2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
b'NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase class 1
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Lyase
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
1A5SA 1H5YA 3LOTA 2C0AA 5H2ZA 4MOZA 3S5NA 4JIPA 4PFMA 1WV2A 1LM1A 5U7SA 4UR8A 3SW6A 1EB3A 3I68A 4AF0A 5K9CA 4RXFA 3FOKA 5DBTA 3S5YA 4FNQA 4KFOA 3DU0A 3NPWA 4G1KA 1B9BA 1DV7A 4TX9A 5HINA 1FCUA 1XL9A 3NPVA 3RLVA 3STFA 2ZZ1A 1FUYA 1MEIA 1K7FA 1TRDA 2B7OA 5A8GA 1WYIA 3THAA 5CSSA 1GZGA 3DAQA 4JD4A 3WFAA 1D9EA 2QCGA 1W3TA 1EPXA 3NVTA 3HG4A 3IVTA 3RFAA 1M7PA 1FXPA 2QCNA 3MYPA 2NX1A 3NQAA 3W1MA 4LRTA 4A29A 3P80A 3S9YA 3GR8A 1CX9A 1KM5A 1OYBA 3PSWA 4AWUA 3N2XA 4M7TA 2V81A 2VEKA 3UY7A 5FF0A 1MEWA 4YWIA 2XN0A 5FF3A 3W84A 3GNDA 2JGYA 3W2LA 1W37A 4ZVJA 1SFJA 3W86A 3W74A 4AHPA 2VXNA 1VS1A 3I7SA 4XKYA 4MIMA 4QITA 3FFSA 4O19A 3P8JA 3LLFA 4JDBA 2H90A 1OFOA 2AQWA 3W1QA 5K9XA 1JQXA 1RQBA 1PCWA 4IXHA 2ZTJA 4MZ8A 4QAIA 2FB2A 4MVAA 4NNAA 3LCIA 5CZTA 3H55A 1SQ7A 2AAMA 1QCWA 4RV8A 4S2BA 3HG2A 4O15A 3LCWA 1FWWA 4UMBA 1T96A 2QJHA 1WDWA 3BG9A 3IIOA 1A5AA 1FWSA 1PCKA 3I7RA 2ISVA 5F2LA 3GKAA 1KTNA 4AH7A 4Y96A 4IQLA 2NUXA 2ZZ4A 1LBMA 4UTTC 3TK7A 2Y7EA 4HKPA 4X3ZA 2ATMA 5FEXA 3T4CA 5DELA 4HNUA 2WQPA 2ZZ5A 1ALDA 1RQEA 2NLIA 4FHAA 2GPTA 3HGJA 3C52A 1ME8A 3TE9A 1UASA 2Y61A 3NO5A 5HWJA 2ZDRA 1XBZA 3C2VA 3ELFA 3ABQA 1O4UA 2ZA2A 3W6YA 4LVAA 4N6EA 3L5LA 3M1ZA 3B03A 2QCDB 1TB3A 2LLEA 5LZLA 1LOSA 1SZGA 2QCLA 4AXKA 1X7FA 4NNCA 2DU2A 1KV5A 1YTDA 3HB9A 4O18A 3LXCA 2ZFAA 1PE1A 2V30A 4LVDA 3NZRA 1QNVA 5A5WA 3HGSA 3DI0A 2CLFA 4DBDA 2OT1A 1OFPA 4NJHA 4M19A 5AHIA 4Z0JA 1A53A 3H53A 4OBTA 3VE9A 4ZZ9A 3CC1A 2QUUA 2ATSA 4L4MA 1G4SA 5I3FA 5I3KA 3MBFA 4BWLC 2FLIA 1FCQA 4FNRA 1TCDA 3A24A 1W1ZA 2A6LA 4PCFA 5K3VA 1OFQA 5I3GA 1IXPA 1I45A 3M9YA 4LUJA 3W7DA 1WAUA 3STCA 3MUXA 4FB7A 1KM2A 2YPIA 3LV5A 1BTMA 4PEKA 5BRBA 5K4ZA 1RV8A 3DKJA 2CLIA 4LV9A 3TV8A 5L9FA 4HPJA 1W31A 1I2QA 3LERA 1QO2A 3HJZA 4K6AA 1FY6A 3M0ZA 1OFAA 3STGA 3GLCA 4R33A 3LTYA 1KM1A 2FIQA 4JTJA 4QM1A 1PVNA 2J88A 4JIQA 3E96A 1SU5A 4EF8A 3EWBX 3KVJA 2TSYA 1AK5A 2RH9A 5IBXC 1TPUA 5DXYA 5CPNA 3MBDA 2WKJA 4O8RA 3GXTA 4DXVA 4JTIA 3W7CA 4E0CA 4KWWA 2DORA 4RCXA 1X6UA 4RZ6A 3I7QA 2WNZA 3LV6A 4Z1BA 1W5PA 2VC6A 4FX6M 1R2RA 4NJGA 4DO6A 2HS6A 2QAFA 3BK0A 3TFCA 4HN4A 1B4EA 3GXNA 5DLCA 1G6CA 5E93A 5EA9A 1XM3A 2E09A 4L4LA 3S0CA 4N9DA 3QZEA 2PURA 4GFSA 3O16A 4UIOA 3E9AA 1SO6A 4YMZA 4JTEA 5TIMA 3H54A 3G3DA 4IUOA 3TXVA 2WV8A 4MKNA 1R30A 2CLKA 1VLIA 5C54A 1HFBA 1P0NA 4Z08A 3HG3A 3NEVA 4AWSA 3C8FA 2J24A 3UZ5A 1HUVA 3C0JA 4QNEA 2QF7A 1OX4B 4D2JA 3PF3A 2E6AA 1I2RA 4LW7A 2J9ZA 1VCGA 2ISSA 5I3HA 2JKEA 3NQ8A 4BWLA 4LV4A 2V9DA 3P62A 4IWWA 3NQDA 2A85A 3P5ZA 4FXRA 2CZ5A 3PS7A 3C56A 4GUIA 4UTJA 1LRQA 3O1NA 4O16A 4CLMA 3NQ7A 1XUZA 3KVLA 4YL2A 4DF2A 4BR1A 5EPDA 2RHGA 3SY5A 1AG1O 3RMJA 3L9CA 1F76A 2P10A 3PBWA 4WZHA 2HSAA 4FXSA 3M44A 1LRNA 3A9IA 4TR9A 3L0NA 1XBVA 3HMJG 4GXMA 4AB4A 4RXGA 5FESA 1GOXA 1L6WA 3W9ZA 1EWDA 4KFPA 1DBTA 3MMTA 3OEXA 3TW7A 5I3IA 3GZ3A 3MWAA 5AHLA 1GPWA 3IRDA 3G24A 2FJKA 2NXIA 4O1DA 3BARA 4WY0A 5IBXA 4AMAA 4O52A 2VFGA 4K37A 3W7IA 1TTPA 3W2NA 4FIRA 1B4KA 4LOCA 4ML9A 4A2SA 1Z42A 3W7OA 3QFEA 1J5TA 3W83A 1LZOA 3M7WA 3CT7A 3GX9A 1VLWA 3KRSA 3CWOX 3W1LA 4N4QA 4O10A 3INPA 2QJIA 3OG3A 1VCFA 3LCLA 3QF0A 2V5BA 5AB3A 1GG1A 3OA3A 3MP3A 3PM6A 1T8XA 2ZCGA 1ZAHA 4HSOA 1VJIA 4N9CA 2TMDA 5TQLA 4ZL1A 2V82A 5DY2A 1EP1A 4NT0A 2ZRZA 5C2XA 1YDNA 4UFKA 1Y0EA 2C14A 4UTHA 3PAJA 2C19A 1I8JA 2A7PA 1VCVA 4RKAA 1MXSA 3CEPA 3M43A 5C55A 2WSRA 5C5YA 3NDOA 3A22A 2A0NA 2PE4A 3UD6A 2O7SA 3E02A 2PRHA 2H8ZA 3W2JA 1QFEA 1XI3A 4LNYA 2E6DA 3U6WA 4XTDA 4AWTA 1F74A 2HTMA 2YR1A 2Y6ZA 2PRMA 3G0SA 4NZJA 4JDYA 3W7NA 1R46A 3A5FA 4S2CA 3EX3A 2QDHA 2YX0A 1ZALA 1J2WA 4MZYA 3TU9A 4IPJA 2CW6A 1W8SA 4WOQA 4KKXA 3FEMA 1C8VA 1TPVA 1EA0A 1LLZA 1ICPA 1TYGA 1WXJA 3NQFA 3MI6A 3W73A 4JXCA 3DHFA 3TQ0A 1K02A 2CFFA 4POCA 3WK2A 4M5PA 2E5BA 2B0MA 2V8ZA 3IEBA 2W0UA 5FEZA 3QSTA 4O57A 1QOQA 1LORA 1YDOA 1ZJIA 4UCGA 1BEUA 4JTHA 2QUVA 5KZEA 1QOPA 2X1UA 5AN7A 1V7YA 3F4WA 4UFJA 3OVRA 1DJQA 1QWGA 3HF3A 2X2GA 1DQXA 3NQMA 3R2GA 3M5YA 3LI0A 3VCRA 2WOQA 1D3GA 3VI2A 3ABOA 2QCFA 3T55A 3WJWA 3STEA 1K7EA 3IIVA 1TV8A 1PIIA 3A23A 4AHQA 2YW3A 1OF8A 2J9YA 3B4UA 2NX3A 2QAPA 3P61A 3O6DA 4GJ1A 4K39A 3MO7A 5AHMA 1EP2A 2VFDA 3MI2A 2NXHA 4H3DA 1PV8A 2A2IA 1GYLA 3TMLA 2HS8A 3NQCA 1YYAA 4LU0A 2CZFA 4O1AA 3LTPA 1LOLA 5H91A 4AAJA 4PTNA 4Z1AA 1DOSA 2Q8LA 1SO3A 3BLEA 5K7JA 3JRKA 1GWJA 1KBIA 4FNSA 3NG3A 3W71A 1ZFJA 4E2DA 2E1DA 2X16A 3E12A 1JVNA 1TJPA 2A7NA 3L66A 2GOUA 5CPMA 2A1YA 1OYCA 3M5XA 1YADA 2E6FA 5G4WA 1JCMP 1T0OA 3MYOA 3BG5A 4O17A 2CZDA 2QCEA 5BMWA 3HO8A 4WUIA 3GXPA 3UPBA 3I6RA 4Y8FA 2G5WA 4Y9AA 3QW4B 3M5ZA 4IMCA 3RU6A 1SSGA 3UZJA 1JJKA 2OMAA 1GVOA 1WOAA 2QCDA 4O12A 3FKRA 5DCBA 4DF0A 3KAOA 3AO0A 4XWUA 2Y88A 3N9RA 5E0KA 4HNNA 4MZ1A 4O11A 1KA9F 2W79A 1IXNA 3BGGA 3PB0A 3TDFA 3DBPA 2XFWA 4JYFA 3QJAA 2YFOA 3NNTA 3PUDA 4X9SA 5D38A 4O13A 1UB3A 1JCYA 3BPWA 3PBUA 3EX2A 4JX4A 2FQIA 1QPRA 2QCCA 2ALDA 4NNBA 3TAKA 1EUAA 5D32A 4MYXA 5T26A 4UTUA 4JGDA 1G7UA 2BX7A 3PBVA 3C6CA 1YDVA 4A2RA 1TO3A 1IXOA 1UUMA 3B05A 3W1NA 4N9EA 2D73A 3HGRA 3K30A 4UNLA 3Q94A 2NV1A 5D05A 1SUXA 1L2UA 5F1UA 2H3DA 4XZ9A 2EPHA 3N73A 3ZWTA 3O05A 1H7NA 3S6DA 1YXDA 2ZA1A 4IMDA 3HOJA 5G2WA 5DCEA 1H60A 4LS2A 4RLIA 4GUFA 1T99A 2VFEA 3EKLA 1NF0A 3G0XA 3QH2A 4LC6A 5G5IA 1F2JA 4DELA 1Q6RA 3BLFA 2R8WA 3LB0A 3PBYA 1PHQA 1F7BA 4NUWA 3W7EA 1HO1A 1BWLA 2ZRUA 4BFAA 4WXYA 3QPZA 5D30A 3N9SA 4XBSA 2ZRXA 4N02A 2H6RA 1M6JA 1FDZA 1TPDA 1QR7A 4GWEA 4BF9A 2BZNA 2NX9A 5LHEA 4BI7A 4IGHA 4OV9A 3GDLA 3Q37A 3RF9A 3FS2A 4IMFA 3DXIA 3EXRA 2C13A 1IIGA 3UWUA 3UWQA 1I2PA 3W7LA 4ADUA 5EKYA 5F2GA 4MY1A 1DL3A 4I7WA 2OT0A 3NQEA 2VFFA 2C6QA 5LKYA 2Q8ZA 3G1AA 3GR7A 4MJZA 3EWWA 1H1ZA 1H50A 4ZQRA 4M6PA 4LVFA 4MUZA 2ZYFA 2Y89A 4GUGA 2C1HA 2E77A 3C4UA 4JY8A 4NX5A 2QEZA 3LTSA 4HT3A 4H6KA 2C15A 4S1FA 1QMLA 3G22A 1KTCA 4FNUA 3QW3A 3L67A 4JTGA 3BW4A 2QCHA 1KM0A 2YCEA 4EVZA 4UFHA 1G4EA 2CWNA 2JGQA 2Z6IA 3P82A 3O15A 5FEPA 3CWNA 4EIVA 4RZ4A 1EEPA 3TA6A 2I1OA 1OX4A 1BWKA 4UNKA 2VFHA 1P0KA 4CCCA 3N2MA 1TTQA 1KTBA 4R34A 5HNRA 1R47A 1JRCA 2GUUA 1JUEA 4NZFA 1N55A 3S1UA 1L6YA 4X22A 3R5EA 4UMAA 3R13A 1ME9A 2CLEA 4IXXA 2GVLA 1DVJA 1VPXA 4LS0A 4DQWA 4BI5A 4MLRA 3UWWA 3IV3A 3USBA 2GJNA 3LI1A 2E5DA 1I2OA 1LBLA 3DH7A 3UXAA 5EL1A 4N9BA 5FF4A 1FDYA 5BMXA 1W0MA 4YXGA 3NQ2A 3G8RA 3S42A 5G4EA 1NFBA 2DJXA 4PODA 1XFBA 3RLUA 1I2NA 1KV8A 1GVRA 3AJXA 4IPIA 4FEZA 4N4PA 4I7UA 4Q4KA 1X1OA 4A22A 1ZHAA 4UTIA 1F6KA 1OVDA 1GG0A 4JN6A 5KTLA 4LY8A 1ICQA 2NXGA 3RK8A 3ATYA 7TIMA 5D2XA 1P5BA 3WK0A 2A5HA 2H8XA 1X1ZA 1GTHA 2WSYA 3B8DA 1HG3A 2FPYA 5F2MA 5LGZA 1SPQA 3W1XA 1LDCA 1VYRA 1YTEA 1SR9A 5EY5A 2GQ9A 2V2HA 3NPUA 1H7RA 1OG0A 4NXSA 1SZNA 3WJXA 1XC4A 3G1XA 1WBHA 1ZCOA 3LHUA 4Q33A 3CHVA 5DCDA 2VFIA 4NQ1A 1OX6A 1HTIA 1KFJA 1H7WA 3LHTA 2R14A 1GVSA 2WPBA 4AVFA 3LM7A 5AHNA 4ZMGA 3IGXA 3VE7A 3W7GA 2A4AA 2DZUA 3FJLA 4OQVA 2BSLA 1KFLA 3LXAA 1ME7A 2DZPA 3M5VA 3O6YX 1XBXA 3S5ZA 5DXXA 1M7OA 5D09A 2CZEA 3RNDA 1VHNA 4QISA 4YCOA 4UFLA 3TX9A 3HPXA 1TPWA 1KFBA 2B7QA 3BG3A 5G2IA 1WX0A 3SR7A 3UWYA 5F4WA 1K3UA 3L5MA 5D2WA 4C1KA 1LBFA 3FA5A 1MEHA 3N19B 2RDTA 3N14A 5CKSA 3LCXA 2CLOA 3KXQA 3C2EA 3L2IA 2A7RA 2JK2A 3KFTA 1VYPX 2W6RA 5LNSA 2A21A 1FXQA 5KMYA 5DN1A 4Y90A 3VNDA 5CGQA 3EX1A 5AYXA 4ALDA 5AC6A 5CG7A 1UCWA 1HO4A 2Y85A 3CB8A 5KITA 5D04C 3SECA 2V0TA 3W1AA 1E51A 1JUBA 3W88A 4JY9A 3M47A 1TTJA 5HWNA 3OVPA 4HNVA 4JTLA 4Z1DA 3VKJA 5CZSA 3GDKA 2ZZ3A 2GVGA 2P0OA 5F4XA 2X1TA 3KHJA 2WO5A 2NWSA 5AYZA 3EWZA 4HPXA 4DO4A 2NZLA 2ZRVA 3P60A 3FYOA 3EX6A 4B5NA 4JYEA 4WX2A 1B57A 1GEQA 3CIWA 4P2VA 3T40A 1MO0A 3LCFA 3EXSA 1XXXA 3HQ1A 3T7VA 5LHFA 3G1VA 3BW2A 4HSNA 5I3JA 3N3MA 1WA3A 5EYWA 1OHLA 5F4SA 2FFCA 1H61A 3HIJA 1OABA 3TH6A 3M6YA 4TU1A 4TMCA 3PC0A 4QNWA 5J5DA 3B06A 3NQVA 1S3HA 1Q6LA 1NVMA 1GQNA 4C1LA 3W76A 2Z2UA 3W7JA 1VH7A 2J6XA 3W1UA 3QQ1A 2CLHA 3GB6A 2Q3RA 1FWTA 3BGJA 4LTSA 4MY9A 1BKSA 2VEIA 2X1SA 4A21A 1JUKA 4ORMA 3GDMA 1EX5A 3P5YA 2DZTA 3TQVA 3MW7A 4UC5A 1C9DA 4UTWA 2PCQA 1AW2A 3NL6A 2WJZA 2E68A 4ZQOA 2OZ0A 3DFQA 4CCEA 2X30A 4M6VA 4X2RA 3BVJA 4XTIA 4LVGA 3L68A 4FO4A 4OHQA 1G69A 4NVTA 1SSDA 3NAVA 4QIUA 1LTDA 4ADTA 3KVMA 2OX1A 3S1VA 2YXGA 3M16A 1H7XA 1VGAA 3DGRA 3OHIA 1A50A 3BO9A 2FDSA 2CLMA 5G2HA 2YSWA 4NXKA 1W54A 4K36A 1W3NA 1JCXA 1D3HA 1GT8A 1C29A 4TIMA 4ZQNA 3R89A 2YYTA 3KRUA 5KINA 4ZQCA 4FNTA 3QM3A 4RX0A 3W1PA 1WQ5A 4U28A 5K2ZA 4JTSA 1W56A 4HNTA 3ZWSA 2QR6A 1H7PA 2R91A 2I14A 4P61A 3MP4A 5D03A 3TKFA 1Q45A 4W9TA 5AOUA 3P7YA 2E5CA 4OGZA 1FCBA 3LX9A 5HJLA 3P8IA 3V75A 2FB3A 2VENA 1TPFA 2NV2A 4OT7A 1TJRA 3HG5A 4UMCA 3EWUA 4EF9A 1KFKA 1RVGA 3GNNA 1F73A 3R8RA 1Q6QA 2BTMA 4DPPA 2ZBTA 3O07A 1F6PA 2VEMA 3QEZA 4NU7A 1G4PA 1A5BA 2PRLA 4A3UA 3O06A 4RJEA 4UR7A 1KFEA 1CW2A 3UQNA 5BW6A 3W2MA 4ZQPA 4WQ6A 3EEGA 1LP6A 5FI8A 4UXDA 2Q3OA 4MY8A 2YDAA 3KX6A 1TQXA 3FIGA 1LCOA 3EWXA 3W07A 3GK0A 1G67A 2VEPA 4DF1A 3EWYA 1TPEA 4QSHA 3GDTA 1IIHA 3NZ1A 1AW5A 4KWVA 1NAL1 2ZRYA 4MPQA 4O4WA 3U8GA 1W5QA 4KFNA 3T44A 4DO5A 3E0IA 1PL9A 4WOZA 3PUEA 1TV7A 3W75A 2IQTA 2QCMA 3CQ0A 4ADSA 3ZFHA 1SW0A 2RKXA 1TPH1 1UBSA 2CLLA 3W7RA 2RDWA 4XQ6A 3P67A 4U4MA 5GVJA 3LHYA 3CTLA 1VRDA 3BLIA 3L0KA 4ZQMA 4UTLA 2FPVA 2YYUA 4O50A 2TPSA 5AC7A 2FPTA 3L21A 4I7VA 5BOOA 3W7HA 1OF6A 4NJJA 1ICSA 4M7SA 2OCZA 3G1SA 1L9WA 2QKFA 4E38A 1TREA 1SZFA 1KM3A 2R94A 3S1XA 3TQKA 3OBKA 2EHHA 3NPXA 1FWNA 5CZ0A 3P74A 3YPIA 2WSQA 1RPXA 1SW3A 3PULA 3W2KA 3CLMA 4O54A 2Y62A 2XN2A 2KZHA 1R2TA 1THFD 3NQ6A 1G7VA 1NSJA 5KSWA 1QPNA 5D37A 2NWRA 4WXZA 4R7JA 3TXZA 4WD0A 2C18A 3PB2A 3B0VC 3HPSA 3QMRA 5D33A 4FIQA 3TSDA 1TV5A 3PWAA 5HMSA 3Q2DA 1X8FA 4AHOA 4MFEA 1ZAJA 1JULA 1XCFA 1Z48A 1YLVA 2OJPA 3O8AA 5KZDA 2Y70A 4FNPA 4AEOA 1AL8A 2ABAA 3SFKA 1H1YA 3ZR4A 1V5XA 4N6FA 1ADOA 1EP3A 3B0PA 4R53A 1WBJA 4WJEA 4J9JA 3IVUA 4LRSA 3TAOA 1O94A 3ABSA 3G8EA 2ZRWA 1O60A 1KLYA 3QMTA 3U2OA 4IMGA 1RQHA 4EOUA 4LS1A 4GNJA 5EBUA 2QUTA 3TR2A 4GUJA 2V2CA 1YTKA 4N2YA 5HUOA 1YXCA 2V2DA 2ABBA 5AYYA 4CQ9A 2WNQA 1IF2A 4Z0SA 2B7PA 4QQ3A 3NM3A 1LYXA 1SW7A 1M5WA 3JS3A 1TIMA 1VR6A 3QQ0A 3LDVA 2AGKA 1KM4A 3O6CA 3S1WA 4O14A 3LGEA 1RR2A 1AW1A 1TMHA 1K8ZA 3LCHA 3TSMA 3S5OA 3LRLA 1JQVA 2G96A 1B3OA 3B0UX 4PL1A 2G97A 3W23A 3W3OA 5G1TA 3FLUA 5ABTA 3C2FA 1O5XA 1OK6A 1VQTA 4PH6A 3UY8A 3QMSA 4AF0B 1KFCA 1W5NA 3MHUA 3DENA 3SSJA 4K8EA 3EXTA 3PSVA 3ABRA 3P84A 3CEUA 2YGYA 8TIMA 1FBAA 1VC4A 3LHZA 3BV4A 3TFXA 1OK4A 5U4NA 5HR6A 1O5KA 5F1VA 3W87A 5LNVA 3SZ8A 1HL2A 3GDRA 1H62A 1ZY9A 3A5VA 1OFDA 3HPZA 3V1PA 1GTEA 3VFLA 3LRKA 3W7PA 1ONRA 1W5OA 2TYSA 3TC6A 4O1BA 4LC8A 3M41A 3WJSA 4BI6A 3G18A 4O0KA 3BW3A 1OFBA 2WNNA 2EF9A 6ALDA 4E2BA 4JTKA 4CNOA 1XBYA 3GAYA 5EMUA 2NUYA 4Q32A 1AMKA 1LRTA 3E49A 2GQ8A 1JRBA 3GYEA 2A6NA 1WOBA 4RZ5A 1XDMA 4NX0A 2F84A 2C16A 3LBCA 5TBOA 1SO5A 4RK8A 2BLEA 6TIMA 2B7NA 3HGOA 3G3MA 4XKYB 4GE8A 1A5CA 3PVFA 3THQA 3UNDA 2I9EA 2XN1A 1SZEA 1OYAA 1XUUA 4NJKA 4M6QA 3DZ1A 4EWND 3NOEA 4YLWA 1YPFA 1DORA 1FDJA 2QDGA 3W72A 3OIXA 3QSRA 3UPWA 1Q3NA 5LNRA 3LHVA 3W70A 2JBMA 2C3ZA 3DFSA 1XKYA 4CNNA 3C3NA 3W7MA 2GQAA 5CPOA 4UTTA 2G95A 3O63A 5IM51 5D2YA 1F05A 2ZZ6A 2DZVA 3EX4A 4RR4A 5CPLA 5LGXA 2X1RA 1JCNA 3G1YA 1VHCA 3PG8A 1S5TA 3IIPA 1UUOA 1Z44A 2PC4A 3TNOA 1H51A 3TCEA 4UTWC 3DFTA 4NJIA 3WJYA 1LOQA 2DZSA 5C6MA 3PY2A 3DHDA 1ML1A 3NL5A 4Z1CA 3JR2A 2ISWA 4ORIA 4O53A 4MYAA 1QPOA 3QYQA 4GRSA 4K38A 3KRZA 1TPB1 4LT9A 3WJZA 3SI9A 1KLZA 4UTMA 2Y7FA 5K4XA 1N8FA 4CNPA 1OFEA 1DKWA 4I9AA 1P4CA 3UXDA 3L65A 1EIXA 1OX5A 3G1FA 4UUIA 2EKCA 3W22A 5HR7A 1H63A 5HULA 3IIXA 3FYPA 4JX5A 3I65A 2Z6JA 2RDUA 3TSBA 4QJ1A 2O7QA 2EAWA 5DY3A 1N7KA 3W7KA 5KZMA 1GYNA 4JNMA 3IIZA 4TMBA 2BWGA 1OJXA 1FQ0A 3LLDA 5D02A 2Z1BA 2EGZA 5AHFA 3TUUA 4H4IA 3LRMA 3GKFA 3D0CA 4OE7A 3W7QA 1VZWA 2Y7DA 3HBLA 1K03A 5SWUA 3QC3A 3G1DA 1JCLA 5HWMA 5K9DA 3MP5A 5AHEA 3UWZA 3PR2A 1JCJA 3F1QA 3G0UA 4PL2A 1TQJA 5DBUA 1YPIA 4JTTA 4LUIA 3MHFA 1TTIA 2F7FA 1H7OA 2YFNA 3PUOA 4IOTA 3IVSA 4GUHA 1FWRA 3TC7A 1XDLA 3KOFA 4UFIA 4FF7A 3KVKA 1NF7A 2HMCA 4OU1A 5AC8A 3LCGA 1U83A 1QO5A 3NM1A 2VKZG 4HIBA 3QPYA 1J4EA 4TO8A 4CCDA 4JYDA 4LVBA 3G1HA 1SFLA 1SO4A 1FCVA 5D2TA 1YXYA 2DP3A 4GBUA 2H3BA 1W5MA 2ZZ2A 4CQ8A 3NQGA 1K8YA 3IGSA 4K8HA 1QPQA 3SGUA 5F2IA 4PA8A 4UTKA 4FX8A 4BK9A 5LSMA 2ZQ0A 4MJMA 3W1TA 1TPC1 2E6YA 2JKAA 1GJPA 2GVJA 4IX0A 5BNKA 3L5AA 3DFOA 1L6SA 5CZJA 1S5VA 4Y6GA 4GC4A 3NL2A 2TRSA 4IMEA 3SGZA 3C2RA 3GVGA 4JR5A 3T78A 4JICA 5G1YA 4JS3A 4XUGA 2Z0IA 3UYCA 4ONVA 2VELA 2DZXA 2Y63A 5FF2A 3C2OA 3OVQA 3DFPA 3LBMA 1G4TA 3MI3A 3NXFA 3W2UA 4YCPA 1QAPA 1KBJA 3CM4A 4IJBA 5D2VA 3FJ6A 3ANYA 5CSRA 1AL7A 3TJXA 3DI1A 4DPQA 3QRHA 2VOMA 3LXBA 4WY0F 3NL3A 1MSSA 3TMQA 4CQAA 2B4GA 4JTUA 2BXVA 1P1XA 1LROA 2JKPA 3NA8A 4DBEA 5L6UA 1K7XA 1NEYA 1LLWA 3CIXA 3LHWA 3N34A 3R12A 3TROA 1FX6A 1GVQA 3NYZA 4O28A 3TW6A 1TRIA 3Q58A 5MHBA 1W3IA 3NR0A 1KM6A 3SJ3A 3WK3A 2YW4A 5FEWA 3CU2A 2ZZ7A 4JEQA 2GJLA 3F4NA 1ZNNA 4K7YA 1GVFA 1VYSX 2J27A 4O0ZA 4K7VA 2ZA3A 3DKLA 3NGJA 2UV8G 1ZAIA 1RD5A 1RZMA 1S5WA 4XBKA 5FF7A 4IX2A 1ZENA 4OWGA 3W85A 1U5JA 2V5LA 4O1CA 1DQWA 1Q6OA 2DZWA 4UFMA 2CU0A 3L0GA 1MZHA 5E1QA 2FTPA 3F03K 3FKKA 2J9XA 1TSIA 4DEFA 4LWWA 3EB2A 3IGUA 1OFRA 5LNUA 1K8XA 1JR1A 3S8HA 1KW1A 4MLJA 3W1RA 2RFGA 3SIZA 4OV4A 1EUNA 5J5RA 3P81A 5LNWA 4MFDA 2P1FA 1EWEA 2YZRA 2Y7GA 4HHPA 2NUWA 1IGSA 1PHWA 3ATZA 3CPRA 3TIMA 4WY0B 4JX6A 3DFNA 3MJYA 1Z41A 3WK1A 3TJLA 3UWVA 3C61A 2ZTKA 1DJNA 4ICNA 4JTFA 1PS9A 1QDSA 2QJGA 3MHGA 4O4VA 4PC8A 1UJPA 3PG9A 4FX7A 1R2SA 1O95A 5HUPA 3B04A 1CI1A 1F5ZA 5AFDA 3EKZA 3A21A 2DJLA 1IXQA 5HQEA 3GAKA 3GIYA 1DHPA 3ZS4A 1I4NA
chains in the Genus database with same CATH superfamily
1A5SA 5CXPA 3LOTA 2O9RA 1EO7A 3DC0A 4JIPA 4AD2A 4YS1A 3B40A 3WEZA 3PAOA 5TNVA 3SW6A 1EB3A 2WM1A 3GNXA 3E5PA 1VPQA 3I68A 4AF0A 6ENLA 3S5YA 1K9FA 4H9TA 2W63A 2H9AB 4DXKA 3CZJA 4G1KA 1M3UA 1B9BA 4TX9A 2HJPA 4MWAA 1D7KA 3PZTA 3E5BA 1TRDA 5A8GA 1WYIA 2ALRA 1TWZA 4NRRA 1GZGA 3AQUA 3QLDA 1YE6A 2ZVIA 2QCGA 1EPXA 3NVTA 3MUY1 1H41A 4A4AA 1UH4A 2NX1A 1AA1B 4ZB0A 1E73M 2YL8A 4WSKA 3BGAA 3PSWA 1S1RA 3N2XA 4M7TA 4AY8A 1TG7A 2QS8A 3UY7A 3EDDA 2XH4A 3AZTA 4YWIA 1LT7A 3L7RA 1W37A 4H83A 5FJRA 3VMNA 4QITA 2WMHA 6CGTA 2QV4A 5HMFA 2H90A 2AQWA 3W1QA 1W91A 1JQXA 1RQBA 2WK2A 1PCWA 2WM0A 4ZODA 4IF2A 3CGTA 4QAIA 2AL2A 3OG2A 5CZTA 1EJRC 5BXRA 3COTA 2R1PA 1IEQA 2VUYA 4S2BA 4HOXA 3BSHA 4LYPA 1EGVA 3KBWA 1F4AA 1FWWA 3THUA 1T96A 2V6AA 1M9HA 1Z6KA 1XRTA 3BG9A 3UG3A 2YBVA 3IIOA 1XLJA 5DQPA 3I7RA 2J62A 1KTNA 3PBGA 1QWKA 3C0QA 1LBMA 4UTTC 1HJQA 4HA1A 4HKPA 4N42A 4X3ZA 2ATMA 4AVNA 3T4CA 4WDXA 2HROA 5TF0A 1ALDA 3TJIA 1R6WA 2EG6A 4IG2B 1ME8A 2WHMA 3PJXA 3MQTA 2QGHA 2J4GA 1JIBA 3TE9A 5I79A 1EOMA 2Y61A 3T0TA 3TLLA 3TYAA 3M0MA 3OGVA 1XBZA 3ABQA 1XINA 1JZ2A 2AL1A 4GZIA 3A4WA 4IFKB 4N6EA 4XAZA 1DIOA 4UR9A 3STPA 2PDNA 1AH4A 2NQJA 3UZZA 2OEJA 2LLEA 1E6XM 3IJQA 1SZGA 4NZCA 1JZ3A 2V30A 2OX4A 1CZ1A 3U2EA 1OFPA 1E15A 4GQBA 1X39A 4FPSA 1G4SA 7CGTA 2Y8VA 4NAFA 4W93A 4L6HA 3BWWA 3S1GA 3BAJA 3NYDA 1E6ZA 1MI3A 1W1ZA 1I6NA 1OFQA 2HXUA 3M9YA 3RUBL 3SN1A 2WBKA 2OYLA 3VOGA 5LA0A 3SO7A 5BRBA 1J79A 1ECEA 4XAPA 2YL5A 3L4UA 2V5CA 1W31A 1OC5A 1V6VA 1GPFA 3H7RA 3M0ZA 3CQIA 2TODA 4JCMA 4QM1A 1PVNA 2CKRA 3E96A 4IIGA 1JD9A 1SU5A 1FFQA 3EWBX 3KVJA 2ZICA 5IBXC 3SURA 2PDXA 3EPMA 5CPNA 4CD5A 3GXTA 4DXVA 5A3HA 3C5QA 4KWWA 3XISA 2DORA 4RCXA 4JQAA 1X6UA 4BA0A 1EYEA 1TMQA 3LV6A 1DWJM 4Q22A 1W5PA 3TONA 1M65A 5AC4A 3NSXA 3TFCA 2PGFA 3BOLA 5M1TA 1B4EA 4ZB2A 5EA9A 4TTGA 3M07A 2E09A 4RNFA 4M24A 3OTRA 2ZX8A 4Y9MA 4LAUA 2BOEX 3QZEA 3UCCA 1SO6A 5CBIA 4AZBA 2HXTA 1CCWB 2PP0A 4HU0A 4B2DA 3L2LA 1VLIA 4HD5A 4IP4A 4F0RA 5C54A 2V69A 3LSCA 4NIRA 2VC7A 4UQDA 3UZ5A 1HUVA 4PYSA 4QNEA 2QF7A 3PF3A 3WLJA 5C70A 2ISSA 5I3HA 1BGAA 3M0XA 9RUBA 1S3TC 4FXRA 3PS7A 3WDJA 4GUIA 1LRQA 3E2VA 3AMDA 4DUWA 4YL2A 4BR1A 2VUNA 1GZ1A 1LWIA 2RHGA 1W9VA 2D69A 1F76A 1QNQA 4GI6A 3W28A 1XW8A 2F9RA 3TNBA 1PX4A 4AC7C 3HMJG 4GXMA 4HNLA 1XLBA 1FTXA 1L6WA 3QC0A 1EWDA 3IJDA 4DZHA 3MMTA 4TUFA 3WQPA 4EPKA 2NQZA 3MWAA 4P8WA 2WZHA 2XGZA 2NXIA 4O1DA 3BARA 2VFGA 4K37A 2NQ5A 3W7OA 1LZOA 3DHPA 4N4QA 3CNYA 3UYIA 3UP8A 4I5UA 2QJIA 3GE7A 3QF0A 4FXJA 3PM6A 4Q8NA 4HSOA 3WL1A 4N9CA 3L23A 4ZL1A 4TV5A 4NT0A 4QG8A 2GZXA 4GYJA 3JVAA 1TWDA 3PAJA 4RKAA 4QP0A 3NJ3A 3M43A 4L9XA 4AD4A 3QR0A 3NDOA 2OLSA 3NWRA 4DJEA 2O7SA 3ZM8A 2H8ZA 4ZXLA 1NP2A 4LNYA 2E6DA 3H2OA 3ES7A 4XB3A 1F74A 3OA5A 2PRMA 1QW9A 4NZJA 4JDYA 5D8ZA 1PDZA 2X0HA 1C8YA 2ASHA 1JYXA 4GH3A 2CW6A 2QV5A 3VNYA 2VRQA 4I8DA 2OSWA 3V36A 1LUCB 1LLZA 3RDKA 1HKWA 1TR1A 3ORWA 4YIWA 4JXCA 3DHFA 4HB7A 4POCA 3GTXA 3ARRA 1ZBCA 1XSIA 4M5PA 5A6SA 3IEBA 3P0XA 5FEZA 2E0PA 1D3CA 4PTMA 4NI8A 1MDRA 3QSTA 4O57A 1MZRA 1YDOA 1DIDA 5BXPA 4AD0A 4JTHA 1QNSA 2X1UA 4RV3A 3C86A 1V7YA 3OVRA 3CAKA 4IJCA 2NT1A 3V18A 2I16A 3B3DA 4AZ7A 2D1ZA 4Q7NA 1ITUA 1NQ6A 3LI0A 3ABOA 3UA4A 2QCFA 3PZQA 1UWAA 3IIVA 1MUMA 1LG2A 2NX3A 3PUGA 3P61A 2JQXA 4DAFA 5AHMA 1EP2A 4I5RA 1ZZMA 3SCQA 5BOFA 1KWKA 1EC7A 1YDYA 5JH1A 3OHMB 2GSEA 3NQCA 1KRCC 1NDWA 1I75A 3MPGA 3LTPA 3HFYA 4AAJA 4PTNA 4Z1AA 1DOSA 5HXMA 4IMAA 1SO3A 2QVHA 3N3TA 1KBIA 3A12A 3GNOA 4H9UA 3N2TA 2CHRA 4IG2A 4HTBA 3V0UA 4UOZA 1NQKA 1YADA 5G4WA 1JG9A 1IWAA 4CQCA 2XM2A 3VO0A 3LD5A 3REQB 1JGMA 1UPPA 4IFKA 1XLGA 2G5WA 3QW4B 2XWEA 3FHAA 2XIMA 4IMCA 1AFSA 1SSGA 1JJKA 2WSPA 4JTCA 1JNDA 4XWUA 2VVSA 4KIRA 3OO2A 4FF5A 3PB0A 3QJAA 3TTSA 2D2JA 3LZ3A 1C93A 5D38A 3HTWA 1V6UA 4B9ZA 2HE5A 4D6JA 2FQIA 1V7AA 1EA9C 5D32A 4MYXA 1OY0A 1L8PA 3AMLA 4LF1A 1YDVA 4A2RA 1TO3A 3NDZA 3W1NA 3USZA 4WKHA 3Q94A 2NV1A 6XIMA 1NFGA 2H3DA 3O05A 3S6DA 2BHUA 1YXDA 4RDVA 3HOJA 5DCEA 1AD1A 4RLIA 1T99A 2VFEA 1R3QA 1F2JA 1Q6RA 3EDFA 4AD1A 3BLFA 1XC6A 1F7BA 3V0SA 3VNZA 2ZRUA 4WXYA 2DVTA 4TX8A 3N9SA 4N02A 2H6RA 1M6JA 1FDZA 3FA3A 4GWEA 3WBYA 1QU4A 4IGHA 4OV9A 1W6TA 2Z00A 2W92A 3RF9A 4BQ3A 4TQTA 3FS2A 1SFTA 1DJXA 3DXIA 7A3HA 4E8GA 1IIGA 2OGJA 4B15A 4WKAA 3Q65A 3NQEA 2O9OA 1E0UA 3K1GA 4IFOA 4MJZA 4FR6A 1W8GA 2Z2BA 4PR4A 4LVFA 2IQ0A 3QGKC 1DXIA 2ZYFA 2C1HA 3RCMA 3WQ6A 3MWCA 1PAMA 4HT3A 4H6KA 1ZS2A 3WLKX 3A47A 4FNUA 4NY2A 4UNIA 2QCHA 4EVZA 1R3YA 3O15A 1RK5A 4QLKA 3CWNA 1EEPA 1W2PA 2XIBA 3XINA 4AZGA 4W7UA 3T4WA 4CCCA 3N2MA 4EPDC 1TTQA 3D6NA 1HJXA 1R47A 3PZVA 1UWRA 1JFHA 4NZFA 3H6OA 1UJQA 2OLHA 3VUSA 3KZSA 4X22A 1DPMA 2P5NA 5D9MA 4UMAA 4IXXA 1VPXA 4DQWA 4BI5A 2CCRA 4Y7EA 2HPMA 5HJYA 4JFUA 2E5DA 2RJGA 3CQHA 1XRVA 1W0MA 3TVAA 3S42A 5G4EA 1I2NA 1GVRA 4IPIA 3V0TA 4FEZA 4N4PA 4IIHA 1X98A 2BHZA 1W3KA 4LH8A 4A22A 4UTIA 4L7ZA 3GD6A 3FAXA 4XV0A 2EG8A 4NRSA 4C6CA 3EA3A 4KQNA 1IZCA 2H8XA 2XU2A 3T0DA 1ITXA 1HKMA 3U7VA 4ZCWA 3W1XA 2BDQA 1LDCA 1EPVA 4NZ5A 2PSNA 1TKKA 4DBSA 2CPUA 1SR9A 2V2HA 1B3ZA 5J8LA 3SADA 5HNUA 3NPUA 5GNZA 1H7RA 5ABFB 1OG0A 1SZNA 4B5XA 1MDLA 3WJXA 3WNPA 3G1XA 1ZCOA 4PCNA 3CHVA 2ANUA 4NQ1A 4DLFA 4Q8VA 2OU4A 3I10A 4Y8EA 1UZHA 7ODCA 1UHVA 4MJ2A 3NZQA 3VE7A 3AHYA 3KOWA 3B9AA 3QZ6A 1KFLA 4EE9A 3LXAA 4WDTA 5HMEA 4QJ3B 1QNRA 1XBXA 3S5ZA 1M7OA 5D09A 5I24A 1UWUA 1K9DA 1POKA 4NSBA 4UFLA 3HPXA 3BG3A 3T09A 2WVUA 3SUVA 3CUZA 3OPSA 3R79A 1V3JA 1XDJA 3QZAA 1K3UA 3W81A 1EJ7L 2PDKA 3TN4A 2V5JA 4UZUA 1HGYA 1LBFA 5B7ZA 1MEHA 2YA1A 3LCXA 2CLOA 3I6TA 5FJUA 2Z1WA 4JZ5A 1LUCA 1TVLA 2A7RA 3QTPA 1WZMA 1XYLA 2DDXA 5LNSA 2CERA 1U5VA 5KMYA 4Q8QA 2ZX7A 4XIAA 3VNDA 3G1RA 2OQHA 4DYEA 5AYXA 4ALDA 2PD9A 2CETA 2YA2A 4G5DA 5KITA 3SECA 1E51A 2DSKA 3R43A 2EPOA 1QI5A 1TTJA 5HWNA 2WKLA 4HNVA 5C8BB 3VKJA 5LXEA 2X40A 3GHRA 3GDKA 5F4XA 1NTHA 5C9XA 3RX2A 3KHJA 4UQEA 3SY1A 1KRAC 1P48A 3N6JA 3W53A 3ARYA 2DSWA 2E7FA 1DWIM 3FYOA 4B5NA 1FHDA 3R6IA 4Y9NA 4J3ZA 4QEHA 3LCFA 2EPNA 3WO8A 3BICA 3T7VA 5LHFA 3PTKA 4HSNA 3RIKA 1XSKA 3T8LA 3WDRA 2VX7A 3BUVA 4CU6A 4TMCA 3OU8A 2PWFA 2ACUA 4ZENA 4H2HA 3RRXA 1S3HA 2PS2A 4ZO7A 4KRUA 3AU6A 1GQNA 3P93A 3PANA 3CIVA 1M68A 4QE1A 2W5FA 1R8LA 3H4GA 2X1SA 4UZSA 3A3XA 2XYLA 1JUKA 4ORMA 2IQDA 3GDMA 3PPFA 1KWGA 3B0YA 2DZTA 3TQVA 1FA2A 3QFWA 3GH5A 4Q8TA 1EZ2A 3ARSA 3V16A 3DFQA 4GIRA 3ZO9A 4ZSUA 4A3RA 3WLLA 4DZAA 4XKMA 5A6LA 3L68A 4GH1A 2FHCA 3REQA 3PFRA 1OINA 3WQWA 1XHGA 4KIEA 3HFTA 2YXGA 4HA0A 2DQWA 1EJSC 4J3SA 2PWEA 2QZRA 3VMPA 1QRQA 2FDSA 2CLMA 4FMVA 4J3XA 4CN1A 1UR4A 1EIBA 2GVYA 4KH2A 1O6IA 4GCAA 4V27A 3W1PA 1WQ5A 7REQB 2VX5A 2Z2AA 4JTSA 3ZWSA 1H7PA 1PPIA 2I14A 3VOIA 5EFFA 3QLLA 1S2WA 4HCDA 5LIXX 5A8NA 3U48A 2CLPA 2FB3A 2ZX6A 1TPFA 1UG6A 2Z25A 4M0XA 4YNGA 3PJUA 4Z2LA 1V77A 4IJRA 3EWUA 1FWFC 3SFWA 3R8RA 2VZTA 3S47A 2C79A 3T0BA 4GI8A 2E3ZA 3QEZA 3N11A 3VOCA 1G4PA 3GHSA 2FKPA 3ZT7A 4RJEA 4UR7A 1HQTA 3PWIA 3T81A 3UR2A 3UQNA 4JNYA 4ZQPA 4V1YA 4JKLA 2ESCA 3EEGA 1E5JA 2VDHA 1KR0A 4WSHA 2BY3A 2ZC1A 3FIGA 4KGJA 1LCOA 4RE2A 2OSXA 3SGGA 3IJ7A 3WCZA 1OQFA 1V6YA 4IL2A 1AW5A 4KWVA 2ZRYA 5A1AA 3KUMA 4M56A 4PMYA 1UD4A 3T44A 4DO5A 1PL9A 1HZYA 4WOZA 4KEMA 2OELA 4URIA 4ADSA 2RKXA 3AXIA 1TPH1 4XISA 3WNLA 1OT1A 4XQ6A 4LUSB 3P67A 3WUEA 2YBTA 4PTXA 4JIEA 3BLIA 3FJ4A 2FPVA 3LM3A 1W32A 1ADSA 3H8AA 4QJ5B 4JHZA 5LIWX 2ISFA 1QI2A 1PKMA 4C5ZA 5H8MA 3UFYA 4B91A 3LQLA 2R94A 1O1HA 1B3XA 3AIRA 4QBXA 5CZ0A 4J2MA 1KCXA 3H2FA 2XZ7A 4IGMA 1R2TA 2DUZA 2XGBA 3ITCA 3DFYA 3GFYA 6PTDA 1NSJA 2J7FA 3IACA 5KSWA 4U3AA 5D37A 3ZOAA 2C18A 3PB2A 4FIQA 4W8BA 4NP7A 4G56A 4W5UA 1X8FA 4GVFA 4GI4A 4MFEA 2E8YA 3NXLA 3SM0A 1UUQA 3RMEA 2ABAA 4AIEA 1VBRA 3PZNA 4MWAE 1OADA 3ZR4A 4A3YA 3B0PA 4R53A 3F2DA 5ABFA 5ENLA 4WJEA 3ZJ7A 2EQDA 4FLRA 4J9JA 3TAOA 3BURA 2KAUC 1O94A 5ECVA 4A05A 3AIWA 2YB4A 5IHRA 4IMGA 4JEJA 4GNJA 3E0LA 3TR2A 4GUJA 4N2YA 1YXCA 3HV9A 3AHZA 3U2ZA 4PUUA 5AY7A 2P0IA 4PCPA 3R0KA 4YTSA 4PMZA 1LLOA 4U2ZA 2B7PA 5HPOA 3JS3A 2F8QA 1A0EA 1DTNA 3LDVA 2R9RA 3APGA 1TR9A 1RR2A 2BBFA 4AXNA 4HHLA 3TSMA 1VJZA 2G96A 1MW2A 4GIYA 4LCSA 4KWUA 4HOZA 3LENA 2O55A 4XAYA 4JAWA 1VQTA 2X7VA 5FSEC 1S2AA 3PTMA 1W5NA 3EXTA 3L12A 3P84A 3CEUA 4TXEA 4CKQA 2YGYA 2ZX5A 3AJ7A 3E6EA 4CD7A 5HR6A 2YZ5A 1US0A 3SZ8A 2WVVA 1W3LA 2BXYA 4MB1A 1H62A 3IPWA 1OFDA 4BQ4A 4GHRA 3VFLA 3DESA 3LRKA 5M03A 2P76A 1OGBA 5LA2A 3CWHA 4O1BA 4LC8A 1RK6A 5E6ZA 3R25A 3CUFA 2PP1A 2WNNA 2IS7A 1KCLA 4YTQA 4CEXC 3UXIA 3GAYA 4L6OA 4Q32A 1P0EA 1RAKA 1JRBA 3GYEA 3DG7A 4GYPA 4XZHA 1XDMA 1RJRA 1ADDA 2BLEA 4CNTA 1S1PA 3PVFA 4GLEA 4GY7A 1BYCA 5T91A 3DZ1A 4EWND 4C91A 1YPFA 1FDJA 4CEUC 3KCOA 4ZB5A 3W72A 3OIXA 2IPGA 3QSRA 3KBJA 5LNRA 3V5CA 3KM8A 2EJ1A 2JBMA 1XKYA 1P0BA 3C3NA 4CNNA 2Y5JA 2CITA 1XRSA 5CPOA 4ZO8A 4MB4A 3O63A 3N17A 3QY6A 5D2YA 2ZZ6A 2DZVA 4RR4A 3WMBA 5LGXA 3G1YA 1JCNA 1VHCA 4QGCA 3IIPA 3URQA 5BYWA 1J2BA 2P8BA 3HM7A 1U1HA 5EMKA 2GUBA 3TQPA 1QVBA 3N04A 4YJ5A 3NL5A 2CXEA 2WHKA 1XLFA 2PTYA 3KBNA 4GRSA 3ABZA 3QY7A 3WJZA 4A6GA 4IT1A 2Y7FA 1WPCA 1P6BA 1OFEA 3AHVA 4MTVA 4I9AA 1Q6EA 2QPSA 4UBPC 3KEHA 1UWIA 3V5OA 4AZIA 5TD4A 1YBQB 3IIXA 1VFOA 3U2CA 7REQA 1DHKA 3KBSA 1HX0A 4S3DA 5KZMA 1GYNA 3GWQA 1QATA 1S39A 4QQUA 3IJ9A 1AQHA 3FY1A 4XD6A 3LLDA 1ONXA 2Y24A 1LQAA 4OE7A 3WZ0E 3HBLA 3WFZA 1R7OA 5SWUA 5HWMA 1BQGA 4LB3A 1K9EA 4LUIA 1JL8A 3KOFA 1XLMA 4FF7A 3WD4A 4OU1A 5AC8A 1U83A 3TTQA 3NM1A 2VKZG 3WH7A 3BLKA 3R10A 3F7JA 4TO8A 1GHSA 3ZR5A 1E0XA 3OZYA 1YXYA 4CN6A 4L65A 4TVDA 2HISA 4CQ8A 3NOYA 1QPQA 5F2IA 2VCCA 4FX8A 1P6CA 1TPC1 4Q8OA 1GJPA 3LYEA 1UKPA 4WCJA 3L5AA 3DFOA 3ITLA 4XIMA 1S5VA 4B90A 3NL2A 2TRSA 1LL6A 3WFLA 3F5LA 4GINA 5G1YA 4H9ZA 3ERPA 3MSYA 2XSXA 2Y1HA 4C65A 3C2OA 1Q63A 2NQ9A 2PTXA 1ZTVA 4YHEA 2QVNA 3DFPA 3LG3A 4B2DD 3NXFA 3CM4A 5D2VA 4LUSA 3FJ6A 1WKEA 3ITTA 1AL7A 4XSMA 3TJXA 3ZT6A 1EO5A 2UY5A 5CEWA 3QRHA 2VOMA 1JFXA 1UR3M 1XG3A 4Z2KA 4XAGA 1LROA 4DBEA 4KGLA 2VDIA 4DM2A 3LHWA 3N34A 3BH4A 3TROA 5AKQA 1FX6A 2FVLA 1QHOA 4O28A 3TW6A 4I5XA 1TRIA 2HE8A 2V3DA 5MHBA 2D20A 1J9YA 4WEVX 5DMMA 2QMJA 1KM6A 3CU2A 1QK0A 1ENUA 3N4EA 4W88A 1JZ6A 3F4NA 3WQVA 2J27A 4Z2IA 1A5UA 2UV8G 1W1YA 1FWCC 1R9YA 1HP4A 1RZMA 3OIHA 3SJNA 1ZENA 4GJIA 3A4XA 3W85A 1Q65A 4K1WA 2V5LA 3TYDA 3WEMA 2A79A 2SFPA 6XIAA 3K4WA 3WUGA 4KCVA 4LBUA 1GOQA 4RW3A 3QOMA 3N2CA 4GMEA 3ISIX 4LWWA 3SAZA 2Z7GA 3IGUA 1OFRA 5LNUA 1JR1A 2PAJA 5JXQA 3VOJA 3W1RA 3E2SA 1OB0A 1EC8A 4C90A 1AMYA 1DJWA 2YDQA 2HPIA 1WDSA 5J5RA 3KDNA 4ICMA 5LNWA 5JIWA 4MFDA 2P1FA 3TYBA 1VJSA 4DXXA 1AD4A 1LL7A 3ATZA 3H12A 3TIMA 4WY0B 4NILA 2BASA 3DFNA 1Z41A 5DRIA 3VIHA 1OGGA 1A49A 2V38A 2O56A 4W5ZA 4WJXA 1IGWA 3L4VA 3UEQA 4ICNA 3N9KA 4JTFA 4GVGA 3PG9A 3GO2A 4B5TA 4FX7A 1R2SA 3M0VA 4C6OA 3L4ZA 2XTKA 2CZVA 4DJED 2PODA 4AIUA 3ITXA 2WMKA 1V0NA 1P43A 3LSBA 3WNKA 1YRRA 4ZXOA 5XIMA 2C0AA 5H2ZA 1SJDA 4MOZA 4MADA 4DZ5A 3EOEA 1E9IA 4CN4A 1WV2A 7PTDA 3PK7A 1U5HA 5ABGA 4RXFA 2INFA 2QT3A 1BVZA 1V08A 4GYKA 4WVXA 3AIBA 1A5MC 1DV7A 4F79A 4D6FA 1FCUA 4WK9A 3RLVA 3TYCA 1FUYA 1PX8A 3KLKA 4LY4A 1GJWA 3U4AA 2Y2WA 2GJXB 4HK6A 5CSSA 1TCMA 3S4TA 1W9PA 3WLHA 3DAQA 4JD4A 4P7NA 5I00A 1W3TA 2ZX9A 3HG4A 3IVTA 3RFAA 4AIOA 1FXPA 4LUYA 4QR6A 4C60A 2PDYA 2KX9A 3NQAA 1F8IA 1E4MM 3K8MA 3ICJA 4A29A 2QULA 1ISWA 3GR8A 4FXFA 1CX9A 1OYBA 1PTGA 3WLOA 5CPTA 2V81A 4QDPA 4G7EB 5FF0A 1DQUA 2GLKA 5J04A 3W2LA 4ZVJA 3W74A 2VXNA 1XYFA 3WF1A 2ZUVA 3FFSA 4O19A 3LLFA 3B9NA 4Q4PA 3F5JA 3LCIA 3H55A 3M7SA 2AAMA 3KTSA 4GJJA 1V3MA 3IJ6A 4RV8A 2DZBA 3E0WA 5DRCA 4GIEA 4I9MA 1WDWA 3ZXWA 4ZFCA 4YYCA 4GFIA 1FWSA 3GFXA 5EMJA 2Y8UA 2BY2A 4QLLA 4AH7A 4Y96A 3FEQA 4KBXA 3RR1A 3TK7A 2J13A 1US3A 3ZZ1A 1SJBA 5DELA 3QV6A 3XIMA 4J2PA 2ZZ5A 2GPTA 2XFYA 2J77A 3C52A 1K6AA 4QTGA 3CHDA 1L6GA 3NO5A 1XLLA 1TJ2A 1X7IA 3NTYA 4FA3A 3AI0A 1O4UA 3VGEA 3PN8A 3W6YA 1K1DA 2OSYA 2O4QA 3CYJA 4WDUA 1TWWA 2Z1KA 1YBQA 5LZLA 1LOSA 2QCLA 3ZJ6A 4NNCA 1YHTA 4PUDA 4LYKA 1ZB5A 1KV5A 2OLAA 2XZ9A 4D1JA 4OZOA 3VCCA 5A5WA 2DPEA 4DBDA 3F4CA 4I6VA 1T6MA 2QLYA 1UD8A 3KLLA 2OT1A 3GW0A 4UQ9A 3SDOA 4K1GA 4NJHA 1J18A 1BVWA 2WCSA 3VE9A 2XVKA 2QUUA 4L4MA 3PBMA 2ONEA 3S46A 3FN9A 1KXVA 2PDCA 4E8CA 3G77A 1TCDA 3MUZ1 1NDZA 5CJNA 1US2A 3BAWA 4KETA 1J0YA 3MUAA 4PCFA 5FACA 4D6CA 4HNCA 5I3GA 4PUKA 1I45A 4LUJA 4BS0A 4FR1A 2DW7A 3WF0A 4ERIA 4HPJA 2WCAA 5JQ9A 3IV8A 3T9PA 4C5YA 1FY6A 3BJFA 1FHUA 2DVXA 3GLCA 3EEZA 3LTYA 1KBKA 2FIQA 3UJSA 4JTJA 3LUTA 4Q6JA 2J88A 2ZUSA 3IK4A 1KRMA 2OGYA 3H2MA 2A3EA 2WKJA 4O8RA 1RPKA 4JTIA 2FHFA 3VKCA 5A2BA 1ZBVA 2QJNA 3U3HA 1WXYA 2WNZA 4Z1BA 1EJXC 2VC6A 3ZSTA 4FX6M 5CC6A 3AIVA 3N12A 1GEHA 3SCWA 5H6HA 3GXNA 3VKAA 1J10A 5E93A 1JZ7A 3S0CA 4M82A 1WAWA 1ONEA 4N9DA 1O68A 3TTEA 3MCMA 4GFSA 1WE5A 3ARWA 4UIOA 1C8XA 2OWXA 2VD8A 4JTEA 1V3HA 5TIMA 4JQ4A 4BCEA 4IUOA 4PMQA 1IZJA 3VX1A 2WV8A 5CLTA 1VFTA 3GDBA 1UD3A 1R30A 2VR4A 2CLKA 2J47A 2OOFA 3SRFA 3AXXA 1HFBA 1WZLA 1P0NA 3HPAA 3FXYA 3HG3A 3MB9A 4AWSA 3PZGA 3C8FA 1VFFA 3DERA 3P6LA 4RL3A 4D2JA 2XSBA 4NF7A 3MZ2A 4NKCA 4MAVA 3TOPA 1BF6A 2OOGA 3ZMRA 1YPXA 2A85A 4RDZA 4GQ0A 3C56A 4UTJA 1V4YA 3Q4DA 3O1NA 4CLMA 1JCTA 5AYBA 3EDJA 4DF2A 1O5RA 1LWHA 5EPDA 3CZLA 3VA8A 1AG1O 3UR8A 3N15A 3L9CA 4ZEPA 4JTQA 4MKVA 1CXEA 3URBA 4WZHA 2AMXA 2HSAA 3FX4A 4FXSA 3M44A 4TTUA 1E0TA 3A9IA 5I78A 4TR9A 3L0NA 1XBVA 3RJXA 1BHGA 6REQB 2PDHA 3AIQA 4E4UA 3OEXA 3QPEA 3GZ3A 5AHLA 1GPWA 1GOKA 3DDMA 3IRDA 4G6CA 2VQUA 1YEYA 2IUZA 4WY0A 5IBXA 4AMAA 2VWTA 4O52A 1TTPA 5CG0A 4FIRA 2GQ3A 3K13A 5I07A 1B4KA 4C6MA 4A2SA 1RA0A 2QW5A 5D4YA 2DVUA 3GX9A 3KRSA 2EKGA 3RJYA 3OG3A 3LK6A 4L4PA 5E9AA 1GG1A 3OA3A 3MP3A 5CPQA 2ZCGA 4IPNB 5TQLA 1AJ0A 4OIFA 3A9BA 2ZRZA 3AOFA 5C2XA 1CWYA 5BOEA 4I3GA 1UPMB 3AYVA 4B5WA 1I8JA 4LAKA 4PFHA 1A4MA 3KRBA 5C55A 3VKKA 5C5YA 4B3LA 2A0NA 3VILA 3BAKA 1MYRA 1RXOB 4F66A 3GNPA 1MMFA 2PRHA 3W2JA 3GXMA 1QFEA 1HT6A 1HL9A 2FMOA 3KDOA 3W7NA 3WLSA 1REQB 3FVMA 3EX3A 1K8CA 2YX0A 2HNEA 5HMDA 4FAMA 3MMUA 1J0ZA 1W8SA 4KKXA 1AODA 3FEMA 2NVDA 1EA0A 1EX1A 1ICPA 4MWAC 1WXJA 3NQFA 3OGSA 3W73A 2GJXA 5I5RA 1G0CA 2XFRA 3WK2A 4KRTA 2E5BA 1UZ4A 4IHCA 2V8ZA 1QHZA 4PMVA 1QOQA 3B9OA 4CVWA 2POTA 1ZJIA 2ZVRA 1BEUA 4H04A 2X1IA 3GYCA 5HDRA 1MQPA 2QUVA 5KZEA 4HPHA 4OJYA 3KBVA 5GJMA 2FVMA 3KTXA 2VMFA 3F4WA 1PKLA 4G7EA 3D47A 2D2GA 3AUJA 3HF3A 2X2GA 1DQXA 5JH2A 3R2GA 4MNLA 5A6AA 2XM1A 3VCRA 2WOQA 1J01A 1H5VA 3AZSA 2CXGA 3STEA 3WBAA 4AX7A 1TV8A 1PIIA 4GC3A 3B4UA 1UMLA 3O6DA 4JIIX 4K39A 3MO7A 3MI2A 2NXHA 5HNNA 4OOUA 1CYGA 1VPYA 2YB1A 4F2BA 3L2MA 1XIDA 5FAJA 1CECA 1CPUA 4Q8WA 1LOLA 3RPDA 4XO6A 3BLEA 5K7JA 1WB0A 1GK8A 3WNMA 1DWAM 3NG3A 1JZ4A 1HXJA 3CPGA 1ZFJA 4E2DA 3G2GA 1E1EA 5CH9A 5H8UA 1VB9A 1JGIA 4QE4A 2FGZA 2GOUA 1ZU8A 5CPMA 5FIPA 2E6FA 1KNWA 1T7LA 4K68A 1TE1A 2CZDA 2QCEA 4MB5A 4U5IA 5BMWA 1PTAA 3HO8A 4WUIA 3UPBA 1B3WA 3I6RA 4Y8FA 2OWWA 1GCYA 4Y9AA 4E2OA 1RY8A 5EMLA 2BS9A 2WJDA 3UZJA 4Z2HA 5H1WA 2OMAA 1WOAA 4O12A 5DCBA 3FKRA 4DF0A 3KAOA 3CJPA 1FWBC 3S2CA 3BTNA 1TVNA 3CO8A 4MZ1A 5HPCA 3N1AA 1FWJC 2J79A 3RX4A 2XFWA 3M64A 3O6AA 4O13A 1JCYA 2HVMA 2D0GA 3T2OA 3EX2A 1D7FA 4XD5A 2QPUA 1RH9A 2BX7A 2W9MA 1W2VA 2VEFA 1UUMA 3B05A 3HGRA 3K30A 1PO9A 4F0HA 5D05A 4FOKA 1VFLA 1SUXA 3UJFA 3P0WA 4MG4A 4JN7A 1H7NA 2ZA1A 5G2WA 4LS2A 3EKLA 3QH2A 3E0VA 5G5IA 3VIIA 1OSEA 4DELA 1KKRA 2QUMA 3LB0A 1UZDA 1MUWA 4NUWA 3LNPA 1C9WA 5I0DA 4BFAA 3VK5A 4B3ZA 3QPZA 3CV2A 4AISA 2BV9A 3WQGA 3OLIA 1XIEA 4N0RA 5F7UA 1EGMA 2ZRXA 3D46A 3TJ4A 2CNCA 4BF9A 2BZNA 2NX9A 3UZYA 5MKGB 1M04A 3OZMA 3PPHA 2YJQA 3UGRA 3C0SA 1G01A 3L4TA 4K2SA 3UWQA 1C92A 4ADUA 2VZOA 5EKYA 4MY1A 2XIIA 4FS9A 1B3YA 4G2DA 1ZPTA 3G1AA 5GJNA 1TUFA 1HP5A 3EWWA 1F3EA 4ZQRA 4M6PA 2JEPA 2NVCA 4MUZA 4GUGA 2E77A 1UWQA 2OR2A 3LTSA 4S1FA 1QMLA 1KTCA 3FAWA 1J11A 4Y9PA 3RYSA 1CDGA 4J3WA 5AVHA 1P7TA 1KM0A 2YCEA 4MGGA 4UFHA 2Z6IA 4EIVA 2EG7A 1BWKA 4LALA 2J7GA 2VFHA 1P0KA 2W3ZA 3IS4A 3AMGA 4I6KA 4NASA 4R34A 1KXHA 1JUEA 3UR5A 2YCJA 4J40A 4A35A 1JYVA 3R5EA 2AKMA 1KGWA 1ME9A 4H8VA 1QASA 2VT0A 5DX7A 3K8LA 3KL3A 4DAIA 4MLRA 3UWWA 3IV3A 3S5SA 3USBA 5DMYA 2HEJA 3LI1A 1DIKA 1LBLA 3AROA 1FDYA 2EO7A 5BMXA 4YXGA 3G8RA 4MDPA 1QI4A 3RLUA 1A5KC 3VPLA 1O12A 6REQA 4Q4KA 4DBUA 1CGYA 1ZHAA 2VTFA 5C9RA 3Q67A 3EDEA 2O4MA 1ICQA 1MNSA 3ALGA 3ATYA 5D2XA 2NT0A 4B5UA 1GTHA 4S3EA 3B8DA 2FGBA 1HG3A 2DEPA 1UD2A 2FPYA 2WANA 1FVPA 2PWVA 3CHCA 2FMNA 2FGLA 1VYRA 3KWSA 4AIBA 5T9BG 3ZT5A 3WLQA 3WH5A 3LHUA 2PI6A 4Q33A 1R3WA 5DCDA 2O0TA 1V8EA 1IEIA 1VP5A 1H7WA 1MQRA 1A0DA 3E0FA 2A3BA 3LZ5A 5AHNA 4H01A 2PWHA 4OQVA 1J0HA 1PTDA 4N7QA 5DXXA 2VWSA 4GNVA 1JXKA 2PLCA 2B7QA 2GSHA 4DJEC 5F4WA 3RHGA 3ZYZA 1MWOA 4NI3A 3FA5A 1L6FA 3N19B 2RDTA 3W01A 1TV2A 3UCQA 3KXQA 3C2EA 1YNQA 1VYPX 1BKHA 2A21A 3R8GA 2P8CA 4DRSA 2VR2A 5CGQA 3WQCA 3E2QA 4C6DA 5AC6A 5CG7A 1UC5A 5D04C 1JYWA 2V0TA 3GG1A 4EWJA 3VUPA 3PHAA 2OTDA 1ZCCA 3OVPA 2PGEA 2D0FA 2ZZ3A 3WF3A 1HL8A 2X1TA 5HQLA 3F2BA 4OOZA 5GQBA 5A2AA 3EWZA 4HPXA 3P60A 3EX6A 3ENLA 5AZ1A 1B57A 1GEQA 1RHCA 3HQ1A 1NP0A 5BWFA 2PDIA 4ERAA 1XIGA 1H61A 1IR2A 4S3CA 3M0YA 1Z8AA 3PC0A 4QNWA 3FVDA 5J5DA 3NQVA 3ZJ8A 1Q6LA 1MQQA 1NVMA 4C1LA 3ES8A 1CXIA 2Z2UA 3W7JA 2J75A 4HYVA 4ZGYA 2Q3RA 3WLNA 3R0DA 3CMJA 1ITCA 1BKSA 2QDEA 5DANA 2CBJA 2HDJA 2D23A 1TZ7A 4UC5A 1C9DA 4F0MA 2WLYA 3E3HA 2C8NA 2WJZA 4PRTA 3L4YA 2YKKA 3BVJA 1M01A 4XTIA 2R24A 4LVGA 1EJWC 4FO4A 4ES4A 3N2OA 2C71A 5H8PA 3NAVA 1UOKA 5B7YA 3RN6A 3M16A 1H7XA 3PPGA 1W1PA 3GRIA 3L4XA 1OG6A 1XKJA 5G2HA 4R27A 4PMJA 2YSWA 2R1MA 3GG8A 1W3NA 1GT8A 4ECLA 4S3JA 1X38A 4H8UA 4PZVA 3KRUA 4NYUA 5KINA 1FRBA 4Y2WA 2ON3A 5CPSA 1W56A 4KF1A 4HNTA 2QR6A 1DE5A 4EAMA 4W9TA 5AOUA 1DP0A 3VD3A 2E25A 5BU9A 2VENA 1EC9A 4AZ5A 3KL5A 4C6BA 3MUCA 4UMCA 1KFKA 1RVGA 1RBLA 1Q6QA 2VURA 2BTMA 3EB4A 4B4HA 3KS5A 2IKHA 1Q6FA 3UXLA 2VEMA 3TA9A 4XK2A 3W38A 4DUOA 2PRLA 1ELSA 3WNNA 3O06A 5MKGA 3TZFA 3W2MA 4R9XA 2YL6A 4WQ6A 2O92A 1AQ0A 1JZ8A 3GHTA 2YDAA 3WLMA 1ZUAX 3M0LA 3VNLA 3DYMA 2VEPA 3EWYA 1TPEA 4QSHA 2GGJA 4GD0A 1I60A 3GC2A 2B31A 4YVPA 4MPQA 3W02A 5A6JA 3H26A 4AEFA 4MNKA 2IKIA 2D2HA 3MA8A 3E0IA 2IKJA 1OCQA 1TV7A 2AQVA 2IQTA 2QCMA 2V3GA 1SW0A 1UBSA 1V3KA 4I8YA 2QYGA 4M8UA 5CGTA 3LHYA 1VRDA 4UTLA 2YYUA 4RNJA 2PGRA 2FPTA 3AUOA 1ZSXA 5BOOA 3R1ZA 3LPGA 5CZKA 1S2CA 1S2TA 2ZUMA 3H4WA 1L9WA 1EHNA 2QKFA 2PWUA 4E38A 1KM3A 2BP1A 1R0MA 3S1XA 3MU7A 1NOUA 3YPIA 2OB3A 3ARTA 2QMKA 1SW3A 4QLJA 1UMYA 2Z1XA 3BAXA 4O54A 2UY4A 2HZGA 2XN2A 1POJA 2Y62A 2KZHA 5HOSA 4LEQA 1THFD 4JIRA 1RBAA 3I3DA 2E67A 3DIPA 2XH0A 2G0WA 1QPNA 5A6TC 3TXZA 3EYPA 1SJAA 3QMRA 1TV5A 3Q2DA 2JE8A 4AHOA 1JULA 1XCFA 1F4HA 5KZDA 1WNOA 2G3JA 2Y70A 3QXBA 1FWAC 1WDDA 3EMZA 3SFKA 3W37A 1H1YA 2Q71A 2DUAA 3WSUA 3CQJA 1WBJA 4H6RA 1Q2RA 2CEQA 2HVNA 3WDHA 2GSJA 4A3QA 2ZRWA 3KP0A 1BWVA 5I2UA 1UR8A 4EXBA 3QMTA 1XGEA 3T2QA 1A80A 1RQHA 2FTWA 1Q6GA 4DIAA 2WSKA 1ISVA 3WX7A 3U57A 2Y8KA 2VHLA 3ME3A 4ZOEA 3SCNA 4KWSA 2WNQA 3NM3A 3DYPA 4BF7A 1LYXA 1SW7A 1XQLA 1UR1A 2WC7A 2WJFA 5A6KA 3VNKA 1ODUA 1H0IA 3E2RA 3S1WA 4PBFA 3H22A 1TMHA 2PU1A 3FJNA 1HVQA 2VQTA 1M03A 3T42A 3LRLA 1JQVA 2I56A 4WIWA 3VIGA 1TA3B 1V02A 2XPKA 1HKJA 3WIJA 3WENA 3BC9A 3AIEA 3W3OA 1PJ9A 1O5XA 4W84A 3UZWA 3T07A 3ARPA 3UY8A 3QMSA 1C7SA 4ACZB 3WDIA 2VD9A 1PIFA 2FVKA 3ABRA 3VTRA 2RUSA 3BV4A 2OZ8A 2FH8A 1OK4A 5U4NA 4EAYA 5C0QA 1O5KA 4Q7IA 4DN1A 1WZAA 4X60A 2A3AA 3A5VA 1ZY9A 4W7WA 4W8LA 4OFCA 2GGIA 3V1PA 1UROA 1W5OA 2TYSA 3GU9A 1CLVA 3TC6A 3M41A 4BI6A 1OFBA 3TN5A 5KETA 6ALDA 2VRKA 4PMRA 3V4BA 3KL0A 4PB3A 4JTKA 4ERGA 1AQFA 1A5OC 5EMUA 4CVUA 3DFHA 3M0IA 3S83A 4NX0A 2F84A 1SO5A 4A8RA 4PMDA 1CLKA 6TIMA 2B7NA 4GE8A 1AH0A 3SQSA 2PEVA 3FSUA 4DZIA 2FZDA 1LG1A 5FCZA 3THQA 2XN1A 4C6PA 2XUCA 1SZEA 3VKDA 4M6QA 2GGGA 3EAUA 1XH0A 2PP3A 1DORA 4V28A 1R3RA 5BXSA 4AEEA 3EZ4A 1OIFA 3LHVA 1H3GA 2C3ZA 4O0QA 4GVHA 2PWDA 4IGNA 2E1WA 5CPLA 1XYAA 3PG8A 2HK0A 4L61A 5A95A 1H51A 4NJIA 4WGHA 2VGFA 1PBGA 1XV8A 1ML1A 1OD8A 4KEZA 4PBGA 1UH2A 4ORIA 3MTWA 4MYAA 4RPPA 4K38A 4PULA 4LT9A 3N6QA 3UVIA 3LMZA 1KLZA 1E1FA 3GH4A 3VC5A 2Y5EA 1EOKA 3N13A 4CNPA 2DIJA 4C6IA 1DKWA 1E6RA 1BXBA 3G1FA 4P8UA 1BD0A 1G9HA 4PSPA 1YNPA 1J6PA 5HR7A 2YBUA 3K4AA 1PIGA 3RCNA 2Z6JA 2VDGA 2OO0A 1XCWA 2X7WA 1KD0A 2EAWA 3W7KA 5I06A 2DH3A 3C2YA 3FV9A 4TMBA 4LAOA 4JKKA 2BWGA 3ARUA 4P8XA 1XPGA 4PRWA 2Z1BA 4UTFA 3RO8A 4MNMA 1W1A1 5C9WA 2Y7DA 3PJTA 3QC3A 4H7CA 3MP5A 5AHEA 1Q7ZA 3F1QA 1VFSA 1UR0A 3G0UA 4GVIA 5DBUA 2IPFA 2F7FA 2YFNA 1XD1A 1UKTA 3WQEA 3J7HA 3TC7A 1XDLA 2ZADA 4BEQA 4RNIA 4UFIA 3KVKA 1XGZA 3WBWA 4HIBA 3G6LA 3QPYA 1K70A 4CCDA 4JFVA 4I9TA 4HK7A 3O0KA 3WMLA 1TJ1A 5D2TA 2DP3A 3V5FA 4S3AA 2ACSA 1W5MA 2W4XA 3GUGA 1UW9A 3IGSA 4K8HA 1E43A 4PA8A 4UTKA 4BK9A 2JKAA 2E6YA 4H8NA 1XX1A 4RZBA 1EBGA 3GVGA 4JTAA 4Q4SA 3SY8A 3QYSA 4JS3A 4AU0A 2ZUNA 3IRSA 3UYCA 4M81A 2DZXA 2EPMX 4AMCA 3CT2A 3EGJA 2E28A 2Y63A 1JI2A 3OVQA 1C7TA 2ZWYA 2ISDA 5C2GA 3DI1A 1ZLPA 4Y9OA 3B9EA 4QCFA 3NL3A 4DHGA 3WD3A 3AYRA 2B4GA 2HRWA 2JKPA 5L6UA 4F0SA 1NEYA 3ZLFA 1Z9AA 4HZ7A 3R12A 3NYZA 2H9AA 2J6VA 1M1BA 1KCKA 3SJ3A 2YW4A 2ZZ7A 3OB8A 4JEQA 2GJLA 3POHA 3BQ5A 4D9PA 1NWRA 1VAHA 3UG4A 1GVFA 1BF2A 3WL0A 3DKLA 5FJJA 4J1OA 1RD5A 5JBEA 1S5WA 1EF2A 5FF7A 4M3PA 4PUNA 4OWGA 1I0DA 3MMWA 5BRQA 1U5JA 1Q13A 4O1CA 1E70M 3DYOA 3FK4A 2CBUA 2CU0A 2ZXAA 4GKLA 1MZHA 1VKFA 1V93A 2FTPA 3GZAA 1JPHA 5HA7A 4DEFA 4H9MA 3D3FA 3EB2A 4FOJA 3S8HA 1TVPA 4HJFA 3SSZA 4OV4A 3MKKA 4HA3A 3NIYA 4W85A 3MCNA 3SCVA 3VOHA 3BZJA 1EWEA 3VDBA 2V3FA 2Y7GA 1EHAA 3LN3A 1HJWA 4JX6A 1JAEA 3DGBA 3TW9A 1UIOA 3TJLA 3UWVA 4PUEA 4R85A 1XYZA 3MKCA 3CL6A 3GTIA 3MC5A 3GFZA 2VZSA 4DJDA 2FHBA 5HUPA 1QNPA 2VX4A 3F4DA 2QDDA 3EKZA 3A21A 2DJLA 3S6OA 1KQYA 2HVOA 4IPLA 1DHPA 1HGWA 3ZS4A 2ICSA 4GKTA 2YLLA 1H5YA 3B8IA 4F40A 3S5NA 3QY8A 3ITGA 1TA3A 5U7SA 4DJFD 4UR8A 4BZYA 2POZA 4NHVA 1OM0A 1R5YA 1TZZA 4XD3A 4F9DA 5K9CA 5DBTA 4ACZA 3F5KA 3DU0A 3WF2A 3NPWA 5HINA 3RM9A 1XL9A 3NPVA 3BV7A 1GOOA 2B7OA 3CL8A 1PYFA 3AS2A 5IXEA 3RM8A 8A3HA 4HK5A 3GVVA 1D9EA 2PMQA 4EX4A 4ICCX 4KT2A 3AU2A 5DT7A 1DJZA 1K6WA 3VIFA 1PEZA 4AC1X 3B9DA 4F48A 3CS2A 1E55A 4AWUA 1O7AA 3NGFA 4L1GA 3ARXA 4Q4QA 5G4HC 1MEWA 2XN0A 3OLDA 5FF3A 3W84A 2JGYA 2HCVA 1PDYA 4LAMA 5D9PA 4AHPA 2MUCA 1JAKA 3QTGA 4R88A 2D0HA 4CD4A 3CUJA 4GYPC 1TIWA 4AD5A 4MSSA 4EXAA 4GIAA 2NSOA 2ZTJA 2ZKMX 4GQRA 4AX6A 4C6QA 3VIMA 4MVAA 4NNAA 1AQMA 5BU6A 2PCEA 4O15A 5JUVA 3LCWA 2CESA 4UMBA 3DC8A 2DW6A 2QJHA 4ZTXA 4GX8A 1Z3NA 1PCKA 4DX3A 1N8IA 1GZJA 3W6MA 4AFYA 2W91A 1W1IE 2PPGA 2ZZ4A 5FEXA 4L1XA 3EOLA 4HNUA 4JFWA 2WQPA 3BMXA 3ITYA 5C9UA 3ZQ9A 3MV01 1E0WA 4JFTA 3RM4A 5FA5A 1UASA 5FAGA 4QJ4B 5HWJA 2VVNA 3APTA 3ELFA 3ZLHA 1IWBA 3L5LA 1TFVA 3M1ZA 4CD6A 1YX1A 2QCDB 3PZMA 2ZOXA 4AXKA 1X7FA 2QGYA 4C6KA 2DU2A 1YTDA 4C7FA 4HYWA 3CHEA 3HB9A 3LXCA 2ZFAA 1PE1A 4H41A 3NZRA 3HGSA 2CLFA 1W17A 1U33A 4M19A 3AMKA 3H53A 3BCDA 4OBTA 1WKYA 4JHOA 3RO6A 4ZZ9A 3RLHA 3WNOA 2ATSA 1BXCA 5I3KA 4BWLC 1VBUA 4BEUA 4R5EA 2E40A 3N29A 4GZJA 2PWGA 5K3VA 4ROPA 4QS5A 4IPPA 3STCA 2CHNA 1RLDA 3FCPA 3DKJA 3TV8A 4ZFMA 4QG6A 2VI0A 3LERA 2Z26A 1R9ZA 4K6AA 5CQ1A 2GFTA 5AECA 3WG6A 2WZEA 4JIQA 3WY1A 3VMOA 4EF8A 3II1A 1AK5A 2OFJA 5I23A 1BQCA 5DXYA 3MBDA 5A6BA 2E9MA 2XIJA 3K8KA 3W7CA 1RBOB 4E0CA 1XH1A 4RZ6A 1SFSA 1JEZA 5CAHA 4R7WA 3O0FA 1PWLA 3ZSSA 4KS0A 4NJGA 4AW7A 4DO6A 1B0IA 1ODZA 2QAFA 3BK0A 4HN4A 2Q6ZA 3OODA 4MPKA 5DLCA 1F61A 4IFRA 1XM3A 4L4LA 2VZVA 4Q8UA 3UNTA 1W1B1 2PURA 2W67A 4XZBA 3O3RA 2OZTA 1VBGA 4YMZA 4MAZA 5EMYA 3H54A 3GR4A 3G3DA 4M1RA 1Z32X 4MKNA 4XSLA 4HTYA 1X6LA 3M0JA 1CLXA 1AVAA 4Z08A 1BSLA 2WXDM 2J24A 3K1DA 4GG9A 1OZQA 1OX4B 3UA3A 1DEDA 3WN6A 2BGNE 2JKEA 3NQ8A 4FOUA 1PZ1A 3CLWA 2V9DA 2WC4A 2XIQA 3NQDA 4RPQA 1F9CA 3I4KA 4GPNA 4LFYA 2QNEA 1GW9A 3NQ7A 2ZXBA 1XUZA 5A8PA 3EPOA 4QG9A 3SY5A 3RMJA 3BSGA 4AQLA 2P10A 3PBWA 1UKQA 3MJMA 3E38A 1LRNA 4E5TA 5CCZA 1R9XA 4AB4A 3MY9A 1W1TA 1GOXA 1EQPA 1XH2A 4KFPA 1DBTA 4QS6A 3T8QA 1I0BA 3G24A 2FJKA 4IIBA 3N4AA 4W4QA 2F6KA 3NZGA 1ONWA 4KEVA 3QN3A 3W2NA 5A69A 4IQJA 4LOCA 1Z42A 1DWGM 3B8WA 3W83A 1QK2A 3CT7A 1VLWA 2FZNA 3CWOX 3W1LA 3CV1A 3INPA 3LMYA 4C1NB 4H6QA 1VCFA 3LCLA 1T8XA 3UT0A 2FZ9A 2V82A 5DY2A 4IQEA 3DECA 1JDDA 4UFKA 1Y0EA 2C14A 4UTHA 1CB2A 3UJEA 3UWEA 4PRRA 2A7PA 1VCVA 2X42A 2IMRA 4KERA 4CU8A 2WSRA 3EOUA 1QBAA 3A22A 1T40A 3FYYA 4MM1A 3WEOA 3POCA 2AKZA 4ZE5A 3NURA 3JW7A 2DGAA 1XI3A 4HMEA 4AWTA 5FJTA 2HTMA 2YR1A 3E1F1 3G0SA 2PD5A 4PTWA 1R46A 2QDHA 1LJYA 3VM5A 1GORA 4E8DA 1J2WA 3TU9A 3O9NA 3WUFA 4IPJA 1EZWA 4WOQA 1NJJA 4KPLA 1W3HA 1C8VA 3TEVA 3SQLA 3UBPC 1TPVA 2A3HA 3S9ZA 4TV6A 1IQ8A 1TYGA 4H8HA 3CZEA 3IUIA 3TQ0A 5IOBA 2YIHA 1FWHC 1JDEA 3PP7A 4KW2A 1JF6A 1U2YA 3WBXA 3H24A 4JL2A 3MV11 1UKOA 3DG3A 1QOPA 2CYGA 3VZXA 2NV9A 3VD4A 3VD5A 2I7GA 3WH9A 2PBGA 3QHMA 3B97A 4LSBA 1IZKA 1VEPA 1L8NA 5REQB 1NOFA 4ZA0A 1FOBA 4DWDA 3WUBA 1KO0A 3RR4A 1D3GA 1GHRA 3T55A 3WJWA 1NFPA 2W62A 2YW3A 2I9UA 1OF8A 2J9YA 1TV4A 5E9XA 4GJ1A 4H3DA 1PV8A 2P53A 4LUTB 1GYLA 1OT2A 2O9PA 4KCUA 4C7GA 5M17A 2HS8A 4CGTA 4LU0A 1VD6A 2Z27A 3NFUA 5H91A 2FZMA 3KTCA 3OLGA 1GWJA 1R86A 4PCSA 3W71A 4ZE4A 1XLCA 4GK8A 1ISZA 3E12A 1J93A 2AOSA 1JVNA 1TJPA 1H0GA 4X0NA 2A7NA 3WQ8A 3L66A 1JYNA 2BVTA 1OYCA 3M5XA 2AMGA 1JCMP 4QDWA 1T0OA 3MYOA 3BG5A 4O17A 1VENA 3GXPA 4PE8A 2PGWA 3RU6A 1RCXB 3S2MA 1GVOA 2QCDA 4Z17A 4B92A 1R3TA 2Y88A 4A8IA 5E0KA 1WXZA 4DNMA 1KA9F 3VXGA 2W79A 1D8WA 2PB1A 2WZIA 3NNTA 3PUDA 4X9SA 2DY3A 1QI3A 1M53A 1BAGA 3BPWA 3PBUA 4GQGA 3TYZA 2WW5A 1QPRA 3N4FA 3CAQA 4WSJA 1E3ZA 2ALDA 3HN3A 4DWSB 1E4LA 4REQB 5T26A 4JGDA 1G7UA 3PBVA 3C6CA 5A8OA 1IXOA 5D9OA 5FL0A 4G1NA 1XIMA 2RAGA 4N9EA 3NCOA 1L2UA 1Q7MA 3R94A 2CHOA 3HQPA 2PDJA 2EPHA 3N73A 4BQ2A 1I9CB 4IMDA 3RGTA 1H60A 4HBKA 2IW0A 1J12A 4Q4MA 1NF0A 3G0XA 1FKWA 1MXDA 4ZO9A 1DJGA 4XZNX 3PBYA 4PUJA 1PHQA 1OZMA 1F6YA 1E6NA 3W7EA 1HO1A 1UWTA 2PFHA 2R1KA 4XBSA 5IRPA 1X1NA 1TPDA 2GWGA 1QR7A 1UQYA 1XYMA 2X41A 3GDLA 1NM9A 1C8QA 2C13A 2QJJA 5HNTA 3PTDA 1QJWA 5F2GA 3QGVA 1DL3A 2OT0A 5JBDA 2ZUTA 5LKYA 1EDQA 2Q8ZA 2PTZA 3GR7A 4JQ2A 1UD5A 1BLIA 1Q6CA 1Q85A 4V15A 2BGSA 1B1YA 4J4KA 4JY8A 4NX5A 2C15A 3OQEA 3G22A 3H23A 1FP8A 3BL3A 4HNOA 1Z69A 4L9ZA 1E6QM 4XBJA 2YA0A 4JTDA 1MW1A 2CWNA 1ZP4A 1E9ZB 2JALA 4C6LA 4EP8C 4RZ4A 1RA5A 2I1OA 1OX4A 4UNKA 4MWAD 5HNRA 2ZE3A 1JRCA 2GUUA 1P6WA 3AZRA 1N55A 5C7VA 3M6DA 3S1UA 4IL0A 2F38A 1RJPA 3R13A 4PTVA 5IDZA 4Q8MA 4GYFA 1DVJA 1ZP3A 2PLJA 4LS0A 3BLLA 1WZKA 3GVWA 2ACQA 1UP2A 2C7FA 3DH7A 5EL1A 5FF4A 2IXUA 3NQ2A 1NELA 1UYQA 2DJXA 3LGDA 4PODA 1QOXA 1UR2A 3TWBA 4I7UA 3WH6A 3G5EA 1BFNA 1X1OA 4H2CA 3S2NA 1F6KA 1GG0A 4JN6A 2BY1A 1V02E 1NIUA 5KTLA 4LY8A 4OBRA 2AAAA 4IIEA 1KFWA 3RK8A 1TWIA 1P5BA 2A5HA 1XICA 2WSYA 3TWAA 5F2MA 4A3HA 5LGZA 3V3WA 5KZ6A 4IZGA 3ABXA 1YTEA 1A3HA 3V7PA 1GYMA 3VCNA 4D71A 1MUCA 4KCTA 4C1NA 1MNZA 1XC4A 1J6OA 1KBBA 2NW0A 1T5AA 4RDWA 2R82A 4GNKB 1OX6A 3LHTA 3SCTA 1F07A 2WPBA 1MFVA 1ZJHA 4ZMGA 3IGXA 3W7GA 2A4AA 2DZUA 3FJLA 1JZ5A 4S39A 1UH3A 2Y5SA 1NDYA 4H9XA 4WRHA 2CZEA 3RNDA 1VHNA 3EPNA 4QISA 1HNYA 4JHMA 4YCOA 3TX9A 4C6FA 1H11A 1TPWA 3AS0A 1KFBA 3Q45A