1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
molecule keywords alpha amylase
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
4R27A 4LQ1A 3KWXA 4D1IA 1H11A 2Y2WA 4UOZA 1EGZA 1QOXA 4HMCA 3LRLA 3K46A 4ZXLA 3BC9A 5DMYA 1DWIM 1U33A 4NRRA 3W25A 3VGEA 4DWSC 3GNPA 3PZMA 1LLOA 1H0IA 1V3JA 2J7BA 1VBRA 4PUEA 1O6IA 2TAAA 1W3HA 4CD4A 4N0RA 4JFTA 7CGTA 1E9LA 2F2HA 2D3LA 3OA5A 1OWQA 4HOXA 1OD8A 3J7HA 2MANA 2UY2A 3N11A 3DX2A 4D6CA 2VVNA 2PWFA 2XHYA 1W91A 4D6JA 5ABFA 3II1A 1UWIA 1V6YA 3AMGA 2X0HA 4HA1A 1R85A 2AMGA 4AD5A 2ZWYA 4PSPA 4MNKA 2FHFA 6CGTA 4DWSB 4E2OA 4GI6A 3DDGA 1E6XM 4W88A 1WE5A 1YHTA 5CLTA 2D20A 2AOSA 2GDUA 1TFVA 5HPCA 3A5VA 4NZJA 3T09A 1KXTA 4L4PA 1BGGA 4GZJA 3RM8A 1HJVA 1XCXA 2X09A 4Z2KA 1FHDA 2DSZA 2EPNA 2EACA 1HX0A 3WY2A 3UG5A 3PHAA 2ZUUA 3EJRA 1K9FA 5ABGA 3LPGA 2BVYA 3WNPA 3AHYA 1UZ1A 3BSHA 2PF0A 4F9DA 5FKYA 1CBGA 4GI9A 1NQ6A 1QHPA 3OB8A 2BXYA 3CPUA 2WMFA 3CZGA 2RGLA 2XWEA 5ABFB 1G0CA 3NSNA 1CGWA 2WCGA 2G41A 2WMHA 5AYBA 2BY0A 1J0KA 1M04A 5GQBA 2ZWZA 3SCRA 1DTUA 2W62A 3GH5A 5A6KA 4D6IA 3KL0A 4DWSA 1MQRA 2F7PA 1JF6A 1TQSA 3WNMA 2A3AA 3OGVA 1JD7A 1MXDA 4AD3A 1UKPA 1GCYA 1R34A 3HJEA 3BMVA 1MW1A 4GZIA 3CZ8A 1JZ4A 4UQ9A 3B9EA 1UWUA 2DIJA 1V3IA 5A3HA 5C71A 4AZ7A 4GKLA 1AQHA 3D51A 1E6NA 2PB1A 4U5KA 1HJSA 4E4PA 1A3HA 1HP4A 3WDPP 5HNNA 3EJQA 3AXHA 4OUEA 2YLAA 3QHMA 4CU7A 3ALGA 4WF7A 2DSKA 1OT2A 2YA1A 4CU6A 1WZAA 1ZJBA 2WZIA 4PTWA 1LL4A 1XCWA 3CUGA 4DUXA 4AZIA 5C70A 4TXEA 4W86A 2BY1A 1HJWA 2RGMA 3ARZA 2ZXAA 3CO4A 1EDGA 2VC9A 3DECA 1FH7A 1UR9A 3FHAA 2BHZA 2DQXA 3EMQA 4OOUA 8CGTA 4WIWA 1CXEA 3BGAA 4U5IA 4OJYA 3DDFA 3AMLA 4ML4A 1U30A 4NZFA 2CNCA 1WDPA 1QI0A 1ZBVA 1HJUA 3MV01 3N12A 5A6BD 1HL8A 3VTRA 2X2IA 5HBFA 5I24A 1AQ0A 4HPGA 4PSRA 1H4PA 3WBEA 3FN9A 1J11A 1VFMA 1B3ZA 2BVTA 1AVAA 4MB4A 4QLLA 2NT0A 1E73M 5DF0A 5FL1A 1CXHA 1M53A 1JG9A 1UKTA 1W1PA 3AYRA 1E6PA 1EHAA 1OGBA 3GBDA 3WFZA 5FIPA 3WD2A 1FA2A 2DSWA 1KR1A 3PZVA 4WLCA 3TOPA 4JZ5A 5I0DA 1X6LA 2VRKA 2EJ1A 3WQ8A 2UWFA 4W85A 3WD0A 1JYNA 4UZSA 4QDMA 3VIFA 3SCTA 4ATWA 4HP5A 2J8GA 4L4OA 4NI3A 3BLKA 1UASA 3D3AA 2D1ZA 1OIMA 3IK2A 4PMYA 1ISWA 3VM7A 1C7TA 3N17A 1HXKA 1CXIA 1QI2A 4H8VA 4B9ZA 1E6RA 4J3UA 2X8RA 3HG3A 4ZFMA 1M7XA 3AXIA 4H2CA 4A3YA 3VGBA 2C0HA 1UR2A 1TUXA 1LJYA 2QPUA 1UHVA 1NWUA 3EDJA 1QNPA 2W63A 1W1VA 1B1YA 3N15A 5CQ1A 3B9AA 2CIPA 3WUGA 5A8OA 5A6JA 3QGVA 1M03A 3VSTA 3WMSA 1W3LA 3NYDA 4Z2HA 2E8YA 3W6MA 2BHYA 1J12A 3VINA 2GJXA 1J0IA 2WCAA 3WUBA 2C8NA 2V38A 1UD5A 3KLKA 3TONA 5A2BA 1C7SA 1W3JA 3SCWA 4FNSA 3GXDA 5D8ZA 1KWGA 4HOZA 3BLPX 1UKSA 4HZ6A 1JNEA 3BAWA 4M56A 3U5YA 3K4AA 1UR4A 4MTVA 4AY1A 2O9PA 1ZB5A 3BVTA 1UOKA 4W7VA 2W61A 3ZQ9A 2JE8A 1VENA 3WQVA 1QVBA 1KGXA 3W4RA 3LXBA 1XH0A 1XYFA 4B3KA 3EMZA 3A6OA 5LYRA 4CCCA 4HZ8A 1VBUA 4NXSA 4AZ6A 4MDPA 1KCKA 2QPSA 4NXKA 4BZYA 5A8QA 4ACZA 5E09A 2JIEA 4ZENA 3LMYA 4D6FA 2V3GA 4EK7A 1UQZA 2CERA 3VX0A 5C8BB 2XM2A 1QI3A 1NP0A 5A6BA 5CSYA 3A21A 1B2YA 1ESWA 2FDMA 4ATLA 1E0VA 1NARA 3CBWA 4CVWA 1PX3A 2CKRA 4D71A 4IPNB 3KL5A 1NOUA 1E5JA 5CG0A 1PPIA 2NSXA 3WUFA 5D9PA 1E70M 1CYGA 2J74A 5ABEA 1HXJA 3BAYA 2J4GA 3OGRA 4M80A 4YHEA 3WQWA 3ZO9A 1JFXA 3IAQA 2QV4A 3ZJ7A 4AXNA 2BHUA 5BXRA 4QAWA 2WVUA 2YBUA 2ZX5A 3WF4A 2A3HA 1E72M 1BYDA 2D2OA 4TOQA 4GQRA 3VIHA 3BSGA 2WLYA 3M07A 4GINA 2V3FA 3CH9A 4QCFA 4TVUA 5E70A 3W0KA 3SURA 1PX8A 3RPMA 2XGIA 3VIKA 4URIA 2PBGA 3AMKA 3VD3A 3KL3A 3VDAA 4Y7EA 4BQ2A 3MUAA 1UWRA 3CUIA 3SCQA 2IXVA 3ARUA 1KBKA 3ZT5A 3WH9A 5EFFA 2J7EA 5JBFA 1GQIA 4J27A 2GK1A 5EBAA 3H54A 3DX0A 3CUJA 2VUYA 2G3MA 2B31A 2XVLA 3A24A 2OW6A 2WM0A 1SZNA 4UR9A 2BFGA 2ZE0A 3U7VA 1MYRA 1JI2A 3VM5A 1I75A 4RL3A 1GOKA 4E8DA 3MSDA 3CGTA 2VMFA 1FFRA 4OBRA 1QW9A 4TX6A 5FL0A 1QX1A 3RM4A 3LX9A 4H41A 4UFIA 1AQMA 2J8FA 1MFUA 4JL2A 2J79A 3MANA 3SCVA 1WDQA 4JHZA 2YL5A 3EDFA 4MB1A 4JCMA 3NSMA 5BXTA 5JBDA 4DO5A 2WC3A 1CXFA 1EO5A 1J0YA 1E4NA 3AOFA 1KTBA 1CWYA 5A6SA 2DDXA 2ZXDA 1Q6GA 3UETA 5ABHA 2OWXA 2WC4A 4LXFA 3VGDA 1TVNA 4AMWA 1XRVA 5D4YA 1J0JA 3VMOA 4C7FA 1OT1A 2WVVB 4KRTA 1I1XA 4TVDA 1H2JA 2X0YA 3FAWA 2CBVA 2XVNA 1QHOA 1E56A 5E9AA 3G6MA 1G01A 3HN3A 4M24A 1SFSA 3QOMA 4BCEA 1GW1A 3PZIA 2EADA 2D23A 3MSGA 3TTSA 1ISVA 3CHCA 1CGYA 1HJQA 1V0KA 1BFNA 1V6XA 3KEHA 1R47A 1UKOA 3IJ8A 3W81A 2ZUVA 3VGFA 2A3BA 2EABA 3CZEA 4D6GA 1E4IA 3GXTA 1EDTA 4PYSA 5FD0A 3WNKA 4PTXA 1E3ZA 3WELA 2WWDA 5A6MA 3WF3A 4LYRA 3ZR5A 1HT6A 1KTCA 4FNPA 1CGVA 2XN1A 1C8YA 2XYLA 1G1YA 2Y8KA 3O6AA 1JZ6A 3CZLA 2XVGA 1NP2A 1W2VA 1RP9A 1GNXA 1FH8A 2EAEA 1UD3A 2YFNA 1H09A 2OW7A 1DWFM 2WSKA 3E1F1 5ECUA 2VX4A 4RE3A 3QOKA 3EJPA 5KEZA 1K9EA 1IZKA 2E3ZA 2WSPA 1A47A 2BS9A 4W87A 1RH9A 1US2A 3SUUA 1C90A 1W9PA 3AS2A 4XUYA 3VIJA 1NOFA 3OLDA 3ARQA 4V27A 5A6AA 1FHLA 2IGTA 1C91A 1QI4A 1HVQA 3IAPA 2JIWA 2CEQA 4FK9A 3WDJA 1ISZA 1UD2A 4W5UA 2CHNA 2FGZA 4DO4A 1WAWA 3QHNA 1IZJA 1DEDA 2X2HA 1GVIA 2QHAA 3WF1A 1Y7VA 4W7UA 3WEMA 2O9OA 2WHLA 2WMIA 4D1JA 4AIEA 4W84A 1ZBKA 1W9UA 3HU7A 3QHOA 4PCSA 2VTFA 3AQUA 5CPTA 3VOCA 4F79A 2G4FA 1NOWA 5E6ZA 3GYCA 2EO7A 2W5FA 1JZ2A 3WNLA 3WY4A 2J7CA 2VZOA 1HJXA 5CJ5A 1Q6DA 3I3BA 3MUZ1 1JF5A 3L4TA 4YN5A 2E40A 2VVSA 2NT1A 2J62A 3BCFA 5A2CA 1MFVA 2BY2A 2XWDA 4AZHA 4CCEA 3K8LA 1XSJA 3MI6A 3ZIZA 1J9YA 4BS0A 4UQDA 4Z2LA 1WP6A 1JZ8A 1E40A 4MNLA 1GZJA 4NZCA 2ZXQA 4PUDA 2J7DA 1KR0A 3ZJ8A 4MADA 5A69A 3KLLA 1ECEA 4CD5A 1FP8A 4CUCA 1R75A 5A94A 1ITXA 4MJ2A 4WSJA 1E4MM 3VGHA 1R87A 1VJZA 1PZ2A 1XV8A 3N13A 3W26A 1BAGA 1GJUA 3UG3A 2OYKA 5JBEA 1KB3A 3WL0A 3HG2A 1X1NA 2JALA 3G6LA 1KBBA 1EHNA 3VU2A 4EKJA 3DHPA 3LXCA 3VDCA 1W9DM 2J7HA 4MPKA 2XTKA 2EPLX 2E9MA 3AS0A 4J3XA 4AZCB 1SMAA 1GQKA 1H5VA 1BF2A 1B31A 3O9NA 2WLZA 4QLJA 2DT3A 2WB5A 3I3EA 2F8QA 3MMUA 3PZUA 2D0HA 3TA9A 3MS8A 3T2OA 2FH8A 3FNDA 2XN2A 2YA0A 2CBIA 4AD4A 3GNOA 1RPKA 1C93A 3WD1A 3NDYA 4M1RA 1UYQA 4AC1X 1VB9A 4HZ7A 1V3MA 3AICA 1E0XA 3AZTA 1CGUA 1JAEA 2ZUWA 1BYAA 4WJXA 4WKHA 3W24A 1LL6A 3W82A 3OIHA 3THCA 4GO8A 2X2YA 1CZ1A 1TMQA 1QPKA 4UFKA 3WUEA 1UH3A 1ITCA 4HPHA 4OBSA 2BY3A 4GIAA 2XM1A 1B30A 1OSEA 2YDSA 1MW2A 2ZX9A 4DM1A 1V3LA 2YLLA 1DP0A 4MB3A 3CIVA 1JDCA 1E55A 4J3VA 4JFUA 2O9RA 1H1NA 3SCPA 3DYOA 3EJTA 3IJ9A 2OWWA 2J7FA 1JXJA 4W8BA 1C8QA 3BUDA 2J75A 1DWGM 1GOIA 1OD0A 1JNDA 1TE1A 3AHVA 1UA3A 3BAIA 4LX4A 3AZSA 4UFMA 4A4AA 3PZQA 1CNVA 4CD8A 1BQCA 1V02A 2DSUA 3AHZA 2CBUA 4A3HA 3WBAA 3NDZA 3D52A 1BYCA 2O92A 1US3A 5E0FA 1ZU8A 2GJXB 1CLVA 3ZR6A 3WF2A 3N04A 1JFHA 5A8PA 2WC7A 3T2PA 2Y24A 4X9YA 9CGTA 1W9VA 4JKKA 3EDDA 3UCQA 3ZMRA 1PX4A 5GNYA 5CZKA 1LWJA 3OG2A 2D0FA 1X6NA 2ZX8A 3BCDA 5D9MA 1XYZA 4YHGA 2VRJA 2WMGA 1LQ0A 1V6VA 3SCUA 4GQQA 1HVXA 1B3VA 2CKSA 5CLWA 4U3AA 5AC5A 4HA4A 1WCGA 3WNOA 2EXOA 3VVGA 2E9BA 4P8VA 3MMWA 4K68A 1MQPA 3VSVA 4BF7A 4P7OA 2DEPA 1UA7A 3VUPA 1CLXA 1PZ3A 2YFOA 4CCDA 1F4AA 3UR7A 3VMPA 4TUFA 5CXPA 1MVYA 1V02E 1UKQA 2WKLA 3THDA 2HISA 4TTGA 1EQPA 2G3IA 1OB0A 3BUBA 4W5ZA 3T0BA 2W66A 4D6EA 3A3HA 1KXHA 3GBEA 5DEZA 3VILA 4U2YA 2GVYA 1V0NA 3GNRA 2W91A 3GM8A 1CXKA 3WH7A 1UR8A 4KGLA 1PAMA 5I3DA 2YDRA 1E15A 3NUKA 3OBAA 1V3KA 2VR5A 4XZWA 1JDAA 2F7RA 5I78A 1BVZA 2W92A 1XH1A 2BVDA 3S2CA 5I5RA 4NRSA 4KH2A 4XB3A 3TTOA 1V03A 4WK9A 1WKYA 2GUYA 3NIYA 3L4XA 5KZ6A 1VEMA 1QBAA 3GXPA 2WBGA 1W3KA 2EPOA 1OBAA 1KGUA 3ZM8A 4H7VA 4CN4A 2GDVA 1P6WA 4UOJA 3OLEA 1HKMA 1VF8A 3T2QA 2JEQA 1TA3A 2V5CA 3WDRA 3ALFA 1BYBA 4JKMA 3AIRA 2J78A 1BPLB 2YKKA 4Z2JA 2VZVA 2A3EA 2PWEA 2VNCA 2D24A 4DWSD 3A47A 2YL6A 4OZOA 2V5DA 3WL1A 1GUVA 4LGXA 3BAJA 3ZSSA 2WZHA 2E8ZA 1IT0A 2QMJA 3AIVA 3DYPA 5EMYA 4M82A 2E0PA 3F4VA 1KCLA 2QLYA 5A2AA 2VL4A 3W29A 2CPUA 3CLWA 4IPLA 2F61A 1TQTA 3VKKA 5I2UA 4MNJA 4AZCA 3FY1A 1E6SM 4GZEA 3GXIA 3WY3A 4OOZA 3PZNA 4WKAA 3L2LA 2W67A 3T0DA 3PTMA 4Z2GA 3WEOA 1CECA 2QF8A 2WPGA 3H55A 5D9NA 1ZJAA 3RO8A 1JL8A 3BUIA 4E8CA 3IANA 4FNTA 4BQ4A 1QWUA 4PRWA 2O9TA 3FXYA 3CZNA 3GZAA 3WD3A 4H04A 3IJ7A 4R5EA 3B8SA 1BVNP 5IDIA 5I6SA 4KGJA 3I3DA 3SUSA 3DX4A 3GXMA 4ZE5A 3WENA 4M29A 4AMXA 2VX5A 5GNXA 3MKKA 3PBGA 3WMCA 3VD5A 3UEQA 2GJPA 3MUIA 2FE0A 1C92A 3BVWA 1M01A 4P7QA 4H8HA 1D7FA 1XD1A 2D3NA 3B9DA 3SCOA 3SEPA 2Y5EA 1GONA 2XSAA 2VT0A 1O7DC 2XUCA 4V28A 3MO4A 1TQUA 4AIOA 1UZ4A 2OSXA 4MAZA 1WDRA 2IUZA 4HMDA 4YPJA 3ARVA 2A3CA 5IFTA 4UOQA 5DO8A 5BRQA 4HTYA 4F8XA 1VIWA 3A4WA 3W6LA 4GI8A 3W37A 3POHA 3F5LA 3L4WA 2YL9A 1R46A 1MWOA 1CDGA 3OZOA 4EE9A 1W32A 3KZSA 1MW0A 1UD4A 2DT1A 1VFOA 3L4ZA 1CEOA 3VD7A 4W89A 1J0ZA 4J3SA 1TZ7A 3CZSA 1G9HA 2VZUA 4WSKA 2VJXA 1HF6A 3M7SA 1S46A 4ATDA 1W1TA 3SUVA 3WDIA 2GSJA 2D73A 3ECQA 2ZUSA 5HDRA 4HMEA 4D6HA 2OYLA 1E43A 1WB0A 1ZBWA 1KXQA 1B90A 2OYMA 3BVVA 2Z1KA 4P7NA 1EOKA 4W8AA 4ZEPA 5A6LA 1LL7A 3TV8A 3WEZA 1Q6FA 1CIUA 1JIBA 3VNZA 1UQYA 3WNNA 5IXEA 2EPMX 2CETA 1UWSA 3N18A 4J7RA 3AFBA 3ARSA 3PN8A 2ZUNA 4FLRA 1UH2A 4OIFA 4AZGA 1QI5A 2XN0A 4KMQA 3NSXA 2ZICA 1JGIA 2WZEA 4H8UA 4UFJA 2V3EA 4OGZA 4AZ5A 1R86A 3AYSA 3CHDA 3DX3A 1GOOA 3WN6A 3AHXA 2FH6A 7A3HA 3ZSTA 5FOOA 4FLOA 3VIMA 1JAKA 4XV0A 4TX8A 1ZL1A 3ZJ6A 4GPNA 4J3WA 3SUWA 2F18A 2XSBA 2VQTA 3AS3A 5HPOA 5A8NA 3ARRA 1BHGA 4HU8A 2DPEA 5GNZA 5DT5A 3BAXA 2FYVA 4QLKA 2WANA 5CPSA 1WZMA 2DGAA 1T0OA 3WFLA 4LYPA 1GORA 4F9JA 4FNRA 1O7AA 3QR3A 2X1IA 3ZT6A 3TTYA 1HTYA 5M03A 3M6DA 3AISA 2ZX6A 4C7GA 1QHZA 3PTKA 4PMRA 3U57A 1KQYA 4B3LA 4W93A 3MU7A 1ZS2A 1K6AA 1V0MA 3EJSA 2GFTA 2VZTA 3VIGA 1N82A 5DT7A 1FOBA 4UQAA 2G8ZA 3LPPA 3OZPA 3UERA 5D8WA 3AJ7A 4JL1A 3BAKA 4IM4A 3F5JA 3AIBA 3U5UA 1GOWA 4CD6A 1E1FA 4MDOA 1TQWA 1UD8A 3HG4A 4NX0A 2Y8VA 4DM2A 4HU0A 3EDKA 5A95A 1HL9A 5DFAA 4OKDA 4XX6A 1FH9A 3ZOAA 5I79A 3GTNA 1ODZA 4U33A 3BUQA 1RD6A 4PMVA 3BH4A 1NM9A 4U31A 1Q6CA 1H41A 3RMEA 4P8UA 2UY4A 2VURA 1I1WA 3OLIA 1C3FA 2JEPA 1AMYA 1UUQA 3WKZA 1B9ZA 2VCAA 2WK2A 4QFUA 3T08A 1J18A 1EA9C 1NWSA 3L2MA 2D0GA 2CBJA 2ZXBA 4U3CA 2WW5A 1WNOA 3VNYA 5E6YA 1D2KA 4UZUA 4M81A 3VPLA 2VCCA 1EQCA 3LPFA 4HA3A 2EBNA 1FFQA 4AISA 1E71M 3SCNA 1FP9A 3KE0A 2BV9A 2WMJA 4ACYA 1KGWA 4U2ZA 2C7FA 4P8XA 3FHQA 3GH7A 3WQ5A 4J3TA 3CUFA 3VX1A 4XZBA 1DWJM 4UQCA 3TP4A 6TAAA 3D50A 5IFPA 1IV8A 2XVKA 3U7BA 1KQZA 1OM0A 4JFSA 1OCQA 1UWTA 3AIQA 3OGSA 1XH2A 6A3HA 3FW6A 1HNYA 4BA0A 1K9TA 1QNOA 2CESA 3L4UA 4B15A 2WHJA 4S3KA 2WAGA 1DWHM 2YJQA 1TVPA 2X2JA 1BLIA 2PBOA 5F7UA 2J7GA 3L4VA 4P7LA 2BXZA 3D5HA 2FHCA 8A3HA 1G5AA 3CC1A 3AROA 4UQBA 3WQ6A 2WXDM 1JDDA 1UR0A 2WYSA 1QNRA 3ARWA 1CTNA 1HKIA 1JYXA 1GPFA 2F7OA 4WKFA 4AD0A 3EMCA 4DUVA 1V6UA 1HKKA 4GXPA 4Q22A 4PBGA 2PWDA 3A4XA 2ZOXA 4TTUA 3T0AA 2DIEA 3WMBA 4CVUA 4CGTA 3AXXA 1JZ3A 1UWQA 3PZGA 5I23A 1GQLA 3WQ4A 3UG4A 1UR1A 4N42A 3GXFA 5JIPA 2VX6A 3MUY1 3UESA 4IUGA 4HOWA 1XSIA 3VIIA 3ARXA 2DT0A 4AD1A 3CHEA 5EFDA 2YA2A 1EH9A 4S3JA 3RM9A 4FNQA 3BLBA 4FF5A 4AEFA 1ISXA 2G3JA 1E1EA 2XVPA 1LWHA 4AIUA 4DO6A 1C8XA 5M5DA 2WVTA 3WD4A 4MNMA 3CHFA 5BXSA 4ACZB 2YIHA 5BYWA 4FMVA 1SMDA 4AYGA 1PIGA 3RCNA 4AMCA 1JZ5A 3A22A 4Q7NA 3EYPA 1E5NA 2GJRA 2WVSA 1TA3B 1NWTA 2XPKA 4IISA 1H3GA 4BQ3A 3BVUA 5LA0A 1Q4NX 3VGGA 3CZJA 1PEZA 1BSIA 3DYMA 4CD7A 3WH6A 2E9LA 1DHKA 1K9DA 3BVXA 1GJWA 1OGSA 1W9XA 2WVVA 1EOMA 2XFYA 2CHOA 4ZE4A 3W28A 1R33A 2DH2A 1QNSA 4NF7A 3F5KA 3PZOA 1CGXA 2PWHA 3WF0A 3DHUA 2HVMA 4JFWA 3SIMA 3A23A 2ZUMA 4JAWA 1BG4A 1LF1A 2BNJA 4CN1A 3N9KA 1MQQA 4CN6A 1JI1A 4P8WA 1HP5A 2CXGA 2Q8XA 1E4LA 3S5YA 3HMCA 1B3WA 1OINA 1HKJA 5BROA 3GXNA 4UQEA 4JFVA 4X0VA 1MXGA 4PMOA 1TQVA 4QP0A 4V2XA 1CGTA 3A4AA 2EEXA 2F1AA 4FLQA 3PTQA 4PTMA 2WMKA 4RE2A 5LA1A 1WZKA 1WDSA 1XHGA 3H53A 1WPCA 1GHRA 1EDQA 4EANA 3W53A 4AYSA 1SR0A 1D3CA 3D4YA 4PCTA 3ARYA 5HXMA 4J28A 4GO9A 2F7QA 3EBVA 4JCLA 3MMDA 1NH6A 1JYVA 4FNUA 3SCSA 3ZJKA 3WDHA 2YL8A 4CKQA 1W1YA 2AAAA 2FHBA 1QBBA 2JF6A 1QWNA 3RDKA 5IHSA 4PMXA 4MJ4A 1J0HA 2VR4A 3RJYA 2WWCA 3VD9A 4PTVA 2PC8A 2EQDA 3WY1A 1DWAM 3RIKA 2GK1B 5D9OA 5M3WA 3NCOA 1GOQA 3VDHA 1L8NA 4FLSA 2WHMA 4PN2A 1R7OA 1JD9A 5BXPA 1KWKA 4X0NA 1QW8A 7TAAA 1J01A 3BXWA 3ARTA 1EXPA 3PZTA 2VQUA 2VCBA 1UG6A 3AHTA 5A8MA 1SYTA 3LPOA 5CGTA 1R7AA 4AZBA 1LG1A 2UY3A 4JHOA 3CV5A 1CPUA 5LA2A 2WMIB 2V3DA 3BUPA 3AIWA 3RILA 4PMDA 4W7WA 2VI0A 3AZRA 3OLGA 4LPCA 3WH8A 4Z2IA 3M46A 2ZX7A 3VD4A 4F66A 1JZ7A 4PMZA 3WIJA 3L4YA 1QNQA 3W38A 1CENA 1B0IA 3S5ZA 2YOCA 1W2PA 1ZBCA 3GH4A 1B3YA 3CMJA 3MV11 1W9BM 3WH5A 3CTTA 3VIOA 4JKLA 5A1AA 3N1AA 5TD4A 1VRXA 1OIFA 5AC4A 4AWEA 3JUGA 4LYQA 4UNIA 2F1BA 3EJUA 1B3XA 4DUWA 1Q6EA 3ZT7A 1VAHA 3LRMA 2OSWA 2XFFA 1UD6A 5BWFA 2WCSA 2Y4SA 5CPQA 1UH4A 4C7DA 3SUTA 3K8KA 5I77A 4B9YA 4MAVA 1CXLA 1OGGA 2VX7A 1VFUA 1TR1A 3CZKA 2OSYA 2JFEX 1GOMA 2DSVA 1E6QM 4TVCA 3CUHA 1KXVA 5HOSA 1H0GA 3LRKA 3CMGA 1U2YA 1PJ9A 5CGMA 3AMCA 3AI0A 3APGA 3VMNA 3K4DA 3AS1A 1KFWA 3VSUA 1GQJA 4PMNA 2DT2A 5E0CA 3K1DA 1NWRA 2VO5A 4KWUA 2OWCA 1MW3A 1V0LA 2D22A 2XG9A 3UR8A 1XC6A 1G94A 3LXAA 2PWGA 2CCRA 3WDQA 2VRQA 4KRUA 2XFRA 1PIFA 2XIBA 5CSUA 1L0PA 2WBKA 3VDBA 1J10A 5AYIA 1RP8A 3HZ3A 4M8UA 2XIIA 2JF7A 4NSBA 2WHKA 2Z1SA 3BMWA 3PZ9A 5AY7A 1EIBA 4UFHA 1VJSA 3VO0A 3ARPA 4ZXOA 4EAMA 1XGZA 1ISYA 4W8LA 1XD0A 5BRPA 2WKGA 4P7RA 1V3HA 2ZIDA 1JYWA 2UY5A 3DC0A 4D72A 1Z32X 1R8LA 1TG7A 2J77A 1GHSA 2G3NA 2YDQA 2IXUA 1XSKA 2CITA 2YBTA 2E4TA 3RJXA 1VEPA 1PS3A 2VOTA 3DX1A 2J47A 5EB8A 1LG2A 2FGLA 3POCA 5GPRA 1EO7A 2ZUTA 1HN1A 4MB5A 3D4ZA 4D6DA 2QMKA 3IGUA 1BGAA 2DH3A 4UTFA 4AEEA 1VEOA 3AIEA 2NW0A 3VIPA 1TCMA 3K8MA 3TTQA 2PI6A 2XJ7A 4UFLA 3W27A 5M17A 5BCAA 4RE4A 1GVYA 4PEEA 2OLHA 5IHRA 1V08A 3AMDA 1E3XA 2VZSA 1E6ZA 2J25A 3NJ3A 2CYGA 2ESCA 3EDEA 1BG9A 1BTCA 3GDBA 1WZLA 1V6WA 1YQ2A 3AIUA 4AW7A 4B16A 4CU8A 1HWWA 5FCZA 5JIWA 3FAXA 2EPKX 2XGBA 1F4HA 1WO2A 4PMUA 4PMQA 2X05A 4BQ5A 1HIZA 1JXKA 4AD2A 3HG5A 3O2LA 5JUVA 1PBGA 1H49A 3S6TA 5E1QA 1ODUA 4JIEA 2WNWA 4QCEA 2W4XA 1E0WA 3WSUA 4UCFA 2ALWA 1VFFA
chains in the Genus database with same CATH superfamily
1NL0H 1H8OA 3IPBA 2VFIA 4LC6A 6PCYA 3LKSA 4A8NA 1VBJA 4JO4H 1KCSL 2Y2WA 2OT0A 3E9TA 3FT3B 2HPIA 4M61A 3LNMA 4P7QA 2YSSA 3Q6FB 3MGOB 1QPNA 1DQTA 2HVJA 1EGZA 1RZFH 4EF9A 4JFXA 4IMEA 3K46A 4PY7A 3DJSA 2A2QT 4A2HA 3BJ91 5B8CA 3MVIA 2F58L 1M6OB 1AD4A 4AGQA 3W25A 3ARFA 4NO0D 3GNPA 4ZTOL 4LAOA 1VCBC 5E2TL 4PGDB 4H44C 4GLRH 2MCPL 3RY6C 3NZHL 3TZVA 4N0YL 3WCYA 1AH4A 4HH8A 1RV8A 5EIIG 1W5PA 2PO6D 4JDYA 4PPTA 1HSAB 1VBRA 1A3ZA 3VAVA 1FIEA 1XLCA 4L3EE 1L9WA 4BCEA 2VIRB 4XZUA 2ADFH 4KRZA 4HIPA 2WAQA 4UC5A 3W39A 1XDMA 3HZVB 4KCWA 1MCDA 2AQVA 2QCDB 1JZEA 3QUMA 5AOMA 1RUML 4WU5B 2VVNA 2PWFA 3O2VL 1W91A 2XHYA 4MJIE 4DZIA 1U41A 4G1EB 3ERPA 2Z7ZA 3JWDC 3AMGA 3LKSB 1A5UA 3MUGB 3O0FA 3T4YA 3BWUF 4HA1A 4UTLA 5KBPA 2NNFA 3M1BA 2C1HA 1UFGA 1FN4B 1U21A 3MCKB 3L3IB 4KRPD 1JZHA 1TWZA 4C6JA 2CJUH 3IFLL 2Z92B 4MNKA 3C8KA 3QV7A 3QCUL 6CGTA 4AMAA 1N0LB 4WGWB 4B90A 2OKTA 5EB9A 5GRJL 3IUDA 1BQUA 2HXTA 1W3NA 5BVPL 5KVGH 3EF7A 5JXEA 3S2JA 1T8QA 1E6XM 4A7TA 4IRSD 2PA6A 3FH7A 4GO6B 3QZWG 4HUMB 4KI5E 3TBYA 4YS4A 2J55A 4JG1L 1GJPA 1HNGA 2DM7A 1RPXA 3IS1X 2R24A 5GGVL 4OQTA 4XIMA 3T09A 3W3OA 2FO4B 3X11B 1ZWIA 3MRIB 3L0NA 3D2TA 1OP9A 5CR1A 5LGJA 4W9IC 2WM1A 3UXDA 1T22A 2X09A 2AKRA 4HWBA 1XUUA 3BGJA 5CILL 3FTZA 4MNQE 1CBVL 4TMBA 1QATA 3EBHA 1YNYA 4GKTA 3SECA 2EACA 2HAZA 3MJ9H 4YMZA 3W0WE 3UG5A 2C5DC 2P0OA 2ZUUA 4XR8C 1KFGA 1ZGLB 1K9FA 1TREA 5CKSA 2XISA 4JPVH 3ILQC 3J2PA 4AYDC 4Z23A 2GSGB 4FF9A 5I16B 1OFBA 2XI9A 4NWUH 1UZ1A 1G7PA 5J89A 3DA0A 5C09A 4XCNB 3NRFA 3IU4L 1SN0A 4PJHF 5FKYA 3SO7A 2FLBT 4O5LL 2NSOA 1SFHA 1WQ5A 4UIOA 1XR8A 5T3XD 4G7FA 4FQXA 2DWEA 3ZQWA 3LV3A 1NANH 2ZUQB 3N1GC 3CLEH 3CPUA 3GZKA 1MJUH 1DL7H 2VMEA 3LIZH 4YR6A 2EDYA 1T0MB 3JV0A 3KR3L 3QZLA 3TYGL 5JIIA 3KDMB 4G1EA 1T5WA 1R0AL 2XWEA 4NGHH 4E4UA 3UWWA 1LE9A 5I17B 5KZDA 3ABGA 1ZV5A 2BNQE 3ZKQD 3OVQA 2WCGA 1IC4L 4MXQD 4XX1E 4YOKA 2YPKA 4HFWA 1H7OA 4MS8D 5BNKA 1J0KA 5GQBA 2GGJA 5AVVB 3TBVB 1QRQA 1RSFA 2VIRA 4XZUB 1F3EA 4PWEA 1MNSA 1Z9AA 1DTUA 1RULL 3P11L 3QIBD 2BWQA 2EE9A 1D3GA 2ATSA 1AKJB 1DYZA 1NFBA 2AEPH 4D6IA 4I1PA 5A6KA 4ZAKA 4MMXA 3UO8B 1XIHA 1DVTA 3MUHL 1JF6A 1TQSA 3OD3A 4HPYL 1GY2A 1DHPA 3WCZA 1X4XA 3U9IA 3HJEA 35C8L 3T2NL 3ZHLA 3KHDA 4H0IA 3D6NA 2ADJA 3MRKA 4OZHE 2EDOA 5GS1C 2C71A 2CLHA 3MRGB 4WWKB 4MCZB 4JTRA 1QQDB 4L23A 3D39D 4PWGA 3T1FA 1ADQL 3SR7A 2R0KL 3W57A 3WKML 4XN7A 4BGDA 2DIJA 3OP2A 5T8GA 3SGDH 3CDZB 4GKLA 1L6XA 4QTHB 4R3SA 4PP2A 1AQFA 1FZKB 5JUEL 2XWTB 1OP5K 2F8IA 3N43B 4H8WL 2VC5A 1D6EB 2DUXA 1WBXA 4EO5A 2R94A 1J9QA 4FI4A 4N90D 3AXMA 3PC0A 2X3BA 3NP4A 3WDPP 3EJQA 4OZHB 3PRZA 2BZDA 4F37K 5I28A 1AACA 4FQQA 3QHMA 4HSAC 3PWUA 3O6FC 4FFZL 5E08H 4Z7IA 1JMXA 1T20B 2BS71 3PDGA 2DSKA 1OT2A 1DO6A 1RIHL 5I0VA 4NIYE 1TQBB 3O8AA 1OCRB 3OSKA 5IB2A 1JDEA 2X44D 4LU0A 3BQUA 4P3DA 5AZEH 1UP2A 2E5CA 3C5ZB 3QEQA 5IUSA 1TCDA 2FX7L 5IM7B 4J3ZA 4ZTXA 4NFDA 2PLCA 3V5KB 1UB5B 4KHXL 4UTUA 2OQYA 1ETJA 1KTRL 3LSOB 2PABA 1WUZA 5C70A 4PJ7E 1GG0A 3DN5A 4TXEA 4UTJA 5J5RA 1EZVY 5E0KA 4GXUM 3O8XC 2W79A 2ITCA 5K93A 4ETQA 2QUUA 3BOFA 3QEGL 1SW3A 3NFNA 2BRQA 2PW2A 4YTRA 5CAKA 4P4KC 4H00A 3ID7A 5E5UB 3QDMA 1AHMA 2B39A 5HQMA 3LHVA 4AH2B 4CVZA 3EMQA 4OOUA 3QJTB 8CGTA 2I9TA 4YHOH 2QULA 2CKBL 2VLRB 3BH9B 3BW9B 5H37A 1JPSL 1S7RB 4KVPA 1F76A 2OOFA 2L04A 3UZQB 1WFJA 5IT2H 5EMMA 3LB6C 4HPOL 3ETTA 3S5LB 3REWA 4HUVB 1QI0A 4Z7WF 1EYWA 5DU7A 4Z95H 3DURA 3WE6A 3GSOB 4H8NA 3ZXWA 1QBLH 4R4FH 2VQ4A 2YGPA 4NNYA 1RIUL 5DBTA 1BWWA 3ECWA 3KXQA 3HZKB 4Y5YA 3HE7A 3ATDA 3BDYL 3S6CA 2O5NA 5HBFA 1I9IH 4LUSA 5HY9B 3WBEA 2E6JA 1J11A 3IFPA 1B3ZA 1X9QA 1Z41A 4L64A 3VI2A 1LCOA 2IKIA 1UVQB 3THAA 2GQHA 2YN3A 4N2FA 5DWPA 1GQNA 5D2XA 2ATPB 3FQWA 4Y4FC 5HYEA 5AOLA 5FL1A 3PNRB 5TH2A 2DMBA 4JN2A 5B1BB 1M53A 1JG9A 1RK0A 1UKTA 3O6LH 3JQOB 3KPNB 4HETA 4M7LH 5GZNA 2YUXA 3E8UH 4PJEF 5C0EA 1HKWA 1VCVA 4WO4C 2R1PA 2NWSA 1L3WA 1OGBA 4EUPA 5E8OB 1XB3A 1W72L 2ALAA 4NNPL 4JG0H 2DM3A 4JMNA 3WD2A 3K74B 4XO3A 1F97A 3QDGA 3HZMB 4HEME 4R9HA 4PYHA 4WLCA 4OCXH 3ZHNA 4U49A 2XN9E 3AY2A 3QUKB 5G2NA 4N2YA 3W7DA 1O7SA 2VRKA 4ZAKC 3W7LA 1JGUL 4JTGA 2EJ1A 2OAAA 2AEOA 1VC4A 3GSWB 4TOYH 4GG6A 5L8JB 2UWFA 1NJJA 3IGHX 4HN4A 1T4KB 5KTLA 4BEUA 3T1WA 1DUYA 1CTOA 4PB9H 5F9JA 5F2GA 1O6TA 4LAQL 3FQXB 4NT6B 4X2UA 4QDWA 2X2GA 2VMJA 1XF5B 2DYPD 2AK4D 4IRJC 1EMTH 4JRXE 4TLKA 3QISA 1TIUA 4FQ1H 5T5FA 3BJSA 5RUBA 2R29L 3GRGA 3OPUA 1U93A 3SBRA 1XX1A 2X1UA 2J1WA 2ACUA 2QGDA 1EP3A 3TQ0A 4IHCA 1T7LA 3F7PC 3VM7A 1C7TA 1AHKA 3QT2A 1BF5A 2BXVA 1MI5A 3N17A 1HXKA 1T04A 4MY8A 5HDBF 1SO3A 1N7MH 1F3DH 3UXIA 1G6VK 2WLIB 5DRXB 1I82A 1X5FA 4I18C 5I1AB 4BSJA 2X4OA 3VGBA 4QTHA 4R3SB 5TDOA 2O56A 3CL6A 4ZTYA 3SQOL 3V4PA 2D9QB 3GFZA 2WQSA 3IGSA 4GD0A 4WVXA 1GWJA 3AU6A 4L3AA 2VJ8A 3Q48A 2BIOA 3IJQA 5AC8A 1KN4H 3ZE1F 2AXGA 3U4BH 3QFEA 2GAZA 3KPLA 4BFFA 2QXWA 2X30A 3TVMB 4KEUA 3F2DA 2EC8A 2W0FA 2CLZB 2NUPB 3GMMA 3VD2A 1CLYL 1Y07A 5CQ1A 5DJ2A 3B9AA 4OVXA 1HHJB 1N8IA 3PXLA 5A8OA 1DXFA 3DTUB 1I8IB 2OMWB 3DJTA 4IGMA 4P2CG 1XDJA 5LBSL 4GP8B 3O2DH 2NCMA 1S7SA 4F7TA 4W4QA 3VQMA 2J6WA 2NY3C 4GBXD 2WUCL 4V11A 5JHMA 1HC1A 3VH8G 5D38A 1WC7B 1V7NH 2DYPB 1XF5A 4P4RB 3AYVA 3W6MA 4LSTL 2YPKB 2QCLA 5E1AA 1NJ9B 3V5OA 4PJAB 1RUAL 4HIEA 4QHLA 1J0IA 2PTVA 3ZE0E 1JXFA 5K33A 5IHLB 1EGJH 2WCAA 1UWFA 4YX2H 3P82A 3V55A 4DW2H 3U25A 4JTTA 2XPGA 2V38A 5T9BG 4RGOL 4NAQA 1GYNA 3C2VA 3MZTA 4KMTL 4XBGA 1C7SA 3GSNB 1W3JA 3UYCA 1JDFA 3WLKX 4UTAH 4FNSA 1LJMA 2N7AA 3KVDD 3GXDA 3WJZA 1KBPA 2Y22A 4O15A 4IMAA 4JGMA 4L4TA 4LF1A 1KWGA 4Q33A 1U3HC 3LCLA 1UKSA 2C9PA 2OPCA 3NDOA 1Q0YL 2EKJA 4NENB 3CU1A 5FAGA 3U5YA 3AAZA 3GK8L 1DVFA 2HROA 4C4KO 3O2WL 1PHWA 5TQ2H 5H2BA 2O9PA 4ALDA 1D9KD 2YQ2A 1UOKA 1CL7H 5K9OB 5EPMB 3LDBC 4HX1A 3K71A 1P7KB 1EGJA 3RUGF 1VZIA 2LABA 4JGJA 4X5XA 1SHXA 2NX1A 2VKZG 4W7VA 1S3RA 2JE8A 4I7UA 1VENA 2ZZ6A 3WQVA 2HTKD 1URZA 4KEMA 4MJIA 4ZW8A 1U3YA 2NY1B 2V5SA 3HE7B 1QVBA 5D2NA 1XLEA 3KBMA 4L1GA 4HBKA 3LXBA 4E41D 1XH0A 1K5NA 3FB7B 3N14A 2PUQT 2IDCA 4FL4C 3VNJA 2KLRA 3MNMA 4U1HB 2W0UA 1GHFL 1WT5C 5ACLA 2ANUA 3EMZA 1XIJA 1V7MH 4IKNA 4RGMB 4L3EA 4GX9A 4E41E 5HYFA 2EVJA 4I1RA 4NM4L 2PPDA 1OGAB 4QMEA 1KJVA 4DAGL 3CUPA 4E9YA 5L88L 4L6DA 2QPSA 2R69L 4LAKA 2DQDH 2WHVA 2VEFA 1TCRB 3WXVH 4IQDA 2OTUA 4WO0A 4KZDL 5B1CA 5E09A 4B2DD 3SGEI 1TTFA 3HPLA 4C56E 1I3RA 4D6FA 3MV7D 1SOKA 2Z92A 3D5OF 4YDIH 5JDSA 4G7EA 1QFUL 2J5WA 1UQZA 3N2JA 1MCBA 3PYCA 3VX0A 2XM2A 3VFTB 4WHYG 5FF7A 3B7UX 4GYBA 4UR8A 4QLRA 1DEEA 1B2YA 3V4PH 2XFXB 3B3DA 5A6BA 1KBVA 5GRYA 1FVDA 3D3VD 4BFGA 1IC7L 1UZHA 1SUXA 4PV9B 3HBGA 1ZCOA 1IKNC 3ZZLA 2FPVA 4H9TA 1AIFB 2HXAA 4HKPA 3KYMB 1W6LA 1AG6A 3LS5L 4GW4B 4O53A 1NFPA 2HT2D 4ZB2A 4AVOA 4MD4A 3KPRA 5CG0A 3C5ZA 3I6GB 2BNQB 4UMSA 3EWZA 3ZO0A 4MQ7A 2J74A 5ABEA 4RMUA 5EU4B 2E7BA 1ZGDA 3KBJA 4PZVA 4JGNA 3PR2A 4GAJH 2J4GA 5AUMB 1T96A 4M80A 1YMHA 4I2XE 4PY8J 4RGOH 4TR9A 1SOSA 5G4EA 2OXHB 2GQAA 3VVWA 3L7EA 1GVQA 2QSVA 1JFXA 3X14B 2QV4A 4JHAL 4L9LB 2BHUA 3EB2A 4OV4A 4WXYA 2YBUA 2WXNA 4ANXA 2QR0A 2E7HA 1TEYA 4LKCB 4ZNEA 2Z00A 3GTIA 3M0JA 1D6VL 2BVOA 4AYFA 3CEUA 4BWLA 5K4XA 1TVBB 4Y9MA 4L1BA 1E9QA 4ONOA 5FO8B 3UGVA 3GMPA 1EPFA 4MKSA 5IVXE 3BHBB 1MUWA 3RPKA 3WLBB 3VIHA 2CLVA 4C5ZA 3D07A 2AQRA 3N29A 4PEKA 1IO4C 5HHPB 4IRJA 4QCFA 3GBML 2GSMB 4OFYD 3PP4L 4IJ3B 4U1IA 4F57H 4R85A 1ONXA 1AZRA 2Z1XA 1PX8A 1AANA 1F11B 4KTDH 2NUXA 1VYSX 5FESA 1FAIL 3LNGA 4DZAA 4H8PA 4H26A 2ZG3A 1VYRA 3AMKA 3L9BA 4XP6L 1DLHA 4HK5A 5J06A 3BESR 3OKLB 3O3EA 3IGAB 1G67A 1YN7B 4YDVB 2W81C 3NFPB 1UWRA 2PWVA 4PUUA 2R4SL 5F1IB 3ARUA 1DL3A 2IXVA 3R8RA 1WICA 3ZT5A 3TYUA 3TBVA 4PTTB 1CICC 1QTWA 3LZFL 4CBPA 3RNQA 1QWKA 3LKOA 3VXRE 5JBFA 5EBAA 2RQEA 4KIEA 3C5JB 1EAQA 3H54A 2J1XA 4WKZA 1YEHL 5L8KB 3WU1A 3CUJA 3PP7A 2H6PA 2X4PA 3NCEB 2VYOA 1CVSC 4B9FA 1K6QL 3E2QA 4OD1H 3A24A 4IOTA 1SZNA 4JG5A 4GGHA 4UR9A 2C9SA 2DL9A 4PGCA 4PUMA 2ICWI 1FHGA 1AY1H 1I1AA 4JPSA 4N2EA 5B22A 3UC0H 1THFD 2R1WB 3L1FA 3NEEA 4WJKB 1MREL 3ITOA 3TBWB 3MB9A 2NY2B 3D08A 3VM5A 2GBTA 4G42A 3QDJE 2BOBB 2A6KB 3MSDA 1U2CA 1XCTB 2VL5A 1WRFA 3CGTA 2L7JA 4XMUA 2GYIA 1I1RA 2L7UA 1QDSA 3FLUA 5F21B 4OBRA 1QW9A 5GXBB 1FP5A 1ONRA 4TX6A 3RM4A 1S7QA 2FNWA 3CQ0A 5DSCA 3BO8B 4OGYL 4BXVA 1AQMA 4H41A 5LIXX 5DHVH 4ZFGH 3NZGA 1QEWA 3EFOA 3K6NA 2RQ8A 2J8FA 1MCWM 4PV8A 3P4MA 5I6OA 1T0NB 5IG7B 1E7UA 3B9KD 2J79A 3OM3B 2BC4B 4LDLB 3SCVA 4GK8A 3HNTH 4Q8PA 5HI4D 1IWBA 5LNRA 1WDQA 4GQ9H 2NY7L 3CFUA 2Y6SC 5IWLA 4IP5A 1KENL 3EDFA 2FO4A 4GSUA 4W4OA 3X11A 5F1SA 4MB1A 3KPMB 2R2HB 2X1RA 3NCYP 5IROC 3V8CA 1W0WA 4U3SB 3KOXA 2YR3A 1GPOL 2DVXA 1YBQB 1CXFA 1EO5A 4TNVK 1E4NA 4JTDA 1CWYA 2ZKHL 3MNDA 1Q6GA 1A6TA 3KWSA 5ABHA 3OXRB 3PK7A 3LI0A 4HEPA 3HOGA 3WOVA 3KOWA 3FRPB 3VGDA 4ANWA 3UWVA 1XRVA 1FV1A 4KK8D 1AMXA 2DQJH 3N1PC 3T0CA 4OU1A 4DK6A 4C7FA 2WVVB 3HPJA 1ICQA 3HR6A 1RQEA 3GSUA 1UB6B 1XEUA 1YNTA 4O02H 2R8SH 3Q2LA 1OCWL 4M6NH 4C59B 4UOW0 3OHXB 1EHKB 5BV7H 2ZZUT 3AB0C 4NQDA 3FBQA 3QA3A 3STZA 3VXTA 2DTMH 3FO0L 5CGYC 3FAWA 4LCWE 3UZVB 4LLVB 2CBVA 1GOGA 1FCUA 1SHMA 2CE6A 4ZMXA 4RWHA 2Q86A 2BCMA 2Y7MA 5E9AA 1NAKH 4LLWB 4RRPM 5GGQH 5A2IH 1JRBA 5G4HC 2CGZA 2P8BA 3RMJA 3OC5A 1X1NA 1TKWA 3B9KB 2BFVH 2OTWB 2XQYK 4PRIA 3UIYA 1IWAA 3QOMA 4PB3A 1MCQA 3X1EA 4K23H 1ZZMA 4QSHA 3TMQA 3C5ZD 4Q56A 5DZAA 2EADA 5I71B 1TXKA 3AQZA 4NWUL 4M1GL 2RCSL 4R7WA 4B4HA 3TTSA 1DBAH 2J21A 3APMA 3EADA 2NYZA 3QO0A 2GJLA 1AGDA 4U6YB 1HJQA 4HQVA 4K39A 5EWIL 2VDNL 3ZS4A 4DGYH 1YHPA 3KEHA 3KLHD 2R1KA 1KRAC 4PGLA 4M9PA 3D69B 2DI8A 3W81A 4HAFA 5BW7A 1XICA 4YS1A 5J9PA 4HPJA 5FJPA 3CZEA 5CFAA 3T3PB 2QW5A 1IEAB 4GKZA 4HHPA 4IJCA 5EKYA 1MWAA 2JF1A 3FIGA 2K4WA 5FD0A 1A9EA 4G9DB 1TETL 3WNKA 4PQXA 4ZMTA 1WWWX 2Z8WC 1E3ZA 3OMNB 5A6MA 3CLMA 1VGEH 3LLXA 5AB0A 5EMKA 5HYIA 3QXUA 1KV8A 1P7BA 3D09A 4X7DC 1QNZL 4RGNB 3QVQA 3QULA 3C6LC 3NIDB 4IRZH 5IJVB 1MHHB 3R06A 3DXAA 1EX5A 4X50A 4PCNA 2DVTA 3AC0A 3MJ9A 1CS6A 2XN1A 2JCCA 3EFDH 1AR1B 2XYLA 1G1YA 4XX6A 3RX4A 5JYMA 1YNKL 4HZLA 4OCYH 2Y36H 1OSZB 1QFWL 4PRPA 5L2KB 1RP9A 3DX6A 4HWBH 1GNXA 3MT1A 4XTDA 2AERT 4OF3A 2EAEA 5E4IA 3UGXA 1MWAL 1UD3A 2ED6A 3CB3A 3BKYL 2DTSA 2OW7A 3QUXB 4MD5B 4N3TA 4ICCX 3HI1A 5EEVA 2CGRL 3N1MC 4LLMA 2JJSC 2VX4A 4G6FB 5AAWA 5EZIL 3EJPA 1K9EA 4J4PD 3DARA 3WFCH 1LL1A 3TS8A 1A47A 2E3ZA 5G2HA 2YRZA 4XCEB 4CMMA 3PUEA 1T1WA 3LH2H 4XUYA 1JZFA 1PVNA 2CDFB 3OLDA 1KJMB 5F7FA 3O45B 1S3HA 2E4FA 3CDGB 3QXDB 4MA7H 4WK4B 3OJDB 2Z7WA 4Y2DB 2QJGA 2JIWA 2CEQA 3CQFA 1UFUA 3WDJA 1ISZA 4JOMA 2E67A 5FKAA 4DVBB 3ILDA 5B38B 5GGRB 1N59A 4W5UA 2FGZA 4JY6B 2ADFL 1OGPA 2QCFA 3S3CB 4U6HB 1ACYL 1IZJA 1DEDA 4C56B 5FUCE 1J48A 5J6GB 1RBAA 4IG2A 4C6IA 1IRAY 2JXMB 3LRGA 1P5VA 1PL3A 4W9JC 1UZ6E 2FLIA 3VFNB 4GSDH 3NCJL 4A05A 4Q9QH 4XNQA 4QY8B 1UWAA 4X42A 1F6AB 3N9SA 2A9DA 1CGSL 1HKLL 2GCYA 2HSIA 5E2UH 6REQA 2IH1A 2RFXB 4W84A 3W7GA 5J13C 1NGPH 1HOCA 2IBGA 2BP8A 2QSCH 4IBZA 4LBRA 3BFWA 1DE4A 4CSTA 2YGQA 1XB8A 4A68A 4YLCA 1UT9A 5MENA 2YAMA 1RZMA 5DMLA 4Y7EA 4RGMC 3V4LA 1KB9J 2EO1A 1N7KA 4I18B 1NSNH 3NQDA 4X83A 5EO0B 3KTXA 2MHAB 1JZ2A 5FYKL 4GUCA 3KM2A 2VDPL 1MLCB 3WNLA 2W65B 3IFOA 4YHYC 4HKXB 2XNAB 2IPTL 4JUTA 2NNXA 3QTGA 4J5NA 1IFHL 1ECYA 3LRSB 4Q2ZA 4JDZA 4HJUA 3V0IA 3QYNA 1WDWA 1QOQA 3ANUA 3GGWA 4KXBA 2H3BA 2IWKA 1YYML 3HA0A 3L4TA 4YN5A 2E40A 2VVSA 1LRQA 3F05A 2Q8AH 5A3IC 5JR1L 2F6XA 3VNDA 3VFVA 1OM3L 4YHZL 2VN4A 4DFIA 3CQJA 2V5YA 3BCFA 3BEWA 3VWKB 3LK6A 1NIBA 4ZFFB 4ZX4A 2VO8A 2J8HA 3B3IB 3K8LA 3L2NA 3OPZL 3BXNA 3BRDA 4HCHA 4JZJA 4ERIA 2VSKB 1J9YA 1KDIA 3W1RA 4ES9A 5FUCC 4IMLA 4IOSA 1HTIA 3LZQA 4O13A 3HZYB 2PTZA 5D7HA 3RFZC 4LVFA 4LT9A 5EIVA 5CSZA 4FX6M 4MJ5A 2E47A 2H3NA 2A6DA 3KLLA 4HIXL 3O3DA 4ADGA 2J6EA 3C0QA 5D96B 4NBYB 5IW6B 1G4RA 4XZLX 4CD5A 5DQJA 1SMOA 1T3FA 1CD8A 2F53D 4PS7A 4UM8B 4CADA 4EBQL 3VD1A 1JULA 5A94A 2FX9H 2ZJSL 1E4MM 2QQKH 1H15A 4FX8A 2QVHA 4LUIA 1XV8A 3W26A 3TBTB 1BVNT 4F7EA 1BM3L 3CLEL 2QKIC 3GFXA 4LS0A 4N8VB 3RVUC 3HG2A 1JPMA 4F7MB 4FERA 1F0LA 4JN1L 2BFVL 3PLYA 5DD3L 1LK3H 5HVFB 3UTSA 5KSBA 3QI9C 3GHSA 1XMWA 4R90H 3E6EA 3AM8A 4UANA 4DCQA 5SX5K 2CBTA 4JY5H 4XI5D 2ON3A 4RDQF 1Y5XA 4XOBA 3U79A 4DQAA 5E1GA 3C2EA 3K5XA 3VDCA 1BJ1H 3SD5A 3MWCA 2E9IA 1DN2A 5DMKA 2LLEA 3FO1A 5DEJA 3LCIA 1OSZA 4PRPB 1D2OA 3W11C 5L2KA 5CPNA 2PO6A 2FO8A 3P3BA 4Q4OA 2YBGA 4WUKH 3VXSB 3BJFA 4J3XA 4I9MA 1X4YA 3A4DA 1FWJC 1GQKA 3ABKB 5GRJH 5TBOA 2NUTA 3C6LD 5AOUA 2WLZA 4QXGH 3ZUCA 1EZVX 2EDFA 4N2NA 4QLJA 3BYYA 4BGLA 5KOVC 3PGDB 3I3EA 1IBBA 4I48B 5EC1A 2YGOA 2ZTBA 4FG2A 3H2FA 2D0HA 2O26U 1RJCA 1UZ8A 3RWIA 3XINA 1D9KC 3GC3A 3N1QC 1OCBA 4XC1H 1X7FA 5CBEB 3ZZ1A 1EJOH 4YSRA 1KM4A 3IM1A 3FNDA 1E4KA 2YA0A 3FUHA 4Q4IA 2CBIA 4YC2C 1CI1A 2QQNH 2QVKA 1MY5A 1A4KB 2H2SC 1GR7A 2BPBA 3FK3A 4K3JL 4N90E 4PCYA 4WI7A 5IGXH 4N25A 3W1LA 2R2CA 4HZ7A 5J3HC 4DQOH 1ECQA 1AXSB 3IFLH 2F1EA 4PU2A 2IH3A 4AKOA 3ONBA 1E9PA 4AWUA 2G30A 3AZTA 4EJ1C 1RIHH 4QITA 1GMEA 1CGUA 4EOUA 1QLEH 5G1YA 2OO0A 1XBRA 1JAEA 2A6JA 3P4OA 1SYSB 4K9EH 4LVHB 5LGHL 4ODUB 4MYPA 5HHXL 3SO3C 3OAYK 1JEZA 3UJIH 1LP6A 3W24A 1XLKA 4BJHA 3OIHA 3ZL4L 4NNXB 3MCNA 3KLDA 1IAKA 1BAWA 3MLSL 4CVZB 5KW9L 5AOIA 5J11B 2G4JA 1AGCA 3UOAB 1TO5A 2YPLA 3GBLA 4FG6C 4NJ9H 3NACL 5F3FA 5HGDB 1O7VA 3KCLA 3NXLA 2VM4A 4UTBH 3DGGB 5FS5A 5FFGA 4FX5A 3UPCA 3X1NA 3GKWL 4AW4A 5D4HA 4PBVC 4A6YH 5I18H 1Q9LA 2WXOA 2ZX9A 1G6CA 2X4UB 3O0RL 5ILTH 1PYFA 1F41A 4BUQA 5KVDL 4J3VA 3GDLA 3LZRA 3RZCD 4Z7AA 2CMRH 3CHPA 5TE7H 2O9RA 5A2JH 2O6DA 3EH3B 5C0BB 1TPWA 1L0XA 3D87B 3I65A 1YEEL 2X4TB 2QADB 1Z9NA 2FFCA 2FZDA 3TR9A 4AVFA 2J75A 1XL4A 1JZGA 2GJ6E 3EGJA 1YLBB 4O0ZA 3UZYA 2R2HA 5F3BB 3QIWB 1FNGA 3HNVL 4O2FB 3HS9A 4MMZB 1P5UB 3GRWL 4LCCB 1TE1A 2IKHA 3GRIA 1SY6L 1JGDA 3ZDXB 3OHIA 1ET8A 5HDBE 1CDYA 3EYOB 1S38A 1H3TA 3PZQA 1CNVA 2YD5A 4FJ6A 1BQCA 1I85C 2OCFD 2OR7A 3KRBA 2FJHB 1HJCA 1RJRA 2VC7A 2P44B 2X9YA 1KFBA 1OQFA 3AO0A 4ELMF 3LKQA 3MJWA 3AHZA 1TJHH 2ERJC 4BK8A 1YPIA 1UM4L 4TUOB 4HSHA 4F37F 1M6JA 3Q2VA 5KBNC 3VFWB 3NDZA 1OZUA 3ZVIA 2K6YA 4CEXC 2Y6SD 2PXYA 4QGYA 3WHE1 1BYCA 1KIUB 1US3A 2O92A 5E0FA 3ECBA 5MHBA 1E6JH 2X1QA 3JV6A 4Y19D 1RZIA 3VXQA 1S9KC 2GJXB 1KO0A 1XZ0A 5AYQA 1CLVA 3QVAA 3SBWC 1E0TA 1JFHA 5A8PA 4NQDD 5T1MB 5LXEA 3EOAA 5F1OB 5CN2A 5E24E 3DO7A 4PCKA 2Y24A 1JCJA 3DRQB 2PC4A 4X9YA 5D03A 1FO0B 2KDGA 3EDDA 4ZX6A 1LHZA 3GSXB 1NU5A 5IMMA 3WKZA 4Y2DD 2NY2D 4E4FA 5AC6A 4P5MB 1WCBA 4K8HA 1A5AA 3ZIMA 3N2XA 3UXAA 1X96A 2ZYFA 5DJ8B 4QNPE 4PFMA 1I31A 2D0FA 3TN4A 3WFHA 1FGNH 2UWEA 5ID1A 1A50A 3ABOA 4ZO8A 1DQDL 4HKJA 4M5TA 1OSPL 3CFQA 1FLRH 1BFTA 4DAGH 5IB4B 1K7XA 1I0BA 1J88A 4ZFGL 2WMGA 2F9BT 2V2XB 1LQ0A 3MLRL 4P2AA 1KBLA 3KDPB 3IJEA 4M6AA 2QPEB 3SCUA 4H1LH 4KERA 1HVXA 4MJ6A 4AIZA 4N85A 1CFVH 1EFZA 1BOGB 5AC5A 4U3AA 1BMWA 4R84A 2TSYA 3FT0A 3UAFA 1O75A 2X6CA 1HQRA 1TTBA 4HZAA 2R1XA 2NY7H 2ASHA 1IE4A 4JM2B 1FDLL 3C6LA 5E5CA 4XCNA 2C3VA 4GG8B 1A8JH 3T7VA 1FFPB 1R3RA 4XXCC 5EOCH 2CLVB 2ESVD 3TIDA 2VXSH 1AY1L 2ZOKB 3DUSB 4YLBA 3B0YA 5DHYA 5J5EA 1SFTA 1HWHB 2DEPA 4P7OA 2KT6A 1QWGA 3BP7A 4UTAA 3AUJA 4QEGA 4E5XB 5IMOB 3MMTA 2CJSA 4OQVA 4JG9A 5JO5B 4A63A 4YFEA 5AZ0A 2WUBH 5KSBE 3WS3B 1IGWA 3VMPA 2GK0B 3O16A 4TTDD 3TASA 3NPWA 1JTTA 3UR7A 4Q4KA 3MBDA 4Q7DA 1V02E 1UKQA 5KSUB 3BW3A 3HTWA 2R29A 3FQRA 4H7CA 4YXKH 3DUGA 4YYFA 1AGBB 3L7EB 5D30A 4CNOA 2Y6TE 1F90L 3THDA 2E9WA 4S3AA 1T83A 5BOPA 4PP1D 4I5XA 5K2ZA 1A02N 2QKFA 3K6DA 1MCCA 3BGFB 3SE4C 2G3IA 3PAZA 3BUBA 4OB5L 4JN7A 4O2CA 3SE9L 2I85A 3PF2A 3ARED 4JRYD 4YZFF 1X1ZA 4NPYB 3FTGB 1TKKA 3GBEA 2XACC 2VR3A 3JTBA 4NDMA 3ZKND 3W5MA 2CZ5A 4JTHA 5DEZA 4XNZC 1Q6OA 3W6YA 2GY7B 1GTFA 4RNIA 1N0LA 1E4HA 4WI0B 3U4EB 5LJYH 1G6RH 5GGRY 4QJ4B 3GNRA 1RZFL 3RA7L 3MV9B 4IIEA 4B9IA 1XAKA 1DVYA 3R7MA 4R0LB 1TO3A 2IANA 5KVEE 1FYTB 3NUKA 3UT0A 5LBSH 5LBGA 4FGMA 3T4YB 3LMJH 3OZLA 2VR5A 1EXBA 1WDDA 2X4TA 4XZWA 5LHFA 1JDAA 9RUBA 3ZRSA 1ZVNA 4X6FA 5LQBH 4RRPG 3TEYA 1EEQA 5C0IA 2W80C 2ZCKL 2ZCZA 4XN2A 2P5WB 4ZT1A 3IS0X 3S2CA 5I5RA 1FKXA 2QPFA 3MV7B 3KXFA 3EJJX 1MLBB 3QO1A 1F4YL 1R3HB 2ED7A 2YPLD 3EGSA 3BWAB 5HDWA 5A16B 4HCRH 4LFHD 1FH5L 1RLCL 4GBDA 4WJ8A 3RG6A 5I74C 4F58H 5T5FH 3RWJB 12E8H 1P43A 5DTFB 1ZJIA 2INZA 2ARWA 3TU9A 3T4WA 2AJYL 3P0YH 2BVUA 2GUYA 3ESPA 3NH7L 3TURA 3NIYA 1PWMA 2R27A 1FWEC 2BOCB 2B08A 3FBKA 3GXPA 4H4NA 1ZLSH 3L3GA 5ADPL 2H2SD 1RXLA 1PLAA 1BIIB 2WBGA 3BG9A 3NG3A 2NV9A 1PO9A 5HNTA 4H7VA 4NQUA 5B7ZA 2XQ0A 4CN4A 3UYPB 4MPQA 4OV9A 2GDVA 1IAKB 1MRAA 2UV8G 2CAKA 3D05A 3AWEA 2ZKXA 4ICWA 3QUXC 2JFCA 4YHIA 5I1KL 5M1TA 1M7DB 4UOJA 1YRKA 4P23C 1MFDL 4KOCA 3WLPA 5I03A 2I56A 5A16A 3NZRA 4G6JH 3WDRA 3GBNH 2V5CA 3BFQG 4JKMA 3BLEA 2FR4B 4PUJA 4HSNA 2LU3A 4NENA 4QXWA 5K9DA 3QDGE 4ENED 4MZ2A 3GU9A 1RZQA 5DHDA 2LOEA 1FWXA 4EUPH 2QKSA 2IH3B 4OF8A 4ESKA 5LNUA 2Y25A 2JJSA 2G95A 1HCFX 1S2CA 4P04A 1L0QA 3A47A 4GWEA 1RHFA 4RIRB 3GMRA 3IKCB 4XBGB 4O00A 1WOBA 3T2LA 3PPSA 3IETB 3NT0A 3W2JA 4WRLA 5EV7A 4XVTH 5CBAA 4U0RB 4JDTH 4PJ5B 3PE9A 5I66A 5ISZE 2N0MA 4E38A 1EEZB 1PYMA 1HKVA 3MVTA 2C7UB 2H26A 5F0PB 4GNJA 4IFKB 4LGXA 3BAJA 2AEWA 4LOEA 4XPHL 4H9VA 4FIQA 4G5DA 1SFLA 1BECA 1RLWA 1WV2A 2X4SA 1TV3A 5E51A 2ADAA 5A2AA 2ZG2A 3GNOA 2AJYH 1YAZA 3P0YL 2DY2A 2Y5TA 4JJHA 4LB8A 4QRSB 3W29A 3CLWA 2CDGB 3QZOA 2PLJA 2F61A 1D5RA 1L9QA 1NMCB 1R9YA 1W31A 4PRPE 8XIAA 4NP7A 1RLDA 4DOHE 1EGMA 1AC0A 3QDMD 3QIBA 2FKPA 1X5ZA 2I7OA 4IX0A 4HAKA 1E6SM 4N2HA 1EF2A 2CZFA 5C7HA 5KYWB 3BSZL 3GJFH 4P2QA 5I1JL 4MDIB 2OM5A 2VDRB 1IT8A 1PTDA 3F12A 4PRPD 5EU6B 1ZA6A 3QJAA 3QDME 3T0VA 4BKTC 2W67A 4IFOA 1WLHA 1YMMD 2FIRT 3VFWA 5B4MD 4OZGA 5GS0C 4LBAA 1FLRL 2B59A 1S78D 5IMOA 4E5XA 4LRTA 4NG3A 4Z2GA 1P4LB 4YMPA 2HRPL 1AZZC 2C26A 4YDLC 5IVOA 4MMWA 1HHIA 2MQCA 3TNMB 1ZJAA 5C0CA 3F7QA 4L0ZA 4QHKJ 3CT2A 2DZPA 3RO8A 3BGFC 4JFZH 4WJ5B 4FFVC 1JL8A 1LQSR 3NAAH 1A80A 2GVEA 3IANA 4GISA 2RH0A 2A77H 2DRUA 3EH5B 2FSEA 1TJGH 2UUDH 2I5GA 3ARDB 2ORBL 4BQ4A 3S47A 2I5QA 4PRWA 3CZNA 4H9UA 1NICA 1FZJB 3FOMA 2Z0BA 4I0PC 4BZ2H 1KFEA 4YVVA 3IJ7A 4Z9KB 5K1JA 5IHUL 5IDIA 1T4KA 3QYQA 5I6SA 4KGJA 5K9XA 3E0WA 1WFOA 3SUSA 5DC9B 1IGSA 1U8KB 1BKSA 2J56A 4FP8H 1IJ9A 4JK0D 1AHWA 3H42H 3DH7A 4IEFA 2AP2A 4P5KA 4WTZG 4LCWA 4ZPVA 1NC4D 3MKKA 1GGIH 1IKOP 1SHSA 3GSXA 4PJIF 3PBGA 1A0EA 1GW9A 1GEHA 4IFKA 4JTKA 3MRFA 3OR6A 1WTLA 5IESH 3UEQA 1ZXQA 5MENE 2FE0A 1YTDA 5GHWH 4HHAB 3BP4A 1C92A 1IUZA 1X9UA 1M01A 3REVB 3S2NA 3TFXA 4ODHH 1AQ8A 4JR9H 1D7FA 3FKRA 1S4IA 1TTAA 2D3NA 2H45A 5D5MF 5H35B 2XOTA 4PJGA 1PLGL 3SEPA 5EN2B 1AL8A 1F73A 3L1EA 1G9NL 1S2VA 5CPOA 2VT0A 1EXGA 4L1XA 4LW7A 1IGJB 4OQTL 1UZ4A 1IL1B 5DO2C 2OSXA 5IQNA 2DIKA 1R3IL 4LUSB 4XXDA 3RZCB 2IUZA 3ZW3A 4W9FC 4QS5A 4YQXL 4L8BB 5EDSA 3M7FB 3EYOA 3EFFB 2OJPA 3PB0A 2N4IA 3KLQA 3F58L 2CKBA 3P77A 3NJJA 2D7NA 4A8LA 3URNA 2CALA 3DTDA 3LEYL 3LIZA 4OFVA 2P7TB 2NY0B 2FX9L 4J3BA 4DPRA 5BMFL 1V7AA 3BEVA 2R0LL 3E6FA 4PJAF 4P3CL 4LLUA 5T3XH 3UZEC 3QEGH 4I9TA 3TJHD 5J6GA 5C0GB 1A6UH 2X5PA 2Y07L 3SKMA 3RWGA 4XVSL 2YL9A 1AQKL 1MWOA 1CDGA 1QW7A 3OF6A 1IIGA 1OFAA 4P2OA 5EUOE 3OTRA 3OZOA 3MMEA 4JJ5B 4DLMA 3HCVB 4ODWB 3KZSA 4JQIA 3UAAA 4EVNB 1DBTA 4G56A 1CWVA 4RDVA 4ES4A 4XWUA 1P53A 2X4UA 4BFBD 4GRWB 3H21A 4CLMA 3OJDA 3MXVL 2DLIA 5E8PA 2I5YH 2VR9A 2NY4C 4OLWH 1PS9A 1KJMA 1PD1A 3ARDD 3T65A 1VFOA 3JYBA 3O3UN 1S5NA 1Q7ZA 1XLFA 5KUKA 1KFCA 1OF6A 1DJGA 1G7HA 4OTXH 1IGCH 2H9GA 3HC4H 4J3SA 4W89A 3H9HB 3NSCA 2Q6WB 3BT2L 4EX4A 3CZSA 1G9HA 4WI6A 4PJEE 3K80A 5AVWB 3BDXA 3FUEA 3GQFA 3T3ME 2Y88A 3IXAA 4XNDA 4WSKA 1G4PA 2VJXA 2J7FA 3LIZL 5F2IA 1V05A 4RWYL 2K7PA 3PDDA 2OL3A 2EDJA 2IPTH 3BZGA 2PPCA 2BSRB 4RSYA 3W76A 4A3RA 4FQQB 2EDKA 4NU7A 5MKGA 1KEML 3MODL 1E43A 3OJVC 1B0WA 1WB0A 4JAMB 1ZBWA 2EUXA 3BKYH 3FUJA 3QULB 1AO7D 3R0DA 3SY0A 3EZ4A 3MCYA 4PUBL 4XC3L 1H60A 3ITYA 4NN5C 4KFPA 1OCOB 3PIQB 3PDOB 5A6LA 1LL7A 4GNVA 5TF1H 1Q6FA 2EPHA 1CIUA 3PHSA 4I8YA 5FYJL 3VNZA 4EPSA 1BX2A 3FQUB 4L8DA 2Y85A 1D5MB 4A66A 2A1YA 1A0DA 2EPMX 2ZCHL 3R4RA 4JBRA 1DBML 3WL9A 4J7RA 2BDQA 2GK0A 3NPVA 1LO5A 2IAMB 2LTQB 4H9XA 2CFFA 3HAEA 1OIOA 3LB6D 1BQHG 4O51A 5KBLA 5G4OA 1TTPA 2WNQA 4OIFA 1YXCA 2VCOA 4G7RB 3NSXA 4LAQH 3UP8A 3QUMH 2O61A 4H8UA 5L4FA 1DE6A 3E0LA 2V3EA 5I8EB 2DKSA 2VLKD 4UU9B 1R86A 2Y7OA 3CUZA 4LTSA 4AZ5A 4PA8A 3CHDA 3DX3A 3SZ6A 3DX7A 5IMKA 3DIVA 4Y9PA 5C08B 2PP1A 7A3HA 2FH6A 3ZSTA 4AXWB 4FDWA 1X4ZA 1FG9C 1E9ZB 3RF9A 2Z8VC 2PYFA 5GS0H 4RX0A 4FLOA 4X6CF 3VIMA 3BPLC 4Q2ZB 1D5IH 3G6DH 1BBJA 1S5IL 4G43A 1XHHA 1Z5LA 4LLWA 1IYXA 2W1NA 2XSBA 3D0CA 2VQTA 2W65A 1RJYB 5F71A 3PL6A 4PRBB 1F1GA 3S35X 1A5KC 1TJHL 4N2CA 5A8NA 1XF3B 1RY0A 1NCDL 3EOUA 5HUPA 4HQQH 4JFYA 4ELME 5IGXL 3TWBA 3OR6B 1VCFA 1UP3A 5CO1A 3O6KL 3ITVA 3S0CA 4HJ0D 4M51A 4F7EB 2BP8B 5IV2A 4LVOB 4POUB 2WQ8A 4IIBA 2GSHA 2GCYB 2VN6A 4O10A 5CPSA 4GT7A 5DUPH 1DR9A 2DGAA 3RCYA 1WEJL 1T0OA 2ZCGA 2K1MA 4Y1AB 3EKGA 3WFLA 3SGDI 3FVDA 2NY2C 4QXGL 4FNRA 4Z3JA 1O7AA 3LH8A 1A6TB 3QR3A 2X1IA 4BQCA 3O3DB 4R7XA 3UTTB 5DD5H 1KF9B 3ZT6A 3IGLA 2EVIA 1U8QB 4QHUA 3IJSB 3RVUD 3TTYA 3M0YA 3I2CL 4WGHA 4Q89A 2PXYB 4M5YL 1ZHBA 5D5MA 5IOBA 1BWKA 1KQYA 3O41B 4I88A 3C75A 3T2NH 2ZA2A 4B3LA 4JZJB 1YEKH 3TGXA 3QBTB 3MU7A 4MA1C 4DW2L 2VZTA 3EA1A 3HB3D 4YHNA 5DT7A 3VIGA 1MJUL 4DXXA 2A9NH 1FOBA 5CBJA 1HHIB 3TNMA 4GVHA 3HG1B 2FBRA 3O3BA 3WNJA 5D1XA 5D8WA 4WEBL 3AJ7A 5IQLA 1XF3A 3B2MA 3TX4A 4YXLL 4OLEA 3OZYA 4WHBA 4OI9A 5T1LA 4IRZL 4R2GB 5H8DA 4QO1A 4KNQA 4PB9L 3NGBC 2ACQA 2AS5M 3ARGD 3W72A 4Q52A 3TCTA 4XP9H 1J8HD 1BM3H 1D5ZB 2J5LB 4MDOA 1MRDL 3QPEA 4BQBA 3TN0D 1I8JA 3KBNA 3WD5H 4X7SH 4WCJA 5FYLD 3OPZH 4RXFA 2FB3A 1SUHA 3WLHA 5KANG 4XZNX 2FGWL 1TVHA 3N3EA 3QCTH 2YUVA 5DFAA 3SN6N 2LVEA 4ELDA 3MPGA 5BOEA 2G0KA 3DFHA 5HYJE 2X87A 3M0MA 4XMKH 4B60A 2XG4B 3AT9A 2JH2A 5TF0A 4JNXA 1QSFE 2GYSA 1FH9A 2ABAA 1FH2A 3K6OA 3GTNA 3OYXA 3MV8A 4YDJA 3K1GA 4HS3B 3RGBA 3M88A 3RDJA 1X98A 3BH4A 1A9EB 3QZMA 2X4NB 1H41A 3JZEA 4HIBA 3KLHC 2FJGA 1HQTA 4P8UA 5C9RA 2JXMA 3B8WA 2UY4A 5HPCA 2OMZA 1YJDC 3OKDA 4F2MB 2V2TA 3PU7A 4ZUWB 4B95C 1U95B 5IBLD 1FCVA 2BP0A 1CFTB 4Q97A 2WTRA 2WK2A 3QDHA 4EXKA 4NT0A 3RWHB 3KTSA 2Y2TA 3QJVB 5EU7C 1CICA 3D1MC 5DQDL 1EA9C 3TKFA 1NWSA 4EWJA 1CE6A 4ZBCA 4A7GF 3VOGA 4IRJB 1U3HD 5KJ7E 4OUUA 1JUEA 3QR1A 2OR9L 4HPOH 4U3CA 2DWDB 4QHMA 5IW3A 1ONWA 4RZ4A 1D2KA 3ZBMA 2ESVA 5D8JH 1JUFA 4UZUA 2R1LA 1QSVA 4N0CD 3KEDA 5DRCA 4LK4A 4RDZA 4JKPH 3OV6A 3P0VL 1I1AC 4P5UA 2UYLB 3HI1B 5DQDH 4Y90A 4LKCA 3RHWF 3SDCA 5D1QB 4AEIL 3PL6C 3LBOA 3BV7A 5C2UB 1WBJA 4MY1A 5C5YA 1FFQA 1WDAA 4HJIA 4M5SA 1SDDB 1E71M 2VXQH 5JQHC 5IKCB 1GVRA 3V5CA 3N85L 4XVJL 3WLMA 5ECGA 3MBFA 5IOPA 2GEQA 2WN2A 3I02B 3KE0A 2BV9A 3S36X 2HRGA 4NC2B 2DJUA 4HD5A 2J88L 5JQ6H 5E8NA 2IIJA 4NKIL 2BZNA 1ZVYA 3PBUA 4K38A 4BWLC 3SGJC 4H9ZA 4H6EA 3MMEB 5GGSB 1VZGA 5B1JC 5C0IB 1R2SA 3GH7A 4R88A 3N73A 5SWSB 1JGVH 1OTUC 1TYEB 1I60A 3CUFA 5E9DD 3IMUA 2AXJA 2HUHA 3TP4A 1DWJM 3WTUA 2PDLA 1IEAA 2JKNA 4GKZB 1WD9A 3H9SE 5B3JF 1TEGA 4ZFQA 4DBWA 4ZUUA 1U92A 5JHDD 5CEXA 4X7SL 1D7BA 5HMSA 1CF8H 2J20A 5IEKB 4KWSA 4OH2A 4UTWA 2XN9A 4XN8A 3CB8A 1KQZA 4JNYA 1M2VB 5I3JA 2NQLA 3VFSB 1E28A 2XPYA 1ZLWH 3NCBB 3HGOA 4AM0Q 2OMUB 3WFEH 1OM0A 5K59F 2GITB 5GZOD 1UWTA 3DFSA 3EYQC 1XCQA 3G1DA 5IJCC 2AF2A 4K2UL 1W6WA 5FDYA 4XMLL 1TJRA 1CD1B 2HJLB 5D7IB 5DEGB 5K9QI 4K1GA 1JQXA 4GP4B 3TSMA 3VCLB 3D4GA 4LY8A 3ISYA 5E4AA 5EO1B 5EU3A 3R18A 3NEXA 3FB7A 2H6UA 3GJEB 4GCXA 7ENLA 5I19H 1MJ7H 3P3SA 1AW5A 3TJLA 3GX9A 2DLFL 3MNWB 1GOFA 2CO6A 4QHPA 1F4XH 2XTLA 3EYVA 1MCPL 5DRZB 4J5VA 3BMXA 1NCOA 3ZK0A 3QBUA 3HMXL 3RKPA 1TVPA 4H6RA 2X2JA 2OB3A 2RJHA 1YDVA 2OCZA 4X5XB 2PBOA 2O4EA 3MUCA 2Y06L 1P7KA 4U6TA 3GSUB 1JHLH 3KNBB 2Z7GA 4XP1H 2NY1D 2X4PB 2WQUA 3NCXA 4HS8H 5DHYB 3BEWB 3RP1A 3S35H 3GXUB 3VTTA 4RPQA 2PDNA 4YWSA 3PJNA 1A6PA 3GMNA 3CC1A 1ORSA 4L5FL 1WT5A 2ZAHA 3HMWH 4Q6KA 2IO5A 4UQBA 5IQ9B 1BXBA 4JEQA 1Q9OB 4PJBA 2H9AA 2G5WA 3WQ6A 1JDDA 2XDFA 5L2JB 1ES0B 1YN7A 2WW8A 1QNRA 3ARWA 5ITFA 2DQCH 1QABA 4HKXA 1BBJB 1IM9A 1Q9KB 2NLJA 4MJ6B 3SJVB 1NGYB 1JYXA 3L5HA 1JCLA 3ME3A 1V93A 1H5BA 4BHYA 5J6SA 2F7OA 2ISWA 1JPFB 5HGAB 3VRJA 2RB8A 1KLUB 3VNLA 2JTYA 4FTDA 2QZQA 3BCJA 2YMXH 1OEPA 1UCWA 1HKKA 5I0YA 4ZFZA 4Q22A 1WHOA 1YJDL 2FX8H 2PWDA 4MVBD 1KBGH 1OAYL 3CFNA 4AMKH 2UZ9A 2ZOXA 3UPMA 2HFTA 4DP2X 1E4XH 3H9SD 4S1DD 1EEUA 1T40A 1A6VH 1SM3L 4CVUA 1PZ5A 1SJEA 5JHDE 4NQCE 3UBXI 4CGTA 3RRXA 3BLOA 3HAEB 4O51B 3PZGA 3REQA 3JUZA 1W1IE 3I68A 4N42A 3FT9A 4X4KA 4XRCA 3MYZA 3TU6A 1I8IA 2OMWA 5JIPA 5DRNB 2QJMA 2YEVB 2BOBA 3UCCA 2X1XR 4HBQA 4WHTA 3UQNA 2Z25A 1I7RA 4S38A 3X1BA 3S1VA 3GYRA 3WS6A 3X3GH 1ITQA 4C1KA 4HKZB 4HOWA 1MCWW 3H42L 4LF3B 2J3SA 3ZDYE 4RLDA 1RZIB 4O8RA 2P8CA 3IGXA 5HJXA 2FZ3A 1TUFA 4XZIA 3O81A 5GGRA 5LUMA 3D7PA 5BNXD 2V0TA 3HB3C 4M43H 3VIIA 4XPTL 4U1KB 3PNWA 1PZ0A 3N2BA 4HPXA 1NL0L 1ZHNB 2IAMC 1FWHC 5EU7E 4ONFL 1NY1A 1SUJA 1UWGL 3OWEA 2OEJA 2VXUH 1F8IA 2F84A 3VXOB 1Q72H 3E2HC 1ZT1A 4OQ1A 5T1KA 3DVGA 1IGIL 3PWAA 3MDWA 4UV4H 1LYXA 2KPWA 1UM5L 2J8UA 3QE5A 3QWOA 1OF0A 3IFNH 4M1DL 4AEFA 2CZVA 1US0A 5IDZA 1UURA 2G3JA 2BNRB 2X41A 3SBPA 2GJNA 5DRIA 2QVFB 4AIUA 3UC0L 2MOGA 4NP4H 3IUIA 3DSNB 5M5DA 5MI0C 4E5XG 3VQ1C 1E9YB 3SFKA 4G9PA 2QJIA 4S1SL 3UU0A 3TNNB 4G6AD 4MNMA 1BMGA 2H0FA 3BISA 3BPWA 2HDJA 4LHUB 2B77A 4AYGA 2JCCB 3RVXC 3TNBA 1JZ5A 1AYRA 5HHOD 1G6RL 3TLQA 4I0PD 4GC4A 5FEXA 2FR4A 1FO0H 4KJQD 4P2RA 3WBXA 4XWGH 4K4KA 3LZFH 2C16A 3C0LA 4X9HA 1H3GA 4ZSOA 3SYCA 4N1CA 4BFJA 3BZEA 4JE0A 3QORB 5FHAH 3BVUA 4XP4H 1GPWA 3TEWA 3OKNB 4JGDA 1K5NB 4D9PA 4YSDA 5EUOF 5I3FA 1YECH 4KWVA 2H8PB 4TVPD 4ZMOA 3FRPG 5JYLA 3NEHA 2APWA 3NAAL 4TOYL 4ZJ9A 3GZQA 2GOUA 3WH6A 2E9LA 3HE6B 2VM3A 1OAXL 4IHBA 2A4EA 2FEJA 1MEXL 3U82B 5TFSH 4DP7X 3K71B 3WIHH 3UTOA 3W7MA 1OGSA 4LSUL 3QRHA 4G8GA 2QVIA 4MQ7B 2GSIA 2VB5A 3DO3A 5DMGC 2DUAA 4Q9BA 1UB3A 4QE1A 2DH2A 1I9EA 2CO1A 1BAFH 3M1CA 4HIHB 3VGAB 1QNSA 4G9FA 2A6JB 5D7JA 4RAVA 4U6XA 4ECNA 4X6DB 1BZEA 4WSHA 1NTHA 3C6CA 5IQ7H 4Y2OA 1W2KT 2G0LA 3WF0A 4L4TB 3ALPA 3A23A 2I24N 3GSVB 1BG4A 3MV7E 4DPPA 1V7NL 4N1HB 1CFNB 4TV3A 3QKZA 3W56A 4X5LA 3E2SA 3PV6B 4ONGH 4EAYA 4PJXF 1TFPA 4GFIA 3U2ZA 3ZHKA 2V8MA 4I2XB 4CNTA 3HPLB 4ZQKA 4AZ8B 2G96A 3LNHA 1JI1A 1CLOL 3H3KA 4AWSA 2I9TB 2AQOA 5E1AB 3EKLA 2KC0A 3W70A 4PGBB 2ITDA 1DQIA 1A8ZA 3LLDA 3L1GA 3MZGB 4HJJH 4C56D 4F8LA 4REQB 4M3KB 2AJUL 5CR8A 5CUSL 3R8BB 3NQAA 1TQCC 4Z77B 1TV8A 3SZ8A 2ED8A 4F7TB 4BZ1A 4EI5D 5D2WA 1DJXA 2C3GA 4M1CC 4PMOA 1TQVA 5I6KA 5L4MA 1K1DA 4DF2A 3G9AB 3OQEA 4L37A 2V7HA 4GXMA 2H2PC 3Q5YA 3O07A 5I0WA 2V17H 2VSDA 1WFNA 3D2UB 2Y3AA 3K0WA 1OE1A 4G5ZH 4ZXBD 3TBBA 5ACMA 3GR7A 4PTMA 4QEEA 3HHSB 1UM6L 1KTDB 2GAZB 3AZUA 3KPLB 4HCIA 1X5AA 1A14L 1SDYA 4YVXA 1LOSA 5EPMA 5I1LB 2QQQA 3L5IA 1Q65A 1GGCH 1ZPTA 3RWFA 3BPNB 2GUBA 5H2BB 1RZGA 3PSWA 3D4YA 3P4MB 4K37A 5LIUX 1X44A 2V17L 4IRSC 1EC7A 2JTDA 1E65A 3BN3B 1P4LA 5BO1L 3V0HA 1RALA 4I7VA 4OZHA 2XG5A 1WIOA 4TLTA 2IH9A 12E8L 4JTJA 5I3KA 4DESA 1GKPA 5KN5A 4QM1A 3BQUC 4JCLA 5AD0B 3MXWL 4FL4B 4YSSA 3FFSA 5T26A 1JYVA 3MMDA 2X9XA 3SCSA 3OKMB 1AZNA 1NFIB 2YRBA 5KYYA 2QR6A