1M1BA

Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
publication title Dissociative phosphoryl transfer in PEP mutase catalysis: structure of the enzyme/sulfopyruvate complex and kinetic properties of mutants.
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 111
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1m1bA00
5TAOA 1UJQA 1M1BA 2QIWA 1T5AA 3ME3A 4KCWA 2HROA 1PKNA 2VGFA 2XZ7A 3EOOA 4L9ZA 3SRFA 3T0TA 1AQFA 1DXFA 2BG5A 3E0VA 4QG9A 1IGWA 1S2WA 4B2DD 3B8IA 1F3XA 2X0SA 4MF4A 4TV5A 1S2UA 2E28A 2HRWA 3SRDA 2R82A 1A3XA 1OQFA 2HWGA 1A5UA 3T05A 2V5KA 4KCTA 4IP7A 4QGCA 4JPGA 1A3WA 3BJTA 5JVLA 3SRHA 3FA3A 1VBHA 3E0WA 1F61A 1M3UA 3QV7A 4RPPA 1S2VA 4HYVA 4B5UA 4B5VA 3VAVA 1GGOA 4B2DA 1F3WA 4B5TA 3M0KA 3EOEA 3OQ8A 3R4IA 3IS4A 1U5HA 2VWTA 3HQNA 3QTGA 2L5HA 4WJ8A 3KTXA 4IQEA 4B5XA 1DXEA 3QV6A 3U2ZA 3OYXA 3GR4A 3QZ6A 4IQDA 3KHDA 3EZ4A 4KCUA 2G50A 4KCVA 1DQUA 4L7ZA 2XZ9A 1PYMA 4YNGA 1ZJHA 3I4EA 1VBGA 2HJPA 1SGJA 3HQPA 3PP7A 2KX9A 4QG6A 3T07A 1XG3A 4L80A 1F8IA 3MA8A 2DUAA 2V5JA 4FXJA 2DIKA 1PKLA 1XG4A 1U5VA 2XDFA 1JDEA 2ZE3A 3QV9A 4FXFA 1KC7A 3LG3A 3QV8A 3HQOA 4L9YA 3FA4A 1OY0A 4QG8A 3G2GA 3LYEA 3QQWA 4B5WA 2WQDA 1MUMA 1F8MA 2VGIA 2VWSA 3E5BA 1Z6KA 1IZCA 2VGGA 4TV6A 1O66A 3H6OA 3SRKA 2OLSA 3M0JA 2VGBA 1O68A 4G1NA 4LSBA 1S2TA 1PKYA 4YJ5A 4MG4A 1E0UA 4ROQA 1DIKA 3GG8A 3OYZA 1PKMA 3N25A 3BJFA 1KBLA 1E0TA 3PUGA 1A49A 3EOLA 3QLLA 1O5QA 4B5SA 3P0XA 4KS0A 4DRSA 3GQYA 4IMAA 1ZLPA 4HYWA 4KRZA
chains in the Genus database with same CATH superfamily
2D0HA 4Q3MA 1QW7A 1LOQA 1EP3A 2E0PA 5HINA 3B0UX 1ITUA 4IJCA 2C1GA 4TV5A 3EYPA 3R10A 5ABTA 1OD0A 3IV3A 4K2SA 1CI1A 4YWIA 4Y6GA 3FLUA 1XPYA 2IKHA 1C29A 4MIMA 1GVIA 1Y0EA 3UF9A 4EF9A 1NOWA 1V51A 1AW2A 1JQVA 2UZ9A 4XK2A 1KM6A 3WQPA 3S1VA 2NV9A 3UR5A 5I3DA 3ZS4A 1TTJA 3C52A 2CBVA 2NWRA 1IEWA 1XIDA 1LUCB 1VCFA 2NVDA 2J88A 3HQOA 3WNLA 2Y89A 4DPPA 2ZX5A 4M81A 3AIVA 4DPQA 2OGJA 2NLIA 4JQAA 3R43A 3ZJ7A 1DJQA 3W88A 1SZRA 3L4WA 1ZPTA 5IFTA 4O50A 1ISWA 2JALA 2PS2A 5DMLA 3GDKA 3TU9A 2FZBA 2ZXBA 3S5NA 3QOKA 2CERA 3O07A 3TTSA 3VGGA 3MI2A 4UOQA 5FAJA 1LT8A 3MI3A 2XU2A 3MDWA 3N04A 2D20A 2OQLA 3VOJA 3URQA 5CXPA 1QU4A 3RJXA 4L4MA 2ATMA 3NNTA 4GINA 3PZOA 1F9CA 2PWDA 3W7KA 2OKOA 1C8YA 3U4FA 2FZNA 3CV7A 2GOUA 3GE7A 3OBKA 2AMGA 4F2UA 1VRXA 3M64A 3L4YA 1E0VA 1RLDA 1RV8A 4EWJA 1YQ2A 1DQUA 2EF9A 3T09A 1JQXA 2W61A 4K1GA 5BZAA 4HVXA 3II1A 4ROPA 1R2SA 1C8XA 4ZOBA 2JE8A 2C8NA 3BPWA 2WZHA 4XISA 4RXFA 5F2IA 3OGRA 3D3FA 4AZ5A 2VC6A 2Z27A 1G4EA 4OV4A 2ZUMA 5BU9A 1KFBA 4UC5A 1IZCA 4PBFA 1CGYA 1VIWA 3FV9A 1B5TA 5HMDA 5CC5A 1HW6A 2B7PA 2QMKA 1KGUA 1TWZA 3FKKA 3NL2A 1I9CB 3N25A 4OTKA 3HB9A 1IE7C 1XYFA 4DUWA 1OFDA 1WPCA 3L7RA 5BMXA 3KVKA 2POTA 5IHSA 3DECA 1DJYA 3ZWSA 5M2FX 2NT0A 2J7FA 1RR2A 5IBXA 4JOMA 3A23A 3VNKA 1PX4A 1A5CA 4UMBA 2JF6A 4HN4A 1FWBC 4NHVA 4R85A 2CHRA 4AISA 1OG6A 4ML4A 1JXKA 1E6SM 5HQLA 1Q65A 3LHZA 1KRCC 1U30A 1TREA 2PC4A 4Q4KA 1PEZA 3G1RA 3ARWA 3T81A 3U2EA 4J3VA 3GU1A 3M5XA 4MGGA 3LRMA 5E09A 1AL7A 3NEHA 4ADTA 1VQTA 3GDTA 3W2LA 4WJ8A 3NXFA 3SIZA 3M4HA 3WLKX 1EXBA 4O14A 1GQIA 3ZO9A 4S1FA 4S3AA 5BW6A 1I45A 4GUFA 4UWMA 1GTHA 3H2OA 3R0UA 2PTDA 3E96A 1I2QA 1VAHA 3K8KA 4CKQA 1HJWA 1XDLA 3LHTA 4LVDA 1ECQA 3I6EA 1CGUA 5BMWA 5EFFA 1UD8A 3RX3A 2WSKA 3VIOA 1NWSA 4GI9A 1G9HA 5GNZA 4YL2A 2WBKA 3UCQA 2VL4A 1OSEA 3L65A 4CQAA 5DT5A 4ZVJA 1VP5A 4LC8A 1KM0A 3HF3A 3RJYA 4GO8A 1WCGA 5TAOA 1YBQB 4PMNA 3RO8A 1C9DA 3H7UA 2VCCA 3MHGA 3SSZA 2BV9A 1U83A 4ORIA 1WDSA 1K6AA 3SUVA 2WQPA 4QBXA 4AZGA 4ZQCA 2I5IA 1MYRA 3GU2A 2SFPA 4PMJA 3W70A 4MAZA 4PTMA 1QR7A 5CC7A 3VTRA 1ITCA 1EOKA 1UIOA 1M68A 4LPCA 2E77A 3WBEA 3UZWA 4A8RA 1BSLA 4MFEA 1PHQA 3DFSA 3AU2A 3PAJA 1GJPA 1QVBA 4FK9A 1FWCC 1VHNA 1WUEA 3FA5A 3W2KA 3LLFA 8XIMA 1J8VA 3AXXA 3UWZA 1IZKA 3S5OA 3WLRA 1OINA 2WC3A 1UR2A 4BJHA 2J7EA 5H8MA 2EPMX 5M3WA 4MZ8A 2FJUB 2CKSA 3H8AA 3O05A 1NTHA 3PS7A 1CXKA 3CJPA 3SY5A 1FWHC 4FLQA 3ZYZA 1Q7QA 4MB5A 4WXYA 4NRRA 3RK8A 3VOFA 4AD5A 4LAZA 6CGTA 5CGQA 1TWDA 1TTIA 3W7PA 3N6HA 1S5TA 4QNEA 4UFJA 3QLLA 4C6KA 3IJ6A 1E4IA 3PBVA 2PE4A 2QKFA 3BANA 3WLJA 1FTXA 3IEBA 4DYJA 2YLLA 2YJQA 2ZVRA 3KTCA 2BVYA 2DT1A 3WH9A 3AIUA 3I3EA 1NWUA 4AAJA 1B9ZA 4M8UA 1FBAA 2ISVA 1RCXB 3IARA 9XIMA 2XN2A 3E0VA 3ZMRA 1A3XA 2JK2A 3F4CA 1TX2A 1G6CA 3ZZ1A 3AS1A 4QM1A 1Y5XA 2WOQA 4YYFA 2Y5EA 1MEWA 2Z1SA 5A8QA 4B5VA 1G5AA 3RG6A 1S5NA 3QC0A 5A6MA 4RUBA 3AU6A 3HPFA 1GKPA 3N18A 3LUTA 1SSGA 2DSKA 2DSVA 1PTDA 2NZLA 4QJ1A 1WKEA 3MO7A 3GNXA 4HTBA 4ACYA 2BOFX 2VC5A 3TW6A 1JCTA 2Q3RA 2WCSA 1SUXA 4R9OA 4GIEA 1BFNA 3MBDA 4LEQA 5BXTA 2W3ZA 3SDOA 5CJ5A 4NJIA 3OA5A 2OZ0A 2ZRUA 1GORA 2WPGA 3B97A 3TQPA 1SZFA 1MW1A 1GOKA 1QHPA 2E6AA 3HJZA 2YR1A 4U28A 5C6MA 2ZRYA 3W0KA 3GDMA 5D04C 2ZDRA 4UTUA 1J96A 1RJPA 5D2VA 1XDJA 3HG5A 3TWBA 5G1MA 3BGGA 2GGGA 2OWCA 1JZ3A 2PGRA 5BOOA 2YZ5A 4HZMA 3GY1A 3VOGA 3WDQA 4HZ7A 2I5QA 2O55A 3RNDA 2PC8A 4GX8A 1QBAA 3TYUA 4DAIA 1VIZA 1GKQA 4HIBA 4IX2A 3ITCA 1UUQA 4B4HA 5LXXA 4PMZA 2FFCA 3BSMA 2X05A 2J24A 2DORA 3VABA 4KCTA 4OBRA 5D2WA 4S3BA 4R7OA 3PB0A 4TQTA 1EGZA 1HNYA 2OZ3A 3SI9A 1R9ZA 2FDMA 5LA2A 1N55A 5DMMA 1RUSA 2YZRA 3RX2A 2Q8LA 1RZMA 2ZA2A 5CJMA 5EMMA 3P2VA 4LB3A 3N13A 3BLEA 3EZ4A 3RCMA 3WQVA 3WH5A 1REQA 1X98A 3N1AA 4RE3A 1WOBA 3MSGA 5AVNA 1TPEA 1V0LA 1GOMA 1X7FA 1BYCA 4WJXA 3DEQA 3UPMA 4XZHA 4QHRA 1GOQA 3VI2A 3M0MA 4L9YA 1V3MA 2QPXA 1M6JA 4H7CA 1VJZA 1KXQA 3OQEA 2VEMA 5D38A 2V38A 4DF2A 1L6YA 4XD6A 3R8RA 3LNMA 2MANA 5LNRA 1NDVA 4Y9OA 5HQEA 3TYDA 2X1TA 5I3KA 1TV5A 1TA3B 1UKPA 2JKAA 4BI6A 2IPGA 1JYVA 5I6SA 3ATYA 3CWOX 3PBMA 4IIFA 2CBJA 4QR6A 1YE4A 1L2QA 3QC3A 3H23A 3R11A 4AUBA 1R3WA 1XH0A 1L8NA 4ENLA 1RK5A 1E9ZB 1NARA 2PWUA 2WM1A 3DHDA 4ML9A 5G1YA 1P7TB 5L6UA 1BVZA 1XDMA 3CTLA 3H2EA 4PMRA 1IGSA 3JR2A 1H4PA 5BXPA 4ZO6A 5EKYA 1Q45A 3CHCA 1T96A 3UG8A 1IWAA 3FS2A 3NXLA 4Z2GA 2ISWA 3DG7A 1SFLA 4UFLA 5F7UA 3UD6A 3TCEA 3ZR4A 4PCPA 2PAJA 5JIWA 3T0AA 1B2YA 3STEA 1ENUA 1AK5A 4UTLA 4D8ZA 1A5MC 1CT5A 6XIAA 1XUZA 3WLIA 4KQNA 3WMSA 1WZLA 3LX9A 4R7WA 2C7FA 3E02A 2EPNA 3A4AA 3VUPA 1VHCA 2QCMA 3NVDA 1M03A 3FKRA 3TXVA 4HSNA 4REQB 1W54A 1GVSA 2HK0A 2BXVA 2B7OA 1YKWA 3MTWA 3HM7A 3EWZA 3RITA 3BW3A 3N12A 3TN3A 3HPXA 3M0YA 1FH9A 4S3FA 1E1FA 3QXBA 3T0BA 3T9PA 2Z6JA 4MNKA 1KM5A 1UH4A 3A5FA 1ISVA 4F0KA 2RDUA 2QCGA 2IPFA 3ENLA 4E3TA 2ASHA 5CZSA 3ZJ6A 1Y8BA 3IIVA 2HZGA 1TA3A 1PX8A 1X8CA 5GJPA 1GNXA 4JYEA 3T2PA 2R6OA 1Z44A 4DHGA 4LB4A 4EKJA 3UR8A 3FY1A 1OC6A 3N3TA 4XSLA 4PZVA 5KZMA 5FF3A 3N6JA 4GQRA 3DFQA 1VYSX 1AQMA 1XW8A 2GJRA 1GOWA 1I1XA 4TIMA 4AH7A 4GMEA 4O8RA 1BXNA 4JCMA 3BXWA 3B8UA 1OIMA 1UD4A 1OX4B 4ZXLA 1TPC1 2FB2A 4JNMA 3GR8A 4IGMA 3E1F1 2YCLA 2Z2UA 2UV8G 4LTSA 2Q71A 3THDA 2GK1A 1XICA 3UR7A 4RDWA 1RP8A 5CSYA 1V0NA 1EP1A 1ZGDA 1NP0A 1PPIA 4MMWA 3WUEA 5E9XA 4UR9A 1EDQA 2H9AB 2V82A 2XN0A 3FSUA 3GYEA 2REQB 1H41A 2ZA1A 1K02A 3L68A 3APGA 1WKFA 4O1FA 3VNYA 4PSPA 3NL5A 4GJJA 3UWUA 3O0FA 3LTPA 3AMLA 4A8IA 3GC4A 4REQA 1IR2A 1MW3A 4DZHA 4G2DA 4H2CA 1PSCA 1NWRA 4JZ5A 2J79A 1DTUA 1BQGA 2ZQ0A 4LC6A 4ZSUA 4N2YA 4G7EA 3O16A 1OB0A 1G01A 1J2BA 1JR1A 2HVNA 1VCGA 3UY8A 1RVKA 4V2XA 4MJ2A 4Z0JA 4D6CA 3W85A 3GDLA 2PP3A 4FMVA 4F2TA 5I77A 4FA3A 2W4XA 3OHIA 3KLLA 5B7ZA 1Q8JA 4AFYA 4ZODA 1KRAC 4PMDA 4NAEB 2X1SA 4LCQA 3UXLA 3LQLA 4UB9A 4XZBA 5A6BA 1XCWA 4POCA 1L6GA 1YRRA 1IT8A 3NZRA 4IXHA 3DC8A 1TV2A 4BF7A 2OODA 1FFQA 5F1VA 1M41A 1BQCA 3NGJA 3TNBA 1SW0A 2C0HA 3IACA 1C92A 1S38A 2DUXA 1E72M 1IEVA 3GVVA 4WDTA 2XFYA 5LXEA 1O66A 2AL2A 1EXPA 2H9AA 3UNDA 1QAPA 4JEJA 1LROA 3W74A 4F0LA 3WH7A 1WE5A 1JCJA 3DI0A 1VFOA 2JF7A 3LY0A 4FNQA 4UTJA 4DRSA 1OG0A 4C5YA 3HG2A 2G3JA 4XTDA 1MI3A 3TQVA 1HP4A 3W1UA 1E6RA 4CD5A 2VXNA 1YTKA 5EMLA 3T0CA 1B31A 1QRQA 1KFLA 2F38A 4UNIA 2X40A 4MF4A 2Y61A 3B06A 5D05A 1G7UA 4KWUA 4F0RA 3QYQA 4CN6A 4IIHA 2J7CA 1P4CA 2E67A 4JX5A 3OW1A 3G1AA 4I8DA 4L4OA 4L6HA 1UROA 5E6ZA 1E70M 4WOQA 4DB7A 1B4KA 1SJDA 5HXMA 1CW2A 3GFYA 5BROA 3JRKA 1Q66A 3KP1A 3DERA 3QF0A 4QAWA 4D6EA 1IT7A 2Y2WA 2BASA 4MTVA 3W72A 5E0CA 1K77A 3MMWA 4HPGA 4ZGYA 5C0QA 2QUNA 1UBSA 2P88A 5FF2A 1IZJA 3SR7A 2Z26A 3NA8A 1A3HA 1ZJBA 4FNTA 2GJPA 4US6A 3IVUA 4FEZA 3SGGA 2HK1A 4I3GA 4W88A 3PG9A 1HJQA 2PBGA 4PMVA 2NQ5A 3VILA 2GFTA 4X9SA 4C6JA 2GUYA 2E9BA 1VGAA 1Z3NA 2WBGA 4PULA 4YS1A 3APTA 1EO5A 5I78A 3U2OA 3V16A 4LVAA 3W1XA 1KRBC 3UT0A 1Z42A 1UR8A 4HMDA 2HMCA 5FESA 2WSYA 4J27A 2NSXA 4MPKA 4KWSA 3TK7A 2CEQA 4IUOA 2VX7A 4H00A 1DIEA 2QUVA 4YLWA 2J7BA 4S38A 1QPQA 5HJYA 2G96A 2Q6ZA 3UCCA 3W9ZA 3NQFA 4C1NB 1HJUA 3MHUA 1Q6CA 1E43A 3SJ3A 1M53A 1UD3A 4W84A 5EA9A 2X16A 2YDRA 4CNNA 1YDYA 2A5HA 3MKKA 1W3IA 4S3CA 1EYEA 5BRBA 2XYLA 1EZ2A 4E3VA 2DVXA 1DWHM 1YNPA 3NPUA 3KRSA 3GU9A 1TUXA 4H19A 5GPRA 2OX4A 1UR1A 2HS6A 2QW5A 3KRUA 2NX3A 3LTYA 1P0KA 1QPOA 1G94A 4OE7A 3LPGA 2VCBA 4OGZA 2YXOA 2QGYA 4J9JA 1QNPA 1BVNP 3W1PA 3QHNA 1JFHA 3VM7A 3XINA 3PB2A 2RFGA 3OLIA 1DJWA 3T7VA 2E6DA 5AYIA 4ZTYA 3V36A 4MY9A 4NP7A 5TNVA 4C7DA 2PTXA 3MS8A 2OCZA 3GKAA 1LQ2A 3G18A 4FP1A 3BV7A 4PFHA 3EOOA 3LDVA 3MQTA 2QV4A 4FNPA 1Q2SA 3SCUA 2RJHA 3H2NA 3AIQA 4WRHA 1CGTA 2A3AA 5CCZA 4V1XA 4ATLA 1R0MA 5H2ZA 4A2SA 1C9WA 4AG0A 3SUTA 3F4NA 2A2IA 4A21A 1FVPA 2Z2BA 1U1HA 4A8LA 3A3HA 1DXIA 4DUXA 3BK0A 3UXAA 3LGEA 1MWOA 4LBSA 3T6CA 1CCWB 1RA0A 1W17A 3OYXA 4K6AA 3CZ8A 3WQDA 4NL1A 3P82A 1GVRA 2J9XA 1C8VA 4E8GA 4ZO9A 1FXQA 3P67A 5AY7A 3UJFA 3COTA 2MUCA 5CPNA 5AN7A 1UZHA 3UEQA 4DI8A 3CAVA 2ABBA 1X6UA 3W7GA 2PURA 4UIOA 4D72A 3AXHA 4CU6A 4JY8A 3SCSA 4H9UA 1C90A 2DZAA 2XTKA 4GBUA 5FSDC 3H2MA 5ABHA 4GZIA 5GQBA 4AVNA 1B3ZA 1JJKA 4ZCWA 4LAOA 3SCNA 3TZFA 1H11A 1TG7A 2E3ZA 3WK0A 4W7WA 3M5YA 4AD4A 3S2LA 1CB2A 3PUGA 1MVYA 3ABQA 3NR0A 4HHHA 1HKIA 4LOCA 4E4PA 1TIWA 3FNDA 4XAYA 3FAWA 1EOMA 1EFZA 4YYCA 3VCNA 3B8VA 4S2CA 1V08A 2D3LA 2ZA3A 5FOOA 4L6OA 2R82A 3I68A 1GYMA 3SN1A 2E25A 4MY1A 4CD4A 4E38A 4J3XA 1F05A 2OO0A 4HMCA 1NIUA 3QV7A 5DFAA 2XGIA 4NIRA 2Y70A 1H5YA 3N4FA 4PEEA 3IUDA 3L2IA 3UVIA 1EA0A 4D6IA 4NZ3A 4FOUA 1VBGA 1FH8A 3E2VA 4KFPA 4QXIA 1TPDA 4ZOCA 3AYVA 5D2TA 1D2KA 3BE7A 3KEHA 4JICA 4U4MA 1A5LC 3ANUA 4U2YA 3H4XA 2PGWA 5JH2A 4LX4A 2JBMA 3UU0A 1K8ZA 3LRLA 3WQ5A 1S2TA 4F79A 3BARA 4IMDA 4DAFA 1PB0A 2ZOXA 4NZCA 7ODCA 3IAQA 2Y7GA 3EDJA 5DXXA 4GWEA 3S1GA 3CPGA 4JGDA 8TIMA 1QATA 1QMLA 1RH9A 3LV5A 4YTUA 2PDMA 3G0UA 3WFAA 1J0JA 4JL1A 4IICA 1W3TA 3SRFA 2QULA 4J1OA 3EPOA 1G4PA 3WBAA 4GY7A 2HE8A 4U3CA 2OMAA 4JNYA 1EJXC 4XQ6A 3P5ZA 3SCOA 2F6KA 3ZM8A 2DZTA 3K2GA 3WQEA 4IXXA 3S6DA 2G5WA 3GB6A 4E8CA 4C90A 2BGNE 3A13A 1H7OA 5DY2A 1L8PA 1N8IA 2AL1A 1PUDA 1AH0A 3AS2A 3GXIA 3TC6A 2RH9A 1RBLA 5A6SA 1BYDA 4TU1A 5IBXC 2OEKA 4Z2KA 4KCUA 3OLDA 4RLIA 1J79A 1BTCA 4JTUA 3ZVHB 4DXKA 1GQLA 3WCZA 3IK2A 1GPFA 3LD5A 4DVOA 4C1KA 3S5YA 2A3BA 1BPLB 3WNKA 3RF9A 4M80A 4WKFA 1YMYA 3PZIA 1PIIA 4QDWA 4RW3A 4E6MA 3AHVA 2DJLA 2YCKX 1ITQA 2YA0A 2ZZ1A 3T2OA 3ECQA 3HTWA 1VFHA 2J8FA 1OK4A 4CN4A 4XV0A 4UTIA 1A47A 4QDMA 3CAWA 2XFFA 4QROA 1DIKA 4LW7A 3TSMA 4ZEPA 1F74A 4MNJA 2YX0A 1UR3M 4KFNA 2F7FA 2O92A 1YPFA 4U3AA 1JIBA 3I7QA 2Y63A 2VZSA 4KGLA 1KGXA 3NQ6A 1ZJIA 2G37A 3E74A 5AHFA 1I4NA 2QLYA 4UZUA 1VPQA 1UJPA 3BICA 1XM3A 4AZ7A 4H9XA 5HNRA 1J5SA 4H41A 2VZTA 1J10A 4XZMX 3WFLA 2TSYA 1H1ZA 1HGWA 5I02A 1IWPA 3BLKA 4AHPA 5H8PA 1R2RA 1UP0A 2QCNA 2WPBA 4NT0A 3U48A 1E9LA 2WHLA 1LP6A 4X60A 4JFUA 4QRNA 3BLOA 4GZEA 3N2OA 3S2CA 3CUZA 3S5ZA 4XO7A 3WLQA 3CL6A 4S3EA 3QZEA 3KWXA 4OECA 3EDFA 4J35A 4WDUA 3M1ZA 3DUGA 2VGBA 4DJEA 3S6TA 3EMZA 3DH7A 2DU2A 2IW0A 2BODX 3D47A 1H09A 3CH9A 4W89A 1R85A 1O7AA 5FEWA 4MAVA 1NU5A 2VTFA 1XV8A 3GHRA 2QUTA 4WZHA 3CIXA 2ACQA 3WF1A 4D6HA 2WNNA 4K3ZA 1NOUA 2ZE0A 3LB0A 4AIUA 1MNZA 4B3ZA 5HULA 4HHMA 4YWSA 3KLKA 3VU2A 3NQ8A 1ZAJA 1EC9A 3AYSA 1S2UA 4K38A 1OHLA 1OFOA 3GC5A 4J3ZA 1LZOA 4P7NA 1H50A 3N2TA 3GTXA 4DJFA 2CLKA 5F4WA 3C61A 5AYBA 3MW7A 5F1UA 2P8CA 5BOFA 1X6LA 2CETA 4DY1A 1V4YA 3EWCA 3W87A 4AMAA 2J4GA 3LK6A 4GACA 1SO5A 2BY0A 4N9DA 3ZQ9A 1XKYA 3SUWA 3TUUA 1K7EA 2FGLA 1DP0A 2QJIA 3VPLA 2D73A 4DM1A 1RD5A 3H21A 5EBUA 3D46A 3C0SA 4MNLA 2B7QA 4UTWC 1QK0A 3PNZA 2V2HA 5AC8A 2VURA 2X1RA 3S1WA 3KBSA 4GE8A 1SO6A 4IFRA 3VXGA 1VYRA 5IM51 4XVEA 4RK8A 2VRKA 1OY0A 4GVHA 2PF0A 3INPA 3CBWA 1GQJA 1X39A 4HNCA 3EAUA 2VR4A 4AY8A 3H6OA 4X22A 1QUMA 2OG9A 4DO7A 4WSKA 5K9XA 1MXGA 2Y8VA 3HGSA 3TA9A 4QISA 3TTQA 2OQYA 2J13A 9XIAA 3K4WA 3NYDA 2J7GA 3VD7A 1T6MA 2ATSA 1XLDA 4R34A 4FNRA 4C6BA 1ZY9A 3NVTA 1TRDA 3KVJA 3RMJA 1EH9A 4DF0A 4JTCA 2BX7A 2UY3A 1W1TA 4GYJA 5DCEA 2ZX9A 3N34A 4Y7EA 2D2HA 4CD8A 2EG8A 1ONXA 3BCFA 3KX6A 3ARVA 4V28A 2IXUA 4RX0A 4EAMA 2WSPA 4F8XA 2XGBA 2BNJA 2GPTA 3FHQA 4HCLA 3H55A 3PTQA 2CWXA 4JHOA 4PODA 2FMOA 2VDHA 2RKXA 4DBEA 4GUHA 3IS4A 5CPTA 2XVLA 4HNOA 4PBEA 1P0DA 4HPHA 3BV4A 4FAMA 5CLWA 1POKA 1V8EA 3LCHA 5AHLA 1J0KA 3TN4A 4IQDA 4KCVA 1H0GA 1LCOA 1PYMA 3PVFA 4JIEA 3KBMA 3DI1A 5XINA 3GXPA 2DIKA 4GY0A 3T0DA 3S2JA 3C56A 5C9WA 3AS3A 4GH1A 5KTLA 2CZVA 1XBXA 3W28A 2FDSA 1T41A 3SUUA 3QFEA 3GNRA 4KIEA 3LS9A 4G9PA 4HA0A 5BXSA 3WBWA 3UZZA 2VGGA 4JYDA 1IEIA 1CLKA 4EANA 3F2BA 3DKJA 3TH6A 2DIEA 1QNVA 3S5SA 2W66A 3IAPA 4JY9A 3S8HA 4C5ZA 1O5QA 1IXQA 2VC9A 4EXBA 3UERA 3ANVA 1MUWA 4GYFA 4NKCA 3W1TA 4AWSA 2H6RA 3MZ2A 1EA9C 4PEKA 1TSIA 3ONBA 4V33A 4I5XA 3KE0A 1QI4A 3M46A 4QG9A 5HUPA 2D3NA 1F3XA 1W8GA 2FH6A 4CVWA 4RDVA 3UXKA 3EXRA 3LCIA 1UOKA 5CEWA 2YIHA 2V5KA 3MUY1 1JI1A 2B81A 4YTQA 4K1WA 3M9YA 2EAWA 3W3OA 4AIEA 1MO0A 3G8EA 1E4MM 1DJXA 2XVKA 1XS2A 3CAQA 3EOEA 3VIHA 1TV4A 1HXJA 5D03A 1PZ3A 1R9YA 3KTXA 4CNPA 5ECVA 4RKAA 4WQ6A 1T99A 3AIWA 3NG3A 1YNYA 3RXZA 1H0IA 3HG3A 1L9WA 4R3UA 3W37A 3WQ4A 4CU7A 3WD3A 1UMYA 2Z6IA 4JR5A 1LQ0A 3GAKA 3UP8A 2B7NA 4GUIA 1EPVA 1NQKA 5A8MA 2OSWA 3PBGA 2D22A 2PFHA 3GR7A 3UZJA 1HG3A 1WOAA 1F6YA 1XX1A 4L56A 3AWNA 4JTFA 4O54A 3P93A 1SFSA 3KZSA 1TVPA 2XVPA 3P81A 1KBIA 1DQWA 3ARXA 1MSSA 5DBTA 5A6KA 1FCUA 3GTIA 1K70A 1GKRA 2DSUA 3QMRA 2C19A 3QY7A 3GWQA 5REQB 3J7HA 5JBDA 4B4FA 2HRWA 1RVGA 1SO4A 3L23A 1E4NA 2E7FA 2HNEA 1H7WA 4MJ4A 3ABXA 3WDIA 1ADDA 2YYTA 2NQLA 3S4TA 1SW7A 2XSXA 3ABZA 1JUEA 3UA4A 4GC3A 4MZYA 3W01A 2FHFA 3MUIA 3STFA 2ACSA 4GD0A 1B3YA 4ORMA 2JIEA 2YXGA 1LDCA 4C6NA 1QXLA 4HN8A 4N4QA 3HQPA 3S9ZA 4RV3A 3L0NA 2XIBA 2DSZA 5D09A 3O6DA 1ZU8A 3U5YA 5EY5A 1QNQA 3CUFA 1S2CA 1I2NA 4NNAA 2QDGA 1ZCOA 4ZTXA 1FWWA 4HQVA 3G1VA 5HJXA 1PKYA 4EACA 2CIPA 2QV5A 1GOIA 5AB3A 1PVNA 3MP4A 4WCJA 1WDRA 4LAMA 4LYRA 3NIYA 2GVEA 2XUCA 3THQA 1UD2A 4RZ4A 3NFUA 4PMQA 4BF5A 1M1BA 2BY2A 3G3MA 4JCLA 4X2RA 1JZ8A 3NQ7A 2WC4A 1MQRA 5DCDA 2OZTA 3PY2A 3GUGA 3NYZA 1DV7A 2VDGA 3NQVA 1ML1A 2O9PA 2X8RA 4CEUC 5G5IA 2DW7A 4P5UA 5REQA 3KDNA 2GWGA 2BOGX 2HNHA 1TQJA 3A9BA 3C2VA 3PUOA 2DQXA 2FFIA 1D3HA 1N2VA 1V3LA 2V68A 3VGHA 3CB3A 4HOWA 3K8LA 1ZBKA 4JFSA 4LS2A 4M19A 4A8NA 3AC0A 3QHMA 3MUAA 3VK5A 2G3MA 1TPB1 3VIJA 3PTMA 1H1YA 2ZUUA 3RRAA 4JN8A 5DMNA 5JMUA 3CM4A 2YB1A 1MMFA 4Q4PA 4V1YA 2YL5A 4CVUA 3C2FA 2XIQA 4O16A 3PPHA 3BDKA 1FWGC 2Z25A 4AB4A 1KTNA 2Z2AA 4YVXA 3C8NA 1AVAA 4UXDA 4JFWA 2ZC8A 1XCFA 1V6VA 2VZUA 2CLHA 1HX0A 3IJQA 3CL8A 3TYAA 1RBAA 2PDPA 1FHUA 2OLSA 1OCQA 3L4ZA 5C9UA 2NX9A 4MM1A 3OVGA 1NM9A 4B92A 2PTZA 1R2TA 2C18A 1JDDA 3UWQA 4GZ7A 3BAJA 3KOFA 4P8XA 5DXYA 4GGHA 4NU7A 1TIMA 4GH3A 1XIGA 3WQOA 3IRSA 3WG6A 5I07A 2PDHA 2P1FA 4P61A 2NVCA 2V5LA 5E0FA 1SFTA 1IV8A 3CMJA 3UR2A 4M82A 3VGFA 4MYAA 1GWJA 3NSXA 3ZLHA 1K7XA 3CV1A 1DOSA 3CYVA 1TPUA 2V0TA 2CW6A 3LBMA 3LCLA 3W6LA 1XH1A 3LXBA 3LENA 3AS0A 3HPSA 3H7VA 4NAFB 4YVPA 4MWAB 3A22A 1GOOA 3L9CA 1YTDA 4O0KA 3VOHA 3LI1A 3MVIA 2DUZA 3DIPA 1KKRA 5M1TA 4Z1DA 5LIUX 3G1YA 1GVYA 4CD6A 4JTLA 2I9EA 3N9SA 2P5NA 3OOQA 1RALA 4DJED 4LF2A 3B8SA 2PSNA 1EJUC 3L12A 3O1NA 3KBNA 1PYFA 3BL3A 3BUVA 3EPMA 4WKAA 1FWIC 4M51A 5E1QA 2Y62A 3CHEA 1KM4A 1JL8A 1WAWA 1HL2A 3WF2A 1CB7B 4UTTA 6XIMA 1W32A 3UA3A 1K8CA 4B90A 3C3NA 4IIEA 3ARPA 3MMDA 3ABRA 4QAIA 3JW7A 4DJFD 2V3GA 2RGMA 1I1WA 5A8OA 3R2GA 4LNYA 1D9EA 2YKKA 1RXOB 3PULA 1QJWA 1WXZA 1OFRA 4YTRA 4CNUA 4I9MA 1W37A 3W86A 1AH4A 4QS6A 1DIOA 5A95A 3OZOA 2NSOA 1P6BA 5DX7A 2GJLA 3B8WA 3ICJA 3MCNA 5DELA 5A5WA 3ALGA 1MEIA 4IWWA 4WIWA 1QWGA 4LVBA 4IQEA 4XBJA 3U2ZA 3PG8A 3LMZA 1LQAA 3VD5A 3W26A 3HV9A 2P10A 4B91A 1UPMB 1EUNA 4O10A 3R25A 3G5EA 2R1LA 1QNRA 4Y9MA 1EEPA 1EWEA 4WOZA 3EA1A 2CLLA 3I7RA 3LERA 1FWTA 1A0DA 3C2OA 5LIWX 3VZXA 1XJBA 4WJEA 3NL6A 4PUJA 4UQDA 1NQ6A 3QQWA 3HGOA 3R0KA 1H63A 1W6TA 5H8UA 3WJZA 2DT2A 3EWDA 3GIPA 1GPWA 3FSTA 3Q65A 4H6QA 1ZAHA 1HJSA 3FW6A 2F6XA 1JGIA 2A4AA 1TZ9A 3TJ4A 4EPBC 4GXMA 1LL4A 1BF2A 3N2XA 1XP3A 4XD5A 3CL7A 5CZ0A 5FACA 3NZGA 3C8FA 4PCFA 4GO9A 3LCGA 5LGZA 4P7LA 2HSAA 2C15A 3M7SA 3QFWA 5DANA 1EJ7L 1XIBA 3L4VA 1XYMA 5GNXA 4PH6A 4IP5A 2WB5A 2WVUA 3O06A 4JD4A 3ZR6A 2WLYA 4C7FA 1OX6A 3N9KA 1H61A 1QPKA 3VIMA 2VQTA 5AFDA 2Z00A 4TX9A 2V9DA 1A3WA 5JVLA 2D23A 4M29A 7ENLA 1TV7A 1OCJA 4C91A 1I2PA 4Y9AA 1C7TA 1T40A 3MBFA 1UC5A 4AU0A 3ITXA 1R46A 4HA3A 3MSDA 3WLHA 2EPKX 4C65A 2AQWA 2E40A 2OKTA 3R6IA 3EWUA 4QQUA 3CV6A 3F4VA 4HJWA 2E1WA 4OOZA 2QJJA 4GQGA 3TXZA 3EXSA 3N14A 3UWWA 2ZKMX 2QPSA 3MVTA 2AAMA 3PJXA 4XUYA 4FX7A 3IVTA 3GZ3A 1HKVA 4UMCA 1EL3A 5CSRA 1TV3A 4ALDA 1H51A 4BI5A 5A8PA 1B3WA 3SRKA 1WV2A 1H49A 3U57A 5B80A 2JQXA 3QN3A 5CZJA 2BS9A 1WZMA 3R12A 4WDWA 4K7YA 3EBVA 4GIAA 4PTVA 2VOMA 2GQAA 2J9ZA 1FP9A 2QEZA 2GVGA 2WCGA 4AZ6A 1QBBA 3ABOA 2ZCGA 4OT7A 3W1NA 4Q8VA 3M44A 3W07A 1E1EA 2VQUA 2VFDA 3GX9A 3ITVA 2ZUTA 5C54A 4UQ9A 3PZQA 1JCXA 1THFD 2Z1VA 4ZQNA 3R8HA 2C14A 1DHKA 3KRBA 4D8LA 2EEXA 4AD0A 3IJ7A 1XWYA 3CUJA 4JKKA 1HFBA 2X1UA 4JDYA 1KBKA 3CZLA 3SUSA 1YADA 4GIYA 1ICQA 4I5UA 2YDSA 3LM7A 1FKWA 4BQ3A 3I7SA 3TLQA 2P0OA 1HN1A 2R9RA 1U5HA 3N3MA 5CSSA 2C3ZA 1AW5A 1BXBA 5FF0A 2X7VA 1NDYA 2GLKA 1FRBA 3QW4B 3TFXA 4UFIA 4U10A 1WYIA 4H83A 1VJIA 4AX7A 2KAUC 4RNJA 3EB4A 3EWBX 3DYPA 3GK0A 2ZZ5A 3I3BA 2XG9A 2H3DA 5D9PA 1Z69A 1JDCA 2AGTA 2O9TA 2ZE3A 3KW3A 1YIXA 4FXFA 1ESWA 4BZYA 3L2MA 3ARQA 3XISA 3A4XA 3LEPA 4FXSA 3G2GA 1UH2A 2G4JA 2EHHA 3GLCA 4GCAA 5B7YA 2XJ7A 5D2YA 2CITA 4DO6A 5D8ZA 3EMCA 5BRPA 2ZXAA 1RHCA 4H9VA 3UJSA 3I6RA 2ZADA 3GNOA 1WZAA 1UKOA 4RW5A 3HGRA 4KRZA 1NAL1 2O56A 4W9TA 4AIBA 4LJ3A 3VMNA 3WJWA 4UQBA 6ALDA 2HCVA 2X0SA 3OG3A 3N6QA 3W00A 2VX5A 2WZTA 5TF0A 1W1PA 4HMEA 1G4SA 3P62A 3AUJA 1YW1A 1KO0A 1QPNA 3GHUA 5MHBA 5FJPA 3IJIA 4FPSA 3U7VA 3CIVA 3PJTA 5G4WA 5I3GA 2ZX8A 3SCWA 2I57A 3MDUA 2CLPA 3KHDA 2TODA 1UZDA 4O0ZA 3PM6A 2E6YA 1XYBA 2NW0A 5AYZA 1DYSA 3PTKA 4LUYA 4AY1A 1CPUA 2OJPA 3NDZA 3ZOAA 4ZQMA 3HPZA 4HPNA 4E8DA 4JQ2A 3LCXA 5BWAA 5G2HA 5FEXA 4RR4A 1M9HA 1CGXA 5T91A 3F7JA 4HNUA 5K4ZA 2CBIA 2NWSA 4U5KA 3W73A 4O1CA 4RCXA 5AKQA 1LBFA 1Q2RA 2HXTA 4M7SA 3F5LA 1JPDX 5HQMA 4AMCA 3SJNA 1KBLA 1VBUA 1FWFC 2XH0A 4S2BA 3P14A 1YTEA 2DSWA 3U7BA 1W9VA 2W92A 4OIFA 4CNSA 3TROA 1US3A 3ARTA 1PKNA 3IIZA 3O15A 4S3DA 4FX6M 4JTDA 4H7ZA 1P0NA 3B0VC 2WNZA 4PUMA 2XSAA 4PTWA 3WX7A 2NXHA 1VEPA 1YLVA 4FX8A 4J4KA 3CQ0A 2FHBA 2OEMA 1TWWA 3TYZA 1Q6OA 1PZ1A 2XH2A 4MLJA 2G95A 2WMFA 3ITGA 4B2DA 3DBPA 8CGTA 1XXXA 4O1EA 3C0LA 3IJLA 4C7GA 5C8BB 3NQBA 4ZOEA 2PLCA 4EX4A 4BHYA 5I3FA 5IRPA 2BSLA 3GR4A 4JHZA 1VBJA 2E4TA 1OC5A 4YNGA 2VX4A 2FZMA 2OQHA 2QCCA 1W2PA 2DUAA 3HV8A 1LLZA 3W1AA 2FIQA 4C6LA 5D2XA 1Q3NA 3M5VA 2NV2A 3WDRA 1QOQA 4ZR8A 5I0DA 4W7UA 1HO4A 1UG6A 3UZ5A 4UR8A 4PMXA 2PLJA 1W9BM 1O5RA 3BWWA 2W63A 3G0XA 3E5PA 4IM4A 1US2A 3VFCA 4DJDC 1HKJA 2FZ9A 4O28A 2OPJA 4GI4A 4XUGA 3WZ0E 1PZ2A 2ANUA 1ISZA 4EVZA 2Z1KA 5LIKX 5C2GA 4M1RA 1K9EA 1GEQA 3W4RA 1UD5A 3NUKA 3QHOA 4EPDC 5I5RA 3JU2A 1IGWA 3CQJA 3BMWA 4QSFA 4S23A 2IS7A 2WW5A 1H7RA 1XSIA 4B9ZA 3HMCA 4E2OA 2IPJA 3WIJA 2I5GA 4DJEC 2FQIA 2RGLA 5CG7A 2GUUA 1FHLA 1TJ1A 1HQTA 2P3ZA 3GXFA 3R7MA 3SM0A 4EWND 4HYVA 4AF0B 1LLOA 4C6OA 1A50A 1B30A 4ICNA 1JYWA 3AZSA 4MB3A 2ZRXA 3DKLA 2YW3A 2CCRA 3IGUA 1T7LA 3QV6A 1T8XA 3QLDA 3LCWA 3ZT6A 3W38A 2O7QA 4S3GA 3PJUA 4ATWA 4NX0A 2OT0A 4I7UA 4X9YA 2R8WA 4ACZB 4HT3A 3CK5A 3VGBA 4PCTA 4DJFC 1VB9A 3MKCA 3IUHA 1SZEA 4NG3A 3IGXA 4UQCA 5LIXX 4PUWA 4AIOA 5I00A 3SIMA 1ZUAX 3W27A 3NDYA 1M7XA 3S9IA 1KCZA 2G41A 4TVCA 7A3HA 4HKPA 3TMQA 1ONRA 1J12A 3WD2A 1W3LA 3VIFA 1PO9A 3PBYA 4GIRA 5AHIA 1OIFA 1J5TA 1W1A1 3OJGA 5GJNA 1BTMA 3OVQA 1OJXA 4DWDA 3P0WA 2NX1A 2YFOA 2W6RA 3RFAA 3HA1A 2DY3A 3VO0A 2ISFA 5HAOA 2VCAA 4X61A 5G1TA 1A0EA 3V18A 3ZXWA 5EFDA 1NF7A 5HWNA 1BRLB 2IKJA 4L6DA 1O95A 3EOSA 3NOEA 1VZWA 1TCMA 4IMGA 3NURA 5JBFA 3SRHA 1TWSA 3TW7A 5C71A 1CBGA 2YXXA 4WY0B 4ERGA 4LUSB 2ZWYA 3ARSA 2QAPA 2QR6A 4UOJA 1FKXA 4HNNA 4CQDA 4AF0A 2FZ8A 3CTTA 1D7KA 3KUMA 1XH2A 2G97A 5EL1A 3BAKA 3DYOA 3AMCA 1UPPA 2AQOA 2QCDB 4EPEC 2XFWA 4CCCA 3QW3A 3I65A 3G3DA 1KFCA 3H26A 2J9YA 1E3ZA 5D02A 4W86A 5HATA 1KCXA 2VZOA 2E8YA 3QV8A 1EQPA 3AAMA 5LGXA 1B54A 2CC0A 3PZGA 3A3XA 4NZJA 2YCIX 3FDGA 4IFKA 5AHEA 4J2PA 4F0SA 1XYZA 1NSJA 1JZ6A 1OZQA 1IQ8A 4MHBA 4BWLA 2PDFA 4I90A 3B8TA 3HOJA 4N42A 3NQDA 2FTYA 4RJEA 3QR0A 5HOSA 2XWDA 4C6QA 3NQGA 4FHAA 3DCPA 4XZIA 3O8AA 3K30A 3DFTA 3SBFA 4DNMA 4X63A 1O5KA 2XZ7A 1V77A 1P0EA 2CNCA 4HK7A 4UR7A 2Q02A 3UGVA 4L5ZA 4PMOA 3T08A 3UG5A 3B8IA 3CZKA 4S3KA 4C6MA 3WK3A 4NSBA 4GKTA 3SURA 4ZQPA 4ZOAA 2VEFA 1AODA 3MUZ1 1VBRA 3SZ8A 2ZDSA 3LA4A 4E4UA 3P5YA 1KLZA 1BRLA 5MKGB 4OBSA 4D6GA 2WLZA 1O1HA 2BVWA 3QM3A 3HIJA 5H1WA 3FFSA 1UA3A 3L5AA 1DXEA 4LUSA 3AIBA 3U4AA 3WLNA 2DZBA 3QKZA 3VX0A 1LUCA 2J62A 3W7LA 3PP7A 4TVUA 4WF7A 2VEIA 1SJAA 1C7SA 3FXYA 4Z2LA 1W3HA 2V30A 3GNNA 1JUKA 2PDCA 4UCGA 3EPNA 2PP1A 4XG1A 1KR0A 3DFYA 1FOBA 2QCDA 3KCOA 4Y8FA 3G6LA 4UQAA 1E9IA 3ES8A 4P7OA 4LS1A 2EQDA 2VRJA 3P60A 3LYEA 1AJ2A 2J66A 2UBPC 1G67A 1V3HA 3HFTA 1UMLA 1EDGA 1JZ5A 2C79A 6TIMA 3LLXA 3H24A 4ZXOA 3BMXA 4AD2A 1KV8A 1J6PA 4GRSA 3JUGA 1BGAA 2TRSA 1K4GA 3CIWA 3TMLA 4EOUA 1SJBA 3T8QA 1PIGA 4PFMA 1SR0A 4GABA 3S47A 2VI0A 3MJMA 2XGZA 1X8FA 2C1IA 1SPQA 5EMJA 1FUYA 5LA0A 3UWEA 4OUEA 2QJGA 3BLIA 4H8VA 2QDDA 4KEVA 1XQKA 1I2RA 3M0IA 4Q4RA 1VFUA 2V63A 3NSNA 3NQAA 1JDFA 4LVFA 3PZVA 3OZPA 1H7PA 4WKHA 5J04A 1HL8A 2ZUNA 5FKYA 1CGVA 3MZNA 3V3WA 4I5RA 4H9MA 1LM1A 4Q8TA 4W8BA 3SB0A 4HCHA 1IF2A 1LTDA 3AMGA 1OFPA 3AOFA 5DO8A 3M5ZA 3GG1A 4DLMA 3UCDA 4HZ8A 1UASA 1R8LA 3HZ3A 4LY4A 4GOAA 5F2MA 3EA2A 3FK4A 4US5A 4Q7IA 1XG4A 2XDFA 4NQ1A 4GFIA 3TTEA 2QYGA 2ZC1A 4F0HA 5FF4A 5D9MA 1ODUA 1XLFA 4LQ1A 5FL1A 5EMYA 5J5DA 3GXMA 4PB4A 1JUBA 2PZ0A 1DQXA 1Z7AA 1VD6A 3GFXA 4WY0F 3VNZA 3WNNA 4Q8WA 3AMDA 4AXNA 3E49A 5FI8A 5A6LA 3S46A 1ITXA 1W0MA 3P8IA 2YBUA 2BDQA 4HU8A 4FIRA 3URNA 4PTDA 2FYMA 2HV5A 1TMQA 1XRSA 1S1PA 3UJRA 1QT1A 3V1HA 4EXQA 1E15A 1ZFJA 1KM2A 4FOJA 4OOUA 3VKBA 5CKSA 1MFUA 5I7GA 3W75A 2VM8A 2HWGA 3LOTA 3CUGA 4ADSA 1KB3A 3H7RA 3POHA 1U22A 3CV2A 5ABEA 4KW2A 4IG2B 4C6IA 3ITLA 1TQXA 1X6NA 4JIPA 4IOTA 4A3RA 4WGHA 1R7AA 1UKQA 4DBDA 5LNUA 3WF4A 1SW3A 3VIKA 2OXNA 4HB7A 4KWWA 1W1ZA 2CBUA 1UR0A 3W2NA 3QQ1A 1XINA 3EMQA 4JTTA 4NJHA 4IGNA 2Y5SA 4BEQA 1MDLA 2X42A 4LUIA 1NWTA 4H4IA 2RJGA 2Y24A 4MY8A 2PDLA 2G3FA 4TX6A 1DJIA 1OEPA 3V0SA 3W76A 2OYLA 4O4VA 4ZFMA 4EIVA 3GW0A 4IJRA 4A35A 1YBQA 5D9NA 3PUDA 9RUBA 4WK9A 3BG5A 5D8WA 3OB8A 3GS6A 1L6FA 3URBA 1O60A 2B0MA 4IMAA 1TJ2A 4LAKA 2RAGA 2WZIA 4MDOA 1XD0A 4CQ8A 3PSWA 2AGKA 2V69A 8RUCA 4ZO7A 4B2DD 3CZEA 3G8RA 4X0VA 5JBEA 2WXDM 4QQ3A 3RDKA 1R30A 1VRDA 4XD3A 5FJRA 3QOMA 1XIFA 3IGSA 4GUGA 1H3GA 1M7JA 2O9RA 5DBUA 3BCJA 1ZAIA 4OHQA 3OQ8A 5EB8A 4AZCB 1B0IA 1E9YB 1PTAA 3WD1A 4DZIA 4IG2A 4XVDA 4IPLA 3RU8X 3N4AA 4GJIA 1EDTA 4HMNA 1SGJA 4EP8C 3ZT5A 3AICA 1ME9A 1WNOA 2AKMA 1XG3A 2JIWA 3DAQA 4K8EA 4L4LA 4DEFA 3ISIX 4F4RA 7TIMA 5A94A 6ENLA 3FEMA 4MJMA 1POJA 3MY9A 1EF2A 9CGTA 1W5OA 2XINA 1MNSA 1D3GA 1GTEA 4I9JA 2BVDA 1W56A 4JQ3A 1QASA 2ESCA 1GYLA 3LZ3A 2NLYA 1Z6KA 3AXIA 1B3OA 1S5MA 3IK4A 3IPWA 4O1DA 1SVDA 3F4WA 4YJ5A 3IGHX 2PF8A 1JZ7A 4MG4A 4W5ZA 3N2MA 1A49A 1K9TA 1Q6DA 4KS0A 4MFDA 1KW1A 3GQYA 4YN5A 4AQLA 3WEMA 1SMAA 3T78A 1KBBA 1T5AA 4GI8A 4Z1AA 4IMCA 4Q4MA 1JNDA 3HGJA 4GNVA 3UQNA 4ZZ9A 1W91A 2ZRWA 3TNOA 1QK2A 1UZ4A 1YPXA 1RQHA 2ICSA 4F66A 4W4QA 1ADSA 1LRNA 2GGJA 1OFQA 4PR4A 3WL1A 1XYLA 5CC6A 4UTTC 5IOBA 2WKLA 1KXTA 1CIUA 3SCTA 3BLFA 2B4GA 1NJJA 4DN1A 4B5TA 1X38A 1AFSA 1ONEA 1VPYA 3CZGA 6A3HA 1LBLA 2NXIA 3NZPA 3L5MA 3QEZA 5CG0A 3SFKA 1EYWA 2VHLA 3VD4A 4YXGA 4M7TA 2A3LA 3PBWA 5EBAA 3VNJA 4JFVA 1F8IA 4DNHA 3MA8A 1Y65A 3AI0A 1GT8A 3KS6A 4GC4A 3RR4A 3PAOA 5HMEA 2I17A 4JTEA 2ZZ2A 1XLMA 3UETA 5T9CE 3APYA 4X0NA 2HISA 2VKZG 5A69A 1F76A 1YHTA 2CZDA 1UP2A 1HTIA 1KCKA 4CQ9A 3HFYA 3BZGA 2C6QA 1D8CA 1VJSA 4KKXA 1KXHA 2Q09A 2RUSA 1DKWA 3WLOA 4ATDA 1DEDA 3IRDA 1WBJA 4G56A 3UPWA 4QEEA 4B3LA 1LYXA 5AZ1A 3SW6A 4DM2A 2P0IA 1WA3A 1UOZA 3GVGA 2DV0A 4YPJA 1US0A 1EIXA 4FF5A 4PRRA 4UQEA 1PX3A 4BQ5A 1W3NA 4UNKA 4MUZA 1M04A 4N4PA 2GJXB 1B9BA 3PZMA 3LNPA 2UY5A 3MC5A 4RDYA 3K1GA 2D1ZA 4LRSA 5IFPA 1CLVA 1ME8A 2WHKA 2W67A 1J0HA 4MJZA 4PL2A 1MW2A 2G0WA 3I4KA 2HEJA 3H4GA 2PZNA 4RDZA 3I4EA 1BHGA 4JTAA 1X7IA 1P43A 3A24A 1N8WA 3B40A 4LCSA 5BOEA 2D69A 4BKNA 1D8WA 4XO6A 3LU2A 4LUTB 3LG3A 1S1RA 3TKFA 2EKGA 3D3AA 2QAFA 2BHYA 1UWSA 5BU6A 1GEHA 2HS8A 5K2ZA 3EDKA 4Q33A 2WK2A 1ZHAA 3RLHA 4W85A 2ZYFA 2Z0IA 1PCWA 1PKMA 1C3FA 2ALRA 1EHAA 3F5KA 3VDAA 3QYSA 4ZMGA 3WMLA 2IKGA 3QBUA 3LPOA 2UY2A 3WO8A 1VKFA 1P7TA 4I9TA 5M17A 3PJWA 1TJ0A 3QPZA 1TFVA 1LT7A 2J7HA 4P8WA 5M5DA 4PUNA 3QPYA 4E2DA 5E93A 3PANA 4OVXA 3ZFHA 3RRXA 1OFEA 3SSJA 4A05A 1XGDA 3UW6A 1KV5A 2GJXA 3BTNA 1JAKA 3GNPA 4YVVA 1JEZA 1SZNA 2GDQA 1FHVA 1I2OA 2TPSA 1QWKA 2V67A 1SSDA 3CYJA 1ZBCA 4ZENA 3ANYA 5CPLA 1DWIM 1YXYA 4UNLA 4H8HA 3MSYA 2FPYA 1FWEC 2HE5A 3LV6A 3R58A 3LXCA 4M6UA 1O6IA 4F2BA 1TZZA 3W22A 1XFCA 1ZNNA 4W8AA 1UBPC 2PRLA 2RHGA 1EJSC 1FWDC 4DBWA 3QGVA 2YYUA 5C2CA 1ONWA 4K8GA 5A6JA 3S2MA 3AYRA 5EMUA 4JQ4A 2CXGA 2VR5A 2IQDA 3JS3A 5EYWA 1R3VA 4NYYA 3R89A 3WKZA 5HK4A 3MANA 2VEKA 3E2RA 3N15A 1JRCA 2DT0A 3DU0A 3FYOA 2BWGA 1TJPA 3FN9A 3GVWA 1U5JA 3GZAA 1EJWC 1W31A 4W5UA 3KBJA 3IJDA 4TMCA 1OX4A 3IV8A 3T40A 1EJVC 5EU9A 6REQB 2W5FA 4US5D 2VC7A 3QVQA 1F07A 4GFSA 1HIZA 3OA3A 4A3HA 1UWUA 1HKWA 4S3JA 2VUNA 2OLHA 2CESA 3XIMA 4L61A 4BF9A 2XH7A 1B57A 4PUKA 3N9RA 1MFVA 2D24A 2V5JA 5T9BG 2REQA 1Z9AA 4YHEA 1U5VA 3TYCA 3USZA 1HKKA 2FH8A 3O7UA 3GVQA 3O3RA 1QW8A 1XIHA 4HPXA 4GYKA 4A3YA 3POCA 1GG0A 1BXCA 2DGAA 3V35A 4WGXA 4R27A 2X30A 1Y5WA 1AZ1A 1O68A 5HR6A 4IH3A 2PCQA 3SFWA 1V7AA 3B9OA 4Q6XA 4AEOA 3AFBA 1CYGA 4G6CA 3M0ZA 1W9UA 3WMCA 3WUGA 3NQMA 3OG2A 4IUGA 4K36A 1F7BA 2CZFA 2WKJA 3SGZA 4CUCA 2XWEA 1XBYA 5TBOA 4RE4A 1Y5VA 3T2QA 4GNKB 4EPKA 2ZBTA 3WLTA 4LRTA 5TIMA 3KDOA 2I14A 3NJ3A 4JIRA 4M6QA 1W1B1 2WMIB 1YDVA 3QH2A 1AUSL 1ZCCA 2BBFA 4FXRA 3VNLA 7PTDA 3V75A 3O0KA 2VX6A 2MNRA 3L0GA 4DZAA 5C9XA 1F5ZA 3WBXA 1W5NA 3FJ6A 4NAEA 4FOKA 2OWWA 3W1MA 2W0UA 4UCFA 3VZYA 1MQQA 3GBEA 1XKJA 2YW4A 2BOEX 4MLRA 1Z8AA 4GXWA 1JF6A 4ECLA 1Q6LA 4GX9A 3E2QA 2WZMA 5AC7A 4BK9A 5HA7A 2VRQA 3BGJA 6REQA 1Q6FA 3FOKA 1TMHA 2Q01A 1TUFA 2ZUVA 4RNHA 1WO2A 1PDZA 2ZZ3A 1QDSA 2NXGA 1J0YA 3TSDA 2DP3A 3RCNA 4Q8OA 4ZO8A 2ZUWA 2A6LA 2ACUA 3F2DA 1RP9A 4JTHA 2ZTJA 2ZICA 3SY8A 3SQMA 3WQFA 3DG3A 2FMNA 2DZWA 2P8BA 1CX9A 1HVXA 3TW9A 1W3KA 2BGQA 4JHMA 3MYPA 3SCVA 4XZNX 4A3UA 3S0CA 3OYZA 1YE6A 1I75A 1XISA 4AC1X 3N29A 4Z2IA 1JDAA 5CAHA 2WHJA 3VDBA 3ZLFA 1X1ZA 2FVLA 2PWFA 3TE9A 3UPBA 1V3JA 2GOKA 1G69A 2BXZA 1XC4A 3FDKA 3VKDA 2NUXA 1NFBA 4JTQA 4C6DA 2GDVA 1DE5A 2EJ1A 1W2VA 2JGQA 2WMIA 2OEJA 2IUZA 1SJCA 4DBUA 1M3UA 1AH3A 3R0DA 3TX9A 2X0YA 3M43A 3G1SA 3N19B 2FLIA 3HURA 4UTFA 3KL5A 3CLWA 2VWTA 2LLEA 4TO8A 1NH6A 4H1ZA 4KH2A 3T4CA 1UWQA 3VOIA 4IT1A 5CGMA 5HUOA 3E2SA 4L1XA 2PDXA 1ICSA 2ZXDA 1N8FA 1RSCA 1SM9A 1GW1A 4QLKA 4JFTA 1GQNA 2INFA 4NUWA 4PN2A 5FEZA 4DLFA 1KC7A 4OFCA 3BZJA 3W7CA 4Y8EA 5FJIA 1IEXA 3NDOA 1BYBA 4Q32A 1RPXA 3CGTA 1HVQA 2J7DA 4AHQA 5RUBA 1J0IA 4GUJA 3GM8A 2GGHA 2E5CA 3RYSA 4A3QA 7CGTA 4WDXA 1EGVA 3VINA 1E0UA 4QIUA 2HBXA 2Y7DA 1WKDA 2CLEA 1U33A 1GOXA 3F5JA 3A4JA 1ZLPA 2FPTA 3NOYA 4O1AA 3HJEA 2PDIA 2A7RA 3IIXA 5KETA 5IDZA 2WC7A 5FL0A 1CXLA 2YA2A 1OABA 1T8QA 4DBSA 1AQFA 4C1NA 4V15A 4C6EA 1FWSA 3B3DA 4B9YA 3L21A 1IIHA 4GCXA 5DY3A 3FJLA 4NNCA 3R94A 4LVGA 4QGCA 3UBPC 4LXFA 5BXRA 3BGAA 1VENA 4NRSA 1D3CA 2POZA 1KFWA 1UHVA 1W5MA 1ODZA 4ADUA 1MDRA 2XHYA 1LORA 3TV8A 2CPUA 3VDHA 1J0ZA 3WNOA 2ZIDA 4DIAA 4Y9PA 1MRAA 3B0YA 4JIQA 3IUIA 1IYXA 4ASTA 1J4EA 1YX1A 3ARUA 4XX6A 1PWLA 2XM1A 3PPGA 3VCCA 3VDGA 3L66A 5JXQA 3NGFA 3P61A 1A5SA 2BHZA 2HVOA 2QS8A 1MUMA 2ZFAA 3WUFA 3PHAA 2E6FA 1FP8A 3M0JA 1XR2A 1TR9A 1TVLA 4D6FA 4YIWA 1V6WA 3H22A 3TSBA 1TZ7A 4XBSA 3G1XA 3NM1A 4WHBA 5KZ6A 2YBVA 4GVFA 5G4EA 2GQ8A 4HHPA 4IMFA 4O57A 1KD0A 4Z08A 4OQVA 1V3IA 2Y7EA 3NWRA 2W79A 1S3HA 1ZTVA 4NJJA 1B3VA 4TR9A 3SCRA 5T8GA 4H2HA 2O0TA 1SZGA 2A3CA 4YTSA 1EHNA 4IX0A 1S2WA 3UYCA 1GUVA 1H62A 1VR6A 1J6OA 4GQ0A 2C13A 3MWAA 3ZWTA 1UR9A 3TONA 2DH3A 3NM3A 4LNCA 1DL3A 4BWLC 5A2CA 5CPSA 3A9IA 1F3WA 2Y88A 2E9MA 1KWGA 1W5QA 2WJDA 2HVMA 4UUIA 4Z0SA 4LCRA 3EB3A 3ZIZA 3B0XA 3KM8A 4D8AA 1V79A 1OT2A 3QZ6A 2Y5JA 1PIFA 3N2BA 3WBYA 1UWIA 3U8GA 4Z1YA 1A5NC 5DT7A 3F03K 3VIIA 4R88A 4AZIA 3AJXA 3TAKA 3WLMA 5DRCA 3T44A 4O13A 1QNSA 1EX5A 4TUFA 5JU6A 3BC9A 3EX3A 4KWVA 4HSOA 4DELA 2Y85A 3KVLA 3RPDA 5K9DA 5F4SA 5MF5A 3V0UA 3SO7A 1CECA 3V0TA 1R3YA 4M56A 3BW4A 1U1UA 1ZBVA 2PI6A 1ME7A 3NQEA 5C2XA 3EOUA 2QIIA 2BTMA 2R1KA 5KZEA 2PGEA 1JD7A 2R91A 3FJ4A 3GTFA 3LBCA 4Z17A 4UFKA 5GVJA 1KLYA 1AA1B 2Y8KA 3CPRA 1EPXA 1QO5A 2VGFA 3L2LA 1BKHA 3EKLA 3TDFA 4WEVX 2YDAA 2ADAA 1DTNA 4TMBA 4OUIA 2O7SA 3GXTA 2VNCA 3JVAA 3IVSA 4UTKA 3W53A 2OLAA 1W5PA 3DN5A 4L64A 2VELA 4GVIA 2BY3A 3W7IA 5DEZA 2XH4A 4MDPA 3NZQA 1AMKA 1PCKA 4RPPA 2BMBA 1YDOA 1NP2A 7TAAA 1JF5A 1ECEA 1EO7A 2PDUA 1E5JA 5CPQA 2L5HA 4HYRA 2PWVA 2G3NA 4PMUA 5AOUA 2PRMA 1VPXA 1ZENA 4UBPC 3RX4A 3KOWA 4PUEA 5I3IA 3BSGA 4NXKA 3I10A 4LU0A 3U2CA 3DZ1A 1PKLA 3C5QA 4F48A 3CWHA 4MOZA 4AVFA 2PRHA 5TD4A 5DF0A 1M7PA 4XIMA 1L2UA 4BI7A 2YA1A 4PBGA 1OK6A 1GK8A 4FO4A 2OWXA 3WYZA 4D6DA 3E5BA 2XFRA 3G1DA 4HOZA 1EEXA 3LM3A 4EK7A 4WR3A 3B4YA 1HZYA 1KCLA 4HCDA 2A0NA 3WENA 1TELA 3TTYA 2GQ3A 3WQGA 5I09A 1LOSA 1Q4NX 2YCEA 3LSCA 1K6WA 1A5OC 5KSWA 3AIEA 5E5CA 4JIHA 2J8TA 1XIEA 1NFGA 3NEVA 3W7QA 4WSHA 3STGA 3B9NA 5D9OA 1XUUA 3EKGA 1DWAM 3M0VA 3K4DA 1H7XA 3TYBA 3WQWA 3GTHA 3FAXA 3V1PA 1KTCA 2FHCA 3HU7A 3ZVHA 3DYMA 3VC5A 4AHOA 3MV01 3R5EA 5D30A 1JULA 4QTGA 3W2MA 4UTWA 5LA1A 3T07A 2Z4GA 1JGMA 2FPVA 3GIQA 3VNMA 2HTMA 3DFHA 4PRWA 1REQB 3AJ7A 4ONVA 1NELA 4R9XA 2BY1A 3CXOA 2Q3OA 3P74A 1OZMA 2DFAA 1BAGA 1JXJA 4LH8A 4CCEA 4DWSB 1GCYA 1K03A 4HPJA 3AHXA 4G1KA 3UYIA 3GAYA 4LT9A 4JTSA 3RN6A 4J28A 2DZVA 4XSMA 5E0KA 1DJNA 3TC3A 4IISA 3R8GA 4ES4A 8XIAA 4XB3A 2PDYA 4HU4A 1CGWA 3AO0A 3S9YA 2J78A 4N9BA 2PMQA 1LWJA 2X2YA 4FZIA 1BVWA 4TX8A 4D9PA 2DZSA 2OSXA 1WDWA 8A3HA 5I06A 4ZBCA 2C71A 3OVPA 2NQHA 1O4UA 1D7FA 1W1VA 4K7VA 3RCYA 2QVHA 4DO4A 3C0QA 1QHOA 4GA8A 4PB3A 1DWJM 3FX4A 4WUIA 1MXDA 2KZHA 1TTPA 3TJIA 2YLAA 5JIPA 1K1DA 2PCEA 1OX5A 1CXHA 3OZMA 1E6QM 3UG3A 1OT1A 4M3PA 1M01A 1XL9A 4GBDA 4I7VA 4L80A 4C60A 1Q8AA 1JCNA 3TC7A 3CHDA 1J93A 2WMGA 2QXWA 2YFNA 4I7WA 3OLEA 4FLOA 1J01A 3AHZA 3FA4A 2NVAA 3A47A 1RJQA 2PTYA 5ABGA 1ZALA 3E12A 3M47A 5FA5A 2PA6A 2P50A 3HMJG 5AC5A 1Q6GA 1NFPA 3THCA 4V27A 4IFOA 2ZZ4A 4YTTA 1CWYA 4DWSA 2OVLA 3MV11 3UXIA 1KRMA 5AVHA 5I79A 1HP5A 3U0HA 2O4MA 2WMHA 2VP8A 3P84A 4O15A 3OIHA 5XIMA 5F2GA 1TCDA 4AEFA 4OBTA 1KM1A 1IT0A 2QQ6A 3BO9A 2VD9A 4N9EA 3W2JA 4CLMA 4HD5A 4QJ5B 3KBVA 5CQ1A 1OBAA 4MZ1A 1OGGA 1XSKA 1I6NA 6PTDA 4AD1A 3DESA 4NXSA 4JIIX 5AC6A 5PTDA 1SFJA 1LRQA 2QDEA 2QVNA 4BA0A 2PWHA 4AWTA 2CZ5A 3OGSA 2YCLB 4BFAA 2ACRA 4GYPA 4QX4A 4GLEA 2DVTA 4LALA 2GK1B 3PPFA 1BYAA 3CWNA 3JZEA 4Q7NA 1R3RA 4B15A 2VT0A 5D32A 4G1NA 1B4EA 1RAKA 4Y96A 3IANA 5KITA 4JTRA 1BSIA 4JYFA 4JX6A 3VD9A 1M65A 3EA3A 1G0CA 3D0CA 1AJ0A 1Q7MA 1IHIA 5LIYX 3DGRA 4JN6A 2Z7GA 1YPIA 1IXNA 4IPNB 4ERIA 3GD6A 1Z41A 4GISA 5C9ZA 2EPHA 3NO3A 2X1IA 1UWAA 4GQBA 1AW1A 4P8VA 1K3UA 2CZEA 2PDJA 2BP1A 2G3IA 3FGCB 3GO2A 4G7EB 3W7EA 3GG0A 4MYXA 3VNIA 4QP0A 3B4UA 1GHRA 3EEGA 3PZNA 4JPGA 1ZB5A 3ZLGA 4Q8UA 3KTSA 4J7RA 1WX0A 1DJZA 4B5UA 3VAVA 3S3GA 4QEHA 3LXAA 4IGHA 3HQNA 4QFUA 1CZ1A 1CXIA 1UWTA 3KCJA 2DZPA 2A3HA 4BR1A 1R5YA 3NZ1A 1FWAC 1XYCA 2EPOA 3PUEA 3B0PA 3MP3A 4NYUA 1VFMA 3CO8A 1ALDA 4FR6A 3KFTA 4NNBA 2FTPA 4IPIA 3SY1A 3GXDA 3KL0A 2YSWA 3K1DA 1SQ7A 2QMJA 4QS5A 1JD9A 1FA2A 2V2CA 3DC0A 2PLKA 4I6KA 3OIXA 1LOLA 3AIRA 4XTIA 3ARYA 4CN1A 1KFEA 4C6CA 4L1GA 4RZ6A 1QOPA 3WQ6A 1LJYA 2YL6A 4PUUA 3W71A 3C2YA 4DXVA 1E0TA 1FDJA 4KESA 1V3KA 1S46A 2AL2B 3G6MA 3G24A 3S83A 2GWNA 4HOXA 5XIAA 2WAGA 4HYWA 1VLWA 3EX1A 4RL3A 3JZUA 1H1NA 3VKJA 1JI2A 1E6XM 2R1NA 4JEQA 2NT1A 3TJLA 3FVMA 3T0TA 1XLLA 5HMSA 3QMSA 3DFOA 5HJLA 3FJNA 2C16A 4C6PA 3RLUA 4KIRA 1DBTA 1VFFA 1JAEA 3G22A 4PSRA 2F9RA 4YHGA 3A3WA 2C0AA 2OYKA 1GZ1A 3FGCA 5LNWA 4WSJA 1E5NA 1A80A 1AZ2A 1HJXA 1QW9A 4GI6A 3MU7A 5K7JA 2PGFA 1I0BA 1XLBA 2GQ9A 5I2UA 2PU1A 4GY1A 1UC4A 2QCFA 1O5XA 3PZTA 4WX2A 4TXEA 1FFRA 1QFEA 1Q4WA 3UJEA 1R47A 4QDPA 1V6YA 5AYYA 3DOPA 2QHAA 4ZE4A 3Q4DA 5FAGA 2D2JA 3P6LA 3YPIA 3WEOA 1VYPX 1Z32X 4PCSA 4S39A 4PYSA 3KVMA 3NAVA 3OTRA 4GKLA 4GK8A 1JPHA 1N7KA 2ZRZA 2ZUSA 1J9YA 2HQAA 4O0QA 3E0FA 2AQVA 5DRIA 4RPQA 4MWAE 1RCOB 4KPLA 3KBWA 1GW9A 2EJAA 2YL9A 4IIGA 2PD9A 3WNPA 3BAXA 3VKKA 2VO5A 3N4EA 4EE9A 4AXKA 1CEOA 2X7WA 2OU4A 1YDNA 1DXFA 3Q94A 4XKMA 2GYIA 4HP5A 2E8ZA 1XF0A 3LGGA 4HBKA 3WUBA 4UFMA 5K9CA 3BOXA 3DX5A 5AHNA 1NEYA 3URAA 1OF6A 2A6NA 3FA3A 1BF6A 4Q8MA 4E5TA 2Z29A 3CQKA 1RK6A 3EX2A 2WMKA 4Y2WA 3W83A 1FQ0A 1KTBA 4Q6JA 1MZHA 4N6EA 3GUWA 2BLEA 1JZ4A 1OCBA 4PCNA 3E9AA 3UWYA 1E0XA 5C70A 2WJFA 3W23A 3CUHA 3VZZA 1VEOA 3W81A 4HZ6A 4U33A 1JYNA 1RY0A 4Q4QA 2DH2A 2I9UA 3KAOA 3AWOA 4F3HA 1ELSA 2WVSA 5EGRA 4LEFA 1E71M 1HO1A 4K68A 3C2RA 2VEPA 1O94A 3T55A 5I3HA 4HHLA 4CCDA 2Y0FA 1EJRC 3BCDA 1TB3A 1UR4A 2E1DA 4O17A 1TPFA 4AYSA 3LMYA 4R33A 1JCLA 4HU0A 1YNQA 5DLCA 3LZ5A 2C91A 3MCMA 2QCHA 4K39A 1OFBA 4DZ5A 2D2OA 3WN6A 4LFYA 1H5VA 1DWGM 2QJMA 1FCVA 4FLRA 2ISSA 4LYPA 1XFBA 4ERAA 1X1NA 1DVJA 1X97A 3M7WA 2YB4A 5AYXA 1V6XA 3SEPA 3W82A 3K5XA 4N6FA 4O52A 1UIPA 2E9LA 3GFZA 2VJXA 3W02A 4ZQOA 1X96A 5U4NA 1BG4A 4L7ZA 2H3BA 4AW7A 3R1ZA 1NY1A 2XIOA 3W7OA 2WSQA 3WF3A 2DDXA 2UWFA 2CFFA 4QITA 2V81A 5DMYA 2Y6ZA 1OD8A 2WVTA 1CLXA 2R14A 4EXAA 4LWWA 3S1UA 1J18A 1A53A 2OGYA 4B16A 4XAZA 1HT6A 3AZTA 3V4BA 1E3XA 3NL3A 4LANA 4NX5A 1GVFA 1TKKA 2Z28A 2B31A 3GSMA 4KCWA 4J3WA 3KCLA 2PTWA 3M0LA 1XBVA 2G4FA 2GUBA 1ZSXA 2X41A 5FEPA 1DJGA 1R7OA 4Z2HA 4E0CA 3EX4A 4HGXA 5ENLA 4DUVA 3QGAC 4NAFA 4J3UA 4MWAA 4FLSA 1HF6A 3STPA 4JKLA 1ADOA 3ZT7A 2JEQA 5I03A 2DIJA 2XN1A 2NQ9A 5HWMA 4GZJA 4KT2A 4N02A 5FJOA 1PXGA 3PC0A 3AXMA 5CBBA 3GXNA 3SCPA 4CGTA 2ZTKA 4IP4A 1L0PA 1HUVA 2X0HA 1FWNA 4O53A 3L0KA 2E5BA 4IQLA 1L6WA 1XYAA 3DDMA 3RU6A 1Q5MA 3C86A 5CPMA 2EGZA 4PB5A 2GSEA 3EX6A 3BJSA 4NASA 2PB1A 4NZ4A 3MB9A 1SR9A 4QLJA 2R1PA 2F8QA 4DWSD 3GC2A 4GJ1A 1E6PA 4WLCA 4LUJA 2H8ZA 2BXYA 4TOQA 2FKPA 4PTNA 1XPGA 3LHUA 2OELA 4J2MA 3PSVA 3ELFA 1KA9F 3ZVIA 3LHYA 3ID7A 2XVNA 3AISA 3F4DA 1UUMA 3AQUA 3LHWA 1L6SA 3HBLA 4A22A 2QPUA 4D1IA 4B3KA 1TJRA 4L9ZA 5A8GA 1CXEA 1XGZA 3VFLA 4JTIA 1LG2A 2Q8XA 2X2GA 3G77A 2WWDA 5A6AA 3B8DA 2GSJA 2JEPA 1K8XA 4TVDA 1XIJA 1W8SA 1IR1A 2QJNA 4AZHA 2TMDA 2TYSA 4D71A 1P6CA 2QJHA 2A21A 3C4UA 2WNQA 2BZNA 1UH3A 3UXDA 5H91A 4AZBA 2H90A 2CLIA 1OC7A 2PDBA 3B9EA 2RDXA 2VENA 3QQ0A 4MKSA 4AWUA 4M0XA 4FF7A 1T0OA 5FJTA 5CZKA 2HJPA 3WF0A 5HPCA 1V0MA 2WWCA 3V5OA 1WUFA 5HPOA 1R6WA 1RPKA 3TA6A 5LSMA 1J2WA 1QOXA 2ISDA 1KFJA 4QJ4B 3VYLA 4ZB5A 1EIBA 5E6YA 4BY3A 3WDJA 2PDWA 2PPGA 3T42A 3CNYA 3O9NA 3AALA 1V5XA 4H9ZA 2OX1A 4DX3A 1ISYA 1EQCA 3ERPA 4HA4A 4JNZA 4B5SA 4R5EA 1RLCL 1HGYA 3DENA 2FGBA 1R9XA 5A3HA 3UESA 3LHVA 1RD6A 2VFIA 4GHRA 2PDQA 4LS0A 3WNMA 4G7FA 5H6HA 4N7QA 4ZSTA 4ZB2A 3MSRA 1UP3A 1E73M 1KKOA 5I3JA 1DJHA 4JQ1A 1E56A 4UFHA 1BG9A 4M5PA 4HTYA 5CH9A 4AD3A 4W87A 4CEXC 3D6NA 2O4QA 3KS5A 2QDHA 4DXXA 1FXPA 3RPTA 2CLFA 3THUA 5AZ0A 2EG6A 4XIAA 2AOSA 3R4IA 2Z24A 2PUZA 2XIJA 2HBVA 3VNDA 2JKPA 2QGHA 3B05A 4C1LA 2OZ8A 4I8YA 4OWGA 4UZSA 4I9AA 2Z1WA 2OOGA 3O6CA 3W29A 2XSBA 1F2JA 5CC3A 5FJJA 3L67A 2FB3A 3UZYA 1G7VA 3A21A 3VOCA 1PWMA 1JPIA 3BURA 3CUXA 2Q8ZA 3NPVA 1C8QA 3FIGA 1DHPA 3VMPA 1FY6A 2R1MA 2PEVA 3GDRA 2J27A 2V5DA 1Q63A 2EPLX 4LSBA 3K8MA 2W27A 1DORA 3OVRA 4H7VA 3P8JA 4X2PA 3WDHA 3CH0A 1UWRA 3W6YA 1H60A 1V93A 1TX0A 1JRBA 3L4XA 2Z1XA 3ATZA 2W9MA 2VVNA 3LBOA 5JQ9A 1LWIA 4XBKA 2J74A 3W1RA 3QY8A 4NF7A 5LHFA 1E40A 1CXFA 1QCWA 1F3EA 1WQ5A 3O6AA 3CPUA 5C55A 2HPIA 2FVKA 1E0WA 3VD3A 2J77A 5G4HC 4Y90A 3I3DA 1R3QA 3RAOA 3VMOA 4LYQA 4IP7A 1JPMA 3H70A 1A5BA 3E0WA 3TLLA 1F61A 2GJNA 3DHFA 2ZX6A 1KWKA 1ZBWA 1JFXA 3SAZA 2QF8A 1RQBA 2EXOA 3M0KA 5CBIA 3U9IA 3R79A 1K9FA 1ZRQA 3HG4A 4W8LA 3RLVA 3MP5A 3GKFA 5BRQA 2FVMA 4XZLX 3UFYA 1XLGA 2CKRA 3EDEA 5A6BD 1FCBA 3K13A 1BKSA 3EGJA 2G8ZA 5L9FA 3AROA 1PDYA 1FHDA 3WDPP 3CZJA 1GZGA 3OZYA 4LYKA 3OBEA 1OFAA 3WELA 7REQB 5CSUA 3BMVA 5C9RA 5EMKA 3GDBA 1XGEA 2BHUA 1MQPA 3CLMA 3SN4A 1ZJAA 4UMAA 3PFMA 4DJDA 1PE1A 1ZL1A 2AKZA 4QCFA 3B04A 1Q13A 3DG6A 2PD5A 1QNOA 2CHOA 3RHGA 3ARRA 5LNSA 2ZXQA 4CNTA 1EX1A 3VIGA 5KZDA 3IIPA 5LYRA 1QI0A 3BAYA 3S2NA 3TQKA 4LAUA 3UY7A 2R94A 3REQB 1OYBA 1LF1A 4HU3A 1H2JA 1LWHA 3KOXA 3GHSA 4W93A 4IZGA 2ZZ7A 4DO5A 2GZXA 3SRDA 3RPMA 1XD1A 1F4AA 5JUVA 3BLLA 3SN0A 4ZQRA 5LNVA 5AHMA 1EBGA 3LTSA 3VKCA 4H6EA 3FCPA 1FH7A 3M0XA 1BLIA 4ILSA 5EPDA 3GNDA 1AD4A 2YL8A 1EC8A 3VE9A 2Z1BA 4FS9A 1OM0A 1DIDA 1RCQA 2PWEA 5HNTA 4WD0A 3N73A 3T8LA 1XRVA 4DI9A 4MSSA 2ZRVA 3P80A 3RILA 2E5DA 2OTDA 2Y8UA 4IL2A 4PC8A 3LRKA 4AC7C 1VLIA 4IGSA 5FIPA 4B5NA 4GPNA 4ICCX 3WLPA 2ALDA 2I1OA 1WZKA 1XQLA 2DEPA 1MEHA 1EWDA 3VM5A 3VA8A 1CDGA 3QY6A 4R7JA 4K37A 5D37A 3KWSA 3O63A 4L4PA 7REQA 2GGEA 2VZVA 1RA5A 2AMXA 4M6VA 3W6MA 1JCYA 5HWJA 1EZWA 3B9DA 1Y7VA 4ZE5A 1N82A 4TTGA 3RUBL 1TTQA 1XIIA 3CHFA 1IEQA 4AVOA 4YCPA 3WQ8A 4QJ3B 1C93A 2VD8A 4JN7A 1AJZA 1UKSA 1XCXA 2X09A 4FI4A 2VYOA 5IHRA 5I24A 1WP6A 3OHMB 3REQA 4Q7BA 4H3DA 2Z7KA 1XC6A 4KGJA 5A2AA 4H04A 2OOFA 2PBOA 3OP2A 2A7NA 1DWFM 3PZ9A 2ZWZA 1XIMA 3MKVA 1WDDA 1GGOA 3QZAA 2WKGA 4RZBA 4BS0A 3WD4A 2VFEA 1M7OA 3S6OA 3VVGA 4D6JA 4XZWA 3PR2A 4IIBA 3SGUA 3TTOA 1F6PA 1ZJHA 5SWUA 3W1LA 1GJUA 3LQGA 2J6VA 3LPPA 1V02E 1JDEA 2R24A 1JVNA 2QCEA 4O4WA 4JTJA 1KXVA 2I7GA 3B03A 4HK6A 4TV6A 3A6OA 1P1XA 3PNUA 3S42A 3H4WA 4LV4A 1VH7A 4HK5A 2WCAA 4NILA 4H8UA 2HPMA 3G1FA 3HO8A 3ZSTA 2HROA 3DBNA 3GG7A 5A6TC 4MWAD 1BGGA 4UOZA 3A64A 4FIQA 2YOCA 4EAYA 2IXVA 4RNIA 2V3EA 3CS2A 4ZB0A 2ONEA 3C3UA 2FJKA 6TAAA 4DYKA 4Q8NA 4KETA 7XIMA 4MUPA 2V6AA 2AAAA 4HNVA 1OVDA 4AY7A 3WJXA 3B9AA 1EB3A 1QO2A 5A2BA 4R53A 1A0CA 2F6UA 2IKIA 2ZZ6A 1ZS2A 4LF1A 4DWSC 3WEZA 2ZX7A 3W7MA 1ICPA 1A5KC 2DQWA 3Q2DA 3VGEA 4ACZA 4KEUA 4B5XA 2J25A 5M03A 4G8TA 2A3EA 2F61A 1FDZA 3MMTA 4O12A 3L4TA 2HXUA 1UYQA 2KX9A 1K9DA 4QG6A 1R3SA 4Z2JA 4KF1A 3VKAA 3RO6A 4FXJA 3CB8A 4RXGA 2ODOA 3VIPA 1EBHA 3IJ9A 1WKYA 3RM9A 1LRTA 5CLTA 1NF0A 1BWVA 2WJZA 3AMKA 4H6RA 1GZJA 3TEVA 1RJRA 3GHTA 1H7NA 1WDPA 2YDQA 3CC1A 3GH7A 1MRQA 1TPVA 1UD6A 3M41A 4J5NA 2XIMA 4K8HA 4NI3A 3QPEA 3TOYA 1S39A 2I16A 4NY2A 3BLPX 1S5VA 3CT2A 2F2HA 3M07A 5AECA 3Q45A 1VFLA 1SU5A 2DVUA 2QIWA 3RGTA 1EJTC 3QKEA 4GYPC 1FWRA 3PTDA 1UKTA 1XSJA 3HN3A 1BEUA 4DYEA 4OZOA 1SYTA 3WY1A 3F1QA 3TVAA 5T26A 4WY0A 3RR1A 3E0IA 1XBZA 1OQFA 5FD0A 4GVGA 5LKYA 2EKCA 3BJTA 3RM8A 2YPIA 1P6WA 5FF7A 3BVJA 3DHUA 4F40A 4KBXA 3NQCA 4L1WA 3LI0A 1PV8A 2WYSA 1V6TA 2DT3A 3TN5A 1GQKA 3MWCA 3OODA 3BG3A 3ZR5A 1RY8A 1AL8A 3KHJA 1FDYA 4FNSA 5CAKA 2RDWA 1MZRA 3NO1A 3GRIA 1MW0A 3PF3A 3MO4A 3PN8A 4OKDA 1KQYA 2WZEA 3C6CA 2PU0A 3LLDA 3CASA 1E1CB 4O11A 5FSEC 2WSRA 3WMBA 5KINA 1VFSA 2VWSA 4ZL1A 1UUOA 2PP0A 5CZTA 5FJUA 4GQQA 3TWAA 4OV9A 1AD1A 1VFTA 5E9AA 2QUUA 2OB3A 4OU1A 1OADA 2V2DA 3V5CA 2RDTA 2H8XA 1V02A 3G0SA 1JZ2A 1PHWA 2OR2A 4URIA 4XAFA 4JDBA 4RV8A 4O1BA 1K8YA 1GG1A 4P2VA 5I23A 3A5VA 1EC7A 3QJAA 1WDQA 1YEYA 5MKGA 4YMZA 1B3XA 3GBDA 2NUYA 1MXSA 4KMQA 5DN1A 3FXGA 1GJWA 4L9XA 1BD0A 3I6TA 4PL1A 5CJNA 1JCMP 1VC4A 1ZP3A 1YYAA 3BSHA 1R86A 2YBTA 2Y1HA 1XLEA 3O6YX 4JX4A 3P3BA 3ZSSA 1GVOA 2V3DA 1HL9A 1UQYA 1I8JA 1NOFA 4IPJA 1OWQA 2IMRA 2INZA 5C7HA 3AUOA 3QMTA 3WD0A 1JPKA 3U5UA 2D0GA 1AG1O 4JTKA 1P0BA 3RIKA 4CQCA 2OFJA 4NJKA 3E38A 1O1ZA 3VE7A 4B5WA 3CQIA 3W7DA 4CQBA 4IMEA 1VEMA 4LBRA 1E1CA 1PJ9A 4OJYA 3WJYA 1RQEA 3MYOA 1PL9A 1DPMA 3EEZA 3TAOA 2XM2A 3MPGA 1SMDA 4FB7A 1XHGA 1A4MA 3RMEA 1EKOA 4QNWA 4RE0A 2GVYA 4MVAA 2J8GA 1VCVA 3N11A 3KL3A 4KERA 3BG9A 2I56A 2QF7A 5IDIA 4XAPA 4M24A 4E4FA 2E28A 2YCJA 2P53A 1TYGA 1OGSA 1R38A 1R87A 2INEA 1Q7ZA 4BCEA 4P7QA 3PWAA 3MT1A 5BYWA 3BQ5A 1GHSA 4MB4A 3C2EA 4NJGA 3RM4A 5BWFA 3TN6A 2JFEX 1XLCA 3ES7A 1XRFA 4O8AA 3MMUA 3TJXA 1A4LA 1CENA 3UJ2A 2BFGA 5TQLA 4DJDD 2PDKA 1TO3A 5FCZA 5KMYA 1QTWA 2BB0A 2V8ZA 5GNYA 3OGVA 4F9JA 3AZRA 4PRTA 4KRUA 3WFZA 1WXYA 1OF8A 4QG8A 3E6EA 4NZ1A 5LZLA 4WXZA