3LZ3A

Human aldose reductase mutant t113s complexed with idd388
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lz3A00
2HE5A 1RALA 3ONCA 2PDWA 1EL3A 3WBYA 3MB9A 2BGSA 4JQAA 1XF0A 4Q3MA 1VP5A 3H7UA 2ACSA 4XZMX 1QWKA 3G1RA 2ACQA 3O0KA 1IEIA 3LN3A 3CAVA 4WDXA 1T40A 2HVNA 3V36A 2HEJA 1Z9AA 4LB3A 3N2TA 2ACRA 1S1RA 2PDNA 2I17A 3CV6A 2IPFA 3UZXA 1LWIA 1MRQA 2J8TA 3V0UA 3N6QA 3H7RA 2PDFA 3MC5A 2IQ0A 4AUBA 1VBJA 2INEA 2PDLA 4ASTA 2FVLA 4XVEA 2QXWA 3BCJA 3R43A 4JTDA 3UZWA 1RY8A 4XVDA 4JTAA 2FZ9A 3VXGA 1Q13A 2ALRA 4GA8A 3UZZA 1X98A 4IJRA 4GQ0A 2IPWA 3R6IA 4R9OA 4LB4A 4HBKA 4JTCA 5LIWX 2PDJA 3LZ3A 1ZGDA 2DV0A 4QBXA 3V0SA 3C3UA 3RX4A 3WCZA 2WZTA 4LAUA 1AH0A 3R94A 3R8HA 4QX4A 4DBWA 3CAQA 2HE8A 2IKIA 4GABA 3S3GA 1SM9A 1AH3A 3BURA 2R24A 2PFHA 3UG8A 3T42A 4JQ4A 3P2VA 1MZRA 2HDJA 1X97A 2PDHA 4XZIA 4XZHA 2P5NA 5DANA 4LAZA 2PZNA 4YVXA 4XZNX 1HW6A 4LBSA 1XJBA 5LIYX 5JH2A 3QKZA 4YVVA 4IJCA 4WEVX 3R8GA 1IHIA 4WRHA 1M9HA 4FZIA 1MI3A 2VDGA 1S1PA 4JQ1A 3LEPA 5AZ1A 3EAUA 2PDMA 3UGRA 3M4HA 4GQGA 1PWLA 1AZ1A 4PUWA 2IQDA 3KRBA 4EXBA 2ISFA 2BGQA 3V0TA 2PD5A 2PDIA 5HA7A 2ACUA 4HMNA 4FA3A 4H7CA 3GHUA 3NTYA 4PMJA 1ZUAX 2PDGA 3G5EA 3LQGA 3UWEA 1JEZA 1AFSA 3FJNA 4GIEA 1XGDA 3F7JA 2HVOA 2IPGA 3DN5A 4FAMA 3DOPA 3H4GA 5HNTA 4JIRA 2PDCA 3GHRA 1AZ2A 1PYFA 4L1XA 5LIUX 2BP1A 3UZYA 2PDKA 4DBSA 1S2CA 4JIIX 2PDQA 3D3FA 2IKGA 1K8CA 1US0A 4EXAA 3RX3A 1Z89A 2IPJA 4OTKA 4JQ2A 4LBRA 2PDXA 1EKOA 3FX4A 2AGTA 4WDTA 3WBXA 3LD5A 4XAPA 3UYIA 3UFYA 3U2CA 1YNPA 3UP8A 1J96A 4H8NA 4DZ5A 2A79A 2INZA 4G5DA 1UR3M 3LUTA 5KETA 1Z8AA 2PF8A 1Z3NA 3LQLA 3R58A 2FZBA 1RY0A 2FZ8A 4XO7A 3BUVA 2FZDA 2I16A 4YVPA 4F40A 1QRQA 3LBOA 4PUUA 4JTRA 4ZFCA 2IS7A 1R38A 3EB4A 3Q67A 4ICCX 4GCAA 3BV7A 2DUXA 1HQTA 4I5XA 4JQ3A 1X96A 2DUZA 4PR4A 2NVCA 1PZ1A 3ONBA 5HNUA 1S2AA 3GUGA 5AZ0A 5M2FX 4PRTA 4WGHA 5LIKX 3COTA 4L1WA 3WBWA 4XZLX 2PDUA 4DBUA 1LQAA 3RX2A 4YU1A 3O3RA 4PRRA 4QXIA 5LIXX 2PDYA 2PDPA 1Q5MA 2IKJA 2F38A 4YS1A 3LENA 1PZ0A 5C7HA 2R9RA 4JTQA 1T41A 4WDUA 2FGBA 3GHTA 2NVDA 3M64A 2PEVA 1FRBA 2CLPA 2F2KA 1AH4A 4NKCA 2IKHA 1YE6A 1YE4A 3LZ5A 3R7MA 4XK2A 3V35A 1EF3A 4QR6A 4IGSA 2PDBA 3WG6A 4Q7BA 1ZSXA 3CV7A 1C9WA 1ZQ5A 3Q65A 4GACA 3M0IA 1YNQA 5JH1A 3ERPA 1GVEA 4JIHA 3LNMA 1EXBA 3GHSA 4FALA 2WZMA 1ADSA 1A80A 4MHBA 4WDWA 3B3DA 3EB3A 2HV5A 3CMFA 4RPQA 1OG6A 3CASA 2C91A 1PWMA 4XO6A 2PD9A
chains in the Genus database with same CATH superfamily
3XINA 2E5DA 1C92A 3ELFA 3M6DA 1XRTA 5TNVA 3AXMA 3H22A 4I5RA 2VZUA 1OD0A 1I2NA 4XZMX 4J3WA 4AZIA 4UTKA 3UPMA 1RBAA 3HTWA 4I9AA 4DBEA 3TWBA 1JQVA 3WDRA 4DI8A 3H24A 4ZQCA 1W9UA 4OHQA 3SRHA 3MVIA 4O50A 5CPMA 3IWPA 1YXYA 1CBGA 3AI0A 2VCBA 2GGJA 1QUMA 1VKFA 2QS8A 2J8TA 1X6LA 3BJTA 2PBGA 4LEFA 2XN0A 3AROA 3C61A 2V30A 1A0DA 4DAIA 1GPFA 1VBRA 5HMFA 3KBSA 3B06A 4DWSC 3ZSTA 3QMTA 5LGXA 2GVGA 1JCYA 3LCHA 3N19B 1HTIA 2E1DA 3IVTA 2Z24A 2B0MA 2Q71A 2ZA2A 1VFMA 3QPYA 3STGA 4GGBA 3JVAA 7TAAA 1JF5A 2DSUA 1V77A 2CETA 1TWZA 1FHLA 2ASHA 4GVHA 3VD9A 1KFKA 1RXOB 3KWSA 1R3WA 3E0IA 3RX4A 1HGWA 4YCOA 4XG1A 4CQBA 4IIBA 3IJ7A 2VJXA 4Q8UA 2IKIA 5IM51 3TTYA 1SW3A 4BI6A 3H2EA 1XDMA 5CXPA 1EF2A 1LOQA 1I4NA 3CLMA 4Z17A 3W1QA 2FTWA 4GISA 1JD7A 5C71A 2CIPA 5IRPA 3RU8X 4MUPA 3PAOA 1DJXA 3EDJA 3G1SA 2Y85A 2HDJA 3LLDA 5KINA 4QQUA 4CD4A 2CKRA 3BW4A 2BXYA 4L6HA 4NP7A 4G2DA 3N18A 3A23A 2BV9A 4FXFA 2QCCA 2ATMA 2GQ8A 3CIXA 3H12A 3EEZA 4DWSA 1XIGA 1FVPA 1BXNA 1IHIA 1FWAC 3ARPA 1KM2A 1WKFA 3VCCA 3EAUA 3BAKA 1JI2A 1B4EA 4NAFB 2ZRUA 1OCNA 2Y2WA 1Q6EA 4Q8TA 1ZTVA 3T0TA 3FEMA 1NTHA 3M47A 1HO4A 1PZ3A 5E6YA 2I9EA 3EXTA 2D2HA 3W7PA 3BMXA 3GZ3A 1YADA 2Z4GA 4CD7A 3MYPA 2A3EA 3WDJA 2RDWA 4FR1A 4QNEA 3UWEA 2I56A 1RJQA 4M7TA 5AN7A 3IK4A 1GZJA 1NP0A 4NHVA 4XIMA 2H9AA 4EK7A 4DELA 3I4EA 4B4FA 2J6VA 4IPIA 2J8GA 3K46A 1CXFA 3V5FA 3W88A 2ZRXA 1OGSA 1TSIA 2BS9A 3UY8A 5HMDA 3WMBA 3GVRA 4L65A 2Z1KA 4ZQNA 4UFLA 1ZALA 3N1AA 4P7LA 4MFEA 3GHRA 1LL6A 4L80A 2YYUA 2ZRVA 3B8SA 4O28A 3AIEA 5I7GA 3TSBA 1WXZA 3N12A 4HSHA 1FQ0A 3KFTA 3MZ2A 1WE5A 2E9BA 3GG1A 3CZLA 2ZUMA 4JYEA 1Y5WA 3OLDA 1NDYA 2WNNA 2J27A 4N4PA 1MDRA 5C5YA 2E4TA 4WSHA 2DZSA 1VJZA 3UFYA 1PYMA 3WQ5A 1VFLA 3IGXA 1K9TA 3R0UA 1XLIA 2ABAA 5I02A 1YTDA 4JFSA 1YDOA 1V51A 1J79A 4DJED 3W26A 5I77A 3CV2A 4MLRA 1HL8A 4ZA0A 4EACA 2VO5A 1R3SA 4B9ZA 2O9RA 1WDWA 4ZE5A 1QWGA 4PBGA 3BE7A 4RNFA 3TCEA 2OOGA 4W4QA 1GQJA 2WWDA 3BTNA 3SRKA 2PU1A 5D37A 4CLMA 3CWHA 1XRFA 4RDWA 3LCXA 4WJEA 4QP0A 5LXXA 1FWDC 4UMAA 1MFUA 4AAJA 3JU2A 4FEZA 1UJQA 1CLVA 1H1ZA 1BKSA 1GEQA 3B9NA 1TPH1 5HMEA 3I6EA 1AJZA 6REQA 5CAKA 4GYPA 3BOLA 5AB3A 1YPIA 2NXGA 2I5IA 1QU4A 1PZ1A 1WAWA 2FQIA 3TJXA 4MWAA 1TVPA 2TPSA 3DGRA 4U4MA 3GU1A 3QZ6A 1ONEA 2ZX9A 3B04A 4J2PA 3LLXA 2QMKA 4C1LA 1OQFA 4WSKA 4DBDA 3GDKA 1B9BA 2WMGA 1NARA 2BOEX 4WZHA 2IKJA 5JIPA 4P5UA 1XS2A 4J40A 3GYEA 2QCGA 3BC9A 1DBTA 5DCEA 2WXDM 3GHTA 3LGEA 3SM0A 4LUYA 4KCUA 4F0SA 1BWKA 2F2KA 3CB3A 4R34A 4M24A 3ZT5A 4AHQA 5CH9A 4CQ8A 4IMDA 4KT2A 1E1CB 2RH9A 4ZQMA 1NAL1 4S3DA 1PCWA 4GI4A 3S2LA 4BF5A 3Q37A 1E15A 3WQOA 1EFZA 4UNIA 1FUYA 4U5IA 2C79A 1R2TA 3M0IA 3WEZA 2BVDA 4PTMA 1TZ9A 2FHFA 5KZEA 1G9HA 5EKYA 1ZS2A 3OZYA 3CMFA 1UC4A 1VLIA 2CWXA 1FWSA 3I3EA 4JHZA 2VURA 1TYGA 3UJSA 1CPUA 3PS7A 3FAXA 4QE1A 2GVYA 3KLLA 2DUAA 3P7YA 1BTCA 3ARSA 1G7VA 4EX4A 1IEQA 4RDYA 4XISA 5T26A 3MSYA 3OQEA 4XKYB 1M53A 3CS2A 1D8WA 3TE9A 5DLCA 3HG3A 1IEIA 4PGLA 4LTSA 1XIFA 3G1YA 3H4WA 2UWFA 1QW9A 2Z25A 2GFTA 4P7RA 2NUWA 4FLRA 2ON3A 4QQ3A 2WVVA 2EJ1A 1PTGA 3TEVA 4X3ZA 4KWOA 5D2WA 3E96A 1A5SA 3LPOA 3EOEA 3QR1A 3KOZA 4RE4A 1KBLA 2XHYA 4QDPA 2Q01A 3GZAA 3E3HA 1BLIA 4V15A 2BHUA 3A9IA 3EGJA 2VRQA 2R1PA 5I07A 1R85A 2B7PA 5I3DA 3IGHX 1PPIA 3G1FA 1FHUA 2QVNA 1PX8A 4D6IA 1MUCA 2WCGA 2DEPA 4CVWA 2WAGA 1BEUA 1FCUA 1QNPA 1ZBWA 4DLMA 3R8HA 5EFFA 1YEYA 1ZJHA 3NO3A 4JNZA 4DF2A 5C7VA 3T9PA 1WQ5A 3GG8A 3HQOA 1UD3A 1XIJA 3F2BA 3PZNA 3R8RA 1AH3A 2W66A 1FH9A 3OBKA 2R24A 2F84A 3TROA 4H8VA 2QNEA 4OBTA 4OFCA 1FA2A 3LRLA 5AYZA 2VVNA 1F73A 1BAGA 2QCFA 3SAZA 5C6MA 3KZSA 4O1AA 1I0BA 4LUSB 3BK0A 3NXFA 3QKZA 1XHGA 4IJCA 2QCEA 2QJIA 1WXJA 2FH6A 1S2TA 2WSQA 3G1XA 4PUEA 3BLPX 3NL6A 2TODA 2VEMA 1IGSA 3SSJA 3NL3A 1EP3A 3G2GA 3ZM8A 3JR2A 2J7HA 3NO5A 4GLEA 3TA9A 1OFPA 4HSOA 1RQHA 4OWGA 3THUA 4MB3A 1AQMA 1R86A 4UTMA 1F3XA 1DJWA 1O95A 2I5GA 1EZWA 4OKDA 1LL4A 1OF6A 4O4VA 1ITQA 2XISA 3BDKA 1AFSA 4MKSA 4FX6M 3AMKA 2PTZA 1P5BA 3AAMA 5AC6A 3VIOA 4RE2A 3U4FA 5JU6A 5HJLA 4KWSA 3OBEA 2ZA1A 3TC6A 2AKMA 2P0IA 5CZKA 1XUUA 4QAIA 3VKBA 2NX9A 3IAQA 4K38A 4OBSA 2QJGA 5CPQA 1MZHA 3CT2A 3QF0A 3H4XA 3WDPP 1OEPA 3BJSA 3W72A 3I68A 4FPSA 4GY0A 1NU5A 2Z27A 1A5MC 3S47A 3H2MA 3KL0A 3EWZA 4IF2A 5BWFA 3BMWA 7ODCA 3I6RA 3VGFA 3ALGA 1TPVA 1K8XA 1JCMP 3GR4A 1REQA 4LFYA 4MNMA 5EMMA 2CW6A 1R47A 1OYBA 4PMXA 4P8WA 4JR5A 4NYUA 5FJOA 3IJ8A 4PL1A 3WQCA 3MKVA 2OR2A 3AFBA 2OGJA 3CH0A 4JTRA 3A4WA 4GZ7A 2Y62A 2XZ9A 3PUGA 2ZVIA 4QG9A 5D8ZA 3THCA 3CHDA 3FKRA 4NYYA 1UA3A 2NT0A 1Z41A 3E0LA 2G8ZA 4MYXA 4V1XA 1XQLA 3J7HA 1DWAM 1LLZA 4TR9A 5ABGA 3ARTA 3G0XA 1OGBA 3UVIA 3MANA 4O0ZA 3PBVA 3RIKA 3L66A 2VGFA 3COTA 3E49A 4YHEA 4XX6A 1TRIA 2VX6A 4HTBA 1HVQA 3FA3A 4PYSA 3O3RA 3WLMA 5F4WA 1PKNA 4JFTA 1RPXA 1EXPA 5H8UA 2V69A 5L6UA 5CPNA 1E9ZB 1R2SA 2NUYA 3CM4A 3PJTA 1TFVA 2BOGX 3EMQA 4IPNB 4M19A 2NT1A 1T41A 2ZUTA 4Q7IA 3SI9A 2XH2A 3ARXA 4HTYA 1KGXA 5XIMA 4ZO7A 1Y0EA 3BANA 3CEUA 4DF1A 4MZ1A 1CLXA 5D2XA 4KGLA 5AHIA 4HNNA 3REQA 4QNWA 3HZ3A 2ANUA 2W0UA 3GKAA 4HPJA 5HWMA 3R4IA 4ZMGA 2D69A 4FXRA 1A3HA 4A4AA 1P7TB 4ZQRA 1YNQA 4RNJA 3AYRA 3EKZA 1CIUA 4OOZA 1OX4B 2QHAA 3IUIA 2A2IA 4LCQA 3KDNA 4JTLA 3MUZ1 1W8SA 3U2EA 2Y63A 3W7LA 1WKYA 3TN3A 5A2BA 3T6CA 1GVOA 1RBLA 4LGXA 1QK2A 1HG3A 3AYSA 2C91A 3E5BA 3ZR6A 3BLIA 2PC8A 4A6GA 3UR7A 4FK9A 1VFFA 3HGJA 1GJWA 3MBFA 4IMFA 1L6WA 3I7SA 3PTDA 3TIMA 2FYMA 3S83A 2EPHA 2ZE3A 1I2PA 1WUEA 3IIXA 2WOQA 3CB8A 2WYSA 2Q6ZA 1T40A 2GK1A 3PTKA 3VU2A 1SYTA 3G0SA 5ABFB 3C2VA 2VGBA 4AC7C 5U7SA 1KM5A 2WHJA 2P50A 2CLLA 3MUAA 3OW1A 4BQ4A 2R1MA 4RUBA 3R13A 1GONA 1M03A 3ZZ1A 2VUYA 3DHFA 4GI8A 2IQ0A 2HXUA 3MV01 3OBAA 4Q4SA 5EMUA 2J7EA 4TOQA 4FR6A 4HHMA 5HOSA 4C6MA 4MWAD 2FKPA 3KCLA 4O1DA 1H60A 3FHAA 5K3VA 2GUBA 4QDWA 4DO4A 4NXKA 4AIUA 4J1OA 5LA1A 3D47A 1G4SA 2ABBA 1R6WA 4NZ4A 5DCDA 2DVXA 3S8HA 4AQLA 3B8WA 4JTCA 1IYXA 1OX6A 3LZ3A 3L67A 4CQCA 5I3FA 3GXNA 4P8XA 4KFPA 3PR2A 1HL9A 2H90A 4LUTA 4IX0A 4CVUA 4QS5A 4A29A 2BVWA 1OM0A 1JPKA 4J35A 2CWNA 3L0NA 3TJIA 1X8FA 3KE0A 4AD0A 1CGXA 4OZOA 2VR4A 3LY0A 3IIPA 4TIMA 4X60A 1EDTA 5T8GA 1QHOA 4OV4A 2FTYA 4RZBA 2PI6A 2CERA 5AHMA 2WV8A 3BLFA 1A5KC 4JFVA 2POZA 1CW2A 4XZHA 2V9DA 1NM9A 1BWLA 4GGHA 1HKIA 3WN6A 1XJBA 2JGQA 2AL2A 5AHEA 1LUCB 1OG0A 3HGOA 2CZDA 2W61A 2CFFA 3TYCA 4R33A 2DZVA 2CBVA 2J7FA 4KF1A 4DYEA 4JQ1A 2PDMA 3H2AA 4N6EA 1RJRA 2ODOA 2VDIA 4LV9A 3WLSA 1V7AA 3VKAA 1AZ1A 5HQMA 5F1VA 4IG2B 3P62A 4UQBA 1IXNA 3G1AA 4REQB 1B2YA 3MMDA 2FTPA 3LOTA 1UUOA 2RJHA 4HJWA 3WQ6A 3DFSA 3ABOA 4BA0A 1GOWA 2G4JA 2OKTA 5G1MA 3RK8A 3LRKA 4PMDA 4W9TA 1R9XA 2XPKA 4HZ7A 2NV2A 1M7JA 1FWGC 2HS6A 1QAPA 1ICQA 6CGTA 1GTEA 3OEXA 2G0WA 4YHGA 1JYVA 3NXLA 1IZJA 1BF2A 5J8LA 1SO3A 1XDJA 2OYMA 2R14A 1XC6A 4Q7NA 3MS8A 4HK7A 3RO6A 1XICA 3S1GA 1MWOA 2OWCA 1HKKA 4JTIA 5PTDA 3M46A 1XX1A 1X7FA 2ZXAA 3GX9A 3QTGA 1KXQA 2J6XA 4DX3A 3MMUA 5BW6A 2YBVA 3M0XA 1FH8A 3UEQA 4EXAA 4DY1A 1H7NA 5F4XA 4LYRA 1UHVA 4B9YA 4GWEA 3P61A 3T4CA 3P8JA 1OBAA 4D2JA 4E2DA 2DGAA 3U2CA 1YNPA 5FJIA 3KHDA 4DN1A 2VOTA 3LM3A 2EJAA 4IOTA 4B3ZA 2BVYA 4IQJA 4ZBCA 3W7GA 3UJFA 2WBGA 4X61A 5FF3A 1JZ8A 3QJAA 2FZ8A 2FZDA 2PP0A 2GLKA 3TONA 1B5TA 3FKKA 3NGFA 3WYZA 2C8NA 4AISA 3V16A 1KM0A 3ITTA 3SUUA 1JZ7A 4LUIA 4AYGA 4JY8A 3IS4A 5LGZA 1BPLB 4CNTA 1DORA 3W2UA 1XSIA 4GVFA 4KEVA 1TMHA 2V63A 3VDHA 3NJ3A 2UZ9A 3CWNA 3PTMA 1W56A 1LLOA 2BXVA 3WO8A 3AS1A 5EB8A 3WF4A 1BFNA 4IT1A 2WSYA 5LIKX 2PLKA 1UMYA 4I3GA 3VNKA 2VGGA 3EWUA 2WJDA 4Z2JA 3GRIA 2CEQA 3RN6A 2IXVA 3Q45A 1TPDA 1RP8A 1JCJA 1H7XA 5I3HA 1QDSA 1KQYA 4HCHA 4B5SA 1GHSA 3LENA 4PL2A 1Q2SA 2A85A 4ACZA 1MMFA 5AC8A 4JGDA 3WJWA 3TQPA 3ARRA 3DI1A 3TDFA 2PEVA 3C8FA 5ABHA 4XBJA 1RVGA 3MCMA 2PWUA 5F7UA 3FDKA 4MKNA 3NM3A 2WLZA 3EPNA 3LNPA 3OHMB 2YOCA 3CHFA 1LF1A 1SJCA 3VCRA 1DVJA 2XVPA 3C3NA 3OA3A 4Q7BA 1WZAA 3OLEA 2VXNA 3W7OA 2YCKX 1FCBA 4G1KA 3VI2A 2HCVA 3HJZA 1T5AA 3C2RA 5JUVA 2D2JA 1S3HA 2D0HA 1YIXA 1CEOA 1DXEA 5FD0A 1A49A 1PDZA 2I9UA 3HURA 5FESA 3C2FA 4ECLA 4HD5A 3LTYA 2HNEA 2V82A 3M5VA 4IP7A 1B54A 3TZNA 1FWJC 5G2WA 1OG6A 4MVAA 3RILA 3C0LA 4IMCA 3ENLA 4TU1A 3V3WA 1W1ZA 1XD1A 3GTIA 1EPVA 2NLIA 5A6AA 1RK5A 4UOQA 2F6UA 2DZPA 1ODZA 4JQAA 4KWVA 2PWFA 1ICPA 4XSMA 1CT5A 3WELA 3SCSA 3O6AA 1EP2A 1ISVA 5HWJA 1KRMA 4OE7A 5D09A 3RR1A 1K4GA 1AMKA 2J66A 4FNUA 3U5YA 4IQLA 2PWDA 4HHHA 5B7ZA 2F61A 1Z9AA 4GFSA 3QH2A 2V5JA 3NQAA 1S1RA 2YL6A 3ANUA 1NH6A 1B0IA 3B0UX 3VGGA 3MA8A 2WQDA 1DL3A 5JBFA 1SZEA 1IT7A 1G4TA 4W5UA 1ZP4A 1OYCA 4AZGA 3VUPA 4DJDC 1M7XA 3FGCA 5LA2A 4P2VA 1A3XA 2EG8A 2WJFA 4KESA 4EPDC 2X30A 2QGYA 2YDAA 4F3HA 2NXIA 4XVEA 1QHZA 3WEMA 3EWWA 4RW5A 3B4YA 1LOLA 1JZ4A 4DUOA 5HNNA 4QISA 4HK6A 1FKWA 1UBSA 4W93A 3ZFHA 4ZO9A 2QJNA 4HU0A 1JFHA 2Y7FA 1DQXA 3M44A 3VKKA 2JIWA 1ZGDA 2O9OA 3N11A 4XV0A 4N9BA 1OY0A 2QCMA 3IJDA 3PB0A 3MWAA 4AWTA 1J5TA 1L2QA 2X42A 1QASA 4R5EA 3NNTA 5AYBA 3GFXA 4X0NA 2HE8A 4TX9A 1VIZA 1LRTA 1TJ2A 3P0WA 1WP6A 5MKGB 3TR9A 3LCWA 4POCA 4C6KA 1EC9A 3OYZA 2OPJA 1WDQA 3TOYA 4AF0B 1NSJA 5HUOA 4CKQA 4FF7A 4PUNA 1SO4A 1ZJIA 4UIOA 4UBPC 4JX6A 2ZRWA 2R1KA 1O7AA 2P5NA 1XIBA 3GNNA 2QDGA 3H55A 2D22A 2H3BA 4TV5A 3IGUA 5CZ0A 4AD5A 1A47A 1GVFA 3ZS4A 4WVXA 2G5WA 1JQXA 3C2OA 5AKQA 5EMJA 1G7UA 3LLFA 3WL1A 3WH5A 2DT3A 4HA4A 3DG6A 4XBSA 4GQGA 4ATWA 1MW3A 3AXHA 3E5PA 4H6KA 1XLBA 3MYOA 1W5QA 3GB6A 2E09A 3GHUA 2ZFAA 3VFCA 3FVDA 2FHBA 1XM3A 4ZQPA 3T4WA 2XSAA 3WH8A 2QCDB 3FJNA 5BXRA 3SO7A 3NL2A 1EX1A 4WX2A 2Y8KA 4ZB5A 1V02E 2HVOA 1J10A 3U2ZA 2VI0A 1XISA 1JGMA 4D6JA 1TPWA 5DX7A 1GVRA 1HP4A 4LYKA 1E51A 2TYSA 4YIWA 1UOZA 7REQA 3ZO9A 3LV5A 3F4DA 1TE1A 1S2CA 3W7KA 1TVLA 3VO0A 4M6QA 1OVDA 4I9JA 1VEMA 4KFOA 5BOEA 4H00A 3CZKA 3NSMA 3ITXA 3VKDA 1SFJA 2F7FA 4C6FA 4GHRA 1UR2A 3SN1A 4L4PA 2J9ZA 3P67A 4BZYA 5CZJA 3H8AA 1QI4A 4H8NA 4EPEC 3RO8A 5CZSA 4PUJA 3D46A 5I3GA 4R9XA 2CLMA 4UQCA 4QCEA 3BGGA 2J8FA 4JEJA 2PGWA 4J3TA 4E8DA 2YX0A 2QZRA 3SY5A 4HA1A 1GW9A 3FY1A 4PCPA 2J7CA 1JDFA 2Z2AA 4JTUA 2GPTA 4PB4A 4G7FA 3M1ZA 4MMWA 5FAJA 1HF6A 4NAFA 2Y7GA 1SSGA 1VCVA 2DUXA 1VFUA 1YPFA 2QV5A 4QTGA 4O10A 3I4KA 3MWCA 4DLFA 4C60A 1XDLA 3S6OA 2MANA 1QBBA 3LI1A 3U7BA 5HNUA 3GUGA 2NSOA 2VNCA 2OSWA 3L2IA 5AZ0A 3ITCA 3B8TA 2WHLA 4RXFA 4NZJA 4B2DA 1UPMB 1A5CA 2A7PA 4RKAA 2H8XA 1SO6A 2GDVA 1ENUA 3LGDA 3IARA 4F48A 2RHGA 2F8QA 3LRMA 4LYPA 3BICA 4HIBA 1ZRQA 3PBWA 3IJIA 1UKSA 3U9IA 4C6LA 4D1JA 4O0QA 5D30A 3W87A 2YLAA 3HBLA 3L4TA 3RHGA 1HZYA 4Z0JA 2R91A 3T8LA 2EGZA 1TJ1A 3NZ1A 4HJFA 4D8ZA 1BG4A 1YYAA 4W89A 5I6SA 3QKEA 4C6QA 1GORA 1V7YA 4ROQA 3SCRA 5D9MA 5D9OA 4IGSA 2X1UA 1AW5A 1ME9A 1TWIA 3MT1A 1F61A 4CNSA 2YFNA 4TVUA 1XRSA 3GXPA 3SEPA 1ZQ5A 2XM2A 3DC0A 5JH1A 1W54A 5EMKA 4CCZA 3IIOA 1EXBA 1TELA 1NJJA 2EKGA 4ADSA 2PLMA 3GDRA 4GPNA 4ZXLA 1AA1B 3L0KA 5BWAA 2ZE0A 2QCHA 1HKJA 3W71A 4LNYA 5BROA 3KVLA 3ZSSA 1FX6A 4NJIA 4JYFA 1EL3A 2W4XA 4D6FA 2QCLA 2PURA 3MB9A 2P8CA 2R6OA 1ITCA 3H21A 4ATLA 2V81A 1GVQA 1UJPA 4JIEA 2I7GA 3DX5A 5JIWA 3WFAA 3CAVA 3MCOA 1O12A 1XRVA 7A3HA 2RAGA 4PB5A 3ITLA 3MV11 1UMLA 5BRBA 2XVNA 2JFEX 2J9XA 5A6BD 4GUHA 4QJ5B 3GC5A 3IUHA 4K6AA 3CUZA 4AXNA 1BGAA 1U5JA 1DE6A 3OVPA 2Q8LA 3T78A 3ZVHA 3DHDA 3VABA 5IHSA 1BVWA 2WCAA 3V0UA 3UQNA 2EPOA 1AK5A 2HXTA 1VFSA 3TC3A 5JXQA 4LY8A 1Z42A 3PBUA 3TUUA 3BV4A 4UZSA 1H09A 4AUBA 4Y2WA 1IR1A 5E5CA 2ISWA 1BGGA 2FVLA 3L2LA 3UXAA 1UKOA 5CBJA 4YTRA 1NOUA 1VPXA 4JTDA 1TG7A 4ZR8A 4ES4A 1E0WA 4Q4KA 3FXYA 1NIUA 3SQLA 5A6JA 1DIDA 1E1CA 3N9SA 3UR2A 2VKZG 3QV8A 4DI9A 4NZ5A 1V08A 3W07A 2UY4A 1DQUA 3FYYA 3ZR5A 2XN1A 4J27A 3S9IA 4H2HA 3UNDA 3P74A 1EYWA 4UTJA 4CEXC 1FXPA 1KKRA 3CAQA 1NF7A 1G67A 4JY9A 3V5CA 4HA0A 3SCTA 1BKHA 4UC5A 4JAWA 2VWSA 1AQHA 1UYQA 1KA9F 3T42A 3TWAA 4UQDA 1UP0A 1TRDA 3HGRA 3AMGA 4OUEA 1XL9A 4IIGA 4XZIA 2YJQA 1KKOA 4IM4A 2VFFA 2DP3A 2QPXA 4M0XA 4XKYA 3WJXA 1TV5A 3T0BA 4V2XA 2XG9A 2FDMA 5I3KA 1UD8A 2GUYA 1FCQA 2V5KA 3HU7A 3N14A 2OG9A 3PPFA 5HJXA 2Y4SA 4WY0A 4MJ4A 4IIHA 4M5PA 5H2ZA 4PUWA 2V38A 3W3OA 3GSMA 4DXXA 3QLLA 3VILA 5JBDA 1VS1A 3ITGA 3GW3A 3ZQ9A 2PD5A 4Q8VA 1YXCA 1W9BM 3WQVA 4I8YA 1HJVA 1GYNA 2POTA 1NFGA 2E77A 5I79A 4Q4OA 4JBRA 1TX2A 3A9BA 1T7LA 1SR0A 5LNVA 5CC7A 2J79A 4IH3A 4YTSA 2YXXA 3PF3A 3G3DA 6A3HA 4EWND 4GYKA 4YTTA 3W1XA 3DOPA 5M1TA 3AIWA 3GS6A 3RLUA 1YX1A 1B3ZA 2YDQA 3UWVA 4DZAA 3QR3A 1EA0A 1KXHA 3KRZA 1HVXA 3QZEA 3EWYA 5LIUX 4DBSA 5A8OA 2A3BA 4HPGA 3W1TA 1QPKA 1M41A 4AG0A 3W01A 1TO3A 3ZLFA 3W37A 3JZUA 2ZWYA 2RGLA 4L9XA 1OB0A 3LTPA 1R87A 4DXVA 4C6EA 2J75A 3JRKA 2A7RA 3PFMA 4G6CA 2CBUA 1K77A 3CUJA 3V75A 5H6HA 1Q8JA 3ARYA 1PKLA 4LPCA 3VKJA 2X8RA 1WDDA 5D02A 4M6UA 3LUTA 1Z3NA 1AL8A 5F4SA 5AC5A 2DIJA 4P8VA 3WZ0E 2OSXA 4NNCA 1LRNA 3MUY1 4J3VA 3SCOA 1WZLA 1BG9A 4LUSA 5G1YA 3KBVA 3GXDA 5DF0A 2VFEA 2X0HA 3NFUA 4MY8A 4AWUA 3BV7A 4RK8A 3A3XA 4WR3A 1XG4A 1EQCA 3KTSA 1X39A 1KCXA 2G96A 1PBGA 3OZMA 3Q94A 4A21A 2VZTA 1KBJA 2VFIA 3CQHA 4PB3A 3PUEA 3WKZA 1O4UA 3FVMA 4AD1A 3R10A 4MG4A 1KO0A 3QBUA 2ISVA 3PBGA 4XZLX 2PDUA 3PVFA 4ZQOA 3DHUA 4NRRA 4QHRA 3RX2A 3PBYA 1XGEA 2ZXQA 3T1GA 2DQWA 5A69A 3UZJA 4PODA 5IXEA 1J9YA 3RR4A 2X7VA 2W92A 4N6FA 4JFWA 1XYMA 1BD0A 4UMBA 2P0OA 4Y7EA 3VIGA 4GC3A 4JTQA 5CPLA 1QPRA 4JN8A 4PZVA 2OU4A 1POJA 3E0VA 3RG6A 5AVHA 2NVDA 2VD9A 4AY8A 3UF9A 4JN7A 1OFQA 3BOFA 1VFTA 4NG3A 2G3FA 3U6WA 4L6OA 5CJNA 4PCTA 4JPGA 1YE6A 3LCGA 5F2MA 4HSNA 3E2VA 1C8VA 3GD6A 4B5UA 1P0DA 3W74A 4QR6A 1P6BA 2QCNA 8RUCA 4MFDA 3TCSA 2PPGA 3U5UA 4O15A 4GACA 3PZIA 3M0VA 3SCWA 4DEFA 1I75A 5FJTA 3CPUA 2G50A 4BK9A 3L4XA 4JTJA 1WOBA 3EB3A 4TV6A 1QJWA 3IIZA 5HATA 4FNTA 3G6LA 1F6YA 1J0HA 4U2YA 1HNYA 4AD3A 5HDRA 2NQZA 5D05A 1NWTA 2NQLA 2E5BA 4Z42C 1E5NA 3B05A 5G4EA 3A3WA 4Q3MA 2ACSA 4H9ZA 4MPKA 2PRLA 1NDWA 6ALDA 3JS3A 3ZT7A 3HB9A 1BWVA 2CESA 3EOUA 2G3NA 3NG3A 1OFBA 4EWJA 5HNRA 4MJMA 1L6YA 5CG7A 3NQFA 4HP5A 4AY1A 4Y9OA 4LAKA 1QW8A 4QDMA 1VHCA 3CIWA 4CD6A 1N8IA 1FWEC 2PTYA 3N2TA 3QYSA 2RJGA 1X38A 1Q7MA 1QOPA 3GAKA 4YL2A 3GM8A 3UCCA 1MW2A 2YCEA 3GTNA 2PDFA 1XLEA 5FF0A 4XB3A 1AG1O 4ENLA 4GUJA 1DE5A 4S38A 2J7BA 1CZ1A 5BCAA 1JPHA 1B3YA 4B2DD 4YLWA 4ZO6A 4LRSA 1J93A 3PZMA 4E38A 2ALRA 3GNPA 4B15A 2BX7A 4TTUA 4GQ0A 4C6BA 3TV8A 1SJDA 1OZMA 4R9OA 3UETA 5LNUA 2GZXA 4HBKA 1Q4NX 2E25A 2FMNA 2PWHA 4FLSA 3PG8A 1A5AA 1EYEA 4Q8MA 1UZDA 2AAMA 2A3LA 1GOXA 1HX0A 1OX4A 3GR8A 2YKKA 1PSCA 1PZ2A 2ZUSA 4URIA 2OQHA 4HOWA 3GDLA 2DY3A 1ZJAA 1EPXA 2VD8A 3N3TA 1ZBKA 1LQ2A 4IMAA 4ZTXA 1HJWA 1LORA 1UCWA 3AMLA 3FJ4A 4Z1BA 3UR8A 1FH7A 3W27A 4DO7A 4MY9A 2OZ8A 1EEXA 4FXJA 1OCQA 1P0KA 1KQZA 1O1HA 5GQBA 1GNXA 2E8YA 4OV9A 4P7OA 1KRAC 4GY1A 1H5YA 4WEVX 3LPGA 3AIRA 1KFEA 5B7YA 1A5OC 3GC4A 3U3HA 1MI3A 3LMYA 3PN8A 1MSSA 3B9EA 2E5CA 3B8DA 4LW7A 5AZ1A 3O05A 5ABFA 3WJSA 1PWLA 3DERA 4IISA 2HROA 1R8LA 4JL1A 1Q6OA 1E6RA 2ACUA 1AJ0A 3G8EA 3BSMA 4O13A 3F03K 1GG1A 1XLMA 1FHDA 3CZ8A 2C14A 3OTRA 3ES8A 4NX5A 2PDGA 3EX1A 1LTDA 5C2XA 5CSRA 2IUZA 1VFOA 2QUMA 5T9CE 4C7GA 2V2HA 1WNOA 1OC7A 4QLJA 2FPYA 5T9BG 4DNMA 4RZ6A 3RMJA 2GQ3A 2XVGA 2JIEA 3SCPA 1ME8A 5F2IA 4AEEA 3TYEA 4AU0A 4Y90A 3QQ0A 3TK7A 4KMQA 1ITUA 4AC1X 1P0EA 3CYVA 1NFPA 4AFYA 3OGRA 1IZKA 1W9PA 2PDQA 2WMHA 1EH9A 1UB3A 3NQ8A 3BAXA 2D24A 2PDXA 1FTXA 1IZCA 4R3UA 2EO7A 3VX0A 5G4HC 5A95A 3A3HA 2E68A 3F5KA 2XH4A 3HQ1A 4XAPA 3QN3A 3VUSA 1EGZA 3UYIA 5HQEA 2FGLA 2X2GA 2DSZA 3UP8A 2NQJA 4XAZA 3OQ8A 5CGQA 3K1DA 3DYMA 3IACA 4FNSA 5FEPA 3WLQA 1TR9A 3LQLA 4FSAA 1XFCA 2J4GA 4AH7A 3GU2A 2GJNA 1HKMA 3BAYA 1IF2A 2XSXA 4IFRA 4YVPA 4GFIA 1RHCA 4UFKA 4C1NB 1R30A 3N3MA 1LUCA 3NA8A 4KRZA 1XIHA 1US3A 3SCQA 3W85A 3LX9A 3TTQA 1KCZA 1ZNNA 2W27A 4UCGA 2IS7A 1R38A 5I3IA 1NELA 3GR7A 3Q67A 5A8PA 4AX7A 4QEEA 4N2YA 2E9LA 1H63A 3FLUA 2D2OA 5HR6A 1P0NA 4IG2A 4D6CA 4MM1A 4RW3A 1H7RA 3UY7A 4REQA 1S2AA 3UJ2A 1WZKA 5BMWA 4UXDA 3DG3A 4JX4A 2EG6A 3EWDA 4GG9A 1MNZA 5AHFA 4WGHA 1XGZA 4QJ1A 4E8GA 4JXCA 4L1WA 2Z26A 2X1TA 5JMUA 3TSDA 4DBUA 3P81A 1V6TA 1VZWA 1T8QA 5KTLA 4GC4A 3G1DA 4FOJA 1PZ0A 1P6CA 4AB4A 4LAMA 2FGBA 2OT0A 1H41A 1EJXC 4ZZ9A 3HQNA 5AHNA 5DY3A 4E4PA 3IIVA 2ZZ1A 1FDZA 1KLYA 1WV2A 2V67A 3AHTA 2XFRA 1JFXA 4E6MA 4TX8A 3G77A 2GGEA 5D38A 1FFQA 3ECQA 2BXZA 3CWOX 4PN2A 1NDZA 4Q8PA 3WG6A 3H54A 1XLHA 1BYCA 2NQ5A 3MSDA 1UWIA 2C1GA 1NQ6A 1Q6QA 3TP4A 1GVEA 3AICA 3IV8A 4PMVA 3W00A 4I6KA 4AIBA 1W5NA 1D9EA 2CHNA 4OJYA 2A3HA 3VNDA 5J04A 3OZOA 4UTTC 4YJ5A 4AYSA 4JTFA 1ZL1A 2V5DA 4I8DA 2ZBTA 2PRHA 3GWQA 4MJ2A 2F2HA 4K37A 1TWDA 3E2SA 4EOUA 2VHLA 2D3LA 5HK4A 5TQLA 1Y7VA 4MDPA 3MHGA 4GY7A 4XD5A 1H51A 3VA8A 4HOZA 3H7UA 4JTKA 2GUUA 5CSSA 5FL0A 2ACQA 4DB7A 1XYLA 1W5PA 3SGGA 3W1UA 5E9AA 3BSHA 4M8UA 4GI6A 4I7VA 3IJ9A 4Q8OA 4S3GA 3DKJA 4D71A 1R3TA 4GJJA 3VINA 2HEJA 4LC6A 3WUGA 5DY2A 4GH1A 1H49A 1ICSA 3CUXA 4XBKA 3TXVA 5FIPA 3KEHA 3IEBA 3TN4A 2XJ7A 2WKGA 2YBUA 1KM1A 3MW7A 3UG3A 1U5VA 3SURA 1J01A 1NDVA 3A4AA 3AXKA 3T07A 4X63A 3TJLA 3GLCA 4F0HA 1LBLA 3GTFA 5GNYA 2OB3A 4JN6A 2QDDA 3PBMA 4CCCA 3DH7A 1K9DA 3DFNA 2GVJA 1IEXA 1IQ8A 3K5XA 3EPOA 4O8RA 1JDDA 1VCFA 1VQTA 1W37A 3BAWA 2RGMA 3MMTA 1X98A 3W7QA 3N4EA 5M5DA 3KS5A 4OBRA 8XIMA 1MYRA 5L9FA 4A35A 4M6VA 2E28A 3GK0A 2BZNA 2E9MA 2HS8A 2WVTA 1HXJA 2AQVA 1B9ZA 1OFAA 2EXOA 3V0SA 3QOMA 3GNXA 3FSUA 4HNUA 1KWGA 3GO2A 2JF6A 1XH2A 4JHMA 5CBBA 4QX4A 2F6KA 1UWAA 3RJYA 3OG3A 4E3TA 2A21A 3FHQA 2PGRA 1NWRA 1MQPA 4UTLA 1H3GA 2XWDA 4EAMA 1MW0A 5G2IA 3L68A 5K4XA 1OFOA 1HO1A 1GVIA 2UY5A 2GJLA 3NPWA 5D4YA 2GDQA 5EBAA 1NVMA 1RCXB 3KDOA 3VVGA 3ANVA 1DJIA 1GOMA 1OT1A 4PC8A 3M0ZA 4WCJA 5FF2A 4XZNX 4CU7A 2X40A 3WLNA 2DDXA 3CAKA 1Q65A 3AHYA 3RU6A 1TV7A 4K2SA 3WD0A 1WCGA 3WL0A 3DI0A 4ERAA 4H6EA 5I00A 4AZCA 1ZBCA 3GTHA 2CZ5A 3VIMA 3RYSA 1TTPA 2VC6A 4YTQA 3QZAA 4HOXA 1WO2A 2GWGA 2ISFA 4JTSA 3C6CA 2VEIA 5A6TC 3T44A 1I1XA 2BLEA 3AMCA 4HZMA 2Z6JA 3CV1A 1OFRA 3UR5A 3ZVIA 3AUJA 2QPSA 5EU9A 2BY2A 4M56A 3DFOA 4YTUA 3S2JA 1ECQA 4AMCA 1RP9A 3PB2A 2JEQA 3VDGA 1DWJM 3LA4A 4HK5A 4MNKA 1DJGA 2EKCA 2Q8XA 3T2PA 1CYGA 1Q63A 3THDA 5AC4A 1CB2A 2WZIA 4LVAA 3EXSA 4S3FA 3HPXA 4B3KA 3LXBA 2B81A 5KEZA 4KWUA 3OZPA 1UH2A 4IFOA 4BFAA 2OODA 3F2CA 3WY1A 3P0XA 4DWDA 3EDDA 1X8CA 2VQUA 1ADOA 3POHA 2W63A 4MKVA 3RPMA 2WKLA 5C55A 1LWJA 3MP5A 3HGSA 4IIEA 4C6IA 3VAVA 1H11A 5MKGA 1GGOA 2NXHA 3NQDA 3A6OA 3RF9A 4AF0A 4EP8C 3RPDA 1LP6A 3AJXA 2UBPC 3MKKA 1RQEA 4Q4RA 3ITYA 4KW2A 3THQA 5EGRA 4XUGA 4PH6A 1LROA 4E0CA 1J0KA 2OCZA 3WJZA 1J11A 2ZTJA 4UCFA 2JK2A 3VNJA 1UR3M 3UG4A 5KETA 1TV3A 3NQBA 1V3HA 1TPFA 3GXMA 2Y5SA 1SU5A 4XO7A 4LS2A 4ZSUA 4N42A 2X09A 1D7FA 1J0ZA 1KR0A 2VC9A 4FOKA 4LRTA 1SW7A 4UTWC 5IFTA 5FJPA 2C1IA 2I14A 3DIPA 1KR1A 2AAAA 3KCOA 1TVNA 1XINA 4AMAA 4GCAA 2XUCA 1E71M 4C1KA 1HQTA 4ICNA 1KFWA 4XTDA 3NZRA 4YMZA 1EGMA 2G37A 1KM4A 4LSBA 3GNDA 1Z32X 1V93A 1XIMA 2R1NA 4MWAB 3KP0A 1RA0A 5F1UA 3V7PA 2VX7A 1DQWA 3ARWA 3S5ZA 2J7GA 4CCDA 1E3XA 1ZCCA 3GIQA 2DT0A 4BQ3A 1U5HA 3SGZA 3WENA 2QCDA 1PAMA 5LA0A 3V1HA 3CGTA 4WKFA 3ZMRA 1LG1A 2XM1A 4XTIA 1XUZA 4JS3A 1Q5MA 1OABA 3WDHA 2FPTA 2QIWA 3S2MA 3SY1A 2YIHA 1LCOA 3BPWA 3FDGA 1RR2A 4LNCA 3ZJ8A 1G69A 3L4ZA 2DZAA 3WQ8A 1WXYA 2VX5A 3DFPA 3VOGA 5C8BB 4R7OA 3WF0A 1W3NA 3VDBA 3UGVA 4XK2A 2QW5A 3OP2A 5KZMA 4O52A 2VR5A 5C9ZA 4NZFA 1M3UA 2OX4A 3E12A 1EUAA 1O66A 3RXZA 2YXGA 4Q4PA 1IWPA 1V6XA 4ADTA 3DAQA 3V18A 1UD5A 1QNQA 3K4WA 3KL3A 4IGHA 2PRMA 2XIOA 3C0QA 4N9CA 4H9TA 4M81A 4UNLA 1CXHA 3NQGA 3L7RA 5XIAA 1NY1A 3IVSA 2QMJA 3AS2A 5SWUA 4KRTA 4QITA 3VOCA 3T0CA 3G24A 4BY3A 3PZ9A 1G4EA 2HE5A 3LM7A 3R5EA 2HTMA 3ALFA 1I2QA 2C1HA 3CXOA 3G6MA 3M6YA 2OVLA 3W22A 1EJVC 1BQGA 2WC7A 4ZVJA 2NV1A 2BY3A 3PJWA 2QYGA 4GI9A 1SZGA 1QI3A 3WMLA 3P8IA 4D8AA 4GJ1A 1E6ZA 2HVNA 2FH8A 2OGYA 3H70A 4H04A 3EOOA 3BQ6A 3MUIA 4B5TA 3EMZA 1IIHA 2CZVA 4L4MA 4J28A 5KITA 1H1NA 4PCNA 4YXGA 4U33A 5K9XA 1UC5A 1VEPA 3ABSA 5HPCA 5E9XA 4M29A 2R94A 3MC5A 3GFYA 5MF5A 3POCA 1ME7A 5HBFA 2B7QA 2VC5A 1UKPA 1RZMA 4DUWA 3UZWA 4KKXA 1UR9A 4JTAA 2QAFA 3URAA 5CSUA 4ADUA 1A50A 4BEQA 3TYUA 1TV8A 4UR7A 1QXLA 3BL3A 3ID7A 4DJFC 4W8AA 3CUHA 4LU0A 1HJUA 2VTFA 1T8XA 1I1WA 4D72A 3TN5A 4HMCA 1EHNA 3L65A 4US5D 4LY4A 2WZTA 3S0CA 1TB3A 3AUOA 1LT7A 4BF7A 3AIBA 5H8MA 1BYDA 3R94A 4RNHA 3QMRA 4BHYA 1ZB5A 3L5MA 2P3EA 3NPVA 5C54A 1ELSA 3K4AA 4GABA 4NJJA 4IP5A 1TCMA 1KW1A 3WNMA 1IEVA 3OPSA 1SM9A 1IWBA 1ISZA 3UCDA 1CENA 3QGVA 4DXKA 1RUSA 4UZUA 1K03A 5BZAA 3KWXA 2ZCGA 1N55A 4ILSA 3NQMA 1ESWA 4GBDA 4LF2A 5AFDA 3BQ5A 1E3ZA 1OGGA 4AVOA 3SCNA 5DRIA 3LCLA 3D0CA 4W88A 4DUXA 3AZRA 2REQB 3FIGA 4I9TA 2DU2A 4B5XA 1YNYA 4YNGA 4K8EA 1C8QA 3O7UA 3G3MA 3W7DA 5E1QA 4IL2A 2ADAA 3TTOA 4IXHA 3UT0A 4ACYA 1HIZA 4TMCA 4UTHA 2PLJA 2GQAA 3LEPA 2WHMA 4KIEA 3UVAA 2FJUB 3N15A 4LJ3A 1PEZA 4O19A 1M04A 2X05A 1PO9A 2WM0A 3HIJA 4DJFA 3C8NA 4M1BA 4O1CA 5LXEA 2BGQA 3RRXA 1YMYA 4V28A 1Z44A 2O7SA 3VIFA 1QCWA 3GDMA 3LPPA 4UTFA 1FKXA 1V3JA 1XYCA 1AW1A 3VNYA 1UR4A 2CZFA 4CN1A 1OZQA 3R0DA 3PHAA 1C93A 3MDUA 4DYJA 4LAOA 2D1ZA 4X9YA 2P88A 2OO6A 1VYSX 3ARZA 5D9PA 3DN5A 2FB3A 4FAMA 4R7JA 1DIOA 4AHOA 4RL3A 5HNTA 1J5SA 1XD0A 1ZU8A 2W9MA 4OIFA 3RPTA 1RD6A 4NI3A 4NU7A 3UZYA 3W7MA 3O15A 3TW6A 2NW0A 3UW6A 1XSJA 5I09A 2GGGA 3SB0A 1EIBA 3HN3A 2RDTA 5IHRA 1TE6A 4F79A 3RX3A 3H2OA 2IPJA 1JJKA 1CECA 3QPEA 1TREA 1KFJA 4HNCA 1RSCA 5T91A 4LCSA 2OSYA 1PE1A 4M3PA 1RD5A 4I7UA 2KZHA 1W1TA 3PC0A 4GH3A 1K9EA 4PMRA 1Z8AA 2PF8A 4Z2IA 1WUFA 3QQWA 4L9ZA 1CI1A 4JKMA 3NUKA 2BOFX 2CLEA 1QRQA 1FXQA 1PIGA 3KOXA 4KCVA 1ZAIA 2RUSA 3LK6A 3PFRA 3CTTA 4PMNA 3WBEA 2FLIA 1YDYA 2JKAA 2WSPA 1SMDA 4QS6A 3WLHA 2O7QA 3IJ6A 2P1FA 5I78A 2YB1A 5HAOA 3NGJA 2VENA 3GU9A 4MAVA 4I5XA 1X96A 2DUZA 2MNRA 3KW3A 2GL5A 1O5QA 3W4RA 1XSKA 3NWRA 3TQVA 3AWNA 2Z2UA 2A1YA 2W67A 2ZRZA 3P80A 1MNSA 5LKYA 3NVDA 4JCLA 3KM8A 3C0JA 1VRXA 5LYRA 5AECA 3WBWA 1XBXA 3G1VA 1ODUA 3ATZA 2QULA 4E4UA 3VC5A 3M0KA 3II1A 4X2RA 5LIXX 2OFJA 4RZ5A 2HNHA 3CZGA 3V4BA 4GOAA 1UWQA 1W1VA 3L4WA 1MXGA 2PA6A 1OFDA 4J3ZA 4UQ9A 1K6WA 3QTPA 1XPYA 4WDUA 1FWCC 3EB2A 5CPSA 3W9ZA 4J5NA 2C13A 2BY0A 2A3CA 4F2TA 1C90A 1B3OA 2OYLA 1SZFA 3REQB 3MSGA 2Q8ZA 1E1FA 3W73A 4DZHA 3W53A 4ZL1A 2PDBA 4WIWA 4C65A 1DTNA 1HFBA 4ZB2A 4G8TA 3OB8A 4WK9A 2CC0A 2ICSA 4EPBC 4RE0A 3N04A 3WQGA 3WF2A 4JKKA 2WZMA 4U31A 4I5UA 3RMEA 3NQ2A 4MHBA 3ITOA 5D2TA 2BBFA 3H2CA 2YA1A 4GD0A 4R7WA 5CZTA 4AVNA 1QMLA 2FVMA 1AD4A 1GJPA 3SCUA 2HSAA 5CAHA 4XO6A 2ZC1A 5GJMA 1JPIA 1OIMA 1L6GA 3WDIA 3WLKX 1X6NA 2JQXA 3WBYA 4HPHA 3PNZA 1FOBA 4JDBA 4FOUA 5TIMA 3B9OA 3H26A 3NOYA 4US6A 4F2BA 2X2YA 3TTEA 3GBDA 4LOCA 4EF9A 4C6JA 1NOWA 3TYAA 4HVXA 4OOUA 3T09A 1GG0A 3AZTA 4EF8A 4W8LA 1I6NA 3RFAA 1R46A 1I45A 1VIWA 2GK1B 4PTNA 5A8QA 2VVSA 1OC6A 2BODX 4PA8A 3TXZA 2B7NA 2XVLA 5DRCA 3CZJA 2IPFA 4GUIA 4WOZA 1KXTA 1Q6LA 3L12A 4Q8WA 2FMOA 1XLKA 2TAAA 3LS9A 3NSNA 1XLGA 1FWRA 2V3DA 3S42A 1OIFA 4PSPA 3NAVA 1ONWA 3OIXA 4EXQA 1DWHM 1HKVA 2PC4A 3B0YA 3NR0A 2BVTA 4LANA 1QOXA 3AISA 4E2BA 1Q3NA 1CXEA 1Q66A 4HMEA 2FZ9A 3A21A 2O4QA 1Q13A 1R3QA 5BU9A 3JW7A 2E1WA 4MY1A 3IRSA 2DSWA 4LB4A 2YDRA 5LIWX 1S2WA 2Z29A 3Q4DA 3GVGA 1E70M 1W31A 2QIIA 4LUTB 3N2BA 1ML1A 2Z1XA 3W38A 3M9YA 3OG2A 1C3FA 3UNTA 5KZDA 4NRSA 3NSXA 2G41A 1E6XM 2WMIA 1TPUA 3W25A 2PODA 4TTGA 4K36A 1S2UA 2XH7A 1JUKA 1TPEA 4N9DA 2Y8UA 3KBMA 2VUNA 4LV4A 5BRPA 4P7NA 3OA5A 3VE9A 4PBEA 2XU2A 1J6OA 4ZODA 4DJEC 1GK8A 3EDFA 4LS0A 3WLJA 1SGJA 3FN9A 4JOMA 3KCJA 2Y1HA 4C6DA 2GJXA 4INFA 1E1EA 2YW3A 3MO4A 2Y70A 1KRCC 1CNVA 4D6DA 5CCZA 3W2JA 2BG5A 1QATA 4ZTYA 2EPLX 4JIQA 4XSLA 1H62A 2JGYA 2EPNA 2YZRA 4EXBA 3N13A 3PK7A 3UESA 4C6CA 1XBZA 3A24A 3LHVA 3RM8A 1ONXA 4GX9A 1SR9A 4LS1A 5CPOA 3H53A 4MF4A 1XXXA 4MSSA 4DWSD 3ITVA 2OYKA 3MU7A 4GKLA 1UUMA 1TMQA 1CB7B 4NZ1A 2V3GA 3A13A 4RJEA 1XWYA 4XZ9A 3SFKA 3DHPA 1Q7ZA 3CNYA 1SZRA 2Y6ZA 2AMXA 1SPQA 5C9UA 1CTNA 3BLDA 4N0RA 1YTKA 4R53A 1XI3A 4H8UA 5A6LA 1V02A 2XIMA 4JIRA 4AD2A 2J25A 3G18A 1LBFA 1KFLA 3BLLA 1W3LA 4XD3A 4L61A 4DJEA 3OLIA 3MJYA 2G4FA 4FIRA 2BTMA 2RDUA 4HB7A 4D8LA 1K8CA 2O56A 3QSRA 5DMNA 3KAOA 1AVAA 5IDZA 1LT8A 4YWIA 4W5ZA 3CQJA 5FACA 3CPGA 3USZA 3SFWA 1P4CA 3EWXA 1N2VA 1DJZA 3AYTA 3TYBA 4NNAA 4DZ5A 2A79A 2YCLB 1W32A 3SSZA 4JYDA 3SCVA 1RPKA 3IAPA 3QPZA 1Z69A 3WLTA 3ARQA 3FNDA 1KBIA 3BWWA 2CU0A 3W1PA 1Q4WA 4PRWA 3BUVA 4LEQA 2G3IA 2C7FA 4Z1DA 3TSMA 3WLRA 3CQ0A 3C5QA 1O60A 1XCXA 5JQ9A 4J9JA 3L4VA 2PU0A 2ZADA 1PUDA 2FFIA 3MPGA 3EB4A 3F5JA 2GSEA 1ZY9A 1QTWA 2VZVA 4JQ3A 1B30A 3N29A 4PR4A 3L5LA 1IXQA 3PWAA 2DZWA 4IHCA 2A6NA 3QY8A 4O12A 4CNOA 4KGJA 2Z00A 4MYAA 1PHWA 2Z0IA 4N9EA 1BQCA 4KETA 4R27A 3HPFA 3WH9A 2A3AA 2QJMA 4FHAA 1LQAA 4HKPA 4MAZA 3L21A 4IPJA 4E2VA 1LOSA 3O6DA 5DFAA 2PWGA 4K7YA 1SW0A 2WHKA 2QVHA 2OQLA 1VYRA 2ZZ2A 4NI8A 5FL1A 2XFYA 2UV8G 4CNPA 4ZO8A 1FWFC 1TX0A 1KLZA 2WSKA 1JCNA 4RE3A 1KTCA 1WKEA 1RV8A 2V6AA 1W9VA 3NDOA 3I65A 1XYBA 4ML4A 2Y0FA 2TMDA 4N02A 1GOKA 2C19A 4P8UA 3WH7A 3THAA 4B4HA 2XGBA 5CGMA 1DWFM 4IUOA 3NO1A 3ARVA 3QRHA 4CEUC 3A5VA 1H1YA 4WD0A 2DZUA 2INFA 1MQRA 3FEQA 1F2JA 3MBDA 2Y61A 2WNWA 4PUKA 1RVKA 3B03A 4FALA 1AUSL 1ADSA 3E9AA 4BKNA 4H83A 1YKWA 3VNMA 3AHXA 3M0MA 1KFBA 3O2LA 3SW6A 4BI5A 5A6MA 4AVFA 1ZZMA 2GWNA 1F6KA 4C1NA 1J6PA 3TC7A 3M0JA 3ONCA 2PDWA 5IFPA 1E6NA 3SRFA 5DT5A 3OGSA 2BGSA 3BGJA 1IV8A 2GOUA 3M5ZA 1UASA 4DUVA 5EPDA 4JTGA 3G1RA 5EL1A 1TJ0A 1EX5A 1QT1A 3SIMA 4RXGA 4V27A 4RDZA 4A8NA 3QM3A 2FZMA 3EX2A 4QSHA 1RBOB 2VM8A 5LHFA 2HVMA 2O9PA 3KBWA 4MB1A 3UWQA 2BHYA 2XDFA 3QHMA 2JE8A 3TVAA 7TIMA 2I17A 3IUDA 4GVGA 1TIWA 1MRQA 1GTHA 2NQHA 1S5MA 1UR1A 1NWSA 3OU8A 4L9YA 2P8BA 5TF0A 2WVUA 3FGCB 5DBTA 3MUCA 5C9WA 4QIUA 4KEMA 1WZMA 5LSMA 3D5HA 3GG0A 3WSUA 3S1WA 5RUBA 4PFMA 4MGGA 4X9SA 1UD2A 2WBKA 3FW6A 1O1ZA 2CBJA 3I3DA 3UWUA 3L9CA 1H0GA 2CLOA 1S5WA 4PUDA 1DIKA 2ZUNA 3HOJA 3TJ4A 1HP5A 1F3WA 2V3FA 3WCZA 3SADA 3WK0A 1P48A 3K8MA 1S39A 1DHKA 4FO4A 4J3UA 4ERGA 3AS3A 4G1NA 1TJRA 5FI8A 3O63A 2QF7A 5BNKA 1J18A 3T55A 3KTXA 3W84A 2WK2A 4PMOA 3CL6A 1A53A 1TJPA 4FMVA 3GNOA 3CZEA 4RPPA 3BURA 1RLCL 1QW7A 4JEQA 1XPGA 2VX4A 2PFHA 4IMGA 3HFYA 3T0AA 2DFAA 4NIRA 5DQPA 4ERIA 3FFSA 5H8PA 1HJQA 2PDHA 3HO8A 3TA6A 1EUNA 3GH5A 3WQWA 1SJAA 2VEPA 4GIYA 3PSWA 3LI0A 4H7VA 5IBXC 1GT8A 1M1BA 1W1PA 1MO0A 5JH2A 1SUXA 2AOSA 3W6YA 1KM3A 4M51A 3C56A 1GKQA 1S1PA 1QNSA 1IT8A 4GQQA 1PKMA 3VMPA 1MW1A 3KRBA 3APTA 1H7PA 2JALA 2YA2A 1QNVA 3DFHA 3PZGA 4AXKA 1ZP3A 3F4NA 3UXLA 3GDTA 5GJPA 3WK2A 4D6HA 4F9JA 4DO5A 3FXGA 2QDEA 2BMBA 1JZ5A 2Z2BA 3UPBA 3NYZA 3GH4A 4HQVA 3C2EA 5G1TA 1MXDA 1BSLA 4DM1A 2AL1A 3B4UA 4J7RA 1SSDA 1LG2A 2Z7KA 3AWOA 1DWGM 3BZGA 2IXUA 2LLEA 3LSCA 7REQB 2PDKA 2PP1A 1W2PA 3OVGA 2YR1A 3FA5A 1E0UA 4Z2HA 3B9AA 3BCDA 1CXIA 1L8NA 1E73M 1MUMA 2HRWA 4FXSA 5IBXA 2X16A 4H9YA 4QGCA 1JPMA 1Z89A 3PUDA 3CH9A 1KC7A 4GRSA 3WQEA 3FX4A 3T2QA 4H4IA 4TX6A 5FKYA 3F2DA 4MB5A 4MNLA 2Z1BA 1O6IA 4FLQA 4H1ZA 1KB3A 6PTDA 4G7EB 4B5WA 1J96A 1VAHA 4U3CA 4GE8A 3BJFA 4DZIA 2GGIA 1RCQA 5K9DA 3GVQA 3R89A 2L5HA 4AZHA 3MP4A 3GFZA 2X0YA 3VGBA 3EXRA 1N8FA 3TX9A 3S9YA 1XV8A 1GZ1A 3TZFA 1WKDA 2WM1A 1LL7A 1TUFA 1TWSA 1YRRA 3S5YA 1N8WA 4AIEA 3E1F1 3TTSA 3KL5A 2DIKA 1OD8A 3AC0A 1EC8A 1EDGA 1Y5XA 5I23A 4QAWA 3O07A 2J47A 4HYWA 4IWWA 3NQVA 1MQQA 1EO7A 1SMAA 1BVNP 2PUZA 4XAYA 1PHQA 1F05A 2J13A 4W8BA 4O1BA 3A47A 3ES7A 1Q85A 1HT6A 4JNMA 4LYQA 2Y88A 4GUFA 2ZKMX 3S5OA 4PCSA 3B8UA 3A22A 2QUVA 4PRRA 1DOSA 4S39A 3QGKC 1UQZA 4WY0F 1P0BA 1V6WA 4FX7A 4YS1A 1CXKA 1OJXA 1DYSA 3DEQA 4GYPC 2PGFA 4DM2A 3WF1A 4KBXA 1EB3A 3QR0A 3WUFA 1PTAA 1GOIA 4MWAC 1W3KA 2CLPA 4UMCA 4A3QA 3IPWA 2J24A 3AXIA 3QQ1A 2ZIDA 1GOOA 4UTUA 1YE4A 3VX1A 1B57A 1D3GA 5CC5A 4NUWA 4FNQA 1JCTA 1EHAA 4H8HA 3V35A 5DELA 1TA3B 2VCCA 4MADA 2YGYA 2OKOA 3P6LA 4V1YA 3U0HA 3T0DA 2YB4A 2VMFA 3WQPA 2OOFA 5AC7A 1BSIA 4H9MA 5M3WA 4KPLA 4GQBA 4WF7A 3MHFA 3AO0A 3BG5A 1F4AA 3NEVA 2HQAA 5BOFA 1K1DA 3N6JA 2ATSA 3DUGA 5DBUA 3W24A 1GPWA 3B3DA 3U4AA 3KXQA 3ZT6A 3ZWTA 2VEFA 1Q45A 3SUVA 4GNKB 4KH2A 3AHVA 1YHTA 1UBPC 3FAWA 2J77A 4DJDA 3GC2A 4XAFA 3SUSA 3M7WA 1G01A 2FIQA 5DCBA 1HN1A 2CCRA 3BOXA 3DCPA 1JNDA 3QW3A 4EIVA 1B31A 1GQIA 1F4HA 1UW9A 3P5YA 2EBNA 1NF0A 3PNUA 1C91A 2WJEA 1SZNA 3P93A 4ZGYA 2XIIA 3P5ZA 1ZJBA 5D04C 3KVKA 3MVTA 3HQPA 3TYDA 2PDNA 3CV6A 3UZXA 4F0MA 2PWVA 3ZVHB 2UY2A 5C70A 2OLSA 2H3DA 3WNLA 3S46A 4WUIA 5F2LA 4S3AA 3VNZA 1D2KA 1XLDA 2OZTA 3HPAA 4PEEA 1S2VA 1HL2A 2WCSA 1MEWA 4ASTA 1B4KA 1XYZA 5CC3A 4JICA 2QXWA 4C6PA 4JL2A 3LU2A 1RY8A 2CYGA 3VXGA 4BR1A 2PE4A 4GA8A 4YWSA 3ISIX 4HA3A 2OWWA 2O92A 3AYVA 4EKJA 1YBQB 5D2YA 2PDJA 3QV7A 1G5AA 4QBXA 2V68A 3DBNA 3QY7A 3CBWA 1PVNA 1W3TA 1ONRA 2GSHA 4XZBA 4GZJA 5A8MA 3DG7A 2ISSA 3IV3A 1VHNA 4WKAA 5FAGA 3VGHA 3M07A 3L23A 2NV9A 2Y89A 3QFWA 4NZCA 1Z6KA 1W1A1 1YLVA 4OU1A 3UG8A 3URQA 1HJXA 3VGDA 4GJIA 5BXTA 2P76A 2OELA 3BH4A 5DANA 1DPMA 1KCLA 2X0SA 3OLGA 4NVTA 4LBSA 1CGVA 4QLLA 3T7VA 1BTMA 1M01A 2BSLA 3DECA 1M9HA 4FZIA 2VDGA 3GAYA 4WY0B 2GVEA 3UBPC 2A4AA 1M7OA 1W5MA 3W0KA 1OCBA 3NPUA 5HA7A 3P3BA 4BWLC 1QOQA 3DZ1A 2NQ9A 3JZEA 3CHVA 4TMBA 1ZUAX 3G5EA 3LQGA 1JEZA 1OF8A 2OLAA 2QUUA 1G4PA 4KEUA 4ONVA 3CMJA 2VGIA 3WUBA 3W2NA 1M68A 1ZFJA 1T0OA 3P82A 3Q58A 4YYCA 4CU8A 3OIHA 4B16A 5C0QA 3LPFA 3I7RA 1OX5A 3MI6A 2G3MA 1AZ2A 2G97A 4L1XA 1E9YB 2NZLA 4IX2A 4UOJA 2BP1A 4GO9A 2PCEA 3PANA 3VM5A 3W7IA 3WH6A 2OLHA 2R1LA 2W6RA 4GO8A 3NQEA 4JIIX 1F3EA 1UZHA 4PE8A 2IKGA 3RITA 3EMCA 3FK4A 1JG9A 3ZWSA 1BF6A 3VNLA 1AMYA 5LZLA 2PP3A 3ATYA 2AGTA 3W1AA 2B31A 1F8MA 3RCNA 3P14A 3WBXA 1UWTA 3E0FA 4A22A 2BFGA 1R5YA 3I7QA 4UTIA 4H7ZA 2VZOA 3FSTA 3GUWA 4YN5A 1DWIM 5BMXA 3R25A 4FX8A 4Z1YA 2XTKA 1E6SM 3HF3A 3S6DA 4E4FA 4G5DA 2PTWA 2ESCA 4UOZA 1E0XA 4BWLA 4ZEPA 3UJEA 3S1XA 2FZBA 4M82A 1UG6A 4S2CA 4ZOBA 2REQA 4Q6XA 3TLLA 3KUMA 4UUIA 1YQ2A 3N6HA 3MZNA 2X1IA 1K7EA 1I0DA 3DFYA 3BARA 4QJ4B 2NX3A 3WD1A 4M80A 3FA4A 2QAPA 2BY1A 1CGWA 1JAEA 1RA5A 1LLWA 2R8WA 3W83A 4GK8A 2RKXA 3EX6A 3H7VA 4FNRA 1JIBA 4HT3A 2NVCA 2CXEA 1TWWA 1ISWA 3PUOA 1JUBA 1FWHC 1RH9A 3ABQA 3NQCA 4K7VA 4JDYA 2CKSA 3KOWA 3SJ3A 1J0YA 2NWSA 3CO4A 1DEDA 2Q09A 1XIDA 2WO5A 4KCTA 4Y9AA 3FV9A 2ZC8A 1R0MA 5CC6A 3KS6A 5CKSA 1C8YA 2PDPA 4HHPA 3K2GA 5C7HA 1TPC1 2R9RA 3N25A 5AYXA 4JTHA 2DIEA 1VFHA 3WEOA 4U10A 4Z0SA 3M64A 2OX1A 2ZA3A 2I5QA 3GIPA 1HKWA 4LUJA 1AH4A 1JVNA 3MY9A 3OVQA 1L6FA 4B90A 4GXWA 3NURA 1V8EA 4ORMA 3R7MA 2DT2A 3PPHA 3HG2A 1NFBA 5HR7A 3K4DA 5D8WA 1TTQA 3VD3A 3BLEA 3CV7A 1C9WA 4Y96A 2QT3A 2WZHA 1X1ZA 1I9CB 3KRSA 2WZEA 3ERPA 3VIPA 4IMEA 4Q8NA 1J8VA 1IIGA 4NQ1A 1K4HA 4UNKA 3RAOA 1WX0A 4HN8A 1H50A 1QI5A 5DXYA 1M7PA 5D33A 3VCNA 4RR4A 4B5NA 1J0JA 1BYAA 3S5SA 2ZXDA 2BNJA 4A2RA 4O1FA 1OC5A 4RPQA 5GPRA 3KHJA 5EBUA 3CASA 3PTQA 1GUVA 4MB4A 1Q6FA 3N9KA 4L64A 4Z2GA 4O57A 3NYDA 4IP4A 1RAKA 4C91A 1XKJA 4GMEA 1W3IA 3VOIA 2WPBA 2AGKA 2ZXBA 1G1YA 2JKPA 3DESA 4KWWA 4I6VA 1O5XA 1DXFA 2WNQA 2XFFA 3OGVA 2WANA 1F9CA 2XVKA 4CD8A 3I6TA 1MEIA 1A5UA 4HZ6A 1F74A 1CGUA 1QO2A 3QGAC 1TUXA 3UZ5A 3SGUA 5CBIA 4GVIA 3QHNA 2FVKA 3VGEA 3NIYA 1M5WA 2E6FA 3UCQA 6TAAA 1E0TA 3URBA 1A5BA 4CUCA 4PFHA 5FF4A 4CNNA 4I7WA 2O9TA 3O0FA 1Q6GA 2PCQA 4LALA 3BMVA 2ZX7A 4AY7A 3APGA 3S5NA 3CL7A 2PS2A 1QI0A 3H23A 1VEOA 3BG9A 3QLDA 5E0CA 3W6LA 2INEA 4JCMA 1W1IE 1NEYA 4K68A 1KXVA 2PAJA 1XBVA 4K1WA 2Z28A 2DT1A 4XVDA 4I90A 1GWJA 4ZOEA 1DJHA 1OADA 3EX4A 3UZZA 1EBGA 1JF6A 3UXDA 1EOMA 1WOAA 1XYFA 4FS9A 4NJGA 1R3RA 4A3HA 1FWBC 1IR2A 1OK4A 3KRUA 3YPIA 1S3TC 3S4TA 2Y5EA 1I2RA 3WLOA 3C3UA 3TKFA 1F6PA 5TD4A 1XR2A 4GXPA 3URNA 3KZPA 4Q4MA 4DBWA 4Y9MA 1S38A 1IE7C 4GYJA 1UQYA 2VRKA 1FCVA 5KZ6A 3L5AA 2BGNE 2VWTA 1EJSC 4HHLA 2VT0A 5FCZA 3OJGA 3EDKA 4JQ4A 3P2VA 3T81A 4Y9PA 1MZRA 3LB0A 3Q2DA 2J9YA 4F2UA 3GYCA 4L4LA 2PZNA 1QVBA 3CMGA 4OUIA 4GINA 3AS0A 4YVVA 4Y6GA 4LWWA 3QYQA 3BW2A 4MOZA 2FHCA 4XWUA 1A4LA 3GVWA 3M4HA 3O6YX 3LCIA 3VNIA 1EDQA 4ZOCA 3QOKA 2Y7EA 3USBA 2YPIA 2OQYA 3UA4A 1V0LA 4O4WA 1S5TA 3BLKA 3K1GA 1AJ2A 1B3VA 4DJDD 1PXGA 4JTEA 1TPB1 3TW9A 3UJRA 4PMJA 4CN4A 1B1YA 4L4OA 4HPNA 3PWGA 1NOFA 1PJ9A 3OYXA 2O0TA 1GKPA 2ZICA 4M7SA 3ZIZA 3STFA 2QLYA 3WNNA 1KWKA 4D6GA 2NVAA 1B3XA 5D9NA 1CCWB 4AX6A 2OO0A 5FJRA 4FP1A 3UA3A 4A3UA 2VL4A 3H4GA 3TU9A 4BQ5A 1OINA 4QM1A 3W7RA 2PF0A 1V0NA 2DSKA 3BGAA 2B7OA 3GW0A 3UG5A 2VEGA 2EHHA 2J62A 2OEJA 4AWEA 1ISXA 1VJIA 1V0MA 4ZOAA 2ALDA 5D2VA 4JX5A 3LBCA 1US0A 2OMAA 1KFCA 4GYFA 2W79A 4KRUA 1JZ3A 1AQFA 2GSJA 5CJ5A 1R3YA 3CHEA 1SFSA 4GBUA 3AJ7A 3BLOA 2Z1SA 4RNIA 1AQ0A 1BXCA 4LXFA 1JCXA 4O8AA 3CUGA 3VIIA 1DIEA 2ZOXA 1RLDA 3RLVA 1DJQA 2VFHA 1O5KA 3LBOA 3KTCA 5AVNA 4FB7A 5K4ZA 1UP3A 4LH8A 2VP8A 3PSVA 4QRNA 4C6NA 1U33A 4F9DA 2EAWA 2Z1WA 3K13A 4GZEA 3WF3A 3MMWA 4MTVA 1CXLA 2HMCA 1UD6A 4MWAE 1EWEA 3CK5A 3DKLA 2V2CA 3ICJA 5GVJA 4AZ7A 4LVFA 3F4CA 3G0UA 4OT7A 5G2HA 3VE7A 5M2FX 4PRTA 2YDSA 5TBOA 1VRDA 4C90A 4S1FA 3AQUA 4MNJA 1P6WA 1EGVA 4QSFA 5CSYA 2FDSA 1XLCA 3WJYA 3WQFA 1EIXA 1UD4A 2PDYA 4LF1A 6XIMA 4UR9A 3SQMA 2D20A 4IGMA 2PTDA 4F8XA 1FWWA 3G1HA 4PEKA 3QV9A 3NVTA 3LXCA 1E55A 2VQTA 3EX3A 4UQAA 1FRBA 3W82A 3FOKA 5A2AA 1GQNA 4QE5A 3TW7A 3LSBA 1JYWA 3PG9A 1V0KA 5HJYA 5K9CA 1QO5A 4IQEA 3EWCA 3TH6A 4CGTA 4Q32A 3EOLA 4WSJA 1GEHA 3SRDA 3MTWA 4JD4A 3HJEA 3VOFA 2A7NA 4PTWA 4ROPA 1P7TA 1K6AA 2NX1A 3CQIA 4CU6A 2ZWZA 5REQB 2J7DA 3F5LA 2Y5JA 3O8AA 2BDQA 3N2CA 2YCLA 1AD1A 1W6TA 1C7SA 4RLIA 4PTXA 4E2OA 5K7JA 1QHPA 4CCEA 2GGHA 3N4FA 3DGBA 3AHZA 5MHBA 3WD3A 2ZQ0A 4QROA 1MEHA 1PWMA 2HK1A 4AHPA 5LIYX 5A6BA 4Y8EA 4Q8QA 4PTDA 3GQYA 3SZ8A 1KD0A 1WA3A 2QEZA 2ZZ3A 1XFBA 1F8IA 3TLQA 5DMLA 2DH2A 5I06A 1EWDA 4B92A 1QWKA 4WJ8A 1E4MM 2WC3A 4AEOA 5A94A 3LN3A 2DQXA 1GVYA 3W2MA 4JTTA 4XAGA 4KFNA 4S3KA 2WMJA 5TAOA 1LWHA 1W1YA 3E0WA 2HJPA 3LCFA 1YXDA 5CGTA 2QPUA 1AODA 5CJMA 3TAOA 3STCA 3HA1A 4DVOA 1S46A 3STPA 2AQOA 1U30A 1VF8A 1JRCA 2YL9A 3KLKA 2J78A 1K8ZA 3PULA 2YL5A 4R85A 5E0FA 2O4MA 5FSDC 4S2BA 1O94A 2F6XA 2WB5A 1QPOA 2PDLA 4F0RA 1ZLPA 4LX4A 4AEFA 1VYPX 2HBVA 3BCJA 4QFUA 1ISYA 3N17A 2ZZ5A 3BO9A 2VOMA 1UUQA 2F9RA 3SUWA 4IJRA 1PIFA 5GNZA 1NQKA 4ORIA 1KNWA 3T08A 1GYMA 4YYFA 5C9XA 3PP7A 4A2SA 3WK1A 1FP9A 5DT7A 3PM6A 1PCKA 3TFXA 3TMLA 3WLPA 1V6YA 4C7FA 5CLWA 4N4QA 1XLLA 3E2RA 1THFD 1D3CA 2IMRA 1XQKA 3W6MA 1VCGA 3QXBA 1EQPA 2CPUA 1JULA 4PMZA 1UKTA 4A3YA 3CUIA 2AKZA 4QE4A 3WIJA 4A8IA 1J12A 1MFVA 4M6PA 3G22A 3VMNA 3O06A 1QFEA 5ABEA 5HANA 1XIEA 5A1AA 3C4UA 1VPYA 4H3DA 4G9PA 1D8CA 1PKYA 1RJPA 2OZ3A 1PX4A 4O54A 4XQ6A 2Q02A 4O0KA 1GZGA 3W70A 3TMQA 3K8KA 3PY2A 1KTNA 4WRHA 3P60A 3E2QA 3BXWA 2Z6IA 4AZCB 1B90A 3ZXWA 1Y65A 1O5RA 3U8GA 4L6DA 1V5XA 4XUYA 4H2CA 5A6KA 1F7BA 3V0TA 2E6DA 3QC3A 3LHTA 3N2OA 1UOKA 2QF8A 2NWRA 1FY6A 2WMFA 3IRDA 4F66A 4UFMA 2CBIA 4NSBA 2WQPA 4HMNA 4IUGA 3MI2A 3DXIA 2V5BA 3OVRA 4TVDA 1JYXA 2YA0A 4B3LA 1QPQA 2DJLA 3EA3A 1UZ1A 5EFDA 5JBEA 5D32A 3ABXA 1KCKA 2ZX8A 2YFOA 3WK3A 3TQ0A 1Q7QA 4PSRA 4OVXA 4ZB0A 4EPKA 3C2YA 3W29A 1W0MA 1V3IA 4H6QA 2E6AA 1F5ZA 4S3CA 4IFKB 3LDVA 3EWBX 4HCDA 7CGTA 2O55A 2J88A 3BAJA 5FJUA 4ZFMA 3R12A 1GQKA 2WKJA 4HNOA 4OTKA 3ANYA 4ALDA 1N82A 1E4IA 4GIRA 2I1OA 4AD4A 3MCNA 5I5RA 3LD5A 4NAEB 1TZ7A 1XKYA 3LBMA 3VDCA 3ZOAA 3EOSA 3LHWA 2ZZ4A 1RCOB 4A8LA 3SR7A 9XIAA 3CL8A 2XWEA 3BW3A 3RUBL 4WKHA 4C5YA 3R2GA 2AMGA 1BRLB 1F07A 3QSTA 5FA5A 4EE9A 3R58A 1R9ZA 1VC4A 1P43A 4JKLA 5HQLA 1W2VA 2OEMA 4TUFA 4ATDA 3QFEA 3VC6A 4S23A 2CLFA 3BAIA 1H5VA 4J3SA 4DRSA 3QW4B 1OSEA 1PDYA 2FZNA 4ZFCA 2DVUA 3CJPA 1I2OA 1TKKA 4ICCX 4MPQA 1LBMA 4CQDA 5HWNA 5FOOA 3GG7A 3ONBA 3O1NA 5FEXA 5HPOA 4Q22A 2QDHA 3N2XA 3A4JA 3ARUA 2YBTA 1CLKA 1R9YA 1KBBA 1OCJA 1UKQA 3NZQA 2ZDSA 4HGXA 5D03A 3W2LA 1ZPTA 1IT0A 2PGEA 1W3HA 1FHVA 4IICA 1T96A 1UROA 3VIJA 4CQ9A 3TOPA 5LNSA 4C5ZA 4DIAA 2W3ZA 3GNRA 5LNRA 1K7FA 3E6EA 3CQKA 3WD4A 4HNVA 5H91A 2QQ6A 3DFQA 4UTTA 5DO8A 4LC8A 1KM6A 4NKCA 1EJTC 4H6RA 4P7QA 1TIMA 3WQDA 1C7TA 2Z7GA 1SFTA 3QMSA 3WD2A 1MDLA 1W3JA 5FEZA 2HZGA 4D1IA 1MRAA 2E6YA 3VOHA 1IXPA 1D7KA 1GKRA 4G7EA 2DW7A 3GHSA 1PX3A 3HV9A 2E8ZA 3U7VA 3LHYA 1GW1A 2JEPA 3A4XA 4WDWA 5I3JA 3W1LA 4WHBA 2NSXA 4LVGA 3HFTA 1UWUA 1EF3A 3BZJA 5U4NA 3S2CA 1VENA 1MXSA 4MLJA 3VK5A 3TQKA 1BHGA 1EC7A 2UY3A 4R88A 1UPPA 2PLCA 3FYPA 1DV7A 2DZBA 2YZ5A 4O1EA 3H6OA 4DWSB 1HJSA 4UR8A 3QEZA 1F3TA 3F4WA 3B0PA 1K02A 1DHPA 1J0IA 4K8GA 5EMLA 1ZHAA 4WDXA 1JI1A 2QUNA 3M43A 4RDVA 3O9NA 4HU3A 3V36A 5A8GA 2E3ZA 3H2NA 8A3HA 1U22A 3QY6A 1A5NC 3WNPA 1VLWA 4UFJA 1E40A 3AU2A 3B9DA 1TCDA 1WBJA 1LWIA 3XIMA 3QV6A 3N6QA 2RFGA 9RUBA 4NILA 2WC4A 5KMYA 3EKGA 4J2MA 3MKCA 3E38A 1GOQA 5IDIA 1VB9A 2VEKA 1YW1A 1VBJA 4E3VA 1Q2RA 1EBHA 2ZVRA 1EP1A 1E9IA 3R43A 2WSRA 3EKLA 2H9AB 3F4VA 1V6UA 4GIAA 3OO2A 2HPMA 2XGZA 1VBHA 2FPVA 1F76A 3NDYA 5LNWA 2PWEA 1XW8A 2CITA 1TA3A 1TQXA 3UWZA 2CHOA 4OQVA 3U2OA 1K8YA 2DV0A 2QKFA 3RCYA 4U28A 5DXXA 2YCJA 4PMUA 1E4NA 1JDEA 2EEXA 1EJ7L 3PZUA 3N9RA 4M1RA 4CQAA 1R7OA 3M0YA 4AZ5A 7ENLA 4S3EA 4LT9A 2CXGA 4WGXA 1NWUA 4O53A 3KOFA 1H2JA 4EAYA 3GXIA 1R7AA 2V0TA 4U2ZA 2HWGA 2WWCA 4D6EA 3SQSA 4IL0A 2R82A 2QV4A 1XH0A 2CNCA 3VIHA 4MJZA 4HPXA 3UXIA 2XFWA 1TR1A 4W84A 3W86A 3UWYA 3PJXA 2QJJA 4HN4A 4YVXA 3BVJA 3N2MA 5AHLA 3AIQA 3HG4A 2XGIA 1PS9A 1L0PA 4KERA 4O11A 4S3BA 1A3WA 4QLKA 4IIDA 5F2GA 2HISA 1FDJA 3GBEA 3UGRA 4LQ1A 3ZLHA 1E4LA 3IK2A 6REQB 3T2OA 2IQDA 4PBFA 3W02A 2FJKA 4NXSA 1U2YA 3SECA 1T99A 1N7KA 2CHRA 3C52A 3LXAA 1OK6A 2P3ZA 2OJPA 2D0GA 3AXXA 3M0LA 4V33A 4Z1CA 3NTYA 2NLYA 3MQTA 4O18A 3MI3A 4K8HA 3OHIA 2XIQA 4MIMA 3ABRA 5FSEC 1W17A 5BRQA 1HUVA 1RQBA 4W7WA 1XGDA 4NL1A 1XP3A 5FF7A 3EDEA 2V2DA 5ENLA 1UA7A 4MZ8A 4W86A 1KRBC 3NQ6A 1V3MA 2C71A 3NQ7A 4XIAA 1X1OA 4ZSTA 3G8RA 1U1HA 1JD9A 3KP1A 2PDCA 2PSNA 1MUWA 1PYFA 1YBQA 3PPGA 3ZLGA 3AU6A 1AL7A 1X1NA 1L8PA 1FWIC 4IXXA 3B0XA 1XC4A 5C2GA 3DU0A 5J5DA 1IGWA 4PMQA 3VMOA 3D3FA 4HYVA 2XIJA 4UTWA 2C3ZA 4LBRA 4WLCA 3SDOA 8CGTA 3TN6A 3U57A 1H61A 3PAJA 1UWRA 4K3ZA 4W7VA 2KAUC 4H01A 1H7WA 4TQTA 3T8QA 2GVLA 3RNDA 2XSBA 4DYKA 1XIIA 5C9RA 1H7OA 4GZIA 3PZOA 2OWXA 2QR6A 1VD6A 4PULA 5CQ1A 2J74A 5BYWA 1UR0A 1YDVA 4GX8A 2I16A 1FDYA 1KV8A 3HG5A 4MDOA 3RCMA 3W2KA 2VFGA 2V5CA 3B40A 3DC8A 2VCAA 3QC0A 2XIBA 1PB0A 2ZRYA 1C8XA 4IIFA 3NZGA 3CU2A 1TMLA 3SN4A 3N4AA 4PCFA 1VBGA 2C6QA 2VDHA 1GCYA 6TIMA 5BXSA 5LHEA 3WLIA 4F0LA 1JR1A 3KVJA 3KBJA 3RDKA 3VD7A 1A4MA 1JPDX 4CN6A 2SFPA 3EA2A 1XH1A 4RV8A 1H4PA 2BWGA 1UH4A 4UWMA 4HZ8A 1LJYA 1JDAA 3VD4A 4I9MA 2D0FA 2WVVB 3UERA 1XYAA 1Y5VA 4DNHA 1A0CA 3UU0A 1ZAHA 1V03A 3TR2A 4NY2A 5K2ZA 2P10A 3M7SA 1XG3A 3GDBA 3VZXA 4NT0A 2DJXA 2XYLA 1G94A 1J4EA 1VGAA 1TV2A 3W75A 4GXMA 4W87A 4PUMA 1V3KA