4RW3A

Structural insights into substrate binding of brown spider venom class ii phospholipases d
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
279
structure length
279
Chain Sequence
GNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase D LiSicTox-alphaIA1bii
publication title Structural Insights into Substrate Binding of Brown Spider Venom Class II Phospholipases D.
pubmed rcsb
source organism Loxosceles intermedia
molecule tags Hydrolase
total genus 109
structure length 279
sequence length 279
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2014-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4rw3A00
4QJ5B 1VD6A 3QR1A 7PTDA 3V1HA 5T91A 1DJYA 3QVQA 4I9MA 4I8YA 3V18A 2PLCA 3EA1A 2OTDA 5T9CE 6PTDA 2O55A 2PZ0A 4R7OA 1YDYA 1V8EA 3PTDA 1PTGA 3OHMB 4I90A 1DJHA 1XX1A 3L12A 4Q6XA 4F2BA 3KS6A 4I9TA 1DJGA 3NO3A 4PTDA 3MZ2A 1AODA 1DJIA 1DJWA 4RW5A 2OOGA 4QJ3B 2ISDA 1T6MA 2FJUB 4F2TA 2PTDA 3QR0A 5PTDA 1QASA 1DJXA 2OR2A 4QJ4B 4RW3A 1PTDA 3CH0A 3EA3A 3RLHA 1GYMA 1T8QA 1O1ZA 2F9RA 3RLGA 4I9JA 1ZCCA 4RV3A 3EA2A 3KS5A 5T9BG 1QATA 4OECA 4S3GA 3H4XA 3I10A 3V16A 3H4WA 4GNKB 1DJZA 2P76A 2ZKMX 4F2UA
chains in the Genus database with same CATH superfamily
4IP4A 2VGIA 3TN4A 3TYCA 3QMTA 3CYVA 2JGYA 1S5MA 2J47A 5KITA 2CWNA 2UY5A 4M24A 3W7GA 2FZNA 5FJJA 4FALA 3R12A 2YBUA 1LQ2A 3H6OA 2ZX8A 3LN3A 3KZPA 1X6NA 4PMUA 1VHNA 4KEUA 4AEEA 5A6TC 2VR5A 4LS1A 4TXEA 1H4PA 2JE8A 3R0KA 4NNCA 4ZBCA 4F79A 4UTLA 1L6WA 3G1VA 4ZGYA 1OX6A 3I7SA 2J77A 4ML9A 5DFAA 4O17A 2EQDA 2V81A 1KR0A 3NZ1A 4JTKA 1QNPA 1UWTA 3S2JA 3N17A 1E1FA 4XZWA 4E3VA 5M1TA 1H1NA 3W7CA 1S2VA 4YTUA 3QBUA 3E5BA 1XGDA 1KBIA 4ATDA 3BZGA 1JIBA 3S9YA 5AC6A 3GNXA 2WMHA 3MVIA 2OLSA 2E1DA 4BR1A 1WDRA 2DSUA 3WBYA 2OZ3A 4RUBA 4GK8A 4YCOA 1P48A 3EDJA 3F2BA 3PNZA 4K2SA 4YVVA 5DRCA 3AXHA 3FXGA 2TMDA 3T2PA 3QOKA 3CC1A 5EMUA 3UQNA 2YCJA 2A3LA 3WLPA 2OG9A 1VR6A 4MFDA 4ZE5A 3RX4A 1TMHA 1EZWA 2G50A 1LBMA 4B16A 3PSVA 2OLAA 3ITXA 3N11A 3BVJA 1RK6A 3NYDA 4Q8VA 4JIEA 3IIPA 5EGRA 1FKXA 2F2HA 3M4HA 2YL8A 4AWTA 2Z1BA 4P5UA 3L2LA 1DP0A 1FP8A 1QPNA 4NZ5A 2I57A 3DU0A 1OEPA 2DQXA 3N4FA 4FA3A 1K1DA 3A22A 2WVVB 2VM8A 1VRXA 1OC6A 4MWAA 3PSWA 4H04A 1G4SA 2YZRA 3QOMA 3SCPA 4HU4A 1UWAA 1QK2A 4DZ5A 2R94A 3QHNA 5A8MA 3ITGA 3GH5A 4W8BA 5HR6A 1E4IA 4IMFA 4WGXA 3UBPC 2DUXA 5IOBA 4NI8A 1DJGA 2GVYA 3STGA 4JTLA 3KBMA 4Z2JA 4ZENA 3VNKA 2W4XA 3M5VA 2EPMX 4M19A 2I1OA 1WDDA 2FPYA 1JPDX 1TSIA 2A0NA 5HWMA 4HHLA 4XSLA 5DMNA 3DERA 3MI2A 4G1NA 2Q02A 3M47A 5LIXX 3TXVA 2WVSA 5ABEA 4KRUA 1TJ0A 2XFWA 2OMAA 2P50A 5CBIA 3VD9A 1PKYA 4O12A 3HBLA 2WCAA 4JIHA 4O1BA 3D47A 2D3LA 3TWAA 2X41A 3M44A 1DVJA 4NX5A 3WDJA 3P82A 1XM3A 3CL6A 1OJXA 5HANA 4X0VA 3H54A 2A1YA 1W0MA 3EDDA 3II1A 3OYZA 5LHEA 3OGVA 1KGUA 5DQPA 1VIWA 2G96A 1DE6A 1GG0A 1THFD 3Q37A 3BC9A 4KCVA 1A4LA 3TJ4A 1GVIA 2B7PA 1OWQA 3UXLA 3BSMA 1JPIA 1JCYA 3VIIA 1H7PA 3QW4B 1XI3A 4UBPC 5CGQA 3OBAA 3UU0A 2HPIA 5I3HA 4GACA 5TD4A 2Y61A 4O0KA 4UR9A 3PFMA 2HPMA 3ARXA 3BAXA 4LS2A 5JUVA 2HQAA 5REQB 4JQ4A 3CBWA 4LX4A 2XISA 3PZUA 1B4EA 3LK6A 4UQ9A 5T26A 2DIJA 3A5VA 3GG7A 1QPQA 4JFUA 1REQB 5EFFA 4IUOA 5HWJA 1JD7A 1ZBVA 4PMDA 2ZUVA 1LOSA 3GIQA 5FJIA 2OYLA 4NAFA 2HS8A 2C7FA 5AC5A 4DUXA 1CGVA 1P0KA 2Q71A 3BOLA 3CS2A 3W7QA 1HL8A 3U6WA 3UZXA 1GJWA 2YYUA 3AHTA 5D4YA 3C3UA 3QR1A 2CHNA 4PCTA 4XK2A 5FSDC 3M0IA 1XPYA 2VI0A 3VOJA 1QR7A 4WK9A 5D2TA 5CPTA 3NFUA 4FNSA 4NXSA 3LCWA 1XDLA 4DM1A 3P0XA 2NV1A 3MCMA 3NQ6A 1N8WA 2WSRA 3LPOA 8XIMA 4MWAE 1TUFA 1GEQA 3BCFA 3JRKA 1GT8A 4XZ9A 5FESA 3SBFA 1VAHA 4ES4A 1H62A 1V93A 3UEQA 1A0EA 4FXJA 3WK2A 4XO6A 4JN8A 1V3KA 3P6LA 3ZWSA 1JUBA 3VKKA 2PGRA 2NQHA 1FWTA 2AAAA 1XFBA 4O8AA 4PMQA 1JYVA 4XD4A 3GS6A 2VDIA 3PPFA 4DUVA 1RAKA 1K8YA 1YTEA 5AYBA 3LD5A 2XG9A 1QW8A 1Q6DA 3IARA 3QN3A 3KFTA 3SSZA 4D6CA 3EDKA 1FWGC 4AVFA 3KS5A 4O4VA 4AWUA 1CXHA 1RD6A 3MW7A 4KPLA 4XX6A 3REQA 3RRAA 2XIJA 1AMKA 4W7WA 3BG5A 5HMFA 2QEZA 1ZHAA 1RCOB 6TAAA 1WKFA 1KRAC 2CCRA 3LERA 4NZCA 3DFHA 4ZFMA 1XYBA 3WL1A 4L4MA 3V0UA 2G3JA 2RDTA 4UZSA 1OZMA 4KCUA 3TR9A 1F3TA 4TVDA 1BRLB 2AAMA 4IX0A 4OV9A 1HQTA 5BWFA 1E0VA 4H19A 3GFXA 3NQ2A 2UZ9A 3T6CA 1OFAA 1KC7A 4R7JA 3GHUA 4PB5A 4ML4A 5G4EA 4NX0A 4AZCB 4NZFA 3Q4DA 2ZX9A 4KFOA 4MZYA 4H41A 4JHOA 4N42A 1PTGA 1ZP3A 2V5KA 2ZVRA 3WF1A 4FXFA 3CHEA 2DW7A 5IFTA 1JXKA 3CUFA 4GZJA 4FO4A 4Y96A 3Q58A 3RJYA 3H2AA 4HNLA 5I3IA 3CZEA 1KFLA 3QY7A 4UQBA 2QF7A 4LH8A 1YE4A 1WX0A 1XRSA 3IAQA 1M53A 1IZJA 5HPOA 3ARRA 4DNHA 3N12A 1KW1A 2XIOA 3PP7A 1UH3A 4HTBA 1WZLA 4W86A 4LU0A 4L9ZA 4O1EA 2GQ8A 5J8LA 3BO9A 3C2FA 4K37A 2BSLA 4UFJA 4M6QA 2WNZA 4YIWA 4AIUA 3CM4A 4C7FA 3MVTA 4L9XA 1JFXA 5HOSA 1MXDA 4OECA 3PZTA 2CLHA 3RCNA 1LJYA 1C8VA 1C7TA 3VIPA 4M7TA 1BSLA 2G97A 1R87A 1LT7A 3CB3A 3WUFA 2PAJA 4JTFA 4IZGA 4IPNB 4KEZA 1W5QA 2AL2A 1RSCA 2I17A 2ZUNA 4E2VA 1K6WA 4INFA 5BRBA 3Q94A 4M56A 4GI9A 1SO3A 3QHMA 1QOQA 2RDWA 4UWMA 3EDFA 1IWAA 3WUEA 2E09A 4UTUA 2ABAA 2Y62A 1X38A 4E8CA 3RRXA 1F4AA 1J0ZA 1E6SM 1QCWA 3W85A 1LQAA 4ZTYA 3WMSA 3ZQ9A 1VEPA 4EF8A 1PB0A 1ZENA 2VVNA 3WJSA 4E2DA 2XINA 2CLEA 4A6GA 4TVCA 2HK1A 1L2QA 3N25A 4JX4A 1QPOA 1M5WA 3G1RA 4C91A 1VYSX 1WKDA 4HGXA 3W2KA 2ISDA 1SFJA 2FHCA 4PMRA 3LV5A 3MJMA 2QUVA 2X1UA 3LCIA 4IQLA 3MUAA 1HVXA 3TC7A 1S2TA 3UWUA 2YL9A 2Y8KA 2FZBA 4IIHA 3T4WA 2W6RA 3ZIZA 4QAWA 1PE1A 1FRBA 1NJJA 4FSAA 2GSEA 5MHBA 3WF3A 4S3FA 3WLMA 4BEUA 4V2XA 5A6MA 2J24A 1KBJA 4D72A 1KXHA 3IGXA 4J3TA 4QNWA 1TPVA 3WYZA 1R30A 5LGZA 1Q63A 1Q6QA 4HK7A 1K4GA 2BY1A 5A2BA 3H53A 3CV2A 2AL1A 1XIHA 3DKJA 3UD6A 1DIDA 1EEPA 5I5RA 4IMAA 4FIQA 1XIDA 3QH2A 2QDDA 2NZLA 4RKAA 1DTUA 3W1QA 5FF0A 2ZBTA 1NELA 1J2WA 4UMBA 2E6FA 4NJJA 1XYCA 1EB3A 3AIQA 4HT3A 2Q8LA 4QG8A 2EGZA 3L0KA 1I6NA 2IPWA 4UNLA 2J8GA 2DU2A 2HWGA 3T9PA 2NQ5A 3LTSA 1HO1A 5EYWA 4PL1A 3CUXA 1KGXA 1CTNA 1OGGA 4IOTA 5I00A 3SADA 1K7XA 4FAMA 1KA9F 3P8JA 6A3HA 1JI1A 3B9EA 3M16A 5A6KA 9XIMA 4JZ5A 3W2LA 2GVJA 1M7PA 4O15A 3I4EA 3S83A 1W2VA 3U2ZA 3WIJA 3MP3A 1S3TC 3VD5A 1KM0A 3T0TA 4JS3A 1F7BA 1QHOA 4RW3A 1EYWA 8XIAA 3RR1A 3TONA 1XCWA 5CZSA 1T8QA 2OB3A 3RM4A 2PDHA 5KTLA 3RN6A 3S5YA 4GZEA 3ZFHA 3IANA 1O5RA 5CPSA 2WVUA 1FXQA 4QM1A 4O53A 6REQB 1E5JA 4NZ4A 3QGAC 4LVFA 4MHBA 4IHCA 3ABOA 3AXKA 5CSSA 1IV8A 2W5FA 1OC5A 2VQTA 3W53A 1W3NA 3ALFA 1VCFA 3EPNA 1L6YA 1WUEA 2PP3A 3MUXA 2BG5A 3PJWA 4DZAA 4HSHA 3NA8A 3COTA 3S6OA 4WSJA 1H49A 4J2PA 4JTRA 1GPFA 1A0DA 4JDBA 1VJZA 3JZUA 3EB3A 1SQ7A 3OTRA 3R4IA 4E3TA 4NZ1A 1ADDA 2R1LA 3G1FA 1K8ZA 3R43A 5KZDA 3LQLA 1LT8A 3MP5A 1XINA 4Q6XA 3FHQA 2YJQA 4F0HA 3SCWA 3VUSA 2FGLA 3SFKA 1J18A 1F4HA 1FDJA 2CBVA 4KWWA 3PUDA 4UB9A 2PWUA 3T8LA 4CD7A 4YS1A 4UFLA 1UR0A 2F84A 3HO8A 1UIOA 4ATLA 4HN8A 2OKTA 3UERA 3IJIA 4PL2A 4C6EA 1P5BA 4MJMA 5ECUA 4U5KA 4WUIA 2Q3RA 3BCDA 1P6CA 1ZALA 2PRMA 1LM1A 4ERGA 4IGMA 3CO8A 1AZ2A 4JNYA 1QPRA 1QOXA 2WMFA 3MY9A 3W1NA 3VIMA 1IEXA 1GVSA 1TX2A 4L80A 5C9XA 1UA7A 5TQLA 1V08A 3BAKA 5T91A 4C65A 2WQPA 1TV8A 1UH2A 2EEXA 4IPJA 4LW7A 3E9AA 3CTLA 3G6MA 3LZ3A 3KCLA 2BB0A 3W1RA 2QCDB 4H7ZA 4V1XA 3QZAA 3R11A 3B97A 3DIPA 3GC4A 2VTFA 2JEQA 4L6OA 1XIGA 4BY3A 3JZEA 1KLZA 1U1JA 2FQIA 5A3HA 4LANA 5FL1A 2JKPA 3SDOA 3BJSA 5DN1A 3WQOA 3PFRA 2VC6A 1W56A 5CBJA 4HNNA 1KFKA 4B9YA 2ZXBA 3GE7A 4LC6A 4QJ3B 1IIHA 4JX5A 4OVXA 2PTDA 3OEXA 4ZQMA 3S1VA 3O0KA 3AXIA 4RPPA 3A3XA 3O0FA 1OFQA 1RY8A 4E38A 3E02A 1G4PA 4M8UA 3B9OA 3K30A 3N9SA 2XGBA 2JK2A 3WD1A 2PWVA 4DY1A 3CT7A 4IIDA 3P61A 3S9ZA 4PN2A 4Q4MA 4DX3A 3NZGA 2R1NA 4LWWA 2YSWA 4MKSA 1YDOA 5G2WA 3W6MA 3QGKC 2OYMA 1AMYA 3QPYA 2ZKMX 1DWAM 3QRHA 1F5ZA 3FLUA 1EZ2A 1K7FA 3W7JA 1HGYA 1JL8A 3WDHA 2R1MA 3M0MA 1L9WA 4BQ2A 3E74A 4KMQA 4K8EA 3HURA 1O1HA 2J6VA 4XBKA 1G94A 3WJXA 3PPGA 4EKJA 1SW0A 1RVGA 4N9CA 4NILA 2ATSA 3NZPA 3SGUA 3EWCA 1N55A 1KTBA 4DPQA 4JL1A 4JQ2A 2DIKA 1E0UA 5C55A 4Q32A 3SEPA 3TN5A 4GI6A 4L1GA 3E49A 3ZR5A 3L7RA 2L5HA 4S23A 3CLMA 1JPHA 2REQB 4L9YA 1E70M 2D69A 2D3NA 1P4CA 2OXNA 4WRHA 1YIXA 3SY5A 4W9TA 3WNPA 3UPWA 2Y85A 1ICPA 3BZJA 4W85A 5A95A 2ZZ1A 5PTDA 3M43A 1BG4A 3RPMA 4Q4KA 2PSNA 4CU8A 1RXOB 1EO7A 2CLKA 1R9XA 4KCWA 3LCGA 2E67A 1UKSA 1TTJA 4TU1A 1GW9A 3SECA 1XQKA 3U48A 4JN6A 4P8WA 1LOLA 4RV3A 4S3KA 2NV2A 2ZUWA 1EKOA 3R94A 2ZE0A 3C8NA 5FEPA 3EDEA 4UQDA 1OCJA 2BOGX 2C8NA 3CZLA 1E9ZB 2OZTA 1EPVA 8RUCA 3PZGA 2X7WA 4X22A 1SO6A 1P43A 2C1GA 1IQ8A 1EJ7L 1XPGA 1P7TB 4Z2HA 3BMVA 4REQA 3VOFA 4JY9A 2E5CA 1HZYA 4GABA 4KCTA 4YYFA 4YHGA 3ITYA 1PEZA 4NL1A 2BTMA 2O55A 3DYOA 3WLQA 3H2FA 4L4PA 3RPDA 3VIFA 3B0VC 2ZRWA 2QV4A 5EBAA 4IICA 4MNMA 3UWZA 4O1FA 3EB2A 5D2YA 3BQ6A 1G6CA 3KL3A 1GG1A 3TZNA 4FX7A 3SCRA 1UR4A 3QY6A 5I6SA 3EX1A 1GZJA 3ERPA 1A5BA 2P8CA 4G6CA 3I4KA 4AD1A 4HPXA 1PJ9A 4FLOA 3SURA 2JF7A 3DFQA 4JEJA 4PRWA 4I8DA 1VBGA 1NDZA 1PBGA 1XWYA 1Q6OA 3C0JA 4L4OA 3GLCA 2C6QA 3QR3A 2XN0A 3ISIX 1FWCC 3M0HA 3O15A 3B9NA 1PWMA 1EXPA 3GXDA 4FMVA 5B7ZA 4YCPA 2VCCA 4ZO9A 3R13A 1GONA 3THCA 3ABQA 5C9UA 1QO5A 2OSWA 4PZVA 2AMXA 1TPB1 4H9TA 2ZDSA 1WB0A 4PA8A 3QV8A 2J66A 4FB7A 1O6IA 1QMLA 2YCEA 3V0SA 3BG3A 1TQXA 2WYSA 2Z2BA 1W3IA 1YXDA 2QMJA 2V8ZA 3RPTA 3F4DA 3OZMA 5C8BB 1XCXA 4Q7NA 4I9AA 3V5CA 3OA5A 3C6CA 2V3DA 4GIYA 1Y7VA 1AQMA 1LUCA 4LCQA 4JBRA 4B5XA 3C2RA 3ENLA 3RJXA 5AN7A 1ZJHA 1JGMA 1E6QM 1VF8A 2JALA 4L6DA 5E6ZA 4MWAB 4UUIA 4C1LA 3SQMA 3W82A 1BF6A 5AY7A 3HPZA 1Z9AA 4EVZA 4MJZA 3QV9A 4IJCA 3NQMA 3USBA 4LCSA 1ZUAX 1W1B1 1WYIA 4MKVA 3VU2A 1AH0A 5AVNA 1W91A 4LRSA 3DFOA 3P2VA 4ZB5A 2X8RA 2R14A 4PSRA 3W25A 3AS0A 1AZ1A 3OYXA 2YA0A 1GVEA 4QE5A 4W7UA 3BWWA 4ZO7A 2HMCA 1NWSA 5K2ZA 3CV1A 3LDVA 5HNUA 4HU8A 4QDMA 3WH9A 5AC7A 2I16A 4W89A 2BDQA 2J75A 5AZ1A 1DBTA 1EX5A 2JQXA 2WSYA 5G1TA 5A6BD 2ZXAA 1W37A 4YHEA 3R10A 1XUUA 2I9UA 3HJEA 5C9RA 4UCFA 3AO0A 4O4WA 3GDBA 5EMLA 2QPSA 3IUDA 4JNMA 2EPKX 3AMLA 1FWIC 1TUXA 4H9UA 1M04A 2TSYA 2HRWA 5G2IA 4A2RA 1UBPC 1SMDA 3PAOA 2CZVA 4Z2LA 5FEWA 3ARUA 4UFKA 3SJ3A 1J0KA 1AK5A 3VX1A 1S2AA 2Y63A 4GYPC 1JAKA 2QIIA 3W87A 2H3DA 4EIVA 4J3SA 1OFEA 5FF2A 5BRQA 3LSBA 2OEMA 3K2GA 1VIZA 4CCCA 2X1RA 3KOFA 4GY1A 4LY8A 3M41A 4KWOA 2P5NA 3KDOA 4TX6A 4PH6A 2VXNA 4S2BA 4O10A 2GVLA 4XD6A 3S4TA 5L6UA 4AD5A 3LXBA 5A1AA 1OG6A 3OVPA 3QJAA 4HB7A 1FY6A 1A49A 1W8GA 1GQLA 3OHIA 4RR4A 3V3WA 3VNDA 4CVUA 2PU1A 2WSKA 1R3YA 4HU3A 4ZO6A 3N3TA 3I10A 1MW2A 4C6OA 1AA1B 4NAFB 5LA0A 3W7LA 3SIMA 4ORMA 1BHGA 1PKMA 3AMGA 3ARTA 3T55A 3EAUA 4X2RA 2QLYA 2F8QA 1BF2A 1V51A 3M0XA 3U8GA 1ZTVA 2ZX7A 3S0CA 3GR7A 2GJRA 1GVFA 2E5BA 3AHZA 3TTOA 2OJPA 3PZ9A 3Q67A 3GR4A 4RDYA 4B91A 2FPVA 1PIGA 2H6RA 3NGFA 4R7OA 1VYRA 3AYRA 4GMEA 1A5OC 3CU2A 2ZUUA 1UR2A 2OELA 3BLDA 3BICA 1FH8A 4HQVA 4KS0A 1B3OA 4OU1A 1TIMA 3URBA 3THUA 2EO7A 3QLLA 3L66A 3MA8A 4O1CA 3EWDA 4IGHA 2QV5A 1IT7A 3AFBA 4RXGA 3WG6A 3UP8A 6CGTA 1KCKA 2YA1A 3UR5A 2XWEA 1QTWA 3PZMA 1B9BA 3SUSA 4XVEA 1EHAA 4DF0A 3P74A 3O06A 4FF5A 4Y9AA 1UOZA 3NSMA 3W70A 5IHSA 4HPJA 3EOOA 5HQLA 1EXBA 2Y8VA 4B5TA 3MMUA 2OWCA 1UD3A 3P60A 3RAOA 4HMEA 1HTIA 4XV0A 5DBUA 4L1WA 1OYBA 4DVOA 4BI5A 4PUEA 1F73A 3O6DA 4CN1A 5EFDA 4GA8A 3REQB 3NQVA 2V38A 3W07A 1W3JA 4E0CA 3GFZA 3CZ8A 1HO4A 6XIAA 1O68A 3R2GA 4I8YA 3O05A 3UZJA 1UD2A 3IS4A 5CJNA 1TR9A 2C3ZA 1CGYA 5MKGA 3MMDA 5EA9A 1GWJA 1CENA 1J11A 5DMMA 5M3WA 4PUNA 3PZQA 4GYJA 4FNUA 1X7IA 2Y1HA 4I7VA 3W7NA 2DZPA 4X2PA 3UXAA 2XVKA 3TMQA 1MW1A 4GUGA 1A5NC 1BYDA 1IXPA 4D6HA 3P7YA 2E68A 1DQUA 4S3DA 1EQCA 2Q8XA 2V5LA 3WUBA 3DGBA 1XH2A 2A4AA 3HMJG 1SFTA 1G4TA 1A53A 3ITCA 3VNMA 1PVNA 2VX4A 1MEWA 4GWEA 3G1HA 4WXZA 3A21A 4KRZA 1J4EA 1HUVA 3EA3A 3E0VA 3N9KA 1YE6A 1WZMA 1OD0A 3SIZA 3WN6A 2UY4A 2VP8A 4AMCA 1RALA 2FJKA 2E28A 3ES8A 2J8FA 4WOZA 3WEZA 1Q45A 1CIUA 4OGZA 3TQPA 3B40A 3S1WA 1WPCA 3USZA 2E9BA 1JDDA 5JXQA 4GVHA 4JTHA 4GNKB 4PGLA 2ZRVA 1XBXA 4AYSA 1TWWA 3CH9A 3M07A 2Z24A 3MHFA 5TIMA 3SCSA 1IF2A 1B30A 3OLGA 2ZWYA 3PUGA 4C6FA 1FWNA 3UA3A 2C71A 1XGEA 2AL2B 3PBWA 1PHWA 3CQHA 4C7DA 1VFSA 1XBYA 2WMKA 1DHPA 4NF7A 1PPIA 3DYMA 1LROA 5TAOA 3OG3A 2NLYA 4IL2A 1M41A 3S2MA 4C6LA 1WCGA 3PWGA 1YPIA 2ZE3A 1XXXA 2C19A 2ALRA 3UZYA 5E70A 4WSHA 4WDXA 3VK5A 2DUZA 5I2UA 4AFYA 1UMLA 3S2NA 4JHZA 3GVVA 3G22A 5CSRA 3U0HA 2R1PA 1JR1A 4PMOA 4POCA 1R85A 4LYKA 1M7OA 1TA3A 4CGTA 4AHPA 4N9EA 3DECA 3GVQA 4ACYA 4ZFCA 4XO7A 2CLFA 3GU2A 4K39A 2RKXA 2ZZ5A 3DX5A 5AB3A 2IS7A 2OQYA 2VKZG 3RMEA 3WDPP 4AHQA 2PUZA 3NL2A 3NGJA 4C6CA 3BUVA 1XLAA 2WKLA 1I2PA 1ICSA 1GHSA 1IR2A 3IK4A 3RCYA 4ENLA 1BAGA 3BOXA 3S42A 3W1AA 1XD0A 4H3DA 3SGZA 1A5AA 2P10A 1RBOB 3I7RA 4OT7A 2C91A 2ZTKA 2RUSA 1VD6A 3MHGA 4DJFD 5EMYA 3STEA 3FV9A 1ONRA 4OBRA 4QNEA 4H4IA 2VEIA 3L4WA 1UD8A 2R6OA 3WLOA 1E40A 3WBEA 4PBEA 3GSMA 1NP2A 4GBUA 1WO2A 1OFPA 2GSHA 4GO9A 1UR9A 2XDFA 3A4JA 5F4SA 2W63A 2BXYA 5GNXA 1W6TA 3WQDA 5BOEA 3L67A 3B8SA 3ATYA 3QPEA 5DCBA 1V3HA 5A2CA 4JTDA 7ENLA 3FYPA 1UH4A 4AH7A 2WC7A 3GTXA 4WY0A 1OGBA 2FH6A 4MY9A 3UYIA 2WJZA 4FXRA 3UCQA 2XWDA 4BQ4A 4ZOBA 1W3TA 1AW5A 1KFEA 2E4TA 4LT9A 1EO5A 4WXYA 5MF5A 3UPBA 4WLCA 2BMBA 4JD4A 3HIJA 1ISYA 3VFLA 1D7FA 3W1LA 3WQ4A 1JZ3A 4W93A 4TOQA 3KTCA 3OBKA 1Q2SA 3T8QA 2BHYA 1EGZA 3NDYA 4DO4A 3GUGA 4D1JA 1I4NA 2GOUA 2XM2A 4JTTA 2QNEA 1HT6A 3GTFA 1CT5A 2Q09A 3TKFA 1JDFA 3HPXA 3T81A 5FAJA 5HK4A 1QNRA 4JEQA 4MMWA 1Q2RA 3LPPA 3PB0A 4EWND 4ORIA 1TTQA 2CZDA 4I7WA 2E1WA 4XVDA 3N29A 4IJRA 3T08A 4AX7A 1QWKA 1RVKA 4DN1A 2GWGA 3BANA 3HJZA 3EWXA 3QYSA 4YTTA 2PA6A 1RQBA 2VGFA 1W5NA 1YDYA 2J9YA 4A8RA 1QFEA 4FNRA 2PLKA 1SM9A 4JTQA 3WDIA 5D37A 5CH9A 2EKCA 1B3ZA 1R2RA 3TTYA 2C1HA 1SO4A 4RL3A 3L12A 1LLWA 2VFEA 3ITVA 1E56A 5IRPA 2GJPA 3WD2A 4DF2A 5HJYA 2NV9A 1UJPA 3W74A 3OBEA 3CAQA 2HVNA 1TV3A 3M5YA 2BVWA 1UWRA 3WD3A 1RPKA 1W3HA 2DT3A 4H83A 2KX9A 3LGEA 3EX2A 4JQ1A 1S1RA 3O6YX 4QAIA 3GTHA 3WLHA 4ADTA 1TWSA 3PR2A 2DT0A 4M82A 2ZZ7A 4Q4SA 1QI2A 2A3AA 4QR6A 5I09A 2G95A 1I9CB 1LBLA 4JKMA 4MLJA 3ANYA 3W2JA 4HOZA 4DWDA 4Q4RA 5EB8A 2Y2WA 4C1KA 1UZ1A 3LLDA 3A64A 3UNTA 1AUSL 2Y7GA 3GC5A 1SGJA 1HKMA 4QCEA 5F4WA 1MUWA 3VCCA 1WKYA 3ZZ1A 2NXHA 4GYPA 4B4HA 4DHGA 2GJLA 2JBMA 3ABSA 1S2CA 3GAYA 3QZ6A 2ZUTA 5DXXA 4WGHA 1RJPA 4RZ5A 4QFUA 1Q6CA 4R9XA 3T0BA 1TJ2A 1XJBA 1AH4A 5IM51 3O9NA 2R8WA 3H22A 1HGWA 7TAAA 4LVGA 3KX6A 3DI1A 2WQDA 4DJDC 4CQCA 8CGTA 1WAUA 4U5IA 3L21A 1EEXA 2E6AA 4C6IA 1GOOA 4IQDA 4D8AA 4H7VA 4O13A 4HSOA 2HE5A 1LG1A 4QE1A 4B9ZA 5FL0A 3UVIA 2PP0A 1DOSA 4ZQCA 3WJWA 1GVQA 3CV7A 3NPXA 3OVRA 1FVPA 1R2SA 1OCBA 4XZHA 2ISWA 4PB3A 4J3VA 3S2LA 2CZEA 2A3HA 4BS0A 2P3ZA 1POJA 4IIFA 4FZIA 2C0AA 3KAOA 3FSUA 1G1YA 3GB6A 5I24A 1TB3A 3ZM8A 5E9XA 3MMTA 5I77A 3F1QA 2CEQA 5A8PA 1CXKA 1DEDA 4LAOA 2WSQA 3WKZA 4QJ5B 1QO2A 4J3WA 4J4KA 1W32A 4RZ6A 4Y6GA 2XVNA 2WC3A 5D03A 4PUKA 4UQEA 5C0QA 1OFBA 3UJSA 2PDNA 1B3YA 3V5OA 5GJMA 3BGGA 4UTWC 2QVNA 3W38A 1UR1A 4AIEA 4GQQA 3PPHA 1XD1A 4PFMA 5CKSA 4H9MA 3CUIA 1QPKA 3UJ2A 3BAYA 4UR7A 1V77A 5I03A 5H1WA 2CW6A 5CQ1A 1ITXA 2ZC1A 5FEXA 3IJ9A 4OBTA 4OE7A 1H09A 3C56A 4HNVA 4JDYA 1PTAA 5HDRA 1HW6A 5EMKA 1CW2A 1K77A 3UJRA 1DWIM 2DSWA 3VIGA 1W1ZA 3KRUA 2Y88A 3HGOA 1ALDA 1RCQA 2R24A 4R34A 4XQ6A 1A0CA 2PWFA 1C9DA 1KTCA 5CSYA 5D33A 5AYYA 3IAPA 1Y8BA 1GQIA 3ARWA 2XH7A 1HJXA 5KINA 4XKMA 1YQ2A 4H6KA 3QC3A 1WUFA 4TMBA 1H3GA 2D20A 3G0XA 3W28A 1ZCCA 3LX9A 3GVWA 1GZGA 2O7SA 1B5TA 4HNCA 2YZ5A 1VRDA 3CL8A 4DI9A 4UNKA 3ICJA 3MUIA 3WFAA 3LZ5A 1RP8A 5C7HA 3KBWA 4DBEA 1P0DA 1WXJA 4EXBA 2X40A 4F3HA 1TYGA 2XIIA 2PWGA 5C5YA 1LLOA 1P1MA 2O9PA 2PDXA 5TNVA 3KHDA 3R89A 1X6LA 4DWSC 4XZMX 2VDHA 3KL0A 3WZ0E 2WZEA 3N6QA 1TWIA 4P8XA 4REQB 1W9UA 3NQEA 2Y5SA 3KOWA 5CC6A 2OX4A 5TF0A 1B2YA 3BLKA 2ACUA 3O07A 4IQEA 2OEKA 1LF1A 4AEFA 3MZNA 1MEHA 1OK4A 4PBGA 2QAPA 4P7OA 1CXLA 3OGRA 1EJRC 2X7VA 1XLIA 1KQZA 5HMEA 4JIRA 4DXKA 1B3WA 5D9OA 3CK5A 1H7XA 4R27A 1KBKA 4HIBA 2VUNA 4WJXA 4U3AA 4XSMA 1R3WA 5A8GA 1EJTC 2HS6A 2V5DA 2CPUA 1JZ2A 4LJ3A 4N4PA 1O1ZA 1XBZA 3MKKA 3ITLA 4QLJA 4B3KA 1JFHA 1EP1A 3TR2A 5FAGA 4FR1A 1A50A 3GY1A 5F1VA 1F3EA 2BZNA 3NUKA 3QFWA 3VZXA 5HNNA 1OSEA 2YX0A 2VHLA 1QNVA 4IP5A 4U3CA 3TSDA 3CIVA 4HOXA 4F2UA 4HHHA 1ZBWA 1JCTA 3KCJA 4TTUA 1BD0A 4DELA 3FYYA 1LL7A 1OX4A 1V5XA 3TQ0A 1CECA 4GVIA 4Z1AA 1QW7A 5AHIA 1E73M 3IGHX 1YPFA 4J3XA 3ARYA 3UXIA 1YNYA 2ZX6A 4AD3A 2OYKA 4NRSA 3RO6A 1YX1A 1PIFA 3ZT7A 1OABA 4U28A 3D3FA 4HPNA 3R8HA 1W5PA 1C8XA 1LUCB 1KM4A 7CGTA 4MTVA 3NYZA 3VE9A 6ENLA 4MAZA 3ANUA 4RDWA 2Y5JA 1R38A 5GJNA 3QW3A 2VD8A 1Y0EA 3OVGA 1E43A 3MUY1 3K5XA 1OHLA 1E6PA 3VMPA 2WKGA 3LENA 3MUZ1 3WBXA 1VP5A 1PCWA 4QISA 1AH3A 4GVFA 2NXIA 4UOQA 3CH0A 2X0SA 4AHOA 2AQWA 1OFDA 3LNMA 1UD5A 4YWSA 1XIFA 4G7FA 3GNRA 1MRQA 1BYBA 2ZC8A 2GFTA 1TTIA 5C54A 3GXNA 3MSGA 2FDMA 1BXNA 3BGJA 1QDSA 3YPIA 4B5NA 2YL6A 4EOUA 3HF3A 1JDAA 2O56A 3NDOA 4O28A 1XLHA 2VEKA 3UZWA 1WV2A 3RF9A 4Q33A 3LBOA 1HJQA 3KOXA 2BLEA 4CNNA 1JF6A 3FY1A 3QYQA 1HG3A 4LGXA 1DQWA 3F5JA 4FOJA 1K7EA 3ARVA 3N6JA 1G67A 4IFOA 1K9EA 4LEFA 3SW6A 3N13A 2QPXA 4K1GA 2CC0A 2NLIA 1CI1A 4MOZA 3IIOA 2PF8A 4I90A 4QE4A 4B4FA 3TIMA 4MF4A 4G2DA 1XP3A 3OODA 2Z2AA 1LL4A 2UY2A 3ABXA 4LAUA 4NJIA 2C0HA 4DBWA 2VCAA 4RNIA 1MWOA 2ZZ4A 4ERAA 4GKTA 3B0XA 4B3LA 2QIWA 3MSRA 4H8VA 1M1BA 1T6MA 1US2A 1SO5A 5CPLA 4I5UA 4XBSA 5LKYA 4ACZA 2DW6A 1SUXA 2V5JA 3LEPA 5EMMA 4OBSA 1UR3M 2HBVA 5EPDA 2PWHA 1NU5A 3WJYA 1ZJAA 3DHFA 3MV11 1V6TA 4LV4A 1FWRA 5DCDA 3AZSA 4LVBA 3NNTA 5DLCA 2QUUA 3H4XA 4GQRA 1EDTA 5E93A 1FHLA 3QMRA 2ABBA 2DFAA 3KL5A 1O95A 4ILSA 3W0KA 4MPKA 3LLXA 3EOEA 2TPSA 3W73A 3V18A 2NSXA 4TIMA 5JMUA 4ZA0A 1T7LA 4WQ6A 4Y8EA 4Z0JA 3VDAA 3M6YA 4HD5A 1MXGA 1KM1A 3PBGA 2A7NA 4ZQPA 1HL9A 2QUMA 2PPGA 4F9JA 3WENA 1TR1A 4X9YA 4IMDA 1UKPA 4RNFA 3W7DA 3LHTA 3VKAA 1I2NA 1T41A 1GOQA 5G1MA 5LA1A 4H9ZA 4W87A 1WXYA 2GK1A 4CVWA 4UTMA 3T05A 3KP0A 2GWNA 3GIPA 4LUSA 4JOMA 2ZFAA 3AOFA 4LB4A 4IQJA 5J5RA 3TYEA 1KM3A 2D23A 3CPRA 4ZCWA 4KEVA 1Q4NX 1XLFA 3Q45A 3VNIA 3IJDA 1R7OA 2DVUA 4DXVA 3ZS4A 3LRKA 1QJWA 4ZQNA 4LY4A 1NFGA 3HQ1A 1I1WA 3M9YA 3W81A 2YLLA 1NM9A 3VGEA 1KM6A 4DJED 1U2YA 1BTCA 1TV7A 4HSNA 3U7BA 3MP4A 3KLLA 4PUJA 4FOKA 2PDQA 3GBEA 2CBUA 4MZ1A 3HZ3A 3I3BA 4D9PA 3H24A 5C71A 1ZFJA 2YXXA 4AEOA 1ZAHA 2O4MA 4Y9MA 2ZUMA 1BG9A 1GOKA 1P6WA 4IP7A 4DJDA 3BXWA 4M6PA 2YFNA 3HN3A 1R5YA 4Z42C 5MKGB 1YPXA 3TU9A 4KW2A 3L2IA 1I0BA 2NQZA 1Z48A 2YB1A 4WOQA 3TC6A 3A4XA 4Q8QA 1B4KA 1DV7A 5EMJA 1VS1A 2VO5A 2XSXA 3IUIA 4PTDA 1KNWA 2A3EA 1OK6A 3PBYA 3TX9A 4AZ5A 1XKJA 3N19B 4QEHA 1ZCOA 3HGJA 3NG3A 1I45A 1TPH1 3WNLA 3WD0A 1B57A 3CZJA 3TOPA 1QK0A 4CNPA 1QOPA 3VUPA 5GPRA 4JICA 5I7GA 3DG7A 2DZUA 1XL9A 2XH2A 3R1ZA 3UXDA 5HJXA 3FAXA 4A8NA 3T0DA 2B7OA 1AL8A 2QJNA 1E4MM 4AZIA 3N73A 5HBFA 2IW0A 1UOKA 1B54A 3L9CA 3DBNA 1V7AA 4S1FA 4WDUA 2O92A 3VOHA 1YBQA 3V1PA 3ES7A 3WMLA 1SZNA 3ZVHA 3WQWA 4RDZA 4UTWA 1GUVA 5A8OA 5FACA 1ZBKA 3MV01 5H8MA 1P6BA 1XR2A 3FEMA 4AWEA 2ZX5A 4DM2A 1GGOA 3IRDA 3VC5A 4G7EA 1VFLA 4MGGA 1FDZA 2VC5A 3CQJA 2Z27A 3O3RA 4QX4A 5A8QA 1IT0A 3AZTA 3VVGA 1GVRA 4CQDA 3FKRA 1PIIA 1E1CA 1K9FA 3GVRA 7XIMA 1XX1A 1OINA 1H63A 2IQ0A 5I3GA 1W5MA 2E9MA 4M80A 2OT0A 1U5HA 3GG1A 3NQ8A 1WDSA 2VRQA 4K8GA 4O11A 4DNMA 3CTTA 1AQHA 2ISVA 2NXGA 2YDQA 3ZJKA 4J27A 3VNLA 5HA7A 1UD4A 1WNOA 3BURA 1JNEA 4PCFA 1TCDA 4DYJA 3CAVA 2EAWA 5D04C 1A47A 3MU7A 1V6XA 4P7NA 3FN9A 9XIAA 4HA4A 3FDGA 1VBJA 1T8XA 4AC1X 3G3DA 3LCHA 1MSSA 1C3FA 1FQ0A 1W5OA 3PTQA 5LSMA 4W4QA 3SUWA 6TIMA 4DWSA 3L65A 3ID7A 3J7HA 3IWPA 5I3DA 1XS2A 2G8ZA 3AJXA 5CC3A 4R9OA 3UF9A 2RH9A 4NAEA 3NR0A 5AVHA 5AHFA 1CLXA 1B0IA 1MQRA 2DY3A 3DEQA 1F6YA 4Z0SA 2NSOA 1OCQA 3KP1A 4EPDC 4QQ3A 3IRSA 1J9YA 2IQDA 2J9XA 3FOKA 3V7PA 1MDLA 1GHRA 2DH3A 4A29A 5DXYA 3GDRA 3NTYA 2C18A 3PN8A 4BF7A 3NXFA 4QGCA 1Q5MA 2WV8A 4M0XA 3WO8A 4TTGA 4TQTA 1SW3A 1B3VA 1LP6A 1V6UA 1LBFA 2PWEA 4HHMA 1XF0A 3EEZA 1EOMA 3T78A 1SSDA 3EYPA 4UR8A 1H60A 4P7LA 4WY0B 2QVHA 4OTKA 1ZB5A 3DH7A 2V68A 1GQNA 4KIRA 3ZT6A 5ECVA 3MMWA 3VNZA 3W2UA 3M0JA 1W1TA 3LG3A 5CPNA 5A6JA 5KZ6A 3VCRA 3W1XA 3DFNA 1KGWA 3H7VA 3OGSA 1PX3A 1TG7A 4RJEA 5LIKX 1QATA 4Z17A 4BI7A 2NUWA 5FF7A 3NOEA 2D2OA 3VKDA 4GC3A 2UWFA 3W84A 2WMGA 1VYPX 5H6HA 2ZZ3A 1NWUA 5ABGA 2BBFA 3WQCA 2GGIA 1EBHA 4DI8A 2GDVA 2D24A 4GCAA 4K6AA 4LV9A 4S3JA 4QTGA 2FTPA 2J25A 5LNRA 4JAWA 3THQA 4MG4A 4P61A 2J7FA 2ACQA 1UP3A 5D9MA 1UKOA 3EXRA 8A3HA 2DJLA 4PUDA 1PAMA 2BNJA 1M9HA 3GDKA 1E15A 3TSMA 5F4XA 2G0WA 4ZMGA 1SYTA 2WNWA 2IPFA 3G8RA 4N6EA 2HVOA 4CD4A 3JR2A 1PHQA 3VZZA 1PS9A 1X98A 1T5AA 1EOKA 3NQFA 1V4YA 3AS3A 3N14A 1XLKA 2PU0A 1FDYA 1QASA 4ZXLA 2BVDA 2YW3A 3IVUA 1CWYA 5KZMA 5AHNA 3QGVA 4AZ6A 2CU0A 2J88A 3LHVA 4K38A 1LWIA 2OOFA 3LUTA 3UR8A 4NKCA 4YPJA 1TTPA 2QMKA 4QITA 4BF9A 1YYAA 4DWSD 3VINA 2WK2A 3N2OA 1ZPTA 2MANA 3LYEA 4XD5A 3PZNA 5K9CA 3AROA 3VM5A 2WCGA 4LOCA 1LOQA 4R53A 1FWFC 4BJHA 3A4AA 2JIEA 2WZHA 5CPMA 4CNSA 3FGCA 3M5XA 2HE8A 2HISA 1CXEA 1QNOA 4MNKA 2XVPA 3P62A 3WFZA 3AIBA 5D02A 4J2MA 1UG6A 4TO8A 1RLDA 3KEHA 3WLKX 1PKNA 3WL0A 3QC0A 3WX7A 4PRTA 3VNYA 2GDUA 2E5DA 1E9IA 1XIJA 2BHUA 5D2WA 1UUOA 4UIOA 4A3YA 4EAYA 1V6VA 1NQ6A 3FS2A 3IJLA 1JJKA 2PP1A 3M46A 4I9JA 4QS5A 3GTNA 4JXCA 4U2YA 2PEVA 3S6TA 4S3EA 3L0GA 3S47A 1MUMA 4GO8A 1BEUA 3GKFA 4J5NA 5A5WA 2PB1A 5I3FA 1C9WA 3IIZA 4JTAA 2DT2A 4PMXA 3PK7A 3UYCA 1RUSA 3O16A 2PC8A 4MNJA 1U5JA 1AG1O 3MCOA 2O7QA 5BYWA 4L64A 3QQ1A 2PDFA 3E0FA 1IYXA 1MQPA 1YTDA 3TCEA 1KFJA 4UFIA 3MC5A 2ZWZA 1O60A 4LUIA 3PZOA 4C90A 1DQXA 5T9CE 3AZRA 3G0SA 1FTXA 1H7NA 1VLWA 3OO2A 4PE8A 2A21A 4X0NA 4NJGA 1UZ4A 3IIVA 2DSVA 2VNCA 2J78A 3DESA 3SRDA 1PZ2A 1HVQA 1GQJA 3QM3A 2HBXA 3VGBA 4LC8A 4GI8A 2VGBA 4C6DA 3ARQA 4Q8NA 3FJ4A 3E0IA 3VIKA 3OW1A 4KFPA 2WHKA 1ONXA 4B5UA 1IZKA 4PMJA 2BFGA 3O1NA 4Z1YA 4HYRA 5J5DA 1E4LA 2CNCA 3KBSA 4FPSA 5D2VA 2FYMA 2GGJA 3GC2A 3N2CA 1OT1A 4S3CA 1ZLPA 1Z89A 1LRNA 1TKKA 5AHLA 3G1AA 1VFOA 1R3RA 1NIUA 2MUCA 3CHDA 2PDMA 1I1XA 3VIJA 4OOUA 3RDKA 5CAHA 2FVMA 4MPQA 2Z1VA 3VYLA 2HXUA 3NVTA 4GGBA 4JL2A 1MNSA 3PM6A 4HZ7A 4K68A 1K8XA 1PL9A 4L4LA 1F2JA 5A8NA 4CN4A 1W9VA 3ZXWA 4QDPA 3GUWA 1CB2A 5DBTA 4F0LA 2YXGA 4E8DA 4Q22A 5BRPA 2CERA 1LLZA 5CEWA 1KWGA 3QQWA 3RUBL 2IKIA 3E2QA 5HUPA 2QCLA 3INPA 2ZOXA 5GNYA 3TXZA 4JTCA 5IDZA 4AC7C 1L6FA 2OGYA 3F2DA 3BMXA 5DY2A 5LXEA 5KZEA 2IKGA 1TE1A 2PDYA 5HUOA 2VGGA 1SZEA 3POHA 1DKWA 4XD3A 4X60A 5GJPA 4D6DA 5EU9A 3SCOA 4MYXA 4ZODA 1B9ZA 4UFHA 1FWAC 5JU6A 2WBKA 1TZ7A 1Y5VA 4NZ3A 2XTKA 1PDYA 3Q65A 1UKQA 3NZRA 3KTXA 1HJSA 1HXJA 2X0HA 4HMDA 3TOYA 1I8JA 2J13A 1AJZA 4FI4A 2J4GA 4N02A 3GNPA 4OIFA 5FA5A 1XLJA 1LZOA 4JGDA 3BW4A 1XLGA 5I3JA 5AC8A 4JCMA 2R1KA 5C70A 1Q65A 1LRQA 2CITA 3SY8A 2F61A 1BXCA 1YEYA 3M64A 1N7KA 4H9XA 1XW8A 1EP3A 2JFEX 1X8FA 1N82A 4A3HA 1OADA 4W5UA 1A5LC 1Z69A 3GG0A 1KXQA 3NQBA 4XB3A 3KXQA 2VEFA 2VYOA 3POCA 1OX4B 2IUZA 1JULA 2QJIA 1E0WA 3EKLA 2YL5A 4WDWA 1YDVA 1DJHA 5BMXA 1SVDA 2AMGA 1H1YA 1H61A 3VD7A 3G3MA 3B9AA 4PTMA 1AODA 4KF1A 4MYAA 1R0MA 2PBOA 4ZXOA 1YMYA 1LG2A 3EB4A 1S38A 3UFYA 3V35A 2GSJA 5BOOA 3HGSA 4Q8UA 2H8ZA 5DO8A 3VGDA 1E6XM 5FJTA 4ECLA 2J7GA 3NL3A 4H2HA 1O94A 2VCBA 2P0IA 4DLFA 2C14A 5DELA 4AQLA 3PF3A 4KKXA 1WZAA 1HJVA 4AYGA 1EA9C 3BTNA 3PB2A 3W27A 4XKYA 1ENUA 1VBUA 1DORA 3PUOA 4WZHA 4PTXA 1UPMB 1AQ0A 4MUZA 3ZSTA 3PANA 2D1ZA 3QKZA 1JRBA 2V3FA 2C79A 2ZRZA 3E6EA 3PJUA 4MB1A 2GQ9A 1N8FA 3F4VA 3AXXA 4BWLC 1PWLA 3MANA 2DSKA 1BVNP 4ADUA 2FHFA 3L23A 4GUFA 1I75A 3URNA 3F4CA 2KZHA 1VBHA 4AISA 3PJXA 3TCSA 3WNMA 4O50A 3H2CA 1E9YB 3RCMA 3WFLA 2DORA 4GXMA 3NQCA 2DZXA 2WWCA 1GJPA 3C52A 3MPGA 5I3KA 4IGNA 4ADSA 3DG3A 3TMLA 3LTPA 2D2HA 5AZ0A 5DMLA 2D2JA 3T0AA 2VZTA 2NW0A 1R86A 3SFWA 4V15A 1AD1A 2VL4A 1I2OA 3P93A 1D8WA 2INZA 3STCA 2QT3A 5D9NA 2FVLA 1K9TA 4AUBA 3W3OA 3UETA 3GQYA 4UZUA 3W7EA 3VZYA 4M1BA 1HN1A 4ACZB 1KB3A 3DFTA 5A6AA 1NQKA 1UROA 3VTRA 2NVDA 3LI0A 3Q2DA 4XUYA 3GW0A 3HPFA 5IBXC 4ZOEA 1W1PA 3WH6A 3L4ZA 2FFIA 3IVSA 2CYGA 3MI6A 4ZSUA 2FDSA 3W2NA 4FNPA 3PG8A 2FVKA 4DBUA 4ZSTA 1PYMA 1LYXA 2WSPA 2UV8G 3W1UA 3W4RA 1RQHA 1CX9A 3WLSA 3GD6A 3KBJA 4YWIA 4WJ8A 5CPOA 1L6GA 2BODX 4C6NA 4GINA 3LRLA 1T96A 2HSAA 3BK0A 1BKHA 3AICA 1LL6A 2OQHA 4WKFA 4W8LA 5CC5A 3JU2A 5FF4A 3B3DA 3BLIA 4XAZA 3M5ZA 1ZJIA 3B8DA 3RHGA 1NAL1 3IJ7A 2BXVA 3A6OA 1W2PA 3GZ3A 4GUIA 2EXOA 3R5EA 2EJAA 2GK1B 4MJ2A 1MMFA 4YJ5A 2FZ9A 5D9PA 4LUSB 2X16A 5HQMA 1QI4A 1EWDA 4C6JA 1SZGA 2YLAA 1XIMA 4QLKA 3RLGA 3R79A 2FZMA 1GVYA 2BGSA 3DXIA 1YXYA 4PBFA 1E9LA 4S3GA 3WLLA 1Z6KA 1RY0A 1V0MA 3WQVA 5E5CA 2RJHA 1JD9A 5EKYA 4UC5A 4HYWA 2PI6A 3VILA 3N6HA 3PZVA 5GNZA 1IEIA 2XU2A 4DBSA 3K4DA 4ZB0A 3WNOA 1H1ZA 1UYQA 1JQVA 2GQ3A 3K8KA 1ISZA 3I6TA 4BQ3A 2VZOA 3R25A 1CZ1A 1AW2A 1OQFA 5DY3A 3BGAA 1IXNA 3MBFA 3EKZA 2VEGA 4GFIA 5A6SA 5GQBA 3S3GA 1BVZA 3B8UA 3RK8A 2BS9A 4C1NA 3VDBA 2CLMA 4EWJA 3KVMA 4BCEA 2O9OA 2VFFA 1D3CA 4QCFA 3OLDA 1UHVA 4LAMA 3BLFA 3G1DA 2Y4SA 1GW1A 1VH7A 1UWIA 4H00A 4LQ1A 4F48A 1UQZA 3H7UA 4H2CA 4GY0A 2RFGA 3BL3A 1DIKA 2YA2A 2WM1A 2WMJA 5HPCA 5BROA 4UXDA 3PWIA 1EDQA 4ZO8A 2WLYA 1NSJA 1RR2A 2VR2A 4K7VA 2GVEA 5EBUA 3B0UX 2QHAA 3WEMA 1FH9A 2DV0A 4HZ8A 2IQTA 1WDQA 2WHLA 3U5YA 2PCEA 1XISA 4DJFC 4MVAA 1H5VA 2VZUA 2ONEA 4F0RA 4O19A 2X2YA 1BLIA 3DENA 2X42A 4PCPA 2FB3A 1KO0A 3CPUA 1JGIA 5HXMA 1XC6A 2A5HA 1YBQB 3OZOA 4IX2A 3VD3A 2PD9A 1MVYA 5XINA 3KE0A 1EF2A 3ZVHB 5A2AA 2R9RA 4C6MA 3W7IA 1B3XA 3TWBA 1ML1A 3IV3A 4AIOA 1CBGA 2GGHA 2R91A 4G7EB 1V0NA 3LXCA 1GPWA 7A3HA 1BGAA 3B8IA 4GNJA 1WDWA 1QVBA 5D09A 1E1CB 1UB3A 1GOXA 2YKKA 3FDKA 3BW2A 2PRLA 4WF7A 4HCDA 1UIPA 1K6AA 4E2BA 1IZCA 1BYAA 4GVGA 3TQVA 1QW9A 1H7RA 3CGTA 2VQUA 1W3KA 1EIBA 3T4CA 3AISA 2X05A 1R3SA 3HQOA 4IIBA 3NL6A 4YU1A 1FWEC 2A79A 3DHDA 4A35A 3HA1A 3KRSA 1U1HA 3NOYA 1BKSA 1UP0A 4HZ6A 3D5HA 4K36A 1QNSA 3WELA 1JZ4A 2ATMA 2I9EA 5CXPA 4D8ZA 2XIMA 4LVDA 2CFFA 2DVTA 1X96A 5I23A 4GQBA 3AS1A 4DWSB 3L4VA 1X1OA 2QGHA 3RIKA 4GFSA 3ATZA 4GHRA 5LNWA 1LWHA 3LMZA 2CETA 2H90A 4DO5A 2E40A 3C0SA 5JH1A 4NT0A 1E72M 2VX6A 2WW5A 3C86A 1W31A 1BQCA 4QLLA 4HNUA 4NAEB 1NOFA 3SY1A 4LUTA 2HEJA 2FTWA 3UXKA 1EGVA 1YLVA 2G3NA 4CQ9A 5LNUA 2EPHA 1LWJA 4TUFA 4YNGA 1HNYA 3UWVA 1XBVA 4GX8A 3STFA 4WVXA 1DL3A 3CJPA 4RX0A 4I5XA 2HNHA 5JH2A 3V0TA 1F76A 1XLCA 3AXMA 3GDTA 5A6BA 2OCZA 4QSFA 4OWGA 5C6MA 1J96A 2O4QA 3WK1A 1ZAIA 4DO7A 2D73A 2IKHA 4Y9OA 4J3UA 3NSXA 1JZ7A 3W37A 3G18A 1CXFA 3AMCA 1O5XA 3W75A 4QEEA 2GQAA 2YIHA 4S2CA 4AD2A 4KRTA 4OKDA 4UTHA 3KWXA 3OZYA 2X0YA 4FEZA 3GO2A 1NTHA 2GYIA 1QU4A 1WAWA 2INEA 1TJPA 3FHAA 3S1UA 3VFCA 1MQQA 3HB9A 4GIAA 4GOAA 4ASTA 1B31A 1PX4A 1F05A 3KM8A 2XIQA 3V1HA 3CB8A 4HU0A 1ME9A 4X61A 4AZBA 5HMSA 3TH6A 1RPXA 3GU9A 2W79A 2J7DA 2FZDA 1VEMA 3WLNA 3EEGA 2JEPA 4RE2A 1SFLA 2A7RA 3M7SA 3PTDA 4D2JA 1BSIA 2B7QA 4PEKA 2XN1A 3MDWA 3AYVA 2VOMA 2OU4A 1VJIA 1E5NA 3NPVA 1O4UA 2DZBA 1IEWA 3ECQA 4EX4A 3H4GA 1FCQA 1VPXA 4H8HA 3DOPA 3KDNA 2PE4A 3W86A 4I6KA 3PULA 1SR9A 4AAJA 2V3EA 2OVLA 3VGFA 2J79A 1UWQA 3U2OA 1X7FA 4FK9A 3I6RA 1F3XA 3SN4A 3DC8A 2Q3OA 2XGZA 3UY7A 4FOUA 1OF6A 4O52A 2J9ZA 1RJRA 4LYQA 3WQGA 2OZ0A 3SM0A 2J27A 2YR1A 5I07A 2WHMA 3CLWA 5IHRA 4UTJA 8TIMA 1H51A 1ZU8A 4BWLA 1F6PA 3P8IA 3W83A 1IGSA 4PTNA 3UT0A 1BWKA 3GW3A 2BV9A 3LPGA 1VCGA 4UOJA 3AIEA 3H26A 3EOUA 4U10A 3TYBA 2PODA 3UG4A 2QAFA 1FWDC 2XVLA 3W9ZA 2PC4A 1I0DA 3MYOA 4JIIX 1MI3A 1XYFA 3GHSA 3VC6A 1BWVA 4EPBC 2NQJA 2WAGA 2ZTJA 1KCLA 3LCLA 3OHMB 2E6YA 3WMBA 1J6OA 3VOCA 2DJXA 3LV6A 2P88A 3JW7A 4IMGA 2YDSA 1PV8A 2ZRXA 3B4UA 1R6WA 2D0HA 3ONBA 3QV7A 2ZCGA 3FGCB 4Q7BA 2WB5A 3A13A 4WY0F 5M2FX 4DIAA 3GIYA 4KT2A 3LB0A 4G5DA 1S5NA 4GC4A 4IG2A 1KFWA 4JTIA 2OT1A 3ITTA 3I6EA 2Y8UA 3GRIA 4MY8A 4XIMA 4LF2A 4XZNX 1W9PA 1U83A 2TODA 3TZFA 4AMAA 2BGNE 5IBXA 4LYPA 3RO8A 1KD0A 1SW7A 1IE7C 4IIEA 4MJ4A 3FCPA 3EPMA 4YL2A 3CWOX 4MFEA 5LXXA 3EX4A 4XAGA 2BGQA 5M5DA 1NEYA 1ZL1A 2ISSA 2V30A 3FA3A 1QUMA 3WD4A 5I02A 4LF1A 1NP0A 5K4XA 3DCPA 4N4QA 4EANA 3QXBA 2P1FA 4EXQA 3MB9A 3WDRA 5BMWA 2WMIA 4GE8A 3QFEA 1FWWA 1V3IA 1CNVA 1SZFA 1ITUA 4I9MA 1OG0A 3VA8A 1G01A 3KLKA 3BLEA 3AIUA 1NVMA 1UC4A 2Z7KA 3T2OA 1Q7QA 1ODZA 1TRIA 4QP0A 4JKKA 2QJJA 4Y2WA 3K1GA 3LLFA 1LDCA 5FD0A 1S46A 3NQ7A 2PDUA 2V0TA 1RK5A 3H23A 5BWAA 1TO3A 3GDLA 4M5PA 1LQ0A 4G1KA 2OO0A 1C91A 2W27A 4HKPA 1H0GA 1NOWA 2Z7GA 3FW6A 5CSUA 3PVFA 1VBRA 4CNOA 5HWNA 3UWEA 2Z1KA 3LI1A 4S39A 2IKJA 1H11A 2A85A 2WPGA 2VEMA 4FXSA 3RITA 2DH2A 3H55A 1YRRA 5K9XA 1VPQA 3UZ5A 3FA4A 3QEZA 3F4WA 3IGUA 4CNUA 3UR7A 2CLLA 5FSEC 4PMZA 3W7RA 2FMOA 5IDIA 1RJQA 2XZ7A 4XZLX 4P2VA 2OPJA 5FIPA 4OV4A 2VZVA 4HOWA 1XRTA 1XRVA 4L7ZA 2AKZA 4HJFA 1DPMA 5E0KA 4XBJA 1TQJA 2P53A 2DVXA 2E0PA 2YB4A 1MZRA 2Z26A 2PDJA 3VM7A 2H8XA 3H2MA 4FNTA 4LSBA 4D6GA 4CQAA 2J7BA 3UCCA 1GQKA 4JKLA 5LHFA 4M6UA 1XIEA 3TW9A 2XVGA 3UG5A 2PZ0A 3DZ1A 3VDCA 3WK0A 3RG6A 4OHQA 3ORWA 2QPUA 3BDKA 3GK0A 1NDVA 3U3HA 2QDGA 4FIRA 4RLIA 1NDWA 4WDTA 3VXGA 2EF9A 4EE9A 3O2LA 1V6YA 3GNOA 2OO6A 2CKSA 4HBKA 5LYRA 3L4TA 2CXEA 1DJIA 4K7YA 2Y0FA 1IEVA 1YDNA 3WCZA 3UG8A 2PMQA 4I3GA 1V79A 4MWAD 4YTSA 4HK5A 2PBGA 4YMZA 1Z7AA 3K46A 3FAWA 1E55A 4U2ZA 1P0NA 1VFUA 3HPSA 3EX6A 3R8GA 4M7SA 1DTNA 1FFRA 4PCSA 1Q6RA 1UUQA 1Q13A 4DJFA 5RUBA 1PX8A 2ZICA 3SI9A 3AU6A 1PXGA 3O7UA 3EZ4A 3W2MA 1WDPA 4Y9NA 3V36A 4L65A 4H9VA 1E0XA 1W9DM 1FWJC 3MS8A 2I56A 2HVMA 3KHJA 3TA9A 3XIMA 3KBNA 1UPPA 3B04A 4R88A 4OUEA 3S6DA 3L4YA 4CEUC 4GRSA 5HNRA 5DEZA 1Q8JA 1NWRA 1NY1A 4E4PA 1TJ1A 2VR4A 2Z25A 1L2UA 3PUEA 2XH0A 4AB4A 4L1XA 1ME7A 2XPKA 3MYPA 1AD4A 4RZ4A 1S2WA 1OBAA 1UWSA 5LIUX 3KRZA 4AIBA 3TJXA 3AHYA 5C2CA 4PYSA 5LZLA 3OP2A 1S39A 2B7NA 1FH7A 2BY3A 2W61A 4AG0A 1R3QA 4ZTXA 2CXGA 1DXFA 4I7UA 4GXPA 2J7HA 4RCXA 3TLLA 4ZE4A 5CBBA 1R3VA 3B8VA 1OY0A 2G4JA 4KGJA 4HCLA 5CGTA 2PTXA 4DZIA 3ELFA 3GDMA 1XDJA 2I14A 3AC0A 1SJAA 5F2GA 3UESA 4HMCA 3DHPA 2PURA 1IEQA 4YN5A 2DUAA 3URQA 3ARSA 3VGGA 1MUCA 3W7KA 3QLDA 1NOUA 2X2GA 2WZTA 3HTWA 3M1ZA 1Q8AA 1UMYA 2GLKA 4UTIA 3GFYA 3L68A 2WZIA 1UJQA 4JYEA 3AS2A 4A3UA 4C6PA 3GXFA 4C6KA 1XQLA 1UWUA 4TX8A 4F40A 4P7RA 2CWXA 2XIBA 3SSJA 3EMQA 2PDWA 1BVWA 1FUYA 3NJ3A 1EC8A 4XKYB 2PS2A 2Q8ZA 1WBJA 3N3MA 4JYFA 1BPLB 3LCXA 4AU0A 3FK4A 1Q66A 4EK7A 1H2JA 5DF0A 4NHVA 1DJYA 3CUZA 3ZYZA 3TAOA 3QVQA 2HXTA 3ZSSA 3O6AA 3BMWA 1E4NA 4GH3A 1ZS2A 1YNPA 2RGMA 4A3QA 1LORA 2PFHA 1W1VA 2XZ9A 3LXAA 3SQLA 3A12A 1FHDA 2DIEA 3AIWA 5D32A 1TV4A 3HOJA 1VFTA 2WVTA 5LNVA 4QIUA 5U4NA 4TMCA 5AYXA 4PUMA 3CIWA 1AJ0A 2YCIX 1V7YA 4D6EA 4KERA 4IFKA 5FF3A 1F6KA 1KRCC 1H0IA 3HMCA 1NDYA 1XIBA 3HQPA 3LPFA 4IL0A 4LALA 2WPBA 2NQLA 3VOIA 3S5ZA 4PULA 3TNBA 3LTYA 2FZ8A 3TE9A 1FHUA 2Z00A 1V03A 3V5FA 2CZFA 1TRDA 1RZMA 1XLDA 2GGGA 1G5AA 2VT0A 4DJEC 3EXTA 1M6JA 1TREA 1ZJBA 1T0OA 1U30A 1POKA 3EWBX 3T09A 4PTVA 1R9YA 3CUJA 3ZR4A 3E96A 4UNIA 5ABTA 2ANUA 2P8BA 2FLIA 4BK9A 2NVAA 4BKNA 2TAAA 3KTSA 3N34A 4Z2KA 3EBVA 3M0YA 3RM8A 2MNRA 1M3UA 3TTSA 1TPFA 2D0FA 2V9DA 3TN6A 1MFVA 4U31A 4JTJA 3SN0A 1OVDA 2QDHA 3AWOA 2E7FA 4D8LA 3SCTA 4JCLA 2OX1A 2QCNA 3C0QA 4FLSA 3AHVA 1XLMA 4J3ZA 4ZB2A 3KVLA 3P3BA 1OT2A 1JUEA 1MZHA 3A4WA 5I78A 1WP6A 4IM4A 4IWWA 3WSUA 1TV2A 1JNDA 4L61A 2ICSA 3VKCA 2WXDM 5JQ9A 1W9XA 4HMNA 2G3FA 5JVLA 1FP9A 2ZZ6A 1X97A 4PODA 2ZUSA 4W84A 1DJNA 2QCEA 4Z08A 4CCDA 2DP3A 1R2TA 3B8WA 3SN1A 2GJXA 3QSRA 4AY7A 1ZQ5A 2V6AA 2WWDA 1U5VA 1YHTA 3TYZA 1D9EA 4Q4PA 3GG8A 2VOTA 4HJWA 3WQEA 1OCNA 2ZDRA 4Z1DA 2VUYA 3UWQA 5DRIA 3BV7A 3TUUA 2XFFA 4IMEA 3CUHA 3D6NA 1VKFA 4GUHA 1EGMA 1VFHA 1DIEA 3UJEA 3T2QA 5AOUA 5AHMA 4H6RA 4LNYA 4GY7A 4DYEA 1R46A 3P81A 3VGHA 3T7VA 1KFCA 5A94A 1SU5A 3SGGA 3TK7A 3GH7A 3GX9A 4WHBA 2XUCA 3LS9A 4P7QA 3C8FA 3BH4A 1W3LA 2BX7A 3N2BA 3P5ZA 4DPPA 1WQ5A 3QTGA 3V75A 5FJPA 5CJ5A 3TP4A 4O16A 2BVTA 2VFDA 3TYUA 3MTWA 2BP1A 3LY0A 1VZWA 2E8ZA 1S5TA 4OJYA 1JG9A 1OIMA 2ACSA 4J40A 4AZGA 3JS3A 3DFSA 1JQXA 4U33A 2XJ7A 3AI0A 2WJDA 5KEZA 1BQGA 1WE5A 3QTPA 4V27A 4KGLA 4A2SA 3FVMA 1J93A 4F8XA 1RLCL 4C1NB 1SJDA 2D2GA 2IMRA 4UCGA 2F7FA 3HV9A 3AU2A 3ZT5A 3LGDA 4XG1A 2CKRA 4CCZA 2YCLA 4JTEA 4KWUA 5CC7A 1V0KA 2Y7EA 4HNOA 4FLRA 4E5TA 3M0LA 3CHVA 2DQWA 1WXZA 1ADSA 4JQ3A 3SUVA 1TPEA 4A22A 4IT1A 5T9BG 1H50A 3CXOA 2XN2A 4GJIA 3RX3A 3BJTA 3CEPA 2OZ8A 5K7JA 1KKOA 1VB9A 2QF8A 1G7VA 3BPWA 2QUNA 4M81A 1CGTA 1JCMP 4M29A 3M0KA 3TFCA 2ESCA 4H1ZA 1YW1A 4B5SA 2X09A 4I5RA 3G24A 1RV8A 3ZMRA 1MXSA 1C7SA 3D3AA 1JYXA 3C2EA 2D22A 2BY2A 3BAWA 3PS7A 2Z28A 1V02A 2V2DA 2VFHA 2PRHA 2Z6JA 3WQPA 4M1RA 2VEPA 3T1GA 1NF0A 4M3PA 2PLMA 1Q6GA 3WJZA 4H7CA 3WH8A 3UW6A 4CD6A 1QI3A 2Z1WA 4Q8TA 3P0WA 3E38A 4QRNA 3L4XA 3LMYA 1CB7B 1QNQA 1EC7A 4S3BA 2WNQA 4KESA 3OJGA 1JF5A 3DFYA 3UCDA 3TA6A 1W17A 4IPPA 4O14A 3NAVA 4PC8A 2BASA 4G56A 3O6CA 2G4FA 4K3ZA 3IGSA 3WNKA 4UQAA 3W1TA 4XISA 4QJ4B 3C2YA 3SRFA 4PB4A 1C92A 3WF4A 3W6LA 3F7JA 1GYMA 1A5MC 4L56A 3R8RA 2OFJA 1GK8A 3FXYA 2H9AA 5JIWA 3L5LA 2POZA 2GUUA 3VPLA 4LS0A 2RGLA 2W66A 4W5ZA 2WHJA 4N7QA 5FEZA 3ZLGA 4DRSA 2EKGA 1DJZA 1MYRA 4BHYA 1W9BM 3LA4A 2AOSA 1TPUA 1PDZA 1FCBA 4WKAA 2PLCA 1WOAA 1O5KA 1SSGA 2OTDA 3MO7A 3EKGA 4KBXA 4ICNA 5DMYA 5AYZA 2E8YA 3A3WA 2Z29A 3WUGA 4IIGA 4QJ1A 4GZ7A 3DC0A 3S8HA 3GZAA 4R85A 3UA4A 2I5GA 2CLPA 1BGGA 5I79A 5B80A 3LBCA 3GXIA 3W23A 1ME8A 2D0GA 3A24A 1QBAA 4LUTB 4J35A 4GZIA 2B31A 1P1XA 3E2SA 3HGRA 1NH6A 1GORA 1C93A 1JUKA 3DHUA 2X1SA 2KAUC 3VI2A 2QDEA 3MBDA 3W1PA 3IVTA 2OKOA 4S38A 1HP4A 3SRHA 4LEQA 4LUJA 1J12A 2HJPA 2VX7A 4ROPA 5E09A 1D3HA 2HZGA 3WY1A 4LAZA 2XSBA 1ONEA 4IXHA 2CIPA 2DSZA 3C3NA 1A3HA 3VMNA 3IJ8A 1MNZA 3F2CA 1G7UA 7REQA 3AUJA 4LBSA 1JEZA 2YCKX 1Z8AA 1K70A 3R0DA 1TPDA 3B06A 3CHFA 4QBXA 1FFQA 1TMQA 3ME3A 4E4UA 5ABFA 3U4FA 2IPJA 4OOZA 3GTIA 3AJ7A 3VMOA 1ECQA 1XRFA 4FF7A 3PC0A 2PGWA 1R3TA 3PG9A 4Z2IA 3RR4A 1HL2A 1TV5A 2FPTA 2EG7A 3ANVA 3AAMA 5BCAA 5D05A 3NSNA 4QHRA 3LHWA 4EACA 1US3A 1V02E 1WKEA 1F07A 2PDCA 2ZZ2A 4OFCA 3L0NA 3W7OA 2DT1A 3AQUA 3W71A 4RK8A 4ZVJA 1K9DA 2YDAA 3K4WA 3ZJ8A 4NIRA 2H3BA 2VRJA 3CASA 3W88A 3AALA 4Q8PA 3QKEA 2QW5A 1G0CA 3LHZA 3HG5A 2ZA2A 2Y6ZA 2F38A 1LRTA 4N6FA 2R82A 2J8TA 4QXIA 3L5AA 4CCEA 2NUYA 4E4FA 1ADOA 3EMCA 2TYSA 3FIGA 4C7GA 3EGJA 3TTQA 4GD0A 3NPWA 2V5CA 2F9RA 1U33A 3UPMA 2PDBA 2RJGA 3WF2A 5GVJA 2J6XA 4LB3A 4HCHA 3UVAA 1TMLA 4AZ7A 2A2IA 3B0YA 3IK2A 2P3EA 1O5QA 4MB5A 2QR6A 1A3WA 4AF0A 1XLEA 5CZKA 1A5UA 5HQEA 5CAKA 2NT1A 3HG4A 3G2GA 4A8LA 1K02A 4P8VA 1J0HA 2EPLX 4H8NA 5A6LA 6PTDA 2GUBA 4MUPA 4OQVA 1PSCA 5G2HA 1B90A 2E3ZA 3W01A 4KWVA 3M6DA 4PRRA 4CQBA 3GXTA 2NUXA 1GJUA 3RU6A 2FFCA 4JQAA 2VRKA 1DWJM 4UTTC 5G5IA 1HP5A 2Y70A 1OFRA 5E0FA 4UMCA 4DJEA 3EX3A 3K4AA 4IG2B 3GAKA 2WJFA 4AZHA 3R58A 1R8LA 2AGTA 3TJIA 5HMDA 4XIAA 1G9HA 3SZ8A 1ZZMA 3LHYA 3JUGA 5BXRA 5JBEA 3ZWTA 3CQ0A 4A05A 3DUGA 2YFOA 4X3ZA 3SUUA 1WA3A 3KUMA 1ITQA 4B5VA 3W26A 4WSKA 2NQ9A 3RNDA 1XFCA 4JFTA 3GH4A 1VJSA 4J9JA 1KXTA 2Z6IA 3B0PA 2EG6A 4AY1A 4IH3A 1HF6A 2WBGA 3CAKA 3SQSA 4R5EA 3AIRA 4Y8FA 4HTYA 2ZRUA 4UMAA 4CKQA 1BTMA 3LBMA 4PUWA 5TBOA 2JKAA 1A5KC 9RUBA 1GKRA 1B1YA 3E0WA 2Y24A 1KV8A 3S46A 2WMIB 3IIXA 2HV5A 2QCMA 4LAKA 1VENA 3DDMA 1BWLA 2GGEA 3M7WA 3QSTA 1TCMA 5LIWX 2YW4A 3ITOA 3O8AA 3B05A 4GX9A 1OX5A 2GJNA 2PGEA 3IV8A 4F4RA 4NASA 2TRSA 3HU7A 1Q6EA 5LGXA 1QWGA 1AL7A 3B03A 2VZSA 1E6RA 2JIWA 1DJWA 4XTDA 4GCXA 3AMDA 3NIYA 3UG3A 4GIRA 1E51A 3FA5A 5CZ0A 3NWRA 5E9AA 3G1XA 1IWPA 2BVYA 5AC4A 1PTDA 3MWCA 3W1MA 3TQKA 1DIOA 1H5YA 4RE0A 3EOLA 2FMNA 1A3XA 1AVAA 3S2CA 5D8WA 4GKLA 1GOWA 5FJRA 3VOGA 2G37A 1VGAA 3I68A 3IJ6A 1UUMA 4UTFA 1Z3NA 2PZNA 1EBGA 3UWYA 2OEJA 1W1YA 1MW0A 1F3WA 1JCNA 3ARPA 2XFYA 3OPSA 3BLPX 4RNHA 5K4ZA 1W8SA 4GH1A 1J8VA 1EA0A 3WQ6A 4RE4A 4Z1CA 1LCOA 5FKYA 4KQNA 2I5IA 1JZ8A 1JYWA 1ITCA 1RA0A 4HA0A 4GQ0A 3G77A 3NEHA 3T40A 3BLOA 4N9DA 1DWGM 3NEVA 3A23A 4XUGA 3RU8X 2UY3A 3ZVIA 1C8QA 4HYVA 3W7PA 4TX9A 4C6BA 1EC9A 4MB3A 4M6VA 3SCQA 1ZBCA 2QGYA 1JCXA 2V2HA 2QULA 3P67A 2VC9A 1JZ6A 4JR5A 4ZOAA 3PY2A 3TW6A 4NU7A 3MHUA 4WIWA 3AYSA 4E6MA 1HKJA 2PCQA 3T07A 1GYNA 4MKNA 2PDPA 2PF0A 4ICCX 1GEHA 3WQ5A 4A8IA 3PTMA 3SRKA 4WX2A 3G1YA 3GR8A 4F66A 4JIQA 1PO9A 5AECA 1M03A 3RLHA 1VPYA 1HKKA 2B0MA 1E0TA 3C2OA 3A5FA 1C8YA 1KQYA 2PDGA 1JDEA 4FLQA 1UASA 3WLRA 7ODCA 2SFPA 4F9DA 4XZBA 3OG2A 4E2OA 4J7RA 3UGVA 4AVNA 4IMCA 3PBUA 4XAPA 1EJUC 1VCVA 4NVTA 1Q6LA 4B2DA 1P0EA 1P0BA 3RFAA 1EX1A 1OZQA 1KR1A 4H8UA 4AD0A 4O57A 3S5SA 2VFGA 1RA5A 1M68A 2ASHA 1S3HA 4EPKA 5CG0A 4IPLA 5FI8A 4TV6A 1J5SA 3IACA 3BARA 3EOSA 3CHCA 3GHTA 5K3VA 2IXVA 1K4HA 2V67A 3W29A 4LYRA 1TZZA 3WBAA 3N9RA 1OC7A 4RE3A 5FCZA 2W62A 1MDRA 3MKVA 4ATWA 3U2EA 3GYEA 3VDGA 5LIYX 2I5QA 5JBFA 5U7SA 2JGQA 3P14A 3AUOA 2ZIDA 4MAVA 3WDQA 1KKRA 2V63A 3WMCA 1K03A 2J74A 4NY2A 2OOGA 2EG8A 1IXOA 2VWSA 1IGWA 1KLYA 2DZSA 9CGTA 3QR0A 1SPQA 4EP8C 2GL5A 3OIXA 3RYSA 3NVDA 4HZMA 2RDXA 5ENLA 2P0OA 3VO0A 3OVQA 3LHUA 3FJNA 4HPHA 4BEQA 3A47A 1V3JA 1XYAA 1L8PA 1SZRA 4QDWA 2F6XA 5HULA 2C13A 4FNQA 4ZQRA 4NJHA 3K8MA 1EFZA 1L8NA 2ZXDA 3E0LA 1CGWA 1ELSA 2NVCA 1JPMA 3G5EA 4FR6A 1GVOA 1DE5A 3PPCA 3G1SA 4PMYA 3E3HA 3CPGA 4Q4QA 1TVNA 3AYTA 3U4AA 2OWXA 3VIHA 1AQFA 2WC4A 4IFRA 3BW3A 3MDUA 3R0UA 4HP5A 2Z1XA 4IPIA 4ERIA 3MQTA 5C9WA 3IPWA 2BXZA 2ADAA 2J62A 5HJLA 1ZSXA 3GYCA 3HM7A 3BSGA 4NYYA 2B81A 4KWSA 1XICA 3CZKA 5BU6A 1E3XA 3N15A 1PZ1A 4HA3A 1EWEA 1TPWA 3MZ2A 4LNCA 5C2XA 5I0DA 2PTWA 4BQ5A 1S5WA 1TA3B 1XLLA 4X9SA 2RDUA 1R7AA 4PTWA 4I6VA 3HPAA 4GG9A 3SJNA 2XSAA 4IFKB 4L5ZA 1RHCA 4JFVA 5AKQA 3IJQA 3U57A 4P8UA 1X8CA 1HJUA 4DB7A 3U7VA 4PCNA 1CDGA 3DN5A 3S5OA 2O9RA 1OD8A 5F2LA 5J04A 1HKWA 2ALDA 3H7RA 1JZ5A 1EQPA 1V6WA 3THDA 4KEMA 1Z32X 5C9ZA 2VC7A 4BF5A 1JI2A 4XAYA 4HHPA 1EYEA 3E1F1 3APYA 1JYNA 3GVGA 4OUIA 3XINA 4DAFA 4QS6A 2OWWA 3I3EA 4B2DD 4V28A 3PNUA 3TDFA 3KOZA 3WLJA 2E77A 5DCEA 4CD5A 3VCNA 3K8LA 1TELA 4UQCA 4GXWA 2OODA 1MFUA 3I7QA 1NARA 3CWHA 5E1QA 1E71M 2QCHA 2BHZA 2GOKA 1J01A 1KRBC 1SJCA 5I06A 4DZHA 4W8AA 4Y9PA 1CXIA 5XIAA 3ZR6A 2CHRA 3BV4A 3FYOA 3W22A 2FJUB 4F2TA 3VKJA 3DI0A 4WD0A 3TYDA 1E6NA 3GWQA 2CESA 4PFHA 2A6LA 2VENA 2YXOA 3WH7A 1TIWA 4O1AA 5CLTA 1EF3A 3SCVA 4YXGA 1F74A 1Q7ZA 2GJXB 1Q6FA 4AWSA 2VMFA 4K8HA 5JBDA 5D2XA 3N2TA 2WJEA 1Z44A 4LTSA 3HQNA 3KBVA 4HPGA 1YADA 4EXAA 1PCKA 1BFNA 2EHHA 3N18A 3W7MA 3W02A 1EIXA 2NX3A 3APTA 3VAVA 4C5YA 5H91A 3QMSA 1UQYA 3TN3A 1Y65A 4GJ1A 1XG4A 3PAJA 3PJTA 4US5A 4MM1A 2QCFA 3VNJA 1JAEA 1VHCA 3ONCA 1C29A 1GKPA 5KMYA 4Q8OA 3TJLA 2A3BA 3FJ6A 4UTTA 2BOFX 1XH1A 5ABHA 1JRCA 1J2BA 3KCOA 5KSWA 3CMJA 4UFMA 3OOQA 3MUCA 4DAIA 1M01A 1GYLA 2QJGA 2V69A 4HNTA 3M0VA 1ESWA 3N04A 2XH4A 3OA3A 5AFDA 1UZDA 1CYGA 3OQEA 1XHGA 4NNAA 1RBLA 1O7AA 2OLHA 3WBWA 1D8CA 1FWBC 1MRAA 4A3RA 2G3MA 4L6HA 2WZMA 1H7OA 1QHPA 4D6JA 2YCLB 3VKBA 3W76A 1GNXA 5HINA 4IXXA 1MW3A 2QS8A 4LBRA 3RGTA 3S1XA 3F5LA 3CWNA 2ODOA 5D38A 3HG3A 3KRBA 5IXEA 4D1IA 2PDLA 1J0JA 3NQDA 4MDPA 1IT8A 3OU8A 1PYFA 3ABRA 3VABA 2EPNA 2WVVA 1EDGA 1NF7A 3DAQA 3O63A 3BE7A 3WLIA 1DWFM 2F6UA 5G4HC 1UKTA 3U2CA 3C0LA 1KM5A 2FTYA 4CEXC 3CNYA 1S1PA 1XCFA 2FGBA 4AXNA 2WM0A 3K13A 4NQ1A 4EPEC 1AJ2A 3AWNA 1SFSA 4LXFA 1MO0A 3BSHA 2AQVA 3N4EA 1I2QA 1NWTA 5DT7A 3S1GA 5A69A 2CLOA 2AGKA 1V0LA 3RLUA 5LNSA 3AMKA 2QYGA 1TVLA 2XFRA 2X1IA 4WJEA 1XG3A 1TWDA 1XLBA 3OQ8A 3CAWA 3GM8A 2GDQA 2IPGA 4LVAA 1OFOA 3ZJ7A 2EBNA 3EXSA 3KW3A 3W7HA 3FVDA 1J6PA 1O12A 1Y5WA 3EPOA 1KTNA 4N0RA 4EAMA 2FH8A 4IISA 4WCJA 3MJYA 2XHYA 3BLLA 1HKVA 1QXLA 1JVNA 1U1UA 1OYAA 4F0MA 5CZJA 2J7CA 4PR4A 1D2KA 2OSXA 2H9AB 4MZ8A 3TROA 4D6IA 2FGZA 1A80A 3C4UA 1XSIA 3QHOA 2QCCA 2X1TA 2W91A 2J7EA 1IWBA 5T8GA 2CBIA 4GYKA 1ZRQA 3NQGA 2ZXQA 2VVSA 4RNJA 4RPQA 1EL3A 3KWSA 5H8UA 2DZWA 2IXUA 3CQIA 3CEUA 1EJSC 3H21A 4US5D 4TVUA 1KBLA 3ZLHA 2FIQA 1UP2A 2F6KA 3RLVA 4YTRA 1K8CA 2V3GA 4GQGA 2O0TA 4PMNA 4ZZ9A 4BZYA 3PBVA 4GUJA 3RM9A 4B15A 4OZOA 5REQA 4K1WA 2GUYA 5SWUA 1XYLA 3KS6A 3N2XA 2VDGA 2Q6ZA 5E0CA 2F2KA 4KH2A 1QI5A 2A3CA 3OLIA 3CO4A 4QG9A 4CD8A 2CHOA 3BJFA 4JHMA 1HFBA 3OIHA 4NJKA 1RP9A 1REQA 1A5CA 3I3DA 1W54A 2WOQA 1DJXA 4JPGA 4CQ8A 1HIZA 5CGMA 2G3IA 5F2MA 2E9LA 1DHKA 1EHNA 3LQGA 3DFPA 3VDHA 1E6ZA 3CYJA 4Q6JA 3HG2A 1JPKA 1TZ9A 4IF2A 4O0QA 4LPCA 4CNTA 1Q3NA 4GBDA 1X39A 1CLVA 4S3AA 2WANA 2DZTA 3VE7A 2P76A 3GNDA 2JKEA 3AIVA 3ZO9A 3K1DA 3EWYA 7REQB 3C61A 2QZRA 1IXQA 1DXIA 2CBJA 3CMGA 3F4NA 2QXWA 3H2OA 3U9IA 1TPC1 3NM3A 5ABFB 4R33A 4PSPA 4YVPA 4Z1BA 1NFPA 3PTKA 4QSHA 3GXPA 2YBTA 1HX0A 3MO4A 3ABZA 2C1IA 1MEIA 3TNOA 4HA1A 4C5ZA 1PKLA 1GKQA 3NCOA 3UZZA 1OB0A 6XIMA 4LCRA 1QRQA 3L5MA 4I9TA 2QUTA 1FCVA 4NG3A 4RZBA 5BW6A 4QG6A 1KXVA 4NRRA 2Y5EA 4RW5A 4NZJA 1FHVA 2PTZA 4YYCA 1PZ3A 3THAA 1S5VA 4QROA 2DEPA 1EJVC 2ZRYA 1CEOA 1XYMA 1YXCA 4H01A 1OF8A 3OZPA 1IR1A 4XZIA 4AW7A 3UNDA 3LM3A 3TV8A 5D8ZA 1OIFA 1J0IA 4JY8A 1N2VA 4FX6M 2W9MA 2RAGA 3DGRA 2OQLA 1EJXC 2A7PA 2ON3A 4O54A 3HFYA 4KFNA 3N2MA 4DXXA 2WLZA 1CPUA 1BRLA 2POTA 1PZ0A 1WOBA 3GNNA 4WEVX 1Y5XA 2PTYA 2O9TA 3IUHA 7PTDA 2FHBA 1ZGDA 1UW9A 3NL5A 3L2MA 3BAIA 1FA2A 5AHEA 4AZCA 1E1EA 1T99A 1PUDA 3NXLA 4AF0B 1X1NA 1XYZA 2E6DA 4FHAA 3RXZA 4NXKA 1ISXA 2HNEA 3APGA 3STPA 1DXEA 1ZP4A 1BXBA 3L4UA 2BY0A 2PWDA 1RH9A 2HCVA 4ZQOA 3WNNA 1YKWA 4ZEPA 4JN7A 1RD5A 3SAZA 2PD5A 2OGJA 1VQTA 4LRTA 4GYFA 4H9YA 2ZA1A 1EJWC 4AX6A 1KCZA 1UA3A 1XUZA 4Q7IA 1CGUA 1QAPA 2YGYA 4FP1A 4WKHA 1S2UA 4M51A 2Z1SA 4E8GA 1FWSA 2WO5A 3QPZA 3ARZA 1RBAA 4JFWA 3M0ZA 3U5UA 1EUAA 2E25A 1DWHM 3TVAA 1TX0A 1VC4A 3FSTA 4GNVA 4LUYA 1IIGA 3TFXA 1TJRA 3BOFA 2ZQ0A 3FNDA 4GLEA 1A4MA 1AFSA 2W3ZA 1L6SA 3VX0A 2QQ6A 3SB0A 4JTSA 1CLKA 3CQKA 3SUTA 3V16A 1UBSA 3H4WA 3CZGA 5H8PA 3TW7A 3DKLA 4NP7A 2NT0A 1US0A 5CPQA 1XSKA 2VWTA 3MT1A 5E6YA 4XWUA 5C2GA 3G8EA 4MNLA 1M7JA 4MSSA 5L9FA 1DJQA 3PWAA</