4XTIA

Structure of imp dehydrogenase of ashbya gossypii with imp bound to the active site
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
407
structure length
373
Chain Sequence
YRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii atcc 10895
molecule tags Oxidoreductase
total genus 117
structure length 373
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtiA00
1VHNA 2ZA1A 4UTUA 4K8EA 1PL9A 1OYCA 2FQIA 2LLEA 3PF3A 3SGZA 2YCEA 3TNOA 2YX0A 3A23A 4WQ6A 3DKJA 3W7RA 4MY1A 4DO5A 4C1KA 3MJYA 3BGJA 3M5XA 3FFSA 3QEZA 1H7WA 1LLZA 1TTQA 3M9YA 3T4CA 5EY5A 4ZQOA 3GAKA 1AW1A 3H53A 2CLIA 2VOMA 3TFCA 3KVKA 3FJ6A 4CQAA 1EPXA 1OFPA 4BI7A 2J27A 1J5TA 3TR2A 3W6YA 2JK2A 3OIXA 4UMAA 2NXIA 4NXKA 1Q6LA 1IXNA 3F03K 4JTGA 3IVSA 5F1UA 3A9IA 2ZA2A 3IIOA 4RR4A 1KM4A 2VEMA 3W83A 2A5HA 2BSLA 3PC0A 3G0SA 3LCXA 2GPTA 2PRHA 3S5OA 3DHDA 3GNNA 4HSOA 4MYAA 3HG3A 1W56A 3G0XA 3T78A 3NXFA 4RLIA 1AW5A 3NZ1A 3KVMA 4CQ8A 4R53A 1PHWA 3HIJA 3UWWA 3SIZA 3W76A 5F4SA 1NF0A 1FWRA 1JRBA 1I2NA 4UMCA 3C2EA 3PSWA 3R89A 4UTTC 1VQTA 1Z42A 4JY9A 1WOBA 3TXVA 2TPSA 1RQBA 3MHUA 2QDGA 4LS2A 2NXGA 2ZRYA 2E77A 4A21A 2GVJA 5CPNA 1H1YA 2E6FA 5A5WA 1MSSA 1QO5A 3CWNA 2HSAA 2IQTA 2C3ZA 3AO0A 4GWEA 5LNUA 2EF9A 1ZY9A 3D0CA 4ZQCA 3ABOA 3WJSA 4KFNA 1W3TA 3GX9A 3R13A 5HQEA 4MY8A 1EP2A 2DJXA 1QPOA 5AHMA 3BLIA 4K36A 1ZENA 3DH7A 3FIGA 3HGJA 2QCCA 3E96A 3GXPA 3EKLA 3EB2A 4MZ8A 1OFDA 3F1QA 5F2MA 5HUPA 1SW7A 3L0GA 4CNOA 4QJ1A 3QMRA 3UWZA 1TTIA 1Z41A 2C0AA 3UPWA 4E0CA 1A5SA 1GOXA 3LCGA 4A3UA 4FB7A 1EA0A 2H3DA 2YYUA 1S5VA 3P61A 3UXDA 2C6QA 3W2MA 3NOEA 3EX4A 5D37A 5IBXA 3PR2A 4JIQA 3I7QA 5CSSA 2A6NA 5I3KA 4MVAA 3IVUA 3ZFHA 5AHIA 3TIMA 2Z0IA 1F05A 4MZ1A 2OX1A 2GJLA 3VI2A 3AJXA 4MOZA 3MI2A 3OVRA 3T44A 1H5YA 4BWLC 1KM1A 3QPZA 4CLMA 1SFJA 1B4KA 4NJJA 1ZAIA 3I65A 4QITA 1XBXA 2EHHA 4D2JA 3QMTA 2VFEA 3C4UA 4UUIA 1K7EA 2J88A 3SW6A 3N14A 1W3NA 2E5BA 5SWUA 3PAJA 2R94A 3HQ1A 4I7WA 1PCKA 1G6CA 4NQ1A 4O17A 4Q33A 4Z1CA 1VPXA 3NQFA 4UNKA 1X1OA 1DJNA 4B5NA 4K6AA 1WDWA 3KFTA 2D73A 4MJZA 4FNPA 4C1LA 1VCGA 4WJEA 1SZNA 4IXHA 2A1YA 3EWBX 4UXDA 3LRLA 1V5XA 2V8ZA 3UZ5A 4AAJA 1TO3A 3RU6A 2E5DA 3VCRA 1SZEA 4EOUA 3S1UA 4TO8A 4CNPA 3CTLA 2YW3A 4KFPA 4LWWA 2CZEA 4FX7A 3DHFA 2A7PA 4UTWC 3P81A 2P1FA 1OFQA 1QOQA 4OT7A 3GYEA 4PCFA 3DFQA 5AYXA 1TPFA 4YL2A 1HFBA 4Z1DA 3LLFA 1ZFJA 3QRHA 3LXCA 4X3ZA 5LGXA 1GPWA 1IF2A 3T55A 2QCEA 2C15A 1VLWA 1O5XA 3C6CA 3SSJA 4O28A 2ZCGA 3HPXA 3O63A 1H7NA 2Q8ZA 3LTYA 1X6UA 3DXIA 3QYQA 2VFFA 1FQ0A 4O53A 4O1BA 3W2NA 4AHPA 4X22A 4GC4A 4A29A 4JXCA 3I7RA 3W2KA 3NQ2A 2J6XA 2NX1A 2PC4A 4HNTA 3W1NA 3DI1A 4HIBA 2RKXA 4M7TA 1FX6A 2QCDB 1FDJA 1N8FA 4JX6A 5I3HA 2A2IA 4OWGA 4NNCA 4NJHA 1I8JA 5C55A 1K03A 1DORA 3P80A 1PE1A 2DP3A 4UTJA 2QUTA 5ABTA 1GTEA 1HL2A 1TCDA 1MO0A 1ZAJA 3ATZA 5EKYA 5AYZA 3GR8A 1AMKA 1TTPA 2R91A 3UWVA 4FNSA 5BW6A 4FNTA 5FEXA 3BO9A 2G96A 1H7PA 3PBWA 1ADOA 4N4PA 1QNVA 1LZOA 2X1TA 3LBMA 1XM3A 3W7JA 3IGXA 4EF8A 5I3FA 2QDHA 1D9EA 3G0UA 1OX4A 3W9ZA 2E5CA 4IMGA 3LLDA 5CKSA 1FWNA 3LCFA 3WK1A 4AF0B 1NF7A 1B57A 1GVFA 5D03A 4GJ1A 2B0MA 3R2GA 3C56A 3KHJA 1GVRA 5EL1A 3UWQA 5FESA 3I68A 3IV3A 4RXGA 5CPLA 6TIMA 1VRDA 3B0UX 4LY8A 1G67A 1H63A 1TB3A 3SGUA 3L0NA 3W2LA 1JUKA 1OX5A 1NVMA 5CZSA 1B3OA 1QPNA 4NVTA 3E12A 1DV7A 4Y90A 3PBYA 1K8ZA 2H90A 4JYDA 3G1FA 3TUUA 4DF0A 1E51A 3G1SA 1ZCOA 1HUVA 4YCOA 4FNQA 3B04A 3CM4A 2C1HA 4K7YA 3W1RA 1ZHAA 1DJQA 3THQA 3W7QA 1IXQA 3W7KA 3GAYA 3GVGA 3M41A 3L5LA 4AEOA 4NJIA 3GDMA 1IXPA 2G95A 4XWUA 4Z0SA 2QJGA 3NVTA 1JCJA 3BG9A 1A5BA 3CIXA 3LGEA 4O57A 3WJXA 3R12A 5DELA 4R34A 2TRSA 2Y7EA 3FS2A 4MKNA 1KFJA 5LKYA 3NQAA 5AYYA 1TYGA 4O4VA 3CHVA 3LRMA 1TREA 3A21A 1WX0A 2J9ZA 3PUDA 4RX0A 1YDVA 2RFGA 3W88A 3W84A 4ZZ9A 2CLKA 4O0KA 2TSYA 1SU5A 1UB3A 3PVFA 3W7LA 5AC7A 4AHQA 1R2SA 3S9YA 1GG1A 4DO4A 5LHFA 4IUOA 5HR6A 3G1VA 4WX2A 4UFJA 3DFTA 2J9YA 4JY8A 3NYZA 5G2IA 1G4PA 4K37A 2CZDA 2UV8G 5H2ZA 4FIRA 2DORA 2F7FA 3IVTA 1SZFA 3M0ZA 4UFLA 3BK0A 4JIPA 3MI6A 4MPQA 5HWMA 1T99A 2I14A 4LS0A 3TJXA 3G24A 1H60A 2Y88A 5FEPA 4LVGA 4HNUA 3CWOX 1BEUA 3HBLA 3LV6A 3CQ0A 2ATMA 5D38A 1A50A 5K4ZA 2CZ5A 2CZFA 2JKEA 3NQEA 4IPIA 3I6RA 2WKJA 4RCXA 5LNRA 3NQCA 4JTHA 3W73A 3EWXA 3WJZA 5F4WA 2ABAA 2WNQA 3W71A 4X2RA 2V81A 4YMZA 1XI3A 3NQ7A 4IX0A 4KWWA 4XTIA 5D32A 1TSIA 4Y96A 2BXVA 3TXZA 4MZYA 1SSGA 2BLEA 4BK9A 3PWAA 5K9CA 3GNDA 4QNWA 4PC8A 2V9DA 4FX6M 5FF3A 3TV8A 4M7SA 4E2BA 3GK0A 1KV8A 1X8FA 3UYCA 3U6WA 1JQVA 5TQLA 1HTIA 2E1DA 5DBUA 3P8IA 3OHIA 1WQ5A 3HPSA 4UFMA 3CLMA 3W7NA 3BPWA 2P10A 5FI8A 3VE9A 3W7MA 2XN2A 4CQ9A 3MBDA 3OG3A 4O1DA 3NG3A 2WNNA 4Y8FA 3WK0A 4P61A 3PB0A 2R14A 4RJEA 3PULA 4CCEA 4A22A 4J9JA 2WSQA 4LC6A 3PBVA 2RDWA 1K8XA 1UUOA 2ZTJA 2VENA 2ISVA 3LHTA 5D04C 3P84A 1K7XA 3ZWSA 2OT0A 4JTJA 3GDRA 1QMLA 4RZ6A 1O95A 3NL3A 1JQXA 2DZWA 4X9SA 3TK7A 4O12A 1S3HA 3O16A 2VEKA 1RZMA 2I1OA 3HMJG 3C0JA 1KM6A 2EPHA 3MBFA 4PFMA 4U4MA 2H3BA 2HMCA 1OFBA 3LM7A 3EKZA 1EIXA 5D33A 1I4NA 4OV9A 3BG5A 1AG1O 1K02A 3HGOA 2E09A 1D3HA 5D30A 4FF7A 3LCHA 3ABSA 5HJLA 1C29A 3EXSA 2WSYA 1F2JA 3O1NA 1A5CA 1YYAA 1QAPA 4GFSA 2Y63A 4RKAA 5DBTA 4O14A 1SQ7A 5HMSA 2H6RA 3H55A 2BZNA 2Y70A 4N9BA 5IM51 3NL6A 2X1RA 3IGUA 1KFEA 4FEZA 1I2RA 5CG7A 3QM3A 3LHZA 1X1ZA 1TPUA 3N2MA 3NM3A 3B8DA 1KFLA 4ZQMA 3HPZA 5E1QA 3CT7A 3RFAA 3PUOA 2OCZA 1KM3A 1YTDA 4RXFA 5HUOA 2GQ8A 1WXJA 1G4TA 3W72A 3NR0A 3G18A 3GIYA 4IX2A 1DOSA 3NQVA 1PIIA 1AL8A 2QCNA 3LI0A 3S6DA 3DU0A 3TSDA 3QJAA 5F2GA 4E2DA 3PB2A 1UASA 2FPYA 2JKPA 2GOUA 4H3DA 1W54A 4MUZA 1L9WA 4UNLA 3FKRA 4BR1A 1FWSA 4AB4A 5LGZA 1G7VA 3TH6A 3M1ZA 2ZFAA 4NZFA 1P1XA 3UXAA 5K2ZA 2E68A 4O8RA 3Q58A 4YLWA 1W0MA 2NWRA 1ICQA 3E02A 3W7DA 3N9RA 5G1TA 2Z1BA 2VFGA 3ZS4A 2WNZA 4O1CA 2Q8LA 3W1PA 3DFOA 4N2YA 1SO4A 2CLLA 1F74A 4PTNA 3IIZA 1QOPA 2PRLA 3LHUA 1W3IA 3TJLA 1MEWA 2DZXA 3KOFA 1LCOA 5G2WA 3LHVA 3VKJA 5C54A 3ATYA 3G22A 1P0KA 4ORIA 4LS1A 1TRDA 4IGHA 5D09A 2EGZA 4NT0A 3TU9A 5AHFA 4JTEA 3C8FA 3W1XA 2QUVA 5FEWA 2J9XA 3NNTA 4OBTA 2GJNA 3TSBA 2Z6IA 1K7FA 4DPQA 1SW3A 4ZMGA 1W1ZA 1HO1A 3RK8A 1RQHA 5AN7A 1EEPA 3NZRA 2PURA 4RV8A 2Q3RA 2YFNA 1R47A 3G1XA 1R2RA 1L2UA 3A24A 4S2CA 2GQAA 5BMXA 4MLRA 3DFNA 4W9TA 1FBAA 4QM1A 2XN0A 4O54A 3O07A 3MMTA 4JTLA 5C2XA 1PHQA 1LDCA 4IMDA 1O60A 4EWND 1LROA 1LRTA 3KRZA 1F5ZA 4N9CA 4JTTA 2GVLA 3G1DA 5LNSA 1LBLA 1H7OA 1KFCA 5LZLA 2X1SA 1SO6A 4K8HA 4UMBA 3SFKA 3P5YA 1P0NA 5MHBA 2YYTA 3L68A 1FCBA 3RLVA 3NQGA 2AGKA 2HS8A 5HR7A 5G5IA 2VXNA 3B06A 3W87A 3W7EA 3HB9A 4O4WA 3DGRA 1VCFA 2JKAA 3OBKA 2W79A 3VE7A 4YXGA 3OVQA 4O18A 1VCVA 2ZDRA 3NPUA 1YXCA 1UCWA 1ICPA 1TPC1 1R30A 1SO5A 4CCCA 1H1ZA 5CSRA 1W5OA 3L21A 4DF1A 3CPRA 4Y6GA 3GDLA 2A4AA 4LV9A 1ME9A 1UJPA 4N6FA 3M47A 1LYXA 2C18A 3ABRA 3BV4A 1JCYA 3O05A 3SY5A 3NPWA 1T96A 4HPJA 4QQ3A 4CNNA 1CI1A 2Y7DA 1KTBA 1F6PA 2CLFA 2RDUA 3F4NA 4JGDA 4XKYA 5C5YA 3PSVA 4GUGA 4DO6A 4POCA 2RHGA 2YPIA 2VFIA 4A2SA 4MLJA 1G4SA 1A53A 5J5RA 4JTFA 1SO3A 2H8ZA 4NNAA 3P8JA 2YR1A 4GNJA 3Q37A 4HNNA 5LHEA 5AFDA 4JDYA 4WY0B 1LRNA 1GG0A 3O15A 1M5WA 1YXDA 3LERA 3RF9A 4Z1AA 4LUIA 3QSTA 4U28A 3UQNA 4Q4KA 3NO5A 3STEA 1OJXA 1VC4A 3LRKA 1XFBA 2VEIA 3O6DA 3O6YX 3M6YA 4NUWA 4EF9A 3GXNA 3HG5A 5C6MA 1Y0EA 4LNYA 5E0KA 4WUIA 1YPFA 1WBHA 3FYPA 1W5NA 1SFLA 4ORMA 1GVSA 2ZRUA 5T26A 3PG9A 4DQWA 2GQ9A 4UTKA 3FJLA 3B03A 1DHPA 1RR2A 1R2TA 4CCDA 5FF2A 1KFKA 3V1PA 2I9EA 4LRTA 4WY0F 2V5BA 3STFA 1WV2A 4QSHA 1OG0A 4OHQA 3SI9A 2DZTA 1KFBA 3B0PA 3SECA 3S1XA 4DXVA 3S5NA 4ZVJA 1GJPA 3C2VA 1ONRA 1DL3A 1SSDA 2A21A 4O13A 2YDAA 1QR7A 1VLIA 1IIGA 2G5WA 1LORA 1XDMA 1TPB1 1MEIA 1EWEA 4RZ5A 1M7PA 3L5MA 1QPRA 4ALDA 1G7UA 1TPWA 4PEKA 3QQ0A 1XCFA 3NQ8A 3L5AA 1TTJA 3KX6A 5CPOA 4JNMA 3LX9A 3UZJA 4QISA 1QFEA 4DBEA 1FXPA 2O7SA 2DZPA 3FEMA 1JULA 1LBFA 2GVGA 5CZ0A 4JTSA 1XUZA 4UFIA 1TPEA 3LTSA 4UTTA 1RVGA 3KRUA 1TV7A 1DBTA 1LOQA 1GVQA 3W1UA 1NFBA 1IGSA 3MP3A 1AW2A 3T40A 4XQ6A 1F7BA 4FXSA 1EUNA 2VFDA 4QIUA 1KM0A 4ONVA 4HPXA 4HNVA 4O15A 3NL2A 2C14A 3MO7A 3HG2A 4OV4A 1VH7A 2AAMA 5HNRA 2NUYA 3GKFA 3DKLA 5FF0A 4JTUA 1JCXA 5D02A 4FIQA 4WZHA 2DZUA 3P74A 4MFDA 3E49A 5G2HA 3TQ0A 1A5AA 2TYSA 4O11A 2B7QA 3EWWA 4KFOA 3GKAA 3T7VA 4DELA 1PVNA 1EX5A 4I9AA 5HULA 3C3NA 2V2HA 1K8YA 1YXYA 2YZRA 1VYRA 2ZRZA 4JDBA 3S5YA 2B4GA 3W1AA 1TPH1 2BWGA 1ALDA 1OX6A 4EVZA 2RH9A 1KM5A 1FUYA 4LT9A 3MYOA 4QNEA 2X2GA 1KV5A 4JYEA 2A6LA 2CLMA 3G1YA 3QSRA 3LCWA 5HINA 3GR7A 3P82A 7TIMA 4AVFA 1Q45A 2HTMA 3VNDA 5U7SA 3MWAA 2V0TA 3PBUA 5GVJA 4H6KA 2EAWA 2TMDA 3U2OA 5DLCA 3NGJA 3TAKA 1YADA 4XBSA 3L9CA 1EB3A 2E6DA 5TBOA 2V30A 5FF7A 4MIMA 3FLUA 4BWLA 1YTKA 1NEYA 2NUXA 5BMWA 3TAOA 8TIMA 4BF9A 3NA8A 4TMCA 3BG3A 4L4LA 3G1AA 1H62A 2QJIA 3TW6A 1ML1A 3W23A 3QC3A 3LXAA 3NEVA 3GDTA 4TR9A 3UWYA 2BX7A 1W8SA 2KZHA 4LW7A 1EP1A 3W1TA 4GUFA 1TIMA 1TJRA 3W70A 4UR8A 4P2VA 1Q3NA 2NX3A 4UTIA 4PL2A 1JUEA 1TQJA 2XN1A 3PUEA 2C19A 3O06A 3W7IA 3FOKA 3TFXA 1SPQA 3DENA 1LP6A 5K3VA 1UUMA 1TPVA 2CLOA 1MXSA 2B7NA 1KBJA 2CU0A 1OF6A 3W74A 3TMQA 1RPXA 1WYIA 5AOUA 4NX5A 3S1VA 1ZNNA 3LCLA 4UTWA 1AK5A 3IEBA 1YDOA 5K9DA 1OK4A 3JS3A 1RD5A 4JX4A 4O16A 4ZQRA 4XZ9A 1TV8A 4JR5A 2Y7FA 4LV4A 3RLUA 4NNBA 1LM1A 3M5VA 2PE4A 5A8GA 1IIHA 1SUXA 4HSNA 1TPDA 2CLHA 3GDKA 1WAUA 1UBSA 2W6RA 5BRBA 5KMYA 1MEHA 3DZ1A 4UC5A 4HKPA 1XBVA 4IJBA 3G8EA 1P5BA 1YLVA 3P60A 1L6SA 3W85A 3L65A 4IWWA 2QF7A 5CGQA 4ICNA 3HO8A 4OU1A 2NV2A 2YW4A 3JR2A 2NUWA 4IMFA 4WXZA 3M43A 2Y6ZA 1S5WA 1OYAA 4N9EA 4O50A 4AXKA 1N7KA 1Q6RA 3CB8A 3TA6A 3UNDA 3TMLA 5D2TA 5I3JA 1CX9A 2DJLA 4FX8A 2VELA 4G1KA 2VFHA 1HG3A 1ZALA 2ZRXA 3GB6A 1QPQA 2YXGA 5FEZA 4HT3A 3P5ZA 2A7NA 4K7VA 4H4IA 4MFEA 1JJKA 1FWWA 2QCDA 4MYXA 1KM2A 4NXSA 3MI3A 2WV8A 1JCMP 1WOAA 1W37A 3OA3A 3EX3A 1C8VA 1ME8A 3P7YA 2ZZ4A 3N3MA 4IMCA 3W7OA 3BW3A 1D3GA 1OFAA 2Y61A 3EWUA 4BI5A 3IRDA 2ZRWA 2ISSA 2J24A 3N73A 3EXRA 4PH6A 3TQKA 1OABA 2ZBTA 4M6PA 1XDLA 4HHPA 1J2WA 4UCGA 2CW6A 2Y89A 2A85A 3TDFA 4KKXA 2P0OA 3KAOA 4O1AA 3Q2DA 1TJPA 1ZJIA 4JEQA 4AF0A 1OX4B 2ZZ7A 2NWSA 4ZQPA 1GTHA 4NU7A 3NM1A 3TX9A 4ZL1A 1N55A 4IPJA 1FY6A 3W7PA 3BW4A 2ZA3A 3QW3A 4JICA 1I45A 2Z2UA 1M7OA 4L4MA 4R7JA 3N34A 3F4WA 1I2QA 3HOJA 3WFAA 4BI6A 3FYOA 4OE7A 1EWDA 4LRSA 2ISWA 1TRIA 3DI0A 4GBUA 3LHYA 4JN6A 1C9DA 1TQXA 3WJYA 1GVOA 4JX5A 1R46A 5G4EA 3C2FA 2Z6JA 1ZAHA 4ADSA 4FNRA 3UD6A 5EA9A 3UY7A 4DEFA 4FXRA 2FPVA 3INPA 3TE9A 3TW7A 3TCEA 1F73A 1Q6QA 3A5VA 4ADUA 3KRSA 1DQWA 2XFWA 3STGA 1FWTA 2PCQA 4YWIA 1NAL1 2Q3OA 1GZGA 2ZZ2A 2JGQA 5D2XA 5AC6A 1JR1A 3O8AA 1QO2A 3R5EA 4GUIA 2QUUA 3TQVA 1I2PA 2EKCA 3USBA 2QEZA 1LOSA 1O94A 1O4UA 1VGAA 1OHLA 2OJPA 3W75A 2V5LA 3N19B 2VKZG 5D2WA 3HJZA 4O0ZA 1YTEA 3EX1A 2VEPA 3UWUA 2ABBA 5CZTA 2YFOA 3HF3A 1F76A 1LBMA 1MZHA 1YPIA 5D2YA 4BFAA 1PS9A 4LOCA 2E6YA 2FFCA 3WK2A 1GQNA 3DAQA 4N9DA 4A2RA 1TV5A 3W7CA 1CW2A 4UTHA 1F6KA 2Y62A 1G69A 3STCA 2QR6A 4XTDA 4PL1A 3S1WA 5BNKA 2NLIA 1B9BA 1PCWA 2CWNA 3TC7A 4Z1BA 3ZR4A 4E38A 3QZEA 3C61A 1WA3A 1SZGA 3CC1A 3P62A 3H54A 3LOTA 3UPBA 4PODA 2WSRA 3TSMA 3FKKA 3W7HA 4AWUA 4M19A 4AWSA 3A22A 1SR9A 1HO4A 3PY2A 1M6JA 2Y7GA 1OF8A 1JCNA 2ZQ0A 2DU2A 4OQVA 5DN1A 2B7PA 3NL5A 3C2OA 2HS6A 1OFOA 1T8XA 2DZVA 2X16A 4I7UA 1IXOA 3WJWA 3UY8A 4GE8A 2YSWA 4NZJA 4UTLA 2G97A 3LTPA 3B05A 4LVAA 4K39A 1B4EA 3TKFA 1O5KA 1TMHA 3FA5A 3M5YA 3W3OA 1QDSA 1FDZA 5CZJA 2GUUA 4FNUA 2WPBA 5DY2A 3OEXA 1VYPX 2CLEA 5KITA 3G1HA 1FDYA 2QCFA 2ZRVA 1XKYA 2ZZ6A 3QFEA 3BVJA 3N2XA 2NX9A 3THAA 5D05A 3M5ZA 1W31A 2QAPA 1BWKA 2V82A 4PA8A 5HWNA 4FHAA 3OVPA 3ABQA 2NV1A 1BWLA 5DCBA 2QKFA 3CIWA 2WQPA 3MHFA 3Q94A 3E9AA 1DQXA 1XBZA 3PG8A 4UR7A 5AHNA 2DZSA 3LV5A 5F2LA 1H61A 2ATSA 3BARA 1L6YA 3W2JA 4I7VA 4ADTA 4Q32A 5AB3A 3PM6A 3PS7A 3NQDA 4LVFA 1H50A 3LXBA 3L2IA 4ZQNA 1EP3A 1KTNA 4N02A 1Z48A 2FTPA 1VJIA 5L6UA 1V7YA 3DFPA 2A7RA 5I3GA 4JYFA 1OFRA 1GWJA 3M16A 3C52A 3LCIA 3U8GA 3KXQA 1H51A 3JRKA 3G3DA 4DF2A 2ZZ5A 3SZ8A 3A5FA 1NSJA 2QCHA 4LUJA 3QH2A 5HWJA 2X1UA 3NPVA 3BLEA 2E6AA 4XBKA 5U4NA 1XBYA 4NX0A 4OGZA 5TIMA 4HN4A 1ME7A 2YGYA 5EPDA 1OFEA 5I3IA 2ZTKA 1XUUA 4GRSA 5AHEA 2V2CA 3MYPA 3G3MA 4WXYA 2VC6A 3L67A 1JCLA 2C13A 4GXMA 2QCGA 3B4UA 3EWYA 5EYWA 3TROA 4DPPA 1PV8A 3O6CA 1RV8A 3EWZA 3CEPA 4IMEA 1W5MA 2NXHA 3I7SA 1FCQA 3G8RA 2CFFA 3TC6A 5LSMA 4AH7A 3CEUA 5DCEA 1H7RA 4TIMA 3W1LA 4S1FA 4N6EA 1GT8A 1OYBA 3ELFA 3LDVA 3EXTA 4WOZA 3KVJA 3EEGA 1SW0A 3MP5A 1OK6A 3W1QA 5L9FA 1XL9A 5CPMA 1THFD 1LRQA 4WOQA 3QQ1A 1VYSX 4WD0A 3BLFA 3IGSA 2O7QA 1KBIA 3QMSA 3LHWA 1S5TA 1K3UA 2ALDA 3KVLA 1KA9F 1QWGA 2FIQA 4LC8A 4ML9A 3BGGA 5F2IA 4S2BA 1RQEA 5K9XA 4TU1A 4IQLA 4AMAA 2A0NA 3DFSA 2QAFA 1G4EA 3N9SA 2ZYFA 5F1VA 3MHGA 1H7XA 4EIVA 3L66A 1KLZA 3ANYA 5LNWA 3NQMA 3WK3A 3MP4A 4UTMA 5DXYA 5BOOA 1KLYA 4GUHA 4TMBA 4Y9AA 1BKSA 5D2VA 2FJKA 4XUGA 3W1MA 2B7OA 3QF0A 5KINA 1U5JA 4IOTA 2ZZ3A 3EX2A 1FCVA 5EBUA 5H91A 4DBDA 1YDNA 1W5QA 2OT1A 1GEQA 5FF4A 2FB2A 4Z08A 5F4XA 4LU0A 3SR7A 2FB3A 5LNVA 5E93A 4R33A 1ICSA 4LVBA 4O52A 4M5PA 1JVNA 3P67A 1KW1A 5K7JA 3S8HA 1DVJA 5DXXA 1OVDA 1LTDA 3HGSA 3QW4B 3R8RA 5EMUA 1GYLA 2FPTA 4JD4A 2W0UA 2C16A 1JRCA 1GYNA 2WO5A 4NJGA 1XXXA 1EUAA 1Q6OA 3HGRA 3LI1A 4MJMA 4KWVA 3W86A 5G4WA 2Y85A 3MUXA 5AC8A 3LB0A 4JTIA 3RMJA 2ZZ1A 3SJ3A 4RK8A 5IBXC 1VR6A 2JGYA 4UFHA 2R8WA 1VZWA 4GUJA 1VS1A 2H8XA 3W22A 1X7FA 5KZEA 4JS3A 4UIOA 5KZMA 3MW7A 4YCPA 2QJHA 4LVDA 4O19A 5G1YA 1BTMA 4RZ4A 2JBMA 3E0IA 3NAVA 4N4QA 1FCUA 3ZWTA 2BTMA 3QPYA 2NZLA 3IIPA 3V75A 3LBCA 3W07A 3S0CA 2OZ0A 1P4CA 2FDSA 3NPXA 2QCMA 2RDTA 4AHOA 4IXXA 1Z44A 3M7WA 1QCWA 2PRMA 4FO4A 2FLIA 4LTSA 3S42A 4AWTA 3C2RA 5KSWA 2OMAA 1LLWA 5AHLA 1DKWA 4K38A 1LOLA 1L6WA 3GLCA 5DCDA 3CU2A 4M6QA 3RNDA 4XKYB 3W7GA 5KTLA 1WBJA 2WOQA 1T0OA 1J4EA 1KTCA 5DY3A 2QCLA 4Z0JA 4TX9A 1U83A 2WJZA 5KZDA 4QAIA 3GXTA 3B0VC 4WY0A 3L0KA 4O10A 3EX6A 3HG4A 3IIXA 3IIVA 3W2UA 1I2OA 2X30A 1FXQA 2F84A 3S5ZA 4NJKA 6ALDA 5K4XA 5J5DA 3YPIA 1VHCA 1W5PA 3M44A 3BW2A 2V2DA 1XC4A 3NDOA 4M6VA 4JTKA 4MY9A 1AL7A 3K30A 2AQWA 4UFKA 3GZ3A 3NQ6A 1JUBA 3VFLA 3DBPA
chains in the Genus database with same CATH superfamily
1VHNA 3S83A 3OODA 4C6IA 3ISIX 2LLEA 3OZPA 1J2BA 2YX0A 3A23A 4Q6JA 4Q8VA 3ICJA 2YDQA 5A6SA 4K68A 3DKJA 5M17A 4C6FA 3TYAA 1LLOA 1LLZA 3RRAA 1G1YA 3GVVA 1M04A 4J2MA 3I3DA 1NWTA 3GAKA 1AW1A 3WQVA 3TFCA 2H9AA 1RSCA 2CITA 3M0JA 1OFPA 1J5TA 4ATLA 2OZ8A 2JK2A 1Q6LA 3F03K 3IVSA 2ZA2A 1JNDA 3IIOA 1KM4A 3W83A 3BQ5A 2C71A 3G0SA 3VUSA 2BHZA 2PRHA 4D71A 4LEFA 1TV3A 3DHDA 2DT2A 1X96A 3HG3A 4MYAA 3RGTA 1AW5A 4GXWA 2XPKA 2PTZA 3MKVA 4JOMA 3MSYA 2O9PA 4R53A 4KEMA 1GONA 3EOLA 3UWWA 3P3BA 1ZQ5A 3FK4A 4JIRA 1NF0A 1BXCA 1DWGM 2OLSA 3C2EA 2XSBA 1REQB 3TYDA 1YDYA 4IP7A 4PMOA 3ZJ7A 1I6NA 4H8VA 2V3DA 4F66A 1TA3B 2TPSA 1RQBA 3MHUA 3L4ZA 3L23A 4LS2A 2E77A 4A21A 1J0JA 4HN8A 1M65A 3PBGA 1DJHA 1UYQA 2IQTA 4ACZB 2UBPC 4GWEA 3B8TA 4LALA 2BHUA 1ZY9A 3TZNA 3WJSA 5C9UA 4J2PA 4GVIA 2Z29A 5HQEA 2DJXA 1US0A 1HKVA 1GZ1A 1E4NA 1NDYA 4KW2A 4MZ8A 3F1QA 5F2MA 5HUPA 2WANA 3L0GA 3WNMA 4QJ1A 2PTWA 1Z41A 2OPJA 3ABXA 5CZKA 3ZMRA 1EA0A 3PWIA 1KQYA 2AGTA 2YYUA 1E71M 2R24A 1RA0A 3EX4A 1Q2SA 4GGBA 5D37A 4D6IA 3VOHA 3KL3A 3DX5A 2A6NA 4MVAA 4D6DA 4AISA 3ZFHA 3IJLA 4XISA 1XIIA 3W26A 3AJXA 1FHUA 1SJDA 1H5YA 1EBHA 1ZAIA 3I65A 4QITA 3OLEA 1ONEA 4AEFA 1XSKA 4JTDA 2XGZA 2CLPA 4KH2A 1GJUA 5LXXA 4MB5A 4NIRA 1DJNA 4K6AA 2C79A 4FNPA 1VCGA 3BCFA 3GU2A 2PGWA 1UUQA 4XD3A 1TO3A 2PU0A 3RU6A 3VCRA 2BY1A 2W61A 1SMAA 4H41A 3WLSA 3KW3A 4CNPA 1FP8A 3CTLA 1QHOA 1Z6KA 4JFUA 1MDRA 4UWMA 1OFQA 1QOQA 1Q2RA 4W86A 4D6GA 3LLFA 1Q66A 4GVGA 4GGHA 2QCEA 3CZJA 3WMBA 3O63A 3LTYA 4O53A 3NGFA 1J6PA 4AHPA 1NDWA 4E8DA 2J6XA 4BEUA 2PC4A 4YPJA 1CENA 1UW9A 2HRWA 2PLKA 2OYMA 2BASA 3VDBA 4Q8QA 4HIBA 4FS9A 3VKAA 4Y9NA 4LF1A 4YTSA 4OWGA 2YCIX 4NNCA 4NJHA 3T8LA 3BV7A 1DORA 1B90A 4LSBA 4W85A 2OWXA 3MZ2A 2GGIA 1HL2A 3VTRA 3ATZA 4H1ZA 1AMKA 1TTPA 3ZO9A 2YIHA 5A2BA 1GOWA 2W4XA 3LBMA 2AAAA 3G0UA 1OX4A 4F8XA 4IMGA 1FWNA 1B3WA 1LWHA 2V63A 5FJTA 4FA3A 3BCJA 1B57A 1GVFA 3U3HA 4Y9MA 3CLWA 4GJ1A 3R2GA 3LBOA 1TUXA 1ODUA 3Q45A 5HA7A 4IF2A 5CPLA 1H41A 1QI3A 1US3A 4LY8A 3VD9A 4MKSA 5A3HA 1G67A 1TB3A 2V5CA 5GNXA 5CZSA 1NVMA 3L12A 1S46A 1AJ0A 1QPNA 2IPWA 3GTXA 4FPSA 4NVTA 4L6OA 1EDGA 4C65A 2I17A 1R3VA 4Y90A 2IPGA 4GNKB 2A3AA 1E1CA 3CGTA 3B04A 3KOXA 2J4GA 3W1RA 1DJQA 1IXQA 3GVGA 4GQ0A 4FLRA 2A3LA 3GC2A 4HQVA 2Z1XA 4QG8A 1UH4A 1EJWC 3BG9A 1UIOA 3CIXA 2W67A 3LGEA 2PP0A 2NSXA 4DZHA 4O57A 4R85A 3A3XA 2XUCA 4C6QA 2TRSA 5DFAA 3D3FA 4HBKA 5E9XA 4O4VA 3GD6A 4LX4A 3PPCA 2VR5A 4HYVA 3RM8A 4YWSA 1UR0A 4ZZ9A 4MPKA 2I7GA 2PDPA 4ZBCA 4ZFMA 1GG1A 4CN1A 3G1VA 4UFJA 2WM1A 1G4PA 1W9VA 4AD1A 4CNSA 4FIRA 4G7EB 2F7FA 2VMFA 3CUJA 4IIEA 4JIPA 4MPQA 3UCCA 3LG3A 2Z00A 3CUHA 4LS0A 3BAYA 3MKCA 1H60A 2WVVA 4GC3A 2G4JA 3W81A 1VKFA 3HBLA 3ZXWA 4B15A 3O0KA 5K4ZA 2CZFA 1E5JA 4ASTA 4IPIA 4CD5A 5CAKA 1P0BA 3MSDA 4S3KA 4LYPA 3MMWA 4KCTA 3W71A 1J96A 2DZBA 4YMZA 1V0NA 3HFTA 4XTIA 4BZYA 2XZ9A 3BSHA 1W17A 4UZUA 4PC8A 3RUBL 1FA2A 1VEOA 3UJEA 1KV8A 3E0WA 4GYFA 5TQLA 1PKLA 3ME3A 3SB0A 3W7NA 1TMLA 3CIVA 5A6BD 3CMJA 2WVTA 4CQ9A 5GNYA 2D0FA 4DXKA 2BBFA 3NZPA 4F0RA 2WNNA 4I9TA 4Y8FA 3WUFA 1XLEA 4HMCA 4P61A 5MF5A 2R14A 2WJFA 2AOSA 4J5NA 3CZKA 4LAUA 2PLMA 5A6BA 5HPCA 2V38A 3M0LA 3ZWSA 2OT0A 3GDRA 3F4VA 4RZ6A 3NL3A 2E9LA 2DZWA 1Z3NA 1S3HA 3H6OA 1RZMA 2I1OA 1JPHA 5CGMA 3MBFA 4U4MA 3SY1A 1UH2A 2ZUMA 1UWSA 2FGBA 2ZIDA 3LM7A 4C6BA 1XLJA 3BXWA 1I4NA 3BG5A 1AG1O 3OQ8A 1K02A 3HGOA 1GOIA 2J13A 4RNIA 2E09A 4WDXA 1HJVA 1D3HA 5JBFA 3ABSA 5ENLA 1Y5WA 4BF7A 1HL8A 1F2JA 3ZR6A 3EMCA 2VZOA 3VVGA 3A4JA 3UR8A 3B3DA 4P8WA 4Q4RA 1KGXA 3C2YA 1RJPA 2X1RA 3IGUA 3FY1A 1JPKA 3C86A 2WMIA 3LHZA 2ZXAA 2QPXA 4PMDA 1Y7VA 1UWQA 5IDIA 5FA5A 3HPZA 3CT7A 2Z1WA 3RFAA 3W29A 2OCZA 4QDWA 1UWRA 1G4TA 3KWSA 3W72A 3NR0A 1WDSA 3QR0A 4IX2A 4KPLA 1TWIA 1DOSA 5JQ9A 1MUWA 1AL8A 1BQCA 4A3YA 3LPGA 5A8OA 1WZKA 3GTNA 1UASA 3VM7A 1WO2A 4H3DA 5CPTA 4UNLA 1MFVA 1PAMA 1MMFA 1FWSA 2CBVA 1RUSA 1DTUA 2SFPA 1A4MA 2VDHA 1G7VA 3GXIA 3TH6A 3ZYZA 1P1XA 3UXAA 1CNVA 2PTDA 1SJBA 1Q6GA 4NP7A 3DIPA 3E2QA 3E02A 3S5SA 4DN1A 4ECLA 1ITUA 4AMCA 1A49A 4G5DA 2Q8LA 3DFOA 2CLLA 3WQGA 4KT2A 3S1GA 3WCZA 3IIZA 3AXIA 3W4RA 4PTVA 3EWCA 4MWAC 2WKLA 3OGSA 3LHUA 1W3IA 1UR3M 4D8LA 3WQ5A 1PDYA 3TJLA 2DZXA 1QJWA 1LCOA 4PTDA 5G2WA 3S46A 2ZUTA 2QT3A 4GIEA 3G22A 4LS1A 5AY7A 3HV8A 3TU9A 1UKPA 5FEWA 3OHMB 4C7GA 5FSEC 2IQDA 4L6DA 4QXIA 1SW3A 4ML4A 3LUTA 3DGBA 3J7HA 1HO1A 5HBFA 1RQHA 5AN7A 1XS2A 4PCNA 3W27A 4QBXA 4J27A 3WH7A 3E0FA 4S2CA 2GQAA 4LH8A 1FBAA 2GDVA 4H19A 1NARA 4EWND 2QMJA 1BFNA 3KRZA 4N9CA 1XLLA 4XD5A 4JTTA 4YTTA 1LBLA 2X1SA 1SO6A 3I10A 1CGYA 4AY7A 3T8QA 2VGGA 4Z2LA 1TIWA 1RJQA 3V7PA 1MI3A 4LANA 3B06A 3UR2A 1WCGA 3DGRA 1BD0A 4YXGA 1VCVA 2ZDRA 3GR4A 1QUMA 1SO5A 1JDCA 5CSRA 2R82A 1P48A 3L21A 3QR1A 4Y6GA 4P7QA 1BGGA 4GZIA 3S9IA 1F3EA 3CXOA 2VYOA 1ME9A 2OZTA 3PZMA 4HMDA 3BV4A 1YEYA 3MUAA 3KTCA 4JCLA 1Q6EA 3WLPA 1S38A 2Y7DA 1F6PA 2CLFA 2RDUA 3PSVA 4GUGA 4DO6A 4POCA 2RHGA 4F2TA 4D1JA 4RV3A 1VBJA 1KFWA 5XIAA 1FWBC 1R7OA 4XZMX 4V27A 5D9NA 3AHZA 4JTFA 1SO3A 1GYMA 1XQLA 3FXYA 4E4PA 4W89A 4GNJA 2DUZA 4HNNA 3AZSA 3QY7A 4W8AA 2NVDA 3EKGA 1UP0A 3O15A 3RF9A 2IKHA 4W93A 3QSTA 4BA0A 2VP8A 1XLDA 3SGGA 5JH1A 1BPLB 3STEA 3KBJA 1OJXA 2WZTA 2ZXDA 1XFBA 3IV8A 3M6YA 3O6YX 3BDKA 4EF9A 3GXNA 5M1TA 2FYMA 4PBFA 1Y0EA 2HVNA 1SFLA 2VR2A 4ORMA 4G1NA 5I07A 2ZRUA 4US5D 1R38A 4AXNA 3H2CA 2PD9A 1F3TA 1XISA 3W6LA 3GZAA 1WV2A 2J7DA 2ISDA 3ARSA 2P76A 4US5A 1Q5MA 2XIIA 2WZIA 1XRVA 2F61A 4ZVJA 1GJPA 4GVHA 1DL3A 1ONRA 4DWSD 5FACA 1HW6A 1IIGA 3MVTA 4NAEA 1MQRA 2XWEA 2C8NA 3OBEA 4RZ5A 4U3AA 2XIJA 4PEKA 3LQLA 2D24A 3QQ0A 4PMRA 1ZSXA 3SCRA 1HP4A 4PUUA 4DBEA 4DWSA 2QLYA 4IIBA 4JHMA 5DANA 1LL7A 1KCZA 1RVGA 1TV7A 5LIUX 5A8PA 1RJRA 1Z69A 1UZ1A 3MP3A 3GVRA 4JBRA 2XFYA 1HJWA 4IPLA 6PTDA 4QIUA 2CCRA 4O15A 4ZTXA 2QDDA 1VFFA 1KRAC 3EDKA 4ENLA 4LXFA 3OGRA 2NUYA 3AIBA 3DKLA 5FF0A 3AZTA 4E3VA 3UVIA 1J01A 2EO7A 1OADA 4FIQA 4OKDA 2WPGA 4AX7A 1JDDA 1X6LA 2UZ9A 3P74A 3E49A 4L1XA 4O11A 2B7QA 3UCQA 3AXKA 1PVNA 1EX5A 1TCMA 4JTRA 1WKDA 3B8VA 3UZZA 3K8KA 2ZRZA 1Q6FA 3AIVA 1PZ3A 2PF8A 4MG4A 4L1GA 1B1YA 3AYSA 1ALDA 1OX6A 4EVZA 1KM5A 3TC3A 3CHEA 1GZJA 4LT9A 1ISXA 4AIBA 3I3BA 4AZIA 3MYOA 2A6LA 2AL2A 2CLMA 1VENA 1ELSA 4GI9A 2YBVA 3GR7A 2HTMA 3VNDA 5U7SA 5MKGB 3PBUA 5FJJA 4H6KA 4QLLA 3U2OA 4MAVA 3U5YA 3L9CA 5TBOA 2V30A 4PCSA 4BWLA 2DQXA 2NUXA 3TAOA 2DVTA 1KXHA 8TIMA 1PWLA 3NA8A 2XH7A 3A3WA 1GUVA 2C0HA 4DUXA 2QJIA 1UC4A 3SFWA 3QC3A 1E1FA 4XD6A 3LXAA 3GDTA 3UWYA 1W8SA 3LM3A 3W1TA 4GUFA 4UR8A 3ITXA 2NX3A 2PEVA 1JUEA 2R9RA 3FVDA 1SPQA 4GO8A 3DENA 1LP6A 2OZ3A 3SCVA 2P3EA 4AZ5A 3SY8A 1KBJA 2JFEX 1KWKA 1OF6A 1Z89A 3W74A 3G1RA 3TMQA 3VD7A 5DQPA 4NX5A 1ZNNA 1AK5A 4G6CA 4RPQA 1OK4A 4ZQRA 4JX4A 3TZFA 2IPJA 3ITVA 4DLFA 4IIGA 1LM1A 4YS1A 3BJSA 5A8GA 1QI5A 1TPDA 3RPDA 1NTHA 2W6RA 2JIEA 5DT5A 5BRBA 4UC5A 1XBVA 3G8EA 3W85A 4KIEA 3L65A 4IICA 2QF7A 4OU1A 3UVAA 1IQ8A 4J1OA 2Y6ZA 1S5WA 1OYAA 3CUGA 2XM1A 3GH7A 3LSCA 3FGCB 4X0VA 4HJWA 3TMLA 3N6QA 2Y5SA 1CX9A 3I6EA 3VGHA 4AZGA 5DMNA 4G1KA 3N6HA 5HDRA 1ZALA 3GB6A 1E56A 3N18A 3WENA 2YXGA 5FEZA 1MWOA 1EDQA 4WDWA 4UOQA 3AMKA 1EC9A 1JJKA 1FWWA 3FVMA 4OVXA 1VFUA 3L4YA 4NXSA 1XH1A 6XIMA 3ID7A 2EJ1A 4TV6A 1NY1A 1EGZA 4IG2B 1FVPA 1W37A 3FAWA 1OD0A 4F0SA 5BXSA 3P7YA 3N3MA 4IMCA 3BW3A 2ZRWA 1QBBA 3TQKA 1JFXA 2OO0A 2ZBTA 2CW6A 1TFVA 3FA3A 2P0OA 5TD4A 3Q2DA 1RVKA 1UZDA 2GK1B 1HXJA 1N55A 1J0IA 4IPJA 1D7KA 2HK1A 2ZA3A 4UQ9A 1I45A 2Z2UA 1VFSA 2WCGA 1M7OA 4R7JA 2V69A 1I2QA 3HOJA 3FYOA 4JN8A 1Y8BA 1AJ2A 2ISWA 5FL1A 4O8AA 3DI0A 1BYDA 4TVUA 1A0EA 1N82A 4JX5A 1VBHA 4FNRA 3RHGA 3UD6A 3UY7A 3LPOA 3TCEA 4J35A 3N4AA 3EGJA 1DQWA 1XG3A 3VOCA 3QOKA 3EAUA 4DJFC 1GZGA 2WM0A 2QUUA 4BQ4A 1I2PA 2Y0FA 2AKMA 3W75A 2FZ8A 3AU2A 3N19B 3K2GA 3OYXA 4QSFA 3TN5A 5D2WA 3STPA 3HJZA 3L7RA 4PTWA 1MZHA 1YPIA 3ZVHA 3UGRA 4LOCA 2BDQA 3WK2A 3EMZA 4F2UA 1YNYA 1IZCA 1SMDA 4XO6A 1E40A 2FGZA 3DERA 2PBOA 2XFRA 4UTHA 1F6KA 2Y62A 4UNIA 3U2EA 1UD3A 1KBBA 4JNYA 1JDFA 5C0QA 3FYYA 2RGLA 2WMHA 2PWUA 3KL5A 4LNCA 4DBSA 1YE6A 3M0HA 4DNHA 2Y1HA 5FJPA 3TC7A 4Z1BA 3GFZA 3RJXA 1B30A 3E2SA 3DC8A 1WA3A 3T0DA 3CC1A 4Z17A 4AIEA 1E9IA 2WSRA 2ZWZA 4ZODA 4DJDD 2Q02A 1HO4A 3F2DA 1ZU8A 2OSYA 4UOZA 3NWRA 3F2CA 5C70A 2E9BA 4GFIA 1PKYA 4QTGA 4F0LA 2DZVA 1IXOA 5FKYA 5D8WA 2BP1A 3BTNA 4DJDA 4LBRA 3AJ7A 3NUKA 3VNIA 1B4EA 2F8QA 5FJUA 3UBPC 3FA5A 1F8IA 1ZBVA 4IQEA 3UG5A 1NQKA 1OT2A 4GNVA 2GUUA 3UW6A 5BU6A 1N8WA 2YXXA 1JIBA 1VYPX 3P0XA 5I02A 5BXTA 4N7QA 2QCFA 1RA5A 4ERIA 3BVJA 1AFSA 3S2CA 3M5ZA 1QW8A 1BWKA 4PA8A 2V82A 3M6DA 3N1AA 5AECA 5HWNA 3OVPA 2OSWA 1LJYA 1GHSA 1B3XA 1BWLA 3CIWA 4W5UA 3VPLA 2E7FA 3Q94A 1XBZA 4UR7A 5AHNA 3QVQA 2DZSA 3RO6A 1OC5A 2X7VA 1S1PA 4ADTA 4H00A 2Q01A 3B0YA 4LVFA 1H50A 3QTGA 3LXBA 1BYCA 2EBNA 1KRMA 4N02A 3UA3A 1XPYA 2XH2A 2ZUNA 3DFPA 2A7RA 4S39A 1QNRA 2GVEA 5HQLA 2G4FA 4DF2A 4ATDA 2HPMA 3SZ8A 3LYEA 2WQDA 1C8YA 1W1TA 2DY3A 5HWJA 3BLEA 2E6AA 4OGZA 5TIMA 2B81A 3W0KA 2YGYA 4IFKA 4AQLA 1TG7A 3HU7A 5I5RA 5AHEA 7ODCA 1KKOA 2VC6A 4WXYA 4GXMA 5CAHA 3TROA 3WF3A 1NOWA 2J7BA 5H8UA 1NFPA 1NJJA 1PYFA 1H49A 1W5MA 3KTSA 3I7SA 2CFFA 4ZSTA 5HXMA 4TIMA 3W1LA 4S1FA 2XU2A 3KVJA 1SW0A 5L9FA 1XL9A 5CPMA 1THFD 4WOQA 3AS2A 1U1JA 1RD6A 5AVNA 2FVKA 3BLFA 2O7QA 1KBIA 3R10A 4V15A 2GGEA 2BY3A 2ALDA 3KVLA 4CD8A 4LC8A 4ML9A 5ABFA 3B4YA 3PZIA 4E8CA 4S2BA 1RQEA 1MZRA 4K2SA 2PU1A 4DYKA 3KRBA 4IQLA 2GDQA 1LUCA 5F1VA 1NOFA 4EIVA 3L66A 1S2AA 3BC9A 3USZA 4FSAA 3EPNA 3UR7A 2XZ7A 2XGBA 4AZHA 4F48A 5HAOA 3B9AA 4HCLA 4XUGA 3NIYA 2B7OA 1MNZA 3GTIA 5CBIA 3QF0A 4C6KA 3ECQA 3WNPA 4XSLA 4L9XA 3UESA 4DBDA 4FAMA 3WDIA 3SR7A 5F4XA 1ESWA 1UPPA 2POZA 4O52A 3ES7A 2ADAA 4XAYA 1KW1A 1POJA 5AKQA 2IKIA 3VILA 4Z2GA 3WBWA 1TWWA 1WXZA 2FPTA 4JD4A 3UXKA 1Q6OA 3E1F1 2EPKX 2HXUA 3OBAA 5G4WA 1JG9A 5I2UA 1EC7A 4KBXA 3NOYA 2EPOA 1JCTA 2ZZ1A 4RNHA 1E43A 3T2QA 2HK0A 1P6BA 3V0UA 2H8XA 2YJQA 2PDNA 5KZEA 4JS3A 2OEKA 3FXGA 4QJ5B 4M24A 4O19A 1R3WA 1BTMA 4AD3A 3WFZA 3NAVA 1JYXA 3R43A 3QPYA 3V3WA 1IWBA 1TE1A 3LBCA 4AZCB 3S0CA 3POHA 1MVYA 4AU0A 3NPXA 2QCMA 4ZR8A 1LF1A 3M7WA 3S42A 2FLIA 3LK6A 3C2RA 5KSWA 3WQPA 4C6EA 2OMAA 1LLWA 3KOWA 3GLCA 4M1RA 5DCDA 1V6VA 2BVTA 2Y5EA 2WZHA 5BOEA 3CU2A 4M6QA 4DLMA 4XKYB 4LCSA 3CHDA 1MNSA 1WBJA 3TWAA 4ERGA 3MTWA 1XIGA 1KTCA 2QCLA 3CQHA 2WJZA 3OJGA 5KZDA 4QAIA 3GXTA 1CXHA 1JZ8A 3TYUA 4EX4A 4PCTA 3IIXA 4HK6A 5BXPA 3W2UA 1I2OA 2X30A 4IHCA 4LUSA 5K4XA 4F79A 4EAYA 5IRPA 5IFTA 1P6CA 1VHCA 1W5PA 4I6KA 1XC4A 1TE6A 4JTKA 4XZHA 1AL7A 1CGUA 1JPMA 2Z2BA 3GC5A 2XTKA 3GZ3A 3HTWA 3H8AA 3VFLA 3DBPA 2ZX5A 2BY2A 3FA4A 1AH3A 3ZJKA 2OKOA 1OCBA 3N4FA 2YCEA 4W8LA 3IJ9A 4GI6A 3BGJA 1CYGA 3M5XA 3QHMA 3S47A 2CIPA 3QEZA 1H7WA 3CPGA 2YLAA 1GK8A 1TTQA 1XRTA 1PTDA 3T4CA 1XLBA 1TX0A 3UJFA 5IXEA 4ZQOA 3H53A 2CLIA 2VC5A 3PBMA 3APYA 1EPXA 1T8QA 2WW5A 1FKWA 4DRSA 1UD8A 3W6YA 2OEMA 4L6HA 4M29A 3HPAA 4JTGA 3A9IA 4XG1A 4PUKA 4XAGA 3IUHA 4JHZA 5DT7A 2QJMA 2A5HA 2ESCA 3F5JA 2BY0A 3LCXA 4HU0A 1UJQA 3RJYA 2GFTA 1EPVA 3CV6A 1UIPA 3HJEA 3DYPA 3PZ9A 1W56A 4GQRA 3WLKX 3NZ1A 1EGMA 4C7FA 1VJZA 1XGZA 1FWRA 3ZSSA 1UR8A 4UTTC 1VQTA 3FAXA 1EO7A 3KDNA 1M41A 4H83A 4MJ2A 2O4QA 2QGYA 1J10A 2I5QA 4DJED 2QDGA 2BVDA 2VWSA 4AD5A 4JIHA 1I0DA 1CPUA 3ARTA 3T81A 1RLDA 4B90A 3BICA 2E6FA 5A5WA 2HV5A 3WH8A 3CWNA 2DGAA 2HSAA 4DHGA 2GJRA 7TAAA 3AO0A 2HVMA 2EF9A 1A5MC 3ABOA 4LY4A 1W2VA 3G6LA 4DJEA 2ACUA 3F4DA 4K36A 5AZ0A 2DT1A 2REQA 1ZENA 3E74A 3WD0A 2QCCA 1DIDA 3EKLA 2EG7A 3VC5A 4DB7A 1S2VA 4INFA 1OFDA 1SW7A 1TTIA 1Q13A 2BOFX 4S38A 3UR5A 2O92A 3SRKA 3W02A 1IT0A 4A3UA 1PZ0A 1A0CA 5JBEA 4W88A 3W2MA 6CGTA 2DUXA 3NOEA 2WLYA 5A6JA 1NIUA 4JFWA 4DUOA 5FSDC 1D2KA 1J79A 5EFDA 1R86A 4Z2KA 5AHIA 3TIMA 3W38A 2PWHA 5I09A 5C9RA 1B2YA 2AMXA 3VI2A 3RITA 3T44A 1QPKA 2IQ0A 3KDOA 1B4KA 4NJJA 5AVHA 4FI4A 3GXDA 3QMTA 3CAWA 2OKTA 1K7EA 1KRCC 4XZBA 1M01A 3E38A 1W3NA 5SWUA 1L8PA 4NQ1A 4Q33A 3AHYA 4I6VA 1VPXA 3PN8A 3NQFA 4JEJA 1X1OA 4B5NA 1X1NA 1WDWA 4WKFA 1TJ2A 3WZ0E 4U31A 1SZNA 4US6A 4HJFA 4J3SA 4UXDA 2NW0A 1CT5A 2Q09A 3FX4A 3LRLA 2PDWA 2V8ZA 1QOXA 2OYLA 1Q4WA 3B9DA 3C8NA 2BS9A 3S1UA 3EA1A 4KFPA 4LWWA 3SN0A 3WLLA 2CZEA 4FX7A 2YZ5A 3RRXA 3DHFA 2A7PA 1R9ZA 1V3JA 1SGJA 4WEVX 1UZHA 4ZXOA 2P1FA 1K1DA 5D4YA 1J11A 1U5VA 4PCFA 3DFQA 4GINA 1HFBA 4Z1DA 3KCOA 9CGTA 3TTOA 3LXCA 4GIAA 4X3ZA 5LGXA 3T55A 2C15A 4BKNA 1CGVA 2Q8ZA 2VFFA 3PJXA 4O1BA 3HA1A 2F2KA 1VP5A 4EPEC 4IP5A 4A29A 1AH0A 2NX1A 4G9PA 3UG3A 1MYRA 4HOZA 4OBRA 3DI1A 3VKBA 3GHRA 1Q65A 3AIEA 2QCDB 1NWSA 4JX6A 1JXJA 4HA0A 4H6QA 1K03A 3WG6A 2QUMA 3P80A 4NAFA 4QCEA 2OR2A 1PE1A 1BXNA 5ABTA 1GTEA 1ONWA 1ZAJA 3GR8A 3UWVA 1EX1A 4S3AA 5BW6A 4HK5A 2DW7A 1C91A 2FGLA 5I00A 1L0PA 2G96A 1D3CA 1H7PA 3KZSA 4DYJA 3V0TA 1ADOA 1LZOA 2J7GA 1XM3A 5I3FA 3IGXA 2QDHA 2E5CA 3C0SA 3LCFA 2X42A 3TN4A 5D03A 1LL6A 1R0MA 3KHJA 3THCA 2VDGA 3IV3A 4AC7C 1VRDA 2R1MA 4YIWA 2X1IA 1UMYA 1H63A 4B5SA 4PMQA 2PWGA 3QV6A 1B3OA 1ZP4A 2B31A 4NI8A 3PBYA 2YCLB 1WAWA 1K8ZA 4JYDA 1BYAA 3G1FA 3QZ6A 5T9CE 4DF0A 4WDTA 3AUOA 2QJNA 4JQ4A 4K7YA 3THQA 3W7KA 1E73M 4LBSA 3GDMA 2Q71A 4XWUA 2QJGA 4JQAA 1GOKA 3CK5A 4REQB 4RDYA 1ZBCA 4H01A 4YTRA 3IJ6A 1XHGA 5D9OA 4W87A 5CC5A 3B9NA 4C6PA 2ZVRA 4EACA 1EGVA 1KFJA 3QTPA 3AHTA 5AYYA 3LRMA 1MW0A 3WQWA 4LB3A 4RX0A 2RFGA 2CLKA 3PVFA 3A47A 3NSMA 3AYTA 3W7LA 4AHQA 3TP4A 3S9YA 1S3TC 4F2BA 4WX2A 3DFTA 4JY8A 3NYZA 1A5UA 4K37A 4FMVA 1XICA 1XIDA 3QHOA 2INFA 1SZFA 3OLIA 3RX2A 3AXHA 3VGGA 3TJXA 2I14A 1W9BM 1GW1A 2YDSA 2Y88A 5FEPA 4RPPA 4HNUA 1JZ2A 1R87A 2IXUA 3CWOX 1XIEA 3LPFA 1W1IE 3AAMA 3EPOA 3LV6A 1A50A 3ZT6A 4ZGYA 3NQEA 5REQA 3I6RA 4RCXA 1OZMA 2WCAA 3VIKA 3LZ3A 4JTHA 3KP0A 1EJSC 1VF8A 1W9DM 1QASA 4X2RA 2V81A 4YTUA 2BG5A 1CZ1A 3NO1A 4Y96A 1UHVA 3R0KA 1R3TA 2BLEA 4BK9A 3PWAA 3GNDA 3TV8A 4FLOA 3FCPA 1UOZA 3AS0A 3U6WA 5BYWA 2MUCA 3FSTA 4RE0A 3OHIA 1WQ5A 3N25A 4UFMA 1WZMA 4NYYA 4N42A 4A3HA 3QN3A 6REQB 3QBUA 3W7MA 4U10A 3BURA 3OG3A 3MUZ1 3WLHA 1FWEC 3VCCA 2J7HA 4ZB5A 3PB0A 4D8AA 4CCEA 2RDWA 4QRNA 1WKYA 2CZVA 3DHPA 3HPFA 5CC3A 4WSJA 1IR1A 1JI2A 3P84A 3GNOA 4KQNA 2E67A 7ENLA 4M6UA 5LIWX 3KBSA 3TK7A 4O12A 4XAPA 1QNPA 3NSXA 3HMJG 3WBAA 4PFMA 2H3BA 2HMCA 2DIJA 3C3UA 3H21A 5E0FA 3I3EA 1UP2A 4QDPA 4XKMA 5CLWA 2Q8XA 4FF7A 4KGJA 2YBUA 3EXSA 3O0FA 2NQ9A 2DH2A 1A5CA 1YYAA 1QAPA 3A64A 4GFSA 1ZBWA 2PUZA 1CEOA 5DBTA 2ACSA 3PJTA 2H6RA 2Q6ZA 2Y70A 4HHMA 3NL6A 4YYFA 3TCSA 1UR1A 1KFEA 3R8HA 3DECA 3QM3A 1BG9A 2VC9A 2BGNE 3N2MA 1PSCA 3QHNA 1OG6A 2E4TA 4K1WA 3COTA 3WL0A 1AMYA 4KIRA 3AIQA 4GZ7A 1IEIA 2FDMA 5HUOA 2GQ8A 1JZ3A 2JQXA 2DIEA 1IWPA 3GIYA 3ZQ9A 3NQVA 3FW6A 1PIIA 3S6DA 3DU0A 2PP1A 3IARA 1O12A 2J75A 4E2DA 2VI0A 1UZ4A 2PLJA 3PB2A 2BFGA 3P14A 1W54A 4MUZA 4J3ZA 1BRLA 3GUGA 4JTCA 4BR1A 4AB4A 4MTVA 1IGWA 3M0KA 3VDCA 3TN6A 1EF2A 4LB4A 3IJ7A 1S2UA 3KLKA 3H7UA 3WD3A 1E1EA 2CBIA 5CG0A 5K2ZA 2XHYA 1Z8AA 5CBBA 3GHTA 3Q58A 4P8XA 5EMKA 2NWRA 1ZL1A 1SR0A 2I9UA 3MQTA 3N9RA 4N0RA 3CASA 2Z1BA 3NZQA 1R8LA 3AQUA 1UROA 2Z1SA 4O1CA 3BLDA 4N2YA 3PNUA 3HMCA 4E5TA 2VCBA 3L4UA 1YBQA 4KWSA 4LGXA 3ZR5A 2GDUA 5C9ZA 2QPUA 1U33A 3VKJA 3ATYA 3H24A 4J28A 1DIEA 1ISWA 5BCAA 4IGHA 3VIPA 2IKGA 4NT0A 4JTEA 2QUVA 3PZQA 3NNTA 3TSBA 2Z6IA 1ENUA 5CXPA 4ZMGA 1DWFM 1W1ZA 2ICSA 3RK8A 4DWDA 4H7VA 4P7OA 2ANUA 4RV8A 3UG8A 2D0GA 2YFNA 2CKSA 4MLRA 3G6MA 4QM1A 4RUBA 4JTLA 3KP1A 2WC4A 2YCJA 4DM2A 4IMDA 1UD2A 3O3RA 4DM1A 1LRTA 1P7TA 2J7FA 6XIAA 5LNSA 3OGVA 4JQ1A 1H7OA 3PTQA 5DRIA 3DBNA 2XGIA 2AKZA 2AGKA 2OOGA 5JIWA 4F0KA 3N9KA 4B5TA 3BLLA 5FAJA 1BXBA 3GIQA 4IL2A 1XD0A 3WDPP 4ZOBA 2X7WA 4DVOA 3HB9A 4UZSA 1VCFA 4CD6A 4O18A 4GIRA 2V5JA 1E15A 1UCWA 1ICPA 3SQSA 1H3GA 1R30A 4CCCA 3SRFA 4GISA 4RE4A 1UD5A 1XYCA 4LUTA 1N2VA 1XPGA 5DEZA 3GDLA 2A4AA 1UJPA 4E2OA 3U2ZA 3M47A 3ABRA 4JHOA 3C5QA 1LQAA 4QQ3A 3UZXA 4NRSA 5A6TC 4PYSA 3VMPA 3GQYA 4JGDA 2XSAA 5C5YA 1V6YA 3VABA 1G5AA 1RP9A 2IKJA 1A53A 2QPSA 5J5RA 1S2CA 4NNAA 2V3GA 1M1BA 3M0IA 1XF0A 3Q37A 3I4KA 4BQ5A 4JDYA 3AZRA 3LERA 3CWHA 4LUIA 2JF6A 2OWWA 4MSSA 1RCOB 3NVDA 4NSBA 4O1FA 8CGTA 3IJ8A 1TWZA 1DWJM 3B40A 1VC4A 3SIMA 1NDZA 3LRKA 4L64A 4D6EA 5C6MA 5EFFA 4LNYA 1XWYA 1YPFA 4NZ4A 3QR3A 4HP5A 3VK5A 4TOQA 1GVSA 4MDPA 1W3KA 3VYLA 4DQWA 2GQ9A 2HNEA 2Y2WA 4M1BA 3VFCA 3B03A 1DHPA 1RR2A 4CCDA 5FF2A 5M5DA 1KFKA 2ZC8A 4ZOAA 4YYCA 2V5BA 1VB9A 1DYSA 4HK7A 1OG0A 4H8UA 4OHQA 5C7HA 2VCCA 4KMQA 3B0PA 2WZEA 4YTQA 2GJPA 3W6MA 2H9AB 1ZLPA 5DRCA 1QBAA 2EG8A 2YDAA 1GKQA 1ISYA 2DSVA 3CB3A 4WCJA 4H6RA 1MEIA 2VQTA 4H9YA 3ZOAA 3L5MA 4FF5A 1KR0A 3UA4A 1VEMA 4GPNA 1W1VA 4I9MA 3WKZA 1AJZA 2ONEA 3RXZA 2UWFA 3T6CA 4JNMA 2E8ZA 4QISA 5XINA 3FEMA 5CZ0A 3WELA 5LA0A 3W82A 4Y9PA 3TW9A 1RCXB 1TPEA 3SEPA 2PDHA 3KRUA 1DBTA 1NFBA 3MCOA 3WD2A 3CQJA 3GFYA 4Q7NA 1BSIA 4NG3A 1TVNA 1QU4A 1HVXA 4RNJA 3MO7A 4UQBA 4TV5A 4EKJA 1ZCCA 1G94A 1LT7A 3GKFA 4B2DD 3RM9A 1E4LA 2X0SA 1JCXA 5D02A 4WZHA 5PTDA 1FWCC 3TQ0A 2D1ZA 1A5AA 2TYSA 4ACYA 4HA3A 2OODA 1GQLA 5HATA 4I9AA 5HULA 2W91A 3UCDA 3C3NA 4NZ5A 4B5XA 3E5PA 1K8YA 3GNPA 8XIAA 2VGFA 1AQFA 4IFRA 4GXPA 1YMYA 1TPH1 2VTFA 3WFLA 3WMLA 2WXDM 1TUFA 3D46A 3F4CA 3CHFA 4QNEA 3S6OA 3VGBA 3VOIA 3DFHA 2X2GA 1KV5A 2BB0A 4JYEA 4S3BA 3G1YA 4B3LA 2W3ZA 4D6HA 3QSRA 2PDCA 3P82A 1JYWA 5GVJA 2EAWA 2PD5A 5DLCA 2FZ9A 3TAKA 1YADA 4XBSA 4JFTA 1EB3A 2VCAA 2E6DA 4LYRA 3UZWA 5FJIA 5FF7A 2X09A 1HP5A 4MM1A 2FHCA 3CZEA 3A9BA 3MT1A 3GS6A 1UQZA 4TMCA 3G1AA 4WKHA 5E0CA 2Z28A 3T0AA 1DWAM 4QX4A 2NQJA 2IUZA 3ITTA 2WBKA 4TR9A 4LW7A 1EP1A 2V67A 3W70A 1OGBA 4P2VA 4UTIA 3PUEA 4HZMA 3OLGA 3KHDA 5FJOA 1V3HA 5F7UA 3EWDA 3WMCA 1UUMA 4J40A 2CLOA 3URAA 1MXSA 2CU0A 3OW1A 5IDZA 3KOYA 1CXIA 5I6SA 3EDDA 5I7GA 1EJTC 2OQLA 1BWVA 3LCLA 2XDFA 1VBGA 2DUAA 3IEBA 1YDOA 2W5FA 5K9DA 4Y9OA 4O16A 4DJDC 4JKMA 1TV8A 2Y7FA 3NZGA 4LV4A 3RLUA 3SQLA 2BXYA 5HANA 4S3JA 3AICA 1SUXA 4HSNA 2HE5A 2Y8KA 1WAUA 4FALA 3ARVA 3DZ1A 2Z24A 1UP3A 4IJBA 3C0QA 4C91A 4GYJA 4KWOA 3JR2A 2NUWA 3TTYA 4PRTA 1AQMA 3GDBA 1BTCA 3TQPA 4N9EA 2W66A 1E6ZA 3DYOA 4AXKA 1IEXA 1N7KA 4HA4A 3THUA 3RX3A 1YPXA 3TA6A 4A8IA 4ZEPA 1XCXA 4B3ZA 3BOFA 3D3AA 3MUIA 2GJXA 2PLCA 3TWBA 4J7RA 2FVLA 1HG3A 2ZRXA 2XFFA 1HGYA 3F7JA 4HT3A 3ENLA 4K7VA 4G2DA 3IRSA 2ZXQA 4MYXA 2DFAA 1E6SM 3BSMA 2WV8A 2OQHA 1AQ0A 3TYEA 1WOAA 3OA3A 1J0YA 4FLQA 1UA3A 2GSHA 1AA1B 5LXEA 1ME8A 3SQMA 3UP8A 2YDRA 4H8NA 1B0IA 4TXEA 3IRDA 2ISSA 4K8GA 4AY1A 5CC7A 1Z7AA 2O9TA 3S2LA 1DXIA 1FWJC 1J2WA 1KD0A 2CETA 4QGCA 2Y89A 1S5MA 3BWWA 3TDFA 4KKXA 3M0YA 1PPIA 3O7UA 1TJPA 1ZJIA 4AF0A 1OX4B 3KUMA 3NM1A 4B16A 2ACRA 2HWGA 5ECVA 1FY6A 3BW4A 3QFWA 4JICA 3TONA 3DUGA 3WFAA 4BI6A 3U4FA 1UKTA 4ZO6A 4LRSA 3DYMA 1TRIA 1NELA 3I4EA 1OQFA 4LYKA 1HF6A 1C9DA 4PMUA 1GVOA 1E4MM 2P88A 5G4EA 4ADSA 3N2BA 5JH2A 1E1CB 4LAMA 1KGUA 2P5NA 3RN6A 4FXRA 2FPVA 3INPA 3TW7A 4NL1A 3DHUA 4QG6A 2V3FA 5E9AA 3UJRA 1WPCA 1E3XA 1FWTA 4YWIA 1NAL1 1V03A 3SRDA 2VZUA 3N6JA 5D2XA 1JR1A 4KEZA 3USBA 4C60A 4KRTA 2QIIA 3PFRA 3QGAC 3VM5A 1VGAA 1ZJHA 2V5LA 4AZ7A 2GGJA 4E6MA 1YHTA 2VX5A 1S39A 2Z7KA 4C6MA 4Q3MA 2VEPA 3EX1A 4KESA 3UWUA 5CZTA 1XSJA 3LENA 3TN3A 1LBMA 1NWUA 3PTDA 5D2YA 4BFAA 1XYAA 2FFCA 3DAQA 5HNNA 2D3NA 4A2RA 2WSPA 4B5VA 1WKEA 3W7CA 1CW2A 5TAOA 7REQA 1TELA 5CQ1A 4QEEA 4PL1A 2WVVB 5BNKA 1RHCA 4JTAA 2CWNA 3ZR4A 3QZEA 1K77A 3K4WA 3P62A 4AD2A 3CZ8A 3UPBA 3P6LA 1ISVA 1EHNA 5I03A 3FKKA 1DEDA 5CJMA 4M19A 3SM0A 1UKSA 3A22A 1SR9A 2YB1A 4JKLA 3G2GA 1EJRC 3GBEA 3PY2A 3TEVA 5B7ZA 2D0HA 2DU2A 5DN1A 5IOBA 3GG7A 1IT7A 3BUVA 3QV7A 2B7PA 4QS5A 3C2OA 3WD1A 2HS6A 3CJPA 4DY1A 4I7UA 3WJWA 1V4YA 5BXRA 4IFOA 4UTLA 2G97A 2QUNA 5CC6A 3SDOA 4DYEA 5AYIA 1VFTA 1GHRA 3TKFA 4GY7A 1O5KA 3TTEA 1L8NA 3BQ6A 1AQHA 1W1YA 2PGEA 1XLAA 3PP7A 4EK7A 4IP4A 3UPMA 1FDZA 1Q8JA 4XAZA 4XO7A 5CZJA 4OJYA 4UR9A 2WPBA 2DVXA 2CLEA 3G1HA 2FTYA 4U5KA 1GQKA 4TTUA 5D05A 1E6NA 4FHAA 3CV1A 3ABQA 2NV1A 2WQPA 1IWAA 4XVDA 1GQJA 2RGMA 3PG8A 3LV5A 5F2LA 1H61A 1ONXA 2ATSA 3BARA 4XZWA 4Q32A 5AB3A 2VRKA 2HISA 1ECEA 2ZOXA 3L2IA 3RAOA 2ODOA 3WLJA 3EZ4A 2VD9A 3AXMA 2HBXA 3OB8A 3EMQA 3GYCA 4UB9A 1VJIA 4GD0A 4IPNB 1OFRA 3KXQA 1E72M 1IEVA 3G3DA 2ZZ5A 1KCKA 4LAKA 3OG2A 3H4XA 2WMIB 3WQOA 2QCHA 4LUJA 3QH2A 1NP0A 2NV9A 1XBYA 1YNQA 5HOSA 5EPDA 1XUUA 3G3MA 4A3QA 4HOWA 1LWIA 3IK2A 2QCGA 3WEZA 3B4UA 5EYWA 3CYJA 5EU9A 3O6CA 4MWAD 3UJSA 1TR1A 3TYBA 4QE1A 1MRAA 2INZA 3CEUA 1H7RA 4JZ5A 3GWQA 4JL2A 3LDVA 1OYBA 1TVPA 1GQIA 1OCNA 1OK6A 3AMGA 1XP3A 1OD8A 2FZDA 5T9BG 3SO7A 4NZ1A 4MWAA 3A4XA 4JKKA 1EYEA 2EXOA 9XIMA 1XSIA 1ZTVA 1S5TA 1KA9F 1QWGA 4M56A 1GJWA 3BGGA 5K9XA 1LL4A 1IE7C 1J0HA 3GY1A 4EXQA 1EO5A 3ANYA 4LCQA 3WK3A 1BQGA 1UWUA 3U48A 1JDEA 1QHZA 1BKSA 5D2VA 2FJKA 3W1MA 1E70M 5KINA 2ZZ3A 2D20A 3EX2A 3T2OA 1YDNA 4PSRA 4Z08A 5LNVA 4M5PA 4J3XA 3UFYA 1JVNA 3BAXA 4NHVA 2OQYA 3S8HA 4GX8A 1OVDA 1HKMA 1MUCA 4W7WA 4RW5A 3QW4B 2A79A 1GYLA 1R85A 2Z7GA 2W0UA 1TWSA 1TJ1A 1EXBA 2ZVIA 2RUSA 4NJGA 3T0CA 3V5OA 3HGRA 4KS0A 3LI1A 3W86A 3LGGA 4HZ7A 3ITOA 3BLPX 4DX3A 2QV5A 3RMJA 3WEMA 3MV01 3SJ3A 4RK8A 4HGXA 2JGYA 1VFHA 1VZWA 4GUJA 3N3TA 4Q4SA 3PZNA 3TOPA 1K9EA 5KZMA 2J78A 3JU2A 3UXIA 4HNCA 2D2JA 5CCZA 5G1YA 1Q4NX 2JBMA 3MANA 1FCUA 4HZ8A 4WHBA 3W07A 3BLOA 2R1LA 2FDSA 1XLHA 3WIJA 3R8GA 1QCWA 2GSEA 5XIMA 3UWEA 5AHLA 1JNEA 4PB3A 4GJIA 3XINA 4K38A 1AZ1A 3KS5A 5A8NA 3LNMA 5D9PA 2PDUA 1EZWA 2X05A 4G56A 1J5SA 3CMFA 5C71A 9RUBA 5KTLA 1Q6DA 2WOQA 2ZADA 3WLNA 3SBFA 4DBWA 1QI0A 4TX9A 1U83A 1AUSL 2PPGA 3PWGA 4WY0A 1M68A 3L0KA 4O10A 3TLQA 1JF6A 4WR3A 3RR4A 1V77A 4QS6A 1B9ZA 1T41A 1FXQA 3ARQA 4NJKA 4HU4A 5J5DA 1DQUA 4QFUA 4WIWA 2V2DA 4IGMA 5HMFA 3NDOA 4M6VA 3A3HA 4MY9A 4L9YA 3NQ6A 2VX7A 4OUEA 1OYCA 1ZBKA 2FQIA 2J66A 4IGNA 4E2VA 3TNOA 4IH3A 5KEZA 5IHRA 1C92A 3QY6A 3W7RA 3MJYA 3FFSA 2G3IA 1WZLA 1ADDA 4R7OA 3M9YA 2R1PA 3MV11 3P93A 2OTDA 2VOMA 2Y8UA 3KVKA 3FJ6A 4CQAA 2J27A 3TR2A 3K1GA 3OIXA 4UMAA 2NXIA 1X6NA 4NXKA 1IXNA 2VHLA 2WJEA 3MPGA 3CUZA 4NAEB 4IQDA 3LQGA 4RE3A 5DMYA 1V0LA 2VEMA 2BSLA 3VC6A 3GNNA 4DWSB 1Q7QA 4GYPC 4XSMA 4HSOA 5ECUA 3NXFA 1ZP3A 2KAUC 4XK2A 1E9ZB 3DFYA 1QTWA 2DIKA 3HIJA 1VRXA 4J3TA 4LQ1A 1A3XA 3W76A 3UXLA 4F3HA 1IZKA 1JRBA 4F4RA 1E0WA 3PSWA 3R89A 5C9WA 3L4XA 5A8MA 1WOBA 3S3GA 2P8CA 1EOMA 1U1UA 1NM9A 4GY0A 4J3VA 3SCUA 3AFBA 2PGRA 3KZPA 1V08A 2NXGA 3I6TA 4CEXC 2DH3A 5CPNA 3UG4A 1BVWA 1H1YA 1QO5A 1IHIA 4UBPC 3SN1A 2C3ZA 5LNUA 2CYGA 4C7DA 4KFNA 3WLTA 2GWNA 4LUYA 3R13A 1O5RA 4MY8A 3BZJA 1E0XA 1PKMA 3GSMA 1K9FA 1WDPA 1QPOA 2OVLA 1EC8A 3BLIA 3PZOA 3FIGA 3HGJA 2PDQA 3E96A 4D1IA 4L61A 1X39A 3EB2A 4HMEA 5LIYX 3AYVA 1OGGA 4QDMA 3WQEA 4BHYA 4CNOA 3QMRA 3UWZA 4DBUA 4OBSA 2XWDA 1A5SA 3AC0A 2AL2B 4FB7A 2H3DA 2XINA 1XD1A 3A13A 3MY9A 1E55A 3EDFA 5IBXA 5CSSA 4JFVA 4XV0A 1OM0A 4QEHA 3K8MA 1M3UA 2HEJA 1KBKA 1VIZA 4MZ1A 2GJLA 3QZAA 5HNUA 1Q7MA 3MI2A 2G8ZA 3OVRA 3QPZA 1X38A 1SFJA 4JNZA 1RK5A 3GG0A 1XBXA 3BMVA 2EHHA 4D2JA 4I90A 2R1NA 4UUIA 4DIAA 3SW6A 3NJ3A 2E5BA 3ZLFA 3PAJA 1PCKA 3MZNA 3HQOA 1G6CA 4O17A 4Z1CA 1K4HA 2ZICA 1V0KA 3KFTA 3GNRA 2D73A 4C1LA 4WJEA 2PA6A 1JPIA 4AEEA 2WC3A 4AZ6A 1XYLA 4I9JA 3UZ5A 4CEUC 4AAJA 2Y8VA 2E5DA 4GG9A 4EOUA 1D8CA 3ITGA 4OECA 2QYGA 3HQNA 3T0BA 1CGXA 1W1PA 1CXFA 3RYSA 4UTWC 1BF2A 3PNZA 4OT7A 3GYEA 2Z1KA 3PUGA 1IT8A 4YL2A 4H9XA 2EQDA 3QRHA 3CAKA 4HNLA 4WRHA 3SCSA 1GPWA 1IF2A 2FKPA 1VLWA 1O5XA 3C6CA 1BF6A 5AZ1A 3SSJA 3HPXA 3DXIA 1FQ0A 4X22A 4GC4A 4JXCA 3I7RA 1SZRA 3NQ2A 4PMNA 3RIKA 3VIFA 4HNTA 3W1NA 1UA7A 2J8GA 2HROA 4HTBA 2A3EA 2RKXA 4M7TA 1FX6A 4R5EA 2PDJA 1XIBA 1N8FA 3XIMA 5I3HA 2A2IA 5BOFA 5C55A 1YQ2A 4HB7A 3T07A 2DP3A 4UTJA 2QUTA 3WQDA 1TCDA 4ZB2A 5EKYA 5AYZA 4FNSA 1TVLA 3UETA 1XJBA 2FZNA 2VM8A 4FNTA 4IJRA 1K6AA 5FEXA 3H2NA 3PBWA 2XVKA 3EB4A 4N4PA 3U5UA 4CNUA 1QNVA 2O55A 4EF8A 3W7JA 1D9EA 3LLDA 1W8GA 4DZIA 1MQQA 1C8XA 2B0MA 3C56A 1UG6A 1XYBA 3WY1A 5CLTA 1I75A 5EL1A 1XRFA 3AWNA 3UWQA 5FESA 2GZXA 3IGHX 3D5HA 3CL6A 2XIQA 3L0NA 3W2LA 1JUKA 1OX5A 2CESA 2FFIA 1UH3A 5CGTA 3H2EA 3K1DA 2BNJA 1A5NC 1MXGA 5DF0A 2H90A 3T1GA 3VIJA 4DJFA 3G1SA 1ZCOA 4FNQA 2C1HA 1C93A 3RLGA 2D69A 4JQ3A 3ZJ6A 2PTYA 3GAYA 3KLLA 2F6KA 1RY8A 3L5LA 4AEOA 1E0UA 3BOXA 1VPYA 1DJGA 2G95A 4OIFA 2YL5A 4U2ZA 3NVTA 1JCJA 4HTYA 3KBVA 3WSUA 1TV4A 2E1WA 3WJXA 4R27A 1R9YA 3NFUA 5LKYA 3NQAA 2XVGA 1TYGA 3K5XA 3CHVA 1TREA 2QGHA 3A21A 1DTNA 2DDXA 2J9ZA 2BV9A 2F6XA 3W84A 4ZB0A 2TAAA 3CL7A 4QP0A 2TSYA 1SU5A 1UB3A 3B9OA 4AFYA 3ZVHB 1R2SA 5LHFA 4IUOA 3H2FA 3DG7A 1JGMA 4PTXA 4ROQA 3VX1A 2J9YA 3S2JA 3SADA 3GW3A 2CZDA 2UV8G 5H2ZA 2DORA 4C5YA 1F4AA 5EBAA 3VZZA 1FFRA 3M0ZA 4UFLA 3SAZA 5CPQA 1BGAA 3BK0A 4M80A 3TVAA 1T99A 3RR1A 1E6XM 1BEUA 3VIOA 2ATMA 1TJ0A 1R3RA 2GL5A 2CZ5A 4NILA 1C7TA 1E6QM 4HMNA 3NQCA 5LNRA 3QV8A 3EDJA 4H9TA 3W73A 4R9OA 3PJWA 3WJZA 2ABAA 2D2GA 3VMNA 1POKA 1XI3A 3NQ7A 4IX0A 4KWWA 3HZ3A 3REQA 2JIWA 5D32A 1XV8A 1ADSA 2BXVA 4D72A 1SSGA 2DPEA 3B9EA 1YX1A 4E2BA 1Q63A 2JEQA 4M7SA 3GK0A 1Z9AA 5I06A 3UYCA 1CWYA 4P7LA 3NXLA 3VIMA 1KXQA 1HTIA 1IR2A 4Q4OA 5DBUA 1GVYA 3WLOA 3VUPA 2QF8A 4DO7A 1GNXA 3CLMA 2P10A 5FI8A 3VE9A 3MBDA 4O1DA 5D8ZA 2Z2AA 3VAVA 4A22A 4KGLA 3RMEA 1UUOA 2ZTJA 1TZ7A 3V35A 3URNA 3GU1A 4L56A 1K7XA 4O1EA 1TV2A 1WUEA 2D2HA 1QMLA 1O95A 3NO3A 1HKIA 4X9SA 3GTHA 4X63A 3MWCA 1JF5A 2YCKX 1HKJA 2OFJA 3C0JA 1SJCA 1KM6A 7CGTA 4PN2A 5J04A 1O7AA 1GOQA 3EKZA 1EIXA 4OV9A 5A95A 2FH8A 5D30A 3R58A 3WBXA 3GM8A 3VGDA 2WSYA 3O1NA 4RKAA 1CB2A 4O14A 4ZO9A 2PODA 3OVGA 1SQ7A 3H55A 2BZNA 1KWGA 2BVYA 5IM51 3G77A 4C6CA 4FEZA 1U30A 1TPUA 4AWEA 4U5IA 3BLKA 4ZQMA 5BWFA 1DJYA 4Q4PA 3PUOA 4W7UA 1KM3A 1QATA 1YTDA 3DG6A 2X0YA 2QQ6A 4IFKB 4P7NA 1KNWA 1I1XA 4YU1A 2QCNA 3V5FA 5F2GA 2IMRA 4KWUA 2FPYA 2PF0A 4C1NA 2FZBA 2GOUA 1XRSA 3SJNA 1FWDC 3SUVA 2VO5A 5H8PA 3CBWA 3QV9A 4D6FA 2FHBA 1JAEA 1EJ7L 3M0XA 5LGZA 1TZZA 3M0MA 4KERA 4MGGA 4MB4A 1H5VA 4NZFA 1MDLA 4IM4A 5J8LA 4O8RA 1EFZA 4DUWA 3GH4A 3W7DA 3O9NA 2VFGA 3MJMA 2WNZA 3W1PA 4B5UA 1SO4A 2OGJA 2ZUWA 5ABFB 5FAGA 2NQZA 3FDKA 4MNLA 1QOPA 4ROPA 2PRLA 2XIOA 4L65A 5C54A 1LUCB 3KE0A 1FHDA 1BHGA 1P0KA 2GYIA 1PZ1A 5D09A 3KBMA 5AHFA 2JALA 1DXEA 4ZOCA 1EJVC 1GKPA 3AS1A 3NSNA 2UY2A 4B9ZA 1K7FA 4DPQA 2WWCA 1F61A 4LEQA 3MC5A 3TJIA 1PXGA 2OO6A 3KTXA 3PTKA 1EEPA 8XIMA 2WAGA 3G1XA 1R2RA 1L2UA 3NYDA 3A24A 5BMXA 3BAKA 2ZUSA 2WHJA 1HNYA 3LMZA 4IMAA 5LYRA 4O54A 5CSYA 3LN3A 4M0XA 3C0LA 1LROA 4Q4QA 2E0PA 1LG1A 4FK9A 3RU8X 2GVLA 1P6WA 4HPNA 5C8BB 1KFCA 3ARPA 5LZLA 3Q65A 4UMBA 4PMXA 4JIIX 3P5YA 5MHBA 3L68A 3WQ6A 3NQGA 3GW0A 2HS8A 2JEPA 3CV7A 4GH1A 5G5IA 4B5WA 4D8ZA 3W87A 3CH9A 4I3GA 3W7EA 4TUFA 3AMDA 2PC8A 4GVFA 3EA2A 4QCFA 2JKAA 3OBKA 3VE7A 3OVQA 3UZYA 3NPUA 2CXEA 1YXCA 2FHFA 5M2FX 1SFTA 3H7RA 5E6ZA 2ZE3A 2ZE0A 4DAIA 4QR6A 1RALA 3IACA 2OGYA 4LV9A 2OLHA 4MNKA 4N6FA 1XIMA 1LYXA 1DPMA 3P0WA 4M3PA 1XLFA 1HQTA 1JCYA 3OTRA 3SY5A 3NPWA 4ZE5A 1CB7B 5ABHA 4CNNA 1KTBA 1HKWA 1JZ5A 4A2SA 2VFIA 4MLJA 1G4SA 2H8ZA 3WDQA 3P8JA 3OZMA 2YR1A 4P8VA 4AX6A 5LIXX 2PFHA 1GG0A 3CHCA 1KR1A 4LUSB 4U28A 3FHAA 1KCLA 5CH9A 1YE4A 3WF0A 4UQEA 3UQNA 3NO5A 3TA9A 4V33A 4HOXA 4AC1X 1DJXA 4XUYA 2Y24A 4GQGA 3SCQA<