1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (ALPHA-AMYLASE)
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
5E09A 3AIWA 1GJWA 4FF5A 3UESA 2XM2A 3DX1A 1QBAA 3AS0A 3PTQA 3VNZA 3AQUA 1RP8A 7TAAA 1KQYA 2XTKA 1KTBA 4OBSA 2Y8VA 3I3DA 5LYRA 4CD8A 1CWYA 1UKTA 2BHZA 3HG5A 3TONA 1EO5A 3I3BA 1WZLA 2WPGA 3VMPA 3SCTA 4P8XA 1EO7A 1Z32X 3GH7A 4EE9A 3BSGA 3VDCA 2J62A 1RP9A 2WZIA 3BH4A 1JZ3A 1FFQA 2XG9A 5JBEA 2WMFA 1GCYA 3H55A 5A8PA 4CCDA 3VD5A 4NX0A 3RIKA 1OT2A 3CC1A 4DM2A 1FOBA 3BCDA 1OGGA 1UWTA 2W67A 1XHGA 2J7BA 1KGWA 4HTYA 3UR8A 3MS8A 4IISA 2DIEA 4OOZA 4YHEA 2WB5A 1BYAA 5D8ZA 3BUQA 1JL8A 3WQWA 3PZ9A 3ALFA 4AZBA 3GXDA 5CQ1A 1B31A 4TOQA 1JAEA 1J0YA 1UWSA 3UERA 5F7UA 4XB3A 2A3AA 4JHZA 2CBIA 3GYCA 2XVNA 2QPUA 2EEXA 4NRRA 4EAMA 4OJYA 2OW6A 1QOXA 1WDSA 5A8NA 1L8NA 4D6JA 4XUYA 1JXJA 3GXFA 4HZ6A 4FK9A 3K1DA 2CXGA 4NXSA 5GNXA 3T2OA 2ESCA 4AW7A 1B1YA 3G6LA 4S3JA 2W92A 1GW1A 4PTVA 1WAWA 1PPIA 3QR3A 4XX6A 4ACZB 5IFPA 3WMBA 2WKGA 4PTWA 4UQDA 2DEPA 4OIFA 3CH9A 3ARTA 3S5ZA 4KGLA 1HJQA 4DO4A 4LX4A 1QPKA 4TX8A 4WKHA 1VBRA 3W24A 4NXKA 4NF7A 4CD4A 2EXOA 1GVIA 2ZXDA 1R87A 3GXIA 4GO8A 3SCNA 5I5RA 2ZXBA 1R7OA 1S46A 1UH4A 3CGTA 4GZIA 3AXIA 2CKRA 3LPPA 1MXGA 1GPFA 2V5CA 4HPGA 4FLQA 5A3HA 3RM4A 2WMJA 1H49A 1V3LA 2ZUUA 2YIHA 3W28A 1OSEA 5KEZA 1AQ0A 6TAAA 3UG4A 1E5JA 1TZ7A 1QW8A 4V27A 3SUWA 2VZUA 4OZOA 3IJ9A 2FGZA 4PSPA 1FP9A 1U30A 2XUCA 1UWIA 4M81A 3BUDA 3HG4A 2F7QA 3B9EA 1JYXA 4J3SA 4GPNA 2JFEX 3SCWA 4MNMA 3WEOA 1BYDA 3HG3A 4A3YA 3VIOA 5BYWA 4PSRA 2YL5A 4MJ2A 1KXVA 3ZSSA 4KH2A 4AD2A 3CMJA 3HU7A 1AMYA 1V02E 2O9TA 2BHYA 1R75A 3KZSA 3W25A 1I75A 1B3XA 1OB0A 2V38A 3GNPA 1NOUA 2FHBA 1KQZA 2ZX7A 2VZVA 2YL9A 2VQTA 4FNUA 4AMWA 4DWSD 2XSAA 3K46A 4UQCA 1ISWA 3WELA 3DYMA 3ZR6A 2VC9A 1M01A 2Y2WA 4JCMA 1KCLA 1VJSA 3OGSA 1TCMA 3EMCA 3OG2A 1KFWA 5ABEA 5JBDA 3CUJA 2JF6A 4MB4A 3AS3A 3RCNA 4IPLA 1VBUA 1TVPA 4JFSA 4CKQA 8A3HA 2GJRA 2GDUA 1ITCA 3AIUA 2D0HA 4N0RA 2BY2A 3ZJ8A 2WVUA 3WH5A 4Z2LA 1GOKA 2CNCA 4BS0A 3TTQA 1V08A 4CD7A 3WIJA 5FKYA 2CBVA 4M8UA 3LXAA 3WNOA 2ZUMA 1NP2A 2GVYA 1W91A 4F9JA 4D6HA 3QHOA 4BA0A 2XHYA 2ZX9A 5CSUA 6A3HA 2DGAA 4W7VA 1JZ7A 3FW6A 2A3CA 1IZKA 2D0GA 1JXKA 2GJPA 2ZUWA 4ZENA 3WY3A 2PBGA 3VGBA 3OGRA 3RMEA 2CBUA 1CYGA 1JYWA 1E6XM 3MI6A 2J25A 2WMKA 4FNRA 2X8RA 3W38A 3QGVA 4JCLA 1UQZA 1VJZA 5HPOA 1DEDA 5FCZA 3LPGA 4AZ5A 1OIMA 1UOKA 2DDXA 2DQXA 1HXJA 3M07A 3PZOA 2PWGA 5C8BB 5DF0A 3D3AA 3WF0A 5I77A 5A6LA 4DO5A 1CIUA 3PBGA 1NQ6A 4Z2HA 4Q22A 3N9KA 3LXBA 2W63A 3OLEA 4DWSB 1HVXA 1G5AA 2WMHA 1BSIA 5M03A 3NSMA 4JKKA 4UQAA 1J0JA 3NCOA 3TP4A 5CZKA 3RILA 2G3MA 3SCPA 5EFFA 1DTUA 1W9PA 1JYVA 1WDQA 3D4ZA 1CENA 1TUXA 1BYCA 2VQUA 1TG7A 3O2LA 2E8YA 3UETA 1JFHA 3A24A 1CGUA 5JIWA 3JUGA 1UG6A 1WKYA 5BROA 1TMQA 3VD3A 1C93A 3U7VA 1M04A 1R33A 1UASA 5A1AA 1R47A 2XGIA 3E1F1 4JFTA 3DX0A 3D50A 1HP5A 4L4OA 3T0DA 2X2JA 4DWSC 2BXYA 4HOWA 1H3GA 2XFYA 5I0DA 2EPKX 2EJ1A 2NSXA 1EA9C 1GOOA 2GSJA 3LPOA 2UY5A 4AY1A 2VR4A 4P7QA 4B9YA 2VCAA 2VO5A 3VGFA 2EPLX 5CG0A 2JALA 2BHUA 1KXHA 1XSKA 1H0IA 1FA2A 3NSXA 2DH3A 4OBRA 4TXEA 3PZTA 4HOXA 3WF2A 1PX3A 3F4VA 1CGTA 1G9HA 4YN5A 2DT1A 4OUEA 1E15A 5CSYA 1EGZA 4M82A 5LA0A 2CHNA 2ZWYA 1MFVA 3N17A 4GZEA 5M3WA 3BSHA 2F8QA 4IUGA 1W1PA 1TQSA 2PC8A 1V3MA 1ITXA 1XRVA 3U7BA 1ISYA 1A47A 1PX8A 1CGVA 2F61A 3CHFA 2W62A 2YFOA 4UNIA 3ARSA 4UZSA 5E6YA 1LWJA 1GNXA 4F66A 3ARWA 4KWUA 3AHVA 2JIEA 1CXLA 1E6PA 1K9DA 2FH8A 4UZUA 2XWEA 3A4AA 1TQWA 3SCUA 1H11A 3SUVA 3DC0A 3VD4A 1BPLB 3RDKA 2VZTA 3OIHA 4WIWA 3VU2A 4Q7NA 3WNLA 3ZO9A 1HXKA 3VMNA 1GHSA 1E73M 2WK2A 1V3HA 4BQ4A 1W1VA 4URIA 3UR7A 1H1NA 2CBJA 4MB5A 4UFHA 1WCGA 1QNOA 2WC4A 3AHTA 4U31A 5CJ5A 1JF6A 1BYBA 3SURA 3TTSA 1E0WA 3GZAA 4JL1A 1GZJA 1HKJA 3CHEA 4NRSA 4H2CA 3F5JA 1R8LA 5D9OA 3WFZA 4JKLA 4Z2KA 1JZ5A 5GQBA 1E72M 4GI8A 4DM1A 3MUIA 3VNYA 2G41A 3AZSA 4AZ6A 3ARQA 1M03A 1JNDA 2XVKA 2VJXA 4OGZA 4Z2JA 1G0CA 3AIVA 3PZVA 3G6MA 3A3HA 5CGTA 3L4VA 1KBKA 3VMOA 1W32A 3RPMA 3ARZA 2WAGA 3TOPA 4FMVA 1C7TA 4E8DA 2BY0A 5CLTA 1AVAA 1CGWA 4WKFA 5M17A 3FHQA 3AMLA 1W9BM 3DYOA 3WUGA 4CCCA 3VSTA 3CUIA 4JKMA 1UWUA 1B3WA 2EPNA 2E0PA 3THCA 4ZE4A 1IT0A 4J27A 3WEZA 2G3IA 2YOCA 3DHUA 2NT0A 4PN2A 3GH5A 2ZWZA 1AQHA 1GQJA 4X0VA 2PBOA 2PI6A 3CZEA 4HPHA 2CITA 1B9ZA 1UKQA 4CU6A 2F1AA 2D3NA 4P7LA 1C90A 3D52A 2J75A 4P7NA 2VL4A 4JAWA 1J0ZA 3AIRA 1TVNA 1VEMA 1XC6A 2PWHA 2PWEA 3DECA 4PMDA 1GUVA 3CZGA 3VIJA 4J3VA 1Y7VA 1OCQA 3MV01 4FLOA 3WDQA 3CPUA 1NOWA 1JI2A 4LPCA 1JAKA 1XSJA 2XJ7A 2FDMA 1UHVA 3S6TA 1OD8A 2WSPA 1GVYA 1DHKA 3LXCA 1QI0A 1ZBCA 2AOSA 5HPCA 1J0KA 3CUHA 2ZX6A 3K4AA 4TVDA 1W9VA 1EXPA 4TTUA 2OSYA 3VO0A 4ZXOA 5IHSA 3BAKA 1ISZA 3VGGA 2QF8A 2WMGA 3VIGA 2EAEA 3FAXA 3TTOA 1R85A 3M46A 1V02A 3ARYA 4B16A 1E70M 4MPKA 3EDEA 1UD5A 3B8SA 4RE4A 3N13A 3NSNA 3WMCA 3MV11 1KWKA 3NIYA 3AXXA 1CXEA 1CNVA 4D6IA 5JBFA 4AZCA 4PMXA 1B3YA 1LF1A 2TAAA 2XWDA 3VGEA 3EJUA 3DHPA 3FN9A 4H8UA 1KTCA 4PMUA 1ZJAA 1P6WA 3AHXA 3O9NA 1WE5A 1FHLA 1NP0A 4W5UA 1C8YA 3WDIA 5I23A 2YL8A 2YL6A 1CXHA 1J9YA 1GQIA 1V0LA 5A2BA 3GXMA 1BQCA 3L2MA 3EMQA 2UWFA 1MWOA 4WSJA 5AYIA 2YBUA 1K9TA 4MDOA 1DWAM 1I1XA 5A69A 1E43A 2F7PA 4JL2A 4PUDA 4QFUA 2CESA 5FL0A 2VOTA 2DT2A 1V0KA 3AMGA 3ECQA 4WSKA 3BGAA 2VR5A 2VX7A 3WDRA 4ACYA 2O9OA 1UKPA 4YHGA 4AZIA 2XPKA 4WF7A 3MKKA 4GKLA 3GDBA 2DSWA 4U5KA 2DT3A 3AZTA 2FHFA 2X05A 5HBFA 2ZUVA 2W91A 5ABFA 1BLIA 3WQ4A 1X6LA 1EH9A 3VM7A 1WZAA 2EACA 4OKDA 1H41A 1XSIA 1HTYA 1RD6A 2ZXAA 2EPOA 1CGXA 2VTFA 2E9MA 4CUCA 2F7RA 5E70A 4P8WA 4C7DA 3WD1A 3GH4A 3RJYA 1KXQA 3AHZA 4MNLA 3EDKA 4MDPA 3THDA 2C8NA 1Q6EA 1UR9A 3MUAA 1XV8A 3AJ7A 2D1ZA 1UD6A 3VIFA 2QMKA 1H09A 3ZJ7A 4QAWA 2WC3A 2WSKA 3M7SA 4NZFA 3A4XA 3EDJA 2QHAA 1OBAA 2J7DA 1BVZA 1E56A 3VIMA 1FFRA 3B9DA 4EANA 1PIGA 4GO9A 2XIBA 4W86A 2WNWA 2VRQA 2X2IA 1NWTA 3A4WA 2GUYA 5I24A 2Q8XA 4KRTA 2BVYA 3QHMA 4UFJA 5E0FA 1UKOA 4ZEPA 4QCEA 2ZUSA 3VIPA 2WCSA 3ZQ9A 2OWCA 3WUBA 1MQRA 4UCFA 4DUWA 3KE0A 3IGUA 4AIUA 4F9DA 3WNNA 5DT5A 4AEFA 5A8MA 3MMWA 3CUGA 3MU7A 3VGHA 3UG3A 1J18A 5DO8A 4PCSA 2WWCA 1SFSA 3MUY1 3VILA 1UZ4A 1LQ0A 2G8ZA 1SYTA 3B9AA 3VTRA 5LA2A 5HDRA 1GQKA 2BVDA 3OGVA 1SMAA 4XZBA 4JHOA 3T2QA 3CHDA 1W9XA 1WZKA 4UQBA 3U5YA 5FOOA 4ATDA 3AMCA 3U5UA 3VD7A 3A23A 3PZIA 1EOKA 1LLOA 1E3XA 4QLKA 3CMGA 4JIEA 2IUZA 3PZNA 1I1WA 2C0HA 2J79A 1E4NA 1MW3A 1VEOA 2WBKA 3IAQA 2O9RA 1UH3A 3HMCA 3S2CA 4QLJA 3LRKA 1VFFA 1WDPA 2W4XA 3WH8A 3CO4A 3SCOA 3AIBA 1NM9A 4BQ3A 2VI0A 2EPMX 4ZFMA 1RH9A 3WEMA 3WF3A 2VZOA 4J3XA 4M56A 1VEPA 4H04A 3W26A 3IK2A 4TX6A 5FIPA 1SZNA 3ARVA 1UWQA 3RM8A 4M1RA 3WQ8A 3VIHA 2WANA 1HIZA 2D0FA 2A3EA 4LGXA 2WXDM 4GI9A 4NZJA 1E0VA 3WBEA 1KBBA 4MNKA 1HWWA 1XCXA 3AMKA 4QCFA 2RGMA 2WWDA 3QHNA 2VX5A 1GOMA 1ZBKA 3N15A 2ZX8A 1HVQA 3QOKA 1JG9A 3W4RA 4GQRA 5M5DA 2WZEA 1E4IA 1E4MM 3APGA 5CPTA 5E6ZA 4PBGA 3VSVA 1MFUA 5A2AA 1FP8A 3DDFA 3N1AA 5A6MA 1CDGA 6CGTA 2QLYA 2J7FA 3ZR5A 2WVVA 4WLCA 5GPRA 2UY3A 1WP6A 2PF0A 1ZJBA 2DH2A 5BRPA 1CBGA 2XFRA 1NOFA 1OIFA 2J77A 1BHGA 1KR1A 3SCRA 1J12A 2VMFA 3HG2A 3AYRA 4W7WA 3N04A 4TUFA 3WUEA 3VPLA 4D6FA 5I79A 1E6ZA 1PX4A 4AZHA 2IGTA 4F8XA 3WL1A 1BAGA 1CXIA 4AIOA 3BLBA 2UY2A 1UH2A 4X0NA 3BVWA 3CUFA 1F4HA 2F2HA 1GJUA 3KL0A 4W88A 3SCSA 2C7FA 4AMCA 1JFXA 4HMEA 3VINA 4PRWA 1B2YA 1TQTA 3WDJA 3NUKA 4PUEA 2EABA 3AFBA 4PTXA 4P7OA 1KGUA 3PZQA 2WMIA 1JDDA 4AD4A 2VCBA 1JIBA 3EDDA 1US3A 1NWRA 1JYNA 1W1YA 2VURA 1MXDA 2CPUA 3BUBA 3WF1A 1EDGA 4WK9A 3W0KA 1EHNA 1W2VA 3VX0A 2E9LA 2CETA 3N12A 5D9MA 4M29A 2VUYA 1RPKA 3QOMA 4AZCB 2VZSA 1G94A 3II1A 1UA3A 1JZ6A 3T2PA 1GOWA 4UR9A 4R5EA 4PMQA 2YA2A 9CGTA 4GQQA 5DEZA 2CIPA 2GDVA 1QWNA 1W3HA 2D3LA 1J11A 3VVGA 4JFWA 3NDYA 2G3NA 1L0PA 2OSWA 3DX3A 3PZGA 2OLHA 3CV5A 1HJWA 3AIQA 2ZX5A 4V2XA 1K9EA 4S3KA 3BMWA 3WENA 1VAHA 2OWWA 1KB3A 4AEEA 4EKJA 2JEQA 2VX6A 4W93A 2J8GA 3BVUA 3L4WA 3A6OA 4RE3A 3NJ3A 1EQPA 4Y7EA 1ZU8A 5A6BA 1E0XA 5ABFB 4M80A 1SMDA 2WLYA 4U2YA 1B3ZA 5KZ6A 4E2OA 4J3UA 1JZ4A 3PHAA 3A47A 3MSDA 1WB0A 3FHAA 1ZB5A 2QMJA 3WFLA 5IFTA 5A6BD 3GNRA 4AYGA 5CGMA 1PIFA 1QX1A 4MJ4A 2XVGA 3L4UA 5CPSA 4EK7A 1D2KA 4L4PA 1HJXA 2EBNA 1QNSA 1W3JA 1WPCA 5BXPA 4JFUA 3NDZA 3FY1A 3BLPX 1V3IA 2BVTA 3T0BA 2YFNA 1O6IA 4TTGA 3H54A 3KL5A 2O9PA 2D23A 2XFFA 4UQ9A 1UWRA 2XIIA 1X1NA 2E3ZA 4QLLA 4BCEA 4HU8A 1OINA 1MW1A 1QHZA 1V6WA 3L4YA 4RL3A 3ZM8A 1PZ3A 3BUPA 1Q6FA 4BZYA 1US2A 3WF4A 1XCWA 3BUIA 4D6DA 2Z1KA 3MO4A 2WHKA 1SR0A 1MQQA 4GXPA 4V28A 4PMOA 1HL8A 3BAJA 2X0HA 3MMUA 4HP5A 1LL4A 3MSGA 2OSXA 3AXHA 4ZE5A 2WBGA 1E1EA 1FH8A 1AQMA 1GORA 3CBWA 2DSKA 2Z1SA 5GNYA 3VD9A 4KMQA 1DWFM 1UD3A 1QI4A 4PEEA 4FNTA 4W84A 4IPNB 1E6SM 3GM8A 2HISA 3TV8A 4D71A 4CVUA 1HKIA 1WZMA 1TQVA 4QDMA 1BG4A 2E9BA 3VKKA 4C7FA 2XN2A 3PZMA 3K8KA 2JEPA 3VIKA 4D6GA 1Q6GA 1E71M 1CPUA 1Q4NX 2BFGA 5DT7A 2MANA 4W5ZA 2OWXA 4P8VA 4AD1A 4AD0A 1HJUA 3W82A 4AZ7A 1QNPA 2WCAA 5LA1A 5BCAA 1QW9A 3WBAA 5IHRA 2WHLA 3PTKA 3D5HA 1KR0A 3ARRA 1U2YA 1E5NA 1V3KA 3IANA 3GXTA 2YDSA 1B30A 2YA0A 1WO2A 5AY7A 4PMNA 3W6LA 1MW2A 1JD9A 3OLGA 1PBGA 2ZE0A 4UFMA 1CZ1A 1NH6A 1E55A 1ZBWA 5IDIA 1NWUA 5FL1A 1UZ1A 1EDTA 3OZPA 1M53A 3WH7A 1EHAA 4MB1A 1TA3B 4UFKA 1HKMA 5A95A 1V03A 1VF8A 3ARPA 2YDRA 1V0NA 1C7SA 1W9UA 1QI3A 5AC5A 2V5DA 4B9ZA 5D4YA 1HKKA 2VRKA 5FD0A 1E6QM 1BFNA 5CLWA 3AICA 1LWHA 1K9FA 2FH6A 3WNMA 3AOFA 3WQVA 5AYBA 1DWJM 2DT0A 4UFIA 4DUXA 3W37A 2G4FA 3KLLA 1XD1A 1VFUA 1YQ2A 3CHCA 2FHCA 3MUZ1 3SUSA 3ZSTA 4HA3A 1ECEA 2WVTA 1TFVA 4D1IA 3RO8A 3BAWA 4NSBA 3M6DA 1JZ2A 3GBDA 3BAIA 4J28A 3MMDA 2V3FA 4NI3A 3PZUA 2D20A 2WVVB 1G1YA 2XM1A 1R7AA 4CGTA 3WNKA 1JI1A 2BY1A 2E8ZA 4AD5A 4W8BA 1ZS2A 1CTNA 3VUPA 4XZWA 4HMCA 2J4GA 2J78A 1V3JA 3VDHA 3BAYA 3UG5A 3T08A 3EYPA 3OLDA 3FXYA 4WKAA 3W53A 2ZUNA 4U2ZA 2JE8A 4TVUA 2J7EA 4AZGA 5GNZA 1UA7A 3WMSA 3RM9A 3EJPA 3IAPA 1J10A 4OOUA 4CD5A 4UTFA 4PMVA 5ECUA 3ARXA 2WMIB 5A2CA 2Y8KA 1O7AA 2J8FA 3POHA 5C71A 4E8CA 4FNSA 3GXNA 1QBBA 3L4ZA 2WHMA 4PTMA 1U33A 4Z2GA 2PWDA 4PCTA 2AMGA 1WNOA 2EADA 5EBAA 2WCGA 3AMDA 4W7UA 3EJRA 4JFVA 4AC1X 4B3LA 4B15A 1H4PA 3F5KA 2YKKA 4LYRA 1CXFA 5AC4A 1ZL1A 1B3VA 1B90A 1QI5A 4HA1A 2D22A 3OB8A 1GHRA 4CN4A 3CLWA 2WC7A 3HZ3A 1QNQA 3AISA 3TTYA 1EDQA 1UD4A 2VX4A 2ZUTA 1GOIA 3N11A 3TA9A 4BQ5A 3O6AA 3CZ8A 1GONA 3HJEA 5TD4A 3W6MA 2OYMA 2EO7A 4X9YA 1XGZA 2V3DA 1MQPA 2J74A 2EQDA 4F79A 4U33A 1QVBA 3AZRA 3WNPA 4UOQA 2ZOXA 1R46A 3H53A 3F5LA 1XH0A 2CEQA 5I2UA 1HJVA 1OD0A 1BGGA 3SUUA 3WH9A 3WH6A 3DDGA 2WVSA 3IJ8A 5DFAA 1C92A 1UYQA 2XYLA 2V3GA 4GZJA 3EJSA 2W61A 1GQLA 4D72A 3PTMA 1JDCA 4AWEA 4W8AA 4ATLA 3LPFA 4BQ2A 1A3HA 1G01A 1CGYA 2G3JA 1QNRA 3ZT7A 2XSBA 2D73A 4UFLA 3WY2A 1HN1A 2J7GA 5CXPA 2YDQA 3WDHA 1FHDA 3KEHA 1W9DM 3DYPA 4U3CA 1TE1A 1D3CA 2BY3A 3ZOAA 4HZ7A 2CERA 4Z2IA 5EMYA 3OA5A 5E9AA 2GJXB 4K68A 3EDFA 3VDAA 5A8OA 2E4TA 3HN3A 2VCCA 1BVNP 3CZNA 2XVPA 1TR1A 3BVVA 4LYQA 1UD8A 3IJ7A 1HT6A 2VRJA 4R27A 1K6AA 2VT0A 4PMRA 1V6VA 5BXSA 3KL3A 1ESWA 5EB8A 1WDRA 1HL9A 1T0OA 4PYSA 4LXFA 5HNNA 3ZT6A 4HA4A 2J7HA 3AHYA 1DP0A 3AS2A 1W1TA 3EJQA 4W8LA 1EIBA 5E1QA 5C70A 4HOZA 3WN6A 4D1JA 1LL7A 5I78A 3OLIA 1CLXA 2GK1A 2WLZA 1UD2A 3LMYA 2OYLA 1E40A 1JD7A 3SCQA 1ISXA 4A3HA 2YJQA 1MYRA 2ZIDA 1B0IA 4CN6A 3PN8A 5D9PA 3VDBA 5ABGA 4MADA 3GXPA 2DPEA 2ZICA 2DIJA 1V0MA 3VIIA 2WYSA 2WHJA 4N42A 3AYSA 3W27A 4FLRA 3L4TA 3EBVA 3J7HA 4AISA 4P7RA 2OYKA 1F4AA 4YPJA 1CLVA 4RE2A 2O92A 4M24A 1JDAA 2ALWA 2UY4A 4QP0A 2HVMA 2XVLA 2FGLA 1CECA 2XN1A 3WD2A 3CZKA 5ABHA 2DSVA 1E9LA 4CU7A 5BXRA 2XGBA 1TA3A 4DO6A 2Y4SA 8CGTA 5BWFA 5A6SA 3ZJ6A 3WD3A 4FNQA 1BTCA 2YBTA 1UQYA 3W29A 2Y5EA 1ODZA 2D2OA 3KWXA 4B3KA 1QHPA 4U5IA 3VGDA 1FH7A 2YLLA 1J01A 1X6NA 4H8VA 2X09A 3T0AA 2NW0A 1C3FA 1E3ZA 1UR0A 3WY1A 1DWIM 2F1BA 4BF7A 1CEOA 1KGXA 4ATWA 5HOSA 2VVSA 4LYPA 1NARA 3EMZA 4HZ8A 3WDPP 1TQUA 3I3EA 1M7XA 4CN1A 1OGSA 2QV4A 1C8XA 4W85A 2PWFA 4MTVA 3WD0A 1BF2A 4AMXA 1QWUA 1YHTA 1VIWA 5HXMA 2XN0A 3D4YA 1J0HA 2QPSA 1E4LA 4ACZA 3SCVA 2IXUA 4E4PA 1XYFA 2E40A 1LJYA 3SUTA 1VFOA 3BC9A 4AXNA 1VRXA 4CVWA 1H0GA 4A4AA 1VENA 3S5YA 2A3BA 1XH2A 1W3LA 3LRMA 1IZJA 2CCRA 2DSUA 4TVCA 3GBEA 2WKLA 1LL6A 1Q6CA 3CZJA 3WD4A 1KCKA 3UCQA 3AS1A 5A94A 5JIPA 1OWQA 1JF5A 3WKZA 3WUFA 3U57A 4PMYA 3KLKA 2X2YA 1UUQA 1HF6A 3POCA 4KRUA 1R34A 1HJSA 5I3DA 4MNJA 2B31A 1V6UA 1XYZA 4GINA 3ARUA 2OW7A 1R86A 3ZMRA 1KXTA 4IM4A 4MAVA 3LX9A 1E6NA 5JUVA 1OGBA 3ZT5A 3CTTA 1PS3A 2VVNA 1ISVA 4NZCA 3GTNA 1UR8A 3ZJKA 3FAWA 3BMVA 3AIEA 5DMYA 2ZXQA 2J47A 1HX0A 5A6JA 1BG9A 2YLAA 3A21A 1EQCA 4H41A 1DWHM 3W81A 4CCEA 2W5FA 3MANA 4FLSA 1KWGA 5EFDA 3A22A 2JIWA 2FE0A 1UR1A 4ZXLA 4CU8A 3CZLA 2NT1A 2D24A 4PMZA 1Q6DA 1H2JA 1N82A 2FYVA 1D7FA 2BNJA 4JZ5A 1LG2A 1E1FA 3AROA 4GI6A 4KGJA 3AI0A 4LQ1A 1E6RA 4UOZA 7A3HA 1VB9A 4AD3A 4XV0A 4D6EA 2VNCA 5BRQA 2BXZA 2IXVA 1ODUA 1C91A 3BVTA 4CD6A 3WY4A 3N18A 4ML4A 4HMDA 3EJTA 1JNEA 5A8QA 2CYGA 3L4XA 2GFTA 1CXKA 3K4DA 1XH1A 5IXEA 4P8UA 2AAAA 4GIAA 1UR4A 4AIEA 5CPQA 1LG1A 3GNOA 2W66A 2Y24A 2F7OA 1HP4A 3WQ6A 3RJXA 4DUVA 3ALGA 2WW5A 4H7VA 3WL0A 1DWGM 5E0CA 5D8WA 2WZHA 1OT1A 4D6CA 1BGAA 1PZ2A 4H8HA 3L2LA 1PEZA 3WSUA 1MW0A 4U3AA 2X2HA 3CZSA 3T09A 2DSZA 1EOMA 2A3HA 2WM0A 3A5VA 7CGTA 1J0IA 1QHOA 3WQ5A 1V6YA 4FNPA 1ZBVA 3SEPA 5A6AA 1IV8A 1OM0A 2F18A 3VX1A 2RGLA 1VFMA 5A6KA 4AYSA 5BXTA 1PAMA 1QI2A 3OZOA 4MB3A 2PB1A 2X1IA 4MAZA 1HNYA 1GOQA 2YA1A 3K8LA 4J7RA 1PJ9A 3D51A 1JGIA 1W2PA 5I6SA 3OBAA 1H5VA 1FH9A 2GJXA 3UEQA 3BAXA 4UQEA 2J7CA 2X0YA 2BS9A 3VOCA 2CKSA 4J3TA 3ZIZA 4W89A 3K8MA 3BLKA 4WJXA 2V3EA 3BCFA 1C8QA 1W3KA 3CIVA 3LRLA 1NWSA 1UKSA 3DX2A 1O7DC 1XD0A 2CHOA 1MVYA 4J3WA 3BXWA 3VSUA 2JF7A 1JZ8A 4W87A 3VM5A 5D9NA 4DWSA 3BVXA 3SIMA 4UOJA 1UR2A 1V6XA 2GK1B 4C7GA 3DX4A 3NYDA 2BV9A 4HU0A 3FNDA
chains in the Genus database with same CATH superfamily
1NCAH 2CBOA 4YXGA 4QJ3B 1Z5YD 3JQOB 5GGVY 1ZJIA 3O06A 4XD6A 4FF5A 2HE5A 4K4KA 2Z8SA 1AXIB 3AU1B 1QBAA 2QPFA 4HF5H 4ABVA 5D1ZI 5FEZA 3O9WC 5ISZA 1PZSA 4DGYL 3QPQC 1AODA 7TAAA 2CIKA 2CZFA 4LVBA 3AWGA 3EZ4A 4C5ZA 1F42A 2Y8VA 1U3JA 3I3DA 4C56D 2A74C 1BWMA 4KKRA 4MMZA 3I4EA 4CD8A 3IM1A 4PJGE 1CWYA 2BHZA 1NCTA 5IMMB 7ENLA 3UPMA 1BEYL 3CUXA 4NP9A 4AG0A 5HMEA 4YC2B 3VMPA 5CSUA 3IDIB 3RGVD 4R7JA 1HIML 1EO7A 1Z32X 4NRYB 1D5ZB 2AL2A 3CL6A 4HHLA 3GH7A 2AANA 2ISWA 3HB3D 3T1FB 4IS6B 4XCNB 4OF6A 4EE9A 5GGVL 3VDCA 3G6JB 3OQRA 1D7BA 3HC2A 2BVQA 3UR2A 5C0JA 1RP9A 2V5TA 4TSCL 2FEJA 1FFQA 5KVFE 4MYPA 5EO1B 1GCYA 3L1OL 5HYQB 2BDNL 5I0ZA 1GGUA 1AGEA 3MOQA 4XO4A 3RWDA 3NN8B 5DC4B 5A8PA 1G9NC 4JRYE 4TULL 3TYBA 1HXMB 4UQ2B 4X6BA 4A3UA 5EA0H 4XPGL 3HI1B 1WWAX 3RIKA 3ELFA 2DAVA 5GZND 3RPTA 3WQOA 2HAZA 2ZAHA 4N0YL 5E99H 4Z7NF 4MHHI 1K8ZA 1OZQA 4M7TA 2YKLH 3ILPB 1G0XA 2EVFA 4OY9A 4NN7B 1KGWA 1J4EA 4G7EB 3TIMA 3HTLX 3NJLA 3GVWA 1JPFB 3CFQA 3MLZH 4GUPA 3RURA 2OG9A 5E00B 3ZL2A 5G4NA 2VABB 4JRXA 1A4KB 4U3SA 3N19B 4NU7A 3JZYA 3KS5A 5D8ZA 3PJSB 1SN2A 4PRPA 1IFRA 4X8CA 5TPWH 3ZZQA 1JL8A 5C0AD 4QR7A 2F6KA 3WQWA 2NCMA 4JDVA 4GQ9L 2QKFA 2KAUC 3WFDH 4KWSA 4HMNA 1UZ6E 4Q9BA 4Y4KC 4V33A 4EWJA 2P5EA 4K9EH 3KMDA 3K72A 4LUIA 1V7YA 5CQ1A 5DXWA 4XBSA 4GKZA 4DP9X 2YN3A 3QJUB 1UWEL 2H6PB 1BOYA 2ZDRA 1JAEA 1TFPA 4I2XB 2W0PA 5E0QA 2W0FA 4RAUA 2QVTA 3TS8A 4UDUA 5IESH 4FZIA 3FFSA 2EJAA 1KIPB 1LK3L 4LBEA 2XVNA 3CWHA 2VE6B 2QPUA 4XNUL 2HFEB 1MFBL 2EEXA 2X4QB 4J23A 1OFDA 1YYLL 4OJYA 2GGGA 2YD8A 5I76B 2ZA3A 2AEPH 4EAMA 5AW9B 2VN6A 3RLSA 1QOXA 5A8NA 3TZVA 4A38A 4IOTA 2XBTA 3HAEG 4W9KC 1A6AA 1BRLB 4R88A 3LCIA 3KJ4C 1FWHC 2PDPA 5G2NA 2QQLH 1FYTB 1MRDL 1QEWA 1TVBA 3ZDZF 3HB3B 2B1HL 5KYYB 2IDTA 3K1DA 4E9XA 3MLPA 1SO5A 4C6JA 1KM0A 2DKUA 3D8MA 4WO0A 2PPCA 1BVLB 1PU0A 3HMWL 3KGSA 5BVPL 4XXDB 2CXGA 1ORQA 4ZMTA 4P57A 3TF7C 4NXSA 4Z78B 5GNXA 1FCQA 4GO6B 2WXGA 2AQPA 3V6FA 3UL4A 4N0CC 1B1YA 1R30A 4M0XA 1IC4L 1UM5H 3KDOA 1TJHH 1KV3A 2LE9A 2OMUB 4BE6A 5TQ0L 4JDTH 3V4UH 4ALAH 3WQFA 3P7YA 3QR3A 5C5YA 2FTYA 3NABL 5I1AA 4ACZB 1C9WA 2WJFA 1Z3GH 3E6EA 5HJXA 2NW3B 5EEUA 1I7ZB 2ITEA 3HC3H 4JM0A 1N6VA 2L0DA 5ICUA 3W7OA 3EKCA 4P5TC 2R0KL 3U46B 4GVFA 4K7YA 3RFRA 4HUUA 1KFAL 5D8JL 5I0XA 2YK1H 1JHLH 4LVDA 3ARTA 4P46D 3HNSH 3NQGA 3FT3B 4XAGA 1WHPA 4E3VA 4F4RA 1YEWA 4F2TA 2GBVA 5KANI 4XNXL 5I1KH 3WTUA 2N1TE 1KTLA 3PPCA 3UPRB 1YIXA 4H6RA 3NZHL 1JRHI 4Y8AA 2BG5A 1M42A 1N64L 4N24A 4BFOA 1EJWC 1DBJH 1PTDA 3WL9B 4B2DA 1DQUA 4CD4A 1OYBA 1GVIA 2ZXDA 4FQPA 5CBEA 3MGTB 1EXGA 1GPOH 4PRNB 5DMJB 2UYLA 1XDJA 2QUNA 5EOCH 5EF0A 3NCYS 5LLIC 1DL7L 5I5RA 3NIDF 1R7OA 3LENA 1S46A 2R94A 1E4XL 2BOGX 3HI5H 3H2CA 4M9OA 4GZIA 4DUOA 2X3AA 3D2UB 4J4PD 4HN4A 5I6NA 2O61B 4JIQA 4N2BA 2NY0B 5LNSA 2HCZX 4Q6YA 4HPGA 4RGNE 3T6QC 4K38A 4FFZL 1G6RL 4MD5B 3OPZL 1P5VB 1OFQA 3NQCA 1H49A 2R4SH 3PXLA 1DIOA 3DBXB 1MCWM 1Q9KA 3RIFF 1L6ZA 2V6HA 3W28A 1F8TH 4OH2A 4LCRA 4DVOA 4H40A 2IPUG 3LQMA 5SX4I 2OVLA 3RX3A 3SGEI 2YLHA 3EX6A 2EECA 2GBTA 1H15B 1UQSA 4HWBH 1H3PL 4D9PA 4KJYB 2Z31B 3P0GB 4ADSA 3QORD 4RFOL 4P59L 2IDQA 3R1GL 5FWRA 2B7OA 4C6OA 3RPIA 1NL0L 5C8JB 1EWEA 4GUCA 3S36L 4FC3E 4OZOA 1E4XI 1XCTA 3IJ9A 3OKOB 3G6JF 3MBXL 4PJ5D 4XO8A 1FP9A 1NELA 5CKSA 4RPQA 3WO4C 3BKMH 2FJUB 1XF2A 1IAMA 1DE4B 3ORJA 4NQXB 3WBYA 1T0MB 4QAIA 3AREB 1TXKA 3HG4A 4WO4B 3OXSB 4C54A 4HIEA 5EUKA 4LZKA 1L9RA 4AX3A 4JNXA 1UWAA 3PJTA 3ITOA 2HLAA 4CVXB 5K1NA 4MNMA 3WEOA 1NUGA 1NAKL 3HVNA 3SYCA 1CICC 5L6YL 2Q3AA 5AW5B 1PE1A 3O9WA 5E8NA 3KH4A 3WIFB 1FIEA 1MHEA 2B9AA 2VIRB 3OWEA 2XKNB 1W5QA 3MLVH 5HVFB 1YPFA 1IIKA 2NY2B 3OZ9L 2VXNA 4AD2A 3BJLA 3C09B 1SYSA 1AMYA 2YJLA 3HZKB 4ZQCA 3N2CA 4DJFD 1R75A 2FQFA 3IKKA 3KZSA 3ATEA 5BRZD 4KETA 4YZFE 4QDPA 3S5LA 4AL8L 3MRIB 4N28A 3H22A 1F8MA 4FEZA 1I75A 2AEOA 1JCMP 4O2EA 3T3PF 2DEXX 4FFYH 4KVCH 4WWNA 5DMIH 2V38A 2VC6A 4RDBA 2YX0A 1CYXA 1WWCA 5AECA 2B2XH 5LGZA 2B3RA 2ZX7A 3EAUA 3GG0A 3QEHA 5EF2A 1YEIL 2N7BA 2VZVA 1LP9E 5G4EA 3XINA 4LLWB 2JFCA 4DWSD 1BTMA 1FVCA 1AGBB 1KG0B 3P02A 3NQDA 3R0NA 3S8FB 5IEHB 4YHNB 5KSBA 1IC5L 1V7ML 3LRSA 1LEIB 3BVJA 2IPTL 3EOUA 3ZR6A 3OGCB 1XDTT 5F9DC 5J6GB 4NZ8A 4G9FA 3FCGA 4YSOA 4GCAA 5DD3L 2PF6A 2W65B 2CJ3A 2X3CA 3QI9C 2VDGA 3OGSA 1TCMA 3OG2A 4FTVA 4Q6IA 3WAKA 1F3XA 3JZEA 1W2KT 5KSAB 5ABEA 4A8RA 5JBDA 1LO3H 1CICA 3P2DA 1DJNA 3CUJA 1AD4A 3ZDZB 1O7DE 4NO0D 4BE5A 5IBLD 4KFPA 4P07A 3U0TA 4PH8A 3WTSA 4AWJC 4IPLA 1X7SA 3UZQB 3S2MA 1KN2H 4UTWA 4JFSA 4KO5A 2OM5A 4CVZB 4LVNC 1W5PA 2GJRA 1HEZA 5CS7A 3BG5A 4Y9OA 2F8VA 3KPSB 3U7WH 1S7QA 1S2VA 5T1KB 3AIUA 2D0HA 4JFXA 4XP4H 4EN3B 4YQXL 4IK7A 5JIWA 5AG9A 2QDGA 2BY2A 3ZJ8A 2CBMA 1T0NB 3SGZA 3EOTL 4XHQA 1GOKA 3MLVL 1XUZA 3DXAB 3EGSB 1VC4A 1Z6JT 1QMUA 2NXZD 3OR7B 4ONHA 1LO2H 2AQVA 1WBYA 3MV9A 4FI8A 4GY1A 4M8UA 5IVOA 3IJHB 2PTZA 3RAJH 1EK3A 3RWEB 3WNOA 4ANKA 3SCMB 3V36A 1ZIAA 2ZUMA 1NP2A 1NFDE 3B3BA 1K7EA 4F9JA 1OAJA 1FORL 4D6HA 4N2KA 3S9YA 3RZCC 4BA0A 3WBDA 3N85H 2XHYA 4HUVA 2ZX9A 2BNUB 1BM3L 5IGXH 3NM1A 2FBJH 5CU9A 3GD1C 4QT5B 5IHUH 5I1GL 4MNQB 1F5ZA 3WEXB 3LJ3A 3EBHA 1JZ7A 3ULUE 3A9IA 3V6OC 2MQGA 4LAZA 2JB5L 1U8HA 1T89C 2WIIB 3OMNB 4LP5A 2D0GA 3KYAA 5KBMA 2F2KA 2BGQA 3C3NA 2OJZL 2ATKA 1JXKA 4IMLB 4RISH 4TNWK 5PAZA 4PJDA 4AZUA 1MMFA 4GT7A 4E4UA 3MP4A 2WNKA 3FOLA 4DGVL 4J1UB 4AK1A 3OGRA 5DLCA 3F7JA 1BQGA 3NJGA 3LDVA 2I14A 4ZD3H 1RBOB 3QM3A 3MI6A 1Z44A 4LT9A 4HPOH 1T22A 1UUOA 4FNRA 2ON3A 2HTLD 5JA9A 2PS2A 1IC7L 2IDCA 4JFQB 4S0SD 3CX2A 1DIEA 3H2AA 2XQYG 4EF8A 1G7IA 3EPNA 5D2NE 3OBKA 1DE6A 3DX7B 4OE7A 3EX2A 2PZNA 1A9BA 4D0CA 1J9RA 1N2RA 3FONB 4UTMA 4JTGA 4H8PA 1YAZA 3C5SB 1ZWIA 2CLHA 5JPMA 2YPLE 3PZOA 4GUHA 5F7WC 4H3DA 5DF0A 6REQA 1HL4A 1TIUA 3OAUL 3VOIA 3PK7A 4GKTA 4KJWC 4A35A 1YDOA 4HHGA 4NO5A 1T03H 4DHGA 4KU1A 2R39A 4GCXA 2J43A 4RBPH 2AVGA 3NGJA 3C08H 2JCCB 3LXBA 4HQQH 3QNXA 4BK4A 1HVXA 3NCYP 4GAGL 2YK1L 2XV3A 1FNSH 3H3KA 4NQEE 4NENB 4I7WA 4LGPB 2HROA 3TP4A 3NCOA 5CCJA 4ZFOL 2ICWI 1BWKA 4YK4C 3RILA 3WO4B 4B90A 3AT8A 2ZOOA 4S2BA 3V0VA 3QEQA 1A80A 1W5OA 3GY1A 5IQMA 4C91A 1JYVA 1MY5A 1AXTH 5GSVB 3D4ZA 3HFML 3M0MA 5FYJD 3OPSA 4BGLA 3AUJA 2E8YA 1ETZB 1ZK9A 2HH0H 4DH2A 4JRWA 2GSGA 3LB0A 5DMMA 4G7VH 3SO7A 1BVWA 2CIKB 3UO8B 2WYHA 5FO2A 3ZHLA 1JFHA 3JVAA 2OCCB 5FM4A 4TQIA 4YDIL 3NGFA 3SDCA 1QO2A 2GGHA 3GZKA 1MCNA 1LRTA 2DYPA 4EEEA 1NGQL 5D7SL 2F19H 3RCMA 3HMJG 2WUCH 2NW2B 4X6DB 4A37A 4Q9QH 4YGVA 4YWSA 5B39G 5FLVA 4RGNB 3J27A 2XISA 4NRYA 5HGHB 4RK8A 4UB9A 3LI1A 3EW3B 3BD5A 2CBTA 2OMBA 1X9LA 4IS6A 1I1AC 2QVIA 4L48A 1ZNNA 2GVEA 2CXKA 5B22A 3EOOA 9XIMA 3G6JA 3TN0C 3IDXH 2BVQB 3D50A 5C0JB 3T0DA 4NRSA 3EO9L 5HHXH 2P52A 4D9LH 1HO4A 4JCWA 1I85C 1TPFA 4V1DE 4G43A 1OX6A 5EZOH 1IXPA 3A3XA 2ZZ7A 4ODVL 1H3GA 3MAWA 4MX7B 4UQ2A 4F8TA 4YSSA 3N4AA 4GUFA 4BRJA 5D6DC 2A9CA 3HI1A 5I3HA 2XFYA 3CQJA 4R90H 4HJIA 4FPSA 2NSXA 2XTSA 3TJEL 2JQXA 3ILPA 4JNZA 3D48R 3BKCL 3GEWB 3PFQA 1EF3A 5SWZA 4G7EA 3WJMB 5D9SB 4EI5C 1YEJL 1OQXA 1JPFA 4GUPB 3MVIA 1MHHA 2DLTA 5A2IH 3I6EA 3QXAA 4JRXB 4U3SB 5CF3A 2JALA 2Z34A 3AW5A 3WGUB 1KXHA 5D7EA 5C6MA 4Z76B 1J6PA 1FA2A 3PJSA 3KM8A 5F7NC 2BWDA 4OBRA 1YLVA 4TXEA 4JDVB 3MJMA 5T3XD 5AB2A 5I8KH 4LPYA 2P5EB 4CNPA 1YJDC 1DR9A 5BV7C 2Q20A 4GKZB 3H85A 4M82A 3D07A 2X0SA 1WTLA 3IWUA 3N17A 2QQQA 2W0FB 5FYKL 3S8HA 4OV5B 3L1OH 1CFVL 4UDUB 2F8QA 2QHLA 3N44F 4AWTA 4LBEB 2EF9A 1XRVA 3HR6A 2VE6A 1VFHA 2JJUA 2HFEA 3EO0A 3LCFA 1P53A 3D9AL 1ISYA 1A3LL 2Q6WB 3T0EC 5I76A 4N8VA 4HCRL 3GUTA 1DHPA 1CGVA 4IIZA 5JIQA 1GQNA 5I7GA 2VEIA 2YR3A 3SOBL 2HB0A 4ZSUA 2V2TB 3GW0A 3QUML 2H6UA 5JIKA 2P46B 1FYTA 1DJYA 1QEWB 1TVBB 2WSDA 2YFOA 4F8QA 1VFTA 2CK2A 4YCPA 2HDJA 3S1XA 1BVLA 3ARSA 4JQVA 4UZSA 4XXDA 3ZRCC 3VB8A 1IILE 1AMXA 4P57B 3R5EA 1GNXA 3RKDD 3ABMB 2C79A 3GC5A 2IBBA 5AZ1A 2PDIA 1CXLA 1K9DA 4JQ2A 3TL5A 2R1LA 3W01A 2J6EL 4UZUA 1E8WA 2XWEA 3RYSA 4LUSB 2BSLA 5E5LA 1INDL 1EBPA 2OMUA 1TQWA 5HGDA 2RIKA 3OAWA 3WJJA 1WBHA 2IKIA 4YHKL 3N9SA 3QC3A 4PTDA 3RXZA 5I1AB 4G7FA 3AG3B 1T7LA 5LNVA 2NW3A 4EI0A 1I7ZA 2DQDH 2NX3A 4XC1H 1MO0A 2XH4A 2P10A 5E2WH 3RDKA 2VZTA 3OIHA 4WIWA 3E2RA 3HCVA 4GIPD 2VDQH 1EFQA 4HUUB 1TEYA 5LKNA 1ZLSL 4Q7NA 1MSPA 2JTDA 7TIMA 1AZVA 3LS5L 1GHSA 4ZUTB 3S4SG 4R3UA 2A2QT 2WK2A 4X6DE 2K8MA 5I30L 1GTNA 1W1VA 3KBVA 3MA9L 4M5TA 3QJRB 4PI0A 5LBSH 4L4TD 2ZKYA 3RB5A 5LJYH 5IHLB 4URIA 5HI5C 1H1NA 2CBJA 1E7VA 3I7SA 3LMJH 2HSAA 2DTML 3AHTA 2WQUA 5TFSL 4CNIA 4MZRA 1M6UA 3MGTA 4AQ8A 1MRQA 3EWCA 2PRLA 4JL1A 3LHPH 5DUJA 5AW3B 3I75A 3WS3A 4Z7OB 3DTXB 1EJOH 4IMKA 4H2CA 3HVDA 5BXFA 3F5JA 3NEOA 2A9NH 5HVHB 2I9LB 4LCCC 1OQOA 2Z25A 3D2UA 4DM1A 4I2XE 4JKNA 4YXLH 2O61A 2XFGB 3KFTA 2F53D 3ETBJ 1LWRA 3T0EA 4J2PA 3U3HA 3WJYA 3AZSA 4XI5D 5LXGH 1EBGA 1FYHB 3DESA 4MD5A 1M03A 4GIEA 1KN4H 4LPVA 3MUHL 3DBXA 1RAMA 3OKLA 4U1GB 5DJ2B 2PXYD 5K69A 4OGQC 4ETYA 1BP3B 3AIVA 1F1AA 1BQHG 4MXWL 1JNNL 4JFEB 5GGSY 1HE8A 1QR4A 3G5XB 2ADAA 4QRFA 1UQSB 4E9RA 1P84K 3NZSA 4KJYA 2VLJD 4M93B 3X11B 5KZCD 1IEVA 1W32A 2WQPA 5AWNH 1QW7A 2JIXD 4JICA 3N2BA 1VPXA 1E6OL 1KRBC 4GXUN 1XMEB 5MEOA 4O1FA 4ZMAT 3TOPA 1XCTB 3OKOA 3NFUA 4NFBA 1KPVA 3TXVA 3UWQA 1TT6A 3MRDB 5KVGH 2OI9C 2VZ1A 5KJRH 4YDVA 1XF2B 1TWWA 4N9CA 1DE4A 4DAIA 4NQXA 3AM8A 4Z8FH 2EPHA 3CB3A 5EY5A 1U95B 5JXED 4WO4A 4HIEB 5E8DL 5EUKB 4F57L 1I8MB 3B3IA 4HFUL 3FHQA 4PUUA 2HLAB 4CVXA 3IRPX 3DYOA 1HIMH 5INDB 4OLXL 4OJCA 1R3LA 3FTVA 2UXFA 5KW9L 4QRNA 4L4LA 2XKNA 4OQTA 4CDHA 3F2BA 3V0EA 4TV6A 1QVOA 4KBXA 4LH8A 1R2RA 1UWGH 2IPGA 5BZZA 2K3TA 5A5WA 4CSTA 1DLFH 5GS2H 4POZC 1HZHL 3D30A 5JMRA 4M1BA 4BKNA 5DR5H 5BVJB 2YAMA 1ZENA 4MJJA 4BK5A 1S9WA 3MRIA 1FPTH 1HCVA 4OSUL 2RA1A 4O2EB 3NSFA 3IGFA 4HXBL 1WFIA 3D3VD 3SPCA 1DSWA 4LCYA 4HPHA 4V2BA 2N7AA 4OCXL 4IOFC 4W9FC 3UMTA 5I18H 5ICZA 5IFJB 4LEFA 5C3LD 1IJ9A 2PWVA 4WEBL 4Z8FL 1RPXA 3FA5A 4I9TA 2DOCA 3JRKA 4M8QA 5F8QC 1FVCB 1KG0A 1AGBA 3MSYA 4S1RH 1CDYA 2E4FA 3MN8A 3PL6D 2C1HA 5CEWA 4C6DA 5C0IB 4P7NA 4HXAL 4JAWA 2K9UA 3LRSB 1LEIA 2QT3A 2YGQA 3OGCA 4XMUA 4G9FB 5ES4B 1J1PH 3O3DA 4HNCA 1LEGB 2GLKA 3KRSA 1BQHB 4MXWH 4RMQA 3IGXA 4FTVB 3MV01 3GG8A 4KRPB 5KSAA 4S2CA 3CPUA 5KZCB 3OV6A 4K73A 3H4FA 7PAZA 4MFHA 2OLAA 1MI5E 4Y9GA 1FBAA 2Y85A 5C9RA 1T7VA 2X4NB 2APVA 2AMUA 3NFSL 2NDGA 3QJHB 1WV2A 1LNUB 2DQCL 1C8VA 4LL9A 4UYQA 3N2TA 2G9KA 2KDGA 5LXGL 3UZQA 2Y0FA 2ZUXA 3E2VA 1FNAA 1DHKA 1TZHB 1U2HA 2D4FA 4JPKL 3V75A 1DO5A 2P44B 1FWAC 3NZRA 3CHSA 3KPSA 4LOVA 1WAAF 2ZX6A 4ABUA 3TVMD 3CUHA 3RX5A 3M0IA 2HKHH 2B39A 4JFXB 4OIAA 3KPMB 4U7SA 1I8KA 2ZVIA 4XMKL 3VO0A 1CW2A 1YDYA 4GOAA 5KVEH 4E36A 1MFNA 2H3XC 1T0NA 2ACQA 1E42A 2BJMH 3O3BB 2XSXA 1QSED 1VD6A 5EU7C 1S39A 3EGSA 2G0LA 2V2WA 3OR7A 2PTDA 4AAJA 5J8LA 1QCWA 3MV9B 4U0RB 1M7OA 5IBUB 1JV5B 2QF8A 4GUGA 3M64A 5AHFA 4TSBL 3RWEA 3SCMA 1YJDH 5AC6A 1BG1A 3C5ZD 3TEWA 3EUUA 4QBXA 3BQ6A 4JHAH 3TSMA 4MQTB 4NZRL 1E70M 5AVUB 4O1AA 2EYTA 2YZ8A 2NZ9C 2XA3A 2BNUA 5FFGA 4JQVC 2YBGA 3HE6A 4N85A 1J5OH 1Z1WA 4QT5A 3QSKB 1FGVH 3TYCA 3ZHKA 4CEXC 3N13A 3NQFA 5CJ8A 4BF9A 5EUOE 4ZTPH 3F01A 3MV11 3NIYA 3M0JA 2NR6A 3CG8A 4K7PL 2YRPA 5AW6B 4U7KA 2B08A 2JGQA 2ATKB 4IMLA 1QO5A 2YAQA 3DGRA 1E2ZA 1OPGL 3TV3H 3TYGH 4RR4A 5HINA 3M45A 1RQBA 3WJJC 4OFCA 2IAMA 3FOLB 4F1ZA 3CLMA 3A4FA 5DT1H 1WXYA 4RDQF 4J1UA 1VYRA 4UR8A 4DYJA 4H8UA 5I73C 3BD3A 1O6SB 3M7FB 3TU9A 4G8TA 1R24B 2QUMA 4YZWA 1CGSL 3LHPL 1P6WA 2DI8A 4EZKA 2IPWA 1ACYL 1QSFE 3HBPA 4NQDE 3C6CA 4F8LA 2IDUA 4UFMA 4JFQA 1A7RH 3APFA 2FMOA 3KXQA 4M6AA 1U8CB 2YD3A 3WDIA 3AQXA 4ZTOL 1G7IB 4XB8A 1CXHA 4AQLA 3DX7A 2FL5B 1A9BB 1GGBL 3GXMA 4HGKC 4D0CB 4ZG1A 5A2BA 2VGIA 3QUZD 2UWFA 1N2RB 3D39D 3EJZC 5KWYC 4WSJA 3KAAA 3GNNA 3QISA 3BSZH 4OB5L 3CDYA 4MDOA 1BXUA 3LS5H 1R3JA 1DWAM 4ODXB 5JPMB 3H8AA 1GKOA 3UP8A 6REQB 4PUDA 4HIXL 3FKUS 2HTKD 4AEHL 1H7WA 5FL0A 2BW4A 4IOIA 4XWGL 2MIZA 3AMGA 4WSKA 1X7IA 3N15A 2TYSA 5DDHB 2VGFA 3VD2A 1ZALA 3MLYL 3VFGL 4ANUA 4BSWA 1UCTA 4ACYA 1O5XA 2O9OA 1WT5C 2QZQA 3JZ7A 2XPKA 3UO1H 2XLLA 2FEDC 3GDBA 3CT7A 3CV2A 4U5KA 2WLIA 1FNFA 4RGMC 3GMMB 1QBLL 5E6ID 2FHFA 3MYJA 3HW7A 1ZP4A 2VHLA 4QRSA 3DRTA 1SMOA 3FO1A 2ZUVA 1GYLA 2P53A 4XMXA 5ABFA 3HIZA 4IKNA 1NMAL 2NY4B 1QLEH 2EIKB 3QEQB 1ZLVH 2ZG3A 2KDYA 4NILA 1EH9A 3RY5A 1YEJH 3JWOL 5EHFA 4H9XA 3L3HA 1WZAA 3VM7A 2D4DA 4OKDA 1ET8A 1I3UA 1KTJA 1HTYA 4UOW0 3W00A 1ETZA 2EPOA 1FWIC 2GSGB 1CGXA 4TNVF 5L8JB 2VTFA 2YUWA 1UCWA 2Z35A 4IFKA 4K5LA 1MLCB 3APCA 5A7EA 1SDDB 2Q76B 4N2GA 1NKGA 5IVZA 3SDCB 4JO1H 4C7DA 1A66A 3DC8A 1ONRA 2ZOLB 2DYPB 4JFYB 4AH7A 4IWWA 2DZTA 2NW2A 4X6DA 4YGVB 2CH8A 2ZYIA 5HGHA 3EX1A 2R8SH 3PAYA 2IMRA 4US5A 4LEEA 3EDKA 1IO4C 1UUNA 4B2DD 3DZ1A 4MDPA 4I3SH 1Q6EA 2Z28A 4H6EA 3L5LA 2C26A 3UACA 1D5IL 2A0LC 2YD2A 4V11A 4GSUA 4DQAA 2D1ZA 1HQRA 4Z7UE 4L3ED 4Q9RH 3TOYA 4G43B 3KBMA 4OFYD 1YDVA 4MX7A 2WSKA 3KBSA 3M7SA 4MSSA 1OFOA 2N0MA 4NJAL 4Z7WE 3SO5A 5IMKA 1RUQL 4CSSA 1A4JA 3PQYA 3VFVB 2QHAA 1S9YA 3SRFA 1OEPA 1WBZA 1TREA 4PVLA 5E94A 2BOFX 2J7DA 5SWZB 3O4LD 3WJMA 1E56A 5D9SA 3B9DA 2GGIA 1MHHB 1PIGA 43C9B 3T44A 1T4KB 3QXAB 4XOCA 1IT8A 2YAPA 3PB2A 2X38A 2F74B 2JI3A 4G70B 4Z76A 1GOHA 3PSVA 5C07D 5EMJA 2NY5H 1Z9PA 1UUMA 3A4WA 3KYKL 3TYAA 3T3PB 1DANT 2GUYA 1FFPA 1P48A 1PCXA 4X5LA 3QHMA 1YNLL 1AR1B 3TJLA 2QBWA 2QJNA 4FXKC 2YD1A 2YXXA 2EG7A 5KN5B 4LIQH 1E6JH 4XXWA 2ZUSA 3VIPA 3RJQB 2WCSA 4UCFA 4OV5A 12E8L 1N3NB 3KE0A 1G0DA 3E7JA 1NCIA 3LEYL 2Q8BL 1XRSA 3DG3A 3KS6A 4F9DA 5M95B 4LDCA 4ICMA 3IU3B 3EO0B 5GJNA 5AVXB 3EKLA 1OHQA 3CFTA 3KPSD 3KXFE 4N8VB 4PLJD 5T1DL 2Q6WA 3GUTB 1DXIA 1B3IA 4LRNL 3MU7A 4Z18A 3VGHA 1EP3A 1CF1A 5ID0A 1J18A 4XCFL 2DJSA 3N42B 3MUY1 3RVTD 5EMLA 3VILA 2V2TA 2L04A 4DHLA 1TTFA 1SYTA 3IJLA 3FT2A 4UAOB 5BOOA 1OANA 3VTRA 4ODSL 2XETA 4FQJH 5LA2A 1QRNE 1TELA 3VNMA 4F0SA 2O5XL 5DZNA 4HSNA 5IBXA 2C4FU 4FA7B 1KNOA 1SMAA 4QTGA 5ELIA 3HJ0A 3OBEA 4G6KL 1C12B 1E51A 1TMHA 2EKGA 2WNGA 3LHTA 4K3DL 4GY7A 5EL1A 3TN3A 1XEDA 4JRXD 3CFNA 1FNSL 5BUPA 2DEYX 3G5EA 4POCA 2PO6D 5HGDB 1Q5MA 3AALA 1CD1B 5ANHA 4BHUA 3R0DA 3MLRH 3PP4H 4PY8J 1G7JA 1Z41A 3VD7A 3A23A 4KI5D 3UJ2A 1X5AA 4DSYA 3WTVA 4ZQMA 1AGFB 4G2DA 1S78C 2VB5A 2ZOTA 4ADIA 4EF3A 5BOZG 3BZ5A 3HCVB 4OJFL 2IUZA 3QV6A 1CL7H 1N55A 2CU0A 4B9GA 5CCKL 3FUIA 1MCFA 1ECYA 3R43A 1MW3A 4ZUTA 3HA0A 4CQ9A 1BQ5A 3IAQA 1CD8A 1DVQA 2O9RA 3KVKA 1UEYA 2ZYHA 4RMWA 4DZBA 1FQ0A 1P5BA 5BO1H 4BDVB 2D7NA 5D71H 3RLVA 5EEVA 1U5HA 4Y96A 3X1EA 4CNIB 5AHLA 2W4XA 3TDFA 2C1GA 3H6AA 3AIBA 5I8CA 1NM9A 1LM8V 4X9FA 1GR7A 1JZHA 3LHAA 3I75B 3WS3B 1F58L 3DTXA 1HKFA 5BXFB 2C9PA 5I71C 2EPMX 2I9LA 4YWGL 4AL8C 3D6GA 3WF3A 1U8OB 4XVEA 3BG3A 4AWUA 1CLOL 3QH2A 3T0EB 2GIMA 1HNGA 1VGEH 4N8VG 4ZO9A 4J3BA 1FHUA 1NFDF 4R5TA 5F97E 1EX1A 1RK5A 1UJQA 4G9DA 1UXMA 2ISDA 4QXTA 1A0EA 1PYWB 2IALA 3ARVA 3A64A 3UIYA 4PJXA 5BS0D 3THAA 2CUIA 3OKLB 5DJ2A 1RJZA 3T3ME 4YYFA 2NX5E 2Q3ZA 2F54E 3FQYA 4RL3A 2ZWKA 5AVQB 3WXVL 4ORMA 4JFEA 1KCSL 4H5SB 4RZ5A 3OF6D 1XGTA 3G5XA 2Y69B 4I8DA 5F1SA 2B59A 3X11A 1H8OA 3FDKA 2OZ0A 1GMIA 4LGXA 5JXAH 4ZGYA 4KCWA 4GI9A 4APQC 2GTZA 1O94A 1FL3B 1VYPX 4KK6C 4ZMWA 5MEOB 4NHCL 1JHLL 1E0VA 1LLZA 1KPVB 4Z6AT 5L7XL 3TJXA 4YLCA 3MRDA 4WGKA 1MCBA 4N6FA 4YDVB 1ALDA 1YEIH 3HC3L 1U95A 3FO0L 1M7PA 2EHHA 2RGMA 3GNDA 5DELA 5AZ0A 4TQTA 3KDMA 4DEUA 1R9ZA 2X88A 5DS8A 3B3IB 1RUMH 1G7MA 1I8MA 4ZX6A 1HVQA 1CYWA 1VGEL 3CFCL 4HUXB 5ILTL 5INDA 1V6TA 5GISL 1XB8A 4NAMA 3GKWL 4Z7IA 5G55A 4AL8H 1R3LB 2CKBL 4O8AA 1PF3A 4U6YB 3H56A 4HVXA 3N40F 3SADA 5M5DA 2Z2UA 4IQHA 5EV7A 4NN5B 1S5VA 4IXHA 1QVOB 1E4IA 5AKSA 1JXDA 1IM9D 1AC6A 4Z7VF 2JELL 5I1CH 2BMKB 3N3MA 1QYGH 3LHZA 2A4AA 1CFQA 4RRPG 2K0RA 4XPTL 5E6ZA 3QEQE 3WJLC 1MFUA 5BVJA 4PBGA 3NSCA 1DQDH 1S9WB 2HFFA 2HJFA 2DDQH 2V5RA 3QRLA 5ERWA 4TNEA 5C0NC 5IHWA 3PAOA 1NAMH 3T8XB 2A0NA 2I57A 3LB6D 5FF2A 4LCYB 6CGTA 3GIZL 4NKOB 2YB1A 5IFJA 3ZR5A 5ICZB 3UC0L 3B7TA 2WVVA 5SX4H 1UP2A 4F0RA 3O6KH 5GPRA 4FR1A 4M8QB 5IVNA 1XGRA 4H6QA 5TDOA 3JWDC 5D2WA 5BRPA 3VDGA 1MAJA 2WAHA 5C0IA 1CBGA 4FULA 1EXUB 1JPSL 5B3JE 2M83A 4PGZA 1ZRUA 3R1GH 3CQHA 4GVIA 3THQA 2EE0A 1M9SA 4TV3A 4NPKA 2GABA 3M0YA 4N02A 4A55A 2ZKXA 3O3DB 1LEGA 4GW1B 3P2BA 1IAIM 3AYRA 3NA8A 1BQHA 4MUPA 1UW9A 2BBFA 4E6MA 5DD5L 5I79A 1TPEA 5GSRA 3M0LA 2CO1A 4MVBD 1HGYA 3DX5A 1ME8A 1V93A 1BAGA 2X4NA 3QJHA 1UR3M 4P5UA 3BLBA 4PJ9D 1LNUA 3G2GA 1G6RH 4KS0A 4ERAA 2FECL 1UVQB 1TZHA 1BFTA 5D09A 1TFHA 1YEFL 1YEHL 4X0NA 4Z0SA 2CLPA 3CUFA 2ISSA 1DVFA 1NC2D 5BWAA 4W88A 5E5MB 3KPMA 1OKEA 5ANMA 1I8KB 4IBUA 1S7RB 4XNYH 1JFXA 4HMEA 2G75A 1SQMA 4L61A 2DYSB 3O3BA 2DVUA 4KZEH 4PRWA 1TQTA 2WTRA 3EA3A 2H1XA 5B8CA 2WLLA 3COTA 3LN5B 3EA2A 1HHHB 2V2WB 3QZMA 3FUJA 1P1XA 4OLWH 2YR1A 3GDRA 5FF3A 1A5CA 1JV5A 3T9WA 4KDTC 1IJNA 2IFFL 5DVKA 2MCPH 3TA4D 4ZTYA 1JDDA 4LBUA 3IBEA 3PL6B 1XFCA 3UWWA 4FERA 3QSTA 2VURA 1BYNA 1NPUA 2DZPA 2KHAA 1IGJA 3PUUA 4ZSOB 4HU4A 3BUBA 2EYTB 4WK9A 4Z0BH 1EHNA 3H2QA 4GW4B 3VX0A 3EOYG 3HE6B 5E2UH 3VXUE 4E9QA 1EHXA 2X4UA 3FOMA 2CETA 4M29A 4PAZA 1RHCA 2BTMA 3L23A 4GVHA 4LVGA 1R3IL 4WW1A 1RPKA 1A6UL 3ECWA 2FVLA 1CURA 4F58H 2WLMA 4UANA 4NQDD 4XCCL 4XP1L 4K7VA 2QVHA 4E9TA 1FWWA 3G18A 4FHAA 2IAMB 3BZJA 1BZEA 5C7ZA 5D7KD 2OCZA 1O6SA 3TC3A 1R24A 4HEME 1A22B 5D7JD 3ZN6A 1LT7A 4HYVA 4WI3A 4UR9A 4A7VA 1YMME 4AKPA 3TCTA 4IP7A 4QLWA 3ULVL 5IJBC 1F3WA 1WD9A 5T1LD 2GDVA 1IQDA 4DELA 3UW6A 3O4LE 3T0TA 3TN0A 1U8CA 4LVEA 2J6XA 1QABA 3FFDA 2ACSA 1TSHA 2PTWA 3IIZA 2Y3AA 4WCJA 2WBJC 2FL5A 5A7BA 1HCFX 1IM3D 2AS5M 3EJCA 5B1BB 5BQDA 2G3NA 5F3BA 1L0PA 1PQZA 1X4XA 2OS7A 3OHXC 4TLSA 5GS0H 3TW6A 4FA3A 5H8MA 4FR6A 1R3JB 4ODXA 3HFTA 3DX3A 3VNLA 5JH2A 4RZCB 1VLIA 4OFIA 2ICCA 4IOIB 5I8OH 5JW5A 2OJEB 5D2YA 5DDHA 2WMJA 4XN4A 2JBMA 2ZX5A 3LN9A 5CFHA 3GD6A 4BSWB 4V2XA 4GYPA 3V1PA 4Y9CA 3UXAA 4MXQC 3WENA 4UM8B 1IB5A 5TDPA 4YS4A 3F85A 1HG3A 3MI2A 2F8IA 2P49B 4HETA 4I7ZC 2WLIB 2NY6C 4AEEA 4EKJA 4HCDA 3GMMA 3QC6X 3DFHA 3MYJB 1Q72H 3L4WA 1OFAA 5E7BA 3A6OA 4ORIA 4M7ZB 4H9TA 4Y7EA 4QRSB 3DRTB 1IT9H 3FO1B 1P9MC 2GITA 1FZJA 1E0XA 3IK4A 5ABFB 4M80A 1N0LA 2YPKB 3QP3A 4S11A 5BW7A 5F7MC 4Y9EA 3UP6A 1J2BA 3L3HB 4PC8A 2NQ9A 3LNMA 4JQ1A 2XXCB 1Z9SB 5GRZA 4C90A 4CQ8A 1ITBB 3QKZA 3MPGA 4D8OA 3T5WA 2BZDA 3SDXB 4IIDA 2Z35B 1ZB5A 4IFKB 1ZHLB 4WENB 4L6HA 3FTXA 3GO1L 5LNGA 1MLCA 1BSLA 4X4ME 2GY7B 3OR6B 1SDDA 2Q76A 4RWHA 4EKXA 3B9KB 2PLKA 2E68A 5IVZB 1UUSA 5IFAL 1PL9A 5A6BD 1BECA 2ZOLA 4JFYA 3GNRA 3LVTA 4MZ2A 2IBZY 2FZNA 4O00A 3V8CA 4HK7A 5CGMA 1E9QB 1QX1A 3W11C 1O9VA 4MJ4A 2XVGA 4U1SB 3L4UA 4PJAE 5CPSA 3OZYA 4O4VA 1X7QA 3UA3A 4JTRA 1QNSA 1D5MA 2YQBA 1WPCA 4HSCX 1W3JA 2OQYA 3MHGA 5BXPA 3NZ1A 4XHJD 1TG8A 3CVBA 5AL8A 1HQRB 4GJTB 4OUOA 2XQYA 3BLPX 3QZAA 4N0UB 3OPUA 1UM6L 5AL0A 3NCJH 1NCWH 3NQKA 4W68A 1X7FA 1TX0A 2EVJA 1Y07A 2YFNA 4L9DA 5IMKB 3BUVA 2L3BA 1A4JB 3PQYB 3VFVA 4E9LA 1TWDA 2WPBA 3IT8D 1S9YB 3H54A 3QMTA 3KL5A 1WBZB 3Q7JA 3P80A 5E94B 4BEQA 4ZO6A 3DVNA 2VYRE 2D23A 1IKFL 4PJBF 4UQ9A 4NBXB 2XIIA 3MJ8A 4Y2DD 43C9A 3SE6A 3L3KB 3G77A 3WYZA 1T4KA 3F2LA 2B7QA 1NGWB 2E74C 5I6XB 2E3ZA 1RUPH 4C6BA 5EN2A 2ZCHH 3OQEA 2F74A 1QHZA 3PR2A 1V6WA 3NL3A 2UXTA 3IDGA 3LZOA 5DUPL 3M7WA 3VH8B 4ADUA 3P11H 2WXOA 1BYOA 1FFPB 3MROB 4JHWL 3FSAA 5DFWH 5HHOE 4Y89A 2NY1D 4KTEL 4X80H 1J96A 3WF4A 4QLRA 1YY8A 2AXGA 1XCWA 2W8CA 2Q8AL 4UTUA 3BUIA 4A7SA 5KN5A 1EEXA 3M0HA 4FS9A 4JG5A 4RVBA 2VEMA 3W7LA 4KKBC 3SHSA 1MQQA 1SR0A 2J27A 3IRDA 1Q3NA 4GXPA 4H19A 1ID5I 1XGYL 2Z6FA 1HL8A 2KZKA 3HMXH 1N3NA 3IJYA 4L8CB 3BAJA 1TO4A 4Y16A 4J5VA 1TMLA 4AWSA 1A50A 1OF0A 3THML 4ZO7A 5C0BD 2RGSA 3IU3A 2NLYA 2LLLA 2PDFA 4ZE5A 1AQMA 3OVQA 4QXIA 4QE4A 2B4GA 5IBTH 4TIMA 2CWRA 4HWUA 4Q58C 5ID0B 5LIXX 4KMQA 3DVIA 4P2OD 1DWFM 1UD3A 1JNHB 1DBML 4FNTA 3QZLA 4FTDA 4FHKA 3FT2B 4EI6B 4DK3A 4AMKL 1W8OA 2CR6A 1AZ2A 1IR1A 1E6SM 3DG6A 1EVTC 4IPNB 4JFFE 4W4OA 4N4PA 1Q9LB 3WLNA 4M7LT 3NCCB 3T4YA 1QNZH 5ABDE 1KNOB 1EO8L 1MIEL 2LU5A 3C2SA 3NFSH 1F86A 4D71A 1WZMA 35C8L 3WFCH 1C12A 4KRMB 1FUYA 1IU1A 1TQVA 3G8EA 1ZAJA 4F0LA 2QCEA 3KDPB 4WHYG 1BG4A 1VFBB 3C12A 4LSPL 4DNLA 1Q2SA 1CD1A 2APWA 4YSTA 4DPAX 4C55A 1NBVH 2FZDA 3E49A 4C6MA 1G7JB 4PJCE 3UNDA 4IRZH 1E71M 3K1KC 1QOPA 4NJHA 1RLWA 5DT7A 2MANA 1AGFA 4QS5A 1OW0C 5EEWA 3QWNA 5D02A 4UTCA 1YC7A 3I85A 1Q63A 3CVCA 1FQ9C 2BIPA 3OL2A 4HNOA 3LS4H 5LA1A 3W07A 3NYKA 1P1VA 4I6KA 2R69L 4LNYA 4QXWA 5HYJE 1OXYA 1X4YA 2VXUH 5K39A 3BE1H 3UADA 5G2IA 4DZBB 1VDGA 4XN1A 1TPDA 1Q1PA 4Z7QF 4BDVA 1RZKH 3O3UN 3ARRA 1KR0A 2BOEX 1SLVA 2Z0BA 3B7SA 3DWTA 5ITFB 3QDHA 3WFEL 3MJYA 3CQFA 2HXTA 3UWUA 2HPOA 4BFIB 2DF3A 2H0FA 5I8CB 3O9WD 4R33A 2PZ0A 4UINH 3UTZA 3H9ZA 3W7EA 2YDSA 4LWWA 1CE1H 1Z5LB 3TJPA 4Z17A 5F0MB 4I0KA 4KJQC 5DD1H 3G5YB 3RRAA 2DQIH 1WO2A 1U8OA 1LP6A 5ABTA 1QLRB 2QADD 3W1ZA 1SU5A 5K7JA 2IOOA 4AUUA 4DYKA 1TKKA 2F38A 4G9DB 4ZW3A 1PBGA 5HDBF 5FGCB 4QXTB 1PYWA 2IALB 3DVFA 1O95A 4PJXB 3TBBA 3QZEA 4NQSA 1RJZB 1OZUA 4QTIL 4US5D 3C2EA 2PXYB 3KAOA 2CCWA 5HHQA 3V6ZB 1U3HA 5IDIA 5E0KA 3KH3A 4H5SA 1EDTA 3C86A 5GVJA 1XGTB 2EXTA 3KCWA 3QEGL 1ZA3B 1V51A 3BMXA 3II3A 2B59B 2X89A 2AJSH 1GOXA 1YVLA 2AAMA 4JIHA 2B77A 1ESOA 4MB1A 3PGFH 4GG8A 1X5YA 4GUJA 4MJID 2GTZB 3SE3A 1FL3A 2GQ3A 3O15A 5FJIA 2VERA 3STZA 1VF8A 1DSFH 4P04A 1E5AA 3W23A 4P5KB 1C7SA 1NTDA 4G6CA 2NLJB 3NQAA 2GK0B 5D4YA 4HD9A 3TBSB 2C1PA 3EJZD 3MRFB 1HKKA 2DP3A 2VRKA 1YNTA 3WV0A 5J1TC 3PPEA 5FD0A 4WU7A 4V15A 2R27A 5CLWA 3AICA 3KDMB 4UT9H 4LUJA 5DS8B 1G7MB 3WNMA 5LQBH 4HUXA 2X0VA 3BAEH 1CI1A 4OLVL 3OTRA 1D5BB 3FCTB 5T5FL 3QUMH 25C8L 4U6YA 3W37A 4C65A 5EBLB 2F15A 3QWQB 3CHCA 5DVNA 3WD5L 2EUWA 3CFKA 3VXOA 2HS8A 4JS7A 2BMKA 4OZHF 2D2HA 4NKCA 3GMRB 1CFQB 4NZTH 4F7KA 4GJIA 2HJFB 2HFFB 4HZMA 5ERWB 3W7NA 2NLIA 4UB0L 1NWPA 4TPRH 4KFMA 5CZRA 4G5ZH 3CPRA 3M6DA 3T8XA 4JE0A 4MNQE 2WXJA 3ABZA 4KKCD 5JPNB 1XJBA 4RV8A 1S5IL 4NKOA 3NQEA 3SJ3A 4CGUB 2D20A 5K4ZA 2WVVB 3L3OC 3OGOE 3QIBD 3H12A 4EZLA 2AVFA 5C0GA 4DVBB 4LDOB 2GQ8A 4UTJA 1XGRB 2ED8A 4KK9D 1OB1A 4KROD 2A7BA 4YXKH 2AQTA 5TDOB 4QITA 4XZLX 1I1CA 3ZRSA 1F97A 1EXUA 3OMAB 3V0IA 1A64A 5SWZD 4KKZA 2BY1A 3LD5A 2QGBA 2QJDA 3SPIA 2E8ZA 2IQTA 2V63A 3R25A 4EAYA 1HWHB 4GW1A 2IH1B 4S10A 1CTNA 3WLWC 5HMFA 1FWRA 3QIWA 3VUPA 3L3DB 3VWJC 5GSRB 3TJEH 4K8EA 2J78A 3E5PA 4F58L 3EYFB 1V3JA 4GK8A 5AW2B 3VDHA 4TM9A 5SX5K 4N22A 4ZODA 3FYYA 5JXEC 4LDEB 2E6AA 1UVQA 3OLDA 3MLTA 1WA3A 2UZ9A 3QGAC 3I74A 4N9BA 1CB4A 2BPBA 3U4EA 3KVQA 4JZJC 2AFNA 4WAFA 3G1AA 3N14A 1DVFB 3AJXA 5C0EB 1CU4H 2FX9L 5E5MA 3BT0A 3U25A 1PB0A 5ANMB 3LN4A 1YDNA 3QYNA 1RU9H 2GOUA 1N59B 1S7RA 4FYSA 4XAZA 2G75B 2J71A 3VYOA 4BQ6A 2DLGA 1A5NC 5DS1A 3MWAA 2WTRB 4U1JA 3UCCA 5B8CB 2WLLB 1FX6A 3LN5A 1HHHA 2VDNB 3ATDA 3FJTA 2I26N 1WBJA 5FYKH 3VCRA 4CD5A 1DCLA 3EWBX 1SOKA 1SSDA 5GS0D 4DJEA 1MNUH 6ENLA 3ARXA 4JY5H 4P2AA 5CILH 5KBKA 4K3EH 3POHA 3PL6A 4NQEA 5F6IC 4F9LC 2J8FA 4E8CA 5IROA 1MVFA 4P2QB 1Q6RA 2P5PA 2YXFA 5D5MF 5DHVH 2LFEA 2DU2A 1IGJB 3C75A 5I8KL 4ZSOA 2W9DH 3L4ZA 2G95A 4PRRA 1KXTB 4HNNA 5FDYA 4GW4A 5F9JA 1JUKA 1CG9A 2O30A 2X4UB 3FOMB 3TH4T 4NJJA 4PTMA 4S1QH 4Z2GA 4PCTA 1KPRB 3DHFA 3VAVA 1J86A 1AE6H 4WW1B 3TT3H 1W72B 3U9PL 3UWZA 3QJXA 1XSOA 3ZBMA 3PTKA 2I7GA 4ANXA 3V0TA 5EBAA 2BK8A 2PDYA 2WCGA 4LEOA 4KMLB 3DJ9A 2IH9A 5JHDD 4LY4A 2G4JA 2FATL 4ODTL 5I75B 2WOQA 2LVCA 4P9HC 3BCJA 3FSUA 3L5HA 4OZGF 3GKFA 5AVNA 1U92A 2J20A 2W5PA 3N9GL 2P1YA 2DEWX 3LDBC 4F9PC 5DMGD 1BMZA 3GFYA 4FXTA 5F44A 1UC6A 3MNDA 1IQDB 1CXFA 2AEIT 5ICXA 1ENUA 3TN0B 2R0ZL 1HTIA 1UT9A 3FFDB 3HMXA 4KDWA 3LB6C 1VKFA 1UC5A 1AZRA 3IDXL 1D2PA 1E4HA 1MQ8A 1QI5A 2KLTA 4HA1A 5LUMA 2D22A 3GIYA 1QLFA 5F3BB 1PQZB 1ROCA 2CJTA 2QSQA 3QIBC 5KS9F 3DFPA 1DYSA 3W85A 1TQBB 1S6NA 5GJSH 2FB3A 1F4XL 1DQDL 2F19L 4RZCA 1T6WA 3T0VA 5IVXB 5JW5B 2OJEA 3U0WH 2Q10A 1MEIA 1J1OH 2AGKA 1UD4A 3E2QA 5J04A 3S3BB 3M9YA 4HPOL 3KLHD 1MAML 4NAJA 4UM8A 1LHZA 3FT0A 2DJ4A 5D7HA 4JZNB 5TDPB 1GOIA 3N11A 5K3VA 1L3NA 1W37A 5C2BL 3W6MA 2EO7A 1WK0A 1A4AA 1XGZA 3MBWB 3WHE0 4RA0C 1I0DA 2VDPH 3FK4A 2EG6A 1XCFA 1E28A 4XVSH 3WNPA 2GITB 4F9LA 1FZJB 3P0YH 4D94A 4YLWA 2XIJA 3P0YL 3VFLA 3AQYA 1N0LB 2YPKA 3BFQG 4D3CH 1BEXA 1WF5A 5AZ2H 4ANWA 2BNQE 3O81A 5EZIH 3Q8BA 1RFDH 4EAEA 1Z9SA 1ETA1 1OD0A 3TCSA 3QUYD 3EJYD 4CMHB 5DLML 1DDTA 1TJXA 2V4LA 3DDGA 4Y2DB 3SDXA 3BKYL 2WVSA 4XK2A 3FKRA 1ZHLA 2H32A 4HK3J 3K0WA 4X7SH 2MRYA 3C87A 4XAYA 3OR6A 4YDNA 1E67A 4IJ3C 3B9KA 5I1IH 3RNKA 1C1EH 1G9NH 2IAMC 5FM8A 3UAJD 2W61A 3SDCD 3UFIA 1IQWH 4Z7WB 1EZLA 2DMHA 1E9QA 2RDWA 5MI0C 1YQVL 4AWEA 4N2OA 4U1SA 3QS2A 4ZYKA 5T5NF 2FZ3B 4KUZL 3ZDYE 4GG6A 1X7QB 4KUZH 5E6UB 1DORA 3PP3K 2RDUA 4LFHD 1D5MB 1F13A 5LWYH 1Q90A 1VR6A 4C6PA 4PCKA 1U41A 3UZWA 4H4NA 4NNCA 2BH0A 1FBIH 4WQ6A 3VKDA 2PRHA 3H21A 3U8GA 1E50A 1WC7A 4NN6C 4N0UA 5AZ2L 4AHQA 3TZVC 2C14A 3T3PE 3TO4C 5HYIA 2OXHB 4WK4B 3GZQA 3TM6A 3PP4L 1DBBL 3WLLA 3P81A 5FOBB 3TH6A 2PPDA 4RQQB 5J6SA 3T4AC 4RMVA 4I4WB 2Y07L 4OCWH 3V0AC 5GJMA 4HKZA 3DVNB 1F41A 4UTIA 2XC8A 4XNZB 1V79A 1MFAL 4UXDA 4Q32A 3MJ8B 3KEHA 3L3KA 3TFBA 1NGWA 1W9DM 3BPLB 5EN2B 2CDGB 1TNMA 4U3CA 1GH7A 4PG9B 4HZ7A 1KYAA 2E47A 3IDGB 4X0KB 4WWPA 2GVJA 4Z2IA 5D1QD 5E56A 4GQPH 3SKMB 3VH8A 3HE7C 1PDZA 3AU0A 3MROA 5ADOL 4CQAA 1PDYA 1KBGH 1YY8B 3T8LA 2AXGB 1JQXA 2ZZ5A 2WJEA 1ZVNA 3URNA 1U3HD 4WY7L 4BI7A 3MJ9L 1JCXA 1T3FB 2VJ0A 3N1MC 4M62L 4I1PA 2XVPA 1ZDSA 4EDWH 4DJDC 5CC5A 4PJEE 3BVVA 3LZFH 1MCHA 3B1UA 4ONGL 3IJYB 4L8CA 5FJUA 1UD8A 5D2VA 4B4FA 3BH9B 4JQIL 4HAFA 4Y16B 4RNRA 5EKYA 2VXVL 4PRAA 4UT6H 2VT0A 5CSGA 2MTPA 1BD2D 4XMPH 1FWGC 4Q4SA 1NCUA 1F2XK 2BSEA 1MWAB 2RBLA 1INEL 3BWUF 3NIFB 1H3VA 3BT2H 3KR3L 1WDRA 5F4XA 4D8LA 1BA9A 2PDBA 4KI1A 1JNHA 5H37H 1RSFA 1F73A 4HA4A 4EI6A 2VN4A 1OAYH 3ZE1F 5HJBA 2WZIA 4PLKD 3X3GH 1JZEA 2QSCH 1Q9LA 1IBGL 3T4YB 5FAJA 1MPAL 2O6EA 1DP0A 1IGCH 2MKLC 3GHPA 5HHME 3U2SB 4R26L 2CO3A 3AG2B 4DP6X 4EPKA 1MNNA 1HSAB 4WFEE 4MVBC 1E30A 1KGCE 5C70A 1VFBA 4Z7NB 4Y2NA 3HOGA 1G4SA 2OT0A 4HCFA 4CEUC 4X61A 1PEWA 1WICA 4TRPL 3F4DA 3BWUC 1ADWA 4NIKB 3LI0A 4D1JA 2DIAA 5F7EL 4NKMA 4NWTH 3U9IA 4LSTH 1L7TH 1N8WA 3LMYA 4AHPA 2AXFA 1F1DA 3GS4A 3DFQA 4HYRA 5F7HA 2QUVA 3R89A 4R6UA 5IUCA 2V2DA 1NC4B 2ZRZA 1QPNA 3VXME 1ISXA 3VOFA 2YJQA 3ASOB 3OZKA 4YE0A 5JOPE 3S1UA 3ML8A 4OUIA 4LAOA 4LANA 2O6DA 2ITCA 4JQIA 3P5ZA 4PJ8D 3LLFA 3FUNA 5K39B 1KKOA 5ABGA 4MADA 4WZ9A 4RLIA 3GXPA 3HAEA 3BZFA 4K94C 4RMTA 4J3OC 2DMKA 1R0AL 2DPEA 3JBG7 5ITFA 5AKVA 1QR1B 2CG9X 1V0MA 1F3DJ 1GMEA 4QTFA 3RFZB 3IJIA 4BFIA 4I77L 2AEQH 3EWXA 5LGXA 3B8TA 2J4WH 3UTZB 4QS6A 2JXMA 1A5UA 3LNEA 1Z5LA 3D06A 2W95A 4WV1B 3UBXI 1SOXA 3W27A 3G5YA 4R83A 3W1PA 2O56A 3FU6A 3J7HA 3L4TA 1QLRA 4JFFA 5IQNA 3EBVA 4NAEB 4DF2A 3QPQD 4AISA 1NAKH 2OYKA 4PYGA 4P7RA 5CN2A 4YPJA 1CLVA 5KVDE 2DIBA 1F4YL 3K30A 3UZXA 3TCXA 1QLEL 1PZ5B 2XU9A 4X5QA 4JM4H 5I15H 1TPH1 4LO9A 3KYMA 3UAJC 3PPGA 2XVLA 3MFGB 4NQSB 3X3FH 1MCKA 2VDPB 3GB7B 2PXYA 2OOGA 4FL4C 2A1WH 1IE4A 1CWVA 1U3HB 3QQNA 3V6ZA 5HHQB 5KSUB 1L8PA 1QTWA 2DSVA 3VABA 4ZDHA 3UJTH 1ZA3A 1KBIA 5J1SC 1F6FB 4CMHC 3FOKA 4P59H 3W7GA 4R3SA 5GGTL 4APQD 4X9IA 2BB0A 4GG8B 5BXRA 1P4UA 1SF3A 5F2GA 3STZB 5BWFA 1TETL 2XI9A 5HMDA 5IP4A