4MVAA

1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 97
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mvaA00
3LTYA 3VCRA 4N9CA 1KTCA 3NR0A 4ALDA 3G0UA 3DBPA 3W7KA 4M6VA 2ZZ5A 4JEQA 4JX5A 5EL1A 1FWNA 4PEKA 4QISA 1W5NA 1LRNA 1N7KA 4N02A 2ZRZA 4HNNA 4BI7A 3CPRA 1A50A 2FPTA 3NQ7A 3S8HA 3LX9A 5F4XA 3B8DA 3N34A 5CPMA 5BOOA 4GC4A 2B7PA 2E77A 3WJXA 3OVQA 2BTMA 3GDTA 1LRQA 5DXXA 3UYCA 5FF2A 3FFSA 3W9ZA 2CLFA 3GKFA 1NVMA 4W9TA 3RMJA 2HS8A 3NQ8A 4A2SA 3C6CA 4Z1DA 4NT0A 3CIWA 1AMKA 2OT0A 2X30A 1TB3A 4MLJA 3B0VC 1NAL1 1WDWA 3W6YA 2ATSA 4S2BA 3G1XA 3D0CA 4MLRA 4YCPA 2NV1A 3Q94A 1W5PA 1OFOA 4AMAA 4A3UA 5D38A 2ZBTA 2E5CA 2G95A 2I1OA 4LVAA 5FF3A 4Z0SA 3BW4A 4WOQA 3IIXA 3FS2A 2ZZ2A 4O8RA 1VH7A 1OFPA 1F6PA 1ME7A 5KZEA 4IOTA 3W22A 4N9EA 4M7SA 4FXSA 2PURA 4LUJA 2F7FA 2ZQ0A 3UXAA 1JCLA 3CQ0A 3A24A 4NJGA 1W3NA 3LXAA 3S5ZA 4N9DA 4X2RA 4MUZA 1IXPA 1X7FA 3WK1A 2ZZ4A 2PC4A 4NX5A 2GUUA 3L68A 4UFLA 1YTDA 3TX9A 3B04A 3NQ6A 1DQXA 4UMBA 3FYOA 3PF3A 4LUIA 3HB9A 2EPHA 4OHQA 1T0OA 2I14A 1FBAA 1BKSA 3W1TA 3STCA 3I7RA 4IUOA 2QDGA 3ABSA 4MFDA 1KFLA 3BPWA 5F2IA 3G1HA 3UY7A 4K7YA 1R47A 3EWXA 4KFOA 2R14A 1OVDA 4PL1A 5BMWA 1Y0EA 3DKLA 1OX6A 4Q32A 3THQA 3UQNA 4UR8A 1VR6A 1SZEA 3NQAA 2YXGA 1O60A 3A9IA 2YCEA 3GR7A 5IM51 3JR2A 2A1YA 4LVBA 1F2JA 1RV8A 4IMFA 4L4MA 4E2DA 1PE1A 3NL3A 4XBKA 3F4NA 2E5BA 4IJBA 4BF9A 5K7JA 3W87A 3G3DA 2V30A 2GVJA 2QCEA 4N4QA 4JY9A 3G1YA 3UWUA 2Y6ZA 3TR2A 1SQ7A 3FEMA 2GQ8A 2WPBA 5KINA 5LGZA 3ZR4A 1F73A 3O1NA 4O11A 3C2FA 1TYGA 3P74A 1H7XA 2FPYA 3DFNA 1FXPA 2E6AA 3S5OA 3UWWA 1WAUA 2ATMA 2DJLA 3CM4A 3R2GA 3YPIA 4O12A 3EX3A 4O10A 3LBCA 3TROA 1D3HA 1G4SA 2GQAA 2Z6IA 4UTTC 4WZHA 3M7WA 4UFMA 1ZFJA 2FFCA 1M7PA 3IIOA 1OK6A 4DXVA 2BZNA 1KM4A 1L2UA 2OT1A 1PCWA 1VPXA 3MHUA 1DJNA 5DLCA 5I3IA 1YXYA 2BX7A 1WBHA 3GNDA 4FB7A 4H4IA 2DU2A 3BG5A 5F1VA 3DI1A 1WX0A 1G4PA 4YCOA 3E12A 3SJ3A 1KFBA 2XN2A 1H51A 2AQWA 4M5PA 4M6PA 4E0CA 4Y9AA 4WJEA 1H1YA 1BTMA 1NEYA 3E96A 3U8GA 1H5YA 2E5DA 2EHHA 5HINA 3F03K 2A6NA 1JUBA 2RHGA 5KZDA 4J9JA 5CGQA 1JUEA 1DOSA 4I7WA 5U7SA 2CZ5A 3W84A 3NL6A 2A21A 1F74A 3C2VA 4TMBA 2VKZG 2A7RA 3MJYA 3A21A 4ZQPA 3BW3A 4WXYA 2DZSA 1ICPA 3L21A 2FPVA 2YSWA 3S9YA 4FIRA 1TRDA 3OVPA 1F7BA 3P81A 3IIPA 3TC7A 2ISWA 3PS7A 1F6KA 4LVGA 3LM7A 4UMAA 1EX5A 1FX6A 3S1WA 1CX9A 2C1HA 2VEIA 4JR5A 4AWSA 1PV8A 2P10A 4JTFA 4JICA 5G2WA 1Q6QA 3TMQA 1VHNA 3RFAA 3M6YA 2XFWA 1LCOA 4R7JA 1Z48A 4GRSA 2ZRWA 3MYOA 5I3HA 1ZCOA 1H7OA 4MZ8A 5F2GA 2VFEA 3L5LA 3BARA 4BWLA 1F5ZA 3CLMA 3H54A 4TU1A 3CB8A 3IVTA 4BK9A 4RKAA 4Y8FA 3QC3A 3HJZA 3NDOA 5E1QA 2CWNA 3C2OA 4LTSA 5HWMA 3PUEA 4AXKA 4R34A 1KV5A 4RR4A 4AB4A 3W7HA 5CPNA 2QKFA 3W7GA 1YYAA 3QH2A 3M47A 2DZUA 4GUIA 1VRDA 3QJAA 4EIVA 3VE7A 1B4KA 2V81A 2ISSA 4XBSA 4AWTA 3IEBA 2ZZ6A 3WK0A 1C9DA 4HKPA 4GE8A 3U6WA 1UB3A 1XI3A 4UTUA 1ZENA 4EOUA 1A5SA 4JX4A 3M5YA 4DQWA 3LI1A 4FNTA 3N19B 2LLEA 1W0MA 3G3MA 1DQWA 5IBXC 1KBIA 3DZ1A 3HBLA 1LBLA 4UMCA 2V9DA 1I2PA 1AG1O 1ME8A 2C15A 3CEPA 3LXBA 2QR6A 3ATYA 3LHTA 2YYTA 5KTLA 3ELFA 3LB0A 5G2HA 1PL9A 4TMCA 2YPIA 1VYRA 1N8FA 3TMLA 3N9RA 4CNPA 3SI9A 1TQXA 3N9SA 5FF0A 3OBKA 4FEZA 5F2MA 4O15A 3KFTA 4WY0F 4MJZA 4ZQRA 1KM3A 3DFPA 4PA8A 4R53A 2NXGA 2CLKA 2NXIA 1OFBA 5AC7A 3GNNA 3NG3A 3GXPA 5AB3A 2CFFA 3WK3A 2VENA 3WFAA 1Z41A 3PSVA 1KM0A 1TMHA 1THFD 1LP6A 1T8XA 3TIMA 3MI3A 1L9WA 4LC8A 5D33A 1IF2A 2ZRXA 5LHEA 4OQVA 3W7JA 3GYEA 1JCYA 4DF2A 3E9AA 4GUHA 2QCFA 4OT7A 3NXFA 4GWEA 3DI0A 3QEZA 4AHQA 1K7XA 4X3ZA 5LKYA 5AHLA 4QNEA 1X1ZA 4AF0A 3QMSA 1IXNA 1JQVA 3N3MA 4Z08A 3MBDA 4EF8A 3HPZA 1G4EA 3HG4A 1TIMA 3MP5A 1SFLA 4JD4A 5TQLA 1O5KA 4WD0A 4NNCA 2RDTA 3THAA 3LTSA 2G5WA 4O28A 1W5OA 3KOFA 4RV8A 5AHEA 3UZJA 1AL7A 1ME9A 3PUDA 3GDLA 3VKJA 3V1PA 2WSYA 1XKYA 5DBUA 3EXRA 3PWAA 3ZFHA 3L67A 3IIZA 3F4WA 1A5BA 1LTDA 1H7NA 4ORMA 4JTUA 4YWIA 1O94A 2EF9A 8TIMA 2C18A 5K9DA 2QCCA 5K9XA 4GBUA 1KM6A 3W1NA 3M41A 2CLIA 4WUIA 3LCGA 1UUOA 4MKNA 4OV4A 3DFSA 3QYQA 3RU6A 4MY8A 3CHVA 2YZRA 4BR1A 4I7VA 3P60A 1TPEA 5F1UA 4A2RA 3KHJA 5AHMA 4XQ6A 4S1FA 1SZNA 3FKKA 1YTEA 4HPXA 3LI0A 1GG1A 1GOXA 3W7NA 4LRTA 4NZFA 3BGJA 2C3ZA 3W71A 4O4VA 1FDZA 4UTKA 2V0TA 3EEGA 4LS2A 5HMSA 1N55A 4WY0A 5EPDA 2J24A 3FLUA 3O63A 5D02A 1J2WA 4MYAA 1GYNA 2J6XA 4JGDA 1UCWA 5E0KA 1ZNNA 1RZMA 5LNVA 5CPOA 1YLVA 3DFOA 5CKSA 4WX2A 1B4EA 1TPB1 1G69A 1MEHA 5D2YA 3NO5A 3PB2A 1OYCA 2CZFA 3NNTA 4JTHA 3HO8A 3FA5A 4EVZA 1XBXA 4QNWA 3S6DA 3KVLA 2NXHA 5I3JA 3W2JA 1RQEA 3S1XA 3E02A 5L6UA 3TXVA 3ABRA 3ZWTA 4UTMA 1KFEA 3PG8A 4IMCA 3TFCA 2OJPA 2YR1A 1XCFA 1W1ZA 2B7NA 3PVFA 1LBFA 3W7IA 2OMAA 5HUOA 4ZMGA 1I8JA 3WJSA 1XL9A 1EWDA 4U28A 5D2WA 5DELA 4ORIA 1TREA 3LHYA 2V2HA 4DBEA 2ZTJA 1OYBA 4GUFA 5EMUA 3U2OA 4IQLA 1GJPA 1RQHA 1HL2A 1FCUA 5J5RA 3P84A 4NJHA 3G1AA 4LNYA 1GTHA 4BI5A 5HULA 2WSQA 2DZTA 4C1LA 1BEUA 3W07A 3O6CA 1XBZA 1OFAA 5DY2A 3SECA 2BWGA 4M19A 3MWAA 1EP2A 4XTDA 3HOJA 3W75A 1WYIA 4NUWA 4ZQMA 5LNRA 1RR2A 3EX4A 2Q8ZA 4I7UA 3P82A 2A5HA 4JY8A 3NQ2A 5AHNA 1ZHAA 2DORA 4Z1CA 5H91A 1QMLA 2V2CA 1SO6A 3S42A 1QO2A 4JYEA 1QOPA 2VFHA 2RFGA 3I68A 2Y7GA 4HNVA 3G0XA 4K6AA 3BGGA 1LLWA 1QPOA 4AF0B 3NZ1A 1LZOA 5KSWA 3EKLA 3LOTA 3TV8A 1OF8A 4QJ1A 4ZZ9A 5L9FA 4MY1A 5K4ZA 1S5WA 4LS0A 3BG9A 3W88A 2CLMA 3NQGA 4O1BA 3N14A 2NWSA 1XDMA 4MZ1A 2E09A 1WXJA 2BXVA 2QCNA 4IPJA 3IV3A 5G4EA 5LZLA 4O19A 3C0JA 5G2IA 3SY5A 3LV6A 3FOKA 3TCEA 5K3VA 3L66A 1H62A 3C8FA 4ONVA 3W70A 4ADUA 4HHPA 1K3UA 3EX6A 3PAJA 2C13A 3FYPA 3UWVA 3TXZA 4A22A 1FCBA 1OX4A 5D30A 2WNZA 3GVGA 1FY6A 4R33A 3EWYA 1SSGA 4JTSA 3QMTA 5FF4A 3TNOA 2WNQA 4PCFA 4AHPA 4K36A 3NPVA 1RVGA 1ICSA 2X1RA 2HMCA 2PE4A 3LV5A 2TMDA 2VFGA 4FXRA 2ZA2A 5LSMA 1DJQA 3VI2A 1HO4A 3QPYA 7TIMA 5BW6A 3KX6A 1SU5A 4NZJA 4YMZA 2YGYA 1YTKA 4JDBA 1PCKA 3MP4A 1YPIA 2O7SA 3MHGA 5FF7A 1TJPA 3T40A 3L5AA 2ZZ7A 1UASA 4O4WA 1EA0A 4NJJA 4TO8A 1EB3A 1ZJIA 1VYPX 1SO3A 1GWJA 3DENA 3QZEA 4DELA 3IVUA 2Y63A 3GXTA 3L5MA 1PVNA 4AH7A 4GUGA 2GPTA 3P8JA 4O0KA 4CNOA 4KKXA 1GVSA 2WJZA 2C14A 2WV8A 1Q6OA 5AC6A 2ZRYA 3OG3A 4XKYA 4N2YA 3DHDA 2C6QA 4EF9A 3BLEA 1JQXA 3BW2A 5DY3A 1KFKA 1G67A 3GDMA 1KM5A 3DU0A 4QSHA 2H8XA 1GZGA 3BLFA 1QOQA 3Q37A 1LRTA 2V2DA 3FJLA 3W85A 3HG5A 3M44A 4Y90A 1H63A 3OVRA 3JS3A 4UIOA 2QCLA 3A5VA 4YXGA 5HR6A 3KRZA 3O8AA 3MP3A 3PC0A 4H3DA 3CIXA 1C8VA 4MY9A 1K7EA 2PRHA 1Q6LA 1S5TA 5AYYA 1OFQA 1YDOA 2EGZA 4JTTA 3W74A 4FO4A 3CU2A 3MMTA 1H60A 3W2LA 3L0KA 4JYFA 3G8RA 4CCEA 4HN4A 1XUUA 3QQ0A 2HS6A 3LHUA 1VGAA 3AJXA 3PM6A 1QFEA 3B4UA 3I7SA 1NFBA 3S1UA 3VFLA 6ALDA 3SGZA 4LRSA 3W7PA 5GVJA 4OGZA 3L0GA 1TPC1 3W7RA 4JYDA 4UTJA 5EY5A 1K03A 1VJIA 1ALDA 5TIMA 2VEMA 2GJLA 3S5YA 2W79A 2WO5A 2FTPA 2G97A 4FHAA 4O1DA 5CPLA 3LRMA 3E49A 5DCDA 3NQCA 5DBTA 2UV8G 2CLHA 2I9EA 2W6RA 3B03A 2FLIA 3ABOA 1H7WA 4ICNA 4B5NA 2QCMA 3W1RA 4Y96A 3STGA 3LTPA 5D09A 4PTNA 1BWKA 3A22A 3GZ3A 4GJ1A 1JRBA 4K38A 4RXFA 4CCCA 1W3IA 2CZDA 2ZYFA 2EAWA 2O7QA 2X2GA 2NUYA 2VC6A 1EUNA 1EEPA 3TK7A 4I9AA 2Y62A 3PG9A 1E51A 5K2ZA 3IGUA 3AO0A 3NM3A 3OEXA 1X1OA 3N73A 3LGEA 1JCJA 4O52A 1MEIA 2J9ZA 1M6JA 4O16A 2Y89A 4X9SA 3DFQA 2FB2A 3LBMA 1JRCA 1SZGA 3R89A 2H90A 3W7QA 3WK2A 4DBDA 2FDSA 4RZ5A 4AVFA 3F1QA 1JR1A 3C4UA 1FUYA 4IXXA 4IMGA 4BFAA 4UTHA 3SSJA 4K7VA 1SUXA 2J9YA 2X16A 4IX2A 1GG0A 3VNDA 1G6CA 4GUJA 3DKJA 1OYAA 4LT9A 1YXCA 2G96A 2CZEA 2HTMA 2YFNA 1SW0A 1K8YA 4DO4A 3K30A 4FX8A 3LHZA 3R8RA 5ABTA 3L2IA 4MYXA 3TSDA 2A7PA 3NQFA 1QNVA 3NVTA 4HSOA 3G1VA 4LVFA 4OBTA 2ABAA 2A85A 3NEVA 1MSSA 3BV4A 4EWND 2KZHA 1DL3A 1ZAHA 1L6SA 1FCQA 4CQAA 1I2RA 4DF0A 5C55A 3HQ1A 4Q4KA 4JTEA 1KFCA 2ZFAA 1TPUA 4FX7A 1LROA 5KMYA 4QQ3A 4NQ1A 1S3HA 4QITA 2A7NA 4Z0JA 2ZZ1A 5LGXA 2TRSA 5LNWA 5LNUA 4UC5A 2NX9A 1KBJA 1VQTA 1A5CA 3N2MA 1MXSA 5D2XA 5J5DA 4Z1BA 4O0ZA 2W0UA 3NL2A 3W7EA 1TJRA 3NGJA 4E2BA 2VELA 1R2RA 3SIZA 4YL2A 2NLIA 3B0UX 4NNAA 3HIJA 3KRSA 2R91A 1XUZA 1TV5A 4O17A 1NSJA 3GXNA 3MHFA 5K9CA 3UPWA 1SO4A 5C2XA 2QCDA 1TRIA 1UJPA 5CZSA 5AC8A 3I7QA 3UZ5A 3HGOA 1V5XA 3LCFA 3QF0A 4NXSA 1DORA 3H53A 3NA8A 4JX6A 3UY8A 3UNDA 3GAKA 4N4PA 1IXOA 1PIIA 1GTEA 3GKAA 4JNMA 5EBUA 3W1AA 1MEWA 3LRLA 2B7QA 4L4LA 3UWQA 5CZTA 1PHQA 5G1YA 3PBWA 4O18A 2AGKA 3EB2A 3ABQA 4PFMA 1OK4A 2ZDRA 2QCDB 5H2ZA 5F4WA 2H3DA 3W1QA 1AW2A 5K4XA 3VE9A 1B9BA 2TYSA 4DEFA 4MIMA 2BLEA 2QCGA 3NOEA 5MHBA 1CW2A 2C16A 3I65A 1I2OA 2YW3A 5CZJA 1AL8A 3LHWA 4IGHA 1KLYA 3HGSA 1OFDA 1OJXA 3ZS4A 4DPPA 5FEZA 2H3BA 3W7LA 5HR7A 3W86A 4JTGA 2C0AA 1RQBA 3L0NA 2NUXA 1EP3A 4CLMA 1GT8A 3W1UA 5CG7A 2H6RA 3W7OA 3TDFA 2V5LA 1R2TA 3W1XA 1K8XA 2WNNA 4O53A 1P4CA 3W83A 1WA3A 2VEKA 4IX0A 2X1SA 1LLZA 5AYZA 3PBYA 3QRHA 4POCA 4LY8A 4UXDA 3UD6A 3NPUA 3SZ8A 4K8EA 1VCFA 4ADTA 1XC4A 2DJXA 1IIGA 3TAOA 2CW6A 4O14A 5FEWA 3CWOX 3P62A 4XUGA 1RD5A 4UTIA 1KLZA 3W3OA 5U4NA 2QUVA 1DV7A 1JVNA 4U4MA 1I2QA 4P61A 2FIQA 3KAOA 1TTPA 5BMXA 3O16A 1TO3A 4O57A 3UPBA 4ADSA 2YYUA 3HG2A 3N2XA 3P5YA 2TSYA 1D3GA 2CLEA 4UFIA 3LXCA 2DZWA 2XN0A 1TCDA 4RLIA 2GVGA 4O13A 2QCHA 1KA9F 5BNKA 1GVOA 2RDWA 4OWGA 3W73A 1XM3A 4UFHA 4AEOA 1L6WA 1QDSA 3GIYA 5FEPA 1OFRA 2BSLA 1TV8A 3BG3A 3TQVA 4CQ8A 3CEUA 4MOZA 3USBA 3P61A 2A2IA 1WOBA 3QFEA 1Q3NA 3LRKA 2AAMA 2Q3RA 1WBJA 1W8SA 1OFEA 5AHFA 4FX6M 1LBMA 5DN1A 1MZHA 3HG3A 5EKYA 4UUIA 1K8ZA 1DKWA 2VFDA 3W7CA 2FJKA 2JGYA 4GNJA 4N6EA 3WJYA 5I3FA 4RJEA 2B7OA 3NYZA 4RXGA 2DZPA 2YW4A 3FKRA 1EP1A 3O06A 3M16A 1JCXA 2QAPA 2NUWA 2ISVA 2Y61A 3KRUA 1A53A 1W54A 4JXCA 3TQKA 2GJNA 2QJGA 1J4EA 1TPWA 3O6YX 3RLVA 1QCWA 2V82A 1TPDA 1VZWA 2DP3A 5A5WA 3UXDA 2VFIA 3NQEA 5DXYA 3KVJA 1GQNA 1U83A 1SFJA 3QM3A 1J5TA 2YDAA 4LV4A 1L6YA 3EKZA 3CT7A 2WSRA 5DCEA 4TIMA 1AW1A 1FDYA 1H50A 4WY0B 1DVJA 3W2KA 1X8FA 1DBTA 1ML1A 2VEPA 3TU9A 4H6KA 4D2JA 2E6FA 1VLWA 2ZCGA 4LU0A 1VCVA 1WQ5A 4JTJA 3TFXA 2RH9A 3QSTA 3NQDA 1BWLA 2JGQA 5HWJA 1MO0A 3MBFA 4MFEA 3NZRA 1FWSA 4MVAA 4JDYA 5FI8A 5AHIA 3W1PA 4JTKA 1R2SA 1VCGA 4GFSA 3C3NA 4LWWA 3SR7A 3CWNA 4JTIA 4UFJA 1H1ZA 1TPH1 1TQJA 4IMDA 5DCBA 2IQTA 1TSIA 3DH7A 1EIXA 4AAJA 1HG3A 3EXTA 1W5MA 3W1MA 1SO5A 1X6UA 2DZVA 1RPXA 4GXMA 4RX0A 1P0NA 3LHVA 2F84A 2EKCA 3W76A 3Q58A 4UNKA 2OZ0A 4Y6GA 3PUOA 2NWRA 3M9YA 4XWUA 1Z44A 3S1VA 3W2NA 2E68A 3TE9A 2J9XA 1Q45A 5BRBA 4JTLA 5CSRA 3L9CA 1F05A 4UR7A 3IIVA 1KTNA 1Q6RA 1XXXA 4NJIA 1YDNA 3GDRA 1GYLA 1YDVA 3O6DA 4LS1A 5KZMA 5EYWA 2V5BA 3Q2DA 3S5NA 3TW6A 4ZQCA 2OX1A 4NJKA 2TPSA 3MO7A 3TA6A 2ZZ3A 3KVKA 4IMEA 4JS3A 1VC4A 1W37A 4UTLA 1ZAIA 4KWVA 4DO5A 3RNDA 1KV8A 4FNQA 1PS9A 5CZ0A 3T78A 3EX1A 2JKPA 2Y85A 5CSSA 3QPZA 1IXQA 4XKYB 3G22A 2VOMA 2YX0A 4NNBA 1QWGA 1TTQA 3PSWA 1JCMP 1G4TA 4PODA 1JUKA 2Y70A 1W31A 2Z1BA 1G7VA 3WJWA 3P5ZA 3C56A 1TPFA 3HMJG 4KFPA 2J88A 2NX3A 4C1KA 2ALDA 2D73A 1EWEA 3P80A 3G8EA 4ZQOA 1GVFA 3M0ZA 4AHOA 2P1FA 1GEQA 1VYSX 3LCXA 3UWZA 2JK2A 1GVQA 1G7UA 1KFJA 3IRDA 1D9EA 4Z1AA 1ADOA 4LVDA 2Y88A 3RF9A 3S0CA 3UWYA 1XDLA 2C19A 5G1TA 3C61A 1TPVA 5D37A 1W3TA 2QAFA 2Z0IA 3EWBX 3NQMA 2QF7A 3GX9A 1OX5A 5D32A 2ZTKA 4ZQNA 3W1LA 4OU1A 3G18A 3EWUA 1AK5A 1H7PA 2Y7EA 4N6FA 2R94A 3NM1A 2E6YA 3QSRA 4IPIA 4UTTA 3RLUA 1HTIA 1JJKA 2GVLA 3QMRA 2QJHA 1ZALA 3ATZA 4OE7A 3STEA 3MI6A 3QQ1A 1LYXA 4DF1A 2P0OA 5FEXA 5SWUA 3PBVA 4M6QA 3H55A 4O54A 4O1AA 3ANYA 1W5QA 2PRLA 3HGJA 1OX4B 1T96A 4QIUA 5HUPA 1FWRA 3BVJA 4KWWA 4CCDA 2WKJA 4PH6A 1LORA 4TX9A 4LV9A 1OABA 4MZYA 1O4UA 2CU0A 3B0PA 1QR7A 5A8GA 1EUAA 2X1UA 2ZRUA 3TJXA 3G24A 4UTWA 1P1XA 2Z6JA 3C52A 3G1SA 4HNTA 4K37A 3LCWA 1M5WA 1IIHA 3KXQA 5EA9A 3QW4B 4NU7A 5E93A 1UBSA 2FB3A 1M7OA 1R46A 5HQEA 2J27A 4HIBA 1LOSA 1ZAJA 1OF6A 3PBUA 1I2NA 4P2VA 1C29A 3TW7A 3W2MA 4O50A 4FNRA 4PL2A 3DHFA 5T26A 3M1ZA 4UFKA 2Q8LA 4DO6A 1ONRA 3T4CA 3M43A 3M5VA 4WQ6A 3WJZA 3E0IA 4FIQA 3DFTA 4UNLA 2ZA1A 1HUVA 2A6LA 3QW3A 4FNPA 4UTWC 4CQ9A 4FF7A 1H61A 3DAQA 3FIGA 3FJ6A 4FNUA 3SGUA 3B06A 1WOAA 1PHWA 3W23A 3TAKA 3PR2A 5G4WA 3MI2A 1SSDA 3NQVA 2XN1A 5LHFA 4HT3A 4BWLC 3BLIA 2DZXA 5C5YA 1I45A 3OIXA 4WOZA 4QM1A 4RZ4A 2VFFA 4HSNA 4RCXA 2VXNA 3T7VA 4JIQA 1QPQA 3C2EA 1VLIA 2X1TA 1CI1A 3EWZA 1TTJA 3HF3A 1XBVA 4E38A 4ZL1A 4XTIA 2RKXA 1QPNA 3O15A 1O5XA 3W2UA 1FDJA 3EWWA 4N9BA 4NXKA 3A5FA 1XBYA 3G1DA 4JIPA 1SPQA 4ML9A 3LLFA 1ICQA 1FWWA 4JN6A 5AYXA 5HNRA 2ABBA 4YLWA 4K8HA 4CNNA 2JBMA 4LC6A 1NF7A 2JKAA 4ZVJA 2B4GA 5D05A 3STFA 3JRKA 3G0SA 3GAYA 2CLOA 3LCIA 1OHLA 4X22A 1V7YA 2QEZA 1DHPA 3OHIA 4XZ9A 1HFBA 1HO1A 2WQPA 2JKEA 1YADA 3EX2A 5AFDA 2Z2UA 2ZA3A 1AW5A 2YFOA 5C6MA 3TKFA 2QUUA 2QJIA 2QUTA 3SFKA 1FQ0A 5IBXA 1K7FA 1KM2A 3NPXA 2E6DA 3OA3A 2B0MA 1SR9A 3GB6A 3R13A 4S2CA 3TQ0A 1OG0A 1JCNA 1H7RA 4OV9A 5D04C 1FWTA 5KITA 4PC8A 3MW7A 3TC6A 3LDVA 2E1DA 1F76A 1FXQA 1VS1A 3HPXA 4MPQA 1QO5A 2Y7DA 3GK0A 3MYPA 2GOUA 3L65A 3R12A 3C2RA 3TH6A 3LLDA 1KM1A 3NPWA 5F2LA 3TSMA 2A4AA 1W56A 2A0NA 1S5VA 4K39A 1QAPA 3HGRA 5AN7A 1WV2A 1LM1A 3IVSA 5HJLA 3BO9A 3W7MA 4AWUA 3CC1A 4LW7A 1TV7A 3TUUA 3T55A 5F4SA 3TSBA 2NX1A 2Q3OA 1QPRA 2PRMA 1U5JA 3ZWSA 3IGXA 3LCLA 3PULA 4MJMA 4HNUA 3B05A 3M5ZA 4M7TA 5FESA 3I6RA 1FCVA 1VHCA 4A29A 3V75A 3M5XA 3P67A 1P0KA 4KFNA 4HPJA 3SW6A 3CTLA 4NVTA 1YXDA 3A23A 3P7YA 3BK0A 1SZFA 2NV2A 3IGSA 1B57A 5I3KA 1ZY9A 2NZLA 2GQ9A 1T99A 4FNSA 2OCZA 1TTIA 1UUMA 3DXIA 1O95A 5AOUA 4NX0A 5C54A 6TIMA 4IWWA 2CLLA 4DPQA 1R30A 3O05A 3R5EA 3GDKA 2RDUA 1KTBA 3HPSA 2H8ZA 1B3OA 1K02A 2Y7FA 3TJLA 3DGRA 3LERA 5HWNA 2HSAA 4G1KA 1IGSA 2V8ZA 3INPA 4TR9A 5D2VA 5I3GA 3NL5A 1GVRA 1EPXA 3MUXA 4LOCA 3PB0A 3O07A 4A21A 1LOLA 5G5IA 4UCGA 1NF0A 3GR8A 4IXHA 3RK8A 4RZ6A 4QAIA 3GLCA 3W72A 1LDCA 3G1FA 1JULA 5D2TA 4WXZA 3W7DA 1SW3A 4Q33A 4O1CA 1GPWA 1A5AA 3P8IA 1SW7A 2PCQA 2R8WA 3NAVA 1XFBA 2QDHA 5D03A 3T44A 1Z42A 3LCHA 5LNSA 4RK8A 3EXSA 5TBOA 1YPFA 3PY2A 2ZRVA 4BI6A 3KVMA 1I4NA 2FQIA 1KW1A 1P5BA 2WOQA 1LOQA
chains in the Genus database with same CATH superfamily
2OG9A 3CBWA 3V0TA 3LTYA 3T07A 2VNCA 3TQPA 4ZOBA 4ALDA 1VBRA 2O9TA 4KERA 1FH8A 3AU6A 5CJMA 2D2HA 3DBPA 3WD4A 2HVNA 4MKSA 4JEQA 4JX5A 2D69A 1FWNA 1V79A 1CZ1A 1W5NA 1O68A 1LRNA 1Q6FA 2NQHA 2ZRZA 3PN8A 4ILSA 4K3ZA 4BI7A 2VZUA 3LX9A 1P0EA 2EO7A 1T8QA 3B8DA 1VFSA 2E9LA 5A6TC 3H4XA 3H7VA 2E77A 1NH6A 1VFTA 3OQEA 1KCKA 4JFUA 1VKFA 4PMRA 4GPNA 2OQLA 5AZ1A 3WLOA 4AG0A 1S5NA 2X30A 1MUMA 4MLJA 3B0VC 5DEZA 2EKGA 2X0HA 3CZJA 2GGIA 2ATSA 2UY3A 4MLRA 2NV1A 2P76A 3V1HA 1RVKA 1PTDA 1DWGM 3UETA 1KXVA 4LH8A 3P0XA 4WOQA 2ZZ2A 4O8RA 1K9EA 4YHEA 3U2EA 4N9EA 1E5JA 2XVNA 4FXSA 5E0CA 3OYXA 4REQA 3ANVA 4E2VA 1JCLA 1W9UA 4TVUA 3R43A 2XGZA 3EDFA 2YKKA 1UOZA 1IZKA 4ROQA 1UP3A 2WCGA 3S5ZA 3WQFA 1EQCA 4MUZA 1R3QA 3UA3A 1X7FA 3O2LA 5HNUA 2GUUA 4Q8MA 4GIYA 5LIYX 1PTAA 4DUVA 1XH1A 2R1PA 5TAOA 2QPXA 5C8BB 4GMEA 4FLSA 3LPOA 2R1LA 2RUSA 3W29A 3BPWA 1R47A 4QQUA 4AZCB 1IQ8A 3OBAA 4C7DA 3UG5A 1I0BA 4Q8QA 3THQA 2QW5A 1VR6A 3AS3A 1JNDA 3A9IA 2YCEA 1K4GA 3HMCA 3U57A 3VNIA 2VDGA 2GGGA 3QOKA 1RV8A 3KBWA 3ABXA 3AIRA 1PE1A 3VDHA 4JAWA 3F4NA 2E9MA 5K7JA 3W87A 3KBVA 2GVJA 2WBGA 2VGIA 2QMKA 3TZFA 1SQ7A 5IFTA 2DEPA 3FEMA 2WPBA 2NQJA 4CCZA 5C7VA 2FPYA 1FXPA 4LUSB 4WHBA 3W00A 2ATMA 5JQ9A 1P1MA 4O10A 3LBCA 5FJJA 1D3HA 4LB4A 4XV0A 4WZHA 2FFCA 4F40A 3QZ6A 2CHRA 3ITTA 1FH9A 3KW3A 4NASA 4HZ8A 3PWIA 3N17A 2Z29A 1YXYA 1XQLA 3GNDA 4FB7A 3EGJA 4DZHA 3BG5A 1PEZA 3AIVA 1IWPA 2ZUNA 3UNTA 3E12A 4IPPA 1H51A 1H1YA 1GHSA 1NEYA 2QF8A 3U8GA 3GY1A 2E5DA 1R3WA 3SB0A 3AMLA 5HINA 2BGSA 2A6NA 1CXEA 2J47A 3F03K 5KZDA 3FDKA 4KCTA 5CGQA 1BYDA 2RJHA 3UJFA 2CZ5A 2EPKX 3VO0A 1F74A 4TMBA 4KMQA 3A21A 4ZQPA 3BW3A 2FPVA 3S9YA 2YCKX 3IIPA 1JD7A 3TC7A 3GVQA 1M01A 1F6KA 4H9ZA 4H9MA 1MQQA 4HPGA 3VGEA 1ZBCA 4AWSA 4JTFA 4JICA 2HXTA 3M6YA 3AIEA 4HCDA 2PBGA 4IQEA 4C6JA 4M51A 4ZOCA 3L5LA 3BARA 2D23A 1UR8A 3CLMA 1E0WA 3HJZA 5E1QA 2CWNA 5M5DA 1A5UA 4PMYA 3LNPA 8A3HA 4R34A 1R86A 3LA4A 3N6HA 4LB3A 1QI0A 1K6WA 1YRRA 4AB4A 3VYLA 3LS9A 3N9KA 2XG9A 3MS8A 3TN4A 4C6CA 4DNHA 1YYAA 2DZUA 3H2CA 1VRDA 3FNDA 4LANA 1GW1A 4AWTA 4I5UA 3BAWA 4HKPA 1NFGA 3PZOA 1IT0A 4PCPA 2GJPA 1ZENA 1DIEA 4RE2A 4JX4A 2HEJA 2FHBA 3LI1A 5HPOA 3WLHA 1JZ7A 2WVVB 2LLEA 1W0MA 3N19B 4FNTA 4HGXA 3L23A 1KBIA 1W2PA 1NM9A 1I2PA 4XKMA 3LXBA 4XIMA 1MVYA 2YYTA 5GJMA 3LB0A 4S3FA 2X40A 1VYRA 3WBWA 1N8FA 3GBDA 3SI9A 1PKYA 1TQXA 5F2MA 2FDMA 3MSYA 3T0TA 3DFPA 2NXGA 2CLKA 5AC7A 3WK3A 2WCSA 2VL4A 3VNJA 4PULA 3PSVA 1THFD 4DJDD 2BNJA 3RO8A 2FFIA 3SBFA 4OQVA 3W7JA 4EACA 3UJRA 4GUHA 1EXBA 2QPSA 4CD5A 4GWEA 4RW3A 2DIJA 1UD2A 3R94A 1OADA 3RM9A 3DBNA 3WIJA 1DWJM 2DQXA 1JQVA 3N3MA 2D22A 3MBDA 1BYBA 4EF8A 1G4EA 3QTGA 5TQLA 1O5KA 2G5WA 4O28A 2REQB 4W5ZA 3VMPA 1XS2A 1T7LA 4QRNA 3VD7A 1XYMA 2VD8A 3WO8A 1ME9A 3PUDA 4QJ4B 4LYQA 5DBUA 5B7ZA 3PWAA 3ZSSA 3ZFHA 4BF7A 1R9YA 2YB4A 3F4WA 3LQGA 3OIHA 1H7NA 1QBAA 1TR1A 3W1NA 1U30A 2PCEA 3SN0A 1PX3A 3DFSA 3VA8A 1PZ2A 2CESA 3DN5A 1TPEA 2Q02A 2QGHA 4H6EA 3FKKA 1LG2A 4NZFA 3BGJA 3UXKA 2C3ZA 1QI3A 2OGJA 1CLKA 1OIFA 2BHUA 2AKZA 3RR4A 3WL1A 1G9HA 2RGLA 4PUWA 4WY0A 1B90A 3K8KA 4MYAA 1GYNA 5A6LA 2PLMA 4MM1A 4JGDA 3LQLA 3MDUA 1B5TA 4RW5A 2R1MA 3NQBA 1ZNNA 1JDCA 3ARUA 1RUSA 3W0KA 1B4EA 1TPB1 2PWHA 1YE6A 4QG6A 1XW8A 4AZIA 3EEZA 1NY1A 4F48A 2PWDA 3PZUA 4JTHA 3HO8A 3S6DA 1ITXA 5C7HA 5I3JA 3W2JA 4ZO8A 2F6XA 4F9JA 2PF8A 3ABRA 3HQOA 2PZNA 3UT0A 3TFCA 2WMIB 2CBIA 1DWHM 2OJPA 5HJXA 3QGVA 4MGGA 4IIDA 1J9YA 2DPEA 1I8JA 3GFXA 5DELA 4ORIA 2OWWA 1OYBA 4Q4SA 4BQ4A 1ADDA 1WKDA 3OPSA 3MMDA 3P84A 7REQB 3G1AA 2E8YA 4LNYA 4YIWA 3VFCA 4BI5A 2CCRA 3GUWA 1QXLA 1DE6A 4C1LA 3KM8A 3O6CA 2OYMA 5DY2A 3SECA 4YTRA 4QLKA 1EP2A 3OTRA 3W75A 1J2BA 1VAHA 4NUWA 4ZQMA 1RR2A 2PD9A 5I03A 3P82A 1S46A 1WKYA 4DAFA 3NQ2A 3AZRA 1C7TA 4P7OA 4LYRA 1QK2A 2W9MA 2RFGA 3I68A 3G0XA 1KRCC 3VGFA 3W26A 2G37A 4DB7A 8XIAA 2Z2BA 5AC5A 4E8CA 1LZOA 5KSWA 1AJ2A 5FAGA 3TV8A 5ABGA 1U2YA 3CGTA 3MVTA 1S5WA 3Q67A 1MNSA 3EDKA 2XFFA 5AYIA 3BG9A 3U7BA 4HOXA 3SSZA 2NWSA 4MZ1A 2E09A 1WCGA 2VO5A 5HPCA 2BXVA 3EDJA 4G7FA 4O19A 5G2IA 1C8XA 3SY5A 2W62A 3G5EA 2REQA 3L66A 1T40A 3C8FA 2H9AB 2FH8A 3PZGA 1V08A 4ADUA 1QTWA 1R5YA 4HHPA 3PAJA 2C13A 3FYPA 1M7XA 5D30A 2PDKA 1D8WA 5FF4A 4L9ZA 2WNQA 3DHUA 4AHPA 3CUHA 2ZXAA 3R0KA 5I00A 2HMCA 1EZWA 3LV5A 1MDLA 3MMUA 2BASA 2F6UA 1EDTA 1M03A 4ZFMA 2DGAA 4HCHA 5AVNA 1KB3A 1HO4A 1H4PA 2J62A 3T6CA 2WK2A 7TIMA 1KCLA 5AY7A 3QTPA 1JPIA 1PPIA 2VD9A 4JHZA 1E73M 3KBJA 4JDBA 3CUZA 1PCKA 3SCSA 3TCSA 1YPIA 4JIEA 4N7QA 3ZXWA 5C2CA 4IL0A 3B9DA 3PPFA 4U2YA 1UASA 4TO8A 3K4WA 4B9ZA 5BOFA 1UG6A 4IGMA 5C70A 3GXTA 5DMLA 1GCYA 1GKQA 2C14A 5AC6A 2ZRYA 3OG3A 3M0XA 4XKYA 1TJ0A 4UCFA 3BW2A 3EKGA 3AQUA 1UR0A 2V5CA 3TN3A 3D3FA 2OODA 3SN1A 4FA3A 3Q37A 3RILA 2E3ZA 1H63A 2QCLA 3LNMA 2FZ8A 3MP3A 3PC0A 1C8VA 3AYTA 2ZVIA 2PRHA 3RDKA 4CVUA 1Q6LA 5HAOA 1HF6A 1OFQA 3BQ5A 4JTTA 4FO4A 1X96A 3MMTA 3BZGA 3L0KA 3A3WA 4PRTA 2I17A 3G8RA 4I6VA 3K1DA 3LHUA 3PM6A 1QFEA 3B4UA 3I7SA 3OO2A 4V27A 1RA5A 2GWGA 4DJEA 3NCOA 2J79A 4LRSA 1NU5A 1CIUA 2X0YA 2CXGA 4UTJA 3SCWA 1K03A 2W79A 4FHAA 4O1DA 4HA0A 3UGVA 3T0DA 2CLHA 4B5NA 1OCQA 4DUXA 2XVKA 4QG9A 2G41A 5D09A 3FCPA 3THDA 3A22A 3GZ3A 1JRBA 2CZDA 2ZYFA 3VM7A 3MSGA 2NUYA 3UJSA 3GH7A 1E51A 1DIOA 3IGUA 3ZT5A 3JU2A 4CEXC 2J9ZA 3N6JA 5E6ZA 3DFQA 4E4PA 1XSKA 3WK2A 1GOMA 3VXGA 1RLCL 1GYMA 1YQ2A 4OUIA 3F1QA 1DIKA 2VRKA 1FP8A 1OC7A 3QHNA 1H0GA 4IMGA 3URNA 1TVPA 1SUXA 3FYYA 3KWSA 3DKJA 4FR1A 3B0YA 3W82A 4DO4A 3ZLFA 3LHZA 1NWRA 1UD8A 2D24A 3SCPA 4PMJA 2A7PA 2Y2WA 3WUFA 2PTZA 1JF5A 3BV4A 2KZHA 1DL3A 1L6SA 1QNOA 4LX4A 4DF0A 3B9EA 5C55A 3GG8A 5HMDA 4TUFA 1JAKA 1OBAA 3N11A 1TPUA 4FX7A 4B92A 4D6FA 5KMYA 3ENLA 1S3HA 3CPGA 5EU9A 3VILA 5LGXA 2TRSA 4HU3A 4F4RA 5HDRA 4QCFA 2WC7A 1RCOB 6XIAA 2V5JA 3QXBA 1A5CA 3N2MA 4MSSA 3UBPC 4Z1BA 1HL8A 2FHFA 4FZIA 3EOLA 3RCNA 3VGGA 3W7EA 3R11A 1A47A 4Q4RA 1R2RA 2Q8XA 2E9BA 3TYCA 3SADA 3VNLA 5K9CA 2PLJA 4Y7EA 3UPWA 3MPGA 2QCDA 5LXEA 4WEVX 1F3TA 2J6VA 2QZRA 3HGOA 3LUTA 1V5XA 5BXRA 5I78A 1F9CA 3W01A 3NA8A 4KT2A 2P53A 4JNMA 4W4QA 1O1HA 4LUSA 1MEWA 3SCRA 4AUBA 1EC9A 4L4LA 2IKIA 2QV4A 5CZTA 4DYKA 1J0ZA 4RV3A 1A3XA 1DXIA 3W6MA 1EFZA 3VE9A 3RYSA 2TYSA 5MHBA 3T0AA 1I2OA 2GJRA 3LHWA 4IH3A 2BFGA 5DMMA 2PGEA 4L61A 3ZS4A 1IE7C 4DPPA 1FA2A 1EOMA 2VHLA 5CC3A 2C1GA 3GC4A 4JTGA 3CT2A 3GD6A 3HV8A 3DHPA 1U33A 2H6RA 3AMKA 3EA3A 4IFRA 3W7OA 2V5LA 1R2TA 3W1XA 3WDRA 4Q8VA 4CU6A 1VFHA 3W83A 2VEKA 4IX0A 4MB4A 3PBYA 1F8IA 1U5HA 2VGFA 3NPUA 3SZ8A 1F3WA 2PDCA 4ADTA 1XC4A 5CJNA 2CW6A 3IJDA 4QR6A 1IYXA 1S2UA 1KLZA 3W3OA 4IG2B 1CLVA 2QUVA 3ZT6A 5F7UA 2YL6A 2WXDM 1JZ6A 5BMXA 3O16A 3U3HA 1W1IE 4O57A 1P6CA 3N1AA 3P5YA 3HN3A 2DZWA 2PDHA 2XN0A 3H6OA 1LQAA 4O13A 2HE8A 2VX4A 3SCUA 1GVOA 4OWGA 5ABHA 5BNKA 1XM3A 3CUJA 4S39A 3URQA 2YDSA 4UBPC 3VIPA 3VGDA 2EPNA 3TLLA 2PWGA 1ZGDA 3POCA 5FOOA 4GQRA 3CV7A 2D2GA 2A2IA 2ISFA 3BLPX 3GUGA 2RDXA 3UR5A 2IMRA 3AS2A 5JIPA 4IJCA 4XVEA 1UPPA 1KKRA 4Q6JA 1LBMA 2JF6A 3MVIA 4UNIA 2QJMA 6ENLA 3B8TA 3W7CA 2FJKA 4KEUA 2PDJA 4RJEA 2B7OA 4Q4QA 2E4TA 3T4WA 3O06A 1RXOB 4Z2GA 3M16A 2OSYA 2QAPA 3KBSA 7TAAA 2ISVA 4YTSA 2BVDA 3KRUA 4YWSA 1M3UA 2QJGA 4KCWA 1TPDA 1UWIA 2DSZA 3NQEA 5DXYA 3KVJA 3FAXA 3QOMA 1LL6A 3QM3A 3EKZA 3CT7A 3OOQA 2WSRA 4DXXA 1AW1A 1FDYA 1H50A 4UZSA 1DBTA 1XLAA 1JNEA 3VIGA 3VNMA 8XIMA 3VGBA 4EKJA 4V1XA 3QSTA 3KEHA 3T1GA 2HNEA 3MBFA 3NZRA 1GPFA 4JDYA 5FI8A 4JTKA 4E8GA 1VCGA 4LWWA 2WJFA 3HQNA 1FWDC 3TOPA 4JTIA 4GYPA 3GXIA 3RUBL 2IQTA 4KRUA 3I4EA 4IP4A 3GTHA 3MA8A 2OZ0A 4Y6GA 1TA3B 2PEVA 3PUOA 3M9YA 3W2NA 2E68A 4PTDA 4JTLA 5CSRA 1PKLA 3OLGA 2BVTA 3L9CA 1F05A 4DJFA 4UR7A 1R6WA 3WF3A 3AJ7A 1XLJA 3WF2A 1CGTA 3BAKA 1XXXA 2DZBA 3GDRA 4H41A 5KZMA 5EYWA 3V18A 3Q2DA 4ZQCA 1E9IA 3IJ8A 2G3IA 3WMLA 3R8HA 4IMEA 1VC4A 4DWSD 3RM8A 3UCQA 3S9IA 5T9BG 3LENA 3UR8A 4WKHA 2VOMA 2YX0A 1H2JA 1QWGA 4B15A 1JCMP 4H8HA 1JUKA 2Y70A 1W31A 1G7VA 4G7EA 1FWCC 3WJWA 4BJHA 2FTYA 3T2PA 3B9OA 4KFPA 2J88A 2NX3A 2ALDA 3REQA 3P80A 3PZNA 4F66A 3NSNA 4ZQOA 4QS5A 1A49A 4AHOA 2P1FA 2BBFA 3NJ3A 3IRDA 1G7UA 1ADOA 2WVTA 2Y88A 4TV6A 3RF9A 3S0CA 1TPVA 1EYWA 2QAFA 4AYSA 2QF7A 1BD0A 5HJYA 3GX9A 1OX5A 1PWMA 4OU1A 4L9XA 5XIAA 5AECA 1H7PA 3CHFA 1K9DA 2R94A 4GVFA 1Q8JA 4I9TA 4EX4A 3EA2A 4UTTA 1JJKA 4OE7A 3STEA 1LYXA 2INFA 4E8DA 2WMIA 1FKXA 4S38A 5CXPA 5SWUA 2PDNA 3PBVA 3ME3A 3H55A 4O54A 3ANYA 3MCMA 5BWFA 4GOAA 4KWWA 3DFHA 4XG1A 4WGHA 1LORA 3EDDA 3KHDA 3DCPA 2PP1A 1EUAA 1VJSA 1XYFA 2XH7A 4JHOA 3EB3A 3TONA 2Z6JA 3QGAC 3GNPA 4G9PA 4AD5A 1TV3A 5E93A 2ACSA 1UBSA 3BGAA 4HOWA 1M7OA 5EFFA 3PBUA 1I2NA 4MJ2A 2ZE3A 5HMEA 1TELA 4NHVA 4I3GA 1RCXB 1UZDA 3OHMB 1EHNA 4FNRA 3MO4A 3KUMA 2UY2A 3M5VA 4HA1A 3GR4A 3E0IA 4FIQA 3DFTA 3BMVA 9XIMA 2ZA1A 4ZOEA 1HUVA 2A6LA 1PTGA 3QY6A 4UTWC 4KPLA 1BKHA 3POHA 3FJ6A 3WD2A 3W24A 3ANUA 5C9ZA 4L7ZA 3B06A 1OGGA 1ZP4A 2QXWA 3FGCB 2GFTA 1UKTA 2VFFA 3MQTA 1QPQA 3EPOA 2X09A 1F4AA 3TW9A 4E38A 4ZL1A 3MU7A 3E6EA 2RKXA 4E3VA 2ZOXA 3O15A 4XAGA 1O5XA 3EMCA 3W2UA 2CYGA 4NXKA 3EWWA 4EAMA 3KDOA 3IARA 4ML9A 5LA2A 4QCEA 1TV4A 4EPEC 1VIZA 4GZJA 3OYZA 2Y5JA 3V36A 3V7PA 4LC6A 4ZA0A 5DT5A 1Q65A 4NRSA 3VKDA 1KGUA 4X22A 2J8FA 5E70A 3IPWA 3EX2A 3H8AA 3GVVA 2VZTA 3R8GA 3WNLA 3F2CA 1ZBVA 2Y1HA 2ZA3A 2YFOA 3APGA 1WUFA 2QJIA 3AAMA 1TR9A 3W53A 4S2CA 3TQ0A 1UPMB 1OG0A 5D04C 4LFYA 3RPTA 4PUMA 2RGMA 4S3CA 3LDVA 4E4UA 3WH8A 2DSKA 1F76A 1FXQA 5JMUA 1C8YA 1VS1A 3HPXA 4MPQA 3GK0A 2UY4A 3LLDA 1OG6A 1KM1A 1FFQA 1JCTA 6XIMA 1QJWA 1P43A 4JN7A 1S5VA 2VDHA 4K39A 4P8XA 4S3KA 1QAPA 3HGRA 3NWRA 3TOYA 5LA1A 5A6MA 3IVSA 4AD2A 2CERA 3T55A 1ISVA 1QPRA 2PRMA 3LCLA 4B3LA 1J93A 3HPFA 2DZAA 3B05A 1HKWA 1JPKA 1W8GA 3EOUA 4A29A 4GGHA 1W1A1 3TEVA 2Z25A 3M5XA 4MWAA 5I6SA 4HPJA 1EBGA 3BK0A 1XYLA 4R27A 1ZY9A 3LPGA 1GHRA 4RDZA 2OCZA 3M0JA 1WXZA 1W9XA 1TTIA 5C54A 1XG3A 1W1PA 2CLLA 3BOXA 3R5EA 4C65A 1B3OA 1K02A 3HFYA 3DGRA 3RAOA 5HWNA 1RP9A 1GONA 4G1KA 5REQA 1CLXA 4O1EA 1VEPA 3NL5A 1GVRA 4LYKA 1EPXA 3T05A 4LOCA 5I2UA 3PB0A 4V15A 2XZ9A 3ZVHA 4HA4A 1E43A 2MUCA 3RK8A 3QR3A 4QAIA 3WLPA 5T9CE 1X6NA 2Y0FA 4LBUA 3IUHA 4YVXA 5BXPA 4U5IA 2PDXA 4QROA 4O1CA 1KC7A 1FHLA 1GPWA 4US5A 1M53A 4HTBA 1E6XM 3P2VA 9CGTA 3BAIA 3NAVA 1V93A 3PPCA 4CNUA 4MNKA 3AUOA 1XIDA 1UQZA 4S3EA 1ZS2A 1VFOA 3LCHA 5LNSA 4AC7C 4C5YA 3EXSA 4CD8A 2F38A 2ZRVA 1FWFC 2P88A 3WNMA 1YDYA 1HGYA 3VCRA 3PZ9A 1E9YB 4N9CA 2J66A 1XC6A 3WG6A 3VIMA 4M6VA 2ZZ5A 2D2JA 4QISA 2D20A 4HNNA 3CPRA 1A50A 5DT7A 4JNZA 2FPTA 3PZQA 1E1FA 3N34A 3WMCA 1E1CB 3FW6A 4GC4A 1NJJA 3A9BA 4CEUC 2IPGA 3S83A 4S3BA 1KGXA 3BOLA 4G6CA 4GGBA 3GDTA 3WN6A 1UR3M 5DXXA 3K4DA 5FF2A 3QHOA 3GKFA 2ZUSA 4A2SA 3VU2A 3C6CA 4Z1DA 4NT0A 4GQQA 2OT0A 3IGHX 4J3SA 1SMAA 4UQAA 4YCPA 1UH3A 4Z2IA 4XB3A 3AUJA 4A3UA 1TMLA 1XIBA 2I1OA 1I1WA 4LVAA 4PN2A 3FVMA 4Z0SA 3BW4A 3IIXA 1XGDA 1VH7A 4LJ3A 1OFPA 1F6PA 1DJXA 1ECQA 1OCBA 1P7TB 4J3TA 1VB9A 3W22A 4GI6A 3L2LA 1BHGA 2PURA 4LUJA 4QAWA 3UXAA 4RE0A 4PMQA 3CQ0A 1YBQA 2EPLX 3AYSA 3QZAA 2XVGA 2X8RA 4EXBA 1W3NA 3IK2A 3ITGA 4X2RA 1L6GA 1YNQA 2AL1A 3ZT7A 3ZJ7A 2ZZ4A 4L1GA 3OA5A 4NX5A 3L68A 2VWTA 4UFLA 2F8QA 4PBGA 2Q01A 3B04A 1DQXA 3NQ6A 5LIUX 4OHQA 1T0OA 2I14A 4DBUA 3SO7A 3W1TA 1ITCA 4KIRA 2ZVRA 4IUOA 4UQEA 4MFDA 1TWDA 3BQ6A 1XSIA 3MB9A 5F2IA 5A8NA 1UWRA 4K7YA 3UY7A 4QE1A 3EWXA 4KFOA 5BMWA 4HMCA 1O7AA 3DKLA 3I10A 5CJ5A 1JYNA 2GSJA 1PIGA 1YBQB 1SZEA 1Y8BA 3WBYA 1N8WA 2OTDA 4HYRA 2I57A 5IM51 3F5LA 4L4MA 1HJXA 5CAKA 3M0YA 4RUBA 1B2YA 3NL3A 4TX6A 4XBKA 4NL1A 3G3DA 3R10A 2P0IA 2V30A 2QCEA 3CMJA 1TMQA 4N4QA 3G1YA 3UWUA 3TR2A 2HVMA 4AZCA 3CASA 3ZR4A 4O11A 3C2FA 1PWLA 3PAOA 1PX8A 1MMFA 3BXWA 3P74A 2VR4A 3UWWA 3GG0A 5DANA 1O12A 3R2GA 3S2JA 3EX3A 2GQAA 3OLIA 3V0UA 4UFMA 1M7PA 3CLWA 1BVZA 3N25A 4DXVA 5H8UA 3PANA 4H9UA 2BZNA 2R82A 1UWUA 2F6KA 3E3HA 3T08A 3MHUA 1DJNA 4ZXLA 4AZBA 2WKLA 1H3GA 3MZ2A 5DLCA 1KCZA 4PUUA 1QHOA 2JQXA 2PU1A 5F1VA 3DI1A 3VGHA 3PWGA 4YCOA 2E8ZA 4ZE5A 4Y9AA 3DECA 1O1ZA 1HKMA 3VOCA 1AQHA 4XAZA 3WD3A 1FHDA 3ZJ8A 1W1VA 2EHHA 3KTXA 1IZJA 2O56A 1DOSA 2OO6A 3GDBA 3C2VA 2VKZG 3DEQA 3AIWA 3MJYA 4GY1A 1J0KA 2HV5A 4WXYA 2V67A 1ICPA 5BOEA 4B5WA 1AFSA 3JW7A 3PZVA 1PXGA 4MWAC 2P50A 1CX9A 5I02A 4N0RA 3AIUA 1ONXA 2F2HA 3BL3A 1Q6QA 1VHNA 3RFAA 2ZX8A 3AC0A 1LCOA 3RHGA 3S2LA 4R7JA 1A4MA 1Z48A 3CHDA 2ZRWA 1ZCOA 1H7OA 4MZ8A 4S3JA 3IVTA 1DE5A 3MT1A 3NDOA 3C0QA 2UY5A 5JXQA 3C2OA 4W89A 1V8EA 3T0BA 5D9OA 1TE1A 4RE3A 3PUEA 4S3DA 5KETA 1LUCA 2QDEA 4CU8A 5E09A 4NAFB 1C91A 3W7GA 1BF6A 2VR5A 1EIBA 3M47A 3QLDA 3QJAA 2DDXA 4EIVA 1E15A 4XBSA 2XH4A 1BGAA 3IEBA 3WK0A 3WH5A 1C9DA 1TA3A 3PTKA 1TVNA 3SAZA 1UB3A 4Z42C 5ENLA 2X42A 3UG3A 1A5SA 4EOUA 3M5YA 3UA4A 1A3HA 2E40A 3HBLA 4OIFA 4XZHA 1VIWA 1ME8A 3UFYA 2QR6A 4XAYA 4ZTXA 5KTLA 5G2HA 4QG8A 4DLMA 1PL9A 2YPIA 3FSTA 3AHYA 1YPXA 3VK5A 1VP5A 3N9RA 3M64A 4CNPA 2DT0A 3GWQA 5FF0A 5BROA 4FEZA 3KFTA 3V4BA 4I90A 4WY0F 4MJZA 1MUWA 1OFBA 4R7WA 1VPYA 3GNNA 3RIKA 1ENUA 2CKSA 5AB3A 2CFFA 4PMVA 3UZXA 1M7JA 5CSUA 1Z41A 4DWDA 4G5DA 1TMHA 1P6WA 5I0DA 4FLRA 2WVVA 3UR2A 3IAPA 3WH7A 1L9WA 1XX1A 4C6PA 2ZRXA 4PEEA 5LHEA 2IXUA 4L1WA 2QCFA 4OT7A 2Z7GA 3NXFA 3DI0A 4IQDA 3QEZA 2OPJA 1K7XA 3JVAA 5LKYA 1US0A 1X1ZA 4AF0A 1UUQA 3DUGA 1ECEA 4OZOA 3HPZA 5JVLA 3HG4A 5AVHA 2Z1XA 3MP5A 1SFLA 3ITYA 3KTCA 1DJZA 3LTSA 2X0SA 3LGDA 4EANA 4BEUA 4NYYA 3UZJA 2EPMX 4OVXA 1WZMA 4HTYA 2ZX6A 3VKJA 3UYIA 2VI0A 4S3AA 4M24A 3VIHA 2XIJA 3L67A 1R85A 3MSDA 4D6JA 1H11A 1QNPA 8TIMA 3VTRA 2J8GA 2C18A 4A3QA 5K9DA 2QCCA 3H22A 4AWEA 2CETA 3CHCA 3CTTA 1XLKA 3GU2A 1X97A 4AIUA 3PFMA 1C9WA 3BSHA 4ACYA 3KZSA 1HJVA 1SJBA 4DJDC 4GO9A 3N15A 4GYFA 3RU6A 2BG5A 1WZKA 3P60A 3AHVA 4A2RA 3KHJA 4WRHA 2BOFX 1EGZA 5AHMA 2E25A 6PTDA 3OGSA 4KGLA 4S1FA 1SZNA 4G56A 3TYEA 3FJNA 3LI0A 4HPXA 1GG1A 1GOXA 2XSBA 3W7NA 4HHMA 1MW3A 1CXFA 3W71A 1SGJA 2VMFA 4PMXA 3B8SA 2V0TA 3WELA 4LS2A 5HMSA 3N3TA 4IPLA 5EPDA 2POTA 1V0NA 1NQKA 3H7UA 2J6XA 1WAWA 4MG4A 5G4HC 1O66A 3LPFA 4MTVA 1JPHA 3DFOA 4UWMA 3HM7A 4YTTA 1MEHA 1D7FA 5D2YA 3M46A 3GNOA 1OYCA 3KBNA 2CZFA 3NNTA 3FA5A 4QNWA 3S1XA 2J75A 2Z28A 5L6UA 4LAKA 3PG8A 3BCJA 4PTWA 4UR9A 2YR1A 1XCFA 4R7OA 3SQLA 2OWCA 1EF3A 4NF7A 3IJQA 3KCJA 2C1IA 3VD9A 2OMAA 3VOIA 1AMYA 3WJSA 4U3CA 4C6EA 1XL9A 1EWDA 4U28A 1TREA 2V2HA 4DBEA 2ZTJA 4PYSA 2WZIA 3MDWA 1RQHA 3BTNA 1TWSA 1HL2A 1XISA 5J5RA 3E2VA 2VUNA 4ACZA 1QHZA 5HULA 2WSQA 2PGRA 3W07A 2W92A 5BCAA 2HISA 3BUVA 3MWAA 4HPHA 5GNZA 1Q6EA 5LNRA 2BY2A 3EX4A 1IT7A 1ZLPA 2A5HA 4JY8A 4LALA 3V5CA 4V2XA 4Z1CA 4NI3A 5H91A 1SO6A 1XRVA 5EMKA 3M7SA 4JYEA 5FJUA 3DGBA 3SCVA 3ONBA 3WKZA 1IGWA 2ZX5A 4HHLA 2YBUA 4K6AA 2FH6A 1ZCCA 3K2GA 1QPOA 2E7FA 3EKLA 3LOTA 2AGTA 1GORA 1E40A 4QJ1A 1DPMA 4B2DD 4ZZ9A 5FSDC 4MY1A 4LS0A 3URAA 5I07A 3N14A 3TC3A 3VX1A 1A0DA 1WXJA 3GXDA 4EPBC 1MXGA 3IV3A 2V63A 5LZLA 3M0IA 1JD9A 3C0JA 4MKVA 3LV6A 3R25A 2BOGX 4X60A 1SM9A 2W5FA 4R5EA 3LSBA 3EX6A 2RJGA 2GWNA 3GVGA 4IFKB 4R33A 1SSGA 1UQYA 4H8UA 4JTSA 3TNOA 7ODCA 4K36A 5LYRA 1RVGA 2INZA 2X1RA 5HMFA 2PE4A 1ZZMA 3WLIA 4BQ2A 2TMDA 3QKZA 2VFGA 2EG7A 2WPGA 1Q7MA 4N42A 2ZA2A 3A47A 4MB3A 5JBFA 3VI2A 1J01A 3A4WA 4GINA 4PMNA 2L5HA 3OVGA 1K4HA 3KX6A 3ZZ1A 4C6QA 1HP5A 2AQVA 2NSOA 4J5NA 5GJNA 2DUAA 3QGKC 1VBJA 1Y5VA 3MHGA 2VCAA 3L7RA 4NG3A 3B0XA 3T40A 5E0FA 3L5AA 1RK6A 2ZZ7A 4NJJA 1EB3A 1VYPX 1EEXA 1WDDA 3ARTA 2DSVA 3QZEA 3MY9A 3L5MA 4BZYA 4GUGA 2GPTA 2CBUA 1RA0A 3ZVHB 3ZLGA 4KBXA 3KOZA 2C79A 3DHDA 3N04A 1JQXA 1KFKA 1EJWC 4K1WA 3GDMA 3VOHA 1HZYA 2XWDA 1KM5A 3CL6A 5CLWA 4JFSA 4C6NA 4L6OA 3VMNA 4QSHA 1TJ1A 1GZGA 3BLFA 4Q4PA 4FOKA 1AZ2A 3SRKA 3FJLA 3W85A 3HG5A 4LAOA 2PWUA 4Y90A 2WJEA 3M6DA 5HR6A 3KRZA 3O8AA 4LXFA 3VCCA 1E1CA 3CIXA 4MADA 4K1GA 1XLFA 4WGXA 1V6UA 5LIWX 1FFRA 1FH7A 3USZA 3DG6A 1S5TA 5AYYA 3VC6A 5TD4A 3SY1A 3D5HA 5I7GA 3WUBA 2O9PA 1V6WA 2EGZA 3CQKA 2J7HA 3BCDA 3W2LA 1QW8A 4JYFA 1XUUA 3G1RA 2HS6A 3T8QA 4H2CA 3FAWA 3S1UA 1RJRA 6REQA 2QIWA 3SGGA 1KRBC 3CAVA 3APTA 3W7RA 1XYCA 1VJIA 5TIMA 1O5RA 3S5YA 3H7RA 3O9NA 4W85A 3NQCA 3WH9A 4QEEA 3XINA 3CXOA 3VKAA 3QN3A 3CV2A 4CNSA 4JL2A 1I75A 3QV7A 1W6TA 1XLIA 3LTPA 4OECA 2VGBA 1VEOA 3N2TA 1P6BA 4ECLA 4IF2A 2XIOA 1RBOB 1W32A 4E2OA 2R9RA 2VC6A 3NVDA 1NDZA 3RCMA 4PUDA 2OB3A 1BWVA 2GK1A 1JCJA 4O52A 1MEIA 2FMNA 1ZUAX 3BANA 2Y89A 5AZ0A 4X9SA 2FB2A 4H8NA 1JRCA 1SZGA 2H90A 4J2MA 4XD6A 3EMQA 4DN1A 1JR1A 4DX3A 1FUYA 4IXXA 4R9XA 3S5SA 4RNHA 2J9YA 2X16A 4IX2A 1GG0A 3VNDA 4LF1A 2GJXB 2MANA 3WDJA 3LD5A 3WLSA 3KOXA 2QDDA 2G96A 5TNVA 2HTMA 1SW0A 4RDVA 3SUSA 5ABTA 4P8VA 4QLJA 3NQFA 2J7CA 3CAQA 2XYLA 3NEVA 1MSSA 4EWND 2FGLA 1KGWA 1FCQA 1N8IA 1EJUC 1I2RA 4EP8C 1HXJA 1E4MM 3U4FA 3HQ1A 1KFCA 1XRFA 2ZFAA 4M6UA 4C6DA 1BXBA 2XJ7A 1VEMA 4F0KA 2POZA 4GCXA 2A7NA 4M56A 4TTUA 4Z0JA 2ZZ1A 5LNUA 4UC5A 5A8MA 4GC3A 1MXSA 5D2XA 2NVCA 3UEQA 3KP1A 4O0ZA 3NL2A 3AWNA 4IIHA 3V5OA 2YCJA 3SIZA 3Q65A 2NLIA 4LAUA 3S6OA 1XUZA 3N12A 4WDXA 1K70A 3GXNA 2F9RA 1N2VA 1TRIA 4BA0A 1UJPA 5CZSA 1S5MA 5E9AA 2X41A 3UZ5A 1UC5A 4FP1A 4NXSA 1DORA 2OR2A 3WYZA 3R1ZA 3CH9A 4ZE4A 4BF5A 2QULA 3UY8A 1RY8A 3GAKA 1WKFA 2ICSA 1IXOA 2VRJA 1PIIA 1Z3NA 1GTEA 5EBUA 3W1AA 1B3ZA 4ATLA 1PHQA 1KKOA 3PBWA 5G1YA 1TVLA 2WZMA 1AD1A 2DW6A 4PTVA 2OGYA 2BXYA 4PFMA 4MDPA 1OK4A 5H2ZA 5F4WA 3W1QA 2BHYA 4DEFA 3H26A 2C16A 1CEOA 1CB7B 3SUWA 3URBA 1A80A 2GOKA 1KLYA 3NZPA 1AZ1A 1OFDA 1S38A 3HGSA 4ZXOA 1HVQA 4PB4A 1XRTA 4V33A 1XH0A 2J7BA 4AFYA 5HR7A 4REQB 4ZSTA 3L0NA 2NUXA 3SUVA 5EMMA 5ABEA 3MUAA 3MUZ1 3MC5A 1GT8A 3QY8A 3W1UA 1KCXA 1XCXA 1SFSA 3TDFA 3R0DA 1EOKA 1UMYA 3DYOA 1K8XA 2V3FA 4S23A 1WA3A 4POCA 4LY8A 4PUNA 3PBMA 2XH0A 3GS6A 1C92A 3EB4A 4M1BA 1BSIA 2FGBA 3TAOA 3DX5A 4QJ3B 5FEWA 3H23A 4JL1A 1RD5A 2PTDA 5GNYA 5U4NA 1JVNA 4U4MA 1I2QA 3RITA 2FIQA 1TTPA 4AEEA 4F0RA 1E71M 2YYUA 2WAGA 2OZ8A 4PB3A 2J4GA 2BGQA 2GGHA 4W7VA 5EMLA 2QCHA 2ZWYA 1ITUA 4GXPA 3AIQA 1MFUA 4LBRA 4J27A 5CBIA 4FS9A 5FEPA 4GZ7A 1TV8A 3CAWA 3BG3A 4GI8A 4CQ8A 2WSPA 3P61A 1WOBA 3WNNA 5PTDA 2R1KA 2GDVA 1BQCA 3U2ZA 3ARRA 2Q3RA 3GO2A 5I23A 2CZVA 1Q13A 5AHFA 3NTYA 5DN1A 1MZHA 3HG3A 5EKYA 1K8ZA 2JEPA 2VFDA 4N6EA 3A4AA 3AZTA 3NYZA 4RXGA 4PCNA 2YW4A 1AH0A 1ISWA 3FKRA 3V35A 1JCXA 1RJPA 4XD3A 4NZ3A 1A53A 2GJNA 1TFVA 1QI2A 3UXDA 5A5WA 2VFIA 2GUYA 1U83A 1SMDA 4A4AA 4DI8A 5FL0A 4QHRA 1CECA 1E0UA 1J5TA 4LV4A 1L6YA 1W9BM 3VIJA 5A6BD 2DH2A 2IXVA 4I9MA 4C6IA 1AQFA 3F2BA 4A8NA 1JFXA 1OSEA 3U4AA 4Q8NA 3VNZA 1DTUA 4HZMA 3TFXA 2RH9A 3O0FA 1BWLA 1DP0A 2JGQA 4C91A 5REQB 4HJFA 2YL5A 4KESA 3T81A 3W1PA 4P8WA 4G1NA 1UD5A 1W3LA 3SR7A 1VBHA 2FMOA 1TQJA 4IMDA 1J12A 4AISA 1TCMA 4B90A 3DH7A 1EIXA 4P8UA 3EXTA 1W5MA 1X6UA 3M0HA 4V1YA 1RPKA 1NIUA 4GXMA 1P0NA 3LHVA 4GQ0A 2F84A 4HNCA 3Q58A 4UNKA 4EE9A 1EH9A 3M0LA 1X38A 4XWUA 4DVOA 5DF0A 5FA5A 2J9XA 2Z2AA 4H9TA 3UR7A 2D0HA 3OBEA 4OKDA 3IIVA 3N18A 1TWIA 1Q6RA 4NJIA 2ZXDA 2V5BA 4Q6XA 3MO7A 3TA6A 2ZZ3A 4UTLA 1W37A 4ES4A 4C7GA 1IWAA 1EDGA 3RNDA 3ZIZA 1KV8A 4FNQA 1Q6GA 1M04A 5CZ0A 2DY3A 3U7VA 4XKYB 3VUPA 3G22A 3AS1A 1FWHC 3O7UA 5A3HA 2HBVA 3C56A 4GYKA 1HIZA 1XP3A 3HJEA 3V16A 3VM5A 2X1IA 3CJPA 5XINA 1GEQA 3UWZA 1GVQA 1ADSA 4Z1AA 4NYUA 2NVDA 5G1TA 1XDLA 1IWBA 3KOWA 5C0QA 1U1HA 1XV8A 4GLEA 3AROA 3DOPA 2Z0IA 2VC7A 3NQMA 5D32A 4H1ZA 4ZQNA 3W1LA 4CD6A 3G18A 3EWUA 3PZTA 4W8BA 2Y7EA 1TX0A 4AW7A 5DMNA 4RNIA 3BZJA 3QMRA 2QJHA 1ZALA 1UKOA 2VX7A 2PTXA 4DF1A 2P0OA 5FEXA 3SY8A 2VX5A 3NXLA 3HGJA 5IOBA 3BVJA 3HU7A 2W27A 4CCDA 2WKJA 2FVKA 1DJIA 3GG7A 1OABA 4MZYA 1O4UA 2CU0A 4HA3A 4PGLA 2ZRUA 3UWEA 4RZBA 3AYVA 4K37A 4RDWA 1E3ZA 4ACZB 2UWFA 1P0BA 1QI5A 2FB3A 3THUA 3TN5A 1L6FA 4HIBA 1LOSA 1ZAJA 2QUMA 1OF6A 4P2VA 1RBLA 3LZ5A 3WNKA 1MFVA 4D6IA 3TW7A 1MRAA 2W61A 1R7AA 1A0EA 4PL2A 4BQ3A 4US5D 5T26A 2WM0A 2Q8LA 4UFKA 4XZIA 4DO6A 1M1BA 3TTEA 3M43A 3E74A 4WQ6A 5HA7A 4JTAA 4GVGA 1EZ2A 4GQGA 2FVLA 4HYVA 4A8RA 4FF7A 1RH9A 1H61A 1Z32X 1WDSA 3E5PA 1WOAA 5A2AA 4A8IA 3E2RA 5JUVA 2WHJA 5G4WA 4ZO6A 3WUGA 1SSDA 3NQVA 4BWLC 1JPDX 3VDAA 2D0FA 5C5YA 1RY0A 4WSJA 3W6LA 5HQMA 2GUBA 2NVAA 2VXNA 4JIQA 3FHAA 3VOJA 2WB5A 1V77A 1XBVA 2PBOA 4YN5A 1NTHA 4P7QA 3KOYA 3F5JA 2D2OA 3QKEA 4QSFA 4KEVA 4N9BA 1UHVA 3A5FA 1MW0A 4FI4A 1NFPA 4IIFA 4JIPA 1XFCA 2PWEA 5CSYA 1FWWA 4XO7A 3RX2A 1MZRA 2O4QA 5HNRA 1X98A 1KNWA 1DJHA 4YLWA 4H6RA 2YBTA 3FSUA 4CNNA 1NF7A 2JKAA 3UERA 1X8CA 4IUGA 3QR1A 3BICA 4FPSA 1DEDA 4D6GA 3CMGA 3LCIA 1UYQA 1V7YA 2QEZA 3OHIA 3KE0A 5B80A 1U1JA 1HO1A 1SVDA 2QJJA 3RU8X 4H7VA 5MKGB 5AFDA 1EXPA 1AW5A 1NDWA 3PHAA 2QUUA 3NO1A 3IV8A 1Z89A 1O5QA 4AIOA 4HU0A 1MRQA 2D0GA 2QYGA 3WEOA 3OA3A 2B0MA 5H6HA 3GB6A 5FJTA 3T42A 3SCNA 2WHMA 2GVEA 2NV9A 3I3DA 2PI6A 1FWTA 5KITA 3IAQA 2WLYA 1PJ9A 4JCLA 3MW7A 4C1NA 3TC6A 2GJXA 2OVLA 4WKFA 2O9OA 2XIIA 4UTFA 3XISA 4JFVA 1WZAA 3IJLA 3L65A 1XG4A 4FMVA 3VDBA 1XIGA 4GVIA 4HN8A 4DM1A 3NPWA 1BGGA 5JBEA 2V3GA 3NURA 4L4PA 1CGWA 2O55A 1LM1A 3RLHA 5HJLA 3ZMRA 2A3EA 4B91A 1XIIA 2DIKA 4LW7A 3TUUA 1BFNA 3BSMA 2NX1A 4KGJA 1R3RA 1U5JA 3ZWSA 1OWQA 2A79A 2VURA 3WBXA 4ZB0A 4MJMA 2ZC8A 4HNUA 1QW9A 2VT0A 3GXMA 4HQVA 3BOFA 3BJFA 1DHKA 3ABZA 3HA1A 2Z00A 3G2GA 1YXDA 4NVTA 3UXIA 3WEMA 3P7YA 1ELSA 4MPKA 1B57A 1BTCA 5I3KA 2GQ9A 4QDPA 1SR0A 1T99A 1HQTA 3ORWA 2GK1B 4Y8EA 3A6OA 3S1GA 3GHRA 6CGTA 4FNSA 4M29A 3DXIA 3H2MA 1XF0A 1V02E 4NX0A 4B3KA 2PS2A 4IWWA 4DPQA 3VOGA 2C0HA 3HPSA 1GW9A 4IM4A 1PYFA 4YS1A 2PDIA 1IGSA 5D2VA 3OJGA 3ZJ6A 1WKEA 1T6MA 1LJYA 1M41A 1WPCA 4UCGA 1OT2A 1NF0A 3GR8A 4IXHA 4RZ6A 2BB0A 5D2TA 3VNYA 4WXZA 4WIWA 4WJ8A 1SW3A 4ZO7A 2I9UA 2AL2B 4QBXA 1A5AA 3WQ6A 1F4HA 1SW7A 3SQSA 2MNRA 2PCQA 2R8WA 3M07A 1E6NA 4X2PA 1UMLA 1H49A 1XFBA 2QDHA 1NELA 3T44A 1Z42A 4IZGA 5I5RA 4RK8A 5BU9A 1ITQA 1US2A 1JI1A 1YPFA 4HVXA 3EOSA 1XIEA 4IIBA 1I4NA 4C1NB 2CNCA 1QNQA 2CXEA 1KWGA 5T8GA 1B1YA 3G0UA 1G01A 3MTWA 5D8WA 1J0YA 3WLTA 4PEKA 5FL1A 1GQJA 1N7KA 1RJQA 3PUGA 3S8HA 1J6OA 4OOZA 5F4XA 1BVNP 3LPPA 5CPMA 2ASHA 2EG8A 5BOOA 2WZTA 3WJXA 4HNOA 3WQPA 1BQGA 2BTMA 3B8VA 4JN8A 2EPOA 4QDWA 4HZ6A 1UW9A 3FFSA 2CLFA 1NVMA 2OSXA 4W9TA 3RMJA 3NQ8A 3CIWA 1AMKA 1TB3A 3GH4A 2FJUB 5A8OA 1WDWA 4S2BA 3G1XA 3D0CA 3NIYA 2UZ9A 1TV2A 4A3RA 5A6JA 1W5PA 1OFOA 4AMAA 2ZBTA 4JQAA 2G95A 3WQVA 1F8MA 3GSMA 2ZUUA 5I09A 4D8AA 3MJMA 1BG9A 1GOKA 3K8MA 2W91A 3NZQA 2F7FA 3R7MA 3IRSA 5IFPA 2Q09A 3BH4A 4GA8A 9RUBA 3KCOA 1E1EA 5HNNA 3WF1A 4HHHA 4P7RA 3WK1A 1IEIA 1S2CA 3GU1A 2PC4A 1YTDA 2VEFA 3GU9A 3U9IA 1TG7A 3BAYA 3V3WA 3ZJKA 4ROPA 3FGCA 5MF5A 1XGZA 4LUIA 4OOUA 1I6NA 2EPHA 4MWAD 4BS0A 3H2NA 1FTXA 2V3EA 2V5KA 1BKSA 3TWAA 3I7RA 2QDGA 3ABSA 4LEQA 2Z26A 1YIXA 3UG8A 4PL1A 1RK5A 2XHYA 4Q32A 1BLIA 3UQNA 1O60A 2YL8A 3GR7A 2JF7A 4LVBA 1XQKA 3U5UA 1UA3A 4IJBA 4BF9A 4J4KA 1R38A 3ARXA 4GK8A 4JY9A 2Y6ZA 6TAAA 3B9NA 5LGZA 5KINA 1F73A 3O1NA 4A05A 1TYGA 1J5SA 1V03A 3S9ZA 3DFNA 1XD1A 3IUIA 4NZ5A 3J7HA 4S3GA 1WAUA 3TTSA 4GFIA 2DJLA 3CM4A 1AUSL 2FTWA 3W81A 4MNMA 3KBMA 3TROA 1G4SA 3M7WA 4TTGA 5GPRA 1ZFJA 1JXJA 4XD5A 1OK6A 3SCTA 3ARSA 1KM4A 9XIAA 2JIEA 2VRQA 1L2UA 1GKPA 2OT1A 4YYCA 3QLLA 4DBWA 5HANA 5IXEA 2DQWA 2QPUA 3R0UA 4EK7A 2PSNA 1D3CA 3AICA 2NQ9A 2E28A 5I3IA 1AD4A 4ZBCA 2GSEA 2V5DA 1WBHA 3KS6A 2DU2A 1NDYA 1WX0A 1G4PA 3GRIA 2G3MA 4W8LA 3SJ3A 2P8CA 1KFBA 2XN2A 2AQWA 3TYUA 4M5PA 1G94A 4M6PA 4WJEA 2I5QA 1S3TC 1BTMA 3GM8A 4A6GA 3E96A 4B4HA 1H5YA 2J7GA 4MF4A 1M9HA 2RHGA 3GE7A 1HNYA 1IR2A 1E9LA 3JZUA 1JUEA 3ARVA 3W84A 3AMCA 1PDZA 2A21A 1D8CA 2I5IA 5A8PA 4PUKA 2DZSA 3L21A 2YSWA 1F7BA 3ARYA 2ISWA 4MWAB 3EDEA 3QPEA 3LM7A 1CDGA 1EX5A 4Z2KA 1BSLA 2ZDSA 4EWJA 2C1HA 3B4YA 2G3NA 3R79A 4JR5A 4K68A 3SRFA 1PV8A 2P10A 5G2WA 3TMQA 3B3DA 1J10A 2A3BA 2IQ0A 3KP0A 1UZ1A 1JF6A 3OODA 5I3HA 4W8AA 5F2GA 1BG4A 3VZZA 3AOFA 3BDKA 1EHAA 3H54A 1TUFA 3GTNA 4TU1A 1JI2A 2YLLA 3QC3A 3OGRA 3RMEA 4LTSA 1ISXA 1NWSA 1IR1A 2OZTA 3G77A 2QNEA 1KV5A 1OC6A 4RR4A 1QASA 3B8UA 3W7HA 1DIDA 2YCLB 4PMDA 4U31A 3CIVA 1UR1A 3QH2A 4F0HA 1TWWA 3EMZA 3F2DA 4B16A 3VE7A 3T2QA 3GTIA 1GZJA 2V81A 4GNVA 3PJUA 2ISSA 1CYGA 2OSWA 4ASTA 4UTUA 3SM0A 1S2TA 4H7CA 4UQDA 4M1RA 4DQWA 4KWOA 2ACQA 3G3MA 5G1MA 1DQWA 3N29A 4L5ZA 3M0KA 3DZ1A 1JAEA 2V9DA 4UMCA 3QV6A 1AG1O 3CEPA 4ERAA 4E5TA 3LHTA 3BAXA 3ELFA 1Z9AA 4CN6A 5CGTA 3EOOA 3SURA 4HPNA 5A69A 4C6BA 3QVQA 3N9SA 5D9MA 3OBKA 1KRMA 4O15A 4DY1A 1GOWA 3VZYA 3QY7A 4ZQRA 1KM3A 3GHSA 1XGEA 3HURA 4PA8A 4B2DA 2GSHA 1AH3A 2NXIA 2YIHA 4H01A 5FJIA 7ENLA 2WMKA 3NG3A 3GXPA 4HP5A 2YXOA 1KM0A 3UGRA 4RL3A 1LP6A 3TIMA 3MI3A 1VENA 4LC8A 5D33A 1IF2A 3N4AA 4AMCA 2PMQA 1JCYA 2GVYA 3E9AA 2XUCA 1S2WA 4WDUA 2ZUWA 4QS6A 4QLLA 4AHQA 4X3ZA 1TUXA 2I7GA 5AHLA 3NYDA 4TXEA 1EQPA 1JDAA 4Z08A 2NT0A 1TIMA 4DUWA 4IJRA 3UCCA 4JD4A 4WD0A 2WYSA 4LAZA 3CHEA 2WVUA 1W5OA 3KOFA 4RV8A 1X7IA 1UP0A 1GKRA 2OQYA 1AL7A 3WSUA 1CWYA 1UR2A 1YE4A 3CQHA 2J78A 2WSYA 3TZNA 1IEVA 3EBVA 3LMZA 1XH2A 4ORMA 1SFTA 3PZIA 1O94A 2EF9A 5J04A 3RO6A 4H83A 4GBUA 1KM6A 2CLIA 1UUOA 3AISA 2BY1A 4LUYA 1H41A 4MKNA 4WCJA 2QVHA 1VF8A 3NDZA 2DSWA 4MY8A 3CHVA 2YZRA 3LEPA 4NZ4A 4I7VA 4JFTA 4JEJA 2G4FA 3ES8A 4D8LA 4YNGA 1YTEA 3UF9A 2XM1A 4LRTA 2C71A 3S2CA 3DIPA 1FDZA 4UTKA 4DWSB 1N55A 3O0KA 1V6TA 2GZXA 4GG9A 2J24A 3FLUA 3O63A 5D02A 3PK7A 3GC2A 1YEYA 1TJ2A 1XLGA 5E0KA 1CNVA 2Y8UA 1FWJC 5HQLA 4D72A 4H04A 1RZMA 5LNVA 5CPOA 1YLVA 5CKSA 4WX2A 3U5YA 2HJPA 3A4XA 1QBBA 1QU4A 3H2FA 4BKNA 2CBVA 3BWWA 5DRCA 1XLMA 3PB2A 5CC7A 5IHRA 4EVZA 1XBXA 3MZNA 3KVLA 1KQYA 4GX8A 1WXYA 2HVOA 3TYBA 5JH2A 1EKOA 3DC8A 1W1YA 3E02A 3TXVA 4F0LA 3ZWTA 4DI9A 4ICMA 1OCJA 1EO7A 3W7IA 4ZMGA 3QV9A 2D3NA 3CZKA 1V0KA 2O9RA 4GUFA 4YJ5A 5EMUA 3CZ8A 4MB1A 4IQLA 3GXFA 4AX7A 4NZCA 3A3HA 4LCRA 2ZUVA 3TWBA 1FCUA 3FA4A 4NJHA 5LIKX 1GTHA 4G2DA 2DZTA 1RSCA 3CYJA 4GH3A 5FJOA 2BWGA 3IK4A 3WDHA 4XIAA 4M19A 3E38A 4IP7A 4JFWA 1R0MA 2D1ZA 2W67A 5BWAA 4I7UA 1HKJA 3GW3A 5AHNA 3VIKA 3ES7A 2V2CA 3LU2A 3S42A 3MKKA 3BAJA 3RJXA 2VFHA 1J11A 4XZWA 1V3HA 1LLWA 3VD5A 3VIIA 1V3KA 2FZDA 4D1IA 2OWXA 5L9FA 3OZOA 2G3JA 4K2SA 4DZIA 2CLMA 4O1BA 1F3XA 1QI4A 4Z2JA 3TR9A 4XSMA 1WZLA 4I8YA 3CWHA 1E70M 4CN1A 4JTQA 1EGVA 2RAGA 3FVDA 4LQ1A 1AODA 5BZAA 3E0FA 4X9YA 3FOKA 3TCEA 4ONVA 3W70A 4GNKB 2OELA 4A22A 3TXZA 1FCBA 3GIQA 3WLMA 1OX4A 2WNZA 2VVNA 1FY6A 5DFAA 3QMTA 2DT2A 3HV9A 2J8TA 4GACA 3NPVA 3SIMA 5HBFA 4A3YA 2DV0A 4KRTA 3E1F1 4HB7A 1B30A 1SJAA 2VZSA 3TNBA 1GVEA 5E9XA 3QPYA 1D2KA 3H4WA 5BW6A 4PCSA 3SCOA 1SU5A 1YTKA 1UZ4A 1C8QA 2ADAA 4C5ZA 3WX7A 3VABA 3MP4A 1BXNA 2V3DA 3C2YA 3KS5A 5KEZA 4GYJA 4HD5A 4O4WA 1V02A 1Q8AA 3ZR6A 1SO3A 1GWJA 1ZPTA 4P7LA 1CPUA 1E0XA 4KKXA 3VINA 3S46A 4HCLA 4N2YA 1GQIA 1LT8A 4EF9A 3EYPA 1OM0A 5DY3A 1G67A 4QE4A 4L4OA 4F79A 5I24A 2H8XA 2EJ1A 2YA2A 4B5UA 4MNJA 3M44A 2VOTA 3OVRA 3JS3A 4UIOA 4JQ1A 4GH1A 5CCZA 3D6NA 2CITA 4MY9A 3PFRA 1JDDA 5CC5A 5XIMA 4RNJA 2EG6A 3W74A 1Z7AA 1TE6A 3CU2A 3ZYZA 1PB0A 4XBJA 1S39A 2OLSA 4JKMA 1V0MA 4HN4A 3QQ0A 1VGAA 3AJXA 4JQ3A 4OUEA 2PDQA 3SGZA 4DWSC 4OGZA 3L0GA 4CD4A 3CUXA 5EY5A 2WQDA 4EPDC 2XZ7A 2WCAA 1EC8A 3ECQA 2VEMA 4KEMA 3VD4A 2WO5A 3WDIA 1CB2A 2FTPA 1UROA 5CPLA 3LRMA 5DCDA 1GQKA 1GOIA 3VX0A 2I9EA 3AHXA 3B03A 4ICNA 3RRXA 5LXXA 3L4VA 3QHMA 4Y96A 5AC4A 4I9JA