1M1BA

Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
publication title Dissociative phosphoryl transfer in PEP mutase catalysis: structure of the enzyme/sulfopyruvate complex and kinetic properties of mutants.
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 111
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1m1bA00
3H6OA 3QV7A 3SRDA 3R4IA 1E0UA 1IGWA 1ZJHA 4G1NA 4KS0A 3QTGA 4B5UA 3QLLA 1KBLA 3HQNA 1DQUA 1GGOA 4HYWA 1DIKA 2V5KA 3GG8A 2DUAA 4B5XA 2E28A 1O66A 1O68A 3MA8A 3B8IA 3SRHA 4MF4A 1S2VA 4FXJA 4KCWA 3EOOA 1S2WA 1M3UA 1U5HA 3I4EA 1JDEA 4B5WA 4KCVA 1S2UA 2G50A 1F3XA 3BJFA 3T07A 1KC7A 1VBGA 2WQDA 3GR4A 3GQYA 3G2GA 1F61A 3VAVA 1AQFA 4B2DA 1ZLPA 4HYVA 3E0WA 2HRWA 4IQDA 2XZ7A 2V5JA 3HQOA 1PKLA 3LG3A 3ME3A 1F8IA 4B5TA 2OLSA 3BJTA 1U5VA 1PKNA 1T5AA 2BG5A 2XZ9A 4B2DD 3QV6A 3T05A 2R82A 4LSBA 3EOLA 1DXFA 2HJPA 3FA4A 3QQWA 2VWTA 1F3WA 3KHDA 3M0KA 4KRZA 1A3WA 3E5BA 3P0XA 2X0SA 1O5QA 1OY0A 1A49A 3IS4A 3SRKA 1Z6KA 2VGIA 4FXFA 3QV8A 1F8MA 2HROA 3E0VA 1A5UA 2VGFA 3QZ6A 3QV9A 2DIKA 3OYXA 4YNGA 4YJ5A 4DRSA 1SGJA 3PUGA 4L7ZA 4MG4A 4B5VA 4B5SA 3EOEA 3OYZA 3EZ4A 1UJQA 4KCTA 4ROQA 4QG8A 1M1BA 4IMAA 1E0TA 1VBHA 3PP7A 1XG4A 4RPPA 5TAOA 3LYEA 4JPGA 1MUMA 3U2ZA 3HQPA 2L5HA 5JVLA 2ZE3A 4IP7A 3M0JA 1OQFA 4QG6A 1PYMA 3FA3A 4TV5A 1IZCA 1S2TA 2XDFA 4L80A 1PKYA 3T0TA 2VGBA 4QG9A 1XG3A 4KCUA 2VGGA 3OQ8A 3SRFA 4TV6A 4QGCA 3N25A 1A3XA 1PKMA 2VWSA 4L9ZA 4IQEA 4L9YA 2HWGA 3KTXA 2KX9A 2QIWA 4WJ8A 1DXEA
chains in the Genus database with same CATH superfamily
3LN3A 4HNLA 2C0AA 3S5NA 4QAIA 1ZGDA 3LXAA 2HS6A 2QUUA 2Z6IA 3VMOA 5A1AA 1B5TA 4QRNA 3LQLA 1IR2A 4HPNA 2E1DA 3DBNA 4LNYA 4XV0A 2OO0A 2CWXA 2WO5A 5I3FA 1EYWA 4LFYA 4IIBA 3NL3A 3DU0A 1BXCA 5HNRA 1HL2A 2Q6ZA 3EWWA 1G9HA 3N4EA 1LUCA 1C8XA 2DW7A 3LPFA 1RCXB 4US5A 2VGIA 4DJDC 1IXQA 1CXLA 4IJCA 3E2VA 1WKFA 1GTEA 4QQUA 1PTDA 1EGMA 1Q8AA 4HNTA 3VGGA 2CLOA 3W22A 3CGTA 2QUTA 2DZAA 3W71A 3FIGA 1EYEA 1V02A 4MUPA 1FHLA 3VIFA 1SU5A 2AKZA 3CM4A 2XM2A 4V15A 4BZYA 4XSLA 1AA1B 4KESA 2XG9A 1F05A 1T8QA 4LAUA 3AU6A 1LYXA 4LVGA 3BLDA 4ZE4A 3H7UA 4I7WA 3Q67A 5DMYA 2FDSA 1QATA 3GO2A 3PHAA 4ML9A 3NCOA 4DB7A 3H6OA 5DQPA 4Z2JA 2CLPA 1DOSA 2WMFA 4NAEA 4C6QA 2I17A 3R7MA 4ADSA 4MY8A 3WQCA 1EQPA 2NQHA 4GPNA 5F1UA 3B8IA 2HE8A 2XGZA 2C13A 2DZPA 2XH0A 2WKGA 5LIWX 5FD0A 5FF4A 5D02A 3OBKA 3W24A 1W5OA 3KHJA 3TLLA 3RCMA 5T91A 4YWIA 3VUPA 3QR1A 1JPKA 2ZRUA 1VJSA 3TA6A 1S1RA 3CV7A 2DJLA 2QPXA 4I6KA 4K36A 4Y9NA 1QR7A 1C7SA 3N04A 1EHNA 2OSYA 4GQBA 4PSRA 1GOIA 4Y9AA 3AMCA 3P0XA 1LL7A 3OJGA 4DAFA 2ZUWA 1SMAA 4DZHA 1U22A 3W88A 5BZAA 3ARPA 4C6JA 5IXEA 1CLVA 3HMCA 2X7WA 1T41A 5HPCA 1UR8A 4JTFA 2IMRA 3ISIX 1JD9A 1AL7A 2GDVA 1NSJA 4DO4A 4QLKA 3WELA 5AHIA 5JVLA 3LI1A 1UKQA 3UEQA 3T81A 1ZSXA 3A22A 4CN6A 1M7XA 4DBEA 1QO5A 4OZOA 1YBQA 4RNHA 4S3BA 2ACSA 3L4TA 4JR5A 1JNEA 3VGDA 3W7OA 4ZQNA 1ODZA 3VNIA 3AXIA 3O15A 4Q7BA 2F2KA 1XIEA 2WCAA 4S3GA 4BK9A 2WKJA 3KWSA 1LJYA 3I7QA 4UTFA 3ITLA 4U2YA 1EGZA 5D37A 2WPBA 3K4AA 3W00A 4PTXA 4KGJA 4DXXA 3W6MA 1TSIA 2QDDA 3M0XA 1ZQ5A 1OX6A 3MYPA 2XZ9A 4Q8WA 2YW3A 4Q4PA 8A3HA 4BQ2A 2W79A 4JKLA 2PDQA 4NY2A 4IIDA 4O1DA 1T8XA 1ESWA 2WVSA 3G1AA 1NFBA 1HW6A 1PZ3A 3A12A 2CU0A 3GAYA 3WDJA 5LNWA 3M0IA 2W9MA 1TIWA 4C60A 4J3UA 1V03A 3HQ1A 4O8AA 5L6UA 3ONCA 1SW0A 1KR0A 1M1BA 4RJEA 4NT0A 2QJGA 1K3UA 3KOFA 3GC4A 4GC3A 5K4ZA 4PH6A 3DGBA 3CU2A 1HNYA 3HO8A 3W37A 4WIWA 3KBWA 3GG0A 3S83A 3W1RA 1C8YA 4YMZA 5C71A 4WVXA 1VPQA 2Y8UA 1EOKA 4PBEA 2UV8G 2GJRA 3AXKA 4JN7A 4RE4A 1S5MA 3ZLGA 1FKXA 3IJ8A 3BDKA 1OADA 3TQ0A 4L1WA 2Y62A 4LVFA 4DO5A 3GTFA 3UG5A 3BJFA 3QGAC 3B8SA 2ZUNA 3DYOA 4H8VA 2PODA 2C1GA 2QCCA 1TWSA 3KEHA 1XBZA 2FH8A 3KS6A 3WFAA 1TV8A 2E25A 3PZGA 2XH2A 3WQDA 3EWYA 1BRLA 1D3CA 4A29A 2ISVA 5C9UA 1YHTA 3CL7A 5FF3A 3IJLA 3BOXA 3SCQA 3FNDA 1JI2A 4AW7A 1NOWA 3NXFA 3SGGA 3S2JA 3LPOA 3S1VA 3I3BA 2QXWA 4GH3A 4UOZA 1HT6A 3RFAA 4BI7A 3FDGA 2YFOA 2VDHA 4IGSA 3MWAA 4PUNA 5K7JA 4MWAB 3WD1A 5JH2A 5AVHA 5C9XA 2X0YA 5TQLA 3QH2A 1VKFA 4IH3A 1KTBA 3CIXA 3PUEA 4G7EA 4I3GA 3WL0A 4JIHA 4LUSB 1Z42A 2D20A 4WD0A 3LLDA 3WUEA 1E3XA 3WLMA 1OFRA 4Q8OA 1RBLA 3AMKA 3TXZA 1TVPA 4LUIA 1ZCOA 2YDQA 3DAQA 1ZTVA 3GH4A 2EPLX 2DIJA 3TKFA 3VNKA 5HQMA 3NZ1A 3ANUA 4J40A 3AHYA 3P5ZA 2E5DA 2Y7FA 5BOFA 3SUWA 1WYIA 3WD0A 5GJMA 3AJXA 4MB5A 2J78A 2DDXA 2E5CA 3P82A 3O9NA 1DL3A 4JTDA 1QI5A 4CNPA 3NYZA 4ZB0A 2QCDB 4ZSTA 3GW0A 4ZB5A 3PVFA 3RX4A 2DZXA 4DUVA 4CNOA 1F8MA 1RZMA 1VCVA 5JXQA 4V2XA 3TIMA 3OYXA 4AD3A 3THDA 3NQAA 2OCZA 4KGLA 3K8KA 5FL0A 4CU7A 4ML4A 5A8NA 2GVJA 3TUUA 1E15A 2QQ6A 1PIFA 3WN6A 3GHRA 4PCNA 3S8HA 1EJVC 1XYCA 3A23A 1B3OA 1OZQA 2OQLA 3TXVA 4RE2A 5GJNA 3LBMA 4IQLA 2DJXA 4UC5A 1M68A 1R9YA 4AD4A 2PTZA 2X1SA 4GVGA 3NDZA 1ZRQA 3ZYZA 3SBFA 4NI3A 3T0CA 1K77A 2PA6A 3W7CA 1GONA 5D4YA 2GVEA 4GX8A 4EIVA 2GOUA 1WO2A 2OSWA 2IKIA 3TP4A 2CCRA 1VLWA 1BXNA 1FWJC 2XJ7A 3TVAA 1YIXA 4RLIA 3FAWA 3LGDA 1U5HA 3VD7A 1C91A 1OM0A 2G3MA 5LNVA 1QT1A 4AHQA 3IV8A 2QVNA 5FAJA 2Z2BA 8CGTA 2ZUTA 4PBFA 3CEUA 1KFJA 4OTKA 9XIMA 1KXVA 4GI6A 2D2GA 2RJGA 3DH7A 4EAMA 4GI8A 1GT8A 2VX6A 4WF7A 3OZOA 1LWJA 2WNNA 2CPUA 1OT1A 1GPFA 3QQWA 3T8LA 3KP1A 3KHDA 3GW3A 1R5YA 5DMMA 2G37A 3UP8A 4C6DA 4H6EA 3GWQA 4DBUA 1FH9A 4JQAA 2R1PA 2VQUA 5D9NA 1JYNA 1PZ0A 4QROA 3LM3A 3W82A 4PB5A 4YJ5A 4DI8A 1D9EA 3EB2A 1WXZA 3FHQA 1YPXA 4ZCWA 5AYYA 1BGGA 3S5YA 5JBDA 3B40A 1EXBA 5I3DA 4Z08A 5JBEA 3KVMA 1TZ9A 3C3UA 3KS5A 3IJDA 4WGHA 5AZ0A 3KRBA 2QVHA 4QISA 4DYKA 1TMHA 4K8HA 1W5MA 1WBJA 6TAAA 5H8MA 1RQBA 3JR2A 2J66A 4MZYA 3AXHA 2VEMA 3QQ1A 3QLLA 4LXFA 1I0DA 4FLOA 3NUKA 4PTDA 3SRHA 2YBVA 1VH7A 2A3AA 4G56A 3V5FA 5HR6A 3WBWA 1OK6A 3IIVA 1TJRA 4Q6JA 4QSHA 2PDWA 1J10A 4UOQA 4JHMA 3N9RA 4S3KA 2H3BA 1HKKA 4AD1A 2WXDM 5T9CE 3WBEA 2VFDA 5A8PA 2V6AA 4TVUA 4UTKA 3CMGA 2Z6JA 1W5PA 4C6KA 4UR8A 1CX9A 4LAKA 3XIMA 3TC7A 1ADSA 2YLAA 1YNYA 1H0IA 1KM2A 1Z48A 2GWNA 1GEHA 3BSHA 1ALDA 4HJFA 4JIQA 4K7VA 3JW7A 2OLHA 1KCXA 4MMWA 3F5JA 4NJGA 3R43A 2Y2WA 4XD5A 5CZJA 4KCTA 3SUSA 1KM6A 3UJRA 3VE7A 4GZJA 4K1WA 4GIAA 5EMYA 2R91A 3AMLA 3N34A 3GH7A 5CGQA 2J27A 5I3KA 1DV7A 3PJXA 1W8SA 3B8VA 1UIOA 1DWAM 2VJXA 1AODA 3ELFA 4NF7A 1SZRA 1UUMA 1TWWA 3CHCA 3MC5A 4FK9A 2I5GA 3PZVA 1PZ1A 4KIEA 3NSMA 1V0NA 3LLXA 4HKPA 4DAIA 1EX1A 3LTYA 1XIJA 3L2MA 3D46A 2PDYA 3HURA 5F1VA 1XH2A 3TJLA 1BVNP 3HTWA 4O13A 3NNTA 4FNTA 2CXGA 2EG6A 2CLMA 3MZ2A 4ACZB 1N55A 4K1GA 1W3NA 3ALFA 4MKSA 1V6VA 1ZB5A 2O9PA 1CXEA 4NXKA 5D32A 4CVWA 1CXIA 3KDNA 2AGTA 4I5UA 5GNXA 5F2IA 3WLHA 3MBDA 3GNRA 4NYYA 4NXSA 1NWTA 1VFLA 1W9UA 5CPNA 2CNCA 1R2RA 5LXXA 1WX0A 4NYUA 3GC5A 2NLYA 2DP3A 3KP0A 4E2VA 1EEPA 3WX7A 1FY6A 2CERA 2EJ1A 2ZBTA 3BAXA 2F84A 3M9YA 1C9DA 5FKYA 4MNJA 1ZENA 3FEMA 1U1HA 3F7JA 1HQTA 4KMQA 3LB0A 2NZLA 3Q4DA 1IIHA 1IR1A 3NEVA 3BCDA 3PB0A 3MP4A 4IP7A 3RPMA 5D2VA 3CIWA 3NA8A 5C9RA 2GJXA 1KBBA 5FJTA 3W7MA 4PEEA 1DJQA 2ISFA 4LB4A 1P0EA 1CB2A 2GJPA 3RXZA 1UG6A 2YB1A 4W84A 3S4TA 3V3WA 3W75A 3PF3A 6REQB 5JIWA 3PJUA 1GK8A 2VZVA 3PM6A 3G8RA 4H7VA 4ZOBA 1XC4A 4W93A 4NNBA 5FSDC 1JYWA 2D22A 1R3WA 3A5FA 2Z1WA 3LEPA 3STGA 3BAKA 1XDJA 2QJIA 1CECA 2PWHA 3P6LA 4Y9PA 4QJ5B 3BC9A 2PI6A 3NQ6A 3VAVA 1NIUA 2DSKA 5E6ZA 3E0WA 3VUSA 2QUVA 4ZQCA 5C9WA 5I23A 2IXUA 3ABXA 2NQLA 5A94A 3B0YA 1LORA 2YXGA 3MUZ1 1PS9A 1IHIA 1VCFA 5I0DA 4JXCA 1HJVA 3ARRA 3WDPP 3NQ7A 2VC6A 3OVQA 3CBWA 1A4MA 2IQDA 4OV9A 4XZWA 3WJSA 3QXBA 2BHZA 3LCGA 1WQ5A 5C2CA 4X22A 3LCIA 4O17A 2ZRWA 3IK4A 4Q7NA 5FESA 3A21A 2CLHA 2VXNA 4JQ2A 4EK7A 1EL3A 1TPC1 4Z1AA 4JKMA 4GINA 3WQ5A 3GIQA 3QPYA 2AOSA 2JQXA 3VPLA 4I9MA 1B3YA 5GNYA 3EBVA 5AYBA 4GJIA 4WKFA 3NGFA 4D6HA 4TVCA 1YTKA 3EDFA 2IS7A 3NURA 1H4PA 3V0TA 2Y89A 3GTIA 2J62A 4HYWA 2CC0A 3DX5A 2PSNA 3IUIA 2BASA 4O28A 1NM9A 1AMYA 4GVIA 3OIXA 3NG3A 2WZMA 2Z1SA 2VFIA 4DM1A 3OHIA 1PHWA 4KETA 4NNCA 4NZ5A 2X1IA 3VNYA 4PTVA 1OINA 1SJAA 2YXXA 1DJGA 1EA0A 4XZ9A 3WNLA 2VR2A 4R7OA 5JH1A 2PUZA 3VDGA 3UZWA 4ZB2A 2Y5JA 3H4WA 2OZ3A 5T26A 4GWEA 4PMOA 4GRSA 3VIOA 5KZDA 4FLRA 2H8ZA 3I3EA 2E68A 3E5BA 5FF0A 1A49A 2E6AA 2F2HA 3CHDA 4GZEA 4AU0A 1W9XA 2BXVA 1YPIA 2VGFA 4UCGA 2G96A 5LNRA 1I75A 3IACA 4AHOA 1NWUA 4EE9A 1Q4WA 1K4HA 5EGRA 5ABHA 2NVDA 2WVUA 4MDPA 3U3HA 4A35A 3BLLA 1TX2A 2X2YA 3K30A 4US6A 4V27A 2V8ZA 3G0XA 3N9KA 2ONEA 4QGCA 4CNNA 3UZYA 2Y0FA 4QJ1A 4AC7C 4F48A 4D6JA 5D03A 5DCDA 4IM4A 2JIWA 4C90A 4F9JA 3EKZA 1K7EA 4DXVA 3UWQA 3BG5A 1NAL1 2QEZA 1SSGA 3TYZA 2R9RA 4MY1A 4B9YA 4WUIA 2G3JA 5DY3A 1I6NA 2D2HA 4WCJA 1J8VA 5DRIA 1Y65A 5F2MA 3JS3A 2XH4A 4KFPA 4F8XA 5TD4A 4HPXA 3TSDA 4HOWA 4C6LA 2YPIA 2QS8A 1KXTA 5G2WA 4Z1YA 1F4HA 1UR4A 2J7BA 3ZFHA 1PKLA 4YS1A 5D2XA 2CLEA 1XGDA 3OLDA 1JCYA 1HGYA 5FSEC 1K7XA 1UW9A 2O9TA 4QNEA 3CHVA 1A53A 3REQB 3R6IA 1EP1A 3S5OA 1TE1A 4PCTA 2NWRA 5KTLA 3SR7A 3IIOA 5CXPA 3CUIA 1FKWA 2BY1A 2Q3RA 3RMEA 3WLQA 4ROQA 3VTRA 3TQPA 1XUUA 1TG7A 2V69A 3SCSA 2V3FA 1GOQA 3N3TA 1S2TA 4XTDA 1K9DA 3WG6A 4C6CA 4H2CA 2YDRA 4TV6A 4HHHA 1I2OA 3KTXA 1GJPA 4CD5A 1SZFA 1UIPA 2OYKA 4C6EA 4DNMA 1IGWA 2PLCA 5JUVA 1HG3A 5H6HA 1KCLA 1RA0A 4LY8A 4P2VA 5EMMA 4DBWA 4CD4A 5LA1A 5J8LA 3CT7A 2GGEA 3L2LA 1THFD 4TMCA 1YX1A 1ADDA 1VFOA 4BF5A 4AF0A 1WZKA 4GBUA 4PTMA 4DHGA 3KVJA 1RY0A 3A47A 4Q7IA 3DBPA 1UR3M 3T9PA 3GDMA 1F3XA 4HNNA 3WQGA 1TUXA 1V7AA 1VEPA 5I78A 4N0RA 1CXFA 4IQDA 3OG2A 3AIRA 2C8NA 3TQKA 1B3VA 4Y90A 3OBEA 4GC4A 5ENLA 3K4WA 1VFMA 2FMNA 3C3NA 3UA4A 2WANA 2VC5A 1A3WA 1XLMA 3S5SA 2PCEA 3GIPA 3CLWA 5FF7A 3EAUA 3CQHA 1XLFA 4YIWA 4UTJA 3J7HA 5H1WA 5DY2A 2PP3A 3DC0A 3SADA 3BAJA 4L6DA 4QJ3B 3HPSA 3THQA 3UZ5A 1XLDA 3LYEA 1LWIA 4EWND 5A6SA 1XIDA 1OFDA 4W8AA 5K3VA 2IKJA 4IISA 2J77A 4KPLA 4UMCA 3G0UA 5H8UA 3GE7A 4D6FA 2RFGA 4IMCA 1KGWA 1VENA 4F0LA 2KX9A 3UXLA 4P7LA 3MCOA 1VS1A 3C2VA 1KFLA 3U4AA 3GS6A 5DT5A 3STCA 3B97A 4PMZA 1M9HA 1RBOB 2A3BA 2Y85A 2DZTA 3QY7A 2GQ8A 3ZSSA 1BSIA 1X97A 4CQAA 4LB3A 1QWKA 1W2VA 4PMQA 2CHOA 4ZQOA 1O5KA 5REQA 4M1BA 1TJ0A 1QRQA 3R79A 3T2PA 3FW6A 3ARXA 4LJ3A 4KRTA 3QFEA 2Z2UA 4X61A 3BQ5A 3GFXA 1E0VA 3AALA 2ZADA 5L9FA 4PRRA 4DJDD 1SO3A 4MDOA 4Q8MA 1G67A 4JDYA 4UR7A 4UFJA 5E9AA 1P43A 4H9MA 1A3HA 4NAFB 1QMLA 4PMDA 3GR7A 3UA3A 1EUAA 5C9ZA 3HPFA 1JULA 1KCZA 4YL2A 5BNKA 3OQEA 4QHRA 3BW4A 4GO9A 2DSWA 1N8FA 3DGRA 2XWEA 4H8NA 1EGVA 3EZ4A 1E0TA 4F0RA 3W9ZA 3RGTA 3L4ZA 4KT2A 4TR9A 3RCYA 4AY1A 4QDPA 3CZJA 3NYDA 1IXOA 4JFTA 4H8HA 5GQBA 1O1ZA 2OGJA 4K2SA 4HMCA 4H9TA 3QEZA 3JUGA 4FR6A 5DX7A 5A6BD 1EZ2A 1LTDA 1M03A 4PN2A 2NQJA 3NPXA 2WBKA 1D2KA 2VZSA 2AMGA 2FHFA 4CD7A 3UBPC 4N7QA 4JFUA 3MJMA 2CZEA 4H9ZA 3I6EA 1R87A 5K9XA 3W7GA 1QHPA 3ARTA 2NWSA 2GL5A 4PC8A 3GG7A 4EF8A 2DORA 4C7FA 2AL1A 5I6SA 3UWYA 3DG3A 6XIMA 7TAAA 5TBOA 1X7FA 1FFRA 4OU1A 1RJRA 5HWNA 3OZPA 3ZMRA 4EXBA 2B7QA 1XLAA 4C6FA 1UP3A 2PDNA 3GXIA 1GG0A 3QSRA 1NP2A 1TJ1A 1VFTA 4Y9MA 3ZT7A 4HHMA 3MU7A 1NOUA 4LBSA 4KF1A 2JBMA 4Y2WA 4HVXA 3HPAA 3UU0A 1CENA 5LIKX 2PRLA 4LV9A 2XGIA 4MPKA 3TNOA 5AYIA 5FJRA 1M65A 3LMYA 3LRLA 3GHTA 8XIMA 1E1EA 4IG2A 3DIPA 2IQTA 2QAPA 2CITA 1XDLA 5AYZA 3AYTA 4D6EA 2A3EA 3SRFA 3HZ3A 4GQRA 2OO6A 2Y8KA 3L4XA 4I8YA 4V33A 3EPMA 4ONVA 3MKCA 2YL8A 2QMKA 3VGEA 1EJSC 1M5WA 2PDIA 4U31A 2PWFA 3TCEA 2GSJA 1DIKA 2BGSA 1OFBA 4OIFA 1KKOA 1AQHA 2GQAA 1HF6A 3QHMA 3P8IA 4HSOA 4B5WA 3B0VC 2VHLA 2YOCA 3AS2A 3TQVA 1UD8A 4J27A 4B3LA 3GQYA 3KLKA 3U8GA 1LOLA 2HRWA 4Q8QA 1U5VA 1NDWA 3FX4A 4Q4RA 1H7XA 7TIMA 3BWWA 3EOUA 3WF4A 1SR9A 4JTGA 2XISA 4UBPC 1FH8A 1X8FA 2WB5A 4GQQA 2GWGA 4UTMA 3T4WA 1XPGA 2OX1A 3K5XA 4AB4A 3EXTA 2A7PA 3DG7A 5LIXX 1U1UA 2ADAA 4HNCA 3LSBA 3GVQA 2F6XA 3GH5A 4MWAD 3M41A 1CT5A 2G3IA 3NO5A 3TE9A 3ITXA 2I5QA 2YBUA 1EPVA 4GX9A 3QKEA 3F4DA 3QC3A 4LVBA 3AXMA 5IBXC 1BGAA 2J7GA 3OHMB 3KRSA 1XWYA 9RUBA 2QV5A 4GO8A 3AZRA 1TTQA 3VDHA 3W3OA 3WY1A 1GPWA 1RCOB 2WSQA 3KLLA 1HJUA 7A3HA 3FS2A 4L5ZA 3BLFA 3D3AA 4YN5A 1DQXA 2OWCA 4LGXA 3H8AA 3A3WA 2VYOA 3LCWA 4LC6A 1P5BA 1E56A 1OG6A 2WMIA 3W7EA 4WGXA 4ZO7A 3W27A 1V3IA 3UD6A 2HMCA 3PWGA 4GI4A 2Y4SA 3IIXA 3ABQA 4TU1A 3HG2A 2GUBA 1GTHA 2FHBA 2J6XA 4AYSA 3TYEA 3T05A 1LOQA 3H54A 3QW3A 3T42A 3FY1A 4UFIA 3EOLA 4IOTA 1TPFA 3ATYA 1GKPA 2NXGA 1VR6A 1O5QA 2VURA 2OT1A 3PTKA 1EC7A 4JIIX 4ATWA 1ZY9A 4JTEA 1POJA 1A0DA 5E0KA 1Y8BA 2EPKX 4UTUA 2O7QA 1ICSA 5G4HC 2ISSA 3W73A 3C86A 1X98A 4HA4A 3GVVA 4FIQA 4PMUA 2WJEA 2WZEA 2YL5A 3K8LA 5AHNA 3BVJA 3U57A 4L9ZA 3G0SA 1M7JA 4CNSA 1O1HA 4H9UA 1BF6A 3VDCA 3SRDA 3HG3A 2EPOA 4C5ZA 5EFFA 2P0OA 4FXRA 2VO5A 1K6WA 4MB1A 1XLGA 2NVAA 1IWBA 5XINA 2WC4A 1ZJBA 7XIMA 2PS2A 3OVPA 3PNUA 2ZWZA 1LWHA 4BHYA 5HNTA 2P3EA 3HPZA 2PFHA 1XLHA 1SW3A 2Y8VA 3BUVA 3PZIA 2XM1A 3GDBA 3RJXA 3BW2A 3QMTA 1XD1A 3OEXA 3TYCA 2QDEA 3U4FA 1SJCA 1W3JA 4HYVA 4IPLA 3V5OA 3HV9A 4REQB 2D3NA 1Z3NA 3LCLA 4CKQA 3PZ9A 3YPIA 4U5IA 5HPOA 3LY0A 5FA5A 2VD9A 2PC8A 3MT1A 4JTIA 3RO8A 3W0KA 2A6NA 1ZPTA 4MZ8A 1PCWA 4JIEA 1N7KA 4NHVA 4OHQA 3ZJ6A 1V4YA 3E0LA 4ADTA 1I2PA 3JZEA 1IF2A 4J7RA 1QW7A 1T96A 2QJJA 3T09A 4XO6A 4K3ZA 4LUYA 1JF6A 3WQ4A 5E0CA 1E6SM 3MHGA 4CQDA 3MANA 4W8LA 3AS3A 4L6OA 2I14A 3OQ8A 4HK5A 1FQ0A 1MDRA 2J8FA 4WY0B 1JVNA 1XUZA 5EL1A 1W8GA 4IXHA 1I1XA 3C6CA 1ICQA 1XLCA 5IDZA 1QK2A 3O6AA 4JTKA 4AIBA 1QCWA 4H6QA 4V1XA 1O68A 1XBVA 5HANA 1XSKA 4JTCA 1FWGC 4QEEA 1H60A 2X16A 1GOWA 2LLEA 2VEGA 3LLFA 1H51A 1NTHA 3MUCA 1OFAA 2QV4A 3QTPA 4O1BA 3KOWA 3CC1A 2YCLB 4HZ6A 1WDWA 3SCOA 1MFUA 1W9PA 4LSBA 3A24A 3AO0A 1JAKA 3LOTA 4KRZA 5G1MA 4I7UA 4K39A 3S3GA 2X0SA 3GU1A 5I5RA 4ATDA 1RP9A 5D04C 3WLSA 2PRMA 3GNDA 1CGYA 3IVUA 2BX7A 5BXSA 3KOXA 3M5ZA 3PC0A 1S3HA 1TRDA 3TTOA 4FEZA 3NWRA 4TX6A 1RBAA 2ZX6A 1XV8A 3VNMA 2V2HA 3GHSA 3NFUA 1ZBVA 4NX5A 3SCNA 3GVWA 4LUTB 3UW6A 2DZVA 4NZ3A 1F73A 3AS0A 4F79A 1FH7A 4D9PA 1A3XA 1F7BA 4K6AA 3PTDA 3O0FA 2HWGA 4KEVA 4HSHA 3OLIA 5EPDA 3QN3A 1G4PA 1MVYA 4IMFA 1X1OA 4DJDA 1QNOA 3PBUA 1GOMA 5XIMA 1R38A 4D2JA 2YCJA 4HP5A 3THAA 1QPOA 3EWDA 5EB8A 5T8GA 1M3UA 2B4GA 1UZDA 3AYVA 3G1YA 4OJYA 5RUBA 2G50A 4U5KA 4MYAA 4O1CA 1V0MA 1PXGA 1HKWA 2J4GA 3IJ9A 4H19A 4AZHA 4DVOA 3LZ5A 1J4EA 4Z2HA 1IZJA 4D6IA 3M0ZA 3FV9A 3L7RA 3V1PA 3NZRA 4LAOA 3B04A 4JFVA 4U2ZA 4H1ZA 3LRMA 5HK4A 2GPTA 2WC3A 1IQ8A 4QE5A 3KBSA 5HA7A 1SGJA 1VYPX 1HL9A 2GSEA 4RPQA 4JQ4A 4UTLA 3BXWA 7REQB 2YZ5A 3HFYA 4RZBA 2XVGA 2OELA 4XISA 1MI3A 2YL9A 1PKYA 3ZJ7A 4UTIA 2HNEA 4HD5A 1GNXA 3CAKA 4FAMA 2XIBA 1EHAA 5E5CA 1WP6A 4M80A 3WMCA 2OEJA 3S2MA 4J9JA 4QIUA 2J9XA 4GH1A 4GUGA 3TFCA 1UD2A 2PTXA 4PFHA 4LW7A 4BEUA 1B9BA 1R3YA 1YDVA 1US2A 2F61A 1BYAA 3GXMA 3M6DA 2NQZA 2H9AA 4NL1A 4AG0A 1DJIA 3M0YA 1IEWA 4E0CA 1XL9A 3OPSA 4JFSA 3M7SA 2NXIA 2J8TA 4GGBA 3O6YX 1J0IA 2NQ5A 4N9DA 4HU4A 3TN3A 5J5RA 4KFOA 3VGBA 4ZGYA 3NL2A 4UWMA 3TC3A 4PMVA 2B0MA 2HJPA 2PEVA 3IJQA 1ZFJA 1K9TA 2HZGA 2EPNA 1MRQA 1H5VA 2RJHA 3DFTA 4UQCA 2D1ZA 2Z00A 1CLKA 2TMDA 1SO5A 3SI9A 4LU0A 1GYNA 3MI6A 3KBMA 1DJXA 3EOEA 5KSWA 2PDMA 3FXGA 3TN4A 4J3SA 2XUCA 4DJFC 3BAYA 2HVOA 1GQLA 1FOBA 3M43A 2ZXBA 4Z2KA 3USBA 1LCOA 4BR1A 3K46A 1QNSA 1SZEA 3G24A 5CEWA 4TV5A 1SSDA 4RNIA 4BWLC 4AYGA 3B4UA 4FZIA 3UZJA 4RV8A 4PMJA 1V7YA 4GUHA 3A3XA 3MV11 4JKKA 4Z17A 4AX6A 1GHSA 1GVSA 5BROA 1HKVA 5IOBA 3RRAA 2V5KA 5BXTA 3WEOA 3BOFA 4JEQA 4IFKB 1K9EA 3VIGA 1UWSA 1JDEA 1F6KA 3VKKA 3I10A 3THCA 3TX9A 3SUTA 2EBNA 4CD6A 1H7PA 3DENA 1RXOB 3SGUA 3ZT6A 4E5TA 4B2DA 3VD3A 3M7WA 1CGVA 3NM3A 3H12A 3BJTA 1O94A 3MSDA 3E2SA 2HXTA 4GNKB 3OW1A 3N29A 4HCHA 4MWAA 2CBJA 1DWJM 2VVSA 4Y8FA 2PB1A 3XISA 3CV6A 1XIHA 1VBUA 3AXXA 3ANYA 4LUSA 3QJAA 3VINA 2VCCA 1AW2A 3B0XA 4S3JA 1HTIA 4HOZA 2FB3A 1KBIA 4MPQA 4B15A 4C6MA 1WKYA 1UOKA 2YYTA 1S2CA 4AXKA 3DEQA 1FBAA 4GNVA 1I2NA 2I57A 4ZTYA 1OCNA 3BV4A 3AOFA 3CUHA 3BCFA 5I3JA 1OC5A 5B7YA 3DFPA 1BXBA 3MKVA 1B3WA 3PJTA 1PDYA 3KTSA 4LBUA 5CPLA 5D05A 4LYRA 4P8WA 1JPMA 1WE5A 4H3DA 6PTDA 1YE6A 1FDYA 4MM1A 4RW3A 3ZZ1A 2J47A 1DP0A 1NWRA 1XISA 1A5LC 2QCDA 2QGYA 3LXCA 5CBJA 3BV7A 1MMFA 4S3CA 1PV8A 5TIMA 4D6CA 3VFLA 4HT3A 1AJ2A 2HPMA 4AY7A 1GG1A 1R3SA 3AHXA 3QZEA 4RL3A 3GNNA 1JDAA 2MNRA 4JN8A 3GSMA 4UOJA 5A8MA 1FWRA 4NSBA 5HQEA 1FA2A 1DJNA 5AY7A 2XN2A 4QDWA 5C7HA 1V3JA 1H5YA 2V0TA 3QFWA 3UPWA 3UXAA 3ORWA 5CPSA 4IIEA 3VK5A 1REQA 1JDDA 3G5EA 3IS4A 2F38A 3VIKA 2BVWA 1C7TA 3LERA 1QK0A 3M0MA 1JZ3A 3WLIA 1KWGA 4NAEB 1E1CB 3FEQA 2Z28A 3RPTA 3S1WA 3IARA 2R1NA 4GQGA 1ZBCA 4CCDA 1AQ0A 4JICA 2EEXA 3OZMA 4UIOA 4QG9A 2VGGA 1ONRA 3QYQA 2P8BA 1Q13A 2FTWA 2D0FA 3UPMA 3RG6A 2OKTA 2PWGA 3L4WA 2X1UA 1MRAA 3EMCA 1PWLA 2X41A 2IUZA 1XFCA 1KTNA 2V3EA 3TW6A 3LU2A 4I6VA 3SAZA 3CPGA 4D1IA 4QJ4B 3D6NA 1P0BA 1GKRA 2BB0A 1OYAA 4UMBA 4UNLA 2Z1VA 1LROA 1OD0A 3WYZA 1Z9AA 5FJUA 3M5YA 4RZ5A 2BOGX 1P0DA 2PF8A 4LEQA 4GIEA 4QLJA 1JEZA 1O5RA 2BGQA 3B9AA 4CQBA 1C92A 1UR1A 5MKGB 1UMYA 1L6GA 4XBKA 1ZBKA 3B06A 3E12A 4ORIA 1T40A 3WLJA 1AG1O 4DM2A 3NPWA 4AIOA 4GACA 3PB2A 3VKJA 4JY8A 5JIPA 3CL8A 3QV9A 1FWDC 1K03A 1VQTA 1K6AA 3UESA 4QLLA 2UBPC 3G1DA 1KQYA 5I3GA 4QXIA 1ISYA 3HPXA 3BAIA 4Q3MA 1XBXA 3FA3A 3H53A 3UCDA 4HNOA 3WD2A 3BICA 5CLWA 1D8CA 4FX6M 3SIMA 1FHUA 2VEIA 2QYGA 3LHWA 4IX0A 5KZ6A 2ZC8A 3R2GA 4OWGA 1VIZA 3SW6A 4PUUA 4PE8A 1UYQA 1XFBA 2QCMA 2ZUMA 4AZCB 6A3HA 2QJHA 4DX3A 2ISDA 1J0KA 2Z26A 3GFYA 2E7FA 1PB0A 4CNUA 1K8CA 3ZSTA 4LF2A 4IIFA 3L65A 4UUIA 2FB2A 3GYEA 2JEQA 2J24A 4KWUA 7ODCA 3IGXA 1P0NA 3H24A 4HK7A 4PULA 2VUYA 2O56A 2DSVA 2RDTA 3H21A 1KW1A 3AYSA 3DFSA 3CTTA 2X1TA 1RLDA 2A3HA 1E9YB 1HO1A 1KM0A 1IXPA 1L2UA 4P7OA 2C16A 1OY0A 4XBJA 3LDVA 1OVDA 2PU1A 3KXQA 4LT9A 2PDCA 1XCXA 4UNKA 5EY5A 3UG8A 5K9CA 4WKHA 4OBTA 4U10A 3EEZA 3H4GA 3OZYA 2ZA2A 1AJZA 4F3HA 5T9BG 4PRWA 1GWJA 3EA1A 3W1XA 1JD7A 3CTLA 5I2UA 1K8YA 2INEA 1BYDA 1CGWA 4GFSA 3ABZA 4P61A 4ACZA 2WZHA 2ZX7A 4WJ8A 1LG1A 4AWUA 3VMNA 3KBVA 2YA0A 1TELA 1XP3A 3AFBA 3RPDA 1CI1A 3QGKC 2KAUC 1QPKA 3ARVA 3LNPA 5EFDA 4WR3A 3IEBA 2Z27A 1V79A 5HWJA 3EXSA 4F0SA 2E09A 3POHA 4KKXA 4A2RA 4DUXA 3H7RA 4XQ6A 1BD0A 3O16A 5E93A 5IHSA 1TQJA 2R94A 3GUGA 2OWXA 3ATZA 2HBXA 1XYLA 2J7HA 5CJ5A 4JN6A 3UWUA 1WCGA 2J74A 5AYXA 3VO0A 3CK5A 5HMDA 2VD8A 4MTVA 1XYZA 3G3MA 4MB4A 5BWFA 4RXFA 4RDWA 3TTQA 2HQAA 5A6AA 1VYSX 1EJUC 4C6BA 1W1A1 1W3IA 4K38A 1SZGA 3S46A 1TQXA 4R3UA 2ZVIA 1NDVA 2EKGA 2QUMA 3HMJG 3QM3A 1Z41A 3TJIA 1J5SA 2DUZA 6REQA 1UJQA 4EP8C 1AQMA 1YMYA 3OIHA 4B91A 3MTWA 1DTNA 4G8TA 3I7RA 3C8FA 3W70A 3NQBA 3LV6A 4OUEA 3G77A 3K1DA 4KBXA 3SEPA 1JIBA 4M8UA 2E9MA 3T0DA 2ZDRA 3R5EA 3CJPA 1HJXA 2X0HA 2Z2AA 3H23A 1H7RA 3VX0A 3KTCA 1GGOA 2FGZA 3GVRA 1WDPA 3CT2A 4C6OA 3PUDA 5MHBA 4CQ9A 2VR4A 1H2JA 3VD4A 4JBRA 4BCEA 3MMTA 2XSAA 2UZ9A 4ZO9A 3EDDA 3W87A 1A0CA 3A64A 2BLEA 4UQDA 3P74A 3N4FA 4GY1A 1U33A 4LANA 2ZC1A 3WUGA 4PUWA 2F8QA 2EG7A 2TAAA 1EB3A 1MW3A 3WQOA 4MLRA 4Q32A 2FVMA 3Q65A 1W1VA 1MO0A 3W1UA 3B9NA 1BF2A 3H55A 1FX6A 2HVNA 2E67A 4UQAA 1YDOA 1UWRA 3SN0A 1QUMA 3S5ZA 4AVFA 3UJSA 3LA4A 1FWFC 3VKBA 3SCPA 3BSGA 4XVEA 4QM1A 3NIYA 1WA3A 4DO7A 4ZXLA 3MS8A 3BMWA 4N4QA 3UXKA 1E4LA 2RUSA 3HIJA 2D73A 3UXIA 3AIVA 3F03K 2A3CA 5FEWA 4E2OA 3WD3A 1NFGA 1RCQA 1XIFA 4E8DA 4UB9A 3W7NA 4EVZA 4FO4A 4BS0A 2OPJA 3LHYA 4AQLA 3CV2A 1RD5A 4WXZA 3OGSA 1NH6A 5G4EA 2OWWA 2OB3A 1OGSA 3T0AA 4R9XA 5FOOA 4TO8A 1Z89A 2CBIA 2ZWYA 1DQUA 3GU9A 2J88A 1T7LA 3QR0A 4GQ0A 4JYFA 4EXQA 3RYSA 2WHLA 2WNZA 4HCDA 3NVDA 4BJHA 3Q94A 3OLGA 4Y9OA 3R10A 3VM7A 3WNKA 4LS0A 2X2GA 3N2CA 2BTMA 4P8UA 3UZXA 2V5CA 4AISA 4POCA 1Z7AA 1ZHAA 1BFNA 2OLSA 4F9DA 1FXPA 1DQWA 1QXLA 4GZIA 1PYFA 4XKYB 1X6UA 5D9MA 1TYGA 2NVCA 5I3IA 1GW1A 4OE7A 3WFZA 1YE4A 1WZLA 3ZLFA 1R0MA 2B31A 4IL0A 4PTNA 1HGWA 3ARQA 1UA7A 3FSTA 1G01A 3TYBA 3W76A 2PDKA 5AHLA 1E6QM 3WQPA 4DN1A 4PUJA 1J6PA 2OR2A 5CZSA 1A5MC 4IP4A 3TNBA 4D1JA 1G7UA 2WWCA 1RD6A 4MKVA 3NSXA 1UBPC 3STFA 4NZFA 1C90A 3L68A 2QIIA 7CGTA 3P62A 2BSLA 1GQJA 2ZA3A 3B0PA 1WNOA 4UFMA 3PS7A 4L4MA 4H8UA 3MSYA 2VDIA 4LH8A 6ENLA 1P48A 3L23A 1EF3A 3FN9A 4RE0A 3KVKA 3QGVA 4PFMA 2DUAA 5ABTA 5DBTA 2YA2A 3EA2A 2PGRA 2WJFA 3REQA 2C18A 3IWPA 5BW6A 1KRBC 4H41A 3DKJA 4S2BA 4ZO8A 3BJSA 1O12A 4O15A 1N2VA 1CEOA 3NTYA 4PRTA 5FIPA 3CQJA 3PPHA 1MUWA 4UFLA 1XKJA 3BGAA 4ATLA 2D69A 4E2BA 3QW4B 3TN5A 2PWDA 5AFDA 4JQ1A 1Q4NX 4M6VA 1XC6A 3HN3A 2F6UA 3RU8X 4GJJA 4D8LA 1I8JA 3RRXA 4FPSA 3EDEA 1UZ1A 3EX2A 3H2NA 3S2NA 1KM3A 4FOKA 4WJXA 1XYBA 1AL8A 4PYSA 3BO9A 2WVVB 4XG1A 4Q8PA 2EG8A 1JGIA 1Y0EA 2OFJA 1Q45A 4LUJA 3O05A 2WJZA 1XR2A 3QPEA 1PYMA 1LZOA 4FHAA 3ZM8A 4HA3A 1H61A 3R89A 1EZWA 3M46A 2JFEX 2JIEA 3G6LA 3DESA 3LCFA 2H90A 2X42A 1O6IA 5U7SA 3HA1A 6XIAA 1PCKA 5C5YA 1E0UA 4GABA 5BMXA 5ABEA 3QMSA 1FDJA 2CLLA 1XBYA 3PUOA 1SJBA 3WZ0E 2RKXA 5C2XA 1RK6A 2BS9A 3ARUA 4ZL1A 1JL8A 2FPVA 2IKHA 4JCMA 2Z4GA 3PBYA 5LIYX 3EPNA 1W32A 2YCIX 2DVTA 1WKDA 4Y8EA 1XQLA 4AZ5A 3WLOA 3BARA 1VBGA 1ME9A 1V6WA 1QHOA 1TPVA 4E6MA 3HBLA 3I7SA 4G9PA 3O3RA 3IUDA 4PMYA 4LYPA 1JQVA 3IK2A 3N15A 1V0KA 1BPLB 4GZ7A 3BLOA 1V5XA 1XIBA 2BOEX 4U4MA 4L6HA 1PUDA 3R0KA 3SUUA 3RK8A 4NQ1A 3F5KA 4B4HA 1K7FA 4R9OA 3RU6A 2NT0A 4DRSA 3W7JA 3AZTA 4DPQA 1VFFA 1J0HA 1XG4A 1UWAA 3DERA 3TU9A 3GZ3A 4PCSA 4FNRA 4ZENA 3UWVA 2WNQA 2VOMA 4TVDA 4CCCA 3H22A 2FZBA 2XSBA 3WENA 1XLIA 3SECA 3FOKA 1TPUA 1VZWA 4YVPA 1R2SA 3GY1A 1ZNNA 1RA5A 2AAMA 1ME8A 3JRKA 4L65A 4NAFA 1P6CA 3NQ2A 4J3XA 3EMZA 1KRAC 4ZOAA 2VEFA 1NEYA 2ALRA 3L0NA 4OQVA 4ZFCA 3O8AA 5HQLA 3TMQA 3SN1A 3NDYA 3N19B 4HU8A 4WZHA 4RX0A 1F61A 5EYWA 4O0KA 4HHLA 4LV4A 1ELSA 2R8WA 5I24A 4ZTXA 3CNYA 2R14A 1XLBA 5LA0A 4XZNX 1FUYA 4XIMA 3RHGA 3BAWA 4JNMA 4DI9A 1RR2A 2I5IA 2A3LA 4DUWA 3GU2A 4PUKA 3RR4A 1YTDA 3G1XA 1VB9A 1IE7C 3NQGA 3PULA 1AJ0A 4S2CA 4JX4A 4S3FA 3IVTA 3RR1A 3RUBL 3SZ8A 1A0EA 3FKKA 4ICNA 3AUOA 1CTNA 1QNQA 3S6DA 2BOFX 3U5YA 1TJPA 3U2ZA 4ERIA 1R3RA 2RHGA 1TPEA 3II1A 1W1IE 4N9BA 1KLZA 2PDHA 2XFFA 1L6WA 1OIFA 1JUEA 3HV8A 4GKTA 2WYSA 1UR2A 1YPFA 1KBJA 3G8EA 3OA5A 3RNDA 3CH9A 4AZGA 2ZIDA 2X7VA 3Q37A 2WWDA 5CZKA 2VRQA 5BRQA 1LF1A 4BI5A 3F2BA 3KM8A 1S2VA 3LK6A 3WL1A 5CGMA 4A8RA 4G1KA 3A4XA 1A5SA 1GZGA 1R3TA 5IRPA 2EGZA 1P1XA 1JDFA 1TVLA 1L8PA 2ZA1A 1XJBA 3N2OA 1HIZA 4NRRA 4J3ZA 1TZZA 1IXNA 1ENUA 4LCRA 1WKEA 2YCKX 2DT3A 3SN4A 1MQPA 4JIRA 4IF2A 4IIGA 3E2QA 3P0WA 4ENLA 4IQJA 3AIQA 4XB3A 4NUWA 3MV01 3ZQ9A 4MB3A 1W3KA 1EO5A 3WQ6A 1DXIA 3WF1A 2GYIA 1MNZA 3KX6A 4J1OA 3OYZA 3UQNA 2BVTA 1EIXA 3GVGA 4B16A 4I9JA 1NQ6A 2QJNA 3GAKA 4MSSA 3NQCA 4FNUA 4TX8A 2XDFA 4B3ZA 1M53A 1RPKA 4IL2A 2EQDA 1FHVA 1EJRC 4H01A 2WW5A 3ITGA 3U2CA 3BANA 1XLJA 4TX9A 3E3HA 3B0UX 4YXGA 4MHBA 4KS0A 1OWQA 3LX9A 4C91A 4MFEA 3QVQA 1UD4A 4G2DA 2OGYA 4J35A 2POZA 3MUAA 4FB7A 3TW9A 1E70M 1VP5A 3R25A 1CYGA 2P5NA 3M07A 4OGZA 4KEUA 5CC6A 1KM4A 3HFTA 2C6QA 3K2GA 2OJPA 2DSUA 3C52A 3W2UA 5HR7A 2RDUA 4HTBA 1SJDA 2FH6A 1F2JA 3PG8A 2FTYA 2VM8A 3NJ3A 4DJFD 5HJYA 1JGMA 1JR1A 1FWTA 2V2DA 3FYOA 3W02A 3WO8A 2HXUA 2CLFA 3O7UA 2P88A 4L4OA 1OCJA 3URAA 3E9AA 1JPHA 2PC4A 1HO4A 3C2RA 5MF5A 3SGZA 2GGIA 2YA1A 1VAHA 2W4XA 4MJ2A 1J96A 1XLLA 2GVLA 3B9OA 2QAFA 3GDKA 3OG3A 1V6UA 1JJKA 4P8XA 2VFGA 1TX0A 4MUZA 5GJPA 1MZRA 1JAEA 3AIBA 1OIMA 2CHNA 5M3WA 3TN6A 4YTSA 1S46A 5F4SA 3OBAA 3AWNA 5A8GA 2X8RA 2X05A 3ZJKA 3LCXA 1O7AA 1HVQA 2DVXA 3L2IA 1XGEA 2YL6A 3V4BA 3TC6A 4UQEA 3MB9A 3UR8A 3BG3A 1WUFA 3W86A 5M5DA 1KO0A 3G18A 4TOQA 2HBVA 2BDQA 4LRSA 4YTRA 2BG5A 5DO8A 3VIIA 1XLKA 3EWXA 4A2SA 5HUPA 3VNZA 3U0HA 1TIMA 3APYA 1I45A 2QCGA 2WZIA 5IBXA 5FJOA 3T08A 2YFNA 3MHFA 1OABA 5GNZA 1HX0A 2WPGA 1MDLA 4N2YA 2PWUA 2PWVA 3P2VA 1HJSA 3LNMA 2Z29A 3IJ7A 2EXOA 1QDSA 5E70A 3GXNA 1UHVA 3F4NA 1ONEA 5BRBA 2ZOXA 3PY2A 4W88A 3R8HA 4HMNA 3NOYA 1KRCC 3M6YA 1B31A 1E43A 1RHCA 2NLIA 3AYRA 3PTQA 1E4NA 1TVNA 5EA9A 2XIOA 3PSWA 4XSMA 1MXDA 1A5NC 4R88A 2Y5EA 1XHGA 4H7ZA 1P7TB 4REQA 5AN7A 4LY4A 2J9ZA 5DLCA 4AD5A 1E4MM 1JZ7A 4XO7A 4FALA 2WLYA 3H70A 4H6RA 1TMLA 4XZIA 3R1ZA 4JQ3A 4Z42C 4UTWA 3PAJA 2HSAA 3NZPA 2W6RA 2E9LA 2XN1A 5HAOA 4OV4A 4DJEC 5CG0A 3B8DA 4IUGA 4ZO6A 4ASTA 3GNPA 1HP4A 2Y1HA 2WQDA 2W92A 1SO4A 4QEHA 1ZLPA 4YVXA 3GNXA 4WX2A 4DLMA 3ITCA 1R9XA 3G1VA 1X1NA 2VZOA 1L8NA 3U9IA 3B05A 3HJEA 1UC4A 3TK7A 1UA3A 2ATMA 3NPUA 4NASA 5G5IA 1K9FA 4RNFA 3JVAA 4QBXA 3VXGA 4WY0A 3RLGA 3CL6A 1Z6KA 2B7PA 3QV8A 3W84A 4HQVA 2O9OA 4QNWA 3BGJA 1BVZA 4HPHA 3NPVA 3U7BA 1SZNA 5DEZA 4B5SA 1CIUA 1BKHA 1Q7ZA 3PP7A 3SY5A 1TJ2A 4MAVA 2CYGA 4A8LA 1QBBA 1G5AA 1Q65A 5F2LA 2YBTA 4AWTA 3FJNA 5CC7A 2PTWA 1W1B1 2OMAA 1Q5MA 2ODOA 1VJIA 4XAZA 3DOPA 4K68A 1JZ8A 1Z8AA 3UY7A 2YCLA 3KRUA 4JCLA 4B4FA 1JXKA 4A3HA 3ECQA 4Q4QA 4QE4A 5HUOA 1B4EA 3GG1A 5I7GA 1M41A 2ZZ4A 1M7OA 5LKYA 1XDMA 2YGYA 1DHPA 4AWEA 1OX5A 4J3TA 5LHEA 2BXZA 6TIMA 4O57A 4O14A 5CSUA 3EOOA 4CUCA 3UPBA 1AFSA 5AZ1A 3UNDA 4KCVA 1WDRA 4Z2GA 1UOZA 1DE5A 1QNVA 2QKFA 2EKCA 4UCFA 1LBLA 5FAGA 4RR4A 3F4CA 5IHRA 1BYCA 5I00A 1DWGM 1ITXA 2O0TA 2A7RA 5EU9A 1C8VA 2V5DA 4IG2B 4LUTA 1E5NA 3TH6A 4Q8NA 3P5YA 1PE1A 3WQEA 3EGJA 5HINA 1GHRA 2PP0A 2ABBA 3AUJA 4ZEPA 3GLCA 2R6OA 3C0QA 2DIKA 5CLTA 4CN4A 4O11A 4QP0A 1FWBC 5DELA 3IAPA 1YNQA 3FYPA 3EX6A 3NAVA 5CQ1A 4GUFA 5DT7A 1VBHA 1AD4A 2AKMA 3VOJA 3WK1A 3ABOA 3CUZA 2V81A 1SMDA 2VUNA 4L80A 1UP2A 4V1YA 4CU8A 3FGCB 2C91A 3GXDA 4IQEA 1MXGA 3M0VA 4PL2A 4DWSC 3ZR4A 4M24A 4YLWA 4IICA 4GYPC 4PUMA 4OBRA 4I7VA 4PUEA 3CO4A 1XM3A 5CGTA 3CB8A 4S1FA 1W3LA 3CEPA 3KOYA 2A85A 3VCCA 3TSBA 1X1ZA 3H2MA 4Q6XA 1GVEA 4M19A 3W23A 4AAJA 2DH2A 3WUFA 1D8WA 4TTUA 3S1XA 2BBFA 1AZ2A 1EC8A 4DO6A 3FKRA 3W1AA 4W5UA 4YHEA 2EHHA 4B3KA 1AQFA 4OVXA 1FP9A 2FZ8A 2G0WA 3ZT5A 1IWAA 1VF8A 3H2CA 3I65A 3DFOA 4HNVA 1J79A 1H7WA 1FWCC 2FYMA 2OVLA 4BQ4A 2ZE0A 4PBGA 1TPB1 2RAGA 3OVRA 3WH6A 1EOMA 1XSJA 1L6FA 5LHFA 2GOKA 1OFQA 3NOEA 1QJWA 4FXFA 3NEHA 3TWBA 1NQKA 5D9OA 3EEGA 3RF9A 4I90A 3OGVA 3L5LA 3M44A 3F4VA 3WNPA 4GD0A 2EF9A 4X60A 3GB6A 4XUGA 5GPRA 4J4KA 4O12A 1YW1A 1KR1A 2FVLA 1ADOA 2VX7A 3LTSA 4YYFA 1UD6A 4QCEA 4GY7A 3IJ6A 1FHDA 3UYIA 4DYJA 2ZUUA 4OKDA 4DWSB 3P14A 4KCUA 3W1LA 4O4VA 4XD4A 2Z7KA 1Y7VA 4L1XA 4AIUA 1MQQA 5A6MA 1UR0A 3URBA 1RQEA 2GQ9A 4M56A 1GQKA 2Q3OA 4JX5A 2OYMA 1DKWA 4U3AA 4FOJA 1OFPA 1ZBWA 4NU7A 2E28A 4IGHA 1QVBA 3Q2DA 5D8WA 1BKSA 1P1MA 4M1RA 2JGYA 1CBGA 4W7VA 4PL1A 4LEFA 5HATA 3AHVA 1HVXA 5J04A 3L4YA 3PAOA 3P3BA 2BVDA 4UTTC 5CC3A 5LSMA 3UXDA 3MMWA 1EXPA 5DBUA 1KCKA 3ITTA 3UJFA 5DCBA 2PDLA 3NL5A 5LA2A 4E4PA 1LQAA 3TOPA 1E73M 1KTCA 2JF6A 4F2TA 2E3ZA 2FQIA 5HJXA 3KL0A 4DQWA 4S3DA 1CW2A 3CXOA 2E9BA 2QF7A 1PX4A 3WK3A 1KBKA 1OD8A 3WF3A 1ITCA 3N4AA 1VYRA 4YHGA 1YXDA 3CUXA 3PUGA 4Q33A 4URIA 1A5KC 3DDMA 4O4WA 2WMHA 3R8GA 3CQKA 1J93A 1LRTA 2ICSA 2J7EA 3HF3A 2GVGA 2A5HA 3DG6A 1J5TA 2MANA 4PA8A 3EA3A 4CCZA 2A1YA 3UGRA 5ABFB 1DVJA 1WDSA 2IPJA 3V7PA 3CUFA 5F4XA 2QCEA 1ITUA 4O50A 4C1KA 1O60A 1K8XA 3P60A 4U28A 1A80A 3E38A 3SO7A 3TMLA 1HN1A 2Z1XA 1PHQA 2YW4A 1RJPA 3WQVA 2F6KA 2QPSA 4DJFA 4U3CA 3VA8A 4WJEA 2B7NA 3DYPA 1EBHA 1KA9F 1GOOA 3QC0A 4XKMA 1ISVA 3K13A 1EA9C 4LRTA 5I03A 1XD0A 1PSCA 1I2QA 5LYRA 3L0GA 2FHCA 1L9WA 1KV8A 4BWLA 4B5TA 5M2FX 3DI1A 2PLKA 3VMPA 3CYJA 3W53A 3PG9A 3TYAA 2YDSA 3FA4A 2VWTA 5B80A 2GUYA 3OB8A 2ZZ5A 3AICA 4I5XA 2XYLA 1RY8A 2O4QA 4JTSA 1S39A 2J7DA 2ZX5A 3SDOA 3CS2A 1RSCA 1V08A 1AH4A 1GJUA 1X39A 2CZFA 2EPMX 1POKA 3LQGA 4UFHA 5AVNA 3VZXA 4WKAA 3W6LA 4Y7EA 3MUXA 3EKGA 5LGXA 3D0CA 3TA9A 1XG3A 2I9EA 5FCZA 1H1NA 4Y96A 3IGUA 2GDQA 4NZJA 4JY9A 2JKEA 4KWWA 5H2ZA 4GCAA 1TB3A 1Q6GA 2ZVRA 1DXEA 4JTLA 5M1TA 3KCOA 3OU8A 3AISA 2ESCA 4IPJA 1PX8A 3N6JA 3ZR5A 3WKZA 3IPWA 2YB4A 4IPNB 2WMKA 3N12A 4YTTA 4OT7A 4WDUA 1OX4A 2YJQA 5I79A 2FZMA 1ZCCA 2P3ZA 3O2LA 4IMDA 4PUDA 3S1UA 3VVGA 4W9TA 1E1CA 4BQ3A 3GTNA 4NKCA 3S47A 4X2PA 5LZLA 3PPFA 4GUIA 1KD0A 4EPEC 1EJXC 4YU1A 1LRQA 3KWXA 4M6PA 2OT0A 3N3MA 1DIOA 3PWAA 3W2KA 3F5LA 2RDWA 4IMEA 2IQ0A 5JU6A 4W86A 3VKAA 1EDTA 2D0GA 4L61A 4DZ5A 4EPDC 1YADA 5E9XA 1TR9A 4YVVA 5H91A 3S6OA 2GDUA 3CPRA 2NX3A 1OC6A 3WMLA 4V28A 4H2HA 3I4KA 3WJXA 4FXSA 1XYAA 3PBGA 9CGTA 2VGBA 1V8EA 4TTGA 2V5BA 2IPGA 4RUBA 2ATSA 4GFIA 4HPGA 4GIYA 3HG4A 1LP6A 4A05A 3H4XA 3VD5A 1V6XA 3DECA 3AHZA 3R4IA 2HISA 1KXHA 2F7FA 1Q7QA 1J01A 1I60A 1OF6A 4J28A 2FGBA 5MKGA 2J9YA 1RAKA 1OGBA 4NJIA 1W2PA 3UR7A 1VCGA 2PBGA 3MA8A 4HNUA 1VJZA 4FXJA 3G22A 4JHOA 2H8XA 1S2WA 4KIRA 3TW7A 3KCLA 1DJHA 3W74A 2W62A 3GYCA 4X3ZA 2NSXA 1MEHA 3MUIA 3T07A 5EBAA 1OBAA 2WQPA 9XIAA 2QUNA 1NDYA 1GJWA 3MI2A 1TKKA 2GUUA 3LG3A 3MVTA 4O10A 1ZJIA 3DFNA 4HK6A 1BWKA 1OEPA 4ZA0A 4WEVX 1UPMB 4MJ4A 1QI0A 3G3DA 3PFMA 1F5ZA 4FR1A 5FI8A 4BF9A 1BG4A 1IEQA 4AUBA 4N02A 1CZ1A 2PP1A 2HROA 2FLIA 3P81A 4HBKA 4AZCA 1AUSL 2H6RA 1RPXA 4JEJA 2PD5A 1Q2RA 1D7FA 4MAZA 1CGUA 1E40A 2GGJA 5EBUA 1O5XA 1VBJA 2DY3A 3B03A 2D3LA 3U2EA 3ZXWA 2H9AB 1TCMA 1YQ2A 1HKIA 1E1FA 1E9ZB 4Q4OA 4IGMA 3DFQA 1ME7A 1S5TA 5E6YA 2DGAA 1TV7A 4UR9A 3FLUA 3R0DA 5IM51 3DI0A 4AXNA 3BW3A 3EOSA 3M0LA 3GG8A 2V9DA 5C6MA 3BZJA 2ZTJA 5DANA 2V82A 1Q6DA 4O53A 1PBGA 1TR1A 4GMEA 4AHPA 4MWAC 5FACA 3TZFA 2YX0A 3SCUA 4LWWA 1ZAJA 1EWDA 1CWYA 3CMJA 3LBCA 3ME3A 1C29A 4F4RA 3FAXA 1R6WA 2NT1A 5FEXA 3VABA 3L67A 4XWUA 3DHPA 3QYSA 4LS1A 8XIAA 4HMDA 1E0XA 3IV3A 3QOKA 3R0UA 3BSMA 1Y5XA 1NARA 2CBUA 1YXYA 1X38A 3ITYA 4ZOCA 2VKZG 1ISWA 3O0KA 1WZMA 3URNA 3KVLA 3TFXA 3BZGA 3TDFA 3UT0A 3MDWA 2GGGA 4O1EA 1CGTA 1JZ6A 4NRSA 2QNEA 5FL1A 1Q6LA 1SR0A 1GVOA 2NV2A 2DPEA 3WF0A 2P76A 3IANA 2G4FA 2CW6A 4HU3A 3H26A 3B9DA 1HJQA 5DFAA 1YNPA 2Q02A 3ITOA 4ES4A 4OUIA 5CAHA 3RILA 2NXHA 1FTXA 3UWWA 3WK0A 1DIEA 3QHNA 3A9BA 3CO8A 1GUVA 1TV2A 2WK2A 1S3TC 1PPIA 3VOCA 1E4IA 4O16A 3VOHA 1UZHA 3VZYA 5CPTA 4MJZA 5HMEA 5IFTA 4Z0JA 1MW1A 4XAYA 3N2TA 3ZS4A 1JZ4A 4XZMX 1NF0A 4C1LA 1YXCA 3B3DA 2CZDA 5HXMA 2ZUVA 2AQVA 3UJ2A 3G1FA 3N6QA 4XVDA 4GBDA 4Q8VA 2A21A 1U83A 4BKNA 4B2DD 1EJWC 1ZZMA 3QV6A 3UETA 4GYJA 1YDYA 3PBMA 4NI8A 4FA3A 3WCZA 1B4KA 2NX9A 1W5QA 3STPA 1CXHA 3MQTA 4LNCA 2B81A 3W1MA 3KDOA 4WY0F 1XRVA 1T99A 4P7RA 1UR9A 4JL2A 4HA1A 3T4CA 2G4JA 5A2CA 3VKDA 3UWZA 1VLIA 3RX2A 1KV5A 3KBNA 4KWOA 3IUHA 3UGVA 5HBFA 2DEPA 3ZWSA 4W85A 1GYMA 1DYSA 3W4RA 3W7LA 1S1PA 1QTWA 4MY9A 5KITA 3EDKA 1B2YA 2REQB 4CNTA 3WIJA 4UZUA 3EX1A 2WHJA 3KZPA 2ON3A 4UTHA 3AI0A 1IT8A 2OEKA 1R3VA 3IVSA 2JKAA 4P8VA 3ZVHB 1TPDA 2X09A 5G1TA 2CLKA 2AAAA 4W7UA 4CQCA 1X8CA 1MEIA 3GUWA 1REQB 2DZUA 2VZTA 4J5NA 3LGGA 4C1NB 1T0OA 1E6XM 2C79A 4X2RA 1EIBA 1B1YA 3B8WA 1OJXA 1V51A 1SQ7A 6ALDA 1S2AA 4ROPA 5A69A 4FNQA 4Q4SA 2JKPA 4GJ1A 4U33A 1VFUA 3N2BA 2WMGA 1AW5A 5A6KA 4NX0A 3N6HA 1D3HA 1S5VA 1OC7A 5TF0A 3ZLHA 3MKKA 2AL2B 2VQTA 4K7YA 4W7WA 1H1ZA 4X63A 2V63A 4IGNA 3NGJA 2FJKA 4JNZA 1QOQA 3ZVIA 1W17A 4JAWA 3DHFA 1C9WA 3ARZA 5IFPA 5C7VA 4CEUC 4X0VA 2FZNA 1NELA 1UMLA 3PPCA 4Z2IA 4IMAA 4LALA 2DSZA 4UZSA 3V0SA 2OTDA 1JCXA 1QNPA 3NQMA 4YWSA 5I06A 1CB7B 1LLWA 1RQHA 1R7AA 1RP8A 1FCBA 2GQ3A 2YLLA 1FCVA 2FZ9A 7PTDA 3WDIA 1NFPA 4DY1A 2G3NA 1LL6A 3USZA 1ZAIA 3FVDA 1HJWA 4XKYA 3F1QA 4D72A 3PZUA 5JBFA 2HS8A 4WHBA 2TSYA 4W87A 5D30A 4YTQA 3MWCA 3DXIA 3PZOA 5CJMA 5BXRA 2FMOA 1SYTA 1UD5A 2TRSA 4HPJA 3L9CA 2Z0IA 2X40A 3I4EA 3V75A 1NP0A 4NG3A 5CPQA 2ZYFA 5DMLA 1B54A 4GXWA 3TONA 1JCMP 1EJ7L 4XAFA 4N4PA 1TCDA 4R53A 2ACQA 4A3RA 4GHRA 2VCAA 2PDXA 2ZRZA 3NO3A 5A6TC 1VBRA 1JG9A 2DZSA 4AH7A 1IEVA 1V02E 3KW3A 2NV9A 4KQNA 5E0FA 2BVYA 1WZAA 5FEPA 2ZRYA 1E72M 4LTSA 2OQYA 1TE6A 2XIMA 4G5DA 3W7HA 4ZBCA 4QTGA 4LCSA 4O19A 3VNDA 3WLTA 1AZ1A 2XTKA 8TIMA 3ZOAA 3PTMA 4PMNA 2QW5A 5KINA 1FWSA 1OQFA 1UKOA 3WH8A 1BAGA 4E4FA 3RLUA 4BEQA 3H2FA 3DFHA 2E6YA 3RN6A 3MSGA 1CGXA 3NQVA 2XIJA 1W6TA 2TPSA 2PDJA 3QV7A 5CZTA 4NVTA 2DU2A 1JUBA 5LNSA 1NJJA 1SVDA 3CAVA 2Y63A 5C70A 3A3HA 2PZ0A 5A8OA 3RM9A 5CG7A 2RGMA 2E8YA 2OYLA 1HZYA 1WDDA 1MEWA 4B90A 2PDFA 2WVVA 3CWNA 1ZJAA 2VC9A 2FPTA 4B92A 2V5JA 4UQBA 1HXJA 1F6YA 4WXYA 3WDHA 3UY8A 1SW7A 3ABSA 1XICA 1IIGA 1OK4A 1G69A 4LYKA 1F3WA 4I9AA 1EF2A 1H1YA 2FTPA 4LQ1A 1NDZA 3GNOA 4WSKA 1Q8JA 1SO6A 1TZ7A 2OEMA 3LHVA 1PZ2A 3R12A 4R34A 4CD8A 4PR4A 4AZ7A 1P6BA 3HJZA 2D0HA 2Z25A 3WSUA 8RUCA 1W54A 3BURA 3I6TA 1GVFA 3W6YA 3ZR6A 2GJLA 3N2MA 3R58A 1G0CA 1MW0A 4Q4KA 4HYRA 3GD6A 2Q09A 4XIAA 1TA3B 4WSHA 3LTPA 5EKYA 4NZ1A 1XF0A 4RK8A 3GDLA 1JNDA 4N42A 3W7KA 1MSSA 2WM1A 2ZXAA 1JUKA 3G1RA 1RK5A 3GIYA 1D3GA 4DJED 1DWHM 4ALDA 4XTIA 4GUJA 1SFSA 3EWZA 5BRPA 2CEQA 4ZZ9A 1IT7A 2PGEA 3E49A 3BTNA 1Q3NA 1UUOA 1YDNA 1XRSA 5SWUA 3RM4A 4E4UA 5DXYA 1QPRA 1EO7A 5CC5A 4ZMGA 1GVRA 1T6MA 3WEMA 5KZMA 3LI0A 3C56A 1V3HA 2A6LA 1GEQA 2GJNA 1DORA 2VFEA 5E09A 2PLMA 3LHTA 2QZRA 2X1RA 3CUGA 1PO9A 1WAWA 1W9VA 3A9IA 1X6LA 1AH0A 1F3TA 3M47A 3SQSA 1FWAC 1VEOA 2Z24A 4ZODA 2QCLA 3FFSA 4BY3A 2XH7A 1RH9A 2OOGA 4BF7A 1LBMA 1XCWA 4IHCA 4L7ZA 3PANA 4ERAA 3AIEA 1E0WA 2I1OA 4UMAA 3W26A 4AC1X 5BMWA 2XIIA 4JPGA 3WQFA 1JCJA 1HUVA 3GKAA 1WOAA 4A22A 4QS5A 2ZUSA 4H6KA 2WMJA 3RM8A 1TV4A 1J12A 1QW9A 5A6LA 3ZO9A 3DFYA 4AZ6A 4PCPA 2W61A 2QLYA 3L66A 4F40A 2J7CA 4H9YA 4S23A 3HQNA 2WSRA 3SSZA 3SFWA 4B5XA 2GK1B 4MADA 1V6TA 3LZ3A 3C4UA 4C6IA 3AROA 2NUWA 4WOZA 1Q85A 2CETA 4LS2A 2DIEA 3NDOA 4BA0A 2WC7A 3AS1A 5FJIA 1FCUA 2DFAA 4KRUA 3L4VA 2I16A 2D2JA 5A6JA 4P7NA 4J3VA 2P8CA 3TZNA 4LOCA 3SFKA 1F8IA 4MYXA 1LBFA 3NQ8A 1ISZA 1EFZA 1MXSA 3MCMA 5CCZA 2Y6ZA 2ZX9A 2RGLA 5CH9A 3UERA 1QOPA 3KAOA 2A7NA 4E2DA 4HOXA 1BEUA 2W91A 1GVYA 4ICMA 3FA5A 2ZZ1A 2Y70A 4C65A 3P93A 1UBSA 2XVKA 4FS9A 1TRIA 3POCA 1ITQA 2HDJA 3NSNA 2RDXA 3S2LA 3P7YA 2XINA 1G6CA 1J2BA 4DWSD 4R7JA 3A13A 1FRBA 1LT7A 1A5OC 5A5WA 4LBRA 1Q6RA 3F2CA 2O92A 1FCQA 1ZAHA 3L5MA 3CZKA 4GOAA 3QRHA 5HJLA 2GGHA 1GVIA 1UCWA 3KFTA 4IFRA 4RDZA 4DIAA 4M82A 3AU2A 1BLIA 5DXXA 3N13A 4GLEA 1Z44A 1G4SA 1YKWA 3FJ6A 4JHZA 4M51A 4MNLA 4N9CA 2PWEA 3HOJA 3P84A 1EH9A 3CZLA 4J2MA 1KKRA 1XGZA 3VOFA 2G3FA 2P1FA 4GY0A 4OECA 2TYSA 3GDTA 4DZIA 4EXAA 5HULA 3PZMA 1H3GA 2NX1A 4FX8A 1R8LA 1A50A 4JIPA 1OT2A 2PF0A 3ZWTA 2BMBA 5M17A 2ZCGA 4H9VA 1NOFA 3W25A 4H7CA 3V35A 1H50A 3SRKA 2OG9A 3RIKA 1TV5A 2VVNA 4J3WA 2VRJA 3E0IA 1J11A 1SM9A 5C2GA 4DNHA 3CAWA 1F07A 2JE8A 4AMCA 3MP3A 2WSYA 4F66A 1KFCA 1LUCB 2POTA 1XI3A 4JYEA 4IIHA 5JQ9A 3VKCA 5ECVA 5CBIA 3V16A 4QCFA 4FX7A 3VILA 3ONBA 2FVKA 3LRKA 2YIHA 4O8RA 3N14A 1MFVA 1WDQA 4KEMA 2DUXA 1W1PA 3RAOA 3SQLA 1F74A 3TEVA 1XSIA 3WQ8A 4QR6A 1V6YA 1FWWA 4LC8A 4M7TA 1RALA 5HMSA 1A5CA 3EYPA 4EF9A 3WF2A 3MHUA 1J0YA 1EDGA 2ASHA 4F0HA 2VC7A 4PODA 1KLYA 5K9DA 3W1QA 3QY8A 4HIBA 3K8MA 1TWIA 2A79A 1PKNA 3NQEA 5ECUA 5G4WA 4HA0A 1JF5A 1I1WA 1EKOA 1MYRA 1XXXA 2UWFA 1F3EA 4TXEA 2OXNA 1WV2A 1XRFA 2WBGA 5IDIA 4D6DA 3UNTA 1EPXA 1H7OA 4R7WA 3CQIA 1L0PA 1OCQA 4K8GA 3U5UA 1GQNA 2XGBA 4JZ5A 5D2YA 5I02A 4M5PA 4M7SA 4LYQA 1E6PA 1BHGA 2ZRVA 2WZTA 1X96A 3FJ4A 4FF7A 1Q6CA 4BFAA 2WAGA 3ARSA 2V2CA 2Z7GA 4WK9A 2PAJA 3P67A 1PVNA 2IPFA 1TREA 1XQKA 3EMQA 2L5HA 5AHEA 3WDRA 2JEPA 3DYMA 3M0JA 3RCNA 3WH7A 4X9YA 3N9SA 1TWDA 1QPNA 1QAPA 4DBDA 4ILSA 3E6EA 2VT0A 3ARYA 4E3TA 3S9YA 1CCWB 3ICJA 2FGLA 1XYMA 3O6DA 1LDCA 1PKMA 3DN5A 3AIWA 4RXGA 5PTDA 4FIRA 4GA8A 3C2OA 2XFWA 3GX9A 1TTJA 4XD3A 3R8RA 2PE4A 3LV5A 4KERA 2ZX8A 3L4UA 3CASA 4H4IA 3B9EA 3ALGA 4DZAA 4KFNA 1GOKA 4JS3A 3NQFA 3GXFA 3GR4A 2NUXA 1YBQB 3UJEA 3VE9A 4J2PA 4ZQRA 2WHMA 3E0FA 2JALA 1ZUAX 4XX6A 5A3HA 4ZOEA 5FJPA 3VCRA 4IMGA 4IXXA 3C0LA 1QOXA 3KBJA 1Z32X 2R82A 4JYDA 4A4AA 4AY8A 3KRZA 2ZRXA 3W81A 1TV3A 3GBEA 4WOQA 3A5VA 3UZZA 1JYVA 1TUFA 1ECEA 4OOUA 4LPCA 1OYBA 1F4AA 1P7TA 3WMBA 4A8IA 1HP5A 2GFTA 4NILA 3M5VA 1W1YA 2PMQA 3MI3A 4RKAA 2Z1KA 3SCRA 3URQA 4C7DA 4EOUA 1K02A 2XVPA 3DC8A 3QZAA 1KFKA 1MUMA 2INZA 3TTYA 3UG3A 1BVWA 4QG6A 4A3YA 4A21A 1RLCL 5D38A 3JU2A 2CHRA 4QDMA 3FDKA 4CQ8A 5K4XA 1W31A 5DMNA 1JRBA 1BWLA 1F76A 2W3ZA 4LVAA 3BK0A 1BSLA 3CHEA 1DJWA 2BFGA 1GCYA 2VENA 1AMKA 3MY9A 1UKPA 4WQ6A 3VDBA 3I6RA 4WRHA 4DF0A 1H11A 2YKKA 4MIMA 2OQHA 1ZP3A 1V0LA 1X7IA 2IXVA 3IIZA 3W1TA 4FI4A 1JZ2A 4MNMA 4IWWA 3MJYA 2OZ8A 4QE1A 2J25A 4XAPA 4Z2LA 1EWEA 5KETA 2O55A 2ZZ2A 3QF0A 2PCQA 1QPQA 2PDUA 3T40A 1GKQA 2FFCA 3GBDA 2V67A 3TROA 3G6MA 2AMXA 1PX3A 3CAQA 1F9CA 3EX4A 4MGGA 4GG9A 2YCEA 4MZ1A 2CXEA 3R13A 5HNUA 1UUQA 1K4GA 4DJEA 3DZ1A 1ECQA 2VZUA 3ES8A 4YCOA 3HQPA 1E55A 3R94A 4H9XA 3GXPA 2VMFA 4XBSA 2XFRA 1BRLB 5ABGA 4ECLA 2XIQA 3UG4A 3T0TA 3U2OA 5BXPA 1QW8A 4WLCA 1AD1A 3BE7A 2Y5SA 1Q6OA 2X30A 1UWUA 5EMKA 1WUEA 3AMDA 2XHYA 4P5UA 2VX4A 4DBSA 4L56A 4ERGA 1TMQA 3ABRA 2B7OA 2V5LA 1W37A 3N2XA 5H8PA 2V30A 4TMBA 1VFSA 1AW1A 5C55A 2A4AA 5XIAA 3SCVA 2Y24A 2W66A 2PU0A 3FHAA 2ZZ3A 1OFOA 3W07A 1O66A 4IJRA 4O1AA 3MYOA 2PTYA 3VX1A 5E1QA 3CLMA 2PPGA 5I3HA 4M6QA 1S2UA 1GQIA 2D2OA 5BWAA 4LAMA 1US0A 4G7EB 1VPYA 4RW5A 2XZ7A 3TR9A 1TFVA 2DW6A 1H0GA 1LT8A 1H63A 3ID7A 2OZ0A 3HM7A 2VR5A 2OLAA 7ENLA 1VRDA 1B9ZA 3E74A 3LCHA 3FGCA 4X0NA 3SY1A 4L1GA 5C8BB 1E3ZA 1K70A 1H09A 1DJYA 3B8UA 1JQXA 3RMJA 3UCCA 3G1SA 1E6NA 4LAZA 2Z1BA 4NJJA 3RO6A 3GHUA 4FMVA 1YEYA 2E40A 3NZQA 3N18A 4IUOA 3M0HA 3WNOA 5TAOA 3BMVA 4DPPA 4CVUA 3TLQA 1TO3A 1J18A 2EJAA 4PCFA 3U6WA 4KH2A 3WBYA 4GIRA 3KCJA 2R24A 5GVJA 2W0UA 2W27A 2J7FA 2J13A 3M0KA 4JTRA 4QQ3A 2P10A 2ZFAA 3WLKX 1G4TA 4QSFA 5DRCA 3PBWA 4EKJA 4ZQMA 1KRMA 1FWHC 3N17A 1W0MA 3VM5A 4YCPA 2JGQA 2WSKA 4RV3A 2FIQA 3VDAA 4MF4A 1QI2A 4ZSUA 3SY8A 4N6EA 5KMYA 1V93A 4H83A 3LHZA 5DCEA 4UNIA 2KZHA 3VGFA 3AHTA 1QWGA 1KC7A 5HMFA 1BTMA 1JXJA 4R5EA 4D8ZA 3MO7A 3C2YA 4AD2A 1K8ZA 1J9YA 1WAUA 2EPHA 3OO2A 5M03A 4D6GA 1MW2A 2PDPA 1OZMA 2BY2A 3EWBX 4B5NA 3EDJA 5F2GA 1J0ZA 1V77A 2P53A 3TYUA 3H2AA 4DWSA 4GYPA 3N73A 4CLMA 1QI3A 4TIMA 3BMXA 4L4LA 1UKSA 3VU2A 1A5UA 5LNUA 4YNGA 3G1HA 4ZXOA 3QR3A 3S2CA 1DPMA 3GRIA 2FKPA 3LGEA 3M4HA 5HWMA 3PR2A 1JFHA 3WH9A 3L0KA 3T2OA 2E8ZA 2R1MA 3W2JA 2RH9A 2E5BA 3GTHA 3CH0A 4XZLX 4UTWC 4JTHA 1K1DA 2PGWA 3MVIA 4YTUA 1VRXA 1D7KA 3FK4A 2O9RA 4OFCA 1W56A 3TJXA 1VHNA 4GGHA 1B57A 4AD0A 1OFEA 4XZBA 2E0PA 2DT2A 1E9LA 2WCSA 5AECA 3OVGA 1RV8A 1LM1A 1PEZA 1PDZA 1W91A 3WEZA 3S6TA 3WBAA 5HDRA 4GKLA 2WKLA 2QGHA 3LUTA 3IGHX 2V68A 4B9ZA 3FSUA 1XIIA 3IRSA 2VFHA 3WK2A 3BLPX 4HMEA 3PNZA 2FZDA 1GZ1A 2VDGA 3ZIZA 1ZP4A 1I2RA 3Q58A 1EUNA 2HNHA 3N1AA 5G2IA 1Q6EA 2OOFA 5ABFA 2QJMA 3C0SA 5G1YA 1Q63A 3M1ZA 4NP7A 3BQ6A 4MLJA 3H2OA 1EC9A 3Q45A 3TOYA 1WOBA 1R46A 1V3MA 5A95A 3GM8A 3C8NA 3WBXA 1UB3A 1KB3A 2G97A 4MFDA 3SB0A 4RPPA 3KZSA 2R1LA 4UTTA 3QLDA 2YDAA 3QHOA 1OGGA 5BCAA 4NNAA 1N8WA 3OGRA 3TAKA 1WB0A 2DT0A 3DKLA 1JRCA 2CIPA 3W72A 3K4DA 2Y7EA 1Y5WA 4DF2A 5LXEA 4CU6A 3W28A 5EMJA 1DWIM 3QKZA 4PSPA 2VTFA 1R9ZA 2WNWA 4HN4A 3BLKA 1ZS2A 2PTDA 3SCWA 4UXDA 2W5FA 3PN8A 3L21A 4INFA 4EWJA 1Q6FA 2WOQA 4XK2A 4W4QA 4JNYA 1JCNA 1B90A 5LGZA 1FWIC 1C3FA 2XSXA 3AZSA 1Q7MA 1QFEA 3W7DA 4QITA 1KGUA 3NXLA 3WUBA 3C2EA 3K1GA 1DXFA 1SUXA 5CJNA 3AMGA 3HU7A 1GORA 2HVMA 2DH3A 3HGOA 2GZXA 1KM1A 4C7GA 1J2WA 3E0VA 2VP8A 1PTGA 1PTAA 4Q8UA 1NU5A 4E3VA 1CPUA 4DXKA 1VIWA 2XU2A 1KFEA 4E38A 1PAMA 4N6FA 3WLPA 1KFWA 3PZTA 3EWCA 2BWGA 4EACA 4QS6A 1XW8A 3UR2A 2AQWA 2WHKA 1OYCA 3VIPA 1E6ZA 4AWSA 4UQ9A 2C7FA 3QPZA 5JMUA 1QNRA 5BU9A 4O1FA 2Q8XA 4BQ5A 5CKSA 4JD4A 4D8AA 4MOZA 4IZGA 1IEXA 1NVMA 2I7GA 3LPPA 1JFXA 3IGSA 3VGHA 3WD4A 2ABAA 4OBSA 4Z1CA 2NV1A 4W89A 1G7VA 3KL3A 1HL8A 2WCGA 4FF5A 1JCLA 4OOZA 4RZ4A 3T78A 1MWOA 2F9RA 2GJXB 3LBOA 5B7ZA 1TPH1 4DEFA 3VCNA 5J5DA 2E6DA 4JFWA 4Z0SA 2CWNA 4DF1A 4ZVJA 4O18A 2Y7GA 3WFLA 4EPBC 2C15A 3QY6A 3ZJ8A 4JDBA 4AIEA 3HGRA 3HB9A 3OODA 4M81A 5DF0A 5AOUA 3UVIA 1CNVA 3AAMA 3DHUA 2HTMA 3N11A 2HCVA 3TJ4A 4JTJA 1S5WA 3KUMA 1R30A 4L4PA 1S5NA 5A2AA 2C1IA 1TTPA 3UWEA 3UCQA 3T6CA 1UC5A 1J6OA 3O07A 4AVNA 3WLLA 5A6BA 3E02A 3TWAA 4CEXC 1P6WA 4NJKA 2HK0A 3STEA 4L64A 3S9IA 1XRTA 4KWVA 4NZ4A 1H49A 1UPPA 4O0QA 5D33A 4W5ZA 5BYWA 3CIVA 3VD9A 1XCFA 1HKJA 2VFFA 3PPGA 3GC2A 1UWQA 2R1KA 5FF2A 1B3XA 5AC4A 2QT3A 1DTUA 3R11A 2Y88A 1R7OA 3EX3A 4DELA 3LSCA 3T1GA 3O1NA 1FFQA 4CCEA 2E4TA 1LLOA 1FP8A 1PWMA 5BU6A 2P0IA 2ACRA 2WVTA 4EANA 1IYXA 4JTTA 3W85A 1FXQA 2QF8A 2DV0A 3C2FA 2DQWA 5HNNA 1Y5VA 1YRRA 1E51A 3CZGA 3OOQA 2BY0A 4QX4A 1VPXA 3GK0A 2QULA 3CB3A 1G94A 3EXRA 2QCNA 5DN1A 1OG0A 1ODUA 1L2QA 2W67A 2V38A 4JTAA 4ZR8A 1NY1A 4Z1DA 3UVAA 3O06A 2VEKA 1U2YA 2YR1A 3M5XA 4FP1A 1EX5A 4IFOA 2P50A 4JGDA 3WJZA 3WMSA 1XKYA 2QCHA 4G7FA 1V3KA 2VNCA 2O4MA 4FLQA 3OA3A 3CZEA 2YXOA 3THUA 3VIHA 1UROA 1UQZA 5TNVA 3RDKA 3W29A 5A2BA 1EDQA 1RJQA 4FOUA 4AMAA 4QFUA 1EJTC 2C1HA 4H00A 4ICCX 1UH4A 3AQUA 1B3ZA 5D2WA 1IT0A 1OSEA 4HZ7A 3UR5A 1FDZA 1VD6A 1TPWA 1MUCA 3KL5A 4PZVA 4MNKA 2HK1A 4LVDA 3TR2A 3W7QA 3MP5A 3C0JA 1OCBA 3DCPA 1JPDX 3VIMA 3VC6A 1R86A 3MW7A 4NZCA 1WBHA 1AVAA 1W3TA 2MUCA 2ZZ6A 1T5AA 2D23A 5CSSA 1JYXA 3GDRA 4WDXA 3VOGA 5C54A 1W1TA 2ZDSA 2A2IA 4F2UA 4F2BA 4O0ZA 3PZQA 3AIUA 3BLEA 1E71M 2BHUA 2O7SA 1OF8A 4GCXA 1G4EA 2G95A 2FPYA 4XUYA 4PGLA 1M01A 4S39A 3VOIA 3NQDA 4E8GA 1TWZA 3ES7A 2WV8A 1JI1A 1RVKA 3IJIA 1QASA 2JK2A 3W2MA 2CZVA 2W63A 2OSXA 3SSJA 4NJHA 3CMFA 1P4CA 1KM5A 1IZCA 2D24A 1B30A 3D5HA 3NM1A 4O54A 3W7PA 3WNMA 3NR0A 2XN0A 5CSYA 1FWEC 4D71A 5LIUX 3CZ8A 2QIWA 2NW0A 1KWKA 4GE8A 4PB4A 4MKNA 1X6NA 2BZNA 4AFYA 4JOMA 1J0JA 3LXBA 5D9PA 1ISXA 4Q8TA 2Y7DA 1E6RA 4DWDA 3SUVA 1I0BA 2A0NA 4M29A 1JZ5A 2PDGA 4HTYA 1LOSA 5CZ0A 3BL3A 4X9SA 4BI6A 2DQXA 4IX2A 1P0KA 3MPGA 2WM0A 2J6VA 1SFJA 1BQCA 4ACYA 1M7PA 3BG9A 3XINA 3MSRA 2QCFA 2OODA 3MCNA