2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase class 1
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
1QPQA 1CI1A 4NJIA 4CQ8A 3TXZA 4EF9A 1VQTA 1LDCA 4LU0A 2YYUA 3W1TA 3F4WA 4O15A 4DBDA 3TAKA 1G6CA 5KSWA 1PV8A 2X1RA 3NYZA 3ATYA 2WSQA 1UBSA 4O1DA 1SSGA 2P1FA 1DKWA 2ZRWA 1JCYA 4IMEA 3O05A 3RU6A 3FJ6A 5EL1A 3W7IA 2WQPA 3M41A 1LRQA 1O4UA 1HO1A 2BLEA 1ME9A 1PS9A 2FB3A 4BF9A 1K3UA 1RV8A 3IIVA 4MFDA 1EX5A 1FCUA 5CPLA 5D2YA 2QR6A 3DENA 3OG3A 4RV8A 3M5VA 4IMFA 2QCDA 2RDTA 3LXBA 1JQVA 3MP4A 2EAWA 3LTYA 4I7UA 4O18A 3W2KA 7TIMA 4FNSA 1T99A 4FO4A 2OMAA 1ZJIA 1M5WA 2J9ZA 4JY9A 1S3HA 3TC7A 4LVGA 4S1FA 1F7BA 4IXHA 2CFFA 1W3TA 3S1UA 4WOZA 1MEHA 5AOUA 1SFLA 1SZFA 4OBTA 4OE7A 1GVRA 3QM3A 4PH6A 2BZNA 3TIMA 2DJLA 1R30A 2VFFA 2NX1A 5H2ZA 3TSBA 4UFIA 3EXSA 5D2WA 1LLZA 3DFNA 1ZALA 4N9CA 2CLLA 1TREA 5AYYA 1FX6A 4JX5A 3FYPA 3W6YA 5A8GA 1VR6A 3GR7A 1TV7A 1QO2A 4XTDA 1K7EA 1NF7A 4JTTA 2ZZ4A 4ZVJA 1QOQA 4JTGA 2DU2A 5J5RA 1W54A 5HULA 3GKFA 1ICSA 3I68A 2TMDA 2Y85A 2QUVA 5HMSA 3TJXA 4R7JA 1VCVA 3FOKA 2Y62A 4AHQA 3TA6A 5LGXA 3ZR4A 3H55A 3W1PA 1F76A 3SR7A 3T4CA 1VH7A 2DZVA 3PULA 4CCDA 5TIMA 1GYNA 1SO4A 3G1DA 3LCWA 3TUUA 5AHIA 1W5NA 4CCEA 1K8ZA 5G4EA 1PIIA 4ZZ9A 4HNVA 2FFCA 1W37A 3TR2A 3EEGA 3L68A 1KM4A 3PM6A 3RMJA 3W85A 3C2VA 3LCLA 1H61A 1Q45A 3BLIA 4X9SA 3NM1A 3EX1A 4P61A 1ZAJA 2C3ZA 3WFAA 1GG0A 3L9CA 4EF8A 1O95A 1THFD 4ALDA 3EX2A 1Z44A 3NQCA 3NGJA 1W5QA 1WQ5A 2A0NA 3LXAA 2YFNA 3BLEA 3W7CA 2QCGA 3W2LA 2NUXA 2NWRA 1OK6A 3BLFA 1OFAA 2OT0A 2CZEA 3KVKA 3MHUA 2C6QA 1TMHA 4E38A 3DXIA 2QDHA 3LHYA 3W7GA 3MUXA 4JTHA 4N9EA 3L67A 3UYCA 4TMCA 4CLMA 4Y96A 3ABSA 3FA5A 4GNJA 4RJEA 5FF4A 1TYGA 2HSAA 1VLWA 2GVLA 1A5SA 3L66A 1FXQA 2HS6A 4NXSA 2X30A 4JS3A 1A50A 2A21A 4M5PA 3P81A 4O11A 3PBWA 3NO5A 4KWWA 5G1YA 4PC8A 3VKJA 4Y6GA 1GYLA 3M1ZA 4LOCA 2EKCA 1OFQA 1H7PA 1ZNNA 4UTMA 1ZAIA 3N2XA 6ALDA 3O16A 5J5DA 4K6AA 2TYSA 2WSYA 1TO3A 1U5JA 3FKKA 3W7HA 1UB3A 2ABAA 3UWUA 2XN2A 1OFBA 3NNTA 2YSWA 2CLMA 1SZEA 3F1QA 1TPWA 4IX0A 3VCRA 3C56A 4N4PA 1OYCA 3OA3A 3M6YA 3W75A 1ZFJA 1S5TA 1I2PA 3W9ZA 4MLRA 2VFGA 5HUOA 3LERA 3NOEA 3NQFA 3EWWA 4A3UA 1DVJA 4N2YA 3KVJA 2UV8G 3W2MA 1GVOA 3C2OA 5AHLA 5H91A 1YXYA 4JX6A 3FFSA 3G0SA 2ATMA 3UPWA 2FPTA 4AWUA 1EWEA 3IGXA 4MUZA 2Z2UA 5LNVA 1TPFA 4RZ5A 4FNTA 3W83A 3QQ0A 2OT1A 2WSRA 3R8RA 4DF0A 1H51A 3LBCA 4UUIA 1KA9F 1QMLA 4JX4A 1OFEA 4QJ1A 5K4XA 5CGQA 2NXHA 3LB0A 3C2RA 2NZLA 1YTEA 4Z1DA 1XBZA 4WXZA 1LRTA 5AFDA 2WNNA 1LCOA 1WYIA 4IQLA 4K37A 4MZ8A 3PS7A 2CLOA 1XUUA 4C1LA 1H7RA 1GVFA 4NXKA 4H6KA 3B06A 4NQ1A 3TDFA 4DF2A 4OV9A 4NZFA 1FWSA 4GBUA 3INPA 3PC0A 3HG4A 4GXMA 3LX9A 5CPOA 3UXAA 2NXIA 2EHHA 3U8GA 3OEXA 4IMGA 1XC4A 3NAVA 3NQ8A 1EB3A 3GNNA 1T8XA 2J9XA 4ZQNA 1LZOA 2VFIA 3T78A 4MYAA 4ZQMA 4JN6A 2CZDA 5G2HA 2Q3OA 3G0XA 4JXCA 4O28A 3HG3A 1DHPA 3MI2A 3UNDA 5AYXA 3GAYA 4FX8A 3C2EA 4CNOA 1LTDA 1PVNA 4TO8A 4QSHA 4GUGA 1GTHA 1QWGA 2A7PA 3EKLA 2R8WA 3R13A 4I7WA 3I6RA 5AB3A 4O54A 5T26A 1B57A 2CLIA 3W7EA 4N9BA 1B3OA 4O1BA 3PG8A 4L4MA 3W71A 5CPMA 1EP2A 3NZRA 3O6YX 1RPXA 3O6DA 1KM0A 3L21A 2BSLA 3B4UA 4WY0B 2W0UA 2QJGA 4O50A 4XQ6A 3RLUA 3ZFHA 4O0KA 3N9SA 2VXNA 3HO8A 1XM3A 4UNLA 3N34A 3VE9A 5AC8A 2BX7A 1FBAA 1SO5A 4O53A 1W5OA 3O15A 2Z1BA 1KW1A 1ONRA 4MOZA 2VEPA 5D04C 2Y7FA 1B9BA 4KWVA 3L0NA 1TV5A 2Y7EA 1WXJA 1X6UA 2YR1A 2VC6A 1MSSA 4RZ4A 3P80A 2V2HA 1P5BA 1I2QA 1SQ7A 1TCDA 2RHGA 2ZA2A 3QFEA 1KLZA 1ADOA 3G1AA 3PUOA 1J5TA 4Z0SA 3NQ7A 1Y0EA 2F84A 3RF9A 2TSYA 3FKRA 5LZLA 2E68A 4UTTC 5K9XA 4LVAA 3UWVA 4K39A 2G96A 3C4UA 4MKNA 3QSRA 5I3IA 1EA0A 5AC7A 3TU9A 4HN4A 5K7JA 5C55A 3GDMA 4OGZA 1JCMP 3UZJA 2QAPA 5AHMA 1QPOA 2ZRZA 3HMJG 1LROA 3S42A 5DCDA 1TTQA 3ABOA 3DKJA 4WXYA 2FPYA 1OABA 2DZWA 3SI9A 1GWJA 2RFGA 1K02A 2QCHA 1XBXA 4LUIA 2D73A 3MJYA 1M6JA 3BG5A 2DORA 1F2JA 3UY8A 1QDSA 3DHDA 3C8FA 4S2CA 3KRZA 5G2IA 3DFQA 3TROA 4M6PA 5LNUA 2WKJA 4HKPA 1OX5A 1D3GA 1N8FA 2JKPA 4H3DA 1VGAA 4GFSA 4IPJA 3S1WA 3ABQA 2VFHA 4NJKA 4O1CA 1GJPA 2H6RA 3W2NA 4J9JA 2QCEA 3FLUA 3MP5A 1XUZA 5FF3A 1KFLA 1IXOA 4ADTA 1K7XA 4A22A 3GDTA 1K03A 3M47A 2QCMA 4UTIA 3TFXA 5BOOA 1UCWA 3BGJA 4O1AA 1EP1A 4MZ1A 1PE1A 3CM4A 3IIZA 5D37A 1YDOA 3L65A 3GK0A 4E2BA 2DZUA 4BR1A 3HF3A 4CNNA 1OX4B 3IVSA 5C2XA 4JTEA 2FQIA 2W6RA 2H90A 5LHFA 2CLFA 1KFBA 1H7NA 3FJLA 1DBTA 5K2ZA 3MBFA 2JKEA 1LBFA 4HNTA 3EWUA 4K38A 1FWRA 3LCFA 4XTIA 3G3DA 5D02A 1I45A 2B7OA 1OX4A 4X22A 2ZA1A 3USBA 1RQHA 1L9WA 3HGOA 1KV5A 2Y70A 2GUUA 3LHZA 2FPVA 4X2RA 1A5AA 3LLDA 3GXPA 1I4NA 4M6VA 5KTLA 4MJZA 2QEZA 3EXTA 3TMQA 2A6NA 2ATSA 3PBUA 1GVSA 2KZHA 2XN1A 5AHNA 2A7NA 1RR2A 4WX2A 5TQLA 2LLEA 2J88A 1WBJA 2RH9A 2OJPA 2CWNA 3PF3A 4UMAA 3TXVA 3LCIA 3R5EA 3S5ZA 3NPUA 1H60A 1F05A 1K7FA 1QPRA 2ZDRA 2V5BA 2VFDA 4AWSA 1ZHAA 4DO6A 3A5FA 3IIXA 2TPSA 5TBOA 3DHFA 4FB7A 1Z48A 4LUJA 5EKYA 1SPQA 5DY2A 1IF2A 1P1XA 4E0CA 2J27A 4R33A 3UD6A 1FWWA 3QH2A 4NNAA 4RCXA 5K4ZA 5FESA 4N6EA 3IGUA 5DELA 4LW7A 3B0PA 1TPEA 5F4WA 2I14A 3A9IA 3QW4B 5AYZA 1VZWA 1H5YA 3MBDA 3MYOA 1ICPA 1JJKA 4PFMA 3QPYA 4FIQA 2ZTKA 1JCNA 1VS1A 4RKAA 4UFJA 4Z1AA 3CWOX 4JICA 3QJAA 4JDYA 4O12A 2B7QA 3KX6A 1P0KA 3LRKA 3G1VA 1DV7A 3UWZA 3E9AA 3PB0A 5F1UA 5K3VA 1GOXA 3DAQA 2QKFA 3P5ZA 3UXDA 1TPVA 2WJZA 1KM2A 2C14A 4YXGA 1VLIA 1TIMA 1D3HA 2EPHA 1TRIA 1YPFA 5EY5A 1QCWA 4JTIA 1V7YA 3I7RA 3P62A 2NX3A 2F7FA 2QCLA 3S0CA 3DH7A 3TC6A 3ZS4A 2GJLA 5KZEA 1W5PA 4HIBA 1G4EA 3LV5A 4KFNA 4GRSA 3C2FA 4JYDA 2EGZA 3T55A 3EX4A 2JBMA 4JIPA 1U83A 4AEOA 4AWTA 2CLEA 4GE8A 4KFPA 4L4LA 4MIMA 4BWLC 3NZ1A 3GDLA 2PURA 3NL5A 3TX9A 1TSIA 4GUIA 2ISSA 4LS0A 4ONVA 4JTKA 4MY9A 3YPIA 1TB3A 5F2LA 4D2JA 2YZRA 4LS2A 4Q4KA 5FF0A 4Z0JA 4O57A 5E0KA 1KFJA 4JY8A 1AL7A 3ABRA 1I2OA 1LLWA 3W7JA 3EX6A 1OVDA 1QNVA 3SGZA 3CWNA 3W7PA 4LC6A 3H53A 2ZRUA 1PCKA 4O16A 2ZZ3A 4HSOA 1X1OA 1H7XA 2E6YA 3W1MA 3W23A 3ZWTA 3P7YA 1R2SA 3A23A 3G1SA 1N7KA 1NFBA 2A85A 4ZQCA 4NNCA 3PBYA 2ZZ1A 5BNKA 2QDGA 2CW6A 4ZL1A 3UWQA 4S2BA 3MHGA 1L6SA 3CQ0A 1LBMA 3MP3A 3NPVA 5I3JA 1OFRA 3EKZA 2A4AA 2E1DA 4AF0A 3G1YA 2ZZ5A 5FI8A 5F2MA 4N02A 4ICNA 3CPRA 3I7SA 4JTUA 2GQAA 1TV8A 3TK7A 3S6DA 3KXQA 2Y61A 3VI2A 3PUDA 3HQ1A 1JRBA 1NAL1 1QFEA 1XI3A 3LHWA 2WNZA 3KVMA 3CEUA 1IXNA 4M19A 1Q6OA 4QITA 1T0OA 2IQTA 4WJEA 3B0UX 4JYFA 1DJNA 3P5YA 5LNSA 3UZ5A 3W76A 4UTHA 1FDYA 1KFCA 4CCCA 5HWJA 1YDVA 3W72A 3SY5A 4DO5A 2C1HA 3M0ZA 3L2IA 3C61A 4O10A 3BG3A 1H1YA 1XBVA 3FYOA 2CZFA 4O52A 1S5VA 3SFKA 4A2SA 3STEA 2WNQA 3GNDA 2Y7DA 4UFKA 3FEMA 4Q33A 4LV4A 1FQ0A 3W87A 3QEZA 5CKSA 1T96A 3KOFA 5DXYA 3PUEA 4PCFA 3P8IA 3NL2A 4DPQA 4K7VA 4QAIA 5LHEA 1TPUA 3CC1A 1W3IA 5D30A 3I7QA 3G8RA 4Z08A 5CZJA 2I9EA 2YYTA 3P82A 3DFOA 4FNRA 1QAPA 4AVFA 5D09A 1LP6A 2G97A 3BPWA 4JGDA 4EWND 4RR4A 2J9YA 4DPPA 1UUOA 1JUBA 2YCEA 4DEFA 1I2NA 3HOJA 2QF7A 1TTIA 4MY8A 2Q8ZA 4QQ3A 1HO4A 1Q6LA 4AB4A 1F73A 4HPXA 1JUKA 1JUEA 4YMZA 4WQ6A 5FEZA 3R89A 1RQEA 3OBKA 2Y63A 4HNNA 3W22A 2AAMA 4XUGA 3WJZA 1SZNA 4DELA 4LRTA 5BRBA 2ZZ6A 3QYQA 1DQWA 3M16A 2C0AA 5G5IA 3AO0A 4Z1CA 3W3OA 3W7RA 3TH6A 1JCLA 1FXPA 3DI1A 1TRDA 3KRSA 1SW0A 2ZTJA 4MYXA 2O7QA 1ICQA 3W1XA 1JCJA 4MFEA 5DXXA 1SO3A 1SW3A 4UXDA 3T44A 3W7DA 1SFJA 3VNDA 4BI6A 2BWGA 2A1YA 4UTWC 4NJJA 4EVZA 2WV8A 1G7UA 1LYXA 3KRUA 1BWLA 2V30A 1A53A 3WK2A 3G18A 3RFAA 5I3HA 1XXXA 4Q32A 3BARA 3B04A 1IIHA 1VCFA 3FS2A 4IX2A 3HPZA 4XKYB 3HG5A 2JGYA 2A6LA 3N2MA 5KMYA 2WOQA 2C19A 3BV4A 3ELFA 1DJQA 1BTMA 3QF0A 1K8YA 1H1ZA 1YADA 3KHJA 1G67A 2CZ5A 3EB2A 3UY7A 3NG3A 1MEWA 5ABTA 3O1NA 3PAJA 2RDUA 3OIXA 3E12A 1JULA 2W79A 2V81A 2QJIA 5AHEA 3LI0A 4QNWA 1QO5A 3W7QA 1ME8A 3QMRA 2YXGA 1KTBA 1CW2A 1G7VA 3LTSA 3C52A 3PSVA 1TQXA 1G69A 5DLCA 1QR7A 4G1KA 1LOQA 2ISVA 3GKAA 2PRLA 4IJBA 5U7SA 5IBXC 4NVTA 3N19B 1M7PA 3NL3A 3EXRA 1YTKA 3N3MA 4LT9A 3JRKA 2WO5A 2QJHA 3G3MA 4GUHA 3W1AA 3DI0A 1W3NA 1KFEA 2PRMA 4EOUA 1LOLA 3M44A 2VKZG 3NEVA 2PC4A 2YDAA 1VJIA 3O06A 3ZWSA 3EWYA 4QM1A 2QUUA 4OQVA 5HWMA 2NUWA 5KZDA 3GB6A 3N9RA 3SSJA 3HG2A 4NX5A 1PHQA 5LSMA 3SIZA 2Y89A 3HIJA 4QNEA 3CIWA 3MMTA 2RKXA 3GLCA 1G4SA 1VYRA 5D2TA 5AC6A 1JRCA 2NUYA 4RK8A 4NUWA 3IIPA 1L6WA 1G4TA 4O19A 4LWWA 1HFBA 3RLVA 2X1UA 4FNUA 5CSRA 4LTSA 1FCQA 2Y7GA 3BW4A 3AJXA 4H4IA 2NV1A 4OU1A 2GOUA 1S5WA 4RLIA 3O07A 3C6CA 4YCPA 2G95A 3W07A 3SJ3A 4DXVA 3P67A 4MZYA 2VEKA 4FHAA 5U4NA 2OX1A 1F6KA 2X1SA 4UR8A 4NJGA 3ANYA 3UWWA 1C29A 3TSMA 2CU0A 1OYBA 2V2DA 3LCGA 4FX7A 1GTEA 5LGZA 2X2GA 2VFEA 1F74A 3QMTA 5C54A 3DZ1A 3ATZA 4JTLA 1QOPA 3S5NA 3B05A 2FTPA 4WZHA 4NNBA 4OV4A 3SW6A 3BW3A 4WD0A 2FIQA 3CTLA 1OF8A 5FF2A 2VEMA 4O8RA 1OHLA 4A2RA 4GUJA 3MO7A 1SUXA 1FDJA 1UASA 4DQWA 1RD5A 2G5WA 2ZA3A 3A24A 3TW7A 4HT3A 2ZCGA 3QW3A 4LVDA 1OG0A 1H62A 5GVJA 3S5YA 2YX0A 3TCEA 3G0UA 3N73A 3OVPA 4RXGA 1ML1A 1C8VA 3GIYA 3Q58A 4JIQA 1KM5A 4W9TA 1OF6A 3HPXA 1QPNA 2NV2A 2NX9A 3GYEA 4FF7A 4WUIA 4O4WA 4RX0A 4JTSA 3LGEA 1OFDA 3QSTA 1RQBA 5I3KA 4TX9A 1RVGA 3THQA 4CNPA 1W8SA 3W1UA 4XBSA 3C0JA 4PTNA 1KM1A 3TQ0A 1H7OA 2BTMA 1SZGA 3TW6A 4UTUA 1KV8A 5D2VA 3NL6A 1BEUA 3W7NA 1LORA 5CG7A 2WPBA 2E09A 5F2GA 4FXSA 1ZY9A 3S1VA 3MYPA 4UTTA 4FXRA 4JTJA 4NU7A 3NQ2A 2VEIA 5LNWA 2FLIA 4LNYA 5EPDA 4FNQA 4UTJA 1G4PA 2FJKA 3U6WA 5DBTA 4IWWA 1I2RA 2X1TA 4CQ9A 5LNRA 4UCGA 4YLWA 1FCVA 4JD4A 1F6PA 1VCGA 3E02A 1ME7A 4LVBA 1H50A 5HUPA 3EWBX 4HNUA 2GPTA 4Y90A 1OK4A 1TTJA 4MLJA 2Q3RA 2A5HA 2Z0IA 5HR6A 1IXPA 2ZRVA 3SZ8A 3WK1A 2E6FA 1LOSA 4N4QA 1SO6A 1BKSA 3MI3A 1P4CA 4YCOA 3SGUA 5DN1A 1WOAA 1HL2A 1SW7A 4Y8FA 1X7FA 3O63A 4O14A 4PODA 3B8DA 1X8FA 1JR1A 4DBEA 5K9CA 1MO0A 2FB2A 3CT7A 2JKAA 5BMWA 2JK2A 4IOTA 1H63A 2V82A 3LHTA 4ZQRA 1MEIA 2GVGA 2ZRXA 4X3ZA 3NDOA 1P0NA 3B03A 1DOSA 3LLFA 4U4MA 1AG1O 3PVFA 1VYSX 1O94A 3QRHA 5HR7A 4ADSA 2E77A 3HBLA 3NPXA 4O13A 4POCA 1ZCOA 3STFA 4ZQOA 1TPH1 4ML9A 3FIGA 4K8HA 3BG9A 1TPB1 2C16A 3DGRA 5L9FA 2ZZ2A 5L6UA 3QQ1A 1EIXA 4WY0A 4CQAA 1YXDA 1OYAA 4LY8A 1VRDA 3R12A 1VPXA 4AHPA 1HG3A 2YFOA 2P0OA 4IGHA 4OHQA 4O0ZA 4UTWA 4IXXA 1UJPA 1K8XA 4LC8A 3VE7A 1A5CA 4A29A 2V5LA 2PRHA 1OFOA 3U2OA 1YYAA 3E96A 1RZMA 4DF1A 2JGQA 3W1LA 3LM7A 3L5AA 2B0MA 3MW7A 1MXSA 3S9YA 1EUNA 1EUAA 1XBYA 4AMAA 5FEWA 3D0CA 5G1TA 2O7SA 1WOBA 4AAJA 1GQNA 1Q6QA 4BK9A 3PG9A 4DO4A 4N6FA 4FIRA 4U28A 3KFTA 1DORA 3NQMA 4JYEA 4UTKA 4GWEA 3WJYA 1GVQA 3T40A 1NF0A 2DJXA 1EPXA 3BK0A 3L5MA 3QPZA 2DZPA 1JCXA 3EX3A 2RDWA 3PB2A 4BI5A 2B7PA 3G8EA 5D32A 5G4WA 1AMKA 4HHPA 2GJNA 3IV3A 2EF9A 1Q3NA 3CIXA 4XZ9A 1XDLA 5DCBA 5BMXA 3M7WA 2VELA 1KLYA 1PHWA 3SECA 3G24A 2QAFA 1JVNA 5A5WA 4IMDA 4IUOA 5F1VA 4XWUA 1I8JA 3M5XA 1AL8A 4QISA 5KZMA 1Z41A 3EWXA 3P8JA 5HINA 3BVJA 5HNRA 1FDZA 3WK3A 1SR9A 1KFKA 2C15A 2B7NA 4UTLA 2OZ0A 1PCWA 3G1XA 3E49A 2GQ8A 2QCFA 2B4GA 1W5MA 2R94A 1B4EA 2QUTA 1NVMA 2H3DA 4BWLA 1XDMA 3MI6A 4O4VA 4R34A 3CLMA 4UIOA 3HJZA 3I65A 4ZMGA 3HPSA 4TIMA 3GDKA 2ABBA 3C3NA 2E5BA 4AXKA 1X1ZA 3CB8A 2QCDB 3NXFA 3TKFA 2I1OA 4MY1A 5E93A 2YW3A 4JNMA 3GX9A 4GJ1A 2ZQ0A 4PL1A 3NM3A 5I3FA 3OVQA 1YLVA 2TRSA 3PR2A 2CLKA 4BI7A 3IVUA 4N9DA 3LRMA 1WX0A 2C18A 4I7VA 4M7SA 5IM51 3NR0A 4WOQA 3STCA 3W2UA 1N55A 1CX9A 1XFBA 5CPNA 1VHCA 3GZ3A 2J24A 2YGYA 2ZZ7A 3LCHA 2HMCA 1O5KA 1B4KA 5KITA 1GG1A 3GXNA 4IMCA 3LBMA 2E5DA 3DFSA 1KTCA 3G22A 3W7OA 4ADUA 5CZSA 2Z6JA 3M5ZA 1SU5A 3TV8A 5D2XA 1WBHA 1NEYA 4P2VA 3W88A 4JEQA 5I3GA 3NQVA 5HJLA 1C9DA 4M7TA 3STGA 5F2IA 4ORIA 5K9DA 3H54A 5F4XA 3IIOA 2GVJA 3K30A 5LKYA 2Z6IA 5DY3A 1YXCA 4NX0A 5C6MA 3TMLA 1W56A 4GC4A 2ISWA 4UFMA 4NT0A 1OX6A 1V5XA 3JS3A 1SSDA 2YW4A 1D9EA 3S8HA 3WJWA 1A5BA 4Y9AA 5BW6A 3S1XA 3W1RA 1LBLA 5AHFA 1IGSA 3DFTA 4UMBA 4FNPA 3E0IA 3RK8A 3W73A 4GUFA 3NQAA 4UR7A 3HGJA 1H7WA 3DU0A 1F5ZA 3IGSA 4LVFA 3P61A 4UMCA 5FEXA 4B5NA 3G1HA 5D05A 3A5VA 3BW2A 3B0VC 4OT7A 3LOTA 1MZHA 1FCBA 4A21A 5EYWA 3T7VA 6TIMA 1AW2A 4Z1BA 1XCFA 2CLHA 3OHIA 3G1FA 1KTNA 3W2JA 1YTDA 1ZAHA 3GXTA 1AK5A 1W1ZA 2E6DA 2DZSA 1JQXA 2V0TA 5AN7A 4FEZA 2R14A 2V9DA 3BGGA 1OFPA 4YWIA 2J6XA 3VFLA 1W31A 2H8XA 3W7LA 1WV2A 3W1NA 5FEPA 3IEBA 4HPJA 4NZJA 3RNDA 1WA3A 2A2IA 3TNOA 1KM3A 2BXVA 3TJLA 1EP3A 4E2DA 5KINA 2A7RA 1OJXA 1W0MA 3HB9A 3LHUA 3PWAA 3PSWA 3KAOA 1GT8A 4NJHA 4PL2A 1IXQA 2OCZA 3O6CA 3Q94A 4QIUA 5DCEA 4TMBA 3CEPA 3GAKA 1E51A 4HSNA 3L0GA 3O8AA 5HQEA 2Y6ZA 1O5XA 3GR8A 3TQVA 3W70A 5SWUA 3GDRA 4M6QA 1AW1A 4MJMA 1TTPA 3IRDA 3OVRA 1TJPA 3M9YA 4YL2A 4ZQPA 3UWYA 2XFWA 3LCXA 1PL9A 3WK0A 1DQXA 8TIMA 2AQWA 3DBPA 4ORMA 1AW5A 4K8EA 1VYPX 1XKYA 4WY0F 1KBJA 4EIVA 1HTIA 1FY6A 1UUMA 3NQGA 3M43A 2V8ZA 3A21A 3V1PA 3NA8A 1GPWA 4LRSA 2HTMA 3BO9A 1ALDA 4UFLA 3WJXA 1KBIA 3TSDA 3W74A 3S5OA 3UQNA 3EWZA 2YPIA 5CZTA 1WAUA 5C5YA 1TJRA 3THAA 2H3BA 5HWNA 3L5LA 1TPDA 3MWAA 2VENA 1R2RA 1Z42A 1YPIA 3QC3A 3NQ6A 1O60A 3HGRA 4IPIA 5CZ0A 4I9AA 1R47A 2V2CA 4UC5A 5EBUA 4AH7A 3TE9A 3DKLA 4K7YA 5D33A 1FWTA 5FF7A 1VC4A 2DP3A 5DBUA 1EEPA 3NPWA 2C13A 3PY2A 4PA8A 4UNKA 2E5CA 5D03A 3A22A 1YDNA 3NVTA 1L2UA 2R91A 4MPQA 2ALDA 2Q8LA 1WDWA 2AGKA 2ZYFA 3Q2DA 4K36A 3QMSA 4UFHA 3DFPA 5IBXA 4LV9A 2DZTA 4XKYA 3UPBA 1R2TA 2HS8A 4AHOA 1BWKA 1M7OA 3LXCA 3TQKA 2NWSA 5F4SA 3P74A 3W1QA 5MHBA 4JR5A 1L6YA 4TU1A 3W7MA 2NXGA 3LTPA 1EWDA 5EMUA 1LRNA 1ZENA 2X16A 3MHFA 3W7KA 3HGSA 4LS1A 3GVGA 3V75A 1NSJA 1TQJA 3R2GA 1J4EA 3NQEA 1LM1A 3TAOA 3W86A 3KVLA 2ZFAA 5D38A 4AF0B 3W84A 4MVAA 4C1KA 3CHVA 3Q37A 1FUYA 3LDVA 2ZBTA 1GZGA 2NLIA 4JDBA 1IIGA 3NQDA 3QZEA 4TR9A 1DL3A 1XL9A 3LHVA 2ZRYA 2XN0A 3WJSA 4BFAA 4KKXA 3P60A 4FX6M 4JTFA 3LRLA 5EA9A 2VOMA 1TPC1 2GQ9A 4PEKA 4KFOA 2Y88A 1KM6A 1VHNA 3F4NA 5G2WA 5E1QA 4OWGA 3F03K 3LI1A 2PCQA 4O17A 3IVTA 1J2WA 1Q6RA 2H8ZA 3TFCA 3LV6A 4R53A 2P10A 1HUVA 2E6AA 2QCNA 3N14A 5CSSA 3L0KA 2FDSA 2PE4A 3M5YA 2DZXA 3PBVA 3CU2A 1FWNA 3JR2A 3P84A 1R46A 1GEQA 2QCCA 4XBKA 4RZ6A 4RXFA
chains in the Genus database with same CATH superfamily
1CI1A 2RJHA 3R7MA 3MKKA 1K70A 3HN3A 1B3VA 1YHTA 4GOAA 2XINA 1LDCA 1J0IA 2DZAA 4KRUA 2GGHA 1ZJHA 3K13A 1PV8A 1KFWA 2EG6A 4D6CA 4HYWA 2FH8A 1KXVA 4IFOA 4O1DA 1SSGA 2P1FA 1DKWA 3IJLA 3RU6A 5EL1A 3VAVA 4LJ3A 2BLEA 3GBDA 1ME9A 2CLPA 1VFFA 5JBFA 1PS9A 4C6OA 1LQ0A 4OJYA 1TELA 5CPLA 2HNHA 5DF0A 4IMFA 4ATDA 1G1YA 3W2KA 2EAWA 3SURA 3DESA 1JAEA 1ZJIA 1UKOA 2DUAA 1JEZA 3KBNA 1CECA 1XGZA 3ONBA 1GOQA 3TC7A 1F7BA 3H2FA 2YKKA 1S2CA 3SUUA 3VD4A 1QNPA 4L9YA 5AOUA 1SZFA 4OBTA 3S3GA 1GVRA 4WDWA 1EZ2A 3TIMA 2GFTA 5HOSA 2DJLA 1ISVA 5H2ZA 4GVFA 3CHEA 1ZALA 2CLLA 4GQBA 5BRPA 2AGTA 4TVUA 1NF7A 2ZZ4A 4AY1A 1S2UA 2Y5JA 1QOQA 4CN4A 1IEWA 2DU2A 1OIFA 1W54A 3H23A 4DWSB 4A8NA 5CG0A 3GKFA 1ICSA 1F4AA 3E0VA 4W86A 3UETA 3VO0A 4UCFA 5LGXA 3H55A 1ADSA 1F76A 2FYMA 1O6IA 4CKQA 3SR7A 3RX4A 3VGEA 4KPLA 3T4CA 4F48A 4Z42C 2DZVA 4KIRA 4CCDA 1DJHA 1WKYA 1VEOA 1W32A 1W5NA 1HVQA 4ZSUA 2X7WA 1NFGA 2QIWA 5CEWA 3TR2A 3EEGA 3F5LA 3C2VA 1ITCA 2C3ZA 5HANA 1V8EA 5M5DA 1EJWC 1Z44A 1W5QA 4B5UA 2YFNA 4UQBA 1XQLA 1RBOB 4LUYA 3D47A 5H8UA 1T41A 3JW7A 1ITXA 2AOSA 3HPAA 3MUXA 2PAJA 4MWAA 4Y96A 3FA5A 5FF4A 3AXMA 2DT0A 2VZVA 1FXQA 1E0TA 3OU8A 3B8WA 4M5PA 4O11A 4A3QA 1F8IA 5G1YA 4PC8A 3VKJA 2HPIA 2DH2A 2A3EA 3M1ZA 2VVNA 3OG2A 1H7PA 2EXOA 1ZAIA 4E2OA 4JQAA 4MUPA 2WLZA 2GDUA 1TO3A 3W7HA 2XN2A 1ODZA 3FJ4A 3NNTA 2YSWA 2CLMA 4LCRA 5LIXX 5HBFA 4IX0A 5I2UA 3GSMA 2FFIA 4N4PA 3OA3A 5MKGA 3W75A 4W87A 3TWBA 3N2BA 5I06A 4WSJA 1J8VA 3NOEA 2PA6A 4A3UA 4EXAA 3IK4A 2C1GA 4RNHA 3SRHA 1MQQA 1BGAA 1B1YA 1YPXA 1X6NA 4DYKA 1TIWA 4JX6A 2ZX8A 3COTA 4NL1A 3OODA 2DIEA 1WKEA 3FYYA 5HNNA 4GNKB 4YNGA 4RZ5A 1OC5A 1YNQA 3H7UA 4IJRA 1H51A 3P3BA 2WWCA 4TX6A 3I4KA 4D8ZA 2JEQA 2E1WA 4LAKA 2VDHA 1LCOA 4IQLA 3URQA 1XUUA 4C1LA 2VX7A 2GDVA 3B06A 2HNEA 4DF2A 1BYDA 3PC0A 5D9NA 1U1HA 3JZEA 1C92A 3OEXA 1JZ2A 3T07A 1NFPA 3GNNA 4ZQNA 4O8AA 5TNVA 4PRRA 1LZOA 4MYAA 1H0GA 4ZOCA 4G8TA 4L1GA 2Z24A 5G2HA 2J4GA 2OKOA 4CCZA 4Q8PA 4JXCA 3HG3A 2FVMA 2OEJA 4UQEA 3WF4A 3CLWA 3UNDA 1K6WA 1US2A 3HQOA 4GY0A 4QSHA 4FP1A 3R13A 2VGFA 1PDZA 2CLIA 3CAWA 4NRRA 1B3OA 4JN8A 3FNDA 4FR1A 5CPMA 1EP2A 1PZ2A 3O6DA 3NZPA 1KM0A 1ZBKA 2BSLA 2QJNA 4X60A 3N9SA 2DDXA 1LL4A 4DUVA 4W7VA 2Q71A 1SO5A 5DMMA 1UUQA 2Z1BA 1ONRA 4HA4A 1FH7A 3CUJA 2XM2A 1IT7A 2X1IA 4PB3A 5HMFA 3W37A 1BGGA 4IG2A 2PDUA 2Y7EA 2YR1A 3CB3A 1ZSXA 2V2HA 3MUZ1 1XYCA 3LSCA 1TCDA 2ZA2A 5EGRA 1TFVA 4FPSA 3PUOA 1CLXA 4FMVA 1J5TA 3GQYA 1TV3A 5LZLA 2E68A 3UWVA 4P7LA 1WE5A 2D3LA 4HN4A 5C55A 3RDKA 3EDJA 5CGMA 1E0UA 2QAPA 1IE7C 1DIEA 2OSXA 3S42A 1MW2A 2PDCA 3GNXA 1E4NA 1OABA 5JQ9A 1S2AA 4HPHA 3B8VA 1IEXA 3TYAA 1K02A 2QCHA 2GVYA 1QI5A 2D73A 1AQFA 1M6JA 1W1VA 1UD8A 4QJ5B 4BQ3A 1DWJM 3VIKA 3GUGA 3PZMA 3TROA 4C6NA 3OTRA 2CERA 4F2BA 1D3GA 3AHXA 1XLHA 4OKDA 5MKGB 5CXPA 4W5UA 4M51A 3KWSA 3TZFA 4QRNA 5EU9A 2G3MA 3S1WA 4O0QA 5HPOA 1X96A 4NJKA 3K2GA 2NQ9A 2H6RA 3OVGA 3TOYA 2QCEA 3FLUA 4IPLA 3OGVA 5CQ1A 1KFLA 3WNOA 3W27A 1ZRQA 1K7XA 1MNZA 4A22A 4XVEA 3TFXA 2W27A 2CNCA 4CQDA 3EB4A 1WUEA 4R7WA 3LM3A 3W28A 2C7FA 3IIZA 3RILA 1J6PA 4E2BA 1OX4B 1ZGDA 2DW7A 2YBTA 5C2XA 4JTEA 2FQIA 3WF2A 1H7NA 1DBTA 4QS5A 4UNIA 3GHSA 1EJSC 4XTIA 4Y9PA 3GHTA 3VK5A 3B9NA 4HZ6A 1L9WA 3CV1A 1KV5A 2Y70A 3O2LA 4Q8UA 1VRXA 5E9AA 3VD7A 3RO8A 4DB7A 1E40A 2VCAA 3I6EA 5KTLA 3EXTA 3TMQA 1XIDA 2WBKA 1G9HA 4PN2A 1RR2A 2J8GA 1D8CA 5TQLA 2YZ5A 4HJWA 2J88A 1WBJA 2XYLA 4ACZB 2OJPA 3PF3A 2Z4GA 1IEQA 4CN6A 1KR0A 1DJWA 1BG9A 2QS8A 1QPRA 2V5BA 3IJ9A 3SGGA 1TX0A 1D7KA 3DHFA 5A69A 4FB7A 3IJ8A 1Z48A 1CB7B 2VC7A 1SPQA 3ZJKA 1UR9A 3BLOA 2ISDA 1E73M 1NQ6A 5K4ZA 4N6EA 2QV5A 3IGUA 4I5RA 2VEFA 1XGEA 5HAOA 5J04A 4Z2GA 3D3FA 3B0PA 1TPEA 1JZ6A 1HN1A 2I14A 2C0HA 2Y5SA 4C6FA 2FTWA 1L6FA 2PD5A 1RJQA 3MT1A 1BFNA 3QPYA 3A3HA 3MA8A 1KQZA 1I1XA 1HJVA 4EK7A 4JDYA 2V3EA 2B7QA 1G94A 2Q09A 1U5HA 3G1VA 4PR4A 2YCJA 3UWZA 4LSBA 4U2YA 1GOXA 1YW1A 1TPVA 2WJZA 1KM2A 4HHMA 4HU4A 2HEJA 3SCTA 2EPHA 2ZX6A 2XZ9A 1QCWA 2HQAA 3I7RA 3OO2A 1RJRA 1MMFA 2H9AB 3WH5A 4DBWA 3U4AA 3ZS4A 2PU0A 3BE7A 3M46A 4U31A 3PZVA 4C6MA 2OODA 3LV5A 2GZXA 1Q7MA 2EGZA 4PBEA 1A0DA 3T2OA 4GE8A 4BWLC 3VXGA 1TSIA 1XCWA 1L0PA 4K1WA 1KO0A 2YZRA 4DJFA 4O57A 4HA0A 2VNCA 4M1RA 3ABRA 1I2OA 3WELA 3W7JA 3RR1A 3VKBA 3SGZA 3AFBA 1QBBA 2BBFA 1OCBA 3NDYA 3VGFA 3ITLA 3W23A 3ZWTA 3P7YA 3A23A 3G1SA 5FOOA 4NNCA 3V5CA 1DWAM 4J28A 3UWQA 1ZBWA 2QYGA 1WZAA 1KCLA 3GTHA 2OKTA 5I3JA 4QS6A 2W92A 3EKZA 2W9MA 4DXKA 2QQ6A 2OYLA 4D6GA 5F2MA 3ES8A 5A1AA 3BDKA 2PDIA 3E2SA 1TE6A 3FXGA 1HQTA 1TV8A 3TK7A 3B8IA 5LIKX 1QI0A 2J13A 1BYCA 1UR0A 2Y61A 3VI2A 3WNMA 3KVMA 1IXNA 2O9TA 4M19A 4AU0A 3L4YA 1T0OA 3B0UX 1U2YA 4JYFA 1WDRA 1V6TA 1UJQA 4CCCA 3NVDA 3SY5A 4DO5A 1Y8BA 1HNYA 1H1YA 4L7ZA 4O52A 2HXTA 3WBXA 1JYXA 4Y9OA 4ZFCA 3ZLGA 1R3RA 3FEMA 3AZTA 5REQB 6XIAA 4F79A 3L7RA 1JF5A 4M80A 3KOFA 4ZXLA 1M7XA 4PCFA 2NSOA 4RL3A 3CV6A 4DPQA 4BEUA 5DRCA 5LHEA 1XLLA 1W3IA 4Q6XA 6TAAA 4UZUA 3F5KA 3G8RA 4MADA 5CZJA 4J35A 4Q8VA 4PUUA 3NWRA 3P93A 2IW0A 1LP6A 3BPWA 4C1NB 3A47A 1D3CA 2WMKA 4ZE5A 4NF7A 1XLFA 2ZUTA 3AWOA 3N4EA 3HZ3A 2V3GA 2PDGA 3QZAA 2Y8VA 4HPXA 5LIUX 1XSIA 1AUSL 3S47A 3UEQA 4S3CA 2Y63A 2AAMA 4ZO9A 4DELA 4MKSA 5DX7A 1DQWA 1VFOA 1XIBA 2C0AA 3AHYA 4QDPA 1JZ7A 5G5IA 3AO0A 3ZJ7A 3W7RA 4AXNA 3VC5A 3KRSA 2ZTJA 2EBNA 1UW9A 1ICQA 2O7QA 3C86A 3N4FA 2FTYA 1B9ZA 1SO3A 1SW3A 4UXDA 3T44A 2UY3A 1DXEA 3ITYA 2GLKA 5D8ZA 1P1MA 3W7DA 3VIIA 3VNDA 3TN6A 4DYJA 1DXFA 4HYRA 1MW0A 1UOZA 3ZIZA 2A1YA 3WZ0E 2PZNA 4EVZA 3F7JA 3V7PA 1PTAA 1BWLA 3EA2A 3G18A 1CXEA 2BHZA 4WRHA 2VC9A 4Q32A 3BARA 1EJXC 4TX8A 3PANA 5EMYA 2PP0A 2P88A 3ELFA 2GWGA 3B0YA 2ACUA 5HQLA 3BH4A 1SYTA 2QW5A 1H1ZA 1YADA 3EB2A 3UY7A 4Q8MA 5ABTA 3E12A 2W79A 2V81A 3RX2A 4S3DA 1Q85A 2YXGA 3AC0A 5DLCA 4A35A 5U7SA 1C8QA 3PJTA 3SADA 3N3MA 3G3MA 4OIFA 4GUHA 4GYKA 4WDXA 4EOUA 4DAIA 3M44A 3Q4DA 4MKVA 2Q02A 4H6QA 1W1TA 1FWAC 1UWRA 3QV8A 1UHVA 4JCLA 4Q8NA 1V6YA 3P0XA 4HZ8A 3N9RA 1NOFA 1Q66A 5FCZA 3PFRA 2RKXA 3GXDA 1G4SA 5D2TA 1BVWA 2HROA 1JRCA 4RK8A 4NUWA 1L6WA 4QXIA 4P7OA 4KCVA 3AYVA 3J7HA 4ZOBA 3RMEA 3UGVA 2PGFA 1UD5A 1RA0A 3WL1A 2Y7GA 2MUCA 4PMUA 2WMFA 3O07A 4YCPA 2G95A 4JEJA 4L9XA 3ME3A 2E40A 5I7GA 3CIVA 1VB9A 1A3HA 1F6KA 2X1SA 3TSMA 4FX7A 1XLCA 3A12A 1J6OA 4NSBA 6XIMA 1FTXA 3ATZA 3B05A 3UZXA 1BPLB 3MCNA 3BW3A 3AMCA 1GOOA 4E8CA 2FIQA 4QDWA 4O8RA 4K68A 3MO7A 5AYIA 3NSXA 4DQWA 1FWHC 2G5WA 1TV2A 2ZA3A 3TW7A 2OELA 1EF2A 3II1A 3UG8A 1M53A 3S5YA 3G0UA 2VC5A 1W1YA 1ML1A 4IL0A 1F07A 3TWAA 3OPSA 2JFEX 4Q8OA 1KM5A 3WO8A 1QPNA 1I75A 3ABZA 3VD9A 1TR1A 2JEPA 2PEVA 4G7FA 4B9YA 4R7OA 1C91A 3CS2A 4WDTA 3QR1A 2I17A 5I3KA 4IIEA 1XIEA 4AYSA 3IRSA 4NI8A 1W8SA 3AS2A 1NWRA 5A6JA 2OB3A 4LANA 1Q13A 5FJJA 3TQ0A 3D5HA 3SCOA 2AMGA 3TN3A 1SZGA 3TW6A 3WBEA 1KV8A 3BZGA 1BEUA 2BVTA 4DIAA 5CG7A 1QVBA 4NAFB 3HTWA 3VC6A 2X0HA 4RDVA 3VMNA 3RYSA 2ZUNA 4DJEC 4DWSD 1KWKA 4TOQA 2GUBA 2ZUUA 1G4PA 3HFTA 1EXBA 1J11A 4B15A 4CQ9A 1F6PA 1VCGA 2WYSA 2POZA 4BJHA 4HNUA 3BCFA 1C8XA 4MLJA 2Q3RA 3OBAA 2TODA 4E5TA 3WQWA 3L4UA 4N4QA 1BKSA 1AH3A 3MI3A 3SGUA 4PCTA 4L65A 4O14A 3KDNA 4OVXA 4KQNA 4QFUA 3TJIA 3R79A 1H63A 4YTQA 4GCXA 4H41A 2VURA 1H11A 2Z2BA 2PDWA 4ZB2A 2XISA 1XYAA 1Z3NA 3CAKA 3QRHA 3AI0A 2FDMA 2O92A 3RRAA 1PSCA 5CPSA 4QCFA 2BVWA 3HBLA 1VJSA 3AIWA 1XW8A 4C6JA 2J47A 2WCAA 3FIGA 1J96A 1GORA 1X1NA 2Z7KA 5L6UA 3B8SA 1A5OC 3TA9A 1EIXA 2Z29A 4CQCA 1VRDA 1Q2SA 3R12A 4AHPA 3VINA 4G2DA 1BSIA 2ZUMA 3TP4A 2QULA 1UJPA 3QTGA 1K8XA 2D22A 3AUJA 1OFOA 3THDA 4DF1A 2JGQA 1OY0A 1I0DA 3LM7A 5IXEA 1OCNA 4A3HA 3MW7A 4YU1A 3S9YA 3BGAA 5FEWA 5XIMA 3D0CA 1R38A 4JL1A 1GOIA 1WOBA 2WC3A 5FJOA 4YVPA 1GQNA 1Q6QA 1PAMA 3PG9A 4DO4A 4N6FA 4FIRA 3KFTA 1DORA 2Y8UA 5EMKA 4IICA 3MV01 5AVNA 3MO4A 2DJXA 3AMDA 2J8TA 3BK0A 4QEEA 2GSJA 3QPZA 1CGXA 2RDWA 2B7PA 3G1RA 1P48A 1LF1A 3O3RA 1JI1A 5D32A 4Z17A 4EAYA 5E0FA 3KL3A 2QV4A 5DCBA 5BMXA 5XIAA 1GVEA 3VUSA 1R3VA 5BWFA 1ZP3A 4ZO6A 3GG8A 5E6ZA 4OZOA 2A3HA 4XWUA 1I8JA 3M5XA 4XAGA 2DQWA 3NOYA 4I9MA 2W61A 4E4UA 3BVJA 4JHMA 3AUOA 1BVNP 2B7NA 4J1OA 3H6OA 3IJQA 2QCFA 2B31A 3WQ4A 2QUTA 3M0IA 3EA1A 1XDMA 3WD0A 4EE9A 4ZMGA 3HPSA 1E5JA 4TIMA 5DT5A 3REQA 5BWAA 4GH3A 1UZ1A 4LUTB 1AD4A 3K4DA 1EYEA 2ABBA 3C3NA 4YVXA 8CGTA 1KGWA 3H21A 1X1ZA 3CB8A 3N4AA 3HJEA 2QCDB 1NOUA 4MY1A 5HPCA 2FHBA 2ZXQA 1EJTC 3V0TA 4AZ5A 4GJ1A 3WD3A 4Q4SA 2CLKA 2F38A 1VFUA 1WX0A 3S2CA 2C18A 3ARTA 1P0BA 3STCA 1QNSA 3KDOA 3UJ2A 3W2UA 1P6BA 2CEQA 4JHZA 3IAPA 5CPNA 3LLXA 3N2TA 2HMCA 1O5KA 1B4KA 1TJ1A 5KITA 1Q65A 1MRAA 5TF0A 4IMCA 3LBMA 4ZO7A 3H4WA 4Y9NA 3T8QA 1EQCA 1SFSA 2PWUA 1SU5A 3OHMB 2OLSA 1WBHA 1LUCA 3W88A 2NVCA 1OZMA 3NQVA 3FW6A 2P0IA 3KE0A 3H54A 3LQLA 1EOMA 5F4XA 5D9PA 3PAOA 3K30A 3V16A 2YCKX 5DY3A 1U1JA 4W85A 1MZRA 2POTA 5C6MA 4H01A 1W56A 2I9UA 4PUNA 2IS7A 2ISWA 1VPQA 4UFMA 3M64A 3FCPA 3KOZA 1D9EA 4F40A 2QDEA 2Z00A 4EXBA 3E74A 4DZ5A 1W9UA 4GFIA 4IIFA 4ZEPA 3EPOA 5G1MA 1XCXA 1T40A 2J25A 3HGJA 3SY1A 4UMCA 1EOKA 3LPPA 2BOEX 5D05A 4ZE4A 1M9HA 2I57A 3PBGA 4GXWA 4GX9A 4GJJA 1K77A 2PI6A 3ITCA 4OT7A 4DI9A 2WJEA 2XSAA 1FCBA 4X2PA 6TIMA 1AW2A 2YA2A 4Z1BA 3WLPA 1YTDA 5LIWX 3GXTA 2KAUC 3AIRA 2WVSA 1W1ZA 2E6DA 3GW0A 1L2QA 4E4FA 2V9DA 3BGGA 1RCXB 3PHAA 4YWIA 4H7CA 3LQGA 4QE4A 4A8IA 3L23A 1W31A 1WKDA 3W7LA 1V0NA 3VYLA 4H9UA 3O0KA 5FKYA 5DO8A 1YDYA 3RHGA 3TNOA 4Z2LA 1CT5A 2X2YA 1EP3A 2WMHA 4UTFA 4B5WA 4E2DA 4PMOA 1IT8A 3CXOA 4XKMA 3GDBA 3M0KA 3C0SA 3QPEA 4D9PA 2XSXA 5AZ0A 3RXZA 3UZWA 3O6CA 1NWTA 3BQ5A 2PP1A 1UQZA 3W4RA 3PJXA 3ZQ9A 5HQEA 1EF3A 1O5XA 2ONEA 3W70A 5SWUA 3GDRA 4YTSA 3G2GA 3F2DA 1GPFA 3V5OA 2QUNA 3OVRA 2WQDA 4YL2A 3AISA 5REQA 4EAMA 1EJVC 8TIMA 1W3KA 3LNMA 1M1BA 1UC5A 4K8EA 1ONXA 4TV5A 4ATWA 1UUMA 3NQGA 2VRJA 3B0XA 3A21A 4EPEC 4ZCWA 1FWCC 2ZUWA 1W9PA 3PP7A 3U0HA 3KCOA 4UFLA 3WJXA 3S5OA 1GGOA 3U5UA 2YPIA 2QIIA 1UR1A 2ZXAA 1JPIA 4J3XA 5HWNA 1TMQA 1OGGA 2QJMA 1DYSA 5D9MA 1TPDA 1WZMA 2PDPA 3MWAA 3ZM8A 3T05A 1E6PA 4UOZA 1Z42A 3I3DA 3SN1A 1PKYA 3PJUA 2ESCA 2NQZA 3HGRA 1V6VA 4FLOA 5CZ0A 4I9AA 3SY8A 1R47A 5A6LA 2RGMA 1X98A 1HL8A 3DKLA 1VC4A 4GO9A 4AQLA 1JDCA 1EEPA 4Y8EA 2E5CA 3KCJA 3A22A 1H09A 2WHMA 3RITA 3NVTA 1Z89A 1B0IA 6REQA 2ALDA 4BA0A 7XIMA 2AGKA 2YCIX 3C0QA 4K36A 1E6NA 4LF2A 4I90A 3DFPA 5CLTA 4LV9A 2CBVA 4OBRA 1EBGA 3AHVA 3W38A 3TQKA 5F4SA 4D8AA 3P74A 3KS6A 4HD5A 5MHBA 4HOXA 1MQRA 2X8RA 3IUIA 3HV9A 1PYFA 4NHVA 4FXFA 1P7TA 1E56A 1LRNA 3MHFA 3EMQA 4LS1A 4PCPA 3GVGA 3NQEA 4L4PA 5C70A 1XISA 3ZT6A 1Q2RA 2OQYA 4QEHA 3FDKA 2CHOA 2NLIA 3TYBA 8RUCA 3DGBA 2PDNA 2XN0A 4KGLA 4BFAA 4PTWA 4E3VA 3P60A 3FHAA 1AQHA 4AY7A 2NQ5A 1XIJA 3B9EA 1WZLA 3LI1A 3DEQA 4IISA 3IVTA 3MMDA 1VKFA 1J2WA 1XX1A 3KEHA 1KKRA 1O5RA 2OEKA 4GXPA 4DHGA 5CSSA 3L0KA 1MW3A 2HVNA 2RJGA 2FDSA 4KCWA 3M5YA 1EGVA 2DZXA 3PBVA 5A6TC 3GU2A 5ABFB 4RXFA 1R46A 1V0LA 2EPNA 5D2YA 2Z27A 4ERAA 3IUHA 1US0A 4CQ8A 3A64A 2GL5A 4AD4A 3TXZA 1NQKA 4J40A 4LU0A 1EDQA 1OINA 4O15A 1XRSA 4EWJA 3GS6A 2X1RA 3NYZA 2P3ZA 1Z7AA 1UBSA 4G56A 2ZRWA 4AIUA 4UZSA 3O05A 3FJ6A 3W7IA 2WQPA 3M41A 1LRQA 3DG6A 1TR9A 4CVUA 1O4UA 1HO1A 2JQXA 1T6MA 2BHUA 2ZC1A 1VFLA 1K3UA 3GTFA 1Z69A 2YBVA 4MFDA 3DENA 1IR2A 4RV8A 3T0AA 2RDTA 3LXBA 1JAKA 1NY1A 2OTDA 3MP4A 4I7UA 3LTYA 4H8NA 7TIMA 3DUGA 1T99A 4Z1YA 3AU2A 2BASA 1Q7ZA 1M5WA 3LS9A 3CNYA 4PMYA 2WZIA 4S1FA 4IXHA 5LA1A 3WEMA 3AOFA 5JH1A 4WOZA 4BEQA 1JF6A 2DT2A 1SFLA 1UQYA 4OE7A 2A3AA 2ASHA 2VFFA 2NX1A 3ZZ1A 2Y0FA 3TSBA 3EXSA 3FSUA 4LB4A 3W29A 1TREA 1UWQA 2NLYA 5BU6A 5A8GA 1NU5A 1VR6A 1OWQA 5JIPA 3CZGA 4MNKA 4JTTA 1MNSA 3IS4A 4JTGA 4GVGA 1MFVA 2BY1A 2TMDA 1QHPA 1UD4A 1K4GA 2Y85A 3EKGA 3V3WA 2Y62A 3SQSA 3ZR4A 2P5NA 1A3XA 3G5EA 1H41A 4ZR8A 5T9BG 1XYZA 1FFQA 4YTRA 3BJSA 3LCWA 1GYNA 1R3QA 2QJJA 3ZR6A 3AHZA 4R9OA 5G4EA 1Y5WA 1PIIA 4XD6A 3AU6A 2FFCA 3PM6A 3RMJA 3WBWA 1GEHA 3LCLA 1H61A 4H00A 1Q45A 3NM1A 3EX1A 4P61A 3QY8A 1YNPA 1GG0A 2D24A 3UCCA 4EF8A 1THFD 4ALDA 1DJXA 1WQ5A 2A0NA 3CUHA 1CLVA 4DNHA 4R5EA 4X61A 3BLEA 3SUWA 1UKSA 4CNSA 1EPVA 3IJDA 9XIAA 1OK6A 1OFAA 3RCMA 4C6KA 1I1WA 4E38A 1TMHA 1CGUA 2QDHA 3GTXA 4UOJA 3W7GA 4XV0A 3CMFA 4N9EA 3L67A 3UYCA 2O9OA 2AKMA 3ABSA 4GNJA 4IPNB 4RJEA 4P8VA 1TYGA 2HSAA 1IQ8A 4ECLA 4RE3A 3WLHA 1UR4A 2D2OA 2B81A 3C5QA 3CGTA 2A21A 1QK0A 1WXYA 3P81A 3E1F1 4HYVA 4IGNA 2D69A 4Y6GA 1OFQA 5FA5A 4UTMA 4JHOA 3OBEA 3O16A 2E9LA 1VD6A 3DYPA 4KCTA 1UB3A 1EGZA 1OFBA 2NQLA 4INFA 2VI0A 3C56A 1V6UA 4HN8A 2XVPA 4GACA 4MLRA 4QE1A 4PEEA 5HUOA 4HCHA 4GC3A 2DW6A 5JU6A 1G0CA 1WPCA 1H2JA 1VFHA 5A6BA 4Q4RA 3KVJA 3MTWA 3UJRA 1TA3B 4A8LA 1QWKA 1GVOA 3C2OA 3SN4A 5AHLA 4UQCA 4PBGA 3LZ5A 1HJWA 3G0SA 2ATMA 4XD4A 4A4AA 4I6VA 4AWUA 4MUZA 5LNVA 1TPFA 1MUWA 1SVDA 4BQ5A 2OT1A 2WSRA 3R8RA 3T08A 1J93A 3UBPC 1QMLA 4JX4A 4L4OA 1PBGA 1CTNA 5CGQA 1RLDA 3MQTA 1XC6A 3VFCA 3C2RA 4D1IA 4WXZA 1T5AA 3V0SA 1O66A 2CLOA 1F3WA 4NAEB 1GVFA 4NXKA 4H6KA 2XFFA 3TTQA 1XRTA 4MTVA 4NZFA 1FWSA 2OLAA 3INPA 2VT0A 3H4XA 3LX9A 3UXAA 4C60A 3LG3A 2FVKA 4P8XA 4US5A 1E0WA 3WH7A 1C8YA 1EB3A 5CC6A 3T78A 1X8CA 4JN6A 2CZDA 2Q3OA 3G0XA 4DJDD 3N12A 2Q01A 1TVLA 3BC9A 4O28A 1DHPA 1O1ZA 3MI2A 4DO7A 4JIRA 5AYXA 3FA3A 4FX8A 4CNOA 4IFKB 1CXLA 3EKLA 2A7PA 3CL8A 2R8WA 4I7WA 4C90A 5AB3A 1V02A 2VQUA 1B57A 3W7EA 4N9BA 1FWEC 2PGEA 2P53A 4O1BA 3PG8A 2IPWA 3ZOAA 1PWMA 1UR2A 3NZRA 3HM7A 3WLKX 3S5SA 3UA4A 4L1XA 4WY0B 3TYUA 3RLUA 2VXNA 4GQRA 4UNLA 1RY8A 5AC8A 2BX7A 3GG0A 1FBAA 3BMVA 5FJIA 1W5OA 3O15A 4MOZA 3ARQA 3AQUA 4JOMA 5B7YA 3MMWA 1REQA 3CZLA 1X6UA 1NOWA 1P5BA 2HXUA 1E70M 1YMYA 3CUGA 1SQ7A 2RHGA 3G1AA 1ZCCA 4Z0SA 4QLJA 3VGGA 3RF9A 5PTDA 5K9XA 3WG6A 4LVAA 2G96A 1Z9AA 3C4UA 1AJ0A 2CPUA 4MKNA 4JTQA 5JMUA 4R88A 4H8UA 1EA0A 3TU9A 5K7JA 7REQB 3UZJA 4E8GA 2ZRZA 1EKOA 1TTQA 2VL4A 3BAJA 3I4EA 3W53A 3RUBL 2DZWA 2RUSA 2F61A 2ZKMX 1Q5MA 4Q4PA 4LBUA 4LUIA 3AS3A 3E0FA 1XYFA 3MJYA 4XD3A 1RBAA 9XIMA 4WF7A 5IRPA 2ZX7A 3UY8A 4HCDA 1QDSA 4YYFA 2HK0A 5G2IA 4BZYA 4M6PA 1FOBA 5LNUA 2WKJA 3POHA 1B30A 4BY3A 3H70A 1KR1A 4GFSA 4IPJA 1GKQA 3ARVA 4QG6A 1NM9A 4O1CA 3DBNA 3MZNA 2PD9A 4J9JA 3MP5A 2PF8A 3WN6A 4DJFC 1E15A 3HFYA 3URNA 1OZQA 4DBSA 4TTUA 4UTIA 5BOOA 4I5UA 3BGJA 1PE1A 3HV8A 3VD3A 1GZ1A 2V3DA 3CTTA 3GK0A 1FKWA 2D0FA 4CNNA 1E1FA 3IVSA 3CYVA 4OFCA 2REQB 4AYGA 1KFBA 4BKNA 2BOGX 1PKNA 4ML4A 4HNTA 4K38A 1FWRA 3UF9A 4YIWA 4S38A 3WYZA 3KOXA 2B7OA 3JUGA 4X22A 2ZA1A 1RQHA 4S3KA 3R94A 3HGOA 3H12A 2GUUA 4GI8A 2FPVA 1ZPTA 4X2RA 2P8CA 2E67A 1CGVA 4M6VA 2P76A 2A6NA 3B8TA 5GJNA 1SFTA 1B2YA 2CKRA 2KZHA 2R82A 4WX2A 1DXIA 2UWFA 4D6EA 2XVKA 1P6WA 2LLEA 2O0TA 2PTZA 4M6UA 3GNRA 1VF8A 2I56A 4UMAA 3TXVA 3RCYA 3S5ZA 1K7FA 3KM8A 2ZDRA 5C9UA 3DN5A 3NTYA 4H04A 4AWSA 4GGBA 3IIXA 2TPSA 3E5BA 3R58A 3UXIA 2PDYA 1N8WA 4LUJA 3GVQA 3H8AA 4E0CA 3CL6A 1X39A 4FALA 2A3CA 4IIBA 3ZSTA 3R0UA 4R33A 3UD6A 1EA9C 1FWWA 3R0KA 3C2YA 4A8RA 1PX8A 5DELA 4FI4A 4LW7A 3N18A 4TV6A 3GD6A 4F8XA 2EKGA 2UBPC 3QW4B 3WKZA 4CNTA 4OECA 3MYOA 3VNJA 3WQPA 1GHRA 4XAYA 4KEVA 3R4IA 4PFMA 5I78A 4RKAA 1AFSA 4UFJA 3WMSA 1CLKA 3QJAA 5HDRA 3AIUA 4HCLA 2VR4A 3UVAA 3KX6A 1E4IA 2QGHA 1JI2A 2ZICA 2YA1A 4N0RA 3O7UA 3LMZA 4HNCA 3E9AA 5K3VA 3S4TA 3DAQA 2QKFA 4AZIA 2NSXA 3VTRA 1DJYA 4GJIA 1E0VA 1TIMA 1BQCA 2WW5A 1TRIA 3ABXA 1B3WA 2F7FA 2QLYA 1J0ZA 3TC6A 2E8ZA 5I3DA 2G3FA 4GRSA 5I09A 1KRMA 3T55A 2YXXA 1JDDA 4JIPA 3VGHA 2CLEA 3MDWA 3VX0A 4KFPA 3GDLA 1S5NA 3PTQA 1ZL1A 4GUIA 5CC7A 4JTKA 2DVXA 5DEZA 2WPGA 4IFKA 4D2JA 4KF1A 3TNBA 1KFJA 2YDSA 3EX6A 1OVDA 5T9CE 3LGDA 1PCKA 4O16A 2ZZ3A 1JYNA 2VP8A 1IV8A 3PZIA 1N7KA 3GH7A 2A85A 4ZQCA 1A4LA 4KRTA 1FHVA 1QHOA 1US3A 3S2LA 1U22A 3MP3A 7ENLA 3H2OA 4Q3MA 3EGJA 2ADAA 2A4AA 2E1DA 5FI8A 1K8CA 1CB2A 4N02A 4ICNA 4PE8A 4I8YA 1UR8A 2VYOA 4GI6A 3MCMA 1NAL1 4EPBC 1QFEA 1TWSA 1XI3A 2WNZA 1R85A 2AKZA 4J3SA 1Q6OA 4IIDA 2HPMA 1NELA 4RDYA 2VHLA 1XYLA 1KFCA 1YDVA 2UY4A 3B40A 1YE4A 4H6RA 1UA3A 4Y2WA 2OZ8A 2C1HA 5BOEA 3M0ZA 3C61A 3A4AA 2CZFA 1S5VA 1XPGA 3SFKA 4Q6JA 3WEOA 3GNDA 3W87A 3QEZA 2MANA 4GH1A 1T96A 1J9YA 5DXYA 1E9YB 3P8IA 3NL2A 3LNPA 2AQVA 4QAIA 3KOWA 1TPUA 3CC1A 2PPGA 1SMDA 3FA4A 4D8LA 2FMOA 4X9YA 3K4WA 4Z08A 5CAHA 4LY4A 5E09A 2I9EA 1EO5A 4HK5A 2F2KA 4LBSA 4EWND 2VCBA 3HPFA 3WQEA 3REQB 1JUBA 2WMJA 3VKKA 1ZBVA 1E1CB 2AL2A 4AC1X 3VZYA 1F73A 1JUKA 4PUEA 1UR3M 4XUGA 1WDQA 3WJZA 1SZNA 5BRBA 4ACZA 2XIIA 3TH6A 4A3RA 3DI1A 2G37A 4AX7A 4GY7A 4XZNX 1E4MM 3AALA 3THCA 3M0LA 1FWIC 3VOGA 1WDPA 3M7SA 2R24A 4MHBA 1E43A 1G7UA 1LYXA 4J3VA 1MVYA 3L4WA 5F7UA 2O4MA 3WD1A 2INFA 1HJSA 2J78A 2HBXA 1VCFA 4IX2A 2JGYA 2O56A 3VCCA 2A6LA 3N2MA 3GIQA 5KMYA 4I9TA 1DEDA 1QNRA 1DJQA 3NCOA 1GJUA 3SUSA 3EA3A 1G67A 2CZ5A 1MEWA 3O1NA 1XDJA 3PAJA 1TCMA 1JULA 3WLSA 4AMCA 4DWDA 1ISZA 2D3NA 5AHEA 1JGMA 1QO5A 3U2CA 3EMZA 4B3LA 3DYOA 1CW2A 3LTSA 3M07A 4G1KA 2ISVA 4IJBA 5IBXC 1XIHA 3VNKA 3TR9A 3JRKA 2YIHA 4C6QA 4DN1A 3UP8A 2Y1HA 4U2ZA 3NEVA 2H9AA 2Y4SA 3O06A 3OGSA 3EWYA 4XISA 2QUUA 5ABFA 5FJPA 3GB6A 1V0MA 2PDKA 3HIJA 4QNEA 3CIWA 3MMTA 4ZB0A 4YPJA 2EG7A 4MDOA 2VDGA 4MWAD 2WHJA 5H6HA 3OLEA 4LWWA 4FXJA 1NH6A 5HK4A 2OSWA 1UKPA 3BW4A 1X38A 4LPCA 3AJXA 4MWAC 1XIGA 3CQJA 2W91A 4OU1A 1QATA 3MANA 4ZSTA 2QVNA 1XG4A 3XINA 5U4NA 2OX1A 2J77A 1RD6A 3ANYA 3R0DA 1VFSA 3UWWA 2CU0A 2V2DA 3LCGA 3WQ8A 3QMTA 1F3TA 3DZ1A 3TCSA 3S5NA 1QOPA 3S9ZA 3VIGA 5BXPA 2FTPA 5A3HA 1R0MA 4OV4A 2JE8A 3N11A 3VM5A 3CQKA 1OF8A 5FF2A 3W02A 4Q4MA 4GUJA 1XV8A 2NV9A 1SUXA 4HHLA 3WUFA 3AICA 3V1HA 4AW7A 3MUY1 4G9PA 1Q6CA 3A24A 1JZ5A 3CL7A 3QW3A 5GVJA 3TCEA 1PKLA 5LIYX 3N73A 3OVPA 4D6JA 1OCJA 3Q58A 4AZ7A 4GABA 4JIQA 3KCLA 4FSAA 4U5IA 1E1EA 1OF6A 3HPXA 1JPKA 2NV2A 2NX9A 3GYEA 4O4WA 4RX0A 1OADA 4TX9A 5JIWA 3DHUA 3THQA 2BG5A 4DUOA 1UH3A 3TOPA 3W1UA 4KT2A 4K1GA 4PTNA 3WEZA 5E9XA 3CUFA 1KM1A 5I02A 4JBRA 3VIOA 4EACA 1QNOA 4UTUA 4B2DD 5D2VA 3W7NA 1LORA 3C3UA 4YHGA 4OUEA 1JDAA 3W00A 5IHSA 5F2GA 1NWUA 1RXOB 2X09A 2Z25A 1AJ2A 7A3HA 1CZ1A 1TA3A 5EB8A 4NU7A 3ZT7A 3A3WA 4FNQA 4KRZA 4GI4A 3CAVA 3PZOA 1NTHA 3SCQA 3WUBA 3EWBX 4HVXA 3V18A 1HKVA 1HKMA 3GO2A 5HR6A 5FJRA 5FSEC 1CXFA 3WK1A 1LOSA 1LWIA 3QTPA 3R25A 4IGMA 5DN1A 1WOAA 1X7FA 1UPMB 1X8FA 1XIIA 1GCYA 4DBEA 1MO0A 2FB2A 1UPPA 1BQGA 5FIPA 4KWSA 4IOTA 1OGBA 4WIWA 1VBGA 4NASA 2FZNA 2YCLB 4HBKA 4B16A 1GQIA 3SQLA 4X3ZA 1DWIM 4NZ4A 1GNXA 1Q6GA 2PP3A 3HQPA 4OUIA 4REQA 1F4HA 3NPXA 1OM0A 4IP5A 1ZCOA 5E0CA 3H2AA 3BG9A 1EHNA 3DGRA 4XVDA 2F2HA 1JXKA 1OYAA 3QV7A 3U57A 3PUGA 5I00A 2JIEA 1HZYA 3OOQA 4ERIA 4CD5A 2D20A 4H9YA 4HA1A 4OHQA 4O0ZA 3WDPP 3VKDA 4IXXA 2G8ZA 2J7HA 3GNPA 1A5CA 1YRRA 3PJWA 4A29A 1XSJA 2V5LA 4JKLA 1YYAA 1KRCC 3AMLA 4Q7IA 4MJ4A 4PTXA 3L5AA 1MXSA 2GYIA 4AMAA 2QPSA 2XGIA 5G1TA 4WVXA 5I07A 1UA7A 4GIEA 4BK9A 5AY7A 1PPIA 4U28A 4IIGA 4QHRA 5B7ZA 3MMUA 2R1KA 3WDJA 3VABA 1NF0A 1EPXA 2XIJA 1XFCA 1QW7A 2FHCA 3MUAA 3PB2A 4UR9A 3WNPA 3SJNA 2INEA 4JIEA 2WHKA 3S6OA 4KEUA 4PFHA 2ACRA 2Z1VA 3VX1A 1VIWA 4V15A 3N6HA 5FJTA 4YJ5A 1C7SA 1KLYA 4QTGA 3ANVA 1B3ZA 2GUYA 3N6JA 4GYJA 2G0WA 1RP9A 3VIFA 5F1VA 2G4FA 3OLIA 3EWXA 4ROQA 3P8JA 1FWBC 3UW6A 2YCLA 3WK3A 1KFKA 2WM0A 1V3MA 1ZTVA 3LPGA 4DZAA 3PTDA 1EDTA 3VOFA 4BS0A 1AZ1A 4DNMA 3P14A 3ZVHB 1B4EA 5KEZA 1NVMA 4IM4A 4WSKA 4IMAA 3AZRA 3HA1A 1DQUA 3GDKA 2XUCA 1LLOA 1ZJBA 2C8NA 1DIKA 4AXKA 1Q8AA 1N82A 3TYEA 5H1WA 1VPYA 2GSEA 4AZGA 3TKFA 2I1OA 3RCNA 5E93A 3WF1A 1N8IA 5JBDA 3FN9A 2ZQ0A 1V7AA 1IWAA 3OVQA 2QNEA 3SCVA 2J7GA 1PZ3A 4BI7A 3LRMA 3NR0A 4IIHA 2FZBA 1PEZA 4ZO8A 5FACA 3VVGA 3OZMA 1VHCA 2AQOA 4U33A 1VAHA 2PWHA 3LCHA 4QE5A 1U5VA 2WAGA 3GXNA 4JTAA 2E5DA 4RUBA 3N1AA 3DFSA 1KTCA 3NFUA 4YTTA 3M5ZA 3OYXA 1NEYA 5HJLA 1V3KA 3GXIA 4KIEA 3STGA 3FSTA 4MB1A 4BQ2A 2ZC8A 1HKIA 1R3YA 4DUXA 3VDGA 3CWHA 1HKWA 2GGEA 2WKLA 2DY3A 2Z6IA 4FA3A 5A2AA 4J27A 2NT1A 4C65A 1E71M 4S39A 4NT0A 1OX6A 2YW4A 3TC3A 1A5BA 1ZU8A 1YE6A 4DRSA 5BW6A 4QG8A 3S1XA 1UWSA 5I23A 4HSHA 4FNPA 2VRKA 3QV6A 2FGBA 2J75A 1H7WA 2EG8A 1F5ZA 5I6SA 4LVFA 4P5UA 4B5NA 3GY1A 4XX6A 5C9WA 3PZGA 4E3TA 1MRQA 1MZHA 2ANUA 3T0BA 4A21A 4HMCA 3T7VA 1KXQA 1R7OA 1S3TC 3OHIA 4NYUA 4IP4A 3W2JA 3QKZA 2PCEA 5BXTA 1EH9A 1V6WA 1SZRA 2EPKX 5A8NA 2JIWA 3AYSA 4TVDA 1KBKA 4CU8A 3KTCA 3WDHA 3N25A 1YKWA 2E8YA 2PLMA 3GHUA 3W1NA 5FEPA 4HPJA 2ZXDA 1E4LA 4PZVA 3TYCA 1KM3A 1R86A 4ZFMA 2XTKA 3GU9A 4NAEA 3TJLA 1WDSA 5KINA 1W0MA 1G01A 3SN0A 2GDQA 3ARZA 3PWAA 3G6LA 3OA5A 1GT8A 1XG3A 4NJHA 1IXQA 1VENA 2Z1WA 5CSUA 4GIRA 2ISFA 2OCZA 3Q94A 4TMBA 4E4PA 2CBIA 1NP2A 3GC4A 2BVDA 3A13A 4HSNA 3L0GA 2GOKA 1A5KC 3TQVA 1HP5A 1U30A 2Q8XA 3HMCA 4M6QA 5CZKA 1UC4A 1TTPA 3VIJA 3PPGA 4PULA 1K1DA 3DECA 2XFWA 2F6XA 4W93A 1XKYA 1R8LA 3OLDA 4RPQA 1FY6A 1XYBA 1JYVA 3OYZA 3TJ4A 3F5JA 2V8ZA 3V1PA 3NA8A 5E5CA 4LRSA 4GISA 2E28A 1P43A 2D2JA 4AEFA 1RHCA 2XVGA 3N15A 3TSDA 1DJZA 4E8DA 3UQNA 5CZTA 5C5YA 7PTDA 3QGKC 3TYDA 2VENA 1R2RA 3F4CA 3AIBA 1FHLA 3B8UA 1YPIA 3QOKA 3QC3A 3VIPA 1H4PA 2PDFA 2XWDA 3ORWA 1JZ3A 4CU6A 4UC5A 4LB3A 3B9AA 1E3ZA 3M6DA 2YDRA 2DP3A 4ACYA 1EFZA 5DBUA 3DYMA 2V6AA 2C13A 4AC7C 1QT1A 4PA8A 2XGZA 3BSHA 4GIYA 5JXQA 3ZYZA 1OC7A 1L2UA 4W84A 4MPQA 1WDWA 5HJYA 1Y65A 4UFHA 4QDMA 1S2TA 3GH4A 3WDQA 3LGGA 5BYWA 5A95A 1R2TA 2HS8A 4D1JA 1M7OA 1R3SA 1MXGA 4MAZA 4M0XA 3SCPA 2WVVB 4MJ2A 1L6YA 3TN5A 5ENLA 1ITUA 2O4QA 1RVKA 1NSJA 1TQJA 3GYCA 3KZSA 3R2GA 4JKMA 4L6HA 3B97A 2OX4A 3W86A 1UIPA 1GW9A 2V69A 2GSHA 3Q37A 3MSYA 3LDVA 4S3JA 3BAXA 1KD0A 2ZBTA 3QZ6A 4U10A 1VEMA 1Q6DA 1KKOA 2ZRYA 4KKXA 3ARWA 4FX6M 4DBUA 2W67A 1OT1A 3KBWA 4KFOA 1VHNA 2X0YA 3F4NA 1V03A 4XSMA 4OWGA 2R1NA 3KTXA 2GVEA 5LYRA 1Q6RA 3U5YA 4AZCA 1JNEA 1Z6KA 4R53A 3GU1A 2WCSA 1HUVA 3N14A 1RUSA 4K2SA 4HMDA 2PDBA 2XIQA 2QCCA 1PWLA 4LYPA 1TWIA 1SR0A 3SCUA 1QPQA 1F8MA 4NJIA 4EF9A 4XZMX 3STPA 3U9IA 1JPDX 2YYUA 4WHBA 3F4WA 4DBDA 2G50A 3TAKA 4W4QA 4AISA 3N3TA 4RDWA 2WSQA 4IF2A 1EBHA 1JCYA 3WQ5A 4IMEA 1UMLA 2RDXA 3IPWA 2NQJA 3AIQA 1OG6A 1ONEA 1B5TA 3M4HA 4ZOEA 2OZ3A 3DFYA 5C9ZA 3RX3A 1CXKA 3IIVA 4W89A 1NARA 3UR8A 1PDYA 3THUA 3M5VA 2F6KA 1JQVA 4O18A 4FNSA 1V51A 2OMAA 3VKCA 2BY3A 4MG4A 2VZTA 2X40A 1S3HA 4LVGA 2E7FA 1WKFA 5DMLA 2PZ0A 2IPJA 3S1UA 1MEHA 4QLKA 4U3AA 4C7DA 2QZRA 1E6ZA 4PH6A 3BOLA 4JQ3A 2BZNA 3WDRA 1R30A 3AS0A 1W3HA 2PODA 4UFIA 3DFNA 4N9CA 4UWMA 3FYPA 3W6YA 1GVYA 3EWCA 3ITTA 4FAMA 1TV7A 1QO2A 4XTDA 1K7EA 1KXTA 3W26A 1EZWA 3MSDA 5HULA 3MKVA 4C6DA 4C6LA 4H9XA 5HMSA 3TJXA 4R7JA 1JXJA 3V5FA 5GJMA 3TA6A 1CGYA 3W1PA 1EC9A 4IGSA 1H1NA 3R1ZA 1PZ1A 1VH7A 5CPQA 2BS9A 1JFHA 1XICA 4CCEA 1K8ZA 4HA3A 1O1HA 2D23A 4ZZ9A 1R7AA 1TUXA 4KBXA 4MF4A 2FMNA 5BCAA 2BNJA 3L68A 3VNLA 3W85A 3G77A 3BLIA 4X9SA 1ZAJA 1GQJA 3WFAA 4J2MA 3EX2A 3NGJA 3LXAA 1LJYA 2X05A 3W7CA 5LXEA 2QCGA 1F3EA 4WKHA 5XINA 4ZODA 2CZEA 4IPPA 3MHUA 4GY1A 2C6QA 3WLOA 3DXIA 3LHYA 3ID7A 2XIOA 1DWHM 3E2RA 4CLMA 4CD7A 3BLDA 3IARA 4NY2A 2OLHA 1VLWA 2GVLA 1A5SA 3L66A 1FHUA 3SBFA 2X30A 5EMMA 3KWXA 2IKHA 3NO5A 3WX7A 1LG2A 4LOCA 3PWIA 2OWWA 1ZNNA 3BV7A 4KWOA 1KCXA 4LUTA 3T1GA 4K6AA 2OWCA 2TYSA 4NZ1A 3MDUA 2WSYA 1U5JA 3FKKA 3FX4A 3EMCA 3PTMA 3UWUA 1EJRC 3QC0A 5IHRA 4XAFA 2WM1A 1SZEA 1TPWA 3NSNA 3VCRA 3M6YA 2F8QA 1I2PA 2VFGA 2E4TA 3WQCA 3T0CA 4AZHA 1A5LC 3LERA 3R43A 4LUSA 4ES4A 3WD2A 3EWWA 3T81A 5FSDC 1JDEA 2UV8G 4H7VA 2E9BA 4PRWA 3TTYA 4ZOAA 5D8WA 2O55A 3W2MA 1GQKA 5H91A 2AL1A 4BF5A 2SFPA 3FFSA 3UU0A 1BTCA 3UPWA 2FPTA 2HRWA 4WSHA 3LSBA 3IGXA 4MB3A 2Z2UA 2OSYA 3VGBA 3A4JA 3QQ0A 4DF0A 3PNZA 3LBCA 4UUIA 1KA9F 1OFEA 4QJ1A 5K4XA 1RALA 3GC5A 1P0EA 3LB0A 4PMRA 2NZLA 5GPRA 1XBZA 1LRTA 1A49A 2DQXA 1WYIA 2CC0A 3SB0A 3SRKA 4K37A 3PS7A 4P8WA 3PWGA 4NZCA 2Z2AA 4NQ1A 3TDFA 2IKJA 4GBUA 1MWOA 1ITQA 3HG4A 4GXMA 2EHHA 3U8GA 4IMGA 1XC4A 3NAVA 3NQ8A 4I9JA 5EFDA 1J2BA 2YBUA 2VFIA 2QT3A 3TTSA 2J74A 3VMOA 2BVYA 3T6CA 2PDXA 3L4TA 3BAKA 3ICJA 3NUKA 4PUKA 3C2EA 4JZ5A 1LTDA 1PVNA 4GUGA 5AECA 4O54A 3UJSA 3ARXA 4QJ4B 1X97A 2QMKA 3W71A 3VOCA 2BGQA 2VOTA 3O6YX 1RPXA 3KBMA 2GK1B 4H8VA 4H9MA 3B4UA 1KBBA 4XQ6A 2QJGA 4O50A 3ZFHA 2NT0A 4PMZA 4H9ZA 1XM3A 1N2VA 2XH7A 3N34A 3VE9A 1V3LA 2CESA 1B54A 2V5JA 5D04C 3JU2A 2IQ0A 4XK2A 1B9BA 1EHAA 4MB5A 1OD8A 1JD9A 2VGIA 2DPEA 3L0NA 2PWDA 4JFSA 1WXJA 2XSBA 2VC6A 1MSSA 3BQ6A 3MKCA 3MJMA 1Q63A 5A6SA 1L8PA 1I2QA 3PZNA 2YLLA 5TAOA 4B91A 1RP8A 3QFEA 1KLZA 1ADOA 1QW8A 3WNLA 1Y0EA 2F84A 3NQ7A 1PTGA 3QBUA 1QUMA 5CBJA 4UTTC 4GNVA 2DSWA 2VD8A 6CGTA 3QSRA 5AC7A 2IMRA 2XU2A 3GDMA 4OGZA 4GVHA 5AHMA 4C6BA 1LROA 4G7EB 2BB0A 3ABOA 4W8LA 1E9IA 2FPYA 3GVVA 3PPFA 3Q65A 1TZ9A 1ISYA 3VNIA 2BV9A 4P7QA 3WSUA 2J6VA 1J10A 1XBXA 2J7DA 4CN1A 3BG5A 4HOZA 1F2JA 2WZEA 3DHDA 2PGWA 4S2CA 3ZVIA 2EPLX 3DFQA 1XIMA 4WJXA 2JKPA 4F0KA 1FA2A 4H3DA 3GH5A 3ABQA 2VFHA 3OZPA 4A6GA 3T2PA 1PX4A 3O0FA 1W9BM 4F9DA 1QRQA 1K03A 3M47A 3VNMA 3NO3A 1DIDA 2YL5A 4A05A 4GPNA 2A3LA 4O1AA 1EP1A 1Q4NX 1CENA 3CM4A 3CQIA 1YDOA 3L65A 4AEEA 2DZUA 3HF3A 2XWEA 5HQMA 3CASA 2Q6ZA 4J4KA 4NRSA 1CXHA 3I3BA 1ISWA 2QF8A 3U7VA 2W6RA 2H90A 5LHFA 2CLFA 3FJLA 1V79A 1LBFA 3EWUA 3FVMA 4EKJA 2IPFA 1YEYA 1OEPA 1RCOB 5D02A 1I45A 4WLCA 4O1FA 1V02E 2VQTA 1W3JA 4B9ZA 4JN7A 4B5TA 3LHZA 4LEQA 1A5AA 3LLDA 1I4NA 2OPJA 1I60A 4MJZA 3NGFA 3EOUA 5I79A 1H5VA 3SO7A 4LCSA 1GVSA 5AHNA 2XN1A 2A7NA 3CMGA 5BZAA 2XH4A 3U48A 3SFWA 5A6KA 3QGVA 4DX3A 3WMLA 2PBGA 3LCIA 2GJXB 3R5EA 1H60A 2QHAA 1F05A 2VGGA 2ZX9A 2VFDA 1MW1A 1J0YA 4X63A 4GK8A 3KZPA 1UP3A 4G1NA 4DO6A 3A5FA 5CBBA 3T0TA 4Q8TA 4XD5A 5DQPA 6PTDA 4RDZA 5EKYA 1IF2A 1P1XA 4WGHA 2J27A 3AZSA 5A6MA 4YN5A 4RCXA 3W82A 2XDFA 2DT3A 5FESA 1R3TA 3LYEA 3VDHA 3AWNA 3AS1A 5JBEA 3A9IA 4ASTA 3L2MA 3UGRA 1VZWA 3UPMA 1H5YA 4CEXC 3TTEA 3I10A 4C5YA 4PUJA 1ICPA 1IR1A 1JJKA 1QBAA 5CPTA 4FIQA 1FP8A 2ZTKA 1JCNA 1VS1A 3CZKA 4IQDA 2WMIB 3VDCA 2OR2A 4Z1AA 1VJZA 4O12A 1S5MA 4E2VA 1A0CA 3L4VA 5HMEA 5F1UA 3VNYA 1IZCA 5TD4A 2ZXBA 4MMWA 2ZWZA 1K9DA 3UXDA 1QK2A 4YXGA 3TTOA 1D3HA 3UZYA 1YPFA 2OO6A 4LH8A 4JTIA 1V7YA 3P62A 2ON3A 4ICCX 2QCLA 1YBQB 4HZ7A 1CGTA 3GM8A 3LZ3A 1W5PA 1G4EA 2J7BA 4JTRA 1UD6A 4KFNA 4US6A 4LNCA 3UG4A 3C2FA 4DLMA 4JYDA 1KBLA 5FAJA 1U33A 1U83A 4AEOA 1T7LA 4DLFA 4MIMA 3NZ1A 1W1PA 2PURA 1DPMA 2OZTA 2VR5A 1QU4A 4ONVA 3GXFA 3GZAA 3SCNA 1TB3A 5F2LA 1JDFA 5FF0A 4Z0JA 4QSFA 2PSNA 3QVQA 1QNVA 3W7PA 2YL9A 3H53A 3BSMA 3FAWA 4HSOA 2E6YA 3W1MA 3HURA 3TQPA 1NFBA 1PKMA 2XVLA 4C6IA 5BNKA 1X6LA 1IEIA 2CW6A 4ZL1A 1UKQA 1B3YA 3MHGA 2FGLA 1PIFA 3CQ0A 1LBMA 3NPVA 1E6XM 3G1YA 2ZZ5A 1OC6A 3CK5A 3CPRA 5HJXA 2GQAA 3GNOA 1HXJA 3EBVA 4TQTA 3S6DA 2Z7GA 2FHFA 4GZEA 4J7RA 3MUIA 3KXQA 5M17A 3PUDA 3HQ1A 4V1XA 2VM8A 3EB3A 2OG9A 3LHWA 3CEUA 3NZQA 5I03A 2G41A 4Q7NA 1S46A 2OQLA 3K8KA 2IQTA 3L4XA 2BMBA 3QN3A 4F0SA 1DJNA 3P5YA 5LNSA 1K6AA 2DFAA 1UBPC 4UTHA 1FDYA 5HWJA 4DZIA 3W72A 3ZJ8A 4W8AA 5M2FX 3L2IA 4O10A 3F2CA 3BG3A 3UA3A 5A94A 4A2SA 3STEA 3AIVA 2Y7DA 4UFKA 1A0EA 4LV4A 5CKSA 2CWXA 2QGYA 1MUCA 4PYSA 5IFTA 1XLGA 2NW0A 2IXUA 4F0LA 2VX6A 4HHHA 3PNUA 4GMEA 1ZQ5A 3MCOA 2PTXA 5A2BA 1P0DA 3VGDA 3P82A 2WSPA 3UJEA 5D09A 1XLMA 1HJUA 3W01A 4BQ4A 2J9YA 2YCEA 1I2NA 3DDMA 4AD5A 3HOJA 3M0MA 2FZDA 2ZE0A 3QY6A 2Q8ZA 4IG2B 1HO4A 4N7QA 4CD6A 4GO8A 5FEZA 4WQ6A 2PB1A 3BAIA 4LRTA 2QXWA 3WMCA 4D72A 4Z1CA 3W3OA 3MB9A 1J5SA