1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ALPHA-AMYLASE)
publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
2XM2A 5EMYA 2J7HA 2V3EA 2CCRA 1JI2A 1J9YA 4C7FA 1A47A 1UD5A 3VIJA 1V3HA 3A47A 3MSDA 2WBGA 3WNPA 1DWAM 1IV8A 1KGUA 4MJ2A 3SCSA 3TP4A 1UR0A 2ZUSA 1H1NA 1GOKA 3RJYA 1XH1A 3I3EA 2OYKA 1Q4NX 3CZLA 2DT2A 3HN3A 1HVQA 4HA3A 4FNRA 2CBVA 4HU0A 3K4AA 3JUGA 3F5LA 3RILA 2NSXA 3WF2A 2J25A 4ATWA 1CECA 1EQCA 2ZUNA 4P8VA 3CZNA 2XPKA 1JNEA 2QPSA 4PTWA 4GZEA 3GNPA 3WDRA 3WMSA 1YQ2A 2C7FA 1WE5A 4CN6A 4TOQA 5D4YA 3LMYA 4AY1A 2J7CA 2F7RA 2EADA 4JL1A 4X0NA 1LQ0A 4D72A 2CBUA 1XC6A 4D6HA 3WD0A 4AD0A 2E0PA 1UKOA 4PUEA 4TVUA 5F7UA 2QV4A 4OBRA 4C7GA 3ARWA 4UOZA 3PZGA 1BGAA 3KWXA 2WMKA 5E1QA 1TZ7A 1R33A 2VZOA 3ZSSA 2XVLA 1E6ZA 3CUJA 4MAVA 3LPOA 3TTYA 3VSUA 1KR1A 4GI8A 4UNIA 1KCKA 3W6LA 5D8ZA 2J7BA 4NXSA 2J7GA 3WL0A 5FOOA 3QGVA 1UKTA 1CXLA 4UQ9A 4OJYA 2X0YA 3AHZA 4QCFA 3PTQA 2XFYA 3PTMA 1B3XA 1LL4A 2A3HA 3ARXA 4PBGA 5I79A 3WEMA 1GOWA 2PI6A 1BVNP 3ARUA 1SMDA 1UD6A 1U2YA 1CLXA 3SCWA 2VX6A 2WLZA 2J7EA 1UQYA 3VIPA 2DH3A 1VEOA 1OIFA 3KZSA 4UFKA 2O9TA 3W38A 3SCRA 3SUWA 3OLGA 1OT1A 3POHA 4ACZA 4CKQA 3U5YA 5JBEA 4XZBA 3F5KA 4QLJA 3WNLA 3VDBA 3WY4A 2FHCA 5D9NA 2VO5A 2ZX6A 1WZAA 4URIA 1PIGA 2GUYA 5I3DA 1WDQA 1JDCA 1ZS2A 1UR9A 4UOQA 3T2QA 3CZ8A 4PCSA 4KGJA 3BCDA 1KXTA 3IJ8A 1W9DM 4V28A 1QI3A 2OSWA 5E6ZA 2FDMA 1PX8A 2ZUUA 3BSGA 2PC8A 2JALA 1E71M 3PN8A 5BWFA 1EGZA 3NIYA 2ZOXA 2VUYA 1W2VA 4PMOA 3VD5A 3VOCA 1QHZA 3KEHA 1J0ZA 1XRVA 2CERA 5BXSA 3NSNA 3UERA 1OM0A 4AISA 1B90A 1PX4A 5A6JA 1CXFA 2VMFA 2J74A 4J3XA 4MAZA 1J0HA 1WB0A 2ZUMA 3EDJA 4KGLA 2CITA 2JIWA 4RE2A 4M1RA 1KTCA 4MNMA 1J10A 3FY1A 3FNDA 4ZE4A 4CVUA 4H8HA 1ODZA 3BLKA 4EE9A 2C0HA 4C7DA 4HMEA 2O9PA 1ISYA 3ARSA 2WVVB 4Z2JA 1NQ6A 1ZJBA 3S2CA 1BFNA 4W8LA 4WJXA 3EDFA 1QNOA 4AXNA 3B9AA 2FH6A 3BUBA 3AMDA 3IJ9A 1CGTA 5JBFA 1G01A 3OG2A 2PWEA 4U5IA 1WPCA 4GO9A 3N18A 3D51A 2YFOA 4MADA 1GPFA 5I0DA 3PZOA 3WIJA 3VNYA 7CGTA 3WY1A 3WDPP 5M03A 2XVNA 3CO4A 3PZQA 1LWHA 3BAKA 5E09A 1CYGA 3VD9A 1ZBVA 3W26A 3D50A 1E3XA 4S3JA 3VDHA 3W29A 4CN1A 1TE1A 2D22A 2X8RA 4F9JA 1CENA 3CUHA 2WC4A 4L4PA 2VRJA 2RGMA 1E6QM 3AIBA 1G5AA 3LPPA 3EDDA 2G8ZA 1E40A 4CD8A 2QLYA 1M03A 5BCAA 3O2LA 4PMQA 2DSUA 3PZIA 4HZ8A 3CUGA 3AIWA 4H04A 3LXCA 3WENA 2XSBA 5CQ1A 2ALWA 1BYCA 4P7NA 5GQBA 3SCNA 1XCWA 1XGZA 2WVSA 2XGBA 4QAWA 3VD7A 1KXHA 1DHKA 5GNZA 3RM8A 4AIEA 4CD5A 1DTUA 3DHPA 2XYLA 4XV0A 4CCEA 4IUGA 5E0FA 3CLWA 4JL2A 1TA3B 1FOBA 1B9ZA 1WDRA 2ZICA 3SURA 4P7RA 1HL9A 4HTYA 2G3JA 2DSWA 1GOMA 3VX0A 5ABFB 1VFMA 1X6NA 1A3HA 2ZUTA 4F66A 2FGLA 3ZSTA 1O7AA 5I24A 3TTSA 1MW1A 5LA0A 1TQWA 3EYPA 4XUYA 3PZUA 4NRRA 4LGXA 3WBAA 4E4PA 2F2HA 4LQ1A 5A6LA 2A3AA 1R7OA 2GDVA 4CD7A 1VENA 1I1WA 1V0KA 1UHVA 3T0AA 1H3GA 3AMKA 4X0VA 3SEPA 5A2CA 4FNUA 4DWSB 3TTQA 2VVNA 3GBDA 3NYDA 4AWEA 1U33A 2GVYA 2XVGA 3AZTA 1WNOA 2OLHA 4ZXOA 1ISXA 1AMYA 2YKKA 2DEPA 3U7VA 4PRWA 3ZT7A 4MNLA 4U31A 1MWOA 1JIBA 2EJ1A 1YHTA 4PMDA 1V3LA 2FHFA 4V2XA 1JZ3A 4AD3A 4ZEPA 4ZXLA 4D6GA 3WD2A 5DT5A 1C93A 3WUBA 1D3CA 4UQCA 1E15A 2G3MA 3OZPA 1KCLA 1JXKA 5M3WA 3MANA 3FW6A 3BAIA 2WM0A 2Q8XA 3S6TA 3GYCA 1BF2A 1J0KA 2ZX8A 1G9HA 3CTTA 1FFRA 1UH4A 4LXFA 3FHQA 3PBGA 4J28A 2YDRA 2V3GA 3FN9A 5I23A 4IPNB 4GQQA 3PZ9A 4W7WA 2E3ZA 1JDDA 1ODUA 3WNMA 1B1YA 1V03A 5DMYA 1E5NA 5CPQA 1HNYA 1UR1A 2A3EA 2BFGA 4UTFA 1R7AA 1Q6FA 2OSXA 3VMOA 4AMWA 3UG5A 1W3LA 1W3HA 2ZX5A 1EHAA 3A22A 3CMGA 4B9ZA 1EOMA 2E8ZA 1Q6DA 4PMUA 4IM4A 4CD4A 2BY3A 1E5JA 1QX1A 3UG4A 3APGA 2GSJA 3VVGA 3VD3A 1UD8A 3CPUA 4AEEA 3AROA 1HXJA 1X1NA 2DIJA 3NSMA 4J3UA 5EB8A 2W66A 2ESCA 2EAEA 3POCA 1BG9A 1MXDA 3WDHA 1VBUA 3AICA 2XG9A 3EJRA 3G6MA 3WN6A 1J0YA 2WHJA 2V3FA 1JGIA 1E55A 3OB8A 2QMJA 1N82A 5IFPA 1L0PA 2BV9A 1CXIA 1GJUA 4HOZA 1CGWA 3W53A 2EBNA 2D0GA 4JFWA 1HJXA 1FP8A 3WUEA 1U30A 4OIFA 3EMQA 3MMWA 5FD0A 3W27A 4CCCA 2J75A 4JKLA 4WF7A 4UZUA 4AYSA 2X1IA 2GJXB 3WFZA 1V0LA 1QNQA 2CNCA 2G3IA 3WNKA 3ZJ8A 1V6YA 4KRTA 2YBUA 2FH8A 1OBAA 1OCQA 3PZNA 4D6DA 5I6SA 1GQJA 2VX5A 3ARTA 5A8NA 1JZ5A 2WVVA 1GVYA 4GO8A 1OD0A 5KEZA 4QP0A 4IPLA 3VKKA 1EXPA 1UR8A 4AMCA 3RO8A 3AMLA 4DM2A 5A6SA 1XCXA 4DM1A 8A3HA 1BG4A 1W9PA 4D6CA 3SUVA 1DWHM 1EH9A 1CEOA 3L4TA 4MDPA 1ZB5A 3AS0A 3T08A 4AIUA 1EQPA 2WMHA 2YL8A 2O9OA 2WYSA 4AEFA 2PWHA 2EACA 2WANA 2WSPA 4QLKA 3BVUA 1GQLA 1GQIA 3CHEA 2W4XA 1UYQA 4KMQA 2VZTA 1B2YA 3BGAA 2VR4A 4QCEA 3IANA 2EPOA 4M80A 2ZXDA 3BUIA 1H09A 2JF7A 2WNWA 4OZOA 3WF3A 1TR1A 4P7OA 2EPLX 4AZ7A 4ML4A 4B9YA 2VT0A 3DX0A 2CHNA 1E4IA 3SCQA 2VI0A 4CU8A 3D5HA 2CYGA 1QI2A 2YDQA 4PCTA 4XX6A 2XVPA 3QHMA 1HT6A 2XSAA 5A2AA 1E6NA 2AMGA 2XIBA 3BXWA 3MO4A 4W8BA 1RH9A 2Y8VA 4LPCA 5FIPA 2EO7A 4DUVA 1CGUA 2QPUA 3RCNA 5BXTA 1LG1A 4H2CA 3LRKA 2JIEA 4AD1A 3BCFA 4HZ7A 2CBJA 1TA3A 3VILA 1HTYA 1NOUA 3NCOA 4NZJA 1DWGM 1H11A 2V5CA 2GJPA 3CUIA 4JFTA 3NJ3A 4J3VA 1JYVA 4PTMA 1QI5A 4F79A 1HP4A 3KLKA 1CGXA 4V27A 2WSKA 1KQYA 3SUSA 4QFUA 2WWCA 1EDTA 4ZFMA 1R34A 1LF1A 4BF7A 3N9KA 4AZCB 2D24A 3MKKA 4TUFA 2VQUA 2AOSA 2X2YA 1ITCA 1LG2A 5LA2A 5E0CA 1US3A 1P6WA 3D4YA 3CUFA 4FNSA 2VNCA 3VNZA 1RD6A 1HIZA 1V02A 1V6UA 3N13A 4TTUA 5GNXA 4Q7NA 1WDSA 1KBBA 1W9UA 5D9PA 4L4OA 3AJ7A 5EBAA 2UWFA 1AQHA 2D0HA 1BAGA 1SYTA 2ZIDA 3EJSA 1QWNA 4RE4A 1JG9A 1BHGA 2YDSA 1QI4A 4GIAA 3T2OA 1BTCA 1TQSA 2CKSA 4JFVA 1C7TA 1GNXA 1EDQA 1JDAA 4TXEA 2W67A 4JHZA 3N15A 1E9LA 5HNNA 3DDFA 2XFFA 3N11A 4Z2GA 3VSVA 4TVCA 4JCMA 1LL6A 3BSHA 4B15A 4UFHA 3VIMA 4AZGA 1DEDA 3IJ7A 4DWSD 4BA0A 4FLSA 3IAQA 3AIEA 3CHDA 1R75A 2VJXA 4EKJA 5EFDA 4AZHA 4W86A 4UQDA 1W1YA 3T09A 5KZ6A 4A4AA 3KL5A 5A95A 2WHKA 1ISWA 1QNSA 4JIEA 1W3JA 3VIIA 4HP5A 1E6XM 1VFOA 3OLIA 3OBAA 3WH6A 4WKAA 5A3HA 4EK7A 2DSVA 4KRUA 1C90A 4MPKA 3ARZA 1CDGA 2D73A 1VAHA 2J62A 4JAWA 2BHYA 1JZ6A 1VBRA 5HXMA 4BS0A 1EIBA 1WKYA 1EO7A 5A6AA 1MFUA 3W25A 4TX6A 3ZMRA 1JF6A 1W1VA 1JFHA 2DDXA 3EJQA 2PWGA 2QMKA 4J7RA 1B30A 3WNOA 5JBDA 2WZEA 4OBSA 3MUIA 1CGVA 2WMJA 5D9OA 4UCFA 7A3HA 1DP0A 4P7QA 3GXDA 2Z1KA 4GI9A 2JEQA 3QOKA 3WH5A 1E0VA 4YPJA 4PTVA 3K8KA 3BMWA 1SZNA 3AFBA 4ATDA 1H41A 3AI0A 4U2YA 2ZX9A 4D1JA 2FYVA 2UY2A 3BVXA 1TMQA 3HG3A 4AZ6A 2BVDA 1UG6A 4F8XA 1JFXA 1JYWA 3CHFA 1WCGA 3II1A 1OIMA 1QVBA 4Z2KA 4WIWA 4ACYA 4N0RA 3DYOA 5A94A 5DO8A 4YHGA 3UEQA 4AZ5A 3GXNA 5ABEA 1QI0A 4MNKA 4D6FA 1MXGA 3K8MA 3ZT5A 2D0FA 3VIGA 3GXFA 5CXPA 3VO0A 1JD7A 5IDIA 4GXPA 1NM9A 3CMJA 3ZO9A 2CBIA 3HG5A 4KH2A 1UKSA 4UQBA 1E0WA 2OWCA 1CPUA 1QWUA 3WMBA 3ZR5A 4LX4A 3TTOA 3U5UA 2QF8A 1UR4A 1BYDA 4AW7A 5E70A 1LJYA 1NP0A 4UOJA 5A1AA 2OWWA 3VDAA 2TAAA 1S46A 2VTFA 4UFLA 5IHRA 1H49A 2V38A 3VUPA 3QHOA 2WC3A 3AOFA 3LPFA 2XN1A 2BXZA 1E43A 1LWJA 3BH4A 3CH9A 4ZE5A 3GTNA 3GNOA 2WAGA 1JL8A 2XTKA 2E9BA 3ALGA 1KWGA 3WQ6A 4PMZA 3U7BA 1JI1A 1HKIA 4QDMA 2O92A 5BYWA 2GJRA 1K9EA 2VX4A 3AIUA 1CWYA 1PIFA 2XN2A 2CXGA 4A3YA 4R27A 2IUZA 2XGIA 4MB4A 4D1IA 3RDKA 1ZBCA 2GDUA 2Y8KA 4TVDA 1CXEA 4DUWA 5CLTA 5E9AA 1J18A 4GINA 2VCBA 2WMIB 1HJVA 3K4DA 2WHLA 3M46A 1XSIA 4DO5A 1JD9A 5D8WA 1MFVA 3WF0A 1VF8A 3MU7A 1TVPA 2J7FA 1HJUA 3WD1A 2YIHA 3ARRA 3NDZA 2CKRA 4HZ6A 4JZ5A 1NP2A 1VEMA 4MTVA 1VFUA 3BMVA 4AZCA 3ZT6A 3G6LA 2PBOA 4GZJA 4AD4A 2JF6A 1FHLA 1QW9A 2VRQA 3WY3A 4FMVA 2OYMA 5BROA 5A8QA 2ZXBA 1O6IA 1GONA 4JCLA 3NDYA 3SUTA 1ZL1A 4HOXA 3ECQA 1WZKA 1ZBKA 3K8LA 1CXHA 2XWEA 1V6XA 1W91A 3AYRA 1WAWA 1ZU8A 4H8UA 5ABGA 1JAKA 4FK9A 3MUZ1 2OW7A 3TOPA 2ZXAA 3LRMA 1HKKA 3GXIA 1GCYA 4FLOA 3UCQA 1BLIA 1US2A 1B0IA 1K9DA 2JFEX 1HF6A 3D52A 8CGTA 1NWUA 3KL3A 1UOKA 4CD6A 1GOOA 2NW0A 4PMVA 3I3BA 1C8YA 4M81A 4AMXA 3EDEA 4WK9A 5GPRA 4H41A 1FP9A 1GOIA 1W1TA 4CVWA 3GH7A 3FXYA 4GZIA 2X0HA 3QHNA 2GFTA 2Z1SA 2VZSA 4Z2LA 4HMDA 1J12A 4WKHA 3L2MA 2G3NA 5EFFA 2J78A 4Y7EA 4BZYA 2J8FA 3MUY1 4B3KA 1TUXA 2VRKA 3BVWA 2WCAA 3AHTA 4LYPA 1TVNA 3MMUA 4CGTA 2EPKX 6TAAA 2Y2WA 5FKYA 3BUQA 4W88A 1HP5A 3ZR6A 4M24A 4H7VA 4U33A 1OB0A 1EDGA 4W87A 2J4GA 3K46A 1M04A 1UH3A 4EAMA 4FNQA 1PS3A 3CV5A 4W5ZA 5A8MA 1HXKA 4MDOA 4HOWA 1PZ3A 5CSYA 1JZ7A 2BHZA 1PAMA 2CIPA 4NZFA 1FFQA 3AIQA 3E1F1 3M7SA 3LXBA 1OINA 1E6RA 1M53A 1W2PA 1FH7A 2F8QA 2BHUA 1QBAA 4YN5A 2OW6A 5DT7A 2XVKA 1BSIA 3AQUA 3CBWA 2OYLA 3S5ZA 2BY0A 4M56A 2WCGA 4BQ4A 2WXDM 3PZMA 1CIUA 2RGLA 5A2BA 5A6BA 1VB9A 3WFLA 1BVZA 1VRXA 2X05A 4WSKA 3W0KA 3UESA 1OSEA 1XV8A 2EPMX 2VCAA 2CPUA 1E1FA 4OGZA 1UD2A 4PMYA 4CN4A 2EPNA 2UY5A 3PTKA 3MS8A 1UKQA 4Q22A 1E72M 1V6WA 5GNYA 3PHAA 4UQAA 2ZE0A 3HZ3A 1KGXA 1QHPA 3VGDA 1NARA 1QPKA 2DT3A 2PBGA 3VIFA 5FL0A 4P8WA 2DT0A 2VR5A 5BRQA 1SR0A 3AHVA 4QLLA 1ESWA 5HBFA 1GUVA 1I75A 5ECUA 1H4PA 1E4NA 3WMCA 1PEZA 3MSGA 3N12A 2BNJA 4TTGA 3WH9A 3O9NA 1HL8A 1KTBA 3A5VA 3FAWA 2DSKA 2V5DA 3VU2A 5BRPA 3WUFA 5AC5A 2W5FA 4KWUA 1E3ZA 3W37A 3ARQA 1CTNA 4AD2A 5IFTA 3HJEA 3GDBA 2DGAA 5A6BD 1K9FA 2YJQA 3WQWA 1PZ2A 3EMZA 1V0NA 1CGYA 1C92A 3A24A 3L4UA 4B16A 3WF1A 1MQPA 4ATLA 3LX9A 4D6JA 3FAXA 1KWKA 5DEZA 3ZOAA 3HU7A 1QHOA 4X9YA 3WD3A 1UZ4A 5HOSA 2WVUA 2UY3A 2D1ZA 1GVIA 6CGTA 3KL0A 1HJWA 2VX7A 1UA7A 1OGBA 2WMGA 1B31A 1PBGA 1OGGA 3AMCA 3IAPA 1HKJA 1UKPA 1KB3A 3BAWA 3W4RA 1QOXA 3B9EA 3H55A 3I3DA 1WO2A 5LA1A 3PZVA 1VJSA 3H54A 4J3TA 1G0CA 3WUGA 1MVYA 1V08A 3CZGA 3TONA 1C8QA 4N42A 3GH4A 1NWRA 1WDPA 3O6AA 3IGUA 2WMIA 2F7PA 3CZEA 3BLBA 2YA2A 3ZJKA 5ABFA 1OWQA 4BQ5A 3SCVA 1B3ZA 4HMCA 4PTXA 4D6EA 1AQ0A 3CC1A 1M7XA 1DWJM 2JEPA 2EXOA 2YFNA 1HJSA 1XYFA 4K68A 2VCCA 4HA1A 3RM9A 4WLCA 2WKLA 3J7HA 1QW8A 1HKMA 4DWSA 2D20A 2XFRA 4AIOA 4NI3A 1F4AA 3VIOA 1JF5A 1H0GA 3AXIA 3W6MA 1TG7A 1MW3A 2F1AA 1PX3A 2UY4A 3SCOA 4DWSC 3MV01 1R87A 1UD4A 1VIWA 5DFAA 1Q6EA 3QOMA 3HG2A 2CEQA 3BVTA 1R46A 3WSUA 2YOCA 2EQDA 4HPGA 2Y4SA 1EO5A 1NOFA 4Z2IA 5IHSA 1J01A 4AZBA 6A3HA 1AQMA 4DUXA 1E4MM 1R8LA 2WB5A 2XIIA 2DIEA 1MQRA 3WBEA 3BUDA 1UQZA 1TFVA 5M5DA 3N1AA 3AIRA 3WDQA 4PYSA 4RE3A 4BCEA 2WZHA 1CLVA 1H0IA 2PWDA 3OLDA 2WVTA 3QR3A 2B31A 3B9DA 2CESA 7TAAA 2BY1A 3VTRA 3ZJ7A 1VEPA 2WWDA 2F7QA 3VDCA 1MQQA 2VOTA 1D2KA 3AISA 1AVAA 4HA4A 4NZCA 1UD3A 4CU7A 2FE0A 3W82A 3MI6A 1LLOA 3DHUA 1XYZA 3MUAA 2YA0A 1GW1A 3DX2A 4S3KA 3OIHA 3L4WA 1CXKA 1W3KA 1JNDA 2A3BA 1FHDA 1RPKA 1V3MA 1PJ9A 1NOWA 1R47A 1NH6A 9CGTA 5C71A 5AYIA 2BVYA 4AYGA 2XWDA 3VGHA 3VGGA 3VMNA 3VSTA 3KE0A 1KQZA 4MB5A 3WQVA 3CZSA 4W85A 1UWUA 4MB3A 3L4XA 3UETA 4W7VA 1E1EA 4JFSA 5CGMA 5JIPA 1UA3A 1ZBWA 2YA1A 3TV8A 4FLRA 1B3YA 3M07A 2CHOA 3M6DA 3W28A 1SFSA 3T0BA 3OLEA 1E4LA 3N17A 1TCMA 2Y5EA 1LL7A 5AC4A 1QBBA 5BXPA 3BAXA 3VIHA 4CUCA 5C8BB 5E6YA 3WQ8A 3A3HA 4W89A 3AZSA 4XZWA 1XD1A 5A8OA 2D3LA 1ZJAA 1C3FA 4J3WA 1WP6A 2J79A 1HX0A 3THCA 2GJXA 3H53A 1J11A 1TQVA 1W9BM 4PMRA 4W8AA 3BC9A 1C8XA 4WKFA 2ZWZA 4U2ZA 3B8SA 5IXEA 1JAEA 1QNRA 4P8UA 2J7DA 1KXVA 4PSRA 1F4HA 3UG3A 1E70M 4D71A 2Y24A 2VL4A 2XN0A 3A4AA 5BXRA 3SCUA 4JKKA 3VD4A 4LYQA 2IGTA 4UZSA 4PSPA 3SCPA 3WEZA 1E56A 2VZVA 3RPMA 3HMCA 3VGFA 2GK1B 5TD4A 1V6VA 4PN2A 3THDA 1RP8A 4M29A 3U57A 1QNPA 1EOKA 3PZTA 4W7UA 1UWTA 3EJTA 1BQCA 1WZLA 4MNJA 1EHNA 4LYRA 1BPLB 1NWTA 1PPIA 3AYSA 3A4WA 3WDIA 2PB1A 1TQUA 1DWIM 2D23A 5I5RA 2XUCA 4J3SA 3DX3A 3CIVA 1OD8A 1K9TA 2X2IA 2OSYA 4IISA 4MJ4A 2WMFA 5DF0A 4RL3A 4UFIA 2BXYA 1HJQA 1JYNA 3MMDA 4NRSA 3ZQ9A 5M17A 1JZ4A 2DH2A 4NF7A 4PEEA 3WKZA 1GORA 2WK2A 4HU8A 3SUUA 3N04A 1W9VA 2C8NA 3A6OA 4D6IA 1E73M 4TX8A 1W9XA 5ABHA 5D9MA 3A23A 2WLYA 2F61A 1B3VA 2O9RA 1JYXA 1CNVA 2EABA 2DSZA 1XSJA 1UUQA 3L2LA 2G4FA 1UWIA 1UWQA 2VVSA 1FA2A 2F18A 3ARVA 3RMEA 2X2JA 1Y7VA 4GI6A 1BYBA 1GHRA 3SCTA 3CGTA 1G1YA 4U5KA 1JZ8A 3WQ4A 3ZM8A 1UH2A 1ECEA 4NSBA 1IZKA 4OKDA 4U3CA 3VPLA 2F7OA 3AHYA 4W84A 3MV11 2D3NA 4EANA 3ZJ6A 5I78A 3AS3A 3HG4A 5A6MA 2BY2A 4BQ3A 4WSJA 2DQXA 1L8NA 3OA5A 1MYRA 1GOQA 4CU6A 2JE8A 1UZ1A 4P7LA 4E2OA 3CZJA 1KBKA 2D2OA 2YLLA 4JHOA 1G94A 1OT2A 2ZXQA 1T0OA 2VQTA 1IZJA 3VX1A 2FGZA 4PMNA 4UFMA 4NXKA 3FHAA 1M01A 1MW0A 3GXPA 2VC9A 2E9MA 3LRLA 2WZIA 1OGSA 4P8XA 3D4ZA 2MANA 2CETA 4AD5A 4PUDA 3OZOA 2OWXA 2WC7A 4E8DA 1RP9A 2BVTA 3AMGA 2NT0A 5CPTA 2F1BA 3W81A 5CLWA 1UR2A 5CSUA 4YHEA 3ARYA 2X2HA 3NUKA 3DECA 4GQRA 2VZUA 1FH8A 3VM7A 2YL9A 3OGRA 3EMCA 1W1PA 3L4VA 3GZAA 3WY2A 2IXUA 3KLLA 5JIWA 3VGBA 3VINA 3A21A 2PWFA 2E9LA 4JKMA 3BAJA 4OOUA 1W32A 5I2UA 3ALFA 4HPHA 5A69A 3GM8A 4Z2HA 4U3AA 3WELA 1V02E 3AS2A 3CHCA 4FNPA 3W24A 4R5EA 1JZ2A 5CPSA 2FHBA 2WW5A 4DO6A 2XHYA 2E4TA 3RJXA 1HVXA 1WZMA 3F5JA 1H2JA 3WD4A 1R85A 1C91A 1UWSA 3ZIZA 5I77A 4J27A 4FLQA 1V3JA 3CZKA 3VM5A 1V0MA 3DYPA 1C7SA 3AIVA 2HISA 3GBEA 4M8UA 1R86A 1TQTA 3DDGA 1XH2A 3BVVA 3VGEA 4DO4A 5CG0A 4A3HA 4ACZB 4AZIA 5CZKA 3EJUA 3UR7A 1BGGA 2YBTA 2IXVA 2DPEA 3RM4A 3F4VA 2J47A 1UASA 4E8CA 2YLAA 5C70A 2ZUVA 1XH0A 2YL5A 2WCSA 3DYMA 3BLPX 4XB3A 3NSXA 4UR9A 3AS1A 4NX0A 3K1DA 3WDJA 3GXMA 5CGTA 3RIKA 4FNTA 1B3WA 1O7DC 4OUEA 3WL1A 1NWSA 2XJ7A 3GH5A 4MB1A 2AAAA 1GHSA 3WQ5A 3WH7A 3DX1A 1Q6GA 1DWFM 2WKGA 1CZ1A 4PMXA 3AXXA 1GJWA 3AXHA 3S5YA 5JUVA 1IT0A 3SIMA 1KXQA 1HN1A 3LXAA 1MW2A 4BQ2A 1J0IA 3WF4A 4CCDA 2QHAA 1J0JA 3A4XA 3L4YA 1V3IA 1XSKA 2ZUWA 5LYRA 2WPGA 1K6AA 3VIKA 3ARPA 3BAYA 2WBKA 2XM1A 3TA9A 2WHMA 1Q6CA 3WEOA 2W92A 3UR8A 2GK1A 1X6LA 2J77A 2X09A 5FCZA 3L4ZA 1H5VA 1ITXA 2E40A 2HVMA 3T2PA 3DC0A 3EDKA 1Z32X 3OGVA 3IK2A 1E6SM 3WH8A 1GZJA 2V3DA 2ZX7A 3AZRA 1HWWA 1ISVA 1KFWA 5HPOA 3LPGA 1KGWA 4GKLA 4W93A 2W62A 3EBVA 1VFFA 2W63A 5FL1A 4H8VA 1ISZA 1CBGA 1D7FA 3AHXA 2BS9A 5A8PA 5HPCA 4OOZA 3WNNA 5AY7A 4JFUA 1KR0A 1JXJA 4UQEA 4ZENA 1UWRA 1BYAA 1VJZA 4UFJA 3BUPA 1GQKA 4AC1X 5AYBA 2W61A 5HDRA 2W91A 4GPNA 4W5UA 4FF5A 2A3CA 3VMPA 1E0XA 3GNRA 2DT1A 1XHGA 3D3AA 1EA9C 3GXTA 1I1XA 2ZWYA 2E8YA 2PF0A 1XD0A 3EJPA 3OGSA 1FH9A 3T0DA 1E6PA 4M82A 5A6KA 4B3LA 2YL6A 3DX4A 2NT1A 4F9DA 2G41A 1SMAA 2VURA 5CJ5A 1V3KA 2EEXA 2J8GA
chains in the Genus database with same CATH superfamily
4AL8C 4NZ1A 4K3DL 1CBVH 3MSDA 2BNQD 5J12C 1W3IA 2JVUA 1NIDA 2YRZA 2GITA 2VLRA 2CPCA 1GGUA 3L65A 1IBFA 3T0XA 5FDWB 4G9FE 4GCAA 2ADJA 2CMRL 2YSSB 4NCDA 1QTSA 3N9RA 3LNIA 4L0YA 1JZIA 2OKTA 4ATWA 1EQCA 3BJFA 4AYDC 2VMDA 3DXAB 5FS5A 4LUSA 1DXFA 1U8CB 3NXLA 3MNWA 4GRMB 3WMSA 1UXLA 2QDVA 1X97A 4OFDA 1LQ0A 4PV1C 5CZRA 4DP6X 4AD0A 3WLKX 3HB3D 2ZRUA 4V1DA 4N4QA 4LOEA 3ARWA 4MKSA 1N8FA 1R33A 1E6ZA 1A1MA 4MQTB 3DXAE 3BIBX 4GI8A 3V0AC 3PAUA 3EZ4A 2J7BA 3W6LA 5TTRA 1RK5A 2ZSVA 5GRVK 2A3HA 1SHWA 3F85A 3OVRA 3UAJA 4A2FA 3RUGB 3QWRD 3CZFA 3IACA 5SV3A 4WW1B 4FXLA 3QQNA 2V5MA 4IEFB 5HVWA 1KN4L 3DA0A 5D7JA 5F6HI 2DMBA 1R2SA 4S1FA 5D9NA 4ONFH 4GPVA 1EUTA 1FWTA 1DQJB 2R29L 3GB7B 1QZ1A 1HINH 3FKRA 2YQBA 3B4NA 3G5ZB 4IBQA 2IPGA 3LRSA 2PAJA 3S4SB 5D71H 2ZUUA 1U91A 2BSLA 2EDRA 2ROYA 1DJQA 5AC6A 2VUYA 1H51A 5ENWA 3MWAA 2D9QB 5JQ6L 3FCSB 5D72H 1B90A 1N5YL 5E0QA 3FU9A 4QWWC 1WBXA 4H8HA 3TH3T 3KPOA 3PSWA 1Q2RA 3NIFB 3LN4A 3DO4A 3TNMA 2W0FA 4IDJL 3F7VA 1RZMA 1MNUL 4MD0B 1S7VB 3LH8A 3KPPB 3PZOA 3DU0A 4J6IA 3BL3A 1GGTA 4QWWD 4GGBA 2G2RA 2GB2A 2NY4D 5DJZA 1GA2A 5GGTH 3NIFE 3OC8A 4YDMA 5IFAL 1U8HB 3AAZA 1D6VH 3APNA 1U58B 3OG4B 2YPLB 5G4MA 5IJDC 1KTDB 4V11A 1TZIB 3DARA 1KG0B 5AOMA 5HBBA 4KQ3H 2EKCA 2K3TA 3R4IA 5DCDA 3HURA 2YXXA 3GZQA 1S7XA 4BEQA 1KXHA 4B5SA 3S8HA 1NGQL 4XXCC 1X3DA 1B0GB 1I8IA 1M7IA 3CLWA 4OD3H 1FOBA 2RAMA 1B9ZA 1WDRA 1I1AC 1NPUA 5J06A 4EP8C 2YPLE 2Z24A 3FU3A 5AWNH 4M9OA 1UT1A 3GVVA 2WN3A 4WV1C 2OR2A 3ZSTA 1O7AA 5BUPA 3QDJA 1G4TA 4XVOA 5L4FA 3PZUA 5CJNA 2A3AA 1ZSHA 1R7OA 5FO2A 4NM4L 5F1NB 5F3BB 1X9LA 4GJTB 2Q7YB 3C5SA 4UV7H 4P2RA 5K5YA 2TSYA 5DRIA 5HHOA 4XMVA 3H9SB 1KACB 1C93A 1D3CA 4AC7C 1E9PB 5ECJE 2VC2H 5C0IA 3S83A 4N4PA 3QO1B 1EKOA 4G6MH 3UWEA 2V3GA 3K81A 3MCG1 3B6SA 2EXSA 4GQQA 4GS7C 1B2WL 3FJTA 2MQGA 5K3VA 1FNFA 1TPWA 2QQKL 2NOYA 1YEEH 3VRIB 1EC9A 3CFNA 3HZMB 3U1SH 3ZHFA 4OB5H 3CSYB 2IH9A 4H9YA 4C1NB 3LKQA 2IQTA 1E5JA 2NX1A 2GSJA 4KMTL 3MJ7B 2WNKA 4A8IA 2GLKA 3JVFC 3JR2A 3VD2A 3ZW3A 4PODA 3DTDA 3MUUA 4H6KA 4XPGH 2C1OB 1HHJA 3PWJA 4HKBB 3DROA 1Z0NA 3VXRD 1JGIA 4OUUB 4BZ2A 1UWEH 3MR9B 2FT7A 3CWNA 1GJUA 3CK5A 2ATAA 1YA5A 4E4UA 4G7YL 4B0MM 3DX9B 1U8MA 2DZPA 5FD0A 4RMQA 1AD4A 2GJXB 1R19A 1QNQA 1ZP4A 4D6DA 1G6RH 3QEZA 1ZY9A 1OD0A 3FBQA 4JDZA 1S4IA 4CEXC 3RWJB 1S3RA 1YECL 1J8RA 1G0YR 3ZQXA 2C9PA 1OGTB 5I06A 4POYA 2IOIA 4AUJA 2ZRYA 4HHHA 1KPVB 2QCLA 2AKMA 3DUHA 2EACA 4GK8A 4HZ1A 1FG2A 3CHEA 5IV2A 1YC8A 4TUOB 1IGTA 4M7KH 5GISH 2VDPL 1ANUA 3CH1A 1INDL 5I1CH 1VYSX 1XB8A 4K7FB 2FGWL 3TEYA 3QHMA 4XVTH 4G42A 5TDOA 1SOXA 4PW3A 5JLZB 4XMKL 5AUMA 4NUQA 5GRXG 3MO4A 1RH9A 5C0EA 3ENLA 2H9GB 3SE9H 4JFFA 5DRZB 15C8L 1QTWA 1G7PA 1XF5B 3MRJA 3ZYJA 2ZKHL 4G1KA 4NOFA 2R9RA 1E27B 3N0AA 1OCWH 1PDKB 2GTZA 3QCTL 1KDIA 5ENLA 3O0RH 4V27A 2EYRA 3HNVL 4ONHB 2WWCA 4PWIA 4F2TA 4A22A 1K8ZA 2CO4A 2QDWA 1KD0A 3SQBA 4OF5A 4MZ2A 2ZOKA 1PY4A 3U83A 2IDTA 3MV8B 3D4YA 3O3UN 3ARFA 4RNFA 1KEMH 4LP5A 4F0MA 5EBAA 5EC2B 3EJSA 1WYJA 3QUZB 3MHZA 2HJFB 4IW4C 1EBAA 1E4HA 4YSOA 4X8JB 3MV8E 3SPIA 3BSZH 4M1GL 4PJDB 4D3CL 2PDCA 1TVHB 2YMOA 3EYUH 1AY1H 2Q8BH 5I0ZA 5E8NB 2R0LL 2OS7A 4DSYA 1FC2D 2ZC1A 4WEVX 4M6OL 4AZHA 1AD1A 1C12B 5KZ6A 4QROA 3KL5A 1UWXH 2WHKA 2OO0A 4YWGL 5BO1L 5CCZA 4IMKA 3OBAA 4JQIA 2OJ1A 1ODAA 4PJDE 1OP4A 4Y4FB 3KEDA 3UG8A 4MPKA 3QRGH 1J1XL 4P3DB 1BKSA 1H0DB 2QHRL 3USBA 1DVFC 3NZ8A 2OV0A 1S9VB 3S8GB 2EO1A 3EJQA 2QMKA 2N7BA 4YSQA 4HAKA 3IDXH 2CJUH 2J21A 1Q1JH 5D1QB 5HGHA 3G04A 1T6VN 4N90E 4WNQA 4Y5VC 4IGBC 5SWZB 3EO9L 3U4BL 6REQB 4YX2H 4D1JA 1DVFD 1JNHB 2LTQB 2P8BA 2AJ3A 3O2DA 4F8TA 5D1QE 3CFDB 5ICUA 4BQBA 4HUKB 5IFHL 2J88A 4NP4L 4AXWB 2TODA 2Y7OA 2GUOB 5SWZE 1MCFA 4GRLB 4DPPA 3K71A 4QKTA 4XO4A 3A67H 2VUNA 4I9TA 5HJYA 4GXPA 1NM9A 4PQXA 3WHE0 3QDGA 4HOMA 1HOEA 3MV9D 1E7UA 1T3FA 3U5UA 2NZ1A 1BYDA 5ES4B 2NR6A 4RGNC 3CVDA 2E25A 4PYHA 4OLXL 1FCVA 3LG3A 3TO4C 3QC3A 3H2QA 3RFRA 2OB3A 3HE7C 2P1YA 5HI3C 1QDSA 3IXTA 4G7EA 1ZWIA 1KWGA 3S1VA 3ZN6A 5XINA 5AHIA 2RKXA 4M6NH 4RGND 2I60L 3MV7D 3TU9A 1J6OA 1NDWA 4PJGF 4F2BA 2UY7B 1DLFL 1JF1A 3GW0A 1U2HA 3GHTA 2G5WA 1SSGA 2YGVA 1K8DB 5AL0A 3GK0A 5D2LB 2Y63A 1JNJA 3PAZA 4OLZL 1S7SA 2ZKMX 3CDZB 3N44F 3KXFB 4FQ2H 3DO3A 2CKRA 3C8FA 4JZ5A 4WDWA 4DQOH 3GSOA 1OARL 3P73A 2XDFA 4OFVA 2OXHB 3RL2B 2DUAA 1ZDSA 5D2LE 1W91A 5HY9A 2ZG2A 2DBJA 3BPOC 1P5BA 3KXFE 2P7TB 3TLRA 3GXIA 1XR8A 1JPFB 2A5HA 1XIFA 1ED3B 4F5CA 4HH8A 2B08A 1NCAL 4OUIA 1IC7H 4XNYL 4PBFA 5AVHA 2BRRH 1HH6B 3P11L 2P3ZA 4L5FL 2C15A 2NYYC 4LYPA 4FA3A 1UXSB 1OVDA 4GQZA 4NC0B 3I2CL 3BUQA 1HP5A 3HBZA 3ZLHA 3CSGA 1QPXA 5HDLA 4KK6D 3ATFA 4HOWA 1PZ3A 4W9FC 1BFTA 3IU3A 4O02L 4TV6A 2DZAA 3NZQA 1M53A 3FFDB 1QSZA 2OW6A 5EIIB 2GCYA 1NDYA 4MWFB 1G84A 1A7RL 2BY0A 4WUIA 4H26B 5B3NA 3DV6A 1YEKH 4M51A 3RNQB 3LBMA 1OAYH 4TM9A 2IH8A 3AWNA 2C5DC 4LKCB 2VCAA 3OMIB 1PLAA 4R3UA 2WWOA 5CKAA 5ABAA 3RKDC 5LN8A 1KGXA 1DANT 2CJSA 3A6CH 1RIVL 1L9PA 3SGUA 5F7LB 3HQNA 3ZYZA 1PG7L 4X7CC 5ECUA 4O9HL 3NCJH 2BSEA 1B3JA 4FFVD 3H0TB 2YRBA 3WUFA 3ARQA 2YEZA 3QXUA 3WQWA 2UXVA 3VFGL 4W1TA 3WTVA 3GMMB 4X4XB 4HV8A 2Y7DA 3FMGL 3RL1B 4F57L 2P48B 3GIYA 3JUZA 5DEZA 2INEA 1P5VA 2N0KA 3GRWA 4EVNA 3LVTA 3W1LA 2GYSA 5EZJB 1SZEA 1GVIA 3I9GL 3W70A 3R8BB 2PWVA 1TPVA 3OG6B 3W1NA 3NJKA 4E0CA 1XFPA 3W2KA 3RVXC 1LP9F 2H4EA 3KCLA 3GJFA 5LA1A 3WUGA 1C8QA 4N42A 3GNDA 5KVFL 2QQNH 1BVKB 2WMIA 2ZYFA 3KXQA 1E28B 1ZLVK 3BOVA 1TJPA 1S78D 4WTXA 4UT6A 1P0BA 4HA1A 3PWAA 3WFEL 1LM8V 2OL3A 5DWUL 4OZIA 3F12B 5DJXB 5BUAA 5KJRL 1XGRB 1R6WA 2EICA 5IVOA 5T8IA 4OLEA 2XH2A 1ZT7B 1UD4A 4U6HA 4AW4A 1M2VA 4Q3MA 5J1AB 2YOCA 1XKYA 1CT8B 1IC0A 1EO5A 4RPQA 3P61A 3VXPB 1VFBA 1JNNL 1DQQA 3FJ4A 1S6NA 1YDVA 4XPAH 1MQRA 5JPMC 3N1AA 4BDVA 4QXUL 3L1GA 4RE3A 1H0IA 4EF9A 2IXQB 3VUAA 3QR3A 3TVMD 2X87A 4LPVA 3ZJ7A 3O9WB 5E2VH 2NZIA 4NZCA 3URBA 3K5SA 1Z3GL 1TTFA 4S0SD 3VFVA 1ZFJA 1N7KA 3D85A 1F61A 4XC3L 2A3BA 3IDGA 5C71A 4AYGA 3SGDH 3FGCB 4ZNEE 2QGHA 1R38A 1KQZA 1W1A1 1U5JA 1ICSA 2DBLH 2D2JA 3S8WA 1KEGH 3VFPB 4KHTL 4KJWD 3M6DA 3C5ZA 5HYSB 1W56A 4R7LA 1QBBA 4U1HB 2FT8A 2Y7NA 1MFCL 5HD8D 3O11B 1XIBA 3H4WA 4XAGA 1R24A 1ZJAA 2ORBH 3QI9B 4MQ7A 3V0WH 2E27L 3H24A 5FX3A 3P5YA 2J79A 4HKJB 2A6KA 3F7RA 4AX3A 4JPQA 4X2PA 3B8SA 5FUZL 3RE0A 3QSTA 3QH3A 1GYCA 4WO4A 1N70A 4MQXD 3A4AA 4LYQA 5BMFL 1FVEA 2VZVA 3VXMB 3GR7A 3R1GH 1S2AA 2UWEA 5JXAH 1OAQL 4ZS7L 3K2GA 1QQDA 2CLEA 2OR9H 4IP5A 1VDGA 4WY0A 3W7PA 4HF5L 1TQUA 1ES0A 4FYQA 3N1GC 5F70A 5F9WC 1EAPB 3VXME 1R5VB 1HJQA 5DCBA 4KUZH 4DQWA 5DRWB 3BCJA 3GKZA 3WXWL 1JZ4A 1IM3A 4HGWA 3LEPA 3WKZA 5HPMB 1O9WA 1J8HA 3RI5F 4XVSL 4O2EA 2EXWD 3KVMA 4LRSA 1Q72H 3BN9C 4PG9B 3TJPA 4RWYL 5D7SL 4M9PA 4KDTC 5FGSA 3ZM8A 4FQXD 1BD2D 4B96A 2CZ5A 2F7OA 3PPGA 3MV11 3G5VA 4BKLA 1M3JA 4HUVB 4BK5C 3L1EA 2QV5A 1RLDA 1N26A 1SO5A 2F74B 4R4BA 1TG8A 3D0LA 5M7QA 1MW0A 3ZRCC 3GXPA 2ICEB 2VDLL 2E9MA 4PJFA 5IOPB 1PKMA 1XF1A 4GKSA 3CAKA 4E8DA 2ADFH 3L2IA 1DQLH 2XU2A 3SQMA 1RURL 3ARYA 1WBZB 3DECA 2VZUA 2AQTA 1NBVL 4I89A 4LAZA 5LAXB 4KWOA 2XWTA 1I4FA 1LRNA 1RXLA 4EAEA 1R3HA 4MMXB 2DEYX 1N18A 2BZDA 3BMXA 1A0EA 4UYPA 3RA7H 2FHBA 3R7MA 2EILB 1O7VA 4NDMB 5JUEH 1AD0A 1V3JA 4NN5B 1F73A 3FQNB 4GA8A 1KKRA 1A9EB 3NZRA 3H6AA 1KPRB 3DDGA 4GAGH 4Y88A 4JFHE 4C91A 3PP4L 1NC4A 4S2SA 1NAKH 4H8PA 2OMUB 1L6YA 3MJ6A 5C9JB 2ZUVA 3DYMA 2X1OA 4K23H 4FIQA 5D7LB 4JGJA 1L5GB 3KPSA 2B15A 2GJ6D 1FWJC 2YCIX 4FNTA 1KSRA 4ZMTA 2NSOA 1B3WA 3ZL4H 4R7VA 3T4CA 4LARL 4MB1A 4IKIA 2JJVA 4F7CA 3PWPA 1OB1B 3I9PA 1ZXQA 1G4PA 1PUDA 1CFTB 5J13C 3VWKB 1K70A 2R4RL 3MDJA 5D7LE 5FK9B 5F0MB 2GVJA 3VIKA 4JQXA 5CC3A 4D9PA 2WHMA 5EPMA 5JHDA 1VFTA 3EKLA 1CDJA 2AEIT 2GK1A 1F41A 3ABGA 1MCEA 3DJTA 4AI7A 4GD0A 2EE0A 2NY0D 2FIKA 3OHXB 4QSHA 3LD8C 1L3WA 2V3DA 2UZYB 3PNWA 2NQ3A 2W62A 5DEJA 1D7FA 1G7HB 3OXRA 3KS5A 2DJ4A 1A6VH 1IF2A 3U6XA 3DMMB 1S8DA 1M6OA 3Q37A 4IH3A 4Y5YB 4ZW6A 2ZWYA 3LZFH 1YPXA 2GHWB 3OPSA 2C9AA 4WWKD 3SYOA 1O66A 4TUKH 1A66A 1X38A 2WLLA 4IJ3C 2VURA 2BC4A 4PVNA 1R3IH 2XTJB 3E02A 5LNVA 1NUNB 3W1TA 4R7XA 1J9SA 5CBEA 5AAMC 2Q3AA 4IMLB 2FX8H 2MNRA 4HPYH 2JKJA 1RPXA 3DX8A 4R97B 1BZOA 4HPJA 4Z1BA 5AEAA 2FB2A 3FOKA 1GKOA 1IFHL 4AY1A 2ZOOA 1F56A 1GZPB 1AH4A 2AJUL 1A5BA 3CFIC 1KY7A 4TKWA 1OFAA 2DDQH 2ERJB 2ZONA 2G0LA 3MQTA 2VXVL 1QFWH 5E2TH 2LFGA 2WPBA 4M62H 1N64H 3BO8B 1W0WB 3EBHA 1SRDA 3NDYE 5MF5A 2TRHA 3V4PA 1BQLL 3QYQA 2IDFA 4BFKA 4LHQB 3QHZH 2WTOA 4KK8C 5EA9A 5B7MA 3QIUA 3H7BB 5DHVB 3L21A 2JB6A 1RY7B 3GDKA 2WJ5A 2C3WA 2WQWA 2O6CA 1RZFH 3WO3B 3OAZK 5LNWA 4URIA 4G1NA 4ANWA 3L68A 3TIEB 1AXIB 1WGVA 3BT2L 3ARDC 1VR6A 2VXUL 3VH8G 4E9RA 1HH9B 5BWFA 5DLMH 2BVUA 5J11B 4PMOA 3VOCA 1UEYA 1R2RA 3JVGC 1U9KA 4UTAL 2DKUA 1UMYA 2BNUB 3WLLA 3WMLA 3CVHH 4GUIA 1L2UA 4Y9MA 2AXFA 4FTVA 3RITA 5EEWA 4C7DA 3KBJA 4IDLA 3TNBA 1CFNA 1QT1A 1BFNA 3N06B 2DWTA 5FPIA 4L4TB 1MPAL 1EWDA 1PWLA 4I5RA 5D03A 1H7RA 1GGCL 1ETB1 1TTJA 1HHHA 4G8AC 4XBEH 3H6JA 1LZOA 4FOKA 5DZOA 4FULA 4CN1A 1CL7I 1CX9A 5E1AA 3LKNB 4O1DA 3TFCA 4BFJA 4YHOH 2MOQA 3MKGA 2LU3A 4L4TE 2NQ9A 4XTRD 1M03A 2DSUA 4PGDB 1P7KB 3C3NA 2QVNA 1EDHA 1U92B 1OAZH 2PTZA 1TPUA 1N5AA 5KSAA 1DHKA 3AGVA 2G96A 2WZPA 3FTVA 4ZYKB 3PPFA 3DHPA 4MUZA 1IJ9A 1JGUL 1TUPA 4WUUA 3B97A 3KYMA 2HT4D 1AGBB 1LE9A 3X13B 3H22A 5LA0A 4ZQRA 3RDJA 3UZWA 4HT1H 4LGXA 4IOTA 1ERNA 1MHHA 3ULUE 4W9EC 5CBJA 1BWKA 3LQMA 5BXFB 2VEFA 1GVRA 3W7JA 3EWWA 4FXSA 1LLZA 2UBPC 2WXGA 1LO2H 1W5QA 1UWGH 3PJXA 1XGUA 5T9CE 4WEBH 5KZCB 2NQHA 2C9SA 4NQDB 2QGBA 5LBGA 5TQ0L 3LS9A 1UH4A 4PYGA 3ATAA 1TKWB 5DC2A 1BZ9A 2CWXA 1HILA 5CZTA 2XBZA 1NL0H 5FYKL 1IAKB 4XUGA 2BIMA 5J3HD 1V03A 2JQZA 1E5NA 3GMRA 3DIFB 4XNUL 4JFPB 1Q0YL 2OSXA 1XBRA 4NQDE 5L9FA 3IJEA 3VZZA 2WJFA 1EOMA 3FHEA 4KHXH 2QKIC 5LO7A 5I76A 4LY8A 3IFPB 1HL4A 5AKVA 2WXQA 2X89A 1JHKL 3N1MC 5EB8A 5C9XA 1N8IA 2EAEA 4UIMA 3NQAA 1T2XA 3F1QA 3FK4A 5IROC 2CIKA 2Y6SD 1F11A 3HI5L 3OB8A 3TN6A 1KCSH 2QMJA 4H25A 1G4EA 2QHLA 2D0GA 3PAJA 4FG6C 2BOEX 1M71A 4UF7C 4PR4A 3AB0C 5DQJA 3VYPA 4Q9RL 1EGJL 1XL9A 3WEXB 5DJDB 5FAJA 3SGJC 1GZQA 4S10A 3WNKA 2BSCA 3QG6B 4J8RA 4GSDH 1I1FA 1WIPA 1FRGL 1YCSA 3TXAA 4EKXA 2QV2A 1AE6H 4NN6C 3IWVA 4MF4A 2IH3A 1K03A 4MDPA 4OFIA 4ABVA 2VLJD 2O9OA 1OYBA 4GSXA 5EB9A 4ZGYA 3KWTA 4KETA 2W4XA 1CL7L 3BGAA 3P67A 1T21B 4FERA 4YXHH 5FF6B 4LOVA 3QUYB 1DBBH 2FJKA 2FX9L 2ACUA 2QADB 4PRBB 3ARGD 1A2YB 1TTGA 3NQ6A 2DQTH 1W8SA 3RGTA 4P3CH 3QGAC 1JRBA 3GIZH 3MRNB 1PS9A 4CC4A 3SB3A 2YKLL 1JSYA 2Q8LA 3MI2A 3SDDB 3BJ91 5FIPA 3TMQA 3OMAB 4G8GA 4YDJA 1W37A 2RUSA 4G1MA 3QEUB 3TT1L 2XZQL 3QFDB 1UM6L 4W4OC 1QI5A 3TYGL 3GSQA 3P1VA 1HP4A 1CGXA 1JV5B 1NY1A 4WHBA 5GGVL 4QFUA 2HFTA 1O60A 2Z2AA 2YSWA 2JWYA 4NNPL 4G1EB 3TA4D 3PM6A 1TO4A 2A74A 4PV9B 5DD6B 1M9SA 3HI6L 3PHQA 3TC3A 4ZUWB 3G6DL 3ZIYA 3WUZA 2HVNA 1FGVL 1MF2H 5J8LA 3N43F 4UU9B 2H0JA 2PXYA 5I0VA 2FO4B 1OIOA 4G6FD 1EDQA 5I15H 1GH7A 2ZYRA 3P4OB 2V6AA 4R3SA 1IMHC 2XV3A 1R0MA 4EPKA 1NMAH 4R2GB 3HNTH 4JTDA 5FJTA 3FQ4A 5L6UA 1X4XA 2HT3C 2DQGH 1Q9KA 5D1XC 1EEYA 3FUHA 2F68X 2A6IA 2GBVA 4WJ8A 3T8MA 4AT6A 3ZVVA 4OKVB 1QCWA 3HM7A 3WIHA 3QQ9D 1Q9LA 1J2WA 3OXSA 1WFOA 4FE9A 3N2JA 5A16B 4NWUL 5CSRA 3FTYA 1JPGA 1QUNB 1PVNA 1DP0A 1OSPH 2JJSC 4FABH 5ISZB 3QC6X 4ZPVA 2RIKA 4LLVB 1TMCB 2LLGA 5EUKB 3CQHA 1RUML 4W9DC 1N3NA 3P14A 1V6TA 3BAEH 5IJVB 5D02A 4L2LA 4N0RA 4LOCA 5DO8A 2P44B 3OBKA 3K6SB 5ISZE 3MRKA 1A1NA 4DGYL 4Q97A 3FCPA 4G6KH 2CKBH 4CW1B 3KLHC 1VGAA 5HULA 4H5SB 1PGRB 2W0LA 3UR5A 2WLHA 1X7QB 3QZOA 3TKFA 3CBKB 2VENA 1S46A 2D4DA 3MLSH 4C6IA 4HGKC 3G08B 3D4CA 1XGQB 3O6LH 3GS6A 3TZNA 5K39A 5TDPA 4PMZA 3QFJB 5HGAA 2VX4A 3ORWA 1DJXA 4NRYB 2HJLA 2CXGA 1UIOA 1ZLUK 3ZHKA 3WKQA 2MNJB 2EIMB 3QULB 2Y7GA 3WSQH 3UJJL 4DUWA 4DIAA 4DP7X 3LHZA 4N85A 3WQGA 4EPEC 3WXVL 4JN1H 3QFJE 1A5OC 5I6KA 2ISVA 2ANUA 4MJMA 3Q01A 4GG6B 4GZJA 2XQBL 8PAZA 3FH8A 4NCC2 2FLRT 3VB9A 3L3DB 1A4AA 3KNBB 4XISA 4Y8EA 2IANB 1RVGA 1KA9F 3W73A 4Y90A 5D5MB 3PABB 4NERA 4K5NA 1KRAC 4PUUA 2R82A 4N8VG 1DTNA 1UB3A 3DOHA 3BP5B 2OW7A 3TOPA 3DBNA 3LRMA 4BA8A 3PPHA 4HCDA 1UVQB 2MIZA 2OOFA 4YDLB 4NHVA 1IBGH 4KPHH 5F7WC 1HNFA 4NRXA 4OV5A 1CURA 1GOOA 2IANE 2K0RA 4LSRH 5D5ME 1MUMA 3ZUCA 3OQ8A 1OGPA 2MRYA 4Z2LA 3TA3C 1Z69A 3AY4C 4YXKH 2GC4C 2CAKA 4UAHA 3MUY1 3IV3A 4A68A 1TUXA 2WTPA 4U1NA 5FLVA 4ADUA 5ITBH 12E8L 1YEDA 4A7UA 4K3EL 4HHMA 2UVFA 5FEXA 1IGML 3MDUA 1PS3A 1HXKA 3C8KA 4WEEA 3TA3D 2B77A 5E9XA 4LSBA 3JBG7 3TBVB 4GJ1A 3U1QA 1F5ZA 2A4AA 3ERPA 4F15B 4OZHA 1QSEA 4FI4A 1F8MA 3W7EA 4B9GA 1OO2A 3Q2DA 4MA8L 4PS4L 4OZFH 4I13B 4F8QA 1XI3A 2YPKB 3PG8A 3BZ5A 2CPUA 4LTSA 1AZRA 1DSFL 1E1FA 1WICA 4JS7A 1XR9A 4QE1A 1QOKA 4N1CA 5AOZA 3LZ5A 1H1YA 1QHPA 5DEGB 4NHCH 4PJHF 3Q8EA 3QUXA 5IHHA 4TUJA 2FTWA 2JTYA 1KENL 3OYXA 1E3ZA 3ARBD 4P5UA 2I17A 2YJQA 1OAKH 1BKHA 3CB3A 2C3XA 4B16A 1IAOA 3IEAA 4D6JA 3V6OE 1QNZL 4HQQH 2Y06H 3HU7A 4L1BA 2O5YL 2YS4A 4DN4L 2WVUA 4IIDA 2D1ZA 1CZ8H 4F33A 4ONGL 5H37G 2HPOA 1FVDB 4LNRA 4BM7A 1K5WA 4JY8A 5CM1A 4QXGH 4RAVB 5H94B 1X5AA 2PF8A 3F2CA 3UT0A 3RU8H 2YA2A 3GIPA 2HROA 4V2CB 3GBNL 4QRRD 1KW1A 2CO7B 5L4MA 5C54A 1ET5A 4LRTA 1SM3L 3XINA 1OK4A 3QQXA 4MAUH 1O4UA 1T2QH 1WTLA 2X70B 4QGCA 1XS2A 5FECA 2EDKA 2PGRA 1B4JH 1SBSH 1ZV9A 2FWSA 5EN2A 4IMCA 1U8QA 1CD1A 1WOBA 3K91A 2O4QA 4FP8H 1U8JB 4A8NA 2Y6TE 4NM8H 5CJQH 3TYDA 4JN7A 4EUPA 4JO1L 3ZDYF 4LGSB 4H20L 4LSTH 5ID0B 2DZXA 3B7UX 3TZVA 2HA1A 2B4GA 4W4QA 1DUZA 1TVBB 4L8CB 2CESA 1RJCA 4M7JL 5FF7A 2OT0A 1ZHBB 4DFIA 2L4OA 2YA0A 4Z1CA 3MUJA 3OSVA 3J8F7 2AABL 2NY5H 4PJ7B 1OP3K 1AGCB 2WIIA 1SO3A 4XN9A 4J2XA 3BW9B 4LVDA 3WQVA 2HKHL 4B9CA 4MB3A 1A4KA 3UETA 3MNZA 1AO7B 2DMGA 4X6DB 4GNKB 4PJ7E 3UH8A 2YAHA 1KGJA 5KVDE 5CGQA 3RUGE 1F4YL 2X6BA 2ICWA 5DT1H 1MCBA 1XD1A 5KYUB 4PEKA 1RULH 1UROA 3GWQA 4O18A 1AO7E 2VDHA 4X6DE 5D4JA 4BJHA 1K2DA 2IFFH 1JN6B 5FGRA 1LQAA 2JJTA 2WO4A 1F4HA 5FYKD 4HIEB 4OF0A 1E70M 4FGMA 2NV9A 2G5BB 2J6WA 2RALA 4LCCC 4KVNH 2Z7UA 4M48L 4AF0B 1A49A 2G4GA 3U36B 4J40A 5KUMA 3WTSA 3EX4A 3FUMA 5IZ7A 1RUAH 5HWNA 2Q20A 3A4WA 1DWIM 2CGZA 5I5RA 2GI0A 2JGQA 1OD8A 1P84J 3ALXA 3O0LA 5SWSA 3GPSA 3W2MA 3UADA 3BDXA 5T91A 1U93B 2RFGA 5AG9A 1A3XA 2R14A 5FA3A 3E0IA 4MCNA 4OBTA 1FL5A 1UZ6F 3A6OA 5GIRA 2BM3A 5TE7L 3LZRA 1YYLL 3VTTA 4PGCB 1UWIA 5DZVA 3RN6A 1ZDQA 2WMPB 1GHRA 4DEFA 3HS0A 4UDUB 3V0TA 1IZKA 1WFTA 3QWNA 1Z9SA 1RUKL 5IRPA 4IKLA 4OQTL 1PTGA 2OMVB 4FD0A 2D31A 4A8LA 3TJLA 5KS9A 4CU6A 2VIRA 2DWEA 4YSRA 5HGBA 3L45A 3I6SA 3OAUH 3ZGHA 1M01A 5LXGH 5DJ6B 4G7SB 3FKUS 3IJQA 2XRAH 4J39A 4PN6A 5E4EB 3LEYH 4DETA 1I1AD 1AH1A 4PTTA 5M1TA 1UR2A 3SE3A 4UT9A 3OP2A 3HOJA 2X2HA 1DEEA 4JKNA 1QO5A 2CCWA 2BSBA 1S7UA 5D33A 3VINA 4PY7A 2ZPKL 4OIIL 3K6OA 4EIVA 3OZLA 5KANI 1YVLA 3MBEC 5D32A 3AADB 2XHYA 5DA4A 1OPGH 3HZYB 4JPKH 5HHQA 4PG2C 3IJHB 2MCPL 1V79A 4YAQB 4E36A 1YDPB 3WD4A 3HHRB 3H9SE 2ATPA 4KV5E 1JVOA 1BEUA 4RGOH 3BRFA 2OOGA 1RAMA 3T9PA 3EKGA 5ANMA 4X6CF 2V37A 3NOIA 1XIMA 3ULVE 2VC2B 3EX1A 4HIIB 3VVWA 2W65A 5HYJB 3BT0A 4F9LC 3EGSB 3LDVA 3PHOA 2HLFC 4LCIH 4NX0A 3K1DA 2BSRA 2NVDA 4PVMA 3CUZA 4PE8A 1R3RA 4WXZA 4PB0L 4HIPA 3AACA 1UC4A 3AABA 1LO0L 5HDOA 3RWHB 5T8GA 3AXXA 4AQAA 4O57A 4F2EA 3RO6A 2YBVA 3KJ4C 5SV4A 5EU6A 5EUOB 1UWAA 4NB7A 1QWGA 2C3ZA 3FO1A 5GS1B 2CH8A 3HGOA 1TTBA 2Z64C 1S38A 2J1WA 2CZFA 1OGAD 2XM1A 3SDCC 3G0SA 1QPQA 3T0EA 4JZOB 2F54A 4NP7A 2ZA3A 3KVKA 2FBJL 4OV4A 4QAMB 1GYMA 4HCHA 2WQ8A 1UEMA 3GJEA 5CC6A 5EUOE 4XQ6A 1N68A 1ISVA 4R33A 4GKLA 4Y5XC 4RV8A 5HPCA 3DESA 5AY7A 2RH0A 4EMZA 2UZPA 4JHWH 1VJZA 2OZ4H 5I1EL 2J9YA 3BUPA 1SXBA 1ZKAA 1YQVL 2P24A 2W61A 1G6RB 2I9LA 3MACL 3SR7A 4R5TA 1E67A 3VAVA 1AIZA 4YDZA 4ZW8A 5MERA 4KXAA 3CHRA 4J4KA 3I6EA 4XBKA 4GW4B 2J8GA 4C5ZA 4HXAL 3GNMH 4RSVA 5EMYA 5KVEL 4E9QA 5IESL 2H1LM 4O4YL 2VDGA 4ZFOA 4X6BB 1HXMB 1I0DA 2MPAL 2J1KA 5KBKA 3P30H 4XWGL 2QTEA 2Q7AA 4KERA 4NU7A 3EO0A 1CECA 1DVYA 3CFBB 2QVHA 1G7LA 2AJSH 5FM5O 2C7FA 3N2MA 3IMVA 1XC6A 5IJKC 1YPZF 5CUSH 5KYWA 1MCRA 1JCLA 2OMXB 5ICYA 4AVNA 2YRLA 2EE9A 3CCHB 1W1B1 3U2EA 1W0VA 4ECLA 3UW6A 2NXYB 5K59F 3FTUA 4OJYA 4RUBA 4LEFA 3IFNL 3QVQA 2NNAB 4MNGA 5L9DH 3DRTA 4XBJA 1GOWA 2PI6A 5IB1A 1TZ9A 5JYLA 1Z5LA 1RLBA 2GBTA 2VAAB 5I02A 2KZKA 1MFDH 2J13A 3SUWA 1QU4A 1G7VA 1FQ0A 5E94A 5DMIH 3OJVC 1DCEA 1PIGA 1JDCA 1LEGA 5DVKA 1K1DA 4MJ5B 3UVAA 2YXGA 1RQEA 1YEGL 5DGQA 4RE0A 5LB1A 3TYCA 2NX5A 1YEFL 2W81C 4AISA 3FRPG 2R1YA 3OVQA 3TESA 2BVWA 1B6UA 4J3XA 5CGYC 3F5WB 2J56A 2DKSA 4TO8A 5IFJB 1J9CT 2C1IA 2Z28A 2X7LA 2DQFA 1JK8B 3CSBA 1YUHB 2WVVB 3MGOB 3WJMA 3MRLA 5E51A 2WQSA 4LLDA 5F3HB 5JBFA 4JIIX 4IGBD 3D51A 2E6FA 2AQ3A 1AHWB 1R3WA 4M0XA 1LWHA 4XOBA 4I9MA 2FMNA 3QPXH 4QRTA 3LI1A 5F7YC 4K3HA 1L0YA 5EBLB 4NZRL 1WVZA 4B5ZA 1FE8H 3NQBA 4F7MB 5I3JA 3G6AA 1E8XA 4Q52A 2CUHA 2O55A 1I8MB 4ILDA 4X0KA 3WD5H 3HV8A 2PC4A 4ABQA 1JWUB 4RETB 3ZRFC 3R12A 1W0MA 2V9DA 2WVSA 3PNZA 5GZNA 3TO4D 1WDWA 3HE7D 4FXGA 3S37L 1BFOB 5HI3D 3HRZB 3BD4A 1F9CA 3TTSA 5JA9A 3ZX1A 3P0VH 4LBRA 1HL5A 1I7UA 4CD7A 4K7PL 4G6JH 1SJVA 3HHMA 5FO8B 1RZ8A 2X4SA 4PY8I 4LO9A 3CVCA 4GACA 4I4WA 3ZDZB 1V3LA 4L4MA 1Y65A 5L2KD 4IOIB 4X50A 3CPLB 3SDYL 4MVBC 5DS1A 3QAQA 3WHXB 1G9HA 2GT9B 3W1AA 3OJGA 1FWNA 3FN9A 4IPNB 5IBTL 2WSDA 1IKOP 1H15B 5F88B 1BXUA 4XBMA 3ZDZE 3ZKXC 3QHFL 4QOKB 4FZEL 3B2VH 4R34A 3WG6A 2A3EA 3O3EB 2VR6A 1WA0X 2IH1A 1S7RB 3I6GA 2RQ8A 3MMTA 3MRFB 1W16A 2C9VA 1H3TA 5I2IA 2AJVH 3T78A 4R7DB 2RHGA 1HQTA 3QC0A 4Z0XB 5EU4A 3CPUA 1BYNA 4Q2ZA 1MUJA 2VDRH 4MRBA 3DFPA 4QOKE 3LBOA 2Q1EA 2JIXA 3XIMA 4J3OH 2DLHA 3B56A 4L9LA 1MXDA 2CDGA 2PZ0A 3MRDA 4POCA 4K5MA 1J0YA 4ZQKA 1EVUA 2NYYD 1ZENA 5EO0A 4IBVA 2V82A 1S9WA 1L9SA 3ITGA 1D5MB 1U8OA 1MLCA 5J6GB 1CXIA 3OQRA 4HOZA 1NCBL 4LPWA 4J5NA 5ECGA 4P48A 1K3ZA 3QV8A 5D2VA 3RZWA 4C47A 2R59A 4HG4K 3ILEA 1FL6B 5DX7A 3CHVA 1V6YA 3IVSA 4N2IA 2YBUA 3TO2B 4HUUA 3H9ZA 2R23A 1EXPA 3RO8A 1YYML 1KCVL 3HJ0A 5A6SA 1Y18B 1XCXA 1TZOA 2H3BA 1WISA 2Z34A 2XA8L 3TBYA 3DUUB 4ZO6A 1CEOA 1NOLA 4BFEA 3UF9A 1XDMA 5TPWL 4JTGA 1H7XA 3QIWB 2P43B 1WAAE 3P8IA 5EDSA 5C09A 3MRHA 3RKDD 1IE4A 3BH9A 4L0ZA 4JX0A 1IGWA 4CILA 2X10A 3W3OA 2Q09A 3DGCR 3MLZL 3BWSA 2V8ZA 3BXWA 5DC0A 1JR1A 6XIAA 3JWDH 2X7WA 4NO3A 5AYXA 3F05A 3BCFA 3GF8A 4HZ7A 4IJBA 1TA3A 1XZ0B 5I1GL 1IC5L 1Z42A 3A0OA 1OPOA 3NFSL 3B9VA 5LZLA 3B4UA 4RW3A 2YXOA 3UBXG 5GS3A 3NR0A 1LTXA 4JO3H 2Z4QB 3B3IA 2D24A 2VQUA 3RVXD 3QEHB 5CSZB 2Y25A 4ZMZA 3QBTB 1P6WA 1I8KB 2J9XA 4X5WA 2X4PB 1T5XB 3MYJB 4A8RA 4JPVH 1SYTA 2R8WA 2R1NA 1MRFL 4L3CB 5IQMA 3N19B 2UVEA 2DFAA 3BZGA 5JTWA 4OY9A 4YIWA 2YQ2A 4DZ8B 5IR1A 5JQHC 1LL6A 3BSHA 1KLYA 1WDAA 2VSDA 4UFHA 4P8QA 4X80L 2GIXA 3D08A 2R0WH 5I1LA 1EP2A 1XB3A 4BA0A 3HMWH 1XWYA 3RQ3A 2BP0B 4M5YL 3K13A 2XXFA 4U6YA 1A7PH 2R27A 5DMGC 3PGDB 3CXHK 4PJBF 1M3UA 3UYOD 2F15A 5BRZA 3T09A 3ISYA 3SJ3A 4MD4A 3M1ZA 3PDOA 3ZDXB 1AJ7H 4BE6A 1C5CH 1H61A 2V8MA 2VERA 4FI7A 4PUJA 1GYVA 4JHAH 1P4IH 4KRUA 3RFZB 2BMKB 2D73A 4K4KA 4FEMA 4NGHH 1EHLL 1B3OA 2GOUA 3V9CA 3VFRB 5AZ2H 2IV8A 3IJYA 4UYQA 2OI9B 4MYAA 4L05A 3BPNC 3HPZA 1X5JA 2EAWA 3LU2A 2ITDB 4P7QA 4UTTC 2PP9A 4N2EA 2Z26A 5D2NB 4X5PA 4DAFA 2J5LB 2DUXA 2ZCZA 2YMXH 4RKAA 1R5YA 4ZMQA 2ZXGA 5GJTL 4N6QA 2ZX9A 3E3QE 4F8XA 1JFXA 3RU8X 1OIMA 5FUOL 4Z2KA 3FN3A 2PABA 4NN7C 5D2NE 4GKZA 4Y7MA 1RSYA 2KPNA 4AKQA 1XG4A 1K6WA 1J1PL 4GG8B 2GK2A 1WXZA 2HPMA 3WFAA 1RMFH 4LEXL 1JD7A 5IDIA 1HYRC 4PJCF 3ZR5A 1VACB 4QRQB 3BQUC 3LQGA 4FOMA 3DK0A 1WBJA 5DANA 1KRMA 2DF3A 4KKAC 4F7EA 1ILUA 1L9OA 4DY1A 2ZP0T 2XH0A 4H1LG 3B0PA 4YGVA 3U7BA 1ORQA 2O92A 4JO8A 4DTGL 3V5FA 4P9MH 3ZE1B 3VCLA 3WLNA 4A3YA 2IUZA 2PRHA 2G9KA 3W86A 3RDKA 2R0KL 4UQ2B 3UTTB 4CRPA 1CXEA 4JY5L 4OGYL 5CLTA 4GINA 1HJVA 2O61B 2F6XA 4JTLA 1DJNA 1JD9A 1FORH 1S5NA 4XB8A 1IGFL 2Y3NA 1JPSL 4ZOAA 1FSKB 3VFUB 4YDKL 4RA3A 2YIHA 3ZE1E 3EUUA 2LFEA 5FR3A 1GTFA 1P6AB 4MTVA 1ZA6B 2VXQA 3VXUA 3G6LA 2POZA 1TPEA 4WJ5B 3UTTE 1FVCA 2C0AA 1QW9A 5CSGA 4PIRF 3PBVA 5AHFA 4KY2A 4DLMA 4YEFA 1ZLEA 3BN9D 5D1ZC 1ZBKA 5GGVY 3RHWK 4HJFA 1MFBL 4AG0A 1F7BA 5CJOH 4IXHA 1T4WA 4JQIH 4GW1A 3SKOA 4OU3A 4KRMB 3UCQA 1SGKA 2DD8L 1BD0A 4MCMA 3SGKC 3PREA 4AH7A 3NCFB 4X6FA 1HF6A 4XN1A 4EI5C 1Z9MA 4NQSA 1WCBA 4TSBL 2EG8A 3ULSB 4CVWA 4US5D 4WKHA 5K9JL 3OJDB 4U1KA 2BFVH 1JPDX 3ITCA 5BS0B 2XIJA 1QD0A 4CGTA 4DNMA 5J1TC 1AFVH 1I3GL 3NDOA 3CFCH 5C2GA 2X6UA 2C3VA 1Q65A 4ILSA 1KV7A 1ZLSH 4TRPH 3O2DH 5EH1A 1R0AL 1R3LB 3QLLA 2CIPA 1JXDA 3BJSA 2J88H 3KPMA 5F93C 1OF2A 4JFOB 1R4XA 1AW2A 2OYLA 3R06B 1FH5H 2WCGA 1MRQA 2QDEA 4C6EA 5E2WH 1AG0A 3QRLA 3DFHA 4Q8OA 3N50A 5K2ZA 5DJAA 4AMKL 1E9QB 3F01A 5B7FA 4IU2B 1DL7H 7REQB 4JFQA 5E8EA 4B50A 4QRFA 3MS8A 4H0IA 4JRYB 2I9UA 4GYFA 1KBPA 4ISVB 4XPTH 2D7OA 1RIHH 3MJ8A 2QL1A 1A4JB 4N86A 1E4NA 1PEZA 1GPOH 3ALWA 1U1HA 3BEWB 2EDJA 3WBDA 5EFIB 2A6LA 1A8JH 1C1EH 1Y6NR 1V0NA 4JRYE 3LQAH 2PMZA 1QMLA 3WF1A 1GVEA 1GGOA 2C91A 1QO3A 1A0QH 2NNFA 2G9HB 5D9SB 5IMMA 5CN2A 2BNRB 3NTYA 4MXWL 1H8LA 4UINL 4ODSH 2ICWJ 2E6DA 4OVXA 4TV3A 4I0PC 1MZZA 3AMCA 3MHFA 1AA1B 1UKPA 1M05B 4Y19B 2QSCH 3OKNB 1MUWA 2PPCA 1WDPA 3ZJAA 1BXNA 3FN0L 2F7PA 4L1TA 2OJZH 4BXSV 1OWQA 2BNRE 4WHYH 2HPIA 4WHTA 3CC1A 3TOYA 4FFTA 4LKXA 1CDBA 3EOYG 2C4XA 1MJ7H 2VCCA 4YSAA 4ZTOL 1TE6A 3W01A 4Y19E 4YIQA 3PWVA 4DJDC 2D20A 1I9IH 2X3CA 3NPUA 3VIOA 1YDYA 3GZPA 1WC7B 4AB4A 1N2RA 4FFZA 3HFFA 2F1AA 1Z0MA 3MV01 5TIMA 3TS8A 5BZWB 2XTJE 2P8PB 4H19A 3V4LA 3LRGA 4XAZA 1SW3A 4JVWA 4Y4HB 4DF9A 5DO2C 3OKMA 1CLVA 3N9SA 4JYEA 3CVIL 3KDPB 1MY7A 3U0WH 3QORB 2FQIA 2EIKB 2DLTA 5KWYC 1I8LA 4XCCL 1XYZA 2D2HA 3M86A 4OGXL 1ETZA 1HZKA 3O4OB 1S9YB 1ORSA 2HH0H 5DO2D 2V9UA 3QZWA 5AYIA 1T8XA 3LKPB 1RERA 1WQVT 3VSTA 2CBMA 3G1RA 1CE6A 3UTSB 1FAIL 1VKXB 3IMSA 4OQ1A 1GJPA 2HLAB 3MC5A 2WUCH 2FEDC 1WHOA 3MLVL 3FTZA 4UV4H 5B22A 5GRUL 5IF0A 2F5AH 3E9TA 2EDQA 3TCSA 4KK8D 2J2ZA 4L8SC 1NCCH 3BVNB 3F00A 4GVIA 4JAMB 5CPLA 3C52A 4B9JA 5D8JH 4M7ZC 2XXMB 2GGJA 4K3JH 4MLRA 3VZYA 1BG1A 4QI3A 3WIFB 4R26H 2EDTA 1ZAIA 3GRWH 3NQ7A 1IJNA 3KPQB 3I4KA 3ARDD 5T9BG 3WJXA 5JQ9A 4LCUB 4M8QA 4P57B 1WUFA 3VGFA 4HBCH 2XU9A 3Q8FA 1U1UA 5AW3B 3EGXA 4JN6A 1WIUA 5CFAA 1BPLB 4RCAA 3NRPA 1DQUA 4DX3A 1JDFA 9RUBA 3DX3A 2RA1A 5B8CB 4UT6H 4IIZA 1CGSH 4IISA 3HR5A 2DQIH 3CVHB 1NEZG 1S3TC 4XP6H 2IMNA 4JY6A 2VDQL 2B1AL 3T1GA 3C60A 3N04A 2CZEA 2CO6A 1MCPL 4TX8A 3VFWA 5ABHA 2DYSB 3S3GA 3WS3A 4P4KB 3QDMB 4LCWA 2KX9A 4MWAC 1FA2A 3QA3B 4KCVA 4E2BA 3BV7A 1AS6A 2ESVB 1H5BB 2WJ7A 2REQB 4LSUH 2HK0A 3B40A 3S47A 3VG9B 3AS3A 4HHAB 4BSJA 4BQ3A 2Y5SA 4HVBA 1SQMA 2FJFB 2CD0A 4HN8A 1BEYL 3QDME 4FEZA 1LBFA 1TJIL 2B1HH 2QR0B 3P62A 4J8QA 5EEVA 3RVWC 2ESVE 1E4XH 1OGSA 4Y4KB 1U3ZA 2CETA 3U3HA 3KJ6L 3AMGA 2NT0A 3HPLA 4JTUA 4Z7UB 2W88A 1U8KB 2X4NB 1GKQA 1YNLH 3IFLH 3QEQA 3MJ9H 4WI3A 1JV2B 3H21A 3AU6A 1I1YA 1NFGA 3KPRA 1IM9D 1XQLA 3QFEA 3V75A 2V9RA 3EFDH 4KEVA 1CF1A 4X8XA 4KKBC 3AS2A 1Q7ZA 1JZ2A 1DQWA 3D3VD 3SECA 2VLKA 2P9RA 1HVXA 4JTCA 3HO8A 2NWSA 1XL6A 4JFXB 3WOVA 3I02A 4PM1A 1C8PA 1TTCA 2JF1A 5F21B 3V7MA 5EDXA 3B0XA 2VDML 3BP7B 3GU9A 3UR7A 1R1CA 5E6IC 2BZCA 4AV0A 1TOXA 1KBGH 3RM4A 3PWGA 3G6JB 2C7UB 4PJIB 5CIPH 1K7FA 4TXVB 1UBPC 5IGXL 4U6XA 4ZAKA 3TH2T 3SOBH 4CA4A 1JOIA 3S6DA 5CGTA 1YN6A 3C2RA 5GRJL 3MCLL 3MP3A 4YHMH 1N0XL 3IGLA 5EIIG 1GHSA 1TYJA 1U8PB 1EP3A 1GJWA 3G6JE 4PJIE 1M1XA 4OT1L 3SIMA 1AP2B 3ML8A 4BFRA 3CN2A 4LEOA 4IMGA 3I65A 4BQ2A 1OALA 3S9ZA 2PLMA 3VKBA 3DRQA 3IXAA 3A4XA 1Q1PA 3AUOA 5F7NC 5IROD 2RDTA 2DMKA 3NFPA 1ZRUA 4DZAA 5M95B 2DQCH 2ATSA 2Y8UA 2GEEA 2OMWA 3T2PA 4FG6D 5B1JC 3UC0H 4WTQA 3OGVA 2DIKA 3FONA 1NIUA 3LPGA 2YBRB 2YD0A 3U6RA 4P2QD 1BP3B 3A3WA 2WZMA 2PCFB 4WU5B 3NN8B 1UWRA 1GQKA 2UZIH 1M56B 1YJDH 5KVGL 3DZ1A 2GQAA 2H3KA 2YAMA 3GXTA 2GJZB 2OPJA 2IADA 4CVXB 1OW0A 1L9RA 3EJPA 4HYWA 5DUML 3CJJA 1PTZA 3UX9B 5C0FB 4MMZB 1AZVA 5CJ5A 3KBVA 1I7TB 1B0RA 1VADA 1J9YA 5IMOA 1EFXA 1T0MB 1EUNA 4LDEB 3SCSA 1HHGA 3TP4A 4ZQPA 5AZUA 4K73A 1WFMA 4H2AA 5BQDA 2R4SH 2DT2A 3FO2A 2IOMA 3UY8A 4HA3A 3QQ3A 1T83C 3OGOE 4RV3A 2AEWA 3NQIA 3T6QC 1E9ZB 3TZFA 1K3UA 4HS6B 1TTQA 3MRIB 4FFYA 1JNEA 3I4EA 4B41A 3HZKB 3M0KA 1WKFA 4CMMB 1EVTC 2P42B 3PP3K 1MHCA 2EH8L 1MI5B 4W9HC 2P50A 4C7GA 2KDYA 1XIWA 3NACL 2VC5A 3LZNA 3BGGA 3C5JA 2OZ0A 1C8VA 4UUJA 2QS8A 2E7BA 3HC0B 1BM3L 3C6EA 3QGVA 3QUML 2VR9A 5ABDE 5CBAA 2XH4A 3V0SA 4FB7A 4GMSL 1MI5E 5F89B 1OK0A 4LY4A 1JTOA 2W38A 1KIQA 1BVNP 1L7IH 1UQYA 1TQBB 4XCEA 4AV5A 3B0VC 4HWZB 5TJWK 4I18A 3VG0L 3BZFB 1U0QA 3S3BB 2I7OA 4UMCA 3IGFA 3S3DB 2NXZB 4IWWA 5F71A 2FVLA 5DELA 5ESVA 3OA3A 4JE4B 4LPUA 1KXTA 5CN1A 1LMKA 4ZFZB 4F2UA 4KAQH 2P5WD 3TJ4A 2HT3D 5C0CA 1PX8A 2ROXA 4CSPA 5D1XD 2X40A 5AVUB 1FNGB 3MOBL 3H26A 3HRPA 4RW5A 2CERA 4L56A 4KFMA 1OM0A 5FO9B 3ZLFA 1CXFA 1MIMH 4TLUA 3OOQA 4EQ3A 3O63A 3KBMA 4MFEA 1KTCA 1U8NA 4H7ZA 4CC1A 2C0HA 1UXWA 2R2BB 3CSPA 4Z2JA 1I2NA 3S2CA 1CVSC 5FEWA 4TQEL 5EU7E 4AXNA 1CGTA 4F1SA 3DBPA 4B97A 3WY1A 5AFAA 3ZYIA 3D48R 4I5BA 1JEZA 2HRGA 6FABL 4Z0SA 5J5RA 1XBXA 2K78A 1JE6A 3W29A 2D22A 1DVSA 2CE6A 1MWAA 5K9OB 5CJMA 3LSOA 1HCFX 3I7SA 2H3NA 1UWYA 4HLZH 1P1VA 2ED9A 1TZGL 4PRID 3STPA 1S5TA 3KLHD 3WENA 4Z3EA 2CKBB 4A7GF 1K6QL 4NCC1 3VD7A 3GG1A 4M6AA 3N42B 4ERSL 1DTUA 4ZRGA 4QY8A 2CJTA 4IRZL 1OP5K 1XEDA 1CFQA 3ONCA 4F2FA 1AC6A 2D03H 1BBDH 4OIAA 5ABFB 3RX2A 3KM1A 1GC1H 1HAUA 3OKOB 2QJGA 1TQWA 2Z7WA 3S36L 3BPLB 4E4PA 3JTTA 4LQ1A 3QPKA 2OYPA 1ZSXA 5M94B 3SEPA 5DD3H 4MSSA 2J1XA 4I1RA 1T1ZB 35C8H 1U33A 3V4VB 5EZLB 4BFIB 1AMYA 2Z91B 3FDGA 3DUSB 2GJLA 3SY0A 4V2XA 2CK0L 3MOAH 3BIKA 4XWOC 1D6EA 5HJLA 2BWQA 4GG6E 1G6VK 3FW6A 1MCNA 5E2UH 2J43A 3T4AA 2PZNA 3IDYB 2J6EA 2ZX8A 1K5NB 3PBGA 4XZHA 2YDRA 4XPBL 3BHBA 4Q8TA 3L54A 4Q4RA 3GMQB 4FSAA 1TTAA 2BFGA 4XWOD 4AMWA 1DJYA 2BOCA 3A22A 2QAPA 1E6OH 2BWGA 4X5XA 3RDTA 2OP4L 4OCSH 1HXJA 3NVTA 2VOMA 1XF3B 1HXYA 5ESAA 2NMSA 2XKSA 4KK5C 4R96A 1NBZB 3C0SA 1SW7A 4P4RB 1B4TA 3V8CA 3PL6C 4PJ5B 2WP3T 3VI4B 2OQHA 3TC6A 3GNXA 4M6UA 4BFFA 3W0WB 2I85A 5IW6B 1BV8A 4WK4B 1JWMA 2TRYA 1POJA 3DSNA 1KYOK 1Q0XH 1GW0A 3NL3A 3WNJA 5DS8B 1QVOA 1RA5A 4PJ5E 4FS0A 3VI4E 3AREB 1ZT4A 4N3UA 3HC3H 1PZ5A 2OQYA 3RPIA 4G8FB 1W6WA 2UZ9A 2XI9A 5HDBB 3BVUA 5K1NA 1UACL 3G8EA 3LS4H 4OZFB 4IU3A 1NU5A 1OQFA 4WVRA 5D7IA 2EPOA 1YMMB 4DYKA 3OYZA 2QKSA 4L1LA 4X5LA 2CHNA 1X9QA 3FRUA 2WYIA 1LILA 1LWRA 3FCGA 3IDNB 3NT0A 2VFGA 3FUKA 1HQ4A 3VACA 5A2AA 1E6NA 4NNBA 4XE5B 3LV3A 5HDBE 3FQWA 4Q8UA 1ZVYA 3WUWG 2YAOA 4CDGC 1YY8B 3UYPB 1YMME 2WB1A 3GMOA 3AITA 1ECYA 3W1QA 3TFBA 1XQKA 5D09A 4Q6IC 1DWGM 1WT5C 3RTLA 2CBPA 2I16A 2APWA 4KJYA 4N9GB 4AUYA 4JY4A 4WDTA 1W1ZA 2BZNA 2VC7A 4NO5A 4DKFL 1UB6B 2DZTA 3P82A 2F5BL 2BP8A 4FQHB 4PHXA 1COBA 1Y5XA 2C18A 4BCZA 3AJ7A 3KP1A 4HZLA 2D0HA 1NC2D 3M0MA 4QCIA 5H8UA 1VP5A 3JSSA 1QI4A 4GIAA 1JUKA 3PR2A 2XBTA 3ZXAC 5AW6B 4W4NA 3L1FA 1ADQH 3L9RA 4V33A 4WD0A 1OE3A 3L3OA 4Y2DB 1NANH 4U1JB 4BH7B 1DEDA 3IJ7A 1TR7A 1QNVA 1CD9B 3OGCB 2IW0A 5E4IA 4J4PC 3L17A 1F4WL 4JNZA 5LIXX 5C6PB 2GQ3A 1OZUA 1I9CB 3MRMA 5A3HA 3KUMA 4YCOA 3S1WA 4NWTH 2HQAA 3LHPH 2DAVA 1NBQA 1SHXA 2QUTA 1XP3A 4E41B 1FCGA 1WKYA 1EO7A 1UBSA 1FO0A 1FV1B 1I9EA 1RUPL 2AEPH 4MJIB 5JBDA 2VZ1A 5LXXA 1XH3B 1WCQA 4M1CC 4C56B