4AXNA

Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the serratia marcescens chitinases
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
DDAAIMPSIANKKILMGFWHNWAAGASDGYQQGQFANMNLTDIPTEYNVVAVAFMKGQGIPTFKPYNLSDTEFRRQVGVLNSQGRAVLISLGGADAHIELKTGDEDKLKDEIIRLVEVYGFDGLDIDLEQAAIGAANNKTVLPAALKKVKDHYAAQGKNFIISMAPEFPYLRTNGTYLDYINALEGYYDFIAPQYYNQGGDGIWVDELNAWITQNNDAMKEDFLYYLTESLVTGTRGYAKIPAAKFVIGLPSNNDAAATGYVVNKQAVYNAFSRLDAKNLSIKGLMTWSINWDNGKSKAGVAYNWEFKTRYAPLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITINASE C1
publication title Hallmarks of Processivity in Glycoside Hydrolases from Crystallographic and Computational Studies of the Serratia Marcescens Chitinases.
pubmed doi rcsb
source organism Serratia marcescens
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4axnA00
3AHZA 1XH1A 2EPMX 4QAWA 1DWAM 1G5AA 1GHRA 3AMKA 2W66A 4UQ9A 2QPSA 2UWFA 3FXYA 1E56A 2C8NA 1TA3A 4N0RA 5FIPA 3MUZ1 1W32A 1GQJA 3WIJA 1MQPA 3CZJA 3VMPA 3SCTA 3DHUA 1KXVA 2WC7A 3K4DA 3VDBA 1E0VA 1OIMA 4U33A 4UR9A 3EMZA 2ZIDA 4IUGA 3BMWA 2E40A 3GXDA 2WKGA 3W0KA 4ML4A 4TX8A 2YA0A 4JAWA 2XPKA 1JZ6A 2BXZA 5CPSA 1K9DA 1QNSA 4FLRA 1WCGA 3M6DA 3VO0A 1JG9A 1H11A 3QOMA 3TP4A 4F79A 1E1EA 3ZT5A 5I2UA 4TVCA 5JUVA 3BXWA 1QW8A 3ZR5A 4HP5A 3F5JA 1XD1A 4IPLA 5BRPA 2DIEA 1BQCA 5JBFA 1MWOA 4LYPA 5DT5A 2XIIA 4GZEA 5IDIA 3A47A 4S3KA 1H09A 5JIWA 3BC9A 4MNMA 4IPNB 1JYXA 2G3IA 5LA0A 4PUEA 4AD0A 3L2MA 1E4NA 1UD2A 1VJZA 4JKKA 4MNLA 1U2YA 2HISA 5I24A 3WF0A 1EOMA 4AC1X 3KL3A 1GZJA 1EH9A 2TAAA 1JF6A 4F9DA 3GXFA 1RP9A 5I3DA 1MFVA 5KZ6A 1HVQA 3O2LA 1UZ4A 2J7GA 1ISWA 3J7HA 2PBGA 4AW7A 4MADA 2YLAA 2RGMA 3UESA 4L4PA 2BNJA 4JCLA 4LXFA 2ZX5A 2J78A 3VGEA 4HU0A 2J79A 1KB3A 3GXMA 2VQTA 2A3CA 4D1IA 3ARWA 4V2XA 2VZOA 2V3EA 4OBSA 4H8VA 1BYAA 2WWCA 2BHZA 4ZENA 1FH7A 3SCPA 3VD4A 1OD8A 1ITCA 4HOWA 2YL5A 3ZJ7A 1KR1A 3BH4A 1KGUA 2O9PA 1P6WA 3OZPA 3VTRA 1XCXA 1UH3A 3ZSSA 2CHNA 1ITXA 4JFVA 3VUPA 1M01A 3II1A 2WANA 3CO4A 3AMLA 3AIVA 4NZCA 2DEPA 5C71A 3WSUA 3WL0A 1E6QM 5BWFA 3ZJ6A 4AD2A 3WFZA 3D3AA 3W37A 4AD1A 2C7FA 3CZLA 4UZUA 3W6MA 2ZXBA 5A6AA 1W9BM 3AS2A 1ECEA 3VDHA 4XV0A 4P8XA 3L4TA 3VIFA 1JYWA 3VNYA 4CGTA 4EANA 2WBGA 1J0ZA 1UR1A 1LLOA 2PWHA 1JI2A 1TR1A 4JFTA 2QHAA 4HTYA 3DC0A 2UY3A 5IHSA 3LPPA 2CCRA 2NSXA 1V08A 3W53A 4DUXA 1FH9A 1XC6A 2W67A 3AIBA 4X0NA 4CD6A 4H2CA 5KEZA 2WK2A 3L4YA 5A8MA 1WO2A 2G3MA 4AZIA 1E72M 2A3EA 1MQRA 4WIWA 3N9KA 3O9NA 2DDXA 4V27A 1DWFM 1PEZA 1W3HA 1UWIA 2J7HA 1OGGA 4ATLA 4UFIA 3W81A 4TTGA 4JZ5A 3IK2A 5FL1A 4AD4A 1VENA 5HBFA 1N82A 4AIUA 3AIQA 1Y7VA 1H1NA 3W38A 1DTUA 1W9PA 2OYMA 5D4YA 1K6AA 2YBTA 2VVSA 4TVUA 1UD3A 1TCMA 2B31A 4W7UA 4D71A 1DWHM 1G0CA 5AY7A 5FCZA 3ARVA 4J3UA 2W62A 3OLDA 4P7RA 1GHSA 2Z1KA 2VUYA 2PF0A 3PZGA 1NOFA 1UG6A 3CUJA 5A6BD 1TE1A 4P8WA 2JFEX 5ABGA 1FP8A 1OM0A 3AYSA 4NRSA 2XYLA 2JF6A 3EDJA 4PEEA 3WBAA 1R86A 1V3MA 1IV8A 3APGA 4CN1A 5CSUA 3WUEA 3LPFA 1E6NA 4JIEA 1JD9A 1UR2A 4JFSA 3WDIA 2J47A 5A8NA 3AZSA 3WD3A 4D72A 4CUCA 1XH2A 2DPEA 2GUYA 1CGXA 2QMKA 3SURA 4S3JA 1OGSA 4M80A 4PTWA 2FHBA 3S6TA 4W7WA 1LF1A 1MVYA 3VGGA 3OLGA 1I1XA 1MXGA 1TVNA 4HZ6A 4AY1A 3FN9A 1FFQA 5JBEA 1JXKA 4M8UA 3IJ7A 2BVYA 1W1VA 1Q4NX 3NYDA 4MDOA 4RL3A 1C7SA 4WJXA 4QFUA 5C70A 3PHAA 3F5KA 5AYIA 5D9OA 4K68A 2CBIA 2ZXDA 3ZSTA 4PMZA 4DM2A 4BF7A 3VU2A 5ECUA 2GJXA 1RPKA 2YA2A 1C8XA 4WKFA 3GH4A 1GOIA 1ISZA 2ZXAA 5JBDA 2WKLA 2WZEA 3SUUA 5CQ1A 3WMCA 3DYOA 1FP9A 3SUWA 1ZBVA 3LPGA 1UWRA 1C7TA 4TVDA 1VEMA 1H0IA 3D5HA 4E8DA 5M17A 1PIGA 2W5FA 3GNOA 3ZR6A 1YQ2A 3CHDA 1GORA 1EGZA 1JI1A 2G3NA 2XSBA 4U5KA 4Z2KA 3ZMRA 4WKAA 2QLYA 3ARTA 4PMUA 3VGFA 3VIGA 3BCFA 3SCOA 2CBUA 2WM0A 5A6MA 2BY2A 4U31A 5F7UA 1OD0A 1ZBKA 4PSPA 4C7FA 3AYRA 2PWDA 1A3HA 4WSJA 4UCFA 4X0VA 4M56A 2VQUA 2VX4A 5D8WA 3VGDA 1OINA 1JZ2A 2Y8KA 1ZBWA 4IM4A 5FD0A 5BCAA 1SFSA 4QLJA 5HPCA 1Q6DA 1MW0A 5I5RA 1YHTA 3CPUA 2DT3A 1E3XA 5E0CA 1QI4A 1CPUA 2WMIA 5BXRA 1KXTA 1GQKA 3FNDA 4Z2HA 1JAKA 3A4WA 2WWDA 2YDSA 1V0KA 6A3HA 3T08A 4ZE4A 5CPTA 1OSEA 1VF8A 3AZRA 4PCSA 4ZFMA 2V5CA 4W5ZA 1E73M 1E4MM 2ESCA 4HA1A 5I0DA 3MV11 1PBGA 1HNYA 1V03A 1HKJA 2EO7A 2WMKA 2ZX6A 3ARYA 4NI3A 9CGTA 4D6CA 1W1YA 1NWRA 3EYPA 1BPLB 3AMGA 1GOMA 4JKLA 2ZE0A 4H04A 1GJWA 3WN6A 1KWGA 1V3LA 4KMQA 5D9MA 3U5YA 4B15A 4W93A 1CGYA 2QMJA 4YPJA 2VVNA 1V0LA 3QHOA 3NSXA 2OYKA 4Z2IA 3IJ9A 1DP0A 4QP0A 1EDTA 4D6FA 4UQCA 1HJQA 1QOXA 3PZ9A 3W28A 4YHEA 1VFMA 3KL5A 2VI0A 4PMRA 2GJXB 3WFLA 1C8QA 3GTNA 4XB3A 1B3VA 4W84A 2VZTA 3U5UA 3AQUA 4WKHA 1E4IA 2CKRA 4QLKA 4YN5A 1V0NA 4CD7A 2Q8XA 4URIA 1W2PA 1E71M 3NUKA 1MW2A 3K8LA 3WH8A 2ZWYA 1JYNA 2D22A 2O9TA 2VR4A 4ACYA 1PPIA 3W25A 5FKYA 3OB8A 3VIOA 4PMYA 4PTVA 2DSWA 2X09A 3QGVA 3WF2A 2PWEA 1IT0A 4KGLA 1DWGM 4D1JA 4DWSA 3VD3A 6TAAA 4FLSA 1XHGA 1CTNA 1BVZA 4WLCA 3KZSA 1E3ZA 2V3FA 2WMGA 2GK1A 2E4TA 2J7DA 2WSKA 2J7CA 2XGIA 2OYLA 4E2OA 4J3SA 4PMQA 2MANA 1UOKA 3VX1A 1SMDA 1VB9A 5A94A 1XSIA 4OZOA 4ZXLA 1E0WA 4OJYA 2WVUA 3SCVA 3T09A 5ABHA 1PX8A 1ESWA 2BVTA 3N12A 4GI6A 7CGTA 2O9OA 1E9LA 4QDMA 2ZUMA 1LG1A 1CGTA 3EMCA 2D1ZA 3B9AA 5GPRA 3WH7A 2VCCA 4HA3A 2WYSA 1VAHA 5A8OA 3AJ7A 1NP0A 1CXEA 3WF4A 3ZO9A 2WZIA 1BYCA 5A2BA 4UZSA 1E5JA 2CEQA 1B90A 1WZKA 2E9MA 3B8SA 1UKOA 2E8YA 4PYSA 2WPGA 4HPHA 5C8BB 1BG4A 5DF0A 3FAWA 2BY0A 1UH4A 4PMVA 2D0GA 1BGAA 2CXGA 2DQXA 4CU6A 4FLQA 2GFTA 3WEZA 4XZBA 5D9PA 2EJ1A 5A8QA 3IAQA 1KGWA 1UR9A 4RE3A 1C92A 3EDKA 3PZIA 1NOUA 3RMEA 1FA2A 5E6YA 1WKYA 3IANA 5IFPA 2EBNA 3MUAA 3PZNA 1UWQA 1TUXA 1VFOA 4X9YA 1MW3A 1B0IA 1CENA 1XGZA 2OLHA 4J3XA 3RJYA 2BY3A 1WE5A 1JXJA 3WNKA 7TAAA 2UY4A 4PMNA 1KGXA 1WZLA 1DWIM 1JDAA 2J7FA 4DWSB 3KL0A 1HJSA 2Y4SA 1TG7A 4FF5A 3MUIA 3TTOA 2FH6A 4RE4A 3THCA 3AI0A 3RM8A 1W91A 3ARRA 4L4OA 2QF8A 2GK1B 1CNVA 1EXPA 3LPOA 5A6SA 1LWHA 1VBRA 2XWDA 4CD5A 3EBVA 3RM4A 2D0HA 3TONA 3AOFA 1BGGA 2DGAA 1J11A 3SCQA 3CUFA 1M7XA 1VEOA 1UR4A 1B3YA 1HKKA 2DSKA 3NDZA 1HL9A 2FHFA 3U7BA 1OT1A 4GIAA 3L4UA 2QV4A 5A2AA 4D6EA 1F4HA 1QI0A 4MJ4A 4W87A 1U30A 2WW5A 2D3NA 3ZJKA 3MUY1 1C3FA 2EPKX 3CHFA 2W91A 3VDAA 1BSIA 2WHJA 4HZ8A 3N13A 3MS8A 1QBBA 1WDRA 3MO4A 3PN8A 4OOUA 1TVPA 3FAXA 2VZSA 4U2YA 2Y8VA 2C0HA 2YL9A 5GNZA 4CD4A 3ARQA 2WHMA 2CYGA 2OSWA 4W88A 2FH8A 1GOOA 4FMVA 5TD4A 1QNQA 3WNMA 3VMOA 2DT0A 2J7EA 4C7GA 2X0YA 3VIJA 4AD3A 4MDPA 1J0KA 4JKMA 3BAWA 4ZE5A 5A69A 2CERA 1E0XA 3SCNA 2UY2A 2WHLA 1RP8A 2WBKA 5CZKA 1J9YA 3OG2A 2CPUA 1UWSA 3CZGA 5CG0A 3ARZA 4HMDA 4PN2A 3VGBA 4RE2A 1UUQA 1UA7A 4OUEA 3WF3A 5A95A 4ATWA 3AXIA 2O92A 4OKDA 1UKPA 5D9NA 1BLIA 3WMBA 1NWTA 3QHNA 4AMCA 2D24A 5CGMA 1NP2A 3AXXA 2GVYA 4PSRA 4QLLA 1LQ0A 3CZ8A 4MNKA 4NF7A 4LQ1A 3WD4A 1ZJBA 4FK9A 1HJUA 3GDBA 2JF7A 2XHYA 1C90A 3WMSA 2DH2A 1AVAA 1V3IA 2YA1A 3AROA 3N18A 2OSYA 3LMYA 1D3CA 1ZS2A 1B31A 4LYRA 5HPOA 3VD5A 1Q6EA 3AIWA 3SCUA 5CJ5A 1CXIA 3PZUA 4MB5A 5DO8A 4CU8A 1MW1A 3SCRA 1E43A 4HPGA 3WUGA 4KRUA 1BAGA 4OIFA 1DWJM 4NRRA 2ZUUA 4DWSD 4V28A 2VMFA 2ZOXA 3VKKA 2BXYA 3GH7A 4XUYA 3GXIA 3WDPP 1UKTA 3WH6A 5M3WA 1QNOA 1XD0A 4R27A 3I3EA 3OA5A 1BHGA 1KCKA 1WZMA 1HF6A 4C7DA 1H2JA 3ARSA 1J01A 4WSKA 1IZKA 1QNRA 2YBUA 1UD8A 1ZBCA 4W8LA 5BYWA 4PCTA 1JD7A 3WNPA 5AC4A 1PJ9A 2X2YA 4CCDA 1V3KA 1CLVA 5CPQA 2X8RA 4UOQA 4CVWA 3MSDA 4UNIA 5GNYA 4NSBA 1XV8A 3VNZA 4D6DA 3OIHA 3SUTA 1O6IA 2IXUA 4GINA 3G6MA 2V3GA 1JFHA 3GNPA 1XYZA 1J18A 1OBAA 1H3GA 4ATDA 1A47A 2PI6A 1MXDA 5D8ZA 3UCQA 1EO7A 3MANA 3GBDA 4GZIA 2NT0A 3TTQA 4IISA 3AFBA 1ISYA 1UZ1A 1QPKA 4AWEA 1NOWA 3F5LA 3SUSA 1MFUA 2FDMA 4OBRA 5BROA 1RH9A 1HJVA 3WD2A 1JZ8A 1GUVA 2EXOA 3N15A 3K8KA 2AOSA 2CBJA 1NWUA 1BG9A 5BXSA 4KWUA 1E1FA 1JIBA 1JGIA 2GSJA 1W3KA 1JZ7A 2D23A 5E9AA 4PRWA 1W3LA 1EOKA 1GVYA 1UR8A 1B3ZA 4B3LA 4Q7NA 1UA3A 2XVNA 4MAZA 1CECA 4CCCA 3WH5A 3AS0A 3TOPA 3VILA 5E70A 5FOOA 4MNJA 2J75A 1FFRA 2VX6A 3VIMA 3WDHA 1W9VA 3ARUA 2XSAA 1ODUA 3RDKA 4MB4A 1E55A 2YDQA 5E0FA 1J10A 1PZ3A 2WVSA 3BAYA 4F66A 4P7OA 2JALA 2V38A 3WD1A 3RO8A 2NT1A 1CDGA 5JIPA 2XIBA 1K9TA 1F4AA 1PX3A 1VJSA 2YLLA 3TA9A 1S46A 2DT2A 3I3BA 3MMDA 3ZQ9A 3CH9A 1R7OA 1R8LA 4F8XA 3DYMA 3T0AA 4F9JA 2WC3A 2CHOA 5I78A 3WD0A 3HMCA 1KQZA 4H8HA 3OGSA 1VFFA 4GKLA 1HXJA 1VIWA 1V6XA 3GM8A 1LG2A 4Z2GA 1SYTA 4LX4A 3T2OA 1UD4A 4ZEPA 3PZQA 4BS0A 6CGTA 4UQEA 2WVTA 3O6AA 2CKSA 3JUGA 4UFLA 1D2KA 1UD6A 1NH6A 2J7BA 2VCBA 1R7AA 1WDSA 2WLYA 3UETA 1V6VA 1GCYA 4E8CA 4XZWA 1LJYA 2VURA 3VD7A 4BA0A 3VIKA 2D20A 1X1NA 1J0HA 1HKIA 1H41A 4WK9A 4BQ4A 2IUZA 5CLWA 3BLPX 4MB1A 4W86A 1EQCA 3CUHA 3QOKA 5DMYA 2A3BA 2WHKA 3SCWA 5ABEA 1E70M 5LA1A 3PZOA 2DSZA 5FL0A 2WC4A 3PZMA 4J28A 2YL6A 1JAEA 4GQRA 2D2OA 1KXHA 4JHOA 2CITA 3HU7A 2G8ZA 1GJUA 3VINA 4A4AA 2OWXA 4TOQA 1TFVA 3N11A 3BCDA 3CUIA 4D6GA 4H41A 4W8BA 5DFAA 3VM5A 1QI3A 4U2ZA 1CGUA 1R87A 3W29A 2GJRA 3A6OA 2E9LA 2JIEA 1I75A 2ZX9A 1E40A 3W4RA 4GI9A 1AMYA 2Y5EA 4LPCA 5LA2A 4U5IA 3W6LA 1W1TA 1XCWA 4A3HA 4MPKA 3WDQA 3ZT6A 4Z2LA 3L4WA 3A4AA 1XH0A 5BXPA 3NSNA 4JCMA 5ABFA 1E6SM 2Y2WA 4TXEA 4CU7A 2BHUA 1EDGA 4KH2A 4UQBA 1ZJAA 2BFGA 3CUGA 4J3TA 3W26A 1KCLA 1UHVA 3AIRA 1ZU8A 2VZUA 3K1DA 3A3HA 5I6SA 3BAJA 3U57A 3FHQA 4GO8A 4WF7A 1XYFA 4CCEA 1SR0A 4AIOA 4AZBA 3WF1A 5E09A 3WL1A 1BF2A 3L4ZA 4OOZA 1FOBA 4AD5A 3UG3A 3FW6A 2E3ZA 1W9XA 4H7VA 1EIBA 2VCAA 4UQAA 2JIWA 2EQDA 3NDYA 3AIEA 1GVIA 2VRQA 1NQ6A 5GNXA 4AEEA 1G94A 3PBGA 2CIPA 3CBWA 3RCNA 3WNNA 1E6ZA 3MU7A 5A3HA 1J12A 4HA4A 2ZICA 4M1RA 3EMQA 4CVUA 4BCEA 1FH8A 8A3HA 1WNOA 3FY1A 3CHCA 2ZUWA 2V3DA 4E4PA 1JNEA 1NWSA 3THDA 4AIEA 3UR7A 4J3WA 1GONA 3OLEA 4J7RA 3WNOA 1X6NA 3CIVA 3TTSA 1B30A 1W9UA 4H8UA 2D3LA 2XTKA 1U33A 3A4XA 1CXHA 3WDJA 3WEMA 1UQYA 1GOWA 2NW0A 4MTVA 2F8QA 4EK7A 2WZHA 1OT2A 4U3CA 1OWQA 1QNPA 1VBUA 2VT0A 1BYDA 2F61A 3W82A 2XGBA 3L4XA 4YHGA 2A3AA 3NCOA 2G3JA 3N1AA 3WQ6A 2ZUVA 3VOCA 1G1YA 1C93A 4DUVA 2DSVA 4A3YA 2YIHA 1CIUA 3M07A 1JDDA 1TMQA 4BQ3A 3OGRA 1CYGA 3WQ8A 3N17A 4GZJA 1B3WA 4HOZA 2FGLA 4TTUA 1WDPA 1M04A 3AHTA 2X05A 1GOQA 1V6WA 2JEPA 2BVDA 3MSGA 4AZ7A 2XVPA 3OLIA 1E6XM 5ABFB 3NSMA 3W24A 2F2HA 3WENA 1V02E 3CMJA 3PZVA 1QI2A 2ZWZA 3WQ5A 1AQHA 2WCAA 3RM9A 2XWEA 3E1F1 4GQQA 4ACZA 4AZGA 5A2CA 4JL1A 3VGHA 2XVKA 2A3HA 3WELA 1OB0A 1DHKA 2VRJA 1X6LA 3VX0A 3BAKA 2DT1A 4DM1A 4QCEA 3WNLA 4W85A 3AMCA 2VNCA 1E15A 4DWSC 1PIFA 3CMGA 1UH2A 1KQYA 2ZX7A 3M46A 1L0PA 3CHEA 3ZIZA 3K46A 1K9EA 4GXPA 4AZ5A 4HZ7A 4GI8A 2WAGA 4UFJA 3ZJ8A 2FGZA 1J0IA 4GO9A 3VIPA 2VOTA 3UEQA 1J0JA 1CGWA 3B9EA 2J25A 3ALGA 4HMEA 3CGTA 3IJ8A 2WMJA 4PMDA 3U7VA 2PWFA 1QI5A 1US3A 4ZXOA 2YOCA 3WH9A 4CD8A 2WVVA 1HJWA 1DEDA 2DSUA 2OWWA 3IAPA 4B16A 1UWUA 2CBVA 1H4PA 4Z2JA 4BQ2A 4LGXA 4PMXA 3ARPA 2AAAA 1Q6CA 1WP6A 3QHMA 2HVMA 1HP5A 2ZX8A 3VDCA 1HN1A 4CN6A 2EPNA 1CZ1A 1TA3B 5CSYA 4Y7EA 2BS9A 1B2YA 1TZ7A 3WEOA 1HX0A 5EB8A 5M5DA 3K4AA 8CGTA 1LWJA 1US2A 4P8VA 1V6UA 2Y24A 2XFYA 4D6IA 1GNXA 2J74A 1H5VA 3PZTA 3WUBA 3WDRA 5DT7A 1B1YA 1XRVA 1GW1A 3POHA 5EFFA 4AZHA 4HOXA 1MYRA 1GQIA 1OIFA 4B9ZA 2E9BA 5EFDA 2XVLA 3VIHA 1K9FA 5IHRA 4JFUA 1UR0A 1HP4A 4UFHA 3POCA 4P7LA 1CLXA 1AQMA 2YDRA 3ZM8A 5AYBA 1LL4A 3AISA 4UQDA 3T0DA 5IFTA 2XFRA 1VEPA 1GQLA 1E5NA 1M03A 4ACZB 5I79A 2VR5A 2YL8A 5DEZA 4UTFA 1QHPA 2VRKA 1ZB5A 1V3HA 4PMOA 5GQBA 3VPLA 7A3HA 3CLWA 2PBOA 3ALFA 3CZEA 4U3AA 2JEQA 2VL4A 4AZCA 1W1PA 3SEPA 5CXPA 3BAIA 4TUFA 1V0MA 4W89A 4W7VA 3M7SA 1XSJA 5CGTA 2PWGA 4BZYA 4PTXA 1B3XA 1VRXA 4EAMA 3ZOAA 1BTCA 2G41A 4Q22A 5EMYA 3UG5A 1Z32X 2ZUNA 1O7AA 2E0PA 1E4LA 1WPCA 1HT6A 3ECQA 1XSKA 2WLZA 1AQ0A 3T2PA 3GNRA 2WVVB 2GDUA 1CXFA 2WCSA 1EQPA 2G4FA 4GPNA 4UOZA 1GPFA 4M81A 1JL8A 4M24A 2OWCA 1G01A 2BV9A 2JE8A 4P8UA 3OZOA 3TTYA 2YKKA 2XG9A 3PTMA 2GJPA 3UR8A 3HN3A 1J0YA 3DYPA 3QR3A 5A1AA 3AS3A 2J8GA 1CXLA 4JFWA 5A6LA 1HKMA 1UWTA 1EHNA 4J3VA 1CGVA 4B9YA 3SUVA 5A6KA 3MMUA 4D6HA 1E6RA 3AICA 5BRQA 5AC5A 2EEXA 1D7FA 4HMCA 4JL2A 3K8MA 3RILA 1QVBA 2WMFA 1GOKA 1WZAA 4JHZA 3AMDA 3RJXA 1JFXA 3DECA 1SMAA 3WQWA 5A6JA 2W63A 2CESA 4PBGA 1B9ZA 1EO5A 2QPUA 1JYVA 2WCGA 1QBAA 2XUCA 2J8FA 4D6JA 4QCFA 1JZ5A 3S2CA 3BMVA 2FHCA 1ZL1A 4J27A 1G9HA 3UG4A 3MKKA 2O9RA 3BGAA 1KBKA 4LYQA 2WSPA 3DHPA 4W8AA 1WAWA 3VMNA 3L4VA 5EBAA 3MMWA 3AXHA 4P7NA 2ZUSA 2OSXA 1H49A 1ODZA 1CBGA 3G6LA 2Z1SA 1Q6FA 2UY5A 3GH5A 4UFKA 2CETA 3OGVA 1BVNP 1LL6A 3KWXA 2WMHA 2DH3A 4AZ6A 5E6ZA 3AIUA 3WBEA 1M53A 1EA9C 3CZKA 3HJEA 1V6YA 3WQVA 3I3DA 4AZCB 2W61A 4TX6A 3EDEA 3PTKA 1BYBA 2WNWA 3WUFA 3W27A 3BSHA 1QW9A 4CN4A 1UKQA 2VX7A 2IXVA 5M03A 3ZT7A 1V02A 1WDQA 3FHAA 3T2QA 3EDFA 2PB1A 1NM9A 4KGJA 3VIIA 3WQ4A 5HXMA 3ARXA 2WXDM 1QHZA 2AMGA 4AXNA 4FLOA 2J62A 3KEHA 2VX5A 3MV01 4PTMA 3KE0A 1PX4A 1MQQA 2YJQA 3NIYA 4HU8A 1FHLA 1E6PA 5BXTA 1CEOA 1JNDA 1WB0A 1KFWA 3SIMA 4DUWA 2D0FA 1W3JA 2X0HA 1HIZA 3UERA 2CNCA 1L8NA 2EPOA 3BAXA 2X1IA 1R85A 1UYQA 2WB5A 4UFMA 4M82A 1HJXA 2W4XA 4W5UA 3VD9A 5HOSA 3VM7A 3AZTA 1KR0A 5HNNA 4MAVA 3RIKA 2VZVA 2XFFA 1PAMA 3GBEA 4UOJA 1OGBA 4R5EA 1UKSA 1C8YA 3AS1A 4XX6A 4B3KA 2W92A 3SCSA 1PZ2A 1EHAA 4EE9A 1C91A 2BY1A 4KRTA 3RPMA 1V3JA 2XJ7A 2PC8A 1HL8A 3EDDA 2DIJA 4AEFA 2VO5A 1JZ4A 1ISVA 2V5DA 5A6BA 3NJ3A 1IZJA 5HDRA 2RGLA 3BSGA 1VFUA 1CWYA 3T0BA 5I77A 1JF5A 1Q6GA 3BLKA 2XM1A 1BFNA 4P7QA 2VJXA 1ISXA 1EDQA 3AHYA 1KXQA 5A8PA 1UQZA 3WY1A 1JZ3A 4M29A 1H0GA 4AISA 1UD5A 2EPLX 1RD6A 2XVGA 4MJ2A 2VC9A 3PTQA 3GZAA 5CLTA 5LYRA 5I23A 1FHDA 4EKJA 1W9DM 3AHVA 5IXEA 2BHYA 2ZXQA 3WKZA 1I1WA 2XM2A 2WMIB 3F4VA 3OBAA 1QHOA 3CTTA 1HVXA 4MB3A 1KWKA 2J77A 1KBBA 2E8ZA 1JDCA 3N04A 4PUDA 3AHXA 1CXKA 4BQ5A 2J4GA 3B9DA 3L2LA 3VVGA 1W2VA 2GDVA 1OCQA 4N42A 2ZUTA 1NARA 1LL7A 4CKQA 2VTFA 3GYCA 4AYSA
chains in the Genus database with same CATH superfamily
1CB2A 1PKLA 1DWAM 4OUIA 5HMSA 1EP1A 2Y62A 1G5AA 1GHRA 3K4WA 3AMKA 3OYZA 2QDDA 1TA3A 3MUZ1 3W1NA 1JEZA 4Q8OA 3VMPA 1VBGA 4K1WA 2B7OA 3BJFA 2E40A 1ADOA 1FWRA 4GH3A 1SW3A 4JAWA 5CC3A 3JR2A 2XPKA 4GNKB 2BXZA 5HINA 4FLRA 2ZYFA 1WCGA 3M6DA 1PCWA 4M7TA 4TVCA 3F5JA 4GQGA 4PA8A 5BRPA 2CW6A 1MDRA 1BQCA 4JEQA 1NY1A 4HB7A 5DT5A 5IDIA 5C6MA 1H09A 5JIWA 2ATMA 2R1PA 3W88A 5CZ0A 4N4QA 1Q8JA 4GH1A 1Q7QA 3NL5A 1VJZA 1TUFA 1PS9A 1EEPA 4JKKA 3WF0A 3W1LA 1EPVA 4RCXA 4B4FA 1JF6A 1UC5A 4EPDC 1HVQA 2J7GA 3VNIA 4L9ZA 1H62A 2YLAA 3LCHA 5EMUA 3UESA 4LXFA 2ZX5A 3SJNA 3GR8A 3W1PA 5C9UA 2J79A 4IJBA 3GXMA 4V2XA 4B2DA 4E2BA 2VZOA 1OF6A 2V3EA 1VPQA 4Q8MA 2WWCA 2GGJA 3PBYA 2YL5A 1KR1A 2W3ZA 3BH4A 3W02A 4O19A 3R94A 5I3IA 3PTDA 3MP3A 3B05A 1UH3A 3ZSSA 3VUPA 1M01A 3CO4A 3AMLA 3AIVA 4ICMA 4O28A 4KIRA 4AD2A 5TIMA 1REQB 4AD1A 4UTUA 2POTA 3BLEA 1V7AA 3W7GA 2ZXBA 3AS2A 4G8TA 3VDHA 4DWDA 4CGTA 5T9CE 3KBMA 3G0UA 1J79A 5EMKA 4JFTA 2QHAA 4HTYA 5IHSA 3LPPA 3LA4A 4HSNA 3W53A 1XC6A 3AIBA 3CLMA 4X0NA 2FZNA 4NL1A 1R9YA 4ZQMA 1LYXA 4S3FA 4E4FA 1KFBA 1ADDA 1RK6A 3R8HA 2V2CA 3VYLA 1E72M 4AZIA 1YMYA 1HUVA 4L1XA 1MQRA 5AYZA 1XG3A 3O9NA 2DDXA 4V27A 1PEZA 1VD6A 2VM8A 2Y7FA 3HPSA 2QVNA 4JZ5A 3C86A 4B5XA 3IRSA 5FESA 4AIUA 3AIQA 1Y7VA 4UTTC 1W9PA 5D4YA 2REQB 3B3DA 1K6AA 1XKYA 2VVSA 3EWYA 1UD3A 2OB3A 2B31A 4YWIA 4D71A 1DWHM 1G0CA 3CB3A 2AAMA 4J3UA 2W62A 4IFKB 1GHSA 1QOQA 1POJA 3SRHA 4C6OA 1OK4A 5A6BD 1TE1A 4ICNA 1FP8A 2XYLA 2VHLA 4PEEA 3APGA 5CZSA 4CN1A 3GNNA 4DO5A 3WUEA 4GJ1A 1XF0A 2I5IA 1TV4A 1JD9A 4JFSA 1ZHAA 2WO5A 5H8MA 1QT1A 4XKYA 3H8AA 1ZGDA 2HROA 4D72A 3S9YA 2QULA 4Z0SA 3JRKA 1CGXA 1L6WA 5DN1A 5D2TA 1N8FA 4M80A 2DIKA 2HVNA 3S6TA 5D03A 1FWJC 3URNA 1MXGA 1TVNA 1IGSA 1SFLA 4EIVA 5LHEA 4LVAA 1JXKA 1AODA 4HHPA 4I90A 2W6RA 3MO7A 4KEVA 3N2OA 1Q4NX 1RY8A 1XX1A 3LTSA 4HYRA 4MDOA 3EWBX 1CLKA 5C70A 4IIBA 3LN3A 4O4WA 4E4UA 2C18A 2CBIA 2ZXDA 3B9OA 3S6DA 4BF7A 3VU2A 1L8PA 2GJXA 4LJ3A 1C8XA 4LU0A 2G97A 3H55A 2WSQA 1DIKA 4REQB 3K2GA 5G2HA 1OADA 3DYOA 3T55A 4I3GA 3SUWA 3W7IA 1PYFA 1UWRA 4L61A 2QDHA 3N19B 2ZDSA 3P2VA 4E8DA 4Q8WA 1KM5A 2ZTJA 3ZXWA 1YQ2A 3SIZA 2Y6ZA 1JI1A 4O14A 3GVWA 4Z2KA 4WKAA 4MWAB 5F2MA 2CBUA 2P8CA 5C7VA 1E9ZB 3VUSA 4U31A 1WOBA 1OD0A 3NZGA 4L6OA 3BW4A 2BOEX 3AYRA 4YU1A 2PWDA 2VC7A 4PUKA 4QX4A 2FZBA 1LUCA 3MBFA 2VQUA 5D8WA 3N3TA 1DKWA 3M44A 2X1SA 3EWXA 5FD0A 3BZGA 2ACQA 1Q4WA 3CL7A 4O0KA 4O1CA 4ONVA 1MW0A 3P62A 1YHTA 4YMZA 5I5RA 3A9BA 3VKAA 5JU6A 1KXTA 1GW9A 2HNHA 1K6WA 3L0NA 1KO0A 2VD8A 2AGTA 3AJXA 3QLLA 4HKPA 2YDSA 1U1HA 4MUZA 3OYXA 4ZE4A 3AZRA 1AMKA 3KBJA 3GG8A 1J6PA 3ITYA 5I0DA 5DBUA 2NQ9A 1U83A 2PDYA 1HNYA 1V03A 1N8IA 5D30A 5RUBA 2DVUA 2EO7A 4FX8A 3FXGA 2GWNA 4FP1A 3EWCA 6REQA 1NWRA 3H26A 1SM9A 1XDMA 3AAMA 4JKLA 4H04A 1GJWA 1YDVA 5DXXA 4I9TA 3A21A 5D9MA 3U5YA 2QMJA 4HQVA 4MWAE 2ZZ4A 1ZNNA 1V0LA 3CAWA 3NSXA 2OYKA 3E0VA 1RBLA 1EDTA 4GOAA 3QV6A 5DX7A 3R4IA 3ME3A 2VDHA 3T8QA 2OKOA 4QHRA 3PULA 4IIGA 3O0FA 4MF4A 4XO6A 3GTNA 4XB3A 1B3VA 4C5YA 3DFSA 2VZTA 4B5VA 3U5UA 1DQXA 3AQUA 1FCBA 2PA6A 1XGEA 1E4IA 2OO0A 4QLKA 2ZC1A 3BV7A 1V0NA 3N6QA 2WZTA 2ZADA 1E71M 2ZBTA 5K2ZA 4FOKA 3BOLA 3KTSA 4F2TA 3N4FA 1RY0A 1WA3A 2IQDA 3K8LA 4DBUA 2F6KA 5T8GA 2ZWYA 1ONEA 3P61A 2VR4A 4GC3A 1QPNA 4U4MA 3TK7A 3OB8A 3VIOA 3U0HA 2DSWA 1TJRA 2BTMA 5I3FA 2Z00A 1DWGM 1TPEA 5EMMA 4PUWA 4ZZ9A 3VD3A 1XP3A 2TSYA 3HG3A 4YVVA 1QW7A 2FPYA 1R5YA 3KZSA 3MUXA 3CJPA 2V3FA 1S2AA 3A3XA 2E4TA 4NU7A 2J7DA 2WSKA 3EX3A 3REQB 2XGIA 4J3SA 2MANA 5I03A 5G1TA 5AN7A 3L0KA 3WQFA 1CX9A 5A94A 4OZOA 1ZPTA 4UTHA 1F7BA 2VEFA 3SCVA 3CV2A 5ABHA 5HR7A 1GGOA 1ESWA 2ZDRA 4G2DA 7CGTA 3PNZA 1E9LA 1TR9A 4MVAA 3MA8A 2D1ZA 2FB2A 3NL2A 5CEWA 5FAGA 4R3UA 1NP0A 3ZO9A 1XIHA 5ABTA 4HJWA 5A2BA 3VOFA 4HTBA 2Z4GA 4L1GA 1UKOA 1G6CA 3VNMA 1MRQA 5DY3A 3DGRA 3GG0A 3LCFA 4GBUA 4XZNX 3PBWA 5HJLA 3BG9A 3SRFA 3H2AA 2DFAA 4ZB2A 2GFTA 3WG6A 3WEZA 5CBBA 3NPVA 1XLEA 3BLFA 2EJ1A 5A8QA 3B8UA 4CNTA 1KGWA 4KWOA 4C6EA 5CCZA 4KF1A 3AYTA 2ZZ1A 4RXFA 1MZHA 4IGNA 5HMEA 4O13A 2H9AB 4OGZA 5E6YA 4A2SA 3IANA 4D2JA 5IFPA 1KA9F 3MUAA 1UWQA 1TUXA 2XH2A 1V77A 3ONBA 3W7CA 4X9YA 1MW3A 4L80A 1W0MA 5BU6A 2OXNA 3EOLA 7TAAA 2UY4A 4PMNA 4GJIA 1W1B1 4HSOA 1RV8A 4RJEA 1TG7A 4MYAA 4HPXA 3RM8A 4I7UA 1W91A 1OYBA 3CQHA 1CNVA 3U4FA 5A6SA 5CC5A 3QY6A 4OV4A 1VBRA 4CD5A 3RM4A 3UJFA 1TPVA 3PFMA 3S1XA 2PTYA 3F7JA 2DGAA 3CUFA 1M7XA 1VEOA 1UR4A 1NQKA 1QFEA 5D38A 3V18A 4UC5A 4RKAA 1TJPA 3U7BA 1OT1A 3L4UA 3N2CA 4D6EA 1QI0A 3B8VA 1ECQA 4WXYA 5IBXA 3W2NA 2VFHA 1U30A 2WW5A 1YPXA 2D3NA 1AL7A 3VDAA 2VEIA 3WQCA 3UA3A 4PTNA 2WHJA 2QAPA 3N13A 1DJHA 3IGXA 3MS8A 2H8XA 4Y9NA 4PFHA 3IPWA 5FF2A 2EAWA 1TVPA 3FAXA 2JK2A 2C0HA 3LLXA 1Z42A 2OSWA 1GOOA 1PKMA 3WNMA 4C7GA 4ROQA 3VIJA 4MDPA 3KOYA 3QH2A 1RXOB 7PTDA 4XTDA 5CC6A 3BAWA 2CERA 1IXPA 3VNDA 2UY2A 3CO8A 2WHLA 2WBKA 2Z7GA 4O16A 3GG1A 2GSHA 3TQKA 1GQNA 1X8FA 3GIPA 1XDJA 1JDFA 1XW8A 4K2SA 4X9SA 2O92A 2WZMA 3PB0A 1UKPA 2A5HA 4J9JA 2FMNA 3WMBA 5CGMA 1NP2A 4A35A 3MY9A 1TJ1A 4QLLA 3AUOA 1YDYA 1LQ0A 5CGQA 2Y5JA 2OT1A 4MNKA 4X60A 4LQ1A 3WD4A 2V2DA 4AH7A 2HK1A 3AXMA 1VC4A 3GDBA 2JF7A 1XC4A 3T4WA 3MW7A 2WOQA 1V3IA 3AROA 3N18A 3BJTA 1ZS2A 2DUXA 3SCUA 3PY2A 3UPBA 3DBPA 3SCRA 2PGFA 1E43A 4HPGA 3QC0A 1ML1A 1DWJM 5EY5A 3C61A 4DWSD 2VMFA 4ZQPA 3S1WA 3WH6A 1J5TA 1XD0A 4RW3A 3B4UA 3SO7A 4JYDA 4WSKA 1ME7A 4JQ1A 2ZTKA 4W8LA 5BYWA 4I9AA 2BB0A 5LGXA 3CQIA 1TO3A 1ME8A 2Y63A 1V3KA 5CPQA 4Y8EA 1EF3A 3GC2A 3UYIA 3HTWA 5GNYA 1XV8A 3EB4A 4D6DA 4H1ZA 4JTCA 2ZVRA 3C52A 3G6MA 3O7UA 4DJED 1BRLA 1JFHA 4KIEA 3SN1A 3S4TA 3GNPA 1H3GA 1E1CB 3FA3A 4J1OA 1Z89A 3H4XA 5D8ZA 4E2VA 2V5BA 3UCQA 2HTMA 3KLKA 2Z1VA 1R0MA 3MANA 3WYZA 4IT1A 4MPQA 4GZIA 2NT0A 4H8NA 1ISYA 2PGRA 2Z24A 1IIHA 4FNTA 5BOOA 4QE4A 1NOWA 3W72A 4O8RA 1JZ8A 2AOSA 2CBJA 3E2RA 1MXSA 5BWAA 1W3KA 1V8EA 2D23A 2QDEA 2P50A 4PRWA 2YW4A 3BICA 4B3LA 3GUWA 3TWBA 2XVNA 4GQ0A 4H3DA 4CCCA 2J8TA 5G4WA 3WX7A 1ADSA 1LORA 2BP1A 4LS2A 1HKWA 2HZGA 3WDHA 2JKEA 4IG2A 3ARUA 1ODUA 3RDKA 3L7RA 1AJ2A 5PTDA 1E55A 2ADAA 2W79A 1IEIA 1Z8AA 3G5EA 4IXXA 3ZYZA 2V38A 4S2CA 2NLYA 3WD1A 4AMAA 3IUIA 3LM3A 5JIPA 2XIBA 4H9TA 4R53A 4DUOA 1PKYA 3I3BA 4QE5A 5JQ9A 3G0SA 4F8XA 3DYMA 4JPGA 3LBMA 2ZKMX 5AHFA 2CZDA 1QCWA 3N9RA 4AF0A 4H8HA 1I9CB 1VFFA 1IT7A 4LV9A 1HXJA 2YBVA 3CV1A 4QM1A 4GIEA 4IP4A 5XIAA 1JDEA 1UD4A 4ZEPA 2OX4A 4UQEA 3JUGA 3WQDA 1D2KA 2J7BA 2VCBA 1GVRA 1R7AA 2CLHA 1GCYA 4UMBA 4YNGA 1N8WA 4YL2A 1LJYA 2VURA 3KRBA 3VD7A 2F2KA 1NF7A 4BA0A 3VIKA 1H41A 2IUZA 4TX9A 5CLWA 3BLPX 4L6HA 4MB1A 2V6AA 3MYOA 2A21A 2A3BA 4I7WA 3TYUA 2HDJA 2P3EA 5D32A 2CU0A 2RFGA 3PZOA 3DHDA 2WC4A 1FQ0A 3PZMA 5IDZA 1JAEA 4GQRA 2D2OA 5TAOA 3BARA 3W7QA 1S5MA 2GQ3A 2OWXA 4H41A 2QZRA 2HS6A 3VM5A 2VENA 4PCFA 1QI3A 1IF2A 2FQIA 5D37A 3OVGA 4X61A 7TIMA 1R87A 4V1XA 3IJDA 2QCDA 1FWSA 3A6OA 3UNDA 3CIWA 4UIOA 4GI9A 2Y5EA 3PBVA 2WJZA 3W6LA 1W8GA 1XH0A 2KAUC 3BW3A 2QW5A 4JCMA 4KQNA 1E6SM 3M7WA 2Y2WA 4KH2A 1LTDA 3TYDA 1ZJAA 4J3TA 3U2OA 1KCLA 2D73A 1J96A 3HPAA 1ITQA 4NILA 2ODOA 1XYFA 4ZO6A 4WF7A 2Y0FA 6ALDA 1YIXA 3QQWA 2Q3OA 1FOBA 2KX9A 3PNUA 4DJEA 3FW6A 4JR5A 2JIWA 4AG0A 1OG6A 2EQDA 3BGJA 1NDZA 1GVIA 2RDTA 5GNXA 3ABZA 1X1OA 4GABA 3PBGA 2ZZ2A 3STGA 5EMJA 3SGZA 3CBWA 1QPQA 2QCEA 1Q7ZA 3E6EA 3B40A 4ADTA 4M1RA 4ZQNA 3GB6A 1FH8A 4DZHA 5C9ZA 3OQEA 4HHHA 3KCLA 4E4PA 3LMZA 1THFD 4BFAA 3UR7A 4KCUA 4AVFA 3TSBA 4XZ9A 1YBQB 3TTSA 1B30A 5FJTA 3V5CA 2QEZA 3H23A 1EJUC 1TTIA 1U33A 4A22A 4NXSA 1CXHA 3WDJA 3GR4A 1KTNA 4HK6A 4U3CA 1VBUA 2VT0A 1A49A 2UBPC 1YXDA 3MVTA 1MNZA 4IL0A 3N1AA 4Q32A 1MO0A 4XZIA 2DSVA 3VOJA 4A3YA 4C60A 4LOCA 1W1ZA 1VPYA 5LNUA 4BQ3A 1CYGA 3WQ8A 2GPTA 4IMCA 3LD5A 3WLKX 1Q2RA 1GOQA 1V6WA 2JEPA 3NO5A 4HT3A 4FR6A 1E6XM 3M64A 4QJ5B 2DW7A 2F2HA 3WENA 4DO4A 1V02E 3CMJA 5KZDA 2WCAA 1A80A 1K1DA 3LTYA 2XWEA 3E1F1 3P5ZA 5A2CA 4JL1A 1M1BA 1V7YA 2AL2B 1DJNA 1OB0A 1FWCC 4IXHA 1CB7B 2Q8ZA 3NURA 3W87A 3M0KA 1NFGA 3IJLA 2V5KA 3UR2A 5D2XA 3UVAA 2VNCA 1PIFA 3CMGA 3N2XA 1SSDA 3M46A 4MLJA 2RAGA 3CHEA 3A12A 3ZIZA 4GXPA 4HNOA 5EPDA 5BU9A 1M41A 3APYA 1O5KA 2NUYA 4UFJA 2FGZA 3ZJ8A 4RNHA 2VOTA 3B9NA 1XFBA 3QZAA 2GUUA 1PHWA 3W07A 2PDNA 3IJ8A 2WMJA 4PMDA 1QI5A 4ZXOA 2YOCA 4XAFA 1DEDA 2DSUA 2R24A 1VQTA 4Q8QA 3PG8A 1SZNA 3W7NA 4PUMA 1HW6A 3ARPA 4Q8UA 1Q6CA 3UR5A 2DZXA 4Q8TA 3ITVA 2C14A 4DJFC 1VHNA 1O60A 1TA3B 3VE9A 3WLMA 5CSYA 2Q3RA 3ZR4A 1X97A 2A2IA 3KOWA 5EB8A 2PDHA 5M5DA 3DG6A 1US2A 4XAYA 1W3NA 1V6UA 1YEYA 4LB4A 2J74A 3I7QA 3QQ1A 1BKSA 3PZTA 3WDRA 1XRVA 5FJPA 2Z2UA 2PLJA 1QU4A 3CU2A 3LXBA 3TAOA 2E9BA 3VIHA 4QSHA 1K9FA 3LDVA 3GIYA 1XIJA 1IEWA 2NVAA 1GEHA 1AQMA 2CZ5A 1K7EA 5IFTA 3NVTA 2NV1A 3ITXA 1M03A 2PWVA 4ACZB 4IIHA 3B06A 3LNPA 1QHPA 2E5CA 2VRKA 1KFKA 3DFYA 5GQBA 2CWXA 2HBVA 3R58A 3VPLA 2Y7DA 3H2FA 4TV5A 2O0TA 2PBOA 3ALFA 1OFAA 3S6OA 3IIPA 4Y9MA 4US5D 2R6OA 4LFYA 2WQDA 3RLVA 3BAIA 2P10A 4TUFA 1P1MA 4GXWA 3R7MA 3M7SA 4NIRA 4Z1AA 2YDAA 2PWGA 4H9MA 3DKJA 3UG8A 2X1UA 1QRQA 5AC8A 5GJPA 2G41A 4L5ZA 1PB0A 2E0PA 4O57A 1WPCA 4N9BA 4O50A 3F4NA 2WVVB 1ZZMA 1EQPA 4UTJA 3RLUA 2JGYA 2A4AA 1JL8A 1R9ZA 4XIMA 1Q65A 2OWCA 1G01A 1OX4A 4P8UA 3TTYA 4V1YA 3HN3A 1XQLA 3IJ6A 3NTYA 4H9YA 3UD6A 3QRHA 3WLPA 4JFWA 1UB3A 2ISWA 3VFCA 3MB9A 2D2JA 3MMUA 4D6HA 4TV6A 3R43A 3BSMA 4GC4A 4TMCA 2BXVA 3CAQA 4ML9A 4JL2A 2GQ8A 3RILA 3QZEA 1GOKA 1YDOA 1WZAA 4JHZA 4US6A 4P5UA 1OC5A 3DECA 1SMAA 3WQWA 5A6JA 2W63A 4BI5A 3GKAA 1B9ZA 1XL9A 1AJ0A 1EJTC 2WCGA 3S1GA 2J8FA 3V4BA 1JZ5A 3I68A 3QR0A 3I10A 3VZZA 2FHCA 5FJJA 1SZRA 4Y8FA 3UG4A 4RK8A 2WSPA 4HHLA 2JBMA 4W8AA 1WAWA 3PBMA 4G6CA 1NJJA 3A64A 4E6MA 3AXHA 2WV8A 1PV8A 3E38A 2INZA 4UTLA 3XIMA 4QQ3A 2Z1SA 3HV9A 3GH5A 4UFKA 1HO1A 3FYPA 2Q8LA 2J6VA 3OGVA 9RUBA 4MWAC 3KWXA 2WMHA 4N02A 1PDYA 2DH3A 3QY8A 1O4UA 5JH1A 3I3DA 1X6UA 4TX6A 4KCTA 5AHIA 3PTKA 3NR0A 3TJXA 3D6NA 3WUFA 3FVMA 3W27A 1JPMA 1G4PA 1UKQA 4GUJA 3W70A 3LBCA 3PPFA 4WOQA 3C4UA 3WQEA 3Q67A 3QPYA 1WDQA 1A5UA 3EDFA 3HMJG 3GHRA 1HG3A 1H5YA 4QEEA 4QITA 4NZ5A 5REQB 2FTPA 3GQYA 3KBNA 4AWSA 3SAZA 4HU8A 1P0DA 3BOXA 3PK7A 1AZ1A 1WB0A 3ID7A 1K8CA 1KFWA 3IWPA 1FDJA 4DUWA 4M19A 2D0FA 5DANA 1W3JA 2X0HA 1PTDA 4S1FA 5G5IA 1F74A 4ERGA 4B92A 1L8NA 2X1IA 4MZ8A 1R85A 4OWGA 3TWAA 3W7MA 4M82A 4C90A 3ABOA 2OX1A 3KS5A 1H63A 4W5UA 1Z9AA 3VM7A 3QYSA 4ES4A 1KR0A 1KRMA 1OFDA 4MAVA 5CPNA 5C54A 5JH2A 3RIKA 3BANA 1PKNA 2INFA 3AALA 4AIBA 4Q4KA 2XFFA 4UOJA 1OGBA 4GYFA 4R5EA 3DC8A 3B4YA 3SZ8A 5EA9A 1Z7AA 3NPWA 1LOSA 1PZ2A 1EHAA 1XUUA 3BW2A 4IFRA 1LWIA 1KLZA 3ATZA 4HCHA 3H7RA 2NQLA 4BEQA 1HL8A 2Z2BA 4UR7A 4AQLA 4US5A 2VO5A 3C56A 4ZB5A 4H2HA 3N34A 3QC3A 3BSGA 4O0ZA 1A5BA 1VFUA 1XIEA 4JIPA 2FVKA 4JEJA 4GVHA 2XM1A 2QJHA 3ITLA 3LM7A 4GX9A 5A8PA 5FF3A 4HA0A 4H7ZA 4J2PA 1P7TB 2VC9A 3GZAA 3QMSA 5LYRA 3TDFA 1DHPA 4EKJA 3SSJA 4M6PA 3OW1A 4XSMA 3AHVA 3C8FA 4DIAA 3R6IA 4C6KA 2I17A 5FF0A 5GJMA 1TIMA 3ZWSA 4Q8VA 3E0FA 4BQ5A 2DORA 3L2LA 1W2VA 2GDVA 2YZ5A 1I0BA 2E28A 3GYCA 4AYSA 3ATYA 1XH1A 4ERAA 4UNKA 2BOFX 2PDJA 2YXXA 7XIMA 4JIRA 2QCCA 2UWFA 3FXYA 1S39A 1REQA 6REQB 2PDUA 5FIPA 4DF0A 3L65A 3WIJA 3V1PA 2HPMA 1E0VA 1F3TA 1OIMA 4JTJA 4XG1A 3UY7A 3ITTA 2VKZG 4UR9A 1FWWA 3GXDA 3FSUA 4ML4A 3NL6A 4QNEA 2F7FA 4BKNA 3CUZA 1Q85A 1A5OC 1G4TA 1LLWA 1JZ6A 4FHAA 5CPSA 2CZFA 1J2WA 3ERPA 3VO0A 1CI1A 1JG9A 3QOMA 5JUVA 1QW8A 4R85A 4INFA 1XD1A 3P6LA 4IPLA 3UFYA 4LYPA 4S3KA 1AW2A 3LY0A 3RFAA 4U28A 2PRLA 2P1FA 2ISSA 4PUEA 4KFNA 4Z42C 1BVWA 4AD0A 2Z1BA 3NQ2A 3EX1A 4GY7A 4NJJA 1DIDA 3JZUA 1ZAHA 4XD3A 3STEA 1TV8A 2A85A 1AW1A 1GZJA 1W5NA 2REQA 3S9ZA 1TELA 5I3DA 4X3ZA 3SY5A 5KZ6A 2HRWA 2AKMA 3O2LA 3KDOA 4MADA 2PDKA 4C1NB 2RGMA 4LEFA 4IFKA 3WLTA 1V5XA 4O1BA 1D3GA 3BTNA 2G3FA 3VOGA 4HU0A 1KB3A 2VQTA 2A3CA 4D1IA 3G1DA 4I8DA 4O11A 5DRCA 3WJSA 2FFCA 3FV9A 5I09A 3NDOA 1W5PA 3FJ6A 5DY2A 1OD8A 3FK4A 3U2CA 3PUGA 4K8HA 1GOXA 1P6WA 3IIXA 3NZQA 1XCXA 3EZ4A 2VP8A 1XIGA 3G1FA 3CAVA 4NZCA 2JKPA 3QV9A 4DYJA 4NX5A 5C71A 3WSUA 1E6QM 5BWFA 3QGAC 3WFZA 4H01A 1S5VA 2OZTA 3W37A 4JY9A 3TYEA 1UIPA 1POKA 1W9BM 1XXXA 4P8XA 1TWDA 2OTDA 4HNCA 1ONRA 3VNYA 2WBGA 2PWHA 4RV3A 1TR1A 1OK6A 4O1AA 3DC0A 1SFTA 2UY3A 1OYCA 4JNYA 2NSXA 4ERIA 3D3FA 4CD6A 1Q8AA 2O55A 1AFSA 4PZVA 2G3MA 4B5UA 1W56A 2J9XA 2YCJA 3KP0A 3QVQA 1UWIA 4M6UA 2FDSA 4GFSA 4Z0JA 3OZYA 3W81A 2BODX 4QG9A 1XM3A 5FL1A 4AD4A 3R25A 3CQ0A 5HBFA 2EG7A 1H1NA 2E25A 3G3DA 4JTTA 4A2RA 1TCMA 5I3HA 5AY7A 1N55A 1F6PA 3OLDA 4P7RA 2NXGA 2Z1KA 2VWSA 3NWRA 4XZLX 2GGGA 3PZGA 1NOFA 3SJ3A 2PDMA 4ZBCA 2JFEX 4NRSA 3WBAA 1IV8A 1F8MA 1VBHA 3LHTA 4WDTA 1K8YA 3EGJA 3RG6A 2WKJA 1SR9A 3ES7A 2X7WA 3WDIA 4B4HA 2I7GA 2BX7A 5A8NA 4CUCA 4QISA 1XH2A 2DPEA 1M5WA 2GUYA 4Q33A 4IPIA 3C2FA 1MUMA 1IWBA 1KRBC 1OGSA 4PTWA 1OC7A 2DZPA 2NVCA 2C0AA 2J66A 1VYPX 3VGGA 1I1XA 4UTMA 1W3IA 3SRKA 5DXYA 5JBEA 4NP7A 1L9WA 1K4GA 1W1VA 5K3VA 1TIWA 4IX2A 3W6YA 5AYIA 4K68A 3H4GA 4DM2A 1RPKA 4WKFA 3GH4A 1ISZA 3M6YA 2BZNA 5CQ1A 1FP9A 3W7OA 3DGBA 1LDCA 1PE1A 2VR2A 3O06A 4TVDA 1VEMA 2PFHA 5M17A 4Y9OA 1OC6A 2G3NA 4U5KA 3ZMRA 2ATSA 2VDIA 3VIGA 4BWLC 4GK8A 3O6DA 3B0YA 2BY2A 3O15A 4EXBA 4ZSUA 3GFZA 3SFWA 2W0UA 1A3HA 5CKSA 2A6LA 4DJDA 1DL3A 4F2UA 3REQA 1JZ2A 2FPVA 1ZBWA 2Y8KA 4IM4A 1SFSA 3TW9A 1YYAA 2Q09A 3U2ZA 2FJKA 4PBEA 1P5BA 4PB5A 1CPUA 1S5TA 3RX3A 1GQKA 3FNDA 1SGJA 1JAKA 4Z2HA 2WWDA 3NQDA 1VFSA 4O10A 5TF0A 4ZO8A 2Q02A 4ZFMA 4XWUA 3LGGA 3O07A 1E73M 2QGHA 3JW7A 3MV11 1PBGA 4B91A 3GY1A 1P0BA 3U4AA 2DZBA 2WMKA 2MNRA 4NI3A 4QROA 4R34A 2J27A 1W1YA 3CXOA 1BPLB 4HU4A 1BRLB 3B8TA 3IS4A 1K70A 4KMQA 2HNEA 1XIIA 1Z41A 1NSJA 4IHCA 4W93A 4PTDA 1DXIA 2VVNA 4JQAA 4MY8A 1DP0A 4IGSA 4D6FA 4UQCA 3NG3A 4HJFA 3PANA 3GNXA 3IVUA 3EKGA 2AQWA 1VFMA 2QYGA 2V30A 3WFLA 1J2BA 4DHGA 4M3PA 4XBJA 3VKJA 4K8GA 4WOZA 1S2TA 4WKHA 4FNUA 5AZ1A 3R2GA 3SI9A 4E3VA 3GTHA 3JU2A 1I6NA 3N9SA 1W2PA 2H9AA 3WH8A 1A5AA 2O9TA 3SY8A 1B4EA 3PPGA 1U22A 3W25A 4HGXA 2X09A 1F8IA 1IT0A 4KGLA 4NZFA 1VP5A 3CWNA 1SPQA 4FLSA 4KERA 4S38A 1CTNA 1J6OA 3CASA 1BVZA 4LVGA 4WLCA 4HCDA 3NFUA 5B7ZA 2PAJA 2WMGA 1UCWA 4ROPA 2NUXA 1O5XA 3BO9A 3ELFA 5AYXA 1UOKA 2X1RA 1T7LA 3UXLA 3V75A 3ONCA 1XSIA 4Q6JA 2BGNE 3SQSA 1E0WA 1R3WA 1OJXA 4MKVA 4NJGA 2BVTA 1P48A 1LCOA 3R12A 4O12A 2GQAA 4LAKA 4X63A 3QFEA 3QW4B 3C0QA 4WSHA 2ZUMA 2GGEA 3E74A 1YXYA 1F2JA 3B9AA 4L65A 2WYSA 4N9CA 3AJ7A 3GTXA 1CXEA 1S5WA 3WF4A 4CQBA 4NZ4A 4WRHA 2D2HA 1B90A 3WJZA 3B8SA 2E8YA 1H7OA 3UPMA 1BG4A 2GJLA 4NKCA 4GFIA 3FAWA 1SZFA 1W3TA 4C6LA 3FOKA 1UH4A 1XDLA 2V68A 4JXCA 4PMVA 2ZQ0A 5EKYA 5TQLA 4HNNA 2CXGA 3KWSA 2DQXA 3E3HA 4CU6A 1Q6QA 2J9ZA 4GIRA 2WNNA 1KCXA 4MY9A 3NZ1A 3M9YA 1ZLPA 3L0GA 1I2PA 1I2QA 1NOUA 5G4HC 2DVTA 1OHLA 1FA2A 4N2YA 1WKYA 1EJVC 5FI8A 1IEVA 2EBNA 2VWTA 2QCDB 3R10A 1Q2SA 1VFOA 3NGJA 4PE8A 1A5MC 1CENA 1XGZA 1X96A 2AKZA 2OLHA 4J3XA 3FCPA 1WE5A 4FOUA 2A1YA 4OBTA 1KV5A 3UA4A 1KGXA 1WZLA 4DWSB 3QKZA 1HJSA 7ODCA 3MUIA 4JHMA 1QO2A 4RE4A 1S2UA 3AI0A 7REQB 3UT0A 4YTTA 3HGSA 2BLEA 5FAJA 4AU0A 2R1MA 3L9CA 1LWHA 2XWDA 2YB4A 3H21A 1XQKA 1TQJA 3E2QA 3TONA 1BGGA 3L68A 3QZ6A 4HPJA 1KW1A 3S46A 3W83A 4RPPA 1B5TA 1R3VA 4LVDA 4IL2A 3NDZA 5DBTA 1HL9A 3GHSA 4AX7A 5A2AA 1FXQA 4MJ4A 2HE8A 3ISIX 5F2IA 2DVXA 3GXNA 3S1VA 3MUY1 3ZS4A 1C3FA 5C9RA 3SDOA 2PP3A 3W85A 3OBEA 2VGIA 3CS2A 1EZWA 4HZ8A 4H19A 1W5MA 3PN8A 4OOUA 2ACRA 4RZ5A 2QUMA 1QWKA 1RQHA 1EGMA 3DI1A 3BVJA 3ARQA 4D8ZA 4W88A 4GD0A 1BWVA 2FH8A 3AXKA 4FMVA 1MZRA 1QNQA 1TV2A 3VMOA 2J7EA 4GKTA 3DEQA 1R9XA 3AUJA 1KBIA 4JKMA 3WLRA 3WJXA 3LS9A 3M0LA 1UR3M 3VI2A 2X41A 4PCNA 1S1RA 2CXEA 4IIEA 2NV2A 4RV8A 3DG3A 4HPNA 2CPUA 1JPHA 3MUCA 1TPC1 1F9CA 2PU1A 4PN2A 3V35A 3BMXA 2OELA 4BWLA 4GBDA 2VFGA 3I6RA 2ZVIA 1BLIA 4ZODA 1FWTA 1NWTA 4AMCA 3EX6A 2D24A 3AXXA 4PSRA 1P0EA 5CSRA 3CZ8A 4GVGA 2J88A 4UTWA 3H2EA 4JN6A 1RLDA 1EP3A 2ON3A 4GYPC 1F5ZA 2VC5A 1XIFA 4PR4A 3WMSA 2YA1A 4AHQA 5KTLA 4L1WA 1Z69A 1V6TA 5H8UA 4W4QA 4LYRA 4RNFA 4O8AA 3SW6A 1CXIA 3PZUA 3EA1A 4LYKA 3OIXA 2A6NA 2ZOXA 3VKKA 2BXYA 2DZVA 1BHGA 2PTDA 4C7DA 1HF6A 1H2JA 3Q2DA 4KETA 3ARSA 5FEXA 4DPPA 1IZKA 1QNRA 1ZBCA 4PCTA 1XRTA 2D69A 3MWCA 4CCDA 3GW0A 4I9JA 4UOQA 4CVWA 4L9XA 3GVVA 4UNIA 3LG3A 3TXVA 3VAVA 5DMNA 3RYSA 1O6IA 4YIWA 5EBUA 2R1LA 3DBNA 2OEMA 4MKSA 3V1HA 2FLIA 2V81A 1EWDA 1OBAA 1A50A 1WBHA 1A47A 2C91A 2PI6A 4DJFD 4A3UA 1DIEA 3HZ3A 3W1TA 1WDDA 4JY8A 3R89A 4POCA 1G67A 3FJ4A 3GBDA 4E2DA 1VS1A 1O68A 1OVDA 3TTQA 4ZR8A 5EGRA 4IISA 2VC6A 1UOZA 3W1MA 1OCBA 3F5LA 3M41A 2FDMA 2VEGA 3HM7A 1H60A 4RR4A 2R14A 1RH9A 1GUVA 2EXOA 4BEUA 2VUNA 1VLWA 1B54A 3HQ1A 1VKFA 3LLFA 5EU9A 1T99A 3MBDA 3UWVA 3L67A 1JZ7A 5E9AA 1W3LA 3W7JA 6XIMA 3I6TA 1GVYA 2OZ3A 4QGCA 1UA3A 5I3JA 1TV7A 3Q37A 4MAZA 1ZRQA 3AS0A 3DU0A 5E70A 3TOPA 3VILA 2J75A 5FJUA 2IPFA 4PB4A 2X42A 3USBA 1FFRA 2VX6A 3KVMA 3VABA 3JS3A 3GR7A 4XVDA 5E0FA 1PZ3A 5FSEC 1SUXA 4QIUA 1UPPA 5FA5A 4LW7A 2DJLA 3EOOA 1F76A 3VXGA 1PX3A 3TA9A 3VNLA 3IK4A 3YPIA 2MUCA 4DRSA 3S1UA 1R7OA 1PHQA 1R8LA 3AC0A 2WC3A 4IZGA 4E8GA 1XIDA 3IUDA 5I78A 4OQVA 3G0XA 3WD0A 3OGSA 3M0ZA 4GKLA 1VIWA 5F1UA 3U3HA 4KWVA 3NQ7A 4LAZA 1D3HA 4JN8A 2XU2A 6CGTA 3IACA 1GT8A 3BLLA 3O6AA 4NAFA 2IKJA 3WLHA 2E7FA 4UFLA 1NTHA 2GYIA 4QG6A 2WLYA 3UETA 1W37A 3XINA 2E6YA 1S5NA 3F2CA 3GRIA 4LC6A 3EKZA 2G95A 2D20A 1X1NA 2JGQA 1HKIA 3DN5A 3L23A 1D8CA 1PXGA 3NYZA 2I57A 2Z7KA 3ABRA 1OX4B 2OLSA 4LV4A 1YBQA 3TR2A 1EQCA 3QOKA 1XYLA 2WHKA 1GVQA 4A6GA 1FCVA 2OVLA 3SCWA 2EPHA 2A79A 5LA1A 2PU0A 3UXDA 2DSZA 2GUBA 4S3AA 3O1NA 4UUIA 1ZP4A 2ISVA 2B0MA 1VH7A 3VCNA 4A4AA 1BSLA 3NEVA 4TOQA 3T78A 3BCDA 2VYOA 1XR2A 3PB2A 4I7VA 2BDQA 4O4VA 4LY4A 4Z17A 2Z2AA 3FIGA 3V5FA 1KFLA 4LPCA 4XTIA 4YVXA 5BW6A 1XCWA 1SJCA 3CMFA 4BHYA 4A3HA 4Z2LA 3L4WA 3VOHA 4WD0A 3HQOA 5A8GA 3ZFHA 3EXSA 3QTGA 4R88A 1R2RA 3UPWA 2R82A 4UQBA 3RHGA 4HYVA 1QXLA 4CNOA 3AIRA 3BAJA 4HNTA 3U57A 2DV0A 3P80A 4GO8A 4I6KA 1TPDA 4AIOA 3WF1A 5E09A 3WL1A 2NX3A 1F3WA 1X38A 1EBHA 3TROA 3H70A 1KRAC 3P7YA 2E3ZA 1W9XA 1RHCA 3LOTA 2VRQA 2QKFA 4AEEA 3OA3A 1G94A 2IW0A 1FWAC 3RCNA 3WNNA 3MU7A 1KV8A 2IQ0A 2ZICA 1TMLA 4CVUA 2E5BA 4BCEA 5C7HA 3WLLA 2QCMA 3CPRA 4GUGA 4UXDA 1H51A 2DZSA 2ZUWA 1JNEA 3THDA 3OPSA 5GJNA 4J3WA 4MYXA 4AUBA 1BXCA 4Q7BA 4K37A 3SGUA 3WNOA 3M43A 3QEZA 5H91A 3DKLA 3P3BA 4H8UA 2D3LA 4H6EA 3M5XA 1ZAIA 3LV6A 1L6GA 1V51A 3WEMA 1GOWA 3CUXA 4FNPA 4RZ6A 4MTVA 4EK7A 1P6CA 2VOMA 2WSYA 2XGBA 3L4XA 4XSLA 5B7YA 4V33A 2A3AA 1TZ9A 3NCOA 4IIDA 3FDGA 3WQ6A 4DUVA 2YIHA 1TMQA 2E1WA 4GYPA 3VKCA 3N17A 2Q71A 4HOZA 3ES8A 3HA1A 2FGLA 1WDPA 1M04A 3PUEA 2X05A 3MSGA 3UXKA 4LCRA 1QK0A 2XVPA 1IGWA 3NSMA 2AQOA 4IGHA 3WQ5A 1QI2A 1H61A 4GI4A 4EXQA 2HK0A 1KTCA 1QNVA 4LF1A 4ACZA 2XVKA 1WBJA 1WKDA 1X6LA 3VX0A 4DM1A 1HFBA 4HNVA 2CLOA 4C1LA 3B03A 5CAHA 4W85A 4CNSA 3UWZA 1XCFA 2ISDA 1W17A 1ZALA 1L0PA 1M6JA 3H2NA 3A5FA 2GJNA 3G1VA 4IX0A 4GO9A 3VIPA 3FKKA 3THUA 4DLMA 4NUWA 3UP8A 1T0OA 4HMEA 3EX2A 1O94A 2FZ8A 2ZZ5A 3TN6A 2WVVA 1NU5A 1HJWA 4JNMA 2V67A 2X30A 2OWWA 5BRBA 4B16A 1RAKA 2CBVA 4Z2JA 4IJRA 4PMXA 1WP6A 1HP5A 1YADA 1HN1A 1MI3A 4CN6A 1EYEA 3NQCA 4TQTA 4M51A 1DPMA 4HN4A 3W2UA 1Y5WA 2BS9A 4Y9AA 4M1BA 3TN5A 3LCXA 1VYSX 1LWJA 3V7PA 3CQKA 3LCLA 1FCQA 1QDSA 4ZTYA 1YPIA 4JIQA 1AG1O 3UZYA 3S5ZA 5L9FA 4AAJA 4RDVA 4HOXA 3TFCA 3P8JA 5K4XA 4LVBA 5IHRA 4K36A 3HPZA 3CT7A 3G8RA 3U8GA 1CLXA 1QO5A 2X2GA 3OVQA 2NX9A 2YDRA 3ZM8A 4ZOAA 1A3XA 2PRHA 3AISA 1R3RA 3T0DA 1UUMA 2O4MA 1GQLA 3HGRA 3QFWA 4DEFA 2YL8A 3LI1A 4GRSA 5DEZA 1KLYA 3CM4A 3NQFA 3GTIA 3W74A 1XLCA 1ZB5A 1V3HA 4PMOA 2E1DA 1IE7C 3N2TA 4U3AA 2ZRYA 1JPIA 1SJDA 1IWPA 5CXPA 3QF0A 4PMJA 4GHRA 3EA2A 4BZYA 4EAMA 4WJ8A 3ZOAA 3IJQA 1WYIA 5EMYA 3UG5A 2DUZA 4PL1A 2PZNA 5EMLA 1Z32X 2ZUNA 1E4LA 4V15A 3ECQA 3LTPA 4ZB0A 1DTNA 4DBWA 4XBKA 2GDUA 4F48A 4JGDA 3C2OA 2WCSA 2G4FA 4H00A 4S23A 1F3EA 5REQA 4M24A 2B7NA 5CZTA 3NM3A 1KCZA 2TRSA 3LU2A 5DQPA 1FRBA 3DYPA 4DXVA 5IBXC 3QXBA 1M3UA 4J4KA 2OCZA 1CXLA 3LRKA 1HKMA 1UWTA 1KFCA 1EHNA 3NPXA 3MP5A 3B0PA 5AZ0A 1E6RA 2PS2A 2EEXA 1ITUA 3W3OA 4YWSA 5LIWX 1PO9A 1QVBA 2DZTA 2R1NA 4LUSB 1JFXA 2P0OA 4GNVA 1GKRA 3STCA 5HWMA 1JYVA 4OFCA 2PF8A 4D6JA 2OEKA 3LEPA 6TIMA 3DESA 3KVJA 4J27A 1G9HA 4K3ZA 2O9RA 1ONXA 3VK5A 1F73A 5FACA 5LSMA 3DHPA 3LV5A 1DJGA 5EBAA 1O95A 2C19A 1OCJA 4CEXC 2G50A 3G6LA 2UY5A 3SN0A 1RPXA 5D02A 2CETA 3M5YA 4Y96A 3AYVA 1WUEA 3BE7A 4Q4OA 1M53A 1EA9C 1SZEA 3HJEA 4OHQA 1P7TA 4AZCB 2BBFA 3EDEA 4AWUA 3TCSA 4QAIA 2Q01A 2ONEA 1JGMA 3QPEA 4CN4A 2VX7A 3CV6A 2IXVA 1W8SA 3FHAA 1NM9A 4BF9A 5AHEA 4FX6M 3VIIA 1OFBA 2ASHA 3M5VA 3WQ4A 3ARXA 2L5HA 1FCUA 1QHZA 1K4HA 2J62A 3GDKA 3MV01 4G1KA 3W1XA 1MQQA 5J8LA 3LK6A 2YJQA 2YCLB 4FA3A 3QGKC 4DBSA 3EPOA 3SIMA 1PTGA 4H9VA 3NVDA 1RR2A 1KKOA 2X7VA 2I9UA 3HB9A 2CNCA 1A5NC 1BEUA 1WV2A 1KBJA 4FXSA 3S5SA 2GDQA 1QASA 3CYJA 3MHGA 4CCZA 3L5LA 1GG1A 1EPXA 1PSCA 4QR6A 3VD9A 2PPGA 5I3KA 4HZMA 1OQFA 4IMAA 3T0TA 1PAMA 3TW6A 4NYUA 2B81A 3I6EA 4UB9A 3R0KA 4I5RA 2RDXA 4B3KA 1TCDA 1EXBA 3RRAA 4OT7A 1V3JA 6XIAA 2WSRA 4DBDA 3DENA 5G2IA 4OTKA 3EDDA 1E51A 4AEFA 1ISVA 1P6BA 5A6BA 3NJ3A 1IZJA 2PDXA 5HDRA 1OEPA 3NM1A 5FF7A 2OGYA 3T0BA 1SFJA 4LNCA 5I77A 3OBKA 2Y5SA 2DZWA 4GVFA 3HGJA 4P7QA 1LM1A 1W31A 4MSSA 3GO2A 2PD9A 3A9IA 1LZOA 2PCQA 1EFZA 4C1NA 3WCZA 4AISA 4R9OA 1UD5A 1TKKA 1JULA 4Q4QA 3PTQA 1PIIA 4ALDA 1FHDA 1A5CA 2CLPA 4ZSTA 1UJQA 1W9DM 1GVEA 5IXEA 2BHYA 3WKZA 4RPQA 1QHOA 3CTTA 1HVXA 4MB3A 2J77A 3QQ0A 3PPHA 3O63A 1JDCA 1O66A 3N04A 4PUDA 4XKMA 3AHXA 4GG9A 3T05A 1BXNA 4CKQA 1LL7A 2VTFA 3AHZA 4N6FA 2EPMX 4PULA 4JD4A 2A3LA 3I65A 2W66A 4JDBA 2WM1A 2Y1HA 3NAVA 1E56A 5E9XA 1A53A 1MQPA 4H83A 1KXVA 3K4DA 3VDBA 3B04A 2RHGA 3N2MA 3EMZA 3P14A 3BMWA 4Z08A 4C1KA 1YPFA 2WKGA 3W0KA 4TX8A 3H12A 5LZLA 3KHDA 1F61A 1TYGA 3HG2A 3KUMA 3KOZA 1QNSA 3AU2A 1XG4A 1YX1A 1GYNA 4JTFA 2NXIA 3MSYA 1P0NA 1L2UA 4F79A 4C6DA 5I2UA 1TWIA 3PWGA 4HP5A 4LB3A 1TMHA 2DIEA 1ZCCA 2QAFA 2XIIA 3MPGA 5T91A 3TW7A 5CAKA 2PODA 4MNMA 4MUPA 4WDWA 1JYXA 2FTWA 2G3IA 3MKCA 5LA0A 4CQ8A 1M7JA 3DFPA 2F84A 3TQPA 1YLVA 3L2MA 1E4NA 4GXMA 5I06A 4MNLA 1U2YA 4I8YA 2HISA 5I24A 3G1HA 3SQLA 3KL3A 4ASTA 2QIWA 2IKGA 1RP9A 1MFVA 4C6FA 1DVJA 3EKLA 5HK4A 3MVIA 4S3CA 1SW7A 4WDUA 4EPKA 3TNOA 4OE7A 2BNJA 4JCLA 1OX5A 1JPDX 2QS8A 1B3OA 3RX2A 1TREA 5AHLA 5KINA 2F6UA 1LLZA 2EJAA 5JMUA 4TU1A 1TWSA 3ARWA 9XIMA 5DCDA 5CH9A 2C1GA 2I9EA 1XI3A 4OBSA 1BYAA 3QV7A 4DYKA 3EPMA 1IWAA 2BHZA 3SCPA 3IGUA 3KRZA 1XLKA 4HOWA 4GYJA 1KGUA 3QYQA 2O9PA 3VTRA 4ICCX 4XIAA 2VGFA 4H6RA 2WNQA 2CHNA 1ITXA 5DCBA 3KRSA 3II1A 4EPBC 2WANA 4JTIA 2DUAA 4DJEC 2DEPA 5AVHA 4NYYA 3WL0A 1DE6A 3ZJ6A 1MUCA 3BCJA 3SM0A 4QJ4B 2OJPA 2C7FA 5LNRA 3CZLA 1LBFA 2Q6ZA 5A6AA 4XAPA 1LRNA 3VIFA 3L4TA 1TQXA 2GQ9A 4PL2A 1J0ZA 3R0DA 3CT2A 1LLOA 1JI2A 3BUVA 4DPQA 1WAUA 3CEUA 3DFTA 4JTRA 4EWND 2DY3A 2OGJA 4H2CA 3GVRA 5E0KA 2IKHA 3ITGA 1AD1A 4CQDA 3I7RA 2WK2A 4O1EA 3MCMA 1P1XA 4FSAA 4WIWA 4A8IA 3MWAA 2DJXA 2PGEA 1W54A 1C29A 1W3HA 2J7HA 4IJCA 1UIOA 4UFIA 1TPUA 2GVLA 3DHFA 4JYEA 4TTGA 4O15A 4Y90A 1TE6A 4ZGYA 3WLIA 1FY6A 1X8CA 3NZPA 1EBGA 1FKWA 3W38A 1DTUA 1R3YA 2ZZ7A 3GAYA 2OYMA 3NOYA 5I7GA 2YBTA 5MF5A 3WK1A 1AA1B 4TVUA 4YS1A 2C71A 4GIYA 3R1ZA 3VNKA 5FCZA 3ARVA 3GU1A 4M0XA 4JTUA 3TN3A 2VUYA 3ABSA 4NJHA 2PF0A 1UG6A 4BI7A 1NFBA 5ABGA 2FZ9A 3AYSA 2JF6A 1R86A 1V3MA 2XSXA 1OF8A 2NX1A 4A8RA 4JIEA 1T96A 5FJIA 2NQ5A 5HANA 1N2VA 4YTUA 2PE4A 1IZCA 4IWWA 5HR6A 1RCXB 2G5WA 3W9ZA 4GNJA 3S3GA 3URAA 3WBYA 4W7WA 4A8LA 4TR9A 1MVYA 1AUSL 4HZ6A 4MM1A 2ZRXA 4PFMA 4AY1A 3FN9A 3BJSA 1FFQA 1UP0A 2CC0A 1SO5A 4GGHA 3TMLA 1AH3A 2KZHA 1S38A 2BVYA 3B0VC 3H22A 2C1HA 1K7FA 1WXJA 4D8LA 3UZXA 3U48A 3ZLGA 2PTXA 4MIMA 3PHAA 3RR1A 2GWGA 3F5KA 5D9OA 3ZSTA 1Q6OA 3MZ2A 5ECUA 4C6QA 5G1MA 3QSTA 3S8HA 1GOIA 2YCIX 5JBDA 3W7KA 1ICSA 3SUUA 3W2JA 4XZHA 1FWEC 1FHVA 3LPGA 4LVFA 4E3TA 1C7TA 2W5FA 3ZR6A 3CHDA 3S83A 4EXAA 2XSBA 3ENLA 3G22A 4BF5A 4AHOA 3M0XA 3OODA 2QLYA 4PMUA 3VGFA 3E0IA 3PSVA 2WM0A 3WLNA 1KC7A 5A6MA 3DFQA 2NLIA 4JTSA 1ZBKA 2B7QA 4PSPA 4C7FA 1XYCA 2AGKA 3BLIA 1FWIC 4YLWA 5E5CA 4X0VA 4M56A 5H6HA 3C2RA 3F4WA 1HO4A 2UV8G 3VGDA 1OINA 3HBLA 2I16A 5BCAA 4QXIA 3UWEA 4QLJA 3BL3A 4WHBA 3E12A 1Q6DA 3URBA 1ZY9A 5CPOA 3Q45A 4XISA 2WJEA 2Z27A 3CPUA 2DT3A 2GL5A 3LUTA 1E3XA 2DZAA 5E0CA 1QI4A 5BXRA 3F4CA 3SRDA 3W7DA 2BWGA 4YCOA 2PWUA 3GS6A 5HNRA 1V0KA 6A3HA 5TNVA 3T08A 1R3QA 3G1YA 5CPTA 1OSEA 1VF8A 2V2HA 4PCSA 3B8DA 1UC4A 2Z29A 4ZTXA 4JN7A 2ESCA 4HA1A 4B2DD 4C6JA 1IR2A 4UWMA 3BK0A 1HKJA 4GLEA 5KITA 1TX2A 4MFEA 3ARYA 3ANYA 2V63A 4HK7A 4F0LA 3EYPA 3AMGA 1DJZA 4JTDA 5BOEA 3P82A 3N2BA 1EKOA 1B4KA 3BPWA 2Y70A 4JX6A 4ECLA 1KWGA 1YW1A 1FVPA 4B15A 1CGYA 2XH0A 1YNYA 3M0HA 4DELA 4Z2IA 4QP0A 3OVRA 1HJQA 1QOXA 3PZ9A 2GZXA 3W28A 1L6SA 4YHEA 4QJ3B 2OQHA 1QATA 2YFOA 3GHTA 3KL5A 1FWGC 1PZ0A 3U9IA 3GW3A 4YJ5A 3VNJA 3SSZA 5DMMA 1DQUA 2QUTA 4LH8A 4GACA 2Q8XA 4ADSA 1QUMA 4URIA 4NJKA 1MW2A 5J04A 1JYNA 2D22A 1FWBC 1PPIA 4EWJA 4PMYA 4PTVA 1TWZA 2NQHA 3WF2A 1UBSA 5CBJA 3OU8A 1A4MA 4D1JA 3PUDA 4DWSA 1P4CA 4FF7A 6TAAA 3D47A 4NQ1A 4LF2A 1TPFA 1XHGA 1DORA 4GWEA 1E3ZA 5T9BG 7REQA 1XLDA 2E68A 1VR6A 4JTKA 2J7CA 1ZAJA 1R2SA 4E2OA 1VB9A 3TSMA 5SWUA 8XIMA 4ZO7A 2WVUA 4MKNA 3W7RA 2BGSA 4ZMGA 1I2RA 4GI6A 1YRRA 5LKYA 2O9OA 4ZOBA 4LALA 4QDMA 5D2VA 2E5DA 3FDKA 1LG1A 1CGTA 3VC5A 1EJWC 3R11A 5GPRA 3LQLA 1TJ2A 4MMWA 3W7HA 1T6MA 4NAFB 3N4EA 2WZIA 4B3ZA 2PDIA 4UZSA 3UJ2A 1E5JA 3Q4DA 2E9MA 2R8WA 3MMTA 2C3ZA 3P93A 2PC4A 1U1UA 2WPGA 3CNYA 3GHUA 3ZVHA 4U10A 8TIMA 1Q6RA 5KZMA 1PWMA 2BMBA 3S5OA 2YYUA 3W75A 3UNTA 3H53A 4MJZA 2D0GA 1BGAA 3W84A 2EGZA 4XZBA 1OY0A 3A5VA 3DZ1A 5U7SA 3ZZ1A 1DJXA 3LLDA 1JRBA 2QUNA 1UR9A 3GWQA 4RE3A 4PUNA 1U1JA 1RJRA 1MSSA 4CEUC 5F1VA 3PZNA 1WUFA 5L6UA 4EACA 3TU9A 4FPSA 1T8XA 3RJYA 1JXJA 2J7FA 1JDAA 3MDUA 3U2EA 2Y4SA 4L9YA 2FH6A 3CL8A 3ARRA 4QDPA 4L4OA 2QF8A 2GK1B 3TYCA 1TV3A 3LPOA 4XQ6A 3K1GA 3I4KA 3BG3A 4QNWA 3RGTA 1BWKA 3LHZA 3AOFA 1HKKA 2DSKA 4GGBA 3TSDA 3N14A 2FHFA 4KEZA 4GIAA 5HWJA 2NZLA 2TPSA 3WMLA 4ORMA 4GMEA 4HCLA 3VE7A 3NZRA 5E93A 3ZJKA 3GFXA 2EPKX 3CHFA 2W91A 4J5NA 4X2RA 3GU9A 4TO8A 4PEKA 2FGBA 3H7UA 1QBBA 2R94A 3K5XA 3MO4A 1ZSXA 2P53A 2FPTA 1ZJHA 2VZSA 1LP6A 4KEUA 1L6FA 3TC6A 3TKFA 5GNZA 5BZAA 2WHMA 2CYGA 3E96A 1XGDA 3P67A 2PCEA 4LT9A 4UR8A 2DT0A 2X0YA 5HQEA 4AD3A 1T41A 1FWDC 4ZE5A 4X2PA 4NAEA 1E0XA 3MJMA 1DXEA 5CZKA 1J9YA 1DJIA 3FA5A 2WJFA 3OG2A 1UWSA 4DO6A 3CZGA 4WY0F 5D2WA 5CG0A 1EZ2A 4DZ5A 4HMDA 4HD5A 5I07A 3VGBA 4AYGA 4OUEA 3SB0A 3IEBA 2EG8A 4ATWA 2HE5A 2OKTA 4WGHA 2QCLA 3QHNA 3S5YA 3JZEA 3ABXA 1EC8A 1VIZA 3KM8A 3KBWA 4GISA 3IARA 3TE9A 1W1A1 3HOJA 4FK9A 4DAIA 1HJUA 4DNHA 6ENLA 1C8VA 1T5AA 2X1TA 4KBXA 3C0LA 3R79A 3GTFA 4JNZA 5EL1A 3U6WA 2C79A 5HPOA 1RALA 3AIWA 5CJ5A 1FKXA 1JUKA 3P84A 5DO8A 3EB2A 1MW1A 1HGWA 3WUGA 4KRUA 1BAGA 4OIFA 2ZUUA 2QJNA 4V28A 4C6BA 2QIIA 1UKTA 5LIUX 3WLJA 4AVNA 3LBOA 3I3EA 3KBVA 3OA5A 1KCKA 5K7JA 1WZMA 4M5PA 2ABBA 1A5SA 3UJRA 4L6DA 1UD8A 1JD7A 4NZJA 1KFEA 3QR1A 5I02A 5AC4A 3IV3A 1PJ9A 4JTEA 2DP3A 1CLVA 1G69A 3AWOA 3QMRA 2X8RA 2VGGA 3N25A 4NSBA 2GVJA 3W73A 3VNZA 3OIHA 3SUTA 3KHJA 3L21A 3T1GA 1T8QA 2V3GA 4AY7A 1VZWA 4H7CA 4RDZA 1RA5A 1XYZA 1J18A 3KCOA 3W86A 2GOUA 4XK2A 4H6KA 2JQXA 3OZMA 2POZA 1Z48A 2IQTA 3UWUA 4QS6A 3T4CA 1U5JA 2H3BA 4KEMA 1UZ1A 5FEWA 1QPKA 3NL3A 3ANVA 1YTDA 3SUSA 1SJAA 1MFUA 4OBRA 5G1YA 5BROA 3VOIA 4H6QA 3WD2A 2YSWA 3N15A 1BG9A 3IIOA 3OHIA 4KWUA 2FVLA 1E1FA 1JIBA 1JGIA 1HKVA 2GSJA 2CFFA 1UR8A 1B3ZA 4NY2A 1XLIA 5HMDA 2ACUA 4LTSA 4XUGA 3LRLA 4HNUA 3G1XA 3G1SA 5C0QA 3MKVA 4PODA 4FAMA 3TLQA 3E5PA 1W9VA 1OFRA 4O17A 5CJNA 3TN4A 1Z6KA 1UJPA 1YKWA 4MB4A 4C5ZA 2YDQA 1J10A 2FKPA 3BAYA 4P7OA 4ZA0A 1WDWA 1B9BA 3EPNA 3SECA 1PZ1A 3C3NA 1F4AA 2YLLA 3PWIA 1S46A 5AVNA 4Q7IA 3HFYA 4KFPA 2OODA 3CH9A 4WY0B 3GKFA 2ZCGA 3T0AA 2HJPA 1OFPA 2CHOA 2PDGA 5MHBA 3BQ6A 1VFLA 3Q65A 3V0SA 3BQ5A 3A4JA 1YTKA 3BZJA 3E0WA 1KM1A 3B8IA 1US0A 4O52A 2ALRA 4RNIA 5K9DA 4KW2A