4RW3A

Structural insights into substrate binding of brown spider venom class ii phospholipases d
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
279
structure length
279
Chain Sequence
GNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phospholipase D LiSicTox-alphaIA1bii
publication title Structural Insights into Substrate Binding of Brown Spider Venom Class II Phospholipases D.
pubmed rcsb
source organism Loxosceles intermedia
total genus 109
structure length 279
sequence length 279
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2014-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4rw3A00
1DJZA 1T8QA 1QATA 1V8EA 4OECA 3EA2A 1PTDA 4R7OA 4F2BA 2ZKMX 4I9MA 3I10A 3CH0A 4F2UA 4Q6XA 3V18A 5PTDA 3EA3A 4I9TA 2PLCA 7PTDA 1PTGA 3OHMB 3H4XA 3QR0A 1T6MA 2O55A 3PTDA 4RW5A 2ISDA 3MZ2A 4I9JA 3H4WA 1YDYA 4PTDA 3L12A 3V16A 4QJ3B 1QASA 1AODA 4I8YA 4F2TA 3QVQA 2PZ0A 3RLGA 4S3GA 1DJGA 3KS6A 1VD6A 6PTDA 4RV3A 2P76A 3V1HA 1GYMA 1XX1A 4RW3A 3EA1A 2OR2A 1DJXA 5T9BG 1DJWA 1O1ZA 2F9RA 2FJUB 1DJYA 3NO3A 5T91A 4I90A 3RLHA 3KS5A 2PTDA 1DJIA 4QJ4B 5T9CE 1ZCCA 2OOGA 2OTDA 3QR1A 1DJHA 4QJ5B 4GNKB
chains in the Genus database with same CATH superfamily
3C6CA 4GYKA 5DX7A 2PB1A 3NXLA 1MRQA 1NOFA 2ZQ0A 4LUSB 3FLUA 1SMAA 2GWGA 2BGNE 3T0BA 3U4FA 5G1YA 2ZTJA 2D0GA 4ZO9A 1KBBA 1NIUA 2Z2UA 2YOCA 2A3BA 4NXSA 3DI0A 4CQCA 1CGTA 5CZSA 1H7PA 2ONEA 3O2LA 4D6EA 2ISDA 3T4CA 4PB3A 1IT8A 4QEEA 4XIAA 3H70A 1UZDA 4WCJA 3C3NA 2RGMA 4NNBA 3APGA 1XQKA 4K8HA 2Z6IA 4PE8A 4LCQA 3H21A 3C61A 4ILSA 4K7VA 3REQA 1S3TC 2BASA 4K39A 1Y5VA 2QCFA 3L4XA 4JTGA 4BWLA 4GE8A 3WH9A 1UCWA 4L9ZA 4IFKB 2BBFA 3M47A 2EXOA 2ZZ5A 3AS0A 1WZAA 4X9SA 2Y88A 1W3LA 3A9IA 3G8RA 1LP6A 5KZMA 1EGVA 2QCLA 3WLTA 1XCWA 5FF7A 3A23A 4LQ1A 4X63A 3GU1A 2CZVA 3SIMA 2YX0A 1V3IA 3M9YA 5A2CA 3ARSA 3TSBA 4QE4A 3LU2A 1QTWA 1R7AA 1YTKA 1W56A 1AD1A 4JYDA 3CIXA 5CZTA 2GQ9A 4UTIA 4TOQA 3H23A 4Q8PA 5I23A 2W79A 5M2FX 4UB9A 2G3MA 2PP0A 2PF0A 3CUZA 4BS0A 2W66A 1T5AA 1ZBCA 5AC7A 4X0VA 2P53A 3HGSA 4JHZA 2QIIA 3MHFA 2FPTA 1F6YA 1EH9A 1TREA 3OOQA 2DZSA 2OWXA 3QMRA 1V7YA 3H4WA 5BCAA 3FGCA 2BY3A 4R33A 2REQA 4YNGA 1QW8A 5CCZA 4U31A 4QCEA 4CCDA 4GD0A 2VEGA 4ATLA 4ALDA 4JDYA 1XXXA 3W73A 1YXCA 2J6VA 4AY8A 3UZXA 5TNVA 3NYDA 3PUOA 3VC5A 2YB1A 4INFA 3KOFA 1XLFA 5E1QA 4MNJA 4Z1BA 5C9XA 3M07A 3R6IA 2W3ZA 3G6MA 1OIFA 1T8XA 2VNCA 4KT2A 1YBQA 2J47A 3C0SA 4WIWA 2VWSA 3ZR5A 1Z89A 1XV8A 3OVPA 1R3QA 4K8GA 1QUMA 1YPIA 1VR6A 4JR5A 2WMIA 2PSNA 2NXIA 4H83A 4QCFA 2PWVA 4FF7A 1SQ7A 4LBRA 2UY3A 4JFTA 4F66A 4JFVA 1YKWA 4QG8A 3O6CA 2VQUA 4WY0A 3ZWTA 3ICJA 3W7CA 4MPKA 1Q6DA 3B8SA 4AVNA 1X7IA 4FX6M 3QMSA 3LHTA 3R8GA 1MMFA 4AD1A 1GOQA 1SSDA 1S5TA 1UKQA 2BWGA 5DMLA 1ZAHA 2RFGA 4RV8A 3IAQA 2I56A 2IPGA 3LCIA 3TXZA 2QJIA 1K77A 1P1MA 2EKCA 1JPKA 3FA4A 3MUZ1 4L1WA 1A50A 4XO6A 3PJXA 3RGTA 3WQ6A 1OFRA 4S3GA 1DJGA 2GJLA 2ZYFA 5A8NA 1A5AA 5HQEA 3TJLA 4U3CA 4D6CA 1TB3A 5I09A 2PBGA 1OFOA 1TZ7A 3C0QA 1B1YA 2A2IA 2CWXA 4GKTA 3JZUA 2CLHA 2WC3A 2NSOA 3IK4A 4I90A 4LW7A 1FWEC 2PTDA 4IP4A 1VFSA 4NZFA 3BV7A 2YCEA 1E6NA 2DZXA 3GVGA 3TYZA 1U1HA 1W5NA 4WJXA 3VGEA 5DO8A 1QI0A 3PZ9A 4V1YA 3BH4A 1X6UA 3FA5A 1WAWA 5F4SA 4JL2A 2PWHA 3MBDA 1A0EA 3PBWA 5I06A 1ZY9A 3NURA 3RPMA 3A47A 4B2DD 2A6LA 1YDNA 3M6YA 1X38A 3UF9A 3QHMA 4LB4A 1R2RA 2XG9A 1Z44A 4YYCA 3O15A 3PBGA 5E70A 1MWOA 3RG6A 2Z00A 2D1ZA 1G67A 2QCMA 4NJHA 2XIIA 4E4FA 5E0KA 1FBAA 4C6OA 3OLGA 1V6UA 4XD3A 1KC7A 5DCEA 2DZWA 1FCQA 1F6PA 5I03A 3IJ6A 1E72M 3DKJA 1KXTA 4HGXA 2W6RA 2AL2B 4M1BA 2ZXBA 2POTA 4C5ZA 3UZWA 1P48A 4AC1X 1UKTA 3LSCA 1EWEA 4F9JA 2ZRXA 3FJLA 1ML1A 1H7XA 2DZBA 1RD5A 3LNPA 2D3NA 5REQA 1T0OA 1AJ0A 5AC8A 3BLDA 3T81A 3K1DA 4M56A 2EPOA 3AIEA 1GTEA 7TIMA 2QCEA 4ONVA 2DW7A 3CT2A 1S2VA 1K8YA 3AIBA 3WDHA 2ZZ3A 3GC2A 3ZYZA 2VFEA 4Q4RA 1U5JA 1NDYA 3S1WA 5BOFA 5PTDA 4X22A 4J1OA 2EPLX 1TTQA 1UA7A 3R79A 2OEJA 1XRTA 2OLSA 3PZIA 2Y61A 4BA0A 2DDXA 1ZP3A 3ONCA 3MZ2A 2GGHA 9RUBA 1UWUA 1A5MC 1O5QA 2Y89A 2DZVA 3AOFA 2IPFA 3S2JA 4ZTXA 4XZIA 2XHYA 1DQUA 5CC3A 4D9PA 3DC0A 2V2CA 4PODA 3B8DA 1U2YA 1EGMA 3G1YA 5JMUA 4UTUA 4URIA 3BDKA 4B3LA 7ENLA 1Q7MA 3W53A 3BMWA 3DHDA 1U83A 4C7DA 4F0KA 3LD5A 1BSLA 3GU9A 3INPA 1VLIA 4Y8EA 1WXZA 4RZ4A 4UTMA 1IZKA 3RX3A 3HPZA 4KWVA 4Y7EA 4QBXA 2FTPA 1OGBA 4BFAA 5T91A 2J4GA 1C3FA 1ADDA 5FI8A 5LIKX 1W1IE 2BVWA 1OABA 3TC3A 5FL0A 3S2MA 2FB2A 2NLYA 1CXIA 1R9ZA 5C9ZA 2OMAA 4LT9A 1CPUA 2NZLA 4WHBA 1A5CA 3PPGA 4ECLA 4F4RA 2MUCA 4JCMA 1H61A 2J8GA 3RJYA 3PF3A 2YA0A 2NVCA 4W89A 2PUZA 1RV8A 1SO3A 3CUGA 3UJSA 4DAFA 1ZHAA 5F1UA 2Z24A 1PB0A 3G0SA 3VI2A 3N2XA 1EJWC 3WK0A 2PDYA 2XDFA 4H4IA 5I3DA 4BI6A 3PJTA 3QY6A 4HZ7A 1GQLA 4CCEA 5I07A 1NDZA 3OO2A 3UT0A 1F3WA 2X0YA 1CIUA 4LH8A 3ISIX 4Y96A 2E7FA 4QS6A 3WJYA 1J96A 1FVPA 5DEZA 3KEHA 1R3SA 2ADAA 1ZENA 2QGHA 3GFYA 4D1JA 3N19B 2V9DA 4QJ3B 1H1YA 4MWAA 1G01A 3AMKA 4UTLA 4JTAA 5I6SA 2ZRWA 3TWAA 2FVKA 2EG8A 1V6VA 1XUZA 3DOPA 4OBSA 3MQTA 3MUIA 1VP5A 2EPKX 4NNCA 4OBRA 4KWSA 4GACA 4O0ZA 4DJFD 5E9XA 3U7BA 3VZXA 3WELA 1F74A 4O1EA 1W9DM 5FAGA 2ZTKA 1EF2A 1TFVA 1BTMA 3TW6A 2X16A 5I00A 3VDBA 2VQTA 1DKWA 5A6SA 5DANA 4D6GA 2QIWA 2FMNA 3QC0A 4UTHA 1W6TA 1WDQA 3R5EA 2O9RA 1ZGDA 1DJHA 4KESA 1XIDA 2W0UA 2PDCA 4J3UA 3WQDA 3PZOA 1EHNA 4OECA 2IKHA 4KWUA 2QPXA 2PA6A 1KBKA 2XFRA 4DVOA 1K9DA 4XD6A 1XH2A 3S1UA 3DDMA 4UTFA 5C6MA 2YCJA 1H7RA 3TROA 3DFSA 3RNDA 8XIMA 4RZBA 2ZZ1A 1G9HA 1BXBA 1QAPA 4B9ZA 4M7SA 2XH7A 4M7TA 1XCXA 1NF7A 2E8ZA 3M1ZA 3WDRA 4IQLA 4DJEA 3T9PA 2HPMA 2R94A 1G7UA 5ABEA 4BWLC 3M0IA 5E0FA 3L4TA 3ARZA 1AK5A 3EX6A 3GR8A 1OC7A 5DN1A 3N4FA 4C5YA 4REQA 4X60A 2VFFA 2XVNA 3DERA 4AF0A 4AMCA 3AQUA 3S8HA 2ZVRA 1TPEA 5C54A 9XIMA 4OHQA 1VRDA 2X40A 4U5IA 1KFBA 4HHMA 1JUEA 3W9ZA 5DT5A 2NV9A 4DZIA 2O4QA 3W1PA 1W1ZA 2R1KA 4B15A 1QNSA 3G1SA 3BOXA 3SSZA 2C15A 4IH3A 1SW7A 1E40A 3TR9A 2J7FA 4Z42C 5BMWA 3G77A 4C6IA 3M64A 4WK9A 4H6RA 3ATZA 1SVDA 3E6EA 4F0LA 8XIAA 1HZYA 1R3YA 2CHOA 2GVEA 4V2XA 5CC6A 1EXBA 1CXFA 2NSXA 3TDFA 2W61A 2ZC1A 3DGRA 1IF2A 4CNSA 1ELSA 1J01A 1Z42A 3HGOA 4UQCA 4ZB2A 3OHMB 2DY3A 1VS1A 1K8CA 3G5EA 1UBSA 2H90A 5EB8A 3V0SA 5LSMA 2OZ0A 4M6PA 3W29A 3H2NA 4MUZA 2PF8A 1GVIA 2YR1A 1BQGA 1CECA 1YBQB 2E67A 4UNLA 5C71A 3MWCA 4JTSA 3SI9A 5FKYA 2IKGA 5A5WA 1DTUA 3MBFA 2D22A 2XISA 2QJMA 4DUVA 3S83A 1J11A 2FHCA 2KAUC 3DHFA 4AD5A 2X2GA 3N04A 1REQA 1H0IA 1YQ2A 2FYMA 2PD5A 4GY0A 4PSPA 3ITOA 3WZ0E 5DQPA 5GNYA 4BHYA 3UY7A 2CBJA 1IR2A 3O16A 2C1HA 3MV11 4Z08A 1KM3A 4O50A 2GGEA 2CERA 3M7WA 4GY7A 3GLCA 1LM1A 3G3MA 2PTZA 1GKPA 4NYUA 4PBEA 1PBGA 4HIBA 4L64A 2QF7A 5BXPA 1AL7A 3ONBA 3IANA 3E2QA 4UXDA 4QLKA 4C1NB 3PAOA 1OK4A 2ACQA 5CGTA 2QVHA 3AZRA 1IWAA 3O0FA 5BXRA 5MKGA 4M3PA 4Q3MA 3TW7A 1XD0A 2OT1A 3WLOA 3BTNA 3V5FA 1AL8A 3F4WA 3VA8A 2FB3A 6TIMA 1OIMA 4R53A 1Y8BA 2I9UA 4WDTA 2Z28A 2PRMA 3QKEA 1Q6FA 3WF1A 3ZSSA 2B7NA 3TCEA 3ZM8A 1JCXA 3GKAA 3UPBA 3SRFA 2GGIA 1TQXA 3W85A 3WQOA 1P0BA 5IM51 3COTA 4MWAE 1X1NA 4W7VA 4FA3A 3UG4A 2QXWA 3KOZA 4JHMA 4S3KA 1GPFA 2V3EA 1LL4A 1OY0A 3GWQA 4LUJA 2V5LA 5FJTA 1ZNNA 2P10A 1FWWA 1F5ZA 2R8WA 4E4PA 3AJ7A 3CPUA 4F0RA 4Q4SA 4JEQA 4YYFA 1QO2A 5L6UA 4AD0A 3K30A 2ANUA 1VIWA 4IJBA 3AO0A 3C56A 5A8QA 1DJQA 1XQLA 2BXZA 3GHSA 4RNFA 2GDUA 4UBPC 1RVKA 5CG0A 3WK2A 3UG8A 3SY8A 4GUFA 4D6DA 1YNPA 1PKNA 3W38A 3PC0A 4L65A 3ATYA 4JQ1A 1TPDA 1VPXA 4IF2A 4MB4A 4JXCA 4ROPA 4UMAA 2X41A 1F8IA 4J2PA 4PUMA 5J5RA 1GCYA 2E1DA 2OGYA 3SR7A 3ZXWA 4DAIA 1M65A 6ENLA 4YTRA 1AJ2A 5REQB 3BL3A 3AUOA 2J7GA 4JKLA 2Z1SA 1QNOA 1I2NA 2WB5A 2XYLA 2C14A 4BR1A 4DHGA 5LNRA 3SGZA 3NQ2A 5HNRA 1BYBA 5MF5A 4RCXA 5C5YA 3AIWA 4Z1DA 4YMZA 1IEXA 3WQCA 2QJNA 3NR0A 5G2WA 3WNPA 3LDVA 3H4GA 4GC4A 1W1PA 1L8PA 3A5FA 3EB4A 4WLCA 3TOPA 3W87A 2G37A 3GO2A 2HNHA 1NARA 3QV8A 3CEUA 1ALDA 3TEVA 4GH3A 4IP7A 3WQEA 1QHPA 1OVDA 3AMGA 3KAOA 2ZC8A 5A8OA 1IE7C 3RM9A 5D2YA 1K3UA 3FJ6A 3P67A 5FEZA 4RL3A 3UA3A 1TPUA 4IUOA 2ZA1A 3T08A 2SFPA 3EB2A 4JTQA 3CH0A 1MFVA 1JL8A 2YL5A 5D9MA 3FYOA 3LZ3A 9XIAA 4PCPA 1CT5A 1JYVA 2EPMX 3NQDA 3OBAA 4Q8VA 2G5WA 3KP0A 4YJ5A 3LERA 2ZE0A 4DLFA 2FMOA 4GYPC 3W27A 1OFQA 2QF8A 2JIWA 3GZ3A 4XQ6A 3SUUA 1YE4A 4U2YA 3IJ7A 1TKKA 1PHQA 1X6NA 4JIHA 4O53A 3P60A 1EC7A 4JIQA 4IIDA 3CXOA 2PDKA 3UWZA 2Y8KA 3AFBA 1DYSA 2YXXA 4RNIA 3E0FA 3B0PA 3NYZA 2CLEA 4CEUC 3DZ1A 1XG4A 4IIFA 2J66A 4JQ2A 1JCLA 2ZX7A 4HOXA 3T2OA 1E9YB 1Q5MA 5C2CA 3WFZA 5D37A 1RSCA 3VK5A 4HJFA 3PULA 4AWUA 5D2XA 1JXKA 4EPDC 1FQ0A 3N2OA 3F5JA 3SY5A 3OIHA 4GOAA 3GDRA 2AMGA 2GUBA 4X0NA 2JFEX 3KXQA 1WKFA 3URBA 5U4NA 3HV9A 1O66A 1LYXA 1HJXA 1QBAA 1SM9A 3IV8A 1XH0A 3BICA 1R2SA 3OLDA 4IG2A 2XIMA 3B9OA 4DYKA 2EPHA 1UUMA 3I10A 4FF5A 1EIBA 1XYBA 1XH1A 1FWHC 3BCJA 1V79A 1RP8A 3C2OA 2VKZG 4CN1A 1JDAA 1LLWA 1W8GA 3UCDA 4C6EA 4Q8OA 3FEQA 3PZGA 1HVQA 2WSYA 1VJIA 6CGTA 2YSWA 5AHNA 1X1ZA 6ALDA 2CESA 1CLXA 2Y6ZA 2QUVA 4A2RA 3TC7A 4ICMA 5C7VA 4GJIA 3W75A 2WMKA 3E49A 3BPWA 4DNHA 4HMCA 4O1CA 1YDOA 3GZAA 2WZEA 3OZYA 1BKHA 3CUJA 1JG9A 1EP1A 3B8VA 4BY3A 1A53A 1TTPA 4CD4A 1KRBC 3SFWA 1GEHA 4KF1A 2E5BA 4YVVA 2WNNA 4WD0A 3OYXA 4K36A 2VD8A 3UXKA 1EKOA 2E9LA 5EMKA 4B5UA 1WA3A 3M0KA 4NZ3A 3LCLA 1SW3A 4N4QA 3NJ3A 2VGIA 1CXHA 2UY4A 2IMRA 2VCAA 1DJIA 2B7QA 4IQJA 2A4AA 2C19A 1EO7A 1QOXA 2QAPA 3MSYA 1KRCC 3WUEA 3EOSA 1KGUA 3PPHA 3MHGA 4Q4MA 2Z26A 1SO5A 4IXXA 2PLCA 2VCCA 4G7EB 1IEIA 1XIJA 3AS2A 1O5KA 4Y90A 3QXBA 5HNUA 5D9NA 3VMOA 1VEOA 5ABFA 2WYSA 2V3DA 1UQYA 3E1F1 2AQOA 3W7RA 4E5TA 1UMLA 3ANUA 2WO5A 3KDNA 3UVAA 4A6GA 3A4XA 1LBMA 4GI8A 2HCVA 1UUQA 3BUVA 1XBYA 4RK8A 4XZNX 4NAFA 1AODA 3WUBA 1D7KA 3DESA 3ZFHA 1W8SA 5AZ1A 1TV2A 4ZQPA 4H9MA 1E9IA 1X6LA 2GUUA 4Q8MA 5IBXA 3HB9A 1KGWA 4JTRA 3N2MA 3HIJA 1M68A 3HOJA 5FJRA 1LZOA 2Z7KA 4US6A 5CSRA 4BCEA 3R94A 1P7TB 1WKDA 3T1GA 1YIXA 3MDUA 3P62A 1VPQA 3MC5A 3RRXA 3BLKA 1EJXC 3G0XA 1RXOB 3QLDA 3G6LA 1A3HA 1GOIA 3W26A 3Q58A 1OZMA 3CHEA 3A9BA 4UFKA 3RU8X 4UTWC 2XM1A 1K9FA 1XKJA 4XSMA 1FWJC 4HOZA 2BY1A 2JE8A 2ZVIA 4UCGA 4PGLA 4QFUA 4EF8A 3RO6A 4N6EA 3MKVA 3W22A 1MEIA 2OX4A 1EL3A 3C8NA 4PN2A 1IYXA 3VC6A 3D47A 2W63A 3T55A 2X8RA 2R1PA 4JTCA 2PZNA 4TV6A 1FTXA 1REQB 1SR9A 2X2YA 3W1QA 1TV7A 1JI1A 2XZ7A 5G4HC 3PNZA 3FJNA 5CPLA 4LV9A 2J7CA 3DIPA 1AMYA 3AZTA 4ASTA 4FALA 3ZJ6A 3PB0A 4YLWA 2D2JA 1BYAA 3GUGA 1TG7A 4O17A 1EJTC 4O11A 4ERIA 4WKAA 2PDMA 1XYFA 3NQ6A 3P74A 3NZQA 4DBSA 3LTSA 1Q6EA 7A3HA 4KFPA 4DO5A 1SR0A 2XWEA 1PX3A 1DBTA 4HN4A 3BW2A 2INFA 4PMYA 3HM7A 3E5PA 2WLYA 1UZ1A 4GHRA 4O1DA 1TA3A 3KS5A 1DVJA 5MKGB 2AQWA 1UZHA 4A3RA 1YW1A 5F4XA 2OOGA 2G3IA 4DJDD 2CU0A 4GO8A 1ISXA 3RMEA 1KTCA 2ESCA 4XV0A 2VENA 3SRKA 3G8EA 1V0NA 4ERAA 2Z29A 1UD5A 3VYLA 1JCJA 2XGZA 3VCCA 2QUUA 2WQDA 2FTWA 3AMCA 2FVLA 3EA3A 3W6YA 3OG3A 3WMBA 1L0PA 1EC8A 2XVKA 4JKKA 4YTSA 3RHGA 4S3AA 3BSMA 1CENA 4YHGA 5B7ZA 1QWKA 3GXDA 4JY9A 2OLAA 3NOYA 2B0MA 1HL8A 1PKYA 4K1WA 3L66A 3T0TA 3WMLA 4FZIA 2CEQA 2QDGA 3VVGA 2E77A 4DWSD 1FWGC 3I3DA 4JTTA 1XICA 2ICSA 3LM3A 2J13A 3UGRA 2GK1B 3W7LA 4OFCA 4Y6GA 5HUOA 2QUMA 1XX1A 3BGGA 1S5NA 1XIEA 1C92A 5LNSA 4QROA 3QH2A 3ITTA 3P7YA 1T99A 4GNJA 2QDEA 4M80A 4OQVA 1BRLB 1ZL1A 1E3XA 1TJ2A 1UASA 4H9XA 1KBLA 3GSMA 1E3ZA 1TIWA 3CPRA 2WVVB 1FCVA 2L5HA 2ALRA 2EBNA 2Z4GA 1PIGA 1FDZA 1XI3A 4I9MA 1TV8A 4LU0A 2CITA 3ZQ9A 4FI4A 6TAAA 1EJSC 1HL2A 1W0MA 1O5RA 2CKRA 1BGAA 2JEPA 7PTDA 2PDNA 3IV3A 5T8GA 3UNDA 1UD2A 3LHYA 4NJGA 5DFAA 2V0TA 3MUY1 3AHTA 2A7NA 4OJYA 3O07A 4Z1YA 3RDKA 2FGLA 1M04A 2PDXA 1A49A 1L6YA 4LUTA 1XDMA 4GUJA 4MNLA 4B4FA 3OPSA 4J40A 4GXMA 4IGSA 4OUIA 2OWWA 1ME8A 3NPWA 4GWEA 4CGTA 3UWYA 3WMCA 4L7ZA 2CC0A 4E2DA 1V4YA 3VX0A 1CBGA 2BZNA 3VFCA 4GI9A 5JUVA 2QCDA 4BEQA 3BK0A 4GVIA 4M1RA 3RAOA 1PVNA 3N2CA 4MKSA 5AVHA 4PMQA 4H6KA 4WOZA 2PGRA 3UZJA 2DT2A 4EANA 4GFSA 5FAJA 3F03K 3VDHA 3LPOA 3XINA 4PRTA 1VC4A 3ERPA 1MSSA 5G5IA 4US5D 4AZ6A 2D73A 1DQWA 1EF3A 2DV0A 3CTTA 1IV8A 4DJFC 3ORWA 4D1IA 1J10A 2INEA 2OO0A 1S1RA 1T40A 3LRLA 4ZO8A 2GYIA 1Q65A 2Z1BA 2DVTA 3JW7A 4XO7A 2DGAA 3BSHA 1LG1A 3SUVA 2F2KA 1UKSA 3SJ3A 4W84A 4DI8A 3W0KA 3TAKA 3EOUA 4N9CA 5EU9A 1I8JA 3NVDA 1NWRA 4JKMA 3E2RA 3MMWA 2NQ9A 4LV4A 1KFJA 4H9VA 2UZ9A 2BOGX 2XSBA 3V0UA 1M41A 1MXGA 4AVOA 1FCBA 3CO8A 3E2SA 5EMLA 1TQJA 3MVIA 3DHUA 5DT7A 3W7PA 1SJCA 2FGZA 5BROA 3G1XA 1M01A 3WX7A 1JDCA 2ZRYA 5A94A 5CAKA 1IQ8A 1M7PA 4PUNA 4IG2B 1LWHA 2WCSA 1ZAIA 3SUSA 4LB3A 4GZ7A 1DJWA 3GXNA 4ZZ9A 5F2GA 1ZRQA 1ZU8A 2NW0A 1ONEA 2E9BA 2V82A 4NU7A 4E0CA 3VABA 3KTCA 1MNSA 3KVLA 4QLJA 1SZNA 5DELA 1G1YA 4TR9A 1EA0A 1C7SA 3AICA 3DC8A 1RD6A 4F3HA 4M19A 4K37A 2OZ8A 4RLIA 5I2UA 4AIOA 2WHJA 2J75A 1TPVA 4I9TA 1ZB5A 4WDXA 1UW9A 3G1FA 3VE7A 3LPPA 1R6WA 1DWGM 2XIOA 4JN7A 2HVMA 1BLIA 3B4UA 3RRAA 2DU2A 3KRSA 1X98A 5HA7A 4PTNA 3R11A 3K4WA 1BVWA 5CZJA 4K2SA 1X7FA 1B3ZA 2CHRA 1XSKA 4MM1A 2WVSA 3LLFA 1R8LA 2PI6A 4W88A 3TN6A 2HZGA 2W67A 4JTFA 3QW4B 3UJFA 4MOZA 3W7MA 3SADA 3PTQA 4M5PA 3UW6A 3KZPA 1QNPA 3FNDA 3R13A 3L4YA 2PDBA 5IXEA 3TWBA 1OCBA 1HKIA 1S2WA 4W87A 2DT0A 2YYUA 1V51A 4Z1CA 4PMJA 1W9PA 4HVXA 4ZSTA 4QSHA 2PU0A 3QZEA 1J12A 4QXIA 4KGJA 1A5UA 1GOMA 4HYRA 1TX0A 3HZ3A 4PUEA 2WJFA 1B3VA 3ABZA 1JZ5A 4P7NA 1KB3A 3LV6A 4QLLA 3CO4A 4GRSA 4QG6A 4H9UA 1F73A 3GHRA 5IHSA 1NP2A 1POKA 1XDJA 4L9YA 1HN1A 4IPNB 5FIPA 3CMJA 1EDTA 3DN5A 3B04A 1JCMP 5EMUA 3W7HA 3E0VA 4BQ2A 2GWNA 3BMVA 4F2UA 3SW6A 3NM3A 4G8TA 3AUJA 3EX3A 5F2LA 1NSJA 4CU6A 3G24A 1OCJA 3QR0A 3R12A 2YB4A 4PH6A 3EXSA 3WEMA 3S5YA 1XLDA 3THCA 2XJ7A 3V36A 3TKFA 1LLOA 4G6CA 3A3XA 5A6AA 4TV5A 1NDWA 1JUKA 1FKXA 4XZLX 3LMZA 2VELA 4Z0JA 4PTDA 4YWSA 2CW6A 1JZ2A 2P8CA 2WZMA 4EKJA 3WJSA 1KQZA 3OU8A 4I6VA 2ACSA 3BZJA 1RK6A 1EB3A 2VC6A 4WY0F 5I0DA 3IUIA 3GH5A 4AAJA 4O4WA 3D46A 3CT7A 2V5BA 3H6OA 3T0CA 5KZEA 4LVFA 2D0HA 5G1MA 3P0WA 4FNSA 5ABHA 2CWNA 3DUGA 4EACA 5LXXA 1A5KC 1PCKA 2A6NA 3AIUA 3OZOA 5LHEA 4FIQA 4YHEA 4UMBA 4KCTA 4QSFA 4D6HA 4JNZA 3LLDA 4LNCA 3SSJA 4FP1A 3DFOA 3NNTA 4JEJA 3GVRA 3N11A 1W5PA 4ZO6A 1E0VA 3G1HA 1AH4A 3CUIA 2V3GA 2PBOA 1H49A 4HPJA 2A5HA 1RA5A 1BSIA 1PHWA 2NT0A 3HG5A 2IW0A 2V69A 2A3LA 3V35A 1SGJA 3NQMA 1ONRA 5JH1A 4MAVA 5C7HA 4HKPA 5TD4A 1HFBA 4GG9A 3NGJA 3BQ6A 4FNRA 3I7QA 3CHDA 1VFTA 3QKZA 4I3GA 3QOKA 3IGSA 3QLLA 2E5CA 1E4MM 2MNRA 1J18A 2I5QA 4CNOA 3DECA 2BY0A 4CU7A 1ZP4A 4I8YA 3EWXA 3CL7A 3OP2A 1F3XA 1POJA 1KV5A 5K4XA 3RO8A 1RUSA 3M0MA 4P7RA 4AZ5A 3PFRA 5G2HA 1UPMB 3O1NA 3ARTA 3TSDA 4RW3A 3CZEA 3B8IA 1WBHA 3WD1A 4JZ5A 1OG0A 3MV01 1XSJA 1EWDA 4J3SA 1P6WA 1DJYA 4WDUA 1E70M 3ZLGA 5JH2A 4IGMA 4GQQA 3OVRA 5AC5A 1UQZA 3SQLA 3MMDA 4A22A 1MDRA 1YPFA 1JZ7A 3MKKA 2OYKA 3KFTA 3W83A 2GUYA 2OSWA 4AY7A 4L4LA 3DFYA 4XTIA 1DTNA 1KLZA 1PTDA 4P8XA 3E0LA 3GAYA 4MB5A 4F0MA 2BHYA 4Q6XA 3T2PA 3UQNA 4K3ZA 1V3MA 3A64A 1J0ZA 3MMTA 3WLSA 5F2MA 1QW9A 4D8LA 1MZHA 1SJAA 4PUUA 5LGXA 3SN0A 1CZ1A 2P0OA 1XPGA 1PIIA 3S4TA 2DH3A 5CBIA 2EQDA 1OZQA 1F07A 2PPGA 3UGVA 3VO0A 1FCUA 1I1XA 3PZNA 3TMLA 2R1NA 4IL2A 1QPNA 3TQPA 4DPPA 2CNCA 4FXJA 3WF4A 4F9DA 1OWQA 1JCNA 4MPQA 3PPCA 1LRQA 1JPDX 1I2QA 3GU2A 4PCTA 4GABA 1J0JA 1Z6KA 4PL2A 3I3BA 2ODOA 1O95A 4C7FA 4AEOA 3ZT6A 4HPNA 2QT3A 5HPCA 4Y9PA 1C8QA 1D9EA 3QFWA 4GZIA 4JYEA 5CXPA 3MKCA 2GQAA 3S5NA 3EPNA 4R3UA 1TE1A 4LUTB 3U3HA 4MADA 4ZENA 1U1UA 2H3BA 1XIBA 1U33A 3PB2A 3ZO9A 1TVPA 3TJIA 2XIQA 4PUJA 4ZA0A 3OLEA 3GX9A 1UP3A 1GKQA 2W92A 1QOQA 1EYEA 3U5YA 4FEZA 2QUNA 3S1VA 3VCNA 4NL1A 4NZ1A 1I0BA 4RE4A 9CGTA 2Y4SA 5TBOA 1GOXA 1XRSA 4FXSA 4NT0A 1SUXA 1Q2SA 3OJGA 4W5ZA 1THFD 1XLCA 1XLIA 4I9JA 4X61A 4DM1A 3CIVA 3O06A 1JZ4A 2BB0A 5EFFA 4D72A 4GUHA 3M0JA 3C8FA 5GJMA 4Y9NA 1EQCA 3CLWA 4V33A 2GGJA 1BD0A 3CQ0A 4TIMA 3I65A 4JTJA 3OYZA 3ES7A 1KCLA 3L65A 3I6TA 1ZUAX 1ZTVA 5A69A 2OVLA 4O10A 3B0VC 4A3UA 2BSLA 3D5HA 1LROA 3MO7A 3F4DA 1W3TA 2FKPA 2FPYA 3VXGA 3ZWSA 3LCHA 3U0HA 4IFOA 4AXKA 3GYCA 3MMUA 6REQA 1NM9A 2HVOA 4S3CA 2ZDRA 2P0IA 1CWYA 4JL1A 3GG8A 2RHGA 4ML4A 2J8TA 1E9ZB 1Q6LA 2CLOA 4GIAA 1D8WA 4D6IA 4H6QA 4H1ZA 2HROA 4HMDA 1UWIA 2I5GA 4TMCA 1R87A 1EOKA 3M5XA 2DJLA 1H7WA 4S23A 1BHGA 3EDJA 2ZADA 3MCMA 1B3OA 1V0LA 2ATSA 3MYPA 1V02A 1P6CA 3S6OA 3IGHX 1K8XA 2Z1VA 1OFAA 1AD4A 1G4TA 3CWNA 2D0FA 1C93A 3SRHA 5D2VA 3TTSA 2ZDSA 3L7RA 4E38A 4MIMA 1OX5A 3MWAA 1V03A 1GQIA 1EOMA 2XH0A 7REQA 2VX5A 4JTUA 1DIOA 4DZHA 1GQJA 3AXIA 3GDKA 4IM4A 3VFLA 2PDQA 1J6PA 5DXXA 3IUDA 4BF9A 3TUUA 1ICPA 4QNWA 3QPZA 2XSXA 4RV3A 4CCZA 1U5HA 3W84A 3T8LA 1UR0A 1L6SA 1MXSA 5KMYA 4DN1A 1UWSA 1IXOA 2JKAA 3CC1A 5IOBA 5FJOA 3GDBA 4HA1A 3L2MA 1PUDA 3KCLA 3F5KA 1TCMA 3DG3A 5IFTA 1ZLPA 3W72A 2GDVA 1WCGA 4Q8WA 1NFBA 1WZLA 4M51A 3KLLA 5AC6A 3H54A 3UJEA 1E1FA 1B3XA 4KCVA 2VX6A 4J3ZA 3TNBA 2JQXA 4TO8A 4NZ5A 1I4NA 3ITCA 2GGGA 3HQOA 2ZUVA 5FA5A 2EKGA 4PC8A 3JRKA 2VL4A 3RX4A 1ISYA 3GXFA 2OPJA 4JTHA 2J88A 3VUSA 3SCPA 3K4AA 1QW7A 3PN8A 2WVTA 3NDOA 4JX4A 3W71A 2GFTA 2VEFA 3L4VA 5A6MA 5LIWX 2XVPA 2C3ZA 1OYBA 3KX6A 3C3UA 5FL1A 3QY8A 5BRPA 1R85A 4W8LA 2D20A 1JGMA 4R7JA 4H7VA 3OIXA 3EZ4A 5A1AA 4H8UA 5JBDA 3G1VA 1NDVA 1FRBA 2Q3OA 4GCXA 3H7UA 5FCZA 5GQBA 1SU5A 5E5CA 3W7KA 1V0KA 3CHFA 2BVDA 3GE7A 3NQEA 4GMEA 4GLEA 2P88A 2XH2A 1TZZA 4LGXA 4LF2A 1DJXA 1A3WA 1TMLA 2NVDA 2W62A 2OEMA 1TPWA 2ISVA 1VEPA 1XS2A 3AYTA 3VDAA 4Z2HA 2P1FA 2VOTA 4JN6A 2E09A 1JPIA 4QR6A 3BG9A 4LBUA 4KBXA 5GVJA 3N1AA 1NWTA 2VR2A 1XLJA 3FYYA 3TONA 2NQJA 1UZ4A 1KM6A 3QZ6A 2G95A 1BWKA 1P0EA 3AMDA 1F7BA 4S1FA 2X0SA 3CU2A 2VEMA 2G4FA 1QRQA 4AW7A 4L56A 1FA2A 2VC5A 1RBOB 2FZ9A 2O7QA 3ZSTA 1K70A 4JTEA 2Y5EA 1OD8A 4F0HA 3H12A 3IPWA 4HYWA 2AOSA 2WSQA 2QCCA 3N73A 2QCNA 1XIGA 4EE9A 3DGBA 3UCQA 1PAMA 4AX7A 4L4OA 1JI2A 3A6OA 3NQBA 1CYGA 1M9HA 3W81A 4IIGA 4EPKA 1E4LA 3ARYA 4MY1A 1F3EA 4WF7A 4UQAA 4QRNA 4OTKA 1W5QA 4C6KA 3MY9A 3U5UA 1ZBVA 2XU2A 1TUFA 1VF8A 3CQKA 1J0IA 5ECUA 4DWSB 3NZRA 2PDIA 4AIBA 1QI5A 2P3EA 3AWNA 2YCLA 5E6YA 1RCXB 4YCPA 4DWSC 4CEXC 4V27A 1QVBA 1KA9F 1UC4A 4J9JA 4JBRA 3B97A 1QWGA 3NPXA 4IUGA 4R5EA 4AFYA 1L6GA 4NRRA 1LT7A 1GW1A 2QMKA 3CV6A 1XLMA 3KBVA 4CQBA 3NEHA 3RXZA 3CTLA 4UUIA 4X3ZA 2F61A 1K9EA 1MVYA 3TA9A 3KL3A 2NQZA 2XH4A 2YXGA 1UIOA 2E0PA 3KCJA 3M6DA 3LRKA 3IACA 2G3FA 2OODA 4XWUA 1QNVA 2DSWA 1S1PA 2XGBA 4HPHA 3S2NA 4QS5A 1J9YA 1V02E 2H8ZA 5LHFA 4O14A 1XLHA 1ME9A 1EFZA 1LBFA 3W7OA 5EMYA 4KWWA 1J5TA 1UH4A 3EB3A 4RE3A 1QHZA 3B9NA 3TLQA 2RJGA 3NOEA 1H0GA 1GVQA 2PE4A 4KRZA 3WBYA 2VZSA 1V6WA 1WQ5A 1GORA 3M0XA 2CLLA 1X1OA 1SZFA 1RJPA 3QBUA 4XBKA 4CQAA 3UETA 5F4WA 1EDQA 2PTXA 3MUAA 3ZJ7A 1PSCA 4XUYA 4HA0A 3FSUA 2B7PA 3NUKA 2XVLA 4QJ4B 1QOPA 1JQXA 1GK8A 2VP8A 2PGWA 3VX1A 3GXTA 1GKRA 1UP2A 4NJIA 4Y9OA 1ZJHA 1VGAA 2DH2A 3KL0A 4N7QA 1E5NA 4S38A 3WD2A 4QTGA 1Y5XA 3B8UA 2AGTA 4RDYA 2XZ9A 3VKDA 1I1WA 4CUCA 3K5XA 4GY1A 1WE5A 1H09A 2NV1A 1JUBA 1OC6A 4LS1A 4LCRA 4EOUA 3UA4A 4CD5A 5CBJA 3F2DA 2GDQA 4L6HA 3KE0A 3BOFA 3MB9A 3W1NA 1ZFJA 4PEKA 1OX6A 2X1SA 2CZ5A 2YDSA 1B31A 3TU9A 2VHLA 1V08A 1RBLA 3W1RA 1VBGA 1YDYA 3VTRA 3H2OA 2IXUA 4U5KA 4C1KA 4OU1A 1MW1A 3P84A 1O6IA 4FHAA 1C9DA 3RM8A 1M7JA 1B4KA 3GTHA 2HNEA 3JR2A 1RK5A 3N15A 3LHWA 3URAA 3GH4A 4NNAA 3H22A 2V5KA 1AJZA 5LIXX 3QZAA 2ZA2A 3VIKA 1E6SM 3AMLA 2E68A 4MAZA 4C6CA 4JQAA 4RUBA 1N8IA 1FWNA 4PTXA 1KFLA 1E1CB 1VLWA 1V77A 4PRWA 3GH7A 3NL5A 3W01A 1R0MA 4DY1A 2A3EA 3EKGA 2GJXA 1WZMA 4L1XA 4FR1A 2RJHA 4ZB0A 3TXVA 4DXXA 5K2ZA 1ZSXA 4ZVJA 4YTUA 3VUPA 4A2SA 4UWMA 3NEVA 3ZMRA 3M0ZA 2C7FA 5KITA 2UY2A 4E6MA 3K8LA 2EAWA 3FEMA 3RCYA 5EMJA 1HKKA 3T09A 3C86A 4K68A 1WZKA 1GVRA 2WXDM 3CZLA 4BQ3A 5HNTA 4H8VA 1EJVC 4ZOBA 1XM3A 4O54A 4GA8A 2DJXA 2A3HA 1TPFA 1Z41A 5D30A 5GJNA 1XJBA 2VDIA 3GB6A 1TTIA 3ZOAA 1AFSA 2RDXA 2Y24A 3B8WA 2ZUUA 4CVUA 1OFDA 3IEBA 4FS9A 3QYSA 3TFCA 3UPMA 4N0RA 1TJPA 5EFDA 2DZAA 1ODZA 2ZXAA 3WDPP 4XKYA 1ME7A 1VBJA 1W5MA 2HQAA 1GUVA 3VNJA 3C2YA 1FWIC 1CB7B 1LG2A 2IXVA 1XWYA 4GVFA 4H00A 3AYVA 3U57A 5H91A 2H9AA 3B0UX 1JVNA 2HJPA 1RPXA 3D3AA 1UWTA 1YEYA 2C6QA 5KSWA 3LA4A 4W9TA 3W76A 1EZWA 4IPJA 3L0KA 1I2OA 3HGRA 4PYSA 1YTEA 5A6JA 3GG0A 1YXYA 2J9XA 1G4PA 1KWGA 2RGLA 2ABAA 2F2HA 1W9BM 1T41A 2EHHA 3C5QA 3A3HA 4GZEA 3FAXA 5D2WA 5IRPA 2Z1WA 3E9AA 4CD7A 2TRSA 3BVJA 1GHRA 1T6MA 2GQ8A 4KQNA 2AGKA 5AHMA 1W54A 1YXDA 4O13A 4NX0A 5HJYA 1MW2A 3CYVA 2D2GA 3TTQA 2DUXA 4OGZA 3B0YA 3SCRA 2TSYA 2VVSA 2OQLA 5D04C 1UD4A 4O28A 5AYZA 2X05A 4ROQA 4DJED 4MLRA 1G0CA 4HK7A 1H50A 1TVLA 4UTKA 4W86A 2I5IA 3W7DA 1VFLA 5H8PA 1EIXA 3WBXA 3VDCA 3VIHA 3S9IA 1N7KA 5BNKA 1B57A 3OHIA 2ISSA 1LQ0A 1E0WA 4LAMA 1Q7ZA 2QYGA 1K7EA 1NVMA 3U2CA 1AW2A 1LDCA 4DBDA 1LCOA 5HK4A 4H9ZA 1GQKA 4Q33A 3S42A 3RLHA 4MJ4A 2WHMA 1LOQA 3LY0A 4FR6A 1HKJA 3LM7A 3U4AA 3O63A 3OQ8A 3PWIA 3E96A 5C2XA 2B31A 4NUWA 1GVYA 1KR1A 1X8FA 4QGCA 4HTYA 4XK2A 1YPXA 1JNEA 4O12A 2PC4A 3DFPA 3NCOA 4NAEA 2OKOA 2C18A 3EWYA 3W82A 1FHLA 1TV4A 2QHAA 4LANA 4LRTA 3WJXA 1TR1A 4NILA 1VYSX 2C91A 5I3FA 3WF2A 3TR2A 2J24A 5G1TA 2V68A 4ZE4A 3ZR6A 3BJFA 4QDMA 3KUMA 3SGUA 4RZ6A 3S5OA 1GJUA 5A8PA 2ZXDA 3ARXA 1CDGA 4GIEA 1KM0A 3TFXA 4QDPA 3KP1A 1HT6A 2WNQA 3UFYA 4WJEA 3B3DA 3GNNA 6XIAA 1O5XA 2ZX8A 4DLMA 1M3UA 4GINA 1L9WA 3KOWA 3V16A 4QITA 4MJZA 3KRBA 2Y7FA 2O92A 4MJMA 1U22A 4ACYA 4LNYA 1FWDC 4HZ8A 1TPH1 3CS2A 4GK8A 2OB3A 2BXYA 3IJLA 3UESA 4P8VA 1XKYA 3CUFA 3LNMA 1PWLA 1K9TA 3BURA 2OR2A 4ML9A 4NX5A 3OGSA 1ZBWA 1Z69A 4B90A 1EEXA 3PZVA 1GWJA 4LF1A 1PYMA 5B7YA 3WLQA 4MNMA 1KTNA 1SPQA 4OV4A 2OELA 3N29A 5EA9A 4L80A 1E4NA 3O6AA 4ZQMA 3VNIA 3L4ZA 1JRBA 1HKMA 1LUCB 1WOAA 3GNDA 3IJQA 3T40A 3WK3A 2Q8ZA 3GHTA 2OJPA 5AHLA 2J77A 5D32A 3RJXA 4HPXA 2PDUA 3WY1A 4QISA 1XRFA 2O0TA 4HCLA 4R85A 4S3FA 5K7JA 3I4EA 4F2BA 3V75A 5HNNA 3AJXA 4ZXLA 3G0UA 4HCHA 2WCAA 3NXFA 5C8BB 1R30A 1XP3A 1KRAC 3PTKA 1XCFA 3AXKA 4WKFA 4Q7BA 4ZL1A 5A2BA 4LCSA 3K2GA 3WK1A 1AMKA 3PTDA 2QUTA 4JIPA 4POCA 2AQVA 1I60A 3W1MA 3FKKA 5C55A 1P43A 3M16A 5DCBA 4AZCB 3VE9A 3CHVA 4Q4KA 3NPVA 3CMGA 1HO1A 2XSAA 4GYJA 2HBVA 1G5AA 2BFGA 3VD3A 4F40A 4QAWA 3RIKA 1H5VA 4C6DA 3IJ9A 1K6AA 2Z1KA 2QEZA 2Z0IA 5LKYA 3L23A 4FOKA 4HSOA 4UQ9A 1JCYA 1L8NA 3LXBA 1V3HA 2EO7A 2E6FA 2YGYA 3RLUA 2Q71A 3M4HA 1PX4A 4O8RA 3TTOA 4ATDA 1VRXA 4DBUA 3WUFA 1W3NA 2VGFA 4QQ3A 3SCSA 2OZ3A 3EEZA 4MF4A 3UU0A 3W3OA 2BG5A 2VRQA 2ZZ7A 3B9AA 4B5WA 1TJRA 4US5A 1UD6A 1DE5A 1XW8A 3KBNA 4UTJA 2NXGA 5M03A 1RBAA 4KIRA 3VMNA 2XGIA 3GTXA 1GT8A 4ZXOA 4I7VA 2WKGA 4EPEC 2DSUA 1MW3A 3E3HA 3U6WA 2VYOA 3EOLA 1UA3A 4XD4A 1JZ8A 1VIZA 4R9OA 4XVEA 2OG9A 1K4HA 1M7XA 2HVNA 1EUNA 3TQKA 1ZJBA 4WEVX 4I5UA 1N82A 3VGGA 2QQ6A 2BOFX 3W28A 2VCBA 3BAWA 3VGFA 4HTBA 2ON3A 2VR5A 4KGLA 1P0NA 1CEOA 3EPMA 1HP5A 4KEZA 1F6KA 2VZOA 3CAQA 3LQLA 1AQFA 1S2UA 3FVMA 4FPSA 1XLKA 1RA0A 3RMJA 1GVEA 4GBUA 2YFOA 3GQYA 3C2EA 3NQ7A 3E74A 3EOEA 2JEQA 2VX7A 4LUSA 4WXYA 4GVHA 2QCHA 3BZGA 4FNPA 5ABGA 1NQKA 1QDSA 3BG3A 3UG5A 2F9RA 2Z1XA 5D9OA 3GRIA 4KWOA 1WAUA 4M6UA 4BF7A 2JF6A 3C2FA 2V81A 4WX2A 3EDFA 4OV9A 4LALA 4XAPA 2DT1A 4UNIA 2VX4A 3ID7A 3D0CA 1U30A 1ZJIA 2QNEA 2J27A 2GOKA 3T44A 3VIIA 4B9YA 1Q66A 3N6JA 5EY5A 1QK0A 2B81A 3GM8A 3OGRA 4H2HA 4ZQCA 4FXFA 3I7RA 4JQ3A 4PULA 5AC4A 2G50A 2V38A 2R91A 3EMQA 3CEPA 3V1PA 4F48A 2R6OA 2OO6A 1RJQA 2ZUNA 1TWDA 2E25A 2ZA3A 3L0GA 3MSRA 2JGYA 5D38A 1PPIA 2IUZA 3KL5A 4ZSUA 2QPUA 3M0LA 4IFKA 1H1ZA 3EEGA 3PR2A 5IFPA 5C0QA 2DORA 1V93A 1WXJA 2WLZA 4IPIA 2HXUA 1L6FA 4FX8A 3BW3A 4Q8NA 5DCDA 3NA8A 4C6LA 2GJPA 3KM8A 3G1AA 3QVQA 3T05A 4EWJA 3WBWA 3NSMA 3SRDA 3FS2A 1TWZA 3S1XA 1HJUA 3SBFA 5DLCA 4CU8A 2GJXB 3OTRA 1L2QA 3W1AA 3CZKA 1WKYA 1KBJA 3AC0A 4GBDA 4HA4A 3RPTA 2E6YA 5JIWA 1EO5A 3REQB 1HIZA 3CWOX 4UFLA 5DBTA 3THDA 1TWIA 1XYCA 1W1B1 2O9TA 2PRLA 2WM1A 4A3HA 2X7WA 5D8ZA 4IQDA 3P8JA 4C7GA 4FSAA 3BANA 3DCPA 1JRCA 1QNRA 3KBSA 2VFGA 4JX6A 3U2OA 5FESA 1O68A 1PTAA 3RK8A 4CNPA 1PS9A 3T7VA 3NAVA 1ITCA 3M7SA 3GG1A 4XIMA 4XKYB 4OOZA 4TVDA 3SQMA 4U4MA 4YVPA 3TTYA 1HG3A 1LBLA 1KKOA 3G3DA 5C9UA 1Z3NA 3TJ4A 4LTSA 2Y70A 3WMSA 4EPBC 4CNUA 1PKLA 1FP8A 1H7OA 2H9AB 3NPUA 2PLMA 2R1MA 2R9RA 3WQ5A 4HNVA 4ZEPA 3CL6A 3WD4A 3AHZA 1GNXA 1YE6A 1JDFA 3E12A 5DRCA 4JTDA 4DEFA 1R38A 5HINA 1KCXA 3FY1A 3I6EA 3S5ZA 3KRZA 1TYGA 4HD5A 3DFHA 1A5SA 3VAVA 1HGWA 1GGOA 1IT7A 3URQA 3FGCB 3GXMA 4K38A 1PEZA 2NUWA 3THQA 2REQB 3TYDA 1NJJA 1A47A 2HS6A 4ICNA 1BFNA 3ALFA 2J9YA 3PP7A 4NP7A 4EXBA 1AH3A 5BRQA 5M1TA 3QHOA 3WDQA 5BU6A 1GONA 5DMYA 4BQ4A 3S2LA 1G4SA 3GNOA 1JZ6A 4A8RA 3WLPA 2WC7A 3PSVA 4H9YA 4HHLA 2ZKMX 1TZ9A 5E0CA 3UYIA 2BVTA 4A29A 2QDDA 1ADOA 3SECA 1EDGA 5EL1A 3TCSA 2ABBA 1W5OA 4GQ0A 1JNDA 2JKEA 4M82A 5FEWA 2WMIB 3ARQA 2Z25A 4MB1A 4JTLA 2YA1A 3M0HA 3AZSA 1DIKA 2WJDA 4QG9A 4H6EA 3VGHA 1IEVA 3USZA 1RLCL 4WY0B 3WYZA 4S39A 4WUIA 3YPIA 3MZNA 1MQRA 5FOOA 4QQUA 1S5WA 3IVUA 4Z2GA 4HNUA 4PBGA 4WJ8A 4AHOA 1CXLA 2B4GA 2F6XA 1F9CA 1JPHA 3MP3A 3HG3A 1KM2A 1DWIM 1F4AA 3ABXA 4QX4A 5MHBA 2ZZ6A 2CZFA 5CJNA 3HV8A 3DENA 1FY6A 1H3GA 1KKRA 4HMEA 5HMSA 3CNYA 1EPVA 3OZPA 1PZ3A 1S2TA 1JAKA 1VJZA 1NEYA 5DMNA 2X30A 2OSYA 2Y7EA 4K6AA 3HFTA 3U7VA 2PC8A 4HCDA 1ZBKA 2NWRA 3JUGA 3V18A 1O94A 1PE1A 4L9XA 3CBWA 1N2VA 1NY1A 2DZTA 2DZUA 4R88A 2IS7A 3GXIA 4I5XA 1KXVA 1N55A 3L4UA 1DHPA 1S39A 3PSWA 3EXTA 5I3IA 3W88A 4P7OA 1VBRA 1UOZA 2PWGA 2GVJA 2WMGA 4E3TA 2E28A 3DEQA 1AA1B 1UR9A 3GUWA 3UZ5A 1JF6A 4WR3A 2WCGA 1R86A 2MANA 3B06A 4JFWA 4AG0A 3HGJA 4YVXA 3B4YA 4NIRA 3TP4A 4DO4A 1XIMA 4IOTA 2ZRUA 3UG3A 3BLPX 3W7IA 3KZSA 4AWTA 1QHOA 2P76A 4MZYA 3P5ZA 4PMUA 1TMHA 1EP2A 1XFCA 4AHPA 1M7OA 2FH6A 2XTKA 1BXNA 3WQ4A 5C70A 3PJUA 4H8NA 2Y8UA 3IIVA 1KM4A 3ANVA 3D6NA 1HKWA 2G97A 1JPMA 5CEWA 2Q6ZA 1J6OA 5FD0A 2FTYA 3LBMA 3QMTA 3UVIA 4O1FA 1ICQA 4DXKA 1BPLB 1VQTA 3FFSA 3AXMA 3PM6A 2VRKA 1JR1A 4AWSA 2OWCA 2GSJA 2EF9A 1Q6OA 1D3CA 3PUGA 4HN8A 4GZJA 1EYWA 5IDZA 3PG8A 1KCZA 3TYUA 3VOFA 4IISA 7CGTA 3OBEA 1BWLA 3VIPA 3A4JA 3K8KA 4IPLA 4RW5A 4DF2A 2WKJA 3UBPC 1SZRA 5I02A 4AEFA 1KV8A 4FIRA 3RR1A 4NF7A 1D2KA 3UXAA 3NL6A 5FJPA 3QF0A 4O8AA 1XYZA 1US2A 5CLWA 3MTWA 1QNQA 5HXMA 3TN5A 1W3HA 1UWRA 1E0TA 4BZYA 5A6LA 3EGJA 3VZZA 3WL1A 5HUPA 1A80A 4GI4A 3GDLA 4R27A 4PCFA 2X1UA 1W3JA 3VIMA 4FNQA 1E55A 3W7JA 1UB3A 4U3AA 4E2VA 3J7HA 2W27A 4L4PA 2VFHA 2Y62A 3QPEA 3W02A 3II1A 4B16A 1Z8AA 2WJEA 1QR7A 4G9PA 5I5RA 3TYBA 1PCWA 2JALA 4PTVA 3TJXA 3PBVA 1OT2A 5ECVA 5H8UA 4U28A 5CZ0A 1ZS2A 4QJ1A 5CZKA 4QAIA 1MUCA 3LG3A 4Q32A 2DUZA 1SW0A 4I8DA 5XINA 3W7NA 3ZVIA 3SQSA 2GL5A 1FDJA 3AXXA 2D3LA 1GYLA 2P5NA 2UY5A 3PBYA 2DEPA 3LB0A 3L4WA 2FZDA 1X39A 4UFJA 1E51A 4QHRA 1X97A 3PZTA 5AYBA 2VZTA 4LVAA 1J79A 4S3BA 1TELA 3IAPA 1EGZA 3NDZA 1A3XA 4ENLA 1QK2A 1JFHA 3P6LA 3GW0A 1KBIA 1MZRA 1EEPA 3UERA 4G1KA 3BOLA 1EJ7L 4JNMA 3K13A 2QDHA 3PNUA 5A95A 1A5OC 3UCCA 1B4EA 4JD4A 4JPGA 2PWEA 4GX9A 3WJWA 1PZ1A 1FP9A 3QV9A 2VUNA 3M5YA 3AYSA 5I3KA 2WANA 2BGSA 4HP5A 3P5YA 4UZSA 3N9RA 1BQCA 1IEQA 1X8CA 2FDMA 3IRDA 3Q45A 4YN5A 3QQWA 1L2UA 4WRHA 5BOOA 1GYMA 2PWFA 1NFPA 3WLNA 2FQIA 3DFNA 2YCIX 5H2ZA 3BE7A 4Q7NA 1XFBA 4DYEA 2AKZA 3EAUA 4HHPA 3EX4A 4NXKA 4CQ9A 2DQWA 5BZAA 4MWAB 5ENLA 1VCGA 3O9NA 2CBUA 2DPEA 1K02A 1KFCA 4XAFA 1OB0A 1FX6A 4M6VA 3WFAA 4MWAC 4ZQOA 4L5ZA 3BJSA 3KWSA 4FLQA 3LHUA 4AXNA 4OWGA 4GKLA 2TODA 3KHDA 2WSKA 3VD9A 3OZMA 4CCCA 5LNVA 5FACA 3TNOA 4WQ6A 1KCKA 2PGEA 2J7BA 2CLFA 1VYPX 3FIGA 4DZAA 4G7FA 4RE2A 2Y85A 3QR3A 4AUBA 4KERA 1UC5A 2E40A 3UR5A 4MYXA 2ZUTA 4RNHA 5BMXA 4AZGA 1RZMA 4H9TA 3CAWA 1RH9A 1HKVA 4DWDA 1V5XA 3R1ZA 4E8CA 1DIEA 3SUWA 3EWBX 4WSJA 4XUGA 4E8DA 1O1HA 3K46A 2TAAA 2C13A 2YPIA 4KCUA 5CKSA 1UPPA 2XVGA 3BW4A 3ECQA 1VD6A 2XN0A 6PTDA 1T96A 4J4KA 1F2JA 1GZGA 3PAJA 3QGVA 3IARA 1A5NC 4CD8A 1RQEA 1UH3A 4DJEC 1OD0A 5D4YA 4DF0A 4IMAA 5D8WA 1UJQA 3DYOA 4REQB 4FLSA 1Z48A 1VCFA 3ES8A 3QHNA 1XLEA 1EHAA 3AHXA 4J3WA 2QJGA 3STFA 1EJUC 4AF0B 3IGXA 4JGDA 4AIUA 1S3HA 3CIWA 3KBWA 1LQAA 3U8GA 1TPB1 4IXHA 1BEUA 4Q4PA 1HL9A 3N14A 4QE5A 1B3WA 1DJZA 1CNVA 4M81A 4DBEA 3MUXA 1QATA 3R7MA 3ZIZA 3HPAA 1ECEA 1I0DA 2HBXA 2Y63A 2I16A 2J9ZA 4IMFA 2ZWYA 3N3TA 2WM0A 4WVXA 5BWAA 3A24A 3CJPA 4GQGA 3RU6A 2O9OA 4PMXA 2RKXA 4GUIA 1MXDA 1TMQA 1ZJAA 2ZBTA 3N4EA 3GIPA 5EMMA 3EDDA 2E6AA 3GVWA 3P82A 3M5ZA 3Q67A 1NF0A 3NG3A 3H7RA 2C71A 3BXWA 1K8ZA 2Q09A 4G5DA 3P93A 2GOUA 3ZR4A 4IMDA 1ZPTA 4KH2A 4IMEA 2RAGA 2VOMA 3UZZA 4NI8A 4PSRA 3T0DA 3P81A 2YL6A 3F4CA 3R58A 2BVYA 3LUTA 3WQPA 3E38A 1US0A 4E3VA 4O4VA 2WHLA 3FJ4A 1DV7A 3W1UA 2X7VA 4C1NA 3SM0A 1E73M 2J7HA 3GTNA 3L5MA 2X1IA 2A21A 1LRNA 2JIEA 3UYCA 4LX4A 2RDTA 3DXIA 2FJKA 1R5YA 2ISFA 4YU1A 2O7SA 3GY1A 5CSYA 4DQWA 1YRRA 3F2BA 1OX4A 1DWFM 2GVGA 3WJZA 5T9CE 1IT0A 1XYMA 3LPGA 3QW3A 4HT3A 4D71A 1FH9A 3UJRA 2FFCA 2HISA 5K9CA 3NO5A 3KRUA 2ZRVA 1KXQA 4KPLA 4N9BA 4IT1A 4NRSA 5CG7A 4ADSA 4AY1A 1W1YA 5CC5A 5HWJA 3WNLA 4UIOA 3LHVA 1Z9AA 2BNJA 3EMZA 2BHUA 2E6DA 4JAWA 1BGGA 1RHCA 3WD3A 1WO2A 4I5RA 5FEPA 3SFKA 1B90A 3WLKX 5HQLA 4LYPA 1SFLA 4DBWA 3QGKC 1LOLA 4Q8TA 1EBHA 2CKSA 3DU0A 1RALA 1TWWA 3DG6A 3VINA 2XINA 1RQHA 4GH1A 2QV5A 2WZHA 5HJLA 4JQ4A 4XZHA 2VTFA 3WENA 2ASHA 4EF9A 2YKKA 3TYAA 1ADSA 3CGTA 4XBSA 4GGBA 4D6JA 1KFEA 1WYIA 4ZR8A 2WMHA 1PKMA 2BV9A 1IIHA 4IP5A 4XZWA 4KRUA 4ZE5A 3SO7A 3I3EA 1HTIA 2E9MA 3W1XA 1R9YA 3TOYA 2FHBA 3MCNA 3M5VA 5D03A 4F0SA 4CLMA 3DI1A 1F8MA 3NSNA 1Y7VA 4MNKA 4Z2JA 3CZ8A 2Z2BA 4PB5A 3S1GA 5BWFA 2FZNA 3BLLA 1V7AA 1XIHA 3E0IA 4LS0A 3LSBA 2XPKA 2G41A 4RXFA 1FFQA 5CPMA 4PZVA 3E02A 4GCAA 3R0KA 2C0HA 3RF9A 3WBEA 4PUWA 5FEXA 5LNWA 4LS2A 2GQ3A 3TTEA 1RLDA 3RYSA 1AW5A 5AZ0A 2YZ5A 3FVDA 4B5TA 5LZLA 1CCWB 4HNCA 3F1QA 4WSKA 2VEIA 3CUXA 6A3HA 4JCLA 1OGSA 4IX2A 3MP5A 1DEDA 1B9BA 1JCTA 3HPFA 1MFUA 3APTA 4PMRA 1DXIA 2QJHA 3KLKA 4OE7A 4RDWA 3KVJA 1VH7A 3N6HA 2ZX9A 3QV6A 2CXEA 2F6UA 2WZIA 4NJKA 3LHZA 4UR7A 1EZ2A 5LYRA 4J7RA 3WSUA 2X09A 3F5LA 5CH9A 2RUSA 3LEPA 1DL3A 4LAUA 1SJBA 4H7ZA 2J6XA 2VEKA 3QGAC 1DORA 1OEPA 2Q8LA 4IZGA 5KETA 5GPRA 4D8ZA 3CWHA 3STCA 4O0KA 3P80A 1OADA 3IJ8A 3AROA 4ZO7A 3JVAA 5C2GA 4RNJA 1V3JA 4XB3A 3SIZA 3DYMA 4GYPA 1OYAA 2PODA 1EBGA 3C52A 3L2IA 3NIYA 4W8BA 1AZ1A 1B2YA 1P0DA 4Z2IA 3LBCA 4J27A 5E09A 4XZBA 5HMFA 4NKCA 5CSSA 3WNMA 1E4IA 2GJNA 4IGNA 1X96A 2XM2A 5D2TA 5LNUA 1KFWA 5FF2A 3NFUA 3S3GA 4LY8A 2OKTA 4KKXA 2DFAA 3GDTA 1BG4A 2FIQA 1GOOA 1QMLA 3A22A 3H2MA 3VZYA 2O4MA 4UTTA 4YXGA 3H2FA 3VM7A 3EMCA 5F7UA 4MFDA 1Q6CA 4KFNA 1UD3A 1SJDA 1QU4A 4F79A 1OCQA 2W4XA 1E71M 4IL0A 1YMYA 3WLMA 1HJWA 3FX4A 3QOMA 3WUGA 5DF0A 4N9DA 1ZALA 2JBMA 3HMCA 1XLAA 4YPJA 1KNWA 5DRIA 1E0UA 3USBA 3QFEA 3IS4A 1UBPC 4OZOA 8CGTA 4A05A 2HWGA 4OIFA 2ZOXA 4YWIA 3W1TA 1EP3A 4NZJA 1A4LA 4B5XA 2O56A 1UYQA 4QIUA 3KOXA 3B05A 3R0UA 4O15A 3MUCA 4NSBA 1QPQA 4N9EA 1FWBC 1OFPA 3BC9A 2FDSA 4A8LA 5AN7A 3CQHA 4HA3A 5E93A 2X42A 2XWDA 1ZZMA 1KTBA 4PCSA 3OLIA 2YJQA 1GYNA 4EIVA 1AH0A 3LI1A 1K7FA 1HJQA 4QJ5B 1QJWA 3IJDA 4O0QA 4F8XA 1TUXA 1S38A 1VHNA 1O4UA 4EXQA 1T8QA 4M29A 1XUUA 1EXPA 3BAIA 1CGWA 1GVSA 4RX0A 4JS3A 4I9AA 4WDWA 2BOEX 4B92A 4Z1AA 4C1LA 3ARVA 1F76A 4PEEA 2CBVA 2Q02A 2YIHA 3WEZA 1H41A 1J2BA 4DPQA 3GTFA 4KIEA 2H8XA 4MDPA 1GQNA 1OHLA 3SY1A 2OEKA 5CC7A 3UD6A 1Q8AA 3WDJA 1WDSA 4U10A 3EDEA 1TIMA 1UWQA 2X0HA 1DJNA 3QEZA 3DG7A 4DXVA 3S47A 5F1VA 3QSRA 1M03A 1JQVA 3ZS4A 4YL2A 4CD6A 3PTMA 1CX9A 4JX5A 2WW5A 1XL9A 1VZWA 4GIYA 3LTPA 1OF8A 2WHKA 2PEVA 2PMQA 3MA8A 1XBVA 4XAGA 3FHAA 2ZZ2A 1UH2A 3TQVA 4XZMX 2YL9A 4CN4A 4ACZA 3CPGA 3VOHA 4ORMA 2W91A 4G7EA 5AHEA 1W3KA 3QV7A 3UZYA 4J35A 2FGBA 2NQ5A 4TVCA 1I2RA 5L9FA 1TV3A 3BLEA 2ZXQA 2YZRA 1QT1A 1GTHA 1TSIA 3FYPA 3LCGA 1CLKA 4G2DA 4ZFCA 4LUYA 4S3DA 3DBNA 3W07A 3I4KA 1MEWA 3AALA 1H62A 1C8VA 1IXNA 1FOBA 3WDIA 1V0MA 3VKAA 3ABQA 5DXYA 2XFYA 5CAHA 3OBKA 1JJKA 4C6BA 4E2OA 1VKFA 1P7TA 5AHFA 4PFMA 3H2EA 4XBJA 1B0IA 5GNXA 4UTWA 3GXPA 2VEPA 3BQ5A 4JTKA 3Q2DA 1FHUA 3W86A 3C0LA 3RX2A 2NV2A 4TUFA 3OW1A 4B5VA 1P5BA 2BS9A 4AZIA 5ABFB 1VBUA 3KCOA 1RY0A 1RPKA 5K3VA 2OXNA 3G22A 3NSXA 1Q45A 3KTSA 1NWUA 1LLZA 2WZTA 3CV2A 1EUAA 3C0JA 4CN6A 2F8QA 4IIEA 5M3WA 3A21A 4NAFB 1OK6A 3OG2A 3S6DA 3PZUA 3WLLA 3CV1A 3VOCA 3GR7A 4GIRA 3GYEA 5AYXA 1ONXA 3AIVA 3F4NA 4B2DA 1BVZA 4EAYA 3JU2A 4HPGA 2I17A 3VIOA 4LEQA 5FJJA 1RY8A 4HNTA 2Q8XA 5IBXC 1VFUA 3HG2A 3ABRA 1BWVA 3CH9A 4JDBA 3WIJA 3IIPA 5HANA 1PWMA 1SO6A 3DFTA 1J2WA 4EP8C 4C91A 4ERGA 3QN3A 1MQPA 1W9VA 3R25A 1NQ6A 3T0AA 3TZNA 1R3VA 2G0WA 3KVMA 3MVTA 3CK5A 3WH5A 5HJXA 3GW3A 3N6QA 4N42A 3BARA 4AYGA 5K9XA 3TA6A 1OX4B 1NOWA 1AQ0A 1VJSA 3GDMA 4AIEA 2VGGA 1RR2A 2DQXA 1KW1A 4KW2A 4AX6A 2C79A 3BJTA 3W70A 3VD5A 3AU6A 4HB7A 2FFIA 3WO8A 3QC3A 4HU4A 5I77A 2J74A 2W9MA 1JF5A 3A12A 4X9YA 5BXTA 1FWRA 1H11A 1UKPA 3CB3A 4Z0SA 5LA1A 1TX2A 3FXGA 1CGVA 1H7NA 1J5SA 3IGUA 3PJWA 3QYQA 2V3FA 2BXVA 4BJHA 5D05A 4FNTA 5CJ5A 2F6KA 4DZ5A 2B7OA 3NZ1A 1EJRC 1OBAA 2R14A 4OBTA 1QCWA 4MMWA 4XTDA 1I9CB 4DB7A 8A3HA 2VGBA 2J78A 1UG6A 5EGRA 3BO9A 4ICCX 4C65A 2IKJA 1TA3B 4MSSA 1P1XA 4PFHA 4GFIA 4AVFA 1GOWA 2CIPA 1KRMA 3LRMA 1BYDA 2A3CA 2BX7A 2GZXA 2POZA 2GK1A 1FFRA 1E43A 1TVNA 3RM4A 5T26A 4XKMA 3WEOA 1R3RA 2NUXA 1YADA 3W74A 1OGGA 2CFFA 2GLKA 2TPSA 1RQBA 4Z2LA 3EWCA 1BRLA 2V5CA 2QPSA 1E6QM 2YDAA 3RLGA 5EBAA 4D8AA 2XUCA 1GEQA 2WVVA 3EWWA 2Y0FA 4U33A 2D69A 1Y0EA 3EWZA 3C2RA 4IX0A 2PDGA 4MHBA 4UQBA 5LIYX 3RUBL 2D24A 4WOQA 3O0KA 1E6XM 3WH7A 2XIJA 1EX1A 4DO6A 3ARWA 1CLVA 3APYA 3UWVA 3V5OA 1JD9A 3V5CA 2HV5A 4NZ4A 3NDYA 2OTDA 2UBPC 3VOGA 4H7CA 3LI0A 1H4PA 4DIAA 4RDZA 4DI9A 3PPFA 3WLIA 1DP0A 4FOJA 1NELA 2V2HA 3PBMA 3LQGA 4YTTA 1D3GA 3STEA 4MZ1A 2ZIDA 2CPUA 1UD8A 1E0XA 1YHTA 3OA5A 2Y5SA 5G4EA 1CTNA 3GBDA 3POHA 2NXHA 3PZQA 2ZUMA 1V6XA 1F61A 3F7JA 1XDLA 3ZZ1A 5G4WA 5KINA 3ME3A 3A4WA 1PDZA 3FKRA 4W8AA 1RCQA 4O52A 5CPTA 4PMNA 4LVDA 5A6BD 3MT1A 3W1LA 3W2NA 3HF3A 4M24A 3UR8A 5U7SA 3CLMA 4DJFA 1Y5WA 5DY2A 1XHGA 2PDJA 3KOYA 3NZGA 3MJMA 3FV9A 1N8FA 3POCA 4GNVA 5DMMA 2Y5JA 3RCNA 3GC5A 4CQ8A 2H3DA 3LGGA 3GS6A 5CQ1A 1Q7QA 2WMJA 5J8LA 7ODCA 2ACUA 2Y1HA 5A6KA 3R8RA 4TU1A 3L67A 2HK0A 3ZLFA 1XYLA 2YXOA 3WL0A 4OOUA 3VD7A 1ZAJA 1XIFA 4OT7A 1A5BA 7XIMA 3BGJA 2FPVA 3THUA 2V63A 4E4UA 4LPCA 3AU2A 2XN1A 4UTTC 1O7AA 5AHIA 3PUEA 3P14A 3N2BA 2QCDB 2HMCA 2VUYA 1TJ0A 1NP0A 4YIWA 5BOEA 3MU7A 5D02A 4A21A 2D2HA 5I24A 2ZWZA 3UY8A 3QTPA 1JEZA 1B54A 1W91A 2YFNA 3DAQA 1W9UA 2PURA 3AHVA 1WUEA 3KBMA 4J3TA 3HO8A 5EPDA 5AECA 3H4XA 2WPBA 1M6JA 5HDRA 1OYCA 1UIPA 3VD4A 4ZODA 4LJ3A 5AVNA 4HOWA 5HPOA 1DHKA 4G56A 1Q3NA 3SDOA 1ISVA 1LORA 4IIBA 4YTQA 3VU2A 1OFEA 2WWCA 2YBUA 2WNZA 4P8UA 3NL2A 4LYKA 2VT0A 5FF4A 3MI3A 2X1RA 4ADUA 3CQJA 3VIFA 1Q13A 3L12A 1D8CA 3ABSA 1XPYA 5M17A 2PDHA 4ZBCA 1XD1A 2C1GA 4C6NA 4PB4A 5HR7A 1G4EA 1P6BA 4P61A 3LZ5A 3KW3A 2AKMA 3MP4A 2ZCGA 3CYJA 4PMZA 3MI6A 3FHQA 3EA1A 1JULA 4AZBA 1M53A 4JFSA 2YW3A 2D23A 3V7PA 4FLOA 3G1DA 4I7UA 3A5VA 3H2AA 3MJYA 3UR2A 1J93A 4Y8FA 2E3ZA 3V0TA 3VNYA 2RH9A 4H01A 1ITXA 3VM5A 2IPWA 2PP1A 1PIFA 4RPQA 3W6MA 4WGXA 1SSGA 3CAKA 3NQVA 3RPDA 1HVXA 3HURA 1PXGA 2PLJA 4LWWA 2OYMA 1JGIA 4WZHA 1H1NA 5HQMA 1AVAA 2WNWA 3Q94A 3WF0A 5GNZA 4C6QA 3H53A 2YDRA 2Z7GA 2BTMA 3ITGA 3QQ0A 1JD7A 1PTGA 4K7YA 2IKIA 3PG9A 5LA0A 1IGWA 3K8MA 4Q4QA 4B5NA 3DBPA 5CGMA 3ENLA 4PUKA 4UFIA 3TK7A 3LMYA 1W3IA 1IEWA 2IQ0A 4FO4A 1A0DA 1UHVA 4MJ2A 4NI3A 4MZ8A 3QQ1A 2ZRZA 3LYEA 4ACZB 4GJ1A 1OJXA 1BAGA 2HXTA 3LENA 3LPFA 2BGQA 4N2YA 4XZ9A 5G2IA 5AYYA 3WFLA 3HBLA 3ITLA 1SZEA 2GPTA 4O1AA 1K4GA 5H1WA 5HMEA 2XN2A 3MSDA 3LN3A 2PP3A 4CKQA 3W00A 3RILA 1VFOA 3EBVA 2R24A 1YDVA 1UR8A 4Y9MA 1TRIA 4TTUA 5HAOA 1HW6A 4RR4A 2WBGA 3DH7A 3ZT5A 2WKLA 3W4RA 1QFEA 2DIKA 2WWDA 3WH8A 4GC3A 4MKNA 2QV4A 5LIUX 1IHIA 3KDOA 2VC7A 5IDIA 4HSHA 3GNXA 4EWND 1H5YA 1XG3A 5KEZA 2Y7DA 8TIMA 3BCDA 1PZ0A 2HDJA 3GVQA 4K8EA 3W2KA 1JDDA 3FXYA 4GGHA 3R89A 3TYCA 3ZLHA 3OVGA 4W7UA 5XIMA 1HX0A 3R8HA 2ZICA 3KHJA 3TV8A 4DUWA 2Z2AA 1A4MA 1L6WA 3H55A 4MB3A 5HOSA 1D7FA 1TRDA 1W31A 3W7EA 1J0KA 3NTYA 4BI7A 3SB0A 3TE9A 4ZOCA 2PTWA 3O8AA 4LAKA 4P7LA 1YLVA 1R47A 2DZPA 3RR4A 5AY7A 1XBXA 2DUAA 1AQMA 1ITQA 2PDFA 3WLHA 4TX9A 3RITA 1E6RA 2WPGA 1W1VA 3D3FA 3LS9A 4UR9A 1OCNA 3K4DA 5H8MA 3VKKA 1BG9A 5TIMA 4AB4A 2NWSA 4HK6A 4KCWA 3GC4A 4TX8A 3OVQA 3UNTA 5JBEA 1WBJA 1NAL1 3HN3A 1QI4A 2UWFA 4NZCA 3N12A 1RAKA 3R0DA 1C90A 1F05A 4KS0A 4H3DA 1TCDA 3S6TA 2GVYA 1KM1A 3DX5A 3O7UA 2P3ZA 1Q85A 1GPWA 5CPSA 1GOKA 4AD2A 4JYFA 3G1RA 4K1GA 2CETA 4E2BA 4JIIX 1JAEA 5GJPA 4DUXA 3NQAA 3ARRA 1XYAA 1HUVA 2KZHA 2GJRA 4A3YA 2E5DA 3SN1A 3O6DA 4AU0A 1FWSA 3M44A 3PS7A 1XGZA 3SEPA 4N02A 4PTMA 5E6ZA 1P4CA 4KMQA 3NVTA 4OUEA 3SGGA 1DWJM 4FNUA 1HNYA 3SAZA 3GHUA 3O6YX 2EEXA 3CM4A 2IQTA 4HNNA 4LVBA 1XIIA 3JZEA 5HATA 1XGDA 4D6FA 3GR4A 4MDOA 2G8ZA 1A0CA 3P0XA 4HMNA 1ONWA 5AYIA 3A4AA 1PZ2A 4AISA 2Y8VA 4DELA 4AHQA 5HR6A 4H41A 4NJJA 4QM1A 3IVTA 5I3GA 3VGDA 5D33A 4RKAA 4N4PA 3B40A 4ZMGA 1R9XA 3XISA 2RDUA 2IPJA 4M0XA 3H2CA 4FX7A 1SFJA 1FHDA 3HQPA 1UP0A 4LC8A 4QNEA 3LCFA 2DW6A 3QTGA 5M5DA 4DNMA 3N3MA 3CV7A 1US3A 1JDEA 2VDGA 3BAKA 4LXFA 2DIJA 3WN6A 5HBFA 5KZDA 1XGEA 3HFYA 3EX2A 2AAAA 4V28A 1MQQA 4W5UA 1J4EA 4DYJA 5RUBA 1EQPA 3HMJG 2PTYA 3L21A 3WNNA 4ZCWA 4J3XA 2QS8A 1V8EA 2PLKA 3EA2A 3FK4A 2QKFA 4QE1A 1R3WA 3WQWA 3N25A 3OODA 3A13A 2G4JA 4IFRA 3NWRA 3AWOA 2A0NA 4PL1A 4LC6A 2G96A 4AYSA 3LK6A 2ALDA 2NX9A 3LCWA 4FMVA 4JFUA 3PWGA 1AW1A 5A8GA 3WD0A 1LWJA 3O3RA 4MGGA 4X2RA 4AEEA 3BMXA 3LOTA 1Q4WA 3W2JA 1W37A 2PD9A 4S2CA 3ALGA 3W2MA 1XBZA 3ABOA 1ODUA 4PMVA 2TMDA 4UMCA 1PL9A 3FAWA 2OQYA 3I7SA 1DQXA 1C9WA 1LL6A 1JYWA 1Q8JA 2Q01A 4UQEA 1DOSA 1KWKA 3M43A 4LOCA 3H24A 1R2TA 5I79A 1FKWA 4S2BA 4HU3A 3AI0A 1DPMA 5BRBA 3V1HA 1K03A 2HE8A 3BSGA 4NY2A 2DT3A 4B3ZA 3NO3A 2XFFA 3S5SA 2FZ8A 3WH6A 1U5VA 3MW7A 1BTCA 1VAHA 2DIEA 1FDYA 4Q4OA 1LL7A 3VNDA 2NX1A 5CLTA 3R4IA 4H8HA 5FF0A 2F7FA 4Y9AA 1UR1A 2R1LA 1B9ZA 2VM8A 3RCMA 1SYTA 4C90A 3WQVA 3CB8A 4C6FA 4B91A 4MUPA 1OQFA 2PCEA 5JIPA 1V3KA 1Q6GA 1OC5A 1TR9A 4TVUA 4PR4A 1W32A 3TSMA 3HPSA 3OQEA 4H19A 3PUDA 3RLVA 3HPXA 3LTYA 5AB3A 3L5LA 4R34A 3LGDA 1S2AA 2FVMA 2PDWA 2O55A 4PUDA 3GK0A 1E1EA 5D09A 3GG7A 1GVFA 2VZUA 1BKSA 1TPC1 3EXRA 4GPNA 4FXRA 4NYYA 4Z17A 1UJPA 3TYEA 3AIQA 4MY8A 3L9CA 5A8MA 1C7TA 1Z7AA 3CZGA 2PU1A 5CJMA 3ARPA 3V3WA 4B3KA 3P8IA 3TC6A 2VI0A 1MEHA 1RJRA 3TMQA 2YLAA 3N34A 3MS8A 5C9RA 3LXCA 1VFMA 1XRVA 2ZE3A 4XG1A 4LVGA 3N17A 4PRRA 4PBFA 1ISWA 1XR2A 4FLRA 1O60A 1PYFA 1WUFA 1MNZA 1S5VA 3WBAA 3HJZA 3L5AA 3LLXA 1IXPA 1QI2A 1UR2A 4HU0A 1VFFA 5HULA 4RZ5A 4AC7C 3AS3A 1FXQA 4DF1A 3QR1A 1OINA 5FJIA 1JFXA 1DWAM 2VMFA 3VDGA 1T7LA 1DE6A 2AAMA 1DIDA 1NTHA 4XISA 5HWMA 3T8QA 3IWPA 2VJXA 5LGZA 4L61A 1ZQ5A 4AD4A 3P3BA 4RXGA 1TWSA 3VKBA 1DXEA 3P2VA 1IGSA 6REQB 3R2GA 1WB0A 1E5JA 1I75A 1P0KA 2VFDA 1SMDA 2V6AA 2VO5A 4KEVA 3GKFA 4A3QA 3XIMA 3WQ8A 4EK7A 3B9DA 3W6LA 4L6DA 4A4AA 2F38A 1GG1A 3TW9A 3RFAA 1JIBA 1LT8A 3LBOA 3T07A 1W2PA 3STGA 3C4UA 1VYRA 4MWAD 4BF5A 4LFYA 5TF0A 2VD9A 3M46A 3IUHA 3FSTA 5EKYA 2G3JA 4KETA 1UR3M 2PZ0A 3WNOA 3VIJA 1Q63A 4IWWA 1B30A 1VENA 1JYXA 3Q65A 3T2QA 3TAOA 4C6PA 3QSTA 1NFGA 4MKVA 4W85A 2EG6A 2EPNA 2VRJA 3MHUA 1FH8A 4L1GA 1BF6A 1J0HA 2A3AA 2FJUB 4LBSA 3ARUA 1K6WA 3VNKA 7REQB 2RDWA 3UWWA 3VKJA 2WJZA 1BF2A 5EBUA 2CLMA 3BLOA 2FLIA 2QLYA 5K9DA 3L0NA 4H04A 3IRSA 2J25A 2QJJA 4IIHA 4GUGA 1A5LC 4FOUA 4GJJA 1KR0A 5KZ6A 2DSKA 3GIYA 4NG3A 4IHCA 1Y65A 4G1NA 1MW0A 3Q37A 3W7GA 1ISZA 3SZ8A 1TE6A 2A7PA 4HNLA 4ATWA 3TH6A 1XLLA 4EX4A 4IJRA 2ZUWA 4J5NA 3TVAA 4JHOA 3WLRA 1LF1A 3UEQA 3N2TA 1YX1A 4GQBA 3FW6A 2YDQA 2EGZA 1XLGA 2VFIA 2HK1A 4C6MA 3NL3A 2CXGA 3VMPA 1UUOA 2I7GA 2J62A 3U2ZA 3H8AA 1W2VA 2NT1A 5J5DA 5I7GA 1AQHA 4IMGA 1JZ3A 2J79A 5CBBA 1XISA 5BW6A 3KWXA 2ZZ4A 2WOQA 2Z27A 2AL1A 7TAAA 4BK9A 1GJWA 4AZ7A 1R3TA 4HJWA 1IXQA 4XX6A 1HP4A 4JNYA 4RDVA 4XVDA 1F4HA 2NQLA 4GYFA 4CNNA 4DJDA 3IIOA 2VVNA 1M1BA 1HQTA 1H63A 4HU8A 1AUSL 4O57A 3I6RA 3G2GA 4W93A 4BEUA 1SZGA 1OF6A 4PTWA 3FCPA 2FZBA 4HSNA 3HG4A 4HQVA 1K7XA 3R10A 3MYOA 5HWNA 3ZVHA 3K1GA 3OGVA 4P7QA 3VCRA 4LAOA 2HTMA 1VHCA 4LY4A 4IPPA 4YS1A 3JS3A 2JK2A 4XAZA 4GQRA 3I68A 3FDGA 3QM3A 1CXEA 4MYAA 1FWCC 4JY8A 2R82A 6XIMA 5HMDA 3RN6A 1CGXA 4EXAA 1Q6QA 4CNTA 2QGYA 4W4QA 4ZOAA 5D9PA 3NQGA 3TLLA 3NZPA 4DWSA 3B0XA 2EJ1A 3GD6A 1WP6A 2CZDA 1VFHA 2YYTA 4AMAA 2E8YA 2INZA 1K1DA 3T6CA 2ZX6A 4AWEA 3FDKA 1KD0A 1I45A 1C91A 2PGFA 4JN8A 1GG0A 4MTVA 5JVLA 3KS6A 3S9YA 1EPXA 2TYSA 3UPWA 1OSEA 4E8GA 1MI3A 2OCZA 2P50A 1ZCOA 3VKCA 4ZGYA 2CCRA 2YA2A 3B9EA 2DP3A 2QULA 4UZUA 3ZT7A 4QP0A 3IJIA 1SO4A 3MI2A 3CZJA 1H51A 3SURA 3UWEA 4L4MA 1CB2A 2CLKA 2CLPA 1ECQA 3WLJA 3AXHA 1O12A 3SCNA 4YCOA 1BVNP 2C1IA 4Q22A 1UMYA 3VNLA 3SCVA 1D3HA 2QZRA 4RE0A 2V8ZA 3ANYA 4M8UA 3IIZA 4UCFA 5AFDA 3UXDA 3O05A 1EA9C 4NQ1A 4Q7IA 2YCLB 2ZFAA 1KGXA 1FHVA 3BAJA 3H7VA 1NOUA 8RUCA 2BMBA 3ITXA 3IK2A 1TJ1A 4FK9A 5K4ZA 1C8XA 1NU5A 1WNOA 2VWTA 4DX3A 2JGQA 3CUHA 4P8WA 3S9ZA 2GVLA 5JQ9A 4XD5A 2FZMA 1KLYA 3BWWA 1XF0A 4RJEA 1LJYA 3UXIA 1MYRA 4KRTA 4FB7A 3KTXA 3SCWA 1H2JA 5ABTA 3NM1A 1PDYA 1HGYA 1QASA 4V1XA 2BY2A 3AIRA 1YNYA 2OOFA 1FUYA 2VZVA 1TTJA 2OYLA 3N9KA 3NQFA 3VIGA 4HK5A 3L2LA 3TIMA 2DVUA 1OM0A 3QY7A 4JIEA 4Y2WA 3WNKA 1PV8A 2VC9A 2X1TA 4BI5A 2V5JA 5H6HA 1HO4A 3GIQA 5DY3A 5FSEC 4JIRA 1C29A 2QMJA 1KM5A 3TN4A 2WC4A 2F84A 2WSRA 3MPGA 2HEJA 2I1OA 4GNKB 4PCNA 3N13A 3W24A 4MG4A 5CPQA 2CLIA 1M5WA 3EX1A 2WBKA 2NVAA 2BLEA 4TTGA 1MDLA 2E1WA 1QBBA 4R7WA 2DSVA 4UQDA 3VNMA 2HSAA 3IVSA 3SUTA 3OB8A 4ES4A 3F4VA 3F2CA 4P5UA 2ZX5A 3EDKA 4O19A 1XC6A 3W25A 2HS8A 4WXZA 2V67A 1G94A 1CI1A 3SJNA 1IZCA 4UOJA 4O16A 5FSDC 3VILA 1WX0A 3EWDA 3FA3A 1MRAA 1IWBA 3BCFA 3LCXA 1OFBA 4KEMA 5TQLA 3W2LA 4IMCA 4J2MA 5A3HA 4HBKA 3SCQA </