4XTIA

Structure of imp dehydrogenase of ashbya gossypii with imp bound to the active site
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
407
structure length
373
Chain Sequence
YRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii atcc 10895
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
total genus 117
structure length 373
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtiA00
4AAJA 5KZDA 4JXCA 4MUZA 1P4CA 3G3MA 1XL9A 4NJGA 3DBPA 2YCEA 3KVJA 1JRBA 5KMYA 3M44A 4JYDA 1KFBA 2Q8ZA 1TB3A 1F7BA 3WK1A 1KBIA 1QCWA 1GJPA 2YX0A 1SSDA 4IJBA 3F4WA 3O6DA 2D73A 2ZRVA 1Q6LA 1H1ZA 3DH7A 1EWEA 3LHZA 1FCQA 4OHQA 3GLCA 3M5XA 5AHFA 3W7EA 1VCFA 4DEFA 2QCMA 3ATYA 1QPQA 1OF8A 1V7YA 4FEZA 3LTSA 4JD4A 1KM3A 4FIRA 4Y90A 4UFHA 4FNUA 1KTNA 2E6DA 3R89A 7TIMA 1H7WA 4X9SA 4JTIA 4LOCA 3N14A 1S3HA 4A3UA 3C52A 2NXHA 3NQCA 1IGSA 3C4UA 4ZVJA 1WAUA 3T40A 3NL6A 4LWWA 4YMZA 3A24A 4MLRA 1XBZA 1KV8A 1XCFA 1I45A 3SGZA 1OYAA 1G4TA 1JUKA 3UWQA 4LU0A 4UTTC 3GXTA 2QCHA 3IVUA 4AH7A 3H54A 2W0UA 2Y70A 1DL3A 1B9BA 5IBXA 4AF0A 3EX1A 1DOSA 3IGSA 3L65A 3LXAA 4GUIA 3JRKA 5KITA 3M41A 1VYPX 4M6VA 3MI3A 5TIMA 3LCGA 3ZR4A 3W87A 1CW2A 3EB2A 1VCGA 4UTWC 5K4XA 2Y7FA 3BARA 2FLIA 1J4EA 3S9YA 3TXZA 1GWJA 3STGA 3EX4A 4NUWA 3NXFA 3WJXA 3HGOA 4JTKA 3FS2A 3W7LA 1JUBA 4UFKA 4EF8A 3W7NA 3SZ8A 3G22A 4GRSA 1TTIA 4AMAA 1OG0A 1VRDA 3A5FA 3S1UA 4CLMA 3GXNA 1W5MA 5AHMA 1B4KA 3E96A 2VENA 2Z0IA 2WOQA 3ABQA 3O6CA 4LV4A 4AHOA 1G67A 3DI0A 3NAVA 5LZLA 3IVTA 4O57A 1KFCA 5D2YA 1DKWA 2FB2A 1KLYA 1TPUA 1OFBA 2FQIA 1AG1O 2TSYA 4N4PA 3DI1A 2YZRA 4A22A 4WZHA 5BW6A 4CQAA 5H91A 1F74A 5LGZA 3TMQA 3B05A 3WK3A 3W1AA 1JCXA 3DXIA 1EUNA 3NG3A 4JTUA 2CWNA 3NQ6A 1SZEA 4LUJA 2WPBA 3QQ1A 3STEA 4Y6GA 2OT0A 3HB9A 3LDVA 4K38A 3EXSA 4XTIA 5T26A 4CNPA 5HUPA 4N6FA 2W79A 4P61A 4BI7A 4NT0A 3PB0A 3L9CA 1WBHA 3UWVA 3NZ1A 4GUJA 2TYSA 3G1AA 4OV4A 2VFEA 4NQ1A 1I4NA 3N9RA 2VFDA 2CLOA 4N9DA 2V82A 1ICPA 1ZALA 1KFJA 1FCVA 1WOBA 2ATSA 3W84A 2Z6JA 4O11A 2WSQA 3TAOA 5GVJA 1GYNA 4LUIA 5C55A 3EX3A 1JRCA 4UFLA 5LGXA 3HG3A 3DU0A 3W23A 4WOQA 3S1VA 4N9EA 3NQEA 1W5OA 1LP6A 1TPDA 2DJXA 3B03A 1VC4A 5LNWA 3UY8A 4LVDA 3N73A 1D3HA 1PHWA 1L6YA 4BI6A 4ZQNA 4IMCA 1K8YA 2CLEA 4DO5A 1NSJA 3CU2A 1K02A 4RZ4A 2ZRWA 2YYUA 1VGAA 2A5HA 3BW2A 1H7RA 3LBMA 5K4ZA 1PE1A 4RZ6A 3LOTA 5AHEA 1HFBA 3BK0A 3P81A 2HMCA 2V0TA 3BGGA 3NQDA 1F6KA 2E6YA 3ABSA 3W7DA 4O1DA 4JTHA 3CC1A 3PBWA 2VFGA 3GDLA 2FJKA 1QFEA 3GDMA 2Y62A 4NXKA 4XTDA 3C2EA 1AL8A 1Z41A 1YTKA 3GNDA 1K3UA 1TV7A 3KOFA 2QCEA 4NZFA 2ISWA 3W22A 3EWXA 3G1VA 2ZZ3A 5I3HA 2BZNA 1R2TA 3S5ZA 3NQMA 2WKJA 1P0NA 2Y6ZA 3NQ2A 3KRUA 4RX0A 4UFMA 5LNRA 2RH9A 1VZWA 2DZWA 2NUYA 1FWRA 3EXRA 4POCA 4Z1AA 2DZSA 2OX1A 4PH6A 3M0ZA 4CNOA 3KRSA 4ML9A 3PR2A 3LCHA 1W3NA 4JY9A 4JX4A 1GT8A 1P5BA 4JEQA 2H3DA 2ZRYA 3Q2DA 5AYYA 3UWWA 3BV4A 4DQWA 3MP4A 1BWLA 1RZMA 5CGQA 4DPQA 3W2UA 2ZBTA 3IIXA 3F4NA 3RF9A 4LRSA 3VKJA 3ZFHA 3N9SA 5G5IA 1QNVA 1IIHA 1KM1A 1ZCOA 5KZMA 3TMLA 4GE8A 1OK6A 3R5EA 3R2GA 5AC6A 1GG0A 3IGUA 4WX2A 2RHGA 1LOQA 1NFBA 2Y63A 3RMJA 4JTTA 4WQ6A 4MYXA 4R53A 5D02A 3GNNA 1G7UA 1JCYA 4O53A 3THAA 3W1QA 4IGHA 1Q6OA 1TPEA 3ABOA 4YLWA 3H55A 1YTEA 4FF7A 2Z2UA 1FCBA 2QF7A 4AWSA 3WK0A 3QZEA 1LOLA 3GB6A 4FNTA 3LCIA 3QPYA 1XI3A 1XXXA 3TDFA 3O63A 2A6LA 3BLEA 3EWZA 1SU5A 1O60A 1EEPA 2NX3A 4JTEA 1T96A 3MHGA 4Y8FA 5LNUA 3M7WA 3DFNA 5L6UA 3FFSA 3UXAA 1I2PA 4CQ9A 5CZTA 4TU1A 5E0KA 4JGDA 1OX4A 2VOMA 3STCA 3B04A 2CW6A 3NR0A 5F1UA 5FEZA 5F4WA 3RLUA 4A21A 4NJIA 4NJJA 3S5NA 2HS6A 5IBXC 3ZWTA 4O4WA 5HJLA 3P74A 4R7JA 3UPBA 1QMLA 5DCEA 3UWZA 4O54A 2ZZ5A 3LLDA 1M6JA 4UXDA 4FX8A 4ZQCA 4NZJA 1M5WA 4DPPA 5AC7A 1HUVA 4Z0JA 4I7WA 1Q6RA 3TJXA 3LCXA 4UTMA 5LHFA 2WNQA 3P82A 3NM3A 1LM1A 1K8ZA 3B8DA 4Z08A 2QR6A 1FXQA 3M1ZA 3NL3A 4PA8A 3KVMA 2P0OA 3LBCA 1NF0A 1VJIA 1L2UA 3DAQA 1S5WA 5E1QA 1UJPA 3DKJA 2A2IA 1P0KA 4LS0A 4YL2A 4K39A 1F2JA 3UQNA 4LS2A 5I3KA 2QCDA 1IXNA 1R47A 3FJLA 3BG5A 5D32A 2F7FA 4Z0SA 5J5DA 1AW2A 2C14A 3W70A 5D38A 3TK7A 1FQ0A 2VKZG 5BOOA 3SGUA 3BO9A 4RKAA 4IQLA 4N9BA 3HPXA 1YPIA 1OFRA 1BEUA 3PAJA 2PC4A 4NJKA 2GVLA 3QC3A 3RK8A 5H2ZA 3TAKA 3TW6A 4JN6A 5DN1A 1EWDA 1TV5A 3TC7A 3TNOA 2Z6IA 4DELA 4WXZA 3LRKA 3MHFA 1GTEA 4MYAA 1NF7A 1TYGA 3NA8A 4FHAA 3GR8A 4QM1A 1W31A 1ZHAA 3MJYA 4E38A 1KBJA 3OEXA 2V2DA 2NV1A 3W83A 4Q33A 3G0UA 4KWWA 3C6CA 3LHWA 1FWSA 1ZAIA 3UXDA 4R33A 4PODA 3PWAA 2VEIA 1VCVA 4K8HA 1A50A 3LGEA 1TPB1 1ME7A 2YXGA 4K7YA 1KM0A 1SO5A 1GPWA 1K7XA 4FIQA 4PL1A 3L0KA 1XC4A 1GVSA 1YPFA 2Q3RA 5CG7A 2F84A 3A22A 3VFLA 1H7PA 1J5TA 3P61A 4N6EA 3GX9A 5G1YA 4KWVA 4JTFA 2DZVA 1W5QA 2QKFA 4HKPA 3SI9A 2JKEA 5G2WA 1KM4A 1JCNA 2J9ZA 4IOTA 2DZTA 4XBKA 3VNDA 4O19A 4OBTA 4JDBA 3IRDA 3A23A 2A21A 4LVBA 2RDUA 2HTMA 4O18A 3QMSA 1TPH1 3GR7A 2YPIA 4ZZ9A 1KFEA 4UTJA 3DHFA 3IGXA 1JCLA 3PUDA 4DO4A 2C1HA 4HPXA 3L5AA 2Y88A 4QISA 3PG8A 4BI5A 3OVQA 1PHQA 2GUUA 3DFOA 3PULA 2O7QA 2PRHA 1OFAA 1F73A 5DELA 4JNMA 4CCCA 1AW5A 3QH2A 3QEZA 3IIOA 3IIZA 1RR2A 3HGRA 4S1FA 5C5YA 2ZA1A 2WQPA 3QSTA 1DQXA 4MY8A 5K3VA 1FBAA 4I7VA 1SQ7A 3TW7A 1LROA 2TMDA 2V81A 3B06A 2E5CA 2ZQ0A 5EL1A 3STFA 1T99A 4EIVA 3Q58A 4CCEA 2WJZA 1K8XA 2GQ8A 4N02A 4XWUA 5DLCA 3CM4A 5G2IA 3M9YA 5D2VA 1TPFA 2JGQA 3G8EA 3B0UX 3QSRA 5FI8A 1G7VA 1MXSA 1EP1A 3L0GA 2UV8G 5DXYA 2BLEA 4JTGA 4XKYA 3PG9A 1A5CA 3DZ1A 4GNJA 1QOPA 4H6KA 3GDRA 4RLIA 4NJHA 5LNVA 3SR7A 4BWLA 2NUXA 4E2BA 2R8WA 4FNRA 4LTSA 3QMRA 1LTDA 1Q45A 1A5AA 1TTJA 1Y0EA 4IMFA 2CZEA 4MZ8A 1ZY9A 4WUIA 1H63A 3W1LA 4TX9A 1HO4A 2G5WA 1IXQA 3LHYA 2YW3A 1RV8A 2B7OA 4RR4A 2CZFA 4QNWA 1GQNA 3G0XA 3MP3A 4NX5A 3Q94A 3DHDA 4UCGA 3LV5A 3LERA 3I7QA 1OX5A 1WYIA 2C0AA 4NNBA 4A2RA 3TQ0A 4KFNA 1C9DA 1XUUA 5HUOA 3ABRA 4NVTA 4O8RA 3CWNA 2QAPA 3TROA 3W9ZA 3W7HA 4AVFA 8TIMA 5J5RA 3M47A 2VEPA 3I7SA 4QJ1A 3LXBA 2OT1A 2EGZA 3K30A 2QUVA 4IPJA 1D3GA 1XDLA 3S0CA 2ZYFA 1DHPA 4DF2A 3QQ0A 3M6YA 4NNCA 5AN7A 1N8FA 5CZ0A 2A7PA 1PS9A 5CZJA 1PVNA 1RQEA 4DF0A 1W54A 2H90A 2EKCA 4O12A 4PC8A 2G95A 3NZRA 2E68A 1W37A 5HQEA 2NWRA 3GAKA 1TPC1 1TV8A 1TIMA 5LSMA 3G1DA 1DVJA 1UBSA 3DFTA 3CB8A 4LY8A 2Q3OA 3TU9A 4KKXA 4UTLA 4MY1A 5EPDA 3IVSA 4WY0F 5D09A 4QSHA 4CQ8A 3LV6A 5G4WA 4HNTA 2NLIA 4MZ1A 3GK0A 3W7GA 1F6PA 4OU1A 1WX0A 1QAPA 3O1NA 3F1QA 3IEBA 3T44A 2A85A 2I9EA 4AWUA 1I2RA 1C8VA 2DP3A 1O4UA 3T55A 1H61A 4D2JA 1FWWA 1T8XA 1XFBA 3HG2A 4FNPA 5EMUA 2FIQA 3B4UA 3EXTA 2C19A 3AO0A 4O1BA 2X1TA 4Z1DA 3NO5A 4ZQPA 3NQAA 5EKYA 1TJRA 4M7TA 3KRZA 3SW6A 5BNKA 2V2CA 3HF3A 1W3IA 4DO6A 1JUEA 1LDCA 4JTJA 3GXPA 1LOSA 3BLFA 3MBDA 4MFEA 4PEKA 1JQVA 4DBDA 5AHLA 3CPRA 4UFJA 2ZZ2A 3S8HA 4UC5A 3MO7A 5AHIA 1S5VA 1GZGA 1W5PA 3L68A 4E2DA 2VFIA 4IX2A 3L21A 5K2ZA 4J9JA 4ADSA 1VLIA 5FF0A 2ZDRA 1EPXA 2CLLA 3G1XA 1RD5A 3INPA 2FPTA 4WXYA 2JKAA 4JDYA 2NZLA 3LRMA 4B5NA 2WSRA 2HS8A 4QIUA 3TKFA 2QJIA 5CPNA 2J24A 4CCDA 4M7SA 5CPLA 3C0JA 2VXNA 4TMCA 1OFDA 2FDSA 1VYSX 1CX9A 1TTPA 4O4VA 2J27A 1H7XA 3S6DA 3WJSA 3W1UA 2QAFA 1ME9A 3ANYA 1TPVA 4UNKA 4L4MA 4X3ZA 1MSSA 2AQWA 2V9DA 1FDZA 1SZNA 2ZZ1A 3PBVA 3BLIA 1DORA 1SR9A 3O05A 1DJQA 1SW3A 3NVTA 2KZHA 1N55A 2EAWA 3O15A 4O52A 2OMAA 3WFAA 4CNNA 1SO3A 1DJNA 2B7PA 3SIZA 2OJPA 5EY5A 4UIOA 4M5PA 1A53A 1GOXA 4UNLA 3KXQA 3NQ8A 2RDTA 3V75A 4JX6A 1LCOA 3W85A 2OZ0A 1TPWA 2YSWA 4O16A 2QUTA 1JVNA 4M6QA 3E02A 4BFAA 1PL9A 1B3OA 2QDGA 1EUAA 3C8FA 1R2RA 4O0KA 4UTKA 4U4MA 5C6MA 5KTLA 4HSOA 5TBOA 3W7MA 3RLVA 4EF9A 3W1XA 2NWSA 4HNUA 2CZDA 1KLZA 4X22A 3FKRA 1LYXA 3T78A 4TO8A 5D2TA 2GPTA 3W7PA 2PRLA 4LV9A 5HULA 1M7PA 3CEUA 4IMDA 2CU0A 4LRTA 3TE9A 4OQVA 3B0VC 3C61A 3MMTA 5F4SA 2B0MA 2PURA 3JR2A 4MLJA 5KSWA 4HIBA 2ZRUA 4LT9A 1OYCA 3E49A 3PBUA 1XKYA 1S5TA 3PF3A 1KM6A 3CT7A 3DKLA 4W9TA 4MKNA 1WOAA 2OCZA 5I3FA 2DU2A 3N3MA 3U8GA 3I68A 5EYWA 2X2GA 4AB4A 2AGKA 2RKXA 4OV9A 2DZPA 4IPIA 3TFCA 2V2HA 3PY2A 1BTMA 3CIXA 3GZ3A 4XZ9A 3FOKA 5DCDA 4C1KA 2E5DA 2Y85A 1HTIA 1X1ZA 1G69A 2GVJA 4MIMA 4UMCA 5L9FA 3HGJA 1ICQA 1ZFJA 3R12A 2JKPA 1F05A 1I2NA 1MEIA 2GVGA 3C2RA 3LTPA 3YPIA 1FUYA 1JQXA 1H62A 2FFCA 5F1VA 1RQBA 3M16A 2ABAA 4KFPA 3HG4A 5CPOA 1YDNA 2PCQA 3EWBX 3A9IA 3TX9A 1TQXA 3W2JA 1FWTA 4NNAA 3I7RA 3P62A 2AAMA 3NQFA 1H50A 1IF2A 1HG3A 5ABTA 4NXSA 2VEMA 4JX5A 1SFLA 1FDYA 1QPNA 2A6NA 3S1XA 3TC6A 3DFSA 1X7FA 1LLWA 3EKLA 1C29A 5HR6A 3S5OA 4AXKA 1W5NA 3PB2A 1DV7A 4FB7A 1TO3A 3C2OA 1OYBA 2DZXA 1YTDA 1AK5A 1R46A 3N34A 3W73A 1SSGA 4QAIA 1M7OA 2R91A 2E6AA 2C16A 4IUOA 2A4AA 4DF1A 1RQHA 2FPYA 4GBUA 4GJ1A 3NDOA 4I9AA 1O5KA 4RK8A 2E6FA 3LLFA 1UUOA 2ZZ6A 1EX5A 3IIVA 3M5ZA 1YDVA 4BF9A 5HWMA 1GVOA 1AL7A 2YDAA 1OJXA 4ONVA 1HL2A 4X2RA 2B7NA 4YCPA 5D05A 3W1PA 4FX7A 3PS7A 2XN1A 4K6AA 3MYPA 1WV2A 5D04C 4ZQOA 1G4EA 4ORMA 3NEVA 2YYTA 4A2SA 1I2QA 1OFQA 2G97A 3W71A 5FEPA 2QCCA 1O5XA 4R34A 1CI1A 2Z1BA 3GDTA 3L67A 4FXSA 2DZUA 2JK2A 4TMBA 1JULA 1QR7A 2A0NA 3KHJA 3E9AA 3TH6A 1YADA 1GVQA 1OHLA 4I7UA 4TIMA 3W7IA 1R2SA 4UTUA 1H5YA 1VLWA 1R30A 4JYEA 4UFIA 3TR2A 2WNZA 3A21A 3MW7A 3NYZA 3UY7A 3TIMA 2J6XA 1BKSA 3QM3A 5AYZA 4DXVA 3D0CA 5D03A 4XKYB 2H8ZA 1Z42A 5BMXA 4MVAA 3SSJA 2YFOA 3FEMA 5F2MA 1WA3A 3THQA 3MI2A 1AMKA 1ZENA 2LLEA 3PSVA 3MI6A 5AYXA 2RFGA 2H8XA 3W2NA 3LCFA 1SZFA 1VHCA 1G4SA 1WDWA 2B7QA 2CZ5A 3O06A 2ABBA 3NQ7A 4ZQMA 3CHVA 2BXVA 2J88A 3O07A 4IXHA 1ALDA 3PUEA 4Z1BA 1F76A 4GUFA 1TSIA 2C18A 3GVGA 4ZQRA 4FNSA 3TA6A 4JTLA 1LLZA 1OF6A 4JICA 3HPZA 3LX9A 3W2MA 3SJ3A 4GUHA 3W75A 3USBA 5HR7A 4O0ZA 1TREA 1JCMP 5K9CA 1SO6A 5EBUA 1NVMA 1XUZA 3P67A 1WXJA 2ISSA 1ZAJA 3ZS4A 2YGYA 1TTQA 3W1NA 3EWUA 4OE7A 4E0CA 3FA5A 5LHEA 2B4GA 4MJZA 3GDKA 1YYAA 3NNTA 3VE9A 1VQTA 2H6RA 3W1MA 3HBLA 3G8RA 3W7KA 3P7YA 4WJEA 3VI2A 3B0PA 1IIGA 3NQVA 4OGZA 1LRTA 2YW4A 3L66A 3OIXA 5F2IA 4AHPA 4MFDA 3OA3A 1VHNA 4Y96A 5EA9A 2NX9A 2PRMA 1HO1A 3FJ6A 2WV8A 4HHPA 1ONRA 1ICSA 1QPOA 3KAOA 3TCEA 2IQTA 3LCLA 4LW7A 3W7QA 5U4NA 1FDJA 5U7SA 2X30A 3G1HA 2C3ZA 1NAL1 2FB3A 1YXDA 5CPMA 2GQ9A 5AC8A 1ME8A 3QW3A 4XQ6A 5CKSA 4WD0A 4WY0A 5BMWA 4K37A 2Y7GA 3S42A 1VH7A 1KM5A 1WQ5A 3CIWA 2X1RA 2YR1A 3LHVA 1Q6QA 3QPZA 2VEKA 3OG3A 3UD6A 3P60A 4PL2A 1G6CA 5F2LA 4PTNA 1E51A 5FF7A 5CZSA 3P5ZA 4MJMA 2O7SA 1W0MA 2BTMA 4UMBA 5FF3A 3W2LA 3NL5A 1EP2A 3G1YA 1QDSA 3WK2A 3PSWA 3UWUA 3NPVA 1XDMA 4HSNA 4MOZA 1PCWA 2DORA 5D30A 1MZHA 2GJLA 1SW7A 3WJWA 1GYLA 3FYPA 1D9EA 3HJZA 1TQJA 4O28A 4WOZA 1LBMA 2WNNA 3NM1A 3QRHA 5D33A 5HMSA 3L5MA 1U5JA 4O10A 1TCDA 3ATZA 2V30A 3W07A 3LHUA 1GTHA 3JS3A 1DBTA 4U28A 1KTBA 2ZTJA 2TPSA 3RFAA 1B57A 2QCDB 2ZFAA 3N2XA 5FESA 4Q32A 3P84A 1QO5A 3L0NA 4YXGA 2VFHA 2ZZ4A 1BWKA 3OHIA 4O17A 1JJKA 2QCFA 2NUWA 2P10A 4HN4A 3UZJA 3ELFA 3G18A 2A7NA 1QOQA 3I65A 3N19B 3P5YA 4BK9A 4LVAA 3G24A 3PC0A 4GWEA 5AB3A 3MP5A 3HMJG 2PE4A 1XBVA 1VYRA 2EF9A 2X1UA 3P8IA 2C15A 5SWUA 3CLMA 3T7VA 3LB0A 1UCWA 4TR9A 4AHQA 4EVZA 5AFDA 5DBTA 2XN0A 3FKKA 1T0OA 3W1TA 4AEOA 4PFMA 2ZA2A 3MWAA 4UTWA 3GIYA 2H3BA 1I8JA 3TQVA 3RU6A 3V1PA 1SFJA 4ZMGA 1X8FA 1JR1A 2QJGA 4GUGA 3NGJA 5G1TA 3SY5A 1ZAHA 4LVGA 2E09A 3L2IA 1V5XA 2QCLA 1X1OA 5HWNA 4NU7A 5KINA 4ZL1A 1H51A 5E93A 2WSYA 5I3JA 5CSRA 3HGSA 1K7EA 3MBFA 1KW1A 1EIXA 4EWND 5LNSA 5DY3A 4YCOA 1FXPA 1QO2A 4LNYA 1MO0A 3OVRA 3N2MA 2E5BA 4K36A 3UNDA 3E12A 1UASA 2NV2A 1EP3A 1H7NA 1RPXA 1VR6A 3O16A 3HQ1A 2FTPA 2CLIA 2CLMA 3PBYA 2BSLA 2A7RA 2ZRZA 3GKAA 4IMGA 1F5ZA 1XBXA 4H4IA 4O14A 3S1WA 3EKZA 3E0IA 1OVDA 4UUIA 4AF0B 2CLHA 1GVRA 2GJNA 4P2VA 5CSSA 3W76A 4LVFA 5I3IA 4GFSA 4XUGA 4UR8A 3SECA 1SW0A 2BWGA 3GKFA 2QDHA 1AW1A 4UR7A 1W3TA 1B4EA 1KV5A 1TMHA 1MEHA 3UPWA 4RJEA 3NL2A 3OBKA 3MYOA 3T4CA 5C54A 2NX1A 4Y9AA 1N7KA 4A29A 1H7OA 4ORIA 3BW4A 4FXRA 3NPXA 2ZTKA 3HPSA 4M19A 2ZRXA 1SUXA 2ZZ7A 4IMEA 2J9XA 5I3GA 3CTLA 3SFKA 4NX0A 3QYQA 4PCFA 4O1CA 2C6QA 1NEYA 1UUMA 2CFFA 3DGRA 4FNQA 1SPQA 1LORA 3P80A 3NOEA 1ADOA 4QITA 4QQ3A 2J9YA 3TQKA 1JCJA 4Z1CA 5DCBA 5FEXA 2TRSA 3GYEA 3LCWA 3R8RA 4JR5A 2Y61A 2R14A 4XBSA 3HO8A 4UTIA 4MY9A 4N4QA 3MHUA 3H53A 3TXVA 3C56A 4O13A 1L6WA 1RVGA 2A1YA 4FX6M 3EWWA 2X1SA 3G1FA 3BVJA 3BPWA 1SZGA 4S2BA 5FEWA 2P1FA 3Q37A 3IIPA 5D2XA 6ALDA 4LS1A 4OWGA 5G2HA 1O95A 4JIQA 3TSMA 5FF2A 3LI0A 3FIGA 4O15A 5F2GA 3VE7A 4OT7A 5K9DA 3BG3A 1W8SA 4IWWA 5K7JA 4ICNA 4RZ5A 1LZOA 1ZNNA 1Q3NA 1OFEA 5DBUA 4RXFA 4UTTA 2X16A 2R94A 3W7CA 4ADTA 3G3DA 1KFLA 1OFPA 3W3OA 3W7RA 1XM3A 1IXOA 3HIJA 1LBLA 1KTCA 3M43A 2NXIA 1P1XA 4GC4A 3W72A 3PM6A 5TQLA 4AWTA 2QCNA 4HT3A 1OFOA 1QWGA 4M6PA 2W6RA 3M5YA 3WJZA 3WJYA 2BX7A 1LRQA 2XN2A 2WO5A 4HNVA 3L5LA 2VFFA 2YFNA 4O50A 1FCUA 3P8JA 5K9XA 1OK4A 3BGJA 4O1AA 3UWYA 3NPUA 4EOUA 3LM7A 1L9WA 5D2WA 4LC6A 1EB3A 1FWNA 2QUUA 2VELA 2ZCGA 4HPJA 1A5SA 2HSAA 3LHTA 3W6YA 5D37A 3EWYA 5A5WA 2Y7DA 3DENA 3TJLA 3I6RA 1I2OA 1X6UA 3O6YX 3KVKA 3UYCA 3W7JA 2QJHA 1K03A 4HNNA 3MUXA 1GVFA 1W56A 2ISVA 3CWOX 4ALDA 1O94A 4MPQA 3S5YA 3FYOA 4JYFA 2NXGA 4FO4A 4N2YA 1LRNA 3PVFA 3TFXA 3TUUA 4H3DA 3C3NA 4JY8A 2V5BA 5BRBA 3LXCA 5KZEA 4JIPA 1Z44A 2RDWA 2V5LA 1K7FA 4KFOA 5AHNA 3DFQA 4YWIA 3ZWSA 1DQWA 3QW4B 6TIMA 4BWLC 3R13A 1FY6A 1GEQA 4UMAA 5HWJA 3W2KA 1H60A 4IXXA 1YDOA 2JBMA 4RCXA 2GOUA 3NPWA 5F4XA 2ZA3A 3W7OA 2EPHA 3BG9A 3QMTA 3TV8A 4QNEA 3OVPA 3C2FA 3VCRA 3TSDA 1YLVA 4C1LA 4JTSA 2CLFA 1MEWA 4RV8A 3G1SA 3BW3A 4WY0B 5MHBA 5IM51 3U2OA 4S2CA 3RNDA 5HNRA 1PCKA 1UB3A 2Y7EA 1GG1A 1U83A 1KFKA 3QFEA 1THFD 3O8AA 3G0SA 5FF4A 1WBJA 4JS3A 4BR1A 1ML1A 4GXMA 2I1OA 3LI1A 4RXGA 3A5VA 1TRDA 1TJPA 1L6SA 4N9CA 2FPVA 4DBEA 3DFPA 5C2XA 3UZ5A 3NQGA 1J2WA 2VC6A 3TSBA 1FX6A 1KA9F 1YXYA 3M5VA 3QJAA 3W88A 2EHHA 1PV8A 4K7VA 1XBYA 2Y89A 2QCGA 3KVLA 3C2VA 1VS1A 3W86A 3AJXA 3GAYA 1EA0A 4IX0A 5HINA 2G96A 3KFTA 4K8EA 1H1YA 3HG5A 2E1DA 3F03K 5DY2A 1VPXA 5G4EA 3CQ0A 3EX2A 1TRIA 4UTHA 4G1KA 3FLUA 2ALDA 2C13A 1G4PA 2ATMA 1SO4A 2XFWA 1QPRA 2GQAA 5DXXA 3U6WA 2Q8LA 4MZYA 5LKYA 3CEPA 1Z48A 3KX6A 4LC8A 1PIIA 1IXPA 1OX6A 3QF0A 3LRLA 5A8GA 3LTYA 1A5BA 1W1ZA 1ZJIA 3W1RA 3EX6A 4ADUA 3IV3A 2I14A 4L4LA 3HOJA 1LBFA 4Q4KA 2CLKA 2E77A 2V8ZA 3W74A 1YXCA 5AOUA 3EEGA 1OX4B 2JGYA 1KM2A 1OABA 2QEZA 3PUOA 2DJLA
chains in the Genus database with same CATH superfamily
3GG1A 1HJXA 3HQOA 1XRFA 4U3CA 3DESA 4W7UA 3WD2A 1KO0A 3P0XA 3TTQA 1LL4A 1FH9A 2Q8ZA 3UCDA 1KBIA 4LYQA 1QCWA 8XIMA 5I00A 1GJPA 4BQ3A 2BY3A 3IK2A 3F4WA 3RRAA 2VDHA 4XB3A 3KLLA 1VAHA 3LHZA 4JL1A 2CHNA 3L23A 2JF6A 3M5XA 1LWHA 3R7MA 1B3WA 3W7EA 1VCFA 4N0RA 2VNCA 3ZJ6A 4DEFA 1ECQA 2QCMA 3QZAA 1QPQA 3KL5A 3CHFA 6REQB 4JD4A 4UQDA 1KM3A 3Q67A 3AIQA 3GUWA 1QW9A 4UFHA 4FNUA 2E6DA 2X8RA 4FALA 3GQYA 1MRAA 3CO4A 2NXHA 3C4UA 1WAUA 3VMOA 3AC0A 3A24A 2PGEA 4RE0A 3WDRA 1G4TA 4KRZA 4REQA 4LU0A 3H54A 4B9YA 1ZCCA 2Z24A 4CNSA 3AAMA 1DL3A 5IBXA 5ABFA 4IFKA 3IJIA 1L8PA 1G94A 3UJEA 1EFZA 3LXAA 5KITA 3M41A 5JMUA 2W67A 1ISVA 3W29A 1EHNA 4GYPC 1GOQA 3QFWA 4DWSB 3K5XA 1VFTA 2Y7FA 2YA1A 3ORWA 3TXZA 3STGA 3SCWA 3NXFA 2OX4A 1XV8A 4GY0A 4YHEA 2PDQA 1C3FA 1GEHA 4Q22A 3HN3A 3VD7A 1OD8A 3WUBA 3W7NA 1NP0A 1TTIA 4AMAA 3WNOA 4GBDA 1PDZA 4DXKA 4RPQA 3DFYA 2HV5A 3IUHA 3NCOA 1BWVA 1B4KA 1G0CA 3ANVA 4XAFA 2VENA 4QP0A 4BJHA 4DUWA 3SEPA 4J27A 3AU2A 3DI0A 3MU7A 2QUMA 2D2OA 3SDOA 4O57A 5D2YA 3U4FA 1DKWA 1Y5WA 1KLYA 2YIHA 3MY9A 2PDFA 2E9BA 1EO7A 4WDXA 1LLOA 5H8PA 4PB5A 2BXZA 2YZRA 2HXTA 3OA5A 5LGZA 3OQ8A 3B05A 3Q65A 3W1AA 2PLJA 3UYIA 3PP7A 3QQWA 3NDZA 2OZ3A 3KBVA 1EDTA 2WPBA 3QQ1A 6XIMA 3KBMA 3VIGA 2XVKA 4ZR8A 3KCJA 4I9JA 2DUXA 5HUPA 4P61A 4BI7A 4J4KA 2C79A 3KOWA 3EOUA 3PB0A 1BYBA 4HPGA 4GUJA 2UY3A 3M0JA 1OB0A 3H7RA 1CB2A 1EJVC 5A6MA 4OV4A 2VFEA 4HA4A 3OHMB 3OODA 2CLOA 4N9DA 3B8UA 5AC4A 2EG7A 3TLQA 1LWIA 1BF2A 2WSQA 3TAOA 2WSPA 5GVJA 1LF1A 3OOQA 1JRCA 4UFLA 3VZYA 5T9BG 5DFAA 2BASA 3M64A 1RP8A 2DJXA 1WUEA 1B0IA 3WQVA 1TWWA 1W9PA 2VT0A 3TJIA 3UY8A 3TYUA 5LIWX 3N73A 3BURA 3WEZA 1PHWA 1L6YA 5FIPA 4BI6A 3GVWA 1L0PA 4IJRA 4IMCA 4L61A 4DO5A 1BVWA 1K02A 1WKEA 1BQGA 4Z2LA 2A5HA 2VO5A 3BW2A 1FVPA 4MMWA 4US6A 2XVNA 4UBPC 2ZADA 4Q8QA 2V5CA 3LOTA 3SCQA 1AQFA 1Y5VA 4PRWA 2FZ9A 5AHEA 3BK0A 4I8YA 2DZBA 2HMCA 3NQDA 2WNWA 2X2YA 3W7DA 4QFUA 4AC7C 2VFGA 3GDLA 5CJMA 1HZYA 4Y7EA 3MMDA 4Z2HA 1QFEA 4LYKA 1OADA 4XTDA 1P7TA 1VFLA 2RJGA 2IW0A 4KPLA 5A2BA 1Z41A 3MTWA 1TV7A 3KOFA 1TG7A 4PMXA 4NZFA 1J8VA 2ISWA 1Q2SA 1HP5A 4D8AA 4IISA 1R2TA 4GIYA 3S9ZA 3NQMA 2WKJA 2ZVRA 5LNRA 4UFMA 5H6HA 2YL8A 2ZX6A 1FWRA 2DZSA 3GU1A 2V69A 1VEPA 1OCJA 2Y4SA 3PR2A 3LCHA 4JX4A 1P5BA 4ZSUA 4QR6A 4KT2A 2ZRYA 3Q2DA 4DQWA 1XSKA 3B40A 4XG1A 3IIXA 4AW7A 4QLJA 4IFKB 5G5IA 1QNVA 3U57A 1ZCOA 5KZMA 4GE8A 5AECA 1OK6A 4W7VA 2FHFA 3R2GA 1GG0A 1CLVA 3GWQA 5C70A 3DX5A 1LG2A 3VCCA 3RMJA 1MDLA 2WBKA 3ZR6A 4R53A 2ZXBA 1ZP4A 1QBAA 4S3DA 1ITUA 4O53A 3THAA 2VR2A 4IGHA 1J10A 1Q6OA 1TPEA 5JIWA 3TN3A 3PN8A 3A4WA 1UZ1A 3QGKC 1E55A 3GB6A 4NG3A 3LCIA 3QPYA 3PBMA 4ES4A 3ZJ7A 3O63A 3BLEA 3WFLA 3ZT7A 1O60A 1EEPA 1CXHA 3WDJA 1DPMA 4QGCA 5LNUA 3DFNA 1X6NA 4MJ2A 1C93A 1IEXA 2P53A 5E0CA 3B04A 1EPVA 2CW6A 5JVLA 3NR0A 3RLUA 4PRTA 3SY1A 3WNNA 4JTCA 2FHBA 2DH3A 3D47A 3S5NA 3RX2A 1EQCA 3SJNA 5HJLA 2YCLA 4RV3A 2X42A 1QMLA 3AXIA 3NSNA 2OYLA 4MWAC 1M6JA 3N13A 2XH2A 4NZJA 1M5WA 3SQMA 1Q4WA 4H00A 2XINA 4F0HA 3WF1A 1BYAA 3TJXA 1Y5XA 3LZ3A 3MSRA 1OT1A 4UTMA 3F2CA 2WC7A 3MUY1 3OGSA 5LHFA 2WNQA 3SSZA 3NM3A 4KEUA 4Z08A 3M1ZA 1ISWA 1NF0A 1VBJA 1L2UA 3DAQA 2O92A 2DT1A 1XGEA 1XLJA 3R11A 4YL2A 4IG2B 4LS2A 2QCDA 3A3XA 3FJLA 2WZHA 5HBFA 3T09A 3W70A 4NILA 1FQ0A 3VIOA 4WSHA 5BOOA 3AU6A 3MKVA 1CXKA 2W92A 3GC2A 3PAJA 2X41A 3RK8A 3VIFA 2C91A 3RUBL 1XJBA 4GMEA 4JN6A 1IR1A 1EWDA 3K4DA 1TV5A 5M1TA 3TC7A 2OTDA 5CBJA 4WXZA 2PTDA 1J0IA 1GKQA 1TMLA 1TYGA 4QM1A 1D8CA 1JF5A 3OEXA 3W83A 1ZAIA 3H4GA 1Q6CA 3THCA 3PWAA 2VEIA 3CT2A 4WR3A 1ME7A 2YXGA 4REQB 3M0KA 4M29A 3V7PA 1K7XA 5CJ5A 3OGVA 3L0KA 3E3HA 3SCTA 4WGHA 1GVSA 4XD4A 1J5TA 3KTCA 3P61A 4HMCA 4N6EA 5G1YA 4KWVA 4JTFA 2VC7A 2DZVA 4PN2A 3SI9A 1UMLA 1FTXA 5I5RA 5A95A 1SFSA 4HBKA 3VNDA 5CC7A 3UU0A 4JDBA 3L4TA 4IIBA 3IRDA 3CZLA 4QLLA 1ITCA 4O18A 4QXIA 4M0XA 3QMSA 2YOCA 4LF1A 3CO8A 4Q8NA 1QI2A 1KFEA 3DHFA 3IGXA 1YDYA 2FH8A 1DXFA 3L5AA 4QISA 2E8ZA 4BI5A 3OVQA 3B8VA 2VGIA 3E5PA 3MMUA 5DELA 4JNMA 3TCSA 1S2CA 1RR2A 1EYEA 3HGRA 4R88A 2WQPA 3QSTA 1E15A 3FGCA 4J3WA 3ZMRA 1SQ7A 1BFNA 3TW7A 1LROA 4DZAA 1JZ7A 2E5CA 4L6OA 1REQA 2DSWA 3BQ6A 3MCMA 2CHOA 2WJZA 2GQ8A 1DJXA 1NELA 4HU8A 1IHIA 3U2ZA 3UR2A 5D2VA 1XIEA 2J62A 4DXXA 5BRQA 1T41A 4Q8VA 1EF3A 2RJHA 5FI8A 4QS6A 1MXSA 1EP1A 3ZSSA 4JTQA 3RXZA 1Z6KA 3DZ1A 4QE5A 4H6KA 3SR7A 3RGTA 3FDKA 4D6JA 4FNRA 4LTSA 4WUIA 1Q45A 4MZ8A 1H63A 1OD0A 1PJ9A 1HO4A 4F2TA 1CGXA 3LM3A 2B7OA 2XH0A 4R7WA 1H11A 3VKAA 5C9UA 3UCQA 1IE7C 3LYEA 3QV6A 2INZA 4XD6A 4JQAA 4TX6A 2ADAA 1GOMA 2C0AA 3TQ0A 5BOEA 1C9DA 1XUUA 4O8RA 4A35A 4HZ7A 2I5GA 3W7HA 4AVFA 5J5RA 1MQRA 3UG4A 3LXBA 2OT1A 3P2VA 1D3GA 3NVDA 4DF2A 3BSHA 3FXGA 1N8FA 1O5RA 1V08A 1PS9A 4DF0A 2FZNA 4AY8A 4PC8A 4GO9A 3UNTA 4W89A 3NZRA 2E68A 3L2MA 3FHAA 3OZPA 3NURA 2VL4A 1UBSA 4LY8A 4KKXA 5D09A 3I10A 3GNRA 4QSHA 3GIPA 1XCXA 4DVOA 1JDEA 2CESA 3GK0A 1X96A 2WJEA 2Y1HA 3O1NA 3IEBA 3WH5A 4MG4A 4AWUA 4WRHA 2DP3A 2J75A 3R6IA 3BE7A 4EWJA 1XFBA 3HG2A 3AQUA 2PWHA 3TLLA 4HMEA 3UGVA 4A8NA 2FDMA 2VD8A 3NO5A 3VC5A 1TJRA 3HF3A 1LDCA 2HVMA 1A0CA 3GXPA 3MBDA 5JIPA 2PDHA 1JQVA 1SMAA 3ITYA 4DBDA 1Z89A 3PZNA 2D20A 3AMCA 4B2DA 3VOCA 5DRCA 6CGTA 4XV0A 3VDAA 2J7HA 1RSCA 1TELA 3L68A 4E2DA 4IX2A 3PHAA 5HOSA 4J40A 2AL2A 3A47A 3PJWA 1YQ2A 1ODZA 3DYOA 1HN1A 1EPXA 1R3VA 2CLLA 3G1XA 4LAOA 3INPA 3LSCA 4IIDA 3SRHA 2GK1B 2JKAA 5T8GA 4B5NA 1SJDA 2BB0A 3VZXA 2QJIA 4GIEA 1CGUA 3AHTA 5BROA 3KUMA 5AY7A 1TTPA 4LUSA 3W1UA 4W93A 3RJYA 2QAFA 1TPVA 3KP0A 1E71M 4L4MA 4X3ZA 3ZLFA 1MSSA 2AQWA 2V9DA 1IT0A 3O05A 4P7NA 3WLSA 1A5KC 4F0KA 4PTWA 5I6SA 4CNNA 1SO3A 1DJNA 4ZODA 4EXAA 5EY5A 2HNEA 3CTTA 4L80A 3KM8A 3KXQA 3NQ8A 2RDTA 3E2RA 4JX6A 1H09A 3UFYA 1XH1A 2YSWA 4O16A 3GRIA 4PTXA 1POKA 4ACZB 4GC3A 1R2RA 3UT0A 2ISDA 4U4MA 1EA9C 2HNHA 2CEQA 5KTLA 4HSOA 3RLVA 4EF9A 3S83A 3VFCA 2NWSA 3VM5A 5BYWA 3PBGA 3FKRA 3T78A 2OODA 4TO8A 5D2TA 2ICSA 1B3YA 4MWAB 3GVVA 2PRLA 4LV9A 5HULA 4W8AA 2D2JA 4IMDA 4YVVA 4LRTA 3TE9A 4DIAA 3C61A 2G41A 2GDUA 1W9DM 1PAMA 4LT9A 2ZRUA 1OYCA 3PJTA 1GGOA 5FJUA 3PBUA 1V6TA 5H1WA 3PF3A 4W9TA 3U8GA 1W3HA 3I68A 5ENLA 4AB4A 3TYBA 4KIEA 3G6LA 2WZEA 4IPIA 2WMGA 3PY2A 1EOKA 1BTMA 3GZ3A 4D8LA 7XIMA 3UF9A 1XLAA 3ANUA 1HKVA 2VVNA 2WMHA 4YU1A 4ERAA 1FHVA 3T2QA 3CYVA 1P6WA 1XINA 3LPOA 3RPDA 3HGJA 1VJZA 5A6KA 2JKPA 2X0SA 1I2NA 2GVGA 3SUWA 3WQ5A 3KEHA 4Y9MA 1H62A 1LL7A 4FF5A 2EPOA 3A9IA 3PZOA 4MWAD 4NNAA 3P62A 1AJ0A 1K6WA 2AAMA 4H7ZA 3D46A 2PD9A 3A12A 3KCLA 3WLLA 3TC6A 1H3GA 5A2AA 1E6SM 4NI3A 3H7UA 3PB2A 4FB7A 1F3TA 2PP0A 2HQAA 4XO7A 2R91A 2E6AA 3B8WA 1TV3A 4GBUA 4GJIA 2R1PA 3NDOA 1B5TA 4FSAA 1DYSA 4WSJA 1BRLB 3LLFA 1CIUA 4GXWA 4B92A 3IIVA 4S3AA 4LUTA 1PKMA 4ONVA 1BF6A 1TVPA 1HL2A 3NXLA 4YCPA 2XN1A 2ONEA 2QS8A 5D04C 4DJFC 4KGLA 2YYTA 2BOEX 2F9RA 5LA0A 2XIMA 3ARPA 1O5XA 3GD6A 4GKTA 3GM8A 3VGBA 4LBSA 1QR7A 3Q4DA 1UKOA 2HE8A 3E9AA 4BF5A 1O1HA 2OG9A 1R2SA 2GK1A 1V7AA 4YNGA 4TXEA 3OLIA 2WNZA 2WM0A 1WDRA 3TIMA 2J6XA 3QM3A 2OKTA 4DXVA 3D5HA 4IGMA 4XKYB 2QIIA 1JGIA 2YFOA 3IAPA 3THQA 2J25A 1E56A 1J18A 3PSVA 3MI6A 2FVKA 3ENLA 3CAQA 3KBWA 1QATA 1VHCA 3N18A 1DIDA 3BH4A 3AS0A 4NSBA 1G9HA 4D6HA 1PIFA 3NQ7A 3PPCA 4DM1A 4MKSA 1XLCA 4Z1BA 1F76A 1QK2A 4ZQRA 3WLKX 3MSDA 3QR3A 4GH3A 4JICA 4AZCA 5HR7A 3S9IA 1TREA 2RUSA 3LUTA 5EBUA 4ATDA 4JQ2A 1A5NC 3P67A 1WXJA 3FW6A 4D71A 5A3HA 2DVTA 1TTQA 1X39A 2E9MA 4MF4A 4OE7A 4EKJA 4E0CA 2D0HA 3PZ9A 1YYAA 4AZBA 3AJ7A 2H6RA 2OLAA 3DG6A 4XBJA 1AODA 3W7KA 3B0PA 3NQVA 1R87A 1K4GA 4KIRA 3OIXA 4PMZA 4MFDA 1VHNA 3N1AA 2J74A 3DBNA 1F3XA 5HMDA 3G2GA 1HO1A 4MAZA 3CZ8A 2WV8A 1P0EA 3LSBA 1RJQA 1QPOA 3TCEA 4IFRA 2JIWA 4LW7A 3W7QA 1J9YA 3WUEA 4LEFA 1RP9A 2Y5SA 5U7SA 1E70M 2X30A 2PDWA 2C3ZA 2P0IA 2FB3A 1NOUA 5AC8A 1I75A 2BGNE 4WD0A 4K37A 2Y7GA 1VH7A 3OYZA 3SURA 2NT0A 3TNBA 2OO6A 3NJ3A 2OPJA 1B9ZA 3QPZA 3QR1A 3LQLA 2P3ZA 1G6CA 5CZSA 2GJRA 4GCXA 1R3QA 3H4XA 4L6HA 3NL5A 1OC7A 3G1YA 5A6LA 3NPVA 1WZKA 4HSNA 1PCWA 1MZHA 1SW7A 4HHMA 5HMEA 3FYPA 1MFVA 1A5LC 5H8UA 1UWUA 2YA0A 5IHRA 1HP4A 4O28A 2WNNA 4PMYA 3NM1A 1XIIA 3F2DA 3UPMA 3TTYA 1B30A 3ALFA 3ATZA 2G4FA 1GTHA 3R58A 3TN4A 1Q5MA 3ARTA 3FA4A 1L6FA 3S6OA 4YYCA 2QCDB 1CECA 1S2VA 3HV8A 3WD1A 1YBQB 1JDDA 3GZAA 1JJKA 2P10A 3UZJA 2EG6A 1EHAA 4G1NA 3TEVA 2Z7KA 3M7SA 1DIKA 4GWEA 4GX9A 4UQAA 4AISA 4OUEA 3PZIA 1WP6A 3W82A 4MTVA 4D1IA 3ZVIA 3G77A 1VYRA 1NJJA 1PWMA 2EF9A 4XVEA 1ONWA 3CLMA 3T7VA 9XIMA 1L2QA 5GJNA 1TUFA 3H26A 2VGGA 2INEA 5FJPA 3V1HA 4AEOA 4PFMA 4TVUA 2ZA2A 3UJ2A 3PANA 1W3JA 1C8XA 1CB7B 3MCOA 1SFJA 3ICJA 1K4HA 3NGJA 2R1NA 2QCLA 2BV9A 4ZL1A 2OGYA 5EU9A 3PPGA 2HDJA 4GQGA 2A3AA 5I3JA 5CSRA 4W87A 3S2LA 1UH4A 1EIXA 5LNSA 1Y65A 4ZFCA 1FXPA 4LNYA 1N8IA 3CNYA 3E12A 1X1NA 1X97A 3M0HA 4XD5A 1ZSXA 5C9ZA 3BZGA 5FJRA 3GG8A 1XR2A 2BSLA 3NQBA 3GKAA 4IMGA 4H4IA 3D3AA 3AHXA 4UQEA 4DHGA 4UOZA 4M6UA 1LT8A 1GVRA 2JIEA 4CN4A 4MKVA 1A3WA 2RAGA 3DDMA 4UR8A 3SECA 2VGBA 4JAWA 4P8VA 2BWGA 1Z8AA 4LX4A 3GTFA 1B4EA 1TMHA 3WCZA 3OBKA 1U33A 2ZOXA 2NX1A 4Y9AA 1N7KA 4A29A 1QXLA 1SUXA 2ANUA 3R25A 3BCDA 4B3KA 1LUCA 3SFKA 1Z3NA 4O1CA 2C6QA 4X2PA 1B54A 3DGRA 1LORA 2DQXA 4QQ3A 1A0DA 3PNUA 3TN6A 2J9YA 3ZO9A 1JCJA 3WQ8A 5FEXA 4W88A 2GGIA 3CAVA 3GYEA 3U3HA 3HPFA 3N12A 3HO8A 4IFOA 4MY9A 4N4QA 5DO8A 3MHUA 3H53A 3TXVA 2XFYA 2V5DA 3BPWA 2BY0A 5MKGB 5C9XA 5FEWA 3Q37A 1WDPA 3HQPA 3CHCA 3SN0A 3WBWA 1MRQA 1HF6A 1MYRA 4MAVA 1UD8A 4UNIA 1E0XA 5E9AA 3VC6A 2ON3A 3TTSA 3WLOA 3AIBA 1EGMA 3KL0A 4ICNA 1ZNNA 1Q3NA 3OTRA 4B5VA 3H24A 4F66A 4UTTA 2R94A 4XZMX 5FJTA 2WVUA 4LAUA 4LAKA 3BLDA 1IXOA 3I6EA 3N2TA 3W72A 3PM6A 5HMFA 3WO8A 3EOOA 3T0BA 3L4YA 4DWSC 2W6RA 3OLEA 3WJZA 3AOFA 4GD0A 4CNUA 3TTEA 4L6DA 3W24A 1XG3A 4HNVA 3L5LA 2VFFA 3B4YA 4U2ZA 4QCEA 1IYXA 2Z27A 3NO1A 3R0KA 1TWIA 3KCOA 3TW9A 5EMJA 4L9YA 3W4RA 3W6YA 3TN5A 1HT6A 3TC3A 1RA0A 4W8LA 3V5OA 5I77A 3UYCA 4GZJA 1W91A 1W56A 2ISVA 4MPQA 3FYOA 2NXGA 4FO4A 3V0UA 3TFXA 4H3DA 3C3NA 4JY8A 2V5BA 3PTKA 3RO6A 4E5TA 2AMGA 2QYGA 4KFOA 3K13A 3AISA 4HK6A 4BZYA 4YWIA 3VD3A 4BWLC 3R13A 4UMAA 3VGDA 1H60A 3LGDA 4LUSB 4RCXA 5GPRA 4F3HA 1OT2A 1KGWA 3QHOA 2PA6A 4H41A 1J6OA 4C1LA 1GVYA 2CLFA 1V0MA 3BW3A 5MHBA 3A13A 1QNPA 3GHRA 3RNDA 1I1XA 1UB3A 3GW0A 5REQB 3LNPA 5FF4A 3PNZA 4JS3A 1V8EA 2I57A 4G7FA 4RXGA 2I5QA 2OO0A 1TJPA 3WQEA 1OGGA 3NQGA 1PKNA 4HYWA 1W9XA 1PV8A 1T5AA 2QZRA 3PTDA 4PB4A 2Y89A 5LIYX 3BLPX 2QCGA 1VS1A 3R94A 4HYRA 4DJDA 1EA0A 4IX0A 3MVIA 1JYNA 2OEJA 4J3XA 1BGAA 3W02A 3AICA 2XHYA 2WK2A 1FWDC 3WSUA 3CV1A 3CH0A 4UTHA 3LU2A 4HA1A 1KCLA 1TE1A 1PZ1A 4MZYA 5LKYA 3CEPA 3LTYA 3EX6A 9RUBA 5AC5A 1WO2A 1UA3A 2P3EA 1K77A 4BEQA 1OX4B 2GJPA 3ZR5A 1OABA 2DJLA 1RBAA 4JXCA 4MUZA 1V3IA 3G3MA 4CQDA 4NJGA 1JCTA 1EDQA 1UR4A 1XIBA 1JRBA 1V79A 3J7HA 4FI4A 3M44A 2V68A 1BVNP 1KFBA 2G50A 4ROQA 2Z7GA 2VGFA 3WK1A 2OQLA 1SSDA 1U5VA 4IJBA 1ZBCA 1ZJBA 1A3HA 3O6DA 2D73A 3EA3A 3N3TA 2ZRVA 1Q6LA 4KGJA 4C6QA 4EX4A 1QPKA 1Q8AA 3S2CA 2PGFA 3H7VA 4J3UA 4UQBA 2ACUA 1Z69A 3T9PA 1OF8A 4FEZA 3LENA 2XSXA 2NQJA 4FIRA 1KTNA 1KWGA 2XZ7A 1XKJA 4ATLA 1H7WA 2VR5A 5B80A 4X9SA 4LOCA 4ZCWA 3VILA 4A3UA 3VVGA 3B0XA 2R1MA 3C52A 1DHKA 3PZQA 3NQCA 1LT7A 5HA7A 1CT5A 4HK5A 3RX4A 3NL6A 1KV8A 1XWYA 4LY4A 2AQOA 1NU5A 1OYAA 3E2QA 1JUKA 2G3IA 2QCHA 3IVUA 4AH7A 1TJ2A 4M56A 4U5KA 2J78A 1YX1A 3GH4A 2BHUA 3DN5A 4TX8A 2PLCA 1Q6FA 4W4QA 1DOSA 3IGSA 3BAWA 4CEXC 4PBEA 5TIMA 4C5ZA 1RJRA 1US2A 1RXOB 4I6VA 3EYPA 1GUVA 3W87A 2D1ZA 1VBHA 3DFHA 4GHRA 2IPFA 3EB2A 4NL1A 3ITVA 3S9YA 2GGHA 1GWJA 4NUWA 1JD9A 3TTOA 1XLHA 1PZ3A 3HGOA 1JUBA 2HPIA 2X7WA 3RO8A 3OO2A 4GRSA 3DIPA 4TVCA 2XIQA 1DJIA 1GOIA 4PBFA 3T2PA 1S46A 3GXDA 1ZTVA 4KETA 4G8TA 5IHSA 2PDKA 3ABQA 1GPFA 4YTTA 2XM2A 4HCLA 2I56A 2ZC8A 3NAVA 4IH3A 3TA9A 3LPFA 1R38A 1IZKA 3IVTA 4P8WA 1BQCA 4XZBA 2ZXDA 4H9YA 4PUKA 4LPCA 4XSLA 1IV8A 2FB2A 2VX4A 2WLZA 1V51A 2ZUUA 5C9WA 3ZXWA 2O55A 4S3FA 3KOYA 1OFBA 1OSEA 2TSYA 4N4PA 3DI1A 1NDWA 4WZHA 3IRSA 5BW6A 3RPTA 4CD5A 2C8NA 4AIOA 2Y5EA 3RN6A 3P6LA 4GA8A 4YVXA 3GW3A 2CWNA 4JHOA 1SZEA 4LUJA 1S2AA 4B5SA 2CCRA 1XH2A 2EKGA 3PTMA 3STEA 4AD0A 4QDWA 5HPCA 1TWZA 4N6FA 2Z1SA 7CGTA 3MB9A 2HVOA 1M3UA 3N29A 3RRXA 3CZGA 1KFWA 3G1AA 1JDFA 2J7CA 1WUFA 1ICPA 4GIRA 1WOBA 2ATSA 1XSJA 3VKKA 2YA2A 1OZQA 4C6IA 1GYNA 4ICMA 1XICA 2PCEA 3EX3A 4DYEA 3WLHA 1GHSA 5EFFA 3DU0A 3W23A 4N9EA 4PSRA 1TPDA 3UJSA 2ZX8A 2BY2A 1VC4A 4R5EA 4PTDA 1D3HA 4ZQNA 2C7FA 5H8MA 3I4KA 3O0FA 4AZIA 2ZRWA 3B8TA 2WCGA 3FY1A 4FOJA 3LBMA 4FLQA 1HGYA 3CQHA 3QLLA 2ZC1A 3IJ9A 1HX0A 1KKRA 4JTHA 3CC1A 3PBWA 4UCFA 2FJKA 3OQEA 4ERGA 4C1NA 4QEHA 4GXPA 2GGGA 2Y62A 3KS5A 4HMDA 2R82A 1AL8A 4Z2JA 4ZOBA 4QAWA 4WCJA 4UOJA 5HQMA 1YTKA 1K3UA 1EXPA 2QCEA 3SY8A 2ZKMX 3W22A 1A80A 3MCNA 2YCKX 3FEQA 1P0NA 3NQ2A 4ILSA 1ADDA 4YTUA 2RH9A 1VZWA 3EXRA 3FJNA 1CXFA 4Z1AA 2OX1A 2IKGA 4CNOA 4GZEA 4HZ6A 4ZTYA 1W3NA 3V4BA 1A5MC 2W4XA 2VWTA 3F4CA 5HNUA 2Z1VA 2O9OA 4DLFA 3ONBA 4Q6JA 3CPGA 2QPSA 2RDXA 5E70A 4HQVA 2VM8A 2CNCA 5MKGA 4LRSA 3VKJA 3L4WA 2GL5A 2CHRA 5C7VA 4WX2A 5HDRA 1DWGM 2TAAA 2RHGA 2Z1WA 3GFZA 4JTTA 4WQ6A 2A3BA 2BOFX 3O3RA 3A4XA 3LY0A 1Q6GA 5D02A 1M7XA 2FMNA 1BYDA 3WFZA 4J5NA 3MVTA 2PWUA 4Z42C 3BWWA 1AZ2A 4L1WA 3ABOA 3BLOA 3FJ4A 1YTEA 1NWRA 2RGMA 3WK0A 4GQ0A 3WMCA 4FNTA 3ZSTA 1XI3A 3TDFA 3VX0A 4RW5A 3EWZA 4XAPA 4C7DA 2I16A 2XIOA 2PI6A 2DPEA 3FFSA 3UXAA 3FXYA 4CQ9A 3CIVA 3T42A 2VI0A 4TU1A 5E0KA 2VOMA 4HA3A 2XVGA 3GNPA 4K3ZA 5FEZA 4MDPA 1XH0A 3LK6A 5LIKX 4NJJA 1J01A 3WQ6A 4XZHA 4JKMA 4XAYA 3N15A 4L64A 5C7HA 3GXFA 1JYXA 3SQSA 4BCEA 4FLSA 4DPPA 5AC7A 2PDJA 2G8ZA 3H2FA 4DZIA 5E6ZA 2KX9A 1XYFA 1TVNA 2XH4A 3NZPA 3P82A 1JNDA 1DIEA 1LM1A 1Z9AA 3LPPA 4H7VA 4PB3A 1FXQA 4FXJA 4PA8A 3H70A 4M1BA 1VJIA 1DE6A 3BAIA 3ZT6A 3E0FA 3DGBA 3ARVA 3DKJA 7ENLA 2A2IA 3BJFA 2XIJA 5I3KA 1R47A 3BG5A 4MHBA 3M0MA 1DJWA 4Z0SA 5J5DA 5CAKA 5D38A 1WPCA 4RKAA 3V0TA 1OFRA 1BEUA 1QI5A 3IJ6A 4AX6A 2PC4A 3QC3A 4K2SA 3WDHA 1QNRA 1J0HA 4OVXA 1EJUC 4IIFA 3BJTA 2O4MA 3LRKA 3MHFA 2O9RA 4MYAA 1NF7A 1ZHAA 5HANA 4FPSA 3B0YA 1FHLA 3FN9A 1UQZA 3S4TA 4GVGA 3MT1A 5DMMA 4R33A 4PODA 1JI2A 3GSMA 1HVXA 5JBEA 2XISA 1KM0A 4FIQA 4PL1A 1P7TB 4E3VA 3WQGA 4LAMA 2D2GA 1YPFA 2Q3RA 5CG7A 3MWCA 1ZBWA 1H7PA 4LYPA 3UR5A 3IUDA 2QLYA 1W8GA 4AEEA 3UZYA 3MPGA 5D9OA 5G2WA 3CAKA 2DZTA 3S2NA 4OBTA 1FWHC 2ZUNA 3A23A 2XH7A 4CN6A 2BVYA 4ZZ9A 5M3WA 2DV0A 2X05A 3EGJA 4E4UA 3PG8A 5JBFA 3DFOA 1GW9A 4XZIA 2PRHA 4QQUA 1XYBA 1OFAA 1EGZA 3R0DA 4CCCA 3MJMA 3UCCA 3WQFA 3QEZA 3IIOA 1DTNA 3VGHA 2ZA1A 4DO7A 4NZ5A 5GNYA 1DQXA 1JI1A 1FBAA 4I7VA 2GWGA 2V81A 4JFVA 1RALA 1AH4A 1GZ1A 1T99A 3THDA 1MQPA 3Q58A 3VOIA 5DLCA 4N02A 4IQEA 2DFAA 1M9HA 4GKLA 4J3VA 4DB7A 2VUNA 2Q6ZA 3S46A 1IEIA 1F4HA 3SCVA 1ONEA 4DJED 3KLKA 3B0UX 4W7WA 2BLEA 4GVHA 1EC7A 3GDRA 4E2BA 3EB3A 2V5JA 3QMRA 4HN8A 1UUQA 1ZY9A 3I3BA 1HL8A 3HZ3A 4TX9A 3W1LA 3RM8A 3WQDA 1CLXA 4I6KA 5FJIA 2YW3A 4RZBA 4PUUA 4QNWA 3BXWA 1GQNA 3G0XA 3MP3A 2WB5A 4PMNA 2REQA 3H22A 2ZDSA 4UCGA 3LV5A 3LERA 1E9YB 2VRKA 9XIAA 1OX5A 1WYIA 4NNBA 3M07A 1UOZA 2A3CA 3CWNA 3ZZ1A 3W9ZA 3K1DA 3FHQA 4EXBA 4A3HA 4QJ1A 3UA4A 4TQTA 4XAZA 1XDLA 2ZYFA 2I9UA 4PZVA 5CSUA 2AKMA 2A7PA 4DI8A 1RQEA 2O56A 1W54A 2EKCA 4O8AA 4JQ1A 2G95A 3SRDA 1IWAA 2ESCA 4YVPA 8CGTA 3LG3A 4IPPA 3EKGA 3ONCA 1TPC1 1TV8A 5LSMA 3GYCA 4YTQA 2IQDA 1UG6A 4WKAA 1LQ2A 3CB8A 2X7VA 5RUBA 1ISZA 1E1FA 1AH0A 3IVSA 3CXOA 5EPDA 1IR2A 4WY0F 1JZ2A 4CQ8A 1EBHA 3LV6A 2RGLA 2ZX9A 5G4WA 2NLIA 2Z2BA 2WC4A 4GO8A 1WX0A 1QAPA 4AC1X 2YBUA 2VDIA 3F1QA 1XLLA 1ZJAA 4I5XA 4Q8UA 2I9EA 4EXQA 1DJGA 3T55A 1VPYA 4HYVA 2VX5A 1UWSA 3WBXA 2FIQA 2YLLA 7ODCA 1NIUA 3EA1A 4O1BA 2ZIDA 3NQAA 2A3HA 5BU9A 4J2PA 3KRZA 5BNKA 2V2CA 2WCSA 3BLFA 2PEVA 2WJFA 4GISA 1XLFA 3PAOA 1QI3A 3UBPC 3MO7A 8RUCA 2PAJA 1GZGA 3ZYZA 4JIEA 2W61A 1CZ1A 1FWGC 4RNJA 4AZHA 4J9JA 2QW5A 4DYKA 2GJXA 3BUVA 1RD5A 4WXYA 3S2MA 2BFGA 2IQ0A 3RMEA 3TKFA 2D0FA 5CPNA 4P7QA 5AVHA 2L5HA 4M7SA 3VNIA 1T40A 2VXNA 4UQ9A 4ZSTA 1OFDA 4TMCA 2FDSA 1CX9A 2J27A 1X38A 3WJSA 4UNKA 1E0UA 1O6IA 3B8SA 1K9EA 4CU8A 4AZCB 3BGAA 3PBVA 2DH2A 2PDNA 3A64A 3MQTA 1DORA 2E0PA 1XIFA 3S6TA 1SW3A 4HOZA 3SAZA 2BBFA 2EAWA 3BAYA 3WMLA 3VUSA 3WNLA 1ZUAX 1NFGA 4P7RA 1W1IE 1CLKA 3WKZA 4QHRA 1U1JA 4GYJA 1GOXA 1G01A 5BXPA 3V75A 4J7RA 2OZ0A 2W91A 1JVNA 1O7AA 3E02A 3C3UA 2YKKA 4F0LA 1TA3B 3W1XA 1SM9A 1S2TA 4OUIA 1GZJA 4X22A 2BOGX 3GVQA 1EDGA 4IHCA 4DZHA 3HFYA 2GPTA 1K8CA 2CLPA 1M7PA 3CEUA 1AUSL 1AJZA 1RCOB 4OQVA 5F4SA 1EZ2A 2PURA 3JR2A 3MC5A 2XYLA 5KSWA 1J12A 1QUMA 1A4LA 4CQCA 3UG8A 3WF4A 1WOAA 5IXEA 1OCNA 2FZBA 5I3FA 2X2GA 2AGKA 4OV9A 2DZPA 1PYMA 2V2HA 2PWDA 4XZ9A 4BQ4A 3SRFA 1UYQA 2PUZA 5J04A 1PKLA 2Y85A 3SM0A 1K6AA 2QJMA 5A69A 5L9FA 8XIAA 4DN1A 1ICQA 3R12A 1PKYA 3C2RA 4C5YA 1FUYA 1EGVA 1RQBA 5JH1A 2OLSA 1MXGA 1PWLA 3EWBX 1GNXA 1E6PA 4AD1A 1BXCA 1JEZA 1VF8A 1FWTA 3I7RA 4EK7A 1NH6A 3JZUA 4ZO7A 1IF2A 3N11A 3U7BA 1KKOA 2VEMA 3WF0A 3WYZA 2ODOA 4AMCA 1HKIA 2XDFA 3HMCA 2A6NA 3MSYA 3EKLA 1QI0A 1MNZA 5HR6A 1UW9A 3H4WA 3LS9A 4CUCA 3S5OA 3M0VA 1AQ0A 1IZJA 1IEWA 3ALGA 4QE1A 3W37A 5AVNA 3WQPA 2BDQA 3NEHA 1AD1A 1OYBA 1YTDA 3QKZA 1K70A 3N34A 4Q8MA 3SRKA 4FMVA 4WJ8A 4LBRA 1M7OA 3FCPA 2FGBA 4DF1A 1O5KA 3QXBA 2HK1A 1EX5A 5FCZA 1EZWA 5HWMA 5B7YA 1V3KA 1OJXA 1Q6DA 3R0UA 3MYPA 1WV2A 3NEVA 2DQWA 4E2VA 3P14A 1OFQA 1W2PA 3EDKA 3W71A 3E0LA 2YB1A 2QCCA 2V6AA 3L67A 4JHZA 4HGXA 4ASTA 2JK2A 3WLJA 1E1CA 5DT5A 4BEUA 1JULA 4IG2A 1XC6A 2A0NA 3KHJA 4H7CA 5E5CA 3TH6A 4H8HA 4WJXA 5GJMA 3FGCB 4QJ4B 3W7IA 4L7ZA 1R30A 1QNQA 4E6MA 3A21A 3NYZA 4P7LA 1E5NA 4FA3A 1Z42A 3SSJA 3JZEA 5CG0A 3EPOA 3URAA 1AMKA 1ZENA 1CWYA 2LLEA 2ZVIA 4V33A 2Z25A 3W2NA 3B9EA 4JFTA 1SZFA 4NAFA 2B7QA 1VRXA 4KWUA 1UZDA 4ZQMA 2J88A 4L9ZA 2WMIB 4LUTB 1B31A 1E72M 3F5KA 4GUFA 2C18A 3GVGA 4S3BA 4FNSA 3TA6A 4JTLA 1LLZA 3LX9A 3W2MA 4KRUA 3SJ3A 1AZ1A 3CH9A 1XISA 1F61A 1WDQA 1NVMA 1XUZA 1ZAJA 3FK4A 1CXIA 4A8IA 3MUCA 3W1NA 2HBVA 3F4DA 2DT0A 1U1HA 2B4GA 4PTMA 4FAMA 1C8YA 2WVVB 3UR8A 2GUBA 4WJEA 1EX1A 1IIGA 1EO5A 1QI4A 1HJSA 1LRTA 2YW4A 1M7JA 2WHMA 1ZU8A 1US0A 5CGMA 4Y96A 3GTXA 1JZ4A 1FP8A 4JZ5A 2NX9A 1YW1A 3QC0A 3FJ6A 3V35A 1PDYA 1ZLPA 1ICSA 3REQA 1EJXC 3RR1A 5C0QA 1FDJA 3F5JA 4UZUA 2VRJA 2YCJA 2VP8A 3G1HA 4CU7A 3N04A 1NAL1 1X6LA 2DVUA 1V6WA 1JPHA 5DMNA 1KRBC 5CPMA 2JE8A 4QSFA 4MPKA 1HKWA 1ME8A 3QW3A 1QW8A 2XM1A 4QE4A 4ZA0A 3C5QA 1FWAC 3CIWA 1DWIM 2X1RA 3LHVA 3UP8A 4B16A 1SVDA 5CQ1A 1ISXA 3OG3A 5A6TC 5F2LA 1EL3A 5T9CE 1E51A 2D23A 2O7SA 2D24A 3TZNA 3W2LA 4DY1A 1EP2A 1GJWA 4IP5A 2IXVA 3WK2A 1ZQ5A 2ZE3A 5E6YA 5D30A 3WH6A 3S1GA 2GJLA 2BXYA 1KCXA 3HM7A 3BJSA 3N17A 4WOZA 3QRHA 5D33A 1TCDA 4BQ2A 3KZSA 3II1A 2W9MA 2D2HA 5HNNA 1A3XA 3LHUA 1DBTA 1KTBA 2ZTJA 1PX3A 5ABGA 3N2XA 3IPWA 1BSLA 2BHYA 2YBTA 2OWWA 3WBEA 1HKMA 3L0NA 4WKFA 5FSEC 1XYAA 4AU0A 2B31A 3E6EA 3ELFA 4NASA 1CGYA 1TKKA 4JIIX 3FYYA 1Q66A 2QXWA 3G24A 5I23A 5AB3A 1VIWA 5ECUA 1J6PA 2PE4A 2HRWA 4EPEC 2X1UA 3LB0A 2VZVA 2ZX7A 4TR9A 4IQJA 4AHQA 3DHUA 2XN0A 2E3ZA 1T0OA 2DIKA 3W1TA 3MWAA 4EACA 3CUHA 5JH2A 4C6JA 3UJFA 2HWGA 3N2CA 1XGDA 1I8JA 1F8IA 2QF8A 2IS7A 3WQCA 4ZMGA 1IGWA 3V18A 5KZ6A 3N4AA 4GUGA 3SY5A 1ZAHA 4K1GA 4DAFA 4HNOA 2E09A 4GPNA 5HWNA 1J0JA 1FWEC 3UETA 5E93A 2WSYA 1DWAM 2YL9A 4I3GA 4YCOA 4MSSA 2PTZA 4KCVA 3OVRA 4AG0A 1V3LA 4A6GA 2NV2A 3IK4A 1H7NA 2G4JA 1FKXA 2DVXA 3O16A 4TUFA 3HQ1A 4X60A 3PBYA 3KTXA 2A7RA 3T0DA 4B5WA 1Y8BA 4ZB5A 3NUKA 4HZMA 1E6ZA 3EKZA 3E0IA 4AF0B 3OBAA 1PB0A 2C71A 4W86A 1BPLB 3W76A 3MMWA 4RW3A 4WEVX 1S5NA 5I06A 2OWCA 4DWSA 1KV5A 5C2GA 3TYDA 3UPWA 4RJEA 3NL2A 3MYOA 5C54A 1H7OA 3CUJA 4ORIA 4F0MA 1UR3M 1X8CA 1WZLA 3IJQA 1DE5A 1MW1A 2G3NA 1UZ4A 2J9XA 4AY1A 1NEYA 2CFFA 2XFRA 4UTFA 4O0QA 1ADOA 3SUVA 3CYJA 4JIRA 4Z1CA 2CYGA 3PUGA 3VA8A 1VBUA 3JUGA 5I3DA 4JR5A 2PTXA 2R14A 4PYSA 1XIDA 4PGLA 3RU8X 3AIUA 1E9ZB 4L4PA 1Y7VA 4O13A 3PWGA 4PR4A 3LMZA 3AIRA 3EWWA 3G1FA 1OIMA 1P6CA 1RPKA 1BHGA 3UR7A 4B9ZA 5G2HA 1O95A 1JAEA 5FF2A 4O15A 1UP0A 5K9DA 1OC5A 2CBIA 4GQRA 1UC5A 5K7JA 3IARA 4I90A 4RZ5A 2PF8A 1UOKA 1OFEA 2QGYA 5DBUA 1W1YA 1NTHA 1QJWA 4JFSA 4H8VA 4GACA 2WANA 1DQUA 3W7CA 3O2LA 3M0YA 3WBYA 1XM3A 3H6OA 1LBLA 2Y8KA 4EPBC 3M43A 2NXIA 4PULA 3USZA 4AWTA 1UIOA 1OFOA 1QWGA 3GG0A 2GGJA 1BXNA 2VX7A 3BAXA 2ZWYA 5KETA 2XN2A 2WO5A 1UKPA 3GXIA 5K9XA 4GYFA 3MDWA 2CPUA 3BGJA 2WQDA 3NPUA 4EOUA 2VMFA 5D2WA 2QULA 3L4VA 1EB3A 2HSAA 3LHTA 4XIAA 3EWYA 5D37A 3TJLA 2NVCA 1QASA 3HU7A 2OYKA 3O6YX 2CZVA 2VX6A 1REQB 3W7JA 2QJHA 1GVFA 2MANA 3CWOX 4ALDA 4JYFA 2R1KA 2YCIX 4V1YA 1B1YA 1AVAA 2CBUA 2J7DA 2CBVA 3BTNA 3EWCA 3V36A 5BWAA 4AYSA 2GGEA 3LXCA 1GCYA 3WL1A 5I02A 5KZEA 3CB3A 2V5LA 3FV9A 2E4TA 3VNZA 1SJCA 3IS4A 1XD0A 3RR4A 3SIMA 3DFQA 3OPSA 1A4MA 1F3WA 3ZWSA 1DQWA 6TIMA 4Z17A 5HWJA 5FL0A 2WVVA 3W2KA 4M51A 1AD4A 5FKYA 2GOUA 4AUBA 3W7OA 1JL8A 4HNLA 1E4LA 2JQXA 4DBSA 1R9YA 4H2HA 4OJYA 2F2KA 5HQLA 1F07A 1HQTA 5A2CA 4RV8A 2OWXA 3TONA 4HPHA 4PMQA 4LJ3A 3SCSA 1XYZA 5J8LA 1J79A 5HNRA 2VZTA 5DT7A 1PCKA 3R10A 2Y7EA 1GG1A 1U83A 1BRLA 1KFKA 2X0YA 1THFD 4LCQA 4CD8A 4BR1A 4GOAA 4PMUA 2XWEA 3A5VA 3MV01 1R7AA 4N9CA 4JL2A 4YIWA 4DBEA 1RCXB 1Q7MA 4GCAA 5JBDA 5FA5A 2A3EA 1NY1A 1KA9F 2E1WA 1C8QA 3W88A 2JF7A 5FJJA 3AJXA 5DQPA 1CBGA 3OJGA 3WLMA 3B9AA 3PPFA 1Z7AA 4ZE4A 1UR8A 4IGNA 4HCDA 3GY1A 1RUSA 1U5HA 3W81A 3CUXA 2YB4A 1KD0A 4NAEB 2C13A 1G4PA 1UR9A 2ATMA 3LZ5A 1SO4A 4IICA 3U6WA 4WGXA 4A8LA 3KX6A 4BF7A 1PIIA 1OX6A 1TVLA 2SFPA 3D3FA 1A5BA 2B81A 1OY0A 4WIWA 2OQYA 1CENA 4Q4KA 2CLKA 5CPSA 1V93A 5AOUA 2PFHA 3EEGA 4S3EA 2JGYA 3F5LA 2EPMX 2QEZA 1VCGA 4J28A 1UMYA 3DBPA 2YCEA 5KMYA 2QT3A 4JYDA 3DC8A 1W9VA 2WXDM 5A8OA 4OZOA 3CJPA 1FWIC 1QK0A 1H1ZA 3DH7A 1J96A 5F7UA 4OHQA 3TP4A 3T0TA 4HOXA 1MUMA 2OR2A 5AHFA 4KF1A 1TWDA 1TJ0A 3GO2A 2O4QA 3ATYA 2WVTA 1V7YA 3LTSA 1XLMA 1WNOA 1XD1A 4JTDA 3MUIA 3GHTA 4Y90A 2A3LA 3O0KA 5A6AA 3B97A 7TIMA 3NYDA 3VKCA 2E40A 1RD6A 4GQBA 1B2YA 3FAWA 1IGSA 3T40A 3AHYA 4LWWA 1MWOA 2XIBA 1BXBA 4MLRA 1XBZA 3CPUA 2O9TA 1V0LA 5BXRA 3K8LA 2DW6A 2OB3A 4CGTA 1KR0A 4GGHA 3GXTA 2W0UA 4MADA 2Z28A 1XDJA 4IIEA 4B3ZA 1TA3A 1W6TA 4AF0A 3EX1A 3L65A 4GUIA 1QOXA 3JRKA 3ZOAA 4DJEA 3RG6A 3T0AA 1RY0A 1F6YA 3ZR4A 1Q2RA 3ZLGA 3RIKA 3N6JA 3W6LA 4GVIA 3CHDA 4F40A 4L56A 1X7IA 3ARQA 1J4EA 3EMCA 1JPDX 5CEWA 4NKCA 3WJXA 2F6XA 4GQQA 4UFKA 3U9IA 3SZ8A 3G22A 1RLDA 1OG0A 3POHA 1VRDA 2V67A 3A5FA 1GQJA 4B5XA 3S1UA 4WVXA 2HEJA 4IGSA 5AHMA 3E96A 2Z0IA 1EJRC 4H9MA 2WOQA 2P5NA 3U48A 4AHOA 4CCZA 1XW8A 4LXFA 4A05A 1KRAC 4AXNA 5M03A 5TF0A 3ABZA 4EPKA 1E43A 3UEQA 3OU8A 3SUSA 3M46A 2FQIA 1AG1O 2Q01A 3FDGA 2OEKA 1VKFA 4CQAA 5H91A 4IPNB 1F74A 5CPQA 1RJPA 3OZOA 1JCXA 3DXIA 3AS3A 1EUNA 3NG3A 4JTUA 1I0DA 3NQ6A 5B7ZA 2XVPA 3DHPA 4CVUA 1UH3A 2VWSA 4Y6GA 4H8UA 2QJJA 4GI9A 3H8AA 4F9JA 1PO9A 3N2OA 4NT0A 1WBHA 4QS5A 2OZTA 2J4GA 3NWRA 3AXHA 4R7OA 4NQ1A 4F2UA 1I4NA 3N9RA 1KC7A 2VFDA 4CD4A 4GX8A 2PDYA 1HKJA 1KFJA 1FCVA 3W84A 2HBXA 4C90A 4CD7A 2OKOA 3UXIA 4RNHA 2QVNA 3R1ZA 5LGXA 3BZJA 3HG3A 4ZOAA 2I5IA 4G9PA 3S1VA 3NQEA 4D6EA 1W5OA 5CXPA 1I9CB 1LP6A 1CNVA 2HE5A 1XIHA 4Q6XA 1FRBA 3DEQA 1J0YA 2CLEA 3ZJ8A 4A3RA 1JD7A 4C6CA 3OB8A 1VGAA 5K4ZA 3CMJA 2O0TA 4RZ6A 1NFPA 2V0TA 3BGGA 3TR9A 1CXLA 5JU6A 3ABSA 4O1DA 4AFYA 1W32A 4C7FA 2FKPA 4WLCA 4JFWA 3GDMA 3QVQA 3C2EA 1JF6A 1WDSA 6TAAA 4AZ6A 3GNDA 4JNZA 3ERPA 1WE5A 1GW1A 4DJEC 3WMBA 4PUEA 2QGHA 3G1VA 4P8XA 1V3HA 2ZZ3A 3K8MA 1R6WA 3KBNA 3AYSA 2Y6ZA 3ZLHA 2DZWA 2NUYA 4POCA 3WLPA 4ML9A 1VB9A 4JY9A 1E4NA 1GT8A 3N6HA 1QHZA 4XIMA 3VXGA 5I0DA 3GTIA 5C9RA 5AYYA 4JCLA 4H83A 1GQIA 4CEUC 4PCPA 3BV4A 3UWWA 1BWLA 5CGQA 2EPNA 3W2UA 3WLTA 3RLHA 1O66A 2NVDA 3N9SA 3TMLA 3R5EA 3NZGA 5C2CA 5AC6A 3IGUA 1LOQA 1NFBA 1Q4NX 4MYXA 3TYCA 1KQZA 4M8UA 3I3EA 3G1RA 3GNNA 3CL6A 1JGMA 3W01A 3W1QA 4YTRA 4OECA 3CK5A 3HJEA 2PWVA 2Z2UA 3QZEA 3UGRA 4QLKA 1RLCL 1E9LA 1XXXA 2A6LA 1KXHA 2NX3A 1IQ8A 3GBDA 1T96A 4Y8FA 3BLLA 5L6UA 1O1ZA 3BOFA 1I2PA 4G56A 3W25A 3STCA 3GR4A 2HPMA 1UWTA 3QTGA 5F1UA 5F4WA 3IJ8A 3WUFA 3N2BA 1B90A 1LQ0A 4DI9A 5DF0A 4RE4A 4TVDA 2J7FA 3PZGA 5D9MA 3VOFA 2HS6A 3ZWTA 4AIBA 4O4WA 3P74A 3UPBA 5DCEA 4RNIA 3UWZA 4HD5A 4XZLX 3ZM8A 4UXDA 5A94A 4FX8A 5EBAA 1HUVA 4Z0JA 4I7WA 3S5SA 3VAVA 4TV6A 1PUDA 1Q6RA 3KOZA 1SR0A 1TIWA 2CKSA 1MUWA 4C6OA 1FKWA 2UY2A 3CZJA 1K8ZA 2QR6A 3NL3A 2WZIA 5I2UA 1UBPC 5IDZA 4ZOEA 2YBVA 5LIXX 2VCAA 4GIAA 1TV2A 1UROA 1AFSA 2HVNA 2YXXA 3MV11 4PUNA 4K39A 3DG7A 3ARRA 4GNVA 1IXNA 1UR0A 5D32A 1XYCA 1JPKA 3PJXA 1AW2A 2C14A 4IT1A 3ARYA 3SGUA 3BO9A 3FA3A 3KS6A 4KRTA 4N9BA 1YPIA 5CJNA 3GFXA 3TW6A 4LCSA 3LBOA 3VIJA 5DN1A 1WCGA 2CWXA 1OM0A 3TNOA 3EOLA 4C7GA 3DYMA 3A9BA 2VR4A 4PSPA 1UWQA 1W31A 2XPKA 1V3JA 3MJYA 3VM7A 6ENLA 1V03A 1KBJA 2NV1A 4UR9A 5CAHA 2HCVA 4Q4RA 4Q33A 4PUDA 3C6CA 4FXFA 1JPIA 3LHWA 4R9XA 1VCVA 2AL1A 4K8HA 1GOWA 1KR1A 4GI4A 3LGEA 2Y2WA 2W5FA 1GPWA 1SFTA 2G37A 4HZ8A 1CPUA 4S3GA 4MGGA 3IJLA 1V6XA 3UG5A 3VGFA 3A22A 1ZZMA 3B9OA 3GX9A 2POZA 3WNPA 3B3DA 2QKFA 1Q6EA 1JCNA 2J9ZA 2VEFA 4AIUA 4GG9A 4XBKA 2UY5A 4O19A 2FZDA 3D6NA 5CC5A 1R8LA 2GSHA 4IL2A 2UY4A 2RDUA 3H2OA 1E40A 2NQ9A 2UWFA 4KMQA 6A3HA 5LXXA 2PDLA 1OINA 1A0EA 1JCLA 3PUDA 2V63A 1XX1A 1FOBA 2C1HA 3P3BA 2Y88A 3WL0A 1PHQA 2GUUA 3PULA 4PTVA 1K9FA 1F73A 4FR6A 1VFUA 4E8DA 2Q8XA 4X9YA 3GU2A 4M3PA 3H2NA 3WLQA 1N8WA 4WDTA 3AMDA 1E1CB 2PODA 1XHGA 4MY8A 5K3VA 4G6CA 3OYXA 3CBWA 2NW0A 3B06A 1GJUA 1K8XA 3VX1A 5G2IA 1ZGDA 3M9YA 3APGA 5A6SA 1D8WA 5DXYA 3L0GA 2VHLA 3N25A 3PG9A 4MB4A 1A5CA 4GNJA 1TZ9A 4RLIA 6PTDA 1UR1A 1W17A 3HTWA 4BWLA 4CU6A 7TAAA 3IANA 1HJWA 1TTJA 1A5AA 3QOKA 3WDQA 1A5UA 3DUGA 3UW6A 1IXQA 4HMNA 1RV8A 1P0BA 2NV9A 4RR4A 3ZJKA 4NX5A 1MZRA 3Q94A 3DHDA 2X40A 1OGBA 2EQDA 3BSMA 3WBAA 4KFNA 4B4HA 2YCLB 5HUOA 3ABRA 4NVTA 3DYPA 3TROA 4PCSA 8TIMA 3M47A 4Q8TA 2VEPA 5BXTA 1KBLA 2EGZA 4EAYA 2QUVA 2W27A 4IPJA 1WKDA 4S3KA 3QQ0A 4NNCA 4YJ5A 5AN7A 3GH5A 4ZB2A 1LWJA 3TQPA 5CZJA 1IZCA 3UXLA 4HU4A 1UP3A 2DT3A 2ZICA 4H6EA 1M41A 5HQEA 2NWRA 3GAKA 1MQQA 3QR0A 1DVJA 5D4YA 1KGUA 3MA8A 4Q8PA 2Q3OA 3TU9A 5GNXA 4MY1A 3AYRA 4PUJA 2QVHA 2J8TA 4HNTA 1R85A 3W7GA 3O6AA 1I1WA 5JQ9A 1BG9A 2F38A 4LBUA 4OU1A 3T44A 3E74A 1I2RA 4GABA 4G7EB 3V5FA 1UKTA 4FNPA 3B4UA 3EXTA 1I0BA 1R7OA 4KH2A 5HJXA 2C19A 3AO0A 2VEGA 2X1TA 2PS2A 1MMFA 1TCMA 4ZQPA 1TE6A 1ZBKA 5EKYA 4MDOA 1OEPA 4M7TA 3SW6A 3DECA 1GKRA 3XINA 3WNMA 4MFEA 4L5ZA 1O5QA 3W28A 4PEKA 3WELA 1PIGA 5AHLA 1V02E 3CPRA 1ZBVA 4UFJA 1QU4A 3KW3A 4BQ5A 3S8HA 3UWEA 3E0WA 5AHIA 1S5VA 3EOEA 1ODUA 5ABHA 2KAUC 1W5PA 5CZKA 2VFIA 3WDPP 5DRIA 2Y24A 4I9MA 3SCUA 4GH1A 3APTA 2JEQA 3L21A 2BODX 4ADSA 4DAIA 2YDQA 2IKHA 4F0SA 5FF0A 1Q7QA 2ZDRA 3OZYA 5ABEA 1MI3A 1SJAA 1XIMA 3LRMA 2WSRA 2WMFA 1SJBA 3UESA 4YYFA 1UKSA 4HPNA 5CPLA 3C0JA 3HQNA 3CUGA 5A6BA 1VYSX 3QV7A 4O4VA 1H7XA 3S6DA 3BANA 3T8QA 2VZSA 1UD5A 1ME9A 3ANYA 3VNYA 1FDZA 1SZNA 2G3FA 2E7FA 2CETA 1DJQA 3NVTA 3TZFA 4C6EA 4JOMA 3U5UA 3CWHA 4UB9A 4XISA 3WMSA 1XYMA 1E0TA 3E0VA 4D6FA 2B7PA 2OYMA 2OJPA 4UIOA 4AVOA 2P50A 3K8KA 4H9VA 3FVDA 1A53A 2NLYA 4UNLA 5EFDA 1LCOA 4UWMA 3SCPA 1B3OA 2QDGA 3C8FA 3KE0A 4XZNX