3LZ3A

Human aldose reductase mutant t113s complexed with idd388
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lz3A00
1YNQA 2PD5A 4GIEA 3NTYA 1Z3NA 2PDHA 4FA3A 2A79A 4PRTA 2IQDA 3LEPA 2NVDA 3H7RA 2P5NA 3GUGA 3B3DA 3LZ3A 4YS1A 4WDXA 3ONBA 4YVXA 3R8GA 3LN3A 1XJBA 4JIRA 3DN5A 4LAUA 2VDGA 4QBXA 4JQ4A 3BV7A 1JEZA 4L1WA 4DZ5A 3R43A 4ICCX 1AZ2A 2BGQA 1ADSA 5LIYX 1US0A 2WZMA 1C9WA 4OTKA 5LIUX 3LQLA 4PUWA 4HMNA 3EB4A 3H4GA 3M64A 1Z9AA 4MHBA 2PDLA 4H8NA 1LWIA 3CV6A 1ZSXA 3WCZA 2PDJA 1EF3A 2PDMA 3R8HA 2NVCA 2FZ9A 3H7UA 3KRBA 3UGRA 2HDJA 1T40A 4XO7A 5JH1A 1XGDA 4NKCA 2HE5A 3UP8A 4FZIA 3LQGA 3BURA 2DUZA 3N6QA 1AH0A 3WG6A 4XK2A 1HQTA 5LIWX 2HVOA 4ZFCA 1SM9A 1X97A 4XZIA 1S2AA 3V0UA 2PDUA 1YE6A 1VBJA 1A80A 4XZLX 1AFSA 3UWEA 4GACA 3P2VA 1MI3A 3UZYA 2PFHA 4DBSA 3WBWA 1PZ1A 1PWMA 1AH4A 1RY0A 2PDYA 1RALA 3MC5A 3MB9A 3FJNA 3G5EA 4G5DA 5JH2A 2FGBA 2FZDA 4EXBA 4PRRA 4JQAA 4WDUA 1Z89A 1ZUAX 2BP1A 2PEVA 3EB3A 1S1PA 5M2FX 4FALA 5AZ1A 4GABA 1EXBA 2IPWA 4JIHA 4RPQA 1IHIA 4PMJA 4JTQA 5DANA 3M0IA 2IPGA 3R58A 1VP5A 3S3GA 3UZWA 3LENA 1QWKA 4I5XA 5LIKX 3COTA 4LAZA 2C91A 4QXIA 3RX2A 1EKOA 3VXGA 2PDGA 3GHUA 4GA8A 5C7HA 4LB4A 4IJCA 4WEVX 2ACRA 1R38A 2CLPA 4JTAA 1YE4A 3R7MA 5HNTA 2ACQA 4F40A 2I16A 3ONCA 4DBWA 2INEA 4JTCA 3V35A 3D3FA 1M9HA 4IJRA 1LQAA 2WZTA 4Q3MA 1S1RA 3RX3A 4LBSA 2PDPA 2ISFA 1Q5MA 1AZ1A 4ASTA 2PDWA 3CASA 4XZNX 5HNUA 4JIIX 3O0KA 3BUVA 3GHTA 2ACSA 3RX4A 2DUXA 1PWLA 1ZGDA 3DOPA 3GHSA 3BCJA 2IPJA 4XAPA 3T42A 4R9OA 2PDFA 2PDBA 1X96A 2IPFA 3R94A 1UR3M 3LZ5A 4GCAA 3V36A 2PDCA 4DBUA 4GQGA 4QX4A 3N2TA 4EXAA 4YVPA 2IKGA 3V0TA 4H7CA 2DV0A 3F7JA 4IGSA 1MRQA 3U2CA 4JQ1A 3O3RA 3ERPA 3UFYA 1PZ0A 2PDXA 3G1RA 2BGSA 3LBOA 2PDNA 4WDWA 3UG8A 2HEJA 2IKIA 3FX4A 3QKZA 3WBYA 2PF8A 3UYIA 1S2CA 2IS7A 4JQ3A 3CV7A 4WDTA 1EL3A 2HV5A 2HVNA 3GHRA 4JQ2A 2AGTA 3CMFA 4Q7BA 1AH3A 1YNPA 3UZZA 1J96A 4WRHA 4YU1A 1QRQA 2FVLA 3UZXA 2ACUA 1IEIA 2FZ8A 2R9RA 4LBRA 3M4HA 2ALRA 3R6IA 2INZA 2IKHA 4XZHA 2PD9A 2I17A 4XVDA 4JTDA 1K8CA 3Q65A 3LD5A 2R24A 1FRBA 2IQ0A 1PYFA 4AUBA 1RY8A 4XZMX 2QXWA 1HW6A 4XVEA 2HE8A 4GQ0A 4PR4A 2FZBA 3LNMA 3Q67A 2PDKA 1ZQ5A 1GVEA 3V0SA 4JTRA 2IKJA 1T41A 4HBKA 4FAMA 4XO6A 5AZ0A 2PDIA 5HA7A 1OG6A 2J8TA 4YVVA 4PUUA 4QR6A 1Q13A 2F2KA 3CAQA 5LIXX 4WGHA 4LB3A 1MZRA 1X98A 2PZNA 2F38A 1XF0A 3WBXA 5KETA 3LUTA 3CAVA 3C3UA 3EAUA 4L1XA 2PDQA 1Z8AA
chains in the Genus database with same CATH superfamily
4A3HA 1DOSA 4EWJA 2BOEX 6TIMA 2VR2A 5EGRA 5A8MA 5FJIA 3RO8A 1BG4A 1GQKA 4DX3A 1UR4A 1TUXA 3LN3A 4C60A 1A5LC 3RNDA 1SO4A 4ZQPA 6A3HA 4LAUA 1E5JA 2QUMA 3GS6A 4QS5A 4TX6A 4NAEA 5T9BG 5I77A 1UIPA 4DWSB 2WZMA 2GDQA 3L68A 4P7NA 5LIUX 4GI8A 2OWWA 3RCMA 1BVWA 3QVQA 3KRUA 3P80A 1KBLA 2PDLA 3DFPA 1LUCA 3TYZA 3W1MA 2TODA 3W71A 3WCZA 2PDJA 3BGAA 1XLGA 1DQWA 2ZRUA 2VFIA 4GXPA 1MWOA 2FTYA 1H5YA 4Z1BA 2GSHA 2OB3A 2YGYA 4U2YA 1IIHA 1QPQA 3S6DA 2BDQA 3UGVA 3UERA 3R12A 3LA4A 2C0HA 3ZO9A 1EUAA 1B3WA 1QBAA 4PL1A 2G4FA 1JGMA 3N2CA 3PSWA 5C9XA 3B8WA 3F2CA 3MUZ1 1P0BA 1DJIA 4G9PA 2V9DA 5T9CE 3MYOA 1S2AA 1EHNA 4A29A 4DB7A 2Q3OA 3LHUA 4TUFA 2VD8A 4C6PA 3KBVA 4ECLA 4JX4A 4D2JA 4LAOA 3VGBA 3EDDA 2V30A 1MI3A 4Q8WA 3W26A 3W0KA 2OYLA 2I9EA 3VUSA 1OF8A 1PZ1A 3QLLA 2BMBA 1HF6A 2H9AB 3KVJA 3LHZA 3LM3A 1W8SA 3WUGA 3NQEA 1RALA 1QT1A 4LVFA 3BLOA 2BY2A 2PLMA 1YRRA 1TQXA 1NFPA 1AUSL 5DMLA 2FGZA 1W0MA 2X7WA 2I5QA 4GJJA 3BLPX 3GNPA 3P5YA 3M46A 1W5NA 1ZTVA 3E02A 5FD0A 3WO8A 2ZRWA 1LRNA 1OADA 3E96A 2GFTA 1OG0A 1J10A 2WNZA 3U7BA 4O17A 1J0HA 2FFCA 4FLQA 3RGTA 4E8DA 3KDOA 2WJDA 4XD4A 2ASHA 1JF5A 4IMDA 3VFCA 3O6CA 3PPGA 4C90A 2G0WA 3COTA 3TJ4A 4WY0A 1ITQA 4DO5A 4L65A 5REQB 1K9EA 1KV8A 4JYEA 2QVNA 3SO7A 5EYWA 2WJEA 1A0CA 4AIOA 1LL4A 4I8DA 1Q7ZA 1LP6A 2R6OA 2OEMA 3TR9A 7ODCA 1W2VA 4FF5A 3AQUA 3W38A 4HMDA 1GOWA 1WKDA 2EGZA 4YPJA 3WQVA 2W3ZA 4NHVA 3RAOA 2EO7A 3G1XA 1HKVA 3MA8A 2X0YA 3FFSA 4MNKA 3WNOA 3I6RA 1TFVA 4TVUA 2BODX 2WBKA 1CIUA 4MG4A 3OB8A 1DKWA 2QUUA 3A4XA 4DJED 2PGWA 1VCVA 3D46A 1XKJA 1Q5MA 3P7YA 4RCXA 3TTSA 1UH2A 2PDWA 3H70A 4UFJA 2C6QA 1MMFA 1V3JA 3MUIA 1RCXB 2QZRA 3LHWA 3POCA 3CT7A 4JKKA 4GFSA 5BXSA 4MVAA 4IX0A 2PDFA 2PDBA 2IPFA 3TA6A 3T08A 5BOFA 2GVGA 2ZTKA 2BOFX 2NSOA 3HPAA 4IPNB 4ERGA 3EWXA 1OGSA 3SCVA 3FYYA 1GVYA 2I7GA 3QQWA 3GB6A 1HKMA 4MJ4A 3TC3A 3ARTA 2PDXA 2WJFA 3LGDA 2ZADA 2PWUA 2PF8A 4M6VA 2XZ7A 2B7NA 1WKEA 3N2OA 1SFSA 1TG7A 3GHRA 4HA0A 2D23A 4JPGA 3T81A 1GEHA 3G18A 3TOPA 2FKPA 1KRAC 1L6WA 3TAKA 5AOUA 4I9MA 1UUMA 3KWXA 2E4TA 4XB3A 4Q8VA 2PPGA 1M6JA 1R5YA 5RUBA 3VD7A 2ODOA 1ELSA 3GVVA 1TKKA 1VC4A 1J5TA 4QNWA 1OK6A 3MSDA 1DBTA 1WCGA 3BH4A 4DXKA 3LY0A 1O60A 3CHCA 3WFLA 2Z25A 4HK6A 4AX7A 2VZUA 4CCZA 4XZMX 4J3SA 1HW6A 3EXSA 5KSWA 4XVEA 1UP0A 3NZRA 3WQFA 4V2XA 3WLKX 4XQ6A 2WHJA 3WF0A 3SI9A 3PTMA 1ZQ5A 2PC4A 3V0SA 2DH2A 1EDQA 4FAMA 3WK2A 2BGNE 4XO6A 4M51A 5LZLA 3LI1A 3WDIA 1XG3A 4YTTA 1JZ5A 2XVLA 1MDRA 3MW7A 3SN1A 4HNNA 1V02A 2DIKA 3MUY1 3OZPA 3OGVA 1SJCA 1WDPA 1FY6A 2P3ZA 3KLLA 2W27A 5CC7A 3UZ5A 1L8NA 2W91A 2O4MA 4FNUA 3L0NA 3G6LA 3BMXA 2GGIA 2PP0A 2BXZA 2QGHA 5GJNA 5DT7A 8XIMA 2J9ZA 4M1BA 3QR0A 3Q45A 4U33A 4LF1A 1GYMA 2YL9A 3R8GA 2A1YA 3B9OA 4M7SA 5LNSA 3O16A 4JQ4A 3UR5A 2WSPA 3EXTA 3VIOA 1MEWA 1C9WA 3KXQA 3N4EA 3HOJA 4AYSA 3M0LA 2XGIA 2VO5A 2VCCA 3O6YX 3PFRA 4HU0A 5LKYA 1N8IA 2NQLA 3UJ2A 3FDGA 3W86A 3R8HA 1KGUA 2CKRA 2V5LA 2A6LA 2NUWA 4NYYA 2FMNA 2QUNA 2V3DA 5G2WA 2ZDRA 2HDJA 1MRAA 1T40A 4XO7A 3U5YA 1Q66A 3V75A 1J0IA 2XWDA 4FZIA 2DUZA 2INFA 1XM3A 1NWTA 1JCXA 3N6QA 3CUIA 5I23A 1FWEC 3EWYA 4BS0A 4EIVA 1RUSA 3BLKA 2O9TA 2HBVA 4LRSA 1PKYA 1RA0A 4HA4A 2ALDA 4R3UA 3V0UA 1OM0A 1LF1A 4BF9A 3Q58A 3SIZA 5HJYA 4XZLX 3EA3A 3AI0A 2JIEA 1HJWA 3IIXA 3TTEA 4C6FA 5ECVA 4I9JA 2PFHA 1RD6A 1WYIA 4PMVA 1PWMA 1PUDA 1T8QA 3C0JA 4WXZA 3ANYA 4BJHA 3WD3A 3D3AA 3C2VA 4TMCA 1UD8A 3GR7A 5IRPA 4LVGA 2QCCA 1NFBA 4IMEA 4IPJA 4DWSC 4GBDA 3NUKA 3W82A 1R2SA 4W5UA 2QUVA 1W3NA 3IJIA 1Q6LA 2XZ9A 5BRQA 5M2FX 1NWSA 2Y8VA 4GABA 1EXBA 1D8CA 3EX6A 4J5NA 1LTDA 2HRWA 1IHIA 4RE2A 1H7XA 2YXOA 1XIGA 2VUYA 2R1MA 2P8CA 3E3HA 1DWIM 5ABGA 4IH3A 4Q4RA 2VEIA 4AD2A 4E4PA 4EKJA 2E3ZA 1LDCA 2X1IA 1BTMA 3WMCA 3WH6A 1TREA 4PODA 5KMYA 2BX7A 5LA0A 2OMAA 2FVMA 4R33A 4S1FA 3FYPA 3R25A 2QVHA 4OOZA 4REQB 4X2PA 1PHQA 4MYXA 5CPLA 4GI4A 5KINA 4L6DA 3WMLA 4BI7A 3VDGA 1AMYA 4H6KA 5E0FA 1TTIA 4CNOA 6ALDA 2XFWA 5KTLA 4S38A 1IWBA 4WSHA 5FL1A 2FHCA 1HO1A 3NL3A 3DFQA 1MQPA 9XIAA 3DKLA 4JFTA 3RX3A 1TJ2A 1TPVA 3FGCA 3WDPP 2O9OA 3G3DA 2WW5A 3AMLA 2ZZ4A 3K46A 2NQJA 2VVSA 1B4EA 4H7ZA 1POKA 4JIIX 1NOFA 3EOOA 3R5EA 1J0ZA 3NWRA 3DGBA 3WK0A 2E5BA 1PCKA 3UG4A 4ATWA 1KBBA 1V51A 4G56A 1V6VA 1R0MA 3ZJ8A 1XSJA 3L4TA 4XAPA 2HPMA 3T42A 2VEGA 4HJWA 5B7YA 2VX5A 4KEVA 1RAKA 5CLWA 2QJIA 5K7JA 5CSYA 1H0GA 4I3GA 4AWTA 3AYVA 3A9BA 2BWGA 4GIRA 4C1KA 4MF4A 2Y24A 2HISA 3S9IA 2PWGA 3LRMA 4XAGA 4O52A 3LI0A 5DY3A 5EB8A 1XH2A 3S9YA 4KCWA 1H51A 1LRTA 2VWSA 2XH4A 3LBOA 1P4CA 4UQBA 4FNQA 3LDVA 1GZJA 1TJRA 2PZ0A 5CZKA 4IPPA 3BJFA 3IEBA 3FX4A 5E0CA 1F76A 3K4WA 3KVLA 1E6QM 2Y62A 4N7QA 3R10A 1M68A 3LCGA 3L2IA 3CMFA 3M0MA 4K39A 4P7LA 1EJ7L 2OZTA 4P7QA 5HANA 3V5FA 3UZZA 1DJQA 5D04C 4QDWA 4JYDA 1CB7B 4WKHA 4ZOAA 5C54A 1FWFC 3RMEA 1HL9A 3GR4A 3LSBA 4K3ZA 2XINA 3QPYA 1S2VA 1RD5A 1Z6KA 2FZ8A 1GONA 3FA3A 4U31A 3RDKA 2FPVA 2I17A 2DZPA 3OJGA 5AC7A 1YXYA 2DT2A 3N19B 3RR4A 1Q3NA 3CBWA 1FWRA 2G3IA 3GC5A 3DDMA 4L6HA 3CU2A 3P14A 4C6IA 4PMXA 1ZU8A 1S2UA 3UZJA 4IHCA 1ZFJA 1VAHA 2J7BA 1XPYA 2FJUB 4QROA 5G1YA 1KRMA 2TPSA 2XSBA 2VT0A 1HNYA 3RK8A 4S39A 3HMJG 4GX8A 3WD4A 2RGLA 3GUWA 4GPNA 3LNPA 4FNRA 5EFDA 1MQRA 3PC0A 3QOKA 4F66A 3KP1A 4Y9PA 4O28A 1EPVA 1E55A 5HK4A 1OX4B 2WVTA 5BMXA 2R1NA 4OHQA 4D8LA 3TQPA 1UYQA 5BZAA 4AZ5A 4H7VA 3OG3A 4NT0A 3CL8A 3HBLA 3PNZA 4HOXA 3DHPA 2PF0A 3OYZA 7REQA 1IEXA 1PX8A 3RUBL 5D37A 2QDDA 2QCLA 3G24A 3LEPA 4O1BA 1KFBA 3BDKA 2W5FA 4NZ3A 2EXOA 4F9DA 4NZ1A 1XJBA 4JIRA 3SGZA 3UWUA 3MO7A 3WEOA 1UUOA 2DZXA 1DQXA 4UQ9A 2Z1SA 4RE0A 1B54A 1UZ1A 3K5XA 3WQOA 2VDGA 4IGNA 3AIRA 4WSKA 3R43A 2J7EA 4OECA 1V7AA 4ZO8A 3E2SA 4A21A 2CU0A 4QG8A 2CLMA 4WF7A 1OCQA 4DRSA 2OSYA 3UR7A 2ZUUA 1W9VA 1EX5A 1UZHA 1V3LA 3A21A 3DXIA 1R46A 3VCNA 1Y5VA 2ISWA 1CWYA 1W9BM 3H7UA 4DYKA 4E6MA 4LPCA 4ATLA 1JQVA 2XFFA 4RV8A 3MJMA 3D0CA 3ITYA 3KVMA 3DI1A 3CC1A 3A3HA 4TV6A 3UR2A 2E09A 3B0VC 2VRKA 1VYPX 3GDTA 3N9RA 2DZBA 2QCNA 1NVMA 2E9LA 2JKEA 4HN8A 3HTWA 1LQ0A 3R1ZA 1IGWA 3URQA 1XGZA 4PCFA 4YMZA 4NZJA 4FIRA 3CTLA 3GQYA 2TMDA 3OVQA 3S2MA 3SCOA 5CGTA 2D0FA 1AD1A 5FF4A 3BZJA 1H7RA 1QHZA 1SPQA 4YYCA 1DJZA 2PTXA 1W5MA 3MMDA 2PGFA 3RM8A 1JYNA 3QXBA 3MDUA 2BG5A 4MB3A 1TMQA 4PA8A 2C7FA 4ZTXA 3DUGA 4Q22A 1UZ4A 4OVXA 1LZOA 3CWHA 3SW6A 2XJ7A 3FJNA 1TTJA 6REQA 3CQ0A 1QNSA 3VGDA 2QCEA 2X09A 1BYCA 1ZUAX 2W9MA 3EX1A 2PEVA 2MNRA 1XYFA 4GVGA 4M81A 2IPWA 4KWSA 4J2PA 3NZ1A 2VVNA 1TWWA 4WXYA 1Z7AA 1NSJA 3SCUA 1H49A 2WM1A 1BQCA 3RIKA 2IPGA 5BROA 3GTFA 4Q7NA 1KM1A 4AC1X 3PUOA 3M7SA 3UPMA 4DWSD 1TE1A 4ZMGA 5AVNA 3T78A 3AHXA 2JKPA 2QYGA 3TSBA 1YPIA 3UY7A 4CQ9A 1HGYA 2VOTA 2CZ5A 4GA8A 3ZXWA 2QQ6A 1XR2A 1GYNA 1OT1A 3PB0A 4IQLA 4E0CA 3KUMA 1PX4A 5EMYA 1DQUA 3IIOA 2ACQA 4GQRA 1M5WA 2I16A 1NDYA 2V0TA 3RMJA 1VEPA 4IJRA 3OODA 1LQAA 1DHKA 3H8AA 3A24A 3SGGA 3H2CA 1HKKA 3W84A 1ZAIA 4JKLA 4U3AA 1OYCA 3PZ9A 3C52A 4UC5A 4DHGA 4B3ZA 2Q01A 3C3NA 2EPNA 4IXHA 1H1YA 3ZSSA 5PTDA 3OGSA 4N4PA 5CC3A 4BF5A 2WAGA 3CS2A 3NL2A 5D8WA 2Y7GA 4J3WA 1HXJA 3BGJA 1DL3A 5CGMA 3R0DA 4R9OA 2X7VA 3NQ7A 1MUWA 3R94A 3CZEA 4PMOA 1SZFA 4RE3A 3U48A 2ZA3A 4LAKA 3B8SA 4M6PA 4ACYA 2CEQA 2Q02A 1SO5A 3TIMA 2YDSA 4PUMA 4JTEA 5KEZA 1RQBA 4PCTA 3DIPA 4TXEA 1BF2A 3WLRA 4V28A 1G01A 2EEXA 3QGKC 3S5ZA 4O8RA 2VURA 4MUPA 4DM1A 1UUQA 2IS7A 3M0YA 3WJXA 6TAAA 4OV9A 4WD0A 3ABZA 1TQJA 1VF8A 4QE4A 3SQMA 2AGTA 4CCCA 4H1ZA 2BB0A 1J96A 5FI8A 3VNYA 5C7VA 2DSUA 5I02A 3E74A 4E3VA 3VDBA 5AYXA 4Q4OA 4UBPC 4H01A 4Z1DA 3NDYA 5AVHA 4ZB0A 4U3CA 5DFAA 4XVDA 3EB2A 2UY5A 3PZIA 1XSIA 4LEFA 1WDWA 1FRBA 4NYUA 5C55A 3THAA 1IEQA 1P1XA 1UQZA 4IOTA 3GIYA 3HM7A 3ZWSA 3U0HA 4V1XA 1C7TA 4GX9A 1KXHA 3NQAA 3EOSA 4G8TA 3QOMA 4PCNA 4B90A 3IJ9A 1XUZA 2VX7A 3VNZA 3INPA 4RNFA 3NYZA 1M03A 4ES4A 3KZSA 1ZCOA 2BV9A 1KM6A 2IKJA 3W27A 5HA7A 1F9CA 3GW3A 1ME9A 3MVTA 3VD4A 1UR1A 3W7IA 2Z27A 3Q37A 2BZNA 5FCZA 3N2MA 4KMQA 4HSNA 5E5CA 4XG1A 4AZ6A 3ANVA 1UCWA 5ENLA 1UPPA 2WKJA 2XH7A 4OZOA 3CAVA 1XW8A 3HQPA 5I3DA 2F6KA 4RV3A 3ZR4A 2FPTA 4RW5A 2J7FA 1H7WA 5CPSA 4X9YA 4G2DA 1FXPA 1SQ7A 2XYLA 3AWOA 2A79A 2VFHA 2C18A 2ZOXA 1JCJA 2QCHA 3NGFA 4E4UA 2ZCGA 2HK0A 4ICCX 1LBLA 4DAFA 3WEMA 4YN5A 2FTPA 1JXKA 3WBAA 2ZRYA 3DHUA 4IX2A 4O50A 3W7NA 5IXEA 2CLKA 1EZ2A 2PTWA 3HG3A 3IJLA 2HTMA 2A4AA 1FTXA 2WOQA 7REQB 4R5EA 2YDRA 3W28A 2CLHA 1XLHA 3NG3A 2NW0A 5FJTA 1GG1A 5FA5A 3O05A 1I2OA 5HWJA 4AB4A 1ZJAA 3EBVA 2VD9A 1CLKA 3OO2A 4J35A 3U9IA 4FEZA 5E9AA 4RJEA 4D6JA 3QR3A 2ZX5A 1NDWA 4L61A 4UR7A 2X2YA 4QDMA 1AH0A 4BF7A 4XX6A 1EBGA 1TIMA 3ELFA 1I2RA 4O1EA 2ABBA 3GNNA 1BXBA 3MPGA 2WLZA 4HD5A 2JALA 1SFTA 4XV0A 1YE6A 4PULA 4LSBA 5A8OA 1E9LA 5A3HA 4GACA 3GVQA 1OSEA 3NIYA 2JF7A 4ALDA 4AW7A 4ZB2A 5BOEA 2I9UA 4B3KA 1GHSA 5KZMA 1AH4A 2VWTA 1K4HA 3K1DA 3GBEA 2QUTA 3G5EA 3B9EA 1KBKA 4DELA 1K03A 3EOUA 4YIWA 5ABEA 5J5RA 2W66A 1KA9F 1PZ3A 4ZXLA 2OO6A 5H8UA 3EB3A 1S3HA 4KETA 1JVNA 3CIWA 4UTMA 4TVDA 1U33A 1QOPA 1VENA 3UXIA 2OKTA 2YCKX 4MLJA 2YDAA 3G6MA 2PLCA 4NZFA 3R58A 2OWCA 3BOLA 1VP5A 4IIFA 4LV4A 3APGA 4JCLA 2ZC1A 3WF3A 2XHYA 2RJGA 3C2RA 4D1IA 3J7HA 2C91A 1RJQA 5CCZA 1W9XA 2CNCA 4UTWA 1VFUA 3BAKA 1EKOA 4O57A 3FJ4A 2CFFA 2WJZA 4PMZA 3MJYA 3RLUA 4CU7A 4CVUA 2R8WA 1A5KC 1UJQA 4LFYA 3C4UA 1GVQA 4PUNA 1TPB1 4QLKA 2Q09A 3C2EA 1L6GA 2WVSA 2IXUA 5AC8A 4AD3A 3ONCA 1L2QA 3VOCA 2WSKA 5HMSA 4TOQA 3WKZA 3LLDA 1XIMA 1ECEA 5EBUA 4CLMA 3NXFA 4PTMA 3LMZA 4CN1A 1GHRA 2ISFA 2W79A 3CIXA 4S3BA 2C13A 1UW9A 3CGTA 4DF2A 1OGGA 4UCGA 2D20A 1YMYA 2ISDA 2ZQ0A 4GH1A 5I2UA 3CM4A 4Q6XA 4RDYA 2AL2B 2REQA 1A5CA 3NFUA 1HUVA 1R47A 4RZ5A 3GXIA 3FEMA 3LZ5A 3A5VA 4FXFA 2OX1A 1JNDA 4AEEA 3A3WA 4PMQA 5HUPA 1J01A 4YVPA 4IWWA 4BQ2A 5U4NA 4QM1A 1F8MA 3F4NA 4HPXA 3GDBA 3FSUA 1DEDA 3ZT5A 3SJ3A 1MW1A 3O3RA 3W7QA 1NOUA 3QRHA 3C0LA 3SSZA 1ITCA 5BCAA 3GLCA 5JUVA 1EP2A 1A47A 1E6PA 2Z6IA 3OZOA 3LRKA 1S46A 3UETA 1C8YA 3B97A 3A12A 4QLLA 2CLFA 3UYIA 2VZTA 1RCOB 1XRTA 3GH4A 5DT5A 4MLRA 1EL3A 5SWUA 1ONXA 1DJXA 3SQLA 2C1IA 2CERA 2ISVA 4ZB5A 3CPRA 2DORA 1IQ8A 2WZEA 2EKGA 1V6UA 2XIOA 3GG1A 1YBQB 5HJLA 3OIXA 4K1GA 2ACUA 4HPGA 1QNRA 4O0KA 3APYA 3QYSA 4NL1A 1UR0A 1UMYA 3MZ2A 2WSYA 1WXYA 4JTDA 5DMMA 1XLIA 1Q6FA 3A3XA 3HFTA 4U28A 5D05A 3BICA 2EPKX 1MW2A 3BG5A 1TWIA 1L8PA 5EU9A 3O63A 4ZSUA 1LG2A 1DXIA 4I7UA 3GAYA 3NM1A 2W61A 3CUHA 4M19A 3KL5A 3ZJKA 2YIHA 3I6EA 2YBVA 4AD1A 3WQCA 2RH9A 3L4XA 4QE1A 3VIHA 8A3HA 4PTVA 4TTUA 1JAKA 1KFKA 3G1FA 3GY1A 3VGFA 3GU2A 1L0PA 2PRLA 4LCRA 2EHHA 1SW3A 4WOZA 1RVKA 2J27A 3QGVA 3LK6A 3HIJA 4H6QA 4Q8MA 4YTSA 4PUJA 3CH0A 1W31A 4AHOA 4NQ1A 1Q6DA 3MP4A 4E8GA 2PZNA 2VP8A 2F38A 1WE5A 3SUWA 3AIEA 4HNTA 4JTSA 1I2QA 3SEPA 1N7KA 2QCDA 3TCEA 1PDYA 1TV7A 5CPOA 3SUTA 1O94A 3GR8A 2Z2BA 1UR8A 2JIWA 3TN6A 3ZIZA 3ABXA 1E6NA 3VNIA 3QGAC 3RU8X 5FESA 3HPFA 1YW1A 4AXKA 3KOYA 5CQ1A 1W1B1 5M5DA 2VCAA 3WIJA 3LHTA 4W4QA 1JEZA 1EJXC 1TVLA 2Z7GA 2ZVIA 3IJDA 1AQFA 1AW2A 3L23A 2ZTJA 3LQLA 1HJUA 2QW5A 1K8YA 1TV2A 3STCA 2PURA 4D6HA 2GWNA 3PJUA 4MHBA 4DY1A 3AZSA 5BU9A 4H8NA 3G1VA 1IZCA 1FXQA 4NRSA 4QGCA 4F48A 5CG0A 4DLMA 3URAA 3C61A 1EQPA 3FA5A 1KCKA 1AW1A 1TE6A 4AHQA 3IIPA 4H00A 2UBPC 5CPTA 3BOFA 1R2TA 3CZ8A 4INFA 1US3A 2YLLA 4W87A 3VO0A 1TRDA 3TYAA 1X38A 1H09A 4LT9A 2OSWA 1V77A 1FP9A 1IT0A 1YXCA 2HE5A 3ARPA 3WJWA 3XIMA 3TUUA 1K77A 2DSVA 3A4WA 3MV01 3SY1A 3WG6A 1G5AA 4MWAE 2QCDB 1HP5A 4WOQA 4LTSA 4A8IA 1KR1A 1SM9A 1XBZA 5FAGA 4YHGA 2WQDA 3P84A 1XIHA 3OEXA 4YTUA 2Z29A 4LUSA 4AEOA 1ZBKA 5I3FA 1NOWA 3BLEA 2AQVA 1OD8A 2Y6ZA 4D6FA 3BAXA 4E2VA 2J7CA 4GO8A 3NA8A 5BMWA 3PPCA 1ISXA 3UZYA 3K8LA 1JCYA 3K8MA 1IR1A 5FEXA 4ZEPA 2F61A 3SRHA 1VFLA 1WOAA 3BE7A 4UFHA 1X7FA 1F3XA 4UTKA 1GVOA 1FWBC 1DJYA 2FZDA 4IMAA 4PUEA 2BFGA 4GWEA 5DLCA 3W23A 4B5SA 5M17A 4FALA 4O4WA 1ITXA 2BHZA 3GKAA 5F4WA 1VBGA 4IIEA 5E6YA 2D3LA 3N2BA 3LCFA 4ZVJA 2GYIA 4CNPA 3PPFA 4WR3A 4H8UA 5CEWA 5CH9A 2I14A 3L67A 1OQFA 2POZA 5G4EA 3RU6A 3VMOA 1GVRA 1NARA 3CHEA 4I5XA 3N25A 3PTDA 4GZEA 1LYXA 3UU0A 3WQ4A 2CXEA 4REQA 3QC0A 1XYZA 4LU0A 4ML9A 3W87A 3APTA 5C9UA 2FB2A 2WVUA 3LLXA 5D2WA 3ZVHB 1ZB5A 3WL0A 1WBJA 5HBFA 3DZ1A 4PTDA 2VX6A 5E70A 4BKNA 2YA2A 2ACRA 3G3MA 3ZVHA 3NDOA 3THDA 5DXXA 3ABOA 4C5ZA 4M82A 4QJ5B 1V8EA 2BXYA 1WAWA 4PTNA 2VDIA 2W0UA 5HOSA 3DG6A 3UJFA 4N42A 1XIFA 2QDGA 2Q71A 5K4ZA 2TSYA 4ASTA 4NXKA 3U7VA 3TLQA 5D9MA 1V4YA 4NNAA 1A5UA 2X0HA 1TV8A 3N1AA 2Z26A 5A6MA 5T8GA 4DWDA 3I3EA 4BR1A 1BKSA 2DZUA 3BVJA 3IUIA 3KOFA 3SADA 4FX6M 3OW1A 4EXAA 4A4AA 5GNXA 2WKLA 3FIGA 4L64A 3M16A 2VGBA 5I09A 2HMCA 3UFYA 2X05A 1O1HA 4UCFA 3PK7A 3PBMA 2ZZ1A 4GVFA 1EF2A 2OGYA 2VX4A 1RLCL 1WUFA 3GTIA 1DTNA 2R1LA 4F0KA 4Z42C 1HL8A 1ALDA 3R11A 1Q6OA 3FXYA 1XBYA 3PS7A 3MBFA 1U1UA 3E12A 1OC7A 4CNUA 4HHLA 1B9BA 1ICSA 2V8ZA 3HG2A 1WKYA 4Z0JA 5CBBA 2ZX9A 3W83A 1F61A 3GXDA 3NQ2A 4YU1A 3KLKA 2ONEA 3UQNA 3NGJA 3W22A 1NDZA 1JPIA 3SFKA 2XDFA 4KS0A 1MO0A 4PMDA 5CZJA 2WANA 4XIMA 3F2DA 1K8CA 4W86A 5KZ6A 4XAFA 2R24A 3B0PA 4TO8A 2GVLA 4NY2A 3HURA 1WAUA 4NAFA 3AS1A 5A2BA 7CGTA 4UTWC 3GTHA 4AIEA 4PR4A 4I90A 4KCTA 1O12A 3W2LA 4ZA0A 5LHEA 5CPMA 1OK4A 3VILA 1VCFA 2HXUA 2O7QA 4A8NA 1JXJA 3PZNA 3OLGA 4ENLA 1WKFA 1EJUC 4HBKA 3EEZA 3POHA 3B04A 4HNCA 2YBTA 3EDEA 2F2KA 2WC4A 3WFZA 3E6EA 4BA0A 4CCEA 4YXGA 4UOQA 2VFEA 4ZOCA 1EWEA 4Z1CA 3LCXA 1RH9A 1X98A 1SSGA 1FDZA 1UD4A 3AS2A 3LU2A 3W1XA 3WBXA 1XH0A 1F7BA 2F84A 5AHNA 4Y96A 4AC7C 4TIMA 1DWAM 3H24A 1GPFA 3TYCA 4WJ8A 3BWWA 4M8UA 4QIUA 4WCJA 3OG2A 4RK8A 1ICQA 2Y5JA 3T0CA 4WVXA 4MB1A 2W67A 4IIGA 4QCEA 1HJSA 4GIEA 3RM4A 4TX9A 2WVVB 4FA3A 3P81A 4JX5A 3IK4A 4H04A 2Y88A 1VJIA 3LZ3A 4YS1A 2AL1A 3FYOA 3GG8A 3QYQA 2EBNA 3LCWA 2ON3A 2CITA 3HZ3A 3C0SA 3PBGA 4BEQA 3WH8A 4UTIA 1CI1A 5K2ZA 1XIDA 1KFWA 1ME8A 1OF6A 3AIQA 2C8NA 1XYAA 1J0YA 4A3QA 3GKFA 1O1ZA 3SRDA 3DG7A 1N55A 1VRDA 4I7WA 4DBEA 3UW6A 1FP8A 1EF3A 1VJZA 4JFWA 4AMAA 4EP8C 2JBMA 3W74A 1EJRC 2RAGA 3UGRA 2IW0A 7PTDA 5JH1A 1EJVC 3BAWA 1SFJA 1WA3A 2J79A 4DZIA 1E0UA 1X8FA 5E09A 1A3XA 2X1RA 4NRRA 1XG4A 1NIUA 4WX2A 1GW1A 4GZJA 3W1QA 4ZQRA 4DO6A 4AHPA 3MZNA 4MJ2A 3Q2DA 4GUHA 3L5LA 1CZ1A 1FHVA 1FFQA 2Z2UA 4TU1A 2CLIA 1B2YA 1B3XA 4TV5A 3QZAA 1C3FA 2GQ3A 3A47A 4Y8FA 4JDYA 1XSKA 1R85A 1LCOA 1QK2A 2YYTA 3AXMA 3KOZA 3N2XA 3MC5A 4KWWA 5JH2A 1DIDA 3GNDA 1JDAA 4S3DA 2XIQA 1GK8A 3GIQA 1E72M 1MW0A 4PB4A 1XLMA 3BXWA 3CH9A 3GVRA 2VR4A 5E9XA 3AHZA 3W72A 1QW7A 2YCLA 2Y7DA 4JTQA 4E2OA 3PM6A 4MIMA 3HG4A 2Z1XA 3UZWA 3LENA 3O9NA 4Q8NA 3WNKA 4RXFA 1BSIA 1IZKA 1TX0A 1EGVA 4K8EA 2EJ1A 3SZ8A 1E70M 3O15A 3VNDA 2WMHA 3S5NA 1OC5A 1GQJA 2QMJA 3PVFA 3RX2A 3W2UA 4LYRA 1ISYA 3O0FA 2W63A 1W54A 4K8HA 4K38A 5C7HA 1R38A 2D2GA 1G4TA 1S38A 3CIVA 2CHNA 2YB1A 5AYYA 1G1YA 2XFYA 3GG7A 3DYMA 1XI3A 3MCOA 5AYBA 4NZ4A 4R85A 5ABFB 3V35A 3CLWA 4BK9A 3QTPA 4I6VA 1OFEA 4M24A 2QCFA 1R9YA 2E28A 4MMWA 3CAKA 2V82A 2YLAA 1NF0A 5HDRA 3E2QA 3VKJA 1HIZA 1A5AA 4EPEC 2UY3A 1BWVA 4JTUA 2DFAA 4MAVA 2IPJA 2G5WA 4UTFA 1J2BA 1REQA 1TJPA 2ZXQA 3T0AA 1UR3M 4MNJA 3CB8A 5HULA 1S5NA 4IGMA 4M1RA 1FVPA 4E5TA 4UOZA 1CPUA 3G2GA 5C6MA 2NV2A 3KEHA 2PODA 1L6SA 4ATDA 5I78A 4XSLA 1F74A 4MB4A 2CIPA 4I9AA 2X30A 3R2GA 2VEFA 3AOFA 3CB3A 2PDNA 3CQHA 1JZ6A 3I4EA 4QCFA 3E5BA 3VOHA 4HZMA 4GY1A 3UWVA 4JQ3A 1H7NA 3QM3A 3TXZA 4NNBA 4G1NA 1A3HA 1C9DA 1XYLA 4POCA 2V69A 2HV5A 2HVNA 2AKMA 3VFLA 1QHOA 3CUJA 1YNPA 4U4MA 3B8TA 2ZIDA 2A7NA 1NJJA 4QJ3B 3VDCA 2PA6A 4PMRA 4NJGA 3O6DA 1N2VA 3NQCA 3LGEA 2OLSA 1ITUA 5IFTA 1H60A 3FHQA 3VI2A 1RPKA 1UD3A 4GC3A 2O55A 1SMDA 1W17A 1LRQA 4RZ6A 4XZHA 3VOGA 9XIMA 1J12A 3EMCA 1VIZA 4LC8A 2A7PA 1H41A 1PBGA 4DJFA 4RNJA 2PTZA 1B90A 1YDYA 3KDNA 3RM9A 3PZMA 2QPXA 4AUBA 1RY8A 3G8EA 3UPBA 3SQSA 1TV4A 1RV8A 3OZYA 1FDYA 5A8NA 4Y7EA 3H2MA 1IWPA 3WK3A 3W1TA 2Q8XA 3IVSA 4LQ1A 2VELA 1J6OA 3RHGA 3ALFA 5CC5A 5A2CA 1LLZA 1AL8A 1JJKA 1TTQA 3ES8A 4CQCA 4PUUA 3ARWA 3QLDA 3TN4A 3CAQA 1R9ZA 4HZ7A 2HPIA 1R7AA 3GRIA 3BZGA 1FOBA 1SO6A 1HJXA 5IDIA 1K9FA 3FK4A 1FHLA 2GVYA 3U57A 2AAMA 1XIEA 3LTSA 3DFOA 2PAJA 3PY2A 3IGXA 4H9ZA 3KBWA 1W2PA 2D2OA 3SUUA 2X41A 2YW3A 1RK5A 4ZSTA 4DF0A 1XBVA 3DYOA 4DEFA 3ZJ7A 3FJ6A 7ENLA 4J3UA 3VAVA 1MUCA 1DJHA 4UIOA 2V5DA 1OCNA 1QK0A 3VTRA 3SCRA 1C8QA 4JN6A 1KGWA 3UY8A 2GK1B 1V6XA 1ECQA 4JIEA 3BL3A 4OQVA 2JK2A 2ZRZA 3SCNA 1E6RA 4GYPA 3TTYA 3TAOA 2H6RA 3ZLFA 1TCMA 4HMNA 1FWJC 3N04A 3S1GA 4HNLA 5F4SA 5J8LA 1BG9A 3S47A 3W2KA 1ZJIA 3AXKA 3CWNA 3W1UA 2GDUA 1FH9A 4W7UA 3C56A 3KBMA 4O11A 2NXHA 3N15A 1TJ0A 1QUMA 1G7VA 3UD6A 2GUBA 3KP0A 4C7GA 1QAPA 2NX9A 5REQA 1UC4A 1YIXA 3CTTA 2NLYA 1QTWA 3KS6A 2HVOA 4XSMA 2W4XA 3GNXA 3RFAA 4ZFCA 4N9BA 2TYSA 4IISA 4N02A 4C6NA 4H83A 4O19A 2JKAA 2HBXA 4IPLA 1ZHAA 1O68A 1OX4A 1UKPA 3MO4A 1A5NC 4IMFA 4QP0A 4D71A 4EANA 2QV4A 4I9TA 3NO3A 3GWQA 3QHMA 3LERA 5DBTA 2OYMA 1KXVA 1MVYA 2Y7FA 1W1TA 5HATA 1FX6A 1XGEA 2VZVA 2GGEA 4GVIA 4ZXOA 3CWOX 3MDWA 1WZKA 4F0SA 4PRRA 1IYXA 4CVWA 5AYZA 1Z89A 2YCIX 2G96A 1BXCA 1J9YA 3M0VA 1W3JA 5HMDA 1VFHA 1XLLA 3FVDA 3PANA 3L9CA 1ENUA 2J62A 1A53A 4HMCA 1UPMB 1JZ7A 6XIMA 5FAJA 1XRFA 1S5TA 4RE4A 2J9XA 2NVAA 3URNA 3W53A 4IGHA 4BZYA 1EYEA 1PEZA 3WLLA 3TQKA 2CLLA 5D2XA 1Z48A 1LLOA 3ARYA 4DQWA 5I3IA 1K7FA 1TCDA 1ZALA 4X2RA 3FCPA 4ZTYA 1R3TA 1B3OA 5C8BB 1VLWA 4E2DA 4CQ8A 2WV8A 2GGHA 1SR0A 2C1GA 3VXGA 2XUCA 1CGWA 2RFGA 3DHFA 3UXAA 3M0HA 1JIBA 3G77A 4GZIA 3GXPA 5CZ0A 4JHMA 5IHRA 2DIEA 2VRJA 4Z17A 3ZWTA 1P7TA 2A3AA 4DBWA 1XQLA 2DW6A 2WC3A 3D3FA 1KM4A 2E6YA 2HZGA 5G4WA 2CHRA 4I7VA 3WENA 3VMNA 2PDPA 4K7VA 3VKBA 3VIJA 3OQEA 4RL3A 5A8PA 1O95A 1A49A 3H2NA 1R87A 3EPMA 1CCWB 4WLCA 3FEQA 1M65A 3WQGA 4DI8A 1FUYA 4J3XA 3TC6A 1E1FA 2NXIA 1AG1O 4DWSA 3P3BA 3GXFA 1OEPA 3L5AA 3M0KA 4ROPA 2ZZ7A 3TR2A 4GCAA 3U3HA 2PDCA 3ITVA 3LCHA 3N18A 2FMOA 4KFOA 4KGLA 4RX0A 1MFUA 5BRPA 4EK7A 4GY0A 1NQKA 2A3BA 4XZWA 3U2CA 2KAUC 3T4CA 4I5RA 1OD0A 2FQIA 3TYDA 5C9RA 2JF6A 5BXTA 2E6FA 1XCXA 4NX0A 2W6RA 2D69A 2VKZG 4KBXA 2HEJA 3BLIA 4L9ZA 3IVUA 1TPC1 4CQAA 4MGGA 1QPRA 3GDMA 4QE5A 2OLAA 2J25A 4UTLA 4J27A 5H2ZA 2QCMA 3L4VA 3AXXA 4FOKA 4EAYA 4OUEA 1VS1A 5I07A 1PE1A 1PV8A 4OGZA 3W7KA 1UASA 2DH3A 4MWAC 4NI8A 3LPPA 2Y5EA 4P8VA 3EA2A 1KXQA 3LPFA 1U83A 4ERIA 4QITA 2C3ZA 3OQ8A 1HN1A 2YBUA 4FK9A 2INZA 1I60A 2EG6A 2BOGX 2J6XA 1SSDA 3VX0A 3CAWA 3IRSA 1Q45A 2QS8A 1ESWA 1PB0A 2RDTA 3LXCA 3AMKA 1EWDA 4DF1A 3UEQA 3OA3A 1EOMA 2QJMA 1D7FA 2WPBA 1QDSA 4XUYA 3TNBA 2NSXA 1PTGA 3LNMA 4KWUA 3R0UA 2CLEA 1F3EA 2QT3A 4H6EA 5DRIA 2DZAA 1VR6A 1V79A 3FW6A 2PDIA 3SRFA 4N9CA 2NT0A 2Z1VA 4AFYA 4LNCA 3F4WA 2GDVA 2RHGA 3W01A 3QZ6A 1EEPA 1XINA 1ZS2A 1B4KA 1UP2A 2D22A 4GINA 5AB3A 3NQMA 1LT7A 3M0JA 3CUXA 3QMTA 3SCQA 4A8RA 4M29A 1G67A 2J9YA 2ZKMX 1XF0A 3IRDA 4O54A 2H3DA 1GVFA 5TAOA 5FEWA 1Z8AA 3HQOA 4FXJA 4KCVA 1H50A 3JVAA 1MQQA 4NIRA 1YNQA 4LYPA 2B81A 1AQ0A 3RYSA 5CSUA 1EPXA 3FAXA 4JIPA 1X39A 2BVWA 3WX7A 2XTKA 5LNWA 4PC8A 2GJLA 3OHMB 4C6EA 3GZAA 5I0DA 4IXXA 1R3RA 3ANUA 4C1NB 3PZUA 1PKMA 1FWAC 2ABAA 1Q7QA 4AY7A 4ERAA 4AZGA 1VD6A 3QV7A 3HV8A 1O5QA 3T40A 3CV1A 1T99A 4PUWA 1FWSA 4BFAA 2ZX6A 1VGAA 1JZ2A 1AW5A 1ZENA 3VIIA 1GOMA 4U5KA 5JBDA 4GD0A 1KBJA 1B3YA 5CLTA 1K6WA 2YX0A 1TZ9A 1TRIA 1OCJA 1JFHA 4Y9MA 1W3HA 2O56A 4Z08A 1XGDA 1TMHA 3LMYA 5C2XA 4WQ6A 3LQGA 2GJXA 4UXDA 1W1A1 1ICPA 4IQEA 4KW2A 3BANA 5AYIA 1TR9A 1UOZA 1KTBA 2IQTA 2OG9A 1QPOA 4GI6A 4Q7IA 3MI2A 4F79A 8RUCA 3VM5A 4S3KA 1D8WA 3LTYA 4ZCWA 5A1AA 1KM5A 3I68A 5DY2A 4D6CA 2NQHA 4A05A 5XINA 4A3RA 4EWND 2WXDM 3KE0A 1F73A 3U2EA 1T7LA 3TE9A 2ZZ6A 3WBWA 2HJPA 5J04A 2OX4A 2ZBTA 5E6ZA 3MCMA 3WD1A 4Q8OA 2C1HA 3LSCA 2YYUA 4YYFA 4GK8A 1UC5A 1BEUA 5C9ZA 2C71A 1P0KA 5FL0A 3PWGA 2DQXA 3OVPA 2I5IA 1OYAA 3DKJA 3IJQA 3EKZA 1XXXA 1H0IA 4EPKA 1HFBA 1LOLA 4GRSA 3WMSA 4MB5A 1TIWA 2DSZA 1GW9A 1FHUA 1IXOA 4AAJA 5FEZA 3FS2A 1QFEA 1JG9A 1TSIA 4X0VA 2DQWA 2WK2A 2FFIA 2FZMA 1UKQA 4PN2A 1E9ZB 1MZHA 1EC8A 3S3GA 4KQNA 4HK5A 5AHIA 4D6DA 1PIGA 3HMCA 1XP3A 4XD5A 1UJPA 2KZHA 1XRVA 3VM7A 2GJXB 1KLYA 2BBFA 4US5A 4GUIA 3PJXA 3UWWA 3GHUA 5EMUA 3O8AA 1FKWA 4BEUA 1DE5A 1MXDA 4V33A 3TJIA 4PUDA 2CLPA 2ZWYA 2EJAA 4PH6A 5CZSA 2G3NA 4EF9A 2VI0A 1FKXA 3TCSA 1K1DA 3QW3A 3E0LA 3KM8A 1IZJA 4G6CA 4YLWA 3SIMA 2NV9A 3DC0A 3SBFA 2P0OA 3HU7A 1UROA 5EMLA 1CBGA 4Q8QA 4F4RA 1JDCA 3PWAA 3K1GA 2PWEA 3VCRA 3ZYZA 3BUVA 1D7KA 4QG6A 1GKPA 3BLFA 3SM0A 3NQ6A 4PSRA 4PL2A 4C7FA 5KZEA 4AD0A 2DVTA 3IGHX 5E0KA 1ZAJA 3ICJA 3VNMA 1QNOA 4JN8A 2OZ3A 1TX2A 1JYWA 4B4FA 4TR9A 4IFOA 1T6MA 3OPSA 2JE8A 3W25A 2IKGA 9RUBA 3WQDA 4I8YA 3KFTA 4JNMA 1QHPA 3PN8A 5MKGB 1UKTA 4HIBA 2CHOA 5LSMA 4UMAA 2E8YA 3FXGA 2CCRA 4XD6A 4PCSA 3TSDA 3W73A 3M47A 3F03K 2HCVA 1OFPA 5AC4A 1KTCA 3CV2A 3ITOA 2J7DA 2V5JA 3T8LA 1EJTC 2DJXA 4ZO6A 3B0UX 4XTIA 4C5YA 3S2CA 3PJWA 1H7OA 4H9VA 4C6DA 3TN3A 1KTNA 2BLEA 2OCZA 4AXNA 2ATMA 1HG3A 3L66A 2FJKA 4W8AA 3NO5A 2P8BA 2FB3A 1ZZMA 4FSAA 4P2VA 1TA3A 4J3VA 4K36A 3T2QA 4J3ZA 3XISA 1P43A 5AHFA 5K3VA 1G0CA 1KRBC 3OIHA 3PBWA 1R86A 3MSYA 4LUTB 3CZJA 5B80A 1M41A 1HL2A 3AALA 3F4DA 2ZZ2A 4R7WA 3WUBA 1E4MM 4O18A 1BYAA 4PBGA 1ME7A 3S83A 4KRUA 4IMCA 2FTWA 3OBAA 1VBHA 4GQ0A 2FZBA 1Z42A 1JR1A 3Q67A 3H21A 1GVEA 1NQ6A 1T41A 1JYVA 1XD1A 3THUA 3C8FA 1E6ZA 5D33A 2A7RA 1JZ4A 1LBFA 1E40A 1E0TA 3GVWA 8TIMA 4L4PA 3VIGA 4JFSA 5LIXX 3WLJA 3BPWA 4ORMA 2J47A 1SZEA 1XHGA 3EXRA 4QQUA 4HPHA 7A3HA 3NZGA 3PZVA 3EAUA 1YHTA 3CL7A 2XIMA 1SMAA 2OGJA 4ACZA 4ZL1A 1NU5A 4GC4A 3KBSA 4LVDA 1ZPTA 1FWGC 3P61A 3TYUA 5HMFA 1Z3NA 2FZNA 2VYOA 4NNCA 1JCMP 2G3JA 3B3DA 3GD6A 3UPWA 2E5CA 3QTGA 2VNCA 1Y5WA 4HCHA 1P0EA 2YCEA 4WSJA 3BJSA 4PFMA 1TPDA 3DN5A 4AWEA 1CNVA 1VPQA 3IJ7A 1LUCB 3TC7A 4UTJA 1H4PA 4HNOA 4CQDA 3HF3A 4YL2A 3WNLA 5LIYX 1US0A 5E93A 3W7GA 4QG9A 1NH6A 2G4JA 1V6YA 4TMBA 4D8AA 3BC9A 2Z2AA 2FYMA 3EMZA 2YB4A 4M80A 3R8RA 5FSEC 5D9OA 2OR2A 2FPYA 2AMXA 3A13A 3AUJA 4LVAA 2XGZA 2PE4A 3E49A 4OFCA 4ADUA 4BQ4A 4DM2A 4FX7A 3C2OA 2WC7A 2PU1A 4RPPA 3RN6A 4IUOA 1DJGA 1XX1A 3D5HA 1NF7A 5LA2A 1UWIA 1LROA 4UZSA 3BSHA 4WY0F 4IIHA 4AY1A 1EJSC 4J3TA 2XVGA 4B5NA 2E9BA 4RR4A 1BVNP 3WLOA 2V63A 5B7ZA 4G1KA 4YTRA 2PDUA 1Y65A 1OZMA 5AHLA 5DCEA 3VABA 3WBEA 1PHWA 4YWSA 2P1FA 2HS6A 4B16A 4UQDA 2CESA 4D6EA 4QEEA 1J93A 1W32A 3A6OA 3II1A 2PDYA 1OX5A 4CD7A 1D3CA 1ZBCA 5ECUA 3ITLA 4S2CA 5EY5A 3CJPA 3NOEA 4GJIA 1BF6A 3STFA 3DH7A 3BMWA 1P1MA 4Z2JA 4XISA 3ZS4A 3G1HA 3AS0A 4HSHA 1V3IA 1OIMA 3IGSA 3MHUA 1JI2A 3GNRA 1Q6QA 2A6NA 4DJEA 2XSAA 1IEWA 1NP0A 4C1NA 5IDZA 1O66A 3LBMA 4H9UA 5K9XA 1DHPA 2XGBA 4HOWA 2G3FA 1V03A 3WYZA 3H7VA 5LA1A 1ZAHA 2BS9A 3OLIA 2P50A 1QI2A 2BXVA 4Z2HA 3E0FA 3TWBA 3UR8A 5AHEA 4FR6A 1S2WA 2OOFA 3OYXA 1E1CA 1QNPA 2CC0A 4S3CA 3D47A 2Q6ZA 2YL6A 1BWKA 1JGIA 5AC6A 3FSTA 4WEVX 3O06A 5BW6A 5HNRA 4Z2KA 4E4FA 1RP9A 3W76A 2R1KA 1EA0A 1ISVA 5LXXA 3QSRA 1CENA 2QJJA 1V6TA 5GQBA 4OOUA 2C0AA 2INEA 3IJ8A 1HGWA 1Q2RA 4GYPC 4XZ9A 2VHLA 5H6HA 4Q3MA 1S1RA 1ZL1A 3UCQA 3W37A 4L4MA 4IM4A 1R3VA 3PAJA 4NVTA 4JKMA 1NWRA 3E0VA 4G7FA 3OBKA 4XZNX 1Q8JA 3O0KA 1QW8A 4W8BA 4MPQA 1OFQA 2ACSA 1BLIA 1ZGDA 1ZLPA 3DOPA 2E6AA 1F6YA 4GYFA 4IFKA 1XQKA 3P5ZA 3PBYA 5D09A 1GQNA 2F2HA 1E73M 4GMEA 3F1QA 1YPFA 1ODUA 1YKWA 4GQGA 4QX4A 1VPXA 4QQ3A 4PRWA 2DEPA 4R7JA 2P76A 2Z4GA 1RLDA 2YPIA 1RCQA 3M1ZA 2WPGA 2AGKA 4QJ4B 2F9RA 3ZT7A 3KBNA 4LANA 3TKFA 5BXPA 1PIFA 2VM8A 1V08A 1E71M 1PL9A 3MANA 5L6UA 3QR1A 4WDWA 3UG8A 4ZQOA 2F6UA 3VCCA 1WDRA 4Y9NA 2ZZ3A 2C16A 4IIBA 3W9ZA 1A0DA 3ZT6A 1H5VA 3NM3A 3KX6A 4WDTA 2VUNA 2XH0A 2V2DA 2DT1A 3AZRA 3PUDA 5DQPA 4WRHA 1YTEA 3N14A 1GT8A 4S3JA 3THQA 3M9YA 3MP3A 2GVJA 3L4UA 3OTRA 1IE7C 3NNTA 3M6YA 4EE9A 3VNKA 2YXXA 1XC6A 1EQCA 3B06A 3N13A 3VPLA 2EG7A 3CHFA 2P53A 3R0KA 4OBRA 4GISA 3TTQA 5LNVA 2A3HA 4IIDA 4CD5A 2HS8A 3BQ5A 1LL6A 3VD3A 1XUUA 2PP1A 2WMIB 2ZA2A 3SUVA 1K7EA 1MNSA 1BKHA 3BG3A 5DXYA 3PFMA 1C93A 3WLPA 4DVOA 1GYLA 2H3BA 1VYRA 3VDHA 1QR7A 3GVGA 5BWFA 4O15A 3U6WA 4IQJA 1G4EA 3BAJA 4GNVA 1FCBA 4JTKA 4LXFA 3WH7A 4L4LA 2EQDA 2V5KA 3WJSA 3VZZA 1UH4A 2VMFA 5I5RA 2E5DA 1GG0A 2OOGA 1C91A 1RZMA 4HTBA 1Q6RA 3GZ3A 3W7PA 3B4UA 4DJDA 3WLTA 3PZOA 1W5OA 5HPCA 1HKIA 4L9YA 1JZ3A 2E40A 4A2SA 1T8XA 1I2NA 1XRSA 5C71A 3W1RA 1JRBA 1F2JA 1DWFM 5CBIA 4KRZA 1IT7A 3P0WA 5LHFA 4OT7A 3SDOA 4DJEC 4ICNA 3A23A 4AF0A 3W6MA 3GTNA 5T26A 4WDXA 4D8ZA 1XKYA 2P3EA 4JHOA 3R13A 4KT2A 1VBUA 1IGSA 1UWTA 1GOKA 1OWQA 3ZMRA 4JYFA 2IUZA 3GXNA 1SJDA 1ADDA 2WCGA 2YSWA 3QQ0A 1XIIA 3TEVA 4HVXA 2QF8A 1UWRA 3UNTA 4OWGA 4V27A 5A8GA 3WUEA 4IQDA 3CHVA 4LUTA 3DBPA 2E68A 1IV8A 2XVPA 3TJLA 2VTFA 2A2IA 2PDMA 2YFNA 3BGGA 3ZOAA 1CLVA 4H3DA 5A6LA 4MDOA 3UXLA 1FQ0A 4O0ZA 4HU8A 3CHDA 2HXTA 1GOQA 3GXTA 3GXMA 3RRXA 1GVIA 4UTHA 1AD4A 4XK2A 3TW9A 1P6WA 4C6JA 1XCFA 1P6CA 1NY1A 5K4XA 4NUWA 1YDVA 3H23A 1OBAA 5DMNA 1K02A 1OINA 3G1SA 1W1IE 1F3WA 4CEUC 4JIQA 3VC6A 4UOJA 3LCLA 1VEMA 1XLBA 3ITTA 5I03A 3ID7A 4GJ1A 4A3UA 3QPZA 4FIQA 4UB9A 3WJZA 5MKGA 1UD2A 9CGTA 4RNHA 3IV8A 1W3KA 3DERA 4MUZA 3N3TA 4GNKB 1I8JA 3KAOA 4P7RA 3U8GA 4B9ZA 1Z44A 2QULA 1GWJA 1FH7A 4HHPA 3DX5A 3AICA 3NL6A 2PUZA 4AZHA 4MFDA 3WF1A 1XPGA 1VZWA 2XVNA 2GQ8A 4JGDA 4HMEA 4XKYB 2O4QA 1R9XA 2WNNA 4GZ7A 1SFLA 3W1NA 2V67A 5A5WA 2I5GA 4QISA 3UJSA 2F7FA 5F1VA 2FLIA 4M3PA 4J7RA 4CNTA 3BQ6A 1GOXA 3FVMA 3W7RA 2RKXA 4IG2A 2QKFA 3D6NA 4LYQA 1X8CA 3MQTA 4O10A 2MUCA 3NEVA 2GUYA 3PJTA 1Q85A 3PZQA 2V3GA 4IL0A 2Z1WA 4JL2A 4LAZA 3HO8A 2CWNA 1KLZA 3JZEA 2A3CA 2GOUA 3NEHA 4GCXA 2J75A 3MSRA 4Y6GA 4LX4A 1KFCA 2NV1A 3CUFA 2DY3A 3WH9A 3T2PA 2GPTA 3UYCA 2GUUA 5A6BD 3NSXA 4YCPA 3CZGA 3OLEA 3W7HA 5HNTA 2QAPA 2HROA 3QHOA 2OWXA 3EEGA 2ZDSA 3TH6A 1XS2A 3SCWA 4HN4A 4KWOA 1J8VA 3E5PA 2VQUA 1W37A 1QPKA 3ZSTA 1EP3A 4J2MA 4DJFD 1QMLA 4MFEA 3CYJA 4B4HA 2DT0A 3GAKA 1FWCC 3CASA 3KCJA 5HQLA 3GHTA 2DUXA 4E8CA 4KPLA 3T55A 3WZ0E 2VJXA 1OC6A 1Q65A 2Z24A 1H61A 4QDPA 4L56A 5I7GA 3RPMA 1BFNA 2QJNA 1ADOA 2FH6A 2D0HA 1U5VA 1PX3A 3VKCA 1FWDC 2R91A 1H1ZA 2Y70A 1AQHA 3N2TA 5C0QA 4Y2WA 1WDQA 1EZWA 4H7CA 2DV0A 1K3UA 4C7DA 1MRQA 1TWSA 3LXAA 3EDKA 4XBJA 3SAZA 3AROA 2AMGA 3V1HA 8XIAA 1GCYA 2ZUWA 1E43A 3MCNA 1M04A 3LGGA 3KVKA 4O16A 1V02E 5EBAA 3GTXA 2ICSA 2NQ5A 1BRLB 4FNTA 3W7OA 3P8JA 1QNVA 3STPA 1K7XA 4EOUA 4AVOA 3S5YA 1JUKA 1MXSA 3RPTA 3K2GA 3QC3A 3WJYA 1MNZA 3T1GA 1QU4A 1GOIA 2FGLA 2JFEX 5HXMA 1CDGA 3DI0A 1HP4A 3TNOA 2R1PA 1QOXA 5I06A 1RBOB 1V0NA 2CW6A 2PMQA 2NUYA 4LBRA 4FNSA 2GGGA 3QPEA 4JN7A 3M6DA 2TAAA 1WV2A 5HWNA 3QBUA 3VD9A 3S2LA 1JPKA 4B5WA 3QMRA 1IIGA 2NLIA 1KXTA 4FXRA 3DCPA 1A5MC 1GQLA 3U2OA 1LOSA 3FHAA 3LHVA 2I56A 2QXWA 2X0SA 4DYEA 3ARZA 3N73A 4AMCA 1EH9A 4DJDD 1PXGA 3OVRA 5HNNA 2PDKA 5FOOA 3H2EA 1E9IA 3T9PA 1RPXA 1OG6A 3TROA 2Q8LA 4QR6A 3B05A 2DDXA 4N0RA 2GSEA 4PYSA 3S8HA 2QAFA 1BHGA 1QI4A 4JHZA 3NSMA 3TSMA 3MYPA 3TW6A 4C6KA 3WY1A 4Z0SA 3IJ6A 3TQVA 4HCLA 3TZFA 2YJQA 1XFCA 1NM9A 3MT1A 4IP7A 5KETA 4UMBA 3LUTA 5D4YA 3AAMA 1A4LA 3W7MA 1FFRA 1AMKA 2ZUNA 3EKLA 3KL0A 1LT8A 1QPNA 3VX1A 1TVNA 3MI6A 4O14A 1CGXA 3A9IA 2PDHA 3GG0A 3W07A 4DI9A 1XL9A 4HA1A 1XIJA 1W5QA 4JTTA 3PPHA 4OV4A 2J24A 2VQTA 4HKPA 3W70A 2OYKA 3GDLA 4NXSA 1QI3A 3DFTA 3H22A 3W29A 4UMCA 1C92A 2D2HA 2OXNA 2BGQA 4RDVA 1H7PA 4Y8EA 1CTNA 3QH2A 1I9CB 3VINA 5BYWA 2UY2A 3H2OA 3W00A 3CUZA 1G7UA 3KTCA 3M64A 3WLNA 3IACA 3HV9A 1OFOA 1MXGA 3MBDA 3N17A 4CQBA 1B1YA 2PB1A 4JX6A 3W7CA 3SN4A 3O7UA 5IFPA 1WPCA 4NX5A 3W6YA 3HB9A 4H2HA 4MAZA 1TWDA 3ZVIA 2WQPA 3A5FA 4NKCA 4AZCB 1CEOA 3L0GA 4U5IA 3UP8A 4FS9A 3GC4A 4TX8A 1BYDA 4HT3A 3UNDA 4AG0A 3GFZA 3E2VA 4V1YA 5FKYA 5GNZA 5T91A 2B7QA 4JTGA 4AD5A 5LIWX 5D9NA 1UBPC 3GNOA 2WKGA 2VC7A 4FLRA 2EKCA 5AKQA 2J6VA 4XKMA 5F2IA 4CCDA 2J7GA 3CPUA 3S1UA 2DT3A 1O5KA 2DUAA 3NPUA 1XLAA 3EWWA 1QW9A 2YCJA 3EZ4A 4BI6A 1TPH1 4Q6JA 3UWEA 1SU5A 2GSJA 4GHRA 2NWRA 2OJPA 4LF2A 3S9ZA 4G7EB 2HWGA 4H41A 4E38A 4PBFA 3FY1A 3W7JA 4NZ5A 3V16A 2CZVA 1XC4A 4MY9A 3AWNA 3I7SA 1US2A 3T8QA 1PO9A 4PEKA 1JDEA 3TU9A 4KEZA 4MSSA 1TTPA 4MY1A 1L6YA 1ONEA 5KZDA 4J40A 4DN1A 2RGMA 4WDUA 1OFRA 1Q6GA 1QVBA 2A3LA 3RILA 1JPHA 4HHMA 1EA9C 3VYLA 2YL8A 3ISIX 2DGAA 3DYPA 3GK0A 1JFXA 1MW3A 3L2LA 3EDJA 4AY8A 4LV9A 1KW1A 5MF5A 1C8VA 2V3EA 4J4KA 1PS9A 1FWWA 5I79A 3GH7A 3MP5A 4ZE4A 2OEJA 4JY8A 2PS2A 3CO4A 3RR1A 3GX9A 3M7WA 4GIYA 4UNLA 2ZUTA 3RCNA 1W6TA 4H4IA 4KGJA 1H2JA 2V2HA 3ES7A 1JNEA 3JUGA 4MNMA 1QNQA 3L12A 2PDGA 4H9YA 3RLVA 3UVIA 4BI5A 1ONRA 1XDLA 5D2VA 2Y4SA 4JBRA 2ZRVA 1XDJA 3CQJA 1CGVA 3R7MA 3CZLA 3BOXA 1EX1A 1HJVA 1UG6A 1K4GA 4LWWA 3SY8A 3L4ZA 1YPXA 1JL8A 4JTCA 1BSLA 4HGXA 2VOMA 1XD0A 5CZTA 3JZUA 2J8FA 1KKRA 3UT0A 1UP3A 4QJ1A 3ITGA 3C2FA 3UF9A 1XISA 5LNRA 1KNWA 2CBUA 1REQB 3BW2A 5CGQA 3N29A 3PAOA 1J4EA 1VFMA 2C14A 3TFXA 3W88A 3GHSA 4WKFA 4EPBC 4NASA 1X1OA 1TPFA 1DIOA 3CEUA 1ISWA 2XH2A 2CWXA 3ABQA 3F4CA 1KO0A 2Q3RA 2G37A 5FJUA 4MKVA 4LJ3A 3A4JA 3QY6A 4JR5A 4KCUA 3M41A 3G0UA 1NTHA 5HAOA 1UR9A 2PWFA 1TV3A 3DFSA 3B8IA 2BSLA 4Q4KA 4QHRA 1ZRQA 1DWHM 3WLQA 2J77A 2VZSA 5FF0A 4DAIA 4O1CA 4IFRA 4KEMA 5D30A 3V5CA 5C2CA 2A5HA 3G1RA 1B3ZA 3RLHA 4DO7A 4JFVA 2R14A 4RDZA 4Y9OA 3V18A 4LUJA 3JR2A 5A69A 2D0GA 2W92A 1A4MA 3QKZA 4QSFA 4NP7A 3UWYA 1EXPA 1NEYA 1M7PA 1HKJA 5DO8A 3OLDA 4HYVA 1YLVA 2YFOA 3WDRA 3AXIA 1DORA 4ZENA 4D6IA 1AH3A 1BGGA 1W9DM 3L7RA 3ENLA 3JU2A 2POTA 2QHAA 1ZNNA 5HINA 2RJHA 1UWQA 5JIWA 3UZXA 4HNVA 1GKQA 2B0MA 4HCDA 3TP4A 3SCSA 3CO8A 5HWMA 1ZJBA 1TPEA 1FWTA 4DPQA 1OVDA 4NSBA 3LOTA 5A6BA 4ZODA 4K6AA 1YYAA 2BHUA 5I3GA 1JD9A 2P10A 5DCBA 3M5VA 1AODA 4XAYA 1POJA 2WCSA 1UWSA 1BPLB 4OBSA 3SURA 3KBJA 3ZZ1A 3PBVA 3DFYA 5I3JA 1WB0A 2GQAA 5DBUA 3H6OA 2NT1A 5I00A 4HZ6A 2AQOA 3BAYA 3WD2A 4IT1A 3AMDA 3V1PA 1CGUA 3AYSA 2J8TA 4R53A 4N9EA 2G3MA 1I2PA 4ZOBA 3NJ3A 2YZ5A 4H6RA 1GTHA 2QPUA 5XIMA 3KRZA 2WB5A 2UWFA 4HYRA 2QEZA 3I6TA 2ZRXA 5JVLA 4FB7A 3VMPA 3LBCA 5XIAA 4LB3A 1RJRA 1J79A 3QY8A 5H1WA 7TIMA 4Y90A 2CPUA 2WMFA 4FO4A 3IGUA 2ZUVA 2Z28A 5DMYA 1HZYA 3WNPA 3GH5A 2WWDA 3CK5A 4PRTA 4AH7A 4DUXA 2AL2A 3CMJA 3HA1A 1JD7A 3GBDA 2EG8A 3GUGA 3S1VA 2WHKA 4DBDA 1RA5A 4Q8PA 1FBAA 4L7ZA 5A6KA 2E25A 3K8KA 4AYGA 1VLIA 1IEVA 4CGTA 3SGUA 3BV7A 1KQZA 3CNYA 4P61A 3IVTA 1AZ2A 1OJXA 5JMUA 3T0TA 3T0BA 5BWAA 4MZ8A 5M3WA 2E6DA 4DNMA 2OVLA 1E4LA 1J11A 1PKLA 3REQA 1O5RA 3UG3A 1V3HA 4I5UA 2YZRA 1SVDA 4FMVA 3T0DA 3O2LA 1XH1A 1V6WA 5FJPA 4JXCA 3SN0A 4CU8A 3NQFA 4M6UA 3PWIA 3H26A 1G94A 3WD0A 5HMEA 3F4VA 5JQ9A 2O0TA 1ODZA 3NPXA 4YHEA 2Y7EA 3U5UA 3VKKA 3WQ5A 1W3TA 3BURA 2Y1HA 4W89A 1HQTA 3ITCA 3AFBA 1D3GA 3S1XA 5AC5A 3GE7A 4FHAA 4JNYA 3BARA 5BU6A 3I10A 5G5IA 3ARUA 2VDHA 3NDZA 5A6SA 1U2YA 4KH2A 4NZCA 4XZIA 1F6PA 3G1YA 4W8LA 4X60A 3ZJ6A 1M3UA 3W2JA 4XAZA 4H9XA 6PTDA 3AHTA 3EX2A 5CXPA 5CBJA 1QO5A 4XIAA 3UWZA 1LWHA 1DV7A 1TZ7A 4C6QA 4HYWA 3W75A 3P2VA 1UB3A 3ARRA 4IZGA 1UZDA 4QS6A 4U2ZA 1R6WA 1XYMA 1R3QA 2WM0A 1P6BA 1Z32X 5CJ5A 5H8PA 5JBFA 1WO2A 3VZYA 2OQYA 3MB9A 3BLLA 5DEZA 1QASA 3VC5A 1F6KA 3H54A 2I57A 3VK5A 2CETA 2BP1A 5LNUA 3IK2A 2BTMA 3L4YA 1EOKA 3XINA 1S3TC 4LNYA 3QJAA 4XBSA 4F0HA 1X6UA 1Q7MA 1EBHA 4WJXA 4MKNA 1TPWA 1RK6A 1K8ZA 1K9DA 4US6A 1XWYA 5DF0A 1RXOB 2Q8ZA 1Y5XA 4A22A 4ZQMA 1L6FA 3AYTA 3BW4A 1OYBA 5ABFA 3C6CA 1W8GA 3ABRA 3BJTA 3QY7A 1HX0A 1J0JA 3NQBA 4PTXA 1VIWA 2DU2A 3P93A 2X42A 4WIWA 4UNKA 2OT0A 4FP1A 4DZAA 1PPIA 3PZTA 3L2MA 3VE9A 4WJEA 5DRCA 3KL3A 4HQVA 3WLSA 1EC9A 1G4PA 2NWSA 4B2DD 3P60A 3SY5A 3CT2A 4AWSA 2ANUA 4NG3A 2WZTA 4ZO9A 1GJUA 3FNDA 2DZTA 4QFUA 3N6HA 3AZTA 4JEJA 2WHLA 5F2MA 2YCLB 2J74A 4A6GA 3RX4A 1X6LA 5TQLA 4F3HA 4F9JA 1Y7VA 2V3FA 3I7QA 3GU9A 4G7EA 2VC9A 2P88A 4X63A 3A22A 4L6OA 1F4HA 3QV9A 3MSGA 2CLOA 4OBTA 4B5VA 2Z0IA 2BVYA 1NFGA 1TMLA 4ZGYA 1YBQA 5GJMA 5D03A 1S5VA 1F07A 3T09A 2QJGA 3ERPA 1VHCA 3L4WA 3CL6A 1I45A 2DZWA 4WKAA 1CXFA 5CSSA 4LS2A 1DIEA 1I6NA 3T2OA 4L9XA 3NSNA 3I7RA 4AZBA 2E77A 2Z1BA 3NZPA 3TXVA 3M44A 2QR6A 4XUGA 1QI0A 4KFPA 4XBKA 5C5YA 1XLKA 3DHDA 2Y8UA 4O4VA 3OA5A 3S5SA 5CSRA 3WQ8A 3AIVA 3EPNA 4GNJA 3QEZA 2G50A 4MOZA 3WUFA 4NU7A 2H90A 5D2YA 2REQB 4PFHA 3UCCA 4CKQA 2D1ZA 3WNNA 3TYBA 3M5ZA 2PC8A 2HNEA 1D3HA 1ONWA 1W9UA 2WHMA 2L5HA 3DG3A 3SB0A 2X8RA 1UWUA 1T96A 2Z00A 5M1TA 5AFDA 3NQVA 4ZQCA 1PTAA 1KM0A 2OO0A 2YA0A 1O6IA 1R2RA 3PUGA 3KZPA 3CLMA 1DJWA 4Q8UA 1A5OC 2Y0FA 3IWPA 1FWNA 4PZVA 2V5CA 4TTGA 1S5MA 5TBOA 1RJPA 1E51A 3HPZA 3LM7A 1G4SA 2WO5A 4WY0B 1VB9A 3SR7A 2WMKA 1JAEA 4HU3A 4PBEA 1RP8A 2XM2A 4P8XA 5HR7A 2ZWZA 4GUFA 3BV4A 2VC5A 3R4IA 3M0ZA 4D6GA 1GORA 2ZICA 2ZVRA 1AL7A 1UKSA 3S4TA 1E9YB 3F2BA 1VQTA 4EVZA 4DNHA 1D9EA 5TIMA 2CZEA 2YA1A 3GFXA 4PSPA 3NTYA 3P74A 2FHBA 4JICA 4Q4MA 5CJMA 2IQDA 5LXEA 3ZR6A 4C6MA 5C70A 4ILSA 2V68A 3N12A 1ZP3A 2XN0A 5G1MA 4YVXA 1UR2A 3OGRA 1W91A 3TQ0A 1EUNA 5BXRA 1JF6A 4CN4A 4E3TA 5ABHA 4EXQA 2A3EA 4QBXA 1UIOA 1OY0A 2EPLX 1KCXA 4GUJA 4URIA 3ME3A 1JI1A 1N8WA 2PWHA 2JEQA 4DXVA 5I3KA 3QQ1A 4IUGA 4ZQNA 1X7IA 1Z9AA 4LW7A 4WZHA 2D2JA 1OFBA 1VFSA 4H2CA 4H8HA 3JS3A 2PTYA 2Y63A 4TQTA 1E15A 4LOCA 1JUBA 1JYXA 4CD8A 3G22A 3E9AA 1H63A 3MMWA 4YNGA 2NX1A 1TV5A 3A64A 3UXKA 4UTUA 1LM1A 1V7YA 3FJLA 2PLJA 2WYSA 2DVXA 3CPGA 2P0IA 5K9CA 4JCMA 2X1SA 4GIAA 3UXDA 3WN6A 5TNVA 3GM8A 3QMSA 1B5TA 3BMVA 4K68A 2OELA 4LYKA 3KHDA 1V0LA 2XG9A 1GZGA 5E1QA 2NQZA 3PR2A 3EX4A 4QLJA 3F5LA 5HR6A 3UWQA 3VKDA 1ZJHA 4Q4QA 4WK9A 5BRBA 2DSKA 1RSCA 4JAWA 1XCWA 2XIJA 2PWVA 3SSJA 3MHFA 3U2ZA 1I75A 1YDOA 1K8XA 2ZUSA 1O4UA 4FX8A 4EX4A 1GJPA 2NQ9A 1DTUA 4MWAD 4PE8A 5JIPA 5I24A 1KV5A 2B7PA 2GVEA 1T0OA 3G1DA 3B03A 4YJ5A 4Y9AA 2RDXA 4O1DA 2OKOA 4NAEB 4G5DA 5KITA 2FGBA 1OB0A 2VGIA 5FJJA 3IARA 3QHNA 3H4WA 4P8WA 3FDKA 3AIUA 4Q33A 4OIFA 4A35A 2X1TA 4GE8A 3W7DA 1PZ2A 1YADA 4PMJA 3IAPA 5EA9A 3G0XA 1L9WA 3PTKA 1M7OA 2J7HA 4JZ5A 4BCEA 5EKYA 5AN7A 1NELA 4RLIA 5LIKX 3TDFA 3USZA 1VFFA 3EWCA 4CEXC 1LJYA 1GGOA 2Y85A 3IS4A 2O9PA 5L9FA 2E7FA 3FKRA 1KM3A 5FJOA 4AZCA 1Y8BA 2UV8G 3TJXA 3VNLA 3N4FA 2MANA 4ZFMA 1I1WA 2GOKA 1AJZA 2Y5SA 1MFVA 3HGOA 1ZP4A 3NZQA 4DXXA 5IOBA 4QEHA 3MUXA 1U22A 3EOLA 2CXGA 1XIBA 3DFNA 1UA3A 4WUIA 1M9HA 2PI6A 3CMGA 3QKEA 3VOJA 4B91A 2WMGA 4IFKB 1UD5A 1U1HA 4LBSA 5LYRA 2D24A 5JU6A 1W1PA 1MEIA 2VGGA 1VRXA 4GGBA 3VOFA 1MYRA 1NAL1 2ZE3A 3KCLA 4O1AA 5H8MA 3E2RA 4EAMA 1ZY9A 3C8NA 3MKCA 3B8UA 1IT8A 4Z2LA 4FI4A 4MJMA 2HNHA 4NJHA 5AHMA 1JDFA 3V36A 2F8QA 2QIIA 3E0IA 1BVZA 4NI3A 2AKZA 1UKOA 3V0TA 1E4NA 2FH8A 1E0XA 1BTCA 3PB2A 3QFEA 3RJXA 4RZBA 2HK1A 4XD3A 4O12A 2BGSA 3AC0A 1C29A 2GZXA 5DELA 4LUSB 2H8XA 2AAAA 3PZGA 1W1VA 2VEKA 3LPGA 1E1CB 4AU0A 4UZUA 1OFDA 4KIEA 1TVPA 4R7OA 4H9TA 2ESCA 3VU2A 2V81A 1EDTA 2DJLA 4JQ2A 4FLSA 2XFRA 3H2AA 2Z7KA 5D38A 1LOQA 1E6SM 1Q63A 4S23A 5EPDA 2XN2A 1XBXA 3VVGA 2WLYA 4RW3A 1QRQA 3NPWA 4MPKA 1VEOA 1E4IA 4IF2A 2PTDA 2X40A 4UTTC 4YCOA 4DUWA 4A2RA 4N6EA 1CB2A 2R9RA 4K7YA 3M4HA 3R6IA 5CAKA 1M1BA 3GSMA 3LD5A 4W84A 4Q8TA 1I4NA 4Z2GA 3B8VA 4HPNA 4OKDA 2J78A 3AIBA 3NO1A 3S2NA 2IQ0A 4AF0B 1R7OA 2VR5A 3GYCA 5MHBA 1KBIA 4ADTA 3KTXA 5BOOA 3AHYA 1K70A 1VYSX 1HT6A 3RJYA 4KF1A 1JCTA 3HGSA 3K30A 2QDHA 4DO4A 2J8GA 4JTRA 3T6CA 1KCZA 2VRQA 1SO3A 4YVVA 4HU4A 4AVNA 4ZR8A 3GDKA 5K9DA 3S42A 1PYMA 2DZVA 2GJNA 4QTGA 2GQ9A 4DIAA 1WDSA 4GKTA 3SCTA 3B40A 1R8LA 2PBGA 3K4AA 1YTKA 4X0NA 1QO2A 1WX0A 5FF3A 3BW3A 3ZLHA 2XM1A 3SCPA 3GO2A 1GKRA 3NYDA 3UJEA 1F5ZA 1UA7A 4H19A 4KKXA 4MJZA 4O0QA 1BRLA 1KFEA 3AISA 4CN6A 3Q94A 1VFOA 1QWGA 3H4XA 1CXHA 5CKSA 2PD5A 3YPIA 4JL1A 1U30A 1B3VA 4UR9A 1AJ2A 4FPSA 1KFLA 1WXJA 1RQHA 2P5NA 3AJ7A 3DENA 3ARSA 5CG7A 2B31A 1K6AA 3RG6A 3UESA 3VUPA 2Y2WA 4PUKA 3N4AA 4L1WA 4DZ5A 1J0KA 2ZX7A 4UQEA 3WLIA 2ADAA 5EL1A 1PCWA 4Q32A 4C6OA 2Z6JA 5G2IA 1N8FA 4CD4A 3H55A 3TTOA 1DVJA 4NILA 4AIUA 3EB4A 1X6NA 1P0NA 3DFHA 1BXNA 1M53A 3RCYA 3G0SA 1Z69A 4C65A 3E0WA 1ZSXA 2ZX8A 2BNJA 1ZBVA 2AQWA 2NVCA 3L21A 2CZFA 3CEPA 1E5NA 2XVKA 3RRAA 3WQWA 2VEPA 1Z41A 1R3SA 4W5ZA 4AWUA 3BAIA 2BY1A 2YR1A 4OJYA 6XIAA 3WSUA 3W7EA 2R94A 2XPKA 4HOZA 1KC7A 2Y8KA 4GGHA 3TMQA 3M5XA 1EO7A 4X3ZA 1OCBA 3WDHA 2A85A 4ADSA 1NWUA 5F4XA 1GUVA 1OT2A 3USBA 4JS3A 4A3YA 3V3WA 2YXGA 3BLDA 3ZQ9A 1MSSA 5FSDC 2QCGA 3GU1A 1XYCA 1L2UA 3M0XA 2CKSA 1XYBA 3IUHA 1AFSA 1JPMA 3WQPA 3N9SA 3NVTA 5HUOA 5EMMA 2Y89A 4CNSA 4M6QA 2DZSA 4NJJA 2VFGA 3AO0A 4M56A 1EB3A 5FIPA 1RY0A 3LXBA 1IR2A 2OFJA 5F2LA 2OZ8A 2VFDA 4PMUA 1OIFA 3E38A 3CQIA 3EWUA 3UG5A 8CGTA 1LORA 3VIMA 5D2TA 1WNOA 1H62A 2OQLA 4TVCA 1VCGA 3VIFA 1QBBA 2O92A 2F6XA 1TPUA 3WNMA 4DUOA 3KRSA 4EPDC 2PWDA 2OODA 3M0IA 4N2YA 4QAWA 3T4WA 1EIXA 4B2DA 3VIKA 3OU8A 1UBSA 4BQ3A 1KCLA 1AVAA 3L5MA 3AHVA 1TR1A 2UZ9A 4J28A 1M7XA 3I65A 3TVAA 5TF0A 2X2GA 1S2TA 5J5DA 2VGFA 1A5SA 1CXEA 5TD4A 4O13A 3CZKA 4ROQA 3L65A 3N34A 4IJCA 3K13A 1XLEA 4CU6A 4GYJA 4AEFA 4JTLA 4L4OA 4JTAA 1YE4A 5F2GA 1TO3A 3V7PA 5CJNA 2PBOA 5IBXC 3MKVA 5A6AA 1X1ZA 3S6TA 2TRSA 4ZOEA 2J13A 1W5PA 3EGJA 4XWUA 3V5OA 1KRCC 1CECA 3DU0A 3RLGA 4KWVA 3OVGA 1CXIA 2YL5A 1AZ1A 3TFCA 2ZXDA 4AD4A 4KFNA 3MMTA 2D73A 1PWLA 4JTJA 1FDJA 4MADA 3W24A 1FCVA 1QOQA 2VXNA 5GVJA 1HKWA 4ZZ9A 1KGXA 4B9YA 4JTIA 6CGTA 2PRHA 1X96A 4BWLC 3NCOA 3O6AA 1QXLA 1EP1A 4DBUA 1JUEA 1UHVA 1BAGA 1PAMA 3W1AA 3WLMA 3NOYA 1THFD 4PMYA 4IL2A 3MMUA 1C8XA 3MWCA 4IGSA 5D8ZA 1S5WA 3ZFHA 4JQ1A 1VJSA 1W56A 3KW3A 2EAWA 3LRLA 1PZ0A 4F8XA 4HSOA 3BTNA 1RBLA 2ZUMA 3HGJA 1AA1B 4AISA 4BQ5A 1W3IA 3NXLA 5GNYA 1U5JA 3N3MA 3PULA 1YQ2A 3SECA 1S2CA 3CV7A 4DYJA 3M5YA 3JRKA 4AZIA 1YX1A 3M43A 2EPOA 2QJHA 1V3MA 4V15A 3WELA 5LGZA 4FXSA 4YTQA 4Q4SA 4MKSA 5EMKA 3W6LA 4MYAA 1C7SA 4AZ7A 1RVGA 4UFMA 2FVLA 2DSWA 3S2JA 1E56A 1Q8AA 1IEIA 3TA9A 3MHGA 3BO9A 3ITXA 4LALA 4UTTA 3H12A 3REQB 1VHNA 4IPIA 4UR8A 1DPMA 3P62A 5IM51 3PBUA 3P67A 1CXLA 4B5UA 1PYFA 5EMJA 1H3GA 4JY9A 1SZRA 6REQB 3ATZA 2BVDA 3DBNA 3IV3A 2BY3A 2J66A 4J9JA 3IIZA 3MU7A 3F5KA 4LY8A 1OABA 1CX9A 4NJKA 1HVXA 1JCNA 3QFWA 4MWAA 3JW7A 4F0RA 5AZ0A 3Q4DA 1AK5A 3IANA 4RXGA 2RDUA 1Q13A 2PLKA 1V5XA 3W3OA 2SFPA 4H8VA 1CW2A 5JBEA 3W02A 3VE7A 1EO5A 4PEEA 3W4RA 4DUVA 3NQDA 1SZGA 3EKGA 2E67A 3S46A 1V93A 4D1JA 3G8RA 4K8GA 2I1OA 1PTDA 2GL5A 3BCFA 3C3UA 4JOMA 1BWLA 4LGXA 4GLEA 4PB5A 1PJ9A 3OHIA 3BK0A 4DJFC 1F8IA 1VBRA 3P6LA 4IG2B 4JDBA 3KOXA 1QATA 2NVDA 3WFAA 3H7RA 1W1YA 4K37A 3W7LA 4MZ1A 1A0EA 2ZE0A 3W85A 3PUEA 3VGGA 1EDGA 3EWDA 4QRNA 5BNKA 2RUSA 2GWGA 5HQEA 3I3BA 1IXPA 5CC6A 3DEQA 1RHCA 4KRTA 4KESA 3VD5A 3CXOA 4N6FA 1D2KA 3PNUA 1TELA 4CNNA 4K2SA 5FF2A 3QN3A 3RO6A 1LQ2A 5GJPA 4Z2IA 1UOKA 3LHYA 1LWIA 3CV6A 2CBIA 4US5D 2BHYA 3TWAA 4M7TA 3NURA 4ORIA 1M01A 1MUMA 1GOOA 3WQ6A 1WZAA 2FZ9A 4I6KA 2C15A 2FDSA 3LX9A 3H53A 3L0KA 2ISSA 1V3KA 1JRCA 4XZBA 2ZXBA 1LL7A 3H2FA 1QCWA 3HG5A <