1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
molecule keywords alpha amylase
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
3TTOA 3KLKA 2J7EA 4AD1A 4OJYA 4EAMA 5LA0A 2ZXQA 3VOCA 2WSPA 2UY3A 1J0KA 2WVSA 1X6LA 3WQWA 4W8BA 2WMIB 4QLKA 3WNOA 1FP8A 4UFIA 1V3JA 3AHTA 1HNYA 4PCTA 5DF0A 1VEPA 2D0FA 1ZBCA 1E55A 1QHOA 1JNDA 1DWFM 4UNIA 4UOQA 1K9EA 3PZ9A 4Q7NA 1FH9A 1LJYA 2E9MA 3SCSA 1IV8A 3SCTA 2WMKA 3PBGA 2XUCA 4W86A 1GHRA 6A3HA 3M46A 3S6TA 3BUIA 3N9KA 2VVSA 4Q22A 4KGJA 1OCQA 2CETA 2BXYA 2OSXA 1H0GA 3WH5A 1B3XA 2V5CA 4PTXA 1BYBA 1ESWA 4Z2IA 1E6RA 3BCDA 1O6IA 4WIWA 1ZJAA 3QGVA 3O6AA 4M1RA 2BXZA 3ZOAA 1KGWA 1LL4A 3H53A 1MFUA 4P7RA 1B0IA 2Y8KA 3W28A 1LWHA 2JE8A 2XN0A 1ISVA 1TA3B 2UY4A 2VX7A 3QHMA 4UCFA 3WF2A 1MFVA 2IXUA 3WD4A 1H41A 1TQTA 1D2KA 4XZBA 1EHNA 3IJ8A 2JEQA 4OGZA 4H8UA 2UY5A 1XRVA 1SR0A 4CVUA 1UR8A 1GNXA 8A3HA 2NT1A 3AYRA 1WDSA 1JZ6A 1E40A 1E15A 5GQBA 3MMDA 3IGUA 1LF1A 3ARTA 2WHJA 3WEZA 2DPEA 2G4FA 2B31A 1J0IA 2FDMA 1ZL1A 4H2CA 3BAYA 4W88A 3WL1A 3AFBA 5A1AA 3SCPA 3B9AA 4AXNA 4CCDA 1W1YA 4OBRA 2VT0A 5I24A 3BLKA 1QW9A 1QW8A 2DDXA 3W4RA 4J3XA 3CTTA 1TG7A 2VL4A 1CXEA 2ZX9A 2BNJA 4HPHA 1I1WA 3ZSSA 3WF4A 1XSJA 4YHEA 3OLIA 4HZ8A 1W9DM 4CKQA 2ZUNA 2EPKX 2CXGA 4PYSA 2YFNA 2WBKA 3MO4A 1NOUA 1V3LA 4J3UA 3CHDA 2QPUA 4NZJA 1V08A 2ZICA 2PB1A 4YPJA 3IK2A 1SMDA 1AQHA 2X0HA 3AMKA 4H7VA 4J3SA 5JBDA 3SCVA 4Z2JA 1W3LA 3OLEA 4C7DA 1J01A 1KCKA 4AMXA 2E9LA 5EBAA 3W25A 1GJWA 1B2YA 2YDQA 1RP9A 6CGTA 1MW3A 1E0WA 1E0XA 2IXVA 5BWFA 4JFVA 1KR1A 1CENA 4J3TA 1JF6A 2ZXAA 1UA7A 1DHKA 4AISA 2A3HA 3W27A 3PN8A 3WFLA 4V2XA 2VR5A 2WHMA 1QNRA 3PZMA 4F66A 5E1QA 1PS3A 2O9TA 3NSMA 1MVYA 3BVTA 1UYQA 3S2CA 1H2JA 1KTBA 3GXMA 1KTCA 3WMCA 1KXQA 3ARYA 1G94A 1HP5A 4D1JA 1BFNA 2J7HA 2XIBA 7A3HA 3U7BA 4UQEA 1WDPA 1XGZA 3QOKA 2JF7A 2PI6A 3AIQA 1ITCA 3WNKA 1EH9A 3AXHA 1HL8A 4AZIA 3GBDA 1J10A 2VOTA 2F7RA 3WF0A 1J9YA 4A3YA 4DM1A 1BVNP 3WFZA 1E6SM 2GVYA 1Q6DA 2J47A 3NIYA 2DSZA 1B31A 3MV11 4TX6A 4BS0A 3L2MA 4QCFA 3QR3A 4PUDA 5CPTA 3CZKA 3U5UA 1JAEA 3N12A 5A6AA 1EGZA 4LYQA 5A6MA 3KE0A 3B9DA 1TFVA 4P8UA 3AS3A 5A8MA 4DUWA 3WUBA 3CPUA 3CZEA 1NARA 3GXDA 5DMYA 2PWHA 4L4PA 3VX1A 2WYSA 3CZSA 4UQDA 1S46A 4JL2A 3HG5A 3K8LA 1WPCA 2YL6A 3IANA 1FHLA 3L4YA 1UWIA 2EPLX 3QHNA 1SFSA 2WHLA 1EO7A 3HJEA 1J11A 4OOZA 3AIVA 5A8QA 5BXRA 1XC6A 2WSKA 3TV8A 4DUVA 2EBNA 4W7WA 3BMVA 2WANA 3A22A 1HKMA 1QX1A 1E70M 3N17A 4OUEA 1B3WA 2J7GA 1JAKA 1HKIA 3DHUA 3GZAA 3F5JA 1ISWA 1UASA 4ACZB 3T08A 4WF7A 1JYWA 1CECA 1EOMA 3WNLA 5AYIA 3A23A 3BSHA 3CBWA 1DTUA 1HJWA 4AIEA 2WMGA 4U5IA 2EJ1A 2VQTA 3GBEA 5CG0A 3A47A 1GW1A 4D72A 4ZE4A 3ZO9A 2WWDA 3NSNA 3KLLA 1HVXA 1F4HA 4FNSA 4WSKA 3VD3A 3PZGA 1B9ZA 3AMCA 2AMGA 1B90A 4LQ1A 1V3IA 5I0DA 1GOOA 1QNPA 1Z32X 4DO6A 2OYKA 1UKTA 3OIHA 2CBJA 3VD5A 1MYRA 2OSWA 4NXSA 1OINA 1R7OA 4TVCA 2PBOA 4Z2KA 3MUZ1 3FHQA 1JG9A 1XH2A 2F1BA 4JFTA 2W5FA 2XSAA 2FGZA 1G9HA 1NP0A 3I3BA 2VCBA 3LPOA 1CTNA 5LYRA 3G6LA 3WY4A 1WNOA 1CLVA 3GXPA 1IZKA 2DEPA 4RL3A 1VENA 1Q6CA 5HXMA 4AZGA 3VSTA 4ACYA 3D4ZA 4JKLA 1HKJA 2G3NA 4AD3A 4HTYA 4HOWA 1WB0A 5A95A 3AHZA 5IFPA 3SCUA 2E4TA 3GYCA 3DX4A 3ZR5A 2OW7A 1UKPA 4WSJA 1R34A 2F1AA 3RDKA 4A3HA 2DH3A 2WNWA 2DSKA 3OGVA 1PJ9A 3L2LA 1K6AA 1OGBA 2FGLA 3PZTA 3BLBA 3DX1A 2J78A 2JIWA 2GDUA 4P8VA 2C8NA 1CNVA 3GH7A 5E0FA 4H41A 2ZIDA 2QHAA 3BAIA 3PZUA 4MNJA 2WW5A 1HIZA 3VGBA 4MPKA 1N82A 4P7QA 5E70A 3CUJA 2XVLA 1JI1A 2W4XA 4PSPA 4UQBA 1QNQA 1LLOA 5A6SA 4JFSA 3WDQA 3AI0A 4FMVA 4JHOA 5HOSA 3VIOA 3L4ZA 4FLQA 4PMUA 1KBKA 1HWWA 1CXFA 4TOQA 2XFFA 1UR4A 2F8QA 1DWGM 1OGGA 4UR9A 3ZM8A 1WAWA 2FHFA 2J77A 3MI6A 2EPOA 1KQYA 3CUHA 1C3FA 3VMOA 4GZEA 1B1YA 2DT2A 1XYZA 3MS8A 3AS1A 1G0CA 3TA9A 1CGWA 1I75A 3EYPA 1H1NA 4MDPA 3EDDA 1JD9A 1JD7A 3OBAA 5HPOA 1XYFA 1EDTA 5C8BB 2BS9A 4CN6A 2WC7A 1MXDA 3D5HA 3D3AA 3HN3A 1JXJA 1TCMA 1V3MA 1W1VA 1LWJA 5CSYA 1HT6A 2W67A 2ZUMA 2ZE0A 1JNEA 3PTQA 2D1ZA 2W92A 2WBGA 3HG2A 2O9PA 2CHOA 4MAVA 4J27A 3PZNA 3OGRA 1KBBA 3VPLA 4B9ZA 4PUEA 3VDAA 2GFTA 2D0GA 4AD5A 1UQYA 3GNRA 1EIBA 2J7DA 2JEPA 3KWXA 2VX6A 3ZMRA 4X0VA 4CCEA 2W61A 3TOPA 2AAAA 3NYDA 1U2YA 1W3KA 3ZSTA 5JUVA 1IZJA 2ZUSA 3CUFA 3CO4A 2XVPA 3VNYA 3GDBA 1R8LA 1WO2A 1ISZA 2PF0A 2YBTA 2W91A 1E6QM 1UH2A 1VJZA 3O9NA 4AYSA 1NOFA 3KL3A 3CZ8A 1WZLA 2YLAA 3WNMA 4HZ6A 1HVQA 3K8MA 3WMSA 4CN4A 1TMQA 2XN1A 1GQIA 2PC8A 4QLJA 1UQZA 1XV8A 2BFGA 1KFWA 2GJXB 1DEDA 4FLRA 2PWEA 2DH2A 5D8ZA 3CZGA 1W1TA 2XVKA 3ARXA 1QI3A 2WVTA 3BUBA 5ABFA 3HU7A 3VIGA 4HZ7A 1ZJBA 1TZ7A 4JCLA 3RM8A 1NP2A 1GONA 1XSIA 1JGIA 1A3HA 4LGXA 1QWNA 1PIFA 1TVNA 1DWAM 2FHCA 1LL7A 3L4WA 4IPNB 3RILA 2VNCA 2JF6A 2RGMA 2A3AA 3W29A 4HMDA 3UG3A 1R47A 1EA9C 1ISXA 2J8GA 4UFMA 1QNSA 1V6XA 2OWXA 1CIUA 2BY0A 2JALA 4PMNA 1X6NA 1US2A 2UWFA 3ARSA 2GDVA 4AMCA 2FH8A 2OYMA 1UD8A 3NDZA 1HX0A 4FLSA 3UESA 3S5YA 1VIWA 1E0VA 2BHUA 2WC4A 1HJSA 1V6WA 2D2OA 7CGTA 5EB8A 3ZR6A 4HA3A 4WKAA 3VINA 1XCWA 1A47A 3BVWA 3SCWA 2YKKA 1QWUA 3A4XA 5HBFA 1E72M 1AVAA 1E6NA 3SCNA 4ZFMA 1EO5A 2ZUTA 1V6YA 4KWUA 1GUVA 2CESA 1V6VA 1DWIM 3VIJA 4U5KA 3UG5A 1Q6FA 5E0CA 3BUQA 5M03A 1PPIA 1ZBVA 4D6CA 3VDBA 3PTMA 2D22A 1SMAA 3WMBA 5KZ6A 4HOXA 3WBEA 2DIEA 3ALGA 3U5YA 2VRQA 2JIEA 1OM0A 1UKOA 3VKKA 1EDQA 1NWRA 2G3IA 2UY2A 4HA4A 1UD6A 4YN5A 3M07A 1M04A 4W7UA 4AD0A 1XSKA 4M82A 3VGDA 1GOQA 4X9YA 3AMGA 4DWSC 1R75A 3DX3A 1OBAA 1JIBA 3VMNA 4CVWA 3VSUA 2DT1A 4Y7EA 2J62A 4GI9A 1C8XA 3AMLA 6TAAA 3EJRA 1BG9A 3MSGA 3AHYA 3WQVA 1OT1A 4ML4A 1E6PA 1UZ4A 3MUY1 3THCA 1J12A 1VF8A 1E4LA 2VQUA 1V0LA 4P7LA 3PTKA 4D6GA 3VGGA 5FIPA 3WH8A 2VTFA 4GZJA 4D6HA 4Z2LA 1BF2A 5D9NA 3VIMA 2VI0A 3POHA 1QOXA 3EMCA 4DO4A 4W89A 3GXFA 1TVPA 2BVDA 3MSDA 2XM2A 1UG6A 4L4OA 3WD3A 4PTVA 1PX8A 4MADA 3WF1A 4AZCB 1ECEA 1UZ1A 2VZTA 5HPCA 3RPMA 3OZOA 3AZSA 2V5DA 2XIIA 2OW6A 1FFQA 2YA0A 1UKSA 4BQ3A 5BXPA 2WZIA 2W66A 4BQ2A 1JI2A 2CEQA 1VB9A 4V27A 1HXJA 1W3JA 5GNXA 2ZUVA 2CBVA 2D23A 3ARWA 3A24A 3WDIA 1ODZA 1UWSA 5A8PA 4AD4A 3FXYA 1C90A 4J28A 3ZT7A 2J79A 2FE0A 3L4VA 4BCEA 3LXCA 4FLOA 2ZOXA 2XFRA 1UKQA 2W62A 1WZAA 2VCCA 3BUDA 2E0PA 2CPUA 4P8WA 4KRUA 2X2YA 4PTWA 2Y2WA 5AC4A 2YJQA 4DO5A 4N42A 3ZJ7A 3CGTA 1B3ZA 4FNPA 3D52A 1B3YA 5GPRA 3GXIA 5CJ5A 3RM4A 4W5UA 1Y7VA 5I23A 4B3LA 4CD6A 4LYPA 2DQXA 4CU7A 3SUUA 3MUAA 2YL9A 1R7AA 1CLXA 1EDGA 1PZ2A 4JFUA 2DIJA 4UTFA 4CD4A 1OIFA 1JYVA 1OSEA 1JZ8A 3CZJA 2D3NA 1QI5A 1QHPA 2J74A 3J7HA 3EJQA 2DSWA 4UZSA 3GXNA 4JAWA 1V03A 3BH4A 1GJUA 1C91A 3KL5A 4PCSA 4J3VA 4E8DA 2WMJA 2XGBA 5IDIA 1BGAA 2EAEA 2EADA 2ZXDA 1CXLA 4HU8A 3A4WA 2XJ7A 3U7VA 2PBGA 2XTKA 5ABEA 1GVIA 1SYTA 1C7SA 2YA1A 1UHVA 3AIRA 3RCNA 2WKLA 3SCRA 4NSBA 1DWJM 1JXKA 5CSUA 3SURA 3GTNA 1HF6A 3T2OA 2EACA 4QCEA 3T0AA 1W9VA 3PZOA 3W37A 1C8YA 1JZ7A 3D50A 2V38A 3VIHA 1O7AA 2GK1B 2GJXA 3AOFA 3II1A 4J7RA 4UQCA 4GINA 2GUYA 4MJ4A 3DDFA 4PSRA 3WY1A 3LPGA 5A2BA 3ARRA 1BHGA 4FNQA 1UR9A 5I79A 2BHZA 2IGTA 4UQ9A 1GQKA 1CGXA 1JFHA 4U2ZA 4UFLA 1OD0A 2FYVA 4IUGA 2V3GA 2TAAA 1BLIA 1C93A 5A3HA 1UA3A 3FAWA 2CHNA 3LXAA 3RJYA 4TVUA 1V6UA 3CHCA 3B8SA 5DT7A 1QI0A 5I5RA 3BAKA 2C0HA 1RD6A 1VBUA 1JDAA 4OZOA 2J25A 2X8RA 1G01A 2Y8VA 3GXTA 2WVVB 3SUVA 1HL9A 4D6JA 3AIBA 1NWUA 3LRMA 4M8UA 1W2VA 4BQ5A 3WL0A 1RPKA 1KWKA 4QDMA 3MMWA 3MANA 1O7DC 4HOZA 1VFMA 3NCOA 3LX9A 3K4DA 1V02A 1PX3A 2EPNA 2VZSA 4KMQA 4W85A 4XV0A 2Y24A 1TQUA 1WE5A 1E4MM 3RM9A 2WCSA 4RE3A 1CEOA 2X2IA 1FHDA 2J7BA 2VZOA 1GOMA 3VGFA 2ZX7A 4H8VA 2CYGA 3T2PA 4UZUA 1GQJA 2ALWA 1UUQA 5CLTA 2CERA 1ZS2A 3AHVA 2CBIA 4W8AA 2DGAA 1E5NA 3CHEA 4AWEA 4IM4A 3CMGA 4CCCA 1LG2A 2YDRA 5A8OA 1WP6A 4QP0A 3RJXA 3W82A 2BHYA 1JZ3A 4B9YA 5IFTA 3VTRA 3IAPA 3ARVA 1VRXA 2VZVA 3VD7A 1W91A 5M3WA 1D3CA 2ZWYA 1NOWA 1CYGA 1P6WA 2V3DA 3LPFA 3SCOA 1TA3A 1BTCA 2XWEA 3VX0A 3IJ9A 3I3EA 1UD2A 1GOKA 1MWOA 3WKZA 5FCZA 4N0RA 1K9TA 3ZJ6A 4U2YA 4W93A 1ZBKA 4NXKA 4MJ2A 1D7FA 4ZE5A 1C92A 5E6ZA 3GNPA 4OBSA 3WNNA 3DX2A 4KH2A 2WPGA 2EQDA 4AMWA 1RP8A 4UOZA 2O92A 2WMIA 2VO5A 2HVMA 1GOIA 2A3EA 3OLDA 3W6MA 4EKJA 1H4PA 4JIEA 1KR0A 2WLZA 1JDCA 3EDEA 4U31A 1KQZA 3CUIA 4TTGA 1CXHA 2CITA 3KEHA 3W24A 5BROA 4JFWA 2E3ZA 4GXPA 4MNLA 2VJXA 3LRKA 1I1XA 3WUEA 3NUKA 1UWUA 1BYCA 3WQ5A 3W0KA 3EMZA 1G5AA 4PRWA 4PMVA 5JIPA 2D3LA 3VD4A 4W5ZA 1MQPA 5CXPA 1BAGA 3DYMA 1EHAA 4R27A 1R86A 1VFOA 1E5JA 4PN2A 1MXGA 3WD0A 1BGGA 4GQRA 3NSXA 4EANA 2VURA 1H09A 3WUGA 2VRKA 4W84A 2GJRA 3ZIZA 4MNMA 3ZQ9A 4F9DA 1FP9A 4M80A 4PEEA 1E4IA 2G3JA 2XFYA 3ARPA 1QPKA 4Z2HA 2WKGA 1Q6EA 4V28A 3OZPA 2G8ZA 4JCMA 3UR8A 1E9LA 3WBAA 1VFFA 2IUZA 3BMWA 1V0KA 2A3CA 4A4AA 3EJPA 1QI4A 1EQPA 1W9BM 3PZVA 5CQ1A 3T0BA 4ZENA 1E6XM 1YHTA 2EPMX 2WB5A 1M7XA 4AIOA 5BYWA 3UEQA 1BSIA 3BUPA 1WDQA 2HISA 2ZUWA 5DFAA 5D8WA 1AQ0A 1HN1A 3VSVA 1PZ3A 5A6JA 2X2HA 3APGA 1L8NA 1QVBA 2YLLA 3HG3A 2CNCA 2VZUA 4AEEA 3TTSA 4PTMA 4JHZA 4HP5A 3WH9A 3W26A 1C8QA 4GI6A 3AZRA 4WKFA 4D6FA 4YHGA 1KGUA 5DEZA 3VIIA 3WIJA 2NT0A 1EXPA 5A2CA 4HMCA 2J7FA 1K9FA 3GH5A 3L4UA 4OIFA 1MW2A 4AYGA 4D71A 1LG1A 4C7FA 2F7PA 3BAXA 3DYOA 4HPGA 3SUSA 5I77A 9CGTA 1U30A 1MQQA 2FH6A 4ATLA 1JZ2A 1CGTA 2F61A 1EOKA 3WEMA 4B15A 3ZJKA 4QLLA 5DT5A 4FF5A 4M29A 1V0NA 3LMYA 4TXEA 1R46A 3U57A 3EBVA 3CV5A 4UOJA 1GCYA 1XH0A 2ZXBA 3E1F1 1MW0A 1PBGA 1T0OA 3EJSA 5E6YA 5FL0A 2BV9A 3PZQA 5I78A 4ACZA 3WY2A 5GNZA 3AIUA 4QFUA 3VD9A 4TUFA 4ZEPA 5FKYA 3MV01 5IXEA 4GO9A 4PMYA 2CKSA 4AD2A 3MMUA 1XD1A 2XWDA 1M03A 1KXTA 5I2UA 4PBGA 2FHBA 3FN9A 1H0IA 3ARQA 2E8ZA 3KL0A 3EJUA 3VIKA 2XHYA 1UD3A 1E56A 3S5ZA 1KGXA 3AMDA 1UOKA 2WAGA 3ARUA 4PMXA 1FA2A 4LPCA 1JYXA 3AZTA 1J0JA 1HKKA 4WKHA 1TUXA 1R85A 3UERA 1US3A 5E09A 2D0HA 2VMFA 5A94A 1MW1A 5M5DA 4UQAA 3N15A 3UR7A 3T2QA 1GQLA 4GIAA 4MAZA 2DT3A 4IISA 2QMJA 4JKMA 1CGUA 4RE4A 4DM2A 3WSUA 3BSGA 3F4VA 2QLYA 1E71M 2V3FA 4W8LA 3N11A 1H49A 3ECQA 4GQQA 1DWHM 2QF8A 2WVVA 2D24A 1XH1A 1IT0A 1BYDA 3AISA 3MUIA 3HZ3A 4LYRA 1BPLB 3IAQA 1E73M 4ATDA 3ZT5A 2VX4A 4AZ6A 4X0NA 3VM5A 1CPUA 1NM9A 1E3ZA 2WHKA 3VNZA 4NF7A 4FNTA 4CD8A 1WKYA 1UH3A 2Y4SA 3GH4A 1UR2A 3SCQA 1V0MA 1GPFA 4E8CA 4H04A 3DX0A 2NSXA 2F7OA 5GNYA 1NH6A 1W3HA 2ZUUA 2X0YA 3F5KA 2YIHA 4HU0A 5BCAA 3DC0A 4HMEA 2JFEX 1FOBA 4AIUA 4IPLA 1MQRA 5TD4A 4PMQA 3VUPA 2XYLA 1JFXA 2EO7A 5F7UA 4M81A 1KXHA 5FL1A 5ECUA 4EE9A 3LRLA 3OLGA 1J0YA 1WDRA 4F9JA 1E3XA 1QBAA 1OIMA 2X09A 2WZHA 2WM0A 3VU2A 4AY1A 3RO8A 4OKDA 4M24A 1CWYA 4BA0A 3WD1A 4R5EA 5E9AA 2XVGA 3BAJA 2XN2A 1ISYA 2VR4A 3THDA 2RGLA 3TONA 3H54A 3LPPA 3O2LA 1OB0A 1Q4NX 2BY3A 1KCLA 2XG9A 3RMEA 5FOOA 3F5LA 2WVUA 2YL5A 2BVYA 2VX5A 1ZU8A 2WCAA 2E40A 3WELA 1DP0A 2WMHA 4TTUA 1TQSA 5A6LA 3WH6A 4AZHA 2XGIA 4XZWA 3SIMA 3FNDA 4PMDA 2Y5EA 3B9EA 2Z1KA 5CPSA 3AIEA 2YOCA 2O9OA 3TP4A 4EK7A 3CLWA 3TTYA 4BQ4A 2BY1A 3SEPA 5IHSA 4MDOA 2Q8XA 2AOSA 3SUTA 3PHAA 2OWWA 2OYLA 1R33A 3ALFA 1TQWA 3DYPA 3AROA 3N04A 4GI8A 4JZ5A 4OOUA 4U3CA 4Z2GA 2CKRA 3W6LA 1JYNA 4MTVA 1V02E 3BGAA 3NDYA 3CH9A 3K8KA 1JZ5A 2WMFA 2XPKA 3WQ6A 1QI2A 5A8NA 3DECA 3H55A 3WUFA 1GOWA 2ZX5A 5I6SA 2VRJA 1RH9A 1LL6A 3CUGA 1CBGA 1UR0A 1TR1A 2OLHA 4NZFA 1X1NA 4FNRA 3K4AA 5AYBA 3OGSA 1GVYA 1UWTA 1U33A 5BRPA 2J75A 1E43A 5EFDA 1W32A 3WQ8A 4NI3A 1NWSA 1PX4A 4F8XA 4U3AA 5A6BD 1E1EA 3AQUA 2A3BA 4AC1X 4CD5A 1XCXA 4NZCA 3WEOA 5D9MA 3ZJ8A 4UFJA 3WDPP 2Z1SA 1H3GA 4MNKA 1VAHA 4ZXLA 1UD4A 4C7GA 3AXXA 5AC5A 2WLYA 3W38A 1VJSA 3UCQA 2WK2A 5M17A 1W9UA 2X1IA 3BCFA 1TE1A 1M53A 1QNOA 4MB1A 4QAWA 1FH8A 1C7TA 5IHRA 1W2PA 4D6IA 2ZWZA 1CDGA 1AQMA 4WJXA 1PAMA 2F7QA 5AY7A 7TAAA 1F4AA 4GPNA 4JKKA 3ARZA 5I3DA 1UWRA 3T0DA 3L4XA 4BF7A 1BG4A 3VILA 5JBEA 3VGEA 1B3VA 1J0HA 3HMCA 1J18A 5HNNA 2PWGA 5ABFB 1Q6GA 2G41A 3WDRA 4E2OA 4P7OA 1FH7A 1L0PA 3VVGA 2XM1A 4NRRA 4ATWA 1UWQA 5ABHA 3N13A 3MKKA 2X05A 1G1YA 1BYAA 2GJPA 3IJ7A 4TVDA 4CN1A 4K68A 3I3DA 4KRTA 3WY3A 4AW7A 5CGTA 3WN6A 1PEZA 2EABA 1B30A 3EDJA 4CU8A 4RE2A 3AS2A 4D1IA 4AZCA 2D73A 3CC1A 3GM8A 1HP4A 3A3HA 3TTQA 1KXVA 2EEXA 5CGMA 1VEOA 3UETA 1CXIA 3W53A 1KWGA 4D6DA 2ZX8A 1UH4A 3CHFA 4CUCA 1UD5A 3RIKA 3W81A 4UFKA 4M56A 2CBUA 1GHSA 1E1FA 3HG4A 1HJQA 2BVTA 3LXBA 3DDGA 3WF3A 2VCAA 3PZIA 4S3JA 4TX8A 3ZT6A 5CZKA 3EMQA 3BXWA 2X2JA 1HTYA 5HDRA 1OT2A 1XHGA 1BVZA 1GZJA 3BVXA 3WD2A 2YL8A 3VM7A 3D4YA 2F2HA 1EQCA 2DSUA 4P7NA 3WNPA 3VDHA 3QHOA 4LXFA 3CIVA 5EFFA 2ZX6A 1ZB5A 4B16A 2YA2A 4FK9A 5A69A 2WCGA 3BLPX 5A2AA 4B3KA 4FNUA 3VO0A 3OA5A 2VC9A 3AYSA 3EDKA 5LA2A 5BRQA 2XVNA 1HXKA 3G6MA 1GORA 1WZKA 3SUWA 3K46A 4MB5A 4U33A 4W7VA 2QV4A 1OWQA 4KGLA 4W87A 2VUYA 2V3EA 3VGHA 3CZNA 3BC9A 1HJUA 1H11A 2OWCA 4URIA 4GO8A 4AEFA 4S3KA 3L4TA 2CCRA 3OG2A 3CZLA 3FW6A 5CLWA 1CZ1A 1UR1A 5LA1A 3AS0A 4MB3A 1KB3A 1V3KA 1ZBWA 5C70A 2YFOA 2GSJA 3VDCA 1ITXA 1E6ZA 1JZ4A 3BVVA 3POCA 4DWSB 5D9OA 1OGSA 3FHAA 3A5VA 3EDFA 3VMPA 2GK1A 2YDSA 1VBRA 2NW0A 2E9BA 1YQ2A 5BXTA 3M7SA 1JDDA 1CGVA 1OD8A 3D51A 2VVNA 3VIFA 1TQVA 1W9XA 1BQCA 1XD0A 4XX6A 2WXDM 2J8FA 2MANA 3NJ3A 5D4YA 3MU7A 2QMKA 2BY2A 4D6EA 3N18A 1H5VA 1NQ6A 3OB8A 1K9DA 3AJ7A 4HA1A 3A4AA 4WLCA 1HJVA 2PWDA 3FAXA 3GNOA 5JIWA 4MB4A 4CD7A 3UG4A 2WC3A 5CPQA 4NX0A 5BXSA 4H8HA 3FY1A 5KEZA 2G3MA 4WK9A 5DO8A 2EXOA 1JL8A 3WENA 2F18A 2CIPA 4DUXA 2YBUA 2O9RA 2W63A 2QPSA 4ZXOA 3AHXA 3WDJA 2WZEA 3AIWA 4UFHA 3AXIA 5FD0A 4XUYA 1R87A 3AICA 4XB3A 2J4GA 1ODUA 4GZIA 1CXKA 3JUGA 2OSYA 3BVUA 2DT0A 4AZBA 3M6DA 4CU6A 1WZMA 4BZYA 1E4NA 1QBBA 1VEMA 4AZ5A 2ESCA 4NRSA 4PMOA 1W1PA 1SZNA 4JL1A 2C7FA 1VFUA 3T09A 3A6OA 4DWSD 3WQ4A 5ABGA 3BAWA 1AMYA 3A21A 8CGTA 3KZSA 4DWSA 3K1DA 1J0ZA 2DSVA 1V3HA 1NWTA 2WWCA 1M01A 5D9PA 3N1AA 2XSBA 3VIPA 5JBFA 5A6KA 2D20A 1PIGA 4GKLA 5EMYA 4F79A 1LQ0A 4P8XA 3DHPA 2PWFA 3CMJA 4PMZA 4PMRA 3EJTA 1JF5A 2E8YA 4CGTA 4LX4A 3WH7A 4E4PA 1QHZA 3QOMA 1W9PA 1WCGA 2J7CA 3WDHA 1FFRA 4J3WA 1HJXA 4AZ7A 5C71A 1CGYA 5A6BA
chains in the Genus database with same CATH superfamily
1IAKB 1LDPH 2C3VB 3PFQA 1W72L 2J1KA 1FX6A 3KLKA 2R1LA 3GY1A 3GZPA 4N1CA 1OFPA 3VOCA 4FL4C 2XBTA 2UY3A 1IEQA 5AVYB 1SW7A 1J0KA 4N1HB 4JLRA 2WLHA 5EIIG 4G11A 5DCCA 4U1HB 5DZAA 2WMIB 2K7QA 1SVBA 3NQ8A 4U3SB 1ZGLB 5DK3A 4K73A 4X4YA 2AGTA 5D7LE 3NZGA 4H6RA 4Q6XA 3VVVA 2C91A 5DJ2A 2F53B 4DVRL 4HEPA 5DVMA 2OODA 4IGSA 4JYDA 3V0SA 4J8RA 2NW2A 1AE6L 3M41A 3VXMD 1CYXA 4HUVA 4IMKA 3LCWA 3H4XA 2EC9T 3EGSA 3B3BA 1ZT7B 4U7SA 3MHZA 1JNDA 4B2DD 4C6CA 3PZ9A 3UEZA 1S2AA 4F9PA 5HGBB 3GDMA 4O17A 4NC1C 1CGSL 2HB0A 2DQCL 3SCTA 2WMKA 3PBGA 3SECA 3D08A 3FYOA 5KW9H 5CG7A 3B7YA 4NERA 1ALDA 5HHOB 1O60A 4XO3A 2ZXWB 3RIAF 1B0GA 3M46A 3S6TA 3BUIA 3MLYL 4G1MB 4ZW7A 5IQ9B 3M16A 2VEGA 4X9FA 1OO2A 1IGCH 3OM3B 2VL5A 4PG2A 3MI2A 2HUHA 4LUSB 3RU8H 1JBJA 2GC4C 5BRZA 5I3JA 3ILEA 4UYQA 4OZGF 5ICUA 4HGWB 1RUSA 4OLWL 1L6PA 2DI7A 4ICMA 2ZP9A 1B3XA 3ILPA 4N0CD 4O2FA 1MPAH 1O7SA 4AG0A 2C1PB 1MRQA 4XD6A 3BIBX 4M93B 2IBGA 2HG5A 3NSDA 4N2IA 4TNVF 3UABA 1BYBA 1I7UA 3FJTA 5E2VL 3C0QA 2FVNA 1KXQE 4EI0A 1ZJAA 3ESPA 3I6LE 3NP4A 3P3YA 1EBHA 3CVCA 3O6AA 2QKIC 4J2QA 1F3XA 2V5YA 4FMFA 1SUHA 4XMPL 4P2RA 1GWJA 2GY5A 4L3EB 2QELA 3H53A 2P48B 1AODA 1MFUA 4L23A 4RMVA 1YYMH 3N1MC 2IPWA 2YBGA 5MP6H 1B0IA 5D55A 4OZIF 3W28A 1P5UA 1W72A 3HNTL 4LGRB 3N4AA 5IHLB 5JZ7C 1OFEA 2WZTA 3IF1A 4AYDC 1SVZA 4KESA 4YHOH 4KWOA 4WDTA 2XN0A 3KPSD 1ISVA 3UC2A 1K72A 3NGFA 1G0YR 2UY4A 4S10A 2VX7A 3RNQA 2G37A 4ZW3A 2L04A 5J1SC 3OVQA 2YGQA 3TWCH 4FABH 3WF2A 3G9VA 1DDTA 1A3RL 3F58L 1S7QB 3TBYB 2R82A 2JWYA 1BGXH 3L81A 4XZBA 3IJ8A 2W0KA 1BWMA 1KG0B 2HFGH 2YGVA 5IHZA 2JEQA 3BZ5A 2IPTL 4Q89A 3S4SA 5EOCJ 1TPXC 1LVEA 5KW9L 4LO9A 4FQLL 5GSRB 4LUTA 3DXAE 1JQXA 5DWUH 3GSUB 4DWHA 1UR8A 3UPMA 1FFOB 1GNXA 3QZEA 4IOIB 1FAIH 1KTLB 4D3CH 3AYRA 2J6EL 1JZ6A 1FGNL 4FYRA 5C0AD 3WK1A 1Q6RA 1DBJL 3L3OC 4QT5A 5GQBA 4WHYG 3M0YA 4YN3A 4MD0B 3SGKC 1M7DA 3IGUA 2Z7GA 1WIUA 5AW0B 3ARTA 3C2YA 1ZA3A 3IPBA 3NCMA 3LV3B 4D8AA 1QLFA 3B37A 5C9UA 3UA4A 2NY1C 3WLKX 2B77A 4XPGH 5J13B 2B31A 2G4FA 2FDMA 2WO5A 5HYSG 4PTDA 3ITYA 3I74A 1J7VR 5AAWA 2NLIA 3C6CA 3CWHA 1W1YA 4WGXA 5JUEL 2GJLA 3BLKA 1ICPA 3LY6A 5EEZA 1RI8A 1ML1A 2YUXA 1QSEB 1HHJA 1ADQL 1K02A 3RK8A 4GQ9H 4J3XA 3BP7A 4PJ5E 1GYMA 6REQB 2FJHB 2HJKA 1VFBB 5B1AB 3T4YB 3ZK0A 4EP8C 3S88H 5D7HA 1K8YA 2NWRA 2OLAA 4HPHA 1NMAH 2XV2A 4UT6H 5FF2A 3WF4A 1XSJA 1S9WA 2M26A 5HYJA 1J87A 4HZ8A 1AC0A 4CKQA 1OE3A 5E4IA 1UM6H 2DVTA 1PSCA 2EPKX 2CXGA 5IQ9A 3CE1A 5FGSA 1HEZB 2P47B 1JCYA 4WJ5A 2DZAA 3NWRA 5CC6A 5EIQA 2Z93B 1KIQA 4ECNA 5H37G 3TH6A 3VZZA 1SXBA 1PKQA 4J3UA 1UZHA 5AD0B 4G80A 5IMOB 1CICA 4CVZB 3NA9L 1ZLUH 2ED7A 4Y4HB 5ANMA 3SGKA 2WXKA 3MLTB 5CWSA 1J6PA 5EA0H 4H44C 4X98A 4WK0B 2AKZA 4I18A 1S2UA 2P8LB 2VM8A 4MG4A 1DN0B 3MJ9L 4MMYB 4FMKA 4YFLF 1JF1B 1F97A 2BHFA 3TPUB 4EI6A 4Q97A 5I76B 1GGOA 4C7DA 5C0EB 2PDNA 3D39B 3FXIC 2E9LA 1JZFA 4NC1E 5DD0H 3WFHA 5AHFA 1TIMA 4R88A 1E6JL 2BNQB 4JAMA 3OHXC 4RJEA 2FATL 3W76A 1ONXA 4FTVA 4N9EA 2FFIA 1MW3A 2G4EA 4X5PA 1CUOA 4E9XA 1E0WA 2WNZA 5A2LH 4A2LA 5I8KH 1OK8A 3ULVL 3G5ZB 3RWHA 1LD9B 3N25A 3QV7A 1A8JH 4PI0A 5F8RC 4DGUA 3XINA 2P80D 3OAUH 4L1TA 3U25A 2JJSC 1CENA 5KYYA 4KROD 2HTLD 3C6EA 4OZGB 1IGTB 4P5MB 1K8DB 4HULB 1C5CH 1HI6B 1AZVA 2EDFA 4ZQOA 1DQLL 4Y4HA 5ANMB 5IMMB 3GG0A 3PN8A 2Z00A 1DE6A 4CC4C 3RNQB 3S5LG 1YMYA 2PF6A 3WAKA 2I7GA 3MXWH 4XNMA 3H9YA 1WA1X 3MUUA 4PS4H 3SOBH 2YPKB 4GGHA 2V6HA 3MRCB 4ANUA 3O0KA 1JE6A 1MVYA 4FYQA 4GRWF 4QHUB 1EMTL 4ROQA 3GXMA 3LJ3A 3WMCA 2P43B 5IJBC 4O9HL 1HP5A 1PDYA 2A74C 5FDWA 4A7GA 3WFCL 2YARA 1I85C 5BVJB 3T8QA 5I1LA 4US5A 4EUPG 4M61B 1T7ZA 4FN0A 5ES4B 1OP4A 5FEBA 3B6SB 3BVNA 5ACZA 3MVTA 4LVAA 3LMZA 5H2BB 3BGFB 3GC3A 4OUUA 2PI6A 3PS6A 1S7XA 1YYCA 4OCXL 4TV3A 5D9SB 3WNKA 3AIQA 5XINA 4DPBX 3GC4A 4PJBF 3U7YH 2B8OT 1BOGA 5JDJA 1HL8A 4S2SB 1P4IH 3GHUA 3TYUA 3PREA 3QIBA 1J10A 2NY6C 5IB2A 1DLHB 1JZGA 3HS0C 4FZEH 5BMFH 3NQEA 3WFZA 3AITA 2R23A 1E6SM 1D5BB 3QPQD 2FJGB 4GUGA 4TQ8A 1Z44A 2L8AA 4PL2A 1X7SA 4WQ6A 1JK8A 4NO3B 5FA3A 2F6KA 1VLWA 1WFIA 2HE5A 5IFJB 1LDSA 4NFDA 1A1MB 3DDMA 4PJAF 3VFOA 2QT3A 3QYQA 4L7ZA 3E6HB 1PG7W 4XCEB 4BHUA 3OAUL 1MLCA 1B31A 3MY9A 7TIMA 1AGEA 5INCB 3F4NA 4QCFA 5JU6A 3BQUA 4E41B 3U9UA 4PUDA 4Y16A 4AOFA 5I8KL 1N0LB 3CZKA 3BISA 3Q9PA 3BSZL 5MHSE 1EGZA 4LS2A 3QZWA 3S35H 2A9BA 1M41A 4GKZB 4FQIH 1DUZB 3IKKA 4EE2A 3Q06A 3MR9A 3VC5A 4DKFL 4HHLA 2ERJC 5ABAA 3ZQXA 2YRBA 4JG5A 5IB5A 5E5RB 2GYIA 3Q6FA 4HU2A 4RGMC 4BELD 2DZVA 3NFUA 4IXHA 4KZDH 2YYUA 2COQA 4J3BA 2VEKA 4KW2A 4J8RB 3JQOB 4RIRB 1IGSA 4KRPC 3GXDA 5I73C 4NKIH 4RNRB 3ZRFC 4ELDA 3VFOB 2PWHA 2G9HB 3NAVA 2D3JA 3FB7B 4S0HA 2ABBA 2HE8A 5E1HB 1S46A 5ICXB 4UIKL 5DS8A 3U36B 1TG8A 4JL2A 5G5DA 1ORSB 4URTB 4XNYL 1MCQA 3HG5A 4XCFH 1ETZB 1BRLA 1SJEB 2PPEA 3HPSA 5IKCB 1P69B 3PF3A 5D2YA 3QEQD 1SOQA 3FZUD 1ASOA 1PTDA 3PUDA 1CLOL 5FGCB 4FFWD 3VABA 2V67A 2M1KA 4R33A 5CC3A 5HHOA 1U41A 3F83A 4R6UA 1LE5B 1OZUA 3CWGA 1U5JA 3CIXA 3QKZA 1OCWH 1SFSA 4LUJA 3WQFA 4MY8A 1IBDA 4N4QA 2MHAB 1ETJA 1XGYH 4HN8A 1XDLA 2WLNA 4OWGA 5EBGA 5GXBB 1MN4A 4Q52A 5D1QB 5I6NA 7PAZA 4XN5A 3KJ4C 1VP5A 4OOZA 3AIVA 3Q44A 4RZBA 3NEXA 4FFZA 1KSRA 1CFTA 1HU8A 3ILPB 3KPPA 4O2FB 5D96C 1FL6B 4LLDA 5LNEA 3FA3A 4E9YA 2LV4A 1C08A 2XRAH 2CLHA 3WK2A 2WB1A 1VBJA 4HZ1A 2FQDA 1O5PA 5C2BL 3KZ8A 5FW8A 4HS3A 1LOLA 2WANA 4I48A 5EEXA 1QX1A 3W1UA 5KZEA 5ITFB 2ZVIA 3EJZC 4HGKC 4JG0H 2EXWD 3FT3B 1B3WA 1JAKA 1ZRQA 4LCRA 2DPKA 4OCLC 4KVNL 3ZFHA 1HSBB 1LEGB 4FXLA 3V9CA 5HPMB 1FG9C 3F5JA 1ZT4B 1UASA 3IFLL 2VJ0A 1Q94B 4JDZA 2EYSB 1BPVA 1OAUL 4UXDA 1FSKC 1T03L 3VDGA 3NG5A 1EOMA 3C2SA 3CFIC 4DJMA 1S3KL 1PTGA 5AYIA 1ROWA 1X7IA 1I7ZA 2OU4A 1I7RB 5T5FL 1GC1L 2Q86A 1G7MA 3O11A 3IDNA 4IRSA 4C6IA 3MO1B 4E4UA 1DTUA 3E8UL 2C4XA 2PDJA 4ZTPL 3KCLA 1AW5A 2BP8A 5JQ6L 4GYPA 4U5IA 2ZXEB 3M5VA 2VQTA 5EBWA 5LNRA 3C8HA 1EEYA 4RGNB 5F1KC 5EN2A 1GW1A 3B4UA 3C0LA 5HYQA 3IKCA 2XTSA 3RWJB 3ZO9A 3PPGA 2VDKL 4YVNA 3NSNA 4JM4L 3SQBA 3W11C 3P2VA 4FNSA 3TH4T 4O19A 4H7CA 3IACA 3VD3A 5KBDA 3GMLB 4DQOL 4PGBB 5DQJA 3Q43A 3EG9B 4W9EC 2GVGA 3FA4A 3NVTA 3PZGA 4LOCA 5C86A 5GRWA 5J12B 5AZ0A 1N0XL 3G04B 2I5YL 4B3ZA 2GY7B 2F6XA 2N59A 4DO6A 4M6PA 1DL7L 1SDAB 2FX8H 3PP4L 3HCVA 5LXGH 5K9CA 3JWNE 1F73A 5DURD 4U1IA 5D1XA 3OIHA 4PJAE 4YMPA 5D09A 1KB5H 5DMMA 4X5XB 4ZDHB 4C4UA 3ABLB 4QNPF 1E9PB 1JEZA 4V11A 4H40A 2CBQA 1L5GA 3F6LA 3M7OA 3MROA 3SDXA 1BMWA 2WUCL 4Z2KA 1RK6A 1EPVA 5D2XA 4PY8I 4PCPA 5CR8A 2BC4A 3K7UA 3O3RA 3TYFA 3PL6C 2BIIA 2XSAA 4ZQMA 1F6FB 3X1FA 3QP3A 2HMCA 5C7HA 2C4FT 4P3DA 4HWBA 3GU9A 5HR7A 3LPOA 3EFFA 2IKHA 4XXDB 1HINL 4WVRA 5LYRA 2PCEA 3NACH 5D2LF 1MCFA 4Q14A 3WY4A 4YHZH 1V27A 3KWWA 1I3VA 2A77H 2A9AA 5E8NB 1KKOA 3LSOB 3KS0H 1Y5XA 2IPJA 5EV7A 3F7QA 5KSBA 4Z7QB 5DJ8A 3UNTA 4PJCE 1TCDA 3CT7A 3SZ8A 1BQGA 2VDPB 4HOWA 2XI9A 4PU2A 3EFDL 5IFPA 3HLAA 4O51A 4UMAA 4FYSA 2CRIA 3DX4A 2ZCKH 3KH3A 4L0ZA 5DJCB 2OW7A 1MZHA 3O6KL 1UKPA 3CCHA 4DVRH 5G1MA 7REQB 1H9VA 1YN7B 4P3DB 2OEJA 2QVMA 4MMYA 4WZ9A 4YE0A 3UIYA 1OAZL 4OVVA 3BJFA 1X7QA 5IM7A 4K23H 3EYQD 3L13A 5FO9A 4O58L 4A3HA 3UJIH 3W1TA 3BE7A 2O5NA 2X42A 3NCBB 3LSOA 4TQPA 3KBMA 1S7TB 1PYMA 1A6TB 3E0WA 2AABH 1B4TA 4S3GA 1AXIB 2OQLA 2WSDA 1MVFA 2VMDA 2PR9A 4LSRH 4EWND 3W72A 5J5DA 3K71B 5A40E 1RUPL 3GVRA 2HLFD 4G5ZH 3OC8A 1LROA 2F7FA 5JIDA 3QRHA 1S7SA 3HG1D 3PZUA 4QTIH 1P4CA 3EZ8A 5CPOA 3WQCA 1F4XL 4FG6C 3OKEB 4XUGA 3S48A 5C9JB 2R29L 4P7QA 2W65B 3S37H 1XYBA 3CUJA 4N85A 4NWTL 1DSFL 2B2XL 1D5IH 2X4PB 2YEQA 4Z7OB 1MEHA 3PANA 4NJKA 1T80A 2HWZL 5E0KA 2D2HA 4HKXA 5FJUA 3GSXB 1QNQA 2GTZB 4MGGA 3OVPA 3ALPA 3W3BA 3WQPA 3N41F 4JFSA 2G3FA 3WDQA 2FEDC 3H3PL 1GMEA 3MPCA 4FMVA 3TNMB 3MRNB 1KJVB 2JTDA 4JHOA 5AAMA 3ATEA 3ESMA 3W22A 5FGCE 3RLVA 5TQ2H 1JPTL 3G04A 4IG2A 5HOSA 1PDKA 3DTDA 1A3LL 1P5UB 2IWKA 2Y36L 4G9FE 3WTVA 1AL8A 3LCIA 4PMUA 1YNLL 3IBEA 4LDCA 2HZGA 5I3FA 1A7NH 5CUSL 4Y88A 1NGWA 4ZS6D 1MJ8H 5IBUB 3UPRB 1MDLA 4PJCA 4MDJB 5FKPB 2XH7A 3KBVA 3TN6A 4C6LA 3FIGA 1T0PB 4HLZG 4UB0L 4OFQA 4Q0XH 5AZ1A 2C1HA 4BDVA 2Y85A 2ZPKL 4GRMA 4ZK8A 1X8FA 4ORIA 2JKSA 2CU9A 1YBQB 5CN1A 3MI6A 4JLRB 3UIZA 1KQYA 1KCSH 1B1YA 3TEYA 1CR9L 1NMBL 4MYWB 2Y25A 2GJ6B 4LKCA 3FUNA 1XYZA 5DCBA 5J56B 1G0CA 3DBXA 4NQDE 1FGVH 4K1GA 3FCPA 4P9HC 2XCMC 1W72H 3Q0HA 1JULA 4MXVE 1AD0B 2WZPA 4E41A 2BOGX 2JIXA 1YTDA 1EUTA 1YEEL 5DRZA 1QTPA 1IARB 3OBAA 3CFBB 2ANUA 1S1RA 5HPOA 4GW4A 5BQ7A 1XYFA 3TTQA 4OQVA 4RPPA 2J2ZA 3O4LD 1BIIB 4I1NB 3ZJAA 4D9RD 5CN3A 2BS9A 5IY5B 4CN6A 1JK9B 1WAPA 3J8F7 4A6YB 3C2EA 4B7LA 3CG8A 1JWUB 4DB7A 5D7IA 2PEVA 4JO3L 3D5HA 2R94A 4XO7A 3D1MC 5I19H 3L5WB 3SRDA 1V3MA 1Q72H 1LWJA 1HT6A 5EPMB 2EKSB 1MREH 3LN4B 4PJIE 2XWJB 2HRLA 2ZOKB 5K3VA 3L7FB 2FT8A 4BH8A 1JNEA 2HT2D 5HANA 1H5BB 3AFBA 3S9YA 5LIKX 1CK0H 1E9IA 3H2CA 5DS8B 4GH3A 1TJPA 1A3WA 1A4MA 5HHNA 2B9AA 2GQ3A 4Y1AE 1TPB1 4NN7C 4PJEF 3DOHA 1R0MA 4K37A 1AG0A 2XIJA 4JJ5B 3PZNA 2RQ8A 4MS8D 3UTTB 4D94A 2Y07H 4TR9A 4ADTA 2DQUL 3V0JA 4TUOA 5CINH 4L1DA 5HGAA 1XS2A 3KBSA 2R1PA 2H9GB 1KN4H 4AD5A 1QFUL 4QKTA 2HX8A 4YHYC 5LIWX 2ID5A 2IDQA 3DFPA 4X80L 2XKNB 3PQYD 1XR8A 1FORH 3EYSH 5D1QA 1W1IE 2A4AA 4CCEA 3O6DA 5B7YA 2GTQA 5FA5A 3ZE2E 2AAAA 3R8BB 1N67A 1CFNA 5BWAA 1SXCA 5FGRA 3RGVD 1TWDA 1QRNB 5KVDE 1OP9A 1IZJA 3FU3A 3SPVB 1E5CA 4MKSA 5C9ZA 1CICD 3OKKA 3CH1A 2QEJA 5HI4D 4JJ5A 3CO4A 2CE6A 2WBJA 3ZDXF 4H01A 4FXJA 2HKHL 1FJ1B 4QE4A 1E4JA 5B39B 1TZAA 3IDYB 1AI1L 3PNWB 5J3HD 1ISZA 2PUZA 3US0A 3B2VL 4PJ8B 4QLRA 2YBTA 4KKCC 1MREL 3RL1B 1UZGA 4R2GB 3UL4A 5F6HI 4ZMNA 1HZYA 3BLFA 4G6KH 1FVEA 5T3XL 1NGYA 2AXJA 1DDHB 4WUUD 4E2VA 4H20L 5DEFB 1E6QM 1XLJA 5FOBA 4V1DA 4Z7UA 1VIZA 3O6FC 4YEFA 4LAZA 4TIMA 3GS6A 4Q8VA 4K7FA 4X5RA 3NFPA 1B54A 3PJSA 3EH1A 3FF7A 4FFVC 4NQDD 3F7KA 4FXTA 4UT7H 2ENPA 5EBWB 1BOYA 2EDBA 3MLUH 4RSVA 1H7NA 3BP6B 4MJIB 3O9NA 1EJSC 4XAWL 4M7KL 3MRDB 3NDOA 4JN7A 4X22A 3BZFA 2VDKB 4FZ8H 4RH4A 3XIMA 1RHFA 1LEKA 3NQDA 4LY8A 1WZLA 3U4EA 1A5KC 4PUKA 4N2OA 2KLSA 2R0ZH 4I88A 3KBHE 4HZ6A 5GGSB 3SY1A 4XP6H 4CN4A 1T1XA 1TMQA 2G9KA 1AOHA 5GGRB 2XN1A 1GQIA 2PC8A 3L6FB 2VUOA 4RR4A 3MDJA 2P0OA 1NMCC 4HLEA 1ULVA 1D9KA 2BFGA 4UM8B 5JHDD 1ZAGA 1L6WA 2Q3RA 3GNDA 4H19A 4NUJB 1VFSA 4H0IA 2ABAA 4Y96A 4WCJA 1DJIA 4LCWB 4A1RA 4ADIA 5JPNA 5MENB 3EOSA 3NQBA 4KY1H 4XP1L 2ZTKA 2QQQA 1JFQH 2XVKA 3MRKB 2PD5A 1QI3A 1GH7A 3TZVD 2OT1A 3YPIA 3LKOB 4D8OA 3DGBA 3GW3A 3PXJA 3BSMA 1A7NL 2DQTH 4HJJH 5I8EA 3J27A 5C9WA 3B40A 4FEZA 2NZ1A 3CZFA 1CJYA 3CXHJ 1XXDC 4O4YH 1MEXL 3ARBA 4KQ0A 1CO1A 1EJ6A 2X70A 3S97C 3AWOA 4X9SA 2J6WA 3B8UA 1CK0L 2ENSA 4KK8D 1A6AA 2R27A 1A3QA 2A6JB 1GONA 1NP2A 2CZVA 5CEZE 4PMOA 2NW2B 1XSIA 5HI4C 1Q8JA 3O3UN 3MNDA 4JGMA 1PYWA 2J5WA 1QVOA 2RFXA 3I6LD 2DRUA 5C7XL 1QWNA 3IEAA 1PIFA 4DP9X 1TVNA 2W0UA 4TKWA 4PGEA 4QUOA 3KBJA 2L4OA 1ADDA 4RBPK 4BJLA 1KRMA 4MNGE 5C08D 5ICYA 4NAEB 5CCJA 4QISA 1NAMH 5GS2H 2UWEF 3GJFA 3QEHB 5M94B 1BQLH 2VERN 3K2KA 2JF6A 3WIFB 4Y4FA 4V1DD 3BTNA 4XK2A 4Y1AB 2LR4A 4MCZA 1WS7A 2Y0SA 3BPOB 4HMDA 5C0CB 2IDUA 1PCXA 2J8GA 5KYNA 2DYPD 4RNRA 3G5ZA 3RWHB 5IW1A 2DJMA 2DMKA 3CFQA 4IU3B 3UXAA 3W6YA 5DHVH 4BFEA 3E12A 1B0WA 3QLDA 1KOAA 1UUSA 3ZIMA 2Z4QA 2WZ0A 4JDEA 5CJQL 3B3DA 1ITQA 1TSRA 2BY0A 3ROLA 1T6VN 4WI2A 3GFXA 4RWYH 4LCYA 1KEML 1EJRC 1DUYB 3ARSA 3W0WE 2B7PA 1A02N 2FH8A 3L9RA 3QCVH 1T83A 2Q02A 4O1EA 3D39D 2Y5TB 1XEDA 1U3JA 4QOKA 2XPGA 4ZFZB 3OMAB 5IMKB 1NFDF 4JGJA 3BL3A 3W7LA 4HIXL 2Z8RA 4JM2C 4LS0A 5CBEB 2AXWA 1OT4A 1ZHBA 3MRPA 1S3KH 2F15A 7CGTA 5EB8A 4EUPH 1ZOXA 1A3LH 1ZKAA 5ANME 2WJZA 2VHLA 4MQ7B 3VINA 1XCWA 4GUOA 5F7WC 4HHGA 1ZK5A 3AVEA 2TYSA 1A47A 4DGWC 1C08B 3A4XA 3DIFB 2NR6D 4JFZH 3ET9F 4ZQKA 1J6OA 5T5NF 1GQNA 1Q85A 3C2RA 15C8L 3EOUA 2Q76B 1Q5MA 4JQIL 3T55A 1T66D 4JY8A 2ZUTA 3QIBB 2I7SA 1BV8A 4XMWA 2KUTA 1EGMA 2E27H 3KCWA 1WBXA 4QTHA 4U5KA 4NPYB 4U10A 3Q37A 4ZFZA 3RWDB 1A5BA 2Z28A 4AXWB 1U95A 3TGXA 3LQMA 4FHJA 2Y6SC 5GS0D 1GOXA 3AXLA 3BXNB 2Y62A 4G2DA 4X60A 1UM6L 5I1DB 3MKGA 1WITA 1F00I 1IBZA 4H1LH 4PJDA 2C1GA 2W9LA 2OOGA 1SFHA 4JFDE 4DP7X 3IYLW 1K4CA 4G6AD 4D6CA 3VDBA 4HPNA 2OELA 4YHMH 2D22A 2DWDB 4LPTA 5BUPA 4HOXA 3ZE1F 1ZIBA 3U5YA 4MY9A 3VKKA 2JIEA 1OM0A 3B5TA 3OG3A 3V8OA 1E4XL 1I3RA 4ZI8A 1KGIA 2OMZB 4HA4A 1BW8A 2EVJA 3DNKA 3MUXA 4HZMA 1SRDA 4M6VA 2AZAA 2X40A 3QPZA 4KJYA 3ZYJA 2B0SH 3FYEB 3PL6A 4XOAA 2Z65C 1WV7T 1XGPB 3N40F 3QDJD 2XA8H 1LRQA 2K7PA 2W60A 3K2UH 3II2A 4C56A 3VYPA 1J8KA 4RAUA 1HUVA 1RHCA 3FO0L 3TAOA 2IFFL 3DMMA 4MJID 5I1DA 4EOUA 4JM4H 3BDBA 5BOPA 1EO8H 3U2SA 4LU5H 4UYPA 1DSWA 2H1PH 4L56A 1DVSA 2G75B 4KXZI 1TSHA 2DBJA 2VLME 4LCCA 1F2QA 4N0UE 1SEQL 4YDNA 5K59E 5F9OH 4DKFH 3AU1B 2LE9A 1DOSA 1SMOA 3IIOA 4N8UA 4L3ED 2DT1A 4PUUA 5FESA 4ZD3L 1C8XA 1QLEB 3AMLA 3H8NA 4OSUL 3DUSB 4NZUL 1OFQA 5FO2A 4C6MA 3SJNA 3BP5B 4V2CB 1WQVT 3W1LA 4XBPA 5DHVB 5D05A 1OT1A 3C9NA 5BZDA 2Q8ZA 3THCA 3SPHA 3ABXA 1X38A 5KVGH 1AGFA 4BJHA 1OGPA 4PBVC 4U1KA 5FIPA 3R0MA 5F88B 5K9JH 4M00A 2G3XA 5EUKA 3WQGA 4D6HA 4RWYL 1FWTA 2NVDA 4Z2LA 6REQA 4NKOB 2CIKB 2XX0A 4LLUA 4GEJA 4Z0XA 5IIEB 3UYPA 2CUMA 1UP3A 3BO8B 3EMCA 2R4SH 4D8LA 1TVDA 4JE4B 1IIKA 4O2EB 3ORWA 4EOWL 4BGLA 1R5YA 1FNSL 2BVDA 4QRQB 2Z2BA 3PWNA 3WFHB 5I8OL 3WJWA 2XM2A 2DUZA 5TF1L 5JO5A 1E4XH 1S6NA 3BOXA 2E7HA 2NX5D 2ATPA 3CZUB 1G9NH 3NPZB 4O51B 5DC4B 3IPEA 5DO2C 1S5MA 3B8DA 3VACA 3D47A 5DZ9A 3PG9A 1EFXA 4G8AC 3LAFA 4AZCB 3UTTD 4WGWB 3PE9A 2B5IB 4LBEB 2GC7C 1YN7A 4JPWL 1NEYA 2V5DA 2XIIA 3KD4A 4JQIA 4XN8A 4LSPH 3EB4A 5IRPA 1UKSA 1NFIA 3BI9X 4MWAE 3ELFA 3HGJA 4BQ3A 3VI3E 5JXEA 4UTJA 5D2VA 3UPBA 1X5IA 4NNPH 3KVKA 5SX5H 3IDIB 1I8IA 1FLTX 3EYOA 4HH9B 3SOBL 4GAGH 2I25N 1M6OA 4UTKA 1O5RA 5FLUA 4HCFA 4J5VA 3HQOA 4V27A 4P57B 1HXJA 2Q8AH 1W3JA 1A1OB 3HS9A 1HQRB 4NAMA 4P9ML 2CK0L 4EIZC 4Q9CA 1A9BB 2WMPA 1UPMB 1ODZA 3FVDA 3H4GA 4DJED 2WXMA 3FTYA 4R96A 4FA7B 3D09A 1QEXA 2UY6B 5F97E 5MHSD 2RFGA 3FXYA 4K8RH 2XZQL 2HMIC 4IIQA 1O5XA 4EPKA 3RTQB 2YJLA 2H47C 4FLOA 3NN8B 2ZZ2A 3GB7B 3B8TA 3VFVA 3G77A 2D7PA 4FD0A 5DQDH 1I53A 1I1AC 5MEQA 1CG9B 2FATH 3WNJA 2LU4A 1DFBL 2NNRA 5DC2A 4GSRA 4P8WA 2QFRA 3EBAA 3VK5A 2X2YA 4NC0B 4DXVA 4XNMB 4L8DA 3L2NA 5DA4A 2XLLA 3L5HA 2WJFA 3VD1A 3C8NA 3DX5A 4HKXB 4HPXA 1TQCB 3BKMH 5I30H 1NAKH 3BJSA 3P3BA 4WZHA 3W1PA 4O1BA 3C6LB 3FQUA 4WU7A 3QUYD 4N42A 4PI2A 3CGTA 1AQ8A 5FDWB 3L6FA 4BFFA 2VXSL 1R5IB 5CJ5A 3XISA 4C65A 2VUNA 1IQ8A 4PTNA 1IWPA 1FWFC 4W5UA 3QFJB 1D3HA 2GYSA 2C16A 4L9YA 3JT0A 4Z7OF 5XIMA 2ATAA 2LHAA 4ZAKD 2YD6A 3HG1A 2VYOA 2QQKH 5I8CB 1BEXA 3PWPB 4BXSV 1BZ9A 1H6UA 4DIXA 2NY4D 1QLEH 1WGVA 3OHXA 4M3JA 4NQEB 5HJDA 5T8IA 1CLXA 4G72B 1EDGA 1EL3A 1XYMA 3T7VA 1MAML 2EC8A 2K45A 1E1CA 1BQLL 3D85D 3BE1H 3OQRA 3ATAA 4N2LA 4X0KA 3RAOA 1FUYA 3E74A 2NY3C 3CZJA 3QJSB 3PVFA 4MWAA 1C5BH 3W9DA 3QZ6A 2F5BL 2A85A 4DY1A 4X7CC 3GKFA 1II4E 2RB8A 4LIQH 3HI5L 5JIHA 4C8XA 3KPOB 4QF1B 1M42A 4Z18A 1PQZB 1NUGA 3VG9B 1N68A 4JHAH 5INCA 1VA9A 3O3BA 3J7HA 5IP4A 2YEZA 3EJQA 3QULB 2ADFH 3LHYA 4N9DA 1MUMA 3L12A 5IQ7H 1XIHA 2V0AA 3HG1B 4JAWA 4OCSH 2F54A 1FPTL 4XVDA 3SSJA 4EVZA 3CHVA 4PCSA 4J3VA 4JRYB 1HILB 4E8DA 1HSAA 2DOCA 5IDIA 5E00B 3WS3B 1A1NA 3I6SA 1BGAA 2H8ZA 2EAEA 4OECA 1G7PA 4MNGB 5C0CA 4RX0A 2ZXDA 1BF6A 3BG9A 4ZUSB 3A4WA 2UV8G 1TJIH 2YSSA 2BP3A 3X3FH 2VOMA 4TOYH 2PDMA 2XZ9A 5AVNA 4C5YA 4UV4L 2FQGA 4KFNA 3AIRA 2DDQL 1MJ8L 2WKLA 2C9AA 2L7QA 4N2FA 4DFHA 2G4JA 2PDHA 4O18A 1JXKA 1UA6L 3ISRA 4UV7H 1XGDA 2Y36H 3KBEA 4XIMA 4M1GL 4E38A 3TYCA 1Q13A 1I9IL 1GW9A 3T0AA 4XQ6A 1BYPA 4Y6GA 3VE0A 2YN3A 2WYHA 3DO7A 5T1MB 1MEIA 1EV2E 2Z26A 3JR2A 2CO7A 1H7XA 2IV8A 2NXYD 1MJ7H 2BFVH 3G1YA 2D7TL 4ZOBA 1XBDA 3D50A 5FF4A 1O7AA 2GK1B 3I7QA 2Z31B 2GJXA 1TREA 4YFEA 2X4NB 4OTKA 4AWUA 3EYFB 3L3DA 4BEIA 2MHAA 3RB7A 5DD1H 1J9TA 1FWSA 3OKYA 2F5BH 3HC0A 1H61A 4FS9A 1RQEA 3DO3A 3TASA 3LPGA 1GC1C 3WY1A 3H2AA 1B3OA 4PRHB 4OD3H 4AT6A 5I79A 4LP4A 1K7FA 2AQVA 3F4WA 3NQCA 4JRWA 5IT2H 4ZFQA 1XLAA 1GHFH 1JFHA 1M3JA 3BK0A 4U2ZA 4HS3B 5D2NC 4GS7B 5HK4A 1DZBA 5AC8A 3KXFA 4DRSA 4GFTB 2XSXA 3ARGC 3MOAH 4ODHH 5D2LA 1MJUH 3B7SA 5ALCL 1RSFA 5AOJA 4DP2X 5C2UB 2CHNA 3WUWB 4P5TB 5HUPA 2OOFA 1V6UA 4MVBD 4UIMB 2HS8A 2V81A 1P1XA 2Q7YA 3APMA 1KF9B 2AERT 4GAFB 3B8SA 4JO2H 4KUCF 3IMTA 4ZUUA 3ZKSD 4JMXA 5JQIB 3OKOB 3QC0A 1RD6A 4MLJA 4XZ4A 3K2GA 4LSTH 1EJ7L 2HVNA 3APYA 2DVUA 4AKQA 1MFBH 3GIZL 1MIEL 4JM0A 4JPVH 5FYLE 3CHRA 5G2WA 4GKSB 1D6EA 3VFUB 1WT5C 3AIBA 4J3OC 3VC6A 4I5BB 4NOBA 2DQCH 3LRMA 4FF9A 1W2VA 1KO0A 1AXSA 4M9PA 3I10A 1KULA 3MUIA 3WL0A 5DVPA 1KLUA 5F7NC 4X4YB 5EZPA 3DPBB 1RPKA 2NW3B 4JFPA 1A7PH 4LAJH 4K7PH 1GIGL 3MANA 2HVOA 1U8NB 3NCOA 2GUBA 4NS0A 2EH8L 1PX3A 3P30H 1RVKA 3KM2A 1SXZA 1QXLA 3QW3A 4XV0A 1FKWA 1GXEA 3UJJH 3FKUS 4Q6IA 3LY0A 2Y24A 3LNHA 3NQ2A 1A3RH 1WE5A 1PW3A 4WI6A 3PWUA 1SJHB 5EU7E 2EJAA 3WMLA 2BOFX 4RE3A 2EDHA 2HVKA 3IUHA 3MWAA 3F64A 4U1IB 4LP8A 1EGJL 1VGEL 1GOMA 3HM7A 1Q72L 2XH0A 3DETD 5I1GH 4OJCA 2XN9A 2YGOA 3TW9A 1MJUL 2JQZA 4B95C 2ASHA 3WG6A 4HIPA 3L3IA 1AZZC 2OP4H 2DW5A 4QRSB 1AK5A 1FZKA 4BQCA 5E8NA 1U8NA 3BZDA 1M57B 1MFCL 1QO3A 3LB6D 1LO2L 3S2JA 1HI6A 4F8OA 2ZKHL 3HGOA 4JEGB 3WKML 1HZLA 4DJDA 3SKUD 1MFAL 4Q3MA 1GGBH 4W8AA 1XKYA 1KJMA 5AW3B 4LRNH 5DHYA 4GC3A 3V4VL 4GCXA 3CHEA 1BYNA 1W1ZA 3L5JA 5KANG 3A6BL 3CQPA 3OG6B 2OXGA 4HALA 2CLMA 2QPXA 4BWUA 1XWVA 3N2OA 3R06A 1EZUA 3PGFH 5CBJA 5DX7A 5FV2A 5C08E 3TO2B 3PUEA 2E6AA 3RJXA 1UCBH 2IVFC 3AUOA 1CDHA 3QG6B 2APWA 2CWNA 2Z8WC 3RR1A 3SBWA 4H8WC 2FX7L 4GSDL 1M68A 4Q8NA 2X1PA 3IT8D 1UURA 4BFAA 2VZVA 3VD7A 4NZ8A 5KVEH 2WV3A 2CDGB 3O6FB 5C0AE 2WQAA 1MCOH 1GIGH 3QAZC 2ADIB 4WWOA 1T03H 1PKNA 4DGIL 5D5MF 1XIMA 3U2JA 2DQJH 1P5VB 3F12B 1BTCA 1N8OE 2XWEA 1FL5A 1UJTA 4K94C 1OIOA 3W1QA 4H6KA 4EPDC 3CN4A 1U8OB 1DQDH 2VM4A 1UJ3C 2E7MA 1TEFA 1FHGA 4U2YA 4W93A 1ZBKA 1MFBL 1K70A 1GGIL 1PU0A 1KRCC 3K6DA 3O07A 3W3OA 3EOEA 1DR9A 1RQ5A 3P9LB 5DD6B 4ZE5A 3ZXWA 2P5WE 5E6ZA 2NY4B 3GPEA 4W1TA 5C09E 3IUDA 2WPGA 4KRLB 2EQDA 3UWQA 4U1GB 3CL7A 1JGVL 4Y1SA 4JHAL 1LBFA 3HMXA 3DIFA 2O92A 5MEQB 4TNWK 1RBLA 4JX5A 2XQBH 1ACYL 4C55A 1U8HB 1ZDSA 3O45A 5IK3A 2A3EA 3SIMA 1E2VA 3W6MA 4LSRL 5EBLB 4EKJA 4IFKB 1FNLA 3CD4A 4PHZA 3GQFA 4I0CC 2FTAA 1OK6A 3FQNA 3F65A 4NO0B 2Y7SA 2FUTA 1A6UH 1GHFL 1MI5D 3TR2A 3EDEA 1CLOH 5DRWB 3BZJA 3FKKA 1EZVX 3KPLB 1KPVB 4O1AA 5JORA 3DVNB 4PFMA 7PCYA 2NY7H 2PLKA 1DJHA 3KEHA 2Z27A 1U4FA 4GY7A 2H1XA 3RU8X 3D69B 3R7MA 5L7XH 4P61A 4GYBA 1G7QB 2DFAA 3CB8A 4GXPA 3HZVB 3DBPA 4XTDA 5EA9A 3V1HA 4HAGA 1ETZA 4MD0A 3F4DA 5T5FH 1OLLA 4OCYL 3ILQC 4PJFF 1N6QH 5EF0A 3TW7A 1GR7A 2FBOJ 2DM2A 4XAZA 2N3JA 1RPQA 3TM6A 2O7SA 4PRHE 3MV9D 3W0KA 3MMEA 4KPLA 3FU9A 5ISZA 2Q3ZA 3G0SA 5LXEA 1H0DB 3KPQB 4KDVA 4B53A 4OLYH 1BECA 5C0AA 3L23A 5K1JA 4PRWA 2YAMA 3MUGA 4QSHA 3URNA 3MCNA 1BAGA 3DYMA 4CBPA 4PUWA 4Y16C 1I2PA 3HOJA 3KPLA 2B1AH 3B9KC 1YNTB 1TTFA 3KPOA 1VFOA 3OB0H 3QRLA 2QKIB 4M4RB 4P4KD 1E5JA 1MXGA 3QEUB 4ORGA 4WWPA 5EOQL 1A4KB 3FHEA 2X2GA 3WD0A 2JH2A 5CMAB 4WEUD 5HULA 1AQKL 2V82A 2QGEA 3KLAA 1IT8A 1Q7ZA 4ZUVB 4NNBA 3G5VB 1DBML 3GM0A 4GW4B 4HUUB 3ROLB 2J8UA 3RVVC 1SM3H 4H9UA 3F5WA 2IJ0C 3HI1B 4KROB 4KUZL 5CJNA 3L7EA 4F4RA 2WUCH 5HTSA 4HCGA 1T8XA 1TITA 4DJEC 4F2BA 4LHJB 3CL6A 4G8GE 2PO6B 5MEOB 4BINA 2WNQA 2I27N 3TO2A 1DTNA 4A7TA 5JBDA 3V4PB 4ZW6A 2J21A 1Z7JA 1I8JA 1FP9A 4M6NH 5HJGA 4JFFD 1E4IA 3A6CL 1P1ZB 4RK8A 1BAWA 4X8JB 2OJ1A 4W9LC 2GEQA 4OJAA 4PJIA 3MJ7B 3BWSA 1ICSA 3DK2A 3EWDA 3OZPA 2NNXA 5T8GA 1H62A 3W2LA 5C9XA 3IRPX 4UNUA 3UWUA 4QS5A 4LSSH 4WJ8A 4PGZA 1HDMA 3U4KA 1H8LA 3BJLA 1TCRB 2JQXA 3WJMA 4A4AA 1TF4A 4NQ1A 3RX8A 1RZ8A 2K9UA 4W6YB 5HGAB 3PB0A 3S1WA 5T3ZH 3KFTA 4OF5A 4OZGE 4ONHB 2AKRA 4KTGA 1K4DB 2BVEA 3AT0A 1EQPA 2R4SL 3IU3A 1I1FA 1GKQA 3PZVA 4CNTA 5DQJB 3HG0A 4ZENA 4LLVA 1E6XM 2NLJB 1ZAJA 2YGPA 1UOLA 1KB5B 1SR9A 1YHTA 2JJSA 3U9PL 3T81A 5I26A 2VD9A 3ZTJH 3FEMA 5DK0B 3U83A 3ULUD 4RNFA 2OKOA 5BYWA 1I4FA 1DBBL 1A4JA 1X5ZA 1TYGA 3TZVA 5KUKA 1C1EL 4QDGA 3N29A 4US6A 2FQIA 2E1WA 2OT0A 1I3RB 4NZUH 4U6XA 2BTMA 2BO0A 5JHLA 3ZKMD 4KJYB 2BINA 3RY4A 5LBVA 4GNVA 4G70B 5IVOA 4BQ6A 5JHDA 1PZ3A 3IU3B 2ZOLA 2CUIA 4HXBL 2X2HA 3APGA 2OLSA 4L4VA 2WXQA 1XF2A 3APDA 3KR3H 2XU9A 3CC5A 1QVBA 4MDIA 4HNVA 3BQUB 3KPSA 3QJOA 4KO6A 1CVRA 3WMQA 4DAGH 1F3EA 2GGJA 4R3UA 1E9OA 1N6QL 1X1ZA 4EF8A 4Y2DA 2X9ZA 3PYCA 2VDPH 4V1DE 4Z7UE 2W9DH 4NT6A 3JWDC 4YXHL 4JN2B 1KGYE 1UENA 2QCMA 2YAFA 2Z1PA 3FTGA 4NCDA 5BOZG 3MRKA 3RKPA 2IG2H 3AAMA 3L3JB 3MLSH 1GPWA 5BS0A 1ORQA 3WEAA 5ESVA 3R19A 4WU7B 5DEZA 5DSCA 3UH8A 4BKLB 1GYCA 4J1OA 4NQXB 5D8JL 3C60C 2WXLA 1EXPA 1KBGL 3IXTB 3G1HA 4DLMA 1SHSA 4MJ6B 5GS3A 2IWFA 3WIHL 1BVWA 1R5IA 2J7FA 4GRLA 2GUOA 2IG2L 1K9FA 1UM4H 2E74C 2OTUB 3LNGA 3QXWA 3GH5A 4YUEL 4GQ9L 1R30A 3L4UA 4OIFA 3KPSB 1YXDA 2N7SA 3AJXA 1LG1A 2J8UB 2VXSH 5D03A 5LGJB 3S36H 3LCGA 3MODL 3LZRA 3RJOA 1IVLA 3QZOA 1UGKA 1QA9A 1R6VA 4L3FA 1OSPH 5KJ4A 1OP5K 1BJ8A 1F5WA 1IEXA 3OKLB 5I77A 4NHVA 3LRSA 3UPWA 1DBAH 1TV5A 4YLQT 5EU3B 2H3NB 2EE2A 4ATLA 3D4GA 1JZ2A 2APVA 2EDQA 5CEWA 3WTYA 1S9YA 2JVUA 3WEMA 4RIRA 1CW2A 5CBIA 5FCUH 1O0VA 3MJ8A 4X8JA 2QPEB 3GRWH 4NO2A 4XVUC 1NCTA 5K9JL 1Y8BA 3GVVA 1NCJA 2YXXA 1YNTF 3HBLA 4I5RA 1V0NA 4GFSA 1Z5LB 2A9ML 3LN9A 3ZL4L 1NWOA 1EAPA 4N0UA 3VTAA 2Z7KA 4PRPB 4LE8A 4TXEA 4Z7VB 4DGIH 1JZDC 2XNAB 4P0DA 1O5KA 3EBVA 4JQXA 3VXMA 2ED8A 1PIIA 4PREA 1TMHA 3QR0A 3DN5A 3HB9A 2FBRA 1OAKH 3M44A 5MF5A 1XH0A 4L3AA 2ZXBA 1THAA 3DX7A 3HR6A 2OZ8A 3GVGA 1NIAA 1T0OA 4RISH 4K3JL 2WO3B 1QP1A 2MNUA 3QXTA 4MNGA 2YXWA 5B1BB 2R24A 1AYOA 3TL5A 3T6QC 4BFNA 1A22B 4FEMA 2NY6B 3L9CA 4ACZA 3HRZB 3UWYA 4JFYA 3P82A 3VD9A 2WN3A 5TDPA 1J9SA 4MBOA 4AK2A 3DTXA 2ADIA 3CLEL 4PMYA 2DQIH 4UTBH 2CKSA 3FYYA 4HU3A 4AD2A 3MMUA 3ECBA 2H8XA 3PZOA 3SPJA 4HETA 3GUTB 1F58H 1JVKA 3C8KB 4L1LA 5CAYB 3MRLA 5KYWB 1QSFE 4PBGA 5I2UA 3VKJA 4HTBA 4Q4SA 2FHBA 4MMXC 2E8ZA 3KL0A 2GFBB 4JPIB 1EMTH 5I15H 2AK4E 4MLRA 3WLSA 1QK0A 4L9XA 4F15B 4NNAA 5AW7B 4U1JB 1AYRA 3TBTA 3V52L 3QUMA 4JMNA 5AYQA 4JY5L 3PJTA 4HZLB 5JVLA 4LPCA 3RG1C 4EZMA 3AZTA 1HFBA 1OCOB 4H88L 4GBUA 1ZV9A 1SPDA 1J5IA 2VDRL 3T3PE 1UTDA 4HT3A 1KTJA 4YPGA 1X1OA 3GSRB 4KKBC 4XD5A 4XBEH 3ZUNC 1YPIA 3FQYA 3ZO0A 3VZYA 1IAOB 5DHXB 2E7FA 1MW1A 5GGUB 3GUTA 1EEYB 4M02A 3AYTA 3EOOA 3MTWA 4UQAA 5GNYA 4A29A 1E9PA 2R0KL 4GKOA 4BRVA 4TUJA 1GQLA 5DY3A 4GIAA 4MAZA 9PCYA 2ESCA 4H0GA 2IAND 3F6IA 1HCYA 2WKOA 3EBIA 3IN2A 4PWHA 3L1OL 3F4VA 4M5YL 3VXME 1QAWA 3UGRA 4C6QA 1R4XA 4DBDA 2O9PA 4ETQB 1N59A 4XT1C 4MZYA 5IZ7A 5D1ZD 3QS3A 4DP6X 5C7ZA 2WVVA 1QKZL 2PGRA 4JW3A 5GZOA 2X1UA 1FNEA 3UJTH 2Y7GA 5EU6E 2DJUA 5I1CH 4C6KA 4YCOA 3O15A 5XIAA 1E73M 1LWRA 2F54B 4R4FL 1MCPL 4L9DA 4OFVA 5F3BA 5IB3A 2GPTA 2YCLA 4AZ6A 4DVOA 2H90A 3QCUH 2I9LA 4NQCB 1KLUB 2ZJSH 1HSAB 5F9JA 3UTTE 1KLZA 3QXBA 1A0QH 3VWJD 2GOKA 3GW0A 2Q8BH 4O02B 5BJTA 3VA8A 2AZUA 4P99A 4X4ME 4UT6L 5AOMA 1DQJA 2WHKA 4LAQL 4NF7A 5DVOA 3KXFD 1ADWA 4D9QE 1KM1A 4X6CF 1WKYA 2CGRH 1UR2A 3SCQA 3IGXA 3VFNA 4OZFB 1HTIA 1U8JB 2LLEA 4H04A 4LALA 4QQUA 3RCMA 3HG1E 3DX0A 4UDUB 2WQWA 5E2UH 5J06A 3LM7A 1WCQA 3R13A 4HPJA 5D8JH 3K6FA 1NH6A 4KTDH 2ZUUA 4Z2JA 2UYLA 3GYEA 3ASOB 3AUVA 4G59C 4KS0A 4LCQA 3UYIA 3UWEA 4WKXA 1XIGA 1KBLA 1X5JA 3KVPA 1M71B 2IO5A 4OF3A 1D9KC 3TBWA 1YUHA 4HMEA 2ZOOA 4XPGL 1FOBA 3JWNG 2VSDA 3GUGA 3WZ0E 4N8PA 4E5TA 3EYQC 5IVXB 5TD4A 1ZE3H 3IMVA 3QIUC 4WO4B 3RY6C 3V55A 5DJ6A 3UX9B 2XYLA 1L3WA 3MLRL 4YSEA 3VXSB 2PC4A 3V3WA 2AK4B 3QQ9C 2J1ZA 3CFJB 5J3HC 3BLEA 4LC6A 4LY4A 2E6QA 2ZDSA 4ZS7H 4LEXL 1AP2B 1TZHA 1QQDB 2BSEA 3MRIB 3ZTDC 2LTQC 4KRMB 1M9HA 1UFGA 4LSQL 4LOFA 4AT6B 5EUKB 3SE4C 1S5IH 1E3XA 1QBAA 1OIMA 1K8ZA 3SCMA 2X09A 3RI5F 3M43A 3ZLFA 3RO8A 5IVZB 4F7MA 1U8QB 3FO2A 1IL1A 5DVKA 5KVDL 3S3JA 1Z9OA 3KWUA 4BA0A 3QLLA 2CXKA 4XCCL 5DXWA 4FB7A 2DLIA 2X4UA 1OD7A 1P1VA 3O8XB 4GIPD 4NENB 2VR4A 5FK9B 5A8GA 1N6UA 3EGXB 1V5XA 4NWUH 2WUBL 4AM0A 3UTQB 3TVAA 4GUHA 2Q5BA 2PP3A 3T9PA 1Q4NX 2BY3A 2F6AA 2V4LA 3ZL2A 2WNNA 4PTUB 4POCA 2VC2L 4Y19D 4LK4A 3RMEA 5D04C 3BN9C 2QGBA 4JFOB 2DD8H 4KEUA 4IJTA 4Z7AA 2YL5A 2BVYA 5KSBE 3HS0A 1ZU8A 1WYJA 4XRCB 1WUZA 3IJSA 2WCAA 4AQ1A 4M51A 3U79A 2ZRYA 3IMSA 1ZV5A 4GRWH 4HWBL 4PC8A 4TSBL 3W0WD 1NDVA 4RNJA 2EHHA 4NUMA 4TTUA 4Y9MA 4MWAD 3HPFA 4MA7L 5A6LA 2XOTA 3A3YB 4LRTA 1M6OB 1HAWA 4WFGE 3TNMA 3FNDA 2VN7A 4X5LA 4OGYL 3AIEA 3OJ2C 5FYKH 4XNAA 3FB5A 3CH0A 4EK7A 3CLWA 3UADA 2WIIB 3KGSA 5B80A 4R26H 5I1EL 1GKEA 1NF0A 5TFSL 4JTTA 4LCSA 4BQ4A 3SDOA 3E2QA 1GY1A 1FCGA 4K3DH 4Y2NA 5LB1A 3VCLA 2LABA 3UZQB 5HMFA 3EXSA 3SEPA 3EWYA 4MDOA 3MXWL 3KYMB 1C5DB 4WUKH 5IOPA 3KXFE 1QR7A 5EBUA 3PHAA 2OWWA 2OYLA 3BKJH 1HGWA 3ALFA 1I9IH 1SDDA 2QJJA 5KSBF 1PHQA 1CFBA 3MRBB 3QUYA 1NC2A 1KJ2H 1E1CB 2P5NA 4P07A 4ICCX 5J0BA 2WM1A 1NCAL 3ARFD 4OZFH 4YVVA 1QSZA 4OOUA 1RZ7H 5KVGE 3NOIA 3OKDB 1JYNA 2P50A 1H5BA 4O10A 4E5XA 4PA8A 2IH3B 1PJWA 4GYJA 3BGAA 2Y06L 1E5BA 5KYUA 4CW1A 1M2VB 3NDYA 1VESA 2HXTA 3U46B 3CH9A 5HYEA 2EGZA 2AJYH 3VFSB 3ONBA 3CBRA 3DFYA 4PJEA 2B3IA 5J8OA 1VFBA 3T4YA 2VFGA 1QI2A 1W80A 1X5HA 1FWIC 3KXQA 3VAEA 1YUHB 3B5HA 2Q0ZX 2XY1A 3P0VH 3VXOB 2G2RB 3MCG1 5EF3A 1ZTXL 3GR8A 4TUUA 4K38A 1MAKA 3W7KA 3TJXA 1RH9A 3KS0J 3L9BA 3PDGA 1YPZF 3BHBA 1I2NA 1EEXA 2NUWA 3HKFA 4ADSA 1S7RA 3L5LA 4R9XA 4KZEL 5E5CA 4WIWA 3DHJA 3QDJE 4FNRA 2JNZA 2YAPA 1QFWH 5CCHE 3MGAA 4YUEH 4ZSOB 1FRBA 3X3GH 2LAGB 3QEUA 3UTPD 1RJPA 1IC7H 3ITXA 1E43A 3O2DA 4M1CD 1SHMA 3OMIB 4OLXH 3WIHH 3STZB 3SQLA 4DHGA 4H20H 4F8XA 2H7WA 1N5YH 3BDXA 1T21B 3S34L 5KVFE 1ZT7A 2A3BA 3NRQA 1WQ5A 1DJWA 1TVHA 2E25A 3FGCA 3SY6A 5C2CA 3MPGA 1CF8L 4NT0A 5AFDA 1JRHL 1JCMP 3WJZA 4UFJA 8FABA 3D18B 2GBVA 4NUQA 4E9TA 2AQTA 5DD1L 5AEAA 1R2RA 3REVB 1IT9L 2VDOH 4WHTA 1CU4L 3H9ZA 1P7TB 2X6AA 4PBWD 3PY2A 5DJDA 2HRGA 4OKVB 4AZ8B 2ICSA 2WLYA 3WFBH 3W38A 3UMNA 1F3DH 2ALRA 1YDNA 5M1TA 1FP5A 3FRPB 1WZ1L 2R0WH 3QH3B 3K2IA 5JR1H 5D1ZA 4HIIB 1QOQA 3P80A 3FQ2A 4QO1A 1UOWA 2FKPA 1NDGA 3I2CH 5HI3C 2OA9A 4F7CA 3HC3L 4EPBC 3HMWL 1CD1B 5MEPB 1ZLUK 3RHWK 4QAWA 1FH8A 5IWLC 1P7HL 5IHRA 5EBLA 1W2PA 1RIUL 2WAQA 4WY0B 5C54A 4GW5B 1MG3C 1WT5A 1VZGA 4P23C 2CFFA 3RIAK 3V6OC 1UZ6F 3A4JA 4IX2A 3HW7A 4MDRA 3SQBB 4YDJA 4Q4QA 1MCOL 3PC0A 3NBNA 4ERSH 2DLGA 2PUQT 3CFKA 3IJHA 4L5FE 2AP2A 4R97B 3DIPA 1WX0A 3LHPL 3LHVA 3NTYA 2VMJA 2R4RL 2I07B 5DURB 3C6SA 3HNVL 1VZIA 5FJRA 3QMSA 2AJVL 3KPRB 2BZDA 4UWQB 2BP1A 4B97A 2YGYA 3MXVH 2FBJH 1P4IL 5ETUB 2GKIA 1SDDB 4IBYA 1KJ2B 3CU1A 4J3OF 4LZKA 3CMFA 4S3DA 5HNNA 5ABFB 4XHJC 3QW4B 3TO4B 1LO4H 1H3PH 3WDRA 3DUSA 3C4UA 4P7OA 1BM3L 5JHMA 1A0CA 4WY0A 1XG3A 4L3CA 1XW8A 1FH7A 1MFAH 2A4CA 1QYGL 1L0PA 4TLKA 3IIXA 2XM1A 5K9DA 3C2FA 3DG7A 3FT4A 4ATWA 1TZ8A 1UWQA 1RU9H 5HDBE 5JW5A 3QNYB 3E3QE 3I50H 5TF1H 4YHPB 3GSUA 3MNWB 4DGVL 1UOZA 2RTTA 5SWZB 2DZSA 4DBWA 3IJ7A 1YRKA 3S2AA 4OT7A 4TVDA 2ZG1A 2OQJB 3UYPB 1VFAA 2HSIA 1RJZA 3I3DA 4R4BB 3MP3A 1IKNC 5HAOA 5IB3B 2OGYA 5CGTA 2NY2D 3KWWB 3WFEH 2YCLB 2B7OA 2I56A 5JZ7D 1Y18B 2Z1VA 5I1KH 5DJ0B 1O6SA 1CDIA 5FWRA 3O1NA 3FO1B 1NAL1 3LM3A 1OAZH 3QEGL 4POUB 3EJYC 4LKXA 3AS2A 1NTHA 3F7RA 4BCZA 4RA0C 4UB0H 3R4IA 4MUZA 2F19H 5BRZB 1PD1A 1EJWC 4X3ZA 1N7ML 3AUJA