1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (ALPHA-AMYLASE)
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
1BVZA 3WBAA 3D4ZA 4KRTA 2ZXQA 4GO8A 1CGVA 3W0KA 1EA9C 3QOKA 5HNNA 1KWKA 1EO5A 3QGVA 5D8WA 5A6BA 4ZENA 1TZ7A 3EJQA 4UFKA 2GJRA 1E0WA 4CD8A 1XH0A 1XH2A 2ZUUA 3VMOA 2IXUA 4HMEA 1R33A 2EEXA 4UOZA 4GO9A 4AD1A 1UKPA 3A23A 5A6AA 4Z2GA 4MNKA 5FIPA 2J7CA 4AD0A 4PMZA 3D3AA 3HZ3A 3AI0A 1CZ1A 3PN8A 4UQ9A 2J7DA 3JUGA 1PEZA 3WDJA 3VGDA 1JD9A 4LYPA 1BGAA 1UKSA 1MXGA 2OW7A 4EKJA 4FLSA 3VUPA 4MNLA 3OA5A 3WD1A 3ARZA 1WZLA 4B9YA 3LXCA 4ATWA 5DEZA 3CMGA 2GVYA 3WF4A 5JIPA 1JF5A 4KWUA 1GOQA 1VJSA 1QOXA 2XGIA 2VX6A 1KXQA 1E4MM 5FL1A 1ITXA 3AS3A 5IFTA 5HXMA 2ZX7A 1GZJA 2A3AA 5M3WA 3VNZA 3A4AA 4W8AA 3CBWA 4XV0A 2WVVB 1AQHA 1PZ2A 1UR0A 6TAAA 3ARVA 2WANA 3ARYA 3AS2A 3WIJA 3WMBA 3BVXA 4M29A 4D6EA 5EMYA 5E09A 3FAWA 1UKOA 4J7RA 2O9TA 2BHZA 7A3HA 4KGJA 2XG9A 3BVWA 4CCDA 2ZUWA 2XM2A 4TVUA 3I3DA 4HPHA 1OD8A 3T2QA 2D2OA 2X0YA 1W1TA 5GPRA 4GPNA 3AMGA 2WSPA 1HL9A 2G4FA 2XIBA 4V27A 1HKJA 1OIMA 1H5VA 1BYBA 1MQPA 1QBBA 2E9MA 1JXKA 1E0VA 4XZBA 4PMDA 3WY2A 1JZ2A 5LA1A 3HU7A 3SCTA 2QPUA 3WQ6A 3RM4A 3D50A 1TMQA 2XFRA 5I79A 1J9YA 3MANA 4MAZA 1R86A 4FNRA 1Q4NX 5D9PA 4TTUA 4DWSD 1US3A 3W27A 1JYVA 3ZR6A 3T0AA 3ARRA 4MB5A 3WENA 3BUPA 2X09A 4U31A 2OYKA 2PF0A 5A69A 4HZ7A 3BAXA 2CPUA 3A4WA 1VAHA 2VNCA 2WAGA 4M24A 5DF0A 1GHRA 5CLTA 4PUEA 3SUTA 4N0RA 1I1WA 4EK7A 4W93A 2WC7A 3MMWA 4UZUA 3VD9A 3WH7A 4AIEA 4WSKA 3MUIA 4QAWA 1B2YA 1TUXA 1JYNA 3VIMA 1UA7A 1KTCA 1V03A 3VD7A 5E70A 3TP4A 4S3JA 3O9NA 3BUQA 2BHYA 1KGWA 1KBBA 2EQDA 4AZ5A 2D0FA 4YHEA 4TXEA 3RMEA 2YBTA 1NH6A 3AROA 3CHDA 5FOOA 5FL0A 3WL1A 3CHFA 1C8XA 3GXNA 3U7VA 4PCTA 4HMCA 1OWQA 4W87A 2BY3A 1UWIA 2WMKA 4JHZA 5HOSA 2J4GA 3MSGA 3PZUA 4OOZA 4U5IA 3MUZ1 3UG5A 4TX8A 3EDKA 3FHAA 2VTFA 4W84A 1NM9A 1H49A 3ZMRA 4JFUA 1CGUA 3SURA 3BVUA 4GKLA 4LPCA 5CGMA 3CV5A 3TTOA 3BAKA 1QBAA 1QI3A 1M01A 4H8HA 1PX8A 4H2CA 2UY5A 2YFNA 2BY2A 3TV8A 1E6ZA 1MWOA 1KQZA 3S5ZA 4PTWA 4HPGA 2VCBA 4PTVA 3N13A 2CKRA 4NXKA 3RO8A 3WF2A 4JL1A 3FHQA 2VRKA 3ZT6A 2XVLA 3AYSA 3ECQA 4BZYA 2QHAA 2Z1KA 1QNQA 3FN9A 3S6TA 1TQWA 3AXIA 3KLKA 3PTMA 3W25A 4W7WA 3OLDA 3THCA 2VX4A 1HX0A 2D22A 3WEZA 3POHA 2VC9A 3CH9A 1JGIA 3HG4A 1CLXA 4AISA 4ZXOA 4D1IA 2WC3A 1E6RA 4NRRA 1C90A 1XSJA 2FHCA 4RL3A 4J3VA 4L4PA 4ZE5A 1E43A 1EOKA 2DT1A 3T08A 1CWYA 1L8NA 1JZ7A 1M04A 3RM8A 3BMVA 5BCAA 2WSKA 2AAAA 4FLRA 1E70M 3VGEA 2TAAA 3WFZA 3K8MA 1GONA 1C8YA 3O6AA 5I23A 1AMYA 1PIGA 4P7OA 2VX7A 4ZXLA 1B0IA 4HOZA 1H0IA 2MANA 2YL9A 3RIKA 3ARPA 4DWSC 2WC4A 2DT3A 3ARTA 2X8RA 2J77A 1GVYA 2JALA 1MW0A 1H1NA 3WEOA 2XJ7A 2WHMA 4FLOA 1XHGA 2WB5A 2ZUTA 2J7GA 4IUGA 2F8QA 3ALGA 3WDPP 2XGBA 1FA2A 1OD0A 1CXKA 4AD2A 8CGTA 3OG2A 4JL2A 1GJUA 2F7OA 3VSTA 1VEPA 4GQQA 2DPEA 1MXDA 1OGGA 4BA0A 3G6LA 4JKLA 4MJ2A 1ZB5A 2E8ZA 2OSXA 1H0GA 1DWHM 3SCNA 4C7FA 3D5HA 1F4AA 1UA3A 2ZE0A 4JCLA 5A2BA 5E0FA 1J0HA 2Y24A 3WKZA 1E4NA 5A2CA 3AQUA 2DSUA 2CITA 1G94A 3GBDA 3LX9A 3VNYA 2Q8XA 3PZGA 1J01A 4AIOA 3K1DA 4Q7NA 2WMGA 3TONA 1EO7A 1ECEA 1WB0A 3AMCA 3K4AA 3SEPA 3AMKA 3DYOA 1JG9A 3MUY1 3EJPA 3A47A 1XC6A 2DSKA 3GNRA 5E6ZA 1R87A 1ZJAA 2DSZA 3EYPA 5CQ1A 1CEOA 1MFUA 1ISXA 2BFGA 3EMZA 3VSVA 1TCMA 2CERA 5EB8A 3K8LA 1E3XA 1BLIA 1JD7A 2OWCA 1W91A 5D9MA 4BQ3A 1BG9A 3LRKA 4F79A 2NT0A 4P8WA 1HXJA 1VBRA 1QWUA 5JIWA 3VGFA 3WF3A 3ALFA 2UY2A 1S46A 4F9JA 3SIMA 3WNMA 3VO0A 3VPLA 3WD2A 1KXHA 4J3XA 1GW1A 1N82A 2D20A 1J18A 4MB3A 4UFIA 1IT0A 2D0GA 3K46A 2O92A 4D6JA 1WNOA 4OBRA 5I78A 3GXPA 4AIUA 2J75A 3WNOA 3L2LA 3UR8A 1JI1A 1BQCA 3ZO9A 5AC5A 5E6YA 3WY3A 2ZX8A 3AOFA 1QX1A 5AY7A 1P6WA 4BQ2A 3N17A 1HVQA 1KCLA 4UFLA 2VRQA 2V3EA 4KMQA 1UH4A 2CXGA 1MW3A 1E5JA 1HT6A 4FNQA 4NF7A 3CHEA 4J28A 3GNOA 3RM9A 4MJ4A 1KR0A 5CPQA 2AOSA 2VZUA 3O2LA 3AMDA 2EACA 4TVDA 1V0KA 2VOTA 1NWRA 1JYWA 3U5UA 3GXDA 3N04A 5A6BD 2GJPA 1B3XA 3AIEA 3NSNA 3RILA 4UTFA 1L0PA 2EJ1A 3DX0A 4H04A 1K9EA 1QW9A 5I5RA 3AXXA 1OBAA 3OZOA 4TX6A 2VZTA 3RDKA 4KGLA 2EAEA 2NT1A 1LG1A 2O9PA 1KQYA 5A3HA 4JZ5A 1BF2A 5IHRA 3WUGA 3ARUA 2XVPA 4P7NA 2XSBA 3SCUA 5LA0A 3ZSSA 1HTYA 1XCXA 3OGVA 2WYSA 3PZQA 1KFWA 1US2A 1VB9A 4NZJA 1QNOA 5EFDA 4BQ4A 4DWSA 2D3LA 2IGTA 5A6JA 1HJVA 4P8XA 1BYAA 3ARXA 4M81A 1WDQA 2GJXA 1OGBA 1OCQA 2QMKA 1CNVA 3GXFA 1M7XA 1E1FA 1AQ0A 4U33A 1LG2A 2J74A 1K6AA 1B3YA 2PB1A 3HG3A 4WIWA 4F9DA 2GDUA 1B31A 1WZMA 4NSBA 4DO6A 5A8PA 3PBGA 1G5AA 2WLZA 2CBVA 1W9PA 2WMJA 4H41A 3VIPA 3GXMA 3WH6A 1UWUA 1GORA 1B30A 4E8DA 1DWIM 3GXTA 2DSVA 1TQTA 3TTYA 4GXPA 2VVNA 2ESCA 4DUWA 1ZJBA 2E3ZA 2VJXA 5A2AA 2G41A 3BUDA 1GVIA 1V0NA 1IZKA 4PTXA 1U2YA 4CCCA 1GUVA 1QWNA 1B1YA 1VIWA 1A47A 4DO5A 1GQKA 3ZJ7A 2W63A 4JFTA 3WSUA 5TD4A 2CHOA 3VM5A 1NWUA 1FFQA 1UZ4A 1LWHA 4PCSA 1O6IA 1MYRA 4BCEA 4EE9A 3S5YA 2W92A 3ZSTA 1VJZA 3CPUA 3CUIA 3ZT7A 3BLPX 1V6UA 4PMOA 3L4TA 3VOCA 5I6SA 4YHGA 3BLKA 1J0KA 3APGA 3SUSA 5CG0A 2XVGA 2OLHA 2PBGA 4M56A 2YDQA 5JBFA 4NRSA 3GZAA 2XIIA 1JFXA 4PMRA 1JNEA 2E4TA 2EPOA 1E72M 2WKLA 4MADA 3AHVA 3PZVA 1MW1A 4JKMA 4OGZA 1WDRA 2Y8VA 2DH2A 2WXDM 1ISVA 3L4YA 5DT5A 1UWSA 2Y4SA 4XZWA 4ACZB 3L4WA 1CGXA 1R85A 2IUZA 3WN6A 1UWRA 3GH4A 3EDFA 1Q6DA 1J0YA 4M80A 2VQTA 1W2VA 3L4UA 3N18A 2A3EA 3WNNA 5HDRA 1D7FA 4UNIA 4AZ7A 3FNDA 3AIVA 2W66A 1UD4A 2W4XA 1E0XA 1E55A 2JE8A 3IANA 1FHDA 3VM7A 1KXTA 1TE1A 3VIKA 1WZAA 2BVTA 2PWFA 2VL4A 4HOWA 4U2ZA 5ABFA 1KGXA 1B3ZA 4OZOA 4AZCA 3WH8A 4HU0A 4UFMA 1J0JA 2JF6A 4QLJA 2YDRA 3DHPA 2WZIA 2W67A 3H53A 1GHSA 1BSIA 1QNRA 1KB3A 3OB8A 1Q6CA 3WQ8A 2ZOXA 1QVBA 1JXJA 1J0IA 3AFBA 3OZPA 2E9LA 3ZOAA 4GI8A 4AEFA 4JKKA 2BVDA 5KEZA 1RPKA 4PMVA 2Y8KA 4W8LA 4CN6A 1MQRA 1R46A 1FP8A 1WPCA 1HIZA 1CLVA 2DIEA 3CTTA 5M17A 4DM2A 3CC1A 3PHAA 1VEOA 1E4IA 1QI4A 1ZBWA 4J3SA 3KWXA 1JL8A 3SUWA 2ZUVA 2EXOA 4FNTA 1NOFA 4W8BA 3LRLA 2CESA 2YL5A 1Q6GA 4GI9A 6A3HA 5CLWA 3VD5A 4B3KA 3TTQA 3I3BA 5DT7A 1V3KA 1PX3A 2EO7A 1JNDA 2E9BA 2ZXAA 2XYLA 3U57A 1Q6EA 4W86A 2WCSA 3OBAA 4R5EA 4A4AA 3A3HA 2WPGA 2XN1A 1JDCA 2CIPA 1KGUA 1E71M 4BF7A 3AZSA 4AD4A 2BNJA 4UOJA 3W38A 1DWJM 2WNWA 4CU7A 4Z2KA 4AEEA 2PC8A 4PBGA 4FNPA 1TQSA 2XN2A 3CZGA 1XSKA 2OW6A 2EPLX 4URIA 5A1AA 4M8UA 1CGTA 3WD0A 3CIVA 4J27A 2CBUA 1QHPA 2ZX9A 2X0HA 3OGSA 3CZSA 2V3FA 3EBVA 3LRMA 1G9HA 1FFRA 4AMXA 1PX4A 2HVMA 1E9LA 4HA1A 1CIUA 3SCWA 3A5VA 3NIYA 1EQPA 1KXVA 3ARQA 4H8UA 5JBDA 1JIBA 5ABGA 2ZWZA 2VCAA 5A6MA 1FH7A 3KL3A 4HOXA 1HJXA 1UR2A 4AZHA 4NZCA 3WQ5A 3II1A 3A24A 4LYQA 5GQBA 4V28A 4FNSA 4C7GA 4Z2JA 1MFVA 3PZNA 4AW7A 3BSGA 4AYGA 4FK9A 2JEQA 1NWTA 1QNSA 1VF8A 4D6IA 4UQCA 4P7LA 3SUUA 2WVUA 2Y5EA 1JDAA 2VZVA 3GYCA 3NYDA 3VGBA 1UR8A 3BAJA 1F4HA 3BUIA 1NWSA 1CYGA 1HKMA 5A8NA 2BXZA 1TQVA 4AY1A 4HA4A 1ZBKA 1R47A 3VMNA 4QFUA 3ZJKA 4Z2IA 2WWDA 2XUCA 1WO2A 4D6CA 1V6WA 3LPGA 4LGXA 1C7SA 1IZJA 3WDHA 4AD3A 2GJXB 4CU8A 3GDBA 1V3IA 2WVTA 4WF7A 4W7UA 2ZX6A 3BAWA 2BY0A 2XSAA 4DWSB 3ZJ8A 3NDYA 3W4RA 1W1YA 2F1BA 3AIUA 4IISA 1RD6A 1K9FA 2AMGA 4Z2HA 4YPJA 4BS0A 5CZKA 3EDEA 2G8ZA 2CBIA 4UFJA 3H54A 5EFFA 5CJ5A 6CGTA 2WLYA 2FH6A 5IXEA 5AYIA 5C8BB 3VVGA 1QHZA 2WM0A 2VI0A 4PMUA 2DT0A 1JYXA 1G0CA 2EABA 3DDFA 1CECA 3CZEA 3K8KA 3EDJA 4OBSA 2FHFA 3A21A 4WSJA 3J7HA 3OIHA 3PZIA 3VINA 2J79A 3KEHA 4JFWA 3POCA 1BGGA 4UFHA 2A3CA 5D4YA 5E9AA 4TTGA 4XX6A 5BROA 3SCRA 2BVYA 1UR1A 4M1RA 3EJSA 3UR7A 2CKSA 2OSWA 1UR9A 2DDXA 3AIBA 1BYCA 1C3FA 2X1IA 3IK2A 3VGGA 1HKIA 1V02E 5GNYA 1OSEA 3MI6A 4AC1X 1HL8A 2X2HA 5I77A 2XFFA 4AZGA 2D24A 4K68A 4WLCA 1VFFA 4CD5A 5IFPA 1J0ZA 1NP2A 3B8SA 2D1ZA 3AICA 2F18A 2ZWYA 1BTCA 1FP9A 1C8QA 2W91A 4ML4A 2GK1A 4D6HA 1LL4A 3WUBA 1UKTA 3CUHA 1E1EA 3HJEA 3NSXA 5EBAA 3WD3A 5ABHA 1TA3B 4MTVA 5M5DA 3PZ9A 1XD1A 4IPNB 3L4ZA 1MVYA 2G3MA 3B9AA 4ZE4A 1OT2A 5DMYA 1UD3A 3OLEA 1W9DM 3GM8A 1V08A 4UZSA 2NW0A 1XCWA 4YN5A 1VBUA 3LPOA 2EPNA 5F7UA 4MB1A 2DSWA 1HVXA 3F5LA 1XYZA 3M6DA 4OKDA 2JIEA 4AXNA 1GOIA 1E6PA 3MMDA 3GH5A 2XWEA 2WKGA 4AD5A 5CXPA 1CPUA 4E8CA 1XRVA 4CUCA 1DHKA 5BWFA 1ISZA 4JIEA 3KE0A 5AYBA 1CGYA 1GQLA 4AMWA 2J7FA 3VD3A 1EGZA 3KL5A 2EBNA 4X0VA 4CKQA 4BQ5A 5IHSA 3T0BA 3N11A 2YIHA 2DIJA 5E0CA 1HJQA 5A8OA 2BY1A 3WDRA 1X1NA 3BSHA 3I3EA 2XTKA 3LXBA 3AHZA 5A6SA 1E6QM 1TVNA 5DFAA 1BFNA 4U5KA 2W5FA 1KR1A 2J7BA 3WY1A 2C0HA 3VX0A 3UERA 3WUFA 4CU6A 4V2XA 1E5NA 3WUEA 4E2OA 2GDVA 2YJQA 4Z2LA 1FOBA 3OLGA 2E0PA 1SFSA 2CYGA 1W1VA 1GOMA 3WNPA 4F8XA 4DM1A 1UD8A 1AQMA 4CD6A 4P8VA 1HF6A 2BHUA 3NUKA 4WJXA 2JF7A 1C92A 2ALWA 2OWXA 1UQZA 1V6XA 4P7RA 2JIWA 3ZQ9A 3BMWA 2CNCA 2J7EA 2V5DA 4A3HA 1UUQA 3MU7A 2WHLA 1H2JA 4NI3A 1JAEA 3CZJA 4TOQA 1H3GA 3W24A 4C7DA 3CMJA 3HMCA 1E6XM 2WWCA 3WQVA 3BC9A 2X2JA 4UQEA 3NSMA 4XB3A 3VIIA 2J8FA 2J47A 4W7VA 3IJ7A 4X0NA 2WHKA 2GK1B 1FH8A 1LWJA 3HG5A 2WBGA 2ZUMA 3WDIA 2VR4A 2PWDA 1C93A 1E73M 4FF5A 3FY1A 4PEEA 3VSUA 2B31A 4EANA 4QLLA 4TUFA 2F2HA 4CD7A 4CN1A 3AS0A 4MDOA 1ISYA 2G3IA 1QHOA 1E6NA 1EIBA 1OINA 1ZBCA 5I0DA 3LXAA 1EDQA 5HBFA 1CENA 2WCGA 2VMFA 1UD6A 4KRUA 2ZICA 5ABEA 1W3LA 2ZX5A 3WMCA 4GZEA 2QMJA 3F5KA 4LYRA 1WDPA 2DT2A 3WDQA 3AISA 4FLQA 1CXIA 3GTNA 5BXSA 3VDAA 2C8NA 1GOWA 3U5YA 4PN2A 4S3KA 2PWHA 3UCQA 3W82A 3SCQA 3DX3A 4U3CA 2VVSA 3T09A 3WL0A 4DO4A 1ESWA 2YA1A 5IDIA 4F66A 3W6LA 1UWQA 3N9KA 4L4OA 4MNMA 5FKYA 2F7PA 3VIGA 2QPSA 1QI5A 1KWGA 1PZ3A 1UG6A 3VDCA 1ISWA 2WVSA 4CCEA 2QLYA 1YHTA 1NP0A 1BVNP 3N12A 5DO8A 3S2CA 1LLOA 4PMQA 1HNYA 5BXRA 2BS9A 3BXWA 2YBUA 4JFSA 2W62A 1JZ6A 2YL6A 3DC0A 1GNXA 2VRJA 1D2KA 1GPFA 4OUEA 5AC4A 5BRQA 2YL8A 3QR3A 4N42A 3OLIA 1I1XA 1HXKA 3ZJ6A 5FCZA 1RP9A 3ZT5A 1EQCA 3MMUA 2J78A 1W9UA 2V5CA 3IAQA 1XD0A 3GXIA 3AS1A 4MPKA 2E40A 4MNJA 3TA9A 3AHYA 4NX0A 1JZ3A 3WNKA 5A95A 4CN4A 1EOMA 2YDSA 4JCMA 1V6YA 2DH3A 2GUYA 3DYMA 3WH5A 1JI2A 1DWAM 3WBEA 5CGTA 3MO4A 1UWTA 3AIWA 4J3WA 3DECA 1UKQA 2WCAA 3N1AA 5GNZA 1WAWA 1PS3A 1B90A 4GI6A 3GNPA 1XV8A 2Y2WA 4PRWA 2FGZA 4PUDA 1JFHA 1VRXA 3EMQA 3HG2A 2QF8A 3QOMA 1OGSA 1BG4A 3AJ7A 4PSPA 1XSIA 1VEMA 2XM1A 3DYPA 3WF1A 2XN0A 1BPLB 3CUGA 1FH9A 4AZCB 1A3HA 3W6MA 4UR9A 3UG4A 2RGLA 5D8ZA 4HP5A 4TVCA 2E8YA 2FH8A 1T0OA 1K9TA 4U3AA 3MSDA 4FMVA 3DX4A 1HJSA 4OJYA 2DEPA 1ZS2A 4XUYA 3LMYA 2X2IA 1D3CA 1V3LA 3AMLA 3KLLA 2F7QA 3W53A 3FAXA 1V3HA 1RH9A 3A4XA 4D6DA 2FHBA 3VILA 2X05A 3A22A 3WEMA 2WMIA 2YOCA 3CLWA 2C7FA 2YFOA 1BAGA 4J3UA 2EPMX 3AYRA 4W85A 4J3TA 2WZHA 3T2PA 2V3GA 3WQ4A 1SYTA 2JFEX 1HN1A 4PMXA 1ZBVA 4CVWA 1E56A 3VIFA 4ATLA 1B3VA 5HPOA 4AZIA 1HJUA 2XHYA 4QP0A 1HP5A 2WMIB 1PBGA 2WZEA 3ARSA 5D9NA 3CZNA 3DX2A 3ARWA 3NDZA 3MKKA 1OM0A 1EDTA 3W29A 2VO5A 1UHVA 3BGAA 1R7OA 1LJYA 1O7DC 4P7QA 5I24A 4UOQA 3SCOA 1R75A 3MUAA 3VIHA 3BLBA 3BUBA 2V3DA 1LF1A 1E15A 4OOUA 5E1QA 4H8VA 1Q6FA 1V6VA 3SUVA 1WCGA 4B15A 3KL0A 1TQUA 5BXPA 1W2PA 4M82A 1FHLA 2GFTA 3UETA 3B9DA 3DX1A 1XYFA 1CXFA 2WBKA 3NJ3A 1Z32X 2RGMA 4CGTA 3FXYA 4ZFMA 1CXLA 2UY4A 4QCEA 1ODZA 5GNXA 4HU8A 5I3DA 3VTRA 4RE3A 3U7BA 4P8UA 1ITCA 4PMYA 1NOUA 4ZEPA 2PI6A 3EJTA 3T2OA 1DWFM 3UG3A 3QHNA 4DUXA 3WMSA 1UYQA 2EADA 1JAKA 1HKKA 2YLAA 4IM4A 2CBJA 3CGTA 1R7AA 5A94A 4AWEA 1UD2A 1CBGA 1HP4A 3F5JA 5C70A 1V02A 3AHXA 2DQXA 3GBEA 5BXTA 1VENA 1WE5A 4PSRA 1H4PA 3AIQA 2YLLA 4DUVA 3WY4A 3UESA 3VIOA 2YA2A 5CSUA 4B16A 2FYVA 3MV01 1G01A 3W26A 3DHUA 2UWFA 4QDMA 3CUJA 4WK9A 4D6FA 4PYSA 1EDGA 2ZUSA 4ATDA 2FDMA 3VDHA 4UQAA 1XH1A 2ZUNA 1UOKA 4QLKA 4IPLA 4RE2A 1KCKA 2J25A 3RCNA 4E4PA 1NQ6A 2PBOA 1V0MA 3VKKA 1HJWA 3MV11 3WFLA 2O9OA 5CPTA 1E3ZA 3N15A 1GOKA 2XVNA 2W61A 1UASA 1ZU8A 1EH9A 1QI0A 2DGAA 1CGWA 3W37A 2V38A 3EJUA 1K9DA 1UD5A 3IGUA 2OSYA 1W32A 1UH3A 2VUYA 3W81A 3KZSA 1OB0A 3BVTA 5CSYA 4Y7EA 1WKYA 1DWGM 3LPFA 3CZ8A 2J62A 2BXYA 1ODUA 4PMNA 5LA2A 3BAYA 4H7VA 1E4LA 2XPKA 2QV4A 2GSJA 4B3LA 2JEPA 2OYLA 1EXPA 3AIRA 3M07A 3MS8A 1TR1A 5BRPA 1WP6A 5A6LA 4R27A 3ZIZA 4JFVA 5A8QA 3WELA 4LXFA 3M7SA 4GZJA 2YKKA 1W3HA 3IJ9A 3AHTA 4GIAA 1LL6A 1NOWA 2HISA 1V3JA 1JZ4A 3H55A 4AZBA 2J8GA 5CPSA 2VCCA 7TAAA 3VX1A 9CGTA 3SCSA 1X6NA 2VURA 2OYMA 1V3MA 1I75A 1R34A 3FW6A 3RJXA 2D0HA 4CVUA 3WF0A 4HZ8A 2FE0A 2XFYA 2FGLA 1MQQA 1LQ0A 1M53A 3LPPA 4FNUA 2WMFA 3EDDA 1JF6A 2XVKA 2WK2A 1UR4A 2YA0A 1IV8A 3THDA 4D71A 3BAIA 1PIFA 3A6OA 1PJ9A 3BVVA 4WKAA 4NXSA 1X6LA 4RE4A 1R8LA 3RJYA 5JUVA 3VDBA 1HWWA 3NCOA 3WD4A 4EAMA 3BH4A 4D1JA 1CXEA 5I2UA 1VFMA 4D6GA 3ZM8A 2WW5A 3QHMA 4D72A 2WHJA 1BHGA 2F1AA 4B9ZA 1PAMA 4GQRA 3WQWA 2ZXDA 2G3JA 1KBKA 3PTQA 1SR0A 1H11A 3ZR5A 1G1YA 3CHCA 3E1F1 5A8MA 1WDSA 2VX5A 1SZNA 3M46A 4UCFA 4OIFA 5JBEA 1TFVA 1XGZA 1J10A 3TOPA 2X2YA 3EMCA 3PTKA 1U30A 3UEQA 1H41A 4A3YA 1YQ2A 1W1PA 5C71A 3OGRA 4X9YA 2CHNA 3CUFA 1EHNA 3L2MA 3AXHA 1UZ1A 4WKHA 1QPKA 1QNPA 3HN3A 1VFOA 1WZKA 3K4DA 5ABFB 3WNLA 1SMAA 1J11A 1CXHA 1W9VA 4NZFA 4JAWA 1TVPA 1C7TA 1H09A 2A3HA 2BV9A 1W3JA 1AVAA 3D51A 4HTYA 1B9ZA 1DEDA 1CTNA 3VMPA 2D73A 3EJRA 3TTSA 4ACYA 5KZ6A 1U33A 2Z1SA 4W5UA 3CO4A 4MDPA 1PPIA 1E40A 3W28A 4AYSA 3VGHA 1NARA 3PZMA 2G3NA 4ACZA 1JZ8A 3AZTA 5LYRA 2CEQA 1DP0A 2VZSA 4W89A 1TA3A 1CDGA 1ZL1A 2CETA 4PTMA 3IJ8A 4QCFA 1KTBA 3BCFA 2IXVA 1RP8A 7CGTA 1GQJA 1JDDA 2F61A 3F4VA 3B9EA 3WH9A 1SMDA 2OWWA 1DTUA 3AZRA 2ZIDA 1O7AA 1B3WA 4W88A 2NSXA 4WKFA 5D9OA 4AMCA 2D23A 4LQ1A 1BYDA 1EHAA 3VU2A 2WVVA 3D4YA 5A6KA 3SCVA 2F7RA 3IAPA 1LL7A 4Q22A 2D3NA 4GINA 1MW2A 8A3HA 2CCRA 1Y7VA 1TG7A 4KH2A 1UH2A 2WMHA 4AZ6A 2EPKX 1QW8A 3CZLA 4UQDA 2ZXBA 3GH7A 1C91A 2VQUA 4HMDA 3QHOA 4HA3A 4CD4A 1W3KA 3SCPA 4HZ6A 2PWGA 3L4VA 4JHOA 3VD4A 5BYWA 1QI2A 1OT1A 4LX4A 5HPCA 3PZTA 1E6SM 5ECUA 1JZ5A 3L4XA 2VR5A 2VT0A 1GCYA 2A3BA 1VFUA 1W9XA 1J12A 2J7HA 3VIJA 1UQYA 1W9BM 2VZOA 4GZIA 1OIFA 2O9RA 3T0DA 4UQBA 1GJWA 3RPMA 1M03A 3DDGA 5FD0A 3BCDA 3G6MA 3CZKA 1GOOA 3PZOA 4MAVA 4U2YA 1GQIA 2XWDA 3D52A 4MB4A 1V0LA 4W5ZA 5M03A 2PWEA 2UY3A
chains in the Genus database with same CATH superfamily
2NOYA 5H37A 1XR8A 3FS2A 1NKOA 4QHUB 4GG6F 3P0VL 4OZGF 4XVUC 3B40A 3P81A 4KRTA 1KPVB 3GC2A 5I1HL 5MENE 1P4CA 4CVXA 3LYRA 3GK8H 4OIIH 3W0KA 3BE1L 3HI6L 2WQSA 5GHWL 1X6UA 2CLOA 2Y07L 4D2JA 2JELH 4D8OA 3LHWA 3W0WE 5I2IB 4H4NA 3R0DA 3C5SA 2YAPA 3L5AA 4AVOA 3RFZC 4DEWA 4QRNA 1EO5A 2CAKA 1EGJA 1T7WA 3UBXA 4ZENA 2P8PB 4HJ1A 3QM3A 4UFKA 3EJQA 1YDPA 2Q01A 3FSTA 3W7OA 3ZDXF 1DUYA 1L9PA 1XH0A 2ZTBA 2CLIA 2ZUUA 3ARDA 3O3AA 4Z7UA 5DJ0A 3C3UA 2HVBA 4I0PC 3VWJD 2IXUA 3IVSA 4B60A 3IRDA 5G2HA 5EFIA 5HVGB 1MWAH 4I13B 4AJYV 1U8QA 5T1LB 1JPTL 1RZIB 3KYOB 4Q58C 2ZADA 1TV4A 1K7XA 4NO5A 2B5IC 4JAMB 4GO9A 1VZHA 2HFFB 4PJXB 4AD1A 2QHRL 1XIWC 3M0KA 1TJ0A 4MDIA 3PHOB 1XVSA 4LEOA 4DPPA 1CG9A 5L2KB 3LNIA 4YNYA 3L3OC 2AAMA 1KJ2B 4EBQL 2R23B 1NA8A 2X1XR 3NQEA 3DGBA 3S9ZA 4GRWH 2W9MA 4R7NA 4LSTH 4XXCC 4JO4H 1N10A 3OAZK 4MCNA 5KBNC 5ABAA 1VFBA 3TO2A 5KYYB 3AI0A 1F42A 4PMZA 2OZ4L 1CZ1A 5TFSL 1GPWA 3BSZA 2Y22A 3PSVA 4Y1AE 4BFIB 4XC3H 3JUGA 2IG2H 1TETL 3CNKA 2PDQA 4WFEE 3L1GA 4DYEA 3SPGA 2LU4A 5CEZL 4LYPA 5IESL 1N2VA 5J12C 2YRZA 1NL0H 3WIHA 1LLAA 4RGOH 4GUPA 4RFNC 3WYRA 2XV0A 4BBWA 5B7FA 2IMRA 3S2JA 4EKJA 1IEXA 4F7PA 4MNLA 4C6JA 5FS5A 3P4NB 3S3SA 3O8XD 3ARZA 4KKBD 1XIIA 3JWOC 4B9YA 3ARFD 4X6BA 1S4IA 2OR8A 3V0FA 1IUZA 5DEZA 3CWNA 2I17A 3H3PL 1L9SA 4X6EB 2W8CA 5ESAB 3NFUA 4QR6A 1NCUA 3W7NA 4TL5A 1VJSA 2XFXB 4IICA 1GGCH 1WWWX 1K8CA 1TKWA 4MFHA 3ZE0B 1P6CA 2BP0A 4L8DB 4CSSA 5FL1A 1Q6LA 1A7RL 1NCIA 5IFTA 3KWWA 4IRJA 3GIZH 2ZX7A 1UUNA 3OHXA 3EHBC 1DO5A 3CBWA 2IWEA 4AM0B 5DBUA 1IB5A 1AQHA 2VDOB 5CBAB 4WWOA 1LQAA 3RGVD 3EOEA 3LCHA 2Z2UA 3N6JA 1Z0NA 1EBAA 3RDTB 1FG9C 3ARYA 4ZBJA 3KXFE 3WIJA 4WEVX 5AHEA 3QRFM 1EBPA 1N2RB 4EQ2A 4UUJB 2X4PB 4QCIA 2EYRA 3QHFH 4X9FA 4PJAA 4XNXL 5EMYA 3WLKX 4ICNA 4G2AA 4UINH 4OLVH 5EOTB 3KPPB 2BHZA 3GS4A 3SYCA 1JPIA 4P23A 1O75A 4HHAA 3BVWA 5ERWB 4DZBA 4CCDA 4WX2A 2QVMA 1RSFA 3BSZH 3FF8A 4JNXA 2UXFA 3QY8A 3LH2L 1FCVA 4FXKA 1A1NB 1RCQA 5BOJA 5CD5C 3FU7A 1C9WA 4ZQKB 1FC1A 1KT2A 2EIZB 2HKAA 3LN5A 2WSPA 4L8SB 4QTHB 3WFEL 3AMGA 2QEJA 1QNZL 1HILB 3VSQA 2WLMA 2WLJA 5D1ZD 5HGAA 3T3PF 1NBYA 2X4UB 1MDRA 2PAJA 3KS6A 5FGBA 4J40A 1EWDA 1HKJA 2HJKB 1RK1B 5JPMB 3DVIA 5DRWB 2VM3A 3KFTA 3KRBA 1H5VA 2E76C 4I9AA 4LL9A 3HMJG 2WBXA 2C71A 3FTUA 2E9MA 4AVNA 3TO4D 3G0XA 3OZLA 1WFOA 4GIOA 2ARJB 5GZOA 5M94B 4XZBA 1A65A 1JEZA 4W9EC 4ERGA 1FCCA 4L4JA 4YEFA 3D07A 1WBYB 3QI9C 4O9HH 3WY2A 5C0FB 4L65A 3FUFA 4CEUC 2BZDA 3CO8A 3F58L 4HKZA 3SZKC 4L3EA 1ZQ5A 3L5LA 4MFEA 3AREB 3U1QA 4BFRA 1M05A 1TQCB 4NQSA 4BFNA 2VDRB 1MCBA 1QTSA 1U91A 1RBLA 2FZBA 1XF5A 3D0CA 3MANA 3FVMA 3LV5A 4KWOA 1R86A 4XVJL 3S36H 4XUGA 1P5UC 2AJVL 4P2OC 1UUOA 2GQ3A 5D9PA 2F84A 4GKSA 4S2CA 2I9UA 4EIUA 3W27A 3QQ0A 5FM4A 4IGBC 2X28A 4Q4RA 5FAGA 3LIZA 3RCYA 5D2LF 2D7MA 3OKDA 3QUXA 3T0AA 3VXMA 3HPSA 4DQWA 2BX7A 2C16A 3IWPA 3R6IA 3UWQA 3BUPA 3ESVF 2AJSL 3SDCA 2X09A 4QNPF 4X9SA 1FPTH 3DPDA 5EU6D 4U31A 3T2NH 3N3MA 1DJGA 2IWKA 2JTDA 4K2UL 2PF0A 1YPZF 4IQLA 1CCZA 1NCDH 2G9HA 2XFXA 3CLFH 4R97B 5AOJA 5I02A 1Q85A 2VXTH 5IVXB 1PKOA 5L2KD 2YKLL 3NDOA 4EPSA 3CSFA 4I88A 4CMMA 1IGWA 3A6BL 1AFVL 2RFXB 4LKCB 5CN2A 5E2VL 4YXGA 4P2RD 3TN0D 1G9ML 1Q1JL 4Z77B 1QUNA 5DF0A 2H26A 2ZXEB 3QG7L 2WAGA 1BOGA 4DWHA 2I16A 3ZE1B 3WLBA 4PJEE 5C0AD 1KRAC 2NYZA 2WC7A 4MD0A 4C58B 2J6VA 5IWLA 3U2EA 1AZUA 3CFEB 4LT7A 4UZUA 1ZHBA 2KZKA 4Z95H 5FSEC 4N9OB 5IVXA 1PDZA 4G1KA 3BOXA 3OKMA 1ZVHA 2PYFB 4WSKA 2R14A 1MAKA 3EKLA 3MYJA 3ATAA 3Q8AA 4A7GF 1F7BA 5ITBL 2QNEA 4TV6A 3QDME 1WGVA 5ITBH 4NLAA 2WJDA 2AL2A 4JN1L 1B2YA 1OFOA 2P5ED 4OGYL 3E0VA 3GSVA 1P0NA 1TE6A 2R23A 5IJDC 3DGCR 3HVDA 1N5AB 4YBQC 4PJ9A 4V1YA 3EO9H 3OKDB 1O6SA 3QUXB 4HJGB 2VFHA 4JE4B 3M6YA 3BVNA 2DS4A 4R2GC 1UC5A 1NPNA 4IX2A 3VFOA 4S3JA 4YHML 4FX7A 4JM2A 1D5IL 3PHOA 1CL7L 4JQXA 3F4NA 4PY8I 1QO2A 3ABZA 3TFBA 4KUZL 1G7PB 2JIXD 2YZ8A 4KKXA 3V6ZA 4Z78A 1F3WA 2WV3A 4ERIA 1MWAB 2ADJA 2EH7L 5B39G 1AJ0A 1YEHH 1QASA 1FO0B 1YEHL 5TFSH 2YBTA 4N87A 4L8SC 4ADSA 1T1YA 3BISA 4HJJL 4CADA 1OALA 4KXBA 3RNQA 3JTBA 5DCDA 4PCTA 3OQRA 1YYLL 1IC4H 4L3ED 5SX5H 4I0CC 1UEMA 2D31A 4OLYH 1GGIH 2OL3L 3BZFB 4UDUA 4W87A 1GGIL 1ADQA 2OL3H 3V5HB 5DN1A 1H3PL 1T0NA 3UWYA 5E1HB 5I5IA 1E2VA 4IGBD 3GY1A 2LVEA 5CSBA 1S2UA 4RQQB 4ZDHB 1BIHA 3BARA 1GIGH 4WKXA 3BEWA 5HHOE 2YS4A 3X1GA 4NJGA 2NV9A 3T6CA 4HJ0D 2YEVB 1QEWA 5LHEA 3MUZ1 5JHMA 1J05B 2IOOA 3Q67A 1K85A 1CE6B 4WAFA 4TX8A 4EXAA 3QORA 2ZDRA 4DFHA 3LV3A 4C65A 4GNKB 2B14A 4Y4FB 3FFCD 2FUQA 5EBWA 1DQUA 1FN4B 3SURA 1FVDB 1CVRA 3V6OA 1REQB 2R1XB 4ZPVA 4MASA 4YGVB 3KPPA 4GKLA 3GINA 2O6PA 4FZEH 1NAKL 1TVDA 2AEQH 1AI1H 2FBJL 5CGMA 3EXRA 3TROA 4E41B 5DUJA 3TTOA 2KPWA 2CZVA 1QWKA 4Q8WA 4PJAB 3GBNH 3D5HA 5F7DB 1M01A 1IXPA 1PX8A 4D8PA 4HQQH 2OMAA 4JYEA 1ZAHA 2ZZ5A 1P7QA 2GSHA 1S7UB 4F2MB 1FKXA 2A9MH 5I3KA 1E6ZA 1O9WA 4XE0A 1IE7C 1HK6A 5FYLH 4Y5VC 4PTWA 5B80A 2VCBA 3SSZA 1KLFA 1I31A 4HNNA 1GJIA 4YYFA 1DVFA 1I8LC 2SODB 3IS1X 2DKUA 3OHXB 4PBFA 4E8GA 1YDVA 2YC1A 2GJ6A 1KB9K 5TF1H 3MLPA 5C0RH 2XG5B 2I25N 4GUCA 3EOLA 3WLPA 2R29L 5E5MB 3ATYA 3QFEA 4BEUA 4KTEH 3VA2C 3H12A 1MCRA 3FHQA 3QJHB 2GSIB 3I2CL 3TYCA 5FM5M 5F0PB 4Q4QA 3Q6FA 1QNQA 4AMAA 1S2AA 3FO0H 4PUMA 2QCDA 1QLFA 2H32H 3SDXA 1T2QL 1HNFA 3G24A 2FL5A 2PTXA 2Q8BH 1DQXA 1LQBC 1MJ7L 3W25A 3FBQA 1S1RA 4O5LH 2CWNA 3D12B 5ADPH 1I2QA 1XX9C 1R6VA 4DBUA 5JH2A 4Q4MA 4YBQD 3BRFA 1UROA 3GRBA 4P2AA 2Y36L 3CH9A 3EIFA 2ZP9A 3M8OL 3NDYE 1CLXA 3KPSE 2AP2A 3DK2A 4M93B 1VKXB 5FUOH 1M71A 3PULA 4D1IA 2V5RA 4WFFE 5AHMA 3OKOA 4OUUB 5MENB 5HJXA 1IXNA 3S47A 1C90A 1C29A 2H32B 3O0LA 5C07D 4TM9A 3BDKA 1USQA 2Y5QA 2FHCA 1S7RA 4W6XB 2A9NL 4J3VA 3KPRD 4IGSA 1HOCA 4ZE5A 1L8NA 5DWUL 4N86A 1M04A 3BMVA 3RY4A 4G6FD 4F2EA 1PCKA 3BT2L 4MMWA 3TTEA 1ZLUH 2AAAA 1XLLA 1T21A 2J2ZA 4UINL 3SIKA 4L1TA 4DPCX 2GTZA 1FIGL 1TLMA 1KLUB 1H61A 1NCDL 4YSPA 1E5BA 1I8AA 2HKFH 2CLPA 3K8MA 3QCUH 4C55A 2C3XA 1AMYA 4FI4A 3N85H 1GVFA 4KZEH 1SJBA 1KGCE 1CYWA 2WBJC 3O6FD 4BHUA 4ZXLA 1QSEE 5MF5A 3FOLB 4XVOA 1ZTXH 4QRSB 4GIEA 2E6QA 2VDNL 4H88H 2PYEB 5J1AA 5FW7A 3CIWA 4XPFL 1I1AA 2YN3A 1XTMA 3G5ZB 5DHYB 4JFZL 1H0IA 1BVKB 1R3JA 2XRAL 1HQTA 3DX6A 4HGWB 4DWSC 4TNVF 5CJBA 3C60D 3DRTA 2X8RA 3ZFHA 2VERA 3QUHA 4N9GA 3VI3B 3PVFA 1GVYA 2GIYA 3KGRA 2AF2A 4QHMA 2GW5A 1MW0A 2ENQA 3F12B 3H9SB 5M7QA 2BVUA 4DPBX 4JIQA 4WZHA 3D39D 1MCOH 3MLUH 2OZNA 5H8PA 2H1LM 1EJUC 3TN4A 4XPTH 5E8EA 5DWUH 2JJUA 3HE7D 2CBPA 3TESA 1OSPH 3EFOA 2IXQA 2XUWA 3G7TA 2XGBA 2JGQA 2QCCA 4OGYH 3B0UX 1CXKA 2YUZA 5MEOB 2H6PB 1LEKA 2YBVA 2RDUA 3KTCA 1XIGA 3FU8A 4JL2A 6XIMA 1OCOB 3SDYH 3GFYA 2NQCA 4C6FA 1JQXA 1DBJL 3GHBH 5KVEH 4EP8C 3ES6A 3DARA 4AYBA 1PYWB 4L4TA 1A6ZA 3WFDL 1CDUA 2E8ZA 3GJFH 2DZEA 4B95C 3NBNA 1AXSB 3FT9A 1S9VB 1BSLA 1H0GA 1EX1A 1XQKA 3MWCA 5SWUA 1ZS8A 5D37A 2DI9A 3STLA 4KI5C 2ZE0A 4XXDA 1QTPA 5F1SA 1I7ZB 1RZ7L 1QDSA 1J0HA 5B1AB 4G5ZH 3B0VC 4TNWF 1FZKB 3IPBA 4JG0H 3QRBA 5A2CA 4Q4KA 3S3GA 4MHHG 5L88H 3AGWA 5IG7A 3FT4B 3AM8A 2DSUA 2DZWA 3R0KA 5K9KA 1DBAL 1KIUB 2IANE 5EORH 1VFSA 2Q8XA 3PZGA 1OQXA 3W2DL 2A6LA 4P2QB 1JXDA 1FHVA 1SXAA 1V93A 5LIWX 2JXMA 1A7QL 4HPOL 4ZPTB 5I0XA 4GG6B 3TONA 2VGLM 4UOW1 3CXFA 1QW7A 3QULA 5FGSA 1XF3A 3O16A 4JGNA 1UXSA 4MY9A 3K4AA 2G4JA 3GRWL 3I4EA 3OR6B 1MLBA 3AMKA 3DYOA 1FNAA 1CLKA 3MUY1 1JP5A 1XC6A 2IBGA 2ISDA 1Q6OA 3MKGA 3F64A 2DSKA 2FUTA 5E6ZA 2P46B 4AYFB 1A1OB 1ZJAA 2C34A 5FGCB 1A5MC 1CEOA 5CQ1A 1AW2A 2ZYFA 4YWSA 2BFGA 1SFJA 1JTOA 1AP2B 4MWAE 1OP5K 4NKMA 1IEVA 4K39A 3MCKA 5T5FL 2OMUA 1AHMA 1J5CA 4RZCA 3RA7L 2ZG3A 1W91A 5AENA 3CZFA 2MKLC 3P11L 3DSFH 4XMPL 4F0RA 2G60H 3PQYA 4UI2A 1ADDA 1ET5A 3MLTB 1LWIA 3KVPA 3LRKA 2I69A 3K6IA 2E25A 2OT1A 4B4HA 2WXOA 1JWMB 3HEIB 3MV7E 3TBSA 5FCUH 2G5RA 2HTMA 3UTQA 5I75B 1K8DB 1OTSC 4RAVB 1TV7A 4JY5H 1QWUA 5K9XA 1U3HB 1CT8B 2VJ8A 4JS7A 3CJPA 1T2JA 5TPWL 3L5JA 3D85A 2UY2A 5J11C 5CWSB 4M1CD 5E6ID 1OAKH 3BO9A 4YYCA 5CIPB 2WO4A 2YSSB 1GG1A 1J5HA 3CVHL 2EIBA 3QSKB 4ZMXA 4PFMA 3SIMA 3VO0A 5F89B 4ADTA 2ICWI 3WD2A 1KXHA 1XEDA 5AB2A 4MWAD 2O61B 1KM3A 4MB3A 3BKJL 3PWPD 4PP1D 4TYUA 4OGXH 3BKJH 4AE0A 3KPLA 4J3OC 5KBMA 4M02A 1MY5A 3DURA 4P2OB 1OP5H 2DEWX 1IGSA 1YEEL 5DUPH 4D6JA 3O2VH 3WJLA 1R9FA 15C8L 4FABL 3E2QA 2NW2B 3MREA 3P73A 5I78A 1UZHA 2P80D 4MYAA 2M2DA 1FVCB 5L7XL 4WW2B 3GXPA 3GR8A 2J75A 1GKEA 4CJ1A 5LCVA 2CDFA 4JTAA 3BWAB 4MNQD 3UR8A 4UTKA 3EWCA 4GRWB 1NAMH 3NSFA 3NJMA 1BFOA 3ZE1E 4C56A 1EPVA 4Q6XA 2Z8SA 4JFHE 4RFOL 4NCC1 3TN5A 1ZXQA 1FIGH 3ANVA 3RY6A 1QX1A 3AOFA 1P6WA 4Z7UF 5AY7A 1IO4C 1O94A 3MVTA 3PQYB 4ROPA 4CAGA 3ZO0A 3T0ED 2GVEA 5D2LA 5FHAL 2V3EA 3FIGA 1TTGA 4FFZH 5T1KB 3A3YB 1JMXA 3DVFA 3OJDB 4OLZH 3U30B 4MBOA 2XQBH 1X5JA 4Z8FH 1FHNA 1E5JA 4NF7A 1A6WL 3QDMD 4A68A 3CHEA 3FDKA 2F74A 2DWSA 3OKNA 1PQZB 1KW1A 3OO2A 5IMMA 1ZVYA 3AWGA 3RM9A 1XL4A 3V4PA 4N6QA 1QNVA 4HOMA 3FO9A 2GBTA 4POZD 4XMZA 5T1MB 3BLOA 4O0QA 5CPQA 3EA3A 2V2WB 5FJTA 4NOBA 3PP3H 3O2LA 4F8OA 4KXCA 3JZUA 4AH2A 4TVDA 4BKNA 3KYMA 1V0KA 1DDHB 4E9TA 1JYWA 3U5UA 2XJLA 4JHWL 2X41A 4JHAL 4YEEA 4QR7A 4X8XA 1EUAA 4AWTA 2GJPA 2K0RA 3D3VB 2J6WA 3FV9A 4LOUC 3MBEC 2Z7KA 3M1BA 4OFPA 3QQNA 4OM0L 1KCBA 1G4MA 5ACLA 4WUKH 5I1LA 5KAQF 2FPYA 2G0WA 2XXFA 2EJ1A 3F04A 4ODHH 4PGCB 3CUXA 4MHBA 4YTSA 5AL8A 1BJ1H 1OADA 3HBGA 4NZDA 1L2UA 3DFTA 5CJQL 3VXTB 3OZOA 3BT2H 1KGYE 5HUOA 2GT9A 3F5WB 3WLIA 2EAEA 3N2OA 2EZ0D 3OGCB 1FBIH 2X6CA 1LG1A 4PJGB 4YBLB 3O6MH 3FJ4A 4LB3A 1MG2C 2YARA 3KLHC 1NANH 3Q5YA 1OX4A 4IZGA 1OAZH 3O9WC 3VRLF 5FX3A 4YTTA 1XPGA 1A7BA 2EC9T 3Q37A 4N2KA 4GRWF 2ZJSL 3FJTA 5C3LD 4A7SA 4QG9A 4ZUVB 4QJ5B 3SCUA 2GJZA 2GWGA 3U4BL 4FZ8H 3FFCE 3FKRA 3QJXA 1HTYA 3NCMA 5KVMC 4I7VA 2EDBA 2BOGX 1MZHA 3OGVA 5AVYB 4G5DA 4ANWA 3N6QA 1TMCB 2WYSA 3CVIH 3PZQA 4QDPA 1KFWA 5G2WA 2VISB 1TTRA 2H9AB 3D2UA 1ZLWK 3EFOB 4AMKH 1US2A 3GSWB 3T08A 4M7LL 5IY5B 4BQ4A 3E6HB 4QE1A 4QEGA 4DWSA 4QX4A 5A6JA 1HJVA 2X4QB 2PS2A 4GY7A 1DQIA 2VLLB 5LGJA 3E02A 1CLOH 1A3RH 2MNJB 3CQPA 1ACYH 4MS8C 4OQTA 1JPGA 1BYAA 1AFVH 5C3IA 4M81A 3FJLA 5DJDA 3NJNA 4K7FA 4U1LA 4I0PA 4Z3FA 2OJPA 4H1LH 1AYOA 4F8TA 3CUPA 2EIJB 3HI6H 4Q3MA 1M7XA 5CGYC 4NRZB 5B4MD 2BJML 1D3HA 4NQCE 3F05A 3MRNA 3TOYA 2MOGA 2R1YB 1EVUA 3OYZA 1MFDL 2XC8A 5LDUA 4Z1PA 2H0FA 4B90A 1B31A 4M8VA 3AG2B 4I8YA 4KMTL 4NSBA 1ZHKB 3GSWA 4DO6A 4WY7L 3HNTH 5CPLA 5A8PA 3VFTB 3I68A 1QPNA 2WKOA 4TQEL 4LKXB 2PR9A 2FWOB 1E5CA 1OF2A 3L23A 5DX7A 5EZIL 2FEDC 5FV1L 4YHZH 2A4AA 3HCVB 2R0WL 3PBMA 3GXMA 3S5LB 1FAIH 4F33A 5C9WA 1VDGA 3VXGA 4N2IA 2JV6A 4AUUA 2GTZB 4E8DA 1XBYA 4C1LA 3JZYA 4W9JC 3VB8A 4G7EA 5DFVD 3DMMC 1WUNT 4MXVF 2FO8A 5ITFB 3Q8EA 1T21B 1EBGA 5HD8C 2ADAA 2PU0A 3EYQD 3FYEB 3I6EA 4GVFA 4GXPA 4M6PA 2PLTA 2IO5A 5EN2A 2VQ1A 3JBG7 3QDAA 2CZFA 1NBVL 2V8MA 3P9LB 5JOFB 3WD5H 3NACH 1G4PA 4ADUA 3THDA 3C08H 4GW1B 4HKXA 1A5BA 1G7MA 3KOXA 2H32A 2RTTA 3CV7A 2BP5M 3KJ4B 2D2GA 4FTVE 4G9FA 4HH8A 3WK1A 1K70A 4NUQA 1HKLH 1A47A 1S5MA 4QOKB 1EVTC 1R3HB 1H3PH 4JFTA 4MMZA 2W63A 3WSUA 5TD4A 4WXYA 1TJ1A 1UJ3B 1WH0A 3CBRA 1FFQA 4G8EB 2QDHA 4FP8H 4LNRA 4ZO9A 1I8JA 3L0NA 4XISA 3V1HA 1J88A 4EE9A 1NGQL 1RHHA 4LPYA 4PJHE 1VBGA 5CGQA 1Q0XL 3S5YA 3N9GH 1KA9F 4HULB 5KSUB 1RULH 2P0IA 1I7TA 3CPUA 3T1FB 3HIJA 3IV8A 1JK9A 4KZDH 1VC4A 1YG9A 3FQWB 2Y5TB 4GSRA 1PVNA 4MGGA 4ERAA 2G37A 1FJ1B 2XN9A 1SR9A 4YHGA 3W0WA 4X4ZA 5HDOA 1IJNA 5DS2A 2D7TH 5E5MA 5F88B 1EV2E 1DYZA 1PQZA 2OPCA 1NMCC 4Y8AA 4Z9KB 1U41A 3N3EA 4H0IA 4OF3A 5CG0A 2XVGA 3ID7A 1KJVA 1IC7H 1LNUA 2OLHA 3KPNB 3UCDA 5KETA 3DGGA 5ETUB 1M57B 4HCLA 1BAFH 4PGDA 5KAQG 1DSYA 1US0A 3FO1A 2ON3A 4UNUA 2G60L 1JNEA 3NZ8B 2X4RA 1FH2A 4N3UA 4G9DA 3UGEA 4PW9A 5KG9A 5L6UA 2E6JA 3C2SA 2W5PA 1VCBC 2AKZA 4MBRA 4MTMA 4O51A 2IPWA 1D6VL 2BM3A 3GZOA 1HZHH 3EKGA 3OJVC 4WUIA 1QFUL 5IBTL 4K3GA 1MZZA 2BSEA 3TC9A 2NXYD 1DORA 1FN4A 3WKYA 2DH2A 1FVCA 3OSKA 1A3XA 3UFYA 3L4YA 1BREA 2K1MA 4M1GL 1DVFD 1YN6B 4Z7QE 4X4XA 4HT3A 5HGBB 3MREB 1Q6RA 4NJHA 4TS6A 4C6PA 4N9DA 2FX9H 1KGIA 2I5QA 1SNRA 2Z31D 3MBEB 4JFFD 4LNVA 4P04A 3OP2A 2P5EA 3TIMA 3ZE2F 3HGRA 1Q7QA 3VACA 2DBLL 1FWTA 4GBXB 1J0YA 4NP9A 1TIWA 3T4WA 4FB7A 4GMSH 4W4OC 3L4UA 4YUEH 4OSUH 3BZFA 4UDUB 3S37H 5FM8A 2YSSA 3F4WA 4OZGB 2F53D 4PGEB 2A3EA 2GGEA 3L67A 4NUMA 4QE4A 4KH9A 1B3IA 3GZKA 4WJ5B 2VM8A 4AZ7A 3E6FB 5FJUA 1UD4A 4I85A 4FTVD 1E0XA 2W66A 3LKNA 3BGGA 3IANA 3P61A 4ZMNA 1A4MA 2XZQH 4IMLB 2XWTA 1FHDA 1XPYA 1FO0L 1WBXA 4R7VA 1HFBA 5LXVA 2QDVA 4HIEA 3VIKA 1XINA 1S8DA 3LVTA 4RZCB 3TCLB 4H19A 4YC2C 1A4KB 1SJVA 1UOWA 3BP7A 3EG9B 3V6BR 3SO3B 3KHJA 4YSTA 1SW0A 5I09A 2VL4A 4X9IA 2C9XA 4BSWA 4DJMA 4HOWA 2AC0A 1YBQB 1AHKA 1XGPB 3GS6A 1B3ZA 4BI7A 4F2BA 2AXHA 3KHOA 5D6CA 2HDJA 1TUFA 4MDJA 5IOPA 3WH8A 4AZCA 2NYKA 1AQFA 4FQ1L 1FHGA 1JWUB 4JDBA 3H2NA 2OQYA 4BY3A 5AWNH 2JF6A 2V63A 3N3TA 5XIAA 4PRHE 5F3HB 5C07A 5MI0C 4HQVA 4QLJA 2YDRA 2ZNXA 2IKIA 2YAFA 1S7TB 2W67A 4XD4A 4M7ZC 2BJMH 1TJIL 1BSIA 3ZZSA 3VOHA 3NL3A 3SE8L 3EUDA 3D0VB 2L7JA 1MEWA 3LJ3A 1BTMA 3OB8A 1Q6CA 3PWJB 2VSCA 3WXWH 4GSUA 1ONQA 1CFBA 3PF2A 5EF1A 4DN4L 4LAKA 2W07B 3SY0B 1QVBA 4PJ8A 1OEZW 2CO1A 3T0TA 4C6BA 3UX9B 5B3JE 5FKAB 5H2BA 3ZUCA 4AEFA 1ZHAA 4KK6D 2BVDA 3WIHH 2QJHA 3LZ3A 5KEZA 4PR4A 4R3UA 3O3UN 1IAOA 2ED6A 2DMBA 3F3HA 5DBTA 2Y8KA 1K5NB 1OTTD 2CLKA 1JVKA 5FF2A 1MF2H 4E9RA 3Q05A 1KLGB 1USZA 2DIBA 4B3VA 4P9MH 5JHBA 4ZAKA 2I1OA 4YPGA 2FB3A 4X2PA 4QRAA 4ELDA 3O11A 1S9VA 4NB7A 2HX9A 3NSYA 4OFYA 1F00I 3OAZH 1ZA6B 4MZ3A 5HYQB 5KSBF 5MP6L 3CC1A 4NBYB 3P5ZA 1DL3A 3VNDA 2QSVA 1OAZL 3GS0A 3QIWD 2BDNL 4NPYA 3TL5A 4G7FA 3W7PA 1QI4A 1ZBWA 4J3SA 3JVAA 3MO7A 2ZFAA 4L9ZA 2CLVA 3SUWA 3RLSA 1KXTB 1DV7A 1NOFA 3R5EA 2CESA 3GVVA 2VDIA 3K1GA 2YL5A 3PL6C 5JQIB 1M05B 4QRPE 1A5CA 4F9PA 2QVIA 2DM7A 3TEZA 4BR1A 5FYJH 1RVFL 5KANG 4B3KA 1CT5A 4ZAKC 4HKZB 2I32A 4WI6A 3TTQA 2IXQB 4XOAA 4RGOL 2OX5B 3BDYH 1LP6A 1LK2A 4IF2A 4L18A 1BEUA 3CN0A 4WY0B 4L3CB 4ZNEE 1DJQA 3T3MF 5IFHH 3KLAB 3CSBA 1NUGA 5GS3A 3DU0A 4YDLC 1ZTVA 3A3HA 2WPGA 3PL6D 2XN1A 4LSQL 1T80A 4F27A 4UAOB 3EX2A 4PG9A 2Z8WC 4BGLA 5C0JB 1ORSA 4U1NA 1UBSA 5C9ZA 3BW2A 1I8MB 3MBXL 3Q2CA 2INFA 5IIEA 4P2YA 2W6RA 3EGXB 2HTLD 1OG6A 3NMEA 2PLKA 1IF2A 3R11A 4AD4A 5CLYA 4UMSA 1CIDA 3C2EA 4KC3B 5TBOA 4E68A 2YB4A 1J1OL 3W38A 3PAOA 2UX6A 1F6YA 2X87A 3MV7D 3NQFA 2WNWA 1SJMA 2NY6B 3MV8A 4CU7A 3N2TA 5JUEH 4WFHE 1EDHA 2WLLA 4FX8A 1ADWA 3O6CA 2WJFA 4PBGA 12E8L 2BVQB 3LEVH 1TQSA 4RBPH 5JZ7C 1P0EA 3CZGA 4N6RA 1A6UH 4AM0Q 4PCKA 1N2RA 1KPUA 4PVMA 3AQYA 4EUPH 4D9LL 5A1AA 4URIA 2JKPA 2ZPKH 4HIHB 2HJLA 1KB5L 3W00A 3VG0L 3RWHB 3WD0A 3GJFK 1I1YB 4LOEA 4D9QE 3U7AA 4O1AA 1QJWA 4M6UA 1A4AA 2CBUA 2FJKA 4A2SA 2K6WA 4TUOA 5FYLL 3Q4DA 4RFOH 1QHPA 1HHHA 2M1KA 2ZX9A 3U4EB 3JWNC 2X0HA 2XN9D 4AY8A 1HKWA 3KWWB 3CZSA 4CGUB 3IETB 4DNHA 5C97A 2I24N 2NY6C 5I3HA 4JTTA 1Z3NA 4WV1A 4X42A 5TQ0H 1JNNL 3PREA 1PX4A 4X80L 4DJFC 3V7PA 4M7JL 4ZZ9A 3H9HB 2QJMA 3JW7A 4TULL 3MSPA 3O3EB 3TA3C 4N0CC 1S7XB 5L9DH 1XZ0B 3RVXC 4AGMA 2VXQL 5LNEA 4NC1E 4R5XA 1KXVA 3NK4A 1HQ4B 2OTWB 3O8XB 2YD8A 4PB0L 4XXCA 4D7PA 3QFGA 1MUCA 4HOXA 1HJXA 1UR2A 4WHCA 5MHSE 1SQMA 1Q0XH 1CC3A 3GZQA 5IUCA 4IBVA 3II1A 3BP5A 1KCUL 1IAIH 4EE2A 5L8JB 2OTUB 2D3VA 2A79A 2YSWA 3T77B 4NBXB 2ARJQ 3RJQB 4V28A 1LEGA 2BP3A 1OC6A 2DWEA 3ESOA 4JPQA 4M61A 3WFCL 3S98A 1LBLA 2QPXA 5DURB 2XTJC 4ZMTA 2IKJA 4QD2E 5DVOA 1SUJA 3N2JA 4MD4B 4PMJA 5GGVL 1UCBL 5JYLA 3BEVA 4QRRA 4FK9A 1YY8A 2ESVA 4P61A 4B3ZA 2GJ6B 5JTWA 1GYMA 3N6YA 2JEQA 2VP8A 1U8CB 4N02A 1JRHI 4KHTH 5BOOA 1BPVA 4MRBA 3GJFB 1KLFB 2XDFA 1A02N 4D6IA 2BH0A 2GJJA 1XKJA 4KDTC 3VA8A 3QUZC 2DDQL 5E2TL 2W38A 3BKMH 4S2SA 1JUKA 1S7UA 3TYFA 2LLLA 4MA8H 4FTDA 3MUUA 3LLDA 2YZ1A 2VZVA 2PPFA 2UYLB 4D8PB 1AE6H 3VGBA 1XB6A 3R94A 3DIVA 2DWTA 3BAJA 3ARDB 3O3AB 4Z7UB 4BWLA 3HC3L 1ERNA 4DK5A 1BVOA 1AQDA 2R1XA 4HA4A 1JHTB 2UUDK 4IIQA 1NEYA 1ZENA 1X9LA 1ZV5A 4FTVB 4WIQA 3UBXB 1ICPA 1OQFA 4WFHD 5EUKA 2PTYA 4WJ8A 4NX5A 1HOEA 2NYYC 2VDNH 3HZKA 3MGAA 4H88L 1F02I 2Q6ZA 2WZMA 4Z2IA 3VFPA 1G4RA 3C2AH 3NCXA 2B81A 2VH5H 4QKXB 4XP5L 1SW7A 4PUJA 3SBFA 3WLMA 3LPGA 4LGXA 3I4KA 4OV9A 1C7SA 1SLUA 2YSTA 4U1IA 5HHXH 4AD3A 1C08A 2GJXB 1DUZB 4NWUL 2BWGA 4OZGE 3ASOB 4I87A 3P3YA 3URQA 1Q1JH 2WVTA 2XY1A 3UZVB 2BIOA 1A5SA 3BAWA 1U8MB 2ADIB 2VR3A 1AQDB 3FK3A 1O6TA 4LBAA 5AD0B 3RWEB 4P59L 4HUKB 3ASNB 2F1BA 4CADB 3RU6A 4AVFA 2UYLA 4PWKA 4BS0A 3HBZA 3K2GA 3SR7A 2G8ZA 3H54A 1WEJH 3TYFB 4KVCL 5C6TL 1THCA 3IRPX 1D3GA 4FQ1H 5AYIA 1ZTMA 3QS2A 2P4AB 1SF3A 4LRIA 3FTGA 1KJMA 1IBZA 3BV4A 1F13A 3RB7A 2VI0A 3QHZL 3N41F 2DQJL 1G0CA 3ZX1A 1K8YA 1N5AA 4IW4C 2YRBA 2XPGB 5KSWA 4FL4C 3UT0A 1CECA 2P26A 3CZEA 1TZAA 2AL2B 2ACQA 3B7SA 3QA3B 3FGCB 4GRLB 2HMIC 3HQPA 2DQTL 3J7HA 3PB2A 2JCCF 5BRZD 3OIHA 5J0BA 4KU1A 1T6BX 3D3VD 4Y4KA 3PZIA 3D5OF 2RAGA 3L2IA 1WUFA 3PGFL 4JFWA 4ZXBB 5KN5A 1NCAL 3M5VA 3SBPA 1BGGA 2XKNB 3TSMA 4UFHA 1SHWA 5A2KH 3FT0A 1SM3L 2WWOA 5JA9A 1M1BA 5D4YA 4L9XA 4YJZL 4TTGA 2I5YL 4WDIA 3A4JA 3VYNA 5C86A 3O8XA 3MODH 1SJCA 1ADQL 4E38A 1UR1A 4H0HB 3DG6A 3DMMD 3QQDB 3UR7A 3C5JA 3UTSE 3E9AA 4CMMB 1HEJC 2CKSA 2VR7A 3LPWA 2OSWA 3P30L 5G4NA 3O3EA 2G9HB 3O6LH 5H94B 5ELIA 2DDXA 1Q2SA 1FDLH 5AOKA 4ANVA 2AJ3A 4E9SA 1C3FA 1IVLA 1BYCA 4JX5A 3W2KA 4NRXB 1U6AL 4CC0A 2DW6A 1GTEA 4RLIA 2Y7QB 2PNDA 3IETA 1TQCC 4X7TB 3LCLA 5GNYA 4PIBA 4AKQA 2OR9H 2R27A 1RUKL 3CWGA 3UXKA 4R83A 3R0UA 1RUKH 4M6VA 3U4EA 4OFQA 4P4KC 4ROQA 1YPIA 1LXMA 2A4EA 4CSTA 1K8XA 3HE6B 4EIZC 2D24A 5EPMB 3W7LA 3QC5X 5CGYD 1OYBA 4K68A 1GH7A 3WS3B 5DMKB 3MZGB 5JOPE 2R1PA 3KX6A 1J0ZA 3RKDC 3JRKA 1BD2D 3I7SA 2K8MA 3NIGB 1U91B 4N0CD 4O00A 4AVJA 3O3RA 1TTCA 5ISZB 1BTCA 1MKFA 3PHQA 2QCLA 3H4XA 2W91A 1BV8A 3QEHA 2APFA 4H40A 1I4FB 1IKNC 3O6FB 3QEUB 5D6DA 1W31A 4GVGA 5B8CA 3ONBA 4IFKA 2XHNA 3OVQA 3QV9A 3PWPA 2YPIA 3NSXA 3BH8A 3DCPA 4HIIB 3HRZB 2X7LB 3UTSB 4MTVA 3IVUA 3SN6N 3BWZA 4NYUA 3BZ5A 3K6SB 2A4ZA 1JUBA 1W1B1 4Z7OB 5DMYA 3MHZA 1URZA 5JXAL 4D9RE 3EJJX 1HILA 3GM8A 5J9PB 3VWKD 3G1DA 2VDPL 2VN3A 5C3TA 2YPVA 3MRHA 1U42A 1EZLA 1XCWA 2ZBTA 4YN5A 4OD2B 4UZGA 5HYSB 2NY2B 3LPOA 4FG4A 3B8IA 5JZ7D 2EPNA 3Q2WA 5JW3L 2X0UA 3KBNA 1HHKA 4L3CA 3W1XA 4WY0A 4DZBB 4OHQA 3HNSL 3MA9L 3BKCH 1GAFH 5HHMD 4JO1L 3MRJA 2YPKA 5EU4B 4UANA 4BSVB 4A39A 1XYZA 3G0UA 3M6DA 2N1KA 3LS9A 5FYLD 4OKDA 5GJSH 2YD1A 4UUJA 1TEFA 4KETA 3H70A 4NILA 4DOHE 3RUGE 1ZGLB 3GH5A 3ECUA 4PREB 2XWEA 3MMDA 4RR4A 2G5BB 3GJEB 2BLFA 2BIPA 3U9PH 3FUJA 4HK0A 1A64A 1DANU 3MBED 1CPUA 3FUIA 4LOUD 4K38A 3W7HA 5F1NA 2PXYC 4D3CH 5IMKA 4CUCA 5K1VA 3APCA 4M6AA 2EGZA 1ISZA 2EE6A 1WSST 5D96C 1PL9A 3O11B 5EA0L 1ZLEA 3KE0A 4H1LB 3E8VA 4MNQE 2J7FA 4UTWC 2GITB 3VD3A 1KLGA 3UC2A 4ELME 2VN4A 4QSHA 4OD1H 2QFPA 3MJ9H 4X0VA 3C09C 1ZPTA 3SRHA 1RSYA 2BOLA 3TPKA 4BDVA 5AZ2L 2IV9A 2YIHA 1SQ7A 1LVEA 1YJDC 5BUPA 3NZSA 1WFTA 1HJQA 4DGVL 2F08A 1XGYL 5KZMA 5M2FX 3Q2NA 2A99A 2Z0UA 1IHIA 2WZAA 1CQYA 1UA6H 4P2QD 5F7AA 3NURA 4KCTA 3HI5L 3VCRA 3W72A 4LAJH 3I3EA 4QWWD 4B9JA 1J6PA 1XIJA 3DDMA 1AC0A 1NICA 3WKML 3STZB 1XCTA 1I9IH 4BH7B 1DQMH 2EHHA 3AHZA 1BFNA 3EAUA 5FA4B 4YSOA 2W5FA 4L4TD 4NM4H 3GSUB 2J7BA 3U6WA 3PWGA 4JPGA 4RH4A 1B4KA 3B2MA 4RGNC 4X4YB 3QE5A 3T9WA 5CH9A 3VX0A 1I9RH 5CJQH 4CU6A 4X99B 3FS9A 4FQXA 1PG7L 5E2TH 1E5NA 2CG9X 4ORIA 3FB8A 1NIEA 1L6XA 5HWMA 4U7KA 4ZUSB 3VFGL 1V77A 3BOLA 2H8PA 1PKQE 2FSEA 1NMAL 1XCQB 1ZLWH 2WQDA 3OYXA 4UMCA 3VKCA 35C8L 1CLYL 1QVOA 5T1DL 1SFSA 4LEOB 1A9EA 2FIRT 1EJVC 2OL3A 3LH8A 3KPSB 2ATPA 5JMOC 2CO4A 4UM9A 4F8XA 3TAOA 1B0RA 3QLLA 3D39A 4MJ5A 3IBOA 3FJNA 4XBJA 2CK0L 3MVSA 3ZHKA 2P3YA 1BVLB 1A3QA 1UD8A 2I7SA 4N2GA 2XPYA 1SN0A 4G80B 1AZNA 1AMXA 4RGNB 2BHUA 3SDYL 5C2UB 2VDHA 3OVRA 1BQ5A 4MMXB 2ZRXA 3BXNA 5IQ7L 3MLZL 4BEQA 5B21A 1KTKE 3EH5B 4WJXA 3T78A 4TRPL 1WTLA 2JF7A 5E6IC 2ALWA 1QLEB 2K70A 3LN4B 3OZ9H 4JFYA 2OI9C 2WN3A 4AENB 2GSGA 5FB8B 5F7NC 4A8RA 2I9EA 3FUNA 1V6XA 4PJIB 4R96A 4DEUA 4YL9A 3NA9H 1TPVA 4HK6A 4F0HA 1WQVT 3BMWA 4PHXA 3ZDXB 4HHGA 2CNCA 2FX8L 1NSNL 1UWEL 3FQRA 1JERA 2FX8H 3KDPB 2V5DA 4RDYA 1F3XA 1UUQA 1H6UA 3BWSA 3Q2LA 1RK5A 3WTWA 3ERPA 2FBOJ 2IH3B 1D5MA 4PRDB 2WHLA 2PCFB 4L64A 2XN9E 3DOHA 3QCVH 4HNCA 4KCUA 1JAEA 3GE7A 3LXUX 2X6AA 3CZJA 1H3GA 4YX2L 4YU1A 3GUTA 2HH0L 3CX5J 1V51A 2A7RA 2PDYA 3OU8A 6REQA 4UQEA 3QDGA 4Z3IA 2C5DC 2VEIA 5G4WA 3VIIA 1MCLA 3TFCA 3IU3B 2Z92B 4MCYB 2WHKA 3FFOA 5F9OL 2DQWA 3CE1A 4HKJA 2JKNA 5AEAA 3AQXA 2APSA 2IGFH 1ZAIA 1E4KA 2AXGB 2J8TA 4FHBD 3CAKA 2R2BB 1LGVA 4OZHA 5KG9B 3E0WA 3G77A 3LTPA 4AQ8A 3ITXA 25C8L 1MNZA 2HROA 2VR4A 4C1NB 1C93A 4Y5XB 5A3IC 3K13A 5BNKA 3X12A 3FY1A 3TNBA 2YGQA 5FEXA 3D69A 2UZXB 4BEIA 2B31A 2XWBB 4EANA 4LSUL 5ETUA 1OTUD 2TSBA 4RLDA 3TCTA 1YYML 2H6RA 1AGEB 2F2HA 2QGCA 2REQB 1ZGDA 4MDOA 3GGWB 1S7VB 3GSRB 1RVFH 2QVKA 3SODB 1QG3A 2P8LA 4L37A 4M6NL 5GGSB 4QRFA 1CLCA 3KPTA 5T5NG 1E6NA 2PRHA 2HT2D 3LXAA 5I0DA 3H56A 3PAZA 2XIMA 2DQTH 3SPIA 4U1SB 1YDYA 3M1ZA 4K36A 1YMME 5D2NA 4H9UA 3QIBB 2WCGA 4LVOB 4AIXA 4AQ8C 1HUVA 2EDNA 3UMNA 4QROA 3FQWA 2ZICA 3ZR4A 3AGVA 4J2QA 1W3LA 3EFDH 4GAYA 2BSLA 2NX3A 4XN8A 2GDQA 3EYUL 1KBWA 3ECBA 1LOLA 2DT2A 1EP3A 4UILL 4AITA 1X7FA 1YTKA 5KZDA 2JWYA 2BPBA 3AB0C 3RX5A 3G9AB 4PUBH 3AISA 5DUMH 3GB6A 4D8LA 4OB5H 2YAHA 2HLFD 1OAUH 1F11B 3LZNA 2DZPA 1DQQB 2FZ9A 4KEUA 3UZWA 1DVJA 3VDAA 2C8NA 1UM6H 4YZFE 1GOWA 3ZDYB 1U5VA 2FCBA 2PWHA 4XMLL 3UCQA 4A3RA 1N19A 3FU3A 4YHKH 1S9XA 3P0YH 3RWJA 3DX3A 3MRGB 3APYA 2G75A 3SCQA 4LSBA 4U3CA 2Y61A 2C13A 4NHVA 2NY5C 2H1PL 2R94A 4YTUA 1WT5A 1FORL 3E2HB 3EH1A 4GS7B 2E7MA 3HE7C 2JKRM 1F58H 3RCMA 4OZIB 2DQHL 2Y72A 3QORC 1W80A 1UWQA 3DX9B 4EWJA 4L4OA 3GKAA 4P5TB 1D2PA 3U9PL 5IR1B 3HB9A 3ZJAA 4GQ0A 2Z91B 2CJUL 5AKRA 3TQKA 3NJIA 2QPSA 1KWGA 2QXWA 5ISZE 1BBJB 4KZEL 1EEUA 3UQNA 3ELQA 4RGMC 1YEYA 1YVLA 1YN7B 5LXEA 1ISWA 1XYBA 2PURA 1IM9B 3R1ZA 5D9SA 4CCEA 3GIVA 5E8DH 5SV3A 4LEEA 3FFCA 3TT3H 1XFPA 1RQHA 4HNOA 4O1FA 4LKXA 3FF7A 4C56D 2OTDA 5BWAA 1ZHKA 2UX7A 1A21A 3LKOA 4M62L 4PMQA 4Y5YA 1CDIA 5D1QD 2DYPA 4JY4A 3GUTB 3QW3A 2W62A 1I8UA 4IK6A 1LYQA 1CBVL 4FAMA 1GNXA 3DOSB 4HCHA 2EECA 2NY1B 2Z4GA 1D2KA 4PJ7F 3NPXA 4OUEA 1DQLL 5AC4A 2HFTA 5DJDB 4I9WE 4OZFB 1NEUA 3GIQA 5FGRA 4N42A 2YZ5A 2B15A 4GK8A 2VSDA 3LHPL 5E2JA 4AK1A 1HXKA 3DX7A 4YUEL 1TQXA 3ZJ6A 1IBGL 2XA3A 4HSCX 4MQXC 5CCGE 4AIBA 2O5XL 2C9SA 4OFIA 2J78A 3MMUA 3DIFB 3NH7H 4LP5A 5DO2D 3CFBB 5CSZB 4YSEA 1W9UA 2QYGA 4PTDA 4QNEA 3EKCA 4C1KA 3HZVB 4YDJB 2ETWA 1SOXA 1MDLA 2E6AA 4OQVA 1MZYA 3HC4H 2RDTA 3AS1A 5CEXB 4XWUA 1Q38A 2PR4L 3MJ7A 3AU1A 4XAWL 5AKTA 1IWBA 3ABQA 2R56H 1AIZA 4NX0A 5DSCA 4Y1SA 5LN8A 1OC5A 1MFMA 1GC1H 4Z7WE 4UTWA 2X70B 1EOMA 2VDNB 5JPNB 2YQGA 2O7SA 3ITCA 2XY2A 5T3ZH 4S39A 1A6VL 3NSJA 3VI4E 3FU6A 3I9GH 5IGXH 4YHIB 4RETB 5KVEL 1HZKA 1DWAM 4LCCB 5B8CC 1RJYA 3ZVVA 3TXVA 5AWNL 4ZFGL 2P24A 3F01A 5LHFA 4GAGL 5E1AA 3UH8A 3DFNA 1MCPH 4O2FA 3QV8A 1P4LA 3CK0L 4J3WA 4YE4H 5F96H 1J5OL 3E0LA 2CA4A 5F0MB 4ZYKB 2PO6B 4UDTA 2HP4A 1BQLH 1EUNA 1XGUB 3MOQA 4BRVA 4F58H 3RF9A 2W9EH 2YRLA 1NIBA 3GHEH 5J13B 1T89C 2A6KA 5IT2L 4Y4HD 1T7LA 4HB7A 3LUTA 4FQJL 1IX2A 3EF4A 3K1KC 3UVAA 5J4MA 4LTSA 3GNPA 3TZVB 1IKNA 2Y2WA 2IW0A 4JHMA 2HLEB 2AI0H 3UTTB 2BVWA 4P3WA 1GGUA 3O7UA 7ENLA 3HG2A 3QT2A 4PTTA 1O9VA 4TPRH 5T1MA 5BV7C 1Y8BA 3LS4H 4AG4H 1PEWA 3ISIX 4TQTA 4WDXA 1XSIA 4BYHA 3MNWA 4MOZA 3MOAH 1BPLB 3F8UB 4BCXA 3OKNB 4KUZH 3W6MA 4DI8A 4UR9A 1AD9A 3CC5B 1JRCA 4BJHA 2J6EA 5DRIA 4AG0A 5D8ZA 3RX4A 4GH7B 2A73A 2HT4D 4HP5A 3AZUA 5SX4I 1T0OA 2NXZD 1K9TA 1WYJA 4U1MA 4XP1L 4JQIA 4H01A 1N6VA 1KB5B 4U3AA 5INCA 4FMVA 2C4FU 4YHPB 3MSDA 2YPLD 2G5BA 3GJEA 1FBAA 3IFPB 3GX9A 1HHGA 1V3LA 5FCUL 1VCGA 3BK0A 5AL0A 2F7QA 4POZC 1MCPL 1TVHB 1QHQA 1EYWA 3A4XA 4ZL1A 4NNBA 3O2WL 4XGZB 4JTJA 4FXGA 2FHBA 4FQLL 5KVGE 1OF6A 4KTEL 3B5GA 2ZCGA 4Q9QH 3U46A 1BMWA 5F7WC 3ULUC 1BXVA 4GOAA 3V10A 3BDYL 1YCSA 3SDAC 3M17A 4XN4A 4C6KA 2OO6A 2YFOA 3G6DH 4OLUH 5DXWA 2FR4B 4OLUL 4XCYB 2FX7L 3GEFA 1TNNA 4MKTA 4HKPA 4WOQA 3A3XA 4ZZFA 1MFEL 3ZL4L 2I5GA 3B2VL 4LRNH 1AG1O 4IX0A 4OI7A 1P5VA 1Z6JT 2V2XA 4O52A 2WZHA 4W85A 3W6YA 3WQ4A 2CBQA 4NFDA 1FCBA 3OJMB 2V5YA 4ZXBD 1FNGA 1HSAA 4HS8H 3TPUB 2JFEX 1HN1A 4RDQG 1A6AA 1NAML 3TEXA 1THAA 5HDBB 1Q63A 3GBNL 3ABRA 3F2CA 4HWEH 4HFWA 4KFZC 5ALBL 4C59B 2WIIA 2RIKA 1BD2E 3HZYB 3INUH 4KFOA 1B3VA 4ATLA 5HPOA 2R9RA 1TDQA 3QG6B 3UTPE 1HP5A 1MUMA 3HHSB 2QSCL 2ZC8A 2VDLL 1MCKA 3ARWA 3DX2A 3QEUA 3ZTJH 4AYEC 3DZ1A 1WZ1H 1KIQB 1PLAA 4NT6A 1MCIA 1FWSA 1FFNA 5ACMA 2HNHA 1EDTA 4R2GB 1A6UL 1BFVH 3SPVA 4YFLI 1UHVA 1KCRH 3QN3A 3BGAA 1O7DC 3ITOA 1G7IB 5I24A 1OK6A 5D5ME 1A9BA 3MUAA 5JOEA 2Z6FA 3FK4A 4KJWC 3QGAC 3W7DA 3C75A 3FB5B 5EPMA 4B9PA 1BLNA 2PTUA 4H8VA 5GSVA 1KKOA 3TW9A 1V27A 5KSBB 3MCKB 4CJ0A 1RHFA 3BFWA 4MCZA 2HT3D 1PKNA 3CYJA 4ETQB 3V36A 4B15A 5AVXB 3DVGB 1URLA 2YW3A 3V7AG 1TFHA 5EA9A 4B6ZA 5FEWA 1QSFD 5BXPA 3GLAA 4M7KL 3EOBB 1YUHB 1X39A 4HJEA 1SQ2N 2ZP8A 3B9DA 3HUJE 1XYFA 1CXFA 2XWJB 2OCJA 3QEQB 3G6JB 3VXME 3A5FA 4BHUI 2RGMA 4IKKA 4ZFMA 4TF4A 3ESNA 4Z7OE 1MCWW 3G1SA 1TPWA 5JO5B 4M19A 1E67A 4ABQA 4PGBA 2DMKA 4QY8B 4DZIA 3UP8A 4LLWB 4S1RL 4OUOA 1ITCA 5DJ2A 3PUUA 3RWCA 4ES8A 2X3CA 3T3MB 5I8OL 2FMNA 3G1AA 4J12A 4XZUB 4RWYL 4HGMA 3OG6B 4G1EB 3T2OA 1DWFM 3DO7B 4XHJD 4X6FB 2CXEA 4I3SL 3K7UA 1F58L 2IGLA 4G7VH 3QIUB 4QRRD 3MJ8B 4KY1H 4YBHA 1PTDA 1JVLA 2ROYA 4DUXA 1D7DA 1JRHL 1HI6B 2EADA 1MUJA 2XG4B 2DYPD 3LEYH 4GKNB 1A4BA 3EW3B 3NCJL 4JE0A 4WU5A 5DRNB 4BQ6A 1G7UA 1PYFA 4LUTA 3ZZLA 4M7ZB 3CGTA 2I85A 1UCBH 5EO1B 3UXFA 1NBQA 1YEGH 1ITUA 1HP4A 2Z2AA 4P2RB 3TN0B 3VTTA 1V02A 3WJSA 2OMXA 5DA4A 2F53A 3VRIA 5E51A 2OGYA 2DY3A 5HNTA 5EIQA 5DWPA 1FCUA 4OECA 4N1EA 3CQJA 3EJYD 4ZUTA 2QCHA 3QYMA 1HU8A 3IGFA 5GRWA 2DQXA 3DBPA 4JIRA 1I8KA 3QAZB 5BXTA 5CD5D 1U0QA 2IFFL 3FKUS 3ITVA 2XKUA 4BSJA 4H0LC 4G72B 3WY4A 3MRDB 2QHLA 4DUVA 2BOCA 1R0AL 4FALA 1W0WA 4BXSV 2PDJA 3NEHA 3HNVH 4UV4H 2HJFB 2WXRA 2TPSA 4O1EA 4Y2LA 3UZVA 3REWA 1SN2A 3FSWA 2FYVA 1G01A 1Z89A 3W26A 1PDKA 5CEZH 1HH6B 1VQTA 2UWFA 4HNLA 4X5PA 4G71B 3N1PC 1AD4A 2EG6A 1MCDA 1G1KA 3HN5A 2D7NA 5ICXA 1AW5A 3UFIA 4S3FA 2CZDA 5C0BE 1EDGA 3G5ZA 5DHYA 5GGTA 1MCQA 4KHXL 2YPLA 4JTHA 2J73A 3FOLA 3HBPA 4UQAA 1LM8V 2VDQB 4E41D 4F9LA 5GS2D 1KCKA 4R4FL 2VR2A 5FAJA 2J25A 5D7HA 1VPXA 2J8OA 3C5XA 1OW0C 4NKIH 2XBTA 3ZWSA 5B7EA 4CILA 3G8EA 3JQOB 1QSVA 4YSQA 1E9PB 1JULA 3NESA 1FVEA 3PL6B 5JW4M 3LU2A 1SBSL 3WLRA 3ULVL 2Z29A 3MV11 4MNGB 2GY5A 4WWNA 1E3ZA 1PZCA 1H51A 1DLFL 1AH4A 3N15A 4LH8A 4XP1H 1MCSA 4LVNB 4I18A 4ZTXA 2XVNA 4AGPA 2HFGL 1W72L 3QGKC 2HVKA 3KCWA 3PFMA 1QFHA 1RALA 5DZLA 3GSNB 1QI0A 3LIUA 3OZMA 4P5TC 4C4KO 3QYCA 2V38A 1NBCA 3FU0A 2WBJD 2NY3B 5L88L 3TJHD 3O2DH 1EJOH 5EBLB 1UD5A 4QTGA 2XACC 1A7NL 1DANT 4JRXB 4WU5B 4JPVH 1W32A 5DU7A 3W81A 3ISYA 1I45A 1JFQL 4AUYA 1SM9A 3KZSA 3IVKA 3CAWA 1MHEA 3E8UH 3OXSB 4JM4L 4Y7EA 3KAOA 1P1XA 1FZMA 2OZ4A 1GS6X 3MCNA 5I1GL 2QADD 1LO3L 4RCAA 1WAUA 3R79A 3GLZA 4P06A 3TBYB 5ESVA 1WAPA 3ZMNA 3TJ4A 4XTRC 1ZA3B 2E77A 2KS0A 1W6WA 3WGVB 3BWWA 5LA2A 2NVDA 1POJA 5IT2H 4F57H 2EJAA 1AGFB 1HQRA 2Z7WA 1XIWD 2GPZA 1E4LA 1NGPH 3JVFC 2VEGA 3FQUB 3OG4B 2QV4A 5ESVB 4PJCA 3ALPA 2ILLA 1PB0A 3CX5K