4MVAA

1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 97
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mvaA00
1G4TA 2KZHA 4NT0A 1L9WA 1FXPA 2V2CA 1DHPA 1SW7A 4JDYA 3ZWTA 1XI3A 2VOMA 8TIMA 5CGQA 1H7XA 2E09A 3E0IA 3NG3A 3C3NA 2H8ZA 3BGGA 1TRDA 2E1DA 2VXNA 3DI1A 3NPVA 3PBUA 1MSSA 4TR9A 3M1ZA 1WAUA 1T0OA 3FJLA 3C2VA 3GAKA 1F6KA 3G0XA 2CLEA 5CZTA 1EP1A 4JNMA 2DORA 1XKYA 2HS6A 2YCEA 4JX4A 2QAPA 2R91A 4N9BA 1W3IA 3W1QA 4QNEA 4ZQCA 3C2FA 4H3DA 3MUXA 1K7FA 3OEXA 4OQVA 1VZWA 1KFKA 4O52A 3S8HA 3B0VC 3GK0A 2Z2UA 2WSRA 5KMYA 4XKYB 4DO6A 5DELA 1W31A 1EP2A 3RK8A 2ZTKA 3LERA 1NVMA 3DXIA 5AB3A 1GT8A 3EB2A 1X8FA 1SO3A 4LY8A 1VCVA 2C19A 1FY6A 3UWWA 3GR7A 2BXVA 3DGRA 1I2QA 1H7NA 1SO5A 4O53A 4WY0F 3VNDA 3HQ1A 1ZY9A 4XTIA 3MI3A 1GWJA 3EWUA 2Y62A 1H50A 4XBSA 1XM3A 5U4NA 2QKFA 3LTSA 4MLJA 3B03A 2X1TA 4GUHA 2QCDA 1XUUA 2A2IA 3S42A 4WY0B 4A3UA 5FF7A 3M47A 1VH7A 1OX6A 1K8XA 2E77A 2Y85A 1B4EA 3P80A 3FKKA 4N2YA 3ABQA 5KTLA 4DPQA 3IGXA 1P0KA 1TPC1 3UY7A 4CQ8A 1I2OA 1VGAA 1VCFA 4N6EA 1VHNA 1L6WA 5LNSA 2B7OA 1YADA 2AAMA 1LDCA 4TMCA 3W6YA 5K9CA 3L68A 1CW2A 3LXBA 2HS8A 4UTJA 4FEZA 4CQAA 4NJGA 1AL7A 3WJSA 3FS2A 1BKSA 5E1QA 1TTPA 3LM7A 1R2SA 2QDGA 3ZS4A 4OU1A 3CPRA 4OHQA 4MUZA 2ALDA 3FJ6A 3G1VA 3QW4B 5D2XA 2YYTA 3N9RA 1HO1A 3SW6A 2EAWA 4FNUA 1W5QA 5FI8A 1Z44A 3W2MA 1W5OA 1DJNA 2RHGA 5HWMA 4UFHA 3W1PA 4ADUA 2E5DA 5CZ0A 5DCBA 3BO9A 4IX2A 3W7IA 1TJRA 5SWUA 1VYSX 5D32A 1LBFA 4MZ8A 3K30A 5E93A 4IQLA 4M6QA 2Y61A 3OA3A 1SFLA 1ME7A 3CC1A 1KM2A 5H2ZA 3LHZA 2DJXA 1RV8A 1GG1A 1DORA 3TUUA 3IGUA 3A22A 4RZ4A 4FHAA 3B06A 1ADOA 2RDUA 4M6PA 3OIXA 1KM5A 4TIMA 2JGQA 2W6RA 3KVMA 3LOTA 4M19A 1N8FA 4N02A 3S1WA 2A0NA 2QCEA 4YCPA 3IRDA 1GEQA 2OT1A 2VENA 3PSWA 1A53A 2FQIA 2YXGA 3G0UA 2I9EA 4XKYA 3GLCA 2VKZG 3BARA 2B7QA 3G18A 2RDWA 1J5TA 3HO8A 4WX2A 4TX9A 4WXYA 3HGRA 4N9CA 3KVLA 5HMSA 2A1YA 1WYIA 1EWEA 4NZJA 4CCCA 4X3ZA 3A5VA 5F2GA 3TSBA 5ABTA 3TQVA 3EWBX 4FIQA 4HHPA 3SECA 2TMDA 5FF4A 4LU0A 3UZJA 2GJLA 4A22A 4PL2A 2X1UA 4A2SA 3LLFA 5G1TA 1VLWA 4GUIA 5CZSA 1PV8A 1F7BA 1EP3A 2NUWA 3PB2A 3NL2A 1JCLA 1D3GA 1SO6A 1M6JA 1LP6A 2ATMA 3H55A 2ZDRA 1D9EA 1LTDA 3LCHA 4ZQRA 3BW2A 4DXVA 1Q6RA 4DO4A 3TXVA 3O6DA 5BOOA 2WV8A 3LHVA 4O14A 3DHDA 2PC4A 4FNRA 4R7JA 4ZQPA 1GVSA 2ZA2A 1W5PA 3G1XA 1F76A 1P4CA 1DBTA 6ALDA 3BVJA 2PRLA 3ATZA 4ZMGA 2BWGA 5H91A 4JYDA 3I7RA 5AYZA 3KRSA 3TV8A 5KZMA 4BF9A 4AF0B 4BR1A 3M5ZA 4AHOA 3L0KA 1LBLA 3QW3A 3QC3A 2QDHA 5TQLA 3DFTA 4KFOA 3KAOA 3M9YA 5BRBA 3MHGA 1UUMA 3TCEA 3BG9A 4DQWA 1RQBA 1I2NA 4LS0A 4XZ9A 4G1KA 4UFIA 3MMTA 1VQTA 3PUDA 3W1RA 5AC8A 2NX3A 1LZOA 3WK1A 1DOSA 4B5NA 4QISA 3ELFA 2BZNA 3C0JA 3LGEA 3W73A 4NQ1A 2A85A 2ABAA 1PHWA 4OE7A 4EF8A 3TAOA 2JBMA 5LHEA 1I4NA 4HN4A 3O06A 2TRSA 1I45A 4N9EA 4X2RA 5L9FA 5HINA 1JULA 1THFD 2JKPA 2W79A 2HMCA 1MO0A 1GG0A 4O10A 3W1NA 3CIWA 1NFBA 1C8VA 5D05A 3EX1A 4PH6A 3W71A 1K3UA 3W2UA 1O5KA 1GVOA 1K03A 3NQEA 2A4AA 2WJZA 5G2WA 3L5AA 2Y6ZA 2QJIA 4N4PA 2R14A 3B04A 1W3TA 1KFEA 2JGYA 1XDLA 4BWLC 4MFDA 4DELA 3FLUA 3WJWA 2Q8ZA 3SI9A 4UTWA 1GYNA 3UQNA 2C15A 3SIZA 2FTPA 3GR8A 4JDBA 3QQ1A 4FNSA 5EYWA 1TRIA 3P5YA 3A5FA 1X1ZA 5K7JA 4JTLA 3PAJA 3QH2A 4ADTA 1KM1A 4IPIA 3VCRA 2WSQA 2Z0IA 1TPUA 1SZGA 3O1NA 1EPXA 3R2GA 3GYEA 3PUEA 4KFPA 2B7NA 3EX3A 3NDOA 3CQ0A 5FEXA 2EPHA 1JQVA 4QQ3A 4RXFA 2YPIA 1H7RA 2FPTA 4HNNA 3CWOX 7TIMA 2XN0A 1JR1A 3AJXA 4FNQA 4UFJA 3LI1A 2H3BA 3CHVA 5F4WA 1HG3A 3NVTA 1H7OA 4ORMA 4K37A 3QYQA 3U8GA 4PCFA 1KFBA 2DZTA 3LRMA 5TBOA 4E38A 2LLEA 1ZALA 3EKZA 2EGZA 4DF1A 3PULA 3W2NA 5D03A 4AXKA 5D33A 3HB9A 3H54A 1DKWA 2O7SA 4LVBA 4BI6A 1SFJA 3GDMA 3FYPA 4FNTA 3PBWA 4MPQA 2DZSA 4I7WA 1FWNA 3GKAA 1KM3A 5EBUA 1C9DA 4DF0A 4AF0A 1FWWA 4ZQOA 4QJ1A 1GTEA 5LKYA 4EF9A 3EX6A 3TSMA 3HBLA 3NL5A 1GYLA 4MKNA 4O0KA 1YPIA 3MBDA 2A7PA 4OT7A 5CSRA 1GVFA 1VPXA 3DENA 5KZDA 5AHMA 3FYOA 1S3HA 3Q37A 3HG4A 2VC6A 4WZHA 4FX8A 5F4XA 3W83A 2ZTJA 5C5YA 1HUVA 1YYAA 2G97A 3QF0A 2ZBTA 4LRTA 4TO8A 4R53A 4OGZA 5AFDA 1W3NA 1OYBA 1HO4A 4NJHA 3G3DA 3BK0A 2F84A 3SZ8A 5FESA 4KWWA 5DBTA 1ZENA 3TW7A 1YDOA 4ICNA 1MEIA 1NSJA 2Q8LA 3W7QA 1FXQA 2P0OA 3PF3A 1G67A 5I3JA 4ZVJA 3C2EA 4BK9A 4OWGA 4JIPA 2G95A 5K9XA 3PB0A 5I3HA 3GDTA 3KXQA 4FXSA 3B8DA 1D3HA 2H3DA 1FWRA 1OFAA 3W70A 3W85A 2C18A 1K7XA 4MYXA 1IIHA 3W1XA 3D0CA 1HTIA 3GB6A 1WXJA 3FKRA 5D02A 5BMXA 4K6AA 2H6RA 5D30A 5FEPA 4O28A 3S1UA 3MI2A 3S0CA 1JRCA 1U83A 2A7NA 2EF9A 1VS1A 1UJPA 3PC0A 5CZJA 2PE4A 4EIVA 1XBYA 1SU5A 3IIZA 4O11A 2Z6JA 5LZLA 4OV9A 1GOXA 3U2OA 4NNCA 1IXQA 1G4PA 4CNPA 4H4IA 4X22A 1RPXA 4NUWA 4RKAA 1HFBA 2ZZ5A 3TNOA 3KRUA 4AB4A 1OFBA 3NZRA 4I9AA 5KITA 3HIJA 3FA5A 4NJKA 2DZVA 5EY5A 3P61A 2ZZ2A 3LTYA 2NLIA 2AQWA 4O1BA 4NNAA 1LRQA 3LRLA 2QCCA 5EKYA 4WXZA 4XTDA 2YYUA 2FB2A 1YLVA 3W3OA 4NXKA 3INPA 1BTMA 2OJPA 3O6YX 2FLIA 3KFTA 2FFCA 1ML1A 3OBKA 3W7LA 4UTUA 4R33A 5DBUA 4RLIA 1TCDA 2V2HA 2Z6IA 1OFQA 2JKEA 5CSSA 1KFCA 2CLOA 3W86A 1H1YA 4CCEA 4GUFA 1RR2A 1M7OA 3S6DA 5CPOA 5LNUA 5AHFA 3RU6A 4IGHA 1WOBA 1EIXA 3R5EA 1FBAA 4RZ6A 5DCEA 5MHBA 4BI7A 1EEPA 4HT3A 3M16A 4YLWA 5LNRA 2NXHA 4UNKA 4AVFA 4M7TA 4GNJA 1GJPA 3LI0A 1R46A 4O57A 3TSDA 2VFGA 5AHIA 3KRZA 3W1TA 4ONVA 1BEUA 1XBVA 2VFDA 1F6PA 5AC6A 4IX0A 5CKSA 2E5BA 2VEMA 2GVJA 3NQGA 3KX6A 2VFIA 1GTHA 1S5WA 1QPQA 3HG5A 1VC4A 2QUTA 4LW7A 3VI2A 1SZNA 1JQXA 5U7SA 5HR7A 2RDTA 4RR4A 2ISWA 3L5LA 1H7WA 4JTHA 4A29A 3LXCA 2UV8G 3W7RA 2QAFA 4O12A 3OHIA 3L65A 3L9CA 3T4CA 3O63A 3CT7A 3USBA 1Q6LA 3CEPA 2JK2A 2Y88A 4LVAA 5HWJA 4K8EA 1JUBA 2J9ZA 3E49A 5DXYA 4HKPA 3U6WA 3L21A 3VE9A 5GVJA 3STFA 1PE1A 3V75A 1H60A 1WBHA 1JUEA 5CPMA 3KVKA 3GKFA 4GWEA 3F1QA 2QCGA 2BLEA 4QNWA 1KTCA 3NQMA 2FPVA 4CLMA 3MYOA 2X16A 3I68A 4R34A 2R94A 4JTTA 4MJZA 3M5YA 3EWZA 1DV7A 3N14A 5EA9A 1ICPA 5DY3A 2OT0A 1IGSA 4Q33A 3EX4A 1X6UA 3EWYA 5K4XA 4EOUA 3O16A 2C0AA 2E6FA 3NPUA 3P7YA 1TPFA 1N55A 4CQ9A 3G22A 3TMLA 1TQJA 4NVTA 3HPZA 3RLUA 3TW6A 4MZ1A 4JD4A 1RD5A 2OCZA 3QM3A 3TH6A 1KV5A 2DU2A 2F7FA 5HUPA 4HSOA 4O15A 3W72A 3GNDA 4BI5A 2V8ZA 3PS7A 1KBIA 3GXPA 1OFRA 4ALDA 3WK0A 2ZQ0A 4Y9AA 3O8AA 4DBDA 2ZZ7A 2OX1A 4L4MA 3STGA 3M5VA 1QWGA 4XWUA 3TQ0A 4IMFA 1KTBA 1K8ZA 2Q3RA 3B4UA 2WNZA 3C6CA 4LVFA 3E02A 2V82A 3S5YA 4JR5A 3N2MA 1JJKA 4E0CA 3W7NA 4PC8A 1UASA 1WV2A 2XN1A 4POCA 2Y7FA 4U28A 3QSRA 3LCFA 1LRNA 4IMDA 3NQAA 4JX5A 1QOQA 5EL1A 4UFLA 2ZRWA 5EPDA 3BLEA 4EWND 1KTNA 1C29A 2R8WA 1DJQA 4YWIA 3OG3A 5F1VA 1A5BA 1OF6A 4MYAA 4UMBA 4JYFA 5HWNA 2A7RA 2NZLA 3NNTA 3QSTA 3HOJA 3P84A 2YX0A 5E0KA 4JIQA 1SSGA 2I1OA 3N34A 3CM4A 1V7YA 1OK4A 4S1FA 2V2DA 4FNPA 2PURA 2J88A 5K3VA 5AYYA 3NR0A 1YDNA 3GDRA 1TPDA 3M44A 4IOTA 1SUXA 4TU1A 3SR7A 1NAL1 1V5XA 3QPZA 4FX6M 5EMUA 5I3GA 2VFHA 1QO5A 3T40A 4O1CA 2X1RA 3THAA 4ORIA 2A6NA 4JX6A 4UCGA 2CZ5A 3UXDA 3TROA 1TB3A 2RH9A 3EX2A 3NQFA 5KSWA 4RK8A 4FX7A 4O17A 5T26A 4UMAA 3UYCA 4O54A 4Q32A 2CZFA 4C1LA 4YXGA 4UTKA 2CZEA 3NL6A 4D2JA 3PUOA 4MVAA 3EWWA 2QCNA 3QMTA 4C1KA 2CLLA 4UNLA 2ZRVA 3UWQA 3W88A 3CB8A 2AGKA 3DFQA 2ISVA 1Q6OA 2EKCA 3OVQA 1QNVA 3C56A 4CCDA 3T44A 2ZCGA 2P1FA 4O16A 1X7FA 1CX9A 4IXXA 3W84A 4NJIA 3DFPA 2BTMA 4N9DA 4U4MA 3TJLA 4MIMA 3TIMA 5K4ZA 3LHWA 3VKJA 2J9XA 4UTWC 1SW0A 1AMKA 1S5VA 3WJYA 1QO2A 3Q2DA 2Y63A 1FWTA 3G1SA 3M5XA 3N9SA 4PL1A 4AEOA 4AH7A 3OVRA 1KLZA 3SJ3A 2ZFAA 1RQHA 1JRBA 1ONRA 1TV5A 3G8EA 3MHUA 2FB3A 3W1LA 1JCJA 3HPXA 3CEUA 4IUOA 3MYPA 3EKLA 1B4KA 1SO4A 4LV9A 2ZYFA 4LS2A 3UXAA 1Z42A 3P81A 1R2TA 5IBXA 2NUXA 4PFMA 2YSWA 3G8RA 2CLKA 1QAPA 5D2TA 3IVTA 2B7PA 4NJJA 2H90A 3FFSA 3H53A 3R12A 5G4WA 4XQ6A 5AHLA 4NX5A 3W7DA 4IWWA 2Z1BA 5D2WA 1WQ5A 2VEIA 5C55A 3PY2A 3R13A 2GQAA 1G7VA 2QR6A 3C2RA 5CPLA 1JVNA 2GVLA 1PL9A 3NQ7A 4UC5A 1LORA 3UWUA 5BNKA 4ZQMA 3VE7A 5AHEA 1FCUA 4AWUA 3SGZA 1EUNA 1Q45A 4L4LA 3QMSA 4S2BA 4O50A 5FF0A 1Y0EA 2ZRZA 2GOUA 3G1FA 4NNBA 4O19A 1QCWA 2V30A 1SSDA 2J24A 3ZFHA 3G1DA 2QCMA 1OVDA 4OV4A 3I65A 1WBJA 3BLIA 3E9AA 3BPWA 1JCYA 3SSJA 4CNNA 1ALDA 4O13A 3LCXA 3W76A 3HF3A 2NV2A 4K8HA 1LLZA 1DQXA 4JTUA 2VEPA 4Z08A 5LGXA 5D04C 2NV1A 3DZ1A 3FOKA 3NQVA 5D38A 4AHPA 4GBUA 1PVNA 4MY1A 1UBSA 1ZHAA 1Z41A 2YR1A 1XXXA 4UR7A 4Z1CA 1PCWA 1IXPA 2PRMA 3TAKA 5DY2A 1A5AA 1QOPA 3LBMA 4XUGA 5DN1A 3TFCA 1SZFA 1OFDA 1TTJA 2WO5A 3NQ2A 5G1YA 1TV8A 4LC8A 2E68A 1KA9F 3FIGA 4GC4A 3F4NA 5D37A 3NA8A 1AW2A 1TPWA 3E12A 3W1UA 3M43A 4MJMA 3W9ZA 1Q6QA 4QSHA 2CLMA 1KM4A 4JGDA 3LX9A 1VJIA 5HR6A 2WQPA 5KZEA 4EVZA 4LVDA 1TSIA 4MOZA 4CNOA 3I6RA 1WOAA 2ABBA 5F2IA 1QR7A 3PVFA 3NM3A 3NQDA 3L0NA 4NZFA 4O18A 3CIXA 2B0MA 3W7GA 4J9JA 3WFAA 1YXYA 3PG8A 1EX5A 4FF7A 3ZWSA 4JXCA 3G1YA 1GZGA 3B05A 4O4VA 4O4WA 4OBTA 3A24A 4JTIA 2BSLA 1P5BA 4WD0A 2D73A 1F2JA 4X9SA 4GJ1A 3DAQA 5FEZA 1O94A 5HNRA 2FDSA 3P5ZA 3W07A 4PA8A 1B9BA 3W1MA 4MY8A 1SZEA 3EXSA 2I14A 1TIMA 2GPTA 1W1ZA 1YPFA 1OX4B 2PRHA 3W7KA 2A6LA 5DXXA 4HNVA 5I3IA 1KLYA 3RNDA 3HGOA 4PODA 4Y8FA 1QFEA 2X2GA 2E6YA 1YXDA 2ZA3A 3L5MA 3W2JA 2P10A 3CTLA 2QJHA 1FDJA 2WOQA 1KV8A 3DFSA 1F74A 1KM0A 3R89A 1OX5A 2YFNA 1I2RA 1LCOA 5BW6A 1ICSA 3HGSA 3Q58A 2BX7A 1TPH1 5C2XA 1TJPA 5A5WA 1VLIA 5AN7A 3PSVA 4IPJA 2WSYA 1LLWA 2Y89A 1PIIA 2WKJA 3HPSA 2GVGA 4DPPA 1T96A 4GRSA 3MBFA 2OMAA 3KOFA 2DP3A 2ZA1A 2V5LA 2QCFA 3A21A 4AWSA 4HIBA 1VYRA 2C16A 5HUOA 2QJGA 1VHCA 4ADSA 5A8GA 1P0NA 3BGJA 4YCOA 3DI0A 2GQ8A 2OZ0A 2PCQA 4LT9A 2CFFA 1GQNA 2NX9A 3QFEA 4P2VA 2FJKA 3G3MA 3SY5A 5G2IA 3S5NA 5D09A 4PEKA 3ANYA 1F5ZA 3R8RA 5D2YA 1W56A 2CLHA 3IVUA 3EWXA 1AG1O 3KVJA 1J2WA 2FPYA 1B3OA 5AYXA 4HSNA 3P8JA 3LV6A 1OHLA 1NF0A 1WDWA 4O0ZA 1W5NA 5DLCA 1SPQA 3PBYA 3GDLA 3A9IA 5LHFA 3A23A 3GAYA 4UR8A 5G4EA 2E6AA 4LNYA 4ZZ9A 5LGZA 2VELA 1YTEA 3LB0A 3S5ZA 2DZUA 1SW3A 4LTSA 5J5DA 3W7EA 3QZEA 1E51A 3UNDA 3PBVA 3QRHA 3STEA 2TYSA 4LWWA 3W22A 3LHYA 1JUKA 1G69A 3W75A 1XDMA 3B0PA 3IIPA 3O15A 3S5OA 2CLIA 1H5YA 1K02A 3EXTA 4IMEA 4QITA 5K2ZA 3TC6A 1VR6A 2TPSA 1W54A 4JTFA 4WUIA 3P82A 3GNNA 3N2XA 1DQWA 1LROA 1ZAIA 1ZFJA 2ZRXA 3BLFA 2VFFA 2E5CA 3CU2A 2V0TA 1UCWA 3ZR4A 3MI6A 4UTHA 1Q3NA 1N7KA 4WQ6A 1RVGA 1WX0A 4O1AA 3W2LA 4Y6GA 3DH7A 2IQTA 3HMJG 3TC7A 1QPNA 4RXGA 3W2KA 1EB3A 1XFBA 2QEZA 4K39A 4Y96A 3QMRA 3NAVA 3W7HA 2VFEA 1KFLA 3STCA 4HNUA 3T55A 4BFAA 1TTIA 4O1DA 3M41A 4JYEA 1KW1A 3C8FA 2J27A 2C13A 2H8XA 1VRDA 1FX6A 2GQ9A 2Y7DA 1OYAA 5HQEA 1LOQA 4LS1A 1LBMA 3E96A 3NPWA 1LRTA 2NUYA 2RFGA 1ZNNA 3MP5A 1OFEA 2NXGA 2ZZ1A 1OX4A 3LLDA 1R2RA 4RJEA 3ABSA 3IVSA 4E2BA 3DFNA 4AWTA 4DBEA 3NEVA 3DBPA 4O8RA 4Q4KA 3GXTA 1BWLA 3TE9A 1QPRA 1O5XA 1XCFA 2Y70A 3NQ8A 3QPYA 2G5WA 3TA6A 1A5CA 1O60A 3KHJA 1OG0A 4WOZA 1AW1A 1G4SA 5BMWA 2EHHA 4GUJA 3RFAA 3P60A 1MEWA 3BW4A 3M7WA 3W23A 4RX0A 4Z1AA 3O6CA 4AMAA 2A5HA 3UPWA 4A21A 3L0GA 3I7SA 4IXHA 4JY8A 1ME9A 2VEKA 3NYZA 3W7CA 1O95A 4DEFA 4FIRA 3P74A 2YGYA 1OABA 4UFMA 2ISSA 1MXSA 3LV5A 1TPB1 4Z0JA 2HTMA 2C3ZA 5F1UA 5I3FA 3BV4A 3NO5A 4K7VA 4Z1DA 3UWYA 3RF9A 3L2IA 1S5TA 4Z1BA 3TU9A 4FO4A 1A50A 3JRKA 4UTLA 2JKAA 3MJYA 1FCQA 1TQXA 4RV8A 1G4EA 3P67A 1JCNA 2W0UA 1CI1A 2DJLA 1YTKA 3UWZA 1BWKA 2QF7A 2CLFA 1NF7A 2NWSA 4YMZA 3UPBA 5FEWA 1B57A 3CLMA 1DL3A 5AHNA 1H61A 1IIGA 3WK2A 2V5BA 1TYGA 1YDVA 4MLRA 1W5MA 5C6MA 4JN6A 4GE8A 3MWAA 3RMJA 1H63A 3NGJA 3GVGA 3QEZA 4LVGA 1J4EA 5IM51 5TIMA 2ZZ3A 3GXNA 4M6VA 1U5JA 4NXSA 4AHQA 3N3MA 3ABOA 3G1HA 3S1VA 3W7MA 5AC7A 3TK7A 3W1AA 2C1HA 1R47A 1MZHA 1KFJA 4JTKA 3WJZA 1OK6A 4H6KA 1O4UA 1I8JA 1YTDA 4WY0A 2Q3OA 1XL9A 2WNNA 1FWSA 5KINA 3S9YA 3IIVA 4P61A 1OJXA 4AAJA 3EEGA 3LDVA 5F2MA 5J5RA 4IJBA 1IXOA 3TXZA 3GZ3A 5HULA 3DHFA 4XBKA 2YW4A 4JEQA 3NPXA 4S2CA 5CG7A 3TJXA 3DKJA 1WA3A 1W37A 1H51A 1MEHA 2Y7GA 3MHFA 4JTJA 4RZ5A 4UUIA 1FDYA 4WJEA 3TR2A 1TREA 5FF3A 4MY9A 3LHTA 3P8IA 2NXIA 3DFOA 3MP3A 4UTIA 1XBXA 3JR2A 3UWVA 5IBXC 1SQ7A 3W7JA 3OVPA 2X1SA 3EXRA 1FCVA 2CZDA 2NWRA 4LRSA 5LSMA 4Z0SA 4W9TA 4KWVA 1K7EA 4A2RA 4UIOA 4FXRA 4KFNA 1R30A 1TTQA 1DVJA 1EUAA 3G0SA 1UB3A 4GXMA 3T78A 1H62A 2FIQA 2E6DA 4IMCA 2V81A 3PM6A 4JTEA 4JS3A 5I3KA 3DKLA 2GUUA 1PHQA 1JCXA 2WPBA 1LM1A 2DZXA 4I7VA 1H7PA 2RKXA 3HG2A 3M6YA 1KBJA 4M7SA 5K9DA 4JTSA 4UMCA 1K8YA 2TSYA 3NL3A 1EWDA 1ZAHA 2G96A 3MO7A 2QCLA 3N73A 3TQKA 1F73A 3G24A 3N19B 3LCGA 4RCXA 1OF8A 1QPOA 4DF2A 1G6CA 1QMLA 5L6UA 3PG9A 3YPIA 4FB7A 4LUIA 3AO0A 5G5IA 1L6SA 3GIYA 2YFOA 3FEMA 1TPEA 1TV7A 2X30A 3IEBA 5LNVA 2YDAA 4K36A 2CU0A 3WK3A 1JCMP 3W7PA 4ML9A 3W87A 4YL2A 3GX9A 1XBZA 4UTTC 1XC4A 3DU0A 2ZZ4A 1PS9A 3QQ0A 1ZAJA 3TKFA 1AL8A 1IF2A 5HJLA 3IIXA 2J9YA 1FDZA 3LRKA 4QAIA 2ZRUA 2QUVA 3GDKA 1TO3A 1T99A 3F03K 3C4UA 3BW3A 1LOLA 3IIOA 1UUOA 2Y7EA 4LUJA 3UZ5A 1A5SA 2GJNA 3CWNA 3W7OA 5CPNA 5FF2A 4UTMA 1NEYA 3NQ6A 5AOUA 4M5PA 3V1PA 1AK5A 1XUZA 4NX0A 4KKXA 3L66A 3M0ZA 3ABRA 2YZRA 3NXFA 1KM6A 3T7VA 3LCLA 1F05A 2NX1A 1TPVA 1L2UA 2ZRYA 4ZL1A 1ZJIA 2QCHA 1ICQA 3BG3A 3LXAA 3MP4A 1H1ZA 4N6FA 4UTTA 1YXCA 3B0UX 2CWNA 1AW5A 3JS3A 4UFKA 1OFOA 1M5WA 1L6YA 1Z48A 1FCBA 1VYPX 4QM1A 2DZPA 1IXNA 1GVQA 1LYXA 3C61A 3QJAA 3PWAA 3C52A 5F4SA 5F2LA 4BWLA 3HGJA 4IMGA 4GUGA 3ATYA 1ME8A 3G1AA 4MFEA 1QDSA 4HNTA 4HPXA 5DCDA 3PR2A 1GPWA 4ZQNA 4LC6A 3RLVA 2O7QA 4PTNA 3S1XA 3WJXA 5G2HA 2C14A 2XFWA 1OYCA 6TIMA 2A21A 1ZCOA 1G7UA 1P1XA 4JY9A 1X1OA 3TMQA 1RZMA 1VCGA 4Y90A 4QIUA 2ATSA 2YW3A 3HG3A 3NZ1A 1HL2A 2QCDB 1W0MA 1W8SA 3TDFA 2HSAA 4E2DA 3I7QA 3LCIA 1LOSA 2J6XA 2C6QA 1FQ0A 3SGUA 2DZWA 4JTGA 4TMBA 4UXDA 2V9DA 1M7PA 3BG5A 4I7UA 3VFLA 4LV4A 2QUUA 3LTPA 4WOQA 3MW7A 1I2PA 3W74A 2B4GA 4NU7A 3O07A 4LOCA 1RQEA 4N4QA 5D2VA 4HPJA 3SFKA 3HJZA 3P62A 2XN2A 3O05A 3THQA 1GVRA 2ZZ6A 4K38A 1SR9A 1OFPA 3C2OA 5LNWA 3LBCA 4JICA 1FUYA 3UY8A 3TFXA 3F4WA 3NOEA 4MZYA 3NQCA 3LCWA 1TMHA 2WNQA 3L67A 3TX9A 3Q94A 3NM1A 5C54A 2CW6A 4K7YA 3IV3A 1T8XA 3UD6A 3LHUA 4DO5A 4GFSA 1PCKA 1EA0A 3IGSA
chains in the Genus database with same CATH superfamily
1G4TA 2KZHA 4NT0A 2FHCA 1S5MA 1XI3A 2J7CA 1H7XA 1P6BA 3NG3A 2H8ZA 4U10A 3DI1A 3NPVA 3GIQA 1MSSA 2OWCA 3M1ZA 3FJLA 1UP0A 1PBGA 1F6KA 3VD4A 3Q67A 3GU1A 1XCXA 3BURA 2CLEA 1YNQA 2EQDA 5FJOA 1EP1A 4X9YA 3RILA 4JNMA 4CKQA 1W17A 3FXYA 4AMCA 3UEQA 4W8BA 4LAZA 1PKYA 1RJPA 4AIUA 3K2GA 1KFKA 4MDPA 3VNZA 1EHNA 1LL6A 3B0VC 3GK0A 4I8YA 4J40A 3B3DA 3EB4A 2GVEA 3MU7A 5DELA 4W84A 3NTYA 3RRXA 1EP2A 1MRAA 1XGEA 1CGYA 2WHLA 4RE2A 3DXIA 3WF3A 4IIHA 4LALA 2ZUVA 3EB2A 1X8FA 1KXVA 3VCCA 4H19A 3SJNA 3PNUA 1FY6A 1I2QA 3IUIA 3I6TA 2CETA 1OIFA 1H0IA 3H2FA 4WY0F 1ZY9A 1SJDA 3SCUA 3EWUA 2Y62A 3GTXA 2Z4GA 1J0YA 3NVDA 4LB3A 2VRJA 4GUHA 2HXUA 1XUUA 4WY0B 4J5NA 1OX6A 2E77A 4ZEPA 4AVOA 1VIWA 2Y85A 4UTFA 1XYLA 1W1VA 3WX7A 5FSEC 2OEJA 5KTLA 1TPC1 4GY0A 5T9BG 1VHNA 5LNSA 2XGIA 5CBIA 2AAMA 2ADAA 2PDMA 2WC7A 1CW2A 3LXBA 1LG2A 4FEZA 1XIMA 4PB3A 2XWEA 3FS2A 3VD5A 1BKSA 4LEQA 1XLEA 1TTPA 3ZS4A 4OU1A 4MUZA 2ALDA 1K9DA 3FJ6A 1NDWA 3G1VA 3QW4B 4XO6A 3GXMA 3Q45A 2PODA 2ZX8A 3WUGA 2VO5A 4FNUA 1W5QA 1T40A 3MT1A 1Z44A 4ECLA 1A0EA 1A3HA 2PWDA 1DJNA 2C1GA 1ESWA 1N82A 2PDFA 1G01A 2YA2A 4UFHA 4YS1A 1A5OC 1XISA 3W1PA 3CUZA 1DXIA 5AC4A 3BO9A 4IX2A 1VFFA 1S2TA 1NH6A 2W66A 1I0DA 1GKQA 3LS9A 5E93A 3C3UA 4RE3A 1ME7A 1GG1A 1DORA 4IFRA 4BQ2A 1MYRA 4JQ3A 2CPUA 1ADOA 3EA3A 1J0KA 2O56A 3OIXA 4TIMA 1XIJA 3KVMA 4M19A 4NRRA 4PN2A 2GK1A 2POZA 3S1WA 3QV8A 2A0NA 4YCPA 3VGDA 2VENA 2VGFA 1JDEA 2OEKA 1NP0A 1EBHA 3CGTA 1XH2A 1AH0A 3U3HA 5FJPA 5A6JA 3G18A 2RDWA 4A05A 1J5TA 2BODX 1N8IA 1BQCA 3RR1A 2BY0A 3S2CA 5HMSA 2ANUA 2A1YA 5GJPA 2VT0A 2QV5A 1YX1A 2PBOA 3GWQA 5ABTA 4JTAA 1YRRA 3T2QA 4P7NA 1S1PA 3SECA 3BAIA 4FAMA 1O5RA 3EGJA 2IPFA 1Y8BA 3QZAA 3F4VA 2GJLA 2IQ0A 3L4XA 4PL2A 2VX4A 2OOFA 3LLFA 4EAMA 3B9EA 5CZSA 3ZZ1A 4QLLA 1O66A 1DE5A 4FP1A 4GMEA 5CG0A 3NL2A 4M0XA 5BWFA 5CXPA 1CNVA 1M6JA 1LP6A 1W32A 4MB1A 2ZDRA 3VNJA 2GUBA 3VIKA 3BW2A 4DXVA 1DWHM 3O6DA 5BOOA 2WV8A 4O14A 4R7JA 4FNRA 1X98A 2XDFA 4D6EA 1P4CA 1KCZA 1ISVA 2PRLA 3V5CA 3UNTA 4Q4RA 2NSXA 3TV8A 1E0WA 5KZMA 4DAIA 4AF0B 5D9NA 3RR4A 3QC3A 1AH3A 1E3XA 2WMIA 4DQWA 1WKFA 4G1KA 1XLAA 1VQTA 2BY2A 1JPKA 4PMRA 5E09A 2NX3A 3GNOA 1E6RA 4B5NA 4GY1A 2FMNA 4B5XA 2EO7A 2BZNA 3LGEA 1EC9A 1U1JA 1ONXA 1GVIA 3KRBA 2XU2A 4IUGA 3H2MA 2JBMA 3ZMRA 1I4NA 5LHEA 3O06A 3M0LA 1FHDA 8RUCA 1ZGDA 3EWDA 2H9AA 1JULA 2EG8A 1THFD 4MB4A 3GC5A 4ZXOA 3KZPA 1GG0A 3K8LA 4BF7A 1MW0A 3CIWA 1NFBA 1C8VA 1QI0A 1Q8AA 4PH6A 4DUWA 1K3UA 3W2UA 3V0TA 5CJ5A 4CD8A 3NQEA 4MHBA 5G2WA 3M0XA 4GO8A 4W8AA 2HPMA 1JCTA 4DELA 3SI9A 1XPGA 3UQNA 1FWGC 2Z26A 3GR8A 4JDBA 4WDTA 5EYWA 1GNXA 1NY1A 4LANA 1J0ZA 3PAJA 1NTHA 3GR4A 2GGGA 2VX5A 2VC9A 1A5NC 4C65A 1TWDA 2ZC1A 2Y8KA 4I9MA 1XLBA 1D8WA 3PUEA 1T5AA 3WFLA 3NDOA 3ZLFA 4RXFA 3TTOA 2WVVA 2FPTA 3BDKA 1FWJC 2XN0A 5REQB 2HQAA 3CT2A 1W2VA 2BNJA 3CHVA 5F4WA 3NVTA 4J2PA 3ARTA 4R9OA 1KFBA 4E38A 4WEVX 3H54A 3GHTA 4R9XA 4IPPA 3BMXA 4BI6A 3FYPA 3NSXA 3GKAA 1NWRA 3AUJA 4Y9PA 5LXXA 4ZQOA 4QJ1A 1GTEA 1NDVA 4EF9A 3EX6A 4O0KA 3WUBA 4OT7A 1TVLA 1GEHA 5KZDA 2FHBA 2CESA 4GYJA 4L65A 4ZO7A 2VC6A 3AIWA 4YVXA 1EJ7L 4FX8A 5F4XA 1HUVA 1E6NA 5LIKX 3QF0A 4I5RA 1A5UA 2G37A 3GFZA 4OGZA 1BG9A 3VZXA 2OGJA 3UESA 1U30A 2F84A 5FESA 1SJCA 1ZENA 4MGGA 4ICNA 1CGWA 1MEIA 1NSJA 6TAAA 3CXOA 1FXQA 1GKPA 2WNWA 4XUYA 4GI4A 4J3TA 3PB0A 2QXWA 1W3HA 1Y5VA 1CEOA 3E0FA 4F0HA 3SO7A 3B8DA 3TTYA 5JBFA 4K68A 2VVSA 4FSAA 4LUYA 4Z17A 2HVMA 4GOAA 3W1XA 3K8MA 4UB9A 2H6RA 4V2XA 3BLDA 3CH9A 1JRCA 3WF1A 1DJIA 2XG9A 3U4AA 2A7NA 3AZSA 5CZJA 4EIVA 3GU2A 1YIXA 2WZEA 3WLKX 1EF2A 4R5EA 1E9LA 5LZLA 5E5CA 3ARZA 4CNPA 1RPXA 4LBRA 3VIIA 2ZZ5A 3S2NA 2FZMA 4H9YA 4AB4A 4RPPA 1OFBA 3NZRA 4I9AA 3T0CA 3MMWA 1CXKA 3HIJA 4WSHA 3ARSA 4CNSA 3LTYA 2NLIA 1KRBC 2P5NA 3AMLA 4WXZA 1KRAC 3GHUA 4HPNA 4XTDA 3WLNA 2FB2A 3NZPA 1PPIA 3W3OA 2GJPA 4IHCA 3C0SA 3W7LA 4UTUA 4J3WA 4R33A 5DBUA 1JF6A 3QN3A 2Z00A 5CSSA 2ZXBA 3BV7A 3W86A 4MF4A 1RR2A 3GVQA 2PLJA 3TOYA 1XLJA 1M7OA 3S6DA 1RALA 5LNUA 2ZX5A 3N17A 1O1HA 2PDQA 1WOBA 1EEPA 5LNRA 4XK2A 1YE6A 4M7TA 1GJPA 4QP0A 1R46A 2EJAA 4FF5A 3C2YA 4NY2A 4ONVA 3UR7A 3L2LA 1F6PA 4JQ4A 5AC6A 2Z1KA 3ABZA 1QU4A 2FVLA 5CKSA 3UFYA 1XICA 1MNSA 3NQGA 2YCKX 3KX6A 1QPKA 1T7LA 2REQB 3GFYA 3VAVA 2Q09A 2ISWA 1A5KC 4FXFA 1ENUA 3F2CA 3KBVA 3V1HA 3W7RA 2QAFA 1FWEC 4LF2A 2WW5A 2XM1A 4K8EA 2J9ZA 3U6WA 4PUUA 5DF0A 1EO7A 5A6SA 3IK4A 3STFA 2FZBA 3H23A 3FSTA 3PNZA 2CITA 4F4RA 9CGTA 2CKRA 2QCGA 3H24A 3JVAA 3N1AA 2YDRA 1KTCA 2FPVA 2X16A 1ADDA 5LIXX 1EGMA 2VWTA 3EWZA 2OT0A 1BWVA 4PMYA 4LUSB 4MNLA 4D1IA 2E0PA 3PZOA 3P7YA 2J66A 5XIAA 3HZ3A 4CQ9A 1ZSXA 3VFCA 4MZ1A 2OCZA 3SRHA 3AWNA 3TH6A 2DU2A 3BGAA 2BGSA 4R88A 3QR1A 3W72A 4MM1A 1TR1A 1HKVA 1MFUA 4MWAB 2V8ZA 4JTRA 4Q7NA 2V3DA 1EJXC 5KEZA 3VKDA 2OOGA 3BSHA 3GDBA 2ZZ7A 2OX1A 1B3ZA 1K8ZA 3MSYA 4LVFA 4UQ9A 3AALA 1JJKA 1DWJM 4PC8A 3ALGA 4POCA 3UW6A 2QIIA 4OVXA 2XSAA 3OQEA 4ICMA 3QSRA 2IKJA 4ZOBA 1I60A 4UFLA 5EPDA 1KTNA 2E28A 3PZNA 1C29A 3VMOA 1DJQA 1R9XA 2J6VA 1KR1A 5HWNA 2A7RA 2WSPA 3MZNA 4GPNA 1VD6A 4S38A 1V7YA 4FNPA 4ZO8A 2PURA 2ZUTA 3NR0A 1MWOA 1TPDA 3WBYA 3M44A 4QJ3B 1FWFC 3F2BA 1HIZA 3QPZA 4CU7A 3FGCA 1QO5A 3T40A 4O1CA 2X1RA 3PZIA 3UXDA 3TROA 1TB3A 3CHDA 3EX2A 2YBVA 3BH4A 4RK8A 2VQUA 5T26A 3UYCA 2PDYA 2Z2AA 4Q8TA 3SB0A 3PUOA 2CLLA 1DWFM 1IQ8A 2PTZA 3M7SA 2XSXA 2OQHA 4CCDA 3EDJA 4NYYA 1M03A 2ZCGA 4PTDA 3WQ4A 1VEOA 2J62A 1RA5A 5M17A 2HVOA 5DANA 3FX4A 1B31A 3H4XA 4U4MA 3TJLA 3SCTA 3AHXA 3LHWA 2GUYA 2J9XA 4FLSA 3WQDA 4B15A 3MSDA 1QO2A 3Q2DA 1FWTA 4AH7A 1TVNA 1J8VA 2PTDA 2ZFAA 5DMMA 1JRBA 1OCBA 1VENA 1C9WA 3G8EA 3AROA 3UGVA 1JCJA 4HOXA 1B4KA 5IBXA 3U5YA 4LAOA 2ZADA 3R0UA 3URQA 4MUPA 1V6WA 2QUMA 4A8NA 2H90A 5G4WA 2WMKA 4ACZB 2AMGA 2XWDA 4DJED 5D2WA 3P6LA 1XW8A 3AQUA 2WZTA 3VKCA 3QGVA 3PY2A 4PMVA 4XIMA 1JGMA 2R82A 2QR6A 3C2RA 4H01A 2HE8A 1JVNA 2OPJA 4KIRA 3UWUA 2YDQA 1KGUA 1SFTA 2A3AA 3S1GA 5C7HA 3QR3A 2D3LA 4ROQA 4S2BA 1EL3A 4O50A 5FF0A 4DNHA 2GWNA 4JL2A 1LT7A 4ASTA 2ZRZA 2GOUA 3G1FA 4O19A 3GNPA 1TFVA 4Z2JA 2V30A 1SSDA 3GFXA 3WLLA 4OFCA 3ZFHA 3VXGA 3G1DA 4BZYA 4FALA 3K13A 3I65A 3BLIA 1I9CB 4H9TA 4YNGA 1PEZA 4PMJA 4H6RA 2NQJA 3HF3A 3SRKA 2NV2A 4K8HA 3BQ6A 4DNMA 4HA3A 3UGRA 3N2BA 4Z08A 3DZ1A 5D38A 4W8LA 3LA4A 1FWIC 2OSWA 1IXPA 1TE1A 2PRMA 4Z1YA 3TAKA 1ECQA 4ACYA 4F79A 1UA3A 1WDDA 3V4BA 4TV5A 2WO5A 5A8MA 3CYJA 3F4NA 5IOBA 4IISA 2ACSA 1EZ2A 1JNDA 1TPWA 3W1UA 8A3HA 3TZFA 1TR9A 1WUFA 4J35A 4GCXA 3MV11 1VJIA 3O3RA 4LQ1A 2C79A 2HNHA 1XX1A 1RCOB 3HM7A 1MXDA 4CNOA 4LBUA 4A6GA 2ABBA 5F2IA 1QR7A 3TQPA 3OODA 3UETA 1KQZA 2PDHA 4UQEA 3W7GA 1GYMA 1J0IA 2X0HA 2SFPA 2IPWA 1UIOA 2PDJA 4O4WA 4PCPA 3A24A 1OIMA 4M8UA 2D73A 3O6AA 3PBMA 1ZQ5A 2FDSA 1FA2A 4IGNA 1G94A 3LPPA 2CHNA 3P5ZA 5DX7A 5HNTA 4O1FA 3REQB 3W1MA 4B90A 1W6TA 2PF8A 3EXSA 1QHOA 2I14A 3WD3A 1TIMA 2ZE0A 3UPMA 2E3ZA 5E6YA 3E2RA 5I3IA 1QWKA 5BOFA 3RNDA 4PODA 2VURA 1YXDA 2ZA3A 3L5MA 1A5MC 1TX2A 3MMUA 2WOQA 1V93A 2ISFA 1EA9C 3SQSA 3PZGA 1EX1A 3B0YA 1ONWA 1LCOA 3ITXA 1DJXA 3Q58A 4IIBA 4JNYA 5A5WA 3L2MA 3PSVA 4TUFA 3D3AA 4LYPA 1A3WA 3HPSA 2OMAA 4AD1A 4AWSA 1VYRA 5HUOA 2QJGA 4ADSA 2ONEA 3AHTA 1ZUAX 2GZXA 4YCOA 3GW3A 4GQQA 4AXNA 2TODA 4GX8A 3I4KA 1Q7ZA 2CFFA 1HJWA 1EC8A 3S5NA 5D09A 4RNFA 1AG1O 3KVJA 1FKWA 5A6MA 4L7ZA 4P8WA 3OQ8A 3SBFA 3SAZA 1OHLA 5C8BB 1C91A 4GD0A 3IGHX 1W5NA 3OYZA 4IG2B 2VVNA 4UR8A 4LNYA 2VELA 3S5ZA 1SW3A 2XIIA 4W85A 1PX3A 2P53A 3VIOA 4FMVA 4L80A 3JZEA 1VP5A 4EXAA 3QRHA 1UR9A 4LWWA 1E4LA 4IP4A 4P7OA 3S2JA 1G69A 4AQLA 3O15A 2CZVA 1XYFA 1EJVC 2CLIA 2XIOA 2P76A 1XFCA 4HYRA 1QW9A 1VRXA 5K2ZA 1L8NA 1VR6A 2TPSA 2QIWA 3N2XA 4ERIA 2PD5A 2WVSA 1MFVA 1ZFJA 3NGFA 1GVEA 3CV2A 2PA6A 1BRLA 3CU2A 2FMOA 3NDZA 3V3WA 1Q3NA 3MUIA 1RVGA 3VOGA 1JFXA 3DH7A 4GH3A 2J47A 3AFBA 3VZZA 3NCOA 5AKQA 2CC0A 2QEZA 2WM1A 4K39A 1OCNA 2VFEA 3M41A 1FWHC 1KW1A 1WCGA 2PZ0A 4MNJA 1GW9A 2OWXA 2GSJA 1VRDA 2GQ9A 2Y7DA 4Q8UA 1LOQA 2NVAA 3OHMB 3S3GA 3TN6A 2ACRA 1LRTA 3B8UA 4H00A 2RFGA 1L6GA 1OFEA 5XINA 1OX4A 1R2RA 1HJXA 2ZXQA 1BTCA 3B8WA 3DFNA 4DBEA 5BXSA 1IE7C 2Q6ZA 3TE9A 1QPRA 3VGGA 1XCFA 4D6CA 2G5WA 1Q65A 1A5CA 3NJ3A 4JFTA 2BHUA 1JDAA 4JHMA 4WOZA 4J3SA 3VNMA 2C0HA 4PMOA 4HOWA 1B90A 1MEWA 3M7WA 1DIEA 1VPQA 4HCLA 4DZ5A 3EOEA 4A21A 4HHLA 3I7SA 5E70A 2WC4A 3AXMA 1O95A 4HA0A 1CXFA 3AIVA 1SZRA 4LAMA 7REQA 3AMCA 1GUVA 1M3UA 3A4AA 5HNUA 1R86A 3KDNA 2HTMA 3ECQA 1LWIA 5CAKA 3BV4A 3NO5A 4K7VA 3IUDA 1XINA 3L2IA 1CGXA 3VIHA 4I90A 1EF3A 1FCQA 4B9YA 3DX5A 1JCNA 1CI1A 1F3WA 3UWZA 2QF7A 4J3VA 2CLFA 4MWAE 1W9XA 3UPBA 1QNPA 3CLMA 3T81A 3KBJA 1IIGA 4PRTA 1TYGA 1YDVA 1PTGA 1XRVA 3RMJA 2DH3A 3UZXA 4O1EA 3RPTA 1M7JA 1OCJA 3GXNA 4GVHA 1GHSA 4NXSA 3MKKA 4XSMA 3W7MA 1E4MM 4LCSA 1QOXA 1MZHA 1KFJA 1WNOA 4H6KA 1A5LC 1YTDA 4V1YA 2Q3OA 2WNNA 1BYAA 1S2WA 1ZRQA 2YBTA 2BOFX 1JPDX 1NOFA 3EEGA 4XZMX 3QBUA 3WO8A 2VCBA 4XV0A 3TXZA 1CLXA 3GZ3A 2FZNA 4XBKA 2Y0FA 3LG3A 4C7FA 4IGSA 2EPNA 4GXWA 4LF1A 4UUIA 4ES4A 4ZTYA 3TR2A 3UVAA 3SN4A 3JU2A 3LHTA 1CZ1A 3MP3A 4EANA 3GW0A 5IBXC 2J8FA 2J7HA 2CZDA 1E70M 5CJMA 1FKXA 1W1YA 3F5LA 4KWVA 1K7EA 4A2RA 4JPGA 2VNCA 4FXRA 4AY7A 1R30A 3USZA 3G0SA 6REQA 4GXMA 3QOMA 1H62A 3GXFA 2E6DA 4IMCA 2V81A 3PM6A 2HWGA 2YOCA 1HVXA 3P0WA 1PHQA 1CXIA 1EXPA 4CGTA 4UQBA 2AAAA 4HZMA 1KBJA 2FH8A 4M7SA 3NL3A 4PSRA 3UR5A 3TQKA 3V16A 5DMYA 3G24A 4Q22A 2X05A 1QPOA 1BFNA 1QMLA 1UKQA 1XSKA 3YPIA 5J04A 2YFOA 3TCSA 3RCNA 3EZ4A 4BKNA 4WKAA 2HBVA 4C5ZA 2YDAA 4AZ7A 7PTDA 2CU0A 1SMAA 3WK3A 3VD9A 5A2CA 1DXFA 2FYMA 3HA1A 3DU0A 1PS9A 3QQ0A 2CCRA 3GUWA 4AISA 1F6YA 4IMAA 2GJRA 4JQ2A 4Y9MA 3UG4A 2ZRUA 2NT1A 4QS6A 5MKGA 1AQ0A 3CIVA 5HBFA 2VC5A 1W8GA 1N8WA 4LUJA 1XF0A 1A5SA 4MNMA 1PUDA 4H9VA 3NIYA 5FF2A 3ZT7A 4UTMA 1NEYA 2ZX7A 4NX0A 1XUZA 4DJEA 1FRBA 4RDVA 3L66A 3EOUA 5T9CE 3QY8A 3M0ZA 3ABRA 2YZRA 2WSKA 2PF0A 3QLLA 1F05A 5HMEA 4HQVA 1MXGA 2QF8A 4UTTA 4F8XA 1VFLA 3WLPA 1AW5A 2YLAA 3N6QA 1XLIA 2C1IA 1E9IA 1S2AA 1VJSA 1E6XM 4F3HA 4WGXA 3BLPX 1RD6A 3C52A 4IMGA 3VOCA 4MFEA 2Z24A 3SCQA 1QDSA 4TVUA 3U48A 3RLVA 2O7QA 1OYCA 4HNOA 5I00A 4BEQA 2A21A 1ZCOA 1E72M 1G7UA 1J79A 3TYUA 1R38A 3TMQA 2ATSA 4KCUA 3BCFA 2QCDB 4RZBA 2HSAA 2E9LA 3I7QA 2X0SA 4KMQA 3W37A 2C6QA 3ERPA 2DZWA 4TMBA 3A3WA 1F9CA 4I7UA 2PZNA 3VC6A 2QUUA 3DG6A 4WOQA 1WKYA 1H41A 3QC0A 3W74A 1QNOA 4PMNA 2FTYA 1Q2SA 3AWOA 4HPJA 4XAZA 8XIMA 4Z2IA 4RDYA 3VNKA 5HNNA 3HJZA 1XG4A 2XN2A 2BBFA 3LGGA 1UWSA 3MPGA 1BPLB 1QBAA 3B0XA 4P8XA 1OFPA 3ZYZA 1EO5A 1KBLA 2E7FA 1D3CA 1XG3A 1RY0A 3Q94A 4US5D 2CW6A 3IV3A 5BROA 3LHUA 4DO5A 1ZJBA 1EOMA 3AS0A 3PPFA 1L9WA 1FXPA 1SW7A 3ZWTA 3L7RA 8TIMA 1B1YA 1V3KA 3FVMA 2WJDA 1TRDA 2Y24A 3E2SA 4MMWA 3BXWA 4PMQA 4E2VA 3M6DA 4TR9A 4YTUA 1T0OA 1R7AA 3BLOA 4H9UA 1VF8A 3G0XA 5FSDC 4NZ3A 4H9MA 5CZTA 3SUWA 1XGZA 3D5HA 4AW7A 1K4HA 4E3TA 4EAYA 1XKYA 4JX4A 2YCEA 3ZOAA 4E2OA 2R91A 4N9BA 4XZWA 1W3IA 3W1QA 4ZQCA 1AQFA 3VPLA 3W81A 2D2HA 2PWGA 3MCNA 4H3DA 1VZWA 4UNIA 4CQDA 3VZYA 1UR3M 2Z2UA 2BVYA 1Q6CA 4WKHA 4DIAA 1OT2A 4QDWA 3AU2A 3LU2A 2PUZA 4F66A 3A4WA 1EFZA 1BSLA 3PANA 4C1NB 5AB3A 3WQ6A 4EK7A 4LY8A 2C19A 3UWWA 3GR7A 2BXVA 3DGRA 1H7NA 4XKMA 2FZ9A 3MI3A 5E9AA 3R8HA 4WDUA 1H50A 1MQRA 2X09A 2MANA 5AC5A 2QKFA 3LTSA 1HKIA 1XDJA 3ISIX 5BU6A 2Z27A 4D71A 4KCTA 1VH7A 4I3GA 3JZUA 1LWJA 4G56A 3FKKA 3TWBA 3EDKA 1Q85A 3A12A 5BOEA 2PP1A 4DPQA 3TYBA 1P0KA 4LBSA 1DE6A 3R58A 3VMNA 2ZUMA 4N6EA 3VDAA 1L6WA 1R7OA 3IPWA 3AIEA 4XAPA 3SY1A 4UTJA 5JMUA 4CQAA 4BF5A 1TE6A 4NI3A 2EG7A 5E1QA 1ZBCA 3KBNA 4C6LA 3VUSA 1UKSA 3C8NA 2KX9A 5ENLA 1TV2A 4OHQA 2BG5A 3N9RA 2JEPA 1HO1A 3SW6A 2EAWA 1Q6EA 5FI8A 1PAMA 4ERAA 1P48A 2RHGA 2WBGA 2FVMA 5HWMA 3ABXA 2Y5EA 4ADUA 1AJ2A 1MUCA 1W91A 4F0SA 3QFWA 5D32A 6CGTA 4DHGA 3R8GA 2OTDA 3VK5A 2A79A 2INFA 3QV7A 4NSBA 4U3AA 1XYCA 4FR1A 4P7QA 1SFLA 3CC1A 4B3KA 2X0YA 2O9TA 3LHZA 1RV8A 4S3EA 3TUUA 1XPYA 3IGUA 3S6TA 3A22A 4RZ4A 5C9ZA 1KM5A 1D2KA 1Q13A 2QHAA 2V5DA 1C8XA 2HDJA 1UG6A 3WMLA 3WQWA 1A53A 3KCJA 1PWLA 2FQIA 3JUGA 1V0KA 3BARA 1DIOA 3QPEA 3HO8A 3DIPA 3A47A 4WX2A 4QJ4B 3HGRA 4NZ4A 4B5UA 1WYIA 3DDMA 2VX7A 3AICA 1BGAA 3EWBX 5I03A 5BRPA 1RBAA 3SRDA 5FF4A 4LU0A 5C9RA 1J12A 3UZJA 4J2MA 4A2SA 1JDDA 1HQTA 3ZVHB 5G1TA 4GUIA 2YL6A 2NQZA 1F8IA 1PV8A 1AQMA 1G1YA 3WH8A 1D3GA 5C0QA 4GIRA 2GJXB 2ATMA 5IRPA 1HT6A 2OODA 1UA7A 3LHVA 3DHDA 4H04A 2PC4A 2GFTA 3E38A 2ZUSA 3KLKA 4XG1A 5A69A 1VKFA 4XISA 2I16A 1E6QM 2CYGA 3OZMA 4ZMGA 5H91A 3TVAA 2B81A 3I7RA 3KRSA 1PSCA 1E1CB 1UWTA 3IARA 4AHOA 3L0KA 1TV3A 2QDHA 1OGSA 1S2CA 1LLOA 1V51A 4HYVA 5BRBA 3R10A 3MHGA 1UUMA 3TCEA 1IGWA 3W27A 1RQBA 1I2NA 4LS0A 3KCOA 5KETA 4M29A 3PUDA 3W1RA 1DOSA 2BXZA 4GYFA 4LUTB 4NI8A 1YQ2A 1XRFA 4MWAD 4QLKA 3C0JA 3RMEA 3W73A 2MNRA 2V3EA 4Q4QA 2ABAA 3PTQA 2BVTA 4HN4A 5JXQA 2QMJA 1HJSA 1I45A 4NHVA 4F0LA 3IJ7A 2E67A 3GH5A 3A3HA 4DJEC 4DWDA 5G4HC 2JKPA 2F6XA 1RXOB 3IWPA 4O10A 3TNBA 2DQXA 1PYFA 3AIUA 3OGRA 3EX1A 2VC7A 1AUSL 2FGLA 1O5KA 1GVOA 1K03A 4ZE4A 3DFHA 2A4AA 2XZ7A 3L5AA 2QJIA 3GBDA 2ZVIA 2JGYA 4H2HA 1XDLA 3FLUA 3WJWA 4X60A 2J4GA 2C15A 3SIZA 3ME3A 2FTPA 3QQ1A 6XIMA 3GC4A 4AD5A 4EKJA 3QH2A 4H7VA 3QKZA 4ADTA 2XH2A 3WNOA 3VCRA 2WSQA 3W6MA 2Z0IA 3ITVA 1W1PA 4ZOCA 1EPXA 3R2GA 4I8DA 1ZL1A 3GYEA 2XVPA 2UY4A 3EX3A 4KH2A 4J28A 5LA2A 1JQVA 4N7QA 4DM2A 4HNNA 4GI8A 3OA5A 1JR1A 3AJXA 3LI1A 3CV6A 2AL1A 1HG3A 4A3QA 4MB5A 3QYQA 2Y1HA 4PCFA 1B5TA 1UBPC 1IEIA 2VEGA 2DZTA 3LRMA 3DEQA 5ABFA 3AU6A 2LLEA 1DIDA 2RJHA 4DF1A 3PULA 2BY1A 2INZA 2WCGA 1JZ5A 5B7YA 1FWDC 5D03A 4AXKA 5D33A 3AI0A 1GPFA 2O7SA 3MCOA 4D6HA 1JZ2A 1PTDA 3VVGA 1SFJA 3GVVA 3PBWA 1WZAA 4MPQA 1E15A 1FWNA 5FAGA 3TTEA 4AF0A 1FWWA 3AIRA 3EYPA 3IJQA 3CBWA 2WCSA 5TF0A 1BVZA 3WMSA 3TSMA 2DUZA 3MBDA 5AY7A 2QJJA 5FJUA 3K1GA 2QQ6A 4E8CA 1R3VA 3HG4A 4F0RA 1I1XA 4Q6JA 2ZTJA 3EDEA 5A8NA 1E5JA 2PMQA 2G97A 2ZBTA 3IK2A 4LRTA 1W3NA 1HJQA 4K8GA 4NJHA 3I10A 3SZ8A 2OSXA 4HMDA 1MQPA 2DVXA 2VZVA 3TW7A 1XLKA 3BSGA 2Q8LA 3WQVA 1GQKA 2P0OA 2P8BA 4ZVJA 4BK9A 1C90A 3VNYA 2G3MA 3ZXWA 4OWGA 5K9XA 1WDRA 5I3HA 4FXSA 1YBQA 1X7IA 3V0SA 3DBNA 4GK8A 1ZLPA 1OFAA 3W70A 5H8UA 1XYMA 3RDKA 3ZLGA 1D7FA 3GB6A 1HKWA 3VKAA 3KS6A 3IAQA 3T08A 3GHRA 4PSPA 4W89A 5D30A 5FEPA 4O28A 3CAKA 2IPJA 1HL8A 3S0CA 1XYAA 2EF9A 5GPRA 3ITTA 4US5A 3PC0A 1XBYA 1ODZA 4RPQA 1Z7AA 4JIIX 2GK1B 2UWFA 3QHMA 2O55A 4NF7A 2QS8A 4IP7A 4W88A 4C6QA 5EGRA 3BAWA 1XLCA 3SCRA 2DZVA 4A3YA 5EY5A 5JH1A 2ZZ2A 2OXNA 4O1BA 3ZSTA 1ZB5A 4NNAA 1LRQA 3A64A 5GJMA 4C7GA 2YXXA 4NXKA 2BHZA 1BTMA 1UOZA 4AZ5A 5GQBA 2ACQA 3OBKA 1RUSA 2MUCA 3HQOA 1ITXA 1TCDA 2V2HA 2Z6IA 1JD7A 2E9BA 1OFQA 1J96A 1XH1A 3EA1A 4GUFA 4EPBC 4JOMA 3OU8A 5CPOA 3GYCA 2FFIA 1CGUA 4IGHA 1EIXA 3WG6A 5DCEA 6A3HA 2NXHA 4UNKA 3CHCA 4AVFA 4DZIA 4O57A 3B8IA 3H26A 5AHIA 4I9TA 2HV5A 3W1TA 1XBVA 2BGNE 2VR2A 4HHHA 4IX0A 2VEMA 2WB5A 2GVJA 3WENA 1LQAA 1S5WA 1QPQA 3AHVA 4RV3A 1PWMA 2GYIA 5JVLA 3K4AA 1OC6A 5U7SA 5IFTA 4CD6A 3SIMA 2C7FA 2GGEA 1MI3A 3LXCA 4O12A 3OHIA 1Q7MA 3L65A 5EFFA 3T4CA 3CT7A 3USBA 1Q6LA 3VDBA 1TWWA 2Y88A 5HWJA 3B8SA 3WF2A 3PTDA 1GVYA 1U5HA 3FDGA 3VE9A 4U2ZA 5GVJA 1PE1A 1US3A 3TYAA 1WBHA 4UQAA 3KVKA 4WDWA 3GKFA 1S2VA 1TZ7A 4Q7BA 4GQRA 3F1QA 3M0JA 5GNXA 3NQMA 3WH6A 3MYOA 1Z3NA 1XIIA 1RH9A 4U5IA 3M5YA 4ROPA 1ICPA 2WVUA 4G7EB 1IGSA 3RHGA 3EWYA 5K4XA 1W3LA 3PPCA 4EOUA 4F9DA 1R0MA 4C6MA 1TPFA 1N55A 4D6FA 7ODCA 2ZICA 3TMLA 2H9AB 4NVTA 1P7TB 5EMLA 1VPYA 2POTA 2VJXA 3LY0A 2OYKA 4JD4A 3MB9A 3QM3A 1KV5A 2F7FA 1KBKA 1XIBA 4HSOA 4GVGA 2ZWZA 2G3IA 4Q4SA 3WK0A 3O8AA 1P0EA 4L4MA 4XWUA 3BOXA 4IMFA 1KTBA 4R7WA 4YIWA 2HEJA 4PUDA 2QPXA 3OZOA 1EEXA 3C6CA 3HTWA 1ZPTA 3N2MA 1AVAA 4GZJA 5HQLA 1EH9A 1QBBA 3NQBA 2W4XA 4DJFD 1B9ZA 1P0BA 3R25A 4RW5A 1QOQA 3IJDA 4YWIA 4HU8A 4H9ZA 4CU8A 3WN6A 1FWAC 3B4YA 3OG3A 1KO0A 5F1VA 1A5BA 2D2JA 4MYAA 4JYFA 3VIJA 2NZLA 4AZGA 2WVVB 3QSTA 3WNPA 3PK7A 1E3ZA 3P84A 2YX0A 4IJCA 2QULA 4S1FA 2V2DA 2J8GA 5K3VA 4C90A 1YDNA 3GDRA 1P43A 3IJ8A 4FXJA 2XZ9A 4IOTA 4HU0A 3SR7A 5DT7A 1TWSA 3KL5A 3DN5A 1RJQA 3CO8A 1W1A1 2REQA 4JX6A 1QW7A 4UCGA 1J11A 3C5QA 2ZDSA 3UYIA 4FX7A 4O17A 4GKLA 3WNNA 4O54A 4DYEA 4Q32A 2CZFA 4YXGA 4UTKA 4UOZA 4LEFA 3NL6A 4D2JA 2QCNA 2DDXA 3TW9A 3UWQA 2G0WA 1KKOA 2WLZA 3DFQA 1XSIA 2EKCA 1W2PA 3OVQA 4L56A 3ZLHA 1LQ2A 3NFUA 4M6UA 1CYGA 2F6KA 1EJSC 1F3EA 1XLLA 2UY2A 2PEVA 5AZ1A 3ZT6A 1CX9A 1O5QA 1X8CA 4ZBCA 4NJIA 1V6XA 3DFPA 1S46A 2BTMA 4JEJA 4MIMA 3TIMA 5K4ZA 3CZ8A 1IZJA 3HMCA 2P8CA 2W3ZA 3FDKA 1AMKA 4GH1A 3KDOA 2FZ8A 2C8NA 2Y63A 3G1SA 4LUSA 5EFDA 4PCTA 1TV5A 4L1GA 3BZJA 4MNKA 4OUIA 5D4YA 2BXYA 4GIEA 1B30A 5CPSA 3TTSA 3LSBA 2EBNA 1OADA 1R85A 3HPXA 3LUTA 4CVWA 3EKLA 4MWAA 1SO4A 4R3UA 4LV9A 2XFYA 3P81A 3SURA 3UU0A 4G5DA 2NUXA 3CUGA 4MJ4A 4MADA 1SJBA 3HURA 1UR4A 2D23A 1QAPA 3WMBA 2DGAA 3LSCA 1OQFA 4NJJA 3ID7A 3FFSA 1V3IA 4XQ6A 1XH0A 1B3YA 3U7VA 1Q63A 3AXKA 3XINA 3KEHA 5C7VA 2VEIA 3CJPA 3KE0A 3QYSA 5CPLA 2OYLA 4S3JA 2NV9A 2XH4A 1LORA 3UZZA 3QTPA 1UPMB 4FLQA 4AWUA 2PDCA 3SGZA 3EB3A 1XS2A 1EUNA 1Q45A 4DYKA 3T1GA 1OM0A 2Z29A 3VNIA 3UJFA 1Y0EA 1XD0A 4L9XA 3CQKA 2IPGA 2QCMA 2UY5A 4OV4A 2WAGA 3BPWA 1TMLA 4X63A 3CZJA 5I79A 2OQLA 1VEMA 4IICA 3TJ4A 4JTUA 1KCXA 2VEPA 1Q4NX 2WXDM 2XH0A 3OYXA 1KGWA 3RX4A 3FOKA 1ZHAA 1Z41A 4HK5A 1V3JA 4GQGA 5TNVA 4MTVA 1HL9A 1ITUA 4TVCA 3QV9A 1A5AA 4XUGA 3KHDA 1QASA 3GRIA 2G4JA 2GGJA 2BGQA 1TV8A 4LC8A 3MS8A 1DHKA 1EOKA 4H8UA 1KA9F 3WCZA 1X6LA 3IJ6A 1TUFA 3PP7A 5D37A 3NA8A 4F2BA 3E12A 4MJMA 1ITCA 4HMEA 4S3BA 2CLMA 1KM4A 2OLHA 5EB8A 4QBXA 3BSMA 5C2CA 2J7BA 2PDXA 4EVZA 3U57A 3C0LA 3XIMA 2XVNA 4HPGA 4MOZA 4HD5A 1GOOA 3I6RA 3TN3A 3TONA 4FI4A 3PVFA 5CLWA 3NQDA 3RX3A 1LQ0A 2B0MA 3L12A 4YTSA 4DLMA 4DWSC 3WLMA 3O2LA 1VFOA 3DYMA 4PUEA 4O4VA 3EMZA 1PIFA 3CASA 1PXGA 1BAGA 5I07A 5A2AA 5HNRA 3H2EA 3P2VA 3RJXA 4CEXC 3F5KA 3W07A 4PA8A 4ZSUA 2QJMA 1SZEA 1C8QA 3U2EA 4O8AA 4JKLA 1W1ZA 1YPFA 2PRHA 2YXOA 3R79A 3W7KA 3VNLA 5DXXA 4F48A 3HGOA 4Y8FA 1JPHA 1QFEA 2X2GA 3PPGA 4ACZA 5LXEA 3W2JA 4ZA0A 2P10A 3OIHA 1FDJA 2QJNA 3V5FA 2OU4A 1F74A 4OBSA 4L5ZA 1I2RA 5ABEA 5BW6A 1TPH1 1TJPA 3H7UA 1NELA 4IPJA 3ENLA 1NOWA 1BYDA 1PIIA 1DXEA 2WKJA 2GVGA 4PRRA 4DPPA 1T96A 4GRSA 1Q6GA 3KOFA 2DP3A 4XO7A 2ZA1A 2V5LA 4HIBA 1I1WA 3C0QA 2CEQA 2Z1WA 3ZSSA 4AUBA 3HU7A 4RNIA 2GQ8A 2Q71A 2NX9A 3QFEA 4P2VA 3G3MA 5G2IA 1TG7A 4M56A 4L6DA 3IJLA 3R8RA 3UCDA 5D2YA 1W56A 1E0XA 1J2WA 4YHEA 1DWIM 1B3OA 1RY8A 1EIBA 3LV6A 1H1NA 4W4QA 1NF0A 3B9AA 1H0GA 3PBYA 3A23A 3GAYA 2E6AA 4DBWA 4IQEA 1GCYA 5E0FA 5J5DA 4S3FA 5CGMA 1OC7A 4L6HA 4QLJA 1JF5A 2TYSA 3WY1A 3LHYA 1JUKA 1LL4A 3CS2A 4H2CA 3EDDA 3W75A 3FHAA 3GNXA 3FGCB 3FNDA 1JI1A 1K02A 3EXTA 4IMEA 4W7UA 4GIYA 3GNNA 3WFZA 2XIBA 3VX0A 1LROA 1E55A 1JG9A 1ZAIA 1Q8JA 3BZGA 2CHOA 3MUCA 1UP2A 2VFFA 1B3VA 2E5CA 1UCWA 2X2YA 4WQ6A 4AC7C 3W2LA 3T4WA 4I5UA 2EG6A 3A4XA 3HMJG 2CNCA 3NUKA 4KGLA 3QMRA 1XLFA 4MJ2A 4D8AA 1ZBWA 1UR0A 4BFAA 2WZIA 3C8FA 1E4IA 1IEVA 5HQEA 4PMDA 2J25A 4LS1A 3VD3A 5JBDA 4KW2A 2BDQA 3E96A 1J18A 3T0DA 3LLDA 3T0BA 1S5NA 3PFRA 3ABSA 3IVSA 2W61A 3WEOA 5I0DA 5A2BA 4O8RA 3GXTA 1O5XA 1U2YA 3NQ8A 3QPYA 2X7WA 3TA6A 4XVEA 1Z32X 3KHJA 1OG0A 1OINA 1G4SA 4I6KA 5BMWA 3LZ5A 3U7BA 4GUJA 3RFAA 3KP1A 3BW4A 5CSYA 3UPWA 3E6EA 1HKJA 2VTFA 1Y5XA 3L0GA 4PTVA 4G2DA 1ZCCA 2VEKA 3W7CA 4DEFA 1EJUC 3I4EA 3D3FA 1CB7B 4UFMA 1OABA 3R43A 2XGBA 1CXHA 4KEVA 3GU9A 4IZGA 3E2QA 4Z0JA 4HMNA 2D0HA 2C3ZA 3GTIA 4JQAA 3G6MA 2TAAA 1UR2A 5JIPA 4Z1DA 3RF9A 3EMCA 4FO4A 1A50A 3JRKA 2JKAA 4NAEB 1JYXA 1G4EA 3P67A 1V8EA 2W0UA 2DJLA 1BWKA 2O9PA 3TYDA 2NWSA 3N04A 1DL3A 5AHNA 1WKEA 4IG2A 2V5BA 4MLRA 1W5MA 3IUHA 1MVYA 1OZMA 4AZ6A 4CD7A 4LVGA 4GX9A 5TIMA 4DJFA 4DYJA 1U5JA 2JIWA 3ZIZA 4AHQA 3N3MA 3ABOA 3S1VA 5AC7A 2C1HA 3AMKA 1DQUA 3Q65A 1KGXA 3K8KA 1A4MA 1OK6A 4PULA 1O4UA 1GQIA 1I8JA 3OTRA 3S9YA 3IIVA 3NZGA 1OJXA 1QI4A 4MB3A 1IXOA 1CCWB 4HP5A 1QK0A 2PCEA 3WH9A 3DHFA 4D8LA 4FOJA 3L4ZA 2GL5A 9XIAA 4S2CA 5CG7A 2WWDA 4XVDA 1C7TA 3DKJA 1H51A 3MHFA 4JTJA 1FDYA 4H83A 3LD5A 3P8IA 2GWGA 3FEQA 1EGZA 2R1LA 3UWVA 5AYIA 4GQBA 1SQ7A 3W7JA 5CGTA 1M65A 2R1KA 1UD4A 3OVPA 2X1SA 1V02A 3V7PA 4W9TA 2RDXA 2VX6A 1R8LA 4ZOEA 1IEWA 5FJRA 4PGLA 4JS3A 5I3KA 3DKLA 5I3DA 2GUUA 1GK8A 1LM1A 3V18A 4I7VA 3HG2A 1W9VA 1I75A 1PX8A 2QLYA 4QROA 1EWDA 2QCLA 4GYPA 3FAWA 3N19B 1KQYA 1UD8A 4RCXA 1R9YA 1G6CA 4DI8A 4B5TA 1BVNP 3BQ5A 3GIYA 3S46A 3FEMA 3R1ZA 1TV7A 2X30A 3GUGA 3IEBA 3N2TA 4MG4A 3W7PA 4ML9A 3IV8A 4XBJA 3WNKA 4PTXA 2FDMA 3GNRA 3S2LA 2BV9A 1AL8A 1IF2A 3IIXA 3LRKA 4KEUA 8XIAA 3RPDA 4KT2A 2CBIA 3BCJA 4D1JA 1NU5A 4FK9A 3BW3A 1EBGA 2C71A 3WZ0E 3IIOA 1UUOA 4JN7A 2Y7EA 3ORWA 1FWCC 4C6OA 3UZ5A 3SUTA 3W7OA 2E40A 1GOWA 5CPNA 4XZNX 3I3EA 3V1PA 3LENA 1AK5A 1XIDA 4KKXA 1E43A 1K9EA 4PMUA 2P88A 5ECUA 5A8PA 3CZLA 4IIEA 3NXFA 3GH4A 4PEEA 3ARUA 4W86A 2NX1A 2X41A 4ZL1A 1ZJIA 1QUMA 3H4GA 3CZKA 1ICQA 1CPUA 1H1ZA 4N6FA 2VR5A 3PJUA 3S9IA 3B0UX 1UP3A 3JS3A 3RUBL 3EAUA 1OFOA 1M5WA 1FCBA 1VYPX 2PB1A 4QM1A 3EOLA 4Q4OA 1H09A 1LYXA 2DSUA 3C61A 2BB0A 3QJAA 3VOHA 3OP2A 4BWLA 4HOZA 5DT5A 2OELA 4GUGA 3AISA 4V28A 4ZFCA 1HJUA 4HPXA 5DCDA 3S1XA 2C14A 3UCQA 2XFWA 4LYKA 4B5WA 2ZIDA 3VKKA 5F7UA 1MDRA 1YPXA 1RZMA 1BXBA 1OZQA 2YW3A 3HG3A 3NZ1A 4XB3A 1EPVA 1VBGA 1A3XA 2CWXA 1W0MA 3TDFA 3APYA 1PZ3A 1LOSA 4Y9NA 3M0VA 2D0FA 3GBEA 4U33A 4MKSA 2BP1A 3TEVA 1FQ0A 4N42A 3DG7A 3SM0A 3GSMA 2VUNA 3BG5A 4DO7A 3LTPA 4LAUA 3MW7A 3VGHA 1V6YA 1EDQA 3TLQA 5TAOA 1IR2A 3T07A 4L6OA 1RLDA 3LMZA 5IXEA 1K9TA 3E0WA 4XZLX 3O05A 4GKTA 1GVRA 2ZZ6A 3SSZA 2PDIA 3ES7A 3UR8A 1VBJA 1UWQA 3PFMA 1W9PA 3DHUA 3MO4A 3VOFA 3DHPA 3UY8A 3TFXA 2WCAA 3L67A 1T8XA 3TA9A 4GZIA 2XM2A 2Q01A 5BU9A 1OB0A 1GHRA 4FLOA 3HPFA 1DHPA 3PJXA 4JDYA 2WJEA 4QFUA 2VOMA 4D9PA 1ISXA 3ARYA 1GQLA 2E1DA 4Y7EA 1WAUA 3LLXA 3C2VA 4GQ0A 3EPMA 4GZEA 4Q4MA 4PE8A 4HK6A 2D69A 4PMXA 3CHFA 2DORA 2HS6A 2QAPA 3AYSA 4QNEA 4IP5A 1A47A 7REQB 3C2FA 2HCVA 4HZ7A 4HB7A 5CQ1A 3UJEA 3P0XA 2VCCA 3QQWA 3SCWA 4B2DD 2JFEX 3THUA 4O52A 3GM8A 4REQB 1BD0A 1REQB 2EEXA 4H1ZA 1XJBA 3TYZA 1J9YA 2WSRA 4JN8A 4XKYB 4PRWA 1BLIA 3VGFA 3M0IA 4W5ZA 1CXEA 2I7GA 4XZIA 3RK8A 4CUCA 1NVMA 2XJ7A 3KS5A 1GT8A 3IAPA 4GXPA 3L4TA 4AZIA 3IS4A 5DFAA 1SO3A 1VCVA 1EYWA 1TUXA 3VNDA 3N2CA 2QDDA 1FFRA 4NRSA 1XM3A 2IW0A 4DXKA 3FJNA 2QCDA 2CBVA 2A2IA 1GOMA 4ZCWA 1B4EA 3UR2A 2GSHA 3CL8A 3I3DA 3CL7A 1DP0A 3VDGA 2F9RA 1HKKA 3BWWA 2CXEA 3UY7A 1I2OA 1VGAA 3WH7A 2VI0A 4UBPC 5DQPA 3W01A 2XVLA 1LDCA 4TMCA 5K9CA 4B91A 1TX0A 2HS8A 4NJGA 1AL7A 1HXJA 2CBJA 3E5PA 3WJSA 3OW1A 3D6NA 1R2SA 3CPRA 1UWIA 1JFHA 3WQEA 1KRCC 3SCPA 4AVNA 3E2VA 3CAVA 1DJZA 3ZT5A 4CU6A 3LK6A 3W2MA 1W5OA 6REQB 4KGJA 3UWEA 2R9RA 2RUSA 1BF2A 2C91A 3PWIA 3WDJA 2IMRA 1KXTA 3W7IA 1TJRA 4IL0A 1VYSX 1RVKA 3SFWA 4YU1A 3K30A 2NSOA 3ZO9A 1EKOA 3H7VA 2RGMA 4M6QA 2ZOXA 1M04A 3OA3A 1KM2A 4QDMA 2Q02A 2G50A 1ODUA 1JD9A 3B06A 4WDXA 3MANA 7A3HA 2JGQA 4AY8A 5HOSA 3PWGA 1NJJA 3KBSA 1NIUA 4TQTA 3VCNA 4WGHA 4N02A 1GONA 2QCEA 5LIWX 1GEQA 1QTWA 2OT1A 3PSWA 4W5UA 2QPUA 5I02A 2F38A 3G0UA 2I9EA 3QOKA 3GLCA 5MKGB 2VKZG 1E9YB 2B7QA 3NZQA 4TX9A 1US2A 4WXYA 4OIFA 4N9CA 3WLTA 4Q8MA 3FHQA 3PTMA 1EWEA 4NZJA 4DZHA 3F5JA 2NQHA 4C1NA 3A5VA 3TSBA 4M1RA 3ONBA 1CECA 1RK5A 3VKBA 4HHPA 2UZ9A 1RBOB 1WP6A 2P3EA 3U0HA 4A22A 3V5OA 1BF6A 3CL6A 3TWAA 4Z42C 1EP3A 2NUWA 1OG6A 1JCLA 3MUY1 1IT0A 3GG8A 3H55A 4ZQRA 1LTDA 2WMJA 1Q6RA 4DO4A 3E74A 4K2SA 1P0DA 3WDHA 1OCQA 3V0UA 1GVSA 3LMYA 1ISYA 1W5PA 3KL0A 1T41A 3G1XA 3WLIA 1NDYA 1QRQA 4C6BA 3BVJA 4GYPC 1OC5A 1FTXA 4CN1A 3M5ZA 5EU9A 4HJWA 1LBLA 3QW3A 1V3LA 4OTKA 5HANA 3CUFA 2NT0A 3DFTA 1F3XA 3GTFA 3KAOA 4NIRA 3M9YA 5E9XA 3CWHA 2FJUB 3WBWA 5C9WA 4IIGA 1UUQA 4UFIA 5I24A 5PTDA 4EXQA 3MMTA 1NWTA 4NZCA 1RHCA 5AC8A 3WK1A 1IR1A 4G9PA 4ZO9A 3KWSA 3T0TA 5ABHA 3WUFA 3ELFA 4Z2HA 3BOFA 2OEMA 1K6AA 3NOYA 4C5YA 1O1ZA 1ONEA 3TAOA 3NURA 4M1BA 1VFMA 5L9FA 2YIHA 1NFPA 3MA8A 2J13A 3MJMA 5BZAA 4P7LA 2W79A 2HMCA 4EACA 1W3KA 2I57A 2NQ9A 2BASA 3W1NA 2XVGA 2WWCA 3VO0A 2OZ8A 4GISA 5I6SA 3ZJ7A 5CPQA 3J7HA 1UZ4A 2VDHA 2YCLB 1M9HA 3OGVA 2OKTA 2VZTA 1PDZA 4TTUA 1GJWA 2Y6ZA 3NEHA 5G1MA 3ARQA 3B04A 8CGTA 1U1HA 1W3TA 4BWLC 2Q8ZA 1GYNA 1V3HA 2XTKA 1UH2A 2BOGX 1TRIA 4S3GA 3P5YA 4XZHA 4E4PA 1JI2A 2XFFA 4JTLA 1CXLA 3CUIA 3DECA 5RUBA 1VIZA 4KS0A 2J78A 1TPUA 2O9RA 3TJIA 3WL0A 2GGIA 4KFPA 2B7NA 1YE4A 5JH2A 4QQ3A 3ARRA 1IWAA 2YPIA 1H7RA 4AG0A 3ZVHA 3I6EA 4NP7A 3CWOX 5JQ9A 1WXZA 3CAWA 3OZPA 4V33A 3AMDA 1UH3A 4L4PA 2R1NA 1H7OA 4ORMA 5A1AA 4DUOA 4V27A 4J7RA 4W7WA 1E40A 1VFUA 4GACA 1A0CA 4UWMA 2WMFA 3W29A 1TVPA 2G4FA 4BQ5A 2W9MA 1DKWA 3CZEA 2W92A 5GJNA 3S9ZA 1FWBC 3GDMA 3ITCA 2YZ5A 4I7WA 2ACUA 3SUVA 3G2GA 5EBUA 3UG5A 2JQXA 4DF0A 4RNJA 2WKLA 2Z1SA 3HBLA 3NL5A 1GYLA 4MKNA 1YPIA 5CSRA 3VABA 1GVFA 3CUXA 3DENA 3FYOA 4ZGYA 1K8CA 1RPKA 3Q37A 5M5DA 5CPTA 2HVNA 4GI9A 4U5KA 1YYAA 4AYSA 3RRAA 3FA4A 3T2PA 4QTGA 4FOUA 4U31A 4R53A 3RM8A 1C92A 1K6WA 4LUTA 1R5YA 3LQGA 1CTNA 3UA3A 2GOKA 1VAHA 3ALFA 1O7AA 2EJ1A 5DBTA 1YDOA 4QDPA 3RU8X 4LYQA 3PF3A 3L4UA 1RLCL 3QKEA 3O7UA 5JUVA 1JZ3A 3WDIA 3PZVA 3N4AA 1XP3A 2EPKX 3ARPA 1EQCA 1X96A 2BOEX 3W85A 1UD6A 5CBBA 2IKGA 3D0CA 1WZLA 4CVUA 3FKRA 5CLTA 5C71A 4K6AA 3S1UA 5C2GA 1GZ1A 1JZ7A 4PUKA 5J8LA 1ZJHA 4NL1A 1U83A 1VS1A 1UJPA 4JAWA 3VC5A 2PE4A 1B3XA 1SU5A 4AIBA 2XISA 4LGXA 3RIKA 4OOZA 2Z6JA 3R94A 4OV9A 2PSNA 1GOXA 3CMGA 4NNCA 1G4PA 4H4IA 1K4GA 5I23A 1HFBA 1T6MA 3T6CA 2PWVA 2PDGA 4YHGA 4F2UA 2ODOA 2VL4A 3RG6A 4ZSTA 3P61A 3WDQA 3R11A 4AZCB 3LRLA 2AL2B 2QCCA 1RK6A 5TD4A 2YYUA 4W87A 2XIJA 3INPA 2OJPA 3B9OA 2FFCA 1ML1A 1XCWA 2YKKA 1EJTC 4JHZA 4B2DA 2J79A 2V5CA 2Z7GA 2VCAA 4AIOA 1H1YA 3HPAA 4IFOA 4N0RA 4MPKA 1KR0A 3ARVA 3SCVA 1X1NA 5AHFA 4R7OA 1R9ZA 2AKZA 3RU6A 1CB2A 1DTNA 5MHBA 1FBAA 3MCMA 4BI7A 4HT3A 1S3TC 3M16A 4YLWA 2A3LA 4GNJA 1F3TA 1BYBA 3H21A 3LI0A 4MAVA 1JZ6A 2G8ZA 2G3JA 1QNSA 3KRZA 4JKKA 2WK2A 3U9IA 4AIEA 4LFYA 3SUSA 1AZ2A 3L4WA 1XSJA 1CDGA 1GTHA 3HG5A 3GH7A 2QUTA 3N4EA 3VI2A 1KCKA 5D9MA 4M51A 5HR7A 2RDTA 1HVQA 3L5LA 1ADSA 1H7WA 3C86A 4JTHA 1US0A 4A29A 2DEPA 1V3MA 2PWFA 1UC4A 3WD2A 4S39A 3E0LA 2XIQA 1Q6FA 3JW7A 4LVAA 1EDGA 3E49A 4HKPA 3F4DA 2HE5A 4AC1X 4BEUA 1VBHA 4IPNB 4BQ3A 4OZOA 3VGBA 3D47A 4GWEA 4DY1A 2Z25A 4QNWA 4AEEA 1LUCB 2Y2WA 1MW2A 3N14A 5EA9A 3OBEA 2WLYA 4Q33A 4LCRA 3EX4A 3VIFA 4ERGA 1X6UA 2C0AA 3NPUA 1NQ6A 1XRTA 3G22A 1TQJA 4RNHA 1AD1A 3II1A 3HPZA 2D22A 3RLUA 2D20A 1RD5A 2CERA 4O15A 3AYVA 3OPSA 4J1OA 2EPMX 1M68A 4ALDA 4Y9AA 4DBDA 4MSSA 1RJRA 3TQ0A 2Q3RA 4KRZA 3B4UA 2WNZA 4Q8NA 3S5YA 4JR5A 2QZRA 4E0CA 3H12A 2CIPA 2I56A 1E0VA 4HSHA 4AD3A 3UCCA 4XAGA 3A6OA 3B9NA 3LCFA 3NQAA 4IQDA 2FKPA 1JGIA 1CWYA 3WF0A 5EL1A 1A49A 4RUBA 2R8WA 4GABA 1SMDA 3KL3A 4XX6A 2DH2A 3KOWA 2V3GA 4JCMA 5FOOA 4UMBA 3QY6A 2PGFA 3HOJA 3W24A 4AZHA 5E0KA 3QLDA 4JNZA 2I1OA 3N34A 5DEZA 1U22A 1OK4A 4KCWA 3GTNA 1NM9A 3DESA 1MW3A 3KOYA 5ABFB 2ZX6A 1FP8A 2VEFA 5EMUA 1FH9A 3VIPA 3P14A 2VFHA 1XIGA 2PD9A 2YDSA 1WPCA 4ORIA 4GINA 2RH9A 3NQFA 5KSWA 4FZIA 2DIEA 2J7EA 4J3XA 3SY8A 4L9YA 1R3TA 4UMAA 2PTXA 1KXQA 1E6PA 2CZEA 1WKDA 5EMJA 4WR3A 1NQKA 4UNLA 4EWJA 2V5KA 2YL5A 3DC8A 4KEMA 3CB8A 2ISVA