1TMQA

Structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
471
structure length
471
Chain Sequence
EKDANFASGRNSIVHLFEWKWNDIADECERFLQPQGFGGVQISPPNEYLVADGRPWWERYQPVSYIINTRSGDESAFTDMTRRCNDAGVRIYVDAVINHMTGMNGVGTSGSSADHDGMNYPAVPYGSGDFHSPCEVNNYQDADNVRNCELVGLRDLNQGSDYVRGVLIDYMNHMIDLGVAGFRVDAAKHMSPGDLSVIFSGLKNLNTDYGFADGARPFIYQEVIDLGGEAISKNEYTGFGCVLEFQFGVSLGNAFQGGNQLKNLANWGPEWGLLEGLDAVVFVDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRIMSSFDFTDNDQGPPQDGSGNLISPGINDDNTCSNGYVCEHRWRQVYGMVGFRNAVEGTQVENWWSNDDNQIAFSRGSQGFVAFTNGGDLNQNLNTGLPAGTYCDVISGELSGGSCTGKSVTVGDNGSADISLGSAEDDGVLAIHVNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (ALPHA-AMYLASE)
publication title A novel strategy for inhibition of alpha-amylases: yellow meal worm alpha-amylase in complex with the Ragi bifunctional inhibitor at 2.5 A resolution.
pubmed doi rcsb
total genus 162
structure length 471
sequence length 471
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tmqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tmqA01
1OBAA 4U5IA 4XX6A 3WQWA 4PEEA 2YKKA 2XWDA 2YLAA 3PZVA 5DT7A 5EB8A 3AS0A 1Z32X 2IGTA 4NZFA 1QOXA 2J7BA 5AYBA 4YN5A 4QLLA 3WEZA 4FK9A 4EAMA 3WF4A 2ZX9A 1K9EA 3EMCA 1HKMA 2J8FA 4MB3A 2CERA 5CLWA 1HIZA 2JEQA 1W3LA 3FAWA 1UYQA 1QI3A 3KLKA 4GQRA 3I3DA 1AVAA 1H11A 3B9DA 4CCCA 3WQVA 1YQ2A 4P7NA 2IUZA 3CUJA 1BVZA 2VNCA 1KWGA 1UQYA 1KXQA 3AXIA 1W9DM 3RILA 2BXZA 4UNIA 3AISA 4GI6A 2Y24A 5C8BB 4R5EA 4NRSA 1FH9A 3ARZA 3MUY1 3SCUA 3UETA 2WNWA 3D51A 1NOWA 3PTMA 4L4OA 2OYKA 1E1EA 1QX1A 3BVXA 2FHFA 3WY4A 3NSNA 1KCLA 2WCSA 4E4PA 1V3JA 1ZB5A 2BY2A 4PMOA 4J3VA 3N17A 3MUAA 4AYSA 3VMNA 3A21A 5A8NA 5HNNA 1KFWA 4FMVA 2BFGA 2EXOA 5D8WA 4HTYA 4AC1X 4M8UA 2YJQA 3VM7A 4AZIA 3ALFA 2C0HA 4BQ3A 3KL3A 1OD8A 1OGBA 1CXLA 2FHBA 2W63A 4AZCB 1UR2A 1EQPA 5M3WA 2FYVA 3DX3A 1IT0A 4JKLA 3NUKA 4Q7NA 3UG4A 3F5LA 2CNCA 1Q6GA 4UR9A 1Q6DA 2XG9A 4FNQA 4KGLA 2VO5A 1MQQA 1QI2A 5A6KA 3QR3A 1U2YA 3ARUA 2PI6A 4D6HA 3W6LA 1ISWA 5BROA 3F4VA 1JZ3A 3W29A 1W32A 1PAMA 4UQDA 1J0KA 4HA4A 4W87A 1MWOA 3OLIA 1FFRA 3BSGA 2WMJA 3H55A 1E1FA 3VIGA 1QWUA 3WFLA 3ARWA 2XN1A 2DT0A 3HG4A 1FHDA 4CN6A 3II1A 4P7OA 2G3JA 5I2UA 4U3AA 1CEOA 3ARQA 1UZ1A 2OWWA 2G41A 1AQMA 3VDCA 4UOQA 3A24A 1EDGA 4AMCA 1JNEA 3S5ZA 3U57A 3AHYA 3DYMA 3LPOA 4NZCA 1H1NA 2YA1A 3A4WA 5CQ1A 2PBOA 5A1AA 1AQ0A 4ATLA 3SUUA 1QI4A 1GOKA 5FOOA 2BV9A 4W89A 1V02E 1RD6A 1DEDA 3BLKA 4EANA 1IV8A 4BS0A 1BYDA 3ZR6A 4XZBA 3AHXA 2E9BA 2YFNA 4TUFA 5A3HA 3EBVA 1DWGM 4DWSC 1CDGA 3EDJA 1NP2A 1MW3A 4DUWA 1HP4A 2YL8A 2BY1A 1G9HA 1J0IA 2G8ZA 3WMBA 3CZSA 3WF2A 3WNPA 3AROA 1I1XA 2WVTA 3VU2A 3CMJA 2A3HA 3L4XA 1HT6A 3W37A 3W0KA 1S46A 3NDZA 3CZGA 4D6CA 1UR4A 3CHCA 1GNXA 3RJXA 2V38A 4ZE5A 3OLEA 1V6YA 2IXVA 3N13A 1ZBCA 3CUGA 2GSJA 1W9BM 3W81A 3CUHA 3L4WA 3IAPA 3ALGA 4TXEA 5CG0A 3LPPA 5JUVA 3WH9A 2V3DA 3WIJA 5IFPA 2OYLA 4H8UA 3GYCA 3WL0A 5A6BA 3ZSSA 3AIBA 4MJ4A 1MFUA 2J25A 3AOFA 2EBNA 3HG2A 1SMAA 5DO8A 1UWIA 4ML4A 3AS3A 2W5FA 1UWTA 1HL8A 4H41A 3AFBA 4CVUA 3IGUA 4BZYA 4QLJA 1VBUA 1JD9A 3AQUA 1KBKA 4DWSA 4WLCA 5A69A 2GDUA 2CBUA 2FGZA 3MS8A 4PTMA 5BWFA 2J4GA 3SCNA 3UERA 3QGVA 3ZT7A 3W38A 1UKTA 4BQ2A 2FGLA 2CETA 4MNMA 4PUEA 1XSKA 1JL8A 1H5VA 4J3SA 8CGTA 3NJ3A 3CV5A 1JAEA 3SUTA 3SUVA 3NDYA 1JYNA 1W1YA 2VL4A 1CECA 1HL9A 2WK2A 1B3ZA 3ARXA 3AHVA 4YPJA 3S5YA 4TX6A 3WQ4A 1K9FA 2OWXA 4MAVA 2X1IA 1T0OA 1YHTA 4DO5A 1RP8A 2ZXBA 1UA7A 1KTCA 2CHOA 1KR0A 2XVKA 1UD3A 3B9AA 3LX9A 3BAKA 2ZXQA 2BS9A 1RPKA 1TE1A 1O7DC 4UQ9A 1OD0A 2OLHA 4KMQA 3WEMA 3SCVA 4ATDA 1E43A 2VVSA 2ZUNA 3PBGA 5CGTA 4P8UA 4N42A 3BLBA 3W4RA 1DHKA 1VFUA 2EEXA 3U5UA 1PEZA 4UZSA 4UOZA 5I6SA 2XFRA 3AIVA 3WNOA 4GPNA 1KBBA 2HISA 3VM5A 4WIWA 4JHZA 3UEQA 2WHKA 3ECQA 2CHNA 3WDRA 4ACYA 2YOCA 4DWSB 2AMGA 4PMDA 4Z2GA 3VDAA 3W24A 1KB3A 4ZENA 1PX8A 3A6OA 4W84A 3BGAA 4AISA 3MUIA 3SCQA 3SUSA 1GVYA 3CC1A 3MUZ1 1IZKA 3B8SA 3VMPA 3PHAA 4U2YA 1UWRA 3SCTA 2OWCA 3SIMA 3VIKA 3L4UA 5A8OA 1BGAA 2W66A 2VT0A 4WF7A 1FP9A 2WLZA 2E8YA 3RMEA 1V0KA 1OINA 2EJ1A 4M81A 4H8VA 1WDRA 3WBEA 2G3MA 4HZ6A 1XD1A 2CIPA 1HKKA 1U30A 1V0NA 4GIAA 1E15A 3BVWA 2VQUA 1OGGA 3S6TA 4WSKA 3OGVA 1C8QA 2WMHA 2HVMA 1CXEA 3EJUA 3GNRA 3BAIA 4MB5A 1HJQA 4CU6A 2VI0A 4UTFA 1JXJA 3WDJA 3UR8A 1EH9A 5JIPA 2XM2A 3CZ8A 3AMCA 3T2PA 4AEEA 3BVTA 3QHMA 3K4AA 3W28A 3A4XA 2WMKA 1UR9A 1K9TA 1B3YA 5GNYA 1PX4A 1R85A 3VILA 3CLWA 2Q8XA 4IPLA 2EPNA 4AZGA 1UG6A 4H04A 4D72A 2BVTA 1AQHA 3FW6A 4URIA 3BAXA 4MNJA 4AW7A 2GJXA 1W3JA 4TVDA 4U3CA 4PMRA 3WY2A 1R7AA 2CKSA 3A23A 2VZVA 4R27A 1E6QM 2VVNA 3HG3A 5JBFA 3WNNA 1WCGA 3F5KA 1TUXA 3IANA 5A6BD 3WUFA 1MFVA 3NSXA 1UD2A 3PZQA 1D3CA 3VD7A 2ZUUA 4D6IA 4AZ6A 1GOWA 3VMOA 2DPEA 3PN8A 2EPOA 1EHNA 2VOTA 4OGZA 2W92A 3AZTA 4MPKA 4NSBA 4LPCA 1JDDA 3GXMA 2JIWA 3RIKA 5IFTA 2E9LA 2D3NA 1GHSA 3WENA 1K6AA 4HMEA 3TTQA 2YBTA 4AD3A 4DWSD 2CKRA 4CN4A 3ZO9A 3VDBA 4X0NA 4PSRA 4W7WA 5D9NA 3VD9A 1J0HA 4UCFA 2G4FA 2EPKX 1QBBA 1OSEA 3WUGA 5E9AA 1UQZA 2O9TA 2OW6A 2WANA 3HU7A 2UY2A 2EABA 2J47A 5FIPA 1TQWA 4CKQA 4GI9A 1E3ZA 1LL6A 4HOZA 4FLSA 4AY1A 4F9JA 1JDCA 1MW1A 4CU7A 4FLRA 2NSXA 3T0BA 3AHTA 4Q22A 2J7EA 3AZRA 4HU8A 3BUBA 4FF5A 3LXAA 2RGMA 5CLTA 3GM8A 1BQCA 2DDXA 4MDPA 3VNYA 4FLQA 3N11A 3ZQ9A 5BCAA 2BY3A 1F4HA 2BY0A 3TTYA 2XWEA 2XTKA 3M6DA 4FNSA 3CUIA 1UZ4A 2ZXAA 3LRKA 2DGAA 1KWKA 2MANA 3RDKA 1KCKA 1EXPA 1BLIA 3WDPP 1C3FA 4PMYA 3WD1A 5CSUA 1E6RA 1WNOA 2F7OA 2JEPA 4HZ8A 3L2MA 1V6XA 1UKOA 1Q6EA 3VOCA 2Y5EA 2X0YA 2AOSA 2ZWZA 3PTKA 2D3LA 2WPGA 3ZM8A 3DX1A 3SURA 5A6JA 1E56A 2XFYA 3EJQA 1Q6CA 4P8VA 1MXGA 5IDIA 1QNRA 3L4YA 4D6JA 2VCCA 1UOKA 5D9OA 3T2OA 4PMXA 1AMYA 4D6GA 2DH2A 3K8LA 4OKDA 3AI0A 5E70A 1WKYA 4HA1A 1V3IA 1ISXA 3MMDA 3I3BA 3UG5A 5KEZA 3DYOA 4JFUA 3VX1A 1E5NA 3HN3A 4B3LA 1IZJA 4UQAA 5HBFA 3L4VA 2E9MA 3GDBA 1WPCA 4JFVA 3O6AA 3FHAA 4JHOA 1JZ2A 4M29A 1FP8A 2J7DA 5CSYA 1BG4A 1D7FA 3EJPA 5ABGA 2C7FA 3VX0A 3GXTA 4FNTA 1GOIA 1TCMA 4JL1A 1DWIM 2YFOA 2VCAA 1UASA 1WP6A 4JFSA 3N04A 4TX8A 1VB9A 4MAZA 3QOKA 7A3HA 4OOUA 3HG5A 2GVYA 4V27A 3WD3A 3FNDA 4H8HA 4FNUA 3ZIZA 1GOQA 1JXKA 2VX5A 3GTNA 1NARA 2IXUA 1JF6A 3MANA 2VZSA 3WF3A 2RGLA 1XH0A 2WC3A 1UWSA 1CTNA 4MB4A 2ZUWA 2WMIA 3OLGA 1GVIA 8A3HA 3WD0A 3GH4A 1MW2A 2D0FA 1VFFA 4GZIA 5I23A 2DSVA 4TTUA 2XSBA 2D1ZA 3PZTA 2XJ7A 1UD6A 2A3AA 4UOJA 1R34A 2WCAA 5BXRA 4P8WA 1UKQA 1R47A 2VURA 3AYRA 3B9EA 1QBAA 4AWEA 1TQTA 4CN1A 1KGUA 1CLXA 3WBAA 1BTCA 1D2KA 5HXMA 3D52A 2WYSA 3LXCA 1BHGA 4PMUA 4E8CA 1E0WA 1KGWA 2FHCA 1C8XA 5ABEA 2D22A 4XB3A 1ISZA 2YLLA 3CZEA 2UY3A 3PZMA 2Y8VA 2ZOXA 2D73A 4NI3A 1EGZA 4E8DA 2XN2A 3WKZA 1UH4A 5JIWA 5M5DA 1NWUA 3AMKA 4HA3A 2DT2A 3KEHA 2OSXA 3WMSA 1B3VA 1ISVA 3CH9A 1US2A 1PS3A 3VIJA 1Y7VA 1JGIA 1H0IA 2BXYA 4PYSA 1DP0A 1OIMA 3MO4A 1TFVA 4WSJA 4KH2A 2X05A 4LYRA 2VR4A 3MMUA 4F8XA 2J8GA 2J7FA 5BXTA 1XH1A 4QDMA 1W9UA 2WWDA 4JAWA 2CPUA 3MMWA 3CPUA 2QF8A 4UFHA 3SCPA 1HN1A 1U33A 3WH6A 3HZ3A 2WMIB 1JFXA 4LQ1A 1XRVA 1LWJA 5CPQA 2WVUA 4J3WA 2YDRA 3PZGA 2WMGA 1MQPA 3BCFA 1LG2A 4P7LA 3HMCA 4ZE4A 4GXPA 1OCQA 4AZBA 3AYSA 5A6AA 3FY1A 1CWYA 1E4LA 3AIRA 3CTTA 3FHQA 3W6MA 4PTXA 3IJ8A 1B9ZA 2ZX6A 3CHEA 4MJ2A 1LWHA 1TVNA 4B9ZA 1CENA 3AIUA 2PWEA 3VIMA 4TVCA 4C7FA 2WAGA 1LLOA 2VJXA 1UKPA 4J27A 1ODUA 1E9LA 4ACZA 4DUXA 2GUYA 1J12A 3EDFA 4RE4A 4EE9A 1VBRA 2VMFA 4IM4A 3DECA 4JZ5A 4C7DA 1JAKA 3VSTA 2YBUA 1QNQA 2ZX7A 1ECEA 5I24A 3BH4A 1E6PA 2ZUMA 3WDHA 1X1NA 1E70M 1E4MM 3RM9A 2GK1A 1B30A 2V3EA 4CD8A 1PZ2A 4LXFA 3OA5A 2V3GA 1LL7A 4AXNA 2F7PA 1UR0A 3OLDA 1CGUA 3KZSA 2QV4A 1HX0A 4WJXA 5DT5A 2E8ZA 2EAEA 3CHDA 5I79A 1FA2A 3G6MA 5E6YA 2ZX8A 4TVUA 3UESA 3A3HA 3T0DA 1B31A 5E0FA 2XM1A 5A6LA 1GONA 4PBGA 4PCSA 3ZMRA 2BHUA 3WUEA 2A3CA 1KQZA 3MU7A 1NH6A 4W85A 1J0ZA 2YIHA 5EMYA 4Y7EA 1B3WA 2DEPA 1ODZA 5CPSA 3WNMA 1UD5A 1OIFA 1C92A 3MKKA 5FKYA 3AS1A 4HPHA 2XVNA 4MB1A 3JUGA 1J9YA 4OZOA 3SEPA 3ARTA 2J78A 3PZNA 2XSAA 3AZSA 3VUPA 2ZUVA 2WXDM 3VIFA 3FN9A 3LPFA 1VFOA 4NF7A 2CEQA 1JD7A 6A3HA 1B0IA 1R86A 1M53A 3LPGA 6TAAA 5GNXA 2WZHA 3WY3A 1KGXA 4N0RA 5GPRA 4ACZB 3WD2A 3KL5A 4OJYA 4P7QA 1GPFA 3WEOA 4V28A 4Z2HA 4B9YA 4X9YA 3TV8A 3TONA 2YA2A 1C7SA 2JFEX 2GK1B 3VNZA 4MTVA 2WC7A 3LRMA 3BAYA 2F8QA 1E73M 1QHOA 4GZEA 4HZ7A 3I3EA 3TA9A 5IHRA 3GXNA 4LGXA 3K4DA 3OZPA 1CXFA 1PIGA 1WAWA 2J77A 4B15A 1J18A 2ZUSA 2O92A 3TTSA 4GZJA 3RM4A 1GHRA 2ESCA 4OOZA 2OSYA 4NXKA 1W9XA 1BG9A 3PZOA 3M7SA 5BRQA 4C7GA 1XC6A 3W53A 1GQJA 1FH8A 1CLVA 3G6LA 3WN6A 3SCOA 4PUDA 2B31A 5DFAA 1WDPA 3VIHA 2WW5A 1VF8A 4AD1A 4PCTA 1V0MA 1J0JA 5CGMA 2WB5A 5M03A 4XV0A 4B16A 1PBGA 3WQ5A 3ZJ6A 3THCA 1HF6A 1JZ7A 4S3JA 1V0LA 1H49A 2XIBA 4P8XA 4F9DA 3AMLA 3WY1A 1V02A 1EOMA 4HPGA 5DEZA 3VSUA 2XVLA 5BYWA 4YHEA 1V3KA 3S2CA 4JL2A 3T2QA 5IXEA 2VTFA 1TA3A 1QI5A 2J62A 2VRQA 1JI2A 3POCA 1UH3A 1W91A 3D4ZA 4OBSA 1QNPA 2PBGA 3APGA 5DMYA 2FH6A 3TOPA 5I77A 5D9MA 3IAQA 3KE0A 2ZICA 4BCEA 3K46A 3WMCA 1VRXA 2V5DA 1NOUA 3W26A 2DIEA 4HOWA 3VPLA 1VAHA 4AD5A 5A2CA 5LYRA 1ZJAA 4WKFA 1WZAA 4J3UA 3WELA 2GJRA 1QI0A 4B3KA 2WKLA 1E6NA 3ARRA 4CGTA 2PWHA 3BVUA 4HP5A 3SCRA 2BVYA 1HKIA 1HJVA 2XHYA 1VJSA 2Y8KA 3EJTA 4OIFA 5GQBA 4D1IA 1CGTA 1LJYA 1K9DA 3AIEA 4M80A 2DT3A 4LYPA 3WH8A 3GXIA 2CBVA 3GNOA 3SCWA 4AZ7A 1JYVA 1CGYA 5C71A 1JIBA 1W9VA 3BSHA 1UWQA 2YL5A 3WSUA 3PZIA 2ZE0A 1R7OA 3MSDA 4J3XA 1E71M 4P7RA 1SZNA 2FDMA 4D6FA 3DHPA 3CZJA 1DWJM 4HMCA 4AEFA 4GI8A 1WZLA 5A8PA 3CZLA 2E4TA 1TA3B 2A3EA 5AC4A 1OT1A 4FLOA 2CESA 1WDSA 1VJZA 4JKKA 2CBJA 3QHOA 2VRJA 3LMYA 1PX3A 2UY4A 1M03A 1O6IA 4BA0A 1W9PA 1X6LA 4QCEA 3QHNA 2F1AA 1C8YA 3OB8A 4DM2A 3L4TA 2QMKA 1GOMA 1W2VA 3GBDA 1JYXA 3L2LA 4W5ZA 3OG2A 4GINA 4A3YA 2J7HA 3PZ9A 4FNPA 1E3XA 1Q6FA 4H2CA 3RM8A 1VEPA 5HPOA 1TR1A 4DO6A 2O9OA 1UUQA 4NXSA 1E6SM 3WUBA 2J7GA 3EDDA 1J01A 5E1QA 2GJXB 3F5JA 3OIHA 1R46A 2JF7A 3ARPA 1W3KA 3T0AA 2VX6A 2D0HA 1R87A 4QFUA 2VX4A 3WDQA 3VGBA 1FHLA 3VIPA 3MV11 1GORA 1XD0A 5ABFA 1V6WA 1ZBVA 1CGXA 1ITXA 1XCXA 2Z1SA 5EFFA 3W25A 4Z2LA 1EQCA 5E6ZA 2J7CA 5I3DA 1US3A 3BUPA 4W88A 5I78A 1G0CA 4NRRA 3GH7A 4J28A 3OZOA 2PWGA 1DWFM 3M07A 2DSZA 2JIEA 3VKKA 1BSIA 1B2YA 1XSIA 2WSPA 4A3HA 2XYLA 1DWHM 3ZJ7A 3N18A 5D8ZA 4Z2IA 4A4AA 3DX4A 3BAWA 1SYTA 3VSVA 1ZJBA 2D20A 1BYAA 5LA2A 3A4AA 1VEMA 4UQBA 4UQEA 1CBGA 1UD4A 7TAAA 3POHA 4CD5A 1CIUA 3WDIA 5A2AA 3K1DA 4Z2KA 1JZ5A 1PIFA 3N12A 2W62A 4PTVA 3FXYA 4JCMA 4HU0A 1HJUA 5EBAA 3VGDA 3BMVA 1V6UA 3W82A 2EACA 1VENA 4WKHA 3U5YA 2QLYA 1VFMA 7CGTA 1L0PA 5HDRA 4W8LA 5EFDA 4F66A 1ZBKA 1JF5A 1HXKA 3DX0A 5CJ5A 1A47A 3EDEA 5HPCA 1JZ4A 5ABFB 1TZ7A 3DDFA 2PWDA 4EK7A 1O7AA 3BAJA 5E09A 1XSJA 3N15A 2J74A 2WHMA 2GJPA 4MADA 3AIWA 2WMFA 5D9PA 5I5RA 3N1AA 2VQTA 4DO4A 2QPUA 4RL3A 3AICA 2PF0A 4CCDA 4D71A 5AC5A 1GJWA 4AD4A 1M01A 2W61A 1XHGA 1GW1A 1E6XM 3TP4A 4ZXLA 3GBEA 1N82A 2JALA 2UY5A 3VGFA 4LX4A 5FL1A 1UH2A 4AIOA 1HVQA 4QCFA 4BQ5A 1CXIA 1HP5A 3IK2A 4NX0A 2DSWA 1BYBA 1GQIA 4KRUA 3WH5A 4JFWA 2WBGA 3CZNA 2BHZA 3GXFA 2EO7A 5GNZA 4HMDA 3WF1A 2E0PA 1V6VA 3AMDA 1B1YA 1EHAA 2DSKA 1GQKA 1L8NA 2ZWYA 1JG9A 4HOXA 3GZAA 5A2BA 3PZUA 3TTOA 1SMDA 2X2HA 2DIJA 2VX7A 4AIUA 4MNKA 1TQUA 1C90A 2YDSA 1EDQA 4PMZA 1W1PA 1NWSA 2WHJA 3AXXA 1JI1A 4XZWA 1EO7A 1UKSA 1R8LA 1JFHA 1M7XA 5I0DA 3WL1A 2XVGA 3CGTA 1CGWA 3VD3A 3L4ZA 1HJXA 2FH8A 4W7UA 3VGGA 1XCWA 2W91A 2UWFA 1MW0A 4CD6A 1QPKA 3ZT6A 1A3HA 2D2OA 1DTUA 2F1BA 4UFJA 3AXHA 3CMGA 3VD5A 3MI6A 4W8AA 4GO9A 4E2OA 2ZXDA 6CGTA 4D6EA 4QAWA 1NOFA 3ZR5A 4MNLA 5A94A 2Y2WA 2X2IA 3T08A 1WZMA 3BUQA 3UCQA 2YL9A 3DX2A 4XUYA 4GQQA 4PN2A 3D5HA 2EPMX 2J79A 3M46A 4GKLA 3PTQA 4UQCA 3VGHA 2BNJA 4UFKA 4KRTA 1LL4A 4F79A 4WKAA 3DYPA 1SR0A 4AZHA 3ZOAA 1JYWA 2CITA 1QW8A 3WFZA 5FCZA 2O9PA 1BAGA 1QHZA 3WD4A 5AYIA 2ALWA 2X8RA 3H53A 2NW0A 2WM0A 5HOSA 3THDA 3ZT5A 3ARVA 1UHVA 3LRLA 3H54A 1E40A 2Z1KA 2WBKA 4D6DA 2WCGA 1GCYA 3RJYA 1J11A 1WE5A 1RH9A 4H7VA 2QPSA 1E5JA 4QLKA 2PWFA 4D1JA 2GFTA 3N9KA 5JBEA 1EO5A 3K8MA 3U7BA 4IPNB 1E0VA 1C91A 4W86A 2WZIA 2DT1A 3WNKA 1ESWA 2G3IA 4PTWA 2F7QA 4ATWA 2AAAA 4CUCA 1QVBA 1WO2A 2WKGA 3BC9A 2VC9A 1J10A 4AMXA 1I75A 3GXDA 1W3HA 1OB0A 2G3NA 2XPKA 2YA0A 1R75A 1Q4NX 1HXJA 1R33A 1V3LA 1P6WA 1SFSA 1KR1A 3NSMA 3KL0A 4WK9A 3AHZA 4PRWA 3EJSA 2VZUA 3SCSA 1XYZA 1C93A 2ZIDA 1KQYA 5LA0A 1VIWA 2EADA 1QNSA 4KGJA 3VIOA 2A3BA 3RCNA 1E72M 3HJEA 2XUCA 3ZSTA 5AY7A 5A8QA 1KTBA 1V08A 3GNPA 1NQ6A 2VZTA 2F18A 1HJWA 3D3AA 5FD0A 3VVGA 1XYFA 1V03A 1W1VA 4CD4A 3OGSA 3ARYA 2EQDA 3UR7A 1ZL1A 4J7RA 3DDGA 1TQSA 1G1YA 1FFQA 4FNRA 3A5VA 4CD7A 1GUVA 5C70A 3K8KA 2TAAA 2DH3A 4M1RA 1HVXA 3WQ8A 3CZKA 1UA3A 1CXKA 1E4NA 4J3TA 3UG3A 5BXPA 5KZ6A 5IHSA 1KXHA 2PC8A 1KXTA 3NCOA 1MVYA 2WVVA 2ZX5A 1BF2A 3EDKA 1NWRA 4JIEA 4NZJA 4K68A 2WWCA 1PJ9A 2WZEA 5ABHA 4QP0A 4YHGA 2XIIA 2X2YA 4EKJA 2X09A 4IUGA 4CVWA 1H2JA 2VZOA 1QW9A 4IISA 1LF1A 1QWNA 3MV01 4Z2JA 4M82A 3WF0A 2D23A 4CCEA 3AMGA 4AZ5A 4U33A 3VO0A 1PPIA 3GH5A 2F7RA 3WNLA 1HJSA 1XGZA 1GJUA 4LYQA 1TG7A 3VIIA 2W4XA 2FE0A 3VD4A 1F4AA 4U2ZA 3EMQA 4AD2A 1EIBA 3EYPA 2J75A 2D24A 4BF7A 2WC4A 5BXSA 1KXVA 2CCRA 1J0YA 1FOBA 1QNOA 3EJRA 4W8BA 2X0HA 1E4IA 2NT0A 4UFLA 4JCLA 3CHFA 5A8MA 3KLLA 1QHPA 5ECUA 3D50A 1CYGA 1ITCA 1GOOA 1JZ8A 1G5AA 5A6MA 1WB0A 4UZUA 3A47A 1V3HA 1H3GA 1CZ1A 3BXWA 5A6SA 4MDOA 3ZJKA 1ZS2A 1BYCA 2E3ZA 4PSPA 2XGIA 3BUDA 1BPLB 1UWUA 1JNDA 2EPLX 2GDVA 3WQ6A 1VEOA 4GO8A 2ZUTA 2E40A 3E1F1 3CIVA 1M04A 3OGRA 1ZU8A 3MSGA 2WVVB 3BUIA 2QHAA 1EDTA 4AMWA 2DSUA 5LA1A 3DHUA 2V5CA 4TOQA 5FL0A 4CU8A 1MQRA 1WDQA 1EA9C 1H09A 1C7TA 1MYRA 1HKJA 1G01A 1JZ6A 2NT1A 3A22A 1XH2A 4W7VA 1TQVA 1OWQA 3AS2A 5A95A 3EMZA 3BMWA 1HTYA 1X6NA 2YL6A 1UR1A 5CZKA 1XV8A 1I1WA 4DM1A 1BFNA 4AD0A 1NP0A 4UFIA 1PZ3A 3J7HA 3O9NA 1UD8A 3FAXA 1ISYA 3SUWA 1NM9A 2DQXA 4JKMA 3QOMA 3OBAA 3BLPX 1H4PA 4PMNA 4S3KA 2VR5A 1CNVA 5D4YA 1HNYA 1E0XA 2BHYA 4V2XA 3VINA 9CGTA 4KWUA 4U31A 1ZBWA 3CO4A 4ZXOA 3RPMA 1EOKA 1HWWA 3VGEA 2D0GA 4W93A 1OM0A 2PB1A 5TD4A 3W27A 4ZEPA 5E0CA 3VTRA 5F7UA 2WVSA 1NWTA 3AJ7A 4AIEA 5CXPA 1TMQA 4DUVA 3RO8A 4AYGA 3ZJ8A 4BQ4A 2XN0A 2WHLA 1GZJA 1TVPA 1DWAM 1CXHA 2F61A 2Y4SA 1JDAA 2JF6A 1RP9A 2XFFA 2OSWA 5BRPA 2O9RA 3U7VA 2YDQA 4L4PA 3VDHA 1LQ0A 2CXGA 3BVVA 4OUEA 2XVPA 2VUYA 1B90A 4TTGA 3AIQA 2XGBA 3CUFA 3CBWA 3IJ7A 1V3MA 2X2JA 3BCDA 3NYDA 3WH7A 3T09A 1WZKA 4M24A 3KWXA 1FH7A 1E6ZA 2OYMA 1CGVA 1W1TA 2OW7A 3LXBA 1H0GA 1UR8A 3ARSA 1LG1A 3NIYA 4OBRA 4PMQA 2CYGA 4ZFMA 2C8NA 1E55A 3IJ9A 2VRKA 4UFMA 4M56A 2V3FA 5DF0A 1G94A 1BVNP 1OGSA 2W67A 2VCBA 3DC0A 2QMJA 2CBIA 1OT2A 1B3XA 4PMVA 2WLYA 5M17A 1BGGA 3GXPA 3O2LA 1H41A 2F2HA 4RE2A 4JFTA 5CPTA 1CPUA 1MXDA 5JBDA 1W2PA 2JE8A 3D4YA 4U5KA 4W5UA 4RE3A 4X0VA 2WSKA 4AZCA 2BVDA 1GQLA
chains in the Genus database with same CATH superfamily
3Q06A 1A0EA 5ADPL 2XWDA 1Z2KA 3ZLFA 1Z32X 2GJJA 2VUOA 3LGGA 4JQIH 2L3BA 3OV6A 5CP3H 3Q5TA 2H45A 3PIQB 4OFPA 1GTFA 4Z95L 4UINL 5C6MA 4E41B 3P81A 2CO6B 4YS1A 1JGEB 1JHTA 2CNYA 3JRKA 2TRYA 4QEHA 4JPWH 5C9KA 4LP8A 4M93B 4W6XB 3ZKND 4A7VA 3BPOC 2BGSA 4IKJA 3CDCA 2WQPA 4NRSA 2B5IC 5E6UB 3ELQA 3D51A 4I85A 3DPDA 5HD8D 1XGQA 4Z7WA 3A21A 3MKCA 4ZNCD 3CD4A 4ZOAA 4MZRA 2DQFB 5D7KD 1V5XA 1BOYA 1TWSA 5CD5D 3TNMB 3SDXE 5B21A 2GY7B 3BLOA 1T2QH 3P3RA 4YZWA 3QR3A 5AAPA 3KM8A 5ANHA 2HYMA 4HZAA 1LE9B 3CMFA 1NC2A 3QB7C 4Y5VA 4WI3A 3BSGA 5L8LB 3TFBA 1OW0C 3OJDB 1WD9A 3MDJA 5EU3A 3KBMA 1NGQH 3CDZB 1AQMA 2VLJE 1H15B 3GG0A 5J5DA 4YBLC 3DYMA 4OQVA 4JLRB 5KBLA 3WJMB 3LKNB 5IHHA 2A74A 4D8PA 4JS3A 1XCQA 5LNDA 4O1CA 2QHRL 3ZR6A 4C1LA 5LAXB 2YSSB 1MUWA 1BQGA 4IP4A 4WEBH 5A3HA 3SDYL 2YD2A 2DU2A 4MJZA 2ZD0A 4ZUVB 3EDJA 4NZ8A 4PB9H 4G7YH 4YNYA 4N1EA 3AROA 2X1RA 3QMRA 1YEIH 4HHGA 1W5NA 2VLLB 3EXSA 4HZMA 2PR9A 4GKNB 1LD9B 2PD9A 3T3PF 3FUDA 4KKRA 3QY7A 1PDKA 2PR4H 2P24B 4C4BA 3NFPA 1FTXA 2DWEA 3CQJA 1CLOL 1OFDA 1E9QB 5DLCA 1MH5B 1FZKA 1A7OH 5KN5B 1E1CA 3ZSSA 4P2OD 1VPXA 2Y7GA 3SD5A 1OTTD 3FH7A 1PKQA 5I5JA 4E68A 4CQCA 4RAVB 1F3TA 3NXLA 4ML4A 4ZMZA 4NAQA 2XRAH 5E23A 4YXLH 1O9VA 1ZGLM 3FDWA 3PL6A 2V2XA 1J8HB 3GBNH 4JREB 5CAKA 1CDHA 1F3JA 5E99H 3BT2H 3OX8A 4ZQKB 2EH7L 1E7UA 1UKTA 4GRLB 4BQ2A 4LEXL 1N8IA 4OZIF 4Z18A 1T6WA 4PUEA 3LCYA 3TBYA 4POZC 2VABA 3BZEA 1LM8V 2I7SA 5E94B 3MHGA 1TOXA 3FT2A 3CUPB 4LNCA 1V7ML 4JPIA 3VI3A 2PDGA 1THFD 1G4MA 4K0OA 5B8CC 5ADPH 4X5RA 5IJBC 1YHTA 1RP8A 4PWHA 1ADWA 1AHWA 1PKYA 1O7DC 3FK4A 1XTMA 2WTOA 4Z95H 4UINH 4ZAKD 5CAHA 1I85C 3VABA 2PDMA 4C60A 3FCBA 2KI6A 5IMMA 3EWWA 3W11C 3W57A 1KBBA 3REQB 1ZLWH 2IXQA 4YXHL 4LS1A 4RA3A 4A7GF 4E42A 5HULA 3B4NA 5C6PB 4AISA 4CNIA 1JCMP 3KYAA 1CICA 4PYHA 4WF7A 1ODAA 3PFUA 4RE0A 3W7IA 5ISZD 1U30A 4WSKA 3BVNB 1VCFA 1K8YA 3AW5A 3QBUA 4KS0A 5JIPA 5E93A 2HX7A 2H3KA 1EIXA 3NPSB 4O2EB 3CZFB 3BQUB 1FVEB 1PX4A 1V05A 5D1ZD 5BOJA 3RCMA 2BVTA 3QJZA 1R7AA 4U0RB 2WWNA 4X6EB 3WNNA 3RX5A 4LAQL 2DWDB 1EJOL 4PJHF 5IP4A 4AD3A 2QHRH 1H3UA 4MXWL 3BUVA 4BE6A 1LYQA 1XYAA 3LSBA 1CLZL 3ZO9A 4X50A 4P5UA 3ROOB 2G4FA 2QQNL 4PJFF 1OZUA 1QBBA 3AT9A 4IFKB 2PPDA 3NSCA 3KXFB 3BH8A 3PJSB 4RXGA 2NPLX 1DJSA 1E3ZA 1LL6A 4HOZA 4ODSL 4AY1A 1JDCA 1JCVA 1MW1A 3OZKA 4OGAC 4FLRA 1LEKA 2NSXA 1T21B 3INUL 5EU9A 1CLOH 4JW3A 3BOXA 4MDPA 4LEFA 2YHGA 5BCAA 3KLAB 4PS4L 2WINB 5AW6B 5ICZB 4J2XA 3DV6A 5K1VA 4LSBA 4DXXA 1INQB 2ICEC 4BFBD 2YQGA 4H9VA 3V0WL 1ORQA 1P4UA 1K6WA 3RDTB 2XWBA 4XAKE 2GVJA 4QOKE 5A3IC 1BWLA 1FVCB 1MHEA 2IS7A 4JY4B 1AGCB 1UYWL 2YLHA 3OKNA 4LCWD 3K8LA 4FYQA 4L4TA 1WKYA 1A9EA 2X2GA 3MRLB 1V3IA 3ZL2A 5FO2A 2EH7H 4LEXH 3APTA 1WPCA 3MMTA 4WY0B 5ABZA 2J7DA 2FX9L 2ZAIA 1D7FA 4IRSA 4MD5A 3AFLA 2XY1A 1V7MH 3GT6A 1GZHA 4MVBC 1PZDA 2XTJC 4G9DA 4P5MB 3EEGA 4TX8A 2XIJA 2Z92B 4Y9CA 4N25A 2YSWA 3D0LB 2OR2A 3GC5A 4V27A 3WD3A 1ID5I 3NA4A 3QRGH 1RZ8A 4LPTA 1IUZA 4CC4A 2VZSA 1F4XL 1Z5HA 4NO5A 3LNHA 3NQMA 1N5AA 4TTUA 3FTSA 3UBXA 1UD6A 1TQTA 5DQ9B 4Q6JA 5TTRA 1CLXA 3ZFHA 4F8PA 2IMNA 3NCMA 4QHLA 3FTUA 2C91A 4CQBA 3MREA 1W3NA 4YVPA 1OF0A 1MFBL 2ISFA 1TSHA 2UVFA 2HT3D 3LB0A 1PCKA 4MJIB 1DZ0A 2D3VA 1F76A 4FXGC 1EGJA 4NPYA 3IRPX 2BW4A 1GMIA 2PXYD 3U79A 4Z3HA 3MZNA 2ZSWB 4WSJA 3RVWD 3H6OA 4HWZB 2RH9A 2X05A 3WO4C 1NDWA 3UDWC 5G1YA 3L45A 2IQAB 5J3HC 1KFGA 2HQAA 4AX7A 2WVUA 1FCQA 4JJHA 3QEGL 4DN1A 5MEND 1REIA 4ZE4A 2C34A 3L3KA 2XG5B 4C6NA 3KLDA 2J8UE 1HQ4B 4LAQH 1S8DA 4JE4B 3KTXA 1EJOH 3RXZA 3MCOA 3V5HB 4F7MA 3BAEH 4GQPH 1NFGA 1VBRA 3Q05A 1I1CA 4MXWH 2VQ1B 1MI5B 1CLZH 2H0FA 3F4WA 1PWMA 2QQNH 1XF5A 1A6ZB 1VR6A 3P6LA 4NC2B 3NQGA 4U3HA 1MFCH 2HJFB 3DDMA 5D7JA 1VFAA 1ETZB 5IJDC 3G6MA 4ODSH 3A3HA 4ZW5A 1QWGA 1NF0A 3INUH 4FX6M 3KWWA 2Q6WB 3F6LA 4HEME 5EMYA 5E8DL 4O53A 4O51B 1ODZA 4PS4H 4Z7QB 2NQDA 1NINA 1KCXA 1S7SB 4D0CA 4QT5B 3AGWA 4XMUA 4RDWA 3FNKA 3V0WH 2W5PA 3VIFA 1NUGA 2EJAA 1ZV2A 2Y0SA 3IJYA 2XVBA 3KLHC 4MSSA 5EOTA 1PD6A 1Q38A 1UYWH 4JDYA 3OG4B 4NO3B 1YDNA 1X5AA 2Z0BA 4HLZG 3MX0A 3OR7B 3QV7A 1Y6NR 2YLKA 5JW4R 3S1WA 2YN5A 3LRMA 4QRPB 4XNYL 3DX8B 3I3EA 2YCEA 5K9KA 3KVLA 2FX9H 1L0XA 5D03A 3L3JA 5DI8A 3MRDA 4AXKA 2OZ8A 4DQAA 2I1OA 2PNDA 4UILL 2B31A 1XT5A 5JH2A 1WDPA 4MUZA 4AD1A 4A2GA 4KU1A 4XV0A 5E00A 4Z3FA 3BSZA 1F4XH 4F2MA 4F9DA 3D3FA 2BVQA 5GSRB 3W0WB 5FJRA 2YD9A 5DJ8B 2B81A 1HSBA 1A6UH 4LSQL 4GCXA 3MRKB 3QH3B 2QCCA 1YMHB 3W2LA 1W91A 2BDQA 2ZONA 3I6GA 1MFBH 5IBUG 2V5DA 5DJAA 1LT7A 3VFLA 3WX7A 4PRPB 2Y0FA 1JK8B 3SCRA 4B5XA 2ITCB 2BNQB 1YCSA 1HJVA 5KBDA 1NEUA 5D7IB 3IN0A 3DIFA 1CGTA 5FW6A 1LJYA 3D47A 4GRMB 2XXGA 3RWIB 5D93B 2VXNA 4JTQA 2PO6C 3BSHA 1BYPA 4DXVA 2FPTA 2ZE0A 3HZMB 1MAJA 3K5XA 4Y1AE 1E7VA 5IQLA 3QEGH 3LZFL 4LLMA 4NIYE 3PWJB 3RUBL 4GI8A 5A8PA 4L1DA 5AC4A 1IGFL 5I8CA 5AFAA 4ODXB 4HJUA 1J9RA 1V6TA 5FKAB 4HQQL 3MJYA 3BG5A 1KYDA 5AHFA 4MVAA 1O66A 3WIHA 4H2CA 1VEPA 5HPOA 4DO6A 1XGPA 1AHKA 5DUML 1CFQA 1IC5L 2GG1A 1W3KA 3AUVA 3KPQA 2VX4A 4P9HL 3C2YA 1YLBB 5I3HA 1SR9A 1SBBA 1SDDB 4K3ZA 5LVEA 2BJML 2PDUA 1MG3C 4WUKL 4FR6A 4YSSA 4JFDB 3ABLB 3MHUA 3C6SA 3WFDL 3BWZA 5E8DH 3TC9A 1G0CA 1KG0A 4HF5L 1OZMA 1TJ2A 5IJKA 3KBNA 1MKFA 3WLKX 3W1UA 4H2AA 3GG1A 4N28A 3ES7A 4P2OA 3SRKA 4DQWA 4CW1A 5AC8A 3W5NA 1SRDA 4PJAE 5FDYA 2A4EA 4HU0A 3KCPB 3UZEC 5IHLB 5EBAA 2E5CA 4JM2F 5IJVB 3MR9B 2JCCE 4XNYH 5C9XA 5KBKA 3QWOB 3W1RA 1SJEB 5D1QA 5JIHA 3N9GL 3TSDA 3KJ6L 3QTPA 4IGSA 2XPGA 2H32A 4Z7VE 2DZTA 2GJZB 2X4QB 3AIWA 1XIWB 1E51A 4I2XB 4PJ9C 4DO4A 4IGHA 2OFJA 4GJJA 2HFFA 4UILH 4PA8A 1YNPA 4UV7L 1KB9J 3BKML 1CTMA 2Z28A 2VOMA 1A6PA 1WXZA 1G9EA 3SY8A 4XO5A 1HP5A 1I7ZA 1NFDB 1GQIA 4ETQA 2BVOB 2YBRB 3CZNA 4GBUA 1NL0L 5DXXA 5JIDA 2E0PA 4LSQH 4ZAKA 4FKKA 1RIVL 5CSRA 3TBCA 1AJ7L 3BG3A 3U2CA 2ZJSL 2K3HA 4LLAA 3C8KB 2JKXA 1U5JA 5CZXC 1JK9A 1R30A 43CAB 4I9AA 4HAKA 4Y5XB 4UNTA 1NMCC 5G2IA 5D1XC 1G7IB 4W8AA 2Q7YA 2ZXDA 1HOEA 2A5UA 4F20A 5C0JB 1MFDL 5A94A 2DQWA 1AL7A 1DBAL 1ITQA 4PULA 3BD3A 4GQQA 2Y62A 3C2FA 3OVGA 4KROC 3CIWA 2NY6D 3PTQA 5AYXA 1GPWA 1IAIL 4WJ8A 3MRHB 4G8GB 2VFHA 1E90A 2P3EA 1JPTL 2O9PA 5C0QA 3GIZL 4FG2A 3CFEA 1K85A 5D7LE 4YDVA 2OXHA 3LZFH 3H3PH 5D4IA 3WFHA 3KDOA 3KTSA 1IGFH 1PTZA 4KBXA 5FFGA 3O9WC 1KGJA 4G6AD 4AVJA 3R58A 2VFGA 4DI9A 5IW3A 2BSEA 4HK3N 1PS9A 4QLKA 3PGDB 3H4GA 5JIQA 3U7BA 4IPNB 4HQQH 2ZDSA 4HFWB 1BEXA 1ESWA 4POCA 1OPGL 1GZGA 1J10A 3MJMA 4CVZA 2IAMB 5DUMH 1XYZA 4KRZA 1U2HA 1EGMA 1IC5H 5LA0A 1VIWA 3KJ4B 1H1ZA 1NKGA 3O7UA 3MV7D 3ZE1E 4JFEE 4QGTA 2FL5B 4XIAA 4NILA 4P9HH 2G0WA 2F18A 3LNEA 3O6ML 2VDRL 2AGJH 2BJMH 1YEDA 4O1FA 4W9GC 4WUKH 1TQSA 2W9MA 1RVGA 1SJHA 4YSQA 5LXGL 4W1TA 3WFDH 3B05A 4YVUA 1KPRB 5BXPA 1W5QA 1WKEA 3D2TA 4HF5H 1RD5A 3CPGA 1LK2A 2A79A 4K68A 1LEIB 3UH8A 1GC1L 2H9GA 3EYFB 4YHGA 2AXHA 1RIHL 4BWLA 2K6ZA 5BMWA 1N55A 2YW3A 1L6FA 1U83A 3D3VB 2MFNA 5F2IA 3DIPA 2J9ZA 2ZF9A 3MRPB 3HBGA 1HJSA 4IJRA 4LYQA 4JQIA 5TH2B 1MNSA 1F3DJ 4WK0B 2YXVA 4OUUA 4U2ZA 5CP3A 1KYOK 4LCWA 2HTLD 4APQD 3QDME 1NGXB 3N9GH 4XGZA 3KJ6H 1DUYA 4HUCA 3EJRA 3U46B 3CHFA 1IEIA 1PV8A 1QHPA 2VLRD 5JDSB 3PWPB 4UZUA 4OZGB 1QAWA 4GUOA 4PH6A 3PWUB 1UWUA 4UV7H 1TNNA 3BKMH 4J3BA 2R1XB 2PP3A 2E40A 4ADGA 4J6RL 3GWQA 5I6NA 4CQ9A 4D9PA 1MQRA 1H09A 4GFXA 1C7TA 1NL0H 3UXAA 4AXWA 3AS2A 3F7VA 3ABSA 1HTYA 3EKCA 3SD2A 4KKBD 3ZTCC 3QVAA 1RIVH 3V16A 1AJ7H 3ABXA 2D9CA 5FXCH 2ZJSH 4TMCA 2I85A 3GSVA 4I89A 4KDWA 1ALDA 1PZ5A 3D18B 1WA1X 3KZ8A 3CQHA 5IV2A 4K8EA 4G43A 4JZJB 4XRCA 5DD0L 2WZPD 3BOVA 2AK4B 2FNBA 1WAEA 5TD4A 1DV7A 3BWAB 4OFQA 2ZPKL 3EH2A 3ZJ8A 1MFDH 2ENPA 3OOQA 2NLJA 1DBAH 4K36A 1YEWA 2PXYA 4I90A 2EE2A 3V4BA 4C6OA 2YDQA 4F92B 2Y6ZA 1IAIH 1RJZA 2XGBA 1NIAA 3RKPA 1JPTH 2X2JA 3GIZH 3W23A 4DJED 4U6HA 2BGQA 3X3GL 2OYMA 1CGVA 1AJ0A 4EF8A 3MMEB 4OBRA 3DKHA 2YS4A 3QIWB 4RRPG 2V3FA 4GYKA 4LUTA 1GYMA 1TMCB 2IANB 3C5ZC 2P5EE 2XQYA 3G77A 5EO1B 2F2HA 5EOCL 1OPGH 4HVBA 3TO4B 2JE8A 1FRGL 3TDFA 2PE4A 4HPOL 1DQIA 1FC2D 5KYWA 4U5IA 3QORA 3OKMB 4IKNA 4HH9B 4PR5A 1F6AA 4YEEA 2EE0A 4RIRB 3PUDA 1JTTA 2WIMA 4A1RA 3TNNA 4EAMA 3WF4A 4EPKA 3O6MH 3BISA 2VDRH 3WBXA 3SGDH 4JGUA 2JBMA 4OZHF 3HRZA 2J8FA 4TUJA 5LXGH 4X0KB 3U4AA 1MZHA 2Z65C 4D2JA 3S1GA 1H8OA 4F2UA 2WBJA 1UQYA 4WHBA 1SHWA 3AISA 5HJBA 4Y9PA 3RWCA 3GR4A 5DZOA 2E46A 3PDOA 1GC1H 2H6PA 1LROA 3S96B 3MU3A 1QX1A 3O3EA 1RIHH 4QGCA 3WY4A 1KPUA 1I8MA 2JCWA 3MI3A 1S2WA 2WKOF 4H1ZA 3N17A 4HIEA 5A8NA 1R0MA 3G5VA 4EWND 1P7KB 4NRYA 4A8RA 1DOSA 1XRFA 4AZCB 3GX9A 4M4RB 2EVIA 2I9UA 2N7BA 3VRLE 3DX3A 4Q7DA 2BNUB 3T3MF 3TWAA 5HHNA 2XG9A 2VO5A 3GY1A 15C8L 2K8QA 1TIMA 1Z5LA 3IFLL 1F56A 4UQDA 1KCZA 1M6JA 4F7TA 5ESAA 4LAOA 4AQAB 2AAMA 4I3SL 2ZNXA 3LEPA 4HQVA 4J6RH 4U3AA 1X44A 4WW1B 3VDCA 2QFRA 2XETA 3A24A 3GIVA 2KZHA 2J2ZB 5DMJB 4X7FC 4S3CA 3U57A 2GBUA 3EUUA 1H1NA 4W9CC 5FOOA 1WC7B 2ISWA 1MVUB 3RNKB 1F4WL 1XI3A 2IMRA 2BNRE 4MNGA 2Z7WA 4GB9A 5DURD 4G8EA 1RZIB 4KOBA 1N12A 1IGCL 4MMXA 1OGTB 4KFMA 4ONOA 2JV6A 4K37A 3SCMA 3WK0A 1PCWA 3C6LC 4ANKA 2DFAA 4I3GA 3QUYD 3L21A 5DD0H 1FFOA 2CBOA 1DQUA 2XH7A 2ARWA 2KZ1B 4PCPA 4WNQA 3MBWB 1WT5C 4A2EA 1CURA 1KGCE 4DP4X 2ZPKH 3LNIA 4BQBA 1U9KA 4E9TA 5DRXB 2I07A 2Q2EB 3BPOB 4ZTEA 4XVDA 5JHMA 1F8MA 4L4LA 1D5BA 1AAJA 3W9DB 5IMOA 4ZFOA 4R33A 4U6TA 3FO0L 3V6OE 4Z77B 1PYFA 3AS3A 5HHMB 3MNWB 3HCVB 1HH6B 4J8RA 1ZSXA 3KVMA 4ZMOA 2RR3A 3X3GH 4BZYA 3GUTA 1E50A 1GGTA 2XPZA 1N8FA 3VH8A 2FEEL 5L8JB 1Z5YD 4GOAA 3B9VA 3F8UB 1UJTA 1FDYA 3UBPC 5K9DA 1WBXA 1DFBL 1NBYA 2O0TA 4FO4A 5AW5B 4Q3MA 3MJ8B 2X4SA 4XPBL 3CV5A 3H2CA 3SUVA 1KKRA 4JDVA 5EOCH 1T2XA 2WN3A 2EEAA 1G7LB 1FRGH 4XTRC 5KZDA 4HPOH 5BZWA 3WEXA 4MS8C 3M1CA 5AB9A 4A6YB 1PUDA 2OR9L 5L88L 1Y1UA 3BAKA 3NQIA 4OE7A 1EX1A 3IPBA 4N9OB 4ELMF 3FRPG 1U0QA 1JGVL 3SCVA 4YBLB 4XHJC 3OAYK 5C9RA 4P8UA 1NC2D 1QACA 4LAKA 5I76B 3UYPA 4M6QA 2WO4A 3HGJA 4ZMAT 3HB3C 2K1MA 3HS0C 3NIGB 3BQ5A 4ZUWA 4FULA 3FZUD 3FFCB 4Q8VA 3D1MC 4YE0A 4D8LA 5ITBL 1MCEA 1LO0L 3SCQA 1C9SA 5I17A 3G6AA 2DQDL 4OV9A 4UIOA 4IG2A 1QVOA 4KXCA 3CE1A 3L4UA 4LAMA 3M0MA 3GHSA 2Q3AA 1LLWA 3RIFF 4JIQA 1XD1A 5DJCB 4H9TA 4PJCA 3SBWA 4CU6A 2DLTA 3U1QA 3K6OA 3CIAA 4XZIA 15C8H 1XLKA 4K1GA 4U7MA 4XPHL 3GS4A 4H4NA 3ZXAC 4M1DL 4LMQI 3IFLH 3ME3A 1WUNT 3W28A 3A4XA 2Z7UA 2A3LA 4AZGA 1HE7A 2F7FA 1OQXA 3QQ4B 4I3SH 3MGOB 4WHTB 3VFNB 3ZUCA 2EUZA 1L3NA 4GSXA 5JHDE 1O9WA 4CCZA 1G7QA 2DMHA 2GTWA 4H6QA 1O5PA 1H7RA 1F4WH 1BKSA 2EIMB 2NY2B 3SKNA 4WGWB 5B8CB 1IGCH 2RJHA 3DTUB 5KJ4A 1CB2A 4AC7C 4RMUA 1B3IA 4XCEB 1NMBL 1RIUL 3PVFA 4Q2ZA 4FLSA 2FIKA 4EXPX 5C07B 2PPAA 2CR6A 3SGKC 2VGIA 3O3AA 2ALRA 2E47A 3N11A 1D2OA 1AG0A 3NSDA 3V0UA 1YBQB 4IRJA 3EKGA 2CR3A 2DGAA 1KWKA 4RLDA 2B7NA 5AL8A 4N3TA 3V0AC 4Z0BL 2JEPA 4HZ8A 3FO0H 4QCIA 2AOSA 2ZWZA 3RY4A 4UT9L 2QTVA 3D87B 4OCYL 3ZKMC 3SURA 4FJYA 3AU1A 3NDOA 2DYSB 1ZSDA 3HE6C 5D9OA 1TVHA 4HK6A 1DFBH 3AI0A 1QSEB 4OFYA 5KEZA 4JFUA 4XPBH 1W2KT 1HHKA 3F7QA 4FLHA 1CICD 1FSKB 4AE0A 5GRXG 5H37G 5I09A 2F9RA 2PRLA 2F5BL 1A9BB 1JJUA 2ATKA 1TPUA 5B4MD 4PJ7A 2FATL 2EHHA 5HPMA 2BDNL 2OR9H 1IBDA 1XR2A 5L88H 4LBRA 1JXKA 2IPUK 2HPMA 5KVFE 2YPLE 3CU1A 4ZQTA 5BOPA 3S1XA 3MV7A 1JGVH 4PJBB 3H4HA 2Y88A 1G4RA 4LNVA 1BJ8A 3WKYA 1RVFL 4X8XA 4GUPB 5D4QA 5C2XA 2XQ0A 1M2VB 5HYQA 4LHUB 4B5ZA 1K4GA 1M1XA 3LNMA 3S4TA 1KGUA 3CV6A 3WBAA 4QRNA 5ITBH 4OF3A 1LO0H 3PK7A 3LH9A 3GRIA 2VE6B 2DQDH 3SO5A 4ZS6C 4Q4KA 4Q4SA 1NUDA 4N8VG 4MRCA 5B3JF 3FOLA 1TWWA 4BI6A 2H26A 2P5WB 2VR2A 3DMMD 4Q52A 1RK7A 1C5DA 3ITGA 3LCFA 4R53A 4NUWA 3TN0A 1A53A 3T42A 3O2DL 5D32A 1RJPA 1AGEA 4XPHH 2B0MA 4M1DH 1F1AA 4APQA 4H1LH 3QNFA 1RJYA 1K6QL 3HZ3A 1SF5A 3GKFA 1PEWA 1SPQA 1OY3B 2VLRA 3VJ6B 3Q58A 5D2YA 5H4YA 4OF0A 1BG1A 5F72S 4PTXA 4AYDC 3ANYA 4O2FB 4CILA 1LZOA 4YHZL 4BH7A 4KRNA 4XO9A 2VMFA 4MTMA 2XTJB 2YBUA 3NBNA 4JNYA 4L4TD 2GK1A 1TR9A 3FB6A 5HWMA 1EERB 3KHJA 4HUMB 2AGKA 3CHDA 3WAKA 1NMBH 2AQSA 3QO1A 1FHGA 2H6RA 4FXRA 3T0DA 5E0FA 2H90A 4IRSD 3MJWA 3MQTA 5KOVC 5HWJA 3ZMRA 1QZ1A 2WN2A 2WZPA 1NH6A 5I6PA 1Z9OA 3E6EA 1QFEA 1U1HA 4IMFA 3SYOA 2VENA 2W9DL 4NT0A 3FX4A 4YGVA 1OIFA 2ID5A 5EBWB 5DJ2B 3S6OA 1ZEAL 2OTWB 3AZSA 4KJPC 4Z0BH 1FP5A 2FVKA 3MA7B 5IGXL 3EYVB 4MLJA 4NHVA 5CR8A 4WJ5A 4UT9H 1M71B 1UXWB 3K6FA 6TAAA 4OCYH 3I10A 4FXGB 3OAYH 3SDXA 4MMZC 4DJEA 3IJ6A 4NM4L 1ZTXL 4Y8AA 1Z9SA 4E9WA 4DJDC 2J5LB 3VXOA 3WO4B 2HJKA 1LWIA 2ATAA 1FNEB 3GBML 2P5PA 2F5BH 4WNJA 1B54A 5AKSA 3OXSB 5DQJB 2PPEA 2FATH 3G6LA 4URKA 5DFAA 1RKRA 2BDNH 4FTVE 2VLJA 4LANA 5M03A 2YW4A 3WQ5A 1MJJA 1HF6A 3MBEA 1S2UA 1RA0A 4KHXL 3MLUH 4Y2OA 5DMGD 5DEZA 3W7QA 1RVFH 4Y90A 3G1YA 2QUTA 1ZLWK 4PLOB 1VGKA 4F2BA 1ZFJA 3G18A 3RY6C 3U0TB 3KHOA 2CHDA 1PO9A 1P5BA 1P4LA 1NBQA 3E0LA 3H2WA 4HGWA 2DQTL 3HVDA 4IEFA 4RCXA 2FUQA 3CDGB 2F5AL 3WMCA 2WY3B 3GINA 4GRSA 3MNVA 2BH0A 4TL5A 4M7SA 1VHNA 1E6NA 4HP5A 3ITXA 4JE0A 5CINL 2A6JB 4IOFD 3QIBB 2YC1B 3IDUA 5HI5C 5EU4B 4M80A 3O2DH 1KJ2L 4LYPA 1YJDL 2FCBA 2CBVA 3SCWA 1Y0LA 3IK4A 5HJ3A 3Q37A 1AG6A 5D7JD 3PF3A 4QJ1A 4X63A 4PFEA 2WUBL 4YHNA 4C83B 5EU5A 3C12A 5J06A 1K6QH 4K3HA 4S2SA 5E6RB 2BO0A 4P7RA 3NO3A 3TVMA 4RMQA 5FECA 5LKYA 3DVNB 5EG6C 3EKLA 2QVFB 1WFTA 3MLYL 3QNXB 3CZLA 3NA8A 2ZCKL 2YEQA 2CESA 2Z6JA 3LMYA 2R29L 1AZ1A 3P77B 3TN4A 2E7CA 2GCYA 3C5JA 4EI5A 1JYXA 4W5ZA 1R5VA 1T1YB 5D7EA 1PZ1A 5K93A 2X70A 3QPQD 1SZRA 4IUOA 2QADD 3JW7A 3SBQA 3IV3A 5TDNA 3P69A 2OTPA 5E99L 3D12B 3GHBL 3WDQA 3VGBA 1LE5A 2F2KA 3JT0A 3RG1C 2GL5A 3ZWSA 4HSHA 1ZVNA 4FERA 4JFZH 3MC0A 3QJVB 32C2A 4HBKA 3LMZA 2PP0A 1ZQ5A 3VCLB 1ZT7B 5E6ZA 3H23A 4FX5A 4KAQL 1YY9D 2WWKT 4LLYB 5BXFA 3L23A 2W9DH 2H8XA 4BUHA 2CGRL 1ZEAH 4RAUA 3RLHA 4GFTB 5IGXH 3VSVA 5KAQF 5BUPA 1BYAA 1EJUC 1DE4B 1SJVA 5EC1A 2NNXA 4O58L 1DLHA 3S46A 4NLAA 4PGEB 3DVGA 3E0WA 3BMVA 4LV9A 4NM4H 1ZTXH 3BGGA 7CGTA 1EUUA 2Y6SC 1J05A 3VB9A 2PO6B 5JNYA 3GBMH 2Y2TA 4NUMA 2X12A 3W9ZA 3MPCA 5F88B 1TTGA 3HR5B 4MY8A 3IF1A 3QMTA 1XHGA 1E6XM 1KLFB 2BCMA 4QGYA 1P4IL 4KHXH 2UZIL 4GXMA 5LBGA 2ZTBA 3QRBA 2OO0A 3GXFA 1TENA 3ENLA 4HG4K 4GC3A 2QKIC 4FQHB 1GW9A 5DZLA 2BLFA 4DEFA 2WP3T 4B41A 4KQ3L 1UT2A 2XBDA 5IB5A 5DEGB 1Z9AA 1SYSA 1XLDA 3T44A 4NQCE 1EDQA 4AENA 1W54A 4REQB 2HFGL 3K2UL 2R1YA 4AQ8A 2DQTH 4JFYB 2F5AH 5IROC 4QRQA 1TKKA 1DANT 2YRPA 2G9HB 3CN3A 2X4UB 3CMGA 4GW4B 4HZLA 1A1MA 3C6CA 5CINH 2GI7A 2X2IA 2GC4C 2RAMA 3NCEB 2F15A 1KJ2H 1YJDH 4PN2A 1NJ9B 1BREA 4TQHA 5KVFL 2HPIA 4UTMA 4L4VB 2BNJA 2X6CA 4QOKA 1GVRA 1B2WL 2WUBH 5E8PB 4KX8A 4HK7A 1BAGA 1BFOB 1S2VA 3ZT5A 2YX0A 3E3QC 5C08B 3OAUL 1WHPA 2Y61A 1E40A 3MLYH 3EX1A 2J1ZA 2ZCKH 3F64A 3UAFA 1MCJA 1GCYA 2AJSL 4CJ0A 2EH8L 2F8OA 5IG7A 2R29H 4WFFE 3KAOA 5ERWB 4F33B 3LBMA 1EO5A 4MQSB 3ZDXE 2OLAA 5EF3A 2WZIA 5F7WC 3WNKA 3BIKB 4QDWA 4CUCA 3RY5A 4X9FA 1X7SA 4JPGA 3O45B 4PJ9B 1SFSA 4V11A 2VZUA 2ZIDA 2Z1PA 5K4ZA 3GHBH 3RCNA 1Z0NA 3RI5K 4QXTA 1HJWA 5D1QD 2MHAA 1EL3A 1MF2L 3OGSA 3TN5A 3D4GA 3ARYA 3QBTB 5GRWA 5K7JA 4L0YA 1W0YT 1RZMA 3TPUB 5U7SA 4KAQH 4Q89A 4OI9A 3EYQD 3URBA 3QEQD 1XGTB 3LYRA 1US0A 3LZOA 2AQ3A 5D2VA 1FH5L 3IJQA 1XQKA 2YDAA 1RZGB 4LAJH 1DQJA 3BP5B 3BLIA 2CGRH 5CBAA 2WV3A 5BNKA 3D25B 1I3GL 2Z0IA 3EAUA 4L8SA 3CVCA 5KVMC 4C4KT 2AERT 3V6FB 3QRGL 4IUGA 2GI0A 2VZOA 2VC7A 1KIQB 4O58H 1BAWA 2WJDA 3RPBA 1LO5A 4WI7A 1XYCA 1X5GA 3ABQA 3MJGX 4KROB 2QCEA 1CD9B 2CCRA 5EIIG 4W8BA 1MCOL 1IAOB 3BV7A 5A8MA 3KLLA 1G1CA 3TFXA 4RX0A 3OEXA 5JIMA 3C75A 2WJFA 2MQ3A 5DJDA 4GUHA 2J8UA 2R91A 2E3ZA 4F7CB 2CNZA 5EO0B 4NZTL 4W4QA 4I13B 4HHHA 4ODVL 1HFUA 2OMBA 1P4IH 2V5CA 2UZIH 1V7YA 1M3JA 3S8FB 4RR4A 1G01A 2G2PA 1HHJB 4EF3A 3CFCL 4MKSA 1UG9A 4KQ3H 1V79A 1AKJB 4JDEB 4H0GA 4E2BA 1CN4A 5INDA 4WY0F 4MWAC 2HFGH 3K2UH 2BSED 3VQ1C 4RQQA 1H0DA 3S48A 3G1FA 3HPZA 4YL4A 3EX6A 3BAEL 1OGAB 4HEMA 3S4SA 3SJVE 4TS6A 2H1XA 2ZWLT 1OM0A 3DK0A 4FG0A 3VTRA 1L0YA 2QCHA 5T3XD 3S88L 4KWVA 2JF6A 1KBGL 3DMMA 2IBBA 5KVFH 4QJ4B 4N8PA 4Q4MA 4NYUA 1B2WH 1MFCL 3P4NB 3I74A 3NYDA 4U1HA 4XVUC 4ZJ9A 2XBZA 2E9IA 5EBGA 3LD5A 2BMKB 1F6KA 2P3ZA 5AHMA 2OW7A 4LYKA 1FNSL 3P73B 3OAUH 2X5PA 1UB5A 2EC8A 2I7GA 1N0LB 2AJSH 1BAFL 5DF0A 2EH8H 2NUPB 3WO8A 4B5UA 3H22A 3R12A 1MHCA 4D9LL 3TIEA 1OHLA 3DIDA 3O2LA 4FQXB 1CPUA 1IQ8A 1WIOA 4XBPB 3KRUA 2VGLM 6ENLA 4E38A 2E1DA 2G96A 4PJEE 3O2VL 3CVBA 1Y5WA 4QRFA 1GYAA 1MAMH 3MRCB 1QPRA 1QMUA 2C3ZA 1P7QB 4JTIA 5T1KB 1MF2H 2E77A 1HCYA 4LOUC 2V6HA 1OE1A 3CFBA 4ZB5A 3IPWA 2HFEB 2OS7A 5D37A 3GMNA 3I3DA 3VA6A 3B9DA 5DD5L 4P2RE 1MZRA 1FZJA 1FH5H 1J8KA 2V0TA 1BVZA 1UWEL 1W9DM 2JB6A 5AVHA 4GI6A 2Y24A 3CASA 5C8BB 4FQJL 1I3GH 1WXJA 1BP3B 2WNWA 1F4YL 5HHVL 1YADA 3Q0HA 3M41A 1ZB5A 5IUCA 4J3VA 2I69A 4YNGA 4H8WL 4LOVA 1S5NA 1XCFA 1I8LC 3PS7A 4K55A 1P84K 5F0PB 4M5TA 3STZA 2GK0B 4PFHA 1A6UL 3LNPA 3K81A 3MROB 3SHSA 4KFNA 4ORMA 3AWGA 1Q6GA 5EWIL 5A6KA 1I1AA 1YUHB 1MCOH 5CPMA 2UXVA 4Y1AA 1QD0A 1DVSA 4PJXB 3VRJB 3PPHA 5BMFL 2NSMA 2V4LA 3O2WL 4X6CB 5T5FL 4P7OA 5L9DL 4AJYV 1XAKA 1AZZC 2MRYA 1X4XA 5I2UA 1XIFA 3ARQA 2C9XA 4NZTH 9PCYA 4ODVH 4BGDA 3ZYZA 4QXUL 5CGYD 3PNUA 5IFJA 4R4BB 4AMCA 5E1AA 4XB8A 3C5ZB 4NZCA 3C61A 1K4DB 1N9PA 2CDGA 2V5BA 1GHFL 4YR6B 2WXPA 5IVXF 5C0BE 1HKFA 3CFCH 4YOKA 3GMLA 1ZD6A 4GAYB 4U1SB 1EEYB 3DUGA 4PV1C 5FM8A 5AOMA 4MMYA 1NP2A 1EBGA 2YL8A 4MQTB 5C0FB 3AM8A 3V8OA 4L5FE 2R8SL 1MIEH 1HKLL 4L29A 3CMJA 2A3HA 2FYMA 2R15A 4UNUA 3HAEH 4ZE5A 4MCZB 3KOXA 3P9LA 1ZV9A 1JWSB 3QORD 1FZMA 3S88H 3UR5A 1TJ0A 1IQDA 4WI6A 1KBGH 5FGCE 2J8HA 1YDPA 1X9LA 2W59A 3LPPA 5JUVA 3L9BA 5C2BL 5ENWB 4Y8FA 1E65A 4GT7A 4WWNA 5AYUL 3RVUC 2E3VA 1CB4A 5DO8A 4LKCB 3EZ4A 2R0ZL 1FG9C 1KCRL 5MEPB 1FNSH 3QXBA 5K9QI 2WBJD 1HYSD 4YCOA 3LZNA 2JCCA 1BAFH 2OULB 1KFCA 5E8OB 4LSUL 3OAWA 4Z7VA 4D9LH 4B92A 3S37X 1W1YA 2R7EB 1AZUA 4DOHE 5D7IF 1SFLA 3WQ4A 4MCNA 3L7EB 3O2VH 5IY5B 2WYZA 3NEOA 4QMEA 2JNZA 4WW2C 3CDFA 4BH8B 3MUUA 3LX9A 4LF3B 4U3XA 3LTVA 3PCYA 1AUSL 2DW7A 2UV3A 2VVSA 5DJ0A 3FCTB 3QIUC 3G8EA 1PEZA 5FK9A 1G0DA 5DD5H 4HK0A 4X8JA 3HTLX 2PU0A 4PRIB 1NDVA 1UWEH 1XLBA 4U28A 3G2GA 2YOCA 2AMGA 4FQJH 3LNFA 2OMTA 1F4YH 4ZENA 5HHVH 3RL2B 3LHWA 3O8XC 2FSEB 4DT2A 3HQ1A 2D7MA 2ZZ5A 4WV1C 2MCG1 3G9AB 2XN9E 4H8WH 1W0VB 5I1HL 1R4XA 1XIDA 5DGRA 5BOOA 2EJ1A 5FV2A 3LZ5A 4Q74A 3QS2A 1G5GA 2EG8A 4AX6A 3J8F7 4YDJB 4TRPL 3W88A 2Z1VA 3SCMD 4MB5A 1X5MA 1IJ9A 3OSKA 3TEWA 1Z3NA 5IESL 5EWIH 1IO4C 2OR7A 2Q8ZA 2ATMA 4FMKA 4OU3A 4NQDB 1NLBL 4FFTA 5D7LA 3BKCL 3VE7A 4PREA 5BMFH 1R85A 3O2WH 4YFLI 3BPWA 1M68A 1AQHA 5T5FH 2YAMA 3L68A 5AZ1A 5L9DH 5IM7A 4AKQA 1TUXA 5TE4L 2UWEB 3WUFA 1JPEA 4HKBA 4QXUH 1N67A 1JDFA 4D6IA 3CBJB 5G2HA 1H19A 2VOTA 1A3ZA 2UYLB 2R2EA 1DPMA 1GHFH 4LCYB 3HV9A 1K6AA 4MYXA 3VDBA 3KBSA 3W71A 4O4WA 3H3PL 4XZUA 5FEWA 1CTOA 3UZJA 3HE7B 3L0KA 2R8SH 2E28A 3TYUA 1HKLH 3GJFK 2MPAL 2WLKA 1R0AH 3F12B 2OT0A 4NNYA 4GI9A 5DCDA 4PAZA 3RWGA 2YAQA 4B60A 1RI8A 1HDMA 4X2RA 5CLTA 3BZ4B 3HB3B 1M7PA 3HS0B 4MCYA 2FQDA 3U4EA 3IRSA 4O18A 1GZPA 3M6DA 2XFGB 3VW3L 1XIHA 1MCCA 2QXWA 1NFDF 5C2BH 3UJ2A 5CHNA 1YN7B 4X98B 5AYUH 1UKOA 1K8DB 2WXHA 2YAOA 1T96A 1P1ZA 2AGJL 2R0ZH 3ORJA 4TSAL 1KCRH 4YTQA 1QNRA 1R5IA 4QXWA 5CBIA 1KNOB 1AMYA 4D6GA 1PL3A 2ZKYA 2J1YA 2CLPA 3MGAA 3DC8A 4LSUH 1YMME 2KAUC 5CJXC 5FB8A 4XD5A 3L4VA 4AT6A 3HV8A 3FO1B 1VLWA 3LENA 4AZUA 1QRKA 4DN4L 2C79A 1FQ0A 4AQEA 4OLVL 4Q4PA 4FNUA 3NIDE 3WMPA 4CADA 4YAQB 4UT9A 4P4KC 4N87A 1UMYA 1I82A 3VYPA 4BV1A 1L0QA 1XDTT 3X17A 3D07A 1A1NA 4GZIA 2V8MA 1JVOA 5FO9B 3OW1A 1YEKL 2WCAA 3FEQA 3QEQA 4GXUM 2BX5A 4B5EA 1ZE3H 2A9AA 4Y5YC 4Y1SA 4B5VA 3UJSA 2AQNA 4JQXA 4XTDA 3BOFA 4KK5C 2YPVL 5I1HH 4E2DA 3WKZA 1VKFA 1K8ZA 5SWQB 1RK1A 2IVFC 3WMSA 3W75A 4TRPH 1XF4A 2WZMA 3H7UA 4FIRA 3I65A 1H0IA 2EXWC 1F61A 2VISA 4S1QL 1UQSA 5IESH 2ZKWA 4KKLD 5BXTA 2JJUA 4JAWA 1NLBH 4F5CE 3FN0L 1AZ2A 4UFHA 3BKCH 2ZKXA 1A4KA 3L3OA 3CFMA 1XJBA 4J3WA 5CBBA 3PZGA 4LCUA 1DVZA 3QUGA 4A3UA 5DVKA 4N1CA 4ZDHA 2MUCA 3AGVA 4IRJD 1Z66A 4CKVX 3H2AA 3NCXA 3PWLB 5TE4H 4FB7A 3MBDA 2P5EA 1S7RB 4GQBA 2FBJL 4MJ2A 1X4ZA 3MRMB 2JJTA 2VJXA 3IVKB 5KYYB 2O6DA 2HDJA 1GVSA 4XKYB 1U95B 4JFQA 3H4XA 3EWUA 1MEWA 1E6PA 4G8FA 1B30A 4OFYD 1G6RL 1UR0A 1XGUB 4G70B 1HWHB 3MRNB 4ZW8A 2MPAH 3N34A 5A6LA 4U7KA 3UPRA 1YG9A 3TKFA 2P3YA 4C56B 1RU9L 2P46B 5F1IA 4R9OA 3VW3H 5LGYA 2WLIB 1E0OB 2GABA 4RDVA 3JUGA 2XSAA 3U9WA 2LABA 4HH8A 2WXDM 4YZFF 3BRDA 2XYBA 3VXMB 4BA8A 1C8PA 3IIPA 1QNZL 2PW2B 1L6XA 3ALWA 4LFHD 1R3QA 3H0TB 4TSAH 3W7NA 3VUAA 5E9DE 5EY5A 1FG2A 1A6TA 3UPCA 2PRHA 3FSVA 4O4YH 2AJXL 4HIQA 4I1NB 4J1OA 3RGTA 1SJXA 4LL1A 5TGBB 1OSZB 1AK5A 2EGZA 4L5FL 1NSNL 4QISA 2EDBA 3S9YA 4X6FB 1U21A 4WTQA 1GOHA 4H6EA 2B0SL 2EDQA 5MEQA 1Q8MA 4P5KA 4DN4H 3V5KB 3U7AA 3DEQA 5HYJE 1F0LA 3FU7A 3WN6A 1IYXA 3TN0D 4OLVH 3PNWA 1FDZA 3R4IA 1S9WA 4WKZA 2FMNA 5E8EA 3NG3A 4S3JA 1T1ZB 2Q86B 1BJ1H 2BNRA 4LLUA 1I9EA 3R0DA 5DRWA 1YEKH 1A65A 1UUSA 1SLWA 2DYPA 3RL1A 3NPXA 4CDHA 2OK0L 2ZYHA 4PJDE 3NZRA 5GGVY 3HVNA 4OV4A 4EQ3A 5H1WA 4IL0A 2E27L 3GW3A 1CFBA 4HX1A 2OX4A 5LGJA 1VAHA 5LGKA 1ZA6B 2YPVH 4PVMA 2GJRA 1G7VA 2YCLA 4X7SL 4CBPA 2WGNB 2PEVA 4XVTL 2QCGA 2HK1A 3LV5A 1OCOB 2O61B 1W31A 5BWAA 2YCIX 2ALAA 4S1QH 4FKEA 3F2DA 4FJZA 1P9MC 5J5EA 3V6OA 2YL5A 4IU2B 4PBXA 2BVWA 5HAOA 1H6TA 3FN0H 5A16B 5AG9A 1PNDA 1MDAA 3GJFH 3UCRA 5CCHE 2VKWA 1P7TA 1EC9A 3GBLA 3DFPA 1SZNA 4ZD3L 3S35L 1TZGL 4MMZB 2EYSB 4JMXA 1TA3B 1VJZA 4JKKA 4XPTL 3K6SA 4ADJA 3DJRA 2FBJH 3GBDA 2V2WB 3FF8A 4J4PA 5I03A 4FNPA 4P3CL 2FO4A 3KW3A 1YN6B 4UMSA 3PB0A 2GLKA 4PP2B 1AXSB 2CJ3A 3WUBA 4JZNB 5ESQA 3GM0A 1E5BA 1KIPB 1R46A 1KJ2A 3MRBA 2JF7A 2Z93A 1G6RH 4L9XA 1ZAGA 1WCBB 4ALDA 1I7RA 4RMBA 3MV11 1XD0A 5BW6A 1TX0A 4U1KA 2Q9OA 2FLRT 4ZFZA 1DQDL 1XBVA 3NK3A 5F1NA 2J1WA 4IOSD 2LGNA 2Z27A 3FPYA 1KFAL 3G1DA 3LQLA 1US3A 4PRDB 2A6IA 3OZOA 1RU9H 2VLJD 6REQA 2R29A 3REVB 2OMWB 3MBED 2FT8A 3SDCA 1DWHM 5A6IA 1A7QL 4X42A 1QNZH 1NAMH 3EO0B 2O1AA 1JV5A 1IXQA 1OC5A 4DPCX 1N6VA 2W62A 2HKFL 4J35A 2AABL 2NY4D 3BO8A 2HZHA 2AJXH 3VGDA 1OIOA 3IMTA 3PB2A 5E9XA 4FRWA 4NM8L 2QVTA 3CN1A 1L0PA 2NNFA 4L5FH 3HHSB 1NSNH 1J5DA 4UZGA 1QSFE 1A47A 5I15L 3LRHA 2AXGB 2EIBA 2JLLA 1BXBA 2B0SH 1QPOA 1DJHA 4DNLA 3QZEA 3AY4A 5E6ID 4PCYA 1TQBC 4CCDA 2OKOA 4PJGB 4U6YA 3V5CA 3FQXA 5SX5K 4IJ3C 1F8TH 5HDOA 3CSFA 1SHMA 4C58B 2X7LB 3MRQA 2E6DA 5DD6B 2EO7A 3GFXA 2YOAA 3VFVA 3LEYL 1JV2A 2DSKA 4P5TC 3SGEH 2W65B 3TVMD 1DJIA 2FECL 4HOXA 4ZO8A 4I5BA 4M8QA 2VX7A 3S37L 2OK0H 4AQ1A 3L5WB 4QTFA 5DHMC 1JI1A 1UKSA 2E27H 3ZW3A 3WTTA 4EI5D 5HGHA 5LGZA 1ZXKA 4D94A 4W7UA 2A77L 1AFSA 1AD9A 2ARJQ 4ICCX 2WHVA 1SVCP 5C0ND 1F6FB 4FA7B 2KT6A 4GO9A 4X7SH 4XVTH 4NOFA 3ZTJH 1A5UA 4L2LA 4BELD 2YL9A 5SWUA 1ZTXE 5GS0L 1UADC 2EPMX 1X39A 2DWXA 4WEMB 1XFBA 3DYPA 4AZHA 3ZOAA 2XNAA 4Z5RA 1OCBA 4IFRA 1TETL 1ZT1B 4UTBL 3W2MA 4HUVA 1ILSA 2DWYA 4WWKD 1FN4B 4ZD3H 3S35H 1LYXA 2D7TL 1TZGH 2DL9A 5CSZB 2IOOA 1F97A 3H54A 4X5XB 4PIRF 5IMKB 3RJYA 4XPTH 3L3GB 2QPSA 4ES4A 4GKOA 3KPPB 2B5IB 2B20A 3P3SA 5AG8A 1E0VA 1W72B 3Q48A 4UDUA 2DT1A 4I48A 1JUBA 3M5XA 4P3CH 3WN5C 1EUTA 2DJSA 5M1TA 2VELA 2J24A 4BFAA 2XX0A 1MCDA 3AQXA 2YPLA 3RVXD 2VZTA 4X7TB 5AZEL 2H2PD 2EQDA 1FI8C 1DQDH 1ETJA 2I14A 2QV5A 1FFQA 2D7PA 3QJSB 3QGAC 1KFAH 1G0YR 2QKIB 3K8KA 4M1RA 2VDLB 1UA6L 1CXKA 4AQOA 4RBPK 2DVUA 3GLCA 1KXTA 5KMYA 3CAFA 1VFLA 1RCXB 1PJ9A 1UXSA 1EAPA 3ZGHA 3TBSB 4E5TA 4XCNA 1A7QH 4MBRA 3U9UA 1UB6B 1DJWA 3AWFA 4I7ZC 3E49A 3NPUA 3WF0A 2CLLA 2HKFH 3AMGA 2AABH 3U0PA 5FLVA 4NM8H 4M02A 1FL5B 5FF6A 3MLSL 3EMQA 1GKQA 2A6DB 1Z9LA 3C56A 5I15H 2IH8A 4RSVA 5JXED 4QM1A 1LUCA 4QJ5B 4WHCA 5KSBB 4IBZA 3VNDA 3VI4A 4ZFQA 3CT7A 4AKPA 3QISA 1HCFX 3RJQB 5A6SA 2UXTA 1M2OA 1VEOA 1XKJA 1TZHA 2V7HB 3CIVA 3EX4A 2P8MB 4XAKD 3DSNB 4QOKD 1MYRA 1YTEA 2OMVB 4RMVA 4PGDB 1RZKC 1JCKA 3LEYH 3DJSA 4E8GA 1BVLB 1XV8A 2A0LC 2PCFA 4IRZL 1BFNA 2IWEA 3PHQA 1OK0A 3S37H 4PJ8A 2OPCA 1W5OA 1GKOA 1H63A 3IUHA 4A2FA 2AC0A 4N2DA 2HPOA 3B6SB 3DX9A 4MPQA 3Q8CA 5GGSB 2A77H 1TIUA 4C6IA 4KWUA 1D8WA 1HWWA 3AJ7A 4XIMA 2WHLA 1CXHA 3UAJC 2PTTB 5BRPA 4PJBF 1JQXA 4J39A 5GS0H 2GPTA 3G0XA 3G3MA 1X8FA 3O3RA 3W87A 1TETH 1K2DB 4UTBH 3TSBA 2IBZY 4UBDC 3R89A 4P48A 3BPCA 2D7TH 3I2CL 5EMUA 4HS3A 2VRKA 3IJSB 4AIXA 4UM8B 3D5OF 5J12C 3DOHA 3TYGL 5EL1A 2CBIA 3NYZA 4JO2L 3VNKA 1OF8A 1YZZA 3HAEA 5D2NC 5DRNB 4HKZB 1W2PA 4G5DA 5F7FA 1MO0A 4ZUSA 4PRBB 5I8OL 4FTVA 4IMDA 3AABA 2OA9A 4S0HA 3GGWB 4OAWA 4NZUL 3GDMA 4NN6C 2GTZA 1SYVA 1QOXA 5AZEH 4JO8A 4KERA 2QAFA 3MRFB 4W4OA 1A5BA 3EMCA 1V8EA 4ZPTB 1UA6H 4CCCA 4NKMB 4DP1X 3AU6A 4P23C 3VXPA 3QM3A 2Y36H 4PP1C 4EKXA 1VCVA 4XCCL 2KPNA 2X4PB 2DZWA 4R5EA 3W3BA 4MWAB 1ZOXA 1QFWL 3X12A 1A6AA 2BSCA 3IDGB 3RWEA 5HJYA 4ZUUB 3ZHKA 1H51A 2Y1ZA 5SX5H 5FYKE 4AYSA 5H4ZA 5HNNA 2AKRA 4C6BA 3U2SA 3BW9B 1KFWA 4A37A 3MLUL 4HTYA 1U58A 6FABL 5K9OA 5KZCB 2VL5B 3G6JB 3CEPA 2OL3L 2EDNA 3H9SE 4DH2A 1OD8A 5J1TC 4MASA 3PANA 2FYVA 1WF5A 5F7AA 3TE9A 3MLSH 4X22A 1Q0XL 3LB6C 1NDGB 1JPFA 2PYFB 4KI5F 5IW6B 5AYYA 2PI6A 1YNQA 4L1GA 4IIGA 4TNVF 2PUQT 1UOVA 3F1QA 4HA4A 5LKNA 2FQFA 1FFRA 3H55A 4QRSB 1XZWA 4ICNA 4NUPA 4MZ3A 3Q6FA 1IAKB 2GQ9A 5F1VA 2BP0A 3TM6A 4JTKA 1VCGA 3UQNA 3JZEA 5KBMA 3NCBB 1SGJA 4RFOL 3LGDA 5F71A 4DBDA 1H62A 2ICEB 3B7UX 1OPOA 4R7JA 4AV0A 1VZGA 5I8EB 1A02N 1CDCA 1GOKA 1RD6A 3OZLA 3ESPA 1MY7A 4JVPA 4IRZH 5C6TL 2CRIA 3TL5A 1IKFL 3SO3C 4PV8A 5AWNL 1W8GA 3ARGC 3WF2A 5G4EA 4XBGA 3CZGA 4D6CA 3M64A 3QDHA 1QQDB 3DBPA 1C08B 2NCEA 4CVXA 4DYEA 2XKSA 1MY5A 4FEZA 4PWKA 3QXWA 5F3BB 5CJBA 4KMTL 2FJFA 2ZXCA 4JFZL 2IH1A 3HB9A 1MHHA 5TE6L 4QLJA 1O5QA 2E75C 3I2CH 4UMCA 5DYOB 3VXSE 1WBYB 4I5UA 4KFPA 4RBPH 4K23L 1L5GA 3TYGH 1XSKA 4BQ6A 4JO2H 3ZZQA 3EG9A 4XKMA 2VIRA 1HL9A 3UABA 1B3ZA 3CL6A 2JK5A 4YWGL 1J1OL 2QT6A 4UI2A 5I8OH 3PXJA 3L66A 4MAVA 3O3BB 1XVSA 5TDPB 4NZUH 1CZ8L 1KR0A 4JO3L 1XF3B 1I1AD 2CIIA 2CLVA 4Y1AD 1Y8BA 1A2YB 2LQRA 4CC0A 2IDUA 4N42A 4X4YB 4U3SA 5EZJA 3NO1A 1J6OA 3Q4DA 4I8YA 4GIOA 4GPNA 4IOSA 4A8NA 2XSKA 4NQCA 1KB5B 4XCCH 2WQVA 2OQJA 3VDAA 2BB0A 1KB3A 1PX8A 1QFWH 3BGAA 4A3QA 4H83A 2M26A 1UC6A 1S2EA 1JNHB 2DZSA 4RZCB 6FABH 4YS4A 1ED3B 2OL3H 1HKKA 1IAMA 4YTTA 2BSTA 2WZ6A 1YE6A 1Q0XH 3W01A 4HJWA 3T4WA 4TLKA 5BRZB 4XAYA 3WIFA 3P93A 4NIKB 1B0GB 2Y89A 1L9OA 1XF0A 5HGAB 1UG6A 4MQXD 4MNQE 4Q56A 5E6IA 1DCEA 3HI1B 2BG5A 1F58L 1WCGA 3NA9L 5DEFB 2G30A 3LV3A 5I1GL 2X6VA 3X11A 3RDJA 4RFOH 1AR2A 3I02A 3EA1A 4LCCC 4NSBA 3NQDA 2QQQA 3GXMA 4R4FL 3KGSA 2GQAA 1OM3L 5JHAA 5C6TH 1IKFH 4O2CA 2CKRA 3M1BA 4LVEA 4PSRA 4GX9A 1Q3NA 4HUUB 2OZNA 4WW2B 5AWNH 5LUMA 2PODA 3NK4A 2O9TA 5LQBL 1TJXA 2J47A 3N73A 3AAZB 3MRRB 4KK8C 1S7VB 3QIUB 4JIRA 2OOGA 3GAKA 2ATPB 2W0LA 5ACZB 4RGNC 2XTSA 1SEQL 2OCJA 2XWEA 1OAQL 2POZA 1WJ3A 5FLUA 2AEWA 4B9PA 1AE6L 1UZ4A 4TVPL 1C12B 5B7ZA 1AMKA 3OAZK 3WJLC 3WD1A 5LG6A 1KIUA 1WNOA 3O8XB 4JAMB 4KMTH 1BPVA 4WV1B 1P5VA 2TODA 4G7EB 3ULVC 4K7FA 4ENLA 2D3LA 4FHJA 5TE6H 4PGBA 4UF7C 4P8VA 1IIKA 3KP0A 4D6JA 4LHUG 1X5FA 4WWKA 4MXQC 1U3YA 1EV2E 4K23H 3MNZB 1JCLA 1FZOB 3EYOA 3GDBA 1I2NA 1PFCA 1YYAA 4NENB 1VH7A 1TZIA 1H9VA 3LVEA 4FG4A 5D96C 2AZUA 3VX0A 2J72A 4YWGH 1J1OH 1GOIA 5PTDA 3MHZA 2IF7A 3EOEA 3GZOA 4IXHA 3STGA 4WI0A 2PD5A 4N68A 2WWMD 5AL0A 3QOKA 2FGWL 3SQLA 1CZ8H 3PDDA 1H61A 4JO3H 5CN3A 4QIRA