1YNQA

Aldo-keto reductase akr11c1 from bacillus halodurans (holo form)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
298
structure length
288
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords oxidoreductase
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
total genus 102
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynqA01
2FVLA 3ERPA 1SM9A 4XVDA 4H8NA 2ACUA 3G5EA 4JTQA 2ACSA 3EAUA 5AZ1A 5LIWX 2P5NA 3R94A 5JH1A 1JEZA 4G5DA 4GA8A 3LD5A 4Q7BA 4XZLX 2WZTA 5C7HA 2NVDA 1Z9AA 4L1XA 2DUXA 2FZ9A 2IPJA 4GIEA 1LWIA 3RX3A 2IPWA 4PMJA 3D3FA 2C91A 1HW6A 4JQ4A 3VXGA 3LNMA 2ACQA 4XK2A 1PWLA 3CV6A 2CLPA 2PD5A 4YS1A 4JTRA 1X96A 2ACRA 4YVPA 3UZWA 4F40A 2HDJA 3BCJA 2FZBA 5HNTA 3P2VA 3MB9A 2FZ8A 4DZ5A 4WEVX 4GCAA 1S1PA 2IKHA 1PYFA 1VBJA 1MI3A 1OG6A 2R24A 4JQ3A 5LIXX 3C3UA 3M4HA 2ALRA 4PR4A 1YNPA 2FGBA 3LBOA 5KETA 2PDJA 1Z89A 3GHTA 4JTAA 1S2AA 3LN3A 2PDCA 3Q65A 4HMNA 4QX4A 4DBWA 3R58A 1PZ1A 1A80A 4AUBA 3GHSA 3CAVA 2PDHA 1Q5MA 1AZ1A 3T42A 1RY8A 1C9WA 3LZ3A 3N6QA 4JQAA 1Q13A 4XO6A 4XO7A 4JQ1A 3QKZA 1Z3NA 1T41A 3H7UA 4Q3MA 4WRHA 1IEIA 3LZ5A 3COTA 4RPQA 1X98A 3RX2A 1S2CA 2BGQA 4I5XA 2PDKA 3LQLA 2PDGA 4QR6A 5DANA 2PEVA 2INZA 4LBSA 2HVNA 2PF8A 1AZ2A 1EKOA 4EXBA 4DBUA 4JIHA 1YE6A 3UYIA 5LIUX 1ZGDA 1FRBA 4QXIA 5JH2A 4YU1A 4FALA 2HV5A 2I17A 4XZNX 1AH4A 1M9HA 2PDYA 3M0IA 2DUZA 3U2CA 3R7MA 4XZHA 4FZIA 1X97A 4QBXA 2PDNA 3UFYA 1VP5A 5LIKX 2F38A 3RX4A 1HQTA 4GACA 3EB3A 3N2TA 4OTKA 2HVOA 2F2KA 3NTYA 4GQGA 2BP1A 2PDFA 4WDWA 2PDWA 3LENA 3CAQA 3LUTA 1EL3A 2QXWA 4WDXA 2HE5A 1RY0A 4H7CA 1AH0A 3EB4A 3O3RA 2PZNA 1XJBA 1GVEA 1R38A 4JIIX 4PUWA 3ONCA 2PDBA 1YE4A 2ISFA 1MRQA 4ASTA 4IGSA 4PRRA 4GQ0A 3UWEA 1AH3A 4L1WA 1EF3A 3CASA 2BGSA 4XZIA 4IJCA 3V0UA 2PDMA 2FZDA 4PUUA 3BV7A 4YVVA 1XF0A 4EXAA 3UG8A 2DV0A 3ONBA 3WBWA 3GHRA 2IQ0A 5HA7A 3CMFA 4HBKA 2IKIA 3BURA 3Q67A 3UZYA 2IPFA 3M64A 2WZMA 3R8GA 3FJNA 4JTCA 1MZRA 1ZUAX 2R9RA 3LQGA 1UR3M 4PRTA 4JTDA 3O0KA 3GHUA 4IJRA 2IQDA 1QWKA 4ZFCA 4LAZA 4FAMA 2PDXA 3WBYA 1RALA 2PFHA 4MHBA 2HE8A 4YVXA 4JQ2A 1Z8AA 2IS7A 3LEPA 3WCZA 3UP8A 2HEJA 2PD9A 4WDTA 3UZXA 2NVCA 3F7JA 1QRQA 3R6IA 1ZSXA 1S1RA 2VDGA 4LBRA 5AZ0A 4FA3A 3MC5A 5M2FX 3S3GA 3R8HA 5LIYX 2J8TA 2IPGA 1XGDA 3V0SA 3V0TA 4WGHA 3FX4A 1YNQA 4GABA 3H7RA 3GUGA 4DBSA 3CV7A 2I16A 3V35A 4JIRA 4LAUA 1IHIA 2A79A 4LB4A 4WDUA 3BUVA 4R9OA 3UGRA 2IKJA 1US0A 3UZZA 4LB3A 3DOPA 2IKGA 1PZ0A 5HNUA 1J96A 1PWMA 1EXBA 1ADSA 3V36A 4XAPA 2PDLA 3H4GA 1ZQ5A 1T40A 3WBXA 1AFSA 3KRBA 3B3DA 3DN5A 2PDIA 2AGTA 3G1RA 4XVEA 3WG6A 4ICCX 1LQAA 1K8CA 2INEA 3R43A 4XZMX 4NKCA 2PDPA 2PDUA 2PDQA
chains in the Genus database with same CATH superfamily
3R8RA 2GVGA 3AIUA 2R6OA 3W1PA 4C90A 2YJQA 4Z1BA 1VRDA 4LBUA 3LPOA 4WIWA 3TC3A 1YDYA 3THUA 4H3DA 3TR2A 3DGBA 2V82A 3V5CA 5F4WA 1DJHA 3LD5A 3AMGA 5DMNA 2BVTA 4OHQA 2NVDA 5D05A 2ZZ1A 2FZ9A 1RA0A 1K03A 3E3HA 2ZZ2A 4RW3A 1JZ4A 3FLUA 3AMDA 4D71A 1H0GA 1AW5A 3LNMA 2PLMA 3EOLA 3WQCA 3R11A 4D6DA 4PTMA 2BXVA 3RR1A 4Q8TA 3A4AA 4HZ6A 3BAXA 1OT2A 1CXIA 3ITTA 4JTRA 3L2IA 4S3CA 2E1DA 5HNTA 1G69A 1H5VA 1NWUA 3VMNA 4GXPA 4DUXA 3BLIA 1YPXA 4HZMA 1S1PA 4IIHA 3UJEA 3NSNA 2QLYA 3FVDA 1OG6A 2VX4A 1F4HA 4YYCA 1TR1A 3C3UA 3HURA 1DJGA 2ZUVA 3S1XA 1XLHA 4PR4A 3LTSA 4W85A 5K4ZA 2VO5A 3C8FA 2WBKA 2ALDA 3ABSA 3WK2A 1NIUA 4R7WA 4UNLA 1FBAA 3S47A 1O1HA 4P7QA 4AIBA 3B9DA 1B9BA 4EK7A 1RJQA 3KP1A 3SCRA 5LZLA 3H4XA 4WLCA 3LG3A 5B7YA 1LOSA 1V08A 3RR4A 4HYVA 3IV8A 1LF1A 3URQA 2OWXA 4XO6A 5HBFA 3TA6A 4MSSA 1DQXA 1GVFA 4NX5A 1T41A 4GKTA 1FWRA 1OFRA 1TMQA 2X41A 3T6CA 3M5VA 2A3BA 2L5HA 2DEPA 3A23A 5CJMA 2PDGA 1CXHA 2FHBA 1KRMA 4N42A 4D6CA 5FF4A 1FXQA 1VBHA 1ITCA 1K7XA 4FX6M 3A12A 2WMJA 1CGTA 1GGOA 3N19B 1XYZA 2BFGA 1KM4A 4A8RA 2YIHA 2F9RA 3QPZA 1SUXA 2V2HA 2WW5A 2WVTA 2YZRA 4ZR8A 4QXIA 1FP9A 1XDMA 2OYKA 1QW7A 1R0MA 6A3HA 1GZ1A 2BG5A 4CCCA 4EOUA 1M7OA 3RO6A 3S6TA 4GGHA 3ARSA 1DJIA 4GK8A 1GORA 1POJA 5A6BD 4ERAA 3DHPA 1E4IA 4QBXA 1EP3A 3NZ1A 1KLYA 4LUSB 1PTDA 4M7TA 5BZAA 2DY3A 1OK6A 3B8SA 2Y5JA 4X0VA 4TTUA 2VD8A 4MJZA 5I3GA 5CZSA 2VZOA 3OLGA 3RCYA 3PF3A 3VKAA 3AHZA 3I6RA 2OODA 2QDHA 5G5IA 4WDWA 1JDDA 1R3QA 1UR8A 3KBJA 2XWDA 1TSIA 4IPNB 1R30A 5D2WA 3BSMA 2ZRZA 3EB4A 4RCXA 3KS5A 4CQAA 4NILA 2J7CA 3P0WA 4PUWA 2GJPA 3QH2A 1XYCA 5FEPA 4H8UA 4J3WA 1LG1A 4F48A 4LTSA 1YE4A 1TVLA 1IEXA 3JRKA 1T0OA 5HUPA 2G5WA 3N4AA 4NI8A 1V7AA 5H8PA 2ZZ3A 3WFAA 2QGYA 2V30A 5U4NA 1NFPA 4AZCB 3M0JA 1ZZMA 4O8RA 4ZSTA 5F2GA 3B0PA 1UWUA 3VM5A 3LDVA 4PUUA 1EJTC 1UP3A 2BDQA 3VIMA 4K1GA 5BXRA 4ZO6A 4JR5A 2Y88A 4I7VA 3M0VA 4DWSB 5A8MA 1OC6A 5CKSA 4X3ZA 1EC8A 2B4GA 1BVNP 4CQCA 3PUEA 1JDCA 2PC8A 3ZSTA 3BGAA 4B91A 2CLFA 3HA1A 4JKKA 4I9JA 5FF2A 1V0MA 2V2CA 4LF2A 4UZUA 3B8UA 4R3UA 1VJZA 5EFFA 3GXFA 5I3JA 1ITQA 1GT8A 4V2XA 1XBVA 2QJNA 1QW8A 1CXFA 4JHMA 5C54A 3U4FA 1EJSC 3G2GA 1XIFA 3S5SA 4XX6A 1XIGA 2HE8A 4RDYA 1FCVA 5AHNA 3V3WA 3RRXA 4WZHA 3WBAA 4FXJA 3PBVA 1XG4A 1OFDA 1SZFA 3GVQA 3PJXA 1R3WA 1H7OA 1UD6A 3B9NA 4H9UA 5TIMA 1MDRA 4H6RA 4GLEA 5FJRA 3SUSA 4M82A 4HTYA 2ASHA 3S3GA 1TIMA 4UFHA 1SZGA 3E0FA 3MSYA 1A5SA 1RVGA 4HK5A 1KRBC 4DNMA 2PS2A 3EOSA 5A69A 2V63A 4H6KA 2BOGX 3F5KA 3JZUA 1TQJA 2W79A 4NNCA 4O11A 3SI9A 1UPPA 3I6EA 4KEVA 1TELA 4FEZA 5I3KA 2PA6A 2C15A 1TPB1 2FB3A 1OG0A 1MZHA 2DZVA 2WNWA 1DEDA 3WH5A 3EX6A 2PGWA 1XYLA 5IBXA 3NOYA 1WV2A 4HNCA 3MYPA 5DT5A 2VDHA 1P7TA 2VEGA 2E8YA 3L23A 2O7QA 4FR6A 3HPFA 4ZODA 2AL2B 1Y5WA 2VVNA 1EP2A 5AOUA 2Y7GA 4QLJA 5HWJA 1D3CA 2GJXA 2NX3A 3G3MA 1PTGA 3YPIA 3LX9A 3BOLA 3GU9A 4UIOA 1E0WA 3MWAA 5J5DA 3S1UA 4ACZA 2ZDRA 3LB0A 3AISA 5EMMA 1YPFA 3GW3A 4XZMX 4W5ZA 2QPUA 3OZYA 1ISZA 4UOQA 2G4FA 4JN7A 3HMCA 1IXNA 4NSBA 3NVDA 2A3CA 4K3ZA 3I65A 4HHHA 1H7WA 4PUKA 3M5YA 3W7JA 4H9XA 5LIWX 5BCAA 1U1UA 1DHKA 1KD0A 1ZNNA 1JEZA 1TJRA 4ECLA 1Q2SA 5C7HA 2IXVA 3LTYA 2FTYA 3ATYA 2IUZA 4H9ZA 1LWIA 5BROA 4IJBA 1ZBVA 3SQSA 1QU4A 2H8ZA 4ICNA 3WLPA 2O9OA 3B4UA 1WOBA 1IXOA 3RLGA 3G22A 1E73M 4O0KA 3VUSA 2E9BA 3RG6A 3TW6A 2OPJA 3LGEA 4Z2HA 4O53A 3QFEA 2I9EA 3SFKA 2VL4A 5FOOA 3F4CA 3PN8A 4PL2A 1XKJA 1JCTA 2YKKA 1A3WA 3MP5A 1RCOB 2OWCA 3EXTA 3QPEA 4GUHA 1X1NA 2C0HA 4UNKA 4JQ3A 3WLMA 1JPIA 4HOWA 4MB3A 1FH8A 1YNPA 5HK4A 3NCOA 2DQWA 2VWSA 4O1BA 3PY2A 2Z7KA 1JI1A 3AC0A 3ZQ9A 4D8ZA 3STPA 4YCOA 3HV9A 5A5WA 3Q65A 4ROQA 4J28A 2WSPA 2C3ZA 1GVIA 2I56A 4QCFA 4TR9A 2X42A 3MO4A 3PZNA 3P80A 5CJ5A 2Q3RA 5CLTA 3CC1A 4DJDC 1W5QA 5KZDA 2WJZA 1YXDA 3APGA 4W87A 1SMDA 1BYDA 2WZIA 3TZNA 3U7VA 3PVFA 2WCAA 1TKKA 3FGCA 4BF9A 1I1WA 4MLJA 3RX2A 5IXEA 4IIBA 2BGQA 3CQ0A 2Y24A 3MMTA 2TYSA 5DANA 4CCDA 5FI8A 2XH2A 2HVNA 1V51A 4FI4A 5AECA 1ZRQA 1Z41A 3AZRA 5I3IA 3C2EA 2GQ8A 4BWLC 6REQB 1K4HA 5CJNA 3S1WA 1K7FA 4U2ZA 1D7FA 4JEQA 1NY1A 4F0HA 4MWAB 1NDYA 3B9OA 8RUCA 4WOQA 4LVBA 4O1AA 4FALA 5C9UA 3TNOA 4F79A 3CUGA 4E8CA 3ZOAA 4DJFD 3PHAA 4FF5A 2B7PA 4GYPC 4WF7A 5A2AA 1XIJA 2NWSA 9XIAA 1OX5A 3L4VA 1E1EA 4NP7A 1ZALA 3QKEA 1YDOA 2REQB 2OLHA 4W88A 3FAXA 5HJLA 2BVDA 1KWGA 1VIZA 1I2NA 2BNJA 2EPKX 1K02A 4HSNA 1A4LA 2A7RA 3HQ1A 1LP6A 3RLUA 4E2DA 1AQ0A 4GC4A 2H3DA 2FHCA 1JDFA 3NQ8A 3VIPA 2BOFX 3PZQA 1Z32X 2VFEA 3TUUA 3AMCA 1M5WA 3O63A 3K8KA 1EBHA 3N04A 4PYSA 5CH9A 4N02A 4RE3A 4ZOEA 1LL6A 5C9XA 4YLWA 4HN4A 1E55A 3UJ2A 3SY1A 1ONEA 3SSJA 3AS3A 4P8XA 2XHYA 2D2JA 2ZE0A 4GQ0A 1AH3A 1JF5A 1XL9A 2JKEA 3O9NA 5AHMA 4UOZA 3W85A 3ALGA 2PDMA 1TV8A 3IIPA 1U30A 2FZDA 2EPOA 3CPUA 3IGSA 5JXQA 4HQVA 1IXQA 3LNPA 1XLGA 3W7MA 1F6KA 4ZE4A 3A4WA 1HGWA 1UD5A 5GNZA 2Q8LA 1XIHA 4QNEA 4JYEA 2WHJA 1MZRA 4UMBA 4IGHA 3W84A 1FX6A 3CHVA 4JTIA 4JTDA 1ML1A 2QDDA 1W8GA 3GB6A 4WVXA 1MYRA 5CPMA 1Y5VA 4FAMA 1EF2A 1IR2A 1XRSA 2WM1A 3IGHX 2GVJA 3VGDA 2Z2AA 1QPQA 2C18A 1L0PA 5DO8A 4Q7IA 1Y8BA 1OFQA 3TJIA 4N4QA 1KGXA 3NDZA 3HFYA 5KMYA 2XIMA 1NDWA 3PUDA 1M41A 1W8SA 1RXOB 3VDGA 5DELA 1C9DA 3BAKA 4LCQA 2E6YA 4GJIA 1H5YA 2VWTA 3BV4A 4LNCA 2YXXA 4NVTA 2XISA 4K8HA 4IP7A 3O1NA 2O92A 3TP4A 4GZIA 3CH0A 2ZIDA 3IRDA 1C91A 3WLIA 1SVDA 2BLEA 4PBFA 1TYGA 1RLDA 3BW3A 3KOXA 1R8LA 2BZNA 3B03A 3C8NA 1LL4A 1EYEA 2HK0A 1WNOA 1QMLA 3GUGA 4YMZA 4TV5A 2HBVA 2BB0A 2A79A 3RPMA 1TR9A 5I79A 1ITXA 1Q2RA 1KFLA 3PAOA 1P6WA 7A3HA 4IPIA 2CWXA 3II1A 1Q7QA 1EOKA 2ZX6A 5D30A 1VIWA 3THQA 5T9BG 3WIJA 4YYFA 2PBOA 4NHVA 5C9ZA 1JFXA 3R13A 4J3ZA 4AIOA 4DB7A 2HS8A 2WSRA 2J77A 1UUOA 2Z6IA 1J2WA 2NWRA 4ADTA 3GWQA 3NQ6A 4G8TA 1FWJC 1SR9A 2C79A 2XPKA 4F8XA 1EJ7L 3CUJA 3ERPA 2HVMA 3SN1A 1HKKA 3MDUA 4G9PA 1EDTA 4LS0A 3CV1A 4TQTA 4ZB0A 3H12A 5AFDA 4C5YA 5H1WA 3WY1A 3EPOA 1LRTA 2VC6A 2YFOA 5FL0A 3EBVA 2YW3A 1CT5A 2ON3A 3FJ6A 1VEPA 5F2MA 3QBUA 4JOMA 5AYYA 4JQ4A 1NELA 3CZEA 2WNZA 4ZQNA 4RZ6A 1CIUA 3G0XA 3DU0A 2OELA 3RK8A 1IXPA 1S5MA 3CL7A 3KWSA 3KTXA 3S2MA 2HDJA 4K7YA 4MUZA 3VNDA 5LSMA 3S4TA 4C6KA 1JQXA 2FZ8A 1CXLA 3QW3A 3W27A 2C6QA 3TN3A 1JNEA 1VBJA 4HK7A 1U1HA 4OUIA 4BF5A 1LBMA 1CI1A 5G4EA 5BRQA 2WMGA 1E5JA 3V1PA 3IIOA 3PULA 2ALRA 3HFTA 1JR1A 3OJGA 6TIMA 5KETA 4GIAA 5K7JA 1MQPA 4Q33A 1XBZA 3VAVA 4FNRA 3GC4A 3L12A 2NVAA 2OKTA 2OU4A 4TXEA 4PMXA 6XIMA 1EX5A 4UQEA 1AZ1A 3B97A 3LHZA 5I00A 2DIKA 1UHVA 2GOKA 3IEBA 4LUTA 1E72M 5E9AA 1A53A 1V6YA 1AJZA 5DT7A 4AWTA 4G2DA 2JF7A 1UP0A 3QKZA 1B31A 4I8DA 4A21A 4HYRA 4WRHA 1FH9A 1J6OA 4O52A 3R5EA 1CGYA 4UFIA 1PZ3A 2FLIA 4QR6A 3NXLA 3QF0A 3UR8A 1AZ2A 3XINA 1W9DM 2NUYA 4C1NA 1R2SA 1AQHA 2EG8A 2Y8UA 1OC5A 4V27A 3ZYZA 4MYAA 3MYOA 5JBFA 1M04A 2GVYA 3GXMA 3GM8A 2CLOA 3RM9A 3WLTA 4PCPA 3H2EA 3QTGA 4K39A 3QSTA 4EVZA 4U5IA 2Z1XA 2XJ7A 3MSDA 1CLVA 3W1UA 3WELA 3UFYA 2AMGA 4ZOCA 4DUWA 3UWUA 3AJXA 1ONXA 2DZBA 3RX4A 4AIUA 3AHXA 4JYDA 3N2TA 1JPHA 1XICA 3T0TA 3UERA 2O9PA 3TU9A 3VCNA 1CDGA 3TFXA 2QT3A 3KW3A 4AU0A 3GK0A 4O28A 4O16A 4NASA 1HKIA 1CBGA 5JUVA 3IVTA 4LSBA 1GPWA 4LCSA 5A8GA 2P0OA 2QXWA 4BA0A 4FNQA 3PANA 4L6DA 1RY0A 3V16A 4PEKA 3WD0A 5A8QA 4O4WA 4MOZA 5M5DA 3CO4A 4HHPA 4MB1A 4QG6A 3FKKA 2WVSA 3HF3A 3D47A 1RK6A 3UXIA 1AW2A 4LGXA 5GPRA 4ZZ9A 1Z69A 2VCBA 1LOQA 2CXEA 1K70A 2ISFA 1E3ZA 3N2OA 1XYFA 4GBUA 3H2MA 4L1WA 2TMDA 3U6WA 4QSHA 5BYWA 4R27A 1K1DA 2AQVA 3M0KA 5KZMA 1TE1A 4PCFA 4B9ZA 1TUFA 2EEXA 3A9IA 4N9DA 3G8RA 4AZIA 3BMVA 4A2RA 1H11A 4DWDA 2VFHA 2G3NA 3E0LA 3W83A 4GY1A 3GDMA 1JCNA 4J2PA 5K2ZA 3OIHA 3W53A 3FIGA 1WKFA 4CD5A 2UY4A 4GVGA 3DEQA 1W1B1 1IZKA 1EDQA 3RUBL 1E71M 2HPIA 3QR0A 1ZUAX 4PB5A 3UVAA 1EJUC 4I9MA 5FAJA 3SUWA 1N82A 2VC5A 1BRLA 3N73A 3W7GA 4UTUA 1QNVA 3GHUA 4IJRA 1VENA 4N0RA 2CLMA 2QUMA 2D0FA 3PPCA 4O18A 2XN0A 2OSWA 1UMLA 4E8GA 2DJXA 1E6XM 3CNYA 4IIGA 1CNVA 1GCYA 3B0XA 1AUSL 3VU2A 1QATA 2GVEA 2PD9A 3PP7A 3CZLA 4WDTA 4PUJA 2R14A 4YTTA 2QDGA 4BR1A 1CXKA 4G1NA 1E6ZA 3LRKA 1W1IE 1GQIA 5E6YA 1W1YA 2XVGA 3E0IA 3P8JA 2PLJA 3FX4A 3M07A 3GDKA 4RDZA 2VFFA 4RW5A 5E0KA 4GY7A 1ZENA 4BHYA 1PIFA 1E15A 3C5QA 3SDOA 4C6PA 3I4EA 3OBAA 2B0MA 5L9FA 3PR2A 1UG6A 3VE7A 4GE8A 2OOGA 1QW9A 1DTNA 3E2QA 4LB3A 3EKGA 4PUMA 2YXOA 4AWEA 1O6IA 4LC8A 3M0ZA 2JEQA 2F6UA 2Y89A 1EXBA 3JR2A 3WKZA 5LXEA 1PJ9A 4YHEA 5C71A 3USBA 4FF7A 2KAUC 3W01A 3KRBA 4CNUA 2X1SA 1TWWA 4F66A 8XIMA 4ICCX 1C8QA 5MKGA 4AZ5A 1JCXA 4DPQA 3RPDA 3VD7A 2CLIA 3R43A 3KOZA 2QAPA 4Q8OA 5E9XA 3V1HA 1KGUA 3OO2A 1L6GA 1VBUA 1MUMA 1EJVC 1WZKA 5D8WA 4AD5A 1KBKA 4OFCA 3HPXA 3ELFA 2Z0IA 2P5NA 3UEQA 3C2OA 3IK4A 4CGTA 3CT2A 3IGXA 1GJUA 2EKGA 1TREA 3KL0A 2WKJA 4Q7BA 1KKOA 3E02A 3PZVA 5I3HA 3MQTA 1KCLA 1QI4A 2X2GA 5F4XA 3E49A 1VFTA 4HA3A 2IPWA 4ORMA 3SUTA 1GVSA 3GVRA 2BSLA 3VXGA 1GYNA 1Q7ZA 3FAWA 3I3DA 2WJFA 2PD5A 3L65A 4WJ8A 3WMCA 4GI6A 2V5KA 4DI8A 1QJWA 2ACRA 5D2TA 4B90A 4F40A 3R4IA 1AK5A 1O95A 4MNJA 4DELA 3N25A 1E51A 1R9YA 4KW2A 1V6WA 1B5TA 4UC5A 4IMDA 2FTPA 3TN5A 5GQBA 4B92A 1Q8JA 1SFTA 2OZTA 4U2YA 4IOTA 1CXEA 1WDDA 4HZ7A 3WLKX 1J6PA 4IGMA 3GNPA 4E4PA 2Q3OA 1K6WA 4WJEA 1H49A 3AYTA 3DIPA 2OJPA 1PUDA 2P3ZA 1KBIA 3U9IA 2DVTA 5M03A 4UTHA 3SCSA 4O4VA 3S9YA 4EPKA 1F73A 4QX4A 3C0SA 2J9XA 3CK5A 1P0NA 1XLKA 3WF1A 2PDHA 2EHHA 2BWGA 4IIEA 1PE1A 3KRUA 3EXSA 5CZTA 3MU7A 1D8CA 2WCGA 4OECA 3N17A 4LPCA 1UKPA 1BLIA 1X8FA 4KERA 3T08A 3TAKA 3H7UA 1RK5A 3KLKA 4O0QA 4FIQA 3U57A 3O05A 5XIAA 4WJXA 2X05A 4D8LA 1UZ4A 2OZ0A 4WCJA 2YDRA 4C6LA 4JIQA 3MWCA 3O06A 2FYMA 1W5OA 4L9YA 4NX0A 1J79A 1M7PA 3T0AA 4LT9A 1HL9A 1UC4A 1KB3A 4K6AA 3FHAA 1MSSA 2YA1A 1YX1A 4O10A 1V6XA 1X8CA 5PTDA 3E2RA 2OTDA 3TJ4A 2HXTA 4DPPA 1U83A 1KM5A 3GNDA 3NL2A 3S2CA 3ITOA 1JL8A 5CC3A 4MAZA 1R7OA 4US6A 5HNRA 3OA3A 4N9CA 5LNWA 4QGCA 2OR2A 2VZSA 4B5SA 1ZJIA 3BO9A 3W25A 1XSIA 1JIBA 3W75A 2C1HA 5LIKX 4HMCA 3USZA 4BCEA 3K13A 2YXGA 5T9CE 3BQ5A 4R7OA 4NZ5A 4L4PA 2J25A 5DN1A 4WD0A 4GQGA 1MW1A 4ATDA 3FKRA 1W9BM 4NNBA 4PA8A 1G94A 3F4WA 2UZ9A 4NAEA 3UCDA 2FMOA 2QJJA 4PTXA 4Q4RA 2ONEA 3KVKA 4IX0A 2QS8A 1I2RA 1ADDA 4XIAA 4BFAA 3KVMA 4S3JA 1TQXA 3ZFHA 3VD9A 2VFGA 4KKXA 2EPMX 3CBWA 1GPFA 3WUFA 3DFPA 5H8UA 1LWJA 2AAAA 3ZJ6A 4HNOA 3PFRA 2E4TA 5BWAA 1DWFM 4XQ6A 3M7SA 4S3AA 4K1WA 5CCZA 1UH3A 4DWSC 1B3VA 4UMAA 4DQWA 3G8EA 4W7WA 4ADUA 5E93A 3B0YA 1TZZA 1ZB5A 2YPIA 4D6FA 3NO1A 1J8VA 4DYEA 1I60A 4Z08A 3BARA 1MEHA 3OB8A 1ONWA 1XF0A 1CLXA 4EXAA 2DV0A 3TJXA 3VOCA 3OW1A 3GHRA 4F2BA 4Q32A 3CIVA 1D9EA 3LHTA 5TF0A 4L6HA 4GYKA 1UD4A 2JKAA 3WYZA 4KESA 4ZO8A 3ZM8A 2CERA 4XG1A 3EKZA 4JYFA 1DJXA 1NWSA 2DZWA 3C56A 4MB5A 4MY9A 3L4YA 1EZ2A 4C7DA 2HROA 1XFCA 1UH4A 2A6NA 4RL3A 1VGAA 2CFFA 2V3DA 1V3MA 1KNWA 3C61A 3ENLA 1P7TB 2PDXA 3VZYA 3BLPX 2DT3A 4MHBA 4DJEC 1LUCA 4HCHA 3G6LA 1MWOA 2PRHA 2Y7EA 2G97A 4IISA 2GJXB 5KZ6A 1O60A 2H6RA 1NEYA 2LLEA 3GBDA 3UR7A 1ISVA 3F7JA 1LWHA 3QXBA 3EWZA 4CN4A 1L6FA 5D37A 1JD9A 1JGMA 3HQOA 3R6IA 1PS9A 3ITGA 3E0WA 4ACZB 2VDGA 1VBRA 1XISA 2E25A 1WDWA 2ZC8A 3REQA 4LOCA 3MC5A 1DIOA 4F2UA 5K3VA 3NQ7A 1IR1A 5AHLA 1UH2A 4G7FA 4HCDA 2NUXA 1NP2A 2JQXA 1VPQA 3W2NA 5BRPA 1H63A 4IPPA 1K9TA 1O12A 3VGHA 1TTJA 4HHMA 3G1DA 4LWWA 1IGWA 3V35A 3ARRA 1ODUA 5DY3A 1OD8A 4X0NA 2PWUA 3F4DA 4AEFA 2ZE3A 1ECEA 5I6SA 4JICA 4OT7A 4AVNA 3BH4A 1I45A 2GUYA 1OYAA 4MMWA 3H8AA 4GO9A 3CHCA 3MSRA 3LS9A 5JMUA 2F6XA 1SU5A 4GNVA 3RM8A 5LA2A 4XAZA 1Q6DA 2D3NA 3L2MA 4DZIA 5FF3A 3PWAA 4LV4A 3NEVA 2WANA 2PDIA 3T7VA 3G1RA 3VIJA 1C8YA 4IWWA 1DWHM 1K8CA 1VFLA 4NKCA 1F8IA 2FVLA 2ZKMX 3UW6A 5I02A 2D2OA 3IIZA 3STEA 3EXRA 2P10A 5HWMA 5HJYA 5HINA 2WVVA 4XISA 5JH1A 4PMOA 3UF9A 4RZBA 4IQEA 2PODA 5DCEA 1F2JA 1OCNA 2VCCA 1VEMA 4ENLA 3IAQA 4LS2A 3KL5A 3WMLA 3ARTA 1HNYA 4PMYA 1PX4A 1GOWA 4HMEA 2IW0A 2XVLA 3D3AA 3FGCB 3POCA 1NF0A 1EFZA 1OFOA 4P8VA 2D3LA 3QYQA 5FJPA 4LVDA 3DYOA 4G6CA 4UTMA 2RKXA 4CCEA 3M6DA 4PMUA 3C0JA 4GQQA 2PE4A 1DWGM 4ZO7A 5HXMA 1SW0A 2R24A 1X39A 1ISWA 3V75A 1GQKA 4WXYA 1UBPC 5E70A 4WSJA 3KAOA 3R2GA 3GG7A 1XIMA 1C93A 3GO2A 3DHFA 4U4MA 1KRAC 4S3DA 4Q7NA 3N3TA 4PMNA 4A8NA 1BYBA 3C86A 1OHLA 2CLKA 2OEJA 2VXNA 4HMNA 4IUGA 3M0MA 1FY6A 5H6HA 3BVJA 1O4UA 3SFWA 3ABQA 2GUBA 1IEVA 2YCLA 4OBRA 3UETA 3T42A 3OVPA 3OVQA 2QUUA 1W32A 1TTQA 5A1AA 2DSWA 2GL5A 3FJ4A 4XO7A 4OV4A 3SGGA 4F4RA 1GEHA 3MZNA 3G1FA 3BK0A 4W7UA 1TRIA 4OJYA 2FZNA 1TPDA 4UTTA 2RAGA 3ZVIA 2OXNA 3N2CA 2NX1A 4MWAC 2G3FA 3THAA 4IM4A 1NOWA 4KWUA 1LYXA 4H9MA 2INZA 3MV11 1NJJA 4I7UA 1CGWA 1EKOA 3KOWA 2NT1A 4J3XA 3VIHA 4JIHA 2RGLA 2OQYA 4U31A 2ZZ7A 4JTFA 4LUJA 4PE8A 5G2WA 5DCDA 4M1RA 1XDJA 2A2IA 4JCLA 3CQKA 3DAQA 3S0CA 2PSNA 2VD9A 1H0IA 2VEFA 4O8AA 1EYWA 3W26A 2EO7A 1XH1A 1OEPA 8A3HA 4EPEC 1JDEA 3R25A 2KX9A 5J8LA 2HISA 2Q8XA 4DM2A 4W7VA 1K7EA 2QCFA 1JF6A 1HUVA 3G18A 3PPGA 1G7UA 3AIQA 2ZX8A 1KFBA 2GGHA 1PHWA 1KFJA 1CB2A 2DSKA 1HVXA 2RDXA 4OOUA 4OKDA 1R2RA 4HOXA 1P5BA 1JCLA 4LAOA 3UYCA 4QAWA 1SR0A 2EPLX 3E2SA 4ERGA 3WLQA 1VPYA 2ZCGA 3UWZA 5CZJA 2C7FA 4WX2A 1Q45A 4X9YA 4HVXA 3O3RA 4OOZA 3K2GA 1SSDA 1FKXA 2RGMA 4LQ1A 3WEOA 1UZDA 3QMTA 4ZCWA 4H1ZA 1R2TA 1RBAA 1HZYA 2WHMA 4KIRA 1OINA 3PZIA 2XM1A 4PRRA 1EF3A 1MDLA 2JALA 1FP8A 5G4HC 2AAMA 3P93A 3P3BA 1DE6A 4A3UA 4V28A 1RQEA 2C1GA 1VEOA 4MM1A 3GS6A 4KCWA 4UBPC 1W9PA 4RNFA 4DX3A 1XG3A 1VFMA 4UQCA 4F0SA 4P8UA 4DXKA 1WXJA 1V8EA 4HA4A 4GNKB 4WQ6A 1BSLA 4RE4A 3KCOA 4URIA 3ANVA 1MQQA 4M81A 5HMFA 1UBSA 5HR7A 3G1AA 3SIMA 3RIKA 1K8ZA 2JFEX 3UU0A 5A2CA 3N9SA 3IIVA 2IQDA 3VOGA 4C6OA 1GW9A 3HIJA 3GR7A 2X1RA 4UCFA 1ZP4A 3CUHA 1HXJA 3A64A 3U2ZA 3U48A 3U5UA 2DW6A 3AO0A 1FWIC 3N34A 1UYQA 3VM7A 4HZ8A 1Y5XA 4IP4A 2NVCA 3A3HA 3RNDA 1QRQA 2O0TA 3XISA 1QI2A 1ZCCA 3B8DA 3M1ZA 3UQNA 5M2FX 3ITCA 1XD0A 2VUNA 1HKVA 2WVUA 5MF5A 1WZLA 1S2WA 3KVLA 2PURA 3MVIA 3V0SA 3W9ZA 4BI5A 2FHFA 3WDPP 4JD4A 3LM3A 3P14A 4OIFA 4GABA 3GG8A 2DT0A 1EWDA 1PIGA 3UVIA 2GGJA 1V3HA 2P76A 3O16A 4LAUA 4JZ5A 1E9IA 1Q65A 1WAWA 1DV7A 3TK7A 5FCZA 2J9ZA 2NSXA 3IUHA 3ZVHA 1ZCOA 1TFVA 2DZSA 4DO6A 2HZGA 4HSOA 1FWSA 1JZ7A 1OX6A 4L56A 2PWEA 2VGFA 3B9EA 3QW4B 2ZXQA 4QTGA 1L8PA 1QTWA 3WH7A 3H55A 3MI6A 1R9XA 4PMQA 3DN5A 4AD4A 3TSDA 3SCTA 4GYPA 2Y4SA 3F03K 3WQ6A 5DX7A 1CENA 2HS6A 3QGAC 1H3GA 4X63A 1TX2A 2WJDA 4RNIA 1AVAA 2CHRA 3M9YA 3QLLA 2X30A 1JAKA 3FCPA 4LVFA 3BE7A 1TV5A 2PCQA 3QTPA 2CZ5A 3M0XA 3BSHA 1HGYA 1TV3A 2WBGA 2ACUA 3CZ8A 1SSGA 1KWKA 4CNTA 4PCTA 3PWIA 4J3TA 1AA1B 3Q45A 3SEPA 3RM4A 1J0JA 3WH9A 3ZR5A 1KBJA 4N7QA 2FB2A 4LUTB 3J7HA 1T7LA 3EA1A 2ISDA 1OX4A 3CV2A 1OC7A 3STFA 1QFEA 2JF6A 2ACQA 1GTHA 5F4SA 5D2XA 4M29A 5A6JA 1AQMA 1B2YA 4EAYA 2NQHA 4BK9A 3VFCA 2I5IA 2X1IA 1R5YA 3P2VA 3UPMA 3KCJA 3HV8A 1H1YA 4PTVA 4WEVX 3QGKC 4C1NB 4JEJA 4MDOA 5IDIA 4MGGA 1ZY9A 3PUOA 2PP3A 3WLLA 4GX8A 4E4FA 5LIXX 4S2BA 4C6IA 2OGJA 3VOHA 2CXGA 4CVUA 1E4LA 4MY8A 5HOSA 1O5XA 2YR1A 2CETA 2FPTA 3EDDA 1PBGA 1ESWA 1A5AA 3K1DA 4A6GA 3DFNA 4DBWA 2GWNA 3WQEA 1IT7A 4D6GA 2XSAA 2Z7GA 4L5ZA 4NJKA 2Q6ZA 3H4WA 1R6WA 3AS0A 3LZ3A 1SYTA 1WDRA 2CC0A 1A0EA 5CC6A 2BHUA 4Q3MA 3WJSA 3K46A 4QE1A 1YYAA 1GTEA 1OCJA 2OSYA 1T99A 1C92A 4DXVA 3R89A 3W1XA 3GY1A 5I23A 1HKJA 1GUVA 4BI6A 4EXBA 4NYYA 4AWSA 1E1FA 1Z7AA 3KX6A 1YMYA 1TTPA 2Y70A 1FWBC 1AMKA 4MWAE 1SJAA 3WJZA 3R0UA 4H9TA 1G0CA 1FH7A 3U2CA 4E3VA 1WDQA 2C19A 3BJTA 5DY2A 4KEUA 2P0IA 3Q94A 4IX2A 3U7BA 1EZWA 1FWTA 2XFFA 1UOZA 1W9VA 2G3MA 3QOMA 1JD7A 2YBTA 2GLKA 2E6FA 1G01A 1TRDA 4WHBA 4UOJA 2DZPA 2DP3A 3NQCA 5HMEA 1S2TA 4DZAA 1HL8A 1O5RA 4DN1A 2HVOA 4YXGA 4Q4MA 1B9ZA 3SY8A 3A22A 4C91A 5HPOA 2PDFA 4M1BA 4QRNA 4TVCA 4IQJA 4Y8FA 2O7SA 2QUTA 3WNPA 4HA0A 5C70A 5E09A 1L6WA 1BRLB 5HMSA 4JL2A 5XIMA 5D2YA 1EB3A 2WKGA 1AH0A 5IM51 4FNTA 1Q6CA 3WQDA 3SBFA 4KH2A 2BTMA 3EPMA 3LGDA 1XLDA 1G4PA 1OFAA 1CEOA 1UP2A 2DGAA 3OLDA 3OQEA 2WMKA 2BV9A 4I9AA 4Z0SA 3ZS4A 5JBEA 3B4YA 1LOLA 1DKWA 2BGSA 3NZQA 3LHUA 2UY2A 1ZJBA 4LYKA 2VFIA 1UIOA 3NPVA 1SO5A 1BWVA 2ZRUA 5IFTA 1V5XA 4S3EA 4YVVA 4RZ4A 3HQPA 1VCGA 4Q22A 5DEZA 1TV7A 2Z1WA 4IXHA 3VOIA 4WK9A 1PVNA 5DBTA 2VCAA 4B5UA 3OU8A 4AAJA 1F7BA 2WMFA 4M80A 4C5ZA 3PG9A 4D1JA 3Q67A 2BY3A 2E6DA 2WZMA 2J6VA 1WKEA 2ZX5A 1ODZA 1UR3M 3MTWA 1U22A 2ZTKA 3O0KA 4ZFMA 1N7KA 1K9DA 1YHTA 4UUIA 4BQ4A 1EHNA 3QZEA 1QT1A 5C5YA 1V6VA 1HF6A 3EWBX 1N2VA 4ZBCA 2ZX9A 4D6IA 3RJXA 4UFKA 1XGZA 4BJHA 3CHDA 1B3XA 2ZXAA 4D9PA 3DCPA 4MZ1A 2WPGA 4JY8A 1ZSXA 1W37A 3BQ6A 4L80A 2GPTA 5D09A 4XZ9A 5MKGB 1VC4A 3C2FA 4LBRA 1OCQA 3NWRA 2ZC1A 2DQXA 4LYPA 4XD5A 2Z25A 3TOPA 1F3EA 3SCWA 1AJ0A 1J01A 4Q6XA 1OF8A 4IZGA 4HU3A 2WZHA 4IH3A 2AQWA 3N14A 4C7FA 3WBEA 2X0HA 5AHEA 4YNGA 2YA2A 4W8BA 3MJMA 4IL0A 4AYGA 3GUWA 3A3XA 3NQGA 5D9PA 3CS2A 4PMVA 5JIWA 1IZJA 3NA8A 3SUVA 1GVQA 5I07A 3H6OA 1H1ZA 1R3RA 2Y63A 2FPVA 5C2CA 1JFHA 2QDEA 3S8HA 3N4EA 1EJWC 2PC4A 1ADSA 3QY7A 2XFYA 5CG7A 1YXYA 3ABZA 5EKYA 1G5AA 3WL0A 1WO2A 3VC6A 1TJ1A 3IJQA 2YCJA 3KRZA 3DFHA 4K37A 4HPGA 1Z44A 3NOEA 3DESA 3T4WA 3WSUA 1ZP3A 3G0UA 3G5EA 3W1LA 3TYCA 4U3CA 3ABRA 2AKZA 3KOFA 4G5DA 1JUEA 3EDFA 4MKSA 2QIIA 4WKHA 2XVNA 3GU1A 1RD6A 1OABA 2NLIA 2O4MA 2WZEA 1XD1A 4AW7A 4JTKA 3EB2A 3SGUA 1M3UA 4XK2A 3BPWA 3T9PA 3TQKA 4UR8A 3MHGA 4B15A 1IEWA 4MJ2A 1FFQA 1X96A 1P6CA 3ZT5A 1Q6FA 1W17A 2FTWA 1D2KA 2J7HA 4AYSA 3K5XA 1O94A 1MRAA 1W31A 1JZ3A 4JTUA 4U5KA 1TZ9A 3L5MA 1PDZA 3FSUA 1L2UA 1H4PA 1LDCA 3L68A 4NF7A 4QQUA 2YL6A 1VD6A 1V3IA 3AS1A 2PTYA 4FLQA 1JNDA 3LRMA 1XW8A 2C14A 3R58A 4GJ1A 1ZAIA 1EC7A 1TA3A 3ECQA 1OWQA 4JQAA 3PZTA 3KFTA 1A5UA 4GVHA 1QI0A 3BCDA 1UUMA 1NDZA 4FXSA 2QR6A 5H2ZA 4NAEB 1S2CA 4MFEA 4O50A 3MUZ1 1XLFA 1KV8A 4HKPA 1E1CA 3U4AA 1FDJA 2TRSA 3CB3A 4I3GA 2OLAA 4JFSA 4IFRA 3BXWA 3PBYA 4RV3A 2ZFAA 5D9OA 7TAAA 1LQ0A 4NI3A 4XD6A 3EMQA 1X1OA 2J79A 1FRBA 4ZQPA 1RJPA 1CCWB 3MMWA 5BOEA 1W3KA 2XTKA 2A7NA 1AH4A 4LUIA 1M9HA 4RDWA 3WFLA 4JX6A 2WQDA 3P84A 4CQBA 1X6UA 3BTNA 1E0UA 4JIEA 4R34A 2XINA 3LBMA 4LNYA 3RN6A 1XIBA 3N13A 3NO5A 3ZJKA 2VEIA 3GRIA 3NJ3A 4PMDA 2F38A 1Q66A 4IFOA 3WUGA 4GACA 3EB3A 3KLLA 5A6MA 2EGZA 5EBAA 5A8PA 5F2LA 1Q8AA 2CKSA 5AC5A 3EX3A 3LENA 3TROA 2EQDA 4NXSA 4KF1A 4IIDA 1OIFA 5IFPA 3WJYA 4WDXA 4GI4A 3PBGA 3T8LA 1LBLA 4UQBA 1BGAA 4F9DA 3OP2A 2PZNA 3W74A 4P7RA 1TJ2A 1MVYA 4R33A 3WO8A 3BAJA 1ONRA 1LUCB 4PMZA 3S1GA 5I3DA 2GJLA 1H7XA 3N29A 3G1YA 1LBFA 2QVNA 2W5FA 4B9YA 1EGZA 1C90A 1UKOA 3AIBA 4IUOA 2YCKX 4LEFA 4HMDA 3LCFA 2OB3A 3V7PA 4ZQOA 1I0BA 1DXEA 1XIDA 1ZAJA 1S5VA 3REQB 2IQTA 2VENA 4FNPA 4H83A 3NSXA 1YLVA 3CL6A 2XIOA 2CHOA 5JBDA 4TX6A 3SCQA 1XQKA 4IG2A 4HGXA 1RA5A 1Q6LA 5IBXC 2IKIA 3BURA 3LY0A 9XIMA 4KEMA 3PPFA 3VCRA 2WSYA 3NQFA 3R8GA 5CSRA 1BFNA 4K38A 1VR6A 4ADSA 4XSMA 3VVGA 3TYZA 4C1KA 3ID7A 4LJ3A 1UZ1A 1OFEA 2F2HA 2PF0A 5D38A 1SJBA 1MW2A 2OZ8A 3DHUA 3MHFA 3VNIA 3UXAA 1RPKA 3BAYA 4TU1A 5CSUA 9RUBA 3W23A 1W2VA 1R3YA 4F9JA 3S5OA 4KPLA 3WD3A 1DWJM 3WDHA 1ZPTA 1UD3A 4FK9A 1BQCA 1ISXA 3WCZA 5LKYA 3GXTA 2FKPA 3SZ8A 3GE7A 3GFXA 4Z42C 2C13A 3WL1A 2J4GA 2PTXA 2E5DA 2ZADA 3FN9A 4PSRA 2GUUA 3PB0A 3G1VA 4LVAA 1I1XA 2QHAA 4A3HA 1FFRA 1TJ0A 1P4CA 2Z1BA 3N15A 4K68A 2VRJA 2QMKA 3BW2A 4L7ZA 3NQMA 1UA3A 5BMXA 3CUXA 5A6TC 4HNVA 3L5AA 3FXGA 2CZEA 1FWEC 2WVVB 1A47A 4GOAA 3TYAA 2QJMA 3ANYA 8TIMA 3GIYA 5I78A 3CV7A 4JIRA 1OCBA 4PFHA 4N4PA 2BMBA 3MKKA 2YW4A 1ISYA 1HTIA 4NJHA 3UGRA 2IKJA 1SQ7A 2Z2UA 1DXIA 5CPNA 2NX9A 4CKQA 1EH9A 2QULA 1AD1A 4LY4A 5HQMA 3NL5A 1XRVA 4WSHA 5IOBA 4RXGA 1GWJA 2DUAA 4JDYA 5DRIA 4U10A 1VFFA 3C2RA 4HP5A 3T07A 3VDAA 3MCNA 3V4BA 1NQKA 1L9WA 1TWZA 2PDPA 2EG6A 1BEUA 1SFJA 3MUIA 3UWWA 1L8NA 4M6UA 3N9KA 1JPMA 3EX2A 3L9CA 2RJHA 3OG3A 3RFAA 5AZ1A 3WH6A 5BOOA 1A0CA 3VI2A 4XBJA 3HU7A 2YCLB 3QGVA 4GA8A 3ARQA 2QYGA 2PB1A 3TYDA 3JZEA 1NFBA 4Y6GA 1F3WA 2G37A 3NZGA 3W7HA 3C3NA 2QCDA 4QDWA 4UFLA 2OLSA 1VFUA 3N2BA 4NIRA 4NZ3A 2WMIA 1OIMA 2FGZA 2E9MA 1H50A 1G4SA 3HO8A 4FR1A 2FZBA 3BOFA 2R1PA 1FWGC 1KFKA 4GH1A 2ICSA 4LW7A 2QCHA 2R1NA 1KGWA 2XSXA 3HMJG 1JZ6A 1MI3A 4Z17A 4B3ZA 3CYJA 5D2VA 3WQVA 3M4HA 5FEXA 4F2TA 4B3KA 3URBA 2VZTA 4TMBA 3FYPA 1R87A 3GH4A 3RPTA 2EAWA 4JTAA 1XLJA 1S2AA 2XWEA 3LN3A 2VKZG 1GOMA 3QN3A 4MYXA 3P61A 1IWBA 4D2JA 5FACA 3VKDA 4DBDA 4Z0JA 4C6FA 2UY5A 5REQA 1CB7B 2GK1A 1IT0A 1Z3NA 5ABGA 4HCLA 2ZRVA 1VYRA 1B4EA 1BF6A 1RJRA 3WDQA 4JTHA 2OG9A 4ZA0A 4KFNA 2NUWA 5ENLA 1B1YA 3B9AA 1TE6A 4P7NA 3IAPA 2ZICA 4MB4A 4D6EA 3TQVA 4EKJA 3OA5A 1SFSA 1H7NA 3AMKA 4DBUA 4IPLA 2WCSA 1W9UA 2YA0A 2EF9A 7PTDA 3UYIA 3R0KA 4QISA 3L2LA 3LYEA 1JYWA 4RDVA 5FSDC 1S39A 3GC5A 5JH2A 2VEKA 1PV8A 3CHFA 4JHZA 3CGTA 2BY2A 1F5ZA 3BW4A 4N2YA 2DSUA 3BOXA 3GXPA 1ALDA 2PDYA 3M0IA 4ZTYA 3R7MA 1MXSA 3OZOA 2PWGA 3LLFA 1E6NA 3PJTA 2JK2A 3T44A 1A5CA 3W22A 1U1JA 3WLHA 5I7GA 4UTJA 4XKYA 1CTNA 4S23A 4E4UA 2PLKA 1UROA 3UXLA 4A22A 3G1HA 3BLFA 2J6XA 1KCXA 4HNTA 3W6MA 4ZB2A 3FSTA 4AY8A 4HPNA 4MNKA 1XYBA 4B5WA 1V02E 3SSZA 3R1ZA 3LUTA 2POTA 1EO7A 4BEUA 1VCFA 4RLIA 2PRLA 4PZVA 4AC1X 1J0IA 4PL1A 2XH4A 4PTNA 3AICA 2DVXA 4RNHA 2E28A 2OX4A 3VK5A 4PUEA 1PX3A 3PSVA 1H41A 1R38A 2HNEA 4MLRA 3KWXA 3NURA 3FA3A 1KLZA 4IP5A 1VPXA 3VABA 3TTYA 1SZRA 3EWYA 1C8XA 1AG1O 2GQ9A 3K1GA 2D73A 2WM0A 3KUMA 4OU1A 1TV4A 5T8GA 1HVQA 4UB9A 1IZCA 1IGSA 1XCXA 3PZOA 1W5NA 3AUJA 1ZS2A 3ZWTA 1Y0EA 3B8TA 2CZDA 2NZLA 4EE9A 5G1MA 2YSWA 2JIEA 3M7WA 1FWDC 3ONBA 4AIEA 5I24A 3BJSA 4QROA 5A6KA 3EOUA 1F61A 1XSJA 2QGHA 5AHIA 1YIXA 3PZ9A 1XLAA 3RYSA 4JTCA 4B4HA 4IICA 4CCZA 4I9TA 3GNRA 2VOTA 1OFBA 4YIWA 3UGVA 3HGOA 3ZVHB 4EXQA 4ZFCA 3G3DA 4F3HA 1K6AA 3M5ZA 3A4XA 1KFCA 1NH6A 2JE8A 3VKCA 2QIWA 9CGTA 1XQLA 3ITLA 1KR0A 1QK2A 1EXPA 3BAIA 3ZR6A 5FIPA 1TWSA 3MKCA 4FIRA 3ZXWA 1VYSX 3NZPA 3NQEA 5F1VA 1VLWA 4MKVA 1NSJA 2WB5A 1HIZA 3OQ8A 3ARVA 2PGRA 1W3LA 1I2QA 1XPGA 4G1KA 2F84A 4Q4OA 3HOJA 4CNOA 4A3RA 1WKYA 2E0PA 3BJFA 2ANUA 2IPGA 3IPWA 4XIMA 2Y7FA 4FX8A 4GVFA 2J7EA 5RUBA 4AD3A 1BSIA 3IJ8A 1UPMB 1HN1A 1XLIA 3LU2A 2NV9A 2WWDA 1XBYA 1G9HA 3TQPA 4PTWA 3L4ZA 4LV9A 3PTKA 3ZO9A 4HPHA 4DBSA 1KW1A 3RITA 3LV6A 4PCSA 3GVGA 1GJWA 4YTSA 3JVAA 1OX4B 2WK2A 4LU0A 4MY1A 4M5PA 3A24A 1XR2A 2IKGA 3TYBA 1AMYA 1PHQA 3QVQA 1YNYA 1HO1A 4Q4KA 2J7DA 2VYOA 1XLCA 3TTQA 2QUNA 1W56A 3HBLA 3I10A 3B3DA 4M6QA 3TN6A 3N3MA 3SQLA 1B30A 3DI1A 4L61A 1JRBA 1O5QA 4E2BA 3QV9A 4IPJA 4DJFC 2XH7A 1KO0A 3ORWA 5DF0A 4H04A 3WF2A 1FWFC 2CBUA 1KA9F 2VELA 3OODA 4M24A 3I7QA 2ZVRA 3BLKA 1XCWA 4UTWA 1TIWA 3LXAA 4KRUA 4L1XA 4QDPA 1A5NC 1DHPA 3CLMA 3W73A 3NVTA 1KR1A 2F6KA 3UPBA 1V93A 3NPXA 1XV8A 5JIPA 3WENA 3LTPA 3GXNA 3VIFA 4PRWA 3S2LA 4GY0A 1B3YA 3N18A 3W37A 4YVPA 2ZA2A 4M3PA 3CM4A 1TTIA 2A85A 2ADAA 3FA4A 3NQVA 1OBAA 1FXPA 4UMCA 1W5PA 5CXPA 2QCCA 3KE0A 1LRQA 1IIGA 2D20A 1ICSA 3CWHA 4IMEA 4WR3A 4DUOA 2OEKA 4KFPA 4EPDC 5J5RA 2PUZA 2RDWA 2J74A 3W00A 1DWAM 1GJPA 1TPC1 2PLCA 3U2OA 3NSMA 3OBEA 4XBKA 3OVRA 2O9TA 4B4FA 1BAGA 4D72A 2NQJA 3ABXA 2QV4A 1XDLA 2PRMA 1H7PA 4YTQA 4DI9A 4ZQCA 4ZTXA 2HCVA 4TOQA 2V68A 5AN7A 1Q13A 2J62A 4GYJA 4PODA 2OGYA 2Z2BA 3UNTA 4V33A 3ARPA 4EACA 1PKLA 1PX8A 1V77A 4EP8C 4PB3A 1LLZA 3L67A 2J24A 1KM0A 1NFGA 2PGEA 4Q4SA 1FCUA 4Z1YA 1VFSA 3SB0A 1XX1A 4XD3A 3TDFA 4J3SA 2H9AA 1WBJA 3TONA 3TLQA 1YE6A 3QHOA 4QJ3B 1C8VA 1FHLA 4YJ5A 3MDWA 4FSAA 1CLKA 3F4VA 4GJJA 4YU1A 2Y62A 4QQ3A 4AEOA 4AY7A 5IHSA 1HG3A 5I5RA 2XGBA 2VZVA 2DUZA 3VMOA 5EMYA 3N1AA 4GVIA 4DIAA 1M01A 3E0VA 1QBAA 4B5XA 1PB0A 3B0VC 1P0DA 3EZ4A 2V3EA 1UD2A 1VBGA 1WOAA 5BXPA 2D69A 2E5BA 4OTKA 1R86A 3HG2A 3FDGA 4AISA 1QNRA 2Y5SA 1GEQA 4O14A 2DZAA 4O1CA 2QNEA 4GBDA 3GIQA 3IARA 1RQHA 3AFBA 5M3WA 2Q8ZA 1FTXA 5U7SA 5AYZA 3UESA 1D3GA 4A3QA 3LXBA 3EWUA 4D6HA 3NO3A 2JBMA 4HYWA 3VIIA 5HMDA 1NWRA 4GWEA 2V8ZA 3U2EA 1WBHA 3GAKA 4U28A 3RDKA 2IXUA 4BQ2A 4WUIA 2W62A 3UT0A 5C8BB 4JXCA 3UNDA 3B8VA 5GJNA 2R1LA 3CASA 3AS2A 4U3AA 1QWGA 3ES7A 3MBDA 2Y5EA 4DUVA 5AHFA 1AL8A 4Z2LA 2B31A 3E96A 4S3BA 2E40A 2I9UA 2YL9A 1QNSA 2E77A 4DLMA 4AF0A 2A3EA 6CGTA 7ODCA 3WEZA 1JDAA 2YBVA 2GSJA 4AD2A 3EOOA 3DBNA 3P82A 3DKJA 3M64A 1RBLA 4AQLA 2FVKA 1W3IA 3BLEA 3GNOA 2J9YA 3GNNA 4ALDA 1IEQA 2ABAA 4ERIA 1QK0A 3CB8A 4TIMA 4MTVA 1KXHA 3UD6A 3KRSA 4H01A 5D8ZA 2PMQA 1KFEA 5A6LA 2GZXA 5T26A 2OOFA 1R85A 4PH6A 3CPGA 5A8OA 2Y0FA 4CNSA 4YN5A 4GX9A 1Z8AA 1SMAA 3NGFA 2CWNA 2XU2A 3OPSA 2ZWYA 2FDMA 2VMFA 2Y2WA 1MW3A 1LT7A 3IUDA 1FVPA 3VX0A 5CC5A 4A4AA 3BICA 2QCMA 2I5QA 1LL7A 1W0MA 2WLYA 1VRXA 2G96A 1IF2A 3PBWA 1S1RA 3CWOX 2ZUTA 5AB3A 4E5TA 4UFMA 3APYA 3AU2A 1LLOA 4NY2A 4Z1DA 2GOUA 3UXKA 4PSPA 1VCVA 4L9XA 2XDFA 5B80A 4PUDA 3TNBA 1GOIA 1XKYA 4WGHA 2XIQA 2V5LA 4PEEA 3IK2A 1P0KA 2W9MA 1WCGA 5E5CA 2QVHA 1I0DA 1J11A 4AB4A 1BQGA 3FVMA 5CZ0A 3SCNA 4ACYA 2YCEA 5DMMA 1Q6GA 1OZQA 3UZZA 3VKKA 3W2LA 5HNUA 4W93A 3U0HA 2YCIX 3NPUA 1A5OC 3R0DA 4XAPA 2V5JA 3QLDA 1CECA 3CAWA 2DZUA 2ZQ0A 3GQYA 3TEVA 3TW7A 5FEWA 3MUXA 2AGTA 1K9EA 1OB0A 3WG6A 5GJPA 4RK8A 2PI6A 1DIEA 3SJ3A 4HOZA 3MUAA 1EDGA 2V38A 1SZNA 3GIPA 2XSBA 1U2YA 2X1TA 4H7VA 3Q2DA 3I4KA 4GINA 2GGIA 3OHIA 4LFYA 1V6TA 4JFUA 1RP9A 3P67A 3EGJA 5EYWA 5ABFA 1GOKA 4K7VA 1TA3B 1ZBKA 2C71A 1JZ5A 1PKMA 3HJEA 4ZQRA 1H7RA 4HTBA 3HN3A 2G0WA 1E6RA 3KBSA 1TPVA 4CNNA 1E0XA 1QASA 3GG1A 3GW0A 1GNXA 3VIGA 3RXZA 1ZBCA 4I8YA 4YS1A 1DORA 5FJUA 3TH6A 3UZWA 2A3LA 1W1VA 1E1CB 1OD0A 3P5YA 5HQLA 3WQFA 2W92A 3H26A 1W91A 4KWSA 1U5JA 1WX0A 1OT1A 3MT1A 5EFDA 2CBJA 4BS0A 1IT8A 3VNZA 1J4EA 1WXZA 4IIFA 4GFSA 2V2DA 4GXWA 3PNUA 1Z89A 2OT1A 1TPUA 3W1MA 3GVVA 3P62A 4HJWA 1UWIA 1THFD 3EWCA 1V3LA 5AC8A 3VE9A 2P1FA 8XIAA 1TO3A 1PZ1A 2W91A 1W3JA 3AYVA 3VGBA 4GNJA 3L4XA 3VILA 4JTTA 3UWYA 1VFOA 3L0NA 2WHKA 1VQTA 3AYRA 1HJWA 1TPWA 1F4AA 4QFUA 5BU9A 3F5LA 5DLCA 4GHRA 2PBGA 7CGTA 4XV0A 4OBTA 3W72A 4O54A 1SW3A 1JGIA 1US3A 1X98A 2E9LA 3TE9A 3M5XA 4L4LA 3GTNA 4H8HA 2X8RA 1XC6A 1SO6A 4LBSA 5EMUA 1W2PA 1RP8A 3O7UA 3N2XA 2XZ7A 5HATA 4TV6A 1DJQA 1EP1A 1UKQA 3C2YA 4JNMA 3CH9A 1EOMA 3WF4A 3RGTA 2FMNA 1RQBA 4XZWA 2W27A 2DSZA 4FOKA 4DAIA 1D7KA 1VF8A 2QPSA 4QJ5B 2MNRA 3MANA 3IANA 3M0HA 2W66A 4UZSA 1UZHA 3BMXA 3GVWA 1SO4A 1DXFA 3BGGA 3CUFA 4ZQMA 1X97A 4LC6A 2W3ZA 1ELSA 1I6NA 1VJIA 3H2NA 3SCPA 1IWPA 3O2LA 5I3FA 4IG2B 3A4JA 1ECQA 2NQ5A 3W3OA 1EJXC 3E74A 2WKLA 4XUGA 4A2SA 1Q85A 3TWBA 4G56A 2WO5A 1RAKA 4PTDA 2DSVA 2YDSA 3W1RA 1AJ2A 4FLOA 3GYEA 2TSYA 1TWIA 3VPLA 5FJIA 1FCBA 3SRKA 3VINA 1DQUA 1BD0A 3VUPA 4DF1A 1GVEA 3DKLA 3TLLA 2NXGA 1DJYA 1WUEA 3UR5A 3ONCA 4P5UA 2C1IA 1FDZA 4ES4A 2DDXA 1JZ2A 1ICQA 2V67A 5I06A 1PAMA 3TQ0A 3LLXA 1O5KA 3S5ZA 3OGSA 4YTRA 3RRAA 1FWAC 2HWGA 2NV2A 2FFCA 4YCPA 4C6JA 3W7CA 3V0UA 3T40A 1ITUA 2QF7A 1CGVA 5H91A 3JU2A 3LCLA 5FL1A 2WOQA 4CU8A 2XYLA 2FH8A 3C52A 3WLSA 4B5NA 1HX0A 2IQ0A 3H2AA 1W5MA 2ZX7A 5HA7A 3L4TA 2XIJA 2CLEA 1B90A 3EKLA 1MXGA 4C65A 3TSBA 3W7KA 1POKA 1QBBA 4XAGA 3FJNA 3WD4A 1OQFA 4NAFA 3O07A 3WH8A 1QPOA 4FXRA 4EF9A 4E2VA 2JKPA 4P61A 2PCEA 2P8CA 4AG0A 3OIXA 1T8XA 3OGVA 3LSBA 1T5AA 1I2PA 4GPNA 2Y8VA 3LEPA 4JAWA 2HEJA 3MCMA 4RZ5A 3H54A 4AX7A 3LPFA 2O9RA 1PEZA 3AALA 2XFRA 1W54A 2J7BA 2HPMA 3RMJA 2OT0A 3SRHA 1WAUA 1JXJA 2PU1A 4HPXA 3DHDA 1YDVA 3EWDA 1NU5A 1I8JA 5FJTA 3E12A 2CZFA 4US5D 1UR0A 3VDHA 2DH3A 1OGSA 4S38A 4NUWA 3S6DA 4C6DA 4Q8PA 4AC7C 5A6SA 3M47A 4HD5A 4Q8QA 1WKDA 2Q02A 3NM1A 3DC8A 4MG4A 4J9JA 1IQ8A 7ENLA 4MPQA 1NDVA 3ZZ1A 2QCDB 1PCKA 4GC3A 2CITA 4LYQA 2WMIB 4K36A 2VGGA 2W61A 2J7FA 3AU6A 3W7EA 3KCLA 1DJNA 1NQ6A 1JQVA 4XTDA 4AZBA 1T40A 1BXNA 5CPTA 1V4YA 4YHGA 1W3TA 3K30A 3AJ7A 3ZLHA 3A47A 1XGEA 5D03A 3NYDA 1A3XA 3WNOA 1V02A 3L0KA 4XVDA 3GTHA 5KINA 3AIEA 2W6RA 4JFWA 4ZXOA 2H8XA 3ZMRA 4J40A 2ACSA 1C3FA 3CMGA 3MZ2A 3TWAA 2ISSA 3N6HA 3R94A 2VP8A 3F4NA 4UTTC 2Y61A 3KOYA 2PTZA 3HB9A 3GTXA 3PWGA 3OVGA 3FOKA 4LXFA 3VO0A 5REQB 5JU6A 1WXYA 2GK1B 3D3FA 1B4KA 2C91A 4O1EA 1ZBWA 3GH5A 4N6FA 5KITA 3CV6A 2PTWA 3CHEA 4KFOA 2BOEX 4HNUA 5CEWA 1OZMA 4JKMA 3BGJA 2PZ0A 2NQ9A 2XIIA 1QI5A 2IKHA 4GFIA 5BMWA 3WMSA 1TCDA 4XD4A 1GOXA 2HSAA 1GQNA 4JTGA 1ENUA 1RHCA 5AYXA 2QJHA 3WQGA 2HJPA 2VR4A 1I4NA 2PDJA 1B57A 1P43A 4Q4PA 4QEHA 2ZUMA 3KXQA 4LUYA 5CZKA 4Y9AA 1X38A 1BWLA 4RV8A 1Q5MA 2GYIA 1JCYA 4IMFA 2V5BA 1JUKA 4QITA 2JGYA 3PBMA 1C9WA 2D22A 4XKYB 3IVSA 1W1TA 4PCNA 2HNHA 3VNYA 4XAFA 3QY8A 2DFAA 2QCNA 3LZ5A 3R10A 1BGGA 1K8XA 4GISA 1YQ2A 2G41A 5AC6A 3LQLA 3HPZA 3WD1A 2V5DA 4G7EA 2RHGA 2DPEA 4WKFA 3W2KA 5EB8A 5D9MA 3WLNA 3W38A 3MJYA 7XIMA 2H90A 3TA9A 4MADA 1S3HA 1ZU8A 1OSEA 3INPA 3W7RA 1F76A 5ECVA 4ZVJA 2CEQA 4GG9A 3TXZA 3IJ6A 3W76A 2BXYA 1LORA 3T05A 1WE5A 4AFYA 2V6AA 1V0NA 2R1MA 4GIRA 3LHWA 2GDQA 2WAGA 2VZUA 1HQTA 3I68A 3GTIA 3W82A 2E67A 2VX5A 3NPWA 2OCZA 1SJDA 3KBMA 2FIQA 3O0FA 1P6BA 2G4JA 2BP1A 1MUCA 2WLZA 1K8YA 1QNQA 3T55A 4IL2A 1H2JA 3ARWA 1V03A 3LMZA 2AGKA 3A21A 3CEUA 4H7CA 4JX5A 4TVDA 5LA1A 3VTRA 5T91A 1DPMA 1JJKA 2WHLA 3W71A 1XJBA 4CD8A 4JIIX 2E09A 1HP5A 3AROA 3GFZA 2RDTA 3BG5A 2GQ3A 4Z2IA 4N9BA 2J88A 1BTMA 4GIYA 2WC3A 2BY1A 4I5RA 5A6BA 4JBRA 1X7FA 2OEMA 5CAKA 1BPLB 3Q37A 4B3LA 2XGZA 3BV7A 4GUJA 5LHEA 1GKQA 3GNXA 4CN6A 3OLEA 4S3KA 2ZRYA 2A6LA 3CMFA 4L6OA 2B7NA 4US5A 2B81A 4X22A 1E4NA 3KDNA 1GK8A 1MFVA 3BL3A 2AMXA 3SAZA 4DJDD 3LCGA 3KTCA 5E6ZA 3T78A 2J78A 2OZ3A 1OVDA 3IWPA 3CLWA 4CLMA 3AWNA 4ZXLA 1OK4A 4N9EA 4R53A 3QR3A 4FXFA 2PGFA 2O55A 1F74A 5JVLA 2BVWA 2ZXDA 3E6EA 3H2OA 3W7IA 3VGGA 3CUZA 4NZCA 2A5HA 4IFKA 1PIIA 4E6MA 1GVOA 2ESCA 2GJRA 1SJCA 3DC0A 3VKBA 3NIYA 4HU4A 4KWWA 4FB7A 2OVLA 3AI0A 3K4DA 1D8WA 5CC7A 1KFWA 1G7VA 1KM2A 3PAJA 1J18A 1K77A 1QDSA 4HPJA 2GJNA 3OOQA 1A5BA 4JS3A 4JNZA 3SADA 1EGVA 3ZLGA 1E9YB 3MV01 2WPBA 1MNSA 1WDPA 4LB4A 3S5NA 4FOUA 3RU8X 4UTLA 3DG6A 1VFHA 3FEQA 1LTDA 5J04A 3ARYA 2ZXBA 3FNDA 1TPEA 4KIEA 1BF2A 6ENLA 1UWAA 4MKNA 1MW0A 1G1YA 4JFVA 1E70M 5KSWA 2BBFA 3GKAA 1J0YA 2E3ZA 3LCIA 1AFSA 2R94A 1OGGA 1CZ1A 4H9YA 5I77A 4H41A 1Q6RA 4FLRA 1ZJAA 4ML9A 4RR4A 4L4OA 4O57A 3WNMA 1LQAA 3TV8A 4FNUA 4LF1A 2E1WA 3S46A 1M7XA 2JGQA 3EA2A 4H2CA 4BQ5A 1SM9A 3LXCA 1EO5A 3M46A 4EWJA 3O8AA 5FA5A 5G1YA 4DBEA 5ABTA 2GDVA 1UIPA 1UKSA 3WLRA 3TTOA 1J5TA 1V3KA 3CZGA 3T0BA 2A1YA 3H2CA 4W86A 2IPJA 4QE5A 1PDYA 4QP0A 1DP0A 1KXQA 4JDBA 2E5CA 2OYMA 3H2FA 6PTDA 2P53A 3EYPA 3CEPA 3LCXA 3N4FA 3MCOA 3RF9A 1SPQA 1UWRA 4GMEA 2V69A 1RLCL 3NFUA 3T2PA 2C16A 3MPGA 4NYUA 3AWOA 1UA7A 3GR8A 1M53A 4GCAA 3OTRA 3ARUA 4UXDA 1V3JA 2WWCA 3MUY1 3S9ZA 3LHVA 2H9AB 4R9XA 2NW0A 1WQ5A 1ZJHA 4OBSA 3B8WA 1G67A 1LLWA 4OGZA 1UUQA 3LOTA 1OADA 4Y8EA 1L6SA 4CQDA 1RZMA 2V3GA 3OZPA 1K4GA 4KGLA 3AHYA 1Y7VA 3H21A 1RR2A 1DIDA 2ZA1A 1DBTA 2G50A 3VKJA 4EANA 1F6YA 5CBBA 5A3HA 3F2CA 3QMSA 2W67A 3EEZA 4Z1CA 1K9FA 4Q8NA 1A3HA 2WMHA 2BXZA 3AHTA 5DMLA 2X7VA 1C7SA 5DCBA 2QAFA 3T2QA 3WUEA 2RDUA 5HQEA 5GNYA 3E1F1 4MVAA 1NAL1 1PCWA 3GXDA 1EEXA 3CAKA 5DRCA 3ITXA 4LAKA 4DLFA 2P88A 4QE4A 2QW5A 5LNRA 1KKRA 2QKFA 2VQTA 2R1KA 4GO8A 2JIWA 3FW6A 3UCQA 3W1TA 3CTTA 5AVNA 1PL9A 3QR1A 2Z1SA 4L64A 2J8GA 3BG9A 1XLBA 1BYAA 1JXKA 1A0DA 3BMWA 4J5NA 2FQIA 3PBUA 4AWUA 1CPUA 1XH0A 2VOMA 1VYPX 2GFTA 1J10A 4A8LA 4HA1A 2BASA 1PYMA 5FSEC 1TVNA 2ATSA 3GU2A 3W86A 1KXTA 3WQ5A 5G4WA 1WDSA 1P0BA 3M0LA 3AIWA 2NQLA 4ONVA 3GSMA 4ZL1A 3A5VA 2I5GA 4UWMA 2POZA 3SQMA 4Y9MA 3D5HA 4RJEA 1SZEA 2CBIA 5EGRA 3NQAA 1VP5A 2Z27A 3KEHA 4XZBA 4AF0B 3T0DA 3S6OA 5A95A 7REQA 4O0ZA 1TMLA 4AEEA 1TPH1 3EMZA 4IMAA 3UWVA 4MZ8A 5DMYA 5K4XA 4JTJA 3C0QA 1M68A 1WZAA 3O6AA 4FS9A 2GSHA 1KCKA 3GYCA 1TUXA 3GTFA 2XZ9A 2P3EA 2QF8A 2BS9A 3FYYA 4DZHA 3MSGA 4YWSA 3W1QA 2DT2A 4DJDA 1EUNA 4Y7EA 1EA9C 3CIWA 1W1A1 4EWND 3TC6A 4QSFA 1G6CA 4NZ4A 3FFSA 4J3VA 4O1DA 2R82A 1BG9A 4DJFA 4OE7A 3SRFA 3AAMA 1UJPA 5BXTA 3WDIA 1H61A 3CO8A 5AC7A 3FHQA 3W07A 2QCEA 5DQPA 1E4MM 2BGNE 3QSRA 4BWLA 4NNAA 2ZRWA 3RLVA 3VYLA 3SCUA 1S5TA 3UY8A 3RILA 4MJ4A 1VKFA 4GQRA 5LGZA 3NGJA 4GXMA 3QJAA 3UJFA 2ZUWA 3V5FA 3QQ0A 3KZSA 2UBPC 1S5NA 5C9RA 2EPHA 2X0SA 1SW7A 3PS7A 4HK6A 2X1UA 1PSCA 5TD4A 4YPJA 1Q7MA 1P1MA 4P7LA 1BKSA 4JCMA 3RCNA 3AOFA 3DGRA 2CKRA 4QM1A 4FX7A 4UCGA 4FPSA 3ZLFA 3CWNA 2DVUA 3KS6A 1BWKA 3AXHA 3THCA 2XVKA 2ZUSA 3MO7A 3W1NA 3KBNA 3LQGA 2VM8A 1DIKA 1KM3A 2PWVA 4XSLA 4PRTA 4QJ4B 1REQA 3LCWA 2I57A 1GOQA 3LPPA 4JHOA 1QWKA 4NRRA 4AHPA 2VT0A 5CSSA 2VX6A 5F7UA 3SCOA 5FD0A 1NVMA 1RV8A 1RALA 3A6OA 3SN0A 3QHMA 5L6UA 5DXYA 1EQCA 1Q4NX 2WV8A 2IS7A 3VNMA 5FKYA 4E8DA 2AQOA 3UP8A 1YTKA 3VNKA 3QZAA 2I1OA 4L4MA 1VB9A 2OQLA 4FA3A 2QCLA 1UCWA 1M6JA 1M03A 1CW2A 5BW6A 4WY0A 2ATMA 3QMRA 4A29A 3S9IA 3NM3A 1FWNA 1F6PA 5TNVA 4J1OA 2Z4GA 4PN2A 1XRFA 3GX9A 3G0SA 4N6EA 4BEQA 1U5HA 3DZ1A 1AL7A 4E38A 1JYVA 6ALDA 5ABFB 1GW1A 5D9NA 4REQA 1A5MC 1UOKA 1NM9A 4JFTA 4I90A 5FF7A 2WNQA 4NZ1A 3U3HA 3VD4A 4TVUA 3H23A 4XUYA 2NT0A 3DG7A 5SWUA 3TTEA 1US0A 4HSHA 3DOPA 3CMJA 1YADA 1JVNA 2ZUUA 2FJKA 5FESA 1JI2A 3GDLA 4H8VA 3SR7A 3DFYA 4M6VA 4DYKA 3AIRA 4FOJA 3H4GA 3PFMA 4UQ9A 3WBXA 3FS2A 4XB3A 1DL3A 1XBXA 1FDYA 1F05A 3VOJA 1GZJA 2INEA 4QEEA 4DRSA 1H51A 2PDUA 3ES8A 3VGEA 3ITYA 3OLIA 4IT1A 3G24A 4ROPA 1R3SA 4D8AA 4NJGA 1WPCA 3OBKA 2A7PA 4IMGA 3K4WA 1E3XA 3EAUA 1HKWA 5B7ZA 4L9ZA 3U5YA 1X6LA 3M43A 2HQAA 5D33A 2BX7A 4DEFA 2ZDSA 2HXUA 1UR4A 1XUZA 3B05A 3TCEA 4AD1A 1DVJA 1EBGA 2F7FA 1IIHA 3NUKA 1Q4WA 2E8ZA 3NQBA 4MZYA 3NQDA 1S2UA 1N8WA 3UBPC 3OYXA 3QZ6A 5C9WA 1NF7A 1YDNA 3VZZA 1ZFJA 4GRSA 3SUUA 4RNJA 3W1AA 1MEWA 3EDKA 1CWYA 3TCSA 1WYIA 2YOCA 3QC3A 3LGGA 3QC0A 3ZJ7A 3AMLA 3M0YA 1XLLA 5G2IA 3S2JA 3LK6A 2FGBA 4EF8A 1Q6OA 2XIBA 5CBIA 5TQLA 4D1IA 5C2GA 3LBOA 3M6YA 3UG4A 3P0XA 4C6QA 4J2MA 3PTDA 1TWDA 4MDPA 5FJOA 5HR6A 1EA0A 5LNUA 2J8FA 3A3WA 5G2HA 2XN1A 4JTEA 1FA2A 3VX1A 5MHBA 1RY8A 4IQDA 2J66A 1XPYA 2TAAA 3N6QA 1GZGA 4JQ1A 1T8QA 1QAPA 2HK1A 4TO8A 5TAOA 3TJLA 4TX9A 3TC7A 1I75A 2EG7A 1JG9A 2VC7A 4LS1A 4UR7A 1OYCA 3TKFA 1ICPA 3AQUA 3D6NA 1YTEA 3F1QA 4OWGA 4ATLA 1HT6A 1Y65A 4LEQA 1WA3A 4HN8A 4C1LA 1ME7A 2PF8A 1WB0A 2FDSA 1HO4A 1ME8A 1QNPA 3L0GA 4FP1A 3CUIA 4I5UA 3L7RA 2E68A 1UC5A 4I6VA 5HJXA 4W9TA 3PG8A 1ZGDA 2DIJA 4ILSA 4GUFA 1J2BA 3IS4A 2R91A 1ZHAA 2ZA3A 3WNNA 5KEZA 4RX0A 2YB4A 3VNLA 2RUSA 4H6EA 2PWFA 2FFIA 3RAOA 1IWAA 4FZIA 5BRBA 1LZOA 4LAMA 2PDNA 4NXKA 5KTLA 1XC4A 1LG2A 2DT1A 3MBFA 2XUCA 1VZWA 3UR2A 4Y9NA 5GNXA 2FVMA 4WGXA 3IACA 2GSEA 1A50A 4R88A 1UKTA 4NAFB 3CAQA 2CU0A 4HHLA 1EL3A 3UG5A 1GOOA 3BLDA 3IVUA 2Y1HA 3P6LA 5CLWA 4NG3A 3OEXA 4I7WA 1MUWA 5FEZA 4FLSA 4O15A 3QPYA 1KTNA 3W29A 2TPSA 3FXYA 5IDZA 3LBCA 3TTSA 1M7JA 1TX0A 2DZXA 3LRLA 2VURA 5I2UA 1M65A 3W2MA 3OG2A 3FJLA 4JN8A 2OSXA 1MRQA 5HNNA 4ASTA 3LCHA 3HG5A 3UWEA 3TX9A 1DWIM 1TPFA 3A5FA 3VDCA 4EX4A 1HFBA 3O6YX 3TVAA 4IXXA 4TUFA 5DXXA 2FGLA 3NR0A 4A3YA 2NLYA 3N11A 2G95A 4QS6A 2UWFA 3NG3A 2VHLA 3K8MA 2CYGA 1SGJA 3P81A 1R47A 2GQAA 4J27A 3DFTA 4ZMGA 3W88A 3MI2A 4MNLA 1O7AA 4PULA 3OZMA 2A3AA 1QHZA 4HBKA 4CNPA 3UZYA 1H1NA 3L4WA 3LPGA 2PWDA 3MI3A 4E2OA 3PZUA 3D0CA 4P2VA 2VUYA 2OMAA 3DFSA 5C55A 3E5PA 1OGBA 4RPPA 2NQZA 4MFDA 4W8LA 4S2CA 3MVTA 3C4UA 3T2OA 1JYNA 2YLLA 3ISIX 1MEIA 2DZTA 5CPLA 1QHOA 3SY5A 3B06A 3WBYA 1S5WA 3I7SA 1OF6A 4GKLA 3RU6A 3SRDA 2FZMA 5CSYA 3UZXA 5A8NA 2EPNA 4QAIA 1HJVA 1LQ2A 4P7OA 4KCTA 2WSQA 5AZ0A 4Z2KA 1JUBA 2PWHA 4GYFA 4O17A 5CPQA 3AHVA 3GD6A 2XM2A 1XGDA 4CEUC 3HJZA 1BYCA 1QCWA 2P8BA 4M8UA 4BQ3A 1LROA 2W0UA 2KZHA 3H7RA 5CBJA 4IGNA 3Q4DA 1Z42A 1C7TA 4V1XA 1BKHA 2GGEA 3GH7A 3MMUA 3BZJA 4RE2A 1PZ2A 3UXDA 4WDUA 4KWVA 3HTWA 1BVWA 2A4AA 2PPGA 2VNCA 4INFA 1GG1A 3DFQA 2VEPA 4HU0A 3TYUA 2AKMA 2D0HA 3MHUA 3I6TA 5M1TA 3UCCA 2VR5A 1WZMA 1QPNA 1F3XA 1YBQA 1XYMA 3R79A 4XVEA 3H53A 4HIBA 4Q8UA 3ARZA 3GFYA 2HTMA 3TYEA 4H6QA 3VFLA 4DWSD 1E56A 3QQWA 3MA8A 2X2YA 1WUFA 2ZZ5A 2WSKA 1P0EA 5CPOA 1PO9A 4AZGA 4AMAA 1S2VA 4I6KA 3SN4A 8CGTA 3ZWSA 4R5EA 3KTSA 1UWSA 3UJSA 1HJQA 3W2JA 5LA0A 4PMRA 2VC9A 1KC7A 2WZTA 3GLCA 3LERA 2DUXA 1Z48A 1LJYA 3RX3A 3BLOA 4PMJA 2CESA 1HW6A 1XHGA 4ZENA 1JCMP 2I14A 1ZAHA 5I09A 2CLPA 5ECUA 4X2PA 1G4TA 3KBVA 3HZ3A 3MB9A 4DJED 3I3EA 3GKFA 4G7EB 3KL3A 3E2VA 1BHGA 4ZSUA 2Y7DA 1JYXA 1IV8A 1F3TA 4LVGA 4M7SA 1J0ZA 4AX6A 4JPGA 1R3VA 4HU8A 3VDBA 4DAFA 3K4AA 1E43A 4KQNA 5K9XA 4GGBA 1MMFA 4A8IA 1GQJA 1KQYA 3KP0A 1ADOA 3NEHA 4ZB5A 4UTIA 1Q3NA 1AQFA 4BI7A 4HNLA 4AUBA 3GHSA 4GCXA 2SFPA 4AXNA 2YB1A 4W8AA 1JULA 3WMBA 4LCRA 1QVBA 3RJYA 1EHAA 1OFPA 3WX7A 3DX5A 3U8GA 3WNKA 4MIMA 2CNCA 1IEIA 1FHUA 4M0XA 5GJMA 4TMCA 2Z28A 2VDIA 1VLIA 3W7LA 4S3GA 2RJGA 1X1ZA 1XYAA 3VIOA 2J13A 2GDUA 4PFMA 4C6CA 2Q09A 4BZYA 2FH6A 3KVJA 1RUSA 4W5UA 1A5KC 3EEGA 2ABBA 1UQZA 2AOSA 5CAHA 4NRSA 5LIUX 2EJAA 3O6CA 3RO8A 1FWCC 3E5BA 5HUOA 1BXBA 1DTUA 2HV5A 3DYMA 3DG3A 4XZNX 2OQHA 3M16A 4OV9A 3UG3A 3HGJA 3JS3A 3S5YA 3VGFA 5G1TA 1I9CB 3NDOA 2OWWA 4AMCA 4BY3A 2PTDA 1QO5A 1NOFA 3DENA 3LA4A 5F1UA 2B7QA 1JCJA 1SFLA 3ZJ8A 2Z26A 4Z1AA 3EA3A 3W24A 3T81A 4PBEA 1KBLA 3JW7A 3KDOA 4R7JA 3ALFA 3DI0A 3L21A 5EPDA 3QOKA 1AD4A 3W7NA 4O13A 3QRHA 4DF0A 1EIBA 1XLMA 3AXMA 3NZRA 3EWWA 5C7VA 4FNSA 2VX7A 1BXCA 3P8IA 5TBOA 3EDJA 3RHGA 3W4RA 1DOSA 3CQHA 1GYLA 3BG3A 2CLHA 5HDRA 3DYPA 2WXDM 5HANA 1S3TC 3LV5A 1MQRA 1B3WA 2DIEA 3SCVA 4X9SA 1J0HA 4M19A 1QHPA 2QZRA 2YGYA 1H09A 2V81A 4IFKB 5I03A 1QPRA 1J93A 3NYZA 4KS0A 2F8QA 4IJCA 1RSCA 4XKMA 4ZGYA 5HPCA 1VJSA 5EA9A 2ZBTA 3S42A 1S46A 4CD4A 5DFAA 4PB4A 1TVPA 3H22A 4LUSA 2V9DA 3POHA 3UG8A 3LI1A 1YRRA 4W4QA 4TX8A 1MXDA 1E6PA 4MF4A 1XI3A 1DJWA 2UV8G 5F2IA 2OYLA 4WXZA 3PNZA 4KBXA 4DXXA 2XN2A 1NOUA 1J12A 1EUAA 3AZSA 4K8GA 3SURA 1VAHA 2V5CA 2GWGA 5H8MA 3APTA 4O12A 3DXIA 1HP4A 2MUCA 1XM3A 1WP6A 5HULA 2PFHA 4MWAD 1A49A 2X09A 4ZEPA 3WNLA 1NTHA 3VCCA 4DHGA 1E0TA 5A2BA 3NL3A 3SM0A 4C6BA 1FWHC 1IE7C 1FKWA 1VH7A 3VIKA 3D46A 4JX4A 3WK0A 3G77A 2R8WA 4V15A 4AZCA 1S38A 1UQYA 2CHNA 2ISVA 4E0CA 2YBUA 1EIXA 4Z2JA 2QEZA 1JPDX 2W4XA 4UTWC 3E9AA 5LIYX 2J8TA 4RXFA 5CPSA 1GONA 3AXIA 1Q6EA 3V0TA 3SIZA 4DWSA 3UJRA 3CIXA 4ZOAA 2TODA 1QI3A 3DBPA 1GHRA 4F0KA 3HQNA 1YPIA 1KCZA 4LANA 2NSOA 3WDRA 4W84A 3TSMA 1TG7A 3VZXA 2D2HA 3CU2A 3EX4A 3DFOA 3BUVA 4JNYA 4MPKA 4JL1A 2DORA 1LM1A 3CJPA 4M6PA 1I2OA 3DDMA 1V6UA 5BWFA 3CTLA 3BWWA 2WC4A 1PWMA 2OO0A 3KM8A 5CGTA 4HT3A 1V7YA 2YX0A 4K8EA 1XWYA 5FF0A 4AVOA 1CYGA 1TJPA 3TN4A 1R9ZA 1ZL1A 1UR1A 3WDJA 3S83A 3P60A 3AXXA 3STGA 4DJEA 3TOYA 1QOQA 5A94A 1N8IA 1LRNA 2PDQA 4FO4A 3QYSA 1KTBA 4DF2A 4V1YA 4DVOA 3BDKA 1XRTA 1L2QA 1KM6A 3AZTA 4CQ8A 3W6YA 4EAMA 4H8NA 5CG0A 1MO0A 1J5SA 4JGDA 1XIEA 3CQJA 5LXXA 3DECA 1FCQA 1UWTA 1UD8A 2Y6ZA 2NXHA 3B04A 1N8FA 1Z9AA 4OVXA 2Q71A 3WUBA 3W87A 2YFNA 2PU0A 4GZEA 1E5NA 1NARA 1GQLA 5D32A 3B40A 1HKMA 2XG9A 4FHAA 2YLAA 2BHYA 5FJJA 1CGUA 1KBBA 2I7GA 4J7RA 1GHSA 1PWLA 3UWQA 3O6DA 1N55A 3WLOA 1TV2A 4KMQA 2A0NA 4X61A 2OKOA