1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
b'AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
1PJ9A 2YIHA 3VMOA 2VRQA 4MB3A 1E3ZA 3BAYA 1FFQA 1WE5A 1ECEA 3WBAA 2VJXA 1VJSA 2WK2A 4CCEA 3L4ZA 2WB5A 2J77A 1S46A 3CHCA 4DWSB 1PZ2A 4M24A 5A3HA 5AC5A 2DDXA 5CPTA 2YJQA 2BFGA 1CXFA 5EMYA 3VGHA 1HVQA 3CHEA 3DYMA 1FA2A 5HDRA 3OGRA 1TQUA 4KH2A 3CUGA 7TAAA 4D1IA 1UD5A 3M7SA 3RCNA 4GXPA 1C7TA 2W62A 4N42A 5A2AA 5A8MA 2ZUWA 1EIBA 2CETA 1GQIA 1VJZA 3AZTA 4TTGA 4OOZA 1CGVA 1CGYA 1J01A 1WAWA 4XUYA 1LL7A 2GJPA 2G41A 4MNLA 3M07A 1M04A 3NSMA 4LX4A 3K8MA 2O9OA 4YHEA 1JDAA 3PTKA 2VRJA 1SR0A 5FD0A 4AEEA 1E71M 2A3CA 5AY7A 1BYCA 2WMFA 3K8LA 1VFFA 2QMKA 1XD1A 3WMCA 1BTCA 1H41A 1JZ3A 4HPHA 1B3YA 4EK7A 4U33A 4U5KA 1QI2A 1UH2A 3VMPA 3GNPA 2BHZA 2VURA 4P7OA 5A6LA 4J3SA 2DSWA 3QOKA 5DEZA 4W89A 2WHJA 3AIEA 4V2XA 1PZ3A 3CGTA 1DTUA 3VD7A 2D3NA 3CZEA 1BHGA 1W9DM 3GXPA 1OIFA 3T0AA 3GXNA 1HF6A 1EQPA 4CN4A 3TOPA 4JKLA 4BQ5A 4QFUA 1TA3B 1QOXA 3BLKA 1E73M 4IUGA 2DSUA 2J8GA 1K9EA 4QLLA 2PWDA 3A6OA 1OCQA 4FK9A 2UY2A 1KR0A 2V5CA 3WF3A 1ODUA 2BVTA 4D72A 1FH9A 5I24A 1CGTA 1I1XA 4Z2HA 2D0HA 3B9EA 3OLDA 4CCDA 5ABFA 1U2YA 1TUXA 1XYFA 3VD3A 1QI4A 1OIMA 1W1YA 3MANA 4W7UA 3LRLA 1G01A 1L8NA 2CKRA 1CXKA 3B9AA 4DM2A 3SURA 1OINA 2VOTA 3VMNA 1KTBA 3L2LA 1E4MM 1EDQA 7CGTA 2JIEA 4D6HA 4FLRA 4CD7A 1UKSA 1KGWA 3APGA 2NSXA 3M6DA 1DWIM 3G6MA 2XIBA 3IK2A 4UOJA 2V5DA 1GQKA 2DT0A 3CZKA 1CYGA 1XSJA 4S3JA 3VD4A 3MUAA 3UG4A 3WY4A 4AZ5A 4J3WA 2YLAA 3MSGA 1ZBKA 1K6AA 2YL5A 2PF0A 3PZVA 1B3ZA 1HN1A 3GNOA 2BS9A 2D2OA 5C70A 1ITCA 2NW0A 1FHLA 1TQVA 2VZOA 2J25A 4AZBA 4DWSC 3AIRA 3KL0A 3DYOA 3SUTA 3WD2A 3DX0A 2VL4A 4U3CA 3W25A 4FNSA 4H2CA 1KCLA 2D23A 5GPRA 3TP4A 2EACA 2E3ZA 4OOUA 3VGGA 1LG1A 3EDEA 1OWQA 1E55A 1UKPA 1JD9A 2WVUA 4NXSA 3WY3A 4DO4A 1EDTA 2XN2A 3VIPA 3WD4A 4H04A 1QWNA 1MW2A 3GTNA 1WB0A 9CGTA 3WNKA 2YA1A 2JIWA 5M17A 3F5LA 2YA2A 1TG7A 5E0CA 4QDMA 4D6CA 3VIIA 1NOFA 4AIUA 4HMEA 4AD3A 5BWFA 1W2VA 3K4DA 3AHVA 3UCQA 3CIVA 4AD5A 2YL8A 4UTFA 2ZX6A 4WKHA 1BPLB 1QNSA 1OSEA 1K9FA 2A3AA 1UR9A 2WLZA 3VINA 1JAKA 2Y8VA 1BVZA 4HU0A 1UWRA 1J0YA 2VX7A 1R86A 3BUPA 5DF0A 5IFTA 1JNEA 1BYBA 1UZ1A 1G0CA 2F7QA 3UG5A 3HG2A 4CU8A 1GOOA 6CGTA 3BVXA 5IXEA 5D8ZA 4F66A 1TFVA 4UQ9A 1J0HA 2D22A 2UWFA 3ARWA 5E6ZA 3A22A 3RM4A 2X8RA 1V3IA 4Q22A 1NOWA 2F2HA 2YDSA 8CGTA 1V0MA 1XHGA 3AZSA 2FHFA 4Z2IA 4HOWA 2EPLX 3N12A 4P8VA 4W8AA 3U7BA 2UY4A 3N15A 5A69A 3VSVA 2XWDA 1EDGA 1SMDA 5IFPA 1HVXA 2VCBA 2OWCA 5CJ5A 1QHOA 4HTYA 2ZUTA 1R8LA 3UETA 1HKJA 5E9AA 1HKIA 3WQWA 3ZJ7A 4MNKA 3GH7A 1ISZA 3KL3A 3S6TA 5A95A 1PS3A 3BLBA 3OLEA 1UOKA 1CECA 3L4YA 1QW9A 2PBGA 2WVTA 1QVBA 2DT1A 5AYBA 2YL6A 4KRTA 1KWGA 1UH4A 2WCGA 3N18A 4M82A 4J7RA 1MXGA 1NWRA 2ZUSA 4M29A 3WQ5A 3WUGA 4W88A 3FNDA 1GOKA 1TVNA 3LPFA 1KCKA 3TA9A 3L2MA 4ATWA 2W66A 1WDQA 3VSUA 1WPCA 4OJYA 2ZWYA 1RD6A 4RE4A 1US3A 2BV9A 2OYMA 1NWTA 3WD0A 2XYLA 3WQ6A 3VNYA 4K68A 4F79A 3LPGA 4P8XA 3DDFA 4ACZA 1OD0A 4BQ4A 5A1AA 4UFMA 1ISWA 1XGZA 1ZJAA 4HA4A 3UEQA 1PBGA 2GVYA 3FHQA 3CO4A 3FW6A 4Z2GA 4V28A 3MI6A 1O7AA 5I0DA 2JEPA 1D3CA 2E0PA 2OYLA 3HG4A 2QPSA 2XGBA 3WMBA 3VIFA 1E0VA 4AD2A 2ZIDA 3WQ8A 1QX1A 5M03A 1AQMA 3WFLA 1JD7A 4HZ8A 2WHLA 2XM2A 2GDVA 4MNMA 2F7OA 1UD4A 1LWHA 3AISA 2CIPA 2FHCA 1DWGM 2WMIB 2ZOXA 3O2LA 2GDUA 2UY3A 5CXPA 4NZCA 2IXUA 5BRPA 4W7VA 4R27A 1JI2A 3D4ZA 1HKMA 2ZE0A 3W24A 3BAWA 1WZAA 4FLQA 4AIEA 3ZJ6A 1GONA 1OGGA 4Z2LA 2VZSA 3MMDA 2QHAA 3POCA 4CKQA 1M7XA 4WSJA 2BXZA 4DUWA 1NWSA 4P7RA 1QNRA 2G8ZA 2EEXA 1UKOA 4QAWA 2EPNA 1V0LA 1GVIA 4KGJA 4DUXA 2J7GA 4ACZB 4FNRA 3ZT7A 5A6SA 4LYQA 2J7FA 4GI8A 3W28A 1J0ZA 3TTQA 1UD6A 4WJXA 4BQ3A 4AYSA 3AHXA 1SYTA 2WHMA 3WY1A 4CU6A 4GZJA 4OIFA 2W61A 4MDPA 1UR1A 3OG2A 3T08A 1W9UA 2ZUVA 3K8KA 3IAQA 3EMQA 1MQRA 3SCNA 1MW0A 4HMDA 3RO8A 4UQAA 1XYZA 1R46A 3KLLA 2Z1SA 3GXIA 2EAEA 1ZS2A 5HPOA 2G3JA 1W32A 3A21A 4PBGA 3SIMA 5I5RA 1J0IA 2ZX8A 3WDIA 3HJEA 1WZLA 4AXNA 5I3DA 3W27A 1KXHA 3EJQA 2WVVA 4AWEA 5FKYA 1E72M 1ISYA 4PUEA 5CGMA 4KWUA 3EBVA 3WSUA 3CLWA 2WPGA 4A3HA 3NSXA 2CPUA 4TVUA 3RM9A 4U2ZA 3HG5A 1E4IA 2VO5A 4AW7A 3SCQA 3DX4A 3VM5A 1G9HA 2C7FA 4W5ZA 4D6DA 2QPUA 1VB9A 5JBDA 1G94A 1PIFA 3F5JA 2A3EA 2JF7A 1V0KA 1UR4A 3VDBA 5E0FA 1UH3A 1CDGA 4OBRA 1F4AA 4PMUA 1IV8A 2E9MA 5BXTA 1W3KA 2X1IA 2VCAA 4RE2A 4CD6A 2FGLA 2WMJA 4M8UA 1UR2A 2Q8XA 5AYIA 5BYWA 4YN5A 1NQ6A 2DSKA 4NX0A 1UG6A 3WQVA 1H11A 2W91A 3AI0A 4JL2A 1HT6A 2YFNA 1H49A 4JHOA 4HA3A 4EANA 4CGTA 1UD2A 4GKLA 1CLVA 4MAVA 3VX0A 4BA0A 2OLHA 3LXAA 4AEFA 1BGAA 3SUVA 1UWTA 2WXDM 4WIWA 3MV01 1BAGA 2CNCA 2JEQA 4OZOA 5CG0A 5CGTA 2XJ7A 4YPJA 3B9DA 1JF6A 2XFYA 2WVVB 1JXJA 1G1YA 1J10A 2AOSA 2YDQA 3A4XA 1JYVA 1V3KA 4LGXA 3AICA 1A3HA 1H5VA 2FDMA 2XVGA 4M80A 2X2YA 3T0DA 2OYKA 1XCWA 3QOMA 2Y8KA 5FL0A 3IAPA 3EDDA 3BAIA 3PTQA 1W3JA 1KR1A 3POHA 1GUVA 1JZ8A 1CLXA 1AMYA 5KEZA 4XZWA 3SUUA 3ARRA 5A6JA 3PZOA 2VR5A 3T0BA 4X0NA 1CIUA 3SUSA 3LPOA 3WEMA 3N13A 6TAAA 1B31A 1HJXA 1XH1A 2ZICA 4C7FA 1FP9A 2GUYA 2WHKA 3WD1A 3ZSSA 3BMVA 1TQSA 3CUHA 1SMAA 1HJUA 3W6MA 1CGUA 3EJPA 2F18A 2F8QA 4AZ6A 3VGEA 5DMYA 1RPKA 2XIIA 1E70M 2ZXQA 3K46A 1R33A 4HMCA 3VOCA 1FH8A 4OUEA 1K9DA 1T0OA 3GH5A 1BGGA 1JYWA 1CGXA 3E1F1 1KGUA 3BAKA 4MB5A 3QGVA 3GXFA 4V27A 3WL0A 4PYSA 3W38A 1VFOA 2J4GA 4M81A 4J27A 4J3UA 3VU2A 1DEDA 1HNYA 2ALWA 1MFVA 1ESWA 3EDJA 4H7VA 4B9ZA 5LA0A 2VRKA 1JZ4A 5E09A 3IANA 2D0FA 5I2UA 1W9VA 3J7HA 2CERA 3AMLA 1AVAA 1B0IA 4ZE4A 4LQ1A 1JDDA 4PSRA 1O6IA 3I3EA 5A94A 5HBFA 3VM7A 2YFOA 1CNVA 5F7UA 2ZUUA 3FN9A 4GI9A 1VFMA 1A47A 3ZR6A 3L4WA 3THCA 5D4YA 1UQYA 2ZXAA 4CN1A 3LPPA 1TQWA 3AOFA 2EPMX 1LG2A 2W4XA 2HISA 2DIEA 5E6YA 4D6IA 1EHNA 4JCLA 5A8PA 4H8UA 4ZE5A 1JAEA 4RL3A 5IHRA 1SFSA 3EJUA 3AIQA 2VQUA 4PMOA 2ESCA 1TCMA 3K4AA 4PMRA 3CHFA 3ZT5A 3II1A 2QMJA 1BYDA 4MNJA 3PZNA 3D51A 1H1NA 4L4PA 3LX9A 1R87A 2WKGA 3TTOA 4JFVA 1SZNA 4AMWA 2J47A 3CV5A 4CVUA 4L4OA 3AS0A 2BVYA 2D24A 3VGFA 1QW8A 2J7EA 3SCVA 4TVCA 3WUFA 2FGZA 1BLIA 1C8QA 1KQYA 3KEHA 3VNZA 3W6LA 3IGUA 1LF1A 4PMNA 1HJVA 2Y5EA 1UYQA 4JFTA 1R34A 4AD1A 1DWJM 1GORA 3GBEA 3WNNA 5CPSA 1QI5A 5A8QA 1V0NA 3WDHA 2WZHA 1XSIA 4IM4A 3U57A 3ZIZA 5ABFB 2ZX7A 4WLCA 1GJWA 3GDBA 3CMGA 4ZXLA 1QBAA 1LJYA 4FNTA 3ARZA 2TAAA 1M03A 5BXRA 2VC9A 4F9JA 1E6QM 1QHPA 3NDZA 3WBEA 3OLGA 2CBVA 1OB0A 4LPCA 3WNOA 2B31A 1GHSA 1KBBA 4TOQA 3GBDA 3VIHA 2VTFA 3U7VA 3BXWA 1FOBA 3A47A 3IJ7A 1MXDA 4WKAA 3VDAA 3OA5A 1JYXA 5FCZA 4W8LA 1V6XA 1HWWA 3PZTA 5A6BD 4HPGA 1V3HA 5A6AA 4B9YA 3AFBA 3ARVA 1R7OA 1E40A 2WVSA 1MW1A 2E4TA 1LL6A 5FL1A 1W3LA 1QNPA 2JFEX 3RMEA 5KZ6A 5D9MA 2CBIA 1Q6CA 2XFRA 3AIUA 1U30A 1NP0A 1NH6A 1B1YA 1R7AA 1JF5A 3ZMRA 1F4HA 4F9DA 4WKFA 4FNUA 1QNOA 1WO2A 4GO9A 4UFLA 3AXIA 2DSVA 3T2QA 3VIKA 1BSIA 2O92A 4MADA 3TTYA 5BROA 5A6KA 2YLLA 2GJXA 3KE0A 1WP6A 3CZNA 3WD3A 1J0JA 3UG3A 4FNQA 4D6EA 3CUFA 1ZL1A 3PBGA 3OBAA 3RJYA 5I6SA 1UR8A 1V6UA 1OT2A 3EDFA 4PMYA 4N0RA 4DO6A 1NM9A 2XVKA 4GZEA 1R75A 1IZKA 2G3IA 1E5NA 3H55A 1D2KA 3D50A 4W5UA 2XN1A 5DT7A 2V3GA 5EB8A 3QHOA 1Q6FA 1EQCA 2O9RA 2ZX9A 4U2YA 4MTVA 1E6ZA 3OGSA 4ZEPA 3BUIA 3NCOA 4WK9A 3WH5A 5EBAA 3EJTA 1UD3A 3RJXA 4HOXA 1HP4A 3JUGA 1KBKA 3NJ3A 3WH8A 1PEZA 3F4VA 3MUIA 2VVNA 3MSDA 4ACYA 1E0XA 3AJ7A 3ARQA 1KTCA 1C8YA 4GZIA 3CUIA 1WDPA 1JDCA 4URIA 1CXLA 4AZ7A 4A3YA 4PN2A 4JAWA 4PUDA 4UQDA 4GIAA 3WF4A 3VX1A 1WDSA 1WZKA 5M3WA 1HL9A 2GK1A 4TX6A 1JFHA 4D6JA 5FOOA 1VF8A 2VCCA 3AZRA 1E1FA 3OZPA 3GXMA 2G3NA 2O9PA 1V03A 2WWDA 1PPIA 3BH4A 1FHDA 1EOKA 3GNRA 3GYCA 4J3VA 4AISA 3O6AA 2D73A 1W1TA 4WF7A 4CU7A 3OB8A 2VZVA 1C3FA 1TZ7A 4UFIA 1Q6GA 3DECA 3WELA 2Y4SA 1C91A 2D3LA 1WCGA 1ZBVA 3H53A 1U33A 3L4XA 5IHSA 5JBFA 4XB3A 2BHYA 1V6WA 3LMYA 1RP9A 4KRUA 3VSTA 1HTYA 1XD0A 1FP8A 1JZ7A 4PTWA 4AZCA 3AMGA 1CXHA 4RE3A 1MW3A 3IJ9A 5CLWA 3VIJA 3BUDA 2CYGA 2EBNA 3EJRA 3BGAA 2EJ1A 4JCMA 4PMVA 5ABHA 3O9NA 2DH3A 1VEOA 2AAAA 4E4PA 3ARPA 4JHZA 2ZXDA 2VNCA 5CLTA 3UR8A 4ZFMA 3CZGA 1UA7A 1W1VA 2PWEA 5HPCA 1VFUA 4KMQA 4PSPA 1JZ6A 4BQ2A 4GINA 1HKKA 2Y2WA 3L4TA 4Z2JA 3OGVA 4JFUA 4PMDA 1HJWA 1UKQA 2EPOA 4E8CA 1BG9A 3GH4A 4ATLA 4YHGA 2X2HA 4DM1A 3MMUA 2XG9A 3CBWA 4FLSA 2WMHA 3ALGA 3N04A 5ABEA 5A8OA 3AIBA 1BQCA 3L4VA 2J62A 3RILA 4MB1A 2BHUA 3S2CA 3BAJA 1B2YA 3EDKA 2VUYA 3WUEA 3AXHA 3CUJA 1ZBWA 2XGIA 3W37A 5GQBA 4HA1A 1EO7A 2WW5A 4ML4A 1H3GA 5DT5A 5A6MA 3GM8A 1UASA 1E6NA 4W86A 3ARTA 2VX4A 3ZJ8A 2VR4A 1TE1A 3W0KA 2F1BA 2JF6A 3DHPA 1MQQA 1Q6DA 3ARUA 2VX5A 2AMGA 2J7BA 1W2PA 5HNNA 3AS2A 3ZO9A 1GVYA 3WEOA 4NRRA 1ODZA 4NXKA 1WNOA 5LYRA 1VBRA 3D3AA 2Z1KA 3AIWA 5D9PA 3AMCA 4PEEA 1DP0A 1HP5A 1E9LA 4X0VA 4AMXA 5HOSA 2BY3A 4W93A 3D4YA 4QCFA 3PN8A 1ZBCA 3ARYA 1KXTA 2ZUMA 4UNIA 2VZTA 2F7PA 3W29A 1EHAA 2BY2A 4PMXA 1UUQA 3D52A 4ZXOA 2VZUA 2XUCA 2HVMA 2JE8A 3AXXA 3QHMA 4E8DA 1G5AA 1PX8A 3CZSA 1JZ2A 4CD8A 4H8HA 4MAZA 6A3HA 1D7FA 1VENA 1ZU8A 2WLYA 4AD0A 2V3DA 3OIHA 1JNDA 5DO8A 3AHTA 4LYRA 1MVYA 1EH9A 4DWSA 1QI0A 3PZ9A 4UCFA 3M46A 3EMZA 3UR7A 3SCWA 4UQEA 4JFWA 3DX3A 3WEZA 4M56A 1ISVA 4PTVA 4UR9A 1X6NA 1N82A 1VEPA 2OSXA 1C7SA 4QLJA 1GQLA 1E6SM 2E9LA 4JL1A 5E1QA 2WBGA 1B3XA 3LRKA 3RM8A 4P8WA 1B90A 1J18A 2CEQA 2VQTA 3WNPA 1E4LA 2W67A 3TTSA 3NDYA 5GNZA 4IPNB 2JALA 4LYPA 3BLPX 3D5HA 4QP0A 1C93A 7A3HA 2X05A 3S5ZA 4F8XA 1GW1A 4MJ2A 2QLYA 1GQJA 3W26A 1TQTA 1VRXA 2FH8A 3F5KA 1V3LA 3A23A 3WDPP 1XSKA 3WL1A 4TUFA 3DDGA 2X0HA 4PMQA 3VDHA 1CZ1A 1H2JA 2OWXA 4Y7EA 4AD4A 4U5IA 1TA3A 3VPLA 2V38A 4H8VA 2CITA 5JIWA 4P8UA 1I1WA 4CVWA 4UOQA 1GJUA 1QBBA 4GQRA 3LXBA 5LA1A 1WDRA 1CBGA 3AS1A 5CZKA 5D9OA 1XCXA 1UKTA 3ZSTA 1EGZA 3WDJA 1E0WA 3MMWA 3AHYA 2ZUNA 3AYSA 1CGWA 4GI6A 2BVDA 4CUCA 4ATDA 4A4AA 3LRMA 1J11A 2YOCA 4J3TA 1C92A 3FXYA 2XWEA 3PHAA 1O7DC 3PZGA 3GXDA 3BSGA 1HIZA 1X1NA 3BSHA 2IUZA 2WMKA 2EQDA 2J75A 1BYAA 4FMVA 1ISXA 3KWXA 1NP2A 3VD9A 2FHBA 1GOQA 1WZMA 2A3BA 1VEMA 4EE9A 3PZMA 1BFNA 3VDCA 5ECUA 1WKYA 4X9YA 3N9KA 2YKKA 3BVWA 1CWYA 4U31A 2FYVA 2G3MA 2OWWA 1B30A 4AY1A 2C8NA 1OGSA 5A2CA 3CPUA 4PTXA 1VAHA 2F7RA 1CXEA 4W87A 1GZJA 1XV8A 3T2OA 3THDA 3A4WA 4MDOA 2BNJA 1W9PA 3EYPA 1C90A 2CXGA 4JKMA 3W81A 2E9BA 2BXYA 2WAGA 1KB3A 4KGLA 2PBOA 1GCYA 2F61A 1E1EA 3WH9A 2X09A 2J8FA 4JKKA 4PCSA 1IT0A 3W53A 1V6VA 1UR0A 3T09A 1Q6EA 4AZIA 2PI6A 2XPKA 5BXSA 4HOZA 1EOMA 1NOUA 3AHZA 5D8WA 3WF1A 2IGTA 3FAXA 3SCUA 2EXOA 2G4FA 3BMWA 1PX4A 1TVPA 1E4NA 2CCRA 1P6WA 3G6LA 4P7QA 2WCSA 1HXJA 1E6PA 3DC0A 2DT3A 1GOMA 1KWKA 4XX6A 3EJSA 3WMSA 1JYNA 3FY1A 2EADA 3CC1A 1MQPA 5M5DA 3VVGA 2E40A 3CHDA 1TR1A 4D6GA 1ITXA 2YL9A 4FF5A 2A3HA 1J9YA 3KZSA 1DHKA 1UWQA 3HU7A 1CPUA 3ZOAA 4ZENA 1XC6A 3ZQ9A 4B3KA 5EFDA 4FLOA 2XTKA 2ZX5A 1X6LA 3I3BA 3SCTA 4UQBA 2ZXBA 3GZAA 3CTTA 2E8YA 2PWFA 3MO4A 3VIOA 4FNPA 3VGDA 2DGAA 2OW6A 2VX6A 1HJQA 3BUBA 3MKKA 1YQ2A 1GPFA 1MYRA 5JIPA 4AZHA 3WENA 1TMQA 1GOIA 3ZJKA 1H0IA 3MS8A 3VO0A 1E56A 4TTUA 1NARA 1KFWA 3SCPA 1H4PA 2J78A 1B9ZA 4XZBA 3WN6A 5A6BA 3RIKA 2XSBA 4GQQA 3DX1A 2WZEA 4JFSA 3RDKA 4S3KA 4UFKA 3AROA 2W92A 3WNMA 1Q4NX 1RP8A 4NSBA 1E15A 3BUQA 5CSUA 1GHRA 3VKKA 3WH6A 4NRSA 3HG3A 3N17A 5CQ1A 5I23A 1E43A 2YBUA 2PC8A 2J79A 1XH2A 4UZUA 4W7WA 4D71A 2BY1A 3W4RA 2NT1A 1MWOA 3ZT6A 3BVTA 5ABGA 4B16A 5E70A 1LL4A 3WIJA 5GNXA 1OT1A 1L0PA 3WFZA 3ZM8A 5BCAA 3HN3A 4Z2KA 4AIOA 1M01A 1LQ0A 2XSAA 1R47A 3CMJA 4D6FA 3AS3A 3PTMA 3QR3A 2V3EA 3VTRA 3BAXA 2NT0A 1BG4A 4BZYA 3CH9A 1PAMA 1HL8A 3OZOA 5IDIA 4BF7A 3NSNA 1VBUA 1V08A 1V02A 5I77A 3SCOA 5I78A 3S5YA 5GNYA 2YBTA 1GNXA 1B3VA 3SCRA 4NF7A 2X0YA 4CD5A 5EFFA 4IISA 2FH6A 1W9XA 3ZR5A 1GOWA 1QNQA 4TXEA 1FFRA 3WDRA 3BCDA 4UZSA 1W3HA 5JBEA 3TV8A 1DWFM 2OSYA 3DYPA 3FHAA 2DH2A 1BF2A 4OGZA 3KL5A 4EAMA 2FE0A 5LA2A 5CPQA 1JIBA 4QLKA 3WDQA 3AMDA 2XN0A 3CZLA 1XH0A 1UHVA 2WNWA 1HXKA 4HZ7A 1W9BM 1W91A 3UESA 4U3AA 2XVNA 3WH7A 4TX8A 5C8BB 1QHZA 4W85A 2VT0A 3BCFA 2WANA 3A24A 2EO7A 4BCEA 3VILA 3ECQA 2GJXB 4P7LA 2WMIA 3PZQA 3VIMA 1EO5A 3PZIA 2CHNA 2D1ZA 4CCCA 3KLKA 2F1AA 3N11A 1ZB5A 3ARSA 1J0KA 1QPKA 2WWCA 3AQUA 1V02E 2WC3A 2DQXA 3RPMA 2MANA 3DHUA 1KXQA 1E3XA 1V3MA 3MU7A 3FAWA 3AMKA 2EPKX 2VMFA 3A5VA 4NZFA 4AMCA 4W84A 4PMZA 1E6RA 3WKZA 2WYSA 3W82A 2RGLA 1Z32X 5HXMA 1BVNP 2DPEA 5AC4A 2CESA 1UZ4A 4B3LA 4HU8A 1KXVA 3VIGA 1LLOA 4C7GA 1JFXA 2W5FA 4LXFA 4H41A 3HZ3A 3AYRA 1UA3A 1UWUA 3SEPA 3DX2A 3A4AA 3CZ8A 2PWHA 2ZWZA 3BVUA 2WSKA 3NYDA 1JI1A 3QHNA 2J7DA 2CKSA 3SCSA 2O9TA 1V3JA 1YHTA 4AZGA 2J7CA 2GK1B 1DWHM 2C0HA 3OLIA 3WNLA 2DSZA 4B15A 3U5YA 2RGMA 2XVLA 3BVVA 1JXKA 2UY5A 2QF8A 1QWUA 1FH7A 2WKLA 4JZ5A 1K9TA 1US2A 2WZIA 3T2PA 3WUBA 3WY2A 4GO8A 1AQHA 2XHYA 1IZJA 1B3WA 4M1RA 1RH9A 2GFTA 1M53A 1PIGA 4MPKA 4UFJA 3HMCA 4PCTA 2VI0A 2VVSA 1EA9C 1JZ5A 1OGBA 2CBJA 2OSWA 1CTNA 2QV4A 2YDRA 1OD8A 1PX3A 1JL8A 2XVPA 5BXPA 3A3HA 3N1AA 3WQ4A 2WMGA 1E6XM 4PTMA 1MFUA 3NIYA 4AZCB 4DUVA 3TONA 3VD5A 1CENA 1DWAM 4UQCA 1UQZA 1C8XA 3LXCA 4TVDA 2IXVA 5A2BA 1OM0A 4R5EA 1CEOA 1CXIA 5DFAA 5BRQA 2WC7A 3EMCA 2W63A 4MJ4A 1H09A 1I75A 3GXTA 4HZ6A 1V6YA 4C7DA 4PRWA 1KGXA 2J74A 3MV11 1W1PA 2EABA 2X2JA 1UWIA 4CN6A 5JUVA 4OKDA 4UFHA 4UOZA 2D0GA 4GPNA 2WSPA 4BS0A 1AQ0A 3IJ8A 4Q7NA 1UWSA 2XFFA 1VIWA 5TD4A 2DT2A 3H54A 3K1DA 1H0GA 2WBKA 2CHOA 3NUKA 4J3XA 3CZJA 4P7NA 2CBUA 3ARXA 2WM0A 2V3FA 3PZUA 3MUZ1 3AIVA 2DEPA 1JGIA 4W8BA 2BY0A 1JG9A 3UERA 4HP5A 4D1JA 4QCEA 2PWGA 2DIJA 4DO5A 2E8ZA 5CSYA 1HJSA 3WF2A 3BC9A 1QI3A 1LWJA 2GJRA 5A8NA 4XV0A 5C71A 3ALFA 4EKJA 2J7HA 2WC4A 3VGBA 1OBAA 3SUWA 2X2IA 4J28A 4WSKA 5FIPA 2GSJA 1R85A 8A3HA 1NWUA 4MB4A 4AYGA 4OBSA 2YA0A 2Y24A 1EXPA 1Y7VA 3I3DA 4AC1X 4CD4A 5D9NA 3B8SA 1ZJBA 4IPLA 1XRVA 2WCAA 4NI3A 4NZJA 4E2OA 1KQZA 5I79A 3L4UA 2D20A 4JIEA 1UD8A 2OW7A 1J12A 1E5JA 4DWSD 1HX0A 3VUPA 3U5UA 2XM1A 3WF0A 2PB1A 3MUY1
chains in the Genus database with same CATH superfamily
2VCOA 4DZ8B 3AJXA 2VRQA 4R7DB 1HHGB 4NYLB 4RGMB 4XBMA 1JV2B 5DUML 1V8HA 4LRIC 3VKAA 3SAZA 4M24A 2YJQA 5EMYA 4PVMA 5HDRA 5D71L 2VR2A 7TAAA 4N2IA 3I6LE 3QO0B 4NP4L 2ZUWA 3WI9A 3Q43A 3BO8B 1OSZA 1VJZA 3G24A 2OEJA 3KDNA 2QDVA 4WXZA 3HHSA 1N5YH 2E6JA 3NSMA 4AG4H 2GJNA 5FD0A 1H7WA 1ID2A 1O4UA 5T1LD 2PZNA 2H26B 3GNPA 2X6CA 3EJCA 4A3QA 3FRUA 4J12A 4DJFA 5AKQA 4ICXA 4G82A 1BHGA 4NJGA 2OMXA 2DSUA 4X80H 4EN2A 5EC2A 3RI5F 3LKOB 3TFKC 4JANA 5DEJA 5AYUH 2I57A 3LRLA 3AACA 4ZFFB 3OKEB 1TEYA 3UXFA 4MNGE 1MI5E 1EPVA 3R19A 2CO4A 1LO0H 4LHUD 4TN9A 3CBRA 2HPMA 3OJ2C 1FC2D 3NDOA 1KV7A 1A5AA 4JY8A 4YLCA 4PE8A 2CO2A 4AZ5A 5I75C 2BPBA 5AVTB 3O15A 1HN1A 1IFHH 4IRJD 1KFLA 2BS9A 3CFQA 4HJUA 2I27N 2O6EA 4Q8NA 2P45B 3LHAA 1FHLA 2C91A 1LO2L 1S7SB 3W25A 2WSDA 2HRLA 4OLVL 5LVEA 2D23A 4PB0H 4XAKD 1LG1A 1OWQA 3FK4A 3QZWA 1RZFH 3GI8H 1WB0A 2CSPA 5HGBB 5T3ZE 3DIVA 2YA1A 4N3UA 3NQKA 4OCSH 3S42A 2HBVA 3VIIA 4QS5A 4YC2B 1I8KB 4E5XA 3H2AA 5IHZB 4EIUA 1XBXA 3MTXA 1JZIA 1BQLH 4NC0B 2WLZA 4MHHG 1XB6A 4MCZA 5FAAA 3Q5TA 1J0YA 1SW3A 3ML9A 1KBWA 4OSUL 1RVKA 4YHYB 1DL3A 5AL8A 1T1ZA 5DK2B 1K4CB 1NANH 1W8EA 5EWIL 1W3NA 4D0CA 1FNGB 1A6TA 4F66A 3WNIA 4UM9A 5JDSB 3ARWA 2QKFA 4EPDC 3P69A 5KANG 1Q90A 3N1QC 2DQFA 2FHFA 1XQ4A 2YAHA 5A69A 4L2LA 5IFPA 1PKLA 1MUWA 1SLXA 3T6QC 4OF3A 2X10A 2BWIA 1MFNA 1SZGA 3QZOA 3PY2A 3HE6A 3B0XA 3BLBA 3P2BA 4TV6A 1Z7JA 4XBSA 3LIZA 1QW9A 3SRHA 3DSNB 4TX9A 1ZLSL 3CK0L 3UO1L 4EXPX 5J06A 2BZCA 4ZBCA 1S7TA 1NWRA 3MDJA 4N1EA 2Q8LA 5AG9A 4L1XA 3LPFA 3L2MA 4IBYA 5DURD 2ZWYA 4PRNA 5E6SB 5D8JH 3PDOA 3TFXA 4PRTA 4MD5B 4P8XA 4C4KO 2OP4H 1IGML 1XGZA 2R0ZH 3UEQA 4YWIA 4WQ6A 4NZDA 2PDWA 1KLZA 1OQXA 1QYGH 1KT2B 4IKLA 1FKWA 2FZ3B 3QDJB 2OYLA 3HG4A 4CILA 2F1EA 5ID1A 4PRHB 2P5WA 3MRCA 3JWOH 4PG9A 3AISA 1OW0C 4QUOA 2WMIB 2AZAA 2GDUA 3QFWA 4HN8A 5AAPA 1HKMA 1SJAA 3EX3A 3VXUB 4ORGB 2YD8A 4KROB 1IGJB 5FO2A 1M7XA 2FVMA 4HJJL 5BV7H 2IKHA 1QBMH 5F7BA 4UOW0 5B8CB 4KGJA 4Q9BA 4MA8L 4YAQA 4WO0A 4LYQA 3ABMB 2Y7NA 3IFLL 3RIFF 4N8CH 5D2LB 4OIFA 4PRIB 3CV6A 5D32A 1YEKH 5D6CB 1KPRB 2EE9A 2Q71A 1FZKA 2BMKA 4F37K 1OANA 3ULUE 1U5HA 1AGEA 5MERB 4Q8PA 1GC1C 5I3DA 3W27A 2FQEA 3QIWC 3CEPA 2ZCKL 2WP3T 1N67A 1RZJC 4GKNA 3ALPA 2ATSA 1SVCP 5SV4A 1MHEB 3TO2B 4WZ9A 1F4AA 5L6YL 1S5IL 1FFNA 3HHRB 3Q05A 2X1IA 3EEGA 1K6QL 1U41A 5BYWA 5A3ID 3CIWA 4Z3FA 1WK0A 3D8MA 4PJFE 1FL5B 5I16A 2B3IA 5FX3A 1RUKH 5DU7A 4PY7A 5EYWA 3EIFA 2X6AA 1DPMA 1BGAA 3SUVA 1G6CA 4TQTA 4XX1E 4RA3A 3MV01 1YNLH 4Y4HA 4P3CH 4BZ2A 2ZOUA 5FXCH 4XD6A 4U1MB 4LGXA 1DSFL 1X5YA 2QYGA 5J13B 1V4YA 2YZ1A 2QQLH 2W80C 3QOMA 3BWUC 3KNBA 1JCNA 1WGOA 2JI3A 4QNEA 4NHUA 5JLZB 4QEGA 4HV8B 5CFHA 4L18A 3L5MA 4EIGB 1F6AB 1B31A 3TN0A 1ZAIA 2WHKA 3V5KA 4FQJL 1AKJD 1I4NA 2AW2A 3A0OA 4PGZA 3M17A 4QAMB 1OGAD 3LSOA 1M1XB 3NZGA 3DV6A 1ZIAA 4HZMA 4R53A 1JSYA 5LIYX 2NNXA 2A7RA 3NJKA 4NEHB 4HNUA 4IKJA 2VR8A 1NDYA 3JBG7 1RJLA 3Q8CA 1RUMH 3U1QA 1VD6A 1FNEB 3CHVA 1HAWA 5K59F 4B9ZA 1E9ZB 3GVVA 2QVIA 4Y1SA 4HJIA 2CERA 5FOBA 3GZOA 4IP7A 3OKYA 1FNLA 3QSRA 2APVA 4KEUA 1ZHBB 3THCA 1S9YB 5BRZA 3HI5H 4D6IA 5A8PA 2OMYB 1KGYE 4K3DL 5FHBL 1G67A 3CN1A 4L4JA 2I16A 1UIOA 4YGAB 3WYZA 2Y7MA 1QBLH 1FFTB 3KWUA 3UFYA 2EP6A 1IKNA 1I9RH 1HSBA 1TQBB 3W1AA 5EPMB 4EN3A 2J6EH 3T4AA 2Z2AA 3WUFA 4FQQB 3WUWG 1HYSC 3CVHB 5CIPA 1V7ML 1EKOA 2ATKA 5CPSA 4HUMB 1MKFA 1Q9KA 2E7FA 3NA4A 2R1YA 1P7KA 5F7DB 2IBBA 4LNRA 4G8GE 4R7LA 1TPFA 3QYNA 1NUFA 1EC9A 5AOLA 1MCWW 2VC9A 4BWUA 1KKRA 3BANA 3FUHA 1JCVA 2EC9U 3UC0L 3QY8A 2DZSA 1V10A 5FCZA 5CSZA 4W8LA 4P23C 1S2AA 4DLFA 1NGZB 4IJTA 1Q94A 4KFMA 2OQLA 3O6FD 2VMEA 2XZZA 3X3GL 4OCYH 4DGVL 4X6CB 3D09A 1J9TA 1G9NH 1PG7L 3QDGB 3MZGB 3UZXA 1CWVA 3M6YA 3LUTA 5GRZA 2FGBA 3WN5C 2TODA 3WZ0E 2FSEA 3CL6A 2FEEI 3BUYA 3OKDB 1ACYH 4NUJA 3LH2L 3OR7A 2Z26A 1JOIA 1U3HB 4PMYA 4N0RA 3CD4A 2GCYA 1J8RA 3F7VB 2ZKMX 2V3GA 4WK0B 2N01B 4ODVH 4ZEPA 3BUIA 2ZDRA 2J6EA 1KBKA 2CXKA 3F4VA 4B60A 4MVBD 4LLWB 4RX4D 3L5IA 3LBOA 3QY7A 1DVFA 3KR3L 2JNZA 1CXLA 2O5YL 4A3YA 2BNRD 3MV8A 4US6A 2CKBH 1WDSA 1YMMA 3SQBA 5M3WA 2F5AH 1PUDA 1ZY9A 4GKSA 4RNRA 3AB0C 3G6JE 4L3EA 1J9QA 3H3PH 2G3NA 3WE6A 1V03A 3BZEB 3BH4A 1A0QH 1B3OA 1W1TA 4WF7A 5I66A 1O68A 1WKDA 1B4JH 1C3FA 1TZ7A 5DK0B 4EDXA 4HOMA 2Z2BA 5IHUH 1ZDQA 2V8MA 3P3TA 5JBFA 4XX1G 1MAKA 3M5VA 1DEEB 3LQAC 3KMDA 4LCUA 1HTIA 3CSYA 1WDDA 4HGWB 3W9DB 3GIQA 4Y16C 5HHMD 1NLBL 3DV4A 5CH9A 2D7QA 3KZ8A 4OCXH 1MFCH 1UA7A 2V67A 2Q3RA 4JHMA 4CQBA 4MJIA 1SJHA 4QIRA 4XP5H 4HIBA 1HSAB 4MJZA 4PMDA 4OM0L 3AUWB 5F9DC 4DM1A 5D70H 4ZS6C 1NC2D 4X2UA 3TSBA 3L4VA 3ME3A 1AUSL 4JMNA 1ONXA 1ZBWA 2OS7A 1SJDA 2DW7A 9XIAA 3QJHA 3HPJB 1OTTC 4GAAA 2A79A 3GM8A 5INDB 1QABA 1G9MH 1LHZA 3ARTA 2G2RB 3KBHE 3ZJ8A 1ERNA 4N1CA 2F1BA 5FF4A 1MG2C 2FVNA 3TBYA 4RZ6A 1GGCH 1W56A 4NRRA 2CKBA 1FJ1A 1TWDA 4NXKA 1PY4A 1QLFA 1URZA 5JOFA 1R0MA 1QEWA 3KLQA 1URIA 4O15A 4UQ3B 4UT6H 1TPB1 5HVGB 4MLJA 4N0YL 1N64H 1N59B 3BZDA 3AG3B 3AAZA 3SR7A 2X5PA 2GWNA 2JE8A 2FSDA 1XX1A 2IG2L 4PWJA 3APMA 1SN5A 2NZ9C 5DO8A 5T8IA 5J8OA 4IMFA 2OQJA 4MQTB 4NNYA 4IYKA 5A7EA 1YQVL 1TTCA 4BKLA 1NFIB 4PTVA 4UR9A 2VMDA 1N82A 1SXZA 3FSZA 1I7ZB 3ONBA 4L1BA 5I28A 1E6OH 2Y88A 2A4ZA 1Y5XA 4HKBB 4X4XB 3PWPE 1R5WB 2PDKA 4APQA 1SZFA 2VQTA 4U1IB 1E9PA 3DFHA 2F7IA 3NDYA 3RNQA 3STBA 4HIJA 4GW4A 5C54A 1GW1A 3DTXA 1GQJA 5IR1B 1EXHA 1A7BA 1IAOB 4AQ8A 2CD0A 4JIQA 5TNVA 2NNAB 4GBXA 4BWLC 2LLEA 2IO5A 4PRPA 5TDPA 5BUAA 5EEUA 1MEXL 1U8NB 4U5IA 1QPOA 4JZNB 3VPLA 3CFKB 2WJ5A 4ZTOH 4YVXA 4E36A 1IQDA 5K39A 3ZSTA 2Y0SA 4P2RB 5GS0C 3LRMA 1NTHA 1KM6A 2GOUA 4U49A 4W9LC 3UJEA 1XGEA 2NY3B 2GFBB 3CO8A 5I5IA 3FB6B 3NPUA 1XZ0B 1ZHKA 3O7UA 2LLNA 5HHOD 3EGJA 5AZ0A 1URLA 1XF1A 4JPWL 25C8H 1GW9A 5INCB 1YY8A 5L88H 4U31A 3PFQA 3J2PA 5H35A 2VXNA 5A2CA 2DWEA 5E6IC 3H9SA 1P2CA 1FYTE 4YWGH 4KZEH 4NFDA 1F8TL 4LASL 1PTAA 4FQLL 3TGXA 2GBUA 4F2MB 2HVOA 2AV1A 4ZZFA 2GDQA 1YE6A 3MGOA 4B5UA 4GW5B 3S2NA 3FPXA 4GW1A 2PRMA 3D39A 5F44A 1TPXB 4QKTA 3V95A 2NUTB 3BZ4A 3RA7H 1SUXA 4N90D 1RURL 4DJED 3UP8A 2PWFA 2YAMA 1FORL 3KS6A 4DVOA 3NA9L 5JIPA 4BFBD 3H4XA 2AMUA 2CO7A 4PJ5B 1NCDL 4FERA 5CBAB 3UWWA 2BNQB 4J3OD 5EUKB 4AX3A 3TTEA 2CU0A 1DXFA 4Y9NA 4NZRH 1PCSA 1U8HA 2FWUA 1AD0A 1NF0A 5MEOB 3WNMA 5AHNA 2C9VA 1PCXA 3FFDA 1YEWA 5D09A 4UUIA 4HGXA 1UBSA 5D2WA 4MDJB 3ZTJG 3V0GA 5IB2A 3SKUD 2ZBTA 2OJEB 1AIZA 3LS4H 3GEFA 1L0PA 5HTSA 1FH2A 1OV8A 3LB0A 4F1SA 4FD0A 4UTHA 1BIHA 3HURA 4LCYB 3GSOA 4D9RD 5DQJA 2QHRH 4BFKA 2ZG3A 5DS8B 2X6MA 4Z0BL 1K77A 2ZVRA 1N9PA 1H15B 1C9WA 2HK0A 3SCRA 3IETB 3EB3A 4Z5RB 3APYA 1YECH 1BRLB 5F6IC 1CB2A 4UZSA 2Y62A 3QIUA 1UGNA 1HKLH 4EIVA 5E8PA 3X13A 4AHPA 3HE7A 1XYAA 2Y2YA 3WDQA 1RCXB 1ML1A 3PXLA 1A9EB 1UIPA 5EU6B 4HZ7A 1W9BM 4YPGA 1AGDB 1CW2A 4U3AA 1BX2A 3GLDA 5D1QA 3BCFA 4ZW7A 3SQLA 3MRNB 2E09A 3HZKB 3NO3A 2VGGA 1EO5A 1IEIA 4I3GA 3WJLC 3N11A 2HFGL 4PULA 2VELA 4JREB 2PD5A 2ZZ2A 3GC5A 4NZFA 3O8XC 3TYBA 3OKLA 4NP9A 1FHUA 5F0LB 5HXMA 4JY9A 2HJKA 2DPEA 5AC4A 5TDNA 2VC2H 1A8ZA 5I76A 1TZGH 1AQFA 3BGMA 1F97A 4LEEA 3NJMA 3GRIA 4C5YA 2WZMA 3D18A 1JI1A 1AK5A 4I5UA 1LOSA 2XWXA 3G0SA 4GMTL 3P77B 2V2TA 3U5YA 1INEL 1FG2A 4OFYD 1NSNL 2GGJA 4LIQE 2E5DA 4W81A 2GIXA 4OLXL 4LUJA 3UZEA 5LIXX 2EKJA 4MPKA 5I7GA 2ERJB 4ODWA 4NQDA 4F9PA 3CXHJ 3ETTA 4O1EA 1QSFA 1TUFA 4JEJA 2JCCB 4ZMWA 4JRYA 3FOLB 4PG2C 5I8CA 5GZOA 1DQVA 1ZLPA 2EABA 4LCSA 3Q2CA 4GSXA 2A83B 2JKAA 4HT3A 3QUZB 4PJ9C 1HZYA 4LF3B 3TA3D 3PAYA 3RGTA 2AQTA 3CLFL 2DB8A 3V0JA 3ESPA 3O9WA 4JY5H 4ZUVB 1RZIA 1OX5A 3IJYB 4LLVB 1F3JB 3D7PA 4XV0A 1NLDL 4NZ4A 2TSBA 3GAYA 5JYMA 3WBYA 1X7QA 2GTWA 5CSGA 1F41A 3MRPB 1F5WA 3DG6A 1QPPA 4E9TA 2PPFA 4K1WA 2HRPL 1ADOA 5J5EA 3L4UA 5JUEH 2DQIH 1J12A 1HX0A 3BT2L 2WWNA 1JPMA 2PP1A 4RFEA 2JWYA 5HSFA 5CJQH 2H8PA 1FXQA 3PP4L 4WJG3 2PDGA 3VXSA 2V17L 3L9YA 4MB3A 3B4NA 1JVNA 1Q6RA 3SSGA 4H0IA 1SLVA 3WBAA 5AC5A 4P9MH 5HQMA 2E56A 1QASA 5FYLD 3VGHA 1BD2B 2VXUH 5DD3H 4M19A 2V4LA 3CDFA 3ZMNA 2NX1A 2VFGA 2UV8G 1H9VA 3UGEA 2ZYRA 2YGOA 3MMEA 2IFFL 5E7BA 5I07A 3QY6A 2G41A 3W87A 1RIUH 4IX2A 4A8NA 4D3CL 1NFGA 1XI3A 4IJBA 4QHPA 4GI4A 1SR0A 3K8LA 2Q76A 1BTCA 1JZ3A 1H41A 1X9UA 4MZRA 5F9OH 2XYCA 1TU2A 4HA0A 4W89A 3AIEA 4Y19D 4RMRA 4FABH 3FMGL 4R9HA 3N9GL 1OHLA 1EQPA 3FEMA 4JKLA 4BQ5A 4QFUA 3S3SA 3FKUS 4FFYH 3FDWA 3A6OA 5IFHL 3UTTA 4DP2X 3BKYH 1H50A 2BDNL 2RTTA 4MZ2A 4Q33A 2NQJA 2CRIA 1QI4A 4XI5D 4AHQA 3TM6A 2QPEB 1WT5C 4IQHA 2WZPD 2ODOA 4BK8A 1EDQA 1HU8A 3VH8A 2ZFAA 1RA0A 1DWIM 4JXCA 1X5AA 3URAA 4H3DA 4NZ8A 3O2WL 5EOCJ 1E8WA 2AGJH 4DPAX 1DQJB 2ZPKL 1AH4A 4GUCA 5F2GA 5I1AB 1ZBKA 1F2JA 5ITBH 1X7SA 4U1KB 4PFHA 1B3ZA 5SX5K 3ULUF 3DPDA 1NICA 2BLEA 1ITCA 4QG9A 3BQ5A 3NEXA 4HHAA 1YTKA 3WD2A 2P1YA 1HYRC 1I0DA 2EDXA 1RZKH 4PGBB 3LCLA 3U2OA 4PTDA 3U4BL 4B5EA 3MV7E 4WDWA 1EDTA 6FABH 1J1PH 3NN8A 1U1UA 4HUVB 5IB4A 4YR6A 3ITXA 2VR3A 3BVNB 3PHQB 1SY6L 2GI7A 3VQ1C 3REWA 4RH4A 2K7QA 3CJJA 1BQHG 3K4DA 2A7BA 1DJZA 3NSYA 4N6RB 2B0MA 2DVXA 1MUJA 3WO8A 3FQUB 5JR1L 4KKRA 1R5VB 3VINA 1JAKA 3HUJE 1EZ2A 3MY9A 2FYYA 2O6CA 3TVMC 3OD3A 1OZMA 3KAOA 4KRMB 4JW3A 5FDYA 3PUGA 3UG5A 4M6NL 3S1XA 3QDHA 2DN7A 1XCQB 4ODHL 4G70B 1GOOA 1XGRA 4IXXA 1FWCC 2PURA 2CDFB 3ZHDA 3D2UD 4D7BA 4ELKA 2B16A 2W88A 2BIPA 4TO8A 3NZUA 5DVOA 5ADOH 2HK1A 2ISVA 1OGTA 2OWCA 1HZLA 1DBTA 1THFD 3TK7A 1M1BA 3RDJA 4FX7A 2AV7A 4G3YH 4AJYV 2WVTA 2H0FA 2X4TA 1YDOA 3GX9A 2E7MA 4Z0XB 2NLJB 4ABQA 3WG7B 2YGNA 3TYUA 3HNTL 1TZIA 5DJ6B 2NZ1A 1PSKH 2IS7A 1IEXA 2XFXB 3D87B 1US3A 1Z3GH 4KUZL 2R2HA 1XDTT 3RG1C 4F79A 3EHBC 2Z24A 1ADWA 2QGBA 4IIQC 1OZTG 1KNWA 3BARA 2BIOA 3FQXA 5JO5A 4F7KA 2E0PA 2XY1A 1E0VA 3WQ8A 5M03A 3ILQC 4UT7L 2XM2A 4MWAD 5D7EA 1K6WA 4XN5A 3NGBC 1IBZA 1UXMA 3ZO0A 4MZYA 3UF9A 4P5SA 4JTUA 2ICEB 1WUZA 3QRBA 1T5WB 1GKOA 3MNWA 4ZAKB 4WXYA 3DWTA 1L6WA 2BXZA 4F1ZA 2WJ7A 3W28A 2GUOB 3RWJA 1EEZB 4KW2A 5IOBA 9PCYA 1CT5A 3WJZA 1A25A 1SYTA 5DUBA 1IKFH 1NEZA 3KS0J 2V37A 1C5CH 1W9UA 1Z9PA 5CEYB 1J8SA 3R2GA 3ZPDA 3KPMA 3C09B 3AT8A 4M3JA 4POYA 3KBVA 1TVDA 1W32A 3A21A 2QZ5A 3FO1B 5CU9A 1N8IA 1WZLA 1GPOL 4CVXA 2ZOLA 1G7IB 1QRNA 3CDGA 1T5XA 4J8RB 2EKSB 2NQ9A 5IVXE 4DF9A 3DG3A 2C7FA 3D30A 1VFLA 2QPUA 4UILL 5T5FH 1P5BA 4C1NA 4MJ6A 5E0FA 3FU3A 3RGVC 3P2TA 4OBRA 4PMUA 2RACA 4UB9A 3LCFA 3SE9H 4WHDA 4A6YA 3IGXA 1CK0L 1N0LA 3FO2B 3G1SA 3N41F 4JHOA 4LLQB 1WBHA 5DZLA 4EP8C 3TQVA 1GYLA 4DVBB 1EPXA 2JEQA 5CGTA 2DZVA 1RHCA 3WLIA 1CYXA 1J05B 2YDQA 2AOSA 3EKGA 2FLRT 1JXGA 1BZ9B 4NI6A 1JHTB 2Y8KA 4JTJA 3B8IA 5I75B 3SUUA 3JW7A 4LS1A 4AUJA 2JVUA 3U1SH 3BSZL 3CQIA 3L3GB 5KSWA 2R23B 5DVMA 4JKPL 1SMAA 3APCA 3AAMA 4CNNA 3LNMA 1HH9A 2AJXL 4F7MA 3G6JF 6REQB 4BA8A 3O3UN 1KGUA 1XL6A 3SKJH 5JOEA 1JZDC 4PGCB 1VFOA 4Q2ZB 1AYOA 1QSEB 4BXVA 4DKTA 5EF3A 5JMRA 3RIAF 3IXTB 1MNUH 3IEAA 2R9HD 4PGDB 4XD3A 5KSUB 4O10A 5LA0A 3REVB 4QGTA 3C6EA 1EZLA 3TBTA 4X6FB 4E9WA 1OX4A 1AVAA 4GRLA 4KRPB 2R0LL 5C0GA 1C8PA 3SCMB 5T5FA 4Y2DA 1WIPA 1VFMA 2YPKA 3ES6A 2ZXAA 3DUGA 3ITCA 4J1OA 4IMCA 1PZBA 1LG2A 3QDMB 5HHVH 5DCEA 3NZSA 3UU0A 5LNRA 1XL9A 3RN6A 1EXGA 3C56A 5D93C 4FKHA 4QRFA 5F1OB 2OMZA 1A4JB 4JGUA 4DF2A 4DZ5A 4A29A 4NJAH 4IF2A 2WKGA 1SZNA 4HG4J 1S9VA 4F7EA 1G7LA 2X4QA 4L4OA 2QJHA 2Z6FA 3GMNB 4N25A 2V2DA 3QEQA 1OCWL 4OZHE 3IGUA 4H1LG 1UCWA 3MJ9H 4Z3EA 2E76C 3BOFA 4J1UB 4BEUA 1GTEA 4WGKA 2B5IC 3I6RA 3VE0A 2BGSA 5LAXB 5BVJA 3NXLA 3N85H 1PB0A 4OLUL 5FW7A 3DI0A 3VQMA 5EF2A 1IEHA 2FX8H 2IV8A 2PR4L 3GPSA 1OWRM 3D9AL 4JN1L 5ABDE 1IU1A 2FD6H 4XZUA 2B9BA 4JRXA 4PUBL 1UM6H 1DANT 1E40A 4GT0A 4LP5A 1B2WL 2PZ0A 3W84A 1OAXL 5FO7B 4XVOA 4N68A 1KV8A 5C55A 5D9MA 3JSSA 4H4NA 2XFRA 3PSVA 2XN9B 1GG1A 3NA8A 2WBJB 1B1YA 3KYOB 2ACQA 3M64A 1DJSA 3D33A 4LSPH 3VVVA 2HVJA 2X4UA 1TZHB 4WSHA 3F58H 4AVJA 3QIBD 1AGFB 1WP6A 4WNSA 4G80B 3QK0A 3NAVA 2MNJB 2O56A 1EJVC 1KFJA 3GUTA 3BTNA 4TSBL 3M16A 1E5NA 2K45A 5C09A 1X9RA 2D9CA 4K7PY 5AYZA 4MTVA 4WK9A 5FKPA 1T1XB 2Z00A 3JUGA 1MREL 4M7TA 4F9LA 3KXFB 3MSDA 3TT1H 1UXWA 2K9FB 5JXAH 3UTZB 1AOZA 1KTCA 1YN6A 4AZ7A 2I7OA 3TZVA 3B3IB 2QQNL 4IIBA 4YSDA 1FWTA 3RAOA 1DLHB 1OL0A 1AKPA 4Q7IA 4CMHC 1HL9A 4LBEA 1T22B 3W75A 4XVJH 3L7EB 4IU2A 1UADC 3UTPD 2JLPA 3G5YB 3BPWA 3SGUA 4IM8A 4L5FH 4PODA 4J3VA 4QIUA 4RZBA 3BRGC 2F84A 2C4FU 2IPUG 4L1WA 2BHYA 3LMYA 1KGCD 3IVKA 1TZAA 3HC4L 2J6WA 4CSSA 3MRGA 1GVSA 4AVOA 4Y5VB 3I9PA 2XIQA 4LPYA 2PYEB 4PV9A 2RUSA 4MA1C 1KM1A 2AAAA 2XXFA 4B5XA 2VLJB 5D7JA 2G0WA 3DRTA 1SF5A 4PREB 4MSWA 4KRZA 3NQCA 4CA4A 3ECVA 4KJYA 3OQ3B 4KMQA 3BPCB 4NPYB 2K78A 4GRWH 2VIRA 2YR1A 4LAMA 4LEOB 4KK9D 3UROR 1MFDH 4P9HC 3ZWTA 4S1RH 2J66A 3C8FA 4J4PA 1I1YA 1HEZB 2OELA 4F4RA 1XGYH 3B2UD 3VXPA 4W9TA 3MYJA 1LTDA 3CL7A 5FHAL 2IQ9L 1HOCA 2LV4A 5CEZH 1T8QA 4QTIL 4ODSH 3BIKA 4GQPH 5IBLC 3P5YA 5HNNA 4WUIA 1ODZA 3WFHA 4E42A 3RRQA 4C56A 4GKZA 2QIWA 4O1AA 2J8UF 1FG9C 3QORC 4A68A 4O0QA 4XPGH 1KXTA 2A74A 3O6YX 3ETSA 2GTQA 5HY9B 3KZPA 2OAAA 2YJLA 4AV4A 1CFVH 2OXHB 3MBEB 1RFDH 2HLFC 2F5BH 3CIXA 2NQDA 3QRLA 4LYRA 2KHAA 3PZ9A 3LNEA 3S1VA 2BOCA 4RIRA 5BJTB 4XH2A 3TO4D 2J6VA 4LUSA 3RDTD 1RAMA 3L12A 3T0EA 1GQLA 1IAII 2H1XA 2P43B 4L1GA 3AREA 4JL1A 3W2LA 3RM8A 1L9OA 3TN3A 2PPEA 1U8IA 4XVTL 3GDCA 1EJTC 2CO3A 3ZFHA 3BLPX 2DZUA 2OKOA 4F8XA 2QDGA 2PGWA 1HH6B 2NV1A 4PQXA 3GZ3A 2E7CA 2I1OA 3WL1A 3DDGA 3UWUA 3MRLB 3EOAB 3AZUA 4KVNH 1YPIA 2WUCL 1RA5A 2R4RH 3ULUC 2YB4A 4IW4C 2ZUNA 3OC8A 5KBDA 4MHBA 2BZDA 4Z7QB 2XPZA 3QJOA 4AY7A 1O7DC 4LU5L 5MF5A 2HS6A 2FZ9A 4WDTA 4W4OA 1OIOA 1YNPA 4FMVA 3F12A 3LEYL 1VEMA 2O30A 3HPLB 1BFNA 1BXAA 4WWID 5D72L 4X9YA 5EC1A 3TNMA 5FS5A 2OWWA 3VFSA 3K6NA 3U36A 2QCGA 4HALA 1ZFJA 2FJGA 4ERIA 3V4UL 1CJYA 3UXKA 3ZU8A 4FI6A 2FIKA 3W81A 4LHUA 1AH3A 2PBOA 3LY0A 2Y1AA 3SGDH 4GP5B 1JWSA 4RFNC 3U25A 4JKKA 4OGAC 1BOGB 4KKLD 1RLBA 4ZFOL 5MENE 4AF0A 2WOQA 3O3BA 4UWMA 2A2QT 2BWDA 2HCVA 2EXOA 3BMWA 5DVKA 5TAOA 3P2VA 4NL1A 4IRJA 2CLHA 5C9JA 4KKZA 2GGHA 3OVGA 1GOMA 4YDVB 5FA3B 4V1YA 4PW3A 3GMOB 2Z8WC 3EWYA 2H0JA 1FAKT 4DN4H 3HZMB 5BS0B 5HHPA 3P67A 4FTVB 4N5EC 4PFEA 1SM3L 2DVTA 2PTZA 3LIZH 1FWWA 4Z7OE 5FO8A 1NEYA 3T6ZA 5F6HI 1TMQA 4NKMA 3IIXA 1P4IH 5E08H 3Q37A 4BSJA 4DKEH 4JO3L 1FLRL 1ZTVA 1CURA 5CFAA 2ATPB 4JX6A 4JB9L 4MQ7B 4BUGA 4NJ9L 2XICA 2VN6A 4EWJA 3HTLX 5EOQL 4LCQA 2WTOA 1FZJA 5CZSA 4PYHA 2AJUH 4QR7A 4NBXB 1IEVA 4BDVB 1GK8A 1VRSA 5EO1B 1Z3RA 1UOWA 3DPBB 1KFGA 2VABB 1UFGA 2YSSA 3AY2A 2H9GB 1DR9A 3UTOA 2FZBA 1MFEH 1K7FA 3AS3A 3BAXA 3OVRA 3KYMB 3CH9A 3MLXH 1F13A 4HS3B 4NQEB 1IGYA 4OE7A 1E4XH 4RMVA 1P7HL 1MHCB 1NGXB 4Q6XA 1GNXA 3RWIB 5C92A 3EKCA 1A3RH 1JCKA 3EZ8A 4LLMB 1N8ZA 4UCGA 1XIWC 1JVKA 2WKJA 2W6RA 2CXEA 1I1FB 2IOIA 3OAYK 4ZMAT 3FFSA 4XZ9A 4WWKD 3CZLA 4AWJC 4YQXL 4DEPB 1CL7H 2AZUA 1WWBX 3WQDA 1DORA 3WH7A 3LKQB 3DMMC 4TX8A 3ZLFA 5BOOA 4WHYG 2OI9C 4GC3A 4HBCL 2NY6C 3KP1A 3QEGH 5HWMA 4WTZA 3G1XA 3WJMA 3JXAA 2PODA 1V3MA 5DHXB 3ERXA 4JDVA 4IJCA 5MI0B 3A5VA 3GTTA 4W9IC 5LJYH 3L3JB 1NCWH 5DFVC 4NDMA 3FQNB 4LBAA 1CO1A 3FGCA 2HKHH 1T66C 2WJFA 5EF0A 4FZEH 1E27B 3U9PL 3UEZA 3VI2A 3H7VA 2C0HA 4IJ3B 3D4CA 3D3VE 4BZ2H 2F19H 3STLB 4YHPB 4B0MM 2ISDA 3SM0A 3BPOC 4NT6A 4N20A 1KTLB 2R1WA 1CF1A 4FQCL 3ERPA 4CEUC 4GSUA 3W7RA 3PUOA 1S9WA 3MSPA 3QXUA 3EYVB 1Q6LA 4U3SA 3RPTA 2V9UA 4AYFA 3OVUB 3MBXL 1BREA 5LXGL 5IW1A 5KZCB 2O5XL 3L08A 4UTIA 2EIKB 3AVEA 2E7DA 3T77B 4MMZA 2OODA 4QYAA 2X44D 4M51A 2Q87A 5CCJA 1K7XA 2VXQA 4UFHA 3AWOA 3QJXA 1UP3A 1O7DE 3A67H 3P74A 3EFDL 1S8DA 1K4DB 2UUDH 3R8RA 2FT7A 3SDXA 5ERWB 1JG9A 3UERA 4L9LA 4NQXA 3HUJF 3QNYB 4EPKA 1U95B 2BVQA 3EG9A 2DQ6A 2AQSA 4ZNCD 3LK6A 3VFRB 4I89A 4NENB 3P30L 3SPVA 1DHPA 8A3HA 2P50A 5I2IB 5C3TA 4WVXA 1JRHH 2K1MA 4PJ8B 3B05A 4TU1A 1F0LA 1F2XK 3B8SA 4XKYA 1MJUL 1QDSA 1AKJA 2VLKE 4E2OA 1AR1D 3QE5A 3HGRA 1OGAA 3MFFA 3O6DA 2EC8A 1RZ8A 4C58B 2VGFA 1PJ9A 3PV6A 1RUAH 3BPNC 3MLWH 5CIPH 2IMNA 5DJ8A 2R7EA 2A73A 4X9FA 1ECEA 4XHQA 2APXA 1VJSA 2X38A 5JHDB 3ISWA 1PZ2A 4GQ9H 2DDXA 3LBMA 2ED9A 5C9XA 1TQUA 3QJFA 1UJPA 1P4CA 5B21A 5F70A 3M7SA 4N8UA 2FMNA 3X17A 3KYNB 4Q6JA 2P1FA 5DRNB 2DM3A 2A9NL 4H2HA 4AEEA 3UQNA 1GW6A 3S37X 2FGWL 1S2TA 1S39A 1CU4H 4U5KA 5IQ7H 4QRQA 2FVLA 2VC7A 4XO9A 4EUPB 1P0DA 1QNZH 1EAQA 4PZVA 1DDHA 3GO2A 3K5RA 3ZHFA 3EX4A 3T0AA 2C9UA 1IC5H 5G1MA 1JNHA 1KB5L 4DFIA 1SJCA 4JZOA 3S4TA 3WLKX 4PJEB 5HGAA 2F54D 4GAYA 4Y4KB 2UY2A 2PW1B 4JLRB 5CJNA 1MZZA 2OO0A 1FH9A 3O6MH 4CCDA 5ABFA 3VD3A 3UPCA 1GAFL 3MBWB 5J6GA 1OIMA 2ZCGA 4WCJA 4AQZA 3LRSA 4DM2A 4QGYA 5I15L 5D7LE 4LVOC 4AEHL 3QYQA 3M6DA 4H25A 3M45A 2WZAA 1GQKA 4MQXD 1H7PA 3KTSA 2J20A 4S3JA 3MUAA 2V5SA 2AC0A 2E7LC 2HZHA 3DXAE 2H1LM 3IJEB 2NW0A 2QADC 2QJJA 3AIRA 3CH8A 2DLIA 5IVXF 2EACA 3RJDA 4GACA 1HI6A 3ZL4L 3VFCA 1U58B 3O6FA 4N0UB 1LO4L 1RUQH 4GXVL 3FTZA 5B80A 1AHWC 1KYAA 1YUHB 4Z7IA 3TLRA 1RK1B 1CLYL 3O2VH 3R8QA 3NJJA 2X4OB 3S1GA 3ZVVA 5C0RL 4AIUA 3BSMA 1EEQA 4YBHA 4Z7VA 1GGOA 3QNXB 4PGEA 2DQDL 3NYKA 3AWFA 3QQ4A 3ZKQD 1UWRA 4WOZA 2IANE 1EHKB 1L7TL 3B2MA 1WWCA 4FXLA 2PCQA 2R0WH 4URKA 2YD7A 5E9DD 4L8SC 4O2CB 2C16A 1FGVH 4DW2L 1TFVA 5ABAA 4U6HA 5F0MB 2ZF8A 5AZUA 5KBPA 2ACRA 4KETA 1OB1B 2VMJA 2BNRA 4YDJA 3CLMA 3SKMB 2YS4A 2J21A 3KOZA 1BAFH 2AJSL 3LGEA 1A2YA 3L9BA 4EZKA 3GD6A 3BPLB 1ILUA 3UJJH 1XLJA 1YJDC 1T83C 1NC4D 2DT1A 4Q74A 4Q6IB 5DMIH 3EGSA 1KWGA 5HBBA 2V7HA 3SY0A 3SN1A 4NQVA 2OMVA 2BVEA 2UZYA 3VCLA 1FCBA 5IMOB 1TVNA 5EEYA 1WBZB 5AQ0A 4GYFA 2G50A 4RBPH 5KJRH 2EYRA 1INQB 1KY6A 3L1OH 2AABL 2XFWA 2DYPB 4LS0A 5IBTL 4HFUH 5KSVB 1DIEA 2F08A 1WWWX 2OTWB 4OCMC 4CADB 3G1RA 5SWZB 2GT9B 2R39A 4ISVA 1FXPA 5J5RA 1LWHA 3B37A 4YSEA 4X4YA 1T99A 4IIEA 5SWUA 3N19B 3TC9A 1T1YA 2DWDA 5L4MA 4Q8VA 3L0GA 1E9OA 4FQXC 1NC2A 1E9YB 4FI4A 4B3ZA 3C4UA 2ORBH 4AIEA 3A5FA 3W6YA 4Z7UB 2QHAA 4CKQA 4ZL1A 1QFUH 2ICWA 4YXHL 4OZHF 4DVRL 3L48A 4P4RB 4RWYL 1V54B 1UKOA 3GQYA 3U6RB 3ROLB 4Z0SA 4M7LT 1UD6A 1IR1A 4WFFD 1GQNA 1BQKA 2XTJB 4MDPA 2HSAA 4HMDA 2ZKYA 3FLUA 5AVUB 4BCXA 3SIMA 1S7VA 1JUFB 1BZEA 2HE8A 1CFMA 1DFBL 4LY4A 4QDGA 1P7BA 4WTQA 3NZPA 1U8PB 3GVWA 1L2UA 2HBXA 1G9HA 1G94A 3AUOA 3RHGA 1Q0XH 3C60B 1I60A 4IOIB 4WQOA 1V0KA 5DJ2A 5LNWA 4H0GA 1TETH 1CB4A 2ISFA 3L68A 5E8EB 2I25N 3HKFA 4NNXA 1NQ6A 1I9JL 4FDWA 2DRUA 3E2HC 4DBEA 1YLVA 1UEYA 2VXSL 1W8GA 3IDMA 4HX1B 4ZFOB 3VRIB 3FU5A 4BA0A 3H2QA 3LXAA 1HL4A 3LNIA 4FL4C 4LVFA 4WIWA 3S5LA 4OZOA 1X5ZA 1YYAA 1A6VL 3SOBL 3L21A 3ORJA 5IROA 1FV1A 4IOFC 1R3JA 3VWJA 4WV1A 4G7YL 4NZ1A 4EI5B 3C5XA 2BW4A 4PJHE 2UVFA 1LK2A 3BEWB 3QSKB 4QCIB 5F1NB 1VHCA 3IFNH 1XIGA 3TIEA 4Q4OA 1IYXA 2V81A 2DZWA 1XUUA 3TWCH 2WZ6A 1JCTA 4RQQB 1MG3C 1CGUA 3IJHB 4Q4QA 4ZGYA 1E70M 3V2AR 1NJJA 4L1LA 1Q9WA 5HHOA 4QRPB 1R33A 4HMCA 3WL9A 2ZDSA 4YX2L 1CGXA 3D48R 4N2BA 3DROB 4KWOA 3HRZC 3APFA 2XNAB 2WSYA 4LPTA 1EANA 1WAEA 2A0LC 5IB1B 4OFDA 4P5KA 4HUXB 3P54A 1EJWC 1I3VA 3FKKA 2GQ8A 3FTGA 4QT5B 2UY7B 3U2IA 3VSQA 4ZXBC 3LNFA 3ZR6A 5D4YA 3UNDA 3FF8A 4TNWF 3BRDA 2PS2A 1DJHA 1OEZW 3EGDA 1XLCA 1P4BH 4XCYA 1SFDA 2KT6A 4RL3A 3EOTL 4PJAE 3LHPH 2PTXA 5LGZA 3VFPA 4C60A 4X5PA 3II1A 4QRRE 4DJEA 1K1DA 3L16A 2X4RB 3OKKA 1IVLA 3WXVH 4PR5B 5IJDC 1ZIBA 4BSVA 3F8UB 1N6QL 3DVGB 4ZUWA 2CLIA 4GIPD 5CMAB 1UOLA 1U4FA 5E2TL 2HH0L 1CICC 4ERSH 2IF7A 4XO4A 1FO0L 5BZWB 3G1DA 1HO1A 2JTDA 1BBJA 5D4QA 2WZHA 3QG7L 1X38A 4I77H 2EDBA 1WUNT 1G43A 5I30H 1XJBA 4HNVA 4NNPL 4DI9A 1DUZB 3HMXH 3I6EA 4FMKA 5LGYA 1BXNA 4PJ7B 1JPGA 4NAQA 2HKFL 4NHVA 3CN4A 1E6QM 2HFFB 1QXLA 3WFBL 1RV8A 3GK8H 3BHBB 1YEYA 2DF3A 5AB2A 4BFIB 1G0DA 4BE5A 3F7KA 5KS9A 4HFWA 4NBZB 3G3MA 5DEGB 4OZIB 3B06A 2CLLA 4UINL 2WVSA 2X9XA 3IS0X 3FJNA 2XQYK 1ZPLA 2J8UE 4E2VA 3NGBB 4EIZC 1R3HB 2CBIA 3VFUA 1ZT7B 3NXFA 2XZAH 4FNUA 4XMPH 2KX9A 3LOTA 1BSIA 2BVPA 5L2JA 4W6WB 2YLLA 2GJXA 5HD8C 1LEKB 2DZTA 3VWKD 3UG3A 1I7UB 4KEVA 1O1ZA 2VP8A 1MN4A 1PYMA 3EDFA 4L6HA 3NEHA 2OMWB 4DP7X 3HF3A 4E3VA 4G9FE 4DXKA 1EQCA 1IXPA 5AHFA 4HIEA 1CFSA 1LGVA 3N2JA 3KPLB 3MA9H 3P8IA 1KLUA 3HQ1A 2WUBL 4JPVH 1OCZB 4X9BA 2PDMA 5TJWK 5H2BB 3M0XA 1XWVA 2KLTA 3QDJD 1XSOA 3HMXA 2O7SA 1NMAL 3BZJA 3DDMA 1WGVA 1MCIA 5H8MA 1AQDA 2D73A 1R9YA 3MR9B 1C91A 1UJTA 1SQMA 4OFYA 4M61B 4HPXA 3VXUD 5HVHC 2K0RA 1JZ7A 2BP1A 1ZT4B 2DYRB 1ZE3H 3MRHA 5LBSL 3P80A 1WCQA 3P11L 4MNQD 1Q66A 4HJ0C 3UZQA 1KLGB 5IWLC 1G7PB 3UR8A 2VEIA 2ZJSL 4PRID 1W1VA 1H1YA 3H1ZA 4KTGA 3RLSA 1QVOB 4HJWA 3HS8A 2O6FA 5KBLA 1M7DA 3MKGA 1HXYB 4RCXA 3QC0A 2R91A 3L2NA 1HJWA 4E8CA 1H1ZA 4V1DB 1CZ8L 4YHGA 2DPKA 2W59A 4Z7OF 4YE4H 3G04A 5A8OA 3AIBA 3GW0A 4BE6A 2K6WA 3P81A 1TO5A 4WK4B 2XGIA 1LO5A 3VCRA 4E8GA 4HA1A 4NO5B 1KRBC 3FT2A 5U7SA 3ARFD 2G5WA 1I8MB 3C5JA 2L7JA 3TA3A 1KEGH 2DJUA 3CFBB 5GJPA 4S1DC 1E0UA 5LYRA 3S3PA 3D3AA 2Z1KA 4MZ3A 5I1KH 1GIGL 1E9LA 1UROA 4X0VA 4CVZA 4NSKA 2BY3A 1TPUA 4JFDD 3BN9D 1D9KB 2JKIS 5JW5B 4UNIA 3STEA 1HEJC 32C2B 1L2QA 1KB5B 5B39G 3I9AA 2OR9L 5CINL 4QHUA 2YKLL 2COVD 3C12A 3PR2A 5PTDA 3RZCC 3ROOB 2EIMB 5AYYA 2YK1H 1Q3NA 1YAZA 3UZ5A 1RERA 1R38A 4KQ3L 5FF7A 4BZ1A 5E4IA 3LHYA 3XISA 1ECQA 3K72B 3LRKA 5I18H 1L7IH 2W67A 2N56A 2OU4A 4GXWA 4X99B 3U0WH 1HXMB 4KY2A 4O5LL 3WQFA 1BWKA 1R9XA 1DQMH 4U0RB 1W1IE 3QBTB 5E1AB 5K5YA 3F04A 4R7WA 1G6RH 4PJDA 1PS9A 5FYJL 4K8RH 2Y22A 1QWKA 2H6PA 4QEHA 4L8CA 3UWQA 2Q9OA 5I74C 2EIDA 3Q2VA 5LGJA 1WDRA 3B9NA 3EXSA 1XCXA 2JK5A 1UKTA 3WHXB 1EGZA 2D7TH 3WD5L 5ETUB 4GI6A 4G71B 2W0UA 3M0IA 4MA3B 3SDDB 1REQB 1VADB 3UYPB 5IEHA 1OAYH 5BQDA 3WCZA 4GUHA 2J4WL 4C4UA 4UBPC 4HKZA 4LL4A 3THUA 2QAPA 3PANA 4KF1A 2BP0B 4F15C 5C0AE 4OCRL 4G83A 4QDWA 3KPSB 4X5RA 4UANA 3FU0A 4I3RH 5F1VA 3U2JA 4XAFA 1VC4A 3RI5K 4S2BA 2WZPA 1BZOA 2V5YA 2CXGA 1UURA 3NQ7A 2EYSA 4LFHG 3MTRA 4MNGB 3SJVD 3BW3A 2ZAHA 2OO6A 3I4KA 3HCVA 1X6UA 2OJPA 2AEQH 12E8L 1CC3A 2G4FA 4L37B 1PX4A 3IJDA 4GBUA 1BLNA 1M7JA 1HUVA 5E94B 1S7UB 3EJSA 5M5DA 5K4XA 1FSKB 3KHOA 4P59H 1XIHA 3KWWA 5J1AA 5B7YA 1XGUA 4PBFA 3ILDA 2B4CH 3MYOA 1GYCA 3KOFA 3SCTA 1HJQA 3AQYA 3F7JA 1G6RA 3ZJKA 2R4SH 2YGPA 4J2QA 3TF4A 3S97C 3N0AA 4G6ML 2J78A 4MJMA 1JPFB 2X3BA 5GRYA 5DMGD 5DY3A 1B9BA 3RNDA 3F00A 1VGKB 5AVHA 3N29A 4YSOA 4MMXB 4BI6A 3QDGD 1QTWA 1PU0A 4IHCA 2YD4A 4RV8A 2NY1D 1FBIL 3GHEL 5I1JH 3TC7A 5E99H 3DI2B 4IRZH 1XH2A 2L3BA 4DWHA 2D2GA 2NT1A 2R2EA 3D2UA 4KTEH 2QJIA 2LE9A 4L9XA 2Q6WB 2WLMA 1U3HD 2E27L 4R84A 4YHOH 1T20B 3OWRA 4AVNA 3WLSA 5DC2A 2P8PA 1AY1L 4UUJB 3NCMA 3OZOA 2PA6A 4CQ9A 2ZNXA 2FECL 3T55A 2VQ4A 1A7NL 1K8IA 3GSUA 1AANA 2OK0H 4KU1A 4ADGA 5C0CB 1GOWA 4TVPD 5DXWA 1CT8A 1D2OA 3M0VA 3PIQB 3P5ZA 2D03H 2AQ1A 2VDIA 4P2OA 1EWDA 3U6XA 5E8NB 4DP4X 4DH2A 4EAMA 4YTSA 4N0FB 4WTXA 5DZVA 4AAJA 4LCVA 5C97A 5LQBH 5C0BE 5ACZB 4LCIH 1R24B 2JELH 1DE5A 4LCWD 5DRZB 5LCVA 3ZGHA 4UF7C 4HPOH 1AIFA 4OLYH 2Z8RA 4ZFZB 3EXJA 3RNKB 3ECQA 3MOAL 3IDGA 3GBML 3MOQA 1UB3A 4L4VA 3GXUB 5EUOA 2YD5A 5JIHA 3SQSA 5EU7E 1QPKA 1OP3H 3JZEA 1BYNA 3RPMA 3UOAB 3MODL 4DGUA 1E3XA 3FAWA 4MWAA 2VB5A 5J3HC 5CILH 3MRJB 1T2QL 4R4BA 4G2DA 3GFXA 2AQPA 2ZOKA 5T33L 1KIRB 1NBVH 4A6YH 1UJ3A 1L9WA 2KERA 1E1CB 2W5FA 3FOMB 1N18A 3BXNB 4IRZA 4UDUA 2UWEE 4S1SL 1UWEL 1BV8A 1MCBA 1YHTA 4OF0A 4UTUA 2CUAA 2GB2A 5EU3B 1I3GL 1F42A 5D1XB 3MNDA 2CPCA 4HK3J 3KPOA 2J57A 3LN4A 3KLHC 2O1AA 1AQHA 3W23A 1TZ8A 3HMCA 5DJXB 2J8HA 2NQLA 3JWDC 5CS7A 1YDVA 2OSWA 4LUYA 4NUMA 1I2QA 1OD8A 5BXPA 2C19A 3IIPA 3WQ4A 4GLRI 1HJBC 3CMFA 2CNYA 5BMXA 5EU9A 2P3YA 4P46D 2LABA 3RB7A 1B3IA 4XMWA 4OV4A 4G6CA 5KUMA 1U8CA 4KOBA 3V9FA 4A7TA 4IGBC 2ZZ5A 3MV11 4HF5H 1MY7A 4GB9A 4R5TA 1WC7A 3GW3A 2YRZA 1XTMA 3L5XH 1QMUA 3IFPA 4TF4A 3WUZA 2CBUA 2BP8A 3S36L 4AQEA 1H62A 1HQRB 5CO1A 1LILA 3W11D 4IS6A 4M02A 4L3FA 1VFAB 1J79A 2G4GA 3GRGA 5AYTA 3QG6B 5G1YA 4PJFB 4J2PA 2IQAB 2UX6A 4N6QA 4FE9A 3PBVA 2J7HA 1TREA 3MAWA 2WC4A 5EOCL 1NIFA 3T8XA 4J28A 2X4SA 4LIQL 5K9DA 3UTSD 2LT9A 2CMRL 5D9NA 2CGRH 4X0KB 5IQMA 4GQBA 1LMKA 1KQZA 5I79A 5C0IA 5HYJB 1EP3A 4HUUA 2IEPA 3OKNA 2Y7LA 3ESUF 1FO0B 4MNHB 2YIHA 4MTMA 1IGCL 1KIUB 3ABSA 5FAGA 3GVGA 1OTUD 4F5CE 1KJVA 4NQ1A 1EDYA 1XRSA 2G3XA 1MQKL 3NTCH 4QO1B 1C7TA 4N42A 5A8MA 5IV2A 3GGWA 4TTGA 1BJMA 2HDJA 5JMUA 4TNFA 1H63A 4HG4K 1WFUA 3WXWL 1WQ5A 3PJTA 4XB8A 5EIIB 1R3SA 1WBYA 4XXDA 5E93A 4EK7A 3V52H 1TPEA 4DETA 3FZUD 4Z77B 1U2HA 5DEZA 2GSIB 2OTPA 3CYVA 4H6QA 4LARL 1UA6H 3GKZA 2BVOA 4Y2OA 4DZIA 4N2OA 3PAUA 1K8DA 3NRFA 3QEUB 3WIHL 4URTB 5DTFA 4G7VH 4FK9A 3TN6A 5KMYA 1FVDA 1SBSH 5IBXA 5KG9B 3TIDB 4I5BA 4AVKA 5K93A 3HPAA 3G2GA 1OINA 1FY6A 1Z9SA 3L2LA 4OLZH 3WIFB 5EBLB 4H26A 5CZXC 4ELME 5FUOH 2X4PA 3IK2A 4PBEA 3QFGA 4LY8A 1B0RB 4G8EA 3MBFA 4GG6B 3QUYC 3QS3A 1M2VA 4KNSA 5GSVB 4WEVX 4G8GB 2OXGA 1EX1A 2C3XA 4BGLA 2D2OA 1UB6A 3TQ0A 3NQ8A 4WU7B 3GHPA 1ME7A 4JTLA 4FHBD 3EYUL 3DXIA 4JFED 5DEFB 1N19A 4YFLF 3V5HA 3BQUA 4OIBA 1J7VR 3OJMB 3PP7A 4RW3A 1UKPA 2LW3A 4UU9A 3ZKMC 2WOYA 1XGTB 3WTSA 1NFAA 4D6CA 3SE8L 2NX3A 4HCDA 3S47A 1ZHAA 1NGWA 4AD5A 4MZ1A 5E8OB 3ZVHA 1S78C 3QCTH 1RJZB 2EIZB 3OZ9H 2YRPA 5ISZD 4RZ5A 5LGHH 2Y8VA 3N41B 1XBZA 4NYUA 3EOOA 3MROB 2YO3A 3L3KA 1A5CA 1ALDA 5L2KB 3VE9A 1VYPX 1R0AL 2WHVA 4PJHF 4CKVX 4K3ZA 4YXGA 4X6BB 1NCJA 3IMBA 3DIDA 4IBLT 3QBUA 1ZQ5A 3VI4E 2GG1A 5EZIH 2PDPA 4F0SA 4CL7A 1HKIA 4WI2A 2DQHH 1L9TA 3B9OA 5F96L 3ATZA 3KM8A 1OHQA 3GKWL 3QIWB 3VXRD 1PKOA 2LQRA 5D7IE 4M29A 1LP9B 2HPOA 3WUGA 1Z2KA 3VRJA 5GS1C 5EGRA 1EXUB 5F72S 4DAFA 2P5NA 4XAZA 2P7TB 2VR6A 1OAQL 4GJIA 3TQPA 3IJSA 4K68A 1WIOA 2QR0B 3N2OA 1P84J 2VAAA 3CO4A 3P0YL 3TCXA 1L9PA 1H3VA 1YDYA 2QPSA 3RVXC 3UYCA 4PJAF 4MNMA 2V8ZA 2AVGA 4Q89A 3Q7JA 4D8OA 1WIUA 1MHPL 2C3WA 4LLAA 3PWIA 5TBOA 4HDIB 2RALA 2XVBA 3JUZA 4IRSC 3G1FA 5HQEA 4OR1A 1LXMA 4JQXA 4NKDA 3ATYA 5GVJA 1F8IA 1IEAA 3FO0L 1QNRA 1TWIA 5CP7A 5AFDA 1MMFA 5A6SA 1YNTB 4WUKL 4KC3B 1U83A 1J5DA 4DBSA 4AYSA 1GGIL 3LN5B 2D4DA 1GXEA 4WDUA 2XKUA 2X41A 3PL6C 3QUZD 3V6FA 4K8GA 1U8LB 4FYTA 4RGOL 1R46A 3WLWC 1NY1A 3I6KB 1BVOA 2EAEA 5HGHA 2G3JA 4K3GA 4RGNE 5E5MB 1J0IA 1GKQA 1M57B 4D9QE 3EBVA 4JHBA 4W5ZA 4A7SA 3LZNA 1TTBA 3V0SA 3MZTA 5D5MA 4YHNB 3TO4A 3OAZK 4OZGA 5DHYB 1W3KA 1SDYA 2ZA2A 3VKCA 4XP1L 4HS6A 1K2DA 2N4IA 3MLZL 3V0VB 3SIZA 1KRMA 1UG6A 2WNGA 2GUBA 5DI8A 4HA3A 5GGQL 3PWPB 4LQFH 1CLVA 3TXVA 5DGRA 3ANVA 4AEFA 2O72A 1IRAY 2WQ8A 3V36A 2H3NB 1V6TA 5REQB 8FABA 3X12A 5K9JL 3V5CA 4Z76B 3P9LA 1OARL 1JGUL 5T91A 1HILB 3BAIA 3TEXA 1KR1A 3STGA 2XV2A 4XBEH 4ZMNA 5A6JA 2J12B 3WEMA 4O2EA 1MCLA 4AMAA 3W1PA 3S4SB 4F57H 3C8NA 4Z78A 5MEQA 3BE1L 4LOEA 4P5MB 4JRLA 3MTWA 3EOBB 2AVFA 2OPCA 1H5BA 3UBFA 2IPTH 3T2NL 3ARDC 2V6HA 5T1LA 3CHSA 5F3BA 5I6XC 4KZ0A 4EOUA 5F7YC 1VHNA 1OPOA 3IARA 2FWOA 5BO1H 4J27A 3OXSA 2H6OA 4ZPVA 2WQWA 1QLRB 2GJ6E 4P23B 5F7FA 3K1KC 4PJGE 4JUSA 4S3AA 4HIPA 1W9VA 3J7HA 1JGLH 3C2FA 1A7OL 1FYTB 2EEFA 4KJQC 1EHXA 4WO4C 2OPJA 4LUIA 3VM7A 5GRUH 1KJ2L 1IL1A 3L4WA 3RWCA 3S1UA 2FB4L 2VW6A 3Q4DA 3EO0B 3B9KD 4C91A 4ONOA 4X5XA 3CV7A 1XLLA 1XDLA 4X42A 2GK2A 5HYQA 3AGWA 1JUBA 1AG6A 3WN5B 2E28A 1GGBL 4HUKB 4OM1H 4JEQA 1KCSH 5IM7A 3K5SA 2QMJA 3FRPG 4EPEC 3CU7A 3M88A 4EIBA 5EU4A 3PBUA 2IWEA 2CGZA 4RMSA 2FZ8A 4IBQA 4HETA 5E4EC 3PB0A 4DI8A 4NRYB 5KN5A 3VD0A 4DN3H 4N4PA 5D05A 4TQ8A 3E5PA 4AD1A 1YNQA 4HEPG 4XBPA 3WNNA 4AFYA 1I8LA 5JHAA 4OJCA 2X40A 3ELFA 3GMRA 3AB0B 2ITCB 3G6DH 3FCPA