2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
b'NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase class 1
molecule tags Lyase
source organism Porphyromonas gingivalis
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
4GNJA 3LHZA 5K4ZA 2ZA3A 2VEPA 1I2RA 3NQEA 3G1HA 3NQ7A 3L21A 4DPPA 4O10A 3EWBX 4BF9A 1TCDA 3HIJA 5LNUA 3W7QA 2VENA 1P0NA 1AW2A 4E0CA 2WO5A 1B4EA 1MXSA 4UUIA 4BWLA 1O5XA 1N7KA 4PL2A 2IQTA 3G1AA 3YPIA 3EXRA 1TPC1 1ZALA 5C2XA 4M7TA 2PRLA 1FWSA 2AQWA 2XN0A 3W87A 3M44A 3TQ0A 3IVTA 1H7NA 4RR4A 3VNDA 2VFEA 4O57A 3TJLA 3QPZA 3JS3A 3W7HA 2WSQA 4Z08A 3EEGA 3LI1A 2AAMA 3H55A 1FY6A 1NF7A 3HB9A 3W23A 4WQ6A 1Q6QA 3EX1A 3TK7A 1CI1A 3R89A 4UCGA 3UWUA 1OJXA 3WJSA 1FWNA 4PC8A 3LCWA 2VEIA 4S2BA 3HGRA 3NM1A 3S42A 4R53A 2ZZ7A 3M7WA 4HSNA 4M6VA 3G0XA 1W37A 2JKEA 3MJYA 3G3DA 3WFAA 1KFKA 1Q6RA 1WOBA 1JRBA 5CZTA 3VCRA 3W74A 5DY3A 4MKNA 5IBXC 3DHFA 3VE7A 3QM3A 4N9BA 4WXZA 4O4WA 1NVMA 5EA9A 4NJJA 5DCBA 3TMQA 1SZEA 4H6KA 5ABTA 1Z48A 4IUOA 4K8HA 3W73A 1FQ0A 2X30A 4K7VA 2ZFAA 3N2MA 2V5LA 1OFRA 4IWWA 5FF0A 5TQLA 3A23A 2ZBTA 3C6CA 3NL2A 1LOLA 3KVJA 2XN1A 1HL2A 1VC4A 4LTSA 3P8JA 4XWUA 4CQ8A 4NVTA 4N2YA 1KFEA 2V30A 5FF2A 1G4PA 4JTIA 1YYAA 1UASA 3LM7A 4NZJA 2V8ZA 4S1FA 1ZHAA 2CLLA 1WQ5A 2OT0A 2FFCA 4GWEA 4FNSA 4IOTA 1VYPX 3M1ZA 1PS9A 2DJXA 3PSVA 1I2PA 3HPZA 3IIXA 4NT0A 3N9RA 1VLWA 1SFJA 4JY9A 4LVDA 2W6RA 4NX5A 4XTDA 2J6XA 4WD0A 4CCDA 1W5PA 1QO2A 4A2RA 1LOQA 1I2OA 3IIVA 3FA5A 3W85A 5F2MA 1XBYA 2YYUA 2NUYA 4GUGA 4A3UA 2H8ZA 2PRMA 3L0KA 3DFQA 3F03K 5AC8A 4YCPA 5CPMA 1H1YA 4MPQA 2V9DA 1LORA 3W7JA 2Z6JA 3CLMA 3M16A 3K30A 3PS7A 2ZRVA 4O50A 3RU6A 4JD4A 1PV8A 4PA8A 3IV3A 2G95A 2HSAA 1DBTA 5J5DA 3I7QA 4YLWA 1TPB1 3PAJA 5CSRA 2C16A 3DHDA 4XZ9A 3ELFA 4LUJA 1TPFA 3CEUA 1XFBA 1JCLA 3TSBA 4ZMGA 1H50A 3JR2A 3ATZA 3GDRA 1X8FA 3OEXA 2B4GA 4HPJA 3Q94A 2FB3A 1LLZA 1TB3A 2JKAA 3P7YA 4LRTA 4WXYA 1EPXA 5D2XA 2CLOA 4NU7A 5C6MA 3E12A 2CU0A 4N02A 3WK2A 3DI0A 5AHEA 2NX3A 1DHPA 2JGYA 3V1PA 4DQWA 4O1CA 3BG5A 3LV5A 1XM3A 3QSRA 5K9XA 3LXAA 3QMRA 5U7SA 1LBMA 4PL1A 1EP3A 2H8XA 3M5VA 1JR1A 3U2OA 2BZNA 1LRTA 3QEZA 4JGDA 3WK3A 2P10A 3O15A 1DJNA 5EKYA 4LNYA 3T40A 3W7CA 3MP3A 4EOUA 1RPXA 4JTLA 2P0OA 2ZRWA 4AXKA 4E2DA 1VCGA 3E96A 3HQ1A 2X16A 4K39A 2FTPA 4CLMA 3KOFA 3THAA 3S1XA 4N4PA 1VYSX 2A85A 5CKSA 2XN2A 3P5YA 4UMCA 5K3VA 3L0GA 3NVTA 1KLYA 3LCHA 1JCXA 3C3NA 1L6SA 5KSWA 3BW2A 3GNDA 5G4WA 3M43A 3O6CA 2CLIA 2GVJA 1TPH1 4ZQNA 1ME8A 5DN1A 3P74A 3LCIA 4BK9A 3FS2A 4HNUA 2C19A 3FYOA 5AC6A 1RQBA 1KV5A 2NXHA 4RJEA 6ALDA 1OYBA 4NUWA 1FCBA 1ZAHA 1T0OA 3S9YA 5CGQA 3TXZA 1GYLA 1P1XA 1OFEA 2R14A 1W54A 5EYWA 2Y7GA 1OFBA 3IIPA 5CZSA 3A21A 3W1MA 2DU2A 3L5MA 1F5ZA 5F1UA 2I1OA 4WJEA 4O11A 1S3HA 1ZAJA 5G5IA 3P80A 3CB8A 5G2WA 5D38A 5D03A 1GT8A 2OMAA 1VRDA 3P62A 1YADA 3B0PA 3EKZA 3WJWA 5LSMA 2NWSA 3CIXA 4X22A 1SU5A 2PRHA 2EAWA 4N9CA 3SW6A 2FDSA 4LWWA 7TIMA 5D04C 1SFLA 3TROA 1B3OA 1XBVA 1J4EA 1H7WA 4UNLA 3MBFA 4UC5A 1EEPA 3W1QA 3PY2A 3B4UA 2V0TA 1GQNA 1Z44A 2J88A 3CPRA 3W7DA 4JDBA 4H3DA 1ZAIA 4UNKA 3B06A 4JTEA 1MSSA 3LTPA 3MP4A 5CSSA 2V81A 2GQ8A 4N6EA 5HR7A 2F7FA 3N73A 4QQ3A 1NEYA 1LM1A 2W79A 3IIZA 3NQCA 1IXPA 4UTJA 3SI9A 3W3OA 4LS0A 3QRHA 5FF3A 3QYQA 3QZEA 1XDLA 2CFFA 1EIXA 4QISA 3SJ3A 1DQXA 1F05A 4UTTC 3QSTA 1K8XA 4JIQA 3L65A 2VEKA 5KZDA 4O12A 1B57A 1X6UA 3SGUA 2BX7A 3HF3A 3T4CA 1CW2A 3W1PA 5L6UA 3F4WA 4RZ5A 1RZMA 3W2KA 3HBLA 1OYCA 4B5NA 5LNSA 5HMSA 4JTUA 4HNNA 3WK1A 1I45A 3BLEA 5FI8A 4TX9A 3MI6A 3UNDA 1F76A 3L0NA 3B03A 4JTJA 1H60A 3A22A 4JTSA 1SUXA 4JYDA 4NJGA 2YCEA 3UXDA 3A5VA 4DBEA 4UFIA 4ZQPA 1W3IA 4BI6A 3GK0A 3E02A 4L4LA 1G4TA 4GRSA 4AHPA 5E93A 4LVFA 4DO4A 3VKJA 3OHIA 5AHLA 4LC8A 2QUUA 5BNKA 3T78A 3O06A 3UWYA 1ZJIA 3G0UA 1TTQA 1KM0A 1SR9A 3PM6A 1WXJA 3P67A 2RFGA 1QPQA 3KRSA 1T96A 3T7VA 3ABQA 3EWXA 4UFLA 3EB2A 3W2UA 1F2JA 4MFDA 1LRNA 1KW1A 3USBA 4Y96A 1FWWA 2O7QA 3ABRA 1GOXA 3LHYA 3OIXA 3A9IA 1GVOA 2FPTA 5K2ZA 4UFHA 1TPWA 4GFSA 1L9WA 3ZS4A 4NQ1A 4Z0JA 3LCGA 4O18A 1PL9A 3MYPA 3TAKA 2WPBA 4FO4A 1KLZA 2HS6A 3O63A 1KM6A 3QPYA 3M9YA 1VGAA 2ZZ2A 4FNQA 2NLIA 2QCDB 4IQLA 2E6YA 4P2VA 2B7OA 4EWND 1G69A 4KWWA 4HNVA 1LDCA 2C1HA 3O6DA 1PIIA 1ICSA 2DZXA 1UB3A 3RF9A 4JICA 3NQ2A 4K8EA 3LERA 3STCA 5HWJA 3KFTA 3MWAA 1JCNA 4DBDA 3GIYA 4IPJA 3CIWA 5FEZA 1FCUA 1UUMA 2EGZA 2QCGA 2GQAA 2ZA1A 1AW5A 4JN6A 1VYRA 1D3HA 1SZGA 3P60A 3W1LA 4BI7A 1K8ZA 3NQGA 3BG3A 5FF4A 4HHPA 1EWDA 2TYSA 4YCOA 1Y0EA 5D2VA 1QNVA 1J5TA 1R2TA 5HUOA 3TSMA 3B0VC 1GEQA 4AWTA 2DZWA 3NDOA 4NX0A 3C2VA 2WQPA 1OFAA 2CZ5A 2QDGA 1W1ZA 1ICQA 1ZCOA 2WSYA 4GBUA 1GVRA 1QPNA 4ORMA 4CQ9A 5E0KA 2J9YA 3W7OA 3IVUA 5A5WA 2PCQA 5AFDA 2YYTA 1KV8A 1TRDA 3TMLA 3HGSA 3EWWA 2JGQA 3MP5A 2A21A 5I3IA 2ZZ6A 1XI3A 2G96A 1XBZA 2ZRZA 4GUFA 2GQ9A 3W2NA 1OYAA 3DFOA 5D02A 1AL8A 1T99A 2QCCA 3M47A 1IIGA 4O16A 4RV8A 4ADUA 3I6RA 2YFNA 3FFSA 3NPWA 4MJMA 3TU9A 4DXVA 4M19A 5CZ0A 1IF2A 3JRKA 5AYYA 2XFWA 1OG0A 3O07A 3HGJA 2B0MA 5BMWA 1ICPA 4JDYA 3IGXA 2QCHA 2C18A 4YXGA 3IGSA 3IRDA 1FCVA 3G1VA 1RV8A 1ZY9A 3Q58A 4BI5A 3GDKA 5G1YA 3L2IA 3GXPA 4LUIA 1S5VA 1WYIA 4JTHA 2X1SA 2QF7A 3M5ZA 1JVNA 3W07A 4GUHA 2WKJA 4W9TA 3TQKA 1HUVA 3C0JA 4FXRA 1DJQA 3HMJG 3PC0A 3DFNA 5F2GA 3DFTA 1LTDA 3RLVA 1K7XA 1F73A 2FJKA 2RKXA 2YGYA 3LTSA 4OV4A 1KFCA 3S1UA 1DORA 1TPVA 1OF6A 3PG8A 3GZ3A 4Z1DA 4MYXA 4ZZ9A 3NGJA 1AMKA 3LLFA 1EP2A 1QPOA 1ME9A 1SW7A 2DZSA 5HQEA 3LBMA 1A50A 3BGGA 3T44A 3M5YA 3MYOA 2YR1A 3W1TA 4RZ6A 4I7WA 4X3ZA 3QMSA 2NX1A 3HG3A 1IGSA 1H62A 3G22A 3N19B 4X2RA 5CPLA 4DEFA 3O1NA 4DELA 2EPHA 1LBFA 3EX3A 1AK5A 4XTIA 3UPBA 2H90A 2RHGA 5F4WA 2DZVA 1GZGA 3I68A 3E0IA 1RVGA 3PF3A 5I3GA 3VE9A 3BPWA 1I2NA 3W6YA 3W7PA 2G5WA 4JYFA 3NQVA 3GX9A 4HIBA 5AYZA 4Q33A 4R33A 3TE9A 2EF9A 3PUEA 5HWMA 2BXVA 1K03A 1OX5A 1IXNA 1PVNA 2AGKA 1CX9A 4WZHA 4M5PA 1QWGA 3LCLA 3PB0A 3LOTA 3EWUA 1LBLA 2DZTA 3G18A 3P82A 4QAIA 1QO5A 3W1NA 4PFMA 1VCFA 3UWVA 2A4AA 2FLIA 2Y6ZA 4BFAA 3WJYA 1I8JA 2NX9A 3S5ZA 5LKYA 2EHHA 3TW6A 3NNTA 3M6YA 1TRIA 4IXHA 1YDOA 3IIOA 4DF1A 4NJKA 3GAKA 2QJIA 1X1OA 3EX6A 5KITA 3D0CA 3NEVA 3UQNA 5T26A 4MZ8A 3SGZA 3TFXA 2YFOA 5CG7A 5DY2A 1QR7A 4ZQMA 5MHBA 1UUOA 1G7UA 3HPXA 2QKFA 1KTBA 4UFJA 3PWAA 1JUKA 1VJIA 3LB0A 3M5XA 1NSJA 4CCEA 5CZJA 3SECA 2NZLA 1K02A 2ISSA 5G1TA 4TIMA 4XQ6A 4HSOA 3W2MA 1TTIA 3M41A 5J5RA 4KFPA 3W1XA 2QR6A 3FJLA 2RH9A 3G1XA 1LLWA 1DVJA 4P61A 3RK8A 2VEMA 1RQEA 3NPVA 5CPNA 1L6YA 8TIMA 4TMBA 3I7RA 4MY1A 4RX0A 3G3MA 3I65A 3DXIA 3QJAA 4UFKA 1A5AA 2A7PA 3OVPA 4A21A 1W5NA 1J2WA 1SO6A 4I7UA 2DJLA 3KRUA 3W88A 1U83A 1SPQA 3W7MA 1ADOA 4Y6GA 5K9CA 5HINA 3EXSA 1H5YA 5HNRA 2VC6A 5LGXA 4GUIA 3UWZA 1FDJA 4PODA 3O6YX 4O0KA 1YLVA 4GXMA 4IX0A 4FNUA 4JIPA 1Q6LA 1SO4A 4X9SA 1M7PA 1H1ZA 1WOAA 1Z42A 2QCEA 1OFOA 4D2JA 2V5BA 4AF0A 2R8WA 2H3BA 3TX9A 1DKWA 4ZVJA 2V82A 3KAOA 2V2DA 1PCWA 4RXGA 4LV4A 4GJ1A 2RDTA 3HG5A 4IGHA 4O1DA 3W75A 1ZENA 4FNPA 4KKXA 4LVAA 3MI2A 4UTWA 2WNQA 5GVJA 4IMFA 3Q37A 4UTKA 1GPWA 3LRMA 1YXDA 3FLUA 3STEA 4YWIA 1DL3A 4AVFA 3FJ6A 1BTMA 2QCLA 4QM1A 1YPFA 4ADSA 5BMXA 3B05A 4PCFA 2Q3OA 4OGZA 3DZ1A 2YZRA 4MJZA 1W3TA 4JNMA 5I3HA 3SZ8A 4ML9A 1GYNA 2ZZ1A 3S0CA 1TTJA 1KTNA 3HG2A 2OCZA 4Y8FA 2QJHA 2DZPA 4DO6A 3DH7A 4Z1BA 3SFKA 3BG9A 1PE1A 4MOZA 1GTHA 2Z6IA 3PUDA 3PB2A 4I9AA 1P5BA 2BWGA 1VS1A 4JTKA 2C6QA 5D32A 3UWQA 2D73A 1FX6A 3DGRA 5G4EA 4XBSA 3A5FA 2RDUA 1TPEA 3P81A 5DELA 1YTEA 1P0KA 4JX5A 1R46A 2TSYA 3LBCA 1NFBA 3O16A 2NWRA 4CNOA 4O13A 1XXXA 3CT7A 2X1TA 1FXQA 2Y85A 2UV8G 5LGZA 1JCYA 2QCDA 4TR9A 3NQ6A 3NPUA 5AOUA 1F7BA 2QUTA 4ADTA 1R47A 4JS3A 3STGA 2VFHA 4CCCA 4O15A 1H51A 1RR2A 4EF9A 3ABOA 3TQVA 3LXCA 2E6FA 4BWLC 1WX0A 5HR6A 3G8EA 1A5SA 3W2LA 1EP1A 3EKLA 3QW3A 3GB6A 1HFBA 1GWJA 4RCXA 2ZCGA 2C13A 3OA3A 2H6RA 1YXYA 4MVAA 3NQFA 3W72A 3SY5A 2WOQA 3PBWA 2A1YA 3R2GA 2CZDA 3LV6A 6TIMA 2NXIA 4PH6A 3LHTA 2J24A 5D2YA 4YL2A 3QH2A 4ZL1A 4MZ1A 3L68A 2Q3RA 4E2BA 1OX4B 4UFMA 3PULA 1W5QA 2GUUA 3QW4B 3LI0A 4MZYA 2A7NA 2QAPA 5KZEA 2ZA2A 3NOEA 4CQAA 3NZRA 1OHLA 4AAJA 4JTTA 4OHQA 4AWSA 3R13A 2ZRXA 2OT1A 1QOPA 1C9DA 2QCFA 3GDLA 4WUIA 1XBXA 2A5HA 1FBAA 1W56A 2QJGA 3STFA 4JXCA 1D3GA 5AC7A 3PR2A 2J9ZA 2Y88A 5HJLA 1NAL1 4FB7A 1FXPA 2TMDA 1K7FA 3P84A 1QOQA 4NZFA 4R34A 2JBMA 3DKJA 4UR8A 2GVGA 3GDTA 3I7SA 1G67A 3MBDA 3KHJA 4NNBA 4JX6A 3GYEA 3EX4A 4OBTA 3INPA 3CHVA 1Q45A 5EY5A 2HS8A 3W1UA 4UTWC 2GPTA 3IVSA 1PHQA 2CZEA 1XCFA 1KM2A 2A6NA 1QFEA 1TTPA 3W1AA 4GC4A 1ZFJA 4Z0SA 5DXXA 5I3JA 2CZFA 4Y90A 4QNEA 3HJZA 3RLUA 4ZQRA 3CQ0A 2QUVA 3L9CA 2Y70A 3QQ0A 1LRQA 4LS1A 1YXCA 4IPIA 3NYZA 4L4MA 1A53A 1EA0A 3W86A 3QMTA 3W7GA 5AN7A 1FDZA 2V2HA 3KRZA 3BW3A 4UR7A 3OG3A 3LCFA 1JQXA 3DENA 3S5YA 2ZQ0A 2TPSA 2DZUA 1LZOA 4NXSA 2ATSA 1AG1O 5EPDA 1XKYA 1OABA 3RMJA 3PSWA 5HULA 1ZNNA 4O17A 5F4SA 1YDNA 4PEKA 3R5EA 3L66A 2HMCA 3QFEA 3LHUA 3WJXA 3U8GA 3S1VA 2C3ZA 3KVLA 5AHMA 1L6WA 5C55A 5D2TA 2FIQA 3O8AA 2E6DA 1MEIA 1ME7A 2W0UA 3C61A 4OT7A 1L2UA 1A5CA 4R7JA 4FHAA 4K7YA 2FPVA 3GDMA 1B9BA 3G24A 3NQMA 3NAVA 5A8GA 5L9FA 3W7NA 4KFOA 2X1RA 5AHIA 3S5OA 4Q4KA 3W83A 4N9DA 1H61A 4DO5A 1OK4A 3UXAA 4IX2A 2Q8LA 4O4VA 4DPQA 1TREA 3LLDA 1G7VA 2QAFA 3N2XA 3UZJA 1WAUA 3BLFA 3GAYA 3HG4A 4O52A 3UWWA 4POCA 3R8RA 2JKPA 3G1FA 2C0AA 1KM5A 1PHWA 2A7RA 1V5XA 3MHGA 4LOCA 3LX9A 3OVRA 1MZHA 3DKLA 1H7OA 5AHNA 1F6KA 1K7EA 1VLIA 5BW6A 5KINA 1VR6A 3V75A 4BR1A 4FIRA 2E68A 1BWKA 2ISVA 1B4KA 1LCOA 1O60A 2R94A 3NPXA 1DV7A 4H4IA 3TSDA 3WJZA 1YTKA 4XUGA 5K4XA 2GJNA 3GXNA 2VKZG 1UBSA 1OF8A 3SR7A 1JRCA 3GKAA 2O7SA 4G1KA 2CLKA 4M6PA 1SSDA 5AYXA 3QC3A 4RK8A 1R30A 1EWEA 4UMBA 1F74A 3W76A 3NXFA 2BTMA 4QIUA 5C5YA 3RFAA 4JYEA 4UXDA 1GVFA 3GR8A 3NL5A 4O1AA 1HO4A 3Q2DA 4ONVA 3L5AA 4LVGA 2GOUA 4IMDA 1LYXA 1G6CA 1TQXA 3F1QA 4RKAA 3QF0A 3N34A 1W31A 5EBUA 4O1BA 3HGOA 3C2OA 3W7LA 2B7PA 3GXTA 3CTLA 3ZFHA 2CLFA 5HWNA 1M7OA 3SIZA 5SWUA 2X2GA 5AB3A 1W3NA 1YPIA 5D09A 4QITA 1OFPA 1N8FA 1IXOA 2Y7EA 4IMCA 3GR7A 2ZZ5A 1DQWA 1IXQA 3M0ZA 4UTLA 4UTUA 1NF0A 1ONRA 2BLEA 3BO9A 3FOKA 3S1WA 4UTMA 3U6WA 1H7RA 1F6PA 2VFIA 3DFPA 3UD6A 4AMAA 4OE7A 3LHVA 1GVQA 4NJHA 3P61A 3LRKA 1OX4A 1TIMA 3BVJA 2YDAA 3EXTA 4A29A 3TDFA 4HT3A 3IEBA 2CW6A 2CWNA 1O4UA 2QCNA 2V2CA 3CEPA 4N9EA 4JX4A 4O19A 2ATMA 1XL9A 1TPUA 4S2CA 1UJPA 3LXBA 3PBVA 3PBUA 4U28A 5BOOA 4AHOA 1MEWA 2YPIA 4A2SA 3PUOA 2ZZ4A 3MO7A 3BV4A 3MHUA 4UMAA 2OX1A 1TJRA 4IXXA 1VCVA 3DBPA 2FPYA 4N6FA 3THQA 1M5WA 3OVQA 5CPOA 2OJPA 1SO3A 1GG1A 3P5ZA 2FB2A 5H2ZA 1O95A 3MUXA 4WY0A 3AO0A 4XKYA 3AJXA 2WNZA 1LROA 4O0ZA 1KBJA 1JULA 5DCDA 3H54A 1GVSA 1ALDA 2A2IA 3MW7A 4GUJA 3ANYA 4U4MA 1SQ7A 3L5LA 1KA9F 3EX2A 4LC6A 1OX6A 1THFD 1W8SA 2ZYFA 4FIQA 3TAOA 2CLEA 1FCQA 2Z2UA 1IIHA 1XC4A 3UPWA 4C1LA 4E38A 1Q6OA 3KVKA 3GNNA 4WY0B 1ML1A 2VFGA 1KM4A 3EWYA 1K8YA 1JUEA 2X1UA 5DXYA 2E5DA 4UIOA 5DLCA 4HKPA 1WA3A 3ATYA 2B7NA 3NG3A 5AHFA 1LP6A 5C54A 3IGUA 5LHFA 3LCXA 2B7QA 4WOZA 1OFQA 1XDMA 1QCWA 5TBOA 1AL7A 1JQVA 1DOSA 1OK6A 2VXNA 3NQ8A 1YTDA 2YSWA 4GE8A 3N9SA 1TV8A 4NXKA 2ABBA 4K36A 2NUXA 3CC1A 4QJ1A 5DCEA 4A22A 5DBTA 2BSLA 4LS2A 2ZTKA 3UYCA 3C2EA 4LRSA 2R91A 4FX7A 4EF8A 1VHNA 1GJPA 3N14A 4MY9A 1UCWA 3NQAA 4J9JA 1EX5A 4JEQA 4CNNA 1M6JA 3CWOX 3GLCA 3NQDA 5KTLA 4FNTA 1VH7A 3C52A 1EUNA 3G1SA 4M6QA 1Q3NA 4FX6M 5LNRA 3N3MA 1S5TA 1FUYA 1O5KA 3T55A 5KZMA 2NV1A 3PBYA 2OZ0A 4KWVA 4FX8A 3VFLA 3LRLA 1KTCA 5D37A 4ZQOA 3R12A 4I7VA 4MFEA 2I9EA 1H7PA 3TKFA 5FEPA 4FNRA 1TQJA 1SZNA 3CM4A 3DI1A 4JTGA 5G2IA 2NV2A 4DF0A 1JCMP 4IJBA 4KFNA 1JCJA 1SSGA 3W70A 5FF7A 1SO5A 1KM1A 1O94A 3G1DA 2E09A 3S5NA 3P8IA 1TV5A 3DFSA 3C4UA 3S8HA 1AW1A 3LHWA 4MIMA 5LHEA 1BKSA 4YMZA 4AF0B 3PG9A 3G8RA 4FEZA 4TO8A 4O14A 3GVGA 3W1RA 1JJKA 5D33A 4HPXA 4JY8A 4O8RA 2PE4A 2C15A 2ZRUA 5BRBA 2Y63A 1W0MA 4UTIA 4TMCA 4AHQA 1HO1A 2ALDA 3QQ1A 1BEUA 3W22A 2GJLA 5TIMA 3NM3A 5KMYA 2ZDRA 5LNWA 2YXGA 4NNAA 3BGJA 3E9AA 3TV8A 4NJIA 1R2SA 3MHFA 2Z0IA 2A6LA 4Y9AA 1Z41A 2CLMA 3VI2A 3W9ZA 4AB4A 2LLEA 4EIVA 3ZWTA 2P1FA 4LT9A 2ZRYA 2YX0A 3KXQA 4LY8A 2EKCA 2F84A 5I3KA 2JK2A 4RZ4A 5D30A 1QDSA 4JTFA 1BWLA 1OVDA 5HUPA 3C2RA 4AWUA 4MYAA 5FEXA 3NL6A 4K37A 2QDHA 4MY8A 3MMTA 3TH6A 4OU1A 2I14A 3TXVA 1OFDA 4HNTA 4RXFA 1TMHA 5FESA 4MLRA 5I3FA 1XUZA 4TU1A 2GVLA 1X7FA 3W7KA 1I4NA 1TJPA 4LV9A 1TPDA 3A24A 3NA8A 4XBKA 2Y61A 2NUWA 2PC4A 1D9EA 1TYGA 1VPXA 4OQVA 3UY8A 4O53A 1QAPA 1GG0A 3W84A 5U4NA 2ZTJA 4NNCA 5D2WA 3RNDA 1YDVA 1U5JA 5IBXA 1RQHA 4JR5A 1S5WA 4Z1AA 3FIGA 2Y89A 3FYPA 1E51A 3NR0A 4AH7A 1WBJA 1SZFA 3C2FA 2DP3A 2KZHA 3G0SA 1KFLA 2Y62A 2Y7DA 3TR2A 4K6AA 3E49A 3UY7A 3TC7A 3F4NA 2E5BA 3O05A 2FQIA 4K38A 5F1VA 4ZQCA 4O54A 2A0NA 1EB3A 4Z1CA 2WJZA 2TRSA 4IMGA 2QEZA 3TA6A 1RD5A 2WV8A 3TJXA 3FKKA 1A5BA 1G4SA 3CU2A 3PVFA 3B0UX 4ORIA 2E1DA 3TFCA 3BLIA 4M7SA 4XKYB 1N55A 1QPRA 3W7EA 3EWZA 2VELA 2E77A 5E1QA 2NXGA 1FWTA 5EMUA 1W5OA 4N4QA 1HTIA 1HG3A 3WK0A 3W7RA 1R2RA 4O28A 1VZWA 4OWGA 3B8DA 4PTNA 3KVMA 4MLJA 3H53A 2YW4A 3ZR4A 3C8FA 2Z1BA 4WY0F 1PCKA 1V7YA 2E6AA 4RLIA 3NL3A 1TV7A 1H63A 3L67A 1T8XA 3UZ5A 3GKFA 1KBIA 5IM51 1K3UA 3BK0A 1GTEA 2J9XA 5D05A 3DU0A 3LTYA 2ISWA 3B04A 5F2LA 3TUUA 5DBUA 4OV9A 2CLHA 2E5CA 1SW3A 4EVZA 1TSIA 4C1KA 1W5MA 4AEOA 2VFDA 1LOSA 3TW7A 2J27A 3C56A 1I2QA 4LW7A 1MO0A 2ZZ3A 1SW0A 2C14A 3W71A 2H3DA 3G1YA 4UTHA 1KM3A 1C29A 4HN4A 1TO3A 3HPSA 5FEWA 4CNPA 4Q32A 4UTTA 2VFFA 5G2HA 1G4EA 3DAQA 1XUUA 1WDWA 1X1ZA 3OBKA 3W2JA 5F4XA 1WV2A 5LZLA 2WSRA 3BW4A 3SSJA 5LNVA 1MEHA 3CWNA 2QCMA 1H7XA 3FKRA 2Q8ZA 3MI3A 3ZWSA 3TCEA 4WOQA 5F2IA 2WNNA 3TNOA 3BARA 2VOMA 3LGEA 4MUZA 2G97A 2HTMA 3HO8A 4LVBA 4QSHA 4WX2A 4FF7A 3S6DA 1P4CA 5K7JA 1JUBA 1EUAA 1FWRA 4LU0A 5EL1A 2RDWA 1FDYA 1KFBA 4IMEA 4ALDA 3ABSA 5K9DA 1KFJA 3NZ1A 1VHCA 3TC6A 1QMLA 3KX6A 4FXSA 3HOJA 3TIMA 1C8VA 1WBHA 2DORA 3W7IA 5H91A 2ABAA 4ICNA 2PURA 3LDVA 2Y7FA 4QNWA 1VQTA 4DF2A 3FEMA 3NO5A 2YW3A
chains in the Genus database with same CATH superfamily
1EO7A 3L21A 2XISA 3ZOAA 4DPPA 2G3MA 2W27A 1E6XM 3HIJA 3SBFA 3W7QA 1AW2A 4E0CA 2OSYA 1MXSA 1NOUA 4I8DA 1S1PA 4PL2A 3YPIA 5ABGA 1Q5MA 1TPC1 3WL1A 4M7TA 4X60A 3GH7A 1EGZA 2VFEA 2R82A 1PUDA 4XZNX 3RJXA 3RO8A 2WSQA 3LI1A 4OUEA 3QHMA 4ZENA 3WJSA 1C7TA 1FWNA 3GXFA 2CBVA 2VEIA 4S2BA 1A3XA 3NM1A 2A3LA 1L8NA 2DT1A 1QW9A 3AYSA 2JKEA 2P50A 3G3DA 5CJNA 2ACQA 5CZTA 3W74A 4H83A 3MKKA 5G1MA 3GHSA 5IBXC 2E3ZA 4LCRA 3TN3A 3VUSA 4ATLA 4U3AA 1MVYA 4N9BA 4WXZA 4L6OA 4A4AA 3PPCA 2W4XA 5EA9A 4NJJA 5ABTA 4LYQA 3H6OA 1B3VA 1VFMA 4QJ5B 3A47A 4Q4OA 3WH8A 1IWBA 5C9ZA 3G6LA 2ZBTA 4AC1X 2OZ3A 2GLKA 3FSUA 4NI3A 4PMJA 3N11A 2PDIA 1VC4A 3P8JA 4CQ8A 1OSEA 4N2YA 2DW7A 3WF0A 1YYAA 3LM7A 2V8ZA 4GD0A 1ZHAA 2OT0A 3M1ZA 4AG0A 1PS9A 1O5QA 3PSVA 1I2PA 1OT1A 1PAMA 4NT0A 1SFJA 4JY9A 3DESA 1E73M 1XW8A 2W6RA 4MMWA 1L6GA 1XWYA 4ZXLA 4B3LA 4A2RA 5HPCA 2WK2A 1X38A 5F2MA 5ECUA 1MFVA 2NUYA 4A3UA 2D3LA 2W5FA 2PP3A 1UW9A 4YCPA 4GI9A 4HGXA 2V9DA 2JEPA 3V5CA 1LORA 3K30A 1QXLA 2ZRVA 4O50A 3UJ2A 3PAJA 4GI4A 3SCQA 4GXPA 5C71A 4N7QA 4XZ9A 3NJ3A 4UWMA 1GOIA 4IQEA 4J1OA 4GYKA 4ZMGA 3O2LA 3ATZA 2YLAA 1RP9A 3OEXA 2B4GA 3D5HA 1HVXA 2OO0A 5A95A 1EPXA 1KCLA 4E6MA 2CLOA 3WDJA 4N02A 1PYMA 1TJ1A 3VOIA 2ZX7A 3M0XA 5K9XA 3LXAA 3QMRA 5U7SA 4LF1A 2I7GA 2H8XA 3PZGA 4ROPA 3M5VA 1JR1A 4QX4A 1BQGA 5GJMA 3HV9A 9XIAA 4CN1A 2P10A 3CT2A 3OLGA 1O66A 3LBOA 5EKYA 2Y5SA 4J3SA 1M65A 2IUZA 1LT7A 5FIPA 1T6MA 1DJXA 1K9TA 2P0OA 3HQ1A 2FTPA 3KOFA 3THAA 1PZ3A 3BCJA 2W66A 3AWOA 3CUGA 3I3DA 5LA0A 2Y5EA 2CXEA 1L6SA 3WX7A 3C0LA 3SIMA 1M04A 4Q4PA 1QHOA 1P6BA 2CLIA 4YN5A 2GVJA 4ZQNA 2NXHA 4NUWA 3S9YA 5CGQA 3TXZA 1GYLA 5C9WA 1V3KA 1OFBA 5CZSA 1IEWA 3A21A 3RLHA 4QE1A 3R6IA 2FZDA 3RLGA 1HKVA 1S3HA 5D9PA 4FOUA 2OMAA 1VRDA 1JI2A 5LSMA 4C6NA 2EAWA 4GY0A 4N9CA 1SJDA 3WQ8A 4K68A 5D04C 1U33A 1SFLA 2AKMA 5D9NA 1H7WA 4J40A 3TLQA 2E25A 4H9UA 1EEPA 3RM4A 2V0TA 1Z44A 1PYFA 2J88A 4U5KA 2I57A 3HA1A 3CPRA 2XGIA 3THUA 3ITGA 2OEJA 3B06A 3QR3A 1MSSA 4JTEA 4ZEPA 4G6CA 3N73A 2BGSA 2O4MA 1LM1A 2YBUA 1AZ2A 1T40A 2VO5A 1DQXA 3GIPA 1DJZA 4O12A 1JGIA 5FCZA 1NQ6A 3TP4A 2DVXA 3LU2A 3QOKA 2CESA 4HNNA 3WK1A 4NSBA 4JHZA 1P0BA 3UNDA 4DJEC 3ENLA 1MWOA 3A22A 4JTSA 1SUXA 3UXDA 4DBEA 4ZQPA 2WLYA 4I90A 4RPPA 1BAGA 1GKQA 4L4LA 1G4TA 3BUVA 5I24A 3CV1A 1KB3A 4Z1YA 1XISA 3SFWA 3VKJA 3OHIA 1R9XA 1ZB5A 2QUUA 2WZHA 3T78A 3O06A 3EDJA 3SDOA 3M0MA 2WNWA 5IHSA 4ZODA 1SM9A 3OGSA 1QPQA 3KRSA 3T7VA 3EWXA 5A6JA 3NZPA 3QFWA 4I8YA 2HXUA 1TR9A 3AQUA 1KBBA 1CTNA 1CBGA 4HU0A 4C6DA 4LANA 2O7QA 3ABRA 3OIXA 4GY7A 5K2ZA 4D6JA 4WSJA 3LPFA 3LCGA 4WJXA 3TAKA 4FO4A 3O63A 3T8LA 3V5OA 4FNQA 4Q3MA 4QXIA 1XLEA 1GNXA 4M29A 3UCCA 2E6YA 3COTA 1G69A 4C6BA 1HJWA 1JNDA 4KWWA 3PNZA 1J11A 3KS5A 1PIIA 2DZXA 1UB3A 2Y0FA 4F2BA 4JAWA 3W6MA 3KFTA 3OZPA 1JCNA 1EF3A 2FH8A 3AXXA 3QGAC 1T5AA 2V69A 3CIWA 5FEZA 3UR5A 3EMZA 2QCGA 2GQAA 2VDIA 4LYKA 2O92A 1F6YA 1ZJHA 4XBJA 3W1LA 5GNXA 1PX8A 2VZUA 1CGUA 4YCOA 1QNVA 2F6XA 5IXEA 3HURA 3B0VC 4LB4A 2GOKA 1GEQA 4DBUA 3PNUA 1AA1B 2DZWA 2WCGA 3NDOA 4NX0A 4JL1A 4NZ4A 5JBFA 1ZCOA 1PWLA 4ORMA 4Z2KA 5E0KA 4C6IA 3W7OA 4CD4A 2VDHA 1MQPA 2XPKA 4E3TA 4C6MA 3F2CA 1KV8A 1ISVA 1UUQA 4UR9A 4DYKA 1TRDA 1W9UA 3TMLA 4XO7A 2A21A 5I3IA 2ZZ6A 1KC7A 1XI3A 1C8YA 1XBZA 3OYZA 2Z7KA 3WH9A 2Z24A 3U7BA 1AL8A 4XK2A 5FACA 1JF5A 4RV8A 3E6EA 4ADUA 3I6RA 1EXBA 1JXKA 1KCZA 3JRKA 1XPYA 3L4ZA 3WZ0E 3HGJA 1QNPA 4JDYA 5CAHA 1QBAA 1UIPA 5A6SA 2ZVIA 4YXGA 3IGSA 4LJ3A 1ZY9A 2OGYA 2P0IA 3KL5A 4B3ZA 1E3ZA 4LUIA 2PP0A 4JTHA 3APGA 1J10A 1V3IA 2VWSA 4FXRA 3BSGA 4JIHA 3DFTA 3RLVA 2D0HA 4UOQA 3WY1A 2FJKA 2RKXA 2O9TA 2YGYA 1FH9A 3LTSA 5KEZA 1KFCA 3K8LA 2WYSA 2Y5JA 3DYPA 5AZ0A 1OF6A 5E6ZA 4MYXA 3GY1A 4DHGA 1R9YA 2QIWA 2R1PA 4U10A 3LLFA 1C93A 1ME9A 4HZ7A 5I23A 2DZSA 5HJYA 1EQPA 9CGTA 3SRDA 2YR1A 3CZ8A 2NX1A 1Z7AA 3BSHA 2A79A 4X0VA 3CZJA 4TV5A 1BD0A 4B9YA 1HKWA 2J79A 1XPGA 2UY2A 3FVMA 3I4EA 1AK5A 1XQKA 3UPBA 3M46A 3MJMA 1UD6A 3QPEA 3TONA 4I9MA 2OQHA 2VGIA 3KEHA 3PF3A 5I3GA 1E5JA 2FVKA 1QW8A 2POZA 4JYFA 3W6YA 3GX9A 3EOSA 2EF9A 4BCEA 2BXVA 1OM0A 2VL4A 4OBSA 3O6AA 4JFTA 4DBWA 3NYDA 2WMKA 3VYLA 3WD0A 2XVNA 1LBLA 2DZTA 3FA4A 2FLIA 2Q6ZA 1V51A 4BFAA 4FOJA 3MZNA 2F61A 5LKYA 3GTHA 3CB3A 3F4VA 4EANA 2NVDA 4Q8QA 1YDOA 1GJUA 3FHAA 4KBXA 3WENA 5KITA 2UZ9A 4DUWA 2WZIA 3DIPA 3FV9A 3SGZA 3LSBA 3DEQA 5DY2A 4MJ4A 1UUOA 1DWIM 5DX7A 4UFJA 3PWAA 4P8XA 4JTQA 4US5D 4JN8A 2XIJA 6TAAA 1ONXA 2ISSA 4MUPA 4C90A 2WB5A 5G1TA 8A3HA 3GFYA 3M41A 5J5RA 3K8MA 3TYCA 2PP1A 2OKTA 1W9PA 4FXJA 1PKMA 2GK1A 2TODA 2Q01A 2RH9A 3ITLA 2DVTA 3TN6A 1DVJA 4PMOA 1V6VA 2GK1B 2VEMA 1PB0A 3KBJA 1L6YA 3UR8A 2V5JA 2D2JA 1KKOA 3LSCA 1EL3A 3CAQA 2AKZA 4FF5A 3DXIA 4UB9A 3T07A 1A5AA 1KXHA 1QATA 3PJWA 2V3EA 3VKDA 4RE0A 5EGRA 2ZADA 2DUZA 2E0PA 5BU6A 1SPQA 1B31A 1ADOA 4Y6GA 5HINA 3EXSA 1CCWB 5HNRA 2VC6A 4GUIA 5JIPA 3UWZA 1FDJA 4PODA 1C9WA 1YLVA 2O56A 3WDIA 4IX0A 4HA1A 2E7FA 4AU0A 1Q6LA 2V5CA 1R9ZA 2F8QA 1HKKA 3MUIA 4KESA 1H1ZA 1Z42A 2OEKA 1B5TA 4UBPC 4OBRA 2R8WA 4C1NB 4ZVJA 1K8CA 2W91A 4GJ1A 3T0TA 4IGHA 3W75A 4EACA 3C3UA 4HCLA 4MF4A 5GVJA 4IMFA 3Q37A 3LK6A 3LRMA 4YWIA 4ZOAA 2HV5A 3H2AA 1SMDA 3BSMA 3DZ1A 4CN4A 2ZX6A 3QV8A 2XFFA 2WWDA 1XR2A 5I3HA 4KF1A 3FGCB 3ZT6A 3B8VA 4RL3A 3HG2A 1JI1A 1NH6A 2UY3A 2QJHA 2DZPA 5CC7A 3TN5A 1EJXC 3LS9A 5HNNA 3WLPA 4MOZA 2Z6IA 3K8KA 4I9AA 1XLGA 1VS1A 4W7VA 4PZVA 1AJ0A 4XD6A 4ERGA 2RDUA 3DECA 4CKQA 1X39A 3P81A 1ZUAX 2DPEA 1R46A 4YS1A 4GA8A 4GZ7A 1UH4A 4WHBA 2NWRA 4IPLA 4CNOA 4HK7A 2UV8G 5BYWA 5LGZA 4IFKB 4TR9A 3NQ6A 5T9BG 1J18A 4GOAA 4ADTA 1R47A 4JS3A 3STGA 1VENA 2VFHA 2CXGA 4O15A 3LXCA 4BWLC 1WX0A 2X2YA 3G8EA 1A5SA 3W2LA 3EKLA 4XKMA 1XLCA 2ASHA 5FJJA 3GBDA 4BHYA 1BYCA 2H6RA 3C0SA 1YXYA 3UR7A 4YTQA 2NVAA 3IJ8A 2FYMA 3PBWA 2A1YA 3AWNA 2NXIA 2BNJA 3LHTA 2J24A 4YL2A 3QH2A 4OIFA 1SMAA 1W5QA 2GUUA 1V02E 1JEZA 1RK6A 5LIXX 1FA2A 4LEQA 2WAGA 2BHUA 2E8YA 4B5SA 4Y9OA 1FWAC 3WEZA 2QCFA 5BOFA 1XBXA 2A5HA 1W56A 4AD5A 1EJSC 3BMXA 3R58A 3STFA 4AIEA 2Y88A 1XYBA 4Y2WA 1XGZA 1FXPA 2OTDA 3P84A 4R34A 2GVGA 4NP7A 5M17A 1I0DA 2GGJA 4JX6A 3GYEA 3U4AA 3INPA 2WC3A 3W1UA 4P8VA 2PODA 2V63A 1PHQA 1JFXA 2UWFA 4RW5A 1XCFA 2A6NA 2J75A 1QFEA 1TTPA 3W1AA 1YNYA 3IS4A 1DJYA 5I3JA 4OECA 4QNEA 3OPSA 4GYPA 3RLUA 2ONEA 4RUBA 3NYZA 2XUCA 4L4MA 5EMLA 4S38A 1A53A 2E40A 3NSXA 1JPDX 3AUOA 1BRLA 1FHVA 2OEMA 1YW1A 1FDZA 3CHEA 2PAJA 3WUGA 4DUXA 1ZTVA 3AYTA 3CPGA 1WDRA 3CTTA 2TPSA 1EA9C 1VIWA 4NXSA 5EPDA 1OABA 3C86A 5HULA 4O17A 3L4VA 3WBAA 2FH6A 2ZIDA 1UQYA 3SAZA 4PEEA 1V8EA 2W0UA 2ADAA 1FWFC 5DMMA 3PTDA 4E2VA 5A8MA 2FPVA 3GDMA 2QULA 3AFBA 4EAYA 3BLKA 5L9FA 5AHIA 3W83A 4Q4KA 4N9DA 1G5AA 1UZ4A 3FAWA 4F2TA 1E6ZA 1TREA 2FMOA 4MNJA 1G7VA 2QAFA 3N2XA 1C8XA 3ZJKA 3MPGA 3G1FA 4IPPA 4B5UA 1D8CA 1BYDA 1QPKA 2XVGA 4LOCA 3OVRA 1MZHA 1H7OA 2DT0A 5GPRA 2CNCA 4BR1A 4TVCA 3CV7A 3HPAA 1IYXA 1B4KA 4IIBA 3GNPA 4WEVX 3WJZA 5RUBA 4W4QA 3CL6A 3VGHA 2HE5A 4YNGA 3USZA 3DFHA 4WDXA 3VKKA 4AVOA 1UC5A 3GHTA 3ZVIA 1P0DA 2CLKA 4IFOA 1SSDA 2PUZA 2Z2BA 5AYXA 5EU9A 1EWEA 4PB4A 2VM8A 1FFQA 2A3EA 2RAGA 3RFAA 3RITA 4S3BA 4O1AA 3T08A 1EGVA 1E4LA 3L5AA 2PDKA 5DF0A 1P43A 3T4WA 2HVMA 3LYEA 2HK1A 3F1QA 4IMDA 3POHA 4IP4A 2P88A 3TC3A 2D23A 2Y8UA 1AH0A 4ZO6A 2F2HA 2ZUVA 3M0VA 4J28A 2CLFA 5IRPA 1M7OA 3FA3A 3THDA 1W3NA 3UU0A 1UZ1A 2XFRA 1JZ2A 3GR7A 2ZZ5A 1W9DM 2YDQA 1DQWA 5HOSA 4UTUA 5J8LA 4J2PA 5MKGA 4O8AA 2EPKX 1XS2A 4F66A 2P8BA 4UTMA 1H7RA 2VFIA 3DFPA 4EWJA 2ZUSA 4DJEA 1XLBA 3LHVA 3EB4A 2PI6A 2PWVA 1KWGA 4ICCX 1TIMA 3BVJA 1NJJA 4A29A 1MUCA 3GC2A 4LYRA 2CWNA 1O4UA 4LUTB 1R5YA 1J0JA 2O9RA 4EXAA 4S2CA 1N82A 4IFKA 4WRHA 4MNLA 2NQHA 1C7SA 4A2SA 3MHUA 2XYLA 1TJRA 2YBTA 1ELSA 1VCVA 1TUXA 1RCQA 3IJDA 3VIIA 1M5WA 4D6EA 4B16A 1UWIA 2FB2A 4GVGA 1FWEC 1F8MA 4WY0A 3AO0A 2Z28A 4PCSA 4AWEA 4XKYA 4DJFC 4D6IA 2WNZA 1LROA 2PTYA 3LNMA 1I1WA 3W28A 1VFOA 5DCDA 1F3EA 2IPWA 3SGGA 3MW7A 3DDMA 3B8WA 4U4MA 5FL1A 1XCWA 4Q4SA 3BAWA 4DZAA 1W8SA 1C90A 2GL5A 4FIQA 2IKGA 1FCQA 3EZ4A 4C1LA 1US2A 4MWAD 1ML1A 3SCUA 4PMQA 1K8YA 1JUEA 4W93A 4S3AA 2JE8A 4UIOA 1TR1A 3WDPP 4YYCA 3BOFA 3GTXA 3UG3A 5AHFA 1LP6A 3MUZ1 4KRTA 3LCXA 3GUWA 3EB3A 2QJMA 3H8AA 2BY3A 1JQVA 1DOSA 1U30A 1ENUA 1TFVA 4GE8A 2IKJA 4NXKA 2OZ8A 4QJ1A 1QI4A 4UQEA 4P7RA 4QDWA 3VNJA 2ZTKA 2RUSA 1NWUA 2PBOA 1VBRA 5TD4A 3VINA 2OGJA 4EF8A 4L61A 4I3GA 4M80A 1M9HA 4J9JA 3GLCA 3W4RA 1E1FA 1Q4NX 1RAKA 3ALGA 1VH7A 1XIHA 3ERPA 4GK8A 1Q3NA 4WJ8A 4FX6M 5B80A 3FX4A 1FUYA 2E67A 3T55A 4KRUA 1NU5A 2OZ0A 3CUFA 4FX8A 2OLSA 3VFLA 5I77A 5D37A 3R12A 1YNPA 4MFEA 1AJZA 1H7PA 3TKFA 1VD6A 2YCIX 5G2IA 4DF0A 1UQZA 4HMDA 1SSGA 3W70A 5FF7A 3RGTA 1SO5A 3AS0A 3BURA 3ITOA 3RRAA 1KWKA 5BRQA 3GU9A 3S8HA 2BVYA 1Z9AA 4JN7A 4MIMA 5LHEA 1L8PA 4NAFB 3WBXA 3M0IA 1CWYA 4O14A 2D3NA 5CG0A 3W1RA 3V0UA 5LYRA 4FLQA 3VIGA 2ZRUA 2Y63A 3QXBA 4UTIA 4JHOA 4AHQA 4R88A 2I5QA 1GQLA 1HO1A 3H7VA 7A3HA 2DT2A 3W22A 1J6OA 3VZZA 4QLKA 3WQOA 3TV8A 1FFRA 4B90A 3IAQA 4CNUA 3W29A 1XIEA 2V6AA 2Z0IA 2CLMA 2CCRA 3W9ZA 4EIVA 2P1FA 2OOFA 4C7FA 2ZRYA 2VRJA 3WD4A 3WQ5A 2EKCA 5A8QA 5I3KA 4B5TA 2IXVA 4RZBA 1VFFA 4JTFA 2CKRA 4RPQA 1PPIA 2QDHA 4OU1A 1EKOA 1S38A 2G3IA 3QOMA 5H8UA 4IG2B 4Y8EA 3VZXA 4RXFA 4KEMA 1BVWA 4C6CA 1X7FA 3B4YA 4K2SA 2DV0A 3A24A 1KGXA 5DMNA 2OSXA 1DXEA 4XBKA 3OJGA 2NUWA 2PC4A 1VPXA 1UP3A 1GGOA 3NO3A 1UR9A 1JAEA 3RNDA 1U5JA 5IBXA 3SN1A 3FIGA 3ARZA 2C1IA 1CGTA 2Y7DA 1EF2A 3AOFA 4H9ZA 3UY7A 2OQLA 1OINA 2E5BA 1ZBKA 3UXKA 2A0NA 1FP9A 1EB3A 4IHCA 2OELA 4H7CA 3TA6A 1RXOB 1XLLA 5ENLA 1A5BA 4J3WA 1VJSA 1EX1A 3FEQA 2E1DA 3TFCA 3TYDA 3VCNA 3M0HA 4XKYB 4M7SA 2HEJA 3GBEA 1J2BA 4H9TA 3W7EA 3EWZA 3PBMA 2VELA 4QJ4B 1MQRA 4KW2A 1FWTA 5XIAA 1W5OA 4AZ7A 1RY0A 3S3GA 2BHYA 3REQA 1HG3A 3WK0A 4S3GA 3W7RA 4HU3A 4HSHA 4KCWA 1JYVA 1VZWA 2G3NA 1JZ7A 4PTNA 3KVMA 4MLJA 1Y5VA 3GWQA 1X96A 4WY0F 4PTWA 2C8NA 1QNOA 1E40A 1H63A 3FNDA 3NZQA 2EPNA 3A4XA 2H9AB 1KBIA 5BXPA 1K3UA 5F7UA 1GTEA 2DIEA 1YBQB 2ISWA 1CXLA 2YCLA 2CLHA 4M6UA 1W5MA 2VFDA 3CYVA 3TW7A 3LA4A 1Z69A 1SW0A 2H3DA 4EPDC 1ADSA 1C29A 1CXKA 3SY8A 3N1AA 3CYJA 4G8TA 4ACZA 4MDOA 1XINA 2RGLA 2XIIA 3BICA 2B81A 1WDWA 4J2MA 5I7GA 1G1YA 5HA7A 5HXMA 1WV2A 4KMQA 5LZLA 1V6TA 2WSRA 3BW4A 1LUCA 3GG1A 4DI9A 3FKRA 3MI3A 3TCEA 6A3HA 4WDTA 1LWJA 3LGEA 3CAWA 3HO8A 4B2DA 1TV2A 2WMJA 3S6DA 4KCVA 1EUAA 3ARXA 4ECLA 4K3ZA 2FHFA 4IMEA 4ALDA 3ABSA 4QHRA 5BXSA 1RA5A 5K9DA 2V68A 1KFJA 2XM2A 1Q63A 1IV8A 3FYYA 4A05A 1I0BA 2ZC1A 1DWAM 3VGEA 4DVOA 4F0SA 3GG8A 1C8VA 1E55A 1UKPA 3VIKA 3ZO9A 1QI0A 2PWDA 4GNJA 3LHZA 5K4ZA 1I2RA 3NQEA 1E1CB 3BJFA 5C9UA 5C2GA 3AXMA 5I02A 3D46A 4A8LA 3EOUA 3EDDA 1P0NA 2WVTA 1LWHA 4BWLA 1N7KA 3G1AA 4YPJA 3WQVA 3EXRA 2DH3A 1FWSA 1UH3A 3E5PA 3W87A 2WBGA 4RR4A 4GGBA 3DYMA 3FDGA 4REQB 2PEVA 1TE6A 3JS3A 5ECVA 1MDRA 4Z08A 4QS5A 2AAMA 4DZ5A 1HX0A 3H55A 1GQIA 1NF7A 3HB9A 3EOOA 3QGVA 4WQ6A 4UCGA 3UWUA 1BF6A 1TWWA 4PC8A 3H12A 2YL5A 2QMKA 3HGRA 5DANA 3S42A 3DHPA 3DYOA 4M6VA 3RCNA 2IPJA 3KZSA 3WFAA 2O0TA 1DIDA 1KFKA 1Q6RA 6REQA 2BODX 1WOBA 3AMKA 1MW0A 5DY3A 1TIWA 3A9BA 3CO4A 5G4HC 6REQB 3VE7A 4S23A 1DPMA 4AY1A 3UGVA 3VAVA 4ASTA 1A47A 5DCBA 3VIJA 4WKHA 1MXDA 1MI3A 4A6GA 3R4IA 1TZ9A 1CB7B 3MSGA 2PDMA 4Q4RA 3NDYA 4K8HA 3W73A 2X7VA 2PDCA 4TXEA 2YLLA 2ZFAA 2V5LA 3T81A 3D47A 4GQQA 1YRRA 1ZPTA 3A23A 5TQLA 3C6CA 3NL2A 2YL8A 3KVJA 4CD8A 4LTSA 4XWUA 1E0TA 4O1FA 1KFEA 1AD4A 2VNCA 4IMAA 4JTIA 3MS8A 1UASA 3B8TA 4NZJA 1ZLPA 2FFCA 1VYPX 1OGBA 2DJXA 4P7QA 5LIKX 3HPZA 2GWNA 2DDXA 1HW6A 5D9OA 3IK4A 3ZJ7A 1VLWA 4LVDA 4NF7A 1E5NA 1BVNP 1DEDA 2V3GA 1A0CA 1Q6DA 4WD0A 3R8GA 4CCDA 1W5PA 1QO2A 1LOQA 4YIWA 4L1GA 3WLQA 1S3TC 3FA5A 3MY9A 4GUGA 1XRTA 2H8ZA 2PRMA 3UPMA 5EBAA 3DFQA 5AC8A 4OOZA 4AY8A 4YTRA 1H1YA 2HROA 1JD9A 4MPQA 2AOSA 2Z6JA 3PS7A 4JD4A 4PA8A 2G95A 1JZ8A 3I7QA 2OXNA 5XINA 1AH4A 3ELFA 1QJWA 3CEUA 1JCLA 3AZTA 2XIMA 1HT6A 3TSBA 4DJFD 1H50A 3VOFA 4U2YA 3WF3A 3WNKA 3Q94A 1LLZA 1HP5A 3P7YA 5D2XA 1GVYA 1AVAA 3DI0A 3H21A 2NX3A 1DHPA 2JGYA 4KEZA 4O1CA 3LV5A 3QSRA 3VC5A 1YBQA 2Q02A 1UWUA 1BRLB 2TAAA 3ANUA 2BZNA 1FHUA 3KUMA 4IF2A 3AIRA 4LH8A 3IARA 3T40A 3RCMA 5JVLA 4EOUA 4JQ3A 1S39A 4C65A 2BFGA 2ZRWA 1S2VA 1KXVA 4E2DA 3IJ7A 3D6NA 1XRFA 2WKGA 4CLMA 3EOEA 3WQ6A 3ARWA 2W67A 2W92A 1VYSX 3M0KA 3DOPA 2XN2A 5K3VA 3VKBA 3L0GA 3NVTA 8RUCA 2AQOA 1KLYA 1JCXA 3PZQA 4Z42C 1ZJBA 4J7RA 6ENLA 1VB9A 1TPH1 3ZMRA 4BK9A 2QUMA 1TA3B 2VD8A 1IT8A 4QBXA 6ALDA 4RJEA 1ITCA 1OYBA 1F3XA 3NFUA 1OFEA 4JFUA 3WO8A 4GIAA 1JZ5A 4JKLA 5CGMA 4E8DA 2DU2A 4ICMA 1M68A 5F1UA 3F2DA 5I2UA 1XGDA 4XAZA 3CB8A 3R8HA 3H2MA 5G2WA 4ACZB 5D38A 3UW6A 1GT8A 3P62A 2G4JA 3RX2A 3CIXA 2PRHA 2Z26A 4KS0A 1QHZA 3TROA 1B3OA 3MCMA 4D8LA 4C6PA 1XBVA 3W1QA 3AS1A 3CZGA 3WH6A 2GJPA 3PY2A 3B4UA 1GQNA 4UCFA 3AIEA 3W7DA 4Q8NA 3MKCA 1JPIA 3LTPA 3TW9A 3UXIA 2V81A 1MUWA 2OO6A 4N6EA 3WFZA 1HNYA 4QQ3A 1Q7QA 3AMGA 3IIZA 1IXPA 4J5NA 1EHNA 4LNCA 4UTJA 4LS0A 2PF8A 5FF3A 3PK7A 3QZEA 1XDLA 2CFFA 4GC3A 4PRTA 2VX6A 2X09A 4BEUA 2PTDA 4V15A 2QQ6A 3QSTA 3L65A 3JVAA 4L4PA 4QDMA 1WDSA 1X6UA 3SGUA 3T4CA 3EDFA 2QDDA 1W2VA 3F4WA 5CC6A 1NQKA 1V79A 3HBLA 5LNSA 5HMSA 1PZ0A 3B8SA 4QE4A 3BLEA 2Z4GA 2HISA 1F76A 1JDAA 4NRRA 4NJGA 2YCEA 5CH9A 3HPFA 1W3IA 1ZP3A 2XWDA 1R38A 5ABHA 4CEXC 1K9DA 1Q13A 4GRSA 4AHPA 3BLOA 2PWUA 4H8HA 4GZIA 1KM0A 1SR9A 2AMXA 4XAGA 1WXJA 3P67A 1YX1A 3W37A 1T96A 3HZ3A 3OTRA 1DJWA 3EGJA 3B3DA 3H2OA 1UD3A 1F2JA 4DY1A 1XC6A 3LLXA 2ANUA 3SCRA 4Y96A 1UP0A 4LUSA 4S3KA 1OD8A 1GOXA 3LHYA 1W9VA 3UZXA 2VEFA 3PTKA 1ZCCA 4UFHA 1EEXA 1L9WA 3ZS4A 4NQ1A 4O18A 3CBWA 1G94A 3VGDA 1KM6A 3DCPA 3QPYA 3M9YA 1VGAA 3J7HA 1CECA 1R3WA 4XZBA 4IQLA 4P2VA 1LDCA 2C1HA 2VCBA 1S2WA 1Q8JA 3RF9A 2VEGA 5CSYA 5HWJA 2PLMA 3MWAA 4HNCA 4DBDA 2REQA 3GIYA 3EYPA 1EJTC 3IUIA 3CV6A 2ZA1A 1AW5A 5BXTA 3WMBA 1SZGA 2VX5A 3A4AA 3T0BA 1EWDA 4MB3A 2NVCA 5GJNA 4B5WA 1W6TA 3W53A 1MNZA 1R2TA 5HUOA 4IICA 3GXDA 2WSYA 3E0WA 2BG5A 3SCSA 4J3UA 4P7NA 1IR1A 3IVUA 1XYAA 3L4TA 4HZ8A 3CH9A 2YYTA 1SVDA 2VR4A 3C5QA 3TTQA 2AAAA 2JGQA 3MP5A 3MT1A 3QTPA 2J7CA 1HP4A 2G96A 5CPTA 3W2NA 5I6SA 4M8UA 2AMGA 4PUWA 1D8WA 5D02A 2POTA 2QCCA 4O16A 3S83A 4LFYA 4DXVA 1R86A 1ISWA 1IF2A 2XFWA 3DG7A 1OG0A 4M1RA 2B0MA 5BMWA 4LSBA 1GOWA 2BS9A 4NZCA 3IGXA 2QCHA 2C18A 4HPGA 4C91A 2WBKA 5FJOA 1B2YA 3IRDA 3KW3A 5AVHA 4BI5A 3GDKA 2BOFX 2I17A 3GW0A 2YB1A 4FR1A 4H41A 1UKTA 2QF7A 3M5ZA 3AMDA 3W07A 4AZ5A 2GSHA 3APYA 1HUVA 3OU8A 1DWFM 3HMJG 2DZAA 4NRSA 1C92A 3CGTA 1TPVA 1E6RA 2P8CA 3PG8A 1GONA 2QXWA 1ZP4A 3NGJA 3UG4A 1HKJA 1JIBA 3QN3A 1EP2A 2ON3A 1SW7A 3VZYA 5D8ZA 1QASA 1VFHA 3LBMA 1ZZMA 3BGGA 3T44A 3MYOA 4I7WA 4X3ZA 1H62A 3OOQA 3N19B 4XSMA 4X2RA 3GHUA 4AEEA 1U1HA 1FWGC 1LBFA 4WSHA 4BF7A 3NVDA 1E1CA 2H90A 1TMQA 2QPSA 4YWSA 3VKCA 1QK2A 3I68A 2FTWA 1RVGA 2XFYA 3BPWA 3W0KA 1TZZA 1KRBC 3WF1A 3CHFA 4H9MA 3BQ6A 2J74A 4Q33A 4Y9NA 5AYZA 4R33A 3RXZA 5HWMA 2WCAA 3RRXA 3LN3A 1JCTA 1Y65A 3PB0A 4C5ZA 3EWUA 2WJEA 3G18A 3C2YA 4QROA 4PFMA 1K9EA 1VCFA 2A4AA 1JNEA 2YA2A 3WJYA 1WDQA 5A2BA 4JKMA 3E2SA 1Y7VA 3OZYA 3S5ZA 5E9AA 3TW6A 3NNTA 2DEPA 1W91A 4PCTA 3L7RA 1HIZA 3WD2A 4DF1A 4RE2A 3GAKA 3UWEA 3EX6A 3UJRA 3W25A 1OB0A 2D0FA 4MZ8A 3TFXA 1QT1A 1X7IA 1G01A 1F61A 1XD0A 4W8LA 3KOYA 3OLDA 4Z2IA 4JFWA 5CC3A 3ABZA 4AISA 3HPXA 5D8WA 3EMQA 4DLMA 3AICA 3WUFA 1EH9A 3M5XA 1NSJA 5CZJA 3SECA 4HA4A 2NZLA 3S46A 2HBVA 1K02A 1WKFA 2YZ5A 1XQLA 4TIMA 4HSOA 1QNSA 1TTIA 1TKKA 3W1XA 3VGFA 5JXQA 2PDFA 4B9ZA 2VYOA 1LLWA 4P61A 3RK8A 3NPVA 3L23A 5CPNA 2D1ZA 8TIMA 4TMBA 3I7RA 2VQTA 1FWDC 3HV8A 3VX1A 4MY1A 4RX0A 4IZGA 3G3MA 1WUEA 3QJAA 1E4MM 4UFKA 4AIOA 3O0FA 3ZLGA 4LUSB 1W5NA 4MSSA 1AQMA 3W7MA 5K9CA 1R3SA 2PBGA 4XAYA 4TX6A 3GYCA 4CNTA 1IHIA 5LGXA 4CNSA 4M51A 5LIWX 2F38A 2GWGA 3QY7A 2DQXA 2DQWA 4XZLX 4JIPA 1QBBA 4V1XA 1UWAA 1Q2RA 1S2CA 1M7PA 1YNQA 4C60A 1AFSA 3N4FA 1WOAA 5BXRA 1KNWA 4D2JA 3BAKA 3ITVA 1RA0A 4E8CA 4GH3A 1GVIA 1LQ2A 2V82A 1PCWA 4RXGA 3OQEA 3R0DA 4WLCA 1CPUA 2RDTA 4EXBA 1ZENA 4FNPA 4LVAA 4W8AA 4UTKA 4HU8A 2EG6A 2XM1A 2HNEA 3TEVA 3SRKA 2Q8XA 1GQJA 1VBJA 3FLUA 4JEJA 4FALA 2CETA 3HU7A 2VUNA 4QM1A 1YPFA 4CGTA 3B05A 3GU1A 4TX8A 3VC6A 2Q3OA 1RLCL 4OGZA 3LZ5A 5T91A 3MWCA 4R9XA 4CU7A 1W3TA 3WNNA 4ML9A 3SCNA 2ZZ1A 2ODOA 1TTJA 3GFXA 2OCZA 5HBFA 3N2TA 4Y8FA 1EZ2A 1EC9A 3ZM8A 3BG9A 2DY3A 2VZVA 2BWGA 4C6KA 4JTKA 4LALA 5D32A 3AIWA 1F4AA 3UWQA 2D73A 3G6MA 3HFYA 2P76A 5G4EA 1WXZA 3A5FA 3BLLA 1XV8A 1YTEA 1P0KA 3H2EA 3OW1A 1H09A 3CXOA 3O16A 1E6NA 1FXQA 1CDGA 2QCDA 1F7BA 3VVGA 2E1WA 4EF9A 1RR2A 1ZRQA 3ABOA 1E4IA 2XIBA 2J8TA 3QW3A 3GC5A 3GB6A 3MO4A 3H7RA 3CQJA 3NQFA 2VTFA 3SY5A 3R2GA 1PTAA 6TIMA 4PH6A 4DWDA 3L68A 1D7KA 2IQ0A 3WEOA 3CO8A 1X1NA 2GDVA 4QS6A 3PULA 1IE7C 2NSXA 3CHDA 4MZYA 1XJBA 2QAPA 2BVTA 2ZA2A 4A8IA 3NOEA 4GMEA 1QI2A 1MW3A 1LQAA 4CQAA 3NZRA 3NZGA 4OHQA 3V7PA 3R13A 2ZRXA 3MKVA 3VU2A 5C7VA 2JEQA 2YA1A 3A3WA 3BWWA 4ZTXA 1DE6A 4JXCA 1DQUA 4PRWA 5AC7A 4HTYA 4PUNA 1NAL1 1HGWA 4FB7A 2DSKA 3H22A 3T1GA 4L80A 1LUCB 2Y24A 3LZ3A 2HDJA 3MSDA 3F7JA 4OBTA 1NARA 8CGTA 1PWMA 2HVOA 1ONEA 1FVPA 4UQDA 1KM2A 4JTAA 4LX4A 1OCQA 4GC4A 4Z0SA 2XGBA 5DXXA 2CZFA 4LAOA 4Y90A 3PN8A 3HJZA 5LA1A 2CEQA 4KCUA 2EEXA 4LS1A 1EA0A 5T9CE 3QMTA 1A49A 3GNXA 3W7GA 3KRZA 3BANA 3BW3A 5I79A 3B0YA 4GLEA 3LCFA 4PN2A 3I10A 3E74A 3S5YA 2ZQ0A 1LZOA 1PKNA 3G77A 1A4LA 1K77A 3SQSA 1CZ1A 1KR0A 4HMCA 1XKYA 3SM0A 4JKKA 3IUDA 3PSWA 1EYWA 4Q8UA 3AIBA 4XZMX 4H6EA 2WKLA 3AHTA 3CUXA 3L66A 4FS9A 2HMCA 3QFEA 3LHUA 3U8GA 4L5ZA 3H4WA 4RNFA 2BV9A 2G0WA 1MEIA 3EMCA 3PZNA 3CMFA 3CASA 3ARRA 3G24A 2WZMA 5C9RA 4KRZA 1C91A 3W7NA 2VCCA 4H2CA 4KFOA 2REQB 4HZ6A 1OK4A 3L12A 4IX2A 3MSYA 2GSEA 3PFRA 1AJ2A 3GAYA 1KCXA 2PCEA 7REQB 1HJVA 1QWKA 4POCA 5FKYA 5KZ6A 3CV2A 3GM8A 1KM5A 1PHWA 2A7RA 1B30A 3A64A 1LG1A 3DKLA 1F6KA 4QLLA 3WLSA 4UZSA 5BW6A 5KINA 1ZGDA 3V75A 1S2TA 4FIRA 2E68A 4Q4QA 2ISVA 2GVEA 3GNOA 1O60A 3NPXA 3TSDA 4AMCA 4Y7EA 4D72A 4JHMA 1PXGA 4LCQA 1QNQA 2GJNA 3M64A 3GXNA 2VI0A 1UA3A 2IW0A 2VKZG 1OF8A 3SR7A 1WO2A 2INEA 4F48A 1FKWA 3OHMB 3CK5A 1R30A 4UMBA 2FZBA 5D4YA 3W76A 1W8GA 1HVQA 7REQA 1LL7A 2BTMA 4QIUA 2PGRA 2Z1KA 3L4YA 1EZWA 4S3CA 4UXDA 3NL5A 2A3BA 1DYSA 2YCLB 4LVGA 1G6CA 3RX4A 4EPEC 1OGGA 3GFZA 3CTLA 3OGRA 1EPVA 3SIZA 3UT0A 5SWUA 2X2GA 2Z1XA 4L6DA 4F0MA 2HQAA 3GVVA 5D09A 2O9OA 4QITA 3W27A 1CNVA 1OFPA 2NQLA 1IXQA 4AUBA 4UTLA 3LY0A 1JYWA 1CGWA 3Q4DA 3BO9A 2A3CA 3FOKA 3S1WA 1V3LA 3U6WA 1F6PA 1YE4A 3FDKA 3LMZA 4ZO7A 3UD6A 4AMAA 1A5KC 3WMSA 3S2CA 1VRXA 2YDAA 1RY8A 1TV3A 2QF8A 4GZEA 4P8WA 3IEBA 2WM0A 2PDQA 3BAYA 4N9EA 2HPIA 5E5CA 4C7GA 1XL9A 3PBVA 1DHKA 1KD0A 4DXXA 1MEWA 2YPIA 3QV7A 3MO7A 1NOWA 3BV4A 2OX1A 2YDSA 2VGBA 2O55A 4IXXA 2IPFA 1A0EA 3THQA 3ONCA 4D8AA 5A6KA 2PB1A 2OJPA 1SO3A 4DUVA 3H2FA 3P5ZA 4NIRA 1O95A 3MUXA 1EJUC 3AJXA 2FTYA 1KXQA 4O0ZA 2W9MA 1KBJA 4MNKA 1GVSA 1ALDA 4GUJA 1F3WA 4A8NA 2Q09A 3ANYA 3V0SA 4D6HA 3L5LA 3P3BA 3UJSA 4LC6A 1OX6A 3KLKA 4U2ZA 3KZPA 1IIHA 1XC4A 4U33A 4V27A 3AIVA 3KVKA 3GNNA 2VFGA 4AX6A 5M03A 3IJ9A 3VD4A 2X1UA 4IIEA 3NG3A 3O9NA 3K5XA 3B8UA 2YKKA 5C54A 5A6TC 3RX3A 2PZNA 1VBHA 1OFQA 1V3HA 5DEZA 1QW7A 1XDMA 1OK6A 3NQ8A 1D2KA 3VX0A 1YTDA 2E4TA 2WJFA 4LBUA 4HOZA 1OC6A 4GJIA 1XYCA 3TLLA 3N9SA 2ABBA 2NUXA 2CHOA 3PFMA 2R1LA 3UR2A 1O68A 4CN6A 3UYCA 3C2EA 4FX7A 4Q7NA 3N12A 4H9XA 1GJPA 1FTXA 2I16A 4MY9A 1W1B1 3GIQA 3NQAA 1M6JA 4QG8A 1EUNA 3G1SA 2ZXBA 4AQLA 2VP8A 3B9DA 3OQ8A 4ZFMA 1FWBC 3ZVHA 1HJUA 3LRLA 1DJHA 1RJRA 4I7VA 3AIUA 1CT5A 1V6YA 2PTWA 3TYZA 3CM4A 3H2CA 4K1GA 3E0VA 1PKLA 1A4MA 1WZLA 2E09A 2NQ5A 3S5NA 1UBPC 4C6OA 3AI0A 3LHWA 1R8LA 1ITUA 3EAUA 3GSMA 5MKGB 4FEZA 9RUBA 3VM7A 3GVGA 4HPXA 4JY8A 3VIHA 1MXGA 2VC9A 2C15A 5BRBA 3LPGA 1VPQA 3VILA 3UGRA 2BXZA 2BDQA 1LT8A 2ALDA 3RN6A 5MF5A 4AZIA 5TIMA 5KMYA 2EPMX 2ZDRA 2OFJA 3NDZA 3BGJA 1XF0A 3E9AA 2KX9A 4NJIA 3MHFA 2A6LA 2XTKA 4Y9AA 1Z41A 3VI2A 3F5KA 3UNTA 4DRSA 5I00A 3ZWTA 1B3WA 3L4XA 3KXQA 4LY8A 4PUDA 3T0DA 3AYVA 3JZEA 4AZHA 3VGGA 2DUXA 2JK2A 2XU2A 4MNMA 5BWAA 4GGHA 3OB8A 3QTGA 2PF0A 2JF7A 4AWUA 3FCPA 4MYAA 5FEXA 3NL6A 3BQ5A 4K37A 4MY8A 3MMTA 4JQ2A 3BXWA 4S3EA 1B3YA 5E0CA 3VIPA 2IQDA 1OFDA 4HNTA 5FESA 1SZRA 4MLRA 4R3UA 3ITYA 1IT0A 3W7KA 1IZCA 3ZLFA 2XH7A 4IISA 3TN4A 1Z6KA 1LWIA 1TWIA 3P0XA 1TYGA 2FFIA 3WQ4A 5A6AA 3MDUA 3M07A 1QAPA 1GG0A 4W5ZA 5AKQA 5U4NA 5D2WA 1RQHA 3BH4A 3KBNA 3WIJA 2Y89A 3RYSA 2Y62A 3EDEA 1RBAA 4L56A 4AX7A 4PSRA 4DZIA 3KCJA 3WLRA 4INFA 1RCXB 4K38A 1UROA 4ZQCA 2WSKA 2F2KA 3A6OA 3KOXA 1BYBA 4CU6A 1RD5A 2WV8A 1RCOB 2EO7A 3CU2A 5DO8A 1SJBA 2QV5A 1JZ3A 3BLIA 4R7OA 3ZYZA 1BKHA 1N55A 1H11A 1QPRA 2INFA 1JL8A 5EMUA 1EDGA 4OFCA 2JF6A 3FJNA 2OYMA 1XKJA 3LNPA 1GZJA 5I78A 2DH2A 1T41A 2Y2WA 1XH0A 1LQ0A 3VM5A 1PCKA 3E0FA 1TA3A 2HBXA 4XAFA 2FMNA 4DLFA 4ZOEA 1CEOA 3L67A 3GKFA 5IM51 2J9XA 5D05A 3IWPA 3LTYA 3TUUA 4PR4A 4OV9A 3IJ6A 2E5CA 4EVZA 4AEOA 5AZ1A 3BAJA 1LOSA 3EWCA 3WMCA 4QJ3B 1I2QA 1XLMA 3KDOA 3S5SA 1V6WA 2C14A 3W71A 3ARYA 3G1YA 3OLIA 1GHSA 2HPMA 5DMYA 3HPSA 1W9BM 5FJTA 5FEWA 4CNPA 5G2HA 1XUUA 1U1JA 3OBKA 3W2JA 1US3A 3STPA 5LNVA 4ZCWA 1OC7A 5HAOA 3CWNA 1H7XA 2Q8ZA 3QQWA 4WOQA 4GKLA 5JUVA 2WHMA 1M7XA 3QR1A 1XLAA 1AQHA 1NWSA 3VNKA 3LM3A 1RALA 1ECEA 2BMBA 3WD3A 1P4CA 5K7JA 1R3TA 3SUSA 1FWRA 5EL1A 1U22A 4LU0A 3P0WA 2GVYA 4XSLA 4IJCA 1FDYA 1UWSA 1L2QA 1EOKA 4C6LA 4TTUA 1PDYA 1YIXA 2BXYA 3I6EA 1W17A 5FOOA 3SADA 3TWAA 3KX6A 4FXSA 3ARPA 3F5LA 3W7IA 4ZBCA 5H91A 1GOMA 4ICNA 3RM8A 4NYUA 4KH2A 4X63A 2Y4SA 3FEMA 3NO5A 2YW3A 1OC5A 1AQFA 2ZA3A 3G1HA 3WLLA 3NQ7A 2FZMA 4ZSUA 1A5NC 3MUAA 2G8ZA 1TCDA 4FI4A 1P48A 3VUPA 5LNUA 3QKZA 4DO7A 2VENA 3F5JA 2WO5A 4UUIA 1XH2A 1O5XA 4UQBA 1Z8AA 4R5EA 3WF2A 1Y5WA 2XN0A 3TQ0A 3GHRA 3VNDA 4W89A 4O57A 3QPZA 3S2NA 3W7HA 1Q6FA 4XD3A 3RHGA 3JU2A 4GINA 2FGZA 1GKRA 3W23A 3RR1A 3RU8X 3E2RA 3EX1A 3TK7A 1CI1A 2XH4A 3A3HA 4MB5A 4XG1A 1OJXA 3BZGA 2C91A 3U5YA 2DT3A 4W85A 2EQDA 4A35A 2CBUA 1JD7A 4JTRA 2ZZ7A 2PDUA 4IG2A 2KAUC 3M7WA 3U0HA 4CEUC 4B92A 1V6XA 3I3EA 3G0XA 3K4DA 3VCRA 3NWRA 3WQDA 4MKNA 1R87A 3DHFA 3PWIA 3AS3A 3QM3A 1NVMA 2XWEA 4MWAA 9XIMA 3I6TA 1W1IE 1SZEA 2QJJA 1Z48A 3V35A 4FP1A 4K7VA 3N2MA 4IWWA 4FK9A 3WMLA 2Z1VA 5FF0A 6CGTA 2ACRA 3QKEA 3UG5A 3V3WA 4MHBA 4NVTA 1E9LA 4WGXA 2V30A 5A3HA 1HGYA 4IPNB 3CUHA 1G4PA 2Z25A 4AIBA 4PFHA 1UKSA 4S1FA 4HNLA 2CLLA 4GWEA 4FNSA 1TX2A 4TTGA 2DW6A 1FP8A 3IIXA 4BF5A 4H7VA 3MCNA 4RNHA 1J01A 3IRSA 3U2CA 1C3FA 4PMYA 3EA1A 1J12A 4XTDA 4LAZA 2D69A 4HYRA 2OOGA 4DX3A 3PJTA 4D1IA 3MV01 3W85A 1EDTA 3UZYA 1XBYA 2YYUA 4M82A 2ESCA 3L0KA 3F03K 3KRBA 4PYSA 2ZICA 3W7JA 3RU6A 1PV8A 1J0IA 1DBTA 2DZBA 4GJJA 4NZ3A 4YLWA 1TPB1 3N2BA 1CXHA 2C16A 3VDCA 4NL1A 4O1EA 4LUJA 4MADA 3FN9A 1V77A 3GDRA 1F4HA 1M03A 1XSKA 4HPJA 1U5VA 4G7FA 1TB3A 2R1KA 4LRTA 1EC8A 1OY0A 1YPXA 4H6QA 5C6MA 4PBGA 2CU0A 3WK2A 4HMNA 1V0KA 5AHEA 1ITXA 3WF4A 5ABEA 3V1PA 4DQWA 3BG5A 1IWPA 1XM3A 2WXDM 3MUY1 1EP3A 3FY1A 4ATWA 3DC8A 3ZJ8A 4JGDA 3CL7A 3OZOA 1A5MC 2BGNE 3AUJA 4S3DA 3W7CA 4J3TA 1XLJA 3MP3A 4PSPA 3CJPA 3H70A 2INZA 4TOQA 4JTLA 4AXKA 1BFNA 2VRKA 4GIYA 1VCGA 3E96A 2X16A 1J6PA 3S9ZA 3VO0A 1ZS2A 1OWQA 3S1XA 4N4PA 2A85A 3GW3A 5CKSA 4CVWA 1ZU8A 4Z2LA 2ISFA 3C3NA 2IKHA 4AZGA 2J47A 4QR6A 1EBHA 5G4WA 1U1UA 3M43A 1AODA 2AL2A 3FVDA 3R94A 5DN1A 1XRSA 3P74A 3TQPA 2C19A 5AC6A 1N2VA 1KV5A 3KLLA 1FCBA 1T0OA 3KBSA 4X61A 3EA3A 2WZTA 4W86A 5EYWA 1WKDA 5JMUA 3NXLA 3PZMA 4DUOA 4CD5A 4XZHA 4RE4A 3HQNA 1F5ZA 1VJZA 1ZAJA 5G5IA 1IEVA 3P80A 5C2CA 1R3QA 5JQ9A 3QR0A 3EKZA 3WJWA 1IQ8A 2NWSA 2NV9A 3XIMA 3SW6A 2PGEA 1SJCA 7TIMA 3CWHA 1PZ1A 3SY1A 1J4EA 4PTXA 4UNLA 3MBFA 4UC5A 4J35A 4DIAA 4KIRA 1RHCA 3LGGA 2WVVB 1X6NA 3ARQA 1UZDA 4JDBA 4H3DA 3FSTA 4UNKA 4HU4A 1W2PA 4HB7A 3SUTA 3DN5A 3PBGA 2W79A 3TYBA 4HTBA 2IKIA 1DIEA 3BCFA 3W3OA 3WCZA 3QRHA 3QYQA 4H8VA 3LUTA 4QISA 3SJ3A 4EPBC 7CGTA 3TTYA 1F05A 4UTTC 4X2PA 3B40A 1K8XA 2CWXA 2VEKA 5KZDA 4Q4MA 1B57A 4ENLA 3HF3A 4FLOA 1CW2A 3W1PA 5L6UA 4UQ9A 2FKPA 3CH0A 4W7UA 5EMMA 2QVHA 1KBLA 3D3AA 2WM1A 3S2LA 5BCAA 3W2KA 4B5NA 5EFDA 4JTUA 4GPNA 1V3MA 2FVLA 3FAXA 2DIJA 4RV3A 2PLCA 3L0NA 4JTJA 1H60A 4JYDA 2ZWZA 3A5VA 4UFIA 4ZB0A 4BI6A 4PUMA 3SCVA 1GCYA 5HMEA 2L5HA 3GK0A 4FLRA 2PLJA 3EEZA 5E93A 3IGHX 1E9YB 3GR4A 4DO4A 3S1GA 5AHLA 3MUCA 5BNKA 3G0UA 2J8GA 5JU6A 3PM6A 2J7HA 2RFGA 3ABQA 4UFLA 3EB2A 5DT7A 4MFDA 1LRNA 1KW1A 4MTVA 3USBA 4M56A 2Z1SA 2JALA 5I03A 5E09A 1GPFA 4HMEA 2RGMA 1GVOA 1TPWA 3AHVA 3VD5A 1PL9A 1NP0A 2ZE3A 2WPBA 3V36A 3WYZA 2XSXA 5CLTA 2HS6A 2MANA 4DJFA 4BEQA 1CXIA 3HN3A 2ZZ2A 2NLIA 2B7OA 3LMYA 1S5NA 4ZR8A 3O6DA 5H1WA 2PC8A 1FOBA 1ICSA 3QHOA 4CD6A 4K8EA 1IEIA 4PBFA 5T8GA 4QE5A 3H4XA 1YDYA 4IPJA 5A2CA 3QLLA 2VMFA 3AXHA 1UUMA 1FCUA 2EGZA 1UPMB 5C8BB 4I5XA 2X0YA 1LL6A 4JN6A 3P60A 3BG3A 4HHPA 3H7UA 4KGJA 1Y0EA 1JAKA 1J5TA 2WQDA 2C79A 3TSMA 3K4WA 4AWTA 3NQBA 4HP5A 2WQPA 1IR2A 1OFAA 1MMFA 1GUVA 4V33A 1UR3M 1EJRC 4WDUA 4GBUA 3UG8A 3ZT5A 1GVRA 1QPNA 4CQ9A 4YU1A 4S3JA 1J0YA 3T0AA 3KTXA 5A5WA 2PCQA 3ARTA 2XVKA 5A1AA 3E5BA 3A4JA 2Z7GA 3N4AA 1P0EA 2D2OA 4CCZA 3P6LA 4TVDA 1NM9A 5DQPA 3WELA 4GUFA 4QCFA 1VF8A 4GYFA 2CBIA 1T99A 5LIUX 3WUEA 2YFNA 3N4EA 4JIRA 2EPLX 2PU0A 4JZ5A 4M19A 3ITTA 4AZBA 1PX3A 3GDBA 4F0LA 3KP0A 1ICPA 4BQ3A 5D9MA 2J4GA 3XISA 1UIOA 4Q6XA 2X0SA 1UYQA 1FCVA 1RV8A 3Q58A 2WCSA 3L2IA 3GXPA 3LPPA 4PCNA 1WYIA 1CLVA 1JVNA 4GUHA 1BGGA 3SCOA 4UNIA 2WKJA 4W9TA 3TQKA 1GKPA 5GNZA 3PC0A 8XIMA 1LTDA 1D3CA 1K7XA 4LF2A 1IWAA 4LB3A 4WR3A 2YJQA 1AMKA 4NHVA 4XV0A 3TOYA 1QPOA 1OADA 2HZGA 1XIDA 5HQEA 1VAHA 2BY1A 2GDUA 2X42A 3HG3A 1IGSA 5BRPA 4YJ5A 4DYEA 1HZYA 5CPLA 4GX8A 2DGAA 1O1ZA 2EPHA 3EX3A 3EBVA 2RHGA 3WDHA 2DZVA 4IGSA 3BAXA 1GZGA 5GJPA 2AL1A 2BOGX 1V6UA 1DJIA 1AH3A 3B9NA 1I2NA 2DSWA 2G5WA 4AYSA 3ZSTA 4HIBA 3AIQA 3TE9A 3B9EA 1QU4A 2YB4A 4ZGYA 3DC0A 1K03A 1OX5A 1CX9A 4WZHA 1QWGA 2ZWYA 3LCLA 1BXNA 2MNRA 2ZUNA 4UQAA 5JH2A 3APTA 1G9HA 1QO5A 3W1NA 4A8RA 2CIPA 4QAIA 1RH9A 3T09A 3KS6A 3UWVA 2ACUA 3I3BA 4IIGA 1MZRA 1DIOA 1I8JA 3UP8A 2QJNA 3MMUA 4QG9A 3N6JA 2EHHA 5EMYA 3QLDA 4FA3A 5E0FA 1MYRA 4IXHA 3SRFA 1Z89A 4Q8VA 3QY6A 2XINA 2UY5A 3D0CA 3UQNA 5T26A 1B9ZA 2GZXA 3TJIA 4GISA 4BKNA 2QNEA 5CG7A 4MWAB 1QR7A 5MHBA 3VTRA 3WLJA 1JUKA 1UZHA 4AVNA 3ANVA 3OP2A 3ZVHB 2ACSA 1JDDA 3Q65A 3SSZA 7PTDA 2O9PA 1H0IA 4KFPA 2QR6A 2QHAA 4AZ6A 1VEOA 3U7VA 3MC5A 3G1XA 2UBPC 1CENA 1NDWA 3R79A 4L65A 3BGAA 3WNLA 4B5VA 3TOPA 4RDVA 2FVMA 1I60A 3TCSA 1XLDA 5C7HA 2J25A 1F9CA 1KCKA 4XIMA 3GG0A 3I65A 4GQGA 4KPLA 2A7PA 3ARSA 1N8WA 3OVPA 4A21A 3W6LA 6XIAA 1J2WA 1SO6A 5EFFA 3WQFA 1QOXA 3W88A 1NOFA 5CBBA 1KR1A 3AALA 5AC4A 3LQLA 2YDRA 3K13A 1CGVA 1L0PA 3WQGA 3O6YX 4O0KA 4QG6A 4RDWA 3N25A 3MZ2A 3CQIA 3RDKA 4FNUA 4MPKA 1M3UA 1PTDA 1TVNA 2PLKA 5CJ5A 1NWRA 4M1BA 4PBEA 2V5BA 4AF0A 2H3BA 3H24A 1DKWA 4EE9A 3KAOA 1DWHM 1OBAA 3AXKA 3HG5A 1B1YA 3SCPA 2WVSA 3AISA 2YIHA 4KKXA 4UTWA 5IFTA 2VDGA 4E2OA 1I1XA 1GPWA 1YXDA 3STEA 3NGFA 1DL3A 3WFLA 1BTMA 3NUKA 5CLWA 1QVBA 2D20A 5BMXA 1O12A 1E71M 5IDZA 2WHJA 4MJZA 4F79A 2G50A 5CGTA 4JNMA 2PDWA 4X9YA 2GGEA 3W26A 4ZTYA 4US6A 1KTNA 2X41A 2PDHA 4QP0A 4PE8A 1BQCA 4DO6A 1UWTA