4XTIA

Structure of imp dehydrogenase of ashbya gossypii with imp bound to the active site
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
407
structure length
373
Chain Sequence
YRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii atcc 10895
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
total genus 117
structure length 373
sequence length 407
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtiA00
4DPPA 3QPZA 1PCWA 2C6QA 5HNRA 1B4EA 2GJLA 3RK8A 3KRUA 2H90A 3UYCA 3VE9A 1OFAA 5G2WA 4UFLA 4Q4KA 3OBKA 3C2FA 1HO4A 4QNWA 2QCEA 5K9XA 5HUOA 3EWBX 5BRBA 1Q6RA 3AJXA 4GUGA 3CWOX 5EKYA 4MVAA 4P61A 4YCOA 3A23A 2RDTA 5IBXA 1W8SA 2GQAA 1SFJA 1X7FA 3GZ3A 3W7CA 2NWSA 2QCMA 1PHWA 2VEIA 2CLMA 2F7FA 3L66A 1FDYA 2VEMA 6ALDA 1OJXA 4UC5A 1JRCA 1OYBA 3TKFA 3W7PA 1FY6A 2CZFA 4FXRA 1XDLA 5KZDA 1O5KA 4FEZA 3N2MA 2CFFA 4IGHA 1JVNA 3A21A 4IWWA 2J24A 4UFHA 1TPWA 5E93A 1OK4A 2ZA1A 5GVJA 1P4CA 4XUGA 3HMJG 2C14A 1ALDA 4LS2A 1KM5A 4M19A 1HTIA 1SUXA 3QMSA 4RKAA 4MLJA 3FIGA 3W86A 2XFWA 2J88A 4FX8A 3C56A 3SY5A 3DENA 3L0NA 5K3VA 4LVFA 2ABBA 4Z08A 5K7JA 3LDVA 1MO0A 4OU1A 1FWRA 3IIOA 5AOUA 3WK2A 1GZGA 1XC4A 4PL1A 3C8FA 3UPBA 3W87A 1XKYA 1T8XA 1OYCA 3M5YA 2CLEA 3PBWA 1TPDA 3E0IA 3NQGA 1W3IA 2B0MA 3G1VA 1TPH1 1WXJA 5FEWA 5LGZA 1JQVA 4ZL1A 1AW1A 4M6VA 4U28A 2CW6A 1EPXA 3FKKA 5A8GA 4HSOA 4IOTA 4DXVA 4JX6A 2H8XA 3GKAA 1G7VA 1W3NA 5E1QA 2Y7GA 1H1YA 4UNLA 1LP6A 1KM0A 1NF0A 3WJZA 5U4NA 3PUEA 3UWWA 3B0PA 4RLIA 2VELA 1OFPA 3W1RA 4FB7A 3ANYA 1UB3A 1Y0EA 1KLZA 1I45A 3GYEA 2CLOA 2Z0IA 2YXGA 2ZZ2A 2A6NA 3TV8A 3O15A 3ABSA 2DJLA 1VYSX 4WX2A 3NYZA 1PCKA 2J27A 2RH9A 1WOBA 3C2EA 3MBDA 2Y70A 3G8EA 5DLCA 2A6LA 3CPRA 3W7IA 1TTPA 1UBSA 4IJBA 4AHOA 2TRSA 3NQ7A 3UZJA 1FDZA 1UUOA 4AH7A 4ADSA 2JBMA 4HNTA 2RDUA 3ABQA 1DJNA 3DKJA 4AF0B 1TJPA 3QW3A 1G7UA 4FXSA 2E5BA 5I3IA 1TMHA 2CU0A 5G4EA 3W1AA 3CHVA 4LUIA 2HS8A 3LB0A 3QPYA 3BPWA 3R2GA 2DORA 3TMQA 3O8AA 2B4GA 1MEWA 3M5XA 3GDLA 5FF0A 2C18A 1VS1A 4AHQA 3EX3A 3NOEA 2E5CA 1DJQA 5D37A 2HMCA 3QF0A 4ZQRA 2WV8A 4XBSA 4UTKA 3GB6A 4FF7A 3UZ5A 5G1YA 3KRZA 1H7WA 1NSJA 3BK0A 3LRMA 1FUYA 3DU0A 5EY5A 4IX0A 5IM51 1EUAA 1KW1A 2VOMA 3QQ0A 3TU9A 1FBAA 3MMTA 3G0SA 4LVAA 4DBDA 4JDBA 4Z0JA 3G1SA 2Y61A 4UTTA 2FB3A 3MBFA 1EEPA 2JKEA 3TSMA 1BKSA 3W7MA 3E02A 1AL8A 1YDVA 4UIOA 3NR0A 3L67A 1QCWA 3GIYA 2ISSA 4KFOA 3G18A 1G67A 2BWGA 3UPWA 5LKYA 1EWEA 1ZJIA 1Q6QA 1FDJA 5DCEA 2X1RA 3W2LA 1RQHA 3NQ8A 3QSRA 1IXPA 2ZCGA 3LCIA 4IX2A 1QO5A 4TMBA 1GG0A 1W31A 3G8RA 3HO8A 3UXAA 2FLIA 2CLIA 3GK0A 2GVLA 4GXMA 3TFCA 3LTPA 2V9DA 1JUBA 3DI0A 3OEXA 1L2UA 1D3HA 4ADUA 1FCQA 4MJMA 3TSDA 4N9CA 1VH7A 2QJIA 1EA0A 4TIMA 3BGGA 3C61A 4NNBA 1S5VA 1G4TA 3W83A 1TPUA 2Y89A 1R47A 1KFCA 1SZNA 1XBXA 1SZGA 1LRTA 1O5XA 4A21A 3DHFA 3W2NA 3W1LA 3OVRA 1GOXA 2WSQA 1ZY9A 3B06A 4GBUA 3LCWA 3O06A 3LHTA 1H63A 4O14A 4HT3A 4CCEA 2QCDA 1PVNA 2QAPA 2C19A 4HPXA 1P1XA 1ZAIA 3UXDA 1ONRA 5F4SA 5LNRA 4K7VA 3EWZA 3HIJA 3PG8A 4OT7A 4O15A 2JKAA 3RNDA 5C6MA 3QEZA 5G5IA 3PBUA 2FJKA 1R2SA 3O6DA 3SJ3A 4BWLA 4UFKA 2GPTA 3DFQA 1YDOA 3R8RA 1A53A 6TIMA 4LVBA 1O94A 1ZAJA 3W6YA 1X1OA 4UFMA 2NXGA 3TW7A 5D04C 5K9DA 3UY7A 1TTQA 2E6YA 2G96A 4OHQA 4E0CA 3QYQA 3P5ZA 4MZ1A 2E6AA 1QOPA 1LROA 4O0ZA 4FHAA 3CIWA 2ZZ7A 3LTSA 2VC6A 3DBPA 1UUMA 3TMLA 4MZ8A 4BR1A 3ABRA 2R14A 3TIMA 2VFFA 3LM7A 3B05A 3BW2A 1J2WA 4K8EA 1F5ZA 3BV4A 3CEPA 1XDMA 4NU7A 4JIQA 4AEOA 3QZEA 3FJLA 1FWWA 3HGSA 1KFEA 2B7QA 2ZRUA 1UASA 1V7YA 3A5VA 1SSDA 1VZWA 1KBIA 2C3ZA 1Q6OA 2CLHA 3EX1A 3V1PA 1H61A 3WK0A 4PA8A 1W56A 3O1NA 2NV2A 3CM4A 3CQ0A 3USBA 4O12A 4UXDA 3MHFA 3F03K 5FEZA 5I3HA 4A2SA 2JGQA 2JK2A 5D2TA 5KZEA 3S5OA 4OWGA 4TR9A 2X1SA 4QISA 1T96A 4JTEA 5CGQA 1J5TA 3F1QA 5A5WA 1TPVA 5C54A 4NJIA 5G2IA 1QR7A 3JS3A 3OHIA 4WY0B 4QNEA 4YXGA 4IPIA 1DV7A 4UNKA 2DZSA 1J4EA 3EX2A 3VE7A 2E5DA 1ICPA 1O4UA 3PUOA 2CLLA 4WJEA 2DZVA 2VEKA 1PL9A 1BTMA 3M43A 2JKPA 1P0NA 4O52A 2V30A 4JNMA 1JCXA 3F4NA 3TQKA 4Z0SA 1YTDA 2ZZ4A 3GDKA 3T78A 3P82A 2DZUA 1K3UA 3O05A 4XKYB 5G4WA 1ZNNA 4WUIA 4UMBA 5I3GA 1QMLA 5IBXC 3Q58A 1JR1A 3GKFA 1QNVA 2QUVA 3HGJA 5F2GA 2YPIA 2XN2A 1GEQA 3TE9A 5L9FA 3LERA 4LT9A 2F84A 3N9RA 2ZDRA 4G1KA 1L6WA 3S1UA 1FCUA 4Z1CA 3W84A 4MFDA 1OX4A 4MJZA 5D33A 1Q3NA 2ZRYA 3LI1A 3IIZA 1QFEA 4RK8A 2YGYA 1PIIA 3S9YA 2WSRA 4DO4A 5LZLA 1W5QA 2A7NA 2Z6JA 3W7GA 1FWSA 2B7PA 3NPXA 4RR4A 4NQ1A 3B4UA 2TSYA 3STEA 3ZR4A 4XQ6A 4YCPA 3S0CA 2QCGA 1V5XA 4NZFA 1VPXA 2C0AA 5K9CA 4O11A 4NNAA 5C55A 3UWYA 4UUIA 5AC6A 3P81A 1WBJA 2AQWA 3NL6A 4QITA 5DY3A 2Q8ZA 3PULA 1I2RA 5KINA 3GXPA 2QCHA 5HMSA 1C8VA 3L9CA 1M7PA 4GRSA 3SZ8A 3EKLA 4IXXA 4MKNA 3HB9A 2Y62A 2YR1A 3O63A 3PB0A 4NJHA 2BZNA 1IF2A 4O57A 3NQ2A 1XBVA 4BF9A 4ZQNA 4JTSA 2ZBTA 2VXNA 4CQAA 1VCFA 3PAJA 5C5YA 4Y8FA 3BLFA 1S5TA 4WXZA 3K30A 3PB2A 3W76A 2HTMA 2LLEA 1LLWA 1KV5A 3G3DA 5KSWA 3TA6A 3FLUA 1DBTA 3R89A 4E2BA 2ZQ0A 1K03A 3LBCA 3W71A 3KVJA 4ORMA 1Z42A 3HG3A 2A85A 1KTNA 1F73A 4UMCA 1XCFA 2NX1A 1TRDA 4O1CA 4Z1BA 4IMDA 2EAWA 3EWUA 3P74A 1SZFA 4TMCA 3CT7A 1TV5A 5AB3A 3LI0A 4POCA 4ZQOA 3NQFA 4BI6A 1IXOA 2V8ZA 3W70A 5CSSA 1IXNA 1FXPA 1F74A 4O54A 3A9IA 1K7EA 3IV3A 1GG1A 1SO3A 1KTCA 4I7WA 3PSWA 1OX6A 3NA8A 1TTIA 1TQXA 1OFBA 4D2JA 4EVZA 4XTDA 4R7JA 5J5DA 1NAL1 1H50A 4XBKA 3LXAA 5LNUA 2A7PA 2YW4A 2OX1A 1MEHA 1LOLA 4M7SA 1VLWA 1UCWA 2HSAA 3PY2A 3O16A 3UQNA 1W37A 2WNQA 2FB2A 4O1AA 2EKCA 4MLRA 5ABTA 4LVGA 3UD6A 3W7EA 5DCBA 1PV8A 3CLMA 4NJKA 5BW6A 4CLMA 1OFRA 2W6RA 1SU5A 3FFSA 1O95A 3PC0A 1B3OA 4U4MA 4BWLC 4Y9AA 4PL2A 1H7NA 1AL7A 3CU2A 3QJAA 3MYOA 3BO9A 5BMWA 4XKYA 1OFDA 3WJSA 1QDSA 3OVPA 4FNQA 1O60A 4MUZA 4M5PA 4ONVA 4ML9A 5D30A 1AW5A 1K7FA 2CZDA 4E2DA 3OG3A 1G69A 3G1HA 3M7WA 3P84A 1W1ZA 3YPIA 1VJIA 4JTLA 1GVSA 1ZCOA 4MY8A 3EXTA 1M7OA 3L0KA 1TSIA 2PRHA 1VCVA 3QM3A 4N6FA 4FNPA 1I2NA 3STGA 4AF0A 4AMAA 1G4EA 1LRNA 2YFNA 1L6SA 1GYNA 3LV5A 3M16A 1KLYA 1HL2A 1X8FA 2ZZ3A 1OVDA 3GAYA 1H7RA 4Q33A 5T26A 1XUZA 1WX0A 3GX9A 5F1UA 2W79A 4UTUA 5CZTA 3NL3A 5TBOA 4AWUA 4NXSA 3T4CA 3GDMA 4O53A 3ZFHA 1YXYA 5CPLA 1GT8A 2CZ5A 3NQCA 3BLEA 3DH7A 1P5BA 3P60A 4JEQA 5F2MA 4O8RA 4FIRA 4RV8A 3TDFA 3IVTA 2IQTA 2ZFAA 2A5HA 5K4XA 4AAJA 2A0NA 1KM3A 1JCNA 3QW4B 3L21A 4DF2A 4NJJA 4PC8A 3C52A 4O19A 3G22A 2OZ0A 3P62A 4BK9A 1SO5A 1K8XA 4M6QA 4PFMA 5E0KA 4GE8A 3EKZA 4RZ6A 1OX4B 1SR9A 2GVGA 1ICSA 3HPXA 4K39A 2NZLA 4NT0A 4I9AA 2BXVA 2E77A 3SW6A 2P1FA 3NNTA 4CNPA 2PURA 4RXFA 1VGAA 5D2XA 5D05A 1I8JA 2Q8LA 1A5BA 2GUUA 4NUWA 1DOSA 1KM1A 1QAPA 3INPA 2RKXA 1DL3A 3W75A 1GQNA 2QUUA 3W7HA 2YX0A 1OF6A 4MPQA 3SIZA 2FPVA 4MY1A 2ZRXA 4UCGA 3FJ6A 4GUJA 5C2XA 4YMZA 4UTLA 1ZFJA 3D0CA 4GJ1A 2CLKA 3DHDA 1PS9A 3NQMA 4JYDA 5DCDA 2X1TA 4KWWA 3FYOA 4PEKA 3TXZA 3KOFA 3SECA 3EEGA 1KM4A 5DXYA 4C1LA 4A29A 4LUJA 3TSBA 2NX3A 1DQWA 4JTTA 4JN6A 3QMTA 1XL9A 3KHJA 1H1ZA 3HGOA 3T55A 4N9BA 2G97A 1KBJA 1LBFA 3ABOA 4JS3A 2Y6ZA 3LHYA 5DBTA 1DHPA 3N9SA 4TU1A 3MJYA 1VLIA 1NEYA 4JTHA 5D32A 2QJGA 1YADA 2ZZ5A 1OABA 4JTJA 2GQ9A 3MYPA 3W72A 3R12A 1I4NA 3S42A 1MEIA 3PUDA 3B03A 4O50A 4JGDA 2ISVA 2TYSA 3LGEA 3UNDA 2WNNA 1GYLA 2UV8G 3C3NA 4K37A 5FF7A 3GAKA 4JICA 4IMEA 2YYTA 1I2QA 1ZENA 5HWNA 3NZRA 3PS7A 3BG9A 5FF2A 1JUKA 3V75A 4LW7A 3TK7A 1LBLA 5AN7A 1WBHA 5CPNA 1IIGA 4HHPA 1GVFA 3HQ1A 1RQEA 1EP1A 4QQ3A 3BW4A 1EUNA 5LHFA 3EB2A 2BLEA 2H3DA 2V5LA 1THFD 3NAVA 4N2YA 1GVQA 2WOQA 1XM3A 3CIXA 3LBMA 3LOTA 3BVJA 1YTEA 5DY2A 3A5FA 3E12A 1QOQA 2ATSA 2BSLA 3W1XA 1WOAA 2KZHA 1LOQA 2FQIA 3JRKA 4NJGA 2ZTJA 4UTIA 3IEBA 4GWEA 1TCDA 5D2VA 2V5BA 1KV8A 4M6PA 5D38A 3NPWA 3N34A 3LRKA 1L6YA 2XN0A 1VCGA 1KM2A 3FA5A 3PM6A 4JTGA 4LU0A 3VI2A 2RHGA 4DBEA 1LCOA 3FOKA 3E49A 3NM1A 4UFJA 1F05A 3RFAA 3NZ1A 2I14A 2X30A 4QJ1A 3I65A 5F4XA 2ZTKA 2QKFA 4I7VA 3W2MA 3PBVA 5FEXA 5L6UA 2Y85A 5DELA 2C15A 2TMDA 4JTKA 4PTNA 2EGZA 2FTPA 3W1MA 3L2IA 2H8ZA 3E96A 3UWZA 5KMYA 4XWUA 4O10A 5H91A 4K38A 3AO0A 4PH6A 3GLCA 3TR2A 1LM1A 1VHNA 2NUWA 2YW3A 3C6CA 1TQJA 3NXFA 3UWQA 1XUUA 2DZWA 4GNJA 4JD4A 1OHLA 5EA9A 4OBTA 4PODA 2Z6IA 2VENA 2WQPA 4LS1A 4UTMA 3I6RA 2E09A 3NPUA 4L4MA 3L65A 2QCFA 4CQ8A 3NQDA 1JQXA 3MUXA 3KRSA 5BOOA 3C4UA 2EF9A 4R53A 3TAKA 4JY9A 4HNNA 1VRDA 4UTJA 3KFTA 3L5AA 1RVGA 5LNVA 4DF0A 3P8IA 3TXVA 1FCVA 2JGYA 5G1TA 1XFBA 1KFKA 4DPQA 4AXKA 2HS6A 3S8HA 5I3FA 4O18A 2G5WA 5LSMA 5HULA 1TPB1 4IMCA 1TPC1 1G4SA 3U8GA 4X22A 1CW2A 1DORA 2ZA3A 5AHFA 3EXRA 3W74A 4RZ5A 3VCRA 3TH6A 3I68A 1BWKA 1ML1A 1GVRA 3MI3A 5CG7A 4O16A 3U6WA 4Z1DA 5K2ZA 1W5PA 3QSTA 3DFTA 4UTWA 5EL1A 4ALDA 4TX9A 4LOCA 3TC7A 3KVMA 3NM3A 2YFOA 1H7XA 2VFEA 4LC8A 2V82A 4JX4A 4S2BA 3DFNA 1BWLA 1RR2A 3ELFA 2V2CA 4JYEA 3W22A 3P8JA 4UR7A 1XBZA 4LRTA 3B8DA 4HPJA 2J9ZA 1TTJA 3P80A 3CC1A 3EWXA 1W5OA 5CZ0A 4JXCA 2QCCA 1XI3A 4Q32A 1VR6A 2O7SA 1G6CA 4GUFA 4QM1A 4YLWA 2VFGA 1KFBA 3LCHA 1EB3A 2QR6A 3I7RA 3GVGA 1OFOA 4LC6A 1W5MA 3DZ1A 4O1DA 1E51A 2NWRA 3TCEA 3B04A 1LDCA 2YZRA 4JDYA 4IMFA 2VFIA 3KVLA 4IMGA 4XZ9A 4BI5A 2V81A 3LLFA 4O28A 3W9ZA 4BI7A 1KA9F 4N4QA 2FPYA 3B0UX 4CCDA 1M6JA 2ISWA 1GVOA 4KFPA 1JUEA 1S3HA 4MZYA 1JCMP 3EX4A 4ADTA 4H6KA 3DFPA 2QCDB 2QCLA 5LNSA 1GJPA 1AMKA 1GPWA 3IGXA 1TO3A 3PSVA 3CWNA 5TIMA 1ME9A 2EPHA 3W1TA 4A22A 2Y88A 4JTFA 2GVJA 5LNWA 5AYZA 5CPMA 1QPNA 3S1XA 4Y90A 5HQEA 1OX5A 4RJEA 2AGKA 1DVJA 1UJPA 2J6XA 2QAFA 3LX9A 4ZMGA 3HGRA 3M47A 3EX6A 3TUUA 3DFOA 1HFBA 1H7PA 3M5ZA 3W73A 3LXCA 4ZQMA 3SI9A 2Y7EA 4DQWA 3LRLA 4LRSA 1N7KA 5F2LA 3S1VA 1K02A 2PCQA 2Q3RA 3WK1A 4X9SA 3TC6A 1TV8A 4NVTA 3I7QA 3M5VA 5EMUA 2X1UA 2V0TA 8TIMA 1LRQA 3HG4A 1U83A 5AYYA 1JRBA 4HN4A 2X2GA 5U7SA 1SO6A 3STFA 1FQ0A 3NQAA 1KM6A 1ZALA 5CPOA 3Q37A 3TNOA 1YTKA 1PE1A 3NQEA 2H6RA 4FNSA 3HBLA 4N9DA 4GUHA 3TJXA 3G1AA 3W7RA 1VYPX 5CZJA 4WOZA 3CB8A 3N3MA 4NZJA 3PVFA 4AHPA 1I2PA 1TJRA 3CEUA 4Z1AA 2PC4A 5TQLA 3GR7A 5FI8A 2QCNA 3L5MA 4UR8A 1WA3A 1TB3A 2ZA2A 4IPJA 3W3OA 1Q6LA 3QFEA 1A5CA 4Y6GA 3NPVA 1G4PA 3PG9A 2A2IA 2V2DA 1ZHAA 3QQ1A 5AHNA 4WXYA 1N8FA 1I2OA 1S5WA 4QAIA 3ATZA 4M7TA 1PHQA 2ZRZA 1VQTA 3W7JA 4LWWA 3DAQA 4OE7A 4WQ6A 1QO2A 5G2HA 1T0OA 3P7YA 5EPDA 1WAUA 1W0MA 4P2VA 1YLVA 3W1PA 3TW6A 4BFAA 5LHEA 4K8HA 1MZHA 4MYXA 3QMRA 2A4AA 4S1FA 2G95A 4A3UA 2VKZG 3G1FA 1OFEA 1BEUA 4RX0A 1ADOA 1F2JA 1R2TA 1XBYA 3QC3A 1P0KA 4HIBA 1EIXA 1YPIA 3S5NA 2BTMA 4JY8A 1AK5A 3A22A 5AHLA 4K36A 3W2UA 2PRLA 5HJLA 2P0OA 5AC8A 1VC4A 1TPEA 4FNRA 3M9YA 5CSRA 1NFBA 2YCEA 4WOQA 3C2VA 3TQ0A 2J9YA 4N9EA 3THQA 3SGZA 1TREA 3BG5A 4RZ4A 3ZS4A 3B0VC 3DFSA 1KFJA 3S6DA 1C9DA 4OV4A 3OIXA 2R91A 4IXHA 5EYWA 3MP5A 1VYRA 2GJNA 2ABAA 2E6FA 1JCYA 3M44A 3FKRA 2BX7A 3THAA 1GTEA 4PCFA 4YWIA 5HR6A 2CWNA 1MXSA 3L0GA 3MI6A 1SQ7A 4DELA 4IQLA 4CQ9A 4UTTC 3IIVA 3TFXA 4LY8A 3G24A 3DKLA 4JIPA 3EXSA 1OG0A 3M41A 1OYAA 2D73A 7TIMA 1F7BA 3G0UA 4CCCA 1B4KA 2DP3A 4Y96A 1TV7A 1R2RA 3TAOA 5BNKA 3O6CA 3LV6A 4N02A 2H3BA 2RFGA 2A21A 4AVFA 3SFKA 1WQ5A 3TJLA 1H51A 5AFDA 1JULA 1YPFA 4NXKA 1R46A 5DXXA 2J9XA 4JTIA 3C2RA 1N55A 3QRHA 4R34A 2E68A 4S2CA 3GDTA 4GUIA 3GDRA 3T40A 4A2RA 1B57A 3MP4A 1LYXA 3JR2A 2OT1A 4MOZA 3NGJA 3UWVA 2NV1A 4EF9A 1A50A 1OK6A 3MO7A 3LCFA 4UMAA 3EWWA 3L5LA 3UWUA 5KITA 1ZAHA 3NDOA 2NUXA 3IIXA 4JR5A 1HG3A 1A5SA 4NNCA 3QH2A 1SW7A 4UTWC 2A1YA 1F76A 2DZPA 2AAMA 1SW3A 3U2OA 3HG5A 1EP3A 1WYIA 4W9TA 3LCGA 3IVSA 3WJXA 2FFCA 3M1ZA 1X6UA 1FWNA 3PR2A 4N4PA 5AHIA 5FEPA 1WDWA 4C1KA 4B5NA 5EBUA 1L9WA 1AG1O 2X16A 1EP2A 3I7SA 5J5RA 1K8YA 1LORA 1YDNA 4MYAA 3N19B 1JCLA 4KFNA 3LHWA 4GC4A 4LS0A 1W54A 2NX9A 5D2YA 1SO4A 3NL2A 2DZTA 1TRIA 3G1XA 4UFIA 2VFHA 1NVMA 1F6KA 3N14A 3RLUA 1QPOA 1ME8A 2NXHA 4JYFA 4RXGA 2WNZA 5FF3A 3W7DA 2I1OA 5HUPA 3O6YX 2QUTA 4L4LA 3NL5A 1LBMA 4H4IA 1FWTA 5HWJA 3W2JA 1CX9A 4FO4A 4HSNA 2GOUA 3HOJA 2ALDA 4JX5A 4CNNA 4EF8A 4EWND 3MHGA 3HF3A 3MI2A 4OQVA 3LHZA 4MY9A 2GQ8A 2W0UA 3CTLA 2WPBA 3IGSA 3W7KA 4FX7A 2A7RA 3NO5A 3S5ZA 2DZXA 5CKSA 3VFLA 1EWDA 4H3DA 3N73A 1W3TA 5BMXA 4LNYA 3P67A 3T7VA 3RF9A 3W1NA 3S1WA 4FIQA 1AW2A 2RDWA 1SZEA 3TROA 1FX6A 2QDHA 3WFAA 1X1ZA 4TO8A 4X3ZA 3TX9A 5HINA 3STCA 2WO5A 3Q2DA 4LVDA 3O07A 5D02A 5F2IA 3LXBA 2XN1A 1LLZA 3W23A 1LOSA 2ZZ1A 1SFLA 5FF4A 4R33A 1RD5A 1IXQA 3UY8A 2FIQA 3IIPA 3NQVA 5FESA 4WZHA 1NF7A 4UTHA 4O0KA 1D9EA 3G3MA 1ICQA 3SSJA 4NX5A 3R5EA 1MSSA 3GNDA 2C13A 2Y63A 2V2HA 4IUOA 1Z41A 4HKPA 1U5JA 3WJWA 5CZSA 4O13A 3W1QA 3LCXA 3W7NA 3LCLA 1F6PA 4HNUA 4MIMA 1TIMA 5D03A 3IRDA 1JCJA 4EIVA 4DO6A 5AHMA 1HO1A 3H53A 3WK3A 4ZQCA 3DI1A 5DBUA 3T44A 1OFQA 1CI1A 3ZWSA 1H7OA 1Z44A 3MHUA 4O17A 4ZVJA 2WJZA 4I7UA 4WD0A 1GTHA 2OMAA 2PE4A 1RQBA 4LV9A 3PWAA 5AYXA 2P10A 4NX0A 3RMJA 1QWGA 5D2WA 1C29A 2YSWA 3HG2A 4OV9A 3MW7A 4ZQPA 3GR8A 1EX5A 3N2XA 3S5YA 3NEVA 2O7QA 1R30A 4MFEA 5K4ZA 3GNNA 2C16A 3LTYA 3VKJA 2NUYA 3HJZA 5HWMA 3BARA 2OT0A 1QPRA 1YXCA 3FS2A 3P5YA 2Z1BA 5AC7A 2TPSA 3NQ6A 4HNVA 1W5NA 3KAOA 3RLVA 1FXQA 2Y7FA 2DU2A 2E6DA 3G0XA 5I3KA 4ZZ9A 4FNUA 4RCXA 3W2KA 1HUVA 2YDAA 2ZZ6A 3W7OA 5SWUA 1K7XA 4ORIA 1A5AA 5AHEA 1SPQA 2I9EA 4K7YA 3ATYA 2OJPA 2FDSA 1VHCA 4OGZA 2PRMA 1XXXA 3KVKA 2ATMA 3DGRA 4EOUA 1H62A 3TQVA 3PF3A 3OA3A 3HPSA 1FCBA 4LV4A 2FPTA 3PBYA 3E9AA 3C2OA 3LHUA 4DEFA 3C0JA 4WY0F 3W85A 2R8WA 1LZOA 4ICNA 1D3GA 2R94A 3W07A 2QJHA 4N6EA 1IIHA 3MWAA 4GFSA 4J9JA 5KTLA 2QF7A 3W7QA 3W1UA 4AWSA 2ZRVA 5LGXA 2E1DA 5MHBA 3H55A 3W88A 1K8ZA 3M6YA 4QIUA 3SR7A 3FEMA 2B7NA 1QPQA 2Y7DA 1ME7A 1JJKA 3BLIA 2YYUA 4QSHA 3H54A 3LHVA 3P61A 2NXIA 2Q3OA 4WY0A 3OVQA 4AB4A 5KZMA 3KX6A 2QEZA 4O4VA 3F4WA 3NG3A 4O1BA 4KWVA 2VEPA 5D09A 2NLIA 3Q94A 3NVTA 3VNDA 3W7LA 2EHHA 2QDGA 1SSGA 2WSYA 3L68A 3SGUA 2ZYFA 3IGUA 1H60A 1OF8A 4O4WA 5HR7A 3BG3A 3DXIA 3WJYA 5H2ZA 4XTIA 1TYGA 5F1VA 3LLDA 5I3JA 4LTSA 2ZRWA 4DO5A 1DKWA 1RV8A 2DJXA 1RZMA 3M0ZA 1RPXA 4X2RA 2CLFA 1YXDA 3EWYA 3GXNA 1DQXA 2Z2UA 3FYPA 1KTBA 3KXQA 1YYAA 4FX6M 4CNOA 3HPZA 5F4WA 4JTUA 1T99A 1H5YA 3BGJA 1B9BA 2B7OA 1SW0A 1WV2A 3GXTA 2WKJA 3MP3A 4AWTA 1KFLA 3ZWTA 3A24A 3BW3A 1Z48A 1IGSA 1Q45A 4E38A 3IVUA 2VFDA 4KKXA 1TPFA 3R13A 1GWJA 4K6AA 4YL2A 3G1YA 3G1DA 2OCZA 2CZEA 1LTDA 2C1HA 5DN1A 4FNTA 1M5WA 3RU6A 4DF1A
chains in the Genus database with same CATH superfamily
4L65A 3QPZA 3NTYA 3VIKA 1ZRQA 3MWCA 3KRUA 3K13A 4AISA 2H90A 2XISA 4UFLA 3RPMA 1TV4A 2DUAA 3C2FA 3KOWA 2WZHA 4H01A 4F0SA 5K9XA 5HUOA 1AODA 5REQA 2XYLA 4GUGA 4DRSA 2X7WA 3T9PA 4D8ZA 4HTYA 4AZIA 2G3JA 2GK1B 4YCOA 5CPTA 2RDTA 3ITGA 2GQAA 1SFJA 2VEIA 4LYPA 5A6JA 1FDYA 1OYBA 2XFRA 1XDLA 3S2CA 4IWWA 2YA1A 1VD6A 4PBEA 1MMFA 1KCZA 4UFHA 5D9NA 1R0MA 4ACZB 4F3HA 3RO6A 3GFXA 3T81A 4EXBA 3ONCA 6REQA 4XUGA 2BS9A 2AQVA 1JPKA 1M04A 3S2LA 3T05A 4DJFA 2XM1A 3QMSA 2OTDA 4UQ9A 3W86A 3DFYA 2ADAA 3MMDA 2J79A 3DENA 5LYRA 4Z08A 1MO0A 1J5SA 3WEMA 1HIZA 2ZVIA 4XB3A 1LT8A 3SUUA 1IEVA 1XYLA 4PL1A 3W87A 3I3BA 1LWHA 1DE5A 4Y9PA 3P0WA 3VIMA 3GH7A 5C70A 4M6UA 3PBWA 3E0IA 1W3IA 2B0MA 5A69A 3IJ9A 4HOXA 3G6MA 3FCPA 1JQVA 1AFSA 4M6VA 4CU8A 3N13A 1EPXA 3PZMA 3A9BA 4JX6A 3S6OA 1UKQA 3B8UA 3GKAA 1W3NA 1KGUA 1FH7A 5E1QA 3WLNA 1OQFA 3GG7A 4UNLA 1KM0A 3LBOA 3PUEA 4RLIA 2VELA 2FHCA 2QPSA 1DJWA 4R85A 1X98A 3QXBA 4GYFA 3TTYA 3PZQA 2E3ZA 1KLZA 2BY2A 2A6NA 3TV8A 1T7LA 3CUIA 1OD8A 3LLXA 2CZVA 4DBWA 2FVMA 5BZAA 2Z4GA 4Y2WA 2VVNA 4DJEC 1XD1A 3N12A 4AHOA 3HM7A 2WPGA 3HQNA 3SCUA 5FAGA 1FDZA 4R88A 1V7AA 5BXRA 3ABQA 3NO1A 2HISA 4N7QA 2UBPC 1TJPA 1G7UA 2WAGA 3LS9A 4GY1A 4F66A 1YDYA 3MPGA 1D7KA 5G4EA 3CHVA 1H5VA 3TQPA 3BPWA 3R2GA 4S3BA 4AY8A 4CGTA 4AHQA 3EX3A 1CLVA 1ZJHA 4L6HA 4J28A 4ZQRA 1K4GA 2GGEA 4I8YA 4XBSA 3VKKA 4CN6A 3SCQA 3AUOA 4FF7A 1XIIA 3UZ5A 3E74A 1Z32X 1H7WA 3OYXA 3ENLA 1JZ3A 1PXGA 3S2MA 1EUAA 2QPUA 4PUEA 1YNPA 1FBAA 3MMTA 3NWRA 3G0SA 2UY5A 4J35A 4L6DA 3G1SA 2Y61A 1AL8A 1YDVA 4UIOA 1QCWA 2ISSA 2FZ8A 3RX2A 4AZ5A 5DANA 2BWGA 4N42A 3UPWA 1DQUA 4XZIA 2OWCA 5DCEA 1RQHA 1V93A 1XLKA 3QSRA 1QO5A 2VX6A 3V3WA 4IIBA 3CT2A 2FLIA 3GK0A 2FGZA 4KEVA 4GXMA 3MUZ1 4LNCA 1SJDA 3JZUA 1DPMA 3CZEA 3TSDA 1VH7A 4NKCA 1CT5A 1EA0A 3C61A 4NNBA 3CHFA 1K70A 5AYBA 5LIWX 1XBXA 4K2SA 4FOKA 3IV8A 3W2NA 3OVRA 2OZ8A 4PSRA 3LHTA 1HKVA 1NDVA 1AUSL 3DFHA 3PNUA 4CCEA 2PLMA 1XRSA 2G3NA 3WY1A 2C19A 1P1XA 3UXDA 1ONRA 5LNRA 3ARVA 3KCOA 2O56A 3E3HA 4OT7A 3B40A 1XYAA 5C6MA 3QEZA 5G5IA 4LY4A 4LF2A 4HK5A 1R2SA 2WCSA 5TF0A 4UFKA 2GPTA 4DJDA 2SFPA 4IIEA 1OGGA 1A53A 4L5ZA 1O94A 2YCKX 2I17A 3W6YA 1X1OA 2NXGA 7REQA 5D04C 2CNCA 2DUXA 3GRIA 1V79A 2E6YA 4KF1A 1PDYA 3P5ZA 3ZR6A 2ZX6A 1QOPA 2ZZ7A 2BOEX 3PZIA 3CMFA 2P88A 5DX7A 4UQDA 3CS2A 3ICJA 3TIMA 3LM7A 3BW2A 1F5ZA 4HU8A 1UD5A 1XDMA 2VC7A 3SJNA 2V5DA 4S3EA 3I4EA 3HGSA 1KFEA 2YA2A 3WLTA 4Y9OA 3CTTA 1SSDA 1V0LA 3FW6A 1KBIA 2C3ZA 3GFYA 3PPFA 1G0CA 5EMYA 3VZZA 3CM4A 1W91A 4O12A 4UXDA 3CO8A 2ZX8A 2R1LA 3ARYA 3ONBA 4B4HA 5I3HA 2JGQA 3S5OA 3K8LA 1M7JA 3AIEA 1V0NA 2X1SA 4JTEA 5A5WA 3GSMA 1EDTA 1QR7A 3DERA 3DBNA 2PGEA 4IPIA 1DV7A 1J4EA 2E5DA 1O4UA 3PUOA 4WJEA 1BTMA 4QFUA 3TQKA 1YTDA 1X38A 3GDKA 3T78A 4XKYB 1K3UA 1W3KA 3O05A 4B92A 2CBIA 1J96A 5FAJA 5JH2A 1HNYA 4DWDA 3HGJA 5F2GA 2YPIA 3R0UA 1S2VA 3RR4A 2XN2A 4OUIA 3TE9A 3KS5A 3N9RA 2OB3A 1W1A1 3WLKX 3PTMA 1JL8A 2BVTA 1L6WA 3R11A 3D3FA 1JGMA 1XGZA 3LI1A 4LJ3A 4G9PA 3IIZA 1E1CA 4FXFA 3W26A 1A3XA 4V33A 3UG3A 3WFLA 1PIIA 3R0DA 3BAKA 3WLRA 1E0UA 1LF1A 1W5QA 4NG3A 1FWSA 1E40A 2B7PA 1ISXA 3N29A 3B4UA 2TSYA 3ZR4A 2PGFA 3VTRA 3ZT7A 1AD4A 3ARXA 1PWMA 1POKA 2HNEA 4WK9A 1US0A 1DE6A 2QULA 4AD5A 1XIHA 3ZIZA 2FYMA 1EC8A 2AQWA 3N4EA 3URAA 4QITA 1ZS2A 2AQOA 4U3CA 2Z28A 3PULA 3RM9A 1QBBA 2ZE0A 2QCHA 1UPMB 1M7PA 4GH1A 4IXXA 1A5MC 4MKNA 1XH0A 3EPMA 2BASA 4AD2A 2F9RA 4HK6A 2BODX 4IG2B 1IF2A 1X8CA 3UXIA 4W7WA 1IR2A 5I78A 2XVPA 3VDHA 4GG9A 2AL1A 3H70A 3B0YA 5JIPA 3PP7A 4GQBA 1OSEA 2GDVA 1S5TA 2IMRA 1CXHA 4OOZA 2Y8VA 1B90A 3TA6A 4EX4A 4BQ4A 3DESA 1HXJA 2ZQ0A 4GA8A 3KVJA 2X0HA 3HG3A 2A85A 1F73A 2IPFA 1XCFA 3WQVA 1TX2A 2QGHA 4H9XA 4H04A 1G01A 4AYSA 1R7AA 1F3EA 4TMCA 3BLLA 2WZMA 2OSWA 5BWFA 4POCA 3CV1A 1IT8A 4ZQOA 4Q8NA 4W84A 4DXXA 3N17A 3NQFA 2ZUTA 4CCZA 3A9IA 1K7EA 3LN3A 4GNKB 3SUTA 4I7WA 4IH3A 3NA8A 4OVXA 3RXZA 1M68A 1NDZA 2PP0A 4DZAA 5MF5A 4EVZA 3GS6A 3MUIA 3N6JA 1NAL1 3LXAA 5CZKA 2XTKA 2PDQA 3E0LA 4IIFA 1LOLA 3CLWA 4L9ZA 5BCAA 2DFAA 2HSAA 3PY2A 3O16A 3UQNA 2VQTA 4MLRA 7XIMA 3UD6A 3W7EA 5HQMA 3CLMA 4A3QA 2W6RA 2GYIA 3PC0A 1VFUA 2XIQA 1B2YA 4Y9AA 1RP9A 4PL2A 3CU2A 1Q65A 2YOCA 3T2QA 4MUZA 4M5PA 3T0AA 5D30A 1AW5A 3OU8A 3KM8A 1NOFA 2EPOA 4F0MA 3OG3A 4GINA 3UVIA 5FIPA 1ZCOA 4UOQA 2F2HA 1M7OA 2Y5EA 4HBKA 1TSIA 1NWSA 3M0IA 4FNPA 3SQLA 3GHUA 4CD6A 1L6SA 3M16A 1KXVA 2ZZ3A 1OVDA 3PPCA 2PDYA 3PJWA 3RPTA 2VZVA 3FGCB 2W79A 3SRFA 3CUGA 2Y5SA 4AWUA 1OCNA 3CYJA 3PWIA 4E4PA 3RM4A 4E3VA 3T4CA 4XKMA 1GT8A 3I3DA 5C9UA 2ZKMX 3P60A 4ATLA 1EOMA 1GVIA 4RV8A 1S3TC 1TA3A 5CPQA 3IVTA 2ZFAA 4YYCA 2A5HA 2CBJA 5K4XA 1JCNA 4DF2A 4OUEA 1LJYA 2OZ0A 2FFIA 4PFMA 1JYWA 1E4NA 1BXNA 3EKZA 2NQHA 3ZJ8A 1R9ZA 4NT0A 2BXVA 3PK7A 3W28A 1KRCC 3SW6A 1EGMA 3O2LA 1VEMA 5D05A 1I8JA 3WL1A 2BOGX 1F07A 4Q7IA 1KM1A 1IV8A 3QGAC 1US2A 1QAPA 3INPA 3OHMB 3W75A 5HMFA 1GQNA 3W7HA 2YX0A 3SIZA 4MY1A 4UCGA 5CBJA 4YMZA 1R9XA 4B5VA 4AEEA 1VAHA 1R3VA 4KWWA 4A05A 3LMYA 4HHHA 3NJ3A 3SECA 5MKGB 2NX3A 1DQWA 5CPSA 1WB0A 4D6DA 4CN1A 4EAYA 1XL9A 1FA2A 5FJUA 2A79A 3QGKC 4N9BA 5XIMA 5HBFA 1QRQA 1IHIA 4Q7BA 1JI2A 3N9SA 4NAEB 2KX9A 3WNPA 3A3HA 5ABFB 1VFMA 1NEYA 3TYDA 4JTJA 1OABA 2WB5A 3MYPA 3AOFA 3L23A 1I4NA 1X1NA 1MEIA 5A6TC 2P50A 4RNHA 1QPKA 4O50A 4JGDA 3K8KA 1OCJA 1ELSA 1XW8A 1MNSA 1HJVA 4IMEA 5HWNA 4BHYA 3GG1A 1JNDA 4CN4A 5IFPA 4GGBA 1S38A 3V75A 1US3A 5AN7A 4B3ZA 3MO4A 1GOIA 4ZB5A 2JEPA 3HQ1A 3LEPA 3BW4A 1U1JA 1EUNA 1WUEA 3K2GA 5DO8A 3ITCA 4F2TA 2WOQA 3LBMA 3LOTA 1YTEA 3BQ6A 1F3XA 3SM0A 2BSLA 1A5UA 1MQQA 2KZHA 1PKYA 4DZIA 4NJGA 2IW0A 2ZTJA 4UTIA 4LUSB 5D2VA 2V5BA 1NP0A 5D38A 4Q22A 3FA5A 2IPJA 4KRUA 4DBEA 1LCOA 3E49A 3MCNA 3NM1A 3R58A 4J2MA 1F05A 3VFCA 3GNXA 2I14A 4D6HA 1A5OC 1RP8A 2VO5A 2ZTKA 4BF5A 5BXPA 3EDJA 3PBVA 2VDIA 3BLPX 2PPGA 1EQPA 1NDWA 4K8GA 2EGZA 2FTPA 1M3UA 3L2IA 2H8ZA 3E96A 5JBDA 3UWZA 1UD6A 2E28A 5H91A 4HN8A 3TR2A 3UBPC 4GIEA 3NXFA 3UWQA 4GQQA 2PMQA 1XLHA 2BXYA 4AEFA 1S5MA 4OBTA 4HNLA 2VENA 2WQPA 2JIEA 3QR0A 1RBOB 1MWOA 4CQ8A 1JQXA 3OQ8A 2QT3A 1TVPA 1PWLA 1NQ6A 2P0IA 5BOOA 2D24A 3DG6A 1IEWA 1UBPC 3OLIA 1J0IA 1QU4A 5LNVA 4DF0A 1CXEA 1XFBA 1KFKA 2G5WA 3KOYA 1TPB1 4IMCA 3CHCA 3U8GA 3WBWA 4KW2A 4QJ4B 3FV9A 3EXRA 4X61A 1A47A 1UKSA 4KBXA 1ONWA 4XAYA 3NSMA 3S9IA 4UQCA 3VX1A 3I68A 1ML1A 1J9YA 5CG7A 3WLIA 2OPJA 1W5PA 4P8XA 1CCWB 5LIXX 4LOCA 2Z1VA 4Q8MA 1W1B1 1XD0A 1V4YA 3PZNA 4LC8A 5BRQA 2EPNA 1BWLA 4C6QA 3EDKA 2V2CA 1VBGA 5AZ1A 3U2CA 3W22A 3P8JA 3L4XA 2UY2A 3KOZA 4XAZA 1W6TA 2QMKA 3VOFA 4HPJA 4JTAA 2J9ZA 2ZUSA 3DC0A 1V03A 3VOJA 2OWXA 3NDYA 1XI3A 4LYRA 3CHEA 1TJ1A 3E0WA 4YLWA 1KFBA 2J7DA 1BYAA 3HU7A 3A4AA 3QV6A 5JQ9A 3DZ1A 4J3SA 3B04A 3REQA 4JTDA 4XZ9A 3UERA 3AYTA 2V81A 1RLDA 1JDDA 2FPYA 3OGSA 5T91A 5H8MA 1UWQA 4MZYA 3TJ4A 1QK2A 3SRHA 3EX4A 4ADTA 4A3HA 2D0FA 3FNDA 1E73M 5LNSA 1GJPA 4IQEA 3RJYA 4E8CA 1A5NC 1TO3A 3L2LA 1IZKA 2Z1XA 2Y88A 4JTFA 3T1GA 2I7GA 5LNWA 5AYZA 1N2VA 3AXIA 4YWSA 4Y90A 3RIKA 5HQEA 2ZXDA 4PCPA 5T8GA 1DHKA 5JMUA 5H1WA 2AGKA 1IR1A 3VYLA 2J6XA 2QAFA 1E0XA 3LX9A 3TUUA 3M5ZA 1H7PA 1XCWA 3ITXA 3PZOA 3W73A 3HZ3A 4EK7A 3VOIA 3SI9A 1EJXC 5FL1A 2Y7EA 3F5KA 3BCJA 2PDNA 3DN5A 2YL5A 3N2CA 1PTGA 5T9CE 4M3PA 5T9BG 3I7QA 1Y5VA 4JHOA 3BQ5A 4C1NA 2V0TA 1Y8BA 2R9RA 4XD4A 1U83A 1JRBA 3S9ZA 3AHXA 3SN1A 4W5ZA 4LBSA 2XIIA 3ARUA 2OX4A 1VRXA 1SO6A 1ZALA 1MUWA 2H6RA 4N9DA 5CZJA 4WOZA 4IQJA 4WKFA 4OKDA 3PVFA 4MG4A 4YS1A 2GVEA 1TJRA 1PZ3A 2YBUA 2X0YA 4EPKA 1XR2A 3IK4A 1WXYA 3SN0A 8RUCA 2P3EA 1G5AA 2XM2A 2XGIA 1ITXA 3M0JA 4J3TA 3QQ1A 2NW0A 4QAIA 3AHTA 3ATZA 1UWAA 1FP8A 4OIFA 1VQTA 1B3WA 1U1UA 4FXJA 4OE7A 3KCLA 4H9YA 2VGBA 1QW7A 3KL5A 3QZ6A 2FTWA 1N82A 4TXEA 4IP5A 1PKLA 4KGLA 1D7FA 4DWSD 3SADA 1J10A 4Q8QA 3QMRA 2EJAA 4A3UA 2VKZG 2X40A 4RX0A 2YB1A 4YHEA 1F2JA 5B80A 3NSNA 4MMWA 3A4WA 3VUPA 4U5IA 2ANUA 3O3RA 2XVGA 2WKGA 3J7HA 2JF6A 1VC4A 3QOKA 3M9YA 3ABZA 5HMEA 2XDFA 3C2VA 3P0XA 2FGBA 4RPQA 1CLXA 3IRSA 2WVTA 3VK5A 4OV4A 3OIXA 4NRSA 4L9YA 1R3TA 1Q4NX 3PTKA 3TLLA 2BGNE 3MP5A 2ISDA 1R3QA 4AZBA 2ABAA 1FHLA 1W17A 3PPGA 2BX7A 3THAA 4YWIA 3L0GA 1HGYA 1XFCA 2Z25A 2Q09A 4IQLA 4C6IA 1LQAA 3TFXA 3ZLGA 2ZC1A 4LY8A 4AVOA 2PSNA 3T08A 3CHDA 3S47A 4QGCA 2VCCA 3LPOA 4KH2A 3SCWA 1HJSA 1F7BA 2F8QA 1S2AA 1UPPA 2HBVA 5BNKA 2FH6A 3VOHA 3LV6A 3WD0A 2WJEA 4C90A 3C8NA 1YPFA 4NXKA 1R46A 1XIDA 3AS0A 3LMZA 2GWGA 2E68A 4CQCA 5LA0A 4A2RA 1B57A 3MP4A 4DWSB 2NV1A 3HV8A 1A50A 1OK6A 2QQ6A 3MO7A 2QDEA 3LCFA 4HD5A 4UMAA 1EIBA 1BSIA 3L5LA 3UWUA 1ZAHA 1VENA 3KCJA 2O9PA 4QLLA 1HG3A 3WG6A 4RE4A 2AKMA 2O9RA 5A6LA 5ABEA 2OEJA 1PBGA 4W9TA 3LCGA 3OZYA 3S2NA 2FFCA 2GGGA 1X6UA 3WELA 4MB1A 3DC8A 5AHIA 1EX1A 2EPLX 2XFFA 3APYA 5EBUA 1AG1O 2X16A 3QR1A 4QBXA 4GC4A 4IQDA 4LS0A 1EO7A 1HVXA 2NX9A 5D2YA 3VGBA 1SO4A 2CKRA 1A5KC 3RLUA 2PDBA 1QPOA 4L1XA 4JYFA 3W7DA 5HUPA 4ACYA 1E71M 4L4LA 1J11A 1K6AA 4QDPA 3I10A 4FO4A 3WNKA 2ALDA 5CBIA 3WZ0E 1C7TA 3MI2A 2L5HA 3RN6A 3KL0A 2AMGA 2HVMA 1UQYA 3CTLA 2XPKA 2KAUC 1EWDA 4H3DA 3ERPA 1QK0A 4UR9A 1W3TA 3T7VA 3WMLA 1BYBA 3F4VA 1VEOA 4IZGA 3TROA 1TWDA 3WFAA 4KGJA 4TO8A 3STCA 3GE7A 2Q6ZA 3O07A 3F2CA 3KP0A 1TUFA 3QKZA 3CH0A 4PR4A 2ZZ1A 1SFTA 4L1WA 5FF4A 1ZBKA 4IIHA 4R33A 1UYQA 3SCTA 3EWDA 1XPYA 3UY8A 3IIPA 3NQVA 1UD3A 5A8NA 3HV9A 2G41A 4UTHA 3DEQA 4O0KA 3CQKA 1TUXA 4GXWA 2VURA 4NX5A 3KHDA 1MSSA 1R3SA 3ZZ1A 3OZMA 1IYXA 1Z41A 4R7WA 1U5JA 2VGIA 2W27A 4H19A 2PS2A 3GTIA 3IRDA 1P6CA 3LK6A 4UTFA 3G5EA 2DIKA 3H53A 1JYNA 3WEOA 4A8NA 3MUCA 4CD5A 1AD1A 3U7BA 1QASA 2QVHA 3WBEA 1R5YA 1H7OA 1W8GA 4IMAA 3NURA 4LV9A 4QS5A 5AYXA 2D23A 2WVVB 1UD2A 4GZIA 4IF2A 4OV9A 2Q02A 1EX5A 1BSLA 2VX4A 2J62A 2NUYA 3HJZA 2OT0A 4H83A 1UWUA 1W5NA 2OZTA 3BJTA 2XH0A 5CGMA 4I6VA 2R1MA 3RLGA 3W2KA 1HUVA 3RCMA 1CBGA 4HPHA 3VDAA 1QVBA 5CC7A 4K7YA 2PGWA 2OJPA 2FDSA 4GJIA 4J40A 3N1AA 6REQB 4W85A 4XAGA 3PF3A 4OECA 3HPSA 3TW9A 5I5RA 1KGWA 4P7LA 4B5XA 4LV4A 3NSXA 4DEFA 4C6MA 2C7FA 3C0JA 4DWSA 3W85A 2R8WA 1AQ0A 3CGTA 3VOGA 1SVDA 5M03A 4WVXA 2C1GA 4QG6A 2DVUA 4GFSA 1PJ9A 4AWSA 3UJRA 1AZ2A 3CMJA 4XAFA 2Y5JA 1K8ZA 3TWAA 3SR7A 4H9ZA 1JPIA 4HYVA 3THCA 3LHVA 3P61A 3R8HA 3SO7A 1XX1A 1WUFA 4O4VA 1ZBVA 2Z1KA 3GYCA 1TJ0A 3R8GA 2NLIA 3Q94A 3VZYA 1BD0A 1EDQA 5I7GA 4B3LA 3T0BA 1SSGA 4DUWA 2HV5A 3CNYA 3FX4A 1XCXA 4MDPA 3DXIA 2D0HA 4AG0A 1TYGA 3MVIA 1RHCA 1EQCA 2EQDA 3LY0A 5GQBA 2C8NA 2WZIA 2ZRWA 2WBGA 2WVSA 4DJED 3WDIA 1OCBA 1MW1A 3M0ZA 3WQDA 4X2RA 1HGWA 1TWWA 1TKKA 1YXDA 1DQXA 2QW5A 1D2KA 3BE7A 4DUOA 4AXNA 4DYEA 2I5QA 5GNXA 3MP3A 1QNRA 2VUYA 4KCVA 1I1XA 1Q45A 3IVUA 5FOOA 1TPFA 3R13A 4K6AA 2BHUA 1XLBA 1TFVA 2OCZA 1PYFA 5DN1A 4FNTA 1HP5A 1M5WA 1C92A 1PCWA 2EKGA 4RDVA 1YMYA 4X2PA 2GJLA 1OFAA 5G2WA 3BDKA 1XIGA 4LX4A 4GI6A 1L8NA 1KCKA 3EWBX 2GGHA 4AZGA 5EKYA 3QYSA 2HNHA 5HATA 1RUSA 4P61A 4X63A 3A23A 4GI8A 2PBGA 3KE0A 1JFXA 2NWSA 2IKHA 3GC2A 2WM0A 4H8VA 1CLKA 2CLMA 3GO2A 1RXOB 5B7YA 2CZFA 4FXRA 5KZDA 4FEZA 4HP5A 3A21A 2D3LA 2J24A 4HU3A 5IHRA 1MXDA 3GVRA 5E93A 3KBNA 5GVJA 3APGA 1P4CA 2C14A 2J7FA 2W91A 4GXPA 3VUSA 3M07A 4AQLA 2W9MA 3SCVA 4M19A 2GLKA 1ISZA 3COTA 4LYKA 1HTIA 3WKZA 3WDHA 3B9NA 4B2DD 2VEFA 4LVFA 5JVLA 1E1CB 2JALA 3LDVA 1FWRA 5AOUA 4YTUA 3WK2A 2GVYA 1GZGA 1XC4A 4RNJA 1Q85A 1T8XA 1OYCA 1KCXA 2CLEA 2DGAA 1FWBC 4KWUA 1IEIA 3G1VA 3GM8A 1TPH1 3SQSA 1KBBA 5LGZA 2ODOA 4ZTYA 4S3CA 1J0KA 4F0RA 3W25A 3N2OA 4UNIA 3RAOA 4GY0A 2OKTA 1OC6A 5A8GA 2VUNA 1FRBA 5XIAA 1G7VA 5DMMA 4PMQA 5U4NA 2UWFA 4AZ6A 4XISA 1AQMA 2E9MA 4NZ5A 4M1BA 3W1RA 3GH4A 3VIFA 4GVFA 4KEMA 2RUSA 1Y0EA 2YLLA 3GYEA 4LEFA 2Z0IA 2YCLA 4GX9A 2ZZ2A 1W9BM 3IS4A 4XD6A 4C65A 1VPQA 3BSHA 3NYZA 1PCKA 1WOBA 4J3XA 2A6LA 3CPRA 1TTPA 1SYTA 2TRSA 1QWKA 3UZZA 2QXWA 4K68A 2DQXA 3MJMA 3D3AA 2VR2A 4XVDA 3TN4A 3EGJA 4ADSA 3U5YA 4ZGYA 1DJNA 4AF0B 3H2CA 4FXSA 1HJWA 5I3IA 1WKDA 4AZCA 5AC5A 4LUIA 3OQEA 4A8LA 1PAMA 2E5CA 3BGAA 3GB6A 3BK0A 3QOMA 2Y2WA 3DU0A 4Z2KA 4IX0A 5IM51 4H9UA 3TU9A 1E15A 2D69A 4ZA0A 4Z0JA 1ZU8A 3V1HA 3TSMA 1EEPA 4PRTA 1CGVA 4U2YA 3NR0A 4G56A 3GIYA 3SCNA 3GH5A 3MSRA 3OBAA 1G67A 3T8QA 4J27A 4IPNB 5LKYA 1EWEA 1NP2A 1HKMA 3GXDA 4IFRA 1Q6QA 1FDJA 4HCLA 1QI0A 2CEQA 3NQ8A 2PU0A 1IXPA 1GG0A 1W31A 3UT0A 1ITUA 1J0HA 2OO6A 4INFA 2W67A 2HQAA 1K4HA 2V9DA 4GC3A 3TYBA 1K1DA 1SMDA 4EWJA 1A49A 1BGAA 1FCQA 1YBQB 1UC5A 5HA7A 2QJIA 4TIMA 1T6MA 1FVPA 4Q8VA 1G4TA 1QNQA 3W83A 4DO7A 1EO5A 1TPUA 2Y89A 2VWTA 1O5XA 1B31A 4LFYA 4PBFA 4D6CA 1KQYA 3DHFA 3WYZA 3VKCA 1GOXA 1E3XA 3EOEA 3O06A 3CQJA 4O14A 1LWIA 4HT3A 2WHJA 4HPXA 5F4SA 3PG8A 2JKAA 3EBVA 2BVYA 4DYJA 3ALGA 3CH9A 1LL6A 1HVQA 2J66A 2FJKA 4GKTA 2J74A 1GOKA 2QGYA 1XF0A 3DFQA 1BRLA 1ZAJA 4UFMA 5K9DA 1J8VA 1TTQA 2DSVA 5C2CA 4FR6A 4OHQA 2QDDA 3ZO9A 1VBHA 3MV11 2E6AA 2VD9A 3BZGA 5CBBA 4P7OA 1BG9A 3TMLA 1QBAA 1IWPA 3ABRA 4MNKA 2VFFA 2FJUB 3EOUA 4HHLA 4K8EA 1DIKA 4RDYA 4JKLA 3LNMA 2PDPA 2A3AA 2ZRUA 1XPGA 2Z2AA 3A5VA 3H2AA 3WLHA 3AMLA 1Q6OA 1ZBWA 3V1PA 3C0QA 3NIYA 4FMVA 3USBA 4CU6A 2DIJA 3WF4A 3MHFA 5C9XA 3BMXA 5FEZA 4ROPA 4V1XA 2JK2A 1AH4A 5FJRA 4R7OA 2UZ9A 3UZWA 4S3DA 4NI8A 3ORWA 1T96A 3EOSA 1J5TA 3OO2A 2CC0A 3DYMA 3F1QA 1TPVA 2DSKA 2XH7A 4NZCA 2Z2BA 3GIQA 1FHDA 4GVHA 4WRHA 3T2PA 1E9IA 4UNKA 2DZSA 1UR9A 2J8FA 3URNA 2CLLA 2VEKA 2HROA 3CAWA 1PL9A 1AMYA 1R6WA 2JKPA 1P0NA 4O52A 2V30A 3BV7A 4JNMA 1JCXA 3F4NA 3LZ3A 5I09A 1VFLA 2DZUA 1ZNNA 4WUIA 1XH1A 4NZ3A 3WH9A 4M81A 3GKFA 3XISA 3B4YA 1GKRA 3TJIA 5M3WA 3UESA 3LERA 5L9FA 3LGGA 4LT9A 2F84A 2Z27A 1BPLB 2E8YA 3BANA 4AY1A 3S1UA 1W3LA 3H23A 5C2GA 5D33A 1OX4A 3DHUA 4AZCB 3AMCA 2A3HA 4D6JA 1HQTA 4RK8A 1QATA 5A6MA 1BF2A 2YGYA 4DO4A 4HTBA 3W7GA 4G6CA 4LUYA 4RR4A 4NQ1A 3V0SA 4YCPA 1XIEA 4E8DA 5J04A 4NZFA 2VD8A 1W9XA 3UWEA 2C0AA 4GABA 3VGHA 2YB4A 2INEA 3UWYA 1V6VA 4UUIA 1I9CB 5AC6A 1XICA 3P81A 5H6HA 1TCMA 3KTCA 5DY3A 3VIJA 3KTSA 1XIFA 1C8VA 3L9CA 3EKLA 1K6WA 3BAWA 2RGMA 5ABHA 2Y62A 2YR1A 5BU9A 4GBDA 1XBVA 4TUFA 3CJPA 1X96A 2PODA 3PBMA 2CWXA 3UR7A 1ZPTA 1B54A 4JTSA 2ZBTA 3SUVA 1BG4A 3PAJA 5C5YA 2QHAA 3WDJA 5CAKA 3BLFA 3N2BA 3K30A 2WKLA 2LLEA 5EMLA 1KV5A 1BKHA 1RLCL 3TTQA 3FLUA 1EA9C 4NZ4A 1LQ2A 1DBTA 3R89A 4E2BA 2HPIA 3W71A 4IIDA 1UUQA 1KTNA 4O1CA 1AJ0A 4HJWA 1SZFA 4MF4A 4UWMA 1TV5A 3NCOA 5IHSA 1ZQ5A 4DI9A 3ITVA 3GHTA 3QHNA 1GEHA 2XZ9A 4F9DA 2ZX5A 2V8ZA 5IDZA 5CGTA 2IKJA 5GJPA 1DXIA 5CSSA 1FXPA 3IV3A 5CJMA 1NM9A 5BOEA 1SO3A 4XK2A 3PJTA 1OX6A 3KL3A 3QZAA 1TTIA 5BRPA 1XLDA 5J5DA 3LQGA 4M24A 1EEXA 2A7PA 2POZA 4YHGA 4PBGA 3F2BA 1E0TA 1CXLA 1N8WA 1Y5XA 2D1ZA 4BY3A 4JTCA 3ARPA 1UCWA 4D71A 1W37A 4ZSUA 2ZE3A 4O1AA 5ABTA 5HNUA 3AXKA 2QNEA 4Q4MA 3HFYA 5FCZA 3B8TA 1JXKA 5KETA 5DCBA 1PV8A 4ZR8A 4LYQA 2CHRA 4NJKA 5HJXA 4XZLX 4CLMA 4LAMA 3FFSA 1ITCA 4W88A 3GVVA 1O95A 1ZLPA 1LUCA 4XZBA 3WL0A 3M7SA 4MJ4A 4XAPA 3QJAA 2PU1A 3MY9A 5BMWA 4XKYA 3WJSA 4W7UA 1O60A 3MMUA 4ML9A 1RJQA 4D6GA 1OC5A 3E6EA 2C91A 2CZDA 4XBJA 3M7WA 3P84A 3ZJ7A 3GWQA 4AX7A 4PB5A 4AIBA 1GVSA 3BAIA 2NVCA 3L0KA 2PRHA 1RAKA 3QM3A 4N6FA 1GQLA 1UKOA 1I2NA 1WO2A 4PUUA 1GYNA 3W02A 3LV5A 5GJMA 1KLYA 1X8FA 1H7RA 4ES4A 1XUZA 2I56A 2CITA 1YKWA 3MSYA 1DIEA 2Z00A 1FP9A 5TBOA 2Z29A 3ARQA 1RBLA 3A12A 2BDQA 4A3RA 3VNIA 5HMDA 3ZFHA 1YXYA 3WDPP 3HTWA 5CPLA 2CZ5A 2DSWA 3WQ6A 4PEEA 1PO9A 4MJ2A 1P5BA 3V0UA 5CC5A 2IQTA 3OA5A 3FEQA 2A0NA 3OW1A 1MYRA 2J47A 4ZO8A 2J8TA 4NJJA 4LGXA 2CYGA 4PC8A 3C52A 3G22A 1SO5A 1WNOA 3VX0A 4C6FA 1IGWA 3THUA 1OT2A 5IXEA 1ICSA 4K39A 7ODCA 1F4HA 3RU8X 2P1FA 3NNTA 2OLAA 4RXFA 5D2XA 3VA8A 2YBTA 1O68A 1YNQA 5DMNA 1YE4A 2IS7A 4R9XA 2GUUA 2QZRA 1CEOA 4NUWA 1DOSA 5IOBA 2CCRA 2RKXA 1OF6A 1V6UA 2R1PA 2DZBA 2ZRXA 4FPSA 5C2XA 3GBDA 4GJ1A 2NQLA 4L64A 1V3JA 4TVUA 2CLKA 1DJIA 4X60A 4OZOA 2WMFA 4GISA 4BQ3A 2X1TA 3TXZA 3WFZA 2VR5A 3EEGA 2OYLA 5DXYA 4C1LA 2WANA 3TSBA 4JN6A 3T55A 1CWYA 1DWHM 2G97A 4D8LA 1KBJA 1E70M 1LBFA 3GXFA 1Y7VA 4ZCWA 2PAJA 2ZUMA 3WBAA 1DIOA 3MJYA 1TWIA 4JTHA 4GJJA 1YADA 1BXCA 4P7NA 4IGNA 4L9XA 1LL7A 5EGRA 4ZO7A 3B8VA 3LGEA 1ECQA 3UNDA 4M1RA 1K9DA 3EPNA 1KWGA 1GQJA 4JPGA 4ILSA 1B1YA 1ZENA 1QT1A 4QS6A 1JDCA 2Y1HA 1EZWA 1HP4A 3B0XA 1WBHA 1RQEA 1EP1A 2FDMA 1S5NA 2HK0A 2V5LA 2WMGA 4JIIX 1D8CA 3E12A 1QOQA 2ATSA 4HU4A 4DBUA 3W1XA 1JEZA 4HVXA 2WJFA 4KRZA 3KBJA 4PRRA 3IEBA 4Q7NA 1KV8A 4XZMX 3K1GA 3WH7A 1DEDA 1L6YA 3FHAA 5DEZA 3P2VA 4E2OA 3PM6A 4JTGA 1KM2A 3POHA 1XG4A 3VI2A 3FOKA 4PMNA 5I79A 3QFWA 4UFJA 2W4XA 4FLQA 3CZKA 2X30A 2YLAA 2ZUUA 4QJ1A 1DJGA 2PDWA 2QKFA 3LM3A 4I7VA 4IT1A 5L6UA 4HMEA 2WHKA 4KEZA 4JTKA 4E4UA 3B9AA 4FALA 3W1MA 4XWUA 1VFHA 3MVTA 4K38A 3AO0A 1Z3NA 3QHOA 1VHNA 1X6LA 4LAKA 4CNUA 1V6WA 4JD4A 2PFHA 4Q4SA 4MKSA 1GW9A 2HEJA 4IISA 2XIOA 4KCWA 4LS1A 4UTMA 3NPUA 4L4MA 1QTWA 3L65A 3C5QA 3I3EA 3OVGA 3S46A 4WDXA 3KRSA 2I16A 3W37A 4QCEA 3C4UA 2EF9A 4IFKB 1NELA 3TAKA 2ZXQA 4HNNA 1VFTA 3AXXA 2PWUA 4UTJA 2DVXA 3L5AA 2WNWA 3P8IA 3CUHA 1PTDA 1UR2A 3WQEA 3S8HA 3T8LA 4O18A 3RHGA 2WMJA 1G4SA 2BGSA 1DORA 5AHFA 3W74A 3K5XA 1FH8A 3ZSSA 3VCRA 1WDDA 1XLFA 4DNHA 3U6WA 3FSTA 5LIKX 5K2ZA 3U5UA 4KERA 3L2MA 2JE8A 3QSTA 3EWCA 4UTWA 3TYUA 3TC7A 4JL2A 3KVMA 1W3JA 4UZUA 3AU6A 2YFOA 1O6IA 3CL6A 4Z42C 2VVSA 4F0HA 1XLMA 2VFEA 4PMVA 2V82A 4JX4A 1ZZMA 4S2BA 4ZFCA 5D9PA 1RR2A 3KBSA 3VGGA 3ELFA 1EJWC 1QW9A 3AAMA 1AQHA 5D4YA 4RL3A 2D20A 3ZT6A 4UQAA 2XIJA 1TV3A 3BLOA 4UR7A 4AFYA 4RNFA 1XDJA 3ES8A 1WP6A 4P5UA 1R87A 4I5XA 3C0SA 3CC1A 5CZ0A 4JXCA 2QCCA 3WMSA 3VPLA 3T07A 3Q45A 2O7SA 4HPGA 4GUFA 3ITLA 5PTDA 1H4PA 1EB3A 3AUJA 1Q66A 3GVGA 1OFOA 4LC6A 1UR4A 3AYRA 1W5MA 4C5ZA 2V6AA 4KRTA 4O1DA 2NWRA 4MAZA 3TCEA 4JDYA 2WSPA 3P14A 4IICA 4MWAB 1Z89A 2ZUVA 3GU9A 2PI6A 3W9ZA 1KA9F 3B8SA 1M6JA 5CLTA 4HZMA 1E9LA 1RA5A 3RX4A 3BCFA 4WLCA 4JZ5A 1JCMP 1P48A 2FMNA 1M41A 3ZJKA 2VQUA 4H6KA 1H0GA 3SGGA 5BOFA 1XKJA 1AMKA 3OLDA 2V5CA 4XIMA 5A1AA 5TIMA 2X0SA 3W1TA 4A22A 1PYMA 4KQNA 5CPMA 3EAUA 4RPPA 4RUBA 1FWGC 4HMCA 3SCOA 3AQUA 3O9NA 1UJPA 4JKKA 1UD4A 4M29A 3HGRA 3M47A 5HJYA 4ZB0A 2B31A 3G77A 2DY3A 2H9AB 2Q71A 5E0CA 1P43A 4JAWA 3BTNA 4DQWA 3LRLA 4LRSA 3LYEA 3PFRA 4US5A 3TC6A 3RLHA 4NVTA 2E0PA 2BGQA 3RG6A 3LD5A 2ZADA 1XSKA 1LRQA 4XZHA 3UJ2A 1WKEA 1NWRA 3G2GA 4HN4A 8XIAA 1X97A 4V1YA 4H8NA 3TNOA 2PBOA 3Q37A 2VRJA 1DTNA 3DDMA 2DEPA 4JTRA 1V3IA 3HBLA 3R0KA 2MUCA 3TJXA 3G1AA 3CB8A 4LBRA 3N3MA 1POJA 4NZJA 4D8AA 3QY8A 1LG1A 1W3HA 1TWSA 2CXEA 3CEUA 2PC4A 5TQLA 5FI8A 1CB2A 2YBVA 1G1YA 4JCLA 3L5MA 2OLSA 4C7FA 3LGDA 3REQB 3QFEA 1A5CA 1E6PA 4TVDA 4JBRA 3NPVA 2V2DA 4EPBC 1GHSA 5AC4A 1N8FA 1S5WA 5IDIA 4G2DA 1PHQA 2ZRZA 3W7JA 3DAQA 4WQ6A 3M64A 5G2HA 4QROA 4C6BA 2E40A 2AMXA 3UZYA 4WEVX 3TW6A 2PZ0A 1MZHA 2A4AA 2X41A 1QHOA 1OIFA 5I07A 3FDKA 3QC3A 2OFJA 3H4GA 1AK5A 3A22A 1O12A 4XUYA 4W89A 2PRLA 3VNJA 4ASTA 2QIIA 4GI9A 2P0OA 1G9HA 2QV5A 4FNRA 4DIAA 4C5YA 4WOQA 1XYZA 4N9EA 2X09A 3SGZA 3THQA 1VJSA 4RZ4A 4AIEA 4AIUA 1BVWA 1C9DA 4U33A 2PDMA 3FGCA 3SCSA 1UROA 2R91A 3OBEA 4IXHA 4BEUA 5EYWA 1JCYA 2VGFA 3M0XA 3M44A 3BAJA 2OYMA 4PCFA 1W32A 1SQ7A 3CV2A 1TVLA 4LUTA 4KCUA 4UTTC 4MADA 1S46A 3IIVA 4WDTA 4JIPA 3AMKA 1DJYA 4JN8A 1MDRA 1CENA 2O0TA 4EE9A 3M41A 3TYZA 4ICCX 2D73A 7TIMA 2DP3A 1L0PA 3ZOAA 3O6CA 4N02A 3N18A 4HPNA 1WQ5A 4PCTA 1JULA 3KS6A 4JTIA 3C2RA 1N55A 3ZSTA 2IKIA 2IXUA 3GDTA 3GDRA 1C3FA 2ZWYA 3ZLHA 4JIEA 1Z9AA 1T8QA 4MOZA 1UJQA 3NGJA 3UWVA 1J6PA 4XG1A 4EF9A 2OQYA 5KITA 1ODZA 3PHAA 4ZO9A 3EA1A 3TTSA 4Z2IA 3IIXA 4JR5A 2G3MA 1XLLA 1A5SA 1JAKA 4NNCA 4TX8A 4Z2HA 2A1YA 2WLYA 4XO6A 3HG5A 1EP3A 2REQA 1V02A 1YHTA 3THDA 4XV0A 2OELA 1FWNA 4WIWA 4K1GA 4N4PA 1JDFA 1GUVA 3NFUA 1K8YA 4PYSA 4MYAA 3ZVHA 4KFNA 2WHLA 4HNOA 3E1F1 3DOPA 2AGTA 2OGYA 1LLOA 3G1XA 1W1IE 4UFIA 5FD0A 1OGSA 3N14A 3WQ8A 2J77A 4DM2A 1OEPA 2V69A 2NXHA 4RXGA 2WNZA 1WZAA 5FF3A 4AWEA 2WWCA 4QR6A 2I1OA 3VABA 3O6YX 4HA4A 3Q67A 1QHPA 1EJVC 2HK1A 3FXYA 1LUCB 4G1NA 6CGTA 1EGZA 3KEHA 4EWND 4OQVA 3LHZA 3BC9A 5FJPA 2WPBA 3W7KA 4B5UA 5CKSA 2CETA 1FHUA 2JQXA 5BMXA 4KWOA 4YU1A 3RF9A 5M5DA 4S23A 4AC1X 4KETA 1JXJA 1E3ZA 2BY1A 1FX6A 1VFOA 4S3JA 1RJPA 3UP8A 3KLKA 1S39A 3VU2A 3C3UA 4DWSC 3WD1A 4X3ZA 4LVDA 1MW0A 3K8MA 2XN1A 1FWIC 1LOSA 1IWAA 1J18A 3MCMA 5I3DA 2VWSA 2FHFA 1IXQA 2FIQA 3AS2A 2XJ7A 2MNRA 4NAFA 3AMDA 2WM1A 1D9EA 1C93A 3G3MA 3DGBA 3T2OA 2C13A 2Y63A 1LL4A 3TR9A 1Q6CA 4TV6A 1V3KA 4LUSA 4JQAA 5D03A 4EIVA 2VTFA 1E6NA 2UY3A 3WK3A 4CD8A 2IUZA 5FSEC 1B30A 4GCXA 4O8AA 4OOUA 3ZWSA 3MHUA 3VINA 2BOFX 2WJZA 2YL8A 3M6DA 1BGGA 1JF5A 2OMAA 3PJXA 4KMQA 1KC7A 4NX0A 1OC7A 5CH9A 3VIOA 3UCCA 5LXXA 1QWGA 3HG2A 3CO4A 1DJXA 3MW7A 3N2XA 5BWAA 3WQ4A 2O7QA 4MFEA 4JFTA 1GHRA 3GNNA 2C16A 5HWMA 4ROQA 1NQKA 4HYWA 2Z1BA 5AC7A 4AU0A 1MVYA 1FXQA 3BOXA 3N25A 4RW3A 4ZZ9A 6PTDA 2YDAA 2ZZ6A 3W7OA 3F5LA 2GJXB 2INZA 1PKNA 4DAIA 1K7XA 4ORIA 3I6EA 2PTDA 4JCMA 4V15A 1A5AA 5AHEA 2I9EA 4DLMA 3WLPA 3ATYA 3FVMA 3CQIA 2E8ZA 3GVWA 3CB3A 3RRAA 3PANA 4P8VA 3TQVA 4DJFC 1Q8AA 2A3LA 2FPTA 4QE4A 3PBYA 3PUGA 2XWEA 3BOLA 4JIHA 3HPAA 3LHUA 1RK6A 4WY0F 1LZOA 2XHYA 4M80A 3AI0A 3H7VA 5G4HC 3W07A 3A3WA 3MWAA 4LCQA 1J6OA 5KTLA 4PUWA 1HF6A 3W1UA 2ZRVA 4ERAA 4GZJA 2Z1WA 3VC5A 1AVAA 5MHBA 1XSJA 3W88A 3OTRA 3MS8A 1H11A 2GGIA 2O9TA 3M6YA 2B7NA 2Y7DA 3XIMA 1ME7A 4F9JA 3VM5A 3WNNA 2Q3OA 2AL2A 5AVNA 4PMJA 3NG3A 4KWVA 1UG6A 2VEPA 3WNLA 1ISVA 5D09A 1JZ6A 1CGXA 3NVTA 3VNDA 2EHHA 4JNZA 3EB4A 1BHGA 2J7HA 3SGUA 2D2HA 2OQLA 5H2ZA 3GNPA 4XTIA 2OZ3A 3LLDA 3KBWA 4BEQA 1UWIA 5I3JA 3ITYA 1VBUA 4FP1A 3VMPA 3GTNA 3M0YA 2DZAA 1MQRA 3B8IA 4L4PA 3VM7A 3EWYA 2QYGA 3F2DA 2Z2UA 1EZ2A 4D72A 4CNSA 4FX6M 5CXPA 4CNOA 3HPZA 4EKJA 3WENA 3M4HA 2Y4SA 4GIRA 2B7OA 1SW0A 3SURA 1WV2A 4LCRA 1TG7A 3GDBA 5LA2A 1Z48A 1O1HA 2G50A 2VFDA 1PEZA 4AYGA 4YL2A 1E1FA 1UIOA 1FWDC 2VGGA 1EF3A 3VD3A 3BURA 1XQLA 1P7TA 2WHMA 1AA1B 2C6QA 1ZBCA 5HNRA 3RK8A 4MNLA 3GNRA 4HCHA 4Q4KA 3OBKA 1HO4A 4QNWA 2GOKA 1U1HA 2ZVRA 4MWAA 2YCJA 1Q6RA 3CWOX 1EJUC 4HYRA 4MUPA 1C9WA 2GUYA 1GOMA 1EJ7L 3C2YA 3CAKA 1W8SA 4AX6A 1H0IA 1RVKA 1EKOA 2O4QA 3GZ3A 4UB9A 3QC0A 2QCMA 3D6NA 4JFUA 5A8OA 4W8AA 2F7FA 1V8EA 1F8MA 3GU1A 6ALDA 4O0QA 1FY6A 1RSCA 3GXMA 1O5KA 5G1MA 1O1ZA 4IGHA 1KNWA 1JVNA 4IJRA 3ZVIA 1V08A 4BF7A 5FL0A 4A3YA 1TPWA 3O6AA 1PPIA 1J0YA 1OK4A 4H7ZA 5A6BA 2OYKA 3HMJG 4LS2A 4J4KA 4ZB2A 3EA3A 3WLMA 1E0WA 1KM5A 2ACRA 4MNMA 2XU2A 2ACSA 4RKAA 3WSUA 3KWSA 3FIGA 3BLDA 2J88A 4FX8A 1O7AA 3SY5A 4UBPC 5K3VA 3PJUA 4Q8UA 5K7JA 2P5NA 1P6BA 3QV9A 4LF1A 1KFWA 3UPBA 1XKYA 3UNTA 4WDWA 2CKSA 4Q4OA 4QJ3B 1TPDA 3A3XA 1PUDA 3R79A 4QLKA 1WXJA 3MSGA 3WQ5A 5FEWA 3UR2A 2W3ZA 3MSDA 3CPUA 5A6AA 2CW6A 4WDUA 1FKXA 3FKKA 4US5D 4HSOA 4IOTA 3VC6A 4DXVA 4KIEA 4JQ3A 1MW3A 2Y7GA 1LP6A 4I90A 2VHLA 1L6FA 2HPMA 2QLYA 1CNVA 3B0PA 3UXLA 4NYYA 1OFPA 4XO7A 4DNMA 3CXOA 1I45A 2CLOA 3IJ7A 4O1FA 2YXGA 3RRXA 5C9WA 4UOZA 1VYSX 4PMOA 4E4FA 1UIPA 2RH9A 3C2EA 2YCIX 2AOSA 3G8EA 3W7IA 2OODA 1P1MA 4JHMA 1MDLA 1JI1A 3UZJA 1A3HA 4H6EA 3HJEA 3CIVA 3ZT5A 1MW2A 1R86A 3GC4A 1BWVA 2JBMA 2FZ9A 3E2RA 2RDUA 3L7RA 3DKJA 3DG3A 3FYYA 2FZDA 2E5BA 4IIGA 1TMHA 2JF7A 2CU0A 3W1AA 4AUBA 4IPPA 2R1NA 3FXGA 5A94A 1HW6A 4HNCA 2DORA 3O8AA 2B4GA 3M5XA 2CERA 1CGTA 1PIGA 1VS1A 5D37A 1WZKA 2WV8A 4UTKA 3URQA 5I02A 2GUBA 3EPOA 4GIAA 3LRMA 1FUYA 4HZ8A 5EY5A 5HQLA 3OLGA 4X9YA 1QOXA 1KW1A 2VOMA 3QQ0A 4GY7A 1QHZA 5E5CA 4LXFA 4JDBA 2F38A 1E6QM 4A8RA 4QP0A 4UTTA 2FB3A 3L4YA 1BKSA 5A8PA 1RK5A 3L67A 4QG8A 4EPEC 4KFOA 3WF0A 1E5JA 1Z8AA 1JYXA 3T6CA 1CYGA 2ZDSA 1ZJIA 3WH6A 2X1RA 1RY0A 2XH4A 3LCIA 4TMBA 3G8RA 3HO8A 4G7FA 3OIHA 3UXAA 2HVNA 1VBRA 2VX5A 2GVLA 4DN1A 3TFCA 3LTPA 4PUDA 1DJZA 3MC5A 1JUBA 4ZO6A 4H2CA 1L2UA 1D3HA 3WH5A 3WMCA 1DP0A 4WJ8A 4ADUA 1YBQA 4MJMA 3BGGA 4US6A 2GJXA 1KFCA 4LPCA 1SZNA 4HHMA 4FLRA 2WSQA 2Z7GA 1ZY9A 2ZIDA 2ZXAA 2Q01A 2PCEA 3LCWA 1JZ8A 1H63A 4QSFA 4JKMA 4P8WA 2QCDA 1PVNA 2QAPA 3E0VA 1UA7A 1ZAIA 4O15A 3V5CA 1EPVA 3S5SA 4AD1A 3PBUA 3UJFA 3N6QA 4KWSA 1V77A 4JFSA 2QJNA 1E55A 3O6DA 2V3DA 4BWLA 4B5TA 4XVEA 3R8RA 6TIMA 4LVBA 3LZ5A 3C0LA 4UZSA 4KIRA 1EXPA 3ANVA 4E0CA 1LG2A 4H9TA 4MZ1A 4O0ZA 3RUBL 3CZ8A 3GTFA 4PFHA 4WSHA 3AIRA 3SEPA 4Q8TA 1UMLA 2VC6A 4MZ8A 2R1KA 4BR1A 2F6UA 1ZUAX 2R14A 3B05A 2G4JA 2WCGA 1J2WA 2GQ3A 3ZVHB 3CEPA 6ENLA 4NU7A 4JIQA 2ACQA 4AEOA 4CEUC 3CBWA 1FWWA 1M1BA 4W5UA 2B7QA 1V7YA 1TV2A 4GIYA 2NLYA 3V16A 3L4TA 1H61A 3WK0A 1W56A 3O1NA 4EACA 3BSGA 3F03K 2DSUA 1GONA 3WF2A 4KPLA 4WCJA 5KZEA 3AJ7A 1OWQA 1KO0A 1BFNA 1WKFA 4QISA 1K9EA 2QMJA 2INFA 5CGQA 1VFFA 4C6OA 5C54A 4NJIA 5G2IA 1EBGA 5AZ0A 3OHIA 4WY0B 1T40A 3NDZA 1U5VA 2I57A 3F4CA 1OD0A 2A3CA 4HA1A 4QNEA 4YXGA 3MCOA 3TZFA 2F6KA 3VD7A 3EX2A 4V28A 1ICPA 4KT2A 1S2WA 1XLAA 2DZVA 4RE0A 4PTDA 2DW6A 3M43A 2PF8A 2ZZ4A 3QPEA 1OG6A 5G4WA 4H1ZA 1PX3A 3JZEA 4H9VA 4UMBA 5I3GA 1QMLA 1IT0A 5IBXC 1JR1A 1QNVA 3CPGA 2O55A 5I77A 3PZUA 3OGVA 1UOKA 3PNZA 4G1KA 1FCUA 4J3ZA 4D1IA 2W66A 1GJWA 4MFDA 5KZ6A 3QY7A 2ZRYA 4DJEA 5C8BB 3QGVA 1QFEA 4IL0A 2OSXA 3MT1A 1OB0A 2ZWZA 4DXKA 4H2HA 3WF3A 2XH2A 2A7NA 1ONEA 3STPA 2PDKA 1V6XA 3NPXA 4H41A 2ZX7A 3IARA 3OZOA 3S0CA 2QCGA 5FJJA 4HGXA 3ITTA 3EOOA 2J25A 4GOAA 1VPXA 4O11A 5C55A 3RCNA 1WBJA 1Q7MA 2W92A 1IZCA 3SIMA 3KLLA 3NL6A 2PTWA 1PX8A 1TJ2A 4IPLA 4S3AA 1I2RA 1OBAA 2W62A 3GXPA 4Y9MA 1VBJA 1FWAC 4KEUA 3VNYA 2PTXA 3SZ8A 4G5DA 4B9ZA 1P0BA 3HB9A 3PB0A 4IHCA 1TZ9A 1E72M 2RJHA 3V5FA 4ZQNA 2P76A 3AZRA 1Z6KA 2VXNA 4A6GA 4FOJA 5A2AA 2P53A 1VCFA 1VB9A 4Y8FA 5DMYA 4WXZA 4FA3A 3PB2A 3W76A 2HTMA 5FA5A 1MQPA 2J7EA 3B9DA 3G3DA 3PZVA 2VCBA 1P0DA 1VEPA 3CL7A 3EMZA 3LBCA 4ORMA 3SCRA 1HN1A 1R3YA 1Z42A 3AIBA 1J93A 4UMCA 1KR1A 1W1PA 4F40A 2NX1A 1F3WA 1TRDA 4Z1BA 3TN3A 5DT5A 3QBUA 4BZYA 3P74A 3GXIA 3M0HA 3KOXA 2Y24A 4QQUA 5AB3A 7ENLA 3CL8A 3LI0A 3W27A 2WYSA 4PGLA 3GC5A 4AD0A 3W4RA 4BI6A 3W70A 4B5SA 3D46A 1F74A 4O54A 1GG1A 3WX7A 1KTCA 3MANA 4B3KA 3UJSA 3FSUA 2EPMX 1H50A 4XBKA 4YJ5A 2GJRA 2YW4A 1ZL1A 2H9AA 3DUGA 2WZTA 5E9XA 1VLWA 2YL6A 3EA2A 3IJ6A 1XISA 4QLJA 2FB2A 3NZQA 1E5NA 2G3IA 4FK9A 2EO7A 3BJFA 4U2ZA 5BW6A 1QI5A 4X0VA 3H2OA 1MFUA 3K1DA 2ZC8A 2J4GA 1UHVA 3CZGA 1B3OA 2PP1A 1G94A 4U4MA 4EP8C 3MYOA 2A3EA 4NRRA 4DHGA 2EG8A 3BO9A 1OFDA 2W61A 4DVOA 3LSBA 3OVPA 1RY8A 4FNQA 2NSXA 4MWAD 2D2JA 3ANUA 1TVNA 3G1HA 3WUFA 1W1ZA 3YPIA 4JTLA 1T5AA 3EDFA 3HFTA 3IWPA 1OADA 3EXTA 4H8UA 1YW1A 1NFGA 5A8MA 2NSOA 2V68A 1TR9A 3T0TA 3TTEA 4PB4A 1VCVA 4HOWA 4CKQA 3STGA 4AMAA 1G4EA 4BQ2A 1V3MA 3EDDA 3CUXA 1HL2A 4ZOCA 2WZEA 3F5JA 1F8IA 5T26A 4GFIA 4Q33A 1SJAA 1WX0A 3GX9A 4H7VA 5CZTA 3NL3A 2PDLA 1HJQA 4NXSA 2B81A 1CZ1A 3GDMA 1BTCA 4O53A 2AKZA 2D2GA 3N4FA 1Z69A 4LB4A 1RJRA 3BLEA 3DH7A 4YPJA 4JEQA 5F2MA 4O8RA 4QXIA 2V3GA 4AAJA 2DT2A 3L21A 4MB4A 3N2TA 3P62A 4BK9A 2XIMA 1K8XA 5E0KA 3NZGA 5ECVA 4GE8A 4DB7A 4RZ6A 2AL2B 1OX4B 1XC6A 3WLLA 1SR9A 4HZ7A 2GVGA 6XIMA 4D1JA 3HPXA 9XIMA 3AWNA 2E77A 2BV9A 5EBAA 3U4AA 1TELA 5A2BA 2Q8LA 3CV6A 7TAAA 4D6EA 4ZOBA 4XSMA 4W8BA 2PC8A 2C71A 1DL3A 4MPQA 2JEQA 5CC3A 5A6BD 3FJ6A 2ZUWA 3GHRA 4ZE5A 2DT1A 2W63A 1ZFJA 1KBKA 3D0CA 2DT3A 3DHDA 2VL4A 3LQLA 3BWWA 1PS9A 3H12A 4IJCA 2PLJA 3CUFA 1EF2A 1EFZA 1KM4A 1DWAM 4LUJA 5JH1A 3L4ZA 4JTTA 3QMTA 4B15A 5AECA 1H1ZA 2CHNA 3P3BA