1YNQA

Aldo-keto reductase akr11c1 from bacillus halodurans (holo form)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
298
structure length
288
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oxidoreductase
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
total genus 102
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynqA01
2PD9A 3T42A 4YU1A 4GQGA 1PZ0A 4JQ4A 3U2CA 3DN5A 4GQ0A 3UP8A 3VXGA 1QWKA 1LQAA 4QXIA 4QBXA 3WG6A 3Q67A 3H7UA 4WDTA 4DBUA 2IQDA 1JEZA 4JQAA 4ICCX 3RX3A 2ACSA 1HW6A 3LBOA 1Q5MA 3CV6A 1HQTA 5LIWX 5KETA 2I16A 4QR6A 2PDPA 4XZIA 2PDBA 3UG8A 2IKHA 3R7MA 4WDUA 4LB4A 2PFHA 2DV0A 2PDIA 3LD5A 4H8NA 3B3DA 2DUXA 3DOPA 3LNMA 4PUUA 4JTQA 2VDGA 1SM9A 2FZBA 4XO7A 1A80A 2ALRA 3BUVA 4XZNX 1J96A 4WRHA 1K8CA 4YVXA 1PZ1A 2IPGA 3WBXA 4JTAA 3WBWA 4GABA 1XF0A 3RX4A 5M2FX 2BGSA 3LEPA 2IQ0A 1AH0A 2R9RA 3EB3A 4XK2A 1PYFA 3V0UA 2P5NA 4FA3A 4JTCA 1Z8AA 3LQLA 1RY8A 3EB4A 1X98A 2FGBA 3CASA 5HNUA 4WEVX 3S3GA 1ZSXA 1UR3M 4XZMX 3M4HA 4YS1A 3R6IA 5HA7A 4IGSA 1IEIA 3KRBA 4ASTA 1T41A 1AFSA 1Q13A 2BP1A 2NVDA 5LIYX 3P2VA 3UYIA 4JIHA 5LIKX 4XZLX 4AUBA 4Q7BA 1XGDA 3QKZA 4QX4A 5LIUX 5AZ0A 2PDYA 2INEA 2WZTA 4DBWA 2IPJA 1AH4A 4L1XA 1IHIA 4FAMA 2R24A 2PDNA 2PDJA 3RX2A 3LUTA 4GA8A 2DUZA 1PWLA 4ZFCA 5AZ1A 2PDXA 1AH3A 4H7CA 3UZZA 3MC5A 4WGHA 4JQ2A 4PRTA 1EXBA 2IKGA 2C91A 3O3RA 3O0KA 4XZHA 2HDJA 1MRQA 1EL3A 4RPQA 3UWEA 5JH1A 4EXBA 1MZRA 2HE5A 1EF3A 2PDUA 4R9OA 1GVEA 3V35A 2A79A 2F2KA 3CV7A 3UGRA 5DANA 4F40A 3NTYA 3R43A 3R8HA 2ACRA 1XJBA 2FVLA 1S2CA 3BURA 1MI3A 2J8TA 1OG6A 2F38A 1RY0A 3WBYA 1VBJA 1X97A 4JTDA 1YE6A 4DBSA 2FZ8A 4JQ1A 1Z89A 1YNPA 4WDXA 4DZ5A 1S2AA 3C3UA 3H4GA 4JTRA 2FZ9A 2NVCA 3EAUA 2IKJA 3GUGA 4LB3A 1Z9AA 2HVOA 5LIXX 1C9WA 2PDQA 3ONBA 2QXWA 3UFYA 2AGTA 2PF8A 2BGQA 4GIEA 1R38A 3GHTA 4YVVA 3V0TA 3H7RA 3V36A 3LN3A 4EXAA 3LZ3A 4PUWA 3UZWA 3CAVA 4LBSA 1ADSA 4L1WA 1AZ2A 3D3FA 2PDWA 3V0SA 3R58A 4Q3MA 2PDKA 5C7HA 3F7JA 1AZ1A 2I17A 2CLPA 1VP5A 4WDWA 1EKOA 2IPFA 4NKCA 4IJCA 1ZQ5A 3M0IA 3R94A 2PD5A 4YVPA 2IKIA 3N2TA 3LZ5A 4OTKA 1M9HA 3FJNA 4IJRA 1ZGDA 3UZYA 4FALA 4XVEA 2INZA 2PDFA 2FZDA 1QRQA 3LENA 3LQGA 3N6QA 4LBRA 3BCJA 2WZMA 2HVNA 4JIIX 1X96A 4LAUA 1YNQA 4PMJA 1S1RA 2ACUA 2PDHA 4HBKA 3GHRA 2IPWA 4GACA 4FZIA 1YE4A 3UZXA 1ZUAX 4XAPA 3Q65A 4G5DA 2PDCA 2HEJA 2PEVA 3COTA 3CAQA 1S1PA 3MB9A 1T40A 3FX4A 2PDLA 3R8GA 3G5EA 5JH2A 4GCAA 1FRBA 2ISFA 4JIRA 4HMNA 2HE8A 4PRRA 3BV7A 2PZNA 5HNTA 1US0A 1LWIA 1Z3NA 2HV5A 4JQ3A 3M64A 3GHSA 3ERPA 2PDGA 3GHUA 2PDMA 4XO6A 3WCZA 3ONCA 4I5XA 3CMFA 4MHBA 3G1RA 4XVDA 1PWMA 2ACQA 2IS7A 4PR4A 4LAZA 1RALA
chains in the Genus database with same CATH superfamily
4FIRA 4MZYA 4FO4A 1TA3A 4YHEA 2XSXA 1VIZA 3TAKA 3UP8A 2G97A 4QLLA 3EPOA 2OZTA 2WJFA 1Q66A 4H9XA 3UJFA 4RUBA 4WDTA 1JEZA 3F5LA 4ICCX 3BV4A 4GYPC 3BMWA 3WZ0E 2J7DA 5JQ9A 1Q5MA 2Q3OA 1QMLA 1IF2A 3PZOA 3ECQA 3KWXA 2Z0IA 5I3IA 1BXBA 5H91A 3U5YA 2C1GA 3G1YA 4WDUA 2RH9A 4MFEA 3L4WA 4REQB 1ZPTA 2JGQA 3W4RA 3GG8A 5B80A 3A4JA 1W9PA 5KSWA 2FMNA 1XWYA 3K4WA 3H2FA 2G3MA 1EHNA 3AALA 1VYPX 5LHFA 1KBJA 1PX3A 2C18A 3BLOA 1FHLA 2G95A 3GXIA 4FLQA 4ZOBA 4NASA 4CD8A 7XIMA 2HK0A 1HJVA 2WMGA 1WZAA 2ZICA 1RAKA 6CGTA 1OCQA 2DFAA 4AAJA 3KHJA 3QSTA 3QV8A 4LAKA 1CIUA 2OXNA 5U4NA 1H51A 3CPRA 2QPSA 3WQVA 1N8WA 1E6SM 2QDDA 4PB5A 1WZLA 4MKVA 1F6KA 3WUEA 5BU9A 2ZZ5A 1OCBA 5M17A 3W25A 4R88A 5F1UA 1QOQA 1A50A 1FXPA 2V3FA 1NF7A 4LVDA 2WPGA 4HZ7A 2G8ZA 2NVDA 3PP7A 1LL7A 3AXXA 1DJXA 2XH2A 1QHZA 2DZUA 3LM3A 1ZBKA 1ZJAA 3NQCA 3BGGA 4D6GA 2GGIA 3PHAA 3LHVA 1GGOA 5DELA 2BOGX 3N15A 3AYRA 3HJEA 4ICMA 2V68A 4D72A 3R25A 2VFGA 3E0VA 3B03A 2O4QA 1R3TA 2WHJA 3CH9A 3PBWA 2PB1A 4I5RA 4Z2HA 4FI4A 1C93A 5G2WA 1BF6A 4IQEA 4O14A 1FHVA 1FDYA 1CLVA 3AUOA 1DL3A 4RNHA 2WPBA 4E8GA 1ELSA 4TVUA 4Z08A 4A2RA 2DZTA 3AFBA 4DJFD 1SQ7A 3V5CA 3O3RA 1TX2A 3WJZA 5T9CE 3T2QA 1LLOA 2OWXA 1RPXA 3URNA 2PDUA 2ZWZA 4UTTA 3I6EA 4QS6A 3USBA 3HO8A 3PWAA 5DANA 4DLFA 1JZ3A 1C92A 4AQLA 4L61A 4GYPA 4BQ4A 3DFYA 1GVFA 2J8TA 3NPUA 2QPUA 4MJ2A 4I9TA 5CCZA 1OGGA 5FESA 3LLXA 4WY0A 3UD6A 2NV1A 5FL1A 4Y2WA 4C6JA 3P8JA 2VM8A 4P7QA 3H4GA 4E4FA 4AZ6A 2BVWA 4PSRA 3AHXA 3WH7A 3R1ZA 1XISA 4MOZA 2BY2A 3UXAA 3OA3A 1W2VA 2J6XA 2R14A 1JZ6A 1R2RA 1NDYA 4GIYA 5AHMA 3DHFA 5HR6A 2P76A 2FHFA 4UWMA 3WD4A 3CPGA 2PI6A 4GYKA 1TPVA 4E8DA 3UXIA 2J8GA 3GHTA 1KFJA 2BXVA 2Y88A 4S2CA 2OEKA 3A22A 2YCKX 3WLRA 4H2CA 1ITCA 2O0TA 2Z6JA 1EA0A 3ZJ8A 1GG0A 3EWDA 3HG3A 2J13A 2PDWA 3FNDA 3IRSA 3UWUA 3MANA 4Q4MA 2XYLA 4IFOA 3HQ1A 3TSDA 1DXEA 2OX1A 2X1TA 2DSKA 3PUOA 1AL8A 2Y7DA 1WB0A 3ZWSA 2OWCA 1QBBA 2E77A 2IKIA 3KW3A 3WUGA 3VKJA 1I0DA 1W5OA 3KE0A 3P5YA 4Y9AA 5H8MA 4PEKA 4L64A 4ORIA 3KRZA 4V27A 3W7EA 2ICSA 4F0KA 3C2RA 4OFCA 2D2OA 4LOCA 4AXKA 3Q2DA 2NUXA 4IF2A 1E56A 2NX3A 3W37A 1E55A 5ABFA 3F2BA 2CKRA 3T1GA 2J7EA 2J79A 1X96A 4LUTA 4LCSA 3BE7A 4BQ5A 4LAUA 3P8IA 5KZMA 4MWAB 5ABEA 3E49A 1M5WA 4J3UA 3TLQA 4PMRA 5F2MA 4S3KA 5I3DA 1XLEA 1SGJA 2XG9A 1XLFA 3NQ2A 3UA3A 2OZ3A 3G1SA 3E2RA 3TJLA 5HNRA 1S1PA 3WO8A 1YDYA 2PDLA 2XM2A 3UG4A 1TG7A 3P14A 4G9PA 4B5TA 2W27A 4X0NA 1LT7A 1GKPA 1P0KA 3H4WA 1KTCA 2HV5A 2PDGA 4OVXA 1ISYA 3GXMA 5FAJA 3HV8A 3S5YA 1T99A 2VWSA 4NSBA 1DVJA 1S46A 3RNDA 3HF3A 2WJZA 1RALA 4IH3A 2XVPA 1O1ZA 3BSMA 3W72A 3NM1A 4M7TA 3UZJA 1H50A 4D6EA 2WJEA 3N9KA 4QBXA 2DY3A 4TV5A 1IGWA 4L4PA 4QEHA 1BYBA 1R9ZA 5I6SA 5GNYA 3MSRA 3JVAA 4Q4PA 1MRAA 3SGZA 5CJMA 2DZWA 3CYJA 3VOCA 2VEMA 4CNNA 1B9BA 1XW8A 3TUUA 2A6LA 3B97A 4PTXA 4W88A 3P93A 2G41A 5AHEA 3RMEA 3W7CA 2DV0A 1MW2A 3S8HA 2YDQA 1EP3A 5K9DA 3B3DA 2POZA 1PCWA 2VFIA 3I65A 2BWGA 2QR6A 3ABQA 2VFDA 2FZBA 3CQ0A 3NQVA 1LZOA 3TW7A 1UWSA 2GOKA 2X1UA 4YIWA 1TJ0A 1G9HA 5FL0A 3FHAA 3WUFA 3VGGA 3KM8A 2OQYA 3B9OA 3PJTA 3WQWA 2QPXA 1R9YA 3QGAC 4G56A 5D04C 3DH7A 1LM1A 5LHEA 2ZA3A 3BO9A 1XYLA 1AH0A 1QK2A 2R9RA 2XJ7A 3QTPA 2QV5A 3STFA 4JICA 3W70A 4WUIA 2HBXA 3RLUA 1P4CA 3GXDA 5SWUA 4JFSA 5CPTA 2F6XA 1XLIA 4IX2A 2PWDA 1BFNA 5CPSA 2FGBA 1XIIA 3LV6A 4LAMA 2WW5A 5EMUA 3T4WA 3VNJA 1OC6A 3QHNA 4HZ6A 4D8ZA 1E3XA 5T91A 1CXEA 5BROA 1XIGA 3EMZA 2YCLA 3HQOA 5XINA 3WELA 4WQ6A 4FOJA 3GUWA 2A2IA 3E2VA 4UFMA 2YW3A 1GONA 3FOKA 2Z1XA 1VF8A 2IUZA 3FSTA 3S1GA 3SADA 3EWWA 3KOWA 3LB0A 5EA9A 3VVGA 1V6WA 2VHLA 3RCMA 4PTMA 3GB6A 1NFBA 3OU8A 1CXFA 3Q45A 3UJSA 5I77A 4DBWA 2QJHA 4HHMA 4LYRA 1QR7A 3TH6A 1V6XA 4IUGA 4MMWA 4GPNA 3KVJA 4O1FA 1V3HA 2ISWA 1JD9A 4HQVA 2E3ZA 2VC7A 2VTFA 1A5KC 3JR2A 5CZTA 5FF2A 4L7ZA 1KC7A 3R4IA 1EQPA 3PJXA 1DWFM 4O52A 3NWRA 4BI5A 1W3NA 4O1BA 2ZRXA 1L6YA 1XR2A 3EA1A 4C5ZA 3N4FA 4AY1A 1HP4A 3G1AA 1U1UA 4MLJA 4M80A 4IGMA 3MUZ1 3VOHA 2F84A 3QM3A 1NOWA 2D73A 2XTKA 4GI9A 2C91A 4B5WA 3U48A 1GVQA 1GOOA 2HDJA 3TFXA 4F0LA 1GG1A 3IUDA 5HMDA 3B8DA 3WNMA 3UR2A 3N14A 1UHVA 3GVQA 2VX5A 4O4VA 2ZYFA 4JTLA 1T0OA 1WNOA 5FSEC 3TYUA 3OZYA 3B0PA 4QS5A 3FYPA 3ID7A 4XBJA 3EDJA 2F2HA 1UR4A 2PWFA 3QHOA 2GJPA 4M19A 1US3A 4K1GA 4J3XA 3MUIA 4IM4A 5BRPA 1OQFA 1G7VA 4H9TA 1ECEA 3T55A 2ZZ3A 4KGJA 3ZSSA 3TYDA 2GUUA 1K77A 4LB3A 4CU7A 3GFXA 1KGUA 5LIXX 1XHGA 3BCFA 3H2OA 3ONBA 4LRTA 3HFTA 5EYWA 3NQFA 4UQ9A 1HKWA 1EBHA 1KGWA 1Q8AA 2WYSA 4FNTA 1R38A 5CAKA 4U5KA 4RJEA 1CXIA 4K2SA 1R3RA 2CLHA 4A29A 2EPMX 3K13A 3QN3A 1DJZA 4DYEA 4Q8TA 3AHTA 3LMZA 1FP9A 2F6UA 1GYNA 1OZMA 1UR9A 5LNRA 1KB3A 2ZRWA 5F1VA 1BXNA 2GDQA 1SSDA 1K6AA 3M6YA 3CLMA 1GJWA 3GWQA 4QG9A 1AL7A 1G69A 4LNYA 4DUVA 2DQXA 3D6NA 4GRSA 4A22A 3W88A 3PNZA 1Q6LA 1KFCA 3FJNA 3YPIA 3RDKA 1TRIA 3VDAA 5LXXA 1T7LA 2CWNA 5HULA 3RAOA 1QRQA 1KWKA 4YMZA 1XQKA 5AHNA 1XC4A 3GH5A 4DEFA 4JTIA 3DI0A 4N6EA 3IK4A 2RFGA 5BOEA 1UA3A 3B0UX 4QLKA 1YBQA 4W7UA 3EWBX 3A23A 4DJED 3BLPX 3EZ4A 3ARXA 3BW2A 4PMXA 3WLTA 3SY1A 3GVWA 2PDHA 1QVBA 4TVCA 1R3SA 1X38A 4D71A 2GQAA 4RE2A 1AJZA 1UJQA 4UMBA 4GZIA 3BAKA 3CTTA 2QUNA 2Y6ZA 3ZT5A 5C2GA 3LXBA 1VHNA 1W1PA 1TMQA 1E1CB 3ABSA 4EAMA 4NYUA 3VIPA 3FCPA 2L5HA 1J0ZA 1U1HA 1Q2RA 1EYEA 3S9YA 2IS7A 3UEQA 3MUAA 2HPMA 3T42A 1X1NA 2Z2AA 5EFFA 5D8WA 1FWGC 3XISA 4JTSA 3ITXA 1I2RA 2VXNA 3H22A 3AJ7A 2ISVA 2O56A 4K6AA 1QI5A 4K38A 2W9MA 3H12A 4U5IA 4J2PA 3EWYA 4N4QA 4FHAA 5CPNA 5A6MA 1WUFA 1S5VA 1BGAA 2PC8A 2NXHA 5D03A 3VDCA 3UW6A 3IIVA 4MTVA 3MI6A 5L9FA 3GG1A 4HHLA 4PYSA 2PDBA 4RXFA 2J66A 5IRPA 2AOSA 1W3HA 2QMJA 1DJQA 1IWPA 1NDVA 2C1IA 4WR3A 4H8NA 4GVIA 3TFCA 2VENA 3UVIA 1SO5A 4AZGA 1AW1A 3OZOA 4HPHA 1HP5A 1OZQA 4I7VA 4O54A 2AL2B 3FA4A 3LBCA 3VOIA 4R85A 1J8VA 1Q6EA 3KBWA 3KS6A 3G8RA 4BCEA 1GW9A 2F61A 3MBFA 4AY8A 4BEQA 1CZ1A 2PTYA 3DDMA 2VMFA 1CGYA 4UTFA 4GUIA 4WKFA 3VCRA 1UWIA 3SCUA 1GPFA 1JI1A 3UZ5A 1HT6A 2BGSA 4W85A 1L0PA 2XFFA 2A3LA 1BYCA 3TP4A 4C91A 3TNBA 4XK2A 2GVGA 1MVYA 4HYRA 2F9RA 4JTCA 4GGHA 1TSIA 4AZ7A 3BAIA 2YXXA 4PUJA 1TVPA 1JYVA 3CASA 4CD5A 1FQ0A 2VR5A 1GQNA 4ENLA 3IJLA 4WD0A 1F05A 1WCGA 2A7NA 1QNVA 4JDYA 4CVUA 2BP1A 1JFXA 2TSYA 1XLLA 3OBEA 3TXZA 1BXCA 1YMYA 4AUBA 2FZMA 2GSHA 3UERA 3NZ1A 3WD0A 4S38A 1ZENA 4A2SA 1OFQA 1J01A 4Q6JA 1G0CA 1Y8BA 5G4HC 4TMCA 3SDOA 1JDEA 5PTDA 2X1IA 4JFVA 5E6YA 3BAXA 1K3UA 3LUTA 3AZTA 1D3CA 3VNDA 2V69A 4O0QA 4BY3A 4D6JA 1RBOB 2E7FA 4OJYA 1MW0A 4ZO7A 1AUSL 4YYFA 1JVNA 1OFBA 4ZE5A 4E6MA 1KWGA 2VD9A 4UR9A 4GFIA 3AMDA 4L6OA 1EXPA 4ZCWA 3UJ2A 1E0VA 1E3ZA 3TTYA 5I2UA 3NG3A 3QW4B 1W1TA 2C0HA 1V77A 2NX9A 1D8CA 1ZJIA 1H5YA 4G1KA 2EF9A 3N2OA 1NEYA 2GDUA 3MJMA 3Q94A 3R13A 3QRHA 1IEQA 3GTIA 4UCFA 2CWXA 2WBKA 3TOPA 1S5MA 2FKPA 4M82A 3MDUA 2DVUA 4GX9A 4LV9A 1OIFA 3IJ6A 1EJSC 2TYSA 3DEQA 4OBSA 4JCMA 1DV7A 5K4XA 4GD0A 1MMFA 3NO3A 4AYGA 3POHA 4O50A 5I02A 2BDQA 2VOTA 3C0SA 2XZ7A 3R79A 2NWRA 1AMKA 3VIHA 3WK2A 4N9CA 2ZDSA 1A0CA 1SJDA 5E1QA 1EBGA 1SR0A 1OM0A 4W5UA 5EBAA 5E93A 3VD3A 1VFTA 2R1LA 3W1NA 1ZL1A 2PC4A 3WMBA 1F76A 2GK1B 3SEPA 3M0XA 5GNZA 4Q8NA 5M5DA 4IZGA 1XPYA 3DHPA 3S2MA 4PTDA 1VD6A 3ISIX 4O0ZA 2ZRZA 2VWTA 2W3ZA 3OQ8A 4G6CA 1Q45A 2TODA 2BVTA 1HJWA 1DJYA 4CKQA 1BSLA 2C13A 4MY8A 1I1WA 2ZRYA 3NR0A 4HSNA 2VRQA 4XIAA 5E9XA 5IM51 6TIMA 1QO5A 2QCDB 4W7WA 3RLHA 2P1FA 3THCA 4XVEA 4F9DA 4N7QA 1KXTA 3USZA 3BCJA 4MIMA 2YIHA 4ZVJA 4I8DA 3KRSA 2YOCA 5F2IA 1L6SA 1UH4A 3ZQ9A 3SO7A 3QV6A 4Z1BA 4Q4QA 1W1VA 4HBKA 3EPMA 3W1QA 2XGBA 1WDQA 4BS0A 4KCUA 2PGRA 1OK6A 3FEMA 4UOZA 2E9MA 1TZ9A 4IFRA 3N04A 4B92A 3DXIA 4TIMA 1FUYA 4RE3A 2UY5A 4XV0A 2BSLA 3QOMA 4JHOA 5JBEA 2X30A 4LY8A 1E9IA 2O9TA 3NZQA 4NILA 2QT3A 5XIAA 1C7TA 4L56A 4FS9A 4GIAA 4NI8A 2ODOA 2JIEA 3WCZA 3H2AA 1XH1A 4H9YA 3JS3A 1S39A 2OO0A 1SZGA 1FWHC 2Y62A 3EKZA 5C71A 1HKJA 3FV9A 3VILA 2VZOA 1PZ0A 2VC5A 1QWKA 1B31A 1QI3A 3ARQA 4NU7A 4ZOEA 3LPFA 3RR4A 3F1QA 4CD7A 1TVNA 3RPMA 3GH4A 3QY8A 2DZXA 4G2DA 1LL6A 4W5ZA 4IWWA 3RMJA 4MKNA 1TWWA 1TO3A 1P0EA 4GQBA 4R7JA 1IEVA 4FNPA 3C2YA 1M7PA 2ZUVA 1HL2A 1EJTC 1W1IE 2O55A 2CBUA 1K9TA 4IIDA 1V0LA 2R1KA 4AIOA 5A6BA 2HK1A 2PRHA 1E0XA 4MUZA 3SQSA 4W86A 4RDZA 3O6DA 3WLMA 1Y5XA 3ZLGA 1RV8A 1C9DA 3MBDA 3LNMA 3QQ0A 1JCXA 1EO5A 4GO8A 1OK4A 3GNDA 1J12A 3QH2A 4NIRA 4LVFA 4XX6A 1NDWA 2Z24A 5G4WA 2VZVA 3AWNA 3GNRA 4JTAA 2BNJA 1ZLPA 4IL2A 2OCZA 1BTMA 4EOUA 4P7OA 1W6TA 3O1NA 1A5CA 1P1XA 3GE7A 3IGXA 3RIKA 5IFPA 3VYLA 5DEZA 1Z8AA 2X41A 1OYAA 4JFTA 2VVNA 3IRDA 4DPPA 4TXEA 3IJDA 1E6XM 5AYBA 3IJQA 1YIXA 1ZSXA 1V93A 3TZFA 8CGTA 1PKYA 4XD5A 3ANUA 5D2VA 3DFNA 4PCSA 2VQTA 4V33A 4LTSA 5HMSA 1S2WA 2E25A 2E40A 1AFSA 2PP0A 3V5OA 3MUXA 4GVHA 3FAWA 5KTLA 2OQLA 1GJUA 3H2EA 2HZGA 2YLLA 2QZRA 3DKLA 3UWYA 1LP6A 4OECA 3D46A 3QGKC 4I6VA 3CT2A 4LWWA 5LIUX 5AZ0A 3N29A 2INEA 1HJSA 3WQ6A 3AIEA 3HGSA 5E70A 1JZ7A 1CENA 4Y96A 4H01A 3VC5A 4XUYA 4EPKA 3L0NA 1VJSA 3T0BA 3W7GA 4C6CA 2NZLA 4NNCA 2NWSA 1GNXA 5I3KA 1H2JA 4PMVA 3WNLA 4HD5A 5HXMA 4ZFCA 5CBBA 4K8GA 4GI6A 4CNPA 1KD0A 3G1XA 5IDZA 3TE9A 3KDOA 4LXFA 4Y8FA 2RHGA 1PYMA 3CIXA 4FF7A 3W7HA 4JY9A 4P7LA 1QW9A 3SR7A 3TV8A 1F4AA 2QF7A 3O0KA 2X2GA 4Z2JA 1J93A 4L5ZA 1VRDA 3T08A 2JIWA 1H60A 1KQYA 2A79A 3B8IA 2QYGA 2R1PA 3UGRA 2GVJA 3ARWA 3WF3A 3KOYA 4Z42C 1KKOA 2PTDA 2Q02A 3VDBA 5IBXC 4LS2A 2OLHA 2ACRA 5TNVA 5BW6A 1E5NA 4Q33A 4X2PA 5M3WA 2DGAA 3FAXA 1DIOA 5G4EA 1UWRA 2VCBA 3NM3A 1PXGA 4JQ1A 1A5LC 5I3JA 1J11A 2F6KA 3HOJA 4HA3A 2PCQA 1YLVA 3FXGA 3GXPA 3MZNA 1KTBA 1IZKA 3O8AA 2Y0FA 6XIMA 4FMVA 4NAFA 3N18A 1A47A 4HPNA 1WUEA 3LTYA 2QXWA 2CLEA 1TCMA 3W7JA 3S2NA 3M41A 3DYOA 3C2FA 2E9LA 1Y7VA 3ITOA 2BGQA 5CGMA 3OYZA 3O7UA 5HINA 4LYPA 4B5XA 1TIWA 1GOIA 5G1YA 1W56A 3ABOA 3LZ3A 1G94A 3LLFA 3T0TA 2V9DA 1BKSA 3VNIA 1SZNA 4AX7A 4NI3A 2HS6A 3WDRA 2BY3A 1AZ1A 1JDCA 4XB3A 4S39A 4UFJA 2RUSA 3MP3A 4JNZA 4QE1A 4FNUA 2VURA 3N25A 3FDKA 3PSWA 1K7EA 1PL9A 2NSXA 2VUYA 1J2BA 3OBAA 4HPGA 4ATLA 2AKZA 4CQ8A 1AQ0A 3OPSA 3W82A 1A5AA 4H41A 1IIHA 1LQ2A 4XQ6A 3LENA 3QY6A 3GXTA 3PM6A 3EKGA 4Y6GA 4FEZA 5C55A 1JYXA 3TU9A 2HISA 3ZR6A 4F8XA 2YA1A 2QNEA 1LL4A 4M24A 1EGVA 1T8QA 2ACUA 1DWIM 1MUWA 2E67A 2VEIA 2HTMA 3DC0A 2ZZ4A 1KTNA 3TONA 3UETA 4ATWA 4GACA 2BXYA 1IR2A 1MDLA 3M1ZA 4DJDC 1DE5A 6A3HA 2E5BA 5A95A 2HEJA 3DBPA 2OGYA 5G1TA 2HSAA 3WNOA 3LCGA 1EJXC 3S1WA 2IXVA 3R8GA 1CTNA 4IPLA 3H55A 1NP0A 1EDTA 2DU2A 3CZEA 2B7OA 1DBTA 4HSOA 3EA3A 3CH0A 2XN2A 2EXOA 1ZAIA 5CC3A 2EJAA 3SJ3A 2IW0A 3A64A 4I9JA 3UXDA 3M64A 1PEZA 1R3YA 1D9EA 4PTVA 1KQZA 5CG7A 4CVWA 1XUUA 3H4XA 3I68A 2WWCA 3A6OA 2V2CA 4MYAA 1OEPA 1LWHA 2ACQA 3RHGA 1TUFA 4JQ4A 1EP2A 3DN5A 1JZ2A 5IBXA 4HGXA 4LPCA 1EH9A 3EEZA 4ERGA 1RA5A 1K8ZA 1ZALA 3STEA 2AGKA 1H62A 3AOFA 4V2XA 3LBOA 1YDVA 3D47A 1DXFA 1HQTA 1QNOA 3GNXA 4K8EA 4GUFA 3WIJA 5FI8A 2DQWA 3HPSA 3NIYA 4N42A 3VIOA 3KP0A 4KBXA 1Z7AA 1XV8A 2DP3A 2DORA 3EDEA 2I5IA 3AYSA 2OELA 2VI0A 3DG7A 2PLCA 1UKOA 2AKMA 1NARA 3BW3A 2W79A 4U33A 4PUUA 3DENA 4JTQA 2AL1A 1NF0A 2OYKA 3U4AA 3APYA 1DIEA 1FFQA 3P5ZA 2WMJA 3CZGA 4CQ9A 2B31A 3HTWA 3SRDA 4QCEA 3VIMA 3ZR4A 1UH3A 4AHPA 1XYAA 4FB7A 4Y8EA 3MUY1 3WENA 1EJWC 2WSPA 4QISA 2EG6A 4KEZA 1F4HA 4NY2A 3REQA 3UJEA 4HU3A 3QMRA 4YTTA 3LEPA 2PAJA 3TIMA 2C6QA 3ZLFA 3G1FA 2DZSA 3A4XA 4QG8A 3PPFA 1XICA 3WMLA 3TW6A 3KOFA 3VGEA 2GGGA 1VJZA 3W29A 4NT0A 5GPRA 3C8FA 4M6UA 3BK0A 2QGYA 1EDGA 5AC4A 1CB2A 3K30A 5HNUA 4WEVX 5AYYA 3OGSA 1XYZA 1UR3M 1EPVA 3N11A 2VEKA 1W0MA 2GSJA 3PAOA 4IGSA 4GUGA 3HMCA 5A8MA 4ASTA 2BVDA 3MKCA 4AZCA 4PCTA 3C2VA 3W2LA 3EDDA 1QNQA 1EO7A 1A5BA 4BWLC 3N19B 1SR9A 1UPMB 1VZWA 3CUZA 3ZZ1A 5LIYX 4YCOA 2B7QA 4NJKA 1W3KA 3M6DA 1HF6A 4XZLX 2FDMA 3B9DA 4QX4A 4YN5A 4B16A 1CWYA 2Y63A 5C9UA 4NZ1A 2G5WA 3BSGA 3W1PA 1ZBVA 3O05A 1KRBC 3ME3A 1LTDA 1KFWA 4DWSD 3TQPA 4DJDA 3WFZA 4AWUA 3EEGA 1YXYA 3B0YA 4FX8A 5F2LA 5FJOA 2A4AA 2YSWA 1LRQA 4MAVA 2XWDA 3FVDA 1UP0A 3VGHA 1D2KA 2JALA 3TJXA 5HMEA 3BQ5A 4PZVA 3G3DA 4MNMA 4A8NA 3AS3A 1HL8A 3AXKA 1QO2A 3G0XA 3IJ9A 1FXQA 1AH3A 3HFYA 1W9BM 4M6VA 4HHPA 1Q7MA 1XYBA 2EBNA 3VKDA 4XD3A 3TQKA 3GDTA 4NUWA 3UR8A 4CQBA 4FF5A 5FAGA 1R0MA 4UTMA 2YDSA 2RGLA 3WEZA 3OYXA 4UQEA 3LG3A 1DJNA 1JCTA 3BARA 7TIMA 2VFEA 3WQ8A 3AUJA 3U57A 3THAA 2GVYA 2YJQA 1AG1O 2VGBA 3ATYA 4AD2A 3QFWA 3WDIA 1DWJM 1POKA 3RCNA 5A6JA 4C7FA 2YCIX 1YPIA 2CZEA 3KBJA 2ZIDA 2ZWYA 2ZZ6A 3ARYA 3RG6A 3WH9A 4FSAA 1H7RA 5I23A 4HOZA 1JGMA 4PMOA 1XLHA 2WV8A 5EMYA 1LRTA 2YDAA 4C1NA 4HN4A 3BZJA 1XQLA 3HBLA 1DYSA 2FZ9A 3E74A 2CCRA 2W63A 4J4KA 3CO4A 3N73A 1I6NA 5IHSA 4CQCA 1TA3B 3DG3A 1EZWA 4DY1A 2VELA 5HQLA 1J0KA 3ZS4A 3RITA 2DSWA 3CZJA 1W31A 4PCFA 2XU2A 2YB4A 4KCVA 3V0TA 3LPGA 5H2ZA 3S2CA 1IWBA 2BMBA 4HK7A 3CU2A 1QXLA 3UZWA 4L1WA 1WYIA 1U2YA 3WQCA 2FPYA 3CQJA 4HCHA 4QLJA 1QOPA 1KGXA 1OC7A 4ACZA 2PS2A 4UBPC 4WDWA 2IPFA 1RHCA 4GXWA 4JTJA 3A47A 1SO3A 5CH9A 1ITQA 1KBLA 2YA2A 4KFPA 1HG3A 1M7OA 4A3QA 3GRIA 3W2JA 3UZYA 2ZUNA 2RDWA 2INZA 4Q4RA 4BWLA 4REQA 2WSYA 3DFPA 7CGTA 3TEVA 1XLJA 4GY1A 4J9JA 5LNUA 3KS5A 4JIIX 3VGDA 5FJJA 3MMDA 1FKXA 1I2NA 4GXMA 4MZ8A 4WSJA 3W1RA 3G3MA 4WOZA 6PTDA 4CQAA 2CEQA 1Q6RA 1UOKA 1UBPC 2QHAA 2CLFA 2QCLA 5HPCA 3ZT7A 2X05A 2NX1A 3LPPA 2V5JA 5FKYA 1NSJA 3FLUA 3WBAA 1K8YA 1GPWA 2WLZA 3NO5A 3VIKA 1JYNA 3COTA 4XD6A 4UNKA 2A3EA 4RV3A 1RSCA 1BTCA 4AH7A 3K4AA 3UCQA 1FRBA 2ISFA 4GUJA 4JTHA 4DAFA 4U4MA 3BV7A 3IK2A 4YWIA 3L5MA 1EHAA 2WSKA 1QPKA 5CZKA 1IE7C 1Q3NA 4GC4A 3CYVA 3OVGA 4DWSB 1AQFA 4I5XA 1K9EA 3CB8A 3R0UA 4UOJA 3MW7A 3P74A 1F61A 3LHYA 4HZ8A 5DMLA 4KS0A 1LQAA 2Z4GA 3EDKA 2FGLA 3DBNA 1VPQA 2O7SA 4IJBA 4QDPA 4LS0A 4NJIA 3ABZA 1P7TA 3NAVA 3TSBA 3A4AA 2KX9A 1HW6A 1VEOA 3IGSA 3KVLA 2WBGA 4NZCA 5DF0A 1SSGA 3W27A 3AIWA 3LRLA 4ZENA 2CC0A 3V16A 1XIMA 3KZPA 4MNKA 3L68A 4FXFA 1F9CA 4AEEA 1TELA 2MUCA 3ANVA 2X0HA 2IKHA 3JRKA 1FDJA 4LVGA 2OZ0A 3KCOA 1N7KA 4N02A 3LS9A 4NL1A 2ZDRA 1YTDA 4EP8C 4UTLA 1QPQA 2CXGA 4PN2A 1VKFA 3B9NA 3ARPA 1GHRA 1K8CA 4TR9A 2FZNA 3P0XA 1OVDA 1JR1A 1TTPA 1PZ1A 4UTUA 3W73A 5A8QA 5C9RA 1JZ8A 4M7SA 3CZ8A 4ZB0A 3LBMA 4C6OA 2VEPA 3LRKA 1PYFA 1JJKA 3VA8A 4RCXA 1GQJA 2A7PA 4OHQA 1HKKA 3K8MA 4Z2LA 1JGIA 3NL5A 4Y9PA 1GQIA 4BZYA 3H2NA 4KEVA 4CNTA 2CZDA 4Q32A 4DJFC 3GNPA 2I57A 1LG1A 4PUKA 3KUMA 3WLOA 2C19A 3PTDA 3LMYA 2J25A 4DN1A 5D9OA 3RPTA 3PBMA 4J3VA 2E1WA 2TMDA 4R27A 2XHYA 1EDQA 3F2CA 2E0PA 3OHMB 1M53A 3QKZA 3WQOA 1GZ1A 3FYYA 1I0BA 4NAEA 3SCPA 4DYJA 2HWGA 5CBJA 2R24A 4GNKB 1QHPA 2YL6A 2DH2A 1VBRA 3FN9A 4R34A 3GDLA 2V3EA 5CLTA 3W7LA 2CLMA 3WQFA 3MU7A 3OHIA 3A4WA 2P3EA 2GLKA 1X6NA 1EEXA 3EXTA 4RPPA 3W0KA 2AQOA 1H61A 2ABBA 2J47A 3PUEA 2ZUSA 2QLYA 3FKKA 3GG0A 5ABFB 2DIEA 1S3TC 3IAPA 4JQ2A 4LUTB 4TU1A 2QJIA 3RRXA 1EXBA 1LBMA 3WNPA 2QVHA 5HATA 1P6CA 1QT1A 2PWVA 2H3DA 2J9ZA 1ISXA 4JTFA 3NEHA 2BOFX 2YL9A 4UUIA 2F2KA 3IEBA 1H7NA 1PKLA 3EOSA 4JR5A 1JPMA 2NVAA 3JZUA 1PDYA 2FVMA 1YX1A 5FCZA 1JFHA 1I2OA 1MEHA 4QGCA 1G4EA 1MI3A 4J40A 3RRAA 2H8ZA 1RA0A 3BAJA 4DBSA 1XGZA 3JZEA 5JIWA 1V3LA 4GFSA 3ES7A 4CN6A 5A6SA 2X0YA 2CZ5A 5C7VA 1HZYA 3KL5A 2G37A 5DBTA 1OF8A 1PHQA 3N2BA 1CT5A 3VZXA 1WKDA 1SJCA 9XIMA 4XBSA 3GC5A 3CNYA 2XFYA 1A3XA 1AQMA 1B5TA 1DHKA 4Q7NA 3TQ0A 2KZHA 3CM4A 3W28A 1EJ7L 1GVIA 5GJMA 3DKJA 1XIBA 3VIJA 3G8EA 5AECA 3GR7A 4RLIA 3KTXA 2B0MA 3IUHA 3ALFA 3L23A 3QV9A 3M0JA 3S9ZA 5AB3A 2ZTJA 4Q8VA 4QAIA 1OFEA 3BOXA 3H7RA 5A1AA 1S5NA 4IX0A 4IMCA 4QFUA 1PJ9A 1H7XA 1T5AA 4PL2A 2Z2UA 5A8OA 1W8SA 4RW5A 2WHLA 5A2AA 2Z2BA 1J79A 4L4MA 3F7JA 1Q4NX 3E0LA 2DVXA 3HV9A 2BS9A 5XIMA 1UQZA 1OX6A 3W01A 3N2TA 3A9IA 1ZJBA 4FXSA 4L9YA 1EJRC 1W37A 1J5TA 1JXJA 4HB7A 2X40A 4AX6A 3CL8A 3IIOA 3W7NA 4PA8A 1QI0A 2O9PA 2GQ8A 5JBDA 3L0GA 4WY0F 4TUFA 3LGGA 3AU2A 4O1DA 1RCQA 3OGRA 2QQ6A 3CB3A 4DIAA 3V5FA 2XM1A 4NZFA 4Q8PA 2X16A 3W76A 2C1HA 4V1XA 2X1RA 2Y4SA 1NIUA 1XRFA 3TKFA 3C0LA 1EGZA 1MW3A 3KBSA 5DN1A 5DXYA 3NL3A 4QTGA 2I1OA 1K4GA 2DZBA 3LLDA 4OV4A 3UZXA 2EG8A 2YBVA 4GKTA 1CI1A 2GL5A 5CXPA 4KCTA 3SUVA 2JEPA 2Y89A 4MY9A 1OF6A 4JAWA 2YCLB 4JIRA 4DZHA 3NDOA 3O9NA 4B15A 1QCWA 2Q6ZA 9RUBA 2TRSA 4LF2A 1C7SA 4XIMA 1FCVA 2EPNA 3ZIZA 3W6MA 2Q71A 3TCEA 4W84A 1OY0A 2V2HA 1HJXA 4S3AA 4L65A 3OVPA 3GDKA 3BLDA 4GQ0A 2VVSA 3SECA 1W8GA 2Q8ZA 5KZDA 3WG6A 4C60A 3WH8A 2EPLX 1R85A 3EA2A 3KL0A 3L4XA 4PTWA 2NXIA 3H7UA 4W7VA 2WWDA 3UQNA 2VNCA 2OYMA 4GBUA 3TA6A 5TQLA 4LALA 4AIUA 1I1XA 1TV3A 4OQVA 3RPDA 3J7HA 1P6BA 2RDTA 4UMAA 3VNMA 3VNYA 4IGHA 3BZGA 1QPRA 4O57A 3BJFA 4CCCA 1B3VA 4BHYA 2JFEX 2PSNA 3E02A 4AFYA 1EZ2A 4UTIA 3WD3A 2OLAA 4ZQCA 1H7WA 2UY4A 2E1DA 3NZGA 1YXCA 4CCDA 3CJPA 4F0SA 3KCJA 1ZY9A 4HNTA 1LJYA 3EX1A 1I45A 1K1DA 3ZM8A 5DFAA 3N2CA 1KM1A 1TRDA 4DELA 3NOYA 3F03K 2WNNA 4XAYA 1XINA 3T2OA 2W92A 2J7GA 4DX3A 4IFKA 2Y8VA 4D1JA 2WXDM 3THQA 3QQ1A 4HYWA 1YPFA 3BPWA 1JI2A 3GTNA 2XIIA 5M2FX 3WH6A 3HG2A 3WDHA 1KM3A 3NQAA 3SCOA 2NQZA 3SIZA 2PRLA 1XYFA 3PANA 1TQJA 3MS8A 3PVFA 1UUOA 1YYAA 3LCFA 5EMJA 2EG7A 3BOLA 4Q4SA 5IXEA 4M29A 4UFKA 7ENLA 1VCFA 3CQIA 5BMWA 1BVNP 3H26A 5MKGA 1YADA 4QNEA 3WLQA 2DZPA 1E0WA 5K3VA 3CAWA 1ONXA 4JY8A 2OOGA 1EC8A 4UZUA 3MY9A 3W1TA 1TKKA 3EX6A 2Y1HA 3Q58A 1XPGA 1VR6A 1I9CB 1NWUA 3SY8A 3MUCA 3CMJA 2POTA 1FP8A 3TVAA 1HUVA 3KAOA 4FOKA 2ON3A 5AY7A 4PMDA 3VE9A 4C6DA 1P1MA 2IPJA 3QC3A 4L1XA 2VL4A 2YCJA 2YXGA 5HNNA 3TWAA 2ESCA 5C8BB 3TTOA 1AODA 1TPFA 4NZ3A 1J0HA 4LV4A 4CNSA 4RL3A 4QNWA 1W9DM 4UC5A 5D8ZA 5C9ZA 3PZQA 2NQ9A 5AZ1A 1TWZA 2ATSA 5C9WA 4H8VA 1D8WA 4GX8A 2XFRA 3EX3A 4S1FA 4IXHA 4HCDA 3T40A 1M41A 1ZB5A 5EPDA 1H4PA 3C56A 1YBQB 2BASA 1CGUA 1RH9A 1GW1A 4RZBA 2R1MA 4UQAA 3W2NA 1RQHA 2QJGA 3CV7A 3VMOA 4XAZA 1LLWA 3UNDA 3GNNA 2GVEA 3NQEA 5BOFA 3NTYA 3TC7A 4HU4A 4HHHA 3BURA 3AC0A 1MNZA 5ABTA 2PWUA 4X9SA 4QE4A 2VGFA 4JTGA 4C6NA 3MHFA 3THUA 1Q85A 4HU8A 4N9DA 1O6IA 1JPDX 1QWGA 4GVFA 2C0AA 1DWHM 3L2IA 1S2AA 5LNWA 3UXKA 2J88A 3T7VA 4FXRA 4OV9A 5AOUA 1R47A 4Q8OA 1XG4A 2XSAA 3FVMA 3GAKA 3VABA 1MSSA 4O17A 1XRTA 1O5RA 2VZSA 1HJQA 2YPIA 3P3BA 2A7RA 1F07A 2W0UA 4DJEC 5I5RA 4I8YA 2E28A 2HCVA 1OBAA 4H8UA 2A5HA 2X2YA 1BQCA 2P88A 3ZT6A 1XRSA 4GZEA 3MP4A 1HXJA 5DRIA 5I79A 5HJLA 4KWOA 1UROA 4BI6A 3QPEA 4KCWA 2A0NA 4OBRA 2V38A 5D2WA 4M51A 2BHYA 3MI3A 4E2VA 3PB2A 1XCWA 5LNSA 1FCBA 5EMLA 4N0RA 1I60A 4YCPA 2RAGA 3NSMA 3ZYZA 4PUNA 2IMRA 1N8IA 8XIMA 4EANA 2DSZA 3W24A 2VZUA 3LZ5A 2C8NA 3AHVA 4CNOA 1KKRA 4F2UA 4GXPA 3PJUA 3N4EA 4LRSA 4PMQA 4R7WA 3WQGA 1GT8A 3W53A 1DEDA 2B7PA 4W4QA 3UWQA 3GZ3A 4LBRA 2HVNA 4GNJA 2FJUB 3R5EA 2NT0A 4J7RA 2W67A 2YX0A 1W1B1 3I7QA 4J3WA 3W1AA 3VD4A 2OLSA 2B4GA 4C7GA 1E51A 1IT0A 2VCAA 3SUWA 2DIKA 4B4FA 4V28A 2IPWA 1OX5A 1ME7A 4KGLA 3CL6A 2EGZA 4IPPA 1KCLA 1LDCA 3TR9A 3QC0A 1UD4A 2R91A 4S23A 1ZHAA 3R89A 2VFFA 3IJ7A 8XIAA 3N9RA 1EX5A 2XN0A 3UBPC 3N3TA 4EE9A 2B81A 3PFRA 3RFAA 2INFA 4HMNA 4IPNB 3BJTA 4INFA 2HE8A 4MWAD 5A6LA 1THFD 1HKIA 2Q8XA 2Z28A 1B54A 3B05A 4K7YA 1PVNA 5D09A 3LGDA 2OSXA 4JEJA 2J27A 4S3BA 3NVDA 4YL2A 4RNJA 3ONCA 4E38A 1C8VA 4MUPA 3SCRA 2X7VA 3T8QA 1ENUA 3CUJA 3HURA 3IIZA 2YCEA 1KW1A 1V8EA 4PSPA 4UR8A 3W1LA 2QDEA 4RNIA 2EKGA 1WXYA 5LA0A 5CJ5A 5CEWA 1XXXA 1JF5A 4ZQRA 4OE7A 3LM7A 4IICA 1JPIA 1FWBC 3CV6A 5LIWX 3V18A 3MSGA 3PY2A 3W22A 2OFJA 4FNSA 4WIWA 5M03A 4KWSA 3N2MA 1GVSA 1G6CA 4M6QA 4BR1A 3I3EA 1IXOA 3H8AA 3FJ6A 3TYEA 2QUUA 1CLKA 4JTUA 1ZBWA 2UY3A 4ATDA 1V3JA 3QVQA 1QI2A 3ARRA 3B8SA 1Q6OA 4EWJA 1W3TA 1KXVA 4NZJA 4XTIA 4DJEA 5C0QA 4B2DD 1R3QA 2VGGA 1GYMA 1REQB 2HQAA 1QASA 1RP8A 2G3JA 2ZRUA 3QGVA 3BG5A 3VO0A 1P0DA 6ALDA 4ZZ9A 3AIRA 4C6QA 4L80A 3FIGA 4XD4A 1OHLA 2ADAA 2HVMA 4E3VA 3WBXA 2WCGA 4GLEA 3MTWA 1MXSA 1OGSA 3CMGA 3GO2A 3T0AA 3IWPA 2IQ0A 1E4MM 2CU0A 1U5HA 3ANYA 4NXKA 1RQEA 3PZIA 1WAUA 3MQTA 3AYTA 1TV2A 4AVFA 2BX7A 3GFZA 3OB8A 5K9XA 1B3ZA 3A3WA 3WQEA 3S0CA 4WF7A 3E6EA 3NZPA 2VD8A 3O6AA 1GEHA 1V51A 1N82A 3ZJ6A 1SO6A 4YS1A 4NZ4A 3BANA 5FEWA 5CGQA 5F7UA 2DUAA 1UD2A 3W6LA 4C6BA 3FHQA 4AHQA 2FPVA 4DWDA 4ERAA 3WX7A 4FX6M 3DFQA 2DW7A 2J6VA 3P2VA 1KRCC 1ME8A 4DLMA 1BRLA 3LGEA 3NL2A 1W1YA 3UXLA 3KBMA 4RDYA 3AYVA 1QUMA 3H53A 4TOQA 3TZNA 3W6YA 3ITCA 5IOBA 1ZP4A 4WKAA 5A6KA 1AA1B 3W83A 4GISA 4Q6XA 3AXMA 5GJNA 2CLIA 2Z7GA 3PN8A 1PWLA 3W71A 1R6WA 3LHTA 4DUWA 5RUBA 4BQ2A 4HNLA 1M68A 2V5KA 2YZRA 2DT0A 5JVLA 1O94A 4FLSA 4GE8A 2QCDA 4AHOA 1RCOB 4OOZA 1WPCA 4IQJA 2ANUA 1LLZA 4MVAA 3D0CA 1TJ1A 2IKGA 1F5ZA 1W2PA 5AC6A 2DDXA 2H6RA 4ZQMA 1EB3A 3HQPA 2WMKA 1H5VA 5C9XA 3DG6A 4UIOA 5K9CA 4QJ3B 2Z25A 4XWUA 5LXEA 2ZX7A 4FR1A 1VFMA 4LANA 5HAOA 1B57A 1ALDA 2VEFA 2XIBA 2ZZ2A 3C86A 1BG9A 2P50A 3PUGA 1EOMA 3TYCA 1JPHA 1X97A 4JL1A 4U28A 5C5YA 3S5NA 1YE6A 5E0FA 3VKAA 1Z42A 3QJAA 4ZL1A 4ZQOA 4C65A 3C0QA 1U30A 3TC3A 4L4LA 1BG4A 1ZU8A 3APGA 2VRJA 3IJIA 4GZJA 3UF9A 2UBPC 2FMOA 2WNWA 4GUHA 1JL8A 1KCZA 1FHUA 2E6FA 4YHGA 5D33A 4H19A 2EPOA 3Q37A 1T6MA 5HJYA 1FWSA 4C6MA 3L12A 2BGNE 3K8LA 5CPQA 3W1MA 4PBEA 1V7AA 5ECUA 4ZSUA 2J9XA 1H7PA 4GJIA 4I9AA 3RU8X 4IP4A 4R7OA 2Y85A 1O7AA 3WMCA 3DX5A 3V0SA 5TBOA 1ODUA 5BNKA 2GDVA 4OOUA 1XYCA 3R8RA 1EKOA 4KMQA 4EAYA 5I03A 1L6GA 1KXHA 2BG5A 1C29A 3M0IA 4YVPA 1CB7B 1YHTA 5BWAA 1JDDA 3LCXA 2ZA1A 4YLWA 4OBTA 3BDKA 4G7FA 1PKMA 1OFAA 2PBGA 1KM5A 4MB3A 3BLLA 1B30A 5G1MA 1EFZA 5C6MA 4RKAA 3OODA 4NNAA 2CBJA 3E5PA 4HT3A 1XLBA 2WZMA 3L4YA 2J9YA 3W7MA 3BAWA 2HBVA 1TPB1 3N6HA 2Y2WA 2V81A 4IQLA 2J7FA 3P67A 5DCBA 3RM4A 3LXCA 2ZXDA 1Y5WA 1YQ2A 4JL2A 5AKQA 4JN6A 1ZBCA 4KIRA 4ZBCA 1W9XA 1UC5A 4I9MA 3M0YA 5C54A 2JF6A 4W8LA 2Z29A 1S2VA 2BOEX 4EXQA 1G4SA 1VFLA 1HTIA 3LXAA 3L2LA 1ESWA 4AWTA 2I5QA 1H0IA 1G5AA 2Y5JA 4LYKA 3KP1A 3LERA 1V79A 2FH6A 5CGTA 4PRRA 3CWNA 3MKVA 3NXFA 1X8FA 3HQNA 1UUQA 4A3UA 3GG7A 2PP1A 2GPTA 3RO6A 3W7OA 2QCFA 3DYMA 4OU1A 1W3IA 4KEUA 3FFSA 2JQXA 4YTUA 3QZ6A 1WQ5A 2VC9A 3S1VA 1W32A 1PWMA 4I5UA 1UBSA 3WD1A 3DC8A 1N55A 3BSHA 4IIBA 4GQGA 3U2CA 2ZXAA 3VXGA 3ZJKA 1KV8A 3AIBA 1M65A 2OWWA 3BJSA 4P61A 1RP9A 4Q4KA 1K02A 4RDWA 4QHRA 1E9YB 3UCDA 3UPWA 2AAMA 3K8KA 1E0UA 3RX3A 2OOFA 3TJIA 1SZFA 2CXEA 3EPNA 2VRKA 3IV3A 3EMQA 3MVTA 1Q2SA 2PDPA 3UG3A 3OTRA 2PF0A 3BG9A 5AC8A 3S4TA 3RJYA 1TPEA 4LUSA 2ZKMX 4Z0SA 5FSDC 1JQVA 3N3MA 3RGTA 4AWSA 2PA6A 1B3OA 3AZRA 3ZVHA 3OQEA 2WZEA 5HQMA 3KOZA 4QJ4B 3VNLA 5DQPA 1H1YA 2WCSA 5H8UA 6ENLA 4ROQA 5G5IA 4MJMA 5CKSA 1WAWA 1PPIA 3E96A 3OW1A 4ADTA 3O15A 3SBFA 4MADA 3RK8A 4Y9NA 1WKYA 4KFNA 1QJWA 1XD1A 3S5SA 1RQBA 2WSQA 3B0XA 1RLCL 3F2DA 5BMXA 3MV01 4GABA 2WB5A 4UTHA 3M0ZA 1TWSA 3IAQA 1A0DA 3VDGA 3SN4A 4HA0A 2VUNA 2A85A 4IT1A 3M5YA 3MO7A 5J04A 2X8RA 3NNTA 4W9TA 5CC6A 5HUOA 1UIPA 1TPC1 3SUUA 4PMYA 2GGEA 4NAFB 2VYOA 3S3GA 3SCVA 4C6EA 2J62A 3LTPA 3U2OA 3CUIA 2ZUWA 2FTWA 4JTEA 4RR4A 2OVLA 3IGHX 3BICA 5A5WA 3UY7A 4PRWA 3T07A 3P80A 1XSJA 1T41A 3H2CA 2XGZA 3OG3A 5TAOA 1RZMA 4WZHA 3PTMA 5E9AA 4OT7A 2D3LA 4UTJA 2WZTA 1D3HA 4D6DA 3OIHA 5A2BA 2EHHA 3WJXA 2YFOA 1KRAC 3DHUA 4LYQA 4HNVA 1A5SA 1UMYA 2PDNA 5HWJA 4CEUC 1WBJA 4UB9A 3NPXA 1N8FA 4PFHA 2XH4A 3WFLA 4RX0A 2Z7KA 2EPHA 1Q7ZA 3KOXA 2OQHA 2RKXA 1JCLA 3GTXA 4LF1A 6XIAA 1FWWA 2DSVA 4UMCA 3E2SA 3MC5A 1D7FA 1J6OA 4DVOA 4BI7A 4EWND 3RM8A 4R5EA 2PWEA 4QQUA 2OSYA 3GIYA 4IIGA 4S3FA 2XSBA 3B40A 3NQ6A 4WJEA 3AZSA 4N2YA 4K7VA 1VPYA 3TQVA 4N6FA 1FTXA 3B4UA 1JUKA 1FWDC 1XYMA 5BYWA 3S6OA 1JQXA 1WX0A 3CAKA 2Z1BA 4RE0A 3W7QA 2OO6A 1POJA 1ONEA 1VGAA 3NYDA 1XJBA 4M1BA 1YTKA 1A3WA 3ITGA 3QMTA 1GORA 5HMFA 3G1VA 4RDVA 1XH2A 5DCDA 3CLWA 5AHFA 2HPIA 4LC8A 4A3HA 4P8UA 4RZ5A 3VKBA 1XDLA 4TX9A 3H7VA 4JIQA 3QBUA 4I6KA 4PMNA 3ZXWA 4Q7IA 1UKPA 3I7RA 3PFMA 1RR2A 1QTWA 2OMAA 4QIUA 5AVHA 3GUGA 2FHBA 1SJBA 4IOTA 1C9WA 2WZIA 2VDHA 1VBUA 1PIGA 2V3GA 3M07A 1HX0A 3KLLA 4HA1A 1ZAJA 3TA9A 1R86A 3R11A 1X1OA 2QV4A 5D4YA 3PZMA 5LGZA 3AIQA 1FWJC 3NPWA 8A3HA 4ORMA 3RJXA 4GQRA 4NHVA 3SM0A 1GKQA 2D1ZA 3VM5A 2V2DA 1LRNA 1ADSA 1UH2A 3U5UA 5B7ZA 5GNXA 1Q6DA 3QR1A 4A05A 1XGEA 1VS1A 2VDIA 1HVXA 1GOWA 1QAPA 3M5XA 2J7HA 2PD5A 2XVGA 1A0EA 5D9NA 4D6HA 3DCPA 3BMVA 3QKEA 2JF7A 1MW1A 1AD4A 5DY3A 3WQPA 4UTKA 3PZGA 1WOBA 2XGIA 1WOAA 3C4UA 1UASA 4IL0A 2C15A 5HBFA 1F8MA 1TZ7A 1QPNA 5CC5A 1J18A 1TTJA 3TK7A 4W93A 1QW8A 3LHWA 1QHOA 3REQB 1CGXA 4DZAA 4A3YA 2CETA 4LS1A 3NEVA 5AYXA 4FIQA 2LLEA 1OC5A 3HPAA 1W1A1 3DERA 1TIMA 2YGYA 4FZIA 4B5VA 1M7XA 5B7YA 2V5BA 1C3FA 4AZHA 3QTGA 1BWVA 4Y7EA 5ABGA 1R46A 1CPUA 4L9ZA 5EBUA 4FLOA 4H9MA 3GBEA 3NQDA 4AZCB 3I7SA 3QOKA 5I24A 2X1SA 1LWIA 3GAYA 2X0SA 2FIQA 4JQ3A 3HGRA 1MO0A 2HROA 1YKWA 4TVDA 2F7FA 4LFYA 1AQHA 3S9IA 4M6PA 3IJ8A 1BVZA 4K37A 3SQLA 1CGWA 2PD9A 3UJRA 3ABRA 1IYXA 3T81A 1HO1A 1VFHA 1GZJA 1MUMA 1TPUA 4QXIA 1QOXA 1J9YA 4I90A 2I9UA 4AZ5A 3AS2A 4HKPA 3FJ4A 1R30A 4E2OA 1W5MA 1O12A 1G4PA 1UKSA 4GY0A 4X2RA 1XIDA 1XKJA 1JAEA 2X09A 4OWGA 2WVSA 1XSKA 4XAFA 1HNYA 1PV8A 2UWFA 1UZHA 4U3AA 3UG8A 1RUSA 1OB0A 3R7MA 1FKWA 5J8LA 2YR1A 3SUSA 5D2TA 5EU9A 3WNNA 1VFFA 3HG5A 3QLLA 1OCNA 1FA2A 4OIFA 1Q63A 3PPCA 1RK5A 4H9ZA 1E6ZA 3TX9A 1IQ8A 2WVVA 3TWBA 4CGTA 4XO7A 1QPOA 5L6UA 3VCNA 4DWSC 4Q8UA 1EC7A 1H63A 3M46A 3VK5A 2CFFA 2XN1A 1YDOA 5BRBA 1QATA 1L8NA 1E1EA 3RX4A 1EPXA 1R3VA 3IIXA 1P0NA 4AD1A 4RZ4A 4CU6A 4AD5A 4C1NB 4P7NA 3NZRA 3R12A 5E0KA 3W3OA 3PJWA 3S83A 2EKCA 2HXUA 5CZJA 5D2XA 1XBZA 3IIPA 3WK3A 1M04A 3W74A 1Q13A 1GK8A 1UWAA 3TN5A 1HGYA 2WNZA 4UTTC 2XIJA 2WKGA 3MI2A 1PE1A 5D05A 3K4DA 2VX6A 3VTRA 2FVKA 4CEXC 2QUMA 2EPKX 4ACZB 1TREA 4DPQA 3V3WA 1VPXA 3EOOA 5AC7A 1WE5A 3SCQA 2WLYA 5E0CA 4WJXA 3CHEA 3W2UA 2PTZA 2DUZA 3AQUA 3UCCA 4PULA 3ZSTA 2E09A 3W84A 4ADUA 2E5CA 3I10A 1XBVA 1V0KA 3F4NA 1PSCA 4CNUA 1GVRA 4QE5A 1KXQA 2ZX5A 3GXNA 2QJNA 1ML1A 5CPMA 4H2HA 1WDWA 3U2EA 4MPKA 3GYEA 3APTA 3RLGA 2HJPA 2CBVA 3SQMA 1SFSA 1UP3A 2BB0A 1JCYA 1K7FA 1SW0A 5REQB 1UZ4A 1M3UA 1E0TA 4P8VA 2JGYA 1C91A 1UIOA 3HGJA 3GM8A 3IV8A 3KBVA 4HMCA 3B8UA 2GWGA 2C14A 3GH7A 2QMKA 5I09A 1OG6A 2F38A 1RY0A 3WBYA 3WLKX 5I06A 1VEPA 2VR2A 4Z1CA 1TB3A 3AMGA 2H8XA 1W54A 3OLEA 3CQHA 4HJWA 4GI8A 1FWCC 2V63A 2E4TA 3GFYA 1YNPA 3VD7A 4WK9A 5FEPA 2KAUC 4JCLA 5F4WA 4ZEPA 3TR2A 1JDFA 2QEZA 4S3EA 1L6WA 1FBAA 1UD8A 4JN7A 5IHRA 3HA1A 2RJGA 4NG3A 3TXVA 3KVKA 3E2QA 1DWAM 4MFDA 1EWDA 1RCXB 2JE8A 2PDQA 4HMDA 2YYUA 4NVTA 1NWSA 3TAOA 5JBFA 2AGTA 2W4XA 3TTQA 3A24A 4DWSA 1EEPA 1B0IA 1LOLA 2NT1A 1E9ZB 3U9IA 4ALDA 1P7TB 2BZNA 3AMLA 1IEXA 1XCFA 3V36A 1JNDA 1S38A 2OEMA 1DHPA 2AQWA 4GHRA 4F66A 3CAVA 1TTQA 3G24A 4H4IA 4OUIA 4O13A 3W2KA 1RLDA 3UR7A 4H7ZA 1R7AA 3R0KA 2QVNA 3U4FA 1AK5A 1XIEA 2YA0A 3F4CA 4AEOA 1VIWA 4CD6A 4O4WA 1RBLA 2J24A 2V8ZA 1UB3A 3PF3A 1XLMA 2A3AA 5F4SA 4PTNA 4FALA 3B8VA 3IPWA 1LBLA 4QJ5B 1K4HA 2XPKA 2PDFA 1UQYA 1GHSA 4AEFA 5I00A 2WVUA 3UY8A 1IT7A 3UR5A 3BCDA 2QDHA 2QCEA 3RLVA 2FFCA 3BLEA 3A12A 2G0WA 3H2MA 4M81A 3BWWA 1V08A 3SUTA 2HNEA 1TE6A 4PMJA 1DIDA 5BOOA 3OZMA 1XH0A 2PLKA 3VMPA 2W61A 4DO6A 4CD4A 4C6LA 4GI4A 2PWGA 2WOQA 3OLIA 4O53A 1JYWA 2D20A 2ZVRA 3NVTA 2E6AA 2QJMA 1ZRQA 4JBRA 3PSVA 3I4KA 3G5EA 2WANA 3URQA 3U8GA 3CTLA 2PZNA 4AF0B 1US0A 3B04A 1E6PA 1OX4B 2QKFA 4D1IA 9XIAA 4ILSA 2PDMA 3ELFA 1F73A 3JUGA 3FA3A 1LCOA 4NAEB 5GJPA 4GBDA 4BQ3A 4LNCA 2FFIA 2I5GA 2ZUMA 1SFJA 1IT8A 3CZKA 5HDRA 3ZR5A 5DY2A 5ENLA 3L5AA 3L66A 4KRZA 4IMGA 2E68A 4X61A 4NF7A 1FH7A 5BCAA 1IXNA 1VYRA 1IR1A 1CXHA 1ECQA 1BQGA 1FWRA 4H04A 2VJXA 1MXGA 1GOMA 4DO7A 2XIOA 4EIVA 5H6HA 1BSIA 1JDAA 3VKKA 3TN4A 4US5D 3QYQA 4CCEA 4F2BA 3GS6A 1J0IA 3PPHA 4LUJA 2J78A 3TTSA 2JEQA 3WBEA 2QCHA 2WNQA 5T9BG 3SSJA 3A5VA 4LB4A 5CJNA 1HGWA 2PFHA 3IARA 2ZCGA 3ZWTA 2V5DA 2PDIA 3TMQA 4F2TA 1S5TA 1IZCA 5DMMA 1JUBA 5DT5A 4H00A 2XDFA 3GVGA 3UT0A 4HOXA 1FCQA 1FWFC 1XX1A 3M16A 2DJLA 3O6CA 4UFIA 1DKWA 3BUVA 3MWAA 4GYJA 3LY0A 4M3PA 5TF0A 3AMCA 1PS9A 1PAMA 2FHCA 4YVXA 2YW4A 1OIMA 4X22A 3E0FA 3MP5A 5CPOA 4PE8A 1A53A 3PZ9A 2R8WA 1XF0A 1U5VA 1TMHA 2V5CA 3RUBL 2OSWA 3EB3A 2E9BA 2VO5A 3MHGA 2CESA 2P5NA 2W6RA 3GU9A 3M5VA 4YTSA 3NSNA 2UY2A 3O16A 4DO4A 3A21A 1P0BA 1VRXA 2G4FA 2OT1A 4JX5A 1KR0A 1JIBA 3EWZA 2NSOA 1KFKA 2CLKA 3H70A 5J5DA 4U10A 2A21A 3W7RA 3WD2A 5LA2A 1IXPA 4JYDA 2REQA 4PBFA 1G7UA 2A1YA 2H9AA 4F79A 2GJXA 1EOKA 1UKQA 3WL1A 4AD0A 3G22A 3SURA 3VE7A 3VAVA 2ZOXA 1MFVA 1PB0A 1XGDA 4D6IA 3ARUA 5C2CA 2V5LA 2NUWA 1PX8A 2GQ9A 1NM9A 1FWIC 1GJPA 1XI3A 1V6UA 3I4EA 3W7KA 1JF6A 1DJIA 5CSSA 2PDJA 4B91A 4QCFA 4KWUA 2PGFA 4HCLA 3N2XA 4ROPA 1VENA 2D24A 2NV9A 1H09A 2PDXA 3K2GA 2D2HA 3U7VA 1MZHA 5FEXA 2VC6A 1SVDA 4HP5A 4S3GA 1BGGA 5BRQA 1Z48A 1SMDA 3OO2A 1M03A 2VEGA 4MB1A 1Q6CA 4G7EA 1S3HA 4K68A 4ML9A 4NJHA 1MRQA 4RPQA 3EWUA 5CLWA 2GUYA 3R2GA 2CITA 4C7DA 3NYZA 1S5WA 6TAAA 5IFTA 2QCGA 3KHDA 2FPTA 5CPLA 6REQA 4QJ1A 4EX4A 1ZNNA 3D5HA 2IQTA 2CZFA 1ICQA 3C3NA 9CGTA 4O16A 3HPZA 2DT3A 1O4UA 1UWTA 3V1HA 1R2SA 1CEOA 4GGBA 4QM1A 1DQWA 4KF1A 4WDXA 4DZ5A 3WYZA 4PC8A 1V6VA 2ZUUA 4KT2A 1UWQA 3T0DA 1Q8JA 5GVJA 4JTRA 1EGMA 4A6GA 2HS8A 1A49A 3SCTA 2H3BA 3GDMA 4ZOCA 4AMCA 1E40A 3EB2A 4M0XA 1KV5A 1M1BA 1ADDA 5HK4A 3UU0A 3GDBA 3URAA 3L4VA 3WY1A 2VP8A 4MYXA 2ABAA 3S2JA 2XUCA 3FEQA 4N9BA 3SGGA 3BW4A 3NGFA 3UFYA 3M5ZA 1I2QA 3PZVA 3VZYA 4DO5A 4X63A 3SFKA 2ZTKA 4HZMA 4ADSA 1E4LA 4C6FA 1AW2A 4WCJA 4GIEA 3ZO9A 1KBKA 1BF2A 3ITTA 4XZ9A 1UR2A 1NQKA 1AZ2A 4AB4A 1VBGA 1TX0A 3D3FA 3AHZA 3R58A 3CHCA 4GWEA 2EAWA 1H1ZA 4EF8A 3TN3A 1WA3A 2WKJA 2I17A 4EPBC 1UD6A 4QAWA 3M0MA 4BA0A 3T8LA 3TCSA 3AS1A 5I0DA 4AYSA 4OTKA 4L1GA 3AU6A 4IISA 2XVLA 5CZSA 3HM7A 3SB0A 1IZJA 1LYXA 3DI1A 2FZDA 4IMDA 4WSKA 3L4UA 3LK6A 3RILA 3HIJA 3LQGA 4Q8MA 4IFKB 4GMEA 1U83A 2OKTA 2QUTA 4A8RA 4WVXA 3E12A 2WZHA 2UV8G 4PL1A 2DT1A 4QDMA 3KZSA 1T96A 2VX7A 4IGNA 3HPFA 3GHRA 3MKKA 3NQMA 4S2BA 3RF9A 3T09A 2Y7GA 1YE4A 3QLDA 2JBMA 3F4WA 3QPYA 1WXJA 3QFEA 2ZX9A 4G5DA 1UR0A 4FLRA 5EY5A 4QSHA 4AXNA 3E1F1 5MKGB 1T40A 1YRRA 2ZX8A 3ICJA 4MGGA 4P8WA 3M0VA 5A2CA 2GGHA 3MSYA 2Q3RA 3G6LA 4HTBA 2WMIA 1Q6FA 2NLIA 2PGEA 1L2QA 2Y5EA 4ZO9A 3P81A 4DQWA 4CUCA 5HWNA 2NW0A 3GNOA 3C5QA 1H7OA 3QY7A 2P53A 4H1ZA 3E3HA 1VFUA 3IVUA 1I2PA 3HN3A 4PMUA 3U3HA 3LI0A 4H83A 3MO4A 4AMAA 3WMSA 4O1CA 4CN1A 1PTDA 3GXFA 2OZ8A 3E0WA 4NX0A 4JOMA 4RNFA 8RUCA 4JQAA 3MHUA 3WL0A 2ACSA 1JNEA 1GOQA 5A8PA 1UOZA 2Y8KA 2QF8A 2E6DA 1UZDA 2QAPA 3N4AA 5KETA 1YPXA 4M56A 4A8LA 2EO7A 2I16A 3CEPA 4CLMA 4K1WA 5D02A 1WZMA 7REQA 2ZUTA 3GKFA 1KFBA 4C6PA 3MWCA 4J28A 4ZO6A 2ZC8A 2DJXA 2G3IA 4P5UA 1PBGA 3UWWA 2BY0A 3W1XA 3GTHA 1MDRA 3NQGA 2G4JA 1O1HA 3WLSA 4GK8A 1LUCA 2EJ1A 4DF0A 1DQUA 2VT0A 5I3GA 3NUKA 3QR3A 4WXYA 5EB8A 1B4KA 3MMTA 3T2PA 4WGXA 1B3WA 3EOUA 1ONRA 1TFVA 4HA4A 4Z1AA 3MZ2A 4HNOA 1V3KA 1PX4A 4OZOA 3II1A 3RR1A 1VBHA 4XKMA 4CCZA 3FXYA 4ZQPA 4JKMA 1ISVA 1OYBA 3WBWA 1A3HA 3UPBA 2A3CA 4DBDA 4IP5A 3D3AA 3GC4A 4L6HA 4HK6A 2Y70A 2PCEA 3RXZA 1CX9A 1R2TA 5A8NA 4JTTA 3E38A 2V6AA 4UFLA 1L2UA 5T8GA 1QW7A 4GO9A 1NQ6A 3GIQA 3DFTA 3FGCA 1Q6GA 2Z27A 2PE4A 3FW6A 5FOOA 4GJ1A 4BEUA 1X39A 2P3ZA 1PUDA 4IG2A 4JZ5A 1UCWA 4C1LA 4UZSA 1K70A 4AISA 3GVRA 1GTHA 3M7WA 4LEQA 3V1PA 1TJRA 3N9SA 2XH7A 4XKYA 3HU7A 1CDGA 3IVTA 1DP0A 1H41A 1VHCA 2E8ZA 1SJAA 2ISDA 5D9MA 2PGWA 4DI9A 3K5XA 4LSBA 1AH4A 3GY1A 2WM0A 2WVTA 3VX0A 1A4MA 4FAMA 1F6YA 4YPJA 4ZMGA 2WQDA 2FJKA 3GSMA 4B90A 1OFPA 2Z6IA 3VM7A 1DWGM 3QQWA 1B1YA 4KWWA 4B3LA 1CCWB 3N6JA 1PZ2A 4N4PA 1EIBA 2ZC1A 4GA8A 2C79A 3SZ8A 2YDRA 3E9AA 4N9EA 3HG4A 3KBNA 3U7BA 5HR7A 4FP1A 1BEUA 1TPWA 1QBAA 2WO5A 4IPJA 4PRTA 4UOQA 1NELA 1GOKA 2ZFAA 1DE6A 4XZHA 1QDSA 3EMCA 4JIPA 1DIKA 4KH2A 5CC7A 3EWXA 1NU5A 3VOGA 2PLJA 4ZA0A 1M7JA 4I7UA 3KLKA 2Y5SA 4F40A 1RVKA 4J3ZA 3VGFA 3LSCA 4F4RA 3ENLA 3VINA 4NX5A 2OTDA 4L4OA 2ZXQA 3MYPA 4Y90A 1LG2A 4DM2A 1F3WA 4PUMA 2DVTA 1NFGA 2NLYA 1ONWA 5KINA 1V6TA 1TV4A 3BLFA 5BXPA 1ICPA 5A8GA 1J0JA 3EXSA 3M0LA 1E15A 4LJ3A 3S5OA 3EAUA 2NVCA 3MCNA 1P43A 1I8JA 2VFHA 2DSUA 4JXCA 4AWEA 1FY6A 1XDJA 3ATZA 3OLGA 2FYMA 1XIHA 1R9XA 1BWKA 3M0HA 3NQ8A 4LUIA 3SN1A 4YVVA 4QSFA 1B9ZA 1NWTA 1O5XA 4XUGA 3S5ZA 1TPH1 1ZZMA 3UWZA 3A13A 1VCGA 4H6KA 3ITLA 4JYEA 5MHBA 3I3DA 3E0IA 2G96A 3QV7A 4KWVA 4MWAC 3W9ZA 3MV11 2DPEA 4NXSA 1VP5A 3C0JA 4FPSA 5I78A 1VCVA 3RN6A 3G77A 3MSDA 2B7NA 2YKKA 4B4HA 2ASHA 2D0GA 2CERA 3W7DA 4IJRA 1TV8A 1JD7A 1XUZA 2ZQ0A 1E43A 2R82A 3W75A 1MEIA 4MPQA 1HJUA 1HL9A 2Z1SA 4JNMA 1E73M 3WLPA 4AC7C 1OT2A 1REQA 4GQQA 1X6LA 2BBFA 3B4YA 4RZ6A 3NFUA 5FJTA 1KBIA 5G2HA 4OUEA 1Y5VA 2DW6A 2PP3A 2YZ5A 5FJRA 1WDPA 4UXDA 5BXTA 4LW7A 4WY0B 2Y61A 2D3NA 1OADA 2QCMA 3WQ4A 4XZBA 3CAQA 3CV2A 3POCA 1GQKA 1PDZA 1OINA 5LZLA 1HVQA 1VEMA 3W7PA 3TMLA 3I6RA 2PRMA 2WQPA 4GCAA 3WQDA 4MJZA 3F5KA 4GJJA 2H90A 1DJGA 4H6QA 3WLHA 1TE1A 1V03A 3WJSA 3XIMA 4GC3A 3IS4A 4YYCA 2W62A 3CHFA 4O15A 1W5PA 1J4EA 1XLCA 5D2YA 4YJ5A 5JUVA 1O66A 4MB4A 1XSIA 1TMLA 4MHBA 4R33A 4XVDA 1BRLB 4P7RA 3C2OA 1A4LA 4JEQA 1SZRA 4AD3A 1A5UA 1FWEC 1XCXA 4UQBA 3L21A 5KEZA 5DMNA 4O1AA 5HANA 1GEQA 1F3XA 4BK9A 3DU0A 1X6UA 5E09A 2NQLA 2DIJA 2OODA 4A4AA 2GSEA 3DYPA 3AWOA 3ES8A 3BXWA 4Z2IA 3NXLA 1HO4A 1XC6A 4UTWC 2BXZA 1ZCOA 4Z1DA 4BJHA 1HKMA 1W1ZA 3MCMA 4JGDA 2RDXA 5K7JA 3T44A 1JRBA 5IDIA 3AXIA 5DCEA 3LCWA 2WM1A 3TLLA 3SCNA 1KNWA 2ALDA 4KW2A 4CQDA 3H21A 3TYBA 4E4UA 1E70M 1FWAC 4QROA 1YNYA 5JIPA 2RJHA 3VGBA 2YL5A 2ZE3A 4WSHA 1GOXA 3K1GA 1BYAA 4ZE4A 2YLAA 3KEHA 4NYYA 1F2JA 3T9PA 1W5NA 4ZTYA 1EA9C 3LCHA 4MDOA 1RBAA 3KX6A 5HPOA 1FFRA 2WC7A 1EJUC 4MWAA 4BF9A 2ATMA 1FH9A 1OJXA 5D9PA 3H54A 4HYVA 1MWOA 4AC1X 3FK4A 2D23A 4FA3A 1RY8A 1VJIA 3EB4A 4B9YA 4Q22A 3QMSA 4KFOA 3GBDA 2Z1VA 1F74A 2P0OA 4WXZA 4IQDA 3NGJA 4AY7A 1E72M 4MDPA 1DJHA 1TTIA 3R6IA 1ME9A 5HA7A 4EVZA 3PBVA 3QF0A 4ONVA 4MAZA 1KM4A 1OT1A 1OYCA 3PAJA 3S1UA 1Y0EA 1VYSX 2GQ3A 3BH4A 5LYRA 3UYIA 4JIHA 3AI0A 3W87A 1UA7A 7A3HA 1Z32X 3GX9A 1IHIA 1UKTA 3VUPA 5TIMA 3UA4A 1BLIA 1O5KA 3GKAA 3S2LA 1P5BA 1LOQA 2C16A 3MJYA 1GKRA 4HNUA 1VFOA 5EL1A 4W8BA 4KIEA 3VUSA 1R3WA 2DZAA 2SFPA 4LC6A 4ZTXA 4HU0A 1ZTVA 2J7CA 1K9FA 1OCJA 3GC2A 1RK6A 2G3NA 1E9LA 1TQXA 2D22A 1W5QA 1XFCA 4B2DA 3TYZA 4H7CA 3UZZA 4C1KA 4ICNA 5FJIA 3S46A 4DJFA 3U6WA 1G4TA 1VLIA 1W3LA 3P62A 1OG0A 2VGIA 1J2WA 1H49A 2WSRA 2ZRVA 5KITA 2FB2A 1ZS2A 3DUGA 1NTHA 3VZZA 5FD0A 1V6YA 4DB7A 1A5NC 3PWIA 1EL3A 3NSXA 5A6TC 3UWEA 1N2VA 4TTGA 4EXBA 3T78A 3GDRA 1JPKA 1R5YA 4EPEC 4ACYA 2PTWA 2C7FA 2VX4A 4ZB2A 3OBKA 4ZO8A 4B3KA 1PKNA 3PTQA 3R43A 4H3DA 3H23A 3L65A 4K3ZA 4HPXA 3KXQA 4UTWA 1J0YA 2OGJA 5EGRA 5DMYA 3KTCA 4PGLA 1E71M 3AICA 4KESA 1XBXA 3C2EA 1Z89A 4EK7A 4TV6A 2WMFA 1B2YA 5FEZA 4D8LA 2FLIA 4JKKA 4H9UA 1ITXA 3IVSA 2XVKA 1KA9F 3WLNA 3S6TA 1G67A 1LF1A 5FJPA 1XD0A 4HTYA 2G3FA 4QEEA 2W5FA 4AIBA 2ZVIA 3F4DA 3HJZA 3WJYA 3MVIA 4US6A 3UG5A 1IEWA 5CSRA 1QNRA 3AHYA 3L4ZA 2XISA 1OD8A 2ZADA 2D2JA 1LWJA 4LBSA 3VFLA 4AW7A 3M43A 4GYFA 3P0WA 3ALGA 1UW9A 1UWUA 1WKFA 1OABA 4LUSB 5JU6A 3MCOA 4LX4A 3WFAA 3PG8A 2PDKA 3QEZA 5HWMA 3M9YA 1EUAA 5C7HA 3MMUA 5AHLA 1LOSA 1TWDA 2OU4A 4F9JA 3XINA 3ZVHB 4IJCA 3NO1A 4X3ZA 3UESA 2ONEA 3R94A 2J4GA 2QGHA 3PBUA 3C52A 2QIWA 1M6JA 3P82A 1FDZA 4CN4A 3K46A 2QAFA 3ZFHA 4NP7A 1CXKA 1M9HA 3CXOA 1B3YA 1XBYA 3N34A 4FK9A 3WK0A 1E4IA 5MF5A 3EX4A 4M5PA 3TJ4A 4RW3A 1FX6A 4HK5A 4TTUA 3V7PA 1AMYA 2E6YA 4CU8A 2OJPA 3STGA 4O28A 4JN8A 1CNVA 4MG4A 3RU6A 1T8XA 3P60A 4B3ZA 2OPJA 1HIZA 3VX1A 3OOQA 1E6NA 4V1YA 4LGXA 3B8TA 3FS2A 2BODX 1S1RA 3VMNA 4AZIA 1V4YA 4U3CA 2A3BA 1WV2A 1BVWA 1E1FA 1KBBA 1V7YA 4HSHA 2AAAA 3WUBA 1ZUAX 3IUIA 4XAPA 3LDVA 1PCKA 4MZ1A 4LVAA 4IMEA 4PCNA 3KFTA 5BZAA 3LYEA 1XDMA 2VR4A 3VOJA 4C6IA 3NA8A 1FOBA 4JX4A 2CNCA 1EJVC 5ABHA 5E5CA 4AU0A 1BAGA 1ADOA 1NAL1 3GK0A 1XLDA 3G0UA 3W7IA 2XVNA 1IGSA 5C70A 3LCIA 1BKHA 3CL7A 3LRMA 4H6RA 1L8PA 1TR1A 1MQPA 2J74A 4YU1A 4BFAA 4E3TA 2GYIA 1TPDA 5CSYA 5BWFA 4NRSA 3QYSA 1DQXA 1CECA 3JW7A 1TJPA 3G2GA 4MY1A 3BOFA 2IQDA 3DHDA 5EMKA 1WO2A 3WDPP 5DRCA 1SO4A 1J5SA 2CPUA 3I6TA 4DM1A 2J77A 3H24A 2F8QA 4TQTA 1JXKA 5CZ0A 5CSUA 1PIIA 3VU2A 3VOFA 3FA5A 4DI8A 3AIVA 3QPZA 7ODCA 4KERA 7TAAA 3S47A 2PWHA 3LD5A 4JNYA 4A3RA 2J8FA 2JKPA 3ITVA 4O0KA 1TV7A 4JHZA 1US2A 3ZLHA 1OFDA 4MSSA 4JPGA 1W9UA 1ZJHA 1Z6KA 3P61A 4IHCA 4YTQA 4IMAA 3LHZA 3EOLA 1DTUA 2IPGA 5HOSA 3W07A 4Z0JA 3EWCA 4HVXA 2VKZG 4LU0A 1SZEA 5DBUA 2I56A 2OG9A 3VIGA 3N17A 3AMKA 3NL6A 4J3TA 1MFUA 1KM6A 3STPA 3A5FA 3V0UA 1WDSA 2PBOA 1RJPA 3LQLA 1X98A 4A8IA 1AJ2A 4IP7A 1LT8A 3P7YA 3TROA 1BD0A 3SSZA 3TDFA 1UUMA 3SRFA 2Z1KA 3WLLA 1VQTA 4MNJA 4C90A 4MWAE 1MEWA 3KRBA 1IV8A 4ECLA 2XIQA 2ZE0A 4Y9MA 5LKYA 4S3JA 1XM3A 4BKNA 5KMYA 1E1CA 2GUBA 3VFCA 1V3IA 1ZAHA 4O8AA 3WLJA 4FNRA 3DAQA 2BVYA 4WJ8A 1OD0A 1BWLA 3CHDA 4MKSA 3M0KA 1O5QA 1I4NA 3URBA 4ZQNA 3OA5A 1NJJA 1V0NA 4LCRA 3N1AA 3WNKA 3C61A 4J1OA 5A3HA 1JUEA 3PBYA 1EC9A 2C71A 1BHGA 2C3ZA 1KR1A 4W8AA 2GVLA 1RJQA 4ZXLA 2V30A 2PUZA 1UR1A 3TOYA 2X42A 3KTSA 4PB3A 1F6PA 1HKVA 3KDNA 4UNIA 3DFHA 1OGBA 2AMXA 2OYLA 2CZVA 1S2UA 3KWSA 2CLLA 3LI1A 3ZVIA 3CHVA 3SAZA 4KETA 3PC0A 1EQCA 1W91A 3ZJ7A 4DXXA 1X7IA 4H9VA 3NDZA 3THDA 5BU6A 2GZXA 1YDNA 4Y9OA 1Q65A 3GW0A 1MZRA 2NXGA 1EF3A 2BLEA 1GVEA 3V35A 3WF0A 4GOAA 2DH3A 1H1NA 3CZLA 1IIGA 2AL2A 4ZGYA 2DZVA 3U2ZA 1KFLA 4GINA 1CW2A 4XSMA 1FVPA 1NOFA 3ARZA 2FDSA 4XG1A 2R1NA 1FHDA 4MB5A 1H11A 3CK5A 3VCCA 3EBVA 2FZ8A 3ORWA 3GZAA 5CBIA 4M1RA 3AXHA 1LQ0A 2AMGA 1L9WA 3DECA 1XRVA 2FGZA 3HPXA 3N13A 3S6DA 7PTDA 1ZFJA 3FSUA 1FCUA 1QNPA 3VI2A 1Z9AA 2JKEA 4X9YA 4A21A 2PPGA 5TD4A 2HVOA 2WAGA 4GNVA 3GU1A 2P8BA 1GCYA 3B0VC 2A3HA 4E2DA 4WLCA 4O18A 1B4EA 2PF8A 2QJJA 3LHUA 2E5DA 3DFSA 1TUXA 1ODZA 2YB1A 3W26A 3CEUA 4P2VA 3SRKA 4JKLA 3CGTA 1IXQA 3BTNA 1X7FA 1OFRA 4Z17A 1Y65A 2A6NA 2WHKA 5EFDA 2NV2A 1H3GA 4ZR8A 1K6WA 3WQ5A 5FACA 3MT1A 3CWHA 1GVYA 5T26A 4GH1A 2CYGA 4OKDA 1WBHA 3OZPA 1ZQ5A 3A3HA 4GIRA 4ZXOA 1LBFA 3KVMA 3AS0A 3BLIA 2Z1WA 3VPLA 1YW1A 1E4NA 1MNSA 4D6CA 2HRWA 2WVVB 3IGUA 2WMHA 1NWRA 1V3MA 5DLCA 5F2GA 2QDGA 2IXUA 1R7OA 4ES4A 2YBUA 5H8PA 3CC1A 4HMEA 1RXOB 1RVGA 4MNLA 3OJGA 3MDWA 3UVAA 1V02A 3A9BA 3WF1A 2ZBTA 1Q4WA 5A6BD 4ZOAA 4DNHA 3A3XA 3B06A 2CHOA 1DPMA 5CQ1A 3NCOA 4S3CA 1U33A 1YNQA 4Z2KA 3W38A 3W85A 5A94A 4RK8A 4XSLA 2OEJA 3Q65A 4E4PA 1WZKA 3PZUA 1G1YA 2JK2A 4TMBA 2GJRA 4O1EA 2P0IA 2QCNA 5JH2A 3WEMA 2BFGA 3OVRA 1V0MA 3OLDA 3L7RA 1GUVA 3WDJA 3DZ1A 3ERPA 3GHUA 1UP2A 4PODA 3T6CA 2YBTA 4L9XA 4PEEA 3GW3A 4HIBA 1SYTA 4MLRA 4F0HA 3TTEA 5KZ6A 1NOUA 3GYCA 3SN0A 1TJ2A 2VCCA 2GJLA 4PFMA 2O92A 3LU2A 3CIVA 2GOUA 5FF7A 3FDGA 3Q67A 1SW3A 1JRCA 4DBUA 1TWIA 3WLIA 4HN8A 1CBGA 2GK1A 3BMXA 2VQUA 4HNNA 3WF4A 3W86A 1V5XA 3JU2A 3L2MA 1TVLA 2EEXA 3AJXA 1UG6A 3H6OA 2CKSA 4ZODA 1NH6A 3L4TA 2DEPA 4NNBA 2NQ5A 3WN6A 3NQBA 4EPDC 3LTSA 1XLKA 3P84A