4XTIA

Structure of imp dehydrogenase of ashbya gossypii with imp bound to the active site
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
407
structure length
373
Chain Sequence
b'YRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii atcc 10895
molecule tags Oxidoreductase
total genus 117
structure length 373
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtiA00
3SGZA 1N8FA 3B03A 5C2XA 3WK2A 1XFBA 3LDVA 3M5XA 5L9FA 1V5XA 3OG3A 1YDOA 1H1YA 4GRSA 1JVNA 3SI9A 4N9EA 4CQ8A 4QM1A 1P5BA 5J5DA 3NQEA 3VE9A 3M47A 3TV8A 4KWWA 3SW6A 4Z1DA 4IUOA 2AQWA 2QR6A 3W75A 3KHJA 2BSLA 1MEHA 1KFLA 3NQDA 1JUEA 2OT1A 1DL3A 5FI8A 1VLWA 3KOFA 3HMJG 3BARA 3LCWA 1O5KA 5CKSA 5TQLA 4I9AA 1EP3A 2A6NA 4DBEA 2QJGA 4LTSA 2J9ZA 3GX9A 3KFTA 4FO4A 4WD0A 1TJRA 3G1SA 2CZFA 3EWUA 1G7UA 1G67A 2Q3OA 5FF4A 3S5YA 1XXXA 2JBMA 1ZFJA 4UMBA 3TW7A 2B7QA 3N2MA 2QCLA 3B06A 4JD4A 2J24A 1MXSA 2CW6A 2ZA1A 1L9WA 1TPH1 1S5VA 3HQ1A 5C6MA 5AHIA 1TB3A 3MI3A 1RZMA 1TPUA 2JKEA 3DZ1A 1J4EA 1KBJA 3A5FA 4ZVJA 5LZLA 1LDCA 3M7WA 3QJAA 3PSWA 3SR7A 3RLUA 1EEPA 4BWLC 3GB6A 1GVRA 2DZTA 2PE4A 3CLMA 3NA8A 3I7SA 4JTSA 2J6XA 3E49A 3TX9A 2FIQA 5CGQA 2GVJA 4FNUA 3P67A 5DCBA 1EB3A 1HUVA 4O11A 2ZRWA 1EP1A 4JTHA 5G5IA 3NQ6A 2F84A 3P61A 4Z0JA 4UTTA 4O10A 2ZTKA 4UMCA 4LC6A 3KAOA 3PUDA 1WOBA 3W1TA 3MI2A 5FEXA 1JCNA 3EX6A 2EPHA 5F2IA 3SGUA 1DQXA 2W79A 2EKCA 4HKPA 4IOTA 1TPC1 4RJEA 3OHIA 3P81A 2E5DA 1TRDA 4Z1AA 5E0KA 4UFKA 1VQTA 1KM0A 4IMDA 1GVOA 3NL3A 2HMCA 4WY0A 1O95A 2Y7EA 3F1QA 1KM6A 4JGDA 2E5BA 2ZZ7A 3S5OA 2QCMA 1H62A 2ZZ5A 3C4UA 3N14A 5F2MA 3N34A 4LT9A 1UASA 3FS2A 3PBYA 5D2YA 3BGGA 1DOSA 1CW2A 1W3NA 1O5XA 1W5OA 2V5LA 3ABSA 1TPB1 1UBSA 3P5ZA 3NQMA 1UUOA 3W74A 3NVTA 4NU7A 4ZQRA 5FF7A 3C3NA 2R14A 2XN1A 1SPQA 1TQJA 3TW6A 3NYZA 3Q37A 4JNMA 2B7NA 2DJLA 1J5TA 5IBXA 4GUJA 4A22A 3GAYA 2OCZA 3FA5A 1FX6A 4DPQA 2B0MA 3N73A 4WXYA 5C55A 1QO5A 4Y90A 3S0CA 4XUGA 3MHFA 1CX9A 3CTLA 3TK7A 3SECA 3TH6A 2G95A 3M6YA 3TIMA 2FB3A 2CWNA 4JTUA 1K8ZA 2JGQA 5D38A 1Z42A 2J9YA 2Y85A 4O18A 5U4NA 3M43A 4WOQA 2CU0A 1QOPA 5TBOA 1VGAA 5HWJA 1GTEA 2X1TA 2ZZ3A 2CLOA 3LI0A 3LHWA 4FX8A 2AAMA 1AG1O 2A1YA 2YW3A 3W9ZA 3NL2A 3LX9A 5CPLA 2QKFA 2PRMA 5BNKA 5I3JA 3W86A 3M41A 1VCFA 4RZ6A 3NL6A 4GE8A 4K39A 2NUXA 4UR7A 1GJPA 3W1QA 4JX5A 1W0MA 5EL1A 2NLIA 5HWNA 1QPQA 3DFNA 2HS8A 1ML1A 3TC6A 2JK2A 5CPMA 3C6CA 2DJXA 3DENA 3PULA 1N7KA 3P80A 1MO0A 3BW2A 3R89A 1OFDA 1OF6A 5D33A 3UD6A 4KKXA 3BGJA 2Q8ZA 3KX6A 3IRDA 5AYZA 3GKFA 5AHLA 5I3HA 4CCEA 4G1KA 3IVUA 4PA8A 3HG2A 2JKPA 4ICNA 3SJ3A 3UWVA 4XKYB 4KFNA 2NZLA 3L9CA 1VYSX 1JRBA 3IVSA 3DFQA 2WSQA 2KZHA 2TYSA 4NNAA 3NM3A 1Q45A 2V82A 1KA9F 1OK4A 1WX0A 1R2TA 3P82A 2BZNA 3A23A 1YTDA 1XM3A 1XI3A 3W7LA 4ALDA 3G1HA 5CZTA 4GUGA 5LNWA 3BO9A 1AL7A 1LRQA 1Q3NA 4TO8A 1NSJA 4LV4A 1DJQA 5K9CA 4ZQCA 5AHMA 1YADA 1AW5A 1KM1A 4XBSA 5H2ZA 2ZRYA 1T0OA 1XDLA 4FX6M 3TE9A 5F2GA 2DZPA 3DI0A 3W73A 1PCWA 3BG5A 3Q2DA 4AF0B 3IGSA 4RV8A 3O05A 1TV5A 2PRLA 5G1YA 3DFTA 3R13A 3C2FA 2YX0A 3QSRA 1MEIA 3BV4A 4O1BA 2Y6ZA 1ICSA 3P74A 1HO4A 3PB0A 3W72A 3S1XA 3F03K 3W2JA 4U28A 5F2LA 2HS6A 5G2HA 3LCGA 1P4CA 3OIXA 2ZFAA 1BEUA 1RVGA 1QPRA 4LUJA 3CM4A 4O1AA 2E5CA 3TUUA 4JX4A 3S5NA 5A5WA 5DXXA 3QQ0A 3ATZA 1K7EA 3W87A 4O0KA 2VELA 2FFCA 3WJSA 2PRHA 3G3MA 1I2RA 2FJKA 3QPZA 2ZBTA 4DEFA 4IQLA 1IXQA 3V1PA 3W07A 2A6LA 1A50A 2A2IA 3INPA 4YL2A 1KFKA 1F7BA 2GQ9A 5LNUA 1OX4B 1UUMA 3QW3A 4FB7A 1AL8A 1F2JA 4MLJA 2C6QA 3B8DA 3DXIA 2TPSA 5HJLA 4UTLA 3STGA 2UV8G 3O6DA 1SW3A 3I7QA 5KITA 1P1XA 3BVJA 3EWXA 3W22A 2TRSA 1TV8A 1SZNA 1F5ZA 2C3ZA 4OBTA 1LORA 5HULA 3EXRA 4OWGA 4JR5A 3TQVA 3UWWA 5HMSA 1ICPA 2F7FA 3GXPA 1H7PA 4TIMA 4N9DA 4I7WA 2QAPA 1EPXA 2VFHA 2ZYFA 3DH7A 1KFBA 1PVNA 3WJZA 4NZJA 4WXZA 2X1UA 4X3ZA 3VNDA 1T99A 4FX7A 3TSBA 1KFCA 3NOEA 4LVGA 3G1VA 3LV5A 1G6CA 2JKAA 3K30A 2W0UA 1ZCOA 2NX9A 4WY0F 3EKZA 1Q6QA 3M5ZA 1UJPA 1YXCA 3W7GA 4AWTA 1JCJA 3E02A 3W7PA 1JUBA 2E6FA 4A3UA 3M1ZA 1W37A 1Z48A 3N2XA 5D2VA 2I9EA 1DJNA 2WJZA 3B4UA 1RPXA 1QWGA 4XZ9A 5DCDA 2Z6IA 2CLKA 3LCHA 4CNPA 1IXNA 1QCWA 3NAVA 4R7JA 3QFEA 4EOUA 1K3UA 1JULA 2WNQA 1EA0A 2ATSA 5K4ZA 3UNDA 1W5PA 4FIQA 4HSOA 3BG3A 4IX2A 4W9TA 3W1RA 8TIMA 3DKLA 5DY2A 1TSIA 3LLDA 1FCBA 4RX0A 5DCEA 1OYCA 3QH2A 1DBTA 3P84A 3OVQA 1IF2A 3KXQA 3W1PA 2X1SA 2VEMA 1VH7A 3G8EA 4IXXA 1FCUA 3QC3A 1FQ0A 1ME8A 2YSWA 1G4SA 4K37A 1ME7A 3FIGA 4MUZA 3A21A 1SW0A 5LHEA 3CC1A 1XUUA 2YDAA 4LNYA 2Q3RA 5I3FA 1UCWA 2Y7FA 4FHAA 3N3MA 4FF7A 1PV8A 2ZRXA 4M7SA 4Q32A 1GG0A 4O13A 5I3GA 1LTDA 4H3DA 3C2VA 1OHLA 4DO6A 2A4AA 1FCQA 1Z41A 4O50A 4GBUA 3JR2A 3RK8A 4NX0A 3KRZA 3M0ZA 5HR7A 3C8FA 3BW3A 5J5RA 1YTEA 4WY0B 5D2XA 1G69A 4HIBA 1JQXA 2C13A 5BRBA 2A21A 1OFQA 1P0KA 4HNVA 5HWMA 3O06A 1PL9A 1GTHA 4FNPA 3O16A 2J9XA 3NQ8A 3G1YA 1KFEA 1NF0A 1ZALA 4TX9A 3H54A 1O94A 2QCGA 2Y7GA 2QCEA 2H8ZA 4LS0A 2YZRA 2X16A 1AW1A 4RXGA 4NNCA 4IPJA 2BLEA 2JGYA 5D02A 3FOKA 1LCOA 3LHZA 1XC4A 4LS1A 3UWYA 2VEPA 1M7PA 3TFCA 3L5LA 3TSDA 1I2PA 5G4EA 4QAIA 1Z44A 3M16A 2BWGA 1QO2A 5AHFA 5KZEA 4O8RA 1VJIA 4GUHA 1TO3A 3DHDA 2A85A 4K8HA 2QCNA 3HPSA 2VFIA 4A2SA 1FDYA 4MOZA 3SIZA 2E6AA 3S1WA 1WQ5A 2I14A 4Q33A 2ZRUA 3GYEA 1GT8A 3E0IA 1JRCA 1KTCA 3HG4A 4N4PA 2E09A 5AHNA 1JCLA 1GZGA 5EY5A 1GVSA 3C61A 5LNRA 1ALDA 4AVFA 4ADUA 1TRIA 1KW1A 3DHFA 4WZHA 3LHUA 1KV5A 2GQAA 4BI6A 4LVFA 4DO5A 5I3IA 1TJPA 1EIXA 2FB2A 2Z0IA 3LOTA 1NAL1 4MPQA 4O4VA 1C29A 3FKKA 1W5NA 2FPVA 1QR7A 3LCXA 3A24A 3LXCA 2RDUA 5D32A 2QJHA 2Y70A 4UTKA 1M5WA 1F6PA 2E1DA 1OX6A 3L66A 4N9BA 3CIXA 3CPRA 2R8WA 1W54A 3NQAA 3GR8A 3ABOA 3GDRA 1ICQA 2EGZA 3MHUA 4R33A 2FPTA 1LBLA 5D30A 3A22A 1J2WA 1ZAHA 4GNJA 1X7FA 3W1XA 4ZL1A 3GKAA 3W7MA 3GIYA 1GYNA 3PBVA 3UWUA 1SZGA 1LRNA 5CSRA 1ME9A 1WDWA 1I2NA 4UCGA 3W7QA 3STFA 4YLWA 3HIJA 1Q6OA 1W3IA 1W5MA 4QQ3A 1R46A 3QPYA 3C2EA 4LRSA 5HUPA 4MZYA 1H7RA 2VKZG 5DY3A 4NX5A 4Y6GA 3TQ0A 4BI5A 3NXFA 4K7YA 4PH6A 4NJKA 3HGRA 1OG0A 1H7OA 2D73A 4WQ6A 2QCHA 2ZA3A 3R5EA 1XBXA 2XN0A 1WBJA 5AB3A 1IXPA 2NV1A 3GDMA 2WO5A 3H55A 5T26A 5IM51 2G96A 4FEZA 1FBAA 1Y0EA 1U83A 2ZZ6A 5D2WA 1RD5A 5KSWA 4BK9A 2NX3A 1KFJA 3O63A 3I68A 2RH9A 3R8RA 3GDKA 1OVDA 2V9DA 3CB8A 3ZWSA 1LP6A 1LM1A 3NPXA 5KZMA 3SFKA 3DFOA 1ONRA 4PFMA 2RHGA 5F4SA 4LU0A 3DFPA 4JEQA 2Y62A 5CPNA 2AGKA 4MY1A 5LGXA 1R2RA 3M5YA 1H7WA 4AB4A 3O6CA 4NQ1A 3FYPA 3NPUA 3PG8A 2FQIA 4Z1BA 3VFLA 2EAWA 2V8ZA 2Z2UA 5LNVA 4RZ5A 2J27A 3MO7A 3G3DA 2NWSA 2E6YA 1TTQA 4PEKA 1D3HA 3LRKA 2ZA2A 2QEZA 5I3KA 4DBDA 3LXAA 1OFPA 2ISVA 4IWWA 4UTWA 1QNVA 4QSHA 3FYOA 1HG3A 1X1ZA 1OYAA 2QJIA 2V0TA 3W71A 4IMFA 4O28A 4ORMA 1H63A 4FNSA 1DHPA 3CT7A 1B57A 1W56A 3MBDA 3TFXA 4O57A 2EHHA 2WV8A 4L4MA 2E77A 3N19B 4JY8A 5CZJA 4AWUA 3L5MA 1E51A 3HGSA 4LV9A 1TYGA 3C0JA 3G1FA 3L65A 2OZ0A 1M6JA 5AHEA 4CNNA 3DAQA 2QUUA 1WAUA 2ALDA 3NPWA 1TTIA 2GPTA 2QCDA 4BF9A 1TPWA 5BW6A 4LW7A 4P2VA 4RXFA 5EYWA 4MYXA 1SZEA 1O60A 4I7VA 3G0SA 3ATYA 2DZXA 4O14A 3OA3A 1X1OA 1OFBA 1RQHA 4FXRA 3VI2A 2NXGA 4BFAA 4MYAA 1OFRA 4MY9A 2VC6A 3HOJA 1VRDA 3W7DA 4UMAA 4S1FA 2NUWA 4KFOA 4WJEA 2YYUA 3IEBA 3NQCA 1OFAA 4MFDA 1KBIA 1H51A 3M9YA 2ZZ2A 2ZRZA 1AK5A 4NJIA 3DBPA 3LB0A 1UB3A 4UTUA 3LM7A 1VC4A 5AOUA 4NZFA 3EX3A 5KINA 3KRUA 1EP2A 4HN4A 4XQ6A 1YDVA 2RDTA 3W7OA 2BX7A 3L0KA 1K7XA 4BR1A 5F1VA 3L5AA 4N9CA 2ISSA 2B7PA 1S5TA 3QQ1A 1RQBA 4N02A 1D3GA 1JCMP 3GLCA 1FWRA 5C54A 4X9SA 3RNDA 5F1UA 2YCEA 5BMWA 3LHVA 4K7VA 3WJYA 2VFDA 3E9AA 3HPZA 4JDYA 3G0XA 5DELA 3PB2A 4CCCA 4IPIA 3LHYA 2Z6JA 1H7XA 4JTEA 5EMUA 4K36A 5D03A 4JY9A 1C8VA 2PCQA 1FDJA 4UFMA 3MW7A 4RLIA 3WJWA 4JTGA 3TXVA 2BXVA 4PODA 3W7EA 3KVMA 3BG9A 4NNBA 4BWLA 1W31A 3GDTA 4O4WA 4MFEA 3MWAA 3IIOA 3STEA 3IIPA 3GNNA 1QDSA 5EBUA 3W2NA 4UNKA 1YLVA 4OE7A 4NJHA 1G4PA 3EWYA 3ZFHA 3ZWTA 5HNRA 1A5BA 3M5VA 2X2GA 4UTIA 3FKRA 1XL9A 4R53A 2NXIA 5DBUA 4MKNA 3TR2A 5AN7A 1WBHA 3QF0A 4JICA 3O8AA 3DI1A 3W3OA 4UTMA 4UTHA 3HGJA 2B7OA 1RV8A 4DF0A 4J9JA 2C0AA 3CQ0A 2V30A 3GXTA 5K9DA 4E2DA 3G18A 3ABQA 4MLRA 4MY8A 5HINA 2WQPA 2Q8LA 1YPIA 1LBMA 3HG5A 1TPFA 2C16A 3W1NA 5E93A 1NF7A 3W76A 1GPWA 1TREA 2ABBA 2DZUA 2NUYA 4QIUA 3W1MA 1MZHA 4NXKA 4S2CA 3ZS4A 4LVDA 4JYEA 2Z1BA 4E2BA 2O7QA 4E0CA 1PIIA 1TV7A 4DQWA 3T7VA 3NPVA 1VLIA 3W1AA 2P10A 1U5JA 4QJ1A 1PS9A 4K8EA 4Z0SA 5LSMA 5DXYA 4GUIA 2QUTA 5EPDA 2ZZ4A 5BOOA 4P61A 3A5VA 3WK1A 1THFD 4M6QA 2OX1A 1HFBA 3P62A 3BW4A 2G97A 5ABTA 4EWND 1VPXA 3LI1A 4XWUA 3TAOA 4O16A 3ZR4A 1B4EA 1HTIA 5CG7A 3EXTA 3RMJA 2C15A 4PL1A 5FF3A 3MP4A 1KLZA 2G5WA 3TQKA 2P1FA 3S9YA 3LRMA 3UPWA 4OQVA 2QCCA 3PF3A 1SO5A 4NVTA 5FF0A 4FNRA 4LOCA 4JTKA 4O52A 4YMZA 4UTTC 1VCGA 1OFOA 1WOAA 3FFSA 4JX6A 4KWVA 1LLWA 3TKFA 4OV9A 3EWBX 1TPVA 2DZVA 1SUXA 4IMGA 4MZ1A 5LNSA 1G7VA 3G1AA 4HSNA 3W2MA 4UFHA 3TA6A 3UYCA 2NXHA 4EF9A 3LTPA 4M5PA 5EA9A 3W88A 4EF8A 4JTFA 1I45A 4O17A 3KRSA 3T40A 1FXQA 1A5SA 3W84A 1YYAA 4DELA 3PC0A 5DN1A 3S42A 4UFIA 2QUVA 3LCFA 2OJPA 3GNDA 2WSRA 4O12A 3NGJA 5CZ0A 3MJYA 1GVQA 2I1OA 2H3BA 2WNZA 3PY2A 3NZRA 4C1KA 2CZEA 4N4QA 2Y88A 2ZTJA 1L6SA 4PTNA 4S2BA 3WJXA 1I8JA 3QEZA 3RLVA 1N55A 3KVLA 5IBXC 4IGHA 1AMKA 1MSSA 4H6KA 3THQA 1JUKA 3TJXA 4JYFA 3TC7A 4RCXA 3R2GA 5LGZA 1GEQA 3G24A 3EEGA 2EF9A 3P7YA 3ELFA 4DF1A 1R2SA 4QNWA 2FTPA 3TU9A 2OMAA 4JS3A 1H5YA 3T78A 5AC8A 1FY6A 3NDOA 1LOQA 2VXNA 4X22A 4ORIA 3T55A 3FLUA 2FPYA 3GR7A 1NVMA 3EKLA 4UFLA 4OGZA 3UPBA 1RQEA 1VR6A 3W7IA 1FCVA 4ZMGA 3U6WA 5E1QA 4AAJA 1NEYA 1LROA 1OX4A 4IMCA 3PAJA 5K3VA 3HGOA 3HPXA 1LOSA 3LRLA 3PUOA 3OBKA 2R94A 3W83A 1FUYA 3NR0A 4M6PA 4ADSA 2DU2A 2YW4A 1XBZA 3NM1A 1R30A 3JRKA 4GFSA 1IGSA 4O0ZA 1PCKA 3LXBA 1VCVA 1YXDA 2C19A 3IIZA 4MVAA 3LERA 3RFAA 3W1LA 3IV3A 4HPXA 4OU1A 1KM2A 3NEVA 4O15A 3G0UA 3G1DA 4TU1A 3W7JA 2H90A 3FJ6A 3RF9A 3NG3A 2E6DA 5FF2A 4UC5A 5D05A 5AC6A 2QAFA 3UZJA 2ZRVA 3CHVA 4OHQA 4Q4KA 3TROA 2XFWA 2W6RA 2VFFA 1DORA 1HO1A 3LCLA 1VZWA 4ZQOA 2QCDB 4Y9AA 4M19A 3TSMA 4TMCA 3I7RA 3TJLA 3UXAA 2Y89A 1T8XA 1ADOA 3F4WA 2Y61A 4JDBA 1VS1A 1M7OA 5GVJA 1SQ7A 4GWEA 1KM3A 1A5AA 1K8YA 1QAPA 2QF7A 4GUFA 3WK3A 1F73A 4ZZ9A 1MEWA 2V81A 4UNLA 1W1ZA 1HL2A 2DZWA 4TMBA 2HSAA 3CWOX 2VFGA 1W5QA 3T4CA 5CZSA 1DKWA 5FESA 5SWUA 4IX0A 1PHQA 4FXSA 1EUNA 1G4TA 1X6UA 3PBUA 3TMQA 1GOXA 3WK0A 3TXZA 2YGYA 3EWWA 3O07A 1SU5A 4HNNA 2V5BA 1KV8A 3E12A 4DF2A 1F76A 1QPOA 4ZQNA 3W7KA 5MHBA 1SSGA 3W7RA 1L2UA 3QMSA 1A53A 1TTJA 3IIXA 2CLIA 4N6FA 4MJMA 4QITA 3DFSA 1P0NA 3VKJA 1AW2A 4QISA 3NQFA 3W7CA 1WXJA 3P8IA 4XTDA 4JTIA 4N2YA 3UY8A 2R91A 2NX1A 2GJNA 2IQTA 4B5NA 3B0VC 2ZDRA 3FJLA 4O1CA 3PM6A 4H4IA 5HUOA 1LLZA 2YFNA 3LHTA 3O1NA 4JXCA 1OFEA 3TMLA 3CEPA 2RDWA 4HNUA 3BPWA 3CWNA 3W7NA 1K03A 4O1DA 4AWSA 4IXHA 2VEIA 2V2CA 1PE1A 1WA3A 2Y63A 1IIGA 3UWQA 1TPDA 4OV4A 5G4WA 1DV7A 3EB2A 4AHOA 3AO0A 3Q94A 1GQNA 3C2OA 1FXPA 1JCYA 3NQVA 1SW7A 1BTMA 5D37A 1XBYA 3W85A 1YDNA 3F4NA 3L67A 3B0UX 4ML9A 1JJKA 2QDGA 3EWZA 1H1ZA 1H7NA 2DORA 1FDZA 1T96A 1XBVA 1I2OA 3LBCA 3L21A 3I65A 3HG3A 1NFBA 3RU6A 4AHQA 1KTBA 1SZFA 1H61A 3CU2A 3IGXA 4ZQPA 1G4EA 2QDHA 5U7SA 1I2QA 3M44A 4UTJA 4CQ9A 2A7NA 3NQ7A 1BKSA 3PWAA 1FWWA 3N9SA 3GDLA 3EX4A 4QNEA 3W2KA 1SO6A 1ZAIA 1VHNA 1B3OA 2A7RA 3HBLA 4LUIA 4CLMA 3U8GA 1ZJIA 2VENA 3W1UA 2YYTA 3THAA 3U2OA 3QM3A 5DLCA 4YCPA 4LVBA 1OYBA 3Q58A 4NT0A 4JYDA 3LTYA 4Y96A 1Q6LA 4CCDA 1VHCA 3MYPA 4PCFA 6TIMA 3S1UA 2A0NA 2RFGA 4WX2A 1KM5A 3EX1A 3OVPA 3DGRA 3HF3A 2OT0A 2NWRA 4ADTA 5AYYA 2DP3A 1OJXA 3GXNA 2BTMA 3PR2A 3V75A 1H60A 3NQ2A 1QMLA 1SO3A 4DPPA 3MUXA 1KTNA 2ABAA 3W6YA 2B4GA 4EIVA 2WPBA 2DZSA 2ZQ0A 2CLMA 1LYXA 4JN6A 4CNOA 3DU0A 4Y8FA 3G1XA 1VYPX 2V2HA 5K4XA 2YXGA 1DVJA 3A9IA 3LTSA 5LKYA 3KVJA 3LGEA 3LBMA 4N6EA 1TQXA 2GJLA 2CFFA 4X2RA 1BWKA 4NJGA 4EVZA 3JS3A 4PL2A 3NL5A 4AHPA 4WOZA 4K38A 3TNOA 3MI6A 3MYOA 1IXOA 1EX5A 1SR9A 4U4MA 3NNTA 2CZ5A 1GYLA 1K02A 5G2WA 1XCFA 4PC8A 3E96A 2V2DA 4AXKA 2WNNA 3QMRA 4MIMA 1B9BA 4LC8A 2ZZ1A 5K7JA 2X1RA 2WKJA 1I4NA 2GVGA 4TR9A 4WUIA 2A7PA 3S6DA 3L0NA 2FLIA 3L2IA 5KZDA 4AEOA 3W23A 3CIWA 2GQ8A 4BI7A 4UXDA 3S1VA 1QFEA 3UZ5A 3GZ3A 4AH7A 3PSVA 4HHPA 1JR1A 4GXMA 1H50A 2PURA 2YR1A 4O53A 1ZHAA 4JIQA 2CLEA 1SSDA 1OX5A 5DBTA 2H6RA 4NJJA 3GK0A 3L0GA 3DKJA 2P0OA 1EWEA 3W70A 1WV2A 4YCOA 1TTPA 4O19A 3GAKA 3B05A 1KM4A 4D2JA 5D04C 3G22A 2XN2A 1DQWA 3HJZA 2O7SA 3VE7A 1OABA 5C5YA 4RZ4A 4IMEA 3MHGA 3UQNA 1TIMA 1GVFA 3QRHA 2CZDA 5FEPA 1C9DA 5EKYA 5AYXA 3FEMA 7TIMA 3I6RA 1KLYA 3GVGA 4JTTA 4POCA 5A8GA 2NV2A 2PC4A 1VYRA 4LY8A 3SY5A 4GJ1A 1SFJA 3B0PA 4UR8A 3W2LA 4GC4A 1JCXA 1GWJA 4M7TA 5CSSA 1OF8A 5F4WA 3R12A 1YTKA 1L6YA 4IJBA 4JTLA 3QW4B 3VCRA 4RKAA 4NXSA 3C56A 3P8JA 4LRTA 1IIHA 2X30A 3QYQA 4Z08A 3NQGA 3NZ1A 2GOUA 3MBFA 4YWIA 2ISWA 5AFDA 3MP3A 5FEWA 4OT7A 1ZENA 4DXVA 4JTJA 4UFJA 4HT3A 5AC7A 4LWWA 4I7UA 3UWZA 1K7FA 2LLEA 5KMYA 1W3TA 3G8RA 3QZEA 3MP5A 1TMHA 3H53A 3UXDA 3WFAA 1QOQA 3O15A 3TCEA 2VEKA 1F05A 3KVKA 1GG1A 1FWTA 3OVRA 1A5CA 4NUWA 3L68A 2A5HA 1LBFA 1OK6A 4K6AA 3HB9A 4XKYA 5BMXA 4FNTA 4AMAA 4ZQMA 5KTLA 4FIRA 1BWLA 4MJZA 2QCFA 3NO5A 3SSJA 3ANYA 3BLIA 5H91A 4CQAA 1L6WA 3STCA 3CEUA 3IIVA 4XTIA 2HTMA 3OEXA 3LV6A 4DO4A 2YPIA 4L4LA 1YXYA 3D0CA 5D09A 1SO4A 3P60A 5G1TA 3QSTA 5HQEA 4A21A 1S3HA 2VOMA 3TDFA 3PBWA 2TMDA 1R47A 3N9RA 3USBA 3PS7A 1D9EA 1PHWA 1X8FA 1K8XA 3EXSA 4JIPA 1TPEA 4UIOA 3BK0A 2FDSA 3S8HA 2E68A 4M6VA 2GUUA 6ALDA 3C2RA 2H8XA 4R34A 5LHFA 5CPOA 3UY7A 1RR2A 1F74A 3B04A 2C18A 3BLFA 4A29A 3PG9A 4AF0A 5HR6A 2WOQA 1LRTA 1ZAJA 4C1LA 1F6KA 2CLFA 2WSYA 3IVTA 3LLFA 3EX2A 5K2ZA 2GVLA 3PUEA 1XKYA 5D2TA 1Q6RA 2C1HA 2H3DA 1LZOA 3BLEA 3MMTA 5F4XA 4Z1CA 1O4UA 5L6UA 1QPNA 1EWDA 3AJXA 4E38A 1XDMA 4HNTA 3YPIA 2TSYA 3QMTA 2VFEA 1JQVA 4UUIA 4UTWC 4MZ8A 1ZNNA 4ONVA 5TIMA 3P5YA 1B4KA 3W2UA 1EUAA 4RK8A 1W8SA 2Y7DA 3C52A 1WYIA 1FWNA 3ABRA 1LOLA 3LCIA 1V7YA 4YXGA 3HO8A 3S5ZA 4KFPA 4O54A 1SFLA 3PVFA 1TCDA 2ATMA 2CLLA 1FWSA 4FNQA 3IGUA 5G2IA 2C14A 2J88A 5K9XA 1YPFA 3SZ8A 4A2RA 4HPJA 2RKXA 1ZY9A 3O6YX 3TAKA 2ZCGA 5FEZA 4LVAA 2YFOA 3W7HA 4RR4A 4XBKA 1S5WA 3T44A 1XUZA 4LS2A 2CLHA 1CI1A
chains in the Genus database with same CATH superfamily
5HNNA 2W4XA 3WK2A 3OLGA 1LT7A 2BY3A 3OG3A 3AOFA 4FXJA 3GW0A 5HJXA 4HOXA 1V4YA 4TX6A 4QJ5B 4N9EA 4CQ8A 4MNKA 1C7TA 3VE9A 2FMOA 3SW6A 2QR6A 4JQ4A 3FAWA 5BZAA 1JF5A 4ZSTA 2PDYA 3UPMA 4Q7IA 4H2HA 3LCWA 3CUXA 5CKSA 3APGA 5TQLA 3KL5A 5H8MA 3LGGA 4LTSA 3SB0A 3HMCA 4DWSB 4DBUA 3DDMA 3T1GA 1TJRA 4LAUA 1B30A 2CZFA 1G7UA 1G67A 1NDWA 2FFIA 3D47A 1XXXA 3ZJ7A 2JBMA 5JUVA 4HNLA 1ZFJA 3TZFA 1EX1A 2B7QA 5DFAA 4J3ZA 1MXSA 3MU7A 5AC4A 1XD0A 3HM7A 4MG4A 3EOUA 5C6MA 3LY0A 1RZMA 1TPUA 4X9YA 4C7GA 2MNRA 3B40A 3CT2A 3AIVA 1KBJA 4W84A 3WQVA 3VIHA 3SR7A 2FZNA 1EEPA 4BWLC 1MWOA 3EMQA 1F3EA 1ONWA 3GB6A 4JTSA 2FIQA 2GVJA 5MKGB 4CUCA 2ZX9A 3P61A 5CC5A 3PZIA 4NL1A 4Z0JA 4O10A 1EZWA 3IARA 4LC6A 3MI2A 2A79A 5FEXA 1KKOA 4HYVA 1JCNA 5F2IA 1DQXA 3UZYA 3S2JA 3SBFA 2EKCA 2BXYA 2VYOA 4RJEA 4Z1AA 3D6NA 4UFKA 4IISA 1VQTA 1QI5A 4ZOEA 3URQA 4WY0A 3SRKA 2EQDA 3PZGA 1CGWA 3GTNA 3CGTA 4F48A 4ATDA 4ZA0A 1P0EA 4LT9A 4I5XA 2G41A 4AG0A 1DOSA 1QI3A 1VFUA 2V5LA 3ABSA 1TPB1 1Q8AA 5G4HC 4QBXA 1ZZMA 4ZQRA 2ESCA 1SPQA 3NYZA 5HDRA 2BHZA 2QS8A 3NSXA 4GUJA 1ENUA 1NP2A 1TZZA 1XDJA 1BRLA 3N73A 2GOKA 3CYJA 1QO5A 4QQUA 3CTLA 3TH6A 1FP9A 4IH3A 2G95A 1DTNA 5C0QA 1MUWA 2FZDA 1Q7MA 2J9YA 2Y85A 3P6LA 2VR2A 1GK8A 3IJQA 4WOQA 1VF8A 1ITQA 1FWBC 1AD4A 1QOPA 1GTEA 1Z89A 2AAMA 3UR8A 2YW3A 3K13A 1CBGA 4BS0A 4XX6A 1VCFA 3NL6A 4EE9A 2NUXA 3ZR6A 4HGXA 1W0MA 2NLIA 5HWNA 5A6TC 3TC6A 1ISZA 6XIMA 3OGVA 4D8AA 1DIKA 1ODZA 3UP8A 3RHGA 2HPIA 4HVXA 4XZNX 1NDZA 4KKXA 5CAKA 1IR2A 2Q8ZA 5AYZA 2YKKA 2X40A 5AHLA 1O66A 5I3HA 4ZCWA 3IVUA 3HG2A 2JKPA 4HHHA 1JG9A 2GDVA 3L9CA 4O1FA 3IVSA 1TV3A 4Y9MA 2WSQA 4RUBA 2DW7A 2KZHA 2PLMA 1EJRC 3GXDA 1WX0A 3CNYA 1R2TA 3GH5A 1RJQA 2HPMA 3V5CA 5C7VA 1YTDA 1EQCA 4ZFMA 3G1HA 5E6ZA 5LNWA 1VEMA 1DPMA 2CBVA 1W1YA 3PZOA 1TWWA 3B4YA 5K9CA 5AHMA 4FX6M 4R88A 1SGJA 2A3AA 1RD6A 1PCWA 3Q2DA 1HJQA 3W73A 1ZBWA 1KB3A 3O3RA 3GQYA 1TV5A 5G1YA 1PBGA 2NLYA 2OZTA 4FK9A 3R13A 3F4VA 3NO3A 4KIEA 2XYLA 2Y6ZA 1ICSA 3II1A 3PB0A 4ATWA 3NFUA 1EJSC 3E5PA 2G4FA 3CM4A 2E5CA 3TUUA 3BMVA 3PUGA 3N25A 1T6MA 3ATZA 1S39A 3ARXA 4E4UA 3WJSA 3ITLA 3TWAA 1E1EA 2FJKA 2ZXDA 3EOOA 1WUFA 3HPAA 3QPZA 1KQYA 2ZBTA 1SJCA 4IQLA 4KT2A 2CBUA 1IXQA 5EU9A 2A2IA 3RR4A 1BYAA 2WBGA 2XZ9A 4GISA 1KFKA 2Q02A 1F7BA 4S3FA 3UERA 1AL8A 2WMIA 1HJXA 2FHFA 1G5AA 3REQB 4WKHA 4CNTA 3STGA 4P5UA 2YA1A 3VIOA 2W9MA 3SCUA 3AXHA 1H49A 2YBTA 1LORA 4NP7A 5HULA 2XH2A 4KERA 1RVKA 5HMSA 1Z9AA 3GXPA 3UWEA 4N9DA 1TE6A 2QAPA 5B7YA 3QHMA 4H6RA 1KFBA 3RDKA 3VNDA 4X3ZA 1RSCA 4K1WA 3K4DA 1REQB 3DCPA 3ENLA 4LVGA 3G1VA 2R1NA 3MS8A 1EDGA 1EO5A 2ISDA 4WY0F 2FYMA 4WR3A 1R3RA 3EKZA 2GGEA 1JYWA 3H2FA 4I9TA 1XYAA 2E6FA 4JHZA 1KWGA 1W37A 3GVRA 1I60A 1DJNA 2WJZA 3B4UA 1QU4A 4XZ9A 2V38A 3LCHA 4C1NA 1QCWA 2WHJA 4DUWA 4ZO8A 2X42A 2I5QA 2J4GA 1FKWA 3AHVA 1JULA 4QFUA 3WCZA 3UG4A 5K4ZA 2AQVA 3UNDA 4ZOAA 1BF2A 2GGJA 3GM8A 5HPOA 1C8XA 3DKLA 6A3HA 2J7EA 1FCBA 4RX0A 3P84A 2ZUVA 1FOBA 2O9TA 3W1PA 2X1SA 1W3JA 3N9KA 1JFHA 1VH7A 2XINA 1ECEA 2PTZA 3RPDA 4LALA 4RDYA 1FCUA 1FQ0A 1DYSA 3IWPA 4P7RA 2Y8KA 3A21A 5C2GA 3MANA 3CC1A 1XUUA 1RH9A 2Y7FA 4FHAA 1CECA 2ZUSA 3OIHA 5A6JA 3T08A 4H3DA 3BC9A 3FN9A 4W86A 2WVSA 2WMFA 4GBUA 3JR2A 4FI4A 2DZAA 3JW7A 3KRZA 3IPWA 3KZPA 2GVEA 1YTEA 4UOZA 1AVAA 1G69A 4QJ4B 2C13A 3FGCA 3ALGA 1QT1A 4MWAE 1IT8A 4AZ7A 4GYPA 1V6TA 1ZALA 1QW9A 3JZEA 1IGWA 2DQWA 1HT6A 1DIOA 4LS0A 1AW1A 3AS3A 4PB3A 3FOKA 1CXIA 2NQJA 3OA5A 1M7PA 3TFCA 2E4TA 1PSCA 1JPHA 3L5LA 3ZT6A 3TSDA 3R1ZA 1NOWA 5I07A 4CEXC 1Q6FA 1VJIA 2D0GA 4K8HA 5FAJA 4RW3A 4MOZA 3SIZA 1UD6A 2BB0A 2QPXA 2E6AA 4XVDA 1WQ5A 3QFWA 4JKLA 4Q33A 1R6WA 3T2PA 5AECA 1A5UA 3GYEA 3T81A 1RLDA 3KS5A 2PMQA 1GT8A 3E0IA 4B16A 3QKZA 1PTDA 1BQGA 3HG4A 5M1TA 2E09A 5AHNA 4U2YA 2GJXB 5EY5A 1GVSA 2QULA 1AH4A 5DMLA 1OCJA 1ALDA 4NG3A 4PMYA 1PTAA 1NWSA 3DG6A 3DHFA 3VIFA 3AUOA 1XF0A 3VDCA 3GU2A 5I3IA 1TJPA 2UY5A 4A3RA 2Z0IA 3TCSA 3FKKA 1ODUA 1BVNP 1QR7A 1HNYA 3AMLA 4D6DA 4N9BA 3CIXA 4E2OA 3BH4A 1FWGC 3WN6A 1W54A 4C90A 3W00A 3UXKA 3MPGA 4AVOA 3K2GA 1JZ6A 1AUSL 3MHUA 4R33A 1LBLA 1M53A 3CHDA 1ZAHA 2WVUA 3B8IA 1X7FA 4NZ4A 2VC7A 3GIQA 3L4YA 1SZGA 3O9NA 3TA9A 3IUHA 1UD2A 5A94A 3IGHX 4UCGA 1Q7ZA 3STFA 2J62A 1Q6OA 1W3IA 3WBAA 3KDNA 1R46A 3QPYA 5T8GA 3C2EA 4A3HA 1ADDA 3KDOA 3TN5A 2FGZA 1M65A 2PDWA 3NXFA 4K7YA 2X09A 3HGRA 4MDPA 2D73A 2PGEA 3WIJA 1OD0A 1WBJA 1B5TA 5AB3A 3GDMA 5T26A 1Y0EA 3KS6A 1U83A 5D2WA 1WKFA 5KSWA 2NX3A 2QV5A 2NSOA 3I68A 5DF0A 1ZS2A 4MAZA 1OVDA 2V9DA 4V1XA 3ABXA 3DFOA 1ONRA 1S1RA 5LGXA 1R2RA 4ERIA 4AB4A 1FWCC 3O6CA 3CV1A 1KCZA 4ACZA 1W9UA 3FYPA 3PG8A 3BANA 2FQIA 3MZNA 5ABHA 2GGHA 1D3HA 3LRKA 1HKVA 3H21A 6TAAA 3LXAA 1OFPA 4KGLA 1QNVA 3LYEA 2J6VA 2Z2BA 3CMFA 2QJIA 4IMFA 4I6KA 2OG9A 4CVWA 1AQFA 1WDDA 4PN2A 1ZB5A 4B5SA 2XSAA 3K8MA 3RJXA 3W81A 3GUWA 4PRWA 3VK5A 1WKEA 1MVYA 4O57A 3CV2A 2BOGX 4L4MA 5I24A 3SIMA 2ZX6A 2PDKA 3L5MA 3LEPA 8CGTA 1BLIA 3SRHA 3C0JA 3G1FA 3TTSA 4CNNA 3FEQA 1R9ZA 1TTIA 1MZRA 3T05A 3UZXA 4BF9A 1TPWA 8XIMA 4C6CA 4AQLA 4MAVA 2D22A 5CXPA 2DZXA 3OA3A 2NXGA 1OFRA 2YLLA 1NJJA 1E73M 3HOJA 1EO7A 2VD8A 3THUA 2R1MA 3VKBA 1PEZA 4QX4A 3H22A 4WJEA 1B3XA 2BOEX 3AS1A 1KBIA 2ZZ2A 2ZRZA 1AK5A 2DSUA 3LB0A 5EFDA 1LUCA 1VC4A 4HA3A 4X61A 3BCDA 2D2GA 2XIIA 3KRUA 4WGHA 1E5NA 4XQ6A 1YDVA 1Q85A 4LY4A 4BR1A 3B9NA 1XLGA 2B7PA 1S5TA 4CQBA 3QQ1A 3GG1A 3GLCA 1OCQA 1FWRA 4KS0A 4AXNA 5F1UA 2YCEA 1M68A 3WJYA 2W66A 2XWDA 2A3BA 3HPZA 3I6EA 4C6FA 3COTA 4MB3A 2WWDA 3SAZA 4K36A 1RP8A 2PCQA 1XIFA 1JCTA 4AWEA 3WJWA 4KETA 4PB4A 4IGSA 4PODA 3W7EA 4BWLA 1M01A 3GDTA 1ZL1A 1JZ2A 3GG7A 3WD4A 2YL9A 4DZ5A 1OB0A 2Y24A 1BXNA 5EBUA 2F2HA 4OOZA 1KGWA 3M6DA 2OWWA 3WF2A 3EWYA 3ZFHA 1GW1A 1WUEA 2V6AA 4HMEA 3M5VA 3VGFA 3SUTA 3ZJ6A 3VZZA 4R53A 1WZMA 3K4AA 3S5SA 2OQHA 3TR2A 1ZBVA 1XICA 3SUWA 3W3OA 1V0NA 3TYBA 3RPMA 4DF0A 3MB9A 4CQCA 2DSKA 2XIBA 3U3HA 5T9CE 5J8LA 5K9DA 3G18A 3OW1A 3FA3A 4JBRA 1UOKA 2CC0A 1A5OC 1YPIA 3HG5A 3AICA 1E6QM 4AMCA 5DMYA 3W76A 3B9OA 4HA0A 2V3DA 3VCNA 2Y5JA 3UYIA 3LLXA 1BGAA 2Z1BA 3M64A 4E0CA 1W1IE 1B0IA 1TV7A 3C3UA 3V0TA 2IW0A 3CL6A 1VLIA 3B8VA 3KOWA 2P10A 1PS9A 1UR4A 1Q2SA 5DXYA 1P6BA 5FKYA 3OYXA 2ZZ4A 3W28A 5DT5A 2G8ZA 1THFD 5E0FA 2OX1A 1HFBA 1MDRA 2G97A 4XWUA 5C9WA 4MNMA 1ZSXA 2PTYA 3RX2A 3EXTA 3RMJA 3HURA 2C15A 4S3BA 4PL1A 3C5QA 2WSKA 5EMMA 5JBFA 3UPWA 3WDRA 3OHMB 4OQVA 4FNRA 4LOCA 3WF0A 2OOGA 4IMAA 1VCGA 1B31A 2HBVA 1XIDA 1UQZA 2Y5SA 2ZC1A 1TWZA 1Y5XA 1SUXA 4IMGA 4MZ1A 1XISA 4F9JA 1G7VA 1IYXA 3EA3A 3ARPA 5CQ1A 4ML4A 2PDJA 3TYDA 1WXZA 4EF9A 1RBOB 1AZ2A 4M5PA 4P8VA 1K6WA 3FHAA 3IV8A 3W88A 2GQ3A 1U2YA 4GGBA 4O17A 4W85A 1DIEA 3TTQA 2BASA 4WSHA 3M0LA 3CYVA 3TN3A 1QW7A 1XGDA 3MUCA 5DN1A 3HFTA 2QUVA 3LCFA 3GNDA 3AUJA 1XYLA 2J77A 1GVQA 5C71A 3TYUA 5JBDA 2CZEA 2ANUA 2O0TA 3WJXA 1XCWA 3RLVA 1JXJA 3KVLA 1C3FA 4H6KA 5T9BG 3TC7A 3IJ9A 1GEQA 4OUEA 3ELFA 1RK5A 2W92A 4DJFC 3TU9A 4NY2A 4R7WA 5IHRA 3WQGA 1J18A 4JZ5A 2O4QA 1LOQA 4X22A 4RPPA 4ORIA 4XVEA 1CXLA 3RILA 8RUCA 3GR7A 5E9XA 1W2PA 4OGZA 1GUVA 2OWCA 3VNYA 3W25A 4AAJA 5E1QA 2C71A 3HU7A 2O4MA 2WHLA 3AYRA 3LRLA 4N0RA 3GXFA 4M6PA 2YW4A 1XBZA 1EHAA 4O0ZA 1V3HA 2C19A 3GNPA 3PZTA 1CLXA 3NEVA 4O15A 1JPDX 2UY3A 4ASTA 1NIUA 3W7JA 2H90A 4WF7A 5FF2A 3B9AA 1YNPA 5D05A 5AC6A 3VGBA 2WAGA 1A3HA 3O0KA 3N4FA 4FF5A 4I90A 4R7OA 2O55A 5A8NA 3WQCA 4ZQOA 6REQA 4REQA 1OD8A 4YPJA 2VTFA 3SCOA 2PDUA 3W53A 4X0VA 3N6QA 4L9XA 4MSSA 1SQ7A 2WZEA 1R3SA 4J3UA 1K8YA 1KGXA 3WK3A 4W7WA 3H4GA 4YTRA 2GK1A 4FOKA 3S46A 3TYZA 3DG3A 1W5QA 1NP0A 3G2GA 4J3VA 5GQBA 5FESA 3OLEA 1EUNA 2DW6A 2I7GA 2CYGA 3TMQA 1GOXA 3WK0A 3TXZA 2YGYA 3ZIZA 3A12A 4RNFA 1PDZA 3MDWA 4HNNA 1SU5A 1V6YA 4DF2A 1YRRA 4GGHA 4AC1X 5BRQA 1QPOA 3W7KA 5MHBA 1SSGA 1L2UA 2BVWA 3UR5A 1A53A 3CXOA 4I8YA 2NQZA 3PBGA 3CZ8A 3NQFA 1UROA 2QJJA 5CLTA 4RPQA 3MV01 2EPOA 5JU6A 1KXHA 2FHCA 2IQTA 2ZDRA 3M4HA 4H4IA 2YFNA 3O1NA 3U7BA 3H24A 4HP5A 1YMYA 2V3FA 3N6JA 1WA3A 1IIGA 3DC8A 4PMDA 3UWQA 1TPDA 4GLEA 1SJBA 5B7ZA 1Z3NA 4F40A 3C2OA 1YHTA 2CCRA 3LBOA 1JCYA 4CN1A 4QGCA 1RXOB 5D37A 3F4NA 3L67A 4Q8TA 2QDGA 1FDZA 3GHUA 3UT0A 1AQHA 4AHQA 1KTBA 2C8NA 1H61A 4ZE5A 1KWKA 4CU6A 1JZ5A 1G4EA 3GC4A 3PJXA 2BGQA 2I17A 2J75A 1TMLA 4UTJA 4GJJA 2VZOA 4CQ9A 1T5AA 4W5ZA 2XUCA 2CBJA 3U2CA 3W2KA 3MDUA 3T8QA 1ELSA 4J28A 1MQRA 3WDHA 4CD8A 1RA0A 3HBLA 3M0IA 4XZMX 4LSBA 4CEUC 3WF3A 3T4WA 2VENA 2FVMA 3W1UA 5D9NA 3U2OA 3S9ZA 3BL3A 3AU6A 1JGIA 3QM3A 1I1WA 1OYBA 4ENLA 4GY1A 1GQLA 3ALFA 3TTYA 1Y5VA 4Y96A 4AYSA 3E2VA 4XZLX 2Z29A 1Q6LA 4QP0A 6TIMA 4LCQA 1EDTA 4P7OA 2NWRA 5AYYA 1OJXA 1GPFA 5HQMA 2BTMA 1NARA 4XB3A 3V75A 5I00A 4LF1A 3M0JA 1VBRA 1TCMA 2ABAA 2NT1A 1ZUAX 2B4GA 4EIVA 4D1IA 1LG1A 4XK2A 1IT0A 1TV4A 2IQDA 3EPOA 3DU0A 4LAZA 5FACA 4CNOA 4Y8FA 2V2HA 1V77A 3H12A 3STPA 3ZLGA 1IQ8A 1I0DA 4JKMA 3CQHA 4M82A 4EVZA 4G6CA 4PL2A 2ZX7A 3NL5A 4AHPA 4WOZA 3SCTA 4HK7A 4IP5A 4BQ5A 3MY9A 5G2WA 1J6OA 1XCFA 3SDOA 3C86A 1SMAA 3ANUA 2I57A 4AXKA 2R1PA 1W9VA 4JTRA 2A7PA 2Q09A 1XSIA 3L2IA 4DLFA 4YU1A 4AEOA 1FHVA 4UXDA 3E5BA 3MA8A 4DM1A 3GZ3A 1M3UA 4AFYA 3PSVA 1H50A 2YR1A 4YS1A 4LB3A 1UH4A 2P88A 4OTKA 1EWEA 3ECQA 3NXLA 3ARVA 1WV2A 2W91A 3ZSTA 2V3GA 5ECVA 3WH9A 1XD1A 3UR7A 2O7SA 1HQTA 5A6MA 4M81A 1J0IA 1BAGA 4PMJA 4UNIA 1TIMA 3CO4A 4HCLA 5CSYA 3AMCA 5EKYA 2ZUUA 3FEMA 3I6RA 3AMKA 2O92A 1IWBA 3LNPA 3MSDA 2NV2A 1J10A 4LY8A 3GTFA 5I77A 1SFJA 3OGSA 1JGMA 5LA0A 4M7TA 4JCLA 3QC0A 1OF8A 5F4WA 4ZO6A 2OTDA 3NZQA 5AYIA 1X7IA 1YTKA 4B5VA 4IJBA 4UQCA 2BVTA 3QYQA 4GI4A 3NQGA 4DJDA 4FLRA 3TR9A 4YWIA 1E4LA 1RHCA 3IAPA 5AFDA 2AGTA 3WQ6A 2VCBA 1QATA 4RE3A 1RAKA 3D46A 4E8CA 2ZE0A 2PZNA 3H2NA 1A5MC 4WIWA 4NSBA 5REQA 4QJ3B 4NAFA 1PX3A 4YHGA 3UXDA 3WFAA 3TOYA 4XAFA 1V3JA 1F05A 1FWTA 1AFSA 4K6AA 4AIBA 2QCFA 3NO5A 1DE6A 4PBEA 2VX5A 4HCDA 2XFFA 3STCA 4C5ZA 3AIWA 3IIVA 3UJSA 2WB5A 3UXLA 3D0CA 3QV6A 4D71A 1J11A 3V18A 3K8KA 4ZEPA 1YBQA 1NDVA 1S3HA 3TDFA 3PBWA 3N9RA 1C8QA 1PHWA 1X8FA 2QGHA 4JIPA 4ZFCA 3BK0A 2FDSA 4YTQA 4M6VA 3C2RA 1V0MA 1O5RA 4R34A 5LHFA 1F74A 1L8NA 1XRVA 1EJUC 3CBWA 5HR6A 1ZAJA 2CLFA 3LLFA 1CTNA 5K2ZA 2PA6A 3PUEA 1FFQA 3UF9A 4FOUA 4S38A 1EWDA 3YPIA 2WYSA 2VFEA 4I9MA 1ZNNA 4ONVA 3N2OA 5TIMA 3SCQA 1M04A 1Q2RA 3PK7A 3SY1A 4DBWA 3E0FA 1XLIA 4Z2LA 3S5ZA 4KFPA 4O54A 4LAMA 3LPOA 1MDLA 3SUUA 4CKQA 4MB5A 1W9BM 4Q8UA 2C14A 3V4BA 5K9XA 1YPFA 2VO5A 4ECLA 4HPJA 2G3IA 5A1AA 3VZXA 1UA3A 4W7UA 4PTMA 3UZZA 5AC5A 5E9AA 1J6PA 2Z1WA 4LS2A 1HVQA 3OO2A 3SRFA 3SGZA 5I23A 5C2XA 1XFBA 3LDVA 5L9FA 1P1MA 3RU8X 5H6HA 2DH2A 4QM1A 2QMKA 3NQEA 3ME3A 4FLSA 4KWWA 3POHA 4HK6A 4IUOA 2AQWA 3W75A 3KTCA 1MEHA 1F3TA 1KFLA 1JUEA 3NQDA 2OZ8A 5FI8A 4MHBA 3HMJG 1XINA 2VR5A 4KRTA 4AX7A 3ONBA 4QLJA 3BARA 4XZHA 5AKQA 3D5HA 3AXMA 2A6NA 1E4IA 2WVVA 3ID7A 3KFTA 5FSDC 2INEA 4WD0A 4UQDA 1DE5A 3VD7A 1W9XA 3WQEA 1M7XA 3QGAC 1PPIA 3QOMA 4AZ5A 4GKLA 4FA3A 2D2JA 1FHDA 3B06A 4JD4A 2CW6A 3KP1A 5CH9A 4B3LA 1TPH1 2IMRA 1K1DA 4FSAA 1C92A 1SYTA 5AHIA 3RITA 3IUDA 3DZ1A 1QNOA 1PWMA 3A5FA 4JHMA 4ZVJA 5LZLA 4G56A 3T0TA 3AALA 3M7WA 3S2MA 4QDPA 2QHAA 3PNUA 3EDJA 4DZAA 2PE4A 3CLMA 3GC2A 1J9YA 1B3WA 4A8IA 4GIAA 3VA8A 1SMDA 4H01A 3NDYA 5CGQA 1W3LA 2FH8A 1EXPA 1Z8AA 4S3CA 3CQIA 1Z7AA 1OG6A 5LIYX 1NWUA 1SZRA 3TN6A 4E3TA 3QV9A 1ITXA 1ZBCA 2DIKA 4IOTA 3VGDA 1E55A 3OHIA 2E5DA 1FVPA 2ZVIA 3PBMA 1O95A 2WKGA 3F1QA 1KM6A 3ES7A 4JGDA 2E5BA 2PLCA 2ZZ7A 1PDYA 4GYKA 2ZZ5A 3C4UA 4PMUA 1NQ6A 5EFFA 1TVLA 3N34A 5F2MA 1UASA 3IRSA 3K46A 3TTOA 2VGIA 2D3NA 1W3NA 3DYOA 1OT1A 4YWSA 4W8LA 1UBSA 2CZVA 4I8DA 3B3DA 2HWGA 2HRWA 5FL1A 3UVAA 1UUOA 2PDXA 3C2YA 2VQTA 3EEZA 1TQJA 3Q37A 3WLNA 2B7NA 1J5TA 1FX6A 2B0MA 1LLOA 4Y90A 1ZPTA 3S0CA 1KBKA 1CX9A 3TK7A 4XAGA 3VDGA 3VX0A 3OZYA 3WH7A 7REQA 2FB3A 2QUNA 4JTUA 1K8ZA 1DWFM 4DJFA 3N15A 3BUVA 3M43A 2REQA 2PDGA 5HWJA 1YDYA 4UCFA 2CLOA 3LHWA 4FX8A 2C1GA 3TLLA 2WSPA 2A1YA 1U22A 3U5UA 3W9ZA 3WUGA 3NL2A 3LX9A 3U0HA 3MTWA 5CPLA 3U9IA 4DHGA 2QKFA 5I3JA 3O6AA 4IG2A 3NOYA 1X97A 1XLCA 1GJPA 2IPFA 1M41A 1ZLPA 2OLAA 3QKEA 4URIA 4NAEB 3CUZA 3PJUA 1XIGA 2JK2A 3H2CA 4L7ZA 1JNEA 3FW6A 4GKTA 4IL2A 2R6OA 4NRSA 1X1NA 1OF6A 1RPKA 3IRDA 4EPEC 4ILSA 2F9RA 4KFNA 1JRBA 3LD5A 3RRXA 2XGZA 4LXFA 4F8XA 3NM3A 4V27A 1Q45A 4GACA 4C6DA 3H4WA 4YVPA 2C7FA 3LGDA 3N13A 3PFMA 3VIJA 4TTGA 1XI3A 1C93A 5CZTA 1MQPA 1AJZA 3NO1A 3F4CA 2PGRA 1LRQA 5A8MA 1Q3NA 4TO8A 4PFHA 4LV4A 1SFSA 1YADA 1AW5A 1KM1A 4A4AA 5H2ZA 2DZPA 3WLMA 4KQNA 3IGSA 2XTKA 4E4PA 1A5KC 3H2MA 2OLSA 1J2BA 3KTSA 4MM1A 4Q4OA 2YX0A 3QSRA 3CHFA 1VFMA 3R4IA 3W72A 3S1XA 3F03K 3W2JA 4U28A 2HS6A 5G2HA 3LCGA 2XSXA 1FH8A 2ZFAA 4L9ZA 1QPRA 3R0DA 4LUJA 1B90A 1VIWA 4ZENA 2Y1HA 4JX4A 1ECQA 3QTGA 1PIFA 1Q6DA 2BY1A 4LUTB 3QQ0A 2GSJA 1K7EA 2VELA 3UJFA 3G3MA 3E0LA 1GONA 3CK5A 3R10A 3WLIA 2DVXA 2G3MA 4US5D 3VDBA 3WQ4A 2A3HA 4ZO7A 5A69A 3CUHA 4JOMA 4KF1A 1NU5A 1UA7A 1UUMA 3QW3A 1OCNA 1F2JA 3B8DA 2WNWA 3DXIA 2TPSA 4D8LA 2XFRA 3N3TA 1GCYA 3O6DA 1SW3A 4JTCA 3GTIA 5FJUA 5FSEC 4GVFA 3BZGA 1HW6A 4S3EA 1H09A 1I1XA 3W27A 2C3ZA 5HMEA 1E71M 1XH0A 1JXKA 4OWGA 4M6UA 2XVGA 4JR5A 3TQVA 3UWWA 3RM9A 2F7FA 1H7PA 4I7WA 3R94A 2HEJA 3OG2A 4Q8WA 4EPKA 3DH7A 3F5JA 3WJZA 4EAYA 4WXZA 1T99A 4G1NA 1P6CA 1UUQA 4FX7A 3GFXA 3TSBA 3ZT7A 1QNSA 3NOEA 3VOCA 2W0UA 5F7UA 1ZCOA 2WZMA 5E09A 4CQDA 1OBAA 3M5ZA 2PF8A 4A8LA 4LBRA 1UJPA 2F38A 2Z4GA 3VD4A 1JCJA 4DYJA 1JUBA 2VX6A 3AYTA 2AAAA 3CAWA 3M1ZA 4A3UA 1UW9A 1CDGA 3N2XA 1QOXA 3EDFA 1QWGA 4AD1A 2Z6IA 2BOFX 1KCLA 1IXNA 3H7UA 4JEJA 3DYPA 3NAVA 5CC3A 1PJ9A 4HPGA 1GHSA 3GZAA 2WNQA 1EA0A 3W24A 1HL8A 1CNVA 1CPUA 2OSWA 3BMXA 4HSOA 3BG3A 4IX2A 3WQPA 8TIMA 3LLDA 1M1BA 2BHUA 5DCEA 4WDTA 3H23A 1DBTA 4HU3A 1TFVA 4ERAA 1IF2A 2VUNA 3KXQA 1MYRA 1XG4A 5A2BA 2PDPA 3ITVA 3G8EA 2GJPA 2W3ZA 3WMSA 4CU8A 3PZ9A 3MUAA 1H2JA 1ME8A 1TVPA 1ME7A 4MUZA 5LHEA 4NHVA 3VGHA 3VUSA 1SFTA 1VPYA 5I3FA 4LUSB 4FF7A 4AZBA 5GPRA 4J7RA 1MMFA 3RMEA 5CBJA 1GG0A 4O13A 5I3GA 1OHLA 4DO6A 2A4AA 3ARZA 1TR1A 3WY1A 1XP3A 4NX0A 3M0ZA 5J5RA 4CD6A 1EDQA 2ASHA 5BRBA 1V02E 3DECA 3RO8A 4R9XA 5AVNA 3FVMA 2UWFA 1GZJA 3NQ8A 3G1YA 1KFEA 1NF0A 1DXEA 3H54A 2V69A 3GU1A 3WFZA 2QCEA 2YCLA 2QF8A 2YZRA 4WVXA 1JZ3A 4DYEA 2JGYA 1QI2A 4ZOBA 3GG0A 2VEPA 1I2PA 2IS7A 5G4EA 1Z44A 4GINA 2PD9A 3PFRA 4OECA 5AHFA 2EKGA 5DEZA 1ZBKA 1US3A 1US0A 3VOIA 3MJMA 5DMMA 1IHIA 3M0YA 1KRBC 1YNYA 2F6XA 2PFHA 1TUXA 2ZRUA 1A3WA 5CCZA 1JRCA 4IT1A 3WMBA 4BQ4A 1XX1A 1GW9A 4P8XA 5JIPA 3GNXA 3EOLA 1GZGA 2ACSA 4M1RA 1Q6EA 3EPMA 3SURA 3QOKA 2DUXA 1DEDA 1KW1A 3OP2A 2OZ3A 1KV5A 2A3EA 5M03A 3GG8A 3NCOA 4FLQA 3PJTA 5ABFA 1NAL1 3MCNA 2Z7GA 1VJSA 3NURA 3H4XA 5LXXA 2OOFA 4QEHA 4LNCA 1QW8A 2RDUA 4HZ7A 5D32A 4DN1A 1RCQA 1M5WA 2E1DA 4HOWA 2X41A 3S47A 1Y8BA 3UG3A 4HJFA 4D72A 2BXZA 3WEOA 1LWJA 3GDRA 2EGZA 4G8TA 4GQBA 3WH6A 2RUSA 1H3GA 1HKIA 3CJPA 3A22A 4DZHA 1O12A 2YA0A 3UETA 3GKAA 3W7MA 2OXNA 3GIYA 3PBVA 3UWUA 2IPJA 3WLOA 3U7VA 5CSRA 1ME9A 1RY8A 1UG6A 3W7QA 2RGMA 4S39A 1W1TA 2C0HA 3HIJA 1BPLB 4PRTA 1VBJA 2VOTA 2QZRA 1E0XA 4MWAA 3NEHA 1R85A 4MZYA 3B9EA 1EXBA 1UYQA 3AIRA 4H9YA 4Y6GA 3TQ0A 3WQDA 4A8NA 1C91A 2QCHA 1GVYA 1IXPA 1BGGA 4GG9A 3EOSA 3UGVA 2G96A 1UD3A 3SCSA 1KQZA 4HHMA 1RD5A 3ZYZA 5LIUX 4WKAA 3RXZA 2J47A 3VM7A 3O63A 2RH9A 4QHRA 3AS2A 1EF3A 1XLLA 4J40A 5I06A 1LP6A 5KZMA 1PX4A 1Z32X 1XIIA 4PUMA 2C79A 4WRHA 4LU0A 3DFPA 2VX4A 1GQJA 2ZUWA 4ZO9A 3V7PA 3OPSA 1H7WA 3M5YA 4JTAA 2V5CA 2WK2A 3S3GA 1FWAC 1DXFA 4NQ1A 2PGWA 4BQ2A 2EAWA 2V8ZA 1E6RA 4RZ5A 2J27A 3MO7A 1XYMA 3WYZA 2NWSA 2HNEA 5HJYA 2E6YA 1EA9C 3E0WA 1TTQA 4PEKA 2D23A 1YW1A 1S5MA 3UCQA 1UD4A 2QEZA 4B9YA 3GVVA 4IWWA 2Z1SA 4AD5A 1UWIA 3UA4A 2Z25A 4AD4A 4O28A 1CGXA 1A80A 4IL0A 1DHPA 3CT7A 1B57A 3AHZA 1PTGA 4Q8NA 3LQLA 4Z17A 3TLQA 2VNCA 1JYVA 5CZJA 1E51A 4GVHA 4DI9A 1TYGA 1QI4A 4IIHA 2OZ0A 5AHEA 5BU6A 3WNPA 3AYVA 3GVQA 3E74A 2QCDA 2OWXA 4RXFA 3CB3A 4CD7A 1VFLA 3CAQA 1BKHA 4L1GA 1EC9A 4AEEA 1DWAM 4QS5A 4FXRA 4MYAA 2XIOA 2V67A 4MY9A 1FTXA 5TNVA 1VRDA 4CCZA 5AVHA 2NUWA 4KFOA 3XIMA 2YYUA 3N29A 3V0SA 5C9RA 4KWUA 3NQCA 4MFDA 1H51A 1Q6CA 3CMGA 1VFHA 2IKJA 3DBPA 2PLKA 4UTUA 4W4QA 4NZFA 1AA1B 1AH0A 3LSCA 3W7OA 3MVIA 4QRNA 2PS2A 1K7XA 1LWIA 2IPWA 3B0XA 4R85A 4N9CA 5F1VA 2ISSA 1D3GA 4I5RA 5LYRA 1JCMP 4E6MA 1W1VA 5C54A 4WKFA 4M1BA 3RNDA 3DFHA 3DGBA 3LHVA 4K7VA 3E9AA 4BHYA 1GQIA 3PB2A 4BEUA 3LHYA 3IJDA 4EAMA 5D03A 3A6OA 4JY9A 2YL6A 1SVDA 4RLIA 3N2TA 2X7WA 2QPSA 3GDBA 3IAQA 2BXVA 3KVMA 3BG9A 4PCNA 5JH2A 1R9YA 1S5NA 3KWSA 4MFEA 3PPFA 4O1EA 3IIOA 4RNHA 3GIPA 3IIPA 3GNNA 1LG2A 3AXKA 1JD9A 3HQOA 1YLVA 2BS9A 4V33A 1KXTA 4NJHA 1HJSA 1G4PA 1XR2A 5HNRA 2O56A 4GQ0A 2BV9A 2X2GA 3ZR5A 1R0MA 3FKRA 4GC3A 2BHYA 4L4OA 2I5IA 1W3KA 1DJYA 3DC0A 3RPTA 3QF0A 2NT0A 3O8AA 3KL3A 3HGJA 2CHRA 3NIYA 2FKPA 4J9JA 3SY8A 2C0AA 2O9OA 3KRBA 1R7AA 1F8IA 5HOSA 3ABQA 3GXMA 4MY8A 1WZLA 2Q8LA 3RN6A 1LBMA 1TPFA 4OUIA 1X6LA 5E93A 1NF7A 2PTXA 1HL9A 1TREA 2ABBA 2NUYA 2YZ5A 1VENA 3ZS4A 2V68A 4S3GA 4JYEA 3M7SA 1D7KA 4AVNA 2O7QA 3A47A 4XAZA 3VOGA 2J8TA 1FP8A 3VPLA 1A5NC 4K8EA 4Z0SA 3BQ6A 5LSMA 3EAUA 3FJNA 2QUTA 5BXRA 3A5VA 3WK1A 4ZB5A 2AQOA 5D8ZA 2AL2A 5CEWA 3P62A 3S9IA 2PP1A 1VPXA 2EPMX 4PUWA 1QJWA 1WDPA 3VVGA 1VP5A 3IJ6A 4Q7BA 3WDJA 2DSZA 4GXWA 1SO5A 2HXUA 4NVTA 4DXKA 1G01A 4YMZA 4WJ8A 4DX3A 1OFOA 3S4TA 2HXTA 4OZOA 2J7CA 1RJPA 3U2ZA 1K9DA 4KCTA 3G1AA 5LNSA 6ENLA 3TA6A 4W87A 3UYCA 2NXHA 2GWNA 4US5A 5BOEA 2ODOA 3WNMA 3FNDA 3LTPA 1DP0A 1Q6GA 4GY7A 2PP3A 1TJ2A 2X05A 3ITTA 4D9PA 3VGEA 4XD5A 1A5SA 3VD5A 2VRKA 3WSUA 4DELA 1OGGA 3S42A 2AKZA 3EKGA 1WKYA 3S6OA 9RUBA 3NGJA 3MJYA 3AHTA 3D3FA 1ITCA 3ONCA 3KLKA 3NZRA 2QV4A 1X39A 2WMKA 1UKPA 4MNJA 2C91A 1L6SA 4S2BA 3QEZA 2CLPA 1S3TC 1AMKA 1UPPA 4F2UA 3QY6A 3TJXA 1VEPA 3R2GA 3SQMA 2X2YA 5LGZA 3A64A 3P7YA 1GOOA 1JYXA 3ZO9A 2FTPA 2IQ0A 4AZCB 1SR0A 2OMAA 2R1KA 2I5GA 1UZ4A 3GR4A 3T78A 1E40A 3NDOA 2VXNA 2P0IA 1XSKA 2OKOA 4AD0A 3FLUA 3OTRA 4F3HA 3AWOA 2PI6A 4UFLA 3APYA 7PTDA 1AODA 2DEPA 1VR6A 1T8QA 3U2EA 3VIGA 5J04A 2ACRA 1OX4A 2OGJA 1CYGA 3WDIA 5K3VA 1LOSA 2R94A 1FUYA 2HJPA 3LPFA 4LQ1A 3OZMA 5CC6A 4EX4A 1V6XA 3MSYA 3UG8A 3U48A 3IJIA 5E5CA 1E72M 4GFSA 1YE4A 4X2PA 2JFEX 4GIYA 4HPXA 4OU1A 1AJ0A 2OLHA 3G1DA 2VC9A 3NG3A 4UC5A 2XSBA 2R9RA 3PTQA 4H9ZA 2QAFA 3AQUA 2ZRVA 4HQVA 3CHVA 4MB1A 4OHQA 3V16A 2XFWA 3LZ3A 2BGSA 4M19A 3G77A 2OR2A 1HF6A 4TX8A 4HYWA 5D9PA 5JH1A 1BVWA 3I7RA 2R24A 1ADOA 1WZKA 5GVJA 4L5ZA 3VDHA 1KCKA 1K6AA 1QAPA 1E9ZB 5I2UA 4GUFA 5C9UA 4HU0A 4W93A 3RLHA 4EANA 4ES4A 2CETA 1F73A 4ZZ9A 2V81A 1XLJA 4FAMA 2D0FA 3RAOA 5I5RA 1PYMA 2J7DA 4JIHA 2WZHA 1BXBA 1DKWA 3G6LA 5HBFA 4LB4A 1G4TA 3PBUA 3TEVA 3WQ5A 4KIRA 1UR9A 3F5LA 2OB3A 3EWWA 2QJNA 1RA5A 2DSWA 3A4WA 3TONA 3A3WA 3GC5A 3MVTA 1ZCCA 1KV8A 3LM3A 1F76A 4UZUA 4ZQNA 3F2DA 4G5DA 1VBGA 4QG8A 1C8YA 3IIXA 1UWSA 3DFSA 3VKJA 3ZXWA 2PDBA 1AW2A 3LENA 3W7CA 1WXJA 4HA4A 3TQPA 5D9OA 1EFZA 3MCOA 3KBJA 2EG6A 4QS6A 2BY2A 2BNJA 4JTIA 5A6SA 3GO2A 2GLKA 1CB2A 1B2YA 2FGBA 4BCEA 4I3GA 2GJNA 3GHSA 4PBFA 1UMLA 3OZPA 4RNIA 5HUOA 1LLZA 1NQKA 3LHTA 5FJRA 3TMLA 1OFEA 1EC8A 1V79A 1M7JA 1Q4NX 2VQUA 4JN7A 3CWNA 4HNUA 1PXGA 1K03A 4JIIX 4AWSA 4IXHA 5PTDA 2V2CA 5I7GA 4MKSA 2Y63A 2QIIA 2WLYA 4QROA 3P2VA 3QYSA 2HK0A 1DV7A 2V63A 2GDUA 1QNRA 4PMVA 1GQNA 1FXPA 1RALA 3WBXA 3NQVA 2GGIA 1G94A 1PO9A 1SW7A 4HBKA 1BTMA 3W85A 2QXWA 1ONEA 3AZRA 4ML9A 4AD3A 1IZKA 3EWZA 3OB8A 2IUZA 1H7NA 4IQDA 2VDGA 1XBVA 4XIMA 4HD5A 3LBCA 2E25A 1NFBA 4PSRA 4GCAA 1SZFA 4ZQPA 1Q13A 3DUGA 3M44A 1IEQA 2ZUMA 1O7AA 5AY7A 2XVKA 2QYGA 3MC5A 3N9SA 2PB1A 1SO6A 2VUYA 1JAEA 1ZAIA 2VM8A 1B3OA 2WMJA 4L65A 4Z2GA 5EMKA 1V6UA 1ZJIA 3LMZA 2YYTA 1TZ9A 1R3YA 4LGXA 3QR1A 2I9UA 1CWYA 4KESA 4LVBA 4DXXA 4HNOA 4ZE4A 3WD3A 3WUBA 4AIEA 4JYDA 4Z2HA 3LTYA 1FWEC 4P8WA 1VHCA 3MYPA 4DWSA 4Y9OA 4IFKB 2RFGA 1EGMA 4B92A 3TN4A 3HF3A 2EJ1A 1OY0A 3FXYA 3ARYA 2JQXA 2NQLA 5DMNA 1J0HA 3PR2A 2Q6ZA 4GQRA 1QMLA 3CUGA 3CTTA 4DPPA 4NI3A 2ZQ0A 2CLMA 3CPGA 1LYXA 2J7HA 1FH7A 2G4JA 3K5XA 1VYPX 5K4XA 1DVJA 3A9IA 3KVJA 4J2MA 1OIFA 1BWKA 3CASA 2CKSA 4E3VA 1S38A 4HA1A 2AKMA 4K38A 3MI6A 4GYJA 1LQ0A 1EX5A 7A3HA 1SR9A 3SM0A 4U4MA 3NNTA 4C6PA 3QGKC 2CZ5A 1K02A 4LEQA 5MKGA 1S2VA 3CHCA 1IEIA 1RBAA 4QTGA 4AW7A 3FCPA 4H9TA 1KD0A 4JKKA 3OBEA 5XIMA 3I10A 4LC8A 5K7JA 2X1RA 3ZLFA 2GZXA 4TR9A 1CGYA 1KBBA 3L0NA 4Q4SA 5KZDA 4GCXA 1FWFC 3UZ5A 4ZSUA 1R9XA 2HVNA 3GHTA 4GXMA 2Q8XA 2Z24A 4O53A 1ZHAA 2E8ZA 3IJ8A 1TA3B 1OX5A 5DBTA 2H6RA 4NJJA 2EPLX 3GK0A 5M17A 1E6ZA 3F4DA 1TTPA 2Z1KA 2FVKA 1GNXA 1U1JA 2HDJA 3B05A 4F0SA 3TYEA 1KM4A 5D04C 3G22A 2FZMA 3GNRA 1MW2A 1UC4A 3FVDA 3S1GA 3VE7A 1OABA 4YVVA 4AIUA 2PDCA 5CLWA 1GVFA 4GO8A 1DHKA 5FEPA 1C9DA 3PTDA 5AYXA 3LQGA 7TIMA 5A6KA 1UP2A 4JTTA 2HISA 3AZSA 1CXKA 3SY5A 2XVPA 3B0PA 3UZWA 3W2LA 4GC4A 3CV6A 3CZKA 1S2TA 4ZTYA 3WF1A 4WHBA 3UVIA 3KZSA 4RL3A 3R12A 4PRRA 3M0MA 3VYLA 1N82A 3BSGA 2YCKX 4HU4A 3QW4B 4S3AA 3C0LA 2OYLA 3VCRA 3E2SA 4NXSA 2JEPA 4PR4A 3VABA 4DJEC 1IIHA 3NZ1A 3LSBA 4AZ6A 3ES8A 2XVLA 1NH6A 2ISWA 1BVZA 4OT7A 5ABFB 2FH6A 4JL2A 4JTJA 3MKKA 1BF6A 5AC7A 1E6XM 3UWZA 3W6MA 1K7FA 4ICCX 4H1ZA 5KMYA 1W3TA 2W27A 1N2VA 3QZEA 4IJRA 4DYKA 5C2CA 1TMHA 2VGFA 4JCMA 2YDSA 2WCAA 4IPNB 1GG1A 3UR2A 3BZJA 2A5HA 2ON3A 3BLPX 4FNTA 4AMAA 2ZXBA 1BWLA 3S2CA 1AD1A 4CQAA 1DIDA 4XTIA 3QTPA 3OEXA 4QDMA 2YPIA 1GVIA 3SN0A 1SO4A 3P60A 3QSTA 3CL7A 4AUBA 3IUIA 1V93A 1K8XA 3USZA 3VNKA 3S8HA 4Q4RA 1IEXA 2RJGA 2GUUA 1U5VA 5I0DA 4M56A 2YJQA 5CPOA 1MUCA 5A8OA 3WFLA 4JQ3A 4YVXA 3BLFA 1NELA 2WOQA 1LRTA 2QDDA 3IVTA 2WSYA 4XKMA 3EX2A 1XJBA 4QLKA 2GVLA 1XKYA 1Q6RA 2C1HA 1LZOA 3MMTA 1TELA 3KOYA 4Z1CA 5L6UA 1CGUA 1QPNA 3AZTA 3AJXA 4UWMA 3CWHA 3NUKA 4J3SA 4E38A 4DUOA 4HNTA 2WXDM 3QV8A 1JQVA 5FIPA 1TIWA 1NOUA 4G7FA 3MUZ1 4W88A 4UTWC 5C9XA 1POKA 1C90A 3PHAA 2CXEA 4JFUA 4R3UA 1ISWA 1PZ0A 3P5YA 5CPSA 3W2UA 1EUAA 1XW8A 4YN5A 1W8SA 3KE0A 2Y7DA 1MUMA 4DJED 1LOLA 3AAMA 3OQ8A 1SFLA 1XRSA 2QVNA 4XO7A 2PBOA 2DV0A 1DTUA 3L4ZA 2CLLA 3SCNA 5G2IA 1E1CB 4A3YA 3SZ8A 4KMQA 1UQYA 1ZY9A 1EJ7L 2ZCGA 5FEZA 3LUTA 3L2LA 4HYRA 4XBKA 3W7HA 1S5WA 3THDA 1J12A 3REQA 3DHUA 2ALRA 2VX7A 1NFGA 2XGIA 1UWQA 3B03A 1W2VA 4BZYA 3M5XA 2DQXA 1K4HA 1V5XA 4J2PA 2OQLA 1H1YA 4HZ8A 1XH2A 4DWDA 4B3ZA 1P5BA 3WL0A 4BEQA 5J5DA 3NGFA 3NZGA 3TV8A 3ZVHB 1J01A 5CG0A 3WUFA 3KHJA 3W38A 3R7MA 3WLLA 2OT1A 1MXGA 1AH3A 3KOFA 4IICA 1O5QA 1XWYA 1REQA 4I9AA 2XH4A 4DBEA 2FDMA 2J9ZA 3GX9A 4FO4A 3CUFA 3QBUA 3D3AA 1TMQA 3G1SA 3EWUA 2Q3OA 1UZ1A 3S5YA 3F2BA 4DRSA 2QCLA 1DJWA 2J24A 5EBAA 2ZA1A 4D6EA 1L9WA 2VGBA 5A6AA 4GIRA 1TB3A 2BODX 3MI3A 1RBLA 4N42A 3EA2A 4ZOCA 4PBGA 1J4EA 2PDHA 2Z7KA 3VU2A 2EEXA 1CCWB 2ZADA 1W1PA 4H9XA 1LDCA 1MQQA 3QJAA 3T0DA 4EACA 3PSWA 2PCEA 3RLUA 2NSXA 1HGWA 4JIRA 1GVRA 2DZTA 1CXFA 2J6XA 3E49A 5D4YA 3TX9A 3LA4A 1EB3A 1HUVA 4O11A 2ZRWA 1EP1A 4JTHA 5G5IA 5HNTA 1ZRQA 3BLKA 1KXVA 2ZTKA 4QSFA 4UMCA 5BYWA 3W1TA 4BA0A 4PYSA 3EX6A 2EPHA 3SGUA 3EOEA 4XZIA 1OC5A 4W5UA 3BAKA 3SCPA 1T41A 3DESA 3P81A 3H7RA 1TRDA 3SQLA 2PDMA 1KM0A 4IMDA 2Y7EA 1H4PA 5GJMA 3GBEA 4H7CA 3MKCA 4KEZA 3BURA 3WMCA 1O5XA 1W5OA 4RE2A 4KGJA 3PWGA 4TTUA 3P5ZA 3NQMA 4KCWA 3SN1A 3W74A 3NVTA 4O0QA 4NU7A 5FF7A 3C3NA 2R14A 3TW6A 5LA2A 3T9PA 5I6SA 2DJLA 1ZU8A 3WF4A 1XYZA 4A22A 4DJDC 3V5OA 3H6OA 1QASA 3GAYA 3FA5A 5FJJA 4LBSA 1W17A 5C55A 4G7EA 3MHFA 3URNA 1TR9A 3TIMA 1PZ3A 2CWNA 2JGQA 5D38A 2CBIA 4O18A 4R9OA 5U4NA 1OM0A 2CU0A 5EMJA 4GD0A 4H6QA 2ZZ3A 3LI0A 1XRTA 4KEVA 4BY3A 2ZE3A 1J0YA 5HMFA 5BNKA 3GS6A 3W86A 1LL7A 4DM2A 2P5NA 4RZ6A 4K39A 2GJXA 3WLQA 1RLCL 3QHNA 5AYBA 5CPQA 3UJ2A 3W1QA 4JX5A 3VKAA 3NSNA 1PKMA 5EL1A 1ML1A 1YPXA 3O7UA 5BOFA 2DJXA 3DENA 1N7KA 1MO0A 3VXGA 3E2QA 1OFDA 5D33A 3KX6A 1UD5A 4CCEA 4PA8A 2J7BA 4D6IA 5C9ZA 3GWQA 4ICNA 3SJ3A 3UWVA 4XKYB 1ZJHA 3BAWA 3WO8A 1VYSX 3QV7A 2TYSA 3AFBA 2R82A 3WG6A 2BFGA 4D6FA 2PU0A 2V82A 1KA9F 3P82A 4S23A 4M8UA 3A23A 3RLGA 2ZVRA 3TC3A 1JDDA 3ARRA 3UGRA 5FOOA 1O6IA 1AL7A 3BAXA 4ZQCA 4GK8A 4XBSA 2O9RA 2ZRYA 3TE9A 1XDLA 4W89A 3WEZA 5F2GA 3DI0A 4UR9A 4WDUA 3BG5A 2GJRA 4AF0B 4HOZA 4RV8A 1BG9A 4RV3A 1GOMA 1GJUA 1HX0A 4DJDD 2WBKA 2PRLA 3DFTA 3AIQA 3C2FA 1ZJBA 3BV4A 3A4JA 5HPCA 3B8UA 3CQJA 1HO4A 2Z27A 4ZGYA 3EZ4A 3OYZA 2Y5EA 1JDAA 1XPGA 1BEUA 3OIXA 2NVAA 3SRDA 3GU9A 1WDRA 3GH7A 4XZWA 5A5WA 5DXXA 4AU0A 4UQBA 4O0KA 2Y0FA 3G5EA 2FFCA 3VAVA 4C6NA 1I2RA 4CN4A 3IS4A 3LU2A 4EWJA 4DEFA 1B3ZA 1QHZA 3W07A 4YL2A 2E0PA 2Z1VA 4MDOA 4Q8QA 2BVYA 4WEVX 4F0LA 2GQ9A 4B90A 1XH1A 1OX4B 4FB7A 4XSMA 4MLJA 2XM1A 1UKSA 1P7TB 1L2QA 4F0MA 2AMGA 4XAPA 5HJLA 3Q65A 1KRAC 3I7QA 3XINA 5KITA 3RM4A 1U5HA 3AU2A 3BVJA 3IK2A 1EOKA 3OVGA 1V0KA 3L4TA 1SZNA 1F5ZA 1T40A 3GFYA 4KCVA 4IQEA 1KCXA 3U4FA 1EJXC 1ICPA 3VC5A 4U3AA 4U31A 4TVUA 2VFHA 2ZYFA 1PVNA 4H2CA 2UY4A 2XZ7A 4UQAA 3J7HA 1KFCA 3LV5A 1KO0A 1G6CA 1VBUA 5JVLA 2NX9A 4LAOA 4GJIA 3KCJA 4K1GA 3AXIA 5IRPA 1YXCA 4AWTA 3E02A 3IJ7A 4DIAA 5FJOA 4EK7A 3AMGA 4JNYA 4RDVA 5D2VA 1TJ0A 1GEHA 5DCDA 4CNPA 2PDLA 3ZZ1A 4R7JA 3QFEA 1L6FA 1K3UA 3RIKA 2POTA 2WHKA 4GFIA 1B3VA 3UCDA 4X0NA 5IDZA 3BQ5A 1UR0A 1POJA 3AHXA 2PWDA 2CWXA 3CL8A 1Q63A 3QPEA 3W1RA 1LWHA 3B9DA 4UQEA 5DY2A 1FWDC 4K68A 3AS0A 3OVQA 4C60A 2P53A 4LYPA 3EB4A 3R8HA 2FHBA 4Z2KA 1D7FA 4Q3MA 4IXXA 3QC3A 3VOHA 2YSWA 4MF4A 1G4SA 4W7VA 4K37A 3FIGA 3ZLHA 2Y8UA 3E1F1 4LNYA 2Q3RA 1V03A 1TWSA 2OVLA 5A6BA 1UCWA 1F9CA 3N3MA 1PV8A 4M7SA 4Q32A 4AEFA 3QZ6A 3C2VA 1KKRA 1FCQA 2GL5A 7ENLA 3DYMA 3RK8A 1WP6A 3C8FA 2E9MA 3PZQA 4WY0B 7ODCA 5D2XA 4HIBA 3VIIA 2BMBA 3U5YA 3VZYA 1OFQA 1P0KA 4F2BA 4HNVA 5HWMA 3O06A 4MGGA 2H8ZA 4FZIA 4AZIA 5JBEA 4RXGA 4IPJA 5D02A 3W4RA 3PPCA 1LCOA 3UWYA 4LS1A 4QAIA 2BWGA 1BRLB 3NDZA 5KZEA 2PWUA 4O8RA 3ZJKA 1OSEA 3L4WA 2VFIA 4A2SA 1FDYA 5DANA 3VDAA 3S1WA 1VB9A 3ITCA 4FOJA 3BV7A 4C7DA 4NI8A 2W61A 3VMNA 4WK9A 1FFRA 3VM5A 3N18A 7XIMA 4RE0A 2WC3A 3WEMA 3WNNA 4UOQA 4D6HA 4CNUA 4N4PA 5H1WA 1PIGA 2ZC8A 4B3KA 4YHEA 4KWOA 3N4EA 3P3BA 4F0RA 4WZHA 1UR2A 2GQAA 4HPNA 4LVFA 4BI6A 4DO5A 3SUVA 2FB2A 3WMLA 2XWEA 3LOTA 2J79A 4MPQA 1EYWA 1C29A 4INFA 3ZVIA 3GVWA 1W5NA 2XM2A 1F4HA 2HVOA 2HE8A 2PWVA 3ARSA 3T0CA 4GX9A 1MRAA 3LCXA 3A24A 3LXCA 4A6GA 1F6PA 1D2KA 1OX6A 3L66A 4XO6A 3NQAA 3GR8A 3BWWA 3T0BA 2ZX5A 3ABOA 4DJEA 1ICQA 2YL5A 2IKHA 1CEOA 3AIUA 1GGOA 2FPTA 2ZKMX 1JZ8A 1J2WA 2E28A 3MMDA 4ZL1A 1GYNA 1Q5MA 1S2UA 4IUGA 5HXMA 2XH7A 3FAXA 1I2NA 4M80A 5HATA 1V02A 1VFTA 1K9TA 1W5MA 2EG8A 4QQ3A 3VD3A 4LRSA 4DJFD 4NX5A 4BI5A 1QNPA 4CN6A 1MW3A 4NJKA 1H7OA 1OCBA 4GHRA 4WQ6A 1NFPA 4UTFA 1XLAA 3GYCA 1A47A 2ZA3A 3R5EA 1J0KA 2NV1A 3V3WA 4MB4A 2QLYA 4FEZA 2PC8A 2Y4SA 1XIEA 2H9AA 1CLVA 2ZZ6A 4U5IA 2YLAA 4BK9A 1A0EA 1JI1A 3CB8A 1LM1A 3TYCA 1HZYA 4JFVA 4J1OA 4ZXOA 3SFKA 3S83A 3TNBA 3L7RA 4TV5A 5F4SA 5C70A 2OGYA 1V3KA 1E0WA 3RYSA 1E9LA 5CPNA 2AGKA 4MY1A 4D6JA 1PKNA 2VC5A 5HK4A 3F7JA 4Z1BA 5LA1A 2Z2UA 5HQLA 5GJNA 3G3DA 1P48A 2SFPA 3DOPA 3H8AA 4QAWA 1UZHA 5I3KA 4DBDA 4UTWA 2ISVA 2WMIB 2DIJA 4HMDA 3UG5A 1X1ZA 3VNJA 2V0TA 3W71A 1P6WA 1G9HA 4ORMA 3B0YA 2OQYA 1H63A 4WDWA 4GQGA 2HZGA 1W56A 3MBDA 2EHHA 4PMZA 4U10A 2E77A 2NQ9A 4AWUA 2WM1A 4I