4AXNA

Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the serratia marcescens chitinases
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
DDAAIMPSIANKKILMGFWHNWAAGASDGYQQGQFANMNLTDIPTEYNVVAVAFMKGQGIPTFKPYNLSDTEFRRQVGVLNSQGRAVLISLGGADAHIELKTGDEDKLKDEIIRLVEVYGFDGLDIDLEQAAIGAANNKTVLPAALKKVKDHYAAQGKNFIISMAPEFPYLRTNGTYLDYINALEGYYDFIAPQYYNQGGDGIWVDELNAWITQNNDAMKEDFLYYLTESLVTGTRGYAKIPAAKFVIGLPSNNDAAATGYVVNKQAVYNAFSRLDAKNLSIKGLMTWSINWDNGKSKAGVAYNWEFKTRYAPLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE C1
publication title Hallmarks of Processivity in Glycoside Hydrolases from Crystallographic and Computational Studies of the Serratia Marcescens Chitinases.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4axnA00
5DEZA 1FHDA 2VURA 2BHYA 1UD3A 1WZMA 2UY2A 2VQTA 2Y24A 3QHMA 3VMPA 2W92A 4D1IA 4AZBA 3VTRA 5A2CA 3AI0A 1JZ3A 3OGRA 4MTVA 1G9HA 5AY7A 2CNCA 3LPPA 3T0AA 3WD4A 2ZUVA 4P8XA 3DYPA 2J77A 2WVVA 2WZHA 3THCA 1GOQA 2PWFA 4WKFA 5HNNA 1BQCA 3AHYA 3RJYA 1VRXA 3TTQA 1WDPA 1BPLB 1UR8A 3OZPA 5ABFA 1VJSA 3F5KA 1C7SA 2O9OA 1LF1A 5CJ5A 3EDDA 2W5FA 2XVPA 2ZX7A 4P7LA 4QDMA 5E0FA 1J10A 1E1FA 3KE0A 2EPLX 2PWHA 3EDFA 4IPNB 3VIOA 3FW6A 4EK7A 4W8AA 1CXKA 1TFVA 1XSIA 3GM8A 4LQ1A 4MAVA 1HP4A 5M17A 3CZEA 5BXRA 2VRKA 5CPTA 1BGAA 1UZ1A 2VZTA 4AIOA 5GQBA 1XH1A 4W7UA 5JBDA 2VR5A 4PMQA 8A3HA 2WSKA 5D8ZA 2XSBA 3WMCA 3W6MA 1JYWA 4N42A 3VDCA 5A6KA 3PTQA 1VAHA 2VC9A 1E56A 1WDSA 3RPMA 1QI5A 4HA3A 3I3BA 1V3MA 1HF6A 4CD8A 3K8LA 2WVVB 2ZUWA 2EPKX 7CGTA 2WMJA 1B3WA 1E6RA 1HIZA 5I6SA 2VO5A 4NI3A 1E4LA 1I1XA 1A47A 4WKAA 1MQQA 1BYAA 2VCBA 2BY0A 1K9EA 1QW8A 5ABFB 1KQZA 3WUFA 1UWTA 1DHKA 7TAAA 3CZLA 3W81A 1UZ4A 1VBRA 5JUVA 1JGIA 2YOCA 1KR1A 1WO2A 2XM1A 2WHJA 4CUCA 1K6AA 4S3JA 3VGBA 4QCFA 1J11A 1CEOA 3TTYA 4WIWA 1V0LA 4A3HA 1C91A 3ZMRA 4FF5A 4CN1A 3NDZA 3AZSA 3VIGA 8CGTA 1N82A 1B3XA 4J3SA 3SCNA 1DP0A 4LYPA 4FLRA 4EAMA 4NSBA 2WZIA 2DT0A 5A3HA 4KRTA 4UQBA 1UR4A 1KWGA 1UD2A 2WPGA 3ZSTA 3VM5A 2D3LA 1TVPA 4D6EA 4F9DA 1Y7VA 4TX6A 4CU8A 4PMOA 3SCOA 1NH6A 2XM2A 3WBAA 1QVBA 2G3NA 2GJXA 1UWIA 1W3KA 3EMCA 4UFJA 2DIEA 4PCTA 1R86A 3BC9A 4JFTA 1M04A 1NARA 3UG4A 3KEHA 2WMHA 4J3XA 1V3JA 4KGJA 5A2AA 1RP8A 1VFFA 1ITXA 3HJEA 3EDKA 1XD1A 5CSYA 3AS0A 4X0VA 3WH5A 3NJ3A 1HKJA 1X6LA 1OIMA 1B3YA 3CHFA 2WLZA 2E9LA 1KXQA 2J8GA 2PC8A 3PTMA 2VCCA 1E6NA 3T0DA 5IFTA 3HMCA 4DWSB 1WPCA 3D3AA 2ZXAA 1H49A 3ARVA 4PBGA 2J7CA 4CD4A 3FXYA 1JYNA 1HJSA 1WDRA 5CZKA 4AIEA 4JKLA 3AQUA 4TVUA 1WCGA 3PZOA 3ZSSA 3RDKA 4EANA 1EO5A 2NW0A 4DUVA 3O9NA 4M82A 4GQRA 1M53A 1LJYA 4A3YA 5BXPA 1XC6A 4PMZA 5EFFA 3A6OA 4PMYA 2WC3A 1CYGA 5I23A 3TOPA 3NSXA 5I5RA 2AOSA 3CUJA 5LA1A 4GINA 4MB1A 4AD2A 4UTFA 3OG2A 2GJXB 1JFXA 4P8WA 1J18A 1EXPA 2QPSA 4ZEPA 1BG9A 3PZVA 3FN9A 3WF0A 4PN2A 1LQ0A 4GI9A 4J7RA 3VVGA 5E9AA 4W89A 3N1AA 2XSAA 1LL4A 2XGBA 3VDAA 1XYFA 2J4GA 1OD8A 4H41A 3VX0A 4UFHA 1E0XA 3VILA 5CLTA 5BRPA 1JIBA 2CXGA 1CTNA 1KCLA 4MNJA 1C8XA 1HJVA 5E70A 2PB1A 3II1A 2GSJA 7A3HA 4D72A 4AZIA 4E8DA 3WDIA 4AZGA 1HKMA 2VT0A 3N15A 1UWQA 4C7GA 5HPOA 1HL9A 1VFMA 4M80A 1G5AA 2AMGA 2WYSA 1V0KA 2XGIA 5FD0A 4AWEA 4F9JA 2GDVA 5D9OA 1EHNA 1L0PA 4HU8A 3SCQA 4JIEA 4KMQA 3QHOA 5IDIA 2JF6A 5E6ZA 1L8NA 1OT2A 2V3EA 3EBVA 4V27A 5IHSA 3CBWA 1KGWA 1J0IA 3W38A 1XSKA 4Q7NA 4V2XA 1BF2A 4N0RA 3UETA 3IANA 3AMCA 1V08A 4EE9A 1MFUA 3VKKA 1QNPA 3CZJA 2JFEX 3MUY1 1UKOA 3WD3A 4XZBA 1GJUA 4JKKA 1PIGA 1BYBA 2J7DA 5HDRA 1CLVA 3VGEA 1GVIA 2FH6A 3T09A 1W1YA 1OGSA 3KL0A 4NF7A 1E9LA 3UG5A 2ZX9A 2C8NA 2G8ZA 4UFMA 2WMFA 2XUCA 2FH8A 4JAWA 3K8KA 3PTKA 3BXWA 1M03A 3SCSA 4JCMA 3NYDA 3K46A 1UKTA 4CVUA 3ARQA 2XHYA 3ARXA 4JZ5A 3WUEA 1TE1A 2JIEA 3M7SA 2CESA 4UOZA 1GQIA 4W87A 3W24A 1KB3A 1HVQA 1VIWA 5D4YA 3VNYA 2BY2A 1HJXA 1QBBA 1H4PA 1OIFA 2WMKA 3QR3A 3OLEA 1VB9A 3WFZA 2J78A 2YLLA 3GXMA 3VD3A 5C8BB 1JI2A 2A3CA 2VVSA 1E0WA 5D9MA 1UR2A 3SCVA 3WDJA 2BVYA 4V28A 1OD0A 3TTOA 3WNPA 3PZ9A 5CXPA 2BHZA 2PWDA 3VD9A 5JIPA 2E4TA 2BY3A 4XUYA 4M81A 3AICA 1GVYA 5EBAA 2VZSA 1GZJA 2G3MA 3WDPP 1E70M 1EDTA 4D71A 3OZOA 1BVNP 3T08A 4U3AA 1K9TA 3EMQA 1GHSA 4Y7EA 1RPKA 3AXXA 5E6YA 1QI0A 1DWHM 5HPCA 1LG1A 1XH2A 2B31A 1IZKA 1ZB5A 2DSWA 5JIWA 3QHNA 2WVUA 5A6BA 4GXPA 4AISA 1W1VA 1JDCA 5TD4A 1GJWA 3W29A 4URIA 4DWSD 1K9FA 2PWEA 4GO8A 2GDUA 1JNDA 4PEEA 3I3DA 4J27A 1PEZA 2BNJA 3CUIA 2J74A 1V3HA 1PZ3A 4B16A 1GORA 3ZIZA 4X0NA 3N11A 3VUPA 4RE2A 1IZJA 1GOIA 1TG7A 1GPFA 1QBAA 2WKGA 3MANA 1OGGA 5A6AA 1LL6A 3SCPA 1QHZA 2Y8VA 3B8SA 1B3ZA 2UY3A 2CCRA 2EXOA 3WEZA 3N18A 4AXNA 5I77A 1B90A 1XD0A 1UR9A 3ARSA 3WNMA 3K8MA 4M29A 5D8WA 4ACZB 1DWAM 1H0GA 3SUTA 3ARUA 2OWWA 3F4VA 4ZXLA 1UUQA 3U7BA 4HMEA 1E55A 1JD9A 3VOCA 1BYDA 3I3EA 4CCCA 3WH6A 1V3LA 1E1EA 3ZT7A 4P8UA 2OYMA 3BAJA 1OT1A 4B15A 3BLKA 4AY1A 3CZ8A 4YPJA 2D23A 3MSDA 1ISXA 1E40A 5GNZA 1BYCA 2BVDA 4UCFA 5AYIA 5CQ1A 3M46A 4E8CA 1E4NA 4P7RA 4AYSA 1XGZA 3WSUA 4TTGA 2W91A 1D7FA 3OBAA 1MVYA 1FP9A 3AIWA 4D6DA 3MSGA 1YHTA 3WUGA 3WNOA 3QOMA 2QLYA 2X05A 2WM0A 3RILA 2YL5A 2QMJA 3ZR6A 1CXEA 1O6IA 2ZUUA 5CG0A 2WHKA 2Z1SA 1IV8A 3FHQA 1WB0A 4FLQA 1FH8A 5A6SA 2ZUMA 3BSGA 1OWQA 2QPUA 4PRWA 1U30A 1RP9A 3ARYA 4OZOA 2ZWYA 2QMKA 4GIAA 1TZ7A 4Z2HA 2GUYA 1VEMA 1H1NA 2FHFA 2GJPA 1V0MA 1GOWA 2BXZA 3GH4A 4X9YA 3M07A 1TA3A 1HJQA 1SMAA 1JZ6A 4CN4A 3IK2A 3IJ7A 5FL0A 1HJUA 2VRQA 3GNRA 5I78A 3L2MA 1VJZA 1W9XA 1H09A 3N9KA 2ZXDA 2D2OA 1UD5A 4JHOA 4W85A 5CGMA 4LX4A 1TMQA 3AJ7A 3F5JA 1XHGA 2QHAA 3MUZ1 4HU0A 3U5UA 5A69A 3AIVA 2D3NA 1UD8A 1FH7A 1Q6EA 1ESWA 3AHXA 3TONA 4ZXOA 2CHNA 3MKKA 1VF8A 1ODUA 2X2YA 1BSIA 2ZX8A 4D6JA 2Y2WA 4XV0A 1H0IA 2V5DA 2WVTA 1UYQA 4ACYA 4UZSA 4UQAA 1NOUA 2A3EA 4JFUA 2YLAA 3ARRA 2OSXA 1EDGA 1AQMA 1VFUA 3AXIA 4WK9A 3WQ8A 3WQ4A 3POCA 3L4YA 1AQ0A 2WVSA 1JZ7A 3L2LA 2DQXA 4M24A 4PMVA 3WMBA 2E9BA 2A3BA 3AZTA 4TX8A 5JBFA 3W37A 1GUVA 4EKJA 2YL6A 4UR9A 4F79A 3VMNA 1A3HA 5CPQA 3VX1A 3WUBA 4JFSA 1JYXA 1R7OA 1JZ8A 1UH3A 1NP0A 1R85A 3VIJA 2DSZA 3AZRA 3CHCA 1ISYA 3VDBA 5AC4A 3NCOA 2BV9A 4XZWA 1MFVA 4IISA 4F66A 1LWHA 2VUYA 3ARPA 2NSXA 1KWKA 4PSPA 2F2HA 2CIPA 1UD4A 3OA5A 3ZJ7A 2XJ7A 4H7VA 1LWJA 1ECEA 4W5ZA 3VIFA 2V3DA 2YL9A 4H8HA 4UQCA 1JZ5A 2J7BA 4RE3A 4HZ6A 2OSYA 3VMOA 3B9DA 1V6VA 4CKQA 3NSMA 3BAYA 1DTUA 3LMYA 3NIYA 4MDPA 2WB5A 3EMZA 3A4WA 5I3DA 1WP6A 3DYOA 2X8RA 4HMCA 1C90A 2WC4A 5BCAA 1YQ2A 1EH9A 1TVNA 3KL5A 4OOUA 1EOMA 4BS0A 1CZ1A 1PAMA 5A1AA 2CEQA 3NUKA 2UY4A 4TVDA 2YKKA 3B9AA 3T2OA 2DDXA 3WQWA 4PSRA 5KEZA 1BG4A 2VX4A 1F4AA 1E71M 4FLSA 2HVMA 3WH8A 2OWXA 2QV4A 4Z2LA 3AIEA 5D9NA 4U3CA 4AD0A 2WCGA 3FAXA 1R7AA 1CGWA 4GPNA 4WF7A 2WHMA 3U7VA 3HN3A 3LPOA 1B2YA 1J0JA 1CNVA 5BRQA 2JALA 4MNMA 1BFNA 4NRSA 3A3HA 5GPRA 4GQQA 4W7WA 4L4OA 2J79A 3AFBA 1XV8A 3BAWA 3ZJ8A 3VGDA 4D1JA 5LA0A 3WY1A 1BAGA 2DH2A 2HISA 2WMIA 1CBGA 4QFUA 4JHZA 4HOXA 1E0VA 3AIQA 1ZL1A 4U33A 1J0ZA 3BCDA 5BXTA 1LG2A 1C92A 1JDDA 4JL2A 3VIMA 5AC5A 4FLOA 3GYCA 1US3A 4PCSA 4BZYA 4CD6A 2D24A 1EDQA 1H41A 1PJ9A 3AMKA 4HZ7A 4Q22A 2VZUA 1E5NA 3CHEA 4HPHA 3U5YA 4AIUA 1NQ6A 1B3VA 4KWUA 5M5DA 1W2PA 4W86A 3WDQA 3WDRA 3GDBA 2E8YA 1P6WA 4D6FA 1VBUA 2IUZA 2X0HA 4WSJA 4B3LA 2D0FA 3DECA 5BYWA 1M7XA 2X09A 3VNZA 4W88A 4AEEA 1US2A 2PBOA 4GKLA 5A8NA 5DFAA 4ATLA 1WZLA 1JAEA 4UNIA 2XVKA 2IXUA 2CETA 3PBGA 1PX3A 2E40A 2WWCA 2PI6A 4F8XA 4U2YA 1V02E 2WMIB 4B3KA 3CUGA 2DSVA 4IPLA 2CITA 2VI0A 4BCEA 3TA9A 1UQYA 1AVAA 3W4RA 3BLPX 4M8UA 2G41A 1OBAA 1CENA 3GBEA 2Q8XA 2MANA 2WBGA 5FIPA 5CLWA 3K4AA 2JE8A 2O9TA 1UKPA 2VR4A 5A8PA 1CLXA 3CMJA 1DEDA 4WLCA 4YN5A 1J0YA 2NT1A 1ZBVA 1UG6A 5A2BA 1ISZA 3BH4A 3L4UA 1CXIA 4UFIA 1JZ2A 2ZX5A 2G4FA 1BLIA 3GXDA 1JFHA 3FHAA 4ML4A 3VGFA 2FGLA 3AIRA 2D0GA 1PX4A 1OM0A 3UR7A 1Q6DA 3CZKA 3AS3A 1NWSA 1XSJA 1EA9C 1VEOA 1QI4A 5IXEA 3SCUA 1XCXA 3AMDA 5C70A 1GQLA 2WLYA 4UFKA 1H11A 2QF8A 5AYBA 2BY1A 2DEPA 4YHEA 2W61A 1WDQA 1CGYA 3WNNA 1TCMA 5LA2A 4JL1A 4MADA 1J0HA 5HXMA 2V3FA 2D22A 1B9ZA 1J0KA 1V3IA 1UQZA 3W0KA 3VD5A 4BF7A 5CGTA 2RGMA 1HVXA 5A6LA 4LXFA 4OKDA 2DSUA 1SR0A 2WKLA 1E6XM 3RM8A 3SIMA 2DT2A 2ZXQA 4H8UA 1JXJA 3DHUA 1EQPA 2ZE0A 1XH0A 4UQDA 1C7TA 4W8LA 1C8YA 1GCYA 3LPGA 4C7FA 4Z2JA 3UCQA 4DUXA 5E0CA 1HJWA 1VFOA 2VNCA 4RL3A 1HKKA 1W9VA 3ZJKA 4MPKA 3AHVA 4J3TA 3GZAA 2CKRA 2J25A 2BXYA 1BHGA 4HMDA 1H3GA 5CPSA 3WN6A 1TUXA 3BGAA 1JYVA 1UH4A 4P7QA 1MW2A 2DT3A 2VMFA 1KR0A 2UY5A 1FFQA 2C7FA 3CIVA 3CTTA 2D1ZA 4TOQA 3UESA 4GI6A 2YDRA 3AHZA 4XB3A 1E4MM 3IAPA 3SUSA 1UWRA 2ZIDA 4M56A 2WHLA 3WL0A 1B30A 1LLOA 2WC7A 4CCDA 2A3HA 2CBIA 2VVNA 1AQHA 4UOJA 3SCRA 2EBNA 3OB8A 3MO4A 3GH7A 1J9YA 3AIBA 1W3JA 2WK2A 3G6MA 3MUIA 5FOOA 1CXHA 1H5VA 1KFWA 1Q6CA 2WCAA 1ZBKA 2JEQA 1UA3A 2GK1A 4OIFA 1PX8A 5E09A 2DSKA 1G01A 2EPOA 4CD7A 2ZICA 5A8QA 3SUWA 1G0CA 3KL3A 3CH9A 3ZO9A 4QCEA 4Z2KA 2E9MA 1OSEA 1WNOA 3RMEA 3MU7A 1QHOA 3VM7A 1EHAA 1E72M 1V6XA 1CGVA 2DT1A 3KWXA 2OYKA 1PZ2A 2OYLA 2J8FA 1V6UA 2CBUA 1U33A 4AW7A 3FAWA 3POHA 4UQ9A 3MS8A 1HT6A 4PTXA 1GONA 2ESCA 5A6MA 1HL8A 3N12A 4U5IA 3ECQA 3AMLA 3ZR5A 3K1DA 1SFSA 3PZTA 3TTSA 4ZE4A 1E5JA 1WE5A 2WW5A 1SYTA 4S3KA 1C3FA 1JDAA 2XWDA 2EEXA 4CD5A 4UZUA 1AMYA 5I0DA 3THDA 1JL8A 4PYSA 1KXVA 1MXGA 3ZM8A 3AS2A 4OJYA 1GOOA 4YHGA 1Z32X 3WH9A 2WWDA 3N13A 1QOXA 3T0BA 3N17A 1WZKA 4AD3A 3RCNA 3MMWA 3IJ9A 4TXEA 2G3JA 1I75A 1W3HA 2GK1B 3UG3A 1WZAA 4CGTA 3VIHA 3A4XA 1V02A 3WL1A 3L4WA 4HPGA 4BQ4A 4U5KA 4TVCA 1KBBA 1W9DM 4PTWA 3W27A 4AD5A 4ATWA 5ABEA 4B9ZA 1CPUA 4E2OA 2BFGA 2VTFA 5DF0A 2FGZA 5A8OA 2TAAA 2VJXA 2J7EA 1J12A 2BHUA 5HOSA 2EO7A 2J7HA 1HP5A 4CCEA 3ALGA 5LYRA 1EGZA 2YDQA 5M03A 2GVYA 2YDSA 2XVLA 2XIIA 4UQEA 2XVGA 4HTYA 1V0NA 3ARWA 5KZ6A 4LYQA 3EDJA 1HXJA 3GXFA 1MW1A 4OUEA 3O2LA 3ZT6A 4L4PA 2JEPA 1WAWA 1E6SM 2J7FA 3D5HA 1KGUA 1H2JA 3WD0A 4QLKA 3DC0A 4XX6A 4CN6A 3M6DA 2GFTA 3G6LA 3OIHA 1NOFA 5GNXA 4Z2GA 4MB3A 2YA1A 1S46A 1W91A 3AISA 4W5UA 5A94A 1QPKA 1ITCA 1UHVA 1QNOA 4J3WA 4D6HA 2XVNA 5I79A 3E1F1 3RM4A 1JI1A 3WBEA 3AS1A 1HX0A 4AZCA 1UWSA 1GQJA 3WF3A 2D20A 1XCWA 2RGLA 2W62A 3OGSA 1U2YA 1JNEA 5M3WA 2VX6A 3CO4A 1NWRA 1R8LA 3VGGA 4OBSA 3VGHA 5FL1A 3ALFA 4JKMA 1MW3A 5EB8A 3MV11 1OCQA 4GZJA 1CIUA 2XTKA 3WMSA 4ATDA 4IM4A 1JD7A 2CBVA 5DT5A 1NP2A 4CVWA 4HOZA 4MAZA 1KGXA 1TA3B 4KGLA 4J3VA 1CWYA 4R5EA 4H2CA 2YA0A 4QLJA 4PMNA 3VINA 2W4XA 3GNOA 3J7HA 3IJ8A 4AC1X 1R87A 1ZBWA 3CUHA 1PPIA 4QLLA 2ZOXA 4U2ZA 4MB4A 2AAAA 5EFDA 3K4DA 1CXFA 1E6QM 3MUAA 2FDMA 2YIHA 2V38A 4MNKA 3QGVA 1UR0A 4WJXA 2XIBA 1HN1A 2X1IA 3SEPA 2W66A 1ODZA 5GNYA 2FHCA 1PIFA 1GW1A 3VDHA 3W82A 3W53A 4BQ2A 4JFVA 1DWGM 3W6LA 4DWSA 3RJXA 2VRJA 4AZCB 1VEPA 1W9UA 3GBDA 1UKSA 5ABGA 1CGUA 1F4HA 2XWEA 1FOBA 2VL4A 1D2KA 4DWSC 5A95A 2CYGA 3AHTA 2VCAA 1G1YA 1X6NA 4OBRA 4P8VA 4M1RA 1B31A 2YBUA 1W9PA 1MQPA 5DT7A 1W3LA 4MNLA 3WF1A 1PBGA 4JCLA 4PMUA 3VIKA 4AMCA 1JF6A 1UWUA 3MMDA 2UWFA 1QHPA 3RIKA 5DMYA 3AROA 4NRRA 6A3HA 2V3GA 1ZJBA 3AXHA 2A3AA 1TR1A 4QAWA 1C8QA 2OWCA 5EMYA 1UA7A 3PN8A 5BXSA 1W1PA 4HZ8A 3L4TA 1GHRA 1CECA 1SMDA 4W8BA 2J75A 3S6TA 4ZENA 3AIUA 1BTCA 3JUGA 2XFFA 2IXVA 4KRUA 1J01A 1UR1A 4BQ5A 1RD6A 4CU6A 2VX7A 1HNYA 2O92A 2Y5EA 1I1WA 2YJQA 4K68A 3WQ6A 3CHDA 2BVTA 3OLGA 4HA1A 4WSKA 4QP0A 5A6BD 4AZ6A 2F8QA 1MW0A 1ZS2A 3W26A 1GOKA 3CGTA 2PF0A 1V03A 3VIPA 1GNXA 4W93A 2E0PA 2VOTA 4TUFA 4Z2IA 1NWTA 4PMXA 1QI3A 4LPCA 3WKZA 5JBEA 2WANA 3SUUA 3FNDA 1DWIM 3WELA 4GZIA 1B0IA 3HU7A 1EOKA 3ARTA 3VIIA 1V3KA 3PZUA 4AZ5A 2EPNA 4H8VA 4PTMA 4PUEA 1UOKA 2ZUTA 1MWOA 3WDHA 2VZOA 4UOQA 3PZIA 4U31A 3VD7A 2ZX6A 1M01A 1OB0A 3CZGA 3SCTA 1G94A 4DM2A 3NSNA 3WEOA 4H04A 2NT0A 4GI8A 1C93A 3WQVA 4BQ3A 3W25A 1FHLA 1K9DA 2WNWA 1JXKA 1KQYA 1E3ZA 1OGBA 3AYSA 2ZUSA 1QNSA 2WZEA 1GOMA 4GZEA 5FKYA 1GQKA 1JG9A 1MXDA 1ZJAA 2O9PA 2WXDM 3WH7A 2Y4SA 1MYRA 3UEQA 2ZUNA 1JZ4A 1W1TA 4MDOA 1X1NA 4LYRA 2E3ZA 3WNLA 4MJ2A 3KZSA 3A47A 2E8ZA 1E43A 3UR8A 2V5CA 3L4ZA 1MQRA 5A6JA 4AZHA 1NOWA 4WKHA 1B1YA 3W28A 3MMUA 1RH9A 1NM9A 3WNKA 1QNQA 2EJ1A 2J7GA 3DHPA 2XPKA 4CU7A 2WSPA 1JAKA 2C0HA 2DPEA 3PZNA 2OLHA 3VPLA 4MB5A 4ZFMA 4ZE5A 3AYRA 4PUDA 2Z1KA 2CBJA 4LGXA 5C71A 4OOZA 4DM1A 2JF7A 4D6GA 2PWGA 1CGTA 3WEMA 1ISVA 3PHAA 3VO0A 1OINA 3BMWA 3BAIA 3OGVA 3L4VA 1E6PA 2CERA 1V6WA 3PZGA 4HP5A 4UFLA 1E3XA 3ZQ9A 1HKIA 3PZMA 1CDGA 1IT0A 3BAKA 3SURA 5A8MA 4J3UA 3U57A 3LPFA 2J47A 2XFRA 3MV01 1CXLA 2YBTA 4AD1A 4GO9A 3WF2A 1JF5A 1D3CA 1KCKA 4AD4A 4D6IA 3AMGA 1KXTA 1EIBA 2OSWA 3TP4A 2DH3A 1V6YA 4J28A 2XYLA 4P7NA 4A4AA 1ZU8A 1ZBCA 4PMDA 2XG9A 1UH2A 3N04A 2WAGA 2WCSA 1UD6A 2WMGA 5I24A 4PTVA 3BSHA 3SUVA 3CUFA 4AZ7A 4DUWA 3WFLA 3BMVA 1E15A 2FHBA 3DYMA 3ZOAA 5ABHA 1NWUA 3B9EA 4FMVA 4TTUA 3SCWA 3T2PA 1DWJM 3QOKA 1XRVA 2X0YA 3CMGA 4MJ4A 4ACZA 2XFYA 4AEFA 4BA0A 3VU2A 2CKSA 2W63A 2CPUA 3RM9A 2WBKA 2GJRA 3ZJ6A 4R27A 2J62A 3WF4A 2VQUA 3WD2A 5FCZA 3O6AA 2D0HA 1QI2A 3BCFA 2ZWZA 3WIJA 5IFPA 4W7VA 2EQDA 3CLWA 1E73M 3GH5A 3WENA 3CPUA 2YA2A 2ZXBA 9CGTA 1LL7A 3APGA 5DO8A 1QW9A 3ZT5A 2CHOA 1W2VA 2O9RA 3BAXA 2Y8KA 2G3IA 5F7UA 3T2QA 1Q4NX 5I2UA 1ISWA 3ARZA 4E4PA 1DWFM 2PBGA 1E4IA 1FP8A 1WKYA 1BVZA 2VX5A 4B9YA 4C7DA 1FH9A 6TAAA 5BWFA 4KH2A 4PMRA 4FK9A 3OLIA 4NZCA 1EQCA 2JIWA 3WQ5A 1KBKA 5BROA 4W84A 2F61A 3EDEA 3WD1A 4D6CA 1QNRA 2YL8A 1VENA 1W32A 4JFWA 1FA2A 5ECUA 1XYZA 1Q6GA 1CGXA 3NDYA 3PZQA 3UERA 3EYPA 5IHRA 5D9PA 1Q6FA 3OLDA 3VD4A 3S2CA 2DIJA 1EO7A 4HA4A 2DGAA 1BGGA 2W67A 3L4XA 1FFRA 2BS9A 3GXIA 6CGTA 4HOWA 1E6ZA 1UKQA 3IAQA 2VZVA 3AOFA 3GNPA 5CSUA 1W9BM 3A4AA 4RE4A 3F5LA 4IUGA 3GTNA 1KXHA 2EPMX 3RO8A 5HBFA 1O7AA 4P7OA 3FY1A
chains in the Genus database with same CATH superfamily
1PHQA 3GG8A 2HK1A 4YMZA 2VQTA 3QVQA 2W92A 4AZBA 1YNQA 2W3ZA 1ZTVA 1QUMA 1DJGA 1IE7C 2V2CA 3WD4A 3V36A 5GJPA 4WDUA 3GHRA 4NILA 1F05A 4AWTA 2PWFA 3TOYA 1KRCC 1ZY9A 1VRXA 2NLYA 1BPLB 4F0RA 3R4IA 2O9OA 4LRTA 3EDDA 2B7NA 4F0HA 2XVPA 4KFPA 2PPGA 5AC6A 4K3ZA 2C71A 1J10A 3V5CA 4REQB 3O63A 2PWHA 2VDIA 1P1XA 2Z24A 3QR0A 3CQJA 1UCWA 1GVOA 1CXKA 4LAMA 3NL2A 3W2MA 5M17A 2OLSA 4NKCA 5BXRA 3T42A 2P10A 4ZSUA 3IVTA 2PDIA 3SRHA 4B5TA 1JGMA 3RCYA 1KKRA 2Y89A 3KVKA 8A3HA 4FI4A 4RCXA 4LAOA 3AUJA 3C0JA 4N42A 3STFA 3D6NA 3RPMA 1HF6A 4ZOBA 3K8LA 5J5RA 7CGTA 3ITCA 2WMJA 1E6RA 1HIZA 2R8WA 2PA6A 2VO5A 3EKGA 4NI3A 5LNWA 1I1XA 1VD6A 2NXIA 3S9ZA 4YIWA 1A47A 2I16A 1BYAA 4RUBA 2O4MA 1VPYA 4M6VA 3CZLA 1M6JA 1PS9A 1UZ4A 3L9CA 1AW1A 4OTKA 1VBRA 2I56A 2YOCA 3LQGA 2WHJA 4CUCA 3WO8A 4S3JA 4QCFA 1GVRA 2ZRWA 1CEOA 1HTIA 2PUZA 2PDBA 1C91A 2ADAA 3ZMRA 2RDWA 3UR2A 2PDXA 2I9EA 4IT1A 2CZEA 3SADA 1F2JA 3BW2A 2I14A 4NSBA 3VOFA 1X38A 1UR4A 2R1KA 4KEUA 4ZA0A 1JCNA 3QTPA 1DJXA 4Z1AA 4W9TA 3SCOA 2XM2A 1QVBA 4MJMA 1F6YA 4HNNA 1NARA 2VD8A 4WXZA 3KEHA 3GVWA 1V3JA 4XO7A 2H3DA 1Y5XA 2LLEA 4DI8A 2NWSA 3G18A 1KFBA 1TPUA 1TPC1 3NJ3A 1HKJA 3QMRA 1X6LA 1OIMA 3MA8A 1YBQA 5BRBA 1S2WA 2WLZA 4Z42C 2Y7FA 3QY6A 4ZQPA 1E6NA 2Z1WA 5IFTA 4DI9A 2YFNA 3D3AA 1H49A 4JPGA 3FXYA 3QQWA 1CT5A 3VNKA 1WDRA 1FHUA 4XKYA 3AQUA 4TVUA 3ZSSA 3G1AA 4EANA 1EO5A 2PDKA 3O9NA 3U4FA 2DVXA 4RXFA 3SJ3A 4RLIA 3CEUA 1TELA 3TR2A 1BWLA 4PMZA 3A6OA 5AC8A 5I23A 3TOPA 5I5RA 2W0UA 2QGHA 3P6LA 3CUJA 5LA1A 1QK2A 4EVZA 1TKKA 3CH0A 4UTHA 1U1HA 1P7TA 1BG9A 3FN9A 4TMCA 5HNTA 3BJSA 1XG3A 5E9AA 4CNOA 3TWBA 2R82A 1XYFA 3VX0A 1YBQB 2ZTJA 1Q6QA 4RKAA 4UTTA 5DRCA 4JNMA 5BRPA 2IS7A 4MNJA 5LHFA 3DZ1A 3QKEA 2EGZA 2R1NA 3KBVA 2GOKA 2PSNA 4L7ZA 4E8DA 2HRWA 3EOSA 1IEWA 3UYIA 3SBFA 3WDIA 4XKYB 2YXGA 1LBLA 3N15A 1UWQA 2B7PA 4IMFA 4C6KA 1VFMA 3KUMA 2NUXA 2WYSA 4GBDA 1V0KA 3TW6A 4F9JA 4HU8A 3CYJA 3SCQA 4GH1A 3LOTA 4I9AA 2ZVRA 3TC3A 1L8NA 3E2QA 4XAGA 1JCJA 1ZAHA 3TE9A 1P7TB 1ZPTA 2QT3A 2V3EA 4LVBA 1OFDA 3CUZA 3B0PA 3TCEA 4L80A 2E6YA 3E5BA 1EPVA 1KA9F 2C15A 4WOQA 1V08A 5BOOA 4X22A 4LB4A 3VKKA 1U5VA 3HQNA 3HQOA 3WD3A 4DO5A 4PA8A 1BYBA 3U3HA 5LXXA 1GVIA 1W1YA 3KL0A 1E9LA 3ITLA 1X7IA 5E9XA 2C8NA 1MNZA 5AYYA 3P5YA 1J2WA 3K8KA 1M03A 3SCSA 3TNBA 1VIZA 4A3QA 3VOJA 4JZ5A 1YKWA 1TE1A 3WUEA 1X1ZA 4O19A 3AYTA 2CESA 3WLRA 2PDWA 1GQIA 5ECVA 1TCDA 4W87A 1HVQA 3U48A 1WXZA 3VNYA 2BY2A 4QHRA 1QBBA 4FR6A 1UBPC 4RNIA 3DFTA 1T7LA 3M0IA 4BF5A 3OLEA 4J2PA 2J78A 2EJAA 4OE7A 3GXMA 3KTCA 3LM3A 4RR4A 2A3CA 1I8JA 3V5OA 4O1FA 4B4HA 1RAKA 3BW3A 2BVYA 3UF9A 3MKCA 1H50A 2BZNA 2PWVA 3TTOA 5LGXA 3PZ9A 1EGMA 3LEPA 4YNGA 3KVLA 2NWRA 4H9TA 1UR3M 1EDTA 1XFCA 2FB3A 1BVNP 8TIMA 3HPFA 1S5NA 3EMQA 4DAIA 3C61A 2YW4A 5BMXA 3GXNA 1LG1A 2NZLA 3W75A 4LYKA 5JIWA 2J6VA 2WVUA 5A6BA 4FX8A 2I1OA 1E9IA 4DN1A 1GJWA 3UG8A 4ASTA 4B5SA 4POCA 3ABOA 3W7JA 3DFSA 3WLPA 3M43A 1THFD 3B0XA 1EJSC 1F5ZA 1F61A 3MPGA 4BR1A 4PEEA 3IS4A 3M6YA 3CT7A 2CWNA 5FACA 2J74A 1V3HA 2NVAA 3A5FA 1QCWA 4B16A 1TTQA 2VGFA 4X0NA 3N11A 4PRRA 4RE2A 4KCUA 1XBVA 3M1ZA 1GPFA 3MANA 1JVNA 3N3MA 1LL6A 1KM6A 2Y8VA 1XIEA 3LTSA 4Y9MA 3UGVA 3NZ1A 1FWSA 4GQBA 1XD0A 1UR9A 4FIQA 4FXJA 3K8MA 4M29A 3L7RA 5D8WA 4ACZB 3SUTA 3ARUA 3F4VA 1UUQA 3GDKA 2Y7GA 4HMEA 1JD9A 4ZMGA 3TU9A 4CCCA 1FWJC 3EPMA 1V3LA 3T1GA 4UTLA 4ZQNA 4ICCX 2FVLA 1OT1A 2F6XA 3RRXA 4B15A 4YPJA 3DKLA 3DERA 1Q85A 2BVDA 3LCIA 4HGXA 4I5RA 4UCFA 4ZOAA 4H1ZA 3VZXA 4PL2A 4P7RA 2DVTA 3QTGA 3SQLA 3H8AA 3USBA 3SSZA 3OBAA 3V4BA 1F07A 3W23A 3AIWA 4D6DA 1YHTA 2G96A 3WUGA 4EWJA 3QOMA 2VYOA 1UASA 4AVNA 3ZR6A 2ZUUA 4L6DA 1HQTA 2V2HA 4QRNA 4B2DD 5CG0A 2WHKA 5LIXX 3N29A 3C8NA 2YCJA 2WQPA 3W1RA 2TRSA 1FDZA 1U30A 2D2HA 4MZ8A 1TZ7A 2GSHA 1EYWA 4NJIA 2NVDA 4LUJA 2E1WA 1FY6A 3IRSA 5D04C 1GOWA 3GH4A 1XKJA 3M07A 4LY4A 3TJLA 4KKXA 3BLDA 3BLOA 3EXTA 4N7QA 1SFJA 4RW3A 1JUBA 3GDMA 5EYWA 3OHMB 1KFKA 4XISA 2NQZA 3GU1A 3PFMA 5CAHA 5I78A 3L2MA 1WXJA 4WDXA 3PSWA 1VJZA 3U2CA 4XAPA 3TR9A 3DXIA 2AL2A 1VBGA 3G1RA 2WPBA 1BWKA 4W85A 4RE0A 3S0CA 1V4YA 3H4WA 3MUZ1 3GTHA 1VKFA 1UROA 3AIVA 2D3NA 3O8AA 3LLDA 1BVWA 3TONA 1ADSA 3GXPA 1XLKA 1ODUA 1SW7A 1BSIA 2ZX8A 4OBTA 2Y2WA 3W01A 3IUHA 1H0IA 2WVTA 3I10A 2I9UA 4UZSA 3HBLA 1NOUA 4JFUA 4XK2A 3R0UA 4QDPA 3RX3A 3KBSA 1AQMA 2R14A 3POCA 2PDMA 3L2LA 3OHIA 4XBSA 3AZTA 1GGOA 4MF4A 2ZBTA 2IKJA 3W37A 1Q6OA 1GUVA 3RFAA 4EKJA 1EFZA 3WQPA 2R94A 4F79A 3WUBA 5CPQA 1R7OA 3VIJA 4XD6A 1H5YA 1F3XA 4DBUA 1T96A 4Q4PA 1OFEA 3WLIA 5D2YA 2AL2B 2BLEA 5I02A 3CAVA 1LWHA 3EXSA 3A21A 2DZPA 3M0LA 3M0YA 3M16A 4Y8FA 1O66A 2CIPA 3FCPA 1L6FA 4M6UA 3OA5A 3ZJ7A 4KWVA 4JTAA 2PAJA 3MP5A 3ENLA 4H8HA 1JZ5A 4RE3A 4HZ6A 2OSYA 3VMOA 3B9DA 4X2PA 4M0XA 4J3ZA 1QDSA 4PCFA 3LMYA 1WX0A 3NIYA 3D0CA 1R3VA 4GC4A 4XZLX 5IRPA 1WP6A 2BVWA 1F73A 1SW3A 5K3VA 2P53A 4JQ3A 4O1DA 1YQ2A 3KL5A 3LRMA 2QDDA 2W27A 1NDVA 2P8BA 2V30A 4GUIA 5FEWA 2UY4A 4M6PA 2YKKA 3T2OA 1SJBA 5KEZA 1BG4A 2QZRA 3B05A 2RDUA 1VBHA 1E71M 1BXBA 3A22A 1LYXA 4D9PA 4Z2LA 1OCNA 4DNHA 3H7RA 4UTUA 4KIRA 3RLGA 4AD0A 1R7AA 1OC5A 2WHMA 3LPOA 4IIEA 3G3MA 1RK5A 5BRQA 2JALA 4TU1A 3VNJA 4L4OA 1MSSA 2J79A 1Z48A 1XV8A 5CC6A 1HFBA 4FZIA 3BOXA 4D1JA 4DJFC 5BU9A 4I90A 4ZQOA 5DMLA 2HISA 1CBGA 1OHLA 4LEFA 4HOXA 3AIQA 1BD0A 3DEQA 2YDAA 3M47A 1W1B1 2XZ9A 3PG9A 1K1DA 2PTWA 1C92A 5D02A 3GYCA 4E2VA 4YTQA 1W17A 1FRBA 3SRKA 3MCOA 4BEUA 2VM8A 4QXIA 1PJ9A 4HZ7A 3UNDA 3U5YA 4AIUA 2INFA 3MZNA 1NQ6A 4AHPA 3TK7A 4A22A 3ZXWA 5FA5A 2ABAA 1J6PA 1S1PA 3EX6A 2A7RA 3O05A 4WSJA 4IG2A 4QE5A 1EPXA 4B3LA 2D0FA 3W7PA 1M7XA 3VNZA 4W88A 1YXDA 3O06A 2ISVA 4BJHA 2PBOA 1QPQA 5A8NA 3CL7A 5FF4A 4Q6XA 1JAEA 3T8QA 1UC5A 2PI6A 3MYOA 4U2YA 4PFMA 4IPLA 2VI0A 4BCEA 1UBSA 3VCCA 1WA3A 1GEQA 3W4RA 3BLPX 3TYZA 4M8UA 1OBAA 4S2CA 2DJLA 1CENA 1EB3A 2Q8XA 4LS2A 2WBGA 1KTNA 1FCBA 2WZTA 3K4AA 4GYFA 3KFTA 3OVRA 3CMJA 4WLCA 1J0YA 1TTPA 2NT1A 3MT1A 4M1BA 3EOUA 1UG6A 2TODA 2BOFX 3KDOA 2MUCA 4UFIA 3N4EA 4KWSA 2G4FA 3S1WA 3LHZA 5K7JA 3WQOA 1ML1A 3H4GA 4IG2B 3KVJA 1R0MA 3CT2A 4O53A 1YNYA 3Q45A 1MEHA 3DOPA 2RKXA 3MB9A 1QI4A 3SCUA 2Q3OA 1XCXA 1HKWA 2OT1A 2WM1A 2KAUC 2L5HA 5C70A 1H11A 3KZPA 3LHVA 4JQ1A 4YHEA 2W61A 1CGYA 4H9XA 5LNRA 4HQVA 4MADA 5HXMA 1ZUAX 3E96A 2NLIA 1XYBA 3LGGA 4X3ZA 1UQZA 1K3UA 3W0KA 1R3WA 4BF7A 1EX5A 5A6LA 3E2SA 1D3GA 4LXFA 4OKDA 3EWBX 1E6XM 3DHUA 1EQPA 3JZUA 2ZE0A 1P4CA 1XH0A 2D73A 4W8LA 4DUXA 2HS8A 2Y63A 2NX9A 4RL3A 3AU2A 3FYPA 1HKKA 4GHRA 3AHVA 1HO4A 5K9DA 3GZAA 3AWOA 4CNSA 4HMNA 2CKRA 3UXAA 3AXMA 2J25A 2TYSA 3ES8A 4IH3A 1BHGA 5CPSA 2XSXA 3CQ0A 5AOUA 2DT3A 1FHVA 1KR0A 2QVHA 4ZB2A 3LCGA 2HNEA 3CTTA 4TOQA 3UESA 1E4MM 3THUA 3SUSA 2ZIDA 2WHLA 4CCDA 5HAOA 2CBIA 1AQHA 1IEVA 3SCRA 3IACA 3W1LA 3I6RA 3IEBA 1XKYA 2Q09A 1BSLA 5XIAA 3TZNA 2WK2A 3CWOX 3GU2A 1KFWA 5FF3A 3S5NA 2GK1A 2Y5JA 1VR6A 2YR1A 4WCJA 5E09A 2R1LA 1G0CA 3KL3A 1LM1A 3CH9A 4K7VA 3IIXA 1WNOA 3QR1A 3PAOA 3MU7A 3B40A 1EHAA 5EMJA 5B7YA 3N2MA 1PZ2A 2OYLA 4AIBA 4AW7A 4EXQA 3POHA 3S5ZA 3BQ5A 3KCOA 1LRNA 4XZHA 4U5IA 2FTYA 4QTGA 3LXCA 1K8CA 3AMLA 3HZ3A 1R3SA 3K1DA 3HFTA 1SFSA 3TTSA 4ZE4A 3ITGA 1XLLA 1FWIC 4MKVA 2B4GA 2WW5A 1R38A 3R10A 1GT8A 4S3KA 3RLVA 4IQDA 1C3FA 4J1OA 7ODCA 5I0DA 3THDA 1X97A 3M44A 1GOOA 1Z32X 3SGUA 2H9AA 2WWDA 1QOXA 3KRSA 2C16A 1IEQA 1QWGA 3IJ9A 4R7OA 4TXEA 4JIHA 2FZBA 1XINA 2GK1B 3P7YA 4MWAC 3AALA 1FWGC 1G7UA 3QC0A 4LUYA 3LNMA 3VIHA 1V02A 3WL1A 4CNPA 3ZZ1A 1YADA 3ES7A 1KBBA 1W9DM 4Q33A 2YCIX 4B9ZA 1CPUA 1V5XA 3ANYA 4UWMA 2VTFA 2FGZA 2TAAA 2PWUA 3EX3A 1J12A 2BHUA 3A13A 2ANUA 3N2BA 5AN7A 4CCEA 3S1UA 1JPKA 3ALGA 1ZAIA 2YDQA 4JR5A 2GVYA 4PC8A 2YZ5A 2XIIA 1EGVA 2PU1A 1VYPX 2XVGA 3KP1A 5KZ6A 4LYQA 3M5XA 2GUBA 3GXFA 3UJEA 3IGXA 3O2LA 3ZT6A 2FFCA 5FJIA 4YTTA 3QPEA 4IICA 2JBMA 4AHQA 5DBUA 4HZMA 3GU9A 1JR1A 4HK5A 2WSYA 2VWTA 3M6DA 1NF0A 3PUEA 2H9AB 1QPKA 1S3TC 3E0IA 2XVNA 5I79A 1QRQA 3E1F1 4NJHA 4UUIA 1X39A 3EOEA 1GQJA 3EX2A 3RF9A 4MSSA 1JNEA 3GNXA 4HK7A 1ZJIA 3AC0A 2VX6A 1R8LA 3TYEA 3AWNA 3HIJA 3ALFA 4JKMA 4O0ZA 3TMQA 4TV6A 1LRQA 1OCQA 3NQAA 2XTKA 1N7KA 1YE6A 4E3VA 2IPFA 3LYEA 3TH6A 1ME9A 1DKWA 5H6HA 1EL3A 2ZZ2A 1DXEA 1TA3B 3CK5A 3V7PA 4BK9A 4IXXA 3LRLA 3BGGA 5E0KA 3E2VA 3B8TA 3J7HA 3DAQA 4HNVA 2ZOXA 1G69A 4IMAA 2C1HA 4LF2A 4LS0A 3ITYA 2Z28A 4GCXA 4WJXA 4MGGA 1YIXA 3FLUA 2OELA 3W72A 2X1IA 1TV3A 1ADDA 3SEPA 5KZMA 4PTDA 4ZFCA 3BMXA 3IJLA 4C6BA 3SY8A 3WJZA 3I4EA 3ANVA 4GJJA 3RJXA 1VHCA 2VRJA 1EA0A 4GNVA 3SRDA 1ZCCA 3GBDA 3PJWA 5CC5A 4WGXA 2F38A 5ABGA 1A5MC 2XWEA 3PUDA 8XIAA 2VL4A 1D2KA 4DWSC 2CYGA 1X6NA 1RK6A 1JPMA 2QULA 3U0HA 1X7FA 2YBUA 1MQPA 4ZO6A 2Z7KA 4JCLA 2FGBA 2GDQA 4HYWA 4IFOA 1PWMA 3K4WA 3RIKA 1B5TA 5H8PA 4NRRA 1BKHA 1ZJBA 3TNOA 1E0UA 1TR1A 1U22A 3PY2A 2OWCA 4GI4A 1UA7A 4YTRA 5BXSA 4KWWA 1N2VA 4N4PA 4S2BA 5DRIA 1SMDA 5LNSA 3PK7A 1Q7ZA 1BTCA 2XFFA 4OHQA 2IXVA 2B7OA 1KFEA 2Y61A 4Q8WA 4BQ5A 4YVXA 3SECA 3BSMA 4CU6A 1HNYA 1I1WA 4KCWA 4NXSA 2F8QA 1MW0A 2PF0A 1MRQA 2A0NA 3FA3A 4RPQA 1XW8A 4Z2IA 3KHDA 4PMXA 1QI3A 4Z1BA 4FOKA 3QPZA 2XH2A 3GRIA 4B2DA 3N34A 4YTSA 5CSRA 3WELA 2OO0A 1B0IA 2I5QA 3CEPA 3RGTA 4O28A 5D32A 1IF2A 5AZ1A 1O12A 4PUEA 2ZUTA 1MWOA 3FFSA 1JJKA 4ADTA 2ZX6A 3TZFA 1OB0A 4E0CA 3CZGA 1UOZA 1OFAA 3C86A 4O52A 3NSNA 3M0ZA 4H04A 4BQ3A 3W84A 1F3WA 1K9DA 2OX1A 1E3ZA 5IDZA 1QNSA 2PDCA 3HG5A 2GJLA 3N6HA 2WXDM 2Y4SA 4KS0A 4R9XA 4IMGA 3UEQA 1TV7A 3M4HA 1W1TA 1GKQA 2BGQA 3U2OA 5D2WA 4WDTA 3UU0A 1OCJA 2NX1A 3A47A 3WLMA 2V81A 3PPFA 3FGCA 1E43A 3UR8A 2Z2AA 3UA4A 2V5CA 4HSHA 4IZGA 3CV7A 1ONEA 3BUVA 1MQRA 3GVVA 3CV2A 4KRZA 2Y62A 5I3JA 5DMNA 4RZ4A 2HVNA 1RH9A 2DZBA 1ZNNA 1JUEA 3WLOA 3UPWA 3K13A 4XD5A 1QNQA 1M65A 2G5WA 3B06A 3MHGA 2EJ1A 4CU7A 3QM3A 3T05A 1JAKA 3PZNA 4ZFMA 4ZE5A 2H8XA 3G1FA 2CBJA 4H9MA 1ELSA 3H12A 4DO6A 3PPGA 1DHPA 1CGTA 3WEMA 2QDHA 3OG3A 4F4RA 3NTYA 5C7VA 3QGKC 3BMWA 3RXZA 1XIJA 5LXEA 2CLIA 3OGVA 4LUTA 2FKPA 1E6PA 4HP5A 4YCOA 4JTUA 4UFLA 5F2GA 1IT0A 3EWWA 4WD0A 3BAKA 3A4JA 3EPOA 5A8MA 1EBHA 3LPFA 2A5HA 2J47A 2XFRA 2YBTA 3SDOA 4LJ3A 2GGEA 1Y5WA 1DTNA 3FGCB 1JF5A 5H1WA 4D6IA 4V33A 2QIIA 1ZBCA 4PMDA 2XG9A 7PTDA 3R89A 1DJYA 1O5RA 2WAGA 5TF0A 2WMGA 1XIMA 4B5XA 3F4CA 2OGJA 4DUWA 2JK2A 1ZRQA 3KM8A 3WFLA 3IARA 1B4EA 5AHMA 4TTUA 1NEYA 3W1MA 1XRVA 2UBPC 3BCJA 4G5DA 4MJ4A 2DUXA 3L67A 4GIRA 3XIMA 4BA0A 1YDYA 3VU2A 3W1QA 1RV8A 1SZGA 4LUTB 2ALRA 5D2VA 2BBFA 2GJRA 5JMUA 5DLCA 4YJ5A 4GD0A 4XG1A 3CL6A 4A8IA 3CLWA 4HYRA 1OFQA 1PCKA 3OYZA 4BWLC 3QJAA 3CPUA 3SFWA 4CQBA 3APGA 1X8FA 2PDFA 3OZMA 1QW9A 3ZT5A 3EA1A 3GY1A 2J6XA 1Q4NX 3ISIX 6TIMA 4QQ3A 2ZC8A 2IMRA 1EUAA 1SGJA 4PZVA 4B5NA 1BVZA 1X6UA 2VFDA 4C7DA 1M7OA 3SGZA 3T8LA 1K7FA 4DJED 4KH2A 1G67A 4PMRA 1XM3A 1Q66A 1MUWA 1KM1A 2PLJA 3OLIA 3UJ2A 4IFRA 2WQDA 5U7SA 2F61A 4QEEA 3EDEA 2ZZ7A 3KBJA 1A53A 2QCCA 2YL8A 1VENA 4HVXA 4KESA 2ZQ0A 3GUWA 2V0TA 2PS2A 4FIRA 1MRAA 4TQTA 1PB0A 1KLZA 5D33A 4H19A 1EXBA 4H8NA 5C6MA 2DGAA 2QUVA 1DORA 2PP0A 5G2HA 1SFTA 2VENA 2J9XA 4PUJA 3W2KA 5CSSA 2BS9A 1E6ZA 4C1LA 2VZVA 3AOFA 4O14A 5CSUA 4JQ2A 4TR9A 2PFHA 4HCDA 1WKFA 4IPPA 3RO8A 2VC5A 1JFXA 1O7AA 2DUZA 3O0KA 4D2JA 4NZ3A 5DEZA 1FHDA 2VURA 2P0IA 1I2QA 1WZMA 3VMPA 1B9BA 3VTRA 1JZ3A 3G1HA 3P82A 3HQPA 2PE4A 2CNCA 1BWVA 1QOQA 4GK8A 1W5QA 4QG6A 2J77A 1LQAA 2WVVA 2HK0A 3THCA 4WKFA 4EF9A 1T6MA 4N9CA 3NQ7A 1BQCA 3PANA 3AHYA 4MPQA 3HPZA 4HT3A 3OZPA 4JEJA 4ZL1A 1PTAA 5ABFA 3YPIA 1K02A 4CQAA 4L6OA 5CJ5A 2ZX7A 4QDMA 2H3BA 1EJVC 3KE0A 2GWNA 4IPNB 5HMSA 3FW6A 4I9JA 4W8AA 3QBUA 1XSIA 3GM8A 4LQ1A 3KDNA 2HROA 3H24A 2O55A 1Q13A 4MYAA 2PC4A 2VRKA 1MUCA 3GTIA 1I2RA 1BGAA 5GQBA 1QASA 4W7UA 4JTJA 1WKEA 1NFGA 4C6DA 1EJWC 5I06A 5G1MA 4MJZA 2WSKA 2CZDA 1I0BA 5D8ZA 2XSBA 3WK2A 3W6MA 2PCEA 4L56A 3IV8A 4YWSA 1RZMA 4QS6A 4Y96A 5EY5A 4B5UA 1WDSA 3EA2A 2WVVB 1TRDA 2EPKX 1QO2A 2Y85A 3CQHA 4PB3A 1B3WA 2DQWA 4LVGA 1E4LA 3W73A 5HR7A 1TPB1 3L5MA 1MQQA 2DJXA 2VCBA 2BY0A 1WDWA 4FNUA 1K9EA 5ABFB 4A21A 4DF2A 3WUFA 4JTDA 1MNSA 3W81A 1TV5A 2CZ5A 4C6FA 5JUVA 1JGIA 3W7MA 2AKMA 3STEA 1C9DA 5EKYA 4CQ9A 3TTYA 4WIWA 2PP1A 1PHWA 2FDSA 4H83A 3Q94A 4KWOA 3UXLA 3O16A 2OZTA 4CN1A 3NDZA 4NAFB 2NSOA 1XJBA 1O94A 3VIGA 1N82A 3C52A 4DLMA 4F0LA 5A3HA 3S2NA 3W7KA 2Y88A 1UD2A 3JVAA 1GW9A 3BLIA 5LNUA 4D6EA 3HG2A 3FSUA 4PMOA 4CU8A 3SAZA 3WBAA 4DUOA 4UFJA 2DIEA 4PCTA 1R86A 3BC9A 3NPXA 3UG4A 2HEJA 4ZBCA 3NPUA 1RP8A 4DZIA 3NWRA 4GIEA 4X0VA 3WH5A 3ERPA 2YCLA 2D2JA 3GLCA 4G8TA 2FJKA 4A3UA 3CHFA 2E9LA 4LS1A 3URAA 3H4XA 2J8GA 5HINA 5BOEA 4RDZA 4HCLA 4C6IA 3T0DA 4PGLA 3M0JA 4DWSB 2A7NA 2ZXAA 4JY8A 1POKA 1L6WA 3FJNA 2GQ9A 3GTXA 2J9YA 1TV8A 4CNUA 4H7ZA 3EX4A 3PZOA 3R8GA 2NW0A 1M53A 3FA5A 2XN1A 2AGTA 3GG1A 2NXGA 5BXPA 4IWWA 2QW5A 4PMYA 1ME7A 3KP0A 2WC3A 1CYGA 5I3KA 4US6A 1LT8A 4MB1A 3THQA 4M3PA 2J8TA 1EXPA 4E8GA 3WF0A 4PN2A 1LQ0A 4GI9A 1YXYA 3GIPA 2ISDA 3VVGA 4W89A 1SM9A 1A0CA 4QNWA 3VDAA 2YCLB 1QTWA 4H41A 3DFOA 1AJZA 4UFHA 3L0KA 1E0XA 5CZ0A 1JIBA 3GC4A 1LTDA 1C8XA 3VKJA 3WLKX 1EC9A 3LCWA 2I5GA 3II1A 2GSJA 4D72A 3IK4A 6REQA 2HPMA 1LROA 1AD1A 4AZGA 2VT0A 2OZ3A 2INEA 3FKRA 5KZDA 4C7GA 3LXAA 3CQIA 4M80A 4Q7IA 1LOLA 5FD0A 2HJPA 5AVHA 2GDVA 1EHNA 3S5OA 3GTFA 3REQA 3R43A 4IJRA 4KMQA 3QHOA 4ZZ9A 4LCQA 1UJPA 5IDIA 3EWUA 3NM3A 1VPXA 4AAJA 3CBWA 3V16A 3W38A 4Q7NA 4JTEA 4N0RA 4Y9OA 3ITTA 3IANA 3AMCA 3LLFA 4GXMA 1ZHAA 1MFUA 3S46A 3ZWTA 2HMCA 1QNPA 3MUY1 1VQTA 5I03A 2PTZA 4XZBA 1GJUA 3VGEA 2FH6A 1F9CA 3T09A 1OGSA 4GQGA 4NF7A 3CXOA 2ZX9A 5BZAA 2G8ZA 6REQB 2XUCA 2P76A 5SWUA 3BXWA 4WQ6A 1KRMA 2JGYA 3UVIA 3QYQA 3HQ1A 1UKTA 4CVUA 4OECA 3ARQA 4UR7A 3IGHX 4KF1A 4B91A 3ARXA 3GKAA 3WG6A 3CIWA 2JIEA 4MG4A 5FJTA 4UOZA 1F3EA 2V9DA 3W24A 1Q3NA 3REQB 1M1BA 4L5ZA 1R3QA 5D03A 1J5TA 2DP3A 3OP2A 2WO5A 1VB9A 5AZ0A 3R8RA 2CLEA 1ZP3A 4AFYA 3TW9A 5D9MA 5JU6A 3E2RA 4V28A 5BNKA 3T4CA 2QCEA 1OD0A 1OQFA 2F84A 2BHZA 3HGSA 1GVFA 4QJ3B 4M81A 3ZWSA 5EBAA 3G1SA 1F8MA 1ZP4A 4EIVA 2G3MA 2G3FA 1XP3A 4D71A 3TYAA 4BWLA 3T08A 4U3AA 3BL3A 1K9TA 4Y7EA 1GHSA 1T8XA 4MLJA 3RYSA 1ONRA 4N9BA 3MQTA 1QI0A 1DWHM 3R6IA 3PWIA 5HPCA 1RALA 4MOZA 4Z17A 1XH2A 1IZKA 3QHNA 1TSIA 4GXPA 3ELFA 3W2LA 2VFIA 1VHNA 1OG6A 2XH0A 5KINA 3APTA 3W29A 4X63A 4AUBA 4JIIX 3TEVA 4GO8A 2FTPA 3P80A 2ZTKA 1HL2A 1TTIA 3I3DA 1PEZA 3HPXA 5IBXC 1S2AA 4INFA 2NQLA 9XIMA 2X0SA 5DQPA 1GOIA 4S3GA 1TG7A 2WKGA 3SCPA 4UTIA 4XTIA 2UY3A 2CCRA 1Z44A 2EXOA 3F03K 3NL5A 3WEZA 1PL9A 5I77A 1FDYA 1B90A 3QZEA 3C0SA 3TYCA 1DWAM 3OTRA 3IIPA 4JTKA 4C5YA 5CJMA 2G4JA 1N55A 4AY7A 4C5ZA 1WUEA 2ALDA 2QVNA 3GC5A 3VOCA 2PZ0A 3T0CA 1R2SA 3BGJA 3WH6A 1E1EA 3WBYA 3BLLA 4P8UA 2OYMA 5CBBA 1GTHA 1WAUA 1UZDA 3NDOA 1OC6A 3WJYA 1XYMA 3HPAA 3OVQA 5K9XA 5AYIA 4IGMA 3M46A 4HNOA 5CQ1A 2Z2UA 1XGZA 4TTGA 4JTQA 2V8ZA 3URBA 1MVYA 3VFLA 1TJ0A 1TIWA 8RUCA 1KRBC 2I5IA 2OOFA 3N2TA 3K2GA 2WM0A 4U10A 5GJMA 1L9WA 3N25A 2D69A 4PRTA 3ABXA 3SSJA 3KTXA 4RDVA 5CGQA 4FLQA 3IV3A 3UWYA 1FH8A 1ZJHA 4IMCA 1F76A 2QPUA 2QMKA 4TMBA 5HJLA 3WBXA 2GUYA 4HNTA 2GJPA 2VELA 1O1HA 3STGA 1Z3NA 3U4AA 4ZB5A 2G50A 2OU4A 4KT2A 1JZ6A 2YYTA 3NXLA 2OODA 3HG4A 1AQFA 1AL7A 5CBJA 5DX7A 1FWHC 1FWBC 2VRQA 2QCNA 1EUNA 2RH9A 3LERA 1W9XA 3AJXA 1XLGA 4F0KA 3W74A 1UD5A 5AHNA 4JHOA 1NSJA 4LX4A 4C65A 4H9ZA 1HO1A 4GOAA 2HV5A 4O1EA 2NVCA 3U5UA 1E9ZB 1AL8A 1FH7A 3W1UA 3WYZA 3RITA 4ZXOA 3MKKA 1RJQA 1UPMB 3SW6A 3DDMA 2P5NA 2GVLA 2VGBA 2V5DA 4N9EA 4C6EA 4N9DA 4HNUA 2OLAA 4NJJA 2ZA1A 2WOQA 1W5MA 2CLHA 1EDGA 1CW2A 4I8YA 3VABA 1VFUA 3BZJA 3AXIA 4WK9A 1AQ0A 2WVSA 5C9ZA 2QXWA 2DQXA 4M24A 1Y65A 3WMBA 2E9BA 1AUSL 4TX8A 2E77A 5JBFA 5AC7A 1XRFA 4UR9A 3M5VA 3VMNA 3VX1A 1JYXA 2V82A 1JZ8A 1XYCA 3FV9A 2Z0IA 1NP0A 1R85A 3A9BA 3DI1A 4JGDA 3R25A 5CPLA 2DSZA 3LHUA 4JTCA 1JCLA 5AYXA 5AC4A 4XZWA 2VP8A 4OVXA 3ZS4A 3ARPA 3BVJA 4IUOA 4PSPA 1UD4A 4GUJA 2XJ7A 2O7QA 4W5ZA 3FS2A 4CQ8A 3DH7A 1TTJA 4UQCA 4CKQA 3W7GA 1QAPA 4MZ1A 1GOXA 3B8VA 3NSMA 1R30A 1DTUA 2FFIA 3G0SA 3H2AA 3BV7A 4KEZA 2CC0A 4HMCA 4DJEA 2WC4A 1AW5A 3W3OA 5BCAA 1TVNA 4DY1A 1MDRA 3TWAA 3QF0A 1WOBA 3C6CA 1Q8AA 2CEQA 3GW3A 4WR3A 3GNNA 2DDXA 2FVMA 1BQGA 3PBYA 2VX4A 3GAYA 4H9YA 2GPTA 3WH8A 4IF2A 2QV4A 4ECLA 6PTDA 1W1ZA 1A5BA 4FNRA 4U3CA 1ME8A 2WCGA 4YVVA 4GPNA 3UCDA 4K6AA 1UUOA 1HKVA 1XLJA 1B2YA 4A29A 1SJCA 4JICA 1CNVA 3RR1A 4MNMA 1BFNA 3A3HA 3IPWA 3AFBA 3LHTA 1XIDA 2Y0FA 4YVPA 5FJOA 4S3FA 1VLIA 4QFUA 3C2OA 1E0VA 4MUPA 1ZL1A 1RY8A 5EU9A 1RBAA 2NQ5A 3BCDA 2H90A 2OEMA 3S2JA 3T6CA 3MW7A 3TSDA 4JL2A 1JDDA 3E74A 1L6GA 4FLOA 1US3A 4NUWA 3XISA 4GY1A 1PTGA 3OVGA 2CLFA 1POJA 5DY3A 1QPNA 2FIQA 1P1MA 3S83A 3EWCA 3ICJA 4HPHA 4E4FA 4IQEA 4KWUA 4IIFA 1P48A 4W86A 3WDQA 1TMLA 3QEZA 1MUMA 1P6WA 4MWAE 3UYCA 4D6FA 4DXKA 3DECA 5BYWA 2X09A 5LKYA 3LRKA 2DZAA 4A2RA 1S3HA 4GKLA 5KITA 2IXUA 2Z29A 3QFEA 5L9FA 2P8CA 2OVLA 4RNFA 1OFOA 4HHPA 1W31A 3TA9A 1AVAA 1GTEA 3UJFA 4IP7A 2G41A 1IYXA 3L2IA 2MANA 3B4YA 2BXVA 5CLWA 1A3WA 3TMLA 2HE5A 1O5KA 4DWDA 2JE8A 3FIGA 2O9TA 5FJUA 1DEDA 1KFCA 4XUGA 3VKBA 9RUBA 4O15A 2J9ZA 5LIWX 1BF6A 4Q32A 1GQNA 1OADA 1QW7A 2OX4A 1TX0A 3FHAA 3VGFA 2FGLA 1LQ2A 1L2UA 4KEVA 3BG9A 1RBOB 1I60A 3AS3A 1HGYA 3VNDA 1VEOA 2XIJA 3CUXA 3TDFA 3AMDA 3TXZA 1GQLA 2WLYA 2DZTA 4UFKA 1K8XA 3MWAA 4FNTA 2QF8A 4PR4A 2DEPA 1WDQA 3NZGA 2VKZG 4Z1CA 3T4WA 3WNNA 5LA2A 1DIOA 4OWGA 4K8EA 2R6OA 3HG3A 4J9JA 1T99A 1J0HA 1O60A 1JCYA 2D22A 1J0KA 2VD9A 3OZYA 2WNZA 3KCJA 4CQDA 4NG3A 1HVXA 2DSUA 3QRHA 1JPHA 3O1NA 3RM8A 3SIMA 4RK8A 4H8UA 4A8LA 1JXJA 2WJFA 4XQ6A 4FALA 2G0WA 4R7WA 1RCXB 3C56A 3LPGA 4Z2JA 3RMJA 2VNCA 4LNCA 1K8YA 5BMWA 4MPKA 4AXKA 1R3YA 2XZ7A 3PBVA 4HMDA 1JRBA 2ATSA 1JYVA 1DIDA 1IIHA 1MW2A 1K4GA 2VMFA 4DJDC 1XX1A 1JEZA 3NURA 4PB5A 5EL1A 4XB3A 3KS5A 1UWRA 3WL0A 5IBXA 1VFTA 1LLOA 2Z26A 2WC7A 3OB8A 3W88A 3OU8A 2IKIA 2ZDSA 3G6MA 2HS6A 2ATMA 1CXHA 5M1TA 1ZGDA 4WUIA 5FOOA 5HQLA 1VFLA 1KLYA 1FWDC 5J04A 4GY7A 2V5KA 2DSKA 3PB2A 4CD7A 3LLXA 4DB7A 3K1GA 1NTHA 2J24A 3KS6A 3MSRA 3KOWA 2QJHA 1VCGA 1E0TA 1UWAA 3RMEA 2ZRUA 2DT1A 1CGVA 3NEVA 2OYKA 1U1UA 3P81A 1R46A 3KW3A 2CBUA 5FESA 1OF6A 1FBAA 5C2CA 1H62A 1A5SA 3RHGA 1MDLA 3F4DA 4UTJA 4N6FA 1GYMA 1HL8A 2YZRA 3ECQA 2F6KA 2Z1XA 1E5JA 2F2KA 1EJXC 3DENA 4JN6A 3G1YA 4ADUA 2BDQA 2EEXA 3TVAA 4DZHA 2C13A 1AMKA 1MXGA 3VXGA 3ZM8A 4NYYA 4OJYA 4YHGA 4LTSA 1ZFJA 4NU7A 1X96A 2GQ3A 4LVDA 1O68A 3KTSA 3V1PA 4DVOA 4JHMA 5DELA 4MMWA 1W3HA 3UG3A 2VFHA 4O1AA 4GYPC 4ICMA 4UMAA 2X7WA 4HPGA 2AQWA 4U5KA 4PEKA 3NPWA 2I7GA 2POZA 5A8OA 1SO4A 3PJUA 5HWJA 3BOFA 1OFPA 5HOSA 4F40A 2EO7A 2J7HA 4UTWC 1VPQA 4C6OA 2IQTA 5LYRA 3N6QA 5M03A 3IIZA 4Q8NA 3P8IA 1XPGA 2ISWA 1RXOB 3RPTA 4HTYA 4O50A 1E51A 1HXJA 3N3TA 2GGGA 2HVOA 2HXUA 3A24A 3S42A 1CX9A 3SO7A 4OUEA 3KRZA 3ZVIA 4L4PA 2JEPA 1H7PA 4ZOEA 3VKCA 2J88A 1N8WA 1H2JA 1D8CA 4QLKA 4CN6A 1TR9A 3G6LA 5GNXA 4RNJA 4MB3A 3EB2A 2BWGA 4JX4A 4LB3A 1W91A 2RDXA 2H8ZA 1VH7A 3AISA 4W5UA 5KSWA 3FOKA 1KM2A 4D6HA 2ODOA 1LCOA 4ZQMA 2FJUB 3RM4A 3TSMA 2BG5A 5XIMA 1VGAA 1VLWA 3GNDA 1EBGA 3W1TA 3E02A 4IX2A 3S6DA 2BB0A 2VEIA 4RV3A 2IQ0A 1KC7A 1XBXA 2RGLA 2W62A 4GUHA 5M3WA 5EB8A 1A5KC 4JIPA 1CIUA 2GJNA 3BJFA 3WMSA 3GS6A 1NP2A 4CVWA 1KGXA 5CCZA 4G2DA 4J3VA 3PF3A 2YA0A 3LY0A 3TROA 3NQDA 3UBPC 3LB0A 4QLJA 3VINA 1BKSA 3GNOA 4XIAA 3W02A 3IJ8A 5FAGA 5FSDC 3C3UA 3CUHA 3H2FA 1X98A 4U2ZA 3PBWA 1FWCC 1VCFA 3K4DA 4WY0A 3UQNA 4MNKA 1EWDA 4K39A 1UR0A 3UFYA 2W66A 5DCBA 1ODZA 5GNYA 1GW1A 3VDHA 3W82A 5C0QA 1D9EA 4S3BA 4JFVA 4NZ1A 1DWGM 4FF7A 2EG6A 1LOQA 3CTLA 4GCAA 1UKSA 4NZFA 5I09A 1J79A 1FOBA 2Z1BA 4GVGA 3ZR4A 3ITVA 3NAVA 1G1YA 3C2EA 1H1ZA 4P8VA 3DGBA 2GYIA 3OOQA 2R24A 2ZRYA 1B31A 1W9PA 4AU0A 1RVKA 5DT7A 4IJCA 4MNLA 2A79A 1SSDA 4PMUA 1KKOA 4GFSA 4BFAA 4QE1A 1UWUA 4O1BA 3TV8A 1TJRA 3PSVA 5DMYA 4WRHA 1A49A 4LALA 3UXKA 4E2BA 3GD6A 1JRCA 4QAWA 4K2SA 3QW4B 3SN1A 1MEWA 3FEQA 1C8QA 3E0VA 2VEPA 1W1PA 4WY0B 1LDCA 5EPDA 2E25A 5BU6A 2IKHA 4W8BA 4I6KA 2J75A 3S6TA 4ZENA 1KCXA 4GWEA 3JUGA 3NVTA 1IHIA 4KRUA 1J01A 1UR1A 4S3DA 4N4QA 1RD6A 3WQ6A 2YJQA 3OLGA 2B0MA 4JXCA 2WSQA 3TQ0A 4AZ6A 5HQMA 1Y0EA 1GOKA 1SZRA 4B92A 3VIPA 4LCRA 3HM7A 3G1XA 3VE9A 3GIQA 4LPCA 4AMAA 3FNDA 1WOAA 1DWIM 1S5TA 4GZIA 4RX0A 1DJZA 1PSCA 3R11A 3EZ4A 3HU7A 1I2NA 2PGWA 3ARTA 1LOSA 3PZUA 4AZ5A 5CEWA 3TJIA 4H8VA 3PZIA 2CZFA 3VD7A 2DV0A 2GUUA 3OYXA 2XU2A 5KZEA 3QC3A 2ACUA 4DNMA 3ITOA 4ZB0A 4JX5A 1VYSX 1QR7A 4MY8A 3WEOA 2JKPA 1O4UA 4Q6JA 1C93A 3WQVA 3W25A 1G4EA 1H1YA 3CPGA 3PJTA 3EEGA 3GIYA 1GOMA 1KTBA 3MVTA 2BOEX 1MXDA 4B90A 3KLLA 1TZZA 2X16A 1MYRA 3OBEA 1JZ4A 3TX9A 4U4MA 5I3GA 3P5ZA 1DQUA 4MJ2A 1OVDA 1FX6A 2VFFA 5AHIA 1RLDA 3M64A 2Z1VA 3GG0A 1AA1B 3HFYA 4IX0A 4PE8A 1TPEA 4I7WA 4AZHA 2OO6A 1NOWA 4WKHA 3UZZA 3BJTA 1EZWA 1W6TA 3CHVA 2PTDA 1XLFA 3EB3A 2J7GA 5I7GA 2E7FA 4YWIA 2C0HA 1IEIA 1R3RA 4MB5A 3AYRA 4K8HA 1GYNA 5C71A 2FZ8A 3OBKA 4DM1A 1ISVA 5HUPA 3G3DA 3P14A 3PHAA 4WJ8A 3VO0A 2PRMA 4MIMA 3L4VA 5F4XA 1SR9A 1E3XA 1GYLA 4ALDA 1QU4A 1EZ2A 1ITQA 1KFJA 4O8AA 3EB4A 1XCFA 1CDGA 4F2BA 4B5VA 3DGRA 3PBMA 1RUSA 3OODA 4J3UA 5E5CA 4ZTYA 3MV01 1CXLA 3BO9A 1FXPA 4AD1A 4GO9A 3TFXA 3C5QA 1CI1A 3MDWA 3AMGA 1FCQA 1W1IE 1IGWA 2FPVA 3HB9A 1J8VA 1ZU8A 2HSAA 4DBEA 3T81A 3AO0A 3GR7A 1SO3A 3DFHA 3BSHA 4DX3A 4YYFA 1B57A 1TYGA 5HWNA 3R79A 2FHBA 5J8LA 3UJRA 7REQA 3B9EA 3ONBA 3T2PA 4YYCA 1Z42A 4XO6A 3CMGA 1XIFA 2HZGA 4DELA 5C55A 4ACZA 3O6YX 4AEFA 5G4HC 4HJWA 4KPLA 3LGDA 5G5IA 1XLMA 3RM9A 3MHFA 4O17A 4LAZA 2OPJA 3ZJ6A 4R27A 2J62A 5FF0A 1I0DA 3WF4A 2VQUA 4P61A 3O6AA 5C7HA 3ABRA 4MFEA 1FXQA 2ZWZA 3B8UA 2QEZA 2VDGA 3MY9A 5IFPA 3W2JA 1M5WA 4E3TA 1EJ7L 3TQVA 4G56A 1UIOA 4AG0A 4EOUA 1PYMA 2CHOA 1AH4A 3BAXA 3N9RA 1RCOB 3T2QA 4DZAA 5I2UA 1T8QA 2Z6JA 3GKFA 3ARZA 4ZQCA 3TXVA 5JQ9A 4H4IA 1FP8A 4G6CA 1XUZA 4GACA 1SZEA 3DN5A 3ME3A 1F6KA 5BWFA 1L6YA 1Z6KA 2PODA 4TV5A 4US5A 3LCLA 4C6LA 3L68A 3MUXA 4NZCA 1EQCA 5HNRA 3WQ5A 1KBKA 7REQB 4C6MA 1EKOA 2C14A 5E93A 3P61A 2DW7A 1W32A 5CPNA 4O0KA 4J4KA 4IMDA 1FA2A 5ECUA 2W6RA 1XG4A 8XIMA 3PZQA 2VWSA 1P43A 1A0EA 3S2CA 3V5FA 3T44A 2DIJA 3OEXA 3URNA 3F7JA 2W67A 3L4XA 3NYZA 4ZO9A 4ZODA 6CGTA 3GNPA 3H54A 1R47A 3GVRA 4LW7A 7ENLA 4RE4A 3V18A 3W76A 3WZ0E 3GTNA 3TJXA 4BY3A 2EPMX 3DFNA 4P7OA 2CLPA 1EWEA 4PBEA 2BHYA 3VDGA 1UD3A 3H2CA 2YB1A 5A2CA 4NT0A 3I6EA 4MTVA 3S6OA 3B9NA 2X7VA 4OV9A 1RA0A 3XINA 3DCPA 4H6RA 1SQ7A 3LPPA 4K37A 2ZUVA 4XWUA 4XIMA 2Z25A 4HD5A 4Z08A 4LV9A 5HNNA 2QUNA 2Z7GA 2QCGA 3RJYA 1DL3A 5K4ZA 2GLKA 3CYVA 3HA1A 1NDWA 1VJSA 1C7SA 1LF1A 4CEUC 2W5FA 4NZJA 4AWUA 2QJNA 5E0FA 3VI2A 2QV5A 3VNMA 1RD5A 3S1GA 3TYUA 2Y7DA 3LXBA 4EK7A 1TFVA 5HUOA 1PUDA 5DXXA 4YXGA 4E38A 4MAVA 2PRLA 3QQ1A 1JDFA 3KLKA 2Y1HA 3CZEA 3NZQA 1PCWA 4PCNA 4S3CA 3G24A 4R34A 2CWXA 3NGJA 1UZ1A 2VZTA 4AIOA 3S5YA 1RCQA 3RU6A 3HMJG 2YX0A 1V7AA 5JBDA 5F1UA 3U2EA 2VR5A 4PMQA 3C0LA 3KOZA 5D37A 3CV6A 4S1FA 1F3TA 1JYWA 2FZNA 1NJJA 3PTQA 2VC9A 1E56A 4ZO8A 3T9PA 2YGYA 1V3MA 1JCMP 2F7FA 4DPQA 2ZUWA 2HNHA 1E1CA 4MUZA 5I6SA 4Q4KA 2FQIA 4WKAA 2PD9A 2PTYA 1QW8A 1KQZA 2PLCA 3BLEA 3QN3A 7TAAA 1BXNA 4DYKA 1PKMA 4QJ4B 1UC4A 1FKXA 1K77A 3DFQA 3AXKA 1TWDA 3THAA 2E5DA 4PUNA 1WO2A 2XM1A 2E67A 1XLAA 4C1KA 1TRIA 3VGBA 1J11A 3E38A 3W00A 3F2CA 1RY0A 1XF0A 2WJEA 5LIYX 8CGTA 4CEXC 3SCNA 1XIBA 4PL1A 1DP0A 4L6HA 2QJJA 4WGHA 1XQKA 4L9ZA 4FLRA 4DXXA 4EAMA 2QCDA 3ABSA 3I6TA 1EJRC 3GB6A 4EF8A 4UQBA 2WPGA 3VM5A 4GGBA 5CPOA 2ZVIA 1TVPA 3W9ZA 2X1RA 4F2TA 4DYEA 4TX6A 3W1AA 1NH6A 4HSOA 1LLWA 1W3KA 1E1CB 3L5LA 2Q02A 4QJ5B 5CC3A 4J3XA 3UZWA 3TN5A 1VFFA 5M2FX 2QAFA 2FMNA 5CSYA 3VFCA 3AS0A 2Z4GA 1T40A 3MDUA 1B3YA 3BZGA 3GZ3A 4G9PA 4EPBC 2E5BA 3W1NA 1KXQA 3ATZA 3PTMA 3GC2A 3GWQA 5F1VA 2GGJA 4O54A 1O5QA 3HMCA 3SI9A 2J7CA 1A5NC 4CD4A 3DG6A 4JY9A 4QSHA 5CZKA 3LI0A 4ONVA 4FEZA 1GVSA 1WCGA 2OJPA 3RDKA 1KBJA 4DUVA 2QCDB 3MUCA 4A3YA 3HOJA 4JQ4A 2BGNE 4JOMA 3COTA 4GVFA 3GX9A 4FX7A 3NSXA 3P74A 4AD2A 4UTFA 5A5WA 1IXNA 1J18A 4LSBA 3C2RA 2QPSA 4ZEPA 3Q65A 4J7RA 1W5OA 1JCXA 5ENLA 4YTUA 3V75A 3JRKA 5EMMA 1O95A 3V0TA 3VC6A 1H7OA 2E6AA 4MVAA 3VILA 1WKDA 2O56A 5IM51 5CLTA 4KFOA 2DZWA 2NQJA 2ZZ6A 1KCLA 2NUYA 3C8FA 3VOIA 1YPFA 1HJVA 3SN4A 1AZ1A 2PB1A 3N14A 3ABZA 5E70A 4K36A 3DHDA 3PULA 4AZIA 1FWFC 4UTTC 2JKAA 1HKMA 5HPOA 1WUFA 1HL9A 2YPIA 4JX6A 1G5AA 5DMMA 1B3OA 2DZVA 3FEMA 4ORIA 4AWEA 4FOJA 2C1IA 1L0PA 4C6NA 1SZNA 4H6EA 1XGDA 2V67A 3OPSA 3OVPA 3TA6A 4GX8A 2JF6A 4O4VA 2ZZ1A 2ZZ3A 1REQA 4OFCA 1ZENA 3HGOA 3M41A 1IT8A 5IHSA 3CPRA 1KGWA 1J0IA 3AAMA 3UXDA 2WSRA 3UETA 4C60A 1FTXA 2JFEX 1UKOA 5K9CA 2HCVA 4WEVX 2YW3A 3QKZA 1PIGA 4V1XA 1J6OA 5HDRA 3E0LA 1UIPA 2X1UA 4JTIA 3M5YA 3ZLHA 4UFMA 2WMFA 3PTKA 4IPIA 3JW7A 3W7CA 3NYDA 2G97A 4A35A 3G8RA 4H6KA 3DU0A 4ZVJA 4LBUA 2A21A 1W3TA 2I57A 3FSTA 1I6NA 1M9HA 1XRTA 3CV1A 1VIWA 3H6OA 1HJXA 3KRUA 1QPOA 4L1XA 3WFZA 1REQB 1NFPA 3GDTA 4WJEA 3VD3A 2PLMA 5D09A 1JI2A 2VVSA 1UR2A 3WDJA 1MZHA 3APYA 3WNPA 1H7XA 4NX5A 3UPBA 3VD9A 1AG1O 4GMEA 2E4TA 3LHWA 3NQ6A 3AICA 2G95A 1GVYA 1GZJA 3WDPP 1E70M 4Q8UA 2X1TA 2AGKA 3AXXA 2DSWA 1TE6A 1VFHA 4AISA 3N4FA 1YDVA 5TD4A 4ROPA 1OCBA 4URIA 4DWSD 1K9FA 4S38A 1GVQA 2GDUA 1KV5A 2WV8A 5HR6A 1F8IA 3MI2A 4ILSA 4J27A 1OYBA 2J13A 4ZQRA 2ZA2A 3H2OA 2BNJA 5LZLA 3CUIA 4UIOA 1PZ3A 2ZC1A 5XINA 1GORA 5AHLA 3ZIZA 2XN0A 5CKSA 5CBIA 1IZJA 3TC6A 1OGGA 3MI3A 5A6AA 4GBUA 4C6CA 3P60A 4XD4A 1B3ZA 4KERA 4FPSA 4XTDA 4GY0A 1U1JA 1J2BA 3ARSA 1DQWA 3ZFHA 3MBFA 2A7PA 3U6WA 3U7BA 3E49A 2HTMA 1YXCA 5EA9A 5FSEC 3MCMA 1OFRA 3F2DA 4Q4MA 4DBSA 3BLKA 3MSDA 3B0VC 4AYGA 2EKCA 2ONEA 4E8CA 1E4NA 3QXBA 3VKDA 1XLEA 1T5AA 4AYSA 3WSUA 2W91A 1D7FA 1DJNA 2WNQA 1KM3A 3MSGA 3NNTA 2PRHA 1NQKA 5HULA 4KW2A 4UTKA 4ENLA 3RILA 2YL5A 3R0KA 4WVXA 1CXEA 1O6IA 4IQLA 3RAOA 3BTNA 4JN8A 3NVDA 4WDWA 4WZHA 5MHBA 1IV8A 1WB0A 4QIUA 3DX5A 3DFYA 2ZUMA 3BSGA 4XBKA 2Q8ZA 3WLLA 3ARYA 4YS1A 4GUGA 2ZWYA 4GIAA 5B80A 1ITUA 4JTHA 1H1NA 4Y2WA 4GX9A 2BXZA 2HBXA 4O13A 1TA3A 2W79A 1EEPA 1PZ1A 3CAKA 4EWND 2C18A 1LRTA 4FR1A 5REQA 4Y9PA 3JU2A 4L61A 3LN3A 1H51A 3IK2A 5AB3A 4GE8A 5FL0A 1XS2A 1VS1A 4GISA 4GG9A 3QW3A 2YXOA 1JPIA 1H09A 3N9KA 3K30A 2D2OA 1G6CA 5CGMA 4GVIA 4XSLA 1TMQA 3AJ7A 4Y9NA 2A85A 3GFXA 5H2ZA 3F5JA 4HU0A 5A69A 1X1OA 1UD8A 1Q6EA 1ESWA 3AHXA 1XWYA 2PTXA 2OEJA 1NDZA 2WKJA 3RNDA 2P0OA 3N6JA 3R58A 2VHLA 3NL6A 5D2XA 1ONXA 2A3EA 2YLAA 3ARRA 3R94A 3R2GA 4Q8MA 1VYRA 2EAWA 2EPHA 3EWXA 3WQ8A 5F2MA 4QAIA 4UBPC 3GXTA 4GFIA 2A3BA 1WBHA 3VZYA 3RPDA 3URQA 5REQB 1A3HA 3BK0A 4JFSA 1QJWA 1IXPA 1ZALA 3H2EA 4P2VA 3G0XA 4RJEA 1ISYA 4LANA 3VDBA 3PNUA 3NCOA 2BV9A 1MFVA 2J27A 3BARA 2VUYA 5FJPA 1GKRA 3UZ5A 2F2HA 1H7WA 5G1YA 3P8JA 3ONCA 3CJPA 3FYOA 1LWJA 4H7VA 4FA3A 3QQ0A 4GC3A 5B7ZA 2V3DA 2YL9A 2VFGA 1V6VA 3BAYA 3RUBL 3FK4A 4AEOA 5KETA 2WB5A 3R13A 4F3HA 3A4WA 5I3DA 4GYJA 2X8RA 1OZMA 1C90A 3NQCA 4O8RA 1P0DA 1YLVA 4NX0A 1EOMA 4BS0A 4OGZA 1PAMA 1TJ1A 2A1YA 3VYLA 3WQWA 1PKNA 4JNZA 3SB0A 1JPDX 1TPWA 2OWXA 4Y9AA 3AIEA 5D9NA 1OY0A 5HATA 3FAXA 3MSYA 4DJFA 1CGWA 4WF7A 3U7VA 3HN3A 2FVKA 1UMLA 1BXCA 4QEHA 1J0JA 2PGRA 4NRSA 4GQQA 4W7WA 1GVEA 2PDLA 4NL1A 2CW6A 1P0KA 3W22A 2HWGA 5LA0A 3WY1A 3OJGA 2DH2A 2WMIA 1SZFA 2P50A 3FYYA 3CB8A 3ATYA 1J0ZA 1RPXA 1SJAA 1YRRA 3G22A 2EG7A 5BXTA 1LG2A 4LBRA 2DZUA 3IRDA 4Z0SA 3VIMA 4XVDA 4CNTA 4PCSA 4BZYA 4Q8OA 4DAFA 4LNYA 4M7TA 1QO5A 1EDQA 5CJNA 3B3DA 2NXHA 3D47A 4LC8A 5C2XA 3G1VA 3EAUA 3SM0A 3WBWA 3CHEA 5T91A 1W8GA 5M5DA 1W2PA 3WDRA 3GDBA 2E8YA 4R33A 4E6MA 1VBUA 2IUZA 2X0HA 3DHFA 4UNLA 1TJPA 5DFAA 3LMZA 1TWIA 4ATLA 4LBSA 1WZLA 1HUVA 3TC7A 4I7UA 4G1KA 2ZA3A 3PBGA 4U28A 4QG9A 2V63A 2WMIB 3CUGA 3L5AA 2DSVA 3TYDA 1U83A 2CITA 3W7HA 1Q63A 3NZRA 2WJDA 3CMFA 4N6EA 3ORWA 1YW1A 2GQ8A 6XIAA 2RJHA 5FIPA 3H7VA 3NFUA 2V5BA 5A8PA 2PP3A 3FJ6A 4YN5A 3W7QA 1H7NA 4HCHA 3WQDA 2CHRA 4QQUA 3O7UA 5HJXA 1I2PA 5A2BA 3SFKA 2OB3A 3BH4A 2INZA 3UZXA 1DIEA 5EGRA 3GXDA 1KM5A 1FWRA 3W86A 4DBDA 3UZJA 4BI6A 3EGJA 1PX4A 1Q6DA 3CZKA 1ZCOA 4NNAA 1EA9C 5IXEA 4QE4A 4RDWA 4PFHA 2DVUA 4IIGA 2BY1A 3KXQA 1WDDA 3LCHA 1UB3A 3WX7A 3ABQA