1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
3VILA 3ZT5A 3ZQ9A 3GZAA 5A8OA 4AZHA 4MAVA 5IHRA 3VO0A 1BGGA 4FLOA 3VMOA 1E4MM 5D9PA 3HJEA 3RMEA 1US2A 4Z2JA 3ZT6A 3UG3A 1OT1A 1JFHA 1V6XA 1CXEA 2O9RA 1BG4A 2J47A 4DO4A 4MDOA 2WMGA 4P8WA 3W27A 3GH5A 2A3HA 1OD8A 4GZJA 5I2UA 1W3HA 4H8UA 4Y7EA 2VO5A 2AOSA 2PBGA 4F79A 2VRJA 2FGLA 2WHMA 3AIWA 3S5YA 1JYWA 2DT0A 3D4YA 1MWOA 5M5DA 2QMKA 4XB3A 2XFFA 4CU8A 1K9DA 1MFUA 4DO6A 5LA0A 1JI1A 3K46A 4HZ6A 4E2OA 4KRTA 3FHQA 2ZX8A 2VL4A 1HWWA 3AFBA 4WSKA 2XVKA 4KRUA 1EHNA 2ZX5A 3MV11 3CC1A 5BCAA 1JZ5A 4AYSA 1B3YA 2CKSA 1OM0A 1HF6A 1NOFA 3SCUA 2QPUA 2GK1B 4MTVA 1H0IA 1JAEA 1E73M 3NJ3A 1IT0A 3AXXA 3CUGA 1E6ZA 3AHVA 4KGLA 1R7AA 4QLLA 3CUJA 4HTYA 3POCA 5DO8A 1V0LA 3BMVA 1V0MA 4S3JA 3SUSA 4X9YA 1JNDA 2WVVB 1MYRA 4D6FA 3MSDA 2X0YA 4BF7A 2XVPA 4ATLA 1OT2A 1PPIA 2JFEX 1E5NA 3WNPA 1UD4A 4DUXA 1QI2A 3LXAA 2OSWA 3WY4A 2D0FA 5ABFB 1J0KA 2EADA 4W88A 5E70A 4U3CA 1LG1A 1KCKA 1QX1A 3GDBA 2WC3A 2J77A 5ABGA 3WKZA 1BVNP 1J11A 5GNZA 2GJRA 4U5KA 3GH7A 1GOKA 3SUVA 1M53A 1H11A 4H7VA 2XWEA 1SYTA 1BFNA 1HKJA 1D7FA 1H09A 2NT0A 4CUCA 3G6MA 4DWSD 3UG4A 4UFLA 4MB1A 2YFNA 1EOMA 1HVXA 1J12A 2VVNA 3SCOA 1DWJM 2XSBA 3AXHA 2G3NA 4F9DA 4U31A 3AZTA 5E0CA 3L4UA 4QCEA 1BVZA 1BG9A 1JGIA 4MDPA 2XGBA 4DM2A 3EMCA 5M3WA 3BXWA 3N9KA 1BQCA 4GPNA 5AYIA 4M29A 4LYRA 4M80A 3FW6A 1DEDA 3VGDA 3TTYA 5I23A 3A22A 3L2MA 1NWRA 1QNQA 4UOJA 2CBIA 5DF0A 3RO8A 4NZJA 1JF5A 1E0WA 2VI0A 5E6ZA 4NZFA 3N15A 3W4RA 3ZSSA 2X1IA 3MS8A 2W91A 1JXKA 1EO7A 4PTMA 4TTGA 2A3BA 3WD4A 3GXFA 2Y8KA 1BSIA 4PTXA 2WCGA 1SFSA 4DWSC 2WM0A 3K8MA 4GINA 5CGTA 1W9BM 4JHOA 1F4HA 5E0FA 5CSYA 1E4IA 4AMWA 1HXJA 3VGHA 1CDGA 5I3DA 2PWGA 2ZXAA 1E6SM 1WZLA 1R86A 4RE2A 3ARYA 3WD1A 4PUDA 4ZE4A 4Z2IA 1TA3B 3VD4A 3O9NA 2CETA 1E6QM 1ZBCA 4PMYA 6A3HA 3U7VA 4UR9A 5GNXA 3IJ9A 6CGTA 3CHEA 1VEPA 5DFAA 2WW5A 3APGA 3WBEA 1NWUA 3OZOA 4HMDA 4UFKA 2YA0A 4PCTA 2VJXA 3AXIA 2BY1A 2F7QA 2VZTA 3WH5A 4BQ2A 3VDHA 1DWAM 3EJSA 1FHLA 1V3IA 1WDQA 2EABA 1BLIA 3UERA 4GZIA 4QP0A 3CZJA 1JYNA 2PWFA 1TUXA 4PMDA 3B9DA 1MFVA 4UZSA 1NWSA 2G4FA 2XM2A 4C7FA 2J74A 3TTQA 2Y8VA 4W8LA 3LRLA 2F18A 3CMGA 3LRMA 1ISZA 1WB0A 2CBUA 5A6BA 2XG9A 3KEHA 3B9AA 4CCCA 1QHPA 3ZT7A 2E40A 1XYFA 4CCDA 4HOXA 2YIHA 4U5IA 3KL5A 1ODZA 3LMYA 3AIQA 3VD5A 1CGUA 1DP0A 2CEQA 4FNUA 3L4YA 1PIGA 3AOFA 4QFUA 3IGUA 4AW7A 1RP9A 2VX6A 2JEPA 1HT6A 2XPKA 4QAWA 2WB5A 2O9OA 2X09A 4TOQA 2F1AA 3F5JA 5JIWA 3CGTA 3BVVA 1T0OA 1V03A 3QGVA 2W66A 1BF2A 1V6YA 4MJ4A 3SCVA 2CHOA 4JFVA 3WUFA 1OD0A 4P8XA 2FH8A 3I3BA 1QWNA 2CYGA 1F4AA 2OYMA 3OLIA 2GJXA 3FY1A 2MANA 3OIHA 2IXUA 3BAWA 2EBNA 1UQZA 5A6LA 2QMJA 2E3ZA 2GVYA 4J3TA 4NI3A 3AHXA 5A3HA 2CPUA 1R33A 2BV9A 2D0GA 4D6EA 1XH0A 2VTFA 2IGTA 2V5CA 4OGZA 2X8RA 1FP9A 3MKKA 4W87A 3PZVA 2X2JA 4RE4A 3NUKA 3DX3A 2ZUSA 4PMUA 4B3KA 4JL2A 3TTSA 1EOKA 1ZJBA 3BVWA 2OSYA 1GORA 3PZQA 3N11A 2VQTA 1W3LA 1E1EA 3BLKA 4OIFA 2DEPA 1UUQA 2D2OA 2DIEA 1W2PA 2WWCA 1J18A 1PJ9A 3PZTA 1VAHA 5A8NA 5FCZA 3TTOA 5HPOA 1PX8A 1GOOA 1VJSA 3U57A 3TONA 4UOZA 1KWGA 3N04A 1X6NA 1Q6EA 2ZUVA 3T0DA 3OZPA 2BXYA 3CBWA 4W7VA 3SCNA 2X2HA 3VSUA 4AMCA 4P7OA 1OGSA 5IFPA 1R34A 1UWUA 5BXRA 4Z2KA 1CEOA 2V3DA 1HIZA 3BAYA 3ALGA 1QBAA 3M46A 2CKRA 4RE3A 1GUVA 4HA4A 2PWDA 5EBAA 4B3LA 2OSXA 2XVNA 1CIUA 2VRKA 5LYRA 3WY2A 4HOZA 3NCOA 3CUFA 2C8NA 6TAAA 1ISXA 1EQCA 4ATDA 3H54A 4H8HA 1B2YA 4PSRA 3A3HA 5LA2A 4GQRA 2V3EA 5CLWA 3DX4A 4IISA 3A6OA 3N18A 3WQWA 4EK7A 2WSPA 1UG6A 4AIUA 3VIJA 4FMVA 1E72M 4L4PA 5CPSA 1UH2A 5A95A 4D6CA 2E9LA 3PZIA 2VCAA 1GHSA 1Q6DA 3WMSA 3WN6A 1V3HA 3II1A 4W8AA 1H4PA 3M7SA 2EPKX 2BHUA 2WVTA 1S46A 1WAWA 1DWGM 1BYAA 1G1YA 2ALWA 2OWXA 4NX0A 3VX0A 1XCXA 1MQRA 3WF2A 5A6SA 2W67A 4R27A 2YBUA 3WY1A 5D8ZA 3A47A 1QNSA 5CPTA 3UR7A 1CZ1A 1CXFA 4DWSB 4N0RA 5BROA 4ZENA 4PRWA 1HN1A 5CZKA 1LL7A 1O7AA 1BAGA 2F8QA 4D72A 4OJYA 1Y7VA 2VCCA 4MADA 4JKMA 3AISA 1G9HA 1GW1A 4PMQA 1B1YA 1UKTA 2WANA 2YL5A 4B9YA 5BYWA 5BWFA 2PWHA 5A6MA 3QR3A 1KWKA 3W0KA 3SURA 2OWWA 1EQPA 3POHA 5A6KA 2BVDA 3VIIA 2XN0A 5DEZA 4FNSA 2G41A 3VD3A 4PCSA 5A1AA 1OIMA 2XIIA 3ZJKA 1J9YA 4JAWA 5I0DA 2BHZA 8A3HA 1WCGA 3F5LA 1B9ZA 2GFTA 4AZBA 5A6BD 3JUGA 3ARUA 1JZ2A 2QPSA 4W85A 1NOWA 3H55A 1JZ8A 2G8ZA 2WZEA 2DPEA 4P8VA 5HBFA 1RD6A 2CBJA 2PF0A 5CSUA 2ZX7A 1E9LA 1V08A 3QHOA 3U5YA 1DWHM 4FK9A 2WMFA 4E8DA 1UA7A 1XD1A 3DDGA 2DT3A 5AY7A 4IPNB 5IDIA 3BVUA 2WZIA 3BSGA 2WNWA 2FDMA 2VR4A 1GONA 5FOOA 3GXMA 4UQCA 3WDIA 4FLRA 3M6DA 5JBEA 3W37A 4MNLA 4HZ8A 1UR4A 1OIFA 2D3LA 4AY1A 2WZHA 2FYVA 3LXBA 4D6HA 5A94A 1TG7A 2VT0A 2EXOA 1GPFA 4AD3A 4P7QA 1FOBA 3VGFA 2OYLA 2BNJA 2ZWZA 4HZ7A 3HN3A 1E6RA 4CU7A 2CITA 3MMWA 2VUYA 3PZNA 4B16A 4TUFA 4ACZB 2WKGA 2PI6A 1G5AA 3GXPA 3D52A 3RIKA 1H2JA 4PTVA 4PYSA 2FHFA 3MV01 1TQVA 7CGTA 3BAXA 1ITXA 1HKKA 4MB3A 4HOWA 1ESWA 3MUAA 4M81A 3DYPA 3VMNA 4FLQA 3BAJA 3VUPA 3VNYA 4D6JA 2VQUA 1GNXA 3WF4A 2BVTA 1PX4A 5D4YA 1QVBA 3BUIA 4GZEA 3EMQA 4AZCA 5DMYA 5BXPA 3ARPA 3EDDA 2F61A 1W9UA 1LJYA 1WZKA 3HU7A 3MUZ1 3BLPX 4AEEA 4IM4A 3VDCA 4H04A 1EIBA 2D1ZA 2YDRA 5D9MA 1TFVA 1QI4A 3BVTA 2HVMA 1PAMA 1JF6A 3BLBA 4D71A 2XGIA 4CGTA 4AWEA 2OW7A 4L4OA 3ARZA 3A4AA 1UR2A 1Q6CA 1RPKA 3RM4A 3ZM8A 3WUEA 1PS3A 1O7DC 3UR8A 5A69A 4NSBA 2YBTA 4A3HA 4CD7A 1BYBA 3SUWA 3FAXA 3OLEA 2D20A 2HISA 3VOCA 4V28A 1ISVA 3WH6A 3DECA 3T09A 2JEQA 1WDPA 3MUY1 1KXQA 1V6VA 4M24A 4NRSA 3VIOA 1EH9A 3DHPA 1Z32X 3ZIZA 2DT1A 4JCLA 2J7FA 2EJ1A 1LQ0A 1UASA 4MAZA 1AQ0A 3UEQA 3KZSA 1E3ZA 4UZUA 1UD3A 4QLJA 5BXTA 4PMXA 3TOPA 2WMIA 4J3XA 1SZNA 2J7CA 1R87A 4TVUA 4UQEA 2XHYA 4DUWA 5I79A 4HU0A 3SIMA 3A4XA 3IJ8A 4BQ4A 4D6DA 4XV0A 1JDCA 4BS0A 3ZR6A 4CD8A 1OCQA 4ZXOA 1GVIA 1M03A 1M01A 2WAGA 3N12A 2W4XA 1YHTA 5FKYA 1EDTA 3A24A 3ARXA 4ZEPA 3DC0A 2G3MA 3EYPA 2XIBA 1LWHA 1W91A 3B9EA 4AZIA 4QLKA 3K4AA 1E4LA 2WLYA 1J0HA 1HL9A 2EACA 1D2KA 2DT2A 5ABHA 1C8QA 2CESA 4R5EA 2X0HA 3OGRA 4W7WA 1Q6FA 2UY5A 1FFRA 2D23A 1PEZA 2CXGA 4JL1A 4KGJA 2VZVA 4W7UA 1VF8A 3WQ4A 3ZJ7A 1VRXA 5I5RA 4KMQA 2ESCA 3WSUA 2WWDA 1R7OA 3VNZA 4UQBA 3SCQA 1OBAA 3W26A 1MXDA 4IPLA 2XYLA 1GJUA 1D3CA 4BZYA 1HKIA 3N17A 4ZFMA 7TAAA 4FF5A 4J3WA 4NXKA 1KR0A 3HG3A 2EQDA 1ECEA 3F4VA 1XH2A 1XC6A 1B3XA 1V0KA 4QCFA 4WSJA 5A8QA 2C0HA 3FHAA 1XD0A 3S2CA 4UFHA 3FXYA 5I78A 4WIWA 3SUUA 3KL3A 1PZ3A 1X1NA 2YA2A 4UQ9A 1UZ1A 1RP8A 5CGMA 1PX3A 3RM8A 2WLZA 4E4PA 1MXGA 3ZJ8A 5E9AA 3BH4A 3OB8A 2JIEA 2CCRA 1HTYA 1AQMA 3H53A 3I3DA 3SCSA 4BA0A 4C7DA 5FD0A 5HOSA 3SCPA 1O6IA 2WXDM 2YOCA 1K6AA 3ARWA 2IXVA 1KTBA 1U30A 1ZB5A 1GJWA 3CUHA 4DO5A 2ZXBA 1CECA 3BSHA 3WNLA 1GCYA 3CH9A 3D3AA 3OGSA 2WVUA 1JG9A 2W92A 2XN2A 4LGXA 4W86A 5AYBA 2J8GA 1R47A 3D51A 3D5HA 2BXZA 1KQYA 2YLAA 3S6TA 5IFTA 2AMGA 4KH2A 4F66A 4JFTA 4MB4A 3ECQA 3T0AA 4Q22A 4M82A 4PMOA 3DDFA 3EBVA 1EDQA 4TX8A 3A23A 1CGVA 4J27A 3CO4A 1C7TA 1VENA 3THDA 4CVWA 3GH4A 1OSEA 1E6NA 1H41A 5JUVA 3A4WA 4YN5A 2XVGA 5M03A 2W61A 2RGMA 1C8YA 3PZOA 2O92A 4OBRA 2XWDA 1HP5A 4MPKA 4GIAA 3FAWA 4JZ5A 5C8BB 1NWTA 3RPMA 4X0NA 1E0VA 1GHRA 3EJQA 2WBKA 3WELA 5A2AA 3HMCA 1UQYA 4KWUA 3SUTA 1UH4A 4J3SA 1ISYA 1GOMA 1B30A 5TD4A 1YQ2A 3WQ5A 2VZOA 3VSVA 1UD6A 5IHSA 4M8UA 4CU6A 2WHKA 2BHYA 3MMUA 3GXTA 1NOUA 3CHFA 2VVSA 2WC4A 2VOTA 1CXKA 4EE9A 3VD9A 4GXPA 3WNOA 2J4GA 1WZMA 3TP4A 1TCMA 3K8LA 3KL0A 2GJXB 1QPKA 1VJZA 5CQ1A 1HKMA 1JYVA 2DSUA 4Z2GA 1CLVA 1U33A 2J7HA 4YHGA 2DH3A 3L4XA 3CZEA 3VSTA 4PMZA 3WBAA 1C92A 4W89A 4PMNA 2JF7A 4JFUA 3T0BA 1E55A 7A3HA 1ZBWA 1XGZA 2XFRA 1V0NA 4GO9A 2J62A 2WMHA 3U5UA 3UCQA 1E6XM 3WEOA 2FE0A 1HJVA 5CG0A 2G3JA 1W3KA 8CGTA 4D6IA 3MMDA 3WH7A 1GOQA 1ZJAA 1JD7A 3WH9A 4PMVA 2BY0A 5I24A 3SEPA 3K1DA 4UQAA 2BFGA 1KQZA 4PMRA 5HPCA 3AMCA 2YLLA 1KBBA 3GTNA 5HNNA 2W5FA 1LLOA 2X2IA 1XV8A 3HG5A 5C70A 2D22A 1E71M 4CN4A 1TZ7A 2Y4SA 4HA3A 2WMKA 4OBSA 2AAAA 1VFFA 3VVGA 3ZSTA 1ISWA 1GQIA 1V6WA 2UY2A 3BUBA 2J7DA 3W81A 1B3ZA 9CGTA 3CMJA 1C7SA 5GPRA 2JIWA 3TV8A 3VDAA 2G3IA 2ZUWA 1FHDA 4FNQA 5GNYA 1KR1A 2TAAA 1XYZA 4LPCA 4UQDA 3L4ZA 3CV5A 1JDAA 3AS3A 1HX0A 1V3KA 2V5DA 4N42A 2VX4A 2ZX9A 3WENA 3NSMA 4WF7A 4OZOA 2E0PA 1FH9A 1KTCA 2X05A 3IJ7A 4W5UA 3L4VA 1EGZA 3AIUA 2ZE0A 2NSXA 1QNPA 4AD0A 2J7EA 1UHVA 2VZSA 4AD1A 3MU7A 1JIBA 1ZBKA 1E56A 2DSVA 4XZBA 3VGBA 2DSKA 4A4AA 3CZNA 1HXKA 1ZS2A 4OKDA 1NP2A 5EFDA 2Z1SA 4LQ1A 3EJUA 3W82A 1QI5A 3DHUA 3AROA 3AZSA 3PZGA 2XJ7A 1CGWA 1KGUA 4J7RA 3PTQA 1QOXA 2FH6A 2DH2A 5GQBA 2J78A 4AIEA 4TVDA 4LX4A 2F1BA 3WFZA 2RGLA 1VEMA 1B31A 1U2YA 2V3GA 3WD2A 3NIYA 1WDSA 2EPLX 2VX5A 1KB3A 1XSJA 1UZ4A 3QOMA 1QW9A 1I1WA 3WDRA 1CGYA 1J10A 1CBGA 1M04A 3PZMA 1V6UA 1VIWA 3O2LA 1I75A 2A3AA 3CZKA 5BXSA 5A6AA 3WMCA 5D8WA 2GDVA 3CZLA 4JCMA 1QNRA 5EB8A 1MW3A 2DSWA 4LXFA 2B31A 3NDZA 2WPGA 4CN6A 2DQXA 2WK2A 3BUPA 1A3HA 4HPHA 2EEXA 2CERA 1KGXA 1KCLA 4M56A 1NH6A 5AC5A 3W38A 4GI8A 4H41A 3AYRA 2ZUUA 3LXCA 4MJ2A 4LYQA 3T2PA 1ZBVA 2GUYA 4DM1A 1W9DM 3L4WA 4MNJA 4DUVA 3WD3A 1ZU8A 2QF8A 4CD6A 3GNPA 4YPJA 4GQQA 1W1TA 3VTRA 2EO7A 2XVLA 3N1AA 3UESA 4HP5A 1H49A 4UOQA 4TX6A 5I6SA 3HG4A 1CPUA 2FGZA 2EPMX 2Y2WA 2UY3A 3OG2A 4HA1A 1DWIM 1JYXA 3EJTA 1E43A 4BQ3A 1JL8A 2Q8XA 2VR5A 1US3A 2ZIDA 2V38A 3NYDA 2A3CA 3K8KA 3BMWA 3DX1A 3VIMA 3IAQA 3PHAA 3RJYA 2C7FA 2GJPA 4B15A 3CZ8A 5EMYA 4PN2A 2WCAA 3WH8A 3AIRA 2DDXA 2J7BA 4V2XA 2XTKA 3WUBA 1BHGA 3WIJA 5A8MA 4MNKA 4NRRA 2BY2A 3W53A 1UKPA 2GK1A 3AYSA 4ACYA 5C71A 2WCSA 2E4TA 3ZOAA 3L4TA 1V3MA 3K4DA 1EA9C 1KBKA 3B8SA 3OLGA 2XFYA 4YHEA 1GZJA 1K9FA 4U3AA 1B3WA 4AZ7A 1CXLA 1GVYA 2WVVA 4ATWA 4M1RA 3CHDA 3ZJ6A 1WO2A 3VIGA 5FL1A 3EJRA 2VCBA 3AQUA 1VBRA 1X6LA 3AIVA 3AICA 3WFLA 1K9TA 3EDKA 4JIEA 1JDDA 4Z2HA 4AMXA 2CBVA 5ABFA 1XH1A 2NT1A 3BUQA 4HMEA 2CHNA 1J0IA 1UKSA 5IXEA 1A47A 3GM8A 1HJSA 3AHZA 3HG2A 1EHAA 3MI6A 4AZCB 4AZ6A 1UKQA 2QV4A 1L0PA 2F7OA 4WJXA 1CTNA 2ZUMA 2CIPA 2D73A 1TQWA 3LX9A 1NARA 2QLYA 4A3YA 3CPUA 1JZ7A 1V02A 4AC1X 3MANA 3KLLA 3VIKA 5KEZA 4PTWA 4OOUA 2ZUNA 2YA1A 1EDGA 4D1JA 1RH9A 1JNEA 1UYQA 5D9NA 1KXHA 2VC9A 2XN1A 2D0HA 3AI0A 3A5VA 4GO8A 3WEMA 3VGGA 4C7GA 1E6PA 3VX1A 1UR1A 1OGBA 4OOZA 2XM1A 1AMYA 1UA3A 1PZ2A 1QWUA 3WQ8A 4JKKA 2E9BA 5EFFA 2D24A 3PZUA 2YL9A 4U2YA 1J01A 1H1NA 3AMGA 3WF1A 4HPGA 1IZJA 1W9PA 1JD9A 5ABEA 1MW2A 3PTKA 4AD5A 3CUIA 1TVPA 1AQHA 3VM7A 1B0IA 1VFOA 4AD4A 2WMJA 3BVXA 2W62A 5JBDA 1OINA 4EKJA 1R75A 4J3UA 4PBGA 1UKOA 3AS2A 4RL3A 2PB1A 1QI3A 3KLKA 4W84A 1FFQA 3BC9A 4WLCA 3PBGA 3EDFA 3O6AA 3AIEA 2WMIB 1UOKA 1QHZA 4FLSA 1C93A 3ARQA 4HU8A 3N13A 3WMBA 2F7RA 1JZ6A 1TQSA 1W1PA 3VMPA 1UD5A 2VMFA 1GQJA 3IAPA 2OWCA 4ZXLA 1QI0A 3LPFA 4U2ZA 2WHLA 3OLDA 3VIPA 3VIFA 3ARSA 4AZGA 3WDQA 2F2HA 1ODUA 1TA3A 3PZ9A 2EPOA 3MUIA 3OGVA 1WKYA 1UWSA 3ALFA 2VNCA 4AIOA 1SMAA 1UD8A 3M07A 2E8YA 4TTUA 5BRPA 3CLWA 4J28A 3RJXA 3WEZA 3AZRA 3D4ZA 1JAKA 2UY4A 1BTCA 5CXPA 2VX7A 1ZL1A 2EPNA 3OA5A 1QNOA 3CHCA 1HJUA 3RM9A 1E15A 3EDEA 1V02E 2E8ZA 1JZ3A 4CKQA 3NSXA 4GKLA 1H0GA 1UR0A 1FH7A 5M17A 1E1FA 1OWQA 1W1VA 4AD2A 3RDKA 3WL1A 3BAKA 2YFOA 4H2CA 1P6WA 2XSAA 3G6LA 2V3FA 3BAIA 1CGXA 4BCEA 1J0YA 5FIPA 2J75A 2WYSA 1CYGA 3QOKA 4UFMA 3EMZA 3ZO9A 1UH3A 5CPQA 3VD7A 3NSNA 3BCDA 1GQLA 2BS9A 5D9OA 3WQVA 1VFUA 3DYMA 3KWXA 3VIHA 4CCEA 5CJ5A 3FN9A 4CD4A 1UWRA 5E6YA 3LPPA 1IZKA 4TXEA 1LL6A 1DTUA 3W29A 5A6JA 1G0CA 5LA1A 4UFJA 1TQTA 4X0VA 2CNCA 4W5ZA 4LYPA 3PN8A 3IK2A 1HVQA 1C90A 2BVYA 1XCWA 3QHNA 1DWFM 5A8PA 3DX2A 2FHBA 3WF0A 1JI2A 1GOWA 2IUZA 1MQPA 1EO5A 3AS1A 4WKAA 2YDQA 1BPLB 4JFWA 3GXNA 3SCRA 2ZXQA 1PBGA 2JALA 3I3EA 1WPCA 1KXTA 1UR9A 4Q7NA 5F7UA 4CD5A 3WY3A 3CZSA 3WD0A 2ZX6A 1UR8A 4MNMA 1HJWA 3VDBA 2DIJA 4UFIA 2E9MA 3W24A 1R8LA 2NW0A 3ZMRA 4W8BA 5E09A 5JBFA 1W3JA 1CLXA 2WC7A 1M7XA 3CIVA 2VZUA 3AMKA 1E5JA 3MO4A 3AHYA 3VKKA 1CNVA 2DGAA 3ARRA 2O9TA 4AISA 3HZ3A 1J0JA 3EDJA 3VGEA 2J8FA 2PBOA 4H8VA 1NP0A 1WNOA 4AZ5A 1OB0A 3SCWA 5JIPA 1UWTA 3SCTA 2PC8A 1CXIA 2OYKA 1MW0A 5I77A 3W6MA 3WDPP 3EJPA 1CWYA 4P7LA 4BQ5A 4URIA 5DT5A 3UG5A 1XHGA 2VRQA 2YDSA 3WDJA 1E3XA 1C8XA 4ML4A 1R85A 3A21A 5HXMA 2XUCA 1LL4A 1SMDA 5KZ6A 1UWIA 1HP4A 4U33A 4P7RA 1NQ6A 2BY3A 1BYDA 1HJQA 3W28A 3DX0A 1TQUA 3RCNA 2O9PA 5BRQA 4HMCA 1CXHA 1FA2A 3NDYA 2EAEA 1TVNA 4JHZA 4IUGA 3WNKA 1E0XA 4GI9A 1FH8A 2J7GA 5HDRA 4J3VA 1ITCA 4S3KA 1B90A 1W2VA 1BGAA 1C91A 3GXIA 3ARVA 2J25A 1W32A 3CZGA 3LPOA 2ZOXA 2YL6A 1BYCA 5CLTA 3AHTA 1H5VA 4TVCA 3GBEA 5A2CA 5FL0A 5E1QA 3VPLA 3T2OA 3VINA 2OLHA 4V27A 1V3LA 2WKLA 1QW8A 4D6GA 4W93A 3BGAA 4AEFA 2WBGA 2Y24A 3U7BA 1V3JA 3FNDA 4WKFA 1H3GA 1G94A 2UWFA 3BUDA 1HJXA 1DHKA 1WZAA 1JXJA 3WL0A 2WSKA 1L8NA 1W9XA 2ZICA 1EXPA 1FP8A 2D3NA 4GI6A 1KFWA 1C3FA 1B3VA 4NXSA 3VU2A 4NZCA 1XSIA 4UNIA 3WUGA 3GYCA 4JFSA 4XZWA 4P8UA 4XUYA 2ZXDA 1VB9A 4QDMA 2F7PA 3QHMA 4DWSA 1KGWA 4OUEA 1GOIA 3AS0A 4NF7A 3W25A 2JE8A 2YL8A 3AMDA 1MQQA 1VBUA 1E70M 3PTMA 3CTTA 1I1XA 4FNPA 1WP6A 4MB5A 3GNRA 4UCFA 1W1YA 1Q4NX 4FNRA 1WDRA 2FHCA 2YKKA 2ZUTA 1HL8A 3W6LA 3T2QA 3WQ6A 1HNYA 2PWEA 2VURA 3UETA 1LG2A 1SR0A 4ZE5A 4CVUA 2WVSA 3MSGA 1JZ4A 1MVYA 4PUEA 4FNTA 3ARTA 4JKLA 3AMLA 4F9JA 2X2YA 3IANA 1IV8A 3KE0A 3D50A 3GBDA 4F8XA 1LF1A 3J7HA 3WNNA 3GNOA 4XX6A 3T08A 3VM5A 1QBBA 2Y5EA 3THCA 1K9EA 3WF3A 3L2LA 3BCFA 4B9ZA 1E40A 2OW6A 1XRVA 4EANA 1MW1A 5A2BA 3RILA 2YJQA 4CN1A 4K68A 3S5ZA 1CENA 3AJ7A 1G01A 1VFMA 1TMQA 4WKHA 1TR1A 5ECUA 3ZR5A 1R46A 4PEEA 4P7NA 4Z2LA 1NM9A 1GQKA 4D1IA 4WK9A 3GXDA 1TE1A 3OBAA 1E4NA 3AIBA 1LWJA 4E8CA 1J0ZA 2DSZA 1JFXA 2QHAA 3F5KA 4PSPA 2J79A 1UWQA 2GDUA 1W9VA 1CGTA 3WNMA 1VEOA 1AVAA 1QHOA 3WDHA 1PIFA 1N82A 1WE5A 2W63A 3E1F1 3TA9A 5AC4A 2Z1KA 3LPGA 2A3EA 5DT7A 3DYOA 4ACZA 1UD2A 2ZWYA 3LRKA 2GSJA 4UTFA 2WHJA 1OGGA 4EAMA 1XSKA 4AYGA 1KXVA 4AXNA 2JF6A 1Q6GA
chains in the Genus database with same CATH superfamily
3GIZL 3BZJA 4G6AC 4AGQA 1LO0H 1T03L 4DOHE 3CLEL 1KTLB 4KEZA 4JPIA 3ZE2F 3DPBB 1KBPA 4AQZA 4RZ4A 2XH4A 4F33A 1KN2L 1CXEA 4G70B 2O9RA 1BG4A 4GJJA 1A4KA 2XU9A 3KG5A 5C08D 4Y7EA 2PBGA 2WHMA 1ZNNA 4HAKA 2YPLD 4WFFD 2R0WL 3HI6L 3CVCA 3C8NA 4E2OA 1MDRA 2E76C 2VL4A 3X1NA 3UJRA 4KK6D 4TIMA 4HISA 1PZSA 2XTLA 2QPUA 1VPOL 1E73M 2MQGA 3AHVA 4M8QB 3ES6B 4J1UB 4GRWE 4QRQB 4DJEC 3G0XA 4JFEE 2J8UA 1GHFH 1MYRA 2EDRA 4ATLA 2Y5JA 5C8JA 2ICES 4Y8FA 1ERNA 1DQIA 4N0FA 1UC6A 5MF5A 3HOGA 1IE5A 4BGLA 1QOKA 4W88A 2BW4A 3E5BA 2VDMH 2GQ3A 4AZ8B 1BVNP 4EI5B 5IOKA 1UPMB 3UJIL 2XWEA 4Y19B 3GG0A 4KNQA 4G6FD 2QADB 3B2UC 2XSXA 3UG4A 2UYLB 2VVNA 4LB4A 4LGRB 1OZQA 3WX7A 1D7CA 2ITCB 4JKWA 1NFIA 1T41A 3P6LA 2DW7A 1XQ4A 2O6FA 5ANHA 1KFCA 3PLYA 1NWRA 3TBWB 1X5HA 2K4WA 1N67A 4R2GC 4NZFA 3HB9A 3BURA 4GW4A 1FE8L 4RX4D 2ZTBA 1HH6B 2J88A 4S1SH 3CEUA 1DDTA 2IG2H 1A4JB 4XHJC 4ANWA 4GINA 4M7ZC 4JPGA 3NA4A 5AVRB 3G6AB 4AMWA 4EDWH 2JQXA 2DEXX 1KMGA 2PRMA 1EUTA 3HCVB 5IF0B 4XAFA 4OGYH 1XLGA 4Z2IA 3HS0A 5GNXA 2Z91B 3WBEA 2BNUA 5JQHC 1BOGA 2VJXA 4O17A 4UT7H 4MAYD 3ULVL 3WH5A 1KXQE 3KPTA 5L2JB 3URQA 3U82B 1SFJA 1MIML 3VNIA 3B9DA 1FJ1B 4N8CL 4OZGF 4I85A 2H45A 1I45A 4C7FA 4ZCWA 4G6CA 3C6SA 2OT1A 1WB0A 2NMSA 2HPIA 2GQ8A 4CCCA 3U0TA 5K9QG 3Q0HA 4CCDA 4X6FA 4U5IA 4O13A 1NCWL 5IMLA 3VD5A 2FB4L 4PJ9C 1NGQL 4WY0A 1MDLA 3ABQA 5T3ZL 4JFZL 3BHBA 3NN8A 1IBFA 3NOEA 4X5XA 3UC0L 4DVRH 5HYEA 4DN4L 3JTTA 1N8FA 4P9ML 2DQTH 3Q2VA 3MRLB 2PPEA 1ZLEA 1C16B 3V0IA 1TJGL 2B20A 2OXHB 5A6LA 5KSAD 5C07B 1SW3A 2A85A 2V5TA 2GKIA 4N2NA 2FO4B 2D0GA 2ZZ5A 1AGDA 1QBLH 1JCVA 3PZVA 4P2OB 3RHWF 1DBML 3MSYA 3B9NA 3CVIL 4M8RA 2OSYA 1GORA 3PZQA 5DXYA 3BKJH 3RLVA 5FJPA 4JM2B 3TESA 1QABA 4G6KL 3MLSL 3W76A 3PE9A 4A35A 1BAWA 1M9WA 4ADUA 1OZMA 3FJ4A 3LDVA 1LLAA 4EOWL 3VXQB 3ARBB 3EJZD 4I0PA 4X6BB 1NFDA 2DTSA 2XKSA 2VR8A 3EFOA 1O9VA 3QJFA 4XI5C 3OZPA 4JQVC 5GRYA 1PD6A 2FJFA 3D0VA 4AKOA 1OGSA 1OCOB 1R34A 1NC2A 4MD4B 4OFPA 1RH8A 2O5ZL 4F7EB 2OTWA 2EH7H 3HE7A 3M46A 2C19A 4AVKA 1P6FA 2OB3A 5EBAA 2OULB 4FADA 4J1OA 4FTVA 2CWXA 3GNDA 1P7QD 4NIRA 1F1GA 1Q6QA 2RBLA 5ISZA 1X5KA 4GJ1A 1YEKL 4KW2A 3QHZH 3PP3K 3DHFA 5JYLA 2NTFA 1D2PA 4LOEA 1YRRA 3MOAH 4F57H 5A95A 1TVHB 4MZYA 1UM6H 3QPEA 5AWNL 3BH8B 4DBEA 5C0IA 2VDLH 3TR9A 3QFDA 4WZHA 3R19A 4DXVA 4PY7B 2GSMB 1XCXA 3S46A 9XIMA 1GMEA 2EZ0D 2XDHA 1FWGC 1X8FA 1BZDA 3IPFA 3IFPA 3WQGA 3P14A 4WWKA 4OJYA 3MXWL 3X11B 5FK9A 1E8XA 3QYNA 5GGSA 5DC2A 2BASA 2X4RA 2RDTA 4FL4B 4AB4A 4GG6A 4MPQA 4HIJB 1LLWA 4LANA 2VLJA 5DS8A 4NI8A 3IU3A 5T91A 1EF2A 4B97A 4LF1A 2XN0A 1JGVH 1NEZA 4Z76A 2X1RA 4QXTB 2XFXB 3UO1L 4ELKB 3DV6A 2WNKA 4TNGA 4Q9RH 3IRPX 4ZS6D 1W5MA 4S1FA 4NKIH 3PB2A 1SN5A 3N2TA 3C2VA 4OLZH 1J2WA 1DCLA 5IDIA 2Z2AA 3DUGA 5TQ2H 2AK4E 1A53A 3GXMA 4K23H 1T99A 3R0KA 3MUGB 4Y9AA 2D3LA 3TIEB 3FVDA 4M62H 3FO0H 2CZVA 3MRNB 1PKQE 3APYA 3MV9E 2C4FT 1RJLB 2WB1A 2NWSA 1FVCA 1M68A 1QMLA 2VC2H 5ICZA 1HXYB 1D9KC 4WEUD 1HKKA 3BFWA 4HOWA 2WLNA 1ESWA 4KFMA 3VMNA 3D18B 3VNYA 1Y0EA 2Z6JA 2IAMB 5CD5D 4OFVA 1RERA 1N7KA 2FJUB 3QFEA 1AQDB 2MH4A 3QF0A 1D9EA 4FG6C 2P48B 3VDCA 1MOEA 3FQWB 1UWEH 5GRJH 4XVTH 3RVUC 3S3GA 3P8JA 1AQ8A 3BLBA 4I8YA 3C6CA 1ZA6A 3ARZA 5D4QA 3IDYC 2LU4A 1ORQB 1D5IH 3NO1A 1KLUA 1XIFA 3UR8A 5EA0H 5IR1A 3PGCB 4DIXA 4PV8A 3UD6A 3VNJA 3G5XA 4YSQA 4H9ZA 4MMYB 1GW9A 4U0QB 4V1DD 1N2RA 3FF8A 4AY7A 2EJ1A 1PZ0A 2EVFA 1UASA 3ML8A 4UQ3A 4PCYA 1MG3C 1SJMA 5AAWA 3DRQB 4IU2A 3GEWB 5TH2B 5B7FA 3RGVB 1JPHA 3FB8B 3LSCA 3LI0A 3LN9A 4LT7A 4CQBA 1ZLUH 2G5BA 3EOAB 3ZMNA 4KUZH 4E9RA 2NOYA 1SZRA 1KZQA 2EACA 1GMIA 1QVOA 4JL1A 1R2RA 5I5RA 2D03L 2K7PA 5MKGA 2YYTA 3FH5A 3O6MH 1H5BB 1TVLA 3UYRL 1MRDH 2Q3AA 3IJSB 4APQA 4H7ZA 3ZW3A 2FNWA 4NS0A 2VR9A 3W70A 4YEFA 1ACYL 5A16B 1KR0A 3HG3A 3F4VA 4ZX6A 3LH2L 2XH0A 1IL1A 4EP8C 2C0HA 3S2CA 4HK0B 2X1SA 4NUWA 4X0KA 2WZ6A 5FGBA 4KKCD 4OLXL 5CMAB 4YJZL 2A4CA 4PGEB 5EH1A 1R6VA 3I2CH 4G1NA 3CFEA 1G7QB 4PJ5D 1PLCA 3EYFB 4XCFH 3VA2C 4WGVB 3BWUF 1GJWA 1XCFA 2GSHA 1F90H 1MJ7H 1F00I 4LGXA 5CHNB 2DQDL 4K8RL 5ITFB 1F45A 1N9PA 3V0WL 1UCBL 1N18A 4HT1L 4FKHA 3CDCA 5F72S 2CZDA 2EC9T 3CO4A 5EOTB 4MCZA 4L18A 4I1RA 4ACTA 4E42A 4H6EA 4IGHA 3P67A 4WWOA 3A4WA 4DW2H 2XZQH 3N1FC 3LCLA 3U1PA 3NL2A 1KLFB 2DZXA 2O92A 1AL8A 2GEQA 4JZ5A 1TDQA 6FABL 1NWTA 4KKBC 1Q72L 3C2RA 1RIUL 2FQEA 3D4CA 3EH1A 3THMH 5LAPA 5H2ZA 1HO4A 4PS3A 5LXEA 4K3HA 1BEUA 1UJPA 3MO1B 3R79A 2NXYB 4NYUA 1WZMA 3RTQD 3KL0A 4G7SB 1CO1A 4WI3A 4WNJA 2NLJA 3V1PA 5CIPA 4OLVL 4G8IA 2DDQH 1D8WA 4OCYH 3W87A 2Z4QA 1M7IB 2HFEB 5D8JH 4AXWB 4KQ4L 4RSYA 3QBTB 1GGYA 1Y1UA 2IANB 1KBLA 4NOBA 3M86A 1ICPA 3AT0A 1IT8A 4Y5YC 4E9WA 3SJNA 1FNAA 5D6DA 1VFAA 4QF1A 5CBEB 4KH9A 2ENJA 5GJSH 4FP8L 4HYRA 1RSFA 1A3LL 3ESUF 3HC0B 2AAAA 1VFFA 2VDNH 3GHBL 2FQDA 1EBPA 4ZSUA 5AALA 3NRPA 4I18A 3TPUA 4YZFF 4G3YH 3PS6A 3MJWA 2MOQA 1XYBA 5I09A 4X5RA 1H3TA 2XWJB 2R1NA 3P61A 2Z6FA 5EU4B 3I7QA 5T1JA 4KKNA 2X05A 5HHMD 4FKEA 4QO1A 2Q8LA 2APXA 1UHVA 4KKLC 5DQJB 5FW6A 1W1A1 4M6NL 1VYPX 1E5YA 1T4KB 5GQBA 3E0LA 2R69A 2DW5A 2HCZX 5K93A 1XSJA 1ZAJA 3SDAB 4M7KH 4XB7A 1UYWH 1S2TA 4RNJA 4WRLA 2YD5A 2CDEA 2CLVA 3DKHA 3WMCA 4IMAA 5DVOA 3RWJB 4X83A 5CEYB 2P4AB 1ZLWK 2DSWA 3BN3B 3W00A 2EEXA 1KGXA 3MLVH 4Z7AA 1NH6A 1RUSA 2Y5QA 3M1OA 4WDXA 2J88L 3TYEA 3O9WD 1HINL 1S7QA 1XPGA 2V7HB 3GNPA 4E9QA 4ZUTA 4ZOAA 3IUDA 5E2UH 5DMIH 4DKDC 4HP5A 4NCC1 4AMKH 2EE6A 2B2XL 4GK8A 5I8OL 3HRZA 3JTSB 3QRGH 5K39A 3OWEA 1BV8A 4G8GD 1GEQA 3ME3A 5AVSB 3B2MA 4UV4H 2H26B 1VZWA 4WUUE 2R56L 5DJAB 5DRZB 2YUZA 4RISL 2O61B 2AJXL 1PKLA 2WQAA 1OCJA 3FDWA 1P7TB 4UT9A 2UZ9A 5M7QA 2GTWA 3LV3B 5I5JA 5F3BB 1Y65A 1ELSA 3MRFB 2I5IA 4RZ6A 1CXLA 3QDJD 4M1RA 3Q2CA 5A2IH 2GJ6E 3UFIA 3EDKA 3SGJA 3OAYH 4PGCA 3L5XL 3V52L 2QDWA 1RCXB 4WUKH 3OPUA 1J4EA 2F15A 3DHJA 4PJBB 4RGNC 1BBJB 1L0PA 4F80A 3VXTB 1SGKA 2VR6A 2ADGA 2YRBA 3HFTA 5DHVH 5DJ6A 3WUZA 4PTWA 4MY1A 1G7IB 4DZ8A 2VC9A 1FI8C 1NGZA 2JF1A 4LCCC 3WEMA 4RNRA 2H2PC 4P57A 4JHVA 1YMHA 1LILA 1S7VB 5E51A 4I6VA 1DSYA 3I68A 4F0RA 3JWNC 2XNAB 3VTAA 1RUKL 5F89A 3N6JA 1XZWA 1VFSA 4RL3A 1Y0LB 1FFQA 4Z78A 2PW2A 2EP6A 2BWDA 3SSZA 4HS6A 1AXTL 1RCYA 3RCYA 3FFDA 4LL9A 4U49A 1UOLA 3TJEL 1JPST 5I1JL 2VL5B 5JORA 3NA9H 4OZFG 4TULH 4X8JB 1WKYA 2CLPA 2V2XB 4CC0A 4Y4HD 3UZQB 3HLKA 2QVHA 2NXGA 4N0YL 1FO0A 3UTZA 3BE1H 4Z1YA 5F0LB 1V02E 2E8ZA 1VCBC 2FQGA 5D4IA 1BZ7B 4AD2A 4UB9A 2RQEA 4YGVB 3BAEL 2XSAA 4UZGA 4KX9A 4QXUH 5FIPA 2Q1EA 3LSOB 2DMCA 4OJDH 1IEWA 4HU3A 5FF0A 2RJMA 4I48A 5AW9B 2BWIA 1VFUA 2BVPB 1YLBB 3UXLA 2CJUH 1A5FH 4P2QB 4BK5C 4HPOH 2GGJA 4HIEA 4XTRC 3OF6D 5K9OB 3WQFA 4HU4A 1A4AA 2HH0L 3WF0A 3P69A 4FDWA 4GRWF 1VDGA 1EO5A 2EILB 2G75A 3CBRA 2PLCA 3RJDA 3GXNA 5ALBL 3V5KB 3ROOB 3HNTL 4KOBA 3O3BA 1E6OH 3U4AA 4F2MB 2ARJB 2WXGA 5HNTA 1I8KB 2OMYA 3VDBA 3LKRB 4F92B 5IMLB 3MU3A 4P2RA 2A3TA 3I50L 1J9TA 3LB6C 3TVMB 1QSFD 1BAFH 3KPSA 3MO4A 4YBLB 3SKMB 1DQTA 3HPJB 3FO9B 4PUJA 3I6LE 1XQKA 1XM3A 4N2IA 3SCWA 4HG4J 4H9TA 1TTPA 2OOFA 2IH3B 3B9KB 3DFHA 5JUEH 1R0AL 2Z65C 2JKNA 4HSCX 1S9VB 2YDSA 2W60A 1E3XA 1C8XA 1IKOP 4ML4A 2AK1L 1FH2A 5HXMA 2VWEE 5TQ0L 4WHDA 4KJQD 1H8NA 2L04A 4DSYA 1FA2A 2C7UA 3L3KB 2E59A 1KDIA 5DXXA 4OI8A 3WSQL 1G9ML 5D1ZA 1BKHA 4JGNA 5HDRA 1ITCA 2J25A 2DVUA 4XBPB 4YS1A 1NGXA 1UZ6E 5LVEA 3NSFA 3LN5A 2ZF9A 2UZYA 5E1QA 5DZLA 5D2LF 1HCZA 1V3LA 3DN5A 1IT9H 3CB3A 5FFLA 4K36A 1F3DJ 1JXJA 2XG5B 4CNTA 3BZFA 3BFOA 1OAYH 1VADA 4NXSA 1XSIA 3WLQA 2Z31B 2JJSA 3JT2A 2FX7H 2F7PA 3DVIA 3LYEA 1KGWA 3IARA 1SO4A 2ZWNA 2TSBA 4PY8I 3S3PA 5IJBC 3UPMA 1A9EA 5J4MA 4LPXA 5CCJA 3G5WA 3EPMA 1M6UA 4FXSA 3V4UH 2VURA 5GRUH 4Z0XB 4N9DA 4PUEA 1IAII 2KBGA 3B4UA 3QUMA 3CIWA 1FDJA 3CFDB 2W0UA 3SCMA 3ROLA 5AKQA 1YEJL 1XLKA 3L2LA 4B9ZA 1OB1B 4LVGA 2PP3A 4W1TA 1UB6B 2A1WH 4DP0X 5A2BA 1B3OA 4KHXL 3S5ZA 5BV7H 5C6PB 1R46A 3MBFA 3HUJB 4I0CC 4JIHA 2MKWA 4OJFH 3SYPA 3VOJA 3JV6B 1KNOB 3QA3A 1W9VA 2N7AA 4OFKA 3W1PA 3VUSA 4LPTA 1I9EA 4PJDB 3W7CA 3HS0C 4GG8A 3TA9A 2A3EA 2QKSA 3E2HB 2AJVL 3L5IA 3FUEA 3V6FA 3QM3A 2VN4A 4MAVA 3L9RA 5D9PA 5IW1B 4NJGA 5HGHB 3H4GA 3WK3A 2WXFA 1E7VA 4FHJA 4XPGH 1G7MA 4UAHA 4B9PA 5KBKA 5G5IA 4BD4A 4WY7H 2CZ5A 4LY4A 2REQA 1YEFL 1YEWA 1OGAD 3FQRB 4KQNA 3I10A 1H6UA 4L3CB 4DFHA 3D4YA 3NZPA 3Q6FA 3S98A 1VHNA 2UY6A 1W8EA 4P46D 3BP7B 2H3KA 4HCRL 1CDJA 1IIGA 3QXDB 1OHQA 2ZX8A 2H1PL 4BFRA 1PB0A 1JZ5A 5K9DA 2E5DA 4AIZA 2CKSA 3UPAA 4YFEA 1LHZA 3H7VA 2CLEA 4KUCD 4PLJC 3LU2A 2OXGB 1ZT1B 4J3BA 5BNXD 1JWSA 2LFGA 1AZ1A 4ONVA 1FF5A 2DTML 3IJYB 1QSEA 3LI1A 1YTDA 2GPTA 3FKRA 1PPIA 2BSEA 4L1BA 1XO8A 2AKMA 1RLWA 1NCIA 2ZPKL 4IFKA 4Q33A 4D9RE 4ESKA 1YBQA 3WY4A 3NACH 1S38A 3P84A 1KB9J 3V0VA 2OX4A 4ZS7L 1GIGH 4O4YH 3S3SA 5IQNA 3ESNA 3BDBA 3U46B 1U8IA 1QFEA 1FNSH 3GDRA 4DWSD 3QVQA 1P1VA 3GNXA 2KL6A 4I0PC 4L8CB 1FBAA 3T4WA 4J6RH 4TO8A 2XGBA 3OBKA 3SE4A 4HGXA 3H12A 4ZQKB 1BQCA 4Y16A 4GPNA 3I6RA 1SXCA 4CVXA 1RUQH 3VGDA 3HE7C 4AM0Q 2ASHA 3IDJA 1DE5A 2H3BA 5GS0D 2DQUH 4FI6A 3FU6A 5K9KA 3ZSSA 3NQCA 4RESB 1FDLL 3MS8A 3GBMH 3C0QA 2A73B 4A8NA 3UWUA 2D2HA 3BZ5A 1HC1A 1XGYL 1QPPA 1EO7A 4K5LA 1JVLA 4JDBA 4Q6IA 2XPGA 3HA0A 3SJVA 2OO0A 4JHOA 4NVTA 2CKBH 3S2AA 3MTRA 1E4IA 2POZA 1L7TL 4X6DE 4WJKB 3S3JA 5DGQA 1N6QL 2QVKA 5I8CA 5E5MB 2PNDA 4CEXC 3RDTB 4JO2L 3SKJH 3V8CA 4AUUA 4EWJA 1JV5B 2GUOA 4GFSA 4MSWA 3CAQA 1GTNA 2GBVA 2M8XA 1D7BA 4EBQH 1F4YL 4TUJB 2EIZA 1TWSA 3HQ1A 1NIFA 1UWFA 3VFPB 3G6JB 2VZTA 4WWKC 3VFVA 1V3IA 1KIQA 2E7DA 2G5RA 5I8KL 4U1JA 1JN6B 1JCLA 2OMNA 3QZPA 4PMDA 1JPMA 1TZHA 2R69L 2F18A 1E0OB 3WIHL 4X6CA 3B3DA 1D9KA 4HX1B 6REQA 1TITA 4G8FB 4JPVL 3AIQA 1CGUA 4JVWA 3DX6B 3QNZB 4I87A 4IF2A 1K6QL 4AL8C 1M7PA 1NFAA 4YE4H 3MGOA 2WB5A 4XO3A 3RX4A 2X53A 3C87A 2YLKA 1T0OA 5ANME 1EZSA 2OZ4H 3WUFA 3HMXA 2BOFX 3P40A 3GR7A 3WCZA 3PRZA 2VD9A 1NCJA 1F4AA 3ZIYA 2QSQA 2HB0A 5CLYA 4XE0A 3DI1A 4UDUB 1X4XA 2MFNA 5DLML 1RBAA 5FHBL 4QRUB 2NNCA 4YVUA 4G9FD 4N8VA 2Y7LA 1VACB 2X8RA 3SO3C 3ABKB 1MREL 2UY7A 5H94A 4PH6A 5HGBB 1WG3A 4YSSA 1OC7A 3CV7A 3E0WA 3QZ6A 4JQ1A 3WI9A 3GHTA 4C6BA 3DSFL 1VA9A 1R4XA 1DBJL 5CSGA 3UZ5A 3T0ED 1WSST 1BD2A 3P8IA 3T0DA 3C2AL 3ET9F 3JZ7A 2GJJA 5BXRA 2NX9A 4LCVA 1GZGA 5FO8B 3L95B 2NQLA 1I7ZA 1D5MB 5CZXD 3WJJA 4ODBD 3W6YA 4P2VA 3VOFA 2NQ5A 4ZG1A 3L0NA 2C8NA 4EZLA 1DBBL 3VOHA 4OZHF 4NHUB 5LA2A 5DCDA 3VFGL 3EFFA 1YPZF 1SHSA 3JWDH 3HPLA 5C0NC 1O68A 4JNMA 4AIUA 4LSTH 3QP3A 1WAUA 1NJJA 4K15A 4L9DA 4OCWH 3WN6A 3SECA 4QRRA 1J1OL 4MQ7B 4BQCA 2UXVA 3UXAA 1SBBA 2UZXB 1I0DA 3R8GA 3D3FA 4ODHL 2ZZUT 4FC3E 1MQRA 4NO3A 4R27A 2FYMA 4GC4A 1A14H 3A47A 4ZX5A 1IM9A 3NFUA 2X30A 5H2BA 3X1GA 5DJZA 4GAAA 2F8QA 3H9SE 1BXAA 5D72L 1Y7VA 4K94L 1TMCB 3NESA 3W1RA 4LBUA 1UKTA 3C2EA 1D5ZA 3GTIA 3MJ6A 3R5EA 4RDZA 1IQDB 2V30A 5JNYB 2NSQA 4KX7A 3AG4B 3MJ9H 2VDPH 3IUIA 4HMNA 3CWNA 4APQC 3RNQB 4MMXB 5HJ3A 4QE5A 3SY5A 2XX1A 4LOFA 2CM6A 3TSDA 4MJID 3V0JA 1AFVH 5FGBC 4QDGA 3QDGA 3LM3A 4ZSTA 3MI2A 5AY7A 4IPNB 4Z7VA 2X4UA 1CTOA 1DFBH 4OGQC 5IVZB 4WTWA 3W37A 1O5KA 1FO0L 4MNLA 4LMQE 1H7RA 4M7JL 3FIGA 2E9JA 1ZA3B 1S9YB 4AD3A 1S2VA 4KETA 4YHZL 4ZO9A 1MFEL 3W11C 1YO4A 2ENYA 3K1GA 1EAJA 4UMCA 3GK8H 5JHDE 2DLFH 4A2GA 4REQB 2Q2EB 5LB1A 4QJ3B 1ZIAA 3MLUL 4PTVA 3O2VL 1RZFH 4MB3A 4H2AA 5GGTL 1D5RA 4TNWK 2HA1A 2PLKA 2V2HA 3FXIC 1DN2A 5DFVD 3PJSA 3LSBA 5CJQL 3PP7A 1KCRH 2O7QA 1PZBA 4MNGA 4XPHL 3UP6A 4GKSA 2Y1AA 5E1GA 3HGJA 5BRZB 2X4NB 3MV7B 4DHLA 4TOYH 3G5EA 4ENLA 4YSDA 2A83B 3CBKB 4NO0D 2Q7YA 5TPWH 4O0ZA 3TN3A 3B3IA 3PWNB 1A5KC 2ODOA 2NX1A 4U3SB 1OTTC 4NM8L 2NX3A 2Q10A 4HFWA 2Z8RA 5B3JF 5G5DA 1UZ8A 2C1OB 3V5DB 1KN4L 1LRNA 1AQ0A 3UEQA 4X4XA 3KGTA 3IPBA 3BO8B 2NY1C 3A4EA 5DVLA 2KZKA 2R0LL 3HC4H 3TA3B 1CICA 3QY7A 3B56A 4L5ZA 1L5GB 1P5BA 3FYEB 2J4WH 4OTXL 1GVIA 2W07A 3CCHB 4KJPD 1PWLA 2NW3A 3FL7A 3T8MA 3UZZA 5D6DC 3APTA 4LPUA 2VC7A 4FZ8L 4KUCF 3EYPA 4JN2B 1SHWA 5DVKA 1J0HA 5E2TH 3TJXA 3DRTB 3S47A 2UY5A 4QXWA 4E2DA 1KIRB 1QJWA 1Q9WA 4ODXB 5CBBA 4I18C 4PUWA 2WWDA 5TK4A 4PBVC 1GJUA 2XICA 1MXSA 1Q8AA 5IKCA 5TQLA 3KVKA 1D2OA 3PG2A 1B3XA 5IB1A 1XF1A 1RJYA 1K6WA 3RO6A 4PUMA 4LNCA 1RP8A 3VNLA 2WLZA 2GIMA 1HTYA 1N8ZA 1DQMH 2K9FB 3ARWA 2V7NA 3GSOB 4P4KC 1X1ZA 3WU1A 2PDFA 2W92A 3BW3A 3P5YA 3UEZA 3QXAA 2EXYC 3D51A 2QUUA 5JR1H 2Q8AL 1BECA 3DDFA 3VXOA 2QZRA 3QUML 2WJDA 1MELA 4YFDB 3N2JA 4DELA 5T1MA 1I8IA 3FAWA 3QCTH 3BOVA 2Y7EA 3GFZA 3AAMA 3ESVF 5F1IA 4NNCA 7REQB 3VOGA 1UH4A 3BDXA 3HRZC 3O2DA 1UD6A 1A6AB 4NO2A 5AECA 3EH5B 1CK0H 5FKAA 5CSRA 2VVSA 1J9CT 3IJHB 1EJFA 4RGOL 1CFMA 3G5YA 3OKMB 4ZBJA 2VKWA 3U9WA 1HWHB 3ZHDA 1K4DA 3WFEH 2XQYK 5FF6B 2A6JA 4XWOC 5HAOA 1HQTA 3CXHJ 4XKMA 2JF7A 4Q8MA 3E49A 4H6KA 5IREA 2IWFA 3FBQA 2WMHA 4QRBA 3TROA 1IAOA 4F15C 3MMDA 1ZJAA 3SEPA 3ARED 2BSTB 4ODUB 3SGJC 1Q1JL 1M1XB 1NEPA 2TRHA 3H56A 3GTNA 4AC7C 3FCUB 1NFKA 2X2IA 4LNVA 4D0CB 5EB9A 5C70A 1E71M 3G2GA 2NXZD 5LG6A 3FU9A 3GRBA 2ODHA 2QHRL 1UATA 2JIWA 5K9JH 3RWGB 1EGJH 4P2AA 4L3EA 2CIIA 5G4NA 3KR3H 1KCBA 5D30A 4QGYA 2VJ8A 1B0RA 3T6ZA 5JXED 1SDAB 3WENA 3NSMA 4HYVA 5TE4L 2Q2LA 2DIAA 4R2GB 5D96C 1ZK9A 4H20H 2HUEA 2V63A 4HQVA 3TZVD 5D7LE 4K94C 4TQPA 1NEZG 1E56A 1J96A 1HXKA 2IALA 4PJCE 4M7ZB 5AYUL 1RA0A 1KGUA 3PTQA 4Y9EA 4PHZA 5FB8A 5AW6B 3WD2A 2FR4B 4B7IA 1PDKB 4GWEA 3PZMA 2H2SC 2CCWA 1UACH 2DMHA 4YIWA 5HHVH 2JKIS 4TVPD 2C1PB 1IC7H 3LKPB 1G0YR 2DQJL 3PFUA 3VXNA 3GD1C 5D1XA 2BM3A 1MF2H 4HPHA 5IHZB 2Z35A 1U3YA 4O8AA 2CGYA 3W38A 1XI3A 5DQPA 1KBIA 4K3ZA 3BI9X 2ORBL 1ZBVA 1MY7A 2VAAB 2AXGA 1XR9B 3TVAA 1Z48A 2FMNA 3BL3A 4ABQA 4CNOA 5T5FA 1XDTT 4L1TA 1LD9B 4PJ9B 4K7YA 4RNFA 5AG8A 4ZW8A 5T5NF 2VXSH 5DK2A 4IEFA 3FT4A 3Q2LA 1P0EA 4CNIB 3BPOC 1JL8A 1WX0A 3CDZB 3U9PH 1V7ML 2VDRH 1XGQB 1T1YA 2LLLA 1SDDA 1OFQA 3FJ6A 1PYWB 4K9EH 2F7FA 1HIMH 4AMAA 1UZ6F 3CXOA 3GEFA 1U8QB 3H9SD 3GG1A 5KBLA 3HI5H 1V3MA 4HIHA 3DX7A 1U58A 2R4RH 1FQ9C 3OLGA 4L5FL 2IADB 3RUGB 4K7FB 1CF8L 4UOW1 3A3WA 1EJOL 5BUPA 5BO1H 4YC2C 3ZDWA 1HXMB 2YK1L 3EJRA 4KI1A 3C6LD 1IBGH 3WFLA 4L37B 1RZKC 1G4MA 2OMZA 3NTCH 3E8VA 3F00A 4PMEA 1T7LA 5T5FH 3SDYL 5F88A 2WINB 5DT1H 1JF1A 4KFOA 2QV4A 4GXVH 2ZUMA 3KPRD 4PJHB 1LP9A 5AB1A 3B7TA 3GB7B 1NARA 3HMXL 2IDCA 3ESPA 2K70A 5ETUB 3ONCA 3WFDL 1EIXA 2PWUA 4PG9B 2VLRB 2NY2D 2E56A 1ZXQA 3QEQB 3GO1L 1MH5A 3CVBA 3GLDA 5AW5B 5D09A 1JWMB 1XPYA 2I7OA 3MV8A 3B03A 3CLFL 3UTSE 3NCJL 4BXVA 4ODWB 1AA1B 1ILUA 3BZ4B 1U95B 2WGNB 1X5JA 1MFNA 5ABEA 1Z9PA 1B0IA 4AD4A 5D1ZC 5FHAL 1ND0B 5HYJE 1KSRA 3MUJA 3QEUA 3PBGA 2BO0A 5KVGH 1DLFH 3ARGC 2Y1YA 5DWUL 5DJYB 3PBYA 4O2EA 4R7XA 1LO3H 1H7WA 4N0CC 3FGCA 3QLLA 4PG2A 5GSVB 2H0PA 3LPFA 2D2JA 2IQTA 1KIPA 3VIFA 2PXYD 4KY1H 3PZ9A 1E28B 3PPEA 5KS9A 1FHVA 3MCNA 1LEGB 2O93L 2Z7KA 2JJSC 5BRPA 3BP5A 3ENEA 3KPNB 4TN9A 3ULUH 5JYMA 1QNOA 5G2IA 3W74A 5I1CH 2VSCA 1JZHA 3RM9A 3OTTA 4NQCA 2OEKA 2W65A 5TDPA 4XXDB 3WL1A 1EL3A 3CSFA 5KYWB 3DOIA 4U6HA 4LFYA 1WIOA 1KELH 5L2KA 3DA0A 2GUOB 5FUOH 3BCDA 4BE5A 2Y5TB 4N2KA 1IEAA 2XWZA 3WQVA 3CHXA 3LD8C 4QKXB 4C56B 4M5TA 3SCMC 3LTSA 4ENZA 4E9SA 4YSOA 4XK2A 1UM5L 4OZFB 4YNYB 4PWFA 5I1IH 1BFVL 3VABA 1XGEA 1YMMD 1MY5A 2W9EH 2FZ9A 3IYLW 1RLBA 1Q2RA 5I1EH 3TU9A 3T3MF 4IOIA 1SO6A 4HBCL 3F7VB 4JX4A 4QRSB 2F5AL 3REWA 4NQDE 4Z3EA 1G7LA 2MUCA 2E9MA 2X7LA 3DROB 1YN6B 4JFYB 2WC7A 3TIDA 1WT5A 4RNHA 3GINA 3ITCA 4XMLH 2K3HA 1T5WB 1WNOA 2O7SA 2INEA 4UTLA 3NZ8B 4LLQB 4HIBA 4Q6JA 1Q0EA 5A2JH 4NAEB 1JHLH 4FGMA 1XHGA 3IDIA 2XUCA 5FOJA 3D39E 3IDYB 3RF9A 4HBKA 1U4FA 1XGPB 1ZT4A 3HC2A 1E9QB 1Z9OA 4C6QA 4PY8J 4CILA 2QT3A 5IIEA 2XN9B 3PQYE 1TIWA 4KZEH 5GHWL 1CGSH 3EWCA 2PYEA 2ZUQC 4AENB 1PKMA 3CZGA 4U6XA 3EX4A 1J88A 5T1LA 4OF8A 4X6DF 3ZVHA 3GPEA 4WIQA 3IJDA 3U8GA 1DBAL 2AJZB 2UWFA 5E6SB 2PCPB 3UYPB 3MYOA 2C3VA 4BF9A 3R43A 4W9KC 3CHQA 3L6FB 1YEIL 1NANH 1S7SA 2ZZ2A 4C4BA 3TC3A 3KW7A 3KBHE 4MWAD 4M7SA 2R2BB 4OUEA 5I75C 1PCSA 1EXUB 4NF7A 4QTGA 2JE8A 3TJPA 4DKEH 1MFDH 4YSRA 4YEEA 4W9HC 5MERA 3LCIA 1W1YA 1GCFA 4AK1A 1NDGA 4LNRB 1S7RB 1OCRB 3IPWA 3D85A 1TSIA 3SE4C 2WVSA 3I4EA 4Y16C 1JZ4A 1MVYA 4XN2A 3KBEA 4AQEA 2X1XR 1XL4A 5KVFL 3UTTE 4YBQC 2AVGA 1CE6A 1E9ZB 1MHEB 3EXTA 3MDWA 1NMBH 4K68A 4Q6IC 4HUCA 1E0TA 4CN1A 1DE4B 4O2CA 1F2JA 5SWSD 4ZUUA 1XISA 2HG5B 4GQPH 4DJFA 3ZKMC 3KS5A 1ACCA 4LNYA 1U41A 2EHHA 1NCAL 4WZ9A 2J79A 2QPEB 4KS0A 1IGSA 1CGTA 25C8L 2ZSVA 2ZCLL 4B91A 5AC4A 2J1XA 3DK2A 4LEOA 4EZKA 4QRNA 4R88A 5D03A 3CV2A 1HESA 3T8XB 5D7HA 2PS2A 3KBMA 5IHRA 2ZZ7A 4NHCH 4FQ1H 3VMOA 3W7OA 3INOA 4M4RB 5I30L 1EC7A 3QKZA 3RWHB 2ZC8A 4P04A 1SZFA 3SSGA 3L7FA 1V6XA 3E8UH 3D33A 3UCDA 3WD5H 3RX8A 4LVEA 2XKNB 3GH5A 1Q9KA 4K7PY 4F79A 3C6EA 1F74A 3K6DA 3N41B 2NUXA 3CAKA 3SGEH 1KJVB 3RWCA 4Y2LA 3CV1A 2YW3A 1JI1A 1OTSC 3FHQA 3CAVA 2F08A 5G4HC 2F53D 3K5XA 3SCUA 1BGXL 2GK1B 4Q0XL 1EJ7L 3MCKB 2HT2C 2B4GA 3WLTA 1EFXA 4QLLA 4WD0A 5BZAA 1FN4A 4S3JA 1BFOB 4QTIH 2WVVB 4PVLA 5CO1A 2JFEX 1UD4A 4Y5YB 4WRHA 3K2KA 1A7RL 3UAEA 4G9PA 1JUFA 1BWLA 3T4YB 1N12A 1J0KA 2KZ1B 3VWKA 4AIXA 2J77A 1OX4B 2R82A 2GJRA 2MNWA 5FSDC 4ODVL 5SWZB 1S5IL 5CEZH 2PR4L 1HKJA 3PFMA 1ZUAX 5I26A 5KVDE 3OPSA 2ZP0T 5C0FA 1BBDH 3FFCA 1IEQA 3AZTA 4RR4A 3MC5A 4MDPA 1MJJA 1KFAH 1RJRA 2PDNA 4M80A 1JHKL 1DEDA 5D05A 5DJ0A 3WJJC 4KHTH 4UUIA 2R6OA 2C15A 5B80A 3RO8A 3WFHB 3GSUB 3VWJA 1GOFA 1FRGL 2GGHA 3IRSA 3AQXA 3UPBA 3THQA 4INFA 1EUUA 3QJTB 1PVNA 1IAIH 3K8MA 4KERA 1FWFC 1F4HA 2YEZA 4DJMA 3VGHA 1I1AA 2AF2A 3D3VE 4JFED 3GTTA 4HKZA 1DIDA 1F3EA 1W3TA 1TJIH 3MR9A 1ZBCA 4XNQA 3A4DA 4WNQB 3APGA 4IIGA 5I76B 4XN5A 3P81A 3AXIA 3I9IA 4LSQL 4ELMF 1JUBA 4ADGA 3DCPA 5EBLA 4XVSL 1SVDA 3VDHA 5HYQB 4M1GL 4HZLA 3CZJA 5HHOB 1JZJA 2HXTA 4UZSA 2ZXCA 2R91A 5FR3A 2PPCA 1OY0A 3CAWA 2VH5L 3LZPA 4Z08A 1XLDA 4GMEA 5ADPL 5EU5A 1Q9LB 3BLOA 1DQUA 4XO9A 2X44D 1LO0L 3O4OC 5EPMA 2YPVH 4CBPA 5TFSL 1LUCB 1OAJA 2WP3O 2VX6A 2D9CA 3QXUA 2X09A 2W9MA 1CDYA 3O0RL 1V03A 3QGVA 1AIZA 4JUTA 3M5VA 5HI5C 2HRPH 4F3FA 4GISA 4Y2DA 4PJEB 1JCXA 4D8PA 5D7JA 3BAWA 3R8BB 5LAXB 3RBGA 3MA7A 1HYSC 1HSBA 5DDHA 1I2OA 1Q3NA 4PJGA 3P4OB 1CL7I 4KK5C 3FXGA 1XGTB 4W87A 2EE9A 3QW3A 3DX3A 3KBWA 4B3KA 3TN4A 4PRIB 4RGNB 3ID7A 1KPUB 1Y5XA 1YX1A 2R4SH 4CADA 1GHFL 1J1XH 1DVQA 3N2XA 3SFKA 5EA9A 1OIOA 1T3FB 4LEXH 2FPYA 4HFUH 3VE0A 4RFNC 2JKSA 5KBDA 4LCCB 1FWTA 2X2HA 4IM8A 2HE8A 1E27A 3TNMA 3EOSA 2OK0L 4LSUH 1ZHNA 1C12A 3HG1A 2Z29A 1YQVH 15C8H 5BVPH 1GUVA 5LXGH 1JCKA 5LYRA 3WY2A 4AH7A 5EU6E 3MNZB 3EOYG 5CLWA 5ENLA 4OM1H 3KYOA 1ROWA 3VFOB 4GKZB 4IJRA 5L4JA 5KSBB 4Z3GA 3AC0A 4ODSH 4ZYKA 1J9SA 3MN8A 3DX5A 5HJYA 3SE3A 5LIUX 3UVAA 1MFAH 3STLB 2ALWA 1CICC 3WF2A 1UXWA 3R25A 3RK8A 1GKOA 5HHNA 1HHJB 4EDWL 1KULA 1LRTA 4HNCA 5I06A 3Q5OA 4P4KA 2FFIA 4WR3A 1LNUA 1B6DA 4OGYL 1B1YA 5DD5L 2PDCA 2B0SH 4L29B 3LHVA 3EFDH 3POHA 4ZNCD 4FJZA 3KYKL 4KCUA 2DQWA 4ZJ9A 4DGIL 5I28A 2NQZA 4UT7L 1B9ZA 3UXFA 1A49A 1QKZH 3H6AA 3U25A 4PTNA 1NOWA 4PRNB 1V08A 5DBUA 3QHOA 2ICEA 1J5DA 3QHFH 4XBGA 4AC2A 1UA7A 3JWOC 2VFFA 5FM5O 3MYJB 4O58L 1BQLH 4U1SB 2FRGP 2OKMA 3KWVA 4PRPA 2EKSA 2XWRA 2VFDA 4I5RA 4JJ5A 2EECA 4AW4A 2GIYA 2WZAA 4O8RA 1KYFA 4DVRL 4DYJA 3U6WA 1M1SA 5DHVA 3NP4A 3S35H 3QUKA 3CTLA 4YSUA 3MV01 1U93A 3OKEA 3DYPA 1Z89A 4JPIB 3I9GL 1OC5A 1QBLL 1BVOA 2VSMB 3Q43A 3C2FA 4YSEA 4F33B 1JNHA 1AGEA 5DRXA 4FFWD 1A4KB 3OSVA 4H04A 4JQ2A 1YECL 3H4WA 1TFVA 3BKJL 3BRDA 3LGEA 4FZIA 1JF6A 3PDOA 2HT3C 2JCCF 2NTSP 2Y7FA 4L4OA 3UPWA 3G5VA 4LH8A 2EH8H 4FERA 3NQAA 1R19A 3D6NA 3TAOA 4KZDH 1AJZA 1RVGA 4A3RA 4TQEH 2G0KA 1O7DC 3MACH 4NSBA 4KI5C 2YBTA 5DEFA 4RV8A 1U8MA 2JK5A 1NDVA 1Z3NA 4BSWA 1NIAA 2WNQA 2PU0A 2NY6D 4ZPVA 2QXWA 2AK4D 1NEYA 1EH9A 2XV2A 2R51A 4IGBA 3RVTD 2J8UB 1A4MA 3YPIA 1KGCE 3KZSA 3TH6A 2JQZA 5C8JB 2V5RA 3OJDA 4N0FB 1F97A 1J2BA 4FFZA 4UAOC 1R9XA 1R87A 2OCJA 5DHDA 5KJRL 4WU7A 3PJLA 4JG0H 4MY9A 3FUIA 3MV9D 3NAAL 4JVPA 3QHZL 3SZ6A 3IDUA 3VXPA 1M01A 3MOAL 4F57L 5KG9A 1BM7A 4X5LA 3A6BH 1NANI 2QSCH 5SX5H 1XAUA 2VDLL 3QQDA 4AKPA 2DPKA 1HL9A 5D1QE 1FFRA 2X6UA 4KGJA 1NFIB 4Z7OB 1OG0A 3LNHA 3DV4A 2ESCA 2Z7WA 1JPGA 2EVGA 2J6VA 3O45A 3SPHA 2JH2A 1E2VA 3B1UA 2DJXA 4RQQA 4KO7A 5E2JA 2QCMA 2CK0L 3D7PA 4GXWA 3ZE0E 3QQNA 4GW4B 3GTFA 4FFZH 3EPNA 3B8DA 4HHAA 1Q7ZA 1ZVNA 5CS7A 2VISA 3H53A 3OAZK 5CGBA 3H2OA 5F4WA 1A6TA 3L5AA 3BSHA 4FP1A 4NKIL 3RVXD 3BVJA 1YA5A 3AAZA 2XWXA 1FRBA 3HS0B 4WEBL 2BNUB 1DFXA 1BOGB 1G4PA 5CFAA 3S36L 4K23L 1CD1A 5C0AA 1ZANH 4X3ZA 1XDLA 1L6GA 2C13A 5D1XC 4M62L 3EBGA 3FO0L 3N43F 4N8VG 5MENA 2WJEA 3F2BA 4JRYE 1E5BA 3CSTA 4I88A 3PBUA 3P3TA 2MCPH 3C6SB 2IDQA 2R29A 2VC2L 3VC5A 2LTQC 1A5CA 4Y1AE 3U0TB 4X0NA 1HO1A 4RRPA 4X6FB 2GGGA 2WJ7A 1BF6A 1MRCH 4WY0B 2AW2A 3TBTA 3RYMA 4RMVA 4CGUB 3BHBB 3NN8B 4AL8L 1XF5A 4X5XB 4R7DA 3SGEI 2WCPA 5FECA 1UXLA 3JTTB 1TQCC 1UWEL 5GRJL 4XVTL 4CQAA 4EE9A 2A77H 2J7HA 1BX2A 3CZEA 4NPJA 2YQ3A 3R7RA 4DJDD 1D5IL 3TCLA 1AGDB 5EA0L 1XGZA 5GRXG 3R0MA 4GO9A 1YUHA 1X7IA 3QN3A 2FJGA 5CG0A 5JA9A 1IGIL 3VQ2C 2R29H 5F0JB 1XLHA 2CMRH 1JR1A 2BFVL 5HNNA 3C75A 2ZRYA 2CU9A 2VDLB 4N4YB 3ARGA 3ZK0A 1CI3M 4I0PB 3VVGA 2NY0C 5E1IA 2PABA 1NFDB 5LLIC 3EFOB 3QJFB 1DQVA 3BUBA 4YSAA 2FJFB 3D0VB 4U6XB 3W81A 2HNHA 5LHFA 4TRPL 1NC2B 1E8ZA 1S3TC 3K71A 5E94A 2OTWB 3HE7B 1EEYA 4KUZL 3CJPA 4B5EA 2Y6SC 3TFKD 4EVZA 5ECJE 3VZZA 3L4VA 1NF0A 2XU2A 4FTVB 2NSXA 1SVBA 1EO8H 5GGQL 3QZLA 1I9CB 3O6ML 1MRDL 1CLOH 1MRFH 5ISZB 2H6PA 3VGBA 3MYPA 5D32A 2NTFB 4JHBA 3D30A 2I9TA 2FH6A 3SDCD 3GRWH 2IWGA 4U0RC 5C0IB 3CHPA 3KMDA 3QFDB 4PWGA 4JNZA 4XPAH 1KEMH 4PG2C 3H26A 1YDYA 5F3FA 3H8NA 3I2CL 4BK8A 3D47A 4BFKA 3IFPB 3QLDA 4WWKB 3NDZA 1F90L 1MJ7L 4NWUH 4WO4D 4EF9A 4ZRGA 5FK9B 1R3HA 5GGSB 1KCLA 2X4RB 3WJLA 4GG6B 3W7RA 2VLJB 3LXCA 5DS8B 2NZLA 3IU3B 1L9MA 4BCXA 1NEZB 4Z76B 4HUNB 1J93A 1CU4L 3L4WA 1TTQA 1ZU8A 1EX0A 3NK3A 3UJTH 3DV6B 4GQQA 3ZE1B 1UJQA 4CVZA 4UOQA 2XVBA 4DW2L 2XZQL 3M5ZA 1M1BA 3CASA 4PAZA 2UY3A 2WNGA 4BELD 1CT8A 2X89D 3CZ8A 1GVQA 4HNOA 3VW3H 1EJ8A 1SNRA 1ALDA 1GY1A 3E02A 2BY2A 3IRDA 3THML 1EMTL 4BEIA 5C71A 4MS8C 4JN1H 4WI8A 3TV3H 4QKTA 2QTEA 3GRIA 2FIKA 3SO3B 4M5SA 5DJDA 2TRSA 1TO5A 1FVCB 4XAYA 5ICZB 2PDLA 2VCBA 2IQAA 2HJFA 2F0CA 4J39A 4WSHA 4OCYL 4LARH 4LBSA 4JG1H 5HSFA 4J35A 1WT5C 4Q8QA 5I18H 4GVFA 3NEEA 4MZ8A 2BERA 2Y69B 4P07A 2ZYRA 2QQKH 4TMCA 2WPBA 1R3YA 4N7QA 3PC0A 4P4RA 4OJAA 3SSJA 1IXNA 2NVAA 1UYQA 1ZA6B 4U7KA 4N20A 5GJSL 1R3TA 3VGGA 4AU0A 1QK0A 4IOSA 4LALA 5DS2A 2CA4A 1FZJA 5KTEH 4Y0GA 2C26A 1KLUB 4JKKA 5IR1B 1XBXA 1KTJA 2CKBA 4PV8B 3WF1A 1IZJA 2Y6TE 3CFQA 3G5XB 4GSUA 4KU1A 1XBRA 1QTPA 4G3YL 2CLRA 4WUUD 4IRJD 3VFUA 1N2RB 1INQA 3E96A 3KJ6H 4GUJA 4UQ3B 3CK0H 4N68A 4FFTA 4AHPA 3DVNA 4NYYA 4IU2B 2VMCA 1OXYA 1W1PA 5AYQA 3SBPA 4RA0C 3T2NL 2Y07H 2JV6A 1DJNA 2CLMA 3M8OL 4GUIA 1FFNA 2G5BB 1OSPH 2GJ6D 3CQKA 3CLWA 1QVOB 4HYWA 2EAWA 3W1LA 5IMMA 1ZL1A 2WO4A 2HV5A 2YR3A 5MKGB 3HQNA 3RFRA 5T1KA 4NNYA 2Q3RA 4APQB 1L2QA 1W1VA 1YDVA 1DJYA 3P3YA 2OZ4A 1QMUA 5D7KE 2PDBA 4ZMAT 3MLVL 4X98A 1IL1B 5AW3B 1Q38A 3CZFA 1KGCD 3CSYA 4RVBA 4X0KB 1URIA 1IIIA 2XRAH 1C5BH 1IR1A 3KWXA 3UADA 5TAOA 3QYMA 4JN6A 1TFHA 1OCNA 5BZXA 3CFEB 4MNQE 3QI9A 4V1YA 3W1ZA 2A6KA 2ZAHA 3S4TA 5E2UL 5DMIL 4LYPA 1AR2A 1T7ZA 5ICYA 5F7KC 3QRGL 3HO8A 1OABA 2LQRA 1R9FA 1BPLB 4DJFC 3EZ4A 1UR9A 4CD5A 2WTRA 4QTHA 1U3HA 4MCZB 4E42B 3TYUA 1WBXA 2GSEA 1W3JA 2Q20A 2QUNA 2QPXA 1RULL 4F0HA 4ZB0A 2I7SA 4U28A 2JELL 4AY0A 1NC4A 3QIBC 1KGJA 3EDJA 1GC1H 1XBVA 1NP0A 6PAZA 1BA9A 1XFCA 2H3DA 3AJXA 3QDME 2X6VA 4Z0BH 3UG5A 1AD1A 4N2GA 4LRSA 3L5LA 5HATA 1F1AA 3EWBX 2O9PA 7XIMA 3B2XA 4JY9A 3KHOA 3CXDH 5FYJE 4Y90A 4IUGA 3OR7A 1OWWA 5KYYA 1KCUL 4JYDA 2NLJB 3TIMA 5CIPB 1B90A 4G8IB 1OWRM 2ZOXA 4UT9L 5BZDA 3GBEA 5D33A 2XIQA 2NY1B 2Z4QB 2CG9X 1D5BA 3BQUD 4HEME 5F96L 4X7TA 4O1EA 2X6MA 4DO7A 1V3JA 3FNDA 2AERT 1H3GA 4IIQA 1W1IE 1WZAA 3WL0A 1FP8A 4GI6A 2DWDA 1LWIA 1VFAB 4QF1B 1S5NA 2O6PA 2IBZY 3VWKC 4NZCA 3MJ9A 2KUTA 1TV2A 2VABA 2DYPA 3MGAA 4XN8A 4DVBA 3AT9A 3FONA 4I18B 4UTMA 3TPUB 2XISA 3I6LD 1WP6A 1KTKE 3HZMA 4GQ9L 4TULL 3N44B 3ARDD 1T5XA 4PRTA 1TJ2A 2VWSA 3D1MC 3MCLH 1XR2A 3O0KA 4QO1B 3ARTA 3GZKA 2X2YA 4R8WH 3DJ9A 3D50A 2C1GA 2JKLA 3E38A 3VWJC 4M6MH 4PUBH 4W4QA 1F58H 1RLDA 1QBBA 3F4WA 4HEPA 4K5MA 5KOMC 3S8GB 4ZAKA 4OUOA 5FM8A 1JPTL 1AQKH 1FWNA 3EXRA 3RILA 1G01A 3QEHA 3K6OA 1TR1A 3Q2DA 4WFHE 3E12A 1HCVA 4EO5A 3FB6A 4PJFE 1I1AC 1A5FL 1QHQA 1FSKC 2QCNA 2CDEB 2CLVB 1WDWA 4I9XA 4PSPA 1LDSA 2VMJA 2EYTA 3BWWA 3NXLA 1JULA 2MIZA 2YN5A 3DARA 5DSCA 2V0TA 3AG2B 2IPUG 2ZWYA 4UTFA 4MUZA 1C08A 2QVMA 2P44B 1BGGA 1S7QB 1AZNA 4ZUTB 4J40A 4NZUH 1V5JA 1EJSC 4DO4A 1BAFL 5HPMA 1OD8A 3GHEH 3HRZB 5K39B 3EOBA 1L6PA 2GC7C 1N0LA 2VUNA 4H13C 3UG8A 3V55A 1CFSA 1JZEA 4LF3A 3CC1A 2VXTL 5IFHH 3W56A 3DIFA 3ZQWA 4AQLA 1ITUA 4Z7UE 3NABH 4MA7H 2XXCB 3DVGA 3I7SA 2GTWB 2TYSA 4Y2DC 5GRZA 3EX3A 5AVYB 5D7JC 3L5WA 5DCCA 4F15B 3F2DA 1TZOA 3MSDA 3ZXWA 3QUXA 4PGCB 1RZKL 3WTTA 5JHLH 1TMHA 2PO6D 1IT9L 3HJ0A 2COVD 1M53A 5E0QA 1PZUB 5I6XC 3SY6A 4UMSA 1RHHA 2ADGB 2Z0UA 3RAOA 5DJ6B 2OSLA 4UFLA 4FI4A 4O1CA 4XOBA 2JTDA 4DZ8B 4F9DA 3R8RA 1NGZB 1JGIA 2IMNA 3VXRA 4BE6A 4RNRB 4P3WA 4L1XA 4P57B 5D96B 1YMHB 4PI0A 3G1XA 4WTXA 32C2A 1AW1A 5ADOH 1Q13A 5F89B 1WA2X 1Q6OA 2ALAA 4AXKA 4Z78B 1X1OA 5GRUL 2PW2B 1JXKA 1T1ZA 1UA6H 1RZIA 4HS6B 3S5OA 4ADTA 4D0BA 3DUHA 1W9BM 3FFDB 3OW1A 3PGFH 2MRYA 4DPCX 4C90A 4QX4A 2HJLA 1H9VA 3SE3C 2ZXAA 5D55A 1R86A 2D31A 2VXVH 3FQXA 5JORB 1MNNA 2VQ1A 2XFGB 3CHEA 4D9RD 5DFAA 4LEEA 3NPZB 5CNHA 4C6IA 3U0HA 1A4CA 1MCJA 2F7QA 5KAQF 1FO0B 4BQ2A 3UTZB 3B7UX 1TRIA 4KFPA 4OJFL 3QXBA 3GLAA 4PEKA 1XZ0A 1MCFA 4U10A 3FQ1A 4KIRA 3VI3A 2Y2YA 5IHHA 1ISZA 5A6BA 5H8UA 4ERIA 1DQWA 4I48B 3OJ2C 3BPOB 3ZT7A 3M0JA 2OMUA 3QCUH 2QDHA 4EE2A 3S1WA 1GYCA 4I5BA 4XPGL 4GA8A 3B3BA 2YGVA 3IGUA 4IP7A 4FEMA 2FD6H 3GE7A 2ICEC 4HIEB 1E4WH 3HVDA 5C2UB 1V6YA 3O8XD 4NFDA 1NDYA 3TC7A 2OCCB 2G75B 3HIJA 3P82A 2LAAA 4PJAE 3ZZSA 3O3BB 4XWGH 1HYRC 3UJFA 4YC2B 2VLKE 2OMYB 1G7JA 2IGTA 5BS0A 4P2RB 2EDKA 2NY3C 3KPSB 1O9ZA 1EGJA 3GDMA 1BQHA 4ILSA 1UUQA 1IGTA 3MP4A 4PS4H 2YEQA 5J8OA 2EC8A 3UCCA 4UINH 3SE6A 1X6NA 2W60B 2P80D 1Z42A 3SCNA 4AMCA 4URKA 2XXFA 1GIGL 1NA8A 4HQQL 1FH5H 3NQDA 5D7IE 2Z92A 4O4YL 4ZOEA 1QBAA 1FNSL 4MQXC 2FEDD 4AKQA 4Z7NB 2PWDA 2C7UB 2XVNA 4NAFA 1DVXA 5FJIA 3L9EA 5D1ZB 3H54A 4J6RL 4E4FA 1N19A 4DCQA 3A3HA 1NGXB 3LN5B 5L8JB 4OV5A 2WO3B 5MHBA 2UZYB 1RUQL 3CDGA 2QJHA 3BXNA 3RVWC 4IGBC 2PDWA 2D4DA 4XBEL 3CC5A 2DQUL 2YQGA 1V3HA 3KTCA 2ADYA 3BZFB 3GBML 4JPWH 1GKQA 1VADB 3OJMB 2GK0A 5FFOA 3RA7H 1CZ1A 1CXFA 4YHNA 1S9XA 2CKBL 2V9UA 5AZUA 2OMVA 4DF0A 5ALCH 5HVGB 3KVJA 3AISA 2HRLA 1A9EB 2E6PA 3SKJL 5BYWA 4NZDA 5BWFA 1XXDC 5I02A 4EBQL 4BKLA 5C3TA 3VD0A 5DEZA 5A1AA 1IGCH 1I9RH 1J9YA 1UVQA 2JK2A 2XIOA 3QUMB 4FXLA 3JUGA 5IQ9A 4Q74A 3LD8B 3CEPA 2RHEA 3SCMB 4W85A 3U4BH 3EXSA 3QQWA 3ROLB 4FA7B 3CWOX 1IO4C 4AQ8A 2VGGA 3MREA 4A8LA 2NYYD 1W37A 2OV0A 1ZLVK 3BSGA 4M5PA 4QRPE 2WAQA 4UQCA 3WQPA 1X7TA 4UNVA 5JBEA 1QWKA 2GI7A 3V95A 5HVHC 1E4XI 4FI7A 4YE4L 3QA3B 4HJGA 4XNAA 2ZWZA 2W0LA 3HN3A 4GG8B 1K4HA 2DI7A 4Z23A 4QROA 3V6FB 1UOZA 5E99H 3L9RB 4Q9QL 3VUPA 2ICSA 4US6A 5D2YA 1G7MB 3LKNA 4XIMA 5C9UA 4GCXA 1CL7H 2REQB 4IM4A 1T5AA 4ORIA