4XTIA

Structure of imp dehydrogenase of ashbya gossypii with imp bound to the active site
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
407
structure length
373
Chain Sequence
YRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii atcc 10895
total genus 117
structure length 373
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtiA00
3C6CA 3O06A 4NXSA 3DXIA 1KBIA 3ATZA 2PE4A 2ZCGA 5LZLA 3SW6A 5KTLA 5DCEA 3IRDA 1F73A 1L2UA 5K9CA 4BWLC 4A2RA 4DF0A 2NZLA 1K02A 4MLRA 1IXQA 2FIQA 2W6RA 1ZCOA 1RD5A 3GAYA 1XKYA 2WPBA 1XBVA 5K3VA 3QM3A 4JY8A 4ICNA 4FIRA 4K39A 1DOSA 3NO5A 2ZRUA 1FCUA 3W1QA 3CC1A 3P67A 1Y0EA 5D09A 2ZZ1A 3GXTA 3W7LA 4AWSA 3NQGA 1KLZA 1M5WA 3DZ1A 5FESA 3BW2A 3EKLA 3Q37A 1TPDA 5DBTA 5SWUA 2ZA1A 1L9WA 5I3KA 2ZYFA 3L0GA 5AHNA 3RLUA 1F74A 4WY0A 2VFGA 1I2QA 3CEPA 2VOMA 5IM51 3GDTA 2C0AA 3TMLA 2J27A 1FWSA 3QC3A 3C4UA 3HF3A 4U28A 3S8HA 1TTQA 4EVZA 3KRUA 1UUOA 2ZZ5A 1QMLA 1YTKA 1JUBA 3GLCA 1VCFA 2RFGA 3PG9A 3E9AA 3F4NA 4N4QA 4D2JA 1D9EA 2BWGA 2DZXA 2Q3OA 4DELA 1TQJA 3QW4B 4Q4KA 1GPWA 3N73A 4JTKA 1RQHA 3LB0A 4G1KA 3W2NA 3BVJA 3LV6A 4O11A 2CWNA 4TIMA 3PY2A 3S0CA 1WBJA 3W7GA 3UWUA 4K8EA 3NXFA 2WV8A 3CB8A 3CTLA 1PCKA 1TRIA 4CLMA 1XM3A 1M7PA 3MYOA 3W87A 4UTJA 1Z44A 5FF3A 3MHUA 3USBA 1PCWA 3W6YA 3MYPA 4PH6A 4O8RA 2CLKA 1TPC1 1UUMA 2QAPA 1DHPA 4NNBA 1AMKA 3MUXA 5EYWA 4LRTA 1OK6A 1JUKA 3NQ2A 4MZ8A 2FPVA 5EA9A 4EF8A 3EX4A 3O15A 3W2UA 2A0NA 3RK8A 3NQFA 3FOKA 4KKXA 3M9YA 5HMSA 3WJWA 2Y89A 3NQ6A 5U7SA 2NX3A 1XC4A 4DF2A 4JICA 2YW3A 1LZOA 3N2XA 3UZJA 1K7XA 2YXGA 4DPQA 5CKSA 1W1ZA 3IVTA 3W1TA 4JY9A 3NQMA 1XFBA 3IGXA 5FF2A 3S9YA 4E2BA 4GC4A 3LX9A 4UCGA 3P84A 2CLOA 3T44A 4RV8A 4EIVA 1LLWA 1SPQA 1O5KA 3MI6A 4O53A 4FNTA 2X30A 2ABBA 4EOUA 3S42A 2WO5A 1CX9A 3EWWA 1WX0A 1G4EA 4PCFA 3G1YA 2A4AA 1GVQA 2FPYA 3R89A 4YLWA 1KM6A 3HG3A 1C29A 2E6DA 2EHHA 2VENA 2VEPA 3OVQA 2NWSA 3P60A 4HNUA 2A7NA 3HQ1A 4OGZA 4UTHA 5EL1A 3IEBA 2BTMA 1BEUA 1BWKA 3HPXA 5AHIA 2V2CA 2XN2A 3GZ3A 4K6AA 2Y7DA 2QJGA 1TV8A 4RK8A 5CZJA 1H7XA 1QPQA 3BV4A 2E6AA 5FEXA 1W31A 3EX1A 2PCQA 1JUEA 1K03A 2C1HA 2CZEA 3G1DA 1H5YA 1WOAA 1YXYA 3NL6A 4A29A 1GWJA 3NDOA 2YGYA 1IF2A 5AB3A 3DFSA 3G0UA 5KITA 1KFKA 1ICPA 3RU6A 1X1OA 4OV4A 1ADOA 4MLJA 1OF8A 4FB7A 1DL3A 4XUGA 3VFLA 3D0CA 1FWTA 3HPZA 4UTTA 4O17A 1EWEA 2RDWA 1I2PA 2VFFA 4Y8FA 4GJ1A 2HS6A 3C2RA 5FEWA 4RZ6A 1RQBA 2V5LA 4MIMA 4RKAA 1T96A 3JS3A 1AK5A 1W54A 4MY8A 2QCFA 4UFIA 2G96A 1WBHA 1J4EA 1LBMA 3NZRA 2EKCA 4ADUA 4HIBA 1YADA 5CPNA 3MJYA 1P4CA 1LLZA 3S1VA 2IQTA 3STEA 3KVJA 1I2RA 3C2VA 3GR8A 3OG3A 5F1VA 1OK4A 1W5OA 4RCXA 5FF7A 3L5AA 2AAMA 3NPWA 3NL5A 2ZZ6A 3NAVA 4IMDA 4XKYA 5TBOA 3CM4A 3IIZA 3IIXA 1KA9F 4UC5A 1A50A 3A24A 1FWRA 3U2OA 1F05A 1JCJA 4WX2A 2Y6ZA 3N34A 4IWWA 2QCCA 1TTPA 4NNAA 5HUOA 5CG7A 3QRHA 2E6YA 3O63A 4C1LA 2VKZG 3HO8A 4FNRA 2V82A 1G67A 3DFPA 3FJ6A 3QQ0A 1LP6A 1QCWA 4N9BA 3QH2A 1VQTA 4JNMA 2CZFA 4QISA 5CPLA 1TIMA 3NZ1A 3UWWA 3C61A 3LLDA 5D04C 1JQVA 3G8EA 1H7NA 1S5WA 2NWRA 4UTLA 1DKWA 3NGJA 3R8RA 2NUXA 1R2SA 4IOTA 2HS8A 4S2BA 2DZPA 2QUTA 4AVFA 2YFNA 1RZMA 4FX6M 3VI2A 2VFDA 2FQIA 1JJKA 1JULA 2A1YA 3O6CA 4JTJA 1SO5A 1GVFA 3W1AA 1FCQA 3GR7A 4EF9A 3LBCA 2W79A 5LKYA 3FJLA 3M5VA 4ORIA 4I7WA 2A6LA 4R7JA 4A2SA 3TA6A 4B5NA 2HTMA 1MO0A 3O16A 4PC8A 1QWGA 3P8IA 2G5WA 4Z1AA 1PHWA 3LHZA 1ZENA 2Y88A 4UTMA 3R2GA 4YMZA 5AHEA 1GG1A 1VPXA 5DXXA 4JD4A 3KHJA 4EWND 3W86A 1FX6A 3W2LA 3GDMA 3NOEA 1OX4B 5BW6A 4O10A 4IJBA 3P62A 3UNDA 2B7PA 1SW0A 2ZA2A 3IIOA 4ALDA 4IQLA 4MUZA 1G7UA 4LUIA 4BI7A 3HGSA 1ALDA 2B4GA 1NFBA 3M16A 3SGUA 2AQWA 6TIMA 4JX5A 3MO7A 3PUEA 4JEQA 1PL9A 1TTJA 3TU9A 4LUJA 1QDSA 1ZAJA 4FIQA 4YL2A 2OJPA 2CLFA 5D2WA 3TDFA 3DI1A 3N2MA 4FNSA 1VJIA 3W7IA 3NQDA 4AEOA 3TQKA 3W2KA 3GVGA 3BLIA 1KM5A 3SECA 1OABA 4GBUA 5CZSA 3LI1A 4IPJA 1AW2A 4JIQA 5G2WA 1LDCA 1TSIA 3PBVA 3E0IA 3M44A 1EUAA 4UR7A 1FQ0A 3G1FA 4LT9A 4OE7A 1W0MA 2TSYA 2E68A 2X1UA 3DFQA 1GOXA 1N7KA 2GUUA 3KXQA 1LORA 3NR0A 3M5XA 5G1YA 4UTTC 4FXSA 4QAIA 1ZFJA 3SGZA 3S1XA 2B0MA 3EB2A 4LVGA 2FPTA 3W23A 1Q6RA 5E93A 1GVOA 5DELA 2RDTA 2ZFAA 4FXRA 4Y6GA 3SI9A 2E5DA 2B7OA 1SFLA 3PG8A 3TSDA 3WJSA 4CNOA 4AMAA 1Z42A 1HFBA 5F1UA 4JTLA 4LVFA 3P80A 2CW6A 2TYSA 3NPUA 2C3ZA 5HQEA 2BZNA 5K9DA 2V9DA 4LS2A 5DY3A 2HSAA 2FFCA 3L9CA 3C56A 2WNNA 1GT8A 4NJKA 2QCEA 3DFOA 1DBTA 1KFLA 3CHVA 1H62A 4H3DA 2QCDB 4AWTA 4UMCA 4WJEA 4O1DA 3IIVA 1OFBA 1QO5A 3E12A 4JS3A 1LROA 1I2NA 4MY9A 5DXYA 1MEHA 1CW2A 4JYDA 3LI0A 3W1NA 3MBDA 3NPVA 1THFD 4ZQNA 1NF0A 3W84A 3P81A 4N6FA 3TE9A 4W9TA 1YXCA 3ABOA 3GNDA 4N02A 2ZRXA 4GXMA 2C19A 2FJKA 3G1SA 1VHNA 3VCRA 3LHTA 5F4WA 3INPA 3M6YA 3W1LA 2X1TA 3W83A 3MP3A 2ZZ4A 3RNDA 2WSYA 1FY6A 1XDMA 4RJEA 4DBEA 3FEMA 1LBFA 1ZAIA 1ICQA 2VEMA 1OFPA 2BX7A 4AHOA 1YDNA 4CCEA 2Y61A 3IGUA 3PB2A 4PTNA 2QCNA 2WSQA 3S5NA 2Y85A 2A5HA 4PODA 4I7VA 4Q33A 2V0TA 1WQ5A 3AJXA 1FBAA 3A5FA 3G22A 3UQNA 3HGOA 4RXGA 1KM4A 1W8SA 2ZDRA 3PWAA 4BK9A 3SSJA 3TNOA 5K4ZA 2C6QA 2YZRA 3A23A 3DFNA 3G1HA 3HGJA 3UZ5A 4UNLA 2X1RA 3ZWSA 1YTDA 5FI8A 3MHFA 3G0SA 3K30A 3TSBA 5C6MA 3UPWA 5DBUA 4TR9A 4JTUA 1TPFA 2NV2A 3CU2A 4O4VA 2V2HA 1SFJA 2C14A 1HL2A 1P0NA 4JTHA 1TO3A 3SIZA 4IX2A 2QAFA 1JQXA 2C15A 1LRTA 2NX9A 2GVLA 3MWAA 1H7PA 4HNNA 5BMXA 4WZHA 5CZTA 3EXTA 4O57A 3STCA 4R34A 3DHFA 3LCWA 4N9DA 1GG0A 1KFCA 1ONRA 3B04A 3Q2DA 4Y9AA 4JTFA 5DLCA 4H6KA 4M6QA 4QITA 3TXZA 1U5JA 3LHUA 3OBKA 4IXHA 3C0JA 3DU0A 7TIMA 1KM0A 4OT7A 3W72A 1XBYA 2I14A 4O1AA 3IVUA 5DY2A 3W07A 1ME9A 4DXVA 3QFEA 4OWGA 5F2MA 3I7QA 1TTIA 2JGQA 5CPMA 3GK0A 3TROA 1V7YA 4N2YA 3KRZA 1IXNA 3IGSA 4WY0F 2E77A 4P2VA 2RH9A 4ZQCA 1QPOA 3EWUA 3S5ZA 3I65A 1G4SA 2CLMA 3S1UA 1KV5A 2CU0A 3M43A 3FS2A 1VLIA 2A21A 3C2FA 1PS9A 2YCEA 2QEZA 3GKAA 3PBUA 4R53A 3PM6A 5L6UA 1O4UA 1A5CA 4HNTA 1GEQA 2CFFA 3LCLA 4Y96A 4HNVA 1HG3A 1FXPA 4JGDA 3LRLA 2Z2UA 2F7FA 2FB2A 1OFAA 5C2XA 4NVTA 3O1NA 5ABTA 2YDAA 4JTIA 1GQNA 4MY1A 4GUFA 3MW7A 4KFNA 4IXXA 2H6RA 1GTHA 2V81A 2YYTA 1Q6QA 3OHIA 5AHFA 4A3UA 3ATYA 3W7OA 4TO8A 2Y7GA 3H54A 1X6UA 4NNCA 5F4SA 5H91A 4KWVA 4BF9A 4YXGA 3RMJA 4Z0SA 4XBKA 1XXXA 1H61A 1OYCA 3B4UA 3EKZA 4FHAA 3NM1A 3A5VA 1KFBA 2H8ZA 1UCWA 1YLVA 1YPIA 1QPRA 2ZZ7A 3WK1A 4KFPA 1LTDA 2H3DA 5I3GA 2G95A 3CWNA 4U4MA 5LNWA 4Z1DA 1TREA 2GJNA 1PVNA 4O16A 1SZEA 2V5BA 3W7NA 4WOZA 2WNZA 2Y70A 4UFHA 3PBYA 4O52A 2CLEA 3N9SA 1MXSA 3GX9A 4K7VA 1IXPA 4C1KA 4N9CA 2VFIA 1ZALA 4LV9A 2BXVA 2JBMA 2TRSA 5BMWA 4JTGA 1EP3A 5D2TA 5E0KA 4A21A 3KFTA 2P1FA 3UPBA 1W3IA 1VR6A 1G4PA 1J5TA 1FXQA 4UR8A 6ALDA 4MYXA 2ZTKA 1FUYA 3LRMA 4OQVA 3E96A 1WAUA 2WSRA 1YDOA 5D32A 4PA8A 8TIMA 3I68A 2AGKA 3PSVA 2DZVA 4LVAA 4MPQA 4X22A 5KMYA 1TPUA 1EUNA 1C9DA 2A2IA 3LLFA 4CCCA 2H8XA 3L66A 3LTSA 1OX5A 1SSGA 1A5BA 1F6PA 2ZA3A 5D2YA 3F1QA 1QFEA 5LNRA 4LU0A 3QQ1A 3EWYA 4UTKA 3WJYA 1B57A 5IBXA 2Y62A 1NF7A 3W88A 2A7PA 3W9ZA 3W3OA 2TPSA 3U8GA 4MVAA 3F03K 4J9JA 3GYEA 4MJMA 3NYZA 1GVRA 1F7BA 3HG2A 2DZTA 3R12A 3S5YA 3H53A 4WXZA 3NA8A 1XI3A 3P7YA 3KAOA 2FDSA 1QR7A 4E2DA 5EMUA 5KZMA 1JR1A 3NQEA 5LNVA 3PAJA 1NVMA 1AW1A 3F4WA 1Z48A 2CLLA 1AW5A 1N8FA 3LCGA 4O50A 5DN1A 3EWBX 1OFEA 4ML9A 1W5MA 5EKYA 3W7EA 1VRDA 3PULA 5MHBA 4PL1A 3N3MA 1K7FA 3DAQA 1DORA 4K8HA 1T8XA 5KZDA 1OX4A 2NUWA 4QM1A 1DJNA 1KV8A 4BFAA 2P0OA 3S5OA 4JDYA 4ZZ9A 1X7FA 3T7VA 1R2RA 1OFRA 4MOZA 2H3BA 1KTBA 4GUHA 4ADTA 4JR5A 2ISWA 3NQCA 1W56A 5I3FA 5D03A 1B9BA 1SR9A 3VKJA 1KM1A 3W1UA 1OHLA 3B03A 1LM1A 2O7SA 3LGEA 1FDYA 3THAA 4AWUA 4DEFA 1SZGA 3SY5A 1PIIA 4MFEA 1VYRA 2VELA 4XWUA 2GOUA 3VE7A 4HN4A 5GVJA 2RHGA 1CI1A 3ZR4A 1O5XA 1H1ZA 2DZUA 4DBDA 4I9AA 4TX9A 3UWYA 4L4MA 1VHCA 3DGRA 2WOQA 4M7TA 4LV4A 3RFAA 2QR6A 4NJJA 5AC6A 4P61A 2DORA 4M6VA 1P0KA 1AG1O 1D3GA 3NEVA 4QNWA 5HWMA 1G6CA 4M7SA 4AH7A 5HWJA 1X8FA 3O07A 2NUYA 4ZVJA 4AF0B 4FX7A 3ZWTA 3QMRA 5I3JA 4DO4A 1W37A 4GRSA 3I7SA 4BI5A 1J2WA 3CWOX 1LRQA 1S3HA 4IPIA 3DH7A 3TAOA 5K4XA 4MZYA 3CIWA 5T26A 3P82A 1HTIA 1S5TA 4FX8A 2JKPA 1F6KA 1LOLA 5D2XA 1DQXA 3V75A 3DHDA 3W1PA 2FB3A 3WJZA 1HO4A 5DCDA 4FO4A 1OG0A 4HSNA 2ABAA 4BI6A 1I8JA 1KFEA 2Q3RA 4X9SA 1MZHA 5CGQA 2QCDA 1Z41A 4LS1A 4ZQPA 3TQ0A 4XZ9A 4O19A 3L5MA 3MBFA 4MJZA 1W3NA 3QW3A 3BW3A 1N55A 5K9XA 4GNJA 1KTNA 3M41A 2GQ8A 1MEWA 2D73A 4JTEA 1Q6LA 2Y7FA 2DZSA 4QSHA 3KOFA 3DKJA 3LOTA 2QJIA 3LERA 4LRSA 3T78A 1QOQA 4K38A 3C2OA 2ZRZA 1WV2A 3NNTA 4LC6A 1IGSA 3PSWA 3RF9A 3W2JA 5J5RA 1G4TA 1Q6OA 3T4CA 3EXRA 4DQWA 5IBXC 3BLFA 3C3NA 4HPJA 1JCYA 4UTUA 4PEKA 4UTWA 1AL8A 2ZQ0A 1MEIA 4O4WA 5CPOA 3QSRA 4N9EA 1TRDA 5G4WA 1TB3A 4ORMA 1YXDA 4S1FA 5D30A 3LXCA 2ZZ3A 4WOQA 3B05A 2JGYA 2GVJA 2LLEA 4AXKA 3ABQA 3NQAA 3PBWA 5AOUA 2C16A 2QCLA 1EA0A 4NJIA 3BK0A 4JX6A 5D05A 3VNDA 3PS7A 1VYPX 3EWZA 2NV1A 4WXYA 4RZ5A 2E09A 1ME7A 1QO2A 2ZBTA 1T0OA 1SO4A 2BSLA 2ALDA 5TQLA 4UFMA 4KWWA 3LHVA 1OX6A 1VLWA 3PR2A 3P5YA 5EY5A 1GYNA 3QPZA 2ATMA 3S6DA 1UB3A 2GJLA 1K8ZA 3G3DA 3CEUA 1HUVA 3HBLA 3UY8A 3O05A 3QEZA 1OJXA 4RLIA 3JR2A 3NQ7A 1OVDA 3L21A 1TPEA 3OA3A 1RVGA 3QYQA 2C18A 3C8FA 4QIUA 2QDGA 3TH6A 1UJPA 3TXVA 4TMCA 1V5XA 4ZL1A 5AHMA 3UWQA 2F84A 4JTTA 2YSWA 1TPB1 4O18A 1JCNA 4GUGA 5HJLA 3DFTA 1R2TA 2Y7EA 3E49A 1FDZA 2OCZA 2DJXA 1ZJIA 3N9RA 3KVLA 4GE8A 5DCBA 1RQEA 1EPXA 3FIGA 4NX0A 3M1ZA 4UFKA 2ZRYA 5FF4A 5BRBA 3Q94A 1O95A 3QPYA 3UXAA 1K8YA 5K2ZA 4PFMA 1SW3A 3L5LA 5LGZA 3EX6A 3NPXA 3P74A 1QPNA 1YPFA 3LXAA 4AHPA 1WYIA 4BR1A 1EEPA 4WD0A 3BLEA 3PC0A 1G7VA 3ZS4A 3G1AA 4UMBA 3HB9A 1BWLA 3TC6A 2J88A 2HMCA 2QJHA 2CZDA 5HNRA 2QF7A 5F2IA 3MP5A 5FEZA 4CQ8A 2JKAA 4X2RA 5LHEA 3HMJG 4OBTA 2V30A 2NXHA 1VCGA 2OX1A 3GKFA 5AYZA 4RR4A 3YPIA 3WJXA 3WK3A 1LCOA 4JDBA 2QCMA 5K7JA 3FKKA 5D38A 2V2DA 2WKJA 1W5NA 3QSTA 5LHFA 3MP4A 2NLIA 3G1VA 1Q45A 2OT1A 1P1XA 2DJLA 3CQ0A 2J9XA 3OVRA 4A22A 2PC4A 4KFOA 2A6NA 3TK7A 1H7RA 3L2IA 3LHYA 2NXIA 1A53A 3A21A 3EEGA 3JRKA 1GVSA 3BGGA 4RX0A 1FCVA 3TR2A 1TV7A 4MYAA 3GNNA 3LHWA 4FNQA 4HHPA 4NJGA 1WXJA 3W75A 2A7RA 1RPXA 1QAPA 5HINA 4HKPA 2XN1A 4WUIA 3CIXA 4LNYA 3CT7A 1LOQA 4IUOA 2WNQA 3TV8A 2O7QA 4DF1A 1I2OA 2Z6JA 2XFWA 3O8AA 3W7KA 2ISSA 3H55A 5G1TA 5FEPA 3TJXA 3HG4A 5HUPA 5A5WA 3SFKA 2PURA 3PB0A 5AHLA 3TFXA 2J9ZA 3HIJA 3OEXA 2PRHA 2B7NA 2E5CA 1WOBA 4LW7A 1TJPA 3TIMA 2R8WA 5A8GA 2QDHA 4XBSA 2FLIA 4MFDA 4IMGA 1SZFA 4UTWC 5KINA 3M5YA 4Z1CA 4I7UA 3NL2A 1FCBA 2CLIA 2NXGA 3GXPA 1PV8A 5EBUA 4LS0A 2G97A 1EP1A 2ZTJA 3UD6A 4TU1A 3L0NA 3TMQA 3W22A 3TW6A 5D2VA 4NX5A 4WY0B 2QCGA 2TMDA 1DJQA 4NZFA 2YPIA 3W85A 3TX9A 3W7DA 3M7WA 1OFDA 4JTSA 1W5QA 3PVFA 2YYUA 3LRKA 3WK0A 5C54A 2UV8G 2QKFA 4JX4A 1H7WA 3LCFA 4GFSA 5HR7A 2JKEA 1WDWA 4UFJA 3RLVA 1IIHA 5U4NA 4PL2A 3L68A 4DO6A 4JYFA 4LC8A 4O1BA 1X1ZA 1R47A 4UMAA 1OYBA 4GUIA 2VC6A 5KSWA 3GIYA 4ZMGA 4DPPA 2NX1A 2QCHA 1IIGA 2EF9A 3M5ZA 4UIOA 1UASA 5C5YA 1XDLA 3DBPA 2Q8LA 3M0ZA 1PHQA 2R94A 3IV3A 1KM2A 3HJZA 4O0KA 5EPDA 3TUUA 4K36A 1TQXA 4O28A 4M5PA 3W1XA 1SSDA 2PRLA 3G18A 3GDKA 3FKRA 4CCDA 4AHQA 3PF3A 4LWWA 1XCFA 3FLUA 2DZWA 2R14A 4E38A 3MMTA 1M6JA 5F2LA 1JRCA 3SJ3A 1IXOA 1NSJA 1SW7A 3TW7A 4Z08A 3W7RA 4FNPA 4LY8A 4XQ6A 4NU7A 2B7QA 2GQAA 3LV5A 2WQPA 3HOJA 4Z1BA 1RR2A 4YWIA 1LBLA 4CNPA 1YTEA 4XTIA 3TJLA 4O14A 4QJ1A 4CQ9A 1G69A 1B4KA 1D3HA 5BOOA 1XBZA 3ABRA 4JXCA 3GAKA 3UWZA 3QJAA 3LXBA 4L4LA 3HGRA 1I45A 1XUZA 1H50A 3V1PA 4QQ3A 2QUVA 3FYOA 3DI0A 1A5AA 5D37A 1KTCA 1VH7A 1O60A 4NXKA 3W7CA 5FF0A 3UWVA 3C52A 4LOCA 3THQA 5TIMA 1XL9A 1L6YA 2C13A 3A22A 1GYLA 1H1YA 4LVDA 3ANYA 4NT0A 3PUDA 5CZ0A 3LM7A 3G24A 1M7OA 4RZ4A 2YX0A 3DKLA 3CLMA 3ELFA 3B0UX 1SO6A 2P10A 3G1XA 1LOSA 4UXDA 3KRSA 3NG3A 3GXNA 1L6SA 3UYCA 2ATSA 1GJPA 1EB3A 1YDVA 3B0PA 5AC7A 2QUUA 1JRBA 2CZ5A 1LRNA 4UTIA 4UFLA 2I9EA 3P61A 2CLHA 2E1DA 4HT3A 2WJZA 4DO5A 1U83A 4ZQMA 1XUUA 3U6WA 3IIPA 2BLEA 4UUIA 2KZHA 4XTDA 3BG5A 1B3OA 1LYXA 2VFHA 4O15A 4WQ6A 2H90A 4POCA 4JIPA 4AF0A 4AB4A 1TCDA 3TAKA 2EPHA 1H60A 1F76A 2YW4A 3W70A 1KBJA 3HPSA 4N6EA 3W1RA 5LNUA 3B06A 4YCPA 5LSMA 2ISVA 4OU1A 3E02A 3NL3A 4IX0A 3O6DA 2VEKA 4O13A 3IVSA 2X16A 2VXNA 3A9IA 1NEYA 4OHQA 2PRMA 2RDUA 4ONVA 1Q3NA 2J24A 2V8ZA 3EWXA 1DVJA 1SU5A 2OMAA 3TQVA 2FTPA 3STGA 1NAL1 1EWDA 3T40A 3MHGA 2YFOA 3G0XA 3R13A 4IMCA 1H51A 3TKFA 2I1OA 4HSOA 3BW4A 4H4IA 4UNKA 3DENA 3QZEA 2VFEA 1W5PA 2ZRWA 5D33A 3W71A 4Y90A 3TFCA 1EX5A 1GTEA 1UBSA 4NJHA 1OF6A 4OV9A 3C2EA 4ZQRA 5AN7A 1ZAHA 1TMHA 4Q32A 4K7YA 1EP2A 1TJRA 2Q8ZA 3BPWA 3NQVA 4XKYB 4HPXA 3EX2A 5C55A 4MKNA 3W74A 1H63A 4RXFA 4BWLA 3TCEA 1HO1A 3BARA 1MSSA 3GDLA 4O0ZA 1F2JA 1E51A 2DU2A 4IMEA 3T55A 1VYSX 1VZWA 1C8VA 2GVGA 4TMBA 1RV8A 3KVMA 3TC7A 4N4PA 4S2CA 1TV5A 3NM3A 4GUJA 5I3HA 3OVPA 1VCVA 1L6WA 3L65A 5KZEA 3QMSA 1VGAA 1ZHAA 1OYAA 1ZY9A 2R91A 4LTSA 5CSSA 3P5ZA 1VC4A 4JN6A 3M47A 2ZZ2A 3W1MA 4QNEA 3NQ8A 3OIXA 2J6XA 1S5VA 1BKSA 3MI2A 3R5EA 3W76A 5H2ZA 1ZNNA 1TYGA 3O6YX 1T99A 1FDJA 1P5BA 3B0VC 3N19B 4IMFA 4MZ1A 2E6FA 4X3ZA 5LGXA 4O54A 4AAJA 1KFJA 1KLYA 3HG5A 4FEZA 3G3MA 4K37A 1BTMA 1JVNA 2GPTA 3KX6A 3SR7A 1OFOA 3NVTA 2E5BA 1JCXA 5AFDA 1DQWA 1ME8A 2RKXA 5J5DA 1H7OA 1SO3A 4Z0JA 3L0KA 5G4EA 4IGHA 1ML1A 3SZ8A 1ICSA 3PUOA 5E1QA 3BG9A 4NQ1A 2Z6IA 2X1SA 1PE1A 4M19A 4R33A 1I4NA 3QF0A 5G2IA 2Y63A 3Q58A 5CSRA 1SUXA 1W3TA 4CNNA 1SZNA 1GZGA 2JK2A 2ZRVA 3W7HA 3B8DA 3L67A 2Z1BA 5HR6A 3LCHA 4O1CA 5G5IA 3LBMA 2J9YA 1R46A 3UXDA 4FF7A 4YCOA 3LTPA 1K7EA 1AL7A 3BO9A 1TPH1 1FWWA 3G8RA 1TPVA 3CPRA 3VE9A 4ZQOA 1WA3A 5I3IA 3N14A 3QMTA 4LVBA 3FFSA 1YYAA 1EIXA 3TSMA 5F2GA 1KM3A 3BGJA 3I6RA 3S1WA 1XBXA 3WK2A 1SQ7A 2EGZA 2DP3A 3LDVA 3W7QA 3LCXA 3I7RA 5HULA 5L9FA 3STFA 3FA5A 5AYXA 4E0CA 1QNVA 5AC8A 3P8JA 3GB6A 1FWNA 5F4XA 2VEIA 3W73A 1KW1A 1F5ZA 2Z0IA 3KVKA 3W7MA 5LNSA 5BNKA 4JYEA 3LCIA 1R30A 3EXSA 3WFAA 5HWNA 3ABSA 3AO0A 3BG3A 4NZJA 4FNUA 1OFQA 1QOPA 4GWEA 2OZ0A 2A85A 2XN0A 1JCLA 3UY7A 1B4EA 4ADSA 1JCMP 3EX3A 2YR1A 3ZFHA 4CQAA 5G2HA 2OT0A 3W7JA 2X2GA 2W0UA 3FYPA 5AYYA 4M6PA 3LTYA 1K3UA 3MI3A 2EAWA 1K8XA 1DV7A 1O94A 2GQ9A 3W2MA 4O12A 3W7PA 1TPWA 1VS1A 1A5SA 3GDRA 5D02A 4NUWA
chains in the Genus database with same CATH superfamily
4NXSA 5CEWA 2FTYA 5DCEA 3VGHA 4A8LA 1U22A 4DF0A 5K9CA 2NZLA 1XG4A 1M7XA 1XLHA 1UR2A 1H4PA 1N8IA 2FIQA 1V0KA 2W6RA 2DH2A 4S3KA 5BROA 4DYKA 3KWSA 5FJRA 2WPBA 3ARSA 4ICNA 1DPMA 1DOSA 1DJXA 4HVXA 2ZRUA 3D47A 4D6FA 5CSUA 4GX8A 2ZZ1A 4B3KA 3GXTA 3NQGA 2YB1A 1DWAM 1KLZA 4JNYA 4B2DD 1TR1A 5C9XA 2J8GA 1KFWA 1P0DA 5DBTA 3VDAA 5KZ6A 3RX3A 5AHNA 2VFGA 1RCXB 5GJNA 1NDWA 4H7CA 2C0AA 5I0DA 3TMLA 1R7AA 4AD3A 2PTDA 1JGIA 4RW3A 1ONWA 2W27A 3S8HA 3DG7A 2OOGA 4HHMA 4Q8PA 3PG9A 1EQCA 4GX9A 1R9YA 3ALGA 3CUIA 1HIZA 4N4QA 4AD1A 1JZ6A 3SN1A 4DELA 4H6EA 1TQJA 4Q4KA 1GPWA 4HHHA 2VUYA 2MNRA 2Y8UA 1TV4A 3LV6A 4MWAC 4HBKA 4DJEC 3A4JA 1WBJA 4S23A 1OCJA 3UWUA 3NXFA 3ZYZA 4UQDA 1ITUA 4GI6A 3W87A 1UA3A 1Z44A 1OZMA 3MHUA 5I79A 4ASTA 3T09A 3MYPA 4C1NA 4PH6A 4FI4A 1US2A 5EYWA 3NQ2A 5EA9A 3WNKA 3EX4A 4CQCA 2D23A 4S3JA 3WLMA 3RK8A 3AALA 3NQFA 3SN4A 3FOKA 1J12A 3USZA 5HMSA 3NQ6A 1OT1A 3ARWA 7REQA 1LG1A 3FVDA 1X39A 3N2XA 5B7YA 2YXGA 1GVIA 5CKSA 1EIBA 1J10A 1NFPA 3W1TA 3CYVA 3NQMA 1XFBA 3P3BA 4TXEA 1VPYA 1WUFA 4XSLA 4TVDA 5DRCA 2X09A 4RV8A 3M0MA 1YRRA 1SPQA 1O5KA 4O53A 4AY8A 2ABBA 3WBEA 1M1BA 3S42A 4G2DA 2WO5A 2ZVIA 4ZR8A 1M03A 5M03A 5BXRA 4ROPA 2A4AA 2YIHA 4YLWA 3HG3A 2OKTA 1GQLA 2DZBA 3T0AA 2QLYA 1MUWA 3OVQA 1IR1A 1KXQA 3HQ1A 4GINA 2BTMA 2Z28A 2ACRA 3LSCA 1BWKA 3HPXA 5AHIA 2XN2A 4GZIA 4K6AA 1XJBA 4HCDA 3WNOA 2BHUA 1TWWA 3BANA 3VX1A 5A2BA 2EPKX 1GKQA 1QI4A 5FEXA 1QRQA 1LL6A 5B7ZA 3EX1A 1EJXC 1JUEA 5FL1A 1VP5A 3WIJA 1H5YA 5REQA 4I5RA 4A29A 3SGGA 5GNZA 1OGSA 4KRUA 1RJPA 1KFKA 2PDJA 4F0SA 4MLJA 3AS2A 5AYIA 4FB7A 3CL6A 1FWTA 4XZBA 1G94A 3UWEA 4GJ1A 5FEWA 1RQBA 5JIPA 1TJ1A 1F3TA 1E71M 1CNVA 1UPPA 3O2LA 3NSXA 1W54A 2YXOA 5BRQA 3KOXA 2EKCA 2BXZA 1P4CA 2IQTA 2VI0A 1I2RA 3OG3A 1OK4A 3VO0A 3WNNA 3DC8A 4J35A 1EO7A 2INZA 4XKYA 2C71A 3DUGA 5TBOA 2EPOA 2EQDA 2I57A 3VNKA 5FKYA 1NWTA 4UC5A 4WR3A 3I3BA 1VFHA 2CESA 4L4OA 5T9BG 1JCJA 2D2GA 2P5NA 3KZPA 3IJ6A 3W29A 3TYDA 5CG7A 4DJDA 2VKZG 2WCGA 2XWEA 3IARA 4FNRA 3DYOA 3GIQA 3QGKC 1LP6A 4N9BA 3QH2A 4GXPA 5DMMA 5H8UA 1EYWA 3UERA 2CZFA 1AVAA 1KR0A 4DLFA 3AXIA 1Q6GA 1TG7A 2PTYA 3G8EA 1S5WA 2NWRA 3WLSA 3ZO9A 5BOEA 4F0MA 2PDGA 3NGJA 3LENA 3GD6A 1O66A 2EG6A 4IOTA 1Q5MA 4HJFA 4S2BA 2WHLA 2YFNA 1RZMA 3V0TA 4FX6M 3SRDA 3VI2A 2ESCA 4MWAD 4DJED 3CL8A 1JJKA 2A1YA 3O6CA 4JTJA 3CL7A 3SIMA 1EF2A 1FCQA 4HYVA 1CXHA 4ZO7A 4EF9A 4J40A 2W79A 2Y4SA 1NELA 5D8WA 3ZVHB 3M5VA 1XIIA 1Q63A 3C2YA 4ORIA 4MB3A 4I7WA 4R7JA 4A2SA 3CQHA 1NOUA 2G5WA 1EJ7L 5D9MA 1TWSA 2PGWA 2PFHA 3M6DA 3EMCA 3TYUA 3GXFA 4Y2WA 1VB9A 3WKZA 4DNHA 4D8ZA 3NOEA 1OX4B 2ZX5A 4IL2A 1ELSA 1SW0A 4PMNA 4ALDA 1G7UA 4PSRA 2IKGA 3LQGA 1UWTA 1E4MM 3B0XA 3BMWA 1HP4A 3M16A 5BOFA 4JX5A 4DAIA 1BVNP 4YL2A 2OJPA 4J3XA 3TDFA 3W7IA 3NQDA 4AEOA 1DQUA 3NTYA 3TQKA 4MNMA 1AW2A 3EZ4A 1S38A 1TSIA 1EUAA 5T9CE 1MDLA 6CGTA 3LLXA 4UR7A 1FQ0A 1UZ1A 4LT9A 2ACUA 1W0MA 2OPJA 4U5KA 3OZPA 2GOKA 3HMCA 4PMVA 2VCCA 3VIKA 3DFQA 2JF7A 1N7KA 4LXFA 3I4KA 2GUUA 1KRAC 4CNTA 1W2PA 3M5XA 5G1YA 2WZIA 5IDIA 1FP8A 2DQWA 1ZFJA 2Y5JA 3NYDA 3PTKA 2RDTA 4XK2A 3AJ7A 3SI9A 1QNQA 1B3ZA 2B7OA 3LPOA 1XLIA 4AMAA 1Z42A 3QR1A 5F1UA 4REQA 4UNIA 4Z42C 1J8VA 1PBGA 2VCAA 5JU6A 3K4WA 5DY3A 1NQ6A 3CUGA 2BHYA 4GYPA 4NJKA 3EKGA 6XIMA 2VOTA 3AICA 4Y8EA 5H8MA 1ZRQA 1KFLA 4IH3A 3TR9A 4IGSA 3KS6A 3MJMA 1J18A 3E12A 4JS3A 3IS4A 3DDMA 3HTWA 1ZL1A 4J3ZA 5DXYA 5HXMA 4EPKA 1UBPC 4IF2A 4MTVA 3LI0A 3W1NA 3MBDA 5ECUA 1FHLA 1FFQA 5AC5A 3TE9A 1JAKA 1HVXA 2ODOA 3ABOA 2VMFA 1QU4A 4N02A 4HB7A 4HD5A 4ZENA 3B3DA 1W91A 2PF8A 3ITXA 5F4WA 4DM1A 1DJWA 2G41A 3W83A 4KWOA 3ITCA 3PZIA 3MP3A 7TAAA 4QTGA 2VQUA 4HOZA 3GIPA 3M0IA 5ABGA 4BQ2A 4OECA 4DBEA 3FEMA 4GQRA 1LBFA 1UJQA 1ZAIA 1ICQA 3DG3A 3PZ9A 4GVGA 1Q7MA 1YMYA 3V16A 1OFPA 3IGUA 3LUTA 4GY7A 1V3HA 3S5NA 2XVGA 4PODA 4J1OA 4I7VA 2ZDRA 4MSSA 4BK9A 3SSJA 2BFGA 4Z17A 1O5RA 3A12A 4ZSTA 3S2LA 4UNLA 1YTDA 2PD9A 5C70A 4R7WA 4XISA 3IACA 3MHFA 3G0SA 3QOMA 5C6MA 3UPWA 4PMZA 1JYWA 4CNUA 4XVEA 3CAQA 1FH7A 3CU2A 1HJWA 4O4VA 3S4TA 3WYZA 1TJ2A 1UC5A 4JTHA 1REQA 3WLTA 4JL1A 2REQA 2B81A 2PLKA 2QAFA 3BXWA 1JQXA 1LRTA 1PWMA 3CUJA 2G50A 3N04A 3M0YA 3TP4A 3EXTA 3STCA 3DHFA 3LCWA 3UP8A 4N9DA 1GG0A 2WC3A 3P2VA 1SZRA 3LHUA 2CBIA 4L1GA 3WQVA 3TVAA 5I78A 3VAVA 1JXJA 2AL2A 4ZXOA 1KM0A 4OT7A 1XLBA 2AAAA 3S2NA 3VGEA 3IJLA 5I3DA 1LF1A 4IIDA 4XAFA 3QFEA 4OWGA 4G9PA 1QT1A 1IEIA 5F2MA 3I7QA 4X2PA 4PMDA 1TTIA 3NSNA 5CPMA 1ITQA 3TROA 4XD5A 2XIMA 1QPOA 3EWUA 2WB5A 3UW6A 1G4SA 2CLMA 4JN7A 1B2YA 4PMUA 3S1UA 1KV5A 2CU0A 3KDOA 3I3DA 3MTWA 2PPGA 3FGCA 3PZNA 3C2FA 2QEZA 4KW2A 3URBA 3WLOA 4HZMA 1R3QA 1A5CA 4DZIA 1FOBA 4D6JA 3LCLA 4BQ4A 5C0QA 1HG3A 4JGDA 4DYEA 3MUCA 1KB3A 3LA4A 5B80A 3MUAA 5I02A 1QK0A 2XSAA 1NOWA 4JTIA 4F66A 4GUFA 2XYLA 4KFNA 2WKGA 4QLJA 1IQ8A 4GYPC 2V81A 3OVGA 2HRWA 5AHFA 4PUMA 4A3UA 1XIGA 4CUCA 1X6UA 1P0EA 1UR8A 2FZMA 3HURA 1V6WA 5H91A 4AIEA 2EBNA 2HVOA 1LWJA 4Q8NA 2GK1A 3RMJA 1E73M 1RK6A 3K8LA 1BF6A 3EKZA 2VVSA 3THDA 1YPIA 4X9YA 2L5HA 2QV4A 1J5SA 4JTAA 3H12A 3CWNA 4H9UA 2GJNA 2J66A 4JTCA 2V5BA 2NV9A 2BGNE 2WNZA 2Y70A 5D8ZA 4UFHA 3WG6A 1MXSA 1IXPA 2F6UA 1TMQA 4N9CA 1ZALA 4GZEA 1JZ5A 5GNYA 1EP3A 3R0DA 4DJDD 4GOAA 4M81A 2VR2A 4Q4RA 4AX6A 1EJTC 4C1NB 1J5TA 1FXQA 3V3WA 6ALDA 2GDVA 4MYXA 1FUYA 3LRMA 2G3JA 2I9UA 4L61A 1UMYA 5D32A 2YA1A 2QPUA 1TX0A 1ZSXA 2H9AB 3GNXA 4X22A 3G1RA 3MMWA 5EMLA 7REQB 4CCCA 2H8XA 3L66A 1H49A 2Q02A 3MT1A 5CBIA 1J0JA 2PA6A 1JDEA 1IV8A 1I0DA 4QROA 2VZOA 4TV6A 4ATWA 3ARXA 3EWYA 5FD0A 3WJYA 5JBDA 4H7ZA 2JFEX 5E70A 3VFCA 4GJIA 3W9ZA 2PP3A 2TPSA 3UJRA 3U8GA 1B3WA 2A3LA 4MAVA 3NYZA 3RO6A 4QLLA 1EKOA 3MCNA 2QMJA 3S5YA 1C7SA 5HAOA 1WZAA 5KZMA 3O0KA 1ZB5A 3PZVA 1P7TA 1DWIM 1P1MA 1NVMA 3F4WA 1Z48A 3S6OA 1W32A 4ML9A 3VU2A 1E6NA 3HQOA 4H83A 1UQZA 3DHUA 3N3MA 3PZMA 1E0XA 4I9MA 3XISA 2X8RA 4Q22A 2ICSA 7PTDA 1DORA 1AA1B 2RGLA 4I9TA 2VGIA 4BFAA 4IIBA 1VJSA 2P0OA 3BLPX 4JDYA 1R38A 1E9IA 2D2HA 1VBRA 2W91A 4OOUA 3II1A 3KCOA 4Q3MA 2ISWA 3NQCA 1V3IA 3MUZ1 1HL8A 4QDWA 1UH4A 3H4XA 1KRMA 4L6DA 1BHGA 4DEFA 1LM1A 3SCVA 2Z1WA 4XAZA 2VELA 3VIHA 1ZZMA 5I23A 3KOYA 1IEQA 3WQDA 1H1ZA 2DZUA 1MDRA 4TX9A 2DUAA 5AVHA 3ME3A 3VGFA 4GYKA 2WOQA 4GA8A 1YW1A 4P61A 3FAWA 2DORA 4M6VA 4S3FA 3HV9A 2VTFA 4GIRA 1D3GA 4QNWA 5HWMA 3VM7A 4KRZA 3SCPA 4AF0B 1MI3A 3L2MA 1FWJC 3QMRA 2VRQA 3WF0A 1W37A 4BI5A 2D3LA 3AI0A 3CIWA 4JZ5A 1TMLA 4XKMA 2VZTA 2JKPA 3R0UA 1Q6CA 2ZXQA 3EMZA 4OOZA 3WJZA 3N18A 5FJIA 3DYPA 4HSNA 4P7LA 3EDDA 4BI6A 2D0GA 2DSUA 1UZDA 1KFEA 1Z6KA 4C6MA 2XH2A 1XLJA 1DHKA 4XZ9A 3UZZA 3QW3A 1DIDA 1XD1A 3BW3A 3M41A 2GQ8A 4R5EA 4JTEA 4KEVA 4QSHA 4H9XA 4GYJA 1FTXA 2PWEA 4FZIA 4HCLA 2QJIA 2F9RA 3ANVA 5LIYX 1QOQA 3BSGA 1PZ0A 1O5QA 1IGSA 1SJAA 2PDWA 3RF9A 5J5RA 1G4TA 3TLQA 4XZHA 3B8UA 1BXBA 1E1CA 4DQWA 1QBBA 3C3NA 4XZMX 1JCYA 1TUFA 4AG0A 4PEKA 4UTWA 3KBJA 1MEIA 4O4WA 2DVTA 4FALA 1NWSA 2OKOA 3AIBA 1TB3A 4ORMA 4GC3A 3OOQA 5XIAA 4IQJA 2ZZ3A 2JGYA 2GVJA 4AXKA 5AOUA 5DMNA 4DUWA 1EA0A 2IMRA 3BK0A 4JX6A 1U33A 3U2ZA 1IT0A 3PS7A 1VYPX 4KT2A 4EACA 4WXYA 2E09A 1SJCA 1T0OA 3WX7A 4UFMA 3N6HA 5EU9A 2BOFX 2GQ3A 3PR2A 4CU8A 4AFYA 1NDZA 1TA3A 3VNMA 1K6AA 4GZJA 3D5HA 2XH4A 2BVYA 3UNTA 3C8FA 2QDGA 1UJPA 3TXVA 3EWCA 4ZL1A 4F40A 2YA2A 1CWYA 2GGIA 1BYCA 4GY1A 2YSWA 1TPB1 4GUGA 1W1TA 1T7LA 3QR3A 2OCZA 2G37A 3H7UA 2HPMA 3OA5A 1RBOB 4REQB 5DCBA 3FIGA 1XX1A 4UFKA 4LJ3A 1UWRA 5BRBA 3Q94A 2G3MA 1E4LA 2AKMA 2Y8KA 5CPSA 3L5LA 5LGZA 1B0IA 1YPFA 1WYIA 1QI3A 1EEPA 1UR4A 3M0XA 3UJFA 1HNYA 3EOLA 4WD0A 3BLEA 3G1AA 1YNYA 2F38A 6REQB 3PPCA 2HMCA 3HV8A 3T0BA 5F2IA 3HMJG 2F2HA 4R85A 3WQ5A 1QASA 2V30A 3RPMA 1PTGA 1VCGA 1WP6A 4NP7A 1A47A 3YPIA 4Z2KA 3AYRA 1TZZA 1VENA 1MXGA 1SJDA 3FKKA 2WKJA 4H00A 3GHRA 5LHFA 1Q45A 1P1XA 4GGHA 3RUBL 2DJLA 4A22A 3AMDA 4KFOA 1M65A 1V6UA 3L2IA 1SFSA 2XVPA 2J74A 3N4AA 1EGZA 3BGGA 2FYMA 4F2UA 3WFZA 1PEZA 2XSBA 4C6FA 3ZLGA 2WHJA 2QPSA 8RUCA 1WXZA 2QPXA 4KESA 1JZ8A 2A7RA 2PGEA 1RPXA 5HINA 4HKPA 4WUIA 3CIXA 2QIIA 4EK7A 1LOQA 2QQ6A 2Z6JA 4MJ2A 4NI3A 3URAA 4FMVA 4PE8A 3W7KA 2CXGA 3OO2A 3H55A 3MV01 5G1TA 3TJXA 5A5WA 2PURA 4HNCA 3TQPA 2IPWA 4OIFA 2E5CA 1XRFA 3W81A 4IM4A 3ICJA 3AIQA 2R8WA 1K4GA 5A8GA 2QDHA 4IMGA 4UTWC 4XSMA 3VOHA 4MJ4A 1FCBA 2CLIA 3GXPA 5EBUA 1L6GA 2G97A 1EP1A 1MFVA 3UETA 4HJWA 1RALA 3AWNA 3TMQA 4UCFA 3TW6A 3VIFA 1QHOA 2BY3A 4LAMA 2FMOA 4WY0B 1TELA 1I6NA 2YPIA 4XO6A 3T1GA 4JTSA 3RM9A 2YYUA 3WK0A 5BU6A 3A4XA 5BZAA 3U4FA 1XIHA 1IIHA 2XFFA 5U4NA 4KGLA 3L68A 4DO6A 3DESA 4UMAA 4MB1A 2GDQA 4DPPA 3PWGA 2NX1A 2QCHA 3SUUA 3ZZ1A 5A8MA 5CAHA 2EF9A 5JUVA 1UASA 5C5YA 4HOXA 1XDLA 1JIBA 1PHQA 1B30A 3W27A 4O0KA 3E2QA 5EPDA 4D6CA 3ZIZA 2WMHA 4FA3A 4O28A 2YCLB 4BF5A 5DANA 2AQOA 2VWTA 3GDKA 3TN3A 4AHQA 3PF3A 4NASA 1UP3A 2E9BA 1XCFA 2VX7A 2WM1A 1V77A 2UY3A 4RL3A 3E74A 2R14A 1CPUA 3CZKA 1MW2A 2PDFA 4WSJA 1L8NA 1IXOA 4Z08A 3W7RA 1R85A 3FW6A 1TUXA 2OLAA 3SUSA 2Z26A 2I5IA 2WQPA 2HBXA 3HOJA 3IJDA 4YWIA 1JZ3A 2WANA 4QJ1A 2ZC8A 4CQ9A 1G69A 1T41A 4ZEPA 1XRTA 4B90A 3KHDA 5HNNA 3QJAA 3LXBA 4I9JA 2Q71A 1I45A 2GK1B 1H50A 3MKVA 3V1PA 4RZBA 1UHVA 3W7CA 2ZXDA 5FF0A 2W67A 3WN6A 4X61A 1V3KA 2C13A 1XIJA 2DT2A 4LVDA 3ANYA 4NT0A 3RR4A 3LM7A 3G24A 3BJSA 1M7OA 4RZ4A 2YX0A 2CBJA 2VURA 3SQSA 3ELFA 3B0UX 3CHDA 3NG3A 2ATSA 2WC7A 3B0PA 1YDVA 4W5UA 4KERA 3N3TA 4JCLA 1O7AA 4UTIA 2BVTA 2I9EA 2E1DA 4DZAA 2WJZA 1US0A 2ZDSA 1U83A 4F79A 3DGBA 4C6CA 1XIMA 2BGQA 1QVBA 3VMNA 3N11A 4O15A 4WQ6A 3VD9A 3CMFA 3IWPA 3S9ZA 4W85A 3W70A 4KPLA 4IPLA 4BQ5A 1BLIA 4YCPA 3A4WA 4OU1A 1EO5A 3O6DA 4O13A 4DBSA 3WQOA 2BGSA 1KRCC 1Q3NA 2Y0FA 3AZRA 4LGXA 4DY1A 3Q4DA 3EWXA 5CC3A 4Q8UA 4HU8A 3STGA 1A5UA 1NAL1 1EWDA 3T40A 2Y5EA 4WKAA 3MHGA 5CJNA 1J6OA 2Q09A 3G0XA 1H51A 4XD3A 3CLWA 3QZEA 3GTFA 3W71A 4MDOA 3TFCA 1EX5A 3A3XA 1OF6A 4GVHA 3C2EA 4ZQRA 1DP0A 3MKCA 4K7YA 1TJRA 4EWJA 3H2CA 4ILSA 5AC4A 4MKNA 2DEPA 3BLKA 4OVXA 3WH7A 1HJQA 2BDQA 5IFTA 4IG2A 4R9XA 3ENLA 1P7TB 3GDLA 5DT7A 2DU2A 3PK7A 4IMEA 3S6TA 3ZJ8A 3WQGA 2GVGA 1ENUA 1RV8A 4DI9A 2Z1VA 4YTSA 2PDKA 3NM3A 3XIMA 3L65A 4DWDA 4DVOA 3QMSA 5FJOA 6TAAA 1OYAA 2J7DA 2R91A 1A80A 3P5ZA 3AQUA 3OYXA 3UESA 3W1MA 2GGHA 1BRLA 2VX5A 1ZNNA 1B3YA 2DH3A 3O6YX 1T99A 4CD5A 1VFMA 4E2OA 2E8YA 1EJUC 2E6FA 2ZUVA 4JKLA 4HTYA 1AMYA 3VOGA 5LGXA 3EMQA 3E38A 3ONBA 2VEFA 4AAJA 5CZKA 3NDZA 1PYFA 4FEZA 3G3MA 1E9LA 4G8TA 1C90A 5RUBA 4HZ7A 3QGVA 4JFUA 3ITLA 3ITGA 1OFOA 2WM0A 3NVTA 1UD6A 3WF1A 1E0TA 4J3VA 1H7OA 2XVNA 2WYSA 3PUOA 5E1QA 1RHCA 3BG9A 4NQ1A 3ITYA 3IUIA 3GZAA 1F9CA 1PE1A 3VINA 5AVNA 1TV2A 2ZIDA 1I4NA 3QF0A 1PAMA 5CSRA 1KCKA 1SUXA 2XINA 1SZNA 1UKOA 2ZRVA 1TCMA 2Z1BA 4IFRA 3LBMA 4IP4A 3BO9A 1TPH1 1BSIA 1FWWA 4PTXA 1GPFA 1TPVA 3AIEA 2NW0A 1JD9A 3QMTA 1EIXA 3EDKA 3TSMA 3UZYA 1V3LA 3CJPA 4UQ9A 1XLKA 1BVZA 1M9HA 4KWSA 4H9TA 3U9IA 1XW8A 2ZUWA 2DP3A 4BY3A 4F0KA 3W7QA 5HULA 1ISWA 1U5VA 4LCSA 3B4YA 2NQLA 4E0CA 1QNVA 1LL4A 3H24A 7ODCA 1K70A 3RCMA 5F4XA 1DE5A 4FF5A 4G56A 2WHMA 2V6AA 1KW1A 1F5ZA 5LNSA 3FJ4A 1R30A 3EXSA 3ABSA 3AO0A 2Q01A 3POCA 4I90A 4H9ZA 2Z2BA 2A85A 2Z1KA 3UY7A 1JCLA 4HNOA 1J79A 1VEOA 1Y7VA 4FR6A 5CQ1A 3PNZA 4ADSA 4NHVA 4NG3A 2D22A 3VKCA 3CYJA 5C9RA 1JCMP 4H04A 3ZFHA 3IRSA 2OT0A 1EL3A 3T0TA 3QHOA 1FWBC 2X2GA 1F4AA 3FYPA 2V67A 3LTYA 4RE3A 3VZXA 3SDOA 2GQ9A 1DV7A 3W2MA 3K8KA 4O12A 2GSJA 3T42A 3TYCA 3GDRA 5D02A 2V5KA 3O06A 5CCZA 3DXIA 5T8GA 3PZTA 4LAKA 4YHGA 3IRDA 1F73A 1UWQA 3OGVA 5HJYA 4ZOBA 3GAYA 1XKYA 2PD5A 1XBVA 1QJWA 3S2JA 4JY8A 8XIAA 3VABA 1U1JA 2XM2A 3COTA 1DYSA 2P3EA 3KW3A 1Y0EA 5AZ1A 3W7LA 4AWSA 5FESA 1NARA 3BW2A 3EKLA 2VWSA 3Q37A 3U4AA 3AHVA 2ZA1A 1JYNA 2EG7A 3L0GA 3RLUA 1F74A 3GDTA 1PKNA 3F2DA 2FZNA 1KGWA 4JCMA 4NYUA 4V33A 4U28A 4LUYA 1WKFA 2G3IA 5IHRA 3PZQA 4EVZA 1P6BA 3KRUA 4JKMA 4E3VA 1JUBA 3GLCA 3UG8A 4C5ZA 1VCFA 1W3KA 3F4NA 2VRJA 1UWIA 2BWGA 2YZ5A 4AD2A 1LT8A 4EXQA 4YU1A 5EFDA 1XP3A 3BVJA 1BXNA 3T2OA 4AZBA 2R6OA 2X7WA 3SBFA 3W7GA 4MF4A 4CVWA 3CB8A 4FOUA 4H8UA 3FV9A 3WF4A 2PBGA 1OD0A 1TRIA 3DBNA 4CLMA 1Z69A 4UQCA 4UTJA 1PCWA 3IK4A 5I06A 4O8RA 2CLKA 1TPC1 3H4GA 1W3LA 4IJRA 1TVPA 3MUXA 1CEOA 4LRTA 1JUKA 3WLPA 3T08A 4AWEA 2YDQA 4MZ8A 4EF8A 1RLCL 2CPUA 2V3DA 4L4PA 4LAZA 4LBRA 4FAMA 2XVKA 3WJWA 3MUIA 4DF2A 1V08A 3REQA 2PWHA 4JICA 1LZOA 3UZJA 3FDGA 3ES8A 1HX0A 4JY9A 3IGXA 4B5XA 3CZEA 4HK6A 3ZJKA 4UCGA 3P84A 2CLOA 1Q7QA 5LYRA 2PWVA 3MI6A 4XO7A 1CGXA 3KLLA 1XH1A 3EWWA 4M0XA 4JFTA 1GZJA 3H2EA 4PCFA 3EEZA 3NDYA 2PP0A 1KM6A 3LG3A 3RDKA 1UQYA 2E6DA 4ERIA 4KCWA 2NWSA 3Q67A 1DXIA 3MQTA 1J9YA 4PTDA 2R1PA 3R4IA 5EL1A 1C3FA 3IEBA 4ZO9A 3B8IA 1PTDA 2Y7DA 3GG7A 1W1PA 3N1AA 4RK8A 2ZE3A 1VBJA 1UIPA 1C8XA 4WCJA 1QPQA 4XV0A 3BV4A 2E6AA 1EH9A 1HVQA 3K5XA 2C1HA 3G1DA 1YXYA 3NL6A 2QULA 4PMYA 1OB0A 5AB3A 3UPMA 3RU6A 3E0WA 4W5ZA 1QW7A 1UYQA 5AY7A 4XUGA 3D0CA 3MANA 4L7ZA 2RDWA 4GPNA 1I2PA 1EZ2A 4Y8FA 2PODA 4YS1A 4RZ6A 1T96A 3AHZA 1AK5A 2F8QA 4JTQA 3C0LA 1J4EA 1LBMA 5BU9A 4ADUA 3MJYA 1LLZA 5JBEA 3C2VA 1SM9A 3PN8A 5M5DA 3SY8A 1W5OA 5FF7A 1A0DA 2AAMA 3NPWA 1WNOA 2ZZ6A 9XIMA 1J11A 3CM4A 3IIXA 3NJ3A 1KA9F 2OZTA 1A50A 3A24A 4Q4MA 4AUBA 2ALRA 1F05A 2A3AA 5G4HC 4WX2A 2Y6ZA 4PCNA 1Q65A 3N34A 2QCCA 1ODZA 5HUOA 3QRHA 3RCYA 3O63A 4A8IA 4RDWA 1Y65A 3E5PA 4G7EA 1MRAA 3RN6A 2YJQA 3DFPA 3CWHA 3VUSA 3AS0A 4F0LA 1E4IA 4B9YA 4HMNA 4BJHA 2EPNA 5LIUX 4JNMA 3I4EA 4QS6A 5CPLA 3NZ1A 3UWWA 3QV7A 3LLDA 3M64A 1VFUA 2PDHA 1JQVA 4KWUA 3VDBA 1H7NA 4A8RA 3R8RA 3VUPA 2HS8A 4Z2GA 5FAGA 4P8WA 3PPGA 3KBWA 2W92A 2VFDA 3ARUA 2R1KA 1RA0A 3GR7A 3UR8A 3LBCA 1B3XA 3CPUA 3H2NA 4HMDA 5LKYA 1B5TA 1MW3A 4AEEA 3TA6A 2HTMA 3O16A 4PC8A 1QWGA 4GK8A 1I75A 2CC0A 1D7KA 3WEMA 1NFGA 5A94A 3FNDA 3R2GA 2SFPA 1UD2A 1GG1A 4QP0A 3SN0A 3ARTA 4JD4A 3KHJA 4NZ5A 4UB9A 1FX6A 1J01A 3GDMA 2PDBA 2VZVA 3UNDA 4MUZA 4WDXA 1BYDA 2B4GA 1NFBA 4QRNA 4M56A 2AQWA 1LJYA 6TIMA 3TYEA 1MXDA 3MO7A 4A05A 3OG2A 3PUEA 1KWKA 1ZAJA 1FH9A 5D2WA 2CLFA 3G5EA 2X1IA 4QEEA 3N2MA 1UA7A 2V3EA 1MVYA 4FLSA 3W2KA 1OABA 1XYFA 4GBUA 3AUOA 2VL4A 3CXOA 5G2WA 1LDCA 3E0IA 4Q7IA 4XIMA 1CIUA 2ZX7A 2RGMA 2ZADA 3HQPA 3JZUA 3UCCA 2TSYA 4F3HA 3MSGA 1H5VA 1GEHA 1GOXA 5FJJA 3KXQA 2AMGA 3EAUA 4FXSA 2WMJA 3EB2A 3KS5A 5E93A 1RY8A 4Y6GA 3ZR5A 2AKZA 3R7MA 3WD4A 4LPCA 3PUGA 1HFBA 3RRAA 3NO3A 4YTRA 3C5QA 4LVFA 4EPEC 3QR0A 3BLOA 3NPUA 2C3ZA 3B9EA 2PUZA 5HQEA 2HSAA 3HA1A 1GT8A 2J47A 2R82A 4L6OA 2QCEA 1DBTA 3CHVA 1H62A 3AROA 2QCDB 4Z1YA 4I3GA 4WJEA 4AWTA 3KDNA 1JFXA 1BRLB 2KAUC 3IIVA 1VKFA 1XCXA 2PDCA 1LROA 1MEHA 3AXXA 1XYLA 1CW2A 4JYDA 1VEPA 1CGVA 2HNEA 4GKTA 1NF0A 3W84A 1CGYA 3BOFA 1JYVA 4TV5A 3WDQA 2ZRXA 2C19A 2O4MA 2ZUNA 4WSHA 1VHNA 4QCFA 1RK5A 3LHTA 2HQAA 3W1LA 1CB7B 1J0KA 4NZCA 3RNDA 5CH9A 2V63A 1FY6A 2JEQA 5LXXA 5M1TA 3VOIA 2J25A 3WUBA 4HOWA 2VEMA 2CXEA 2QIWA 4AHOA 1DTNA 3PB2A 4W8BA 3OZYA 2A5HA 2NQHA 4C5YA 4HA3A 3A5FA 3T81A 3G22A 3UQNA 2O9TA 3TNOA 1H0GA 1R3RA 3WELA 2YZRA 3DFNA 1MWOA 3ZWSA 3K30A 5HMDA 3AMGA 1CGUA 2E9LA 4JTUA 1TPFA 4TR9A 8CGTA 1JXKA 2C14A 1H09A 2HK0A 4Q8WA 4HSHA 4K1WA 3GWQA 2IPGA 3SIZA 1G01A 4RNHA 3M0JA 3CO4A 2GVLA 4P7QA 1AQMA 4WZHA 1GOKA 2OFJA 4H01A 2OYKA 3R6IA 4LUTA 1EPVA 4S3CA 2FDMA 4HNLA 4NKCA 4JTFA 4TX6A 5DLCA 5CAKA 4ZB0A 3S5SA 1Z89A 1RH9A 4LYKA 1GNXA 4AC7C 2AMXA 3C0JA 2WBGA 3ONCA 2DUXA 7TIMA 3VILA 3W72A 1XBYA 1FWFC 3UZWA 3PWIA 4FR1A 4O1AA 5ECVA 3Q65A 4DXVA 3CAKA 4B3ZA 3UU0A 2YLAA 4B15A 3WEOA 2JGQA 4NZ4A 3SJNA 4WY0F 1HZYA 4ZQCA 3WNMA 3I65A 3L4XA 2C1IA 1KGUA 3CQIA 3FS2A 1C9WA 2FZ9A 2A21A 3ZOAA 1PS9A 4Q4PA 4RNJA 1XHGA 1R9ZA 3PBUA 2ZWYA 3PM6A 3UR2A 1O4UA 1J0HA 4PTMA 4Y96A 4EANA 1OFAA 1KRBC 4HPGA 3O1NA 3DFYA 2YDAA 1GQNA 3B9OA 4MY1A 5HATA 4QX4A 3VD3A 1GTHA 2YYTA 3B8VA 3ATYA 3W7OA 1UOKA 3NZGA 1JDFA 5F4SA 1FWHC 4KETA 2POZA 1X6NA 4BKNA 5DMLA 2WVTA 4XBKA 1XXXA 2P8BA 3NM1A 1KFBA 5I6SA 1SR0A 4W84A 4D6IA 4KFPA 1ZTVA 4GQQA 2H3DA 3RAOA 4DAFA 2G95A 5LNWA 3B0YA 1XIFA 1VIZA 4Z1DA 4DX3A 2CHRA 2FZDA 3KCLA 1SZEA 3W7NA 4WOZA 6XIAA 4HA4A 3PBYA 4O52A 1RPKA 4LFYA 1JL8A 1BPLB 2XGIA 1FWIC 2IXUA 4K7VA 2F2KA 4YIWA 2OZ8A 4JTGA 4PN2A 3GYCA 5D2TA 5E0KA 4GO9A 4IPNB 5E5CA 2P1FA 1VR6A 1G4PA 3SADA 3OQEA 4DIAA 1AH4A 2HPIA 2WW5A 1NJJA 3GXIA 1UMLA 4O1FA 5A2CA 1HXJA 3UGRA 1E40A 2AGKA 3I68A 3PSVA 2DZVA 1AH3A 5KMYA 1TPUA 2A2IA 1C9DA 5BCAA 1UR3M 2VX6A 3LLFA 3I3EA 1OX5A 1FWCC 2PWGA 3DN5A 5HANA 2BP1A 2O9PA 3KP0A 5D2YA 3GVWA 3TZFA 3BSMA 4LU0A 3QQ1A 4JOMA 3BCDA 4UTKA 2Y62A 1NF7A 5FACA 3W88A 4J2MA 2A7PA 2V68A 3UVIA 3W3OA 1M04A 5E6YA 4GIAA 3MS8A 5MKGB 3STPA 3S46A 3FXYA 4L5ZA 3HG2A 1E56A 2DZTA 3TN6A 4CQDA 3N4FA 2E4TA 2WVSA 2OSYA 3NA8A 2CBVA 1XI3A 3P7YA 1MYRA 3KAOA 2FDSA 2FVKA 1DXEA 1XDJA 4E2DA 4JPGA 3ZVHA 4PB4A 2XUCA 4YN5A 4HYRA 1FVPA 3QY6A 1W5MA 3I6TA 1PIFA 3W7EA 1VRDA 4V2XA 4KQNA 4PL1A 5FJUA 1IZJA 2Z1XA 4I5UA 2DUZA 3UGVA 4C6OA 4K8HA 4E8CA 3Q45A 1A4MA 1T8XA 1OX4A 2E8ZA 5FJTA 3T05A 1DJNA 3S9IA 1IWAA 1T6MA 4ZZ9A 1X7FA 2PZ0A 3T7VA 3F7JA 4H8NA 4ZFMA 4MOZA 1NP2A 1V51A 2H3BA 4CN6A 3WEZA 2NT1A 5D03A 3BAIA 1TIWA 3GG1A 2O7SA 3GG8A 1FDYA 1BWVA 1OGGA 1XR2A 3PP7A 2GOUA 4HN4A 3LM3A 2RHGA 1CI1A 2CHNA 4L4MA 1VHCA 3DGRA 4QHRA 1O68A 4M7TA 4WJ8A 3MO4A 4ZE4A 1S2WA 4OTKA 3GU9A 1BGAA 1P0KA 3EOSA 9CGTA 1GQJA 1Z8AA 1WZMA 4AH7A 3ORWA 3BQ5A 4D71A 4ZVJA 2FVMA 4M6UA 1UIOA 3OIHA 5BWFA 5I3JA 5HMEA 3BQ6A 4FLRA 3W4RA 1LRQA 4HZ6A 4IPIA 3P0XA 1WDPA 4MZYA 2ISFA 1LUCB 3P82A 3O0FA 2O92A 3AIWA 1F6KA 5D2XA 5I2UA 1H3GA 2Z1SA 4GMEA 4DBUA 3V75A 4F48A 5H8PA 4GKLA 5A1AA 3H7VA 1NDYA 4FO4A 1OG0A 5A8PA 3ZR6A 3DECA 2Q3RA 5I00A 5CGQA 4JFSA 3G77A 1QTWA 3L5MA 2WZEA 1W3NA 2Q8XA 3IAPA 2DT1A 1HF6A 1N55A 1E0VA 1E3ZA 3E3HA 2D73A 2Y7FA 3FN9A 2DZSA 4NZ1A 3VZZA 4MM1A 4TUFA 4C7GA 3WDIA 3AIRA 4IHCA 1F6YA 4LRSA 3T78A 2ZRZA 5A95A 4LC6A 1RXOB 4QQUA 3W2JA 5FL0A 3N2BA 3T4CA 2BBFA 1HKKA 7XIMA 3EXRA 3BDKA 1KXHA 2CWXA 5AECA 4N9EA 3KBVA 1TRDA 3FSTA 5G4WA 2G3NA 2IQ0A 4H41A 1F8IA 2YCIX 3OP2A 4UR9A 2EO7A 3ABQA 3PBWA 4CD7A 2C16A 2QCLA 1NQKA 2BY0A 3LPPA 1FA2A 1IWPA 1LL7A 1GORA 1MQQA 1L6FA 1SO4A 2ALDA 1GCYA 5CLTA 1R0MA 5BXSA 3S6DA 2OTDA 1M01A 3G3DA 3CEUA 3UY8A 4L65A 3QEZA 4RLIA 3JR2A 1OVDA 3L21A 3WLIA 1AFSA 1CT5A 3WQEA 3QYQA 1E72M 4GQGA 1XLCA 4V27A 1DE6A 4QIUA 3CBWA 1IE7C 1MUMA 2PAJA 4RPQA 2WZHA 4W7VA 4QG6A 1WCGA 3UWQA 1K77A 1I9CB 1XLLA 5DX7A 2Y1HA 2Y7EA 1FDZA 1H41A 5A6SA 3FDKA 5CJ5A 3KVLA 3R8HA 1EPXA 2ZICA 2PLCA 1PYMA 4KBXA 3UXAA 5K2ZA 2J7GA 2DVUA 4XUYA 5XIMA 3UCDA 1W1A1 3LXAA 2PF0A 3GU2A 4HMCA 1IT8A 1OG6A 3PZGA 4E4PA 1G7VA 3ZS4A 4CKQA 1BWLA 4HGXA 2QJHA 3H2FA 1Q13A 2GLKA 5HNRA 4CQ8A 3MP5A 1WKEA 1ZJHA 2JKAA 3EOUA 4AVOA 4GD0A 3SQLA 3WCZA 2WK2A 4FLQA 4W87A 1PIGA 4RR4A 3G6MA 3VMPA 4BQ3A 2P3ZA 4W89A 4J3UA 4DN1A 1S2UA 2QGHA 2V2DA 4OUEA 1W5NA 5IHSA 3MP4A 2NLIA 3V1HA 1V6TA 2J9XA 2A6NA 1S2AA 2XH0A 3M0VA 3TK7A 1H7RA 2NXIA 2W4XA 2WHKA 3JRKA 5FA5A 4KMQA 4DWSB 1GVSA 4RX0A 3KL3A 2FGBA 1TV7A 4LNCA 3F2BA 3LHWA 3CT2A 3W75A 1ZU8A 4Y9OA 4ACZB 3D6NA 3AS3A 3ZLHA 4LNYA 4PUNA 4IUOA 1F3XA 4DF1A 1I2OA 3MSYA 3HM7A 4AZHA 2ISSA 5FEPA 2UY4A 1UR0A 4NRSA 3H4WA 3PB0A 3TFXA 5HOSA 1F61A 2DY3A 3PHAA 3SEPA 2PRHA 4AD5A 2VZSA 4LW7A 2A3CA 5KETA 4WDTA 1TJPA 4PMXA 4KH2A 4MB5A 3W37A 4JIIX 1ESWA 4HA1A 2UZ9A 4XBSA 2G4FA 3WF3A 1V4YA 2XPKA 2BOGX 5KINA 2HV5A 2BODX 2DSZA 4A3QA 3P14A 3B97A 1PV8A 3KL5A 1P0BA 3E0VA 3N13A 4HMEA 4LBUA 2ISDA 1XLAA 4V28A 3W22A 2XG9A 1WZKA 5IXEA 5D2VA 2W9MA 1R5YA 3R58A 4NX5A 3TA9A 2QCGA 3GY1A 3MC5A 3CHEA 4LUTB 2VC9A 2H9AA 4NZFA 3WBYA 3RX4A 3W7DA 3PVFA 3LRKA 2UV8G 3R10A 1H7WA 4GFSA 2XWDA 2YA0A 1WDWA 3RLVA 4PL2A 3TJIA 1PXGA 3MV11 4LC8A 1X1ZA 1R47A 3TYZA 3A3HA 1IR2A 1OYBA 1R87A 4ZMGA 4UQAA 2FKPA 5A2AA 4FP1A 3VGBA 3PBGA 1IWBA 4ERAA 3M0ZA 3IV3A 2ACQA 2WSPA 3APYA 2DW7A 3ZSSA 4R27A 5HQLA 2HVNA 2QGYA 3AU2A 4CCDA 1IEVA 4LWWA 5BYWA 1OINA 2D2JA 3FLUA 2DZWA 1V3MA 5CGMA 1OADA 4W7WA 5F2LA 4AZIA 3SJ3A 1NSJA 4KCTA 3BMVA 1D7FA 4QEHA 4PBGA 3BAKA 2B7QA 1JZ7A 4QXIA 4QLKA 1LBLA 2Y2WA 3TJLA 4MG4A 2V5CA 1B4KA 1B54A 5BOOA 1B90A 4PRTA 4JXCA 3GAKA 3UWZA 4L4LA 4Z2IA 3T4WA 3FYOA 1VF8A 1A5AA 4JIEA 1VH7A 1O60A 4NXKA 4LOCA 1XLMA 1UD5A 1GYLA 1I0BA 2WZMA 1Q7ZA 3CLMA 2YBTA 3W53A 4S38A 1E5JA 4UXDA 1LOSA 4LF1A 4MNLA 2TAAA 3UYCA 1UZ4A 1GJPA 1YBQB 5AC7A 3BAWA 2ASHA 4B16A 4C6PA 4XD6A 1LRNA 1Q2SA 2WVVB 3WQWA 3AISA 1XUUA 3CUZA 2BLEA 3BUVA 3M4HA 1LYXA 5E0CA 3H7RA 4UQBA 2E3ZA 2VO5A 4POCA 3FY1A 4AF0A 5TF0A 1E6XM 2EPHA 4M51A 1H60A 3MU7A 4NAEB 4ICMA 3KOWA 3OLGA 5LSMA 2ISVA 4B3LA 1NP0A 2Y8VA 3IVSA 4HYWA 2VXNA 2PEVA 4WSKA 4XZLX 2PRMA 2RDUA 3OLEA 4ONVA 3NSMA 1V0LA 1Y5VA 1ZQ5A 1W9VA 1DVJA 4C6EA 1SU5A 3TQVA 2JF6A 3AIVA 4L9ZA 1I1WA 2WC4A 4GBDA 4PUWA 3TJ4A 2UY5A 3CUHA 2YFOA 4GY0A 1XLFA 1K9DA 3KE0A 1WO2A 3R13A 4U5IA 3RGTA 1Q8AA 4YJ5A 4H4IA 4UNKA 3DENA 1KBLA 4UOJA 1W5PA 5GQBA 3W02A 2FTWA 2Z4GA 1GTEA 3QPEA 3TTSA 4OV9A 3VC5A 3KM8A 5AN7A 5A6AA 3GC5A 1EP2A 4LALA 1UW9A 4AX7A 3EX2A 5C55A 2YB4A 2XJ7A 4O8AA 3URQA 2XM1A 4RXFA 4BWLA 4DUXA 2W66A 1UKTA 1A3XA 3TCEA 3E0LA 4NYYA 3WSUA 3UF9A 1CDGA 4XX6A 3SURA 5JVLA 4C6BA 4TMBA 3AS1A 2W63A 1NH6A 4N4PA 3VX0A 3APTA 3RG6A 3MKKA 1ZBVA 1L6WA 3MMUA 5KZEA 1DTUA 1VGAA 1ZHAA 3E2RA 4PMRA 1VC4A 2BB0A 3M47A 5JIWA 3NUKA 3L7RA 3V5OA 4UQEA 3NQ8A 1BKSA 3MI2A 3ARRA 3W24A 4XIAA 1LT7A 1TYGA 4H19A 3WNPA 3A13A 1P5BA 1KQYA 3N19B 4JQ1A 5FSEC 4MZ1A 4DUOA 1TVNA 4O54A 1KFJA 1BTMA 3EB4A 1R6WA 3CV7A 4PBEA 1CCWB 4KS0A 2E5BA 1NDVA 1DQWA 1ME8A 2RKXA 4Z0JA 3VOJA 4V15A 4M19A 4R33A 4DBWA 5G2IA 1EEXA 3Q58A 2FGZA 3A3WA 2JK2A 1C8QA 2J79A 3B8DA 4YVPA 2R1MA 3VNLA 3VOCA 3GE7A 4RE2A 1HQTA 4ZE5A 4M29A 4YCOA 3ABZA 2PDIA 3LTPA 1EJVC 3G8RA 4GYFA 3AIUA 1WA3A 5I3IA 2VC7A 3NZPA 1YYAA 3GRIA 3TOPA 2CHOA 2EGZA 1OEPA 4GCAA 3LCXA 1LWHA 4PEEA 3FCPA 1SVDA 6REQA 2DPEA 5AYXA 3DG6A 4B5SA 2XZ7A 5AC8A 1PDYA 1ODUA 3SQMA 4A3YA 5CJMA 3KRBA 1WDDA 3W73A 1QOXA 4IZGA 3LNMA 4DJDC 1EC7A 1KQZA 4CNSA 3SCOA 3DIPA 2G0WA 1QOPA 4YYFA 4OZOA 3K2GA 3IAQA 1B4EA 3VOFA 4UZSA 2QVHA 5BXPA 5CLWA 1QHPA 3VDHA 2JALA 4UTFA 2POTA 4KCUA 3WH9A 1X1NA 4JFWA 1XG3A 4C6IA 5LA1A 1K3UA 3VKBA 3MI3A 4AZCA 3W7PA 1TPWA 1A5SA 4NUWA 3C6CA 1JG9A 3MCMA 2YL9A 3U57A 1KBIA 2PE4A 2ZCGA 3MSRA 5KTLA 3BV7A 3WH6A 1L2UA 2WMKA 4BWLC 4JTDA 2D24A 1K02A 1IXQA 1ISZA 2X0SA 1ZCOA 1RD5A 3CZGA 2GL5A 4OUIA 3DYMA 3URNA 4AYSA 4FIRA 2IUZA 1FH8A 5IDZA 3BH4A 1FCUA 2F61A 5I7GA 3CC1A 3P67A 4H9VA 4ICCX 3GVRA 3GQYA 1M5WA 3DZ1A 1WB0A 4P8XA 1GKPA 4QDPA 4ATDA 1L9WA 1D8WA 2IXVA 2ZYFA 4WVXA 5I3KA 1KGXA 4WY0A 3RXZA 2VOMA 3WFLA 2J27A 2QXWA 2QUMA 3QC3A 1S2VA 1QHZA 3C4UA 1YE6A 3HF3A 1YE4A 4OBSA 3HFYA 1TTQA 3BICA 4GHRA 3WLKX 4QE5A 1Q4WA 1QMLA 2ZZ5A 1UD8A 1BAGA 3KEHA 1DWHM 4RPPA 4F8XA 1UD4A 3ZSTA 3APGA 4YPJA 3BGAA 4QS5A 3N73A 4JTKA 1Z7AA 4JBRA 3LB0A 3FA4A 4LF2A 3W2NA 3UA4A 2CWNA 4TIMA 4ZBCA 1R3TA 1OGBA 4ENLA 4XZNX 1QNPA 3EA2A 3JVAA 1PCKA 1P48A 3N2OA 1XM3A 2YCLA 1V02E 1DJGA 3MYOA 2HEJA 1BYBA 4C6JA 2ZC1A 1UUMA 2QAPA 1DHPA 1GOOA 1ZUAX 1OK6A 3KLKA 3PTQA 3O15A 1SFTA 4I6VA 2A0NA 3M9YA 2Y89A 1XC4A 2OVLA 4YTQA 4O0QA 4DPQA 1W1ZA 5FF2A 1EQPA 4GC4A 5MF5A 1BD0A 5M3WA 2X7VA 3LGGA 2NVAA 4EIVA 3UYIA 4IL0A 1LLWA 2PZNA 1OCNA 2X30A 3UEQA 5FSDC 1E6QM 1EDGA 4YTUA 1WX0A 3VD7A 3WLLA 1TFVA 3CUXA 3SCUA 3TEVA 3G1YA 3HQNA 2R1LA 3R89A 4ZB2A 2A3BA 1C29A 6ENLA 1K9TA 2VEPA 1P6CA 3P6LA 3P60A 2A7NA 3NO1A 4OGZA 2WJDA 3TNBA 5G1MA 3S1GA 2J7HA 1WDRA 1BEUA 2OQYA 1HGYA 2V2CA 3GZ3A 1UP2A 4PYSA 1A5KC 1M7JA 2WLYA 1SMDA 5CZJA 1J0IA 4LSBA 1W31A 3B40A 2PCQA 1K03A 4FS9A 1WOAA 1M68A 2IPFA 3NDOA 5A69A 4RNIA 1IF2A 1VRXA 1ZJBA 5ABFB 4P8UA 3G0UA 3VIPA 5KITA 1ICPA 2OQLA 3V0SA 3VFLA 3HPZA 4UTTA 2VFFA 2HS6A 2V5LA 4MIMA 2IKIA 1F4HA 4JL2A 3JS3A 2Z25A 4MGGA 3PFMA 2QCFA 4ROQA 2G96A 3FK4A 2WCAA 3BOLA 3NZRA 1CBGA 3V18A 2WZTA 4HIBA 1YADA 5CPNA 1K4HA 1RVKA 4ZOEA 1L2QA 4GVFA 2CCRA 1NWRA 3STEA 2HVMA 3GR8A 4CU7A 3L4YA 5F1VA 2PLJA 4PUEA 2CKRA 3L5AA 5TD4A 1GYMA 4OJYA 3NAVA 4Y7EA 1XKJA 3TTEA 5GPRA 1HKIA 1AZ2A 4Y9MA 2X40A 3N9KA 4B5UA 1TE6A 5CSYA 1FWRA 3P0WA 3WQ6A 3H23A 5JQ9A 3LNPA 4DI8A 4DRSA 3MWCA 4IWWA 3NCOA 3DHPA 3KTSA 4HK7A 4AISA 2GSEA 4C1LA 3HO8A 1G67A 4IFKB 3ARQA 1QCWA 1VQTA 2CYGA 2XTKA 5CG0A 4QISA 1TJ0A 1T5AA 4FSAA 1PTAA 2FHCA 3C61A 2VVNA 3GHTA 2E28A 4UTLA 6A3HA 4G5DA 3EDEA 1G5AA 1WE5A 4LYRA 1T40A 4B5VA 1E1EA 2XVLA 3WLRA 2DW6A 4D8LA 1DIKA 5I07A 4GNKB 1JULA 1WPCA 4P7OA 3MVIA 1SO5A 2PS2A 4DUVA 3K46A 1UR9A 1S5MA 3DERA 5DF0A 1V02A 2W5FA 2PU0A 3OJGA 3FJLA 1S46A 2A6LA 1WZLA 4WDWA 4B5NA 1OSEA 1OD8A 3P8IA 2IQDA 4KRTA 4NAFB 2NVCA 2DIJA 3N2TA 2Y88A 2ZKMX 3LPGA 4B4HA 2OU4A 3RPTA 4UTMA 3QC0A 4YMZA 5DXXA 3IJ8A 4EWND 2W3ZA 3W0KA 3EBVA 3W2LA 3WUFA 4O10A 4L64A 1XQLA 4NY2A 3V5FA 2ZA2A 3IIOA 4U3CA 1A4LA 4LUIA 4BI7A 4DNMA 1UROA 3HGSA 1ALDA 3EDFA 2IW0A 4JEQA 1TTJA 1EYEA 4AD0A 1QDSA 4FIQA 3HJEA 1UC4A 3TZNA 2Z7KA 3DI1A 3JZEA 4FNSA 5HQMA 3AHTA 1KM5A 1XINA 5CZSA 4IPJA 4GISA 1F07A 4PCPA 2QF8A 1UWSA 4GZ7A 3IPWA 2VDHA 4AY7A 4OE7A 2X1UA 4TVUA 1UOZA 3VD4A 1EJSC 4CU6A 4QSFA 4ZGYA 3WD0A 1LORA 3LMZA 3NFUA 3C86A 5I77A 4UTTC 3VKDA 2VNCA 4S3EA 1VEMA 3SGZA 3S1XA 2B0MA 3W23A 1Q6RA 1EDQA 1XICA 1ADSA 5DELA 3RM8A 4HU0A 2VJXA 3TSDA 3PG8A 2PCEA 3WJSA 4CNOA 1X8CA 4Q8TA 4JTLA 3RILA 2CW6A 2GGJA 7A3HA 5LXEA 3LPFA 3K13A 1JI2A 5K9DA 2V9DA 4A35A 4LS2A 3E2VA 2FFCA 3L9CA 1OBAA 3KL0A 1V3JA 3QZ6A 4UMCA 1A0CA 4O1DA 4I8DA 3R0KA 3WMBA 1OFBA 3TLLA 1QO5A 2YKKA 1CYGA 1RD6A 4MY9A 2C0HA 4ZXLA 4YVXA 3TTOA 3V0UA 4ML4A 3NPVA 1THFD 1RBAA 4PGLA 3OGSA 4DZHA 3P81A 4J3SA 3WNLA 3FA3A 4W9TA 4JIRA 1RLDA 3FAXA 1YXCA 1XIDA 3H22A 4F9JA 2FJKA 3VCRA 5JBFA 1P43A 1RCOB 3KTXA 2ZZ4A 2WSYA 3NOYA 1YNQA 3CAVA 3UJEA 4W86A 4D6EA 4WLCA 4NRRA 2BX7A 4Q6JA 1YDNA 4CCEA 1KO0A 4IIEA 2Y61A 2DIEA 1GJWA 4PTNA 3QOKA 3WENA 4YHEA 2QMKA 2Y85A 2PP1A 1UUQA 3VA8A 1A5OC 3GS6A 2V0TA 1WQ5A 2FMNA 3AJXA 1FBAA 3UXLA 3T8QA 1W8SA 4R9OA 3PWAA 1QW9A 1A0EA 5K4ZA 3A23A 3G1HA 3PZOA 3HGJA 3UZ5A 2IPJA 1JDDA 4PMQA 2MUCA 3RITA 1TWZA 2MANA 3CK5A 4PZVA 4INFA 3LSBA 3FHQA 1SFJA 1HL2A 5JMUA 1P0NA 2QUNA 2YCJA 3BSHA 2C15A 2YBVA 3MWAA 2FHBA 2XFYA 1WKDA 1TVLA 3F4VA 4E5TA 5T91A 5CZTA 4QBXA 1S5NA 7ENLA 4R34A 2OWCA 3WH5A 4CN1A 1JDCA 1ONRA 3Q2DA 4KIEA 3TXZA 1D2KA 3OBKA 4IXHA 3DU0A 1U1HA 4BHYA 1UH3A 3HZ3A 1PX3A 3AZTA 5DY2A 4AZCB 1HJUA 3W07A 1ME9A 4YNGA 3WQ8A 1UKSA 1S3TC 1OCBA 3LEPA 1H0IA 1EF3A 3GK0A 1V7YA 3GUGA 4L6HA 3KRZA 1GK8A 1I60A 1R8LA 4IP5A 2E77A 4YWSA 4WRHA 2R24A 3M43A 1Q6FA 3D3FA 4AVNA 2YCEA 4R53A 2D3NA 4AIBA 1DWFM 5L6UA 3GNRA 1EBHA 4HNTA 2PDYA 2CFFA 4ERGA 4ZFCA 3EOEA 3G6LA 4HNVA 1ZBKA 2Z2UA 1NOFA 2F7FA 4C6LA 4NVTA 4A4AA 5I24A 3MW7A 4IXXA 4I6KA 2H6RA 1PDZA 3S2CA 1CLVA 1GW9A 4PTVA 1Q6QA 3N12A 4PR4A 1PZ2A 3AU6A 3GM8A 1GW1A 1B1YA 1PJ9A 4WJXA 4YXGA 4L1XA 3TTYA 4AZ6A 1H61A 3N6JA 1OYCA 4FHAA 3A5VA 1YLVA 4GGBA 3E1F1 3QTPA 1Q8JA 2JIEA 4LX4A 2ZZ7A 3WK1A 4C65A 4GXWA 3ALFA 2X42A 3PFRA 3WQPA 3T8LA 4DXXA 4OKDA 3AYSA 1OIFA 1PVNA 1AQFA 5CGTA 4O16A 5AZ0A 2CLEA 1UG6A 1H2JA 4LV9A 2JBMA 5HJXA 5BMWA 4D6DA 3KFTA 3UPBA 3CGTA 4IMAA 4KF1A 1MRQA 2ZTKA 3E96A 4X63A 1YDOA 2BASA 5E9XA 3ARYA 1ITXA 1XSIA 2HCVA 5TNVA 4W8AA 2XGBA 2FFIA 3EYPA 1E43A 4LVAA 4Q8MA 1EUNA 5CBBA 4IT1A 4GLEA 2E9MA <