVDA 5TNVA 3S2MA 4URIA 4PBEA 3TV8A 1LWJA 1EB3A 4L65A 4YS1A 2QVNA 3UD6A 1FCBA 1S2TA 4IT1A 3PNZA 1W1TA 1EXPA 4HNTA 1P7TB 2F9RA 4O4VA 1EBHA 4B5NA 3PSVA 4H7ZA 1D2KA 4OE7A 4WF7A 3JR2A 3E96A 1CLVA 1RVKA 4IP7A 2O0TA 5G2HA 5BWAA 3CHDA 4MG4A 3EWDA 4C6OA 2VD9A 3GH7A 2XGBA 5L9FA 5I0DA 2DSUA 4RUBA 1YTEA 3WDJA 5FSEC 1J4EA 1QOQA 2VX4A 4C6FA 2Z0IA 3KS6A 2EAWA 3SQSA 7CGTA 5HJLA 1Z6KA 2QCHA 1TZ7A 3KBVA 4WVXA 3GH5A 1Q7ZA 3HM7A 5CSSA 2E6DA 3H7RA 4A21A 3WUFA 1KFJA 1P0BA 2R8WA 3KP1A 3ZT5A 3BOXA 3DGRA 2QYGA 2BVTA 3THQA 1FXQA 3DYMA 3Q58A 2O92A 3A5VA 4UTTC 2P0IA 3O15A 4M29A 3VO0A 2C79A 3N4AA 5FEZA 3UZYA 1C8VA 3V5OA 3OG2A 1M7OA 5CQ1A 3TE9A 4NRSA 3U6WA 3FGCA 3R6IA 3WQGA 4JNYA 3STPA 4FLRA 3ZYZA 1V0LA 4ORMA 3NDYA 3SECA 2YB1A 1CLXA 2PLMA 3MCOA 2R1NA 4UTTA 5F2LA 3GTXA 1N7KA 1EPXA 4U3CA 4RZBA 3NL6A 4JTJA 4AC7C 2OJPA 4DF1A 1QJWA 5I23A 4JL1A 1RA0A 2WJEA 3CT7A 1SZRA 2FZBA 3VA8A 4ZQRA 5J5RA 2FZMA 1OFEA 1LG1A 1UH3A 3QPEA 1O5QA 3URQA 1F61A 4MDOA 4N6FA 3O3RA 4ATLA 1DWFM 4CNUA 1VZWA 1F07A 1XSKA 5C70A 3VIMA 3IUDA 5TIMA 4Z0SA 1WZLA 1R3RA 4LGXA 4BKNA 2CBVA 3B9EA 4C6BA 1JUBA 3M47A 1SW3A 4AYSA 3CO4A 5KEZA 2QGHA 4LRTA 1W5PA 1P7TA 3C6CA 2DY3A 3F4WA 3NDOA 1VIZA 4JKKA 2HBXA 2GVJA 2VFEA 2WWDA 4Y9NA 1GJWA 2BGNE 1V93A 1MFUA 4E3VA 3VDGA 4QNWA 2YA2A 3PPFA 3T4WA 3S8HA 4Z1CA 1FHDA 1TWWA 3P2VA 2FTWA 4MHBA 1OFBA 1PCKA 1UHVA 2VHLA 1EP1A 4K7VA 1A3XA 3A12A 4GNKB 1GOMA 4GUGA 3EOLA 4TQTA 1QBAA 5GJPA 4IZGA 4EF8A 1UZHA 2OKTA 3WH9A 4FLQA 3BAXA 4GG9A 4ZB5A 5T91A 2NSXA 2ZX8A 2PCQA 3NQ7A 4B4HA 5J04A 3W86A 4LAKA 1EA0A 5HQLA 1DWJM 4J28A 3FJ4A 4CQAA 3II1A 2YL6A 4M0XA 1VCGA 3B3DA 3T2PA 3ITTA 3SZ8A 3IUIA 3P62A 2V63A 2ZUWA 4AWTA 3BSGA 3W24A 3PBGA 2CFFA 3LI0A 2YLLA 4FF5A 4HP5A 4H9ZA 5DELA 5C7HA 3UWWA 1I0BA 1O12A 4UUIA 2MANA 2XSAA 4L6HA 2BODX 5I77A 3OQEA 5DQPA 1OC6A 2X1SA 3T0TA 3KVLA 4MLRA 5BRPA 2W3ZA 3BJTA 4Y9AA 1XKJA 4A29A 2A6LA 1V5XA 5DFAA 1CXIA 4DX3A 1EZWA 3GDBA 3S5ZA 1UR2A 2NX9A 3PWGA 2DH2A 1TMQA 2YPIA 1SUXA 4EANA 3R79A 4ALDA 1BVNP 3L2IA 2NX3A 2XFWA 4XZWA 1Z41A 1VBJA 2XH0A 3BOLA 3QMSA 1NWSA 3AS3A 3UWYA 2D24A 3REQA 3TTYA 5IHSA 3M46A 3ARSA 4H4IA 3UGRA 5K2ZA 1XLHA 2BY1A 3F4DA 1A5UA 4QCFA 5BXRA 4M82A 3QQ1A 2OEKA 1OFAA 1OC5A 4M7SA 1K3UA 1TPEA 4UZUA 1C93A 4UOQA 2WMJA 1XR2A 3ATYA 5CPOA 3O0KA 3UA4A 1M41A 5K3VA 4KRUA 4NU7A 2DSWA 1VRXA 1BKHA 3O63A 2O4QA 4OBTA 2P8BA 4C91A 3NJ3A 4QQUA 2WHKA 3PTMA 1GW1A 2Z27A 4XZLX 3PJUA 2E5CA 1B9BA 3ES8A 4NZCA 1KFCA 3H2OA 5BXPA 3R0UA 3TTSA 3VNZA 3CHCA 2VQTA 1PKLA 4ZZ9A 4RE4A 2DZUA 1VKFA 4LVDA 2Q71A 2VEFA 3AIQA 5ABHA 4QNEA 1D8CA 3MO4A 4AU0A 2C6QA 3W01A 3DBNA 4I5RA 7REQB 1V3MA 1VR6A 3APGA 3QZ6A 4UWMA 2CWNA 3RPTA 4C6PA 4UCFA 4IM4A 2NT1A 3EPNA 1DBTA 3AZRA 3UNDA 4PMZA 3DOPA 1QASA 2ATSA 2PTDA 1G4PA 4W8LA 4W85A 5LYRA 4O12A 4GYKA 1HG3A 1GYLA 5D9NA 1Q3NA 1QXLA 2WC4A 3AYSA 4XUGA 3ITLA 2ZFAA 3KVJA 1XLJA 4U5IA 1EIBA 4AIBA 4MAVA 4PB5A 3VU2A 3CPRA 1EHNA 3IIPA 2VRQA 4U31A 4LS1A 1DWGM 1E15A 3VGDA 4MWAA 3ZLFA 4QROA 5BOEA 1FHLA 4XD4A 3PZGA 1YE6A 4H7CA 4UQBA 3IIXA 5H91A 2DIKA 2WQDA 5D2TA 3HPZA 2E28A 4NZ1A 1RLDA 1FH9A 2P5NA 3LPOA 2RDWA 1RALA 4LF2A 5C0QA 1TVLA 1MUWA 3BXWA 3LCFA 2ZYFA 1KGUA 2MNRA 2WK2A 4YMZA 1ADDA 3A64A 4O1AA 3TWBA 4DF2A 4GISA 1PKMA 4O1DA 4Q7IA 3WK3A 2W92A 1BAGA 1EA9C 1QW8A 5M1TA 1MI3A 3LCHA 1OCBA 1A47A 4AVNA 2NQ9A 4IF2A 4KPLA 1UWUA 1GT8A 1NWUA 3ITVA 4O16A 4FAMA 3CPGA 1HN1A 2IXUA 3EZ4A 2VR4A 5CJ5A 4NIRA 1LZOA 3R7MA 3LS9A 3IVTA 3WFZA 1VHNA 4S39A 1NDVA 3WJWA 1MSSA 3E2QA 3O06A 1WB0A 4I90A 2H8XA 3LQLA 5RUBA 2DFAA 3UERA 2WVVB 3VD5A 5CPTA 1UH2A 3KTXA 1NEYA 3B06A 1PEZA 2PWHA 2AQVA 3GD6A 3AXXA 1BQGA 1AMYA 1S1RA 2NLYA 1FKWA 3GXFA 1DE6A 3QR1A 3K8MA 4DO7A 4C90A 4AXKA 2FZ8A 2NWRA 4GVFA 3L9CA 3QKEA 2V5CA 4IMEA 4C7FA 1MXGA 2Y7GA 2A3CA 3N15A 2YA1A 2GUBA 7REQA 5A6BD 1GVFA 2VCAA 1I60A 4FNTA 2ZICA 3ZIZA 3RRXA 5AC5A 2JK2A 2OYLA 4HA3A 1J01A 3ZSTA 2B7OA 4XO6A 1QVBA 2OPJA 3PBUA 1EJVC 1EFZA 2PUZA 3RCNA 4EE9A 4TTUA 3VIJA 5L6UA 1GG0A 1K6AA 2QPSA 3PWIA 5D8ZA 3W7DA 1H3GA 1G5AA 1B2YA 1L6WA 3YPIA 2Y89A 3HN3A 4M1BA 3SGGA 5AC6A 2YKKA 5C9RA 1LWIA 3B03A 1RBAA 3EDEA 1I2RA 4ONVA 1FFQA 3UT0A 3WQWA 1W9BM 1LORA 3OIHA 4QITA 2H9AB 1TV4A 1CNVA 1ELSA 4N02A 4ZENA 4QDMA 2PDHA 2CERA 1OBAA 1OB0A 2ZX6A 3KHDA 4Q4MA 5MF5A 4EPBC 2BOEX 4DJED 1W3TA 1LWHA 1AD1A 1SFLA 1UUMA 3B9OA 5JH1A 2CKRA 1DEDA 4Q6JA 4PSRA 3KS5A 1C8YA 4RE3A 5AC7A 1Q4NX 2A7PA 4E6MA 2QCDB 4Q33A 5BXTA 3CUZA 1UASA 6ENLA 2CKSA 1PO9A 4HT3A 2HE5A 2OEJA 2R9RA 1HZYA 3T0DA 3M5YA 1AH4A 3GNDA 1CW2A 1R8LA 1XKYA 2I5GA 5EYWA 1W5MA 3CV2A 1A5KC 3AMCA 3TQVA 1GUVA 4JIRA 2WVVA 1SR0A 1W8GA 3TROA 3TW6A 2X09A 4US5D 5A6LA 5G1MA 1X97A 3KW3A 2SFPA 1RY0A 2C71A 4ATDA 3M5XA 4HPGA 4JS3A 3MDUA 3BQ5A 5JXQA 5DXXA 1W1IE 1BSIA 2FGBA 3KDNA 3HQNA 1RQHA 4RV8A 2X7WA 2UZ9A 5DBTA 5I2UA 4RJEA 1EUNA 4J40A 4JAWA 3SY8A 4OQVA 3F4NA 1CECA 1KLYA 2J9XA 3MA8A 1V6XA 1D8WA 1C91A 3Q65A 4EXAA 4Q3MA 1BFNA 3C0SA 1XYLA 5BRBA 4B2DA 3W53A 1EDGA 1K8CA 1Y5WA 3EDKA 5AZ1A 2W79A 1RCOB 1DKWA 4MFEA 4BK9A 1S46A 3CIWA 5FF4A 3WLNA 3INPA 5DBUA 1UWQA 3M0IA 4PBGA 1TZ9A 1K8YA 1JFXA 4N9BA 3NL5A 2OZ0A 3E3HA 4V15A 1P6WA 2GFTA 3UYCA 3F2BA 2ZZ7A 2OX1A 1CXLA 4QQ3A 2H9AA 1ITXA 3TFXA 3AXIA 4LBUA 2WCGA 3AIWA 3I7RA 4PB3A 1UR3M 5DMNA 3VIKA 2DVXA 3N2TA 1KRCC 1BGAA 1XUZA 2J47A 3LX9A 3G6MA 5GNYA 5HWNA 4LT9A 2V3FA 4GVGA 4NNCA 1HL8A 3AHVA 4BR1A 3GU1A 2G95A 1M6JA 2ZUNA 1YNPA 3BGGA 4W7WA 1RD6A 1J5TA 2CHNA 1Q7MA 3LU2A 2PAJA 1BG9A 1NIUA 2IKIA 4OOUA 4JTSA 3UWVA 3B4YA 2Q3OA 4WOZA 4WKAA 4HA0A 3I4EA 1ZBCA 1R3QA 1RLCL 3W37A 4WZHA 1SJDA 4MYXA 2OLHA 3LXCA 1V0KA 1Z42A 5DLCA 4L64A 3H22A 1TV8A 2OFJA 2VGIA 3TH6A 4R7JA 3EWXA 3WF2A 2Z6JA 4C7DA 1IE7C 3WJYA 3HA1A 1XYFA 4H9VA 4CD4A 4J3XA 2JIWA 1J9YA 1E5JA 1KQZA 5CZ0A 3S5NA 3SQMA 3VDAA 3NCOA 1R85A 4LBRA 4AD2A 4KGLA 3GVGA 1K4HA 3E6EA 2Z26A 4JIEA 5DY3A 3LEPA 5IOBA 3BO9A 2ZC8A 1H5YA 5C71A 3N4EA 3VCNA 3DKJA 4RDVA 2CW6A 4JTRA 4E8DA 3KM8A 2D23A 2W0UA 2CLLA 2DQXA 4UR9A 4RZ5A 1XISA 2X30A 2FMNA 2OCZA 4EPKA 2J88A 4BI5A 1C9DA 2E0PA 3T1GA 1KFWA 1S3HA 4S38A 3BJSA 1POKA 3IJ8A 1U33A 3VD7A 4RDWA 3DG6A 3H6OA 1M7XA 1XDLA 4J3VA 3IRSA 3UXIA 3KRSA 1J6PA 1EPVA 1XUUA 2XTKA 3N11A 2VFIA 2OELA 3BZGA 3IAPA 4L7ZA 2VX7A 1IXPA 4MFDA 3RCYA 4HU0A 4MJ2A 1Y8BA 5BRQA 1TPH1 3UCCA 4GQRA 1KGWA 2W63A 4LAOA 1O5KA 5KZEA 4DLMA 3DI0A 2E9MA 2PLJA 1YYAA 3WD1A 4YPJA 1YHTA 4OV9A 1JAKA 5KZMA 2J75A 1MUCA 3FY1A 2H6RA 3BAKA 4GI6A 3URBA 1H09A 1QNRA 4Q8VA 3M44A 4GGHA 2F61A 1KRAC 4DIAA 4N7QA 3N2BA 4JFVA 4Y8EA 2BVWA 3C2YA 5B7ZA 2DDXA 4BCEA 2BFGA 3CQJA 4WK9A 4UTHA 3WF0A 5CSRA 2OU4A 1W31A 1F74A 1WDRA 1MRQA 4JY8A 3CZGA 5E0FA 2B4GA 4A8LA 3R8HA 3N6JA 3CEUA 1H7NA 1W1A1 2FGLA 4ZQOA 5LA2A 1XI3A 1V3IA 1UR9A 4M81A 3C2RA 5CZSA 4FSAA 5LNVA 3ARXA 3QR3A 1LJYA 3EOOA 3H4XA 1IEWA 4EXQA 2WHLA 2WMKA 1G4TA 3PJTA 1AH3A 2KAUC 4OJYA 2X05A 3QLLA 2Q6ZA 2V68A 5AYYA 5FA5A 3WJXA 4Q8UA 1SPQA 1PXGA 2TYSA 3F03K 3TYAA 3UPWA 2FPTA 2HPIA 5ECVA 3DXIA 3I3BA 2EXOA 1JYVA 2I5IA 4LVBA 1S2AA 1I1XA 1VPQA 2D73A 4UR7A 1SW0A 2YLAA 4MJMA 3G3MA 3W6YA 4KFPA 1XYAA 2VCCA 5ABTA 1QNVA 3KL5A 4ZBCA 2R94A 5EMUA 3G5EA 4HIBA 3R8RA 1L6FA 3G0SA 4QR6A 3E5BA 4CCCA 3GKFA 4AF0A 3UXKA 3OLDA 3I10A 4JHMA 3HG3A 4TOQA 1H50A 3SUVA 1PYFA 1KC7A 4WDXA 1CLKA 4KBXA 3W7KA 2PDBA 4HHHA 3LV5A 4AZGA 3MSYA 4CU6A 3S47A 1V02E 3UG3A 5ABFA 2DJLA 1E71M 4IGSA 4Q4QA 2V6AA 1CGUA 4QSFA 3LK6A 4GPNA 4PUKA 2UY2A 3SY1A 5A69A 4FF7A 3UPMA 2G41A 3CV1A 1Q7QA 5GVJA 1RQBA 4LEQA 3JU2A 4B15A 3B8UA 1W1YA 2HCVA 2HXUA 3E0LA 3MCMA 1OCNA 2EQDA 1O1ZA 1Y7VA 2J7FA 3JVAA 4NASA 5CH9A 4PTNA 3W81A 4GZEA 1B31A 1S2CA 2AKZA 2ZE0A 3AMGA 2FTYA 4CVWA 3THAA 3W70A 2E6YA 1TRIA 1GEQA 5D38A 3AWOA 4XV0A 3PWAA 5HNRA 1VHCA 3XIMA 1W54A 1LLOA 3VDCA 1E40A 3QSRA 1H7RA 1DJYA 4KF1A 3SIZA 3P14A 3FSUA 4AUBA 3EX1A 1MQRA 1X8FA 3VFLA 4CCZA 2OZ8A 2XPKA 4OBRA 3OHIA 5F4WA 1ZBVA 1UBPC 2C7FA 4FLSA 2R14A 1E51A 1OFDA 2G8ZA 4XD6A 3HTWA 3OZPA 4RPPA 3IACA 1XFBA 3D5HA 1TTPA 4DO6A 3EOEA 4WGXA 3VIOA 2C13A 4DM2A 3ARRA 3V5CA 4DHGA 1KA9F 4LSBA 3NTYA 2GZXA 1E9IA 2WNNA 1H61A 3H23A 3CBWA 3DGBA 1G01A 1GVQA 4UBPC 4CD7A 4DJDA 2VDHA 4MJZA 1TWIA 2VX5A 2R82A 1ZGDA 4LWWA 4O57A 3AJXA 4XUYA 3UY7A 4DB7A 3N19B 2G3FA 2OSWA 1S5MA 2BG5A 3A4WA 2PP3A 3GUGA 5DT5A 3BAWA 1Z3NA 4RE0A 3W4RA 3G1XA 1YBQA 2J79A 2Z1KA 1XIIA 4Q7NA 2E09A 3BLEA 2QS8A 3QGVA 4Z1YA 3FV9A 4WXYA 2AMXA 1HQTA 4L4OA 4XIMA 3S6TA 1E0TA 2QXWA 4AD5A 3BG3A 2DW7A 4UTWC 3SRDA 4ZO8A 1UCWA 1BKSA 1AG1O 1D3GA 3U9IA 3U4AA 1V0MA 3CWNA 3TOYA 3LM7A 2DT0A 3M64A 3RDKA 3KZPA 2PDGA 1FUYA 3HO8A 2PRLA 2EPMX 1KR1A 3AO0A 3DDMA 2QDEA 1ECQA 1E3XA 3IIVA 3FN9A 1XL9A 4RE2A 3MP4A 4I8YA 4MLJA 3C0QA 3ALFA 1KM3A 1BQCA 1EOMA 1EBGA 4UTWA 4H8VA 1E1EA 3ITGA 3M41A 4RPQA 3TYBA 3WJSA 2QV4A 2NSOA 3W88A 3DI1A 5FI8A 2IUZA 1TQXA 3ABXA 2C1IA 3B0PA 3STEA 1XIGA 1JZ3A 3M4HA 1EWDA 4WIWA 1ICPA 1DQXA 3KWXA 1QNOA 4RNIA 3WQPA 3SADA 2PLCA 1OINA 2CXGA 4ORIA 3CMGA 5AHIA 4ZA0A 3MCNA 2OWCA 1MDLA 3VIHA 1ADSA 4S3DA 1QT1A 4CNPA 4QJ4B 5FD0A 9RUBA 1Q6QA 1VPXA 4DYJA 3MWAA 2VR2A 1US2A 4XD3A 1QATA 1SMDA 2PMQA 5CJMA 3N9SA 4GQGA 4WKFA 3A3HA 4O11A 4QJ3B 3L2MA 4O54A 4HYWA 1HKIA 4AZ7A 4TUFA 4ZR8A 4JFWA 1IEIA 3L66A 2P76A 1VRDA 5JMUA 4OOZA 4CU8A 3SRHA 2UY5A 2OODA 3G3DA 2YL5A 4O19A 3QYQA 1EDTA 3E2VA 1WDDA 4QISA 2AAAA 2O56A 4ZCWA 4LPCA 4K68A 4MB4A 2GVLA 4MY8A 2OQLA 2YW4A 1R30A 1XLAA 3OW1A 3UYIA 5G1YA 3N1AA 1MFVA 3HQ1A 1EIXA 3GE7A 3TUUA 2B7PA 3TU9A 5AB3A 4B4FA 1HJSA 4CQDA 3VDHA 1I75A 3PFRA 2WO5A 4H00A 4IJCA 3U7VA 4DYEA 2X42A 2D3NA 1DWIM 3CB3A 2Y7EA 1UR0A 3T08A 1B3ZA 3ITCA 1LQAA 3EWYA 5I6SA 2PDIA 4BQ5A 5A6SA 3BQ6A 3UXDA 1MZHA 3CHVA 3LZ3A 4PMJA 4C60A 1IWPA 2MUCA 3RR4A 1XP3A 1S5WA 3WLMA 3CV6A 3W1MA 1AJZA 3PPHA 5HJYA 5DRIA 2XM2A 4A2RA 2X0YA 4GABA 3ICJA 3LPGA 2ZXBA 4S3AA 3CZLA 3F5LA 2J7EA 6CGTA 5LNSA 3H53A 1TJ1A 2P3ZA 4DN1A 2GDVA 1R7AA 3RG6A 2NV2A 3LV6A 3KRBA 1VFHA 3QJAA 1A50A 3RX2A 5JQ9A 1P0KA 4JICA 5BROA 3URAA 1UG6A 3QY6A 1UUQA 4AX7A 3BK0A 3HGJA 2YW3A 3LCWA 2A4AA 5CPMA 3LMYA 1WZAA 5A2CA 5HMFA 1NAL1 1P4CA 5EPDA 1S39A 1FWCC 4ZVJA 3T8QA 3FX4A 3NZGA 2YBTA 4ZQNA 1QCWA 1CXFA 1U22A 3C4UA 3RPMA 1PE1A 4XZBA 4UFLA 4Q8MA 3SEPA 3HG5A 4ZFMA 4MTVA 1UD2A 3C61A 2D3LA 1BYDA 5HMSA 2OEMA 3IGSA 1W9UA 3TZFA 4L1WA 3OVQA 2QCEA 3KX6A 4MMWA 2ZC1A 1FP9A 4LAUA 1XJBA 4F79A 3AHXA 1GPFA 3CB8A 4P8XA 1JZ2A 3ES7A 3W7CA 2G3IA 1RHCA 3UG4A 3A22A 2PDCA 5CSUA 3PNUA 1GW9A 5G1TA 1YMYA 1T96A 1HFBA 4EX4A 4HPXA 3WQEA 1KXTA 1XH0A 2BASA 3C2OA 4DZAA 4HZ6A 4JKMA 1CPUA 4HK7A 4PB4A 3HJZA 4AZBA 1C7SA 3H2NA 3RMEA 2JBMA 1BGGA 1M7JA 3W1LA 5E5CA 4Z2HA 5CPLA 2WYSA 2VFGA 4L6OA 1EEXA 2C3ZA 4ACYA 4HOZA 3ZS4A 1JL8A 4NY2A 7ODCA 1OGGA 3O7UA 3AMDA 7TAAA 5KZDA 1GQLA 1TV2A 4GCAA 4TIMA 4A6GA 3VNLA 5D33A 3TYCA 1RXOB 1HVXA 3V4BA 4IUOA 4DUOA 2DUZA 2X7VA 3RU6A 1VBGA 1BRLB 1W1VA 1P0NA 3BV4A 3SN0A 4BJHA 2WJDA 2PDJA 3NVTA 4FNUA 2R1MA 1EF3A 3C3NA 3F5KA 1DHPA 2XSBA 4BFAA 3IARA 3AQUA 3QMTA 3GNRA 3MJYA 1ZCCA 4CD5A 4YYFA 4WQ6A 3IJLA 4FALA 3L0NA 3BGJA 2ZX7A 3OJGA 2WM1A 4ZGYA 1XLEA 2PWDA 3I6TA 4F0SA 4JQAA 2C1HA 2WSKA 2V69A 4JTAA 3H55A 4HN4A 1FDJA 4IL0A 5DMMA 4XKMA 4GH1A 3VC6A 1U83A 3EB4A 4MKSA 2BY2A 4O15A 2QVHA 4ZOAA 4NJGA 2GJPA 1OF6A 4D6CA 2P10A 3VKCA 1FHUA 3CNYA 4HHMA 1V6YA 4JEJA 3H2AA 5A6AA 1VEPA 1VCFA 2NX1A 3Q2DA 3K4WA 4HNNA 1GPWA 1J10A 3W7LA 3RR1A 3DHDA 3G1AA 3T0CA 3D3FA 1MVYA 4BF5A 4GJJA 3LHWA 2FPYA 5FJJA 3FAWA 1A4MA 5C7VA 3VC5A 1TUFA 1QWKA 2BVDA 3I6RA 1O60A 1R47A 4ZOBA 3V1HA 1UP3A 3PAJA 1V79A 2GK1B 5CXPA 3ME3A 4GQBA 1UBSA 4NHVA 4EF9A 3CL7A 1OK6A 4D8ZA 2F6XA 4XSLA 4GFIA 3W82A 4UOJA 2JEPA 1A5OC 1DORA 1QI4A 4AVFA 4WKHA 4O0KA 4JNZA 1FH8A 3R58A 1LM1A 1BYAA 5FAJA 3G8EA 2IKGA 3M0VA 2NXHA 1F9CA 3P93A 4ZODA 5LIUX 1ONEA 4QLLA 1HGYA 3EXSA 4AW7A 3H7VA 2WC3A 2A7NA 2QJHA 2R24A 1GTEA 4D6JA 4F0MA 1UD8A 1UWRA 2WC7A 4AISA 1A5NC 4AEEA 1EJSC 3NZQA 1P0EA 1RV8A 1ZRQA 4KWUA 4S1FA 1SR9A 1BRLA 2W61A 3WBXA 4G7EB 2OVLA 2W4XA 4C1LA 2WZTA 2OYKA 3TYZA 1W3HA 4PMQA 4DJEC 1Q6DA 1QUMA 4OGZA 4F2TA 1DJQA 2J8FA 3CC1A 5HDRA 4IMAA 1L9WA 2OZTA 3M9YA 5HWJA 2GQ8A 3C2FA 3N17A 2O9PA 4MUPA 2CBIA 4JIIX 3RUBL 3L4VA 1JCJA 3GTIA 2OZ3A 4LYRA 4X2PA 3ECQA 1PZ3A 4RNHA 4Q8OA 1OCQA 2C0AA 1XBXA 4PE8A 4DJEA 5IHRA 2ZVRA 5EB8A 2ZKMX 3QEZA 1R5YA 2WLYA 1CGXA 1JF5A 2FHFA 4GC3A 4GO9A 1ISXA 3IIOA 5C9XA 1B57A 1UOZA 5FCZA 2YR1A 4R3UA 3GNNA 1GVIA 1E9YB 2PP1A 4UFJA 2VC5A 4TV5A 4R9XA 2UBPC 1G7VA 1XX1A 5DCBA 1T8QA 4H7VA 4IQEA 2GQ3A 2G3MA 4AIUA 1J79A 3W7HA 2V2CA 2QJIA 4XKYA 2GK1A 5D37A 5IBXC 3NQ2A 4JR5A 2NUWA 3OA3A 5GJMA 1J11A 1RPKA 3BLDA 2VD8A 2VZSA 2ZZ2A 3EWZA 4GY7A 4Q32A 1TFVA 3PS7A 3VIPA 3DKLA 3EOUA 2NW0A 4DNMA 3OBEA 4GWEA 5CZKA 3LQGA 3W7GA 1E55A 1UPPA 2Z00A 4P8WA 4ROQA 5IBXA 1VLIA 4LUIA 4HA4A 1ONXA 2PDXA 1RJRA 4FNPA 1NELA 1W9DM 3H7UA 2BTMA 6XIMA 1YXCA 2HK0A 2X2GA 1A0EA 3NZ1A 3BLKA 3FAXA 2PDMA 3IRDA 3R12A 1PTGA 2FB3A 4QCEA 2H3DA 4G7EA 2XIIA 4F3HA 2WZHA 2CZ5A 3E74A 4QIUA 3TFCA 4I7UA 4P7RA 5I24A 1Z48A 4L4PA 5EY5A 3QPZA 5A6TC 2OO6A 3ZVHA 2PDNA 3ABZA 4WXZA 1GOXA 2VZOA 1P6BA 3CO8A 1NY1A 3ENLA 1TSIA 2WVUA 2O7QA 5EGRA 1Q66A 2XVGA 4JYEA 4DNHA 1Q6OA 2D22A 1MMFA 3CUIA 1DJXA 3CWOX 2E25A 1EUAA 3MHUA 4JPGA 4JEQA 5A8MA 4HVXA 1Q63A 3KTCA 4PMDA 1W5OA 1G9HA 1UZDA 4DY1A 1VH7A 8A3HA 4UZSA 3TAKA 5AFDA 1G1YA 3UF9A 1JCLA 4FP1A 2F6UA 1QHPA 1E4NA 2WM0A 1F3WA 4UMCA 3TN3A 1R2TA 1VIWA 1JYNA 4MVAA 4IXXA 3SAZA 1Q6EA 4GXPA 3L65A 3N9KA 3WLHA 1SU5A 1UKTA 4MM1A 2YCKX 1RK6A 3N3MA 1K9TA 1DJGA 1TX0A 3QHOA 3RYSA 3Q4DA 4B91A 2E1WA 2ZA1A 3G1FA 2DGAA 4TVDA 2QUMA 3BLFA 4ZO7A 3A13A 3LLFA 2E6FA 3PBYA 1GNXA 1H1ZA 2JEQA 2VENA 4UFKA 1F6KA 2CLIA 3NQAA 1HT6A 1XIMA 3GR8A 2PTWA 4ATWA 1OX4B 3M0ZA 2I9UA 2IKJA 5CGQA 3V0UA 3WK1A 1E4MM 2X8RA 1YNQA 2HWGA 3SUUA 2WCSA 4NZJA 2I14A 4IP4A 3LCGA 4H9TA 5E6YA 4GYPC 2BOFX 2E68A 3CQ0A 1CWYA 4AB4A 1YTKA 4YJ5A 2H90A 4CCDA 4WD0A 1IXNA 2YFOA 4ZL1A 4YIWA 3NQFA 4ZMGA 3ZLGA 3S5YA 4NNBA 5CGTA 1XRFA 2EPLX 1O95A 4LVAA 2NLIA 1CYGA 3TR2A 4Q4OA 1YDVA 1GZJA 4PULA 3I68A 3DEQA 1FX6A 1DIKA 3OBKA 1LOSA 1QAPA 3M0MA 4NI3A 4GYPA 1Q8JA 1R2RA 4QS6A 1RVGA 3RIKA 2HJPA 1N8IA 2OXNA 3W7RA 3UWQA 3HIJA 3V0TA 5BU9A 3VUPA 4K3ZA 1RUSA 1IHIA 2TAAA 2J9ZA 2NT0A 4J5NA 2ZRZA 1HJQA 1WKEA 4JOMA 2W91A 4Y9PA 1UOKA 2RAGA 3IPWA 3C56A 1WO2A 1PAMA 4Z2KA 5HUOA 1GQJA 1A3HA 5BWFA 1LBMA 4C6QA 2DPEA 4S3KA 5FKYA 4M7TA 2EO7A 5I79A 5AECA 4IGMA 2VYOA 2ALDA 1MW0A 1UR4A 4I9JA 2GLKA 4PMOA 2VURA 4QM1A 1YADA 3COTA 5DX7A 1NSJA 1L6YA 1C90A 1MXSA 5I5RA 3C8FA 1W1B1 3H8AA 4H9UA 2CLOA 4R85A 3EMCA 3DFSA 1UKPA 1JZ7A 4Z42C 2IXVA 3SN4A 1UPMB 2W27A 4LC6A 4MKNA 4PTXA 4KW2A 4UIOA 4M1RA 4QRNA 4F0LA 4CN4A 3GU9A 4EACA 2QF8A 5FF0A 3AYVA 1JPHA 3IJDA 1IT0A 3S1GA 1HUVA 2CLKA 5C55A 1SJCA 3DUGA 4P8UA 2BB0A 4CKQA 4IIHA 3LTPA 3VX1A 3QQWA 2JE8A 1VFMA 4HMEA 4GNVA 2FB2A 3IUHA 4PGLA 3UCQA 1FWRA 4QJ1A 5CC3A 1ZUAX 4PTVA 3WLQA 4H1ZA 1MDRA 4P8VA 3UBPC 4QG9A 4OVXA 4PA8A 1ADOA 4NJKA 2RH9A 1Z44A 4C6DA 1DP0A 4AZIA 3GDRA 1BLIA 1US3A 3O9NA 1WOBA 3NQVA 2PRHA 2PLKA 2DIEA 3GTNA 1GEHA 5G5IA 4R7WA 4XZIA 3EX4A 3PC0A 1VFUA 3GFXA 2E3ZA 3WLRA 4UTJA 1A0CA 3LSBA 1QDSA 3P74A 1IIHA 3WNNA 5I06A 3WNOA 3AXMA 1OD0A 3EWWA 2PPGA 3RRAA 3WK2A 3S42A 2JKAA 1LDCA 3EEZA 2VOTA 5BCAA 4JY9A 4ZB0A 1RCXB 1XBVA 3D3AA 4DJFD 4BA0A 4PSPA 5BOOA 1AZ1A 1F76A 1ZP3A 5CPQA 3D47A 1Q6GA 4D6EA 5G2IA 4P7OA 1S5NA 1B3WA 3HFYA 3GAKA 1OHLA 4GACA 3CASA 4HNCA 2XZ7A 3O2LA 1NFPA 2QQ6A 4YTSA 2CZFA 3LBMA 3RX4A 1TIMA 2XGZA 4L9YA 1J2WA 1DJNA 1UJPA 2ZQ0A 1DWHM 1AQ0A 4C65A 2VRKA 3TP4A 2D0HA 4UQAA 2VNCA 3DG3A 2ZUUA 3BJFA 3DZ1A 3PTQA 5GNZA 4NQ1A 5B7YA 3TLQA 3T42A 2EPOA 2PDUA 3HBLA 1FBAA 1FWAC 3L5MA 1TPUA 3WMLA 1NOWA 4B16A 1HVQA 3MZNA 3CIVA 3KBSA 4DBSA 4HK5A 3KL0A 1X39A 4GI9A 4PYSA 3W9ZA 1KNWA 3W84A 2NVCA 3MSDA 1IYXA 2A0NA 3ARTA 1TPC1 3P3BA 1IEQA 2DVUA 3TN6A 2F2KA 1DXEA 4CGTA 1AODA 2CLPA 1UP2A 2OSYA 2C16A 4C6IA 1F3EA 1K9DA 2J13A 4ZEPA 4LAMA 1JZ5A 2OR2A 3RPDA 3PB0A 5I3KA 4HZ8A 4K37A 2QMKA 4LCQA 4FNQA 3WN6A 1VF8A 4HB7A 4NKCA 1JRCA 5DANA 3O0FA 5C5YA 1XYZA 2CZEA 1V3HA 3FK4A 1LT8A 1OX6A 2RDTA 4H6KA 2WMIB 2V82A 4V2XA 1GKPA 4HK6A 1KRBC 4CNTA 4M5PA 2A21A 2YDSA 3WJZA 1XG4A 3ZJKA 1QK0A 2DU2A 1KFKA 4YHGA 4JL2A 3UQNA 1DPMA 3HJEA 2ABBA 1TWZA 2BXVA 3C2EA 1Q5MA 4CD8A 3HPAA 4GUIA 4FIQA 2W62A 2X40A 4XK2A 3AHZA 1XLFA 1K1DA 2IPWA 1BYBA 2V3GA 4H6EA 5A95A 1UC5A 4F4RA 3EA2A 3L12A 4QE1A 3E02A 1POJA 3T6CA 4V28A 2O9TA 1Q2SA 2WCAA 2E6AA 2O4MA 4WRHA 1XC4A 4DWSD 3NPUA 1AJ2A 3VIGA 5I09A 1WV2A 4WSHA 5HMEA 4TX6A 4O1CA 3WD0A 1TG7A 2XHYA 4LCSA 4GJ1A 2OLAA 1UUOA 2PDYA 4PCTA 1LLWA 5G2WA 4GYJA 1AQFA 1AW1A 4KS0A 3NXLA 1US0A 5JIPA 1B4EA 2BHYA 5JBDA 2VCBA 3W02A 4F2BA 3ZJ6A 3CXOA 4EAMA 1P0DA 1GJUA 4IJBA 1V8EA 2X0SA 4W4QA 1FWJC 4H83A 2NQZA 2P88A 1I1WA 2EJ1A 1GQKA 1WDSA 1MWOA 1UH4A 2AAMA 4E38A 3B8IA 4AZCB 2CBJA 1F5ZA 3TQKA 4PUMA 1T7LA 4YHEA 4DPPA 4W86A 2V0TA 1NP0A 4OFCA 4AD0A 4C6KA 3S1XA 2Y85A 2NQLA 3UJ2A 3FYYA 2V3DA 3KCLA 3IGHX 4OWGA 1I2NA 1ZJHA 1AW2A 5HNNA 3TOPA 2WSRA 1J0ZA 3S6DA 2NWSA 3HG2A 1IIGA 3CAKA 3CZ8A 2V5BA 2PSNA 4DEFA 4LW7A 1BTCA 1CDGA 1UD4A 1EJ7L 1XGDA 1JPKA 4FR6A 1HF6A 4IMGA 3K8KA 4AD3A 1JYXA 2BXZA 4ZOCA 1VFFA 3TA9A 1A5LC 4FPSA 4LC8A 4CNSA 1LYXA 3ID7A 4MZ8A 3GC5A 3U3HA 3VGBA 3P81A 4K8HA 3VD4A 4J3TA 1LBFA 2HMCA 3QTPA 5JH2A 1JRBA 4BHYA 3FLUA 1XGZA 3RCMA 3DYOA 1QPRA 4CD6A 1U2YA 4LNCA 5FL1A 2OOGA 1M7PA 2E8YA 3T09A 2AGTA 2QCGA 2A3BA 3GDTA 1PIFA 4KCVA 1UR8A 3T7VA 1NJJA 4C6LA 3JW7A 2GGEA 6XIAA 4CCEA 1EC7A 3V35A 2HISA 4ICMA 2QJGA 1XINA 1EDQA 3NYDA 3AROA 4JYDA 5HAOA 1SQ7A 3RITA 3O05A 2DVTA 4QEHA 3E5PA 3I6EA 2OWWA 3ZR6A 4ACZB 1B3YA 5D02A 2DORA 3VI2A 5PTDA 1CTNA 2O9RA 2GUUA 5EA9A 4DZ5A 4MAZA 4MB3A 3RMJA 4RZ4A 3W25A 4AHOA 1WDWA 1F6PA 4NL1A 4AZCA 1H2JA 4L1GA 5J8LA 5BMXA 4K36A 1HJVA 2OGYA 3EA3A 4LJ3A 2EG6A 2VP8A 4XD5A 3VOJA 4M80A 4Q7BA 4IWWA 4WJXA 5DXYA 3LGDA 4FS9A 4LY4A 2V81A 5SWUA 3QW3A 3DAQA 3NVDA 3QOKA 2ALRA 1FKXA 3LLDA 1O7AA 1FDZA 3VE7A 4ZFCA 2E5BA 4MWAE 1XBZA 1G7UA 3PB2A 2BGQA 1EJWC 2Z2UA 2ICSA 5BYWA 3BOFA 3GSMA 3LCLA 3RFAA 2DZTA 3MSGA 3LTYA 1Q13A 5AY7A 4DO4A 4Z0JA 3M6YA 4GBDA 2EJAA 3W1RA 1QWGA 3HZ3A 1J2BA 5AYIA 4DAIA 3CUXA 4HMCA 3MV01 3WEMA 1V6WA 3CS2A 2PD9A 1JDFA 1JDEA 2CBUA 1Q8AA 2QCFA 4EOUA 2PTYA 4KWSA 2PA6A 2VC9A 1TPVA 3AU6A 3HV8A 1L6GA 3FOKA 1OYCA 1GHSA 3VFCA 2ACSA 3PFMA 4FXJA 1P43A 2Z7KA 4NI8A 5H6HA 3WX7A 1LLZA 2V3EA 3BV7A 2YXXA 3B05A 4HYRA 5BZAA 3MO7A 4J3UA 1VYPX 1FWBC 1JIBA 1O4UA 3BC9A 1FXPA 1QHOA 3W85A 2ZCGA 4GUFA 4S3BA 3UGVA 2LLEA 4WLCA 2WB5A 3ANUA 3WDRA 4L61A 1W1ZA 2WANA 5GQBA 3VNKA 4J3SA 2PODA 5E0KA 2PGRA 1GCYA 2VQUA 3E0WA 5LXXA 4A3UA 4ACZA 3DU0A 3UXAA 5LHFA 1UA3A 4GGBA 4RDZA 1ZCOA 4JFUA 2E1DA 4S3GA 5D04C 4GXMA 3GHTA 3QMRA 3W7EA 3R89A 2Q3RA 3L7RA 4MY1A 2HE8A 1EEPA 2EF9A 3MP5A 1KTBA 1A5BA 1VQTA 3VOCA 3NURA 4LBSA 4PEEA 5IXEA 2WMFA 5FF3A 4X0NA 2NQ5A 1QPNA 4NILA 4B5WA 1LCOA 1DWAM 4NAEB 2RGMA 3QC0A 4ZQPA 4KKXA 4I5UA 3K5XA 2W9MA 3RM9A 1Z9AA 3U57A 4NX0A 4RLIA 3OZYA 1E6ZA 1QW7A 5AHNA 4I9MA 2ABAA 2ZE3A 1F3TA 2CETA 3ZSSA 1HIZA 2BHUA 4Z1BA 3LRKA 4B5SA 1H63A 4B90A 1ZB5A 2TSYA 3N34A 3O6AA 4JN6A 1EGMA 4CLMA 4YWIA 2PZNA 4HPNA 2EEXA 4QP0A 3S0CA 3CZEA 4Q22A 3APYA 3CHFA 4KERA 2PDFA 4DBWA 4WOQA 1LUCB 3NR0A 3T44A 3RLGA 5D09A 4JGDA 4CQ8A 1LTDA 1N8FA 3PUGA 2ZZ1A 3MANA 3T07A 3SUWA 8TIMA 3UG8A 3CYJA 3ZQ9A 2GWGA 5FSDC 4LX4A 3PUDA 1KFBA 1EX5A 1XYCA 4XSMA 3BWWA 3ARZA 2Z4GA 4AYGA 1G0CA 3TYEA 3F5JA 4NG3A 2RGLA 2BZNA 2TRSA 2Y6ZA 3W07A 1MXDA 3LGGA 3I3DA 4Y7EA 2GDQA 1BHGA 2PP0A 3VD3A 4K8EA 3KOYA 3PBVA 4G1KA 5D2VA 4D71A 4BQ3A 2XUCA 2WJFA 1PIGA 3JUGA 4J7RA 1TJ0A 2IPJA 4Z08A 1VCVA 2XISA 3GG1A 3KRZA 2A3HA 5M5DA 4EVZA 2W66A 2BWGA 2X1RA 3W2LA 1OK4A 2HXTA 3KCJA 3EEGA 3G8RA 3CJPA 1UC4A 2XFFA 2FIQA 3B40A 5EMKA 4C6EA 2PWVA 3F2CA 4WSJA 4I6VA 3BAYA 4JIQA 1O5XA 2PGEA 3KDOA 1BWKA 3NZPA 5DEZA 2REQB 3R25A 1PWLA 2GSHA 2QJMA 3HU7A 1J0JA 1ZNNA 2P50A 3HPFA 4NJJA 1NQKA 4H2HA 3GS6A 4IFKB 5JIWA 1W3NA 4O52A 2E8ZA 4LYQA 1T40A 3VVGA 1Z32X 3LUTA 3OVPA 4NAEA 2EPKX 4N9CA 4PUEA 1TA3B 1X38A 1O5RA 3DYPA 3VYLA 4MB1A 5E1QA 4UMAA 3WQ6A 1N82A 4K1WA 4S3CA 2Q02A 2IPGA 2ZUVA 2XIOA 4ROPA 2ZZ6A 2DUXA 3VPLA 3DFHA 1BXCA 2A85A 2A3EA 1XH1A 2GSEA 3S9ZA 2CHRA 1VFOA 3H2CA 4IPIA 3L4XA 4EWND 3W87A 3HPSA 1ITCA 3K1DA 3MVTA 4H8NA 3WQVA 4IPLA 2I16A 1NDYA 1PBGA 4AIEA 5K4XA 2HVNA 4AFYA 1LUCA 8RUCA 2I1OA 1VJZA 4AWUA 4HPHA 3B8SA 1BYCA 3LM3A 3E49A 1R46A 2G3NA 2F8QA 4M51A 3DFTA 3FDKA 1ZAIA 4M6VA 4UB9A 4ZE4A 3W23A 2J24A 4WDUA 2VFFA 2WHJA 2PWEA 1GVEA 3KL3A 3ZMRA 4D1IA 4PC8A 1R6WA 1WZMA 1DJZA 3R4IA 4IMCA 5F4SA 4A3QA 4WJ8A 2IQTA 3EWBX 1UJQA 1PX3A 3BW2A 3KBNA 4DYKA 3CT2A 2OKOA 1DHKA 1HKWA 1G69A 1W17A 4IFRA 1YXYA 5D2WA 1C8QA 2TMDA 2ANUA 3W6LA 1I6NA 1VEOA 3HQOA 4X63A 5M2FX 2ACUA 3T40A 4ECLA 3H2MA 3I3EA 5BXSA 1XDJA 2Y5SA 2BMBA 9XIAA 4D6HA 4K6AA 4MWAD 3NQBA 4FNSA 3G1YA 5HPCA 4L80A 4Q4RA 1XPGA 1CGTA 4UMBA 3PF3A 4O17A 4H8HA 2J62A 3FXGA 2XVPA 1YEYA 2ASHA 4EPEC 5JBEA 4XZ9A 4O1FA 4IFKA 5C2GA 4F9DA 3TA6A 5G4EA 1A49A 1JI2A 1TA3A 3VMPA 1DIEA 1HO4A 4JTLA 3V5FA 3R5EA 3GFZA 2HS6A 3TC6A 4NZ5A 2NQJA 5DN1A 3CAWA 1HKKA 5HANA 1E1CB 1EP2A 1W6TA 2I9EA 4Y9MA 1ZY9A 5FESA 2D2JA 3CH0A 4W8BA 5CGMA 4RW3A 3UG5A 4HSNA 2HDJA 5F4XA 4P61A 1UB3A 2HBVA 4N2YA 5EMJA 3NOEA 4Y8FA 4X22A 3NA8A 2YYTA 1PSCA 2ON3A 1UKOA 3V36A 3UJFA 3BVJA 4PODA 3BMXA 2J77A 1LROA 1XW8A 3W22A 4MNJA 4RNFA 3A6OA 4LXFA 3VX0A 2HPMA 1UA7A 4JTDA 3IJIA 3AIRA 2C0HA 1V08A 2Y5EA 3SM0A 3CPUA 4AH7A 1CXEA 3UP8A 4O0ZA 5GNXA 2CPUA 4S23A 2PWGA 4EP8C 3WQOA 2BOGX 3G1HA 4JDYA 3TTQA 4GIRA 1KR0A 1D3HA 3GXIA 3AJ7A 1I8JA 3SB0A 3CU2A 3VKDA 4X61A 4FA3A 4JHOA 3CTTA 1X96A 1K77A 5CC5A 1RA5A 4BI7A 1PZ2A 5FJUA 4A3RA 4CNOA 2O9OA 5LXEA 3GIPA 2R1KA 2VFHA 3N4FA 4YN5A 4UXDA 3T4CA 4ES4A 3POHA 3GG7A 1T99A 3QRHA 1OIMA 5H1WA 2ISFA 5HUPA 4OBSA 3NPXA 3A4XA 1GZGA 4WHBA 1WKDA 1ZBWA 1B3VA 3TW7A 4FXRA 2P1FA 1AL8A 3ZT7A 4LYKA 1WKYA 3NGJA 4GVHA 4EK7A 1FA2A 3VINA 3PZOA 2VEGA 4GX8A 3WBWA 3KVMA 3QN3A 3KOFA 2AKMA 3BAIA 2A79A 3GHSA 3FW6A 1AD4A 1B1YA 5D9MA 1XWYA 2VUNA 2VOMA 1ZJBA 3O6DA 3G77A 4HZ7A 3UY8A 3MMDA 4BS0A 1J93A 1EHAA 1WBJA 4FX8A 3G22A 1E1CA 3N18A 4WY0F 1OFQA 3M7SA 3L23A 2VFDA 3W1QA 1SW7A 1TV5A 2VDIA 4IIGA 5EBUA 4JFSA 4NYUA 3L2LA 3FNDA 5HQMA 1F6YA 1E4IA 5A8NA 4KIRA 4I6KA 4HOXA 5C2XA 2AL1A 3TYUA 3U4FA 4D6GA 4QLKA 3WLIA 4GY0A 3G2GA 3CMFA 1XCFA 1A5CA 4OECA 4JD4A 3WD4A 4I9AA 1RBLA 1LL4A 4LOCA 4DWDA 4LANA 3T78A 3H2FA 2ZWZA 2OT0A 2YXGA 3AXHA 4P7QA 2ISVA 3AI0A 3MTWA 3WFAA 3KEHA 4GQ0A 2PWFA 3ARVA 4FIRA 2ATMA 1ICSA 1D7KA 3W72A 1XDMA 2A3LA 4BI6A 3ERPA 1RBOB 5AC8A 1JCTA 3N6HA 3DC8A 4A3HA 2VO5A 3OBAA 3IAQA 1TPWA 4TMCA 1K9EA 1AL7A 2XINA 3BDKA 3KRUA 1VBUA 4RV3A 2QNEA 2R91A 1EP3A 4B2DD 2WNZA 4KGJA 4XO7A 2GGJA 2BX7A 4K1GA 3WUBA 1BD0A 2QULA 2FQIA 1E9ZB 4NXSA 3BGAA 2D20A 3AS1A 2VGGA 5I07A 3C86A 2YX0A 3RK8A 3I65A 3UJEA 4JX4A 1WA3A 3QFEA 3EB3A 3VILA 5H8MA 4O50A 4NYYA 3UETA 3LB0A 4OT7A 3W2MA 3FJNA 1RR2A 4JQ3A 2I7GA 3PPCA 1XHGA 4N0RA 3PBMA 2FFIA 3NQEA 4R34A 1FY6A 1UWAA 3ONCA 1FWNA 5KETA 1NWTA 4UNLA 4YVXA 1GVYA 1MZRA 3K2GA 2VZUA 5FJIA 2BNJA 4UNKA 2C15A 4C1KA 2DSKA 1EL3A 1GORA 2G3JA 5M3WA 1WXJA 2XU2A 1DQUA 3P0WA 1EC9A 2GQ9A 3A3XA 4B3KA 5F2GA 4EXBA 4MSSA 4Q8PA 4B3ZA 1W32A 1OADA 5KMYA 1S5VA 4ZSTA 5HXMA 3W7OA 2QDHA 4JTGA 3RGTA 1M53A 5FEXA 3TMLA 3NM1A 5K9XA 4A2SA 3UESA 1W3IA 3KBMA 3DENA 4JQ1A 3K8LA 2QGYA 3W76A 2AMGA 5HMDA 3AZSA 2XZ9A 2B81A 4ICNA 2XDFA 1NM9A 1MNZA 3OGSA 3HMCA 1UQZA 4NP7A 4WDTA 4GMEA 1NARA 3MKVA 1QNSA 2BXYA 3WQFA 4AIOA 3QZAA 1KV5A 3E0VA 1EOKA 2YCIX 1XV8A 2J74A 1LRTA 4LCRA 3KVKA 1D7FA 2BGSA 3FEQA 3P6LA 3EWUA 4F0HA 1KCKA 5D05A 8XIAA 5E6ZA 4QE5A 2A5HA 1SZFA 1ALDA 1TJ2A 3IJ9A 1LQ0A 3S46A 2YBUA 2QCDA 3TONA 3GNPA 5LIWX 2YCLB 2R1PA 4GIEA 3VM7A 3L0GA 1SGJA 1IGSA 2CC0A 2DSZA 3CUJA 3VE9A 3VNYA 3RJYA 5AYXA 1V3KA 3R0KA 4JTCA 1TMHA 1FWFC 3RO6A 4KIEA 4GC4A 1BSLA 1WAUA 3L5LA 3W0KA 3RLVA 3BW3A 2XGIA 4Z2IA 4CQ9A 3ZWSA 1U1JA 3K4DA 1GWJA 3EX6A 4ILSA 1OY0A 1KD0A 1JCMP 2Z1SA 4N9EA 4E2DA 3VD9A 3SCUA 1LF1A 4Y9OA 2FZNA 1X6LA 3EGJA 4GA8A 3QSTA 2XWDA 3APTA 4PRWA 3RM4A 3NQDA 4LUTB 4FI4A 3N25A 1EWEA 3CWHA 1QI5A 4QX4A 4ADTA 2H8ZA 1L8NA 3T9PA 3T0AA 3L0KA 3S1UA 3P7YA 1OD8A 2FLIA 3STCA 4IP5A 1KRMA 4BF7A 4JTEA 5T8GA 5HWMA 1H49A 3LRLA 4JKLA 4D1JA 3VKKA 1KM6A 1JGMA 1YXDA 1F7BA 5I03A 5E0CA 1J96A 5I3HA 5A2AA 1S2WA 2ZX5A 3E2RA 1H62A 4F66A 4IICA 3DFPA 2HRWA 4PCFA 2V5DA 3TC3A 4MGGA 4CN1A 1F2JA 4R9OA 4CVUA 3W7MA 4KT2A 3N3TA 4R5EA 4FOJA 5HINA 2J8TA 3GW3A 4S3FA 1SYTA 3ZOAA 3UZZA 3WIJA 4DXVA 4AD4A 1XH2A 1TJPA 2CZVA 3WNMA 1CGVA 3U8GA 1UROA 1ZS2A 2G4FA