4AXNA

Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the serratia marcescens chitinases
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
316
structure length
316
Chain Sequence
b'DDAAIMPSIANKKILMGFWHNWAAGASDGYQQGQFANMNLTDIPTEYNVVAVAFMKGQGIPTFKPYNLSDTEFRRQVGVLNSQGRAVLISLGGADAHIELKTGDEDKLKDEIIRLVEVYGFDGLDIDLEQAAIGAANNKTVLPAALKKVKDHYAAQGKNFIISMAPEFPYLRTNGTYLDYINALEGYYDFIAPQYYNQGGDGIWVDELNAWITQNNDAMKEDFLYYLTESLVTGTRGYAKIPAAKFVIGLPSNNDAAATGYVVNKQAVYNAFSRLDAKNLSIKGLMTWSINWDNGKSKAGVAYNWEFKTRYAPLIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE C1
publication title Hallmarks of Processivity in Glycoside Hydrolases from Crystallographic and Computational Studies of the Serratia Marcescens Chitinases.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 115
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4axnA00
2GK1A 1E43A 3W81A 2EPOA 3ALGA 2ZUUA 4GI9A 1UR8A 3W53A 3WMBA 2DT3A 2V3FA 5AC4A 1OM0A 1E55A 5LA1A 3DHUA 1HX0A 2B31A 3IAPA 1FH9A 1XH2A 3W28A 3SCUA 5A3HA 5HXMA 1CXEA 1HJSA 4JKLA 1UWRA 4X0NA 1UWUA 3K8KA 2WC3A 1G0CA 1KXVA 1UR4A 4P8WA 2DGAA 3QHOA 2PWHA 1G5AA 2O9RA 2WSPA 2XYLA 1E4NA 1OD8A 3CHCA 3TTYA 4D71A 4M80A 2G3MA 1X6LA 3KWXA 4PMNA 3WFLA 2ZX7A 5ABFB 3CZGA 5CJ5A 4EE9A 3L4XA 2XWEA 3VD7A 4JL2A 2AMGA 4UOJA 2NW0A 2Y5EA 2PB1A 5DO8A 4B16A 1KB3A 3CZKA 5CLWA 1GJUA 3VM5A 2WBGA 2WC7A 4D6FA 5AC5A 4AWEA 1CDGA 3HMCA 1JD7A 1FP9A 5LA0A 3KL0A 2E8ZA 3ZMRA 3UERA 1HP5A 3NIYA 1E6PA 1UKQA 1GQLA 2CERA 4GXPA 2ZXDA 1M03A 5M3WA 1H49A 2DSZA 4E4PA 2J78A 2OYMA 1B9ZA 5CPTA 5C70A 3ZSSA 3M46A 2JEPA 1ISXA 4UQ9A 3ARQA 4HZ6A 1HJXA 4DWSD 4PRWA 3PTQA 4UFLA 3ARSA 3WQVA 3DECA 3MV11 4UOQA 2EPKX 3NCOA 1JI2A 4DUWA 5JBEA 4OBRA 4XB3A 1BVZA 4UOZA 3GXMA 1AQ0A 1GPFA 1RPKA 1UA3A 1XRVA 3AZRA 5EMYA 3EDJA 2XG9A 2JE8A 4LQ1A 4P7OA 3WQ8A 3CO4A 4XUYA 2Y8VA 2JF6A 2ZX9A 1FFRA 1PPIA 4OOZA 3WQ4A 1CXKA 4MB1A 3WD4A 4MADA 2WMGA 4YHGA 4JAWA 1G01A 1MW3A 4IPLA 7TAAA 4D6CA 4ZXOA 1SMDA 1HKKA 1Z32X 1SFSA 2J8FA 2VL4A 1OCQA 4ATLA 2J7FA 3AMGA 3SUSA 1LWJA 1ZJBA 2QV4A 2XFRA 2VRKA 1JYXA 4HOXA 1UR1A 1CLVA 1HJQA 3WH5A 3RM4A 5HDRA 1X1NA 3FHQA 4JZ5A 1NM9A 5BXRA 1GOKA 1UKSA 2J74A 3VDAA 2D0FA 3WY1A 2IXVA 3WF2A 2WAGA 5A6BA 1TUXA 2GVYA 4PTWA 5FKYA 1HL9A 4JL1A 1H1NA 2WVVA 1CBGA 2PWGA 4TOQA 1CECA 3NJ3A 3N12A 5IDIA 1FOBA 1JDCA 1VEOA 4CD5A 1XSIA 1OB0A 4Z2IA 2XGIA 1WPCA 5CQ1A 1LQ0A 3VKKA 1XCWA 5C71A 3HJEA 2D22A 1QHZA 3W38A 3UG4A 1E15A 3RM8A 3MS8A 1UD2A 1EHNA 3OGSA 3ARPA 1EH9A 1ITCA 1EGZA 5JBDA 3RO8A 2WYSA 2ZE0A 1VBRA 1HL8A 1GOMA 4MTVA 4ZFMA 1MVYA 4AEFA 2DIEA 1ESWA 2J8GA 4DUXA 4J3XA 2W66A 1V6XA 1C93A 2WCGA 3WL0A 1WKYA 2WKGA 1EIBA 1HF6A 2DT0A 2NT0A 3ARWA 5ABGA 2ZXQA 1UQYA 3GBEA 3EBVA 2E9BA 3VPLA 1R8LA 1JNDA 2WMHA 3BAYA 3W26A 1JD9A 1VJZA 4QLLA 1UYQA 3VINA 5CLTA 2ZIDA 1HJUA 1NQ6A 1BVNP 1R86A 1J0HA 2YL9A 2VRJA 3JUGA 2A3EA 1P6WA 3SCOA 1KGXA 4NZCA 1JL8A 2ZXBA 1HKIA 3VD5A 2WCAA 3M07A 4P8UA 4CVWA 3MMUA 3FY1A 2DSVA 5I3DA 2D1ZA 3U5UA 3MSGA 1GVYA 4RE2A 3ARVA 2DH3A 4W7WA 4MAZA 1H0GA 2CKRA 3BAXA 4L4PA 3A4WA 3VX0A 5FCZA 4KWUA 1I1XA 1TVNA 3BAKA 3AISA 1L0PA 1MXDA 3WUBA 3GNOA 5A69A 3N9KA 3VTRA 1DWFM 1PIFA 3WDIA 1UA7A 3BLPX 3VIGA 2DQXA 1V03A 4ACZA 1DEDA 1KR0A 5AYIA 1B0IA 1W9PA 4KGJA 4B3KA 3B8SA 1E0WA 5CZKA 1QNSA 3ZQ9A 1IZKA 2V5CA 3S6TA 1WDQA 3EMQA 2WLYA 4GIAA 4NRSA 3ZJ6A 4BA0A 2VX6A 1ZBWA 3OLGA 5EBAA 1GW1A 1V0KA 2V3GA 3WQ6A 5HBFA 3AIVA 1VFFA 4HOWA 2J79A 3ARYA 3TTSA 2WMKA 3D5HA 1ZU8A 1V3JA 1J0JA 4BZYA 2VNCA 2OSWA 2CBIA 4U33A 2CITA 1C8XA 4C7GA 4UQBA 1OINA 3WBEA 1CXIA 3LPGA 2AOSA 2BY2A 4UZSA 2CETA 3S2CA 1LLOA 3EYPA 6A3HA 1VAHA 3T08A 3N11A 3VIKA 3RM9A 1Y7VA 3MUY1 1J0ZA 3VU2A 1JF5A 3VDBA 1D2KA 2PC8A 3BSGA 4S3JA 3AXIA 3NUKA 4OJYA 3SEPA 2BS9A 2VZOA 5IFTA 2XSAA 2YL6A 3GTNA 2DEPA 3CZEA 3QOKA 2VX5A 1H4PA 4W5ZA 3KZSA 1QI2A 3W4RA 4MNMA 4UQCA 1UHVA 2WB5A 5A95A 2X1IA 3OGRA 1C92A 1HJWA 2TAAA 5GNZA 3WD2A 5IFPA 5A1AA 4HZ8A 1CENA 2YL8A 3WMCA 2ZUWA 1JG9A 3K8LA 4MPKA 1UR2A 3AZTA 2IXUA 4CN1A 3AIUA 5I0DA 1YHTA 1C7SA 3G6MA 4GI6A 3T2QA 4XX6A 2E4TA 2J7CA 4QCEA 3MUZ1 3SCSA 2FDMA 1QI0A 1QW8A 3UETA 3WH8A 4EAMA 2DT1A 4CU6A 2PWFA 3AIBA 2JF7A 2CYGA 1S46A 1WE5A 4H41A 3L4YA 4HTYA 2BVYA 1J01A 2VJXA 3WENA 2XVKA 3O6AA 4PMOA 1BLIA 2ZUMA 1H0IA 2XWDA 1VBUA 3OA5A 3PZQA 1UR0A 2VCBA 3UG3A 4D1IA 1B3XA 1LL7A 3PN8A 2VVSA 2D3NA 3CHDA 4WF7A 3WDHA 1J0IA 3I3DA 2VR4A 3HU7A 4TUFA 3A4XA 1KWGA 4AZCB 1EDQA 2J7BA 1EHAA 3FAWA 4TVDA 3A47A 4MB4A 2UY3A 3THCA 2WNWA 3THDA 3OGVA 1JDDA 4KRUA 1ZL1A 3VVGA 2CKSA 4DUVA 1E56A 1Q6GA 1CLXA 1JYWA 2NSXA 3VGHA 5D9NA 3FAXA 4BQ4A 3N18A 1NWUA 5A2CA 1BGGA 2YL5A 1LL4A 4A3YA 4UQDA 3BGAA 3SCWA 3WD1A 3VGBA 4W84A 1V3MA 1E70M 2JFEX 2GJXA 3K8MA 2ZX8A 4V2XA 1UD5A 2O9TA 3W37A 1XYFA 1AQMA 3L4UA 4CN6A 2WXDM 4UR9A 3W24A 4HMDA 4A4AA 4H7VA 3NDZA 2V38A 1E6QM 3ARZA 4M29A 4Z2HA 1WP6A 1ISVA 1RP9A 1TE1A 3WNOA 1GOWA 4J27A 4IPNB 4AZBA 2YOCA 2MANA 1CEOA 1UD6A 2ZXAA 1W3JA 3AHVA 3ZT5A 2W67A 1QHPA 4JFUA 4GI8A 4PMDA 1IV8A 1JIBA 4HPGA 3SURA 4W8AA 2EO7A 1WCGA 4TX8A 1XCXA 1GQJA 3POCA 1EXPA 4U3CA 3ZO9A 2X0YA 2YDRA 4JHOA 2BXYA 4U2YA 3T2PA 1E5NA 3M7SA 5AYBA 2VVNA 2FH6A 2ZUVA 2E9LA 4CGTA 4PMXA 3K1DA 4Y7EA 5A6SA 3AICA 4AD3A 3WDJA 1PX8A 2CXGA 5BXPA 3AXXA 3AHZA 1WNOA 1CGUA 3WNMA 4CU8A 4ATDA 2WHKA 3GM8A 5BRQA 2WLZA 1V3KA 1CXLA 2E0PA 1NARA 3A3HA 2YA1A 1H3GA 5EFDA 3BAIA 3ZT6A 1C91A 4UFKA 3LPOA 4PMRA 4E8DA 5GNYA 3AFBA 1EQCA 3VO0A 3EMZA 2G8ZA 2BNJA 4PN2A 5BXTA 2GK1B 4U2ZA 1OT1A 1V6VA 3CHFA 5I2UA 2E40A 3AMDA 1HT6A 4N0RA 3VNYA 1E1FA 1CXHA 4QLJA 2VX7A 4CD7A 1OGGA 4DWSA 2VX4A 4AIEA 4AD0A 2XFYA 2ZWZA 3CUIA 4CUCA 3WIJA 4U31A 1PX4A 4HA1A 3K46A 4J28A 3TOPA 1Q4NX 5HPOA 3AMCA 3HN3A 2C0HA 1W1VA 2YLLA 4P8VA 4M56A 3AOFA 1MFUA 1MXGA 1DWAM 1J12A 2WC4A 4EKJA 3BC9A 3VMNA 4HU0A 3SUTA 1E0XA 2OSYA 5BCAA 1WDRA 4FF5A 1E4MM 4NRRA 3WUFA 2ZOXA 2FHCA 3A4AA 1GOOA 1W3LA 1JZ8A 2DDXA 1ISYA 5EFFA 1ZJAA 2Y24A 4TTUA 3AS0A 2FGLA 4QAWA 1JYVA 1JXJA 3EDKA 1HXJA 1V0LA 2EPNA 3FNDA 1NP2A 3T0AA 1M04A 3GNPA 2OSXA 1TCMA 3FXYA 3PZNA 4H04A 1DTUA 1GVIA 4J3UA 1DP0A 1MQPA 4B9ZA 1UWQA 2VCAA 4AYSA 1VRXA 1O6IA 4UFIA 2F2HA 1UWTA 2C7FA 2GUYA 3AHTA 3KEHA 5CPQA 3WQ5A 2Z1SA 2CHNA 5A8OA 4JHZA 3NYDA 5GQBA 2VZUA 4J3WA 4P7QA 2YIHA 4IUGA 3MKKA 3AS2A 2WZHA 2VR5A 4M24A 3W6LA 2WM0A 3CBWA 3OLIA 4MB5A 5CPSA 4F66A 1M01A 3QR3A 2VZSA 4LGXA 3KE0A 4PUEA 3TP4A 1OBAA 2XVGA 3CLWA 4AZIA 1V3LA 1E6ZA 4B15A 4OIFA 3T2OA 4FK9A 4GZIA 2JALA 1PBGA 3PZMA 1XC6A 1W91A 4QFUA 3W25A 1V3HA 3O2LA 3BLKA 5HOSA 1BYBA 3D3AA 2QMJA 4OZOA 2WBKA 2WZEA 3GXDA 3L4WA 2O92A 4PSRA 4ZEPA 4WLCA 2E3ZA 1BSIA 2OWXA 1HN1A 3ZR5A 3IJ7A 2WK2A 3AJ7A 3RILA 2WVVB 3WL1A 1K9TA 4PTMA 3T0DA 4HZ7A 4BF7A 3VIJA 2XTKA 1E4LA 1KBKA 2BHYA 2ZUNA 5BYWA 2GJPA 3TONA 1NWTA 5FOOA 1FFQA 2G4FA 2HISA 1V6UA 3L4ZA 1VEPA 1JF6A 2YKKA 3B9AA 5CGTA 4W7VA 5BWFA 1ISZA 2J62A 2CHOA 2CNCA 4Q22A 4M8UA 1LWHA 1GORA 3CZLA 3BSHA 2D2OA 4XZBA 1XGZA 1OT2A 1QI3A 1G94A 4D6GA 1E0VA 4JCLA 1QHOA 1CGVA 4BCEA 2D20A 3AIEA 3WDQA 3N13A 2W63A 2DSUA 2QPUA 1W9DM 4LYRA 1O7AA 4YPJA 3U57A 1E73M 1W1PA 1G1YA 4CCCA 4M82A 4Q7NA 2F61A 4LYQA 3GDBA 3ZJKA 2DSKA 1V3IA 1E5JA 3SIMA 4MNJA 1GNXA 4AZHA 1PZ3A 1CWYA 3AS1A 3G6LA 1KXTA 3BCFA 2XIIA 9CGTA 4GINA 3POHA 3WSUA 1JZ7A 3N04A 4PTVA 2YBUA 4W86A 3WUEA 2ZUSA 2J7EA 2ESCA 4R27A 1J9YA 1KQZA 2E8YA 1MWOA 1DWIM 3SCVA 4XV0A 3CUFA 3PZVA 3VMPA 2EPLX 5JUVA 1CZ1A 1ECEA 5JBFA 4V27A 1PAMA 1JFXA 1QOXA 3DYPA 3PZTA 4UFHA 3KL5A 2WWDA 4RL3A 3SCNA 1GJWA 3ARUA 4JCMA 1FHLA 3CZJA 2WANA 3VD4A 4W89A 2VI0A 3WF4A 1XV8A 4JIEA 1KCKA 1UWSA 3AMLA 1JZ3A 1JFHA 3TTQA 3AXHA 3ZSTA 3WELA 3CMJA 4UZUA 1EO7A 2FH8A 4MJ2A 4MNKA 4OUEA 2WSKA 1VB9A 4P8XA 4J3VA 3K4AA 2J4GA 1W1TA 1VEMA 1JGIA 2W62A 1TMQA 4PUDA 3BAWA 1FH8A 1FH7A 1XH1A 2FHFA 1A3HA 3DYOA 3VMOA 4WSKA 2GJRA 1CYGA 1V6WA 3EDFA 1WZAA 5A2BA 1ZBVA 4JKKA 4UQAA 5D9PA 3FHAA 1VENA 3IK2A 2J7DA 2EEXA 4IM4A 2CESA 5HNNA 1J10A 3VDCA 4TXEA 4PCTA 2BVDA 1C8QA 2X09A 1MQQA 2G3JA 3CMGA 2D3LA 3EDEA 2ZX5A 3PHAA 2WVTA 3ZJ8A 5A6LA 1UOKA 5ECUA 2D24A 3KL3A 1UH4A 1N82A 5GPRA 5AY7A 4PSPA 3ZR6A 3WQWA 1GCYA 3WN6A 2V3DA 3VM7A 4X0VA 3B9EA 1V6YA 5A6KA 1E3XA 4W85A 2WW5A 4PBGA 1XSKA 4AD4A 8A3HA 1KQYA 1XHGA 1FHDA 3ARTA 3O9NA 2ZWYA 1EOMA 2VQUA 5BRPA 1BGAA 4WIWA 1JAKA 5ABEA 2GFTA 1UZ1A 3VIHA 4EK7A 3VUPA 1IT0A 4MB3A 2JIWA 5DT7A 1KXHA 3RJYA 1ODUA 1HKMA 1TA3A 1BPLB 2V5DA 2CPUA 2OWCA 4YN5A 2WHMA 4JFTA 1JI1A 1TR1A 1GOIA 2OYKA 4H8UA 3CPUA 2DH2A 1PEZA 5FIPA 3ZIZA 1QNQA 2ZICA 1VF8A 5I24A 1AQHA 4H2CA 1NOWA 3OZOA 2Y2WA 4FMVA 5JIPA 1NOUA 4CD8A 1C90A 4WJXA 2WMIA 1VFOA 3CTTA 1KWKA 1MW1A 4UTFA 2VT0A 5I23A 1BYAA 2BY1A 4LXFA 2WMJA 4FLRA 1W1YA 1E6NA 2JIEA 3ZM8A 2PWEA 3U5YA 5LA2A 1Q6EA 3II1A 3APGA 2UY5A 1R85A 1JYNA 3DC0A 3MANA 2F8QA 1JZ6A 2JEQA 2VOTA 3BCDA 4J7RA 3WF3A 2WHJA 4D6IA 2G41A 4D6DA 3VIPA 3WKZA 4MDOA 1IZJA 4W87A 1F4AA 3CUJA 1UWIA 3UR7A 2EQDA 2GDUA 4AMCA 5BROA 3SCRA 2FGZA 2E9MA 4LPCA 3VGGA 1L8NA 3WH9A 2GJXB 3VD9A 3GYCA 2DSWA 2Q8XA 4W8BA 2UY4A 3SUVA 4U3AA 2J25A 3MO4A 5JIWA 4H8VA 1K9FA 1I75A 5D8ZA 3QHNA 2QPSA 3N1AA 1RD6A 1XD0A 4CD6A 3OLEA 3MMDA 4N42A 1SYTA 1HKJA 1KXQA 4HPHA 3VGDA 1Q6CA 1XSJA 3MV01 2GSJA 4BQ2A 1HIZA 3WF0A 4GKLA 5A6AA 3PZ9A 2PWDA 3MU7A 4WKFA 3AS3A 3UEQA 4AD2A 2XUCA 4V28A 3UG5A 1H09A 5GNXA 5E0CA 2WHLA 3F5JA 1W3KA 2O9OA 2ZUTA 4BS0A 1WZKA 2XPKA 3FN9A 5KEZA 3CGTA 3I3BA 1KGUA 4AIUA 3WEZA 3VIOA 5E09A 1CPUA 2V3EA 3VIFA 3T09A 1C7TA 1D7FA 2YDQA 1UKTA 2Y8KA 3UESA 4S3KA 5ABFA 2AAAA 3WBAA 4CN4A 5A94A 3RJXA 1Q6FA 3BH4A 1HVQA 4PMYA 1CNVA 2VO5A 5DFAA 1CIUA 4GQRA 1E6SM 1V02E 1QNOA 4KGLA 1GHSA 3WH7A 2WCSA 1CGYA 5I77A 3IANA 5E9AA 3VILA 3IJ9A 4FLOA 4JKMA 5IXEA 3GNRA 4KMQA 4UQEA 1UKPA 1GHRA 3N15A 5E6ZA 1QI5A 3DHPA 3WNNA 1ZBKA 3NSXA 4A3HA 4OKDA 4WK9A 3VX1A 4QLKA 4CCEA 1H2JA 3WUGA 3SCTA 4DWSB 3F5LA 4KH2A 2UY2A 2GDVA 5CSYA 3M6DA 3VOCA 1FA2A 3NDYA 2EXOA 1ZBCA 3IAQA 1ISWA 1JZ5A 1VIWA 4F79A 2CBJA 2WPGA 4OOUA 3VNZA 3W82A 2DIJA 1UUQA 1UQZA 4CCDA 2BV9A 4AIOA 4D1JA 2YDSA 1HNYA 4E8CA 3AIWA 5A2AA 1LJYA 1NWSA 2X2YA 1BG4A 1E3ZA 1V0MA 3ZT7A 4WSJA 1UD8A 1LF1A 4F9DA 3PZIA 4CD4A 1C3FA 1OIFA 4QDMA 4M1RA 2QF8A 4URIA 3LMYA 1TVPA 4UNIA 2BXZA 3VDHA 2A3BA 1EQPA 3N17A 5EB8A 4AZGA 3AIRA 1E71M 3SUUA 4HA3A 1JXKA 2VCCA 4L4OA 3RIKA 1W2PA 4NF7A 4QCFA 4QP0A 3OZPA 4FLQA 2NT1A 2PBGA 3MSDA 4CVUA 4AY1A 1E6XM 2W91A 1H11A 1M53A 1WZMA 4GO8A 3SCPA 4C7FA 1HVXA 3W6MA 4MAVA 3AYSA 1MQRA 4AXNA 1RP8A 1U33A 1DHKA 3L2MA 1H41A 1QVBA 2YLAA 4ATWA 4H8HA 4CKQA 1LG2A 5C8BB 2WWCA 5I5RA 1B90A 4HA4A 4NSBA 1MW2A 3WD0A 4CU7A 3QGVA 1B1YA 3T0BA 3SCQA 1K6AA 2A3HA 1W2VA 3AHYA 1EOKA 2BY0A 1J18A 4C7DA 1BHGA 1B2YA 2HVMA 1VJSA 1DWGM 3OLDA 1RH9A 3CH9A 1B3ZA 4GZEA 3TA9A 4TX6A 3VGFA 3L4TA 1BG9A 2J7HA 1J11A 1WAWA 1EDTA 1V08A 4UFJA 4P7RA 3U7VA 1PIGA 3MMWA 4AEEA 4WKHA 4AD1A 3IJ8A 2CEQA 2ZX6A 2FHBA 4W7UA 3WF1A 2EJ1A 2J47A 2VZTA 3SUWA 2IUZA 2YBTA 3OBAA 3I3EA 2OLHA 2WZIA 5A8MA 1WZLA 2CBVA 4W5UA 4LX4A 4DM1A 3MUIA 2RGLA 3WNKA 1NH6A 2BY3A 1GQKA 3BMVA 4B3LA 3GH7A 5A6BD 8CGTA 1U2YA 1U30A 2EBNA 1F4HA 1B3YA 1XD1A 3L2LA 2XSBA 3F4VA 1CGXA 4Z2KA 4D6JA 4E2OA 2CIPA 3AI0A 3VD3A 5M17A 4HMEA 4KRTA 3RDKA 4D6EA 1SR0A 5CXPA 1US3A 4PMVA 1B3VA 3QHMA 3RMEA 4PMUA 1SMAA 3ZOAA 1EDGA 4MDPA 2VURA 5DMYA 1R87A 2XIBA 5IHSA 2RGMA 1E72M 1R7OA 1W9VA 4F9JA 4HOZA 1YQ2A 5LYRA 1UKOA 3EDDA 3WEOA 1UZ4A 1BYCA 5D9MA 1PX3A 4R5EA 3PZUA 5DEZA 4F8XA 4JFSA 3CZ8A 4AZ5A 1B3WA 3WNLA 1JNEA 3FW6A 3W0KA 3OG2A 4GPNA 1OGSA 4J3SA 3GBDA 4GQQA 1J0KA 1GONA 4BQ5A 5CGMA 3AYRA 3E1F1 2QHAA 4HP5A 1TZ7A 4W8LA 5A8QA 3MUAA 3OB8A 1OGBA 2XVNA 4TVUA 5M03A 3BXWA 4ACZB 1A47A 4P7NA 4PTXA 1D3CA 3CUHA 2YA0A 1NP0A 7A3HA 1W9XA 1WB0A 3PZGA 4U5KA 3WFZA 2VRQA 3RCNA 4NI3A 1HJVA 3A6OA 3PTKA 5CG0A 3B9DA 3ZJ7A 4YHEA 5KZ6A 3LPFA 1FP8A 1DWHM 1QNPA 1H5VA 2A3CA 1Q6DA 5CSUA 2XVPA 3VIMA 2J75A 2XFFA 2OWWA 1JDAA 2CBUA 3OIHA 2BHZA 2QLYA 1PJ9A 5FL1A 1ITXA 2XJ7A 3VIIA 5D9OA 3GXIA 1X6NA 5DT5A 1E1EA 4ZE5A 2W92A 3ALFA 1BF2A 1W9BM 4IISA 1MYRA 3GZAA 4ZXLA 4AW7A 3AZSA 1V02A 5A8NA 1LG1A 3BAJA 4ZENA 1QI4A 3PZOA 3NSNA 3W29A 1QBBA 3AQUA 1OWQA 1UG6A 3K4DA 4UCFA 1AVAA 4GZJA 1AMYA 1JAEA 4D6HA 1HP4A 4XZWA 1EO5A 1CTNA 2D23A 1KBBA 4WKAA 2YJQA 3F5KA 3AHXA 2BFGA 4JFVA 4DM2A 3WD3A 1BTCA 2UWFA 1GQIA 5E6YA 2DPEA 2O9PA 4PEEA 1K9DA 1QW9A 1KR1A 4LYPA 5FL0A 2XM2A 5F7UA 2D0HA 3LPPA 1W3HA 2WVSA 2J77A 5I6SA 3AIQA 1QBAA 1MW0A 3BMWA 1BYDA 2BHUA 2Y4SA 4PCSA 3ARXA 4Z2LA 1CGTA 1BAGA 1QNRA 5ABHA 4DWSC 4X9YA 1UR9A 4RE3A 3U7BA 3CHEA 4HMCA 1E4IA 1KCLA 1MFVA 1B31A 3PTMA 1W32A 2G3NA 2WMFA 3QOMA 1ZB5A 3UR8A 3WDPP 1VFMA 1E6RA 5HPCA 4W88A 5A8PA 4AZCA 4ZE4A 3CIVA 2DT2A 1ZS2A 1EA9C 2EPMX 7CGTA 1OSEA 2VUYA 4ML4A 3NSMA 4AZ6A 4TVCA 2VMFA 1CXFA 2PF0A 1E40A 1XH0A 3EMCA 3WH6A 1QPKA 1TA3B 1BQCA 2QMKA 3CUGA 6CGTA 3PBGA 2VZVA 4OBSA 4AD5A 2WKLA 4UFMA 1US2A 3GH4A 2PI6A 4MNLA 3W27A 2XVLA 4AZ7A 5A6MA 1WDPA 1R7AA 2D0GA 2W5FA 2WVUA 3VGEA 4Z2GA 1W9UA 5FD0A 4PMQA 6TAAA 4EANA 1JZ2A 1ODZA 2J7GA 4ACYA 3WEMA 1GZJA 4M81A 4JFWA 2Z1KA 1V0NA 1WO2A 3GH5A 2WMIB 1OD0A 5E0FA 5IHRA 3WMSA 3WDRA 3AMKA 3J7HA 1BFNA 3L4VA 3DYMA 2X0HA 3ARRA 1TFVA 1TG7A 2G3IA 1K9EA 4PMZA 2A3AA 4RE4A 4U5IA 1NWRA 2VQTA 3UCQA 4W93A 1UD3A 2W4XA 5BXSA 1PZ2A 2VTFA 4K68A 1J0YA 3GXFA 3RPMA 2CCRA 1KFWA 1LL6A 4PYSA 4MJ4A 4FLSA 2X05A 2X8RA 1CGWA 3AROA 4D72A 1WDSA 2VC9A 3ECQA 1G9HA 2XM1A 1GOQA 4Z2JA 1UD4A 1C8YA 1XYZA 5M5DA 5D8WA 4BQ3A 5D4YA 4GO9A 1E9LA 3TTOA 4HU8A 1JZ4A 5I78A 5DF0A 1NOFA 1VFUA 2YA2A 4AC1X 4J3TA 5I79A 1B30A 1OIMA 2W61A 2XGBA 2PBOA 4AISA 4TTGA 1KGWA 1DWJM 5A6JA 5E70A 1I1WA 4B9YA 3WNPA 4P7LA 1UH2A 1M7XA 5TD4A 1UH3A 1GUVA 2OYLA 2XHYA 2BVTA 2C8NA
chains in the Genus database with same CATH superfamily
4B5WA 3VNIA 1DPMA 1TELA 2PLMA 2EPOA 3DENA 3ALGA 4GI9A 1SFJA 1UR8A 4AG0A 5CGQA 4JQ2A 2YGYA 1OM0A 3KZPA 3UR2A 3TAOA 5CSRA 2R8WA 4MZ8A 1YNPA 5KMYA 1XLFA 1CXEA 1VIZA 4J5NA 4YVPA 1UWRA 1UWUA 3U2EA 4A3RA 3W75A 1KXVA 3STGA 2EF9A 3NQGA 1UR4A 4E2BA 4GQGA 1E1CA 3FYPA 2PWHA 3TYZA 5DY3A 4INFA 3O6YX 2WSPA 2OMAA 4AVFA 2FJKA 3GWQA 3PJTA 3UA4A 3TTYA 4H01A 4YXGA 4FOJA 1SR9A 3L4XA 1EEXA 5G5IA 3SN4A 5B7ZA 4I6VA 3PFMA 1TPDA 3GAYA 5DO8A 1K77A 4XIMA 3DBNA 1RSCA 3VM5A 5AC5A 3U2CA 4AWEA 1AZ1A 1A5NC 3BG9A 1TRDA 4ZOBA 3TROA 2E8ZA 2HRWA 4FXSA 1FCUA 3TU9A 3GQYA 2CERA 2ZXDA 1M03A 5M3WA 2G95A 4E4PA 1JCNA 2QPXA 1B9ZA 1XG3A 3C2VA 1ISXA 4UQ9A 3NO1A 1L6YA 2GGGA 3PPHA 2EPKX 4CLMA 5JBEA 1BVZA 4UOZA 5LNUA 4K3ZA 4Z17A 3MA8A 1GKRA 3VZZA 2BXVA 1ITQA 4XUYA 1FFRA 4OOZA 2HE5A 4E6MA 1CXKA 4QBXA 4GQBA 3UYIA 1XIFA 2O7QA 1I2QA 4JTEA 3NQAA 1TVLA 3UGRA 3VI2A 2RDXA 4ATLA 2J7FA 3AMGA 1WXJA 4MKNA 2YBVA 3O1NA 1LLWA 4ZB5A 1UR1A 1HJQA 4XZIA 3LUTA 3RM4A 2GVGA 3A22A 1GOKA 1UKSA 4Y9MA 3VDAA 2IXVA 3T78A 5FJUA 3WF2A 1TUXA 3BPWA 4PTWA 3L12A 4MVAA 3VFLA 3TK7A 3Q45A 1UUMA 3RPDA 1K70A 3ZFHA 5FACA 3UPMA 4PB4A 3EKGA 2R1KA 5D03A 1AFSA 4WDXA 3XISA 4N02A 1VEOA 4CD5A 2XGIA 1WPCA 3TXVA 5FEZA 5CC3A 1XCWA 5C71A 2PDIA 1S38A 3HJEA 3W38A 1QHZA 4TX9A 1SJAA 5JBDA 3RO8A 4W9TA 2Z1XA 3NOYA 4U28A 4XSMA 1AW1A 1H7XA 4FR1A 1ESWA 2J8GA 3NQFA 3IJDA 1EWEA 1RK6A 1JRBA 3P5YA 3WL0A 1WKYA 2OEKA 2H9AA 2PMQA 2IQ0A 1EPXA 2DT0A 3OW1A 3EBVA 4K2SA 1JNDA 2WMHA 3UA3A 1GEHA 4GXWA 1XLCA 4JNMA 3V5OA 1R2RA 2YL9A 2VRJA 5CZTA 1S1PA 5HNRA 4NZCA 4RZ5A 4QDPA 2ZRYA 3R0UA 1HKIA 3VD5A 2E1WA 1ONXA 3AU2A 1KRAC 3FY1A 4M6UA 3U5UA 5C9UA 3GLCA 3TYUA 2ON3A 3AC0A 4OGZA 3L68A 3BAXA 1GVRA 1LROA 1VS1A 3A4WA 5JH2A 5FCZA 4S3FA 3BAKA 3WUBA 4XAPA 1DJWA 3HG2A 3FSUA 3WDIA 3BARA 3BLPX 3VIGA 4DZAA 4UNKA 5EL1A 5I06A 2QUUA 1DEDA 1B0IA 1AL7A 4KGJA 1SQ7A 4I7UA 5LNSA 4H9MA 3B8SA 1E0WA 1KFKA 3N29A 2V5CA 1H62A 1H7PA 1AODA 2FVMA 1QO2A 2YB4A 5CCZA 4HPJA 3QQ0A 3P0WA 2FTPA 4IIGA 4S3AA 3OYXA 4GUIA 4GCXA 3W1QA 3WQFA 3N14A 4S3DA 1QK0A 2WMKA 1ZU8A 3MQTA 1UBPC 2NQZA 5F4SA 3FX4A 2OLAA 5FJRA 3S9YA 5BZAA 2OSWA 4KETA 2OQYA 2HBXA 2CBIA 4U33A 3SI9A 2CITA 3USBA 3UZJA 3DFPA 3F1QA 4H6EA 4UQBA 2Y7FA 4F2UA 3WBEA 4NT0A 5FI8A 2BY2A 5DCBA 4UZSA 2C1IA 6REQA 5I3HA 4KW2A 3VIKA 3QXBA 4B91A 4JQ4A 4I7WA 4DXXA 2PC8A 3BSGA 3AXIA 1W31A 2V2DA 1FDZA 5EBUA 4Q8MA 4OJYA 3IJIA 5TNVA 3SEPA 4GX9A 5EKYA 5IFTA 4BWLA 2JKEA 2XSAA 3GTNA 3VCNA 4PBFA 4YMZA 2QJHA 4G8TA 4MNMA 1UHVA 3HQ1A 2X1IA 3OGRA 3NQ8A 5C9RA 3WD2A 2DUXA 2QCMA 1CENA 1TO3A 4UXDA 1UZDA 5HAOA 2YL8A 2QUVA 2ZUWA 3LI1A 4MPKA 1JULA 3AZTA 4ZO9A 1JJKA 3M16A 4K7VA 1C7SA 2R24A 4ERGA 4QCEA 3ZR4A 3MUZ1 1XYAA 3CPRA 3UETA 1M3UA 1Z6KA 1TYGA 1UIOA 4CU6A 2PWFA 3AIBA 1DIEA 3RFAA 3RN6A 3TDFA 1O68A 3L4YA 2BVYA 1J01A 4I9AA 1QCWA 2Y89A 3WENA 2XVKA 4PMOA 1ME8A 1RCQA 4FNTA 1ECQA 4XTDA 3UG3A 4D1IA 1XX1A 2IKHA 3PN8A 2ZBTA 3WDHA 1LOQA 1Q2SA 4PMJA 2PUZA 4JNYA 1FWGC 2VR4A 4HPXA 3DCPA 1EHAA 1QPOA 4MB4A 2UY3A 3W2NA 1AK5A 4C6DA 4I8YA 3KS5A 3THDA 1JDDA 3THAA 3B3DA 1E56A 1Q6GA 4R3UA 3LI0A 1JYWA 1AQFA 5D9NA 3TXZA 1NWUA 4M0XA 2OGYA 5LIYX 1BGGA 1LCOA 4A3YA 3BGAA 3SCWA 1XIBA 2Z0IA 4ZMGA 4L1XA 4W84A 3R0DA 2ZC8A 3I6EA 4OHQA 4JQAA 5AOUA 4MFDA 3KW3A 3W37A 4H8NA 3SJ3A 2CLPA 4FR6A 3GVWA 4UR9A 3NQCA 3ZXWA 5AC6A 2WQDA 2D73A 3BDKA 4H7VA 4Z2HA 4GBDA 1TE1A 1BKSA 4U4MA 4PE8A 4J27A 2PDMA 4AZBA 2YOCA 4LANA 5T8GA 2Z4GA 1W3JA 4IMGA 4JIRA 5HUOA 3URNA 1JCMP 4OTKA 4PMDA 4HPGA 4XKYB 1T0OA 3RUBL 1WCGA 4TX8A 1L2QA 3I65A 1H7WA 3POCA 1X7IA 4CNNA 1ZTVA 3ZO9A 3BL3A 4DAFA 4U2YA 4A05A 2REQB 3T2PA 1E5NA 2YSWA 1CT5A 2NQLA 3ERPA 3UD6A 2ZUVA 2E9LA 4MGGA 5LGXA 4CGTA 4IIHA 1EBGA 3ITYA 2PZNA 3PUDA 3AICA 3WDJA 5DBTA 1CI1A 1J2BA 1RALA 3QC3A 3S9IA 3A5VA 3WNMA 1Z7AA 4YTTA 4IIFA 1XFBA 3GM8A 5C7VA 2WLZA 1V3KA 3NL5A 1CXLA 2E0PA 4K36A 1W5QA 1KCXA 2WO5A 3S5OA 3WK2A 7TIMA 3BAIA 3LPOA 9XIAA 1EQCA 1OK4A 2BNJA 4PN2A 4YNGA 1M7PA 4C6NA 1NF7A 5I2UA 4N0RA 1E1FA 4CD7A 1U5JA 1K6WA 1LBLA 5E5CA 5CSSA 1UC5A 2YX0A 4U31A 3M0HA 4QGCA 4KIRA 1K4HA 2MNRA 1FKWA 3K46A 3KBSA 4UTJA 4O52A 3AMCA 2P3EA 1S5TA 1DORA 1NU5A 2VGIA 4P8VA 1WUEA 2Z6IA 1MFUA 1MXGA 3NM3A 4J9JA 3URBA 4C6JA 4RW3A 3NO3A 1J12A 2WC4A 5KSWA 2Z29A 1EYEA 4GYPA 4Q4KA 1XLBA 2OXNA 4IL2A 4K39A 2FIQA 2GUUA 3QLDA 1JZ8A 1HUVA 5DXXA 1ISYA 4B3ZA 4A3QA 2Y24A 2QCEA 2D2HA 3IRDA 4IT1A 3V4BA 4F48A 4KWOA 3BG3A 1Z41A 2EPNA 3BTNA 1TQJA 5IBXC 1NP2A 1M04A 3FXYA 3CV6A 3S6OA 1RQEA 4DPQA 1DTUA 4IIBA 3H7VA 4J3UA 3P74A 3G0SA 2PEVA 1RBAA 2Q3RA 1EFZA 1VRXA 4LSBA 1HQTA 3AHTA 2QF7A 4C6PA 4Q4QA 2CHNA 5A8OA 3WQCA 4CNOA 2VZUA 1TQXA 4PL1A 2WM0A 4YCPA 3OLIA 1NJJA 4M6VA 4MB5A 4F66A 1M01A 3QR3A 4HHMA 5FA5A 2XVGA 4L56A 3STPA 4XD6A 2X40A 2ZE3A 4AZIA 4O1CA 1V3LA 3LTSA 4OIFA 5F2LA 1MDLA 2JALA 1XC6A 2XSXA 1W91A 3FVMA 2VC6A 1V3HA 2JGQA 2DVUA 3BLKA 5HOSA 3GSMA 2WZEA 4LY8A 2QGHA 3GXDA 3VABA 3L4WA 3EB4A 4WLCA 5D05A 1HN1A 4FNRA 2RJHA 2WK2A 5HR6A 2ZZ7A 2XN1A 1O1ZA 1K9TA 3TR2A 3LHUA 3SJNA 3OA3A 1LT7A 1P6CA 5HA7A 5BYWA 3UCCA 4IMEA 5FOOA 2HISA 3H2CA 3HQPA 1VEPA 4LS0A 5DELA 1LUCA 4KCVA 3B9AA 3FV9A 5CGTA 4W7VA 1ISZA 3FIGA 4ORIA 1LYXA 4DB7A 3SY5A 3VOJA 2OU4A 5EA9A 4Z1YA 1OT2A 1G94A 4OV9A 3RX4A 3N13A 1DBTA 3CUXA 2QPUA 3WK1A 1G1YA 2NV1A 3R10A 2DSKA 4W4QA 5AVHA 4C6QA 2FJUB 3H53A 1EJRC 3LCHA 3SN0A 4DRSA 1Q2RA 4AIBA 4CQBA 5IM51 1FWRA 1JZ7A 3N04A 4PTVA 5J8LA 2YBUA 3WUEA 2ZUSA 1H7RA 2WZMA 1J9YA 2E8YA 3SCVA 3WQGA 4FB7A 4HU4A 3G1FA 5JBFA 4QIUA 3DYPA 1GZ1A 2ZZ2A 2DUAA 5HNUA 4UFHA 2O56A 3KL5A 2B7OA 4OU1A 3MP5A 2H90A 3O0FA 5DCEA 3EWDA 5IBXA 4D9PA 2HSAA 4A8NA 2VI0A 4Q4SA 1UWSA 1TTQA 1JFHA 5LIKX 2EJAA 2DZBA 2OPJA 4IFOA 5HWNA 2HXTA 4QEHA 1EO7A 2FH8A 5B80A 4OUEA 3A21A 2QDHA 1UUOA 4JR5A 3KCLA 4OUIA 3ITTA 1J96A 3PFRA 1RY8A 1FH8A 1FH7A 4LU0A 2CU0A 1GVEA 1T8QA 1XQKA 1A3HA 3DYOA 4US6A 4H00A 4WSKA 3T81A 4JPGA 2NQHA 1CYGA 3EDFA 3KHDA 1ZPTA 3KUMA 1TIMA 1U22A 2EEXA 5CJMA 2CESA 4ZCWA 3SIZA 3MHUA 4ZODA 4TXEA 2X09A 1MQQA 3W7JA 3CMGA 5C54A 5CKSA 2ZX5A 3R58A 1REQB 4N9DA 1UOKA 1TX0A 3LENA 2AQVA 2J6XA 1PTGA 3WLIA 4H9TA 1UMYA 2FMOA 3UVAA 3KL3A 4ILSA 1N82A 3R5EA 1XLGA 5GPRA 5AY7A 2ZRVA 3U9IA 1OYCA 3B9EA 4PZVA 2WW5A 4Q8UA 4ZTXA 2BGNE 2IW0A 8A3HA 3ARTA 3AWOA 4NKCA 2GSEA 4GA8A 2VQUA 5BRPA 3G0UA 1BGAA 3KBWA 5ABEA 1UZ1A 1F74A 3P2VA 4EK7A 4ZQOA 3LQGA 3TX9A 1IEVA 1Z89A 4EWND 4WDUA 5L9FA 1A5UA 3AWNA 5I3JA 3QV7A 1E9IA 2VKZG 4JFTA 1VKFA 2DH2A 4HSOA 3V75A 1YIXA 4FIQA 3G8RA 2HPIA 2C1HA 1X8CA 4UB9A 4CD8A 3UWQA 2PGFA 3BMXA 3UZZA 1KWKA 3W7GA 4AUBA 2VT0A 2NQJA 3TKFA 1EC9A 1W1YA 2JIEA 1EP2A 5LA2A 1Q6EA 2PF8A 5I7GA 3C0SA 2F8QA 4N7QA 1U1JA 2Y0FA 5DX7A 2JEQA 4ZQPA 3RU6A 4J7RA 2E1DA 1WAUA 2WHJA 3GW3A 2G41A 1KW1A 3WKZA 4LUTB 1GVFA 1ZFJA 4RLIA 2OEJA 3AUJA 5H8UA 3MYOA 4GX8A 3TEVA 3UR7A 4MKVA 3S6DA 5EMMA 3W2LA 3O05A 3R94A 4I5XA 2VEKA 3C86A 2QS8A 3A13A 1L8NA 5C9ZA 3WH9A 3EAUA 1A3WA 3GYCA 3R13A 1I0DA 3SUVA 3VKAA 1DOSA 3MO4A 3EB3A 5H1WA 3TW7A 2ZZ1A 2XN2A 4RXGA 3GHSA 3WLPA 4XBJA 3WX7A 4JQ1A 8XIMA 1XQLA 1RD6A 4MWAC 1XD0A 4WUIA 3GIYA 3GW0A 2DZSA 3G24A 1TJRA 3NAVA 4IOTA 3GHUA 4JN8A 2HZGA 3W76A 3LBOA 1TJPA 3WF0A 5A6AA 1XPGA 5C6MA 3AS3A 5HWJA 4V28A 5GNXA 5DN1A 3FLUA 3U8GA 5E0CA 4RKAA 3F5JA 1W3KA 2O9OA 3LGGA 2ZUTA 1WZKA 2P8CA 2P8BA 1PHWA 4IIDA 3CGTA 4QQ3A 4AIUA 3VIOA 3VIFA 5ABTA 2W79A 1C7TA 1UKTA 3OTRA 3PG8A 4O1FA 4S3KA 3D6NA 2WJFA 2AAAA 3WBAA 4UUIA 4UTUA 8TIMA 3UW6A 4QE1A 3MZNA 3QYSA 1S39A 1V02E 4N2YA 1BXCA 3WH7A 2WCSA 2X42A 3T8QA 1E0UA 1KFJA 4UQEA 1SSDA 1GHRA 3N15A 2CLFA 1EP3A 3RLVA 3DHPA 3L0GA 3IACA 1XLEA 4OKDA 4WK9A 4GIEA 1FUYA 2C19A 3Q4DA 1H2JA 1FWNA 5HQEA 3F5LA 4DWSB 4FOKA 1UJQA 1J5SA 3NVDA 3VOCA 1SFTA 1ISWA 4MLJA 3QY6A 5I03A 3ZZ1A 3OHIA 3RO6A 1TTPA 1DTNA 4G6CA 1NWSA 5U4NA 2X2YA 2OJPA 4WSJA 3PZIA 3GNNA 1XIDA 4M1RA 2BXZA 4LUYA 3GU1A 5DQPA 1EQPA 3N17A 5EB8A 1LP6A 2DZWA 1K8ZA 4AZGA 2PDLA 1BWKA 5HJLA 1W2PA 3LHVA 5JXQA 4CVUA 1HL2A 3C0JA 3O63A 4AY1A 4OVXA 4UWMA 2HV5A 3LXBA 4Y8FA 4ZQNA 3PNZA 1JPHA 2FMNA 4L4LA 4OE7A 4UTWA 3KTSA 3W6MA 3KOWA 1P0KA 4AXNA 1R3TA 4E4FA 1ZGDA 4JNZA 1H41A 2E25A 2QJJA 4H8HA 3XINA 4NX0A 3LCGA 5PTDA 3CAQA 4CU7A 3T0BA 1M6JA 2J9XA 1AUSL 1W2VA 2B7NA 1UB3A 4L9XA 2BY0A 4ZB2A 1J18A 4C7DA 1B2YA 2HVMA 1DWGM 1A0DA 3QQ1A 3W7OA 3L4TA 1EDTA 1TPWA 1V08A 2ZRUA 4C60A 4UFJA 4AHOA 4WGXA 4AEEA 4AD1A 1TB3A 2FHBA 4W7UA 2J47A 4TO8A 2ACUA 1VC4A 1NIUA 2YBTA 3I3EA 4D8ZA 1DHPA 3MUIA 5TQLA 4GISA 1NH6A 1GQKA 1Z69A 3EKZA 3TMQA 1U2YA 1FRBA 4DO5A 2V30A 3C56A 1XD1A 1P7TB 3L2LA 1F61A 3NO5A 4P61A 3TLQA 3EX1A 5G1MA 2RFGA 3AI0A 4LCSA 3RDKA 1YXYA 4D6EA 5CXPA 5FJPA 1ELSA 2CLOA 3VZYA 4DPPA 3QHMA 2Z24A 3L0KA 1R9XA 4X2PA 5DMYA 1R87A 5IHSA 3L5AA 5J5RA 3RGTA 4LV4A 1UKOA 1UPMB 3CHVA 2FPYA 4MMWA 4IQLA 4DN1A 3P81A 1QRQA 1UBSA 2G96A 3CZ8A 1B3WA 4L61A 1RVGA 3WNLA 1WA3A 4YTUA 2BOFX 3W0KA 4WX2A 2Y8UA 4GPNA 2HVOA 3QFEA 1J0KA 1R38A 1I2PA 1AH0A 1QO5A 2PTDA 4W8LA 4IMFA 4M51A 3TMLA 2BGQA 3KCOA 2DU2A 1OGBA 1F3EA 1LLZA 2Y63A 1GTEA 2DJLA 5M03A 4TVUA 5G2HA 3BXWA 4O0ZA 2XIOA 4LW7A 4FXJA 1A3XA 1M41A 1RD5A 3CUHA 3R11A 2YA0A 1W9XA 1FWTA 3EOLA 4RDZA 3PZGA 3WFZA 1VFTA 4IP5A 2XH7A 1R6WA 5XIAA 2GOKA 3B9DA 3ZJ7A 3W2KA 2INZA 4FOUA 4TMCA 1N7KA 5CSUA 4KT2A 2XVPA 2J75A 1TIWA 1IIHA 3OIHA 5LHFA 4IXXA 2XJ7A 1POKA 3GXIA 1O5KA 1UW9A 1E1EA 4ZE5A 2Z1VA 2OT0A 1W9BM 1FHVA 1FX6A 1EZWA 3AZSA 1SPQA 3IUIA 3M44A 2MUCA 1OWQA 4K1GA 1GKPA 2V5JA 1AMYA 4D6HA 1K8XA 3L23A 1CTNA 2D23A 1KBBA 3LHYA 4FI4A 2YJQA 4WKAA 2OTDA 3LN3A 1Q66A 1RJRA 3CH0A 4DM2A 1XYCA 3WD3A 3RXZA 1BTCA 2UWFA 3WQPA 3UR5A 3MCMA 1EP1A 1KR1A 5FL0A 4O1BA 1RHCA 2D0HA 3LPPA 1W5MA 3LRLA 1MW0A 1W56A 3NXFA 3VXGA 5LNRA 1NFBA 1YLVA 3UNTA 4PCSA 1A5CA 3ARXA 4RZ6A 1P0EA 1Y65A 3B8VA 1QNRA 4GNVA 3W1UA 3LTYA 4HMCA 1E4IA 5FEWA 3FEQA 2UBPC 2PDQA 3PTMA 2G3NA 2WMFA 4JYDA 2C3ZA 4FSAA 6ENLA 4O8RA 4ZBCA 3WDPP 4JX5A 1GYMA 4S38A 1A5KC 1SO5A 4HN4A 3TQPA 3L2IA 3R7MA 4JTUA 1WKFA 3ITOA 3G1RA 2NWRA 5HANA 5EPDA 2DT2A 1EA9C 5I07A 3LBMA 1LM1A 4TVCA 1YW1A 1CXFA 2PF0A 2VDIA 1E40A 5F4XA 5I09A 4S2BA 3WH6A 1R3RA 2PDXA 1A4MA 2ZC1A 3CUGA 4OBSA 4C6EA 1WDPA 1C9WA 2WVUA 4JTFA 5HATA 1W9UA 5L6UA 1AD1A 3TSDA 4EANA 3GE7A 1PHQA 2ZRXA 1Q85A 4ACYA 4HHPA 1SO4A 4M81A 2Z1KA 1WO2A 1OD0A 1LZOA 5IHRA 5G4EA 3UYCA 1ZRQA 2CLHA 3EEGA 1IT8A 2GGJA 3L4VA 4AMAA 3PJUA 2X0HA 5CAHA 3ARRA 3QV6A 4Q4OA 2D2JA 3VOHA 1TG7A 3KVJA 4RE4A 4HA0A 4JQ3A 4XKYA 3UCQA 4W93A 1UD3A 2W4XA 4L9YA 4KF1A 3CEPA 2GWGA 3LBCA 3B0XA 2REQA 4FLSA 5LHEA 2DV0A 3AROA 4XD4A 1R2SA 4C1KA 3ECQA 1G9HA 3W1PA 2PP3A 2E28A 1XYZA 5M5DA 4S3CA 1HGYA 1E9LA 3V35A 1L8PA 3TTOA 3DC8A 1S5MA 3PNUA 1SGJA 5M2FX 1HFBA 4J3TA 4YVXA 3DESA 2V69A 1V7YA 4AISA 2RAGA 1DWJM 2W27A 3PC0A 1I1WA 2XZ9A 3VOIA 2PGWA 3KHJA 3VNDA 1FWFC 1FWDC 1N8IA 1UH3A 3KBJA 2BVTA 4C6IA 3T4CA 7PTDA 3WMBA 2DT3A 2NXGA 3LY0A 5AC4A 1E55A 5LA1A 3ZLHA 1HX0A 3VZXA 3TWBA 3TTEA 1XH2A 4Z0SA 3EA3A 5JU6A 4M5PA 4O17A 2WC3A 3SGZA 1G0CA 5AHMA 2JGYA 2DGAA 4EPKA 3QHOA 3QKEA 3QGKC 2XYLA 1E4NA 3SQMA 3BCJA 3BLLA 3CHCA 2PD9A 3VYLA 2E5BA 4GH1A 3M0IA 3WFLA 5FSEC 3PP7A 5ABFB 1PYFA 5AECA 4R85A 2XDFA 3C4UA 4B92A 4BY3A 4I3GA 4HU3A 1KB3A 2OLSA 4NP7A 3IVUA 4PODA 1RZMA 2AKZA 4YJ5A 4I9MA 1CDGA 3HMCA 1JCXA 1FP9A 1XRFA 3JU2A 2CZEA 3LA4A 3UERA 1P1XA 1LORA 1PSCA 2VDGA 4XZLX 3NURA 4GXPA 4O28A 5CPTA 3ZSSA 4RDYA 3N73A 2FVKA 1S3TC 4DWSD 2O55A 4PRWA 3PTQA 1TPUA 1EF2A 4L6HA 3NCOA 1TWZA 1JI2A 2NWSA 1F05A 3QZEA 1GPFA 2Q09A 2VDHA 5EMYA 1FWJC 4IP7A 3EDJA 4P7OA 3MO7A 3WQ8A 3DKLA 2Y8VA 2DY3A 2JF6A 1MUMA 1Q8AA 7ODCA 4E3VA 4AHQA 3WD4A 1G01A 4N9CA 3D0CA 3IIXA 4ZXOA 1HKKA 4X9SA 2OGJA 2UV8G 4KEUA 3W7NA 5AFDA 1LWJA 1ZJBA 2QV4A 2E6DA 4LCQA 1JYXA 2DVTA 1CLVA 4Q8NA 5BXRA 1JEZA 4JZ5A 5H91A 5HMEA 3I6RA 4HCDA 2WAGA 1R9ZA 3QVQA 3GC2A 4WOQA 2QJIA 1XGEA 2QJMA 3LERA 5GJPA 1CBGA 1XIEA 3I68A 2ZZ4A 4LNCA 1CECA 1PDYA 3NJ3A 3N12A 3QPEA 1OB0A 4PRRA 5CQ1A 1H1YA 4IGMA 5BNKA 3UG4A 3CYVA 3RM8A 3OGSA 3ARPA 1EH9A 4GABA 2WYSA 1HL8A 4M3PA 4KPLA 1NFPA 4E2DA 2P3ZA 4QX4A 1BQGA 2WCGA 3CV2A 2WKGA 3MZ2A 1R2TA 3F2BA 1HF6A 3H4WA 1KTCA 4PCNA 2DZPA 2XZ7A 3OZMA 2C71A 2E9BA 2YCLB 1JD9A 5CLTA 4RPPA 1HZYA 1J0HA 3OQEA 3P84A 3S1XA 4AWUA 1F7BA 3TSBA 3JUGA 5E1QA 3M0KA 3N25A 2WCAA 3TC7A 4CVWA 2EKCA 3MMUA 4IZGA 3ES7A 4EPBC 5I3DA 3IK4A 3MSGA 2DH3A 4HYVA 1XC4A 1F3TA 4MAZA 4IQDA 4NNAA 3H4XA 2QIWA 2PU1A 1N8FA 1S1RA 3REQB 1DKWA 4KWUA 1I1XA 1ONEA 1X39A 3AISA 1L0PA 1KTBA 1T7LA 3GNOA 4A3UA 5A69A 3VTRA 5FAGA 3LRKA 1PIFA 3BGGA 1ZCOA 3M5VA 4DJDC 1UA7A 4DXKA 3CASA 2DQXA 5HWMA 2BMBA 2DW7A 5JMUA 4MIMA 4ACZA 3DG7A 1W9PA 3BGJA 1O12A 5T9CE 4ES4A 4DF0A 4B3KA 1QNSA 4UR7A 2H8ZA 3ZQ9A 1IGSA 4ZO7A 1QUMA 3TYAA 3EMQA 1AL8A 2HCVA 4MY9A 2HVNA 5LNWA 4NRSA 3ZJ6A 4BA0A 3HJZA 4Z08A 1EUAA 4IICA 3ZVIA 4ONVA 5EMUA 5ENLA 1JDEA 2ZA2A 1GW1A 3W1RA 2V3GA 1M68A 4JIIX 4A29A 2WKJA 4B2DD 1QJWA 3AIVA 3QGAC 2B81A 3A64A 4HOWA 1XXXA 2RKXA 3MC5A 1GK8A 1P1MA 2I9EA 3MP3A 1FWHC 1O1HA 4DBWA 1FCQA 1I9CB 1XDMA 1BTMA 4AAJA 4HTBA 3QJAA 3BJSA 3OHMB 3CXOA 4ADSA 2FZDA 1GVQA 5G1TA 1WYIA 1OINA 3W74A 1XLKA 2AOSA 4KWWA 1HW6A 3HGOA 3S2CA 6A3HA 2PRLA 3BOFA 3T8LA 3HG3A 1VPQA 4S3JA 3NUKA 1SO3A 5FJJA 1NDZA 4AHPA 2BS9A 3GFYA 4RK8A 1NSJA 1AG1O 1YTEA 4NZFA 3CZEA 3QOKA 4FX7A 2VX5A 5CPLA 4UQCA 2WB5A 3P61A 5GNZA 3B0YA 1XYBA 1KBJA 4G1KA 1HGWA 4F2BA 1JPKA 3WMCA 3TCEA 3K8LA 1PKMA 4C6MA 1SSGA 3C5QA 3PBVA 1RJQA 3AIUA 3CT2A 5I0DA 3UP8A 2HMCA 3DGRA 3G6MA 1CLKA 1PWMA 4J2MA 3T2QA 1Q7QA 3DFHA 2FDMA 1FXQA 2YXXA 4RNIA 4K38A 3PUOA 3ONBA 3W1LA 2DT1A 2PPGA 3M5XA 1GG0A 2NX9A 2JF7A 4I6KA 2Y5SA 3FA5A 3APYA 3RAOA 1WE5A 3G8EA 4H4IA 5KINA 5H6HA 3MHGA 2ZUMA 3FOKA 2R1NA 3GR7A 1TREA 3GRIA 4O16A 3LRMA 3OA5A 1QNVA 1B3XA 1ZP3A 3VC5A 3QBUA 3VNLA 1EJWC 3CHDA 5EMKA 1KKRA 3IWPA 2FYMA 4WF7A 3TNOA 1LTDA 1FDYA 4TUFA 1KWGA 5KZDA 4F0HA 3MMTA 1POJA 4QS6A 4NI8A 3THCA 5LIWX 4E3TA 1X98A 3E0WA 3OGVA 4GWEA 5CBBA 3GXPA 4KRUA 3NL2A 3GFZA 4LUTA 3TYCA 3GX9A 1G69A 3FAXA 1RLDA 4BQ4A 3R0KA 1BEUA 3WG6A 2E67A 4EWJA 4JTIA 3SFKA 2HNEA 1LL4A 4UQDA 3WMLA 3WD1A 1E70M 1B54A 1C8VA 4GYKA 2O9TA 1XYFA 3L4UA 4CN6A 2FZMA 3W24A 3GG7A 4M6PA 1FWSA 3QTGA 2MANA 1UD6A 3SSJA 1ZJHA 3ZT5A 2CC0A 2VENA 4JFUA 2QYGA 3HIJA 4V33A 3LTPA 3SURA 3IRSA 3U2OA 2EO7A 3E96A 3OEXA 4X63A 1QXLA 3KVMA 1YX1A 4BJHA 1K3UA 4GYFA 1X1ZA 3MCNA 2BXYA 3M7SA 2A6NA 3APTA 1Q6QA 1A5BA 2FZBA 2FH6A 2X16A 3UWWA 4I5RA 3K1DA 1AD4A 4Y7EA 5A6SA 4C5YA 2CXGA 1MNSA 2VD9A 1E9YB 4CU8A 4ATDA 2FGBA 2WHKA 1EJVC 3DUGA 1NARA 2C16A 3OVRA 3W2UA 8XIAA 1H3GA 1NAL1 5EFDA 4EP8C 3UBPC 4IWWA 2I57A 4PMRA 1IWPA 3C2FA 4DZIA 3AFBA 3OODA 3EMZA 1PXGA 1L2UA 3WK3A 6TIMA 2GK1B 4U2ZA 1OT1A 4HNOA 1V6VA 1D3GA 4MPQA 4NL1A 1XR2A 3RF9A 2E40A 3UJFA 3AMDA 1HT6A 3JRKA 4FPSA 2C1GA 4LNYA 1OGGA 1IGWA 3TQ0A 4DWSA 1O5XA 2VX4A 3S2JA 4N6EA 3H4GA 3I4EA 3EWCA 3GTXA 2XFYA 2XGZA 3DG6A 1XINA 4BR1A 1Q65A 3D46A 5AHEA 4UMAA 5HPOA 4WSHA 3TNBA 3FJLA 4GG9A 1H60A 1W1VA 2BBFA 3AOFA 5HQLA 4O15A 2A0NA 3S3GA 3XIMA 4EKJA 1W5OA 1KFEA 1RBLA 1E0XA 2OSYA 4MM1A 1WDRA 4FX8A 4L80A 4JEQA 1E4MM 4NRRA 2FHCA 2R1LA 2DP3A 3CC1A 1TV5A 1S5WA 1IEXA 4LC6A 3DZ1A 2DDXA 1ZJAA 4PBEA 3NGJA 4JTHA 1JXJA 1VLIA 1V0LA 5HK4A 1SZFA 1TCMA 3KTXA 2F2KA 4HYRA 3F2CA 5ECVA 1DJQA 3T1GA 2VCAA 4AYSA 1M65A 3S5SA 3KBVA 3QMSA 3WJZA 1X97A 1T8XA 2WSQA 4ICCX 2GUYA 3N2OA 3QH2A 4JHZA 2PDGA 4J3WA 3E9AA 4YVVA 4IUGA 3MKKA 5AYZA 5D2TA 3FA3A 1XGDA 4H9YA 2PC4A 3AS2A 2WZHA 2ZADA 3CBWA 3GVQA 2DORA 2VZSA 1E9ZB 4PUEA 3TP4A 1OBAA 2PA6A 1XF0A 1I8JA 2QAPA 5DBUA 5CC6A 4RV8A 1OYBA 1E6ZA 4B15A 2E6AA 4PUMA 3QW4B 1Q6LA 1YNYA 4Q6XA 1PBGA 3PZMA 3CS2A 1JQXA 2BOGX 2J9ZA 3G1XA 1VLWA 2A5HA 2ISVA 2TMDA 4WZHA 1BYBA 3D3AA 2QMJA 1XDLA 2QV5A 3H7RA 3DBPA 4PSRA 1OFBA 3WLSA 1V7AA 2E3ZA 1BSIA 3NXLA 3L65A 3P6LA 3AJ7A 3NL3A 4PTMA 4HZ7A 1LT8A 1X1OA 2CWXA 4CNTA 4YCOA 2XTKA 1PS9A 2VFIA 1E4LA 2BHYA 1P7TA 2GJPA 2W0UA 4JHMA 3W7HA 1NWTA 1FFQA 3RX2A 2G4FA 2YKKA 3SAZA 3VCRA 4JYFA 5C2XA 4LF1A 5J04A 3P62A 1HKVA 2Z2AA 4H6KA 1LWHA 1GORA 2A6LA 2BVWA 1QI3A 4GACA 2C15A 1U1UA 4BCEA 5HULA 3R2GA 2W63A 2ZZ5A 1VH7A 2GVLA 2FZNA 4YYFA 2EAWA 4LYRA 3NQVA 3DXIA 2D2GA 1T5AA 1V51A 4M82A 2F61A 3DFYA 4LYQA 3GDBA 4B2DA 3ZJKA 3QMTA 2ALDA 3W7EA 3SIMA 3B06A 4MNJA 3QYQA 1SW0A 5C7HA 1CWYA 2VEFA 3AS1A 3G6LA 1CW2A 1KXTA 9CGTA 4GINA 3WSUA 3W02A 4AWSA 3SQLA 2TSYA 3VC6A 1W54A 4N4PA 2J7EA 4R27A 3MTWA 3KOFA 1MWOA 1DWIM 3CUFA 1S3HA 1MRAA 3A3XA 1VYSX 2E77A 4GVGA 3KVLA 5FJIA 1GJWA 3QV9A 1FHLA 3IS4A 2WANA 3SRDA 1WV2A 3N34A 3GVVA 4W89A 3R4IA 2Z2UA 1XV8A 3WELA 4HN8A 4UZUA 4MJ2A 2WSKA 3BANA 3PY2A 1YDYA 1Y5VA 4A35A 1XL9A 4LVDA 1W1TA 1TMQA 2YPIA 3MI3A 3IGXA 1XLMA 4YTQA 4BKNA 1UZHA 3HG5A 1V6WA 3PBMA 1WZAA 3WLNA 5A2BA 2POZA 4UQAA 1ZJIA 3TYEA 4H7ZA 3WJXA 2QJNA 3N4AA 4L6DA 4H9ZA 5CG7A 1QDSA 4J2PA 4GNJA 3B04A 4C1LA 4X60A 4PCTA 1WKDA 1ALDA 1L6WA 3S5YA 5C55A 2VEGA 1XG4A 4GJIA 1A50A 2D3LA 1YPIA 4R9OA 2WVTA 4RX0A 3ZJ8A 1RPXA 2Q8LA 5ECUA 4BHYA 5I3KA 1OC7A 3O06A 5BMWA 3VCCA 2GGHA 4RJEA 3S1UA 3K5XA 3HB9A 1GCYA 5C9WA 5D2VA 4PBGA 1XSKA 1KQYA 4PUKA 1XHGA 1FHDA 3GXTA 1A0CA 2ZWYA 1XUUA 1H7OA 2Z1BA 1IT0A 4XTIA 2FLIA 4NAEB 1HKMA 1SM9A 2V5DA 3H12A 2BWGA 1P5BA 2OWCA 1JI1A 4FNUA 2Y5JA 1TR1A 1XKYA 1TSIA 1PEZA 5FIPA 3ZIZA 1QNQA 2ZICA 5I24A 4IJCA 3UPWA 4H2CA 5LXXA 4FS9A 3OZOA 4O54A 3EA2A 5JIPA 1NOUA 1C90A 3EWUA 5LXEA 3OU8A 3W73A 4B5VA 5CBJA 1VFOA 3CTTA 4A8LA 1OFEA 3SB0A 4UTFA 2BOEX 4LXFA 4DYJA 3ZM8A 3B40A 5AB3A 2C6QA 3APGA 4JYEA 4YIWA 1OG6A 2ZCGA 1NDVA 4NVTA 1JYNA 1O60A 2OCZA 2ZTKA 1MMFA 2RDWA 2VOTA 3JZUA 2QKFA 3DFTA 4IGNA 3SGGA 4MDOA 5D30A 4DVOA 2AKMA 2OX1A 1F4AA 4GJJA 3CUJA 1UWIA 3MSYA 4AMCA 3SCRA 1FWWA 3VE9A 4LPCA 3DGBA 3VGGA 3P14A 3NQDA 2GJXB 3E02A 2DSWA 1OFRA 3V0TA 4IQJA 2J25A 3WJSA 1JUEA 1KC7A 4IP4A 4NY2A 3LXCA 2I56A 4GUGA 5KTLA 4F40A 3W70A 1VRDA 3TJLA 1D9EA 3K1GA 1ADDA 4N42A 4DBSA 4QNWA 4HPHA 3WZ0E 5K3VA 1Q6CA 3MV01 4LV9A 1HIZA 1J6OA 3PAJA 4GKLA 4Q33A 1MZHA 3UEQA 1W1ZA 3NL6A 1H09A 3M0MA 3PWGA 4HK7A 4DO4A 2XPKA 3FN9A 5KEZA 1HKWA 3ABXA 1AZ2A 3BSMA 3I3BA 3C52A 3WO8A 3E2VA 4O10A 1CPUA 2V3EA 3OVQA 3HPXA 2Y8KA 2NVCA 3HURA 5ABFA 4CN4A 5FEXA 5A94A 4ZVJA 2PDNA 4R7WA 3BH4A 2XU2A 4PMYA 1CIUA 4GQRA 1GHSA 5FJOA 3H54A 1CGYA 1AJZA 3VILA 2NLYA 4FX6M 5K7JA 5IXEA 3BLEA 2R94A 3EWYA 4A8IA 5E6ZA 3WNNA 3EOUA 3MP4A 3NSXA 2W6RA 3UFYA 1VPXA 3VX1A 4QLKA 3DFOA 3GTHA 4CCEA 3WUGA 1LQAA 3SCTA 4KH2A 3R89A 1JUKA 4LY4A 1R3VA 1LBMA 5CSYA 3M6DA 3CQ0A 1FA2A 3NDYA 3CTLA 1JCTA 1GQNA 1IZCA 2I17A 3I6TA 4KS0A 3JVAA 4OOUA 3VNZA 1UUQA 2PFHA 4X22A 3QY7A 3LG3A 2BV9A 3ANUA 2YDSA 1HNYA 4E8CA 1EWDA 4O14A 1LJYA 1BG4A 1LF1A 4NQ1A 4F9DA 5MF5A 4CD4A 3W2MA 3D3FA 1OIFA 3LMYA 3AYVA 3V1PA 1YTDA 3PB0A 3VDHA 4DWDA 2A3BA 4BI5A 3PBWA 3AIRA 1EEPA 1E71M 3SUUA 2PTXA 4HA3A 4HCLA 5U7SA 2OX4A 4QCFA 1QWGA 4WD0A 3WK0A 2VHLA 2NT1A 2ZA1A 1E6XM 2W91A 5F2MA 3CWNA 2ABBA 1DYSA 3ATZA 2IQTA 4C7FA 1HVXA 4JY9A 1RAKA 1JQVA 4PFHA 1RP8A 2AGTA 4Z1BA 2VGFA 5DMNA 1K7FA 2IPGA 1QVBA 1A4LA 2OO6A 4ATWA 4CKQA 1LG2A 1B90A 1MO0A 2Y7DA 2H3DA 4BF5A 1Z9AA 3N2MA 3KDNA 3HFYA 3AHYA 2YCEA 4GRSA 4BWLC 2OT1A 3OLDA 4GZEA 3TA9A 4TX6A 3B97A 3VGFA 1SZRA 1J11A 2ZTJA 1LDCA 3TIMA 3HQNA 5H8MA 3GG1A 3EOEA 3AXMA 3CT7A 1DQWA 3IJ8A 1TX2A 3RR1A 3P8JA 2YCLA 4JTJA 2EJ1A 2VZTA 3Q67A 2VWSA 2IUZA 4IGHA 2QEZA 2E6FA 2WZIA 1WZLA 2CBVA 4W5UA 1DXEA 4DM1A 3F4WA 3WNKA 2BY3A 3BVJA 4B3LA 3GH7A 2OZ0A 4WR3A 1W8GA 3SM0A 3UJ2A 1YDOA 4TMBA 2EBNA 1F4HA 3TC3A 2XSBA 3F4VA 1CGXA 3G1DA 1QPRA 2CIPA 3IGSA 3VD3A 5M17A 5JQ9A 1XBXA 4KRTA 1QU4A 1US3A 1IEQA 4AH7A 1B3VA 1WQ5A 1FY6A 2V63A 3N2BA 3REQA 2CZVA 1E72M 1R7OA 2ANUA 3GUGA 2QCGA 5LYRA 4DNHA 1JVNA 5EYWA 1OC5A 4ZQMA 4FA3A 1UZ4A 3NQ6A 2KAUC 4WQ6A 3P67A 3PZUA 4JFSA 4IGSA 1GGOA 2XH4A 4AZ5A 1M9HA 1O94A 4QJ5B 1OGSA 4KEZA 4AF0B 4GQQA 1H51A 4HJWA 2XIMA 3N2TA 3PK7A 4K6AA 2JKAA 3KRUA 4HP5A 1TZ7A 4MOZA 3AUOA 1UJPA 2BGSA 5REQA 3OB8A 1MNZA 3BZJA 3RPTA 4NZ5A 3IARA 2F7FA 2GLKA 1WDDA 3B4YA 2P5NA 3SRFA 2VRQA 3OBEA 3QMRA 1G4PA 1YTKA 3PS7A 1JDFA 2A2IA 4HB7A 4YHEA 1FP8A 3K13A 4KEVA 1E0TA 4UCGA 4GC4A 5BWAA 1Q6DA 1OX4B 3VIMA 3Q37A 3RX3A 2XFFA 4L65A 2OWWA 2BX7A 1JDAA 3ZLFA 1H5YA 2QCDB 2QLYA 1FKXA 1G4TA 2I7GA 5AHLA 2W92A 2VFEA 1ZNNA 1SUXA 4IISA 1MYRA 3GZAA 4ZXLA 4AW7A 4ERIA 1V02A 3JW7A 1LG1A 3BAJA 2Q02A 1QI4A 3GU9A 3PZOA 5LKYA 3TE9A 1ZY9A 4B4FA 1HP4A 4JX6A 4XZWA 2FQIA 3TJ4A 3DHFA 3U4AA 3GTIA 3B9OA 2OQHA 2BTMA 3GNDA 4IIEA 4PFMA 5E6YA 1H63A 2DPEA 3JS3A 3KRSA 4IL0A 2QGYA 1OQFA 1K9DA 3H21A 4AY7A 5F7UA 2J77A 1TWSA 3CEUA 5C2GA 3W7KA 4XO7A 3AIQA 3PPFA 3BMWA 1BYDA 3HF3A 2BHUA 2Y4SA 1YMYA 3VOGA 5AHFA 2WV8A 4RDWA 5ABHA 3U48A 3U7BA 3B9NA 7REQB 5HNTA 5IOBA 1OVDA 1W32A 4HCHA 1U83A 1ZB5A 1K4GA 4ROPA 2DZAA 4MWAE 1UP3A 3H8AA 4HNCA 2QR6A 1VFMA 5HPCA 3SFWA 4JXCA 5FF4A 2A1YA 2QZRA 4MY8A 2EPMX 1OSEA 3G18A 3NNTA 3NSMA 4AZ6A 2CLLA 1KLZA 4S2CA 3WQDA 5C2CA 2VMFA 3QC0A 1XH0A 3EMCA 4GQ0A 2PAJA 4GYPC 4OWGA 1XWYA 1TA3B 2QMKA 1BQCA 6CGTA 3DFNA 2PP1A 4DBEA 2F9RA 4AD5A 1LWIA 1KCZA 1JRCA 2WKLA 4JTLA 4UFMA 1US2A 3T0CA 3BLIA 1R7AA 4G2DA 4ML9A 1R3QA 2W5FA 4DJFD 4A21A 4Z2GA 5FD0A 3G1HA 2NUYA 3T44A 6TAAA 5CH9A 1JZ2A 3S42A 2NXHA 4JFWA 1XLHA 2HBVA 1V0NA 2PURA 2WMIB 4NJKA 3IV3A 1EX5A 2P53A 2X2GA 2RH9A 2Z00A 4QG6A 3PULA 1Q63A 3EPMA 2PS2A 4IX2A 2Z27A 4GY1A 4N9BA 3UNDA 3MKVA 1Q4WA 4H6QA 2IPWA 4LAUA 2Q6ZA 2ISSA 3PUGA 1PZ2A 4K68A 4K8EA 1LRNA 1KFWA 2I9UA 3S2LA 1T6MA 3L5MA 1TE6A 1CX9A 3L67A 1Q13A 1WDSA 1XIJA 4Y9AA 1C8YA 1RR2A 1EJUC 5D8WA 4GO9A 4LRTA 1R3WA 4HU8A 4BFAA 1VFUA 4AC1X 5I79A 1B30A 3RK8A 2W61A 1S5NA 4NYUA 1I6NA 4J40A 4R9XA 4JTTA 4DJED 4IQEA 1UH2A 1PYMA 1M7XA 1GUVA 2G3FA 3EXSA 3CQJA 3WLQA 2GK1A 4O12A 1JUBA 4FXRA 1W0MA 1XYMA 3W81A 1TV7A 3W53A 4PB3A 4ZOAA 3LZ3A 1UOZA 3MHFA 3YPIA 2PWUA 3IAPA 1GT8A 1FH9A 5I02A 3W28A 3WBYA 5CPOA 3OYZA 3SCUA 1VHCA 5A3HA 5HXMA 1HJSA 3QZAA 4JKLA 4X0NA 1EYWA 3T6CA 2OODA 3T55A 5MKGB 3NPWA 4RR4A 3CUZA 3K2GA 1W8SA 3N9RA 4GKTA 3W7RA 3IPWA 2V5LA 4D71A 1VR6A 2E68A 2G3MA 4M80A 1X6LA 3KWXA 4PMNA 1Q5MA 4JTGA 3EPOA 5BU9A 3M1ZA 4M7SA 4D8LA 5FESA 4EE9A 2XWEA 5C5YA 2AMGA 3SECA 1KM5A 1HG3A 4UOJA 2GL5A 1PDZA 4B16A 4MYAA 4NG3A 1GJUA 2WC7A 1AW5A 3DU0A 3M64A 2WNQA 1JD7A 2Z6JA 1PTAA 5LZLA 3MVTA 2DJXA 3ZMRA 1HP5A 1E6PA 1ZAHA 1GQLA 3S2MA 3M0JA 1K03A 3SY8A 4LJ3A 3ARQA 1HJXA 3C6CA 4XK2A 5JVLA 4UFLA 1ONWA 2A21A 3WQVA 3MV11 1SFLA 4H6RA 4CQCA 4LRSA 4OBRA 3GDMA 4XB3A 2XISA 1TUFA 1RPKA 1UA3A 3AZRA 1DV7A 2XG9A 4XAYA 1EGMA 1UROA 1PPIA 3PAOA 4LAOA 4MB1A 3F03K 1R30A 3M6YA 2WMGA 3H55A 4EVZA 4TV5A 1MW3A 4JTRA 3S5NA 4D6CA 4ZO6A 1DIKA 1SMDA 3TQVA 1Z32X 3EEZA 2J8FA 1EF3A 1OCQA 1MXSA 1O66A 3SUSA 4Q4RA 2OB3A 2F6XA 3PANA 1RUSA 4KWSA 5LNVA 1TR9A 2V82A 4JTSA 1X1NA 3FHQA 4I5UA 2J74A 6ALDA 3RYSA 5FKYA 3K4WA 2XIJA 4NASA 2PWGA 3DEQA 4Q6JA 2GSHA 1H50A 2NLIA 2R1MA 5IDIA 4M6QA 1R3YA 3HV9A 4Z2IA 3OVPA 2BSLA 2VXNA 1LQ0A 4DF1A 3WBWA 2PDKA 2B0MA 4C91A 3VKDA 2D22A 1UD2A 3SZ8A 1EGZA 2A7RA 4KCTA 4B5SA 3CV7A 2ZE0A 1V77A 1MVYA 4AEFA 2Z25A 2DIEA 6PTDA 1V6XA 1DJHA 4XWUA 3T05A 1RQBA 3STFA 1UIPA 2PDWA 4GMEA 4AX6A 4EPDC 2CHRA 1VJZA 2FB2A 1UYQA 4QLLA 3VINA 1KFBA 1KM3A 1OFQA 1HJUA 1NQ6A 4GXMA 4BI7A 3SO7A 3SR7A 4R7OA 1TCDA 3N19B 4PULA 1IXQA 3GYEA 2P1FA 3FKRA 2A3EA 1P6WA 3SCOA 4GI4A 5D2WA 1IWBA 2DSVA 2D1ZA 3GO2A 4RE2A 1GVYA 3TAKA 3DAQA 2ISDA 3BW4A 3VDGA 2CKRA 4AXKA 3LM3A 4L4PA 3EPNA 1F5ZA 4LOCA 4NZ4A 2F84A 3M0XA 2HE8A 2ZZ6A 2PSNA 1VBJA 2Y88A 2W3ZA 1V03A 1I0BA 1KR0A 1F07A 4WGHA 3P7YA 5DLCA 1JR1A 3H2NA 1IZKA 1XPYA 3O16A 3S6TA 3H2FA 1XISA 1WDQA 2J8TA 4GIAA 4MYXA 2VX6A 3QR0A 2YZ5A 4JN6A 3GD6A 4DI8A 3W1AA 1TJ0A 1V0KA 1I45A 3CL6A 3INPA 3NQ2A 3WQ6A 5HBFA 4GY7A 1VFFA 3RCMA 1ENUA 1W5PA 1G67A 4MLRA 2INEA 1PCWA 3KRZA 5D09A 3EWBX 1L9WA 4HNNA 4L9ZA 3TN5A 1V3JA 3NM1A 1J0JA 1JCJA 4UMCA 1JPMA 4J3ZA 2ONEA 1DIDA 4GCAA 4DNMA 1C8XA 1FTXA 4HNVA 2OFJA 4PH6A 3WLRA 1CXIA 5GJMA 3UWVA 3G3DA 2IPJA 2QUNA 2CETA 2YW3A 3M0LA 1LLOA 3EYPA 1VJIA 3GHRA 3DG3A 4QROA 1TPEA 3RM9A 3KP0A 5BRBA 3GHTA 4LS1A 3IEBA 4Z42C 3VDBA 3B8TA 3W1XA 4YYCA 1MEHA 5HMFA 2ODOA 4LUJA 5DRIA 5I3GA 4Q32A 1A5LC 2YL6A 3VAVA 4G56A 3KZSA 1QI2A 4Z1DA 3DI0A 1BWVA 3OOQA 3C2YA 2TAAA 1TMLA 5IFPA 2CLEA 5A1AA 3ES8A 4HZ8A 1PTDA 1F8MA 4O13A 1WXYA 1YDNA 1JG9A 3B05A 1UR2A 4JOMA 1PB0A 2ZQ0A 4NAEA 4PUWA 3NYZA 4GI6A 1QT1A 3N6JA 4DJFA 4QQUA 1ONRA 3ONCA 3SCSA 3WH8A 1W5NA 4EAMA 5AZ1A 4S3BA 1OF6A 3G22A 3W7CA 4H41A 4C6FA 1BKHA 2E6YA 4QEEA 2VJXA 3H26A 3PR2A 3O6AA 3PG9A 3QSRA 1X96A 2XWDA 1QW7A 1VBUA 4LF2A 3PZQA 2VCBA 4PUUA 1H1ZA 2CZDA 2NSOA 2VVSA 3SDOA 2VOMA 3BLDA 1J0IA 1MSSA 1AH3A 3C3NA 4AZCB 1EDQA 2J7BA 1D7KA 3FAWA 4NZJA 1W1IE 4NZ3A 1AMKA 1Z8AA 3A47A 4LBUA 1TV8A 3C61A 1OCJA 3LSCA 1VYPX 1AJ0A 3GDTA 1ZL1A 4RNFA 3GFXA 2CKSA 3KVKA 1CLXA 3T07A 3PB2A 5E9XA 3MYPA 3W23A 3N18A 4H9UA 4N6FA 3GK0A 4DZ5A 1TZ9A 2CZFA 1A5SA 4R7JA 3WYZA 3CO8A 2GDQA 3OQ8A 3VGBA 1V3MA 5B7YA 1AA1B 2ACRA 4WJEA 1PL9A 2GJXA 4OV4A 4DJEA 3GIQA 2ZX8A 4V2XA 1UD5A 3E38A 4JEJA 5A5WA 1ADSA 4HSHA 4UTWC 3JR2A 4HMDA 4ADTA 4A4AA 2O4MA 3NDZA 1OYAA 2V38A 1E6QM 3ARZA 4M29A 4UTTA 2FFCA 1RP9A 1DJIA 3WNOA 4HNLA 4IPNB 4KCWA 3N2XA 5D2YA 1CEOA 3LHTA 2ZXAA 4QJ4B 3AHVA 5AC8A 3FYYA 4GI8A 1TV3A 2QXWA 2ZVIA 2QDGA 2QIIA 4W8AA 3ITLA 3W1MA 4BEQA 1XCXA 3GXNA 2QQ6A 3DFQA 1KD0A 2GYIA 1EXPA 4J35A 3O6DA 4Q7BA 2X0YA 2YDRA 3W7DA 2PGRA 1W1B1 3C0LA 4IG2B 4DHGA 2WPBA 4WVXA 2VVNA 4EXAA 1DIOA 4ZZ9A 3MB9A 1XIHA 2BODX 3GVGA 4AD3A 1PX8A 5BXPA 2PTZA 3AXXA 1C9DA 2NXIA 1WNOA 4D8AA 4A2SA 2X1UA 1CGUA 3ENLA 3GVRA 2PWVA 3IUDA 1TJ2A 1TPH1 4FNPA 3MWAA 2INFA 4K7YA 2AQOA 2YA1A 4GE8A 3U3HA 2QCNA 1C91A 4F0LA 3O7UA 2P50A 2V81A 4E8DA 5GNYA 3ZWTA 3VO0A 2WSYA 4ZOEA 5K9XA 1EUNA 3QZ6A 2FTWA 3G0XA 3VNYA 3C8FA 2YFNA 4EF8A 1R0MA 2G5WA 2HTMA 2ZWZA 3CUIA 4CUCA 1AJ2A 1GJPA 1EJ7L 2ZFAA 2V68A 3FKKA 2BG5A 1KBIA 4GZ7A 1PX4A 1TTIA 2X41A 3B0UX 3TOPA 1Q4NX 3ZVHB 5SWUA 2B7PA 4NNCA 3VNKA 3HN3A 2X0SA 4PA8A 2YLLA 4M56A 4JIHA 4HNTA 2H6RA 1IXOA 3MBDA 2F6KA 3VMNA 4HU0A 1MUWA 3SUTA 5BCAA 1BRLB 3LMZA 4CCZA 3WUFA 2ZOXA 5H8PA 3A4AA 1W3LA 1OZQA 1S2UA 1W3IA 5A8GA 3W1NA 4TTUA 2Y7EA 3U6WA 1JYVA 3KP1A 4A2RA 2PLCA 3EDKA 1HXJA 1U1HA 1TWDA 1KFLA 2OSXA 3ELFA 4H04A 3PVFA 4QISA 4IX0A 1DP0A 5FF0A 1XM3A 4B9ZA 1HTIA 1FCVA 3V18A 3TVAA 1LOSA 1O6IA 4UFIA 1TV4A 2C7FA 3KEHA 5CPQA 4K8GA 3F2DA 2Z1SA 1XUZA 1SJCA 4JGDA 3SQSA 4NYYA 2YIHA 4UC5A 2R82A 2VR5A 4M24A 3W6LA 4MZ1A 3IJQA 1K8YA 4G5DA 9XIMA 2ZYFA 1ZHAA 4ADUA 4LGXA 3ICJA 1GYNA 3CLWA 1ICQA 2VGBA 1ML1A 3CWHA 5HQMA 2A4AA 5G1YA 3S0CA 3H2OA 3NQ7A 3LNPA 4GZIA 3HPZA 3BJTA 1T41A 3KOZA 1X8FA 1DE6A 3RCYA 3PSVA 2YR1A 3ME3A 2WBKA 2VFGA 4Q8WA 2DQWA 4K8HA 1FWAC 3W1TA 2HEJA 4WRHA 2OWXA 3HZ3A 1TPB1 3ID7A 3ZR5A 1T96A 1XICA 3QM3A 4J4KA 3UG8A 3TUUA 2PODA 4KQNA 2WVVB 3FK4A 3JZEA 2I5IA 1XLLA 3RLHA 2I16A 4MWAB 3WL1A 4XZHA 1IEIA 3PTDA 4CEXC 4DZHA 5T9BG 2HPMA 2YXOA 3THQA 1KBKA 3UCDA 4F4RA 2ZUNA 3I7RA 3TONA 3N6QA 2I5GA 4LWWA 3G3MA 3L4ZA 1F76A 1JF6A 1XDJA 3F7JA 4GVFA 4DLMA 1EX1A 3LNMA 4JBRA 4WJ8A 2C91A 1SZGA 3ORWA 3NZPA 3G1AA 5BWFA 3ITGA 2J62A 2Q01A 2CNCA 1YRRA 3BQ6A 3KBMA 4M8UA 3CZLA 3CK5A 2D2OA 4XZBA 1XGZA 4JCLA 1QHOA 2D20A 3AIEA 3WDQA 1W9DM 5MHBA 2B7QA 4OQVA 4YPJA 1KM2A 3U57A 2AL2B 1W1PA 4CCCA 4UBPC 1ZLPA 2PRMA 1ZAJA 1PKNA 5CEWA 1UASA 3DDMA 4AF0A 1V3IA 1E5JA 2QUTA 1X38A 3PWAA 2ZDRA 3UWYA 4HD5A 1PZ3A 1EPVA 1W6TA 3BCFA 5BOOA 2RJGA 3POHA 2EHHA 4ERAA 3W87A 1J6PA 4BF9A 2IPFA 4PTNA 2ESCA 4V1YA 1KQZA 1M7OA 4F0RA 5TF0A 4XV0A 3VMPA 5JUVA 2PRHA 1CZ1A 3PZTA 2WWDA 5D33A 3M5YA 1RVKA 1OX4A 3ARUA 4JCMA 2O7SA 4FZIA 5E0KA 3FEMA 5G2WA 3KAOA 4ZO8A 3VD4A 2QCDA 3WF4A 4JIEA 1KCKA 1FWBC 3LLXA 3AMLA 4EACA 1JZ3A 4JDBA 1FWIC 3ZSTA 3CMJA 1J8VA 4GGHA 1EGVA 1FCBA 3LV5A 4MNKA 3WLOA 3W07A 1VB9A 4P8XA 3RG6A 1XI3A 4J3VA 2G97A 1S2WA 1P43A 1QPNA 2J4GA 4O0KA 3WCZA 1VEMA 1JGIA 2YXGA 2WSRA 3BAWA 4PUDA 2PP0A 1XH1A 3ABZA 4Q4MA 4S39A 1ZBVA 4JKKA 1RK5A 5D9PA 1TTJA 3FHAA 3GU2A 3IK2A 3S9ZA 4H3DA 2J7DA 2EG6A 4IM4A 2BASA 3A3WA 3LYEA 4Y6GA 2GUBA 5HNNA 4MZYA 3VDCA 4OECA 2BVDA 2G3JA 2QNEA 2Y7GA 4E38A