1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
b'EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ALPHA-AMYLASE)
publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
3ZR5A 1E43A 1G9HA 1HKIA 1B90A 3CLWA 1OT1A 2EXOA 2PWHA 5CQ1A 2D0FA 3II1A 2BFGA 2BVTA 3TONA 3G6LA 4CKQA 4M80A 3WD4A 3ZJ6A 4QLKA 4AMXA 4MTVA 2G3MA 1R46A 2OSWA 4QP0A 3AFBA 3L4UA 1V02E 4E8CA 1GJWA 3KEHA 1WCGA 1GVYA 4NX0A 1V6YA 3BCFA 3B9DA 4ACZA 3GH4A 1NWRA 5A3HA 2CHNA 3QR3A 3WNLA 2D0GA 3BAIA 3VIKA 3W81A 4IISA 3BLPX 4KGLA 1QI3A 5AYIA 4U2ZA 2DSZA 2IGTA 3GYCA 1UKPA 4MNKA 4GIAA 2YLLA 4L4PA 4D6IA 3CIVA 3L4VA 1UWQA 1PS3A 4NZCA 1LL7A 4W8LA 4FNRA 2ZWYA 3BVXA 1C91A 3ARQA 4CU7A 1JZ2A 5A6KA 3N17A 1MW1A 3CPUA 1E72M 4HU0A 2BNJA 2BHUA 1V0MA 2WW5A 1JZ5A 2V38A 1MQRA 1HL8A 1HKMA 1XYZA 1SZNA 4B16A 4X9YA 1KB3A 2BS9A 3U5UA 3RM8A 1GQKA 2E4TA 3WQ8A 4D6JA 3BAXA 5E70A 1D7FA 3AICA 3VVGA 2BHYA 2VMFA 1AQ0A 2F61A 3CUFA 5A6BD 1HNYA 2BHZA 3FW6A 3KLLA 1QVBA 1OCQA 3AMCA 4OGZA 2CYGA 1C92A 2PBOA 4BF7A 1HXJA 4J3WA 3RMEA 3T0AA 4CN6A 1OWQA 3AMGA 3AXXA 3VUPA 5E6YA 3A3HA 3ZJKA 5I5RA 2WMFA 2E40A 3N18A 2PC8A 5HOSA 4CVUA 3D4ZA 4CN4A 1NARA 3NDZA 4ZXLA 2IUZA 1B3WA 1GONA 4U3AA 1GQLA 5I2UA 4HZ8A 3G6MA 3MANA 5LA2A 1OD8A 2WCAA 4B9YA 1CGYA 2X2HA 4XX6A 3FY1A 3VO0A 2VL4A 4JHOA 5I23A 5LA0A 3T0DA 3AZRA 2WZEA 2J74A 1VBUA 4PN2A 1AMYA 4FLRA 1WPCA 1UKOA 2XSBA 3WUBA 2JALA 1JNDA 1BGGA 3KL5A 4J3SA 1OT2A 2VX7A 4TTGA 3LMYA 2X09A 2PF0A 4J3UA 5LA1A 4RL3A 1JZ4A 1M53A 2UWFA 1QOXA 3B9AA 5C71A 1CXKA 3ZM8A 4UTFA 5DMYA 1UHVA 1TQTA 2WWDA 5GNZA 2IXVA 2XIIA 2Q8XA 2VJXA 4JHZA 2XIBA 2HISA 4PTMA 3UG5A 3W29A 4CCDA 3DX1A 4X0NA 2BVDA 1ODZA 4UQ9A 2CCRA 1XC6A 2J47A 1ZBVA 1X1NA 2VTFA 1ZB5A 2YL6A 1WDPA 3VTRA 3RJXA 1WP6A 3NCOA 1C3FA 2EABA 2Y2WA 1KXHA 3VIIA 3S2CA 3N11A 3VOCA 1JYVA 2JEQA 3FXYA 1CXHA 1XCWA 4QCEA 1Q6EA 3UCQA 1W1PA 3ARTA 4MB1A 1K9EA 3BUQA 2V5CA 2DSUA 4Z2HA 4H7VA 8A3HA 1SFSA 3M46A 4BQ3A 5JUVA 2J7HA 4CN1A 1JYXA 3CZKA 4DO6A 3HG4A 3RDKA 1BGAA 5D9NA 1U33A 4Z2IA 1E71M 1XSIA 3T09A 3GNOA 4BQ4A 4RE4A 4LX4A 1GQJA 4OBRA 1JDDA 3UG4A 1W91A 3ARUA 4ATLA 4RE2A 1BLIA 1VB9A 5FD0A 3HN3A 1CXEA 5GPRA 4PMOA 1Q6CA 4W85A 3VMNA 3A4XA 3AXIA 1V3MA 1K9DA 4NZFA 3K8LA 3AQUA 1J0JA 4CGTA 2DT3A 3U7BA 4LYPA 2J7CA 4CD6A 1TQUA 3AIRA 1GOMA 4U31A 1R87A 3KZSA 1A47A 1B3XA 2PI6A 3ARSA 2F1BA 3MUIA 3AIEA 5HPOA 3CUHA 3SUSA 2WVTA 1CBGA 4UFJA 2ZUUA 3L4ZA 1ITCA 4W7VA 1XSKA 1W3KA 3MMDA 5E6ZA 1BF2A 3BUPA 4EE9A 1M04A 4OJYA 4WIWA 2ZX5A 3S6TA 5DO8A 5BXSA 3LPFA 4UCFA 3WSUA 1QNRA 1FHDA 1B3VA 3TP4A 1GUVA 2WHLA 1V6VA 4R5EA 3OLDA 2G3IA 3ZSTA 5A1AA 4U5IA 3OBAA 3CHFA 3D3AA 4EAMA 2VRQA 4HZ6A 1O6IA 3CGTA 5HDRA 4OOUA 3WQWA 5C8BB 3VPLA 5CGMA 4IM4A 1UASA 3LPOA 1V6UA 4DWSD 4C7FA 2OYKA 1OIFA 3GBDA 1UG6A 4LPCA 3WH9A 3EYPA 3VSVA 5C70A 4MDOA 3AS3A 4MDPA 4UOJA 1EO5A 3W6LA 5HPCA 5D8ZA 1VFFA 1R34A 2DT1A 2VX6A 3RJYA 1VFOA 2F7RA 3TV8A 3KL0A 2J8FA 2YOCA 3HG5A 3MUAA 3MV01 1OGSA 2CBJA 2WM0A 2FE0A 2YDSA 4GXPA 3WIJA 1MFUA 3TTSA 3EJSA 2C8NA 2F18A 4NXSA 1V02A 2EPMX 4XUYA 4BS0A 1WKYA 4MNJA 2BY3A 4HPGA 3EJUA 4YHEA 3M07A 3WDQA 4U33A 1ZBKA 4J3XA 1E6XM 3VIMA 7TAAA 3W38A 1KQZA 4TX6A 3D4YA 4ACYA 1OB0A 3DYMA 1C7TA 2Y8VA 4JCLA 2C0HA 1OINA 2ESCA 5CLTA 5A2AA 3E1F1 2WBGA 3WUEA 2AAAA 2Y5EA 1GORA 5A6JA 4PSRA 4HTYA 4M8UA 1L8NA 4D1JA 4MB4A 1QNSA 1E0XA 4BQ5A 4FLQA 2C7FA 1KCLA 4FNPA 3W25A 4V27A 4AZCA 4W89A 1NH6A 2GUYA 5DEZA 1E73M 1WZMA 2ZE0A 3SEPA 1E15A 3AROA 3VX1A 3ARXA 3AIQA 2CHOA 1R75A 1KWGA 3KL3A 4GO9A 2W5FA 5A69A 5F7UA 2YA1A 3ZT5A 3BMVA 1ITXA 1GPFA 2DIJA 2XFRA 3IK2A 1NQ6A 3F5KA 4OBSA 3WH6A 3EDDA 4Z2LA 4F66A 3W4RA 1ZJAA 3WL1A 1SYTA 3LXAA 3OGVA 2DDXA 1AQMA 1DWHM 4E2OA 3AIWA 1V0LA 4PMNA 1ZU8A 1EGZA 1R85A 2VI0A 3SCQA 5CXPA 1BTCA 2J77A 1HL9A 1Y7VA 2XN1A 1B0IA 3VD3A 3OB8A 4AEEA 1G01A 4BCEA 2WANA 4FF5A 3HMCA 3O6AA 1H1NA 1TQWA 4AZ6A 3WMBA 3WNPA 3W24A 4DM2A 3WDPP 4AZHA 3F5JA 3PZNA 1XH2A 4QDMA 4TOQA 3VGDA 5AYBA 2D23A 2ZUNA 2WVSA 1BQCA 3SUTA 1E70M 1JDAA 1XHGA 2DGAA 5CLWA 1WZAA 2W91A 4EANA 2VRKA 5BCAA 4PSPA 3SCSA 2OSXA 1H41A 4WLCA 1W9VA 1ZBCA 3DHUA 1CEOA 2J8GA 4MJ4A 1O7DC 3WD1A 3TTYA 3BSGA 1W3JA 2D20A 2RGLA 3IJ8A 2X1IA 1KBKA 3GXTA 4B9ZA 5ABFB 2BXZA 5DFAA 2J7BA 2WLZA 2FHBA 2WLYA 3POHA 1W9PA 3A21A 3MO4A 5CPQA 1EQPA 2BY0A 2WC7A 2VRJA 5I3DA 1G0CA 3AZTA 3WKZA 4AD2A 1B31A 2CITA 5CZKA 2GVYA 2W63A 3EMZA 4PUDA 5E0FA 4ZE4A 1QWNA 4GKLA 1PIFA 3LXCA 1J0IA 3OLIA 3EJQA 1LG1A 1UWIA 1R33A 4Q22A 1LWJA 2J79A 4PCTA 4PMQA 3ARYA 4D6GA 5M03A 4W93A 5IDIA 2JE8A 2V5DA 2X2JA 1J10A 1W2VA 4CCEA 4QCFA 2O9TA 1DWJM 1GHSA 1U2YA 3PZOA 4PMZA 5IXEA 3CUJA 1DWFM 3GH7A 4N42A 2A3AA 1PZ2A 1JYNA 3PTKA 4E4PA 3ARVA 1E6SM 1HJXA 3AYSA 4M81A 3F4VA 4AW7A 1CDGA 1TR1A 4YPJA 2Z1KA 3W53A 4OKDA 2TAAA 3RCNA 5DF0A 4DWSC 3PZUA 3BCDA 3VIFA 4DUWA 4HPHA 2NT0A 1EHNA 3WNNA 3K4DA 3LXBA 4ML4A 3SCVA 1H4PA 2J75A 4KWUA 1KTBA 2YA2A 3EMCA 4M29A 1QWUA 1E6RA 3AI0A 2CESA 2WMHA 4FLSA 1JXKA 1CXLA 3SCTA 3W27A 3AHZA 5A94A 1RH9A 5I0DA 1T0OA 1VFUA 2OW7A 2GJPA 3QOKA 3VMOA 4JFVA 3BMWA 3GXIA 2DT0A 1TA3A 2VO5A 1QNOA 3APGA 4H8UA 2CBUA 1KXVA 1HJWA 1ZL1A 1W9XA 4PEEA 4PCSA 4MAVA 1HVQA 4PUEA 3CHCA 1RD6A 1TVNA 3GXFA 1J11A 2ZXBA 4M82A 4AZCB 3BVVA 4RE3A 2ZUMA 1LL4A 1J0HA 2EQDA 1H09A 1SR0A 2F2HA 4UQEA 5A8NA 1Q4NX 1GNXA 1OSEA 2J7GA 3L4YA 3CZLA 6TAAA 2NT1A 2WVVB 4OOZA 4P7OA 4FNQA 4MB5A 4TVUA 3OLGA 2EO7A 4QFUA 1TFVA 2XG9A 1GJUA 1KXQA 2WHMA 1TVPA 5CSYA 1ISZA 3MS8A 3FAXA 1JAKA 3K4AA 1BSIA 3CUIA 2D2OA 3MSGA 5A6SA 3VILA 3A23A 3D52A 2CKRA 1SMAA 1C7SA 2XFFA 3W28A 3WDIA 5I78A 1JD7A 3W82A 1NOUA 2D1ZA 1GOKA 2WZIA 1UA7A 2YIHA 3WF2A 1ODUA 2E8YA 3T08A 1HIZA 3QHOA 4GQRA 4XV0A 1C93A 1NP0A 4E8DA 2F7QA 3WY1A 2CERA 4NXKA 4PTWA 1E5JA 1TQVA 2FYVA 4HMEA 1RP8A 3DYPA 2YFNA 1KGXA 3BLBA 1JL8A 3GNRA 3CZ8A 2V3GA 4MJ2A 3WFZA 1F4HA 4GO8A 3AOFA 5A8PA 1VEOA 3FHAA 5GNYA 1O7AA 1QHOA 1V0NA 2XFYA 4P7LA 1MYRA 1UUQA 1VIWA 1R86A 5KZ6A 4JKKA 2PWEA 3WNMA 1HP5A 4UFLA 4P7RA 4K68A 1TQSA 3DECA 1V3KA 5IFTA 3BUIA 3WY3A 2GDVA 4S3KA 2XGBA 3CZNA 6A3HA 3MU7A 4QLLA 4DO4A 2QMJA 4M56A 3K8MA 1BG9A 2E9BA 1J0ZA 4WKHA 3NSNA 3W26A 4A3HA 2VCBA 2XWDA 5EBAA 2EPKX 4FNSA 3IAPA 3ZQ9A 1UR2A 1I1WA 2HVMA 3GXDA 2GK1B 1H3GA 1E0VA 1WDQA 4P8UA 1CXIA 3MSDA 2JF7A 3PZTA 4TUFA 4X0VA 4TTUA 3VIJA 1JDCA 1UD5A 2O9PA 2ZXDA 3RM9A 2YDQA 1EQCA 5AC5A 1XD0A 4AIEA 2WKGA 3AHTA 1WB0A 1AQHA 1V3JA 5BXPA 2G3JA 1QBBA 1K9FA 2J4GA 1HP4A 3WD2A 1MFVA 2XN0A 3AJ7A 3GXMA 9CGTA 1ISVA 1DWIM 2OYLA 3IJ7A 2ZUSA 3VU2A 4F9JA 1C90A 1LWHA 4MB3A 5JBDA 2MANA 3LPPA 4D71A 4U5KA 1E6QM 1PZ3A 4AYGA 4JIEA 3EMQA 1E56A 1FH9A 1E9LA 3WQVA 3D5HA 1E4LA 4D72A 5CG0A 4FK9A 1GHRA 4W8AA 3KWXA 4LGXA 4D1IA 5D9PA 4JCMA 3J7HA 5IHSA 1BYAA 3ZOAA 2XJ7A 1NP2A 5M5DA 1UR9A 4QLJA 1EXPA 2VZSA 2FDMA 1EOKA 1QHZA 3VGGA 1DP0A 1ZBWA 1TA3B 1LL6A 3AIBA 4AD4A 1Z32X 4UFHA 2ZIDA 5KEZA 1J0KA 1FOBA 3VX0A 4HOWA 2QF8A 1TMQA 2EJ1A 5CPSA 1I1XA 3NSMA 1VF8A 3AMLA 3A4WA 3AS1A 3F5LA 5ABFA 3CC1A 2VZOA 3ZT6A 3CUGA 4AD1A 1RP9A 3HG3A 2XHYA 3DC0A 2WKLA 2FGLA 2D73A 3ARRA 5BRPA 2Y8KA 3VDBA 2OLHA 1CTNA 2XVGA 4H8VA 3BSHA 3PZIA 3LRKA 3WBAA 1VRXA 3WF4A 4H8HA 1KTCA 2X2YA 5FKYA 2PWFA 2J7FA 4AXNA 2YL8A 1PX8A 2X05A 2WMIB 3ARZA 3OZOA 3FN9A 3T0BA 1YQ2A 1CZ1A 1GOQA 1TZ7A 2CBIA 4JKLA 4ZENA 2A3EA 3VNZA 4AD0A 2PWDA 2VQTA 2CBVA 3N12A 4AZGA 2VVNA 4WKAA 3ARPA 4CD7A 1UR8A 1MXGA 4UOQA 4WSJA 3D50A 2J7DA 5A6AA 3GDBA 1H0IA 3BH4A 4AWEA 2VNCA 3VKKA 4UFMA 1FP8A 4W7UA 2CIPA 3BUDA 1JD9A 1W3HA 3MUZ1 1X6LA 3MMUA 4F79A 1PX3A 4NI3A 1E4IA 1UZ4A 3VMPA 1PJ9A 4AD5A 4AISA 3UESA 5I24A 3AHXA 2DQXA 1W1YA 3RO8A 1CENA 4MADA 3ALGA 4V2XA 1B3YA 3RM4A 1E3ZA 4KRUA 3IGUA 3SCWA 3SUVA 3VM7A 2PWGA 1V08A 2CKSA 2VX5A 3BVWA 3L2MA 5ABHA 1XGZA 2CPUA 1M7XA 5JBFA 2W61A 3SCOA 1HKKA 3N04A 1ZJBA 1PAMA 2PBGA 2XVNA 3WEMA 3ZO9A 1TE1A 2JFEX 5A2CA 4DUXA 1UWRA 4CD4A 3W6MA 1UR0A 1R8LA 1AVAA 3A5VA 1CGTA 1UWTA 1KXTA 3VD5A 3NSXA 3DYOA 2WVVA 4D6HA 4UOZA 3VDCA 4Y7EA 1FP9A 2E8ZA 2XM1A 4AZIA 5EFFA 4HA1A 2FH8A 2ZUTA 1E6PA 1H49A 1GCYA 1CGVA 3BC9A 2CEQA 2O92A 4C7DA 4DWSB 2GFTA 4ZEPA 5FIPA 1R7AA 1UYQA 1C8YA 1K6AA 2X0HA 3L2LA 3DHPA 3WEZA 2WYSA 2G41A 2WK2A 4AZBA 1TUXA 2WBKA 3VD7A 3WNOA 4QAWA 1JI1A 3PZVA 1N82A 4OIFA 3ZJ8A 2VCCA 2DT2A 3BAWA 3VIOA 2VVSA 3SUUA 3AZSA 3WQ6A 3SUWA 2X0YA 4LQ1A 5HBFA 4W87A 3T2QA 4UFIA 1V6XA 4W5UA 3SCUA 1JG9A 1UOKA 1G94A 4MAZA 5FL1A 4FNTA 5AY7A 1XRVA 5DT7A 2A3BA 3AIVA 3L4XA 3HG2A 1OGBA 1FFRA 4TVDA 1QI4A 3BAJA 7CGTA 1DEDA 3AYRA 3I3EA 1KCKA 3THDA 1UA3A 1XD1A 4AY1A 1D2KA 2XYLA 3ARWA 3CHDA 4J3VA 1DHKA 2YJQA 2A3HA 2O9RA 1WO2A 3WEOA 3PZ9A 2YBTA 2EADA 4KH2A 3PHAA 1EO7A 4FMVA 1LQ0A 3W0KA 4HA4A 1GZJA 3VD9A 4HA3A 2BV9A 3GM8A 2OW6A 2GK1A 2X8RA 1HJSA 5CGTA 3WNKA 3I3BA 4S3JA 1IZKA 1UQYA 4GZIA 3QHNA 4GINA 4LYQA 5I77A 4W5ZA 3BLKA 1TG7A 3WF1A 1UD6A 4W84A 3W37A 1B3ZA 3PZQA 5A6BA 4BZYA 5IHRA 3VD4A 5A8OA 1BG4A 2WNWA 4PMYA 1OGGA 3AMDA 4AIOA 4L4OA 4KRTA 3AS2A 3UETA 2XM2A 5A8MA 1E6NA 1JI2A 2BY1A 4NSBA 3GH5A 3CZSA 4HOXA 3MKKA 3NJ3A 3UEQA 4CVWA 1ISXA 2RGMA 3ZMRA 2WHKA 3SURA 3I3DA 4PTVA 3DDGA 3BGAA 2VC9A 3OIHA 1E1FA 4YN5A 2Z1SA 2GJRA 4J27A 1K9TA 3M7SA 2EAEA 4JL2A 1M03A 3LRMA 4Z2KA 5ABGA 2FHCA 3SIMA 4UQBA 1BYDA 3AXHA 1E1EA 3DX2A 1EH9A 1V3HA 1ISYA 4D6CA 2VCAA 4F8XA 2QPUA 2A3CA 2D24A 3SCRA 4BQ2A 4YHGA 4TX8A 2W66A 3DX3A 1KGUA 4JL1A 2W92A 5ABEA 1BVNP 1HKJA 2D0HA 3PZMA 2ZX6A 4JKMA 2WZHA 4PMDA 4LXFA 3L4WA 1JXJA 3WENA 5EFDA 1E4MM 4M24A 4WK9A 2CNCA 1UR1A 1XSJA 3GXPA 4B15A 4ATDA 3OGRA 4GZJA 2ZX8A 1VJZA 2XVLA 1BYCA 2V3FA 3LPGA 1PIGA 2WB5A 4MNLA 4ZFMA 4IPNB 5BXRA 2YKKA 1W2PA 1QHPA 4B3KA 1LJYA 5E09A 1CECA 3WQ5A 2D22A 5BXTA 1IV8A 1EDTA 4Z2JA 1XH1A 2ZOXA 1VBRA 3EDKA 1MQQA 3WDRA 5E9AA 3A24A 4EKJA 1J18A 3GXNA 3N1AA 4MNMA 4ATWA 2EPOA 1CGXA 1XCXA 3VIPA 1H0GA 2WMIA 1H11A 4IUGA 2F7OA 2UY3A 3U57A 3O2LA 2YL9A 1UZ1A 1DWAM 2D3NA 4HMDA 2O9OA 3MUY1 3VSTA 1Q6GA 3U7VA 2ZICA 1CIUA 1G1YA 1WZKA 1WDRA 1FH7A 2QLYA 4J3TA 5GNXA 4GI9A 4J7RA 3A47A 3VGEA 3PTQA 3WH8A 1V3IA 1NM9A 3VINA 2FH6A 3O9NA 4KGJA 1LF1A 1QNQA 3CZJA 1L0PA 3CZGA 1IT0A 1LLOA 2XVPA 3SCPA 4DM1A 3ZR6A 4PMUA 1XV8A 1ESWA 4U2YA 4PRWA 1UH3A 5A6LA 5TD4A 2BVYA 5D9MA 3GNPA 1JZ8A 3BUBA 3K1DA 4W86A 7A3HA 1QW8A 3M6DA 3ECQA 3WL0A 2ALWA 1W32A 4UZSA 4PMVA 2ZXQA 4AC1X 4CD8A 2EPNA 4A4AA 3WMCA 1MW0A 2W67A 4B3LA 4CUCA 1UD4A 2Y24A 5A8QA 2ZX9A 3U5YA 3N13A 4UNIA 1HT6A 3WDHA 1US3A 1V6WA 4TVCA 1CLXA 1NWSA 3UG3A 3VNYA 4FLOA 1TCMA 2E9MA 1WZLA 3VDAA 1JGIA 1MW2A 3WD3A 3CZEA 4Q7NA 1UH4A 3LRLA 2DSVA 1KFWA 3NYDA 2WCGA 2ZX7A 1U30A 2GJXA 4D6FA 3RILA 4PYSA 4UR9A 4DWSA 2QV4A 3L4TA 2DH3A 1CGUA 3WFLA 5CSUA 2F8QA 2YA0A 3T2OA 2OSYA 2XWEA 2XPKA 5CPTA 4JFWA 1WDSA 5CJ5A 2VQUA 1JYWA 3JUGA 2F7PA 3ZIZA 2WPGA 2VZVA 3FAWA 3THCA 3WELA 3VSUA 2WMKA 4J28A 1WNOA 1QI5A 3H53A 2GSJA 3WMSA 3N9KA 1MW3A 3EDFA 3WUGA 3KLKA 1UQZA 4JAWA 4ZXOA 3EJPA 4W8BA 1UKTA 1NWTA 1I75A 4UQAA 1HWWA 2X2IA 1W1VA 3WF0A 1UD3A 2YDRA 2VR5A 2VZUA 3CV5A 1CGWA 2ZWZA 4AEFA 4UQDA 4GI8A 3WH7A 1F4AA 1IZJA 2VUYA 4NZJA 3OZPA 3DX4A 3A6OA 5EMYA 2ZUVA 4D6DA 3AMKA 1KWKA 3H55A 1VJSA 1FH8A 4GPNA 3ZSSA 1BHGA 1JNEA 3GZAA 1UH2A 4EK7A 1E0WA 1QBAA 2XTKA 2J7EA 1CLVA 2WMGA 2EPLX 2J25A 3NUKA 4PMXA 4ACZB 2J62A 1BYBA 1P6WA 2W4XA 4OZOA 5E1QA 4PMRA 1HTYA 1J12A 3B9EA 4NRRA 1H5VA 2BXYA 5I6SA 1W3LA 5JIWA 1QNPA 2VURA 4AIUA 2DSWA 1HXKA 3CH9A 1NOFA 1SMDA 1KBBA 3AHYA 4CCCA 3QGVA 5D8WA 2OYMA 2NSXA 3OG2A 5M3WA 1BPLB 5AC4A 1VEPA 4A3YA 2UY4A 1QI0A 5BROA 4H41A 1CPUA 3UERA 3FHQA 1KR0A 1DTUA 5I79A 1E6ZA 1MWOA 3HZ3A 2WAGA 4HOZA 3TA9A 1B2YA 1BAGA 2CXGA 4C7GA 1NOWA 5ECUA 3WQ4A 3DDFA 1FA2A 3WF3A 2ZXAA 1QPKA 1PBGA 1MXDA 3ALFA 3PBGA 1GW1A 5D4YA 5HNNA 3VIGA 3NDYA 1EDQA 1GOWA 3TTQA 2AMGA 1BFNA 4PBGA 4TXEA 4GI6A 2DSKA 1PX4A 2GDUA 1V3LA 1PPIA 4DO5A 1YHTA 2XN2A 4AYSA 1KR1A 2G4FA 2CETA 1OBAA 2Y4SA 4IPLA 3WN6A 4HU8A 4WKFA 1OIMA 3WUFA 2OWWA 5HXMA 2QHAA 3WBEA 3RPMA 1MVYA 1EDGA 2W62A 1B9ZA 4FNUA 4W88A 3OA5A 1OD0A 3CO4A 3WY2A 5M17A 1M01A 1ISWA 3T2PA 2EACA 4XZWA 2OWCA 3UR8A 1EA9C 3PZGA 4N0RA 1E3XA 1HJUA 1C8XA 1GQIA 2BY2A 2ZUWA 1B30A 2XSAA 2YLAA 1HX0A 1CWYA 5FOOA 4JFSA 1FFQA 3BVUA 1ECEA 1BVZA 3CBWA 1Q6FA 1ZS2A 1JFHA 1V0KA 5JIPA 1X6NA 2YFOA 2XVKA 2XGIA 4HMCA 3MI6A 4P8XA 1HJQA 1CNVA 2D3LA 2JIEA 3ZJ7A 1WE5A 3RIKA 2WMJA 3A22A 4WSKA 3S5ZA 8CGTA 1MQPA 2G8ZA 2FHFA 2WC3A 4H04A 1EOMA 2DPEA 2WXDM 3MMWA 3CTTA 1JF5A 2GJXB 4NF7A 1V03A 1UWSA 3WDJA 3NIYA 3B8SA 2WC4A 2OWXA 2UY5A 2DH2A 3TTOA 1HJVA 5DT5A 4BA0A 5E0CA 3AISA 3HU7A 3BAYA 1XYFA 4P8WA 5A2BA 3POCA 3K8KA 4GQQA 2PB1A 3IANA 2VOTA 1Q6DA 4KMQA 4JZ5A 3CHEA 1E5NA 2WHJA 3D51A 2IXUA 2F1AA 3A4AA 5EB8A 3AIUA 1H2JA 3MV11 1WAWA 4NRSA 2DIEA 1PEZA 2JEPA 5JBEA 4PTXA 5BWFA 1B1YA 3LX9A 1JF6A 2EBNA 5LYRA 5A95A 4F9DA 5BRQA 1W9BM 4CU8A 1FHLA 3IJ9A 1GVIA 1VAHA 2VR4A 3K46A 5D9OA 4P8VA 4CD5A 1E4NA 4H2CA 3PN8A 4W7WA 3N15A 1US2A 2B31A 2UY2A 4P7NA 3VIHA 4D6EA 4AD3A 3AS0A 4Z2GA 1E55A 1GOOA 2G3NA 4WJXA 2WSKA 5BYWA 2YBUA 2E0PA 3VGHA 4P7QA 1QW9A 4HP5A 4WF7A 3UR7A 1NWUA 4URIA 3QOMA 2DEPA 3EDJA 3S5YA 4OUEA 1W1TA 1GOIA 1W9DM 2JF6A 2WVUA 3AHVA 1UKQA 3CMGA 1HVXA 5FCZA 1HN1A 5FL0A 1G5AA 1W9UA 1J01A 3EDEA 1VENA 4UZUA 1UWUA 3BXWA 2VZTA 4UFKA 2J78A 1UD8A 3IAQA 1XH0A 3EJRA 1LG2A 2YL5A 3ZT7A 1UD2A 1EHAA 2EEXA 1E40A 3VGFA 1RPKA 2E9LA 2VT0A 2VX4A 3WY4A 1QI2A 1VFMA 4JFTA 1S46A 3GBEA 1R47A 4AZ5A 2QPSA 3EBVA 4R27A 4AMWA 3WD0A 2WSPA 2JIWA 5IFPA 1JAEA 1CYGA 1J0YA 6CGTA 4HZ7A 3OGSA 3SCNA 1KQYA 2XUCA 3PTMA 2E3ZA 2WWCA 1KGWA 2WCSA 2QMKA 3VM5A 3FNDA 4DUVA 3EJTA 5A6MA 2FGZA 4XZBA 3KE0A 2NW0A 1DWGM 3CMJA 1C8QA 4UQCA 3VDHA 1D3CA 3DX0A 1J9YA 1OM0A 4AZ7A 4CU6A 1JIBA 1A3HA 3GTNA 3HJEA 1UKSA 3VGBA 1QX1A 2V3EA 1UR4A 1HF6A 2AOSA 4ZE5A 1VEMA 3BVTA 3TOPA 4JFUA 1R7OA 4AMCA 3H54A 1EIBA 3QHMA 1JZ3A 5GQBA 4XB3A 1JZ6A 4U3CA 3OLEA 4MPKA 1CXFA 3BAKA 3WH5A 4LYRA 4V28A 1JZ7A 4M1RA 4GZEA 2V3DA 1JFXA
chains in the Genus database with same CATH superfamily
3ZR5A 5EMJA 2MRYA 4WKXA 3SE6A 3U7YH 3GI8H 1I1YA 3ZDZB 1W6LA 2OSWA 4WVRA 1AG6A 4R4ND 3B9DA 5IMLB 2HB0A 3ARFC 4PLKC 4X22A 4IG2A 3QR3A 5E4AA 3QHTC 2L04A 4IISA 1QI3A 4K39A 5EYWA 4I9XA 1DDHA 1F9CA 4MNKA 1F2QA 1L9TA 4BSVA 5FJUA 1HKWA 3JYBA 1Y6KR 2ATMA 3KBJA 1AW5A 3SPIA 3GZPA 3W1TA 4L9YA 4L64A 3QDJA 4YGVA 3S6CA 4Z7NB 3GDCA 5FECB 3ITXA 1G7UA 1OP9A 2BS9A 3C0SA 3QDMB 4ZT1A 1KULA 2HVNA 4FQHA 5ADPL 1EGMA 3PCYA 4HGWB 3QWOA 1SEBA 3O4OB 1OCQA 3I6EA 2A77L 3GUWA 4ZUTB 3AUWB 1XQKA 3K5RA 4CLMA 1HXJA 3A67H 2BVQB 4U1LA 1OOAA 2NPLX 2GJZB 4KJWC 3S35X 1EJ6A 4PJBF 4FLHA 5JIDA 5CSBA 4Q32A 1U8CB 1GONA 2X40A 3M88A 1KY7A 2GSIA 2Z6IA 1TKWB 4WNQA 3AZRA 2A2QT 3SKJL 4TQTA 3IF1A 3MLUH 4M0XA 3RPIA 1BGGA 1XF2A 4NO0D 5F21B 1JWMA 1XWVA 3V5OA 5B4MD 1OGAE 3CIXA 1BQUA 2ADJB 4FL4B 3LJ3A 3HMWH 3PWNB 3CH8A 4F9PA 4WEBH 2NZLA 3DX1A 1X1NA 5JYMA 5CD5C 2PP9A 2BP5M 2W6RA 1M2OA 1Q6EA 3QC3A 1HZHH 2VUKA 4FERA 4MMZA 3W39A 5LKYA 4KXBA 4V1DA 8A3HA 1CI3M 4PVNA 3KYKL 2P3ZA 1AGDA 1UURA 4CGUB 2X1OA 4FQXB 3GLDA 2H32B 3BUTA 3W75A 1NBZA 5L8JB 2NXZB 1RZMA 1EFZA 3BT0A 5GXBB 3CDCA 4BYHA 4XWGL 3EH5B 3VMNA 4KQ0A 1S2EA 1IIIA 4QTFA 4IG2B 3GEWB 4YX2L 1NCCL 1SN2A 4PW9A 4DLMA 3LV3A 1NKOA 1R3RA 4IOTA 2VABA 5GZND 5FAGA 5E6ZA 4EE9A 1T1WA 1RAKA 1RV8A 2ZX5A 4PWHA 3BGGA 3SDAA 5BXSA 1ZCRA 3QDJB 2E46A 1XEUA 5JNYB 3GRIA 3I6KA 5FF6A 2ADYA 4FQHB 1SFJA 3DKJA 3T42A 5FOJA 4GIPD 5C8BB 4IM4A 4DWSD 2G0WA 1E9OA 2J8HA 4KX8A 5M7QA 3TXAA 5AVVB 4XBPA 3W6LA 4MAUH 5TQ0L 4Y9OA 3KL0A 4E5XB 3HG5A 4O12A 2BSTB 3TTSA 1I2NA 2GSIB 3LKNA 3VWJC 5E2UL 4U33A 4EUPH 3ARBD 2GC7C 4WNQB 3D4YA 3TGXA 1C7TA 5AWNH 2PCFA 2ESCA 1U22A 1TRIA 5CLTA 2PDIA 5K3VA 3RPIB 2XSXA 3L1OL 4FQQB 4M43L 1L8NA 2ATSA 1B5TA 4M7TA 4V27A 4LDEB 1DJQA 4YQXL 1E0TA 4WY0A 4H8PA 4KUZL 5HJBA 3RZCB 2LHAA 5FXCH 3FYEB 2CZVA 5A6IA 2O5XL 2Q76B 3O8XD 3OKKA 3RAJL 3W4RA 3G5VA 5IVOA 3CFJB 3X2QB 4S0HA 2CLOA 5IBLD 3VYLA 4JFFE 4ODHL 1GKRA 4V1DB 1G01A 2PS2A 1AGDB 1ORQA 4L18A 4GG6F 3FYPA 5GS2H 5IOKA 4ZXBD 4P46C 4PGJA 1QZ1A 3NQFA 5KJRH 3EJYC 1P7KA 2RGLA 4UQIM 5DTFA 4IRSA 1FZOB 2VIRA 5T3XE 3G5EA 4AL8C 4PAZA 1T1WB 2TSBA 4M93C 1A25A 1AIFA 3QIWA 1TJIL 1LG1A 2CWXA 3N43B 1O5DT 1SFDA 2QKFA 3S8HA 4YXLH 4W93A 5B1CA 4UM9D 5FF6B 2WJ7A 4NKIL 3EBHA 3MXWL 4U7SA 1NGZA 3VYNA 1C9DA 1WDDA 2JXMA 3RYMA 5I66A 4X80H 1RCYA 1E9OB 1NGQH 2G3ZA 5IVZB 1JCLA 3AYSA 3MTWA 4NM4L 1L6FA 3W53A 3W0WE 5D72H 4FX7A 1JHKH 3FRPB 3U9PL 3UBHA 1TOXA 4ZYKA 4EIUA 1W5NA 1DXFA 4BA8A 3WAKA 3DN5A 3LKNB 2V2HA 1X5AA 1XIWD 5BZXA 3NZGA 1XCTA 4PLOB 3DFQA 2VLRE 1LHZA 2OGJA 3AHZA 2WBJD 1RH9A 3EAKA 3L21A 2YW4A 2PCFB 1X39A 2PRMA 3KLHD 3NCBB 1I8KA 5K9CA 2FEDC 1CDUA 1OF6A 1OM3L 4PEEA 3UTQA 3K81A 4KEVA 3BIAX 4NQCA 2CO3A 4HBCL 3G5ZA 4NIRA 1NGPH 2OCFD 4WY0B 3S3DB 3CZLA 1JPGA 3V6FB 5JPNB 1TQBC 2PMZA 5CR1A 3W7RA 1ITQA 4MB5A 5GIRB 4QFUA 2DLTA 3D0LA 2Y85A 1D6VL 3G5VB 1KDIA 3WIIL 4HWEL 1HKFA 5I78A 1NOUA 5EV7A 2PRLA 2HUHA 5FB8A 3PXJA 3SDXA 4OFPA 4DJFA 1KB5H 4DFIA 4JS3A 3IMSA 4PTWA 1ORQB 1KM4A 3CEUA 2FYVA 4OLZH 3HQNA 1KGXA 2H0EA 4TF4A 1DJNA 3UIZA 2PYFA 3KOWA 1R1CA 2AQPA 1GOFA 4XPFL 5ERWB 3LERA 5AVZB 3CC5B 3OKEA 4ECLA 2QW5A 3TPKA 2Y36L 4W70A 2RBLA 4P7LA 1LQ2A 2O6DA 2YXXA 1R86A 2BP0A 4K8RD 4QHLA 15C8L 1P7KB 2MPVA 3RCMA 1IEVA 4DKAA 1BFTA 5DTFB 3CZNA 4LCUB 1N0XL 5KVDL 3U1SL 1DIDA 2YX0A 3N1FC 3FQXA 2VXNA 4I0PC 4QI3A 5DEGB 4X83A 2ESVA 1JV5A 4OVVA 3S8FB 4R7XA 2YBRB 1WB0A 4YC2B 4XNYH 2JXMB 5I66B 5C6WH 4Z7UA 5FEBA 1I4FA 3N1GC 1TB3A 2ZUSA 3L48A 3MXVL 4HS8H 4U1KA 4K23L 3APMA 4H4IA 1KB9J 4D71A 4TULL 1OAJA 4TUOB 4Z3FA 4ZYKB 5LLIC 5IW1B 1JGDA 1O75A 4D72A 4W8AA 3FU8A 1EXGA 2N1TE 3V1PA 1QEXA 3PANA 4K7PL 3N6HA 2VZSA 4GCXA 1HTIA 3VXOB 3LV5A 1BXNA 5EU9A 2ZIDA 5KEZA 4ZMOA 2EXWD 4ORZC 4Y19D 3B83A 2F53A 1E4XL 5AW8B 2HRGA 3ZHDA 4LF1A 1BTMA 3G5ZB 3I6SA 1NMAL 1JZHA 3L1EA 3VQMA 1JPGB 5LNSA 4DGIL 4ZOAA 3PZIA 3HFYA 4LMQE 3FFOA 3VXUE 1SDAB 3ATDA 5SX5H 3FUIA 2PWFA 4WFHE 2J7FA 2EIJB 4HQQH 4LSBA 4WWID 3RNDA 3IMVA 3OZOA 4N0FA 4LRTA 1I2RA 3DG6A 7TIMA 1TVBA 2C15A 1FN4B 2Q8ZA 5IWLC 2Z9TA 3FB5B 3L3HB 3RIFF 1UR8A 1PTDA 2E67A 2CQVA 3LQMA 1RJQA 1XF4B 3BH4A 1NTHA 4RFNC 1A3XA 2PYFB 1QTPA 3S0PA 3MKVA 4YTUA 3OKEB 4YSAA 3CHRA 2XWRA 4Z78A 2BP0B 4NNYB 2JB5L 3TYFA 4N2LA 1B4KA 3CYJA 3VM7A 3LQAC 1FORL 3M1CA 3E74A 4LEFA 2VDIA 3BVWA 2XTJE 1PLBA 4KRNA 3FQXB 3FQRA 1JUEA 1UR0A 4YHLH 3IJEA 2ESVB 1G9NL 5KSAD 1JV5B 1CGTA 2O93L 2OT0A 4LPUA 1PTGA 3I7QA 2FPVA 1QHQA 4HS6A 2EZ0D 1I4FB 5ECJE 3WI9A 2E76C 4FQIL 1TO3A 1GG1A 4M7JH 2EPHA 4A22A 3QJTB 1HXYB 2AMXA 3THUA 1I8MA 2W81C 4N0YH 1D9KA 4O4YH 3L3IA 4HIBA 4U1GB 2YAOA 4CNIA 3CX2A 4OKVB 4LVNB 1UYWH 3HHSA 5G5IA 4PCPA 3SUUA 1JZIA 3HNTH 3C5SA 4JFPA 3TH3T 1W8GA 5CD3A 1JVNA 1ML1A 3D33A 1XKYA 3QIUC 4JN2B 5D7EA 1FWAC 3GC5A 2Y5JA 3S37L 1SM3L 1YPFA 4LIQE 5C7VA 3THDA 2XTJC 2B0SH 2OMUA 2XXFA 3WLQA 4ICMA 4JFXA 2EE3A 4FFYL 1YPZE 3PHQB 2X10A 2EKCA 2DICA 1KFKA 1O4UA 4REQB 5MERA 1DVJA 2BV9A 1RCOB 2X8RA 1VPQA 5AW0B 1IRAY 4X2UA 1HYRC 5HUOA 3HLAB 1ZSHA 3MJ8A 1DQML 4JDZA 2E27L 2Z7UA 4QWWD 3WLWD 4N0FB 4GXWA 4W5ZA 4PTTA 1TG7A 1WIOA 5FV1L 4RUBA 3RQ3A 1XBDA 1QASA 2B2XH 3IYLW 4KWOA 4FZEL 3TO2A 2GWNA 5GRJH 4YHYB 4GXVL 5IY5B 3M47A 2QVHA 2YCIX 2QYGA 1TG8A 25C8L 1GVFA 1IX2A 3I3DA 4UTIA 4DP5X 3KP0A 1FCQA 4DF9A 4GACA 4XNBA 4P9MH 4Z78B 3HHRB 4MZ8A 2XXGA 3BD3A 1WWWX 1EH9A 5K1VA 3LI1A 4CVZB 5CKGA 4MMZC 1VLIA 3OO2A 3KVKA 3VRJA 4G3YH 5DJDA 4MAYD 1X1ZA 1FZJB 2WJ5A 4PJEA 4XX5A 1UG9A 2OV0A 3LN3A 3TF4A 4GUIA 3IJEB 1E4MM 3FEMA 1Z66A 1MRFL 1TR7A 2DWSA 3LEXA 1TV8A 3K2MC 3P74A 4XMKL 4ZFMA 3EO9L 4G5AA 1EVUA 3S96A 4HS6B 2D22A 1I1RA 1P7BA 2WZ6A 1VSCA 3O6DA 3BG3A 2XTSA 3AC0A 5IHHA 1NDGA 3N1AA 4ATWA 4EXAA 4MTMA 2KH2B 4W9DC 1FNAA 3BWZA 4HEPA 1I8MB 3L3IB 4LCIH 2CMRL 5AOIA 3EB2A 3SDAC 4JRXA 4RKAA 1YKWA 3ARGB 1G1YA 4EBQL 3CIWA 2J88H 3HHSB 5ADPH 3QLLA 3C5SB 3LVEA 4NQDE 4JFPB 2A77H 2Y6ZA 4WI2A 3BWAA 4Y4KD 5DUJA 4WXYA 3SQMA 2EDJA 4HLEA 2B15A 1XV8A 4U2YA 1A6ZA 1H19A 5LVEA 2YD8A 2BVYA 4LP5A 3ECQA 2ALWA 4J3OC 5B3SB 4A4AA 4DYEA 4JBRA 4KZDL 5MERB 3RWCB 1KEGL 5T1LD 1FWCC 1XB8A 4F2BA 3F12A 2VC5A 3ISWA 2DW5A 4YHZL 2LQRA 2RDTA 5DX7A 4PTTB 4P5UA 4KERA 1DANU 2FPTA 2XX0A 1ORSA 2Z1WA 3FB7B 3UD6A 4DB7A 2F8QA 1PE1A 4APXB 4MBRA 5CPTA 4JFWA 1KRBC 2O6CA 5SWUA 1L9OA 4J28A 5F9WB 1KV5A 3QFJA 2ZZ2A 3TCXA 2PLKA 5I71C 3EJPA 3DROB 1UKTA 4MA3A 4Y9CA 2RR3A 3KYKH 4L48A 4CSTA 5DHVH 3KCLA 1IEBA 5LGKA 4UQDA 1AS7A 5GGRA 1IZJA 1LQSR 4ZI8A 3DX4A 1GXEA 5BRZD 1OFQA 3OBKA 1RJZB 2BP3A 4GUGA 2IQ0A 1TF4A 3ZSSA 2ZUYA 1EVTC 4XWGH 2WAHA 2WUBH 4YX2H 1BYBA 1NCCH 1AZVA 2X38A 1NC2D 1YEHH 5E1QA 5CINL 3QYQA 4WUKL 2DJ4A 3S96B 5D38A 4EAEA 5AVQB 3I75A 3LMZA 2YAFA 2ZKHL 1NDGB 5ADOL 5FUOL 4IRSC 4K5NA 4LLVA 5CZVH 2AJSL 4PWIA 3FHQA 5CP3A 3IGAB 2VW4A 3HZ3A 4NQCE 1YN7B 5I30L 5IG7A 4JRXB 4XK2A 3QIWC 4EVNA 2GIYA 4KKCD 2Z31A 3PBGA 4PJHF 3B97A 1GYMA 3GSUA 2VLJB 2DLFL 3E0FA 4RNRA 5TQ0H 2BW4A 2MMXA 4ZSOB 5HYJA 3QXDA 4NJ9H 1K4CB 2W62A 4W88A 2XIQA 3LYEA 4PRID 3SDXE 1TZOA 2HWZL 5E2UH 1HUVA 5GZOD 3TCEA 3DC8A 3JTTA 3QI9D 4PS7A 1WUNT 4BK8A 3DV6B 5D6DC 2QBWA 4DP0X 3CBWA 2NUPA 1NBCA 2Y0SA 5TE4L 4PRPA 3L1OH 4M43H 4PB9L 1A4MA 4YN3A 1JJKA 2WXDM 3CTTA 1FBIH 1ES0A 4LUTB 4NF7A 4YQXH 1T8QA 3TW9A 3AT9A 2UY5A 3CH0A 1JGLL 1MFDL 1PYMA 3DXAD 3JBG7 4ZS7L 4KUZH 3A6BL 3DSNA 1N12A 1GC1C 4JZ5A 3KDPB 2O5XH 2HFEA 1HFUA 3RAJH 4BGLA 3ZKND 3QFJB 6XIMA 3B7UX 3CVHA 1JF6A 5FKPB 4ODHH 1LO4L 5D7IF 2ITDA 1EBPA 4Z7UE 1RZFH 1GVIA 2VR4A 4A2LA 2PO6A 3V6ZA 4DJEA 4NJHA 1J5CA 3SSZA 1YYCA 2YGNA 3B0PA 3ATFA 1Y1DA 4P7NA 1YLVA 4NQVA 4DJFC 5F89A 2QQ6A 1POKA 2YBUA 2ZQKA 3OZ9L 5F96H 4Z3JA 1QRKA 3P82A 1PUDA 1T5AA 4OJEH 3MPGA 1NDZA 1AS8A 3IMWA 3FQNB 2NXIA 3AALA 4HHHA 3I75B 1KNOA 2GBTA 4NUJB 3WS6C 2A73A 3EWYA 2GHWB 5FJJA 1IT9L 5ECVA 4ZMQA 1AQDB 3AU1A 2A21A 2OMTA 2F53E 4TUJA 1AZ2A 1BA9A 5IFPA 4NKIH 3MXWH 5IG7B 5C7XL 2YXVA 3SGDI 4EVNB 4LCWA 3FT9A 3M7OA 2Z31B 3RWFA 1AIZA 5A6MA 4QHPA 3DRQA 3X3GL 3KE0A 3WIAA 1QR1A 3SJVA 2EIKB 3G5YA 2HVKA 2V3EA 4RNRB 2K6WA 3CNKA 2WQPA 3U9PH 3NQDA 1FSKB 3INUH 4GA8A 4DNHA 3MREA 4M62L 4ANUA 5C0RL 1OSYA 2UZYB 3EG9B 1HOCA 4LV4A 3F05A 4HWUA 2NUPB 3SRDA 4AYEC 5FA4B 3T4AA 2NW3B 1Q13A 1OM3H 2IPUK 5KAQG 3V79C 4E3VA 1F6AB 1FHUA 1IAIL 2Q3OA 4L56A 1Y6MR 2UX6A 5HTSA 3BGJA 4O1EA 1ES0B 4HBCH 4I4WB 1TJ1A 5J11C 1T0MA 3P81A 4YBHA 2OQJA 3HE7D 1RY8A 1A4KA 2DF3A 5AOMA 3ARQA 5KVGE 3HMXL 4LY8A 2FX9L 5A6KA 2HFEB 2R29A 1ACXA 4OJAA 4KOCA 3IDNA 1J8KA 3GHBL 1DN0A 3CVHB 1O5XA 4DPCX 5E70A 2BHYA 2VMFA 3O9WB 4F3HA 2ITDB 1HHIA 5A8GA 1UPMB 4DEFA 1QVBA 3GE7A 2HTKC 3EYSL 3ILQC 2YD4A 3UTTE 3VTAA 3FGCA 3QWRA 1JZEA 2HEJA 5F89B 1MZZA 3ZJAA 5I1JL 1IL1A 5E6YA 4XPFH 3NO3A 5HOSA 1NARA 4K1WA 2Y36H 4US5D 2BNQA 1A6AB 2IQAA 3RVXC 3VABA 4XX6A 2BIIA 3FY1A 3D2UD 3VO0A 4NZ3A 4IFRA 2IS7A 3O0LA 1KNOB 3MQTA 4ZBCA 1UKOA 3QPQD 2W07A 4O9HL 4U6YB 2B16A 3AU1B 1F3XA 2C9PA 1XYCA 4U7KA 2R2HA 2WXIA 3BQUB 4WHCA 3B2UD 3RWFB 3V4VH 5EBWA 3T8XA 4DNMA 4NCDA 3B04A 3JVAA 1FY6A 1QR1B 5FGRA 3G5YB 2DJSA 4AVNA 3U79A 1HH6A 4NQEB 4K23H 3MTXA 2V8ZA 3EWZA 2BSRB 1JYVA 4KNQA 5KS9A 1LUCB 4TULH 4MFHA 1PEWA 1G7QA 3U0HA 1HZHL 4O28A 2I7GA 4QRPA 2J7HA 3MQIA 4LKCA 9PCYA 1W0VA 1D9KC 3NCFB 4KZEL 3L9BA 4RE4A 1XISA 2YPVL 4LCCB 3W9DB 3TQ0A 1JWSA 3ARFA 1VB9A 3C2VA 3T4AB 1YRRA 3QULB 2EKSA 3KVJA 3Q13A 4HIJA 3K8LA 1HHHA 1E4XH 4NGHL 4U0RC 4CD6A 2LAAA 3V0VB 1R87A 2WIMA 1A47A 1B3XA 1O95A 3SZ8A 1Q9OB 1NMAH 1T0MB 2ARJQ 4XVJL 1ITCA 3HR5B 4DGIH 5HHOA 1IT8A 3LCFA 2OQJB 3TC7A 4HHWA 3MSPA 1FUNA 5DO8A 4FTVE 4PJEE 2FTWA 1A7NL 1CICD 3ESNA 1QOPA 4UINL 5E5LA 5C3TA 4QLWA 1GUVA 1HYSC 2XETA 4WFGD 1DN0B 3NABL 5DJ8A 2Z0UA 4EAMA 2ARJA 3EYFB 5ANME 5L6UA 4LFYA 1F6FB 4FXLA 5CGMA 1SZEA 4LPCA 3WH9A 4JFHD 9RUBA 3FUMA 1N8FA 5PCYA 3N85H 2WWKO 1FWEC 3FGCB 2J2ZA 1VFFA 4OZGB 2GOKA 3RFAA 1IL1B 4H83A 2VP8A 4FS0A 1NUGA 2FE0A 3SRKA 4EXKA 1W8EA 4MNJA 3IARA 2JB5H 4BEUA 4R5VA 1PWMA 3EWCA 1FORH 6PCYA 2G95A 4G9PA 1YJDL 5A2AA 1O7DE 4Z3GA 4J23A 1Z69A 2WXKA 4QAIA 2F1EA 1G9NH 2D7NA 5AUMA 4PJDB 2R2HB 4FOKA 2JH2A 2ZE0A 2AJVL 5I28A 3UZXA 1WXJA 2WUCL 1K5NA 2QJGA 1A0DA 5EBWB 3T8XB 1ZFJA 3ABQA 4XVSL 4I9MA 1J8SA 3VG9B 3VK5A 2XQ0A 5CCKL 3UZQA 4FQIH 4HHGA 3EDDA 5D7HA 4MJ6A 2IFGA 2DYSB 3L12A 3W7LA 1G7QB 1VLXA 1D5RA 1J96A 1W0VB 1KN4L 1XAUA 4W9JC 5I1AA 2K7QA 4Q4IA 3QQXA 2KT6A 5CIPA 2VDRH 1JWSB 2YMTA 3ARFB 2DIBA 1WFTA 1BQGA 4N0UB 4N8VG 1SJBA 4UU9A 4KK6C 5LNRA 1HAUA 1O7DC 2H3KA 5KJRL 1R17A 5EB9A 5DGQA 4FFYH 3W2NA 3CXDL 3SDCD 4JFOB 1TWWA 4V15A 5L2KD 1G0CA 1XLJA 3AZTA 3N9RA 4JDVB 4GKLA 2E09A 1J0IA 4DKTA 2AS5M 5G2HA 2J79A 1DQMH 1RUML 2E27H 4XB7A 2X2JA 5DJ8B 2B3IA 4XNXL 4L8BB 4FZEH 5I0ZA 3CUJA 4LAKA 4OAWA 5HYEA 1LOSA 5XIMA 4GXVH 2XH7A 5GGQH 1YNTA 3EH4B 3MRFA 2DDQL 25C8H 1CQYA 2XNAA 4HN4A 3ZRSA 2DMKA 4N02A 3H6OA 2J2ZB 1A4AA 3UXAA 2YGVA 5LGHH 2XY1A 4HPHA 5FF4A 4AIBA 2WZ5A 1CIDA 1AODA 2I85A 4R2GC 2WZPD 3QV6A 2GVLA 1EJSC 3QS3A 4FLSA 1ZV5A 3H3BC 4XB8A 3CU7A 1W5PA 4UTBH 3G9AB 2ACUA 2LU7A 2VO5A 1KXVA 5HYJE 1U4FA 4XWOC 1FYTD 3CHCA 1NGWA 1MFBL 1HC1A 1MRFH 1OGTA 5AUMB 5F4XA 3N50A 2BB0A 1TMLA 1LORA 3EO9H 4OOZA 5BO0D 2AJUH 3I74A 2EO9A 4XVUC 4GRWH 1K8ZA 3GIPA 4BWUA 4GVIA 1GJUA 4GSDL 3PULA 3GTTA 3UZQB 3B9KA 3WBWA 1ZPLA 5DSCA 4PRPE 4MJ6B 3QH2A 3KXQA 2UV8G 1XJBA 2CMRH 4EBQH 2LE9A 5IRPA 4IPJA 3BW3A 1KYAA 1R5VB 5JQIB 2V2WA 6XIAA 3ROOA 1RP8A 2E7DA 1E9PA 4OLZL 1E0UA 4DWHA 3KRUA 7FABL 3VNMA 3PG9A 4YHKH 4WFFE 4G1EB 2AQNA 4NUGL 4TO8A 1OGAB 5FYJE 3SRFA 3A13A 4S3KA 1QACA 4DPPA 3Q2VA 5G2WA 1T83C 3W01A 3ZGIA 2H9GA 4KZDH 4MQTB 5GRXG 1KEGH 5EBAA 5HGDA 3GXUB 4L0YA 2P48B 3A4DA 3IBEA 2VC2L 4YHZH 5T8GA 1JDCA 1P4UA 3QHFH 1S2AA 2ZXDA 1I3UA 3CCHA 5AC5A 1ZTMA 3LTSA 4U1IB 4JFFA 1HP4A 1OEPA 1AFVL 2F74B 3BPLC 2Z8RA 1OSZB 2QIWA 4TX9A 4RRPM 1J6PA 4YK4C 1E6QM 3VWJB 4ZMAT 1E56A 4KKZA 4RA0C 4LCWE 2I5GA 4ZGYA 4XH2A 4V1XA 1BVLA 4KNUA 3SJVE 1NCAL 3RGVD 2FDMA 3AWNA 2CR0A 1QHZA 1T6VN 1EZLA 1MCKA 1NFIA 4JW3A 2H3XC 2PO6C 4DJEC 1L9SA 4AB4A 5DRNB 4NOFA 1NGWB 1IM9A 1OGTB 1GGIL 3RFZA 1ZT4A 1UBSA 3P62A 4XXWA 4ODUA 1NTDA 1MJ8H 3ITCA 5CINH 4WUKH 3PAVA 4Y9FA 3BSHA 4FXKC 4X6CF 2WYIA 2REQA 2ZKHH 4OR1A 3VFTA 1Q45A 1MZHA 1AYOA 5ADOH 5FUOH 5FKYA 3B9KB 5DSCB 2EXYC 3W0WA 3G0SA 4UNTA 1T03L 2YOAA 2AJSH 3H7RA 2Y7DA 3UA4A 4JQ4A 5I30H 2LLNA 4X98B 3QUMA 4JFQA 3HQOA 4C5ZA 3LS5L 3BANA 3D50A 1F76A 5F0MB 3ROOB 4QRUA 2VLRA 3HC0A 4P46B 4GUJA 1KC5L 2FSEB 2DLFH 1TJGH 5BJTA 5CCHE 2Z0IA 1H7RA 4AISA 1XXDC 1G84A 2J9YA 3SPJA 2QVNA 1BWWA 3F03K 2HWZH 1RJYA 3HPZA 4LLDB 1XZWA 4M93B 3IU3A 2PWGA 3LKQA 2VX5A 4I0PA 2NZ9C 1G6RA 3SCOA 5GS0H 5HGDB 3FCTA 2J12B 2EIMB 3SBQA 5TE4H 4L37A 4PB9H 2BNQE 4I7VA 4C59B 3CCHB 1XF3A 3NVTA 1U8LA 2RA1A 1O5PA 4JFFB 5FHAH 2DWEB 2XM1A 2C1GA 5EEVA 1JGLH 5I6OA 1LP9B 1CGVA 1MFDH 1ZP4A 3TNMA 4NB7A 2YARA 2PABA 3A6BH 4XMUA 2X0HA 4YVUA 1ZTXE 1A5MC 3H6JA 1QLFA 4M7JL 1P0DA 3Q01A 3MLSL 3EJJX 2F5AL 3ZUNC 1N82A 1OHLA 1GKEA 2FWLB 4WUUD 1JXDA 5I00A 2DLGA 1BVLB 1GAFL 5FL1A 5DT7A 4DBDA 3DVNA 1DPMA 5CJOL 1XIIA 3CZUB 1NFIB 5CKSA 1T99A 2YCLA 5KS9E 1ZIBA 3H8NA 3OZ9H 1A4JB 4MGGA 2NX5E 4U3SB 1IM9B 1TQBB 5HJXA 4HLJA 1M7IB 4QRPE 3BKYH 5JA9A 4HNOA 2YJQA 1S4IA 2H9AA 1XBYA 5DURB 1OE2A 2YEVB 3CSTA 4EIGB 3MUCA 5DGRA 2FBRA 4UTJA 2I9TA 5AHLA 4N1HB 1IT9H 1NSJA 3W0WB 3DLQR 4WNSA 5IWLA 3RTQC 3O4LE 2VRAA 3W2DH 4L8SA 3U9IA 5C7XH 3QUMB 3AS2A 2DORA 1MCWM 4ODSL 5HHOE 4AJYV 1L3WA 3X3GH 3IE9A 4MZ3A 4N85A 4QRUB 2VLRB 3GM0A 3HC0B 4QHMA 2WJZA 1XLBA 5BJTB 3TBSB 2CCLA 3T6ZA 1M03A 1QLRA 4MYXA 4P9ML 3AXHA 3LIUA 3D7PA 1ISYA 5C0RH 1RJYB 4F8XA 4LNYA 5J1TC 3LKQB 3SCRA 5AALA 5ALCH 4I0PB 2R1PA 1G6RB 1DE6A 3BPWA 3M1ZA 3VKDA 5ICXB 4G3YL 3VXUA 3ENEA 5I17A 4UNUA 3NFSH 5DJCB 4L37B 4WK9A 4ONGL 1IAIH 4Y90A 1S7SB 3RKPA 4NJKA 1XF3B 1BYCA 1HO1A 1U8LB 5T5FL 3WLRA 3TLQA 2O4MA 4A2GA 2EDRA 1KCUL 4ZQPA 4HUNB 3ZL1A 1J18A 5G4WA 2EE0A 3HMXH 1WTGT 2FX9H 1QLFB 5JIHA 5HYIA 3OJ2C 1T7ZA 3GS0A 3GSNB 4JY4A 3UWZA 4MCNA 1Y18B 3GHBH 4Y1AD 3FT1A 4UT6A 4TL4A 2FJHB 4LCIL 1RD5A 3IVSA 3NRPA 3O6FC 5DI8A 4J3TA 4QPEA 2J88L 5F7YC 3DMMA 3QIUA 2QPDB 3EYSH 2RD0A 1BP3B 3RU8L 1UXWA 4J12A 2G2PA 1ALDA 3URBA 3WV0A 4AQLA 1J5OH 5I1JH 4DJDD 4IHCA 2AF2A 1WIUA 2E6JA 3G1DA 3L5LA 5DVMA 4L4TB 4Q4OA 4GC4A 3DBXA 2H9AB 4H1LB 2F9BT 3TAOA 4QLRA 1RJCA 4LW7A 2PYEA 2Y24A 5CGYC 4AKOA 4LL1A 2I9TB 4UANA 2LVEA 1ZSDB 5L4MA 3U5YA 3N91A 5LIUX 5AOJA 4WTQA 1CLXA 3QJFA 2FBJH 4O9HH 2F8VA 3V0HA 3CU1A 2XXMB 3SGKC 4B5SA 2HKAA 3QR0A 3MGAA 4D6FA 3CU2A 3BDBA 1WAUA 3V4PL 3L4TA 4D9LL 2XVBA 4RFNB 1KJ2A 1RK0B 3EO0A 5AEAA 4BFIA 2DY2A 1PTZA 2F7PA 4QHMB 1RQEA 2P5PA 4L1BA 4Y8AA 3VSUA 2WMKA 3H53A 4DGVL 2P10A 3HGSA 2J1WA 1QLRB 4F48A 1AI1L 3B2MA 3AAZA 2D4DA 4RZCA 2X70A 1JBJA 3IRZA 4G7VL 2VR5A 1KTJA 1YPZA 4KZEH 3O1NA 2INFA 3U1PA 4Z3IA 2YPVH 2YZ5A 5EMYA 4DPAX 1I1YB 3GINA 3VXUB 1HCYA 1PMYA 4OGXL 1E0WA 4KK8C 3NZPA 3NQEA 4JYEA 3E0GA 2WUBL 4RW5A 4NGHH 1IJ9A 1AKJD 4KVNH 5I19L 1HHGA 1YEHL 5I15L 1DDHB 4XVJH 1NMCC 1GZ1A 1UWFA 4BSVB 3IUDA 1PBYA 3GAYA 2CRZA 4JYFA 1A7NH 1CPUA 4UINH 4JY4B 5CZVL 4YGVB 2WAGA 4OFYD 4HOZA 5J13C 5DR5L 3NABH 5LAPA 1H8OA 3K30A 1TZHA 1FA2A 4XVEA 2VMDA 2GSGA 2ZXAA 3HBGA 5DI8B 4X5WA 1EDQA 3QIUB 1GOWA 1UUOA 3OQEA 1BF5A 3QWOB 2NSMA 1SEBB 1FWBC 2XTJB 1ZTVA 4WQOA 2H0JA 4M61A 3DH7A 2P8PA 4U1LB 4NJ9L 2DZSA 1KBJA 4B6ZA 3EOLA 3QB7C 2AI0L 5A3ID 4DT2A 1IFRA 3T2PA 1ESOA 3DBXB 2YXFA 4IGHA 1B30A 5B7YA 2QCDA 1ECEA 4RE0A 1YJDH 3IF1B 3EOYG 5C08A 3QJFB 5A7BA 1WE5A 1N59A 1XF2B 2VELA 1WWBX 1JWMB 3UP6A 2Z25A 5J06A 1JF5A 2AJVH 1KXVC 1FBIL 2WUCH 5GRYA 5G5DA 4HZAA 1S7XA 3VE9A 4XVSH 2ZZUT 4L1TA 4NQDA 3K8KA 3IANA 1Q6DA 5CCKH 5JPMA 2IXUA 3UXKA 1OSPH 3ZE1E 3MVSA 3D39D 2H6UA 3AAZB 1XCFA 3D0VA 5FFGA 5BRQA 1DBJL 3B9KC 1DE5A 4IOIA 3FQTA 4MMZB 3W39B 5EEXA 3ULUE 3AGWA 2G4EA 1RZFL 4PJ5D 1KN4H 1YPZB 4UTCA 4AITA 2APFA 4Z0BH 1MCEA 1NBZB 1HE8A 1W1ZA 4URIA 2DEPA 1WD8A 4ZDHA 5F96L 4LHQB 4M48L 3MRPA 1R0AH 2J6XA 4A2EA 3CMGA 3ILDA 3CSGA 1FCBA 5C92A 4MD4A 1OZTG 3CXDH 3LV3B 1W0WA 2VABB 1OV8A 2IEPA 3IGLA 4Z9KB 4AUJA 3MV9A 3O2DL 3SDAB 3CM4A 1RUMH 4PTDA 1EHLL 3OTTA 5EEUA 4AQEA 4HNLA 1RCXB 1TQXA 1UB6A 2J6EA 2HMCA 3I6KB 1TZHB 5J12C 4NEHB 1RAMA 2GSGB 4XNXH 3KPLA 4CMHC 4PJ9C 4FJ6A 3B1TA 3G1YA 3B8UA 3B7RL 2DDQH 1A3HA 1UKSA 1UR4A 4XBPB 4GUHA 5TDPA 4M61B 3ULUC 3OXSA 1VFHA 2P8PB 2V5BA 1S2WA 2JKNA 4UUJA 3INUL 1J1PL 2Y1AA 5IVNA 2V3DA 1K1DA 3BH8A 3MWCA 5D6DA 2VAAA 2EXOA 3MRLA 4ZO8A 4LVFA 3FTXA 4GHRA 5C09A 1IZCA 4QP0A 3AFBA 2PTUA 2A6IA 4LUSA 5EH1A 1AGEA 1N59B 3BCFA 4ACZA 3WNLA 1MFBH 2EUVA 1GWJA 3GYCA 3H22A 5G5DB 1S7XB 4X4KA 2E7FA 2Y7NA 4BF5A 4NQDB 3RFZC 1KBIA 1LL7A 4XXWC 1AKPA 4GSDH 5I71B 1X5HA 4YAQA 3OKKB 5F1SA 3GU9A 1XYZA 2JKWA 3RM8A 3D0VB 3V0GA 2COQA 2VGFA 3BI9X 3AICA 1YNQA 4MY8A 4YWSA 5AAWA 3ZDYE 4TN9A 1HNYA 2ALRA 4LZKA 1B4RA 3S3PA 1TPEA 3I9GL 3TN5A 2VUNA 3AMGA 3BW2A 3VUPA 7FABH 4QRAA 4ZDHB 1UGKA 2MUCA 3W85A 3SM0A 4NUGH 1L2QA 1OD8A 3WS6A 3BLIA 4AFYA 1PCSA 4MD4B 1I1AA 1W0WB 4PMFA 3V16A 1G43A 2AEIT 4IRSB 2NUXA 2OPCA 1FYHB 2VIRB 1IXNA 2PFHA 3Q43A 1U91A 1JRBA 4J3BA 3KL5A 2X09A 1AIFB 1B4EA 2VC2H 3QIWB 3ZYOA 1LOQA 3LN5A 4ELMF 1JOIA 2P45B 4KXZH 1MUMA 3FU7A 1NGZB 5HQMA 3O3UN 1AFVH 2XQYG 3V4VL 3TJEH 2C19A 2ACQA 3FK3A 1LBFA 3S5LA 4Z7QE 1L6ZA 2EABA 1ASPA 5TDPB 3OXSB 1CXHA 1A8ZA 5D96C 1KTLA 2B4CC 1S2UA 3M46A 3KCPA 3G1RA 3GNOA 1XCTB 4JG5A 3X1FA 2VAAB 3T0EE 1THAA 1NCAH 3H85A 3ZY7A 1CGSH 2W38A 4ATLA 2GAZA 3P8JA 3IJHA 2KZBA 1Q6CA 1I8KB 5LIYX 2A6IB 4LUSB 1TPWA 1RVKA 1G9MC 1GHFL 2VYRE 3AQUA 1SMOA 3IU4H 2VSMB 3QQWA 3U2EA 3UTQB 3F2BA 1IGTA 1TQUA 3GBML 1GGIH 4L3FA 4U49A 4NQCB 5HPOA 3M5YA 1ANUA 2BWIA 4GZ7A 4EI0A 3BUPA 4IT1A 4OJYA 4WIWA 3UXDA 2XBTA 4DNLA 4A7UA 1ET7A 3D0LB 3U6WA 3BICA 5FYLE 5FA3A 1T03H 4YHIA 3MOBH 2FATH 4WJ5A 5LN8A 1M7JA 3EWUA 1D6EA 3VPLA 5FB8B 1HGYA 3SDXB 2AKMA 2BMKA 3LS5H 5C0AD 4L8SC 5E5RB 5JW4Q 1T66C 1KC5H 1SBSL 3N85L 3O41A 2EDXA 3RJYA 3L3OA 3DRTA 4NYYA 3L66A 2YOCA 3MUAA 3M6YA 4GJIA 2VMEA 2YQ2A 2F18A 4H8QA 5J57B 1B6UA 2WXNA 3CQPA 4ICXA 3KLAA 4YH6A 4QHLB 1E6XM 4UMAA 4L8DA 2EEAA 1OINA 2Y5SA 1U91B 3E1F1 1ZJIA 1YYAA 3TM6A 1GOXA 4ADUA 4BQ5A 1EJ7L 2YUWA 2ITFA 1TV4A 4DPQA 1A21A 3P3TA 2NX9A 3T3MF 4JHWL 1U92A 2CO2A 2ZG2A 3VI4A 2VEFA 4Z7UB 2PYEE 1J5DA 3S5LB 1BF6A 4H2HA 3GC3A 1OZUA 3UTTA 2OJEA 3SRHA 3BUYA 4K2UL 3R7QA 3WL1A 5U4NA 3MP5A 1DVYA 4U1KB 3MLSH 1KTLB 2F5AH 2YC1A 4PLJD 3FSVA 1T7XA 1JZFA 2L0DA 4O54A 1JGDB 1MVUA 3I9IA 5TQ2L 2DPKA 3C52A 4ZTYA 3WJWA 1MLBA 1GAFH 2ZZ7A 2QGCA 3TNNA 5AYQA 4H1ZA 2BM3A 5CJOH 5BV7C 4XX1G 2VDRL 2GAZB 4POCA 4UILL 1FO0L 2G2NA 3IJHB 3DMMC 1A9EA 3S42A 5J11B 2ZE3A 3C3UA 1WA0X 2HYMA 4EDWL 1AD4A 1UT2A 4K38A 2F53B 4OF7A 1TTJA 3TO4C 4HU3A 4QSFA 4AC4A 3B8TA 3ERXA 2NNAA 1PDKA 2BRQA 4QIRA 1IARB 4PUDA 4P3DA 2WTPA 3PU7A 4RBPH 4A8NA 4FF9A 5FOBA 2UZXA 1DWJM 5AHFA 1D6EB 1TVBB 4HJTA 4N42A 2BMKB 4ODSH 1XB6A 3MYZA 5GGQL 4EDXA 4OKDA 2TAAA 2RACA 4IIEA 4H0IA 2JKTM 1FF5A 2IAMD 5LGHL 1KCRL 5C7ZA 1NEZA 3VD2A 2F8OA 4OCLC 1TWZA 3TYFB 5D2XA 2WMHA 3CFTA 3UH8A 2PDGA 3W27A 5CM1A 2JGYA 1QQDA 2OW7A 3QOKA 1RSYA 4UTBL 3KS0J 1E4JA 1T21A 2QSTA 4FTVA 1RD6A 3FQRB 1S9VA 3VXPA 1PXGA 4ONGH 1J8VA 1GNXA 2EO1A 3T2LA 5T5FH 1OCBA 4I7WA 3AG4B 1LK2A 4LARL 5ANMA 4HCGA 1WBXA 2NRDA 4TVUA 2AJUL 4NQUA 1KCUH 3IIXA 1G6CA 4PJAE 5C08E 5BVPL 3P5YA 3BUYB 4LAQH 4EI5A 3MSGA 4EVZA 3O6KL 1Q1JL 2AC0A 1C7SA 3WDIA 3S1VA 1D9KB 3BIBX 4OTXL 2WZIA 4M1GL 3DX6A 1AACA 3DUGA 1MVUB 4MS8D 4CNIB 3RRQA 3P9MA 3N42F 4N1CA 1TETL 2YD3A 3RU8H 3WQDA 3TNNB 5K1NA 1X5XA 5CD3B 4WOZA 1ZXQA 4GO8A 5A8PA 4U0RB 4G5DA 5AVWB 4NYUA 2QVKA 1V0NA 1TPB1 1UUQA 4ENZA 3FU0A 4YHKL 2PWEA 1YE6A 3WTVA 4K68A 2OMUB 4HIQA 3VYPA 3HKZA 4JFXB 3FF7A 1XH3A 2NNAB 4QR6A 1GEHA 1Z5HA 2OULB 1JMXA 4TM9A 1XGTA 1L8PA 4GRMA 1H3GA 3ARDA 1E0VA 1T6BX 4P3DB 2P24A 3FQUA 3BISA 2NLJA 2I5YL 3MJ8B 1NGYA 1J05A 4JDZB 2IW0A 1P0SE 2YDQA 2UZXB 3QHFL 4I0KA 3WAJA 3V4PH 4KDWA 4D9LH 3TO2B 1ZVYA 3L23A 1MCSA 2X28A 4NKDA 5IROD 1GSMA 3FSUA 3MV9E 1WAPA 4U5KA 4DGVH 3BJ91 5D70L 1AI1H 2PP0A 1IQDA 1NEZB 1VESA 5JPMC 5DRIA 3G1HA 3PQYE 1DL7L 1U21A 2BNUA 4G7VH 1BYAA 1NP2A 3GR7A 3SR7A 3VYOA 4NO5A 3VA6A 4I90A 3AZUA 3ZKXC 4PP1C 1DP0A 1T21B 4AD4A 3VRJB 5DJDB 3W5NA 1J0KA 3PAYA 4G7EA 2WP3T 4FTVB 4PJEB 1S9VB 3VXPB 2WY3B 3ZL4L 3D85A 2C13A 4OGXH 2VZOA 4PCYA 1E9YB 2WKLA 3R1ZA 3LEXB 4O58L 2H32H 1MJ8L 2Y8KA 2APTA 4FFWD 5I19H 3NQGA 3LCXA 5ANMB 5I15H 4GCAA 4ROQA 2GJJA 4P5SA 3VFPA 5C09E 1IEAA 1R6WA 2A4EA 1UWGL 1YECL 4ZB0A 1T4KA 3Q2NA 1GOQA 2X4SA 2CBIA 1T7VA 2YAEA 5DR5H 2WNKA 4N2YA 1S7UA 3L3KA 1PZ0A 3PJNA 1N0LA 3MCKA 4UWMA 3P9MB 1EB3A 3KWTA 2YEZA 4FSAA 5JMOC 4WGWB 5I07A 2X0WA 3WKYA 3BWAB 1INDH 4Q52A 5GS2D 1TJGL 5SX4H 5I24A 3AHXA 4C57C 2X1SA 1T83A 1A6ZB 3RO8A 2APXA 2UXFA 2AI0H 4S10A 1YEEL 4S1QL 3ZE0E 3M0XA 2FB3A 1KCVL 2UUDH 2XH4A 5J7CC 4GOSA 1X9RA 3KMDA 1JPEA 1XGTB 4E42A 5GJNA 3ZYJA 2A9AA 5D7JA 4GRMB 5GS0L 2Y89A 1UWRA 2YGPA 1IHIA 2P24B 1U8NA 3F12B 3FQUB 2NLJB 1NGYB 1J05B 1YMHA 3ZZ1A 2CHXA 4LBSA 1DJZA 3VDCA 2IQ9L 4QGTA 3QJXA 1P4LA 5EFFA 5FHAL 3BC9A 1ORSB 5DFWH 1PLGL 3FFDA 4JNYA 4O1DA 4NKDB 2JK5A 4Y4FC 3TNOA 1AQFA 4PL2A 3MRDA 3W2UA 4R2GB 3ZJ8A 3MFFA 1DBJH 3N5AA 4MA3B 4JQIA 4J4PD 3PS7A 3Q44A 2EC8A 2A3BA 1IEBB 1JS4A 5AAWC 4XBEH 3KPQA 5GGRB 4U3HA 3W86A 7CGTA 4GSQA 4G7EB 4FAAB 5I5IA 2A85A 5TF0A 1K70A 4ZCWA 4M48H 3D85B 4FHBD 1D2KA 1OG6A 4FXKA 4LB8A 3T78A 4I3GA 5JDSA 4ZMGA 3BKYL 5GSRA 3OF6D 1TRDA 3MLYL 1J93A 1S7RA 3QXUA 3R0NA 3SN1A 2PPFA 1R9FA 3M1OA 4Y2OA 2QLVB 4S3JA 1I1AC 3O2DH 1GOGA 5C0BD 1T4KB 1PO9A 1HKVA 4M03A 4LLVB 1EHLH 3RVVC 3BLKA 3OKLA 4LANA 3W2DL 1S7UB 4KRTA 5D1XE 1N0LB 3MCKB 4H8WH 1EJFA 1UOVA 4CQDA 1UATA 3GSUB 3CT7A 2EAEA 2BIOA 5DK0A 5ABGA 1AG0A 5HYJB 3QXDB 4MVBC 5K4XA 1J1PH 5DK2A 2C9UA 1XIBA 2K1MA 4C4UA 3W1PA 3B40A 1JGVL 3SN6N 4BWTA 5ABEA 5ALCL 4RMQA 3JTTB 2WZHA 4PMDA 3EXLA 1WCBA 3EA2A 3NFSL 4PRPB 3HB3C 1QU4A 2OKOA 1UR1A 3NL6A 3PP3K 3BPLB 1NIUA 2DWXA 4Z6AT 5BXTA 5DN1A 4YK4B 5FEZA 4Z1DA 4MNMA 5CC5A 4C6LA 2EPOA 3DSNB 1H0GA 2WMIA 1H11A 5D1XC 1NIBA 3CH1A 4FOUA 1VR6A 2AHIA 3D3VD 2QUTA 3DERA 3R0DA 1DLHA 1MFMA 1HAWA 5FK9A 2WINA 4FI6A 3TFKC 1FCVA 4LOEA 3VI4E 4EZJA 5B7ZA 2PO6B 3V6ZB 2ADFL 3LZLA 1L0PA 3T77A 3VC5A 3IACA 4XCEA 3KPQB 2BLEA 1XLAA 3I9GH 3ZR6A 4NQVB 3SDDC 1J5OL 4EIVA 1HINL 4URTB 2YRPA 3L3OC 4FXKB 2WZMA 4A55A 2NYYD 5GSRB 4FXRA 3ABGA 1MW0A 1Z42A 1S7RB 4FOJA 2D7QA 4HUKB 3HZYA 2BHFA 2A73B 4Y2OB 3RTQA 4NAQA 4JRLA 4CC4A 1AC6A 2R2CA 1ZHKA 1YLBB 1DQWA 2FBJL 1WZLA 1F6KA 1KCSL 1GH7A 3NYDA 2OMTB 3SPGA 4TUJB 4A63A 2WJDA 3BPNC 4RXFA 4HZMA 3MCNA 4LCWB 2YA0A 3T2OA 1TTGA 2VXVH 1UGNA 2XWEA 3DRQB 2IG2L 5EZOL 5HI5D 3SJVB 3FAWA 3WELA 1BDYA 3G5WA 2HVKB 1FWFC 5EA0H 3P3UA 3OMIB 3H9HA 5T1MA 4E0CA 1BD2D 2CLKA 2R1NA 4TU1A 5DK2B 2NX5A 3CVCA 4IFKA 3MREB 1VP5A 3P3YA 4L1XA 5M94B 3OHXC 4TQPA 1HOCB 4RDBA 1OTTD 3OVQA 2NNRA 4D6DA 4QS5A 2C1OA 1FH8A 5MEOA 4UR8A 4XP5L 1WCBB 3VA8A 4O1CA 4QRRD 4QNPF 2ZRZA 1FLTX 4I13B 3R6IA 1GHFH 4Q8UA 2BCMA 2A4CA 1GT8A 3WE1A 2PLCA 3ECWA 3GBMH 3RTLA 3O4LA 5I6SA 3JS3A 3QQ3A 2VO8A 4KVNL 1MPAL 3LTVA 2EYRA 1XW8A 4P9HC 2NSXA 1ZK5A 3DXIA 1BPLB 1VEPA 1P9MC 1A4KB 2D4FA 4D9PA 1KIPA 3O6FA 2XDHA 2FIQA 3BZEA 1O0VA 3RO6A 3IDNB 1B2YA 5HHPA 4ZFOL 4QTHA 5FK9B 2ZWSA 1GW1A 3VIGA 4IS6A 1HHIB 3W2MA 2IPWA 5IP4A 3T77B 1UOZA 4J6IA 4O2FA 1UWYA 1DVTA 5HGGS 5E4EC 4XCEB 3Q65A 5CILL 1OBAA 1SBSH 4UT7H 1N3NA 4GBXD 1EDGA 3BLLA 3M43A 3CO4A 4PWFA 2AEQL 2BNQB 1ISWA 2QVTA 4M6OL 2IQAB 2OWCA 2CM5A 3WKMH 3BZDA 3GD6A 5H8MA 3KYMA 3Q9PA 3STEA 2K0RA 4LO9A 3RTQB 4AX3A 2W07B 3SGKA 2FVNA 3KG5A 3GNNA 1ZHKB 3K6NA 4L6OA 3VNKA 2BK8A 2EGZA 2PDHA 2FT7A 1V03A 4JHWH 2WC4A 3TA6A 2OT1A 4DK6A 2VDNL 5DELA 4HJSA 3CN1A 3X1NA 1MAML 1OANA 1IFHH 1OCRB 5EA9A 1S5MA 4K2UH 1HH6B 3MV11 4BELD 5E9NA 3W76A 1OSPL 5KS9B 1OQFA 2NX5B 3IPFA 4QEHA 5LIWX 4EI5C 5DMGD 4QRPB 2CK0L 5TQ2H 4LKCB 4DVRL 2B31A 4P2AA 4AVHA 4YBQD 3RYSA 4Z0BL 2C1OB 2ZOKA 5K9KA 4UILH 2ZJSH 1FO0H 4HCHA 2AV7A 3LIZA 3MRIA 4EDWH 4JO8A 2EKSB 1R0AL 4FQJL 3AU6A 4HIJB 3O4LB 1HHHB 1SVCP 1UWAA 4U6TA 3VD1A 3ABZA 5AD0A 1GZQA 4QE5A 1TQCC 2YL5A 5HHOB 1UD2A 4P2RD 2OTUA 1QI2A 3HBPA 1N6VA 3B0YA 1MCHA 2CKBL 3VFUA 3U46A 5CLZA 3O6FB 3BZEB 4Z3EA 2JIWA 1FAKT 4N0CC 5HHPB 6CGTA 1YEYA 2XUCA 2XXCB 3ARDC 4RVBA 1EUUA 4IS6B 1K7XA 1QSFD 2ARJB 3II2A 1H15A 4UQCA 3WKPA 1UZ8A 3RMJA 1RZGA 1WKFA 1UXMA 1G4TA 4ALAC 3FH8A 2WGXA 2KUTA 4PJCF 1KCRH 3OLEA 1WCQA 3BAKA 4NKMA 1UUMA 4L7ZA 4Z7VE 4RNFA 1B90A 3B7TA 1OTSD 4AMAA 1R5WA 4KBPA 5MKGA 3P3SA 3EBIA 5E23A 4GS7C 4P23C 3TONA 4IL2A 3OMZA 3UTPE 5F7DA 2WXPA 5FJIA 4MLSA 4G7RB 1OG0A 5C0ND 1UOLA 1O66A 4GIAA 4L4PA 1K5NB 4LARH 1YW1A 3DVFA 5FF7A 1HE7A 4NZCA 1J9SA 1QBMH 4KAQL 5BVPH 5F1IA 3RVTC 3VOGA 3AU0A 1X8CA 5H1WA 1DQLL 4ZAKA 2VAJA 5ABDE 2WQSA 5ICYA 3O6KH 1Q1JH 3NBNA 3BAXA 4OTXH 4FR6A 4M1GH 5IQMA 4F0MA 4OGZA 4LHJB 2OB3A 5I6XC 5HANA 1TETH 3EKLA 4IHBA 3HUJF 4ZW5A 5FV2A 5I1AB 2E9GA 5CIPB 4UAOC 2ZOKB 3KBPA 3FSWA 5AKQA 4E9LA 2JKSA 2AV7B 2J6WA 1EJOL 4U3AA 3B2XA 4UU9B 4U3XA 5DFVD 1M57B 4O19A 3KRZA 1ZWIA 1FDJA 1NMCB 2DTSA 2PTYA 3EBGA 2PGEA 1GZQB 1I7ZA 5IFAH 2OX4A 3GZ3A 3S5NA 5H8PA 3ET9F 4HEMA 5J13B 3ZO0A 3IBOA 4IRJC 3U46B 4PWEA 3W11D 2I5YH 5E9DD 2W9LA 4LV9A 1QOXA 3BFQG 4PJ9A 5D7JC 5GNZA 2MIZA 4JHZA 3W29A 4QQUA 2C3ZA 5HJGA 1H15B 3PK7A 4E9YA 3V18A 4OAWB 3TJEL 3ASWA 4KS0A 8RUCA 3ZZSA 3QNFA 1YNTB 4R9XA 3MRFB 1RZGB 1Q6QA 2XNAB 4WTXA 4QCEA 4RAHA 5INDA 4JICA 2IAAC 5DQPA 3CQKA 4OQTA 4MB1A 3MODL 4M7KL 5D70H 1P6BA 4K7PY 4NLAA 3LZFL 4HC1A 2AK4D 1U33A 3M41A 2X2UA 1DL7H 2FK9A 1PZCA 1S3TC 1GQJA 5MKGB 2OMAA 4GJ1A 3RX5A 4GH3A 3R06A 1H7OA 4AT6A 4MUZA 4C6JA 1CGSL 5FD0A 5GPRA 2WXMA 4UDUA 1I3RA 4JFDD 1W3TA 3ZL4H 3IU4L 3ANUA 4H6RA 3UABA 3TC3A 4HBKA 4O58H 2ZUUA 4E9QA 1VACA 4LF3A 1I8LC 5E5MA 5F1IB 3ZKQD 1UWGH 3TA3D 2CZNA 1YECH 4HBQA 4RZ6A 2OEMA 1LJMA 3MOBL 2VRQA 2WLIA 2FATL 4NUWA 3BLEA 4E41D 3M0HA 2V2WB 2C9VA 3LDVA 3V0TA 5IM7A 3H7LA 2J8FA 1E9PB 1EPVA 2CBJA 2X1QA 2BVEA 4JKNA 3EJSA 5DT1H 4YSQA 3MNMA 3LSCA 4J2XA 1ZWIB 2RHGA 1YEEH 1QTYT 1GJPA 4S1QH 2IBGA 4ZFQA 1KQZA 1KCVH 2QSCL 4XN5A 1I7ZB 4GD0A 3RBSA 1MI5D 1BJ1J 5I6LA 2H9GB 1XRTA 2A4ZA 4PRHE 5AC7A 3Q67A 2C79A 4Y2WA 1XLCA 2UX7A 1FA4A 2DM7A 4OTKA 5KYUA 5J12B 4CMHB 4PJ9B 3BEVA 1WZMA 1E9ZB 3ZE1B 1ZUAX 1E15A 3F7PC 2IQ9H 5CGBA 3TIMA 3M45A 5A69A 3GFYA 4N1EA 1PLGH 1QVOA 5C6TL 4NZ4A 4JEJA 5F93C 1WAEA 1H5YA 4JIPA 4UIOA 1ZJAA 2PDCA 1SYTA 5HATA 3FKRA 4HW6A 4PMNA 1R85A 4GG8A 3GTHA 3SCQA 4WHYG 2IBBA 5F72S 1B0IA 3OB8A 5CCJA 3WFEL 4FF5A 7XIMA 1CFVL 2NY4D 4JR9L 5MENE 2IDQA 3IVTA 5CPNA 2Q2LA 4XH2B 1XH2A 4LLYA 2ZCHH 4Q2ZA 1W72L 2DJLA 3LNFA 5I74C 4L3AA 4J4KA 4OJFL 5LBVA 3GDRA 4XTIA 2C9QA 3ZTNL 4O16A 1WZAA 4IK6A 4UDUB 1BIHA 1VYRA 5E8NA 2OI9B 1S8DA 2KI6A 3TTYA 4EX4A 2C9XA 4K94C 1JDFA 3RFZB 1ZT4B 1BWVA 3WGUB 4ODUB 5DMNA 1VACB 5BPPA 2BY0A 3MLYH 2X4NA 5KSBE 5E5MB 3SPVA 1SRDA 9XIMA 2FUQA 2REQB 3QUKA 1SXCA 3VFTB 4Q22A 2BOEX 5DD1H 4Q89A 4EEEA 2JE8A 2PPCA 1J10A 1QSEA 2WLIB 5EIIA 4CC4C 3PJTA 2E28A 3C0LA 4JFQB 1FP5A 4XNMA 1KA9F 4IGBA 1GTFA 3T0EA 3VIFA 4LAZA 2PGRA 2RHEA 2Y88A 1GS6X 4YSUA 4NNBA 3VXSA 1HL5A 1AA1B 4L4LA 2R9HC 2X9WA 4BV1A 1ROWA 4F0RA 1U8KA 1EAOA 4K8GA 3IU3B 2QADC 4XZLX 1JGVH 4TKWA