4AXNA

Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the serratia marcescens chitinases
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
DDAAIMPSIANKKILMGFWHNWAAGASDGYQQGQFANMNLTDIPTEYNVVAVAFMKGQGIPTFKPYNLSDTEFRRQVGVLNSQGRAVLISLGGADAHIELKTGDEDKLKDEIIRLVEVYGFDGLDIDLEQAAIGAANNKTVLPAALKKVKDHYAAQGKNFIISMAPEFPYLRTNGTYLDYINALEGYYDFIAPQYYNQGGDGIWVDELNAWITQNNDAMKEDFLYYLTESLVTGTRGYAKIPAAKFVIGLPSNNDAAATGYVVNKQAVYNAFSRLDAKNLSIKGLMTWSINWDNGKSKAGVAYNWEFKTRYAPLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hallmarks of Processivity in Glycoside Hydrolases from Crystallographic and Computational Studies of the Serratia Marcescens Chitinases.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords CHITINASE C1
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4axnA00
4TTUA 1JDCA 4B15A 4MB1A 4DUWA 3SURA 4J28A 1UUQA 3VD4A 4OUEA 1C3FA 4W87A 5FKYA 1WCGA 4HTYA 1BPLB 2CNCA 1UWIA 1XHGA 1HVQA 4BCEA 3FHAA 4WKAA 3L4WA 3W6MA 2QLYA 4DM2A 2ZXQA 4PMRA 4MB3A 2UY5A 4CD7A 1J18A 4OZOA 1QPKA 1UYQA 3OLEA 3EBVA 1NOFA 1W3JA 4IISA 3ARTA 2HVMA 3PN8A 1V0LA 3U57A 5HXMA 1UR4A 1TR1A 3T08A 2BY2A 1VBUA 3BMVA 1EOKA 3MUAA 3G6MA 4H2CA 4W8LA 2O9PA 4P8VA 3WDIA 3M07A 1JZ2A 3ARXA 2IXUA 1BF2A 1W9UA 4KGLA 4WKFA 5CG0A 3BCDA 1GOKA 1W3KA 4ACYA 1MXGA 4FF5A 1FOBA 1CXLA 1M53A 4UQ9A 1U30A 3I3BA 3J7HA 2PB1A 3VKKA 5BXTA 3PZQA 1BGGA 1CXHA 3UG4A 1EDTA 5I23A 2NT1A 1W9VA 3GXDA 1BTCA 5A1AA 4P7QA 3BMWA 3CUIA 3ARUA 1FFQA 3EDFA 2OYLA 3WMCA 1BAGA 3BAXA 2PC8A 3WNNA 4BQ3A 3U7VA 1QI0A 1UWUA 2Z1SA 3CH9A 4W7WA 1UA3A 5DF0A 3ARSA 4KMQA 2E3ZA 1QHZA 3MUIA 1AVAA 1BVNP 1FFRA 1VBRA 4HPHA 5A6KA 3BSGA 2QPUA 3JUGA 3GNPA 1QHOA 1BGAA 1E72M 1OINA 1KXVA 3ARRA 3A47A 4AZCA 3VM5A 1FHLA 3LPGA 2XWDA 1JZ5A 2DIJA 2YL6A 1CGXA 5BRPA 1JF6A 1E0XA 1FHDA 2WMHA 1CIUA 1JD9A 3VTRA 3WY1A 3FN9A 3I3DA 3W53A 1HKMA 2CCRA 3VMNA 1VEMA 1KR1A 4OKDA 3SCPA 2WMFA 4M1RA 4GI6A 1E1EA 2B31A 4J3UA 4R27A 1GONA 4UFIA 1JI1A 1QI3A 2CHOA 2XSAA 3UERA 5HOSA 1PZ2A 1OGSA 1QOXA 3WD0A 4M29A 4CGTA 4WSKA 3UG3A 2VVNA 1OCQA 4LX4A 2YDSA 3ECQA 3ZO9A 4Z2KA 4UFHA 2V38A 3L2MA 1WDRA 3CGTA 1W2VA 2FH6A 1W1TA 3GH7A 2V3EA 3A3HA 3LPPA 2EPOA 2OSYA 4GIAA 3WFLA 3FAXA 3W27A 1TUXA 2V5DA 4P7NA 5A8NA 3PTKA 1HJUA 5LA0A 5M5DA 4UQCA 4OOZA 3RM4A 3EDEA 1TG7A 1Q6CA 1XYFA 3ZQ9A 1GUVA 2G3IA 2JF7A 2G3MA 2DDXA 1JYXA 1V3LA 4Z2LA 2BVDA 1CGVA 1MWOA 4JFVA 4P7LA 3F5LA 4AMCA 2VX4A 2VZVA 1V3MA 1ZBWA 2D0HA 1SFSA 3DYPA 1XV8A 3GNRA 4HOZA 4BQ5A 1CWYA 3VUPA 1CXKA 1K9DA 3PHAA 5M03A 2C8NA 4A3YA 4AZ7A 3MSGA 2G8ZA 3AOFA 1ZB5A 1HVXA 3K1DA 3VM7A 1UH2A 2V5CA 2WZEA 1CDGA 3RCNA 1HJSA 3WDHA 3GM8A 3W0KA 4HZ6A 4N42A 1XC6A 4ZENA 3THDA 3WH9A 1JGIA 2VUYA 3WNMA 2XFFA 1H09A 1VEPA 1XCXA 1L8NA 4HU8A 2AAAA 3PZTA 3KL3A 5BWFA 3AIBA 3EDJA 4GI9A 5C71A 1UKQA 4A4AA 6CGTA 2A3BA 4U3CA 1XCWA 5HNNA 3NSXA 1JZ4A 3W4RA 3PBGA 5JBEA 1LL7A 4J3WA 4CCEA 4PMQA 5KEZA 3CUHA 1MW1A 5AC4A 2F8QA 1RP9A 1FH9A 1DWIM 3BC9A 2J7DA 3B9EA 4D72A 2ZX8A 2WHMA 1M04A 1XYZA 4PMNA 3WDQA 1X1NA 1E6NA 3POHA 5AC5A 3GYCA 1GZJA 3FW6A 4GXPA 4MDOA 1V03A 3WQ5A 4RE2A 1EO5A 3M7SA 1RH9A 1LWJA 1UH4A 2CKSA 4PTXA 3VD3A 3WDRA 4MNMA 5LA1A 2WANA 2CBUA 5DO8A 3W6LA 1TVPA 1B1YA 1NWTA 3B9DA 4FK9A 4WSJA 2EO7A 4PMXA 1QBAA 1W1YA 1TCMA 1GQIA 4TXEA 5D9NA 3AJ7A 3SCSA 1HJVA 1UOKA 2JFEX 2WWDA 5ABHA 1VEOA 2GJXB 3RO8A 1S46A 1WKYA 3VIKA 2JIWA 2VL4A 3AHVA 5DFAA 4BQ2A 2EBNA 4D1JA 1D7FA 1ZJBA 1P6WA 1E71M 4XZWA 4MB4A 1TA3A 3IJ7A 1NM9A 3GXFA 1PIGA 5HPOA 2CITA 2J8FA 4M8UA 1R8LA 2ZUTA 1CXIA 4MDPA 1JNDA 2VZOA 3A4XA 5C8BB 4LYRA 3BAIA 1Y7VA 4MTVA 1UR1A 3SCRA 2DSWA 1EH9A 2C7FA 1R86A 5FOOA 1UQZA 2WVVB 1J0HA 4HP5A 4TTGA 3L4XA 1E56A 5CGMA 3M6DA 3SUVA 2WPGA 3EYPA 1HT6A 4OBRA 3MMWA 1ECEA 5CZKA 1J0JA 2DQXA 2XPKA 4BA0A 2OWWA 4TOQA 3SEPA 2ZUMA 4QCEA 4CVWA 4IPNB 4EK7A 3VIMA 1SMDA 4JHOA 5EMYA 3CO4A 1B3XA 2CPUA 4R5EA 2XG9A 4C7DA 3E1F1 1OIMA 2A3EA 4F8XA 1V0MA 1MXDA 3AROA 3OGVA 5CSUA 5A2BA 4JL1A 2CXGA 2JEQA 2CHNA 3KZSA 2VZSA 5BXPA 1KGWA 3QHMA 1PX4A 3W37A 4Z2HA 2ZUSA 5IFTA 1MFVA 1H11A 3VIHA 4B3LA 5LYRA 3WQ8A 1PIFA 3DHPA 1BSIA 1SMAA 3AIEA 4ZXOA 1UA7A 2WK2A 4J7RA 5DT5A 4X9YA 3LMYA 4MJ4A 4MADA 3D5HA 4GZJA 2XTKA 3CZKA 1MYRA 2GDVA 6TAAA 1JXKA 1M01A 1NOUA 2W62A 4ZEPA 1E4NA 4W5UA 1JDDA 3M46A 4EANA 4ZE4A 2YLAA 4JKMA 3MUY1 3CZLA 1J12A 4UCFA 2WLZA 1C90A 1VENA 1CGWA 3AICA 3WD4A 5A2AA 4PN2A 2W63A 1F4HA 3ARYA 2Q8XA 4GINA 3PZIA 4JFWA 1W32A 2CEQA 3OLGA 5JBFA 3DYMA 2VX6A 2ZE0A 2NW0A 4PMZA 4H04A 1GJUA 3OB8A 4URIA 2J74A 1OT2A 1QBBA 1K9FA 1CGTA 5F7UA 1HXJA 1SYTA 3GTNA 1EGZA 1GCYA 3B9AA 1VIWA 2GK1A 4XUYA 4KGJA 2CYGA 3A4AA 3WL0A 5E09A 1GPFA 2A3HA 3F5JA 4W8AA 2VURA 4YPJA 1HF6A 1W3HA 1J9YA 2VQUA 3PZ9A 3HU7A 4TX8A 1EHNA 1HN1A 2G41A 4NZCA 1HIZA 1E5JA 2WHJA 3MMDA 4W84A 5D4YA 3VIIA 2PWFA 3K8LA 5E6YA 4OIFA 5A3HA 1BG9A 3VMPA 3CZ8A 4JL2A 3WEZA 1V3KA 5IHRA 4GO9A 3N9KA 3ARWA 1QNPA 4H7VA 1UR0A 2X0YA 3WL1A 2BFGA 3MO4A 1WE5A 3SCOA 3WSUA 3AHZA 5BYWA 1BYCA 4OBSA 1KCLA 1N82A 3AXIA 3AIWA 5CPQA 1MQPA 3WH8A 3WH5A 1BHGA 3TONA 3QOKA 4MJ2A 5E0FA 2WLYA 1VAHA 1ZL1A 5BCAA 2WHLA 3QGVA 1G9HA 1JAEA 2BNJA 1UWRA 1VFMA 3GXMA 4N0RA 2NT0A 4CCDA 1EIBA 1TZ7A 1KWGA 2UWFA 4HU0A 4XZBA 5ABFB 1HJWA 2EPNA 1E40A 3AMCA 4C7FA 2DSUA 2XUCA 5EFFA 5D9PA 2D22A 3WUFA 2XM2A 2W5FA 5D8WA 1PX3A 1I1WA 2CBIA 1VRXA 2DSZA 2FHBA 3ZM8A 1C8XA 1E0VA 1HJXA 5IHSA 4Z2IA 4B16A 2DT2A 2CESA 3GH5A 1FH8A 1MW2A 2CERA 4HA4A 5CXPA 1PZ3A 1W9XA 2O9OA 1E15A 3VPLA 2XGBA 2XM1A 3T09A 4M81A 1NARA 2DH2A 1X6NA 3CHDA 1DTUA 1NWSA 2VRJA 4JHZA 1ODZA 2DT1A 1ISXA 3A4WA 3ZOAA 1HP5A 3NDZA 3ZSSA 1JYWA 1CTNA 1UHVA 1ZBCA 3U5UA 3KE0A 2D1ZA 5FD0A 1UKOA 4TVUA 4NRRA 3TTSA 1AQMA 4UR9A 2VO5A 3UR8A 1DP0A 3VINA 3ZSTA 3IANA 2WBGA 3VNYA 3LPOA 1G5AA 2DSKA 3EMCA 2XGIA 1UWQA 2WM0A 1V3HA 4PSRA 4M24A 3ZMRA 4Z2GA 1XSIA 3W81A 2BV9A 1C91A 2X2YA 3WD1A 2YL5A 1UWSA 4YHGA 4JCMA 3AS2A 4P8XA 3BSHA 2X09A 4WJXA 3VIFA 5CLWA 3IJ9A 2JF6A 4MNKA 1H0IA 1ITXA 1G1YA 5DEZA 1V6VA 4CVUA 3DYOA 4PMOA 2O92A 3QR3A 3PZUA 4B9YA 2G3JA 2WMIB 1JZ8A 3WUBA 3WBEA 3S2CA 4PCSA 2WSKA 1LG2A 3CMJA 1J0YA 1V0KA 2XFYA 1MW0A 1Q4NX 3VDBA 2WHKA 2BXYA 1GVIA 2TAAA 1WP6A 2J79A 3ARPA 1EQPA 1JFXA 2EJ1A 4D6CA 2WMIA 1JFHA 2VMFA 3SCVA 5A6BD 1BVZA 9CGTA 3RMEA 1JG9A 2XVLA 4LGXA 3TTQA 4PEEA 3RDKA 4AIEA 2WW5A 2BHZA 4UFJA 2A3AA 1NP0A 3CLWA 4C7GA 4IUGA 4M82A 2AOSA 2V3FA 1MQRA 2QV4A 4AEFA 4JAWA 2MANA 3L4VA 1HNYA 1EHAA 1C7SA 3RJYA 3MV01 3WF0A 1MVYA 4UQAA 3IK2A 4JZ5A 4CD5A 4TUFA 2ZWZA 3IAQA 3GXIA 3N04A 5EBAA 1LJYA 3VNZA 1M03A 5JBDA 5FL1A 3MUZ1 3UETA 1J10A 4LPCA 3KWXA 2Y2WA 1LWHA 2WWCA 3AMLA 3O2LA 3TP4A 3W82A 1U2YA 3AIUA 1OSEA 4AZ6A 2GK1B 2CETA 1GHRA 1KBBA 2QMKA 2DH3A 4J27A 3WFZA 1C8YA 1JYVA 1J01A 3AISA 3WDPP 4YN5A 2E8YA 1JNEA 3VDCA 3CZEA 1QW8A 1JL8A 4A3HA 1CLXA 2WMKA 3DC0A 2EPMX 2FGLA 3TOPA 4EE9A 1WPCA 3NUKA 3ZIZA 1JXJA 1J0IA 1JF5A 3CUGA 4DUXA 2VR5A 2CBVA 5I77A 3SCQA 2WAGA 4MNJA 3APGA 4D6EA 2O9RA 1R7OA 2D24A 3WQWA 3AYRA 5LA2A 4AW7A 2BS9A 1E4LA 1TA3B 3OZPA 1QNQA 1US2A 4AIUA 2VR4A 4PBGA 2GJRA 4GO8A 3UESA 2FGZA 3UEQA 4HOWA 5I0DA 1GQLA 4U33A 3ZJ8A 1A3HA 2W91A 3SCWA 1KFWA 3GBDA 3T2QA 4XV0A 1QVBA 2X05A 4MPKA 3AHXA 2OLHA 1CPUA 4D6GA 1CBGA 5HBFA 3GDBA 1GOMA 3FHQA 2E4TA 1WZAA 1UD8A 2VT0A 1UG6A 4HA3A 1KQYA 4QLLA 5A6AA 1I75A 2VZUA 3AQUA 4W85A 4AY1A 1GOIA 4RL3A 2WVUA 1V08A 4AC1X 8CGTA 5D9MA 4ATDA 2YKKA 2OYMA 3IJ8A 3AMDA 1LLOA 4EKJA 3DHUA 2WC7A 5GPRA 1WB0A 1XSJA 1JZ3A 1C8QA 3PZOA 1OBAA 2ZUUA 3T2PA 1NWRA 3BAJA 3W24A 1K9EA 3O6AA 3MMUA 2DSVA 1XH0A 4V27A 4F79A 5CQ1A 2D0GA 3F5KA 1UWTA 3CZGA 5AYIA 2XYLA 1E6PA 1IZJA 2WCSA 4U2ZA 3WNLA 1QW9A 3F4VA 4W93A 2YBTA 4P8UA 5I79A 3L4ZA 2VRQA 5A6SA 7TAAA 4J3TA 1V02E 4PMUA 2J7FA 3SCTA 4HPGA 1DWGM 1K9TA 3SUUA 2YIHA 2UY3A 4B3KA 4UOQA 1E4MM 2PBGA 4AISA 3VMOA 3UCQA 4AWEA 5I2UA 3K4DA 4UNIA 4DM1A 2WMGA 3AZRA 2YDQA 4D1IA 4H8UA 3RIKA 2V3GA 1XH1A 3AIRA 2G3NA 3VU2A 1HKIA 2GJXA 3TTYA 4L4OA 1DWJM 5BROA 1CECA 2DEPA 3EDKA 2VC9A 4EAMA 2XWEA 1KXHA 3UG5A 3PZGA 5ABEA 2W67A 1W1PA 3CIVA 5ABFA 4JFTA 5A6BA 2F61A 2E9MA 3AXHA 3PTQA 5GNYA 3VGGA 4ATWA 1D2KA 3T0BA 2QHAA 4M56A 4B9ZA 1OM0A 3AIVA 4CD8A 1E3ZA 4U5KA 1GJWA 4ACZB 3VGHA 1WDSA 4UFLA 1CGUA 3N17A 3BAKA 4Q22A 1UR9A 1UZ4A 4KRTA 3ZT6A 4BF7A 3WF3A 3AMKA 4AZCB 4S3KA 1QNOA 1PAMA 1Z32X 2YL9A 2BVYA 1BYAA 5HPCA 3N1AA 1BG4A 3WN6A 4FLSA 1B90A 1OT1A 4JFUA 4E8DA 4PCTA 2WZHA 4UFKA 1G0CA 4F9DA 2XHYA 4NRSA 4ML4A 1HKJA 2W92A 4BZYA 3VD5A 1KGUA 3NSNA 3K8KA 5ECUA 4PUDA 4H41A 5M3WA 2WKLA 4CUCA 1FA2A 4PMDA 3BLPX 4UZUA 1K6AA 2D2OA 3CUFA 4W88A 2ZUWA 3W26A 2D3NA 4LYPA 1Q6GA 3RPMA 1JYNA 2D23A 5CPSA 2WNWA 4HMCA 4CCCA 1H3GA 3UR7A 1PBGA 1E0WA 2Y8KA 3CHFA 2JEPA 3BLKA 4AZGA 4J3VA 1R87A 4JKKA 5IXEA 3GNOA 4OJYA 2J25A 2DPEA 3WF1A 1KXQA 1C92A 1IT0A 1GOQA 4U31A 2J7BA 1UKTA 3VD7A 1XRVA 3WUEA 1H2JA 3GBEA 4U5IA 2GDUA 1BYBA 1CEOA 4E2OA 4W5ZA 1D3CA 3VDAA 1HX0A 3MU7A 5E9AA 2GUYA 1NOWA 4P7OA 4HZ8A 4JCLA 5E6ZA 4P8WA 2FHCA 1B31A 1Q6DA 2GFTA 2IXVA 5EFDA 2Y8VA 3K4AA 1M7XA 1XH2A 4PYSA 4FLRA 3VO0A 5ABGA 1KR0A 1J11A 2WCGA 4QLJA 4UQDA 2CBJA 2VI0A 4ATLA 6A3HA 2C0HA 5A95A 3VIGA 2PBOA 4BQ4A 1E9LA 3L4TA 3A6OA 3WMBA 4WK9A 2WVSA 3O9NA 2UY2A 3AHYA 3AS1A 2VJXA 1IZKA 5CGTA 1ODUA 3VGEA 1ZBVA 1ITCA 5GQBA 5A8MA 4H8VA 4WLCA 2DIEA 1QI5A 1W91A 2YJQA 4D6DA 4AZBA 1MQQA 2WYSA 2VRKA 1B3YA 2JIEA 1HL9A 2VTFA 1B30A 1EOMA 1B9ZA 4AD5A 4UQBA 1OWQA 4Y7EA 1C93A 3MKKA 3PZNA 1NWUA 1ISZA 1OGBA 1GOWA 4PMYA 4UQEA 4WKHA 1JZ7A 1J0KA 4UZSA 5I78A 1GQJA 1HKKA 2J75A 3VILA 1E3XA 4PMVA 1XD1A 3ZJ7A 1QHPA 5JIPA 3TTOA 5TD4A 3N12A 2RGLA 1GORA 1IV8A 2W66A 1G01A 1ZJAA 5I5RA 2PWEA 5IDIA 3N15A 4QCFA 3WQ4A 2BXZA 3AYSA 4RE3A 3HJEA 5C70A 1JAKA 3AZTA 1UR2A 1QI4A 4AD1A 4MNLA 4AZ5A 3ZJ6A 1EDGA 2YL8A 3W38A 5GNXA 3OGSA 1H49A 4KWUA 1QNSA 2J77A 1WAWA 1RPKA 1AMYA 2Y4SA 4MB5A 3WEMA 2XVPA 2PWDA 4CU7A 4S3JA 4AZIA 4D6FA 1WZKA 1ESWA 3QOMA 5A6MA 1TMQA 1VF8A 3BAYA 5CLTA 4DUVA 2CIPA 2X0HA 4IM4A 3SUTA 1E6QM 4QDMA 2CKRA 1E4IA 1H0GA 2XVGA 1TVNA 1ZS2A 4GI8A 4LQ1A 3FXYA 4AZHA 5FCZA 4OOUA 4CKQA 1GW1A 1KCKA 4UFMA 3OA5A 3MSDA 3PTMA 2XIIA 3ALGA 1UKSA 2EPLX 3OZOA 2Z1KA 1GHSA 1O7AA 5GNZA 2VZTA 2ZXAA 7A3HA 3VDHA 1WDQA 1LQ0A 1VFOA 3ZT5A 2VX5A 3MV11 4V28A 4GQQA 2J7EA 2D3LA 4M80A 1VJSA 2OSXA 3VIPA 4HZ7A 3WKZA 2VVSA 2HISA 1H5VA 1UQYA 2JE8A 3ARQA 3PZMA 1DEDA 4BS0A 3WELA 1HL8A 4LXFA 5BRQA 1DWHM 3LPFA 3VVGA 4W86A 2PWHA 5CSYA 4FMVA 2ESCA 1KGXA 1OB0A 2VQTA 2XSBA 3VGFA 1US3A 3WH7A 1OGGA 3T0AA 2ZIDA 1V6UA 3VGBA 3II1A 4JIEA 1ISWA 2XFRA 2E9BA 3AI0A 3NSMA 3RM9A 2E8ZA 3FNDA 3WD2A 5EB8A 4TVDA 3WF2A 2J7HA 3NJ3A 3CZJA 1EQCA 2BY3A 2OWXA 1XSKA 3ARZA 1PX8A 1E5NA 4CU6A 2JALA 5E70A 3OLDA 3CHCA 4UTFA 2J47A 2E9LA 3WDJA 2YBUA 1VB9A 1LL4A 1E70M 2UY4A 4PSPA 5D8ZA 3WENA 5A2CA 3AMGA 3AS3A 1ISYA 1U33A 5A6LA 2YDRA 3EDDA 5I3DA 2WCAA 2WKGA 2WSPA 3B8SA 3WNPA 1BYDA 3AZSA 4HA1A 1CZ1A 1NQ6A 3SIMA 5BXRA 2XVKA 3OLIA 4QP0A 4XX6A 2YA2A 4DWSB 1UKPA 2VCBA 3AS0A 4DWSC 4QLKA 4D6HA 4FLQA 4HMEA 1E6ZA 2FHFA 3THCA 3BGAA 2Y24A 3WQ6A 2X8RA 1UD5A 4AIOA 2J4GA 5A94A 3VIJA 2WC4A 3NCOA 1EXPA 3ZJKA 4P7RA 2J7GA 3AIQA 2QF8A 1TE1A 3N11A 3EMZA 3OGRA 7CGTA 3U5YA 4DWSA 2ZX6A 5FIPA 1BQCA 3WMSA 4L4PA 4AD0A 4GPNA 1PPIA 2FDMA 3GH4A 2YOCA 3KL5A 3N13A 2BY1A 2OWCA 1L0PA 3WIJA 3CBWA 2AMGA 5D9OA 3ZR5A 3AHTA 1OD0A 1UD6A 2DT3A 3SUWA 3QHNA 3HMCA 2ZUVA 3T0DA 3L2LA 1B3VA 1LF1A 3EMQA 1E73M 4D71A 3QHOA 1R85A 2ZX9A 1EA9C 1WNOA 2V3DA 1VJZA 2YA0A 3N18A 2ZXDA 1CENA 5A8PA 1E6RA 5E0CA 2J62A 4CU8A 4JFSA 4J3XA 1QI2A 4X0VA 2OSWA 2PI6A 5FL0A 1E6XM 2VCCA 3NYDA 1WDPA 3KL0A 3G6LA 2O9TA 3VGDA 1VFUA 4KRUA 2D0FA 2ZUNA 1H1NA 4W8BA 1GNXA 4XB3A 3SCUA 4CN6A 3S6TA 1I1XA 4AD3A 1W3LA 3ZT7A 1WO2A 2DT0A 2J78A 1XGZA 4H8HA 4YHEA 3CMGA 1UD2A 1JDAA 1MW3A 2G4FA 3ALFA 3WD3A 2EQDA 2ZX5A 2EEXA 4NF7A 4MAVA 3OBAA 2EPKX 1V6XA 2FH8A 4CN4A 3RILA 1WZLA 2OYKA 1VFFA 1KQZA 1H4PA 4LYQA 3BXWA 4JKLA 2J7CA 3W28A 5M17A 1RP8A 3K46A 4AD4A 4ACZA 1ZBKA 5A69A 1C7TA 3ARVA 1UZ1A 3MANA 1RD6A 3BH4A 3CHEA 4E4PA 4PTVA 3WEOA 4F9JA 3VIOA 3WQVA 1Q6EA 4AD2A 3FY1A 3NDYA 1DWAM 1FP8A 1UR8A 4CN1A 1SR0A 1V6YA 1R7AA 1CXEA 1W9PA 3AFBA 4F66A 2VCAA 4AYSA 4PTMA 1FP9A 5IFPA 1NH6A 4GZEA 1B3WA 3ZR6A 3RM8A 1KWKA 4U3AA 4TX6A 1AQHA 5A8QA 1B3ZA 4CD6A 1PJ9A 2F2HA 5DMYA 2ZX7A 1CYGA 3BAWA 1W9BM 2QMJA 3L4YA 2XVNA 1J0ZA 1CLVA 3FAWA 2VX7A 4ZXLA 4NI3A 5JIWA 1F4AA 1MFUA 4GKLA 1QNRA 3U7BA 4Z2JA 1YHTA 4HOXA 3RJXA 1YQ2A 2A3CA 2WBKA 5DT7A 3OG2A 4HMDA 4UOJA 1A47A 3VX1A 2NSXA 1LL6A 2WXDM 3K8MA 4IPLA 1V02A 3PZVA 1EDQA 3CTTA 1CXFA 3WH6A 2IUZA 3L4UA 1Q6FA 1O6IA 2E40A 5I24A 2WB5A 3SCNA 4TVCA 3AXXA 2WC3A 2XJ7A 1B0IA 5AYBA 5CJ5A 4RE4A 1DHKA 1JIBA 4ZFMA 1V3JA 5HDRA 2W4XA 2BY0A 4PTWA 4V2XA 5A8OA 3TA9A 1AQ0A 1W2PA 3BCFA 1G94A 5AY7A 4UOZA 1V6WA 3VX0A 1V0NA 1GOOA 2QPSA 4X0NA 1W9DM 4W89A 2WVVA 5CPTA 2RGMA 4GQRA 3WNOA 4QAWA 3SUSA 4DWSD 3WUGA 5KZ6A 1GQKA 2WZIA 1BLIA 3WNKA 3DECA 3HN3A 1GVYA 1E1FA 4FLOA 4ZE5A 1KBKA 3IAPA 1X6LA 2DGAA 1BFNA 3CUJA 2VOTA 1UD4A 1HJQA 5I6SA 8A3HA 4J3SA 2YLLA 3POCA 4GZIA 3CPUA 1EO7A 1DWFM 2BHYA 2GJPA 2X1IA 1E55A 2XIBA 2GVYA 1JD7A 1FH7A 5A6JA 2ZICA 1ISVA 1PEZA 2J8GA 2ZWYA 2BHUA 4NSBA 1UD3A 1KXTA 3W29A 4MAZA 2GSJA 3WF4A 1LG1A 1E6SM 1CNVA 4KH2A 2PF0A 4D6IA 4PUEA 1ZU8A 1W1VA 3W25A 4PRWA 2W61A 1UH3A 2EXOA 4K68A 5JUVA 3VOCA 3I3EA 3VD9A 4Q7NA 1NP2A 3KEHA 5BXSA 2VNCA 3NIYA 1CGYA 1TFVA 1H41A 4AEEA 3MS8A 2PWGA 2WVTA 4E8CA 1HP4A 2ZXBA 4D6JA 3T2OA 2Y5EA 1B2YA 1V3IA 1JZ6A 2YA1A 4U2YA 4W7VA 2ZOXA 4CD4A 1E43A 1WZMA 3OIHA 2BVTA 3GZAA 1OIFA 3WBAA 4AXNA 3D3AA 4QFUA 2D20A 1KB3A 2E0PA 1JI2A 1XD0A 4WF7A 1OD8A 4W7UA 2WMJA 4WIWA
chains in the Genus database with same CATH superfamily
4OV9A 4CEUC 2C1HA 4FNUA 2VDGA 4B4HA 1J6OA 5EA9A 4YTTA 4DLFA 1O95A 4KCUA 4HTYA 3LHWA 2CNCA 1W5QA 1I8JA 1ONXA 1UWIA 4BCEA 4WKAA 3L4WA 3NL3A 2PDMA 4EOUA 2NX9A 2PLCA 2E6DA 4DM2A 4MB3A 2UY5A 4NJHA 4CD7A 3QR0A 1PIIA 1UYQA 1W3JA 1TTQA 1TV5A 3U57A 5HXMA 1UR4A 1TR1A 3B8TA 3ONBA 1VBUA 2P10A 5EY5A 3GDMA 3MUAA 4Z0JA 4W8LA 2NQZA 2WSQA 4ICMA 2IXUA 4Q8WA 5CG0A 3BCDA 1CXLA 3UCDA 2NXHA 4Z17A 2XIOA 3RF9A 2ONEA 1EDTA 2QUVA 2DUAA 1QU4A 3T40A 1PTAA 1BTCA 3TA6A 4Z1BA 1HO4A 2I17A 2HXTA 1VYRA 2FIQA 2BODX 5CSRA 5KTLA 1KBIA 2X42A 2D69A 3PAJA 3U7VA 1QI0A 2F9RA 3DG6A 2PPGA 4W7WA 1UA3A 3R0UA 1TB3A 3P81A 1Q7QA 3U2OA 3S3GA 4HPHA 2H9AA 4LBSA 5E9XA 4AY7A 4HHMA 1TPUA 3TQPA 3NURA 1OINA 3ARRA 3FIGA 4B90A 2QGHA 2XWDA 4LF2A 5BRPA 2DUXA 6XIAA 1E0XA 4C1NB 2WMHA 1ZAHA 4HK7A 5DCEA 4B92A 3GDRA 2PAJA 3I3DA 3QMRA 4OU1A 4QQ3A 4GI6A 1E1EA 4UFIA 1QI3A 1EL3A 3WLRA 1Y65A 3WQGA 4Q7BA 1XIDA 4WSKA 4N9BA 1AA1B 4F4RA 2P8BA 4DIAA 1OCQA 5AHMA 2YDSA 1M9HA 4WXZA 2VOMA 3BPWA 4Z2KA 2V38A 3HPXA 4ZCWA 3LBCA 4XBKA 1VIZA 3CGTA 3H24A 1AZ1A 1W2VA 2FH6A 3B0PA 1TV2A 4N7QA 1F3WA 3LPPA 2EPOA 4FOUA 3FAXA 2A1YA 4P7NA 3T7VA 4UQCA 4OOZA 4I7UA 3EDEA 4DF2A 2G3IA 3UJ2A 3QV9A 3V35A 4Z2LA 3F5LA 1PZ1A 3W86A 3A21A 2Y5SA 1ZBWA 2D0HA 1SFSA 3DYPA 3GNRA 1DTNA 1LOLA 1Y5WA 3M64A 4BQ5A 1O5QA 4QNWA 4HNVA 3IV3A 1K3UA 2R1NA 1CXKA 2X7VA 2PU0A 2G4JA 4KESA 4PBFA 3GXNA 1ZB5A 3RNDA 1HVXA 1OCNA 2WJEA 4KIEA 4MY9A 4HZ6A 3THDA 4ZENA 3QMSA 3ATZA 4F0MA 4XKYB 1IIGA 5F2LA 1X8FA 4I5XA 2AAAA 3HFTA 4OT7A 5EU9A 1UKQA 3DGRA 6CGTA 4BI6A 3HO8A 1XCWA 1JZ4A 4O52A 1PE1A 3W4RA 2FDSA 5JBEA 3W2MA 4J3WA 5KEZA 1F74A 5AC4A 2X30A 2F8QA 3GQYA 4Q3MA 1ONWA 1O4UA 1SW3A 4D72A 2FGBA 1A5KC 1M04A 2TODA 1XYZA 4PMNA 2V5KA 4GHRA 4MDOA 1V03A 3LQLA 4MWAC 1EO5A 2C18A 3M7SA 3SGGA 2CKSA 3H54A 4GFIA 5LA1A 1H7NA 4US6A 3KXQA 5DO8A 5EMMA 3GNXA 4FK9A 5CPLA 1BXCA 4PMXA 1VLWA 2WNNA 5D9NA 1HJVA 5DCDA 1DJYA 4DJDC 1B4KA 1S46A 1WKYA 3VIKA 2JIWA 1K7FA 3BOXA 1D7FA 1ZJBA 3EB4A 5AOUA 1E71M 2FZDA 1TA3A 3IJ7A 1NM9A 1F05A 4I9TA 3GXPA 5HPOA 3EWCA 1CXIA 4MDPA 1JNDA 1TTJA 3GRIA 4GE8A 3N4AA 5EMLA 3GFZA 4HP5A 1E56A 4YJ5A 3SUVA 1ME8A 3EYPA 4OBRA 2X1RA 3MMWA 2XPKA 5DY3A 4W4QA 1FCBA 2OWWA 3T05A 3KS6A 4H9MA 4CVWA 2C91A 2VEPA 4JQ4A 2XG9A 4HYWA 1LTDA 5CPOA 2A3EA 4KBXA 1WYIA 3OGVA 3B9NA 4IICA 3LK6A 2JEQA 2ZRXA 4JTQA 4D8LA 4JTJA 2IPWA 4UTTA 2A5HA 2VWSA 4HU3A 5IFTA 3U2EA 3VIHA 2QUTA 5FJOA 1EJXC 5LYRA 4KWWA 1I2RA 3STPA 3RU8X 3F2BA 2C0AA 3CAWA 4C1LA 2PFHA 2FPYA 6PTDA 1BWLA 1TJ2A 4JPGA 3PJXA 5DT5A 4WEVX 4MJ4A 4MADA 2CLIA 2GGIA 4HYRA 3PFRA 5I00A 3BE7A 6TAAA 1XIJA 3UWUA 2PGFA 1E4NA 4GUIA 3M46A 4ZE4A 2YLAA 4Y96A 3GFYA 3N6JA 1TKKA 3MUY1 1VQTA 1J12A 4UCFA 2V68A 1C90A 1XLIA 1PXGA 1CGWA 3WD4A 5A2AA 4PN2A 1U5JA 2W63A 4G9PA 3PBWA 1W32A 5JBFA 2ZE0A 1XQLA 4H04A 1GJUA 3NO3A 2FMNA 2Z1BA 4URIA 1K9FA 5D30A 3TMLA 3QC3A 1HXJA 3GTNA 1VIWA 1IZCA 3LLXA 3TYUA 4X9SA 3LM7A 1VS1A 3FYYA 5LHFA 3WL0A 4FZIA 3F2DA 4K38A 4YPJA 1HF6A 3HU7A 4O54A 4TX8A 4XK2A 4UWMA 5IOBA 4YWIA 4PBEA 2V0TA 3TZFA 2E68A 1XFBA 1E5JA 4DN1A 4O15A 1MNSA 1FWAC 3IPWA 3PUGA 4FF7A 5E6YA 1O5KA 4OIFA 5A3HA 5DLCA 3WEZA 3MA8A 2XN0A 4BI7A 3N9KA 4H7VA 4YCOA 4L9YA 2J6XA 2QCHA 2I16A 3GVWA 3TSMA 2VC6A 3SFKA 3SCOA 4GBDA 3E5BA 2P0IA 4RZ4A 3E74A 4DBSA 2DP3A 4WDUA 1TWWA 3W7OA 3MKVA 4V15A 3AIWA 3PBMA 4XZLX 1NDZA 4JIRA 3PUOA 3WH5A 5I06A 4F48A 3OO2A 3L23A 3TONA 4E2VA 1DJNA 4HSNA 3S6OA 1ZL1A 5BCAA 2WHLA 3ABSA 4C65A 1VFMA 3NL2A 4N0RA 1GTHA 3M0JA 1BKSA 5E1QA 3R11A 3I4EA 1KWGA 2PDHA 2CFFA 2INFA 3RRAA 3CL6A 3AMCA 3M0LA 1PX3A 1I1WA 1VRXA 1LRQA 3ZM8A 4OTKA 1TQXA 4WJEA 3AYTA 3R12A 1C8XA 3BLEA 1YBQB 5IHSA 4KEVA 4G8TA 1FH8A 1E9ZB 2H3DA 3I7RA 4FI4A 3ITCA 2ZRYA 3TLLA 3IUHA 4HA4A 1PZ3A 1W9XA 3UGVA 2NQ9A 3VPLA 3R10A 1YNYA 1NARA 3IUIA 1O68A 4WCJA 3M7WA 3CHDA 1A5LC 3WK3A 1QASA 3VNMA 1ODZA 1ISXA 1QTWA 1FWRA 3NDZA 1JYWA 3P84A 1CX9A 1XLDA 4IFKB 4Q8TA 3S9YA 2FFCA 3KE0A 2GQ8A 4GA8A 3EWZA 3OVRA 2DVTA 2VP8A 3TTSA 3QRHA 1QOPA 3WQEA 4MWAE 3UR8A 2VUNA 3VINA 2O4QA 4AX6A 3LPOA 1G5AA 1KM2A 1UPPA 4CNTA 1W54A 3IJ6A 3PPCA 4PSRA 2BV9A 3CU2A 3STFA 1RXOB 2X2YA 4JIHA 4AG0A 5L6UA 4YHGA 5M1TA 4RUBA 2QQ6A 4WJXA 4LS2A 1SVDA 2JF6A 4F40A 2E5BA 1V6VA 2DVUA 1KM5A 2BZNA 4CVUA 1RD5A 4RDVA 1SUXA 4AB4A 4GVIA 4QHRA 3QR3A 2Y85A 2FTYA 1JZ8A 4IXHA 3N2CA 4L6HA 4C6LA 3PFMA 5F4SA 3CLMA 1J0YA 1GVIA 3CB3A 3NFUA 1JFXA 2EJ1A 5HANA 2WMIA 2VMFA 3G1VA 2FTPA 3SR7A 5CBBA 1BVZA 1AD4A 2R94A 4TMCA 2XVLA 3UPBA 3I10A 1B57A 1NP0A 2IKJA 2R1MA 2G3FA 3WLIA 1W3NA 4FNSA 2QV4A 4AEFA 3L4VA 1HNYA 4IX0A 2FZ9A 1MVYA 3G1FA 4TUFA 2VFIA 1GYNA 3IAQA 4RV3A 3XINA 4C5ZA 1M03A 3MI2A 3QV8A 2QJIA 2WWCA 2XSXA 3AMLA 1IXOA 4LAZA 4Q4OA 7PTDA 3AIUA 2GK1B 5LIWX 4XVDA 4NXKA 3UWZA 5C2XA 2PDYA 3WJWA 2YYTA 1F6PA 4AWSA 3C4UA 4BF5A 2PLMA 3WDPP 2E8YA 2R6OA 4M3PA 4KFNA 3S5NA 3GB6A 4MWAA 1PKNA 1YW1A 5HATA 1VCFA 2E5CA 3TOPA 4EE9A 3ZIZA 3A3WA 4AUBA 1JXJA 1V8EA 4Q4RA 1M6JA 4KW2A 3P93A 2VR5A 1FCUA 2WJFA 4S38A 4CQ9A 2ZRVA 4MNJA 2Y63A 3UZJA 4ZSTA 2O9RA 1VH7A 2D24A 3B8VA 3WQWA 1C9DA 5H8UA 4AIUA 4O1AA 4PBGA 4RNJA 3P5YA 2YSWA 4HOWA 1GQLA 4UTMA 3ZJ8A 3G3DA 1KFWA 4XV0A 1FWHC 1QVBA 2X05A 4NZ5A 4I6KA 5LGZA 1CBGA 4ADSA 3GDBA 2DZVA 5CKSA 1NF0A 1UD8A 4GVFA 4QLLA 5A6AA 3TYAA 5C6MA 2C71A 5EPDA 3C8NA 5D9MA 1A5MC 4JTRA 1YKWA 3IJ8A 1SO4A 2FPVA 3USBA 2WC7A 1P48A 1WB0A 1XSJA 1C8QA 3O0FA 4IIEA 1YNQA 1NWRA 3O6AA 1XIFA 3MMUA 1IT8A 3S8HA 1Q4WA 2EF9A 2D0GA 1G69A 1NELA 3F5KA 3CZGA 3C86A 1E6PA 2YBVA 4ERIA 4JNMA 2HNEA 1SU5A 1S38A 2ZC8A 2Z0IA 3F4VA 4I7WA 4B5TA 2E09A 1R3RA 2HROA 3NZRA 3OHMB 2W79A 3STEA 3H4GA 3N29A 4PMUA 4XD5A 5AHFA 1K9TA 2NX3A 3RX4A 3SUUA 4JTLA 1E4MM 4AISA 3Q4DA 4UUIA 5I2UA 3K4DA 4V33A 5C5YA 4LOCA 2WMGA 2Y7GA 3MUXA 2QIWA 4H2HA 3AZRA 4D1IA 2V3GA 3W1MA 1XH1A 3AIRA 2G3NA 2GJXA 2Q8LA 3TTYA 4CCZA 3QGKC 3N3TA 4L4OA 1IEXA 3FOKA 2DEPA 2VC9A 3C0LA 4MPQA 1KXHA 3H70A 3TN6A 3PZGA 4QG9A 2CZFA 4JFTA 5A6BA 4KPLA 2E9MA 3KCOA 4E2DA 1LRTA 3LMZA 1P0EA 1SO5A 2YB1A 1OM0A 1EZWA 4CD8A 2XH2A 3S2LA 1FWCC 4U5KA 1GJWA 1EC9A 3GDTA 1U1JA 3CYVA 4NZJA 1UZ4A 3PB0A 3HG3A 1PAMA 2A3LA 2YL9A 1UWAA 3U8GA 4EACA 1TX2A 3WFAA 3BICA 2ATMA 3QSRA 3BLDA 1BG4A 2O56A 3PUEA 4JFUA 4FR1A 4E3VA 1S5WA 1G4EA 4LB4A 4NX5A 4JNZA 5AC6A 1NY1A 1ZRQA 3TJXA 3ZR4A 5FJPA 3KTCA 3DESA 3TFCA 2R1PA 4UTHA 4LCRA 5ECUA 4CUCA 1PTDA 1FA2A 3ITTA 4PMDA 3TZNA 3CUFA 2ZUWA 3BJSA 4J35A 4EWJA 4RXGA 1JYNA 3MCMA 4IPPA 1XYBA 1H3GA 3M4HA 1DIDA 1RPXA 1ZQ5A 4G7EA 4IOTA 3P14A 3SY8A 1XDLA 3N14A 3CXOA 4S1FA 3I7SA 2J25A 4O17A 4F0SA 1OFOA 2OO0A 1C92A 1GOQA 3IWPA 4YYCA 5K9DA 3NQDA 2GDUA 1XINA 4BHYA 1F61A 4DZIA 1EWEA 1HX0A 1JPKA 3RITA 1JRCA 3V1HA 3T0CA 1PSCA 4JCLA 1OCBA 3KHJA 1VRDA 2V67A 2F6XA 1MEIA 1QAPA 3WQCA 4QGCA 1BD0A 4S39A 1UC4A 4R85A 1KR0A 4POCA 2JBMA 4QLJA 2PRHA 4UQDA 3JR2A 2NV9A 2PBOA 3WLNA 1Q7ZA 3A6OA 3WMBA 2WVSA 2UY2A 2VJXA 1H7PA 3T9PA 5C7VA 3LCWA 4MZYA 1Q6RA 1ZBVA 1WXYA 1ITCA 1G7UA 5T91A 1A5BA 3G5EA 1IGWA 4XAGA 1QI5A 4RKAA 2VD9A 3RO6A 4HA0A 4BK9A 4IIFA 3AU6A 1LDCA 1NDVA 2JIEA 2VTFA 2IS7A 4AHPA 4LT9A 1LT7A 2B81A 2PDIA 3LLDA 4Y7EA 3VOHA 1XLMA 4GZ7A 1XIIA 4KT2A 1UZDA 3KRBA 3PZNA 3PJWA 4IT1A 4B2DD 3QN3A 1Y8BA 4LB3A 4LCSA 4WKHA 1JZ7A 1GQJA 3DI0A 3OBEA 4B2DA 3MHUA 1W1B1 1E3XA 4DEFA 3N25A 1XDJA 6TIMA 1QHPA 3FSTA 3JU2A 5TD4A 3N12A 3BMXA 2W66A 1G01A 1KTNA 1ZJAA 3SN0A 5IDIA 2BXZA 1JAKA 1AW5A 4AD1A 5LXEA 3TCSA 4MNLA 2FZMA 4YXGA 3UWYA 3ZJ6A 4DO4A 3C2YA 4RV8A 4DZHA 2OEKA 1EUNA 5D2WA 2G50A 3IGUA 1V6TA 1QT1A 2J77A 4QSHA 1RPKA 2Y4SA 3CPRA 4YLWA 3FXGA 5C0QA 3IK4A 4S3JA 4AZIA 4DJDA 2QEZA 3LGDA 5LNWA 4RW5A 5F1UA 4C6MA 5CLTA 4DUVA 2CIPA 9XIAA 5H8PA 4QDMA 2F6UA 1UCWA 1PDZA 4NZ3A 2XVGA 4GKTA 3R5EA 4LQ1A 3FXYA 4AZHA 4ZOAA 2B7OA 2R9RA 4PRTA 4UFMA 4DPPA 1FDJA 1ZAIA 1GJPA 2OLAA 3TW7A 1C29A 3H53A 2E25A 1GHSA 2Z1KA 2P53A 5GNZA 4NI8A 1WDQA 3GU2A 3TEVA 4V28A 5DMMA 1NDWA 2OSXA 2WSYA 1H5VA 1KO0A 2JE8A 3MW7A 3ARQA 2DJXA 2I5IA 2QUUA 4BS0A 1DPMA 3WELA 1HL8A 4LXFA 3VVGA 3PNUA 5SWUA 4JQ2A 1KGXA 2QCDB 4NX0A 2DZTA 3GIQA 2VQTA 5REQB 1US3A 3T0AA 1YXYA 3VGBA 1WBJA 3L7RA 4C6BA 2E9BA 1RLCL 1REQB 1N8WA 3FK4A 3G8RA 4K8HA 1A5OC 1TPB1 2E7FA 3CAQA 4UTJA 3GU9A 2BY3A 5HMFA 3ARZA 3VE7A 1PX8A 1E5NA 4A3UA 4DJFA 3D0CA 4DWDA 5HUPA 4EP8C 3HZ3A 2RUSA 3OLDA 2J47A 4XQ6A 1T7LA 3R2GA 1P1MA 1K7EA 4H83A 5BMXA 3WENA 3AS3A 1U33A 1PL9A 2O0TA 1XLFA 1TJPA 2WSPA 4ZOBA 2PDWA 3VOGA 1VFTA 4LYKA 3W2NA 1EA0A 4GUJA 1QW7A 2TRSA 3QMTA 2ZZ1A 3TSDA 4QP0A 4JN6A 4LAOA 1PTGA 4PGLA 2VCBA 2TPSA 3AS0A 4S2CA 1E6ZA 4G1NA 2Y24A 4GGHA 3HGSA 1UD5A 3DG3A 3VIJA 1FWGC 2WC4A 2PDCA 4R33A 2QDHA 3OQEA 5C9WA 2QPXA 2J7GA 4R7OA 1UC5A 4GY0A 3N11A 4JX6A 3ZYZA 4LUJA 3WJSA 4I9AA 4DWSA 1PZ0A 2PLJA 4MY1A 3L67A 3B8UA 5DQPA 3WMSA 2FVKA 4L4PA 3F4WA 4AD0A 3MWCA 4GPNA 1X96A 1F3XA 3BQ6A 3KL5A 5D38A 2OWCA 1RA0A 1L0PA 3L2IA 4XZMX 3KOWA 3WIJA 4K36A 1A5SA 4JR5A 4IQLA 3ZR5A 3UT0A 4N4PA 4ORIA 3TMQA 1UD6A 1MXSA 3LHUA 3SUWA 1GOXA 4I5RA 3L2LA 1XIMA 1RALA 3FJ4A 4HU4A 1E73M 2PTWA 4IGMA 4LF1A 4PZVA 2ZX9A 3LRMA 1WNOA 3RU6A 3N18A 1KCXA 3S9IA 4OE7A 1YNPA 6ALDA 4L1WA 5E0CA 3C8FA 2JQXA 2IQTA 7XIMA 3BGJA 1R9ZA 2EG7A 3NYDA 1WDPA 3UZZA 3GU1A 4O0QA 2O9TA 2UV8G 3VGDA 1VFUA 2D0FA 1QPQA 4W8BA 5B7ZA 1AJ0A 1TRIA 4FXSA 1GNXA 4XB3A 4AVOA 3S6TA 1EUAA 3W1TA 1WO2A 2YXGA 4NJGA 1UD2A 2G4FA 1H7XA 2EQDA 4TX9A 1V5XA 3ERPA 3RILA 1KQZA 2ZZ7A 4JTTA 1L6FA 5M17A 1WOBA 4WXYA 1R2SA 3TJIA 3PWIA 5HK4A 3V1PA 1F8IA 1UBSA 4B4FA 1C7TA 3ITGA 3VNDA 1RD6A 1SR9A 3BH4A 3M0HA 4O0ZA 4X61A 4MUZA 1UPMB 4F9JA 1UOZA 1S2VA 3TDFA 1Q6EA 4CQDA 2WSRA 5IM51 1W9PA 2VCAA 5IFPA 2ANUA 3CB8A 4V1XA 1B3WA 1W17A 3VOIA 2ZZ6A 5T9CE 4TX6A 1AQHA 4CQCA 5A8QA 1B3ZA 1PJ9A 2E28A 2ASHA 1LBLA 2F2HA 2PCEA 1QATA 3E38A 4ZTXA 3BAWA 2AQVA 2ZADA 5DMNA 2XVNA 4MHBA 1Z42A 1J0ZA 1CLVA 3A24A 3FAWA 5FSEC 2DZWA 3UXAA 1ADOA 3PPFA 3TSBA 5JIWA 1KKRA 4V1YA 3E5PA 3W6YA 4YS1A 1QRQA 3OG2A 4UOJA 3WLKX 3R8RA 4Q8PA 2PD9A 1XLHA 5CBIA 3TWAA 4ERAA 1DJGA 3LCLA 1KKOA 1C9WA 4IPLA 1V02A 4HZMA 4JYFA 1SJBA 1K70A 1CXFA 3WH6A 4LVGA 5HQMA 4TVCA 3O6YX 5C9UA 1XYLA 3M43A 1W1A1 4MLJA 4ML9A 3W1QA 1JIBA 4ZFMA 1V3JA 5HDRA 1M41A 2BY0A 1LBMA 4V2XA 5A8OA 3W70A 3TAKA 3JS3A 3VOFA 3NYZA 5D2XA 3VX0A 3SBFA 4ZR8A 1KM3A 1M7OA 4X0NA 3GC4A 5CAKA 1W9DM 5FJJA 2BGQA 1FXQA 3VUSA 2QGYA 3SUSA 3E2QA 4EIVA 3MO7A 4I5UA 3S1GA 3HPAA 1GVYA 1O66A 1YE4A 4NZ4A 4FLOA 2DGAA 2J88A 3EX2A 3M0MA 5HNRA 1HJQA 5I6SA 8A3HA 3W7HA 2RDWA 2PDJA 4GZIA 2HS8A 3SM0A 4W9TA 2BHYA 3UR2A 2GJPA 1EWDA 2ZTKA 1P7TB 2OJPA 4ADTA 2ZICA 5A6JA 5FF2A 3WLSA 3BURA 1DJIA 3BLIA 3WF4A 4PUMA 2X1SA 3RLHA 2ZA3A 4WD0A 3LSBA 4PUEA 4B5NA 1W1VA 4PRWA 2W61A 1EP1A 4WRHA 3PF3A 2EXOA 3TV8A 5DXXA 5JUVA 3FVMA 3VD9A 3W7LA 1I60A 1R5YA 4I9JA 5BXSA 2R82A 5DXYA 1H41A 3GXTA 2BLEA 3MS8A 2NQLA 3FGCB 4E8CA 4RNFA 1RLDA 4ONVA 1Q45A 4D6JA 3T2OA 4NNBA 3HPFA 2BMBA 2YA1A 5F2MA 1E43A 3WBAA 4JTEA 3S1VA 4QFUA 3Q65A 5G4WA 1AG1O 1JPHA 1KV8A 3CV7A 4XKYA 4W7UA 5FI8A 4K7YA 4B15A 3NXFA 1RBLA 3V5OA 4DUWA 2GL5A 1UUQA 1D8CA 3Q37A 1C3FA 5TBOA 5FKYA 3C52A 1OFPA 3W2JA 5FF4A 4GH3A 1WCGA 3VZZA 5JH2A 4XD6A 1XHGA 4OUIA 4XAZA 4YTSA 3GC5A 2O4MA 3RUBL 3U9IA 4ALDA 4IISA 3VFCA 2Y89A 3JVAA 4MZ8A 4CNPA 2ZBTA 1IXNA 1W3TA 1FKXA 3ANYA 4E38A 3B06A 4KGLA 3VE9A 1W3KA 4N2YA 3WBWA 1FOBA 5G2WA 4UQ9A 4KIRA 1KFCA 4IG2B 3J7HA 2PB1A 9XIMA 1BGGA 1CXHA 3UG4A 4BFAA 1JQVA 1WDWA 1W9VA 4U28A 5A1AA 3K4WA 7ENLA 4HD5A 4HJWA 5D33A 3CUIA 3UZYA 3ARUA 4PB3A 1FFQA 3EKGA 3ELFA 3WNNA 1JPDX 3GVVA 3TYDA 4PULA 3UJFA 5KMYA 3P0XA 1BXNA 2Z1SA 5LIYX 4B5WA 3ARSA 4ZA0A 1QHZA 1AVAA 2YZ5A 4LVBA 1FFRA 5B80A 1LUCA 5A6KA 1QMLA 3EB3A 2I57A 5BW6A 1KLZA 3M5VA 1KXVA 3GVRA 2WZMA 2R8WA 4AZCA 3N4FA 1FHLA 1MZHA 1JZ5A 1CGXA 4UXDA 3IS4A 3GDKA 5M2FX 1VR6A 1CIUA 2Q02A 2OCZA 3M1ZA 3KBVA 5DANA 5G4HC 2DIKA 3MKCA 3VMNA 2SFPA 1JRBA 2DV0A 5T26A 4OKDA 3SCPA 2WMFA 3VFLA 2B31A 1GGOA 3ITOA 3MVTA 1R0MA 1TREA 2XSAA 3UERA 3FVDA 5HOSA 3EOLA 1OG0A 1RCXB 1EYWA 2VVNA 4LX4A 4MKVA 2NV1A 4AMAA 1EC8A 2EKCA 2AL2B 3ZO9A 4L1GA 3L2MA 4N6EA 4NASA 1GTEA 3SY1A 4F2UA 4O0KA 3GG7A 3IIPA 3O06A 1W1TA 3GH7A 3A3HA 4GIAA 4K6AA 3NZPA 2VM8A 3W27A 1TV7A 3NQGA 2Z6IA 4I7VA 1VHNA 2YFOA 4NQ1A 5LA0A 4GABA 1TG7A 1XM3A 4JGDA 4DZ5A 1XYFA 1QK0A 4NKCA 3R8GA 2G3MA 2DDXA 3PBYA 2BVDA 1CGVA 1E9YB 3QYQA 4AMCA 2ZRZA 3PP7A 3SJ3A 1QCWA 1V3MA 2QDEA 3T6CA 1JCYA 5DBUA 1R2RA 2V5JA 4K2SA 4MOZA 4XAFA 2CLHA 3NZ1A 1XLEA 3VUPA 4X3ZA 2GDQA 2I5QA 1DE6A 1K9DA 1D3GA 5M03A 2IKIA 2HS6A 1AODA 2FPTA 4A3YA 3MSGA 1VBHA 1UH2A 2V5CA 4R7WA 1CDGA 1V7YA 3OVQA 3RCNA 3FJLA 3LBMA 4XUGA 3V7PA 4J5NA 4N42A 2VUYA 1PWLA 3WNMA 1IGSA 2V69A 1L8NA 4IFRA 5DRIA 4IGSA 4HU8A 3AIBA 3EDJA 3ANUA 4GI9A 3TXVA 1DQUA 4UC5A 1L8PA 1FX6A 2A3BA 2E6YA 4U10A 3NSXA 4IXXA 4PUWA 1MW1A 3UVIA 1BSLA 3MHGA 1DWIM 3BC9A 5C9XA 1S2WA 3B9EA 1Y5XA 2FB2A 1EPVA 4NAFB 1X1NA 4K3ZA 2PDQA 1E6NA 3POHA 4G5DA 3UY7A 3GYCA 1GZJA 4Y9OA 1XIEA 1RH9A 1LWJA 3WDRA 5DBTA 3TNOA 4LV4A 2P8CA 1K02A 3PSWA 5TAOA 6XIMA 1QBAA 1GQIA 3SCSA 1UOKA 4NJIA 2JFEX 4GX8A 5ABHA 3HMJG 1VEOA 4Y8FA 3RO8A 1D3HA 2QW5A 3OW1A 2OEJA 2VL4A 4BQ2A 4IIBA 1BF6A 3KBMA 3CQ0A 1EXBA 4MB4A 3GXFA 3FA3A 2CITA 1EJ7L 2J8FA 1R8LA 1K6WA 1IF2A 1DJQA 3U3HA 2ZVIA 2NLYA 4LYRA 3BAIA 4MTVA 1UR1A 2DSWA 5HWJA 1NIUA 1R86A 1MDLA 1UQZA 2OG9A 2TYSA 3L4XA 5CGMA 1QR7A 4DBWA 4LEFA 3V75A 3TC6A 5CZTA 3NQEA 1HT6A 5IBXA 1J0JA 4BA0A 5G2IA 4TOQA 4DJEC 3SEPA 1S39A 4IPNB 2PEVA 2YXOA 3ID7A 4EK7A 3VIMA 1SMDA 4PB5A 2CPUA 1L9WA 3QY6A 1RHCA 3S4TA 2WNZA 4JL1A 1V51A 3QY8A 5BXPA 4GJIA 1OQFA 3VKJA 2ICSA 1Z48A 2ZUSA 1VFHA 1H11A 2BTMA 1AH0A 3E12A 3W76A 4DUOA 4PUNA 1BSIA 2D2JA 3UBPC 4O53A 1RBAA 3ZZ1A 4X22A 1R46A 3D5HA 2QV5A 3GY1A 3CV2A 1J93A 1JXKA 4DO6A 3TC7A 1RAKA 2ACSA 3CT7A 4W5UA 3IRSA 1EEXA 3QQWA 1E0UA 5BMWA 3CZLA 1I9CB 3N3MA 2OGYA 4XWUA 3AICA 3LZ3A 3OODA 1F4HA 2YPIA 2Q8XA 3PZIA 3YPIA 1T99A 3B97A 1HQTA 1US0A 2NW0A 4PMZA 2GQ9A 3OB8A 2BSLA 3HG5A 4A2SA 5F7UA 1PYFA 1TV4A 4KCTA 3UP8A 2GK1A 4KGJA 2CYGA 2J9ZA 4G7EB 5E09A 1XLKA 2A3HA 2XN2A 3PZ9A 4GI4A 4NZCA 1S2CA 4NUWA 1G7VA 3LU2A 5BWAA 3SQMA 4W84A 2HEJA 3M0ZA 4J9JA 4IG2A 1UR0A 2F2KA 1GVFA 2PDLA 2XZ7A 2I14A 4H6EA 2G95A 4MYAA 3AHZA 2VKZG 2PURA 1H7RA 3SGUA 1T40A 3CEPA 3WLMA 2IKHA 3TC3A 4OHQA 1S1PA 1H50A 5CPQA 1MQPA 4MF4A 1Y5VA 1RJQA 4C60A 1BHGA 5G4EA 2CW6A 3XIMA 1H1YA 2QCMA 1NF7A 2WLYA 1W56A 5HWNA 1OX4A 1L2UA 1VHCA 1EIBA 1TZ7A 2DY3A 4R7JA 2UWFA 2XFWA 2JK2A 4UB9A 2EPNA 1R3VA 3B9OA 1BKHA 4C7FA 3PG9A 1H62A 2P76A 2W5FA 1DXFA 1YRRA 3DENA 2Y88A 4L5ZA 2C15A 3W1RA 3FDGA 1JPIA 1A3WA 2IW0A 4B16A 3QW4B 2CESA 5F4WA 2QXWA 5AFDA 3F4NA 1TQJA 2XGBA 2QKFA 4M81A 1QWKA 3H7VA 1WUFA 3D6NA 1Z8AA 1ME9A 4HNCA 3M9YA 4CQ8A 1NWSA 4O28A 1XIHA 4UBPC 1XBZA 3HOJA 4JHZA 3KW3A 1ENUA 4AYGA 1HP5A 3ZSSA 1UHVA 1TPEA 2MUCA 1DBTA 2D1ZA 4B5UA 3LYEA 3FJ6A 4LUIA 2A7NA 4AAJA 5HMEA 4DJED 4FAMA 1AQMA 3DKLA 2BWGA 1S2TA 5EYWA 1F3TA 3SN1A 3VK5A 3QZEA 3VNYA 2DSKA 4US5A 1VPYA 2WM0A 1V3HA 3ZMRA 1XL9A 3KOZA 5AHEA 3OVGA 1XSIA 3W81A 2AKMA 1C91A 3HF3A 3E96A 3P74A 2YL5A 2Z1VA 4JCMA 3GTFA 1UMYA 4L61A 3RPDA 5JH1A 5CLWA 4CNSA 1LQAA 4L4LA 1UIPA 4PR4A 4N9CA 1H7OA 1X6UA 2O92A 1KRAC 3GO2A 3FX4A 4B9YA 3UWEA 1F5ZA 4DYEA 3H4XA 3WBEA 1S2AA 3DDMA 1XLLA 4MM1A 3UXDA 2OQLA 2GGJA 1A49A 3FYOA 1N2VA 3CMJA 3W88A 1NFGA 2XFYA 1MW0A 3MSYA 1MDRA 1FWNA 3ARPA 4IF2A 4D6CA 1CB7B 4L80A 2OZTA 4FIQA 3SCVA 3A9IA 4HPXA 1XCFA 3LERA 9CGTA 3RMEA 3OOQA 3W02A 1GYMA 4LGXA 2GWNA 2HPMA 3IVUA 2NVCA 4LSBA 2BHZA 4UFJA 2A3AA 3ZVHB 4M82A 2DU2A 1VPXA 4XG1A 2C79A 5I7GA 1C7SA 3WF0A 2NWRA 2ZWZA 2NLIA 3N04A 1ZPTA 5EBAA 1LJYA 5FL1A 3MUZ1 4J2PA 3BLFA 3G22A 3TP4A 1U2YA 1TWZA 5FJTA 5I02A 1PHQA 2CETA 4TO8A 4LEQA 4CLMA 1C8YA 1J01A 1I0BA 3AISA 3TJ4A 3WCZA 3TKFA 3CWHA 1XLCA 3GG8A 3MP5A 4JTCA 4LU0A 4LV9A 3UXIA 2OEMA 1LYXA 3NUKA 1J4EA 5C54A 4GYJA 1FWTA 2GQAA 2Z28A 3QF0A 1JGMA 3H8AA 2B7NA 3KOXA 5A6TC 4EX4A 2GGEA 3GDLA 3HGRA 5I77A 4O8AA 4XD3A 1HG3A 3PANA 4MFEA 1ZGDA 1OFAA 1R7OA 3LCGA 5LA2A 4HHHA 2BS9A 3CWOX 4IMFA 5KITA 1A5UA 2RDUA 3MSRA 4WR3A 1XX1A 3CTLA 3UESA 3UEQA 3V0SA 4U33A 2X40A 4PA8A 2W91A 2BVWA 4OECA 3T2QA 3RRXA 3AHXA 2OLHA 4H9ZA 2R1LA 4XTDA 4D6GA 1SJAA 4XSMA 3FHQA 1GVEA 1QK2A 2VT0A 1UG6A 3LA4A 4Q4KA 1I75A 3DH7A 3H6OA 3MZNA 2WVUA 1V08A 2ZCGA 4LUSA 4Q33A 3KVMA 1Z6KA 1SO6A 1ME7A 4NU7A 2YKKA 1JVNA 2ABBA 3AMDA 2KZHA 1XRFA 3QQ1A 3GR7A 3DHUA 1AW1A 3PZOA 1OBAA 4AY8A 1B4EA 1LM1A 1XH0A 1PWMA 1T0OA 3DCPA 4K39A 3MDWA 4R34A 2EAWA 4LC6A 3S6DA 3E0IA 2E67A 5CQ1A 5AYIA 1IZJA 2WCSA 4U2ZA 4JDYA 1JCTA 3OEXA 1QW9A 4W93A 2YBTA 4FSAA 4H8NA 5I79A 3O6DA 4S3DA 7TAAA 4J3TA 3EAUA 3H2EA 4CEXC 4KEMA 3H2NA 1LLZA 1AQFA 4OGZA 4UOQA 1DJHA 3VMOA 1ONEA 5LIXX 4UNIA 2VGBA 1SW7A 3KM8A 2Z27A 2ZZ4A 4KQNA 3HFYA 3PY2A 3RIKA 3UU0A 3ATYA 1VFLA 3QFWA 3I68A 1DWJM 5BROA 4EAMA 2XIMA 3ZVHA 1HGWA 5ABEA 1Q2RA 4IMCA 3EA1A 3E3HA 3PTQA 3SRDA 3VGGA 2G37A 2FB3A 4ATWA 3SZ8A 3KTSA 3B0UX 2Q09A 3P80A 3ZFHA 1X1ZA 3JW7A 1L6GA 3CO8A 5C2CA 2W6RA 1WDSA 1CGUA 4HPNA 3WJYA 1Q6LA 4KRTA 3ZT6A 1LRNA 3TR2A 4BF7A 3WF3A 4XTIA 3AMKA 1QNOA 2GSHA 1BYAA 2E5DA 4O1CA 5IDZA 3E2RA 5JVLA 4CNNA 3TVAA 4H6RA 2WZHA 2IQDA 1UIOA 3RX3A 3ABOA 1XYCA 2MNRA 2W92A 4BZYA 3O1NA 4L56A 4RNHA 5H91A 4E5TA 3K8KA 1R3YA 2PTYA 4H41A 4DHGA 2GVJA 2RAGA 3R8HA 3BLPX 1G4TA 4UZUA 1K6AA 2D2OA 4M7SA 1DIKA 3W26A 1Q6GA 3RPMA 1Z7AA 3GC2A 4QRNA 5CPSA 3S1XA 5LHEA 1W3IA 3GUGA 3T4CA 2Z25A 5TIMA 2JEPA 1RA5A 2YW3A 3CHFA 1DJZA 1TPVA 4PUKA 3GTXA 1Q5MA 4OJYA 3T78A 3V0UA 1KXQA 2PDUA 3BW3A 3JZUA 1IT0A 2FVMA 4U31A 2J7BA 1UKTA 3EX1A 1ZJIA 1XRVA 3WUEA 3GBEA 4J1OA 1YDOA 4W5ZA 1D3CA 3ABQA 3VDAA 2OPJA 4C6KA 1EPXA 4P7OA 4HZ8A 5E6ZA 2DUZA 2VHLA 3FCPA 3KHDA 3LY0A 2IXVA 1V79A 2Y8VA 5EFDA 1M7XA 3EPNA 3HM7A 1FVPA 3VO0A 4KRZA 1J11A 1P1XA 2WCGA 2FKPA 4ATLA 4WGXA 1ELSA 1QPRA 3ITYA 3VIGA 2ACRA 3O9NA 3AHYA 3AS1A 1SZEA 3IIVA 3VGEA 3HQ1A 2YJQA 4ZO9A 4AZBA 2WYSA 4LTSA 1OABA 3NG3A 1HL9A 1EOMA 4UQBA 1S1RA 1C93A 4LH8A 5E93A 1IHIA 1NWUA 1OGBA 4PUJA 3NWRA 2DORA 1DJWA 3GG1A 2J75A 2DW7A 4PMVA 3DEQA 3W7MA 4L1XA 3TTOA 2EHHA 2O55A 1GORA 3PG8A 1XRTA 5AYYA 5I5RA 4QCFA 3I7QA 4HK6A 4C6FA 2OTDA 3CT2A 3WQ4A 5FACA 4PTDA 3L66A 3HJEA 4JQ1A 4IP4A 4HCLA 5C70A 4GWEA 8TIMA 4I90A 3G0SA 4AZ5A 4IMGA 3W38A 3UJSA 1PKLA 3OGSA 3DKJA 1H49A 3MYOA 4KWUA 1ZFJA 4HK5A 2J9YA 3O16A 4A35A 2PWDA 1TELA 1JEZA 2PGRA 3KVKA 1X8CA 1WZKA 1KBLA 4D8ZA 5A6MA 4REQB 4AF0B 2C16A 4G2DA 1TMQA 4LAKA 4XVEA 4HPJA 1PCWA 3SUTA 1J79A 4I6VA 3NVDA 3SO7A 3P3BA 3DFHA 2PP0A 1TPC1 2QAPA 3FA4A 1ZS2A 4GI8A 1VYPX 1HW6A 3QEZA 3VNJA 3WK2A 2V2HA 4OOUA 1WKEA 4CKQA 5LSMA 5GJPA 4YNGA 5CAHA 3OA5A 3TQKA 3PTMA 4NG3A 2EPLX 4AF0A 1JQXA 3HV9A 3OQ8A 1W1ZA 2OQHA 3CASA 1V77A 2ZXAA 3KBNA 4ZO6A 1LQ0A 3UZWA 3ZT5A 1O5RA 2VX5A 5AZ0A 5LNRA 4GQBA 2D3LA 5IBXC 4FR6A 4HTBA 3DXIA 4Z1DA 5BRQA 3NQBA 4LY8A 1P43A 1OFQA 3KP1A 4FX7A 4S3GA 3MBFA 2IQ0A 1OB0A 2ZIDA 1V6UA 2P50A 2WZTA 4PUUA 3T8QA 5CCZA 3NSMA 2E8ZA 3FNDA 3GHTA 4IGNA 4NILA 3CZJA 4S23A 3CM4A 2OWXA 1LOSA 1FY6A 4KETA 3LGEA 1OX4B 2JALA 1YEYA 3LEPA 4UTIA 4BI5A 5E70A 4EPEC 1ICQA 3MVIA 2YBUA 1E70M 2UY4A 4XIMA 2FVLA 2QNEA 3AMGA 4O19A 5A6LA 5DMLA 3EDDA 3VCNA 5I3DA 2WCAA 1FDYA 2JKPA 4PC8A 4GX9A 3AZSA 5A8GA 4ZODA 1CZ1A 4ZO7A 1VGAA 4RXFA 3C0JA 5BXRA 2XVKA 3OLIA 2OX4A 2VXNA 3N2XA 3BARA 5BOFA 1UKPA 3ES8A 1W8SA 4DWSC 4QLKA 3BJTA 4HMEA 4WQ6A 4B91A 4JIIX 3B8WA 4HCHA 4H6QA 3GVQA 4Q7IA 2J4GA 5CPMA 4NYUA 2VEFA 3NCOA 4P7RA 3TIMA 1DORA 1TE1A 2QUMA 3EMZA 2J24A 3U5YA 4QG8A 1IWPA 3GZ3A 4FIRA 2FLIA 4MGGA 1PPIA 2FDMA 1EGVA 3N13A 2BY1A 5LIKX 4MUPA 5I09A 1RZMA 2VDIA 1EJTC 1OADA 4RCXA 2PDBA 2V5BA 4F0RA 3SIZA 5D9OA 3AHTA 3UA3A 4IMAA 3BG9A 4YVPA 2DT3A 4O4WA 4Z0SA 3K5XA 1B3VA 4CQAA 2NQ5A 1LF1A 3ZWSA 3ISIX 5E5CA 2V3DA 1VJZA 1TVLA 1QNVA 3L65A 2A7RA 2OKOA 4RNIA 5HR7A 4JYDA 4QISA 4JFSA 5JXQA 1TV8A 4J3XA 1QI2A 2PI6A 1YPXA 2VCCA 3KL0A 4Y9PA 4E3TA 4KRUA 1HFBA 5MKGA 4N6FA 4LAMA 2HCVA 2Y6ZA 3CNYA 1R38A 4WDXA 3URBA 1I1XA 3ZLHA 3ZT7A 2CZEA 4YHEA 3ALFA 3Q94A 4GUFA 3PM6A 1V6XA 4JS3A 5D03A 2OYKA 1VFFA 5H1WA 3GD6A 1SPQA 4LYQA 4JKLA 2J7CA 1RUSA 1N55A 4H3DA 3FGCA 4R88A 3THAA 2UBPC 4ACZA 1FWSA 1S5TA 5U7SA 2NQJA 3LUTA 3M0VA 4PTVA 3W1XA 4ZQOA 5K4ZA 4ES4A 3FY1A 3P2VA 4DLMA 1I2OA 3NDYA 1XDMA 1PVNA 3DFSA 4H7ZA 2PWVA 2WO5A 4HNUA 1SR0A 2PP1A 3W1UA 4F66A 1YLVA 1AH4A 4L9ZA 4PTMA 2HMCA 1FP9A 3UG8A 1QXLA 3LRKA 1GG1A 3MCOA 4JIQA 1W6TA 2W9MA 1KM6A 1Y0EA 3BOLA 3CEUA 3NNTA 3G2GA 3NL6A 4J2MA 5KZEA 2QMJA 3L4YA 5CZJA 4UR7A 4ZXLA 4M7TA 1MFUA 4GKLA 4GIRA 3U7BA 4HOXA 4O8RA 3QZAA 3KRUA 2NSXA 2EG6A 3M41A 2WXDM 2PTDA 3TQVA 3PZVA 3WO8A 1EDQA 3CTTA 1QPNA 1LZOA 2Y1HA 2G0WA 3U2CA 1Q6FA 1O6IA 3CL8A 4L6DA 1AZ2A 4C1KA 5I24A 4AU0A 4DJFD 2WC3A 1PUDA 4JTFA 1K03A 3R4IA 2XJ7A 1B0IA 5AYBA 5D02A 3M0IA 4JQAA 2DVXA 1DHKA 4O1DA 4QE5A 4ZQRA 3UW6A 5DY2A 2W4XA 3URAA 3BV7A 1EYEA 3V4BA 1G94A 3C0QA 4M6PA 2X41A 4QS6A 3PWGA 3IRDA 9RUBA 2RGMA 3WNOA 2IKGA 1TZZA 3WUGA 4IUOA 4EF8A 1GQKA 3H2OA 3UCCA 3H2CA 3DECA 3C2EA 3CV6A 1K8CA 4ZE5A 4JNYA 2FZ8A 1BFNA 1AFSA 4RR4A 3NDOA 1XWYA 4J3SA 5H6HA 3IVTA 4LFYA 5D2YA 1EO7A 1DWFM 1EBGA 1IR1A 2X1IA 2YGYA 1LBFA 4GNKB 3EOUA 5ABTA 1ISVA 3AXKA 2G97A 2ZWYA 4PEKA 4Q8NA 3CUXA 2BHUA 4NSBA 1UD3A 1NJJA 5FAGA 2QJGA 4MAZA 4DJEA 3W7IA 2TMDA 3PS7A 1YXDA 3EXTA 2QS8A 4S3FA 1CNVA 4O18A 2PF0A 5DX7A 3W25A 3NZQA 1OK6A 1UH3A 5GJNA 3S2NA 3ITXA 5J8LA 1CGYA 1TFVA 3T81A 3L5LA 4M1BA 3MTWA 3EX4A 3DG7A 2DQWA 1B2YA 3W7GA 2Q3OA 3B0YA 4XO7A 3CIXA 4W7VA 4CD4A 2GQ3A 3ONCA 3NPUA 2J9XA 2AL2A 3PB2A 4HSOA 3ITLA 1KB3A 3TW6A 1XD0A 4WF7A 1PB0A 1OD8A 2XH0A 2WMJA 2FQIA 4GC3A 4MB1A 3R7MA 5K4XA 3LTYA 1LOQA 2AL1A 4HCDA 4UNLA 3VD4A 3OZYA 3S83A 4MVAA 2YZRA 3TAOA 5LIUX 1T6MA 2DW6A 1YPFA 4MKNA 2CLPA 1HVQA 3FHAA 5U4NA 3W6MA 2YR1A 2ZXQA 7REQA 4OZOA 2YCLB 3CQHA 3PK7A 3AUJA 3EWUA 3Q67A 5LKYA 3PN8A 1V0LA 2OT0A 4MKSA 4ILSA 3QYSA 3DFQA 1TIWA 3BMVA 4M19A 3PR2A 3H4WA 2O9PA 3O63A 1Q85A 4P8VA 3WDIA 4DRSA 2PRLA 4B5XA 4BKNA 4WKFA 1GOKA 5CZ0A 4FX8A 5EL1A 1DVJA 2VEKA 4GYPA 1OC5A 3VKKA 5BXTA 3PZQA 4RPPA 5G1YA 5I23A 2NT1A 4GG9A 4IH3A 3WX7A 3GXDA 4QS5A 3U6WA 5AHNA 1AW2A 3L0NA 4P7QA 5J5DA 4QDPA 4LBUA 3WMCA 1XIBA 1IR2A 1RQBA 3DFTA 4ZOEA 2BGSA 3V16A 1YX1A 3S0CA 5DF0A 4KFOA 3STGA 4EPDC 4KMQA 4ZFCA 4QEHA 2Z26A 3G1DA 2E3ZA 3HTWA 3V3WA 3UXKA 1VBRA 5HUOA 5FEZA 1VCGA 3BSGA 2QPUA 4S3AA 3W7QA 3GNPA 4KWSA 1BGAA 4NJKA 3S2JA 2YCJA 3A47A 4IP5A 2I7GA 3VM5A 1B54A 2DIJA 2YL6A 4ZOCA 3UGRA 3MC5A 3H55A 3W72A 2XH4A 1JF6A 3L21A 3VTRA 3FJNA 2R14A 3FN9A 4F2TA 3FKKA 1HKMA 2KAUC 4AC7C 3WLOA 1VEMA 4HJFA 2Y61A 1K8ZA 3L0KA 4Q8UA 3A5VA 2QT3A 3DHDA 4J3UA 4UTWA 4R27A 2VENA 5CH9A 3UWVA 4D8AA 4FPSA 1XBYA 3IGHX 1FQ0A 3EPMA 1PZ2A 3UY8A 5LGXA 1OGSA 1I2PA 5HJLA 4CGTA 3OJGA 3UG3A 1GPWA 3H2AA 4C5YA 4XAPA 2Z4GA 4UTUA 3S42A 1WDRA 2YYUA 3DGBA 3EX3A 1I0DA 1TTIA 1FRBA 2V3EA 5BU6A 3WFLA 1TUXA 2V5DA 4LALA 1HJUA 4Q4PA 5M5DA 1W0MA 1OZMA 1S2UA 1Q6CA 1GUVA 1Q2SA 3FYPA 1HUVA 2Y7EA 3LHZA 1JJKA 1ICPA 2QCLA 1V3LA 1RK6A 4P7LA 4JFVA 3UJEA 3T44A 2VX4A 3RHGA 4IFOA 2UZ9A 1THFD 4LW7A 5FF0A 1F2JA 1XV8A 1HGYA 3N2MA 1XLJA 1XICA 1J2WA 3TNBA 5AN7A 1KFJA 3G0XA 2HSAA 1JR1A 1J8VA 2RFGA 2C8NA 4IJCA 4NP7A 4ZTYA 3KWSA 4AZ7A 3THQA 2DZXA 1TJ1A 3AOFA 3ES7A 3K1DA 4YVVA 3VM7A 2AQWA 3EPOA 3U4FA 2GSEA 1XQKA 1EB3A 2RHGA 1HJSA 3WDHA 1PKMA 3GM8A 3W0KA 3GW0A 3VKBA 3GKAA 3WH9A 1JGIA 4Z08A 5JU6A 2XFFA 2NVAA 4HT3A 1VEPA 3DOPA 3WK1A 1M7PA 3ZS4A 3KL3A 4ZQCA 1YMYA 5C71A 2WPBA 4A4AA 5G1TA 5HNNA 3H12A 2RDXA 4I9MA 1R30A 4Q4MA 3UPWA 3PBGA 2QCNA 1LL7A 4H4IA 4PMJA 3W1AA 4PMQA 4EXBA 1D9EA 3U48A 1RP9A 2IPGA 3MYPA 1FH9A 3GNNA 2FJUB 3OU8A 4O12A 3GE7A 5F4XA 1L6YA 2OOFA 1BVWA 1W8GA 4LVAA 5FAJA 4Q6XA 3WQ5A 3TCEA 1XG4A 5FJRA 2NUYA 4PTXA 3VA8A 3VD3A 3C3NA 3EEZA 1R3TA 4JX4A 2REQA 3EGJA 1O94A 4MNMA 2CBUA 3NQCA 4U4MA 3W6LA 1TVPA 3ZWTA 1TWDA 4XISA 3R79A 1B1YA 1A3XA 1NWTA 2DFAA 3RG6A 4KFPA 4JDBA 4GVHA 3UPMA 3WLLA 3AJ7A 3UYCA 2WWDA 1KFBA 4FXJA 5DFAA 2D2HA 3AWOA 4HN4A 1XUUA 4EF9A 1P6WA 4XZWA 1OK4A 1B3OA 1O5XA 2HK0A 2ZUTA 2Y7FA 3HIJA 3SCRA 1VYSX 5J04A 1EH9A 2P3EA 5FOOA 4CNOA 1J0HA 4TTGA 3B8IA 4BWLC 3AJXA 2WPGA 4ROQA 1GKQA 2XGZA 1TX0A 3R25A 1EJVC 2W0UA 3W7JA 4JHOA 5EMYA 3CO4A 4R5EA 4C7DA 2NUXA 3E1F1 1OIMA 4YTQA 1V0MA 3N2TA 4REQA 1MXDA 3AROA 4XBSA 1OF8A 4C6EA 5DCBA 2CXGA 3N4EA 3KZSA 2A0NA 2PRMA 1AUSL 1TTPA 1XUZA 1KGWA 3LHTA 1F3EA 3K30A 1MI3A 4GQGA 4LUSB 1PX4A 4FHAA 4Z2HA 1POKA 4B3LA 3NM3A 1SZFA 8XIMA 3K13A 4XBJA 3WQ8A 3LX9A 1PIFA 3KTXA 3TROA 2IPJA 4A21A 3AIEA 1JCLA 4A8RA 3RCYA 1UA7A 2WK2A 3S5ZA 1IT7A 1ZSXA 4RLIA 4GZJA 2XTKA 3CZKA 1MYRA 3CMFA 4EXAA 1NOUA 1UZHA 1JDDA 4EANA 4JKMA 4OQVA 4YIWA 3REQB 4XZIA 3EOEA 3NO1A 3NOYA 1CCWB 3ICJA 2WM1A 2FFIA 4GINA 4JFWA 3GAKA 2CEQA 4ZBCA 4GQ0A 3RCMA 1OG6A 1RR2A 3Q45A 4LS0A 1OT2A 4EPKA 5LNUA 1F07A 1SYTA 4JIPA 3D46A 1EGZA 3B9AA 4JHMA 2PA6A 2ISWA 4XUYA 4H00A 3TQ0A 4QTGA 3SRFA 3A4AA 1F8MA 1GW9A 3DBPA 4W8AA 5D09A 2VURA 4DF0A 2VQUA 1I2NA 1EHNA 1HN1A 4IMDA 1WBHA 2CHRA 1YBQA 4GIEA 2PWUA 1NEYA 1F76A 1EF3A 1KLYA 4DF1A 4J3ZA 3MMDA 3VIIA 1T5AA 2PWFA 3K8LA 4A29A 4A8NA 3CZ8A 5FEPA 1V3KA 3SGZA 5CSSA 1OYCA 4FA3A 1QNPA 3NO5A 3MO4A 4FNQA 3SFWA 4O13A 3WSUA 5BYWA 3EB2A 1KCZA 1BYCA 3HQOA 4OBSA 3LTPA 3UWWA 3G1RA 3WH8A 2RJHA 1VAHA 3W01A 3B03A 4O10A 5FEWA 4CCDA 4DVOA 1OCJA 4Q8OA 3QPZA 2OFJA 1HKWA 4MWAD 4XZBA 2OZ3A 4JTIA 1TSIA 1UP3A 1A0CA 1YADA 3K2GA 4DZAA 2E77A 1E40A 4C6NA 2BB0A 2Z00A 5EFFA 5D9PA 2D22A 3WUFA 2XM2A 3ANVA 1Z69A 2CBIA 2EG8A 3H21A 5CG7A 3MP3A 3EA2A 2DT2A 2PP3A 2CERA 1FUYA 4LVDA 5CXPA 3W83A 3IJIA 1E15A 1TWIA 4IIGA 2XM1A 3T09A 3VNIA 4MSSA 1XP3A 1X6NA 3MBDA 4KS0A 4AH7A 1DTUA 2Z6JA 4WSHA 1KM0A 3G77A 1FHVA 1RQHA 4WVXA 4O57A 2YXXA 3TFXA 3ZOAA 4YYFA 1CTNA 1ZBCA 4MWAB 4L9XA 4TMBA 1UKOA 2H90A 1SFJA 1JUEA 1XKYA 4J40A 4M6VA 3ZSTA 3MMTA 1GK8A 3IANA 1OC6A 2WBGA 3GUWA 3BOFA 1UWQA 1GWJA 4EWND 1EBHA 3PNZA 3QLLA 1TYGA 4ZB5A 1UWSA 3APTA 4P8XA 1FKWA 2X09A 3VIFA 4TIMA 4PB4A 4FNTA 3QW3A 2ACUA 4MNKA 2QCDA 2B7PA 5I3GA 1H0IA 4WGHA 1G1YA 1S5VA 2AAMA 1SW0A 2HPIA 3RLGA 3CPGA 1WA3A 5BOEA 3DYOA 3KVJA 5AKQA 4X60A 3SW6A 3TH6A 2GZXA 2PTXA 3PZUA 2WMIB 3XISA 3WUBA 4WOZA 3TK7A 3PSVA 3R13A 5JMUA 1UJQA 5AYZA 3IIOA 4PCSA 4Q32A 3O15A 3WLPA 1LG2A 3SSJA 1TJRA 1JULA 1Q65A 3VDBA 2WHKA 2BXYA 2TAAA 4BEQA 1EQPA 2GPTA 3RR4A 3A64A 3O07A 2ODOA 4BWLA 2CU0A 4GYFA 4A22A 5A6BD 4HN8A 1JG9A 3EWXA 3R94A 3O05A 3RDKA 2WW5A 3VYLA 4AIEA 3GR8A 3CLWA 4C7GA 4IUGA 4RX0A 1EJRC 2AOSA 4HB7A 1IEIA 3M44A 4JAWA 2MANA 3MI6A 1EHAA 3RJYA 1NAL1 3MV01 3IK2A 4HMNA 3VC6A 3VNZA 5JBDA 3ABRA 3UETA 4ENLA 1J10A 2Y2WA 5FEXA 5TNVA 1LWHA 4QDWA 1Q63A 4NXSA 5EKYA 3O2LA 1MEHA 2C3ZA 1OSEA 2HBVA 1GHRA 4FNPA 4N02A 4J27A 3W22A 1OEPA 3LB0A 3N2OA 1JNEA 3VDCA 3CZEA 1QW8A 1AJZA 1CLXA 2VR2A 2WMKA 1TWSA 3DUGA 3TJLA 2EPMX 2FGLA 1XLGA 4KCVA 4M0XA 4L4MA 3U2ZA 1S5MA 3TN3A 4GH1A 4QJ1A 5K9CA 1JF5A 4PFMA 3BANA 2V8ZA 2AMXA 4B5VA 3QZ6A 1MRAA 3APGA 3E9AA 4D6EA 2EPHA 3AYRA 1ALDA 2WQPA 3AU2A 4AW7A 3RGTA 1TA3B 3OZPA 1QNQA 3MP4A 1W5PA 1X38A 2GJRA 4GO8A 3NQFA 4IPIA 5I0DA 1CW2A 5H2ZA 3GBDA 5AECA 1RBOB 3M0YA 4ASTA 2CXEA 1CPUA 3HQNA 1TZ9A 4QXIA 1WZAA 1RK5A 4HA3A 3GHUA 4D2JA 3TW9A 5T8GA 2VZUA 3AQUA 4RDZA 1GOIA 1YTDA 3HB9A 4RL3A 4AC1X 5AB3A 4ATDA 4C6OA 1TMHA 3L9CA 2BXVA 1Q66A 3IEBA 2OYMA 3HV8A 5HNTA 2YCEA 3C6CA 1LLOA 1DQWA 4EKJA 3BLLA 3QPYA 3IJQA 4O1FA 1JZ3A 1BQGA 2QJMA 3BAJA 1K9EA 3TYEA 2PD5A 2B4GA 3KBWA 4JICA 2ISFA 2GWGA 1C8VA 2XYLA 3RPTA 1Z41A 3O8AA 2VDHA 4DX3A 3WNLA 1LUCB 3BZJA 4BR1A 5FF3A 3W00A 3SRKA 3L4ZA 1SFLA 3PWAA 3LCIA 1V02E 4HPGA 4R53A 1KD0A 2UY3A 3KAOA 3MB9A 1JDEA 1ADDA 2NSOA 1I4NA 3W3OA 4HBKA 2Z1XA 4DM1A 3OA3A 4GVGA 5LXXA 3STCA 4H8UA 5GVJA 1SZNA 4I8DA 1HKIA 3G1SA 2I5GA 1CECA 1BWVA 3GYEA 2XWEA 3W23A 1SGJA 4UTWC 4HKPA 3R6IA 3UG5A 3RAOA 1W1PA 3CIVA 5ABFA 2OR2A 4A2RA 1WKDA 3AXHA 1OVDA 4OBTA 1ZALA 3LTSA 1Q8JA 3QLDA 4IPJA 4M56A 3N34A 4GNJA 4O1BA 1E3ZA 4XIAA 2QULA 3PULA 4MYXA 4UFLA 2AGTA 1OX6A 3THUA 5JQ9A 3G1YA 2BVYA 3F4DA 3N1AA 1WOAA 5HMSA 4FLSA 1OT1A 2DZPA 3CL7A 4QIUA 3UNDA 1KFKA 1VZWA 2ZZ3A