1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
b'AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
molecule tags Hydrolase
source organism Pyrococcus woesei
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
3W28A 4KRTA 1B0IA 3BCDA 3TTOA 3UG4A 4B3LA 1WDPA 2WZEA 2V38A 4JL2A 4UQAA 4BA0A 2YA1A 1QW8A 3WEOA 5FIPA 4V28A 1XCWA 2IGTA 2VZUA 4U33A 1HT6A 2F61A 1BSIA 4DUVA 4HMCA 3EDJA 3ZJKA 2OSWA 3A4XA 1VF8A 3EDEA 1R34A 2CESA 2FGLA 1GOMA 1G5AA 5EB8A 2GJRA 1R46A 3AMKA 1XSKA 3BSGA 1GPFA 3H53A 4XUYA 5FL0A 1SYTA 5HBFA 1SR0A 4CKQA 2HISA 1GOIA 3ECQA 1KGWA 1X6LA 4BF7A 1QPKA 1JDAA 5I2UA 2G41A 3VIFA 1GVIA 4AZHA 1KWGA 1V6UA 3T0BA 2VZOA 3POHA 3GNPA 3ARPA 2Y24A 2YBTA 5JBDA 1QHPA 5JUVA 1JZ4A 1FOBA 8CGTA 3VIGA 3ALGA 4PMVA 3RM8A 3VD9A 4DO5A 1CGWA 1LQ0A 3ARSA 5A8QA 1QBBA 1PJ9A 3BXWA 4EAMA 3WFZA 2IXUA 2DSKA 3TONA 4AIEA 2BHYA 3VMOA 2BY1A 3AXXA 2JEPA 4WK9A 2GK1B 2VCAA 4JIEA 3THDA 4PMDA 3FW6A 4UTFA 2ZWYA 1QOXA 3PZGA 4NZJA 2QHAA 4UQCA 3VDHA 3EDKA 1H1NA 2YOCA 3AMGA 2ZUWA 2WC7A 3SURA 3WD0A 1BAGA 4NRSA 4XV0A 1PX3A 3AIUA 1JYXA 2VUYA 3KLLA 4PMZA 5GNYA 2WWCA 4YHGA 4CVUA 2E4TA 4Z2JA 2ZICA 1EHAA 9CGTA 4JZ5A 4JCMA 1CPUA 3SCSA 4CD5A 2G3IA 3RM4A 4BQ2A 4S3KA 3GH7A 1EH9A 1SMDA 3HG2A 1CXLA 4WSJA 2XVLA 2JE8A 1J0IA 2DGAA 4DUXA 1KWKA 1KXHA 1JZ2A 1OD0A 1NOWA 3WH9A 3SIMA 3EJSA 3WY1A 4NZFA 3JUGA 1SMAA 3VNZA 2C0HA 3LRKA 1D2KA 4B9YA 1XYZA 3ZT7A 3FNDA 4LYPA 4GPNA 3UR7A 3VIJA 1U2YA 4JFWA 4MNJA 3L4TA 4ZENA 5ECUA 1ODUA 1F4HA 2CETA 3FHQA 3SCOA 5A6JA 3WH7A 1HKIA 4CUCA 1IV8A 4GI8A 4E2OA 3NCOA 2Y8VA 3NUKA 4UFLA 2V3FA 4EE9A 3WF1A 4W7VA 1QI4A 1K9DA 4J3SA 3OBAA 1JD9A 2ZXDA 2PWGA 1TFVA 4GQRA 2J7BA 2ALWA 2C7FA 5CPQA 5CSUA 3LRMA 1QVBA 1E73M 4M82A 4PMQA 3WF2A 5A6SA 5JIWA 3VMPA 1KXTA 4UOQA 3VTRA 3M46A 3D51A 4ACYA 4HPGA 1FH9A 1H11A 4M80A 1WE5A 4PTWA 1ZBVA 1WZMA 1AQ0A 1KGUA 2GVYA 1NWUA 4NZCA 4F8XA 1B31A 3T08A 3K1DA 4KWUA 4DO6A 3PZOA 1XYFA 3VDCA 5JBEA 1UR8A 1KB3A 4F66A 3WBEA 1KQYA 4W5UA 2ZXQA 1BFNA 3RDKA 4WIWA 3AQUA 2YL8A 2OYMA 4UOZA 1WKYA 3AS3A 3GDBA 5LA1A 5CXPA 5A8OA 3BLKA 5GNXA 1VB9A 1EO5A 4XB3A 1W1PA 1GCYA 3PBGA 1B1YA 3BVUA 4LX4A 5E6ZA 3VSVA 1EDGA 1R86A 4JHOA 5D4YA 1CXEA 1GHSA 4QDMA 3WFLA 1MW0A 5I79A 3SCRA 3U5YA 3A4WA 3N9KA 4PCSA 3EJRA 2YDSA 3UG5A 3WQ4A 3HU7A 4CU7A 5LA2A 3I3DA 3W6MA 2E0PA 3F5LA 1V0KA 2BHUA 4Y7EA 3ZT6A 1JL8A 3QHNA 4D71A 1MQQA 2WK2A 4MNLA 3N12A 1H41A 3WMSA 3MSDA 4LYRA 3DYPA 2WKGA 4PTVA 4GKLA 2J62A 3RMEA 3GXPA 1JI2A 3T0AA 3T2OA 2J7DA 4AYSA 1B9ZA 4DUWA 1UWUA 3KE0A 5D8WA 3EMCA 5HOSA 1ITXA 2YLAA 3IANA 1HJWA 2J7CA 4ZEPA 4PTMA 1E6SM 3AHYA 4CD8A 3AHZA 1R75A 5AC4A 1UA7A 1J0HA 1M04A 2AMGA 2EJ1A 3VSUA 2WMHA 3VILA 1W1TA 2J7EA 3WD2A 2FHFA 3CZ8A 1KR1A 3W29A 1N82A 1FH8A 2DPEA 4UFKA 2D73A 1E71M 3IJ8A 3BUPA 1BYBA 5CPSA 3D50A 3DDGA 2ZUUA 2DSZA 4N0RA 3AOFA 2EABA 1ISVA 4HMEA 3U7VA 4F9JA 4NXKA 4D1JA 1UWRA 2F1AA 2XN0A 2B31A 1E4IA 4RE2A 2OYLA 1OGSA 2D20A 2CBIA 4MNMA 4DWSB 3D4YA 1E56A 1RH9A 1JIBA 1BPLB 1QWNA 1C90A 4GO9A 4BZYA 1VEOA 2CCRA 4PMRA 4QLLA 3TTYA 2FE0A 3MUY1 2CBJA 2WBGA 2VCCA 1VFMA 1U33A 1SFSA 1EIBA 4UFHA 2A3BA 2ZXBA 3WDRA 2VX7A 4UQBA 3VIIA 1OINA 1UD8A 4Q22A 3MSGA 1QHOA 5I5RA 1X6NA 2VZTA 3W53A 3AFBA 3ALFA 3CGTA 2EPOA 1E4NA 4AD3A 2PI6A 3DX3A 3A4AA 4ACZB 1JNDA 1ECEA 2VC9A 3K8LA 1B90A 1EHNA 2BFGA 3U5UA 1R8LA 5KEZA 1LWJA 1QHZA 1PZ3A 2CBUA 5A69A 4IM4A 1H3GA 1V03A 4TTUA 1JXKA 4C7FA 4YHEA 1WDRA 4ZXLA 4QLJA 1XHGA 3FXYA 2CYGA 4A3HA 1QX1A 4URIA 4QP0A 3HG3A 2PWFA 1VJSA 2UY5A 3AS2A 4QCEA 1AMYA 1PX8A 2CKRA 4PBGA 4NRRA 4DWSC 3CV5A 1V02A 1W3LA 4HZ7A 1V08A 2HVMA 1VFOA 1LJYA 2J77A 4AMWA 1KGXA 3VX1A 1OIMA 1UH4A 5A6BA 5ABGA 1SZNA 1MWOA 4OOUA 4AMCA 1UD2A 2OSXA 1W9VA 3VGFA 5IXEA 2YA2A 4FLOA 2GDUA 3CPUA 4IISA 3OZPA 2VJXA 4MAZA 4TVDA 4P7LA 1EO7A 1EA9C 3SCWA 3AHXA 2F7QA 3VKKA 1E15A 2F1BA 3VM7A 2W5FA 3BC9A 1X1NA 4J3VA 3ZIZA 3KZSA 1MXDA 2IXVA 1GUVA 3MS8A 1HKMA 2TAAA 2FYVA 1IT0A 4HPHA 2UWFA 5DF0A 4DO4A 3B9AA 3VVGA 1M01A 5EMYA 2YDRA 3SUUA 2E3ZA 1W1VA 1OSEA 4MB1A 4UR9A 4AD4A 3TTSA 4LQ1A 1EOMA 1KBKA 3DYMA 4J27A 1OWQA 4UQEA 3GBEA 1GQIA 5GPRA 1JDDA 1VFUA 3VINA 3VO0A 2A3EA 1CXFA 1WPCA 4BQ4A 1CIUA 1TG7A 3ZJ8A 3WDQA 3N13A 2A3CA 1W1YA 2YFOA 2UY4A 3CUJA 1TUXA 2RGMA 3AYRA 1TMQA 1E1FA 1HTYA 4CN6A 2ZX9A 1HXKA 3EMQA 5F7UA 2EEXA 3GH5A 3AMDA 4TOQA 3VSTA 2VVSA 1J9YA 2GUYA 4PMOA 5A3HA 2XFFA 1C8YA 1WCGA 3NIYA 1B30A 1K9TA 3VD5A 4AZCB 3NSXA 4UZSA 4JKLA 1RPKA 2PWHA 1OBAA 3L2MA 1KCKA 3PZ9A 2YKKA 3ZM8A 3KWXA 2XFRA 2VQUA 3ZJ6A 3GNRA 2AAAA 2EAEA 1Q6CA 4F9DA 1BG9A 3OLEA 2WZHA 1TQWA 3H55A 1JI1A 3U57A 5BRQA 3EMZA 1GW1A 4U3CA 3MO4A 1GJWA 4FMVA 3CUIA 1J0ZA 5E6YA 4NSBA 4OIFA 1FP8A 2W92A 2D1ZA 4CCEA 3AXIA 2OSYA 2J79A 1BVZA 3CMGA 4FK9A 2FH6A 1UD6A 3VGEA 2XG9A 3AIEA 1NQ6A 5KZ6A 1US2A 3AZRA 5IHRA 1EDQA 4AW7A 5FKYA 1V3IA 2XHYA 1WP6A 2EBNA 1IZJA 1BHGA 1R33A 1KBBA 4W8AA 3K4AA 1M03A 1GOOA 2PC8A 3WQ5A 3BAKA 3SUVA 3F4VA 1HVXA 4WJXA 1TA3A 2WMJA 2DT0A 3WIJA 4XX6A 3RM9A 2XVNA 5A1AA 2Q8XA 5ABHA 4AIOA 4Q7NA 3DX1A 2XVPA 2XM1A 3ARUA 1W3JA 2X0YA 3LXBA 3OZOA 1CBGA 1C7TA 1UQZA 3FHAA 4TXEA 1A47A 2ZUNA 1HJXA 4PMYA 2ZIDA 4QCFA 2X1IA 2BXYA 2F7PA 1G94A 1KTBA 3LPFA 3AI0A 3EDFA 3M7SA 3L2LA 4TTGA 1E3XA 3GXNA 3BH4A 3VIKA 1M53A 3CC1A 2G8ZA 2V5DA 1Q6FA 3DX2A 1R47A 2ZUSA 3WDIA 4R27A 5M5DA 1UD3A 4QAWA 2ZX7A 2X05A 4JFSA 3UETA 4N42A 3NYDA 3D4ZA 1EGZA 3QOKA 2G3NA 3GNOA 1ZBKA 4FNSA 4KRUA 5ABEA 1XH1A 2FHCA 2D2OA 3D5HA 2OWCA 2JIEA 4HZ6A 1QNSA 4DWSA 4P8VA 2VTFA 4UQDA 4CD7A 3SCTA 1H09A 3CTTA 2WMFA 3W6LA 2E8YA 1FH7A 4KGJA 5BROA 2XTKA 3MU7A 3VGDA 1CGVA 3ZQ9A 1W9DM 4W7WA 1WB0A 1BVNP 2ZX6A 2VCBA 1DEDA 2PF0A 5EFFA 4IPNB 2BHZA 2XSAA 3VIOA 1HL8A 1H0GA 4PCTA 1UWSA 3PTMA 1HJSA 2WB5A 1ISYA 2FHBA 3T2PA 1CXKA 4JAWA 1VENA 1LL4A 3W26A 2WCAA 2X2HA 3RIKA 3IAPA 1Q6GA 3OGVA 2WVSA 5I77A 4AD0A 3IJ9A 1H0IA 4FNQA 1XC6A 1PPIA 2WHLA 4BQ3A 3WF3A 2W4XA 3I3BA 2CIPA 3BLPX 5IDIA 1OT2A 4PTXA 1E0XA 4ZE4A 3QOMA 4AZGA 1B3XA 1H49A 2DIJA 5A6MA 5FL1A 4X9YA 1VAHA 4W8LA 3D52A 5A2CA 4UZUA 3PZTA 1PZ2A 1UH3A 3VIMA 3WUGA 1JF5A 1XH0A 1TQVA 1QBAA 1W9PA 4OJYA 2WCGA 1XSIA 2YFNA 4U31A 1OD8A 2W61A 2W66A 4TUFA 4M24A 2UY3A 2E8ZA 2X2JA 1NP2A 2WC3A 1EXPA 3CBWA 4P7OA 4J3UA 1CXIA 1FP9A 1QW9A 4W84A 3FN9A 1NP0A 5I0DA 2EQDA 3M07A 1LLOA 3CH9A 4L4PA 4AD5A 3RPMA 3L4UA 3CZNA 4HMDA 1GQJA 2V3GA 2PBOA 4P8XA 1GONA 5BRPA 5I23A 1XRVA 3VIPA 1QI3A 5CG0A 4JFVA 2EPLX 2WBKA 3N1AA 2YLLA 3W37A 4LPCA 3IAQA 3EBVA 5IHSA 1I75A 2YL5A 1Q6EA 3QR3A 5DEZA 4FNPA 3WL0A 1FHLA 1GZJA 1HXJA 4KGLA 5HPCA 3M6DA 2XJ7A 1OM0A 1DP0A 2BNJA 3WQ8A 2WMIA 4U5IA 2FH8A 5GQBA 3CUFA 3WH5A 3PHAA 2VURA 2PWEA 1XH2A 3WUFA 1EDTA 1R87A 1NH6A 3FY1A 1LF1A 2JF6A 1E70M 4V27A 2WPGA 3HZ3A 1O6IA 3IJ7A 4TVUA 3N17A 5E09A 3RCNA 5C8BB 2CERA 5CZKA 1CYGA 2ZX8A 4E8CA 3BCFA 4OGZA 4DM2A 4WKHA 3VOCA 6A3HA 2VNCA 5E0CA 2J7FA 4JKMA 1QI2A 3RO8A 3MV11 1L8NA 3ARWA 4D6JA 2VRKA 1XV8A 3CHDA 3WH6A 2J8FA 1JF6A 2WLYA 1J01A 4EANA 3AS0A 1C93A 2G4FA 2F18A 4AD1A 3AICA 1AVAA 3A47A 1UZ4A 2VR5A 2IUZA 2E9BA 1E6ZA 3BAXA 3CO4A 2J25A 3B9EA 1CENA 3WUEA 1O7AA 4K68A 2WMGA 2MANA 4V2XA 2WSPA 4TVCA 7A3HA 4QLKA 4GQQA 2WVVB 3AJ7A 3BAIA 5A6BD 1OGBA 2BY0A 1LL7A 2DSWA 3WQ6A 4AC1X 5A2BA 1F4AA 3PZNA 3K4DA 3K46A 3DHPA 1J18A 3NDZA 2CNCA 1KQZA 2FGZA 3VMNA 4GINA 1OB0A 1UH2A 1FFQA 5A6AA 2D24A 5GNZA 2BVTA 3ARRA 1BGGA 2YL9A 4HU8A 3QGVA 1HWWA 2WCSA 4A3YA 2A3AA 5AYIA 4CCDA 3VDAA 4D72A 4CU8A 1GOQA 2X2IA 2Y4SA 4YN5A 3ARVA 4MTVA 3ZJ7A 1CZ1A 4D6IA 1JYNA 3AHVA 4M1RA 3CHEA 3AISA 3SUSA 3GXMA 3WBAA 3VX0A 1LL6A 1HP4A 1JFHA 1JYVA 1R85A 3W38A 4QFUA 4U5KA 5HNNA 4FLQA 5C71A 3A21A 3GM8A 3W4RA 4P7QA 3HN3A 3L4ZA 1DWGM 3WL1A 2O9PA 1H2JA 2Y5EA 3EJQA 5CGMA 4A4AA 3N18A 1W32A 3AHTA 3N15A 3A24A 3VGGA 1WZAA 3VD3A 3APGA 3H54A 1LG2A 5HPOA 5LYRA 1G9HA 2V5CA 2YDQA 3BUIA 3LMYA 3AZTA 1E9LA 3CUGA 3S6TA 3BSHA 2JFEX 3AS1A 4U2ZA 3AMLA 2OWXA 3AIQA 3WEMA 4MAVA 4UNIA 3ARYA 4MDOA 2ZUMA 3DDFA 1WZKA 2WZIA 2VQTA 3MANA 1HF6A 2DQXA 5DO8A 3HG5A 2J75A 4W7UA 4PRWA 2XIIA 1G01A 1E40A 1HKKA 2EPKX 2EXOA 1V6XA 2JIWA 5BCAA 5DFAA 5CLTA 1V6WA 4PSRA 2NT0A 4AY1A 3SCPA 4EK7A 1FFRA 4Z2HA 3CUHA 2D0HA 2PWDA 1WAWA 1HN1A 1JD7A 2ZE0A 2GJXB 1E43A 4UFIA 1UA3A 1Q6DA 1JYWA 1GOKA 4NI3A 4HA1A 1D7FA 4AZ7A 3W82A 1W9BM 1CTNA 2VVNA 3WNKA 1W91A 2QF8A 2V3EA 4CN4A 2GJPA 3WN6A 1JZ7A 3MMWA 4OBRA 4CCCA 1UWTA 2X8RA 2XN2A 3SUTA 3KL5A 4LXFA 5C70A 4M8UA 3N04A 3VUPA 4CU6A 1GOWA 1HJUA 2CBVA 3CZSA 3FAWA 4Z2LA 1KXQA 1JDCA 4H7VA 1ISWA 1UQYA 2WHJA 3RJXA 1K6AA 5D9PA 3MV01 4R5EA 1HIZA 1YHTA 1PIGA 2O92A 1HVQA 3G6LA 4FLRA 4ZFMA 3EJPA 4C7GA 1VIWA 1V3MA 2WSKA 4HOXA 1XD0A 1ZJAA 1C7SA 1MW3A 1GQLA 1UKPA 1W3HA 3F5KA 1HKJA 4J7RA 2DT3A 1DWHM 1KCLA 2CEQA 5LA0A 4AXNA 4AYGA 3AMCA 4OOZA 3VGBA 2XYLA 5DT7A 4H8HA 3T2QA 2VO5A 4W86A 3DC0A 2QLYA 3NDYA 1JFXA 3OG2A 1C3FA 2WLZA 3NJ3A 5BXTA 4AWEA 1CGXA 3W25A 1UD5A 5A8NA 1TE1A 1TQTA 3A3HA 2WM0A 3BUQA 3EYPA 1BLIA 3TV8A 2F8QA 1CWYA 1EQPA 3A23A 3WMCA 4C7DA 1MQRA 1TVNA 3A5VA 3W0KA 2Z1KA 3J7HA 1UHVA 4HA3A 4J3XA 1WNOA 2W67A 5A6KA 5BXPA 1UR1A 1GORA 5IFPA 1LWHA 1JAKA 1E6NA 2DT2A 2GJXA 2PBGA 1VEPA 5CPTA 2XPKA 3L4VA 4JFUA 4JFTA 3DYOA 5A8PA 4HA4A 2YJQA 3WNNA 3PZUA 3WH8A 2EADA 2OW6A 1J11A 4MJ4A 2XN1A 1K9EA 1WDQA 2BV9A 2CKSA 5EBAA 2PB1A 3FAXA 3GTNA 1V3LA 3ZSSA 5BXRA 1TQUA 1BYCA 2BY3A 3VPLA 1R7AA 1V6YA 4MB4A 3WDJA 1M7XA 3VIHA 3POCA 4ATWA 2F2HA 3ARXA 3EDDA 2W62A 1E4MM 3QHOA 4JCLA 3AYSA 4MDPA 4B16A 1JZ6A 3ZMRA 2DH2A 3IGUA 1UWIA 2XFYA 1W9UA 4NF7A 2DSUA 5E9AA 3TTQA 3HMCA 2J78A 1OT1A 4XZWA 2JALA 1WDSA 3A22A 4AEFA 1JZ5A 4JHZA 2DSVA 1DWIM 1ZS2A 4M81A 5IFTA 3BGAA 5D8ZA 4DM1A 1E0VA 3PZIA 1DWJM 1MW2A 4MADA 1RP9A 5A8MA 4D6FA 3WD4A 2WMKA 3OLDA 5E70A 1US3A 2WVUA 1UKOA 1UD4A 1B3YA 3ARQA 1BG4A 4YPJA 4H04A 4PSPA 5CSYA 4PEEA 1H4PA 4KH2A 6CGTA 4AISA 1TR1A 1G0CA 3WNPA 1ODZA 1QWUA 3CMJA 3THCA 4P7NA 2OWWA 1K9FA 1UKQA 4W87A 5AC5A 1DHKA 4MB5A 2WXDM 1CDGA 1W2PA 2XIBA 1I1XA 2Y8KA 5HXMA 4EKJA 4PUDA 1EQCA 3TOPA 1CXHA 3ARTA 4ATDA 3OA5A 5M03A 3HJEA 4HOWA 3AIBA 3WD3A 3CHCA 1UWQA 2DIEA 1W2VA 3D3AA 2BY2A 3ZR5A 2VOTA 1ESWA 2O9RA 3A6OA 3ZT5A 4GZEA 1WO2A 1XSJA 1JGIA 4AZ5A 7CGTA 3WDPP 4CD6A 2J8GA 3GXFA 4UCFA 2VX4A 2CPUA 4ML4A 3BUBA 3WNOA 1VRXA 5EFDA 1OCQA 2X09A 2VZVA 1MW1A 5I6SA 3G6MA 4AZBA 4AZIA 3WMBA 4UOJA 2GDVA 3MMUA 1JZ3A 4E8DA 1JG9A 3WKZA 3BMVA 5JBFA 2VT0A 4UQ9A 4D6HA 2QPUA 1PBGA 4J3WA 3MUIA 4B15A 3GZAA 3WDHA 3E1F1 1E3ZA 2J4GA 3CZKA 4PYSA 1VBUA 1QNPA 4RL3A 3EJUA 4FLSA 1BQCA 4W88A 3W27A 3F5JA 4BCEA 2OW7A 3WQVA 4M29A 2XGBA 3WUBA 3BAYA 3CHFA 3LX9A 3SUWA 1UUQA 2F7RA 5DMYA 2W91A 1J0KA 3UCQA 1UR4A 5ABFA 1NOUA 2WNWA 1UKSA 1RD6A 1NWSA 2WKLA 4AD2A 2EO7A 3K8KA 2YBUA 2XUCA 1BYAA 3OLIA 3WF4A 2F7OA 3VD4A 4GI6A 2JEQA 1NM9A 2ZUTA 4MJ2A 1XGZA 4D6GA 3BAWA 5TD4A 3ZSTA 1JZ8A 1O7DC 4OZOA 5FCZA 1E72M 1QNQA 1QI0A 4OKDA 1WZLA 3WD1A 3VU2A 5DT5A 1HX0A 1E5JA 4PN2A 3K8MA 1E6PA 3CZLA 1L0PA 1BTCA 5D9NA 3SCNA 1KXVA 4W85A 3SCUA 5D9MA 3TA9A 4H2CA 1XCXA 2VZSA 3W24A 4D6DA 3DHUA 3GBDA 1CECA 4X0NA 4LGXA 5HDRA 1UR9A 4J28A 2ESCA 1CLVA 3OB8A 1AQMA 4ACZA 3S5YA 5BXSA 5BYWA 1B3VA 1HJQA 4FF5A 1NOFA 3WSUA 2QMJA 3T09A 3BLBA 3DECA 4PMUA 3W81A 1CGTA 5CQ1A 3S5ZA 4UFJA 2JF7A 3UESA 2VI0A 1GQKA 2CITA 2WC4A 2UY2A 1LG1A 3UR8A 2NSXA 2E9LA 1JAEA 4ATLA 4CD4A 1V3KA 3DX0A 3BVWA 2O9TA 3LXAA 4TX6A 5FD0A 2G3MA 1J10A 1NWRA 4FNTA 4L4OA 4AZ6A 4KMQA 1PS3A 3WQWA 5M3WA 1W9XA 3VNYA 4U3AA 1PEZA 1V0NA 1Z32X 5ABFB 2ZXAA 1E55A 3ZR6A 1HNYA 3HG4A 1AQHA 4JKKA 1B3ZA 3AIRA 3AIWA 2WAGA 3IK2A 1W3KA 1R7OA 3AXHA 2XSBA 5E0FA 1XD1A 1Y7VA 1NARA 1PAMA 1QNOA 1BGAA 2CXGA 2V3DA 2BS9A 1V3JA 4WKAA 4AIUA 1TA3B 4HOZA 1CGUA 5A2AA 1PX4A 4D6EA 1FHDA 3KL3A 1RP8A 4E4PA 3VDBA 1I1WA 2XVKA 1UKTA 6TAAA 3OGRA 5CGTA 1T0OA 3MI6A 1HP5A 1UASA 3UG3A 4F79A 3RJYA 4Z2GA 3KEHA 4OBSA 2CHNA 3CIVA 2DDXA 1V0MA 2W63A 1JXJA 1P6WA 1E5NA 1A3HA 4PUEA 2O9OA 3PZMA 4GZJA 4IPLA 1G1YA 1GNXA 5CJ5A 2WVTA 2AOSA 2EPMX 4RE3A 4FNUA 4WSKA 4P7RA 2NT1A 1CNVA 7TAAA 4WF7A 4BQ5A 3UEQA 5I24A 3CZEA 1V3HA 3O2LA 2WWDA 3MUAA 5I78A 1DWFM 4DWSD 2X2YA 3PN8A 5AY7A 4PMXA 3WY2A 1HL9A 5AYBA 4IUGA 1ZU8A 4WKFA 3LPOA 1PIFA 4GIAA 1TQSA 3BMWA 1MVYA 2XGIA 1VEMA 3B9DA 1TCMA 5I3DA 1UR2A 3NSMA 3BVTA 2QPSA 1UOKA 3BVXA 3RILA 4D1IA 4CGTA 4CN1A 1VFFA 2FDMA 1NWTA 4NXSA 3AROA 3WELA 3LPPA 3KLKA 3UERA 5M17A 1E6RA 3O9NA 4B9ZA 4B3KA 1S46A 4HU0A 8A3HA 4W93A 1TVPA 3OGSA 4GXPA 4U2YA 2RGLA 3BVVA 2ZOXA 1C92A 1Q4NX 1QNRA 4HP5A 4RE4A 3S2CA 4P8WA 3O6AA 1UZ1A 5D9OA 1VJZA 4X0VA 1H5VA 1B2YA 2VRQA 1ZJBA 1ZL1A 2GFTA 4D6CA 1ZB5A 3GYCA 2DT1A 1MQPA 3EJTA 4XZBA 2VX6A 2NW0A 4FNRA 5A6LA 2WANA 2ZWZA 4GI9A 2WHKA 1EOKA 1HJVA 1UR0A 2A3HA 3ARZA 2D0GA 1D3CA 1MXGA 3T0DA 3VD7A 4P8UA 3SCQA 2VR4A 1C91A 1GHRA 3CZJA 1J12A 2VX5A 1V02E 1KTCA 1FA2A 2GSJA 1JNEA 1UYQA 4ZE5A 1J0YA 2YIHA 2X0HA 4W8BA 4CVWA 2Y2WA 4Z2IA 4GZIA 1E6QM 4HTYA 3N11A 3U7BA 1MYRA 2OYKA 1DTUA 5A94A 2XWEA 4H8VA 2E40A 1B3WA 2BVYA 1V6VA 2XVGA 4W5ZA 2E9MA 3SCVA 2XM2A 4JL1A 4LYQA 4BS0A 1GJUA 3LXCA 3GH4A 1OGGA 1ISXA 2J7HA 2J7GA 3L4YA 4J3TA 3TP4A 2G3JA 4PMNA 1KFWA 1GVYA 3VGHA 2ZUVA 3PZQA 2ZX5A 3CZGA 2J74A 4OUEA 3OLGA 2GK1A 5FOOA 2D3LA 3WEZA 5CLWA 3GXTA 2WHMA 1ZBCA 1E4LA 3B8SA 4GO8A 1ITCA 3QHMA 2EPNA 1V0LA 4MPKA 4AEEA 2QV4A 4UFMA 1CEOA 1ZBWA 3WY4A 2DH3A 3WNMA 4HZ8A 4W89A 3LPGA 1C8XA 4MNKA 1IZKA 4H8UA 3AZSA 3ZOAA 2BXZA 4AMXA 1KR0A 3PZVA 4M56A 2XWDA 3OIHA 2D3NA 5BWFA 2J47A 2VRJA 3CLWA 1MFVA 2WMIB 1J0JA 3L4WA 1VBRA 3KL0A 5A95A 1CLXA 1TZ7A 2YA0A 3WNLA 1E1EA 2CHOA 4Z2KA 2WW5A 3DX4A 2WYSA 3GXDA 5JIPA 3BAJA 1CGYA 2D0FA 1BYDA 1E0WA 3ZO9A 4WLCA 1OIFA 1MFUA 1BF2A 3GXIA 3WF0A 3WY3A 3AIVA 3I3EA 3VM5A 1C8QA 1ISZA 3NSNA 4S3JA 2VL4A 2C8NA 3II1A 5E1QA 1UG6A 3PTKA 3WENA 3MUZ1 1E6XM 3SEPA 2VMFA 1YQ2A 2DEPA 4ZXOA 3L4XA 2EACA 2Z1SA 4TX8A 1U30A 4H41A 3LRLA 3BUDA 3PTQA 1DWAM 4NX0A 4MB3A 2OLHA 1QI5A 2WVVA 2YL6A 3MMDA 2QMKA 2D23A 3MKKA 2D22A 4AZCA 2BVDA
chains in the Genus database with same CATH superfamily
4XVJH 1S7RB 4GG8A 4MASA 1B0IA 3SYQA 4K1WA 4HX1B 1KJ2H 2XZAL 4KRTA 3W28A 3TTOA 4B3LA 4NNAA 3L0GA 3VWKB 5J4MA 4UQAA 4BA0A 1LO4H 2NZIA 5BZDA 4FPSA 4KCUA 3WFBL 4BR1A 2JQMA 3IM1A 4QYOA 1PL9A 3K6FA 5JIKA 2XUWA 2WQWA 3DFSA 2OQYA 4RUBA 4V28A 3UR5A 2VZUA 1CIDA 3FK3A 4U33A 4EDXB 2GJ6A 5I71C 1HTIA 1BSIA 4H9ZA 4HN4A 4ZFCA 4E2VA 3QEQA 4HMCA 5TFSH 5L8LB 3WEXA 1F3WA 4OFIA 1TTRA 2RAGA 4NUJB 4DZBA 4KO9A 3WHXA 5BVPH 1NBYA 3WQGA 4J5NA 3F64A 4QSHA 2GTZA 2P5WB 3MOAL 4F93B 2I27N 1KIUB 3LLFA 2PTTA 1TOXA 3S35L 1P9MC 5C0GB 3PK7A 5I3IA 1R34A 1GZ1A 2VM3A 3HS8A 5F3FA 4JHAH 1D5BA 1T6BX 5HP5A 2JQXA 2QCCA 2NOYA 1IAKA 1OGPA 4BF5A 5IMLB 4Q4MA 1R46A 4AQAB 1YCSA 3DJSA 3H53A 3C6SB 2DEYX 1ZVHA 1TTQA 3E9AA 3HBPA 4RNJA 4ONFL 2WWMC 3VXNA 3QULA 5DMKB 2BOGX 1IT9H 3SPIA 4MCNA 3VVWA 2XIMA 3N6QA 4RPPA 1BMZA 2HISA 2AL2B 1KB9J 2XWRA 1YN6B 3TIEB 5LBGA 3CDYA 4ZS6D 3RWJA 1P1XA 3CIQA 1NTHA 1JXFA 1P2CB 3QULB 3WIHL 3LN5A 5F7WC 2GGJA 3VCRA 2ZONA 1VACB 2QKSA 1PKLA 1R3VA 4PULA 3HJZA 3QJSB 1WZ1L 3RFRA 3NQ7A 1YN6A 4PUKA 3VIFA 5JXQA 2C13A 1KWGA 4PS4H 1EJUC 4AU0A 3W1AA 3ATFA 1ZLVH 1JRHH 2ICES 4YHML 3G1RA 3UBHA 3QEZA 4A8RA 2Q3ZA 1QSED 3AUJA 3UZVA 3MUGA 1AQ8A 3MTWA 1JPKA 4OIAA 2YBTA 4LUYA 3OAUL 2LVCA 3Q1SL 1AXTL 4QI3A 3RVXD 1JZ4A 4LC8A 4WX2A 5JUVA 2PLCA 1RFDH 8CGTA 4NOBA 4DVBB 3GBLA 4XAWH 4JREB 4DO5A 2OXNA 4MA8H 1M6UA 4AE1A 3M0HA 4J3BA 4HK7A 3QORA 3ARSA 5KBNC 1K7EA 2NQ9A 5DBTA 4O4YH 3LHVA 5AW9B 5FX3A 5F70A 3DVIA 3TH3T 1TTFA 5D2NB 2IPFA 3T1GA 2VEFA 3WFZA 3C5ZA 4LKXA 1VBHA 2HLFC 2PKDA 3ULAB 3MSPA 3ILQD 2J1XA 5BZWA 3AXXA 3T9PA 1LP9F 3BWAB 4GW4B 3R0UA 1G7PA 4R7NA 3OXSA 2YSSB 1CQYA 2ZWYA 3L8QA 1IVTA 1P5BA 3L13A 5FECB 4G82A 2NY6C 2EVIA 3KBEA 2QHAA 3VD2A 4Z7OF 2EINB 4P2QE 1Q7QA 4X7TB 1JHTA 3DVGB 4XCEB 4E5XA 1G0DA 3EDKA 1L6ZA 1JQXA 1SOKA 1AZZC 1AO7B 2PCXA 4H3DA 3SURA 3SJVA 1TZGL 4L4TE 1YO4A 4X8GA 1IM3A 1D2PA 3L5WB 4DGYH 4BFFA 2QTVA 3PL6D 3QIBB 4WWKA 4ZQKB 3UDWA 4O12A 3RQ3A 4A3QA 3GMRA 4H7CA 5DRZB 1EZVX 4MWAA 1TWDA 1MI5D 3I9AA 3LXUX 4CVUA 4BFJA 5I6KA 1OKEA 2E4TA 3A67L 1WBXA 2ZICA 4D94A 3AB0B 1YUHB 2A9ML 9CGTA 4JZ5A 4IIHA 1ZEAL 3G1SA 5DO2D 1Z3NA 3VI2A 1T1WB 1FNGA 4L8DA 2XISA 2RQEA 2K78A 2OVLA 1AW1A 4PBEA 1WV7T 4JFEE 3ELAT 4LVNC 5BW7A 3QDGE 5KN5A 5M94B 2VDML 3BHBB 2B7PA 3HG2A 3FJ4A 4S3KA 1U8IA 2B1HH 4WSJA 4GMSH 3IE4A 4LVDA 5IQNA 3ZLGA 5FYJL 4IUOA 4PB5A 2JE8A 3I2CH 4L2LA 4MJIE 2PP3A 3M16A 3JTBA 5I73C 3U7YH 4QHRA 3BOVA 2P52A 1NPJA 3JZUA 2BNRD 4DUXA 4EE2A 3LQMA 5F1NA 4A22A 5EEUA 5TF0A 4MAUL 4RFNB 3FRPG 4XN4A 2R14A 3X1BA 2V8MA 5EFIA 2FO1A 4RMWA 3AJXA 3HA0A 1MFEL 4U1NA 3FT2B 2QAFA 2Y5TB 1DJIA 1SMAA 1GGBH 4NO3A 2D7OA 5HYSG 2OMVA 2C0HA 4LALA 3NP4A 2J6EA 4FD0A 2KHAA 4KRNA 4WEEA 4WEUD 2C9RA 3W1MA 3P9MB 3QARA 1ORSB 4GYBA 3V0WH 4BJLA 3DSNB 1E6OH 1D2KA 2C6QA 4WUKL 2A73A 3QPXH 1U8MB 2WLMA 2L5HA 4EI5B 1S5MA 1S7SB 2F53A 2DZSA 4PUMA 1TT6A 1CDUA 4A6GA 1RJZA 2H1PH 1Q7MA 3O15A 4LYPA 3D46A 3UR7A 1TU2B 1QPPA 1QFWM 1U2YA 3C8DA 3OKLB 4PWHA 1QO2A 4LAKA 2WCPA 3LDBC 3SBWC 3INPA 1A2YB 5ECUA 2UYLA 1A6WL 1F4HA 1I3VA 3FFCB 3JZYA 1CL7H 5D7LB 3VFRA 2YMTA 5ELIA 3WLWC 3B7YA 3MLSH 1DJNA 4A8NA 2WXHA 4BK8A 4O1DA 1SLUA 1UWFA 2VN7A 3IFNL 2ZUYA 3NUKA 3NCOA 3MRRB 4UFLA 3GMNA 5FAGA 5K9XA 1BMWA 3UJFA 1ZVYA 4M3JA 4W7VA 4XO7A 3FDKA 3OBAA 2JB5L 1TJIL 5FYLE 4ONOA 2DEXX 2MOGA 4U4BA 3LZ3A 2PWGA 2ONEA 3CHSA 3NWRA 1TQCC 3GF8A 4I2XE 2J7BA 4RMQA 4Z3IA 1OADA 3L0KA 2C7FA 2NNCA 4APQD 3KBJA 3DI3B 4LCIL 3PSWA 1QVBA 1E8YA 1L4IA 5I8EA 1E6JL 3MMTA 4PRNA 2INZA 3TGXA 1KLZA 2NX9A 1VBGA 2Z4GA 2HJFB 1EEYB 2I9LA 4QO1B 2EIBA 4AGMA 4JS3A 1KBVA 2WLIA 3LV3A 4P2OB 2GWGA 2Q7AA 2VDNL 4EF9A 3MMEB 4MYXA 3GMPA 1DE5A 3KM1A 4IIBA 1EMTH 5ESAB 3FA3A 4ZTPL 5J5DA 3BE7A 4XOAA 2BTMA 3NCJL 3SGEI 1RJQA 1RIVL 3CHRA 5FCSH 1H11A 2C9UA 1ZNNA 1QZ1A 43C9A 1XYLA 2VLME 3D4CA 2VUNA 5FV1L 1WE5A 4NRZA 2PUZA 1MRFL 3PWLB 1AYOA 4X6EB 5GS2H 2V69A 3EB4A 4Y5XC 1XIEA 4IBYA 2GITB 4YHMH 4V15A 1LDPL 3K1DA 4UT9L 3VKCA 2GI7A 1JNLH 4TKWA 1U91A 5I5MA 4U0RB 1NDMB 2HRWA 5D7JC 1DYZA 5HY9A 2HNHA 2PDWA 3GFYA 4IQEA 1KIRB 1XYFA 2YRPA 4ALAC 2V63A 5I02A 4G7SB 1IBZA 1TR7A 4AWSA 4JANA 1Y18A 4TPRL 4IIQC 4XB8A 3NGFA 4TQEL 4JEJA 5FEZA 3QZPA 4HIEA 4IRSA 4QRQB 3O2WL 3M7WA 3F7VB 3OF6A 3DROB 1AE6H 1RULH 1WA3A 3G7TA 1X97A 3GJFB 4G6FB 1N5YH 4I0CC 5D1QE 4LCWB 3SGDH 2ZYIA 4KRZA 1IQDA 2ADAA 1BAFH 1MIEL 4QRQA 4UOZA 3QUMB 3GDBA 1EXGA 1ESOA 4KZ0A 2NLJA 5I75B 4ZW5A 5AYXA 1FGVL 3RY6C 4LFYA 4JQVC 1H0DA 4MDJB 3K81A 4QKTA 1PKNA 4JHUA 1YBQB 5GNXA 5CC6A 1EO5A 1Q65A 3TBCA 5G4HC 1IQDB 1KG0A 1AH1A 3SBRA 3PBGA 1B1YA 4LX4A 1YAZA 2VITA 4MNGE 4YH6A 5E6ZA 5I8KL 3UBFA 1DN0B 4DFIA 4E9XA 1ALDA 3M64A 1GHSA 3CFKB 5D4YA 4WY7L 3WFLA 3SCRA 2AK4B 3OVPA 3FBQA 3OKOB 1TJGH 3APNA 3BRFA 4Y1AE 2OI9C 4CU7A 1BF8A 1R0AL 4NJKA 1NM4A 5AW3B 5B1KA 3LHAA 4WU7B 2E0PA 1KYUA 3F5LA 4PRTA 4PW3A 3A67H 5F7DA 2Y25A 2AQ3A 3V4PB 5C0CD 1S9VB 4RAUB 2H6PA 5CKGA 3WTXA 4D71A 4YIWA 1MQQA 3NZHH 5EBMA 5GSRB 1RIHL 3MAWA 5C0FB 1DLFL 2Q7YB 1A5KC 4DJDD 3NJIA 1VKXB 4LF2A 4F57L 3N12A 3VI3F 2XZQL 1B0WA 1EL3A 2APSA 4BGDA 2JKRM 4JN7A 4LYRA 5REQB 1BEXA 1NLDH 2XG5A 4U3SB 3GTXA 4OM1H 4HKBB 2UXTA 4I77L 1FZMB 2XFGB 4ODHL 4PTVA 4XVTL 1KCBA 4Q9CA 4GKLA 3GNML 4TNWK 4B5NA 4EIVA 1XUUA 5FB8B 1J1XH 1T4WA 5D7JB 2V5MA 4N1EA 1D5IL 3W0WA 1T5WA 4XCCH 4KKNA 3T0AA 3T2OA 5KS9F 1FSKC 1KZQA 2LU4A 3SPHA 5GS1A 3UIZA 1EZUA 2YC1A 5INDB 2J7DA 3FSAA 5DSCB 1UWUA 1OP5K 1TZIA 2PDNA 5JW5A 2ASHA 4M93C 3EMCA 3FK4A 5D8WA 5HOSA 1RZJL 3U1SH 2WSYA 2IGFL 4IK6A 1FVCA 2XDHA 2V9DA 3GW0A 1E6SM 1KM3A 3AHYA 3PQYB 4ZEPA 3AXLB 2O6EA 4YSQA 5J11B 3O3DA 3GKWH 2YC1B 3QQ4B 4JN1L 5DZLA 1DQIA 2AMGA 1BCIA 2ADFL 5JW5B 3U79A 2EUZA 4X61A 5BRZE 2EJ1A 5CP3H 4FOUA 3TBVA 4D3CL 3CZ8A 2EIDA 1KR1A 5J1AB 1KBWA 2HX7A 5GJPA 5INCB 1YYCA 2E56A 4RLIA 4WR3A 3S8WA 2VKXA 5K39B 2D73A 2EIMB 2YRBA 1AR1C 2CUMA 3KOWA 1GY2A 4KBPA 2VLJB 3IACA 3EGDB 2OX5B 3P8JA 1SJAA 3LSBA 4XAZA 2NR6A 1TQCB 3CX2A 4IBSA 2H32H 2DSZA 1SDDA 1NSNL 3H85A 5TK2A 4BDVA 1ZV5A 2EUVA 2Z28A 4ROPA 1T89C 1ACZA 5D7IE 3MWCA 1ISVA 4MHBA 4CQCA 2CO6A 2LFEA 3MA9H 5GJTL 3EGDA 1S6NA 3PHSA 2OODA 1TZAA 4KZDH 1HUVA 1E42A 1AP2A 4DI8A 5EZJA 1UWRA 2PDBA 1XLJA 4FOJA 5ERWB 4KIRA 2YAFA 1T6MA 3QFJB 2V2WA 3F4DA 5E8NA 1E4IA 1ICTA 1A4JB 4WTZA 4UTLA 1TV3A 2NY3D 3JTTB 3ECWA 3MDJA 1RLCL 5KYUA 4HU3A 3TMLA 4X6CA 2D2GA 3T3ME 3N42F 1MIML 1RL1A 1U4FA 4DWSB 4JMNA 4X7FC 1E56A 5JHDB 5ERWA 4Y8DC 4PWJA 1RH9A 1BPLB 4MVBD 2EH8H 1M6OB 4QXIA 1FKXA 3VCCA 2QJGA 5E8DH 3JS3A 1C90A 3L5IA 2NDGA 2W60B 3IU4L 2IANB 4GO9A 3PWAA 4XAKE 4YDKL 5H94A 4GGBA 3CVHH 3APCA 1PTAA 3X17A 3UTZA 4MQXC 3MLSL 4PTTB 5AVYB 5TGBA 2LLEA 3ULVC 3MUY1 1IIIA 4YXKL 4FG4A 4Y5YB 4DKAA 4ZOCA 4DK5A 3H9SB 4F66A 1ORQB 4IM8A 4JDVB 4MCZA 2R9HC 1BXCA 3L5XH 5H8DA 3BPCA 4ZPVB 1VFMA 3FRPA 4NUGH 3QDJB 1XR2A 1U33A 1ZA6A 3BE1L 4XMKL 3DUGA 1JMZA 1DDTA 3IMWA 5F72S 1SEBB 2FUQA 1X7FA 3D3FA 4KHXL 5IUSA 4JKPL 1US0A 1OAJA 3O6KL 4S2CA 4UWMA 3WIIH 2MEJB 2W9EL 1QFUH 1FFPB 1NC2A 2E5EA 4HZLB 4WFGE 2ZQ0A 3EWWA 3DX7A 4F2UA 5I5RA 3VZYA 5AD0A 1XS2A 1DSFL 3W11D 3GDRA 3G1XA 4L2YA 1OFPA 2N59A 3IWVA 1FFTB 4LL9A 4UUJA 4HFUH 5ISZB 3LZRA 1TJHH 1YYML 1Q0XH 3KVPA 3NN8B 3O2VH 2R29A 5EU6E 4Y8FA 5T1MB 4EUPA 2GWNA 4H1LH 5LWYL 1TQJA 2PI6A 4MM1A 1YIXA 1VP5A 1E0UA 4TTDC 5AYUL 4G8TA 4DUOA 3LIUA 1ZLUK 3ZZ1A 5GHWH 4NQED 5ITBH 3WS6C 3WZ0E 2D2JA 3U5UA 3W2MA 3QJRB 1LWJA 1F76A 3TN5A 4YVNA 1PZ3A 3DBXB 4XI5C 2YRLA 3QDME 4HPXA 3GSNL 4IM4A 1H3GA 3LDBB 1V03A 1WFUA 4TTUA 4N8VG 4DCQB 4FAAB 2X6UA 4AEHL 3HE6C 1JXKA 4YTSA 5I19H 2Q8ZA 4Q4SA 3NQKA 5J6HA 4YHEA 4NHUB 2EYTB 4Y5VB 4QLJA 4Y90A 2QSTA 4M62L 5LIXX 3ZMNA 4RZ4A 3D47A 2XKNA 5I6XB 5E51A 2CKNA 3AIWA 3AS2A 3HG3A 5F89B 4NKDA 2UY5A 5CZTA 3UZZA 3E6FA 3QHFH 1X9QA 5SX4I 1TWSA 4NRRA 3ABLB 2CKBA 1N9PA 4NHCH 1JUKA 4PJ5B 4L8SB 4F5CA 2DLEA 3CAQA 1WTGT 3LS5L 1MUJB 1LJYA 4PVBA 2VQ1B 4KOBA 3JUYA 4WWNA 3ZDWA 4HETA 1HXMA 2DQFA 1NSNH 4LVAA 1EO8L 1JNJA 2QJMA 1I7ZA 1FX6A 4H26B 2PDCA 4G9PA 2AABH 5FYJE 3T8MA 1MNZA 2VLJD 5G4OA 4YSEA 2INFA 3LKQB 4NZTL 1WWBX 3O4OC 1UD2A 3ULVH 2XXCB 4OOUA 2OSXA 4HT1L 4AMCA 5IXEA 5TE6L 4BK4A 2YBVA 2X6VA 5D4IA 4PRAA 3KGRA 4OZGB 5DMIH 2YA2A 3NZUA 4KX9A 1XCFA 5JOEA 6REQB 4JQ3A 1MCOH 4O2CB 3T8LA 1J4EA 3EOTH 4MAZA 1YMHA 3HR5B 1HH9A 2AQRA 1LOQA 3EKLA 1V27A 4OM0L 3WL9B 2J8TA 3SCWA 5AAMA 3AHXA 1OFRA 4URTB 2W5FA 4JPKH 4ANUA 4UTWC 4J3VA 3V5DB 3SRKA 1DBJL 1RZQA 1BMGA 3Q48A 1SPDA 5DHYA 1D3GA 3KZSA 5FEWA 1NGQH 3H22A 1NBZA 5I5IA 4J3OC 4YX2H 1HKMA 5TH2B 5JHDD 1KM5A 1K6WA 1EAPB 4CSPA 1QFHA 5FF6A 3S2NA 5DHXB 4L4VD 3DRTA 1BBDL 4LL4A 1LYQA 5CLZA 4BQ9A 4RSVA 2A6IB 2DQUL 1ML1A 3SIKA 2EDOA 3B9AA 1G7LA 4WWKC 2AQPA 3UDWC 3T0EA 2ZZ1A 2CSPA 2NY6B 3S3SA 3R8HA 1W1VA 1OSEA 2FDBP 4K71C 4FQQA 4MBRA 4LAOA 3EOBA 3HNVH 1EOMA 4P46B 2Y6ZA 1EJSC 1YYLL 4L3EB 4EUPG 3CFBB 1DVXA 4UQEA 4XNMA 3VOHA 3GBEA 3JV0A 1ILSA 1A6AA 4M7ZB 3LTYA 1JDDA 1T7VA 1VFUA 1W72A 1JV5B 4PVLA 5SV3A 2CHDA 3T77A 2F8XC 2EDWA 4GQPH 4IXHA 1I7TA 3ZHLA 3KDNA 1QSFB 3O4LE 4L1TA 3R7QA 5HHQB 1F07A 1YX1A 1CIUA 1DQUA 1TG7A 2E9WA 5C9WA 5E9XA 1OP9A 4R9HA 3BURA 3OHXA 2WBGA 3CUJA 4AVNA 1TMQA 3LNPA 4WJXA 5BS0E 4HJIA 4WHTB 2JCWA 1XQKA 4FEMA 3EEZA 2VM9A 1HXKA 5KW9H 5HHQA 1RBLA 1SXAA 2FO8A 3GG7A 2EEDA 5KVDH 5FA3A 1A1OA 2YD2A 4O54A 3RWHB 1TVHB 1FCCA 2Q3XA 4IS6B 4NKMA 5FUZH 1BM3H 4PJXA 4WUUD 2WZMA 2H6UA 4P4KB 3GH5A 2ZCKL 1KFGA 2X4QB 1X1ZA 2FZMA 1WEJL 3C8KB 1AL8A 4NHVA 1C8YA 3K80A 4EX4A 3UAEA 1B30A 1JCXA 1WD8A 4NQCE 4WEVX 4UILL 3NZSA 3VD5A 1WAPA 5HJDA 4DF0A 2REQB 1YYAA 2PDJA 1BXXA 2QFPA 5EIQA 4IHCA 4Q8QA 1NBVL 4YL9A 4GE8A 3ZYOA 4WQOA 4Y19E 1NFDA 4S3EA 3E2RA 4UZSA 4Y4HD 5KVMC 4YWIA 2PWHA 1OBAA 4JTHA 1F3JB 2ZDRA 4XRCB 4OVUA 2AJ3A 4GQZA 3TVMC 3M0YA 5I3HA 1GG1A 4Y7OC 4X60A 2VQUA 3N6JA 3ZJ6A 4A67A 2HVJA 4LCCA 3VG9B 4H00A 1VCAA 2J7LA 1IGIH 4UAOB 1M7IA 5I1DB 4GY7A 1S9WA 4DZBB 3EXTA 2WZHA 3HE7D 4LLMA 3UXFA 1OGAA 1C8VA 3S96B 3LKRB 2G50A 2OELA 3JWNG 4DELA 2AXJA 1JI1A 3QCUH 1CLYH 5BRQA 2HUEA 1BZ7B 1L9SA 1S3RA 2JI1A 4C59B 1TELA 3H8NA 2AERT 3EMZA 1E8XA 2BRRH 5DJ2A 2AGKA 5LHFA 3VXQB 2E6PA 4U3CA 3Q58A 3TT1L 2QVIA 1GJWA 3FXIC 1CFBA 1IGJB 4FFWC 4S39A 4I7VA 4XMXA 1N8ZB 2FJFB 4OIFA 1XIWB 3HC0B 5D05A 1H6EA 4ZJ9A 3ZTNL 2Z2UA 3PTMA 1MCKA 2JMRA 2ZPKL 3VFPB 1TLMA 4KUZH 5FM4A 3NFSH 3TXAA 3CU1A 5E2WH 5DCDA 4BWLC 3CMGA 3MCLH 3V7AG 1I2QA 1QPNA 4FK9A 3L9RA 1BEUA 2O30A 4POYA 2E6AA 4Y9BA 2FVKA 4YO0A 3FT4B 1BBJB 3PY9A 1V93A 4JQIL 1VHCA 3R11A 2HVBA 4PB3A 1YC8A 3ABMB 4LOFA 4N3UA 1US2A 1S9YA 4JUSA 3E2HC 1EDQA 4I5BB 2VFIA 3EA3A 3ZM8A 5IHRA 1HINL 2NY5L 1N12A 2XWBB 1RQHA 1V3IA 4NASA 1Q72L 1CFQA 5A6TC 4O58L 1WP6A 1RFDL 2Z9TA 4F9PC 2KS0A 2EBNA 3IU4H 1NIDA 3E0FA 3GD6A 1R33A 1KBBA 3ZS4A 3K4AA 2VABA 3BWZA 3BISA 3IJYB 1A22B 1GOOA 1TJRA 2PC8A 3WQ5A 4MD4A 3O07A 2DJLA 4Z7VA 3SUVA 4CGUB 3VFUA 1W1A1 3QH2A 3D48R 4K7PX 1KM2A 4KWVA 4HKPA 4HUUA 3WIJA 4EN2A 4P2QA 2IAMB 4XX6A 1F5ZA 2J9YA 1QASA 3SYPA 2MNWA 4S1SH 3WFEL 2DYPA 5JHBA 1ONRA 5CILH 2RGSA 4FQXA 3SJVE 4OV5B 2OQLA 4XNYH 1TZHB 3NJFA 3PJTA 3DX1A 5L2KD 1RJCA 3MUJA 4KMTH 3V0DA 2X0YA 3EKZA 4UR8A 4X6FA 3LXBA 4K8RD 4GMTH 4HHMA 2QELA 3CSGA 5KSAB 1RUQH 4V11A 4N0YL 5EL1A 4PY8I 5CAKA 3OO2A 3FHAA 4LAJH 4OV5A 5J1SC 4KCTA 2X4TA 2ED8A 2VH5H 1AKJA 3ZDZB 4PMYA 3T0EC 4NHCL 3EB3A 1WG3A 1HAWA 4WUUA 1SFTA 4X6FB 2CIKA 3DVNB 3A13A 5T9CE 2ZIDA 5KTLA 2X1IA 3W74A 2A7BA 1FYTA 1G94A 2OFJA 3ZL2A 2KQNA 2CBOA 4UNTA 3CHQA 1G9NL 5CEXA 1MRAA 1XG3A 3QDGA 2CLPA 1KTRL 3BTNA 5IR1A 4LDEB 3CVIL 4XPHH 4JNZA 5AB3A 3MUGB 4R90L 1I2PA 1XLCA 2XBZA 3G6JF 4OLUL 3BARA 3M0IA 4B4FA 5I1HH 2PTXA 4GC3A 4PJ7E 3W7JA 1VYSX 2XJKA 4I18B 1S7XA 4HT3A 1SYVA 1O5XA 3HC3L 1SR9A 1RK0B 2K9FB 1USQA 4W6WB 5A43C 3GXNA 1SYSA 3ZE1E 1UZDA 4XSLA 3WK3A 1J8SA 2V5DA 4Y4KB 2ICEA 4N2BA 4XZUA 2DVTA 3IIZA 5BU6A 4BHUI 1KNOB 3DX2A 1H5BA 1M2OA 4ZO8A 1BD2E 4P49A 2ZUSA 4FG0A 2CXKA 1SXSA 3KG5A 4NO5A 4ZW7A 1D5IH 1HL2A 1VC4A 4UC5A 3KBWA 5BZWB 1UD3A 3PCYA 3VE0B 2ZX7A 3OQEA 3QV6A 2JIXA 3K6DA 4GUFA 4DZHA 2GK0B 4N42A 4O9HL 2HN7A 4I48A 2YPVA 2C19A 4XK2A 3VH8B 5CP3A 4QHKI 3QOKA 1P1MA 3GSNA 1UMLA 2VLKB 4KJQD 4ZQPA 3E1ZA 4ZDHA 1EBPA 1PSKL 2ZCKH 5T1JA 4PJ8B 2OP4L 4JFPA 5I1GL 1BP3B 4GEJA 4L3AA 2C3VB 4Y9OA 3H26A 2HN7B 1HCFX 2X3BA 4QXUL 4HPOL 5IQOA 5SX5K 1YEGL 1ADOA 4IGBA 4P8VA 4CMHC 2AXFA 2JKLA 3ZKMD 2DFAA 4TMBA 5FJRA 4CD7A 3BEWB 5CM1A 4MA3A 5XINA 2ZCGA 3BMXA 4HGWA 2SFPA 1PZAA 2O5NA 1B4LA 1VDGA 4MFEA 5BROA 2XTKA 4PUJA 4IGBB 1UBPC 1F3RB 1IBBA 2ZSWA 3ZQ9A 3D0CA 3FCBA 4DP2X 3ABQA 4TVSa 1EWHA 1C08B 3WN5B 1WB0A 1NBQA 4G8IA 1K5NB 5HGHB 5D8JL 1X5LA 2BHZA 4LEXH 1GVSA 1KNWA 3EGXA 4HSQA 2AJSL 4OD2A 4TTDD 3T6XA 1H0GA 1FNAA 5FHAL 4MLRA 2EDRA 5F9OL 1CGSL 2FHBA 3SKMB 2X0VA 4L4TB 1ISYA 1CB2A 3PAOA 3PGDB 3THUA 5DLMH 3JU2A 3A4EA 4HIHA 5CEZL 3PWJB 3FO1B 5JO5B 4FXFA 3WLJA 1PMYA 1KCVH 2X2HA 2WCAA 3HBQA 3IAPA 2R0LH 1ZSDA 1IC5L 3GMQB 2A1YA 1Y6NR 1DL7L 2CBQA 1H0IA 1M7PA 3LEVL 4S3CA 2G5RA 1ZAGA 4RWYH 3OPZL 4TYUA 2MKWA 3OQRA 2A5HA 4B90A 4TLTA 3GE7A 4RNRB 1AGCB 1VBRA 3U0WH 4MJIA 3QNFA 4JJ5A 5FW7A 3M0VA 4PCFA 4K15A 5LO7A 1G4MA 1U8MA 2J88L 5KVGE 2VEGA 2N0KA 2CIPA 5AOMA 2VFEA 2AQOA 3BOLA 3KPPA 4IDJL 4LUTB 4OZFG 3MRQA 3BP5A 4M6VA 4OB5H 5IMKB 2YS4A 2CMRH 3QUYB 4NZUH 5EU6D 4IBVA 3USZA 4JFYA 3MDWA 4OD1H 2QDDA 4PEKA 4JNMA 2QSCL 2OL3B 2I14A 4AZGA 3KPPB 3KUMA 4I0PD 4KV5E 2VR8A 4PLNC 1B4RA 4LUTA 4AGNA 3S2LA 2DIJA 5D1QA 4AQ1C 4RIRB 5MI0C 1OEPA 1VAHA 1IEIA 3KS6A 1UATA 2H1XA 1X5GA 2XTJC 5A2CA 5HYQA 3B2VH 1FFNB 4A66A 4O02H 4YLBA 4TNWF 1KIRA 2P5EE 2ZKXA 3VIMA 3WUGA 3QUML 7FABH 1QBAA 2OMZB 4Y7MA 3B2DC 3BQ6A 4IG2B 1FA4A 2J66A 3WFCH 4YMZA 2OXHA 5ITFB 2Z31D 5FK9B 2D7TL 3O9WD 2YFNA 4U31A 4N68A 4XQ6A 2J6VA 3S36L 4TUFA 5IY5B 1GOFA 2IMNA 1SUXA 4M24A 1OPOA 3O06A 1A1NB 4BE5A 2E8ZA 3C2YA 5FO8B 3KRSA 5L2JA 4JRLA 1NJ9B 4J12A 3NG5A 2MPVA 3PUCA 4IG2A 3CBWA 1I8LA 3F5WB 1AQKL 3GQYA 1M41A 4G7FA 1FP9A 3EYUH 5ESAA 3UJJH 5MHSE 1T89A 3G77A 3MNWB 3R4IA 3M47A 1YEYA 2EDJA 2BWQA 1A1NA 4GS7C 1NP0A 4NC2B 5KSVB 3V9FA 1LP9A 2NR6C 3M8OL 1J87A 3WBDA 2AQ2A 4PS3A 1IQ8A 4OAWB 3EGSA 3L4UA 3VRLE 1PFOA 3QF0A 5E6RB 3DMMB 2V2TB 1MFBH 3OWRA 3QRBA 3FBKA 2DI9A 4AWUA 4FKEA 3B9VA 4ZFOA 4X5QA 5FWQA 5I23A 2HG5A 3BWUF 2QR0A 1JNNL 3QT2A 4HGXA 3CIWA 4N9BA 1P7QD 1CLOH 3EZJB 5DHEA 4LB4A 4LEQA 1KN2H 5FGSA 1EJWC 1DQQA 3N1AA 3P93A 4Y2OA 3BP4A 4U1HB 2HQAA 3QV8A 5TIMA 3Q1EA 3DOSA 5HDBE 3MLTB 1KTDB 3GO1L 3P73A 2YL5A 2QR0B 2VDLB 2G5BB 3HRPA 1OAUH 4D8OA 1Q6EA 3QR3A 1K8XA 2Y7OA 1RJYB 3O2VL 1JDFA 1FHLA 4LARH 2GJ6D 4KGLA 5HPCA 4AENA 4PGDB 4HHWA 4AK2A 2EXTA 1B2WL 3JV4A 5KUMA 5EBAA 1OM0A 3MLTA 3B34A 4LOUD 2Z0UA 5DQDL 4NJHA 2E4FA 2UXFA 4ZPTA 1G6RL 5C2GA 2DWTA 5SX4H 3U9PH 3GHBL 5D33A 5IV2A 3U2SA 2DRUA 2FH8A 4PV1C 5F6HI 1E9OB 5C3IA 4P23A 2DN7A 5CBAA 1LZOA 5D55A 3DIDA 1KG0B 1BG1A 4EN3C 1XH2A 1WICA 3BKCL 3LBOA 4S2SA 2UXGA 5CJOL 2YB4A 4M6AA 5IV2B 1R87A 3QMTA 1WC7A 4K8RH 3KGSA 2CLEA 4LCYB 3AALA 1AH4A 1ECYA 4KC3B 1TMLA 2VXNA 1JZFA 3PBVA 4LKCA 4V27A 1MJUL 1S9XA 2OK0L 4ETYA 4NZ1A 4IL0A 2C1HA 1VJIA 4QCIB 4JO8A 4Z3JA 1F3DH 4W1TA 3EJYD 5D7IA 3B04A 3VGAC 3GS7A 3ZRSA 3RCNA 4MNGA 3U83A 3D6NA 3GFXA 4K94H 4US5A 3W39A 4PP2A 1CYGA 4JFDA 1WXJA 3XISA 3RK8A 5G2NA 3ULVD 4Y1AA 2OX5A 1K4DB 3ZKQD 3OAZK 3Q2NA 4P4RB 2VUOA 2B14A 3MCLL 3VOCA 5CHNA 1MJ8L 2ZOKB 3REVB 3OMNB 4JQVA 3BICA 4PREB 4O0QA 3DJ9A 3QAZC 4JKMA 2SEBB 3HG1A 3JWOL 2R7EB 4L3CA 1FCVA 1SFJA 2XU2A 1NOAA 3OAZH 1L8NA 3RO8A 2Z31A 3CHDA 3WH6A 5CHNB 2FJHA 3V0FA 2J8FA 1OP5H 1AKPA 2XV2A 4PREA 5E8NB 4KDVA 2C91A 2J27A 5GGSA 3IDJB 4B95C 1TFHA 1FVCB 2B0MA 4OCYL 4ZXBB 4AC7C 4WW2A 1ONXA 5GRUL 2K6ZA 1UR3M 3MX0B 3AICA 1TEFA 3CFJB 5K9CA 2Z31B 5GIRA 3KR3H 1OX6A 2Y7LA 5AVVB 4WXZA 3UU0A 2EDQA 1F58L 1OP4A 4V1DB 3K6NA 1CD0A 3NCYS 3UAJC 2IUZA 5AFDA 2C3XA 3EJYC 4OZHB 5I1EL 1LUCB 1EA0A 2GYSA 2BSSB 2GUUA 4CDHA 4AE0A 5KZDA 3CH8A 1ZANH 3GS0A 1I1FA 3CNKA 5D7IF 2P80D 4H0LC 1ZOXA 3SDDD 1R3TA 1HEZA 2MANA 2L4OA 2DM7A 4KVCL 1DBBL 4W68A 4Y5XA 2QW5A 2IFFL 3L9CA 4C1LA 4DLMA 1RCYA 4PTNA 3PAZA 5KYWB 4QLKA 5I8OH 3AJ7A 3NQFA 2BNRE 2FPVA 3OGOE 3QS3A 1MVUA 2BY0A 1OGBA 2WXJA 4G9DA 2FQDA 1CT8A 4GSXA 3LHPL 1F4AA 3LNIA 3OC5A 1AIZA 3PZNA 2BASA 2H9GB 2IQ9H 4IJBA 1M2VA 4HXAL 4F57H 1WWWX 2N7SA 4JRFA 5IROA 1J18A 2UZ9A 3VXTB 2WNQA 4RPQA 4QWWD 1EUUA 1NL0L 1SBBA 3NCEB 3TVMD 3CV2A 5IW1B 2ESVE 1E90A 3EJJX 4ICWA 4HIQA 5AD0B 1JRCA 3SYCA 4N6RB 1PZ1A 5CJQL 2GQ3A 2YL9A 5DK2B 4FQJL 1IBHA 2BZ7A 4PGCA 3UCCA 2BNUA 2MQ0A 4XOCA 5TE7H 5CS7A 3QW9A 3IRSA 2YPLD 4CCDA 3VDAA 4EPKA 3S3DB 3FTSA 2JCCF 3VFMB 3WJJA 3ZX1A 4FP8L 1CR9L 4M8RA 2Y4SA 2W60A 3EFFA 3SYOA 5FKPA 3MRNB 3ZL1A 5G4NA 4HUNB 3U9IA 2DIKA 5HI5D 5EORL 3MBEB 5F96H 5F7LB 2OLDA 5I16B 4DXKA 2QGYA 2GY7B 2A4ZA 3CHEA 3GXUB 3UYCA 3AISA 1UADC 1XFBA 2K45A 1M9HA 1IHIA 3VX0A 1JPIA 5KVGH 1LL6A 2IKIA 4F5CE 3NP3A 1A6VH 1JFHA 5TFSL 2OCZA 2EXSA 1S39A 3REQA 4A6YA 3TWYA 3T65A 2I9EA 1AXSB 1DE4B 2D3VA 4MZIA 4W9GC 1PDKA 3TBWB 4LGRB 4HOMA 1AO7D 25C8H 3KCPA 3M6YA 3U4AA 3ES7A 2F0CA 1QWKA 2OZ8A 4QSFA 4OGAC 5DUMH 4HISA 1BWVA 1SO4A 4S38A 2AVGA 2HT2D 1PVNA 3PL6B 4QXUH 5F89A 1MCRA 3QTGA 4P7QA 3REQB 3W4RA 3NJMA 2OG9A 5IFAL 1GGUA 2J77A 2NSMA 3ARGB 3PV6B 3SGDI 3SQBB 2FZBA 3NOYA 4RDZA 1M05A 2Y5EA 3CMFA 3WE1A 4GLEA 1QA9B 3I7RA 4A4AA 1SDAB 1FDJA 4UTKA 3FLUA 3K5SA 3N18A 5DK0B 4PGBB 5A3ID 3VGGA 5JHLL 1WZAA 5F0LB 1Q6QA 2PFHA 2P47B 2XGZA 4PY8J 4UT9H 4EUPB 4IKLA 5KS9B 4PVNA 4S2BA 2JCCA 3CVBA 2V5CA 3G5EA 1T2JA 3ZZLA 4K2SA 1KTLB 3N2XA 2E67A 2DIAA 4GIEA 5H35A 3LMYA 1QACA 1EGJL 2R0KL 3HAEH 1ZAJA 3AZTA 4RKAA 2AQTA 1FWFC 2OV0A 3AS1A 2QNEA 4HIJB 1Q0EA 2AJZA 4FZ8H 3AMLA 2ZA3A 3MI2A 2ZYFA 2WQSA 1DQLH 2NY3B 1KELL 2ZKYA 3BAEH 3OKNB 4I0PA 4B5EA 1AZ1A 1LBMA 3LB0A 1UPPA 1N8OE 2HPMA 2GUOB 2BODX 3ARYA 1R5IB 3M17A 2CA4A 3P30L 4YPGB 3T0EE 2PW2B 3DDFA 4MQ7A 3F05A 2IBZX 4OGAD 4ZPVA 3QGKC 3VXSB 3H6AA 1DBML 5DCEA 3W9EA 3MANA 1HF6A 3TBYA 2XKNB 5D7JD 1V79A 3TYFA 2DQXA 3V35A 4Y6GA 3T0TA 4GKOA 4ISVA 4LOEA 3P84A 5EOQL 3QUXB 1G01A 2OJZH 2FYYA 2C4XA 5DJZB 1HSAA 4FOMA 3DO3A 2EXOA 2DQCL 3O4LA 2X1SA 3A4FA 3FH7A 5M2FX 2UZXA 1NMBH 4QLRA 3K72B 2ISWA 4M6NH 4ISVB 4UF7C 3FN0L 5FO7A 3TA3A 3RUBL 5CSBA 1H3XA 3QJFA 4O5LL 1K4CA 5BXFA 1U8CA 3N0AA 1A7RH 1LQ2A 4BFOA 3BW9B 1ACYH 3BVNA 3RVUD 1FFRA 5DQ9A 5U4NA 4Z2HA 2W88A 1NCCL 1R19A 3GSNH 3IKCA 2D0HA 1GGTA 2EDDA 3KPRA 4IOIB 4ZW8A 4JM0A 3ULSA 4HIBA 3C5ZC 3AGWA 4WW2F 5DZVA 4Q8OA 2RHGA 4XZNX 4U6VH 3DPBB 1E4WH 4PJ9D 1NDWA 5BPPA 3BW9A 3AYVA 5EKYA 3D07A 3MRCB 4H0IA 2GQ9A 3UTTA 5C0IA 4GYKA 1UA3A 3T8QA 2PP1A 3VFLA 5CJNA 2IADA 2ZOOA 3EYOA 2WP3T 2WO2B 5DD3L 2WM1A 3ANYA 1FIEA 3NPUA 3TYBA 1OHZA 1GC1L 1OC6A 5LXGL 5DMNA 5C8JB 1W9BM 3VK5A 3MNVB 4KH9A 5E94A 5HMFA 3MRKB 1RZKL 2DICA 1UOVA 2QF8A 5DEGA 4J2XA 4GX8A 2BSLA 3RVVC 1D5RA 3GI9L 5C8JA 2O61B 1JZ7A 4OI8A 1E4XL 1BZ9A 3ETSA 4UTAH 2YPKB 2QQQA 3ATZA 1S7WB 3T6CA 4XC1H 1YNYA 2X7LA 1VZIA 1MELA 1X5XA 2QADD 3QHFL 4QRSB 4U1IA 5D1XB 1UWTA 1U4EA 1ZT7A 4M8UA 5FLVA 1A50A 4JE4B 1OGAE 3G1HA 3G24A 1LLWA 2DL2A 1T66C 3I10A 1AG0A 5E5CA 4GG8B 1H7PA 2EG7A 4PJEE 4MAUH 2OT1A 2Y88A 2Z92B 2ZOLA 3VG9C 4CU6A 5C6MA 2A9BA 4XPAH 3W2DL 4U1IB 4JIIX 5AKSA 2WJ5A 1QABA 4DEWA 3FAWA 1J5IA 4Z2LA 4H7VA 1OCZB 1K6AA 3UBXA 4HPYL 3FQTA 3D85A 3WBYA 1DPMA 1HIZA 4BFGA 1MNUH 3QXDB 4TNVF 1PIGA 1XF3A 3V1PA 3V0UA 3KYMB 3FFCD 5D7LD 1YN7A 1RJLB 2BOLA 2VLRD 4R96B 5C2BH 2O92A 5IVNA 4FFZL 3ZIYA 3EJPA 3KDOA 4PUNA 2OMUA 2Q6WA 4FXSA 4W4OC 1Y6MR 3ARFD 4PJDF 1BZ7A 4XB7A 1RBAA 1V3MA 2X9YA 5C0JA 1U8OA 3PF2A 2F74B 2AGJL 2ICWB 1CU4H 2EDXA 4DVRH 4XZIA 2Z7WA 1C7SA 4PWEA 3C3UA 1MW3A 3BVDB 1NCIA 5GRXG 1TTBA 5C07E 4O51A 3QO0B 3TNMA 3OX8B 1J8HE 4J7RA 3RIFF 5DEJA 1F6AB 1FVEB 4HMNA 3CC5B 3L54A 5IJDC 5ESQA 1T4KA 3Q45A 4UT7L 3FH5A 4XWGH 1F4YL 4HWEH 1P1ZB 4E0RB 1WUFA 1R6VA 2GHWB 4MGXA 1EC8A 1A6UH 3MGOB 1GWJA 4OOZA 3CJJA 3VI3E 3BWSA 4JRYE 3CC5A 1FGNL 5T5NG 2Z00A 1Y1UA 3ALPA 1XKJA 2HTMA 3GYRA 1XW8A 1A25A 1JFXA 3NDYA 3OG2A 4LGPB 5EOCL 5KJ4A 4JZNA 1PTGA 3NJ3A 3AWEA 4GY4A 3JV5A 1ZIAA 4M7ZC 2HB0A 3MFGB 4TULL 1CLKA 2WB1A 2Y6TE 3MRDB 3OA3A 3WS3B 5A8NA 3PGFH 2LU5A 1FWTA 4D9QE 3N9SA 1MFNA 3A3HA 4WNQA 3BUQA 3GX9A 1G7HA 3TA3C 3EYPA 5ABTA 5FCUH 1Y5VA 3R0KA 4HIXL 1AJZA 1FTXA 2FYMA 4Y4FD 1GGIH 5BZXA 1CWYA 5HQLA 4DEFA 1TVNA 2IOMA 4WUUE 4LCRA 3WIHH 3J7HA 4X4ME 3ZWTA 1KCUL 3CB8A 1W72L 3P60A 1RY7B 4LL1A 5T3ZH 4LSUL 3MXVH 3L5JA 3UAFA 4QNEA 1UCWA 1W17A 1D7CA 1O7SA 4M5PA 4ZRGA 5DC2A 3JWOH 1YVLA 4JY4B 2WINA 5E8PA 5I18H 3TESA 1RVFL 3STZA 5BUAA 2A2QT 4IQDA 1T2QH 3BSZA 4PLJC 1E0TA 1JAKA 2NWRA 4J3OG 2YGOA 3Q6FA 4P05A 2NVDA 2R83A 5MENE 1VEPA 3F04A 1UWXH 1JWMB 4TPRH 4ZQRA 4R7NB 5DMKA 4JFUA 3DYOA 5A8PA 4UU9B 3LNFA 4JE0A 3CH1A 4HA4A 3WNNA 4XPBH 4Q4OA 3WH8A 4HNNA 2YBRA 4A2FA 1IC4L 4QTIL 5T3XH 3QNZA 1NUDA 5BV7L 1OX5A 3ZDZF 4QRTA 4XH2B 2X7VA 2B39A 3TSBA 1WKFA 4EE9A 4GG6A 3GTNA 1EJTC 2FD6L 1V3LA 3QUXC 4JPWL 3KOZA 1Z5LA 3H2EA 3C2EA 1OFDA 3MLZL 5ENLA 4A55A 1VADB 1KN4L 1SYVB 4OM0H 1BYCA 3FONB 2I57A 4CEUC 1N0XH 2BY3A 4RX0A 3DKHA 5D2LE 4B53A 4KEMA 3VPLA 2R2EB 2W5PA 4MB4A 2FEEI 2A6DA 4HWNA 3N55A 4N4YB 5EUKA 3COOA 3PUEA 4WGKA 3R6IA 4K8HA 3L3DA 1XUZA 2EE6A 4ATWA 1EF3A 2D4DA 5JMRA 5J6GA 2G60H 4B5TA 3OPUA 3ARXA 4X7TA 3DJZA 3QHOA 3AYSA 1CZ8H 2JIXB 4R8WH 4HQVA 5TAOA 3KTSA 4Y2LA 2D4FA 3DTDA 5E2UH 1ZLDA 2WW8A 1RLDA 1X5MA 1T5XA 5EWIH 2BGSA 4G80B 2FWOA 4R4BB 2DSUA 4TQ8A 3IMVA 1INEL 2DWXA 4KDWA 4OGQC 4ODXB 4DP4X 5ILTH 1CU4L 4O4VA 5I1KL 4WV1C 3WTWA 4IWWA 4AZHA 5E5UB 3SZKC 2RACA 4OLWH 3ZDXB 2PABA 4IRJD 4Q14A 3WMPA 3IXTA 2YEQA 4CSSA 1WDSA 1DVQA 1BFOB 2ZRZA 1VCFA 1V5JA 5L88H 3QLLA 3LN9A 4QF1B 5AW5B 1MHHB 4AEFA 2C0AA 3DI2B 3PL6C 4KNSA 2QZRA 2CZDA 1QYGH 2Q7NA 1ORSA 4PJ9B 5B22A 5K33A 4PJXF 3A4JA 3DG3A 4G6CA 4R5EA 3V36A 1AZRA 1ETZB 3NCBB 2E1WA 1R5VA 2P0IA 5IFTA 2ZG2A 5DJAB 3LDVA 3WNJA 1FYTE 2O56A 5D8ZA 5ECJE 3OKLA 5MEOB 3K2KA 2XA8H 2B81A 2V82A 1NCAH 2NUPB 1MUWA 4C6LA 1RP9A 2COQA 1H6TA 1YPXA 5E2TL 5A16B 4D6FA 5KETA 1GGBL 3VRIB 3L1FA 5IROC 5AB1A 2BPBA 1F9CA 5E9DB 3RA7H 3F1QA 4IBZA 3CFEA 4PRPB 3IDMA 3W73A 1US3A 3HMWL 4NO3B 1ADQL 4BWWA 4D0BA 3GO2A 3EFOB 3I84A 1XIIA 1TJ1A 3EBIA 3ARQA 4OCYH 2PDKA 2O4MA 3GSQA 2K8MA 4ZTPH 3SN0A 1BYPA 3VG0H 1Y07A 1DDHB 2Y3NA 4FQCH 4IBLT 1OQXA 4PEEA 2MPAL 4GUGA 4KHXH 1V7NH 1N5AB 4D9LL 4IX0A 1JPHA 1JCVA 1QFWI 1WXZA 2FR4A 1ODZA 1XGDA 4LF3B 2AEQL 4RNRA 3GSQB 1QWUA 1I1RA 1P84K 5EBUA 4N6FA 4PG2C 1GK8A 4P7NA 2H9AA 3NQDA 1A9EA 4S10A 5ANHA 3LV3B 5LCVA 1N5AA 4W87A 5AC5A 4R7LA 2QCEA 3I50L 3MMEA 1LD9A 3FB6A 5CN1A 1FHVA 5FOBA 1BJ8A 2RJMA 4D0DB 5JHLA 4P9HH 1RURL 1YEFH 3K2GA 1IBGL 1UQSB 2EO1A 1GR7A 4O1AA 3MXWL 4MGGA 3TJ4A 4PRID 1ED3A 2XZ7A 1EQCA 4MVBC 3TJHD 3H9HB 2JK5A 1LHZA 2K6WA 1G87A 3ASWA 1ET7A 5B39B 3FJLA 3ARTA 3MKGA 4ZB2A 3VNMA 4HGKC 4O10A 4DPQA 1NGXA 1UQSA 4RZ5A 1SY6L 3L4CA 3PJSA 4JO3L 2EH8L 4YWGL 3HJEA 5H4ZA 3DEQA 4BK5C 3AIBA 4XXCA 4ABVA 3FULA 4UMBA 1DFXA 3GB7B 3CHCA 1VFHA 4UR7A 2F15A 4F20A 4OQTL 4QHPA 5KJ7E 3Q44A 1NGXB 4QNPF 3ZT5A 2O9RA 1AG6A 2FJGA 1I2OA 3QPXL 2A9DA 3F6LA 3QPQC 4BCYA 4XODA 1MAJA 4AJYV 2EXWD 4F9LA 1PU0A 5JOPE 3FN0H 1YLVA 4AV5A 5CCZA 4TSAH 2VX4A 3BUBA 4Z7OE 4XBKA 4O17A 1ZT1A 4UINL 1VRXA 3W3OA 3MN8A 4NRZB 3FU0A 3RVWD 3V5HA 1FV1B 4XIMA 3RNDA 5LKYA 3Q05A 2QT6A 2VZVA 1MW1A 2QJIA 5I6SA 2DLTA 3U2OA 1A5LC 4WEBL 4L5FE 2PDFA 4ZFFA 2N7BA 1WK0A 4X9BA 5E0KA 4AZIA 1U91B 4LNVA 3S9DB 4OAWA 4DFHA 3WMBA 4EAEA 4LSTL 4Q8UA 1JZ3A 1KIQB 1TCRA 4N86A 1I85A 4DN3L 2Z25A 4JANB 3PNUA 2UZIL 4WOQA 1VCBC 4NM8H 1FSKB 3TT1H 1IXPA 4LCWE 4RIRA 4PLKD 43C9B 2VC2H 5ICUA 4Z5RB 2WJDA 4KPHL 4LCUA 4P5MA 4AMKH 4K5LA 3TZVB 1D7DA 2NLYA 2V4LA 1TJXA 3DIVA 5BMXA 4QHNB 3E49A 4F2MB 3GJFA 4K8RC 3V0VB 4U1HA 2BO0A 2J4GA 1QR1B 1A4KA 1JGEA 1E8WA 5KSBE 2WNNA 1KTDA 1FLRL 3KWVA 3P73B 4NWUL 1XR8B 1J1XL 3HAEA 4F37K 2C7UA 4YEFA 3IJHB 5FA4B 4RL3A 3LEVH 1R2RA 4OWGA 3AYTA 4WI4A 4ANWA 2YGVA 1QTPA 2F6AA 2SODB 2UV3A 4C8XA 3C6LA 1J5OL 4BCEA 4PJCE 3SGKC 1B0GA 3WUBA 3BAYA 4IHOB 5GGSY 2Z6IA 3SUWA 4MXVE 1YEJH 3G6JE 4AL8L 3MBWB 2FZ9A 3QZWA 3U0TB 4A2LA 1LP9B 5C7ZA 1GMIA 2IBBA 3GEWB 4P5RA 1W5PA 3RM4A 1YNLH 5JUEL 2H0EA 5DFTA 2VN3A 2OLAA 2BS8A 1RERA 1IR1A 2P53A 3H7VA 5BU9A 4X6DB 2R2BA 25C8L 1TZ8A 2WKLA 4PRPD 4S2SB 1ZUAX 5B80A 3AG3B 2EO7A 5F7DB 2UBPC 4JFDE 5LIWX 1MREH 1BYAA 2XNAA 3FQRB 2EVJA 2OGYA 5GRJH 3S0CA 3WF4A 5FGRA 2YJLA 4ZUVA 4ELMA 1PIIA 4DOHB 5GSRA 4ZMGA 2IG2H 2QGCA 4ZUUA 4GI6A 4P3CH 3RLSA 3VOGA 3ZLQC 2CG9X 2Q7YA 1Z9AA 4NYUA 1RZ8B 5DQJA 3LS9A 3T44A 4AIZB 2XN9E 4D6GA 4GLRI 5MKGA 4I13B 1I8LC 2Y0FA 1U9KA 2J57A 4PJDA 4TUUA 1XF2A 4HA0A 3GC5A 3UBGA 3U3HA 1MIEH 4L1XA 5LNUA 4AH2B 5L9FA 5TD4A 1JZ8A 4TRPL 5BZZA 1NPNA 4XBEH 1IGCL 3PJWA 1I1YB 1M7JA 1E72M 1XL4A 2E76C 4N24A 3QCVL 4WKZA 4X6CF 3RJDA 3DUSB 4LPTA 3FTUA 4YZWA 4GGHA 1AD1A 2DZEA 4Y2DD 5IGXH 1XXDC 2KZWA 4YZFF 1N7ML 2K7QA 4GRLA 4Q8BA 3EKCA 5BOJA 3FVMA 4M7JH 1F11A 3VU2A 4D8ZA 1SJVA 4APQA 1R3KB 5EYWA 1E5JA 1AC0A 4ZODA 3AXLA 3IPFA 1FC1A 3K8MA 5TQ2H 1E6PA 3FXGA 4WDWA 5AKQA 2XG5B 1HKLL 3F58L 3CK0L 2XH7A 2QVHA 2WUBH 1KXVA 3NJVA 2D31B 3I6RA 2UVEA 1XVSA 3WGUB 4HWUA 5FB8A 1U92A 3PUOA 4XTIA 2GSMB 1J1PH 2XXMB 4D2JA 2V2WB 2VZSA 2AL1A 4RZ6A 4MS8D 4FTVD 3MLZH 4IQHA 2EF9A 4JMXA 3TM6A 1BQGA 3BLOA 5DRNB 3MOAH 1N0XL 3CVDA 4Q33A 5E56A 3H6OA 4B91A 1JDEA 3GZOA 1CECA 4LGXA 4OFYD 2G97A 2YD0A 1HCYA 2ENYA 4J28A 2Q8AL 3KJ6H 4I9MA 4F0LA 1PCXA 5DJ8B 1OSZA 3WQPA 1FF5A 1XIHA 1OARH 1V7AA 2VDOB 3CUPA 2GB2A 2H3NA 4G3YH 4PP2B 2VM8A 1AS8A 3CSYA 5EH1A 3UTZB 1HJQA 3APMA 4BSWA 3FEMA 1I1AD 4L0YA 1NOFA 3RPDA 3KWUA 4G7RB 2J88A 5DJ8A 3STLA 4XNDA 4JPIB 3T09A 1NCDL 4U1MB 2HRHA 1NL0H 1LOSA 3UT0A 1DJQA 2BWGA 3KBNA 3D0LB 1MFCH 3NVQA 2MKLC 4X6CB 4EF3A 3HNTL 5IZ7A 4G7VL 3APDA 4E9VA 4RNHA 4UFJA 4LSSH 5D04C 4NNYB 1CN4A 3U2JA 3VI4B 3UESA 3ZN6A 4HYWA 4K36A 5GGSB 4YU1A 4N6RA 3MVTA 2JTYA 4F58L 2CITA 3D0LA 3EX2A 4X83A 1F56A 4LVFA 1Z7AA 3LQZA 4L6HA 4MOZA 2H0PA 4HIXH 4YSTA 1ME9A 1ORQA 3RKDD 3HIZA 3S37L 3UZWA 3HUJF 5I19L 1IBGH 3BQVA 2DMGA 1HSBA 4XE5B 3SDAD 5KVFH 2P0OA 3NR0A 4MF4A 2CLZA 2PCEA 5FD0A 2PWVA 4PMEA 4ZB5A 1P7BA 3B06A 3O2DL 2ENJA 4GAGH 2KT6A 4FNTA 2LHAA 2D7NA 1KLFB 5FF7A 4MWFB 1ZRUA 4KMQA 2Y8UA 4NPYB 1T1ZB 4ZW3A 1W9XA 1A5SA 2XSXA 2GBAA 1V0NA 3B4NA 4M02A 4YE4L 4HBCL 4BWUA 4E9RA 1HNYA 5FUCE 1AQHA 4JKKA 5T5FH 4ZFZB 1KLFA 1TCDA 4KXZI 3TUUA 3G04A 5E2VH 1OD9A 3MUUA 5D96C 1OAXH 3QDJA 3WLOA 3IGKA 3US1A 1R7OA 2XSBA 4ZTXA 1OL0A 4Z0BH 5E0FA 3QEGH 4MFHA 4B9PA 2WGNB 1NARA 2YD9A 1A3LL 2ODOA 1G7IA 3BP7B 5IB1A 2CU0A 3V75A 2BVPB 3DO7B 5FYJD 1TA3B 4GQGA 5KSWA 4U3HA 1CGUA 4XNUL 2BNRA 1PX4A 4OIIH 4DPRA 4CL7A 5HDLA 3US0A 2PYEB 2VH5L 4NUGL 1FJ1A 3DI0A 1UC4A 5AAWA 5SWZE 9RUBA 5D7KE 3VFOB 5IHZB 4X22A 3F00A 1NDVA 2XX0A 2GABA 2AGJH 3VDBA 4LUSA 4NQEB 5HULA 3FO2B 4U1KA 2Q8XA 3OXRB 4BRJA 6TAAA 2XG4A 3FU9A 2BNRB 5CGTA 3OGRA 3BESR 4N0CC 1TZZA 3NZQA 3LBCA 5G2IA 4XWOC 5KYYA 5FA5A 1ZEAH 1UASA 4DCQA 4DI9A 1H6FA 1T7ZA 1Z5HA 3B43A 3LK6A 5JXED 1ILUA 2ESVA 1DO6A 1QLEB 2HK1A 4L4LA 2ODHA 5CBIA 3CIVA 1GYMA 2AJZB 2DDXA 4F15C 1Q0YL 1T20A 4PJ5E 2DWDB 1V0MA 4HNTA 1OAZH 4GC4A 4GACA 3FQUA 1H8LA 1L9RA 2UUDK 4NDMB 4I9JA 3FTVA 1A3HA 4PUEA 2O9OA 3VAVA 2PW2A