1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ALPHA-AMYLASE)
publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
4LXFA 2PWDA 1KR1A 1XD1A 4MB3A 3I3DA 2VJXA 1JDDA 3VIPA 1XSIA 3A3HA 1XV8A 3D4YA 3WNNA 3AS3A 3WUGA 1HKMA 3HMCA 4BS0A 3L4XA 3VGBA 2DH2A 4AEFA 5FIPA 4MB5A 5EFDA 1MWOA 3EJUA 1BG9A 3AHTA 1VEMA 2WK2A 3DDFA 3AIBA 3VIOA 3SCNA 3W6MA 5BROA 2EPLX 1H0IA 3ALFA 2Z1KA 1C90A 1BGAA 5M03A 1GHRA 3SCQA 4WK9A 1ODUA 3DDGA 1QNRA 4OJYA 3VIGA 1E0WA 3WD2A 4PMYA 2JALA 1XSJA 3PZQA 3CUHA 2EPMX 2W63A 2J75A 3WQVA 4PMZA 3IK2A 1SYTA 1R85A 3OB8A 4WF7A 3VGHA 4BQ5A 1BHGA 3RILA 4FLRA 2GK1B 4DWSC 2WKGA 3H53A 4BZYA 3OG2A 1R8LA 5BXRA 2WMJA 1TZ7A 2YL8A 5ABFA 1W9XA 1HVXA 1H5VA 4EANA 3WF1A 3SCWA 7TAAA 1E6NA 5ABEA 1KBBA 4HPHA 3OBAA 5A2AA 1LG1A 2YA1A 4CD5A 3KWXA 2Y2WA 3T2OA 1T0OA 2XVGA 4JZ5A 4MDOA 3OLDA 2BY2A 4H8HA 5BCAA 1NOUA 2CPUA 1WNOA 4W88A 4C7GA 3FN9A 1HL8A 3PZ9A 3OZPA 1VEOA 4BQ3A 1UD3A 2YA2A 1BG4A 1G1YA 1GZJA 1E4LA 2NW0A 1TE1A 4U5KA 4XZBA 4UZSA 2OSXA 2RGLA 3U5YA 1WDSA 1UR8A 4PYSA 3AHZA 2V3GA 1MXGA 1HVQA 3POHA 4IM4A 4TVUA 3SEPA 4D6FA 1W1TA 1BPLB 4PSPA 2WZIA 3A4WA 3MSDA 4P7QA 1KXTA 1PAMA 2VZUA 2PWFA 3L4VA 3I3EA 3N17A 4MADA 2OSYA 2A3EA 1M04A 4HA4A 1U33A 1EXPA 3UERA 1RH9A 1IZKA 5E1QA 1TA3A 5DT7A 3NDYA 2PWGA 4D6IA 1UA7A 1ZJBA 5A69A 3WQWA 1OSEA 3AXIA 4NI3A 3CZSA 1LL4A 4U3AA 3M46A 3SUWA 1HX0A 4FNTA 4AZCA 3H54A 1R33A 3RDKA 1X6NA 2XHYA 3TA9A 1DWGM 2YL6A 3ZIZA 5ABFB 5CLTA 5LYRA 3BSHA 1NARA 4F9JA 3W4RA 3W38A 5HXMA 2VX4A 1HKJA 1XYFA 5FL0A 2WMIA 1JIBA 3SUVA 2D0HA 4OZOA 4R5EA 3K4AA 2O9RA 1HNYA 2CKRA 3K4DA 4DM2A 1K9DA 3AYSA 3L4UA 5A95A 3MKKA 1FHDA 1EO5A 2J79A 2EPOA 3MV11 3CZNA 3EDDA 1V03A 1SMAA 1ZL1A 4MAVA 4EAMA 2VZSA 4URIA 4S3JA 2EO7A 5AYBA 1GNXA 1R7AA 4QLLA 1XC6A 1IT0A 1VJZA 2D22A 2CEQA 1CIUA 3D4ZA 3CLWA 1H11A 5FOOA 3QOMA 5GNXA 3VMNA 2F1AA 5GQBA 2FHCA 5BWFA 5CZKA 1UA3A 1EOKA 5DFAA 3CPUA 2B31A 3AMCA 1W3JA 5BRQA 3DX0A 1VRXA 2YOCA 1TA3B 4UCFA 1E73M 2X0YA 3CGTA 1JZ4A 3LMYA 1W2PA 5D8ZA 3A6OA 5I0DA 4TOQA 4HU8A 3F4VA 1HXJA 4JAWA 2C8NA 1J18A 1PZ3A 2DSZA 1W1PA 5M3WA 4W8LA 1GUVA 1UD2A 3NCOA 1EDQA 3T2QA 2DIEA 3WDHA 1UH4A 1PIFA 4AD1A 2WMIB 1TQUA 1B9ZA 1PX3A 1FHLA 4KH2A 3VD5A 3SCRA 4PMUA 1ZBVA 5A6BD 1B2YA 1V6UA 4F8XA 2C0HA 1E72M 3IJ7A 3MO4A 3N12A 1K9EA 1HKIA 1GQKA 4U2YA 2WZEA 3VM7A 3VDBA 3WD4A 4F9DA 2VX5A 3PZOA 1UWIA 2G4FA 1JYWA 1CEOA 3AROA 3W0KA 4ZEPA 2BHZA 5I78A 3BC9A 3WH5A 4AEEA 5HPCA 4MJ4A 3W25A 3CMGA 4LX4A 1CGTA 1GOQA 3PZTA 2OWWA 2YLLA 1KQZA 2BNJA 5FD0A 2XN2A 2QMJA 5D9PA 1X6LA 2CESA 1BTCA 3A4AA 1A47A 3EMQA 3RO8A 4IISA 2ZE0A 5C8BB 2BXYA 3BAIA 2BV9A 2WWDA 2DH3A 4PMXA 5LA2A 3MUIA 4B3KA 1CGXA 3VINA 3AZSA 1MW0A 3M6DA 3W37A 4YHGA 1TVPA 4E4PA 2ZX8A 2EXOA 2ZXBA 1GQIA 4J3SA 3QHOA 4CN1A 1LL7A 1R47A 4UFHA 3VDHA 2EBNA 4UQEA 4UFIA 1BAGA 1CPUA 2DSUA 3CHEA 3BAJA 1XGZA 2XN1A 4HMDA 3AOFA 3DX3A 4HP5A 1J11A 1EOMA 1E0XA 4HZ7A 5JBDA 4W8BA 2XIIA 1NP2A 1LL6A 2G8ZA 3ZMRA 3BMWA 4UQCA 4H2CA 4AW7A 2XVNA 3WQ5A 2J7EA 5EMYA 3W53A 3BGAA 4GQRA 1KBKA 3LX9A 3T09A 1GQLA 2W91A 3G6LA 3ECQA 2E4TA 3AS0A 1M03A 2FHBA 2WSPA 5I6SA 3OGSA 3AXHA 4AIOA 3VGFA 2D24A 4FNUA 2J4GA 4PN2A 4LGXA 2D0GA 3WNOA 2W66A 4JIEA 4B3LA 3WN6A 5AYIA 4DM1A 4IPNB 3EJTA 5FKYA 3WH8A 1GVYA 2EPKX 4HZ8A 2JIEA 4V28A 3CZGA 3ZT5A 3WNMA 3WQ6A 1GW1A 4PEEA 3PZMA 2XVLA 2G3NA 1VFUA 1V6WA 4UFKA 2WKLA 2V5CA 5M5DA 2J8FA 3SCPA 4CKQA 4CU6A 1QHPA 1DHKA 1W2VA 3OGRA 1OIMA 3AJ7A 1D3CA 1UZ1A 2VCCA 1XCXA 1KTBA 4RE4A 2XN0A 2EAEA 2QPSA 3WY3A 4OOUA 4P7RA 1R34A 2GSJA 5A8OA 3BAWA 4UOQA 1V08A 4HA3A 2CBJA 5KEZA 1E0VA 2XFFA 4M1RA 3VM5A 1S46A 1H2JA 5A6MA 2IXVA 4TTUA 3BMVA 2YFNA 4CGTA 3L2MA 4NZJA 4FLQA 1CGUA 1V3LA 2TAAA 3O2LA 1HJXA 3UESA 1HT6A 1UKQA 2GJPA 3VMPA 1KR0A 3KL5A 4M82A 2XSAA 1G5AA 1ISYA 3WD0A 4JHOA 2V3EA 3LPFA 1GOOA 1V3HA 1KWKA 4E2OA 3RJYA 3PTQA 4PTXA 2UY2A 1DTUA 2OYLA 3CC1A 3VSVA 1P6WA 2O9PA 3J7HA 3SCOA 2F7RA 1XH0A 3FAWA 2J77A 4CD8A 2ZUWA 1UASA 2ESCA 1YHTA 4IUGA 3RM4A 4NX0A 4NXKA 2GDVA 3WBEA 2QMKA 4OOZA 3K46A 1NWUA 4PTWA 1FH8A 1XH1A 1IZJA 1I75A 5A1AA 4CCDA 2E8ZA 1WDQA 3T2PA 1HJQA 2J7GA 2F1BA 4QP0A 4FNRA 3VVGA 6A3HA 4ATWA 2IUZA 1C8YA 1W91A 3ZM8A 1ZBWA 5AC5A 1QWUA 2FGZA 5JBFA 1ODZA 3OLIA 1CECA 2ZUTA 2FE0A 1KXVA 1E6RA 5CJ5A 3W81A 4P7OA 3N13A 2EEXA 1E70M 1H1NA 2XGIA 1JD7A 4AISA 3BLKA 4LPCA 4AMCA 3PBGA 3CUFA 4H41A 3OA5A 1IV8A 2HISA 4W85A 4AWEA 4AMXA 4GO8A 2BVTA 4W5ZA 4WKAA 4AIEA 2XM1A 1DWIM 1QVBA 4GI6A 1V0NA 3GH4A 1MQQA 3CTTA 1NWRA 3U7VA 3CUIA 4HU0A 3GXIA 2J7HA 1OGGA 4P7NA 4UOJA 1WPCA 1UOKA 1VB9A 1E3XA 2OW6A 3O9NA 1MW2A 3ZR5A 3BUBA 2DGAA 1HXKA 1GOMA 2PWEA 3DC0A 1E6SM 1AMYA 1Y7VA 2WWCA 1OD8A 1HIZA 1BF2A 5IDIA 1EA9C 4JHZA 4ZXLA 3LRKA 1OD0A 5ABHA 3AMDA 3EMZA 5LA0A 4NF7A 5D9NA 1QI4A 3S5YA 1CWYA 2QLYA 1X1NA 3WD1A 4P8UA 3WH6A 1BYCA 4P8WA 1JF5A 2J7BA 1QI5A 3K8KA 1M53A 3GXFA 2E9MA 1RP9A 2VZVA 2OYMA 5E70A 2WHLA 2F8QA 3TP4A 4DWSA 4CVWA 5A8NA 2X8RA 1CYGA 1O7AA 2F7PA 2VL4A 1XSKA 4Y7EA 3WD3A 2WAGA 3TTYA 4FNSA 3SUTA 3A4XA 4DO5A 4PMOA 3D50A 2F7OA 4GPNA 1TG7A 1B90A 4PBGA 1E43A 4A3YA 2GDUA 4N42A 4MNKA 2PF0A 2ZX5A 4WSKA 1FFQA 5IFPA 3AHXA 3GXDA 3NSNA 3SURA 2DPEA 4D6GA 5EFFA 1BVNP 3D5HA 2JF7A 4YN5A 4BCEA 4GZEA 1FFRA 4MNJA 2O92A 2ZIDA 2VRKA 1ITXA 3UG3A 3SCUA 4D6JA 2WC7A 4TX8A 3MI6A 5D4YA 1CGYA 3B8SA 1E4IA 3WDJA 1KCKA 2OWXA 1L0PA 3KLKA 4YPJA 3DYPA 4L4OA 3WIJA 4AD5A 1JDAA 1E9LA 2VQUA 1UKPA 2VRJA 3VIJA 1QHZA 3AMLA 2WNWA 4E8DA 2YL5A 1H0GA 4PUEA 1UQYA 4QDMA 2PWHA 3AMGA 2CBVA 5D9OA 3DECA 4W5UA 3VNZA 3MANA 5CG0A 4WLCA 3E1F1 5E9AA 3SCTA 4CVUA 4Z2LA 1B0IA 1GVIA 2Y5EA 2VCAA 2D20A 1NOFA 3AIUA 5CSUA 1E6QM 5A6JA 4DWSB 5IXEA 4ZFMA 3TONA 1EHNA 2YBTA 1V0MA 4OGZA 1JAEA 3AQUA 5JUVA 1XYZA 2BY1A 1J0HA 4UQBA 2DT0A 2RGMA 4R27A 1K9TA 2V3DA 4JFTA 4TUFA 1J0ZA 2DSWA 2DIJA 3TTQA 1KXHA 2XUCA 4IPLA 3HG4A 2XG9A 3BVXA 1ZB5A 4EK7A 2WMHA 1GOIA 3WMBA 3AIRA 2F7QA 3HG3A 2HVMA 1QI0A 4D71A 1L8NA 5DO8A 1PPIA 1ZJAA 1M7XA 4RL3A 3II1A 4LYQA 4M29A 1J01A 1GORA 5EB8A 3ZJ7A 1JZ3A 3VSUA 2WCAA 2JF6A 4RE2A 1H09A 4AZIA 3JUGA 2ZWZA 3KZSA 4CUCA 4OBSA 4AD4A 4XUYA 4FF5A 1ZBKA 3KLLA 4PMDA 3CIVA 3A5VA 2WVVA 1J0JA 3W29A 4GZIA 3D51A 4QCFA 4XZWA 4TVDA 3L4TA 1QNSA 4QCEA 3N11A 2FGLA 3W24A 4GI8A 3VIHA 3AIEA 3POCA 3U5UA 4Z2HA 4BQ2A 1QI3A 5BRPA 1J0KA 4HOWA 5E6ZA 4AC1X 1C7TA 1V3JA 5GNYA 1V3MA 3WUBA 1RP8A 2VOTA 1B3XA 1BLIA 5F7UA 1B3VA 1BYAA 3WFZA 4J28A 4RE3A 2CYGA 1OBAA 2ZUNA 3DYOA 1MVYA 4JCMA 2BY0A 3LPOA 4M8UA 1VEPA 2PBGA 3K8MA 5CSYA 4D1JA 2CHNA 3PZUA 5CXPA 3B9AA 1V02A 5HBFA 3AIVA 2ZICA 3GM8A 2OYKA 1TQVA 4J3TA 2W5FA 5BXTA 2WSKA 2O9OA 4U3CA 4AZCB 1KWGA 5HPOA 4UFJA 3WMCA 1JZ5A 2GFTA 2GVYA 5I5RA 1UR1A 2ZX7A 2J7CA 3GZAA 3WENA 1B3WA 3MS8A 5HOSA 1EO7A 2JE8A 2VNCA 3CZEA 4MJ2A 1UR4A 2BVYA 3T0DA 3ZT6A 4B9ZA 1DWAM 2WVVB 1JZ2A 1W9UA 3D3AA 2WCGA 1F4HA 3AICA 4D6HA 4PTVA 3GXNA 2FDMA 4D6EA 1HKKA 1GPFA 2X2IA 5I3DA 1I1WA 3GXTA 1R87A 1BYDA 4KGLA 1WDPA 1CXKA 4KMQA 4ML4A 4PMNA 3WH7A 3A24A 3WDIA 1EHAA 2Z1SA 4AZHA 2VRQA 2YDQA 3BUPA 2ZXQA 2WC4A 4B16A 4PMQA 3ARSA 1BVZA 1R7OA 3VUPA 3PN8A 5A6BA 1B1YA 3WBAA 4TVCA 5I79A 2CNCA 3EDKA 5M17A 1XD0A 4U33A 1O6IA 3NIYA 4ZE5A 1UD4A 1B3ZA 5A3HA 2ZUVA 3VMOA 2E40A 3B9EA 1EQCA 1QPKA 3HZ3A 1QNOA 5A6KA 1PS3A 1Q6DA 1VENA 3G6MA 4MTVA 4A3HA 4AXNA 1MQPA 1G0CA 3QHMA 3AS2A 1JNDA 1MW1A 2OW7A 3WY2A 2YKKA 5IFTA 1C91A 1LQ0A 1SR0A 1HJWA 5A6SA 4GKLA 3FNDA 2CKSA 2V3FA 4UQDA 1UD8A 2E3ZA 3S6TA 1WE5A 3BAXA 3O6AA 3SCVA 1V02E 4CD4A 4GI9A 3A47A 2Y24A 6CGTA 1VBUA 4BF7A 1UKSA 2CXGA 1G01A 2BS9A 4F79A 4DUXA 2F61A 2VZTA 1M01A 3TOPA 1UYQA 4CD6A 3AYRA 1Q6FA 3HG5A 4UQAA 3OGVA 1C8XA 4X0NA 1MQRA 4W7VA 3T0BA 1G94A 4NZFA 1ISVA 3CUJA 4YHEA 2OSWA 5I24A 3NYDA 1KCLA 1E5NA 1W3KA 1V6YA 5A6AA 1PIGA 1TQSA 1CGWA 5A8QA 4UFLA 4NSBA 2ZUMA 2YBUA 2IXUA 3CBWA 2JIWA 3H55A 3UG5A 3GH5A 1BGGA 1JAKA 2E9LA 4NRRA 3W27A 1JFHA 3ZSTA 4V27A 4X0VA 4M81A 2XJ7A 1BSIA 3VGEA 3WY1A 2CETA 2XWDA 3CZLA 3BUIA 3VTRA 1V6XA 3F5JA 1E4NA 3ARUA 1WZKA 2DSVA 4NRSA 3AHVA 1UG6A 1AQMA 2X2HA 2EJ1A 3CUGA 4UOZA 2DEPA 1OINA 2X05A 7A3HA 1KXQA 5A6LA 5JIPA 4W84A 2VR5A 3PZVA 5A8MA 4EKJA 2XWEA 1RD6A 3MV01 1XRVA 1CBGA 1SZNA 5I23A 3WDQA 3CHCA 2WMFA 1MFUA 1UWQA 3PHAA 4ATLA 2VX7A 2XTKA 2VX6A 3FHAA 1E1FA 2VZOA 1F4AA 4BQ4A 4PSRA 1JG9A 3BCFA 4NZCA 1R46A 3SIMA 1H41A 1Q4NX 2D23A 2BHYA 4OUEA 3NJ3A 1KQYA 3ARXA 4W7WA 1RPKA 3ZJ8A 1GQJA 1EGZA 4QFUA 1UD6A 1SFSA 2YJQA 1JNEA 3PZNA 3BXWA 1E6XM 3VIIA 2WBKA 3IGUA 1EH9A 2WANA 4KRTA 2ALWA 4MAZA 1JL8A 2Y8VA 4KWUA 3HU7A 5CGTA 1JZ6A 4M24A 4UNIA 2E9BA 1KGXA 1G9HA 4GQQA 3MUZ1 4JL2A 1H49A 1AQHA 4JFWA 3VX0A 2VT0A 2DDXA 2OLHA 2WHKA 3EDEA 3QHNA 2W67A 2XSBA 3ZSSA 2YA0A 3MSGA 3AZRA 2QF8A 1WDRA 1PEZA 1ISXA 2A3AA 3WL0A 3VD4A 1E3ZA 1U2YA 1HF6A 2G3MA 2D0FA 2VURA 4JL1A 4UZUA 4HTYA 1FOBA 1W9PA 3F5KA 3NDZA 1VFMA 1ZU8A 2W62A 3LRMA 1I1XA 2J62A 1WCGA 1W9DM 2WLYA 1WZMA 1VFFA 3VNYA 1J12A 1CXFA 2IGTA 1Q6EA 4D6CA 2WHMA 3W28A 3CV5A 4MNMA 3GBEA 2A3HA 1JXKA 3VX1A 1CTNA 2CBIA 3WF0A 1FA2A 2D3NA 4W7UA 4JKMA 3EJSA 2WB5A 1QNPA 4QLKA 4PTMA 2PC8A 3HJEA 3PZGA 4P8XA 2XIBA 3UETA 1MFVA 3BCDA 2GJXA 3T08A 1TQTA 1JYVA 2GJRA 3IJ8A 2CBUA 4WIWA 3WL1A 3EBVA 2J7DA 5E0FA 1LWJA 1OWQA 2ZOXA 1PZ2A 3TTOA 4ZENA 2J25A 2Q8XA 3VIMA 2O9TA 2BVDA 3WMSA 1LWHA 1E4MM 3VDCA 3DX1A 3VILA 1W9BM 2ZX9A 2YDSA 1HJSA 1ITCA 3WF3A 1UR2A 2WBGA 5DF0A 1VIWA 3DYMA 4AYSA 1KTCA 1HP4A 3LXCA 2VUYA 2VCBA 4Z2IA 4GXPA 2DT3A 4JKKA 2XFYA 2MANA 3EYPA 2WMKA 3SUSA 3SUUA 1UD5A 1VBRA 3GNRA 4B9YA 2VQTA 1GJUA 1UUQA 1ISZA 4TXEA 4GO9A 1XHGA 4HOZA 3GTNA 3ALGA 1NP0A 4AD0A 1CDGA 4FK9A 1V0LA 3WDRA 2XYLA 2CERA 2XVPA 1NQ6A 3D52A 2UWFA 2DT2A 3GDBA 3MUY1 3WQ8A 1QHOA 2W61A 5JBEA 3UEQA 3WFLA 5GPRA 5CQ1A 1JZ8A 3IANA 1W3HA 2XPKA 3DHPA 4W87A 1KB3A 1ZS2A 1UR9A 5GNZA 3WH9A 1D2KA 1NWSA 3GH7A 1QBBA 2NSXA 2GJXB 4HPGA 2F18A 2CHOA 4PUDA 5E09A 4J7RA 1DEDA 1AVAA 3AZTA 2E0PA 4AMWA 1U30A 3WQ4A 1OT2A 4MB4A 2WVTA 2W92A 3VSTA 3T0AA 1JXJA 1ISWA 3BH4A 2ZX6A 1JF6A 1JZ7A 3OZOA 3K1DA 2JFEX 1QOXA 3BVVA 1BQCA 3GXPA 4L4PA 1TUXA 4OKDA 1US3A 4HOXA 5FL1A 3QGVA 4MNLA 2YFOA 3WSUA 1UZ4A 5C71A 3BUQA 5BYWA 4Q7NA 3U7BA 1QBAA 1V0KA 1VF8A 1UR0A 1WKYA 3BVUA 4FNQA 3A22A 2VMFA 4W89A 4J3WA 1C92A 2J78A 4D72A 1UWRA 2WCSA 3FY1A 3VD7A 4WSJA 2E8YA 1EDGA 4WJXA 1PBGA 3TV8A 3AS1A 1OM0A 1J10A 1A3HA 4J3VA 2D2OA 3EDJA 1BFNA 4C7DA 2UY3A 3WNPA 3BLPX 4DUVA 1JYXA 3BVTA 1W1VA 2WLZA 4CU8A 1K9FA 2XFRA 1TR1A 4UR9A 4D6DA 4PMRA 4S3KA 5E0CA 1KGWA 2J47A 1QWNA 1DWFM 5CPTA 4FLSA 5CGMA 1JFXA 3AXXA 1WP6A 3CMJA 1WZLA 2WMGA 1OGBA 3WEZA 2EABA 3N04A 1GJWA 1ZBCA 1VJSA 3BUDA 3BLBA 3CZ8A 5BXSA 1NOWA 1UKOA 4Z2KA 5EBAA 4PCTA 3VO0A 4BA0A 1PX8A 2WC3A 2WVUA 2X2JA 4V2XA 3WDPP 1JI2A 4TTGA 1QNQA 3VIKA 1OCQA 1J9YA 3B9DA 1UWTA 1E56A 2ZXAA 1CXHA 3ARWA 4AIUA 3RPMA 4LYPA 3LRLA 4CN4A 1OIFA 1HP5A 2WM0A 3FHQA 4AZ6A 4CCEA 3U57A 2FYVA 1BYBA 3IAQA 2Y8KA 4JFVA 2X2YA 1J0YA 4ACZA 2WZHA 3GYCA 2XM2A 1V6VA 3A21A 3WEMA 4TX6A 4JFSA 1WO2A 1NM9A 1JGIA 1XCWA 7CGTA 8CGTA 2CITA 3ZT7A 1UH2A 1N82A 4MDPA 1E1EA 3WF2A 4FMVA 4AD3A 2V38A 1FH9A 4LYRA 1Q6GA 4M80A 2NT1A 4KGJA 2DSKA 3ZOAA 3QOKA 4H8UA 1W9VA 3EJPA 2ZWYA 2DT1A 1VAHA 1DP0A 1JD9A 1JI1A 2G41A 4DO4A 1CZ1A 2YIHA 1TCMA 3ARQA 3GNPA 1H4PA 3PTKA 2FH8A 3VD9A 3VGGA 1C3FA 1D7FA 4JKLA 4NXSA 2G3IA 1B3YA 1KGUA 4GINA 4WKFA 2PB1A 1HWWA 1NWTA 5CPQA 5FCZA 2BY3A 4XX6A 4J27A 5D8WA 1DWHM 2QV4A 3IJ9A 3PTMA 1SMDA 3NSXA 3EDFA 2WVSA 3L4WA 4ACZB 4M56A 3VD3A 3RMEA 3ARTA 3VOCA 3LXBA 1K6AA 5ABGA 3GNOA 3BAKA 4GZJA 3GBDA 1EDTA 4JCLA 4K68A 1LG2A 1TVNA 4Q22A 1W1YA 4DO6A 9CGTA 2A3BA 2QHAA 1WB0A 2XGBA 3AHYA 2NT0A 2X09A 1C8QA 3BSGA 1HL9A 1MXDA 5BXPA 1FH7A 4U5IA 3VIFA 1CGVA 1R86A 3AFBA 1UH3A 3UR8A 3BAYA 2UY5A 2UY4A 5IHRA 2PI6A 2YDRA 3CHDA 4AD2A 1OGSA 1QW9A 1ESWA 2BXZA 2FHFA 4H7VA 1E6ZA 2Y4SA 1TQWA 2VO5A 5A8PA 1E6PA 3UR7A 3ZJ6A 5D9MA 3DHUA 2EACA 2D1ZA 3OIHA 3W26A 4CN6A 5HDRA 3I3BA 4EE9A 4XV0A 4Z2GA 2AAAA 3ZR6A 3TTSA 1GCYA 3GXMA 3THCA 1E15A 2WXDM 3HG2A 3AISA 1MW3A 4U31A 3N18A 1JYNA 3AIWA 1UKTA 2ZUUA 2DQXA 2C7FA 5DMYA 2VI0A 3ARYA 1C7SA 4KRUA 4AY1A 3VPLA 1LLOA 1V3KA 1OT1A 2WW5A 3CHFA 3SCSA 1HJUA 4HA1A 3RJXA 1E5JA 2YLAA 3FXYA 1CLVA 2WYSA 2WHJA 4AZGA 2EADA 5LA1A 3IAPA 3F5LA 1H3GA 1E40A 1FP9A 3QR3A 4E8CA 3MMDA 3APGA 3NUKA 4GIAA 3WUFA 1LJYA 4CU7A 4AYGA 5JIWA 5A2CA 4X9YA 1GONA 3CH9A 3WUEA 4ZXOA 3N1AA 2F2HA 3OLEA 4W86A 1E55A 2VR4A 1HJVA 3VGDA 1US2A 3L4ZA 3OLGA 1UWSA 3EJQA 2JEPA 1NH6A 2V5DA 3L2LA 4N0RA 5TD4A 2W4XA 2J8GA 2VC9A 1AQ0A 1HN1A 5ECUA 3WKZA 1VFOA 1O7DC 1UQZA 3AMKA 4FNPA 3EMCA 1XH2A 1W32A 2X0HA 3N9KA 2ZXDA 3KEHA 5CPSA 1TMQA 5DEZA 4C7FA 4F66A 1YQ2A 4AZ5A 4W8AA 5I77A 5AY7A 1ECEA 5DT5A 2BFGA 3ZQ9A 4CCCA 3DX2A 3CZJA 4UFMA 1PJ9A 4HMEA 5CLWA 3ZO9A 4WKHA 3LPGA 3UCQA 4MB1A 2BHUA 3FAXA 3ARZA 1TFVA 3W6LA 3PZIA 2G3JA 1Z32X 1MYRA 1C93A 5HNNA 4P8VA 3RCNA 4B15A 5I2UA 4FLOA 3KL0A 3HN3A 3EJRA 4H04A 4PCSA 1WAWA 3M7SA 3KL3A 3VU2A 4ZE4A 2J74A 4U2ZA 4JFUA 3MU7A 1CNVA 4AZ7A 1FP8A 2J7FA 4P7LA 1R75A 3FW6A 2XVKA 1LF1A 4UQ9A 2WPGA 2CCRA 4D1IA 1EQPA 3MUAA 3WNKA 4J3UA 4A4AA 2AMGA 2AOSA 2A3CA 1W3LA 1UHVA 3S2CA 4LQ1A 5KZ6A 3KE0A 4H8VA 3RM8A 5IHSA 1EIBA 2D73A 3MMUA 4MPKA 3WF4A 1E71M 1B30A 4DUWA 2OWCA 2CIPA 2VTFA 4AZBA 4W93A 5A2BA 4PMVA 1CXIA 3VDAA 3RIKA 1HTYA 2VVNA 1PX4A 2FH6A 2EPNA 1CENA 3S5ZA 1CXEA 1Q6CA 4OIFA 3BVWA 2PBOA 4PRWA 3WY4A 2VVSA 1WZAA 3ARVA 4HMCA 2YL9A 1B31A 3DX4A 3CO4A 1V3IA 3UG4A 3VKKA 4ATDA 4UTFA 3NSMA 2EQDA 1J0IA 4XB3A 6TAAA 3ZJKA 3M07A 1GHSA 1UWUA 2GUYA 3RM9A 3LPPA 3AIQA 3L4YA 1QW8A 3K8LA 3WNLA 1CLXA 3MMWA 1DWJM 2JEQA 1CXLA 3WELA 3THDA 2X1IA 1GOKA 3CZKA 1QI2A 3AI0A 4QLJA 3ARRA 1QX1A 2GK1A 5E6YA 1JDCA 4HZ6A 4J3XA 1GOWA 5AC4A 8A3HA 3WEOA 1OB0A 5C70A 1KFWA 4OBRA 3ARPA 4QAWA 3LXAA 2QPUA 4ACYA 2ZUSA 5A94A 4CD7A 3N15A 3A23A 3W82A 4DWSD 2D3LA 4Z2JA
chains in the Genus database with same CATH superfamily
2PWDA 2QADD 4EF8A 4E9VA 1KBLA 1E5BA 4EBQH 3VIPA 3MNZB 4N68A 3DWTA 1G4MA 1WFOA 4OF8A 5MI0C 1A5NC 3AIBA 5JW3L 3SCNA 5E00B 5EEVA 5DZJA 1C90A 3TYZA 2XC8A 3TWCL 4ORIA 2NNXA 4OU1A 1YIXA 3HE6D 1C29A 2JALA 2E68A 5J8OA 4XRCA 2RR3A 4ZFGH 3PABB 1M1BA 5KW9H 3WF1A 3SCWA 1LK3L 3D48R 5E99H 5IMLA 5DRXA 1F6PA 3SDDD 3GG7A 3ZPDA 3QDGA 5K1NA 4YSOA 3BDKA 3DCPA 2C26A 3UO1L 1UADC 4HJTA 1UD3A 4RXGA 2ZKHH 1A1MB 3IACA 4LCQA 4RA0C 3F03K 3PQYB 1ZWIB 3CSBA 4UTBH 3G5ZB 2A2IA 4PYSA 4PFHA 2VSKB 5EZOL 3HI1A 5FO7A 1AGCB 4BZ2A 2GDQA 4I5UA 1NMAH 2X88A 4MQXC 5SWZB 3U6RB 4DQOH 4NU7A 1M04A 5DJYA 3S5NA 2VXQL 2HK0A 1KEMH 4IRZA 4Q6XA 1IFHL 2BO0A 3MV8A 2VSMB 1X6NA 3BOXA 2IIJA 5HHXL 2YB4A 4XNYH 3QMTA 2IH1B 4YXGA 1XYFA 2FMNA 3SUVA 3HAEA 3LKOB 2QQNH 3ZBMA 2EUVA 5L4IA 2Z8WC 4GRMA 1KT2B 2ARJA 3NSFA 1ZLWK 1MLBA 2EPOA 4MYPA 4G9FB 4O10A 4F37F 1ZE3C 1M05A 5AYBA 1ZFJA 2PYED 3VACA 4BWLC 3STBA 5GS1C 3CLWA 5M7QA 1A5BA 1X5KA 4HXAL 4KZDL 4ERSL 2P80A 3ZJAA 4MHBA 4LVHC 2BWIA 4YDZA 2M83A 3CPUA 3QWQB 4G8EB 1VRXA 3VWJD 4PUNA 3SGJA 2OZ4L 5D8ZA 1XIWA 2MIZA 2R2BB 1CICD 3LH8A 1T7ZA 1AA1B 2CLFA 4GRLA 1A0EA 1EDQA 1ME9A 3TBTB 2APSA 3BW9A 5MHSD 1RIHL 2V5RA 1N68A 1FHLA 3RBGA 1GSMA 1UJTA 4LSSL 5I16B 5E0QA 4L4MA 2QCHA 3V0WH 2VR3A 2ZXGA 4AG0A 1HOCA 1E30A 5ITFB 4F24A 2A0LC 2WJ5A 3DX7B 2VQ4A 1JCVA 3BZ4A 2H9AB 1V8HA 4MX7A 5K33A 3DO4A 4ENLA 1QFUH 3IFOA 3BQ5A 1F1DA 1XFPA 5E24E 1VFBA 3F6LA 2GVLA 1I8IA 1FC2D 1OC5A 3W25A 1A65A 1FDYA 3KCPB 2XTLA 1GOQA 4MNGA 1MCHA 4AX3A 1YEGL 3KG5A 1OTSC 4G8FA 5LA2A 5FB8B 1JV5B 4LKXB 2WNZA 3Q1SH 5ETUB 1IGCL 3F1QA 4BKLA 3BJFA 1LL7A 1NDGB 3WJJC 4C1NA 3LIZA 5D6DA 4K5NA 5AZ1A 1B4TA 1QZNA 4GP8B 3PJTA 5HYSG 3HBZA 4GXMA 3Q8AA 3R7MA 3KNBA 4EPEC 2WW8A 4NWUH 4UTUA 5JBDA 3T81A 4MS8D 1F8TL 1KD0A 3WV0A 3CPRA 2FHBA 1TTRA 4YDKH 2AK4E 4NSKA 3TC9A 2A7NA 1MI5A 5BS0E 4PP1C 3ABLB 1GRWA 4MDRA 5D7KE 5MENB 1T3FB 1XGDA 5C9JB 4HZ8A 3CZGA 4YVXA 4CNIB 1EC9A 5LNEA 3VAEA 1XR8A 4MNHA 5M5DA 4GAYB 2QGHA 1DHKA 5D8JH 2K8MA 4X7FC 4G8GE 1W2KT 4JJ5A 5C0JA 1TU2A 2FO8A 3VW3L 1HI6A 5PCYA 1NFIB 1QLEH 4BF9A 4PWFA 5IBTL 1YEEL 2X1XR 4FZEL 3KTXA 4US5A 3QQNA 3QIUB 3IGHX 3RXZA 2CXEA 3UGXA 5C08E 1KCZA 1A1NB 2ZPKH 2MNUA 1HS6A 1ZVSB 1AKPA 4EPDC 1RULL 2FB4L 2EDOA 1E9PB 2MH4A 3S8WA 4KJWD 4ADGA 3S42A 4FEMA 4ENED 3CL6A 4WW2B 4N24A 3MRNA 4I9TA 3ULUC 4FQJH 4BQ9A 4AFYA 3KVKA 5ADPL 1TYGA 1WDQA 1IGWA 2KS0A 4RPQA 1GYMA 3P4LA 4F58H 4ATWA 2JK2A 3MY9A 3ZM8A 3DTUB 2WXJA 3MRRA 3FU7A 4KFNA 4JRXA 1N12A 4AISA 1BZQK 1ZS8A 1CFTA 1O95A 2HISA 4AWEA 1KJ2H 2AQWA 5AG8A 3FT0A 5KYUA 3P6LA 1FORL 3ETBJ 3WL9B 1AQFA 3HO8A 1KENH 5L2KB 4OZGB 5C0EA 2KZ1B 3AC0A 1A3ZA 3G1VA 3QLDA 4Z0SA 2AEOA 4JIIX 3ARGA 4GQZA 4E41B 1EA9C 4UAHA 1NGXA 4GG6A 4IU2B 1CWYA 1AXTH 2YK1L 2KQMA 2XSXA 4P2VA 3L1EA 3S8GB 3CASA 3RK8A 2YQBA 2BNUB 6REQB 3GDKA 4EI6B 3VWKC 1Q9KA 4JPKH 3RP1A 4OF6A 3P77A 3IEBA 4UILH 4P2RE 1Y0LA 5GRVL 2DZTA 3GDCA 2PF0A 3S3BB 2UZYA 3ULVF 1K6QH 4MWAB 4GZEA 2EUXA 2UY7A 2VWSA 4K3JL 3C60B 1O60A 1CGYA 1UA6L 2NYZA 3NJMA 5E6RB 2I69A 4FFYH 2L8AA 2G0LA 4AD5A 1A9BB 4NQXB 4QT5A 4FA7B 4OFYA 4H5SB 3RAJL 3BZGA 3W39B 4QDMA 1WK0A 3U6WA 1F07A 3GSNH 5SX5H 5C3IA 2VDLL 4PJDA 3EOTH 1BECA 3VFSB 4KQ3H 2VCAA 4NAQA 1CD1B 1SDAB 2HYMA 3KDMB 2O4MA 2AQ3A 3RCMA 4OGZA 5FW8A 3IVSA 3VG9B 1WBZA 1HQ4A 3GLZA 3ITTA 2PW2A 4GE8A 4IPLA 3NWRA 4PJXE 5AVYB 4LOUD 2VXUH 5DO8A 1E7UA 3MLSL 2VGFA 2PW1B 3M1CA 1JZ3A 1KM1A 1A6WL 4Q9BA 1GG1A 1ICSA 4AZIA 3KZSA 43C9B 4FF5A 2PAJA 3D51A 1QNSA 3D0LA 3E9UA 3FO2A 4I1NB 5HVWA 4AQ8A 3P2DA 4XCCL 4NJ9H 5DJ2B 3ZUCA 4S0TD 3K2GA 1V3JA 2CLRA 3RPBA 2AXHA 1B3XA 1EP3A 5BQ7A 3PZUA 2HN7B 4CVZA 1PE1A 3F7RA 2J8UB 2JELL 3PWPE 1A8JH 3QUMB 2WBJC 5FSEC 1GR7A 4JPGA 3OKLB 5CMAA 3I6GB 4L8BA 9XIMA 2ADAA 4QXTA 1UR4A 4GKNB 1MJJB 1KTNA 4B9ZA 1FLTX 5DO2C 7TIMA 3U46B 2YRBA 4ZUVB 4LCYA 1F4HA 2NVDA 1ODAA 4F7EA 1SBSL 2VH5L 4LLQA 2LU5A 1MRCL 4UBPC 5I3DA 1OC6A 4R3UA 3VI3E 4P4KC 1CXKA 2FEEI 4X6CB 2YXFA 5EG6C 1P5VA 3BUPA 4MAYC 4WW1A 1IWPA 4OUUA 5DEJA 5AALA 2WNNA 4N6RA 1RAKA 1F90H 3PE9A 1QEWA 2Y8UA 2NTSP 4JM2C 2B8OT 2JGQA 3ZDZE 1ZV9A 3VYLA 2QYGA 3OAYK 1JXDA 2O6DA 2H8ZA 3U48A 4C6QA 5TE7L 3WY2A 2VDOB 1YLVA 1Q0YH 2DM3A 4JQVC 2BP0A 1HXMA 4XAWH 2VGGA 2ADGA 2BS9A 4XTDA 1ZVNA 4MJMA 1TG8A 1UBPC 2HXAA 3AYRA 2V7HA 1GOGA 2L3BA 3MRDA 4EBQL 2OSWA 2BCMA 3FDWA 4ZO9A 5F1KC 3HIJA 4N2LA 4WI7A 4H88H 2MPVA 3IPEA 3O6FA 2QCDA 4JICA 1B4JL 1CX9A 4CGUB 1MRDL 4QQ3A 3SPGA 4IOTA 4X0VA 3MGOA 1UIOA 3BQVA 3WY1A 4ZMNA 3MX0A 3TJ4A 1E4NA 2VDQB 5IB1A 2EDLA 1U8NB 5E56A 5K9KA 2CGYA 4EKJA 2Y7QB 3LH9A 4RQQB 1RZIB 3MZ2A 4JFOA 2XWXA 1IM3D 2HT2D 5KW9L 1NDVA 4DP9X 3GQFA 1K8DB 3NGFA 4YHYB 3WLWC 1R3KA 1OTTD 5EU5A 2VZOA 1E1FA 3E02A 5K2ZA 4P2AA 1MUMA 3IT8D 2CWNA 3ARXA 2N4IA 1E4JA 1S2EA 3NPSB 2ZKHL 5LWYH 4MAZA 3M0MA 4UTBL 3LRHA 1MCLA 1OHZA 3ROLA 5F9OL 4JL2A 3KBSA 1CTOA 2XSBA 1T21A 3KJ6H 4ZUWB 4WQOA 1NMAL 3WL0A 7PAZA 1EX1A 1YY8A 4IOFC 4IXXA 3GHPA 2QJDA 4XWOC 1BZDA 3RPDA 1W3IA 3F7YB 4EN2A 5I1AB 3UZWA 3DFNA 4GXVH 1DYZA 2KT6A 4NRXA 2PKDA 1SLVA 5C0CE 3VX1A 1FA2A 4TUOA 3A4EA 4DP1X 3H3PL 5AUMB 3EJSA 2O1AA 4B9CA 5CZJA 2K3HA 2QQNL 4P8XA 3UETA 3BCDA 4WIWA 1IAKA 1KXQE 3WL1A 1TQBB 2YOAA 4RZCB 1LO5B 3MI2A 2ODIA 1HJSA 2WBGA 4K9EC 3HN5A 3CH1B 1KTCA 1B9KA 4IIEA 4A3RA 5L2JB 1PZAA 5FO2A 4QGCA 3O4LE 2HV5A 2E3VA 4AV5A 3QEGH 2ISWA 2EIEA 5TQ0H 5I1DA 4KTEH 4RCAA 3RWIA 3MCYA 4ZAKB 4U28A 1N70A 7XIMA 5CJXC 1DLHB 3G6DL 4Q8MA 3ML8A 5T33H 2JSFA 1UWXH 5IBLD 3R18A 3KHQA 2A1YA 3AZTA 4JFYA 4HUWB 2E77A 1TPH1 4Q89A 3UXIA 5EZLB 1QFUL 5I09A 1CT8B 3OB0H 4LCCC 5DD0L 2PDBA 1BQCA 3QO0A 4Y9FA 2QUVA 3S1XA 5BYWA 4Q7NA 1BFVH 2EDMA 5BVPH 2Z65C 3FEQA 3A6CH 2CNYA 1BOGB 1T2XA 2E8YA 4GS7C 4NUWA 3CHVA 3Q1SL 2E59A 3WNPA 1U8MB 1U92B 3QRHA 2KKQA 3NBNA 1MRQA 4I0PB 1I8AA 2Y5TB 1QWNA 4XGZA 1Q6LA 1DWFM 3KYOB 4RAUB 5LNDA 5CGMA 1VHCA 3N6QA 5H8PA 1OPGH 2UXVA 1E8WA 1IEBB 1DIKA 4NWUL 4DRSA 4Z2KA 1EF2A 3JZUA 1MCOH 3QIBB 4NZ8A 4FCHA 2YSWA 1N5AB 4YDKL 3HE6B 2EG7A 4LSQH 2CBOA 1G4SA 4XBGA 3G5YA 1HHGA 1X5JA 3CFJA 1Z5HA 5CHNB 1J96A 2C16A 3EOAA 5DC0A 2CQVA 3TNNB 3QDMB 2DDQH 1PO9A 1K72A 4RPPA 1Y6MR 2XFXA 4R7DA 3MACL 1GYVA 3FJ6A 4JEQA 3ARBD 3GJEA 4L37A 2Z6JA 1P1VA 5D8JL 2W88A 2XQBH 4HPNA 4AD3A 4Z7OE 2R69A 1EWHA 2XFWA 4IPIA 3EJPA 5HGHB 2PD9A 2AK4D 2NCMA 3ZVVA 5BS0D 4JFHE 5D7KD 2WHVA 3KHOA 3NYKA 1B3YA 4O50A 4JPSA 4ZTOL 2PB1A 1PG7W 1ACYL 4BUHA 4AUYA 2VC7A 1EZSA 3R2GA 1E8YA 5HUPA 2ZPKL 3PFMA 2NXYD 4G8GD 3SBFA 2WVSA 4KHXH 2OK0H 2B9BA 4TNEA 4IKJA 1DQMH 3TZVA 3C6EA 4LRSA 1FH7A 1I1FA 5AD0B 5JOPD 4F58L 2CNZA 5AHIA 4BXVA 3W2LA 2UY5A 3C6SB 3KXFA 2GPZA 4NHUA 3C5SB 3MBDA 3FT3A 1YDVA 4GUCA 2CLHA 2Y1AA 3HNTL 2EC9U 1KJ2L 4IH3A 2EE6A 1JPSL 2VISA 1NU5A 2G75B 4BE5A 1P84K 5KVMC 1NGYA 3GTVA 1EXUB 3ZU8A 3QUGA 3VWJB 2MOVA 5D71H 1KTRL 1CICB 4JG1H 3SCSA 3RFAA 5FGSA 1YVLA 3QG6A 3BG9A 3X1FA 1P7KB 4Q6JA 4LOFA 5GGRY 5IOKA 3BKML 1AXTL 4OZGF 4DIAA 3VXTB 4U3HA 2K6ZA 1LM1A 4JFZL 4PVLA 5DCEA 5E6IC 2DQGH 4JPKL 1ZLPA 1CDJA 1M1XB 2JEPA 1FFOA 3QYSA 1QRQA 3FZUD 4KKCD 4UILL 5K4ZA 2IALB 4JS7A 5EBUA 5DSCA 1AQ0A 1JPTH 1FZOA 1TENA 3TNMB 1K6QL 1QOKA 3HZYB 3VFRA 3G1SA 5I3GA 4H0GA 1RJQA 3GLCA 4L1SA 3QJQB 3GK0A 5AZUA 1C5BH 2D9CA 8FABB 1SJCA 3UEZA 4B96A 5SWSA 4QDGA 3P5ZA 3OMZA 2X4SA 3IBEA 3TASA 3O3EB 4Z0BH 1J8KA 1EFQA 1IKFH 2V6HA 2OMAA 4LFHG 4JFDE 1NUFA 5K5YA 3GSNL 3KL3A 3SIZA 4PLJC 4GG8B 2JLPA 5DEFA 3PJSA 3EOTL 3G5VA 4P2RD 4KQ3L 3NL2A 2XVKA 2WAHA 3MLUL 4B5VA 1BD2D 2WLJA 3WNKA 4H25B 4PS7A 3CSTA 3GSWA 5FJRA 4LQ1A 4AQEB 2EKSA 4X7EC 3TBVA 3UZXA 1JZGA 3FH7A 1ECZA 2VXUL 1FWRA 5JIMA 3WUZA 5C7XL 4R33A 4AY7A 5A2BA 3W7LA 1SLWA 3TPKA 3ZMEA 2VVNA 1H0DB 1YNTA 3VCLB 1B31A 4I9MA 3DX4A 1TQCB 3Q67A 4UTFA 3IN2A 4B7IA 4OZIE 3M07A 4MCZB 3CSYB 3K8LA 4OVXA 2HTKC 3MMWA 1DWJM 2X1IA 2BFVH 4PJHE 5IB4A 3F58L 1B54A 1T0MB 3V6ZB 4F4RA 3QJRB 5A94A 2PU1A 5F3FA 4A38A 4U6YB 2EINB 4FTVA 1GIGH 3S3DB 2C9VA 3WNNA 3IPWA 1I8UA 4NQCE 4N85A 3TYUA 3FQNA 2C9PA 4WRHA 2FDBP 1IAIH 3ME3A 4DBDA 3GS0A 3P73B 3NQAA 2DAVA 3ZO0A 4DJDC 4JY5H 4L1TA 3L9EA 4Q97A 2QR6A 2FPTA 4WTXA 2WTPA 3PB0A 3IK2A 3OB8A 1JPST 4OFIA 4QJ3B 1SJDA 5FHAH 1T99A 3PWPD 3R06B 3LKQB 4MQXD 2Y5QA 5CUSH 4L8SB 4K8HA 5D2LB 3IWVA 1E6NA 1XG4A 2E6JA 4HPHA 4G1MB 2N56A 1DQLL 2IJ0C 4HQQH 1T0OA 3ZRCC 5J1AA 3UC0L 5BCAA 3O6LH 2H0JA 1GZJA 3G22A 1EJ8A 5DEGA 2CAKA 3MLVH 3FT9A 3FTVA 3CMOH 2BOFX 2D03H 3EKCA 1JVKA 1NEPA 3JVFC 2ANUA 4ZBJA 1Z3RA 1IC0A 2GHWB 1QFPA 3WJXA 3B9OA 3EGDB 2PXYC 4P49A 1LL4A 4BFAA 2UY6B 3C0JA 1XL6A 3IDJB 4HJWA 1OZQA 4A8NA 4MOZA 2CDGA 4G70B 4XTRC 3LEXB 1BGXH 5B1CA 5FYJH 3RY5A 1HNYA 1T4WA 1PHQA 4GBDA 1YMHA 2VZSA 2ZZUT 5D93C 2X4UB 1SGKA 5I2IB 3GUTB 5FO8A 5IW1A 1BXXA 2A0LD 3KPMB 4NPKA 4UT9H 5IY5B 4BK4A 2CO6A 1WC7B 1OAZH 5ABAA 4BEUA 2R29A 1BQKA 4TOQA 4Q56A 3SRKA 1UT9A 1P7TA 3TIEB 3MRFB 1NGQH 1FNEA 4ONGH 3TA6A 4ORGB 4Z3EA 3KRZA 1BBJA 3AQZA 4AD1A 1OTSD 3KJ6L 4IFRA 2ZD0A 2HKFH 3USBA 1WFJA 4DP0X 5TDPA 1FSKC 1UM4L 3M0JA 3PNWB 2IPWA 3Q37A 2WZEA 1HL5A 3N91A 3SECA 3L2IA 1FWAC 4UIMA 4GXVL 1GW0A 5I8CA 1AC6A 1FFPA 3ZKMC 3NQ2A 1ZJHA 4CW1B 2HE8A 5HD8C 1X1OA 5FECA 1GTFA 4PG2C 3U2CA 2AAVA 4BUGA 2WWDA 1ADOA 2NXGA 2J1KA 3GBLA 4PP1D 4QRUB 4H40A 2BOCB 4YXHL 4E4PA 3HJZA 2JLLA 2APBA 4HMDA 2HX7A 3WFDL 1SYVB 4FJ6A 3QHTC 3EA3A 4L1WA 5C0CD 2GLKA 3OG6B 3MOQA 1NP2A 3HB9A 3DURA 2PYEE 1CB2A 3LX9A 2NY5L 4KTEL 4FA8A 3F01A 3D0AA 1P6AB 1J8HE 1TFPA 1XGRA 3MTXA 1UCTA 1HYRC 1BJ1H 3FOMB 2CLZA 4JIEA 2C4FT 2Y7OA 4DM1A 2ITEA 2EPKX 3D85D 3CFUA 1GW1A 5L7XH 2A6IA 2WKLA 2ZUQB 4Y16A 1SLXA 3GK8L 3O4LD 1F6LL 3NURA 2CR0A 5MHSE 1CG9B 1OL0A 1C08A 2I60L 2OSLB 3GVVA 3N14A 4X4XB 4Y5VA 5J1TC 4EAYA 3WLJA 2XZCH 2IBBA 3HR5A 4L29A 4ZTPH 3CDZB 1L4IA 3O6DA 4Y5VC 2IH3B 4N2CA 3BG5A 1YPFA 4WWPA 3CXHK 3GWJA 4E2BA 1KJMB 3V9EA 3B06A 3PPFA 2XSAA 1KIQB 3FUNA 4I90A 4G7YH 1KWKA 1T7LA 5FDWB 3TEVA 3VSVA 4JRYA 1OPGL 1XF2A 3FAWA 4JFEB 3EB4A 3RDTC 4EUPA 4MKTA 2EPHA 3BLFA 1U8PA 4LY8A 1WAUA 3K2IA 4TMPA 1MCOL 1VGEH 1QXLA 4JDBA 4PUKA 5JDSB 3KYNA 3RU6A 3QEQA 2XX0A 1TKKA 2OMYA 4QE5A 3O9WC 3II2A 3UTQA 1ZBWA 8PAZA 2YBVA 2FZ9A 1LK2B 5M2FX 4YDVB 2DDQL 2EEXA 1H1NA 1T66C 3AG3B 2Z4QA 5LJYH 3PBGA 1JWUB 3VWKD 2XQBL 2CKBL 3MJ6A 4C4UA 4TSCH 5DRWA 4QNPE 3CUIA 2H1PH 4OJFL 4L56A 2J3SA 5IG7B 1F11A 4DEUA 1EJVC 4M5YH 3YPIA 3QCVL 4BELD 3THMH 3PAYA 2R4RL 1X5GA 3QC3A 3EOYG 3WLMA 4P8UA 3MA9H 4PUMA 1JF5A 3ZL4L 3FPXA 2Q02A 1ORQB 4DJEA 2OYMA 4EIZC 4L05A 2YGPA 5CSSA 3U2ZA 5TDNB 1BYNA 1KELH 1L9TA 2WAGA 1KV8A 3DK2A 2KUTA 4HNVA 4DJEC 2AFNA 4BQCA 3PIQA 1KFEA 2HVNA 1BX2A 3R13A 3AWGA 3LKSA 1CLKA 3FRUB 4ZFCA 3LENA 4EPKA 4JFHD 4PAZA 4WVRA 1L8PA 4U1IA 5JLZA 4GJJA 3NN8A 1RCOB 3ARDB 1E4IA 1L0PA 4FYQA 3C61A 2VQUA 3JUZA 2X1PA 2OR7A 4GAJH 3H2NA 2X89A 3EYFA 1XRSA 4ODWB 3A6BH 1S8DA 1XKJA 4FI6A 4NIRA 1YBQB 5F6HJ 4J4PC 4F1ZA 5IJDC 3GU1A 15C8H 4N20A 1U8KA 1M68A 4NQTA 2OTDA 3HG1E 3MJ8A 4I3SH 1XDLA 4A2LA 4CSZA 3HG0A 2RGMA 1FHVA 2FVMA 1XIIA 2XUCA 1O5PA 4Q6IB 3D9AL 1FH5H 3F7PC 1HAUA 3LQLA 3E3QC 5EMJA 4RL3A 4XP6H 1KB5B 3P4OA 4W4OA 3LV3A 4LCIL 3GPSA 1WFNA 2KQNA 2WBJD 5ISZD 1UJ3C 3FB7A 3ANVA 2GQAA 4RFOH 1UUOA 2I9LB 3U5UA 1UPMB 1JPTL 5DO2D 3AUWB 4PBEA 1NLDH 1MLCB 3NPUA 4A2GA 3ZYIA 4RE3A 3ZDYF 1NTHA 3WK3A 4P4KD 2AQRA 5CSYA 2CHNA 2AKZA 3H70A 4FP8H 3V0FA 2EF9A 4MAYD 2FT7A 2OKMA 1OABA 3H7VA 1IKFL 4ZMGA 3D4GA 4BSVB 3C8NA 4JM2D 5DHVH 1LNUA 4JLRA 3SGKC 4UINL 2AQ2A 4P04A 2FK9A 3CN4A 3ESMA 1G7MB 4IMKC 1WXJA 1DWAM 4AUJA 2VXQA 1JZ2A 3S4SA 1PXGA 4BINA 4PGEB 1IILE 4H8WH 2V5SA 3Q0HA 3VH8A 3L95A 3L9YA 4PRPA 2IWFA 2BX7A 4PCFA 3UWZA 4AZHA 3ES7A 2OI9B 2WC4A 4MYWB 3ARSA 2YPIA 1P5UC 4EIBA 3K6SB 3CYVA 3G2GA 2DJXA 2SEBA 2VM4A 4JFDD 3C09C 1U6AH 3ARBB 3KCOA 1AS6A 3KVPA 4QGTA 1Q6DA 4FLHA 4XOAA 3IVKA 4HOMA 3MUUA 2R1MA 4X5WB 2QZRA 4HJJL 4Y19A 1V54B 2DQCL 3U4EA 4GKLA 2XJLA 4PJGF 5K9QI 3O6AA 1V02E 1TTFA 2AK4B 4M5ZH 1VBUA 2DWSA 3RL1B 3THQA 4CVXB 2OZ4A 5I19H 1VFLA 1BFSA 1M01A 4LF3B 4B9GA 4E5XA 3D18A 4X0NA 1C8XA 1GIGL 2C4XA 1DJSA 5TE6H 3WLWD 5FYLL 1CGWA 2NXYB 4IMFA 2FTYA 3CQQA 3TYGH 3S8HA 2YBUA 4G8GB 3UG5A 3GHEH 1GOHA 1SUJA 1YY9C 1JFHA 4HCRA 4BXSV 4JY5L 4UM9B 3GRWH 1CFQB 3S37X 2FTPA 3QH3B 4GXUM 1CIDA 2IBZX 4IBVA 1W72B 3PP3H 4GEIA 4G2DA 4WUKL 5FOBA 2X7VA 3C5XA 2V82A 2YS4A 1GHFL 4XCEB 4OR1A 4KTGA 4IOFD 5C08B 2A2QT 2AXJA 4XWOD 1MFUA 4WHTB 1UWQA 3PHAA 1DYSA 4NQCD 5CNHA 4HQQL 4C6KA 3TA3C 3AG4B 3SJVA 2QW5A 3LBCA 3CSGA 3ZW3A 2RDWA 1JL8A 1RIUH 1J93A 4ZW7A 3MLVL 1I2PA 3E2QA 3ZXWA 2D03L 1XP3A 1KZQA 3QHFH 3QB7C 4KK6C 1XLKA 1BQHG 3K2MC 2BOLA 4XBEH 1T1YB 3TS8A 3VFGH 3QZPA 2J62A 2I7OA 3DN5A 4LPWA 2IGTA 5HVHC 1TQXA 3JUYA 1VCBC 2DVTA 2D2HA 1JXKA 3C2RA 1NGWB 4YR6B 3AWNA 1U8IB 1JUKA 4J5VA 3HFFA 3STCA 5D2VA 3ROOA 4LDCA 5C97A 5FYJL 1TQTA 1XGUB 4MQSB 1FQ0A 2BVDA 1R3YA 3MU3A 4HMNA 5ESAA 3G0XA 1OVDA 3OKEA 3R4IA 2XFYA 2EYSA 2K4WA 1UUMA 5EBLB 4YYCA 3GHBH 4UT9L 5I6NA 2IPFA 3FJNA 4PCKA 1RCYA 2YBRB 4TXEA 4HOZA 1CDGA 1UM6L 3KM1A 2XYLA 2JQAA 1TJMA 3H2PA 4MJ5A 1IE5A 5D1XC 1D5MB 4LRIC 2Z1WA 1XIJA 2XY1A 2BIMA 4N1HB 1XGTA 1DJWA 3B2UC 5AECA 4QR7A 2HKFL 1VGAA 1M9WA 3E0IA 4PUDA 4HLEA 4WHBA 4FXJA 1DEDA 3EEZA 4MB4A 2Z27A 3QQDB 3DGCR 1K85A 4HS6A 4AWSA 4JIHA 3OZOA 3K1DA 1QOXA 3BVVA 4HETA 1I3RB 1SZRA 1PWLA 3BUQA 2YN3A 3NSCA 1O5RA 1FGVH 2XBDA 3JWOH 4PJIE 3C5ZB 4W89A 1C92A 2NV1A 2X7LB 3CFBA 4PJXB 4NBZB 3AS1A 1E2WA 4PL1A 3N55A 1X5AA 3BLPX 1LE9B 1SFHA 1NCJA 3DIFB 1LYQA 1AJ2A 3WG7B 1JFXA 3VNIA 3QUKA 4NT6A 3MZGB 1KV5A 3KD4A 3DRQB 2F0CA 3MNVA 5JNYB 3CZ8A 4OM0H 3ANUA 4PQXA 2BHFA 4JAMA 2FIKB 1VYSX 1LL1A 2ADJA 3ALWA 3QZ6A 1OCQA 2W5PA 4G7EA 2VENA 2RFXB 5CIPH 4NT0A 4CN4A 3HC0B 2F6AA 3G08A 5BOZG 3CWOX 1PDZA 3PWPB 1QLRB 3M7FB 3ES6A 3JWDL 3GC4A 5ERWB 3W6YA 4TX6A 1AQKH 1RA5A 3DOIA 5E94A 1E1EA 3WF2A 4R97C 2YUWA 1MNUH 4DYJA 4X22A 3T0CA 3GLAA 2XZCL 2NT1A 3H85A 4NRZB 3CAVA 3SZKC 4ZTPL 3QZLA 1IAOB 4DO7A 1J8HD 2NW2A 4U1LA 3GNPA 4WTQA 2DVUA 1EQWA 5HJ3B 5IR1A 2O5YH 3D69B 4D9QE 3QORA 2BCKB 4O19A 4CMHB 3E3QE 1QHQA 2VC2H 5EO1A 3BH9B 2FDSA 3SGJC 5GS1B 3RG6A 1XIWC 4JKNA 3L4WA 1WQVT 4KX7A 1ZLDA 3VD3A 1DQJB 4NKDA 1TJHH 4GRLC 4Q4PA 2Q3OA 4ZW3A 3FXIC 5KS9E 1VGEL 5LO7A 3GIQA 4PCNA 4RGMB 1E1CB 1W1YA 2A3BA 3QYCA 5HHOB 1V27A 3O0RH 4IHOB 1GPOL 4K36A 1XYCA 1MXDA 1ZIAA 2WWMC 4Q9RL 4CBPA 3RURA 5C2UB 3RLGA 3CHDA 3GMPA 3IDIA 5CZTA 4ZQRA 1E6PA 5CJNA 1J5IA 5HDRA 5DZ9A 4QRRE 2AQQA 5E6ID 4O51A 2VGLM 5CZXC 2H1PL 1NCAH 4Z1CA 1XIGA 3QY6A 5C3TA 3GKZA 3MROB 1LLOA 2KZKA 3IUDA 4G6CA 4TSAH 5JPMB 3RJXA 4R4NC 5IQ7H 1MZHA 1IQWL 4PJ7A 5GJSH 3THML 4AZGA 5D6DC 3VKDA 2Q3XA 4JHVA 3IAPA 5BOEA 1SFDA 2WO3B 4JN8A 2EDDA 3MBXH 4PB0H 4YK4C 3FUIA 2NVCA 5BXFB 1RUSA 1D6VL 4XQ6A 4HPYL 2I5IA 4PLJD 2F54E 2Y63A 2J4WH 4RJEA 4I7ZC 1GC1L 1A4JB 1E0UA 2IANA 4F15C 1SY6H 3D25A 2F7FA 1VFOA 1PG7H 1M5WA 3DX5A 1DQKA 1I4NA 2LOEA 4XNZC 5CU9A 1BPVA 5I3HA 5G2WA 2F5BH 4QHRA 2VLKA 3MRIB 1DEEA 1PV8A 3B3DA 4A7QA 3CZJA 2JF1A 5EZJA 2CLMA 2G37A 3TEXA 1KM4A 3AT9A 1K4CB 3HCVA 2A4EA 1I3UA 4PTTA 3B3BA 5JOPE 3RVTC 3DGRA 1QQDA 2VDGA 4TKWA 2JGYA 2J7FA 5C0CB 2I26N 4I3SL 5AW4B 2HTKD 4UTAA 2IDUA 1MY5A 2WPGA 4AVNA 1YDOA 4H6KA 5I1JH 1UB5A 3BGMA 3RN6A 4I3RH 1UWFA 4GLRI 5G5DA 1Z9AA 1NBQA 6PCYA 4CAGA 2PP1A 1OX6A 3MJ7B 3AO0A 2OTWB 4FB7A 4XTIA 4WK0B 1WAAA 3L8QA 1I7ZB 5PAZA 4R26H 4K2SA 3U30C 1EO8L 2AQPA 2GUYA 3EOBB 8XIMA 4ZK8A 4UTLA 4PRRA 1U3YA 3HG1D 4TYUA 1EHLH 2C5DC 3W7OA 4MNQA 1G7LB 2HKHH 3G1RA 3BLOA 3D3VB 4DJDD 1CUOA 4P5SA 4FNLH 4J3XA 1NFAA 3LN3A 4ONOA 3ORWA 1VERA 1X8FA 5CLYA 4FP8L 1K8CA 4AE0A 4UTBA 3SGEH 2GUBA 3DC8A 3MCG1 1NCNA 1XSIA 1HKMA 2AK1L 3DUSB 3VE0A 3EJUA 4L1BA 1BG9A 4XZUA 3VIOA 2QTVA 3MNWB 3HPJA 4JY6B 2I7GA 3ARGC 3L48A 4RXFA 3SCQA 3TBWB 4OJYA 4WJ5A 3TYFA 3LEVH 4NNBA 1PKQA 3IN0A 4PS4H 3ME0A 2VEKA 4H8WL 4HWBH 3KPQA 4NN7B 5GS2D 4JX0A 2WQSA 5EIIB 3L0NA 1BD2E 4IWWA 3FONA 1HVXA 1NAMB 5JO5A 5HHQB 1I53A 2PXYD 3KPSA 2I5YH 4RDYA 2R1WB 4W9LC 1RJZB 3NYZA 4H8HA 3VWKB 3L7FA 4G56A 3PZ9A 3MWCA 3KOXA 2GFBB 4XTRD 1TE1A 4YL9A 1OGTB 3IWUA 3U5YA 3R1GL 1IGFH 1MXGA 1JZJA 3TH4T 3L9RA 5D1XE 4M5ZL 3W22A 5G55A 4AENB 4KNSA 3HURA 4DX3A 4Z7AA 5I19L 3L4VA 5KUKA 1KV3A 5A2IH 3UERA 4KKAC 3M5XA 4ZFZA 1NCDL 5DXXA 4DZ8B 4PJ9A 3NAAH 2BC4A 3GINA 4B9JA 1FCQA 3TYGL 3OMAB 2CRYA 3LSOA 3GHEL 5CSBA 3V0HA 4FCAA 3BSHA 5KN5B 2E74C 1NUDA 3V5HA 2D0HA 5EZPA 5EEYA 4R5EA 4DW2H 1N2RB 1K9DA 3UXFA 5JH2A 1FHDA 3E2SA 3H0TB 2PR4H 4RFEA 1NFDB 4HHWA 4HZMA 1E6JH 2R56H 4URIA 3QC0A 1Q2SA 1UT2A 3FSZA 3QDGE 4AQ8C 2NW3A 3ZS4A 5B3NA 3TX4A 5HY9A 3HI5L 5BRQA 4GH1A 4ZW6A 1DVZA 1E73M 1BEYH 1TZ8A 1KO0A 2NUYA 4LF1A 1H7WA 1QZ1A 3ZKMD 3RGVA 4JDVB 2XH2A 4FR1A 1F13A 4PL2A 1UC5A 1RIUL 5HD8D 3M7WA 2EUZA 5J1SC 2Z28A 1DQIA 2BIOA 5F7NC 3QHFL 2QJJA 3NCCB 1PX3A 1OF0A 2INZA 1D5BA 2ZXCA 4DAGL 1TEGA 5GRUH 1T03L 4Z7UA 2DMBA 1AKJB 3MV8E 2CO3A 3IDGA 3WQPA 3MLXH 2W0FA 4TQIA 1GPWA 2WBJB 1HHIB 5A3IC 2GSGA 3K72A 1GAFH 3WH5A 5DS8B 5ICYA 1WCBA 1EJRC 5MEOB 3TEZA 1PJWA 4JTJA 4ZO7A 3S96B 1QBMH 3CLEL 4AB4A 1BTCA 1QTSA 4R34A 5H94A 1TPWA 2Y5JA 4AIXA 2YR1A 2H6PA 2GTZB 1CYWA 3LN9A 2W9LA 4N0YL 4KO7A 3A9BA 1RZ8B 4PBFA 2ILLA 3PV6B 2PF6A 4MAYB 3OKYA 3TQ0A 1PL9A 5KYNA 3TT3L 1W5MA 1X98A 3GHBL 3QMSA 3AYTA 2BODX 5GIRB 4MFEA 4W8BA 3GEWB 1OK4A 3WQ5A 2QVTA 1SYSA 1J88A 2WXPA 3BKJH 2PLCA 4N87A 3TT1H 4MMYA 3WNOA 2X0WA 2R6OA 2Z93A 3VQLA 1EZWA 4YFLF 2AXFA 3NEXA 4ETYA 3ZT5A 3WEXB 3O6FC 4N90E 1POJA 3ZLHA 1THCA 1QHPA 1QJWA 3A9IA 3N42B 3SPVB 3RNKB 1KTBA 3QXVA 3QJXA 4RIRA 4N1CA 3EXSA 4WTZA 3RDTD 3EAKA 4P3DB 4ZFGL 1GZ1A 3CFMA 5KEZA 1TUFA 2GEEA 5E99L 3QQ3A 1FGVL 1TZAA 3JWOL 1H2JA 3V5FA 4IEFB 3O9WD 4N9CA 5GSRA 3IDNB 4JCWA 1XR9A 2BB0A 4L0ZA 3I85A 2TYSA 1T66D 4HKXB 4EDXA 3DUGA 1XGPB 3L5WB 4LV4A 1GVOA 4H7CA 5IOPA 2DY3A 3KPOB 4DQOL 4IUGA 4HWZB 2OMXB 2G3ZA 1MWAB 2NY6C 2YB1A 1JNHB 1MI5E 2ZSWB 1DE6A 1KEML 3A4DA 4PJHB 5F0LB 4K7VA 3SSZA 2IUZA 4XNYL 3IKCB 5REQB 3MSYA 4V2BA 3WI9A 5JBFA 5ALCH 4ZQOA 1IEQA 5EULV 1TMHA 3MHGA 1A8ZA 5L8KB 4W9EC 3VQ1C 1L6PA 3L3GA 1U8QB 3LHWA 4QRSA 4AMCA 1N26A 4ENZA 4IJTA 2CZ5A 4WUUA 4W5ZA 3UL4A 5HPMA 4XSMA 3V4BA 4GI6A 1VF5C 3I2CH 2P50A 3PB2A 2W0LA 4DJED 2PTYA 1ZAJA 2FKPA 1NDMA 1Q8JA 2FSEB 3GSNA 1R38A 2O5ZH 3L3DA 5AC8A 4M0XA 2WLNA 1VHNA 3ILPB 4Y5YA 4OZ4B 4UM8B 1MMFA 5HWJA 3QIWB 1GW9A 1VCVA 1LP9A 3DOSB 2HSAA 3GE7A 4NQ1A 4Z1PA 4OZFB 2DQIH 2CIIA 3LHAA 4KFZC 3ULUE 4YHOH 3PUDA 5A8NA 4DIXA 4J4PD 5C07D 5JPNB 5CBAB 4BH7A 3TTYA 4H13C 5KSAA 3SPHA 2W8CA 1TJHL 1CFSA 3IAGC 1RUKH 3V0WL 5E8PB 3BV7A 2DPEA 3T05A 3II3A 3EYSH 4PODA 4RX4D 2O92A 1G7HB 2G2RB 4POCA 5KMYA 3R4RA 4ROQA 1CYXA 4JRXE 4D9QD 3UIYA 4P2OB 5IOBA 1EEUA 5J0BA 4WDIA 3BISA 3AMLA 1XT5A 2R1PA 2WLIA 5BJTA 1VACB 3AM8A 4W5UA 3VNZA 3KOWA 4XZLX 2YEVB 2V9TA 1O94A 1FWJC 1VRDA 3SCMA 1NCAL 4GVHA 2QADB 4UIOA 4ZG1A 1ASQA 2LU4A 5AW5B 3SR7A 4GG6E 4TSAL 1O66A 3H22A 2E28A 4X9FA 5GJSL 1T89A 3WMBA 2D9QB 4ZPVA 4NQQA 1CTMA 4YPGA 3EGJA 4HCLA 2L5HA 1ZJAA 2BPBA 3MBXL 5HHME 4FR6A 1YDNA 3QEZA 1E4WH 4QOKA 3X1GA 2DM4A 2WVVA 2YCKX 3IF1A 4QRRD 2Z7GA 1WITA 4GFTB 2B0MA 2F53A 1TT6A 3QXAB 5CN3A 4BK5A 3PP7A 1SY6L 2BS8A 1J0KA 1FV1A 4WWNA 2C1PB 5GNYA 4QEEA 3WUBA 2VOTA 4HEPA 3RR1A 3SDDB 1BLIA 5H37G 1OBAA 1UC6A 3LPOA 4AIZB 4XE0A 4FADA 4HSHA 3RITA 4R90H 1QLEL 5D2NA 4LUTB 4YE0A 4YGVB 1EEZA 3CDGA 3N3MA 4KVCH 2NNCA 4PJDE 3P4MB 2EZ0C 4ZOBA 1JZ5A 4FX6M 4G59C 4E0CA 1DQWA 3MS8A 1YPZB 2JE8A 2F54D 5FYKD 4HHLA 2R59A 5K9JH 2I1OA 2DU2A 2I9TB 2CO4A 1FVCB 4NN6B 3D3AA 3T44A 5IB5B 3DERA 3UBXB 2F6XA 2IADA 4AJWA 1GPFA 3DBXA 2R0KH 4NKMB 1GXEA 4WKZA 1NMCC 2HPMA 4PJCA 4JTLA 3G1XA 4FQJL 1NIDA 3HGJA 1JK8B 4ANWA 5I79A 4R26L 3FOLB 2E47A 3JZYA 1D3HA 1WYIA 3U9WA 3KS5A 5C6PB 3QKZA 5KZDA 1ETB1 2JB6B 3CCHB 3QFJA 3TZVC 5FW6A 3UMTA 4WW2F 5A6KA 1N0LA 3MFFB 1MQPA 2PYEB 1YY9D 1JNDA 2YKKA 5I82A 3M7OA 1HJWA 4R3SA 1QBLH 5ISZE 3BFQG 1IEAA 5F1IB 3UTOA 4X8CA 3CV7A 2HJKA 1G4RA 1GGYA 1KENL 3FRPG 3LGDA 4L5ZA 4F33B 1VPQA 2C3GA 1A7OH 4OB5H 5B3JF 3IMBA 3VFTB 2YD8A 2CALA 3QR2A 4UFLA 4J2XA 4GG9A 4GAFB 3CBWA 3TA3D 4EZLA 1OG6A 3LKNA 4B6ZA 1JAKA 4LHJB 4OLUH 3FT1A 1MDLA 2V5MA 2XJ7A 3LEVL 1YAZA 4OLXH 4LUYA 3ECVA 3ARUA 1BVKA 3LS4H 4I48B 4PJBB 1XX9C 3ZUNC 5CJMA 1YEFH 1MCSA 1KY6A 4KK6D 1DVFA 4LTSA 1MCRA 4A7GA 1TTAA 1D6EA 4LPUA 4IL0A 4WI5A 3KLAA 1S2TA 4FYRA 2J56A 1X9RA 1BXNA 1RZJC 2I5YL 4DPAX 5F2FA 4FFYL 3S2JA 4BQ4A 2MJWA 4X6EA 1IL1A 1EYWA 2D23A 1KQYA 1RPKA 3Q8BA 1U2CA 4ZMOA 2KHAA 2V17H 4P8QA 4KV5E 2WBKA 3IGUA 4IGBA 3FTWA 4LAUA 5GGUB 1FHGA 2OZ0A 4Q8TA 2F08A 2VITA 2F9BT 4JFWA 3MR9B 3GMLB 1P6CA 3QWOA 1AW2A 5BMXA 3AZRA 1P4CA 1I9IH 2A3AA 3LN5A 3LTSA 4Q6YA 3VI2A 4HIEB 3DI3B 4JL1A 3MRCA 4NM4H 3WJZA 2O72A 4YLBA 3VZXA 1AIFA 4YSRA 1CXFA 4GC4A 3Q2WA 4XBJA 4J23A 5DJ0A 3WF0A 4MA1C 3BPNB 4YSSA 2AVGA 2I57A 4PBWD 3ZZLA 3W00A 3LH2H 1SOKA 2J7DA 5D1XD 4EQ2A 2Q8XA 1ZTVA 1TO3A 2J1XA 3B2UD 4NJ9L 1KRCC 1KFCA 5FKAA 1E6JL 2DRUA 2R56L 4LFYA 4QI3A 1HZKA 3QLLA 5FA4B 4Z08A 1E4HA 2CDEB 1K02A 1LQSR 3GIZH 5E2VH 3C8DA 2PTTA 1AJ7H 1PWMA 3EOLA 3RA7H 5AB2A 3SUUA 1O1ZA 1XG3A 4RK8A 1ZHBB 4PV8A 1NFDF 1LDPH 4V33A 5CEYB 1KLGA 3BGFB 4TNFA 4HUVA 1BEYL 1MF2H 3JU2A 4CEXC 3BWUC 1V0LA 2W65A 3DUHA 1AXIB 1NQ6A 4KEZA 2HWGA 1IYXA 5T91A 1VZIA 3U1SH 2HVKA 3TIDA 1KB3A 2J8UF 1D2KA 4NNYB 3STLA 1ILUA 3Q43A 1QACA 3MWAA 3C2YA 2APWA 4TNWF 3QDGD 3CXDH 4WI0A 5JXAH 3VJ6A 3MLXL 3UWVA 4I7UA 5CGYC 2FO4B 1R17A 1GAFL 3LZFH 2XKNA 3FVDA 2VGIA 5E7FA 1A7NH 3WSUA 1LEGB 2VWTA 3TQPA 1N59A 1F90L 4C91A 1QBML 1T7VA 1K8IB 4HUUA 1CK0H 2DKUA 3TYEA 5B1AB 1GY1A 3CNYA 3DGGB 4X6CF 2CKBA 1UWRA 3UA3A 5FA3B 4F27A 1SU5A 1J10A 4J3VA 5BRZA 4GLEA 3L3OB 2YC1B 1Q0YL 3MV8D 3H21A 4MA3A 1RK1B 4FLSA 3EX2A 4NO5B 1KDJA 4PCPA 4XAWL 4B5EA 5FUCC 3WEZA 4YNYB 2YMXH 2YXVA 4QCIB 3B2PA 5KWYC 3W7NA 1PX8A 5H2BB 3QSKB 3TFXA 4ERAA 4D9RD 3GXUB 1QNQA 4H88L 3U79A 1RK5A 4LVOC 5DI8B 3TROA 2VL5A 3TT1L 1FVPA 3FHQA 1IARB 1AGEB 5LDUA 2P80D 3CQ0A 4R96B 5F96H 4Z42C 3A21A 4TUJB 1J05B 1LP6A 1L7IH 3HBPA 4L3FA 1UH2A 1XIWD 2V6AA 3W2DH 4MDPA 2RAGA 2X1SA 2QHRH 2WBWB 3CN1A 5I1LA 5AVVB 5T1LA 3O41A 4GRLD 4EF3A 4KGJA 4PJ6A 4H8UA 4ML9A 5HHPB 1PHWA 4U10A 4DO4A 3N42F 4JY4B 3IGKA 4NYUA 3FB5A 1JV2A 3IJEA 3FT2B 2FH8A 2WWMD 1F5ZA 1OF2A 3MSRA 4NXSA 1F3EA 1E8ZA 5LWYL 2AJZA 2EE0A 4PJEB 2ALRA 4N90D 1KFGA 3EWUA 1S5NA 1FL3B 2DUZA 5F7DB 5AL8A 1U4FA 4MZ2A 1U58A 3PTMA 1UIPA 2YAQA 1QK0A 2V81A 3KS0H 4B0MM 2D3JA 3LQGA 5CZXD 3DX6A 3D0CA 2CCLA 5JR1H 2Q7YA 1XWYA 4R4ND 1ECYA 1A7RH 5ALCL 3G1FA 4Z95H 3VXPB 4H7VA 1NBYA 4H4NA 1AD0A 1FSKB 5DRCA 3O45B 1PDKA 2D1ZA 3W26A 1RK6A 5DRZB 3THCA 2GITA 4LKCA 2FJHA 1IXNA 2XWZA 1XZ0B 1B0RB 1LZOA 4MBRA 2JKTM 3G04A 3GRGA 1MI5D 4FL4B 2WTRA 3ARYA 4UWQB 4IX0A 1YNLH 4FOUA 5E8EA 4IQDA 3WXWH 4P59H 2DZBA 3QEGL 5AW8B 4CEUC 1FP9A 3QR3A 3FTGB 5TQ0L 1MHEB 4CU7A 2VE6A 3NZ1A 2DQIL 1OFEA 1LEKB 3NOIA 2NY2C 2YCJA 3RVTD 5T33L 2AV1B 1EGMA 5FGCB 4JHUA 3D8MA 3B7TA 3VRJB 3X1EA 1WICA 4FYSA 1JPMA 4FQXA 4US5D 4HHAB 2ZXDA 2K4AA 2OKOA 3CQHA 2VMCA 4G11A 4AZ5A 2Q3RA 2PUQT 3KXFE 4UNKA 4IP5A 1PD6A 4B9KC 3ZQ9A 3NGBC 4X7CC 2LE9A 5D2WA 2MFNA 5CG7A 3ZTEA 3USZA 3PFRA 2J20A 1AYRA 3MGTB 4Y16C 4JTRA 4OLVH 1BFVL 2B9AA 5BVPL 4F5CE 3A6CL 3RCNA 4HCDA 4F8NA 3ULUD 2VFIA 2WSQA 1XYAA 4LPTA 3RL2A 3QHZH 3LZ5A 2YXXA 3MUJA 4P7LA 3AWEA 3MMEB 5DVKA 2O61B 2GC4C 1W8NA 4DBSA 4QKXB 4C6DA 1XL4A 3C8KB 1UWYA 3DRTA 1RZ7H 5HJYA 4ADIA 4MCMA 4GAGH 4JRXD 1YYLH 3TQVA 4AZBA 4W93A 1SNRA 4PMVA 4FJZA 4H1LB 4GACA 1FG2B 2ED8A 3WY4A 4LSQL 4J5NA 3NSMA 4CNUA 3SM0A 1R3HA 4G8TA 1BQ5A 2EO1A 2VLLA 3BP7B 1IM3B 2NUXA 3ARGD 4O12A 2E27H 3UXLA 1EUNA 2OA9A 2C71A 1J6OA 5SWSE 3W1NA 1VFTA 4XCNB 3JQOB 3IGAB 3N1QC 1RHHA 3FL7A 3FSVA 4ACYA 3P9LA 1VDGA 1UB6B 4LVEA 2Y88A 4R90L 3W82A 2Y2YA 2FZDA 2D3LA 2A4AA 1KR1A 4MJ6B 5HHMD 1O6SA 1UZGA 3V6OA 3I3DA 4KVCL 1FWBC 3GJFA 1XV8A 2HPOA 4BS0A 4JQ3A 4AEFA 3U2JA 4K5PA 2B1OA 1VEMA 3ESOA 1U4EA 4R7VA 5K9JL 5KVFH 1LWRA 3OU8A 4QYOB 4OT1H 5HNTA 1XYMA 3EEGA 2Z0UA 1S9YA 4PMYA 4L8DA 2Q2LA 4U1SA 3CUHA 3VU1A 2R0KL 4P9MH 1YPZF 5DGQA 4KHXL 2OK0L 4WF7A 3VGHA 2VN4A 4OFYD 4HDIA 3RILA 1KLYA 2PLKA 1GGCH 1KPUB 1TEFA 3WOVA 2RACA 1S7XA 5FOJA 1DQML 4YLCA 3UGVA 5DRIA 4KKAD 1IEWA 3OBAA 4IG2B 3VNJA 5KSWA 3U82B 3WMLA 4OF0A 1S7TB 3L5XH 3Q6FB 5IEHA 3FN9A 5TGBA 1VS1A 2B14A 2W07B 4TV6A 1DVUA 2ZYSA 4FFVC 1Y6NR 1F6KA 1QBLL 3VFPB 4FTVE 1JZHA 3RCYA 2DZPA 1JNLH 1YSOA 1SN2A 2R1YB 3FYPA 1A7OL 4QIRA 4OB5L 5D71L 4JG1L 1F4WH 1ZJBA 5I66B 1T4KA 2AQSA 2LLGA 5CSZA 2LU7A 1B2WH 3QUZA 2WMIA 1H3WM 1MVFA 4M3JA 1DUYB 4FTDA 1T7WA 4OLXL 2CKRA 2DQGL 5EMMA 1AOHA 5B39B 3LS4L 1UURA 5DUBB 3MKKA 1YLBB 4W4OC 4N1EA 1YEFL 3R11A 4L23A 4LV9A 1SMAA 4MAVA 4OI8A 2QAFA 4XD5A 3NABH 4QLLA 2DWXA 4LEQA 2Y06H 3WLOA 1TTBA 4PJBF 4DZIA 1C5BL 4L9YA 1WAPA 1IX2A 3AMCA 5A3ID 3OWRA 2QJMA 2X0YA 1R9XA 4N2DA 2OXHB 5I0DA 4Z0BL 3TGXA 3FCTB 4DT2A 2DSZA 3VQMA 3LHPH 2P7TA 3V7AG 1UH4A 4PRNA 3S46A 4KH2A 3UJJH 3SCRA 4HC1H 1JXGA 3U7YH 2ORBH 1K9EA 5DMGC 4NM4L 1HL2A 3UJEA 1QOQA 3VDBA 4HN4A 4HIHA 4B3VA 4OH2A 5A2FA 3LKRB 1RFDH 1MHCA 4FXRA 5C5YA 4O11A 5CEZE 3LKPB 4QRRB 4PR5B 2PRLA 4JO4H 3APDA 4PH8A 1CGTA 1A4BA 4GW4B 2P1YA 3K4WA 4WU5B 3D07A 4XNMA 3IXAA 3EMQA 2QKSA 4O2EB 3QG7H 2DH3A 3TFKC 3SPIA 3VINA 5I5MA 5FJIA 4BKTC 4A66A 2ZXBA 4K1GA 2GJJA 3SY8A 3ZTNH 2BFVL 4BR1A 1IXQA 1BRLA 3GIZL 1ZA3B 5E2VL 3O6FD 3OYZA 1CPUA 2YUVA 1P5UB 4DEFA 3RA7L 3OGOE 3ITYA 5BS0B 1ZAGA 3GTHA 4K39A 4MA8H 3C09B 3BP6A 2ZCZA 4A6YH 3US9A 2XVNA 3BGAA 2FJGB 4FG2A 1RLWA 3GIVB 5DQ9B 1P0SE 1HCFX 4L5FH 1FWFC 3PTDA 3TSDA 3G24A 4DNLA 1G9MH 4P5MA 1IAIL 4WJG3 4HK0A 5FKYA 5ESVA 3N85H 1XAUA 2D7NA 3ZRFC 1TIWA 1V7AA 5JXAL 2V5CA 2J8FA 4O57A 4M7ZC 3OGRA 1PD0A 3T40A 1E27B 5C0FA 2R27A 2VCCA 3LZFL 5FHAL 3FCPA 1U5JA 1A7NL 4I18A 1OWRM 2IPKB 5CUSL 3DIDA 1U93A 2XXCB 3V3WA 3QISA 3G77A 2VWEC 2NY6D 1CK0L 3VM5A 4NN5C 1WX0A 3O3BA 3RWCB 3X11B 1BIIB 1OJXA 3QPEA 1MN4A 2DVXA 3O6LL 2V9QA 4G5DA 4AVIA 1DJYA 3NH7H 5D2LF 1I8MA 3X12A 4E2OA 3AQDA 1VPOH 4X9BA 3CMOL 3KJ4B 4U05A 3I68A 1H6EA 3PCYA 4PTDA 2C3VA 1I9JH 1J5TA 1XH0A 1IIIA 1B6DA 1TRIA 4NXKA 3K46A 1NWUA 4TR9A 4JDEB 1F3JA 1RZQA 5CBEB 4WUUD 2JCCA 5IP4A 4QHKI 3VFUA 3WLBB 2ARWA 5D7JA 5DZNA 1K8YA 4ZOEA 1L6GA 3MBWA 4EQ3A 1QWUA 2PDPA 5JXEA 4PJ5A 3T8MA 1BGXL 3UJRA 4JW3A 2W1NA 2HQAA 5DMIH 4FABH 3NFNB 2OQYA 2DZVA 4RA3A 1F56A 2QHRL 4CJ0A 3CFDB 5MERA 3BE7A 4ICWA 1RQEA 1WPCA 1H50A 1RK0A 1GOMA 2CZNA 2PC4A 1Q9OB 3ICJA 3FU6A 3QVAA 1FF5A 2GBAA 4HX1A 3LRKA 1NFBA 1OAZL 1G7QA 4P2RB 4A8LA 4EXQA 3IPBA 4M4RA 5GJPA 4TL5A 1BQLH 3EUUA 4WNQB 3BKCH 3W7KA 1BD2B 1M53A 4JRYE 1NGQL 4ONGL 2J7LA 3P8IA 3LHYA 5HQEA 3WLHA 4ZL1A 1XSKA 4QHPA 2BP3A 2DQHH 3JTBA 3FIGA 1W80A 4WDUA 2B3RA 4I0KA 3QEQE 4PJEF 5IZ7A 5EFFA 1I8KA 2IAMA 5JR1L 2X70B 3ZWSA 3GFUA 2ZIDA 4Y96A 2MUCA 4QRTA 4LHUA 5D1XB 2RTTA 1H7RA 4AVFA 1A7RL 5MI0B 2VW6A 4KNQA 4O2CA 3VIJA 4LK4A 4Z95L 1W6TA 4JM0A 3UBFA 1TCDA 2CBTA 5ACZA 2PGFA 5GXBB 3LCFA 3MANA 5I6XC 1K7FA 3SCTA 2DQUH 5IXEA 4ETQA 4N5UA 3GFYA 4O02H 5JUVA 4HSQA 1XBZA 1OM9A 4DOHE 1LLZA 4XRCB 1YNLL 1AY1H 1W15A 5LHDA 3WXWL 1AXSA 4P59L 4F0MA 2OMVA 2HVMA 4D71A 3RWJB 1HSAA 2CBQA 5IMLB 5DRXB 1CFMA 3QDGB 1D5XA 2NZLA 3BQ6A 5G1TA 2PTUA 3VTAA 3BO9A 2E76C 3L4TA 1F3RB 3L3IB 4EIUA 3KPTA 3AIEA 4BQ2A 2UWEE 5L7XL 1A5CA 1XTLA 4HOWA 3DROA 2Z9TA 2Q2EB