3CT7A

Crystal structure of d-allulose 6-phosphate 3-epimerase from escherichia coli k-12
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
b'MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENIDEAWRIMTAQILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-allulose-6-phosphate 3-epimerase
publication title Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.-:
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ct7A00
2Y70A 5G1TA 3DENA 2ZZ5A 1ICQA 3NQ7A 4DO4A 4DXVA 3UYCA 4LV4A 5DXYA 3BG5A 2NXIA 5CZJA 4NJKA 4CQ8A 2FB3A 2CLMA 3DI0A 3SJ3A 4AWTA 2FPTA 4E38A 2QDHA 5FF4A 4JIPA 2ATSA 1V5XA 4QITA 3IIXA 5EBUA 3IIZA 1JRCA 3PBWA 1OX4B 1RV8A 5AHNA 1R2RA 4Y90A 5K7JA 4FNRA 3UXAA 4CLMA 3GR7A 4JR5A 2VFGA 1TO3A 4RJEA 1BTMA 2R91A 2NX3A 1JCLA 3EX2A 3GX9A 4JTKA 3TMQA 2XFWA 3P7YA 4RLIA 2RDTA 1OVDA 1DORA 1M6JA 2CU0A 1FWTA 4MLJA 1SZFA 2J27A 3NEVA 4BFAA 1MSSA 2VKZG 1VCGA 5CZTA 3PC0A 3C2RA 5D38A 2FIQA 3EXSA 4GUFA 1LROA 1TPUA 1ZFJA 2CWNA 4UTKA 1AW2A 4JTGA 2GQ9A 3PBVA 1F05A 1VHNA 5KITA 1LP6A 1K7FA 2GOUA 5HINA 3O05A 3PULA 3QMRA 4H3DA 3WJWA 1WOBA 1TIMA 1NF7A 4O1CA 1FX6A 1OFBA 3P61A 3LXAA 4FX6M 3C2EA 4ORMA 1F7BA 1G7VA 1EB3A 3PS7A 5U7SA 3LCLA 1H7NA 2X30A 2A85A 1EWEA 3NGJA 2A21A 1MEIA 3P74A 1YDNA 4A22A 1LLZA 4LC8A 3C8FA 3CWOX 1DOSA 2NLIA 2ALDA 1O94A 1ADOA 3HG3A 4JTTA 4W9TA 1Q6OA 3H54A 3KVKA 5A8GA 3CT7A 3L68A 5G2HA 1LLWA 1TPC1 4O54A 2QCDA 1TV8A 1FCUA 1UCWA 2WNNA 1F6KA 3W83A 2DZXA 1VQTA 3UWYA 2YXGA 1PVNA 4ONVA 3SECA 4MKNA 3P80A 2P0OA 1WBHA 2GVGA 4YWIA 5LZLA 5HQEA 2I14A 1LYXA 5G2WA 3GB6A 4IX0A 1OFQA 3RMJA 3FJ6A 4HPJA 1KLZA 2YDAA 1LBLA 3MI3A 2ATMA 4MZ8A 3N73A 4O12A 1NAL1 4XUGA 5G4WA 1JUEA 1OF8A 2B7PA 3MBFA 1YDVA 5D33A 4MYAA 1UJPA 2D73A 3ZFHA 1QFEA 1KM1A 1FCQA 1XKYA 1SSDA 3TC7A 4UFMA 4LVBA 1BWKA 2AQWA 4LUIA 4G1KA 2NWRA 1VHCA 1LOLA 1H50A 3SI9A 4IGHA 1T99A 2DORA 4UTLA 5FF7A 1YPFA 2J88A 2QCEA 3HIJA 3LV6A 3Q2DA 3W7PA 1TPVA 2OT0A 2ISVA 4GUHA 4MOZA 2O7SA 3G1VA 3L21A 4JYDA 2VEIA 1NEYA 3HPXA 3S5OA 2AGKA 5LNRA 4UFLA 1W5PA 3YPIA 3GXNA 4LS2A 3T55A 1RPXA 1Z44A 4ZQCA 3W7HA 4JTFA 1W5NA 1IIGA 5KZDA 1KFLA 2YYUA 3FKRA 1C8VA 1QPOA 2NUWA 4AF0A 1KTCA 4POCA 1C29A 3EWZA 3KHJA 3PG9A 3CHVA 1PV8A 3HGSA 4OU1A 2X16A 1TRDA 4O53A 1B9BA 1GTEA 1FWWA 4YXGA 1SO3A 3LCWA 1H7WA 1OFAA 2HS6A 4LY8A 4R33A 5AB3A 1GVQA 1LRTA 1N55A 3PAJA 4ZQPA 2WOQA 3U8GA 1OABA 1B4KA 1KFJA 1VR6A 3TFXA 4X22A 3EWBX 2P1FA 4NXSA 3R89A 2EGZA 4R53A 2ISWA 3OHIA 3B06A 1SZEA 3P84A 4GE8A 1A53A 1AK5A 3S5YA 3PY2A 1Z42A 2NWSA 1VYSX 2R94A 4KKXA 2W6RA 1PCKA 3EWXA 1OX6A 1SW3A 3H55A 5I3JA 3GNNA 3OVQA 4YCOA 3HGRA 4RV8A 1FWRA 3DXIA 4EIVA 4UCGA 1MEHA 2BZNA 2LLEA 3NVTA 4MY8A 5K9DA 4MVAA 3CWNA 4KFNA 4GC4A 1OYCA 4LVAA 3G1XA 4JS3A 1M7OA 2CFFA 3LRLA 3C2OA 3D0CA 3C3NA 3WK2A 4O0KA 4RR4A 1ONRA 1QOQA 3CEUA 3TNOA 1BWLA 1VS1A 1VRDA 3GXTA 3DFTA 5EKYA 3HPZA 3OIXA 5CGQA 4FB7A 4GFSA 2OZ0A 1WAUA 4ZQOA 2G96A 4HPXA 4WY0B 3O06A 5IBXC 3HG5A 2NXGA 1ICPA 4UFKA 2EF9A 4TR9A 3W71A 4MJMA 5F2LA 4MFDA 4PTNA 3M44A 3STFA 4JTJA 1JRBA 2A7RA 4IJBA 2DZUA 3KRSA 5DBTA 4O1BA 3NR0A 2V30A 1OYBA 3P5YA 1XL9A 1KTBA 3BLFA 3IGSA 4JXCA 1VZWA 5H2ZA 1H61A 2XN0A 3PWAA 4ZQMA 1F2JA 1O5KA 2Q3OA 1TRIA 4R34A 3LRKA 3FLUA 3GZ3A 1WDWA 3M5XA 4M6QA 3FJLA 1VCFA 3TSDA 3PUDA 1X1ZA 4UTWA 1RD5A 4NUWA 4EF9A 4UTJA 5D04C 1Y0EA 1LRNA 2W79A 5KTLA 1FUYA 3QSRA 3NL2A 1SZNA 3W1RA 2H3BA 5F1VA 3WJXA 4CQAA 4JTHA 3W7MA 2DZPA 2J24A 2Y7DA 4AB4A 4CCDA 3LX9A 2ZA3A 5U4NA 3ZR4A 1J4EA 3E9AA 4NJGA 3WJSA 3BARA 2QR6A 3FIGA 3TCEA 3IIOA 1Q3NA 5DELA 4DEFA 3DU0A 1SUXA 4N4QA 3MP4A 1TREA 2FB2A 3EEGA 1FQ0A 2C16A 1TQXA 3WJYA 3RK8A 2QUUA 4M5PA 1H51A 3KVMA 2E5DA 4NX0A 3W1AA 1EPXA 3OVRA 2YX0A 3G1FA 4O16A 3MI2A 5DY3A 3DHFA 3CTLA 1AW5A 3QMTA 2Q8LA 1DJNA 3O15A 4I7UA 4IMEA 1LBFA 1AW1A 1WXJA 1PHQA 3ZWTA 4M7TA 5CZ0A 5KZMA 4QM1A 5AHIA 4RCXA 4IWWA 1FDZA 4TU1A 4E2BA 5AOUA 1I2PA 1NF0A 3STGA 2F7FA 2NUYA 1S3HA 3QYQA 3W1NA 4Q33A 4FO4A 3DHDA 4S2BA 3L0NA 2GJLA 3INPA 2BLEA 3LXCA 1XUUA 2VXNA 3UWVA 2C14A 2BXVA 1EP3A 4FIQA 1AG1O 3G1DA 1DQXA 3EB2A 1W5OA 4PODA 1TQJA 3LB0A 4UFJA 4MYXA 3KAOA 2BTMA 3QF0A 2GUUA 3ATYA 1X7FA 1M5WA 1QWGA 4OQVA 2G95A 2RDUA 4LWWA 4ZZ9A 1OFDA 4HHPA 3NL3A 3UWWA 3KRZA 3AO0A 3TIMA 2RKXA 3G8RA 4O4VA 1V7YA 5BOOA 3W6YA 1GZGA 1IGSA 2O7QA 3W70A 2V2HA 1ZCOA 8TIMA 3ABRA 3W7DA 3B05A 1GYLA 3FKKA 3STEA 3SFKA 3W7JA 5ABTA 5I3IA 1ZAIA 3FEMA 4NU7A 1EA0A 2WV8A 3NQFA 1W0MA 2DJXA 3EXRA 3UY8A 4FIRA 1KM4A 2ISSA 2JK2A 1DHPA 1TMHA 2WNQA 4UXDA 4FX7A 5E1QA 1X6UA 4E2DA 2J9ZA 2J6XA 3MYPA 1UBSA 2ZQ0A 4MUZA 5AN7A 3TR2A 3E0IA 1W54A 1W31A 1VH7A 5J5RA 2B7QA 5C5YA 4MFEA 2A7NA 5C6MA 1TB3A 2ZCGA 2BX7A 4FHAA 3DH7A 4JY8A 4PEKA 2WSRA 3S1UA 1F6PA 1VC4A 2V2CA 3A23A 3RU6A 1TPEA 5EPDA 2QJIA 2Z6IA 1TPH1 3P82A 3OBKA 3USBA 2C6QA 1GPWA 3KX6A 3G1AA 3DI1A 3CIWA 3GAYA 4IPIA 4NJHA 4K7YA 3GR8A 4O28A 4AEOA 2VEMA 4C1KA 1HL2A 2ZTKA 5MHBA 3B8DA 3NPVA 1G67A 3DKJA 3LHVA 3BLIA 1JULA 5DCBA 3A24A 1DKWA 3TW6A 5TQLA 2PCQA 3LI1A 4I9AA 4XKYA 2ZZ2A 1VLWA 2P10A 4Z08A 4O52A 3M16A 3TAKA 3NO5A 3HB9A 3MHGA 3S1VA 5D02A 2IQTA 1UASA 2E6AA 3IGUA 4B5NA 2OX1A 2YR1A 4NQ1A 3R5EA 1XI3A 1MEWA 4S2CA 2H8ZA 1WYIA 2QUVA 3PBUA 3L67A 3BLEA 4YCPA 2YPIA 4EVZA 4KWVA 3G22A 1I2NA 1K03A 2B0MA 5E93A 4MIMA 1I4NA 1WQ5A 1OG0A 1B4EA 3UPWA 1F5ZA 1RR2A 4J9JA 3KOFA 4QAIA 3H53A 4NJIA 3TAOA 5CKSA 5HWMA 4LVGA 4O57A 1IIHA 3GKFA 2C1HA 1TPB1 1ME7A 5FF0A 1T8XA 3N9SA 3U6WA 1K3UA 2RFGA 2H3DA 1SSGA 3CM4A 4ZL1A 5F2MA 3CB8A 3VE7A 4X9SA 4P61A 2H6RA 3RLVA 4MZ1A 3N3MA 3W23A 3NPUA 3TSMA 2Z6JA 2E5BA 3BVJA 3M5YA 3NM1A 3L66A 3Q37A 5D09A 1KM3A 4Q4KA 3ZWSA 1JR1A 4IMFA 1A5SA 2V82A 3G24A 4DO6A 2A6NA 1KM6A 1G4SA 5BMXA 2VC6A 1YXDA 4OHQA 4GUGA 3UY7A 3W1XA 5HMSA 2CZFA 3C6CA 4X2RA 5D37A 1K8YA 2ZRZA 1FXQA 3NPXA 1N8FA 1XM3A 2V9DA 1KA9F 1OK4A 5DXXA 5CPMA 5LGZA 2DJLA 4RXGA 5LNWA 3B0VC 1VYRA 1GT8A 3B0UX 1Q6LA 4P2VA 3I7QA 1FDJA 4LRSA 4IPJA 1U5JA 3NNTA 3P62A 2DP3A 4UTWC 1GVSA 3OEXA 3MWAA 3NL5A 1I45A 1P5BA 3SSJA 4O1DA 1VGAA 1GEQA 3W7RA 3G18A 4GBUA 2QJGA 3C52A 4D2JA 3W1QA 3LTPA 4JTUA 3UWZA 4DF0A 3M41A 2Y63A 1EEPA 3W72A 4A3UA 2JGYA 3N2MA 5K2ZA 5F1UA 1H63A 2ZZ3A 4JIQA 3QH2A 2QCMA 4A2SA 2CZDA 1G69A 3L65A 1KBIA 1KM5A 4HSOA 1HFBA 2QCFA 1D3GA 4ADUA 3VE9A 4FNQA 1VPXA 3UXDA 5HNRA 5D2XA 4O11A 1N7KA 5DCEA 2ABBA 3ABQA 1A5BA 3WFAA 1P0KA 4O15A 3QSTA 3O16A 4IXHA 4OGZA 4OV4A 2WSYA 3FYPA 1H1ZA 1BKSA 3C56A 1PHWA 3DAQA 1H7XA 4JD4A 2CLOA 1LBMA 1PL9A 3T44A 4O19A 3SGUA 6TIMA 5K3VA 4CCEA 3UD6A 1D9EA 3LHUA 2ZRUA 3LCGA 3G1SA 5D2YA 3R2GA 4Z1AA 2HTMA 2WPBA 2ZZ6A 5I3HA 3QPYA 3O63A 4N6EA 4IMGA 2NX1A 1ME8A 4I7VA 3NDOA 3W7IA 5DCDA 2Z1BA 4BR1A 2VFEA 4XWUA 3NQAA 4AF0B 5KMYA 4LNYA 3VCRA 3M47A 3EWYA 3IIPA 2PURA 4IUOA 1ZENA 1SW0A 1Q6RA 2YYTA 4M6VA 1LORA 2VEPA 4UR8A 2EKCA 1RVGA 3A21A 2Y7EA 3LDVA 4K36A 3TKFA 4JEQA 4BI5A 3F1QA 3O07A 4UTUA 3Q94A 3W7NA 4GUIA 1TV7A 3W86A 2Y7FA 5AC7A 1JJKA 4BK9A 2Y7GA 5G4EA 2DZSA 1H60A 3PUOA 1RQEA 2ZZ4A 5AYXA 4CQ9A 4WX2A 4WD0A 4OE7A 2E68A 3C2FA 3K30A 1WX0A 3MP5A 4IX2A 3W2KA 3NQ8A 1P1XA 3M1ZA 3IVTA 3RF9A 4KFPA 4NJJA 3UZ5A 4QQ3A 1SFLA 1YDOA 1ML1A 1P4CA 2HS8A 1J5TA 2NXHA 1W3NA 2Y62A 3NPWA 5LHEA 1F74A 1KM0A 3QFEA 1XFBA 4RKAA 4AWSA 4HNNA 3TC6A 2ZZ7A 4H4IA 1CW2A 3A5FA 1OJXA 3G8EA 3EX4A 5TBOA 4TMBA 4K7VA 4XBKA 1TTJA 3MHFA 4LW7A 1YLVA 1E51A 2G97A 3PSWA 1KFBA 2F84A 3P81A 5KINA 4NX5A 5CPNA 4NNAA 3E12A 4JYFA 2YSWA 1LTDA 1SO5A 2UV8G 3QRHA 1XCFA 1I2QA 4GNJA 1L6YA 3LCXA 4YL2A 3OA3A 3GYEA 2CLIA 4E0CA 3KVLA 3MW7A 1MO0A 4C1LA 2RDWA 3TJXA 2EHHA 2QCCA 1PE1A 1ZNNA 1SR9A 5BMWA 4UR7A 3W7EA 3S42A 3GKAA 1O95A 2ZBTA 1FBAA 4LVFA 5F2IA 1UUMA 1EP1A 1WV2A 2ZFAA 4TMCA 3B04A 1XBZA 2J9YA 4O13A 1P0NA 3W76A 3LRMA 5HR7A 5FF3A 4U4MA 3QC3A 4AXKA 3QQ0A 4PFMA 1SQ7A 4RK8A 4LC6A 2VEKA 4UC5A 3PB0A 2CLEA 3EWWA 5CSRA 2EPHA 2GQAA 3G3DA 3MO7A 4ZQNA 3NQ6A 3NA8A 4LUJA 2TMDA 2W0UA 1Q45A 5A5WA 3I68A 3S8HA 5HR6A 2VFDA 3LXBA 3GDMA 1GVFA 3W2JA 1FWSA 1SO6A 3S0CA 1YYAA 1IXOA 5D2TA 5E0KA 3Q58A 3W2LA 3W88A 3GK0A 4JDBA 4RXFA 3F4NA 3PG8A 3UWUA 4JY9A 1Z48A 2QDGA 1EUAA 3MMTA 5CZSA 3W2UA 1R46A 3LCIA 4Q32A 3A22A 4WZHA 3RLUA 2QJHA 1QMLA 1EUNA 2QCNA 3STCA 3EX1A 4DF1A 4FNSA 1OX5A 3EKZA 2OMAA 3S9YA 4MZYA 4JYEA 4N9CA 5BNKA 4RZ4A 3TMLA 4DPQA 4QISA 1F76A 2X1RA 4N9DA 3L5AA 2B7NA 1VYPX 2C19A 3QW4B 4WXYA 4JTIA 3CU2A 4O18A 3QJAA 4A2RA 2CLFA 5C2XA 1A5CA 3W84A 4FX8A 3BGJA 3HF3A 2GQ8A 2XN1A 4O50A 4WXZA 5HWJA 3ANYA 3GVGA 1W1ZA 5FEZA 4QSHA 3A9IA 1O4UA 3QPZA 3NQGA 4LT9A 4LS1A 3O1NA 3P67A 3ABSA 4LTSA 5J5DA 5FEPA 4K8EA 3HO8A 2ZA1A 2C13A 4K6AA 4JX5A 4ALDA 4CCCA 1H7RA 2ZA2A 4HKPA 4DO5A 1EWDA 1S5VA 5LGXA 1VCVA 2HMCA 3M7WA 2H90A 4M7SA 3SIZA 3V1PA 3E96A 4MLRA 3NG3A 1U83A 4QNWA 1SZGA 4XBSA 3W73A 2NV1A 3ZS4A 4TX9A 3TK7A 2DU2A 1TV5A 4Y6GA 1GVRA 1RQBA 2YW4A 4UUIA 4AAJA 3TQ0A 4NXKA 1B3OA 1FXPA 1XDLA 4AHOA 1PCWA 3W2MA 1K7EA 1TTIA 2TRSA 2CW6A 1JCYA 4MY1A 4LS0A 3QZEA 4UTHA 3N2XA 4FXSA 4NVTA 3NQ2A 2E1DA 5DBUA 3TXVA 4OWGA 3TDFA 1GWJA 5DN1A 4Y96A 2QAFA 5AFDA 3RNDA 4WY0F 4BI7A 2FDSA 2A4AA 1AL8A 1YTKA 4HNVA 2HSAA 1KFKA 1OYAA 5L6UA 2Z2UA 2PRLA 2A2IA 3I7RA 3N9RA 3I65A 4UTIA 3WK1A 2XN2A 3IRDA 1QO2A 1FWNA 5HWNA 3ATZA 4N9BA 1KBJA 2Y85A 2WSQA 4UTTA 1OF6A 3S1WA 3DBPA 4OV9A 1TPDA 1I2RA 1QAPA 3LOTA 2WO5A 2PC4A 4N02A 4ZMGA 2FTPA 1H1YA 3FYOA 3U2OA 1TPWA 4WOZA 3O6CA 1YXYA 2AAMA 4GJ1A 1EX5A 3L5MA 4A29A 1SU5A 4N6FA 2X1TA 1AL7A 1Z41A 1C9DA 3GDKA 4NNBA 2X2GA 5G5IA 3IIVA 3BW2A 3GXPA 3NYZA 1GVOA 2WJZA 3PUEA 3ELFA 3DZ1A 5HUOA 2CLHA 1TYGA 3M6YA 3CQ0A 3CIXA 4NZJA 1H7PA 3R13A 2I9EA 6ALDA 4AWUA 2GPTA 1JCMP 2PE4A 5KSWA 3HGOA 5EY5A 4DQWA 2VENA 4MJZA 2NV2A 1KTNA 3JS3A 4IMDA 3W1LA 2QCGA 3PSVA 3W7LA 3W7GA 3W3OA 5CSSA 1MZHA 2C18A 1W56A 4O10A 3IV3A 3NQVA 4IQLA 1ZY9A 3EX6A 4AHQA 3HG2A 1DV7A 4A21A 3ABOA 2E6DA 3NAVA 1PIIA 1XDMA 1OX4A 3TV8A 3TW7A 4PL1A 4JGDA 1FCVA 3HGJA 1QO5A 4K37A 4UMAA 5AYYA 1LRQA 4IXXA 2A7PA 1QPRA 1JQXA 4M19A 3W9ZA 2YFOA 3UNDA 4FXRA 4U28A 3CEPA 2VFFA 2WKJA 1KFEA 4Z0JA 3W2NA 1TTQA 3E49A 3B4UA 3G0UA 3UQNA 3LERA 2GJNA 3EXTA 4EWND 3LCHA 4UMBA 4MPQA 4I7WA 3DFPA 3NL6A 3UPBA 4Y9AA 2V0TA 4RZ5A 5BRBA 3QM3A 4GWEA 1OFRA 2E6YA 1J2WA 1IXPA 3IVUA 4UNKA 1W5MA 5C54A 3PB2A 2CZ5A 2PRMA 3LHZA 5F4SA 2FPYA 5LNVA 4O8RA 1S5TA 4ORIA 1G4PA 2A0NA 1X1OA 1H62A 1ZHAA 2QAPA 1W3TA 2JKEA 1FDYA 2ZRYA 3P8IA 3TSBA 1ZAHA 5I3KA 3BK0A 1JCXA 5FEWA 3NOEA 2H8XA 1SO4A 1K8XA 2QCDB 2YGYA 1SW7A 5D32A 2FFCA 5LKYA 4LV9A 1XBXA 1QOPA 1L6SA 4LVDA 2A1YA 1AMKA 4HT3A 3MBDA 2QCHA 2FJKA 2CLKA 1W3IA 4CNNA 5TIMA 1EIXA 3HQ1A 4UNLA 1ZAJA 1OFEA 4OBTA 2EAWA 2Q8ZA 3BO9A 2X1SA 2I1OA 3R12A 3W7CA 4TIMA 1G4TA 5EYWA 2A6LA 4PA8A 2ZRVA 3JR2A 3QQ1A 4JNMA 3W7KA 3QMSA 3PM6A 5C55A 3E02A 3OVPA 3EKLA 1R2SA 4ICNA 1KLYA 3M5ZA 3N19B 4BWLA 3W74A 4IOTA 3CLMA 4DELA 4HNUA 1YXCA 5EMUA 1JQVA 2JGQA 3O6YX 4YMZA 1FCBA 4NZFA 3LGEA 5I3GA 2ZYFA 2WNZA 3VKJA 5LHFA 3GDTA 4TO8A 2DZVA 1KM2A 3LHWA 2YCEA 3LLFA 4S1FA 2E6FA 3GDRA 3MYOA 1HO4A 3TXZA 3DGRA 3N14A 3WJZA 2Y61A 4O17A 1W8SA 1TSIA 5L9FA 1SPQA 4L4MA 3FOKA 1QCWA 2GVLA 5AHLA 4ZVJA 3I6RA 1A50A 4KFOA 1ICSA 3GIYA 3QEZA 5KZEA 2V2DA 3W85A 3L5LA 2E5CA 3BG3A 1NVMA 5F4WA 3GNDA 1XC4A 4XTDA 3BGGA 5HJLA 1IXNA 4QJ1A 4CNPA 3HBLA 1T0OA 1YADA 4XQ6A 1LCOA 1R47A 3C2VA 2QCLA 3W7QA 3B0PA 4EF8A 5FEXA 4OT7A 4K38A 1A5AA 1IXQA 4IMCA 2FPVA 4FNPA 2OCZA 1K7XA 3M9YA 4K8HA 3TQKA 1O60A 5T26A 1OFPA 2QUTA 1GG0A 3MJYA 1G4EA 5BW6A 1LOQA 2C15A 1L6WA 4JX6A 4M6PA 3DFSA 1FY6A 1LOSA 3HMJG 3WK0A 1OK6A 1DQWA 1UUOA 2ZDRA 3P8JA 3PVFA 3S5NA 3KRUA 2Y6ZA 2Y88A 3V75A 1TTPA 1DJQA 3F03K 2QF7A 3TA6A 3TJLA 2OT1A 3W87A 1I2OA 2E09A 3IEBA 1ZJIA 2FQIA 1Q6QA 2OJPA 3CPRA 4R7JA 3O6DA 1GG1A 3LLDA 2VFIA 2ZZ1A 1DL3A 4HN4A 5D30A 3L9CA 5D2WA 2C0AA 3MHUA 2Q3RA 2C3ZA 4UFIA 3T78A 4GRSA 3W75A 1WBJA 4UTTC 5K4XA 4JTSA 1KV8A 2Y89A 1PS9A 2JKPA 3KXQA 4K39A 1QR7A 3A5VA 3W07A 3I7SA 5F4XA 4ADTA 5GVJA 5CPLA 2CLLA 3G0XA 2DZTA 4FNUA 3JRKA 1VJIA 4NNCA 1EP2A 3PR2A 1ALDA 3EX3A 2VELA 4WY0A 1XUZA 1NSJA 1B57A 3NQCA 1O5XA 2V8ZA 3NQEA 3UZJA 1CX9A 4FF7A 4ML9A 5AC8A 3BPWA 3M43A 5AYZA 3DFQA 4H6KA 5D2VA 5DLCA 4X3ZA 1H7OA 3LV5A 5G2IA 2GVJA 2NZLA 3KVJA 1W37A 4XZ9A 1T96A 2ZRWA 1CI1A 3LHYA 5LNSA 1LZOA 1M7PA 2G5WA 3VNDA 2V81A 5CG7A 2VOMA 3NQMA 4JTEA 4O14A 3TH6A 1UB3A 1X8FA 2R8WA 1HTIA 5EA9A 5F2GA 3DFNA 1QPNA 3S6DA 1JCNA 2YW3A 1H5YA 4Z0SA 1R30A 3W22A 1XXXA 3F4WA 3NZ1A 1ZALA 4NT0A 1JVNA 3MI6A 4DBDA 3T4CA 1W5QA 4KWWA 3TUUA 1TCDA 3VI2A 1JCJA 3O8AA 1YPIA 3S1XA 4BF9A 2A5HA 1GJPA 4UMCA 2B7OA 3IVSA 2PRHA 2TYSA 1LM1A 3CC1A 3FS2A 3W1MA 3TFCA 3GAKA 4MY9A 2J9XA 5DY2A 5AC6A 2V5LA 2TPSA 1LDCA 2FLIA 4FEZA 2NX9A 4CNOA 5IM51 3GLCA 5I3FA 2B4GA 4Z1BA 3DKLA 1QDSA 4ZQRA 4O0ZA 4UIOA 5D03A 4JICA 5AHEA 4BI6A 3SY5A 1K02A 2ABAA 4UFHA 1DVJA 4WOQA 2X1UA 3RFAA 4N4PA 3G0SA 3SW6A 3L0KA 4AHPA 1K8ZA 4JDYA 1SFJA 3GDLA 3SGZA 2VFHA 3AJXA 4PH6A 2RHGA 4QIUA 3L0GA 3UWQA 3G1HA 4XTIA 4Z1CA 2E77A 1GOXA 1G6CA 2WQPA 2QEZA 3HJZA 4N9EA 7TIMA 1L9WA 3WK3A 1OHLA 3IGXA 5FI8A 2JBMA 1S5WA 4QNEA 3BV4A 5AHFA 4O4WA 3LM7A 1BEUA 3R8RA 4LRTA 4GUJA 1WOAA 3LBMA 2Z0IA 1GQNA 4DF2A 1HG3A 3N34A 3SZ8A 4WUIA 1JUKA 1R2TA 1VLIA 2YZRA 4AMAA 3TU9A 1YTDA 3DFOA 4AH7A 3C0JA 4HSNA 4EOUA 1KFCA 3FA5A 4LU0A 3NZRA 5FF2A 1QPQA 3P60A 3BW3A 3HOJA 1DBTA 4Z1DA 4ADSA 3PBYA 1HUVA 4BWLC 5LSMA 1G7UA 3KFTA 4L4LA 2ZRXA 3HPSA 4GXMA 1XBYA 3S5ZA 1WA3A 3T40A 1TJRA 3L2IA 1RZMA 2RH9A 3PF3A 2JKAA 3SR7A 3THQA 5K4ZA 2YFNA 3NXFA 3QW3A 3EWUA 5HULA 4JN6A 1F73A 1RQHA 3BG9A 4LOCA 1GYNA 1YTEA 3M0ZA 1KW1A 4UTMA 4PCFA 1GTHA 3G1YA 5D05A 3T7VA 3MP3A 2V5BA 4RX0A 3W1TA 3P5ZA 5G1YA 1TPFA 3B03A 3NM3A 2NUXA 1MXSA 2CZEA 1XBVA 4HIBA 3LI0A 1IF2A 3W7OA 4AVFA 1D3HA 5EL1A 1QNVA 5HUPA 5AHMA 3C4UA 3FFSA 2BSLA 5H91A 1JUBA 5K9XA 3LTYA 3M5VA 3W1PA 3MUXA 2ZTJA 3LHTA 3VFLA 5SWUA 1NFBA 3TQVA 1ME9A 4FNTA 3LCFA 4PC8A 4PL2A 2QKFA 3LTSA 1L2UA 4WJEA 4N2YA 4YLWA 4DBEA 4WQ6A 3BW4A 4O1AA 3LBCA 4RZ6A 2R14A 4Y8FA 4HNTA 3THAA 1TJPA 5IBXA 4XKYB 2DZWA 1KV5A 4JTLA 1I8JA 3W1UA 3G3MA 2BWGA 3TROA 1THFD 3TE9A 5CPOA 2KZHA 5K9CA 3C61A 3HG4A 5FESA 3TX9A 5LNUA 1OFOA 4JX4A 4DPPA 1HO1A 3NQDA 2TSYA 3OG3A
chains in the Genus database with same CATH superfamily
2AMXA 2Y70A 1R3VA 1XC6A 4CD5A 4DO4A 4LEFA 3ZT6A 4DXVA 4LV4A 4CQ8A 1RJPA 2WC7A 1QASA 2PCEA 1E6ZA 5FF4A 2ATSA 4LUYA 3PBWA 4KEZA 1AQFA 2EPMX 4CLMA 3BJFA 4S3GA 1BTMA 1AQHA 3N18A 4KRZA 1OVDA 4MB4A 4P8XA 1UC5A 7REQB 1CTNA 4JQ2A 4BFAA 1MSSA 4LBSA 3EA3A 2H9AA 4DZAA 5A8NA 3PC0A 2A3AA 1UR8A 1VBUA 1ZFJA 2UY4A 3PJUA 2GQ9A 1LP6A 1K7FA 1KRCC 3PULA 3QMRA 3MO4A 1BFNA 1TIMA 2WPGA 3G1RA 1OFBA 3AICA 3LXAA 4FX6M 4WGXA 1ZJBA 1EB3A 1M41A 2A85A 1FWJC 5CH9A 2GUYA 5A6JA 4A22A 4Y7EA 4M24A 3OYXA 1Q6OA 5A8GA 3CT7A 3L68A 3GZAA 2QCDA 1TV8A 5BRPA 3W83A 4O0QA 1US3A 4EXAA 3SECA 4PULA 1JFXA 3VM5A 4XD6A 2GVGA 4YWIA 5HQEA 1NH6A 3GB6A 3P93A 3V5OA 3DG6A 1JEZA 1VBJA 2ATMA 4DJDC 4O12A 3ARZA 4I9TA 4XSMA 1JUEA 2B7PA 1PYMA 3MBFA 3I3DA 5DRCA 1CEOA 4MYAA 1UJPA 1X7IA 4E5TA 1QFEA 4JQ4A 6A3HA 3PZNA 2ANUA 3TC7A 4UFMA 3HM7A 4LUIA 3OLGA 4M82A 2NWRA 1VHCA 1W1TA 1B0IA 1BQCA 1Q85A 1YPFA 1POJA 3Q2DA 3LV6A 4W4QA 4DJFA 2OT0A 4MOZA 4GVFA 2O7SA 3G1VA 2PDCA 2WZIA 1RLDA 3C3UA 2D2OA 5LNRA 4DYEA 3R1ZA 3CYVA 4LS2A 4NASA 2QZRA 4H6EA 3W7HA 4JTFA 1W5NA 3RU8X 4X0NA 5DO8A 5KZDA 3KL3A 1EF3A 4DRSA 1NY1A 1C8VA 1KTCA 4X63A 3EWZA 3PG9A 4O1EA 3WO8A 1B5TA 3VD3A 3PZGA 3ZVHA 2X16A 1TRDA 2ZX9A 4O53A 1B9BA 5C9WA 4YXGA 1SO3A 2HS6A 4C6DA 3D3FA 3WSUA 2PODA 1N55A 2WMHA 2DFAA 2WOQA 3U8GA 5I78A 1OABA 4PB5A 3TFXA 2WVTA 5CG0A 1Z3NA 1FWFC 3AMKA 2A3EA 5REQA 4AD2A 3OHIA 3B06A 2UBPC 4GE8A 3PZMA 3MU7A 5JQ9A 2PWDA 1W6TA 4NAEA 3SRFA 2NWSA 4KKXA 4FZIA 1P1MA 2W6RA 3B97A 1PCKA 3WNPA 4BKNA 3H55A 4FXJA 1R6WA 1L0PA 4MNJA 5EMLA 3OVQA 1ONXA 1A3XA 4UCGA 3TONA 3CQHA 4MVAA 3CWNA 4KETA 4GC4A 4LVAA 1CGTA 3G1XA 4C6NA 4JS3A 3LPGA 4DYKA 1REQA 4C5ZA 3VDHA 3BJTA 1TWIA 1LUCB 2CERA 3D0CA 3WQFA 2CHRA 1DWIM 4C90A 4O0KA 1XLHA 2P88A 3VOHA 2HK1A 1BWLA 1WZKA 3QY6A 4RL3A 3P2VA 4LUTA 4F0HA 4K2SA 1UD6A 3EOSA 4H04A 2IW0A 4NF7A 4ZQOA 2G96A 4ZXOA 1XISA 4TTUA 4YJ5A 3O06A 5IBXC 3UGRA 2WB5A 3CUHA 2EF9A 4TR9A 3WQCA 1B3WA 4C91A 2A7RA 4IJBA 2OSYA 2OOFA 3KRSA 4IIHA 1J2BA 4WRHA 3NR0A 2HNEA 3AMGA 4JXCA 8A3HA 2QHAA 4ZQMA 2G4FA 2GJXB 1QNRA 2AL2A 2YB1A 2EPKX 3GHRA 4B2DD 4GD0A 3LRKA 3OB8A 3PWIA 2X2YA 1XLCA 3V3WA 1V0KA 1OC5A 3H23A 1K77A 1VCFA 3PUDA 1CNVA 1RSCA 1PUDA 4NUWA 1LRNA 2W79A 4NILA 4GO8A 3W1RA 1FP9A 5F1VA 1PO9A 1UPPA 4G7FA 1JDAA 4ICMA 4AB4A 1CYGA 3LX9A 4WK9A 5U4NA 3E9AA 3FIGA 4LNCA 3TCSA 3TCEA 3CV7A 2OR2A 3DU0A 4HA1A 1SUXA 4N4QA 3EEGA 1FQ0A 4H83A 2OO0A 3RK8A 3B9DA 2F2HA 1CLKA 4PMJA 1LLOA 1S2VA 2XHYA 3DIPA 3W1AA 2IPFA 2VGGA 3MI2A 2GFTA 3DHFA 1JNDA 3WUEA 4EK7A 1AW5A 1GCYA 3O15A 1LBFA 5IFPA 3DECA 5F7UA 3ZWTA 2IPJA 5CZ0A 5KZMA 4FI4A 4RCXA 4CGTA 1FDZA 3FAXA 1X38A 3T08A 3STGA 2HDJA 1S3HA 2Y1HA 3DHDA 1DJZA 7PTDA 3V4BA 2BLEA 2J8FA 3MC5A 4PYSA 2BXVA 3E0VA 4KWUA 4XV0A 1IT8A 1RH9A 1GJWA 1TQJA 3RX4A 5J04A 4TX8A 2BTMA 1J0JA 4NZCA 4ROPA 3TEVA 1M5WA 2PSNA 1TMLA 3GW3A 1ELSA 4K68A 3VIJA 1OFDA 3KRZA 3KP0A 3TIMA 2OWWA 1TUFA 3SB0A 3W70A 3E2RA 4QS5A 1ZCOA 8TIMA 3ABRA 3W7DA 2PS2A 4US5D 3STEA 1SYTA 3W7JA 2FVLA 2Y2WA 1ZAIA 3FEMA 4NU7A 4LFYA 3HQPA 1B3ZA 3CL8A 1W0MA 4XZLX 3UY8A 4B9YA 1GORA 2ISSA 4FSAA 5I77A 1X6UA 2J9ZA 2VVNA 5AN7A 1TE6A 3TR2A 3WMLA 2X0YA 4F40A 2J7DA 5J5RA 5C5YA 5FA5A 1LQ2A 4MFEA 2A7NA 4UQEA 1GVIA 5FJOA 3R6IA 4NZ3A 4QFUA 4QXIA 1RLCL 1VC4A 1S39A 4Z17A 2WANA 1UR0A 4NL1A 3OBKA 3K1GA 3E0LA 3TW9A 3USBA 3IUIA 1GPWA 2V3DA 5FEZA 3CIWA 3CUZA 4K7YA 4O28A 2VEMA 4C1KA 2ZTKA 5MHBA 4LY4A 3DKJA 3LHVA 2FZ8A 3EKGA 3TW6A 4AZHA 4P7NA 4JIHA 4XKYA 2J13A 4MG4A 2P10A 5C9ZA 3M0XA 4PFHA 3O7UA 3TAKA 4LF2A 2YKKA 3CHDA 3VUPA 1UASA 2CNCA 2CWXA 4B5NA 4YTTA 4NQ1A 2Z1SA 1MEWA 3BAXA 2H8ZA 2W27A 1WYIA 1W1A1 3PBUA 3L67A 2OQYA 3KWXA 1EDTA 5CC5A 2EPOA 4EVZA 4KWVA 5EMMA 1Q5MA 4MIMA 5LIWX 1WKYA 3TYUA 4CN4A 1A3WA 1B4EA 3UPWA 3CV6A 4F66A 2PF8A 4J9JA 5M1TA 5CKSA 4O57A 3QV9A 1IIHA 5JUVA 2C1HA 1WNOA 3AXIA 1ME7A 4CN6A 1T8XA 1BVNP 4B15A 2H3DA 1SSGA 2A79A 4ZL1A 4P61A 3RLVA 4MZ1A 3W23A 3HQOA 1UR1A 3IJLA 2NQJA 2WVVA 2Z6JA 1XRTA 3L66A 1B30A 4HCHA 4Z2LA 3VGDA 1R8LA 5BMXA 6REQA 4BF7A 4HOWA 3W1XA 2NQ5A 2JEPA 4AZIA 2J25A 1XM3A 1OK4A 2BGNE 2Z1WA 3B0UX 1GT8A 1V6VA 3HMCA 4UTWC 5HNUA 4O1DA 1GEQA 2FHCA 4W85A 3G18A 4V15A 2XH2A 3LPFA 4XG1A 4JTUA 4DF0A 3M41A 3U2CA 2B81A 5PTDA 3CWHA 5C9RA 3QHNA 1O5RA 2JGYA 2BB0A 1A5NC 4ZTYA 2O9RA 4GY1A 1H63A 3SADA 1UG6A 2QCMA 2CZDA 3AXXA 2QPXA 4TV5A 4QGCA 1VPXA 4QG6A 3ONCA 1FP8A 3WH8A 5HNRA 1J01A 5GQBA 4DY1A 2ABBA 1EZ2A 1Z9AA 3WFAA 1SM9A 2MUCA 1KO0A 3ZJ7A 3BAIA 1C8YA 3O16A 4JAWA 4PMUA 4LQ1A 1OGGA 2O4QA 2WSYA 3C56A 4WDWA 3DAQA 2VZVA 4JD4A 1NTHA 4O19A 6TIMA 1G94A 3ZO9A 4Q22A 1BVZA 1LQ0A 4QCEA 4HGXA 1D9EA 1VIZA 3LHUA 4H7ZA 2BVDA 3FV9A 2WPBA 5I79A 3LPOA 4N6EA 1KNWA 2C91A 4I7VA 4GZ7A 4QR6A 5DCDA 2Z1BA 2OU4A 2REQA 4E4FA 1LG2A 4LNYA 1X6NA 3EWYA 3IIPA 2PURA 1SW0A 4AIBA 5JXQA 1E1CA 1S3TC 1ISWA 4IIEA 2QUNA 2VEPA 3RITA 2YXOA 4C6OA 3LDVA 4XD5A 4XVDA 1H0GA 2XVLA 2VI0A 3F1QA 3V7PA 2BXZA 3O07A 3A6OA 2DSUA 4UTUA 3Q94A 1DYSA 4GNKB 1HF6A 1UD3A 1H5VA 2W92A 3KBMA 1EC7A 4X9YA 2Y7GA 3MKVA 5G4EA 4AD1A 3DGBA 3GVQA 3T81A 2ZZ4A 1QI2A 1V03A 2PU1A 4XB3A 4QE1A 5IFTA 1TA3B 1WX0A 4F48A 4IPLA 5FAJA 3NDYA 3AFBA 1HVXA 2IPGA 3HURA 4ZGYA 3W2KA 3RPTA 4EPDC 4KFPA 5A6BD 4B92A 4ICCX 4QQ3A 2CZVA 1Q6GA 2NVAA 1P4CA 2HS8A 2GWNA 3VK5A 3QLDA 2DSKA 1SJAA 1RPKA 1CT5A 2XIJA 1XFBA 4S3BA 2EG8A 1OJXA 4CD7A 3MKCA 4XBKA 3PSWA 5T9BG 1H1NA 1KFBA 1P7TB 3VIKA 2PDYA 1S5NA 1K6AA 3VD7A 4NNAA 5I02A 1WPCA 1J0YA 1WP6A 3KUMA 3Q4DA 1I2QA 4KCVA 4Q8PA 2JALA 3QY8A 4BQ4A 4R7OA 3K4AA 2RDWA 1E0TA 5H8PA 4PMXA 1SR9A 5BMWA 2BOGX 1GOQA 1MYRA 2QULA 4LSBA 3L2LA 4ZCWA 2ZBTA 3UG4A 3VOCA 6CGTA 1I60A 3VDCA 4AXNA 5F2IA 4CVUA 3TP4A 1OADA 1WV2A 3SRKA 2V3GA 1P0NA 5FF3A 3QC3A 4AXKA 3QQ0A 4LC6A 2GQAA 4KCUA 4UOZA 4DBWA 4PEEA 5JBDA 1HJWA 1A5OC 2W0UA 3KE0A 2E9MA 3I68A 1US2A 2G4JA 3N04A 5HR6A 3U9IA 2FKPA 2CC0A 3GDMA 3LXBA 3S0CA 3W27A 1NOUA 4U2ZA 4Y8EA 5D2TA 3PG8A 3AXKA 4JY9A 3RX3A 3UXLA 2VDGA 4C6EA 1NP2A 2WWCA 1K8CA 4Q32A 4LYKA 5FCZA 7ENLA 3M0IA 2GWGA 5BWAA 5CBBA 2NQ9A 2QCNA 3STCA 1RBAA 3D5HA 1NJJA 1X8CA 4KT2A 2WMGA 4JYEA 4QISA 2J8GA 4N9DA 1WB0A 3MCNA 7TAAA 4WXYA 7XIMA 3KLKA 2PDLA 4GISA 3CJPA 1A5CA 1QK2A 1JYVA 3VKDA 3BGJA 1ENUA 1UOKA 3CQJA 4WXZA 2HNHA 1NU5A 3T9PA 1R87A 2IXUA 3LPPA 1BGAA 3A9IA 2VUYA 4PBFA 2X05A 3N6QA 3H7VA 2VR5A 3P67A 4LTSA 5JVLA 5CEWA 2D3NA 2BBFA 2ZA1A 3RCYA 3UZXA 1OB0A 2C13A 4K6AA 1UWIA 4CCCA 5KEZA 1ZLPA 2QVNA 2QIWA 4FAMA 3E96A 3UP8A 4MLRA 3UYIA 2Z24A 2P8CA 4QG8A 4QNWA 2EXOA 4XBSA 3REQA 2DU2A 4Z1YA 1GVRA 3WCZA 2Q01A 1WDSA 2ZVRA 4AAJA 1PCWA 3F7JA 4W5ZA 4JBRA 2HE5A 3VKCA 4AD3A 2TRSA 3WLHA 4LS0A 3QZEA 3BSMA 3QQWA 3Q67A 4HMCA 2BDQA 1E0XA 2BODX 2J62A 3E2SA 3CHEA 3ZR6A 4FLQA 2A4AA 1EIBA 4JHMA 4HNVA 1OYAA 4LXFA 2Z2UA 2PRLA 3I65A 3VPLA 2XN2A 3WK1A 2GK1A 1E6PA 1FWNA 1UZHA 3VNJA 2J4GA 2AMGA 2Y85A 4QJ5B 1XYLA 4LAMA 1H09A 3WELA 1I2RA 2WO5A 1XQLA 2FTPA 3ALFA 3FYOA 4TXEA 1EX5A 4EAMA 3GFZA 4WJ8A 2EJAA 4GMEA 5CPQA 1E9LA 3GH7A 1Z41A 1E55A 1IEIA 3LK6A 2IQDA 3GDKA 2X2GA 3VMNA 3ZLFA 5G5IA 1GOMA 1XLDA 3NYZA 1JDEA 4KESA 3ELFA 3PPGA 2WKGA 2WCSA 2NSXA 1Z69A 2VZTA 4B90A 3R13A 2W9MA 4I5RA 5HOSA 3KBVA 5ABFA 3WFZA 2GPTA 2P3EA 4HOZA 1KTNA 5AY7A 3LA4A 1I1XA 3PSVA 3W7LA 3T0CA 4Q4PA 4L6OA 4UQCA 2C18A 4BEUA 1QHPA 3VC5A 1FWIC 1XYBA 5GPRA 4IQLA 1O68A 1DV7A 1BSIA 1MRAA 5LIKX 4LANA 1VFHA 4FK9A 1KBKA 2PTDA 1UMLA 2YCLB 6PTDA 2X7WA 3HGJA 4H9XA 4L6DA 4R88A 4L6HA 4MADA 1LRQA 4AIOA 1ESWA 4U28A 1IQ8A 4J3UA 2VFFA 3SQMA 3TN4A 4LAOA 3W2NA 3R4IA 4MWAE 3O2LA 2G3NA 4P5UA 2YCKX 5HMEA 3B4UA 3UQNA 3LERA 2IQ0A 3V5CA 1ZRQA 2VDIA 3PHAA 2ZWYA 4RE4A 2I7GA 3CQIA 2AKZA 2WJDA 1QNOA 1U5VA 3AXMA 4B9ZA 4I7WA 3DFPA 1O5QA 1XDJA 3NL6A 3KL0A 3UPBA 3EMCA 1EFZA 4Y9AA 2V0TA 5BRBA 2HROA 1OFRA 3RJXA 4HHHA 3M6DA 3PB2A 2IPWA 4QEHA 2CZ5A 5LNVA 2PWHA 2BY2A 3GNXA 1BPLB 4AU0A 4E4UA 4YVXA 4L56A 1NARA 2ZRYA 1ZAHA 5CJ5A 5I3KA 1JXJA 2JEQA 3CZJA 3B8TA 4H8UA 1IZCA 2H8XA 2HVMA 2BGQA 2QCDB 3JW7A 4GIAA 2YXXA 3ARQA 4KGLA 1L6SA 1MNSA 2OGYA 1F3EA 3OTRA 3QY7A 1W3IA 2ZXBA 1WDRA 2Z4GA 3W25A 2FZNA 2X1SA 3IJ8A 2JF6A 4D8AA 3JR2A 2ODOA 3NSNA 3W7KA 4ZB0A 5CXPA 1UC4A 3RCMA 3CPGA 3EKLA 2OYKA 4PN2A 1KXQA 4BWLA 3W74A 3T2OA 4DUWA 4IOTA 1HL9A 3CLMA 4YTRA 4IT1A 4JN8A 1QNQA 3PWGA 4YMZA 5GJNA 1MRQA 1PKYA 3MVTA 4BQ2A 3GFYA 2VC9A 3LGEA 2ZYFA 3LS9A 1K9TA 4TO8A 4MB5A 4ZOEA 2DZVA 3VZZA 3AWNA 1LT8A 4PMQA 1G5AA 4S1FA 2E6FA 2ZVIA 4EWJA 3NCOA 1JZ7A 4TQTA 4A8RA 1TJ1A 1TSIA 2Y8KA 4PUJA 1X1NA 1LWJA 3FOKA 2GVEA 4GQRA 5BXSA 3I4EA 3CUXA 3W85A 2E5CA 2VTFA 1UD8A 1XC4A 2HEJA 2VC5A 3R10A 4QJ1A 1XINA 1UR3M 4ERIA 2CLPA 5ABEA 3WH6A 3ITOA 4PTMA 4R3UA 4Q8VA 2QCLA 1JCTA 3B0PA 1DWJM 4K38A 3OQ8A 2ZUVA 3O0FA 3BLPX 5DT5A 3GYCA 3TN5A 3H2MA 4AEEA 3FYYA 1ITUA 5T26A 1Y5WA 2ZX6A 1LOQA 2C15A 1L6WA 1OEPA 3DFSA 3WK0A 4I5XA 4GQQA 2I16A 3PVFA 4WSHA 4M1BA 2QF7A 2OT1A 1I2OA 2E09A 3CH9A 4QHRA 2CBVA 1ZJIA 1Q6QA 3CPRA 1HGYA 3E38A 5A8OA 4ENLA 3AOFA 3N1AA 4JFTA 2E4TA 5D30A 4LB3A 2Q3RA 1W9PA 4UFIA 2B31A 3ZYZA 2YIHA 3W75A 1Y65A 1KV8A 3F4DA 3SCVA 1EDGA 2JKPA 2ESCA 3VCNA 4K39A 5A6TC 3U48A 3A5VA 4HP5A 3I7SA 5F4XA 4ADTA 4LUTB 2BG5A 1XIDA 3N29A 2CLLA 2DZTA 1OZMA 1UZ4A 3JRKA 3KL5A 5I24A 1KC7A 1RJRA 4HTBA 3OGSA 4H9ZA 4JZ5A 4F2TA 1NSJA 2V8ZA 4AX7A 4EE9A 3B0XA 1UIPA 4FF7A 3KTCA 3BPWA 2FHBA 1EHAA 2G3JA 2NZLA 4DUXA 4XZ9A 1T96A 5E6YA 3SIMA 4GZEA 1CI1A 1J0ZA 2RDXA 5LNSA 2MANA 2O9PA 1EGMA 2OWCA 3VNDA 2VOMA 3AQUA 4YS1A 3NQMA 2R1PA 3GIPA 1X8FA 4XUYA 5F2GA 1U33A 4DJFD 5HANA 1JCNA 2AOSA 1H5YA 3H12A 5CLTA 4CQBA 4AIEA 3MI6A 3VD5A 3T4CA 1W5QA 4BZYA 4EP8C 4E8GA 1E56A 4IFOA 3S1XA 3SCOA 4S38A 2A5HA 1GJPA 1V0NA 4XO6A 4RNIA 3WLQA 3W1MA 3WH5A 3UWEA 2EBNA 4DLMA 2QGYA 3CQKA 1MW2A 2NQHA 4ERGA 3WLMA 4HZ6A 5I3FA 1M7XA 2B4GA 1V3MA 1UKQA 3PUGA 3IJDA 3CAKA 3ZSTA 4HN8A 1B90A 1RCXB 4JICA 3DHPA 3SY5A 3AJ7A 5LA0A 4UFHA 4A3QA 1J18A 3RFAA 4C6IA 1FWBC 3VO0A 3NDZA 1XYCA 3L0KA 3AIUA 3FGCB 2VFHA 4GOAA 4PH6A 1FH8A 4V1XA 4AQLA 2RHGA 3QZAA 5XIMA 3UWQA 3C8NA 4XTIA 4Z1CA 4ZSUA 1G6CA 4WIWA 3BCJA 5CPSA 3GRIA 1KCZA 2ACQA 4CN1A 7TIMA 1L9WA 3WK3A 2JBMA 1S5WA 5HMFA 3SCQA 5AHFA 4HPHA 4NIRA 2PLCA 4A8NA 2GSEA 1HG3A 2FTWA 4H19A 3WFLA 4WUIA 4AD5A 4D1JA 4FALA 4AMAA 4EOUA 4H1ZA 2VRJA 3W4RA 4N7QA 3JVAA 3C0LA 1QPQA 3P60A 5M5DA 3H7RA 1DBTA 4Z1DA 3AUJA 4HYVA 1G7UA 3GHUA 2VRQA 1JAEA 2VX7A 2XZ7A 1R9YA 1XSJA 2HV5A 3PF3A 4Y9OA 3THQA 5K4ZA 1PZ3A 2YFNA 2DQXA 3QPEA 2ZC1A 1E9YB 5HULA 3O9NA 1WKEA 1Q63A 3BG9A 3S47A 3SN4A 1YTEA 3THCA 4UTMA 5D05A 3T7VA 4GK8A 4Q3MA 5G1YA 3RPMA 1TPFA 4ILSA 1YHTA 2VQUA 3B03A 4W86A 3Q45A 4QAWA 1MXSA 3E2QA 1YNQA 3V0TA 3LI0A 1IF2A 3W7OA 4AZGA 3AYTA 1OM0A 2VEFA 5H91A 3AHZA 3QTGA 5AYIA 3KOXA 3LTYA 3M5VA 3MUXA 4R85A 3HV9A 5SWUA 3TQVA 1ME9A 4PC8A 4PL2A 2QKFA 4KWSA 3GU2A 4IFRA 4ZXLA 5C0QA 3WLJA 1BXNA 3ANVA 4Y9NA 4D6HA 2UY3A 1UJQA 3IARA 4LF1A 5LXXA 3RIKA 1JDDA 4BA0A 4DWSB 1TJPA 4XKYB 2BFGA 1I8JA 3W1UA 3G3MA 1DTNA 3R0UA 3VZYA 4MDPA 2JQXA 3TE9A 5CPOA 5FOOA 3HG4A 5FESA 1QI0A 4IZGA 3W29A 3BXWA 4AZ5A 4RDVA 5G1TA 2ZXDA 3DENA 2VX4A 1J10A 1GKQA 4FR1A 3QOMA 4PE8A 3WUBA 2FPTA 2QDHA 2P3ZA 4JIPA 5EBUA 3CTTA 3B4YA 4TX6A 4E4PA 5AHNA 1R2RA 4Y90A 4B3ZA 5K7JA 2PAJA 4FNRA 1VJZA 3GG7A 4H8HA 4Z2GA 2VFGA 3MUIA 4RJEA 2XFRA 2IKJA 1WCGA 2R91A 3BMWA 3CK5A 1JF5A 4JTKA 3P7YA 2RDTA 1HJUA 1M6JA 1F3XA 3HFYA 4RE3A 1EYWA 3M7SA 1VCGA 3F4VA 2C71A 3CUJA 5D38A 3EXSA 1TPUA 1LQAA 4UTKA 1AW2A 1ODZA 5HINA 2L5HA 4QDMA 3U7BA 4YWSA 4O1CA 1FX6A 4QE4A 4FS9A 3LY0A 5U7SA 1UWAA 1H7NA 2X30A 3LCLA 4QTGA 3B3DA 4ZODA 5JIPA 1FKWA 3NGJA 4DNHA 1CXIA 3P74A 1OG6A 4HB7A 3WF0A 1DOSA 2PWVA 1ADOA 3GNRA 4KW2A 4JTTA 3KVKA 1LLWA 3GTNA 3ZIZA 2PZ0A 3I4KA 1UCWA 1G0CA 2WNNA 2DZXA 1I9CB 1VQTA 2OKTA 1Z6KA 4QE5A 4RNFA 1W91A 5LZLA 3W6MA 2I14A 1LYXA 2DEPA 5AZ1A 3TWBA 3EOOA 1DWHM 3IJ9A 4ZSTA 1OFQA 4HPJA 3ARYA 4S3DA 2YDAA 3RXZA 1V02E 4MZ8A 3N73A 1DJGA 2V38A 2JE8A 4XUGA 5G4WA 4X2PA 1ZPTA 3IV8A 1V4YA 2VHLA 3T0TA 4DB7A 2AQWA 5A95A 4CU7A 3SI9A 1T99A 3N25A 4UTLA 3EPOA 4DWSD 1JD9A 1ODUA 4NI8A 1NEYA 1PAMA 4OTKA 2AGKA 3VABA 4UFLA 3YPIA 4GVHA 3T55A 4B5VA 2REQB 3LUTA 4HU3A 3PZOA 7A3HA 1PWLA 3FKRA 3TR9A 1QPOA 1TJ0A 3MV01 4H41A 2DT1A 3W00A 4AF0A 1C29A 4H6RA 3CHVA 1E1CB 3CGTA 1C7TA 2Z29A 4PB4A 2J78A 9RUBA 5BXPA 4LY8A 4L65A 3UT0A 2FVMA 4HVXA 5AB3A 1GVQA 2ZIDA 3PAJA 4ZQPA 4BF5A 1A80A 3FSUA 5IOBA 1KFJA 2RJGA 3IAQA 3QHMA 4J7RA 3EWBX 4M6UA 2EGZA 1K9FA 5FJTA 3PNUA 2ISWA 1Y8BA 2NQZA 1SZEA 4JL2A 3DYOA 3R43A 1AK5A 3PY2A 1VYSX 1PTDA 2C79A 4NI3A 3AMLA 3NGFA 3VGBA 3EWXA 1DIKA 5JBEA 4NKCA 4FF5A 4LAUA 3KLLA 1OX6A 1Z32X 5I3JA 3CT2A 3HGRA 4RV8A 1CXKA 1M53A 2OQLA 3POCA 1QHZA 2LLEA 4I3GA 4XZMX 5A2AA 3NVTA 4PMVA 2GJPA 3MKKA 1OYCA 1O1ZA 4IIDA 3SFWA 1OIFA 4GVIA 3WK2A 5TAOA 3CEUA 3V1HA 3VYLA 2WVUA 5XIAA 1W1VA 3WYZA 5EKYA 3WLPA 3HPZA 3OIXA 5EGRA 3FHAA 2DIJA 1KBBA 3GVWA 3WF4A 2GZXA 4WY0B 4JHZA 1UWSA 5BRQA 3WBXA 1WUEA 1PTGA 1ONWA 1KKOA 5F2LA 4NRSA 3A4XA 4P7QA 4Q8TA 3STFA 4JTJA 1XD0A 1TX2A 2DZUA 1AQMA 1HJXA 4PSPA 2Z2BA 2V30A 1OYBA 1XL9A 1JZ6A 1J9YA 4EPBC 5H2ZA 2XN0A 2ZWZA 2OQHA 3WD0A 2E28A 3RM8A 3E74A 1SFSA 3A64A 3MT1A 5BWFA 4YYFA 3FLUA 1V3KA 5FJUA 3GZ3A 1WDWA 1UWQA 3FJLA 4J3ZA 5I09A 3SQSA 5A8MA 4EF9A 5D04C 1Y0EA 2P8BA 4PMRA 1FUYA 3FXGA 1MXDA 3CZKA 4JTHA 3W7MA 2DZPA 2J24A 2Y7DA 1ZBCA 3ABZA 4V33A 4CCDA 4H00A 1PYFA 3QXBA 5A8PA 3VXGA 4NJGA 3WJSA 8XIMA 2QR6A 3WLOA 3EDFA 1Q6EA 1GW1A 5DELA 1LL6A 4ZE5A 3MP4A 1TREA 2MNRA 3PZUA 2FGBA 2VGBA 1K1DA 2XPKA 1JGIA 4S3EA 5DT7A 2D20A 4UCFA 4HD5A 2PLMA 5D8ZA 3OVRA 3G1FA 4BJHA 4O16A 1P0DA 2JF7A 3A13A 5I03A 2D1ZA 1GQKA 3W0KA 3AS2A 4FA3A 5CBIA 3GWQA 1WDPA 1Q7MA 3T0DA 5AHIA 1SJBA 4AC1X 4TU1A 5AOUA 3BAWA 4US6A 2DUZA 2F7FA 3ORWA 2NUYA 3QYQA 3W1NA 5MKGB 2VZOA 4XSLA 4S2BA 3FXYA 3L0NA 3BUVA 1EJTC 3INPA 2POTA 3EEZA 3MPGA 4IQEA 3SUUA 2E40A 3ZMRA 5EB8A 5BCAA 1VEOA 3M0JA 2Q02A 4FIQA 4PMOA 3G1DA 1GNXA 1W5OA 4E2VA 2WMFA 3LB0A 1HGWA 4AVNA 1OCBA 2TODA 4J27A 2Y5JA 2WHLA 4NY2A 3CIVA 2BASA 1BAGA 4ATDA 5ENLA 2HZGA 3VKAA 3N11A 3ARXA 5B7ZA 3AU6A 3OOQA 2I5GA 4LYRA 3G8RA 4O4VA 1OGBA 4LUSB 5BOOA 1IGSA 2O7QA 3IAPA 3CNYA 2PZNA 3B05A 4UTFA 3FKKA 4DJFC 4J28A 2X40A 5ABTA 2WV8A 4PBEA 1SJCA 4P8WA 3QGAC 4FIRA 3BMVA 4H9VA 3TN6A 2GK1B 4GGBA 1AMYA 3N2OA 4E2DA 1V3IA 5AVHA 4A35A 4KWOA 1UBSA 5CAKA 4MUZA 1W54A 1ZJAA 1W31A 3UFYA 3VNYA 2PTZA 1EXPA 2YOCA 5HBFA 1XH0A 4UWMA 3ARSA 1RP9A 1W9UA 1OC7A 4JY8A 1XYFA 2WSRA 1V0LA 4L1GA 3S1UA 3A23A 4Z42C 2Z6IA 1TPH1 2DSWA 5FAGA 5I6SA 3KS6A 4H2CA 2C6QA 4IPIA 3KX6A 3DI1A 1GUVA 3B9EA 4HNLA 1G67A 4L1WA 3PK7A 2WZMA 5DCBA 1B2YA 5TQLA 3E0WA 3LI1A 4I9AA 2EJ1A 3APTA 5ABFB 2FH8A 4HA3A 4O52A 3M16A 1OD0A 3MMDA 3S1VA 5D02A 3IGUA 4DJDD 3ZJ6A 5EMJA 2VZSA 4OUEA 4EXBA 4AISA 1P6CA 3VNLA 3TOPA 4YCPA 4GINA 3RX2A 2X7VA 1R85A 1A5KC 2DIKA 4YN5A 2XIIA 2B0MA 1WQ5A 5D9PA 1SMDA 1KQZA 1RR2A 4QAIA 1D7FA 3KOFA 2I17A 2CPUA 3H53A 3TAOA 2YBVA 3M0MA 4LVGA 4C6JA 2BY1A 5FF0A 4GC3A 3MUY1 1ZS2A 4Q8UA 3U6WA 1F3WA 4AYSA 1K3UA 5MF5A 2Z1XA 2ZUNA 5F2MA 3CB8A 3VE7A 3TZFA 2H6RA 3V0SA 3G5EA 3AZSA 4INFA 3TSMA 9CGTA 4PMYA 2EQDA 3T05A 1R3RA 3SCSA 3BVJA 3Q37A 1DWGM 2HPMA 1KM3A 1J93A 3ZWSA 3G24A 3LYEA 2ZUSA 1LL7A 2WSPA 1TX0A 2YA0A 1YXDA 3UY7A 3DFYA 3VZXA 7CGTA 4X2RA 2ZRZA 2V9DA 1KA9F 1A0DA 5HATA 5DXXA 4D6DA 5LGZA 5LNWA 1VYRA 2FMOA 4P2VA 3I7QA 3CZLA 4QRNA 4LRSA 1U5JA 3QR0A 2I9UA 4DXXA 1GVSA 3LNMA 3UR8A 5JIWA 3OEXA 3FY1A 1OQFA 1U5HA 1I45A 4ES4A 1VGAA 1EO7A 2GGHA 3UETA 2Z28A 2WYSA 3SY1A 4MKVA 5ABHA 4PBGA 1EEPA 1UR4A 1I6NA 4HZMA 5K2ZA 4PGLA 4DYJA 5E0CA 2ZZ3A 4JIQA 2ADAA 3QH2A 4A2SA 4J2PA 1G69A 1DPMA 2PTYA 2OWXA 1V6WA 2QPUA 1VBGA 4JIIX 2DZAA 2IMRA 3WQDA 5BXRA 3LZ3A 3ABQA 3W26A 1F8IA 2OGJA 1QOXA 3I10A 2PFHA 4HHMA 4IXHA 5A1AA 2POZA 1NDZA 3PANA 1BKSA 5E70A 3NZPA 3UJFA 4WR3A 1LBMA 3A4AA 3RILA 4YYCA 3VIGA 3DX5A 2PDJA 1E70M 4CCEA 3UD6A 2ZRUA 3G1SA 2J74A 4YTQA 2ZZ6A 5GNYA 3O63A 3NSXA 4IMGA 4GQGA 3HA1A 4H9UA 5B7YA 3C86A 5DF0A 2PD9A 2PI6A 3TN3A 1YNPA 1LT7A 1YDYA 3W7IA 4K3ZA 3L4YA 1KCXA 2PGEA 3M47A 4IUOA 4B5SA 2YYTA 1MUMA 5GNZA 2EKCA 1TKKA 1FTXA 4UZSA 1QBBA 5CC6A 3DUGA 2Y7EA 1B54A 2OZ3A 3TKFA 4BI5A 2AAAA 4QS6A 1F3TA 3GDBA 2PDIA 4GUIA 4DZHA 1ZTVA 2V3EA 3W86A 3KBSA 1G01A 5AC7A 1JJKA 3WNKA 3ITCA 4BK9A 1C8QA 2DZSA 1RAKA 3PUOA 2VZUA 3MUAA 3QC0A 3CHCA 3H22A 3WBAA 3CB3A 4C65A 4OE7A 3TLLA 1FWEC 4ZBCA 2BOEX 2E68A 2V67A 3C2FA 4IGSA 3MP5A 4QJ4B 4S3AA 3NQ8A 3AZTA 3M1ZA 3RF9A 4J3SA 3UZ5A 2VL4A 2VUNA 1SFLA 1YDOA 4Z2JA 4BS0A 1AODA 1XIFA 4HZ7A 3GNPA 1WDDA 2Y62A 3NPWA 1K4GA 3QFEA 4IP7A 1TV3A 3ARVA 2ZUUA 4KPLA 4A3YA 4H4IA 1C9WA 3EX4A 1FWHC 2DZBA 4TMBA 4K7VA 2HVOA 4ZOBA 1E51A 1EGVA 3NURA 2WHKA 3UJ2A 2F84A 2FHFA 3P81A 4NX5A 3E12A 2YSWA 4XAPA 1R3SA 3SRHA 2PA6A 5FACA 2UV8G 4HMEA 1HQTA 1QW7A 1L6YA 3DN5A 2ONEA 1BG9A 3D6NA 3TYZA 3QKZA 4XD4A 1Q4WA 1J79A 3L4UA 3KVLA 1MO0A 2V5CA 3WD4A 4C1LA 1R0MA 4X0VA 4E8CA 3IRSA 4GIRA 4EPKA 3WNNA 4UR7A 2YA2A 3QZ6A 3GKAA 3TTSA 1O95A 3ZT5A 1MW0A 1UUMA 5FD0A 2PDMA 2VWSA 5I23A 4F0RA 3PNZA 4B16A 1XIIA 1Q6CA 1XBZA 2J9YA 4U33A 3ZSSA 2HBVA 4GNVA 5HR7A 2OSWA 3CASA 1SQ7A 4NSBA 1CB2A 4UC5A 1JPHA 5CSRA 2INZA 3G3DA 2NVDA 3NQ6A 3NA8A 4LUJA 1Q45A 3WDRA 4IMAA 5DMMA 1GVFA 1PZ1A 1YYAA 1E0UA 3VIOA 2OYLA 1UOZA 5E0KA 5CJMA 3Q58A 3GHSA 4Q7IA 3ARPA 1X97A 4RXFA 3F4NA 1YEYA 1W9XA 3UWUA 1TELA 5CZSA 3MMTA 3W2UA 1R46A 3A22A 2BY0A 4AY7A 2CXGA 3EX1A 4ZTXA 4FNSA 1OX5A 3ABXA 3EKZA 4NP7A 3S9YA 2VP8A 5BNKA 2BVTA 4RZ4A 2Y24A 4WVXA 1F76A 1NWSA 4N0RA 3L5AA 3QBUA 3QW4B 2HWGA 3CU2A 3QJAA 3AAMA 3EGJA 2GQ8A 2XN1A 3ANYA 3AMDA 3GVGA 1W1ZA 1EJUC 3QTPA 2YL8A 3QPZA 4GGHA 3ONBA 5J8LA 3WBYA 4UBPC 3O1NA 3ABSA 4YIWA 5IRPA 5IDZA 3RAOA 3PTMA 3LNPA 4K8EA 1BTCA 4ACYA 4JX5A 3NXLA 4F9JA 3C2YA 1L6GA 2ZA2A 4HKPA 1EWDA 2HMCA 3M7WA 1NQKA 3AUOA 3NG3A 1U83A 4IGMA 3L23A 3W73A 3C0SA 3ZS4A 1FWAC 4Y6GA 1RQBA 5BZAA 3SO7A 4M29A 4NXKA 1FXPA 3APGA 4XO7A 1Q65A 1K7EA 1TTIA 4C1NA 1S1PA 2CW6A 4MY1A 2FZDA 1L2QA 4CD6A 1CGWA 9XIAA 4W87A 1RJQA 5DBUA 3TXVA 4H7VA 1XSIA 2DSVA 4Y96A 3KCJA 2QAFA 3RNDA 2YCIX 4WY0F 1E72M 4BI7A 4B91A 2XVKA 1BVWA 2YLAA 5HDRA 3EYPA 4MB1A 4CNUA 1FKXA 3L2MA 3N9RA 3R0KA 4FLSA 3IRDA 1QO2A 4J5NA 3MSRA 2YZ5A 1J5SA 3MY9A 2XINA 4UTTA 1EQPA 3UJSA 2J7HA 4OECA 1QW9A 3QR3A 2VCAA 4OV9A 4H9MA 4E8DA 3L12A 3LOTA 2DV0A 4PTWA 4N02A 5FIPA 1RK6A 1TPWA 1YXYA 3AWOA 3AIRA 1SU5A 3AI0A 2X1TA 2P0IA 3QV6A 1CZ1A 4QP0A 1UWUA 1NWRA 3FNDA 1C9DA 4NNBA 3WQPA 2OZTA 1DJIA 3GXPA 2OTDA 1GVOA 3WQEA 3DZ1A 1TWDA 2FTYA 1OY0A 2P53A 2CIPA 2CLHA 4NZJA 3HTWA 2I9EA 5HNTA 1ZSXA 4F9DA 5EY5A 3ZT7A 4MJZA 4EACA 1J6PA 4IMDA 2QCGA 2XH7A 1W56A 4QJ3B 1K4HA 1H41A 3NQVA 1ZY9A 1J0HA 1VFTA 4A21A 4Q4RA 2OFJA 3MJMA 3CUGA 2E8YA 1T8QA 3W02A 4GQ0A 1I1WA 3IUDA 4JGDA 1XFCA 1JPKA 2Q8XA 2WVSA 2YA1A 4JFWA 5AYYA 4I9MA 3P3BA 2A7PA 1IEWA 1MQRA 1DJXA 3W9ZA 2YFOA 3GUGA 4FXRA 2XWEA 3AIQA 5JH1A 7REQA 3UR2A 3G0UA 2GJNA 3OPSA 2OXNA 4S3CA 4MPQA 2ZE0A 4XIAA 2X0HA 3KBJA 4RZ5A 3QM3A 4GWEA 3IVUA 4JKMA 3GBEA 5C54A 4LEQA 1VRXA 3UJRA 2FH6A 1M3UA 3GTFA 3GVRA 4ORIA 1G4PA 2A0NA 4NG3A 1X1OA 4KCWA 2QAPA 1W3TA 2GDVA 3P8IA 4LX4A 3BK0A 4I6KA 3NOEA 1DEDA 3UCQA 3S2JA 3KHDA 5D32A 2V3FA 2DW6A 4LVDA 2PC8A 4HT3A 1AMKA 1GW9A 4G6CA 3MBDA 2QCHA 2FJKA 2CLKA 3WQWA 1V08A 3PTQA 4UNLA 1ZAJA 1OFEA 3UJEA 3W6LA 3BO9A 3UESA 4PB3A 2I1OA 3W7CA 3K8KA 5EYWA 2A6LA 4PA8A 2ZRVA 3QQ1A 3QMSA 2BHZA 3PM6A 5C55A 3BLKA 2QS8A 1R2SA 4HBKA 1KLYA 2YCJA 1UP3A 4LALA 1EC8A 5EMUA 1DHKA 1E1FA 4M0XA 1JD7A 2AL1A 3NJ3A 1RCOB 1KQYA 3O3RA 1UKPA 5I3GA 5EFDA 2G0WA 4D6FA 3BJSA 3LHWA 5ABGA 2YCEA 1XP3A 3ID7A 3TXZA 3DGRA 4U3CA 3PN8A 1D7KA 4MMWA 1GOWA 3UCCA 2J7EA 4O17A 1A5UA 1NP0A 3APYA 1IYXA 1R3QA 1SPQA 4L4MA 4YNGA 4MAVA 2BOFX 2GVLA 5AHLA 4KFOA 1F8MA 1ICSA 3B40A 3TJIA 2V2DA 1J6OA 1XLIA 4WDTA 3MMWA 2PGRA 4Q7BA 2RGMA 4XTDA 5HJLA 3BGGA 1HKMA 4CNPA 1WDQA 4CU6A 3WN6A 4XQ6A 4R5EA 3R0DA 3MCOA 4PMNA 1LCOA 3C2VA 3BL3A 3MSGA 4OT7A 4XVEA 4JTRA 3ECQA 3EB3A 4FNPA 1UZDA 3EDKA 1OFPA 1NM9A 1GG0A 1G4EA 1EJRC 1LOSA 3HMJG 5DEZA 1OK6A 1AJ0A 4NZ1A 1PIFA 1DQWA 3WF3A 2E67A 3GG1A 4DO7A 4RZBA 2DH3A 2VC7A 1Q8AA 3LGDA 2VM8A 3URAA 3CHFA 1VF8A 4WGHA 2PB1A 2GOKA 2OJPA 5M03A 4R7JA 2ZUWA 3O6DA 1QU4A 1RCQA 3TOYA 2QGHA 2VFIA 4Q8QA 1DL3A 4GJIA 4KERA 1VP5A 5D2WA 4L61A 2C3ZA 4V1YA 3T78A 3EPMA 3W53A 3EA1A 1M03A 2Y89A 1OCJA 3WD2A 3KXQA 4PUMA 4RUBA 3B8IA 4H9TA 2G3IA 4B5XA 2Y8VA 1BRLB 5LYRA 5CPLA 3SUVA 1EX1A 3G0XA 4Q4QA 4FNUA 4JFSA 3KOYA 3U7VA 4KF1A 3IK2A 3F2CA 5HMDA 1ALDA 3EX3A 4HJWA 2EKGA 4ZO6A 1O5XA 4US5A 5GNXA 3UZJA 3RCNA 4AZCA 1CX9A 5AC8A 5DX7A 3KCOA 2WJFA 2WNWA 3LV5A 3KVJA 1W37A 1VAHA 4HK7A 2ZRWA 4REQB 2X42A 3EOLA 1UUQA 2GJXA 5HJYA 2G5WA 1T5AA 4NAFA 3CV2A 3WD3A 2GJRA 3QGVA 1S2UA 1VFLA 2UZ9A 1UB3A 4GIEA 4LYQA 3CL7A 2YW3A 1R30A 2WSKA 1XXXA 3BOLA 3UBPC 5C8BB 2YL5A 1TCDA 5ECVA 3VI2A 1HJVA 4FLOA 1HVQA 1W32A 3WZ0E 3GC5A 4UMCA 2B7OA 1E4LA 1QNPA 3CC1A 3FS2A 1UKTA 2J7FA 3GAKA 4RW5A 1H2JA 2V5LA 3PTDA 3COTA 4CNOA 5IM51 1C93A 3PP7A 2DVXA 1ITCA 1ISVA 1OGSA 1S1RA 1DE6A 4Q6XA 3VMPA 2ABAA 1JZ5A 3SCPA 3KEHA 4WOQA 4P7LA 2X1UA 3Q65A 3IJIA 5FJJA 3GG8A 1KGWA 1BD0A 3IANA 4JDYA 1SFJA 2XM2A 4HA4A 3SGZA 2WWDA 1MMFA 3PZ9A 2Z27A 4XBJA 1GOXA 2WQPA 3LQLA 3NIYA 3HJZA 4N9EA 2PDWA 1YMYA 3BV4A 3WBEA 4EPEC 4GUJA 2XFYA 1GQNA 4CEXC 3N34A 1LG1A 2C7FA 4ZENA 4PRWA 2YZRA 4WSKA 5CSYA 3TU9A 1YTDA 3DFOA 1C7SA 4A05A 1XGEA 3FA5A 3BSHA 5EU9A 2OO6A 1LWIA 1XIHA 2O9TA 4Q8WA 2OB3A 3H8AA 3VX1A 3NZRA 4J1OA 4WLCA 4PTXA 3UEQA 3HOJA 1ECEA 5EBAA 4ADSA 1EHNA 1HUVA 4BWLC 1S2AA 1ZB5A 5C9UA 1TV2A 2ZRXA 3HPSA 4IIBA 2WC3A 4GXMA 1XBYA 1WA3A 1CXLA 3SUTA 1TJRA 3L2IA 3NYDA 1DWAM 1QVBA 5A6AA 3SN1A 1RZMA 3OLEA 1EOMA 3SR7A 3A47A 4AZBA 4YHEA 4JN6A 3FW6A 3OZYA 2WK2A 1CXHA 3UG3A 1RQHA 2XZ9A 1S38A 4PCFA 1JYXA 4RX0A 3W1TA 2YDQA 1C3FA 2VEGA 3NM3A 2NUXA 5CGTA 3SURA 3VNMA 4HIBA 4GX9A 1HN1A 3S2LA 1A0EA 1JYWA 3HQNA 5AHMA 2E8ZA 5K9XA 3W1PA 2ZTJA 3H2OA 1X96A 2HPIA 3WDIA 4FNTA 2XIQA 4Q7NA 3SSZA 4WJEA 3OO2A 3SBFA 4G9PA 4N2YA 4YLWA 1WZMA 3RJYA 2IS7A 4Y9MA 5A6KA 2J7CA 3DYMA 4WQ6A 3VMOA 2DUAA 5CJNA 2R14A 4Y8FA 2HISA 1Q8JA 4RE0A 1GHRA 3WY1A 2DZWA 1KV5A 1GK8A 3WEZA 1WE5A 3EDJA 3TROA 3JU2A 1THFD 3B9OA 3K8MA 5K9CA 1KD0A 1XLAA 4DPPA 1HO1A 2Y5EA 3FA4A 3PBGA 4GVGA 3QLLA 3T09A 2ZZ5A 1ICQA 3NQ7A 3GY1A 3PZTA 3OP2A 3UYCA 2XSXA 2W66A 5DXYA 1U1JA 3BG5A 2NXIA 5CZJA 4N42A 2FB3A 2CLMA 3DI0A 3B8VA 4AEFA 4AWTA 4E38A 3VC6A 4R9XA 3CH0A 1V5XA 4LBRA 4QITA 3IIZA 1JRCA 1C92A 1OX4B 1CLVA 4AFYA 1J12A 1EJSC 3AS1A 2G41A 3RGTA 3E1F1 3LG3A 4U2YA 1TO3A 1L8PA 3RLHA 4XK2A 1W3JA 1XF0A 2NX3A 3EX2A 3GX9A 4G7EA 3TMQA 5EFFA 3DCPA 1DORA 1FWTA 4MLJA 1SZFA 4HOXA 2J27A 1XJBA 2YBUA 3NEVA 2D0FA 3RDKA 2PEVA 3F4CA 1DXFA 2FIQA 1AJ2A 5DANA 3OVGA 1LROA 2ON3A 4JTGA 3PBVA 1F05A 3KTSA 1XIMA 2HXUA 2GOUA 3WQ5A 3O05A 4B5WA 1S5MA 2QIIA 1DIEA 1VB9A 4BHYA 3P61A 3SCTA 3PS7A 5IHSA 1EWEA 5LXEA 1GZ1A 3SAZA 3T4WA 2WLZA 1LLZA 5A69A 1Y5VA 3CWOX 2W5FA 2NLIA 2ALDA 3HG3A 3D47A 3H54A 4H7CA 1UD5A 4YHGA 3DDMA 3F5KA 4FXFA 1F6KA 3GXIA 3DFHA 3UWYA 4ONVA 1BXCA 4MKNA 3P80A 3PJTA 3VUSA 4M8UA 1WBHA 2PMQA 2WKLA 4IX0A 3S6OA 4Q8OA 2J6VA 3RMJA 2F2KA 3FJ6A 2ISDA 1KLZA 3MI3A 1LBLA 1K9EA 4DI8A 1NAL1 1OF8A 1YDVA 5D33A 3CAVA 3A4WA 3FJNA 4JTQA 1KM1A 2DY3A 3UA4A 2NT1A 1BWKA 3POHA 4O1FA 2CCRA 4G1KA 4XZNX 4B5UA 1PTAA 3V16A 1LOLA 3FK4A 2VCCA 1PBGA 1H50A 4IGHA 1JYNA 3LLXA 5IHRA 3HIJA 3W7PA 1TPVA 2ISVA 3BAKA 2IXVA 3OZMA 3KWSA 3S5OA 1PJ9A 3KS5A 4IGNA 1W5PA 3GXNA 1RPXA 4ZQCA 1EDQA 2ZX5A 3NTYA 1BXBA 1KFLA 5T8GA 3BAYA 1DTUA 3VDAA 3WQVA 1VEPA 4JQ1A 1E0VA 1CENA 3HGSA 4KMQA 1GTEA 3W24A 3LCWA 3GH5A 1XLGA 4I8YA 2GLKA 1M04A 1LRTA 4KGJA 2F38A 3RR4A 4MNLA 3EB4A 1X98A 4X22A 3WKZA 2PBOA 2P1FA 4B3KA 4NXSA 1W1PA 1DJHA 4DX3A 4R53A 1X39A 2VR2A 4IQJA 2XFFA 3NVDA 4U31A 1MFVA 1AH0A 3P84A 2WHMA 2J77A 3OQEA 2QV5A 1Z42A 2R94A 4UZUA 4FPSA 1TA3A 3ERPA 3KM8A 3QVQA 4Y2WA 4F2BA 3HZ3A 3ENLA 1RD6A 1E0WA 2DPEA 1FWRA 3DXIA 4EIVA 5FL0A 2GGGA 4DLFA 3TYCA 5K9DA 3CMFA 1JFHA 4ATWA 5HXMA 4KFNA 3L4TA 4WDUA 1JI2A 1M7OA 4G1NA 1AZ1A 3C2OA 3C3NA 2PP0A 4RR4A 1ONRA 1QOQA 3TNOA 2XGIA 3RYSA 1GQLA 1VS1A 3OA5A 5E0FA 1P7TA 1VRDA 5CGQA 4MUPA 4GFSA 1P43A 1WAUA 1FA2A 3KDOA 4HPXA 1D8WA 1G1YA 1OD8A 2DH2A 4YTSA 4P8UA 2OPJA 3KP1A 1ICPA 3DC0A 2JIWA 3H6OA 3AS3A 3S2MA 5I06A 3W71A 4MJMA 3WBWA 3WX7A 4PTNA 3M44A 1JRBA 3FDGA 1AH3A 5DBTA 5AYBA 4O1BA 3P5YA 3ARTA 3BLFA 1KTBA 3IGSA 1VZWA 3GIQA 1F2JA 2GUBA 5HQMA 1WXYA 1L6FA 3U5YA 2XTKA 4KRTA 2F6XA 2BGSA 1GHSA 4M6QA 2PDKA 3TSDA 3CO4A 3BTNA 1X1ZA 2HJPA 1A3HA 1RD5A 3ZJ8A 1YX1A 4UTJA 1M01A 2BV9A 3A3HA 3D3AA 3QSRA 1SFTA 3WQ8A 3NL2A 1SZNA 3N2BA 5JMUA 4AY8A 2W4XA 1V3JA 2V68A 4XZHA 3AYSA 3KOZA 3UA3A 1RVKA 3IIOA 4RPQA 1Q3NA 1XLEA 4DEFA 1WUFA 2C16A 3WJYA 1WKFA 2ZUTA 1CDGA 3K1DA 4M5PA 2E5DA 1EPXA 2XSAA 1GJUA 2DIEA 3ME3A 1DWFM 3QMTA 2Q8LA 1DJNA 2V69A 2Z25A 4M3PA 2CBUA 1XLLA 3NUKA 2OG9A 4PUWA 2X41A 5FJPA 4IWWA 3SCRA 4JCMA 4HYWA 4E2BA 3UNTA 4QEEA 4KIRA 2VVSA 4TUFA 2GJLA 3F5LA 3N12A 3LXCA 2VXNA 2C14A 1EP3A 3EDEA 3GTHA 5A94A 1AG1O 3A12A 3EB2A 4UQBA 1VJSA 5KZ6A 4UFJA 4MYXA 3KAOA 1VPQA 2GUUA 3T2PA 2R6OA 3ES8A 5D4YA 2AQOA 1QWGA 2D2HA 3AIEA 4FOUA 1R3YA 4OQVA 2G95A 3WL1A 3B0YA 1NWTA 4PCPA 4MWAA 1VBRA 1H0IA 4LBUA 1AQ0A 4ZZ9A 1AJZA 4HHPA 3NL3A 4DUOA 4ACZA 3AO0A 2ZKMX 4U5IA 1V7YA 5DFAA 3GBDA 1GYLA 3XISA 4GCAA 3N2TA 5I3IA 1UA3A 4ML4A 3EBVA 3LQGA 3EXRA 1IHIA 3SCWA 1KM4A 4IFKB 1TMHA 3SEPA 4HYRA 4UXDA 4FX7A 2ZQ0A 3K4WA 3E0IA 4GYFA 3MUZ1 4DM2A 3FEQA 4H6QA 2B7QA 2Q09A 3DC8A 1GQJA 3WQ4A 4F2UA 4CCZA 2BX7A 4FHAA 1R3TA 4AWEA 4G8TA 4P8VA 1CGVA 3LZ5A 1RK5A 3GNOA 3P82A 2ZX7A 3ITTA 2VR4A 1AD4A 8CGTA 3G1AA 2CKSA 3GAYA 4NJHA 3U2ZA 3B8DA 3VAVA 3WH9A 3NPVA 2FZBA 4PMZA 3BLIA 2R1NA 1JZ4A 3A24A 1DKWA 3VINA 1DXIA 4HNOA 2PCQA 1I75A 2GSHA 2PDNA 2ZZ2A 2BP1A 1XLMA 3OIHA 4AX6A 3PBMA 2OEKA 3HB9A 3MHGA 2IQTA 2E6AA 1BF6A 3H70A 3BQ5A 2OX1A 2TAAA 3CMJA 1FHVA 3VFCA 3VGFA 4LGXA 2QUVA 2CEQA 3HN3A 2YPIA 3G22A 1I2NA 5HJXA 2D24A 1F61A 3H2CA 1OWQA 4D6IA 3AXHA 5E93A 1QUMA 2G3FA 1XYAA 4IG2A 2YCLA 4GQBA 2ASHA 2RUSA 1TWSA 2ZXAA 1K6WA 1MZRA 5HWMA 3GKFA 1R3WA 1TPB1 3BOXA 4QROA 4HTYA 1BWVA 4W7UA 3GR4A 2RFGA 1TWWA 1GKRA 2J8TA 4RPPA 1M7JA 3WNLA 2PGFA 4GLEA 1BLIA 1XQKA 4X9SA 4IJRA 4Q8NA 3NPUA 2H9AB 1W2VA 3M5YA 4Q4KA 1U2YA 4IMFA 1A5SA 4DO6A 3UVIA 1ZBVA 2VC6A 1XRVA 2DUXA 1FOBA 3V18A 2CZFA 3C6CA 3PJXA 3IGHX 1N8FA 4NYYA 3R8GA 1HNYA 2VD9A 1CGYA 2I5QA 4RXGA 2XUCA 1BYDA 1W8GA 3FCPA 1PXGA 1Q6LA 1IEXA 2XISA 1V0MA 4ZOCA 4IPJA 1PB0A 3NNTA 2AGTA 2PPGA 1D2KA 3MWAA 1OSEA 2YJQA 5C2CA 3PAOA 3BH4A 3SSJA 4D2JA 2QJGA 3C52A 3VGHA 3W1QA 4IPNB 3M0KA 1R9ZA 3PTKA 2Y63A 4HA0A 4A3UA 3VTRA 1JIBA 1FHUA 3N2MA 2NSOA 1E73M 3H21A 5F1UA 4BQ3A 2R9RA 1BYCA 2KX9A 3AIBA 1KBIA 5AECA 1KM5A 2QCFA 3WLLA 1D3GA 3R25A 1MWOA 2PDPA 5D2XA 5CBJA 4O11A 2UY2A 1PDZA 1V6YA 1A5BA 2Z7GA 4O15A 3CUIA 3QSTA 3OGRA 4F0SA 1XYZA 4OGZA 4C6BA 3S83A 1SJDA 4AVOA 3FYPA 1H1ZA 3JZUA 4PCSA 4HNCA 3HJEA 3ZJKA 1HZYA 2CLOA 2WBKA 1PL9A 3T44A 2PD5A 1YW1A 3BC9A 5K3VA 4D6JA 3VKBA 4E3VA 2XYLA 2Z26A 3R2GA 2HTMA 3E5PA 1JF6A 5I3HA 3QPYA 1ME8A 8XIAA 1KB3A 5H6HA 3ZQ9A 3NDOA 4YPJA 4BR1A 2VFEA 1IT0A 3NQAA 5KMYA 1B3VA 3VCRA