4MVAA

1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
255
structure length
255
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural, kinetic and proteomic characterization of acetyl phosphate-dependent bacterial protein acetylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 97
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mvaA00
4HPXA 5EA9A 3TJLA 1K02A 5FESA 3M7WA 4DEFA 3NQVA 3CU2A 3T44A 1VGAA 1OFRA 3DFSA 3QZEA 3TSBA 1Q6LA 1OK6A 2A5HA 1KTNA 2G97A 3DENA 2PRHA 3PWAA 3G1HA 1W5OA 1QAPA 5F4SA 3HG3A 4IMCA 5AYYA 4FEZA 2Z6JA 2ZZ5A 5G4EA 3I68A 3S9YA 3TH6A 3P61A 1QWGA 1LM1A 3C2VA 4AHOA 3SY5A 5FEXA 1I2QA 4OHQA 4UTKA 2HSAA 1K7FA 3CWNA 4ZVJA 3PG9A 3W1LA 4H4IA 1V7YA 1CW2A 3N9SA 3UZ5A 3SECA 1L6YA 1XUZA 3NPUA 1OFQA 1SW0A 4FO4A 1CX9A 3EWZA 5K9XA 4X2RA 3G3DA 3JR2A 3TMLA 2X30A 1TPDA 5A8GA 3RLVA 2PCQA 3ANYA 1M7OA 2FIQA 4P61A 1W31A 2I1OA 1KTCA 3G8RA 2ZZ7A 1S5TA 4Z1BA 1VCGA 1JCLA 1T0OA 1ME7A 4TX9A 1GWJA 4AMAA 5D05A 4CNPA 5LHFA 3PUDA 4O1DA 1T96A 3G18A 3NPWA 4YWIA 1TV5A 5C2XA 4RLIA 4LS2A 4K38A 1R2TA 3NL6A 3W1NA 1ICSA 1A5SA 4RZ6A 2H90A 5KMYA 1JUEA 3QC3A 5D33A 4BWLA 4M6QA 1GJPA 2Y7FA 5FEZA 4IMEA 2Y61A 1G4PA 2GUUA 4UNKA 1HUVA 1XM3A 5DCDA 2ZZ3A 4A2RA 4N9DA 1IF2A 5HJLA 3W7IA 3LOTA 1LRQA 4RXFA 3R12A 4B5NA 4WJEA 3KVLA 1WQ5A 1YTEA 3TFCA 2TPSA 4JTGA 1T8XA 3CPRA 3DU0A 4UTHA 2TYSA 2LLEA 3G1XA 4Q4KA 1QO2A 5CPMA 4N6EA 1DJQA 2A4AA 1N7KA 3LCFA 1VHNA 2Z2UA 3C4UA 3FLUA 1TSIA 2ZDRA 1FCQA 3NA8A 1OJXA 4JYEA 4CCDA 1EWEA 2V2HA 4ZQRA 3HGJA 3MBFA 4MJMA 4QJ1A 2NZLA 2QF7A 4FNRA 3GDKA 1OX5A 1UASA 4C1LA 4KFNA 4CCCA 2Z6IA 4YCPA 5D30A 4UFJA 4GWEA 4DXVA 5G2HA 4ZMGA 1S5WA 4IMDA 3LLFA 2NWRA 4P2VA 4DBEA 1XBZA 4MZ8A 1LLZA 3P7YA 1WA3A 3GKAA 3R89A 1DV7A 3HPSA 2X1TA 1Z42A 3EX2A 5CPOA 4GUJA 2C14A 4WY0F 4XUGA 5I3GA 5HUOA 5D03A 2CLFA 3AO0A 4FX6M 2ABAA 1ME9A 3DBPA 1FWRA 5EKYA 3MI3A 1K7EA 4JR5A 2RHGA 2V30A 4RX0A 1RQBA 1H7XA 3DAQA 1A5CA 1YPFA 4ZQNA 1XBXA 2A85A 3KRSA 3TQKA 3P67A 1TPB1 1UJPA 2B7QA 3CEPA 5G5IA 1I2OA 4G1KA 4FXRA 1ADOA 4UIOA 3LTSA 3LHVA 3GAKA 3GK0A 1YYAA 2VEIA 1GTEA 4BF9A 2JGQA 3G24A 1FCVA 3B06A 3UZJA 3NQ7A 5AHLA 3DH7A 1FDZA 4UTTC 3MP4A 2YX0A 5HR6A 1JQXA 1O95A 5LNRA 4PODA 4DF0A 1KFJA 1XDLA 4OWGA 1GVFA 1OABA 4Z1AA 3MBDA 2NX3A 4H3DA 1IXOA 4PL1A 4LUIA 4M19A 1TQJA 2QDGA 3O15A 5AHIA 4AF0B 1TPUA 2CFFA 4O50A 5TQLA 4O10A 5KZEA 1H7RA 2GJNA 3S6DA 2QKFA 2C13A 3QF0A 3FS2A 5TIMA 1JULA 4TU1A 4I7UA 3E9AA 1P0KA 1RQHA 3NOEA 1KBIA 3T78A 3L68A 1X6UA 1ZJIA 4X9SA 3LHWA 1BWLA 2A2IA 5HWMA 2ZTKA 3W1RA 1NVMA 5C54A 4IUOA 1JCYA 1G4SA 1C8VA 3HGSA 4JTTA 1OF6A 4XTIA 4DO6A 3M41A 2ZRUA 2ZYFA 4NQ1A 4LV4A 1KM4A 1UB3A 2XN1A 3P74A 1KV5A 3DGRA 3L5MA 1EIXA 3W2KA 4A2SA 3WFAA 1A5BA 3BG3A 4O14A 4W9TA 2OJPA 5FEPA 3TIMA 1KA9F 1J2WA 1TTIA 4GFSA 1VH7A 1QPNA 3I6RA 1WBHA 4R7JA 3FYOA 1KW1A 4UR8A 2DZPA 1THFD 3W7LA 1J5TA 4FNPA 4OT7A 5DELA 5L6UA 4DPPA 2PC4A 4NXSA 1VLIA 3NPVA 1F6KA 3I7RA 4DF1A 3AJXA 1Q6QA 3Q2DA 3FKRA 2GQ9A 1DKWA 3P84A 3TQ0A 1ZY9A 2EKCA 3MUXA 4GUFA 3W6YA 2A6LA 1TPVA 4K8EA 2YCEA 3W7RA 4BI5A 2DU2A 4HT3A 3L5LA 3QYQA 1W56A 3M16A 2HS6A 3W1MA 3IIVA 3PS7A 3BW4A 5D04C 1SZNA 3FFSA 3GDLA 4M6PA 5BMWA 1VJIA 3EWYA 3STGA 4KWVA 3UPWA 5AYXA 2A7NA 2FPYA 4UR7A 2B7NA 1SU5A 4LU0A 1O5XA 4LVFA 4S2CA 5KSWA 2E6AA 1OK4A 4DO4A 5KZDA 5G1YA 5FEWA 4MY1A 4OBTA 4EOUA 3N9RA 3W74A 1TO3A 1FXQA 1RQEA 1XCFA 4FHAA 3RMJA 1R30A 3O6CA 1JUKA 2WOQA 4YMZA 1QPQA 2EAWA 2GVJA 1W0MA 1F74A 1W54A 3T40A 4MIMA 2V5LA 1OF8A 3DFPA 3UPBA 4Y8FA 3W71A 4XKYB 1XFBA 4JICA 3VKJA 1SUXA 4O19A 1T99A 3BW3A 5F1UA 3LHZA 5K9CA 2VXNA 3LCHA 3TAKA 1LYXA 3KRZA 2QCNA 2YXGA 4JTIA 1SO6A 2QCLA 2QUTA 5KITA 4N9BA 1AW1A 2ABBA 1N8FA 3IGXA 5AHNA 2PE4A 4RR4A 1W8SA 2Y70A 1QOPA 1TRDA 3IEBA 4UTTA 1K7XA 3G1AA 4ONVA 5SWUA 2CLKA 3W7JA 3UQNA 1RPXA 4LTSA 5BMXA 4LRSA 1QDSA 1EP1A 2JKEA 4LVGA 1IXPA 4OE7A 4JX4A 2DZVA 1TCDA 5I3FA 4BR1A 1WXJA 3TU9A 3EXSA 3S42A 2IQTA 3LTYA 1WX0A 4PA8A 1W5QA 3S5OA 2J24A 3U6WA 3W70A 4R33A 1B4KA 3LCWA 3CIXA 2YYUA 3BG9A 4UMCA 2HTMA 1VS1A 2X1SA 3BLEA 3C6CA 4M7TA 4GRSA 2E68A 2WSQA 1W3IA 3C2RA 3DHFA 1EA0A 1SZFA 1IXQA 3UWQA 5HMSA 3L9CA 3QW4B 5CSRA 2A1YA 3G1DA 2GQAA 2ZRZA 5HULA 1G67A 2DJXA 3W75A 5K2ZA 2RH9A 2X1RA 1OHLA 3BGJA 4JN6A 3S1WA 3L5AA 4NNAA 3W7MA 1RD5A 1EP2A 5HNRA 5F4WA 1SR9A 3T7VA 1DVJA 1OX4B 1ZALA 3A22A 4EIVA 1YDNA 3W88A 2CLOA 3LCLA 2ZQ0A 3VCRA 3L67A 1AMKA 5C6MA 1OYBA 1W5MA 1H7WA 3F4NA 3SZ8A 4AWTA 3E12A 2ZBTA 2C19A 2OCZA 3OEXA 1CI1A 1H7NA 2AAMA 4UFHA 4HNVA 3P80A 1AK5A 1D3GA 4ADSA 2FB2A 3G1VA 4U28A 5CGQA 2BLEA 3UWYA 3NQ2A 1SO5A 3IIZA 1SFJA 1P1XA 1H60A 2DZTA 3QRHA 2ISWA 1NF7A 3UY7A 3M47A 2C0AA 3LDVA 3CIWA 3W7OA 2BXVA 3UWVA 2HMCA 1MEHA 3OG3A 1H5YA 1VC4A 3GLCA 1GZGA 3UWWA 1K8XA 5ABTA 3A5FA 5D2YA 3SI9A 2E1DA 2Y7GA 3MWAA 1JR1A 3NQMA 2KZHA 1GQNA 2WJZA 2H3DA 3P5ZA 1YTDA 3B05A 3PY2A 3B03A 2D73A 3KVMA 4WXYA 2CZEA 1NSJA 4K6AA 4Z1DA 4K37A 3LLDA 4CQAA 1DQWA 3CEUA 4YL2A 3EKLA 3IGSA 1AW2A 3S5NA 2FLIA 3W2NA 1ZCOA 1B57A 5HWNA 1G4EA 3I7SA 1DJNA 2E6YA 4QAIA 3MMTA 4OV9A 1AG1O 3IGUA 1B3OA 1KM5A 4R53A 4GUGA 1VCVA 4S2BA 1XI3A 3NQAA 3HGRA 2J6XA 4XBKA 4KFOA 2OX1A 3NL3A 4JTJA 3BK0A 2G95A 3W83A 3GZ3A 3DI0A 1AL8A 4JDYA 4WXZA 3RNDA 4HNNA 3E0IA 4I9AA 2E6FA 1W5PA 3M5ZA 2GJLA 4MFEA 3BO9A 2CLIA 4O4WA 3ZS4A 2VFDA 3C2EA 3F4WA 4AH7A 3NQCA 4WY0A 3W7GA 2JKPA 3TSMA 1ZNNA 1JJKA 3GR7A 1SW7A 1X1ZA 3RF9A 3B04A 3NAVA 4JTHA 1H1ZA 3CT7A 3MO7A 3HG4A 1FWNA 3NEVA 3MHFA 2QCDA 4UXDA 1G7UA 2ZFAA 5BRBA 1YTKA 3W3OA 1B4EA 1YPIA 3EEGA 1X7FA 4JYDA 4JD4A 4JNMA 4PCFA 4WOZA 3W7PA 3SR7A 3L65A 4O1AA 4RKAA 5LNWA 2H3BA 3SW6A 3L21A 2XN0A 1PVNA 3VE7A 3R13A 3PSVA 3ATZA 2ZRVA 3DFOA 1YDVA 5DY3A 2FQIA 2QCMA 3W72A 1UUOA 1A5AA 2QUVA 4X22A 2ZRXA 3CHVA 3W1TA 4AHQA 3CQ0A 1A53A 2Z0IA 2X16A 2JGYA 2YPIA 1FCUA 1GG1A 4I7VA 1JRBA 4M5PA 4O13A 3CC1A 1LRNA 4NJKA 4MKNA 3EWWA 5DBUA 1EUAA 4MLRA 1GOXA 5LHEA 2GVGA 3RK8A 5BW6A 4A3UA 1LCOA 5D02A 4NJJA 1XBVA 4LC6A 5AC6A 3OVRA 4FNUA 2NUYA 1L2UA 1H62A 1XC4A 1RV8A 3TJXA 5KINA 3STFA 4Y90A 4AXKA 4MY9A 4UTUA 4N02A 3NQ6A 3IVSA 1XUUA 1AW5A 2NWSA 3ATYA 3C0JA 5AOUA 1SSDA 2ZZ4A 1NFBA 4HSNA 1N55A 3L66A 1LORA 1K8YA 1JRCA 1GVQA 3LGEA 1GEQA 3GDMA 1ME8A 5D38A 3P8JA 2PRLA 2HS8A 4JX5A 4O1CA 2TMDA 5FF3A 4XZ9A 3TR2A 3DI1A 3UD6A 4NNCA 3S1XA 2J88A 3GR8A 1FX6A 2QCEA 5E0KA 4HNTA 1QPOA 4LS1A 3M1ZA 4IGHA 3QJAA 4Z1CA 2R8WA 2I9EA 2QJGA 3HPZA 1Q3NA 1QOQA 3RU6A 3I65A 3HGOA 3NQGA 3WJXA 4TIMA 4XTDA 3KXQA 4E38A 2A21A 3W7NA 3FYPA 2H8ZA 3EKZA 3LRLA 4N4QA 1U5JA 2WPBA 2GVLA 3CTLA 4NVTA 4YXGA 4GC4A 4LS0A 3NQFA 1M5WA 2CZFA 3M6YA 2DJLA 6ALDA 3NGJA 2F84A 1G4TA 4FIQA 2AQWA 3UY8A 3W07A 1IIGA 1H63A 3R8RA 4PEKA 5IM51 3P60A 2G96A 3PM6A 1YDOA 1LOSA 3A24A 4J9JA 5E1QA 2VFFA 3DHDA 3QQ1A 4EF9A 1VR6A 4MY8A 1JVNA 3GDRA 3V75A 2AGKA 3LERA 3OBKA 4NJIA 3P62A 4NJHA 2QJIA 1ICQA 4QITA 2H6RA 3NXFA 3I7QA 2YYTA 1TQXA 3HPXA 4MYAA 3C61A 4UFLA 1KFCA 3ABOA 5T26A 5L9FA 3S8HA 1O60A 4MZ1A 1W3TA 4JIPA 3NL2A 4CNNA 1G6CA 4CNOA 2DORA 4O53A 3WJSA 3Q37A 5CZJA 3ZWSA 3KOFA 3TMQA 2VOMA 4TMBA 1QO5A 1VZWA 4IMGA 4MOZA 5G4WA 3FJLA 1D3HA 3O05A 3STCA 5HWJA 2WNQA 3LM7A 5K7JA 2ZTJA 4IXXA 1O4UA 4LRTA 4C1KA 3F1QA 3NR0A 2GQ8A 4JEQA 2QR6A 1TIMA 5D2VA 2VEMA 2Y89A 2NLIA 4NNBA 5H2ZA 4ALDA 1M6JA 4UMAA 3LHTA 2EF9A 1QCWA 1H50A 4IJBA 2NUWA 3WJWA 2ZA3A 1UCWA 2FPVA 3LCGA 3C52A 1HFBA 4E2DA 1FUYA 2B4GA 4QQ3A 1HL2A 2YW3A 3H54A 5LSMA 2DZUA 2Y88A 3LV5A 1ALDA 2B0MA 3HF3A 3FEMA 3G3MA 5DBTA 2Z1BA 5AHFA 4JY8A 4MZYA 2WV8A 4ML9A 3W73A 3OIXA 3QM3A 2ZZ6A 1UBSA 4PH6A 4MPQA 5C5YA 3VI2A 4GUHA 1E51A 4PL2A 1W1ZA 3IVTA 5AB3A 1P0NA 3OHIA 5IBXC 4Q32A 3DKLA 4EVZA 4UCGA 4DBDA 4UTWC 2Q3OA 3GDTA 1LTDA 5CPLA 5MHBA 2FB3A 4HSOA 3G1YA 1QR7A 4O16A 3D0CA 1JUBA 1FQ0A 5AC7A 2W6RA 4BK9A 4GBUA 5D2TA 2DZSA 4POCA 3L0NA 3R5EA 2OMAA 2YDAA 1O5KA 2NXGA 3QQ0A 3ZFHA 1OFDA 1DOSA 2E5CA 3LI1A 3TX9A 1WBJA 3PG8A 3KRUA 2QAFA 2E09A 1OYCA 2Y6ZA 2QUUA 1GVRA 1FWSA 3C8FA 3W2MA 1GVOA 3PUOA 3S0CA 4LY8A 1LRTA 4RXGA 4X3ZA 5K3VA 4FB7A 1SQ7A 4DQWA 1BWKA 2V0TA 5EL1A 4LVDA 4IX2A 1FBAA 4O11A 4OU1A 3TW6A 1P5BA 4PFMA 2NUXA 1DHPA 2CLMA 3P8IA 1KFLA 1VYPX 3TC6A 3G1FA 4ADTA 5FF2A 2P10A 4IX0A 3W76A 3GXPA 1IIHA 2JBMA 1RVGA 1QMLA 4WZHA 1WOBA 3HOJA 1DL3A 3W22A 2Q8ZA 3E96A 3O16A 1O94A 3PBVA 4MFDA 4QNEA 1P4CA 4Z0JA 1TTQA 3TXVA 3VFLA 3ZWTA 3HQ1A 2P0OA 3P82A 1F7BA 3GX9A 4RV8A 4BFAA 5DN1A 1R47A 1NEYA 4DELA 2C15A 4MYXA 5D37A 1OX6A 3VNDA 3GB6A 2E5BA 5HUPA 3QSRA 4FNSA 3WJYA 3W1UA 3LTPA 3MI2A 5DY2A 2OT0A 4O57A 3NQEA 2H8XA 5FF4A 1TPWA 3BLIA 3N73A 4N4PA 3HMJG 1KM6A 1EPXA 4RZ4A 1S3HA 1BEUA 4UFKA 4IWWA 4GXMA 3QEZA 4A29A 3TSDA 3Q58A 1EEPA 3O8AA 3GNDA 3NO5A 1PHWA 1W3NA 3U8GA 1D9EA 1XL9A 5U4NA 3M5VA 1GYNA 3MJYA 5EMUA 1TPC1 1AL7A 4O4VA 4XQ6A 1DBTA 3B0PA 4YLWA 1SO3A 3IRDA 4AAJA 1SSGA 1HO1A 1JCXA 3RFAA 3INPA 1TPH1 2NX1A 3NQ8A 4N2YA 4Y6GA 4L4LA 2YR1A 3PB2A 1LBLA 2FFCA 2TSYA 3A9IA 3PBUA 5GVJA 5F1VA 2WSRA 1VQTA 4FNTA 1KFEA 1L6WA 1KM3A 2FTPA 3G0SA 5LZLA 4NJGA 3W87A 1H51A 5HINA 4DPQA 1SW3A 3O07A 1J4EA 3EX4A 3B0UX 3O63A 3PUEA 1M7PA 1PCKA 1H1YA 4LW7A 2A6NA 3W7KA 2B7OA 1WYIA 1KV8A 1TTJA 4HNUA 2PURA 3NQDA 3WK2A 4NZFA 5KTLA 3HO8A 1TREA 3EWUA 4JGDA 5D32A 3PSWA 1TPFA 1LBFA 4TR9A 2VEKA 2BZNA 3G0XA 3LI0A 2YW4A 1KM1A 3DZ1A 3TW7A 3TXZA 5CPNA 1W37A 3W1PA 2A7PA 5HR7A 4JS3A 3QW3A 4O18A 3ELFA 1IXNA 3OA3A 5IBXA 4KWWA 1FWTA 2XN2A 4UTWA 3CB8A 4AVFA 2ZZ1A 4BI7A 5F2GA 2Y7DA 5J5RA 3DXIA 1F05A 4IXHA 1ZAJA 1JCNA 5D09A 3IIPA 4UUIA 2GPTA 2WQPA 3THAA 2RKXA 3FOKA 3STEA 2CWNA 3KVKA 1OVDA 1EB3A 2NXHA 1OFOA 4FF7A 3M5XA 2V8ZA 3TK7A 2RFGA 3W86A 5AYZA 3N3MA 4LC8A 1MXSA 4UTIA 1Q45A 1QNVA 2QDHA 2QJHA 3WK0A 1K8ZA 2UV8G 1WDWA 2ALDA 1HTIA 2J9YA 1ZAIA 3C2FA 1X8FA 3LXAA 2DZWA 3BPWA 3B0VC 3SGUA 1PV8A 1GPWA 3KAOA 4K39A 3QMRA 3E02A 1Z41A 1HO4A 4O52A 4QIUA 1DORA 2OZ0A 1F73A 2Y63A 2CZDA 4UMBA 2DP3A 3M43A 1PL9A 5DXYA 3EX1A 4JTLA 4ADUA 3W7EA 4N9CA 1OFPA 3M0ZA 4O0ZA 5EYWA 3VE9A 2X2GA 1OFEA 1LLWA 3LXCA 5FI8A 4WQ6A 3IIOA 3W7QA 3MYOA 2O7QA 2X1UA 3KX6A 1EP3A 4CLMA 1PCWA 4IOTA 2GOUA 1WOAA 4XBSA 2Q3RA 5KZMA 1I2RA 4K36A 5CZTA 4EF8A 3TROA 1LBMA 3BW2A 1I2NA 3MHUA 1KM0A 4FNQA 2YZRA 3FJ6A 1MO0A 1MEIA 1KLYA 4IPIA 1VYRA 1KFBA 3HB9A 5AHEA 1JCJA 2DZXA 3IVUA 4LUJA 1TB3A 3FKKA 6TIMA 3HG5A 2J27A 3W2JA 1H7OA 4NX5A 3PB0A 4LT9A 3GXNA 4AWSA 3S1VA 3NDOA 1TTPA 2CW6A 1GTHA 3PVFA 2I14A 3TKFA 3FIGA 1B9BA 4JTKA 4HKPA 4LOCA 1VLWA 1GT8A 4S1FA 2YFNA 1C29A 4E2BA 5I3KA 3EWXA 4LVBA 5DCEA 1KM2A 4NXKA 1Y0EA 4M7SA 3SGZA 3OVPA 3W1AA 4UTLA 3DFQA 2ZA2A 3SJ3A 3LXBA 4FIRA 1OYAA 3L0GA 4KFPA 5FF7A 1RR2A 1TJPA 3SSJA 5C55A 1YADA 2CU0A 3ABQA 3R2GA 3TAOA 3GNNA 3WK1A 3NZRA 3QMSA 1FCBA 1PE1A 4O12A 3S1UA 5AC8A 4FXSA 4HN4A 4WY0B 1JCMP 3NM3A 4JTUA 3UXAA 3DFTA 2VELA 1XBYA 3CM4A 1F2JA 1A50A 2O7SA 2QCDB 2ZZ2A 4RK8A 5D2XA 3O6DA 8TIMA 3K30A 4HHPA 4WOQA 4BI6A 3G0UA 3UWZA 1G7VA 3PAJA 3GAYA 4LVAA 3IV3A 1K3UA 1LOLA 2EGZA 1LOQA 4AF0A 1FWWA 4WX2A 5A5WA 2RDUA 3LRKA 3TUUA 1IGSA 2QCCA 2YFOA 2V2CA 4GUIA 3BLFA 2C1HA 4D2JA 3B4UA 4MJZA 4NX0A 4ICNA 5BOOA 3TDFA 1VYSX 3H53A 4UTMA 2VFIA 3HBLA 4ZQOA 5AFDA 2VFEA 2ZRWA 1GVSA 1XKYA 3DKJA 2VFGA 3P5YA 4AEOA 4Y9AA 3F03K 3PC0A 3UXDA 2C3ZA 4Y96A 4CQ9A 1NAL1 1Z48A 1TV7A 5LNVA 3V1PA 3MI6A 3M5YA 2Q8LA 4ORIA 5E93A 1EX5A 2CLHA 1PIIA 4K7YA 5I3JA 1KBJA 1Q6RA 3LB0A 4A22A 5G2WA 3M44A 3GIYA 3C56A 2VENA 4UC5A 3T55A 1U83A 5K4XA 1FY6A 3EWBX 3QH2A 3TC7A 4O1BA 3WJZA 4OV4A 1X1OA 1VCFA 2QCFA 5F2LA 3NVTA 2RDWA 1EUNA 4Z0SA 3UWUA 3L2IA 1TV8A 4ZQCA 2C6QA 3JRKA 5EY5A 5G1TA 3T4CA 5H91A 5BNKA 2WNZA 1XDMA 3B8DA 4JXCA 4O0KA 5G2IA 2E5DA 4CCEA 5LGZA 2B7PA 3QMTA 1EWDA 4JTEA 4HIBA 4FX8A 4OQVA 2TRSA 4IPJA 1NF0A 2EPHA 4GNJA 4H6KA 5DCBA 1LROA 4O17A 2JK2A 2WKJA 4AHPA 4PTNA 4E0CA 5DLCA 3PBYA 2JKAA 3PBWA 3GVGA 4AWUA 2CZ5A 4RCXA 3E49A 2QAPA 4QISA 2G5WA 4HPJA 3W84A 1LZOA 2WNNA 1SZGA 4JY9A 3LRMA 1WV2A 2QCHA 2BTMA 2WSYA 4RZ5A 4DO5A 2CLEA 2EHHA 1UUMA 4Z08A 3LHUA 3TE9A 3N2XA 1VRDA 3KVJA 4M6VA 1YLVA 3LCXA 5AHMA 4JYFA 4NUWA 3BVJA 1ONRA 4PC8A 1R46A 1SZEA 3A5VA 3A21A 3NG3A 4XKYA 3W85A 4EWND 3BGGA 5LNSA 3NYZA 3W23A 1OFAA 4UFIA 3W1QA 2Y85A 2VC6A 2VFHA 2PRMA 5CSSA 3BG5A 2W79A 1G69A 2W0UA 5D2WA 5I3IA 4K8HA 1LDCA 4O28A 4WUIA 1MEWA 4LV9A 2Y62A 1C9DA 2ISVA 1Z44A 2Y7EA 5TBOA 1GYLA 3EX3A 3W2UA 1ZENA 4WD0A 1SPQA 2FJKA 2BSLA 2V5BA 3GXTA 3QPYA 1MSSA 3O6YX 1QPRA 1OG0A 3EX6A 5I3HA 4AB4A 1PS9A 1HG3A 3OVQA 3PULA 3S5ZA 3NL5A 3HIJA 3YPIA 3ZR4A 1FDJA 4MLJA 5HQEA 4N9EA 3HG2A 2J9XA 3LBMA 3LV6A 4L4MA 3TNOA 2OT1A 1SO4A 2P1FA 1FXPA 5FF0A 3DFNA 1ZAHA 1BTMA 1PHQA 3EB2A 1Q6OA 2ATMA 1YXCA 4DF2A 2RDTA 3NNTA 3LCIA 2C16A 3G22A 2R94A 2CLLA 4UFMA 1TPEA 3EXTA 4NT0A 1OX4A 4U4MA 4UNLA 3S5YA 4A21A 3QPZA 3C3NA 4GE8A 2ATSA 2VEPA 5EPDA 4I7WA 3Q94A 1ML1A 3L0KA 1S5VA 4OGZA 1FDYA 3UNDA 3P81A 1W5NA 1KLZA 4K7VA 1I4NA 1F6PA 3EXRA 3WK3A 4IQLA 2BX7A 4JX6A 3KFTA 3JS3A 1VPXA 3GKFA 3MHGA 1XXXA 5CKSA 5K9DA 1R2SA 1SFLA 1TYGA 3THQA 2ZA1A 3N34A 4TO8A 5LGXA 1TJRA 3W9ZA 1TMHA 3TFXA 3TV8A 3O1NA 3O06A 3G8EA 2V81A 4O54A 2WO5A 4O15A 4ORMA 3A23A 4JDBA 4O8RA 1KTBA 2R14A 5AN7A 1OFBA 3W1XA 3UYCA 1ICPA 4TMCA 3LHYA 1H61A 5CZ0A 3CLMA 4NZJA 4BWLC 4KKXA 3TQVA 3LBCA 3ABRA 1WAUA 3PR2A 3N14A 2YSWA 3H55A 4YCOA 4Q33A 2V82A 1K03A 3N2MA 1TRIA 2XFWA 2NX9A 2BWGA 3PF3A 3BV4A 3C2OA 3MYPA 4N6FA 4ZQMA 5LNUA 4RJEA 5F2IA 3TCEA 4JTFA 4LNYA 5DXXA 3W7DA 3IIXA 1GG0A 4XWUA 1BKSA 5J5DA 3G1SA 3N19B 4GJ1A 3BARA 4ZQPA 3W2LA 2V9DA 4IMFA 3QSTA 3ABSA 1MZHA 4JIQA 4QM1A 5F4XA 1QFEA 1ZHAA 4UTJA 3RLUA 3KHJA 5F2MA 1ZFJA 2QEZA 1L9WA 2A0NA 3GYEA 5CG7A 1V5XA 4MUZA 5CZSA 4ZZ9A 4QSHA 4CQ8A 3MW7A 3M9YA 1DQXA 3MP3A 3NM1A 2YGYA 4QNWA 3USBA 3W7CA 2C18A 3CWOX 1KFKA 2NV1A 4JTSA 2V2DA 4LWWA 1R2RA 5LKYA 1VHCA 3NZ1A 4R34A 5EBUA 3SFKA 2NV2A 3SIZA 3U2OA 3LX9A 3TA6A 2FDSA 2J9ZA 1RZMA 2ISSA 2E6DA 5K4ZA 1L6SA 1I45A 3MP5A 1YXDA 2A7RA 1H7PA 2VKZG 2NXIA 2ZCGA 3HJZA 1LP6A 2ZRYA 1F76A 1I2PA 4MVAA 2QCGA 5U7SA 1I8JA 4NU7A 7TIMA 2E77A 2F7FA 1JQVA 2FPTA 3QFEA 4ZL1A 3W7HA 1YXYA 3FA5A 2R91A 4FX7A 1F5ZA 3NPXA
chains in the Genus database with same CATH superfamily
3TJLA 1WKFA 1K02A 1B3ZA 5FESA 4L6OA 4DEFA 1EJWC 1Z7AA 4FA3A 1O1ZA 2FVKA 1OK6A 1KTNA 2G97A 2DDXA 5BXPA 3DENA 3G1HA 2VUYA 1QAPA 1GPFA 1Z3NA 1UWQA 1PZ1A 2VUNA 1IR2A 4RNHA 4AVOA 3QTPA 3WQCA 1QWGA 2YB1A 1RBAA 1GEHA 5JBEA 1K7FA 4ZVJA 4JCMA 4CD4A 2OTDA 3W1LA 3T0CA 1UR9A 3UZ5A 5BWFA 4GY1A 1SJCA 2I5QA 1IZKA 2OOGA 4QX4A 4UOQA 3EWZA 5H8UA 3JR2A 2FZNA 2X30A 1W1PA 4ZOAA 3SCSA 1XS2A 4FAMA 4U3AA 3HQOA 2I1OA 1L6FA 1S2TA 3W01A 3C5QA 1J11A 1HNYA 3G8RA 2QT3A 4Z1BA 1JCLA 1RJPA 3SY1A 1UROA 3LBOA 2WCAA 4GVGA 2WVVA 3WH6A 5LHFA 3BV7A 3NPWA 3HM7A 1NDYA 4K38A 1R2TA 3K1DA 4DVOA 2ZUVA 2H90A 1J0HA 5D33A 5CZKA 3FA3A 4BWLA 1MFVA 2Y7FA 4IMEA 4YTUA 4AD2A 1UC5A 2DT1A 3UZXA 4KERA 4N9DA 1IF2A 2WB5A 3W7IA 1A5NC 4RXFA 4P8UA 4YS1A 4B5NA 2E1WA 5EB8A 1WQ5A 4E2VA 3SCOA 1OD8A 1UWSA 4U2ZA 4H7VA 3CPRA 1XINA 4Q8UA 4Q4KA 1IWAA 1VPYA 3UZWA 4N6EA 4S3FA 5CH9A 1VHNA 1ESWA 1JNEA 1TSIA 2VDIA 1LL7A 2V2HA 1IWBA 3HGJA 3FAWA 3FCPA 4MJMA 4QJ1A 3CTTA 4B5SA 2GDVA 2J25A 2VGFA 4HA0A 3CHFA 4IQEA 2ZUWA 4UFJA 4GWEA 1S5WA 3AS3A 4DBEA 4XAFA 3BQ5A 1TR1A 2OB3A 3FGCA 1K70A 3OZPA 3BAYA 4Q3MA 2WK2A 1WA3A 1A5KC 3R89A 2CWXA 2YL5A 3D47A 2X1TA 3EX2A 2HK0A 4RZBA 4WY0F 1VBRA 3VZXA 2CLFA 1IEIA 2ABAA 1E4LA 1ME9A 1MQPA 3DBPA 4CN4A 3Q4DA 3WH7A 1HT6A 1F07A 2G37A 5AZ1A 4FP1A 4H9YA 1YPFA 1V51A 2ZUMA 3CZJA 1XBXA 3P67A 4DWDA 3MSYA 3BTNA 1Q2RA 3CEPA 5I6SA 3MUIA 3OTRA 4GXPA 5REQB 2OLSA 1HF6A 4OUEA 4RDVA 1E5JA 1GTEA 5CPTA 5HA7A 3PJWA 4L9XA 3RR4A 2OQLA 5DT7A 5E5CA 2ISFA 2XUCA 1N2VA 2QHAA 1RP8A 1JQXA 1O95A 2YDRA 4JHOA 5LNRA 1UMYA 1CNVA 4PODA 1KFJA 1XDLA 4Z1AA 1IQ8A 2YDQA 4PL1A 3WNNA 1GVIA 2WLYA 1EEXA 4ERAA 3AMKA 4JL2A 4XAGA 5AHIA 4AF0B 3M6DA 5EMLA 2OKOA 4PB3A 3VDHA 5TQLA 2E25A 1H7RA 3RJYA 4H8NA 3FS2A 1XIIA 2BBFA 5TIMA 4W5ZA 1QI5A 1LQAA 3E9AA 2OO0A 3PTKA 3LHWA 3W38A 2A2IA 1KCZA 5HWMA 4HOZA 3HGSA 1OF6A 2PDNA 2ZX7A 3M41A 3N18A 2J78A 2BHYA 3CHCA 3P74A 1KV5A 1J6PA 3ZJKA 2CITA 1EIXA 3I6EA 1FWJC 3W2KA 3WFAA 3BG3A 1EPVA 4AZ5A 3TIMA 1KA9F 1JEZA 1K6WA 3BZJA 3Q65A 4KH2A 1VH7A 3EB3A 1KW1A 1RLCL 5D8WA 2DZPA 5L6UA 4DPPA 1V6YA 1VLIA 1F6KA 3I7RA 4HBKA 3K13A 1EFZA 2NLYA 1UH2A 2X2YA 3AJXA 1Q6QA 3Q2DA 4QRNA 4OBSA 3MC5A 3MUXA 4GUFA 4QE5A 3S4TA 2A6LA 2YCEA 4BI5A 1UJQA 3PNZA 3OGRA 3QYQA 1F4HA 4LUSA 1CLXA 1U5VA 4PB5A 3ZSTA 1C7TA 2DZBA 3F5KA 3HTWA 3EKGA 5BMWA 4L65A 3I4EA 2HBXA 4LU0A 5KSWA 2XH4A 1K9FA 1EO5A 1RQEA 1XCFA 4FHAA 1WXZA 3KW3A 1R9YA 2QPSA 4AYGA 1JUKA 2EQDA 3BL3A 4ES4A 1QPQA 2GVJA 2Z2AA 2EPMX 3BLOA 4XKYB 3VKJA 1QU4A 1SUXA 3DG7A 2WHMA 2P88A 3WEMA 2XVPA 5K9CA 3LCHA 3N11A 1XRFA 1C9WA 1V02E 3WLSA 5ECUA 4NRSA 3KS5A 1V77A 2QCLA 5FOOA 1FP8A 2QUTA 3IGXA 3SEPA 2FVMA 3NSMA 2PE4A 4RR4A 1W8SA 4W7WA 1TRDA 3GIQA 2P53A 4ONVA 3AIVA 2BG5A 1MFUA 1RPXA 3WD4A 5BMXA 2XVNA 4LRSA 2JKEA 3WF1A 4LVGA 5CPQA 2VZVA 5I3FA 5BRQA 4BR1A 1PKLA 5IDZA 2PDPA 3K4WA 2E9MA 3ARYA 3WF3A 2IQTA 3MCNA 4PA8A 1Y5VA 3LLXA 2J24A 4DIAA 4IGMA 3BE7A 3W70A 4O0QA 4WSHA 5AY7A 5AYBA 3CIXA 1XW8A 2YYUA 1PBGA 3BG9A 2HTMA 3UXKA 3VD3A 3MMUA 3C6CA 1ITUA 4GRSA 4LQ1A 3C2RA 3UZZA 1EA0A 4Z2JA 1XLDA 1V6UA 3L9CA 5CSRA 3ABZA 2ZRZA 2DJXA 3ZR5A 4HB7A 2X1RA 3BGJA 1L8PA 3S1WA 1EP2A 5HNRA 3M0VA 4MKVA 1EF3A 5HANA 3U2CA 1V6VA 3I4KA 1ZALA 4EIVA 3VKAA 1E6PA 2CLOA 5D8ZA 1FWGC 2ZQ0A 3CV2A 5HQLA 1OYBA 2XINA 1H7WA 1SM9A 4ZTYA 4HU8A 2OCZA 3OEXA 1YW1A 4UFHA 4WVXA 1AK5A 2ZKMX 1PUDA 4J4KA 1P0DA 2QJNA 4XD6A 1D3GA 3KDOA 3G1VA 1Q7MA 2RGMA 2BLEA 1BVZA 4ICCX 2GK1B 1P1XA 4W89A 1E1CB 4ERIA 2DZTA 3QRHA 2W9MA 1W9DM 2G3FA 3LDVA 2BXVA 2V5JA 3UWVA 1MEHA 5EMMA 4J3XA 1PTAA 1UWRA 4IZGA 1BKHA 1K8XA 3A5FA 2VEGA 2Y7GA 3E5BA 2ICSA 1JR1A 3GBDA 3R0KA 4A3RA 4WXYA 3DC0A 1NSJA 4MUPA 3LLDA 4Q8TA 2XIOA 3IGSA 2NT0A 3IRSA 2IUZA 4D71A 4KGLA 4PN2A 1EDTA 4EPBC 2CERA 4GJJA 3RM8A 2XVGA 5JIWA 1O7AA 1QT1A 4GA8A 1KM5A 3L23A 4UTFA 4S2BA 2CKRA 2J6XA 4KFOA 1TKKA 3GE7A 3ZJ8A 4F0HA 1PJ9A 4JTJA 2QDDA 3GZ3A 3H2EA 1F9CA 1UP0A 4AZBA 4JDYA 4D6EA 3A3XA 2YBUA 4PSPA 3E0IA 4I9AA 2E6FA 3M5ZA 1V3IA 4MFEA 3DHUA 3A4AA 1TA3A 1XYMA 2VFDA 4TTGA 1F3TA 4WY0A 5H6HA 1KRBC 2ZOXA 1JJKA 3GR7A 1SW7A 1ADSA 1H1ZA 1LJYA 2OLAA 5IHRA 5I5RA 1HJXA 5IRPA 2WVSA 4HZMA 1G7UA 3MCMA 1EJ7L 3W3OA 3M64A 1B4EA 4JNMA 5ABEA 4WOZA 3W7PA 3JZUA 3L65A 1I0BA 2DY3A 1CXEA 2GSEA 1A49A 3TYZA 2F61A 2H3BA 1PVNA 3VE7A 1DP0A 3KWSA 2FVLA 2VQTA 2YL8A 3W72A 1UUOA 2ZRXA 3K4DA 3DYOA 4I9TA 3UPMA 2PZ0A 2JGYA 4DNHA 4I7VA 1JRBA 4TV5A 4Q6JA 1LRNA 4NJKA 2AAAA 1SMAA 5FL1A 3V7PA 4AD5A 3ANVA 5PTDA 5CSYA 2GVGA 3LQGA 1LCOA 5D02A 2YXOA 4LC6A 1L2UA 3OYXA 1XC4A 5CBIA 3STFA 2VZSA 4C6CA 1BGGA 1QK2A 5C9UA 1XRVA 3VAVA 1VB9A 2O56A 3TLLA 1CXFA 1BQCA 2O9RA 3CZ8A 4HSNA 1XLEA 1G9HA 1K8YA 4HJWA 1GVQA 3LGEA 3N29A 4P8WA 5D38A 1C8QA 4JX5A 3VPLA 3S2CA 4EANA 2J88A 1XYAA 1FX6A 4LUYA 1VIWA 2GDUA 5E0KA 2V3GA 1OCJA 3DECA 1PIGA 3M1ZA 4IGHA 4QJ4B 1Z6KA 2QJGA 3RU6A 1A5MC 4CU8A 3NQGA 2G41A 1JDEA 4XTDA 4W8LA 4GKLA 4N4QA 1U5JA 3CTLA 4NVTA 4YXGA 4RL3A 2HROA 2CZFA 2VGBA 3A4JA 2XFFA 3NGJA 3SUSA 4WF7A 2F84A 2AQWA 3UY8A 3W07A 3P60A 3C86A 1GKPA 3IANA 3L4UA 4D6JA 6XIAA 1VR6A 1MXGA 2R1KA 2H6RA 1RA0A 4IPLA 1ZBKA 3HPXA 1XH0A 3QGKC 4MYAA 4MNJA 3ABOA 1R5YA 1W3TA 4KRUA 1GW9A 3VGGA 4CNNA 3ARPA 1TE1A 4CNOA 1XJBA 2DORA 3WJSA 3Q37A 3PPCA 3SIMA 3S9ZA 4TMBA 1ITXA 2J7BA 4IMGA 5G4WA 3STCA 5HXMA 5HWJA 1T40A 1V02A 4HK5A 2FTWA 2ZTJA 1F3EA 5D9OA 1UMLA 4C1KA 4ILSA 4KS0A 3KBMA 5FAJA 1VFOA 1KD0A 1HGYA 3SO7A 4UQDA 2NLIA 2D2HA 1P7TB 4GQBA 1M6JA 3WLLA 2AMXA 1QCWA 4IJBA 4XO6A 3BJSA 1UBPC 2WZHA 2J66A 1XIDA 4KF1A 2NVAA 1HFBA 4Q8NA 4DM2A 1FUYA 1FH8A 3BMWA 3VKBA 2DZUA 2Y88A 3FEMA 5AHFA 4JY8A 1HKVA 4D6GA 4B3ZA 2QULA 2X1IA 2EPNA 3TTEA 4GUHA 4DYJA 3IVTA 4IIEA 3U5YA 1E6RA 5IBXC 4Q32A 3S83A 1XIJA 2WZIA 4UTWC 2E9LA 3G77A 1LTDA 3KRBA 4J1OA 5MHBA 5CLWA 2FB3A 1QR7A 3G5EA 3AYRA 2W6RA 1EYEA 5D2TA 1WE5A 3L0NA 2B31A 3H23A 1W1YA 2DIEA 2OSYA 3PZIA 3ZFHA 3T42A 1OFDA 4DAFA 1RBOB 2E5CA 3LI1A 2QAFA 1DJHA 3C8FA 1FWSA 3S0CA 1LRTA 2PDHA 1JYXA 1QHPA 1VF8A 5BOFA 5A8QA 1E70M 4KQNA 4X3ZA 1HP5A 5CGMA 4NZ5A 2V0TA 2PZNA 4IX2A 1FBAA 1P5BA 3A47A 2CLMA 2QMJA 3P8IA 9RUBA 3UXIA 3G1FA 5FF2A 4QJ5B 3A4XA 3U3HA 5FJRA 1WO2A 1QMLA 3HOJA 5EBAA 3D3AA 3H2NA 1V6WA 1O94A 1P4CA 4Z0JA 1E9IA 2DT0A 1P48A 4Y8EA 3ZWTA 3P82A 4NAEA 4RV8A 1GONA 2INZA 2DPEA 4J2MA 1GVEA 5HPOA 4KCVA 5FJTA 4GO8A 1VD6A 3E1F1 5D9MA 1OM0A 2XJ7A 5DY2A 3TWBA 3CAVA 3H4GA 1Q63A 3VINA 4HGXA 3HMJG 1ITQA 3VK5A 1BEUA 2BOEX 4DM1A 3U0HA 3PP7A 1XRSA 3Q58A 5LA0A 1TCMA 1PHWA 3U8GA 4F4RA 2OYLA 3M5VA 1GYNA 4DWSB 5EMUA 1AL7A 4O4VA 4XQ6A 3ALGA 1Y5XA 2FZ9A 4ZODA 5A6KA 3PB2A 1LBLA 3UCQA 1VBHA 3A9IA 3PBUA 1UH3A 4DZAA 4BS0A 3EEZA 3O9NA 1KCLA 4H9UA 2OZ3A 5C2GA 2Z1SA 1DTNA 4UQCA 3N6JA 1J4EA 4AX6A 3EX4A 1FVPA 2VTFA 1W1VA 3T0BA 2A6NA 1YE4A 4DJEA 2B7OA 2UWFA 3GQYA 4J3WA 4HNUA 1CB2A 5KTLA 3HO8A 3WNOA 4JGDA 1Z8AA 1JI2A 1KNWA 2IKHA 1XLAA 2OQYA 2BZNA 1J0JA 2VX5A 3DDMA 3TW7A 1NP0A 2A7PA 2DSWA 4UOZA 4M80A 4JS3A 4PRTA 5CEWA 2HPMA 3POHA 3MJMA 5A8NA 3CB8A 3GWQA 4IPPA 3MSDA 2ZZ1A 2BY2A 2NV9A 4DJFA 3DXIA 4J40A 3F2DA 4PCNA 4I6KA 1XLMA 1ISWA 1JCNA 3B8SA 4UUIA 1ELSA 3THAA 1JZ3A 2MANA 3WQGA 4IP4A 4GQGA 3WLOA 1KR0A 4ZSTA 3TK7A 2RFGA 3W86A 2YOCA 1K8ZA 2UV8G 5A3HA 1ZAIA 3AISA 2I7GA 3BOLA 4GO9A 3GDBA 3ABXA 3CMFA 3U5UA 3KAOA 4J35A 4PMXA 3EPNA 1RY8A 1FWBC 1RK6A 1Z41A 2G0WA 1CZ1A 2OZ0A 4PCSA 2Y63A 3LSCA 4YTSA 2CZDA 3M43A 1PL9A 3GHUA 4JTLA 2WMIB 1OFEA 3GW0A 1HVQA 3W7QA 4JFVA 5M1TA 1ZP4A 1EP3A 3IAQA 1PCWA 3N6QA 2GOUA 5KZMA 4J5NA 2YCLB 2DUZA 2W62A 1LBMA 3BW2A 4GNKB 4KIEA 1I2NA 1UKQA 4FNQA 2REQA 2FHFA 1VYRA 3C8NA 1KQZA 3HB9A 4NP7A 5AHEA 2DZXA 1IV8A 3WQ5A 1CXHA 3TOYA 3T8LA 1TTPA 4DLMA 3QR0A 4GZJA 3GS6A 4HZ7A 1Q6GA 2I14A 3TKFA 4X60A 4JTKA 4HKPA 4PCTA 4Z2LA 1VLWA 3NVDA 5IFTA 3WMLA 1MRQA 4QLLA 4BHYA 2E3ZA 1KM2A 2OWWA 3T2OA 4FR1A 3DFQA 5C7VA 2ZA2A 3ZIZA 2XVKA 3VIIA 4QROA 5DMLA 2XIBA 1JDDA 4D6IA 4FIRA 1OYAA 1V0NA 3TYBA 3MWCA 4O1FA 3R2GA 3LS9A 4KEZA 1S46A 2HV5A 2WC4A 1JCMP 3WG6A 5HQMA 1OY0A 3LPFA 3SCWA 3UXAA 4C6KA 2BY3A 1J8VA 1UW9A 2Y4SA 4IQJA 3ARVA 1POJA 2INEA 3TN6A 3BSHA 4KCWA 1F2JA 3OLIA 1A50A 1WKYA 1YQ2A 1B1YA 1Z32X 3LZ5A 3SFWA 2WXDM 3G0UA 4QCEA 5GJNA 2POTA 4L9ZA 1G7VA 4LVAA 3IV3A 5A5WA 2RDUA 3TUUA 3H2CA 3B4UA 1N8WA 4MJZA 1PZ3A 4IP7A 1IT8A 2B81A 1UUQA 1J96A 2EO7A 3CB3A 3TDFA 3U2ZA 3F4DA 4KEVA 3VNIA 3G2GA 2DIJA 1XIHA 4OTKA 4IMAA 3P5YA 4UQ9A 7A3HA 1S39A 4Q22A 3MTWA 2Z27A 4CQ9A 4BF7A 4TVDA 1TV7A 3H4XA 3K8MA 4LAUA 2Q8LA 4BA0A 1S1RA 4IL0A 8CGTA 2CLHA 4N42A 4UQAA 3XIMA 1PIIA 4K7YA 3U4AA 3GFXA 2ACSA 1A3WA 2A3AA 4JOMA 1GOMA 4HCLA 2VENA 4UC5A 3T55A 4JTDA 4MNKA 5C7HA 3EWBX 4QDWA 2F2HA 3T0DA 2QCFA 4F0SA 4Z0SA 3UWUA 4W86A 1OCBA 4QCFA 1S38A 1HXJA 3B8DA 4IFKA 4DBSA 4JXCA 2GJXA 3IJIA 3EMQA 4JTEA 2J74A 4OQVA 4XSLA 1G5AA 2PP3A 3BLKA 4R3UA 3OZMA 4IPJA 1NF0A 4AIOA 2JK2A 2ZDSA 1SR0A 3PUGA 1Y8BA 1E1FA 3ITYA 2X0SA 4RCXA 1QW7A 1AH0A 7CGTA 1J6OA 3W84A 2GGGA 1LZOA 4IIFA 3WLMA 4CKQA 3H21A 1SZGA 1V3HA 3AYVA 3LRMA 2QUNA 1FWCC 1GUVA 4MDPA 4KCTA 3ITVA 3KBJA 4I9MA 2WSYA 2AQVA 4DO5A 3LHUA 1EC8A 1S2AA 4G56A 1VRDA 4M6VA 4EACA 5AHMA 2OSWA 4MB4A 4AZHA 4NF7A 1SZEA 5BOEA 3NG3A 4HHMA 5LNSA 3AHTA 3NYZA 3P2VA 1RH9A 4JFTA 1K4GA 2OXNA 3EPMA 1OFAA 4UFIA 3W1QA 2VC6A 3CQKA 2VFHA 5I78A 3AIUA 4K8HA 2Z1XA 4O28A 4WUIA 1TUXA 2X42A 3PBMA 3BLDA 4WD0A 3GTIA 2BSLA 2V5BA 3SRFA 3O6YX 4GIYA 2BDQA 2PWFA 1QPRA 1CEOA 4AB4A 4RDYA 1IR1A 3MCOA 2RUSA 3ERPA 3TN5A 4EX4A 3R79A 1XPGA 3ISIX 4IT1A 1RBLA 2VWSA 4TX6A 3ZR4A 2F6KA 1FDJA 4J3UA 4Y9MA 9XIAA 1BFNA 3LBMA 2BXZA 3QV8A 1SO4A 3R0UA 3E2QA 1BG4A 3DESA 4U31A 2D24A 3EWDA 3CUXA 3LCIA 1Q65A 2FZMA 3G22A 5E6ZA 2CLLA 4UFMA 1E43A 1V8EA 4U4MA 3C3NA 4C6OA 5I02A 1KLZA 3O7UA 1ZU8A 1FOBA 2WW5A 1IHIA 1F6PA 1FHLA 4GVHA 4GQ0A 3JS3A 5K9DA 3SJNA 4HTBA 4I5XA 3APTA 4Q8OA 3G6LA 5LGXA 1TJRA 2Z7GA 1TMHA 5CGTA 4FZIA 3TV8A 4GJIA 2BVWA 4XKMA 3VDGA 4W8BA 2V81A 4O54A 2WO5A 4ORMA 4O8RA 4QLJA 1KTBA 3W1XA 3UYCA 3OPSA 4TMCA 3LHYA 3CHEA 4CNSA 3CLMA 5J04A 4NZJA 4BWLC 1NDZA 3T8QA 3MDUA 4KKXA 3DGBA 3WDRA 4MKSA 3LBCA 1UKOA 2DFAA 2YSWA 2Q01A 5F7UA 2V82A 5MKGB 3VU2A 2BWGA 3PF3A 3BV4A 1A80A 4EE9A 2X05A 4N6FA 5F2IA 2NQZA 4V33A 2OG9A 3ZT6A 4XWUA 3ONBA 3N19B 4US5D 3ENLA 3TJIA 4UTJA 4WDTA 4HPNA 3KHJA 2QEZA 1V5XA 4H9VA 3BAIA 4MUZA 3PZMA 4QSHA 5AC5A 3M9YA 2GJPA 1J0IA 3QV7A 3B4YA 3WQEA 2C18A 5JH1A 4B16A 2V2DA 3AAMA 3FXYA 1AH4A 1GQIA 1R2RA 4JIRA 1SGJA 3SFKA 4HHLA 1RZMA 2ISSA 2WC3A 4F2UA 5K4ZA 2ZUSA 3KBSA 4JBRA 3UR7A 3MA8A 2VKZG 2ZRYA 4MVAA 3CV7A 2GVEA 4B9ZA 4PUWA 3PWIA 2R1PA 4UWMA 1OG6A 4JQAA 2WMFA 4LUTA 4XG1A 2R91A 4LUIA 2GVYA 3W25A 3NPXA 4HPXA 4JQ1A 3PJTA 5CLTA 4AY1A 3JVAA 3M7WA 1O68A 4G6CA 3T44A 6TAAA 3WUBA 1XG4A 3UWEA 4FALA 3QZEA 4BEUA 3TSBA 4CVUA 3KP1A 3SCNA 4E8CA 2PRHA 3PWAA 1GHSA 2Z28A 3TYAA 4TVCA 4PMQA 1Q6EA 4IMCA 4J2PA 5AYYA 1IEVA 4RE0A 1B3WA 2DSUA 2Z6JA 3U57A 4H04A 7PTDA 3TH6A 1RP9A 4H8HA 4JIEA 1KXHA 2QS8A 4AZ6A 1BRLB 1LM1A 3C2VA 4AHOA 5FEXA 1PTDA 1OADA 3ORWA 2FGBA 3LM3A 1I6NA 1JZ6A 1J0YA 4H4IA 1V7YA 1CW2A 3KZPA 4N7QA 3SECA 4HA1A 1BF2A 4JTAA 1UR4A 3KCLA 3NPUA 3QY6A 3ES7A 5IHSA 3WQFA 5K9XA 1GYMA 3T4WA 1SMDA 4P8VA 5A8GA 2PCQA 2PWGA 3HFTA 1W31A 1ONWA 4ZFCA 5EGRA 1L0PA 3ZYZA 5A2CA 3SBFA 1YNQA 5EMJA 1I75A 1VCGA 3POCA 4TX9A 1EA9C 4YNGA 2IXUA 5M5DA 4A05A 3ONCA 3DBNA 1O66A 5C2XA 4XZNX 3NL6A 1V3KA 3QC3A 4H19A 5FEZA 3DN5A 2Y61A 3ZMRA 1XM3A 4LB3A 2JEQA 2BGQA 3TQPA 3HV9A 2PAJA 2JIEA 3N4FA 3LOTA 1RVKA 3R12A 4WJEA 2ZX8A 3AC0A 1EQPA 4ZB5A 3PAOA 4L7ZA 3DU0A 4UTHA 2TYSA 2LLEA 2IPGA 1NJJA 3IK2A 3G1XA 3ZVHA 3GYCA 3LCFA 1W8GA 3VUPA 1EL3A 2HK1A 3NA8A 1OJXA 4ZQRA 2OLHA 4XZHA 2QF7A 1PKYA 5E0FA 3VIOA 1F4AA 1JGMA 1OIMA 3LNPA 2GSJA 3RM4A 3DUGA 3VGDA 4YCPA 5G2HA 3K1GA 3VMNA 3B0YA 3SSZA 4GBDA 3FY1A 3MZNA 5CPOA 2VQUA 1WKEA 5C71A 1LWIA 3AO0A 2PTDA 5EKYA 3MI3A 1K7EA 3LENA 3EOUA 1TWZA 1VFUA 4RX0A 5CC5A 3ITTA 3RLHA 3KRSA 1TPB1 1UJPA 2B7QA 2WM0A 2FZBA 1I2OA 4G1KA 4AZCA 3QLDA 3GAKA 2IMRA 2VEIA 1O5RA 1FCVA 3B06A 4RE3A 3CAWA 2AL2B 3PN8A 1FDZA 3KBNA 5CJNA 1J9YA 3H24A 4E8DA 5HR6A 5A2BA 3VD7A 4PULA 3VNJA 3ZT7A 3B9NA 1NFGA 2BOGX 4DF0A 2D2JA 4M24A 1AQMA 1C92A 3BICA 3WD0A 3WZ0E 3CQHA 4XUYA 4V1XA 4H3DA 1C8YA 4IIBA 3VOFA 4QG8A 1EDQA 3F2CA 1LF1A 5FJJA 2QDGA 2PD5A 5DFAA 3VOCA 3UG4A 3EOEA 1ZBCA 2GJNA 2QKFA 2C13A 4JFSA 4QDPA 4CUCA 1NU5A 1Q7QA 4ICMA 4I7UA 4TU1A 5B7ZA 3NOEA 1KBIA 1UIOA 3T78A 3AU6A 1MQRA 1X6UA 1ZJIA 4X9SA 1BWLA 3N12A 4IGNA 1QRQA 4F8XA 1C8VA 2CNCA 2ZICA 1LQ0A 2D2OA 2GZXA 2ZYFA 4NQ1A 3WL0A 3LU2A 3E2VA 1UB3A 3CGTA 2XN1A 3DGRA 3VIFA 4QG6A 1Q85A 4O14A 2OJPA 3QHOA 3F4VA 4NAFA 3RX4A 3U7BA 3I6RA 1WBHA 4IL2A 4R7JA 3GTNA 2W92A 4UR8A 1THFD 3H6OA 1J5TA 3QOKA 4P7QA 2PC4A 2QPUA 1OT1A 4GZEA 3B40A 4AY7A 3FKRA 3W6YA 4GK8A 1MDRA 2DU2A 4XZBA 2J77A 3WBAA 1W56A 2YA0A 3M16A 2PWUA 3VX0A 4RE4A 5E6YA 1FKWA 5D04C 2QGHA 1K1DA 3FFSA 4M6PA 4EPDC 3EWYA 2QF8A 3GVVA 2FPYA 3WUFA 2B7NA 4AG0A 1O5XA 4LVFA 1OQFA 2OQHA 2E6AA 2BHZA 1OK4A 5KZDA 1JIBA 1UA3A 3AU2A 3MSRA 3CZEA 5E09A 4PEEA 3O6CA 4PUNA 4FI4A 4PTVA 3A3WA 3RO8A 2WOQA 4PZVA 2QXWA 4WKAA 1W54A 3T40A 4MIMA 1DXIA 1OF8A 5DMMA 3UPBA 3W71A 3BMXA 4V1YA 4GISA 2D1ZA 2EPOA 4JICA 1CT5A 4L80A 3GTFA 1LQ2A 1T99A 2XU2A 3KOZA 3MVTA 5F1UA 4AVNA 3T2QA 2IPWA 4ROQA 4JTIA 4W87A 4ZO7A 5KITA 1AW1A 2ABBA 5AHNA 2Q71A 2Q09A 2Y70A 3IEBA 3VC5A 1PDZA 3W7JA 3T6CA 4LTSA 1QDSA 3OZYA 1IXPA 1MWOA 2PLCA 3I10A 1TCDA 4K1WA 2FYMA 2WQDA 1SFSA 2Z00A 3SCVA 1VAHA 3S42A 2VYOA 3UFYA 1VFSA 3LYEA 3EDFA 3R4IA 4AMCA 3NO1A 3U6WA 2OWXA 2DW6A 2PDBA 1W32A 4XVDA 3CYJA 3QXBA 1W2VA 1JDCA 1VS1A 2E68A 3S5SA 3DHFA 3GNRA 1BSIA 4MF4A 1IXQA 3UWQA 3QW4B 1UZHA 2GQAA 4KIRA 3W75A 2RH9A 1OHLA 2OWCA 4WR3A 2O55A 1QUMA 1EQCA 1TFVA 1SR9A 6CGTA 3T7VA 1DVJA 1E73M 1OX4B 4HMEA 4JN8A 4F40A 1YDNA 3VNZA 3LCLA 1PZ2A 3L67A 1B2YA 3BSGA 5C6MA 2ALRA 3GU2A 2WKLA 3PZOA 3V5OA 1W5MA 4R7WA 1DJWA 2J8GA 1XIFA 2PD9A 4ZB2A 1CI1A 1KKRA 4IH3A 4GC3A 3SGGA 3WD3A 2D22A 4ATWA 5CGQA 5FCZA 3IIZA 3PZQA 3TN3A 1C93A 1VFFA 3LMZA 4I8DA 4GYPA 1NF7A 3M47A 2C0AA 3RU8X 3TWAA 3W7OA 2HE8A 2QIIA 1LG1A 1TG7A 4XAPA 5EFFA 5D2YA 2E1DA 2FZDA 3UJEA 3NQMA 1DYSA 2PF0A 1GQNA 1R3SA 2H3DA 2FHBA 3WQ6A 1K6AA 3PY2A 3KVMA 4C60A 2D3LA 1NWTA 2WBKA 3R43A 3OVGA 3CEUA 2R82A 3S5NA 4WSKA 4JIIX 3WUEA 1ZCOA 4JN7A 1YNPA 1G4EA 2POZA 3E0FA 1AG1O 3IGUA 1XSKA 4WDUA 2J8FA 2XM1A 4U33A 4MTVA 1VCVA 3NQAA 3HGRA 3L2MA 2C91A 1XC6A 2OX1A 3NL3A 2XFYA 4KWSA 3Q67A 3BK0A 4PMUA 3DI0A 1UC4A 1V6XA 3GC4A 4UCFA 3PK7A 3ZLGA 2GJLA 3BO9A 2CLIA 2YB4A 3ZS4A 2I5GA 1HGWA 3C2EA 2JKPA 1HJQA 3TSMA 1ZNNA 2PODA 3NAVA 1DWIM 3UW6A 3HG4A 2CXGA 3APGA 3B8WA 2YCJA 1XLKA 2QCDA 3NEHA 3CAKA 5BRBA 1LWJA 4WHBA 5C9ZA 2HWGA 3KL5A 2Z7KA 1YPIA 3EEGA 1X7FA 4E3VA 3SR7A 3CV6A 5H8PA 3VDCA 3V35A 3VKCA 2RJHA 1UR8A 5RUBA 3L21A 2XN0A 3NSNA 3R13A 2ZRVA 3TYUA 1E1EA 5DY3A 2FQIA 3WNLA 2QUVA 3CQ0A 4DO7A 2X16A 1CTNA 1OCNA 1S5NA 2OPJA 1GG1A 4PE8A 1XGEA 4GIAA 1PWLA 2SFPA 4F9DA 4O13A 2DZAA 4AUBA 3T2PA 4MKNA 3EWWA 5DBUA 1EUAA 3FK4A 3MPGA 4MLRA 3SUTA 5LHEA 3RK8A 5BW6A 4A3UA 1OBAA 4JFUA 4NJJA 5HJYA 4FNUA 2O9PA 1RV8A 5KINA 3V0UA 2PDXA 3WQWA 4PB4A 3M46A 1PYFA 2HCVA 1AW5A 1YMYA 3ATYA 2ZZ4A 3WY1A 4G7EA 1N55A 1GEQA 1ME8A 4YJ5A 3P8JA 2HS8A 2WVVB 4O1CA 4XSMA 5FF3A 4HA3A 1BG9A 1KXQA 3DI1A 3UD6A 2QCEA 1KBKA 4WIWA 3E3HA 5JUVA 1RCQA 4HNTA 1JDAA 4LS1A 1JF6A 3QJAA 2JIWA 2VI0A 3VDAA 2I9EA 1ZB5A 1Q3NA 3LN3A 3I65A 1PX8A 4TIMA 3WJXA 3KXQA 3LPPA 4E38A 3W7NA 4KT2A 3TCSA 1WDDA 4Z2HA 4LS0A 4PMNA 4JTCA 2VRQA 1M5WA 3QQWA 2DVTA 6ALDA 1KRCC 1G4TA 1PPIA 2OZ8A 2XHYA 1H63A 3AMDA 2NSOA 2G96A 3PM6A 8A3HA 1YDOA 3AYSA 4J9JA 5E1QA 2VFFA 3H7VA 1U1HA 4DUOA 2WCSA 1CLKA 2AMGA 2HDJA 8XIMA 1JVNA 3GDRA 3V75A 2AGKA 2UY2A 1RK5A 4AU0A 3XINA 2ONEA 5A6TC 4NJHA 4QITA 3I7QA 2YYTA 1SYTA 1TQXA 4PTMA 3C61A 2VL4A 2OEKA 5L9FA 2ZVRA 1O60A 1F61A 1A0DA 1EZ2A 3BAXA 3IUIA 1G6CA 4I5RA 3ARQA 4O53A 3WH9A 4C65A 3KOFA 3TMQA 1QO5A 3FGCB 3FJLA 1D3HA 4GABA 4M1BA 3O05A 4PR4A 4AQLA 2WNQA 4B92A 4GACA 4ZA0A 2WSKA 5GNXA 5A8PA 3NR0A 4LF2A 1IT0A 1TIMA 3S46A 2FFIA 2VEMA 3NUKA 3ARSA 3PNUA 3O3RA 5H2ZA 4ALDA 1QNPA 2EF9A 4Z2IA 2PLJA 3NDYA 2ZA3A 3E2RA 2PDKA 1R3QA 4L1XA 4GQRA 4Q7NA 2BHUA 4KRTA 5CC6A 3W81A 1HL2A 3PBGA 3ITCA 5LSMA 3HMCA 2PDCA 2D23A 4DJEC 3LV5A 3QHNA 1ALDA 3HF3A 3WFLA 4MNMA 1L8NA 3MU7A 4KRZA 3BCFA 4K8GA 4ML9A 3QM3A 1OD0A 3WENA 4MPQA 1E51A 1UD5A 3IACA 5JMUA 1P0NA 3LA4A 2VR5A 1P6BA 4MDOA 1HJSA 1N8IA 1ONEA 3DKLA 4DBDA 2Q3OA 3GDTA 4X2PA 1FWHC 2BXYA 2YKKA 4DJFC 3CUZA 1JUBA 1V4YA 1FQ0A 2OFJA 3ZOAA 4BK9A 3FYYA 3V3WA 4ZE4A 2DZSA 5CBJA 3V16A 3VDBA 4L6DA 1DOSA 3WBWA 3PG8A 5HAOA 3KRUA 2XIJA 3WLJA 1EZWA 1WUEA 2CHNA 4G5DA 3HURA 4DWSA 1EH9A 4FB7A 5K3VA 2VD8A 4JHMA 2G8ZA 1E4NA 1S2UA 4K1GA 1EJVC 3TW6A 4OU1A 4ROPA 2P10A 4IX0A 1KRAC 3RITA 1J0KA 1WDRA 2CZVA 2DH2A 4B90A 1TUFA 3E96A 3O16A 3CPGA 3R94A 4L61A 1XICA 3SCTA 1M65A 4FLQA 2P0OA 3AIQA 2WWCA 4OKDA 4ERGA 4GX9A 4HYWA 1A3XA 3ZSSA 4RV3A 3RJXA 1YBQA 3AMCA 4GNVA 1DIOA 1R47A 5E70A 3RM9A 3PPHA 1M41A 3QZ6A 5D37A 3AALA 1OX6A 1FWFC 5HUPA 4LUSB 3W1UA 4B91A 4LBUA 4O57A 3PZ9A 2H8XA 3F2BA 3BLIA 2MUCA 3LSBA 4S3KA 4CQDA 2XH7A 3AS2A 2QYGA 5CJMA 2V38A 3KZSA 4UQBA 1YDYA 2OVLA 4GXMA 2V5DA 5FACA 1EHAA 3QEZA 3LUTA 3M07A 1I60A 2ON3A 3QFWA 1O5QA 2Z29A 1J10A 3O8AA 1HL8A 3E5PA 5LYRA 1YIXA 5DT5A 3SADA 1B30A 1F6YA 3WLQA 4AAJA 3EGJA 1HO1A 1JCXA 3RFAA 4DAIA 4BKNA 1TPH1 3NQ8A 3H22A 3BMVA 4L4LA 1CGTA 4HSHA 1E6QM 3RXZA 1HX0A 5A1AA 1VQTA 4FNTA 3DFHA 1KM3A 3G0SA 1EHNA 4NJGA 1UWUA 4JQ2A 1RCOB 1L2QA 1KRMA 3O07A 3IJ9A 1AFSA 4M1RA 5ABFA 2WZEA 3GHSA 3O63A 3PUEA 3F7JA 4RUBA 1BYCA 2A3HA 1WYIA 5JBFA 3MQTA 4NZFA 5I06A 1TREA 5D32A 3PSWA 1TPFA 1LBFA 1Q2SA 1XIMA 2YW4A 1R8LA 1KM1A 1BD0A 1CXKA 4RDZA 3TXZA 5CPNA 4FSAA 3AIRA 4LPCA 4ZXLA 4AIBA 4KWWA 2PWHA 3CUJA 1FWTA 4AD0A 4PMVA 4KGJA 3CYVA 4BI7A 2Y7DA 3FXGA 4M0XA 1F05A 3CQJA 4IXHA 1ZAJA 4Y9NA 1D3CA 3WQOA 3RO6A 1TX2A 2RKXA 3FOKA 3STEA 1JZ2A 4LYPA 1EB3A 3M5XA 4Q4MA 3WLPA 3QV6A 3PZGA 2QJHA 4D1IA 2ALDA 4PUEA 1HTIA 1X8FA 1Y5WA 2WYSA 3AXMA 1UYQA 1GPWA 2VCAA 3QMRA 1HO4A 2W61A 1UP3A 3LGGA 3AMGA 2VM8A 3GH5A 1F73A 1KWKA 1E9ZB 4OBRA 3EX1A 3WF2A 1ZSXA 4N9CA 4O0ZA 4P7NA 1R86A 3VE9A 3O0FA 4WQ6A 2UY3A 3B0XA 1T7LA 1QHZA 2Y5EA 1X97A 3IIOA 3MYOA 3KX6A 4CLMA 1B5TA 1B3VA 4V27A 2HNEA 3VM7A 1Y7VA 4K36A 1F3WA 5CZTA 1ODUA 3W27A 3TROA 3GH7A 4MB3A 3E74A 2YZRA 3FJ6A 4PMZA 4U5IA 1MEIA 3S3GA 3IPWA 1KFBA 2PDYA 3KCOA 4PMRA 3U7VA 1HL9A 1JCJA 3IVUA 4MHBA 5A6JA 4LCSA 1TVNA 4WRHA 3W2JA 2V69A 4NX5A 3EA2A 3UEQA 1DWGM 1JPHA 4ZO8A 4H6EA 1GTHA 2PLMA 2WMJA 3WL1A 3PVFA 2IQDA 4OJYA 1B9BA 4S39A 5A6LA 1PYMA 1RSCA 4NI3A 1K9EA 3EWXA 1KXVA 3KOXA 2EJ1A 1KGXA 3PJUA 4Q6XA 3R6IA 1ZTVA 3W1AA 4UTLA 3WQVA 4NYYA 1XLBA 3KLLA 3SJ3A 4QSFA 3PTDA 1GKRA 4FPSA 1H2JA 1YADA 1JD7A 2CU0A 3ABQA 3SQLA 1OB0A 3GNNA 3NZRA 1FCBA 5JQ9A 1EO7A 1TA3B 4Q4OA 4HN4A 4WY0B 1R7AA 4NZ1A 3NM3A 4JTUA 3ZZ1A 1KWGA 4Y2WA 2PGEA 4M6UA 1S3TC 1XBYA 1MW2A 3BAWA 1UD2A 4IIDA 4DZHA 2ZZ2A 4RK8A 5D2XA 5CC3A 4ZR8A 4M56A 2G3NA 4CD8A 4WOQA 4BI6A 7TAAA 3PJXA 1POKA 4V15A 3M0MA 4GOAA 1LOLA 2R1LA 2WJDA 3VA8A 4FF5A 1UOKA 4WX2A 2C71A 4QE4A 2NQ9A 1EKOA 3E38A 4H9ZA 5CXPA 2QCCA 2YFOA 1IEXA 2V2CA 2GUYA 4CQBA 4RPPA 1K4HA 2E67A 1NARA 3BLPX 5BOOA 1TWDA 3H53A 5ABGA 4UTMA 2YBTA 3UG5A 2ZRWA 4FOJA 4U3CA 3SCUA 3NDZA 3F03K 3PC0A 2C3ZA 2BOFX 3JZEA 4IUGA 3UJ2A 1H41A 5LNVA 4DYEA 4PSRA 1OZMA 5E93A 4BCEA 4AISA 3BGAA 1EGMA 5I3JA 1KBJA 1Q6RA 2Z1KA 3LB0A 1R9XA 3N2OA 1GZ1A 1NWUA 3RCMA 2A79A 2CHRA 4HZ8A 1PB0A 3MMWA 1ZCCA 4OV4A 2IKIA 4ZTXA 3L4YA 3K2GA 2RDWA 2J7DA 5G1TA 2C6QA 3JRKA 3GVRA 5EY5A 1TX0A 4PTWA 3UETA 4O0KA 1R87A 2XIIA 3N04A 1F8MA 5G2IA 4HIBA 2QNEA 4GFIA 4AC1X 4D8ZA 1A0CA 1V7AA 4AHPA 3I3BA 3CLWA 3V5CA 3PBWA 3GY1A 4AWUA 2CZ5A 2OO6A 4XZLX 5C8BB 2R6OA 2QAPA 4QISA 4HPJA 1D7KA 1CENA 1AVAA 5IFPA 4GI9A 4W7VA 3N1AA 4H9TA 1XQLA 2QPXA 3B8UA 1WV2A 4WJ8A 2BTMA 4RZ5A 3KTCA 2EHHA 1U22A 5BRPA 3GXDA 4CQCA 4M8UA 3ME3A 3BVJA 2VD9A 4MB5A 3A5VA 4YWSA 3A21A 4H1ZA 2OSXA 4EWND 1VBGA 2DSVA 4J3TA 1EBHA 4C6LA 2Y85A 3VILA 4DZ5A 2W0UA 5JIPA 5D2WA 3K46A 4WGHA 3ZJ7A 2GFTA 2Z24A 3JUGA 2Y62A 1C9DA 2ISVA 4JPGA 2D3NA 5TBOA 3EX3A 1QNSA 1ZENA 1SPQA 2WC7A 2X8RA 1E0TA 3GXTA 2D0HA 3QPYA 3BOXA 2J79A 1S5MA 3EX6A 2AKZA 5I3HA 1PS9A 2PCEA 1HG3A 1JI1A 3T08A 2YL9A 1KGWA 1X96A 3WFZA 5AKQA 1FHUA 4MLJA 5KZ6A 1B54A 4N9EA 5GJPA 4UNIA 3HG2A 4GYKA 4F0KA 4L4MA 2PEVA 4L64A 2GUBA 3LGDA 5FF0A 4XIAA 1ZAHA 4H9XA 2XTKA 4G8TA 3W29A 2Z4GA 3EB2A 1QVBA 5FAGA 4LAZA 8XIAA 3T1GA 3SCPA 3NNTA 1SJAA 3N2BA 3GNPA 2C16A 2NSXA 3QLLA 1NP2A 4TTUA 4NT0A 3LPGA 4UNLA 3OBEA 4A21A 3WDIA 1R85A 2ATSA 2XDFA 4I7WA 3D46A 3ECQA 3ITXA 3ARWA 2YDSA 3KP0A 3G6MA 4C7DA 2BX7A 2FGZA 2P0IA 3RR1A 1GHRA 3QGVA 1VPXA 3LG3A 4MWAA 1R2SA 1SFLA 1TYGA 3THQA 2ZA1A 3N34A 1X6NA 2ZUUA 4KW2A 1PTGA 1IE7C 3AHYA 4EXAA 2EEXA 1BXNA 1BYBA 3O1NA 3O06A 2W27A 3G8EA 2F6UA 5FJIA 4H2HA 4O15A 4JTRA 2X0HA 2R14A 1Q4WA 4DBWA 1OFBA 5A8OA 2PDMA 5CZ0A 1IEQA 3CMJA 2E28A 3FV9A 3ABRA 3H55A 3EB4A 1P0BA 4Q33A 1K03A 1NWRA 3N2MA 3SURA 2NX9A 3C2OA 3ITGA 5LNUA 4RJEA 5DXXA 2H9AA 3NURA 2BVYA 3P14A 1J01A 3QR3A 1BKSA 4YVXA 2DIKA 3L2LA 4GJ1A 1Z69A 2GGIA 3W2LA 2HNHA 4F48A 2E8YA 1QI3A 4IMFA 3QSTA 3ABSA 4QM1A 2G4FA 3RLUA 5F2MA 4NAEB 2A0NA 5CG7A 1UA7A 5CZSA 1QOXA 1KB3A 3MW7A 3V1HA 4D6HA 3MP3A 4DUVA 3GG1A 3USBA 4NI8A 4GIEA 5J8LA 2WWDA 3CWOX 2NV1A 4JTSA 1XYFA 4JKLA 4PTXA 3VOIA 2AGTA 2EG6A 1A5LC 1VHCA 4R34A 1E3ZA 3AQUA 2NV2A 2IPFA 5G4HC 3U2OA 1E6ZA 2DEPA 5BXSA 4IGSA 2E6DA 5HDRA 2PS2A 5LIWX 3COTA 3HJZA 1F76A 3HFYA 2E4TA 3DYPA 3IARA 7TIMA 2E77A 3BOFA 3QFEA 4ZL1A 3W7HA 3GG8A 1YXYA 3T0TA 4DX3A 2O92A 1F5ZA 4L1GA 1EYWA 4KESA 1W9XA 4DJED 4RW3A 3CU2A 1VGAA 1OFRA 1OEPA 2Y8KA 1GK8A 1Q6LA 1TWSA 3VD5A 1QK0A 3TYEA 2PWDA 1H5VA 2Y8VA 4P7LA 1TWWA 5F4SA 4QE1A 1JF5A 3CK5A 4QP0A 3MMDA 2C0HA 4FEZA 3WCZA 5G4EA 2VNCA 2HXTA 2VC9A 3I68A 5C9XA 3GUGA 3S9YA 3P61A 4JZ5A 2HVNA 1VJSA 1I2QA 1W3JA 4OHQA 4DJFD 1US2A 1ZLPA 2DQXA 2HSAA 2PWVA 2VR2A 4UTKA 4W4QA 1G1YA 1VJZA 3H2FA 1R6WA 3E0WA 4Y7EA 4ZXOA 3VVGA 1UKTA 3PG9A 2GDQA 2OEMA 4Y9OA 2WKGA 1L6YA 3HPAA 1Q4NX 1JYVA 4DI9A 4OOUA 1OFQA 4H83A 1GORA 1SW0A 1CX9A 2YZ5A 4X2RA 4EWJA 5A6SA 3ZM8A 3HU7A 3RLVA 4DXXA 3UXLA 3ANYA 1M7OA 4P61A 1JPKA 2F6XA 3RYSA 4MAZA 4QG9A 1T0OA 1GWJA 3R1ZA 1UWIA 4AMAA 5D05A 3KOYA 3PUDA 2DW7A 1VRXA 3O0KA 1UH4A 4UR9A 1T96A 3G18A 4YWIA 3CH0A 4LS2A 2WJEA 3LMYA 1A5SA 4RZ6A 4C1NA 5KMYA 1JUEA 2WBGA 1GJPA 2PDFA 1R3TA 1QI2A 1G4PA 2GUUA 1HUVA 1E72M 1T41A 4A2RA 2J4GA 5HJLA 3A3HA 2WMKA 1LRQA 1JPIA 4MNLA 3VGBA 2ZE3A 3KVLA 1HVXA 1VEMA 2TPSA 5C9WA 1T8XA 3TZNA 4W7UA 2FDMA 3KTSA 4L4PA 2Y8UA 2AL2A 1N7KA 7XIMA 2PDWA 5HOSA 2Z2UA 3AWOA 2I57A 3NTYA 3NXLA 3KM8A 3AHXA 3SCQA 2REQB 1EWEA 5BROA 5DRIA 2NZLA 4FNRA 6REQA 3GDKA 4ACZA 2PDJA 4KFNA 1DJIA 4D8AA 4CCCA 2Z6IA 4MG4A 3UG3A 3LLFA 2NWRA 4P2VA 2VX7A 4H00A 4PMJA 2EKGA 3QZAA 3GKAA 3AJ7A 1XKJA 1DV7A 1UWAA 3SUUA 1Z42A 1X6LA 5I3GA 5D03A 4ZOCA 4EK7A 1B90A 4AD1A 4IG2A 4KWUA 4GLEA 3CPUA 4UZSA 1WZMA 3H26A 2G3JA 4LCRA 1YKWA 5DEZA 1JYWA 3U2EA 3TQKA 5G5IA 1M68A 4FXRA 4R88A 1ADOA 3B97A 4UIOA 4LB4A 3CBWA 1G0CA 1VFLA 3GK0A 3S6TA 5LA2A 4BF9A 3APYA 2JGQA 2R24A 3NQ7A 5AHLA 1HP4A 3N15A 1I0DA 1SFTA 3BAJA 3MP4A 1WPCA 3OZOA 2YX0A 3BZGA 1BYDA 3AS1A 4OWGA 1OABA 2OELA 2WVTA 3MBDA 2NX3A 4H6QA 2WZTA 1IXOA 4M19A 5ENLA 2J62A 3EYPA 1TPUA 1XH2A 4A35A 4AIUA 5KZEA 4F0RA 1IZCA 3HPFA 1AJ2A 4S3BA 1JFXA 3QF0A 6XIMA 1P0KA 2A3BA 4G9PA 3DC8A 4GPNA 2OKTA 4FOUA 4HU4A 4DJDA 2ZTKA 3W1RA 3LPOA 3AROA 4DO6A 5FL0A 4FLRA 4GZIA 4LV4A 4J7RA 1P6WA 3OYZA 3VMPA 3M0YA 3FJNA 4X9YA 1XCXA 3LK6A 1AD4A 1CXIA 3QHMA 2XFRA 4IICA 4YN5A 1A5BA 2PDQA 4W9TA 2AQOA 1E0UA 5BXRA 1J2WA 1TTIA 1UD6A 3R58A 1W91A 3FYOA 2R1NA 4B15A 1BVNP 3AMLA 2Y0FA 2HE5A 3W7LA 4FNPA 5DELA 5CAKA 3NPVA 4YTQA 4GYPC 4CCZA 2PDGA 3GUWA 2CBUA 5LIYX 1NELA 1NFPA 1DKWA 3TQ0A 2EKCA 4C6FA 3F4CA 2NT1A 1EOMA 3SDOA 3UA4A 2Y5SA 4HT3A 3L5LA 1JXKA 4IFKB 3EBVA 4AWEA 2GJXB 4YU1A 3W1MA 1J0ZA 1SZRA 3PS7A 1E3XA 4BY3A 3BW4A 1XSJA 1JG9A 3ZVIA 4PUDA 2WAGA 1UR1A 2Y5JA 1VJIA 2GWNA 5A8MA 3STGA 3W6MA 3LNMA 4KWVA 3UPWA 5AYXA 4LANA 3IJ7A 2Q6ZA 4S2CA 4F0LA 4HOWA 2EG8A 5G1YA 5FEWA 4MY1A 1BPLB 4WLCA 1RJRA 2IKGA 4L56A 1JCTA 1W3HA 3KL0A 3RMJA 4JHZA 3WDJA 1R30A 3A6OA 3M0IA 1BHGA 5TNVA 2WVUA 2DUAA 3SCRA 1X7IA 3DG3A 1W0MA 1PSCA 1BXBA 1O12A 3THDA 4Y8FA 3VIJA 1N82A 1XFBA 5XINA 4O19A 3WYZA 5I24A 1CGUA 4FS9A 3LHZA 3VIGA 1P1MA 4X0NA 2ZE0A 4QS6A 4LX4A 1SO6A 1E56A 3L4VA 4HMNA 1N8FA 1VFTA 3WIJA 2D0GA 4IPNB 2VWTA 1QOPA 3AHVA 4UTTA 5G1MA 3UQNA 4HCHA 3L4ZA 1EP1A 4OE7A 2AOSA 2YCKX 4GHRA 4Q8PA 1WXJA 3GHRA 3URNA 3LTYA 5A6MA 3GFYA 1H1NA 4R33A 3OJGA 4GCAA 2GQ3A 1DE6A 3MO4A 4UMCA 1C8XA 2X1SA 3FVMA 3WX7A 1W3IA 2BMBA 3MT1A 5HMSA 3EA3A 2A1YA 1K9DA 2F2KA 1G67A 1QPKA 5K2ZA 1W9VA 5EMYA 4JN6A 3OQ8A 3L5AA 2GWGA 4NNAA 3U9IA 3SB0A 3WQ8A 4BQ5A 4DB7A 3WF4A 3A22A 2UBPC 4HQVA 4AY8A 3KBWA 3WD1A 3S9IA 3GH4A 3REQA 1AMKA 3VCNA 4C90A 2GOKA 4QS5A 3F4NA 1ZZMA 4CEUC 1U5HA 2ZBTA 4XAYA 4HZ6A 1H7NA 1VKFA 4HNVA 4E6MA 2CBIA 4DLFA 4ADSA 1TZZA 2FB2A 4U28A 4KETA 3SM0A 3NQ2A 1SFJA 3T81A 4REQA 2VRKA 3UY7A 5LIXX 3PFRA 4QFUA 2CXEA 1ENUA 4UBPC 2HMCA 1KBBA 4XO7A 1VC4A 1E9YB 1GZGA 3WD2A 2XIMA 3MWAA 4C6BA 4JNYA 2KZHA 3P5ZA 1YTDA 5GNZA 4QR6A 3B03A 2D73A 1ISYA 4ATDA 3LD5A 1QW9A 2CZEA 4K6AA 4Z1DA 4R27A 2I56A 3UVIA 3L4WA 4YL2A 3EKLA 1AW2A 1QWKA 2V5KA 2FLIA 1J93A 2JQXA 4DUXA 2R1MA 3I7SA 1CBGA 2RJGA 3ZQ9A 1IEWA 1XYCA 2HJPA 4OV9A 2BY0A 2V63A 4XBKA 3WUGA 3W83A 3A64A 1E55A 1KQYA 1T5AA 3N4AA 1UP2A 3OBAA 4HNNA 3W28A 4FOKA 1JAEA 1W5PA 4FLSA 2J7GA 3WLTA 3TOPA 3F4WA 1ISXA 5AVHA 4AH7A 1QNRA 2PF8A 4RNIA 1V08A 3CZLA 4GX8A 3RF9A 3QC0A 2Q8XA 3CT7A 4HD5A 3DG6A 5HATA 2PGRA 1PIFA 1FWNA 1PO9A 4UXDA 4LUTB 2W5FA 3WLHA 1A5OC 4QLKA 1YTKA 3W0KA 4X63A 1X1NA 3THCA 3OGSA 4JYDA 4JD4A 4K3ZA 4DBUA 1TV2A 5HMEA 4O1AA 3S2LA 4RKAA 1M7XA 2OYMA 3AIWA 2YL6A 3PSVA 4J27A 1A3HA 3CL6A 3DFOA 2BV9A 1SJDA 4X22A 4AHQA 3CHVA 4QHRA 1A53A 4D1JA 1YE6A 2J6VA 2PBOA 3S6OA 4K2SA 4WDWA 3SAZA 3GU9A 4M5PA 4OUIA 2PTWA 1V0MA 2BB0A 6A3HA 3GU1A 4GXWA 1ZL1A 4W93A 4H8VA 4G7FA 2DVXA 1EJXC 3H4WA 1XBVA 1HKWA 3TONA 5AC6A 4IJRA 4ZOBA 3OVRA 2NUYA 3TJ4A 6PTDA 4DZIA 3TJXA 4AXKA 4ASTA 3SN0A 1CB7B 4N02A 1AQ0A 5FJPA 3D3FA 3CAQA 5T91A 1XUUA 4R5EA 4GI8A 4NL1A 1SSDA 2CIPA 1NFBA 4ZE5A 4JCLA 3LZ3A 3FVDA 1X38A 5C9RA 1HIZA 3GDMA 1FHVA 2PRLA 4UB9A 4XZ9A 3UERA 4TUFA 3S1XA 3AWNA 4DWSC 1HJWA 2V3FA 2CETA 1V3LA 4ZEPA 4LYRA 1Y65A 4MGGA 4ZGYA 1B9ZA 3BH4A 2C1IA 3RPMA 1OCQA 4EKJA 2R8WA 6ENLA 4XIMA 3HPZA 1QOQA 3I3DA 2AL1A 1MUWA 1XISA 1NOUA 2V3DA 4DUWA 1D2KA 1R3YA 2A21A 3FYPA 3EKZA 2WMGA 3L4TA 1REQA 4RNJA 2WPBA 2GVLA 4GC4A 4Q4RA 2EG7A 3UR2A 2DJLA 3OA5A 4PBFA 4FIQA 3SN4A 2C7FA 1IIGA 5IM51 3R8RA 3CH9A 3VOHA 1OGSA 3ZVHB 1LOSA 3A24A 3DHDA 1Q6DA 2BGNE 4EF9A 3GM8A 4MY8A 2PSNA 4ZFMA 1CXLA 4GQQA 1UPPA 2XSXA 3OBKA 4GVIA 4NJIA 2VC7A 2PPGA 2QJIA 1ICQA 1XGDA 3VC6A 3QVQA 1KFCA 3GVQA 5T26A 4DNMA 3FA4A 1XRTA 3S8HA 2XH0A 4MZ1A 1LUCA 2YLAA 4JIPA 4QDMA 2J7FA 4GKTA 2YJQA 4FMVA 3CZKA 3VNLA 1VZWA 4GINA 1XIEA 4G2DA 4MOZA 1XLCA 3DYMA 1H4PA 3CO4A 3LM7A 4NRRA 2QMKA 1XG3A 3R10A 4IXXA