1M1BA

Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
publication title Dissociative phosphoryl transfer in PEP mutase catalysis: structure of the enzyme/sulfopyruvate complex and kinetic properties of mutants.
pubmed doi rcsb
source organism Mytilus edulis
total genus 111
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1m1bA00
4KS0A 2HWGA 2XZ9A 3E0VA 1F61A 4KCWA 4FXFA 4L80A 3HQNA 4B5UA 4L9YA 2OLSA 3GR4A 4QG8A 2QIWA 3N25A 4B2DA 2R82A 4JPGA 3M0KA 4B5SA 1O66A 3P0XA 2VWSA 3ME3A 4B5WA 3BJTA 4KRZA 2XZ7A 3R4IA 1PKNA 3QV7A 3OYXA 4TV6A 4KCUA 4HYVA 4YJ5A 1S2TA 1A5UA 4IP7A 3GQYA 1SGJA 1E0TA 1DQUA 3GG8A 1A3WA 4RPPA 2ZE3A 2L5HA 4IMAA 3T07A 4B2DD 4QG6A 1F8MA 2V5KA 4FXJA 1PKMA 2VGGA 1KC7A 3SRFA 1IZCA 1IGWA 4KCTA 3B8IA 3PP7A 1JDEA 4QG9A 4B5TA 3LYEA 1O5QA 3OQ8A 4L7ZA 3T0TA 3FA4A 1MUMA 1GGOA 1ZLPA 1PKLA 2XDFA 3BJFA 3PUGA 2VGFA 3EOEA 3T05A 3QLLA 3IS4A 3QQWA 1PYMA 1U5HA 3QV6A 1UJQA 2V5JA 3SRHA 1DIKA 4WJ8A 2X0SA 1PKYA 4HYWA 4LSBA 2BG5A 3EZ4A 3QTGA 4IQDA 3I4EA 4ROQA 2VWTA 5JVLA 3HQOA 1F3WA 3E5BA 2HROA 1O68A 2G50A 4L9ZA 1AQFA 4IQEA 1KBLA 1XG4A 3HQPA 3LG3A 1VBHA 1DXEA 2HJPA 2VGBA 2DIKA 3G2GA 4MF4A 4B5VA 3QV9A 3KTXA 3MA8A 4B5XA 3EOLA 4DRSA 1U5VA 2DUAA 4QGCA 3VAVA 1M3UA 4G1NA 1F3XA 1DXFA 1A49A 1S2UA 1ZJHA 3U2ZA 2VGIA 3QV8A 1VBGA 3KHDA 1M1BA 1S2WA 4MG4A 2KX9A 1F8IA 1E0UA 1XG3A 2E28A 3FA3A 1Z6KA 3SRDA 3OYZA 5TAOA 2WQDA 3M0JA 3E0WA 1OQFA 3EOOA 3QZ6A 1T5AA 4KCVA 3SRKA 1A3XA 2HRWA 3H6OA 4YNGA 1OY0A 1S2VA 4TV5A
chains in the Genus database with same CATH superfamily
4N9EA 4C6OA 1H7PA 1JCYA 1R2RA 2P8BA 1NFBA 3KVMA 3MSRA 3KDOA 4IPNB 2Q8LA 2X2YA 3BANA 1NDVA 3GH4A 2PTXA 1EDGA 4LX4A 5CG7A 1B31A 1OFDA 2XVKA 5IM51 1X7FA 4B91A 1WDSA 4F48A 1AK5A 3BVJA 3L7RA 3PN8A 2CW6A 4LRTA 3G8EA 4UUIA 4AEFA 4FXJA 3GBDA 3UWYA 2YL6A 5ABGA 4HK6A 3R13A 4D8ZA 5BRPA 1XLAA 2ZBTA 3UCQA 1JVNA 1GVIA 3RF9A 5M5DA 4M5PA 1GOIA 3AC0A 3EX2A 4AISA 4OFCA 1WDRA 1P4CA 2R24A 4FNTA 1ME9A 3T2PA 2OGYA 1AW1A 1VYSX 1Z7AA 3GNPA 4G5DA 1UPMB 5BZAA 1QASA 3DEQA 3STFA 4IJCA 4IXXA 1GOMA 4DAFA 3QV8A 1RALA 2XH2A 4IISA 4E0CA 4PMYA 1PZ0A 4W7WA 3KHJA 1ZGDA 1V6UA 1N7KA 2ZXQA 4Z0JA 4GABA 3THDA 1JD9A 5H91A 5D03A 1TE6A 2PP0A 4KW2A 2X41A 3WDHA 3W74A 1GVFA 3RPTA 4RL3A 1EIXA 3DH7A 2O7QA 3P0WA 4GY1A 3O8AA 5A8NA 4ZVJA 3L66A 3H2NA 3MTWA 1ISXA 2A21A 1CPUA 3SCRA 3FYPA 1FHUA 3VA8A 1PTDA 5AHNA 1WNOA 2CBUA 8XIAA 3E2RA 4WDTA 5HR6A 1P7TA 4LNCA 2VGGA 3P74A 6ALDA 3KOWA 2JEQA 1O5QA 4H6RA 4U3AA 4NZ5A 2EXOA 1BWVA 4GI4A 3N9SA 5HWMA 4GKLA 5JBDA 3ERPA 3DERA 4WD0A 3WYZA 1GNXA 1BD0A 3TJIA 3KUMA 4NXSA 3FXYA 3T09A 4H9YA 2WZMA 5HQMA 2QDDA 5D05A 1AFSA 1JUKA 3ZLGA 5CG0A 4CD6A 3UWQA 4QQUA 2VDIA 4PMUA 4ZEPA 3PZUA 3IWPA 4LAOA 4AVFA 4HOZA 4JQAA 3WMBA 4AYSA 3FAWA 3P14A 5CBIA 2JGQA 5FF4A 3P80A 3PJWA 1HO4A 4TX8A 2DSZA 4MZYA 3O0KA 3LHTA 1WKFA 1Z42A 3PZ9A 1MDRA 1XG3A 5IDZA 1OG0A 4J3UA 2VELA 3SCVA 3SAZA 1O95A 3S2NA 4NYYA 2WZEA 1FBAA 1FWIC 2P3EA 1M5WA 3SCSA 2OT0A 3AISA 1CX9A 2UY3A 2YCIX 4C6LA 3W6YA 1PWLA 3LTYA 4GI8A 1EQCA 3WQ8A 4PGLA 1OFRA 3W7NA 5G1MA 3AIQA 2Z4GA 2IW0A 2ZE0A 3S1WA 1RJQA 4C1LA 3H7VA 2WZHA 3RCMA 2UY5A 2OCZA 1UH4A 3N9KA 3BMWA 2B7PA 3LEPA 3TR9A 1TA3A 2CESA 1SR0A 8A3HA 3AJXA 3OJGA 2DVXA 3DENA 5KTLA 5E1QA 3R8GA 4YCPA 1MNSA 2HV5A 3CQJA 2AMXA 1W1VA 2QMJA 3VDBA 1F3WA 1CLKA 2WCSA 3O07A 4FLRA 2GSHA 4CD7A 2REQA 4DNHA 3L4WA 1IF2A 1YYAA 4BWLC 4TMBA 1JJKA 4C1NA 1FP9A 3N4AA 4EPEC 4AZCA 1RQBA 4BZYA 2J78A 1V5XA 5D9OA 1B3WA 4AD1A 1E5JA 1S5WA 3SCTA 3C86A 3STEA 3TWAA 2VT0A 2NQHA 2OWWA 4BF9A 1C8XA 4EOUA 4A4AA 4CCZA 3NTYA 3M0ZA 2PDLA 1M41A 5G4EA 3ISIX 4H6KA 1XRFA 3L9CA 1KKOA 1E4NA 4O52A 2PC4A 3W26A 1GOWA 2C15A 5A6BA 4DN1A 2YXGA 2BOEX 2J7HA 1G7UA 4HOWA 2Z26A 3P3BA 3L67A 3MJMA 3MMDA 4KEZA 4X0VA 1JR1A 3P7YA 2CITA 4WSKA 3TN6A 5G5IA 3CBWA 1UUQA 2XHYA 3D5HA 1U83A 4ALDA 4Q4SA 1C3FA 4AWUA 3WF4A 2INFA 4U10A 4CUCA 4IT1A 1JPMA 3EX6A 1RZMA 4UBPC 2GZXA 1QNQA 3S6OA 3GKFA 4MNJA 3TJLA 1ZAJA 3NDOA 1XLDA 5CEWA 1TTPA 1DIOA 4PR4A 1OFQA 3QEZA 4FNSA 1N82A 1VHNA 2QCLA 1IIHA 4I6KA 1UUMA 5BROA 3C52A 3NPWA 4AZ6A 3H55A 4LUSB 5HMFA 8TIMA 1J11A 5DT7A 4Z2KA 1M3UA 5EMLA 3E2SA 4G1NA 1DOSA 4MKSA 4H83A 3WUEA 3B05A 3ICJA 1A5SA 3CTTA 4GZ7A 4QJ3B 3C0SA 2I7GA 3HJEA 1PV8A 1A0EA 4ZE5A 4RE3A 1LT8A 3UZJA 5BMXA 3UYCA 1X8FA 5D37A 1WV2A 2GOKA 4NIRA 1JYWA 4ZO9A 3TU9A 2D0FA 1F74A 5EL1A 4Z1CA 3EEZA 2OYMA 2D1ZA 2YCEA 4MWAA 2VFIA 4L1XA 4E4UA 2DT0A 3W2UA 3SGUA 3CUFA 1HKKA 5A2AA 3LHVA 2E25A 4IMGA 4D6GA 1W9DM 2XM2A 3UZ5A 2BX7A 3EDDA 3VX1A 3IJ9A 3QPZA 1XIJA 3B8VA 2AQOA 4P7NA 3GDTA 4FXRA 3EDKA 2AMGA 3HGJA 1J10A 3WLOA 1EIBA 4EE9A 4O0QA 1UJQA 1WYIA 3UR7A 4NJIA 4DJDC 2WAGA 5MF5A 1LG1A 5F2LA 3HGSA 4HYWA 3GXFA 2PUZA 4QCFA 3I68A 3HQOA 3E38A 1H0GA 2Z6IA 1CIUA 1AQFA 2PLKA 3LD5A 3HQ1A 3IIOA 1Q8AA 4WVXA 5CGTA 3PZNA 3OVGA 3FYOA 3KL3A 3Q94A 1UWSA 3U7BA 3R2GA 3Q67A 4HGXA 3VE7A 3PFRA 1W1YA 3VKCA 4C65A 2XH4A 1QBAA 2WK2A 1QW7A 3DC0A 3HMJG 7TIMA 1G4EA 4TV5A 4GNJA 2BVYA 3KZSA 4PYSA 3T0BA 1BHGA 1EGVA 5HANA 1T8QA 4H8VA 2A6NA 2FHCA 1S38A 3NJ3A 3CT7A 3EGJA 3KWXA 5FJTA 3CQKA 3T8QA 2A3CA 3K1GA 2E9MA 4F9JA 5HNUA 3SY1A 1KQZA 5EFFA 3P84A 1YDVA 3BZGA 1TPEA 2ISWA 1AMKA 2PGRA 5EMKA 1KXHA 2PMQA 5CZTA 1CXEA 4B15A 5I3IA 4F0LA 4A8RA 4H41A 3NQBA 1GT8A 4C5YA 2WSPA 3BCFA 3T08A 4EP8C 4Q22A 4O16A 3ANYA 1IXPA 1R7AA 1Q6RA 2D0HA 4FI4A 2PRLA 4S3EA 3BLLA 5F4XA 2PU0A 4MUPA 4LOCA 4LRSA 4N4QA 4PTMA 3WJSA 2RDTA 4NAFB 3H21A 1QOQA 4RZ4A 7ODCA 2YLLA 4PCSA 4B5XA 1ZNNA 3N2OA 2PE4A 1BVZA 4M24A 1XYLA 3M44A 1TZ7A 2PCQA 3A4JA 3ATZA 3LBMA 4TVDA 1TPFA 1YBQB 1KW1A 4XBJA 3OVPA 2VOTA 3UW6A 1UZDA 4JOMA 3WUBA 5BW6A 2Z1VA 1IEXA 4DXKA 1AODA 4WHBA 5REQA 1EJWC 1TJRA 1PEZA 2HCVA 1Q6LA 1LUCB 3PNUA 3A3WA 7REQA 4GX8A 1WZAA 3HU7A 4A2SA 1XBZA 4F0HA 4XTDA 1ITCA 5C9XA 1VIWA 4G6CA 4LYKA 4E8GA 2NQZA 4S3GA 4JHMA 3W24A 1E6ZA 1VFOA 3ALGA 3W4RA 3RCYA 4R7JA 4IFKA 4CCCA 1IXOA 1J5SA 3LHWA 4QSHA 3KM8A 4IHCA 3SUSA 1D2KA 2PWUA 1KFWA 1FKWA 4M80A 4NF7A 3VOHA 5BU9A 4R85A 1VRDA 1XLCA 3PUGA 1JDDA 1H7NA 1UR1A 4O15A 1L2UA 2BDQA 1E1CA 2GJXB 3T2OA 2GUUA 1B9ZA 2W66A 3AMKA 1GJPA 4EXBA 2FVLA 4ZOAA 4LEFA 1DWFM 4Z0SA 4H9TA 4NZ3A 8XIMA 2XISA 1VEPA 4PUKA 1OSEA 2FVMA 2GPTA 3AIEA 2VKZG 4QEEA 4C7DA 1KV5A 2YL9A 3UT0A 1YPIA 2HXTA 1CTNA 2WB5A 3LZ3A 4UR9A 4AIEA 2W4XA 3C8NA 1XH2A 4B5VA 3UESA 3B03A 5CAHA 4HZ7A 1FKXA 1YE4A 1W9BM 4G7EB 4ADSA 2YFNA 1Q6CA 3L5LA 3S42A 4I90A 4K37A 4LUJA 3NGFA 3DOPA 4J3TA 2BB0A 3CEPA 1ISYA 1WZKA 1H3GA 2XGZA 4I7VA 5JMUA 3CO4A 3NEVA 1UR3M 4TQTA 4Y9PA 5A69A 1W32A 1JDAA 4B16A 4LS0A 2CPUA 5D2XA 1W9XA 1JYVA 4AG0A 1BXNA 3GU9A 4GA8A 3SY8A 2P88A 3TW6A 2QCEA 2L5HA 2V68A 1X97A 4HSHA 3FHAA 3VNDA 3DDMA 4RJEA 2CLOA 2ISFA 3DFNA 1XIDA 1CLXA 2NT1A 4GH3A 5CBBA 2VEKA 1O4UA 1K8XA 1KV8A 4QLLA 3KFTA 3QLDA 5EFDA 1OX4B 1V6YA 5BMWA 1UROA 3KX6A 2QDHA 3M41A 3L2MA 2YLAA 3KEHA 4EXQA 4DBDA 3AZRA 1UH2A 5AHFA 2OWXA 3E74A 4YWIA 1EHNA 1GTHA 3CH0A 1NM9A 3GVGA 2DH2A 2I57A 5DLCA 3U5UA 4NKCA 1TVNA 4GVFA 4JTIA 1AD1A 4IGHA 2OJPA 2XIOA 3ANUA 3LCHA 1AD4A 1UOKA 1KXTA 1SQ7A 5K4XA 4LB4A 1KLYA 5C0QA 4XKYA 2WLZA 3ABOA 1ZAHA 2R9RA 3TV8A 3BW2A 2XZ9A 5HQLA 3TH6A 3KL0A 1GTEA 3LN3A 4MB3A 6TIMA 4KWUA 4BI5A 1SMDA 4DIAA 1RA5A 1I60A 1GW9A 1XINA 1WAWA 2J13A 2GK1B 2VEPA 5HK4A 4QISA 2WV8A 1CT5A 4H8UA 4GY0A 4UQEA 3VKDA 1BF2A 3R6IA 1XYBA 4UFJA 3S5ZA 1V6XA 4NX0A 1MXSA 3V4BA 3HGOA 1TIMA 2O9TA 4MY1A 1IWPA 3B8WA 1UC4A 3CYJA 3WFLA 1V93A 3NSMA 1M7PA 3AAMA 3T05A 4OUEA 3C2EA 2BS9A 3PSWA 4Y7EA 3VIOA 4NY2A 2WMGA 4ROPA 4H8HA 2G96A 3URAA 2MANA 5IHSA 3S46A 3QJAA 5I2UA 4UMBA 1O68A 1UKSA 1GONA 1E6SM 3LXAA 2BMBA 1PX3A 3LRLA 1V3JA 2A7PA 5I23A 1FWBC 1S1RA 2VEMA 5BOOA 3SCPA 5C71A 5DRCA 5DMNA 4ZTXA 1UBPC 3S2LA 4N6EA 2C1GA 5FF2A 4C7GA 3AO0A 2GDUA 3W01A 4R5EA 3WLNA 3KAOA 1MFVA 5HNTA 1V02A 3DG3A 5EMUA 1UD5A 3GXIA 3PJTA 3MUZ1 1XGDA 4QROA 2H3DA 1EJTC 4XBSA 2A0NA 3DGBA 1JZ5A 4UTHA 5CXPA 2XGBA 4NASA 1B9BA 3L4VA 2NZLA 2PWGA 1XYFA 4B5WA 3VIJA 2GUYA 1A5OC 3B9OA 1A53A 4D2JA 2BSLA 4PBFA 1PZ3A 3CMJA 2PLMA 2B31A 4AZBA 3A6OA 4UZSA 4GO8A 1RXOB 1XLMA 5A6SA 4D6CA 1R9YA 2F7FA 1UD2A 4R3UA 3M5XA 3WD2A 4GRSA 3WD3A 1O1ZA 2F61A 3NYZA 1VQTA 3VC5A 2FGZA 1UP3A 4PMRA 1WUEA 2J47A 1SZEA 2BBFA 2HK1A 4PTXA 1T96A 1ZCCA 4O1DA 2WOQA 1OG6A 5K9DA 2R14A 4N9DA 3MP3A 1SMAA 1J0IA 4JN7A 3I7QA 2PZ0A 3O9NA 2XVPA 1PIFA 3KBVA 4LAZA 2A3BA 2OVLA 1OADA 5AOUA 2HVOA 2VC6A 1QI4A 4H9XA 1CGVA 3FGCA 4IPJA 4W7UA 1AJZA 5HULA 1E43A 4AF0A 1V6WA 3P93A 4GHRA 3UR2A 1LORA 2E7FA 4HTBA 3RMJA 1VYPX 2BV9A 2CIPA 3PBWA 4B9ZA 4D8LA 3FA3A 4JHOA 4DJFC 5HR7A 3PSVA 3HG5A 4M1RA 3IRDA 2J62A 4ZXLA 5C7HA 2FMNA 2XTKA 1I1XA 3TSMA 3QMSA 3WNMA 3H22A 1DTUA 1KM3A 3KWSA 4PSPA 2V81A 2P53A 3Q37A 2Y89A 3AMCA 4ZQRA 3AYTA 4C6NA 3N1AA 3T1GA 3QN3A 3C0LA 4GQGA 1EZWA 1LF1A 3QPEA 1IIGA 4AU0A 1V3MA 1WKDA 2H9AA 2HXUA 2QJMA 3EWYA 2HS8A 4PMOA 4ZSTA 3LI1A 2J77A 2W92A 1TTJA 1C90A 3U3HA 1VPQA 1L8NA 1MEHA 3M6YA 4X2RA 3A9IA 3URNA 2BGQA 1GQNA 4PTDA 3VIMA 3CZEA 4YU1A 4DYKA 2QV5A 3NCOA 3W29A 3T9PA 1XGZA 2C13A 3COTA 2ZUSA 2E0PA 1Z8AA 3LSBA 4WDXA 3FW6A 2YA1A 1H0IA 3HN3A 4TUFA 4Y8EA 4HPJA 4JTTA 2CHNA 3NQAA 3VTRA 2E6FA 2X8RA 3QXBA 1E6RA 5I77A 1DE6A 3INPA 7ENLA 3S5NA 3AS1A 3QHOA 1POKA 1QPRA 1M03A 4IIFA 4GNKB 4MTVA 4S3KA 5G2WA 3SRKA 3BMXA 1NSJA 2VDGA 1RA0A 5ECVA 3UR8A 4DAIA 1J4EA 2ZZ6A 4U33A 4LVDA 3NVDA 2Y5EA 3VK5A 2DFAA 4EVZA 1XYMA 2QF8A 3WL0A 1NDZA 2XWDA 4HNVA 5AYIA 4E4FA 3J7HA 2FHFA 3MVIA 3MYPA 4YWSA 1UKQA 1NY1A 3W70A 1DWAM 3O6DA 2C1IA 5ECUA 1DTNA 1TVLA 1W3LA 3WZ0E 5E09A 2CYGA 1EA0A 1FCBA 4GBDA 4D8AA 3ITLA 1GQJA 2YW4A 3W7KA 4IIEA 3V0TA 1XRTA 1NFPA 1FCQA 3E0LA 5CCZA 4LSBA 4AC1X 3QTGA 4JTAA 4BI7A 1ZBKA 5H8UA 3GG1A 1PIIA 2A5HA 4MADA 1FH9A 1IEIA 1A5CA 1KRAC 4KRTA 1DXEA 1OT1A 3GDBA 2R6OA 3WF0A 4P8WA 4UNIA 1VJIA 1RSCA 4LYQA 1I2OA 5KZ6A 5JBEA 1OGBA 1LLWA 3GHRA 2VRKA 3NQDA 1OVDA 3W37A 5C9ZA 4MKVA 3S9YA 8RUCA 2CWXA 4FB7A 3SSJA 2AKZA 3AHTA 4PMQA 4YXGA 2DY3A 3W1RA 3E2QA 1LZOA 2CERA 1FHDA 1P6WA 2OKTA 3CEUA 5HWJA 1XICA 1EO7A 3F4WA 2V69A 3CNYA 1MQRA 3RFAA 4B90A 2HBVA 3NM1A 1UD3A 1LRNA 3IPWA 3QSTA 1ME7A 2YKKA 4NILA 1Q4WA 4EF9A 1PX4A 3U2OA 2ACQA 1JCMP 2QCHA 2NVDA 1PAMA 5AYBA 3U8GA 1YHTA 4DELA 1YPFA 3VXGA 1EF2A 1FWJC 1B2YA 4EK7A 3DFTA 3WLHA 2PDIA 2V63A 3EMCA 4X60A 4AH7A 1CNVA 3NSNA 4JQ4A 5CZJA 1VLWA 2ZUMA 1PO9A 3MKCA 4GE8A 1LRTA 1AW5A 1ZALA 1LQ2A 3G0XA 2A7NA 4ACZB 3C8FA 3A13A 1CZ1A 2X42A 1F6KA 3H70A 3FSTA 4NJJA 2HDJA 1IT0A 4KEVA 5B80A 3LI0A 4QFUA 3VIGA 3T55A 2EKCA 3OBKA 4WKHA 3N2BA 4A3HA 1I1WA 1Q13A 2IQTA 2VZTA 3ARUA 1F73A 1U2YA 1YDNA 3BG9A 3ZFHA 2ZXBA 3VDGA 3FK4A 3ZWTA 1TSIA 1OC6A 3D3FA 4QJ5B 3FOKA 2XSAA 4UFKA 1UIPA 1Q63A 2YCLA 1EUAA 2XIMA 3NXLA 1MSSA 1GZJA 2BFGA 5E70A 2A6LA 4WY0B 5A6BD 4K1GA 4HU3A 1M7OA 3RO8A 2J4GA 4NXKA 3IGXA 4C90A 1J8VA 4HPXA 5AC4A 3UYIA 2EGZA 2GVYA 5EPDA 4GO9A 3PPFA 4X9YA 2ATSA 2WHKA 3W1QA 4GIYA 4J40A 2OFJA 1VH7A 1H63A 3SQLA 2ESCA 1H62A 3CAQA 4RZ6A 1W2PA 1L9WA 2V3FA 3WQ6A 4CU7A 1M6JA 4PUJA 1G1YA 4RZBA 3VDHA 3MVTA 2VC9A 5CC3A 1YW1A 3R58A 1BYDA 4DJEA 3H2FA 5C54A 3MI3A 3G1HA 4JIPA 3A4AA 4PTNA 3VOIA 1GYLA 4QEHA 5U7SA 3GU2A 3OG3A 3RX2A 2BGNE 4FX6M 3UETA 4RLIA 4E8CA 3APYA 2VOMA 2HBXA 3TQPA 3IGUA 2H3BA 4IJBA 5DN1A 4Q8OA 1B30A 3KOFA 1UPPA 4GPNA 4AEEA 4HK5A 2NQJA 2FZNA 2H6RA 2RFGA 3W2MA 1XQKA 4FLOA 3EWCA 4JTRA 4OJYA 1KRCC 4PCFA 1ESWA 1OD8A 3O3RA 4KS0A 2EJ1A 1QAPA 4KCWA 4B5UA 3HG3A 4DNMA 1F4HA 4US5D 3BH4A 3P0XA 1DVJA 2BASA 4AX7A 1R3RA 5U4NA 3VCNA 3PBVA 2HPMA 2QCGA 1WB0A 5BXSA 3LBCA 5HQEA 4AY8A 4QS6A 4IP7A 4M7TA 3VGHA 4XBKA 1KTBA 3TYBA 4Z1YA 5CPTA 1UR4A 2TMDA 1BYBA 1Y8BA 4AIUA 3OLIA 4JFTA 3KP0A 1OFBA 3BGJA 5TF0A 3GTHA 1W31A 4HD5A 4PMXA 2FPVA 1FWWA 4DXXA 3VOGA 4S38A 3U9IA 4GKTA 2P76A 1REQA 4L61A 3FFSA 1B3ZA 1XCXA 3RLGA 3TYCA 1ZB5A 3KW3A 1DJXA 1U33A 2NV1A 3MUY1 4E2OA 4XZLX 1OGGA 1WO2A 3QHMA 3I10A 3B0XA 3WNNA 2G0WA 3PTDA 2KZHA 2A79A 2B7QA 3GB6A 4L4PA 3ARTA 2DSUA 1S3HA 4DWSA 1HKVA 1CLVA 2GJRA 3E5PA 3GNXA 5AC5A 2NUXA 4X63A 1R2SA 4Q7IA 4OQVA 4FPSA 4JTUA 2Q02A 5TAOA 4UTUA 2PU1A 4I9MA 3PPCA 4W87A 3SSZA 3TUUA 1QPKA 2I14A 5J5DA 2PCEA 1N8WA 2ZTJA 1PWMA 4QJ1A 2X09A 2AOSA 1QXLA 2XIJA 4NUWA 4J3XA 4AWSA 1YIXA 2D0GA 4F2TA 1DV7A 2PD5A 3W28A 1A3HA 1V0KA 4KWWA 1KC7A 1D3HA 1WUFA 3BCDA 1GOXA 2C0AA 3VYLA 1R3VA 5J5RA 1BSLA 2VGFA 4DHGA 1XI3A 2NLIA 1HTIA 1EOKA 3RAOA 4OU1A 3NQ7A 2NW0A 2GDVA 3S2MA 3OZMA 1H51A 3LCWA 4PE8A 1NTHA 4YTTA 4XB3A 4LGXA 3UCDA 1DJYA 5F2MA 2E4TA 1E6NA 5F2GA 5BWFA 3SM0A 1IEQA 3LCGA 2X1SA 3SGGA 3B04A 2A2IA 4REQA 3B9EA 1W0MA 1VBHA 1EX5A 2FYMA 1ZZMA 3JS3A 1TV4A 5EBUA 3BK0A 2DU2A 1Q3NA 3WJZA 1W5MA 3G1VA 2ZADA 5FF0A 1FWFC 3AXKA 3L23A 4CVUA 5F4SA 3IAPA 2ALDA 4YIWA 2PFHA 4GYKA 4HZ6A 3IIPA 4M29A 5AC7A 3UG3A 1TWDA 3GR4A 4LANA 3VCCA 1L6SA 1O66A 3GXDA 1SSGA 1MUCA 1U1HA 2CLFA 1RVGA 3GIPA 1OK6A 4GUJA 5D2WA 3ZT6A 1D8WA 4V33A 2OKOA 5EU9A 2FJUB 4UTTC 2FGLA 2CXEA 3T07A 1PZ2A 4AY7A 3V0SA 4IFRA 1WA3A 3GIYA 2NQ5A 1JZ2A 2XSXA 2YJQA 1I6NA 3FA4A 1GGOA 1VFMA 3QZEA 5FJPA 1LQAA 4MAVA 2VZUA 3NQCA 1O5RA 5CSYA 1Q7QA 3AMLA 1XLLA 2C6QA 4JXCA 1KFJA 5FSEC 4LJ3A 1I0BA 4LAKA 3MZ2A 2XN2A 1CDGA 2BWGA 2Z1WA 4YPJA 4GFSA 1OF8A 3WH9A 3QC3A 4O19A 1QHOA 1D9EA 3TLLA 5JIWA 2XN0A 1HF6A 4KQNA 3GH7A 2Y8UA 5EMJA 3WEMA 3YPIA 4DBWA 2Z2AA 4WKAA 4GJIA 4GUFA 4UTWC 3NQ8A 1CCWB 1SR9A 2DZWA 3C6CA 4XSMA 4CNSA 3UU0A 1QOPA 3B0UX 2GVJA 4QG8A 1DQXA 3P5ZA 3K5XA 1R8LA 1VB9A 2VVNA 2A3AA 5BCAA 4GINA 2Y2WA 2ZXAA 2A1YA 1V8EA 2CHOA 3G77A 1XLFA 2QAPA 3F7JA 3WNPA 5IOBA 3LV6A 2VZSA 4FIRA 3LCIA 3R12A 4G56A 1SGJA 3BLPX 3ES8A 3GG8A 5CQ1A 3MI6A 4IFKB 3B0VC 4WRHA 2NQ9A 4DLMA 2ZOXA 3OLDA 1VAHA 2WMJA 2Z2BA 2PRMA 3Q45A 3GWQA 1Z48A 4JCLA 3C2OA 3RRAA 3QGKC 3CWHA 4U5KA 4F79A 1XISA 5A1AA 5FD0A 4OWGA 4PB3A 2BXYA 5CGQA 2CEQA 3HO8A 5HATA 3M5ZA 1A0DA 2Y8KA 4R7WA 5DFAA 3MV11 1JGIA 2CC0A 1HVXA 1CGXA 1NOUA 3CH9A 3CXOA 4BFAA 4GYJA 4GACA 1QBBA 3WBAA 3EWWA 4PMJA 2E68A 3BLFA 5GPRA 3TVAA 2Q3RA 4DLFA 2WSQA 2G4JA 5DQPA 3WD4A 2J74A 1TELA 3ITYA 3NQVA 1SO3A 3IK2A 3FCPA 3PK7A 2WHJA 3GM8A 1JAEA 2QCNA 4KWSA 4PBGA 1H11A 1Q6EA 1UIOA 5FIPA 4IICA 1XPGA 3O0FA 4EACA 5LNUA 2I17A 3M9YA 3GIQA 3TQVA 3WK1A 2WVTA 4OE7A 3A64A 3T6CA 1O60A 3MCMA 2V2DA 3RJYA 5L6UA 2QPSA 1R38A 1D7KA 4W8AA 2WYSA 2OLHA 2I16A 3AOFA 2DPEA 4JTGA 3K46A 4UNKA 4PH6A 1CGYA 1IZJA 3HBLA 4L4OA 1TREA 3ANVA 5I78A 5CSRA 4IMFA 1KFKA 4NL1A 1C9DA 2X40A 5DMYA 3BW3A 5DCDA 3VD7A 5FACA 1XXXA 2QJIA 3MWCA 2ZZ2A 4QXIA 5DF0A 4Q3MA 5MKGB 2PDCA 3NVTA 4Z42C 2WPBA 1XP3A 1XSIA 1SO4A 3FY1A 4ZFMA 3O6YX 4BQ3A 3I4EA 3KCLA 2J9YA 2V2CA 3OGSA 2QV4A 3A12A 4UOJA 3TXZA 4LCSA 3H12A 4Q32A 4AUBA 1WXJA 2O4MA 2O55A 2VGBA 4MNMA 5FEXA 3RPMA 5C70A 4LBSA 1QO5A 4Z2HA 1WDQA 1QNSA 1XS2A 1GVSA 1XCFA 4R7OA 3W38A 2D24A 3NZGA 4ZB0A 1QUMA 4D6EA 3L0NA 3RN6A 4ICCX 5IFTA 4XKYB 5I0DA 3XIMA 1UA3A 5A6KA 5HA7A 5D9PA 1TJ1A 4O8AA 1XKJA 3NL6A 1E55A 3RHGA 1P1XA 1GCYA 3AIUA 4N4PA 4FIQA 1BGGA 2PDWA 4LT9A 5E6ZA 3DFQA 7PTDA 4DBSA 1ZTVA 1SFSA 1UMYA 5AHLA 3RNDA 4O50A 5CZKA 5A5WA 3AIBA 3ZJ6A 5CZSA 3UY7A 2W63A 1EX1A 4NI8A 2PDYA 4A3UA 4UNLA 1FQ0A 3WFZA 3TZNA 1H1YA 3MZNA 4IL0A 4P7OA 4LPCA 4LUSA 3AWNA 4K6AA 4EIVA 4P7RA 4OTKA 3M43A 3NYDA 2QR6A 1KRMA 1X6NA 1KRBC 4J7RA 4Z08A 3WN6A 1BXCA 4C6CA 1RBAA 4IQDA 2VP8A 4JN6A 1RJPA 5HXMA 3TYDA 2EG8A 1W1ZA 3VZXA 4PTVA 4XO7A 2V82A 1EJRC 1L6FA 1JG9A 3G1FA 3NA8A 3MA8A 1DL3A 4AX6A 4HNTA 1ZJHA 1K6WA 1YNQA 2E6YA 3UQNA 4HJWA 1W8SA 1KA9F 2G3JA 3WLJA 3FV9A 3WNLA 4HIBA 5D32A 3BLDA 2WJEA 1JXKA 2BXVA 1JPHA 3AALA 5HBFA 1H1ZA 1OM0A 3ENLA 4GJ1A 1XUZA 2FZ9A 2F84A 3PJUA 4JQ3A 2PODA 1LOQA 2HNHA 4XO6A 2J6XA 1WAUA 3CUZA 3FJ4A 2E8YA 2BZNA 2CCRA 4MDPA 3WDQA 4KFPA 4W4QA 4Q8QA 3TTSA 5B7YA 2NXIA 4DZ5A 3APGA 3UXIA 4JCMA 3B8SA 3ABSA 3AHVA 1SZNA 2QJGA 1AW2A 2ZRVA 2OODA 3H23A 1PYMA 1ML1A 1XIIA 3RILA 4OT7A 3ZVIA 4M56A 2GSEA 3GFYA 3AQUA 3EBVA 1XL9A 1XYCA 2GYIA 4MGGA 4Y8FA 1YMYA 4DX3A 3C3UA 3GXPA 5AKQA 3AXXA 4XZ9A 2CXGA 1WCGA 4TR9A 2NSXA 3VKKA 4MJZA 4PMNA 2CBVA 1FWNA 1DP0A 1T41A 2NWSA 5D8ZA 1UWUA 4O0ZA 5H2ZA 2V2HA 1DJQA 2YYUA 2V30A 3HV9A 2INEA 5HNRA 1DJIA 3QHNA 2J75A 4NT0A 4EX4A 3KOZA 1XFCA 3PPGA 5TIMA 2EJAA 3I6EA 3L4XA 2D22A 1CGTA 2XFWA 3IARA 3GE7A 4PCPA 3EX1A 4OGZA 2TRSA 2GVEA 5HJLA 4UFMA 4URIA 3FYYA 4FP1A 2DVUA 1EH9A 4M19A 1NAL1 1N55A 4AW7A 4NAFA 2VC5A 1WXYA 3TNOA 5E6YA 1NWRA 2VJXA 1W91A 2UV8G 1OYCA 4OUIA 3M0YA 1YBQA 5LA0A 1BQCA 1HKIA 3QH2A 4B3ZA 1QK0A 3BQ5A 2NLYA 1BAGA 2WC3A 1ODZA 3BUVA 2V5LA 4QDWA 3ZIZA 3I3EA 1Q6QA 3HA1A 4ZR8A 3NQ2A 1B4EA 1LUCA 1E6QM 2DUAA 2ZZ1A 2PDHA 5EKYA 4BR1A 4XG1A 1CXHA 1E1FA 2F38A 4UMCA 3LPOA 4AD0A 1EB3A 3AXMA 1IE7C 3WEOA 1W37A 2OWCA 3AICA 4H9VA 3GTXA 3NZPA 1TJ2A 3OHIA 3UVIA 5D4YA 4AZIA 3VM7A 3AWOA 3VILA 1EC8A 3BAIA 1M04A 1MRQA 1S39A 1ZBCA 2NXGA 1JYNA 2FMOA 3EAUA 4CNOA 6CGTA 4D1IA 1UQZA 2FTWA 1Q2RA 4DO6A 4GG9A 2GJXA 1CB2A 3FKKA 4Y2WA 3UJEA 1TQJA 5I3GA 1VLIA 4RPQA 3W7LA 1RD5A 1QO2A 4QSFA 3QR1A 1XDJA 2OSYA 4PCTA 2VRJA 3VD3A 5MHBA 3NFUA 5C6MA 1NP0A 2BNJA 1XBYA 4UTMA 1W1TA 5ABFB 4G7EA 3CIVA 1AQMA 2EPHA 1VRXA 1V7YA 4HA3A 1BKSA 2BXZA 5CJ5A 3HFYA 1Q8JA 4NG3A 5GNYA 1K8YA 1RUSA 3DU0A 4O1AA 1XIEA 4CQAA 3QV9A 3EOLA 5F1UA 1UCWA 3JUGA 1FFRA 2VGIA 3HPZA 5TNVA 3IIZA 1HJUA 2CBJA 5CH9A 4MWAC 4L4LA 3KS5A 4LNYA 2DZPA 4J28A 5C2CA 3MUAA 1XHGA 3H8AA 2JALA 2QJJA 2CLPA 3CQ0A 3WQFA 1JQXA 4PUWA 4GUHA 2PWDA 4NX5A 4XZBA 2F6KA 3SCWA 4ZO6A 1WX0A 3N25A 2A3LA 3BAKA 4B5SA 3CZGA 1UR8A 1I9CB 1TPB1 3QM3A 1NOWA 4MVAA 3GYEA 4J9JA 4P7QA 4QCEA 3W7OA 3MANA 1KWGA 4UTJA 4JIQA 4NSBA 2Y7DA 4HTYA 4WQ6A 4HYVA 1OX4A 4ATLA 1J79A 3VGBA 2XFYA 3CWOX 2EG6A 4NAEB 2ZE3A 4MAZA 1GQIA 4KIRA 4CU8A 3VIKA 3SURA 1EA9C 1PKMA 2VD8A 4RNIA 1EJSC 5D09A 1V51A 2MNRA 3CZ8A 3BLEA 4CNNA 1HJSA 5I02A 1MYRA 1WBJA 2NV2A 3TXVA 2YB4A 3I7SA 4X61A 4NVTA 4RR4A 3LV5A 4H1ZA 4H7VA 2WNNA 4W93A 4H9ZA 5F4WA 3OU8A 5BOEA 4ADUA 4LF2A 3VD5A 1GVQA 1XUUA 4HYRA 3GDRA 3IVTA 1TFVA 3KS6A 2C8NA 4JEQA 3QKZA 3M7SA 1BKHA 2BGSA 5JQ9A 3UG5A 3VIIA 4E5TA 2GQ8A 4HU4A 1OF6A 1MWOA 4NZFA 5D38A 1U5JA 3I6RA 2GK1A 1THFD 3Q65A 1CGWA 3LLFA 2CKSA 4LC6A 4B4FA 7TAAA 1HQTA 1UWQA 4CNPA 2UWFA 4QITA 1RHCA 4KWVA 2EAWA 4IG2B 3CS2A 4UOZA 5HUPA 4IIBA 3PZVA 2VI0A 4LF1A 3BJTA 4K7YA 2RAGA 1I2NA 3KOXA 4GIAA 2G5WA 1SO6A 3OP2A 1TWWA 4GUGA 4C1KA 1ELSA 3W0KA 4XVEA 3A22A 2PDMA 3LQGA 3TSBA 7CGTA 3BAWA 3B0YA 5ABHA 4UB9A 3UBPC 4UZUA 2OR2A 4N6FA 2X1IA 4WEVX 1WKYA 3BW4A 3RU6A 4HNCA 2ON3A 4W5UA 2V5JA 2GGIA 3A5FA 1PS9A 2Y85A 1BSIA 3A21A 4KH2A 3DZ1A 3TAKA 3N29A 4CU6A 4ML9A 3APTA 4WCJA 3W1NA 1IWAA 2D20A 4YN5A 3M0MA 3WH7A 4JYEA 5CJMA 3HFTA 1S2UA 2O7SA 2CBIA 2DDXA 2Z00A 2HPIA 1FVPA 3N3MA 4B5NA 2NX9A 1R7OA 2R91A 2JKEA 4J3SA 4RXGA 4FOKA 5M3WA 1NU5A 1HO1A 1K9TA 4ZE4A 1ZJIA 2E9BA 4GX9A 1F4AA 1HJVA 3WMLA 1ZPTA 3MO7A 4YMZA 3PTKA 3GXTA 2VRQA 4DB7A 4H6QA 3SJNA 2QAFA 4PRWA 5ENLA 1FWEC 4MYAA 4A8LA 3U6WA 1Y5WA 3LPFA 3V0UA 1K9FA 3A47A 4LAMA 5IBXA 3AHXA 2E40A 2E6DA 5A2CA 2C79A 4Q4RA 4LCQA 5LGXA 1CYGA 3WQCA 1DJZA 4U2ZA 3W7RA 3IUHA 3DCPA 3CJPA 1V0NA 5D9NA 1JCTA 4S3AA 1W1IE 1QDSA 1F9CA 5FJJA 3QTPA 5EY5A 1QK2A 4GY7A 3LQLA 1IGSA 1GKPA 2Z1SA 1SO5A 5EMYA 4R9OA 5JVLA 3DXIA 4US6A 3TQ0A 2Z7GA 5CZ0A 2DV0A 4EPDC 3IIXA 1PCKA 1XSKA 1E56A 1O5XA 3E02A 3OVRA 1TRDA 2DGAA 3BJSA 1HJWA 3TC6A 1HG3A 3W2JA 1VJZA 2QGHA 3TYAA 1Y5VA 4LYRA 2F2HA 4H8NA 4GH1A 3T7VA 5CPQA 1PDZA 1S2VA 4AZGA 5D02A 3KCOA 3BAYA 3BV4A 1OZMA 2E1DA 2FJKA 4JQ2A 1FWCC 1ZJBA 1JCXA 1KNWA 4PUUA 1P0BA 3VIPA 4IX0A 1GKRA 1QRQA 4BA0A 3AYSA 4HSNA 3WLRA 4QR6A 2ZYFA 4I5XA 1A4MA 1E4LA 2H8XA 2J66A 2PWFA 3W71A 1XWYA 1IQ8A 3WF2A 3UZWA 1R9XA 3DHPA 4J4KA 4LY8A 3WJWA 1EP2A 3RRXA 4EWJA 4BKNA 3WDIA 1BRLB 1VP5A 3ABRA 3HG2A 2VMFA 2G97A 2Z29A 3GX9A 2BODX 3FDKA 3G1RA 4JQ1A 3EOEA 4DO4A 3QC0A 2VQTA 4XAYA 3N3TA 2CU0A 3DN5A 4PB5A 4XTIA 5E0FA 1DJNA 1G94A 1XIBA 2WANA 3BDKA 3RLUA 5CKSA 4I7WA 2JIWA 1ISWA 3W00A 1JD7A 1I2QA 6A3HA 2W6RA 1V4YA 1ALDA 3V35A 1VFLA 3RM9A 3PVFA 2P3ZA 1WP6A 3WLKX 5I5RA 3GH5A 1RY8A 2QCMA 2V3GA 5I06A 1HGWA 4LCRA 1U30A 4CQ8A 1A5LC 1VBUA 2BP1A 3STCA 3QBUA 4ZZ9A 4LYPA 1FWTA 4HB7A 3QW3A 3SI9A 4DF2A 1JF6A 3L2IA 4KEUA 2RDWA 4XUYA 3G1AA 3WLPA 4HHPA 2ZX7A 6PTDA 1LOSA 4RDWA 4XWUA 1RCOB 1E9YB 5DEZA 1AH0A 2GQ3A 3W7MA 3DBNA 5KETA 2IPJA 3WQ5A 4IJRA 2JEPA 4JYFA 5I7GA 4LH8A 2KAUC 4QE4A 4O13A 1E1EA 1E4MM 1QPQA 3KRSA 2P10A 5T9CE 4P8UA 4Q4OA 1JUEA 1US2A 4NZ4A 3M07A 4QS5A 3WLTA 3P8JA 4JNZA 3UY8A 2X16A 4WKFA 2NX1A 1FHLA 1FCUA 3B8IA 3DI1A 5I07A 2YCJA 3O2LA 4XAPA 5GQBA 1UZ1A 3WSUA 1P1MA 3MY9A 4JTFA 1A5BA 3HM7A 2IKIA 2VEGA 1E73M 4F2UA 3TX9A 3G0SA 2CZFA 3A3HA 3D0CA 2PTYA 3GBEA 3MHUA 3FS2A 1EDTA 3NO1A 2ZDSA 2ZRWA 2Z2UA 3W85A 1MQPA 1CECA 1E9LA 3RUBL 3PM6A 3GDMA 3UP8A 3OEXA 4RE2A 4FALA 1WDWA 5K2ZA 1TQXA 3TW9A 5A6JA 1Q7MA 3TMLA 3PBYA 3L5MA 1S2CA 2F6XA 1SVDA 1CXKA 4Q6XA 1F5ZA 1Z41A 3V5FA 4O1BA 1ZUAX 4UQ9A 2MUCA 4Q7NA 4ZBCA 2YSWA 4RCXA 3WQ4A 3MC5A 4L80A 2DEPA 3ABQA 1TX2A 5KEZA 4QE1A 3NL5A 3RLHA 3WEZA 1J2BA 2DSVA 3VD4A 2VZVA 3GW3A 3P62A 4RKAA 3MDUA 4WSJA 4DF1A 5L9FA 3PZQA 3R4IA 4WDUA 3S47A 3H2EA 1OYBA 2A85A 5H8PA 3GAKA 3GR8A 3ELFA 4YS1A 1S3TC 1UR2A 3GTNA 4UR7A 3TYZA 2OPJA 4C6EA 2CWNA 4ACZA 4YTSA 1A3WA 2WZTA 1UBSA 3K8KA 1TIWA 2OXNA 3EYPA 4DQWA 2QNEA 2VZOA 3F03K 1E4IA 5DRIA 2PAJA 1J9YA 1WOBA 3LGEA 1Z32X 4YVXA 3VNMA 4HBKA 1KWKA 4L56A 4UTFA 1ZP3A 1DORA 3WIJA 1W1PA 4IQLA 2XJ7A 2VC7A 1JL8A 3PZGA 3FLUA 1S5TA 3ECQA 4XD3A 1VEOA 3S2JA 2C3ZA 5LKYA 3AMDA 3LCXA 4WX2A 1BG9A 4GNVA 4AZHA 5DX7A 2AAAA 4AD5A 5FOOA 6XIMA 3RXZA 5E0KA 4WY0A 1MXDA 4XAGA 5FI8A 1M1BA 2I9EA 3B4UA 1P0DA 1I8JA 3NQMA 1HT6A 1CENA 2Z1KA 3K4AA 1GORA 1W3JA 2W61A 1KGXA 3QY8A 4F9DA 3CPUA 3VD9A 4YNGA 2DVTA 3EKLA 2G3NA 2WZIA 3THAA 3JZEA 2HISA 3JR2A 3MUXA 1JQVA 4GZEA 3MU7A 1TB3A 4OZOA 5A95A 3W76A 4JNMA 4W86A 1H1NA 3UWWA 5DT5A 2XFFA 2JQXA 2AQWA 2VEFA 3EXRA 5BOFA 1YDYA 3WMCA 1EP3A 4CNUA 2Z1BA 2VCBA 3IK4A 3LU2A 2ONEA 5A2BA 3HOJA 2VFFA 3CQIA 5A8PA 4R33A 3WY1A 4BY3A 2Y1HA 3B8TA 5HMSA 4E2BA 3LXCA 4L6DA 5D9MA 3CMGA 1MW3A 1GYNA 1Z89A 4P7LA 2QHAA 4FO4A 1J96A 3PZTA 5AB3A 3CHFA 2BY3A 3NDYA 4AIBA 3W7GA 4EAMA 3KLKA 3G1DA 2JIEA 1XBVA 1S5VA 2DIKA 1RVKA 4L5ZA 5LHFA 2W62A 3BOLA 2F9RA 5A6AA 4F8XA 4CLMA 3IJIA 3PWIA 4NZCA 1QWKA 4BK9A 4LY4A 3V5OA 1UB3A 1W9PA 4ZO8A 4Y9MA 1MW0A 3OODA 3PANA 3W1MA 2WQDA 4OV4A 3AROA 4FEZA 3VIFA 4HPNA 5FESA 4DPPA 4P61A 1JI1A 1FTXA 1X1OA 4W5ZA 4S3DA 2RKXA 2QCDB 2R8WA 1L2QA 2PDQA 3CLWA 2PWHA 2O4QA 4WOQA 3GHTA 4RDYA 1BF6A 4ES4A 4KMQA 1E51A 1TMHA 2WMIB 2RHGA 3CUXA 4J3VA 3NDZA 5AVNA 4DUXA 3H2MA 4LS2A 2EPNA 3CUJA 3T8LA 1KR0A 3KVKA 5TBOA 3DHFA 1K6AA 1LWJA 2ZC8A 3T0AA 4HHMA 3IV3A 1JZ4A 3SQSA 4INFA 4DZIA 3BG3A 3V16A 4C5ZA 1S2AA 1B3XA 2IS7A 1VCVA 2PB1A 2DT2A 1XM3A 5D8WA 4PC8A 3C2RA 4DBUA 3MCOA 3AJ7A 3F2BA 4LVGA 1TYGA 3TJXA 1EJXC 4FR6A 2Z27A 2Y7EA 1S46A 3BLIA 1Y5XA 1UC5A 2ISVA 1EGZA 3EWBX 1I2PA 4JR5A 2ZUNA 4DBEA 4ZQMA 1DEDA 2ZA1A 3TONA 1QT1A 3U2EA 3EPOA 4US5A 1MEIA 1ZQ5A 3BMVA 1H7OA 3KE0A 5PTDA 3R1ZA 3S9IA 4PFMA 1T5AA 5FJIA 3GNOA 3CAVA 1VR6A 1C8QA 2ZRZA 2Q6ZA 4IOTA 4QIUA 1TVPA 2X1RA 1O5KA 1YE6A 1G69A 2OELA 3M1ZA 2FTYA 1V77A 4N02A 4A35A 1W2VA 3SCQA 2QKFA 5C7VA 3UCCA 2QS8A 1X38A 5LSMA 1XLGA 3ME3A 1FXPA 4S2BA 3WJXA 5DCEA 4UXDA 4C60A 2J79A 4Y9OA 3CHEA 3SO7A 1TRIA 1VEMA 2PC8A 7XIMA 3O7UA 1XR2A 4WLCA 4FOJA 2FDMA 2GSJA 4KRUA 1IZCA 1T8XA 1IEVA 3PAJA 1BYAA 3AS2A 2QUUA 3SEPA 4O28A 2CZVA 3EPNA 3D46A 2Y7FA 4ML4A 4FLSA 3NQFA 2QZRA 3STGA 4BQ2A 2QMKA 1YTDA 1RJRA 1DYSA 3GG7A 3T78A 3VMNA 4PTWA 4JX6A 3CHVA 3IJLA 4MLJA 2CZDA 3JVAA 1R9ZA 2CLEA 1SYTA 2RGMA 3VGGA 3G1YA 5BRQA 2PA6A 4NJKA 3ZYZA 3IJ7A 3GTFA 5CPMA 3W86A 3VC6A 3DFYA 4H7CA 3SUWA 1O1HA 2QULA 1RP8A 3WLIA 4JIIX 3SRDA 1K8ZA 2CNCA 3GVRA 3H2AA 4JNYA 2DIJA 3M47A 2WMFA 3L4UA 5DCBA 2J9ZA 1K7XA 3O63A 4I8DA 1GQKA 4FHAA 2BHUA 5AC6A 5JH2A 1FOBA 2PP3A 5T8GA 5JUVA 3W7IA 3ARVA 2C7FA 2OT1A 1FCVA 1GOOA 4F66A 4DJEC 3TQKA 1NQ6A 1RBLA 4E8DA 1YXCA 2BVDA 3QFEA 4XIAA 3G24A 4LUYA 4OVXA 2VCCA 3WQDA 3SW6A 1WPCA 4CQBA 4ERIA 4GFIA 4JKLA 1PKLA 2PDFA 1W3KA 3QQWA 1UWTA 3XINA 1KM1A 3F5KA 1JZ8A 1JXJA 2R1PA 3GFZA 3IJDA 2XIBA 4JTHA 2O0TA 5KZMA 5HMDA 1G4PA 3M5YA 3CLMA 1XLJA 5FL0A 2NVAA 2G3MA 3PBGA 4UIOA 2Y6ZA 1PYFA 3HQPA 3AMGA 3W25A 1WBHA 3MWAA 4ORIA 1YXYA 4KGJA 3NR0A 4ERGA 3ATYA 1LLZA 3UWVA 3I6TA 2JE8A 1XLHA 1OCNA 1EF3A 3NM3A 3RX4A 3TWBA 3UZYA 2PP1A 1Q6GA 3FDGA 4QM1A 1GPWA 1PJ9A 3KLLA 2V5BA 4LVFA 3MSDA 3TKFA 1HL8A 3CB3A 1NOFA 1MNZA 4IIGA 2RDUA 1YKWA 2TSYA 3DKJA 2C71A 3FEQA 4M6VA 2WJZA 2X0HA 4ACYA 3R8RA 4IPPA 2PTDA 4TIMA 1XH0A 4MZ8A 3A24A 3ZXWA 3B0PA 4I3GA 4TV6A 1M9HA 3PPHA 1R5YA 2O9RA 2DZSA 2C1HA 2Y0FA 4C6FA 3SGZA 3B97A 3PG8A 3EDFA 1KM0A 1EUNA 3EA3A 3TLQA 4QQ3A 2Y88A 3BJFA 1SZFA 2HK0A 3OZYA 2DT3A 4CN4A 4DWSC 4FK9A 4LAUA 2YGYA 1ENUA 1QW8A 5AZ1A 1JDCA 4MUZA 4B92A 2E5CA 1SUXA 1F6PA 4JIRA 4HN8A 5XINA 5CPNA 2E6AA 4W88A 3GSMA 4JX5A 3UGRA 3UD6A 3W7CA 4RW3A 2DJXA 1VPXA 3UGVA 1UA7A 2C14A 3AHZA 4MFDA 4ZQOA 1TV3A 1FFQA 4JIHA 4L6HA 1RP9A 1DIDA 1I2RA 3LERA 2VFEA 1K4HA 4JEJA 4JTJA 2KX9A 4J5NA 1R3SA 3WO8A 3GVWA 4MY8A 3VNKA 5LIUX 4O4WA 5C5YA 1YRRA 3HJZA 1FHVA 2GJNA 1ZBWA 2ATMA 3EB2A 3DGRA 2ZA2A 5ABTA 1E0VA 4M82A 3E6EA 5MKGA 4DZHA 3LOTA 1XLKA 1SPQA 5I79A 4XKMA 3VCRA 3CK5A 1ONEA 1FWSA 1ZP4A 4B2DD 3M5VA 3EMZA 2WKGA 2BOGX 5C2GA 2YDRA 1ECEA 4KFOA 3WQEA 4JICA 4A6GA 3URQA 3N15A 4Q4QA 1POJA 1VFTA 3HG4A 5E9XA 3VGDA 2C16A 3CUHA 2DZXA 5FCZA 6XIAA 1B54A 4I8YA 4H2CA 1ONRA 5BNKA 3L68A 3SR7A 3O06A 4JDBA 3A5VA 2WSKA 1DWIM 2EEXA 1XG4A 2CLKA 4J27A 1HVQA 1E70M 4DWDA 4TX9A 1EDQA 3C0QA 1A4LA 5FJUA 4DRSA 3LHUA 4MM1A 2DQXA 3KBMA 2RDXA 1R30A 1F3XA 4QAWA 4X0NA 3RU8X 3C2VA 1W3IA 2GOUA 2YL8A 4L4MA 4D6JA 4FR1A 2ZKMX 1EHAA 1AQHA 3QOKA 1E0UA 3GTIA 5K4ZA 4HPGA 5JXQA 5LA2A 3H6OA 4KBXA 4A3QA 1BPLB 4WJEA 3LGGA 1E9ZB 3C3NA 3E0VA 4G8TA 1ZSXA 4AY1A 1UP0A 3DESA 4ZL1A 3CV1A 3W1PA 1OC7A 1EXPA 4IIDA 4DO7A 3A23A 3OGRA 4W84A 5TD4A 5HPOA 3GDLA 4OOUA 2IKJA 3P60A 3IIVA 2E8ZA 4JTCA 5BYWA 2I5GA 3GVVA 2ZXDA 2XH7A 1XRVA 4GVIA 4Z17A 1PB0A 4HNLA 3U7VA 4S3BA 4O1CA 1E6PA 1K7FA 3W27A 1XIMA 2J7EA 1QFEA 1ZLPA 2A4AA 2DT1A 4ZFCA 3SN0A 3TYEA 4KFNA 3WDJA 1R86A 1XDMA 2PWEA 1QNOA 2XSBA 3VDAA 3OOQA 3LENA 4P5UA 1RH9A 3UFYA 4H6EA 4XD4A 3TW7A 3CWNA 2DJLA 3ARRA 3TE9A 3BWWA 1T0OA 1QNVA 2OQHA 3U48A 3WF3A 2NUYA 3GUGA 3G2GA 1OHLA 4QGCA 5M2FX 3G8RA 5BXTA 3USBA 5JU6A 1TUFA 1Y0EA 4FNQA 4KT2A 2ZX5A 4P2VA 4ZOCA 1JNEA 5H6HA 3I7RA 2EQDA 4V1XA 3WUGA 5CBJA 1PL9A 2GGGA 3DYMA 4BEUA 2EG7A 4M6UA 5K9XA 4GLEA 2VDHA 2ACUA 3BG5A 3V3WA 4MHBA 4Y90A 2OEKA 4H01A 1HXJA 1DJWA 3F2DA 2QPXA 3SECA 2XIIA 3MUIA 3GR7A 3OBAA 1KXQA 4WDWA 3WG6A 1M7JA 4EAYA 4HU0A 4DZAA 1F2JA 1CXLA 4HQVA 5I6SA 1V6VA 3NL2A 1GUVA 1KBKA 3ZVHA 5BU6A 1VYRA 1HNYA 4MB4A 3N34A 3P6LA 2YW3A 2X2GA 1SW3A 1B0IA 4JTLA 4BF5A 2WBGA 3VNZA 4Z1AA 3W6MA 1QWGA 1XIHA 2FKPA 1JDFA 3THCA 3ARYA 1X6UA 4LC8A 1IZKA 2VEIA 5A6LA 4NP7A 4MPQA 2WXDM 1QR7A 1OC5A 2DORA 3HGRA 3BGGA 3N2MA 3W3OA 3QMTA 2V38A 4I7UA 3BTNA 2XM1A 1P5BA 4U31A 3TN4A 2CZ5A 2O9OA 3ZLHA 3OHMB 4ENLA 4F2BA 3OW1A 3ITTA 1EJUC 1JUBA 3CAWA 3UVAA 4JD4A 2GWNA 1CEOA 3CZLA 3TNBA 1Q45A 3M0JA 1SZGA 2W0UA 3TOYA 5LNVA 1KGUA 2V3DA 1J6OA 1H5YA 1RPXA 3P2VA 2R1MA 4Q8PA 1W3TA 1ZBVA 2G3FA 3LX9A 2Y4SA 3S6DA 1F6YA 4O54A 2XZ7A 4JTDA 1NFGA 4ZCWA 3ZM8A 4JFWA 2Q3OA 3AYVA 3CO8A 3KDNA 2ZZ7A 2Z25A 5CPLA 4B5TA 2WHMA 4JDYA 2PSNA 2XPKA 5C2XA 3EXSA 2AL2A 1PHQA 2O92A 3NIYA 4OBSA 1CWYA 2OO0A 1XCWA 3EDEA 2YFOA 4ATDA 3RMEA 1RK6A 1PPIA 5C9WA 3PULA 2XN1A 4S3CA 2VVSA 3K4WA 2ZFAA 4RUBA 1KFLA 1KM4A 1W1A1 1VS1A 1JI2A 3LG3A 1UD8A 2HJPA 1W6TA 3WQWA 3KTXA 3MKVA 3S5YA 1V03A 4QLKA 3R25A 3TN5A 3EKZA 3LDVA 4O18A 1LLOA 2FFIA 2E28A 2X7WA 1RQEA 3TTEA 4DY1A 1J0KA 5HWNA 2PEVA 2GQ9A 3AIRA 4IXHA 1JZ3A 2R1NA 3FJLA 4M6PA 5I3KA 4F0MA 3UA3A 1ME8A 1QOXA 3WKZA 3GLCA 4Y9AA 1LQ0A 2WWDA 4ZQPA 2WKJA 2ZX9A 4Q33A 4YVPA 5ABFA 2IXUA 3JZUA 2TAAA 1E9IA 1UMLA 4MPKA 1H7XA 4CD5A 3WNOA 4YJ5A 1T6MA 2W5FA 3NGJA 1CBGA 4J1OA 3LS9A 2Q8XA 4RPPA 3W02A 3F2CA 2ZCGA 3PNZA 5A8MA 4N9CA 2XVLA 4M3PA 1B57A 3ARSA 3CHDA 3E49A 3IUDA 4KIEA 3JW7A 4DJFD 3S8HA 1K4GA 1LROA 2YDSA 1FRBA 1VZWA 4K2SA 3N18A 4GD0A 3U4AA 4Z2IA 5I3DA 4EF8A 4ERAA 3AUJA 1V6TA 2AQVA 2FTPA 5LGZA 1OABA 1TJ0A 4YYCA 2F6UA 1AQ0A 1V3HA 4HKPA 5T9BG 1IHIA 1DKWA 2VX6A 4O8RA 4RV3A 4OV9A 4XD6A 3DHDA 3EOSA 2VENA 2E1WA 4UFHA 3C56A 4K39A 2ACSA 2GGJA 2V5CA 2YBVA 5KMYA 3DFSA 1G67A 4HSOA 3WH6A 2DUZA 3ARZA 1NELA 3OYZA 1TPH1 2XYLA 4TVCA 3G6LA 4GBUA 4H9UA 2VTFA 4PZVA 4PUEA 1K70A 4NAEA 1GW1A 4E6MA 3REQA 4DI8A 2J8FA 3H7UA 3PY2A 3EOUA 3BARA 3AYRA 2I9UA 3AIWA 1FH8A 4KETA 4GYPA 5DXXA 2UY2A 1A50A 2ZIDA 4O17A 3SB0A 3W7HA 1EKOA 3WCZA 5D2TA 3N4FA 1H61A 4LEQA 2NVCA 2YXXA 4WXYA 4QAIA 2AKMA 2C18A 5RUBA 3W1UA 4RX0A 5LHEA 3CL8A 1QW9A 3ZZ1A 2WC7A 2IKHA 4S39A 4M8UA 3GW0A 4HHHA 4RE0A 3VOJA 4CGTA 1EOMA 1L6YA 5HDRA 3EZ4A 3S4TA 3CASA 3UF9A 2AAMA 4A3RA 1NWSA 1K9EA 1X98A 3HTWA 2I56A 4EPBC 1V0MA 5GJPA 3QOMA 1JAKA 4IG2A 3KOYA 4DVOA 3UNDA 2QDGA 4RDVA 4IP4A 3M7WA 4KKXA 5AFDA 2AL1A 4AXKA 2EPLX 4X2PA 1DJHA 4W85A 5GNXA 1FWRA 1EQPA 1LL4A 1C91A 3U0HA 3IGHX 3EOOA 2PDXA 1J6PA 1R47A 3H4WA 4GI9A 4MIMA 4PODA 1UH3A 1IWBA 2OLSA 1SJAA 2D3NA 2GL5A 4JKMA 2R82A 2X1TA 1PCWA 1HGYA 3CPGA 3P81A 2JF6A 1SFTA 4XAFA 3A9BA 4GXMA 3IEBA 3OG2A 3LUTA 3LNPA 3P8IA 2PTZA 1BWKA 5DBUA 1OEPA 1G5AA 4IGMA 3TFXA 3BC9A 3ZJ7A 2WVSA 4GOAA 3ZR6A 3SRFA 1RLCL 3CZKA 1OBAA 3OQ8A 1L8PA 2HS6A 4J3WA 2DZAA 3IUIA 3W72A 5DELA 3RM4A 3VX0A 1P48A 1MUWA 1R85A 3IANA 3MI2A 2ICSA 3T40A 2JF7A 1UZ4A 3SRHA 2NWRA 4FX7A 7A3HA 4ONVA 1Q6FA 3UG8A 2PI6A 2TODA 1UQYA 6ENLA 3LHYA 3KTCA 2DSKA 1TX0A 1HIZA 3SY5A 3JU2A 4JTKA 1QJWA 1J0YA 5IRPA 3I65A 3JRKA 1V7AA 4FNPA 3W1AA 4C6MA 3G3DA 3UZXA 3VO0A 1DWJM 1AZ2A 4HZMA 1F8IA 3S9ZA 3QR3A 4AEOA 5A94A 1XLBA 2OYLA 1PSCA 3WDRA 2HRWA 4KESA 5FAJA 2Y70A 3RR4A 2VFHA 3PFMA 1TWSA 4ZTYA 1RLDA 4UCFA 4WJXA 1AG1O 3H53A 2PWVA 5LZLA 4C6JA 3WMSA 1P6BA 4MDOA 3G0UA 3LM7A 3VVGA 2EKGA 5G2IA 1TG7A 4QDMA 2UY4A 4K36A 3EEGA 3TCEA 4FSAA 3CUGA 2Y8VA 1G4TA 1GEQA 3DKLA 2OEJA 4GZIA 3OLEA 4UQBA 4L1GA 3ZJ8A 4BI6A 1IGWA 3W87A 4H00A 3DG7A 4H9MA 2E5BA 2IXVA 3RYSA 4DUWA 4CN6A 1JCJA 3V1HA 1BYCA 4PN2A 4HPHA 4PUMA 4E2VA 1SW0A 2OGJA 2OZTA 4LBUA 3R10A 1H41A 3A4WA 3OGVA 1B1YA 1S5NA 3WK3A 2GVLA 2HSAA 2YL5A 3GXMA 3P61A 4G7FA 2AGTA 5EA9A 4CNTA 9XIAA 2PS2A 4AC7C 3DBPA 3O15A 1JFHA 3GNDA 5F2IA 3T44A 3W7JA 3MCNA 3UPBA 4PUNA 4HCLA 1MZRA 5AN7A 1O12A 4P8XA 4LTSA 3TYUA 1OCQA 1Q66A 2I1OA 2DZBA 1YQ2A 1TUXA 4O14A 1AL8A 2VX4A 1W3HA 3BAJA 3LA4A 4E3TA 5C8BB 2NUWA 1HL2A 1QVBA 4MWAE 1QI2A 2PDJA 2VUNA 2VO5A 1TPC1 1BRLA 3UWEA 3W7PA 3DFOA 4PL1A 1VC4A 4JPGA 1UZHA 4XD5A 5CLTA 2VWSA 2E77A 5DO8A 4HCDA 4A29A 1O7AA 4PRRA 1VIZA 4D9PA 1V08A 2V3EA 2QVHA 2CLLA 3B9NA 3DECA 5I00A 4OBTA 2RH9A 3FXGA 3AS0A 4LB3A 1ZS2A 3R79A 5G4WA 4K1WA 1WDDA 1Q5MA 4U3CA 1K1DA 2BHYA 4UTIA 4WJ8A 1D7FA 3GK0A 1FA2A 1QHZA 4F0KA 1RQHA 3ZR4A 3BLKA 1SJCA 3BXWA 4H2HA 4I9AA 2HVMA 3UNTA 1I45A 1PDYA 2WVVB 4FNRA 5AVHA 4IL2A 2B7NA 3PHAA 4XZIA 1E0WA 2PZNA 1B90A 5GVJA 4BQ4A 3F5LA 4WK9A 5DBTA 1G01A 3EA1A 4YL2A 3QZAA 1XC4A 1XGEA 4MG4A 5LIYX 4S1FA 4RNFA 1H7WA 3H24A 5LIXX 3QZ6A 3GC2A 3MB9A 2XH0A 1U1UA 4MYXA 3ZT5A 5FJRA 3F4DA 1AL7A 1KR1A 2ACRA 4GI6A 3I3BA 3TSDA 2FLIA 1LTDA 3DAQA 3HIJA 1WXZA 2WPGA 3S1VA 3U4FA 1VD6A 4JX4A 5D30A 3NEHA 2XGIA 3B8DA 2NXHA 5FEZA 3GAYA 2NX3A 2Q8ZA 1K02A 3VMOA 1K3UA 3GC5A 2PF0A 4JKKA 1TV2A 5TQLA 1KTNA 3BLOA 2YA2A 1TR1A 2W3ZA 1GZ1A 4Y6GA 2BVTA 4D6FA 4DO5A 2D23A 4PBEA 5LNRA 2WVUA 1G6CA 3SBFA 1KB3A 1LT7A 5CC5A 1OCJA 1KD0A 3MMTA 1ODUA 5EGRA 5D2VA 4MNLA 3U2CA 1UYQA 2ZVRA 5FF7A 5D33A 1EEXA 4HMNA 3MMUA 1ZY9A 1EPVA 1XIGA 2WSYA 1GJWA 4IQEA 3RX3A 1M01A 4DM1A 3SN4A 4U28A 1NEYA 1Y7VA 3VAVA 5BWAA 1OX5A 3ZR5A 1EJ7L 3ARWA 5ABEA 4XVDA 2QCCA 1ZHAA 2D73A 3LM3A 4RV8A 1KQYA 1MZHA 2PF8A 4KGLA 2PDNA 1EC7A 3QGVA 1W56A 1ZAIA 4FLQA 5IBXC 4CCDA 1GJUA 4FX8A 2ASHA 3HQNA 1TCDA 2FH6A 3ZLFA 3EDJA 2CLIA 1H09A 1U1JA 3K4DA 3BCJA 3MO4A 3H7RA 1XD0A 2W67A 3P82A 3WFAA 2QUVA 3THUA 4A05A 4AYGA 3GHUA 3GYCA 2QLYA 4KERA 3TCSA 4O1EA 6REQB 1VJSA 3ZO9A 2G95A 3LZ5A 3MHFA 1IR1A 1EC9A 3NNTA 3D47A 2ZUTA 2Y61A 3UXKA 1H2JA 4A2RA 4JYDA 4QG9A 3K1DA 4O12A 4ICNA 4B3KA 4C6KA 3AI0A 3TZFA 4M51A 3UR5A 4JAWA 2ZUVA 1KKRA 4MFEA 4O1FA 2D2OA 3KBJA 5E0CA 4QRNA 1M68A 1PX8A 5DMMA 4JY9A 1O6IA 3SQMA 2VWTA 3N14A 1UOZA 5G2HA 4B3LA 3ZJKA 4EXAA 3NSXA 3E2VA 1GHSA 1Z69A 4ZXOA 4R88A 1ADSA 4RZ5A 4V1YA 2V67A 3NUKA 2J6VA 4ZO7A 2J24A 1HUVA 1VBGA 2OZ8A 4BQ5A 2OSXA 4FS9A 1PTGA 4RK8A 4F3HA 5A6MA 5EYWA 2BVWA 3GXNA 3E96A 3SUTA 1PE1A 4JGDA 1QHPA 3RR1A 1OY0A 3QMRA 4L9XA 3W88A 1HX0A 2X7VA 2GGEA 1F3EA 3NOYA 1XC6A 3NOEA 2CLHA 3DC8A 4MJ2A 2ZICA 4AAJA 1J2WA 1GPFA 5GNZA 2ADAA 1R0MA 1VGAA 4J35A 1Z9AA 2ISDA 2Q71A 1LG2A 3W1TA 4JS3A 3W07A 5FEWA 3VZYA 5EMMA 5CLWA 2IQ0A 1X8CA 1GG0A 5DY2A 3CIWA 3VNIA 3V5CA 4LU0A 3CL7A 3MPGA 3TEVA 1W3NA 2PDBA 5M17A 4MNKA 3O16A 1NVMA 1ZCOA 1V3IA 3QV6A 3ES7A 3UPMA 2EF9A 1UD6A 3NWRA 3BV7A 3GRIA 1LP6A 2VFGA 3S0CA 4NNBA 5C55A 4LALA 1XPYA 4F0RA 2JFEX 4JFSA 1ADDA 4WY0F 2J7FA 1KBJA 4AB4A 5FAGA 4BCEA 2QCDA 5FEPA 3BSGA 4AQLA 1KXVA 3IVUA 1UP2A 1W5NA 3B4YA 4AFYA 3M64A 2FZDA 1JGMA 2WMIA 3N11A 5JIPA 5DMLA 3B9AA 1Q6DA 4HN4A 3PS7A 5C9UA 1MO0A 4MOZA 2QJNA 3TJ4A 3LMZA 4X9SA 2OLAA 3B06A 3W2KA 3N2TA 3W84A 3N12A 1ZENA 3DFHA 1XYZA 1DIEA 2EPKX 4KRZA 3W7QA 1XF0A 4L64A 5K3VA 3W23A 1YADA 3VMPA 1GZGA 2E3ZA 2G8ZA 3AZTA 3RDKA 3C61A 2X0YA 1VBRA 1LM1A 3WBXA 1HZYA 3VKBA 3G3MA 3AHYA 3IJ8A 3PG9A 2G4FA 1H49A 4C6QA 1Q6OA 3WQPA 2ZWZA 5CPOA 2B81A 2PLJA 4ZENA 3VFLA 3DYOA 2VFDA 2WW5A 5AHEA 1K8CA 2DUXA 4AD3A 4DUVA 2WC4A 4N2YA 4M7SA 3R7MA 5JH1A 2PTWA 2WO5A 4RW5A 2HROA 3N6HA 2NSOA 2POZA 1TO3A 4GK8A 2R1LA 2FB2A 4MB1A 3TK7A 1ISVA 1EYWA 1V02E 3QQ1A 3NXFA 3CU2A 1H60A 3EMQA 2QEZA 1UKTA 4LWWA 3FIGA 3KVLA 4UCGA 3VOCA 3AU2A 4Q4KA 4Q8NA 4AZ7A 4QP0A 5AY7A 2VYOA 1HFBA 3EA2A 1XX1A 3N19B 1FWHC 4QX4A 3W1LA 2WM0A 4ZOBA 4WOZA 2ZC1A 1KM6A 3SJ3A 5AYYA 2C19A 2A3HA 3ARPA 2VXNA 1VFUA 4GCXA 9XIMA 5CSUA 3KTSA 3CV6A 5E9AA 3B9DA 1E71M 1I75A 1T40A 1R3QA 1R6WA 1AJ2A 3WF1A 1QPNA 4HNNA 2FH8A 5HUOA 1LJYA 2FVKA 3ZVHB 4YTRA 1NF7A 2YIHA 4Z2JA 4J3ZA 1FDZA 2W79A 4Q8UA 4GISA 3TROA 3UJSA 1GKQA 4ZGYA 1KFEA 4LUTB 3OIHA 4D6HA 3CV2A 5H8MA 5HOSA 2INZA 2WNWA 4XISA 2OTDA 3QGAC 1OX6A 4LW7A 1W54A 3VI2A 1WQ5A 1XW8A 1VKFA 4FF5A 3K30A 3GZAA 3V7PA 1OWQA 3BQ6A 4OBRA 4U5IA 1X39A 3CIXA 3RCNA 1HKWA 4NNAA 3WH8A 2BY2A 3N2XA 1J01A 2ABAA 1GK8A 3W2LA 3LSCA 1VFHA 2D2GA 2Y5SA 4IM4A 4AXNA 3EKGA 4R34A 3F4CA 3HF3A 3E0WA 4D71A 1IT8A 3WQVA 4QE5A 3CYVA 4FXFA 4BWLA 4RXFA 3L4TA 1R3YA 2XUCA 4LS1A 5I3HA 2FPYA 4M0XA 4J2PA 1GQLA 4IIHA 1TV7A 3KRBA 1DHPA 3W6LA 4CCEA 4FAMA 1HL9A 3VABA 2OYKA 1JPIA 2DSWA 2J8TA 1C9WA 1E72M 8CGTA 4G1KA 3T0TA 1TTQA 2VQUA 3RG6A 3B40A 2AL2B 1BEUA 3LNMA 3NURA 2CETA 1LYXA 1AA1B 3ITXA 4R53A 1TV5A 4TO8A 1J0JA 2PBGA 2XVGA 2Y7GA 5IHRA 3EX3A 1GOKA 4NJHA 1D3GA 3QSRA 3RJXA 1ICPA 3IVSA 4HHLA 1UWRA 4WUIA 4K7VA 1NIUA 1Q7ZA 1M53A 3LTSA 5G1TA 2XINA 4XZWA 1DXFA 3H2OA 2OX1A 3CL6A 1EEPA 2F2KA 2WJFA 1UWIA 4PMZA 3KCJA 2YBTA 1ICSA 4A21A 5BXRA 1R87A 4PEEA 2ZZ5A 3WLMA 1NWUA 1BXBA 4GVHA 4JHZA 1YNYA 2EPMX 1GOQA 4QBXA 2XVNA 1TWZA 3ZMRA 1TTIA 2WBKA 1JRCA 1BVWA 2D3LA 3BSHA 4Q6JA 2J27A 4PUDA 3V1PA 2ISSA 4ORMA 5LIWX 1CGUA 3DUGA 1A47A 3WH5A 2V9DA 1WZLA 3NO3A 3GUWA 3MW7A 2BLEA 4OECA 1FX6A 3GNRA 4GWEA 1TKKA 3L65A 2IKGA 3Q4DA 2V5KA 1J0HA 3O1NA 1FWGC 4NJGA 1JYXA 4RE4A 3GG0A 1P0KA 1EBHA 4LV9A 4JTSA 3URBA 6TAAA 2P5NA 3V36A 3T4WA 1QATA 3QY7A 4RNJA 4IUOA 3HV8A 3MSGA 2IPGA 3TA9A 4TMCA 1ZU8A 5GJNA 2FB3A 3NG3A 1B3VA 3ABXA 1EWEA 1Q4NX 2QT3A 3LRKA 1P7TB 3THQA 1DPMA 5HMEA 4UR8A 1W5PA 1QPOA 1NJJA 3KXQA 3V18A 5LYRA 1XJBA 1XH1A 2QUNA 1E3ZA 3VDCA 4CD8A 4ZB2A 2HZGA 4DJDA 4DUOA 3VM5A 1SM9A 3N6QA 3SIZA 3UXAA 2I5QA 1OQFA 3LXBA 1DWHM 3BL3A 2IPWA 1K03A 4Q7BA 1F07A 1C8YA 4W7VA 2WMKA 3REQB 2IQDA 5A8QA 2QIIA 3FVMA 4M81A 5KSWA 3ZQ9A 1E0XA 3POHA 3OYXA 3S5SA 1N8IA 1H7RA 3ZSSA 3S1UA 1UR0A 2VNCA 3QF0A 4X3ZA 2G3IA 1TJPA 1E0TA 4LQ1A 2V6AA 3KZPA 4FZIA 1NH6A 3MV01 3POCA 3FKRA 3H4XA 4IMDA 1RAKA 2H8ZA 4QLJA 3T2QA 4HMEA 1EBGA 1OFEA 3LCFA 4Q8WA 1H5VA 2WQPA 2YPIA 3C2YA 2DZUA 2QCFA 1H4PA 3OQEA 2C0HA 3R5EA 2CKRA 1G0CA 4NHVA 4W9TA 1XRSA 2R94A 4K8EA 1O94A 3W53A 5T91A 5LNWA 1QMLA 2FZ8A 3SZ8A 3L0GA 1KFCA 3BPWA 1QI0A 4UMAA 1NARA 1HW6A 2O56A 3E0IA 2XFRA 4GQBA 4FXSA 4ZQCA 5AYXA 3OTRA 2OOGA 1E3XA 3Q2DA 3IACA 1UKPA 2OEMA 2VHLA 3HB9A 3E1F1 2OX4A 2XWEA 3R89A 1TA3B 4MMWA 1ZRQA 2QVNA 1FY6A 3W81A 3AZSA 4RDZA 1LL7A 1A80A 1SFLA 1TR9A 3EXTA 3CTLA 2V0TA 3WD1A 2D69A 3R11A 1OFAA 2PGWA 3GS6A 1MFUA 4PMDA 1YPXA 4G9PA 3S6TA 2REQB 4C1NB 4GGBA 2E9LA 3GKAA 4AZCB 4B2DA 1BLIA 2JGYA 3G18A 4I9TA 3QQ0A 3SUUA 1KCKA 1PKNA 1IEWA 3KP1A 1I0DA 1MW1A 4PA8A 1OZQA 3WD0A 3C2FA 3VKJA 1DQUA 4MWAD 2BTMA 1XKYA 1T7LA 1G7VA 2OZ3A 4ZOEA 1N2VA 3ITVA 1JRBA 4HNOA 4TX6A 1OT2A 1A5MC 1DWGM 1P6CA 1OJXA 4FMVA 4H7ZA 4PCNA 3P5YA 4UWMA 3LTPA 1NP2A 3S83A 2ZX8A 3RPDA 3Q58A 2G41A 3O05A 3T0CA 3NPVA 5H1WA 3DFPA 4OIFA 3CQHA 3SN1A 3I4KA 4G2DA 4MF4A 4KEMA 1JFXA 3MBDA 3P67A 3FHQA 4Q4MA 5M1TA 2HEJA 1QTWA 2ZX6A 3O6CA 2HE5A 4POCA 1XD1A 4KWOA 2QUMA 3W83A 4B4HA 3UZZA 1R3WA 3BOFA 4M6QA 2VD9A 4WZHA 1IXNA 2DP3A 3PUDA 1F05A 4WXZA 3GC4A 3S3GA 2WLYA 3PB2A 1BTCA 4L9YA 4ASTA 3T4CA 1W5OA 1RCXB 3PUOA 1W5QA 3W7EA 3EX4A 4AMAA 3BGAA 3OBEA 4K68A 1J0ZA 3FJNA 5A8GA 2VX7A 3PR2A 4DI9A 1WKEA 4UTKA 3ZWSA 2QW5A 2Q01A 5DANA 3M0LA 3H2CA 3KBWA 3FSUA 3BAXA 2F8QA 1A5AA 5LNSA 1AH4A 2G37A 2YB1A 3H54A 2IMRA 2Z0IA 3DIPA 3I3DA 3IAQA 5JBFA 3N2CA 1OCBA 1XIFA 1JEZA 4WR3A 2GFTA 4AMCA 3GNNA 1VENA 3M0HA 1MXGA 3RLVA 4L1WA 4MWAB 4HMCA 3UJFA 3FX4A 4CEUC 5D2YA 2BOFX 4PULA 3W2NA 3VINA 4ATWA 1PKYA 3WK2A 3MKKA 3QYSA 1YXDA 3ITOA 2VX5A 4L65A 1CB7B 4GQQA 3BICA 1CW2A 3VU2A 4Y9NA 3N6JA 3MP4A 2IPFA 4JL2A 4V15A 3VKAA 4Y96A 4EWND 4PMVA 2POTA 1J5TA 5K9CA 4CVWA 1MW2A 1MEWA 1SFJA 3TC7A 2PDUA 3VIHA 5FA5A 3ONBA 4I5UA 1XDLA 3TP4A 2HQAA 1TCMA 3HPAA 4LFYA 4JL1A 4JIEA 1RPKA 2OU4A 2Q09A 4BHYA 2B7OA 1YX1A 2YYTA 5G1YA 1PTAA 4YCOA 1T99A 3WBEA 1EXBA 2OB3A 1YTEA 3CT2A 2DZVA 4I5RA 3OA5A 1DBTA 1E5NA 1FWDC 2ZQ0A 3DHUA 3W22A 2RJGA 3ONCA 4GXPA 3OA3A 1GG1A 1S2TA 2VR2A 3VE9A 3GQYA 2FGBA 1W1B1 1LBLA 3GVQA 4Q4PA 1RBOB 1F76A 3N4EA 4JY8A 4MJ4A 4R27A 2I5IA 1GVOA 3R0DA 1X96A 1UUOA 4XZMX 3DI0A 5HAOA 3H4GA 4GQ0A 1TE1A 2XDFA 4PEKA 3LB0A 3HPSA 5KZDA 1LCOA 4S3FA 3AXHA 4GVGA 4TTGA 4IMCA 5FL1A 2Z28A 1G9HA 3AUOA 1P0NA 4EANA 1EGMA 5IFPA 4DF0A 3TC3A 4QHRA 4ROQA 3UJRA 1JCNA 4ZSUA 3MP5A 2HVNA 4PSRA 3N13A 2J8GA 4EKJA 3PBUA 1SW7A 2ZWYA 1HP4A 4JFVA 1MMFA 4ZODA 5K7JA 3A3XA 1Y65A 1OGSA 2YCKX 5HJXA 4O57A 2GDQA 2EHHA 2OOFA 1KGWA 2WKLA 4AVOA 1Q85A 1JF5A 1QI5A 4V27A 5I3FA 5M03A 3C0JA 4UFLA 3QVQA 1WZMA 4C6BA 3UEQA 4Z1BA 3CUIA 3QV7A 2HNEA 4GUIA 4BF7A 4QNEA 2W9MA 3NZ1A 2TYSA 4O11A 5REQB 3PWAA 2PD9A 4YLWA 4XIMA 1Q65A 2NV9A 4IMAA 1ZJAA 1F3TA 2UBPC 4Q8TA 4JN8A 7REQB 1RY0A 3GFXA 4E38A 3LMYA 1M65A 2J7CA 1HN1A 2SFPA 1VCGA 3L5AA 3ID7A 3LLXA 3PB0A 4IQJA 1XLIA 3GO2A 3L12A 3CB8A 2EO7A 1PIGA 4IGNA 4N42A 4BJHA 3UERA 3N04A 5I3JA 1X7IA 2EPOA 3ARXA 5F7UA 3FEMA 2OZ0A 2G50A 3SIMA 2YA0A 4WIWA 1BG4A 4ICMA 4FNUA 4FOUA 1PZ1A 3PF3A 5CC6A 3OIXA 1ITXA 2ZVIA 3UJ2A 1E1CB 4W89A 1W8GA 3ZOAA 3EB3A 3TA6A 3E9AA 2FQIA 3GD6A 4IUGA 4HA0A 3TDFA 1Z6KA 4A3YA 4NU7A 1VCFA 1JPDX 1GEHA 1UW9A 4LUIA 4V28A 1E6XM 3OVQA 3MSYA 4IPIA 1F61A 3OPSA 4CEXC 1AJ0A 2DQWA 4N0RA 1KBIA 3IJQA 3B3DA 1ONWA 1GVRA 4DJFA 2D2JA 4TTUA 3G1XA 2GWGA 4AD4A 4YVVA 4D72A 2QQ6A 2FZBA 4N7QA 4U2YA 4KCTA 3LLDA 1XBXA 4MB5A 4GQRA 5AYZA 1AZ1A 1FWAC 3CHCA 3M0VA 4H19A 2ZA3A 1U5HA 5CC7A 3TTOA 4A22A 3OZPA 3D3AA 4XQ6A 1HJQA 1P43A 4Z1DA 3WELA 5T26A 1RR2A 2NQLA 3CPRA 3L0KA 1KBLA 2TPSA 2OSWA 3W73A 4Q8VA 4NI3A 3NO5A 4XAZA 4GIEA 4QNWA 2A7RA 3IRSA 4H04A 4O10A 2E09A 3SCUA 2Z24A 4KCVA 1DJGA 1XLEA 4R9XA 3EWXA 3VOFA 2W27A 3F4VA 4NQ1A 1IT7A 4CN1A 3WBWA 4IH3A 4E3VA 2PDKA 9RUBA 3BOXA 3PTMA 3MUCA 2IUZA 3LPPA 3EWZA 4MLRA 5AHIA 4HT3A 3QYQA 4HA1A 4D6IA 5D04C 1IXQA 3II1A 5A3HA 2DZTA 1AVAA 1NWTA 1X1ZA 1V79A 5KITA 3GZ3A 3ARQA 2JBMA 4HU8A 3PC0A 1L0PA 2X05A 3QY6A 3NZRA 4NRSA 1AH3A 4GCAA 5XIAA 2YOCA 1C8VA 4P8VA 2JK2A 5XIMA 1FXQA 1PHWA 1VPYA 3O6AA 1K9DA 3UWUA 1OD0A 4IZGA 2UZ9A 1EYEA 2GUBA 4UTLA 3KRUA 4L9ZA 3NZQA 3TTYA 3EPMA 3L21A 1LBFA 2FIQA 4BEQA 4O0KA 3HURA 3AXIA 1J12A 1V3LA 1XV8A 2ZRUA 3RO6A 3OO2A 1OYAA 2PLCA 4LBRA 3A4XA 3FA5A 2PRHA 5FF3A 3NQEA 1NQKA 3B8UA 3DG6A 1RD6A 3ITGA 1XFBA 1B4KA 1D8CA 3ZS4A 3KBNA 1P0EA 3PTQA 2QGYA 3MJYA 1XSJA 4QJ4B 3IV8A 3M6DA 3UXDA 2FDSA 3TMQA 3SCOA 1OFOA 3WLSA 5J8LA 2VR5A 3EWUA 1ITQA 4DYJA 4GIRA 2ZRYA 4U4MA 5FKYA 3WL1A 4CQ9A 1V0LA 2XU2A 3CMFA 1AUSL 2HMCA 2P0OA 5G4HC 5I24A 4B9YA 4DEFA 2E67A 2ZUUA 2H90A 2EBNA 4IFOA 2HTMA 3R94A 1YLVA 2ZUWA 3CC1A 4I6VA 1TZ9A 1KCXA 2E5DA 3R43A 1S1PA 1K7EA 3GDKA 4HNUA 1UKOA 4D1JA 2FPTA 2Y62A 1LDCA 4A8IA 4MZ1A 3T0DA 1L6WA 3DYPA 1FDJA 1TMQA 3ABZA 2W91A 4AZ5A 1DQWA 1NDWA 4HVXA 4O4VA 3C5QA 2ABBA 4GYPC 3HPFA 4KPLA 1C7TA 3GHSA 3MYOA 5J04A 2Z1XA 1R3TA 4ECLA 4KF1A 3BE7A 2HWGA 2BHZA 4PRTA 3FGCB 3IGSA 3BURA 4C6DA 1GVYA 2QIWA 2ZRXA 4TOQA 3PZIA 4AF0B 3M0KA 3K13A 4C7FA 1W9UA 1RV8A 2J88A