1MXDA

Structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 157
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxdA01
1HVXA 5A6MA 1C8XA 3TTQA 1DWIM 3ARXA 4MDPA 9CGTA 4UFJA 1GPFA 3ARYA 1HJWA 1OGBA 3HG3A 3HG5A 3AYRA 4P8XA 1VRXA 1H3GA 3W37A 1H2JA 2JIWA 4UQAA 2A3AA 2ZE0A 1GNXA 2GDUA 2WMFA 2OSWA 3AIBA 2ZX5A 5I23A 1V3IA 4W7VA 2ZUNA 2FHFA 2FGZA 2F61A 4UOQA 2J7GA 1UH3A 1ODZA 1BF2A 5DEZA 1E40A 2UY2A 1BFNA 3OGVA 4J7RA 1ZBCA 3CZSA 4UFMA 1QNPA 1B3VA 3A23A 1DEDA 3B9DA 1OD8A 2F7RA 3EDKA 4PBGA 1QNOA 2GFTA 4D1IA 4YHGA 3D51A 3KLKA 2G41A 3VUPA 4AY1A 3DX3A 1V3LA 1CGYA 3GNRA 3SIMA 3BUQA 1HP5A 1J0IA 4KGLA 1TQUA 3BUDA 1QBAA 2E9BA 5FOOA 2GJRA 3BGAA 1J0YA 1M03A 2J78A 1BYBA 3FY1A 1E43A 2ZUUA 4MB3A 5DT5A 5ABFB 1JYWA 1ZB5A 3LPGA 4OIFA 2BHYA 4PSRA 4W8LA 4WKHA 4PMRA 4UQ9A 3VILA 4QCFA 5FCZA 3APGA 3GNPA 5AC4A 2NT1A 1HKIA 3FXYA 1UWTA 1EO7A 4DO6A 5A3HA 4WIWA 1PPIA 1Q6DA 4E8DA 5A6KA 3VM7A 3O2LA 2A3HA 1H1NA 5GNZA 1C91A 4WF7A 1W3JA 5BXRA 4FNTA 5BXSA 4WKFA 3D4YA 1OSEA 1XCXA 5A2BA 2WHLA 1HKJA 4CU7A 3GZAA 4FNPA 3N11A 2F1BA 3WY4A 5AC5A 2XVNA 2OW6A 2WANA 3AJ7A 3F5LA 1WDRA 3W82A 1QOXA 2BY3A 4AC1X 1BPLB 1V08A 3AZTA 4FLRA 1NWRA 4OGZA 4HU0A 3OIHA 3IAPA 5EBAA 3AMLA 4WLCA 3IAQA 5I77A 3BUPA 3QHNA 3ZR6A 1KGWA 4FF5A 4C7GA 4E4PA 1CGUA 1GJUA 2D2OA 2D0GA 3MUIA 3EYPA 4IPLA 1I1XA 3MSDA 4GINA 3M07A 2NSXA 2BVTA 4JFSA 4GZJA 4ACZB 1R7OA 1JI2A 1EIBA 2QF8A 3U57A 2HISA 1GOIA 1E1FA 2QPUA 1J12A 3ZMRA 1J0HA 3OZPA 3CZJA 3QOKA 3WMBA 3PZOA 4AZIA 4DUVA 2WMGA 1ISWA 3H53A 1QNRA 3EJSA 1MW0A 4JZ5A 3A47A 4XB3A 1UG6A 3CBWA 2IXUA 5D8WA 3CUHA 1E6XM 4HA3A 1BTCA 4GQQA 4AYGA 3WH9A 1W9BM 1BGAA 4FNUA 4P8UA 1V0MA 4N42A 4AZGA 3CZ8A 1HIZA 4TX8A 2PI6A 3RPMA 1UKTA 4DWSD 2CETA 4NSBA 5A2AA 4BQ4A 3PZTA 1KR0A 3WNPA 4JKLA 3WY1A 1OM0A 4JAWA 1TUXA 1VJZA 3UR7A 2O92A 2Y4SA 1FH8A 1V02A 1HXJA 4DO4A 1UWQA 4OZOA 1HT6A 4RE4A 1WPCA 3SURA 2XYLA 2WB5A 5DFAA 1Z32X 2FHCA 5KEZA 1JFHA 1GHSA 1AQMA 3A4AA 1E4MM 1GOOA 3AQUA 1BG4A 2XVGA 2EAEA 4MB5A 1GORA 3UESA 3WNKA 2W4XA 4UTFA 1NP2A 1NP0A 3VNYA 2GJXB 2RGMA 3WH7A 4W8AA 1W9XA 4LPCA 1OGGA 1MWOA 4TX6A 1N82A 2WW5A 4J3TA 2CCRA 3NSNA 3T0BA 1WZLA 3GBDA 3WF4A 5IXEA 2FH6A 1UWUA 2PWGA 1XYFA 3SCQA 3ZJKA 2CESA 4L4PA 3DHUA 3BVUA 2XJ7A 4IUGA 4E8CA 2C0HA 1E6RA 4AD3A 1GOWA 3WL1A 1E1EA 3RIKA 1US3A 4DO5A 1MQQA 5IHRA 1FFQA 2OSXA 2WK2A 1GZJA 5AYIA 5HOSA 1QI0A 5A94A 5ABHA 4KMQA 3AIVA 1SZNA 5D8ZA 3DX0A 1WO2A 4OOUA 5A8NA 4QFUA 1KBKA 3UCQA 3EJTA 3EMQA 5E0FA 4CD8A 4UOJA 1ODUA 3CZGA 3NUKA 3A5VA 3D52A 4TTUA 5JBDA 2WVUA 1TG7A 4UQDA 4AZCA 2UY3A 2DT3A 2WMIA 3ALFA 3VIJA 2MANA 2J74A 3VDHA 5M5DA 1VEPA 3OB8A 1QW9A 2WZEA 2GUYA 3W24A 4LQ1A 1CXIA 2YLAA 1V0LA 4IISA 3KE0A 3EJUA 4J3SA 2W67A 1J01A 4H41A 1M04A 5JIPA 1JZ3A 3ZSTA 2O9PA 5A1AA 4AD5A 3QHOA 3NJ3A 1TE1A 1K9EA 5EFDA 3VD5A 1Y7VA 2V5DA 3W81A 2YA0A 6TAAA 3W6MA 4PMOA 1XSIA 4M56A 1GHRA 5GNXA 4Q7NA 1UR8A 1QNQA 1SYTA 1CYGA 1G5AA 1V0KA 4D6IA 2WSPA 2WAGA 3BAWA 2F18A 2X0HA 1CGXA 1J11A 2ALWA 1E6PA 1JXKA 3WFZA 2PWDA 2VCCA 1OT1A 3L4UA 4F9JA 4M82A 1H4PA 1XRVA 2XWDA 1VAHA 1O6IA 2D0HA 1MQPA 2J7FA 3WD1A 3IANA 3GNOA 3PZNA 1HXKA 3BH4A 3ARZA 2BXYA 4P7OA 4AD2A 3KL3A 1EOMA 4GO9A 1LG2A 4H8HA 2BVYA 1JZ7A 3BUBA 2G3MA 1NH6A 2D3NA 5IHSA 1TVPA 1SR0A 1XCWA 2XGIA 3WEOA 4XX6A 3OZOA 5D4YA 3WMCA 2VX6A 3AS0A 4GI9A 4AZBA 1W1PA 3UG5A 3WY3A 4HMDA 2WHKA 1JGIA 5A95A 3CUIA 1XSJA 3N1AA 1XH2A 3WD3A 2ZX6A 1UUQA 5HPCA 3WQ4A 1XGZA 4UQBA 2BV9A 4J3XA 4M80A 3ARTA 1A47A 6A3HA 1E56A 3AMCA 1HX0A 1C7TA 1B0IA 2EBNA 2VZOA 2FE0A 4JL2A 1UR2A 5C71A 2JEPA 3K1DA 5HBFA 5LA0A 3BMVA 4Z2LA 3SUVA 1SFSA 5DMYA 3W38A 3WF1A 4R27A 1D2KA 4OUEA 4W93A 4UOZA 1ZJAA 2J47A 3VIMA 3GXMA 1V6VA 1MFVA 4HPGA 1VEOA 5C70A 1PS3A 2CBVA 2WNWA 1KXTA 2YDRA 5M3WA 3MUZ1 1UASA 1E4IA 3H55A 1FFRA 3WL0A 4QDMA 1JD9A 1B30A 2BFGA 2BNJA 4PTXA 3SCRA 1M01A 4AMXA 1WDQA 1BSIA 2XG9A 4HZ7A 1UR1A 2X2JA 3MV11 1MVYA 1QI2A 3WEZA 3WSUA 1PX4A 3W4RA 2J7CA 5CPQA 3NSMA 2OYMA 2CBJA 2D20A 4Z2HA 1L0PA 3AYSA 3CMJA 1K9DA 3NSXA 1VFFA 2CXGA 4DWSC 5E1QA 4H2CA 4AYSA 2EPKX 5DT7A 1QBBA 2ZX8A 1E4NA 4NX0A 1CDGA 4PCSA 5A8QA 1PZ3A 3LPPA 1HJXA 1CGTA 4UR9A 1MYRA 1VBRA 1D3CA 1MW3A 3AS3A 3QHMA 1AQ0A 1D7FA 4FLOA 1C93A 1NOWA 5CG0A 3FHQA 1B1YA 1DWJM 5F7UA 2GSJA 2JE8A 2PB1A 3T0DA 3VDCA 1EH9A 3UR8A 3BSGA 2VJXA 3EJRA 1KBBA 1E0VA 3ARWA 4HMCA 4AD0A 5EFFA 1V03A 1PX8A 5JBFA 1J0KA 3CZKA 4C7FA 4B3LA 3KZSA 2XN0A 1WZAA 3T2QA 3WBEA 4D6EA 3PZQA 2WHMA 3VIKA 1UWIA 2JF7A 3U5YA 2WMJA 3FHAA 4XZBA 1CZ1A 2GDVA 1ZBVA 1B9ZA 2W5FA 2G8ZA 3VSUA 3VM5A 2ZUTA 1O7DC 2J7EA 4F8XA 2WC4A 3AHTA 3WUBA 3ECQA 5M17A 2WYSA 4MB4A 1JZ5A 5D9PA 2YA1A 3VDAA 2E9LA 4BQ3A 2W91A 3AOFA 2D23A 3CUJA 2QLYA 2WVVA 3W0KA 4MAZA 2GVYA 3EDFA 2UY4A 1BVNP 3A4XA 3U7VA 3L4VA 5A69A 1XH1A 4H7VA 5FIPA 4PTVA 1CLXA 2ZWYA 5A6BD 1OGSA 4GKLA 2XN1A 3VGDA 5M03A 3MI6A 5A6LA 3CMGA 3L4ZA 5CSUA 3DYPA 1HKKA 2XSBA 1QHZA 2VVNA 2F8QA 1R75A 1QPKA 1BG9A 3DYOA 3BLKA 2XFYA 4W84A 3SUTA 3TOPA 4ZXOA 1VENA 1W91A 4JL1A 3WQ5A 2BY1A 2TAAA 4CGTA 1PIFA 4U2ZA 1EDQA 3VIPA 2F7PA 1UD3A 4GXPA 1CXEA 3AICA 1KXHA 4WJXA 3SEPA 3NDZA 3IJ7A 4TVDA 3OG2A 1PIGA 1JD7A 3L2LA 4H8VA 3WUGA 4JIEA 3LRKA 3BCFA 2E9MA 4AEFA 1G94A 4W7WA 4PMNA 1ZBWA 3MUAA 2ZXDA 3LXCA 4D6JA 1XHGA 3SCOA 1C8YA 3AHXA 2ZUWA 3ZO9A 4GIAA 1J0ZA 3W25A 2DSZA 1CLVA 2WLZA 2YL9A 1OD0A 3THCA 7TAAA 3BAYA 2VRJA 2YJQA 1I1WA 1JYVA 2EO7A 4JFTA 2OW7A 1KXQA 1CTNA 3AIUA 4EKJA 1IZKA 3F5JA 4DM1A 1IT0A 1E9LA 1JYXA 4B9ZA 4LYPA 2WCAA 1GCYA 3JUGA 1BHGA 4PYSA 3A6OA 1F4HA 3BAXA 3BXWA 2VQUA 1JZ8A 3I3BA 1TZ7A 4MTVA 3ARPA 2YL6A 3GDBA 4HP5A 3OLDA 1L8NA 1JFXA 3EBVA 4CCDA 4EE9A 2VNCA 3CC1A 1HJSA 2FGLA 1JG9A 1LG1A 3FAXA 1UKSA 4CKQA 1KB3A 1CXLA 2CNCA 3MS8A 1DTUA 2YA2A 3EDDA 1CENA 4EANA 3CO4A 2AMGA 3EDJA 1BQCA 4P7LA 2EXOA 3SCVA 2V3GA 1CNVA 3MMWA 3VX0A 2ZXQA 1WNOA 3D4ZA 4CN4A 4M81A 3WH6A 4DUWA 2DT0A 3TA9A 1KQYA 4WSJA 2EPMX 4D6FA 1LL4A 2XGBA 1DWHM 1R85A 1K9TA 4JHOA 1R34A 4HMEA 4CUCA 1EDGA 3ZT7A 5LA1A 2ZICA 5CZKA 1LF1A 3VD3A 1GUVA 4FNRA 1NQ6A 2CKRA 1JL8A 3VSTA 5GNYA 1H41A 5TD4A 2D24A 3CPUA 2O9TA 4XV0A 4FLSA 3VDBA 2X8RA 4PMVA 1NOFA 4KGJA 1E72M 1Q6EA 4JFWA 1HN1A 1ITXA 1W32A 3T08A 3G6LA 4PMQA 3GYCA 4F66A 2FH8A 1PZ2A 1H09A 2AOSA 1VIWA 4AZ6A 3VMPA 2PC8A 1ZBKA 3PZMA 3CLWA 3CTTA 1E5JA 3LXAA 1HP4A 2EPLX 1KGXA 4NXKA 2VVSA 3LRLA 5AY7A 1XV8A 3PTMA 3RJYA 3AZRA 3LXBA 1WDSA 2EABA 1V6UA 5LYRA 4Z2JA 5I0DA 3QR3A 1G0CA 2DDXA 1H5VA 2VRQA 4P7NA 2ZUMA 4GQRA 3WN6A 4CU8A 1ISXA 3AFBA 4AZ7A 2YDSA 3RM4A 2EADA 3PTQA 1XSKA 3IK2A 4W7UA 3GXIA 2VR5A 3BMWA 1US2A 1UH4A 2WKLA 1PAMA 2J79A 4EAMA 1OBAA 2QHAA 4MNLA 3TTSA 3MANA 4OKDA 3IJ9A 4F79A 2XFRA 3W53A 4W87A 4DM2A 1J10A 1NWTA 3VTRA 1UKPA 1CECA 4AWEA 4WSKA 1F4AA 1KR1A 4AZCB 3POHA 5D9NA 2X2IA 3CV5A 5JBEA 4UCFA 3N17A 1KFWA 1VF8A 3L4YA 2V38A 2WMIB 2XHYA 4HA4A 1T0OA 4MDOA 4C7DA 2DPEA 4CVUA 3MMUA 1NM9A 1HJUA 1XC6A 1JDDA 3K4AA 3TTOA 1DWGM 3MSGA 2BHUA 1HWWA 2JIEA 4V28A 2FYVA 3ZM8A 3VGGA 3VD7A 4D6GA 2W62A 5KZ6A 1GOMA 5BRQA 1WZMA 2VMFA 2EPOA 1JZ4A 3DX4A 3HG4A 4PCTA 1H0GA 2CHNA 2GK1A 2EACA 5BCAA 1U30A 3FAWA 4A3YA 3W26A 1R47A 3VGFA 1WB0A 5BRPA 3MV01 4NRRA 3B9AA 3SUWA 1VB9A 4HZ8A 3ALGA 3OGSA 4CCEA 1GQKA 3S5YA 3VVGA 1E70M 3EJQA 4LXFA 1CXFA 3SCUA 4L4OA 4S3KA 2YFNA 3M6DA 4UQEA 1M7XA 3T0AA 4ATWA 2VT0A 4AZHA 5D9MA 3W6LA 5CLWA 3VO0A 1KCKA 3WBAA 2OWXA 4K68A 1FA2A 2VRKA 1EGZA 3PZGA 3FW6A 3MU7A 1AQHA 2V3EA 5LA2A 1OT2A 4M8UA 4X0VA 4NZFA 4M24A 3A22A 1LWJA 1TMQA 3T2OA 4MAVA 1E6QM 5CLTA 5ABGA 1MFUA 1UHVA 4J28A 1G1YA 4JCMA 1GVYA 4U5IA 3BVVA 2DH3A 2WLYA 3PBGA 4TOQA 4AEEA 1R46A 1JNDA 3AXHA 2D1ZA 3W28A 3VINA 3UG4A 5I6SA 4RL3A 5DF0A 1M53A 1UA3A 3TTYA 1B3ZA 1E5NA 2Y8VA 1WAWA 2J62A 4QAWA 1R8LA 1K9FA 1NWSA 2YL5A 3WMSA 3ZOAA 1B3YA 2VOTA 4AISA 5JIWA 4CVWA 2YLLA 2XIIA 3SCTA 4PEEA 2PWEA 2QMJA 1C90A 3KLLA 3RILA 1A3HA 1PJ9A 3CHFA 4E2OA 3SCNA 2DQXA 1KWGA 1W1VA 1B2YA 3DYMA 3BLPX 1UR4A 2A3BA 3FN9A 4HTYA 1W9PA 3LMYA 1UR0A 3CUGA 3BVWA 3GBEA 3UG3A 3GH4A 2E40A 3LPOA 1R86A 1GW1A 5JUVA 4NZCA 4FNSA 1W9UA 3N15A 3BSHA 3VGBA 4U2YA 2WMHA 3PZ9A 1TFVA 3WENA 3FNDA 2XN2A 3B8SA 1E73M 4OBRA 4UZUA 1V6XA 2VX5A 2XTKA 2BY2A 3LRMA 1FP9A 4J27A 2E8YA 3OGRA 2OYKA 3ZT5A 4J3WA 3GXDA 3MKKA 3T2PA 3K8LA 4PMUA 3AS2A 1IV8A 5A6AA 3NDYA 4ATDA 3VGHA 1E15A 1JXJA 2WSKA 1UA7A 1V0NA 2XVKA 2CBIA 1UWRA 3VKKA 4HA1A 2D73A 4B3KA 2YIHA 3EDEA 3OBAA 4AMWA 1DWAM 1LL7A 5IDIA 2V3DA 4NF7A 3VMNA 4YN5A 1P6WA 1SMAA 1QI4A 3CIVA 5GPRA 4PTMA 1J18A 2WMKA 4ATLA 2CPUA 1UH2A 4AIOA 2VTFA 3WDRA 4P7RA 1KTBA 4NXSA 4A3HA 3N12A 4PMXA 2F1AA 4FNQA 4W5UA 1E71M 3D3AA 4QP0A 5CXPA 2X09A 4MNJA 3TV8A 3WFLA 1V3MA 2WBKA 2CITA 3BAKA 4LYQA 2J8GA 3AHVA 3WKZA 1FHLA 3HJEA 2OSYA 2C8NA 2VZSA 2WC7A 1TVNA 1UD6A 3NIYA 3NYDA 1UZ1A 2WVTA 1GOKA 1NOUA 1KWKA 1I75A 3WDQA 2CIPA 3CZEA 3KEHA 1ISYA 3GXTA 3AIWA 5A6JA 2WVVB 5FD0A 4XUYA 1NWUA 1HTYA 4PRWA 3AISA 3WDJA 1JZ6A 2CBUA 1BYDA 1V02E 4P8VA 2D0FA 2O9RA 4U33A 3BAIA 3DECA 2ESCA 2O9OA 4CD4A 1CXHA 3ZJ8A 2JALA 5IFPA 3SUSA 4D71A 3HU7A 4U31A 1E0XA 1Q6CA 5E0CA 2J7BA 1OB0A 1KCLA 4U3AA 4CU6A 5HPOA 2OWCA 5BWFA 3K4DA 1VEMA 4HOXA 5A2CA 2A3EA 2CKSA 1E3ZA 1HF6A 2XIBA 4KWUA 2ZX7A 2A3CA 3K8MA 1QI3A 1CXKA 1FH7A 3BC9A 1TQWA 2VR4A 1ZJBA 4JHZA 4RE3A 1EQPA 4KH2A 2F7OA 2WWDA 1TA3A 2WBGA 3A24A 3N9KA 3HG2A 1W3LA 1J0JA 1MQRA 1B31A 1CIUA 2V3FA 2WZIA 2OWWA 2ZWZA 2RGLA 4PMDA 4FMVA 3BCDA 4TVCA 3L4WA 3A21A 3CHCA 2XSAA 1GQLA 1QI5A 2FHBA 2D3LA 3TP4A 3UETA 2VZTA 2X2YA 4GZIA 3WUEA 8CGTA 5EMYA 4MNKA 1OCQA 5CPSA 1Q4NX 1GONA 3AIQA 4W5ZA 1JYNA 3IJ8A 2VZUA 4DWSA 2Z1SA 1RP8A 1V3HA 5FKYA 1E55A 3HN3A 4NZJA 1WKYA 4AD1A 3J7HA 3M46A 1UD4A 4BCEA 2JEQA 1HKMA 2W66A 5I5RA 1J9YA 4CD5A 7A3HA 1HJVA 2ZIDA 2X0YA 2XWEA 1KXVA 4HOZA 1UWSA 2YL8A 3VIIA 5I3DA 2JFEX 1WDPA 3VIGA 1ISVA 4FLQA 3AS1A 2Y2WA 4U5KA 2ZXAA 1TR1A 1EDTA 4BQ5A 2J7DA 2C7FA 1RPKA 1BAGA 3OLIA 1RD6A 4LX4A 2J25A 3CHEA 2CERA 1JF6A 1E6NA 1AMYA 3RDKA 3DX2A 3VSVA 1Q6FA 4D1JA 2DT1A 1ESWA 1LWHA 1Q6GA 2X1IA 4P7QA 1UQZA 3WDHA 3MMDA 2EQDA 3AZSA 1FP8A 3KL5A 4QLLA 1HNYA 3MO4A 3WF0A 4BQ2A 1HJQA 1JDAA 2ZXBA 3A4WA 5CGTA 5CPTA 2E4TA 1R33A 3GH5A 3AHYA 3II1A 3U5UA 1JF5A 2OLHA 2WVSA 5BYWA 1JDCA 5HXMA 1LL6A 5E09A 4D6HA 3EMCA 1CEOA 3SCWA 1GOQA 3VPLA 3WQ6A 3GXNA 4D72A 4V27A 5BXTA 3WQ8A 4PSPA 4QLKA 1VFMA 5IFTA 3VOCA 4HPHA 1EXPA 1K6AA 1W3HA 1BGGA 5ABFA 3H54A 1UD2A 3WNLA 1QX1A 3ARRA 4ZE5A 4WK9A 4D6DA 2XM2A 5D9OA 2WCGA 3AHZA 1U2YA 2WCSA 2ZX9A 3PN8A 3O9NA 1UKQA 1HL9A 3O6AA 6CGTA 4JCLA 5ABEA 4CCCA 2B31A 2W92A 2JF6A 4PN2A 3WEMA 1JI1A 1EHAA 3WDIA 2PF0A 4ZEPA 2VCAA 2WM0A 3WH5A 4AXNA 4BF7A 4RE2A 2XVLA 2QPSA 2J7HA 4F9DA 4UFIA 4HZ6A 1WE5A 3RMEA 1MXGA 3NCOA 4Z2IA 1V3JA 3ARUA 2VZVA 4ACYA 4KRTA 1NARA 4M1RA 3W27A 1X1NA 5BXPA 3AMKA 3AXIA 1G9HA 1C3FA 1W9DM 3G6MA 1W2PA 2Y24A 4P8WA 4MJ4A 4MB1A 4AIEA 4ACZA 4CD7A 2DH2A 5E70A 1QHPA 2GK1B 3CUFA 2ZOXA 3U7BA 2DIJA 3WIJA 3S5ZA 4JKMA 3OLEA 1PX3A 3AROA 2VC9A 4NRSA 5E6ZA 4FK9A 5E9AA 5A8PA 3LX9A 5CQ1A 4KRUA 3VD9A 1BLIA 2WC3A 1FH9A 5CSYA 3PZIA 3VU2A 4UFLA 5I24A 3L4TA 3CZNA 3UERA 3D5HA 3LPFA 1MW2A 3K8KA 2D22A 1GQIA 1OIMA 2CHOA 4Y7EA 4ZXLA 3F5KA 1X6NA 5DO8A 2YBUA 4S3JA 1O7AA 4AIUA 3N18A 1UR9A 2XPKA 2XFFA 4AMCA 4W86A 5GQBA 5BROA 2DIEA 2NT0A 2VO5A 2VI0A 1W1TA 4CN1A 4R5EA 4ZE4A 1H11A 1UYQA 5A8MA 3CH9A 3WH8A 4UNIA 4AZ5A 2X2HA 3ARQA 4MNMA 1B3XA 4D6CA 3I3DA 5AYBA 2IXVA 3VNZA 4OJYA 2CYGA 4CN6A 1V6YA 3BLBA 1R87A 2W63A 3CZLA 1X6LA 3I3EA 4JKKA 1VFUA 3HMCA 4W88A 3RCNA 1QNSA 5EB8A 1CGVA 1ZS2A 1TQSA 1WZKA 4LYRA 3AIRA 2GJXA 3BAJA 2WPGA 2Y5EA 4BS0A 2DSKA 5HNNA 1CPUA 4H04A 4UFKA 3UEQA 3E1F1 1VBUA 4WKAA 1MW1A 1CWYA 2PBGA 3WNNA 3PZVA 2QMKA 2VUYA 4ZFMA 3WNMA 3B9EA 5FL0A 3ZSSA 3VIFA 4B15A 2YOCA 4Z2GA 4GPNA 2DSVA 4JFVA 3WQWA 1LQ0A 1BVZA 1XD0A 2XM1A 4PUEA 4ZENA 1B3WA 2BS9A 5I79A 7CGTA 2BVDA 1OINA 2YDQA 1VJSA 3EJPA 3PHAA 4HU8A 4PTWA 2WWCA 3SCPA 4UZSA 4Z2KA 2YBTA 3KWXA 1G01A 4DUXA 3AI0A 1JZ2A 3QOMA 4B16A 3DX1A 2IGTA 3WD4A 2ZUVA 4OOZA 1UOKA 1WP6A 1QWUA 2NW0A 4A4AA 2Q8XA 3DDGA 2J75A 3N13A 4BZYA 3ZR5A 1UZ4A 3ARSA 4BA0A 3WY2A 2VX4A 3VGEA 3POCA 1JAEA 3AMGA 3GXPA 2XVPA 3RO8A 2W61A 2OYLA 3WUFA 3TONA 4NI3A 1JNEA 1CGWA 5CGMA 3ZJ7A 1RH9A 3ZJ6A 3VMOA 4YHEA 5E6YA 4TVUA 3QGVA 2F7QA 2DSWA 1W1YA 3AXXA 2EEXA 4MADA 3ZQ9A 3AMDA 3RM9A 1OIFA 3ZIZA 2VCBA 1BYCA 2ZUSA 3IGUA 3F4VA 1LJYA 4QCEA 1EOKA 2Z1KA 1LLOA 3GXFA 2VX7A 2BHZA 4GZEA 1ECEA 5A6BA 1EA9C 3ZT6A 4GO8A 4YPJA 3THDA 4W85A 1GQJA 1FHDA 1UD8A 4MJ2A 3PZUA 2J8FA 2PWFA 2DT2A 5C8BB 1UD5A 3GTNA 1B90A 2VL4A 3CHDA 2EPNA 4TXEA 2J4GA 1YHTA 1E0WA 2X05A 3VD4A 1QVBA 2EJ1A 4U3CA 3MUY1 2G4FA 2QV4A 1HVQA 3W29A 3WD0A 4ML4A 1E6SM 4J3UA 3WQVA 3DDFA 1TQVA 2VQTA 3WF2A 1XYZA 1E3XA 3RM8A 1DWFM 5A6SA 3ARVA 1XH0A 3VIOA 1RP9A 2HVMA 3KL0A 4V2XA 3L2MA 3BUIA 1DP0A 2E3ZA 4TUFA 2YFOA 2Y8KA 1EQCA 1JAKA 3K46A 4M29A 4URIA 3WD2A 4Q22A 3GH7A 2G3NA 1H49A 1SMDA 5FL1A 1HL8A 1ITCA 2V5CA 1KQZA 3M7SA 4GI8A 1AVAA 1C8QA 2IUZA 2E0PA 2G3JA 1CBGA 4W8BA 1V3KA 3GM8A 1TCMA 2G3IA 3WF3A 1TQTA 4AD4A 4QLJA 1V6WA 3OLGA 1W2VA 1E4LA 1PBGA 2DGAA 4OBSA 4X0NA 5HDRA 1QHOA 3SCSA 3HZ3A 2XUCA 3BVTA 3EMZA 2WZHA 3SUUA 4AW7A 3WDPP 5I2UA 4MPKA 1U33A 1YQ2A 2PBOA 1GVIA 8A3HA 1KGUA 4LGXA 4GI6A 2GJPA 4PUDA 3L4XA 1XD1A 2E8ZA 1EO5A 2BXZA 3OA5A 1TA3B 4PMYA 2WHJA 2VURA 4TTGA 3A3HA 1E6ZA 5CJ5A 1JIBA 1BYAA 4IPNB 3PTKA 5A8OA 3VX1A 1EHNA 1QWNA 1FOBA 2CEQA 4XZWA 4IM4A 4PMZA 1H0IA 4UQCA 2FDMA 3VIHA 2WXDM 3AIEA 4J3VA 1MXDA 3RJXA 2WKGA 4CD6A 2BY0A 3DHPA 4W89A 4H8UA 2UY5A 1C7SA 2YKKA 1VFOA 1QW8A 3BVXA 4JFUA 2J77A 1OWQA 1R7AA 4B9YA 3S6TA 3N04A 1S46A 1KTCA 3DC0A 3T09A 2DEPA 4DWSB 3WELA 1IZJA 1WCGA 4X9YA 1PEZA 5I78A 1ZU8A 1GJWA 2AAAA 1ISZA 2F2HA 4N0RA 1ZL1A 3WNOA 1W3KA 4EK7A 1W9VA 5ECUA 1UQYA 3CGTA 1C92A 4UFHA 4HOWA 2DSUA 1DHKA 3S2CA 2PWHA 1UKOA 3D50A 2UWFA
chains in the Genus database with same CATH superfamily
3EX2A 3TTQA 3JBG7 3OVQA 1WD9A 3BGMA 1BVWA 1HJWA 4QS6A 1DJYA 3AYRA 1FGVL 4YSCA 3L5WA 3O6FC 1U92B 4EVNB 2L7UA 2W0FA 1VYRA 3CVHA 2GDUA 2OSWA 3AIBA 4KKRA 4OZGE 1ZTVA 1GYVA 5AHMA 4QIRA 3S37H 4KJWD 4Q8QA 3MUJA 3SR7A 1DQQB 1F5ZA 2DKMA 4HCHA 2F7RA 3WHXA 4U4BA 3VUPA 4AY1A 2Z7ZA 4WZHA 3V0TA 3EFDL 5H8UA 4HF5H 1TQUA 3UR2A 1NIAA 4YHKH 3BGAA 2J78A 2MTAA 2Q7AA 1M41A 1YRKA 4OIFA 4W8LA 1NTDA 1GIGL 3X1FA 5AC4A 1HKIA 4OFYA 3GE7A 5A3HA 5GGTA 1PPIA 5DZPA 5AHNA 1W15A 5LGZA 3PBWA 4UNKA 3GO1L 3MACL 4Y89A 4FNTA 3S5NA 4AGMA 2WV3A 3LRHA 4JKWA 4PRRA 4CU7A 5A6IA 4RZ5A 1TZGL 3D39A 4QF1A 5AC5A 2J4WH 2Q2LA 5EC1B 3BG3A 4IQDA 2B7OA 4AC1X 5T1KB 1P4BH 1W3TA 2GUBA 1PZ5A 4IHCA 4XP5H 1NBVL 1CGUA 3TWYA 3BPNC 4G7FA 1CICB 1YAIA 1RZFL 4AMKL 3DJSA 4NN5C 4PGCA 4M6MH 3WHE0 1MJ7H 3L5HA 4AI7A 4Z1BA 2AXFA 3N43B 4XB3A 1UG6A 3DMMB 2BODX 4NM4L 1XF3B 5D96C 1V0MA 3O05A 4LPUA 4NAQA 1FFNA 5K39A 4DP5X 1VJZA 3PQYB 3D2UB 5AAMC 3LXUX 2EIEA 1FO0B 2ZXWB 3P8IA 4MB5A 3MRQB 5LNDA 3CM4A 1I9EA 3CVIH 2VDLB 2FL5A 3ZHFA 4TX6A 2R94A 5HQMA 2WBJD 4NQQA 1ZZMA 3HJZA 4E8CA 1GPOL 1O1HA 2DTSA 1E1EA 5FA4A 1A7OH 2G3XA 4XVJH 2Y9RT 4DYKA 1EFZA 4G6JL 1SFDA 1TPDA 1ONQB 4JXCA 4TLSA 3DUHA 4AYID 5BNXD 5I5JA 4ONHB 3CE1A 3L3KA 1VPQA 3B83A 5CPNA 3FCUB 3KOZA 3VQ1C 4JZOA 2P3ZA 5KVFL 3C6LD 3Q4DA 2V5DA 1HHGA 4XBSA 2JCCB 4YDJA 2BFVH 1LO4L 2XTJB 2V6HA 4Q7NA 5HDBB 2BVQA 3ARGD 3LKQA 4HCLA 4N0FA 1G5AA 1MCWW 2WSPA 2DWSA 1ADOA 1IUZA 4F9JA 2OEKA 5D6DA 8PAZA 1OGTA 5E5UB 2OMAA 1TJHH 5HYJD 2O93L 4PG2C 4LEOA 4GO9A 4UTIA 5J5EA 2Y2YA 2VABB 4JY5H 2G3MA 2RDTA 3TSMA 2YUWA 3MRHA 4HIXH 3UG5A 4KWVA 4L1SA 5MHSD 1XGPA 4EPEC 1LNUA 1NWPA 4FA6A 4MMZB 2BV9A 5C0BD 3P30H 3QEQB 3MBEC 3JUYA 1A47A 1HX0A 2EBNA 4P9MH 2JXMB 4WJ8A 2R2BB 1AI1L 1ZCOA 4Z2LA 3WF1A 2VN6A 3VIMA 3G6DL 1S9KC 3AB0C 1ZCCA 4K3HA 2CBVA 3UZYA 2ENPA 4RUBA 5ESVA 4ENZA 3MLZH 3B2UC 2MPAL 5HAOA 4MAUH 3WS6C 3DZ1A 3D33A 4Z7UA 1QI2A 1MFMA 2EG6A 4Z2HA 4UIOA 1L0PA 3NQCA 3WKYA 4MMYB 2WLIA 2J43A 2W65A 1X7QB 2DLFH 3W9EA 1TPXB 3ATAA 3RL2B 3MRDB 4O4YL 5L6YL 2OULB 3S4SA 4X4YB 3P54A 4GG6E 3GF8A 4ADTA 4DYEA 4FLOA 1AD0B 1EK3A 5J3HC 1PTGA 2K78A 4C6KA 4IBWA 3RFZC 2VMJA 1W5MA 4AD0A 5EDSA 1A7NH 3DX7B 3NJGA 3Q94A 3KZSA 3IU3B 1IC5H 4K3GA 5H2BA 4Y2OA 3DU0A 4IG2A 3FHAA 4B9KC 5HNRA 3VSUA 2ZDSA 4ONVA 5CUSL 2C1HA 3EKLA 1QZ1A 4K3JH 3EGDA 4P48A 5CZ0A 1IGWA 1NBZB 3UXAA 4P23A 2HLEB 4F7EB 5T91A 1OGSA 3Q0HA 4N2DA 2VDGA 1WUFA 2DYSB 3M17A 4FQ2L 5CSUA 1FCVA 4WUKH 5ITBH 5F9WC 1IKOP 5LNEA 1KJMB 1N64L 1MRAA 1JUFA 1JZFA 4NASA 3WQ5A 1X5FA 4JIPA 2I07B 4C59B 1F56A 4WY0A 1IF2A 1FIGH 3NDZA 5XIMA 3OG2A 1JD7A 1G94A 3VXRD 3VNDA 2DQIH 4U6TA 3GHPA 1OZUA 4PTTA 3AHXA 5DRZB 5KVFE 3R7RA 3HQPA 1P0DA 2LHAA 7TAAA 2KPNA 3MJ7B 1EMTL 3VI3F 4AGNA 3F6IA 2YJQA 1HYRC 3HG1A 1OC6A 3EFOB 1IT0A 1JYXA 4HJTA 1GCYA 1HE7A 1S7XA 1JZ8A 5ISZD 3W0WE 4UTAH 3QYMA 4K8RL 4P99A 1RV8A 4EXBA 4YXKH 1BLNA 3OXSA 4EE9A 4JG5A 3WJMA 4DK6A 3WO3B 4L65A 3EG9B 5I6XC 4DJMA 5C07E 4PRHE 2VLKB 3PWGA 3IF1A 2AMUA 4OLUL 3FA4A 3TESA 3IV3A 3QMTA 2PXYA 4YWGH 1DVZA 2QIWA 2CJUL 2VZ1A 2E47A 4QNPE 4OGYL 4G7RB 3QXVA 2H6PB 4YVUA 2OKMA 1TE6A 5IBTL 1AKJD 1LF1A 3N2JA 2YPLE 1DVQA 3ETBF 1I7TB 4NO0D 4E5XG 3CFKA 3N6JA 4FLSA 4XV0A 1TUPA 4X6FA 2J1YA 3O11B 5DZLA 5CBIA 2EUVA 4O2EB 2RQEA 3W00A 1TV5A 2AOSA 3VMPA 2Y0SA 4MCZB 3APMA 5U7SA 4QNWA 4IMLA 3OF6D 4GUGA 2EABA 1A6ZA 3RPKA 3UZEC 3QIBC 3SBWA 5EU7C 1FJ1B 4QGCA 1DQVA 2V2WA 4N5UA 1H7OA 5FECB 4AZ7A 3R6IA 1QFWI 3E2HC 4BQ6A 3K74B 1FYHB 1UH4A 5KSBE 4EAMA 3P6LA 3NQDA 5IG7A 2PWUA 1KACB 4TMBA 4W87A 1J10A 1MRFL 2XHNA 1CECA 4RH4A 2EHHA 2YD8A 4X4ME 1VF8A 4FXRA 2FO1A 3SE8H 4FADA 5D8JL 4MDOA 1MZHA 2VXNA 5SV3A 2ITCB 1ZENA 1HJUA 3KPSD 4QAMB 5I6LA 3LEVL 4XT1C 2QVMA 1I7RB 4CSPA 3VABA 3IEAA 2WTOA 3PRZA 2QR0B 1LORA 2XDHA 2P5EA 3P4LA 3BZJA 4A3YA 4K15A 4FX5A 4A2RA 15C8L 1KLFA 2CLFA 4KMTL 4YUEL 2HPIA 5CGYC 1AH1A 1JCXA 3NMEA 1AG6A 1FKXA 4YFLF 2N56A 3OBKA 4LXFA 5K5YA 3D25B 1U93B 5B21A 3VC5A 4ENEC 3M1BA 4JDZB 4Q4EA 4PY7B 4U6XA 5EBWB 3BZFB 5I07A 1T2QH 1DQWA 5CCZA 3QDJD 2IXQB 2H8XA 5LA2A 3RNKB 4DH2A 4TNWK 4GEJA 1TMQA 4XMUA 4WI9A 1OPGH 1J8SA 3IDIA 1D5XB 3ARED 4OH2A 4TOQA 4RBPH 3GY1A 2QT3A 1X7SA 3OODA 5FUOH 5JHLA 3C8KB 2YL5A 3BP5A 2DQEH 3TQ0A 4GWEA 4IS6A 3GDMA 2HLFD 1MCOH 1XGQA 3DYMA 3A3WA 1KV7A 4N68A 5I1AB 5E8NB 4LJ3A 3DX5A 1S7RA 3NJJA 2BB0A 5KS9B 1JV2A 2CZ5A 3EB4A 3UC2A 2PYFB 1NQBA 3O9WA 4UQ2A 4B41A 1NAMH 4XAWL 3FTXA 2VXSH 2GSIA 4GKTA 3KPRA 2C26A 5ADOH 2OYKA 4CMMB 1ZWIA 2FYYB 2HJKB 3TWCH 1LT8A 1P0NA 5K9XA 1DQDL 2CBIA 1UWRA 3O2WH 4L3CA 4J2PA 2YIHA 2EXYC 4R9XA 4Z7WB 3G1DA 2H6OA 1LL7A 2HFEB 3PM6A 3IDJB 5CZXD 5EY5A 1IQDA 5JW3H 3C2RA 2HG5A 4G8IA 3WIFB 3IXTB 3GWJA 2CPUA 3ES6A 1A5KC 2OX5B 4NXSA 3T6CA 4FQXD 2PMZA 5FW8A 3RY5A 4M93C 2FEJA 4PREB 4A3UA 2OSYA 1P53A 4Y9MA 3G6AA 1UZ1A 3MSPA 3W76A 1X44A 2GEEA 3ULVH 5LNRA 1NWUA 3BW4A 3APNA 1BYDA 4IIDA 1G7IB 2C71A 2VDPB 3ULSA 2J7BA 4CU6A 2IWKA 2Y36H 2A3EA 4FEZA 3EOLA 4R0LC 4C4BA 2XG5B 3FBKA 4WEUD 4FOJA 5DU7A 1R5VA 4HJJH 2EYTB 3C5XA 4HD9A 2UWEB 3US9A 5E9NA 1FZJB 1S8DA 2R56L 1YG9A 3NIDB 5J8OA 1TPC1 4DQOL 4DPQA 3A4FA 3TP4A 3UTSB 3ITCA 1T4WA 3W73A 5AZUA 1Z3GH 1JK8B 5BV7L 3D3VB 3EOBA 1INDH 1Z42A 5XINA 2BSTA 3WK1A 5DRNA 5D7KE 3SE3A 4YSQA 1YPZE 4B2DD 4Z0XA 5MP6L 2VSKB 5KVGH 3VIIA 2FECI 1WXZA 2QV2A 4G42A 2Y7DA 1EDTA 5AOJA 1BAGA 5KYUB 1WX0A 4LBSA 3O6FB 4DPPA 2AP2A 1DJQA 2DT1A 3BFQG 1MQKH 3RWHB 4P7QA 3RY6C 2YPVA 1ZS8A 3UF9A 4JY4B 1NUDA 3OKLA 2G60H 1YNKH 1ETA1 2D4FA 5E2JA 4HIEA 5IMOA 5TJWK 1ACZA 2H3BA 5IMMB 4GW1B 3KLAA 2OLHA 4KAQH 2ZADA 4NLHA 3TQPA 4I9TA 1FWSA 2CUMA 5GSRA 1GOQA 1L7TL 4XO7A 4D72A 3WQ8A 2MNUA 4QLKA 3AY4C 3EOTL 2AFNA 1A2YB 2J6EH 3IJYA 4G5ZH 2VKXA 3B5GA 1OHQA 3AACA 5E93A 3DJZA 5CWSA 1R5YA 3W1TA 3ECBB 4F1ZA 4DJFD 4DKAA 3Q2VA 5BMWA 5L7XL 3FSOA 1T3FB 4YXHH 2K6YA 3S2AA 2A4EA 4OZFG 1KMGA 1SJXA 4HFUH 2RHEA 4PG9B 4GW4B 5KTEH 4PJFE 5J6GB 3WH5A 2WKOA 4BF7A 2AJ3A 3NBNA 2X6MA 3NIFB 1KV5A 3GMQB 2GGEA 1N0LA 3L08A 4ATTA 5FKAA 4Q6IC 1OGPA 4Z2IA 1P7QA 3ABQA 4ACYA 2VDML 1SGKA 2VB5A 4LSUL 4QTFA 3RWEA 1U4EA 4CQDA 1S5VA 4JM4L 1W9DM 3UYRL 4OSUL 4MJ4A 1KRBC 5T8IA 4ACZA 3KCJA 4LLVB 4A6YA 1WFMA 5CBAB 1ZLVH 5HYSG 4DO7A 3U0TB 4JN2A 4FK9A 3KPQB 5DJXB 3VD9A 3R94A 1RZGA 1JNNH 4ZPTB 3DDMA 1QASA 4P5TB 4HX1B 5D96B 3R1GL 3UZXA 3UERA 4L4LA 3DPBA 2D22A 3V0SA 1BDYA 5JIQA 1G6RH 3CO8A 2CALA 5HWJA 4OFYD 2Y70A 4QGTA 2TRSA 1LQSR 1UYQA 1ND0A 5AW8B 5GJSL 3FCGA 4BBWA 5I1DA 2X2HA 3ILEA 4YE4H 3CDZA 3VNZA 1EBPA 2Z8WC 1XKYA 3KS0H 3FU9A 2IKIA 4HSCX 3NPXA 1M2VA 3GSWB 2X4NA 2JGYA 3NNTA 4W6WB 1HILB 1KC5L 4H04A 4QRTA 4G7EB 4HGMA 5B8CB 1QFEA 4MA3B 4LU0A 2PBGA 2H2SD 3OHIA 3CX5K 4QTHA 4Z2GA 3WU1A 1LTDA 3U1SH 3KPOB 1TZ8A 1BWVA 2OMVB 2B77A 3CN2A 4NCDA 3PL6C 3ZXWA 1UYWL 4XBGB 3WD4A 1J5SA 2Y5TB 3PDDA 2M83A 1TOXA 3WLBA 3RX7A 3ETBJ 5HSFA 3IPEA 1AHKA 4FG6D 5B38B 2I9TB 1S7SA 3MRGA 3JWDH 2B9BA 2Y88A 4HS3A 2TSBA 4NZ1A 3T77A 1T96A 1RH9A 3WV0A 2JKEA 4H13C 2YXFA 2AC0A 1AL7A 4AYDC 5B3JE 1RZIA 3WUWB 2DM2A 1LLOA 3VOJA 2H3XC 5A6BA 5FJPA 4FYRA 4UIMA 1OK6A 3NYKA 2DM4A 3SYQA 5TE7L 3WFBL 3SI9A 3KCLA 4GBUA 1B90A 1CT8B 2HUHA 3DOIA 4QXGL 1Q1JL 3OJ2C 4ML4A 4XN4A 5LGHL 4JQ1A 4J1OA 3REWA 2PDIA 2BNQD 3P5ZA 3QAZC 5JUEL 4JM2C 2BIHA 4GSUA 3HE6D 4MJJA 4S1QH 3MOAL 3UC0H 5FEPA 3U9PH 3UMTA 4LT7A 5BO1H 3QVQA 4H1ZA 5K59E 1MQ8A 1CLOL 1AH3A 5HDQH 1YBQB 2X70A 2RJGA 5GZNA 1W2VA 4I6KA 4CQ9A 3IFOB 1XUUA 4K2UL 5I3HA 5HGBA 2IFGA 4H7ZA 1OF8A 1ADSA 2ISSA 3MT1A 4LVDA 1THCA 2BERA 3TYFA 1QR4A 3ZTJG 3QC6X 4LLDB 3AB0B 4PJAE 2A1WL 5E23A 4O0KA 2LR4A 3BCJA 4AWUA 2PTYA 4WW1A 3CLEH 4PMZA 4ZYKA 4QCIA 1F6YA 5I2IB 2AW2A 5GGRA 1SJEA 1BWKA 4H8UA 3SPVB 2E59A 2Y2TA 3C5SB 1DUZB 3AXLB 3JZYA 2NQ5A 3B6SA 1XLBA 4GAGL 4X6EA 4JIRA 3P4OB 3EYUH 2BMKB 4B5NA 2CK2A 3UZ5A 2A99A 2UXGA 2ZKWA 2BDQA 4LDOB 2WSQA 3HUJB 1W9VA 1OAUL 2FZDA 2DSUA 3ETTA 5F9OL 3N1MC 1HCYA 3JXAA 1HVXA 1C8XA 3S88L 1U83A 3OTTA 3RFZB 3ARYA 5EMMA 4M19A 2Y7MA 2PC4A 3UROR 3MNZB 3NEVA 1MDAA 3VNLA 1INQB 5ECJE 1IAKA 4OZIF 4H1LH 3V6FB 4G80A 3K1GA 4O11A 3M4HA 5D70L 5C0JB 3OPZL 2DBLL 3OQ8A 2F61A 2D03L 7FABH 5AW4B 1BF2A 4ISVA 2PO6D 3MSRA 1YJDC 3U7YH 2YQ3A 1I2PA 2XFXB 3LVEA 1OFAA 3LS4H 4O28A 4KZDL 2WM1A 2G41A 4R7XA 2F08A 4P06A 1IEQA 2NV1A 4ZOAA 1RIUH 4XE5B 3RWIB 4NYLB 5C09E 4NSKB 2X0VA 3W75A 1RK0A 4KVNH 1VKFA 3HZKB 4GUIA 4U1KB 1T6VN 5IIEB 1A5FH 3HS0C 1UWTA 4GD0A 4DVRH 1RHCA 4G83A 4X7SH 1JPKA 1W3JA 3IYLW 4H9XA 1CICC 1YY9C 5JNYB 4UZGA 4NIRA 1ZA6B 3S8FB 3B7RL 4FKEA 4NEHB 1A64A 3BKJL 3LHAA 3TJPA 4JEQA 3F5LA 2YD0A 2QJNA 2OMWB 3SY6A 2CA4A 3GMPB 5KSVA 5JHBA 3DMMC 2YSWA 5ACZB 2D0GA 1IXOA 5TAOA 5RUBA 5I02A 2IMNA 4LOVA 3NDYE 2VKWA 4JFSA 5I6XB 1R7OA 5CC3A 3SGEH 3FN0L 4XP6H 5JO5B 5C0QA 3OZPA 1UM5L 3CZJA 2VDRH 3S8HA 3TWBA 3VK5A 5HVGB 1XMWA 3Q48A 2ENJA 1U8NB 4M1DL 3A47A 3NEXA 4LCWD 3LQAL 4M43L 3EBGA 1BTCA 4YZFF 5CLXA 4WEEA 4YO0B 43C9A 4AZGA 3STBA 4DWSD 3RRXA 4JFFE 3QW9A 1KPUA 4XZIA 2R1WA 2DLGA 1PFOA 5HNUA 1IEAB 4UMSA 3QDGA 3Q37A 4MA8H 4LAQH 2FHCA 3C5ZA 1JFHA 4XPGH 2L8AA 2DZPA 4YN3A 3LQMA 1PWMA 1YEKL 2XVGA 2EAEA 4XMXA 4OECA 2IPWA 3SD2A 3QIBB 1UMLA 3NL3A 3THAA 4LVOB 1VPOL 3AYTA 1EO8L 2P48B 3I65A 3ZLHA 1Z9AA 3KTCA 2QELA 3BVUA 3ZY7A 2EGZA 2IOIA 3SDYH 4R4NC 3RU8H 1OX6A 3QUXA 4Y2WA 4PD4J 3E2HB 3SDXE 4H3DA 3DX0A 4LCIH 4NQEB 4R9OA 1U3HA 4GUHA 1XBVA 1L2QA 3FVDA 5FM5M 3NSFA 2OYPA 3DI0A 1QLEL 3LKPA 1KCVL 5L88H 2XTJC 3PPEA 5BRZE 3KPLB 5IJBC 3ALFA 3EB3A 2VDRB 2VC6A 2H1LM 4CW1A 3FCPA 3PWJA 3MNVA 1T04B 3TIMA 4J3SA 2XKUA 3MKVA 4BFEA 1MHEB 1I1YA 1DTNA 2JI3A 1ZT1B 4U7KA 3T6WA 5JHDA 1HG3A 2ZJSL 2WSDA 5EFDA 3VD5A 4ASTA 2QFRA 2VDQL 3FQ1A 3HLAA 4PMOA 3MLTA 4LCRA 3ORJA 5C55A 4IBTA 1SYTA 5FA3A 5IOKA 3WFHA 3VFWA 2YK1H 4TPRL 3HLKA 1UCBL 3JVAA 1QA9B 3FFDA 3DENA 3CQIA 5HHME 3L4UA 5I71B 1XRVA 2VXVH 4XHJD 1MQPA 4MA7L 4MMZC 3TASA 4NDMB 4IU3A 3NPSC 4BI6A 1AJ7H 1PKMA 4OJAA 2D3NA 4HS8L 1XRTA 1SR0A 4BH7B 4FFVC 1CB2A 2XGZA 1THAA 4HMDA 3WY3A 2ARWA 2L0DA 2X2GA 3JU2A 1ZA3A 3NIGB 4HZ1A 3IDXH 2QCNA 2YB1A 2NZLA 4LQFL 2OMZB 4WWID 1E7UA 1H6UA 2Z8RA 1E56A 5HJ3A 1C7TA 2OQYA 3QFJD 1WFNA 3FU0A 3MV7A 1FH5L 5ETUA 2CO4A 4LDEB 4PJEE 4UOZA 1ZJAA 1IFHH 2GUOB 1U8OA 3LI0A 4GOAA 4XMKH 1VEOA 4RFEB 2G75A 1CK0L 3PY2A 2GIXA 2W81C 4GX8A 2QDWA 2ZWNA 4KI5D 1CX9A 5LWYL 4RIRA 4EI6B 3E6FB 1VESA 1A4AA 5FESA 1QSEA 1UP2A 1KM2A 3FCSB 4US5D 1KM0A 4ZTPL 1QBBA 2FR4B 1L9WA 2PU0A 5A8QA 4RNRB 3LPPA 4JFQA 1CGTA 1U3ZA 1OSPL 4PRIB 1KCUL 4X9IA 4ZZ9A 1D7FA 1C93A 1Q6QA 4IOTA 2VP8A 4FQ1H 4U3SA 1J5OL 2PB1A 4I48B 3BSGA 1T5KA 1UGNA 4JFOA 4OKVA 4WKZA 5EC2B 4X6DA 4OV4A 4JPKH 3OYZA 3N6HA 4B3LA 3GS0A 12E8L 1TV7A 3QFWA 3US1A 4M93B 2PURA 3T55A 3TR9A 3ZKMC 4XCYA 1QRNB 1P7HL 3T2NL 1F4XL 5I09A 4M4RA 4F8XA 3WX7A 4R84A 4O1AA 2PDFA 4NM4H 4ZFOB 4G6MH 4FGMA 3E0WA 2F19L 4HSNA 4GKLA 4I3SH 5LGJA 4L18A 1UJPA 5A6LA 3T4CA 4N5EC 1XIDA 1S5NA 3BLKA 4AEHH 3U6WA 3NQ6A 2Y3NA 3TNBA 3BWAA 4TTDD 4PJ7E 4XE0A 1PFCA 2VD8A 2BY1A 3V95A 4R0LB 4TUOA 4EDXA 3REQB 4WJXA 4TQEL 2F53E 4L61A 1TPH1 3MI3A 4AEFA 2YSTA 4E5XB 4PMNA 2ZXDA 4D6JA 1J86A 4JRFA 4DGIH 2ZUWA 1QKZH 1QLRB 1OD0A 1F3RB 3H6JA 3E3QE 2WJZA 4IFKB 2W07B 4DP2X 3C5JA 1KXQA 4EKJA 1NMAH 3MUXA 4Q7IA 1BHGA 1EFQA 2K6WA 5EOTB 3BAXA 3BXWA 3TBVB 3OYXA 8XIAA 2E6DA 2ESVB 4OZ4B 2H41A 2CM6A 3Q2LA 1PTDA 5DSCB 3LIZH 5F7KC 1K5NA 1TSIA 1TPWA 5ESQA 3ZR4A 3T4YB 2P45B 3AO0A 2WLNA 3U1PA 1U36A 2A6JB 4Y9GA 3OKOA 4E9QA 2Z2UA 4DUWA 5I30L 3MLWH 4APQB 4MDIB 3HRZA 1Z7JA 5FOBA 4LH8A 2JTDA 2OPJA 3C2VA 1EDGA 2A77H 1OGAE 1NQ6A 2GJJA 4FTVA 4WKXA 2DF3A 2RDWA 2JBMA 4JTKA 3G04A 5AW0B 4XNQA 1Q6EA 2XA8L 1ITXA 3GYEA 3P3SA 2J72A 1ID2A 3W7CA 2CKBL 5EPMB 3PJNA 2Z7WA 4G6FB 3F12B 5CR8A 1TFHA 2AQ1A 2E74C 2PNDA 3RJYA 2NNAA 3GR8A 4QG6A 3W39B 3K2UL 3QQ3B 4U6VL 3BX7C 1I8JA 1R38A 4CVZA 1E2VA 2N3JA 4JZNA 1JUEA 3ANVA 2GSHA 4CC4C 1XGUA 4IP5A 4V15A 2QJGA 2Y07L 1JPTL 4L0ZA 1IEVA 3Q7JA 1FZOB 4YSDA 1EJ6A 2UV8G 1MLBA 4JN1L 1GTNA 3GSNL 4QHKJ 1NWTA 3UJFA 4TVPD 1TWWA 2YD4A 2WMIB 1Q0XH 4KWOA 2CO1A 4Q6IB 1G7PB 2NY1D 3ULUH 2Y7EA 4JX5A 2X7LA 2UUDH 1RCXB 2V4LA 2OJEB 1J8RA 1JPHA 5BCAA 2X4UA 1G84A 1FNSL 3MV01 1N3NA 3PP4L 2V2HA 1DLHA 4J6RH 4HZ8A 3F7YA 4MKNA 5IB4B 4X5XA 1LEGA 3FH7A 1AD1A 4UTBA 1IWAA 2VIRB 3IUIA 5I26A 3TBSB 1SXSA 3V4PL 5HANA 1R3HA 3OB0H 4G8FB 2O4MA 3MOBL 3EH1A 1PAZA 1YMHB 3PZGA 4ONFL 4FI8A 1U22A 2DQ6A 4O1FA 3B8DA 4GK8A 3CG8A 3SN0A 1LWJA 1FAIH 4MAVA 5D2TA 2CO3A 5C0AE 3KRUA 1PDZA 1UHVA 2GT9A 4GBDA 1G1YA 3LYRA 4ETYA 4ILSA 1A7PL 3QC3A 2D1ZA 3ICJA 4UAOC 4RL3A 1OYBA 3RLHA 1ALDA 3NVTA 3SZ6A 4JW3A 4GH1A 2N01B 3TFBA 1H3UA 1WAWA 3HHSB 3MFFB 2J62A 1J8HB 1HHHA 2VM8A 4JQAA 1FBIH 3WMSA 1KB5A 4JO1H 5C0GA 3R8QA 1C5CL 2ZP0T 1ZXKA 5GISL 1I9RH 2YC1B 1ED3A 3EYVB 2PMQA 3LMYA 4HCGA 3GBEA 3UG3A 1TPFA 1DDTA 2BP0B 1GW1A 5JUVA 3C2AH 2I5GA 1QNZH 1EQWA 1OB1B 5E5MB 4YFLI 2BCKA 1HNFA 5T33L 1F3WA 1ADWA 4ZAKD 1U8QA 1D9KD 2FVNA 1LEIA 4L8DB 1M71A 1FP9A 2GBVA 2O4EA 3LNGA 1UPMB 2GWGA 5AHIA 4MD0A 1V54B 2NUTB 1RUQH 2REQA 3PCYA 4J3ZA 3QW3A 2D73A 2WXKA 3EO9L 1KZQA 3HNVH 1FYTA 1A66A 2O56A 2VEPA 3V7MA 3GB7A 1T1YB 3G3DA 4PM1A 3SYCA 3FTWA 2IKGA 4U1HA 4HIIA 2J1WA 3ESVF 4L4VD 3ARDD 2PKDA 3KHQA 3QAZB 2QQNL 4JM2B 4OZFH 4FNLH 3MLUL 2HWZH 3WDQA 3QS3A 3T65A 1DSFL 4JFDA 1VZGA 1M9WA 3WFCL 1IIIA 1Q0EA 4PCYA 3KBEA 4U33A 3P93A 1ACYL 5L9FA 1IL1A 1C5DA 3HVNA 1CXHA 4WHCA 3ITVA 1GGOA 4J1UA 3E1ZA 2ZUYA 4HOXA 4XD4A 2J8UF 1RJRA 4GAYA 3SPGA 4RFNC 2Y1HA 3S97C 1SZFA 3P8JA 3D5OF 3W6YA 3BC9A 1ZJBA 4UDTA 4MSWB 2G0WA 3BZGA 2F7OA 4JIQA 3N9KA 2Z6IA 3V4UH 1BFOA 1TSHA 4ZS6C 5JPNA 2R7EB 1XUZA 4IPJA 3PTDA 1GQLA 4JY6A 3SOBL 4M9OA 3KPPA 3D7PA 5HVFB 3S36L 5CO1A 4IRJC 3ULVC 2Q0ZX 3WHE1 4KKLD 4N2YA 1RZ7L 5FKYA 2P49B 1MEWA 4W4OA 1UD4A 3O45B 2X3AA 5E2VH 4P2RB 5HI3C 4Y4HB 4HOZA 3EYFA 3AXMA 1QT1A 4ELDA 4OZFB 1EJ8A 3PSVA 4BGLA 1TVHA 2ZXAA 1T0NA 2XPGB 5GZND 1UATA 1IBHA 1G9EA 1SDAB 1TIUA 1ESWA 3QRHA 1Q1PA 5EOQL 1KYOJ 4NNXA 4UILL 2E4TA 4PVLA 1VBGA 4JRXE 3UEZA 2L4OA 3QNZA 2V7HA 4FQJH 1MRDL 4TMPA 2BSEA 5BYWA 2B0SL 1KFAH 4D8OA 4MZRA 3GO2A 2ARJQ 4L8BA 3U30C 1OY3B 1HQRB 5HYSB 2ICES 3E02A 5DMGD 1BXXA 1HL5A 1WA2X 4FF9A 2VUOA 3HS0B 1ECYA 4Q4KA 4JTEA 1AW1A 1A80A 1AH0A 4TO8A 4NHUB 4L3EB 4Y6GA 3UFYA 2OPCA 1OVDA 5EU6A 4KVCL 2GBTA 2XZ7A 4ZRGA 5GS3A 2QTVA 3LB6D 1HESA 2HT2C 1Q13A 1E6JL 4FZ8L 4W4QA 1IT9L 1LO2H 1WE5A 1FL5B 3Q3GB 3MNWA 1MXGA 3WG7B 4QYAA 1N5AA 3K6NA 4P5TC 2QUUA 3G1RA 2VZVA 2DLIA 4F7TB 2F15A 1AGDB 5FKPB 2WNGA 5I8EA 1RUKL 5AKTA 2CWXA 1J1XH 4F2FA 5H37H 5HY9A 1DBAL 3U7BA 2V9TA 3S5ZA 2PCXA 2E5BA 4ERSL 5FYLL 2YEZB 1EJXC 3NSYA 5FYJH 5FF0A 3N2XA 1TJXA 3FQNB 3U2SA 4LRNH 3ZTJH 3MJ9A 3CMFA 3L3JA 3BH9B 3K2KA 4PUNA 1F18A 5B8CC 5FO8A 4DJDA 3QFGA 3W83A 1K7EA 2BW4A 1IGFL 1E65A 1JHKH 5GSVB 2JQZA 4H1LG 3E6EA 5E99L 7PAZA 4MS8D 3U0WH 3KBVA 4ECLA 2W63A 3VWJA 4JTDA 2BMBA 3QWNA 1HKWA 3EO0A 3MO1A 3UWQA 4NKDB 2KZHA 2PE4A 3BAJA 3QDHA 4OZHB 1OSYA 3GSRB 4FMFA 1IGSA 5G1YA 4UFKA 1AZNA 5IOPB 4JN8A 1I1AA 1U8MA 3TU9A 1CFBA 4Y0GA 3B9EA 3CAWA 3CAVA 3WFDH 1CMOA 2DSVA 1XG4A 2NLJA 5KZMA 1BVZA 4IFRA 5FAGA 5DRCA 3INUH 2A0LC 2NTFB 1QO2A 3DK0A 5IEHA 5JW4N 4Z3HA 3IIZA 3X3GL 1QWUA 3W7QA 4IBQA 2YGYA 2C79A 2PDPA 1UC6A 3FCBA 1KJVB 3EOAA 3U46A 1QO5A 4D0CB 1UM6H 2FX7H 1XWVA 2QVKA 3DROB 2OYLA 2NUPB 5EBLA 3JWOL 1ULVA 3VFRA 5FLVA 4HKXA 5DDHB 1SJMA 4A3RA 4RSYA 3M6YA 2H1XA 2D7OA 1FL6B 2B0MA 3ZIZA 5CGBA 2QSTA 1A5MC 3QZWA 1KFJA 4IIZA 1S7WB 3RJDA 4QGYA 4BELD 4NGHL 1BEUA 3DXAE 4OFPA 5FAJA 1KA9F 3P1VA 1AQDB 3RY4A 3N6YA 1E0WA 2DYRB 3KBWA 4PWKA 5INDA 3WD0A 3TIEB 1E6SM 5KZCB 3QO0A 3MC0A 5CU5A 5IV2A 1W1A1 4OB5L 2HRGA 5I76B 2AEPH 3DOSB 4HS6A 3H8AA 3NPSB 4LT9A 3L2MA 3RP1A 2VR7A 4XTRD 3DG6A 5T3ZD 4Q22A 3GH7A 2FD6L 3UPRB 4XNYL 1FRBA 3K7UA 2H8PA 1KQZA 3JWDC 3M47A 2E0PA 5J5RA 4Y5YA 3UZQB 2R6OA 2PDHA 5CC7A 3XINA 1PBGA 2DGAA 1EXUA 3OG3A 3MZNA 1XTMA 1QHQA 1J4EA 3BVTA 3UG8A 4MZ3A 1NKOA 2BOGX 2ENYA 3CS2A 1U33A 2PBOA 3TYUA 3ATFA 4IBSA 3BW9B 3MRKA 1LLZA 4TTGA 1PVNA 3NJLA 1GHFH 1BYAA 5MENB 3PTKA 1WUEA 5IM51 4R5TA 5G1TA 2EUXA 2QKFA 4HUKB 1K3IA 4G7VL 4MWAA 4XMPH 4BFKA 4ODHH 1Y0LA 3N4FA 3JZ7A 3N04A 5FYLE 4YMPA 1BQSA 3SQSA 2VW6A 3LCIA 1K5WA 4P9HL 3K72A 2HVKA 2P80A 3BOXA 3T8XB 3VOHA 2HKHL 1D2PA 3UPAA 3UGXA 3NZQA 3JWNE 3PBVA 1YYLL 1ROWA 4GIEA 3D9AH 4XAKD 3B3BA 3Q8BA 5B39A 5FS5A 2ZZ6A 2X4OA 3KXFE 5D4IA 1VQTA 1JV5A 1DWIM 1PV8A 1TNNA 5ABTA 3CDGA 4GQ0A 1NEZA 4XRCB 2VFGA 4LSVH 1LQAA 5EUOB 2NYZA 1XRFA 5DD5H 4Q8UA 4NT6A 2YXOA 3NJVA 2QSCL 1GC1L 1D7BA 4LOUC 1EJFA 4BKTC 2FHFA 3UBXI 1G4PA 3ZKQD 3CWGA 3ABSA 4GXVL 2E9GA 2FQGA 4ZW5A 1Z9PA 4P46C 3R4DA 1FVEA 2B7NA 3EDKA 1J5HA 1QNOA 4NPYB 3KPNA 3GNRA 2AK4D 3X14B 1N26A 3ITTA 1B88A 1M03A 1S5MA 1A1NB 5SWSB 1OP5H 1S5HA 2AJYH 5LXXA 4ZTOH 3A4DA 5GIRB 2P8MA 2NUYA 1KTLB 4WIWA 1DDHB 4L8CB 3CFTA 2NSQA 4DAGL 4E8DA 5EA0L 1YNTF 4HGXA 1FTXA 4M6VA 4WKFA 1WFUA 1LDSA 5T8GA 4A8IA 2HMCA 1N18A 2ZNXA 5C0NC 1Q85A 3KS5A 3H9SA 1QCWA 1KKRA 1ZT4A 4KZEL 4P3WA 4OCWL 5J57B 2F6KA 2V5RA 4XCCL 4QWWC 1RULL 4LNVA 2DTMH 4E4PA 4JGUA 4DI9A 4GRLD 4QHKI 6REQB 1S2VA 4EOWL 5D1XA 5LBSA 1YMME 1Y18A 1EIBA 2V33A 2NR6A 4MUZA 1DIOA 2I32A 1QAPA 2GCYB 3R25A 3PZOA 1A4KA 3QCUH 4LBEB 3ZDYB 3Q8FA 5T1KA 3CBWA 3SKJH 2A38A 2Z91B 3IJSB 2QGDA 3NP3A 3DHDA 3IE4A 1NAKH 1RZKL 2JQAA 3PYCA 3MRPB 5KN5B 3TE9A 4LVOC 5J0BA 2Y72A 4OR1A 1DQLH 3KP0A 1KELL 2WB5A 1Z32X 1P7TB 3VFGH 2QL1A 4P5SA 1EJ7L 4R7NB 1YDVA 1EJUC 1FRGH 3I9AA 1P2CA 4E6MA 4ZVJA 4BIKA 1UWGH 1BYNA 3WLJA 3EAUA 4EQ2A 5DBUA 1Q8AA 5CCKH 3FDWA 4YSPA 3B2DC 1GOWA 3VXME 3HHRB 2ZKMX 3NGBC 1R17A 3LU2A 4KMQA 2CDFB 2DMBA 4OAWB 2VUKA 5IY5B 4OOUA 4B3ZA 5DWUL 3GQYA 3AU6A 3NK4A 3IMRA 3EJTA 1NY1A 4UOJA 3M86A 2DMKA 4HPYH 1OSZA 2VISB 2YPIA 4K5NA 1AS7A 3GHUA 4X61A 3MCLH 5HULA 2UX7A 2GUYA 3IMUA 2IV9A 1V0LA 1ZHLA 4WWKD 1E1CA 1UXSA 3ZE1E 5I71C 4HC1A 3AT8A 3N55A 3C2YA 1N70A 5D7JC 1EPVA 3DJTA 4YDVA 1EGMA 3W6MA 4D94A 3QJOA 4LC8A 1ONQA 4R88A 1UR8A 1QBMH 2VN7A 5JHAA 2JI1A 4JTQA 4ZZKA 4D6IA 1IM3A 4IZGA 3PWUB 2ALWA 2D69A 1AGCB 3S88H 5BO0D 4JO3L 3STLB 3ZIYA 2ZG3A 1SHMA 1O6IA 3KVKA 3M0LA 2J7FA 2ENSA 3PPSA 4UC5A 5IHLB 3F7PC 5BOPA 4L4TA 4AD2A 3ZN6A 3MJYA 4MJMA 4U1LB 3ZRSA 3FT9A 3CK0L 3VXUB 1JPST 4BFNA 4IIEA 4UAOB 2O6DA 2WHKA 3LGGA 1T1ZA 4N90D 1JGIA 5ANME 2H32A 3MC5A 4Z08A 4E9SA 3NTCH 4QRRE 3C8DA 1FWNA 4K73A 1SF3A 5GS0D 3WCZA 1SFSA 3W38A 1SN0A 4K6AA 4QHMA 4XZUA 4X4KA 1DSYA 2ORBH 1UXWB 3H42L 1H5BA 3SCRA 4AMXA 2RQ8A 3E8UL 3QJXA 1GGYA 1TZOA 3TYAA 4U10A 2ICCA 4LCSA 5E1QA 3FQRA 5DT1H 1IEXA 4LALA 2POTA 5BS0D 1YW1A 1D6EA 4UT6H 1TZHA 3UJ2A 3ZVVA 4I6VA 5L8LB 5JLZB 1PX8A 2KLTA 4LCCC 2F54E 4LBRA 3CZKA 4QO1A 3T2QA 4N26A 3FN0H 4Y5VA 2FBRA 4WR3A 4OLYL 4Q8BA 2N0KA 3RWCA 3DARA 2FPTA 4LVBA 1X6UA 4HSHA 2WJEA 2PR9A 3D87B 1KM4A 1KBIA 5D9PA 1NAMB 1P6BA 1NDTA 5HHOB 4RGMC 4NN7C 4DSYA 2ZWYA 4U6HA 5DJAA 1CFMA 4L8SB 1WFTA 1IU1A 3DYPA 4IDLA 4DGWC 3TJHC 2OZ4H 4BUHA 3ATEA 2P44B 3H1ZA 3REVA 5E8EB 1ITQA 4XODA 1ICSA 1U8KA 3O0FA 2DYPB 1VENA 4KQ4L 4JL1A 4BV1A 4RFNB 4I3RL 5DJ0A 2CLMA 1UD3A 2NLIA 3B4NA 2PDMA 4QRUA 1CGSL 1NBZA 2HT4D 2XYBA 1NQKA 3QRGL 4GMTH 5FGCE 3SGJA 4YS4A 4AXKA 4QIUA 1DO6A 2P53A 2YL9A 1XCQA 4PUJA 4IFOA 4HN4A 3QPXH 3BAYA 2EYSA 3SGZA 4M5TA 3O41B 2RALA 4IRJB 3RQ3A 2P3EA 2AKRA 2CGRL 3SW6A 1WWWX 3S5OA 1SDDA 4APQC 3GDBA 1PG7W 1IAIH 3MOQA 3TC3A 4K9EH 1OFOA 1RJLB 4UQIM 3U2JA 3R5EA 4FFZH 1YUHB 1KB3A 2PWVA 4MXVF 3QNYA 4NNAA 3R89A 1W72L 1CENA 3EFOA 1UWFA 3DVNA 3QIUA 4ABVA 4MNQA 2C18A 2OKOA 1JDEA 2D7TL 2DQJH 1ZHNB 5CBBA 3OAZK 2XGBA 4P4RA 3T3MB 3I02A 3RWJA 1ONRA 3VFVB 2V5YA 4HIBA 3WI9A 4DF1A 3L6FB 2XRAL 1OJXA 1V27A 5TD4A 3OEXA 5GGVH 5FYJU 3U30B 3UYPB 2EVHA 1E8YA 1Y6MR 1I7UB 2AJSH 4NUJA 4WUUE 1HSAB 1AZZC 4ALAL 1XV8A 3PTMA 3WYZA 4Y5XA 1LUCB 4NB7A 3G9VA 5LAPA 2VN5A 3QEZA 4PR5A 4P7NA 4TNWF 3PWLA 4JX0A 4OD1L 4NHVA 3CVCA 4KROB 1GSMA 3EOEA 4H8QA 4B9FA 3KUMA 3I84A 3RNQA 1PIIA 5LCVA 2NDFA 2O5YH 4MNLA 1OADA 1G7MA 4F79A 4XO9A 4P3DA 4AWEA 4WSKA 4EXQA 4A63A 4PJXA 1F4AA 4AF0A 5D9NA 5D5ME 4Z0BL 2DZAA 4WDIA 3A6CL 1XC6A 2JFCA 1G9NL 4O02L 2J13A 3PABB 3CQQA 4NENA 1OABA 4N9BA 4AVOA 4GKNB 1WGVA 5CEYB 4EZLA 2A3LA 2X0WA 4DF0A 4PCTA 2CHNA 5AOUA 3HTWA 3O8XC 3C2FA 4AFYA 1ML0A 5BRPA 4DESA 3D47A 4NNPL 4KXZH 2GYIA 3GUTA 2R9HC 3D39D 2DJXA 1KCUH 1I1FA 3RVWC 2NQZA 1CBJA 4KTDL 3TM6A 3KDOA 3H24A 1WVZA 1YEDB 2G4EA 5I19H 3W6LA 2Q8AH 2NY0B 3T40A 4KJQC 1HQ4A 2XWCA 2YB4A 3SFWA 2EVIA 1M05B 1JF1A 5CBEA 6FABH 3ZE2E 3H9HB 2AQVA 4IEFB 1OG0A 5EUKB 3QC0A 3ULUC 2ICWA 1M53A 1Q9KA 4C56B 1B3ZA 4QAIA 4OQTL 1WWBX 1UUMA 5DANA 1SY6A 2FRGP 4JDZA 3EA2A 2F19H 2ITDB 3N1QC 1IGYB 2CO6B 2VOTA 5IKCB 2R0ZL 4WFHE 4YSUA 5KSAC 2DQXA 2XJKA 3M1CA 1WF5A 2PP9A 4H8PA 3MRBA 3O0LA 2BIIA 2MH4A 1D5XA 5DWPA 3H7LA 3H2PA 4GQPH 4MJIE 5F96L 4AKPA 1G6RB 1YNLL 2F8XC 3ITXA 1TIWA 1NCDL 5BVPL 1L9OA 2O6PA 1TTQA 4YWIA 2BSSB 2X40A 5KW9L 3FJNA 3GXDA 4HKBA 1KIPB 4JE0A 4PMUA 4UINL 1PYMA 4ATDA 1BYOA 4M51A 4APXA 2YUZA 4WHBA 3LRSA 2Q8ZA 5FHBH 2CH8A 4M6OL 1DWAM 2R69A 4L48A 4PCNA 1SMAA 1NCOA 3RA7L 4I2XE 5IW3A 2Q9OA 3ISIX 4HJWA 5D1QE 4LCYB 3TBBA 5KOVC 1ZLEA 2NCMA 1PEWA 4ELMB 5G4EA 1E71M 2A74A 5H37G 1V3MA 1XF4A 4B0MB 2J8GA 3OTRA 1XZ0B 4AQAB 2C8NA 1HXYB 2OCCB 2WC7A 4QITA 4HH8A 1KM3A 3NYDA 4EBQH 4MMXA 1RY7B 5IBXA 1E3FA 3SO3B 3H7UA 4W9HC 2AEQH 3SPHA 1HTYA 3HGSA 1XPGA 4NNYB 1JWSB 3I50L 3VWKA 3CH1A 5L2JB 3ZK0A 4JFYB 4PB5A 1BP3B 2QNEA 1WKEA 3NCWA 4XZ9A 5HVWA 3P4MB 5DC9B 4MWFB 1TWZA 2F1EA 1FG2B 5F3BB 3RI5K 1QI3A 1QQDA 4D9RD 2WNZA 4K8RC 5JXEA 3HG2A 5C0CA 1QFWL 4Q0XL 3LSBA 2V3FA 4FMVA 3GBNL 3QG6A 4Y4HC 1LRNA 2JSFA 4XOBA 4PGJA 2A73A 4PZVA 3N2BA 3W2NA 4CJ1A 1A6TB 3WUEA 4JIIX 2WJDA 3WG6A 4TQIA 1ZHKA 3U48A 4L9XA 4IK6A 2GTWA 4CDHA 2HSIA 1GVRA 3BKMH 2Y1AA 2Z26A 3GG7A 2FZMA 1WA1X 1E5ZA 4CD5A 2BRRL 3O4LB 5CJQL 5CEZD 1AZBA 4CBPA 2NLYA 1SUJA 1AQFA 3GKWH 5A2JH 3LLFA 1XLKA 5G1MA 4JANB 3K1KC 2UZXA 4JB9H 1JF6A 1E6NA 2NY2C 3RDKA 1O95A 1Q6GA 2PA6A 1P1MA 3ZWSA 5CCGE 3UWZA 5C7ZA 2X4SA 4D8AA 2FEDD 2NXZD 4IKNA 4PJBE 2R1XB 3QIWA 3V0WL 5IVXF 4P46B 3VTAA 1XI3A 1OP3K 3EX6A 2ACUA 3GSVB 4Q56A 1B57A 4ZUUB 2VN3A 1B4EA 4G3YH 3G5XB 3GXNA 4R4BA 4Y8FA 3GS7A 2DQFA 3LV5A 2E6FA 2IS7A 1XICA 2VLLB 3BZDA 4M3HA 3T9PA 4L6HA 4LEBA 4KBPA 4PJ5B 4JY4A 4XN5A 4WK9A 3OWRA 5HTSA 2CLRA 4A7TA 3BGJA 3QY8A 3IJQA 4HPNA 3QEUA 3SQLA 1HL9A 3V36A 4M8VA 1XF1A 4H1LB 4JPVH 3MZTA 1R24A 4GUPA 3AUJA 1B3JA 3GW3A 2QGYA 4RRPM 4S3GA 1ET7A 1N6VA 3G9AB 4P23D 5F2GA 1F45A 2R1PA 5I1CH 5IEKB 3KCPB 1I9JH 2OTUA 4AMAA 4LKCA 1UMYA 3CB8A 2GAZB 3A67L 1QYGL 2N7AA 4KPHL 1O94A 2IJ0C 2Y3AA 3UGEA 5T33H 5D4QA 3Q1SH 4P8WA 4I5UA 3SCMA 1KJ2L 4ZR8A 4LANA 4FFTA 1EDYA 4PG9A 4YDZA 4JKMA 4LHUG 2FBJH 4BFFA 4NRSA 1WIUA 1AXTH 2CU9A 5DVKA 1FH9A 5T5NF 1HHJB 4OZGB 1M42A 2VLRA 3T7VA 4UFLA 3EOOA 3HG1D 4ZUTA 5F1IB 1P4IH 1VRDA 4Y7EA 1W1B1 3VVWA 3BGFC 1X6NA 3UBGA 1FDYA 3V75A 5GQBA 4Z7VF 4ZE4A 2NTSP 3P14A 3GRWA 2PTXA 1VLIA 2KDYA 4QXUL 3VFMB 3TV3L 4A68A 1F58H 3Q5OA 3AGVA 4MJ6B 1X6LA 2PLKA 4JKKA 3X12B 1L9SA 2DZEA 2W9DH 1MAJA 1OKEA 1P1XA 1VERA 4HKZB 4LYRA 2BVOA 3J8F7 1EEZB 2GJXA 4KO5A 3FEMA 2PXYD 3S9ZA 2QMKA 5K9JH 4B15A 2HXAA 5F7LB 4PJGE 2MPVA 2P24B 4IDJL 1KM1A 3NGBB 4Z0JA 1OINA 2YDQA 4B91A 4B5ZA 4RCXA 4IBUA 4PCFA 4WNQB 3TZNA 4B16A 2ZUVA 1BQ5A 2Q8XA 2VQ1B 4AKOA 2W9MA 5DR5H 2FT6A 2W80C 1JAEA 4Q74A 1L3WA 2G0KA 3O81A 4KWSA 4PMEA 2BOLA 4LF1A 3KX6A 1R9XA 3E9TA 3EWWA 3W2JA 2OO0A 4LHQB 5CJNA 1AGFB 5CFHA 2E6JA 2XWJB 1AG1O 3L8QA 1FGVH 5D7JB 3IJDA 5DHYB 1BVLA 5M94B 5B80A 1XT5A 2FECL 2Y22A 4OU3A 1TTGA 3CFMA 5DHVH 2Z65C 3CWNA 2LVEA 3RI5F 2G4FA 4BWUA 3DX8A 4QRPE 1BV8A 2CUHA 1FHUA 4JPSA 4WU7A 3LKOB 3EFDH 2HVMA 3V5CA 4MS6A 4Q4OA 3V5DB 5LDSA 2PRHA 4IQJA 1GG0A 4X6CE 2FIKB 3FT4A 2PDUA 3DUSB 1ITCA 2P5ED 1DVXA 4MKVA 3V0FA 1GIGH 3WIIL 1AQ8A 2XACC 4WI2A 3FB6B 3GUGA 2UY6A 2ZZUT 5HDRA 3SM0A 2GB2A 1R3JB 3ONCA 2W0PA 4PTUA 3GO1H 2OXGB 3MACH 3QISA 1D6VL 2VCOA 4BFGA 3APCA 2GJPA 1TZGH 3FQXA 3L4XA 2E46A 3L5LA 3W22A 2JLPA 5DJ6B 4MJHA 1TG8A 2XY1A 3NJKA 5AVTB 4GS7B 2CEQA 2QUTA 3HAEA 3OOQA 2FB2A 1OAZL 3FV9A 3R8HA 3KLHD 5TH2B 4XKYA 5CAHA 3N42B 4HIHA 4QKXB 1C7SA 1NBVH 1QSFE 2PRLA 4ZFFA 4N8VG 3BJSA 3BVXA 1IM3D 3MBEA 1VLXA 5C6PB 3WE1A 5CIPH 1RZFH 5AOIA 4AMKH 3HPAA 2Y7QA 2VJ0A 4RGNC 5DHVB 4DEFA 1EBHA 2XU9A 4L4TD 4DIXA 4N87A 4NQTA 3FLUA 3AW5A 1Z48A 1GPFA 2CWRA 3US0A 5J6HB 1UURA 5D7SL 3WS6A 3HG5A 3QPQC 4N0CD 4LCCB 1DUZA 3NCYP 2R82A 4DFIA 1GYLA 2E75C 3KZPA 5DS2A 3O9WD 1MCKA 2CLHA 3HE7A 4JJ5A 3QQ4A 3KPRD 1J6PA 1T8XA 5I23A 5CN2A 4A55A 2BP8B 1FCQA 3FUEA 3T8QA 1JHTB 1E40A 3QM3A 4RGMB 5BW6A 4AT6A 4UT9L 5IWLC 4NN7B 3JWNH 4HHAA 3RFZA 4MASA 1TX0A 2CPCA 4YHLL 3VQLA 4GQ9L 2ZZ4A 3LN9A 2WKJA 1UB6A 1GPOH 1NEPA 5LG1A 4UR7A 3V6OE 5AYUL 2EDFA 3BPCB 2FPVA 4X9GA 3UA3A 3O2DL 3BN9C 3SKUD 3GNPA 1P43A 1XB6A 3F6JA 2JMRA 3GVQA 1Q6DA 4G6JH 5A6KA 3D85A 2DJSA 3T0EE 5CIPB 1J9RA 3FO9B 4NRZB 1FNHA 5ADPL 4HH9A 1WBXB 1OWRM 5FK9B 3FT0A 2XBDA 1PLAA 3MBXL 2NZ9D 4NYLA 4NSKA 3MX0B 3RDJA 1LMKA 4DP4X 3S96B 4C1NB 1GTHA 3AZTA 3MV9A 1H50A 3NJMA 5D7IF 1GY2A 5KVFH 1FNLA 3OIHA 3OKNA 1WHOA 4GG6B 1KGWA 3VE0A 1LO4H 1DZBA 3T6XA 1G5GA 3VNMA 2V2TA 4U3XA 3V16A 1TLMA 3UJEA 4JDBA 3UW6A 2PYEA 4XN2A 1ZA6A 4XWOC 4LVHC 4AZIA 4E4UA 3EJSA 5FJRA 3QRBA 2BS71 2VR8A 3MVSA 4HJUA 3TCLA 2Z31C 4HA3A 4AYGA 1FORL 1S78C 4UYPA 1T21B 2PI6A 5IJCC 1UKTA 4LAJH 3QV7A 4BR1A 1J2WA 4LLUA 1A0DA 4BK9A 1OM0A 2VD9A 3R8RA 1Q4WA 1ML1A 1ZLSL 1NM4A 1GEHA 1AQMA 2H45A 2A9ML 3L3DA 2FVLA 1T1WB 2O72A 4H0LC 1AI1H 4EF3A 4PJHE 2PCEA 3DBSA 5C7VA 4FA3A 5AVSB 5EZOL 4YQXL 3G6DH 1HU8A 1UEMA 3LCLA 2XNAB 4OD3L 3WIHL 2NQHA 4RR4A 2WK2A 1L8PA 2MPAH 4RAUB 2J21A 5A94A 3KNBB 3OR7B 2WTPA 1E9OB 4CNIA 3V0EA 5E0FA 1AHWA 2AEOA 1YLVA 3CC5A 2Q01A 3FYYA 3EOUA 3UZEA 4O4YH 3GFUA 5L6YH 5IMLB 3UWUA 4RK8A 4KEZA 1FUNA 4Y1TA 2A85A 2DUZA 4UM9B 1QW9A 1AFSA 1CXIA 4DJEC 2W67A 3UAFA 1J01A 4HK6A 5CSBA 2ATSA 1ZDQA 4RA3A 1XH3B 1SJHA 3O8XB 3NZ8A 1MI5A 3BMXA 4EWND 3DGCR 3PUCA 3GZQA 1MH5B 2XZAL 2WAGA 4JUTA 2F18A 4ZOCA 5CUSH 4G82A 1HWGB 3KVDD 4M82A 3B7SA 1MHEA 3CX5J 1JHLL 1P7QD 4KERA 1NEUA 1WUNT 4FQ2H 3RDTC 1O7DE 1V7AA 1BOYA 4HEPG 2QSCH 1ZRQA 1NH6A 2B2XL 2VWTA 1N64H 4FFWC 2CAKA 3NSDA 4GB9A 3GS6A 2KH2B 4HPOL 4UNTA 4HJEA 4EUPG 4IP7A 3AQXA 2ZRYA 1LP9E 1WT5C 4KKNA 4RGOL 3FK4A 2AJXL 4OFDA 5KSAB 3RL1A 2NY4D 1WHPA 1HL2A 1XSOA 4E8GA 3SUVA 3OMZA 5IB5A 1EMTH 4P2OC 1NFPA 4AZ8B 4X3ZA 3N34A 3IETA 1V6VA 5JMRA 3T78A 3P2VA 2YDRA 4AWTA 2WQPA 4ZO7A 4NS0A 2OT1A 3MRCB 2DB8A 1IGJA 4K8RH 4POZD 5D37A 2H2PD 4ZNEA 3ZYZA 2QZQA 5G4NA 5BZAA 3T1FA 3F4NA 5LB1A 2BM3A 1VFFA 1GKEA 4AYSA 2QADB 2C9AA 5C5YA 2WMPB 2DMCA 4OLUH 1JPIA 4KZEH 4WU5A 3GMLB 2C3VA 2H4EA 1J05A 2MCMA 4KV5E 2DBJA 2CJUH 3HFTA 2IH1B 1CLCA 1XTLA 3VDCA 4OGYH 2I9LB 2BZNA 2IFFL 3NK3A 4I9XA 3E6FA 5DHDA 3FPYA 5IBTH 1EFXA 1WZAA 7ODCA 3U4EA 4L8SC 1UWIA 3FCSA 2ITEA 3FXGA 3U5YA 1DCLA 1T7XA 2DMHA 2W5FA 1AXSA 4J3OH 5IGXL 4AYFB 4ANVA 3RWDB 2WZMA 3EW3B 3DA0A 4MAZA 5K1JA 1NCJA 2CM5A 2ALDA 1IAOA 3EDFA 3FF8A 5FIPA 1A5NC 4PTVA 3SDAA 5A6BD 3UX9B 4S2CA 3WKPA 2CGYA 5DK2A 3CVDA 2JJUA 4N9GB 5J1TC 4XCNB 3QZLA 2XFYA 1KELH 2LAGB 2OS7A 4G6KL 4OLZL 4GAFB 4MKSA 3BZEB 4Y8EA 1EDQA 4C55A 1KXHA 2QEJA 5I7GA 1SPDA 3KRZA 1MRFH