2IQTA

Crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
295
structure length
295
Chain Sequence
NAMNKEQLQQMRQAPGFVGALDQSGGSTPKALKAYGIQPDAYQSEEEMFDLIHQMRTRMITSPAFATGKIIGVILFERTMRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEANGVQLMKPFPELGKLCEEAVGYHVFGTKMRSVIKQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEVDIHCPEKAKAEEILKRELLAQLDKMTEPVMLKITIPTVDNFYKEIIEHPMMLRVVALSGGYSREQANELLSRNHGVIASFSRALVEGLSARQTDAEFNAMLEASIEDVYQASIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase class 1
publication title Crystal Structure of Fructose-Bisphosphate Aldolase, Class I from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Lyase
total genus 95
structure length 295
sequence length 295
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2iqtA00
2QCLA 1K8ZA 2GVJA 5HJLA 3WK3A 4MYAA 1JUBA 4O0KA 1H60A 3GIYA 4NJHA 1BWKA 4UC5A 1Y0EA 3QSRA 3R13A 3QQ0A 4XQ6A 1A5BA 1HL2A 2I14A 2I9EA 1K7EA 3UWWA 2Y70A 3BLFA 2JBMA 1W5MA 3NGJA 3QRHA 4QSHA 2H6RA 2ZZ5A 3TFXA 3HGOA 2J27A 4A2SA 5DXYA 3B0UX 3T40A 2FDSA 2V81A 2EPHA 5DBUA 2BZNA 3FJLA 3QPYA 3F4NA 4O18A 3KFTA 4NQ1A 1H7XA 2Y85A 3TH6A 2NUWA 3U6WA 4O4VA 4DO6A 3MHFA 1OK4A 3KAOA 1YLVA 1LTDA 5H2ZA 3C2VA 2E6AA 4O53A 2EF9A 3GK0A 2XN0A 1KM4A 3E96A 5DCBA 4KFPA 3RNDA 4M6VA 3VNDA 3LERA 1WOAA 5TBOA 3NPXA 3LHZA 3NL2A 1MEWA 2YYUA 3NQ8A 6TIMA 4CNOA 1KM0A 4H6KA 5LNSA 3P60A 4PODA 2O7SA 4S1FA 1CI1A 5AC6A 4O8RA 3PG8A 4ORMA 3E9AA 4Y96A 4EIVA 4TU1A 1U83A 4NJJA 4IGHA 5ABTA 3LV6A 1UASA 3L9CA 1KLYA 1VZWA 3HBLA 3O63A 4UUIA 4Z0JA 1IIGA 4UMAA 4OV4A 1K7FA 3E0IA 1OF8A 1R30A 3EEGA 1XBZA 4HSNA 2NZLA 3A23A 2WPBA 4O14A 3IIPA 3LTSA 4H4IA 1H50A 3P81A 3W23A 1W5NA 3IIXA 4LUIA 2QR6A 3THAA 4OBTA 4RR4A 4GRSA 3W74A 3P80A 3LHUA 2LLEA 4HNNA 3ZR4A 1QOQA 3P74A 4JYFA 3HB9A 3T44A 2Y62A 5BNKA 5D09A 4DF0A 2ABAA 1ZY9A 3L2IA 3P8JA 4HNUA 4ZVJA 4ADSA 1WQ5A 1H7OA 2A7RA 1YADA 1OYBA 1VPXA 1TREA 3CLMA 4A29A 3A24A 2D73A 5LGZA 2A21A 4FNQA 1HUVA 3L5MA 3NR0A 1JVNA 1SW0A 1M7PA 3HF3A 4IX2A 1Z44A 4UMBA 5LHEA 1TIMA 3NZRA 1TO3A 1OFAA 1X6UA 4QAIA 5LHFA 1SSDA 3MUXA 3W22A 1I2QA 3PUOA 4WXZA 3IIZA 2ZRXA 5E0KA 2B0MA 1KM3A 2B7NA 1KTCA 4O28A 2J9ZA 3NEVA 3PB0A 3HGJA 3DHFA 2QCHA 3HIJA 2VEPA 1PIIA 3TX9A 5AYXA 1H5YA 3R89A 3G1YA 4XZ9A 4K38A 3SECA 3S42A 3W1AA 1SZNA 1MO0A 4K6AA 3VE9A 3NG3A 1T8XA 1SO5A 1TTQA 4ADTA 4DELA 1IGSA 3MP5A 1SZFA 4MZ8A 5HR7A 1F73A 4MY9A 5HUOA 3LM7A 4R34A 5KZDA 4OWGA 4UTUA 3G22A 3GXTA 4NJGA 4O52A 1X7FA 2Q8ZA 2E6FA 2C19A 2VEMA 3W1MA 1GZGA 3L5AA 3EWWA 4FNRA 3EWXA 4MFEA 4KFOA 1EWEA 1EUAA 2FPYA 1A50A 3NL5A 2NV2A 3QF0A 4NX0A 4ORIA 5F4XA 4JX6A 3WJZA 3B0PA 4HN4A 3M5ZA 4ZQCA 5C54A 2QKFA 5K4ZA 2ALDA 3VCRA 2NV1A 5H91A 5G2IA 3NL6A 4JTEA 3DAQA 4DPPA 4HKPA 2RHGA 1LOLA 4TR9A 1DQXA 4FIRA 4AH7A 2PE4A 3GDTA 4UNLA 2HSAA 5DBTA 1YTDA 1OX6A 3M1ZA 4GJ1A 2ATMA 1OFOA 1H7WA 3VI2A 2O7QA 1QPOA 1B9BA 1K02A 5FEXA 1VRDA 1RPXA 1IXOA 1VYSX 2ISSA 5D33A 3CEPA 4O15A 3LCXA 3UYCA 4UFMA 2DZWA 3U2OA 2EAWA 1GVRA 3LI1A 2WSQA 2ZA3A 4UTTA 4MJZA 1M6JA 5A5WA 3S9YA 1MZHA 1A5AA 1QPRA 3BPWA 3SW6A 1F6PA 3P62A 1W3TA 1X1OA 4IPJA 1F74A 3G18A 4Z08A 3W2MA 1AG1O 4QM1A 4JTFA 1ME7A 5HUPA 3W85A 1Z42A 1SU5A 1Z48A 3W7NA 3DFSA 3OVPA 3CC1A 3NPUA 5D30A 4W9TA 1GEQA 1DVJA 4IUOA 3CIXA 4MJMA 3W75A 5GVJA 4R7JA 2X2GA 4YXGA 3TUUA 4NJIA 1LLZA 2GQ8A 5D2VA 3EX2A 3T4CA 4JY9A 2NX3A 3W72A 3K30A 3U8GA 4JN6A 3O15A 4A22A 3PUEA 4TMBA 3ABOA 1G4SA 5DY3A 4LS0A 4O11A 3G0UA 4O12A 5FF7A 1Q3NA 2E1DA 4JYDA 1ZAJA 3T55A 3L21A 2PURA 2Q8LA 1OYCA 3NQMA 4MKNA 2C18A 1VH7A 4CQAA 2ZRZA 3E12A 3GR7A 1GWJA 3S1VA 2W6RA 3JR2A 3DI0A 4I9AA 4GUFA 1ICPA 5CZTA 1VCFA 1T99A 1OJXA 1PCWA 4JXCA 1S5VA 2FB3A 3KHJA 3M43A 2VOMA 3M47A 2Y7DA 1G69A 3M0ZA 3NQAA 4NT0A 2YW3A 2A2IA 3C52A 3FKRA 3R12A 1C8VA 3W2LA 2DORA 5G4WA 5I3GA 3LHTA 4RLIA 2ZYFA 4RJEA 3CWOX 3HG4A 3M16A 3NQCA 1KFKA 3QJAA 2Y88A 1BKSA 3N14A 1EWDA 3UZ5A 4FXSA 2DJLA 3M5XA 4UFIA 2CLLA 4ZMGA 1KW1A 2VEIA 1YPIA 3M7WA 1YPFA 5F4WA 3TK7A 3P7YA 1TV5A 4GE8A 2DZVA 2ZZ2A 5E93A 1VYPX 1LOQA 1E51A 3LXAA 1KBIA 1KA9F 1VLIA 4UTJA 3MHUA 5EL1A 1R46A 3L0GA 3KRSA 2E6YA 4ALDA 3W88A 5KINA 2C6QA 2E6DA 2TSYA 3W7OA 3WK1A 4Q32A 1GG1A 1P5BA 4XTIA 3R8RA 5EBUA 3DFNA 4AWUA 1L2UA 3TSBA 4RV8A 5F1VA 3QMRA 5TIMA 4AWSA 1VC4A 3I7QA 3MI2A 4PH6A 4BF9A 1LORA 3BV4A 4K8HA 2Z6IA 3LX9A 3MO7A 1DJNA 1JCYA 4NZJA 3WJWA 3HOJA 3RU6A 5E1QA 1F76A 2YFNA 4LOCA 3PC0A 1GJPA 1XI3A 1TTIA 4QISA 4PCFA 4FEZA 4WY0A 1I2RA 1VGAA 2P10A 3SR7A 3TKFA 1G7UA 1LBFA 1W8SA 2PRMA 4FX6M 2XFWA 4JDBA 4JY8A 3UWQA 4IMFA 3MWAA 3C3NA 4O54A 4BI5A 1H7RA 2C16A 4PEKA 3USBA 4ZL1A 3B04A 4UFLA 2F84A 4TMCA 1LBMA 2A85A 1P0NA 4C1KA 3UD6A 4I7UA 2J6XA 1T0OA 3WJXA 3PBWA 1WXJA 3PG9A 2TMDA 5KTLA 4HNVA 5K4XA 5CSSA 3RF9A 1RQBA 5HNRA 2V8ZA 3QW4B 4FIQA 4A2RA 5BMXA 3QC3A 4GWEA 3QM3A 3W7PA 3V75A 1EEPA 2QJHA 5DXXA 4X9SA 4FB7A 4DBDA 1WA3A 3S8HA 4XWUA 1Q6LA 3GAYA 1YDOA 4N9CA 3PM6A 4UR8A 2QCFA 3W71A 5LZLA 2B7OA 3PSWA 4JR5A 4L4MA 5D2TA 2R94A 2H8ZA 4AF0B 4BK9A 3M44A 3WK0A 2ABBA 4FX7A 4CCCA 4N9EA 4UMCA 1ZCOA 4S2CA 4JDYA 3HPZA 5I3IA 3LCIA 2I1OA 4O16A 2XN1A 2A6NA 1SO4A 1I2NA 2FPTA 3LXCA 1G4TA 2H3BA 3CEUA 2J9XA 4OQVA 4AHPA 4LWWA 1DV7A 2YW4A 1VR6A 1PV8A 2HS8A 1TRDA 4HSOA 2C15A 1GTHA 4LC8A 1ZFJA 1V5XA 2RKXA 2OX1A 1LP6A 2Q3OA 5LGXA 2CLHA 4LW7A 4XBSA 5FESA 4DEFA 3TQKA 2ZA1A 3TFCA 1FWNA 4O19A 4LC6A 1HFBA 3H53A 1VCGA 3FKKA 3CWNA 1TCDA 1DHPA 5K7JA 3FFSA 3MP4A 1OFDA 2X1RA 4POCA 4QIUA 1XUZA 1SW3A 4FO4A 1VQTA 1B4KA 5AHFA 3OA3A 3I65A 4MLRA 2EHHA 1OG0A 1GT8A 1F05A 2YSWA 5U7SA 1H1ZA 1VHNA 1LLWA 1G4EA 3FOKA 4LV4A 4EWND 1JULA 3TDFA 2KZHA 4IX0A 2ZCGA 2QUTA 8TIMA 2FLIA 1XUUA 4OV9A 4GUIA 4NNCA 4K36A 1TPB1 1QMLA 4FNSA 3IV3A 5C5YA 2C14A 1KM2A 2VENA 4I7WA 3GNNA 4E38A 4EF9A 1EIXA 1NFBA 1LRTA 3UWZA 4O10A 1FCVA 1LBLA 1XBYA 1UUOA 5LKYA 3GXPA 5F2LA 1LDCA 3VKJA 4HPXA 3LGEA 4LRSA 3OBKA 1PVNA 4ZQNA 2NX9A 4DXVA 1JUEA 4PL2A 3NAVA 2V0TA 4CQ9A 1H63A 4MOZA 4BWLC 4UTWC 4QNWA 3G1HA 5FEZA 5LNRA 2ZRYA 2ZRVA 2NXIA 2OT0A 4N2YA 2FTPA 2ZFAA 4JX5A 4O17A 3BGGA 3JRKA 1EP3A 2YX0A 1BEUA 3W7QA 4UR7A 4EOUA 2HMCA 3EX3A 3EX1A 3GKAA 4ZQRA 2CU0A 2X30A 3T7VA 4QNEA 2ZRUA 3IVUA 3DFQA 4HIBA 1SPQA 1TPEA 1LYXA 3KVLA 4WD0A 1SSGA 1N8FA 4NJKA 4DO5A 5EY5A 1TSIA 3O8AA 1ZAHA 3Q37A 3G1XA 3NNTA 1QPQA 4LTSA 1W37A 5G2HA 3AO0A 4JGDA 7TIMA 1ADOA 5HMSA 4WXYA 3ELFA 2A1YA 2EKCA 2GVGA 1SO3A 2QAFA 5CPLA 2FIQA 2YDAA 5FEWA 1ME8A 1RQEA 4X3ZA 2JGYA 4N9BA 1W3IA 5G5IA 1KFBA 2QAPA 2CLEA 3BG3A 3SZ8A 3N73A 2X16A 3S1XA 5CG7A 2V5LA 2DZTA 2YCEA 3IGUA 4YL2A 4Y9AA 3NQ6A 3W1RA 1LCOA 4WY0B 1X1ZA 4EF8A 5KITA 5D05A 2H8XA 5CSRA 3WK2A 4NNBA 4BFAA 5EMUA 1PCKA 3KXQA 1X8FA 4Y6GA 1TV7A 4IMGA 1OX4B 1GVSA 2ZA2A 1UB3A 2GJNA 2RDWA 1PHWA 1OABA 3B8DA 2DJXA 3KRUA 2QCCA 4E2BA 3M41A 1MSSA 3ATZA 4JTTA 4NXSA 4O0ZA 1AL8A 3HJZA 1QR7A 3DKLA 1P4CA 1YXDA 4BWLA 3TA6A 5I3KA 3IEBA 3N34A 3GNDA 2QCEA 2QCGA 3PWAA 1I8JA 2WKJA 3F4WA 2Y6ZA 3GDLA 4QQ3A 2ZZ6A 2ZRWA 4XKYA 3NM1A 1SO6A 3OHIA 1R2RA 3G0XA 4DQWA 4PC8A 4Q33A 5K9XA 5FF2A 3I68A 1L6YA 2E5CA 1Q6RA 3ABRA 4OGZA 3LI0A 1FDYA 4R33A 4ZQOA 4M7TA 2VFDA 4AAJA 4BI6A 3FYPA 3N9SA 4HT3A 6ALDA 3STEA 2VC6A 3W7KA 3HO8A 1DBTA 4JTHA 3TW7A 3FJ6A 3STFA 1Q45A 1F7BA 1JRCA 1UJPA 4MUZA 4CCDA 2R91A 1JCNA 3W9ZA 2IQTA 5AHEA 2E77A 4KKXA 3BVJA 3PR2A 3NA8A 4IWWA 4MY8A 3QZEA 1VLWA 1ZHAA 1EP1A 4DPQA 4FNUA 3HGRA 3MW7A 1SFJA 1H62A 3G1DA 2E09A 3TAOA 3S5ZA 1LOSA 2E68A 5C2XA 2FJKA 3AJXA 4E2DA 4O13A 1LRNA 3NPWA 3GDRA 4AEOA 4AF0A 3EX6A 3O05A 4YMZA 3L0KA 3TXVA 3P8IA 3N2XA 3TSMA 4N6EA 2WJZA 1IXQA 2VFEA 3BW4A 3NM3A 3TNOA 3ZFHA 2WNZA 2WQPA 2FQIA 1O5XA 4JX4A 5L9FA 1I4NA 3L65A 1MXSA 1TMHA 1XC4A 2DZPA 2X1TA 3MJYA 5TQLA 1YTEA 3M6YA 5D38A 2QDHA 4DF1A 3W6YA 2JK2A 3VFLA 1JQVA 5CKSA 3LV5A 4WJEA 3PULA 3QEZA 2G97A 2PRHA 2ZBTA 3BLIA 1S5TA 4M6PA 1W56A 3UWVA 3SI9A 3QSTA 4O4WA 4UFHA 5LNWA 3IRDA 4ZZ9A 2NX1A 1GVOA 3PVFA 1N55A 1K8XA 3EXSA 3PY2A 2RH9A 1TPDA 3PS7A 2CLOA 3ZWSA 3GYEA 3NOEA 2V9DA 2ZDRA 4D2JA 3W7HA 3CPRA 2CZDA 4CCEA 4OHQA 2VFGA 3G8EA 3P5ZA 5AC8A 5J5RA 1SQ7A 4LS1A 4WOZA 4IJBA 2ISVA 3O06A 1KM5A 3PAJA 5I3JA 1EA0A 2BLEA 4JEQA 4G1KA 3RK8A 3QMSA 3PBUA 3EKLA 3MI6A 3W2UA 5U4NA 1HO1A 5D03A 1OFPA 5IBXC 3TC7A 3CTLA 4MIMA 3LHVA 1TTJA 4DBEA 1XM3A 3NQGA 3GDKA 4FXRA 3UZJA 5F1UA 3F1QA 5CZ0A 4XBKA 4LNYA 1TRIA 4XUGA 2AGKA 1OHLA 3L66A 5K9CA 3QQ1A 4ZQPA 1CX9A 2CW6A 3G24A 4LVGA 3QH2A 4O1AA 4QJ1A 3C2EA 1J5TA 4UTKA 1G4PA 5BRBA 2WSYA 3UWYA 1SZEA 5LNVA 1LROA 3BG5A 1FXPA 4UTIA 1AW5A 2ATSA 4JTGA 1GPWA 4UXDA 1B4EA 3ZS4A 3DFTA 4QITA 3NQ2A 2ZTJA 1AMKA 3FYOA 5CPNA 3UXDA 2OMAA 4O1DA 1WBHA 2WNQA 5HR6A 2VELA 4OU1A 1N7KA 5LSMA 4YCOA 3GR8A 1TPC1 4BI7A 2ZZ1A 1TV8A 1AW1A 2VFIA 3FA5A 3W7LA 3P84A 4Z1DA 3TU9A 4M7SA 4JIQA 3G1FA 1DORA 3QYQA 3W1TA 3W1UA 1AL7A 1PHQA 1XDMA 3I6RA 3A21A 3QMTA 4MPQA 2GVLA 1YDNA 1OFBA 3A5FA 1KTBA 4R53A 1O5KA 1J4EA 1OYAA 3BLEA 4MLJA 2G95A 3SJ3A 1ZAIA 1FDJA 3LHWA 4A21A 4UFKA 1NVMA 1ML1A 2VFHA 3B05A 1EPXA 1FUYA 4O1CA 5CGQA 5IM51 2QDGA 1AK5A 3C2RA 2WOQA 2X1SA 4XKYB 1EUNA 2NWSA 3EXRA 3NVTA 3SFKA 4O50A 4S2BA 4MZYA 4LVFA 4EVZA 3CIWA 1BWLA 3C8FA 3NQ7A 1OX4A 1YYAA 4JS3A 1KM6A 3RLVA 3NPVA 3TW6A 4B5NA 4NZFA 4PFMA 2OT1A 4AHQA 3TROA 3CM4A 5HINA 4GXMA 4AVFA 4NUWA 3EWZA 1CW2A 3KRZA 4LS2A 3UY7A 4MFDA 3RFAA 5G2WA 3EWYA 4JICA 1RZMA 1AW2A 2QCMA 2DU2A 3C6CA 4JTIA 3B0VC 1W5OA 5AHLA 1PE1A 1A5SA 4K8EA 5I3HA 3FEMA 1YXCA 2CZFA 2J88A 4A3UA 4C1LA 3HPXA 3LHYA 5AN7A 4RXGA 4RZ4A 1U5JA 1JRBA 2J24A 1LRQA 2WV8A 3TE9A 5AHIA 5HQEA 2V30A 3S1WA 2V2HA 3ABSA 3P5YA 3KX6A 4K7YA 3ATYA 1R47A 2Z2UA 1GVQA 4GC4A 5AYYA 4IOTA 1I2OA 5DY2A 4Z1CA 3UQNA 4JNMA 1FWSA 3W83A 3BGJA 1FXQA 3T78A 3W7MA 1OFEA 3L68A 4Q4KA 4IXHA 3DZ1A 1C29A 2TRSA 1FWTA 4RX0A 1O4UA 5DCEA 1NF0A 3NZ1A 3C56A 3GB6A 4RZ6A 3P67A 4E0CA 1MEIA 1KBJA 1RVGA 1I45A 1W3NA 3THQA 2UV8G 4X2RA 3MYOA 1DJQA 1TTPA 3MP3A 1WOBA 3EWUA 4AXKA 3S5NA 3DENA 2DZSA 1YTKA 3UWUA 2NXHA 1FWRA 1O95A 2C3ZA 2QUVA 3LLDA 5D37A 2R14A 3IVSA 5F2GA 5I3FA 1XDLA 1EB3A 4FNPA 3EWBX 1QOPA 3F03K 4KWWA 2YFOA 4H3DA 5DN1A 4LRTA 1VS1A 1KFLA 3W7CA 3NO5A 4KWVA 1OFQA 2V5BA 4TX9A 1IXPA 2BX7A 5AYZA 4LU0A 1I2PA 3LCWA 3EXTA 2C0AA 1K3UA 3STGA 1C9DA 4J9JA 3Q2DA 1BTMA 1TPUA 1XCFA 3GAKA 3C4UA 4IMDA 1R2SA 5K3VA 3LCFA 5EKYA 3KVJA 3DU0A 1ZNNA 2YGYA 3DI1A 3UXAA 1W1ZA 3IGXA 3A22A 2CZ5A 1KLZA 4YLWA 3GX9A 1KTNA 3TC6A 5F2IA 1Q6QA 3W70A 3LXBA 1B3OA 2JKAA 1JJKA 2NXGA 3GLCA 2GPTA 3LRLA 2W0UA 1QFEA 1Q6OA 3CQ0A 3S5OA 1FCUA 3CB8A 1FCQA 3UPWA 4IPIA 2R8WA 1SZGA 3CT7A 3PBVA 4ZQMA 3C0JA 1B57A 2YR1A 3N9RA 3W2NA 4UTMA 1QCWA 1RD5A 4O57A 3GVGA 1L6SA 1F2JA 4NX5A 1ME9A 1P1XA 1NEYA 1G6CA 1NAL1 2CLKA 2TPSA 2G96A 1WX0A 1F5ZA 3NQDA 1ONRA 3A9IA 3W73A 5HWMA 4N9DA 1TPWA 3MYPA 2BSLA 2PC4A 5T26A 1THFD 4M19A 1ICSA 3S6DA 2OJPA 2FPVA 4KFNA 3W7IA 3W2KA 3O6YX 1DKWA 2VFFA 3OG3A 3W86A 4M6QA 3M9YA 1IXNA 2CWNA 4TO8A 2Y63A 1S3HA 1XBVA 3W07A 3TSDA 4WX2A 2Z0IA 2QF7A 2DZXA 4JTJA 3DXIA 1TJPA 5KMYA 1D3HA 4RZ5A 1PS9A 5CZJA 1SR9A 3WJYA 3LCHA 1TJRA 4JTSA 1WDWA 1JCLA 5EA9A 1WV2A 1TPH1 3I7SA 1KFEA 2E5BA 1OVDA 5FI8A 4ADUA 3DFPA 3Q58A 1WBJA 4GUHA 2A6LA 4LVDA 2J9YA 3O1NA 4WOQA 4DF2A 2X1UA 2GQ9A 1ALDA 5CPMA 3MBFA 5D04C 4RCXA 5DLCA 3W7GA 4Y90A 2Q3RA 2V82A 4FF7A 5DCDA 3IGSA 4K37A 4LY8A 5EPDA 1OF6A 3NL3A 3DFOA 1HG3A 4JD4A 4IQLA 1P0KA 5FEPA 1TB3A 5AHNA 1V7YA 4JIPA 2CFFA 1A53A 2G5WA 4UTTC 1ZENA 2B7QA 4GUJA 3W87A 4MY1A 3DH7A 4PL1A 5D2WA 4TIMA 5AC7A 3SIZA 3EB2A 3G3MA 1F6KA 3LB0A 3HQ1A 2JKPA 1H7PA 5D02A 3DGRA 1NSJA 1S5WA 1DOSA 2WO5A 4UTWA 2Z6JA 1FCBA 1QNVA 4GNJA 4P2VA 3FIGA 2QJIA 5G1YA 3QW3A 4RKAA 4UNKA 3OVQA 3BW3A 3W1LA 3O6DA 4OE7A 5F4SA 1UUMA 1VHCA 3TR2A 4M5PA 3C2FA 1FBAA 2QJGA 4Z1BA 2NUYA 1OFRA 3C61A 1H1YA 3EKZA 3S5YA 2YXGA 3RLUA 3CU2A 1GG0A 4YWIA 2GUUA 5D2YA 3W1NA 1Z41A 3W7EA 2QCDA 4X22A 2ZTKA 3H55A 4NNAA 1TQXA 1W5PA 1ZALA 2P1FA 2QUUA 5HWNA 1WAUA 2A7PA 2Y7FA 3BK0A 1GYLA 2GJLA 1IF2A 3G0SA 2NLIA 2RFGA 4LVAA 2NWRA 4AMAA 3TJLA 3BW2A 2AAMA 4O1BA 4UCGA 3R2GA 4K39A 3LBMA 1QWGA 1JCMP 1KV8A 3GDMA 3P82A 5FF3A 3B03A 3B4UA 5D32A 1H61A 3INPA 2PCQA 4WY0F 1XXXA 4ONVA 3W1XA 2RDUA 2HS6A 3D0CA 3M5VA 4Z0SA 3DHDA 5AB3A 3G8RA 3UNDA 4AHOA 3PBYA 5K2ZA 4RXFA 3I7RA 4DO4A 3O07A 1WYIA 3TV8A 1W31A 4P61A 3W76A 5KSWA 4N6FA 3LRMA 1O60A 4Y8FA 3M5YA 3LBCA 2ZQ0A 1IIHA 3EX4A 2V2DA 2V2CA 1ZJIA 4WQ6A 1NF7A 3JS3A 1G7VA 2PRLA 3HG5A 3R5EA 1OX5A 3HMJG 1ICQA 2B7PA 4IMCA 3LLFA 1VYRA 4RK8A 4MYXA 2QEZA 1FWWA 4NU7A 3PF3A 4IXXA 1FY6A 2A5HA 3LRKA 2ZZ4A 3L5LA 3P61A 3GKFA 5LNUA 1JCJA 3CHVA 1KFCA 3N19B 1JCXA 3NQFA 3HGSA 4IMEA 3SY5A 1J2WA 1FQ0A 5BW6A 4FNTA 4UFJA 2VXNA 3LCGA 4OT7A 5MHBA 1EX5A 3ANYA 2CLIA 3MBDA 1D3GA 3ABQA 2WNNA 3TJXA 4JTUA 3W1QA 3TMQA 3WFAA 1RV8A 4K7VA 3W7DA 4MZ1A 2NUXA 3OIXA 1K7XA 1SW7A 3ZWTA 5CZSA 3GXNA 4N02A 1GVFA 5KZEA 3H54A 5BMWA 4CQ8A 3B06A 3TXZA 1MEHA 4JYEA 4CLMA 1W54A 1DQWA 3W7JA 3UPBA 1QPNA 2H3DA 1SUXA 2YPIA 3TMLA 2BWGA 3FLUA 3NQEA 2AQWA 2Y7EA 3O16A 3MHGA 1O94A 3SGZA 3C2OA 2WSRA 5AFDA 4HHPA 3LCLA 1K03A 3OVRA 1FDZA 1UBSA 3PSVA 2W79A 1QDSA 3QFEA 1GOXA 4WUIA 3TQ0A 2FB2A 4HNTA 2YZRA 3STCA 1JUKA 5G4EA 4GBUA 2EGZA 2OCZA 2A7NA 2H90A 2DZUA 1PL9A 3NYZA 4LVBA 2VEKA 3LTYA 1RR2A 1OK6A 3TCEA 3W1PA 5KZMA 3S0CA 3O6CA 5FF0A 3MMTA 3IIOA 5F2MA 4NXKA 3PUDA 2ZZ7A 3NDOA 2P0OA 4YCPA 2BTMA 1W0MA 1QO5A 3LDVA 3UY8A 4UIOA 1KV5A 1L6WA 2CLFA 2HTMA 3KVKA 1TYGA 4BR1A 1K8YA 3N2MA 1H51A 3G1AA 3S1UA 1EP2A 3DBPA 3GZ3A 5C55A 3G3DA 1R2TA 3NQVA 3KOFA 3E49A 3L0NA 4N4PA 3BARA 3MI3A 3HPSA 2XN2A 1M5WA 1T96A 2B4GA 1LZOA 2ISWA 4L4LA 1XFBA 5AHMA 4UTLA 1XBXA 4NVTA 4CNPA 2RDTA 3IIVA 3LOTA 2E5DA 1W5QA 1SFLA 3N3MA 1XL9A 3TQVA 1UCWA 1QO2A 1M7OA 5EYWA 3E02A 3QPZA 3W3OA 1A5CA 4ML9A 5L6UA 2FFCA 2QCNA 4WZHA 3V1PA 5IBXA 2TYSA 3NXFA 3LTPA 5D2XA 4JTLA 3W84A 1H7NA 1TQJA 5J5DA 4I7VA 4ICNA 5FF4A 1KM1A 1XKYA 4AWTA 4U28A 4LT9A 3G1VA 3HG3A 2QCDB 4MVAA 3Q94A 2C1HA 4FHAA 4UTHA 2Z1BA 1VJIA 1GQNA 1G67A 2GOUA 4Z1AA 1D9EA 3DKJA 3OEXA 1HTIA 3TIMA 1JR1A 5HWJA 3BG9A 3BO9A 1L9WA 3FS2A 4GFSA 4HPJA 2OZ0A 2CZEA 3WJSA 5AOUA 3RMJA 1YXYA 2Y89A 1FX6A 5CPOA 3W7RA 4AB4A 5BOOA 3YPIA 1RQHA 5K9DA 2VKZG 3SGUA 4U4MA 4PA8A 3PB2A 2YYTA 4FX8A 5G1TA 4JTKA 5A8GA 1GYNA 4CNNA 2JGQA 1GTEA 2JKEA 5DELA 5C6MA 1TPFA 4GUGA 3G1SA 2A0NA 2C13A 4LUJA 2Y7GA 1LM1A 2ZZ3A 3A5VA 3L67A 2Y61A 1JQXA 3W2JA 5SWUA 1HO4A 1KFJA 2DP3A 2BXVA 1DL3A 2GQAA 1VCVA 2CLMA 2F7FA 3TAKA 4LV9A 4XTDA 1TPVA 2A4AA 1QAPA 3HG2A 4PTNA 3VE7A 1YDVA 5HULA 3KVMA 4N4QA 3SSJA 3IVTA
chains in the Genus database with same CATH superfamily
4MWAC 5HJLA 3WK3A 3KS5A 4LPCA 4XD3A 1JUBA 4Q8MA 2D1ZA 4UC5A 4OOZA 3QSRA 1BXBA 1JPMA 4XQ6A 1K8CA 3DGBA 6A3HA 2GWGA 2VUYA 5I78A 1EJUC 1VFHA 2I9EA 1VRXA 2QV4A 3BLFA 4M3PA 3NGJA 3QRHA 1A4MA 3R6IA 4QSHA 2G41A 3U2CA 1R0MA 1A0CA 1BVNP 2EPHA 5DBUA 1YE6A 2OX4A 5JUVA 1XJBA 3QOMA 4KGJA 4NQ1A 3L4TA 5JH2A 3T2PA 2NUWA 3U6WA 1R8LA 4DO6A 4PMDA 2Y8KA 1OK4A 5EB8A 3KAOA 1YLVA 1XLIA 3GHSA 2P53A 2EKGA 2E6AA 3H7VA 3MJMA 1UD3A 2QNEA 2J7FA 4J40A 3SUVA 4EX4A 1WOAA 3DOPA 2D22A 3NQ8A 4CNOA 1PTAA 4L5ZA 1XCWA 4S1FA 1IWPA 4HU0A 4ORMA 3E9AA 4DYJA 4Y96A 3W00A 4ZFCA 4EIVA 3HTWA 4IQEA 3IUIA 2VX4A 4CQBA 4HMCA 3LV6A 1EHAA 1UASA 1KLYA 1LQAA 2EXOA 3DFYA 3VIOA 2Z1WA 4DYEA 1IIGA 1FH7A 3AXXA 1K7FA 5A8OA 1XBZA 2NZLA 3A23A 1RJPA 4OIFA 4E2VA 1EJTC 4O8AA 3W23A 4J2MA 4J2PA 5LIKX 3CO8A 5FSEC 4GIEA 1PX4A 4C6EA 2VQUA 4Z2HA 2BXYA 3NO1A 2P88A 6XIMA 2EJAA 1QOQA 3P74A 3KRBA 4UZSA 1RCOB 1EL3A 3OZPA 1H41A 4L6DA 3FHAA 1YADA 1OYBA 4GG9A 5CC3A 2A21A 4FNQA 4UMBA 3WSUA 3GTFA 3E0WA 1TO3A 2HZGA 3ZJ7A 1SSDA 3ME3A 3MUXA 4RW3A 3W4RA 4BKNA 5TD4A 1GVIA 5E0KA 4J3TA 1KTCA 4O28A 1EDQA 2J9ZA 3PB0A 1DIOA 1XLMA 3HGJA 3DN5A 1TUFA 3WEMA 3CV2A 1PIIA 2CZVA 3WQ4A 3SCTA 1TVLA 4S39A 4QLKA 4D1IA 1XIEA 1QI2A 3FXYA 4K38A 3S42A 4I90A 1SZNA 1UD5A 5D8WA 1JFXA 1MO0A 3VE9A 3RJYA 3S47A 4CKQA 1TTQA 4ADTA 4XZNX 3D46A 1IGSA 4QHRA 3IV8A 1I1WA 2EPMX 4MZ8A 5HR7A 5HUOA 3B4YA 4R34A 1CXHA 4GYKA 3N6JA 4NJGA 4O52A 2Q8ZA 3VNYA 2WC7A 1C91A 1Z89A 3L5AA 4DM1A 1DJHA 1NFPA 1CTNA 3EWXA 3NL5A 2FGZA 3QF0A 1A50A 3CYJA 4JX6A 4BCEA 4PCNA 3L23A 1DP0A 3S2JA 1IWAA 3E0VA 3BLLA 3DAQA 4DPPA 3VDGA 1NDYA 2RHGA 4FIRA 3SEPA 1M1BA 1QATA 4F4RA 4I6VA 4MSSA 3KW3A 2ATMA 5C0QA 1QPOA 4S3EA 1W1B1 5FEXA 1VRDA 1RPXA 4AG0A 5DEZA 3TYDA 4O15A 3H2NA 1JZ7A 3U2OA 1YEYA 2VCCA 2XFRA 4IHCA 5HNNA 1EGVA 1F4HA 4X61A 4GO8A 3MB9A 2ZA3A 2PP0A 4LCRA 2WJEA 3PHAA 4DLMA 1F6PA 2O4QA 3T09A 4Z08A 3W2MA 3PPFA 5HUPA 1A5OC 3FYYA 1SU5A 1Z48A 4HNOA 3DFSA 1H2JA 1UOKA 4W89A 5T9CE 1E6SM 2Q02A 3TUUA 1NWSA 2XWEA 2X1IA 1GKPA 5D2VA 5T8GA 4AIOA 3PTKA 2F2HA 2NX3A 4PB5A 2Q09A 4A22A 3PUEA 3H24A 3ABOA 2NT0A 3A64A 5A8QA 4HNLA 3G0UA 2GJXA 3KM8A 1E56A 4JYDA 1ZAJA 1BSIA 4YTSA 1OYCA 4GKTA 1POJA 3R0UA 4OJYA 3E12A 3WZ0E 4A3HA 1CNVA 4YHGA 1G94A 1GWJA 4JQAA 3BL3A 1QVBA 3DI0A 4RPQA 1WKDA 1ICPA 1Q6FA 3AQUA 4HYRA 1A5UA 4BF5A 3U48A 3GVWA 3VO0A 2Z26A 2Y7DA 5CC5A 3V5FA 3M0ZA 3EDJA 3UU0A 3NQAA 3SRKA 4C5ZA 1Q6DA 2A2IA 1CZ1A 3W2LA 5I3GA 3LHTA 2VD8A 4WKHA 1DTNA 2ZYFA 3U2ZA 3M0LA 1QWKA 3CWOX 3HG4A 3E74A 1KFKA 2OYKA 3N4FA 2VEIA 3TTSA 3TK7A 4AZ6A 3WLHA 1EZ2A 3B8IA 4GE8A 5FKYA 3ONBA 2ZC8A 1VYPX 1E55A 3LXAA 1TJ2A 3P2VA 2VI0A 1KA9F 1VLIA 4PFHA 3KTSA 3S46A 2ZXAA 2E6YA 1LLOA 3VDCA 3W88A 1DIKA 3PAOA 2CKSA 3TTEA 1T40A 4RNHA 1S2WA 1XIMA 1VIZA 4PE8A 3HMCA 5EBUA 3WMCA 1VFTA 2YZ5A 4AWUA 1L2UA 4H1ZA 4RV8A 3WFZA 4ZCWA 4AWSA 1VC4A 3I7QA 1J0KA 3UEQA 4PH6A 4BF9A 2OKTA 3HURA 3TN3A 3QC0A 2P3EA 4XZIA 4HCDA 1DJNA 1UZDA 4NZJA 1BYAA 3ECQA 3RU6A 1F76A 1UP0A 3WDIA 3VPLA 3PBGA 3QZ6A 3AIBA 3TKFA 1NFGA 4IIFA 2OWXA 3ZVIA 1XIIA 4JY8A 2IPGA 4IMFA 1H7RA 2PP3A 2F6KA 1CEOA 3ITVA 1TMQA 4E8CA 4C65A 4TMCA 4MAZA 3BV7A 1LBMA 2A85A 1FWDC 4C1KA 1OCQA 2JE8A 4I7UA 3UP8A 4C1NA 1ECEA 4HNVA 5DMNA 5K4XA 1YNQA 2CBIA 1D7FA 5HNRA 3L4VA 3GIQA 1PX8A 1ZJHA 5D9PA 1IZJA 3PPGA 1E6ZA 1LUCB 4YN5A 3WF3A 1WA3A 5CGMA 2YJQA 3ARVA 4CU7A 1YDOA 3H8AA 1UD8A 3PM6A 2ZXBA 2QCFA 3W71A 5LZLA 3PSWA 4L4MA 5D2TA 4U31A 3WK0A 2V3DA 5XIAA 2IKJA 1RP8A 2GGHA 4UMCA 4S2CA 5I3IA 2I1OA 4O16A 2XN1A 1RY0A 1G4TA 2H3BA 2J9XA 4OQVA 2QVHA 4AHPA 3OGRA 2QLYA 3EDDA 4LWWA 2HROA 3L12A 2HS8A 4HSOA 2C15A 3CUGA 1HQTA 1GTHA 3GXMA 1M03A 2CLHA 4W84A 4Q3MA 3KTXA 1FWNA 3USZA 1H5VA 3H53A 1VCGA 2ADAA 2YL5A 4JHMA 1TCDA 1DHPA 5K7JA 1B90A 1FH9A 3MP4A 1OFDA 2JF7A 1SW3A 4FO4A 1VQTA 3VIPA 1VBUA 1CWYA 1B4KA 3UFYA 4LNCA 2DT3A 1H0GA 1UD2A 2EHHA 1F05A 5U7SA 5IHSA 2RAGA 4KWUA 5DF0A 1UHVA 3V4BA 3AIQA 4FA3A 4S23A 1JULA 4IX0A 2P0IA 2QXWA 4W85A 2XGBA 3F2CA 5I24A 1XUUA 3M6DA 1ODZA 2XGIA 3IV3A 4RE0A 3W81A 3WBWA 2FZNA 2DDXA 1FCVA 3BZJA 2ASHA 3POHA 1POKA 1LDCA 3EB4A 3HV9A 3LGEA 4ZQNA 4PEEA 1JUEA 4I8YA 2FKPA 3NAVA 1ISWA 1VD6A 4NZ1A 1GGOA 2Z27A 4MWAA 1HVXA 3GXFA 4XO6A 4OECA 5LNRA 4DZAA 5JH1A 2VZUA 2POTA 1XV8A 5I6SA 2OT0A 3VYLA 4JFWA 5LIYX 2FTPA 1QI0A 1EP3A 2YX0A 1BEUA 4IPLA 4EOUA 1QNSA 1Q63A 3GKAA 3MVTA 4QNEA 2J7BA 1SPQA 3LGDA 4DO5A 1ZAHA 1EYWA 2W91A 4M1RA 3PBMA 7TIMA 1YHTA 3ELFA 2A1YA 2EKCA 2GVGA 1SO3A 2FIQA 1XH0A 3C0LA 4H9VA 5FEWA 2QW5A 4N9BA 4O1FA 4S3BA 3WD1A 3LEPA 4ZB5A 4PMJA 2DSVA 4M29A 2QPXA 2DZTA 4JHOA 4YL2A 1K70A 4TVUA 4B4HA 3G5EA 4GGBA 3VOGA 1GKRA 3KDNA 3AWNA 1PJ9A 4A35A 2H8XA 4EK7A 1QHZA 4NNBA 2F2KA 2VRKA 4MNKA 4BFAA 1C90A 1X8FA 4Y6GA 2OQYA 3WIJA 2GJNA 2J7DA 5CSYA 3VD7A 2OSXA 1JZ5A 1PHWA 3B8DA 2DJXA 3KRUA 4ZSUA 4A3YA 4HK6A 4C1NB 3EA1A 2WPGA 4AZIA 5BU9A 4W8LA 2PBGA 2PZNA 3VA8A 3HJZA 3DKLA 4BWLA 3FY1A 3IEBA 3NOYA 1QTWA 4DB7A 4JQ4A 4DWSB 1UW9A 3O2LA 3R25A 1DQUA 2QCGA 4P8UA 3W26A 4Q8PA 3WY1A 3GC2A 3UR2A 1J0ZA 3ARTA 3KOXA 3ARSA 1R2RA 4UOJA 1EKOA 3OVGA 5FF2A 1L6YA 4NI8A 2E5CA 5AKQA 2G8ZA 1Q6RA 3ABRA 2WBKA 1FDYA 4AAJA 4GCXA 4PTWA 4I3GA 2VC6A 3OO2A 4WR3A 3N4AA 4C6CA 4YYCA 1GOKA 4QS6A 3TW7A 4L1WA 1JRCA 3WMLA 3BICA 1XC6A 3SDOA 1UJPA 5J8LA 2R91A 1X39A 1JCNA 2IQTA 2XFFA 4GMEA 5AHEA 3J7HA 3BVJA 4MY8A 4IWWA 1WUEA 3K13A 1MW3A 2INFA 3QZEA 4J7RA 4XZMX 4PTMA 1YDYA 1ISXA 4GI4A 5C2XA 5C7VA 1JD9A 1HGWA 1TE1A 4E2DA 4O13A 1LRNA 3NPWA 4HSHA 1OCBA 3O05A 3R7MA 4H04A 3L0KA 4NYYA 2KX9A 3TSMA 4C6MA 3NM3A 2VZTA 1F3WA 4GPNA 4H6RA 1HL9A 2FVKA 3MJYA 4XZLX 5TQLA 4MG4A 4M0XA 1MMFA 3TQPA 5CKSA 3LV5A 1DJYA 2YDQA 2QHAA 7TAAA 1OSEA 3VNIA 3OZOA 4U2ZA 4PCTA 4UFHA 2NX1A 4JL1A 3PVFA 1K8XA 3BH4A 1A3HA 3W82A 3GYEA 2Q71A 1W9PA 1GYMA 4CCEA 4OHQA 2VFGA 3P5ZA 1SQ7A 4H00A 4H2HA 4MWAB 3O06A 4C6JA 5I02A 4QXIA 2CETA 5I3JA 4G1KA 4AMCA 4QLJA 4X0VA 2Y5SA 2FHFA 3W2UA 3TWBA 1OFPA 2CEQA 3CTLA 2FZBA 3LHVA 4DBEA 1P7TA 3PTMA 4GOAA 3GDKA 1TWWA 5F1UA 3KBMA 1TX2A 2WWCA 2WMGA 1TZ7A 4GIRA 4H9UA 2CW6A 4QJ1A 1XLJA 4UTKA 1G4PA 2WSYA 1VB9A 4KCTA 5LNVA 4CD7A 1EJ7L 1J0HA 2G3IA 4UTIA 1FH8A 2WAGA 4JTGA 1GPWA 4UXDA 3DFTA 4CGTA 2PP1A 4ENLA 3E1F1 5CPNA 4O1DA 1G01A 2WNQA 1UZ1A 3ZJ6A 3RLGA 4YCOA 2D0FA 4BI7A 1TV8A 4AEEA 4Q8WA 3P84A 3U57A 2YA1A 2F38A 3KWXA 4D6IA 2Y1HA 4RV3A 1PHQA 3ZYZA 2Q01A 5BXPA 1TZ9A 3A21A 1QASA 3VABA 3TCSA 4MPQA 2GVLA 3A5FA 3EGJA 2G95A 1ZAIA 1MW1A 2VL4A 4LBRA 4MNLA 2J6VA 3CIVA 3A9BA 4K1GA 3K2GA 1B3VA 1VBRA 3B05A 4D1JA 1FUYA 4IP5A 1B3WA 2PDQA 4Q6XA 6REQA 3AIRA 3HQPA 1W17A 2J7CA 2QDGA 3FW6A 3UVAA 3MDWA 2GUBA 3GY1A 3EXRA 3SFKA 3UBPC 4S2BA 2I16A 3CQKA 3C8FA 3R4IA 4RNFA 3NQ7A 1YYAA 4JS3A 2PBOA 4B5NA 4KBXA 1UIPA 2ZE0A 4B3ZA 5CAHA 3E0LA 2OT1A 1O7AA 3EPOA 3B40A 4ZSTA 4WLCA 4MFDA 1RCXB 2WHLA 4JICA 3E6EA 4QCEA 3AHXA 4NI3A 5KEZA 3K5XA 4JTIA 3B0VC 1W5OA 3SRFA 4BZYA 1A5SA 1CLVA 1RCQA 4A3UA 4C1LA 4PMQA 2CXEA 1BQGA 1J96A 4RDZA 4G6CA 5AN7A 2R1NA 4RXGA 1U5JA 2A3AA 2WV8A 4Z2JA 3OBEA 2V2HA 2ISDA 3KX6A 3EA2A 1YX1A 2EPLX 2DT1A 4R27A 2Z2UA 4GC4A 4IOTA 1GUVA 4Z1CA 4NAFA 1FWSA 3W83A 2H9AB 1K9FA 2RGLA 1FWTA 1O4UA 1NF0A 3NZ1A 3C56A 1J93A 1FWFC 3GB6A 4GCAA 2Z7KA 1QHPA 4GI6A 1RVGA 1I45A 1W3NA 3THQA 1T5AA 4GFIA 1DJXA 1BYDA 2XIIA 3MYOA 3EWUA 1Q13A 3S5NA 1UR9A 3O0KA 5FOOA 1B0IA 1S1PA 2R14A 1UKPA 4FNPA 2QGHA 1QOPA 4KWWA 2YFOA 3RIKA 1D8WA 4LRTA 1VS1A 1ONWA 1GHSA 3NO5A 2QPUA 3VDHA 5G1MA 3CH9A 5FJIA 2E40A 1XH1A 2V5BA 4TX9A 4H01A 2BX7A 3LN3A 4LU0A 3RILA 2HDJA 5HATA 1K3UA 5JIPA 2HK0A 4URIA 2O9RA 1E4LA 4LY4A 3RRAA 3WNPA 1BTMA 3EWCA 1TPUA 3GAKA 1JPDX 2XSAA 1R2SA 3GE7A 3BSHA 1E9ZB 1KGWA 5MF5A 2YGYA 4J3SA 3R1ZA 4KESA 4YLWA 3U5YA 1YKWA 2EG8A 2DVXA 1BF2A 1B3OA 4Y2WA 1BQCA 2FZMA 3KUMA 3KEHA 2ZX7A 1QHOA 1PB0A 1GW1A 2ZIDA 4IFRA 5C71A 3G77A 1SZGA 4ZOCA 1I75A 1RBLA 3W2NA 1PKNA 2ZUMA 3VCNA 3GVGA 4NX5A 3MUAA 4GQ0A 3NTYA 1JDEA 1G6CA 3R8GA 1NAL1 1F5ZA 3W73A 1TPWA 1NOWA 1J5SA 2ZWYA 1R87A 4HCLA 2V3EA 2VFFA 3W86A 3BSGA 4QJ4B 2VUNA 2Y63A 1XBVA 3MA8A 2XIJA 3GG8A 4FLQA 4AD3A 3DXIA 1TJPA 3UT0A 3B8TA 5BOFA 3L7RA 1SMAA 1ECQA 1H4PA 4ZB0A 3SCSA 4XD4A 4JTSA 1WDWA 2BY3A 3VC6A 1REQA 2WMJA 1CGVA 1WV2A 2DIKA 5CLWA 1XG4A 4PYSA 3B8WA 3Q58A 4DWDA 1WP6A 2A6LA 1U30A 4JTQA 1UWIA 3WD2A 4B15A 3W7GA 2JFEX 1ZP4A 3U4FA 5A6MA 3H22A 5HOSA 4JIPA 1A53A 2XG9A 3T0BA 4UTTC 2B7QA 2FZ8A 3QR1A 4MY1A 4NSBA 5AC7A 3SIZA 3LB0A 5D02A 3AMDA 2YDRA 3XINA 1W91A 3ARRA 1S5WA 4YJ5A 3M0YA 2Z6JA 3RGTA 1WDDA 4DZ5A 4NZ4A 4P2VA 1PXGA 1MDLA 3FIGA 5G1YA 3S4TA 4M5PA 2FVMA 3RLHA 2V69A 2WQDA 4Z1BA 1ONEA 2OWWA 3EKZA 1H1YA 1ZL1A 1GG0A 1U22A 1R7AA 4Z2KA 2R1LA 3PFMA 4Z2LA 1TQXA 4NAFB 3IAQA 1W5PA 1E5JA 2HE8A 2I7GA 2P1FA 4XV0A 3S9IA 3U7VA 2QUUA 4C6NA 5HA7A 1V3JA 1IF2A 5AECA 2NLIA 2RFGA 4LVAA 5I06A 4AMAA 1PEZA 2XJ7A 1UKSA 4R7OA 3VNMA 3R2GA 3GDMA 3P82A 1JZ3A 4FP1A 4KEUA 4H6EA 3B4UA 3OTRA 4LF2A 4MJ2A 3INPA 4PB3A 4WHBA 2RDUA 3D0CA 3DHDA 4JCMA 5IOBA 3G8RA 3UNDA 3CUIA 3HN3A 4PRWA 2CHOA 4RXFA 1U1JA 4MHBA 2HEJA 4CN4A 3JVAA 2JEPA 3MCNA 4PN2A 1W31A 2J7EA 3OLEA 3AC0A 2WMKA 2PDPA 1WAWA 3FAXA 1MDRA 2V2CA 1Z3NA 4RDYA 1NF7A 4JL2A 2VNCA 4WEVX 2WANA 2FH8A 1A5MC 3R5EA 3ONCA 1ICQA 2B7PA 2Z29A 1SVDA 5CLTA 2QEZA 5A6LA 4EP8C 1NWTA 3AHTA 3PF3A 5DMLA 2A5HA 4EPKA 3UA4A 3GKFA 2JQXA 4Q8QA 2X0SA 3HGSA 4FPSA 4IMEA 3V1HA 3AROA 1FHVA 5AVHA 4UFJA 1EX5A 4TTGA 2FGLA 4XSLA 3ABQA 2WNNA 4XO7A 3BLKA 2NUXA 1Q8AA 2YIHA 4JTAA 3ZWTA 1Q8JA 4N02A 2YLLA 4CN1A 3L4XA 3ZLHA 1W54A 4EE9A 1JGIA 2BASA 1MVYA 3R43A 3TA9A 4WSJA 3FV9A 3SADA 1IEXA 5H8MA 4GC3A 2YPIA 3AMLA 2BWGA 2E8YA 3MHGA 4D6GA 3SUSA 5AFDA 1E6RA 3IJ7A 1K03A 3PANA 4ZR8A 1VPQA 1HKMA 2PWVA 4WDUA 5G4EA 1DPMA 1JI1A 4DJFA 1UWTA 4Z2IA 1REQB 1TR9A 2DZUA 3NYZA 4LVBA 3LTYA 2E7FA 3WNOA 2PDNA 2O92A 5KZMA 4EXBA 3IIOA 3PJUA 2ZUSA 3PUDA 3RYSA 2P0OA 1W0MA 2RGMA 1X97A 4UIOA 1IYXA 1L6WA 2CLFA 3EYPA 1J6PA 1H51A 1RJRA 1O12A 2Y2WA 3TZNA 2DT2A 4AC1X 3G3DA 1R2TA 4HK5A 4N4PA 1M5WA 1T96A 4YVPA 2ISWA 4L4LA 2F8QA 3OLIA 4UTLA 4CNPA 3IIVA 3LOTA 4WKAA 4HMNA 1SFLA 4IGNA 3S9ZA 3N29A 3GU1A 4PBEA 3DC8A 3TOYA 2FFCA 4C6QA 4WGHA 2QZRA 2TYSA 4IM4A 2P5NA 2XWDA 3GUWA 5A6BD 1W9VA 5EFDA 1V93A 4P7NA 5FF4A 3BOLA 1EO5A 1KM1A 3WQGA 2HPIA 4U28A 4HHHA 4JKMA 3LNMA 4MVAA 1M65A 4FHAA 2OU4A 2QQ6A 3CS2A 3BOFA 1R7OA 4R7WA 4Z1AA 1G67A 5A6JA 1I60A 5GJPA 3B3DA 2X40A 2YCLA 3OEXA 3TIMA 1OGGA 3OQ8A 1W1VA 4LXFA 5CPOA 4AB4A 4GQQA 1RQHA 2PDFA 2X7WA 4U4MA 3TP4A 2FH6A 3CQIA 3PB2A 3PJTA 4NZ5A 5A95A 4JTKA 4QAWA 3VVGA 4I9MA 4DJEC 3VX0A 3BZGA 1I6NA 3GQYA 3KWSA 5C9XA 4AISA 3G1SA 2CKRA 4LBSA 4W5UA 2ZZ3A 3FEQA 1XIFA 3GH7A 2DEPA 4UTFA 1JQXA 4Q7BA 5EMYA 2DP3A 2VZOA 3AMKA 2GQAA 1BTCA 3THUA 4XTDA 3N12A 1ZTVA 1QAPA 4PTNA 5GJMA 4FXFA 2QF8A 1JCTA 4NZCA 2WZIA 1KR0A 3F7JA 4B3LA 1SM9A 2OXNA 4MYAA 1MW2A 2DUAA 4NJHA 3LU2A 3NUKA 4HP5A 3ZT6A 3AIWA 4F9DA 3OB8A 2I14A 1AJ2A 1K7EA 1YPXA 2Y70A 1W5MA 5CBBA 4KGLA 4US5D 4KW2A 2OYLA 1YE4A 2H6RA 2ZZ5A 5CH9A 5XINA 4EPDC 4A2SA 3ITOA 1OD8A 2FDSA 2V81A 5BXSA 1KKOA 2BZNA 2BVTA 3QPYA 3F4NA 2NQJA 2JIEA 3ARUA 5C9RA 4O4VA 4B9YA 4RE4A 3E5BA 4J28A 1P6CA 1LTDA 2FVLA 3C2VA 1SJAA 1FP8A 4O53A 3ERPA 3GK0A 2WVTA 2XN0A 1DWGM 1OCJA 3ZIZA 2HVMA 1C8XA 5TBOA 3LHZA 3HPFA 3NL2A 1R3YA 4IFKA 1MEWA 6TIMA 1UR2A 4PUDA 4H6KA 2PZ0A 3NZGA 1HN1A 4LUYA 5LNSA 4PODA 2JF6A 1SFSA 1Q65A 2WVUA 4S3GA 1T6MA 2PLKA 4F0MA 3AYTA 2VT0A 4ACZA 3L9CA 3W53A 4CNUA 3V5OA 1HIZA 3E0IA 1XS2A 2V3GA 3MMWA 1IR1A 1LQ0A 4O14A 3LTSA 8RUCA 1ZU8A 1QK0A 3V36A 1KBLA 2QR6A 1KB3A 2D20A 4P7RA 2OZTA 1XRFA 1TV4A 4HNNA 3RO8A 3ZR4A 3BAJA 4F2BA 3TLLA 4JYFA 3COTA 3EPNA 5BNKA 5LIWX 1JZ6A 3P8JA 2XTKA 4CU6A 1V6YA 3NXLA 1WQ5A 2A7RA 4KT2A 1JNDA 4XD6A 3A24A 1HUVA 2GSEA 3GBDA 3NR0A 1JVNA 1SW0A 3HF3A 2PGRA 1E0XA 3CUFA 5IFTA 3BXWA 5LHEA 1PKMA 4MNJA 3NZRA 1OFAA 3PUOA 5C2CA 1K1DA 3UNTA 4DJED 1KM3A 1GQLA 1MW0A 4CD4A 4HMEA 2WLYA 3DHFA 3T1GA 2QCHA 3HIJA 3N25A 4OBSA 4H7ZA 3PZGA 3TX9A 1CGXA 3V0UA 1H5YA 3R89A 3G1YA 1VBHA 2PLMA 4AQLA 1W9XA 4K6AA 1T8XA 4OVXA 4PULA 4DELA 2WSKA 1VFFA 3URAA 4EPEC 4OWGA 4QLLA 4B90A 1X7FA 1EA9C 2XIBA 2C19A 3URBA 2VEMA 5H8UA 3W1MA 3JW7A 2QIIA 1B3ZA 3LD5A 5I79A 4MFEA 1EUAA 5F4XA 3WJZA 4HN4A 2QKFA 1UH4A 3HPAA 3H7UA 3VCRA 5H91A 2X09A 4ASTA 1ZBCA 4HKPA 1DQXA 4AH7A 3NVDA 4UZUA 2FHCA 1TX0A 3M1ZA 1NELA 2GJRA 3FK4A 2VZSA 1B9BA 2VD9A 4KERA 1QBAA 3KTCA 3XIMA 1OINA 1B2YA 1IXOA 2KAUC 4QG8A 1YMYA 4C6BA 3UYCA 4UFMA 3UETA 1EOMA 2Z24A 2WSQA 4KCWA 4UTTA 3A3WA 4MJZA 2C0HA 1MZHA 4L9YA 3ZQ9A 2XVGA 2OR2A 4W87A 4IPJA 3G18A 3T81A 1JEZA 1KCZA 3Q45A 3C0SA 1IT8A 4JTFA 1ME7A 3M0MA 1IQ8A 3IJQA 3OVPA 4AZ7A 3CC1A 4D6EA 2PGEA 4ATLA 3NPUA 5D30A 1UKQA 4KS0A 1ZBVA 4J3ZA 4RW5A 2EPOA 3IPWA 4MJMA 2VCBA 4R7JA 2X2GA 4NJIA 1LLZA 2OODA 3NSMA 2GQ8A 3L2MA 1HJWA 3T4CA 5A1AA 4JN6A 3O15A 4IFKB 5E6ZA 3ARWA 4O11A 2WNWA 4KCUA 4O12A 3VGBA 1Q3NA 3T55A 3F5LA 4P5UA 2Q8LA 2XIQA 2BY0A 1OIMA 3NQMA 3KL0A 4MKNA 3DUGA 2C18A 3BUVA 4ACZB 4CQAA 2ZRZA 3CUXA 1TFVA 4NY2A 5JU6A 2W6RA 4C7FA 1YIXA 1KBKA 2BGSA 1T99A 1US3A 7CGTA 4JXCA 4AX6A 2FB3A 4FALA 2MNRA 2VOMA 3PP7A 1XR2A 2J8FA 4HGXA 2E4TA 3C52A 3FKRA 1C8VA 2DORA 5G4WA 2DSWA 4Y9PA 3WF4A 3KOYA 4RLIA 3NEHA 3AUJA 1XIGA 4RJEA 2UBPC 4O0QA 3M16A 1OGBA 4PCPA 3UZ5A 2DJLA 1C7TA 2CLLA 4ZMGA 4LFYA 3WQCA 3VNZA 2FFIA 2QJMA 4AUBA 5FJPA 4N42A 1XRVA 4DJDC 2DZVA 2V38A 2ZZ2A 5E93A 1XLBA 1D8CA 3HU7A 1LOQA 7A3HA 1E51A 1JZ8A 3VIKA 3GU9A 4V27A 4M24A 1GW9A 2E28A 4CN6A 3APTA 3MHUA 5EL1A 1V7AA 1XLLA 3CL7A 1HJUA 1S1RA 4ALDA 3ABZA 4WIWA 4H9ZA 2DQWA 3WK1A 3ALFA 4WJXA 3H7RA 5IDIA 1GG1A 4GD0A 1J10A 2X41A 5TIMA 5GJNA 4B92A 1LORA 4I5UA 3KE0A 2VCAA 2EJ1A 4K8HA 5CQ1A 3LX9A 2I17A 4GABA 3OZYA 4DLFA 3WJWA 3FNDA 4KIEA 3PC0A 1GJPA 3CGTA 4PCFA 1UWQA 4FEZA 1I2RA 1TVPA 3SR7A 4US5A 1G7UA 3UF9A 5FA5A 1K9TA 3H4WA 2PRMA 4FX6M 3C3NA 3ALGA 4BI5A 3AYSA 4PEKA 3B04A 1OZMA 4UFLA 2ZX8A 3C5QA 1GOOA 1P0NA 4AD0A 2ACRA 4Y8EA 3PBWA 3PG9A 1RSCA 5KTLA 3R8HA 4Q8UA 2ZADA 3RF9A 3UCQA 1IWBA 3KCOA 3SY8A 4XIAA 1RP9A 1PO9A 2VEGA 4C6OA 1A49A 1J18A 4GWEA 3RM4A 3VOCA 3GH4A 2F9RA 1CIUA 4F0KA 4X9SA 4FB7A 2V3FA 1PPIA 1RK6A 1V6WA 2OOFA 3S8HA 4XWUA 2GVYA 1Q6LA 3RJXA 3GAYA 4S3KA 4YVXA 1UC4A 5C9WA 3H2CA 1UJQA 4O1EA 3OODA 4E3VA 4AF0B 3M44A 4CCCA 4Y9MA 4N9EA 1M3UA 1ZCOA 1Q5MA 4XAFA 3WLTA 3VMNA 1R86A 3I6TA 1ITCA 2FPTA 3WBXA 3WD4A 4QS5A 1P6WA 3VGDA 2OQLA 3CEUA 4LQ1A 3CYVA 1E5NA 3DYMA 2YW4A 1VR6A 1PV8A 5EMJA 4Q4OA 3BTNA 2J8TA 3QBUA 4H8NA 1P0BA 1XLKA 4LC8A 4JZ5A 1ZFJA 3O0FA 2Q3OA 5LGXA 3VGGA 5FESA 3H2EA 4XBSA 4DEFA 4XVDA 3NCOA 3TQKA 3UR8A 1Z8AA 2ZA1A 3TFCA 2W67A 4O19A 4LC6A 1Q6CA 1CCWB 3FKKA 4WJ8A 4CUCA 1WO2A 3FFSA 1JDAA 4KH2A 1ITUA 2X1RA 1KXQA 4D9PA 1EF2A 1UPPA 4PUKA 3U0HA 4X2PA 3PUGA 2XUCA 5AHFA 5AYBA 1JDDA 3WLKX 3I65A 1HGYA 1SJBA 1OG0A 2A3LA 3BWWA 5CZKA 2IXUA 3XISA 1Z7AA 4E6MA 1AQHA 2VWTA 4EWND 3TDFA 1N8IA 2IXVA 4DJDD 2PTZA 2QUTA 3URQA 1JYXA 4DJEA 4OV9A 4GUIA 4NNCA 1QMLA 1S2VA 4R9XA 3RITA 2QDEA 4I7WA 3RCNA 1KRAC 2GK1B 4S3AA 1NFBA 1LRTA 3DYPA 1E4IA 4F66A 1W1IE 3VXGA 3RPDA 1FKXA 4AZCA 1W3HA 4LRSA 3OBKA 1PVNA 2R9RA 4DXVA 2V0TA 2W66A 1LWIA 4UTWC 1CB7B 2FYMA 2NXIA 1FWIC 1SJCA 1ODUA 1E3XA 3HFTA 3BGGA 3W7QA 2XH4A 4NG3A 2XM2A 2HMCA 2FZ9A 1AQMA 5A94A 2CU0A 2VGBA 2WK2A 2Z4GA 5FL0A 3BAKA 3OZMA 3T0AA 3KVLA 4WD0A 1EJSC 5EY5A 1TSIA 3O8AA 3G1XA 2R1MA 4KPLA 1QI5A 1W37A 3AO0A 4GIAA 1RY8A 4OTKA 3N04A 2XDFA 2W4XA 4IP4A 4PRRA 5CPLA 2GDVA 2YDAA 2CBJA 2A3BA 3WQ8A 4LGXA 4GKLA 4DUOA 1BRLB 1KFBA 3ITXA 4TQTA 3KCJA 4WSKA 4F2TA 3APYA 3NGFA 5HAOA 1JXJA 5EMKA 1W3JA 3AZSA 3L4YA 5HK4A 3IGUA 4V33A 1XD1A 3NQ6A 4IISA 2A3HA 1X1ZA 3WNKA 2VP8A 2ZICA 5ABGA 4EF8A 2A3CA 2XSXA 5KITA 5D05A 3QXBA 1WKFA 5JVLA 1PCKA 1TV7A 4IMGA 4L1GA 3QY8A 4GX9A 4H41A 2ESCA 3SN1A 4DY1A 3AZRA 5I77A 2QCCA 2BV9A 1QJWA 1OQFA 3MZ2A 4JTTA 3VMOA 3WF2A 3FN9A 2PDCA 5M1TA 4J3UA 1E71M 2XH7A 4L7ZA 4Q8OA 3M64A 4I9JA 3BCJA 2UY2A 4UQ9A 3PWAA 5FSDC 1I8JA 2ZUNA 3FGCB 5H6HA 2ZZ6A 2BHZA 2ZRWA 1B30A 4DUVA 1C7SA 1A5KC 5LYRA 3NM1A 1UMLA 4MB4A 3BC9A 3I68A 5CXPA 3PNZA 4OGZA 2ODOA 3N9SA 6ALDA 1F3TA 2J75A 3PZOA 1UPMB 5FAGA 4MUZA 1R3QA 1EIBA 1GEHA 3LG3A 3WDQA 1LG2A 3SQSA 3QTPA 2E77A 3WLPA 1VLWA 1ZHAA 3TC3A 4C6DA 4FNUA 4UQEA 4DPQA 4Z1YA 3DDMA 2G3MA 4UQDA 4A8IA 1LOSA 3KS6A 1E40A 3LUTA 3BCFA 2ZOXA 3LA4A 3C3UA 2PDYA 4PMZA 1A3XA 4N6EA 2PAJA 5E6YA 1FWCC 1IXQA 3A3XA 3FJ4A 3RAOA 4Q8NA 5EMLA 3DG3A 5GPRA 2QT3A 3WQPA 1TMHA 4D8ZA 4QDPA 2DFAA 3SCUA 1YTEA 3LPPA 1G9HA 2QDHA 2A79A 4DF1A 3UWEA 4KETA 2V5KA 2PDKA 5A3HA 4C7GA 3PULA 3QEZA 3N2CA 1CPUA 3CJPA 1CXFA 4XUYA 1W56A 3UWVA 1HJQA 5LNWA 4ZZ9A 2DH2A 1GVOA 2RH9A 3PS7A 1TPDA 1XQKA 4CEUC 1MRAA 3NOEA 2ZDRA 2J47A 3CPRA 5AC8A 4LS1A 1W9BM 5I5RA 2Y8VA 3PAJA 1N82A 4GA8A 1EA0A 4JEQA 3T0CA 3RK8A 3QMSA 3ZZ1A 4G1NA 1B54A 4B2DD 3WMSA 3B8VA 3TC7A 3B0XA 3LSCA 3UJSA 3IWPA 1TTJA 3WLOA 1XM3A 4FXRA 4QX4A 5LXXA 3UJ2A 5A6KA 1BHGA 4PBGA 3S2CA 3WQFA 1OHLA 5K9CA 3M0XA 4ZQPA 4JNYA 3LGGA 1DIEA 3G24A 3GVVA 1J5TA 1SZEA 3WO8A 1NDZA 5B7ZA 5CJ5A 2J25A 4XVEA 3FYOA 1E1FA 3UXDA 2Y24A 1HKJA 1N2VA 1KC7A 4OU1A 2VGIA 5LSMA 3GR8A 4AEFA 3MC5A 4DHGA 3UW6A 2ZZ1A 3K4WA 1UR8A 5BROA 7ENLA 1KFWA 1YQ2A 3G1FA 3DHUA 3H4XA 4XISA 1EC8A 4GZEA 3QMTA 2Z2BA 1RH9A 4DO7A 1BYBA 1EBHA 1PZ3A 2D2JA 4MLJA 2PUZA 4HU8A 1FDJA 2R6OA 2YB4A 4A21A 5HPOA 1NVMA 2QJNA 1V0LA 2E8ZA 4PRTA 1TA3A 2VFHA 1UD6A 1EPXA 3IJ8A 1KKRA 4O1CA 3W24A 5CGQA 4D8AA 2C7FA 2YOCA 3EB3A 2X1SA 3SQMA 2QYGA 4ZTYA 3W28A 4LVFA 3CIWA 1BWLA 2BDQA 1NARA 1E6QM 1OX4A 1KM6A 3RLVA 2O0TA 2L5HA 4HA4A 3EBVA 4AHQA 3TROA 3CM4A 3MMUA 5HINA 4GXMA 1UKTA 3EWZA 1CW2A 3UY7A 1E3ZA 3U5UA 3WH7A 4E4PA 4IH3A 3RFAA 4WGXA 4G7EB 3I3BA 1RZMA 1OEPA 3OHMB 2Y4SA 2QCMA 3OGVA 3AU2A 1UP3A 4DJDA 5CCZA 1P43A 1PE1A 1EEXA 1YXCA 2J88A 3HPXA 3LHYA 1IE7C 2FZDA 1RA5A 1JRBA 2J24A 3TE9A 3OW1A 5AHIA 5HQEA 4Q22A 4AZGA 1PZ1A 3QV8A 3V5CA 2F6UA 3NZQA 3UQNA 1GZ1A 3TYZA 4JNMA 3O3RA 4P8VA 2VX7A 3DG6A 3BGJA 2G3NA 1FXQA 3VKAA 4IUGA 3R11A 1AD4A 3AXKA 3DZ1A 1C29A 2VC5A 2BY1A 4ZXOA 3CZJA 3P67A 3WBEA 1MEIA 3NURA 3KLKA 1MQQA 3SCPA 1IEQA 4TX6A 4AD5A 3ZR5A 4GQBA 3MP3A 4ECLA 1MI3A 3DENA 2DZSA 2X0HA 2NXHA 3WELA 2C3ZA 2QUVA 1H1NA 5D37A 3IVSA 3UJEA 1XDLA 3K4AA 3EWBX 1VFOA 4DZIA 5AY7A 1Z6KA 3CQJA 1Z69A 4PR4A 2Z28A 3MSYA 3W7CA 4KWVA 2OSWA 1IXPA 2PI6A 4FLSA 3FX4A 4HZMA 3EXTA 2C0AA 3VGHA 3CMJA 1C9DA 4J9JA 2BOFX 2C1IA 1EO7A 1XCFA 1YW1A 1B3XA 2WC4A 4M1BA 4L4OA 5EGRA 5K3VA 3TZFA 2CYGA 2QUNA 5EKYA 1M53A 2OEMA 3KVJA 3DU0A 4PMNA 3DI1A 1W1ZA 3IGXA 3A22A 4HTBA 3VZXA 4HBKA 1KTNA 1OWQA 1GVYA 4WVXA 2P8CA 5JBFA 2JKAA 3A13A 3I10A 3FAWA 1UIOA 2GPTA 3SCOA 3BSMA 3SUWA 4B5UA 3UR7A 3BGAA 1XQLA 3E3HA 1FCQA 2WKLA 3R0KA 3UPWA 5DX7A 2R8WA 4QTGA 4Q7IA 3AHZA 4ZQMA 3C0JA 1B57A 4UTMA 1HW6A 4O57A 1KXVA 1QCWA 1L6SA 1P1XA 3VZYA 3KBWA 1AH3A 4BY3A 2TPSA 2CLKA 2NVAA 1WX0A 1N8WA 3NQDA 3A9IA 4N9DA 4B5WA 2PDUA 1XLGA 2BSLA 5A8MA 1NWUA 2PC4A 4M19A 2FPVA 5BWAA 3RM9A 3VUSA 2VDHA 3OG3A 2ZVRA 1QXLA 1VBGA 1NH6A 1TJ0A 1S3HA 3W07A 2OYMA 3N9KA 4WX2A 2OO0A 2Z0IA 2QF7A 4QSFA 4JTJA 4KIRA 4ICCX 2OOGA 1Q7MA 2QVNA 2YA0A 3AXHA 5CZJA 1WZLA 4ZBCA 1ENUA 3H70A 3QR0A 4IL0A 1HNYA 1V08A 1EQCA 3WH9A 2BVDA 5EA9A 4F79A 3KBNA 4C90A 4N0RA 3VAVA 4YS1A 1TPH1 1KFEA 3N6QA 2PF8A 4ADUA 1WBJA 3IAPA 1ELSA 3BQ6A 4JEJA 3B9OA 2Z1KA 1MUCA 4YTQA 4WOQA 1XWYA 1TA3B 1V3KA 1ALDA 4H2CA 5CPMA 5D04C 4RCXA 5DLCA 1TELA 4Y90A 1K6WA 4G56A 5DCDA 5EPDA 4LY8A 1UA3A 1QW9A 1V0KA 4MAVA 4JD4A 2G4FA 1AH0A 3WLMA 5C9ZA 3AU6A 1O66A 1T7LA 3M0HA 1NDWA 1ZENA 4GUJA 1UR4A 2PTXA 4PL1A 4TIMA 3FA4A 2JKPA 3DGRA 1H49A 1NSJA 4R5EA 1A0EA 3CPGA 4UTWA 4Y9NA 4A8RA 4QDMA 1HT6A 4GNJA 5JBEA 3GNRA 3MUZ1 4UNKA 2PTWA 3W1LA 1UUMA 2X7VA 3WBAA 3DX5A 3C2FA 1J6OA 2V63A 2PDHA 1S5MA 3PZNA 2YLAA 3ZXWA 1RJQA 1J12A 1OFRA 3S5YA 4JFUA 4XD5A 1Z41A 5M03A 4MMWA 2ZTKA 3H55A 3VTRA 1XSKA 5ABEA 1WAUA 3G0SA 2NWRA 1W1A1 1CLKA 1TG7A 4B2DA 5I2UA 3BW2A 2AAMA 1XFCA 1T8QA 1XX1A 3H2OA 3LBMA 1JCMP 1NM9A 5FF3A 4AIUA 2JEQA 1XP3A 1XPGA 5D32A 4LBUA 2ZWZA 3W1XA 2O9OA 4C6LA 3P0WA 4RPPA 4E2OA 1ZBKA 4JAWA 4AHOA 4L56A 4LCQA 5K2ZA 3I7RA 1R3TA 3AISA 1WYIA 1Y5VA 2XFYA 8CGTA 4P61A 3W76A 3AIVA 1O60A 4Y8FA 1V0MA 3EX4A 1ZJIA 2HXTA 2PDBA 3W27A 1IV8A 4RZBA 3MUY1 5TNVA 2QJJA 4IMCA 3VUPA 4UWMA 5CBJA 2PD5A 3LRKA 2ZZ4A 4JCLA 5I0DA 3TYCA 2EPNA 1AZ1A 2NQ5A 1KFCA 5FL1A 3ZLGA 3N19B 3WLQA 1V02E 5BXRA 4EWJA 2JALA 2G50A 3QN3A 4OBRA 5BW6A 4FNTA 4OT7A 3VKCA 5KETA 4ZTXA 2Z1VA 3ID7A 5HXMA 3WFAA 2BY2A 1K7XA 4HYWA 4Q8TA 3CXOA 3GXNA 4W7WA 3RR1A 1E43A 3WUFA 1P1MA 3H54A 3TXZA 4GIYA 4CLMA 1NDVA 1DQWA 3MKCA 3W7JA 3AYVA 1OADA 3WDRA 1W32A 1SUXA 4PTXA 4GJIA 1XGEA 3S2LA 1XW8A 3NQEA 1AA1B 2AQWA 1DWFM 2Y7EA 3ISIX 6XIAA 1I0BA 1K77A 3V0SA 1AUSL 3OVRA 1FDZA 3GD6A 4E3TA 5IFPA 1UBSA 4CVWA 1OCNA 3PSVA 4GY7A 4B5SA 4A6GA 5CBIA 4ZOBA 1S2AA 5B7YA 1XYAA 1UWAA 1JUKA 1XPYA 4WSHA 1KR1A 4LALA 3WQ6A 2ZXDA 3M7SA 1RR2A 3TCEA 4C60A 1AMYA 4WDXA 3S0CA 1J9YA 1GNXA 5FF0A 3MMTA 5F2MA 2WCGA 2HE5A 3NDOA 2X8RA 1WCGA 1XYZA 1QO5A 1K4HA 3CAVA 3KVKA 2VDIA 3CB3A 1V6UA 4EAMA 1K8YA 1QNOA 2W61A 3S1UA 1BVZA 1DJZA 2XH2A 5C55A 2OZ8A 1RPKA 3CPUA 1Y65A 4B9ZA 3E49A 2OTDA 1Q7QA 3HPSA 2B4GA 2PWFA 1R3RA 1LQ2A 3D5HA 1XBXA 4L9ZA 2RDTA 2PDIA 1W5QA 5GNYA 1XL9A 3TQVA 1QO2A 1M7OA 1A3WA 3W3OA 1VIWA 1A5CA 2WSPA 4XIMA 3S1GA 5E0FA 3B8SA 3NXFA 4DRSA 3OQEA 4I8DA 5D2XA 1EGMA 4JTLA 1DEDA 4I7VA 3OIHA 4GX8A 3TJ4A 3PZMA 1XKYA 4MB5A 4AWTA 2IPFA 3G1VA 5C8BB 2Y5JA 2PGWA 1B3YA 3SQLA 2C1HA 2Z1BA 1XYLA 3DKJA 3VNKA 2J8GA 3T2OA 1FWJC 4ZFMA 4GZIA 2DT0A 5H8PA 3BO9A 3EDEA 4GNVA 3WJSA 4QEEA 8A3HA 5AOUA 3RMJA 5CAKA 1DJGA 1FX6A 4HYVA 3TONA 3MMDA 3YPIA 3UCDA 4FLOA 2DIEA 3MY9A 2YYTA 3WLLA 3T9PA 1WKYA 5G1TA 5A2AA 1GYNA 4CNNA 2JGQA 2JKEA 5DELA 3WNMA 4IPPA 2C13A 2Y7GA 1WDRA 4LF1A 5SWUA 1HO4A 1R3WA 5ECUA 2ZXQA 2WJDA 1TVNA 2CLMA 2E0PA 2F7FA 3OU8A 1RXOB 4TV6A 5HMFA 2A4AA 3GXDA 3SCNA 3VE7A 2GL5A 1UR0A 4V1XA 3ZSSA 3KVMA 4N4QA 3SCRA 3IVTA 4GO9A 1GHRA 1KCKA 2QCLA 2GVJA 2FTWA 4AXNA 1JZ4A 1OBAA 4G9PA 4O0KA 1L6FA 5PTDA 3UYIA 4GVIA 4TX8A 1Y0EA 3KBVA 4JTDA 5DT5A 5A69A 1JYNA 8XIAA 1PWMA 1I9CB 1A5BA 1HL2A 3GTHA 2D23A 3LBOA 4J3VA 1ZB5A 4H9MA 4KRZA 4MGGA 4GINA 3B9DA 3RR4A 4QQUA 4X60A 3TFXA 1XLDA 1BF6A 1X38A 3HGOA 2J27A 1OC7A 1KQYA 5DXYA 3T40A 1R38A 2GJXB 3MQTA 3FJLA 4DBWA 4Z17A 4B4FA 4O18A 3KFTA 1H7XA 2Y85A 4NKCA 3MHFA 3M0KA 3UXKA 1WNOA 2CXGA 4GYPA 2EEXA 5H2ZA 2R24A 1XG3A 3MV11 3TYUA 4ATWA 2EF9A 4BQ4A 1KM4A 5DQPA 4GXWA 5DCBA 3CHFA 1CB2A 1A4LA 3RNDA 4C6IA 3VNDA 2ZUUA 3LERA 2CHNA 2PDGA 1RK5A 1RBAA 3E2RA 4FOJA 1J0IA 2E9LA 3VM7A 1DTUA 2J79A 3P60A 2O7SA 4YYFA 1CI1A 4C6KA 2J7GA 4O8RA 5AC6A 1MXGA 1XGZA 1C92A 4LAMA 2UWFA 1E9LA 3LYEA 5ABTA 4M80A 3BJTA 2EQDA 1LT8A 3PZ9A 3H4GA 4UUIA 4Z0JA 4I5RA 4OV4A 1OF8A 4HHLA 3TNBA 4LEQA 4NASA 2WPBA 1VFSA 4CU8A 3IIPA 1UP2A 1E9IA 3P81A 4UQCA 4HJFA 3T4WA 3UPMA 1W5NA 4LUIA 1XHGA 2D2GA 4OBTA 4MWAE 4GRSA 4WKFA 5E9AA 3P80A 4JQ2A 3LHUA 2LLEA 1PSCA 1DWJM 2PF0A 3T44A 2PWUA 5D09A 4DF0A 2ABAA 3L2IA 4ES4A 5KZ6A 3E2VA 4ZVJA 1UH3A 4LB4A 1H7OA 1EJWC 1VPXA 1TREA 4A29A 2D73A 1Q2RA 1BG9A 1M7PA 4DN1A 4IX2A 3AIEA 1RUSA 1VENA 3CHEA 4REQA 5LHFA 4LUTA 3W22A 4WXZA 3IIZA 2B0MA 1TIWA 5HQLA 2B7NA 4HNCA 3W0KA 4DI8A 4HA1A 4XZHA 3TW9A 5A8PA 2VEPA 2J62A 3UCCA 1HKIA 3N2OA 4LJ3A 3MS8A 4BA0A 3AS0A 3SECA 2CWXA 3NG3A 1RA0A 2BODX 3M46A 4M51A 3MP5A 1SZFA 3GM8A 3V18A 3LM7A 2V68A 4U3AA 4P7QA 4UTUA 3G22A 3GXTA 4HB7A 2AMXA 3U7BA 2E6FA 1TV3A 4FI4A 1GVEA 3VU2A 3VZZA 1C8YA 1GZGA 1PDZA 3Q65A 3CLWA 3EWWA 4ZA0A 4FNRA 1EWEA 1GORA 1WDQA 5H1WA 4ORIA 3SIMA 4HU4A 3B0PA 4ZQCA 3M5ZA 5C54A 2VHLA 3EMZA 2PU0A 1U33A 5LXEA 3FA3A 3NL6A 2PS2A 1MNSA 4JTEA 4KF1A 2OVLA 2QGYA 1FHUA 3L2LA 2DGAA 3UXIA 1X6LA 2PE4A 4MM1A 4QEHA 1HKKA 5DBTA 1YTDA 1OX6A 4GJ1A 3SRHA 1OFOA 3G2GA 1XLFA 2O7QA 4M81A 1LG1A 1E1CA 1K02A 1P48A 4DBUA 4CVUA 4H8UA 1NQ6A 4NP7A 2ISSA 2CBUA 1H3GA 5D33A 3CEPA 4IF2A 1M04A 2IKHA 3EDFA 4XBJA 5TF0A 2EAWA 3HQNA 4B91A 1EGZA 1QPKA 3V35A 3HJEA 2PSNA 3ES8A 1E70M 1M6JA 9CGTA 1CGUA 2P50A 1A5AA 3Q4DA 2BXZA 4PB4A 1F74A 2AOSA 4K1WA 3FXGA 1FVPA 1UR1A 3BLPX 2NQHA 1HKVA 2XISA 1E15A 4GI8A 2GGGA 3W7NA 4QP0A 1XISA 2PTYA 3ANUA 4CQCA 1DVJA 3CIXA 4BEUA 2HJPA 3DESA 3W75A 5GVJA 3THDA 3SUTA 3UGVA 2ZUWA 2OELA 4JY9A 3W72A 2BB0A 3U8GA 1LF1A 2PODA 4KEMA 1TZZA 4TMBA 5E09A 4FK9A 5DY3A 3C2YA 2E1DA 2J78A 3APGA 3WMBA 4QBXA 4D71A 1ZUAX 3GR7A 4YTUA 1JDFA 3S1VA 5LA0A 4WCJA 2D2HA 1GQIA 4I9AA 4GUFA 4U5IA 3RMEA 4HU3A 4NILA 4H9TA 4QE4A 2V6AA 1PCWA 1S5VA 4AC7C 3M43A 2HXUA 5HJXA 3T2QA 1G69A 3ABXA 4C7DA 1O1ZA 4YTRA 4NT0A 2YW3A 3JZUA 3R12A 3AALA 2BG5A 3LZ3A 2VJXA 4L64A 4A8LA 4M56A 3WKZA 1CXKA 3NQCA 2Y88A 4QG9A 3IARA 1BKSA 3N14A 1EWDA 2VVSA 3LPGA 1R3SA 4FXSA 3M5XA 4UFIA 3B97A 1KW1A 4FS9A 1YPIA 3WL0A 3M7WA 1NQKA 3PZTA 4Q4RA 3RCMA 3P7YA 4DWSC 9XIMA 3VOIA 2YB1A 2Z2AA 5C2GA 4REQB 4UTJA 4LUTB 1E73M 1FOBA 3L0GA 3MWCA 5DO8A 2GOKA 1OC6A 5KINA 4GYJA 1BGGA 2PC8A 2TSYA 3W7OA 4Q32A 4EANA 1P5BA 4XTIA 3R8RA 2YL6A 2ZX6A 2G3FA 3LQLA 3QMRA 2XYLA 3KDOA 3VCCA 1I1XA 3KBSA 3BV4A 2Z6IA 4E5TA 1JPHA 3MO7A 3IUHA 1L0PA 4LOCA 3WLSA 3RPMA 4QISA 3ITTA 1TMLA 4WY0A 1VGAA 2P10A 1LBFA 3CZKA 1QOXA 2XFWA 4JDBA 4BQ3A 3UWQA 1QNQA 3MWAA 4D6JA 4O54A 2WCAA 2C16A 2AAAA 3USBA 1LJYA 2INEA 3U4AA 5HMEA 3VIJA 3LQGA 3UR5A 2WZHA 3QKZA 3UD6A 1T0OA 3WJXA 2OWCA 2TMDA 3PN8A 2I56A 3CZEA 5CSSA 1XLHA 1RQBA 3CK5A 1CT5A 2V8ZA 3CAQA 4A4AA 1WKEA 4A2RA 5BMXA 3QC3A 2Z25A 3QM3A 4UNIA 3W7PA 2O55A 1EEPA 2QJHA 1AQFA 2PDXA 1QRQA 3TOPA 4QE5A 4DBDA 4DVOA 4CCZA 5JXQA 4IICA 4IT1A 1UH2A 5E0CA 3WEZA 3NO3A 4N9CA 2B7OA 8XIMA 4JR5A 2ZVIA 1ONXA 1SR0A 2H8ZA 1DJWA 1US0A 4BK9A 2ABBA 3GH5A 1F3XA 1S39A 2OLSA 1V8EA 1DJIA 2W62A 1QNRA 4B16A 2A6NA 1I2NA 1CGTA 4L6OA 2AKZA 4N7QA 4INFA 3M0JA 3ZJKA 3BANA 3DCPA 1BAGA 1D2KA 3WEOA 2XZ7A 3BURA 1V5XA 2RKXA 3GTXA 1LP6A 4LW7A 5ABFA 4H9YA 3HFYA 2C91A 4ML4A 4ILSA 1V6VA 1UD4A 4FLRA 3PZIA 1BLIA 4POCA 4WK9A 4QIUA 1XUZA 4IQDA 5LIUX 3OA3A 5FD0A 5DANA 4MLRA 2XVNA 3ZVHA 1LLWA 1G4EA 4ZE5A 4DWSD 1KRBC 2ZCGA 4ERAA 2FLIA 4HPNA 4K36A 4EPBC 4FNSA 4M8UA 5C5YA 5A6AA 2C14A 1P7TB 4FSAA 3GNNA 1EIXA 3MSGA 3WFLA 5B80A 4O10A 3WX7A 1LBLA 1V6XA 5LKYA 3GXPA 5F2LA 1ITQA 1F8IA 1GPFA 4HPXA 1BD0A 2QUMA 3SSZA 2NX9A 1U1UA 4PL2A 4CQ9A 1L6GA 3RCYA 1H63A 4BWLC 4QNWA 1OT2A 3LMZA 5FEZA 2ZRYA 4ZGYA 3PJWA 1S2TA 4FF5A 4JTCA 2E67A 3T08A 4CD5A 3TN4A 4O17A 1XIDA 4UR7A 2GJPA 3EX1A 1KBBA 3QHMA 2X30A 2W9MA 1M7XA 4HIBA 3FVMA 4GHRA 4WRHA 3N6HA 1ADOA 3EMQA 4UB9A 4WXYA 2QAFA 1E6XM 1CXIA 1E4MM 4HJWA 4X3ZA 1OG6A 3N11A 2JGYA 1E9YB 1W9DM 5G5IA 2Q8XA 5IRPA 2CLEA 3M0IA 3BG3A 3N73A 1KD0A 1AODA 2X16A 5JIWA 2CLPA 2FMOA 1EOKA 2YCEA 3MO4A 2ALRA 5HMDA 4IGMA 6REQB 4WY0B 1AQ0A 1SJDA 1XRSA 1VFLA 3WK2A 4JFVA 3PK7A 5FCZA 1WZAA 3VM5A 4RNIA 1GVSA 2ZA2A 3AYRA 1ISZA 1H11A 1UOZA 1O5RA 2RDWA 5CG0A 2XVKA 4E2BA 3TEVA 3AUOA 3M07A 4ZE4A 4KWOA 3M41A 3ATZA 3PWGA 4MWAD 4O0ZA 1DXFA 1QR7A 3TA6A 2D3NA 5HNUA 1HXJA 3GNDA 2QCEA 5I09A 4ERGA 3F4WA 5FIPA 2Y6ZA 3GDLA 4QQ3A 4AYSA 1Y5XA 3TYEA 1XYFA 1SO6A 4DYKA 4DQWA 4LH8A 3EZ4A 3W38A 1S5NA 1EF3A 3LI0A 2WYSA 4R33A 4BI6A 3FYPA 4HT3A 1FKWA 3STEA 4J27A 3ZMRA 3HO8A 1DBTA 4JN8A 4JTHA 4J35A 3FJ6A 3STFA 2YXOA 3VGFA 4CCDA