1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (ALPHA-AMYLASE)
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
1JZ7A 1B2YA 1V6YA 3UETA 4AXNA 3LXCA 2WAGA 2J7CA 2ZUMA 2GVYA 1XH2A 4CN4A 5ABGA 3TTYA 4U2ZA 2YBTA 4PMOA 1X6LA 5M03A 1CGTA 3KWXA 5I5RA 1ZBWA 5FIPA 1R33A 1HVXA 1H0GA 1H49A 3AHZA 4V28A 1TQSA 1PX3A 1UH3A 2NW0A 3SCVA 2XM1A 2VR5A 1UH4A 2W66A 3N9KA 1U33A 4GO9A 2HVMA 3GTNA 1BFNA 1UQZA 4AIOA 2BHUA 1BG4A 2ZUWA 2C8NA 3IJ7A 1MW3A 5BYWA 1E4MM 2VX7A 1TG7A 2WWDA 4QDMA 3OZPA 3UG4A 1KGXA 1CLXA 3BLKA 4PN2A 1HXKA 5A2CA 1HTYA 3T2PA 2BVTA 1DWHM 2BV9A 3VGDA 3VINA 1UD6A 2CHNA 4LPCA 2QLYA 4NZJA 1C91A 4W8BA 1UWRA 5I78A 1E40A 3WDIA 5A8PA 4JKMA 4KWUA 1HP4A 3DYOA 1MQQA 5CZKA 3VIIA 1GVIA 1CYGA 1QOXA 3T2QA 4V27A 4FLQA 1JYXA 4PSRA 4NX0A 2DIJA 4HP5A 1JFXA 3UERA 4U3AA 1BYDA 4NF7A 4BQ4A 4B9YA 3CIVA 3UR7A 1Q6GA 3MV11 4D6JA 3BMVA 3IJ8A 2AOSA 2XN2A 1DWGM 4LYRA 4PMXA 3MKKA 1WO2A 5FL1A 1K9EA 1KXTA 2YLLA 4DWSD 3NSXA 1JG9A 3PTKA 3F4VA 1GJWA 1CXEA 1J0KA 2FGLA 1PIFA 5EB8A 3BLPX 4QLJA 1K9TA 4W8AA 1E3XA 4DWSB 1E56A 2O9TA 3POCA 4QCFA 3WF3A 1ISYA 5FD0A 3DHUA 3CZKA 2XTKA 4TVDA 4PMUA 4JKLA 3WQ5A 4HMEA 1JDDA 1HT6A 1TQUA 1QWNA 1J0HA 3SEPA 2QV4A 3VSVA 1V0MA 1GJUA 3ZR6A 4JIEA 3RJXA 3W6MA 4ZEPA 1H41A 5A6MA 1V6WA 1G5AA 3DYMA 3CH9A 1P6WA 3IK2A 3AMKA 3SCNA 3WD0A 2D22A 4W85A 2V3DA 4FNSA 5ABHA 3M6DA 5EMYA 1UUQA 1M01A 2D23A 2WHMA 4KGLA 1OBAA 1W9UA 4E8DA 1US3A 3N11A 1NOUA 4Z2IA 3AZRA 2J79A 1VFUA 2YL9A 3AXIA 3K46A 4DUXA 2VZTA 1PX4A 2IUZA 1TZ7A 4CN6A 2PWDA 1TE1A 1BAGA 4LYPA 4BQ2A 4P8XA 2UY4A 3VGBA 5CPQA 2DH3A 4FNPA 1WDQA 4MJ2A 4A3YA 2OYMA 2ZICA 1ISZA 3WUFA 1XCXA 4D6FA 5DFAA 2ZXBA 3F5LA 1V08A 4UFKA 2WW5A 3RPMA 1QI4A 1Q6CA 2EPOA 3D52A 4U31A 4NRSA 4OKDA 3AICA 2X0HA 1HJVA 2Q8XA 2VVSA 3EJTA 8A3HA 3BSHA 1R7AA 2XJ7A 3S5ZA 1DP0A 2VRJA 1WP6A 2G3JA 3ZT7A 1N82A 1R34A 2NSXA 1GOMA 4AZ7A 5E09A 2CPUA 3W26A 3FHQA 3WNLA 3AS3A 4C7DA 1QI3A 3T0DA 1QNOA 2WNWA 1JDCA 1G9HA 3AMGA 4U5KA 2VZSA 2W91A 4E8CA 3GH5A 3HG5A 3WMBA 1XSJA 2DIEA 4HMDA 4HOWA 5CJ5A 4PYSA 1VAHA 3VKKA 5DO8A 2DSWA 1BVZA 2XFRA 4UQAA 4ATDA 1GPFA 2J25A 4L4OA 3ARRA 1J0JA 2F1AA 1CGWA 3GXNA 3WH6A 4FLOA 1E6QM 1UR2A 2YLAA 3FHAA 5HPOA 1UASA 3T08A 2J8GA 4GI8A 3HMCA 3WQVA 1EXPA 4AD3A 1CGUA 4YPJA 4WSJA 1JYWA 1IZKA 1ZB5A 2YL8A 1KTCA 6TAAA 2X1IA 3QHNA 3N13A 5DMYA 1TA3A 3F5JA 2V5CA 2GK1A 4PMRA 3APGA 1WE5A 1TVPA 2Z1SA 3WY4A 2WLZA 4J3XA 2OSWA 3MMUA 1JI1A 4C7FA 1XSKA 4W7UA 1E5JA 3FAXA 2VX4A 3BVUA 4MJ4A 3VIKA 2EJ1A 1AVAA 3MMWA 5F7UA 3B9DA 1PAMA 4AIEA 1UD8A 3O2LA 3GBDA 3O9NA 3A4WA 4J3WA 1E1EA 5GQBA 5D9NA 1B1YA 1C8QA 3EDDA 3A22A 1KXQA 1LG2A 4UQDA 5HOSA 4AEFA 3WDQA 2JEPA 3SUWA 3ZJ6A 5I79A 2VCBA 3VIOA 3L4UA 5A94A 3M7SA 1UH2A 1E9LA 5A6JA 3AMCA 2NT0A 3TV8A 2Z1KA 4Z2GA 3A6OA 2JIEA 4KGJA 2CNCA 4W93A 4J3VA 3ALGA 3E1F1 2D3LA 1EQCA 1WZAA 1E71M 4IISA 1JD7A 4P7RA 4GPNA 3PZIA 1CIUA 4AZ5A 2VZOA 1O6IA 3WFZA 2WXDM 3B8SA 1XD1A 3AJ7A 2YDQA 2G8ZA 3NSMA 3N15A 3CMGA 1MXDA 3VNYA 2ZUTA 3CZEA 3M46A 4WF7A 2JF6A 3J7HA 3VILA 5D8ZA 5A1AA 3A24A 1AQHA 3S5YA 2VQTA 2VRQA 1OT1A 2W62A 4CD4A 1VRXA 3NJ3A 2E4TA 1WCGA 1GOQA 1R46A 4P8WA 3ZJ8A 1VBUA 4WK9A 3BXWA 2WC7A 3VGEA 3NYDA 3EDJA 4OOUA 1VEMA 2FE0A 1HX0A 2BY2A 2XVNA 3BVVA 1TQWA 2BVDA 2GDVA 3N17A 3T0BA 4CCEA 4WJXA 2VO5A 2ZIDA 2J7BA 2WB5A 4AEEA 1XGZA 6CGTA 1HXJA 1DWAM 2GFTA 2IXUA 1FP8A 1VJZA 1GOWA 2DH2A 3OA5A 7TAAA 3SURA 1FHDA 5D9OA 5E0CA 1BYBA 2BHYA 4E2OA 3GH4A 4W88A 1D2KA 1HJQA 3PTMA 4OZOA 5A8MA 3NCOA 1OD0A 1ODZA 1EHAA 2WMIA 3VGGA 3FW6A 2GUYA 2WZHA 2PBOA 3BMWA 5AC5A 1M04A 1CTNA 3ECQA 5HXMA 3VSTA 4JFUA 2GJRA 5CGMA 2YJQA 3VM5A 3ZOAA 1MYRA 2ZOXA 4H04A 1BQCA 3WL0A 4A3HA 2A3AA 1BSIA 3THDA 3WKZA 2A3CA 1HL8A 1XCWA 2X8RA 1UD4A 4UFJA 4HU0A 3GXIA 4QCEA 1UOKA 3EJRA 1QNQA 3LMYA 3MUAA 2VNCA 1LQ0A 1FOBA 3CPUA 2VZUA 5I2UA 4H8VA 4ZENA 4UZUA 3S6TA 2CETA 4EANA 1QNPA 4Q22A 3VOCA 3KL5A 4FNRA 2WSPA 3A4AA 4M80A 4X9YA 1E3ZA 2FDMA 3EJSA 3GXPA 4B16A 3RM8A 4W89A 3SUUA 1OCQA 5A95A 1NWTA 2J7FA 3GXFA 1C8YA 1QX1A 1E6NA 4J3UA 2XN1A 4PMYA 4Z2JA 1I75A 4BA0A 3TOPA 4E4PA 2DEPA 4AC1X 1RPKA 4F8XA 1FFQA 3RJYA 3UG5A 1E0XA 1EDQA 2TAAA 4AZCA 4TVUA 1E72M 4JL2A 4YHGA 4PBGA 1GORA 2XFFA 1SFSA 3WF0A 3BUPA 4JCMA 2ZUNA 3HG4A 3BAXA 1GW1A 2HISA 4HU8A 2WKLA 1F4AA 1MQPA 1SZNA 3ARPA 1D7FA 4OIFA 1CEOA 4NI3A 3MU7A 2WHKA 1LL4A 3KEHA 2FGZA 1CGXA 1H4PA 4HTYA 1KR0A 3VIJA 4AD4A 2J7GA 4AW7A 2V3FA 4W8LA 2O92A 4P7LA 3ZR5A 1QI0A 3ZMRA 2XVGA 3A23A 1JYNA 1R75A 3PZQA 4D6EA 2ZUVA 4IM4A 4BQ3A 4W7VA 5ECUA 1FH9A 3W24A 1E6PA 1SMAA 3SCOA 1OGBA 3VNZA 1LWJA 3K4AA 1FFRA 1DWFM 2XGIA 2MANA 5C71A 3VD3A 3GXDA 3NSNA 1VIWA 1PBGA 1XH0A 3HG2A 1NARA 2PC8A 4X0NA 2OSYA 2E3ZA 2VMFA 2VTFA 4L4PA 4OGZA 3FAWA 4GXPA 1E70M 1EH9A 2A3HA 2VCAA 3AHXA 4ACZB 1GQLA 5IDIA 2YDRA 3B9AA 1UZ4A 3OZOA 3VIPA 3PN8A 2WMGA 4ACZA 2BNJA 2JF7A 4AZGA 5DT5A 1ITCA 3AOFA 4Q7NA 5I24A 3WL1A 4FNTA 5JBFA 4Y7EA 3MANA 4WKHA 5M3WA 3MV01 2ZX8A 4LXFA 4Z2HA 1UA3A 1B3WA 3AS2A 2XPKA 1OB0A 3D3AA 3VX1A 1V3MA 1KXVA 2G3NA 1G94A 4CGTA 3EDKA 2CXGA 3EYPA 1GVYA 2XIIA 4XX6A 1IV8A 5E6ZA 1CECA 1Q6EA 2RGLA 1QNSA 3CTTA 1UWSA 2XM2A 2X2HA 2WLYA 1AQ0A 4P7QA 1E73M 4DWSC 3FY1A 2X2JA 5A2AA 3PHAA 3VGHA 4A4AA 1EOMA 3WQWA 1W3JA 2IGTA 1G1YA 4OUEA 4YHEA 1UWUA 4D6CA 2JFEX 4GZEA 3AHTA 2XHYA 1R85A 3VMOA 3QGVA 1WKYA 3PZMA 4W84A 1HN1A 2AAAA 1EDGA 4RE4A 1V3HA 4C7GA 4GINA 4NXKA 2CEQA 3DDFA 4H41A 1OGSA 3AHVA 2G3MA 5IFTA 1GHSA 5LA0A 1VJSA 3WY3A 1W3KA 3U5UA 3UCQA 1VBRA 2GK1B 2QHAA 1GZJA 2EAEA 5M5DA 1WDSA 3THCA 1PS3A 3KL0A 1CXLA 2G3IA 3D50A 3CHEA 3GNPA 3AYRA 1O7DC 3PBGA 2J74A 2O9OA 4BF7A 3HU7A 2DT1A 1Q4NX 1QI5A 3OGVA 3LPFA 2NT1A 4URIA 1MW0A 2V5DA 1CENA 3GNRA 2VQUA 2W4XA 4QLLA 4GI9A 1L8NA 1KFWA 3OGSA 2F7OA 3VIHA 1XH1A 2D3NA 1JZ5A 1W1PA 1E0WA 3WEMA 3KLKA 3MUIA 2WMJA 2XVPA 4ZXLA 3W81A 3SUSA 1H09A 4NSBA 5A69A 4TTGA 2EACA 1A47A 4D6GA 2X05A 4TOQA 4ZFMA 4D6IA 1J0IA 3OG2A 2WC4A 1JXKA 2BY3A 4JHZA 2EABA 4U33A 1LG1A 5E1QA 2PBGA 4HOZA 4MDOA 1C8XA 4OJYA 1HKMA 4PTWA 1TCMA 4PCTA 4M29A 1GQIA 4ZXOA 3W25A 3RIKA 3CUJA 7A3HA 4MNKA 1I1XA 1HKKA 2WVVA 1HP5A 5AYIA 3PZGA 3OLGA 1LF1A 5IXEA 3RDKA 1C3FA 2Y24A 2E9MA 1W1TA 3LRMA 4UFIA 3WF2A 2C0HA 2J47A 4AD5A 5KZ6A 3BSGA 4MNMA 1UD3A 3MO4A 4UFHA 4TTUA 3VIMA 4WLCA 5CPTA 2E9BA 4B15A 1W9PA 1EIBA 3HN3A 2W67A 5HBFA 4PRWA 3VO0A 3OB8A 1FHLA 2Y8VA 3W82A 5I77A 1H5VA 3DHPA 3OLIA 2A3BA 3A47A 3N1AA 1W9BM 1Z32X 1BYAA 1NH6A 1W1YA 3EMZA 4KH2A 1ZU8A 1WB0A 2J62A 4P8UA 3WF1A 5DEZA 3TTSA 4JFTA 1X6NA 2AMGA 1BYCA 4UFMA 4K68A 3ZM8A 3TONA 1HWWA 4AIUA 4PMDA 3SCRA 3WH5A 3MUZ1 2DQXA 4CKQA 2X09A 3ARWA 4WKAA 1VEOA 4B3LA 3K8MA 3F5KA 4D71A 2D20A 3EMQA 4ZE4A 5BXSA 2XVKA 4AZHA 3W0KA 4F9JA 1M7XA 1MFUA 4UR9A 4P7NA 2WYSA 1NQ6A 1C7SA 4N0RA 1E5NA 1VF8A 5HPCA 1V6XA 5BRQA 1GOOA 1XHGA 2CBIA 3D4ZA 2PWFA 2ALWA 2EPKX 2CKRA 1CWYA 1GQKA 3O6AA 3WNKA 2UWFA 4PUEA 2WVSA 1KB3A 4FLSA 2EADA 2F7PA 1W32A 2J4GA 3TA9A 5CG0A 1OGGA 3GH7A 1WZKA 2CYGA 4EAMA 1NOFA 1R87A 3GXTA 2XIBA 4KMQA 1HJSA 1UR1A 1XYZA 2XVLA 4HA3A 4AWEA 1E4IA 3WD2A 1FH8A 4CD8A 3VPLA 1M03A 3SCSA 2D73A 1WZMA 3W38A 2WVTA 3T0AA 3KZSA 3WQ8A 3AQUA 2XSBA 4OBRA 2JEQA 3D51A 2VCCA 3VD7A 4DWSA 4UOJA 2WBGA 1JAKA 1E43A 1V02A 2UY2A 4PSPA 1W3HA 3ARTA 1RP9A 5I0DA 2EPMX 3AFBA 5BXPA 3CBWA 3W29A 3AIVA 2F61A 3AS1A 3ZSTA 1PPIA 1JNDA 3NDYA 3RM4A 2WZIA 5JIWA 3MUY1 4XV0A 3AZTA 4DM2A 1JGIA 2D2OA 5FKYA 2CBJA 3AMDA 5A2BA 3II1A 3KLLA 4TX8A 1OINA 1QNRA 1KCKA 4UQCA 3K4DA 1NOWA 5CPSA 3WELA 4M56A 3W53A 4DM1A 5C70A 2E8ZA 1TQTA 4J3SA 2J7HA 1HF6A 2XG9A 2WANA 2IXVA 5D4YA 4HA1A 1J0YA 5ABEA 4EK7A 2F2HA 5DF0A 2PF0A 1UHVA 1ZBVA 5CQ1A 4CU7A 2FH8A 4XUYA 2WCGA 3W37A 3BAKA 2PWEA 3LXAA 3WNMA 3DX2A 2UY3A 1R47A 3GM8A 5A6KA 2VUYA 1B9ZA 1CZ1A 2PI6A 3DX0A 1W9VA 4XZWA 1W9DM 4F66A 1DHKA 1V0KA 4TX6A 1JYVA 1BLIA 3LXBA 5BROA 5BWFA 5BXTA 1HKJA 2E0PA 3L4TA 3KE0A 2DPEA 2G41A 2BHZA 3POHA 1JZ4A 2BFGA 1CPUA 1U2YA 1BF2A 3WIJA 3BUIA 1JF5A 3U57A 5JBEA 4CUCA 3N04A 4DO6A 4S3KA 1ZS2A 3WUBA 1IZJA 2QPSA 1KR1A 1R86A 3N18A 1ODUA 2ZXQA 4H8UA 2F7QA 2WHJA 4Z2LA 1DWIM 5A6BD 1JNEA 3UEQA 3EDFA 3EJPA 3WMCA 4NRRA 3CZGA 2JE8A 1JL8A 3GBEA 3ARXA 1J11A 3BCDA 1VB9A 4J27A 1KWGA 1Q6DA 3WDPP 1QW8A 1J12A 4JCLA 2B31A 3H54A 3OBAA 1TR1A 3LX9A 3WQ4A 3CUGA 4W5ZA 1CXFA 1UWIA 1B90A 2CERA 1GCYA 1W9XA 1LLOA 1HJXA 3RILA 3PZTA 1QHZA 4W86A 3WEOA 2DGAA 2G4FA 2V3EA 1J18A 1ZJBA 3L2MA 3RM9A 3WBAA 3L4ZA 4AMWA 1UWTA 1XC6A 4GZIA 4S3JA 4FF5A 3WH7A 1U30A 3LPGA 5E0FA 3AIQA 4OBSA 4W5UA 4LQ1A 4MB4A 2QF8A 4KRUA 3LRKA 5CGTA 2X0YA 3BUDA 3SCPA 4D72A 2FHBA 3A5VA 3WNNA 3MSDA 2VX6A 3BGAA 2BVYA 1CXKA 3FN9A 2D0GA 2V3GA 5I23A 4BS0A 1UQYA 4PEEA 1KWKA 2F8QA 2A3EA 4WIWA 1BVNP 2J7DA 3RMEA 3I3EA 1L0PA 3BLBA 3D4YA 1BGAA 1V3IA 3AROA 4MAZA 3VD5A 3DX3A 4GQRA 3L4WA 1H2JA 3RO8A 3EJUA 3AIEA 2CBUA 3WD1A 3OLDA 4CU6A 3VSUA 1X1NA 1V0NA 1E4LA 3QOKA 3WEZA 1EA9C 1NP2A 4AMCA 3ZJ7A 5JBDA 1OWQA 4H2CA 3U7BA 4TVCA 1PEZA 4HMCA 3AYSA 1DTUA 3DECA 3GYCA 3IGUA 3UR8A 4DUWA 1PX8A 5CSYA 5TD4A 1LL7A 5AYBA 5GPRA 3CZNA 4CVUA 1M53A 2Y8KA 3UG3A 1EO7A 2WBKA 5JIPA 1MFVA 3CHFA 2WMFA 5JUVA 2ZX7A 2ZXAA 2CKSA 2W5FA 1UZ1A 3MS8A 3BVWA 1W1VA 1NP0A 1CGYA 3SCWA 2BS9A 3AI0A 1QWUA 1E6SM 3ARYA 2VJXA 2YFOA 3EMCA 1W2VA 2YIHA 4PCSA 1EOKA 3S2CA 4AZ6A 4U3CA 2WSKA 1TMQA 1TQVA 5GNZA 1VFFA 2QMKA 3AS0A 3ALFA 1QPKA 3W27A 3WN6A 3BAYA 3NIYA 4P7OA 4AY1A 1YQ2A 3DX1A 3A21A 4QFUA 2YA0A 2OYKA 3CHCA 4CN1A 1D3CA 3K1DA 3VX0A 2DSKA 1UR9A 2OLHA 4J3TA 3DX4A 3WNOA 4PTXA 2VR4A 4FK9A 1RD6A 3CUFA 3AIWA 3LRLA 1WAWA 1Y7VA 4HZ6A 1KTBA 1J10A 4AD1A 1ECEA 1VFOA 2WWCA 4FMVA 1VEPA 2ZWYA 4JFVA 2Y4SA 4MAVA 2O9RA 5LA2A 2QPUA 5ABFA 1HJWA 4M24A 4UQ9A 4JFSA 2BXYA 3WD4A 3QOMA 2ZXDA 5A8OA 4R5EA 1C93A 1HNYA 4KRTA 3EDEA 4LGXA 1WDRA 4ACYA 1UWQA 4MNLA 4HZ7A 3CMJA 3VMPA 1HVQA 2EXOA 2E9LA 2V38A 3AXXA 2DT0A 4M81A 4R27A 3PZ9A 5E9AA 2GSJA 5A3HA 2WK2A 1G0CA 4RL3A 3NUKA 3WF4A 4ATLA 3VDHA 3VM7A 2DSZA 1JD9A 3K8LA 3VVGA 1KGWA 1K9FA 1ESWA 3WY2A 5BXRA 1US2A 2CHOA 2F7RA 1EGZA 4J7RA 4UNIA 2VT0A 4CVWA 4ML4A 4CD5A 1OD8A 1JI2A 4CD7A 5IHRA 2YL5A 2JIWA 3I3DA 1GHRA 4GIAA 1GQJA 3WNPA 1PZ2A 3IANA 4F9DA 3CZLA 1B3XA 1E55A 5FL0A 4CCCA 1PZ3A 1GOKA 3G6MA 1V02E 3SCUA 2J78A 2XSAA 4CU8A 1G01A 1ZJAA 2FYVA 1HJUA 4QLKA 3VUPA 4N42A 1R7OA 4NXSA 2YBUA 2WHLA 4U5IA 4H7VA 3ARQA 6A3HA 4B9ZA 2VOTA 2FHFA 1WZLA 1S46A 5D8WA 3NDZA 3CZ8A 2DSVA 3HG3A 2VC9A 5D9MA 2D24A 2W61A 4UFLA 5AY7A 1NM9A 1CNVA 3IAPA 1ISWA 4JKKA 3VD9A 1YHTA 3BAIA 3WUGA 1QHOA 1XYFA 1ITXA 3SUVA 2XYLA 2EO7A 1CLVA 3BAWA 1V3KA 4MADA 1LWHA 4NZCA 1CDGA 2EEXA 3BAJA 2W63A 4XB3A 2J77A 4IPLA 4F79A 1TA3B 4M1RA 3VDAA 2F1BA 3FNDA 3VTRA 2GJPA 4V2XA 1E6XM 1XSIA 4UQEA 4AD2A 2WMIB 4JFWA 4AYGA 2GDUA 3SCQA 2VL4A 4PTVA 1B3VA 1KCLA 2UY5A 1EHNA 2X2YA 2WZEA 4JAWA 1BTCA 2EQDA 1TVNA 3SCTA 1GNXA 5HDRA 3UESA 1RP8A 3MI6A 1E6RA 1OSEA 2ZX9A 9CGTA 1PJ9A 2CESA 3T09A 3U7VA 3W28A 2YA2A 1R8LA 4HZ8A 3VIGA 3M07A 1KQYA 1DWJM 1V3JA 1WPCA 3ZT5A 1J9YA 2PWHA 5A6LA 1OIFA 3HZ3A 4CD6A 2DT2A 4D6DA 1UKPA 2VVNA 2YFNA 3BCFA 4J28A 5CSUA 4HPHA 5GNYA 2JALA 3ZQ9A 2DSUA 3FXYA 7CGTA 4HPGA 5DT7A 4D1IA 3PZOA 3CHDA 2WVVB 3DDGA 2WMHA 4TXEA 3BH4A 5I6SA 1OT2A 1BG9A 5LYRA 1NWUA 4IPNB 4H8HA 1PIGA 2WVUA 1VFMA 1ZBKA 4U2YA 3WSUA 1RH9A 2XGBA 1SYTA 3L4VA 1DEDA 1JIBA 2E8YA 3EJQA 5A6BA 1TUXA 1UG6A 4NZFA 1OIMA 2GJXA 2CBVA 2Y5EA 1JAEA 1MXGA 3ARZA 1BGGA 4LX4A 3L2LA 1C92A 4BCEA 5KEZA 1UD5A 3BUBA 2DDXA 1MQRA 1UKOA 3QR3A 4AZCB 3GNOA 1VENA 1SR0A 4D1JA 3ARUA 4QP0A 3ZSSA 4FNQA 3WUEA 4OOZA 5BCAA 2WCAA 2CIPA 4AZBA 3AXHA 2XFYA 2WCSA 2J8FA 2YL6A 4Z2KA 3CUHA 3WDJA 2YDSA 3H53A 2BXZA 2ZE0A 4JL1A 4MB5A 4MDPA 3BUQA 2CITA 1JXJA 1CXIA 1Q6FA 2XUCA 3IJ9A 2FH6A 4BZYA 1LJYA 1GOIA 5C8BB 2RGMA 1HL9A 1SMDA 2OWCA 2EPLX 4B3KA 3TTOA 3AZSA 4UOQA 1B31A 2EPNA 3ZIZA 1KGUA 4JHOA 4D6HA 4CCDA 1EQPA 3DC0A 2OYLA 3WDHA 1BHGA 1JF6A 3BC9A 4MB3A 5IHSA 1T0OA 4UZSA 3CV5A 5GNXA 3ARVA 1NWSA 5CXPA 2QMJA 3CZSA 3D5HA 2OWXA 2C7FA 5ABFB 1ZBCA 4PMVA 3CO4A 3TP4A 1XRVA 3QHOA 1BPLB 1E1FA 3WFLA 3VD4A 3VGFA 4UTFA 1JZ3A 2XN0A 2D0HA 3CLWA 2ZX5A 1QBAA 1B3YA 2OW7A 1J01A 5I3DA 3WDRA 5A6SA 5HNNA 1W2PA 1J0ZA 4GI6A 4GQQA 3WBEA 1K9DA 2BY0A 3GZAA 4X0VA 4M82A 1JZ8A 3GXMA 2EBNA 4YN5A 3VIFA 1GONA 3U5YA 3W6LA 2VZVA 2YOCA 4EKJA 2YA1A 3ZO9A 1TFVA 5EFFA 4AZIA 2WM0A 5EBAA 1E0VA 3WD3A 2VURA 3K8KA 3RCNA 5LA1A 3CGTA 5A8QA 3JUGA 1C7TA 2PB1A 1HIZA 2Y2WA 1FH7A 4DUVA 4FLRA 1B30A 3WH8A 1V0LA 3WQ6A 1V3LA 4M8UA 5A6AA 2OW6A 4EE9A 2FHCA 1F4HA 3G6LA 1UD2A 2ZUSA 4AISA 1JZ6A 1H0IA 3WH9A 4MB1A 1E4NA 3WENA 3AMLA 3BVTA 1B3ZA 1OM0A 3VU2A 5M17A 1IT0A 4BQ5A 1QW9A 1MWOA 1UR0A 8CGTA 3L4YA 3HJEA 4QAWA 4LYQA 3AIBA 1C90A 1CBGA 1V6VA 2D1ZA 3IAQA 3SIMA 1KQZA 2OSXA 1AMYA 3VDBA 1QHPA 2O9PA 1ZL1A 5FCZA 3PZNA 4ATWA 5E6YA 3ZJKA 2WMKA 3EBVA 5D9PA 1MW1A 1UYQA 5E70A 2ZUUA 1MW2A 2ESCA 5BRPA 4DO5A 3AISA 1JZ2A 2ZWZA 2PWGA 3DYPA 4GO8A 3MMDA 5AC4A 1KBBA 1JDAA 3VMNA 1H3GA 4FNUA 3ARSA 4GKLA 2DT3A 3VDCA 3KL3A 4W87A 4AD0A 1JFHA 1H1NA 1H11A 1NWRA 1HKIA 1V03A 1XV8A 3CUIA 3OGRA 4IUGA 2ZX6A 2YKKA 1WNOA 1E6ZA 4P8VA 4UOZA 4HOXA 2VX5A 3A3HA 1KXHA 1GUVA 2WKGA 3AIUA 1CGVA 1QVBA 1KBKA 1MVYA 5FOOA 2X2IA 1UR4A 4RE2A 3LPPA 3H55A 2VI0A 4PUDA 1UA7A 3AIRA 4RE3A 2XWDA 3CZJA 1XD0A 4TUFA 3AHYA 3LPOA 4AYSA 4HA4A 4PMQA 3SUTA 5EFDA 3QHMA 1UKTA 1EDTA 2XWEA 3BVXA 4GZJA 3PTQA 3PZUA 1K6AA 1WDPA 3OLEA 4AMXA 4MPKA 4WKFA 4WSKA 1ISXA 3ZT6A 2WPGA 4UCFA 1CXHA 1LL6A 3WMSA 3I3BA 3W4RA 2CCRA 1O7AA 4XZBA 2OWWA 4W7WA 4ZE5A 3TTQA 1E15A 4MTVA 2F18A 2GJXB 1EO5A 3CC1A 3GDBA 1V6UA 4PMNA 3L4XA 3MSGA 3WY1A 2VRKA 1AQMA 4PTMA 3B9EA 5A8NA 1QBBA 1W3LA 2E40A 3N12A 2W92A 4UQBA 2J7EA 1W91A 3T2OA 1A3HA 3A4XA 2WC3A 1FA2A 1UR8A 1UKSA 4DO4A 4MNJA 5IFPA 2BY1A 1QI2A 1B0IA 5CLWA 1UKQA 5CLTA 3OIHA 4PMZA 1I1WA 4JZ5A 1ISVA 2J75A 3PZVA 1FP9A 2D0FA
chains in the Genus database with same CATH superfamily
1TJHL 3ELQA 3W0WE 1B2YA 2R69A 1V6YA 3WQFA 2OI9C 3PG2A 2J9YA 2J7CA 3U0PA 2GVYA 4DNMA 2V9TA 4NP4H 3K1GA 1BXCA 1NUDA 2VLJE 4CN4A 4DK5A 1ZHLA 1ADOA 3T1WA 2FO8A 2OR9L 3PXJA 2CKBB 1X6LA 3BWAB 1F61A 3WBWA 3MBXH 2NQ5A 1CB4A 3IGAB 5KTLA 5I5RA 4GLRH 3PBUA 4BINA 4OGXL 4ROQA 4GY1A 1Z7JA 1BREA 2G3XA 1VF5C 4L9DA 2ZRXA 1R33A 3DBPA 1JVOA 4KKCD 2Z93B 1FL6B 1TQSA 5GRVL 1I8KA 5LGJA 1I7ZB 4MRCA 2VR5A 1UH4A 3GJEA 3MUCA 5DHYA 5HUPA 4GO9A 3WJXA 4ADUA 3QUXB 4YFDB 3VB9A 2AABH 3KYAA 4M9PA 2ZUWA 4QRUB 2JIXB 1OGAE 1RR2A 3S88L 3HRZB 2KI6A 4IKIA 2H1XA 2WN2A 3F6LA 3MGOB 4QRAA 4OUOA 5ID1A 4Y2DB 2W94A 1ETJA 1TPH1 5IJVA 1GL4B 2G2RB 1AAJA 5D1ZB 1ACYL 2WWDA 1KIQA 3OAZK 2NZIA 4WW1A 5KAQG 4O51B 3VU1A 3JWOC 2IW0A 3W1MA 3IDIB 4NWTL 4AENB 4C8XA 4TLSA 2R1XA 3KYNB 4ZFOA 5JXAH 1RPXA 1CFMA 3T2PA 3V8CA 2BVTA 3VXNB 5I30H 1DWHM 3QSTA 1YXDA 1DBKL 4HZLA 4NQVA 3OZYA 3PVFA 4GIEA 4Z0JA 4NJ9L 2G2RA 2NMSA 2ID5A 2Z7GA 4DP9X 3WMLA 1J2BA 3C5JB 1KKOA 1UD6A 1GKPA 4G5ZL 2EKGA 2QLYA 3GRGA 4A63A 1JCLA 5F4WA 1FNSL 2XTJB 2QAFA 1CE1H 5EMLA 5IUCA 4Z8FL 1VDGA 3VXPB 4W8BA 1N6UA 2YCLB 4HZLB 3D8MA 1E4HA 3MR9B 4JRYA 4NAJA 4RMTA 3CWOX 3U2ZA 1FWTA 4QF1A 2E47A 2O5YL 3FCBA 4JKMA 5A8PA 2OSLB 1KO0A 4RZCB 3VIIA 5EA0H 3RIFF 3HE7B 4LVBA 2GABA 3T2QA 4V27A 3TAKA 5DS8A 2PP0A 2E5BA 4PSRA 1PZDA 4MJIB 2ALRA 2V2XB 5I00A 2RJMA 2B3RA 2WLIA 2ZP9A 3N40F 4NX0A 3MODL 5KS9A 1L6GA 4HP5A 1V55B 3GI9L 3N50A 2DWXA 2YMOA 4H9XA 1JFXA 5AL0A 3UERA 2ZA3A 3CK0L 3O3EB 3KS5A 2ENYA 4E41D 5DCBA 5E9DB 1D9KA 1JXGA 3B9KC 2Z6FA 5AHLA 4BQ4A 2G9HA 4AYFB 4FOUA 1QACA 2KDYA 4PJIE 4WK2B 5AW1B 5ECVA 1PKQA 1RAMA 1DIDA 1Q6GA 1WTLA 2Q86B 3CVDA 3BMXA 5L2KE 3HMXA 5I15L 5AOUA 5T1LD 3OG6B 4TVPL 2YQGA 1B4RA 5JLZA 4FI4A 4LYRA 5E9DA 4N0YH 2BVOA 3CVHH 3S4SG 4NQXA 2HBXA 1CFSB 3VNLA 2R51A 3UTPD 2DQGH 4Y0GA 4FEMA 5TTRA 2X4SB 1AG1O 1PZSA 5C07B 5JW4N 2JKWA 3AXLA 5C2BL 3P9MA 5FL1A 5A7EA 7FABH 1JCXA 3MC0A 4XMKH 3OZ9L 1W31A 1QAPA 2BLEA 1RBOB 1I9CB 4LVFA 4B9FA 3MBEA 3NN8A 2IH1B 5DK2B 1HJBC 3GMMA 1MJ7L 3T65B 5DSCB 3AXLB 1RJPA 4LLDA 2VM8A 1RK0A 3THAA 1YNLH 3TVMA 4FLHA 4NO2B 1HI6B 3F01A 5E51A 1B2WL 2WNXA 3GNXA 3HMXH 3ARFC 2GTQA 1LVEA 4QPEA 1KD0A 3RUBL 3UJSA 5K9DA 2DQJL 4G8GA 3RIFK 2JJWA 2WXHA 2O5XL 1ZLWK 2VP8A 1VBHA 2R15A 2VSDA 1LO5A 4KKQA 5FD0A 3DHUA 4FI6A 4NQEE 5E00B 4MKNA 4CC0A 4HPYH 4NCDA 1ADSA 3W75A 1B4LA 1YZZA 2X6MA 1W0VB 1TWWA 2AGJL 3WQ5A 4RPQA 3A3YB 3JV4A 4HMEA 4M6ML 4NZ8A 4IRSB 1MNUL 5CINL 2QHRL 3UROR 1MIML 3KG5A 1PYFA 5C08E 1N6QL 1SM3L 2OKMA 2C3XA 1Z7AA 4KY1H 3BHBA 3SEPA 1I7RB 1NCBH 2QV4A 2OMTB 2YCEA 2YX0A 4Q8PA 4N1CA 3WKYA 3RPIA 5IHZB 3H3BC 3C6CA 5AOMA 3Q45A 4XN2A 2V68A 2JJSC 4P2OC 1BZEA 2MMXA 1UACL 3V0IA 4KTEH 4H44C 3DKLA 4NN7B 2V17H 4CC4A 1KN4H 3MMEB 1G7LA 2BJML 2XQYA 1YN6B 2OX5A 5E7FA 1DXIA 4AQ1A 2X9ZA 5IQLA 1FYTE 3LEVL 3SCNA 5FEPA 2QL1A 3TW7A 1KCUL 1T2QH 3GKWH 1FIGH 1MFBL 2VITA 3ID7A 1CFTA 4J2MA 4PV8B 3IMTA 1XBRA 2D22A 2Z1PA 2K3HA 4JRFA 1VR6A 1M6OB 1MF2L 4FA6A 3D46A 1V7YA 3GC4A 2FKPA 2R6OA 3SCMB 3M6DA 2BFVL 1YPIA 3HZMB 5G1MA 4JFQB 4JZJB 4C7FA 4YIQB 1DN0A 2D03L 4LT9A 3NL2A 5EMYA 5F7EH 2D7NA 1PNCA 4W9CC 2D2CC 3NP3A 4P07A 5IY5B 2WHMA 4NZ1A 2PD9A 4TQEL 5JORB 5CFAA 3UCCA 4L56A 5CGYD 3STLB 1KPRA 2WY3B 2CGRL 1OBAA 1Z44A 2QR0B 5K9KB 1GW9A 3Q5TA 4XWGH 4YIQA 3EXJA 3KW8A 1NOUA 1FPTH 4HK0A 2R1WA 1SZEA 3AZRA 1NIAA 4FXTA 1QSFA 2J79A 4MWFA 1GIGH 1WFJA 4U6VH 4MD5A 5DEGB 3WFEH 3CEPA 4DPPA 2WWKT 4Y8DC 1JFQH 2Q8AL 5FGCB 2YL9A 3C8FA 4XN9A 3RU8H 3TSMA 2WQPA 3NEOA 4X6DB 1J5OH 4UTAH 1SHXA 1PX4A 4UV7L 2IUZA 1G7JA 4X50A 4KXDA 4X8XA 2F2KA 4CN6A 2PWDA 1MELA 5SWZA 4H88L 4LYPA 1UC4A 5BVJB 1OF2B 2OCCB 1S4IA 3IU4H 1ID5I 1TQCB 1T0NA 1KDIA 3SJVE 2OYMA 5DJ2A 4L6HA 3CQFA 2WLLB 2ZICA 1ISZA 3QEQB 5KAQF 2GUBA 1HHIB 3WUFA 3LKQB 1YMHB 2NY0D 4DFHA 3CMOH 1BMGA 2Y1HA 4D6FA 4B4FA 1MCOL 3RPMA 2PTWA 3B2MA 4LCCC 4HLZH 4XN1A 1ZAHA 1JSYA 4OD1L 3FN0H 5FFOA 5EMMA 3WFCH 3O6FD 2UUDH 2WIMA 2PDHA 2V5LA 3MJWA 3EJTA 5LIUX 1AGDB 3GWJA 1FP9A 2NXGA 3CLFH 4NQEB 2R0WL 6PCYA 2XJ7A 2EDHA 3HFMH 3HHSB 3PP4H 2X30A 4UFHA 2KH2B 3KPNB 4B5TA 1DP0A 3GSUB 2VRJA 1WBYB 4PUNA 1ZCRA 1EO8L 2KQMA 2G3JA 1TJMA 5MEND 3MLWL 4F2TA 4LOUD 1GOMA 4AZ7A 2CDEB 5G2IA 4PWHA 3FT4B 2CPUA 1S6NA 2RGSA 2MJWA 4AUJA 3ZWTA 3G6AA 2YC1B 3V5DB 1YYML 1QI3A 2QLVB 2WO3B 1X7TA 3EF7A 4GQGA 4BJHA 2HTKC 5C2CA 1QNOA 3ZZQA 1CD9B 2VZSA 4LEOA 1LRQA 5KZEA 4OZIB 4IIZA 4E8CA 3PAJA 5EA9A 3GH5A 1YECH 4YDKL 2B1AH 2VM9A 1W5QA 3WMBA 1SDAB 1ZNNA 4EOUA 1XSJA 1K4CB 2B4GA 2DIEA 1OEZW 4HOWA 3DX8A 1VAHA 2ATPB 4Y89A 2ZT9C 5DO8A 3RRQA 5JPNA 3HOGA 1G87A 1BVZA 3ZHKA 4AC2A 3LN5B 1UEYA 4X7SL 1RY0A 4WHBA 2J25A 2WMPB 3TZVA 2DJSA 2YPLD 5FW8A 2YD2A 3N2XA 5HI3C 5IVXF 1AHKA 1UVQB 3GHUA 2BP8A 3WH6A 1LEGB 1I9JL 3F83A 3VXUA 4GRLD 2X1TA 1ETB1 3FFDA 3ZDYB 1YJDH 4IMKC 3TDFA 1JHKL 2HT4C 3MP3A 1SVBA 2A4EA 1D5ZA 4KY2A 5KBPA 3HMCA 4Y1TA 2CJ3A 1DL7L 5D8JL 3RGVD 2DWEB 3BGMA 3KWWA 4JKWA 2QUUA 3W1RA 1F74A 5EF3A 5IJKA 1R5YA 4LAJH 3DJTA 4X9GA 1PLCA 3V2AR 4F27A 3S4SA 4JANA 3ZKMD 1ZB5A 2C13A 2YL8A 1O4UA 1QMUA 2QIWA 3FO2B 5LDSA 5DMYA 2EJAA 4Y9EA 2GK1A 2DWEA 1S7RB 2V8MA 1T8QA 1WE5A 4X9HA 1DTNA 4MNQE 1UOLA 4XH2B 5KUKA 1OF6A 3L3DB 1QOKA 1KFBA 5GIRB 3NL3A 1JGLL 3S4SB 2OSWA 1H7XA 4L4VD 1DCEA 4PJDE 4ZQTA 2YHGA 1MQKL 3D39E 4O4YL 2AL2B 1JI1A 5EUOF 1RK5A 1AZVA 4WR3A 1DDHA 1NIDA 5BOZG 1YDOA 3FU0A 1OFDA 2P10A 2RJGA 1Z3GL 4LBSA 4PJDF 1XSKA 2OPJA 2OOGA 4M43H 1L6YA 1LWRA 1FWNA 2PDCA 2JIXA 2EJ1A 1AVAA 2F8OA 2VFFA 2Y88A 4JDVB 4ZFZB 1Q66A 3S1XA 4F0LA 2AL2A 3TUUA 2ZRYA 1YTEA 2I26N 4HF5H 2DIBA 4A7UA 2YK1H 4ERSL 2FDBP 4P9MH 1G7VA 4FTVD 3TXVA 3O2DH 4JTFA 5TDPB 2P5EA 1NCWL 4GY0A 4GUQA 3IDMA 2VEKA 2AQSA 1EWDA 5TPWH 5GQBA 5IFHL 1MHEA 2ZA2A 3QV7A 2YXFA 3MRIA 3UR2A 3JV5A 4IIHA 3QQ4A 4Q74A 4KPHL 3S3BB 2NXZC 2X4PB 1GAFH 3QCTH 3EDDA 4I7VA 5HANA 2P5EB 4MD0B 2QQLH 5ITBL 1BM7A 4O00A 3FSAA 4QJ4B 2DJXA 4GJTB 4QGTA 3CL6A 3UYCA 1NCNA 2JXMA 2WQRA 3UXAA 3ZN6A 4O1BA 1WC7A 4AEFA 2QJNA 2X41A 3DHDA 1UWEL 4R96B 2Y06L 1ZPUA 2A74A 2DQDH 3GMPB 3L95B 4K73A 4H5SA 3VIOA 1RUML 1GJPA 3DV6A 43C9A 3O11B 3QZOA 3MUUA 5EDSA 1RLCL 3MV8B 5A3ID 1FV1A 3MI3A 2IADA 1L2QA 1IGFL 5A6JA 2FEDC 4Z2GA 3I9PA 3ZKXC 2Z1KA 1CDIA 2D3JA 3P3RA 4LHUG 4CMMB 5EZPA 5CSBA 3MJ9H 1FWBC 1XB6A 4L48A 5DJ6B 3VWKC 1A5FH 4RKAA 1EPFA 3ALGA 3F4NA 4RFOL 4ZMLA 2GIYA 2D3LA 4UQ2A 4LUJA 5ELIA 4PR5B 1E71M 4IISA 4HJ0C 1U92B 5GGVY 3IK4A 4U6XA 4QRPA 3OTTA 3RVVC 4LDOB 4J2XA 4L1GA 4MLIA 1Q0YL 2IBGA 3SE4C 2HA1A 3UZZA 1ME8A 4WI3A 2OEKA 3AGWA 3HNVL 4HGWB 3WKMH 2G8ZA 3NSMA 4RDVA 5HVGB 5GS1C 1OPGL 3FL7A 5J57B 3EHBC 5D4HA 4XR8C 5DD1L 1OFOA 3IGKA 4CAGA 3RNDA 4N2GA 4JCWA 5D1XE 3MSRA 4R0LC 1P53A 3RFRA 5DRZA 3VFGL 4GIPD 3GDCA 4DAIA 2ABBA 3NACL 4XXCA 1TPVA 3H2EA 2EEFA 4D0CA 3MWAA 1NVMA 3OC5A 3NN8B 5DK2A 3MJ7B 4PW4A 2VQTA 1AQHA 3ZE0E 3N4EA 1FDLL 1J6PA 2DZWA 3IARA 2E4TA 2P88A 3O3BB 3D39B 4YXHH 3TJ4A 1BGXH 5AOJA 5J0BA 3SE3A 1G4PA 5GJMA 1IT8A 1VBUA 4LF2A 2POTA 3PXLA 1NBYB 2CGRH 4G71B 2WC7A 4MQXC 4ENEC 3DFOA 2NY1C 1PCSA 1AACA 3LXUX 3DIVA 3NPSC 5CPMA 4HYVA 4OZFA 5JU6A 1IAKB 2RHEA 1KM3A 3QV6A 1PCKA 5EUOA 1EP1A 4IGHA 1VEMA 2QPDB 4H8QA 4S39A 3S1VA 3WGUB 1H5BC 4JN2A 3HO8A 4RPPA 3TEVA 4PB3A 3IETB 2BVDA 4GQ9L 3BVVA 1TQWA 3MLYH 1OYCA 4C1NB 3HMJG 1KTDB 4PJHF 1E2ZA 2VO5A 4JRXD 4L8SA 4NPJA 3AQXA 2J7BA 4ZW3A 1MDLA 4AZ8B 4X7EC 2PR4H 3KXFA 5F1IA 3KR3L 2BNUA 4K7PL 3SFWA 4NNXA 3QXAB 3SD2A 4YHPA 2VLLB 3QV8A 4ADGA 4KI5C 2Z7YA 2RQEA 4NHUA 4UZGA 1JNNL 2YOAA 1CFQA 4M1GL 1C5BL 2QUNA 4YDVB 1XBVA 3EFDH 2ZP8A 1GVFA 4NNCA 4NERA 2CLFA 1BYBA 2B14A 4JPKH 1CICA 4E2OA 2PEVA 1ITUA 1N6QH 2DQCH 3LKNA 3K2UH 4S3DA 5E93A 1Q9OA 1M05A 2HUEA 3IDGA 2ZOOA 4AQ8A 1LO0H 1HJQA 3C2FA 1BIIA 4E2DA 5HGDB 1EHAA 3VYPA 4EZJA 2FT7A 4Y7MA 1S9YA 3MROB 5CD5D 1IEWA 2GSHA 5F9OH 2X4OA 2WZHA 3N6HA 2BC4A 1C8PA 4FXJA 1NEZA 1OARH 1NMAH 3IJYB 5EEYA 3GSXA 5AC5A 3PR2A 3LMJH 4RRPA 4FO4A 4NZ3A 4ZMWA 3S1UA 2G75B 4YHNA 5HNUA 5CEWA 3ECQA 1KN2H 5HXMA 1JPGA 1E50A 3X3GH 4Q8TA 3LQMA 4JFUA 5DUPH 2HNHA 3WLKX 2C14A 2GJRA 5BRZE 5CGMA 1CI1A 3ULVF 4OD2B 1CE6B 4HIJB 3W23A 4Y90A 1UZ6E 2A3AA 4DBWA 4EAEA 1TVBA 5CWSA 5E99H 1L9SA 4O1DA 2W9EH 5ACZA 2ZXWB 4G2AA 4OTXL 1FCUA 3B40A 3QDGA 3T9PA 1UD4A 3Q8FA 2WZ6A 5FHAL 2OQJB 3DI3B 8FABB 1F2JA 1GOXA 3VKBA 3RYMA 5HDQL 3GLDA 2E7DA 4HKXB 1DQUA 2NQ9A 5I8KH 2DQTL 5C1MB 4PGZA 5D93B 4HJEA 3EB4A 4APQB 3E0IA 5KVMC 1AKJB 5I2UA 3HFML 4K9EC 1OC5A 1RY8A 4Q8MA 3NJIA 1COBA 4GXMA 4W9KC 4ZX3A 1YNPA 1JRHI 3GNNA 1UWXK 1PKOA 4UILH 2ALAA 2F8XC 5HHOB 1TPB1 4GH1A 4NP7A 3MFFB 3O2WH 3TC9A 2R0KL 3KS6A 4M7TA 5DI8A 2H7WA 2JJTC 4HK3J 4F7CB 1FCCA 5DZ9A 1YJDL 1DEEA 4XZ4A 3TF7C 1PKQE 1XFPA 3OZKA 4UTHA 3MYPA 2WSPA 1G4MA 1INDL 3A4AA 2ZG1A 3LDBC 2WINB 4F5CA 1TTIA 2V2WA 3QIWC 5DJCA 4M80A 3S42A 1KFKA 1SGJA 4PM1A 1SPQA 4P2QE 1MCOH 1ZHBA 4IGMA 3GXPA 1B54A 2FTPA 4Q6JA 4WVRA 3TH6A 4A39A 4NUWA 2MIZA 4W89A 3PUGA 4AXKA 3SUUA 1ZTXH 1OCQA 5A95A 3D2TA 1A6ZB 1PTZA 1FQ9C 3FB8A 2J7FA 3R10A 3PWGA 3ZTCC 3IYLW 4YL9A 2ZDSA 3N73A 4BI5A 1E6NA 3KM2A 4ABUA 3MSPA 4GUPA 5KANI 3VXOA 1Q3NA 3FT4A 4PMYA 1I75A 4J3OF 3R1ZA 4IHCA 4E4PA 1EFZA 4CSSA 5FHAH 2A73B 1TTFA 5FF6A 4LGSB 4BXVA 1M5WA 4EXAA 1EZSA 1DQMH 5B38G 3ME0A 4AC1X 1RPKA 4F8XA 4G7SB 1GC1C 3NZHH 4KRMB 4LQFL 4K07A 4OZIA 2FB3A 3QWQB 2GK0A 4KRPD 3H2OA 5GSVA 5JHDE 5D7KD 1IWBA 5FF2A 3DSNB 1KEML 3C2VA 1GTNA 4P9HL 1E0XA 1CLYH 5DA4A 4OJFL 1E8YA 1ZTVA 4NWTH 3PP4L 4JDBA 3I10A 1E72M 4JQXA 1D9KC 1NF0A 4U3SA 1O60A 4GX9A 2F6AA 2E5EA 3C6LD 3WF0A 4XMXA 4JCMA 5LIWX 1EFXA 2EDEA 2YMTA 3KJ6H 2K78A 2EDRA 3N40P 5GZNC 1TSRA 4DXXA 3ZX1A 1AZUA 1GW1A 4NKQB 1HNFA 4CC1A 3IEBA 3LCIA 4HFUL 1F4AA 1MQPA 5CKAA 4WW2F 2WZPD 4HKJA 1D7FA 4OIFA 5DYOA 1CVRA 3SQOL 3BZ4B 3KEHA 2FGZA 4E4FA 5GS2H 4PGJA 5BRZB 3LIZH 4ZD3L 1AGFA 4GUFA 5I74C 2ARJB 2ARWA 3L6FB 1IKOP 2EYTA 3RB7A 4RCXA 3VIJA 2PDUA 1YBQB 1SW3A 3GSNB 1FUYA 3I75B 2ETWA 3BQ5A 1CWVA 3K3QA 3KLAB 1XGTA 4A7GA 1WXYA 1MUWA 2OR9H 3CFUA 3MDUA 5JQ9A 2PDGA 4EMZA 2PDNA 3ZHNA 3W9EB 5KVGH 1EX0A 2XVGA 3A23A 1ZWIB 1UWGH 5D7EA 3QK0A 3SW6A 4XUGA 1MLBB 2PMQA 4ZSTA 3IFLH 4FQCH 4IM4A 5D7IA 4ELME 4CCDA 1LLZA 1FH9A 1XLLA 3W24A 1UTDA 1VC4A 2FB2A 4JFFE 4UQ3B 5L6YH 1ZAGA 4G7EB 1SMAA 2E86A 4LHQB 3EKCA 3L66A 1FFRA 2JTDA 3GMQB 3KPLB 5MP6L 3KUMA 1PBGA 2CO2A 1M2OA 5CILL 4YWGH 5DHYB 1E67A 2F7IA 4G8GE 3X11A 4G7EA 4OF3A 4X0NA 3FQWB 2OSYA 1H9DA 2E3ZA 4LE8A 1UGKA 3VKDA 3JWDC 1N64L 4NAFA 1N59A 2VFDA 1FWRA 1KCSH 2CO7A 4BM7A 5K9QI 4PGDA 4L4LA 3HG1D 2VCAA 3AHXA 2COQA 3AXKA 4I88A 3UAEA 2J88A 4WY0A 1KC7A 2N1TE 2Y36H 3KPOA 2JELH 3MRLA 4P2YA 4QGYA 5DEFA 4FRWA 3B9AA 5AQ0A 3FKRA 5C6TL 3WLHA 4PYGA 5I74B 3OZOA 4DZIA 3VXNA 2Y22A 1JOIA 4ZYKA 1EP2A 1UUSA 2TPSA 1DVYA 1NUFA 2X1SA 3UBXI 4IMDA 3IFPB 2WLIB 3S2JA 1BJMA 3DSFH 2VDQL 2ERJC 1WFTA 3DMMD 5I15H 1AJ0A 1RFDH 3SJ3A 3U0WL 5ICUA 1B3IA 1A7RH 1NSNH 1A5AA 4C5ZA 3H9SA 3RFZC 3KYOB 2FJGA 1TEFA 5H35B 1EVUA 3LHAA 4I0PB 2E7HA 1IEBA 3LCYA 4Q7NA 4Q6YA 3TBSB 2X1RA 2Z0IA 4P3DA 3BZFB 5JBFA 4LSQL 4MOZA 4L4JA 3C2OA 2Q3OA 4WKHA 1XG3A 3OR7B 4Z0BL 1QZ1A 5M3WA 3X3FL 5C0EA 3BPNB 4P8QA 3KYOA 1U3ZA 2XTJC 2O5XH 2B15A 4I9TA 5SWSA 3TYFA 3ZMNA 4IMGA 1CFSA 1R3QA 4WXYA 3KPPA 1A5SA 2AJVL 1U41A 3OGCB 3ZTDC 5C6TH 2L5HA 1OB0A 2FMOA 3GW0A 4C1KA 5KUMA 1Z6KA 4EPDC 3E2RA 1A53A 3R4DA 3D0LB 2HP4A 2YRBA 1P5BA 2D2GA 3TYFB 4RRPG 5FV1L 3SY1A 3RGBA 4NZUH 3UWUA 1ZDSA 4S11A 5C6PB 3RYSA 1S8DA 2QSVA 1PZCA 3E3QC 2CXGA 3O6KH 4ZPTB 3TVMB 4K1GA 1NPNA 3D0LA 3QJRB 4HWBH 1IWPA 5D7JC 3UXFA 5D03A 5HULA 1NCDH 3KAOA 2KYIA 3F2LA 1WLHA 1J1XH 4HUCA 4JR9H 4S1DC 5JIQA 5D6DA 1XKJA 2RGLA 4LEBA 2XXCB 3QFJA 1OQOA 4WI2A 4BD4A 1B3OA 3KWSA 4UT6H 4YNYB 3VQLA 3G22A 1H15B 5B39A 3P4OB 5EU5A 2VCOA 4M5YL 4XP9H 3K71B 3TFKD 1L7IL 4GE8A 4AY7A 2C3GA 3GMOB 5DWUL 1OFEA 3KCWA 4JFFB 4BGDA 3WTVA 2IH1A 3PHAA 1WVZA 4XWOC 3GDMA 4XAFA 5DQPA 1N8FA 3VGHA 3QWRD 5F96L 4Y4FD 2PW2B 3CC5B 4FX8A 4UOW1 2CGZA 1OSPL 1N0LA 1HOEA 1IAIL 2K70A 3EWBX 4QQUA 1JPSL 4PYHA 5DRCA 4C6NA 5KVDH 1F90H 2QUTA 3DC8A 1F0LA 4G70B 1U8MA 4WTWA 2J6EA 3D69B 1H3XA 2ZVRA 3DOSA 2Q8BH 2J8TA 4H8PA 3SY8A 1R85A 1Y65A 3FCTA 1NWOA 3TMLA 5HJLA 4X4KA 4A67A 3BI9X 1HN1A 2PCFB 3R0UA 5DMMA 4HPOL 3G3MA 4GINA 2UWEA 4PGCA 2BWGA 5CEZH 1TB3A 4FPSA 4GPVA 2PO6D 4K5OA 4ZFGH 3TESA 3AHVA 3QXAA 5DD5L 5C0BE 5JPNC 3HGJA 1AIFA 4X2PA 1VJSA 1W3KA 1CFQB 5IB2B 3UCQA 4XPFH 2FQDA 4XVSL 1LDCA 2QHAA 1XWVA 2N7BA 3RDJA 9RUBA 2FVNA 3VXUD 3H2MA 3PJWA 3QQ9D 5BO0D 3MRNA 1TO3A 1WFNA 3UTSB 1LK2B 2ZCZA 1KJ2L 1KJ2H 2J6EH 3KL0A 1DJNA 3HURA 3UW6A 1UCBL 3D50A 3KJ4C 3LHWA 3VFRB 4PI0A 2XIMA 3SE9H 3QPZA 2VIRB 4JTDA 3FQXB 4PRNA 1KCXA 3IJLA 2E9JA 3L3KA 3WS3A 3CAVA 3QC3A 3TLLA 5FESA 3FA3A 2J7GA 4NQCA 3NPWA 1Z5LB 4DP0X 5CUSL 4WJ8A 4IMLA 3L5AA 3E9UA 4XWUA 3HZMA 3WQDA 3LPFA 1XDTT 3VFRA 3DRQA 2Z24A 3VFOB 5HR6A 2V7HB 2VDLL 3CDGA 3L3KB 4DCQB 1OF2A 1BVLB 2XTLA 3EJYD 4JN6A 2B1HL 2VQUA 4HT1L 3T0EB 4DN3H 2Q8LA 3S6DA 3VVGA 3WGVB 4B7LA 5CGYC 4S23A 1LORA 3Q2NA 2F7OA 3O4OB 4GG6F 2IIJA 1XYBA 2OZTA 1SXNA 1JFQL 3CHRA 2Q8AH 3RTQC 1PYMA 1KN2L 3SOTA 2CZEA 3SYCA 4KRZA 3TLRA 3ESOA 3WEMA 4JVPA 1NA8A 5A3IC 5KSVA 3T0EA 1S38A 4PFMA 5TBOA 2XVPA 2CJUL 4LFYA 1IL1A 3OPSA 4F58L 4NSBA 1ENUA 2P53A 1INDH 3BVNB 3QZ6A 1A47A 4G80B 4U4BA 3K74B 4D6GA 1ZS8B 4OR1A 4TOQA 4ZFMA 1MI5E 3PWNB 5U4NA 3PFRA 1J0IA 1BMZA 3QYMA 4YTSA 3O3AA 4X4XB 4X5RA 1SBSH 4F7CA 2WC4A 4RW3A 1FNGA 1IGYA 1IL1B 3I4KA 1AD1A 5KITA 3RI5K 4KOBA 4JD4A 2BNQA 2YZ8A 5FUZH 4PJEE 4AGNA 1NAMA 4L9LA 3QJSB 4JHZA 4MQTB 1LNUB 3W2MA 1KGJA 1TU2A 2DM2A 5BZAA 3SI9A 4KKLC 5DJDA 5FB8B 4OJYA 3QV9A 1HKMA 3V4VH 4PREB 2X4QB 3BRGC 4PCTA 4QXGH 1GQIA 2YEQA 1J8HE 3OC8A 5C09E 4GWEA 5F0PB 3RIKA 3W25A 7A3HA 3FQUB 5CC7A 4DP1X 5E5UB 1HP5A 4GIYA 3EBIA 5I3KA 3EZ4A 4GUPB 3WFHB 3AU1A 2HVJB 2NZ1A 1H3PH 4MAUH 1Y0EA 2PP9A 4QSHA 1W8NA 5EO1A 1GK8A 4MWAA 4IIQA 1NMBL 2VSMB 3T0WA 3HHSA 3NQGA 5E2TL 4P46C 3IMRA 2XY2A 4OGAD 1OKEA 4BYHA 3AQDA 3FQUA 3KPQA 5C0IA 4W4OA 1A0CA 3H0TB 1DE6A 4WWKD 1DQQA 2C0HA 4I2XA 3BSGA 2FJFA 4R84A 3ARGD 3RIAK 4IBZA 5CJXA 3T42A 3PUCA 4KK6D 4LSPL 2QVKA 4KKAC 5T33H 4QYOA 4BQ8A 4FYTA 3H6JA 5HGBA 5FF3A 4YSEA 4IIDA 2OMYB 5BZXA 1A5BA 1RVGA 2QCMA 1MHHB 1NIEA 5TF1H 3ZPDA 3MBDA 5BZDA 3FU8A 1F42A 1ZSXA 4NQTA 4HBKA 2UY7A 2GI0A 3ZGIA 1IRAY 5I6MA 2EPHA 3UU0A 1QNZL 3B8DA 3DG6A 4JVWA 4L29B 1FGVH 3ULVE 1EIBA 3HN3A 1CB2A 4UIMB 1I9EA 1XMEB 2HKFL 3B9KB 3L3JB 4N2OA 1VFTA 5TFSL 1P7TA 1HILA 2AKMA 4HUXB 1VGAA 5HBFA 3PIQB 4HXBH 4TMBA 4RWYH 4PRWA 1J8RA 3OB8A 5AUMB 1OM3L 3W82A 1FHLA 1H5VA 1OFAA 5FM5O 1G43A 2Y8VA 3NJJA 3OLIA 3A47A 5AOKA 3WN5B 3SN4A 3QUZC 5JHBA 3LHPH 3VINA 3IMVA 8XIAA 5KVEE 2M2DA 3L5WA 3LB0A 3US1A 1FN4A 1HTIA 5IBXA 4ACTA 1MCIA 1W1YA 5GIRA 4LRNL 5EO9B 1RHHA 3M47A 2WLKA 1QBLL 1AD9B 1GYCA 1MVFA 3CDCA 3DVNB 3F5WB 3OAYH 4YH6A 5SV4A 1EUNA 1QBML 3BWAA 3U1SH 4BRVA 4Z7WF 2J62A 1TJGL 4M3HA 1A5LC 3NZRA 2GCYB 5CILH 5EU6D 4CNNA 3QRGH 3VXTB 1H62A 3BUVA 4K3EL 2JQAA 1KV8A 4JDVA 4ZFZA 5L0QC 1I3GL 1EAPB 2B5IB 3DVNA 3KWTA 3HLAB 3HHMA 3ZU8A 5I6LA 3AG3B 4UWQB 5KBMA 1UOZA 5AC8A 4HIXL 4KTDH 2ZWKA 1JNLL 3TBTB 4JDEA 3VCLA 1F58H 2QCHA 2ZQ0A 4X5XA 3HVDA 2ZYFA 1QT1A 2DZEA 3C6LC 3WFDH 1KUMA 5IFJA 1S2CA 2ESVB 4NPKA 2LGNA 1TTQA 1XBXA 3MCOA 1IE4A 2X09A 2Z1XA 4B2DD 4DELA 4DPQA 1WK0A 2PPFA 3EG9B 4Y4HD 2ITCB 4RETB 2ZC1A 1FNHA 2OCFD 5BXFA 3S4TA 4P5TD 2BSRA 1C1EL 1E2WA 4PJXA 5ABDE 3NACH 4QTHA 1NCAH 4D71A 1MFAL 3M1CA 4NUGH 2XFXA 1QUNB 4LLAA 1YDPA 4LOEA 4YHOL 2Z34A 1NFDA 1CE1L 2R1YB 4Q2ZB 5E5MA 1W1IE 5DBTA 5I18H 5IFHH 3DMMB 5TPWL 1U42A 1XIDA 4NKIL 4RQQA 3W7IA 4AZHA 3RR1A 3G1YA 1TSHA 3IF1B 2IPJA 4UR9A 1EBPA 5K33A 1OPGH 4LDLB 1C7SA 3C5JA 3HF3A 1RUAL 2BSBA 1AZZC 1TZGL 4HAFA 4HETA 1VF8A 2Y7EA 3TTEA 4K36A 5JQ6L 3VA8A 1MFEL 5C0BD 1V6XA 3F7YA 1U83A 3A5FA 4KZ0A 4UBPC 4L4TA 4AYMC 4X22A 3BG5A 3GSNH 3D4ZA 3B3IA 3VFSA 3S1WA 5DRWA 5CBEB 2R82A 2FWSA 4PJ7E 4QTIL 1Y18B 1GQKA 3O6AA 3WNKA 2TYSA 2CRZA 2IPUK 2CUHA 1N19A 1R6WA 3CFNA 4KQNA 5CBAB 3BN9C 3VYNA 2OR8A 4UT6A 1VFBA 4PJ5D 1KB3A 3WNIA 3BH8B 4FLSA 4GSDH 5C55A 5TE4L 1SHWA 4I9WE 3G0XA 1QG3A 3MUJA 2F7PA 3ZHDA 1EHLL 1POKA 1AK5A 1W32A 3TA9A 4D8LA 1PG7H 1WZKA 5AC6A 4K7FA 1EJ8A 2QSCH 2PDXA 4EAMA 1DBML 1NOFA 1R87A 3GXTA 4JM2B 1PKQB 2QAPA 1HJSA 3AHTA 4HK3N 4JZNB 2ZSVB 4AWEA 2XVLA 5TIMA 3OKOB 4UNUA 3JWNE 3M88A 1MNZA 2ZCHL 1CG9B 1RSYA 1TJIH 4U6XB 3LZFL 1J1PH 4NLHA 1P4LA 1FRGH 3V4PH 2REQA 4QG6A 4LCSA 4N90E 5HI5C 4JZNA 1HS6A 2ITDA 4F8OA 1U5JA 3T55A 3LMJL 3QC5X 1U8IA 5I1EH 3TJHD 4WHYG 4NQQA 3WO4B 5JXEA 5FS5A 3B56A 4HF5L 4PJ8B 2VMDA 4POCA 5D7SH 5T1KB 1A6UH 1W0MA 1ZV2A 2JEQA 4PJXF 2VSCA 4Q7DA 1RK0B 2ZWSA 4PLKC 1H7OA 1WHPA 2RR3A 1A4BA 2AJZB 2BOEX 4N0CD 1WG3A 1TWZA 4UTTC 4C6EA 4DWSA 4UOJA 1H3TA 5C9WA 4PTUA 3DPDA 4ANVA 2ZVIA 3CNYA 4PL2A 2XETA 2BVUA 4ZFGL 3C0JA 5AL8A 3MPCA 1JPKA 1AGEA 5IV2B 4S1SH 3HQPA 4RV3A 1REIA 2AJSH 4PSPA 1OTTD 5HDQH 3HOJA 4M51A 2FR4B 1ONQA 2J5LC 3BZJA 4KKBC 3R79A 5DELA 4I77H 3QDJA 2BPBA 4ILSA 3D48R 1R3VA 3BT2H 2NY1D 5INDB 3W7PA 3QW9A 3AFBA 4E0RB 5BXPA 4X6FA 3W29A 1JMXA 1DIKA 5IV2A 3W1NA 4N90D 5LJYH 5EUOB 1KYDA 4DY1A 2Y89A 1F90L 4LZKA 4PJ9D 2QFRA 3QZEA 4HJIA 2VJ8A 2F61A 3LNIA 4GP8B 4HWBA 4UF7C 1QU4A 4NVTA 4S1FA 5FGRA 1YEFH 3RWDA 1PPIA 3PJUA 1NKOA 1BFVH 2QDVA 3RM4A 2R59A 1QFWH 3IPBA 5FAGA 4LVAA 3F7QA 4QUOA 5DFTA 5IB2A 1ZGLM 2WZIA 2HB0A 5CPTA 3EXSA 5JIWA 1YEWA 3AZTA 4DM2A 5E8EB 2V63A 4AX7A 1JGIA 1QYGL 2CHZA 1JCNA 1KRAC 1N7ML 4F1ZA 4YHNB 1ZAIA 1K3IA 1KB9K 2PTYA 5A2BA 5FKYA 3NJHA 2O26U 1YEDA 3V6OA 3EJZD 1OK4A 2PAJA 4DJEA 4JICA 3K2UL 2AK4A 4K7PY 3LZRA 4G8IB 5TJWK 2VAAB 3W5MA 1JCJA 5E5LA 4ES8A 1OABA 4NUQA 2ZFAA 3HE7C 4KZEL 3FK4A 4U4MA 2D4FA 1M05B 4NQCB 1OX4B 4PCNA 3STLA 2A7RA 3KOFA 4D9PA 4TU1A 3QEQD 1S9YB 3MROA 1HF6A 4A2GA 2ZCKL 5T1MB 2IXVA 1C5CH 3DRQB 3QJTB 3GBML 4X5LA 4XNXL 5DR5H 2N0KA 4ELDA 5F9DC 3RJQB 3C12A 4MA3A 5ITFB 2YRZA 3VYOA 4LARL 4ADJA 1D8WA 1YLBB 2IWFA 1JZEA 3LZLA 3GJFA 1CT8A 4HKXA 5BZWA 3UTSD 2IQDA 2R9RA 5EMKA 4AF0A 3MXVH 1O7SA 2GZXA 1AZBA 4IX0A 1ILSA 4L8DB 5DF0A 1I1FA 1IQDB 3GUTA 3HVNA 4H3DA 2ZXGA 4IGBD 5G5DB 4X0KA 3KTXA 1SF5A 2WWOA 4QE4A 5EH1A 1NC2B 3RWEA 2AK1L 3WYRA 2WCGA 4XUYA 4AVNA 3S6OA 1VACB 3VFVA 5JIMA 1X3DA 3X12B 2X4NB 4HC1H 1LE5B 4ZUWA 3GUTB 5A6KA 2XZ9A 2V2WB 3VXRA 1WAEA 4MY9A 1B9ZA 3UMNA 3V6FB 4L23A 1HCYA 1I1AB 4HUWA 2PI6A 2UZIH 3DX0A 2FD6H 3DO4A 3RE0A 2OAAA 3MFGB 2OL3A 3N1GC 2XIOA 3ARBA 4Z7VF 4EOWH 4XZWA 4G6CA 2VB5A 3EFOA 2W59A 1Y1UA 2IQAB 2W07A 1I60A 1MRDL 1OK0A 4TKWA 4O8RA 1V0KA 5DMLA 2DUAA 3F7RA 2OM5A 3RK8A 3V55A 1P7BA 1RCXB 3LRHA 3WS6A 4Q6KA 4OGAC 5F3FA 5BROA 4O4WA 2XWJB 3ARBB 4AE1A 4ZB0A 4L9YA 1AY1H 3O8XD 2BHZA 4URTB 1Q9KB 4F2FA 3K72B 3N2TA 3UMTA 3WAJA 5TNVA 3POHA 3ECBB 3QY6A 2YAPA 2MKWA 3UO1L 1F3DH 2UZYB 4BHUA 3FJ4A 3SGJA 4XNUH 5T5FH 5FA3B 1F58L 2NLIA 4A6YL 5DO2C 4WUKL 4P5RA 1OVZA 1JF5A 3U57A 3LNFA 3IU3A 3A64A 2VFHA 2EKJA 3HMWH 1BZ9B 2F5BH 1RZ7H 1Q9LB 2GIMA 3MRKB 2AQRA 1YO4A 3QHFL 4NJAH 1Z3GH 1Z9NA 5PCYA 2MCMA 4DO6A 4S3KA 2Z1BA 1YYCA 1KR1A 1IF2A 1R86A 3GUGA 4MIMA 4X3ZA 4X63A 3TIMA 3B2DC 1PEWA 2ZXQA 5BZDB 3IVTA 2FPVA 4PRBB 1U3YA 4FQ2L 2J8UB 4S0TD 5EWIL 5D1QA 1MEHA 3HRPA 5AKRA 1S2AA 1Y5XA 3P8IA 1S3KL 1H3PL 2YB1A 3PF2A 3HS0C 1DWIM 3ES7A 1L9PA 2HFTA 3UEQA 4EN3A 3EJPA 3OV6A 4B90A 4NRRA 2YD6A 3W2NA 2Y6SC 4YDLC 1IQWL 1J11A 1VB9A 4J27A 4JUSA 3RA7H 2EVIA 1J12A 3WDPP 3MOBL 5B4MD 5EMUA 1AXTL 5K4ZA 3DX7A 5EN2A 2XXMB 3N43B 1SN0A 4KPHH 4OZHF 1JGUL 2C6QA 4FTDA 4OZHB 1DIOA 1XRFA 3ZIMA 3GR8A 1OF8A 2E67A 1XPGA 1R9ZA 3CHVA 1TR1A 3G77A 1FLRH 4UTMA 4G5AA 3LK6A 3CL8A 1KV7A 1TEYA 2C5DC 4M7LH 1BWKA 1BJ8A 5DFVD 1ME7A 2ZOKA 1CXFA 5A40E 4F2ME 1XCQB 4M6OH 1UWIA 4MF4A 2EXYC 4S1QL 2CERA 3IS1X 4WWKC 4KI1A 3RGVC 1LLOA 4JR5A 3N85L 5T3XH 1PTGA 4AIZA 4C6JA 3MVSA 3T6ZA 4HQQH 4Z3IA 3TA3C 5A2FA 3ES6B 6FABH 2EH7H 2ZF9A 1OIOA 2VC2H 3BGFB 4X6CA 5IREA 1NDMA 1GVSA 4JB9L 4OCNC 2CHDA 4ONVA 2OJZL 3WBAA 1EAQA 4IJTA 1WS7A 4KK9D 3M0VA 4AMWA 2Z64C 5EBMA 4X9IA 5ADPH 3EKZA 3DROA 3HG1A 4RMVA 3TR9A 1THFD 4D9LH 4F9PC 1XC6A 1RZKH 2BVQB 3T40A 4GZIA 4HHLA 1KLUA 4WGVB 4WNJA 4FF5A 2Z93A 1ZE3C 1YG9A 4Y8AA 4N4QA 1X5IA 2GBTA 4XZIA 2VDOH 4E68A 1F86A 5KG9B 2ZADA 3TT3L 2BSRB 4AUBA 4FERA 3AIQA 3WEXA 3QPYA 1XKYA 1AD4A 4MB4A 5JHLH 4Z7NE 5AVZB 2AJSL 1RZIB 1NFDB 2R1YA 4OM1H 4IBSA 4Q2ZA 2ISWA 3N6JA 4LVGA 1I8UA 2X16A 3I50L 6REQB 3WNNA 1T1YA 5E56A 3V3WA 2EG7A 4WWID 1HQRA 1CXKA 4HG4K 3RI5F 4DERA 1CDHA 4JFHE 4LL1A 4OM0H 1L5GB 3V4PA 5I16A 5I23A 2Y6ZA 4P4KD 3SIKA 1NGYA 4Z5RA 1JNHB 4S10A 4NQVB 3NQIA 3OXRB 4KV5F 4L4VA 4XBMA 3G1XA 2IGFL 3TYDA 4U1IB 4JO4L 3RMEA 1L0PA 3D4YA 5CLZA 3T2NL 3AROA 1AHWA 1BGAA 1XLFA 1EAOA 3L5XL 2UV8G 2XQBH 3VD5A 2IDTA 3HB3B 1FO0H 5EC1B 2WW8A 4IXHA 3RRAA 3Q67A 1AC0A 4D8ZA 4JRYB 5GGVL 1AGBB 1OAYL 1VADA 1WAPA 5EA0L 3V4PL 4JQ1A 3D2UA 2YD4A 2B20A 4WNQB 3PV6A 4CU6A 4ZNEA 2PGFA 3AT9A 3WD1A 2B39A 3HPXA 2O5YH 3RU6A 4DX3A 1YECL 4YDKH 2J88H 4K7FB 1V0NA 4WWKA 2AGTA 1ET8A 1LO3H 4FTVA 1WX0A 3ESMA 4P3DB 3ZJ7A 2DDQH 2R1KA 1W72A 5I75B 1ICQA 1OWQA 4UTWA 3NVQA 4AHOA 2X3BA 2ED6A 3L16A 4TVCA 5KSAB 4AT6B 5D55A 5LVEA 2VDPL 1S9XA 1G4TA 1DTUA 2W6RA 1JK8B 1E3FA 3IGUA 5DJ0A 1HXYB 1PG7L 3TWYA 3NABL 3NVDA 4UTCA 3OKKA 4HDIB 1PD1A 2ITEA 4P57B 4PGBA 1TE6A 5GPRA 3IRSA 4HAKA 3VTMA 2REQB 1JWMB 2QADD 1FG2B 1T2XA 1JZFA 2I9TB 3NCYS 4GOSA 4JIHA 1P9MC 2A4ZA 1CI3M 1ED3A 1RPQA 1A0QH 2F5AH 2Z92A 2X87A 3ETTA 4HCFA 2WBKA 1NDGB 4KMTL 4EN3D 5TQ2H 5JIPA 2F58H 1I6NA 3B97A 5HMDA 3CXHJ 2XZ7A 1RL1A 1W72L 2Y7MA 3VRIB 2HROA 4NYLA 4XT1C 5JUVA 1N5AB 4YFLI 2CKSA 4FQXA 4X8GA 5I71C 1IM9B 4PHXA 2PW2A 3BVWA 4OD1H 4K71B 1A4JA 2XH7A 3B9VA 3IB4A 3ECUA 5I1JH 1N8WA 4IYKA 2OTDA 4AIXA 5E2WH 3AI0A 4MKTA 4R4BA 5FO9A 3C86A 5E6IB 4QM1A 1GMIA 3FZUC 5HHMB 4Q6IA 3GSOA 3ME3A 3VYLA 3EMCA 3GK8H 2HN7A 4PCSA 5DZPA 4YNYA 4B0MB 2R24A 1RHFA 1E5YA 3L3GA 1IGWA 3B9NA 1MCBA 3K7UA 3PNWA 4EDWL 1U8JA 1DJGA 2NYYC 2ISSA 2EO9A 2NX5A 2QMKA 5F72S 4GZ7A 3ZDXE 1X5LA 1JGEB 4IRJC 2A0LC 4TV3A 4XN5A 1DQVA 1GTHA 1Q63A 3PAUA 1W3NA 5T9CE 4M6MH 4ZAKB 4NJHA 3PP3K 2J4WL 1VZGA 1U8JB 2VERA 3NCCB 5D2WA 3NFSH 5DD6B 2W81C 5KYYA 4K15A 4N3UA 3GHSA 4NNXB 2FBJH 1G1KA 2OMUB 3PGDA 4KZDL 5GJTL 3TJIA 4U1NA 5H1WA 3RWJA 1J8KA 3QIUA 1GOFA 1AZCA 4GUCA 3K1DA 4ODUA 3VX0A 4WEBH 5GS0L 3MV7E 1UR9A 4O02A 2DSKA 2VUNA 3LI1A 4ZVJA 2FWUA 4QTFA 1J1XL 4JR9L 3NGJA 3FT1A 3GSVB 4GW4B 4FK9A 1MVUB 3VXME 4PLKD 1H8OA 3AVEA 1WFMA 3ARBC 5HPMB 2ACQA 5LN4A 2APWA 2YPLA 3VWKA 4XKYB 1FHGA 1WKDA 4R83A 3WIFA 5SX4H 3UJ2A 4KC3B 4Z3JA 1KYOK 2GQ3A 1U0QA 4PJFF 3T4CA 1EDHA 1F3XA 4PRPD 3FUMA 5C0FA 5F7AA 3F7LA 4GW4A 4XMLH 4Q4MA 3ZKXB 2HTLC 3KCPB 2IFFL 4FMVA 2NQJA 3EYUH 3FYPA 3I6LE 2ZWYA 4GA8A 4WFGE 4F2EA 4AUUA 1S5TA 2AQWA 4JFVA 3EX1A 3F2DA 4MAVA 2O9RA 3O6FA 4QBXA 2XNAB 1WA2X 3NURA 2ANUA 5LA2A 5HJGA 3NH7L 3GR7A 4Q9QL 1P4BH 2OMZB 5FPIA 1R5IA 2K8MA 1T3FA 4JFSA 2EO1A 1TPDA 1SM3H 4BF5A 4IMLB 4M61A 3NK4A 3L7FB 2ZXDA 4B41A 4Y9PA 4FE9A 3S3GA 1Q5MA 5EMJA 3HA1A 5HYJD 3MRGA 2KBGA 3GIZH 1HNYA 4GKTA 3SIZA 1YAZA 2PUQT 3AACA 3FRPB 1R2RA 4MNGA 3EDEA 1WJ3A 2HVBA 3FTVA 4YDIL 2QPFA 3L7FA 4ACYA 3I6GB 5ICXB 4FFWD 3M7OA 3VMPA 2E9LA 2V38A 4DVRL 3CO8A 2DT0A 4R0LA 5LNSA 2JGYA 3SHSA 2UY6B 3QUZA 1LDSA 4PREA 4ZXBD 5E9AA 2GSJA 1P6CA 4XG1A 4MFDA 5A3HA 3VXGA 4RL3A 4KUZL 3WF4A 4ATLA 1JD9A 4L8BA 2JK5A 4YZFE 1PW3A 3LKQA 2VHLA 1V7NH 4PAZA 5CR8A 3EGSB 1PD6A 1RJYB 3GSRA 2G5BA 4FQJH 3C0LA 4YUEH 4S3CA 3R58A 2EIZA 3TYAA 3RKDC 3MLSH 2F7RA 2IEPA 1EGZA 4Z95L 4JKPH 3SKMB 2E5CA 3U2OA 2P8PB 2KT6A 3H0TA 3P3UA 4HUMB 3NBNA 3NA4A 3E6FB 4UNIA 2VT0A 2JCCA 3OKEA 2V5BA 1A9BB 6TIMA 4LHJB 1F5ZA 2JQXA 4CVWA 4ML4A 4AQLA 3L17A 3KZ8A 3EJCA 1TV4A 1JI2A 4DJDD 2JBMA 5J13B 2YW3A 1BFTA 4G7VH 2YL5A 4ERSH 5I6XB 1RQEA 1GHRA 1CLYL 3C6SA 1I85C 2JIWA 1G7PB 4GIAA 4DZ5A 2A6IB 3EX4A 1MMFA 1KBGH 1A9BA 4XVTL 4QRRB 3QJZA 4W68A 2AKZA 3CZLA 4Q14A 1XLIA 3QW3A 3AITA 4Z0XB 4F7MA 3SBPA 1QJWA 1SW7A 3DBNA 3KPRB 4JG5A 5FCUL 1KLFA 2AQPA 5IKCB 3T6WA 2ATAA 4PRPA 3M5VA 1PZ3A 1S9WA 3R25A 3NSYA 5AOIA 5HHQB 2DP3A 1FUNA 2WO5A 2XSAA 5CEXA 2FYVA 4LV9A 4KKAD 3VUPA 1R7OA 4NXSA 2YBUA 1OAYH 3TCSA 4H7VA 4PRPB 2FEEL 4I4WB 3VNDA 3QMTA 2FHFA 3U2SB 1R2TA 1WZLA 1S46A 1VP5A 1IAIM 2VGLM 4NZRL 3HG3A 4LSSL 5D9MA 4V1DD 3T3PF 4HULB 2W61A 5CC6A 5I66B 4XCCL 2Q5BA 5AY7A 5IVXA 3L3JA 3AZUA 4FL4C 1UJQA 2J8HA 2VXTH 1A4KB 1KNOA 4X5WA 1FDJA 4DVOA 5F0LB 2AJUH 5I1IH 3GD1C 4N6EA 3VD9A 1OJXA 3SJVD 1YHTA 4AL8C 2NPLX 5AUMA 2R8SH 1FVPA 5DC0A 2EO7A 5MERA 2E6FA 2KDGA 5D1ZI 2IAMB 1WD8A 5HJBA 4S3FA 5MHBA 4U4IA 1V3KA 2H9AA 1EC9A 2IAAC 5BW7C 2XBTA 4NZCA 2PPDA 1CDGA 2R2EA 1L9NA 4X5XB 1ZWIA 2AS5M 2W63A 1ICPA 2J77A 1LP9E 4IPLA 2DMHA 1ML1A 5IFJB 5LWYH 2R69H 5D7IF 3GKZA 2KKQA 2V6AA 1KLYA 5D7IB 4Q9BA 2AABL 3SQBB 1IT9H 1NJ9A 2UXGA 3IPEA 1TZ8A 3EYQC 3LEXB 4QE5A 2GJPA 3DROB 3HG1B 3O9WA 1IIHA 3C9NA 3KH4A 5GRJH 1ZHNB 3NAVA 4BE6A 3MCNA 4X2RA 3MZ2A 4P2OA 4OD3H 2WMIB 4LY4A 3CS2A 3MBWA 3Q3GB 3GEFA 4JFWA 4AYGA 1UQSB 2FLMA 5ID1B 5LBSA 1KCLA 5HDLA 4O9HH 5JZ7D 3C0SA 1IGIL 4JMXA 2AXGA 3NFPB 2OZ8A 4KVNL 3OG4B 2V8ZA 2OMWA 4YR6A 1WBZA 4WI8A 1LTDA 3UESA 4RV8A 1BX2B 9CGTA 4WI6A 4HQQL 4XC3L 3BZEB 2O7SA 3U7VA 3EW3B 1VKXA 3O3RA 3W28A 1QRQA 5G4NA 1U2CA 3SOBL 3B3IB 2IGFH 2FL5A 1R8LA 1DSWA 2WQSA 3UPRB 3IIOA 3DVFA 3JV6A 3HZVA 1XXFC 3BCJA 4R8WL 5KZCB 4G8EA 2IG2H 2NY3C 1L4IA 1Q8MA 2AJ3B 3H4FA 1DWJM 2Y3AA 4QRNA 4NZ4A 1NGPH 2QHLA 3N44F 3QUKB 4UT6L 1J9YA 4P2OD 2GSMB 3PWVA 1EJWC 3ULVL 3MBFA 2FSDA 5C8JB 1GVQA 4GO6B 4P48A 1CF8L 1QTSA 4CD6A 3OB0K 2DT2A 4TYUA 3SQMA 4D6DA 2D7OA 3DTXB 4X6EB 1TOXA 1MCQA 4X7TB 1KNWA 3O15A 1SBBA 4JYEA 2Y1ZA 2GTZB 3G5YA 1JHLL 2P3ZA 2NSOA 3VAVA 2V2XA 2P44B 1SDDA 1D5XB 5F1UA 2BOBB 2P42B 2AEOA 1BBJA 5IOKA 4MYWB 4B3EA 1TV2A 3B6SA 2QPXA 1AFVH 5C9RA 3CFKB 5CZSA 2Y6TE 2IPTH 1T7WA 3O8XC 5HGHA 4TQTA 1BXAA 3CHDA 4NGHH 3RX5A 2AK4E 3GHEL 5I17A 5JZ7C 2VDPB 3H6AA 1YEIH 3F4DA 4TXEA 1BG9A 3HR5A 3JWOH 3NGFA 4YS4A 1Q2SA 3ZYIA 2X7LA 4NBYB 1NWUA 1KY6A 4H8HA 1A8JH 1X7IA 2CDGA 3O41A 3F8UB 5H2BB 1ZBKA 2VYRE 5F1NA 4RX4D 3CFKA 3MLUL 1U8IB 1RHCA 4FX5A 3FFSA 3ES8A 4XBJA 3WSUA 4CBZA 4L5ZA 5F21B 4IQEA 3NT0A 3C0QA 5D1QD 3FPYA 5IM7B 1FDZA 2CE6A 2E6JA 2Y2TA 1P5UC 3DX9B 4AVHA 5BOJA 1HE7A 5ALCL 1BF5A 4KI5D 1KM0A 1GSMA 5C9KA 1Z41A 2V5TA 2ZOUA 3ARDC 3ILEA 4LF3A 4NZFA 1MREH 1HDMA 5D30A 3H8AA 1YDNA 1EGVA 3GMMB 3ARZA 3V95A 5IW1A 4LLDB 1OGAB 1BGGA 3ABMB 3B34A 4LX4A 5I1AB 5EU5B 5L2KD 3L2LA 2A9BA 3B2UD 4NO2A 2EXWD 2J1ZA 3MRBA 3NFNA 4R34A 4YLWA 1GKOA 4XBGA 3PJLA 2DUZA 5ABTA 4M03A 2DDXA 2HT3D 3MWCA 2FQEA 4AZCB 5IK3A 4RA3A 2CR0A 3FOLA 2YZRA 5L8LB 1WOAA 3E5BA 2P45B 5EORL 1SR0A 3BKJH 1TETH 2WXOA 3ARUA 4MA8L 1AO7B 2Y72A 4DP2X 1XX1A 4FNQA 4QP0A 3IE4A 4N0UB 1EK3A 2EXTA 4Q6XA 1VCVA 3MA9L 4Z7WB 2CIPA 5KZDA 4OLYH 3TBWB 4D9QD 3FOKA 1KLGB 4MSWA 4O11A 5DLML 4PD4K 3V0WH 3CHQA 5LQBH 5RUBA 2W0FA 4ELMB 3H53A 4ADIA 4LAMA 1QFOA 2ZE0A 2BXZA 1T5XA 1SF3A 4XPAH 3SDCB 3NM3A 1TIUA 4MDPA 2XT1B 2P0OA 1YUHA 3DFPA 1JXJA 4R7DB 1CXIA 1XX9C 4ILDA 4P23D 4FZ8H 3I9IA 4PTTB 2PE4A 3GSQA 3IJ9A 2QCNA 1N4XL 2FH6A 2NW3B 1NKRA 4KJWD 4PJ7A 4R90H 5H94B 5C97A 4LP5A 1GOIA 1XGDA 3DXIA 4H6EA 5DHVA 4UMCA 5C8BB 2OWCA 3FQNA 5DZLA 5ICZB 1W56A 5D7LE 2NQLA 3CH1A