4AXNA

Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the serratia marcescens chitinases
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
DDAAIMPSIANKKILMGFWHNWAAGASDGYQQGQFANMNLTDIPTEYNVVAVAFMKGQGIPTFKPYNLSDTEFRRQVGVLNSQGRAVLISLGGADAHIELKTGDEDKLKDEIIRLVEVYGFDGLDIDLEQAAIGAANNKTVLPAALKKVKDHYAAQGKNFIISMAPEFPYLRTNGTYLDYINALEGYYDFIAPQYYNQGGDGIWVDELNAWITQNNDAMKEDFLYYLTESLVTGTRGYAKIPAAKFVIGLPSNNDAAATGYVVNKQAVYNAFSRLDAKNLSIKGLMTWSINWDNGKSKAGVAYNWEFKTRYAPLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hallmarks of Processivity in Glycoside Hydrolases from Crystallographic and Computational Studies of the Serratia Marcescens Chitinases.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords CHITINASE C1
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4axnA00
4D6EA 1W2PA 3AMCA 4ZXOA 3HMCA 2XVGA 3RM8A 4Z2HA 1KQYA 2OSYA 2VI0A 1TUXA 2ZX8A 2EPMX 3E1F1 1VFUA 5I23A 3LPGA 5I6SA 1WZMA 3GH7A 1JG9A 1KXHA 3QHNA 2Z1KA 4GPNA 3ZR5A 4PMZA 5JBDA 3WH5A 1HXJA 3WH7A 4WKHA 1H0IA 4UFHA 1M04A 1E0XA 1SMAA 3L4TA 4AZIA 4E8DA 1PEZA 2WBKA 1DWJM 3SUSA 1AMYA 3WMCA 1H4PA 3A3HA 1RPKA 1MW3A 4U33A 1HVXA 5BWFA 5DMYA 3W24A 1ODZA 3CUHA 4M56A 2ZXAA 3HJEA 2F8QA 3EMCA 3VDBA 4AY1A 3WEOA 1UWTA 2TAAA 3B8SA 1CZ1A 3MUY1 1BHGA 3IK2A 2WB5A 2UY5A 1GHSA 1GONA 1V02E 3NCOA 2G8ZA 3MMUA 1H3GA 4OOZA 1BG4A 3WUGA 4QFUA 1QNOA 2QF8A 2VZVA 1OM0A 3MSGA 3BAKA 1FOBA 1M53A 2GVYA 3OB8A 2WLZA 2VX5A 5JBFA 2FHFA 4H04A 3OIHA 4IM4A 3WQ6A 2XYLA 3A6OA 2ZWZA 2WAGA 2HISA 3VGBA 1BYDA 3UESA 3WNLA 1HJUA 3UCQA 1XH2A 4U3CA 5A6MA 2XGIA 2DEPA 5CSUA 4AMCA 5HBFA 1JI1A 3U57A 4AD2A 1ITCA 1XGZA 1UOKA 1JZ8A 1CXKA 1FA2A 1JFHA 1VENA 1K9EA 4ML4A 3WBAA 2F2HA 1R86A 1D3CA 1QPKA 4QCFA 3UR7A 2WHLA 3OBAA 3VMNA 4D72A 4Y7EA 4MJ2A 3BMVA 3BC9A 1LJYA 4DUVA 1WZLA 2CETA 1W91A 2C7FA 3HU7A 2IXUA 1ZBCA 4U5KA 2E4TA 1PX8A 1LWHA 2X05A 4AISA 4C7FA 1FH9A 1QBBA 3AIVA 2ESCA 1ITXA 3ZJ8A 4AZGA 3KL5A 1PZ3A 1UH3A 3KWXA 3AS0A 1J11A 4PUEA 2VZOA 2FDMA 1XV8A 1HJQA 3ZJKA 3ARVA 5A2AA 6TAAA 1I1XA 3T09A 2OYKA 2ZUWA 1WO2A 3CIVA 4C7GA 1VF8A 5I0DA 1HKMA 3FHAA 2XWEA 2DSVA 4W86A 2DH3A 2BHUA 4UOZA 5CPTA 4GO9A 1HP5A 3RJYA 1HIZA 4UQDA 3WBEA 3AIRA 3AMLA 2DH2A 1W9DM 1JD9A 4LYRA 2JEPA 1KXQA 3W38A 1VFOA 2VX4A 1C93A 3FNDA 3M46A 2XVLA 4UOQA 2J62A 3AHXA 3MUZ1 1F4AA 1I1WA 1CXHA 3HN3A 4TUFA 4QLJA 1ZU8A 1UHVA 1JXJA 2GJXB 1BYBA 4TVUA 4MADA 4OUEA 2B31A 4LPCA 4H2CA 4KMQA 1VIWA 5BYWA 1NM9A 4FF5A 3ARXA 1OWQA 4GIAA 1V3HA 2WK2A 3WL1A 3OG2A 1R85A 5BXSA 1J18A 1UR4A 2GUYA 3OLGA 1JYVA 3FAWA 1Q6FA 1FFQA 4OKDA 1WCGA 1FHLA 1CGXA 4JL1A 2J7FA 1WKYA 1U33A 5CSYA 3GXIA 5I2UA 4MB3A 4W87A 4J3SA 1B0IA 5E70A 4CVUA 1QHPA 5DFAA 2WWDA 1WDQA 4H41A 2W91A 2YIHA 1MQRA 4ACYA 2Y24A 4ZE5A 4J3TA 2BS9A 2PWGA 3RM9A 3AMDA 1HF6A 1MW2A 4TX6A 1JZ4A 1NH6A 3SCSA 1BGGA 4UQEA 3AICA 4PMVA 4Z2GA 3VDAA 8A3HA 1AQHA 4JKLA 3WF0A 2J7HA 2YBTA 1ZB5A 2V3EA 4AZCA 2X1IA 4AC1X 2DT0A 1AVAA 1ISZA 1BGAA 1D7FA 1CBGA 3T0AA 5C8BB 4P7RA 2JF7A 4MB4A 2XIIA 1C8QA 4F8XA 2PWHA 3WQ4A 4UCFA 1E3ZA 4JIEA 3FN9A 4YPJA 4JFTA 3ARRA 1GOIA 5CZKA 1CGUA 2XVNA 3VMOA 2VCAA 4D71A 4JHZA 4CCDA 2DSKA 1TA3B 3VIJA 1JZ3A 2O9OA 3N9KA 2DSZA 3AS2A 2OWXA 5A6LA 1EDTA 1UZ1A 1OD8A 2YLAA 2NW0A 4M29A 4AZ6A 5ABHA 1KGXA 4F9DA 1HNYA 1A3HA 4UZSA 5D9OA 1OGSA 2VOTA 4AXNA 5DEZA 1UH4A 3CUGA 4N42A 1GPFA 1QI4A 1GW1A 5A8PA 3VDHA 3ARZA 4BQ4A 1DTUA 4X0NA 4TOQA 3ZJ6A 4CCCA 2J7GA 3WF1A 1H41A 3WIJA 2PBOA 4ZXLA 2OSWA 1UQYA 4B9YA 4P7OA 1DP0A 1V6VA 2CIPA 2NT1A 2BFGA 2G4FA 4BQ5A 5C70A 3W53A 4EKJA 1TFVA 3CBWA 2WVVA 4UOJA 3ZOAA 1E6QM 1SR0A 1XHGA 1TVNA 2WCGA 1HKKA 2J8FA 3PN8A 4B15A 1KGUA 2XPKA 3T0DA 2VRJA 3GNOA 5FOOA 1CPUA 4PTVA 2Q8XA 1J10A 3DYMA 3U7BA 3L4ZA 1UQZA 4J3UA 2A3EA 4GXPA 4GZEA 3VIKA 4AIEA 3BXWA 4U5IA 2CYGA 4Q22A 1LWJA 2WMFA 1EDQA 2D24A 5A6JA 1TZ7A 1GJWA 3PZ9A 4MB5A 4JCLA 1PIFA 2FHBA 3BSGA 2PB1A 2ZUVA 4NRSA 4Q7NA 1J0YA 4FLOA 2XFFA 1C91A 2ZIDA 4EE9A 1MW1A 4HOWA 2VRQA 5A6AA 3AJ7A 3EDFA 4D6GA 3TTOA 4OBSA 1WZKA 2OSXA 1XD0A 4H8HA 1CXEA 1JGIA 2CESA 1TG7A 2BXZA 1E6SM 4LYPA 1IZKA 2EXOA 4DWSB 1C8YA 1CENA 1GNXA 2Y8KA 2O9PA 4JKKA 3ZT7A 3N1AA 3VTRA 3FHQA 1SMDA 4OZOA 1VEPA 3AZSA 1E6XM 1UZ4A 3NDYA 3AQUA 4CD4A 1WZAA 5CQ1A 1W2VA 5D4YA 3WEZA 1BG9A 1JNEA 2YL9A 3BAYA 1UD6A 1TR1A 4CCEA 1LL4A 1E56A 1V6YA 5M17A 4B3KA 1ISYA 3OGVA 2WZEA 4HA1A 3CUFA 4GZIA 1GOMA 4JKMA 3DC0A 3WQ5A 2VVNA 3GBDA 4UFMA 2PC8A 3EDKA 1UR1A 2PWDA 1CLVA 2DT1A 3BCDA 4HZ6A 1OB0A 3BMWA 2YA0A 1E6ZA 5IDIA 4WLCA 1Q6DA 2VRKA 4HPGA 2CBJA 2WC3A 7TAAA 3CZKA 4YN5A 2VMFA 4AZHA 4HMDA 1WNOA 3NUKA 2VL4A 3PZTA 1RP9A 3SCVA 3VM7A 5LA0A 4UQCA 2WCSA 4AZ7A 4TVCA 1E40A 2EEXA 1WE5A 1BPLB 3TTQA 1QI3A 1UWQA 2CNCA 1O7AA 3AHVA 3II1A 2D23A 3WH8A 4JHOA 3QOMA 4AD0A 1QW9A 1H09A 3ZJ7A 3WKZA 1BLIA 3SEPA 2ZOXA 1JYNA 2QPUA 4JCMA 3ARQA 5CGTA 3ZT5A 1WDSA 5ABFA 2A3BA 2GJXA 2W67A 2G3MA 1EDGA 2XJ7A 5GNZA 4D6HA 2OYLA 1ZBVA 2ZUSA 3T2OA 2DSUA 4CKQA 3AHYA 2D1ZA 1V3IA 1CGTA 2FH6A 4W89A 5A6BD 1LG1A 1W9XA 4GO8A 2ZX6A 2J8GA 4MAZA 1GQKA 4CN6A 1XSJA 1W1PA 1BVNP 3N04A 3AI0A 5FKYA 1E73M 3A4XA 1VRXA 1KWKA 1JI2A 3N18A 1CXLA 4ATWA 4J3VA 2WMIA 2J7EA 2BHYA 2O9RA 2YA2A 1JDDA 2YL6A 4H8VA 4HU0A 2ZE0A 3VIFA 1TVPA 1EOKA 3VDCA 3IAQA 2WCAA 1PX3A 4WF7A 4AD1A 4AWEA 4H7VA 4YHEA 4CN4A 2CPUA 3VIGA 1LF1A 1JF6A 1GORA 4QP0A 5GQBA 1KR0A 1B30A 1BAGA 3NDZA 3ZT6A 4DWSD 3WENA 3DECA 4GI6A 2BVYA 2VQUA 5HDRA 2XFRA 4JFWA 4W7WA 5FIPA 2ZUUA 3WQ8A 1HP4A 2AOSA 3IANA 1EO7A 4W5ZA 3NIYA 3BCFA 1UKPA 2QPSA 3IAPA 2X2YA 3CUJA 1HKIA 2CBIA 2YKKA 4J7RA 2FHCA 5C71A 2ZICA 3ARPA 1J0KA 3DYPA 1PBGA 1G5AA 1BYCA 3W37A 5EB8A 3QHOA 2DSWA 2WM0A 4CN1A 1A47A 4AZ5A 1JZ2A 4D6FA 2BY1A 4TTUA 3CHDA 2BY3A 4AIOA 4OJYA 1MW0A 3EDEA 1XCWA 3TA9A 5HXMA 1W9VA 5AC5A 4M80A 1V3LA 5AYBA 1CGWA 4W85A 4EAMA 1TMQA 4AD3A 2W4XA 2XSBA 4CGTA 4KGJA 5EFDA 4DUWA 3ALGA 1NP2A 2WVUA 1CTNA 1MQPA 4J28A 3GTNA 4Z2IA 3CO4A 4B3LA 3G6LA 2ZX5A 1B3XA 2WKGA 4MPKA 2IUZA 4RE3A 3GH5A 5IXEA 3GNPA 1DEDA 1JYXA 3PZUA 1X1NA 4URIA 4J3XA 4AZCB 1B3VA 5A1AA 1EOMA 5A95A 4MNJA 3WDHA 3THCA 5FCZA 1FH7A 5A3HA 1C92A 1EQPA 1Z32X 3BLKA 3VINA 3QOKA 1UR0A 2J75A 2D3NA 3AHTA 1NP0A 3VNYA 2YDRA 3KL0A 1KXVA 2GDVA 1HVQA 3VD3A 2A3HA 2HVMA 3K4DA 4IPNB 1JIBA 4D6JA 1UWSA 3FW6A 1QHZA 3W0KA 1ZBKA 2VZTA 3RO8A 3EYPA 1W3KA 4PMQA 1PX4A 1KFWA 1G0CA 2CBVA 4UTFA 5TD4A 1H49A 4UZUA 3ARTA 2WLYA 3SCWA 1NOWA 1VFFA 5DF0A 5EMYA 2QLYA 1OCQA 1BF2A 4XZWA 2W63A 2VVSA 1GOOA 4LYQA 3WD2A 2YL5A 2WXDM 2W62A 2WNWA 5FL1A 3VX1A 4TVDA 3B9DA 3UEQA 1E1FA 3AZRA 4TXEA 4CVWA 1D2KA 4IISA 3EMQA 1E6NA 1J0HA 3W29A 4WSJA 4MDPA 4LX4A 1UKQA 2E0PA 1XYZA 2VQTA 2IXVA 2NT0A 5A8QA 4KRUA 3I3EA 3TOPA 5A6SA 4E8CA 1FP8A 2ZXBA 3NSNA 4C7DA 3I3DA 4PSPA 4CD6A 1K9DA 1KQZA 4UR9A 2WSPA 4M82A 2WVTA 3SURA 2C8NA 4F79A 4U31A 4AD5A 2GJPA 1KCKA 1ODUA 2CHOA 4Z2LA 1CGVA 3AYRA 4MTVA 4GQQA 4ACZA 4QAWA 1W1YA 5ABFB 4B16A 1CIUA 4MNMA 1OD0A 3QHMA 3T2QA 3VVGA 5BRPA 3MU7A 4MJ4A 2WHJA 1K9TA 2VURA 1SFSA 3MV11 3L4XA 4JFSA 4FLRA 4DWSA 5BXRA 4GKLA 3AZTA 2WKLA 5CLWA 3AIEA 5CJ5A 4P7NA 3W4RA 1C90A 3SCPA 3OLIA 1E4MM 1UR8A 3O2LA 4QLLA 5E9AA 3F5LA 3WUFA 1XCXA 3SUUA 1FFRA 3RPMA 3CZEA 2XM1A 3VD9A 4OIFA 3BAJA 3GXFA 2XUCA 1DWIM 4P8WA 4AEEA 4M24A 3WSUA 4X9YA 3B9EA 4XB3A 1B31A 1ZS2A 2WW5A 2PF0A 2DIJA 1JZ6A 5EBAA 3DHPA 1ESWA 4D1IA 3W81A 3AXHA 5DT7A 1P6WA 3KEHA 4PCSA 3U7VA 4QLKA 1JAEA 3N17A 2D0HA 4V28A 1V0KA 5CG0A 3WDPP 3N13A 3WDQA 5GNYA 2WMIB 3AIUA 5LA2A 2DGAA 1EHAA 1TE1A 3BH4A 3W82A 4R5EA 1E6PA 1NARA 1U2YA 5IFTA 2GK1A 3BAIA 2VZSA 1HJWA 2WANA 1JZ5A 4AIUA 2J79A 3DYOA 3GZAA 4WSKA 2GFTA 2YJQA 1V6WA 3AXIA 3PBGA 2JE8A 3WMSA 3SIMA 4AYSA 1HL9A 1LQ0A 2W5FA 2BXYA 3PTMA 4A3HA 3AFBA 3EDDA 4QCEA 1OBAA 1N82A 1E5NA 3OA5A 2D3LA 1UR9A 1HX0A 1QI5A 2YOCA 1HT6A 5HPCA 5A6KA 4GI8A 4RE4A 4FMVA 3SUTA 3SCOA 2X09A 1EO5A 2E3ZA 4WKAA 1S46A 1RH9A 1GCYA 1JL8A 4NZCA 5D9MA 4M81A 1L8NA 2VX6A 1PPIA 1Q6CA 3WF4A 1W9UA 1H2JA 4UQ9A 3O9NA 1KCLA 2JALA 2YL8A 2ZUNA 4J27A 2VCCA 3RIKA 1ISXA 3K8LA 3PZGA 3NYDA 1CGYA 1E4LA 2JIWA 2YDSA 2J74A 3LPPA 3BAWA 2VT0A 1PZ2A 5JIWA 3BAXA 1C7SA 3ARUA 1W32A 4U3AA 4CD5A 1JZ7A 1CECA 2XFYA 5A8OA 2BVDA 3WD1A 4QDMA 3OZPA 1IV8A 1B1YA 4W93A 3MUAA 1R7AA 2G3JA 1E0VA 1RD6A 3IJ9A 3QGVA 5JIPA 2WVSA 3AS1A 5KEZA 2ZXQA 4MB1A 5A6BA 1C7TA 3IJ8A 1GOQA 3CZLA 3WF2A 1E43A 4M1RA 4PMUA 3LPFA 2AAAA 2XWDA 2D22A 2WPGA 1NQ6A 3RILA 1UR2A 3K8KA 3U5YA 1UKSA 2A3AA 1G01A 2V38A 3GNRA 1B3WA 4IPLA 1EHNA 3MSDA 1EIBA 3WDRA 3PHAA 4JZ5A 3B9AA 3MO4A 3NSMA 3VPLA 4JFUA 4LGXA 1XRVA 4GI9A 3VIHA 2WVVB 1R8LA 2ZUMA 1R7OA 4PEEA 3CTTA 4Z2KA 3D3AA 3ZSTA 3A47A 3WH6A 4OBRA 3W28A 1DWGM 3PTQA 5M5DA 1IT0A 1OGBA 4TTGA 3WEMA 3ARYA 5I77A 4ATDA 3OLEA 1VB9A 2V3FA 1UD3A 1V03A 4KWUA 3PZNA 2ZUTA 3FXYA 5E6ZA 3WDJA 2VCBA 5I3DA 5A8NA 5DT5A 1AQ0A 2X8RA 4ACZB 3L4YA 4E4PA 5A94A 2J4GA 2XTKA 3LPOA 2WC7A 1LG2A 3KZSA 4W7UA 1EH9A 2XSAA 1VEMA 4FLSA 3AHZA 4BCEA 1DWFM 4UFJA 4HMEA 2VX7A 4W88A 2JF6A 3WY1A 2Y4SA 4M8UA 1GHRA 2UY3A 4UFLA 1TA3A 1QVBA 3VGDA 2V3GA 1W9PA 2XVKA 4UFIA 1V0LA 3VGGA 2NSXA 4D6DA 7A3HA 2E9MA 1YQ2A 1CDGA 3AIQA 1X6NA 4XZBA 4LXFA 2WWCA 3D5HA 2G41A 4XX6A 1V6XA 2XM2A 2Z1SA 3K4AA 1H5VA 1EGZA 3PZIA 4P8XA 3A4WA 3AISA 1US3A 4F9JA 3CHEA 2CXGA 2E8ZA 1BTCA 3GDBA 1Q6GA 3WN6A 1KBKA 2XGBA 3WH9A 3VOCA 4IUGA 1QOXA 5CPSA 1VJZA 1DHKA 4PMDA 3ARSA 2X0HA 2A3CA 2XIBA 3JUGA 3I3BA 1G94A 1WDPA 1UUQA 2J7DA 1XSIA 1HN1A 4A3YA 7CGTA 3CH9A 1XH0A 1JD7A 4MDOA 4PMXA 2WMHA 3ZO9A 4W5UA 1QHOA 2AMGA 1B90A 1UA3A 5JBEA 3VGHA 1J01A 3W27A 4U2ZA 1AQMA 3VX0A 2UWFA 1QNSA 1U30A 1G9HA 2EPLX 1C8XA 3AIBA 4KH2A 1E9LA 1NWSA 2GK1B 3FAXA 3T08A 2VJXA 3ZMRA 1E15A 1EXPA 2CKRA 1W3JA 3K8MA 1J0IA 4CD8A 5HNNA 5AYIA 4P8UA 4XV0A 1US2A 3SCNA 4GQRA 1UD4A 1BFNA 1IZJA 3TTSA 4HOXA 3L2LA 2W92A 4HP5A 2C0HA 1JDCA 8CGTA 1KXTA 2CEQA 2J47A 4PRWA 3SUVA 2GJRA 3ARWA 3DHUA 2WSKA 3SCTA 3T0BA 2WMGA 1LL7A 3KE0A 3N15A 4AW7A 3S6TA 3O6AA 1KBBA 1OINA 2YDQA 4BQ2A 2GSJA 4E2OA 3QR3A 3VO0A 1C3FA 2PBGA 2X0YA 5M03A 4KGLA 4BZYA 1QI2A 3AMGA 1JNDA 2J7CA 3UG3A 5JUVA 2XHYA 3WNKA 1OSEA 3K46A 1GQJA 4GZJA 5D9NA 3POHA 3CGTA 4HMCA 1QBAA 1NOFA 4N0RA 3ZQ9A 3AXXA 1L0PA 1V3MA 3VU2A 5I78A 2E8YA 4AD4A 1YHTA 1V3KA 1GOWA 4RE2A 3CZGA 1CNVA 1HJSA 2WHKA 1LLOA 1V08A 3WFZA 3BLPX 1TCMA 4PN2A 1I75A 1OT2A 1GVYA 1UA7A 1MYRA 1CEOA 3J7HA 2RGLA 4WJXA 3WD4A 1VAHA 4NRRA 1UWUA 3AS3A 1GQIA 4BA0A 5FL0A 4HU8A 5IHRA 3VD5A 2QMKA 2D0FA 1MQQA 4ATLA 4CUCA 3APGA 1VBRA 4GINA 2XG9A 2OLHA 2EPKX 3POCA 3PTKA 4S3JA 1QW8A 1JAKA 3VIOA 2VR5A 3ZIZA 4HA4A 1J12A 4P7LA 1CXFA 5FD0A 4JFVA 4X0VA 3AIWA 3MKKA 3RCNA 1W3LA 1JXKA 2EPOA 2QHAA 4LQ1A 4Z2JA 3GXDA 2CITA 2BY0A 1V3JA 3L4WA 2WMJA 2J78A 2MANA 1XH1A 4F66A 1WDRA 2J77A 1GVIA 2VTFA 2QV4A 4BS0A 1K9FA 1MWOA 5IFPA 4PMRA 1EA9C 1R87A 1ZL1A 3CZ8A 5GNXA 3MMWA 2EQDA 3MS8A 3N11A 3ZSSA 3WF3A 1B2YA 2E40A 2JFEX 2VNCA 4W8BA 4J3WA 2PWEA 3VNZA 3EDJA 3L4VA 5E09A 1ISVA 1E6RA 1QNPA 1WAWA 2ZX7A 2PI6A 5E6YA 2Y8VA 4YHGA 2VC9A 1HL8A 2D20A 3GBEA 4MAVA 4CU8A 3N12A 3OLDA 5D8WA 3UG4A 3UR8A 1M03A 1M7XA 4S3KA 1NWRA 3ECQA 3BGAA 3WDIA 2G3IA 2OWCA 4PTMA 3GYCA 4ZE4A 3EMZA 2DT3A 1UKTA 1UG6A 2JIEA 1E55A 2UY2A 4V27A 4W8LA 1VFMA 3TONA 6CGTA 1JF5A 2BHZA 1H1NA 2PWFA 4MNLA 4JL2A 5ABGA 1MXGA 3L2MA 3WL0A 4DM1A 4PTWA 1MFUA 4BQ3A 2FGZA 1VBUA 3AMKA 1KR1A 4PMOA 5E0FA 3WQWA 3SCRA 4R27A 1VEOA 4UQBA 3WFLA 4DM2A 1CXIA 1SYTA 3SCUA 5ECUA 1B3ZA 3RJXA 5KZ6A 1XYFA 3EBVA 5CXPA 2DPEA 3BSHA 1E70M 2V5DA 3ZR6A 1H0GA 3W6LA 1E4IA 3GH4A 1PAMA 5BXTA 1E72M 4P8VA 3OGSA 3PZOA 1GOKA 4HZ8A 5DO8A 2FH8A 5BRQA 1RP8A 1ZJBA 4CU6A 1FP9A 1GZJA 1W3HA 3ALFA 1UWIA 1CLXA 2Y2WA 9CGTA 3K1DA 3VGFA 5IHSA 3T2PA 3OZOA 3WQVA 2VZUA 2CHNA 2CBUA 4D1JA 3WNOA 2FGLA 2WZIA 3CPUA 4AEFA 4DWSC 3MUIA 3PZMA 1UYQA 1UKOA 2CKSA 2VR4A 1XC6A 3AYSA 1WP6A 3A4AA 5EFFA 4D6CA 5HPOA 1GJUA 1DWAM 3WUEA 3WNNA 2G3NA 3VKKA 2WHMA 4BF7A 4PSRA 2JEQA 1MFVA 3VM5A 4FLQA 4HOZA 1X6LA 3F4VA 2D0GA 3M7SA 4W8AA 4EANA 3M6DA 4NI3A 1JDAA 1OGGA 2WC4A 4HPHA 2V5CA 4PBGA 3PZQA 1UD8A 3PZVA 1QNQA 4RL3A 1FH8A 1J0JA 2CCRA 4H8UA 1E3XA 3S2CA 3NJ3A 2DT2A 3CHCA 4P7QA 4NF7A 4JAWA 3WMBA 1JFXA 5CLTA 1OT1A 2WYSA 3W25A 2DQXA 5I79A 6A3HA 3VIMA 3AROA 3U5UA 4HTYA 2EO7A 1E5JA 3OGRA 2OYMA 3UG5A 2OWWA 2VO5A 4KRTA 5LYRA 4XUYA 3WNMA 4DUXA 3VUPA 4L4PA 1E71M 1BYAA 3RMEA 3W6MA 4ZENA 1WPCA 1FHDA 5A8MA 2BVTA 2WBGA 4HZ7A 3WNPA 2VUYA 3THDA 1W1TA 1J0ZA 3IJ7A 2GDUA 3VIPA 1ISWA 1UWRA 1F4HA 4EK7A 5BROA 1BSIA 1CYGA 1XD1A 4PMNA 5LA1A 3ZM8A 1QNRA 4UQAA 5A69A 4W84A 2O9TA 3NSXA 3SCQA 3CHFA 1BQCA 1XSKA 4WIWA 1W9BM 4PUDA 2CERA 5A2BA 3KL3A 4UFKA 3UERA 3CUIA 1H11A 3VGEA 4TX8A 1Y7VA 1HJXA 1PJ9A 2BV9A 1ZBWA 1NWTA 2W66A 2RGMA 3VD7A 1GQLA 5AC4A 4PMYA 2V3DA 1E4NA 3MANA 4WKFA 3LMYA 3L4UA 1E0WA 2XVPA 2EPNA 4V2XA 1V6UA 3F5KA 4ZEPA 2O92A 3CMGA 3VMPA 4D6IA 1E1EA 4W7VA 1WB0A 5D9PA 2ZX9A 4FK9A 1ECEA 3CLWA 1HKJA 1OIMA 5I5RA 1BVZA 3M07A 5BCAA 3AOFA 1QI0A 5CGMA 4PYSA 1V02A 2DDXA 1Q6EA 1GUVA 1M01A 2DIEA 4WK9A 5CPQA 2J25A 2E9LA 2EJ1A 4CU7A 1Q4NX 3TP4A 2D2OA 1PIGA 1V0MA 1LL6A 5BXPA 4A4AA 2W61A 2ZWYA 1CWYA 1UD5A 3W26A 1KGWA 4NSBA 1K6AA 1HJVA 1UD2A 4HA3A 1DWHM 4PCTA 3TTYA 5E0CA 4U2YA 1V0NA 3GM8A 4MNKA 5I24A 2YLLA 1EQCA 1NWUA 3GXMA 2BY2A 3UETA 2YA1A 3CMJA 1O6IA 5D8ZA 5GPRA 1J9YA 1NOUA 2QMJA 1OIFA 2WMKA 3FY1A 1UH2A 1W1VA 3RM4A 1B9ZA 1KWGA 3VIIA 3G6MA 3MV01 3WUBA 4OOUA 3RDKA 2Y5EA 2E9BA 3VD4A 5F7UA 2EBNA 3SUWA 3F5JA 1ZJAA 5M3WA 1KB3A 2WZHA 3WD3A 5ABEA 4AZBA 4ZFMA 3MMDA 4UNIA 5A2CA 2BNJA 2ZXDA 4B9ZA 1B3YA 3CZJA 5AY7A 4K68A 2J7BA 1JYWA 1VJSA 5HOSA 4L4OA 3WELA 4PTXA 3VILA 1MVYA 4CD7A 3WD0A 1MXDA 1G1YA 2F61A 2YBUA 2UY4A
chains in the Genus database with same CATH superfamily
3N29A 3DGRA 3UWWA 2WJZA 4NNBA 3KX6A 5LHEA 1TUXA 3SR7A 1TJ0A 1ICPA 4WDTA 3W7OA 3QV6A 4HYRA 5I6SA 1WZMA 2HDJA 1LRNA 3RCMA 4JPGA 1KXHA 3QHNA 3QH2A 3ZR5A 4PMZA 1EF3A 4NJIA 2NV9A 3WH5A 3B9NA 2VFFA 4JIHA 4UFHA 3CL7A 3H4WA 4AZIA 1AK5A 5FEPA 2OOGA 2G50A 2A21A 2WBKA 3KAOA 3SUSA 4BF9A 3F2BA 1M7PA 1H4PA 1A5UA 2BASA 2E1DA 4KCWA 2V67A 1HVXA 5BWFA 3QC0A 3W24A 1BWKA 5LNUA 5H6HA 5EMKA 4KF1A 2G97A 3W1MA 2YXGA 3TJ4A 4AY1A 4IJCA 1VLWA 3TDFA 2TAAA 3B8SA 1CZ1A 3TW6A 3E0FA 3CU2A 1ME8A 4KKXA 4YCPA 1BHGA 4U28A 5B7YA 3KBJA 4OOZA 2ZBTA 1LQ2A 1KRMA 2VZVA 4OECA 1GZ1A 1TPDA 3BAKA 1FOBA 2GVYA 1OC7A 4WQ6A 1XIGA 3P8JA 4H6EA 1DYSA 4IM4A 4XD4A 3QM3A 1XKYA 1W1IE 4HPXA 3UESA 1RV8A 3L65A 1KBIA 3WQOA 2DP3A 1XH2A 3BURA 2VFGA 2IMRA 5KSWA 1DOSA 3P61A 4Q4SA 3E49A 3U57A 3H2NA 1ITCA 4ALDA 1JZ8A 1CXKA 2J88A 4M7SA 1VENA 2F2HA 1R86A 4QCFA 2YSWA 3LDVA 3UR7A 3H6OA 3REQB 3VMNA 4WGXA 3BMVA 4RNIA 1SUXA 4QGCA 3GAYA 4ICCX 3ZYZA 1XYBA 2DJXA 5CC7A 3BOXA 2CETA 4K39A 1W91A 2E5BA 1ZBCA 2VD8A 1PX8A 2X05A 4C7FA 2PCQA 1XR2A 1KKRA 4A8NA 2ZA1A 1QO5A 2ZKMX 2BGSA 1PZ3A 1VP5A 4PUEA 3NQ8A 3PM6A 4JTUA 1XV8A 3V4BA 1KFJA 5A2AA 2ZUWA 1TTPA 4PTNA 1EC7A 2CZ5A 4ORMA 3UY8A 3QW3A 3D6NA 3R4IA 1R6WA 1TV3A 2QUTA 5LNSA 4H6RA 4B92A 3WBEA 3UFYA 1JD9A 5DY2A 5AHMA 2JEPA 4GK8A 4E2BA 2VX4A 1C93A 3KOYA 1B54A 1DJGA 3MUZ1 1HGWA 1I1WA 3TC7A 1DL3A 2UV8G 3UNTA 1ZU8A 1UHVA 4S38A 1G6CA 1OYCA 3EWXA 4GJIA 1VIWA 5BYWA 3SGUA 4GUGA 4FF5A 1OWQA 1FXQA 3LGEA 3W1XA 3PF3A 4ZQNA 1XQLA 3OLGA 1A5MC 1TTJA 1EJWC 2DZAA 2ZFAA 1OYAA 1OFRA 2XH7A 3GXIA 5I2UA 4MB3A 3VFCA 4L4MA 4W87A 2PTXA 4KERA 1QHPA 5DFAA 5FEWA 1WDQA 1XS2A 4H41A 2W91A 1MQRA 3LX9A 2Y24A 4ZE5A 4GCAA 4IGHA 3AMDA 3A21A 3LOTA 3N3MA 1AG1O 1NH6A 1V8EA 3FYYA 4CQBA 3AICA 4LBSA 3CUZA 3VDAA 2FVKA 2EAWA 4XZHA 2J7HA 4XZLX 3VK5A 1R3TA 1X38A 4Y9AA 4AMAA 1XC4A 4PFHA 1D7FA 1XYMA 2Z00A 5C8BB 3IGXA 4J5NA 4GXMA 1VBJA 1E3ZA 1QRQA 3FN9A 4HT3A 3C2OA 3CUXA 2FPTA 4OU1A 4NG3A 3UJ2A 2XVNA 2VCAA 4JHZA 5A6TC 1KRCC 3F7JA 7ODCA 4AB4A 4M6UA 1JZ3A 1XGDA 4IMEA 3N9KA 2ZRWA 1RJQA 2OWXA 3KBVA 4AZ6A 3MWCA 1KGXA 1W37A 4AYGA 1A3HA 1TPEA 1JRBA 1OGSA 1OX4A 3W2NA 3N6JA 2CC0A 4ZO6A 1I0DA 1POKA 4BQ4A 1DTUA 2AKMA 1UJPA 3G8RA 4O53A 3A4JA 2WJDA 4JX5A 4GE8A 3BUVA 3L5LA 1H41A 4FNTA 3B0PA 4GNVA 1YEYA 1RVGA 4QIUA 5PTDA 1DP0A 4C6CA 2NT1A 4HCLA 4M1BA 4DNHA 4F40A 4O54A 5C70A 1N8FA 3CPRA 3W88A 3R8HA 2WVVA 1KFCA 3ZOAA 4X3ZA 2IPJA 1XHGA 5KZEA 5CSRA 2Z6JA 4B15A 1KGUA 2XPKA 3UQNA 5LIUX 1OABA 1RAKA 4XG1A 4GCXA 3TNBA 4RX0A 5A8GA 3S83A 2HS6A 3SZ8A 3THQA 3L0KA 5A6JA 4L9YA 3FKKA 5H8PA 2VOMA 2PZNA 5LIYX 3PZ9A 4JCLA 5AC7A 3T4WA 1EP2A 4IIDA 3PS7A 2PB1A 4DUOA 4NRSA 4Q7NA 1ECQA 1J0YA 2ZIDA 3LYEA 5A6AA 4BI6A 2I1OA 4PUMA 4OBSA 2OSXA 2PEVA 3R79A 2QJMA 1XIIA 1IWBA 2PDXA 3EX3A 2NLYA 2O9PA 1XIHA 1R5YA 4NAFA 3ZT7A 1AFSA 3N1AA 1R3QA 4O8RA 3FHQA 3JVAA 3T55A 1UZ4A 2I16A 3AQUA 5AYYA 3GKAA 2YL9A 1UD6A 3QQ1A 3GU9A 1V6YA 2PDLA 2WZEA 3CPGA 3DZ1A 3G1HA 3M0JA 4N9CA 2LLEA 2DZPA 4LNCA 1UIPA 4HNVA 2PF8A 1CLVA 1JEZA 1EF2A 3GYEA 4AWUA 5FSEC 3OODA 3UZJA 4XD3A 3SGGA 3LRKA 5C9ZA 1GEHA 1T6MA 2DVTA 6ENLA 7TAAA 2GUUA 2QCGA 1G4EA 2C1GA 4IJRA 5AYZA 2VMFA 4AZHA 1WNOA 3NUKA 2VL4A 3PZTA 5D09A 3B03A 3OBKA 1WXJA 1WE5A 1BPLB 3JS3A 1I45A 3TTQA 1K70A 5AHEA 2ATMA 3C86A 4H1ZA 3OA3A 4LUTB 4R3UA 3QOMA 1AJZA 3ZJ7A 4F3HA 4NZFA 4REQA 3WKZA 1TV8A 3LM7A 3MP4A 3VKAA 4PB4A 4JCMA 3ZT5A 4MJZA 3PNZA 2KX9A 1Q6QA 4CNOA 4B4FA 5GNZA 2OYLA 2DUAA 3H70A 3ITYA 3NYZA 2R9RA 1Z3NA 1V3IA 3DG6A 3WK3A 3UVIA 2FH6A 3UR2A 1O1HA 4W89A 4GO8A 1GG0A 1XSJA 3EX1A 3A22A 5FA5A 4RR4A 4XIAA 4NP7A 4AEOA 4PCFA 5EA9A 3N18A 1C9DA 3TKFA 3N2CA 1GT8A 4TU1A 2BHYA 2YA2A 1YTKA 1JDDA 3CM4A 5AECA 4HU0A 1TVPA 1EOKA 3S5SA 1PX3A 2P3ZA 4FB7A 1A50A 4MKNA 8RUCA 1P0DA 3WK1A 1IWAA 1JF6A 4E4UA 4QP0A 3WYZA 1TV4A 5GJMA 1B30A 3H54A 2BVYA 1ADOA 1UR3M 2YYTA 4LW7A 3CYVA 2O4QA 5C0QA 4HU4A 1HP4A 3NIYA 1UKPA 3TROA 2I9EA 1V51A 4KEMA 4EVZA 3CUJA 3QF0A 1TTIA 2ADAA 3ARPA 1F5ZA 3BANA 1J0KA 5EMMA 2NV1A 3DYPA 3MCMA 4FPSA 3T44A 5LZLA 1G5AA 1BYCA 6REQB 3W37A 3OEXA 2P76A 1P7TA 3IUDA 1BEUA 1JZ2A 2EG6A 3V35A 4TTUA 1X1ZA 4C91A 3G0XA 4LU0A 3R2GA 3EDEA 1XCWA 5AC8A 4FR6A 5AC5A 3DBPA 1CGWA 3TYUA 4EAMA 1RLCL 1SZEA 1TMQA 2W4XA 3LBOA 1OC6A 2XSBA 2RDXA 4KGJA 1WKEA 2NQHA 3R10A 3DKJA 1NP2A 4B91A 3BZJA 3WBYA 4IZGA 2G4JA 3EA1A 3H7UA 4UTMA 1DE6A 2IKHA 2J8TA 3NXFA 3GTNA 1NDVA 2XN0A 4Z2IA 3CO4A 1X96A 4XBKA 1B3XA 1XLDA 4M51A 2IUZA 4RE3A 5IXEA 4HNLA 3GNPA 1JYXA 3B3DA 1SR9A 3G1FA 4K36A 3ZWTA 4J3XA 5A1AA 4M19A 3O8AA 2BLEA 3TR9A 4RXGA 3LM3A 3THCA 5A3HA 1Z32X 4KESA 4TX9A 3BJFA 3QOKA 3ZR4A 4GYKA 3W75A 3KBMA 2RDWA 4B5NA 1ZAHA 3WLJA 3STFA 4MGGA 3VD3A 1KCXA 2E67A 2R94A 3K4DA 2E6FA 2PUZA 4DEFA 2V2DA 3FW6A 1ZP4A 3PSVA 3RO8A 4ZCWA 3R13A 4UZUA 5BU6A 1W5QA 3NQFA 4C6DA 5DF0A 4KBXA 5DY3A 4NYUA 4ZL1A 2QW5A 4NU7A 3TYEA 3WG6A 1IXPA 3MY9A 2A1YA 3B9DA 1EP3A 4DB7A 3UEQA 4NAEB 2NLIA 4H9MA 3QYQA 3QMRA 2QJIA 5AC6A 3OQ8A 3PB0A 6TIMA 2Y88A 3PPFA 1UKQA 2E0PA 1Y8BA 2VQTA 2NT0A 2CXEA 5A8QA 2ZXBA 3I3DA 3SY1A 2WSPA 5A5WA 4HB7A 4WRHA 2DW7A 4G2DA 1IGSA 5F2MA 3TWBA 5EPDA 3B8VA 4IIHA 1OVDA 4U31A 3KCOA 2GJPA 1KCKA 3NURA 4MTVA 1AH0A 4GQQA 4BY3A 5ABFB 1CIUA 4MNMA 4FX6M 4KPLA 3WLRA 5DXXA 2RJHA 1VYRA 2PDYA 3CS2A 2NQ9A 4EF8A 1FWFC 2ZC8A 3MV11 3STGA 1XIEA 3L4XA 4DWSA 1H1YA 2W3ZA 2HROA 2ACSA 1RR2A 4GKLA 1R2RA 3AZTA 3LZ3A 3ITLA 5CLWA 1F8MA 4JGDA 4P7NA 1C90A 3SCPA 3WLSA 1E4MM 4ICMA 1H50A 1F2JA 3WUFA 3SUUA 4JQ2A 3RPMA 2F84A 3T40A 2VEPA 1L9WA 3D46A 3FEQA 2OJPA 2XM1A 3OQEA 2QPXA 2PDPA 3GHUA 3BW3A 4QNEA 1UBSA 3KOZA 3B9EA 2RUSA 4XB3A 2WW5A 3BMXA 5EBAA 2AL2B 1MZHA 1ESWA 4WZHA 2QCLA 3GSMA 4HSOA 3TZNA 2XU2A 4FX8A 3WLOA 4GRSA 3E3HA 5JH1A 3EWBX 1OX6A 1V0KA 1V7YA 3LS9A 1F7BA 1XM3A 2WMIB 3SFKA 2HSAA 1KM4A 2QR6A 5EMJA 1E6PA 5IFTA 2VZSA 4XAYA 2V30A 3MT1A 2J79A 4MY1A 4WSKA 1NFPA 2GFTA 1MMFA 3LNPA 4X2PA 1FXPA 2I57A 3WMSA 2JE8A 5DN1A 4AQLA 2EPHA 2QXWA 1HL9A 2PCEA 5J8LA 4B5SA 1ML1A 4WCJA 2BXYA 3EXTA 1E9IA 3AFBA 3DFOA 1OBAA 3MUXA 2NSOA 1DJIA 3OA5A 4ZO7A 3ISIX 3B4UA 1QI5A 4L7ZA 1JDFA 4WUIA 2DVUA 3CAVA 2HRWA 3VNMA 3M0YA 1NDZA 1EO5A 2E3ZA 3LEPA 4A35A 2P8BA 3SRKA 1L8NA 5I3GA 5HR6A 1VZWA 4XO7A 1Q6CA 4Q8OA 2YL8A 4J27A 2P50A 2ZZ2A 4I7UA 4KIRA 1TV7A 3PZGA 3NYDA 4IL0A 3HQ1A 5K4ZA 2YDSA 3HPFA 4GUHA 3BAWA 2VT0A 1MXSA 3FSTA 1KW1A 1AJ2A 5A8OA 5LNWA 3LY0A 1XWYA 3PJUA 2BVDA 3WD1A 3AU6A 1PHWA 2G37A 4W93A 3QGVA 1H61A 3S8HA 2WVSA 5CSSA 2L5HA 1C7TA 3KWSA 2Z27A 3H4XA 4O4VA 1E43A 4M1RA 4PMUA 2AAAA 5D32A 2F9RA 3RILA 1PWLA 4UMBA 2YCKX 2A3AA 1KBJA 5T26A 4DF0A 2PRLA 5LIKX 4N4PA 1PCWA 1FWSA 3MO4A 3G22A 1LTDA 1XRVA 3EPNA 4GI9A 3VIHA 2TPSA 2W6RA 1CB2A 2Z2AA 4O1BA 4MWAD 4QQ3A 3ZSTA 1DTNA 4IX2A 2R1PA 5M5DA 1IT0A 3RUBL 3ARYA 5I77A 4ATDA 2IQTA 3OLEA 1VB9A 1UD3A 2GSHA 2ALRA 3BCJA 4B90A 1RCXB 1VCFA 2VP8A 5A8NA 5H8MA 1AQ0A 2X8RA 4ACZB 5HWNA 5DMLA 2XTKA 1LG2A 3O6YX 4LV9A 3S5OA 1W8SA 4WHBA 3B0UX 1VIZA 3BL3A 1K7FA 3IVUA 3KP0A 4JQ4A 2C19A 4UFJA 4KIEA 4M8UA 1GHRA 4CQAA 3R12A 2TYSA 4LV4A 3PJXA 4UFIA 1V0LA 2QGYA 5AN7A 3G1DA 4BI7A 1H51A 4PRRA 1BRLB 3RCYA 2KAUC 2GJLA 1IYXA 2WOQA 1YQ2A 5D03A 4XBJA 4LEFA 1V6XA 1ZENA 1YNPA 3K4AA 4LRTA 3WLIA 5CJMA 3BVJA 2Z1VA 3JZUA 4P8XA 4F9JA 3BLFA 1Z9AA 4QISA 4ZQMA 3NEVA 2CXGA 1BTCA 2J9YA 3TAOA 2Y0FA 3PUOA 4DI8A 4Z42C 4IUGA 3WJYA 4AHPA 1QW7A 3NZ1A 3M0XA 3HG2A 3VNKA 4MDOA 2WMHA 1OHLA 3N2TA 1AQMA 1X8FA 1QNSA 1L2QA 1C8XA 1S3TC 4FXFA 2GK1B 1EXPA 4E0CA 5C9RA 5HAOA 4FF7A 5F2GA 1KLYA 4P8UA 4JTJA 3AC0A 1GVQA 3OPSA 4YTRA 1BFNA 3A3XA 4EACA 3TN4A 3L2LA 4HP5A 1VR6A 3UXKA 5SWUA 2C0HA 8CGTA 1KXTA 3SUVA 1YDVA 2GJRA 3DHUA 2WV8A 3TTEA 3W71A 2DIKA 1HKVA 3S6TA 4GH1A 4I5XA 1KFBA 1OINA 1TRDA 5AHLA 3SRDA 2PWUA 1EX5A 3W76A 4BZYA 1QI2A 3DG3A 1JPIA 2I7GA 1K8YA 2PP3A 2J7CA 4WJ8A 4E3VA 3K46A 1LRQA 3FLUA 4Z0JA 3SO7A 5G4HC 1NOFA 2V5LA 3CAKA 3EXRA 4PB3A 3ZQ9A 3EWWA 2NQ5A 3NQEA 3AXXA 4QSHA 4KCVA 2D69A 4MHBA 4JTRA 4R33A 1V3MA 2TSYA 2E8YA 4AD4A 3MBDA 1WX0A 3GU1A 1V3KA 1GOWA 1CNVA 5L9FA 1V08A 2BX7A 1I75A 2HTMA 2Z7GA 3GIPA 1CEOA 4WJXA 1I9CB 1KM6A 1UWUA 3AS3A 1GQIA 4EX4A 4Y9NA 5GJNA 2XIMA 2PDBA 5IHRA 4GX8A 2QMKA 3UGVA 3TYZA 4ATLA 3NQ6A 3OVPA 2EPKX 4IFKA 1LWIA 1JCYA 3GVWA 3MUCA 1HL2A 3FIGA 1SW7A 4QBXA 2FZNA 1CXFA 4AHQA 1OFQA 1UOZA 1H5YA 4JFVA 3AIWA 1NEYA 2QHAA 1JXKA 4Z2JA 3U9IA 1UP2A 1XFCA 2BY0A 2OKTA 4OV9A 3IWPA 2WMJA 3A9IA 4AX6A 2MANA 4ERIA 1EL3A 1WDRA 2J77A 1GVIA 2VTFA 5HMEA 3A12A 2TMDA 4BS0A 1K9FA 2X1UA 1I2QA 1R87A 2QCDB 3CZ8A 4Q4MA 2VD9A 3W1TA 3M43A 4B3ZA 3AXMA 3WF3A 4RZ6A 2V2HA 4LNYA 5C9WA 1QTWA 2JFEX 4JEQA 2VNCA 4NZ1A 2H9AB 3O07A 3VNZA 3L4VA 4MPQA 1SPQA 3CB8A 4QE4A 2Z1BA 1PL9A 5E6YA 2X30A 3LCGA 3HQNA 3N12A 5AZ1A 4CLMA 1A80A 4IPJA 4XSMA 4S3KA 3NZQA 1NWRA 5JVLA 4XZIA 4PTMA 4D2JA 3WJXA 2DJLA 3MBFA 4LY8A 4W8LA 1QO2A 1F73A 4S3CA 4HK7A 5EGRA 4ROQA 2ANUA 4P61A 5KETA 1SU5A 4UTTC 4PMOA 1D8WA 4WD0A 5T8GA 5E0FA 4ZQOA 1XISA 1ZQ5A 2GVEA 4R27A 1VEOA 1E0UA 3ABRA 4UQBA 4E6MA 1T8XA 1XUZA 4J3ZA 1CXIA 3SCUA 1B3ZA 3TJXA 3IPWA 1IEVA 1D3HA 3EBVA 1MEWA 5CXPA 1W17A 4XAGA 2BOFX 4ILSA 3ES8A 4JEJA 3WJWA 2PSNA 3Q4DA 1GYMA 1PAMA 5DLCA 4HK6A 3KRZA 4MUPA 1AH4A 3OGSA 2FH8A 4DJFA 1S2UA 3BJSA 1ZJBA 1GZJA 1XRFA 1W3HA 4JTTA 1XYCA 1QMLA 1TJRA 1UWIA 3T2PA 3OZOA 1F61A 3EEGA 2CBUA 4D1JA 1OX4B 2A6LA 2FGLA 2WZIA 4GUIA 3T42A 4GVFA 4AEFA 1PB0A 4QHRA 3MZNA 3PANA 3V16A 4V1XA 3AYSA 1WP6A 3HIJA 3WNNA 3BLOA 4DWDA 1IXNA 2A85A 1NVMA 1MFVA 4FLQA 2OXNA 1HUVA 4HCHA 4EANA 4NI3A 1OGGA 3LRMA 3D3FA 1EJVC 1UD8A 3PZVA 5C9UA 1QNQA 1J0JA 4IQLA 1SZFA 1E3XA 1O5QA 2DT2A 4IFOA 1B4KA 1JFXA 5CZSA 1M5WA 2X16A 1NSJA 1TCDA 2R6OA 2DQXA 5I79A 1DHPA 3VIMA 1RUSA 3AROA 3U5UA 3SECA 1E5JA 4OE7A 1EBGA 3LV6A 4M6QA 5LYRA 1LDCA 4LT9A 3CXOA 4NNCA 3VUPA 2E6DA 4L4PA 4K1GA 3PPCA 3SRHA 2HNHA 1BYAA 1Y0EA 1XIMA 5K7JA 2BVTA 2C13A 2CLFA 4KW2A 3ZFHA 3EOSA 1RQEA 5FF3A 3H2FA 3VIPA 1OFOA 2IKJA 1F74A 2H9AA 5A69A 4IMGA 4W84A 2Q6ZA 1GOXA 1XSKA 4NAFB 4WIWA 2B7QA 3GG7A 4LCSA 5EMLA 3B97A 3DH7A 3R89A 2CERA 5A2BA 1W54A 3O15A 4B5WA 3S5NA 4TX8A 1PJ9A 5FSDC 1DJQA 2W66A 2GZXA 2QF7A 4O11A 5AC4A 3ZWSA 3GHTA 1GEQA 3PFRA 2P0OA 1WUFA 3CL6A 3L4UA 2VWTA 5HQMA 1E0WA 4OTKA 4V2XA 1V6UA 7REQA 1G7VA 3WBXA 3LTPA 4XK2A 2O92A 4FK9A 3CLWA 5C2CA 3NQDA 1REQB 3KUMA 1DKWA 3ORWA 1SJDA 2WQDA 4V1YA 1V02A 2DDXA 4Z1DA 3NQMA 5J5RA 2GSEA 1M01A 4JTGA 1RK5A 4IG2A 1AH3A 2P88A 4H6QA 4CU7A 3EKGA 3TP4A 1ME9A 2BB0A 1TWZA 4ZQCA 2W61A 3U4FA 3RPTA 3TXVA 5MKGB 2ACQA 2OCZA 4JTQA 1MDRA 3TTYA 1T5AA 4U2YA 1V0NA 3TC3A 4MNKA 2YLLA 3UETA 2YA1A 1WOAA 4GXWA 5I06A 1PKLA 5K3VA 2C16A 2NZLA 3M0MA 1NOUA 4Y9MA 2OPJA 4JOMA 1PDZA 1N7KA 1WYIA 4YTQA 4HIBA 1PVNA 1ADSA 2CLOA 2ZTJA 1KFLA 4GVHA 2EBNA 4OVXA 3VKDA 3SUWA 1ZJAA 5C54A 1UB3A 5CH9A 2X42A 5ABTA 1UROA 2OQHA 3UXAA 1QOQA 5L6UA 3MMDA 4IMFA 3G1SA 2XZ7A 4GMEA 3AO0A 1JYWA 5HOSA 1A49A 3M0HA 1JR1A 3KW3A 3N25A 3P81A 5G2HA 2PP1A 1J2BA 1G1YA 1BKSA 3W9ZA 3GK0A 2YBUA 5GVJA 2UY4A 3IEBA 2KZHA 4KWWA 3GVVA 3AMCA 3YPIA 1KM0A 3HMCA 4EPBC 3K30A 4MZ8A 4Z2HA 5BMXA 1KQYA 2OSYA 4HGXA 4TR9A 3VKBA 2EPMX 1T8QA 3CO8A 1VFUA 4O16A 5D38A 1JCLA 2J13A 3GG1A 4RKAA 1Q65A 4HK5A 4AIBA 1J6OA 3O1NA 3M0ZA 3CT2A 3WH7A 2CLHA 2PZ0A 1E0XA 3L4TA 4LCRA 1AMYA 1K02A 1UZHA 3S47A 1P6BA 3A3HA 1K8ZA 1PV8A 2HZGA 2CLLA 4MY8A 5G5IA 5DMYA 3R0UA 4G6CA 1AD4A 2ZXAA 3HJEA 2PLCA 3EMCA 3L23A 1UWTA 1TZZA 2YCIX 3GTIA 2WB5A 3CQKA 2H8ZA 2OG9A 1GONA 1V02E 1FWNA 3NCOA 1QNOA 4LS0A 3FDGA 1M53A 3OB8A 5E93A 4O57A 1V79A 3GXTA 3WQ6A 2ZWZA 2WAGA 3IARA 3VGBA 3PULA 4C6PA 1LORA 1A0EA 1VFLA 5REQA 1HJUA 2BSLA 3VABA 3UPWA 3UCQA 4MZ1A 2PRMA 3SSJA 5A6MA 2XGIA 2PU1A 3WLQA 3SSZA 5CSUA 3R0KA 1JI1A 3S1XA 1YE6A 3C61A 3HA1A 1B4EA 3FFSA 4AD2A 3TU9A 1XGZA 2BOGX 4LUSB 2HE5A 3ABZA 4JTAA 1FA2A 1JFHA 1K9EA 1G4TA 2XN1A 4IGSA 1D3CA 1QPKA 5DCDA 2WHLA 3OBAA 1G4PA 4D72A 3HQOA 4UIOA 5K9CA 2R82A 2FZBA 3CEUA 3NVDA 1IEXA 1YDOA 4IQJA 4RW3A 2C7FA 4U5KA 1FCUA 1FH9A 4AVOA 2YB4A 1YX1A 5TAOA 2ESCA 2CZVA 3KL5A 1ZCOA 4UTWA 1J11A 2VZOA 2OT0A 1HJQA 5FJJA 2AQOA 3ARVA 1VPXA 1WO2A 1EEXA 4B2DD 3UCDA 2CLKA 1F6YA 5I0DA 1PS9A 4UOZA 4S2CA 2RKXA 4UTKA 3P3BA 2FVMA 3UPMA 1GZGA 1RQBA 1W9DM 3RF9A 4L6OA 1G4SA 1QOPA 2A5HA 3KHDA 4N4QA 3NGFA 1KXQA 1R47A 2A2IA 1OK6A 4GD0A 1FWRA 1VFOA 3FNDA 3EZ4A 2XVLA 4QX4A 2J62A 3KVMA 1A0CA 2PDGA 2ACUA 3W1LA 4O28A 1AW2A 5D05A 1JXJA 1S38A 3HM7A 3T78A 4TVUA 4MADA 4OUEA 3WQEA 4KMQA 4M5PA 4OT7A 1SW0A 2CWNA 3KRSA 3ARXA 1K4GA 4DLFA 5C55A 2ZQ0A 4GIAA 1R85A 2HS8A 3OG2A 1UR4A 2GUYA 4GJ1A 2IPFA 3FAWA 3NZRA 4G7FA 1RJRA 3DX5A 1Q6FA 1FFQA 1S5WA 2QCMA 4EIVA 2ISVA 4PL2A 2P8CA 3S46A 1F3XA 1CGXA 3PY2A 1DQWA 3W2MA 1TQXA 3QZ6A 4L5ZA 4J3SA 4XUGA 3G18A 4ACYA 1ELSA 2BS9A 4EPKA 1M41A 2PWGA 3RM9A 3ANVA 1IGWA 3CV6A 3SCSA 2AL2A 3BZGA 4UQEA 4Q8VA 3ME3A 1O95A 2FFCA 4R7OA 1AQHA 4JKLA 2HQAA 4IXHA 2DT0A 4YU1A 1AVAA 3W74A 1ISZA 3ATYA 1CBGA 3T0AA 4P7RA 4PCNA 2ZRUA 2PWHA 4CQ8A 1DIDA 4UCFA 1O5RA 4JQ3A 2I5GA 4YPJA 4JFTA 1VJIA 5B80A 1CW2A 1GOIA 5E9XA 5CZKA 1CGUA 3UZXA 3VMOA 4GC4A 4CCDA 3VIJA 4YNGA 3RU6A 3C8NA 1Y5XA 2C15A 4WY0F 4GNKB 5G1YA 4H9UA 1GWJA 3W00A 4UZSA 3QC3A 2WQPA 5D9OA 1L6SA 1OFDA 1UH4A 3CUGA 1ITQA 4N42A 1QI4A 1EC8A 4R85A 4X0NA 4TOQA 6PTDA 4NVTA 1XLLA 2P0IA 2J7GA 4F2TA 1A5LC 1L6GA 3UZYA 5BU9A 4Q8MA 2OSWA 2PDCA 4B9YA 4P7OA 1V6VA 3PWAA 4BQ5A 4YL2A 1Z89A 4DF2A 1DE5A 3W73A 3DENA 4TMCA 4UOJA 4CNPA 3C5QA 2WCGA 3E2SA 1HKKA 3PWGA 3LI0A 3H8AA 4ONVA 3T0DA 1XLKA 5M2FX 2VRJA 2FB3A 2EJAA 1TMLA 3GHRA 3U7BA 1QWKA 3EKZA 3LHYA 2A3EA 4GXPA 1EFZA 1Q2RA 4HPNA 2JKPA 1VYSX 3HO8A 1EDQA 1F8IA 4Q3MA 3P0WA 5HINA 2FHBA 4AXKA 2ZUVA 1FVPA 3OVGA 4FLOA 3ELFA 4EE9A 1MW1A 4FA3A 4A22A 1YYAA 4IQDA 1FBAA 4D6GA 3RMJA 4EWND 1WZKA 3OVRA 1EUNA 1XD0A 5DBTA 3MC5A 3MCNA 4MMWA 3N9SA 1JGIA 5C7HA 1E6SM 1EBHA 3TCSA 4LY4A 3Q37A 3UR5A 4DWSB 3VKCA 4JKKA 1VPQA 1E6XM 5FJIA 3E0VA 4CD4A 3G24A 3WEZA 5LIXX 5KZDA 1H7WA 1TR1A 4IT1A 4B3KA 1RCOB 3OGVA 4JS3A 3CUFA 4JKMA 2V5KA 3DC0A 5HK4A 4JYFA 4JQAA 4UFMA 2QUVA 5FJPA 3U2EA 2Z24A 4FOUA 1H62A 3HGSA 2HE8A 3C4UA 1HZYA 3BCDA 4HZ6A 4KEVA 3TW7A 2YA0A 1E6ZA 2PDMA 1YIXA 4HPGA 2DZSA 1XPGA 3MKCA 2OTDA 4IIFA 2WC3A 2ISWA 1A3WA 3TVAA 3RITA 3RX4A 4HHLA 2ISSA 4S3BA 1DBTA 4HMDA 2Y89A 2F7FA 3H23A 3SCVA 3VM7A 2XGZA 2X2GA 2NWRA 4YVXA 4H6KA 4AZ7A 4TVCA 1BRLA 1UWQA 3VFLA 1TQJA 2NVCA 1WDDA 2D23A 5EMUA 3SDOA 2NXIA 3AYVA 3OVQA 1BLIA 5IRPA 3SEPA 2ZOXA 2QPUA 4JTKA 3ARQA 5CGTA 3E0LA 4JTSA 2YBVA 3E2RA 4E2DA 3T2OA 5F2IA 4QXIA 1EJRC 5AHIA 5A6BD 1LG1A 2ZX6A 2J8GA 4CN6A 1L6FA 1BVNP 3N04A 2NV2A 1OZMA 3S1VA 2E7FA 3A4XA 1VRXA 1KWKA 3S9ZA 2GGHA 1CXLA 3AAMA 5M1TA 4J3VA 2WMIA 3E5BA 2YL6A 3VIFA 4BF5A 3P5YA 3B8UA 1SFLA 1X1OA 1YBQA 3IAQA 4I7WA 3WLHA 3V1PA 4AD1A 4YHEA 2XN2A 5J04A 4DBUA 3XISA 3BG5A 2VUNA 3VIGA 1LF1A 2QDEA 1GORA 4K8EA 2Q8LA 3HF3A 1PWMA 3NDZA 3DECA 4GI6A 1IT8A 4TMBA 1S5MA 1DV7A 4FS9A 4W7WA 2PTYA 5FIPA 3RAOA 4DPPA 1EO7A 1JUEA 4W5ZA 3BCFA 2HXTA 2QPSA 4DBWA 4XSLA 4G1KA 3PC0A 1HKIA 2CBIA 2HBXA 2YKKA 3WQCA 4J7RA 2FHCA 5C71A 4HZMA 3U2ZA 3C3NA 1HFBA 3GNNA 2PDHA 5G2WA 5EB8A 1TX0A 3QHOA 2NQJA 1HQTA 1A4MA 2PD5A 1LLWA 2CZFA 1Q13A 4AIOA 3B06A 1MW0A 3TA9A 2DUZA 4JTLA 3A23A 4GFIA 2WVUA 1CTNA 2GVGA 3D47A 4J28A 3K5XA 4BK9A 1WQ5A 4B3LA 3G6LA 1SW3A 2ZX5A 2WKGA 1H7OA 2PLKA 4C6EA 1DJYA 3HPSA 4MVAA 3SN4A 3HQPA 3IIZA 3PZUA 1IEIA 2REQA 4NJKA 4K38A 4H83A 3MJMA 4CNUA 1X1NA 4URIA 5HNRA 1N2VA 3W02A 1IEWA 1ZGDA 2QJNA 2OO6A 3FCPA 5DELA 3CLMA 3FA5A 4RK8A 4PC8A 1EQPA 3VINA 5DRIA 3N2OA 1F6KA 1TZ9A 4BEQA 1Z41A 2P53A 2I9UA 3AHTA 4LUSA 4C65A 3UXIA 3KL0A 1KXVA 3TFXA 1DJXA 2A3HA 1K03A 1WA3A 1XQKA 4HNUA 5C5YA 1RLDA 1JIBA 4ZTXA 3MJYA 4GACA 1XLAA 3JU2A 4KFPA 1W5MA 1XYAA 1AA1B 1W3KA 1PX4A 5DBUA 1K6WA 3CIXA 1H49A 5TD4A 3SM0A 4ZB2A 3ARTA 3SCWA 2PURA 5EMYA 3S1UA 4XZWA 2W63A 3F4WA 1GOOA 4IUOA 4LYQA 3WLTA 4EPDC 5FL1A 3SGZA 1KA9F 1E1FA 1GJPA 2VENA 4CVWA 2JQXA 3HG4A 4IG2B 4BR1A 1LT7A 4C6BA 3W29A 2WNZA 4WSJA 4LRSA 1W5PA 1XYZA 2QUUA 7TIMA 4KRUA 3I3EA 1EX1A 1FP8A 3NSNA 4L61A 4C7DA 4CD6A 1K9DA 1KQZA 1IXOA 4M82A 4JTHA 3SURA 4H19A 2C8NA 3UF9A 1J8VA 3NQ2A 1IT7A 4AY8A 1U1UA 3P14A 4LFYA 4PB5A 3QPZA 1ODUA 4G7EB 4Z2LA 4MKSA 4MYAA 1E51A 5CBIA 3G5EA 1W1YA 3S1WA 4Q33A 3QHMA 3M5VA 3MW7A 3UZZA 1V5XA 3MU7A 1YDNA 2WHJA 1K9TA 4BEUA 1TMHA 2DZBA 4LAMA 2FQIA 4JFSA 4Q8NA 5BXRA 1XUUA 1NIUA 5HMFA 5T91A 4X63A 3P93A 3OLIA 3PFMA 1JCNA 2X1RA 1UR8A 3ZZ1A 1Z44A 2NX1A 1OADA 3VD9A 1DWIM 1BKHA 4P8WA 2DW6A 2VWSA 1JDEA 2PF0A 2QUMA 3BV7A 2FZDA 3AXHA 2VEGA 4JN7A 1TPWA 4PUUA 3W7NA 1FWCC 4KQNA 1D9EA 1JAEA 1F3TA 3W2JA 4Q8QA 3PWIA 4F2UA 1F3EA 4V28A 1Z69A 2PLJA 4ZSTA 1PE1A 3M9YA 1KC7A 4IOTA 5T9CE 3AIUA 3PUEA 4EXBA 5LA2A 3V0UA 1RK6A 1TE1A 3BH4A 4KCUA 1NARA 1U2YA 4FO4A 3G77A 2WANA 1JZ5A 4AIUA 3OO2A 4TIMA 2YJQA 3IJIA 2IKIA 1F07A 1V6WA 2Q8ZA 3GIYA 1I6NA 1LQ0A 1QPQA 2W5FA 3KOWA 4AY7A 3SY5A 3EDDA 3O0KA 4PODA 3GB6A 1E5NA 5CPLA 2D3LA 5HPCA 3P8IA 5A6KA 1M7JA 2OZ8A 1R3RA 1P7TB 4FMVA 3SUTA 1Q5MA 4X22A 4WKAA 4RDVA 4RZBA 1RH9A 1EKOA 1TPUA 1GCYA 1LP6A 3PVFA 1XLFA 1FDJA 1JL8A 3CV1A 3RRXA 5D9MA 4XWUA 1R0MA 3EOUA 4QE1A 1MRAA 1Q85A 4UQ9A 3E9AA 1QXLA 4DZAA 3APTA 1KCLA 2JALA 2AL1A 2GUBA 1V4YA 1LT8A 1PO9A 3IVSA 4X9SA 1NF7A 4AF0B 1CGYA 1E4LA 2VGBA 1I0BA 1C7SA 1CECA 1GQNA 5CC5A 4QDMA 3R5EA 1IV8A 1B1YA 4RZ4A 1UJQA 1MUWA 4H00A 3C2EA 3WX7A 4I6KA 3BPWA 3RXZA 1P0EA 2ZXQA 4D8LA 3E0IA 5A6BA 1QASA 4GY7A 4JHMA 4FZIA 3W7EA 4AC7C 3CZLA 3UA4A 3H53A 2OFJA 1U22A 4GVGA 3EX2A 3LXCA 1NQ6A 4I9TA 1UR2A 1I2OA 4KFNA 9XIMA 5LSMA 3TEVA 3LERA 4O18A 3DOPA 1B3WA 4IPLA 3MSDA 1EIBA 2V8ZA 3ITXA 3VPLA 4LGXA 3T6CA 4H9XA 3H55A 4O0QA 2GDQA 1R7OA 3VAVA 4ZVJA 4Z2KA 3D3AA 4RDWA 3N19B 3MKVA 3PTQA 2FJUB 2V68A 1OGBA 4GLEA 3GY1A 4FP1A 3WCZA 1S1PA 1EPVA 2AGTA 5H2ZA 1XDLA 3IIXA 4KWUA 3PZNA 1THFD 3FXYA 5TNVA 2ZUTA 3GFXA 3EKLA 4O1DA 5DT5A 2QCFA 2PGEA 4QAIA 4IFRA 5A94A 2Y62A 3LPOA 1JUBA 3NTYA 4W7UA 1EH9A 1E0TA 4UC5A 5I3KA 4UTJA 4FLSA 2Q71A 4OFCA 2VELA 4BCEA 4F0SA 4HMEA 4W88A 2JF6A 5HWJA 4UFLA 1S2TA 2NWSA 3QFWA 1W9PA 4S3FA 1CI1A 3S5YA 5CPOA 3VGGA 3UJEA 2QEZA 2HXUA 3LBCA 4DX3A 2NSXA 7A3HA 3H22A 2YR1A 4PZVA 3RLGA 5FEXA 4XZBA 1QU4A 1EWEA 3H21A 2XM2A 4HN4A 4GWEA 1H5VA 1ONWA 4B5UA 1KM3A 2ZCGA 3QZEA 2OR2A 3AISA 1US3A 4XAZA 2VC5A 3DEQA 2E8ZA 3GDBA 1Q6GA 1VHCA 4A3UA 4KWVA 3HG5A 4B5XA 2E77A 2Z2UA 3QBUA 3R0DA 2XGBA 3VOCA 1QOXA 4LAKA 1DHKA 1R3WA 3NZGA 4Y8EA 5TBOA 4DYJA 1WDPA 1UUQA 2J7DA 1XSIA 7CGTA 3CH9A 2MUCA 4LBUA 3ZLHA 3ZO9A 1QHOA 3NAVA 2AMGA 5HNTA 1R9XA 3LCHA 1J01A 2NUXA 1TWDA 2UWFA 4DY1A 3K2GA 5FJRA 2RDUA 3CWHA 2BTMA 3AIBA 2Y63A 1UCWA 1O60A 1OX5A 1J0IA 1EZ2A 4CD8A 3M44A 3IS4A 4GQRA 1UD4A 5H8UA 2HMCA 2B7PA 1VBHA 4HOXA 2W92A 2FB2A 4PRWA 1RBOB 3H12A 2SFPA 3RPDA 1OCBA 5HANA 3MQTA 3GHSA 1W31A 5IDZA 1LL7A 2ZADA 3UWUA 4XZ9A 2PBGA 5M03A 5HMSA 3GDMA 1T40A 2GQ3A 2F6XA 1US0A 3WNKA 3C6CA 1GQJA 4QEHA 4V33A 3M41A 4QS5A 3VE9A 1JPMA 4CEXC 3KBSA 4HMCA 1QBAA 1ZALA 4OWGA 4RV8A 2V6AA 3VOHA 3VU2A 2DV0A 2OMAA 4NX5A 3USBA 3FEMA 3UW6A 2WHKA 1OT2A 2E5DA 2XDFA 2ZE3A 2YXOA 4J2MA 1EC9A 3J7HA 4HNCA 3WD4A 2ATSA 4JX6A 4BA0A 4HU8A 4F4RA 3VNJA 4K37A 2DZVA 2D0FA 3EWZA 1MQQA 4IP5A 4QR6A 3W86A 1TSIA 3POCA 2Y7FA 3Q65A 3G8EA 4GI4A 2GGGA 4LUTA 8XIMA 1M3UA 3ZIZA 5C2GA 3TLQA 4PL1A 2EPOA 3BLIA 2FGBA 4Z08A 3GXDA 1F3WA 2CITA 1V3JA 3SBFA 2RHGA 3EWUA 1DIKA 2J78A 4TV6A 3CB3A 4XKMA 4S39A 2R24A 1YPIA 3IACA 3ATZA 3REQA 1MWOA 3EWDA 4F48A 1ZTVA 4OHQA 5AB3A 2BP1A 1JPKA 3L7RA 5GNXA 4MF4A 3EXSA 3AWOA 4JICA 4N6FA 4W8BA 4NAEA 4UTIA 3FA4A 4IF2A 1S1RA 1JCXA 1TUFA 5E09A 2H8XA 5BOEA 2Y8VA 2OLSA 1BQGA 2VC9A 1EJSC 1HL8A 4OQVA 2D20A 4CU8A 3OLDA 4RUBA 1M7XA 1N8WA 3BGAA 3ECQA 3GYCA 2OQYA 4ZE4A 1TJ2A 3W7KA 1UKTA 1A0DA 3STEA 4E4FA 2JIEA 3UT0A 3TONA 1J5TA 6CGTA 1JF5A 2BHZA 3V3WA 3K4WA 3ITTA 1H1NA 2PWFA 4H3DA 1JVNA 4ML9A 3DDMA 1MXGA 1OF8A 1MFUA 4BQ3A 4X61A 3AMKA 2ZZ1A 5K2ZA 2R1LA 1A53A 2POZA 3WQWA 3SCRA 1LYXA 1OJXA 2GWGA 1XW8A 3ABSA 1KD0A 5ECUA 1VKFA 2YW4A 4WY0A 3RJXA 5KZ6A 3IRSA 2IPGA 2PAJA 3BSHA 1E70M 3WMLA 2V5DA 3E5PA 4NL1A 3GS6A 3ZR6A 1H0GA 4DZ5A 3FX4A 3KLLA 2QJGA 5BXTA 1E72M 3NQBA 2OGYA 4ZMGA 1RSCA 4HZ8A 5BRQA 2A7PA 4CU6A 1FP9A 5AOUA 1KTBA 3ALFA 4S3DA 4Q8UA 3TSBA 4UR8A 4JR5A 5IHSA 3KP1A 2E68A 2VZUA 3GW3A 3WNOA 3MI6A 1XJBA 3G3MA 3SIZA 1UYQA 3SQSA 2CKSA 1XC6A 4BWLA 1N8IA 1ZFJA 3CAQA 3D0CA 4D6CA 3LG3A 4L9XA 1GJUA 2OO0A 3NEHA 2G3NA 4O4WA 4BF7A 4PSRA 2JEQA 1BSLA 3VM5A 1X6LA 1Q6OA 2ZZ4A 4UB9A 4NI8A 4IICA 5LHFA 4N9DA 4JN6A 3M7SA 1CX9A 4W8AA 1JDAA 4HPHA 4PBGA 1TTQA 2GQ8A 3M0VA 4QE5A 4Q7BA 1MEHA 4QG8A 3NJ3A 5LGZA 3CHCA 1PUDA 4NF7A 3FK4A 3OHIA 2WYSA 2JBMA 3W25A 3VI2A 3B4YA 2FPYA 3U3HA 2AKZA 2EO7A 4HTYA 4AWSA 4I5RA 2CLEA 3CEPA 4KRTA 4XUYA 5FF7A 4C6JA 3QGKC 2WBGA 1M9HA 1AL8A 3IJ7A 3QTGA 1R9ZA 3R58A 3I7SA 1CYGA 1LOQA 3MYPA 4YYFA 3NQAA 4JNMA 4ZB5A 2D73A 2O9TA 3ABXA 1XG4A 3NSXA 3B04A 4NNAA 4PUDA 3UERA 3CUIA 3LHTA 4Q6XA 1IXQA 3VGEA 1HJXA 2BV9A 1ZBWA 1NWTA 1PDYA 3G0UA 2RGMA 3BO9A 3VD7A 3R6IA 4FNUA 4LAUA 1KFEA 3LQLA 1VRDA 5DCBA 4IPPA 3LMYA 1E9ZB 4Q4RA 1UUOA 4GC3A 3W7JA 1QK2A 1U5HA 1E1EA 4W7VA 1WB0A 1HKJA 3ABOA 3EX4A 3SN1A 3OIXA 2V0TA 3P60A 3GR4A 4FX7A 5CGMA 3K1GA 3TIMA 2C71A 4PYSA 3W7LA 4QROA 3URAA 1Q6EA 3E74A 4EXQA 2DIEA 5CPQA 4PA8A 2Z28A 2E9LA 5AZ0A 2EJ1A 5CCZA 2D2OA 3NO1A 1V0MA 4PUNA 4ROPA 1UWAA 1I4NA 2ZZ6A 1UD5A 4JYDA 2PTZA 3GU2A 3GVRA 3W26A 4C1KA 1KGWA 3VZXA 3O06A 1DWHM 2GQAA 4GBUA 1OFPA 2FTPA 1KBLA 4ERAA 1NWUA 1WBJA 3EB3A 3WO8A 4QSFA 3W7GA 2O55A 5GPRA 1XLIA 1SO5A 3NPUA 2HPIA 2QMJA 5K9DA 1PIIA 5G4EA 2OZ0A 5HQLA 3H2AA 3CK5A 1B9ZA 1JCJA 1A5OC 3WUBA 4OOUA 2E9BA 3C8FA 4GYJA 3SJ3A 5AFDA 2W0UA 4RJEA 5JH2A 4HNOA 3RLVA 3WD3A 4AZBA 3BLLA 4DO4A 3WLLA 2QIWA 3NOEA 3KM8A 3WK0A 1WOBA 4LUYA 5A2CA 4IWWA 2YW3A 4MLJA 3MYOA 3A3WA 1B3YA 3CZJA 3PPGA 5AY7A 4A21A 4K68A 4MSSA 4N9BA 3UA3A 3WELA 4PTXA 4CD7A 3WD0A 4N9EA 1P0NA 1MXDA 2FZMA 5G2IA 1IF2A 1W2PA 3ITGA 3NQVA 2E5CA 2XVGA 4DAFA 3RM8A 3ZLGA 2J24A 4Z1BA 5DQPA 5I23A 4G7EA 3LPGA 4KEZA 2BOEX 3GH7A 3M4HA 2PTWA 1G69A 5I3JA 4A2RA 2Z1KA 4CNSA 4GPNA 4LJ3A 3T4CA 2XINA 1HXJA 5CZJA 4FOKA 1M04A 4E8DA 1PEZA 2C3ZA 1WV2A 1DWJM 3WMCA 1PKYA 3FYOA 1RPKA 3N3TA 1MW3A 1ODZA 5FF4A 4BKNA 1V6TA 1Z8AA 4LC6A 4DBDA 1W5NA 2F8QA 3BLEA 4C1NA 3VDBA 1RBLA 3WEOA 4XO6A 1Q66A 3GG8A 4Y9OA 1XICA 2ISDA 3MMUA 4IP4A 4IMCA 1BG4A 4O52A 1MEIA 3LQGA 1IZCA 4PFMA 3UVAA 4QFUA 2QF8A 4GUJA 2QS8A 3H26A 3B40A 2Y8UA 3MSGA 1VGAA 4E38A 1JPHA 5JBFA 2FHFA 1ALDA 3IV3A 3OIHA 4H04A 5C6MA 2XYLA 3A6OA 3TC6A 1BYDA 1SSDA 1W56A 3WNLA 4DN1A 2Y5JA 4U3CA 5CC3A 1P0KA 5KITA 3PTDA 3RO6A 4MY9A 4NILA 5HBFA 1YADA 3U8GA 1KO0A 4IIBA 1UOKA 4GIEA 2P3EA 4V15A 4HCDA 3TLLA 4ML4A 3WBAA 4XTIA 2YCLB 1PCKA 2GL5A 4Y7EA 3N73A 4MJ2A 3NG3A 1Q8AA 2JGYA 1FWHC 4DUVA 1WZLA 2VEKA 2IXUA 3MSYA 2E6YA 1HO1A 4A8LA 1WKFA 4NYYA 1QBBA 3AIVA 3ZJ8A 1ITXA 2WJFA 1QNVA 4Z17A 3KWXA 3C0LA 1I2NA 3QVQA 4DJFD 4H7ZA 1I1XA 3LXBA 3T09A 2OYKA 2V2CA 1P5BA 3CIVA 4JQ1A 4C7GA 2XWEA 1JQVA 5DCEA 4W86A 4GJJA 2BHUA 5CPTA 4GO9A 1HP5A 4GFSA 1J2WA 3DBNA 1HIZA 3AIRA 4O1AA 2DH2A 1J79A 5KMYA 4RNFA 2CZDA 2PDKA 5ENLA 3E2QA 5CAKA 3KBNA 3W38A 5DXYA 2VDGA 4BI5A 4UOQA 2VEFA 3BJTA 3AHXA 1R2TA 5K9XA 1F4AA 3UYIA 1CXHA 4QLJA 2B0MA 3BQ6A 1M6JA 2YFNA 3JR2A 3VKJA 2BMBA 4CCZA 2QVNA 4H2CA 4LPCA 4QNWA 4HHMA 1NM9A 1VC4A 3C3UA 1C8VA 2OX4A 1VCVA 1V3HA 3WL1A 2HJPA 5BNKA 1QPOA 2AGKA 1JYVA 3RRAA 1QK0A 1WCGA 3PUDA 4ZBCA 1FHLA 4CNNA 1NFGA 1M1BA 4JL1A 2J7FA 1WKYA 4XD6A 4GX9A 4CVUA 1DJNA 2BBFA 4I3GA 2WWDA 3R94A 2YIHA 2C0AA 3SQMA 4J3TA 2PLMA 3GW0A 1HF6A 4TX6A 1JZ4A 1AL7A 1POJA 1RD5A 1V7AA 1BGGA 4F0KA 4L6HA 3C2VA 1MNSA 4Z2GA 3M0LA 8TIMA 4FNPA 2V3EA 3JZEA 2W9MA 3TCEA 4K1WA 2CW6A 4AC1X 2QCHA 3LXAA 4XKYB 5G4WA 2JF7A 3W7QA 4QS6A 1C8QA 3RX3A 1SFTA 5E5CA 4JIEA 3S9YA 1MUMA 1OEPA 1T7LA 5G1MA 3GC4A 4YXGA 4NJHA 1SVDA 2O9OA 1YPFA 2QJHA 2DSZA 3AS2A 5A6LA 1EDTA 3NA8A 3GQYA 4M29A 4DJEC 5ABHA 1UC4A 1L8PA 4ZB0A 1HNYA 2JKEA 3QGAC 3TJIA 4AXNA 5H91A 3RR1A 1QPRA 4R88A 2PGWA 3W2UA 3VDHA 4Q7IA 2HBVA 3ARZA 4RPQA 4DRSA 4DHGA 4CCCA 4C6QA 3E2VA 3WF1A 4LF2A 3EOLA 3COTA 1UQYA 1U5VA 1CCWB 3FS2A 1ONRA 1XIDA 3GR8A 1ICSA 2BFGA 2VHLA 3FGCB 3W53A 1FWBC 3NGJA 3CH0A 1LOSA 4EKJA 2A4AA 4PULA 1TFVA 4ZSUA 4GG9A 3HZ3A 1TVNA 3A64A 3MHGA 2J8FA 3PN8A 3H24A 3UZ5A 3NVTA 4NASA 3OG3A 3ZXWA 2Q8XA 3DYMA 1UQZA 3VIKA 4AIEA 3BXWA 4U5IA 2CYGA 3CQIA 1GKQA 2WMFA 2D24A 2Q09A 3F4NA 1TZ7A 4C5ZA 1UMYA 3P7YA 4H9ZA 4M3PA 4DLMA 3BLDA 1PIFA 1PSCA 3BSGA 2QVHA 1SFJA 2XFFA 2VRQA 2OZ3A 3R8GA 3EDFA 1EJXC 1YMYA 2VC6A 3DGBA 4H8HA 1WKDA 4NZ3A 4X2RA 3WLPA 1CXEA 2CESA 1TG7A 3BGGA 4Q4QA 1E1CB 3FV9A 3ITOA 1IZKA 3CYJA 2EXOA 1C8YA 1CENA 1GNXA 4JTFA 4UBPC 1UMLA 3KDNA 3XIMA 4OZOA 1VEPA 3AZSA 1ZUAX 2VXNA 5CQ1A 1FWDC 3UU0A 1IWPA 5D4YA 1BG9A 1IR2A 3P62A 3R43A 1CB7B 4C90A 5FI8A 1LROA 3DFSA 1GOMA 1JPDX 3WQ5A 4KS0A 5AVHA 1TE6A 3GBDA 3N14A 2PC8A 4AU0A 5FF0A 3W1QA 2AQWA 1UR1A 3VNIA 1RXOB 3L2IA 2DT1A 4PE8A 4ERGA 2E6AA 1OB0A 3BK0A 3BMWA 2PDFA 2E09A 1N55A 4WLCA 2VRKA 3CQHA 2CBJA 4O12A 3TV8A 4GBDA 3VE7A 3LB0A 2INZA 2V5BA 4ORIA 4GUFA 3CZKA 5TIMA 1LUCA 4YN5A 5LA0A 4UQCA 1QT1A 2WCSA 3IGUA 1E40A 2AMXA 4IMDA 1QI3A 3DG7A 1O7AA 3AHVA 4OUIA 4ENLA 3II1A 3BQ5A 1IR1A 4JHOA 4YTSA 1H09A 2R1NA 7PTDA 4Y2WA 3GNXA 4H01A 4YMZA 4XTDA 4C6FA 3VOFA 4LS1A 1WDSA 4N6EA 1R38A 2A3BA 2GJXA 2W67A 2G3MA 2XJ7A 5J5DA 2DSUA 3T7VA 2DVXA 5AHNA 1CGTA 1W9XA 4PUKA 5DMMA 5LXEA 4MAZA 1W1PA 3AI0A 1E73M 2Y7DA 2I17A 1GW9A 3QPYA 3NO3A 3W87A 2J7EA 2O9RA 1JQXA 2V63A 2WCAA 4WF7A 1QATA 4AWEA 4MLRA 3RG6A 3QKZA 2FLIA 4CN4A 2CPUA 1SGJA 1S2AA 3OTRA 3HFTA 4U10A 5GQBA 1KR0A 5B7ZA 4UTWC 1BAGA 2IQ0A 3ZT6A 3WENA 2FFIA 5HDRA 4GABA 3I6RA 1AZ1A 2XFRA 4JFWA 3NPWA 2AOSA 3IANA 4ZZ9A 4WSHA 3QR1A 4F0MA 3LBMA 4IPIA 4UTLA 3IAPA 1YXDA 2AAMA 3GDRA 1NDYA 3SFWA 3TR2A 1PBGA 1NY1A 1UC5A 4Q8TA 3IUHA 1LQAA 3LLXA 3TQVA 1IEQA 1TKKA 4A3RA 4CN1A 3UG8A 1A47A 4AZ5A 3KVJA 2Q3OA 4CQCA 2C1IA 3TFCA 2BY1A 1R2SA 1RCQA 4DIAA 2V82A 3CHDA 3KCJA 4IXXA 4XKYA 4OJYA 2D2GA 1L2UA 3PBUA 4M80A 1V3LA 1XBVA 5AYBA 3W70A 1TJ1A 4LBRA 1CLKA 3M5XA 4D8ZA 3O6CA 1O1ZA 3QSRA 4LALA 4MPKA 3O6DA 4W9TA 4HJWA 3LV5A 1XLCA 2H90A 2FMOA 2G96A 1EGMA 3G1RA 3G1AA 4DQWA 3H7VA 2Y7EA 4AZCB 1EOMA 3QV9A 4MNJA 2O7SA 3UD6A 2RDTA 2AQVA 2UZ9A 2PC4A 1FH7A 5FCZA 1C92A 1S2WA 3GUGA 3BLKA 1FWJC 3PJWA 4O14A 1UR0A 2D3NA 2CZEA 1NP0A 3VNYA 1GVFA 3FGCA 1TB3A 1R30A 2ZA3A 1C29A 1HVQA 3CTLA 3UNDA 3QFEA 1KV8A 2G5WA 4IPNB 1BXCA 2QGHA 3PSWA 4DO5A 4B5TA 1UWSA 1XGEA 3EEZA 4RNJA 5CAHA 3W0KA 3RNDA 3TE9A 1UZDA 6XIAA 1ZBKA 2VZTA 2CBVA 3KOXA 3WLMA 1X6UA 4GVIA 2WLYA 1NOWA 1OCQA 4DBEA 2ZC1A 1FWIC 2QQ6A 3NPXA 3WD2A 3N2BA 2WXDM 2W62A 3MTWA 3VX1A 2PDWA 3AZRA 3R1ZA 4IISA 3URBA 4GIYA 2YZ5A 2J6XA 4EWJA 3QEZA 3RLUA 2VR2A 4GYPA 3M5ZA 3UCCA 4LX4A 2PP0A 4E3TA 5CPMA 3TOPA 5A6SA 2FTYA 3I7RA 3B8DA 4PSPA 2A6NA 2Y6ZA 4UR9A 2WVTA 1KCZA 4REQB 3EGJA 1GYNA 3TAKA 2FZ9A 4F79A 4QRNA 2DZTA 4AD5A 2XISA 2CHOA 3NPVA 3TX9A 4ACZA 1GTHA 3AU2A 4C5YA 3N6QA 1OD0A 3T2QA 2ON3A 1EB3A 3VOJA 5FJOA 3VVGA 5BRPA 5C7VA 4MJ4A 5C2XA 1SFSA 4K3ZA 3U2OA 4FLRA 1MDLA 1XL9A 2Z1XA 1DJHA 3ITCA 3PP7A 4C60A 4P5UA 3TQKA 3W4RA 5LIWX 3LLDA 3UP8A 4O1CA 2NVDA 3O2LA 5EKYA 4QLLA 1AODA 1TVLA 1ZJHA 3QPEA 1FFRA 2DQWA 1XLEA 3GDTA 4S1FA 1K7EA 4AEEA 4M24A 3WSUA 4YLWA 1YNYA 4X60A 1PYMA 1K8XA 4ZOCA 3UWVA 4D1IA 1X39A 1TX2A 3CC1A 2QCEA 5U7SA 2OB3A 2X7WA 3LA4A 3N17A 4YTUA 2D0HA 3RHGA 5KZMA 3W84A 2O0TA 5CG0A 1Q7ZA 3WDPP 3WDQA 4ADUA 5GNYA 1ZLPA 3AUOA 4UMAA 3KTSA 3PJTA 5BOFA 3VDGA 1EIXA 3W82A 4R5EA 1H1ZA 2NUWA 1NELA 1O12A 3BAIA 3GR7A 1HJWA 2Z4GA 3DYOA 4FAMA 1QCWA 1Q6LA 3W72A 1LRTA 2WNQA 1LM1A 4YVVA 3IJQA 3AXIA 5JMUA 3SIMA 1KRBC 1KV5A 3R11A 3BE7A 3FJLA 3OU8A 3KOFA 1ENUA 4A3HA 5FF2A 3EX6A 4GHRA 2F38A 2HV5A 1N82A 5HJXA 1UIOA 1AZ2A 2PWVA 5IM51 1UR9A 1AW5A 5T9BG 4GI8A 1E1CA 4RE4A 4H9YA 2FPVA 3GO2A 4KCTA 3B8WA 1H7PA 1S46A 4PBFA 4FOJA 1ADDA 3B0VC 4NZCA 4DPQA 2VX6A 1H2JA 3O9NA 4KFOA 2ZUNA 1ZSXA 4G5DA 3GTXA 5MKGA 1DIOA 2VCCA 3RIKA 4GISA 3NFUA 1ICQA 2NXHA 2QDHA