2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase class 1
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
1JUEA 1RPXA 1TSIA 2YYUA 2XN0A 3C2EA 2Y7DA 4N9EA 1VZWA 3LBCA 1TV5A 2DZUA 4UFKA 1LZOA 3CU2A 3HGJA 1IXQA 4DPPA 1QMLA 3C52A 4DQWA 5HWJA 4I7VA 4S2BA 5FEXA 3LV6A 5F4SA 1QNVA 4Z1BA 4I9AA 1H1YA 4A22A 3V75A 2VFEA 3P60A 1GVSA 1NEYA 3MWAA 4M7TA 3M7WA 4XUGA 1PIIA 3F4NA 2A4AA 1J5TA 4ZQPA 1VYPX 4M19A 4BFAA 1M5WA 3P74A 2Y7EA 5EY5A 3GZ3A 5LNRA 3W88A 4LUIA 4O8RA 2NWSA 1AK5A 5F2MA 5KITA 1YADA 4Z1AA 3CTLA 3W73A 1BKSA 3E49A 2V2CA 1JCLA 2CWNA 3L21A 1OX4B 4FXRA 4O1CA 2GQ9A 3GNNA 3HGRA 3UWZA 3KVLA 3T44A 3VCRA 1FWRA 3S0CA 1HG3A 3NG3A 3LGEA 3I68A 4O11A 1JCMP 4J9JA 1OX4A 5CZTA 3LHWA 4FNRA 4LTSA 5DCBA 3G3MA 2FLIA 4QM1A 1IIGA 1WV2A 3W86A 3QPZA 1FUYA 3M43A 4FIRA 3TV8A 1GOXA 2O7SA 4UTKA 4Z0JA 3SR7A 1RR2A 1JVNA 3ZWTA 1XBYA 2ISWA 1L9WA 2J24A 3CEPA 4X9SA 3N19B 1GZGA 3PBVA 1FWNA 1A53A 2OT1A 1BWLA 1H60A 4AAJA 2X1TA 1HO1A 3ANYA 5LHFA 3W7PA 4GUIA 2DZVA 2ZZ2A 3KRSA 3SJ3A 3P61A 5FF0A 1EUAA 4QQ3A 5LGXA 1P0KA 3HPXA 5K4XA 1C8VA 2ISSA 1OF6A 2BTMA 2R91A 3W70A 1L6YA 5D30A 3JRKA 1B57A 5K9XA 1U5JA 3G24A 3GB6A 1SPQA 3CHVA 3C3NA 4FB7A 3BGJA 4Z08A 3QM3A 1CW2A 4IMGA 4MLRA 2FTPA 4CQ9A 4JYFA 5AHMA 3N9SA 1P1XA 1BTMA 2Y88A 4GJ1A 1ADOA 1QOQA 3WJWA 1TPVA 3LTPA 3W83A 1B4EA 3QH2A 3QJAA 2V2HA 1OABA 2DU2A 3NEVA 4JN6A 2WNZA 5CPNA 2QDGA 1PHWA 1X1ZA 4JTKA 2J88A 3UZ5A 3FS2A 3EWWA 1RQBA 3C2FA 3T55A 4IOTA 4PEKA 3UXAA 5HWNA 1ALDA 1XKYA 2ZZ7A 4LW7A 4N4QA 2F7FA 1Y0EA 4LC6A 3DFTA 2PRMA 3W7QA 5CZJA 3L67A 4LVAA 4PCFA 3MI6A 4LS2A 3FKRA 1SW0A 1GTHA 4O18A 3QW4B 1W37A 2Z0IA 3STGA 3S5NA 4UTHA 5AYYA 3FA5A 4Y90A 4NZJA 4CNOA 3G0UA 3IIPA 3NAVA 3NQ7A 3BG9A 2ZRWA 3W1UA 3DHFA 3LCGA 1C29A 1A5CA 1VRDA 1GYNA 3TQ0A 1QAPA 1R2SA 4JEQA 5D02A 1LCOA 3DXIA 2CFFA 3YPIA 1WOBA 1TQXA 4JYDA 3LLDA 3RLVA 1SUXA 2V5BA 2G95A 1W0MA 2H8XA 3TH6A 4WUIA 1MEIA 4IGHA 5LNUA 4NXSA 3S1WA 3KFTA 3TC6A 3S8HA 2A7RA 1XBZA 4LOCA 2X1RA 1EIXA 2TRSA 1PCWA 1VHCA 5BMXA 4I7WA 3BW3A 5LKYA 3LCXA 4HSNA 2ZRXA 4Y96A 2C15A 4YXGA 5BRBA 3PM6A 3T4CA 3ATZA 3QC3A 3MI2A 4ONVA 5AHIA 3GXTA 3W71A 2A21A 3PG9A 1RZMA 3I6RA 4NX5A 4Z0SA 5LSMA 3NQVA 1H62A 3FKKA 3GVGA 4MLJA 4QISA 4GBUA 4NJKA 5DXYA 2QCDA 1VPXA 2A6LA 3CQ0A 2OMAA 4N9DA 3A22A 3C2VA 1SZEA 2DZSA 2NV1A 2OX1A 5F2IA 5DELA 4FXSA 2E1DA 1YDOA 4CCEA 1GYLA 1TRDA 4MY9A 3BV4A 3CEUA 5LNVA 1W5QA 1YXDA 2QAPA 4K6AA 4NJJA 3LV5A 4O0ZA 1HTIA 1A5BA 2VFFA 3MYPA 1XCFA 3QRHA 4E38A 1LTDA 2FDSA 3CWNA 2W6RA 3C56A 1SSGA 3CM4A 1TB3A 1G4TA 4K8HA 4ADTA 1J2WA 3P5ZA 3WK3A 4CQAA 3CT7A 3MP5A 4A21A 1KFJA 1H7NA 1D3GA 2YCEA 3FYOA 3WJXA 1WXJA 3L0GA 3B06A 1PV8A 4JTTA 4WD0A 5BW6A 3MBFA 3LHZA 3W7RA 2QUUA 3UY8A 4HSOA 2WSYA 3UD6A 4D2JA 1D3HA 1EEPA 1OYCA 1IXOA 3TIMA 4WOZA 3IVSA 3S6DA 1KTBA 3M5XA 3W7IA 4G1KA 2GVLA 4MYAA 2QEZA 3DFPA 2TYSA 1OX5A 3STFA 4LVGA 4DEFA 2DJLA 2ZZ4A 3MP3A 3PSWA 1Q6LA 2V82A 3IGSA 4WXYA 5BOOA 2GQ8A 3M44A 4RZ6A 3P8JA 4OT7A 4LRTA 4UFIA 4Q32A 2QF7A 3DI1A 4Y6GA 3R89A 2JGYA 3BPWA 4AMAA 3R2GA 4IX0A 2YX0A 1SQ7A 3WJZA 3H55A 3GDKA 5C55A 3THQA 1H7XA 3W72A 3LTSA 4UR7A 2ZBTA 5IBXA 2ZQ0A 4ZL1A 3W76A 1RQHA 3RLUA 2G97A 1TJRA 3H53A 3NYZA 3L0KA 3NNTA 5D2WA 1O60A 5EPDA 3U8GA 4AVFA 2ZA3A 2FPYA 3CB8A 2ZRUA 1T96A 3AJXA 3LHTA 3SIZA 4OBTA 3G18A 4C1LA 5F2GA 2VENA 1L6SA 2WSRA 3IVTA 3USBA 4DO4A 2G96A 4NQ1A 3W1NA 4YCPA 3W7EA 3IIZA 1C9DA 4DPQA 1ZFJA 1JULA 3KRUA 1KFEA 1KTCA 2E09A 1W5PA 2FB2A 2EAWA 2GOUA 3INPA 4LVBA 2H3DA 3W7HA 3EXTA 3PAJA 3OA3A 4KWWA 5K7JA 1B9BA 2Q3RA 1ZAHA 3LI1A 4A2RA 4UTTA 4E2BA 3MUXA 4JY8A 3UXDA 2X2GA 3Q2DA 4N9CA 2QDHA 3TW6A 1PS9A 4A3UA 3FJLA 1TTJA 3NXFA 2XN1A 3BLFA 3VFLA 4FIQA 1HO4A 2J6XA 2B7NA 4MOZA 5D05A 1G4EA 2BWGA 1W54A 1XDLA 1GTEA 3LCLA 4ORIA 4ZQRA 3THAA 3DU0A 3TQKA 4YL2A 5HR7A 1XFBA 3S5YA 1LOQA 3QQ0A 4WZHA 3TXZA 1W56A 5A8GA 2VXNA 5FF7A 2Y85A 2ABAA 1YTKA 3NL5A 4O54A 4WQ6A 2A5HA 5AHNA 3FIGA 1XUZA 3G1DA 4W9TA 3LCWA 1DQWA 3NL3A 3G0SA 3FEMA 4CCDA 3ABQA 1ME7A 1F74A 4MJMA 1OYBA 3MHFA 3EKLA 4FHAA 1KV8A 4MPQA 4GNJA 3E02A 3UWUA 4WXZA 4R53A 1VS1A 3VNDA 5BMWA 2VEMA 3BVJA 4JDBA 1WA3A 2YFOA 1OJXA 2OT0A 5LZLA 3W2MA 2TSYA 5G4EA 5CZSA 2ZDRA 1JCNA 3W7JA 1K02A 3T78A 3M5VA 2XN2A 1KTNA 2I9EA 4ML9A 4JX6A 3U2OA 3W23A 1TJPA 3TAKA 1EP2A 4DELA 5H91A 4K8EA 4XZ9A 1DL3A 3LCIA 4RV8A 3M5ZA 2C3ZA 4GUFA 4TX9A 3FFSA 3SGUA 4HHPA 5KZEA 1K3UA 3TU9A 4EF8A 1T0OA 2QJGA 1XC4A 4UTWC 1LBLA 1NVMA 1JUBA 3NQ2A 2C6QA 2DZTA 2EHHA 2PCQA 2FFCA 4NUWA 3KVMA 1QO5A 4X22A 4NNAA 4XBKA 3C61A 5D2XA 2GUUA 2WSQA 2CLOA 3ZWSA 4AF0A 2C19A 2GQAA 1GVFA 3EWYA 2A1YA 5C5YA 1KM5A 2EF9A 3EXRA 4TIMA 5G4WA 1UB3A 1H7WA 1SW7A 1JUKA 1AMKA 1SO6A 4YMZA 3R8RA 1MXSA 3L9CA 1LROA 2RDTA 1SZGA 3MHUA 1ZALA 5FEPA 4O52A 1G69A 4GFSA 1Q6OA 3VI2A 5D09A 3TSMA 3HOJA 1YTDA 3Q58A 2BXVA 5DY3A 4BF9A 2EPHA 3E0IA 4HN4A 3NQEA 1GVOA 3BG3A 3UQNA 4MFEA 5D33A 3HG4A 4JTEA 5J5RA 4AHPA 5L9FA 5LNWA 4JD4A 5HJLA 3PG8A 4O50A 1H7RA 3B0VC 1W3NA 4JDYA 5AYZA 2QCGA 3GX9A 3QW3A 3NM1A 4JTSA 3O6DA 2ZZ5A 1DKWA 1TPEA 3TNOA 4O1BA 3TDFA 3DAQA 3W2KA 1YDNA 3P8IA 2NXGA 4P61A 3B03A 4QNWA 5D32A 4KKXA 3W2JA 2V8ZA 3PS7A 4KFPA 2QR6A 1TRIA 4JTHA 1TTIA 1JCYA 3D0CA 1DJQA 1N7KA 2X1SA 1K7EA 3V1PA 1DORA 4HNTA 4M6PA 1OK4A 2NWRA 1NF0A 3S5OA 4IQLA 1KM2A 2V9DA 5MHBA 3QPYA 1KLYA 3O8AA 1VYSX 4WY0B 5CSRA 2CLKA 1UJPA 4A29A 1KM0A 2A2IA 1ME8A 2BSLA 1SFJA 3CWOX 1L2UA 2YSWA 1W5MA 4JIQA 1XBXA 2AQWA 2DP3A 2D73A 2VFIA 2G5WA 3IGXA 6ALDA 2ZZ6A 3KVJA 5ABTA 3QF0A 3LXAA 4OU1A 1VR6A 1OFBA 1ME9A 2TPSA 2VEPA 3PC0A 3G1HA 2Q8LA 3GAKA 4UTWA 3SZ8A 1KBJA 3NPUA 4IJBA 1VC4A 4PFMA 4UCGA 2V30A 2XFWA 4UNLA 2YFNA 1SO4A 2A6NA 5CG7A 5D38A 3NQ6A 1ZHAA 3HQ1A 5TIMA 4RR4A 1FDZA 2WPBA 4UTIA 4DF1A 2HS8A 4RJEA 1B4KA 3EWBX 4LWWA 3SW6A 3EWXA 4GUJA 5SWUA 1K03A 3UY7A 4N6FA 2CZ5A 2DZXA 5LNSA 2Z2UA 3SI9A 4IMFA 5KSWA 2E6YA 3PBYA 3MI3A 4UMAA 2E6FA 3E12A 3L68A 5HQEA 3W9ZA 2CZDA 2VEIA 3PB2A 4UTMA 4LUJA 3PBUA 1EWEA 2Y89A 3DFSA 1TV8A 4JTJA 3OHIA 3GLCA 3PR2A 3MJYA 3TKFA 4DF2A 3CLMA 1I2PA 4K39A 4JTGA 3G1XA 5U4NA 5BNKA 4UNKA 4RCXA 3TUUA 3W6YA 1GPWA 4O4WA 2ZFAA 5I3KA 3F4WA 3EWZA 2Y7FA 3DFOA 5AB3A 1H7PA 3TCEA 3UWYA 1L6WA 4JGDA 4CLMA 3PUOA 4R34A 4EOUA 4MUZA 3RMJA 4RZ5A 4O57A 5E93A 1OFQA 1JCJA 2FIQA 2NUXA 3TR2A 3ZS4A 2H6RA 3S1UA 2NX9A 1RQEA 4O53A 5DLCA 1GG0A 2O7QA 4O16A 4FX8A 1S5VA 4JXCA 5G1YA 1TREA 1AW2A 1XUUA 1IGSA 4PA8A 2C18A 3HG2A 2YGYA 2H90A 3E96A 2WQPA 4NVTA 1FWTA 3RFAA 1MEWA 1QWGA 3G1FA 1LRTA 1G7VA 1W1ZA 4H3DA 3QEZA 3M16A 2B7OA 2J27A 3KX6A 1KM6A 5K2ZA 1W5OA 4H4IA 1TYGA 3W1LA 3O06A 1ML1A 4E2DA 3UWVA 3Q37A 1QFEA 1THFD 2C0AA 3GIYA 3TA6A 2C13A 3MYOA 4L4MA 1F6KA 3GXNA 3BLEA 1VJIA 1OFAA 1TPH1 3OG3A 3HB9A 3G22A 5AN7A 3O6YX 1GJPA 4X2RA 1S5WA 1VCGA 1LBMA 3O1NA 4HPXA 3GKFA 1G67A 1BEUA 1N8FA 2ZCGA 1ICSA 1I8JA 3DBPA 3TSDA 4AHQA 1SSDA 1W31A 1JCXA 1SO5A 2UV8G 3B0PA 3GDRA 4K7YA 1GVRA 2FPTA 2B7PA 3GYEA 1P4CA 3IVUA 1ZNNA 3TQVA 4UMCA 3GDLA 3TAOA 2ZA2A 1O4UA 5E1QA 4QITA 3A24A 3HF3A 3DH7A 4HPJA 1B3OA 5G2IA 3K30A 4BWLA 4K36A 4XKYA 3P7YA 1V5XA 1NSJA 2RDWA 2TMDA 5U7SA 4BI7A 1EP3A 1XDMA 5AYXA 5EBUA 4GUGA 4O0KA 2NUWA 3EX2A 3T7VA 5J5DA 2E6AA 3OVQA 2Z6IA 4LS1A 3NL2A 2X30A 3HJZA 2E68A 3N73A 3NQCA 3VKJA 3N34A 2VFDA 1A5AA 5T26A 1Q6QA 3P62A 5AC7A 3LXBA 4Q4KA 4O1AA 3G8EA 2QUTA 1QPQA 1PE1A 1QOPA 5HULA 4DXVA 2YW3A 4WJEA 3F03K 2F84A 1P0NA 5D2TA 3A21A 4NJHA 5DN1A 3RU6A 3BLIA 1WDWA 4MZ1A 1U83A 5I3IA 4IMCA 1OFDA 3DENA 1IXPA 3PULA 2CLEA 5IBXC 4FX6M 2JKEA 5CKSA 2V81A 4PL2A 4LVDA 3IGUA 4BR1A 4NX0A 1M7OA 4JICA 4XWUA 3TK7A 3GAYA 2QCLA 2OZ0A 2Y62A 3OVRA 3LCHA 4HKPA 3PUDA 1EPXA 2NX3A 3EB2A 1X7FA 3ABSA 1TPFA 4CCCA 8TIMA 1R46A 2QCHA 3L2IA 4MZ8A 1KM4A 3GR8A 1EA0A 2HSAA 4AB4A 4ADUA 1DHPA 4NNCA 4TMBA 4WY0A 3F1QA 1KFCA 4LRSA 2HMCA 2YZRA 1QPRA 1TPDA 3EX4A 1G6CA 4O13A 3EX1A 3UPWA 5AHLA 1TV7A 3BW4A 3NVTA 5DBUA 1NFBA 3A5FA 2CLLA 1XXXA 3PB0A 3WJSA 3ZR4A 3HBLA 1OF8A 3S5ZA 4M6QA 4UUIA 3A23A 1I2QA 4UTTC 3S42A 1WBJA 1ZJIA 3NA8A 1WBHA 3I7SA 5D2YA 4M6VA 3N2MA 5I3FA 1TPB1 1XBVA 1R2TA 1SR9A 2Y63A 1W3TA 3ATYA 3NPWA 4IPJA 2W79A 1LDCA 1TTPA 1G4PA 4KFNA 2E5DA 3DI0A 5F4XA 1AW5A 4XBSA 3B0UX 1Q3NA 4HNUA 3HG5A 5KMYA 3DFNA 4BWLC 5K4ZA 3P67A 3W1MA 4TR9A 2C14A 1VCVA 3NQFA 3NQMA 2E77A 3PY2A 2JKPA 2CLMA 3QYQA 2P10A 1LLWA 3STEA 2R94A 3TFXA 3TROA 1FCQA 2ZTJA 4UFHA 3W07A 3W74A 4P2VA 1O5XA 3M47A 3MO7A 3QQ1A 4JX5A 3IIOA 3UWWA 1OFOA 1F73A 1F76A 5AC6A 1FCUA 1Z48A 1PL9A 3LERA 2EKCA 3M5YA 1OG0A 3LDVA 7TIMA 3G1AA 1I4NA 3W1QA 3GKAA 4UFMA 5G5IA 4PC8A 1I2RA 1YPFA 3W1XA 3L0NA 1GT8A 5I3HA 3BO9A 4FX7A 1UCWA 1FCBA 3QFEA 2YYTA 4TU1A 4OV4A 3TJXA 2A85A 3C2RA 2J9YA 4ALDA 1F5ZA 5D03A 1IXNA 1TCDA 3LRLA 2VFHA 3KAOA 2FQIA 3C4UA 4LNYA 1O94A 5EL1A 4O14A 5LHEA 2E5BA 4JR5A 1SFLA 1JRCA 2NX1A 3NOEA 3GR7A 3LRKA 3L5AA 1W8SA 4NT0A 2I1OA 1OVDA 4IX2A 5A5WA 1QCWA 1CI1A 3BG5A 1WQ5A 3ELFA 2OCZA 4CNPA 2J9XA 3W1AA 2EGZA 4LY8A 4O12A 4XTDA 1FDYA 2VC6A 3C8FA 3OEXA 3NM3A 4MFDA 3W7CA 4JTIA 3W7NA 1MEHA 4JTLA 3R13A 1SW3A 2H3BA 3LOTA 4DF0A 4HIBA 1VQTA 2DZPA 4O28A 1KFKA 4O1DA 3NQAA 1O5KA 3TSBA 2ZRYA 2PC4A 3OVPA 3W1PA 5DY2A 3IIXA 1T99A 3DZ1A 1TTQA 5DCDA 1FY6A 2V5LA 2QCNA 2X1UA 3SECA 3WK1A 2I14A 3LRMA 2Y70A 1EX5A 3W1TA 1ZAJA 2ZZ1A 1PHQA 1MSSA 1LBFA 1FXPA 2ISVA 2GJNA 3ABOA 1I2OA 2JGQA 3M6YA 4EIVA 1VYRA 3G1YA 4RLIA 3HMJG 4N6EA 2E5CA 3S1XA 1JQXA 3P80A 3W85A 4LC8A 5G2HA 3IIVA 4XQ6A 4PH6A 1VH7A 3PF3A 3LB0A 4NNBA 3FJ6A 1V7YA 4QIUA 1H51A 4Y8FA 3SFKA 4EWND 1VLIA 4GXMA 5EKYA 2E6DA 1LYXA 3W2LA 4N9BA 3UPBA 5TQLA 3G1VA 5I3JA 4KWVA 4JNMA 4GWEA 3LCFA 4B5NA 2PE4A 3DKJA 3RNDA 2FB3A 2CLFA 1MZHA 3C6CA 1HFBA 4L4LA 1YLVA 3NQGA 4NXKA 2C16A 5IM51 4XTIA 1QR7A 4S2CA 5CGQA 2R8WA 1VGAA 3UZJA 3G3DA 4MY1A 4JX4A 3LTYA 2YDAA 3M1ZA 1KBIA 2ATSA 5KZDA 1YXCA 5TBOA 4IMDA 2VFGA 3AO0A 5FEZA 1X1OA 3JS3A 3U6WA 1OFPA 1Z42A 1DOSA 2NUYA 4RXFA 1I2NA 2QKFA 3EX3A 4DBEA 2ZZ3A 1KW1A 1VCFA 4MKNA 3L5LA 3M9YA 1KLZA 1EWDA 1WYIA 2HS6A 5G2WA 4EVZA 4ZQOA 1WOAA 4UFLA 3RF9A 5G1TA 1LORA 2WO5A 3PUEA 4AXKA 5L6UA 1DQXA 3LHYA 3GXPA 4ZZ9A 5FI8A 4IUOA 3TMLA 4DBDA 4OV9A 3EKZA 3WFAA 1QDSA 4OWGA 1FCVA 1EP1A 4HNVA 1H1ZA 4N02A 5EA9A 3M41A 1DV7A 1YTEA 2Y7GA 3NPVA 1K8XA 1R30A 3BARA 4N2YA 1JRBA 4TMCA 1X8FA 1W5NA 5F2LA 4JYEA 4GE8A 2NLIA 1GVQA 1H50A 2WKJA 1AG1O 5AOUA 3T40A 1KV5A 4AF0B 3W7OA 2H8ZA 5KINA 4HT3A 2A7PA 3O07A 6TIMA 2CZFA 4GC4A 2ZTKA 2V2DA 3GK0A 4CNNA 4FO4A 1DBTA 1IF2A 3NL6A 4FEZA 1Q6RA 3CIWA 1SZFA 1G4SA 4JTFA 2RFGA 1J4EA 3G0XA 4QNEA 4A2SA 4WX2A 1EUNA 3LLFA 3G1SA 1I45A 4WOQA 3JR2A 4DO6A 1HL2A 3KVKA 1UUMA 5LGZA 3QZEA 1GWJA 3O15A 2QJHA 3B05A 3E9AA 1OX6A 4K37A 2YR1A 1YDVA 1FX6A 2CZEA 5AC8A 1N55A 2LLEA 4IXHA 4IMEA 5E0KA 3TX9A 2WNNA 3W7GA 4ICNA 3BK0A 1Z41A 2QJIA 3HPZA 4AHOA 3PBWA 4I7UA 4ZMGA 4Z1CA 2AAMA 4RZ4A 1JJKA 3QSTA 4K7VA 4FNQA 3S9YA 4MY8A 1FXQA 3MMTA 2PRHA 5HNRA 4JY9A 3QMSA 4TO8A 1DVJA 2WOQA 3CPRA 2A7NA 3P81A 2P1FA 4HNNA 1ICQA 2BX7A 3R12A 4O19A 3C2OA 2P0OA 4ORMA 1Q45A 3MW7A 1FWSA 4UIOA 2GVGA 2Y6ZA 1A50A 4UR8A 3W7MA 2CLIA 2RHGA 1LM1A 1G7UA 1PVNA 1NAL1 1GEQA 1NF7A 3OBKA 3QMRA 3UNDA 3EXSA 4NJIA 1H61A 5FEWA 3W1RA 3L66A 4IWWA 3O63A 4O4VA 2HTMA 4K38A 4MYXA 1H7OA 4NU7A 1XL9A 3I7RA 2WV8A 4RXGA 3W3OA 2GVJA 4AWTA 1S3HA 1CX9A 4LU0A 2DJXA 5DXXA 5FF2A 3WK0A 5K9DA 3TJLA 3HGSA 1KFLA 4UTLA 3N14A 3KHJA 1TIMA 1UUOA 1R2RA 1S5TA 3P82A 1ZY9A 5AHEA 1KM1A 2R14A 3W2NA 1F6PA 4LV9A 4AWUA 1LOSA 1E51A 4PTNA 5DCEA 3UYCA 1H63A 4OQVA 1ZCOA 1PCKA 4RX0A 2B4GA 1JQVA 3B04A 1ZAIA 4OE7A 4ADSA 4ZQMA 3SSJA 4AWSA 4LS0A 3O6CA 4X3ZA 4O17A 3N2XA 4C1KA 1OFEA 3GDTA 2NXIA 3TW7A 4U28A 3FYPA 4XKYB 5HUPA 5D04C 2BZNA 3NQ8A 4O15A 3TC7A 1Z44A 2ABBA 2QCFA 1KFBA 4QAIA 1DJNA 2QAFA 2OJPA 3EEGA 2RKXA 1LOLA 3B8DA 1F2JA 4GUHA 4IPIA 3TFCA 2FPVA 1RD5A 4YWIA 3B4UA 1RVGA 2IQTA 1QO2A 5FF3A 4BI5A 3TMQA 4YCOA 1K7FA 4ZQNA 2AGKA 3L5MA 3UWQA 3PVFA 4R33A 3SGZA 4MJZA 2NZLA 1FWWA 5CSSA 3H54A 5DBTA 3P84A 4BI6A 4M7SA 1OFRA 3ABRA 2QCEA 3NQDA 3SY5A 1OK6A 5HUOA 4O10A 3C0JA 1HUVA 1M7PA 4GRSA 1LP6A 3WK2A 5D37A 5AFDA 1TQJA 3KXQA 3W7KA 3PSVA 3RK8A 5HINA 4LVFA 3PWAA 3W75A 2B0MA 1GG1A 4ZQCA 4OGZA 1RV8A 3LX9A 3QSRA 3HIJA 4AEOA 3I7QA 3DKLA 4FNPA 1M6JA 3TXVA 3EX6A 4KFOA 3HPSA 2QUVA 1VLWA 3STCA 5F1UA 3EWUA 4R7JA 1LRQA 4H6KA 3HO8A 1UASA 4Q33A 5FESA 1WX0A 2DZWA 2JBMA 1ICPA 3R5EA 4ZVJA 5AHFA 3MHGA 1ZENA 4UC5A 3BW2A 1EB3A 3O05A 4Y9AA 3HG3A 1TPUA 2VELA 3DGRA 2PURA 4YLWA 3QMTA 5K3VA 5K9CA 2GPTA 3I65A 2VOMA 1WAUA 4MVAA 5GVJA 1P5BA 1W3IA 5F4WA 4LV4A 5HR6A 1F05A 2RH9A 1MO0A 2KZHA 5I3GA 4AH7A 3DFQA 3W2UA 4UXDA 4N4PA 4OHQA 1TO3A 4NJGA 2ALDA 3MBDA 3O16A 3ZFHA 1LRNA 3N3MA 3P5YA 3GDMA 1YXYA 2ATMA 1IIHA 1R47A 1JR1A 1AL8A 2QCMA 4RK8A 3LXCA 3Q94A 3W7LA 4DO5A 2QCDB 5H2ZA 2C1HA 3NZRA 4JTUA 3N9RA 4JIPA 5C6MA 3W84A 1SZNA 5CPMA 3OIXA 4BK9A 2GJLA 2W0UA 4QSHA 3IEBA 2B7QA 4MIMA 4QJ1A 2CW6A 3KRZA 1YYAA 2CU0A 3L65A 4E0CA 2Z1BA 2NXHA 3VE9A 3CC1A 2RDUA 3LHVA 5FF4A 3M0ZA 4UTJA 1F7BA 1AL7A 4JS3A 1ONRA 1VHNA 1H5YA 2Q3OA 1LLZA 1QPOA 1SO3A 1O95A 3W87A 3CIXA 4FF7A 1GQNA 4MZYA 1QPNA 5KTLA 2FJKA 5F1VA 3S1VA 3W22A 4PODA 2Z6JA 4UMBA 4CQ8A 5EYWA 3LM7A 4IXXA 4LT9A 5HWMA 3LI0A 3FLUA 2YPIA 2ZA1A 5D2VA 1K8ZA 4NZFA 2PRLA 3W7DA 4FNTA 4FNUA 2X16A 3LBMA 4Z1DA 2VKZG 3A5VA 1AW1A 2VEKA 3BGGA 3G8RA 1T8XA 2QCCA 5CPLA 2YW4A 3IRDA 5EMUA 2NV2A 3DHDA 1FBAA 2BLEA 1OYAA 1XM3A 4WY0F 1KA9F 5C54A 4FNSA 1FQ0A 4U4MA 3NZ1A 2Y61A 3HGOA 5HMSA 4RKAA 4M5PA 2DORA 2ZRZA 1FDJA 4UTUA 1D9EA 4PL1A 2ZRVA 2WJZA 5C2XA 3VE7A 1TMHA 4POCA 3WJYA 3TE9A 1SU5A 3A9IA 1X6UA 3FOKA 3NGJA 1BWKA 2JKAA 1YPIA 2WNQA 5CPOA 1KM3A 1K8YA 2CLHA 3KOFA 2JK2A 2V0TA 3NPXA 2J9ZA 4EF9A 1TPWA 1TPC1 1OHLA 2YXGA 3NDOA 5KZMA 1UBSA 3MP4A 3IV3A 2ZYFA 1K7XA 4UFJA 3NO5A 3NR0A 5CZ0A 1A5SA 2A0NA 3GNDA 1XI3A 2Q8ZA 4S1FA 3LHUA
chains in the Genus database with same CATH superfamily
1TSIA 3QQWA 4P7LA 2Y7DA 3AFBA 1Q7ZA 4N9EA 1E4NA 1Q4WA 4EX4A 3ANVA 4L1WA 2EPMX 1IXQA 1R7OA 1YIXA 1FH7A 1UPPA 3C52A 2J66A 1MI3A 1V3HA 4HOZA 4Z1BA 1CXIA 4I9AA 4A22A 4B3KA 4CQCA 4F48A 3ITOA 3P60A 1PX8A 1POJA 3AHZA 3M0KA 5JBFA 4AIUA 4XUGA 4RDWA 1GOQA 2OZTA 1M5WA 3EEZA 5HANA 2PTXA 2XINA 3W88A 4FF5A 5FJTA 3H24A 3GTFA 3PZUA 1D8WA 3WLNA 1EH9A 1YADA 4Z1AA 2VQUA 3CTLA 4AY1A 1JCTA 3E49A 3L21A 1OX4B 1CCWB 3HGRA 3UWZA 3KVLA 3VCRA 1Q65A 1QI5A 1QI2A 3I68A 4O11A 4LH8A 5CZTA 1YDYA 4NAEB 3TOYA 4GGHA 1E6PA 2EPNA 2HRWA 2IW0A 1JYNA 1B31A 2DT2A 2P8CA 3ARZA 1CPUA 5A8QA 3RITA 5CPTA 5CSYA 3UVIA 3PBVA 1AJ2A 1BWLA 2ISDA 3H4XA 1R8LA 1GORA 1H60A 1EZ2A 4AAJA 4LQ1A 2E8ZA 2DZVA 3OB8A 3P61A 5DT5A 1EUAA 1CGXA 3D6NA 5K4XA 4ZB2A 3S2LA 1L6YA 1NP2A 4AD5A 5T8GA 3T2OA 4UWMA 1B57A 1UIOA 2AOSA 1U5JA 3EOSA 2XWDA 2GJXA 2OELA 4IPPA 3C3NA 3BGJA 1M1BA 4Z08A 3QM3A 1T40A 4OJYA 2DW7A 4CQ9A 1F3WA 4KERA 4XZMX 4FA3A 1EXBA 4MAZA 2P88A 4AVNA 1EZWA 1TPVA 3EPNA 3E38A 3RX2A 2E25A 3QH2A 3QJAA 3WH9A 1E1CB 5CPNA 2REQA 1PHWA 1KWGA 4TUFA 4QE1A 1OT2A 1QK0A 2YCLB 3U4FA 1WZAA 3TTSA 3MKVA 3UJRA 1HGYA 4LW7A 1QTWA 2F7FA 5CAHA 1VENA 3VMNA 4LVAA 4UB9A 3FGCB 1SW0A 5FJJA 3QFWA 2ZE0A 1L6FA 1A49A 3DECA 3K1GA 4Y9PA 4UTHA 4D6HA 4S3EA 4C6NA 2YKKA 2XH7A 4CNOA 5CC7A 4B5XA 3AHTA 2UY5A 3H4GA 3GXIA 4DX3A 1GYNA 3JVAA 1QAPA 1R2SA 1HKWA 1UWSA 1LCOA 3DXIA 3MCMA 1VBUA 4HNOA 1GQIA 1BSIA 1WDDA 4JYDA 3LLDA 2V5BA 3BMXA 4DZ5A 2DUZA 4XISA 1PZ3A 1W0MA 1CECA 2DIJA 4ZOBA 1MEIA 3PFRA 2VT0A 4IGHA 2OVLA 4NXSA 3TC6A 3EOEA 5A6BD 2Z1KA 1W1A1 1SZRA 2ACQA 1ONEA 1QWKA 2TRSA 2PI6A 3LCXA 1FH8A 4Y96A 1I0DA 1V3LA 2ACRA 4KGLA 3T4CA 1Q2SA 1HKMA 1K6AA 1LQ0A 2OLHA 3MI2A 5AHIA 1MQRA 4NI8A 3MSYA 3PG9A 1RZMA 2PDLA 1UH3A 4NX5A 2QLYA 1XLGA 4Z0SA 5LA2A 1JPHA 4H83A 5CCZA 4QISA 1UWUA 1TV4A 4LEQA 1EC7A 3A22A 4Q6JA 1WKDA 1HKKA 2DZSA 2PB1A 2FZNA 5BU9A 5F2IA 1T5AA 4RNJA 5ECUA 3P0WA 2BNJA 3CEUA 3B8SA 1XLAA 4LYPA 3UJEA 4H6RA 4O0ZA 4AIOA 8XIAA 1A5BA 2VFFA 4JQ1A 3GG0A 3CWNA 3OQEA 2P0IA 3NUKA 1F3EA 4JN7A 3P5ZA 4CQAA 3MP5A 3WLRA 3MSDA 2A3CA 4S3CA 1QNRA 2YCEA 3WJXA 1DE6A 1FKXA 3BL3A 1PV8A 4F2BA 2G4FA 3CHCA 4EPKA 1NOFA 1TWWA 3AALA 1SM9A 4RDVA 4ZFMA 4D9PA 1XRTA 1JYWA 1V0LA 2WSYA 3UD6A 4HCHA 4GABA 1EJTC 1IXOA 2NSXA 4WOZA 3S6DA 1KTBA 4C6MA 2GSJA 2GVLA 5CZKA 5DMMA 2VEGA 4S38A 3RAOA 3MP3A 1TJ0A 3PSWA 1U1JA 1Q6LA 2GSHA 1J79A 2C0HA 2VX5A 5LXXA 4H7ZA 1EX1A 2VDGA 4UFIA 4P7RA 3DI1A 2DVTA 2AQOA 3R89A 3LSCA 2JGYA 1JYVA 2XTKA 4IP4A 3GE7A 3CAWA 3GDKA 4PTWA 3LTSA 4PB5A 2OX4A 1KXVA 1PZ2A 5IBXA 4L6HA 5C8BB 5E6ZA 2Y8VA 2G97A 1WDSA 1EHNA 4MNMA 4C1NA 1QBBA 4ACYA 1CIUA 1O60A 4QG8A 1BYCA 1SFTA 2ZRUA 1O6IA 1NWUA 4OBTA 4DJFC 3CHEA 3NGFA 2ASHA 3GDBA 3L4YA 4DO4A 3KDNA 3IWPA 4HU8A 4NQ1A 3IIZA 4C7DA 1UH4A 1FWDC 2J8GA 4Z2KA 4A3YA 2PDWA 1ZFJA 2GYIA 5ABFB 1EDTA 4B5WA 2FB2A 2GOUA 3INPA 4LVBA 4KT2A 1JD9A 4KWWA 1GOMA 2Q3RA 3EOUA 4A2RA 2GWNA 3AROA 3MJMA 4JY8A 1HX0A 2X2GA 3Q2DA 1E0UA 2E67A 3TW6A 4A3UA 1ADDA 1HJUA 4JEJA 3NXFA 4BS0A 4GO8A 2B7NA 1FWIC 2DUAA 2VURA 5BOFA 2WHLA 3PWGA 3DYMA 2C91A 4YL2A 1V6UA 1XFBA 4ML4A 2IKIA 3QQ0A 2YDSA 1RY0A 1W56A 1ZBWA 3RU8X 3WN6A 3LCWA 1DQWA 2W62A 3G0SA 3FEMA 4Q4QA 3ABQA 5E09A 2WVVB 1IZJA 3BOLA 3CUJA 3L2LA 4AZ7A 3MHFA 2D2JA 3PTKA 1KV8A 2XH4A 1POKA 3E02A 2VRQA 3UWUA 4HNLA 4WXZA 1B3XA 5CPSA 4HYRA 3EA1A 2E7FA 3VNMA 1GYMA 2TSYA 2BS9A 3ZVIA 3ZR5A 1K02A 3T78A 3LENA 1WKYA 4PE8A 1KTNA 1Z8AA 4JX6A 5DT7A 3W23A 4NIRA 1EP2A 4P7QA 5H91A 3WLSA 4DELA 2GWGA 4B3LA 3LCIA 2BHUA 4LUSB 4TX9A 5KZEA 2Q02A 1K3UA 1KGUA 4EF8A 4UTWC 3PFMA 3NFUA 4ZE5A 5A2CA 1C3FA 1NVMA 3NQ2A 4ZE4A 3AU2A 1M01A 2PCQA 4IGNA 4NUWA 4HNCA 2HE8A 3KVMA 1DXEA 4IIFA 3T0CA 1UKPA 4GQ0A 8XIMA 2PDNA 2FHBA 2R24A 1GVFA 4FXJA 5C5YA 4UQ9A 3RX4A 1X1NA 1NDWA 3R1ZA 3PPFA 5AY7A 3ARSA 4LBUA 3GHSA 5G4WA 4DWSC 1NQ6A 3EYPA 3UR2A 4MM1A 1H4PA 4LJ3A 1MXSA 2BY2A 2RDTA 3U9IA 3UZYA 4O52A 4HGXA 4QEEA 3SUVA 3VI2A 5HOSA 5DY3A 4JHMA 4BF9A 5HBFA 3E0IA 1XH2A 3NQEA 3KP1A 5D33A 1UWTA 2VVNA 5L9FA 1FFQA 4O50A 3B0VC 1C8QA 5AYZA 5CLWA 2VZUA 1LL7A 3B8UA 3QW3A 4JTSA 4EACA 3O6DA 2ZZ5A 3VNLA 4ZCWA 1DHKA 1AD1A 4HA3A 3QV6A 5LA0A 2W9MA 3K8KA 3DAQA 2VGIA 3R0DA 3CZ8A 3P8IA 2NXGA 1A5UA 2RJGA 3B03A 3F2DA 4KKXA 2QZRA 3PS7A 4KFPA 2QR6A 1TTIA 4Q8OA 5A6MA 3THDA 2X1SA 3EDEA 1RALA 4UQDA 5I09A 2NWRA 3CQJA 4IQLA 4LX4A 1MRQA 3TTQA 4X9YA 1SJDA 1VYSX 5CSRA 3RUBL 1ME8A 4MGGA 3CWOX 1MUCA 1J0KA 3ARQA 2YSWA 3II1A 1FFRA 4H7CA 1JFHA 1XBXA 2DP3A 2VFIA 1XCWA 1J0JA 4U3CA 1OD0A 2ZZ6A 3LZ5A 4YTSA 4KGJA 3GH7A 4OU1A 4MDOA 3PZQA 4F0KA 1A0CA 2NVDA 4H8VA 3GAKA 3WF3A 4UTWA 3NPUA 1ZTVA 4PFMA 4UCGA 4FXFA 3BCFA 2OEKA 3MUCA 3NQ6A 1PPIA 4QG6A 3HQ1A 1WO2A 2AL1A 3WYZA 4HHMA 4UTIA 1QNPA 1MW2A 2HS8A 3FEQA 4CD4A 3QR0A 1ISXA 3GZAA 3VGBA 3OP2A 5SWUA 3EWXA 4L61A 2DH3A 1K70A 3SI9A 2PTDA 5KSWA 3CH9A 1RD6A 4P8UA 4UMAA 3VIKA 1D2KA 3GIPA 3W9ZA 2J4GA 4LUJA 4GINA 4GNVA 3DC0A 3PR2A 3QLLA 3TKFA 4O1EA 3CLMA 4K39A 3VD9A 3TYZA 3B9EA 2GLKA 3W6YA 4PUEA 1QK2A 1KCKA 1TZ7A 1RSCA 4CLMA 3V7PA 3PUOA 4GK8A 3T07A 1UD2A 1JEZA 4JIHA 2WVSA 5E93A 1CDGA 3FXYA 1EEXA 1OFQA 3CZLA 4LXFA 4QDMA 1CGTA 2XIMA 1XLCA 4Z2LA 1VJSA 1AUSL 3H7UA 2NLYA 4U10A 2NX9A 4YIWA 4W89A 2OYKA 4O53A 4ERIA 2R9RA 3CAQA 4RUBA 4UZUA 1HL8A 2J79A 2OG9A 3FY1A 2J7DA 3DFHA 5DRCA 1XUUA 4CQDA 4AD2A 1REQB 1W1PA 3E96A 2WQPA 1FWTA 1K4GA 1QWGA 3QBUA 4NZ4A 3CZEA 9RUBA 1HVQA 3KX6A 1KM6A 4H4IA 1TYGA 2E0PA 2YIHA 1E4LA 2YDRA 1ITCA 4E2DA 2XVLA 3WLIA 1GPFA 4L7ZA 3UCQA 3CK5A 4IIBA 2VZTA 3CUFA 3TZNA 2UWFA 2C13A 3MYOA 2ZC1A 3G22A 1WB0A 3FN9A 4X2RA 3QC0A 1YX1A 1G01A 4EPBC 3N9KA 1G67A 1HJVA 4XKMA 1BEUA 4QE4A 1B54A 4JTDA 1KXHA 1LG2A 3ZJ6A 3M4HA 3NZQA 3K8LA 1IEXA 1W31A 3TNBA 4DJDC 8CGTA 5B80A 2R1LA 1RP8A 1ZNNA 4GJJA 4I3GA 3TAOA 2ZA2A 4CD5A 3IV8A 5E1QA 4E4UA 3ZT5A 1KD0A 3T9PA 1Q8JA 3F4CA 3AUJA 3VMOA 1B3OA 3KEHA 7REQA 2EJAA 1V5XA 3TN6A 3NDZA 1XDMA 3ITYA 4EAYA 2E9MA 3EX2A 2Z6IA 3NL2A 2PP0A 3HJZA 4Y9OA 1V93A 3VKJA 1B30A 4W85A 1A5AA 3K13A 5T26A 1E6NA 1CXHA 3D47A 4Q4KA 2I7GA 2XIBA 3S9ZA 1GJUA 4AZCA 1IWBA 1PE1A 3TW9A 3MB9A 5HULA 4DXVA 1P0NA 1XLKA 1A3HA 3THUA 1P48A 4NJHA 5DN1A 4S39A 3BLIA 4IMCA 1XJBA 3CH0A 3T2PA 5CG0A 3AMKA 3DENA 1BLIA 1EYEA 2DIEA 3PULA 1BGGA 3STPA 3OGSA 4FX6M 2JKEA 2WPGA 4PL2A 1GKRA 4BR1A 2V67A 4NHVA 4JICA 1VFHA 3T0TA 3BOFA 1IHIA 4S3KA 3OVRA 3A4WA 1YRRA 3GNRA 3ITTA 1YEYA 4REQA 3EB2A 1B3ZA 3V36A 8TIMA 2PCEA 3L2IA 4IPLA 1KFWA 4GYFA 5CH9A 3F1QA 2HMCA 1I6NA 1S2WA 3EX4A 2PAJA 3UPWA 1C7SA 1W1VA 3AWNA 3CS2A 5DBUA 3LSBA 2PWGA 2EXOA 3PB0A 1XPGA 2FVMA 3WH8A 4UUIA 4UTTC 3S42A 4AIBA 3OBEA 1ZJIA 3NA8A 3N2MA 3VILA 4DJDA 1CGUA 1IEWA 2PTWA 2Y63A 4IIEA 1UA3A 3DGBA 3S2CA 3MUZ1 1TTPA 1G4PA 4KFNA 4JHOA 5F4XA 3UZZA 3RRAA 3HG5A 3AISA 3EDDA 4QS5A 3W1MA 3CAKA 4B91A 4O8AA 3H2EA 1BG4A 5JBDA 5ABFA 1P6CA 4DO7A 3OU8A 1KRAC 2C79A 4JN8A 2ZTJA 4GCAA 1C8XA 4PFHA 3MU7A 4P2VA 1Q2RA 3CPUA 3MO7A 3QQ1A 5DMYA 2VO5A 1OFOA 1F76A 5AC6A 1FCUA 1Z48A 3F2CA 2CERA 4AZ6A 1PL9A 1E5JA 4HA1A 3WO8A 1ZCCA 1OC5A 1LUCB 4J27A 3QLDA 4HCLA 1UMYA 2F9RA 4I5XA 3GFZA 1I2RA 3ITVA 3BO9A 1HN1A 1IGWA 1UCWA 1FCBA 1U5HA 2A85A 4R9XA 4DI9A 5D03A 4JL1A 3XINA 3OOQA 1V3MA 2WW5A 3ME3A 4LAUA 3C4UA 3W01A 3AXHA 5HA7A 3ZZ1A 1EOMA 5LHEA 4AZGA 3URQA 3WNOA 1J6PA 1UG6A 4NT0A 1F6YA 1CI1A 3BG5A 3NEHA 1C7TA 3ELFA 3BSHA 2XVGA 2Z26A 3W1AA 2EGZA 3OTRA 4LY8A 4GFIA 3OEXA 1KQYA 4JTIA 5EBAA 2L5HA 1BRLB 3LOTA 1J96A 3ITCA 1KFKA 2CHOA 3NQAA 2CXGA 3AIBA 3KOXA 2PC4A 4AU0A 3W1PA 5DY2A 3WL1A 3DZ1A 2RJHA 3TYCA 1RBLA 3IJIA 1W1B1 1YQ2A 3E1F1 5D9OA 2Y70A 4CVWA 3HJEA 2ZZ1A 1MSSA 2EG6A 2PLJA 1OB0A 1I2OA 2JGQA 5LA1A 4TVUA 1VYRA 4N6EA 1KBLA 3GU9A 1EJXC 1KR1A 4XQ6A 3GQYA 5REQB 3FJ6A 4QIUA 3M0LA 3AZTA 4W5ZA 3SFKA 3WCZA 4REQB 2GJXB 3W2LA 4N9BA 5DX7A 3VKKA 5I3JA 4KWVA 3SCVA 4MJ4A 4AX6A 1O1HA 4AUBA 2HISA 1E72M 3HN3A 2FB3A 1MZHA 1ZPTA 3GYCA 4NXKA 1PYFA 2CBVA 5IM51 4XTIA 4S2CA 2FFIA 4HCDA 1MQQA 3UZJA 2PC8A 5CBIA 3LTYA 3HV8A 4IMAA 4UTFA 4F40A 4UCFA 5KZDA 5TBOA 1MXGA 1V0KA 4V27A 2VGFA 3SCNA 1Z42A 3U6WA 1IYXA 5E0CA 1V4YA 4RXFA 3MPGA 3EAUA 3S9IA 2VZSA 2ZZ3A 3IUHA 1KW1A 1VCFA 4CKQA 4F2TA 3M9YA 1EWDA 1WYIA 2CLPA 4AVOA 5TD4A 2PDMA 3MDWA 1DQXA 4DBDA 4OV9A 2PF8A 7TAAA 3AMCA 2NVCA 2MNRA 5EA9A 3M41A 2Y7GA 3D3AA 5TNVA 3F4DA 4GQBA 4N2YA 4AZHA 5E6YA 1B2YA 4ZENA 4GE8A 5AOUA 2WKJA 1I60A 2JF7A 1CNVA 1KV5A 3W7OA 5KINA 3O07A 6TIMA 2CZFA 2V2DA 3FHAA 1DBTA 1IF2A 4FO4A 3T1GA 3VOIA 3KWSA 1RAKA 4JTFA 3JU2A 1R85A 2YL6A 4QNEA 4A2SA 1EUNA 2AMXA 1OCNA 1MQPA 1UUMA 5LGZA 1GWJA 3E9AA 2YR1A 3CB3A 4FSAA 1YDVA 2EPOA 4L5ZA 1N55A 4A8LA 4IXHA 5E0KA 3TX9A 2WNNA 4AEFA 3REQA 4AHOA 3PBWA 1XGDA 2AAMA 2PDBA 4RZ4A 1W32A 4K7VA 1OIFA 1DJIA 1W2PA 4F0RA 4MY8A 1FXQA 1LJYA 1U33A 3FDKA 3QMSA 4DWDA 1FP8A 5A3HA 3FAWA 3T0AA 1Q7MA 3ZSTA 4PR4A 1WNOA 2Z1SA 1G94A 1LWHA 2P0OA 3I3EA 4Q7IA 2V38A 3S2NA 4NYYA 3WDQA 2RHGA 1K1DA 2X7VA 1G7UA 2E4TA 3SUWA 3QMRA 3UNDA 3NO1A 3EXSA 1VD6A 2O9RA 1H61A 4NJIA 1JI2A 4GD0A 4GG9A 4IWWA 1XHGA 3O63A 3REQB 3RO6A 3DG3A 3UCCA 2BVWA 4LYKA 4MYXA 4WR3A 3VX0A 4D1IA 1XIEA 2Z00A 3UXKA 2O9TA 4LU0A 3EB3A 1KRBC 1J11A 4PB4A 1JPKA 3H21A 4L9XA 3N14A 1TIMA 1R2RA 2ALRA 5AHEA 2R14A 3W2NA 4L6DA 1F6PA 2ZICA 4LV9A 3FAXA 4DNHA 1LOSA 2MANA 2GUYA 3UR8A 5DCEA 4RX0A 3GH5A 1TIWA 3K1DA 1OFEA 3FCPA 2Y8KA 4US5D 2NXIA 1J0IA 3FDGA 4XAGA 4TV5A 2P76A 4U28A 3FYPA 4XKYB 5F7UA 1QI3A 5HUPA 4OUIA 3NQ8A 5BXRA 1V02A 3TC7A 1Z44A 3F5LA 4F0HA 4A3QA 4S3DA 1TFVA 3RYSA 1T41A 4GIAA 2OJPA 2RKXA 5CC5A 3B8DA 1F2JA 4GUHA 4QCFA 4YWIA 1W1TA 3CASA 4I5RA 3TZFA 3CWHA 1W9VA 3M0XA 3H7RA 1XIMA 4MJZA 4U2YA 3H2FA 4QJ4B 1FWWA 5CSSA 3H54A 2BHZA 3ABRA 3NQDA 1WKFA 1TMQA 5HUOA 4GH1A 4UBPC 4GRSA 1GUVA 4DZAA 1RA5A 1LP6A 5AFDA 3AYRA 4Y9NA 5H1WA 3SRFA 4FOJA 4DB7A 2B0MA 2XGBA 1GG1A 3WF2A 3QSRA 2J62A 1I9CB 3DYOA 3FGCA 4FNPA 1QW8A 3EX6A 5I07A 1RHCA 2Q71A 1IR1A 5F1UA 4IT1A 5HQMA 5AVNA 1JDEA 4ZVJA 4B9YA 5AHFA 5JVLA 3KM8A 2O92A 4Z2GA 3BW2A 3R0UA 1EB3A 1JG9A 3GC5A 2A3BA 3HG3A 1H5VA 2BOFX 2DSUA 2VELA 2NQ5A 1ZUAX 4H2HA 1QNOA 3ZR6A 1WAUA 4LV4A 3FV9A 2D23A 4KCWA 3P14A 4JBRA 3UGRA 2D69A 3L4UA 3UPMA 1R3QA 4Q4RA 3VCCA 4AH7A 4ZTXA 4UXDA 1T8QA 1XWYA 2PBOA 3NVDA 1XSIA 4J1OA 3CUZA 1AL8A 1TVNA 4ECLA 3Q94A 2C1HA 4JTUA 2O9OA 3W84A 4EE9A 5CPMA 4BK9A 8A3HA 2GJLA 5CEWA 1IT8A 3AUOA 4M81A 2PTYA 2B7QA 4MIMA 3M64A 4QJ1A 2CW6A 4BA0A 3M7SA 1J0ZA 2V5CA 4GI9A 4E0CA 2Q01A 5BU6A 2OQLA 1RCXB 3TYUA 3M0ZA 5CAKA 1OQFA 1EF2A 2PWVA 4PRWA 7REQB 1ONRA 2V6AA 4UOJA 5M5DA 2Q3OA 1O95A 3W87A 1V6XA 3F4VA 2NSOA 4NAEA 1XLIA 5HMFA 2PP3A 3MZNA 3VKDA 4MSSA 4WSKA 4WGXA 3SQLA 3PJTA 2QJMA 4IXXA 3FLUA 3FA3A 1E9ZB 4QS6A 1IE7C 1F8MA 2I57A 4A8NA 2BY0A 4FNTA 7CGTA 3RRXA 1BVNP 3LBMA 4N7QA 3BGGA 3G8RA 1ZJHA 3WUBA 2QCCA 4PSRA 2WMHA 1FBAA 1XF0A 2BLEA 3GNOA 4UQBA 1OYAA 1FQ0A 4IFRA 2H9AB 3F5KA 3NZ1A 1WZKA 2DORA 3LGDA 2DZAA 4G1NA 4UTUA 1XYBA 2ZRVA 2WJZA 1UQZA 1FKWA 1GVYA 5D4YA 3N6HA 3ID7A 5DEZA 3WJYA 4PMZA 3BCDA 2WNQA 1KM3A 3ICJA 2CIPA 2V0TA 2J9ZA 4EF9A 1OHLA 5KZMA 1AQMA 1UBSA 3IJ6A 4UFJA 3NR0A 3T81A 2G37A 3GNDA 1XI3A 2Q8ZA 4LSBA 3LHUA 2PODA 1RPXA 2YYUA 1JZ8A 3C2EA 3G6MA 4PMDA 1VZWA 4UFKA 4DM2A 1LZOA 3CU2A 4Q8VA 3APTA 5HWJA 4S2BA 5FEXA 1UKTA 5F4SA 2Z27A 2PDFA 1H1YA 1A4MA 3V75A 1NEYA 2O0TA 5E9AA 1E6QM 3IK2A 3M7WA 3RR4A 1W3HA 1I75A 7XIMA 1PIIA 5HNTA 1J5TA 3POCA 2PU0A 4ZQPA 4QE5A 2WCGA 4DLFA 4M19A 3GR4A 4OKDA 3P74A 3GZ3A 2YXOA 4KETA 3OPSA 1AK5A 3ENLA 1XFCA 1BKSA 4IIDA 4O1CA 1EJWC 2PWFA 3GNNA 2QHAA 1UD4A 2NV9A 3S0CA 4M0XA 1M3UA 3ARYA 3LGEA 1XRSA 4GGBA 4RL3A 3WD2A 1JCMP 1AQ0A 3LQLA 4LTSA 2FLIA 2WVUA 3E2SA 4BEQA 2PWUA 1IIGA 3WD0A 4IJRA 3BH4A 4OFCA 4WKHA 4FIRA 2WKGA 1NELA 3SR7A 1KQZA 2YB1A 1XBYA 1L9WA 2VX4A 3B9NA 1FWCC 4E2OA 4ZTYA 1FWNA 1E40A 2ADAA 3P6LA 4F9JA 3GTIA 1HO1A 1KCXA 1JZ5A 4GUIA 4WDWA 2FZMA 3LA4A 2ZZ2A 3KRSA 3N1AA 5FF0A 4PTVA 5LGXA 3CL8A 1P0KA 5FJOA 1TWZA 2ISSA 4OZOA 1OF6A 3ITXA 2R91A 4D6JA 5D30A 1E0TA 1ZU8A 3GXMA 2PDJA 5K9XA 3G24A 1SPQA 2XVPA 1DTUA 3WQEA 3UG4A 1CW2A 1EBHA 3PZVA 3UXIA 4IMGA 4MLRA 4JFUA 2FTPA 1F61A 4JYFA 4XK2A 5D9NA 2PU1A 1P1XA 3RM8A 1BTMA 1O5RA 4ZSTA 2PDGA 3IAQA 4GJ1A 6XIAA 3LTPA 4J3WA 3CUXA 1OABA 3AYSA 3OO2A 2X40A 4JTKA 3UZ5A 3FS2A 3BICA 3MV11 4H01A 1BAGA 3W02A 1RQBA 2UY2A 2OO0A 2ONEA 4IOTA 4PEKA 3UXAA 1XKYA 2ZZ7A 4N4QA 4XV0A 4LC6A 4XZNX 3VGGA 3W7QA 1W1YA 3RPDA 1DIOA 3B8VA 4O18A 2Z0IA 2DSKA 2EPKX 4QLLA 3FA5A 2BVDA 3NQ7A 3BG9A 3DHFA 1RBOB 3LCGA 1C29A 5A8PA 1A5CA 3FVMA 1VRDA 3TQ0A 1EOKA 2B81A 3PZOA 2V3GA 4XAFA 5HATA 4IQJA 3EGJA 1O12A 4WUIA 1AODA 3VU2A 2PZ0A 2X1RA 3DESA 2VHLA 4GZ7A 4GX8A 5BMXA 4I7WA 4LPCA 2ZRXA 2C15A 4YXGA 1UQYA 3KBVA 5BRBA 1E4MM 3PM6A 2BB0A 3ATZA 3UESA 3QC3A 4A8IA 1Y65A 3PJUA 3W71A 4HN8A 3KCOA 4LY4A 1UKQA 4J7RA 2VWSA 3NQVA 1Q7QA 2WJDA 1KWKA 1VPXA 1M7XA 3CQ0A 2OMAA 3L4WA 3ZT6A 1SZEA 2C8NA 2QPXA 2OX1A 3WLHA 3KBJA 2E1DA 1PX4A 4DZHA 1O66A 3APYA 1NOUA 1LQ2A 1W5QA 5E9XA 1BKHA 5I5RA 4NJJA 4ZBCA 3LV5A 2W91A 1DJWA 3U2CA 3RM9A 1LTDA 1C93A 2FDSA 3C56A 3RCMA 3CM4A 5E5CA 3OBAA 4K8HA 5I2UA 1GGOA 3WNNA 3CT7A 3SY8A 3DDMA 3ZLFA 3FYOA 5GJMA 1WXJA 2GK1B 5BW6A 4FLQA 2VUYA 3MBFA 3LHZA 4HSOA 3CL7A 4DHGA 3IVSA 4JCLA 3W7IA 1ISYA 1E9IA 4G1KA 2KX9A 4D6EA 3STFA 4LVGA 1JIBA 2ZZ4A 3N29A 4WXYA 4IIHA 3VFCA 5BOOA 2XFYA 3M44A 1GEHA 2FHCA 4OT7A 1V3KA 4Q32A 4JQ2A 2O4QA 4GQGA 4Y6GA 4H9VA 3GU2A 2BASA 3VIGA 4YS1A 3BPWA 4AMAA 3H70A 3PZNA 5C55A 3B9AA 1V3JA 2J47A 1K9FA 1UP0A 2ZQ0A 1QOXA 4ZL1A 3W76A 1RQHA 2JEQA 5FJUA 3RLUA 4GVFA 2D2GA 2F6XA 3H53A 4GXWA 3K4AA 3NNTA 2BVYA 1E1EA 2VGBA 4KCTA 1NJJA 2ZA3A 1V6WA 2GL5A 4MG4A 1UD3A 5MKGB 5BXTA 1P6BA 3USBA 4HPHA 1AH3A 3AWOA 4QCEA 1EA9C 3KL5A 1OC6A 1E0VA 1JL8A 4HZMA 1GKPA 4JFTA 3L7RA 1JULA 3KRUA 1KFEA 1KTCA 4OBSA 1JNDA 4C60A 1XQLA 3WH7A 3OVGA 3VDAA 1WZMA 3QKEA 3APGA 3CYVA 3PAJA 5K7JA 1C90A 1ZAHA 4UTTA 4E2BA 1FP9A 1ISVA 3MUXA 1RA0A 4M24A 4N9CA 1PS9A 3OW1A 1TTJA 2XN1A 1Q85A 3BLFA 3WLOA 2XDFA 4FIQA 4YWSA 5D05A 1G4EA 4LF1A 4KCUA 1UR9A 2IKHA 3LCLA 3THAA 4DXXA 3HA1A 4KPLA 3VO0A 1DXFA 3R0KA 4S3GA 4WZHA 3TXZA 2DSWA 3TONA 1QATA 1JAEA 3U2ZA 1R3WA 3FIGA 4W9TA 3NL3A 4B4HA 3WENA 1ME7A 1IR2A 3WLQA 1OYBA 4GPNA 2IXUA 1PX3A 4W4QA 4GNJA 3HQPA 3AICA 1MUMA 1W17A 4R53A 2GFTA 4MNLA 1SJCA 3VNDA 3BVJA 1XIHA 3GH4A 2OT0A 1VEOA 5HNNA 5LZLA 4HK5A 4AYGA 5G4EA 3U0HA 2ZDRA 1X98A 1EJVC 3LS9A 1WPCA 2YLAA 4XAPA 2CITA 2XN2A 3M5VA 4AD1A 3BC9A 4URIA 3EPMA 3FYYA 3L23A 4K8EA 4MB3A 2C3ZA 4HHPA 2PDKA 2IKGA 3UP8A 3V35A 2PUZA 1X8CA 4W7VA 3PTMA 1YW1A 1T0OA 1M03A 2QJGA 3SAZA 3O9NA 1J10A 5IRPA 3URBA 3OG2A 5B7YA 2HVOA 1QO5A 4YTRA 1XINA 4X22A 3C61A 2GUUA 2WSQA 2DSZA 2CLOA 3ZWSA 4AF0A 1CXLA 3LYEA 1IV8A 2C19A 2GQAA 2VC9A 1E56A 2A1YA 2G41A 3OLGA 3OA5A 3VDBA 4PTDA 2VDHA 2ESCA 3SGGA 3VDHA 1ELSA 1JUKA 1AMKA 2VNCA 3EDKA 3LNMA 1SZGA 1G69A 1Q6OA 1R5YA 1YTDA 3Q58A 2BXVA 4FALA 3B8WA 3LBOA 2HXTA 4XSMA 3VD7A 3UQNA 3E2RA 1XRFA 3KS6A 4AHPA 3AIVA 2OSWA 3QHOA 5LNWA 4JD4A 4C6KA 2VP8A 1ZL1A 1UC5A 3D3FA 3RHGA 4J2PA 3WQVA 2E9LA 4WDTA 3GX9A 4EK7A 1DKWA 1TPEA 3TNOA 4HYWA 2WCSA 1XLDA 4O1BA 3TDFA 1OBAA 4M80A 4PUJA 5FOOA 3U7BA 5D32A 1XP3A 3N04A 2V8ZA 1TRIA 4JTHA 1U2YA 3NQBA 1K7EA 1DORA 4HNTA 1B3VA 3RCNA 2WNWA 4EWJA 2WC3A 3NOYA 3W82A 1EHAA 2WVTA 5MHBA 3O8AA 4BQ3A 1PDYA 1QHOA 4LB3A 2VD9A 2BSLA 1L2UA 1WKEA 2WYSA 3SUTA 5I3DA 2Y1HA 3JZEA 3AXIA 1TJ2A 1BTCA 1YBQA 4GZIA 1UW9A 3HQOA 1AQFA 2TPSA 3V5CA 3PC0A 2DGAA 3Q4DA 1RK5A 3G1HA 2Q8LA 4GI4A 2DW6A 3T42A 1G1YA 1WDRA 4IJBA 2PLKA 4JHZA 3V1HA 4D8ZA 1VC4A 1VPQA 2V30A 1R7AA 2YFNA 4D8AA 2G8ZA 1QHPA 2VC5A 5TIMA 4RR4A 1ONXA 3UJ2A 1N82A 3WMSA 3KL3A 4Q4MA 1JZ7A 3DG6A 4LWWA 4GUJA 1UROA 1K03A 5JXQA 3OJGA 2E6FA 3L68A 3VUPA 2ODOA 3CZJA 3PB2A 4GLEA 4WDUA 1EWEA 2Y89A 1NM9A 3WNPA 1VIZA 1W9UA 3GLCA 4EP8C 4F0SA 4DF2A 1I2PA 1Z3NA 2PDUA 1HJXA 5BNKA 2F6KA 1BYBA 3GNXA 1X96A 2X2YA 2ZFAA 1V6YA 3S1GA 3EWZA 3OZMA 5AB3A 3TCEA 1V03A 3O2LA 1KXQA 1NTHA 3UWYA 3VIIA 4EOUA 3RMJA 2D24A 1EF3A 4RZ5A 4O57A 1R9ZA 3VOFA 3AQUA 4K1WA 3ARRA 2OTDA 2XIJA 2PDYA 3ZS4A 2H6RA 3S1UA 1A5OC 3BZJA 4HA4A 3PP7A 1UBPC 3VKCA 1JXJA 4LBRA 3R8HA 1L0PA 4FX8A 4NZ1A 4WRHA 5G1YA 4IICA 4PA8A 2H90A 4FPSA 3RFAA 1MEWA 5HNUA 1Z9AA 3G1FA 4GMEA 5HPOA 2XIOA 4AEEA 1UP2A 4E4PA 4QAWA 4ENLA 1PZ0A 5A2AA 2EO7A 1WDQA 1CT5A 2EEXA 1NQKA 1DYSA 4XG1A 1E1CA 4FAMA 1HIZA 2C0AA 2DFAA 2Q8XA 2QDDA 4HK6A 2WXDM 3BLEA 1OFAA 2VMFA 2DT1A 1XYCA 3IJDA 1AMYA 4Q8QA 1H3GA 1UJQA 3UFYA 4UQAA 3I4KA 2POTA 1LBMA 4PYSA 1MW1A 2QVHA 4DBWA 3DIPA 1EIBA 3VPLA 1X7IA 2QUMA 1ICSA 2WK2A 3DBPA 1D8CA 3TSDA 4AHQA 1SSDA 1QPKA 3B0PA 4QG9A 4K7YA 1UR0A 3UXLA 1GVRA 3WQ6A 1P4CA 4E8GA 2CHRA 3IJ8A 2ZVRA 1VFMA 4GZJA 1O4UA 3W38A 4QITA 1GCYA 3MQTA 3VM5A 3DH7A 1MYRA 2FKPA 3CL6A 4BWLA 4K36A 4JFVA 4BI7A 2F6UA 5EBUA 3PZGA 4DAFA 2RAGA 4O0KA 3PZIA 5J5DA 2D0FA 4CN4A 2E68A 3OZYA 2YA1A 4DYJA 1HVXA 1OG6A 1OZMA 2EBNA 4MMWA 3ARXA 2HXUA 4O1AA 3M0HA 3IJQA 3EKGA 1NWRA 4RDYA 2XISA 4NRSA 3BUVA 4IL2A 1D7FA 3PNZA 2F84A 4Q4SA 5D2TA 3A21A 4HU0A 4RDZA 1U83A 3WUFA 1OFDA 1XGEA 3ZOAA 3GO2A 2CLEA 1KO0A 1UD5A 3T0BA 3N18A 1HT6A 2OPJA 1UR3M 4LVDA 3U5YA 3WLPA 1OINA 1M7OA 1WUEA 4DLMA 2OZ0A 4GNKB 3LCHA 3PUDA 4BY3A 2FZDA 1S3TC 1EPXA 2OSYA 1GQJA 4GVIA 5M2FX 3BTNA 1X7FA 1TPFA 4EPEC 5EMJA 1R46A 3VABA 4MZ8A 2HSAA 4ADUA 4NNCA 4HPNA 4KIRA 4W8AA 4LRSA 2A3EA 3KOWA 3OZPA 6XIMA 3QYSA 1QPRA 1BF6A 1DJHA 3EOOA 4O13A 1RK6A 3AAMA 1ECEA 2PLCA 2AAAA 3A3XA 1NFBA 1XXXA 3VKAA 1KGXA 4GKTA 3AHXA 3S5ZA 3A23A 1I2QA 2ZE3A 2WB5A 2DT0A 1HXJA 3V4BA 1BFNA 3WQ5A 3QOMA 1TPB1 1XBVA 1R2TA 3OQ8A 1W3TA 2H9AA 5C9UA 2BV9A 3TC3A 2OO6A 3TTEA 3LPFA 2YBVA 1UZDA 3DI0A 5CJMA 4Q8WA 3LPOA 1Q3NA 3TR9A 5KMYA 1R0MA 3DFNA 4BWLC 1GZ1A 4TR9A 3SIMA 3VGEA 4DBUA 3MMDA 3NQMA 2JKPA 3QYQA 1P6WA 2P10A 5I7GA 3W28A 1VEPA 4TVCA 3N11A 4UFHA 1GVEA 3UF9A 3BJSA 4H8HA 1JPDX 1PXGA 4KRTA 3GY1A 3C3UA 3KCLA 3PZMA 4L1XA 3LERA 3ZT7A 2EKCA 4W84A 1OG0A 3LDVA 1HNYA 1QXLA 1ESWA 3GKAA 1O7AA 4PC8A 1YPFA 2F8QA 5A8OA 3H8AA 3SB0A 1H0IA 4TU1A 3TJXA 4C6CA 4MWAE 4HHLA 3C2RA 2J9YA 4MNKA 1PEZA 3NIYA 3LRLA 2VFHA 4XSLA 1YMYA 3JUGA 1LUCA 5H8PA 2FQIA 1FWBC 4ILSA 4P5UA 1O94A 1PDZA 4PB3A 2E5BA 2V3EA 4JR5A 4AQLA 3LUTA 3ARUA 1ZGDA 1VBGA 3UEQA 1U5VA 3L5AA 3WDPP 1OVDA 2PFHA 3EDFA 2VGGA 3QY7A 2ZDSA 1L2QA 4BF7A 3V0TA 4NAFB 5KETA 3H2NA 1NH6A 1OM0A 3BLKA 4XTDA 4J3TA 3BMVA 1FDYA 3AS0A 4MDPA 4MFDA 3W7CA 1F4AA 1JAKA 4DF0A 1SW3A 2H3BA 4HIBA 4HHHA 1O5KA 3E5BA 4YYCA 1K8CA 2DV0A 4NZ5A 3LMZA 5REQA 4DUOA 1TTQA 5DCDA 3GG8A 3SECA 3COTA 3WK1A 2I14A 1SJBA 3CNYA 4AX7A 1DIDA 2WWDA 1EX5A 4FP1A 2ISVA 1LBFA 3BJTA 4U5IA 4PMNA 1EYWA 3M6YA 4S3BA 4XAZA 3G1YA 2W63A 4JFWA 5JU6A 4C6OA 5BCAA 4H1ZA 3AOFA 1JQXA 2D2OA 4LC8A 4UR9A 5G2HA 2GQ3A 4H9UA 1A0DA 4YNGA 4HSHA 1B5TA 3BLDA 1VLIA 1CB2A 2NVAA 1HQTA 4GQRA 3WD1A 3TEVA 5M03A 3UPBA 3G1VA 2WMIB 4JNMA 4I6KA 4F2UA 2PE4A 4IH3A 1OCBA 3RNDA 2BGSA 4Q4OA 2DT3A 3RILA 4L4LA 2ZKMX 1E55A 3NQGA 1ODZA 2FH8A 3BAXA 2F38A 5CGQA 2R8WA 1P1MA 4MY1A 4JX4A 1KBIA 1XLBA 3VZZA 4AC1X 1YXCA 3A13A 2QXWA 4IMDA 2VFGA 4C6LA 5FEZA 4AZCB 1GVIA 1I2NA 5FKYA 5KZ6A 4DBEA 3GIQA 4GIEA 5FAGA 2G0WA 1E9YB 4B2DD 4YJ5A 3L5LA 5H8MA 3KW3A 1TKKA 4ZQOA 1WOAA 4UFLA 1HW6A 3EWCA 7PTDA 1KKOA 5CC3A 2INZA 4HMEA 3GXPA 4PGLA 2D22A 4ZZ9A 4QLJA 4KQNA 2WKLA 2OOFA 1H1ZA 5T9CE 2WSKA 2OLAA 3NPVA 4I9TA 3SM0A 1X8FA 4JYEA 1Q5MA 4IZGA 1IEVA 1H50A 2NLIA 3DERA 1V79A 3IGHX 4AF0B 2H8ZA 2A7PA 3T2QA 2I17A 4AFYA 2ZTKA 4PTXA 3U57A 3NL6A 3NSNA 3DC8A 3E3HA 2RFGA 4C6DA 3G0XA 3M0YA 1EDQA 1A5MC 4R27A 1ZB5A 2YDQA 1HL2A 3KVKA 6TAAA 4IP7A 2G4JA 2QULA 3QZEA 3O15A 3PBGA 2QS8A 3B05A 3L2MA 3ZJ7A 2JE8A 2V63A 3NXLA 4GY0A 4DYEA 4XB3A 1FWJC 4GYPA 3GVVA 1Q6DA 1ONWA 5AC8A 3QZAA 1DJZA 5I0DA 2W5FA 1C92A 3BDKA 1DQUA 4H9ZA 3B0XA 4NYUA 1E15A 4C5YA 1RUSA 1Z41A 5CBJA 3HPZA 4DVOA 3NURA 2VVSA 1YKWA 1MMFA 1JJKA 4CUCA 3MMTA 1UWRA 2Y5JA 1EQPA 1GHRA 5HDRA 2V3DA 4BZYA 1UPMB 3CPRA 2ZIDA 2YA0A 3PPGA 2P1FA 2CC0A 2Z25A 4HNNA 1IT7A 1DTNA 1O5QA 2BX7A 3IJ9A 3R12A 4PMQA 4O19A 4PMVA 1FWSA 4UIOA 2GVGA 4C90A 4UR8A 2PPGA 1NAL1 1US0A 1GEQA 3OBKA 3TVAA 1MFVA 5FEWA 3SRDA 3W1RA 2G3NA 1DJGA 4XZIA 3SQMA 6CGTA 2WZMA 1H7OA 4NU7A 3RX3A 2WV8A 4ES4A 3SUSA 3W3OA 2ICSA 4AWTA 1S3HA 4XO7A 5FF2A 2Z7GA 3H4WA 1KFLA 2ZXAA 4UTLA 4H9XA 3A64A 3KHJA 2QUNA 3P82A 4J5NA 1TWSA 3WFLA 5I24A 1KM1A 1S2CA 2J7GA 5JH2A 1I1XA 4YN5A 3J7HA 4XD5A 3SFWA 1US3A 4PTNA 3UYCA 2ZUVA 1W9DM 2A3LA 2XM2A 1NDYA 1JQVA 4TOQA 4MJ2A 4ADSA 1EDGA 5M3WA 1BVWA 4LS0A 1GOIA 3ITGA 1FOBA 3N2XA 2DZBA 3TW7A 3S5SA 2RGLA 3E6EA 3GU1A 3U5UA 3QGVA 3EEGA 2YCIX 1ODUA 1LOLA 1WZLA 3SADA 3TFCA 3B4UA 2XWEA 4GYPC 3NO3A 5FF3A 2AGKA 3UWQA 4R33A 1RJRA 4DBSA 4X2PA 4B9ZA 1XR2A 4M7SA 3SY5A 4NI3A 4O10A 3C0JA 1HUVA 3S46A 1UH2A 5D37A 3TLLA 1TQJA 1M04A 3PSVA 3RK8A 1R38A 3PWAA 1XLHA 5LIYX 4JQAA 3I7QA 3MWCA 4R7WA 1EGVA 3WMLA 5I6SA 4LNCA 3STCA 3FHQA 4R7JA 4H6KA 1V77A 2VCBA 4Q33A 5CJNA 2OGYA 2OWXA 2JBMA 1XW8A 4Z1YA 2EG8A 4CN1A 1F9CA 4Y9MA 4JTAA 3ZQ9A 1SR0A 2P3ZA 1FHVA 1VB9A 3DGRA 4YLWA 2UY3A 2NT0A 3VNYA 4L64A 5J04A 1P5BA 2KZHA 4H8UA 4J28A 1B9ZA 2PZNA 1J01A 4NILA 4ZXOA 1XD0A 3HTWA 4XZHA 2A3HA 3DFQA 3LG3A 3EB4A 2Y2WA 4N4PA 4NKCA 4NJGA 2ALDA 5BXPA 4MB1A 3ZFHA 4TXEA 3VNJA 3SCSA 1J5SA 3WNMA 2ATMA 1R47A 1EGZA 3NZRA 1UOKA 5EB8A 1J18A 1WXYA 4W88A 4HVXA 5C6MA 1SZNA 4CN6A 1S5NA 4QSHA 2OWCA 3IEBA 4ZB5A 3VA8A 3KRZA 3PN8A 4H41A 1YYAA 1GONA 2YL9A 1FHUA 4WCJA 2NXHA 1TA3B 1J0HA 3CC1A 3LHVA 3R4IA 5MKGA 1F7BA 1R3YA 4GX9A 1GNXA 1VHNA 1H5YA 1SO3A 4P7OA 2PDQA 3LY0A 3NSMA 4J40A 5CBBA 1QPNA 1XX1A 5KTLA 4GCXA 4DUXA 4C7FA 2YOCA 1JD7A 4J35A 1W3LA 4UMBA 4Q7BA 2HK1A 1WAWA 4R3UA 4RE3A 2X0SA 5A95A 4KWUA 5EYWA 3LM7A 3R10A 4LT9A 5HWMA 1LQAA 1OSEA 1K8ZA 3W7DA 5A8NA 4RZBA 1Y5VA 4FNUA 5FSDC 1E6XM 1VFOA 3A5VA 4C7GA 3IRDA 5EMUA 2NV2A 3DHDA 4R9OA 2NQ9A 3CQHA 2D20A 1OADA 1CTNA 2BXZA 2WJEA 1XM3A 5C54A 4FNSA 4M5PA 3SDOA 1V51A 3GG7A 3CTTA 2BG5A 2O56A 1J8VA 3DEQA 3A3WA 4PL1A 1KXTA 3CXOA 3V18A 2OFJA 2J7CA 4BCEA 1AH4A 4WDXA 3WFZA 3WBXA 4M82A 3NGJA 1P0DA 1SU5A 3TCSA 1YPIA 1K9EA 5CPOA 1LL4A 4PMUA 1K8YA 3W00A 1VFTA 2YXGA 2VOTA 1CGYA 1RLCL 3MP4A 3IV3A 1E43A 1NIUA 3K46A 2A0NA 3QY8A 4PBEA 2KAUC 3GUGA 4LAOA 1XSKA 3LBCA 2YXXA 1J12A 2DZUA 3HZ3A 3HGJA 1MWOA 4DPPA 3WQGA 3EMQA 1I1WA 2FHFA 3KUMA 3LV6A 5TAOA 5IHSA 5CXPA 2ON3A 1AZ2A 1GVSA 4U3AA 5GQBA 3SN0A 3F4NA 4NY2A 2Y7EA 5EY5A 3M0MA 5LNRA 4O8RA 4LBSA 5F2MA 4LF2A 1DIEA 2HK0A 4LAMA 2HBVA 3UNTA 2PD5A 2V2CA 1JCLA 2FTWA 4FXRA 1FWRA 3GFXA 3ZJ8A 2VDIA 1OX4A 1H2JA 3G3MA 1Q13A 3GW3A 3U7VA 1WV2A 3W86A 3QPZA 1FUYA 3SURA 2CCRA 3TV8A 1EJSC 7ENLA 1GOXA 2BOEX 2O7SA 4UTKA 5HMDA 5IHRA 4Z0JA 1UHVA 3LD5A 3ZWTA 2ISWA 2J24A 3IK4A 4X9SA 3N19B 1GZGA 4ZO8A 2OT1A 1N2VA 4TVDA 3K5XA 4CVUA 4IG2A 5LHFA 3N2CA 2P8BA 3SJ3A 5TF0A 1SMDA 4QQ3A 2UY4A 1DP0A 2WMKA 3PK7A 1A5LC 4AD3A 1MDLA 3TJ4A 2BTMA 2R6OA 3W70A 3BURA 5BZAA 1UZ1A 1J2BA 2ZUWA 3GB6A 1DEDA 1EQCA 3GVQA 4B5UA 1F8IA 1ZZMA 6PTDA 1CLXA 4IHCA 2Z28A 4D72A 4S3FA 5XIAA 1ADOA 3WJWA 4MTVA 5I78A 2V2HA 5IFPA 4HJWA 2DU2A 3VD5A 3BSMA 3NEVA 1RBAA 1BYAA 2PWHA 2WNZA 4PRTA 2QF8A 3EWWA 3C2FA 1AD4A 3GHTA 5HWNA 1ALDA 2ZWYA 2VUNA 5CQ1A 4B5VA 3DFTA 4Q3MA 5CZJA 3L67A 5CSUA 4PCFA 4NP7A 3MI6A 4LS2A 4NAFA 3SY1A 3LPPA 3FKRA 3QW4B 1W37A 1MZRA 4GO9A 4AW7A 2C71A 5LIWX 1PAMA 2RUSA 3S5NA 4NZJA 3IIPA 1R3TA 1IZKA 3NAVA 3W1UA 3U4AA 1SFSA 2JIEA 3LN3A 2J8FA 4EXAA 4LCRA 3SRKA 1XLMA 1DXIA 4UOQA 4HA0A 2CFFA 4HTYA 1TQXA 2G95A 2H8XA 3TH6A 3B8TA 3S8HA 2A7RA 5GNZA 1EIXA 1PKMA 4YTUA 2WC7A 1VHCA 1US2A 3BW3A 3CHFA 4E2VA 5KEZA 3GM8A 5DMNA 3GTXA 1W9BM 3CYJA 1XISA 2I56A 5DRIA 4L9YA 3CHDA 2BBFA 1H62A 1KGWA 3FKKA 3GVGA 3T0DA 1M41A 4MLJA 2Q6ZA 5EMMA 4GBUA 1YPXA 5DXYA 4LAKA 4WHBA 3KZPA 3H2OA 5JIWA 3TQPA 3DFYA 2FVLA 1YDOA 1TRDA 4HU3A 2BY1A 5LNVA 1QNSA 4K6AA 4EAMA 4KWOA 1HTIA 1XCFA 2FYMA 4E38A 1QU4A 1TB3A 1G4TA 2J13A 4ADTA 3VXGA 5BRQA 3WK3A 4QJ5B 1AJ0A 2VC7A 1VBJA 1H7NA 5HQLA 4PUWA 3B06A 1MXDA 4WD0A 3W27A 4H8NA 1YE4A 2FGLA 4GKLA 2W61A 2DPEA 4C6PA 3WL0A 3MUIA 2AMGA 1D3HA 1EEPA 1OYCA 1E6ZA 3DHPA 2YBUA 3FXGA 3TIMA 3CUIA 4XZBA 4MYAA 2QEZA 2TYSA 1U1HA 4PUDA 2OGJA 4QSFA 3IGSA 5I79A 2IPGA 2GQ8A 3KL0A 3P8JA 6REQA 1TVPA 1C9WA 2OYMA 1ITQA 3Q67A 4Z2HA 4IX0A 1SQ7A 3WJZA 1OWQA 1H7XA 3W72A 4KEMA 3S3GA 2QQ6A 3ABZA 3IARA 2X0YA 3JW7A 4BKNA 1XIJA 3NYZA 1ZP4A 3L0KA 2J78A 2RDXA 3VIMA 5D2WA 5BROA 1DWAM 2BHYA 5EPDA 3U8GA 3EDJA 5MF5A 4AVFA 2FPYA 3CB8A 2PWDA 2OQHA 3LHTA 4IF2A 4L80A 1FVPA 4PULA 4ZOEA 4HMNA 3UA4A 1TVLA 3GTNA 1Q66A 4X0NA 3W1NA 4QFUA 4U33A 2AKMA 2XH0A 4DPQA 4A6GA 1O1ZA 1OCQA 4FS9A 1W5PA 2EAWA 3UZWA 3LK6A 3W7HA 3EXTA 3ZO9A 3OA3A 2VR5A 3LI1A 5C0QA 5DMLA 1SVDA 3QR1A 3I10A 3FJLA 3QKZA 1K9TA 1WDPA 3RG6A 3N12A 3UZXA 4AISA 3VFLA 1HO4A 4CGTA 2J6XA 5RUBA 1VBHA 5D9MA 1W54A 2AL2B 3S2MA 3TQKA 5HR7A 1ZBVA 2ZC8A 3S5YA 2VXNA 2WMGA 2FJUB 2Y85A 3NL5A 1HP5A 4PUMA 2A5HA 5AHNA 1XUZA 2P53A 3TJIA 2AQVA 3PPHA 3B9OA 3H2MA 3I3BA 4MJMA 4K1GA 3EKLA 4FHAA 1TUXA 2CEQA 4DRSA 4D71A 1TX2A 3FJNA 1E3XA 1PKLA 5BMWA 4IISA 4DJDD 4ASTA 2X42A 1WA3A 3B97A 3QVQA 2WMJA 3GTHA 3H23A 3W2MA 4DJEA 3TWBA 4F79A 1ZS2A 1K77A 3M0VA 1JCNA 3RM4A 3E0VA 3W7JA 4FZIA 4W5UA 4W93A 3WEMA 1KCZA 2YA2A 4CD7A 2I9EA 4ML9A 1HJSA 1TJPA 3TAKA 3VX1A 2JQXA 2WLZA 4D6FA 3GC2A 3SCTA 4MF4A 1JPIA 3E2QA 4RV8A 3SGUA 3TA9A 3OLDA 4C6QA 5AVHA 3TU9A 3MKKA 4PUUA 4JTRA 3UG8A 4E4FA 1JUBA 4D6DA 1FH9A 2DZTA 4TTUA 3VZYA 5JBEA 1JDCA 3BGAA 3TLQA 2V3FA 1VFSA 2ACUA 4PCPA 5D2XA 2FMOA 5C71A 5HPCA 1BD0A 4YU1A 3LM3A 4Q6XA 2V5JA 1KM5A 2EF9A 3U48A 3OODA 4L56A 4AY8A 2Z24A 3O6AA 1XIDA 3M0JA 4TIMA 1H7WA 3A47A 1SW7A 2E9BA 1LROA 1OZQA 3IS4A 3MHUA 1FRBA 3NJ3A 3HOJA 2DUXA 3GWQA 2IKJA 1GVOA 2F2KA 2QGYA 3H22A 4TTGA 3HG4A 5J5RA 3P2VA 4QLKA 5C7VA 5HJLA 3AZSA 3PG8A 3K2GA 4YVVA 3DOPA 1R3SA 5EFDA 3NM1A 4ZGYA 5A6JA 3RN6A 3W2KA 1UA7A 1TMLA 3LMYA 4KIEA 4HBKA 4F8XA 1JCYA 1OD8A 2V69A 1N7KA 1H0GA 1CLKA 3WEZA 3V1PA 4M6PA 2WHJA 3VNZA 1NF0A 1XYZA 2C7FA 4H00A 1KM2A 2I5QA 3H7VA 5LXEA 1NY1A 3QPYA 1KLYA 4GBDA 4C6EA 1KM0A 2A2IA 1Z6KA 3FNDA 3KTSA 3WSUA 4J3UA 3BV7A 1W5MA 3KWXA 3GS6A 4JIQA 2AQWA 3IGXA 3BAKA 1UD8A 1P0BA 5LIUX 1PWMA 3AI0A 3QF0A 2ZWZA 3LXAA 3HPFA 4Q8NA 4M29A 1ME9A 3L12A 4W7UA 2HNEA 4JNZA 1IZCA 1F07A 2ZX9A 3SZ8A 3L4XA 3GBDA 5H8UA 1XYLA 2XFWA 4UNLA 3WBYA 4JIEA 4CU6A 5D38A 4G8TA 1ZHAA 3GD6A 1XH1A 1FDZA 2EPLX 2Z2BA 1M68A 6A3HA 2WPBA 3XIMA 4G7EA 4FLRA 4RJEA 1B4KA 3SN1A 4W7WA 3TN4A 4JQ3A 1CENA 1ENUA 4N6FA 2CZ5A 2Z2UA 2ZXQA 4IMFA 2PA6A 1S2AA 4IQEA 1OC7A 4MKSA 3AIRA 2XVKA 3E12A 5HQEA 2CZDA 2VEIA 1HF6A 2Z2AA 1AQHA 3DFSA 1TV8A 5C2CA 4JTJA 3OHIA 1XS2A 3ABXA 2BY3A 3T05A 4L65A 2J6VA 3BLOA 4JTGA 3FA4A 4A3HA 2X09A 3ZLGA 4RCXA 3GRIA 3LPGA 3F4WA 2Y7FA 3DFOA 3N17A 1JDDA 1H7PA 1S1RA 1S38A 2QPUA 4INFA 5GNYA 1JCJA 3OLEA 2FIQA 2NUXA 2HCVA 3CPGA 5JIPA 1RQEA 3SUUA 3B4YA 4V33A 4PUNA 4MUPA 2GZXA 2Z1VA 2OEMA 1MDRA 4MNJA 4JXCA 1SYTA 3FJ4A 3PBMA 1TREA 1AVAA 2YGYA 3SEPA 1KCLA 5ENLA 1LRTA 3THCA 4IFOA 1G7VA 1W1ZA 4H3DA 2FVKA 1XQKA 3QEZA 4C91A 2B7OA 2J27A 4QDWA 4B5TA 4CNTA 5K2ZA 3UG3A 4XVDA 3O06A 1XLLA 1UZHA 1QFEA 3QHNA 4DUWA 3URNA 2J7HA 3TA6A 2NT1A 4L4MA 4U5KA 4IL0A 1VJIA 1TPH1 2AKZA 5AN7A 2PDPA 1Z69A 2BVTA 4JCMA 3KBSA 1GJPA 3PJWA 2GK1A