3CT7A

Crystal structure of d-allulose 6-phosphate 3-epimerase from escherichia coli k-12
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENIDEAWRIMTAQILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-allulose-6-phosphate 3-epimerase
publication title Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.-:
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ct7A00
3KVMA 3L0NA 3OVPA 3EXTA 1QPRA 3UNDA 3NQFA 2O7QA 4H3DA 3NZRA 1SO5A 1TV8A 1RPXA 5CZSA 1X6UA 1ICPA 4L4LA 1DOSA 3GDMA 3LHWA 1XXXA 1H7RA 4ZMGA 4XKYA 1U83A 4MFDA 2V9DA 3NQMA 4TX9A 2DJLA 1S3HA 1JUEA 4MIMA 2BXVA 3STGA 3PB0A 3MJYA 3QH2A 3NM3A 4X9SA 5A8GA 4QAIA 1ZFJA 4QM1A 4BK9A 4MZYA 3THAA 3KRUA 2D73A 1FXQA 2DZSA 4UMBA 1LLWA 4GBUA 4LOCA 3A24A 2ZZ3A 1Z44A 2QUVA 3LGEA 3NQAA 4RR4A 4JICA 4ZQRA 2Y6ZA 8TIMA 4JTHA 4M5PA 1W8SA 3W85A 1MEHA 2Y61A 4RCXA 1F6PA 5DBTA 2R94A 1K8XA 4JTIA 1WQ5A 3G1SA 1JUKA 1GZGA 3CIXA 4JR5A 1MEIA 1TPUA 2RDWA 4UFJA 1VRDA 2Z1BA 4UTJA 3UWVA 4IWWA 4XQ6A 3UZ5A 4RX0A 4HIBA 4KFNA 3G18A 2DORA 1L9WA 1A5AA 3GB6A 1WOBA 2TYSA 3PSWA 4CQAA 2P1FA 2V2HA 5I3KA 3HQ1A 4E2DA 1KV8A 1HFBA 1XBXA 2PURA 4FXSA 4NUWA 3DFPA 1VZWA 3E12A 2ZBTA 5LGZA 3W07A 3NQ7A 4M7TA 1OHLA 3C2RA 3V75A 3I6RA 2Z6JA 4R53A 3PR2A 1QWGA 3PUEA 1KFCA 1N55A 3DFOA 4UFIA 3M5ZA 4FNUA 1UUMA 4LWWA 3SSJA 5LNWA 2QEZA 5AB3A 1OX4A 3PB2A 3CLMA 2J24A 3W1QA 4ADTA 4JY9A 3IVUA 3GZ3A 3GLCA 3UPWA 3PBUA 3B0PA 3TSDA 1QO2A 1H60A 1SU5A 3I7SA 1YADA 1ZY9A 3N9RA 1TB3A 4IX0A 3P5ZA 1VHCA 2DZTA 3W2UA 4MY8A 1YPIA 5HUPA 1JQXA 1D3HA 3KRSA 3STCA 3T78A 1Q3NA 4DO4A 1T96A 4FB7A 4UTWC 2CLFA 4RZ6A 1FCUA 4O1CA 5EA9A 3W1AA 1A5BA 1KM1A 4JNMA 2A7RA 4QSHA 4UXDA 5FI8A 5CGQA 1FUYA 4LS2A 4HSNA 4YL2A 1XUZA 4N6FA 1EPXA 1GOXA 4DF1A 1L6YA 1QOPA 2OMAA 3NXFA 1TYGA 3L67A 3P84A 1VC4A 3W7QA 2WKJA 4UFHA 4EF8A 1B4EA 4WJEA 4Z1BA 2A0NA 1FWNA 1GTEA 3G3DA 3PBWA 1VYPX 2OX1A 2YFOA 2VOMA 2PRHA 1W3IA 3TR2A 1NVMA 2OT0A 2Y89A 3FFSA 2A1YA 5DN1A 5K9CA 2PRMA 1KLZA 2NZLA 3W23A 3UZJA 4LV9A 1OF6A 5HUOA 5K3VA 4NZFA 3GX9A 1YDOA 1JCYA 4I7WA 5BW6A 1FDJA 1GG1A 4I7UA 3TJLA 3TXZA 2ABAA 2JK2A 2Y62A 3QJAA 3S5OA 2BTMA 1T8XA 3IGXA 2PCQA 3QMTA 4OBTA 2YFNA 5KINA 4O53A 2CZDA 4AVFA 1VHNA 4RXFA 2ATSA 2R14A 1OFDA 3VI2A 1OYBA 3LLDA 1W1ZA 1WBJA 2JGQA 4O0KA 2A6NA 2TMDA 3A22A 4XBSA 4OV4A 4PCFA 3RNDA 3DU0A 3T4CA 5KZDA 3T44A 3R89A 4MY1A 3TW7A 5D05A 5F4SA 3A23A 3TK7A 3PC0A 3W1RA 3BW4A 1EP2A 1XL9A 2B0MA 3LI0A 4NX5A 5E1QA 1GTHA 1LYXA 2XN0A 2UV8G 2VEKA 3QM3A 2H3DA 1QCWA 2VFHA 4X22A 3B0UX 5AHEA 4ZL1A 3HG2A 4K6AA 4NXSA 1RQBA 3NVTA 1IXOA 1L6SA 4RK8A 3W87A 3FA5A 1H7OA 4GRSA 4O14A 3TMQA 3W2KA 4A29A 5AHNA 5AYZA 3HGRA 1TMHA 3L21A 2ZRYA 4ORMA 4Y9AA 1AL7A 5LZLA 4UTKA 3TAOA 1I4NA 1OF8A 2HSAA 2CLHA 4X2RA 4Z08A 3EKZA 1YPFA 3NO5A 5AN7A 1W5MA 2ISVA 3S5ZA 4NJJA 1GVRA 2XN1A 3UD6A 2NX1A 1W3TA 3K30A 2RH9A 3S5NA 1RZMA 3CWNA 2F84A 1R47A 4MYXA 4JYEA 1AW1A 3EX1A 4MVAA 4MJZA 5HULA 2A7PA 3GDTA 3G1VA 1F76A 2YYUA 3MP3A 1KM3A 1WOAA 3RLVA 1H1ZA 1OFRA 1UB3A 2WPBA 3QRHA 3M5XA 3TX9A 3TW6A 4GJ1A 3S6DA 4Z0JA 5HQEA 3W9ZA 2FTPA 1WYIA 4N4PA 4LS1A 3GK0A 4UTTC 1EEPA 2WO5A 3NNTA 2ZZ5A 5H2ZA 4QISA 2TPSA 4Q4KA 4O10A 2FB3A 3L65A 1OK4A 3MMTA 2ZTKA 4O50A 1G7VA 2V2CA 3PULA 5TQLA 3LCXA 4MLRA 5AFDA 2Y85A 2QCLA 5EBUA 2ZZ2A 3UWWA 2V5BA 1O94A 3P82A 4Z1AA 1LCOA 3SJ3A 1QPNA 1SO3A 3QMRA 3KOFA 1SFLA 4DQWA 2ZA3A 4PC8A 3SECA 4Y8FA 4AHOA 3W7NA 2Q3RA 1XCFA 3PSVA 5G2HA 4LVAA 1VYSX 3TA6A 3IVTA 4DF0A 4Y6GA 2P10A 5AOUA 1N7KA 1HL2A 2JKPA 1DQXA 2BLEA 5KSWA 4UMAA 1A53A 1AK5A 1QPQA 1RQHA 4JTFA 4NJHA 3SY5A 1SO6A 4AWTA 1KTNA 1EUAA 1OYAA 5AHFA 5D30A 1X7FA 3ATZA 3W7LA 5G2WA 3DKLA 5FEZA 3IEBA 1SQ7A 4OQVA 3F4NA 3FKKA 3DGRA 3DFNA 1JRBA 2QJHA 4N9CA 2GQ8A 5G1TA 3FEMA 2Q3OA 3EB2A 2DZXA 4JX4A 1PV8A 4YCPA 2DJXA 3B04A 5AC8A 3N73A 2Q8ZA 3G1AA 3C2OA 4AHPA 3E9AA 1VLIA 3PUOA 1BTMA 4FNPA 3SGZA 3BG5A 3G8EA 1FDYA 2CLEA 3SR7A 3RK8A 1W5NA 4AWUA 2Y7GA 2QJGA 5EL1A 1Q6LA 1BEUA 3DKJA 4K8EA 5C5YA 2QDHA 2J9ZA 4JDYA 5G2IA 1EP1A 1UBSA 3OA3A 5D09A 2BSLA 4UTUA 3CWOX 3NPWA 3KAOA 3PAJA 2VEIA 1YYAA 1FWSA 3W83A 4E0CA 3G8RA 3NQ2A 3E0IA 3S0CA 4DELA 4WD0A 3C61A 1ZAIA 2QCDB 3QPZA 1X1OA 3HMJG 2F7FA 2QUTA 3W74A 4NNAA 5J5RA 4JYFA 1YDVA 3W1LA 2AGKA 1AL8A 3LM7A 4ONVA 4HHPA 1TV5A 2Y63A 2CU0A 4YMZA 5L9FA 4A2RA 3W7OA 1F6KA 3ZS4A 4HPJA 3B0VC 1NFBA 3B8DA 1K8YA 1VJIA 3MI3A 2XFWA 4I9AA 5FEPA 3W75A 3BO9A 4XZ9A 1JCMP 1ZAJA 2C14A 5FF2A 4WUIA 1H7XA 3CQ0A 2FLIA 1SFJA 4UNLA 3M47A 5BOOA 2JGYA 1R30A 1VH7A 1HO1A 4BR1A 4EOUA 4O57A 1KTCA 3E02A 5MHBA 3EWUA 4DPQA 1MXSA 5D02A 1L6WA 2GVLA 1O5XA 3LHUA 3O6DA 4CLMA 3LCLA 4PTNA 5K7JA 3INPA 3NL3A 5KMYA 3HB9A 1C29A 3UWQA 2ZYFA 4Q33A 2Y7FA 3NAVA 4ADUA 2J88A 3D0CA 1G7UA 2GUUA 3Q2DA 3EX6A 2VEPA 3HG4A 4LUJA 3G1YA 3RU6A 1GQNA 1KTBA 1K02A 4PEKA 4UUIA 3B06A 1G6CA 3BK0A 3S42A 3LXCA 3BGGA 3P61A 1OFBA 3W1NA 1PCKA 5AC7A 4AHQA 1GVOA 2G95A 3LTPA 1KFBA 3TDFA 4KWWA 1H7WA 3BG3A 4MFEA 4UMCA 3FKRA 4N4QA 3NPVA 4A22A 2A5HA 1GWJA 2QCHA 3A21A 3FOKA 3O63A 4IUOA 3UWYA 3HO8A 2G97A 1G69A 1WXJA 1Q45A 3C2VA 3LCFA 4JTSA 4Z0SA 1J2WA 3JRKA 3SGUA 3G1FA 3IGSA 1CX9A 1P0NA 1W31A 1LOLA 3TXVA 3LBCA 3IIZA 4GUHA 3PUDA 2GQAA 4HT3A 4LC8A 3WJWA 3W7CA 1ZJIA 3B05A 1DJNA 3F1QA 4UR8A 1JCJA 4O1BA 5E0KA 1XUUA 3OVRA 3OBKA 4RKAA 4CNOA 4BI5A 3DXIA 2VC6A 1GT8A 4XKYB 1O95A 1SZGA 4QQ3A 5F1UA 2X1UA 1DORA 3TIMA 1V5XA 1OFPA 2V8ZA 1JCXA 3CTLA 1HTIA 3R13A 1J5TA 3WK2A 4K7VA 3VFLA 4O4VA 2YXGA 1JUBA 2JKEA 1KFLA 3U6WA 2G5WA 3BW3A 1OG0A 3AO0A 5BMXA 3HJZA 5CPMA 4S2BA 4EWND 3TFCA 1LZOA 2C1HA 2DZPA 3G3MA 1ZALA 2Z0IA 3L2IA 2VFEA 3RLUA 1OFEA 3H53A 4GUFA 3Q58A 3EWWA 1I2PA 4JTUA 1W3NA 2EHHA 2CFFA 4Z1DA 1YLVA 3NYZA 1TSIA 3KRZA 4WQ6A 1HO4A 2EPHA 4XTDA 1P1XA 4NJKA 1SW0A 3DFQA 1KBIA 3M44A 3N34A 5G4WA 2YDAA 4K38A 4ZQMA 2H8ZA 3C4UA 3EX4A 1FCQA 2J9XA 2ZTJA 4WXYA 4XBKA 3LV6A 3S1VA 1PIIA 4CNNA 1EWEA 4AH7A 4FNSA 4PA8A 4CCCA 1WV2A 3HGOA 1QPOA 2OT1A 3NQGA 3GNNA 4UNKA 2X1TA 3QW3A 2YR1A 3TSBA 5CPNA 3LHTA 1Z41A 1LRNA 3TAKA 1THFD 3I68A 3LB0A 2EF9A 2RDTA 3P8IA 5F2LA 2ZZ4A 3JS3A 4LVGA 1O60A 4R7JA 1XKYA 4IMEA 4MKNA 3G1XA 3M41A 1TQXA 4WX2A 3GDRA 5CPOA 4BF9A 3L66A 3M9YA 5AYXA 1XM3A 3I7RA 1W0MA 2E77A 4GUGA 4UTMA 3KX6A 1TIMA 4EVZA 1EWDA 5HWMA 1IXNA 3TCEA 4Y96A 1OX4B 2VENA 1P0KA 4KWVA 4OHQA 1XI3A 2X30A 3CEUA 2ZRWA 4RJEA 1GG0A 3P62A 4E38A 2HS8A 4O54A 5K2ZA 1W54A 5LNUA 3WK1A 1LDCA 3GXPA 1O5KA 3T7VA 3V1PA 3CB8A 1YDNA 3E49A 5KITA 3GNDA 2J27A 2OJPA 1PCWA 2GOUA 3W71A 3QYQA 1OYCA 5J5DA 5I3GA 1LOQA 4KFOA 3TFXA 1D9EA 3OIXA 4HSOA 4UIOA 3M5YA 2C6QA 2E09A 2NXHA 3FLUA 2ZA2A 4MOZA 4LC6A 3B03A 3GDKA 3KXQA 2A2IA 3LHYA 2WOQA 1K7XA 2VEMA 5D04C 1GYNA 3C3NA 3W73A 2A85A 4UFKA 4CQ8A 1H7PA 3GAYA 3JR2A 1F5ZA 3H54A 3DHFA 3MBDA 3C6CA 3LRLA 3I65A 3LRKA 1QO5A 3PVFA 5SWUA 4BWLC 4JTGA 3WFAA 4FX6M 4UTHA 1ME9A 3NGJA 2B7NA 4MJMA 3CPRA 5C55A 1RV8A 2WQPA 5I3HA 4UTTA 3NDOA 3GYEA 3NQEA 1MO0A 4OU1A 1FQ0A 4ADSA 3TQVA 3FYPA 1KFEA 4BFAA 4GFSA 3IIOA 1Q6QA 1F05A 1WX0A 3QZEA 2NWRA 4BI6A 1LP6A 3FYOA 1IIHA 3G1HA 1K3UA 1JVNA 1GPWA 5DXYA 2GVJA 4AEOA 4OWGA 1QDSA 1FCVA 4HNVA 5A5WA 1JCLA 5DCBA 3O15A 4FX7A 4O15A 4ZQCA 3CEPA 3QF0A 2QCMA 4UTIA 1OX6A 4S1FA 4JX6A 1TPWA 5D2WA 4HNUA 4YXGA 3OG3A 1VR6A 5CZJA 2QJIA 4HNTA 3IV3A 1IXQA 1PS9A 3MP4A 3G24A 3SZ8A 5F2IA 4PFMA 3UY7A 4LTSA 1KLYA 5K4XA 2C13A 2FPVA 5FF4A 5K4ZA 2E6YA 4WY0F 1YXDA 3NQVA 3NQDA 2KZHA 2NXGA 1T0OA 2Q8LA 4WOZA 3SFKA 2H6RA 3LXAA 4LV4A 1VLWA 2VFDA 2V82A 3NQ6A 1XDLA 2Z6IA 3L68A 1R46A 4NXKA 5TBOA 1E51A 5U4NA 4ALDA 1SSDA 3NM1A 4M19A 3QQ0A 1KFKA 4LUIA 1TRDA 3TROA 1W5QA 1M6JA 4NQ1A 1I8JA 3C2FA 3W72A 5LSMA 4JXCA 1YXYA 5K9XA 4UCGA 1WBHA 4IGHA 1ZAHA 3IGUA 3MUXA 5LNVA 3G0UA 4TMCA 3BPWA 4NU7A 3G0XA 1RVGA 5CPLA 2E5CA 5F4WA 1WDWA 1OFOA 3ABSA 3ZFHA 3S1WA 1ML1A 4HNNA 3DFSA 3TU9A 2LLEA 4A21A 2J9YA 3BG9A 2C19A 3UXDA 2QCFA 5GVJA 2EGZA 1TTIA 3EWYA 2H8XA 4JIPA 2NXIA 4JIQA 4FNRA 6ALDA 3N2XA 1UJPA 1VPXA 1B4KA 2ZQ0A 2QDGA 1UASA 4DPPA 4LRTA 3LHVA 3SW6A 3PS7A 3PG9A 1F2JA 1M7OA 3AJXA 4TMBA 3HG5A 4MZ8A 5D2XA 1CI1A 4K7YA 1HUVA 4QNEA 4OV9A 1V7YA 4ZQNA 1O4UA 1LBLA 5EYWA 5HMSA 3TKFA 3ABQA 1Z48A 3S1XA 2OCZA 5DLCA 1TPVA 5HNRA 3Q94A 4LU0A 2VFGA 3W88A 2RKXA 1SUXA 3Q37A 2CLLA 5IBXC 2NV2A 3QFEA 3ABOA 1J4EA 3GAKA 3P80A 3W76A 4DBEA 5DY2A 5AHIA 4EF9A 2OZ0A 3TC6A 5LHEA 2ZZ1A 3HBLA 2BX7A 3USBA 1K8ZA 3HG3A 1NF0A 1ZENA 1XBVA 3DHDA 1U5JA 4RZ4A 1VCVA 1Z42A 2ZRUA 4K36A 4CCEA 3A5VA 3CU2A 4N9EA 4AAJA 4Z1CA 1PL9A 3LBMA 2QCNA 4AF0A 1RD5A 4YWIA 1FWRA 3MYPA 5EKYA 3NQ8A 3TQKA 2YW3A 2HS6A 4S2CA 3CIWA 1TPH1 1TTPA 1LRQA 2QCCA 3P5YA 3W7PA 1EX5A 3P60A 2DP3A 4LVDA 2C18A 3LTSA 3LTYA 4AMAA 2Y88A 1UUOA 1Y0EA 1W37A 1I45A 4LNYA 4HPXA 3TSMA 3W7EA 5ABTA 3IIXA 1DHPA 1BWKA 3I7QA 3BW2A 2YGYA 4Y90A 4GXMA 1XFBA 4FEZA 3W2NA 2Y70A 2A7NA 2G96A 2DZVA 3LV5A 1W5PA 2RFGA 2PC4A 2WSQA 3KFTA 4POCA 1TQJA 3ELFA 5FF0A 3W1MA 5D2VA 3L5LA 3O1NA 1SSGA 2ZZ6A 4O12A 4IXXA 3UYCA 3L5MA 3S5YA 2QKFA 4LVFA 4E2BA 1W56A 4JTEA 4O17A 1TPB1 1X1ZA 2WNZA 3PM6A 3RFAA 3L0KA 2AAMA 2WSRA 3W7RA 3W6YA 3QSRA 1AW2A 1M5WA 5G5IA 3LDVA 4JDBA 3PWAA 4QITA 4U28A 4UTLA 3E96A 3QQ1A 4FIQA 3UY8A 3VE9A 1AW5A 2W6RA 1JCNA 2NWSA 3LXBA 3MI6A 2E5DA 3T55A 3MP5A 3C2EA 3P67A 4O18A 1P5BA 1LM1A 1TRIA 1JJKA 4XWUA 3S9YA 5HWNA 3OEXA 4K8HA 1TTQA 4HN4A 3IIPA 3WK0A 3HPXA 1GVQA 1R2SA 2C3ZA 3M7WA 4IQLA 1QFEA 3PF3A 3HIJA 2X1RA 3DAQA 2DZUA 4NNBA 2FPTA 3W84A 1FDZA 3M1ZA 1N8FA 1OJXA 4NZJA 5EY5A 3GXNA 4N2YA 4Q32A 3W7HA 1IGSA 4IOTA 4IMCA 3ZWSA 3QW4B 1H62A 1I2QA 4JYDA 1KM5A 5CSRA 1B57A 3W1TA 3EXSA 2YZRA 3W1XA 3DFTA 1EIXA 2B7OA 3FJLA 1XC4A 3LCGA 4IMGA 3THQA 4O4WA 1DQWA 4P61A 5DCEA 1G67A 3TJXA 4NJIA 2B7PA 2E68A 5E93A 4PODA 3HPZA 3GXTA 2CZFA 2RDUA 2WNNA 4IX2A 3MHFA 5FF7A 1DJQA 4LS0A 2GQ9A 1H63A 3NL2A 4YLWA 4OGZA 5D2YA 4M6PA 1UCWA 3DH7A 2FIQA 3VNDA 2E5BA 5LNRA 5H91A 3MI2A 1R2TA 3W7IA 4UTWA 4AWSA 5D33A 4C1KA 1RR2A 5LKYA 2NV1A 4NJGA 4FX8A 4K37A 3CC1A 3G22A 1C8VA 2E1DA 3TNOA 3MBFA 1I2OA 4MLJA 5F1VA 1GVFA 5AYYA 2NX3A 3C0JA 5CZ0A 5I3FA 1ME8A 4R34A 1XBYA 2ZFAA 3ABRA 3DENA 3EKLA 4RV8A 3TQ0A 1NF7A 4AXKA 3DBPA 3P7YA 1DV7A 3GR7A 3PBYA 4RXGA 5D38A 4O13A 1SO4A 4JGDA 1OFQA 5EMUA 2CLOA 4W9TA 5T26A 2TSYA 1FY6A 1I2NA 1KM0A 2X16A 1VYRA 2QCGA 2V81A 1DBTA 3LX9A 5DCDA 4U4MA 1SZNA 4GWEA 1GJPA 1DL3A 3N3MA 4BWLA 4D2JA 4HKPA 3NZ1A 2EKCA 1FXPA 1WA3A 2FDSA 3PG8A 4UFMA 4LT9A 1A5CA 2X2GA 2C15A 3W7JA 4FF7A 3STFA 1R2RA 1VCGA 1S5TA 1KW1A 3QPYA 3RF9A 4O16A 1BKSA 1M7PA 4OT7A 1PE1A 2WJZA 3KVLA 3TC7A 1ME7A 4YCOA 3W3OA 1TPDA 1ALDA 3NR0A 3QEZA 1JR1A 4LRSA 1W5OA 2YPIA 4NVTA 4ZVJA 2A21A 2H90A 1TJRA 3MHUA 1TCDA 3HOJA 4X3ZA 3NEVA 3A9IA 1ZHAA 3SI9A 4XUGA 5AC6A 1ONRA 3M16A 1TV7A 4IMDA 4AB4A 1S5VA 3W7MA 3DZ1A 2PRLA 5I3IA 2I14A 3MYOA 4MY9A 1OK6A 4JTTA 3OHIA 4JTLA 5D2TA 1K7EA 3M43A 3UXAA 2DU2A 4LW7A 5FEWA 1MZHA 2DZWA 5F4XA 4KFPA 2J6XA 3VKJA 1DVJA 5G1YA 4IMFA 3VE7A 2CLMA 4N9BA 2GJNA 5CG7A 2VFIA 3N19B 5F2MA 4MZ1A 1EB3A 4GNJA 1C9DA 1LBMA 4TIMA 1VQTA 5D37A 1F74A 4JY8A 2ZCGA 2W0UA 4WOQA 3KVKA 1VGAA 4JN6A 2FQIA 4QNWA 4DF2A 4DO6A 4NNCA 3HGSA 3UWZA 1TREA 1VCFA 2ZRZA 1NAL1 3CM4A 4QJ1A 4M6VA 2B4GA 2JBMA 3BGJA 1F73A 1LORA 5C54A 2AQWA 3PY2A 3GKFA 4G1KA 3LI1A 3TUUA 1SR9A 3R12A 1QNVA 4O28A 2NUXA 1P4CA 1TTJA 5KZMA 3GDLA 3DI0A 4OE7A 3W7GA 4B5NA 4WY0A 2CLKA 3BLIA 5C2XA 5LNSA 2QCEA 1H61A 1SZEA 4DXVA 3PBVA 3EWBX 2VELA 4H6KA 5EPDA 3OVQA 3UWUA 4WY0B 5BNKA 3GVGA 4TU1A 5LGXA 4DBDA 2E6AA 3LLFA 1B3OA 1H7NA 4LY8A 3LCWA 4A3UA 1XBZA 2NUYA 3BV4A 3LERA 1IXPA 2I1OA 4N02A 2I9EA 1KV5A 3W22A 2GVGA 3WJZA 1JRCA 2B7QA 4LVBA 3EWXA 1KM6A 3R5EA 1OX5A 1S5WA 2VFFA 4NX0A 3A5FA 5DY3A 4NT0A 3O05A 1OFAA 1X8FA 2R8WA 3BARA 1ICQA 2FPYA 3ZR4A 4K39A 1H1YA 2VXNA 3QMSA 1RQEA 5L6UA 2WNQA 3HGJA 3MWAA 1TO3A 2ISSA 5CKSA 2V0TA 2CZ5A 2GJLA 1ADOA 3O6YX 2V5LA 4O1AA 4O1DA 5TIMA 2CLIA 4GUIA 1CW2A 1G4PA 2CZEA 5K9DA 5IBXA 3C8FA 3NL5A 3TV8A 3BVJA 3N14A 3LHZA 4FNQA 4JX5A 2P0OA 1HG3A 4PH6A 3GR8A 1ZCOA 5DBUA 2NX9A 4JD4A 3NOEA 3FIGA 1QOQA 4TO8A 2QAFA 2PE4A 3NPXA 1FCBA 2HMCA 3FS2A 4ZQPA 4QIUA 3EX2A 1K03A 1ZNNA 4O52A 4CNPA 3G1DA 1H51A 3M5VA 1KM4A 5HJLA 2V30A 4M6QA 3N2MA 1MEWA 4MYAA 3SIZA 1G4TA 3W2JA 1KBJA 1H50A 1AG1O 1L2UA 3EX3A 4IPIA 4UFLA 5LHFA 1OABA 1K7FA 4TR9A 1G4SA 5G4EA 3LCHA 2E6FA 6TIMA 4GC4A 1QMLA 3NL6A 2IQTA 2YYTA 3O07A 4KKXA 4IPJA 2WSYA 5CSSA 3LOTA 4O11A 2C16A 2W79A 2YSWA 3L5AA 3IRDA 3IVSA 3W1UA 5FESA 1QR7A 2CWNA 1YTEA 1FWWA 1A50A 3BLFA 5C6MA 1SPQA 4FNTA 2V2DA 4JS3A 3L9CA 1IF2A 2CW6A 3M6YA 3MW7A 4ML9A 4JEQA 3UPBA 5FEXA 3W2LA 4P2VA 3NPUA 4JTJA 1LRTA 4ZQOA 5KTLA 1GYLA 3WJSA 1FBAA 2R91A 2YX0A 3T40A 3LRMA 2A4AA 5I3JA 1D3GA 2O7SA 4C1LA 4CQ9A 1SW3A 3O16A 1YTDA 3TH6A 2RHGA 4CCDA 4IXHA 1XDMA 4N9DA 4IJBA 2QUUA 3EXRA 3U2OA 3M0ZA 5AHMA 3N9SA 1MSSA 3W1PA 5D03A 4PL1A 1DKWA 3H55A 1GVSA 3R8RA 3R2GA 2BZNA 3BLEA 1G4EA 4I7VA 1NSJA 4MPQA 2ABBA 2WV8A 1Q6OA 4M7SA 1KM2A 1A5SA 1VS1A 2ZZ7A 5BMWA 2ATMA 4DEFA 3ZWTA 4RZ5A 2ALDA 2H3BA 1LLZA 3L0GA 2C0AA 3KVJA 3LCIA 3TMLA 3O8AA 5HWJA 3VCRA 3O6CA 2TRSA 4PL2A 2QR6A 3ATYA 3P8JA 3W70A 1EP3A 2ZDRA 1ICSA 3MO7A 4UC5A 1T99A 3RMJA 3STEA 3F03K 2QCDA 3EWZA 1PHQA 1WAUA 1I2RA 1SZFA 2Y7DA 3NQCA 4AF0B 4A2SA 1NEYA 1TPC1 3W86A 1JQVA 1TPFA 3HF3A 4O0ZA 3YPIA 2X1SA 5HINA 3IIVA 5D32A 3P81A 2E6DA 4XTIA 1Q6RA 1AMKA 4GE8A 4RLIA 1BWLA 1OVDA 3WJYA 3WK3A 4GUJA 1LTDA 4ICNA 2ISWA 1EUNA 3O06A 2EAWA 2A6LA 2JKAA 2YCEA 3ANYA 1LOSA 3DI1A 5AHLA 5FF3A 2GPTA 1LBFA 3QC3A 4EIVA 2QAPA 1PVNA 3C52A 5IM51 2QF7A 3F4WA 3GIYA 3U8GA 4BI7A 2BWGA 1F7BA 3EEGA 1PHWA 3FJ6A 1LROA 3GKAA 4WXZA 4UR7A 4R33A 2NUWA 1GEQA 4JTKA 2VKZG 4FIRA 1KFJA 4DO5A 5HR7A 3TE9A 5CZTA 3UQNA 1YXCA 3CT7A 5F2GA 3W2MA 2XN2A 1SW7A 2HTMA 1FX6A 2ZA1A 3S8HA 3WJXA 4FHAA 4WZHA 4L4MA 3MHGA 2Y7EA 5DELA 1JULA 4MUZA 1FWTA 3P74A 1QAPA 7TIMA 3KHJA 4N6EA 3NA8A 1IIGA 2Z2UA 1EA0A 3CHVA 5U7SA 1B9BA 3W7KA 4FXRA 1KA9F 2ZRVA 3QSTA 2NLIA 3C56A 5HR6A 4O19A 2YW4A 4J9JA 4ORIA 2ZRXA 5BRBA 2FFCA 4FO4A 2FB2A 4O8RA 1TPEA 3S1UA 1TJPA 3G0SA 2FJKA 4H4IA 5DXXA 3NG3A 3B4UA 3W7DA 5KZEA 1H5YA 3HPSA 4ZZ9A 1YTKA
chains in the Genus database with same CATH superfamily
2CZVA 4DHGA 3L0NA 1WZLA 2OFJA 2VRKA 1NU5A 3W6LA 1XC6A 3SUSA 2ALRA 2O7QA 3NZRA 1SO5A 4UQDA 1X6NA 3N6QA 5CZSA 2D2GA 1PSCA 2VD9A 2OKOA 1JZ2A 4BF5A 1GQKA 1ICPA 4L4LA 1PYFA 4ZMGA 4MNKA 4XKYA 1E1EA 5H8PA 3ES8A 4US5A 3NQMA 3ITTA 3BAXA 4HVXA 4KIRA 3LSCA 1Q85A 4QR6A 4MIMA 2BXVA 2YA1A 5HNNA 5LIUX 2ZUTA 3MJYA 4P7NA 4O8AA 4BK9A 1UR8A 1UZ4A 3EOUA 2D73A 2I5GA 1FXQA 3AZRA 1HKMA 3KL5A 3DUGA 3PZMA 1OZQA 2QUVA 3LGEA 4JKLA 4JZ5A 3U9IA 4JICA 3KUMA 4JTHA 1CGVA 2WW5A 3ANVA 2Y61A 4CD6A 1QU4A 3W37A 1K8XA 1WQ5A 4YTUA 1GZGA 3ZMRA 1E6PA 4S3JA 5HQLA 1A47A 3H4GA 4AVOA 2RDWA 2Z1BA 4OUEA 4Q8NA 2Z28A 2XGIA 1E71M 1L9WA 1J96A 1BF6A 3GB6A 3AIBA 2V2HA 1J0KA 2EQDA 2PLMA 1EDQA 2PURA 3NSNA 3ZLFA 1VZWA 1FHLA 4M0XA 4MB1A 1B2YA 1HVXA 3ZSTA 3WQVA 3C2RA 3I6RA 2OEJA 3NVDA 1LQ2A 2X0SA 2ISDA 1JPDX 3PR2A 1QWGA 3QR3A 1B90A 2TODA 2CEQA 3U4AA 2G4FA 2J62A 2QEZA 5AB3A 3WL0A 3W1QA 3ZJKA 1JPMA 5JXQA 3GD6A 4XD6A 3GZ3A 3GLCA 2E7FA 2FDMA 2P3EA 1UC4A 3PBUA 1WDQA 1UPPA 2D2JA 3K8KA 3B9OA 1K9FA 1SU5A 3MY9A 4HU8A 1YADA 3GDBA 4EAMA 2QPXA 3WD0A 3RM8A 1DWFM 1UWUA 1D3HA 3STCA 3T78A 2GGHA 4C6CA 4QHRA 3UZZA 3W1AA 1QI2A 1M53A 4UXDA 3W00A 3UA4A 2YLAA 5A8PA 4S3KA 3VUPA 1GOXA 4GI9A 1AQMA 1K6AA 2ZIDA 3P84A 4IJCA 4UWMA 4UB9A 4Z1BA 1RK6A 1GTEA 1W3IA 3TR2A 3HZ3A 2OT0A 1XLLA 2A1YA 1MFUA 1R3RA 4LV9A 5HUOA 5GJMA 4PCSA 4NZFA 4A8RA 4XIAA 1E9YB 4QX4A 3B8VA 4AC1X 2IPGA 1GG1A 2ABAA 1KBKA 2PGRA 2B31A 3QJAA 1T8XA 3PZQA 1O6IA 2QHAA 4AVFA 3TA9A 2R14A 3VI2A 1OYBA 2HV5A 3LLDA 3ICJA 1T8QA 1W1ZA 2EKGA 2JGQA 4O0KA 4EWJA 2A6NA 4HJWA 4DZ5A 3A22A 1XISA 1XLMA 4OV4A 4PCFA 5AZ1A 3DU0A 5LIKX 3REQB 5A2BA 1VF8A 2EJ1A 1W91A 5DMMA 3KHDA 3BW4A 2B0MA 5E1QA 1LYXA 4C6DA 2EPKX 4HCLA 3B0UX 4F2UA 5AHEA 5A6KA 4K6AA 3S9ZA 3NVTA 1XLHA 2PFHA 2G0WA 3K8MA 1L6SA 3W87A 2VC7A 1TX2A 1EX1A 5D9MA 3W2KA 1IZKA 2YA0A 2ZRYA 4ORMA 1AL7A 3W29A 4UTKA 1I4NA 1OF8A 2O56A 4IP4A 1V3LA 2E9BA 2HROA 3UEQA 4X2RA 1SJDA 4YS1A 3ZJ8A 2A3BA 2PWDA 1P6CA 1OB0A 4XBJA 1T6MA 1TUXA 1RLCL 3CMJA 1E56A 2WVUA 3XIMA 2AKZA 2OR2A 3W26A 3AS2A 3GWQA 1R47A 2ACUA 3GH7A 3CHDA 4XKMA 2ZX8A 3P2VA 4B5UA 1F76A 1TFVA 3USZA 3MP3A 1KM3A 3SBFA 4GY7A 1Y5XA 1H1ZA 2WPBA 5I09A 2OWXA 4HU0A 2A3LA 3TW6A 3SQMA 5IFPA 4FOKA 2Q6ZA 4H7CA 4B2DD 2WO5A 4JAWA 4WSJA 4QISA 3UT0A 2TPSA 2BVYA 2EPNA 3VUSA 1HT6A 1OK4A 4NRSA 1V02E 2X40A 3LCXA 1PZ1A 1J5SA 5AFDA 1KRAC 4U10A 4DYEA 1RVKA 2QCLA 1ECQA 2E8YA 1MRQA 3UWWA 1XIHA 3P82A 1LCOA 4PGLA 4GY1A 1OT1A 1XLAA 4I8YA 4Y8FA 3HV9A 3W7NA 2XIQA 4LPCA 2QPSA 2F38A 1W9BM 2PP3A 4DAFA 1RCQA 4WGHA 1V0LA 2BLEA 5KSWA 4UMAA 3CO8A 5FSDC 3MCMA 1XH1A 4JTFA 4NJHA 1U33A 4AWTA 3II1A 3H21A 5AHFA 3ATZA 3W7LA 5G2WA 3DKLA 1QUMA 3D6NA 2GZXA 1LWHA 4QROA 4OQVA 4RV3A 3E5PA 3WQWA 1XRFA 3DGRA 3DFNA 4MB4A 1JRBA 4HOWA 2XIBA 3OW1A 2GQ8A 4JTAA 8RUCA 2Q3OA 5GNXA 3FA3A 2HPIA 1RA0A 3OJGA 1WE5A 1CXFA 3E9AA 1VLIA 1PTAA 4FAMA 1V6TA 4DI8A 3K46A 4AWUA 5IDIA 2Y7GA 2DIEA 3IAPA 1KRCC 3KWSA 3PPGA 1Q8AA 5AY7A 4XVDA 2W67A 5C5YA 2QDHA 4LCSA 3KAOA 4JQ1A 3G8RA 3E0IA 1AVAA 3C61A 3WNPA 2OLAA 3W74A 3WNLA 1Q66A 4NNAA 4JYFA 1YDVA 4BJHA 4R27A 3WSUA 2H9AB 3M4HA 2Z1KA 3CTTA 3EPOA 4AY8A 3W7OA 1F6KA 1Q8JA 2Q09A 1NFBA 1K8YA 1XD0A 3MI3A 3CUXA 1E0UA 3BCDA 4ZE4A 5FF2A 1U1HA 3R25A 4WUIA 1DE6A 1OD8A 1FH8A 3ITYA 2JGYA 4X60A 3ZSSA 1VH7A 3H2CA 2Z1XA 4GQBA 1CCWB 4HCDA 1OCJA 1SR0A 2B81A 1KTCA 3E02A 5ECUA 4H01A 2BS9A 1TJ2A 2VRJA 4DPQA 2DSKA 2C8NA 2GVLA 4NILA 3O6DA 4CLMA 3LA4A 3NL3A 5KMYA 3ZLHA 2R1PA 2V63A 4AZGA 1W3KA 1W2VA 1UR0A 3K8LA 3HA1A 2WMIA 2GUUA 4LUJA 3RU6A 2V5CA 1FH7A 1Q2RA 2G8ZA 1P48A 3B06A 1BD0A 3BK0A 4HZ8A 3BGGA 3P61A 1OFBA 4K8GA 4HP5A 4OOZA 4ACZA 5AC7A 1GVOA 3FAWA 4RE2A 3A12A 3ARYA 4HJFA 3EOEA 3BG3A 2DQXA 2POTA 3DESA 3K5XA 1DIEA 4C6JA 3N25A 4YJ5A 3DG7A 2QCHA 4I9TA 1EOMA 4IUOA 1TZZA 2E28A 4KH2A 1WXJA 4RDYA 1Q45A 1UG6A 3LCFA 1J2WA 3VD4A 4JPGA 1DJHA 1P0NA 4JN7A 3GW3A 2NVDA 4GUHA 3WJWA 3W7CA 4AD5A 4H9YA 1TV4A 3URQA 1DJNA 4KIEA 1E6QM 3H12A 4PUJA 1R9ZA 1GT8A 1O95A 2XM2A 1DORA 3GNXA 3TIMA 2VDGA 3B8IA 3WQCA 2EPMX 4D9PA 2VURA 1ZGDA 3VNYA 3R13A 4K7VA 1JYVA 1V93A 4O4VA 1XDJA 1KFLA 3U6WA 1B1YA 3GSMA 3PFRA 4CVWA 3TFCA 1ISVA 3POCA 1LZOA 3FNDA 2Z0IA 3CB3A 3ABXA 3L2IA 4MB3A 5DANA 3TWBA 4DJFD 3WLQA 3H53A 4RW5A 1KXHA 4GUFA 4OBRA 2EHHA 4Z1DA 1V08A 1YLVA 4PRRA 2EPHA 1P1XA 4NJKA 2Q02A 1R7OA 4J5NA 2H8ZA 4ZQMA 5HNUA 1FCQA 1TVLA 3FEQA 1FWHC 1B30A 1WUEA 5BRQA 3KTCA 1EWEA 3CV7A 3WD4A 1I60A 4WRHA 2OT1A 3GNNA 4ERGA 2YR1A 1YE4A 2VGGA 4L9ZA 3EOOA 3TAKA 4M24A 2D69A 2EF9A 3UZYA 1KKOA 4H9VA 2XU2A 2BGSA 3MDUA 1O60A 4R7JA 4IMEA 2D22A 4CN1A 4WX2A 4BF9A 2IKJA 2WSKA 1E15A 3GC5A 1EWDA 3FVDA 2BOEX 1OCNA 1IXNA 4RDWA 3MUY1 3EYPA 2X30A 2O4QA 2IXVA 4RJEA 4JL1A 3ARPA 3M07A 5K2ZA 1W54A 1AD4A 3T7VA 3V1PA 3NSXA 2J27A 2OJPA 5I3GA 4LUTA 3SRHA 3OIXA 1EQCA 3E38A 4M29A 2C6QA 2W91A 3CK5A 2J74A 3V7PA 4DM1A 3B9NA 4LUTB 3UP8A 2QVHA 1YPXA 3A6OA 4IPNB 4LC6A 4L61A 3FN9A 3B03A 5FCZA 2A2IA 3CQIA 3WLNA 3LHYA 6REQA 3RR4A 2YLLA 1TE1A 5D04C 4XAGA 3W73A 3UF9A 1H41A 2Z2BA 4UFKA 3U2CA 3KCOA 4PMRA 2VO5A 2R1MA 3H8AA 3WQ8A 1MMFA 6XIMA 3M0KA 3C6CA 3LRLA 3THDA 3QHOA 3LRKA 3S46A 4B3LA 5CC7A 3KZSA 4RUBA 4BWLC 1E9ZB 3TYUA 1JZ8A 4TQTA 3AS3A 4Y8EA 3QGVA 2HPMA 4H83A 3NDOA 3GYEA 3NQEA 5C70A 3TQVA 5AC4A 3FYPA 4BFAA 3VNZA 4EPDC 3IIOA 2G37A 4UOJA 5DRIA 3QZEA 4J2PA 1S1PA 2NWRA 1ZQ5A 5I2UA 3G1HA 1P6WA 1JVNA 4MM1A 2Z27A 5DXYA 3J7HA 2XFYA 3N2TA 1BSLA 2GVJA 4AEOA 2PDCA 4C1NB 1FCVA 4C6LA 4FX7A 4XG1A 2QCMA 5D2WA 1OT2A 3OG3A 1PKNA 2QJIA 1IXQA 1PS9A 2X0YA 3IARA 3G24A 5F2IA 3SY8A 4LTSA 4K1GA 3IJLA 3VYLA 1X7IA 4HZ6A 2FPVA 1B3ZA 4WY0F 3NQVA 3CNYA 1REQB 3VVGA 4EE9A 1HX0A 2ZUSA 2OO0A 3UJFA 2Z7GA 5REQA 3ECQA 3NQ6A 1QI0A 1TMQA 3W02A 1CXHA 3VTRA 3T9PA 5ABGA 1VBRA 1PZ2A 3AQUA 1VFSA 3MUCA 3QQ0A 4JQ4A 1UWQA 1QNOA 3ANUA 1KFKA 4LUIA 4HQVA 1O66A 3SAZA 3AIEA 3R10A 4YPJA 4JXCA 1YXYA 5K9XA 4UCGA 1UWSA 1IR2A 3LGGA 5IXEA 2OPJA 4JKMA 1ZAHA 1M7JA 5CAKA 1XGZA 4TMCA 1IEIA 2QYGA 5CPLA 3DFHA 4TVCA 2E5CA 4LCQA 3NZQA 3ABSA 5A6TC 4HNNA 2EG6A 2ANUA 2J9YA 3PZVA 4GC3A 3UXDA 4JFVA 1TTIA 1XLKA 2PU0A 1QNQA 4QG9A 1WZAA 4KGLA 5A6SA 4S38A 4DPPA 4LJ3A 3V1HA 5CEWA 3WH9A 4BKNA 3B8WA 1OG6A 4GNVA 9XIAA 4XISA 1J0JA 5FA5A 3ABQA 2W4XA 1EJVC 2OCZA 3CZLA 4IP5A 2PU1A 1FWIC 3B8SA 3CAWA 1FFQA 3WCZA 3PNUA 3Q37A 4H9XA 3MPGA 5IBXC 2QV5A 4DJDC 3ID7A 1J4EA 3GAKA 4DBEA 4D8LA 2VMFA 1G5AA 2PWEA 5DY2A 2OWCA 4DYJA 4ZEPA 4H8NA 1E6SM 2ZZ1A 2BX7A 3USBA 4QQUA 3H2AA 1PZ0A 3CHCA 2ON3A 3W25A 3VILA 1ZENA 3R43A 4WDUA 4D72A 1XBVA 5FJTA 1U5JA 4RZ4A 4GPNA 2ZRUA 3VU2A 4D6DA 2ZX6A 5FSEC 2NVCA 2NT0A 4AAJA 4DLFA 5BU9A 3WH8A 1RD5A 2Z25A 4MWAD 5CPQA 4ZOBA 3GG7A 3QXBA 3MYPA 1BVNP 2YW3A 1AJZA 2ODOA 4D6HA 1LRQA 2QCCA 4GFIA 1EX5A 1ZL1A 2OSYA 4H6EA 5IRPA 2VTFA 3W7EA 4CN6A 2JF6A 1J0IA 1EQPA 3BW2A 2XTKA 4JN8A 3M0JA 2Y70A 2P8CA 5XINA 2Y1HA 3LV5A 3RO6A 3MUAA 1DXFA 4DXKA 2VEFA 4POCA 3RJXA 1TQJA 3ELFA 1DWHM 3W1MA 5D2VA 4XAPA 1UUQA 3A3XA 1IYXA 1NIUA 2XJ7A 3L5MA 3I3DA 5DRCA 4LVFA 5EBAA 2OELA 4O17A 2VYOA 1X1ZA 2WNZA 4J1OA 3RFAA 4YVPA 3W7RA 3W6YA 3QSRA 1AW2A 1M5WA 5G5IA 3LDVA 3UYIA 1YNYA 2PDNA 1KR1A 3LK6A 4FIQA 2GGJA 2QW5A 3MI6A 1IV8A 1JCNA 2NWSA 4M80A 6XIAA 3KBWA 2E5DA 3LZ3A 2X1IA 3DHUA 3C2EA 4BQ2A 2IPJA 3P67A 4DY1A 2CITA 5LXXA 3S9YA 2JIWA 3OEXA 4FPSA 4A8IA 4HN4A 4IGMA 3SSZA 3BURA 4A3RA 3AYVA 3DAQA 4NNBA 3IUDA 1UA3A 1FDZA 4NZJA 1US2A 3SUUA 3AMDA 2XISA 1PYMA 5CLWA 1KM5A 2FZNA 3LMYA 2YZRA 4C6EA 5BOFA 1EIXA 4PTMA 3WQOA 5A94A 5EMKA 4GX9A 3T08A 3PBMA 3AHYA 4NJIA 4QSFA 1VJSA 4C5YA 2CZFA 4MTVA 3PZ9A 3WLOA 3F4CA 3MV01 2XG9A 2J7EA 2VCBA 3SQLA 5D2YA 3SEPA 5HATA 1RP9A 3DH7A 3O6AA 1UBPC 5TAOA 3MI2A 1MYRA 3VDCA 4C1KA 2ADAA 5LKYA 2NQ9A 2NV1A 4CQCA 4LF2A 3CC1A 1C8VA 2E1DA 5GQBA 2CHOA 1A3HA 4WLCA 3MBFA 2DSVA 3U4FA 1BAGA 1J12A 1RK5A 3VIGA 2WZMA 4MLJA 1AODA 5MF5A 3BZGA 5CZ0A 3TVAA 2DW7A 3AICA 4F0MA 4R34A 3ABRA 3EKLA 4B3ZA 1A5MC 5M3WA 3TQ0A 3WMLA 4W7VA 5I23A 1AMYA 4X63A 4NKCA 3GR7A 1KFWA 4LB3A 4E8CA 4RXGA 1FKWA 3IK4A 3S2LA 4ZO8A 2VUYA 3CT2A 5T26A 2PTWA 5A1AA 3AHZA 4J3ZA 1KM0A 4JTCA 4KESA 1VYRA 4D2JA 1XINA 4GWEA 1GJPA 2O9PA 2EKCA 4P7LA 1W1VA 4H2HA 4LT9A 1A5CA 1FWGC 4W93A 1OC6A 4FF7A 1W3HA 2GGEA 2GWGA 3BLPX 3VMOA 4O16A 8CGTA 1BKSA 3THUA 2VM8A 2HE8A 4YCOA 2V3FA 1TPDA 2VHLA 3NR0A 5I78A 3E2RA 4LRSA 5EMLA 1R38A 2PS2A 2YPIA 4NVTA 2A21A 4GYKA 3MHUA 2A3EA 3HOJA 2PDWA 4FR6A 4PCPA 4X3ZA 3WMSA 3WFZA 3UXKA 1JZ7A 2ASHA 5AC6A 3CZGA 1YRRA 3M16A 3VIKA 4OKDA 1S5VA 4AIEA 2FH6A 1X8CA 3DZ1A 4L7ZA 5E9XA 3OHIA 4J27A 5D2TA 3S6OA 2J66A 2DZWA 3EB4A 3BXWA 3MC5A 3OGVA 3NIYA 4Q6XA 3FV9A 2IKGA 2CLMA 4N9BA 2X09A 2GJNA 2VFIA 5F2MA 4Z2KA 4GNJA 3OZPA 3ES7A 5IFTA 1AQ0A 1F74A 1Q7QA 3T6CA 4WOQA 1FOBA 4JN6A 1Q5MA 4MNMA 1K1DA 2J8TA 2VVNA 4B16A 4CGTA 1O68A 1TKKA 3UWZA 1TREA 1VCFA 2ZRZA 3EGJA 4QJ1A 3KLKA 4YYCA 2IS7A 2HWGA 3BGJA 3BL3A 1F73A 2HXUA 5C54A 3PY2A 3GKFA 4JFWA 1SR9A 2UY4A 4QDPA 2GJRA 1OEPA 4DJFC 2GGGA 3QTGA 2Y8VA 3T0TA 3AJ7A 2QCEA 1H61A 4F3HA 3LD5A 2ZVIA 2WB5A 3G6LA 3MKVA 4H6KA 5EPDA 3OVQA 5JH1A 1CECA 4I8DA 5I07A 4TU1A 1H4PA 5LGXA 3R0UA 3AMCA 4U3AA 4A3UA 2NUYA 2I1OA 5A6JA 2XZ7A 1PZ3A 3W22A 4GO9A 3EWXA 1KM6A 2JIEA 2YXXA 2VFFA 1WDDA 5DY3A 3E1F1 3IK2A 4NT0A 4RNHA 4F2TA 2V5DA 2DQWA 4XIMA 5CBIA 1NDYA 4I5XA 3WNMA 3LG3A 1J6PA 1KC7A 4UQEA 3N6HA 3MUZ1 2E4TA 3QKZA 3MWAA 3KOWA 1OCQA 1BPLB 2V0TA 3WLRA 2V5LA 5HJXA 2CLIA 5FJPA 1G4PA 2D20A 3IANA 3C86A 4FS9A 3NL5A 3CV2A 3BVJA 3LHZA 4PH6A 4HMDA 2YXOA 3NOEA 1QOQA 2PTXA 2HMCA 3FS2A 1SFSA 3SRKA 2OGJA 3GXIA 4XZWA 3V3WA 3TZFA 2YCKX 4H6QA 1EJUC 2PTDA 3W4RA 3KCLA 5J04A 4M6QA 1MEWA 2PB1A 4XVEA 1G4TA 1P7TA 4H8UA 3U5UA 4UFLA 1JF5A 5G4EA 3LCHA 2GGIA 1FP8A 1QMLA 2C71A 3NL6A 4YIWA 5HANA 3BCFA 3WLTA 3L5AA 3QV6A 4YN5A 3IVSA 5FESA 3VKBA 1B54A 2AOSA 1VKFA 3A64A 1D8CA 3BLFA 1SPQA 2E40A 2V2DA 4AEEA 1W1B1 4JTJA 4ZQOA 5KTLA 1OGGA 2PBOA 4GMEA 2OZ8A 1FBAA 2MNRA 2YX0A 5I5RA 3CQKA 3LRMA 4QG6A 4Y9PA 4X2PA 3GR4A 1D3GA 3QBUA 1WXZA 2DV0A 1YTDA 3AU2A 3TW9A 3AI0A 4M51A 1WDPA 1XDMA 2DT0A 3T1GA 3M0ZA 5AHMA 3N9SA 3LM3A 3UR7A 1DKWA 3SB0A 2QGHA 2OWWA 1B3VA 4H7ZA 1BRLA 1P1MA 4A05A 5A2CA 4DWSC 3CAKA 1UWRA 4MPQA 3K4AA 2R1KA 2OLHA 3BLLA 5H8MA 1V03A 2ATMA 1BRLB 3ZWTA 1KQZA 2PGEA 4MPKA 4RZ5A 4DYKA 1E4LA 2C1IA 2VDHA 1LLZA 3PZOA 1XKJA 3L0GA 2QPUA 1WKEA 3VZZA 5ECVA 2ISFA 2O9TA 1ZB5A 2E3ZA 1PX8A 1G01A 2TRSA 1X1NA 3W70A 2WLZA 3P8JA 2YIHA 2XIMA 1ICSA 3RMJA 3STEA 1ZJAA 4PUUA 3VKCA 4D8AA 3GVQA 3MCOA 1PHQA 1SZFA 1I75A 2EPLX 4O0ZA 1ZRQA 1OIMA 2X1SA 2D0GA 1GYMA 3IIVA 2UY2A 1HXJA 1AMKA 3WK3A 1BWLA 4FMVA 4AG0A 2ISWA 4Z42C 4US6A 2PWFA 2EAWA 5E09A 2A6LA 4P8XA 2JKAA 2OVLA 3DI1A 5HBFA 3QC3A 2J7BA 4QE4A 4FALA 2WXDM 3HN3A 4DNHA 3F4WA 3SCPA 2HISA 3VOIA 1F7BA 5I3DA 1V3IA 5LIYX 4UR7A 4R33A 2WHJA 2VKZG 4MMWA 5HR7A 1L6GA 3UQNA 2ICSA 1HN1A 3TP4A 1SW7A 2IQDA 2ZA1A 2PDHA 1O1HA 3HM7A 3WLJA 3S8HA 3WJXA 1N82A 3RITA 3FXYA 3T0BA 1JULA 1IT7A 4MUZA 1UD5A 4P7OA 4U2YA 4EANA 3P74A 4JTQA 1XIDA 4ECLA 4DO7A 3POHA 3E2SA 4LB4A 3FVMA 3CHVA 1B9BA 1ISZA 4Q4OA 3WLLA 3DECA 1KGUA 2F8QA 3AU6A 3SDOA 3DG3A 4PUEA 4J9JA 3MO4A 1W3LA 4NYYA 2FFCA 3VDGA 3VMNA 1SYTA 3KBNA 3ZYZA 1BVWA 3K1DA 3G0SA 1B9ZA 2DH3A 3WQ4A 4NG3A 3M0VA 1YTKA 5L9FA 4MJ2A 3KVMA 5D4YA 1CBGA 4J28A 4ZOAA 3QZ6A 1R3TA 1X6UA 3OQEA 3LSBA 3AXXA 1DOSA 3LHWA 1XXXA 1SJBA 4MFDA 8XIMA 1J8VA 1KR0A 4TX9A 2DJLA 3LY0A 1MFVA 3VD9A 3GUWA 4ZOEA 2D23A 4MWAC 4GQQA 4PB4A 3PB0A 4ZENA 7ODCA 4X9SA 5A8GA 1GOMA 1ZFJA 4Q8TA 3VPLA 1EXPA 1FWBC 3GHUA 4IIFA 4UMBA 3GG1A 1OBAA 3VCCA 3A24A 2ZZ3A 3CYVA 5CPTA 3BDKA 4QG8A 2Y6ZA 3VMPA 1QBBA 1MW3A 4JTIA 4IM4A 3G1SA 2IKHA 3CIXA 1UHVA 2G3IA 3LYEA 1CGTA 2OO6A 3UWVA 4IWWA 3NXLA 1XRSA 4IP7A 4HIBA 4M6UA 3VIHA 2VDIA 4KFNA 4TTGA 1RBAA 1WZMA 2DORA 4Y9OA 1WOBA 2TYSA 4CQAA 5BWAA 1HNYA 4E2DA 1XBXA 4H04A 4FOJA 4HHMA 2CCRA 3D47A 1ZLPA 3W07A 1A5UA 3N2BA 1QHZA 4M7TA 1Q6CA 4D6CA 2OSXA 1V79A 4QCEA 3RXZA 3KBSA 1F9CA 2NV9A 2GVEA 1XWYA 3PUEA 2GQ3A 3TYCA 3M5ZA 1UUMA 4YTSA 1OX4A 3L4UA 4GNKB 2DW6A 4UOZA 3CAQA 1BWVA 1JDAA 3B0PA 1QO2A 4JQ2A 4L1GA 3QHNA 3W38A 1AH4A 4OTKA 4IX0A 2F9RA 2DZTA 3W2UA 1YPIA 2OKTA 4R9OA 1C92A 4RZ6A 2J78A 1FCUA 5F7UA 1X98A 3C2YA 2YZ5A 1KM1A 4BZYA 5C9ZA 3FY1A 3ARRA 4QSHA 5EMJA 3WO8A 2AQVA 5BU6A 1FUYA 4LS2A 5GPRA 3H7UA 4N6FA 1EPXA 1ZBWA 4Q8UA 3NXFA 4PUMA 3F2CA 3SURA 2WKJA 3H24A 4UFHA 3FW6A 5CSUA 1FKXA 3G3DA 3IUHA 4TVDA 1M68A 4GIAA 5CLTA 1U5VA 1NVMA 4C6BA 3N4FA 3F5LA 5K9CA 3RPDA 5KEZA 1KLZA 3DYPA 1OF6A 5K3VA 1W1YA 3GX9A 1YDOA 1BGAA 1E0XA 3EDKA 1JCYA 1E5NA 3SCQA 2OB3A 3WH6A 3IJ9A 4I7WA 4NZ5A 3W6MA 4I7UA 1FWCC 3TJLA 5DQPA 1BYDA 4GH1A 1IR1A 2REQB 3QMTA 1Y7VA 2HCVA 1BQCA 2ATSA 2IXUA 1UQZA 4IFKB 3WG6A 1AZ2A 4CEXC 1EA9C 2TMDA 3MWCA 5KZDA 4HTBA 5IOBA 1IZCA 4QJ3B 2FZDA 3W1RA 1EP2A 1DPMA 3LI0A 3VD7A 3LQLA 2HEJA 3MV11 1B3YA 4UBPC 3QM3A 2H3DA 4ZL1A 3VD5A 1JF6A 4EP8C 4J3SA 4RK8A 3FA5A 4GRSA 4Q4SA 3TMQA 4RW3A 5AHNA 1JL8A 1BHGA 3L21A 3TZNA 3AYSA 4MKVA 1DWIM 1MZRA 1YQ2A 2CLHA 4DJDA 1YPFA 5M2FX 4NAEA 3S5ZA 4ZA0A 2MUCA 1PAMA 1S5MA 3NURA 4F9DA 1W3TA 4KPLA 1MUMA 4NAEB 3CWNA 2F84A 1Z89A 3WDRA 4MYXA 3EX1A 2UBPC 5HULA 1WOAA 3FDKA 3RLVA 2BASA 2YCLB 3TX9A 3VNLA 4GJ1A 1UWTA 5HQEA 3W9ZA 3UNTA 3BWWA 3GK0A 4UTTC 1UKOA 3NNTA 5H2ZA 4GKTA 4Q4KA 4O10A 4OJYA 2QMKA 3MMTA 2ZTKA 3AMLA 5TQLA 3PULA 4PFHA 4TV5A 1XIFA 5T9CE 2VNCA 2CBIA 3QGAC 2Y85A 1Z69A 7REQA 4DWDA 3WLKX 3NEHA 5EBUA 2ZZ2A 1GOQA 2V5BA 1N8IA 5HK4A 4JHZA 1QPNA 1JDDA 1AH0A 4GYPA 3IS4A 4PC8A 1XCFA 3PSVA 5G2HA 4DZAA 1VYSX 3IVTA 5CZKA 2ZUVA 2PGFA 2P10A 5AOUA 4C5ZA 4G7EA 3MQTA 1EZ2A 1HL2A 1DQXA 1CGWA 2INEA 4E4FA 4AU0A 3L2LA 1WAWA 4C6PA 1RQHA 3SY5A 5G4HC 2YOCA 5D30A 3PZGA 4CD8A 1XX1A 4HU3A 4GBDA 3ENLA 1X97A 5I0DA 3KWXA 3HQPA 1HJSA 3WLPA 2QJHA 3FEMA 3V5CA 4ZZ9A 2XINA 3N73A 2Q8ZA 3WBXA 3PUOA 4IH3A 1UR9A 1EJSC 3QZAA 2R1NA 2CLEA 4FXJA 1MI3A 5E6YA 1XJBA 5EL1A 1GVEA 1AJ2A 7ENLA 4BQ3A 3TTSA 4K8EA 1NDZA 5G2IA 4J35A 2BSLA 3MSGA 1WCGA 3W83A 2QT3A 2PF0A 1EDGA 4WD0A 1ZAIA 2GJPA 3QPZA 3HMJG 3KZPA 3M0IA 4B3KA 5A6BA 1J6OA 1ISXA 1XYFA 2GOKA 2AGKA 5BWFA 4ONVA 1FHUA 4YMZA 2VGFA 5HOSA 1XLBA 4Q8VA 3TTOA 2J75A 1BYCA 3GE7A 3ONBA 4XZ9A 1C90A 1LQ0A 4PRTA 2C14A 1PIGA 9CGTA 3CQ0A 2FLIA 4MAVA 4NIRA 4UNLA 3RRXA 4IQJA 1L2QA 1R30A 2FZMA 1RBLA 4UZSA 1PEZA 3EMCA 2OYKA 3F4VA 1HP4A 2XYLA 1KCXA 3LCLA 4MADA 1PTDA 3JVAA 1C29A 3UWQA 2ZYFA 3NJ3A 3FSTA 4Q33A 2Y7FA 4ICMA 3D0CA 3I6EA 3B40A 1KKRA 2HK1A 2VEPA 4PBFA 2PTYA 3OGRA 1KTBA 4UUIA 4F79A 3CAVA 1PCKA 4Z1YA 3B97A 4PMZA 3FYYA 4IICA 5CJMA 2DSWA 4US5D 3ZT5A 3FKRA 1WKDA 3QFWA 5CGTA 4A22A 2A5HA 5I06A 2ZE3A 8A3HA 3R7MA 1LL6A 3FOKA 4V1YA 4DJED 3UWYA 1G69A 3KL3A 4U5KA 3C2VA 1NARA 4JTSA 4GVFA 4Z0SA 3SGUA 2V69A 1LOLA 3TXVA 3WKZA 4F66A 4DIAA 3IIZA 4HYVA 2GQAA 4LC8A 4OECA 4AZCA 4EX4A 3CGTA 1JCJA 3VIPA 2PGWA 3QY6A 4RKAA 4W89A 5HMEA 4DUOA 1E4IA 1V5XA 1XIEA 2J8GA 5AECA 1JCXA 1O12A 2BXZA 3DC0A 1JUBA 4RDZA 1HIZA 4DBSA 2BY0A 2V68A 1OG0A 5BMXA 3HJZA 5CPMA 3AZTA 3M0XA 3RLUA 2FTYA 3TNBA 3WDPP 3EWWA 1EO7A 1I2PA 3NYZA 3KRZA 4WQ6A 3ITVA 5ABFA 1DXIA 3WBAA 5LIXX 3KM8A 3TLQA 4PEEA 3VKKA 1KBIA 1GOIA 2RJHA 2YDAA 3JW7A 3GRIA 3C4UA 5DMLA 2YCJA 3EX4A 2J9XA 2ZTJA 4WXYA 5ENLA 2E8ZA 7PTDA 4XBKA 4RL3A 4D6FA 3CUIA 5LA1A 4E5TA 3OB8A 2JFEX 4UNKA 2X1TA 3GHSA 4ZSUA 3LHTA 4KWUA 1LRNA 1VFTA 1THFD 2Y24A 4IZGA 3LB0A 3I6TA 5F2LA 3M0HA 4LVGA 3R4IA 1GHRA 3G1XA 3M41A 5CPOA 3M9YA 1XM3A 1W0MA 3MMDA 3DG6A 4NASA 2PD9A 4NF7A 2OLSA 2CPUA 1IE7C 3AWNA 3WQDA 1P0KA 4ZXOA 3ZO9A 4OHQA 1P0EA 1XI3A 2PODA 4L4PA 2BVWA 1UR3M 1XIBA 3DFYA 1E3ZA 3P62A 1KRMA 2AL2B 4E38A 2HS8A 3OOQA 3QV7A 4C6OA 3MMWA 1GW1A 3WK1A 3QOMA 4M3PA 1O5KA 1T7LA 3UR8A 3ZR6A 3F5JA 3HTWA 4WJ8A 4D71A 4LH8A 3GNDA 3F2DA 1PCWA 4YTRA 2CBUA 2D0FA 1LOQA 5C71A 1A80A 2DSZA 4XAYA 4BQ4A 4HPHA 1FWJC 4XO7A 1XYBA 2JF7A 3M5YA 2PDGA 3CZ8A 1XGDA 3C0LA 4B5VA 2ZA2A 4MOZA 3B3DA 3KXQA 3WZ0E 1PX3A 2QDEA 2WOQA 1K7XA 4AUBA 1PDYA 4F9JA 3QKEA 4CQ8A 4YNGA 1JYXA 3GFXA 3RPMA 3CMGA 2VCAA 3MANA 1ODZA 3XISA 4FLRA 3EMQA 2EG7A 5TD4A 4FX6M 2CKSA 1R3SA 3NGJA 4GJJA 2VCCA 3VIFA 2ZX5A 1J0HA 1ONWA 4ROPA 1JGMA 1S1RA 4GIEA 3BZJA 3IJIA 3WELA 2CKRA 3GC4A 2NQ5A 2I7GA 4ATWA 4ZE5A 5FAJA 3GG0A 1Q6QA 1F05A 1CTNA 2V3EA 1WX0A 4BI6A 1V3JA 2X0HA 1K3UA 4HU4A 1PJ9A 1Q63A 5E9AA 2OGYA 1OADA 1FHVA 2VQTA 2QIWA 4OWGA 2E67A 2F6UA 4AW7A 5DEZA 3O15A 3EDJA 4ZQCA 4UTIA 1TPWA 4W87A 4HNUA 2BXYA 1VR6A 1SJAA 1EHAA 2I5IA 3SZ8A 3TOYA 4PFMA 3UY7A 1KLYA 2VR4A 5K4XA 3OLDA 2ACSA 5JQ9A 5FF4A 4KW2A 3JUGA 4I6VA 2NXGA 2GYIA 2Q8LA 4WOZA 1UKTA 3RU8X 2ZX7A 3MSDA 2H6RA 3C0SA 2VFDA 3T4WA 3N17A 4BEQA 4Q6JA 3L68A 3HFYA 5TBOA 4DWSB 2DIJA 3VNIA 4QE1A 1SSDA 3NM1A 1E6RA 1LWIA 3GBEA 1Y65A 3S2JA 3TROA 4CVUA 4XZLX 3DX5A 4NQ1A 2WKGA 4B4HA 3BLDA 3C2FA 3UW6A 5LSMA 1R5YA 3IJ6A 3IJ7A 4YWSA 3EPMA 1SMAA 3MUXA 1SZRA 3G0XA 4LALA 1KXQA 1ELSA 1V02A 1OFOA 1JYNA 3OODA 1VJZA 4TX8A 3DFSA 2LLEA 2C19A 3KEHA 3H2FA 5E0CA 3EWYA 3O0FA 3N11A 1F3WA 4JIQA 2NQHA 1W1IE 3N2OA 1VPXA 1B4KA 1JAEA 4FA3A 4J3VA 3PS7A 5HQMA 5MKGB 3R0DA 1ADSA 3N13A 3HG5A 1CI1A 3BANA 4OV9A 1S46A 1V7YA 1O4UA 4C7FA 1S39A 2XGBA 3TYEA 4FI4A 1CDGA 1XLGA 3BOLA 2AQOA 5HNRA 4S3CA 1EC7A 3MS8A 1UKSA 4Y9NA 2PLKA 4UQBA 1CGYA 1F4HA 3P80A 3T07A 1MW1A 3EDDA 4EF9A 1NQ6A 2CLPA 3TC6A 3GTHA 1VEPA 1C93A 3N29A 1MW2A 1Q6EA 1LLOA 4LYPA 1AQHA 2PDPA 4G9PA 4QDMA 3QY7A 1VCVA 4PN2A 4L6OA 4K36A 4CCEA 4HGXA 4F40A 3VDHA 2AL1A 4NYUA 1P6BA 1PL9A 3LBMA 2QCNA 1Z3NA 4KEUA 4GK8A 4MKSA 4W7UA 4YWIA 3CL6A 3RMEA 5JUVA 1UIOA 3CIVA 1ZU8A 2BOFX 4R7WA 3WQEA 2CETA 4S2CA 1EXBA 4LYRA 3RCNA 4ACYA 3P60A 2DP3A 4LVDA 3QC0A 1TJ0A 4KWSA 4ATDA 1I45A 3TSMA 3IIXA 2X42A 2OQHA 1BTCA 4N0RA 3I7QA 4KMQA 2YGYA 1GONA 3ZVHB 1M03A 1R3YA 4GXMA 5LYRA 2P50A 3N6JA 3PN8A 3ARQA 2DZVA 3B4YA 4XO6A 2PC4A 4JEJA 2PAJA 1TV3A 3B9DA 1RALA 4MWAB 4MHBA 5FF0A 1GGOA 4E8GA 1XCWA 3KBVA 4HZMA 4WJXA 4O12A 3S5YA 2QKFA 2FYMA 4JTEA 3AMGA 1K4HA 3WEMA 2QVNA 1IGWA 1OINA 2AAMA 1EC9A 2WSRA 1W2PA 4OZOA 3PANA 3OZMA 4QITA 4XZNX 3E96A 4MUPA 4ZFCA 1AW5A 4LBRA 2HE5A 3ORWA 3MP5A 1UP2A 4O18A 1P5BA 1LM1A 3WUBA 1TRIA 5D8WA 2HNHA 4XWUA 1BXBA 1R7AA 3AXHA 2E1WA 4K8HA 1TTQA 3HPXA 2FJUB 2DT2A 3AZSA 3PF3A 4ICCX 2A79A 3SQSA 1LL4A 1E1CB 1V3HA 1VPQA 4KT2A 2VT0A 3AXKA 3W84A 4KEMA 4YVVA 1OJXA 1CNVA 3MKCA 1A5KC 3GXNA 4M1RA 4N2YA 4Q32A 4IOTA 1UYQA 4IMCA 4N42A 3ZWSA 2BGQA 1XYLA 3W1TA 1IEQA 2XFRA 3TYZA 3FJLA 1XC4A 4C6MA 1DQWA 4P61A 1C9WA 5DCEA 1G67A 3CZKA 3TJXA 2E68A 1J11A 3GXTA 2IUZA 3VNKA 2RDUA 3NYDA 4BS0A 6TAAA 4JKKA 2GQ9A 3NL2A 4OGZA 3UVIA 4M6PA 5JIWA 4DUWA 2E5BA 3NO3A 3WBYA 4AY1A 3G2GA 3LN3A 4DJEA 4K37A 4D6GA 1ZSXA 4AD1A 1Q65A 2E9MA 5F1VA 2BVTA 1GVFA 1R6WA 5AYYA 3LQGA 3ZQ9A 3C0JA 4GISA 1E3XA 1XBYA 3DENA 1HGWA 3H2NA 1DXEA 1DJXA 3VZXA 1S3TC 1NF7A 2ZUMA 3DBPA 2EO7A 1R3VA 3P7YA 4IGSA 5CAHA 1MDLA 2V67A 3QQWA 4O13A 4G56A 2UY5A 3TCSA 1XLJA 2ZXDA 4D8ZA 4W9TA 1B3XA 3OPSA 2X16A 2QCGA 2V81A 1DL3A 4GJIA 8XIAA 4HKPA 4F0SA 1CGXA 5FJUA 3W7JA 1VCGA 1S5TA 1J79A 1BSIA 1QW7A 1KW1A 4NP7A 4EXBA 1CEOA 1R3QA 2WJZA 3KVLA 3TC7A 1ME7A 4GCAA 4P8WA 1VIWA 3W3OA 4M56A 4C65A 4XV0A 2YJQA 2QF8A 4DVOA 4QJ4B 4HYWA 3R79A 3RM9A 3N1AA 3KTXA 4E2OA 3NEVA 4XUGA 1ONRA 2J79A 4F0KA 5FJJA 4IL2A 3T05A 1M65A 1XHGA 1ZS2A 5HJYA 4QS5A 3MYOA 4MY9A 3G77A 4KRUA 4QP0A 3W0KA 4JTLA 2DFAA 4GG9A 2YDSA 3SCNA 2YL6A 3M43A 3UXAA 1MZHA 1NP2A 1XR2A 5F4XA 2J6XA 4IMFA 1W1A1 3L12A 1XRVA 4Q8MA 4JY8A 3WQFA 2W0UA 1XIIA 2QUNA 1VGAA 2E0PA 3H7RA 1MW0A 3HGSA 1GKRA 1UJQA 4XX6A 1SMDA 2VEGA 1TR9A 4HK6A 4KCUA 2PSNA 4L6DA 4URIA 1M9HA 1M01A 2WWDA 2WVVA 2AQWA 1NP0A 3UZWA 2ZX9A 1T40A 3ARWA 3R12A 4Y2WA 2QMJA 5KZMA 3QLLA 5A8MA 2WVVB 2CLKA 5E0FA 5LNSA 3N2CA 1SZEA 3T8QA 1BXNA 3VIOA 3PBVA 4D1JA 5J8LA 2WK2A 1HW6A 3W24A 4IF2A 1JXKA 4H1ZA 1XLDA 5BNKA 4U2ZA 2PI6A 2G3FA 4DBDA 2E6AA 2YL8A 3LLFA 1B3OA 4J4KA 4GA8A 4B92A 3BV4A 3REQA 3LERA 2OZTA 1KV5A 3WJZA 2GVGA 4LVBA 3SN0A 3ZM8A 3MMUA 1S5WA 1HKJA 1F3XA 2PDMA 3JU2A 5CJNA 4UR9A 2VOTA 3CV6A 3I4KA 1ICQA 3ALGA 2P53A 4ZCWA 3ZR4A 5I24A 1H1YA 2NVAA 4KCVA 2VXNA 4XZHA 5L6UA 2WNQA 3HGJA 1A5NC 2ISSA 5JMUA 3D46A 5CKSA 4ZO6A 3V35A 2CZ5A 3ISIX 4ILSA 3O6YX 1V6WA 4L9XA 5TIMA 1M3UA 2CZEA 3UG5A 3JZUA 4HHHA 4WKAA 3NTYA 4UTFA 2QIIA 3N14A 3CHFA 1W9UA 1M1BA 3L23A 1PBGA 4TO8A 3WNKA 1FCBA 4PBEA 1Q6FA 1VFFA 3TYDA 4CNPA 3G1DA 1XYAA 4X0NA 3K1GA 3IRSA 3M5VA 5HJLA 3BAIA 2V30A 1M41A 3R0KA 1IT8A 4RE4A 1KBJA 1E73M 4IPIA 1JFHA 1FTXA 3HQOA 1TG7A 4GC4A 3EOLA 2PWGA 3IACA 1TZ7A 2YYTA 5B7ZA 2WSYA 2VGIA 2Y5SA 5JVLA 3DDMA 1GJWA 4B91A 6A3HA 1QR7A 9RUBA 1CLVA 1FWWA 3OYZA 4MNLA 2G3MA 4FNTA 3L9CA 2VD8A 3MW7A 4JEQA 4A6GA 3UPBA 5FEXA 3TN5A 5DT5A 3APYA 2PUZA 4Q3MA 3OVGA 3B9EA 3K4DA 3GXMA 2A4AA 2I5QA 5I3JA 4CQ9A 1JAKA 3E2QA 5H8UA 4CCDA 2RHGA 1A0DA 3M64A 4BEUA 4NZ1A 4N9DA 4IJBA 1EL3A 1NOWA 2X8RA 1XLIA 3CO4A 4LNCA 5D03A 1XQLA 1GVYA 3ARXA 4S23A 3H55A 2BV9A 1G4EA 3KBJA 3IGHX 2VR5A 1GZ1A 1NSJA 4HPGA 4LBUA 1QXLA 1VS1A 2IPFA 5A69A 2ZZ7A 5A2AA 4B5SA 4DEFA 3EAUA 1F3EA 2H3BA 5I00A 3OZOA 3A9BA 4PMJA 3A4JA 3WYZA 4DUXA 3NSMA 2XVPA 5HWJA 3WUEA 4G1NA 1PWLA 1R0MA 3VOGA 2QR6A 4PULA 3WF4A 2ZDRA 4GD0A 4UC5A 1T99A 1F8MA 1YBQB 3EWZA 4AF0B 1I2RA 1V77A 1KQYA 3W28A 4HNCA 3W86A 4B5XA 2H9AA 2W3ZA 1C7SA 4IIGA 2VP8A 1JD7A 4XTIA 2AKMA 4GE8A 1LTDA 2DH2A 4GI8A 2BHYA 1EUNA 2ZUUA 2SFPA 1QTWA 1QW8A 3GIQA 1DHKA 3XINA 4DM2A 4S3AA 3IV8A 4IPPA 1VBGA 2NT1A 4EIVA 3V0UA 2QAPA 4HMNA 1PVNA 3C52A 4JIRA 4MWAE 2QF7A 1EJ7L 3GIYA 2QZRA 3U8GA 2BWGA 3UERA 3AUOA 1C8XA 4GACA 3QHMA 3H70A 3ZR5A 1O5RA 4DO5A 4C6FA 3TE9A 4B15A 3GU1A 5CZTA 3CT7A 1KCKA 3CZEA 2CERA 1LUCB 2V5JA 1QHOA 3BUVA 3MZ2A 4ZFMA 5CC3A 3BSHA 4CD4A 1FWTA 3WF1A 3DYMA 1VBJA 1IIGA 1M04A 1EA0A 3BJFA 1K4GA 4QRNA 1EOKA 3H4XA 4FXRA 1CIUA 1KA9F 3UPMA 5C2CA 3GBDA 5DX7A 5HR6A 2ZRXA 1OC5A 5BRBA 4FO4A 3WH7A 2FJKA 3VC6A 3NG3A 3B4UA 4NL1A 2PPGA 3KDOA 1QW9A 1H5YA 1UP3A 3ZIZA 3WQ5A 3OVPA 1T41A 2PWUA 3RCMA 4H3DA 1T5AA 2FGBA 4H8VA 3PFMA 1E9IA 1GJUA 3OZYA 4ZSTA 4G5DA 2XPKA 2DUZA 1JUEA 4S3BA 3STGA 5FJRA 3QH2A 1TZ9A 1UQYA 4QM1A 3VGDA 4M82A 1I1XA 4MZYA 3THAA 1CGUA 4GBUA 3L4TA 4LOCA 3SN4A 1F8IA 4RR4A 4ZQRA 1Z32X 3W85A 1WNOA 1MEHA 4RCXA 3GH5A 4PRWA 3CUGA 4JR5A 2P8BA 3K2GA 1MEIA 1EDTA 4EKJA 4FP1A 4UFJA 1VRDA 4LAZA 3UZ5A 1OM0A 2VC9A 2BDQA 3G18A 2Q01A 1A5AA 1R3WA 5T8GA 1HGYA 5I3KA 3HQ1A 4Q4RA 2PDUA 1AZ1A 3AIRA 1E4NA 2ZBTA 5IDZA 4ZXLA 1OHLA 4WDWA 3AMKA 1JZ6A 1D2KA 3BAKA 1NFPA 5DFAA 2GSEA 4K3ZA 1KFCA 4RZBA 3DFOA 4FNUA 5AYBA 3SSJA 3URNA 1UROA 5LNWA 3EB3A 4GHRA 2J24A 5AC5A 4ADTA 4JY9A 5LIWX 4XK2A 4REQB 4AZ6A 4GQGA 3IVUA 1UOKA 1VD6A 1AJ0A 5B7YA 2WVTA 4ZB0A 2FZ9A 3TSDA 4AZ5A 1H60A 1XPGA 5M5DA 3HV8A 1ZY9A 3N9RA 1TB3A 1MWOA 1VHCA 1U5HA 2PD5A 4MAZA 3UR2A 3KRSA 1HL9A 2FHCA 4UTWC 2CLFA 1QWKA 3ERPA 4H19A 4TUFA 2F6XA 4ZGYA 5EA9A 1Q6DA 4JNMA 2A7RA 4NHVA 5CH9A 4Y7EA 4HSNA 3S3GA 1XUZA 1UH4A 2WJDA 1RAKA 4UNIA 1QOPA 2OMAA 2I57A 2VX7A 5E5CA 3TEVA 4WHBA 5HAOA 3ITGA 4WJEA 3PNZA 3PZUA 2A0NA 1FWNA 1N2VA 3AXMA 3PBWA 1VYPX 5HA7A 3M0YA 2YFOA 1DWJM 2VOMA 3U2ZA 5BXSA 2PRMA 4DZIA 3W23A 3UZJA 2X05A 3WENA 1ZUAX 5GJNA 1CLXA 1TMLA 1A49A 1BLIA 1RP8A 4KF1A 4QS6A 5E6ZA 3QR0A 5BW6A 2D2HA 2E9LA 3ARVA 1ONXA 3VAVA 3LGDA 3ZZ1A 5FACA 5FD0A 3RX4A 3WF2A 2BTMA 3FHAA 1E9LA 3NUKA 4GKLA 3QY8A 4OBTA 4W88A 3EOSA 3UFYA 4O53A 4C6QA 4L4OA 3CLWA 4RXFA 4TVUA 3RM4A 3LS9A 1OFDA 6CGTA 1D3CA 1CWYA 4YTQA 2G3NA 1QNPA 1RY8A 4XBSA 3URAA 4C1NA 2VC5A 3RNDA 3HQNA 2XSBA 3T44A 1NOUA 4PTXA 3R89A 5F4SA 2EPOA 5I77A 3CS2A 3PC0A 4NX5A 1GTHA 2XN0A 1ZJBA 3VINA 2VEKA 4LGXA 1QCWA 1DJZA 4X22A 4PMVA 3U3HA 4S3EA 3GC2A 2O9OA 1RQBA 3GG8A 1REQA 3N3TA 1BVZA 1RLDA 1H7OA 5AYZA 1MUWA 4LBSA 1JDFA 2C1GA 2BB0A 3QOKA 3RPTA 4Y9AA 2EJAA 4IJRA 5LZLA 3TAOA 1MNSA 1H1NA 5FL0A 1MRAA 5PTDA 4Z08A 3TWAA 3EKZA 2ONEA 5AN7A 1OWQA 2ISVA 4J3WA 3T0DA 4QLJA 1GVRA 2WM1A 3SCSA 2DVUA 1YW1A 2HXTA 3K30A 1NWUA 3S5NA 3NZGA 3V36A 4MVAA 4IG2B 4DN1A 2CXEA 4AC7C 3GDTA 4QFUA 3E6EA 2YYUA 1OFRA 1UB3A 9XIMA 4Q8WA 5I02A 1ADDA 1EBGA 3S6DA 2FTPA 4N4PA 1TA3B 4MB5A 2ZZ5A 1IQ8A 3GTNA 3PPHA 4CU8A 3RILA 2FB3A 4LX4A 3L65A 3T09A 4J3TA 2WJEA 3BAJA 2INFA 2V2CA 3L4VA 3KOZA 3GS6A 4ZB5A 2PDKA 2UWFA 1WKFA 4Z1AA 3QMRA 1ZP4A 1BYAA 1SFLA 2QGYA 3H2OA 1H2JA 3SECA 2Q3RA 1UA7A 4DF0A 1GQLA 2P0IA 4M1BA 1EFZA 2JKPA 1UPMB 1N8WA 1P0DA 1A53A 1IHIA 3Q4DA 4L6HA 1LJYA 3WD3A 2W61A 1EUAA 3VNJA 1X7FA 4RNJA 3VM5A 3IEBA 4A35A 4DZHA 3F4NA 1KBLA 3FKKA 3BOXA 4EAYA 5AYIA 5G1TA 4GGBA 3B8TA 3EB2A 2PDQA 3AYRA 2ZWZA 1PV8A 4YCPA 3VA8A 5AC8A 1HJQA 3DC8A 1YKWA 3G1AA 3C2OA 1JEZA 4AD0A 1BTMA 3UCDA 3SGZA 4FLOA 3G8EA 3SR7A 3RK8A 3KP1A 1MQPA 2V3DA 4B90A 3GNRA 1Q6LA 2GSJA 1RD6A 4BY3A 2J9ZA 4JDYA 3AOFA 2PCEA 3OA3A 5D09A 4UTUA 3CWOX 3WLIA 4F48A 3VDBA 2Z00A 3GY1A 5HNTA 1YYAA 3NQ2A 4DELA 5A95A 2YDQA 2QCDB 3FGCB 4A4AA 2QUTA 3WF0A 4PUDA 5FOOA 1AL8A 1XF0A 3LM7A 3PTQA 4GGHA 2Y63A 4Y9MA 3VOFA 4A2RA 3L2MA 4CKQA 4KRTA 1Q7MA 3B0VC 3VGBA 2XFWA 1ZTVA 1ZAJA 3IAQA 4L56A 1H7XA 3V5FA 3OQ8A 1DJYA 3M47A 3AHVA 3B0YA 1A0EA 3RLHA 1HO1A 2PP1A 4EOUA 2OQLA 4O57A 5MHBA 1BKHA 3EWUA 4NZCA 1Q6GA 4J2MA 3GNPA 1MXSA 1L6WA 2A3AA 4PTNA 1GW9A 3BAYA 5C7HA 1KNWA 1F07A 3NAVA 3F7JA 2CNCA 4S39A 1JFXA 1G7UA 3PJXA 2GLKA 3EX6A 3HG4A 1GQNA 2ZKMX 5TF0A 4OUIA 1AH3A 3SCOA 4P8UA 4W5UA 3LXCA 5TNVA 1VFLA 1FFRA 2Y4SA 5C2GA 1JDEA 4GZIA 3LTPA 1KFBA 4F0LA 1H7WA 5EFDA 4N4QA 3NPVA 2JEPA 3O63A 1B31A 2OEKA 1U1UA 3HO8A 2VZSA 1NELA 1TVNA 1W17A 4JOMA 1Y5VA 3KS5A 3G1FA 3IGSA 2Z2AA 3IUIA 2HQAA 1OCBA 3W82A 3WLHA 3UGVA 1Y8BA 3N04A 1POJA 4HSHA 4JCMA 2YB4A 3E5BA 4HT3A 3QV8A 2G3JA 1ZJIA 3B05A 3WLSA 4IMAA 5E0KA 3C8NA 1DYSA 3OVRA 3OBKA 4BI5A 4GLEA 4XKYB 1SZGA 2BODX 4B9YA 4IL0A 1Y5WA 4HTYA 4PTWA 2HDJA 1NDVA 2HBXA 2V8ZA 3BSMA 3CTLA 1J5TA 2RDXA 3WK2A 1DWAM 3VFLA 1PO9A 2YXGA 2J7DA 2JKEA 5A8QA 4KERA 2G5WA 3BW3A 4EWND 4UQ9A 4PSRA 2C1HA 1ZALA 3WBEA 1JZ3A 2BY3A 3A4AA 3QGKC 3VX0A 1DIDA 1W3NA 2CFFA 1TSIA 1JPIA 4XTDA 3S9IA 2PEVA 1UH3A 1SW0A 3DFQA 1J2BA 5FJIA 3N34A 3AIWA 4XZIA 4V2XA 1JD9A 1HJUA 4XB3A 2Z7KA 3BMWA 3S1VA 4MGGA 3AXIA 4CNNA 4PA8A 1WV2A 3AHXA 1QPOA 4B9ZA 3NZPA 3TSBA 3W53A 5CPNA 4C7DA 3TTEA 3UU0A 4GIYA 1ISWA 1ITXA 1QI3A 1KGWA 2RDTA 3P8IA 5CBJA 2ZZ4A 3JS3A 1MXDA 1WDSA 2WZEA 3I7RA 4L64A 2CHRA 2E77A 1XG4A 1HZYA 1TIWA 4GUGA 4H2CA 4UTMA 1TIMA 5DO8A 4XAFA 5HWMA 3RAOA 3KL0A 4KWVA 3VCNA 3HFTA 3CEUA 5KZ6A 1GHSA 1GG0A 4GZJA 4HMCA 2BNJA 5LNUA 1LDCA 3GXPA 4KQNA 1YDNA 3E49A 1OY0A 5KITA 3URBA 1UR2A 2GOUA 4RE0A 3QYQA 5J5DA 4KFOA 3LZ5A 3TFXA 1D9EA 3TR9A 4HSOA 3AS1A 4W8AA 2NXHA 3I10A 1LG2A 4HOZA 5C0QA 2BG5A 2OEMA 3GDKA 3OTRA 3KLLA 1V0KA 4WK9A 2OTDA 1H7PA 2PDFA 1HJXA 1F5ZA 3H54A 2FVLA 3DHFA 3LNPA 3MBDA 4LQ1A 3I65A 1E72M 1QO5A 3PVFA 2OODA 3I3EA 4UOQA 1CENA 4F0RA 3AWOA 4UTHA 1ME9A 4WDTA 4E3VA 1GKPA 1PIFA 4MJMA 2DEPA 3CPRA 5C55A 1RV8A 3GTFA 1QOXA 2WQPA 4AD2A 4K68A 4OU1A 1FQ0A 2IMRA 2VZVA 1KXTA 1ITCA 4GFSA 3WF3A 1G1YA 2L5HA 4IIBA 3SUTA 1LP6A 3UVAA 1IIHA 3JZEA 2XUCA 3ARUA 3G1RA 4DRSA 2BP1A 2Z1WA 1QDSA 4DJDD 5A5WA 1PXGA 1F61A 5IHRA 1JCLA 5C8BB 5DCBA 4O15A 2R6OA 3CEPA 3QF0A 4S1FA 4JX6A 4FF5A 4NSBA 4YVXA 5CZJA 4HNTA 1XH2A 3IV3A 1IWBA 1DJGA 1BYBA 4GYJA 1SM9A 4LAUA 5C9UA 2W5FA 2PLCA