2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase class 1
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
5FEPA 1MXSA 1ZENA 3KRSA 1H1YA 3SJ3A 5LHEA 1XUUA 4OWGA 1VH7A 3BARA 2YW4A 3TKFA 4O8RA 3DHDA 2GQ9A 5AHEA 3LB0A 2AAMA 1NAL1 5HULA 2BSLA 1RR2A 2CLEA 3IEBA 3UY7A 2H90A 2YGYA 3LCGA 4H6KA 3TQKA 1G67A 2QCGA 3B03A 5G4WA 5HR6A 4O28A 4BR1A 3KVJA 4UFHA 1G4PA 4DPQA 1GVFA 2GPTA 3I7SA 4IOTA 1M7PA 2YDAA 4FF7A 1L6YA 3PSVA 2NXIA 3HB9A 3I6RA 5CKSA 3Q94A 2WOQA 3NZ1A 4O1DA 2QJIA 4Z1DA 4JTJA 4MVAA 3TQVA 4NX0A 4UFIA 1SO4A 1KW1A 1SU5A 2O7SA 4GC4A 4Z1AA 1YTDA 1DKWA 5F2MA 4O0KA 1HUVA 2TSYA 1TQXA 1ICSA 4PC8A 3NL2A 1OFDA 5HR7A 4JTEA 3QMSA 1FXPA 5FF7A 4HT3A 4O53A 1M7OA 1JVNA 1KA9F 1N7KA 3FEMA 4Y9AA 4XTIA 5DCBA 4FNUA 3L0KA 4CCCA 3PBVA 1RV8A 2E5CA 4Y90A 3PM6A 4DXVA 4JDBA 1VCVA 4AEOA 1R2TA 3P62A 4BFAA 3L2IA 1SZFA 1PV8A 4UFLA 4UMBA 1I2NA 1VQTA 4ZVJA 4HSOA 4O11A 1SW3A 5I3FA 1EB3A 1XDMA 4CNOA 1YXDA 1WAUA 1ONRA 5HUOA 3W9ZA 2QCFA 2GJNA 5AYYA 4JEQA 3LBMA 3WJYA 2PRLA 4O15A 1OVDA 3DFPA 3DKJA 1H50A 2WNNA 2Y85A 5AN7A 3W23A 4RZ4A 3B0PA 2X30A 3MBFA 1JUBA 3L67A 2ZZ4A 2CLKA 3W7GA 5BRBA 4UTIA 4UCGA 5AC6A 2ZZ2A 1HTIA 3QEZA 4X3ZA 3G22A 4JX5A 4NJHA 5AHMA 2A7RA 4ICNA 1WQ5A 3LERA 2OX1A 6TIMA 1GWJA 5L9FA 2CZEA 4LVDA 3N9SA 3VFLA 2ZZ3A 2GQAA 4OU1A 5E0KA 1Z44A 2VELA 1Q45A 2EF9A 2H6RA 3M44A 3LTSA 1LCOA 1JR1A 3SGZA 4AVFA 1QOQA 1LRTA 3TAOA 3O07A 4PH6A 2VC6A 1XBXA 1YLVA 3I65A 5D2YA 4UFMA 4B5NA 1LLWA 2OJPA 1OJXA 2A0NA 1W5NA 2J6XA 3C56A 3DFSA 3MBDA 1TB3A 4MKNA 4BWLC 3NQDA 4K7YA 1BWLA 4O14A 3QSTA 1Y0EA 4UNKA 4DO6A 3G0XA 1GG0A 1H51A 1X8FA 2Y7GA 4HIBA 5K9CA 5AHNA 4NNBA 1TYGA 3RU6A 3G18A 5HWJA 4Z1CA 1TJPA 1FWTA 4UMCA 2IQTA 3LCHA 1JRBA 1FDZA 1W54A 1VCGA 3RK8A 1VYPX 1JULA 4EVZA 1PCWA 5EY5A 1OX5A 3UXDA 1W3IA 3GAKA 5DY3A 1K3UA 1Z42A 3EX4A 2OT1A 2DZTA 1H62A 3W7RA 1GPWA 2NXHA 4O50A 4LUIA 2DU2A 2Y6ZA 3U2OA 3GLCA 3TAKA 3KAOA 1TQJA 5HUPA 3TX9A 4OBTA 1ZY9A 2WNZA 2DZWA 5SWUA 2J27A 1H61A 3EKLA 3LI0A 3NQ2A 2PURA 2O7QA 1P1XA 4FIRA 4ADUA 3SFKA 1YDOA 2ZTJA 2NXGA 3STEA 3W7MA 4RK8A 3TH6A 2FB3A 3AO0A 5D32A 1XBVA 3DKLA 4QJ1A 5LNRA 3NQGA 4CCEA 2FDSA 4DEFA 1XDLA 3UWZA 1OK6A 4N4QA 4RZ6A 5DN1A 3IVUA 2TRSA 4KFPA 2FPVA 4UTWC 1I2OA 3A22A 2DJLA 5KZMA 3B0UX 4PTNA 1DOSA 2Q3OA 1OX4B 5AFDA 5FEXA 1GTHA 1K7XA 1R2SA 5BOOA 1H7PA 2FIQA 1VHNA 4JYEA 1Z48A 1GQNA 4RX0A 5CPMA 1RZMA 2QUVA 4MZ1A 1R47A 3LXCA 2A6LA 3M0ZA 5DBUA 2QCEA 3ZR4A 4XKYB 1TJRA 2I1OA 1A5BA 2C16A 4NQ1A 5KITA 2A2IA 5HQEA 2HS8A 1QMLA 5CZSA 2CZDA 1AW5A 3C2VA 3F4NA 1H60A 4K6AA 4PODA 4DQWA 4AHPA 1XM3A 1EP1A 3LRLA 1TRDA 2QCNA 4JTUA 3QM3A 2YR1A 2X1UA 1H5YA 2I14A 4I7WA 2TMDA 2V2CA 3WJSA 2C1HA 4O13A 5D30A 3W84A 4ZL1A 2OZ0A 2WKJA 4MPQA 3IRDA 5KINA 2XFWA 4LOCA 5G4EA 1OYAA 4HNUA 5C2XA 1EUAA 4QNEA 1I4NA 2ZDRA 4X22A 1E51A 1KFLA 2E68A 2ZA1A 3W7HA 3I7QA 3R8RA 1GTEA 3P67A 4A3UA 2ZRUA 5EMUA 1XUZA 5FEWA 4O0ZA 5LGZA 5AYXA 1S5VA 4E0CA 3LRKA 3W2JA 3DFTA 2QAPA 1TPC1 1EP2A 1VJIA 3O15A 3BLFA 2R8WA 4LUJA 4JN6A 1Z41A 3N2MA 5I3KA 3ELFA 5EKYA 4RV8A 1X7FA 3WK2A 3LOTA 2CFFA 3EXSA 5DLCA 3MWAA 2QDGA 5BW6A 3CWNA 3RF9A 4AF0A 1VPXA 3LV5A 5K9XA 4NZFA 4K39A 4ONVA 1KM2A 4NZJA 5HINA 1DVJA 1LROA 5D37A 2Z2UA 4QQ3A 4GXMA 1FY6A 4MFEA 1ZCOA 1QCWA 2DORA 3S5OA 2HMCA 2Q8ZA 4M7SA 1FX6A 1T96A 3LTYA 4S2CA 3ZWSA 5FI8A 1O95A 5L6UA 4AWTA 2WO5A 2FB2A 2X1SA 2VFGA 3B8DA 1ZAJA 3PB0A 4POCA 3P8IA 1H7NA 6ALDA 3GKAA 1FCBA 2DZVA 4KWVA 4WUIA 3S1WA 3IGXA 3C8FA 3UWVA 4UTHA 3N34A 3WJXA 5G1YA 4O19A 1LBFA 3IVTA 3I68A 3BG3A 3M16A 1AW2A 3LM7A 4LV9A 2NX3A 3T40A 3W1RA 5C54A 2F84A 1TTQA 2OT0A 1SFLA 1A5CA 2YXGA 4FEZA 1LP6A 4NJGA 4A2RA 4MUZA 4W9TA 2WSRA 3MYPA 4K36A 3L5AA 2W79A 4YL2A 2RKXA 2LLEA 3F4WA 3NQ6A 5I3HA 4NX5A 3TJLA 1DJNA 3BLIA 3SY5A 1H7XA 1A5SA 2FPTA 2X16A 3N73A 4JIQA 5F1VA 4HKPA 3P7YA 3C61A 4UTLA 3C2EA 4FX8A 1P5BA 3W7NA 4TR9A 1XBZA 4DBDA 1VLIA 4O18A 5E1QA 3RFAA 3QQ0A 1SZEA 4AWSA 2EKCA 3TA6A 2HS6A 3C52A 1KV8A 2DJXA 2QCHA 2BTMA 2ZRYA 1FWSA 1YXYA 1N55A 1VGAA 3VCRA 5BMXA 1RVGA 1TMHA 3W88A 1NF7A 5LNWA 4NJKA 4JTTA 2QCDA 3N14A 4MY9A 4PL1A 4OV9A 4R33A 4O57A 1JCNA 3BO9A 1WV2A 2JKEA 1SFJA 1ZAHA 5EBUA 3LLFA 4HHPA 5K7JA 4NVTA 3BGJA 4K8HA 1TIMA 4MJMA 1FXQA 4A21A 1LOSA 1K7EA 2G96A 4LVFA 1QPRA 2H8ZA 2RDWA 2PC4A 2JKAA 3W71A 1NSJA 3L5MA 3IIXA 3TR2A 1JCYA 1TTIA 4P2VA 3W72A 2ZZ1A 3OVPA 4IUOA 2BXVA 3C0JA 3TMLA 4WJEA 3TK7A 5K4XA 2QR6A 4UR8A 2R14A 1O5XA 1TCDA 3SI9A 2JGQA 3M6YA 2ALDA 1SO5A 1SW7A 3KRZA 3G0UA 1Q6LA 3CIXA 5EYWA 4DBEA 3S1VA 4RZ5A 3O05A 3CIWA 1CI1A 1HG3A 3NA8A 2A7PA 1OK4A 4N9BA 3NQVA 2VOMA 1K8YA 1PS9A 3VNDA 1OFBA 1PE1A 1WXJA 2G97A 3CEUA 3HG5A 2J24A 3KVKA 1EWDA 3UWYA 2EHHA 5LHFA 4GUHA 2ABAA 5D2TA 3EKZA 3TC6A 1G6CA 2D73A 3QQ1A 4BWLA 2NUXA 3P74A 1Q6RA 3KHJA 4N6FA 2BX7A 1K02A 3E12A 3CB8A 1TPDA 1WOAA 2VEKA 5DXYA 1JQXA 5DELA 4JGDA 2VENA 3S5ZA 5C6MA 1UUOA 1O4UA 4WZHA 3WJWA 4WY0B 1GYLA 5H91A 2ZRWA 1THFD 3AJXA 3S5YA 1C9DA 1RQEA 2Y61A 3W73A 3W2LA 1PIIA 3W75A 3QPZA 3S0CA 1FCVA 3W7CA 3DI1A 3GXTA 4Y8FA 3TCEA 1F05A 3G8RA 1SPQA 4WXZA 2C19A 4G1KA 2YW3A 4O1CA 3OBKA 3LV6A 4O1BA 5LKYA 4LT9A 1XL9A 2Q8LA 4QAIA 3THQA 3ATZA 1MZHA 3S1XA 3F1QA 2ZZ6A 5A8GA 1LOLA 3V75A 2NZLA 1IGSA 1VRDA 3R5EA 1GEQA 3D0CA 1AL7A 1WX0A 3OVRA 3TNOA 1W3TA 2Y88A 3PG8A 3TU9A 1F6KA 3JS3A 1IXNA 2VFEA 1L2UA 5F2LA 5HJLA 5F2IA 3GNNA 2CZFA 2Y70A 3NPUA 1K7FA 4TMBA 4N9CA 1OF8A 3GDMA 2NWRA 5TBOA 2V2DA 3W87A 1WA3A 4FNPA 1DHPA 1PHQA 3QH2A 3BW4A 3W2MA 4JS3A 1LLZA 3FYOA 4TO8A 1OYCA 3MW7A 4A29A 2V30A 4UTWA 4OHQA 3UXAA 1AL8A 2YZRA 3T7VA 3C2OA 3THAA 1TPVA 2CWNA 4GJ1A 3T55A 4LS0A 3HPZA 1AMKA 1G7VA 3ABOA 5J5DA 4M19A 1ALDA 3NVTA 4L4MA 4CCDA 3BLEA 4ML9A 3U8GA 1D3HA 3LHTA 1DL3A 3A23A 4LS2A 2EAWA 3M5ZA 3W07A 1KFBA 4GWEA 4BI6A 1EX5A 2ZRVA 3QMRA 1O5KA 1KFJA 1B9BA 1V5XA 4CQAA 3CM4A 3B04A 2J9ZA 2TYSA 2E6FA 1W37A 3L68A 3C2FA 3EWWA 3TC7A 1ZFJA 4N9EA 3E02A 1MEIA 1UUMA 1OFQA 4M6QA 3WFAA 4YMZA 3R13A 3EWYA 3UD6A 4FHAA 2ZQ0A 3NGJA 4BK9A 3ABQA 2OCZA 3LCWA 3PS7A 4FXRA 1S5TA 3PUOA 2NV2A 3YPIA 1W3NA 5K4ZA 3R12A 4NXSA 3L66A 5E93A 2UV8G 3W1AA 3UPWA 2ABBA 4ZMGA 1VZWA 1I2RA 3P8JA 1ZALA 1KTBA 2QCCA 2E6AA 1Q6OA 4UC5A 1WDWA 1ICQA 4ZQCA 2J9XA 3PUEA 4R34A 3PVFA 1XI3A 1W5MA 3NL3A 4IQLA 2E09A 4JTSA 3FKKA 4PL2A 1LM1A 4HNTA 3STGA 3TSBA 5I3GA 5C5YA 1JJKA 5IBXC 4QITA 5LNVA 1W8SA 2C0AA 3BK0A 4AHOA 4ZQNA 4UUIA 3TFCA 3QPYA 3G1VA 3T44A 3U6WA 4U4MA 1HO1A 3QZEA 1F6PA 3C4UA 5AHIA 1HO4A 1LRQA 3E49A 2ZBTA 3CTLA 1G69A 3G1DA 1KBIA 1QOPA 3MJYA 3EX6A 3NQCA 3GIYA 3OA3A 2B7NA 5D33A 4NU7A 5KSWA 4M5PA 2V5BA 2ZTKA 1XC4A 5D05A 4CNNA 4CLMA 3DFNA 3G1YA 4O52A 2G5WA 4HNVA 3BW2A 1ICPA 2A1YA 1FCUA 3WK1A 3UPBA 1K8ZA 3QFEA 4JY9A 3LXBA 4GBUA 4M7TA 2FJKA 5AB3A 4XZ9A 1QWGA 1A50A 4HPJA 2RHGA 1AG1O 4JX6A 3MI2A 4GUIA 4LU0A 1DJQA 3M5XA 5BNKA 2Z6JA 4K8EA 3LXAA 4N9DA 1IF2A 3M7WA 1PVNA 4QIUA 1B4EA 4Q32A 3NPXA 1O94A 3SZ8A 1EP3A 3UYCA 5HNRA 2P0OA 3W6YA 3PBWA 3C2RA 3W1PA 2CZ5A 3GDLA 3S8HA 4H4IA 3MUXA 3ANYA 4LNYA 1J2WA 3W1NA 3EWXA 1W5QA 1TPWA 1PHWA 5DY2A 3NQFA 5IM51 2DZXA 1XXXA 4FO4A 3G1AA 3MYOA 3R2GA 1OFAA 3NL5A 3S5NA 1T8XA 4AB4A 1TREA 3TW6A 1W56A 3L5LA 4MIMA 4DF2A 1QR7A 3TDFA 2ZRXA 3W1XA 3DXIA 3LGEA 5MHBA 1KM6A 4UTKA 2RH9A 4RXFA 4D2JA 3BV4A 3PG9A 1LOQA 1TRIA 2WV8A 4HNNA 2X2GA 1H1ZA 3C3NA 2WJZA 3CU2A 3SW6A 3W7PA 1LTDA 3TW7A 3PR2A 2J9YA 1ZHAA 3O8AA 4GUFA 5LNUA 3IIPA 1IXOA 2VEMA 1SW0A 3FFSA 4NT0A 3HG3A 2ATSA 1TTPA 2PRMA 1KFKA 1GYNA 4Q33A 1P0KA 2CU0A 3M9YA 1UBSA 5CSRA 4WY0F 2V5LA 3DFQA 3EWZA 3T78A 4I7VA 4Q4KA 5LNSA 2VFHA 3UY8A 4TU1A 4TIMA 5LSMA 3O63A 3W1MA 1GOXA 4XUGA 2PE4A 4A22A 1X1OA 4UTTC 1PL9A 1IXQA 3L21A 3PB2A 1JRCA 1WOBA 2QF7A 2Z0IA 1OFRA 3JRKA 3KRUA 5AC8A 2VXNA 1YTEA 3EWBX 2QJHA 1FWRA 3FKRA 1VC4A 2FLIA 1NF0A 1WBJA 1OFEA 4WOZA 4E38A 2H3BA 4JTLA 5CZTA 3L65A 1VHCA 4R7JA 3WK0A 4QM1A 3L9CA 3W76A 4O1AA 3FJLA 5G2IA 1F2JA 2Q3RA 4MLRA 1CX9A 5HWMA 3CT7A 2VEPA 5DBTA 4ADTA 4DO4A 4MY8A 3LDVA 4RXGA 3CHVA 3NQMA 4K38A 3LHVA 3NPVA 3UNDA 3QYQA 1KM5A 1BWKA 2QUTA 1YTKA 5GVJA 1A5AA 4IXXA 2BLEA 3O6DA 3W1QA 3G8EA 1S3HA 3DFOA 4GRSA 5HMSA 1TSIA 1OX6A 2YYTA 2C14A 3EEGA 5CPLA 3RLVA 1KTCA 1YDVA 3ZFHA 1XFBA 3SIZA 4O4VA 4YXGA 2EGZA 3HPSA 3A21A 3PY2A 2ZZ5A 5I3IA 4KFNA 3DHFA 3S6DA 1NEYA 2AQWA 3LLDA 3P61A 1MO0A 4IMGA 3M47A 3W7OA 3G3DA 3NZRA 1J5TA 5K3VA 2FQIA 4UFKA 4JTKA 2ISVA 1FWNA 3NOEA 1I2PA 4C1KA 3GX9A 3CC1A 1L6SA 4IX0A 3USBA 1AK5A 2VKZG 1QPNA 2C3ZA 3B05A 2I9EA 2JK2A 3S42A 1KM3A 4OQVA 1XCFA 3PUDA 1NVMA 4OE7A 4X9SA 3W83A 3P84A 3SGUA 3HMJG 3LTPA 2BWGA 3P60A 1YXCA 4MFDA 2Z6IA 1W5OA 2W6RA 1R30A 1QDSA 1F74A 2W0UA 1I45A 4JDYA 2DZSA 1VYRA 2ZZ7A 2C18A 2E1DA 3STCA 1TPUA 4HSNA 2ISSA 1UCWA 2FFCA 4CQ8A 1LBMA 3GYEA 4DF0A 1F73A 3IGUA 1V7YA 1ZNNA 4ZQPA 3FYPA 5F1UA 1YDNA 1LRNA 1VLWA 1IIGA 3EB2A 1TPEA 2V82A 2B7OA 3NEVA 2VEIA 1EA0A 3DH7A 4LV4A 4YLWA 2QEZA 3EX2A 2A21A 3CEPA 3LCLA 3W86A 3O6CA 4U28A 3B06A 2P10A 3TUUA 1DQXA 4LVBA 4UTJA 1OFPA 3G1XA 2CLOA 2E5DA 2JGYA 4UNLA 4RCXA 1HFBA 3R89A 3W7EA 2JKPA 3W85A 1SO6A 1OX4A 1ME8A 3M5VA 2YX0A 3IGSA 4JR5A 2RDTA 1LYXA 5D03A 4Z0SA 4XKYA 3LCFA 4ZZ9A 3PBYA 1UJPA 3M1ZA 3W7QA 2B7PA 1B57A 4JTHA 4LC6A 4AMAA 5FEZA 4N02A 5K2ZA 2HSAA 3DAQA 1UB3A 1EWEA 4JYFA 5EL1A 3DU0A 1LZOA 3P5YA 3NQEA 4L4LA 2GVJA 2NV1A 3NO5A 5CG7A 5EPDA 1OABA 2B4GA 1SZNA 4WX2A 3G24A 1TPFA 2V9DA 1RPXA 4NXKA 5IBXA 5FF0A 5G2WA 4IMEA 2CLFA 4O10A 1T99A 4BI7A 2ZYFA 3BG9A 3G0SA 4Z0JA 3VKJA 2TPSA 4QSHA 3WK3A 1XKYA 1OG0A 1B3OA 1QNVA 3HGJA 1TO3A 3VE9A 1LBLA 4HPXA 2A85A 1FDJA 3PF3A 3HPXA 2CLMA 3TFXA 1O60A 4FIQA 4MOZA 3BG5A 3M43A 3W1TA 1DBTA 4IPIA 1TV8A 2R91A 5CPOA 1K03A 4IMFA 1PCKA 3P82A 3HGSA 2GOUA 4MZ8A 3UWWA 4AH7A 3FOKA 5H2ZA 5D02A 1FBAA 3QF0A 3FA5A 4JY8A 4LC8A 4LTSA 4N6EA 4XBSA 3W7IA 4LW7A 3NL6A 4RJEA 3NR0A 2ZFAA 3HJZA 3IVSA 2WSYA 2CLIA 5C55A 1QFEA 2QJGA 4K37A 2HTMA 3MHFA 3Q2DA 4JNMA 1QPQA 1GZGA 5AC7A 2DZUA 1YPIA 1GVQA 3LHWA 4FNTA 5U4NA 4NJJA 3TROA 1H7RA 2X1TA 4MJZA 3HG2A 4MYAA 3PBUA 3HG4A 3TJXA 2P1FA 1G4SA 5A5WA 1KLZA 3W7DA 3CQ0A 2GQ8A 2NX1A 1X6UA 5FF4A 3DGRA 3LCIA 3GNDA 5CSSA 4X2RA 3QSRA 3TV8A 1KM4A 4DELA 1OF6A 3VI2A 4PFMA 3DENA 1SSGA 4JD4A 4LRSA 5J5RA 2E5BA 2Y7FA 4H3DA 4Y96A 1KTNA 4O16A 3TIMA 3TSMA 3G1HA 3GR7A 3INPA 3K30A 2NUWA 2C13A 4AF0B 1VS1A 2H3DA 2V8ZA 4RLIA 3NYZA 4IWWA 3W70A 1FCQA 3O1NA 3HBLA 3OIXA 3LHYA 4LRTA 3QJAA 1YADA 4DF1A 1GVOA 4IMDA 3MI3A 3QW4B 4EF9A 3GB6A 3P81A 2PRHA 1MEHA 3TSDA 2Y7EA 4ADSA 5FF3A 3CLMA 3HO8A 3UWQA 3UZ5A 3P80A 4LS1A 4OGZA 1JCXA 2B0MA 4ZQMA 1QAPA 1DV7A 4IPJA 2QCLA 3T4CA 1KLYA 3MP4A 2E6YA 1F7BA 1I8JA 4UTTA 3BGGA 3MHUA 5FF2A 2C15A 4EWND 1M6JA 3TMQA 2QAFA 4QNWA 4XWUA 3PC0A 4JTGA 3N19B 3UZJA 1RD5A 5G1TA 4RKAA 3W7JA 2YSWA 2YFOA 2XN0A 1TTJA 2Y63A 3GKFA 4IGHA 2H8XA 3O16A 4O12A 2WPBA 4PA8A 3W74A 3KFTA 8TIMA 1BTMA 4Z1BA 3HQ1A 3ATYA 4AHQA 3LX9A 5D04C 1C29A 4ORMA 2GJLA 2ZA2A 4S1FA 1U83A 5FESA 5AHFA 3NPWA 4XBKA 5BMWA 5LZLA 3Q58A 1ME7A 4N2YA 3V1PA 4ZQOA 3NQAA 4N4PA 1IXPA 4GUGA 2XN1A 1FDYA 2V81A 4YWIA 4BI5A 3W2NA 1H7WA 3HOJA 2ZRZA 5DCEA 3DBPA 2QCDB 1VCFA 3EWUA 3QMTA 5ABTA 3A5FA 3MI6A 5AOUA 1S5WA 4JTIA 3B0VC 4UR7A 4WOQA 2NLIA 3HGOA 4LY8A 2WSQA 4NNAA 5DXXA 3LHUA 2NX9A 3NQ7A 5F4SA 1H7OA 3RNDA 2PCQA 2EPHA 2J88A 3M5YA 3W2KA 3S9YA 1KFCA 2QUUA 1ML1A 3GXNA 4CQ9A 1RQBA 1C8VA 5CZ0A 5D2VA 4RR4A 4FNSA 4DPPA 2CW6A 4UIOA 1AW1A 4FB7A 2XN2A 4WY0A 2Y7DA 5EA9A 3OG3A 5LGXA 3GXPA 5T26A 1RQHA 3EXTA 2Z1BA 4AAJA 3B4UA 3EXRA 3S1UA 5CGQA 3H53A 1GG1A 2OMAA 2QCMA 5TQLA 3GDRA 1LDCA 3GDTA 2VFDA 1EIXA 1KFEA 2QDHA 3ABSA 1W31A 2WQPA 1JCMP 3A5VA 1UASA 1JCLA 2E77A 1SZGA 5CZJA 3A9IA 1FWWA 5AHLA 5AYZA 4FX6M 2RFGA 3RMJA 1JQVA 1HL2A 1Q6QA 1DORA 1D9EA 1GVRA 2NUYA 3KVLA 4I9AA 3IV3A 4JX4A 1SO3A 3PSWA 2X1RA 3FS2A 4Y6GA 4JIPA 1D3GA 3LI1A 1K8XA 1XBYA 3NQ8A 3MP5A 1MEWA 4ZQRA 1JCJA 1KV5A 1T0OA 4M6VA 1SUXA 3GK0A 2A4AA 5KZDA 1P4CA 3LCXA 1OFOA 1VYSX 3TQ0A 2R94A 3MO7A 3NNTA 3PWAA 5G2HA 3VE7A 3E0IA 3G1SA 1GVSA 1WBHA 3IIZA 4ORIA 3TE9A 3BW3A 4O17A 4OT7A 4OV4A 5KZEA 3C6CA 3E96A 4Z08A 3UWUA 4CNPA 2GVGA 1EUNA 2FPYA 5KTLA 1TPB1 1KBJA 4WXYA 5K9DA 3Q37A 4IX2A 4UXDA 1NFBA 5D38A 3EX3A 1L6WA 1OHLA 2V2HA 1G4EA 3N9RA 2A6NA 3H54A 1JUKA 3W22A 4MLJA 3SSJA 4XQ6A 3GZ3A 1B4KA 4O54A 1X1ZA 3KX6A 4LVAA 3M41A 3PULA 3H55A 4EF8A 3W1LA 3OEXA 1TV7A 3EX1A 4KFOA 4E2DA 3N2XA 1JUEA 3SR7A 1KM0A 1I2QA 2NWSA 3E9AA 2QKFA 4AXKA 2GUUA 3W1UA 2AGKA 4LWWA 1BKSA 4J9JA 3NG3A 2VFFA 2GVLA 1CW2A 4ALDA 4UTMA 2B7QA 3W7KA 3DZ1A 3NXFA 3OVQA 2G95A 1ADOA 1KM1A 1MSSA 3GVGA 3MHGA 5D2XA 3KOFA 5TIMA 1Q3NA 2DZPA 3L0NA 1R2RA 2KZHA 5DCDA 1W1ZA 3W7LA 2A7NA 4KKXA 4R53A 4P61A 1G7UA 1QPOA 5F4WA 1GJPA 5F2GA 1OYBA 1QO5A 3QW3A 2Y62A 1ME9A 1ZAIA 2ZA3A 1H63A 2BZNA 3LBCA 1J4EA 4PCFA 3LRMA 4WQ6A 3TXVA 3HIJA 4UFJA 3HGRA 3LHZA 5U7SA 4NUWA 2V0TA 4E2BA 1FUYA 3QRHA 3NAVA 1SR9A 3RLUA 4M6PA 3UQNA 4S2BA 4UMAA 3N3MA 1VR6A 1BEUA 2YYUA 4TX9A 4JICA 4MZYA 3FIGA 5D2WA 4JXCA 1EPXA 4XTDA 3ZWTA 3GR8A 4WD0A 3G3MA 4IMCA 4I7UA 5I3JA 4IJBA 3FJ6A 3GAYA 3KVMA 3GDKA 3W3OA 5G5IA 2C6QA 3MMTA 3NM1A 4GNJA 3W2UA 4UTUA 2YFNA 1G4TA 3ABRA 2DP3A 3A24A 2ZCGA 1A53A 3STFA 3SECA 3ZS4A 4PEKA 1F5ZA 2Y89A 2E6DA 1U5JA 1TPH1 3F03K 4HN4A 2WNQA 5D09A 1W5PA 7TIMA 4YCOA 1GT8A 3CWOX 1P0NA 1SSDA 4JTFA 1QO2A 2YCEA 1N8FA 3O6YX 4MY1A 4BF9A 1LORA 2ISWA 3WJZA 2RDUA 3CPRA 2CLHA 3I7RA 1IIHA 2CLLA 2YPIA 4FNQA 4TMCA 3HF3A 4DO5A 5F4XA 3L0GA 4JYDA 1F76A 3NM3A 4KWWA 1ZJIA 3JR2A 3QC3A 3P5ZA 3O06A 3PAJA 4O4WA 4C1LA 4FX7A 4GE8A 1M5WA 4A2SA 2F7FA 4GUJA 4QISA 3IIOA 4GFSA 3BVJA 4K7VA 3TXZA 5HWNA 3IIVA 4NJIA 3OHIA 2FTPA 1R46A 4FXSA 5KMYA 1YPFA 2VFIA 4LVGA 1L9WA 1YYAA 4IXHA 3MP3A 3FLUA 3DI0A 4MYXA 3NDOA 5CPNA 2A5HA 1WYIA 1FQ0A 4EOUA 2ATMA 4FNRA 4AWUA 1DQWA 1SQ7A 3KXQA 4YCPA 1W0MA 2JBMA 1EEPA 4EIVA 1TV5A 4NNCA 3BPWA 3G1FA
chains in the Genus database with same CATH superfamily
4GY1A 1MXSA 1AFSA 1ZENA 3S5SA 5CBIA 4US5D 2E1WA 5LHEA 1XUUA 2CXEA 3A3HA 3AIVA 3NIYA 3WO8A 5AHEA 3MSYA 1RR2A 2CLEA 3IEBA 4U3AA 3QHMA 1RLDA 4BKNA 2E4TA 2PDJA 4TTUA 2W27A 1RBOB 3B03A 1B5TA 1HX0A 4O28A 4IIEA 1UMYA 4DPQA 3CQHA 3IJDA 3PSVA 1CECA 1RLCL 2GJPA 3H12A 2WOQA 3NZ1A 3FA4A 3Q94A 3CHDA 2EBNA 3I4EA 4Z1DA 4MVAA 3PWGA 5HNTA 3TQVA 2E9BA 2WKGA 1KW1A 3ICJA 1DKWA 3H2MA 1FP9A 2PTDA 3BSGA 3NL2A 1OFDA 4HPGA 3NEHA 1FXPA 2J47A 1XLDA 4GY0A 4KH2A 5DT5A 2DT3A 3L0KA 4CCCA 1RD6A 2G3FA 1J10A 3PM6A 4JIIX 1VCVA 4AEOA 1DEDA 2V5DA 3P62A 3L2IA 4XD5A 1SZFA 4LQ1A 4IISA 4UMBA 4HSOA 4WKHA 3BOXA 3WNPA 5DRCA 1XDMA 4CNOA 3PFRA 2O9PA 4AU0A 5AYYA 4JEQA 1E15A 4IT1A 3LBMA 4HMCA 4D6FA 1UR2A 3VNZA 4UOZA 2Y24A 1BXNA 3BMWA 3URQA 4IP4A 3DKJA 1H50A 5HXMA 5AN7A 1JZ7A 2ISFA 2YDRA 5HAOA 3W23A 3B0PA 1JUBA 3E6EA 3W7GA 4UOQA 5BRBA 2ZZ2A 4U3CA 6XIMA 3G22A 2CHRA 3W53A 4JX5A 1EJUC 4NJHA 5AHMA 5LA0A 1DXIA 4R5EA 4BHYA 4AISA 1GWJA 1QWKA 4ZCWA 1S5MA 4OU1A 1TV3A 3OZPA 1Q45A 2EF9A 1Q7MA 3M44A 2IPJA 2PWVA 5M2FX 1M53A 1LCOA 2XH2A 2WPGA 4HGXA 3E74A 1XBXA 1YLVA 4J5NA 4B5NA 1LLWA 3GG0A 4A8IA 2A0NA 4LH8A 3S46A 3URAA 1TVLA 3DFSA 3O0KA 1W3LA 1XH1A 3A4JA 4DUXA 1QATA 1IYXA 4ZOBA 5BXPA 3UFYA 4HD5A 1GG0A 1H51A 1X8FA 4HIBA 5I0DA 1J8VA 5AHNA 3SQSA 4F4RA 4UQDA 1HVQA 1TJPA 2DIEA 2PDUA 1MI3A 3LCHA 5A8NA 4J3XA 5AVNA 3I6EA 4GABA 3UCDA 3UXDA 4PSRA 1U1HA 3UVIA 1E0WA 1H62A 1ZLPA 3PP7A 5DMLA 4IL2A 4LUIA 4MKSA 2Y6ZA 3GLCA 4DRSA 2YDQA 3TAKA 3KAOA 2YDSA 3WUGA 4GZIA 4OBTA 3OLIA 2WNZA 1QVBA 2CBIA 1JF5A 3PZUA 2J27A 1S38A 1H61A 1S2CA 1TA3B 1BD0A 1YDOA 3V5CA 5I00A 2VNCA 3STEA 4ZODA 2PU1A 4QRNA 1CDGA 2HK1A 2HK0A 1XBVA 4QJ1A 5LNRA 4MNLA 3GDBA 1QASA 4RPPA 1SVDA 2PS2A 4LSBA 3UWZA 1OK6A 2CBVA 1TX2A 4DUWA 5DN1A 3N25A 4W86A 3QGAC 2GL5A 3B0UX 4UQAA 2Q3OA 2YBUA 1RAKA 1R2SA 5BOOA 1J93A 2FIQA 4JYEA 5CPMA 1R3YA 3ARYA 4GBDA 4AC1X 3M0ZA 2QCEA 2WVSA 2A2IA 2V68A 1K9TA 1YNQA 3LBOA 4AEFA 2OR2A 3OP2A 4DNHA 3LRLA 1TRDA 1JZ3A 3GY1A 1GYMA 1V02A 4L56A 4XAYA 2I14A 4I7WA 5FJUA 2V2CA 3E1F1 4LUSB 1SGJA 2OZ0A 1CNVA 4S3KA 4HNUA 3AHTA 4CNTA 2UZ9A 1UJQA 1EUAA 4QNEA 4QQUA 2ZDRA 3KCJA 4X22A 1E51A 2ZA1A 1IEIA 3GVRA 3R8RA 3VZZA 3COTA 1UHVA 4FAMA 5TNVA 3II1A 2PPGA 3P67A 4RNJA 1CGXA 1Q6EA 3DYOA 4IJCA 4O0ZA 5LGZA 4H01A 1F8MA 4WDUA 1TPC1 5GJPA 5LIUX 4J3SA 3ELFA 3LA4A 3KRBA 1X7FA 3ZOAA 1GQIA 3VA8A 1XIHA 2P53A 3MWAA 2PWFA 3CWNA 1EH9A 3RF9A 5K9XA 1MQQA 1J96A 4PMQA 2OEMA 4QFUA 1SMAA 4Q6JA 4CNSA 3UU0A 1QCWA 1SR0A 3AIWA 2HMCA 3T42A 3ZWSA 5L6UA 4K1GA 5TF0A 1WP6A 1XINA 1JDAA 3B8DA 3CTTA 3PB0A 3OW1A 4POCA 4CEXC 5DRIA 1H7NA 3GKAA 1FCBA 3OODA 3UWVA 3CV6A 2EG6A 1EO5A 1LBFA 4K1WA 3R0UA 1AW2A 3LN3A 1SFLA 1A5CA 1MW3A 1KCXA 4FEZA 4YNGA 5CBJA 3A4XA 3TEVA 1EZWA 5CQ1A 4A2RA 3CYJA 4MUZA 2WSRA 3L5AA 2W79A 4MKVA 1V79A 3NQ6A 4I6VA 1FRBA 1DJNA 1H7XA 1IR2A 2IKJA 3BZJA 4HKPA 2QPXA 3CQKA 1J6OA 4LYKA 2OVLA 2HNHA 2UWFA 2WMKA 5E1QA 2OELA 2WWCA 3P93A 1KV8A 2DJXA 2ZRYA 1VGAA 5BMXA 1TMHA 3PTQA 1HT6A 2CPUA 4JFSA 3GE7A 1ONWA 1HKJA 4CD8A 1J9YA 3S6OA 1QBAA 3N14A 4MY9A 2Y0FA 1R9XA 3BO9A 1WV2A 3BE7A 1SFJA 2XYLA 1B1YA 3W00A 3WH8A 1EYWA 5K7JA 2CITA 3RRAA 4K8HA 3RX3A 1TIMA 3VIJA 4YWSA 1VFUA 1FXQA 3ZJ7A 3A6OA 1YBQA 2H8ZA 2RDWA 1G01A 2V3EA 3W71A 2V3GA 3L5MA 3BLKA 2GWNA 3EDJA 3MUZ1 1CTNA 2BXVA 1GVIA 4C6BA 3C0JA 4WJEA 4KEMA 3S6TA 4UR8A 1O5XA 3SI9A 1W2PA 2NVAA 4AZ7A 3VIMA 3JUGA 1SO5A 1SW7A 3KRZA 3KZSA 3AYVA 5A6JA 4DBEA 3CB3A 2VOMA 5A3HA 4QEEA 1H1NA 1B3ZA 2XG9A 3REQB 3F5JA 1TVNA 1B3YA 1XYZA 4GUHA 2ABAA 3N4AA 5D2TA 2X0YA 2D73A 2PD9A 4GC3A 4NI3A 4V1YA 4B5WA 3G77A 1FVPA 3AC0A 1JQXA 3S5ZA 3AIEA 1UUOA 2VGFA 4Q4SA 5C9RA 1Z7AA 1W17A 3AJXA 1T6MA 2POTA 2Y61A 4H9MA 1PIIA 3WF4A 3W75A 3IV8A 2NSOA 3W7CA 3DI1A 3CNYA 3BANA 1ADSA 3GXTA 1R3VA 1SPQA 3CQIA 4G1KA 4OVXA 3T08A 3LV6A 3N9KA 2Q8LA 3N6HA 4AY8A 2PDMA 1KR1A 1PYFA 2VC5A 5M17A 1LOLA 3TR9A 1IWAA 3V75A 4AQLA 3P3BA 1IGSA 2R82A 2XIJA 3DG6A 5BXTA 4H8HA 3R5EA 1JL8A 1Z32X 1C3FA 3D0CA 2GFTA 2WMIA 4FLRA 3TU9A 1R5YA 5TD4A 4LY4A 1C8YA 2VFEA 1L2UA 1YW1A 4KWUA 3IACA 4KCUA 2XH4A 3FW6A 4P7OA 5CC3A 3WEMA 5A69A 3W87A 3PHAA 3VINA 3QH2A 2QZRA 3W2MA 4TV6A 4JS3A 7PTDA 3MW7A 1C8XA 1NP0A 4UTWA 3VOHA 4LB3A 4OHQA 2Z25A 3UXAA 2VCCA 3T7VA 4H6EA 3DFHA 2NW0A 4GJ1A 2CWNA 1LG1A 4LS0A 3HPZA 2VWTA 3MDWA 1BXCA 1TUFA 1ZTVA 5J5DA 3BLEA 3AISA 2NQLA 3AMGA 4ML9A 3U8GA 1D3HA 3LHTA 1EC9A 3A23A 1DE6A 2ZX7A 3FK4A 1E4NA 4JQ3A 3VK5A 2ZRVA 3QMRA 3VIGA 2G41A 4NILA 1V5XA 3MU7A 1XISA 2A3AA 3VOGA 5HNNA 4LGXA 1X96A 1WUEA 4YTTA 4N9EA 3E02A 2DUZA 4YN5A 2WANA 1UUMA 1OFQA 1PSCA 1XH0A 4GI4A 4UZUA 3WFAA 1DJYA 3AYSA 3GO2A 3EWYA 4FHAA 1OD8A 4GVIA 2QDDA 4JIEA 4NSBA 3PUOA 3YPIA 1W3NA 3IJLA 4KS0A 5E93A 2UV8G 4BS0A 5A8QA 3UPWA 4IQDA 2CHOA 4IP7A 1I2RA 4L9ZA 1KTBA 1XG4A 1Q6OA 3VFCA 2Z2BA 3HQPA 4Q8PA 1W5MA 1M7XA 5FJRA 3IJIA 1LM1A 4Y2WA 5C7VA 3LK6A 2D23A 1RCOB 2ZUTA 2HE5A 2DW7A 3BK0A 3KW3A 3CUGA 1ZB5A 3BWWA 4ZQNA 3QPYA 3M0XA 3T44A 4K68A 3BLDA 3U6WA 5I5RA 3QZEA 1F6PA 3C4UA 4HNOA 1HO4A 1JZ5A 2ZBTA 1LLOA 3CTLA 3QC0A 3V3WA 7REQB 3ZSTA 4PULA 1KBIA 4YTSA 1E6SM 3EX6A 3NQCA 3OA3A 4ZSTA 1ZL1A 5D05A 4DJFA 1UWSA 4GOAA 4HNVA 4YPJA 1ICPA 4EXQA 3WK1A 4JY9A 1UH2A 4M7TA 4ATWA 1REQA 3T2OA 4EACA 4Q4QA 2P0IA 1Q2SA 4QTGA 3CWHA 1OIMA 4PMVA 5GNXA 3C5QA 1CXLA 4P7RA 2EEXA 3MI2A 2O55A 4HP5A 1DJQA 3VCNA 1EKOA 4N9DA 3H2FA 1B4EA 4Q32A 3NPXA 4AZGA 5XIMA 3HV8A 3NDZA 2P0OA 1U1UA 2CZ5A 3S8HA 3K8LA 3ANYA 3PPCA 2JFEX 3W1NA 5DY2A 3NQFA 1BF6A 3GTNA 3R0KA 2C7FA 3T6CA 4A3RA 2WAGA 4AD4A 3R94A 2RJHA 2DVUA 4TXEA 3UJ2A 2DSUA 3NSMA 1TREA 3TW6A 3GC2A 4GZ7A 4DF2A 1QR7A 2ZRXA 1WXYA 3LGEA 3GD6A 4PMOA 2DV0A 1KM6A 2EXOA 4CNUA 4RXFA 3BV4A 1TRIA 1OT1A 2X2GA 3OGVA 2OSYA 3ITYA 4I90A 3TW7A 1CLKA 1WZLA 1ZHAA 3RMEA 5LNUA 1ELSA 1IZCA 2VEMA 4YJ5A 3FFSA 4NT0A 7CGTA 1XICA 2ATSA 1TTPA 2SFPA 1P0KA 4M1RA 4RW3A 5DX7A 1B3XA 4WY0F 3B97A 3DFQA 3T78A 4Q4KA 5A6LA 3VNMA 3ARZA 4KWSA 1EC8A 1J0HA 1DHKA 5LSMA 1W9DM 3VX1A 1GKQA 1NELA 1XIMA 1YPXA 2IKGA 1E56A 4UTTC 1JRCA 1WOBA 3RPMA 4HQVA 3V18A 1TFVA 4S3BA 3K8MA 3KWSA 1KXVA 4EPKA 2QJHA 1GOMA 4DUVA 2X8RA 1LL6A 5J8LA 3LGGA 2FLIA 1WBJA 1NWTA 2H3BA 1VHCA 3WK0A 2VEFA 4QM1A 4O1AA 4J40A 1F2JA 3VNIA 2WSPA 5HWMA 4CN1A 3NQMA 4K38A 1XYFA 4DXXA 3GHTA 1PUDA 4DIAA 4HMNA 5GVJA 1A5AA 4IXXA 3WLKX 1S3HA 1S2VA 3L4WA 2OQYA 3UZXA 3NSXA 2HWGA 3VDAA 1QHOA 1YDVA 3P0WA 1X6NA 4B9ZA 3GH4A 3A21A 3PY2A 5GJMA 2ZZ5A 5EMMA 1DIOA 1RPKA 1W8GA 4A05A 4REQB 2BY0A 1MO0A 4IMGA 3M47A 3G3DA 3NZRA 5K3VA 2ISVA 3NOEA 3WMCA 3VO0A 1I2PA 2VKZG 2I9EA 3I3DA 3PBMA 2JK2A 1GEHA 1KM3A 2OU4A 4OQVA 5CPSA 1W9VA 4RNIA 4HVXA 3W83A 3P84A 2QULA 3HMJG 1DXEA 4MFDA 1W5OA 3SCNA 2W6RA 1X8CA 1G0CA 1F74A 1ESWA 1I45A 3STCA 1OGSA 1UCWA 1XF0A 2FFCA 3S9IA 1F73A 3BAIA 1XD1A 1ZNNA 2E8ZA 4DJDC 3S2NA 1LRNA 1PEZA 3UVAA 1DJIA 2B7OA 3K5XA 4XAPA 2VEIA 3DBNA 3M0MA 1GOQA 4Z42C 4NAFB 3RGTA 1OCBA 1KQYA 4DY1A 1CXFA 2QXWA 2E28A 4U28A 3RLGA 3M0HA 3ZLGA 4JFTA 3MVTA 2CLOA 4K3ZA 4RCXA 3QV8A 4PUMA 4QLJA 2JKPA 3M0JA 3DHUA 1Z9AA 2F6XA 3ITTA 3ANUA 3DGBA 4JR5A 3WDJA 4E5TA 2A3CA 4Z0SA 3DEQA 3AICA 3PBYA 5FCZA 4HK5A 3ORWA 4JTHA 4AMAA 5CH9A 5FEZA 2HSAA 1CZ1A 1UB3A 1V0LA 5EL1A 4DAFA 2CYGA 3NQEA 4QHRA 2ZX9A 3VTRA 5EPDA 4WX2A 2V9DA 4NXKA 3WY1A 3POCA 3RR4A 1AVAA 2CLFA 1K9EA 4V28A 1T99A 1T41A 2ZYFA 2BGSA 4QSHA 3WK3A 3WUBA 3S3GA 1E70M 3L2LA 1B3OA 4H9ZA 1LBLA 4KGJA 1J11A 1MUCA 2Y5SA 4S39A 4LANA 3TFXA 3RN6A 1U2YA 3BG5A 2XFRA 2L5HA 4F79A 3CV1A 1OEPA 3ITGA 1K03A 4IMFA 1PCKA 3TTEA 4EAMA 3UXIA 2ZUVA 4ZOAA 5H2ZA 4W87A 4D9PA 3OO2A 1FBAA 4H41A 4N6EA 4XBSA 4Q6XA 3W7IA 3ZMRA 1J2BA 3NL6A 2F6UA 3NR0A 2C8NA 3AXKA 5C55A 1QFEA 2QJGA 1XRTA 3L4UA 4IJRA 1QPQA 5AC7A 4PTMA 2IUZA 3ITLA 1VENA 1YPIA 3VNYA 1H7RA 3TLLA 2VL4A 1W1IE 2XUCA 3PBUA 1NFGA 1G4SA 5A5WA 3W7DA 2PP0A 1AH3A 3ANVA 4IIDA 5BXSA 1E1CB 4H6QA 2GQ8A 2NX1A 1UD6A 3WQDA 5FF4A 2PDFA 1ZQ5A 3LCIA 3GNDA 2QVHA 2PODA 4H1ZA 1W1B1 1KM4A 4DELA 2YXOA 1PAMA 4PFMA 1QI3A 5JXQA 1SSGA 4JD4A 3UF9A 5J5RA 1O12A 1UUQA 1JGMA 2J8TA 3GR7A 1PB0A 4E8GA 4RDZA 2QVNA 1OBAA 1WZAA 2DVTA 3M4HA 4PBEA 2H3DA 3QN3A 2V8ZA 4RLIA 4LF1A 2O92A 3MT1A 3NYZA 3W70A 1T8QA 1FCQA 3BOLA 1VFMA 4KQNA 2YCJA 1DTNA 1J0KA 3ARWA 1TELA 3B8WA 3QJAA 2DSKA 1YADA 2WJDA 1E5JA 3BZGA 3NXLA 1UD3A 4HA0A 1X98A 4L80A 4NZ5A 4RDWA 1NU5A 3P81A 3SADA 3I4KA 2QGHA 1W1YA 4IIBA 4EANA 4IPJA 2QCLA 1DJHA 3N11A 1OD0A 3VNLA 1RBAA 1I8JA 1C90A 3BGGA 2YCIX 4NKCA 1MRQA 2QAFA 3MMDA 2WHKA 1DIEA 3UZJA 4RKAA 3W7JA 1TTJA 2PGFA 1XD0A 3EDKA 4IGHA 4L6DA 2E9LA 3UA3A 3ZR5A 4AG0A 3GHUA 2FH8A 2WPBA 1CLXA 3VXGA 2FVLA 2WC7A 4A3HA 4PA8A 3G2GA 2ZXQA 1BTMA 4KMQA 3H21A 3ATYA 1ZUAX 3AAMA 4WDXA 3FDKA 5FESA 3NPWA 5BMWA 5LZLA 2HEJA 4H9VA 4ZQOA 1IXPA 3B0YA 2ESCA 4GUGA 4IICA 3MUY1 1GVEA 4YWIA 4BI5A 4L9YA 3U0HA 3H4WA 3DBPA 2QCDB 3EWUA 3QMTA 3TOYA 3CHEA 3VOJA 1E73M 3UR8A 5ABTA 5LIWX 3MI6A 5AOUA 1J0JA 4WOQA 3WX7A 3LHUA 1BAGA 1IZKA 1KWKA 3NQ7A 1H7OA 2EPHA 3M5YA 5H8PA 1TE6A 1M3UA 1E4MM 3TYDA 1B0IA 1ML1A 3KTSA 1C8QA 3OGRA 2YB4A 5CZ0A 4GJIA 4RR4A 4C7FA 4G5DA 4FB7A 3TTOA 5LGXA 3GXPA 1KB3A 4XVDA 4KEUA 3B4UA 3EXRA 1PIFA 5DF0A 1S1PA 4D71A 1W3JA 5TQLA 1E9LA 1CXKA 2RJGA 4IIHA 3GDTA 1EIXA 4BA0A 3TYEA 1H41A 1JCMP 1JCLA 1GJUA 2E77A 1SZGA 2XSBA 3W4RA 2VCAA 1ZSXA 4F9JA 1DORA 1GVRA 1X7IA 2BBFA 2WJFA 4BY3A 2X1RA 5A6MA 4DZHA 4OBRA 3GXMA 5EMJA 1JCTA 5FSDC 1MNSA 2Y5JA 4GQRA 2PDHA 1KV5A 2A4AA 1VYSX 3TQ0A 3MO7A 4PMZA 1M01A 4F66A 3E0IA 3IIZA 4ORIA 4LEQA 1PDZA 3BW3A 4OT7A 1JI1A 4JZ5A 4UXDA 3N2CA 3R25A 1L6WA 3H2AA 2J7FA 2WK2A 3N9RA 2A6NA 1KO0A 1JUKA 1ZP3A 3SSJA 1WZKA 4KERA 3ZZ1A 4OTKA 4ZO7A 3VYLA 3S9ZA 3GZ3A 2IPWA 1OCQA 4O54A 5FACA 1KR0A 3EA1A 3H55A 1UZ1A 3L4XA 4PB4A 4EF8A 3VOFA 9XIAA 3EX1A 4KFOA 4Y9NA 4P7LA 1JD9A 4OFCA 5FAJA 2W9MA 3SR7A 3S4TA 4P8VA 3E9AA 7ENLA 3WLJA 4AXKA 4W89A 2BHUA 2GK1A 3W1UA 4RE2A 2DEPA 3A47A 4LWWA 4NG3A 1BKSA 4J9JA 3NG3A 2GVLA 5E5CA 2Z1XA 2NQJA 2G95A 1ADOA 1GCYA 3KOFA 5TIMA 4P7QA 4KKXA 4CVWA 4R53A 2OG9A 3QHNA 1G7UA 4C7GA 2PLMA 4WF7A 3SN4A 1QO5A 3UG3A 2Y62A 3W28A 1H63A 3NUKA 2BZNA 3LBCA 4PCFA 3LRMA 2X09A 5CLWA 4B90A 2PDIA 3HIJA 4UFJA 3LHZA 3PN8A 1EL3A 4NUWA 2V0TA 5CGMA 4XD6A 4HA3A 2JIWA 4E2OA 2BGQA 1BEUA 3M0KA 4JXCA 1PKYA 4I5RA 3E0LA 2HROA 4IJBA 4Q8WA 4BQ4A 3PNZA 3GAYA 2A3LA 3TCSA 3KVMA 3GDKA 3SFWA 7REQA 3QR1A 1R86A 3GUGA 4R9OA 4LBSA 3CPUA 2ZCGA 3ZS4A 3SECA 4PEKA 1XSKA 1FHVA 2GUYA 1QPKA 3BCDA 4J3UA 3Q67A 4ZGYA 3LZ5A 4HN4A 4Q4RA 3TOPA 1QW8A 4Q4PA 1UD8A 1TVPA 3TTSA 1P0NA 1QK0A 1SSDA 2Y1HA 2YCEA 1N8FA 4MY1A 2RDUA 3GVQA 2CLHA 4PZVA 1PWMA 4NASA 5A1AA 1D8CA 3FY1A 4ROPA 4I3GA 5T9BG 4Q8TA 4HZ7A 4JYDA 4PTDA 5C8BB 3JR2A 3QC3A 3ALGA 4XK2A 2HXUA 4O4WA 1M5WA 1WKEA 4QISA 3GVVA 4GFSA 1H09A 2D2OA 1WNOA 4NJIA 1OC5A 3WDQA 4BQ5A 4C6QA 1YPFA 3VMPA 4HK6A 1YYAA 4OOZA 1TV4A 3FLUA 1IT0A 3NDOA 2D20A 2A5HA 3UXKA 5GNZA 1Y65A 4EOUA 4DLFA 1DQWA 3KXQA 1W0MA 1EEPA 1BYBA 4KW2A 4WR3A 1BF2A 2PGEA 2EG7A 1LTDA 2DT2A 3ARRA 1W9UA 4CGTA 3SM0A 5I02A 3BARA 1YMYA 3TKFA 2W62A 2GQ9A 2FGLA 4Q7BA 2AAMA 1NAL1 1CLVA 1V8EA 2DVXA 4B5UA 2YGYA 3LCGA 2VO5A 3TQKA 2QCGA 1UH3A 2PC8A 1MFUA 4BR1A 1VB9A 5LIYX 3KVJA 3I7SA 4MDOA 3J7HA 3P14A 1QI4A 3I6RA 5CKSA 3THCA 1CGTA 4UBPC 4NX0A 3RG6A 3UG4A 4UFIA 7A3HA 1SU5A 4H9TA 4ZE4A 4GC4A 4DWSD 4Z1AA 1YTDA 4ATLA 2GGHA 3EB3A 3QOMA 1SJBA 5HR7A 4XAFA 5CG0A 1M7OA 5EMYA 1KA9F 3WLOA 2PTYA 3FEMA 4Y9AA 4QAWA 4XTIA 2WC3A 1K6AA 5CC6A 1KCZA 4Y90A 4HA4A 4W85A 4I8DA 3ARSA 3N6JA 3T07A 4IUGA 4M24A 2XIBA 1PV8A 5IHSA 2R1NA 4O11A 5I3FA 1PKLA 3MCMA 3E0FA 2GJNA 1OGBA 4XG1A 3N3TA 4P8WA 3WJYA 3EWCA 2J7HA 2WBGA 1OVDA 1W3HA 2AAAA 2Y85A 3CL6A 2PD5A 3AJ7A 1A4LA 4J2PA 4MHBA 3WLQA 3R8HA 6REQB 2ZZ4A 1S39A 2VWSA 4UTIA 5AC6A 3L7RA 3AQUA 1L8PA 4KT2A 2A7RA 4GK8A 1WQ5A 4GI9A 3AMLA 3VABA 5L9FA 2CZEA 3BUVA 3VFLA 2GQAA 5RUBA 3G5EA 3WUFA 5E0KA 4JBRA 1LQ2A 3K4DA 1MXDA 3W24A 3U7BA 2Z28A 2CHNA 3N13A 1JR1A 4AVFA 1LRTA 2QF8A 4PH6A 4XZLX 3EPMA 3I65A 2NVCA 5D2YA 1QNQA 2WNWA 2PWEA 2XVKA 2OJPA 4MB5A 2J6XA 3BXWA 3MBDA 2DZBA 4BWLC 3GFXA 1B54A 2X7WA 4K7YA 4RPQA 1EYEA 2PDLA 3SQLA 2VOTA 1KBKA 3WEOA 4IM4A 1TYGA 4HA1A 1GQKA 3R7MA 4DXKA 1WKYA 2IKHA 3XINA 4NAFA 3B8SA 2IQTA 3QV6A 5DEZA 1OG6A 4M3PA 1YX1A 5I3DA 3OBEA 1JRBA 3LNPA 1FDZA 3RK8A 2XIQA 3AWOA 1YQ2A 5EY5A 1OX5A 1W3IA 5DY3A 3EX4A 3BAXA 2G4FA 4Y9OA 3W7RA 1GPWA 2J7GA 1J6PA 2NXHA 4F3HA 4O50A 3ITCA 3U2CA 3U2OA 3TP4A 5ECUA 1TQJA 1NJJA 4TVUA 3TX9A 3LU2A 4ACZB 3SCTA 5SWUA 3KL3A 3EKLA 2HRWA 1I1WA 5D9MA 3POHA 2PURA 1GZJA 1OINA 4S3CA 4M8UA 1ZP4A 5M3WA 2ZTJA 3W7MA 1UPPA 2BMBA 1GKPA 5D32A 4PBGA 4QE5A 1LT8A 4CCEA 5KZ6A 2E7FA 4UQBA 4YU1A 4N4QA 1UWTA 4RZ6A 3IVUA 4RE0A 2FPVA 1A0EA 4RNFA 3B9DA 3UBPC 2HBXA 2I7GA 2Y8KA 5KZMA 1EGVA 4PTNA 1GTHA 2A3EA 1QHZA 4TV5A 2REQA 1RZMA 1VIWA 2QUVA 4MZ1A 3LXCA 5CAKA 4DB7A 4PFHA 3ZR4A 1SYTA 2I1OA 2J25A 4NQ1A 1ZZMA 1QMLA 3WQWA 1UKQA 4K6AA 4MNMA 3RHGA 4DQWA 1XM3A 4NY2A 3AYTA 1EP1A 3VC6A 1DE5A 3KTXA 4O1EA 2BGNE 2VVSA 1E3ZA 3CZLA 2X1UA 1H5YA 4WSKA 1ISYA 2YLAA 2C1HA 4O13A 1I0DA 1GONA 4QE4A 3C86A 4MPQA 1MRAA 3IRDA 4Y9MA 4MWAA 2BS9A 1EGZA 2DT0A 5JVLA 1W91A 3CT2A 1I4NA 4XIAA 4ZXLA 3UWEA 2E68A 4I5UA 4ERAA 2VM8A 1R3RA 1NTHA 5JU6A 4E4FA 1E6XM 1XUZA 5FEWA 5D9PA 1XYBA 1DJWA 4E0CA 3GTHA 3O15A 3N2MA 4GH3A 3TTYA 4ZTXA 5EKYA 3TONA 2IS7A 4IGNA 1EF2A 5BW6A 4CD4A 4W5ZA 2INEA 2OKOA 4F8XA 1OQFA 2D0GA 1FWJC 2DQXA 4K39A 1KQZA 4NZJA 5HINA 5D37A 5DO8A 4GXMA 2XGBA 3ONCA 1ZCOA 4MFEA 2DORA 4AVOA 3S5OA 3MSRA 3D3FA 2Q8ZA 1FX6A 3GNRA 3LTYA 5FI8A 2FDMA 1O95A 1V3HA 1BGGA 2G8ZA 4ILSA 3C0SA 2WO5A 3ARPA 1IHIA 4U10A 4DWSB 3B40A 2Z7KA 6ALDA 1J79A 4KWVA 4WUIA 4NHVA 4EKJA 3C8FA 3UJSA 3N34A 3WJXA 3Q65A 3IVTA 3WMLA 3M16A 1E1EA 3LM7A 4LX4A 3W1RA 3SCPA 3A4AA 2OT0A 3MMWA 4XISA 4PMRA 3GG1A 5AY7A 5BRPA 2Z00A 4W9TA 4J1OA 2GSHA 4B4FA 3MYPA 2LLEA 3T05A 1TMQA 3WDHA 2YL6A 5I3HA 4NX5A 3S2JA 2GGJA 3TJLA 1AUSL 4ZO8A 2PDKA 3BLIA 3SY5A 4C6OA 3N73A 4JIQA 3NVDA 5F1VA 3T2PA 2OKTA 4PCPA 1E9IA 4UTLA 2ADAA 3C2EA 1P5BA 3GM8A 2XWEA 3W7NA 3LZ3A 2XHYA 3QY7A 1C9WA 4DBDA 3A13A 1VLIA 3QQ0A 2OEJA 1SZEA 5EBAA 3CHFA 4GIAA 4G7EA 2OB3A 2HS6A 1LF1A 1YDYA 2QCHA 4PMUA 1FWSA 4D8ZA 1W32A 1NDZA 3VCRA 4ATDA 3KOYA 1HGWA 3W88A 3HV9A 2FHBA 2P50A 1KWGA 4KESA 2QCDA 3SIMA 1JCNA 1XV8A 5MKGA 1FKXA 1WDSA 2JKEA 3QLDA 2G3MA 2VD8A 4RE3A 1UWRA 3TVAA 3OA5A 4L9XA 5EBUA 5A6BA 2G3NA 1NQ6A 2R1PA 1Q7QA 3IUHA 1PZ0A 3R6IA 4H7VA 3AXIA 1YE6A 3ZVHA 4CQDA 1K7EA 1NSJA 3FNDA 2OYKA 3GU1A 1JCYA 4P2VA 3W72A 3AIUA 4NRRA 2XVPA 4CUCA 1FHUA 1PO9A 2F9RA 3TMLA 4N0RA 3DECA 5K4XA 2E3ZA 4D6DA 3UR7A 4AEEA 4YTRA 2Y8VA 1C7TA 3M6YA 1R3WA 1EX1A 3UGVA 4BF5A 1OK4A 4N9BA 3NQVA 1PS9A 3CMGA 3AALA 3CEUA 3HG5A 1JDFA 1EWDA 4FR1A 2D3NA 3EKZA 2ICSA 2YCKX 3BJTA 3QQ1A 2BX7A 3KOZA 3CB8A 2WMGA 4C91A 3EOOA 1WOAA 2PGRA 3RDKA 4JGDA 5C6MA 4B3LA 4PGLA 4MDPA 1ITCA 1GYLA 5H91A 2FZ8A 1JNDA 3GVWA 2B81A 8XIAA 1G9HA 3UZYA 2ZE3A 5JH1A 4WXZA 1DIDA 3VM7A 4O1CA 3FN9A 1AZ2A 2WMJA 4QAIA 1Y7VA 2ACQA 3CJPA 2ZADA 3F1QA 3RX4A 4H2HA 1TIWA 3RPDA 3UCCA 2NZLA 1KRBC 3HQOA 4KPLA 4RUBA 1GEQA 2PTZA 3STPA 3K4WA 3R11A 1W3TA 2VX6A 1F6KA 3JS3A 5F2LA 3TLQA 2G4JA 1M1BA 3V0UA 3PTDA 2NWRA 4O1FA 2D0FA 4HJWA 3KBNA 3KM8A 1PXGA 4HHMA 3BW4A 3BQ6A 4C6JA 1Q6DA 1OYCA 2V30A 1QW9A 3GW3A 2V3FA 2YZRA 1F8IA 3C2OA 4LF2A 1RH9A 3OQ8A 3THAA 5I23A 1TPVA 5I79A 4UOJA 3T55A 4J3TA 1XC6A 1G7VA 4M19A 3NVTA 4CCDA 3IJQA 3BC9A 5ABEA 3CBWA 3MUAA 2QMJA 1E0TA 3GNOA 1US0A 3M5ZA 4GWEA 1QI2A 4BI6A 5C7HA 2VCBA 1P0DA 1O5KA 1KFJA 1B9BA 1E4IA 1R0MA 3WQEA 1KC7A 2IXVA 3B04A 2J9ZA 4HJFA 4A35A 1QT1A 1W37A 3OYZA 3SB0A 1RSCA 4PUWA 4AVNA 1TE1A 3WUEA 3HQNA 3TJIA 1BXBA 4M6QA 3HJEA 4YVPA 4YMZA 3R13A 3XIMA 3NGJA 3ABQA 3JVAA 1S5TA 4MSSA 1XIJA 3R12A 4ZMGA 3HMCA 3BCJA 1VZWA 2ONEA 3WDRA 1WDWA 3PFMA 4ZQCA 2J9XA 2P88A 3PUEA 4LXFA 4R34A 3KP1A 3F4VA 3N17A 3CAKA 3WBWA 2E09A 5FIPA 4PUUA 3PAOA 2FGZA 4H9YA 5IBXC 5C5YA 1JJKA 2WVUA 5LNVA 1W8SA 3UZZA 2PSNA 4NF7A 3WLIA 3UJRA 3L4ZA 4KRZA 3OIHA 3QR0A 4PUNA 4RZBA 2D2GA 4XKMA 4LJ3A 3WQPA 2D0HA 4JKMA 3G1VA 4MPKA 2JF6A 5ENLA 5AHIA 1JDDA 5JIWA 3CUXA 4U31A 2I5GA 3G1DA 4QCEA 1QOPA 2FYMA 2VQTA 3GIYA 1DWAM 1XIEA 5D33A 1XC4A 1WKFA 4CLMA 3JW7A 1AJZA 3DFNA 2G5WA 4F0KA 3BW2A 2R6OA 4AD1A 1EDTA 1FCUA 3NZQA 3UPBA 1K8ZA 3LXBA 1XLHA 3IJ9A 4G1NA 1QWGA 4ICMA 1A50A 3FGCB 3EMZA 3E2RA 4DJED 1AG1O 3WH9A 3PZQA 1RY0A 3VGBA 4H7ZA 3E2QA 4C6KA 5BNKA 5C2GA 2G0WA 5CAHA 4K8EA 4QX4A 2Q01A 1O94A 1KKRA 1A0CA 4JHZA 3PBWA 2BASA 1Q4NX 5H8UA 5A6KA 3GDLA 1AQMA 3W01A 3MUXA 2PCEA 3FVMA 1WKDA 4LNYA 3BLOA 4IG2A 4ENLA 1JG9A 3QTPA 5IM51 2DZXA 3GBDA 1XXXA 2R24A 4FO4A 3G1AA 3MYOA 4C6MA 1TMLA 1QTWA 2Q8XA 4TVDA 3L5LA 4C6DA 3DXIA 4ZB0A 5F7UA 1JD7A 5MHBA 1MWOA 4UTKA 4D2JA 1LOQA 5REQA 2CEQA 3CQJA 1H1ZA 1O1HA 3C3NA 1DYSA 4R9XA 1KXQA 3SW6A 3W7PA 1O5RA 4PSPA 3PR2A 4IQEA 3O8AA 3IIPA 9CGTA 4KWOA 3HG3A 1WUFA 3W82A 1M9HA 2NLYA 3M9YA 2V5LA 3T2QA 2PDQA 4YVVA 1ZCCA 6XIAA 1GOXA 4XUGA 3QV9A 3ZJ6A 3WG6A 1AODA 2GYIA 1GQLA 4IH3A 1V6UA 3WNNA 2QF7A 3AFBA 2VVNA 2E67A 3AHXA 1XH2A 4HSHA 1YTEA 3EWBX 4E2VA 3ES8A 4GGHA 3FKRA 1VC4A 4I9TA 1W1A1 4GNVA 2X0SA 4WOZA 4TVCA 4LNCA 3WF1A 5CZTA 3L65A 4R7JA 3FJLA 5G2IA 1PBGA 2Q3RA 1FTXA 2YA0A 3E0VA 1CX9A 2VEPA 4ADTA 1V6XA 3LDVA 4RXGA 2GSEA 5D9NA 3UNDA 1KM5A 2QUTA 4XB3A 4HCHA 3O6DA 4EAYA 3U57A 3DFOA 3ECQA 4GRSA 3LQLA 4EX4A 8CGTA 2YYTA 3EEGA 5CPLA 3ZFHA 3Q45A 2IQDA 3GR4A 1XFBA 4YXGA 2QQ6A 2EGZA 1E6PA 3HPSA 3T0BA 2BY1A 3HZ3A 1EZ2A 1K70A 2VGIA 3DHFA 2AQWA 3LLDA 4G9PA 3FYYA 4WGHA 3W7OA 1J5TA 1XYLA 1FWNA 1X38A 1E55A 2OLHA 5HOSA 3CC1A 4BEQA 1TR1A 4IX0A 3USBA 4GO8A 4C90A 1ZBKA 3KDNA 3HPFA 3B05A 1JEZA 3PPHA 5BXRA 1RUSA 1Q5MA 3VDGA 3NOYA 1NVMA 4L64A 4X9SA 1BKHA 3SGUA 3EOSA 1VFLA 2BXZA 1WCGA 4DUOA 2DSWA 4L6HA 1NOWA 5T91A 1TPUA 2QHAA 2ISSA 4CN6A 5H8MA 3LD5A 3RCYA 4CQ8A 1LBMA 3PZNA 4ACZA 3U5UA 1V7YA 5EFDA 4JFUA 1V3IA 2DIKA 3BLPX 2QV5A 1ISXA 1IIGA 2TODA 1TPEA 1EA0A 3S2MA 5TAOA 1B3WA 4ECLA 4D1JA 4NZCA 3WFLA 3SDOA 4HU0A 2A21A 3VD7A 3DC8A 3W86A 4ICCX 4B3KA 1A5MC 4XSLA 1DQXA 1MUMA 2JGYA 4UNLA 1JPHA 2G37A 2BVTA 1UQYA 3W7EA 1VKFA 3W26A 1ME8A 3FAWA 3M5VA 6ENLA 3NFUA 1HJVA 2WLZA 3MB9A 1LQAA 3IGSA 5D03A 5C9UA 1JPIA 1DWFM 3IJ7A 1BRLB 1B57A 2I5IA 4LC6A 1PWLA 2E40A 1WDDA 1UZHA 1EWEA 4IFKA 1BVWA 1ZBWA 2GVJA 2P8CA 4P8UA 3WLSA 5FF0A 1UD4A 3EOEA 4O10A 1NFPA 5EFFA 2DGAA 2WKLA 2QIWA 4BI7A 1NWSA 3M0IA 1EXBA 1V6VA 1XKYA 4HYWA 3HGJA 1TO3A 3VE9A 4IZGA 4BEUA 3CS2A 4KRTA 4ZFCA 4P7NA 3HPXA 1FH8A 3UP8A 2CLMA 3V1HA 4FIQA 2GDVA 4MOZA 3WQ8A 4FS9A 1Z6KA 4JL1A 1DBTA 4NYYA 1RCQA 3KEHA 1UA7A 4XSMA 1NDVA 1JFHA 4MZ8A 3PTKA 4AH7A 1P43A 3FOKA 2J77A 4RW5A 3VNKA 3MO4A 4LC8A 1OC6A 4LW7A 4UCFA 3CL8A 2WSYA 1P6CA 4K37A 4JNMA 1NP2A 2YXXA 5T8GA 4HZMA 3D6NA 4WCJA 3GZAA 3AS0A 1GHRA 1UKSA 1NH6A 3CO4A 4P5UA 1GVQA 4FNTA 5U4NA 3THUA 2RAGA 3EOLA 3PPGA 2X1TA 3VOIA 4GX8A 1W9BM 4MJZA 3WYZA 5FL0A 4MYAA 2OX4A 1S2UA 2Z4GA 1NWRA 1XKJA 4D72A 4YYCA 1X6UA 3IAQA 4XZMX 2WBKA 1TWDA 2DW6A 2QT3A 1WE5A 1RK5A 1QI5A 3VI2A 5A6TC 2Z1WA 3IGHX 3OZOA 1RA0A 3SAZA 2E5BA 2Y7FA 4MTVA 1EXPA 1KTNA 1S1RA 4O16A 4IFOA 1UD2A 4U33A 3G1HA 3BAJA 3AU6A 4GYJA 1ENUA 5A8OA 2NUWA 2I57A 1ZJAA 2JQXA 4AWEA 4HCLA 4IWWA 3HBLA 3PJXA 2PI6A 3EKGA 3AOFA 2Q09A 3ARXA 5HA7A 4DBWA 1VPYA 5IDZA 4IMDA 3MI3A 4DM2A 3QW4B 4EF9A 2PRHA 2Y7EA 3CLMA 4Q22A 4AD2A 3P80A 4OGZA 1JCXA 2B0MA 1W1PA 1DV7A 3QY6A 1J0ZA 3HA1A 2E6YA 4YTUA 1R87A 4TX8A 4UTTA 2NT0A 3R43A 4EWND 2WYSA 3VCCA 1M6JA 3TMQA 4DM1A 5I77A 4DZIA 5E9XA 4XWUA 2OZTA 1XLIA 1H2JA 3N19B 1J12A 4B3ZA 4NRSA 3GKFA 4GKLA 1Q6FA 3VIPA 4O12A 3BMXA 4HBKA 3G6MA 3GG8A 3W74A 3KFTA 8TIMA 4AHQA 3BAYA 1XR2A 4V33A 1A4MA 1W3KA 3R79A 5A2CA 1X97A 2UBPC 1R8LA 5CJMA 2RGMA 1ME7A 2BDQA 4MJ4A 1E40A 2VZOA 2O4QA 2XN1A 2QMKA 1FDYA 1JNEA 4MB1A 4JTDA 1W6TA 3H26A 1BPLB 3BURA 2WVVA 3HOJA 2ZUWA 3RRXA 3WSUA 2J13A 4FK9A 2PWGA 3WQVA 3B0VC 4DI9A 2HZGA 3HGOA 1N8WA 4NNAA 2NX9A 4NP7A 4XZHA 3VM5A 3RNDA 2J88A 2XIOA 2J78A 4CQ9A 1C8VA 4DPPA 3DESA 2X1IA 4HPNA 2I5QA 2XN2A 3KL5A 4ZOEA 4NZ4A 2Y7DA 2AL1A 5EA9A 3OG3A 1QJWA 1UC4A 2O9TA 4AAJA 3DC0A 1GG1A 2PDCA 5AC4A 3GBEA 3GDRA 4J28A 3T0TA 1I0BA 1FH7A 5BYWA 1W31A 2WQPA 1A80A 1DPMA 2G3IA 2VQUA 2NQZA 4AD0A 3A5VA 4GX9A 4L61A 3CYVA 1XQKA 1D7KA 1EJRC 2CNCA 2RFGA 1JQVA 2R1MA 1I9CB 2NUYA 4DJDA 4I9AA 3IV3A 3PSWA 3FS2A 1V6TA 1VFHA 5FJJA 3WBXA 4Y6GA 1IQ8A 4JIPA 1D3GA 3LI1A 3BLLA 5A8MA 1IV8A 4FOJA 4DX3A 1D7FA 4F0RA 1EJ7L 3VDBA 4KRUA 4PUEA 3GK0A 3MTWA 1QNOA 1OFOA 1E3XA 1CB2A 3PWAA 5HNUA 5G2HA 4CQCA 3VPLA 4WDWA 1XLJA 4OV4A 4ZXOA 3C6CA 3UWUA 4CNPA 3N2TA 3FJ4A 1EUNA 5KTLA 1TPB1 4IQJA 3B8UA 5K9DA 3Q37A 4MWAE 3WF2A 4OIFA 5D38A 4JQAA 1OHLA 1G4EA 3BV7A 3AIQA 4MLJA 4XQ6A 1CGWA 2DPEA 3M41A 3PULA 3UNTA 2WWDA 3EMCA 2PF8A 3N4EA 1GW9A 1A5NC 2EPKX 4NZ1A 4XV0A 3UG5A 3SUWA 2GUUA 3SBFA 5B7YA 1P0EA 1JZ6A 4EXBA 4EPEC 1CW2A 3W6MA 3W7KA 4F48A 1QHPA 1KM1A 3GVGA 3MHGA 3ZLFA 5MF5A 1UR9A 1Q3NA 3L0NA 1R2RA 2KZHA 5DCDA 3PNUA 3FHQA 2Y5EA 4P61A 1QW7A 1LUCA 1OYBA 3B0XA 4JTCA 2ZA3A 1ADDA 2AL2A 2R1LA 4WQ6A 1L8NA 1F3XA 2ZXBA 1PTGA 3HGRA 4E2BA 1E0XA 1SM9A 3SCRA 3QRHA 3NAVA 1ZBCA 3F4DA 5I24A 1U33A 3CZ8A 4H8VA 1AA1B 1XGZA 5C71A 3RIKA 4S2BA 4UMAA 1W2VA 1VR6A 2YCLA 1V3JA 4ERGA 4Z2KA 4E8CA 2WZEA 3NO3A 3W29A 5D2WA 4S3JA 2YL9A 3GR8A 5C70A 4IMCA 1O68A 5I3JA 3UERA 5CXPA 3MA8A 4BJHA 4GIEA 3C8NA 2ZUNA 3KZPA 5G5IA 2C6QA 3W2UA 4PCNA 3A24A 1E9YB 1UG6A 1B2YA 1F5ZA 2PP1A 2Y89A 1Q85A 5JBFA 3GNPA 5JMUA 3H7VA 5D09A 4RDVA 4UQ9A 2DQWA 1B9ZA 3ITVA 1GT8A 1I6NA 1V0NA 4JTFA 1QO2A 1LORA 3FGCA 2ISWA 1E43A 3CPRA 3ZSSA 4MADA 1NQKA 2VDIA 5C0QA 5BRQA 1F76A 4AZBA 1JXKA 4KWWA 3P5ZA 5FJTA 1NARA 2CERA 4FX7A 1XLGA 2F7FA 2FTYA 3BVJA 3KCOA 4TX6A 2ISDA 3IJ8A 1N2VA 4NL1A 3CUFA 1R46A 3WZ0E 4FXSA 2OQLA 3VILA 1KXTA 3MZNA 1L9WA 2BOGX 2ZICA 2A3BA 4IXHA 3MP3A 1FWDC 4MYXA 1HIZA 1V03A 3DI0A 1Q6CA 4DWDA 3KS5A 5I6SA 4IPLA 4GXWA 6A3HA 2ATMA 1SQ7A 3RLHA 1JPKA 4NNCA 1XWYA 3AMCA 3SJ3A 2FMNA 1ISZA 4OWGA 3L23A 4G8TA 3LYEA 1MW0A 3DHDA 1DWGM 3T8LA 5HULA 3MMUA 1VBJA 2BSLA 2GOKA 3BH4A 1JAKA 1AD4A 3UY7A 1HJXA 3AXXA 4M80A 5G4WA 5HR6A 1CPUA 4H19A 1GVFA 2GPTA 4FF7A 4V27A 3URBA 3WF0A 3B9EA 3WIJA 3E38A 2EKGA 1XCXA 1UKPA 3A3XA 5HMEA 5CJ5A 2DT1A 3P6LA 4JTJA 1QNSA 1SO4A 2O7SA 4AZ6A 3ZVIA 4YIWA 3I6TA 1TQXA 2QJMA 3QMSA 3N18A 5FF7A 4HT3A 3UESA 4O53A 1ECQA 2OWXA 1N7KA 2QW5A 4QS6A 3ES7A 2V3DA 4Y7EA 3PBVA 5ABFA 1RV8A 2E5CA 5FJPA 4KEZA 2OZ8A 2OWWA 4EPBC 4JDBA 5T9CE 1R2TA 3H8AA 4W7UA 3V4BA 4DBUA 5AYBA 3K13A 2PTXA 1SW3A 2AOSA 1EB3A 1VBHA 4ZTYA 1F9CA 1JDCA 1YXDA 1WAUA 1ONRA 5HUOA 4H8NA 2AKMA 2GZXA 3W9ZA 2QCFA 4L1GA 4W4QA 1H49A 4AZCA 3SURA 2PRLA 1LJYA 4MB4A 4O15A 3DFPA 4GFIA 2EO7A 2WNNA 3UA4A 1XP3A 1TUXA 4RZ4A 4R7OA 3MBFA 1BTCA 4QJ4B 1EC7A 2CLKA 2ZX6A 1HP5A 1S2WA 4UCGA 3GIQA 2CBJA 1RY8A 1HTIA 3QEZA 3A4WA 1MMFA 4WDTA 3LM3A 2VP8A 3VX0A 4ICNA 3WH6A 4GZJA 3LERA 5AZ1A 4JAWA 4LVDA 3N9SA 2J7DA 2VR4A 2ZZ3A 3ARTA 1CGUA 1Q65A 1Z44A 1EO7A 2XH0A 3M6DA 2DFAA 3UG8A 3LTSA 1SJCA 2X42A 2ZXAA 2QPUA 5LYRA 3O07A 2J7EA 1PTDA 4N42A 2VC6A 4FOKA 4M56A 5BU9A 4XVEA 1NWUA 4C7DA 1OJXA 4GG9A 1W5NA 2OLAA 4Z2JA 3H4GA 4MKNA 2YL5A 2PDGA 4IIFA 1XIFA 4DJFD 4DO6A 1I1XA 2Y7GA 3EA2A 4IHCA 2WW5A 1Q63A 1B30A 5HWJA 4Z1CA 1GGOA 3CK5A 2XTKA 1PKNA 1S2AA 5CC7A 2PLKA 3B9OA 4E4PA 1RVKA 1VCGA 1AJ0A 4IMAA 9XIMA 1BGAA 1VYPX 1JULA 4ZR8A 5CPQA 1PCWA 3URNA 4LB4A 2XM1A 3GAKA 2QDEA 1Z42A 2C91A 5M03A 2BY3A 3NZPA 2J4GA 1UZDA 3CZKA 1TV2A 3HN3A 5HUPA 2Z29A 3WFZA 4AY1A 2DZWA 3DUGA 3MUIA 4YVXA 3ZJ8A 3WD3A 2O7QA 4FIRA 4ADUA 3C2YA 3GC5A 3T81A 2FB3A 3AO0A 5D8ZA 4PMJA 3DKLA 3OZYA 2NT1A 1JPMA 1XCWA 4GI8A 2FDSA 4LAOA 4DEFA 2JIEA 3IANA 5XIAA 3RM9A 1EIBA 1UPMB 1QUMA 3SRKA 3OLDA 4KFPA 3QKEA 3SQMA 1I2OA 3VGGA 2PB1A 4JNYA 2DJLA 4FALA 2VRKA 4AIEA 1OADA 1OX4B 4C6EA 5FEXA 5LA2A 4DWSC 1K7XA 4TQTA 3GW0A 1H7PA 1XGEA 4L1XA 2Z1VA 3KOWA 3CAVA 4RX0A 3WN6A 3IK2A 1FWGC 3KWXA 2GWGA 4XKYB 1TJRA 1A5BA 2C16A 1G94A 4UB9A 1KGXA 1MW2A 5HQEA 3WELA 3VIHA 2HS8A 1NDYA 5CZSA 3C2VA 3LPOA 1DIKA 3DX5A 1J5SA 4DAIA 3AU2A 3ABXA 4NZ3A 1NOUA 2QCNA 3I10A 3CO8A 4O8AA 3QM3A 3LG3A 4S3EA 3WLTA 1R3SA 1AZ1A 2B31A 1E6RA 2TMDA 3OG2A 1PTAA 5D30A 3FXYA 2OOGA 2VD9A 4R27A 4ZL1A 2WKJA 4PYSA 5KINA 4OBSA 5JUVA 1HW6A 4LOCA 1OYAA 4B16A 3CZEA 3WQ4A 3MSGA 4AUBA 3TJ4A 5C2XA 4FZIA 1UA3A 1KFLA 1TZZA 1UR8A 1Q13A 3WEZA 2ZRUA 5EMUA 3UCQA 3RM4A 3LRKA 1TZ7A 2BVYA 2QAPA 1EP2A 1VJIA 3BLFA 4KCWA 3VC5A 3CUIA 4JN6A 1GUVA 2WMIB 4Q8UA 5I3KA 4RV8A 1EHNA 3AS3A 3WK2A 3EXSA 2PFHA 1BWVA 1UKTA 3VDHA 3VAVA 2YIHA 1O7AA 2V69A 3LV5A 4NZFA 2C71A 4ONVA 1DVJA 1LROA 1QNPA 4QQ3A 4GNKB 4OECA 1HNYA 1VFSA 1ITUA 3ME3A 4M7SA 3FEQA 1RXOB 1T96A 5CLTA 1LWIA 4EPDC 1XYAA 4AWTA 3I3EA 4LYRA 2XIMA 1MQRA 2DZVA 3IGXA 1MXGA 4UTHA 5G1YA 3I68A 4BQ2A 4LV9A 5JBEA 3T40A 4I9MA 1TTQA 3ARQA 2WMHA 3WD0A 4AYGA 2EPNA 1LP6A 2CBUA 2NQ5A 4NJGA 1EQCA 4K36A 3H7RA 4YL2A 2RKXA 2H9AB 3GSMA 3O3RA 2VR2A 4B2DA 4WGXA 1J01A 4J7RA 3W25A 2X16A 3T4WA 1XLFA 4XZBA 3P7YA 1R3QA 3C61A 1K1DA 1CGYA 4TR9A 3IK4A 1R7OA 4O18A 3OU8A 2VGBA 2E9MA 2VURA 1T5AA 3A12A 4GH1A 3S2LA 4AWSA 1P6WA 4U2YA 4YHEA 2ACSA 2ZKMX 3RR1A 3C52A 5ABHA 1N55A 2AMXA 1QOXA 1DP0A 1V3MA 3SCWA 1M03A 1NF7A 5LNWA 2HPIA 4NJKA 3CZGA 2D2JA 2DY3A 2PZ0A 5E0FA 4PL1A 4OV9A 1Q6GA 1V51A 1TA3A 1MNZA 4JCMA 3PANA 4F0HA 4I8YA 4JOMA 4JFWA 4NVTA 5FD0A 4ES4A 4MJMA 1I75A 4A21A 1LOSA 3GTIA 5E9AA 1TJ1A 2G96A 4LVFA 1QPRA 4ML4A 5FL1A 4BCEA 2G3JA 2BP1A 2VEGA 3TR2A 1TZ9A 2Q71A 3L4VA 4X63A 3W27A 1TTIA 2ZZ1A 3OVPA 2OQHA 5AKQA 4IUOA 1UP0A 3GYCA 2QJNA 1K6WA 2DH3A 3TK7A 1HZYA 2YBVA 2QS8A 2R14A 1TCDA 1EDQA 4QS5A 2ALDA 1Q6LA 3CIXA 5EYWA 1F3WA 3S1VA 4RZ5A 3O05A 3T09A 3CIWA 1CI1A 1HG3A 3NA8A 1K8YA 1OFBA 1PE1A 1WXJA 2C1GA 2VI0A 1XIBA 3KVKA 3UWYA 5I09A 3TC6A 3DN5A 4BWLA 1XIIA 1ZGDA 2VYOA 5E6YA 4OZOA 1TPDA 2Z27A 2VEKA 1DJGA 2VENA 1PX8A 1O4UA 3AZTA 2Y2WA 2W63A 4WY0B 5J04A 2VRQA 1THFD 3S5YA 1QXLA 1RQEA 4ZENA 1O66A 3W2LA 4B4HA 3QPZA 4NI8A 1FCVA 4LUSA 1LT7A 1E5NA 1F05A 2ZUUA 1E6ZA 2WQDA 2YW3A 3W38A 3R0DA 4O1BA 5LKYA 4LT9A 1XL9A 4QR6A 3SEPA 1EPVA 5EB8A 3THQA 3ATZA 1MZHA 3S1XA 4IP5A 2ZZ6A 1A47A 5A8GA 1POKA 1H4PA 2CKRA 3PTMA 1BVZA 2ZC8A 4US5A 3SGGA 1VRDA 5A2AA 2PEVA 1G5AA 1DJZA 2W67A 1CCWB 4L6OA 3OVRA 4C6NA 2Y88A 2PDBA 3BICA 1IXNA 3HURA 5HJLA 3WD4A 5F2IA 4FLQA 2CZFA 3NPUA 1KNWA 2UY4A 1K7FA 1MFVA 2GGGA 3CUHA 4GQGA 1IEWA 1KXHA 3TWBA 3GDMA 2V2DA 1WA3A 1F6YA 1PHQA 3OYXA 4QDMA 8RUCA 1LLZA 3NWRA 4RDYA 4A29A 1BQCA 1HN1A 1ALDA 4L4MA 1AH0A 1A5LC 3KBJA 1LL7A 3PZ9A 1DL3A 3VD4A 4L65A 1POJA 1U30A 2BHZA 2JEPA 3ITOA 4KCVA 4FI4A 1UIPA 1KFBA 5C9XA 1EX5A 1NY1A 1DWJM 3CGTA 1BHGA 4CQAA 1OZQA 3V5OA 2TYSA 1KRAC 3F5KA 5D9OA 3C2FA 1N8IA 3EWWA 3TC7A 1MQPA 4D6IA 1MEIA 4DZAA 3KHDA 3WF3A 3CHCA 3JZUA 1UWIA 2OCZA 3PS7A 2QUMA 3BDKA 3ZT5A 2OPJA 3CV2A 3PPFA 3L66A 3VUSA 3PZVA 4H04A 1WXZA 3P8JA 2QCCA 3RITA 2E6AA 4UC5A 3UJEA 2HISA 3SUVA 1B31A 1XI3A 3NL3A 1A5UA 1MDRA 4YTQA 3SN1A 2DSZA 1XLEA 4PL2A 4Q8VA 3STGA 2FTWA 1YKWA 5JH2A 3TSBA 5I3GA 3B4YA 3B8VA 3FVDA 3T0CA 2GLKA 3A9BA 2GJXB 3VNJA 3WQ5A 2OOFA 2CKSA 1NDWA 1H0IA 4UUIA 1VBGA 4LFYA 3LEPA 2P76A 4GISA 1PX3A 2TAAA 4X9YA 4WEVX 4U4MA 1D3CA 1HKKA 1T40A 3U5YA 3AIBA 1G69A 4QJ3B 3PZGA