3LZ3A

Human aldose reductase mutant t113s complexed with idd388
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lz3A00
2BGSA 4G5DA 1YE6A 3CASA 5DANA 2HE8A 1GVEA 4NKCA 3FJNA 4XZHA 4WDUA 2PDIA 4PRRA 4I5XA 3G5EA 3BURA 3CAQA 2PDPA 1MI3A 5LIYX 1A80A 5LIKX 1VBJA 1S2CA 4IJRA 3M0IA 1T40A 2WZTA 4PRTA 3CMFA 3DOPA 4PUUA 2HDJA 2IPJA 2IKJA 1X98A 2FZBA 3R58A 2QXWA 3V0TA 2PDUA 3ONCA 3O3RA 4XVEA 1VP5A 2ALRA 1AH4A 2VDGA 3Q67A 2PDNA 4R9OA 2IQ0A 3UWEA 4IJCA 4EXAA 2PF8A 4QBXA 2CLPA 3O0KA 4LBSA 4XZNX 4ASTA 4GA8A 4QXIA 4GIEA 1X96A 5LIUX 4YVPA 4JTRA 1ZGDA 3LQLA 2DV0A 4XVDA 2AGTA 3R6IA 4XAPA 4H7CA 2NVCA 3BV7A 4WDXA 1YNQA 4JIIX 4HBKA 3LENA 1PWLA 2HEJA 2R24A 2FZ9A 3QKZA 1IEIA 3R7MA 3RX4A 3LZ5A 3WG6A 2HE5A 4Q3MA 1T41A 1YE4A 3V0SA 1RY8A 4YVXA 3ERPA 3WBWA 2PD9A 3NTYA 4Q7BA 4PMJA 3V35A 4YVVA 4IGSA 2F38A 1QWKA 3LN3A 3P2VA 4QX4A 3R8GA 3BUVA 3UZWA 4OTKA 2DUXA 3GHTA 4LAZA 1Z9AA 3UZZA 1FRBA 2HVNA 1LQAA 1YNPA 3BCJA 4XO6A 3GUGA 4EXBA 2PDJA 2IPWA 2HV5A 4DBWA 2IKIA 3LZ3A 4FA3A 1PWMA 2A79A 3R94A 4JQAA 5HNTA 5KETA 3R43A 4F40A 3MC5A 3T42A 3CAVA 4H8NA 1Q13A 1XJBA 2PDXA 3UYIA 1LWIA 3MB9A 1J96A 3UZYA 1S1RA 1S1PA 3UFYA 2BGQA 3V36A 2ACUA 3H7RA 2PDBA 2PZNA 3N2TA 4ICCX 2R9RA 3H7UA 4MHBA 2PDHA 4FALA 2IKHA 4PUWA 3KRBA 1IHIA 1RALA 3GHRA 5LIWX 3DN5A 4WDWA 1AZ1A 2FGBA 3LUTA 2ISFA 3F7JA 4GABA 3G1RA 2I17A 4GQ0A 1ADSA 2PDMA 4RPQA 3EB4A 4ZFCA 2FVLA 2IQDA 4QR6A 5HNUA 2ACQA 3LQGA 3C3UA 2BP1A 4WDTA 4JQ2A 2C91A 2ACRA 3M4HA 3B3DA 4LBRA 2IKGA 4JQ4A 1Q5MA 5AZ1A 1AH0A 1RY0A 3EB3A 2FZDA 3WBXA 1UR3M 3WBYA 2F2KA 1EF3A 1ZQ5A 2ACSA 2PD5A 3VXGA 2PEVA 1XF0A 4YU1A 5C7HA 1HQTA 1Z3NA 2IPFA 3FX4A 1AFSA 4LB4A 1ZUAX 4FZIA 3EAUA 4GQGA 2FZ8A 4GACA 3LD5A 1S2AA 2PDFA 4JIRA 3UZXA 3ONBA 2INZA 4XZLX 1Z89A 3UG8A 4JQ1A 4L1WA 3COTA 3N6QA 1PYFA 2IS7A 4LB3A 3V0UA 4XK2A 3D3FA 4JTCA 3U2CA 1XGDA 3CV6A 4JQ3A 2PDKA 4JTDA 2I16A 1MRQA 3CV7A 1C9WA 1K8CA 2DUZA 2J8TA 4GCAA 1US0A 3RX2A 3LEPA 4WRHA 4WGHA 4FAMA 2PFHA 3GHSA 1AZ2A 3GHUA 2PDWA 4DZ5A 5LIXX 2HVOA 4AUBA 4JTQA 1MZRA 4DBSA 1PZ1A 5JH1A 4WEVX 2PDCA 2PDLA 3Q65A 4DBUA 4L1XA 2IPGA 2PDYA 4XO7A 2PDGA 2NVDA 3UGRA 5HA7A 4JIHA 1EXBA 1JEZA 1HW6A 4JTAA 1PZ0A 3RX3A 5JH2A 3H4GA 3M64A 1X97A 3LBOA 1QRQA 2P5NA 1M9HA 4LAUA 3R8HA 1AH3A 2PDQA 1SM9A 5AZ0A 1EKOA 4YS1A 1R38A 3WCZA 2INEA 1OG6A 3LNMA 4HMNA 1EL3A 3S3GA 3UP8A 5M2FX 2WZMA 1Z8AA 1ZSXA 4XZIA 4XZMX 4PR4A
chains in the Genus database with same CATH superfamily
3HV9A 1PBGA 1S5NA 4PRWA 3WLJA 4R88A 1E4MM 1JQXA 2PMQA 1WPCA 1W1VA 3NOYA 1FH9A 3IUIA 3G5EA 4X61A 3PHAA 4LVFA 2TMDA 3M6DA 2E68A 4AXKA 3WH9A 1B4EA 3W1TA 4B5NA 2WZTA 3OOQA 4WQ6A 4U28A 3OVGA 2GDQA 1LLWA 4ZO6A 1X98A 2QUUA 1KV8A 4UCFA 5A6MA 2XIBA 3A64A 2P8CA 1FXQA 3K8LA 4PFHA 4AX6A 3UR8A 2VX7A 3GR7A 1DL3A 2NLYA 3TN5A 2XG9A 1QI5A 2WKLA 2EXOA 3B9DA 3WN6A 4N7QA 1TMQA 5HATA 2CLPA 5M3WA 3T8LA 2ZWYA 1W8GA 2YBTA 2WANA 3UVAA 1YX1A 4RE4A 4QROA 1FX6A 3L4WA 4RDWA 3DKLA 3FK4A 2P50A 2CC0A 1W3JA 1M6JA 5EFFA 4KF1A 3EMQA 2Z0IA 4H3DA 4EWND 4XV0A 4MWAA 1U1UA 2QCGA 4MOZA 1IF2A 3EX3A 4JXCA 4DJED 3LENA 5FJTA 5F1VA 2WCGA 3ZXWA 1EJVC 2NXHA 1PDZA 2PP3A 1TQJA 1M41A 1GORA 3FEQA 2VC6A 3UA3A 5HANA 2HE5A 4H8HA 3CAKA 3TMLA 4PZVA 1IZKA 3UD6A 2O9OA 2OX1A 4JTHA 5AN7A 4IG2B 2Z2AA 1I1XA 4YCOA 4YVXA 1NDYA 1H49A 4PMJA 4UTIA 3VFLA 3DFQA 3C0QA 3QPZA 3UG4A 3ITXA 5C55A 2Y5SA 1JCMP 1W1PA 4H41A 2ANUA 3AUJA 4NJGA 2YDSA 5TNVA 3UJ2A 4XD4A 1XYMA 2Z26A 4JHOA 3LZ3A 1G67A 3BAWA 1TWIA 3S5ZA 1XGEA 3L12A 1NVMA 3OLEA 1G7UA 1EA0A 4LVGA 2B31A 3PG8A 2P76A 2WHMA 4MB4A 1J96A 3SEPA 2E8ZA 2WWCA 3P93A 2UZ9A 1NARA 2DJLA 4RE0A 3V36A 3M0XA 2WBKA 1BWVA 2REQB 2CLLA 3EWDA 5EBUA 3I7RA 2BY3A 1Q6RA 4GYKA 4DYKA 2GUBA 5JBEA 3NQ8A 1RJRA 4ZXLA 2XVKA 3FA4A 3MUAA 3M07A 4JCLA 3T78A 4Z2GA 5A3HA 4WIWA 2BVWA 3PWIA 1YPIA 5JIWA 3TXVA 4F0RA 4N6EA 3VM7A 1IWPA 1FWNA 1XCFA 2I17A 4CN4A 3UPMA 2OZ0A 2E9LA 1CIUA 4QFUA 4GIAA 1W2VA 2JIEA 4UTTC 3ZLHA 2QCLA 1E70M 3AICA 3E0WA 1BG9A 1X38A 2WHKA 1XLHA 3WY1A 2ACRA 4I6VA 2FZNA 1ADDA 1ITUA 5GJNA 4ENLA 4DXKA 4OU1A 1OF6A 1Q8AA 1FDZA 2Y7EA 3SCVA 3KX6A 2VQUA 3WBEA 3WLSA 1DWFM 1QK0A 3NVDA 3P62A 1FCUA 1OT2A 2AL1A 1XL9A 2OT0A 2YYTA 2VDHA 2NSOA 3E9AA 3MI3A 3QPYA 4PMOA 1NP0A 4DAFA 1MWOA 1G6CA 5EY5A 4E4UA 3KP0A 2XIJA 1H5VA 3VX1A 2QGYA 1VC4A 3EWXA 4FNUA 3KDNA 3V0UA 4QRNA 4UQCA 2A6NA 4IOTA 5LA0A 2QCEA 1B90A 2CBJA 3WQ5A 3WLIA 2I16A 4AZBA 1TV4A 2Q8ZA 1VEMA 5T9BG 5BOEA 1B9ZA 3BH4A 2DUZA 4GZJA 2GJRA 1G4PA 1E9ZB 1EOKA 4CU7A 3E12A 3ECQA 2DDXA 4DWSD 4INFA 3E1F1 2CERA 3LLFA 2C79A 1RHCA 3NXLA 2CCRA 1UWUA 2E1DA 5MKGB 1IXOA 1N2VA 4ZE4A 3BWWA 2EG7A 3TTSA 1C8VA 3M5XA 4DLFA 2VO5A 2A21A 2QCHA 2WBGA 3C52A 1OCJA 4LVDA 1MFVA 4AU0A 2J7CA 4NIRA 1PKLA 1DWAM 4JIHA 1JEZA 3OQ8A 1SPQA 3EA1A 3VM5A 4AZHA 4HYRA 3PTDA 4KW2A 3CO8A 4FNPA 3RPMA 4JIPA 5LNUA 2X0SA 1WDSA 5G1YA 4C1NB 2W27A 5KEZA 1E1FA 3PJTA 1TA3B 4IIEA 1OFRA 1AW5A 3DX5A 1XUZA 3TYCA 2YCEA 3L68A 4B5WA 4UBPC 3CZEA 4O15A 3UCCA 4CQ8A 4EPDC 4EF8A 3H2CA 5GQBA 9CGTA 3VKJA 4PR4A 1NDZA 4NX0A 4FB7A 1MMFA 1V6YA 3MKKA 3P84A 1UBSA 1XIBA 1CXLA 4I5XA 4C1KA 3N2CA 1VLWA 3BURA 1L6FA 1AG1O 1REQB 1GOQA 4GYPA 3VPLA 3ZJ7A 4OV9A 4IJRA 2ALDA 1EHNA 3DYOA 4HJWA 1IEXA 4S39A 4AYSA 2J78A 3AYTA 1FKXA 2QUTA 4MJMA 1YHTA 1DPMA 1KXVA 2YA2A 5FJOA 2Y8VA 3OJGA 3GNPA 3R58A 1GTEA 1K8YA 1ECQA 4KEZA 2H8XA 2CW6A 1VP5A 5F7UA 1VQTA 1E6PA 5DQPA 4KWUA 4M6QA 1WE5A 3B05A 1ONWA 1V7AA 4IJCA 3USZA 4CUCA 4P7QA 1EJRC 5EB8A 5C9ZA 2Z29A 8A3HA 3IK4A 4O0QA 2J75A 4FNTA 3W00A 3PC0A 3WLKX 3VOIA 3BZJA 4CLMA 3SB0A 4MNKA 2W3ZA 1J0HA 3GNOA 2EG8A 1WOBA 2OYKA 3DHPA 4UFMA 1YNQA 4FXFA 1VFSA 3E0LA 3QKZA 1EEPA 5H8MA 5M5DA 1UD8A 1TR9A 2VR5A 1M3UA 1W9DM 4Q32A 4UR9A 4UOQA 2NUYA 4GQBA 4DF2A 1HGYA 3GIQA 1TYGA 3SN4A 3F4VA 3LSBA 3S5YA 1UQYA 4ZO7A 3GWQA 2IW0A 4TVUA 3BLIA 2V2DA 1C8QA 3RJYA 1F9CA 3VOCA 3WK0A 5TQLA 4ZQRA 3UW6A 1EOMA 1DIDA 2CESA 4IMEA 3DHDA 3DU0A 3HG3A 3PS7A 1PHWA 3AISA 3PUOA 5REQB 4L56A 2V3EA 3UQNA 4HNTA 1TWSA 3ARQA 1XRSA 2OQLA 5FF3A 3W7GA 3T42A 1PL9A 1Q13A 3BW4A 3OP2A 4YNGA 2PCQA 3LHTA 5JIPA 3SGGA 1PEZA 3I6TA 4W86A 5ABHA 4J5NA 1UB3A 1CLXA 3GH5A 4MNMA 4E2VA 1FWIC 1E0WA 4DUWA 1M7XA 1AMKA 3BVJA 3H7UA 2YIHA 1P4CA 3BARA 4NAFB 4HP5A 3LPOA 5LHEA 1OX4B 1W3TA 4KT2A 3G1XA 2OQHA 3TK7A 1WDPA 4EPEC 4ATWA 2W6RA 4MFDA 1JPHA 1X6UA 4MY8A 3QYSA 1OD0A 4FLSA 4ZQNA 2OQYA 4ATLA 2VC9A 1ZP4A 1XIFA 4RDVA 1Q66A 1EC9A 1RCXB 4W8AA 2EJ1A 4Y9MA 2HSAA 3NQBA 3O9NA 3DERA 3D0CA 4NASA 3W26A 1WV2A 3W37A 4ZOCA 2QJNA 4M3PA 3MS8A 4YXGA 4J3XA 2BX7A 5FCZA 5AYBA 3WBYA 2YFOA 4M1BA 1DIOA 4H01A 2PU1A 4BWLC 3RAOA 1YTKA 4LANA 1T99A 2VX6A 5TBOA 2GJLA 2IPFA 2ZUWA 2D0HA 1VEOA 1KLYA 5DXXA 3WQPA 1ELSA 5LGZA 5REQA 4TOQA 1E1CA 2I5IA 1QASA 3WJYA 1TPB1 2OKOA 2WMKA 3DKJA 4CGTA 4Y9OA 2Z1WA 3IVTA 5FL0A 5IHSA 5DFAA 3CQJA 4UIOA 1BF2A 3GU9A 1W3IA 4KEMA 3RCMA 4XZLX 2WQDA 4JQ1A 1T6MA 1F3TA 2NWSA 2YXXA 5D2VA 4R85A 4DNHA 4KRTA 1WOAA 3MUZ1 3S1UA 1ICSA 1VHNA 1QVBA 1HKMA 3R1ZA 2J6VA 2DT3A 3OHMB 3T4WA 3TONA 1OEPA 4AIEA 3I3BA 4IGMA 2X1RA 1FWTA 3CV2A 3AMGA 2H9AB 3RX2A 2QUVA 3RRXA 1MUWA 3FVMA 1M7OA 3WMLA 1VYRA 3CQHA 5J5RA 3S5NA 3AIEA 4TVCA 5C7VA 1SO4A 2QEZA 2TSYA 4MZ1A 4DWSB 4H8VA 3M0JA 4A3YA 5D09A 2PDYA 2YB1A 2VC5A 4XO7A 4C6IA 3CO4A 3E74A 2XN2A 3PN8A 1O5RA 1QI3A 4OUEA 4Z42C 1SR9A 5T8GA 3ZR5A 4JFSA 1OC6A 2V30A 4LCQA 3UWWA 2A7RA 4CNPA 3BCFA 4WLCA 3ABXA 1B30A 4O0KA 3P82A 2XJ7A 3N29A 2V5LA 1TVNA 2OOFA 4EWJA 3QOKA 1HF6A 1W3KA 5D9PA 3E38A 1CECA 1XLKA 3B06A 2VX5A 4PB4A 2HK1A 4A05A 1S3HA 3F4DA 4US5A 5MHBA 4C6CA 1B54A 3KRUA 3L4YA 1GVEA 1FWBC 1V3IA 4PRRA 4LFYA 1GYLA 2WPGA 1EQCA 4D8AA 1V3HA 5DT5A 2PDPA 2D73A 1RA0A 3AYSA 4AAJA 4D6FA 3W7LA 1M03A 3STEA 3EOEA 2OYLA 2Y2WA 4HNUA 1V93A 3R0DA 2DW7A 1UKTA 2IPJA 1V3LA 3EX4A 4KFPA 2YA1A 1EDQA 5EU9A 3KUMA 4DAIA 7TAAA 2H9AA 4H19A 5DLCA 3GC2A 4FX7A 1QDSA 2YSWA 1V0LA 3CYJA 1AMYA 1XIIA 1FP8A 4O52A 1KCKA 3ABOA 3NNTA 5CZ0A 3UPWA 3LGEA 3ABSA 1NY1A 5M17A 1SO6A 3H2OA 2OG9A 4DO4A 3EEGA 3WQDA 2J8FA 2BS9A 3LI0A 5CPNA 3U8GA 1E15A 3GW0A 4WR3A 3QTPA 1XD1A 1FH8A 5A6LA 3BAJA 3PB2A 5AYXA 2GVEA 3WNLA 4Q8NA 3K46A 3FDKA 1HVQA 1BGGA 1WDWA 1UW9A 1R85A 1YXCA 3CK5A 5CLWA 1C90A 1I4NA 1K77A 1KBBA 1XSKA 3L65A 1CENA 4XB3A 1FWFC 2R24A 3BMXA 2Z1KA 4NZ4A 3AMLA 1EPVA 3WLOA 2HISA 4Z1BA 2DY3A 4XWUA 5EGRA 4CQBA 2Q3OA 3HPAA 1MQPA 5I5RA 2DZWA 1W37A 5AYIA 2DZUA 1LJYA 4P5UA 4NY2A 3V0SA 1SO5A 4Q8VA 3L4XA 1U33A 3T40A 4CD8A 4Q7BA 2H90A 3I7SA 3LHVA 3WUEA 5J04A 3VDBA 3GDRA 2TODA 3POHA 4HCDA 3UJSA 4LC8A 2ZX5A 1ISWA 1W5QA 1EEXA 2W4XA 4OHQA 5B7ZA 4IP4A 2OXNA 1YTEA 3NPUA 1UR8A 2ZRWA 2VWTA 2AL2A 2BTMA 3B8UA 3LYEA 3BCJA 3SW6A 4DBWA 3EOLA 2J7FA 1G0CA 2A79A 1EZWA 1GYMA 2WJDA 3EXTA 1BYAA 1OYAA 5CPTA 2V5KA 2ZOXA 4IIFA 5HNRA 1KFWA 5HNNA 2RKXA 1EDGA 2A3EA 2DSVA 4QE4A 3ZMRA 1ZCOA 2VURA 3N2XA 1H63A 3H7RA 3G77A 2DVUA 4LUSB 1JYNA 3QBUA 3KVMA 2F6KA 4JTEA 1R7AA 2WSYA 2P53A 4FALA 4JHZA 1TE6A 3HGSA 4GWEA 2F2HA 3IJIA 3DN5A 2QCNA 5CKSA 2I14A 1KA9F 1WUEA 5C9XA 2JEQA 1EIXA 4GJIA 3MJMA 2B7PA 4GQ0A 1K4HA 2FDSA 2PPGA 3CPUA 4XTDA 4EX4A 3VOJA 5I6SA 3LQGA 1TQXA 1OC7A 2VGBA 1PB0A 3UVIA 1B57A 4GJJA 3ZLGA 3SI9A 1O68A 3KS6A 2C1GA 4QG9A 4V1XA 5HK4A 4DYEA 2DORA 4X22A 3LCFA 3W76A 1A5NC 3HOJA 5D03A 3G0UA 2CZEA 3DFYA 4GIYA 4IL0A 2PWVA 3OHIA 1A53A 2CLIA 4YJ5A 3KTSA 4MF4A 2PD5A 2PEVA 5I0DA 1F3XA 5EMKA 4IPJA 3BG5A 1SO3A 3EB2A 3W85A 3N13A 4O11A 3MWCA 4PSRA 3ZT7A 3I6EA 2E6DA 1GW1A 1HJVA 5KZMA 4AHQA 4GYJA 3TC7A 4R34A 3UWUA 3OLDA 1HJSA 3INPA 3WLQA 4TMBA 2VR2A 2VCBA 4IMAA 3VKDA 2GVGA 1TRIA 3TJIA 3OVPA 4GACA 3W73A 4WK9A 2XDFA 1OFDA 4MNJA 4MDOA 4IF2A 2NX3A 4OVXA 1UBPC 2Q3RA 1LOLA 2V67A 3N6QA 1K03A 1XLGA 2PP1A 3V18A 1KKOA 1YKWA 1BSIA 5I3JA 1Q2SA 3I4KA 1JFHA 5K7JA 5ECVA 3W7MA 3A24A 3U3HA 5CBBA 3Q2DA 4E5TA 3VUPA 2OLSA 3GUWA 1I75A 3GKFA 3ZWTA 3AXHA 1YIXA 2XSAA 2V8ZA 3R4IA 3UT0A 3UJEA 2OEJA 4GPNA 1XLFA 1BGAA 2I5QA 5AC4A 1SYTA 4J3TA 3DG3A 4GX9A 2V69A 1LLOA 3NWRA 2PE4A 4F9JA 4DJDC 2PDCA 4OFCA 2UBPC 4UNKA 3WFAA 5HA7A 4N2YA 4Y8EA 3UY8A 5K9XA 2YJQA 1UMYA 1FUYA 3PY2A 1XCWA 3NUKA 4RE3A 3RLUA 2DSZA 3URQA 5I03A 2HCVA 3CHCA 1TVPA 3MSDA 3OBEA 4K1WA 5TD4A 3N9KA 5I3KA 2EPOA 1XIJA 2XH7A 4LOCA 4PMVA 4HMNA 5I09A 5EPDA 3QV8A 4GKTA 3TXZA 3HM7A 1ZJIA 2G3MA 2DIKA 3GXIA 1OINA 3QGAC 3TLLA 3WLLA 4QDWA 3N4FA 3S9IA 3KL0A 2CETA 3OQEA 3QSTA 4MGGA 3NPXA 2E1WA 4IMCA 4QISA 1YE6A 3SN1A 4CKQA 1FHLA 3AJ7A 3PBVA 1XDJA 5CSYA 4KIEA 4XZHA 2FB2A 2PDIA 4GG9A 3Q45A 3D46A 1KFBA 3QJAA 4DJFC 3SCTA 4C6OA 1IGSA 4O1CA 3UA4A 2D3NA 4PMUA 3QMTA 3TN3A 3GXDA 4HNNA 3WL0A 2Y8KA 2V0TA 2E67A 1T40A 1XLBA 2ZUSA 4GINA 1ISZA 4C7FA 3UZJA 1IWAA 3CMFA 3T0DA 4PUUA 4UFKA 3PFMA 1OF8A 3WYZA 1UP3A 2J7EA 5I79A 5XINA 3KWXA 3ITLA 4DHGA 1UKSA 4RKAA 3W86A 3W2LA 4E4PA 3EX2A 4CNSA 3IVUA 3KTXA 4YHEA 4E8DA 2DZXA 3WD1A 3NEVA 2B4GA 3PSVA 3WUFA 3W7HA 4F2BA 2WHLA 2WM1A 4P7LA 5A6BA 5FIPA 5IFTA 3SFKA 3W7DA 5LIUX 3OGSA 1VH7A 1B0IA 4YTTA 3GG0A 3E6EA 3PBMA 3EPMA 1XQLA 3ARTA 4E38A 1A3HA 2FTWA 3DFHA 1FCBA 4AHPA 2Z7GA 3THUA 4TUFA 3WLNA 2YX0A 3BV7A 3M0LA 3P74A 3VFCA 3FXYA 1W9PA 1EIBA 3BGAA 4K3ZA 1E72M 1LYXA 4OOUA 3RX4A 1WXJA 5D9MA 3CH0A 1IZJA 3LV6A 5T26A 4L4MA 2D24A 3A22A 4J40A 4O1DA 2JF6A 1YE4A 3LPFA 1PV8A 3IIOA 1AVAA 3LOTA 1E4LA 4G6CA 1CGYA 2BGNE 3WELA 1QNVA 1JI1A 5CZTA 4AZCB 4CD4A 3AXKA 2E7FA 5MF5A 4MUPA 4A6GA 3VO0A 2CBVA 4QLKA 1X1OA 3SQLA 5FSDC 1KM4A 3UZZA 1FRBA 2RDWA 1L6GA 1CX9A 1FY6A 1KM5A 5KETA 3GDKA 2EJAA 4V15A 3T2PA 2QS8A 3TTOA 3NQFA 1N55A 4CEUC 5H8PA 1PIIA 1SVDA 1YADA 4MZYA 2HNEA 1NWTA 1KD0A 4GK8A 5A2BA 1A4LA 2PDBA 1E6XM 2R9RA 3UXAA 2GVLA 3HG5A 5GVJA 5C2CA 4DZAA 4LPCA 1EF2A 1POJA 1L6WA 3QSRA 1JUEA 4B3ZA 3SJ3A 4IMFA 3LG3A 1TO3A 2VZSA 3HPFA 2GWNA 1AD4A 1G1YA 2QVNA 4E8CA 4FS9A 3NXFA 1UC4A 5JMUA 4UQ9A 3QFWA 1Q6GA 5FD0A 4IT1A 1ZAHA 3IJ9A 1XUUA 3IACA 5FEZA 2J74A 3QQ1A 4KETA 4A8IA 2ZC8A 1I45A 1FFRA 4FXSA 4B91A 1QOPA 1VCFA 4DRSA 3AZSA 1AL7A 2AQVA 4GBDA 2X7VA 3CZKA 5CC3A 2DU2A 1VR6A 2Y7DA 4C5YA 4C6KA 1UWSA 2D3LA 4G56A 1V0KA 1EF3A 4UTLA 2A85A 3UG3A 4DNMA 4RCXA 4IX0A 3VI2A 2GLKA 1LOSA 1OB0A 4PCNA 4Z2LA 5ABGA 1GONA 3BQ5A 1GQNA 3NZPA 1DJGA 2Z2BA 4F4RA 4NUWA 3UY7A 1WYIA 4HNCA 2OWCA 1PS9A 4RZ4A 4LB4A 4GE8A 3G1FA 4FP1A 3WJXA 1GNXA 4LNCA 4L64A 3NURA 1VBHA 2G97A 3LS9A 5E0CA 1XYCA 3F4WA 4I6KA 4MM1A 2V3GA 4DO7A 4K8GA 2YBUA 2XVGA 1T96A 3ARUA 4MWAC 5HMDA 5CG7A 1TKKA 3WD4A 2G5WA 2ZRYA 1UR4A 4S3CA 2XIIA 4JY8A 3MO4A 1KRAC 4ILSA 3GRIA 4WF7A 3I4EA 4O1FA 4CN6A 1VPQA 2ESCA 4HKPA 1HXJA 2WCSA 1JRBA 4YTUA 3ZJ8A 1Z41A 3E0FA 1RBLA 2NQ5A 1XR2A 3NA8A 1PX8A 4IIHA 2QCDB 1RA5A 2ZUNA 3BLKA 1QPKA 3WNOA 3SBFA 2GSJA 5FA5A 3SAZA 3MVTA 4EAYA 3SUUA 1F5ZA 3GNRA 3K5XA 3PF3A 2DZBA 5BYWA 4D8LA 3GAYA 1LORA 1Z42A 3TSBA 1Z32X 3BOFA 2PDGA 3ITYA 4GVGA 5GJMA 4JN6A 2CHRA 1EXBA 2PBOA 5C54A 3WKZA 4YYFA 4ZQOA 3V5FA 3NL5A 4E3TA 4RV8A 4I5UA 3ARPA 4IH3A 1AH3A 5A94A 4M1RA 2PDQA 1SM9A 3EYPA 3IIPA 2WSPA 4XISA 3JZUA 7REQB 1WKDA 3TQKA 4TO8A 3VGFA 3U57A 2C7FA 2C15A 3BGGA 1O5QA 3G1AA 1OK4A 2ZYFA 3CHDA 3CIWA 1ZAIA 3S3GA 3C2YA 3I7QA 3S2LA 4W89A 1J6PA 4J2MA 5G1TA 4JX5A 1HJWA 3NPWA 4AD4A 4EF9A 1S46A 5HDRA 3TZNA 1O66A 4NF7A 2XSBA 3LBMA 1M5WA 1GQIA 2KZHA 4IL2A 1R2RA 3CTLA 4NKCA 5HMSA 2NUXA 3GIYA 1O7AA 2GUYA 2C3ZA 5EYWA 2G37A 4QDPA 5AC5A 3A6OA 1KCLA 1MI3A 1LRNA 5LGXA 3CHEA 3S6OA 4LRTA 3ABRA 4HD5A 3R0KA 4XZWA 2WMJA 3EEZA 1FHUA 1XRTA 4M7TA 2FZBA 4PB5A 3IGUA 1JZ2A 2QPXA 3HPXA 1E0VA 4ZO8A 1Q63A 2QCDA 3B40A 3EA3A 2ZUVA 2HVMA 1X39A 2NT1A 4DEFA 1WXZA 2V68A 1GTHA 1TTPA 2Y24A 1F3EA 5HWNA 3ARSA 5AC6A 4J3ZA 3GNXA 3VNYA 2QDDA 5E09A 4I5RA 5LXXA 1M7PA 2DZSA 3PM6A 1EP1A 2VRKA 2WQPA 4A8RA 1FH7A 3W7CA 5CSSA 1MSSA 3EMCA 2V6AA 3R6IA 2PC8A 3CUHA 1VPXA 1VZWA 3PANA 1W1IE 1ZB5A 3BLDA 1A5CA 1Y8BA 4QLLA 3N2MA 3TR9A 1IEIA 3QVQA 3RG6A 2Q09A 3WDJA 4GO8A 3R0UA 3UBPC 1FP9A 3IEBA 2LLEA 2YXOA 1XIDA 3LCWA 1LRTA 3MV01 1P7TB 1P5BA 3ERPA 5C2XA 2EO7A 3UWQA 1RPXA 3LM7A 4AH7A 4P7NA 1QWKA 1ZP3A 2YYUA 1Q45A 3BUVA 3JR2A 3HQ1A 4N4PA 2WC7A 5DBTA 4PTDA 2A3HA 3CZLA 4B9YA 2EPLX 2ZIDA 4AD5A 1YBQB 1Z9AA 3N15A 3FV9A 1AQHA 3ABZA 1A3XA 2WNWA 1E3ZA 1UP2A 2PWDA 4C90A 1A5MC 2QJJA 1KFLA 3PSWA 4C6BA 3R43A 2ZA2A 3ALGA 4AFYA 3FJLA 2WJFA 1JIBA 2NQLA 3NO3A 1LT8A 2PAJA 2ISDA 4CU6A 1S1RA 2YLAA 3EKGA 1PJ9A 3H2MA 4I90A 3S6DA 1K9DA 4FNRA 3LXCA 4L9ZA 4AD3A 3GG8A 3IIVA 1BLIA 2OT1A 1LOQA 3E96A 2PA6A 4DYJA 1MEIA 1C8XA 2FVMA 5CZKA 3U7VA 1FWAC 3K13A 4PMNA 4QAIA 3KRBA 2WNNA 3QGVA 3WNMA 3CUJA 3FJ4A 3PTMA 4WDWA 3PZMA 2NZLA 1E40A 3KBJA 3H12A 1UR9A 4A29A 1ISYA 3N04A 5LZLA 1F4AA 2JK2A 3MBFA 3M0YA 4IGNA 4WSJA 1UD2A 3ELFA 4IPIA 1CPUA 3VDHA 1GOOA 1PE1A 1UH4A 4FLOA 5BRPA 4IQJA 5J8LA 1QUMA 2DUAA 5C9UA 4Z0JA 4B5VA 1D3CA 2Z6JA 1I2NA 4QAWA 4MJ4A 3K4WA 4LY4A 5ABFA 4JQ4A 2ASHA 5BOOA 1E51A 4L4PA 4D6DA 1TREA 2FIQA 3EB3A 1TWZA 2XTKA 2ACSA 1J0KA 3PUEA 2Q8LA 3SR7A 4FIRA 1TJ2A 4PTMA 4ZO9A 1J12A 1BD0A 4RNFA 4NJIA 5RUBA 4HU0A 4R7WA 2OLAA 5SWUA 4DJDD 1J01A 1ZUAX 1Z48A 3MKVA 1LT7A 4HHHA 4XAYA 2G8ZA 2QUNA 4GY1A 4C6DA 3URAA 5AHEA 4L1WA 3ICJA 3DG6A 4IP7A 2FFCA 5FOOA 1PYFA 2PRHA 2IS7A 2YOCA 2VFEA 4XK2A 5LKYA 3ARYA 3TDFA 5D2YA 3D3FA 5KZEA 2VNCA 1XGDA 4MPQA 3UESA 4JTDA 1E0TA 3W9ZA 3VNLA 4LS2A 6ENLA 1M1BA 1F8MA 3AC0A 1GYNA 3F2CA 3BTNA 4LEFA 2FH6A 5F2GA 3LEPA 4Q8WA 4L6OA 3WMSA 2EKGA 2XVLA 3H70A 4JTTA 2ABAA 1J6OA 1ONEA 4J4KA 2GL5A 4LRSA 3H54A 4IISA 5A2CA 4DJFD 4TVDA 3CM4A 1MZRA 3AHXA 3KWSA 2Y70A 2OODA 1UD3A 1JZ7A 1W5NA 2X16A 3EPOA 4PYSA 1TV8A 1SFTA 4GXPA 1KKRA 2PWEA 4GZEA 3WD3A 1OGSA 3SSJA 4FEZA 3T0BA 1XQKA 8TIMA 1RCOB 5IXEA 4AF0B 1LBMA 3IJ6A 2ZUMA 1KNWA 3GDLA 4LH8A 3UYCA 3RU8X 3LV5A 3HURA 5CC5A 1BEUA 1JF5A 4UWMA 1EDTA 2VGFA 1SW0A 1VIWA 3F4CA 5HQMA 3GTIA 3VD4A 4O18A 4ML9A 3NGJA 1XPYA 4TMCA 4DELA 1J10A 1KR1A 1ZSXA 4J28A 3UGVA 4B5UA 2XVNA 3W87A 1GKPA 3W28A 3W1UA 4OBTA 5DF0A 4ATDA 4PH6A 3KVLA 3W23A 2OZ8A 1YYAA 3FOKA 3LHUA 1DWHM 4ZENA 4JX6A 3CHVA 5HR6A 5LIYX 1XW8A 1AUSL 3IV8A 1KGXA 2Z1SA 1FDYA 3B8IA 1CW2A 3C2OA 3GU2A 1TMHA 2ZCGA 4PODA 2C16A 3VMOA 7CGTA 1HL2A 1DJZA 4HPNA 1PCKA 4DM1A 1E6SM 4TV5A 4LX4A 1V3KA 4NZFA 1HT6A 3ITOA 3DECA 2W79A 1AH4A 5BWAA 3GD6A 3NZGA 2Y4SA 3ANYA 3AIRA 3TEVA 4W5ZA 3EPNA 3M5VA 1HG3A 3EOSA 1R0MA 1UWAA 4PEEA 2FJKA 3T4CA 3IRDA 2D2JA 3Q37A 2OZTA 3QR0A 4LBSA 4NXKA 3CIXA 4GIEA 1M68A 1I2RA 2R91A 3RUBL 1EJXC 1XDMA 2GQ9A 3CB8A 4UQDA 4MYXA 5EMUA 4JTRA 3OO2A 1W2PA 4HNLA 1SSDA 3NO1A 3UWZA 1X8CA 3FA5A 4DF0A 3W6LA 4W84A 3RIKA 5I02A 1J0JA 3W81A 3RGTA 3M1ZA 4AIBA 1D8WA 2ZDSA 4OECA 4DB7A 1XLEA 3MP3A 3HGJA 2WVUA 4O12A 4JFVA 4Z2JA 3AFBA 3SUTA 2BB0A 4G2DA 4A3UA 1NQ6A 1Q6QA 4JCMA 2C19A 4GD0A 2WMHA 4TQTA 1PAMA 3PPHA 4L9YA 4FNQA 1JD9A 2A2IA 2HNHA 3WBWA 4YWIA 4BI7A 1FOBA 4WVXA 1QI4A 1FTXA 1A0CA 4NZ3A 3RNDA 3O6YX 1UROA 3KOZA 3BOXA 3B0VC 3S6TA 4S3AA 3AYRA 1KBJA 4JKMA 5E9AA 2WMIA 5E9XA 3KHDA 3I3DA 3MZ2A 3GC4A 2FHBA 2OYMA 1HJXA 3OVQA 2J27A 4MTVA 4EPBC 3UYIA 4Y2WA 1H7OA 2D1ZA 3EBVA 3GVRA 4JTJA 3B97A 1LWJA 1W91A 1ZS2A 4HQVA 1O5KA 3NZ1A 4EPKA 5IBXC 4OJYA 4OE7A 1F6KA 3S8HA 1IIGA 5AC8A 3LHZA 4QEEA 2O92A 3E5PA 1QNRA 3LMYA 3T81A 3TC6A 3APGA 4PUWA 4Z08A 1RALA 3A47A 2GQAA 3SCPA 2C0AA 2J25A 4EXQA 2FGBA 3W7KA 5C5YA 4OT7A 3QC0A 1ITQA 4AD0A 3LBCA 1WDDA 3S1WA 1E73M 1X1ZA 4H83A 4DI9A 4ERIA 3TH6A 1YDOA 1WXYA 1XG4A 1UYQA 3RMJA 1RV8A 3AJXA 1EC8A 4MWAD 1EP2A 1PVNA 4AEFA 3NAVA 4O19A 4JQ2A 3RPDA 2J9XA 3QC3A 8CGTA 1S2WA 1HP5A 2BHZA 3UZ5A 1NTHA 3AWOA 1Q7QA 4NG3A 2YXGA 2F7FA 3G24A 3OZPA 3PVFA 1OZQA 3E2VA 3QQWA 3K30A 2DJXA 3PUDA 3FFSA 2V81A 1S5VA 1OX6A 3SUWA 2GYIA 4S3BA 1KW1A 2WNQA 1JYXA 1H7NA 3S1VA 2DT2A 2Z27A 3NSNA 1YLVA 3OBKA 4YTRA 3LXBA 5HUPA 2F6UA 1OK6A 4X0VA 3OG2A 1DYSA 1IR2A 3ZT5A 1L9WA 2QAFA 4BKNA 4R7JA 5FACA 3EDEA 1GG0A 3P0WA 3W74A 4DVOA 4HSNA 4BQ2A 4U3AA 3H4XA 1LBFA 3EWCA 2TYSA 3UU0A 5A6JA 1LDCA 5DELA 2PSNA 4AWTA 3NGFA 3TQVA 3ARZA 4UNLA 3TR2A 4QE5A 3BAXA 4KWWA 1EJUC 4NI8A 3VIFA 3HJEA 3REQA 2YR1A 2VRQA 3F4NA 3FCPA 4JX4A 1PTAA 1ODUA 1P0KA 3TLQA 5LNRA 8RUCA 2ZVRA 1AW2A 1FWJC 1JCTA 4HHPA 1BWKA 2QIIA 4WGHA 3B8TA 2C18A 1R9ZA 2OFJA 2OGJA 4GO9A 5D37A 4G7EB 1DTUA 1EP3A 2I57A 1WZAA 3I65A 2ATMA 2R14A 5I3IA 4FMVA 2YCIX 3W38A 1DWIM 1IWBA 4LCSA 4G1NA 1GOKA 2BHYA 2VI0A 3XINA 3NSXA 2VCCA 3LPPA 3W7PA 3TQPA 4LAUA 3CU2A 3RCNA 1QPNA 1V6TA 2VXNA 2O9PA 4BF7A 1G9HA 3AALA 2V2CA 4ADSA 5CEWA 4Y90A 1KLZA 3W84A 3HFYA 5HJLA 4Y6GA 3CQKA 1MUCA 2AMGA 1ME8A 4DN1A 3KOFA 3SCUA 3R25A 2POZA 1TPVA 4LF1A 3TAOA 2E5DA 1P0BA 1CB2A 2H3DA 2X0YA 2CFFA 3MDWA 5E6ZA 2OEKA 3K4DA 4B5XA 4CQ9A 1IQ8A 3NQCA 2WHJA 3QM3A 1Q2RA 5DANA 5I77A 3WLMA 1EX1A 4WDUA 1GEQA 4H8UA 3O6AA 5ABEA 5BXTA 1PZ2A 1E6NA 3KXQA 1V77A 4XSMA 3HTWA 3AXMA 3ANUA 5H8UA 1D7FA 1Q6DA 2YA0A 4BQ4A 2OELA 2YKKA 3ZSTA 1H61A 3LK6A 4S3EA 3N6JA 1EBGA 4OV4A 3AUOA 3QOMA 1J4EA 4KKXA 3STGA 4CCDA 1B3OA 2E3ZA 4PUEA 4LVAA 4DQWA 1RJQA 3H26A 4PC8A 3SQSA 4G7FA 4WOZA 4XVEA 3WH7A 2EF9A 4Y96A 2C6QA 4K8HA 3WQCA 3S42A 1R6WA 1XCXA 1JVNA 3Q67A 4XD5A 3FVDA 1IXPA 3W2UA 2EPNA 4LAMA 3H2FA 1OM0A 4HK5A 2GJXA 1Q85A 3TMQA 4GA8A 1GJUA 2FMNA 4F9DA 3KVKA 1IXQA 3DIPA 1JXKA 5HQEA 4YVPA 2HRWA 2Q6ZA 3UEQA 3WD2A 1S5MA 2OLHA 2F8QA 3WEZA 1ZY9A 1QBAA 4QJ5B 5CBJA 3LTPA 3N11A 2XU2A 3PB0A 4LVBA 4KEVA 5A2AA 2GOUA 3N1AA 4J3VA 3VD3A 4WDXA 2QT3A 4LUTB 4JIIX 4HBKA 2F84A 3E49A 5CC7A 1XHGA 4QNWA 1VYSX 4M82A 3KEHA 3IARA 5HWMA 3G1VA 1OFOA 2Y8UA 3SY1A 3ZVIA 1SGJA 2WB5A 4LTSA 3CUIA 3V1HA 4M80A 3EMZA 1VRXA 1HKWA 1YPXA 4MUZA 5FF2A 1RY8A 1C91A 3QHMA 3IJLA 3OW1A 2E6FA 4S3GA 3VGGA 1GZJA 2Q8XA 3WEMA 1PXGA 4JD4A 3S9ZA 3QH2A 3POCA 2ZC1A 2RDUA 5T9CE 3BV4A 3NCOA 4F0KA 1QBBA 2A3AA 2QHAA 4OTKA 2W67A 2DUXA 4REQB 2X1IA 4JR5A 1J11A 3QYQA 2VZVA 3GVGA 1S38A 1Y7VA 2XM2A 2IPWA 4QG6A 3ME3A 1HJUA 1I1WA 2ZTJA 4RR4A 1JCYA 4MY1A 3VILA 5A8NA 4JTUA 3UJFA 1TPH1 1KRMA 1C9DA 4N6FA 3G0SA 4W5UA 4DIAA 1JCLA 1DQWA 3UFYA 2ABBA 4QITA 1JG9A 2CPUA 3DG7A 3HV8A 2PGEA 3TYEA 3TWAA 3MMDA 2ZUTA 4AIOA 4JBRA 2YDRA 5DRCA 2RAGA 1XIMA 2G3IA 3SDOA 1W9BM 1SJBA 4PULA 4GNJA 5LIWX 4HCHA 3DCPA 4GX8A 3HQOA 3DEQA 4GFSA 1QPRA 4RLIA 3ZFHA 2W9MA 4DBDA 3BJFA 4AMCA 1VBRA 2FVKA 2JKPA 2PS2A 3CMGA 4ROPA 4U5KA 1E9LA 1ICPA 5I00A 3P8IA 1IZCA 3T0CA 4TXEA 1LUCA 3STPA 3U6WA 5CBIA 3EX6A 4LBRA 4PMDA 4JHMA 4MWAB 4BI6A 1NDVA 3G3MA 3R2GA 3S4TA 1KWKA 2PTYA 2VGGA 2Y62A 1GVYA 2WZIA 2PLMA 3H6OA 4I9JA 5C7HA 1AQMA 5C70A 4JICA 1OG0A 4A8LA 4YN5A 4U5IA 1ZHAA 3WUGA 3B0YA 1FWHC 3ATZA 4K2SA 3LCLA 3MANA 1XLIA 4REQA 4FSAA 5DCBA 1I8JA 3IAPA 3TCSA 4FZIA 1XIEA 3KE0A 2B7QA 2IMRA 3LD5A 3WL1A 3BANA 3M46A 4RXGA 1K9EA 4JNZA 4ORIA 4RXFA 1MW3A 3W3OA 3WX7A 4HPXA 3N18A 3DFTA 3MP4A 3NDYA 1BXCA 1QO5A 1JDFA 1IE7C 1VFFA 4AZ5A 4D1IA 1Q6FA 3MHFA 1UUQA 1E9IA 2JQXA 3P8JA 2VEFA 3GTHA 4AWEA 1DQUA 1O60A 4X60A 6XIMA 1JF6A 2PTWA 1R3WA 1H7XA 2OGYA 1NEYA 4PCSA 4ALDA 1LCOA 2R8WA 1HIZA 3W6MA 1F7BA 2R94A 2V5DA 1TPC1 4ZOAA 2PF0A 5A6KA 2EG6A 5A5WA 3WD0A 3GHSA 3M0MA 1S3TC 3N17A 1UR2A 1CGXA 5GPRA 3KL3A 2CEQA 1BKHA 2WLZA 3LCXA 1GQKA 3Q65A 5I06A 4P8UA 3IJDA 3P5YA 1EWDA 5HPCA 2CLMA 1LBLA 4CVWA 1LP6A 1CGUA 4UXDA 3OZMA 3ZR6A 2WVVA 4ADTA 1DORA 2RDTA 2Z7KA 5BNKA 3DFNA 1GPFA 1XKJA 2JGQA 1TWWA 5E6YA 1OIFA 4Q4KA 3C2FA 4J9JA 2CYGA 2QPUA 5K9DA 3OVRA 3M44A 4HZ8A 5I78A 4XBKA 4XZBA 1GWJA 1K8ZA 2AKZA 4LWWA 1HKJA 3WJWA 2P0IA 1EQPA 2PCEA 3PBGA 5IM51 1NQKA 1J79A 3I6RA 2BGSA 4KH2A 3VIPA 9XIAA 1R30A 2VZOA 2HE8A 1E5NA 4IX2A 2FPYA 1D9EA 1FCQA 3HMJG 1BXNA 1DOSA 3VIOA 3N4AA 3W7OA 1QO2A 4GGHA 3S5OA 3E0VA 4M6PA 3ITCA 1VBJA 4IXHA 4AYGA 3OYXA 2D0FA 1KRBC 4ONVA 5AKQA 1A5AA 2HDJA 3VMPA 1CYGA 3CBWA 1UKQA 2Y88A 3N25A 3UWYA 3W6YA 3CLWA 3ONCA 3HN3A 3VGHA 4AD2A 3G0XA 4F48A 1UPMB 4P7OA 2VL4A 4I9AA 3QY7A 3WMCA 1A50A 3FDGA 5AHLA 1VFTA 2OU4A 1AQFA 1MNSA 3GLCA 1RBAA 4E0CA 1HFBA 1SJDA 1XRFA 4M0XA 1AQ0A 1WBHA 4IZGA 4E4FA 1EGMA 4HYWA 1QI2A 4FXJA 2ZICA 4PL2A 4K7VA 3WO8A 3W25A 4NAEB 4FOKA 1K6WA 1VFLA 1A5LC 4NT0A 4UFHA 5CQ1A 4DUVA 1H2JA 4H9ZA 2QPSA 1G7VA 3H23A 3QN3A 3BL3A 1IXNA 4C6PA 3UERA 1PKNA 1QHPA 1SFSA 4XAPA 3VZYA 4BQ3A 3B8WA 2BVTA 4H9MA 4M19A 4HJFA 1YNYA 3EWZA 3W07A 2NUWA 4UTKA 4KESA 1MQRA 3NM1A 2FYMA 3JUGA 2A1YA 1MXDA 4M6UA 5CPQA 3B9AA 4ZB0A 1S39A 3W2MA 4D6IA 1T41A 4MYAA 2YW3A 2OPJA 2QIWA 3QGKC 5HULA 4AZIA 2P8BA 3TTQA 3GDMA 1Z7AA 4O0ZA 4O4VA 5ENLA 1J0ZA 3PZNA 2D22A 4LYPA 2RDXA 4W85A 1A5KC 1LTDA 3LN3A 4QX4A 3G8RA 1RBOB 1MXGA 1L6YA 3B4YA 3GBEA 1RPKA 3WNNA 2BY0A 5HXMA 3LMZA 1HGWA 3OYZA 2I1OA 2HV5A 3HU7A 2G0WA 1RR2A 2CNCA 2Z1BA 1TB3A 2XIQA 3AHTA 4UR8A 4R27A 3A12A 3KCOA 3DBPA 4H8NA 3RFAA 5EFDA 1V08A 1E6ZA 1LWIA 4IHCA 2NX9A 1OGGA 5BU6A 2ODOA 4BK9A 5FI8A 3AS2A 5HR7A 2Y63A 2ZA3A 3KP1A 3VDAA 4HT3A 3OLGA 5IHRA 4F79A 3NZQA 4UFIA 4KGLA 4RW5A 3S47A 4A2SA 1BXBA 7TIMA 4IUOA 2A6LA 3B9NA 5G2HA 5CPSA 3MPGA 1NFGA 1Y65A 1QHOA 4NAEA 2WO5A 4GLEA 1TX0A 2VFIA 4UMBA 3U2EA 1KFJA 1O4UA 3FHQA 7ODCA 1IEWA 5CJMA 3G1HA 5GNXA 1KXQA 1A5SA 3THCA 3V7PA 4RZ6A 3CLMA 2HXTA 3NL3A 1QI0A 1WKYA 3AI0A 3QPEA 5FEXA 4PA8A 4HB7A 3QMRA 1KWGA 3EDFA 4HA4A 2C91A 2QAPA 4CD6A 2V38A 5D2XA 1JZ3A 4Y9PA 1W1YA 3G8EA 3M4HA 3VINA 3PTKA 4D6EA 2J7HA 2YCLA 3GQYA 1YDYA 3ANVA 1WAWA 4XAGA 4NQ1A 1RLDA 3FGCA 4LBUA 1CWYA 1RQEA 1RCQA 3PZGA 4GZ7A 2BNJA 2F2KA 3SQMA 1GKRA 4W7VA 2FQIA 2IQTA 2NQ9A 2X1SA 1X1NA 3ZO9A 1OFAA 1V4YA 2B0MA 4XKYA 4A3HA 4QDMA 2PWUA 1XDLA 1NFPA 2ZZ3A 2V63A 3KW3A 1NWUA 1EGZA 4O4WA 5EBAA 1CGVA 4Q8QA 4JTFA 3T2OA 3GTNA 4L6HA 2XH4A 1OZMA 3BSMA 2R1PA 2ZZ4A 1TRDA 4H6KA 3EWYA 4CEXC 1VJSA 5I24A 1DJIA 3P80A 3W7RA 3VGDA 1L8PA 1P0DA 4X2RA 5D4YA 3WH8A 3C2RA 3M0ZA 1PKYA 4CCEA 4JTCA 4GQRA 2VEGA 4NNCA 2QDHA 4AVFA 1GPWA 2Z28A 2E25A 3UPBA 1RD5A 3H53A 1MDRA 1XLAA 3FJ6A 5DMLA 4GBUA 4H7VA 3O6DA 2EQDA 2W62A 2E8YA 3AHYA 2PRLA 4GCAA 5DEZA 5BW6A 3UF9A 3XIMA 3S1GA 3TROA 2VJXA 2G3NA 2WSRA 4LUYA 1OFBA 4A35A 2YZRA 4PFMA 1ZNNA 4MY9A 3P3BA 4WX2A 4DZ5A 4Y7EA 4D6HA 4AUBA 4DBSA 1J5SA 3HBLA 4HA1A 3D6NA 3W1LA 2QCCA 4ZMGA 2OEMA 5HPOA 3FNDA 1H4PA 1UA3A 5DN1A 4IIGA 1WNOA 1MEWA 2JEPA 4ERAA 1HW6A 4D2JA 4DPPA 4ZOBA 1GOWA 4HSOA 4YIWA 3A3WA 3M64A 3IIXA 3IVSA 4Z1YA 4XG1A 3PZ9A 4G9PA 2PZ0A 1ZBWA 2YPIA 3GXMA 1BRLA 2W5FA 1ZJHA 1R38A 3DZ1A 1F6PA 1ODZA 3TNOA 1OG6A 3W7EA 1H7PA 3TOPA 4O28A 4Z2IA 3VOFA 5BU9A 2OCZA 2OSYA 1J2WA 2GGEA 2CWNA 3NO5A 1Z8AA 4F66A 3S2CA 3PAJA 2KAUC 3TIMA 3EOUA 2ZADA 3W1PA 1E6RA 2E9MA 4RE2A 3S2NA 1WDQA 1B3WA 1FWEC 4G5DA 4OQVA 1WKEA 5CZSA 3OGRA 3T6CA 3L4ZA 3HA1A 2AAMA 4WJEA 1EO7A 1C92A 1VFUA 1US2A 2VTFA 3W22A 3AZTA 2X8RA 4GOAA 4ZVJA 2PWHA 3BICA 3MO7A 2HWGA 3M0IA 1Q65A 4FLRA 2YB4A 2ZXBA 1E1CB 1PX4A 2XUCA 1EA9C 4PRTA 3DOPA 4JPGA 4TTGA 1QXLA 3V3WA 4NI3A 1A5UA 2WXDM 3V0TA 2BV9A 3CXOA 3B0UX 3ITVA 3KCJA 3R11A 4LXFA 3WQFA 4UTUA 2F9RA 4NVTA 1I2QA 3TFCA 1W9XA 5BOFA 1CXFA 4CNNA 1POKA 1QWGA 2IQ0A 4H4IA 2DIJA 3FAWA 3HJZA 3WF2A 3M9YA 3MCOA 5HMEA 1CTNA 3O0KA 4GGBA 2BODX 1OCNA 3U5YA 1M01A 3UR7A 4FOUA 4BZYA 2Z6IA 3KL5A 3G3DA 1E1EA 5E5CA 1UH2A 1C3FA 5HJYA 3GNDA 1YRRA 4Q8TA 1RVGA 4AIUA 1J93A 3DFPA 2VT0A 2RGLA 3W1AA 2OVLA 3SECA 1L0PA 1EBHA 2O9RA 3AIUA 3AMKA 3KAOA 2R1MA 1DP0A 4HHMA 1JL8A 5H1WA 4Q4RA 4QNEA 4IQEA 1CXHA 3BZGA 4UC5A 3RITA 4RZ5A 4NZJA 4MKVA 4IUGA 5D9OA 3TTYA 5TIMA 1KGUA 1W5OA 3W7QA 2FKPA 1XH2A 3L2IA 4KERA 4H9UA 5A8PA 3A9IA 1GG1A 1HTIA 1SFLA 5FAGA 1QOQA 2AMXA 4UQAA 3SJNA 1RJPA 1VFHA 1R3RA 3P2VA 1H1NA 3ZQ9A 3E5BA 1XYLA 3RILA 1I60A 3IJ8A 4XAFA 1J0IA 3GO2A 4W7UA 2YL6A 3SURA 3LSCA 3ZJ6A 2P3EA 3IGSA 4OUIA 2DQXA 2V3FA 3N2OA 3MBDA 1XS2A 4LGXA 4PSPA 4MAVA 3D5HA 1ONRA 3PTQA 3QV9A 2G4JA 2XN0A 3GFZA 2E6AA 4H6EA 3RYSA 2BXZA 1XJBA 1KR0A 9RUBA 2BGQA 1OHLA 4YMZA 1GVOA 4RNIA 3DC0A 3S9YA 3CT2A 4HVXA 3MYPA 5D05A 1U22A 2DIEA 3CS2A 3CUFA 2HMCA 2A4AA 2QUMA 3NL2A 3RLGA 1IIHA 1Y5VA 2O56A 3GZ3A 4PUKA 2ISFA 3F7JA 3SRFA 4GI9A 4HU3A 4FF7A 4OBRA 1Q7ZA 2ZUUA 1VFOA 3W7NA 2BP1A 3C8NA 2JF7A 4WKFA 2D2GA 2PTDA 3C0SA 4I9MA 3RM4A 1KFEA 3T9PA 1RLCL 1JPIA 1Q6CA 1HP4A 5U7SA 3L67A 2NT0A 5G4WA 2I9EA 1UR3M 4IQLA 5CZJA 4XD6A 1TVLA 2VZTA 2A3BA 1DJYA 4M7SA 1XF0A 2QQ6A 4UUIA 1E4IA 2XZ9A 3VX0A 1JJKA 4X2PA 4JS3A 2NQZA 4DF1A 3L2MA 4A4AA 1YW1A 4ACZA 1BG4A 4KRUA 4AY8A 3PJUA 1XISA 1P1XA 4C6QA 4DJDA 4F0LA 5CLTA 5BWFA 3PULA 3FX4A 3CH9A 4DLMA 4GFIA 3VIMA 1ZBCA 1T5AA 4O1EA 3O63A 4EAMA 3C2VA 2YDQA 3H2AA 6REQB 3IJQA 1JPKA 3STFA 4GJ1A 3LHWA 2NQHA 4H9XA 1ZJAA 3AHVA 1WB0A 3RF9A 3EX1A 4LB3A 3HB9A 3MMTA 4AWSA 5JXQA 2Y1HA 4PEKA 1BQCA 3UXLA 1XYZA 2AL2B 3VOGA 1TG7A 3MKCA 3WLHA 3AO0A 2E77A 1TV7A 3UCDA 4D9PA 1MRQA 4IIBA 5AVHA 4RK8A 3WK2A 1JQVA 3MUY1 4ZODA 2C1HA 3T05A 5XIMA 1BVNP 3OIHA 1N8FA 1OFEA 3NYDA 4YLWA 1ZL1A 1BVWA 3TZFA 1NWSA 4S3DA 1GVRA 3MDUA 3CJPA 5CGTA 1TTQA 2PDWA 4FO4A 3RK8A 3T7VA 3TSDA 4C7GA 2CU0A 2F61A 5JH1A 2JBMA 1VENA 2PDLA 3G6MA 1D2KA 2O9TA 4KIRA 1O1ZA 3DI1A 4OKDA 5G4HC 3BG3A 1NP2A 3ATYA 1DE5A 3WLPA 3RX3A 4IFRA 4DUOA 3WMBA 2VUNA 4BJHA 2WYSA 2MANA 3DFOA 3VMNA 2INEA 1D3GA 3GIPA 1JZ4A 5DCDA 3HFTA 1WBJA 1XINA 3W4RA 2ZRVA 3R5EA 4AVOA 3VKCA 1TUFA 4GIRA 2J7GA 1EUNA 3BSHA 5ABTA 3N34A 4XZMX 2G50A 1TTIA 3GR8A 4PUMA 1NU5A 1KRCC 2DSKA 4N9DA 4ECLA 6REQA 3GU1A 2VELA 1EPXA 4ZR8A 4K6AA 1ZU8A 4GC4A 1W0MA 2ISVA 1X8FA 3NQVA 4C6NA 2E28A 3TKFA 3BLLA 2L5HA 1ZBKA 3ARXA 2Y5EA 2TAAA 1L2QA 3VIIA 3L66A 3PWGA 5LXEA 1FBAA 3VKKA 4HGXA 4E6MA 5DCEA 1JZ8A 4Q8OA 3H55A 3F1QA 1J5TA 1DV7A 4Z2KA 4BEQA 4BF5A 1LQ0A 1W3HA 1UMLA 2BWGA 3RO8A 1LQ2A 4PBEA 5CH9A 3VD5A 2BHUA 1XICA 1SZEA 3WQEA 1MEHA 2CHOA 3CNYA 1P1MA 2ALRA 2HXUA 2CZFA 4ZOEA 1XGZA 2Q01A 2PU0A 4R9OA 1J8VA 3WDRA 1K3UA 3GY1A 1WUFA 3MY9A 3DBNA 3FKKA 3EWBX 4J2PA 1B5TA 3O6CA 1KM1A 4UZSA 3F03K 1H1YA 1A5BA 3WQ8A 2X7WA 3ID7A 2CLKA 1PSCA 1GOXA 3PWAA 1TMLA 4Z2HA 1B4KA 1B9BA 5FJIA 4QJ4B 5D32A 2Y0FA 2Z24A 1NOFA 1VYPX 4IGHA 4POCA 3TTEA 5XIAA 4AVNA 1JXJA 3PP7A 4P7RA 4H7CA 1PTDA 1R9YA 3W88A 1ZCCA 2CXEA 3CTTA 2ADAA 3CQIA 2FZ9A 4QG8A 4MVAA 4H6RA 3MQTA 5D9NA 4QSHA 4LSBA 3P0XA 4O53A 4Z0SA 1F07A 4IICA 2J47A 4CNOA 3CZJA 3W7IA 4QIUA 3TP4A 4A3RA 3N73A 3VOHA 1DWJM 4N42A 1K9TA 2ZTKA 3TYZA 4HSHA 1EHAA 1TPUA 1R2TA 3A5VA 3A3XA 3NL6A 1MQQA 4YVVA 4IGSA 1UUOA 4NNAA 3WSUA 3KBNA 2QYGA 1CLVA 2DPEA 2FZMA 4JAWA 5K4ZA 4MSSA 1R3QA 1C7SA 3NYZA 1ICQA 3G1DA 4QCFA 5FJJA 4UQBA 2DZTA 1CBGA 2Y6ZA 3AMCA 4NSBA 4M24A 3ZOAA 4X9SA 4NJKA 1OSEA 4IP5A 2G95A 3SRHA 1JR1A 3ITGA 4H00A 3W1RA 1E56A 2EBNA 3KOWA 5D04C 4QP0A 3DAQA 2PZNA 1WKFA 3THQA 4RNHA 5AECA 2ZX9A 4DPQA 5CXPA 1R7OA 2Y7GA 4FNSA 1RVKA 1VGAA 4Q33A 1ADSA 1O94A 4M81A 2PDMA 3DHUA 3EB4A 4JGDA 5M1TA 2EPMX 4QR6A 3JRKA 4ZE5A 2X40A 2VEIA 1S5WA 1RZMA 1W1B1 1SJCA 3M7WA 2G4FA 1K70A 4YYCA 1ALDA 4R3UA 1NM9A 4Q4QA 2OWXA 3A9BA 5LYRA 1R9XA 3WBAA 2QKFA 3BSGA 1RY0A 3NM3A 3KTCA 4LUJA 1AL8A 3CL6A 2ISWA 3AXIA 3CC1A 3CL7A 1NOUA 3DGBA 1XWYA 1RK5A 3QZEA 4HK6A 1I0BA 4ZB5A 1V6WA 3HGOA 2J88A 1HNYA 3DYMA 3QHOA 1ITXA 1WZKA 2QGHA 4U4MA 4C65A 4TX8A 3IGXA 4Q7IA 3RLHA 1AFSA 3TJXA 3P5ZA 3VNMA 1AA1B 1HJQA 1TTJA 2BY1A 2ZZ7A 1N8WA 1P6BA 2QCMA 2QJMA 3EA2A 3PBWA 4E2BA 4DXXA 3KM8A 3UZXA 3BLOA 3ONBA 3PAOA 2BOFX 3OGVA 3WF0A 3CHFA 4P8VA 3WDHA 3GZAA 3AWNA 1DXIA 1UD4A 4V2XA 1EUAA 4XTIA 4Q4SA 3WENA 3BJSA 4GRSA 4PBFA 2JGYA 1ISVA 2E5BA 2WVSA 3I10A 5CAKA 2WKJA 4M6VA 4UFJA 3QR3A 4H04A 4BEUA 3WIJA 2PDKA 3BAYA 2Z4GA 1GZGA 4GH1A 3KDOA 4W87A 5F2LA 3EDKA 1Y5XA 5G2WA 2V5CA 3TYBA 1HVXA 3AROA 2WNZA 3CZGA 2FGLA 5AY7A 1VRDA 4U33A 5LSMA 1RK6A 4MB5A 2XINA 4LQ1A 4I8DA 4AEEA 2XM1A 1OVDA 1XP3A 2TRSA 4JTSA 4DI8A 3O07A 3BG9A 4JTQA 4L1GA 2W91A 2BOGX 5KZDA 5F2IA 3T08A 7ENLA 2NVDA 3K1DA 3UGRA 4EP8C 3HGRA 1BYBA 3G22A 4L4LA 2XIOA 2BXVA 4S1FA 1PZ0A 3M41A 1L2UA 5JH2A 2C14A 2E5CA 3IWPA 1Q4WA 2P5NA 2CBUA 4W8LA 5CJ5A 3R8HA 3B9OA 3SY5A 1BF6A 4IG2A 4YL2A 2V5JA 3WCZA 1C7TA 3MSRA 1OYCA 4H6QA 2XSXA 1ML1A 4C6EA 5LNSA 2BVYA 4FK9A 3UP8A 4W93A 3E02A 4AQLA 5C9RA 4PE8A 3F2BA 4QEHA 4O50A 1IV8A 3UR2A 1UKPA 3I68A 4QM1A 5KZ6A 1R86A 3DFSA 4ZA0A 5JBFA 3B9EA 1H11A 2I56A 2ZXAA 3FAXA 4JOMA 2PURA 1GCYA 3RHGA 2AGKA 1KQYA 3BCDA 3TJ4A 1A80A 2XWEA 4RPPA 2PUZA 4DO5A 2VVSA 3VNIA 1WZMA 2YL9A 5AHFA 2REQA 2DGAA 4GKLA 1F4HA 3F5KA 4JZ5A 1HO1A 2PDUA 3M47A 2WKGA 1KTBA 3TNBA 1GT8A 4AX7A 1V6XA 3QF0A 2VFGA 3MHGA 4YWSA 2PDNA 1BTCA 4LAKA 2BY2A 5A6SA 2HS8A 2Y61A 4LC6A 3QY6A 3AHZA 4L4OA 4UZUA 3IPWA 3N12A 5BRBA 5AFDA 2HPIA 3H22A 1IT0A 2X42A 1ESWA 2FB3A 2QZRA 3LRMA 5E0KA 3IANA 3V5OA 3KBVA 3BW3A 3RM8A 4LY8A 1TFVA 2VP8A 2OZ3A 3NQMA 1E9YB 3CYVA 4RUBA 3MZNA 2AAAA 5JBDA 4LAOA 3A23A 4JFWA 1SU5A 1H51A 4TR9A 2DT1A 2NVCA 1N8IA 3CMJA 2DZAA 3C6CA 4P2VA 5AVNA 3GSMA 1RQHA 2PGWA 5CC6A 2YCKX 4WGXA 3LI1A 4PMRA 1Z6KA 3R8RA 2A3CA 2VOTA 3BLEA 3UNDA 3ZWSA 2Y5JA 2R1LA 3U4FA 2KX9A 2RGMA 4WKHA 1TCDA 4FF5A 2XH2A 1FWGC 1N82A 1V3MA 1Q4NX 4GUHA 1XYBA 2VEPA 2PLKA 4JTKA 3BOLA 4JIEA 2QJIA 4AZ7A 5TF0A 1NAL1 2NX1A 3R79A 3U2OA 1F2JA 1TZZA 1SW3A 4PCTA 3KOYA 5M03A 4UTWA 2ATSA 1JI2A 1ZFJA 3SADA 3SZ8A 3OBAA 4PUDA 1KQZA 4R7OA 3B04A 1DHKA 1QPOA 1BWLA 1RP8A 4JN7A 3FIGA 4K68A 1CXIA 1BHGA 1IT8A 2RJGA 4FI4A 2OX4A 1C93A 4ZL1A 4XKMA 1GUVA 2PDXA 1PKMA 3KRSA 3K1GA 3UZYA 3C4UA 5U4NA 3G1SA 1UJQA 2R6OA 1QHZA 4UOJA 1HKVA 4FX8A 1IR1A 1GQLA 3KVJA 4XUYA 3SGUA 5MKGA 2VCAA 1TPDA 2Y85A 7XIMA 2VC7A 3C8FA 3W72A 1YMYA 3SRKA 1MW0A 3DHFA 3LDVA 4ICMA 4Q4MA 1EZ2A 3LTYA 4E2DA 1ITCA 2W61A 1EXPA 2E09A 1LG1A 3FKRA 2V2HA 4IPLA 4JTGA 1F05A 1SMAA 1UQZA 4HCLA 4GABA 3GKAA 4ZBCA 2VENA 3S83A 1QNSA 4B5TA 2UV8G 1TR1A 3KZSA 4RPQA 4JL1A 4ZFCA 2FVLA 2RHGA 4C1NA 3C3UA 3VAVA 3HQPA 4F2TA 1TA3A 4MIMA 4B90A 3TN4A 1XC4A 3U9IA 3B3DA 3GC5A 2JFEX 4MB3A 3R12A 4LJ3A 3T09A 5AZ1A 1AH0A 2INFA 3L7RA 3PZOA 3WBXA 4O16A 2W66A 6CGTA 2PTZA 1TPEA 1OBAA 2ISSA 2P0OA 1CGTA 4H9YA 3ISIX 3NIYA 1FHVA 3OB8A 3BC9A 5AB3A 2P1FA 3L5AA 4CCZA 3ZIZA 3GG7A 5DMYA 1M04A 1QW9A 3OPSA 4OBSA 3W2NA 4A3QA 4KWVA 1REQA 4PCFA 4Y9AA 1UC5A 1R3YA 1LZOA 3T55A 5CPMA 1V03A 1ADOA 4QE1A 4TIMA 5CAHA 3N9SA 2PDFA 5DMNA 1NELA 4D6GA 3P60A 3GYEA 3GFXA 1GOIA 4FIQA 1E0UA 3MT1A 1Z89A 2VOMA 3COTA 1FXPA 3VNZA 5AYZA 5A8GA 3FSUA 4H2CA 4N9CA 1TJ1A 3S1XA 3VGBA 3N4EA 1OC5A 3KFTA 2WCAA 3UXIA 3KOXA 4S2CA 3LRLA 1E4NA 3FHAA 3VA8A 5L9FA 4Q8UA 2OSWA 3CV6A 3QKEA 1DBTA 1VFMA 3URNA 3VIHA 1UG6A 3IK2A 3T0TA 3NFUA 2IXUA 3GDTA 3IAQA 2VD8A 2X1TA 5HMFA 2ZZ1A 3ZR4A 1W31A 2XISA 4W88A 1DE6A 2QJHA 1QFEA 3NJ3A 4GXWA 4WRHA 4L5ZA 2PP0A 3BO9A 2H3BA 2VMFA 4XIMA 5H91A 1R3VA 1KM2A 3CV1A 2ZE0A 2J7DA 2VUYA 3MJYA 4PMXA 5HQLA 2P10A 4DBUA 4L1XA 3RM9A 4WJ8A 3II1A 4FR1A 3GS6A 4JYDA 4K1GA 5F1UA 4PGLA 2VFHA 1WDRA 2OSXA 1SW7A 2RH9A 1ZJBA 3H4GA 3NSMA 4FPSA 4DJEA 3BGJA 4B3LA 3AU6A 4K38A 4LYQA 2BVDA 1XLMA 1BQGA 4CU8A 2CIPA 1UA7A 5AZ0A 1H09A 4HTYA 4XD3A 4GMEA 1LF1A 1H0IA 3GR4A 2GSEA 3TCEA 3PR2A 1BSLA 3B0PA 5ABFB 2VM8A 5M2FX 7PTDA 4B92A 1YXDA 1A5OC 3T44A 3WFZA 1UPPA 1WZLA 1J2BA 3VD9A 2C71A 2WLYA 4KPLA 1V6VA 5HAOA 2DH3A 4MB1A 2XFWA 4CD5A 3WFLA 2HK0A 3SIZA 5HINA 1JUBA 4AEOA 3VYLA 1H60A 4U10A 1S2CA 1CDGA 4MFEA 1F74A 3OU8A 2EHHA 4KBXA 2CZ5A 1XFBA 4U2YA 4GQQA 2IKJA 2WK2A 3R10A 4J3UA 2ZDRA 2QXWA 3UWVA 1V51A 1XLLA 1YDVA 4NAFA 1UUMA 3E2QA 4GXMA 1OX4A 1XBYA 1U1JA 3AQUA 3W02A 3BAIA 4FOJA 1KTCA 3PG9A 3GH7A 1U1HA 4NP7A 4V28A 1GJPA 1KM3A 1X7IA 1HUVA 1HL8A 4EE9A 2E9BA 1LL4A 3CPRA 5AYYA 3J7HA 4ASTA 1UIOA 2J62A 2D23A 1ENUA 2W63A 1M65A 1ZLPA 4C91A 2OWWA 1ZPTA 1TZ9A 3VIGA 5D33A 2HBVA 5H2ZA 1VD6A 4N9EA 1BVZA 2DV0A 1TWDA 4GI8A 4ZCWA 3CUGA 4W9TA 4CQDA 4CQAA 1F76A 4GYPC 5IBXA 1DJHA 3D47A 3DYPA 1BYCA 5AHMA 3LZ5A 5C6MA 2BOEX 3TC3A 2I7GA 3RCYA 3G18A 3VGEA 5A95A 5F2MA 4J35A 4GUFA 1LM1A 3GYCA 1PPIA 4NYYA 4TX9A 4S3KA 1DEDA 4GH3A 3MI6A 1I6NA 2X41A 3GXTA 1W9VA 1O6IA 1LLZA 3DH7A 3H21A 3DXIA 2R82A 3PJWA 1JGIA 1MYRA 2VEMA 4S2BA 3V16A 3APTA 5AHNA 2UWFA 2FFIA 1TJRA 3APYA 3GHTA 8XIAA 4ADUA 2GGJA 4IQDA 3CUXA 2XFYA 2JIWA 4LS0A 4YCPA 5B80A 1PWMA 3W29A 1BAGA 4GCXA 4B5SA 1SSGA 1XFCA 2GPTA 3HMCA 5FJRA 1VEPA 5HNTA 3C61A 4F40A 3MC5A 2J9ZA 3MSGA 3FSTA 4IPPA 4B9ZA 2G41A 2GGIA 5HUOA 4A21A 2NW0A 1XG3A 1XD0A 5L6UA 5CPLA 4WJXA 4HYVA 4ERGA 1X6NA 2GOKA 3P6LA 3N2TA 3CWNA 4JDBA 4DWSA 4GNKB 1BYDA 4RL3A 4TU1A 2VQTA 5EL1A 1J18A 4GHRA 1B3VA 1D7KA 3NR0A 4H1ZA 4KCUA 3RRAA 5HBFA 1VJZA 3S2JA 1TV3A 1F6YA 2GJNA 1JPDX 4Q8PA 2ACQA 3QZAA 1JAEA 4WDTA 2FH8A 1F3WA 4HOZA 2A5HA 1O95A 1UOKA 4B2DD 3VCNA 2ZRUA 2PI6A 1RSCA 3GXFA 1KCXA 1VLIA 1W9UA 1GVQA 4NHVA 3NQGA 1R47A 1QT1A 5A8OA 1XLJA 1H7WA 3IGHX 1Q6EA 2CHNA 3M7SA 1O5XA 2O7SA 2VFFA 2ZZ6A 1HQTA 1W17A 1I2PA 3TW9A 3L23A 3FA3A 5CCZA 1DJXA 3CL8A 2G3FA 1A3WA 3VE9A 1UASA 2J24A 1ZAJA 1V0MA 1XH1A 4UFLA 3NQ2A 3UG8A 3M5ZA 4DM2A 5IRPA 1PDYA 1L6SA 5H6HA 3G2GA 2J13A 1G5AA 4LCRA 2WMIB 2VYOA 3WK3A 4LF2A 2A0NA 1G4TA 4AISA 5I2UA 3DESA 4K39A 3U2CA 3RU6A 3MU7A 2FGZA 1OYBA 2A7PA 1GVIA 4HN4A 4HA0A 2WJZA 3ABQA 1C9WA 1I9CB 2D69A 4RDZA 3SO7A 3HPSA 3JS3A 3MMUA 4MG4A 2ZX8A 2ZZ2A 1W8SA 3EDJA 4NU7A 1FDJA 4PTWA 1R46A 6XIAA 3QR1A 5CPOA 5JUVA 4GYFA 3THDA 3QV6A 3O05A 3MUXA 3TU9A 3FEMA 1MO0A 3OZOA 1DKWA 4LYRA 2ZX6A 4U3CA 5DY3A 3RR4A 1RAKA 3WQ4A 3LGGA 3TOYA 2WPBA 4GUJA 3TW7A 4PUNA 3TUUA 4ZEPA 3WNPA 1TV2A 3TX9A 1QOXA 4O8AA 3SCWA 4C7DA 4GUIA 1LRQA 2JKAA 1OCBA 3MMWA 4JYEA 4JFTA 1V79A 1MW1A 1K7XA 5BZAA 2FLIA 1AD1A 2P88A 3TV8A 4W7WA 3SCSA 5AC7A 3CPGA 4KRZA 1JPMA 5DO8A 2WZMA 3NQDA 2WSKA 2VFDA 1Y5WA 3CB3A 3B4UA 4GVHA 1XH0A 1QMLA 1VCGA 3CASA 3GK0A 4MLJA 1K02A 2QR6A 3K4AA 3VCRA 3QFEA 3KBSA 3GDBA 3VDCA 1KO0A 4F0HA 1NF7A 1PTGA 5DRIA 2F6XA 1JYVA 1EJSC 3U7BA 4XAZA 1E43A 2H8ZA 2BBFA 5A8MA 3L0NA 1UD5A 4UMAA 5GJPA 1Q8JA 4LUSA 3HO8A 3T8QA 4NX5A 4O1AA 4BA0A 4QS5A 4PMZA 4W8BA 4ZSTA 5F4WA 3A3HA 1ZBVA 3QTGA 3RXZA 3T07A 3UWEA 4KMQA 4GVIA 5EMLA 2V9DA 4JTIA 3REQB 4TTUA 1R2SA 1I0DA 5D38A 1HKIA 3EDDA 1HX0A 1XI3A 4E3VA 2PF8A 4K7YA 2WMFA 4MKSA 4NRRA 4XZNX 1LG2A 3PK7A 4C6FA 2Q02A 3UG5A 3W71A 4JYFA 6TIMA 4S3JA 4ZGYA 5KSWA 4W4QA 4QQUA 4NILA 3PZTA 3N9RA 3EWUA 5B7YA 3GE7A 4KGJA 2E0PA 4XVDA 4ZQMA 4AC1X 4BS0A 3E0IA 1S2TA 4GI6A 3M43A 3WQWA 1PWLA 5HJXA 2WC4A 1NSJA 2FTYA 4UNIA 3O15A 2ZZ5A 1XYAA 2BASA 3L5LA 3R7MA 1DWGM 4AZ6A 2J77A 4QGCA 1TUXA 2XGBA 3SSZA 4LW7A 3F5LA 4Q3MA 4C6JA 1NDWA 3ES8A 4O57A 1OFPA 4BR1A 4FXRA 3S5SA 1IT7A 2QVHA 5D2TA 1SMDA 2GQ8A 3VE7A 3E2SA 3GX9A 3CGTA 4KFNA 4UMCA 3WH5A 3IRSA 1A0EA 1S2VA 3R8GA 2NXIA 3UJRA 3BLPX 1F73A 1JZ5A 4Q6JA 3PFRA 2EEXA 1PX3A 6PTDA 4D1JA 5A6TC 4K36A 3W1MA 4XO6A 3DC8A 4IMDA 2PDJA 1P43A 4IM4A 4UTJA 1GJWA 1T0OA 3UXDA 4D71A 3MW7A 3O2LA 3R94A 5BMWA 4JQAA 1H41A 4QSFA 2GDVA 1SR0A 3CAVA 1A4MA 5CG0A 3MB9A 2ICSA 4UR7A 1B1YA 4IFOA 4I7VA 1CLKA 1UZ1A 4MHBA 3SN0A 1P48A 1SZNA 2CZVA 4ZFMA 1MDLA 3VNKA 4CNTA 4JTLA 1EJWC 2CLEA 3C0JA 4WCJA 2QF8A 2YDAA 3PZUA 4PCPA 5K4XA 3BPWA 3AS1A 1JCNA 3GB6A 4A22A 3CZ8A 4ZZ9A 2GJXB 3M0HA 3ENLA 3G6LA 1VPYA 4Q6XA 3MWAA 2QDGA 2Y7FA 5D8ZA 1V3JA 2VX4A 2VKZG 4V33A 2J7BA 3T2QA 4FR6A 2UY4A 1QJWA 2O7QA 1A47A 2WVTA 4PMQA 1Q5MA 5A1AA 1M7JA 4GNVA 4FX6M 3FYYA 4N9BA 4RJEA 3W0KA 1O1HA 1JZ6A 5G5IA 3QMSA 4J7RA 2VD9A 2XFFA 3CIVA 1OIMA 4YU1A 5DT7A 2HZGA 3UNTA 1HN1A 2X0HA 1Z3NA 2P3ZA 3A4WA 4HMCA 3EKLA 4WY0B 3LERA 5DMMA 5IOBA 4NZ5A 2FPVA 1NFBA 1JDDA 1VBUA 2PGRA 4A2RA 5C71A 3OODA 1EFZA 1QR7A 2O0TA 2FDMA 2GZXA 3F2DA 1S2AA 4B4HA 3V1PA 3OZYA 2IXVA 4V27A 4HTBA 3VCCA 4JIRA 4NL1A 4D8ZA 1NIUA 1EWEA 3GG1A 3G1YA 2AQOA 3ARWA 4HPHA 1U5HA 3C86A 5DY2A 3MVIA 2B81A 1DHPA 4JDYA 1MZHA 4O13A 3DI0A 3GM8A 2VEKA 4HNVA 1RH9A 3LNPA 4MPKA 3SGZA 5I07A 4DO6A 1LROA 3ALFA 1AK5A 3IIZA 5C8BB 4KEUA 3GXNA 2VVNA 1SZFA 2ZWZA 5CJNA 2FHFA 9XIMA 3WLRA 3A13A 3VK5A 4PUJA 5JU6A 2UY2A 4NYUA 1JDCA 4HMEA 2YFNA 5LIXX 4Q7NA 3A4JA 2D2OA 5EA9A 2JALA 3VIKA 4ICNA 2X30A 1I2OA 3NEHA 3EKZA 2CLHA 6ALDA 4P8XA 3AIVA 5I23A 4MLRA 1SFJA 4RZBA 4JTAA 4JKKA 1YQ2A 2YGYA 3Q4DA 2QNEA 4OZOA 3B8SA 2QLYA 3KLKA 1PZ3A 1M9HA 1KBLA 3MI2A 2DSWA 4EIVA 1V5XA 4AZGA 1EKOA 4YS1A 3BAKA 6TAAA 3HF3A 1B3XA 4GVFA 5A69A 4KCTA 2NV1A 2CKSA 4AZCA 1C8YA 1LUCB 4DY1A 1EL3A 2X09A 3JZEA 4WY0A 3H7VA 2G96A 1DTNA 3AU2A 1SZRA 4IMGA 1AJZA 4ES4A 4RX0A 1LL7A 4GZIA 2QV5A 4O1BA 3PBUA 3GVQA 1TX2A 4TX6A 3ZZ1A 4MAZA 3MYOA 3LM3A 3N19B 4HZMA 3PPCA 4EVZA 2J79A 2EKCA 5BXPA 2E6YA 3PJXA 2AOSA 1B31A 5HWJA 2XPKA 2OR2A 4CN1A 1UWQA 1GVSA 1IGWA 2OO6A 2PWGA 4UTTA 3WDIA 2ZBTA 3FY1A 1QPQA 4S3FA 5E0FA 3PZVA 5LIKX 2J9YA 3TWBA 2R1NA 4NXSA 1MFUA 1GHRA 1ZZMA 2TPSA 2MUCA 1XX1A 2WOQA 1FCVA 1F8IA 1SQ7A 1W32A 4PL1A 3LX9A 5K3VA 3IV3A 5T91A 3WQGA 3WF1A 2E4TA 3EWWA 5EMMA 3A21A 3SIMA 2O4QA 3KBMA 5BCAA 1FWDC 3K2GA 3R89A 1RD6A 3M0KA 4MNLA 3C56A 1W1TA 3L5MA 2NV9A 4CQCA 3T0AA 4I3GA 4AW7A 1K9FA 1Z69A 4OIFA 3NOEA 3N3TA 3IUDA 4D6JA 4F2UA 2RUSA 2WMGA 1HKKA 3LLXA 3VNDA 3VTRA 2VRJA 2X2GA 4WXZA 3BE7A 2HROA 4AY7A 3KLLA 1EGVA 2OKTA 4JY9A 3O16A 3NQ7A 3BK0A 1W3NA 1XSIA 3LY0A 3QQ0A 4HNOA 3M16A 2A7NA 4I7UA 1GZ1A 2ON3A 3AS0A 1JD7A 3ZVHB 1QW8A 4J3WA 2HEJA 5EMYA 1TELA 1JULA 2JE8A 3V75A 4YHGA 5I3FA 3DDMA 3QY8A 2GVYA 5FSEC 3LCHA 1KXHA 2QMKA 2WVVB 2CZDA 3WG6A 3LA4A 1F61A 4UB9A 2BFGA 5D02A 3N6HA 3SRDA 1XV8A 5C2GA 3V5CA 1KBIA 1Q7MA 3CT7A 3U48A 3NG3A 3FYOA 1VHCA 1V02E 5ECUA 1CT5A 3L21A 3L0GA 4RDYA 1K4GA 3IS4A 3VD7A 1P6CA 4NZCA 1ZTVA 1VS1A 1XXXA 3NDZA 3GUGA 1FQ0A 2WSQA 3M6YA 2IKIA 2X1UA 4FA3A 4IWWA 3FN9A 4JKLA 1H5YA 2PGFA 4U31A 3W82A 4GY0A 3MP5A 1JFXA 4Y9NA 3B8VA 3JU2A 1AJ0A 1NJJA 3BW2A 4PBGA 2ACUA 2CLFA 4QJ3B 3OIXA 3L2LA 1D8CA 1MUMA 3K8MA 1CEOA 1XLCA 3WEOA 4L61A 4B3KA 3RMEA 1KGWA 3K8KA 1IHIA 4LNYA 1M53A 1VF8A 5LA1A 1SUXA 3ZJKA 4AWUA 1UR0A 1RP9A 4GUGA 2G3JA 4O17A 1OX5A 5CSRA 4Z1AA 2RJHA 4KWOA 1V0NA 3Q58A 4WY0F 4DWDA 1LWHA 4K37A 3ZVHA 1VB9A 7REQA 2NWRA 4M29A 3H2NA 2O4MA 2Z1VA 3P81A 4HOXA 3B0XA 2XZ7A 2QJGA 2FTPA 5F4SA 3W53A 4LEQA 1FWCC 2QF7A 3OA5A 2OTDA 1N7KA 3BQ6A 4L65A 3VU2A 4AXNA 2RFGA 3ORWA 5KITA 1R87A 1JCJA 1K1DA 3ARVA 1W56A 1V7YA 2H6RA 3MTWA 2J66A 1DQXA 1UCWA 4URIA 3W75A 1JGMA 3VUSA 1QTWA 1H7RA 3TJLA 4L80A 3OTRA 1UZ4A 4GC3A 3EAUA 4CD7A 2SFPA 4GQGA 3PPGA 2ZXDA 3MCNA 2PRMA 4P61A 1G4SA 4FHAA 4ORMA 1UWRA 3B03A 3WLTA 3CEUA 1H3GA 1BKSA 4G1KA 2CWXA 1OWQA 4PTNA 4XBJA 3MCMA 2UY5A 4BY3A 2GGGA 3PPFA 4KWSA 4CVUA 4O14A 3WJZA 2Z1XA 4XBSA 3KS5A 5FEPA 5CSUA 5FF4A 5IFPA 2GGHA 2CBIA 4HMDA 3OEXA 2BDQA 3SCRA 2CITA 5IDIA 3W01A 2XN1A 3LCIA 2CXGA 3NDOA 2W92A 4YPJA 2E40A 4WZHA 1GOMA 3QV7A 2BSLA 4IJBA 2WZHA 2QCFA 4KCVA 4HHLA 4FAMA 1KM0A 1ZALA 2OMAA 5FJUA 4M8UA 3TA6A 3M0VA 2Z25A 3H24A 3KZPA 1PHQA 3DUGA 4KCWA 4MJ2A 2ONEA 1FWWA 5JQ9A 1JAKA 5KTLA 4ZQCA 4Q4PA 3BMWA 2PBGA 2HPMA 2IPGA 5E1QA 1QW7A 1K6AA 1TE1A 4LT9A 4UTWC 2C0HA 3SCOA 1PUDA 5F4XA 2HBXA 3PNZA 4JL2A 1Y0EA 6A3HA 5FAJA 1X97A 1QATA 1UWIA 3FS2A 3UCQA 4I9TA 3KBWA 5JVLA 2ZFAA 4XQ6A 1RQBA 4R5EA 4UTMA 3P7YA 1P7TA 1GQJA 1OGBA 3W83A 3EXRA 3AIWA 3SCQA 4M56A 3S2MA 4RV3A 4JEJA 2O55A 3P67A 1K7EA 1KFKA 5EKYA 3C5QA 3PBYA 4LU0A 2YCLB 1QAPA 1UKOA 3FGCB 1R8LA 1CXKA 1W5PA 2YLLA 3VDGA 3EXSA 1J0YA 1H1ZA 2XYLA 1YBQA 1V8EA 5I3HA 3MUIA 1JDEA 3SCNA 1JUKA 1DJWA 4US5D 3AAMA 4XKYB 3UETA 1E5JA 5FF0A 3FJNA 3W1QA 4F8XA 4I7WA 1ECEA 3PZQA 3S0CA 3A5FA 3H4WA 4P8WA 2VZUA 4QJ1A 4KS0A 2NQJA 1G4EA 1EJTC 3EOOA 3ARRA 4JNMA 5D2WA 4ZTYA 3WUBA 3RR1A 1VBGA 3LXAA 3A4XA 3WF4A 5J5DA 4MKNA 3IJ7A 1WO2A 3L4UA