4MVAA

1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mvaA00
2QJHA 2NV2A 3NGJA 3MYPA 2B7OA 5K4XA 5J5DA 3L2IA 2RH9A 3N9SA 1HO1A 2PRLA 1X7FA 1L9WA 4FB7A 3W7IA 3LBCA 1C29A 2QUUA 5CGQA 4UTMA 1OX4A 2V81A 3DFOA 2OT0A 3EX4A 3ANYA 1G4PA 1XUZA 3ZR4A 3OVRA 1VLIA 4O1CA 5LGZA 5AHLA 3PWAA 3I68A 4N9EA 1M6JA 2E6FA 5LNUA 1U83A 3LV5A 4UTUA 2WPBA 3CIWA 5AC8A 3W7EA 3KRZA 1LORA 3BLIA 4RZ4A 4RJEA 3CQ0A 2EF9A 3W86A 3UWVA 4X22A 3GR8A 2KZHA 4BWLC 3M47A 4UXDA 5BW6A 3P8IA 1NAL1 1XCFA 5F2MA 3B05A 1R46A 2OZ0A 4IMCA 1W54A 2H8ZA 1AK5A 4Q4KA 5G1YA 3TMLA 1YXCA 2WNQA 2ZZ6A 4HN4A 1F6PA 1MEHA 4HKPA 4YCOA 2VKZG 3W7RA 3S5ZA 1FWNA 3OEXA 3NL5A 2QDHA 3TQ0A 2AQWA 4TO8A 4IUOA 1DV7A 2BX7A 2HS8A 3W07A 3N73A 2Q8LA 5D30A 3HBLA 2VFFA 3INPA 1YDNA 3C2VA 3P61A 4AHPA 1F05A 2DU2A 5IM51 4LRSA 2J27A 5D03A 2A6LA 3QSRA 3M5ZA 2TSYA 1DHPA 3BGJA 4FXSA 3R5EA 4WX2A 1XBYA 3OA3A 1V7YA 1FCQA 2E6AA 3M43A 3KAOA 1GZGA 4ZZ9A 4UTTA 3C0JA 3LI0A 1RQEA 3TAKA 1TPB1 2VFDA 2Y70A 3MI3A 2QAFA 1W3NA 4JICA 4HNNA 3O06A 4JTEA 4HPJA 3THAA 3I6RA 2E09A 2CLEA 3KOFA 1Z42A 3R2GA 4LVAA 5EYWA 5K7JA 3N9RA 2DORA 3W1AA 1YDOA 1A5BA 1KM4A 2NXGA 4MOZA 5EY5A 5CPLA 4XZ9A 3KVLA 1MEWA 4LNYA 3L0KA 1FDJA 3C52A 3WJZA 3PY2A 5HULA 4RXGA 4OV9A 2DP3A 4O14A 2YDAA 2ZYFA 2E5CA 3ZFHA 3IGSA 3NG3A 1XC4A 3TFCA 1TO3A 4BWLA 4UTLA 1L6YA 1SUXA 1I2RA 5EKYA 3TXVA 4ICNA 1RPXA 3TJXA 5LNRA 3QH2A 2TRSA 1WA3A 4HNVA 3C2FA 1Q6QA 1FDYA 2ABAA 4NX5A 4EWND 4AWTA 1DJNA 2DZSA 2HTMA 1JCXA 3SGZA 3S8HA 4JEQA 4KFOA 2ZDRA 4FNTA 1VJIA 2ZA2A 1SFJA 5HUPA 1PHQA 3NXFA 1IXQA 1NSJA 4Z08A 1W5PA 3LHVA 3F1QA 4A3UA 1NVMA 1DQWA 1EIXA 4Z1DA 3MI2A 1GG1A 3TW7A 3P74A 4O18A 2JGQA 1KM3A 3G3DA 5CZSA 4UTWC 4PC8A 3IIZA 4IWWA 4N9DA 3DBPA 4GUJA 1EP1A 1XBXA 1VLWA 3GXPA 1WBJA 3CPRA 5TQLA 4DBEA 1H7RA 3TU9A 3TAOA 4JTFA 1D3HA 3I7QA 4K38A 3G1XA 1WX0A 1K8ZA 1YTDA 1W0MA 4I7UA 4QNEA 3SY5A 1JCYA 3GLCA 3CEPA 3TSDA 3HF3A 4XBKA 4GUGA 2Y85A 5E93A 3H53A 2X16A 1PL9A 4IXHA 2W6RA 4FEZA 1JCMP 5C54A 1G6CA 2NX3A 5FF0A 2C3ZA 4NU7A 1R2TA 4M6VA 5K2ZA 4O15A 2A5HA 1JCNA 3VNDA 3W83A 3LLFA 3UWQA 1GJPA 3T55A 4JTUA 3M7WA 4X3ZA 1NFBA 1JUBA 5D2TA 1H63A 5H2ZA 2NX9A 3T4CA 1WV2A 1TREA 5HWJA 3DKJA 3ZS4A 3TSMA 4K36A 2HMCA 3IIPA 2V2HA 4DF1A 3PBWA 3S42A 4LV9A 3TQVA 2GPTA 3NNTA 4ZQCA 1TRIA 1ZAHA 3G24A 1QOPA 3IV3A 1JJKA 3ABQA 3UQNA 1OFBA 1QMLA 3GNNA 5BNKA 2YYUA 3P60A 1ICSA 1K02A 1TV7A 5I3JA 4O17A 2ZZ3A 4S2CA 1UJPA 3LRMA 1O4UA 4JTIA 4ZQMA 1Q6OA 4ORMA 4RKAA 3RLUA 3MBDA 5F4XA 4FX8A 4JY8A 3BLFA 4OGZA 2ZRVA 4AHOA 1L6WA 3ABRA 3F4WA 4N4QA 1Q3NA 4NNCA 1AW2A 4OE7A 3PS7A 2ZZ2A 3T7VA 1LZOA 3GDTA 3L66A 5D37A 5FF2A 4ZQRA 3DHFA 1QDSA 1W8SA 3W7CA 3LBMA 1QPNA 2RHGA 4MYXA 1P4CA 3B06A 1MO0A 3GKFA 6ALDA 1ME7A 3UD6A 3QM3A 3DFQA 1G4TA 3NQ8A 3IGXA 4TMBA 6TIMA 4LS2A 2NWSA 1D9EA 3NL3A 4UTWA 1R30A 4IGHA 3G0UA 4UNLA 4UR8A 3P82A 3IRDA 3PUEA 5CZTA 3LTPA 1EX5A 1EPXA 3S5OA 3ELFA 1T0OA 3LX9A 4LUIA 4OV4A 1WDWA 1EWDA 2FPYA 4BF9A 4WY0A 2GQ9A 3G0SA 3GAKA 3G1YA 1K7FA 5HWNA 5IBXC 3LXBA 4JTTA 4YCPA 1H5YA 1XKYA 3I65A 2XN0A 3HQ1A 3U2OA 1TPUA 4JYFA 1PS9A 3C56A 5HWMA 2QCHA 1YDVA 1BKSA 1QAPA 4PODA 3FOKA 1BEUA 4A29A 4E2BA 3BW3A 3WK0A 4U4MA 1K7EA 5AB3A 1UUOA 3QMSA 4TIMA 3TC6A 1OYBA 1TPC1 3BG9A 4I7WA 2FDSA 1WXJA 2DZVA 4AF0A 4FNSA 3DI1A 5DN1A 3LDVA 5GVJA 3W2JA 2VFHA 4NVTA 3IEBA 3M16A 2GQ8A 3FA5A 5DBTA 4A2SA 4LVGA 4NXKA 1DL3A 2Z2UA 4IXXA 3UPBA 3SIZA 4DPPA 1T99A 2OJPA 3BPWA 3BW2A 2VELA 3QW4B 4YL2A 1FY6A 1LLWA 3DFSA 3R13A 5DCDA 2IQTA 4A21A 1UASA 5KINA 3M41A 3MP3A 3QC3A 1JRBA 4Y9AA 3A5VA 5AYXA 4I9AA 1H1ZA 1RVGA 5C2XA 1F74A 3WJWA 2CZFA 1LBMA 1SZNA 3TR2A 1SW3A 3UYCA 1YPFA 5K4ZA 1OK6A 2E6DA 2YPIA 3P8JA 4M5PA 2QCDB 1W3TA 4GXMA 3HJZA 3DFTA 3PM6A 3WFAA 4C1LA 1LTDA 4Y6GA 5DY3A 2WO5A 3CIXA 4R7JA 2Q3OA 1KTCA 1H7NA 1LYXA 3W88A 1JULA 4LTSA 4H4IA 3NQFA 4PL1A 3IIOA 1TB3A 3E9AA 5CPNA 1B4EA 4JGDA 4JYEA 1FX6A 2X2GA 3EWYA 3DU0A 3C61A 2WQPA 3MO7A 4IX0A 3PBVA 4LC8A 1MSSA 4K8EA 4JDBA 5AHMA 2ISVA 3GXTA 3QYQA 4O54A 4L4LA 5IBXA 4UTKA 2ATSA 1RQBA 2BSLA 4O0KA 4RXFA 2B4GA 1RZMA 3LTSA 1TTIA 2A0NA 3U8GA 5LZLA 3P62A 3HMJG 2VEPA 4MPQA 1VQTA 2NUWA 2JK2A 4QIUA 4FNPA 3W2MA 1HG3A 4DELA 2Q8ZA 1VGAA 3FS2A 4QM1A 4JTHA 1B9BA 1ICQA 1WOBA 4GUIA 3W2KA 1OFOA 2YFOA 4GUHA 2DZXA 2I9EA 3VKJA 2WSRA 2Y7GA 1G67A 3O15A 4CLMA 3L9CA 3LLDA 3KVKA 4UFHA 4LV4A 3HGRA 4CNOA 3QJAA 1TPEA 2QCCA 4CCDA 3KXQA 3VFLA 5D38A 4FNRA 1MZHA 2JKPA 2FB3A 1OFEA 1IXNA 2V30A 3NYZA 3L0NA 1A5AA 1JCJA 3NQCA 4TX9A 3W1MA 5KZEA 4CQAA 1GTEA 1XL9A 3M5YA 4IMDA 1S3HA 3M6YA 4ADUA 2B7PA 3E49A 5D32A 1SSDA 1LOSA 1SZEA 4O19A 1KLYA 2VEIA 2XN2A 2CLOA 4N02A 3MW7A 4P61A 5A5WA 3QFEA 3W7DA 2C19A 1L6SA 3NR0A 4BFAA 2C15A 1F76A 1EEPA 2CLMA 4I7VA 4NNAA 1KBJA 2W0UA 3CC1A 2CW6A 1FXQA 3SI9A 1BWKA 1KM2A 3ABOA 1MXSA 2E5DA 2RDWA 3I7SA 1P1XA 4MYAA 3OIXA 3IGUA 2QJGA 1EA0A 4O4VA 2Y7EA 2CFFA 3O6DA 3NL6A 3O6CA 4MLRA 3CT7A 3F03K 4DO5A 5EA9A 1JUEA 2QEZA 1H61A 4WQ6A 1SFLA 1E51A 3PF3A 2J9ZA 1SU5A 1UB3A 2DZWA 4UR7A 3STFA 1FWTA 1KA9F 1QPQA 3W7HA 3BK0A 2V9DA 4NQ1A 4O8RA 5AHFA 3H55A 2TPSA 2DZPA 1S5VA 4CNNA 1V5XA 3SJ3A 5MHBA 1HFBA 1H51A 1VCVA 3VE9A 4TMCA 2PCQA 1ONRA 1KTBA 4HNTA 3W84A 1VH7A 2E68A 1JRCA 2QCNA 3O63A 3STCA 4UNKA 1IXPA 4K6AA 1KFBA 4O1BA 2E5BA 4LY8A 4ZVJA 1JVNA 3NZRA 1THFD 4K8HA 5BMWA 5KSWA 4JTSA 4U28A 5KMYA 3B0PA 2Z6IA 2V0TA 1TJRA 4N2YA 3LHWA 1HUVA 1FBAA 3UWUA 4FXRA 5LNVA 1LBLA 1I8JA 2JBMA 3FYPA 3G8EA 1B4KA 3YPIA 3EB2A 2P0OA 2YGYA 4XTIA 1QNVA 1LP6A 5CZ0A 5DCBA 2BTMA 3CHVA 4RZ6A 1B3OA 1LLZA 2WNZA 2Z0IA 3BLEA 3LB0A 1HO4A 1JCLA 3NEVA 5SWUA 3IVUA 3GVGA 3N2XA 3WJXA 1G4SA 2AAMA 2I1OA 2Y7DA 4DO4A 1F5ZA 1GPWA 3HG2A 1FQ0A 4O0ZA 2ZRYA 1KFEA 3CWNA 3HB9A 3LV6A 4KKXA 4ZL1A 2EKCA 4MVAA 3IVTA 4ZMGA 3L67A 2GOUA 3M1ZA 3HGOA 5I3KA 1ZJIA 3TXZA 1VCFA 4P2VA 1KFKA 3S1VA 1Z41A 1N8FA 1F7BA 1TV5A 4RCXA 1QPOA 3E02A 3VE7A 5D33A 5C55A 4ADSA 1H7XA 1OX5A 3NQVA 2J24A 1QWGA 3L0GA 3OG3A 5I3GA 5FEZA 4AAJA 3PULA 5AOUA 1W37A 5LKYA 3JR2A 1ZENA 3M44A 2BWGA 5DBUA 3TE9A 4UCGA 3R8RA 1TYGA 3W7GA 3BVJA 5KZDA 3LXAA 1FCVA 4PTNA 3GR7A 4YMZA 4O1DA 4M7SA 1C9DA 5EL1A 1FCBA 3O8AA 4HIBA 2E6YA 5AYZA 4JS3A 2B7QA 5E1QA 1X1ZA 2QR6A 1EB3A 3LTYA 3G1AA 1I2NA 2DZUA 3GKAA 2WNNA 4TR9A 2VC6A 1QR7A 2FFCA 3HGJA 2EPHA 5CKSA 2I14A 2QCLA 2A7PA 4XUGA 4O13A 1OF8A 4MZ8A 4NZJA 3BARA 3HPSA 4W9TA 3A9IA 1OYCA 1H7PA 3W73A 5AN7A 3CLMA 3B0UX 3NOEA 3R89A 1PE1A 3NO5A 5LGXA 3N19B 3TMQA 3EX3A 3SFKA 2G5WA 3DHDA 4MZ1A 4QISA 1RV8A 1VCGA 3NQ6A 3UZJA 3TFXA 3S0CA 3LCGA 2YSWA 4OT7A 5CSSA 4UTHA 1GQNA 2RDTA 2ZZ7A 4XWUA 2JKEA 4JTLA 4Q32A 3HG3A 2NWRA 2ZRXA 5J5RA 4FHAA 4EF9A 3OVQA 1IGSA 2VXNA 2CZDA 2R91A 4AMAA 1H62A 3NQEA 3MMTA 3NDOA 3I7RA 2QUTA 3W1PA 1QPRA 3KFTA 2RFGA 2RDUA 3C2OA 4YWIA 2ZCGA 3SZ8A 3SECA 2FPTA 4LVFA 3TCEA 1VYPX 4N4PA 3G1VA 4JIPA 2J6XA 1JQVA 2HS6A 3JRKA 1QFEA 2CZ5A 2V8ZA 1Y0EA 2QJIA 3HG5A 3S1XA 2Y61A 1WBHA 2CLIA 2E77A 5HR6A 4AEOA 2GVLA 3GNDA 4UTIA 1N55A 3WJYA 3NM1A 5F2GA 4JTGA 1PCWA 1FWRA 1ZCOA 3QQ1A 3W2LA 3W7LA 1WYIA 3G3MA 3OHIA 5D2XA 1TTQA 4QSHA 2ZA1A 1G7VA 3W85A 3NVTA 2C18A 2GVJA 2VFIA 3LHUA 1FDZA 1TCDA 5DXXA 3EXTA 1OFQA 3CU2A 1IIGA 3W71A 3WK2A 4H6KA 1D3GA 1W31A 3LHTA 4ZQOA 2OX1A 3C8FA 3EX2A 4DBDA 3H54A 2YXGA 2Z1BA 3TDFA 1ZY9A 2ALDA 2X1SA 1LOQA 3C4UA 4HPXA 1G7UA 4KFPA 3W3OA 5A8GA 3SR7A 1GVFA 2G96A 1R2RA 4UIOA 2F7FA 4XTDA 1H7OA 2V5LA 5HR7A 3W1RA 2C6QA 3E12A 4K7YA 1CI1A 1JQXA 1GG0A 4IJBA 5AC6A 3LCXA 3NPVA 3NQ7A 3NQAA 4MFDA 1A50A 4XBSA 1VR6A 3S9YA 5U7SA 3O6YX 4O11A 4PH6A 2FLIA 3LCHA 3TQKA 5I3FA 1U5JA 2PRHA 2H6RA 1Z48A 4OWGA 1YTEA 3FLUA 3QRHA 4O4WA 1TRDA 4YXGA 4AXKA 4NJHA 2V5BA 3S1WA 3GB6A 3B4UA 4IMFA 3MJYA 3L65A 5CG7A 3N2MA 2B0MA 3GDKA 3L68A 5BRBA 5LNWA 1A5SA 1FWWA 3HGSA 5I3HA 4LRTA 1UUMA 1I2QA 1QO5A 2PURA 1W5NA 2V2CA 3R12A 1SZFA 1KLZA 3QZEA 4IX2A 4WOQA 4BR1A 1VPXA 3KVJA 3LRLA 3MI6A 4O12A 4Z0SA 3W1NA 3M5VA 2ZBTA 5D04C 2VFGA 1EP3A 3EEGA 2YR1A 5G4EA 1SZGA 3NPWA 4LVDA 3PAJA 2VEMA 4LU0A 5E0KA 2P10A 3V1PA 4UFMA 4OU1A 3QMRA 1N7KA 2ISWA 3GDLA 2EGZA 3EXRA 4S1FA 1X1OA 2Y62A 4PFMA 3DXIA 1DBTA 3CTLA 2QCDA 3GDMA 2QAPA 1CW2A 3PVFA 2TYSA 3LXCA 3TV8A 4IQLA 5F1VA 4AWSA 3T44A 1KM1A 4JIQA 1KFCA 4O57A 5H91A 1XBVA 4M19A 1UCWA 5KZMA 2ZRWA 1LM1A 3V75A 4NJGA 1TMHA 4DF0A 3DENA 5LHFA 1YXYA 2Y88A 3IVSA 1LRTA 4Z0JA 2QDGA 4FX7A 5DLCA 4NJJA 3BG3A 1UBSA 1C8VA 5C6MA 5LSMA 3QQ0A 3RFAA 5D05A 2AGKA 4JXCA 4GBUA 3RK8A 2JKAA 1PCKA 1Q45A 2ZA3A 4LWWA 1IF2A 3IIXA 2EHHA 3KRUA 4Z1BA 2GJNA 3LHZA 1OJXA 4DF2A 1XFBA 1W3IA 3RF9A 3EWZA 2OT1A 4LT9A 1QOQA 4UFJA 5CPMA 3ZWSA 1P0NA 2YYTA 5HQEA 3OBKA 4JX4A 4EIVA 2ZQ0A 1VYRA 3CB8A 2UV8G 2FB2A 3EWWA 4G1KA 3LCWA 4K37A 4JNMA 4ML9A 3TH6A 4Z1CA 3DFNA 4S2BA 3PB0A 3W76A 3B0VC 2H8XA 3MBFA 4FO4A 3IIVA 3STEA 1P5BA 1GEQA 3LGEA 2A4AA 3C2RA 4JYDA 2YCEA 4E0CA 4JX5A 3LERA 2PC4A 5CZJA 2Y6ZA 2J9YA 4A22A 1TJPA 2RKXA 4AVFA 3LM7A 4NUWA 4J9JA 4UMAA 3W1UA 2FJKA 5FEPA 1AG1O 3E0IA 5AC7A 3TIMA 4XKYB 4C1KA 3MYOA 1GYLA 4CNPA 3NQ2A 4Y96A 3SSJA 2Q3RA 1LCOA 3PSVA 4LS1A 4ADTA 1TTJA 4FNUA 1AL8A 4WD0A 2GQAA 3NL2A 1X8FA 1I2PA 4AWUA 1G69A 5HJLA 4NT0A 4UTTC 3BGGA 3UY8A 3P7YA 3G8RA 3S1UA 1H60A 1K8YA 2ATMA 3QPYA 1F2JA 1W5OA 4R33A 3W7PA 1P0KA 2O7SA 1AL7A 4BI6A 4CQ9A 4XQ6A 4QITA 3SGUA 5FF3A 1F6KA 3BV4A 3AJXA 2NXHA 3NZ1A 2GJLA 1GVRA 1H50A 3LCFA 4ZQNA 1TTPA 5F4WA 2A85A 4ZQPA 1TPDA 3A23A 1GTHA 5FEXA 1XXXA 3NPUA 1NEYA 1M5WA 3L21A 4WUIA 1H7WA 4FX6M 2WOQA 2D73A 5K3VA 4NNBA 1ALDA 3UZ5A 1OX4B 5EPDA 2CLFA 3NQDA 3EWUA 1GT8A 3M9YA 1FCUA 1SO6A 4HSNA 2DJLA 1K8XA 4UFLA 4DXVA 4MY9A 1ME8A 4WJEA 3W1TA 1YYAA 5AYYA 2R8WA 4LW7A 1OHLA 4JY9A 4NJIA 1GYNA 3PG8A 1KW1A 1AW5A 4O16A 4POCA 3OVPA 2ZZ4A 1YADA 4AH7A 4GJ1A 4MJMA 1W1ZA 1ME9A 3HG4A 1KFLA 4EVZA 1OFRA 4HHPA 1SR9A 4IMEA 1PVNA 5TBOA 5BOOA 1DOSA 3GK0A 1VZWA 3W6YA 4QNWA 4IMGA 3TX9A 5KTLA 1LDCA 3THQA 4JR5A 2ZRZA 4O53A 3KX6A 3ABSA 1EWEA 2C13A 4FIQA 2NUYA 3FEMA 2GVGA 3PC0A 3LCIA 3KHJA 1ML1A 1AMKA 2A7NA 2CU0A 4JTKA 2ZRUA 4GWEA 4E38A 1WOAA 1XBZA 1LBFA 2YW4A 3PG9A 2OMAA 4UC5A 4M7TA 3AO0A 2DJXA 1VYSX 4RK8A 1I2OA 1OFPA 4IOTA 1B57A 1K3UA 4Z1AA 2VENA 3NM3A 5TIMA 4MLJA 4WZHA 3BO9A 3N34A 4MUZA 4RLIA 1G4EA 2WV8A 1ZALA 1QCWA 2V82A 2ZZ1A 1RD5A 1ICPA 1ZNNA 2ABBA 4PCFA 2FPVA 1I4NA 2CLKA 3JS3A 3D0CA 3O07A 4LOCA 1Q6RA 3QF0A 2XN1A 1TQXA 2OCZA 3TK7A 1DVJA 2C0AA 4MKNA 2Y63A 5HNRA 3N14A 2B7NA 2NX1A 3PB2A 5K9CA 2NZLA 3EKLA 1KTNA 4UTJA 3NAVA 2H3DA 3W72A 2BZNA 3GX9A 2ZTKA 1HL2A 3W9ZA 1GVQA 4O10A 2CWNA 4IPIA 2Y7FA 3P84A 5G1TA 3UNDA 3P80A 3W2UA 3TJLA 1OG0A 1KV5A 1XI3A 3RLVA 4UMCA 3FYOA 1SSGA 3FJLA 3DFPA 2FQIA 2A2IA 3W74A 1KM0A 3M0ZA 3GXNA 3ZWTA 3EKZA 4RZ5A 5C5YA 2V2DA 1EUNA 3A21A 3W87A 3P5YA 3Q37A 4X9SA 4FNQA 3B03A 2QF7A 4EOUA 1O94A 3GIYA 2C1HA 5LNSA 3G1HA 3W7MA 4A2RA 1H1YA 3A5FA 3PBUA 1VC4A 2CZEA 2PRMA 3LI1A 3W7QA 1K03A 4L4MA 1S5WA 4LS0A 4KFNA 3GYEA 3N3MA 4MIMA 4NJKA 3TNOA 3C6CA 1VS1A 2TMDA 3F4NA 3W1LA 4ONVA 3UY7A 1TPFA 3C2EA 1DJQA 2WSYA 5D2VA 5FF4A 3VI2A 4CCEA 2CLHA 3Q58A 1O5XA 2A6NA 3DI0A 4Q33A 4K39A 5DELA 1DQXA 5CPOA 3PR2A 3O16A 1O95A 3CWOX 3LRKA 1FUYA 2Z6JA 4JTJA 1OFAA 4O1AA 1IIHA 5FF7A 3UWYA 3L5LA 1FXPA 3EXSA 1W5QA 2QCEA 3W7KA 4NZFA 4K7VA 3O05A 5HINA 5FESA 4TU1A 3UXDA 3EX6A 1XDMA 3T78A 3VCRA 1WQ5A 3P5ZA 3ATYA 2QUVA 1RQHA 1LRQA 3LHYA 3RMJA 1JUKA 2C16A 4UMBA 3RU6A 4BI5A 3W22A 4DQWA 2X1TA 1CX9A 3W23A 3TKFA 3BW4A 3P81A 3S5YA 3G1SA 1PHWA 3L5MA 1O60A 1QO2A 5AFDA 4FF7A 1LRNA 4H3DA 1KM5A 1EUAA 4UFIA 1GWJA 1ZAJA 1SQ7A 1J2WA 4GE8A 3QMTA 5D09A 1A53A 5HUOA 3LCLA 1OFDA 5DCEA 1KM6A 5LHEA 4QAIA 1LOLA 3FKRA 5G2IA 3GAYA 4MFEA 1BTMA 5G2WA 5G2HA 4IPJA 4DPQA 4CQ8A 2NLIA 1Q6LA 4D2JA 5T26A 2QCFA 2A1YA 3G1FA 2J9XA 1FWSA 3MHUA 4O50A 5K9XA 1MEIA 4WOZA 4N6FA 2VEKA 3NQGA 3UXAA 3T40A 1OABA 4ORIA 2E1DA 1TIMA 3O1NA 4AHQA 4JN6A 2FTPA 3MHFA 1IXOA 2EAWA 3FFSA 4R53A 5KITA 2LLEA 3W7NA 1F73A 1S5TA 2ZFAA 4KWVA 4BK9A 3B8DA 3HOJA 4PEKA 3FKKA 3W2NA 5G5IA 1VHNA 3W1XA 1J4EA 1DORA 5ABTA 1GVSA 1KFJA 4O52A 3S6DA 1XDLA 4RV8A 3SW6A 4CCCA 3L5AA 4R34A 4OHQA 2WKJA 3UWWA 2YZRA 5I3IA 4JDYA 3QEZA 4AB4A 3QSTA 3DKLA 1GVOA 2VOMA 4HSOA 4N9CA 1TV8A 4QJ1A 4GC4A 3FIGA 1ZHAA 1SW0A 5HMSA 2ZZ5A 3QPZA 4WXZA 2F84A 4PA8A 2C14A 8TIMA 1LROA 4GNJA 2DZTA 1OF6A 2WJZA 1SW7A 3TSBA 3CM4A 3B04A 1WAUA 3A22A 1VHCA 4WXYA 1JR1A 5FEWA 3DH7A 3P67A 3TROA 2PE4A 4OQVA 2W79A 3E96A 1VRDA 3UPWA 1DKWA 1L2UA 4M6QA 2QCMA 2R94A 4B5NA 1BWLA 4MZYA 2NV1A 4QQ3A 4N9BA 3HO8A 3LOTA 3USBA 1NF7A 1I45A 3MP4A 3HPZA 4GRSA 4WY0B 2Y89A 3W1QA 3WK3A 4OBTA 3MUXA 4ALDA 1XUUA 3EWBX 3ATZA 5D2WA 3NQMA 3KRSA 3EX1A 2J88A 2X1RA 5L9FA 4DO6A 1TPVA 4Y90A 5DXYA 3STGA 3Q94A 4WY0F 3EWXA 2H3BA 3S5NA 3C3NA 1PV8A 1OK4A 3DGRA 2X30A 2A21A 1SO5A 5F2LA 1RR2A 4LUJA 2G95A 1ZAIA 1KV8A 3TW6A 1NF0A 5BMXA 5K9DA 4GFSA 4AF0B 1O5KA 4BI7A 3PBYA 1PIIA 3G18A 1K7XA 1SO3A 3TUUA 1HTIA 4M6PA 1OYAA 4EF8A 3MWAA 4LC6A 4RX0A 5FI8A 2NXIA 3TA6A 5CSRA 5EBUA 1OX6A 2ZTJA 5AHNA 1OVDA 4MJZA 4DEFA 2VFEA 5EMUA 1ADOA 2YFNA 4X2RA 4HNUA 2A7RA 3NPXA 3DZ1A 3FJ6A 3G0XA 5AHIA 4HT3A 3W70A 1R2SA 3GZ3A 2R14A 1SO4A 1TPWA 5F1UA 3MP5A 1T96A 3WK1A 4O28A 3DAQA 4RR4A 2H90A 2P1FA 4UUIA 1J5TA 4JX6A 3Q2DA 2QCGA 1TQJA 3HPXA 4FIRA 1YXDA 2X1UA 3GDRA 2BXVA 4MY1A 3W7OA 4JD4A 5L6UA 4UFKA 1W56A 1R47A 5DY2A 3W75A 3PSWA 2QKFA 4Y8FA 5D2YA 1A5CA 2JGYA 2XFWA 3U6WA 1M7PA 1X6UA 3G1DA 3PUDA 4NXSA 1AW1A 3A24A 3W7JA 3HIJA 1Z44A 5D02A 5G4WA 7TIMA 5AHEA 2ISSA 4XKYA 2WSQA 3RNDA 4PL2A 3G22A 4LVBA 4N6EA 2YX0A 4MY8A 2GUUA 3CEUA 2NUXA 3PUOA 5F4SA 3UWZA 3NA8A 1YPIA 1XM3A 5U4NA 1ZFJA 4NX0A 2FIQA 1TSIA 2O7QA 1T8XA 4YLWA 5F2IA 2G97A 3BG5A 3QW3A 4GUFA 2YW3A 3WJSA 2HSAA 4KWWA 1EP2A 1GOXA 3TC7A 1YTKA 4E2DA 1M7OA 2CLLA 3K30A 2BLEA 3M5XA 1KBIA 1TPH1 3KVMA 1YLVA 1SPQA 3MHGA 1W5MA
chains in the Genus database with same CATH superfamily
2B7OA 5K4XA 1XKJA 1BHGA 2RH9A 1HO1A 2DUZA 2XH4A 3UR2A 3LBCA 2QUUA 4V28A 4MNJA 1ADSA 4FOUA 2XSBA 1CXLA 1XUZA 3OVRA 1CENA 1R87A 3I68A 4N9EA 2NQ5A 1M6JA 2QDEA 3E5BA 3QR0A 4LANA 3SN0A 3CIWA 3QV9A 3DYPA 3ZJ8A 2EF9A 4XVEA 1JDCA 3T8QA 2Y8UA 2KZHA 3F5LA 4BWLC 4M8UA 4UOZA 2WMGA 4RL3A 3ITLA 5KEZA 1XH2A 2WMJA 2PLMA 3AALA 5HMEA 4B9YA 2Z4GA 1YXCA 4HN4A 4R27A 1F6PA 1XISA 3CUXA 1XIDA 4HKPA 5CLWA 4YCOA 2VKZG 4UQEA 3S5ZA 1ZBVA 3NL5A 1BWVA 1PTDA 2PDUA 1LG2A 2HS8A 3M0HA 1FP9A 2OOGA 4E5TA 2F6KA 3VMNA 4LEQA 4I90A 5D30A 2VFFA 5A6TC 2JALA 4AHPA 2OPJA 1F05A 1DWHM 5T9BG 3URQA 3G6LA 3TTSA 1UC5A 3FHAA 2QMKA 4HZ6A 1UR2A 2PF0A 3MUZ1 3ARUA 2TSYA 1XYZA 1NH6A 1P0EA 4HU0A 4ZZ9A 1RP8A 1US0A 3BANA 5B80A 3LI0A 3WUFA 1YQ2A 3GXMA 1V6YA 1MUMA 2IMRA 4LUSB 3S9ZA 3MI3A 4JICA 4HMDA 4AD5A 2Z1VA 5HMFA 3K4DA 4X61A 3SURA 1FA2A 3WQ8A 1A5MC 3PZMA 1IQ8A 4JIEA 1Z42A 3SCWA 3R2GA 4LVAA 1P7TA 4IGSA 2WVVA 1FH9A 4MWAB 4HBKA 4XZ9A 1UP0A 3L0KA 3WDJA 1AQHA 4OUIA 2ASHA 3RX3A 3PY2A 3TZNA 4RNFA 4RXGA 3GHTA 1W9DM 1WDSA 1WNOA 2O92A 2Y2WA 4UB9A 4ZEPA 1XC4A 2WHKA 3TFCA 1CGWA 1TO3A 1QNQA 3BLKA 5EKYA 1XLIA 3TJXA 4PTXA 5I79A 1V3IA 2GSJA 1Q6QA 3LMZA 4QG6A 4QG8A 2E8YA 2DZSA 3SRKA 2HTMA 1JCXA 1EPVA 1VFUA 3S8HA 2J7GA 4W88A 1DEDA 4UQ9A 2AGTA 4CN1A 3VPLA 4PUUA 3OU8A 4XD6A 3NXFA 1QTWA 3LSCA 2WKGA 4Z08A 3W02A 1W2VA 2PDBA 3F1QA 4QDWA 3GTFA 3PJXA 4Q4PA 4PC8A 2X40A 3IIZA 2G50A 3POCA 3DBPA 3RCYA 1WBJA 1E1EA 3ZXWA 1VRXA 5TQLA 2FFIA 2FZDA 2PWGA 4H6QA 5IHSA 1W0MA 4QNEA 3F2CA 4KETA 3W82A 4LAKA 1S2TA 3BLOA 4IXHA 2GJXA 2W6RA 3CQJA 4FEZA 1G6CA 2C3ZA 2GK1A 4Y7EA 4S3EA 4NU7A 1GW9A 3BAWA 2G3NA 3WF3A 2OKOA 2GOKA 1GNXA 4LYPA 3VNJA 3ARZA 4DWSA 4JTUA 5CPQA 5DMNA 4X3ZA 5FA5A 1JUBA 3CXOA 4Q4QA 5CJNA 4A3HA 4E8GA 5T8GA 3VABA 5FKYA 4HNLA 4D6DA 1KXQA 3T4CA 2L5HA 2ZXQA 2VCBA 1UZ4A 3RITA 3TSMA 2OO0A 5CAHA 4DF1A 4DLFA 4CU8A 4XK2A 4LV9A 1QW7A 3GUGA 3G24A 1ZAHA 1QOPA 2GGIA 1JJKA 2YXOA 5TF0A 1GKQA 2PGEA 3H4GA 5BNKA 1A0CA 3P60A 3FAXA 4J4KA 3S2JA 1KRMA 2GLKA 5I3JA 2OR2A 2ZZ3A 1IZCA 2DT0A 1JAKA 4S38A 3MBDA 5F4XA 4OGZA 3ABRA 4N4QA 1AW2A 2GYIA 4OE7A 5E5CA 3T7VA 3GDTA 4YN5A 1IEWA 3MKKA 5M3WA 3DHFA 1EOKA 1QDSA 3W7CA 3LBMA 2VEGA 4GQGA 1P4CA 3B06A 6ALDA 1FH7A 4XO6A 3K8LA 2Y8KA 4W7WA 2CBJA 3IRSA 6TIMA 4NI3A 2QDDA 3NL3A 4UTWA 3TP4A 2F2HA 4UNLA 3I6EA 4N42A 1TZ9A 3PUEA 1YHTA 3S5OA 2ZE3A 3R8GA 2KAUC 3LX9A 1QK2A 4LUIA 3LN3A 2FPYA 3UR8A 1RA0A 2GQ9A 1J0KA 4L61A 4JTTA 2J7HA 3KEHA 1H5YA 1XKYA 2XN0A 5A3HA 3SCRA 1YEYA 5CC5A 1BKSA 2DT3A 1QI5A 1DE5A 3FOKA 3BW3A 2HQAA 2KX9A 5AB3A 4HPNA 1UUOA 4PZVA 3BG9A 5CPSA 1IT8A 4AF0A 5EMKA 3HV8A 2D3NA 2G3MA 1S2WA 3RRXA 3TC3A 4JFWA 2WWCA 5I06A 3M16A 4PR4A 4A3RA 4LVGA 3F7JA 4NXKA 1DL3A 1GVYA 3QV7A 1MQQA 4FOJA 2YKKA 2Z25A 1G5AA 4S39A 5DCDA 4H9YA 4A21A 1P48A 1QHZA 3EA2A 3NWRA 1JRBA 2Q71A 5E6YA 4MTVA 4Z17A 2OOFA 3WDIA 3C5QA 3BL3A 1YPFA 3URAA 2YPIA 1NWTA 1FFQA 4C1LA 1IEVA 3SCUA 4HU8A 1LTDA 4UR9A 3CIXA 3DDMA 2F61A 4TTGA 1ZSXA 2I56A 4GYPC 2BBFA 4LTSA 3TYBA 1R85A 4H4IA 3NQFA 4ENLA 1B4EA 3ZT5A 4JGDA 1FX6A 2I5QA 1F61A 3MO7A 4IX0A 3B8IA 5AHMA 1W6TA 3KL3A 4GFIA 3ZM8A 3LTSA 3CLWA 1GOMA 1WZKA 2A0NA 1RJRA 1O1ZA 2VEPA 2QIIA 1M68A 3L2MA 4JQAA 4QIUA 3RN6A 4CD7A 1TE1A 4FNPA 4IJCA 3HN3A 2HWGA 4KEVA 3FS2A 4QM1A 4JTHA 3VKCA 3DX5A 1WOBA 3PJUA 2J47A 4IFKA 2YFOA 4GUHA 1B3WA 3O15A 1SMDA 3ZT7A 3BGAA 3LLDA 3MZNA 3CQKA 3FNDA 1XLMA 5GJMA 4UFHA 1XD1A 2DIKA 3QJAA 1PO9A 2QCCA 1FHVA 4PTWA 4FNRA 4RUBA 1BVZA 2PS2A 3FHQA 4PMOA 1OFEA 1GKPA 2CKSA 3T07A 5BXSA 5KZEA 1GTEA 1E0TA 1QT1A 4ADUA 2D3LA 1SSDA 2CHOA 5HPCA 2XN2A 2CLOA 5A5WA 3QFEA 3U4FA 4CU6A 4HOXA 2ISFA 2C19A 4M51A 3J7HA 3UFYA 1A5KC 1EKOA 2C15A 1KBJA 2W0UA 5FJTA 1FXQA 3SI9A 3A12A 5XIMA 5A8OA 1J0IA 1MXSA 2E5DA 2YBVA 4I5XA 3IGUA 1JZ3A 3O6DA 3NL6A 4MLRA 3CT7A 3F03K 3WLTA 4KWOA 1H61A 1E51A 1UR1A 4PN2A 3RIKA 3WNLA 1XRFA 3R25A 1QPQA 3P0XA 3H55A 2DZPA 3GUWA 1GUVA 4CNNA 1V5XA 3SJ3A 1HFBA 3N2OA 2ZXBA 3VE9A 1HQTA 4AWEA 4YTUA 4QS6A 4EKJA 2PTZA 3O63A 3STCA 1ZB5A 4AUBA 1EBHA 3NZRA 3K8KA 4Z2GA 1THFD 3U0HA 5JBFA 1EL3A 3LHWA 5H8UA 1I8JA 2ZUVA 5B7YA 4IIGA 3UVIA 4LUSA 3EB2A 2P0OA 5E09A 1QNVA 5DCBA 6CGTA 1TR1A 3EOEA 3VD5A 1B3OA 2WNZA 5MF5A 4D71A 2FVMA 3WJXA 1G4SA 4HA4A 2FTYA 3E5PA 1DIOA 3N04A 2ZRYA 1UBPC 4XZHA 4KKXA 3AMLA 4MVAA 3IVTA 3L67A 3HGOA 1TIWA 3OQEA 1VCFA 1CGXA 4F2UA 1I6NA 3MUAA 2XVPA 5FSDC 4G2DA 2BHYA 5C55A 4GKLA 1VBRA 4H00A 2PCEA 2J24A 3L0GA 5FEZA 3QTGA 4U10A 5LIYX 1MUCA 2X42A 3AZTA 1U2YA 3VOGA 3SCTA 1R5YA 1C90A 3JR2A 1YNPA 4HA0A 5DBUA 3D6NA 3MO4A 1A47A 3TE9A 3R8RA 4E6MA 1PIFA 3L2LA 3LXAA 2VDGA 1FCVA 2QGHA 2FVKA 1FCBA 1X1ZA 2QR6A 5C7VA 2I9UA 2X1IA 3LTYA 3NZQA 1I2NA 1E9LA 2WNNA 2VC6A 3HGJA 3TW9A 5CKSA 2REQA 4O13A 3WD3A 3AFBA 1OF8A 3HPSA 1V0KA 3W73A 3TZFA 3ABZA 3NOEA 5LGXA 3M0MA 3TMQA 2BY0A 3GG1A 3DHDA 3UZWA 1AVAA 3LUTA 4QLLA 1NFPA 3RAOA 1UWTA 1E9YB 2J13A 4OT7A 5CSSA 3PBGA 1GQNA 2ZZ7A 2DW7A 3N6QA 2JKEA 4JTLA 2HE8A 3HG3A 4Q22A 3MZ2A 2F6UA 2ZRXA 4LH8A 4GX9A 2PBOA 4KCWA 5REQB 4PMJA 3GTNA 5HANA 3IJ6A 2R91A 4AMAA 1H62A 4LQ1A 4XIMA 1OC5A 3W1PA 2XSAA 3KFTA 3E38A 3SZ8A 3AQUA 3LNMA 3WH6A 2J6XA 2HS6A 2V8ZA 4PSRA 1Y0EA 2E9MA 4B15A 3TONA 3HG5A 4LCSA 3T4WA 1WBHA 5HR6A 4PB5A 4FXJA 2P8BA 4UTIA 3WJYA 3NM1A 1DJYA 2CBVA 1PKLA 4KRUA 1ZP3A 4M1BA 4F4RA 2RGLA 3W2LA 3G3MA 3OG2A 3S9IA 5D2XA 5ABEA 1G7VA 1V93A 1XQKA 3B8SA 2C18A 2GVJA 3LHUA 4DM2A 3N3TA 1TELA 4PULA 1KCXA 1NDYA 5D8ZA 1AH4A 1S2AA 2DIEA 3WK2A 3ECQA 1VFMA 3BQ5A 2PDYA 4P7RA 3C8FA 3EX2A 2VGFA 4DBDA 3VC6A 2I5GA 2YXGA 1ZY9A 4NZ5A 3AOFA 1WDPA 3T9PA 1VJSA 3WF0A 3I3EA 4HPXA 4C90A 1G7UA 3DIPA 9XIMA 4C6KA 1R2RA 1L0PA 2G37A 3R11A 1S39A 1XPYA 2PDLA 3RGTA 3WD1A 3GNPA 3KRBA 3E12A 1ECEA 4J3SA 4FAMA 1E40A 2IXUA 1NQ6A 1GG0A 3IJIA 3ZJKA 1PKNA 5JBDA 1A50A 5FAGA 2BDQA 5U7SA 2WB5A 4LXFA 3WQPA 4O11A 3R79A 3OO2A 3LCHA 1R3SA 5I0DA 9RUBA 3TQKA 4NZ3A 3FLUA 4ZB2A 4NJHA 2FVLA 1J79A 1EZ2A 1HZYA 3NDYA 3B4UA 2IKHA 3MJYA 3D5HA 5CG7A 3KUMA 4R88A 3GDKA 4NAFB 1IWPA 1FWWA 3HPAA 3HGSA 5I3HA 1LT7A 4AZ6A 3KCLA 3VNMA 3DCPA 2PURA 2V2CA 3R12A 3ZMRA 4JL2A 1SZFA 3K2GA 2CESA 3QZEA 4BR1A 3MI6A 3W1NA 3CB3A 4U2ZA 5E9XA 4Q8WA 3EEGA 4LYKA 4Q8VA 2YR1A 4IUGA 2ZXAA 5G4EA 1SZGA 2OU4A 3H26A 3H21A 3V1PA 2ISWA 1I0BA 4H9UA 3GDLA 1ZCCA 3D3FA 2NQLA 4WSKA 4S1FA 2ZXDA 3TLLA 3B9AA 2W3ZA 3ZR5A 3CO8A 3GDMA 1K8CA 2QAPA 3TV8A 4IQLA 2QV4A 3MCNA 5F1VA 2C7FA 3ITGA 1KM1A 4JIQA 2E1WA 4MKVA 2MNRA 1VBGA 2RUSA 5H91A 4NF7A 3S46A 2ZRWA 1NP2A 2EBNA 1E0VA 3SQMA 4AIBA 4IH3A 3DENA 2VVSA 1J18A 3UJFA 1UKOA 3WLOA 4HMEA 3QR3A 5C9XA 3BG3A 3G5EA 1XGEA 1G1YA 5C6MA 1XSJA 4E4UA 3CZKA 3N6HA 1AH0A 1J01A 3N4EA 4GBUA 1DHKA 1J96A 3RK8A 1TZ7A 1Q45A 1JPKA 3MY9A 3VO0A 4H2CA 3KRUA 1ZJAA 1VEPA 4PMUA 3QVQA 1KQZA 2WJEA 3AJ7A 1H09A 1XFBA 1W3IA 1FOBA 4D8ZA 1CEOA 3AUJA 1SJCA 2XSXA 4GH3A 2DSKA 2ZUNA 4UFJA 3LPFA 1MI3A 4US6A 4WJ8A 1M9HA 4IPNB 5HQEA 3OBKA 4EIVA 4KRTA 1BQCA 4HPHA 1CT5A 3EWWA 2E0PA 4JNMA 1ZTVA 3TH6A 4Z1CA 1HJQA 4AW7A 3B0VC 5JVLA 3MBFA 3STEA 1MW2A 2ZADA 4S3JA 1R3TA 3C2RA 3NCOA 3UGRA 1UD6A 3WMSA 3N6JA 1E56A 5T91A 1QATA 2RKXA 1XWYA 1TX0A 4NUWA 1BF2A 4CKQA 3KE0A 5LXEA 1TWDA 1DIDA 3ARVA 3IANA 4C1KA 3EPMA 3NQ2A 4Y96A 3SSJA 4Z2JA 3V7PA 1PX8A 1EC7A 3IV8A 4WD0A 3EOUA 3ME3A 3H2NA 1G69A 1VFLA 3UY8A 3P7YA 4GZEA 1IGWA 5CC6A 4BQ2A 1H60A 3RPDA 1VBJA 4BCEA 5BXRA 1K8YA 3QPYA 1W5OA 1HF6A 2HRWA 3W7PA 1PYFA 1GHRA 3SGUA 1F6KA 3BV4A 1PBGA 3UJEA 1ECQA 4J35A 1GVRA 3LCFA 3R43A 2YA1A 3QXBA 4Y9OA 3AAMA 1XXXA 1NEYA 1M5WA 1H7WA 2BY3A 1KNWA 4NNBA 1ALDA 2QVHA 1QBBA 2PSNA 1CGYA 1UKTA 5E9AA 4MY9A 3W1TA 5ENLA 2GUBA 2R8WA 4LW7A 1GYNA 4EXQA 4POCA 3LY0A 4AH7A 2V69A 4MJMA 3IJ9A 2ISDA 4P7NA 1SR9A 1PVNA 1MMFA 1DOSA 4GNKB 4Z1YA 4QNWA 3IAQA 5KTLA 4JR5A 4I5UA 4O53A 1YX1A 2WJFA 4FIQA 2NUYA 1VEMA 3OODA 2BFGA 1M7JA 3WX7A 4YU1A 1GCYA 2A7NA 5GJPA 4JTKA 2O55A 4GWEA 3EDFA 2CKRA 5CJ5A 2YW4A 2HROA 3AIRA 1UD8A 5LA0A 4CGTA 1SJDA 2VENA 4MUZA 4RLIA 5FJUA 1ZALA 3W26A 5EMMA 2GDVA 4ZFCA 1KRCC 3AMKA 1I4NA 3QF0A 2Z24A 1TQXA 2Z7GA 4FPSA 3OGRA 1U1JA 3EDKA 2NX1A 3AS0A 2O0TA 4FS9A 3PZNA 4ZOBA 3EKLA 1KTNA 3DHPA 2BZNA 1HL2A 1EX1A 4PB3A 1BTCA 1J9YA 1VIWA 2Y7FA 3P84A 1ITQA 3KOZA 5G1TA 1SMAA 3P0WA 3P80A 2DW6A 4PYSA 1Z89A 3W2UA 2R6OA 1OG0A 3TJLA 3SADA 3RLVA 4HMNA 1PAMA 4C6QA 3WIJA 3VGBA 3TEVA 1JEZA 1EGZA 2QF7A 3B03A 3A6OA 3QY6A 3GIYA 4HCDA 1E6PA 3G1HA 3GTHA 2PTYA 3W7MA 2HK0A 2Q6ZA 2PRMA 4WR3A 1K03A 1YE6A 1E4LA 1S5WA 2OQHA 5REQA 4WEVX 3C6CA 3F4NA 4GY1A 2V5CA 3K46A 3R10A 1LJYA 3BCDA 1TPFA 3C2EA 1XX1A 4RDVA 4ZOEA 1L8PA 1NU5A 1QVBA 2EXOA 3T0CA 4GI6A 5BWAA 4I9MA 4ZSTA 1PX3A 4CCEA 4GNVA 2CLHA 1FWGC 2A6NA 3O2LA 2G3IA 4DJFD 5DRIA 3PR2A 3CWOX 1JD9A 4G8TA 2Z6JA 1OFAA 4O1AA 5FF7A 3UWYA 3L5LA 1FXPA 3VAVA 3HMCA 3VKAA 2PZNA 1W5QA 4JTDA 3O05A 5FESA 3UXDA 3EX6A 5A6BD 1BGGA 1WQ5A 5CG0A 3ATYA 1RQHA 3LHYA 4IP7A 1JUKA 4I6KA 4S3BA 3NO3A 3RU6A 3GM8A 1CX9A 4JTCA 3W23A 4BQ3A 3MSGA 3G1SA 1WKDA 1OINA 1V6TA 1O60A 4FF7A 4H3DA 1VENA 1LWIA 5D09A 3G77A 2YCIX 2MUCA 5HUOA 3LCLA 1OFDA 1YBQA 1KM6A 3GAYA 4MFEA 3U5YA 4ZA0A 5BRPA 1E43A 4DPQA 4CQ8A 1O6IA 1ONXA 1Q6LA 1J12A 5M1TA 4C91A 1XLAA 2QCFA 1C91A 2J9XA 1O66A 3MHUA 3JW7A 4O50A 4N6FA 3K1DA 4LGXA 1H49A 3GIQA 1Q5MA 1MFVA 3SCOA 3VIOA 4JN6A 2FTPA 3MHFA 1S2UA 4H6RA 1R7AA 2OSYA 3Q45A 4ZO7A 5CBIA 5I77A 3ABXA 3FFSA 1OZMA 5KITA 4H9VA 2OLHA 3DHUA 1S5TA 3V36A 3HOJA 3FKKA 4V33A 3W1XA 1IZJA 3DN5A 1KFJA 2XVNA 1XDLA 4NAFA 4NYUA 2PI6A 3SUWA 3GXFA 2BGNE 4OHQA 4C6JA 4JDYA 4YJ5A 2VL4A 3N18A 3DKLA 3QR1A 2ZZ5A 4WXZA 4C7GA 3OPSA 8TIMA 4B4FA 3WUGA 3ZZ1A 4ZB5A 2DZTA 1OF6A 4CVWA 3N11A 2I5IA 2JIEA 5HDRA 3A22A 1ZBCA 4WXYA 2GWNA 3BC9A 1W9PA 2PE4A 3VIMA 4BF7A 3UPWA 4M6QA 2QCMA 4GI4A 4DJEC 3QY7A 2W62A 2OG9A 3CTTA 4MJ4A 3R58A 4GIAA 2DY3A 1W3JA 2RJHA 1NF7A 1I45A 4WY0B 2XIMA 4ILSA 4OBTA 1KBLA 3EDJA 3SUTA 4JOMA 2J6VA 4C6DA 1VAHA 2VQTA 3EX1A 2OFJA 3IJQA 5AYIA 3Q94A 2HPMA 3MB9A 1T41A 2H3BA 3S5NA 3C3NA 3TTYA 2Y5SA 4QP0A 5F2LA 1RR2A 2GJRA 1ZAIA 5A2CA 4WDXA 2WWDA 3TW6A 5BMXA 1HKKA 4GFSA 5I00A 1O5KA 3L4WA 4AX6A 3PBYA 2W4XA 3WDPP 1BVWA 1K7XA 2JEPA 2XGIA 3N25A 3UJ2A 3IACA 1OYAA 1E1CB 4M6PA 1ISZA 4EF8A 4JCMA 1Q13A 1QBAA 3OVGA 1OX6A 2QULA 3RUBL 4Y9MA 3GRIA 4DJDC 5BU6A 2EEXA 3WUEA 1OVDA 3GSMA 4MJZA 1K9DA 3ITTA 3FV9A 4DWDA 3EOSA 3GC4A 1JZ6A 3DZ1A 4HPGA 3W70A 3GZ3A 3SUVA 2QZRA 3FCPA 1OCQA 5EFFA 2H90A 2W67A 1W1TA 1UKSA 1CGTA 4DBSA 2QCGA 4EPDC 3PPHA 4MY1A 1SR0A 4AVNA 1OC7A 1C9WA 5BWFA 1OIFA 1TV3A 1ZS2A 4Y8FA 3FX4A 2JGYA 3NSNA 4GVFA 4M29A 3S2CA 2QV5A 1X39A 3A4XA 3TOYA 5G4WA 3H4WA 1PX4A 3WD0A 4PL2A 3ID7A 4LVBA 4DBWA 8XIMA 3HZ3A 1UWSA 4NRSA 1FWEC 3PUOA 3UWZA 3BICA 3NA8A 1T40A 3OQ8A 4D6FA 2OTDA 2FIQA 1TSIA 4Q8TA 1GZJA 4LALA 3V16A 1GQLA 2G97A 4PMVA 3QW3A 4GUFA 1JAEA 4FA3A 3KLLA 4KWWA 5M03A 4X63A 4UZUA 1WZMA 1Z6KA 4JFTA 3LPOA 1YLVA 3UGVA 3OLGA 3MHGA 3S5SA 4QEEA 1Q6FA 5IHRA 2NV2A 3NGJA 3IWPA 1W1IE 3L2IA 2IPJA 3N9SA 2PRLA 1M3UA 1L9WA 4UTMA 5J04A 3KS6A 4YIWA 3DFOA 2X0YA 4IT1A 3STPA 4Z2IA 3MDUA 4HHHA 4HQVA 3KZSA 3VNYA 1G4PA 4Q4RA 5LGZA 5AHLA 3WMLA 2DSVA 4A3QA 3MUCA 4W4QA 3WLPA 5LNUA 4JIIX 1JIBA 2ZWZA 3VDAA 1K6WA 4DXXA 1US2A 3KP0A 1FVPA 3KRZA 3VZXA 1NOFA 3BLIA 4RJEA 4PB4A 4NG3A 3M47A 1HKMA 1NAL1 1XCFA 5F2MA 1R46A 2OZ0A 3W27A 1NELA 2H8ZA 1VP5A 3NDZA 1HGWA 2DH3A 2Z29A 4HA3A 1UYQA 4Q4KA 5G1YA 3TMLA 2WNQA 3BSGA 2ZZ6A 3T08A 1AFSA 5JU6A 1O5QA 2PDHA 2WMIA 3MV01 1RPKA 3T42A 1PYMA 4B5VA 3WQVA 4PBEA 4IUOA 3SCPA 4D6HA 1UD2A 3FVDA 3N73A 2Q8LA 1NWUA 4LCQA 3HBLA 4JHZA 1YDNA 3C2VA 3P61A 2DU2A 4KMQA 3BAKA 4LRSA 2J27A 5IM51 5D03A 5IRPA 1XYAA 3M5ZA 3G6MA 1DHPA 4FXSA 2NQZA 4DAFA 1BG9A 4QDPA 1XBYA 3SEPA 1FCQA 2E6AA 3KAOA 3UESA 1OBAA 1MW1A 2YDRA 2DSUA 4CNTA 4WDWA 4JTEA 4HPJA 1KWGA 2E09A 1V6UA 2CLEA 5I6SA 2R1PA 1FRBA 2YL9A 5EYWA 3N9RA 3W1AA 4MOZA 5EY5A 4L65A 4GQQA 4LNYA 4BY3A 4GACA 4IQDA 2QS8A 1Q85A 4OV9A 2DP3A 4P8WA 3MUY1 3QC0A 4F48A 3ZFHA 3IGSA 3NG3A 4EXAA 2EKGA 2CXGA 4BWLA 4UTLA 4DYEA 3QPEA 2BVYA 2V63A 1SUXA 1I2RA 3TXVA 4ICNA 5LNRA 2ANUA 4NX5A 2UY3A 4EWND 2IPWA 4QCEA 4XVDA 1DJNA 4JFVA 4GQBA 2QJNA 1OADA 5H8MA 5FAJA 3HJEA 5IDIA 4D9PA 4FNTA 3NTYA 5EGRA 6ENLA 1VJIA 1SFJA 1QASA 5HUPA 5BZAA 1VIZA 3TYZA 1JDDA 1RVKA 1I75A 2OYLA 1W5PA 3LHVA 2ALRA 5FSEC 3TW7A 3CAKA 5HNNA 1TJ2A 7REQB 3G3DA 4CUCA 5CZSA 3CK5A 1EF2A 3SDOA 2ZWYA 1D3CA 3CPRA 1W3LA 3TU9A 4HN8A 3AI0A 1XLCA 2ZX9A 5LXXA 1YTDA 1JCYA 3CPUA 4DN1A 1OQFA 4Q4SA 4GUGA 5E93A 4DO7A 1F8IA 4LF1A 2PWUA 3AYTA 3H2EA 4PRTA 3R94A 1JCMP 3UG4A 4EK7A 1LQ0A 1F3WA 5AY7A 4DYKA 4M6VA 4YWSA 3CUIA 2W63A 3VNDA 1PZ2A 1V79A 3E0VA 2XH0A 4AYGA 4FLSA 1W1A1 5E0CA 1XLLA 2C1GA 4PMYA 2OELA 2XH2A 1V77A 4NASA 4HYVA 2NQHA 5H2ZA 1UPPA 5JIWA 2OLSA 3APTA 4H04A 3GVVA 3ZS4A 1EXPA 4K36A 8RUCA 3IIPA 4GI9A 3S42A 3NUKA 1PPIA 4HZ7A 5B7ZA 3GXIA 4ZQCA 4G7FA 1E15A 1KCZA 3ABQA 4GBDA 2YYUA 4REQB 4O17A 5CXPA 1WXZA 4JTIA 1O4UA 4AVOA 2HBXA 3CH9A 4ZQMA 3BJFA 3VOIA 4FX8A 2Y1HA 2ZRVA 4AHOA 1Q3NA 4NNCA 1VKFA 4NP7A 4IISA 2F8QA 4A8NA 4ZQRA 4IL2A 2RHGA 4X0NA 3GKFA 1UJQA 3S6TA 1ME7A 1MYRA 4BJHA 3QM3A 3DFQA 1G4TA 1P6WA 3TJ4A 4LS2A 2NWSA 1D9EA 4XISA 1R30A 4MJ2A 1VJZA 2BHUA 4HNOA 3P82A 4JIHA 3IRDA 5DMYA 4KBXA 2UBPC 7PTDA 4ACZB 1IEIA 5A2AA 3ELFA 1GPFA 4OV4A 3M0YA 4JIRA 4WY0A 3G0SA 3GAKA 3G1YA 1K7FA 1EJTC 4YCPA 3LPGA 3U2OA 1FWAC 1XYMA 4GY0A 1H3GA 4TV5A 2ZUMA 3WDHA 1YDVA 2EPKX 5BROA 3H2AA 1QAPA 4PRWA 1LT8A 4J7RA 1QI4A 3UR7A 4E2BA 5HQMA 4L4OA 1M04A 1MRAA 4GIEA 4MKSA 1OGSA 4NSBA 1ZPTA 4KIRA 4P7LA 2PTWA 1UQYA 3DI1A 4QBXA 3L4UA 1EJSC 3PPGA 4L4PA 1E1CA 3W2JA 2J75A 4NVTA 2G8ZA 1XYBA 3MCOA 3VKKA 3BW2A 2J4GA 3QW4B 1CGVA 4CEXC 1LLWA 7A3HA 3R13A 1UASA 3M41A 3ENLA 3URNA 4GXWA 1IV8A 2NSXA 2Z1SA 1H1ZA 1RVGA 5C2XA 3WJWA 3NOYA 1LBMA 2GWGA 4KCVA 1DPMA 3UYCA 1EC9A 5K4ZA 3L12A 3MT1A 4M5PA 2QCDB 1W3TA 4GXMA 3HJZA 4X9YA 3AHXA 3PM6A 3W53A 4QE5A 1WAWA 4Y6GA 1CGUA 1BD0A 5DY3A 2WO5A 4R7JA 3BMXA 1KTCA 1H7NA 1WCGA 3GXDA 4B3LA 2ZDSA 3W88A 2PU1A 4P7OA 2F38A 4W7UA 4F2BA 2CETA 2PDQA 4JYEA 2VD9A 2X2GA 2WQPA 2PA6A 4AMCA 2NLYA 3LGGA 1K4HA 1F3EA 4XSLA 1UWIA 2ISVA 3GXTA 4O54A 2E3ZA 2BSLA 3BSMA 4RXFA 1RZMA 4UQCA 3WH8A 1E4IA 4MG4A 3HMJG 4F0KA 1VQTA 1E0XA 1Z9AA 1HG3A 4LY4A 4DELA 2Q8ZA 1VGAA 1Z3NA 1YRRA 1ICQA 3RRAA 4QS5A 2DFAA 4HJFA 5JUVA 3RU8X 2I9EA 3UT0A 1KXHA 3U2CA 3VKJA 2WSRA 2Y7GA 1G67A 1K6AA 1F4AA 4P8XA 3L9CA 2G4JA 4QHRA 1R3WA 1HJUA 3HGRA 1TPEA 2BVTA 3KXQA 3UEQA 2A79A 2FHBA 3VFLA 1BSLA 1MZHA 4H9ZA 4D6CA 1JL8A 3D46A 3WLSA 2Q02A 2J74A 3L0NA 4F40A 1KGWA 3NQCA 4TX9A 3WLRA 3CHDA 3M5YA 1EBGA 4QSFA 3IPWA 3ZSTA 4AIOA 3EEZA 5D32A 2F2KA 2E25A 4DRSA 2QVNA 3CASA 2R82A 4JAWA 1EA9C 2AQOA 4C6IA 4W87A 4C5ZA 3KTXA 4XAZA 4N02A 2XJ7A 3MW7A 3EWCA 4F3HA 3GNOA 3WQGA 4AZCB 1L6SA 3CL6A 2J7CA 1ONWA 4DJFA 3V35A 2CLMA 4I7VA 2WZIA 3CC1A 2CW6A 1BWKA 1IE7C 1KM2A 3ABOA 3I7SA 3OIXA 1EA0A 2A3CA 4GYPA 3O6CA 2DUAA 4F0HA 4XG1A 3LBOA 3OZPA 1JUEA 4US5D 5A6BA 4GX8A 4WQ6A 1RHCA 3PF3A 2FGLA 3OB8A 4CD5A 3QY8A 1YIXA 3WL1A 2QJJA 1GHSA 4LFYA 3BK0A 2CLPA 4GINA 4W93A 3VOFA 4DI8A 3B9EA 2XVGA 4J3XA 3Q65A 2FMNA 1JRCA 4IIBA 2QCNA 4UNKA 1XSKA 1OC6A 1IXPA 4K6AA 4O1BA 3NZPA 1HP5A 2ZE0A 1Q7QA 3RM4A 4A6GA 1R38A 5KSWA 3PZIA 1ISXA 1TJRA 3V1HA 3M0VA 1HW6A 1LBLA 4GABA 2PD5A 3AHZA 1PKMA 3E2SA 2JBMA 2QPUA 2EPLX 2PC8A 3P14A 3U7BA 4W5ZA 1DJIA 1OCJA 4ES4A 4OKDA 1GOOA 4OBRA 1LLZA 3LB0A 2Z0IA 3PNZA 4KT2A 1H4PA 1JCLA 4MHBA 3IVUA 3N2XA 3JZUA 3UVAA 2I1OA 2OYKA 3HG2A 4QCFA 1KFEA 2YCLB 2CC0A 3HB9A 4ZL1A 1PSCA 2EKCA 1OT2A 5DEZA 3TXZA 3LG3A 4P2VA 1KFKA 4FR6A 1F7BA 3E02A 4I5RA 8XIAA 3UWEA 4E8DA 1OX5A 1KCLA 3NQVA 1QWGA 3JU2A 3NIYA 3PULA 1MVYA 5AOUA 4N7QA 3B8TA 1SYTA 3OIHA 5LKYA 4DLMA 5HJXA 3PZVA 2YLLA 4GY7A 3OOQA 3WLJA 3CV6A 2FZNA 4YMZA 4O1DA 2OWWA 3WLLA 2XG9A 3KM8A 1N82A 3RLGA 5E1QA 3PP7A 3BOXA 5EBAA 2PPGA 2OZ3A 1EB3A 2DZUA 3GKAA 1A5NC 1QR7A 3ZIZA 1P7TB 1JI1A 1R7OA 2WVVB 2QCLA 7REQA 1UH4A 2I16A 1EHNA 3TQPA 4XUGA 1LF1A 3VIIA 2AKZA 3BARA 4W9TA 1H7PA 4G56A 5MKGA 4JBRA 1DXIA 3B0UX 1SM9A 1Y5VA 1J6PA 5G1MA 3N19B 3LK6A 4MZ1A 1VCGA 4NYYA 3NQ6A 4ZXLA 4JHMA 3MU7A 3RPMA 4RE2A 3U3HA 4UTHA 2RDTA 3O0FA 2HBVA 5D9NA 3VC5A 1NQKA 2NWRA 3GVRA 4ROPA 4DJDD 3OVQA 1PB0A 3VNKA 1IGSA 3N9KA 3VUPA 1EYEA 1SJAA 5DT5A 4IG2B 4OBSA 2X09A 3V0UA 5DANA 4V15A 1R0MA 2QUTA 3BUVA 3N1AA 3WYZA 4YWIA 3BCJA 2XIBA 2FPTA 1VYPX 2CZ5A 3JRKA 3MCMA 7XIMA 2INZA 3KW3A 3S1XA 4RPPA 2Y61A 2E77A 5FJRA 4AEOA 1N55A 1PWLA 3VDCA 1QW9A 3HM7A 1Q2RA 1ITXA 4JTGA 1EQPA 2ZUUA 1S46A 1FWRA 5DMMA 1ZCOA 2PMQA 1A5LC 3LGDA 4JTAA 2G41A 3NVTA 3BAYA 4LNCA 5DXXA 2Q09A 3EXTA 4RNHA 4E4PA 1XIFA 3CU2A 3W71A 3W25A 2EJAA 1VPQA 3LHTA 4ZQOA 4TVUA 1QW8A 3CZ8A 5HXMA 3H54A 2Z1BA 3TDFA 1AJ2A 2ALDA 2X1SA 1R86A 1LOQA 1VD6A 3QN3A 3B0YA 5A8GA 4ZTXA 3T0BA 4UIOA 3RMEA 1HXJA 1AUSL 3MC5A 2V5LA 3ZJ6A 5HR7A 2C6QA 1CI1A 4JQ1A 2HDJA 5AC6A 3B8VA 2G3JA 3NQ7A 4KWUA 1E3ZA 3NQAA 4XBSA 1VR6A 4JCLA 3S9YA 2UWFA 3KLKA 3TTOA 4GO8A 3O6YX 2W9MA 3H2FA 4PH6A 2HCVA 1TCMA 2PRHA 4OWGA 3ZVIA 3QRHA 3GB6A 2VC9A 2IUZA 6A3HA 4HSHA 1SZRA 3QQWA 1S1RA 3BLPX 2B0MA 3L68A 5LNWA 1S2VA 4LRTA 6XIMA 2YL8A 1Z8AA 1I2QA 2BG5A 3GBDA 4IMAA 3HFYA 4QXIA 3A9BA 3GW3A 3VFCA 2PDPA 3LRLA 4J3TA 5D04C 3BSHA 4WSHA 4E8CA 3ICJA 2Z27A 3NPWA 2D0FA 3P2VA 3VD7A 3EGJA 5E0KA 2B81A 5CBJA 4NZCA 3E2QA 1QU4A 1QUMA 1PDZA 3M0IA 4X0VA 1JI2A 1ZL1A 3KTSA 3WENA 4PFMA 4GH1A 4ROQA 2FGZA 1CXKA 3DXIA 3CTLA 2QCDA 3PFMA 1ZUAX 4Y9NA 3LXCA 1A49A 1D8WA 1MFUA 4AWSA 3PJWA 4J27A 4M56A 4UBPC 4C7FA 3S83A 4O57A 3ALFA 5CAKA 3SCQA 3C3UA 2Q8XA 1UCWA 3AYRA 5KZMA 2XIQA 4NJGA 3F2DA 3WQ4A 1TMHA 2GUYA 5LHFA 1Y7VA 1YXYA 5E70A 2Y88A 2R1KA 1OG6A 3WH5A 2PUZA 4LF2A 2QDGA 5DLCA 5GNZA 4ZOCA 1H0IA 1EO5A 1DP0A 1DJXA 3F2BA 3W29A 5D05A 2AGKA 3RR4A 3HU7A 1DYSA 6PTDA 2XISA 2BB0A 1B5TA 3B4YA 5I2UA 4LAUA 2EHHA 2GJNA 3LHZA 4ATLA 2O9OA 4XAPA 3TYEA 5GPRA 1QOQA 4I8DA 1J0JA 2VZSA 5CPMA 5ABFA 4BEUA 1E0WA 4JX4A 3BLLA 1VYRA 2UV8G 3P6LA 4IIHA 3KOYA 3V5OA 4S2BA 2QQ6A 3PB0A 3TN4A 2H8XA 3IIVA 3KHDA 1GEQA 1Q63A 2J7BA 1TG7A 2C91A 2YCEA 1UOKA 4JX5A 4M1RA 2Y6ZA 1XLHA 3OTRA 4AZCA 1RALA 1TJPA 3LM7A 4UQBA 4UMAA 1M53A 3RXZA 2BP1A 3CGTA 3E0IA 1CCWB 4MWAC 5AC7A 8A3HA 1XRSA 3E6EA 1GYLA 4CNPA 5C9UA 1Z69A 3GC2A 1UA7A 4ADTA 4FNUA 4PBGA 1AL8A 4LAOA 5DFAA 3RCNA 4D6EA 3R8HA 1HX0A 1JCTA 1A3XA 1UD4A 3S1UA 4V27A 1REQA 2CBUA 2OXNA 2HJPA 4R33A 3GHRA 1P0KA 1AL7A 4E4FA 4XQ6A 4QITA 1TMQA 4QRNA 5FF3A 3AJXA 3NZ1A 2NXHA 3AHTA 2WM1A 1P6BA 1J0ZA 1E5JA 2QUMA 1H50A 4ZQNA 4GYKA 4L6OA 4ZQPA 1TPDA 1GTHA 3RCMA 5FEXA 1XLDA 4RDYA 4WUIA 1CB2A 2WOQA 1ZBKA 2FZ9A 2CHRA 3MPGA 1EF3A 4HU3A 2NQ9A 2BVDA 1PTGA 4L6HA 2DJLA 1K8XA 4WJEA 5AYYA 3FA3A 1OHLA 4JY9A 3PG8A 1KW1A 5A6AA 5H6HA 4O16A 4E2VA 4N0RA 4GJ1A 3GNXA 2BGSA 4UNIA 4WGHA 5LA1A 1B30A 4HHPA 5TBOA 4AX7A 1E55A 3W6YA 1XFCA 2YCLA 4TQTA 3T1GA 3VNIA 1XICA 2Y4SA 3NSMA 3FEMA 2GVGA 3PC0A 3LCIA 3R0UA 3LD5A 1AMKA 4JTQA 1UG6A 2VR5A 1XBZA 2Z2BA 4HTBA 1LBFA 2PP1A 3N2CA 2D20A 4RK8A 4RZBA 1OFPA 2YZ5A 3FGCA 4IOTA 3DESA 4O0QA 4Z1AA 4H01A 4WZHA 3N34A 2YDSA 4EANA 3FXGA 1QCWA 1YMYA 1RD5A 2XWDA 1Q7MA 2WMKA 1ISVA 1BQGA 1XLFA 1AH3A 3D0CA 4LOCA 4ZE5A 1NWSA 2OCZA 2XH7A 4YHGA 1E6XM 1K9EA 5HNRA 2B7NA 3PB2A 2VVNA 1EJ7L 2BV9A 5JMUA 3NAVA 1BF6A 3W72A 3E0FA 4JN8A 2ZTKA 3W9ZA 1GVQA 3NQBA 1DJZA 4H7ZA 1Q8AA 2CWNA 1O5RA 2P5NA 4UQAA 1E71M 5IFPA 4UMCA 2CPUA 1SSGA 3FJLA 3SCNA 1CLXA 4MADA 4QTGA 3EKZA 3VDHA 4RZ5A 1EUNA 2V68A 3P5YA 2HV5A 5RUBA 2FKPA 1ITUA 2AAAA 2WANA 1H1YA 3A5FA 4DIAA 2VZVA 1DQUA 2HE5A 3VNZA 3OP2A 4NJKA 1DWJM 4AY8A 1W3HA 1FWBC 1V51A 4IG2A 3ZLFA 4GVGA 5D2VA 5PTDA 1EC8A 1O5XA 2JFEX 4MNLA 4Q33A 2QXWA 2PEVA 3KBMA 1ZLPA 3QV6A 3VM5A 3TJIA 3O16A 1H41A 2REQB 3LRKA 1C92A 1IIHA 4LBUA 3EXSA 1JPHA 2QCEA 4KQNA 3S1GA 4U31A 1V6XA 3VYLA 2VJXA 2TODA 2DZAA 3VCRA 5ABGA 2QNEA 1V7AA 2J7FA 3W22A 5T9CE 2J79A 3TKFA 2VP8A 4ATDA 1DWGM 3S5YA 5C2CA 3L5MA 3U2ZA 1DJHA 5AFDA 3HV9A 2EPMX 2P53A 1EUAA 4OZOA 4DI9A 3FN9A 1ZAJA 5A6LA 1SQ7A 1J2WA 3QMTA 5CCZA 3WLHA 4DZHA 2W92A 1NOUA 2E9BA 5DCEA 1OD0A 4HK5A 4CN6A 4B2DD 4Z2HA 3DERA 1GONA 1LOLA 1T6MA 3AS2A 5G2WA 5FJIA 5D9MA 2J77A 2NLIA 4KPLA 4C5YA 3UERA 1EJWC 4HVXA 3IS4A 5H1WA 4WOZA 4MGGA 3APYA 1DXFA 4ZO8A 3NQGA 2GVYA 3UXAA 1HL9A 1EH9A 1IEXA 2XHYA 1V3HA 1IXOA 1Q6DA 1WO2A 3MMWA 4R53A 3RM8A 5JIPA 1F73A 3ARPA 2WYSA 3B8DA 2ZOXA 1B3ZA 2WW5A 3H70A 5G5IA 1VHNA 1BYBA 4C6LA 1PEZA 2Z00A 1XINA 2J62A 1GJUA 3L5AA 5C0QA 2VUYA 3L4ZA 2WVUA 2WKJA 1G9HA 4RE0A 2VOMA 5D8WA 4HA1A 4N9CA 1CXIA 4QJ1A 4GISA 4GC4A 3FIGA 1SW0A 2F84A 3SUUA 5C7HA 2FH8A 3TSBA 4GZIA 1CB7B 2P50A 1JD7A 1F3XA 5TNVA 2X05A 3P67A 1FWHC 2A3LA 1EZWA 2OGYA 2RAGA 2W79A 3E96A 1E0UA 4US5A 2GGHA 4L9XA 2IKGA 1NWRA 1NARA 4FLRA 3EOLA 4FALA 3HQNA 1H2JA 3LOTA 4GRSA 3F4DA 5CJMA 4M24A 1BSIA 4NZ1A 4AC7C 3IAPA 3GG0A 3EWBX 3ATZA 5D2WA 3GH5A 1IR2A 3KRSA 4RDZA 2DIJA 2X1RA 4KCTA 1W2PA 4JKLA 1TPVA 3HA1A 4QFUA 5DXYA 1OK4A 2VGIA 4BQ5A 2PLJA 2PZ0A 1TX2A 1R6WA 3IGHX 4LUJA 4I9JA 1KV8A 1NF0A 1CIUA 3O0KA 2GL5A 1DWAM 1PIIA 1SO3A 4OVXA 2VZUA 3U7VA 1QK0A 5CSRA 2SFPA 4G7EB 4H8HA 4IM4A 4DJFC 5AHNA 3TA9A 2D22A 3DUGA 1ADOA 3NPXA 3I3DA 4BA0A 4HT3A 3WNMA 3E74A 1R2SA 2R14A 4YTQA 3MMUA 4WF7A 3LEPA 1T96A 4O28A 4RR4A 3TN6A 4E3TA 2NV9A 4JX6A 2WAGA 1UR0A 3QKEA 4DZAA 2PWEA 1TQJA 2X1UA 4OOZA 4X2PA 1R47A 3POHA 4GCAA 2PBGA 1VPYA 3PSWA 2QKFA 2OEJA 3UBPC 3VILA 3WG6A 3PWIA 4KS0A 1E6ZA 2XFWA 3U6WA 3G1DA 1F8MA 2PDKA 3A24A 4LJ3A 4Q3MA 4DJEA 7ENLA 5D02A 1H11A 1BPLB 3UYIA 1UWRA 2Z1XA 3RNDA 3GG7A 4EAYA 3VNLA 2YX0A 4MY8A 5EMJA 2GUUA 1QHPA 1E9ZB 5F4SA 4QLJA 1NP0A 1NJJA 1YPIA 3M0KA 3KTCA 4NL1A 3WLNA 3SUSA 1F4HA 3QLLA 2XINA 4AG0A 5F2IA 4YS1A 3BG5A 3IJ7A 2HVOA 3TTQA 1D7KA 2YW3A 3WD4A 3WJSA 1EP2A 1EGMA 1OT1A 1M7OA 1RA5A 2CLLA 3OLDA 1JZ4A 3K30A 1KBIA 1YW1A 3KVMA 4INFA 1W5MA 1E6SM 3UA3A 1H1NA 1PDYA 2QJHA 4JZ5A 1PIGA 3ITCA 3WO8A 3F5JA 4FF5A 3T0DA 1IYXA 5KZ6A 4C65A 1X7FA 4FB7A 1C29A 5CGQA 2OT0A 3KP1A 4DJDA 1XG3A 2XIOA 2E7FA 1VLIA 3VKBA 2WM0A 4B5XA 3CWHA 3KZPA 4CCZA 4HK6A 2NVDA 3LV5A 4UTUA 3UG5A 2WPBA 5AC8A 1OCNA 3W7EA 1FH8A 1LORA 1S5NA 2VC7A 1F07A 3CQ0A 5CH9A 4L1WA 3W86A 3UWVA 3AU6A 4X22A 5DMLA 3BH4A 3GR8A 1RY0A 4Q7IA 3BLDA 4CD6A 1UD3A 3H12A 4IMCA 1XIBA 1TFVA 4WVXA 4ICCX 2UY2A 2R1LA 4ZR8A 5TAOA 4H9XA 1V3MA 4AXNA 1E6NA 2FJUB 2QJMA 1LWJA 1NOWA 2Y5EA 4A35A 3W7RA 1NTHA 3R6IA 3TQ0A 2ZX6A 2AQWA 4M80A 5GNXA 1DV7A 3C0QA 3DYOA 2HZGA 1E4NA 1XLGA 3WCZA 3INPA 1W1YA 2P76A 1XR2A 1PXGA 1XPGA 5IFTA 1JZ8A 3M0XA 3REQA 3K8MA 4CQCA 2D1ZA 3BGJA 4WX2A 2ZX8A 3OA3A 1K9TA 1MNZA 3C0JA 4RPQA 4GZJA 4HNCA 2VFDA 5C2GA 1XSIA 1W3NA 3AXIA 3O06A 2DQWA 3THAA 1WE5A 2O4QA 3PUGA 1W17A 3KOFA 2RGMA 2ZKMX 2V67A 1JF5A 2DVXA 3EB3A 3IK4A 4W89A 3WH7A 2DORA 1YDOA 3CQIA 2NXGA 3T6CA 4DY1A 4NIRA 1XS2A 4JQ2A 2F6XA 3KVLA 4G6CA 4P7QA 4D8LA 1JYVA 2AKMA 4XD4A 3C52A 3WJZA 5HULA 2PDXA 4O14A 3F5KA 3T2QA 4YPJA 2ZYFA 4S23A 2GDUA 3PTKA 3PZGA 3CUHA 5I09A 4B90A 1K77A 1E4MM 2CCRA 4B5SA 2AL2A 1RPXA 2RDXA 5FL0A 2XFFA 4H6EA 4MNKA 1WA3A 1VEOA 1KKOA 4C7DA 4D72A 1WB0A 1FDYA 1Q6CA 1W8GA 2ABAA 1HKJA 3SGZA 1GOQA 4PCTA 2OB3A 5JH1A 4JEQA 4KFOA 2Q01A 3N2TA 2ZDRA 2ZA2A 3VCCA 1PHQA 2PDFA 3PPCA 1IXQA 1NSJA 1T5AA 3AXKA 2WHJA 2EPNA 4EPBC 1BG4A 3N13A 3PK7A 1NVMA 1EIXA 4Z1DA 3MI2A 3ZLGA 1GG1A 4O18A 5EU9A 2JGQA 5A1AA 4IWWA 4N9DA 1BYCA 3DC8A 4GUJA 1EP1A 1XBXA 3GXPA 4DUVA 4KCUA 4JTFA 4K38A 3ZVHB 4I7UA 1K8ZA 4LAZA 3UJSA 4WKHA 1KBBA 3H53A 2X16A 1EDGA 3CQHA 4C60A 3BZGA 2VI0A 5C54A 2NX3A 3UETA 3W4RA 4Y8EA 4BEQA 5K2ZA 1JPIA 3CJPA 4O15A 1FKWA 3M46A 3W83A 3LLFA 2E8ZA 3OBAA 4AD3A 4C1NA 4PGLA 4EXBA 2FH6A 2HVNA 2C1IA 2NX9A 3WL0A 3AXXA 1TWZA 3BTNA 3DKJA 2A3AA 4UOQA 1S38A 3PBWA 2DGAA 2WPGA 4GJIA 2UY4A 3TQVA 3NNTA 3KCJA 3IV3A 3GYCA 3CAWA 3H8AA 1POJA 3UQNA 1QMLA 3VD3A 1K02A 1TV7A 3ITVA 2D2JA 3WKZA 1RY8A 4S2CA 3T81A 1EDTA 4H7CA 3LS9A 3RLUA 4RKAA 4EE9A 4JY8A 1AMYA 3BLFA 3XINA 1L6WA 5I07A 2E4TA 3WF1A 4OECA 4P8UA 2ACUA 3PS7A 2ZZ2A 4MWAD 1LZOA 4UTFA 3L66A 1YBQB 1XD0A 1WDRA 1ENUA 2WBGA 5HK4A 3NYDA 2DPEA 4QE4A 3UD6A 3BE7A 7ODCA 3PJTA 1C8YA 3NQ8A 2WVSA 4AZIA 3UXKA 3HQPA 1CXEA 3IGXA 4TMBA 1ADDA 2POZA 4F0MA 4K3ZA 3U2EA 2RJGA 4IGHA 4UR8A 1HKIA 2Z1WA 3GDBA 1EJRC 3G1RA 1J10A 1QWKA 1EPXA 4O1FA 4ZODA 1WDWA 1KC7A 2WC4A 1EWDA 4J3UA 3TNBA 5IBXC 1C93A 5LIXX 3VX1A 4AU0A 2DUXA 3HQ1A 1TPUA 1B54A 3K4AA 3VOJA 4PUKA 2VRQA 5I5RA 4L64A 1K4GA 3MMDA 2DSZA 2OWCA 3EWDA 2ZICA 4U4MA 1TR9A 2D2GA 1K7EA 5BU9A 3QMSA 3TC6A 3EZ4A 1OYBA 1CBGA 2FDSA 1WXJA 3FDGA 3U57A 2IQ0A 2P0IA 5DN1A 1LL4A 5GVJA 3MQTA 1M1BA 2VOTA 3IEBA 3CZGA 4G7EA 1UR8A 4AZHA 2Z2UA 2FZMA 3UPBA 3SIZA 3E3HA 2OJPA 3BPWA 2VELA 4YL2A 1XIGA 1AJ0A 3DFSA 4QJ4B 2DEPA 1XIJA 3TWAA 1EHAA 2IQTA 5KINA 1GYMA 3QC3A 2HXUA 4AD0A 3QHOA 3A5VA 2PDJA 4ZBCA 2CZFA 3RO6A 1SZNA 3TR2A 1OK6A 3SY1A 3P8JA 3N15A 5AC4A 8CGTA 3WFAA 3DFTA 2YLAA 1UC4A 2R24A 3VMOA 2Q3OA 3CHEA 3OYZA 4UWMA 3CV1A 2WSPA 1LYXA 3GS6A 1DIKA 4DB7A 1MQRA 4PL1A 1H0GA 3IIOA 1TB3A 3CHFA 3DG7A 4W8AA 3PTQA 2Y24A 3DU0A 3C61A 4KGLA 2A3EA 2OSXA 4LC8A 1GEHA 4OOUA 1RQBA 3ONBA 4O0KA 2QPSA 2B4GA 3S6OA 3CL7A 3FK4A 1UUQA 3U8GA 5LZLA 3LZ3A 3P62A 3ZO9A 2EG8A 4MPQA 2NUWA 5E0FA 2OEMA 3THCA 3AROA 1B9BA 4GUIA 1OFOA 3UZYA 1S1PA 4RNJA 3KVKA 2BY1A 2VEFA 2C79A 3B9NA 3AMGA 4LV4A 5AVHA 4CNOA 4CCDA 4PUNA 2BOFX 5D38A 2PODA 3AHVA 2FB3A 1IXNA 3NYZA 2BS9A 3WEZA 3W1MA 4GVIA 3DYMA 4CU7A 2PAJA 1XL9A 3WF4A 4TVCA 5DF0A 2PDIA 2B7PA 2PWVA 3VD4A 4F0SA 2HK1A 1E1FA 4KW2A 4O19A 1KLYA 1UIOA 3UXLA 4GMEA 3NR0A 2O4MA 2J8GA 4BFAA 1BLIA 3ZYZA 3EOOA 1TJ1A 4H8NA 1P1XA 3MUIA 2QJGA 3VX0A 4O4VA 2ZUWA 2Y7EA 3WLIA 4BZYA 1U1HA 1LLOA 4DO5A 3QHNA 5AECA 3CT2A 2XVKA 2QEZA 4QJ5B 2J9ZA 1SU5A 1QJWA 5LA2A 2DZWA 1S2CA 3EYPA 2Y8VA 4UR7A 2PP3A 1ZP4A 4O8RA 1EXBA 1VFSA 5MHBA 1H51A 1VCVA 4Q8MA 1ONRA 1KTBA 3W84A 1VH7A 2G0WA 5JXQA 5CGMA 3WF2A 4A05A 4KESA 1M41A 2YB1A 5FJPA 2E5BA 1JVNA 3VD9A 3OZMA 1GOIA 3OLEA 4B2DA 5BMWA 4U28A 3AC0A 3B0PA 2Z6IA 4NAEA 2V0TA 3BAJA 4N2YA 1WKYA 4G1NA 4GI8A 2XIIA 3II1A 3EBVA 3G8EA 4S3GA 2HVMA 3YPIA 4LUTA 3SRHA 2YGYA 1EIBA 3FDKA 1LP6A 5CZ0A 4E2OA 2BTMA 5M2FX 2AMXA 4RZ6A 2OO6A 1RSCA 1ZBWA 2J25A 3NEVA 5SWUA 3GVGA 4V1XA 3WQ6A 2WMIB 4HHLA 1FQ0A 3M4HA 4PMDA 3V0SA 4BS0A 1FWFC 3OBEA 3CWNA 2P3EA 1CZ1A 1VBHA 4FLOA 4MB5A 3DG6A 2GOUA 1XW8A 3M1ZA 1YNYA 4MMWA 5A8NA 2ACSA 3DECA 1XRTA 2PDCA 1TV5A 2EPOA 1QPOA 4RCXA 3PANA 4Z42C 1UR9A 3VE7A 1SJBA 4IPLA 5J8LA 3Q4DA 1WDQA 3EA3A 1SGJA 2OYMA 3GQYA 2X0HA 3OG3A 5I3GA 2QF8A 1W37A 4GYFA 2BWGA 3IUDA 2X7WA 4WK9A 4TTUA 4KERA 5KZDA 2VR4A 5D4YA 3UF9A 1K9FA 4PTNA 4QR6A 3GR7A 4AIEA 4M7SA 1B31A 1OGGA 1C9DA 5EL1A 3O8AA 4HIBA 1MDRA 2B7QA 4TR9A 4M82A 2FFCA 3P3BA 1JGMA 3DGBA 1E9IA 2A7PA 3VGGA 4Z2LA 2VC5A 4MZ8A 1F6YA 2DSWA 1OYCA 3UA4A 3CLMA 5HA7A 3R89A 1PE1A 2QUNA 3NO5A 4PUJA 2J8FA 3EX3A 3SFKA 2X8RA 1QI3A 2G5WA 3ZVHA 4YVVA 1RV8A 2ICSA 5CC7A 4AD1A 3UZJA 3S0CA 3LCGA 1ODUA 2YSWA 1AQFA 1TWWA 4K68A 2BODX 3KOXA 9CGTA 1QHOA 2Y5JA 4PBFA 3GR4A 3LPPA 3V5CA 2XM2A 5J5RA 3ANVA 3TLQA 4EF9A 3SIMA 1JPMA 2PWHA 4A8IA 1JNEA 2HXTA 1ELSA 3NQEA 3N12A 3MMTA 3NDOA 2IKIA 3I7RA 2RFGA 3C2OA 5AZ0A 2ZCGA 1DWIM 2VX6A 4LVFA 3SECA 3TCEA 1JZ2A 4HYRA 3R0DA 4JIPA 4DZ5A 3KS5A 3GU2A 1AODA 3WNKA 4B5TA 4TUFA 4R7OA