4IMEA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164a mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
molecule tags Lyase
total genus 117
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imeA00
5CPLA 3GLCA 3IGXA 1DKWA 4PC8A 4PL2A 3A9IA 1UUOA 2NX1A 3BGJA 4NNBA 5F4WA 5LGZA 4HN4A 1PS9A 4GJ1A 3FYPA 3G1VA 4UTWA 1FY6A 1NF7A 3W7IA 4O54A 3PB2A 4DF2A 1KTNA 4MLRA 5F1VA 3STCA 3NM3A 3H53A 4NU7A 5DBTA 4BWLC 5J5RA 1TPDA 3IIVA 2QJHA 5J5DA 4R33A 2DZSA 2NUYA 4GUIA 3P82A 4RR4A 4CCEA 4I9AA 2CZ5A 4GWEA 1AL7A 1YPFA 2RDTA 4ZQMA 3SGZA 2AGKA 2Y85A 4PFMA 5KITA 1FWTA 1F05A 1WOBA 5KSWA 2QCHA 1F5ZA 3G3MA 2CW6A 1N55A 1GPWA 2JGYA 3RNDA 3C3NA 2XN0A 3R12A 2ZZ6A 4LS1A 3GDKA 4NXKA 3S1XA 2WKJA 4UTIA 3IRDA 1LOQA 5HULA 2ISWA 3P84A 4O11A 4BF9A 1A5AA 3TDFA 1OFBA 3PM6A 5SWUA 4GUFA 1AW2A 5G2IA 2NX3A 1XDLA 4UTWC 3EB2A 5AHLA 5LSMA 5AHEA 5AHFA 1W37A 3FIGA 4R7JA 2GQ8A 2VFFA 5I3GA 3G22A 1GG0A 2WV8A 4NJGA 1OFPA 4PEKA 4AWTA 3S5ZA 3HJZA 3MYOA 4ORMA 2VENA 3DFNA 2ZQ0A 2NLIA 3EXRA 1GZGA 1OFEA 2I14A 4DXVA 4UTUA 1OF8A 3MHFA 4WY0A 4LV4A 1RPXA 2C6QA 3NQCA 2YSWA 4UUIA 2PE4A 2ISVA 1Z48A 1YPIA 3G1HA 4N9CA 2ZRUA 3N14A 4DF1A 3FOKA 3SY5A 2YW3A 3KRUA 3LHWA 1H62A 1V5XA 3PS7A 2YR1A 3OA3A 1XC4A 2FTPA 1B57A 3CQ0A 3TXZA 2CLMA 4JD4A 4K39A 3KVJA 2PRMA 3HO8A 1R46A 4Y9AA 3B0UX 1DV7A 3NA8A 3PG8A 4YXGA 1SSGA 2V9DA 7TIMA 3P67A 2AQWA 3O07A 5F4XA 1LLWA 2ZA2A 3B04A 3S5NA 4UFLA 3UWZA 1VR6A 5KMYA 4QNEA 3EX3A 3CPRA 3TMQA 2YGYA 2E5DA 5FEWA 1F73A 4PCFA 1LTDA 2H6RA 1H50A 3M47A 1HO4A 2FB2A 4LT9A 1OFQA 4LVDA 1S5VA 3BPWA 3PG9A 4H3DA 5IM51 2ZRVA 4O52A 2I9EA 2QCFA 4O28A 5FEPA 4LV9A 2FJKA 3MW7A 3NG3A 3TXVA 1I2OA 1Z44A 2V30A 3NQMA 4UFIA 2E6DA 3B8DA 2ZTKA 1TO3A 5LKYA 4RZ6A 3B0VC 3TW7A 2W79A 4XTDA 1SUXA 3W75A 2C15A 4O53A 4O13A 1GTEA 1LROA 3W1TA 3CU2A 5AYZA 2QUUA 1Z41A 3M0ZA 1H5YA 1ZY9A 3GR8A 3SI9A 3LOTA 3HGJA 5HNRA 1VHCA 4E38A 3DI0A 4UTLA 4CLMA 3PB0A 4FO4A 4I7VA 3LERA 3W7OA 1H51A 4LC8A 1QMLA 3MO7A 1SZFA 2ZA1A 3WJWA 4XZ9A 3GDTA 2CU0A 5D2TA 3BLFA 1MEIA 3UPBA 4UCGA 3W1UA 3SW6A 3LCFA 2R91A 2A1YA 3C6CA 1HL2A 4LVFA 1DBTA 3S6DA 1XL9A 1ZALA 4LVGA 1GYNA 2NV1A 3CB8A 3UWVA 1RVGA 3G1FA 1DL3A 1RZMA 4IUOA 3NQFA 4ML9A 2F84A 1K03A 4Z1BA 1KM1A 1QPOA 4O18A 3VE9A 2VFEA 5KZEA 4IPIA 4DBEA 1Q45A 3M41A 1ME9A 1LYXA 5AFDA 2YCEA 2DP3A 4X9SA 1SO4A 3L9CA 5EYWA 4XWUA 3W1LA 3R89A 2QUTA 2A0NA 2DZVA 1ZHAA 4DF0A 4JTTA 3ANYA 3QW3A 4FIQA 3LDVA 2PC4A 1UCWA 5F4SA 1PE1A 3N2XA 5HQEA 4MIMA 1EWEA 1OX4B 2YPIA 3LCWA 5KINA 4EF8A 3QF0A 1JR1A 1O5XA 4ZMGA 4K7YA 3LB0A 1A53A 3IGSA 3B05A 3P61A 2CLEA 2B4GA 1SZNA 1TPFA 1SQ7A 4LRTA 3IGUA 3GK0A 5BNKA 5U7SA 1C29A 1DJQA 1EPXA 3MBDA 3HQ1A 2GPTA 1YXYA 1OABA 2CWNA 3DH7A 3GDLA 4DELA 2Q8LA 1SR9A 1L2UA 3G1SA 3LI1A 3L0KA 3B03A 4TMCA 2X1TA 4NT0A 4JX4A 1ZAHA 4NJKA 1IGSA 1GQNA 3C2FA 2YDAA 2FPTA 2X1UA 1PV8A 4O4VA 2A21A 1B3OA 1BWLA 4JEQA 4IGHA 4JGDA 3DHFA 2ZRWA 3LV6A 2B0MA 2ZZ7A 3W07A 2TSYA 3E49A 1IXQA 3S1UA 2V2CA 3N9RA 1G4SA 3W7MA 3IIZA 1VCVA 3PAJA 4O1DA 1XFBA 3NNTA 1B9BA 1SZGA 5DXXA 4JTEA 1QDSA 2EF9A 3UQNA 4O15A 3KVLA 2I1OA 4M7SA 4GUJA 1LOSA 3O6YX 4NJIA 4QIUA 3NQ7A 4LRSA 5CG7A 1P0NA 4NJJA 1EWDA 1X7FA 1VHNA 3W1XA 4GRSA 3NPXA 2ATMA 4JYEA 4G1KA 3NGJA 5FEZA 1YTEA 4JX5A 1AG1O 3KX6A 1OX5A 5D38A 3TU9A 1KM4A 1VZWA 2E5BA 3ZWTA 3W70A 3I7RA 1Y0EA 4UMAA 3LHYA 5HR6A 2YYTA 3CIWA 2C1HA 3LCGA 2H90A 4GC4A 3GZ3A 3N3MA 2H3BA 3W7NA 5C6MA 3E96A 3M5VA 3M1ZA 2VFIA 4N4PA 3UYCA 2WNNA 1Q6RA 4JTJA 3BLIA 5L6UA 3NVTA 2JGQA 5CZSA 2UV8G 4LNYA 3SJ3A 3W1QA 5DY2A 3P74A 4ORIA 5D37A 1X6UA 2J24A 4MPQA 2FQIA 4H4IA 4K36A 1FWNA 2R8WA 1L6SA 2HSAA 3MYPA 4N9DA 5FF3A 4MVAA 3DFQA 4L4MA 5I3FA 4HNUA 2BSLA 3P81A 5IBXA 3VE7A 4AMAA 3EX2A 4A2RA 5GVJA 3AJXA 3S5OA 1F2JA 3FJLA 3T44A 3NM1A 3MMTA 1TTPA 5D02A 2FB3A 2VEKA 3W1NA 5BMWA 1PCKA 3BLEA 1HFBA 3STGA 2NX9A 4ICNA 4EVZA 3MWAA 1N8FA 4HSNA 2E68A 5E1QA 3PF3A 4RKAA 4YMZA 1PHQA 2OZ0A 3V75A 2J27A 3PY2A 1W1ZA 2VKZG 4FNUA 4FNTA 3PUOA 3UXDA 1OK4A 2A2IA 1UASA 5EMUA 1KV8A 5LNSA 3S5YA 3UWUA 3NPUA 4UTTA 2NWRA 5CSRA 4KFPA 1ONRA 2QKFA 3UPWA 3QMSA 2YX0A 3W7GA 4QAIA 3N73A 3G24A 3OG3A 4O1BA 5AYYA 1QOQA 3MI2A 2Y63A 2WQPA 4IMDA 2HTMA 4LVBA 4JNMA 1LOLA 1HG3A 1DQXA 3G1YA 3Q2DA 5HUPA 2QCEA 3PBVA 1VC4A 1XKYA 3GX9A 1FXPA 3EX1A 5IBXC 3DBPA 3N2MA 3NL6A 4JIPA 1BWKA 1SW0A 3W71A 4N9EA 4JYFA 3MBFA 3QMRA 5G4WA 3IVUA 1M7OA 2ZZ1A 3IV3A 4PL1A 1QAPA 1KV5A 3UZ5A 1I45A 3FEMA 1XI3A 4MY8A 4WXYA 1M7PA 4IQLA 1SFJA 1S3HA 1JCYA 2C3ZA 2JKPA 3PSVA 2QCLA 4OE7A 5D33A 2E6AA 2G5WA 3O63A 4LUJA 1YXCA 3MJYA 4IWWA 4UTKA 2KZHA 4QISA 3NQ6A 3T40A 1SO3A 1ME8A 3NL2A 4UNLA 1EUNA 1YADA 1R2SA 4OGZA 2J9YA 3LLFA 5AYXA 1OYCA 4W9TA 5D2WA 4UR8A 3I7SA 2VC6A 4MFDA 3TUUA 2C14A 2EHHA 3TNOA 4HNVA 1LZOA 2C16A 3FJ6A 3FS2A 3QQ0A 4JTIA 3W85A 3C2EA 2FDSA 2VXNA 3SFKA 1PHWA 4I7UA 1MEWA 4CCDA 2VFGA 4TR9A 4QITA 1N7KA 1IIHA 5E0KA 1G4TA 3CWOX 4TU1A 5FF2A 1JULA 4NVTA 4NNAA 3KFTA 1KBJA 3TJLA 3NR0A 3I6RA 1OK6A 3TJXA 1K3UA 3W84A 2D73A 2HS8A 3W2UA 3UXAA 3W23A 4MZYA 2YW4A 3G8RA 3A5FA 2NWSA 5BMXA 3TROA 2QF7A 4UR7A 3TFCA 1P4CA 3MP5A 3DAQA 1GWJA 2QCDA 1WV2A 3WK3A 3KAOA 3HGSA 2C0AA 2E6YA 1H61A 3LLDA 3PBUA 2YFOA 2ABBA 4E0CA 2QJGA 3C61A 3TQKA 5G4EA 5FESA 3S8HA 2A6NA 4QQ3A 1DQWA 1D3GA 1I2NA 2NXHA 3DENA 1BKSA 1JVNA 4GXMA 1FBAA 4UNKA 3EX6A 3GB6A 1W5PA 3LGEA 3KRSA 3KOFA 1TIMA 3G1AA 3GVGA 4OQVA 2ZDRA 3ABSA 4X2RA 3LXBA 1XDMA 3R13A 3QC3A 4IJBA 4GE8A 3PUDA 4NXSA 2VEIA 3GDRA 3ZWSA 5LNRA 4NUWA 1W31A 4OBTA 4WY0B 4Z1CA 1ZCOA 4NX5A 4AB4A 4JTUA 4HT3A 4IMCA 4FHAA 4LU0A 3W1PA 4MYAA 3NEVA 3NPVA 4M6QA 1KA9F 2NXIA 5FF4A 3DHDA 1OX6A 1FWRA 1I8JA 4R53A 3DKLA 1QR7A 5EKYA 4LS0A 3M6YA 3WJZA 1HUVA 2X1SA 1GVRA 2Y7DA 4KKXA 4MUZA 1XBZA 4S2BA 1ICSA 2VELA 3BK0A 3TQ0A 1KTCA 2YZRA 4POCA 4O8RA 2Y89A 5CSSA 1TQXA 1UBSA 4OT7A 1MSSA 4RCXA 2QAPA 3W7HA 3FFSA 1KBIA 4PTNA 1EA0A 2E77A 4XTIA 4IMGA 2A85A 2A7NA 3ZR4A 4NX0A 4UTJA 4YCOA 1ZJIA 1VJIA 3PUEA 2FIQA 3G18A 1T96A 4OV4A 1A5BA 5H2ZA 1IXPA 2A5HA 3PSWA 3TSDA 3RLVA 3P80A 4TMBA 2TPSA 1JCJA 5A5WA 3ATYA 5LGXA 4RXGA 5K2ZA 4RJEA 4CNOA 2Y61A 4I7WA 3UNDA 4MKNA 2GOUA 5G2WA 4DO5A 5AHNA 1TPVA 4JN6A 2ZZ3A 1VYSX 5C2XA 3EXTA 1T99A 2WNZA 3ZS4A 5AC8A 5FEXA 4ALDA 3W88A 3O06A 2CFFA 1AW5A 1YDVA 4TX9A 2QCMA 3MI3A 1OFOA 3E9AA 5AHIA 3IEBA 2X1RA 3OIXA 2A7PA 2Z0IA 3INPA 3LV5A 5CPNA 5CPMA 3WK0A 3M5YA 3W86A 1K7EA 1P5BA 4IOTA 4TO8A 1VGAA 4CNNA 2CLKA 3NL5A 5CPOA 4RZ4A 3I65A 2X30A 1KTBA 2V8ZA 4O14A 4Y8FA 3MI6A 1W5OA 3A23A 4RV8A 5CGQA 5TQLA 3LHTA 4Y90A 5K4ZA 3NQDA 1L6WA 1WQ5A 3LRMA 1W3IA 2ALDA 4JTHA 5LNWA 1QNVA 3CTLA 2DZUA 3HPXA 4O1AA 4AWUA 4AVFA 3IIXA 2G96A 2A7RA 1H7PA 2QR6A 5DXYA 3LTPA 3HGRA 2QCCA 2ZCGA 3IIPA 4M5PA 4RLIA 2DZXA 2GJLA 1EP3A 3NQ8A 1SZEA 3W7KA 3NYZA 4HNTA 5KZMA 2ZRZA 3USBA 3TKFA 4UMBA 4Z0SA 4EOUA 3OBKA 1JQXA 1QO5A 1F6PA 3BGGA 2RDWA 2RDUA 4JX6A 3WFAA 1YXDA 4UFJA 1QO2A 4JTSA 5KZDA 3QYQA 3QEZA 1O5KA 3OVPA 1H63A 3EWYA 2CLHA 3TX9A 3LCHA 3E0IA 1VQTA 4JXCA 1LBMA 4KWWA 1JRCA 3WK1A 3LTYA 1TPH1 2G97A 5F2MA 2ZYFA 3DFSA 3DU0A 4ZQRA 3G0UA 3LX9A 2PRHA 1TTIA 4Z1DA 3HIJA 4XQ6A 1H7NA 2V5LA 5C55A 4IXXA 1RV8A 1TV5A 1XUUA 3F1QA 1ZFJA 3NO5A 1WBJA 4OV9A 2TMDA 3DFOA 4WOZA 3C8FA 3M44A 4OWGA 1GVQA 3CEPA 3H54A 3RMJA 3I7QA 1JCNA 2Y6ZA 4FXSA 5DBUA 1VH7A 3S42A 2QEZA 3P8JA 2TRSA 5AB3A 5I3JA 4MLJA 3JRKA 4DPQA 4ZL1A 2VFDA 4AXKA 2V2DA 1H60A 1ZAIA 2P0OA 3VKJA 3ABRA 2WSQA 3SZ8A 4RX0A 1XBVA 1VYPX 1T8XA 2DZWA 2Z1BA 4ZQCA 3S9YA 1G67A 3W83A 5HWNA 4JY9A 8TIMA 5T26A 4A3UA 3A5VA 2GVGA 1Q6OA 1E51A 3S1VA 4AHQA 1EX5A 2V82A 3STFA 1QPRA 1TCDA 2FLIA 3STEA 4B5NA 1XXXA 2CLFA 2P1FA 3K30A 3ABQA 3QZEA 3B06A 3NPWA 4UFKA 1AL8A 5HR7A 5HWJA 4MJZA 4CCCA 2JKEA 3NZRA 3P8IA 6ALDA 4N6FA 4KFOA 3W2NA 1LBFA 4AAJA 3TA6A 3C4UA 4LY8A 1SU5A 3GXTA 4YLWA 3GR7A 3W7DA 2BLEA 3E02A 4N9BA 4LTSA 2WO5A 1UUMA 5K9DA 4AHOA 4UFMA 1MZHA 1YLVA 4K6AA 3BV4A 5MHBA 4J9JA 1D9EA 3BG5A 4UIOA 3W7RA 4X22A 1IXOA 3MHUA 1QOPA 3T78A 3W2KA 5D09A 4FX6M 2QDGA 3G3DA 1G6CA 1PIIA 1JCMP 3W2LA 1FDYA 3O1NA 4N4QA 1SO5A 4O10A 1KFBA 2ZFAA 1TPC1 4AEOA 4BFAA 3G1DA 4CQ8A 2VEMA 3QPYA 4YWIA 4LC6A 1IIGA 4HNNA 5HJLA 3DI1A 1UB3A 4JTGA 3FA5A 5KTLA 3W76A 1ADOA 5G2HA 1W8SA 5D30A 2EPHA 3HG3A 5CZ0A 5E93A 4RXFA 3W7CA 4JR5A 1WXJA 2C19A 4K37A 1VLWA 2XFWA 3LHUA 3EWUA 1TJPA 3TC7A 2JKAA 4S2CA 3W7JA 4DO6A 5A8GA 4LOCA 2CLLA 4HKPA 1LRTA 3IIOA 1H7XA 1KW1A 2BX7A 1GYLA 3OVRA 1YTKA 1RQEA 2NV2A 2DJXA 1DJNA 4K38A 4BI5A 1OYAA 4Y96A 3WK2A 1H7WA 4HSOA 1QCWA 4HHPA 3YPIA 4FX8A 3C56A 4AF0B 1TREA 4JDYA 1O95A 2NZLA 2CZEA 3JR2A 2A4AA 1M5WA 2GJNA 5LZLA 4O57A 1OG0A 4DPPA 3BARA 3U6WA 4O50A 1JCLA 3EKLA 3JS3A 1KFCA 5BRBA 1H1YA 3UWWA 1KM6A 2RHGA 1TV7A 3HOJA 2RH9A 2B7OA 4MYXA 1QFEA 1TPUA 3T4CA 4R34A 1UJPA 3NDOA 5D2XA 5F2GA 4IXHA 3CM4A 3KHJA 1GTHA 1KFJA 3LHZA 4XKYA 3HPSA 1B4EA 1TPEA 4FNSA 1OHLA 5D04C 1NEYA 1VPXA 3O15A 3W22A 3M5XA 3EWXA 1AW1A 3L0NA 4LW7A 1WBHA 4DEFA 1TSIA 1VRDA 1JUBA 2QUVA 5G1YA 1OFAA 3ABOA 3C0JA 4FNRA 1ZNNA 4YL2A 1NF0A 1H7RA 2PCQA 2GUUA 3M9YA 3PBYA 3NXFA 4IX0A 1C9DA 3TAOA 1K8ZA 4ADUA 1FDJA 2EKCA 1U83A 4JICA 4O4WA 1I2RA 4UTTC 4QSHA 3NQEA 4FX7A 3B4UA 3R8RA 4KWVA 2H8ZA 1PCWA 2IQTA 4BWLA 5TIMA 4IMEA 3W72A 3O05A 1Q6QA 3EWBX 3PWAA 3PR2A 1XBXA 3CIXA 4JY8A 2V5BA 3L0GA 3Q37A 4WXZA 1VLIA 1GVOA 2NUXA 3VI2A 2FPVA 2QCDB 1TTQA 4Y6GA 1RQBA 5G1TA 3OEXA 3WJSA 4JIQA 1LCOA 1LDCA 4ZQPA 4YCPA 3G0SA 1FDZA 4GUHA 2RKXA 4S1FA 1TJRA 1KFKA 5DN1A 3TSBA 4L4LA 2OT0A 2BZNA 3NL3A 3W7QA 1GVFA 2LLEA 2NUWA 4M7TA 1DVJA 3Q94A 2Q3RA 4C1LA 3UWQA 2ZRYA 1LLZA 3W1MA 5C5YA 1TMHA 4ZQNA 5G5IA 4OHQA 1FCVA 3G0XA 1S5WA 2PURA 3QPZA 5EL1A 3TW6A 3W2MA 1LRQA 3QFEA 1WA3A 3BW4A 2WSYA 4A22A 3B0PA 1A5CA 4WD0A 2QDHA 3RLUA 3A24A 4EIVA 1LM1A 4U28A 4MY1A 1KFLA 4WOQA 1KM5A 3W3OA 2CLIA 1WOAA 5L9FA 4O0KA 3M16A 3O6CA 3PVFA 3HPZA 5CZTA 1SW7A 2ABAA 4XUGA 5D05A 4GUGA 4CQAA 3L2IA 4FNPA 3GAYA 2OT1A 5I3HA 3W6YA 3SGUA 1F76A 1TRIA 3LRLA 4NJHA 1NVMA 4C1KA 1YDOA 3KRZA 4PA8A 5D03A 4XBSA 3QSTA 3ATZA 5BW6A 1JJKA 1FCUA 1I2PA 1WYIA 4QNWA 2QCGA 3KVMA 4BK9A 5HMSA 3M43A 2WOQA 2J9XA 4ADTA 5AOUA 1QPQA 4PH6A 4IPJA 2Z6JA 2JBMA 5F2IA 5AN7A 2WJZA 3FYOA 2CZDA 3KVKA 1MO0A 2BXVA 3U8GA 2O7SA 5D2YA 1OVDA 4XBKA 2DJLA 4KFNA 1OJXA 5F1UA 1HO1A 3NQAA 3GIYA 2ZBTA 2X16A 5LNUA 1Q3NA 3BW2A 1C8VA 3NQVA 1WDWA 1TTJA 2V81A 2PRLA 4QM1A 3L66A 1G7UA 2RFGA 3F4WA 4AWSA 2DZTA 1EEPA 4U4MA 3CWNA 2E6FA 4AHPA 4CNPA 1I2QA 5TBOA 3QQ1A 1OYBA 1WX0A 3L5LA 4K7VA 3N34A 4FEZA 1P1XA 1ML1A 1GVSA 4PODA 1R2TA 5EY5A 5F2LA 1ICPA 1YDNA 4UC5A 2V2HA 1ALDA 5I3IA 1XM3A 3F03K 3LBMA 3W74A 5K4XA 2ZZ5A 1LRNA 5EBUA 3Q58A 4M19A 3TMLA 1S5TA 3RK8A 3WJXA 2BWGA 3VFLA 1QWGA 1GJPA 4M6VA 2GVLA 1W3NA 5HUOA 2ZZ2A 2OJPA 3P62A 3AO0A 2GQAA 2F7FA 3S1WA 2Y88A 3T55A 3FLUA 5D2VA 4CQ9A 3HG4A 2H8XA 5I3KA 2Y7GA 4GFSA 1OFRA 3CEUA 3PC0A 3TQVA 1K8YA 3LM7A 2P10A 2R94A 3LXAA 3TV8A 1G7VA 3SIZA 1BTMA 4JS3A 1A5SA 4ZVJA 3RFAA 4N2YA 1A50A 5DCDA 4HIBA 1THFD 3W7PA 3NOEA 1CI1A 5H91A 2FFCA 1GEQA 3LI0A 2E1DA 2GVJA 3W73A 3HF3A 4K8HA 1EIXA 1D3HA 1K7FA 1L6YA 1W5QA 2X2GA 4LVAA 2Y62A 3TC6A 5HINA 5EA9A 1FX6A 1NFBA 1IXNA 2OCZA 1X1OA 5D32A 1JUKA 4WJEA 1VCGA 5DCEA 1AMKA 5ABTA 1F7BA 4BI7A 3H55A 1O4UA 3BO9A 2W6RA 3EWZA 3BG9A 4RZ5A 4UXDA 4WY0F 4IMFA 3GYEA 4WX2A 1ME7A 4UTMA 3T7VA 5C54A 3CHVA 1DOSA 1MEHA 1I4NA 4WQ6A 4BI6A 3W9ZA 3FKRA 3UZJA 1MXSA 3E12A 4BR1A 1J2WA 3EWWA 1PVNA 3V1PA 4JDBA 3W7LA 3EKZA 3L5MA 1KLZA 5AHMA 3VNDA 4ZZ9A 2YYUA 2CZFA 1JRBA 2EAWA 3C2OA 4JTLA 1WAUA 3DXIA 1CW2A 4GNJA 2TYSA 3CT7A 1L9WA 4TIMA 3D0CA 2Y7FA 4FXRA 1R30A 4H6KA 5FI8A 3OHIA 4K8EA 2DZPA 1SSDA 3L21A 2OX1A 3W1RA 3BG3A 4O0ZA 3IVTA 2ZZ4A 3EX4A 4NQ1A 1PL9A 3L67A 3N9SA 4Q32A 1GOXA 3GAKA 3M5ZA 3TAKA 3DGRA 3GNNA 3HBLA 3KXQA 3O16A 4NZJA 2AAMA 1SPQA 1TQJA 4OU1A 3R5EA 3HMJG 2C13A 1G4PA 1SW3A 2ZA3A 4N02A 1ZENA 1LBLA 5U4NA 2Z2UA 3DKJA 3FKKA 3U2OA 1M6JA 2A6LA 3R2GA 3PULA 1TPWA 3M7WA 3L68A 4JTKA 2QCNA 3QJAA 3P5ZA 1J4EA 1X8FA 4O16A 4N6EA 5DY3A 1H1ZA 3MP3A 5EPDA 1NSJA 4A2SA 1XCFA 1X1ZA 3O8AA 2Z6IA 3TH6A 2VFHA 2ISSA 3P60A 3THAA 1JUEA 5AC7A 2DU2A 3A21A 3L5AA 3UWYA 3QW4B 4X3ZA 4Z08A 1R47A 4Z0JA 4E2DA 1OX4A 3HG2A 4RK8A 3TK7A 1TRDA 1FWSA 4MZ8A 3QRHA 4A29A 4ADSA 2HS6A 2C18A 3I68A 1EP2A 1FQ0A 3P5YA 3GXPA 4DQWA 4WUIA 1Z42A 3LCLA 3TFXA 4UMCA 1EB3A 2XN2A 3LCIA 1J5TA 3LTSA 4O17A 1JCXA 3G8EA 4DBDA 3PBWA 1DHPA 5HWMA 1GT8A 4P61A 2DORA 2WSRA 1NAL1 1LORA 4WZHA 3F4NA 3W7EA 3C2VA 1QPNA 4E2BA 2NXGA 1TYGA 3DFPA 4FNQA 4D2JA 2J88A 3RF9A 2B7QA 2W0UA 1W3TA 4Q4KA 2QAFA 2V0TA 4IX2A 2Y70A 1YTDA 2B7NA 2O7QA 3P7YA 3W87A 3LCXA 1LP6A 1XUZA 1K7XA 5LHEA 5DCBA 5CZJA 2E5CA 2ZTJA 4P2VA 4MZ1A 5FF0A 2WPBA 1RR2A 1HTIA 3TSMA 1ZAJA 6TIMA 1KM0A 1KFEA 2Q8ZA 1R2RA 1SFLA 3EEGA 4EWND 3GNDA 4MJMA 1RQHA 4O1CA 2H3DA 5FF7A 3BW3A 1YYAA 4NZFA 3MHGA 3GKAA 5K7JA 2YFNA 2B7PA 3QH2A 1TV8A 3TR2A 2J9ZA 1KLYA 1SO6A 3CLMA 4LWWA 1FUYA 2HMCA 3RU6A 1H7OA 2EGZA 2Y7EA 5AC6A 1FWWA 1GG1A 4XKYB 2VOMA 4DO4A 2VEPA 3DFTA 1FXQA 1VYRA 5BOOA 4FF7A 3OVQA 4O12A 3SECA 3SR7A 3C52A 1KM3A 2QJIA 1W56A 1OF6A 1V7YA 3O6DA 2JK2A 1OFDA 3G1XA 4UFHA 5LHFA 3HB9A 1BEUA 1B4KA 1O60A 2G95A 1K02A 4NNCA 4EF9A 3ELFA 4AH7A 1DORA 3NAVA 4QJ1A 2Q3OA 3ZFHA 3UY8A 4LS2A 1F74A 4MFEA 3GDMA 3LHVA 3QM3A 1AK5A 1EUAA 1W0MA 1ICQA 1IF2A 1W5MA 2WNQA 4O19A 1VCFA 4JTFA 5CKSA 3TIMA 1CX9A 3SSJA 2E09A 5K9CA 3A22A 1VS1A 2CLOA 3W2JA 3MUXA 3LXCA 3THQA 2FPYA 4UTHA 4HPJA 3LBCA 3MP4A 1P0KA 1W5NA 4AF0A 4FIRA 1KM2A 4JYDA 3VCRA 1Q6LA 1W54A 3C2RA 4Z1AA 3LRKA 3HGOA 4Q33A 3HG5A 3GXNA 3L65A 3BVJA 2XN1A 2OMAA 3DZ1A 2YXGA 1G69A 4FB7A 2ATSA 1T0OA 2ZRXA 3CC1A 1JQVA 2GQ9A 4GBUA 3IVSA 1TPB1 3N19B 3W1AA 3TCEA 2BTMA 4ONVA 5K3VA 1G4EA 3UD6A 1XBYA 1F6KA 1FCBA 1K8XA 5K9XA 3QSRA 1RD5A 1U5JA 3WJYA 1TB3A 4LUIA 3UY7A 2J6XA 3NQGA 4M6PA 4ZQOA 2R14A 3S0CA 1O94A 4A21A 1FCQA 4HPXA 3TE9A 1EP1A 5DELA 4MY9A 4MOZA 3NZ1A 5DLCA 3NQ2A 3GKFA 3EXSA 3QMTA 5LNVA
chains in the Genus database with same CATH superfamily
1PKMA 2HK0A 3IGXA 3N3TA 1QW9A 2NX1A 5F4WA 5LGZA 3CAVA 3MKVA 1XLEA 2XH7A 5A8OA 3VDHA 4FOUA 3FYPA 3G1VA 4UTWA 1FWAC 1NF7A 1LT8A 3W7IA 4O54A 3PB2A 2CBVA 2REQA 4G1NA 5F1VA 3ITOA 1REQB 5CGTA 4NU7A 1BF2A 3W25A 1WP6A 3IIVA 4C6BA 5J5DA 1TZ7A 2O9OA 4GIAA 2NQJA 2B81A 1V6WA 1VEMA 2DZAA 4FOKA 3S9ZA 4K2SA 1AL7A 1E4LA 2G3JA 1UR1A 2VX4A 2RDTA 4ZQMA 2AGKA 2O9TA 4AZ5A 5KITA 4J7RA 1ISXA 1JPIA 1UBPC 1DJGA 2JGYA 4JIRA 1JIBA 2ZZ6A 1TA3B 1HKWA 4GMEA 3PTDA 3APTA 3UXIA 4UTIA 3NJ3A 4JIHA 2EPNA 2V5DA 4S3CA 3CWHA 3ZQ9A 1XV8A 2PLMA 4WF7A 1OFBA 3PM6A 2DT0A 2WJEA 1B30A 4RNIA 3WQGA 5LSMA 1LL4A 1UQYA 1DXFA 5AHFA 2PF0A 1W37A 4KWOA 3G22A 1OFPA 2YLAA 3FJ4A 3KP0A 4W7WA 1FWCC 3HJZA 3MYOA 4LAKA 1BXNA 1N2VA 3RCNA 2ZUNA 2GGEA 5A6MA 1DJWA 3FNDA 3SRDA 3UXKA 4DXVA 1EC7A 1XSJA 3VMOA 4DF1A 3AIVA 2YL9A 2BOEX 3U2ZA 3VZYA 4CD8A 3LHWA 1H62A 1GK8A 2FTPA 3CQ0A 2QHAA 4JD4A 4K39A 3UCQA 2FHCA 2VR2A 1L0PA 3SGGA 2OGJA 4MAZA 2CWXA 1AQ0A 4AG0A 1LLWA 3WLRA 2XIMA 3TA9A 5KMYA 2J8FA 4WKAA 3TMQA 5BXPA 2XSXA 3R25A 1LTDA 2IKIA 1H50A 3M47A 1J0ZA 2FB2A 2GLKA 4MWAE 3WD0A 5FJTA 1S5VA 2XU2A 3BPWA 5IM51 4DJEA 4O52A 4GOAA 3BJFA 5FEPA 4LV9A 2G3NA 4B90A 1ITXA 4BJHA 1Z44A 2V30A 3NQMA 5LKYA 2ZTKA 1E71M 2W79A 1SUXA 2C15A 4V15A 1H1NA 4O13A 1LROA 3VIPA 8RUCA 5MKGA 3KCJA 5AYZA 2QUUA 2BVWA 3M0ZA 4DUWA 1ZY9A 3GR8A 5HNRA 4QLJA 4MHBA 3CZGA 4KGLA 4LPCA 2J8GA 3WJWA 3CBWA 3ID7A 3GDTA 1DWJM 5CC7A 5D2TA 3UPBA 2PDBA 4XZIA 2A1YA 1XJBA 3S6DA 4R9XA 1ZALA 3JZUA 4EP8C 2VVNA 3CB8A 3ZLHA 4KT2A 1K70A 1RVGA 3G1FA 4ASTA 4ML9A 1K03A 2AMXA 3E6EA 1QPOA 2E7FA 3OO2A 2J79A 2DP3A 4X9SA 2ACRA 4XWUA 3W1LA 4C6FA 2A0NA 4W7UA 4AZ6A 1JFXA 1ZHAA 4DF0A 2EPMX 2W67A 3GHUA 4A3HA 3OP2A 5F4SA 5C7VA 1PE1A 3N2XA 1K9DA 3FHQA 4WKFA 3E1F1 1EWEA 1EKOA 1RUSA 1XYBA 3H22A 1UMLA 4MMWA 3AAMA 1A53A 4R7OA 4J3XA 2E9LA 4FLSA 9XIAA 2R1PA 1TPFA 2OELA 1C29A 1YDYA 1DJQA 2XVGA 3MBDA 2GPTA 2XVPA 4V28A 3EMQA 4HPHA 4H1ZA 1YXYA 1FHLA 1OABA 3DH7A 2Q8LA 3LMYA 2X0SA 5DMYA 4TMCA 2X1TA 4NT0A 2V3DA 4TVCA 1GQNA 2Z1VA 2W5FA 1XDJA 4AZBA 1PV8A 4MTVA 2PDUA 4O4VA 4XKMA 3WX7A 1ZSXA 1VJSA 4JGDA 4M8UA 5ABHA 2ZRWA 4IIGA 3W07A 2TSYA 1F61A 1OCNA 4CQDA 3N9RA 3U4AA 1TWZA 3PAJA 3RMEA 3QZ6A 3WY1A 1QDSA 3CL6A 2I1OA 1POKA 3OVGA 4NJIA 4UQAA 3M07A 3NQ7A 4YVPA 2OB3A 4RPPA 4HK6A 3W1XA 4GRSA 3PPCA 2F2KA 4JYEA 1M41A 3ARPA 1KWKA 3A13A 3NGJA 1XIFA 2GUBA 3G5EA 1EJRC 4GVFA 4KESA 3WDQA 4IIFA 3VFCA 3TU9A 4U10A 4PCSA 2E5BA 3ARUA 3ZWTA 4B5VA 2XYLA 2PDGA 1GUVA 3LCGA 3GZ3A 2H3BA 3W7NA 1E55A 5C6MA 3F2BA 3M1ZA 5AVNA 3LA4A 4N4PA 3L4ZA 3UYCA 1Q6RA 1SR0A 5L6UA 5CZSA 5TF0A 2UV8G 1B31A 3GXMA 4ORIA 5D37A 3E38A 2BB0A 4DYJA 3NZQA 2R8WA 3GG1A 4C6OA 1PX3A 2AMGA 1JDFA 1HVQA 4HNUA 3QHMA 3P81A 4JTQA 5IBXA 4DI9A 3SCWA 1OCQA 3BXWA 3S5OA 1F2JA 1OD0A 3MMTA 1TTPA 3V35A 1IHIA 1RSCA 4Y9MA 3W1NA 3TTYA 2X0YA 1NU5A 1HFBA 3STGA 3UVAA 1GORA 2PTDA 3DC8A 3UF9A 3MWAA 4HSNA 6A3HA 4YMZA 1PIFA 1C8QA 3G77A 2WPGA 2XSAA 4J3WA 3HPFA 3UETA 3OG2A 6CGTA 5CSRA 1SJBA 2PDNA 2QKFA 2EJ1A 4JFSA 2PWDA 4HVXA 3TTOA 4LQ1A 2H9AB 1QOQA 1UOKA 1GPFA 1E4NA 4IMDA 2HTMA 3TYUA 3BANA 1HG3A 1DQXA 2QYGA 1RA5A 2J8TA 3DBNA 3GTXA 5HUPA 2QCEA 3H2CA 1XKYA 2Y8VA 2Z26A 3T0CA 3CUFA 3HN3A 1YKWA 3REQB 3V3WA 1ZJHA 5BXRA 3W71A 1S1PA 1K6AA 3MBFA 2HBXA 4FPSA 3A4AA 3IV3A 3SIMA 3VCCA 1YEYA 1I45A 3GIQA 1XI3A 4WXYA 1M7PA 4EK7A 1U2YA 1NP2A 1S3HA 4OE7A 2G5WA 4JN7A 3B9DA 4IWWA 3NSMA 1SO3A 1ME8A 4HNOA 4YTTA 1ZBCA 4QX4A 4OGZA 4P8VA 2QNEA 1OYCA 1GZ1A 2GSJA 4DXKA 1MQRA 3HQNA 2FHFA 2NQ9A 1RH9A 4JKLA 3I7SA 2VC6A 2Q01A 1MQPA 4HNVA 1LZOA 1DPMA 3C2EA 1VD6A 2FDSA 2VXNA 4IHCA 5D9MA 1NWUA 3GS6A 5H8UA 3V7PA 1TE1A 4HB7A 3IJQA 2VFGA 1N7KA 5E0KA 3CWOX 1RCOB 3WNKA 2IPWA 3CYVA 5FF2A 4YPJA 3U5UA 3KOXA 2AKZA 3HJEA 4NAEB 1K3UA 3CV2A 1GQKA 2HS8A 5C9XA 3BJSA 3ITTA 4ZB0A 3CMFA 2OZ8A 1GOMA 6ENLA 1DYSA 3DG3A 2BVDA 2I16A 2VC7A 1NP0A 3KL3A 4IFKB 3DAQA 1U1UA 4GKLA 3WK3A 2ABBA 3PZ9A 2QJGA 4IQEA 4Z42C 3XIMA 4M56A 2WKLA 4HU3A 3S8HA 5GNZA 1W2VA 1MW0A 1UWTA 4PBGA 5ABEA 1PPIA 1C3FA 3MTWA 3EGJA 3VNIA 3DENA 1Q6DA 4MJ4A 2HV5A 3TZNA 5EB8A 2XH2A 5JBDA 4UNKA 1W5PA 3LGEA 5LIUX 4F0KA 4LUSB 2WHLA 2O9PA 3MSDA 3QC3A 4IJBA 4GE8A 1MWOA 3E2SA 4AX6A 4YIWA 4NUWA 4Z1CA 3KBMA 1OADA 4MYAA 3U2EA 1XS2A 4M6QA 1KA9F 4WDTA 3G1RA 1OX6A 1I8JA 1NFPA 2DSUA 2WJFA 2AL2B 5EKYA 3U7BA 3GNRA 3ZJ8A 1GVRA 2C79A 4W93A 1BF6A 3SQLA 4Y2WA 3APGA 2VZUA 1R7OA 2Y89A 1UBSA 5D8ZA 5CEWA 2QJMA 3PJXA 1RK5A 1MSSA 2XIBA 4OT7A 4RCXA 2QAPA 4WGHA 3W7HA 4PTNA 1B90A 1OQFA 4HPNA 1V02A 2A7NA 3ZR4A 1EDGA 1VJIA 7ENLA 3G18A 3PZNA 2HNHA 2HXUA 3B97A 5H2ZA 2BY2A 3ABXA 3TSDA 1M65A 1TIWA 3R94A 4E3TA 1O5RA 1JCJA 1WUEA 4Z2KA 3LSCA 4RXGA 4Y9OA 2DIJA 4PMOA 3UPMA 4WSJA 4AXNA 2XIIA 5G2WA 2QMJA 1T40A 4X63A 1TPVA 3IUHA 1NH6A 3ZS4A 5FEXA 2BODX 3GVVA 3O06A 3EOOA 4I6VA 3E9AA 1NDVA 3OIXA 1T7LA 1F6YA 2GUYA 2Z0IA 3INPA 3CUGA 5CPNA 4A8LA 3M5YA 1O1HA 3T8QA 3W86A 4TO8A 1XQKA 4M81A 3WDIA 4M1BA 3UGRA 2R24A 4QEHA 3NL5A 3RR4A 5CPOA 2VR4A 1TWWA 2BXZA 3I65A 1UZHA 3TYCA 4DUXA 1KWGA 1DEDA 4Q7BA 3DUGA 1VBRA 4Z2LA 3MI6A 1A5UA 1P6BA 3GZAA 3ITCA 1LL7A 1L6WA 4C6KA 1JGMA 7A3HA 1ZU8A 4HZ8A 1W3IA 1P43A 2ALDA 3PHAA 1DE6A 5LNWA 1HX0A 4HOWA 4GYJA 1V0NA 3SCUA 3BAWA 3EKGA 3HV9A 1MNZA 3KWSA 3BAJA 4EANA 2R82A 3ITYA 3OZMA 3LTPA 3PANA 2ZCGA 4RLIA 5DMNA 2WXDM 1EP3A 2XSBA 1SZEA 2VD8A 4AD3A 1LUCA 4UMBA 3SN0A 1ZBKA 4EOUA 1I75A 4TQTA 1BFNA 1QO5A 1F6PA 4DJEC 4UOQA 4JFWA 2GQ3A 1QO2A 1TR9A 1BAGA 3GE7A 1QPKA 2Y5SA 4DYKA 4UB9A 3B9OA 3BAIA 2WMIB 2CLHA 1GQLA 3EWYA 3TX9A 1Q8JA 2GK1B 4E6MA 1KR0A 4JXCA 3TLLA 3LTYA 1TPH1 4DJFA 2VT0A 4GXWA 2XFFA 4FZIA 2PRHA 3HIJA 4DIAA 2V5LA 5C55A 4YYCA 1TV5A 3PTKA 3AXHA 3LYEA 4OV9A 5LIWX 3H54A 3CEPA 1V3MA 2PDCA 4DHGA 1R3WA 2MUCA 2VD9A 4FR6A 4WIWA 2CXGA 2QV5A 3P14A 3BOLA 1H60A 2P0OA 2ZUUA 3A6OA 1V79A 1ISYA 4HTYA 1XLCA 2DZWA 2PDFA 2Z1BA 4Q8TA 4LYRA 3S4TA 2IKGA 1WZAA 4JY9A 1W3KA 3A5VA 4AHQA 3MT1A 1EX5A 3STFA 1VFSA 5BRPA 4B3ZA 2BV9A 2FLIA 4DVOA 2GDUA 3VO0A 1TELA 2CLFA 3QZEA 1AZ2A 3B06A 3NPWA 4WJ8A 1V3JA 2R1NA 3RRAA 3NZRA 1S3TC 4IIHA 3P8IA 2JF6A 4N6FA 3APYA 3C4UA 2QJJA 4YLWA 3RITA 4N9BA 4OUIA 3UJRA 2WO5A 1UUMA 5LIXX 4D72A 1NJJA 4KIEA 4DWSA 4K6AA 2OZTA 1D9EA 3BG5A 4UIOA 1I9CB 1GVEA 2WHKA 1DHKA 5FJPA 3WF2A 1G6CA 2EXOA 5I24A 4N4QA 2ISDA 4H7ZA 1TX0A 3SCRA 3LLXA 1KFBA 2OWXA 3GUWA 2SFPA 1NOWA 4F0MA 2AQOA 2G37A 2BS9A 4DJDD 4H8VA 4HNNA 2HJPA 2I9UA 4DBSA 1Z89A 5KTLA 3WZ0E 2HQAA 4GJJA 5D30A 1HJVA 3KBJA 4LB3A 1HJSA 1R38A 2D2OA 4LUYA 4IIDA 4KEVA 2WZMA 1KGWA 1TJPA 3TC7A 3ZMRA 2JKAA 3W7JA 2IPJA 2Y8KA 1QW7A 5A8GA 2BHYA 4AW7A 3VGBA 2X2YA 5CC3A 1IZJA 1TX2A 1KBBA 2HPIA 2NV2A 3KBNA 2OWCA 4BI5A 1OYAA 3MPGA 4Y96A 3WK2A 2ACSA 2X7VA 4AZIA 1JYXA 1IV8A 5TD4A 3C56A 2Y5EA 2CZEA 1M5WA 1W9XA 2I7GA 3ES7A 4ACZA 5LZLA 4GY7A 4DPPA 2YDQA 4NY2A 3U6WA 3EZ4A 3JS3A 3WIJA 4HCLA 3E5PA 2TAAA 1KM6A 2RHGA 2QVHA 2XJ7A 5F7UA 2QVNA 4KW2A 3S6OA 4J3SA 5F2GA 5D2XA 1OG6A 3U7VA 2CZVA 1GTHA 1K6WA 3NCOA 4HA1A 1B4EA 4HJWA 2PZ0A 3PJWA 2VMFA 2JEQA 1BXCA 1E6QM 3W53A 3O15A 4IQJA 5LXEA 1MNSA 3BTNA 3N25A 4D8LA 3ABOA 3EDJA 4YL2A 1NF0A 3ECQA 1JGIA 5J8LA 2PCQA 4FF5A 3NXFA 1C9DA 1V3KA 3TAOA 4ADUA 1FDJA 1JZ7A 3V16A 1Q13A 2W92A 3II1A 4F0SA 5D4YA 1POJA 1MXGA 4QSHA 3B4UA 1IZCA 1PCWA 4J35A 6REQB 2E8ZA 3O05A 2REQB 1BXBA 3PR2A 5LXXA 1W1A1 4JY8A 1HKJA 5D9NA 2OVLA 3L0GA 4GY0A 3M0YA 1DIKA 2V38A 2CITA 3AS2A 1UD3A 2FZ8A 4GINA 2QCDB 1VIZA 4AZGA 5G1TA 5HA7A 1LDCA 4YCPA 3G0SA 3CQJA 4FLRA 4HD5A 4S1FA 1TJRA 1RK6A 1GJWA 4L4LA 3T42A 2BZNA 4NZCA 4YTSA 4M7TA 5KETA 2Q3RA 4C1LA 3H7VA 1CGTA 3W1MA 5C5YA 5HAOA 4HSHA 1K4GA 2E28A 4EACA 3LZ3A 3TW6A 4D1JA 3QFEA 2WSYA 3RLUA 3A24A 1Q2SA 5ABFB 1QNOA 1KM5A 9RUBA 2CLIA 5L9FA 4HTBA 1J9YA 3M16A 4MWAA 3URBA 4TX6A 3HPZA 3UJFA 3TYBA 1SW7A 1BRLA 3MC5A 5HOSA 5D05A 4LB4A 3KW3A 3N17A 2NV9A 3GAYA 3K4DA 2Z2BA 5I7GA 5HNTA 3RRXA 5D03A 3ZO9A 3OQ8A 3LK6A 1TJ1A 2QQ6A 5FKYA 1WYIA 1R9YA 1ZGDA 3SN4A 1PTGA 1U30A 5F2IA 5AN7A 3H8AA 4FMVA 3D6NA 3NQBA 1R3QA 2DJLA 4KFNA 4IZGA 1OJXA 5F1UA 5GNYA 1XLKA 4JZ5A 3LQGA 4L4OA 3SQSA 3GIYA 3LPFA 1CXLA 2BNJA 5C2GA 1Q3NA 4ES4A 2V81A 2GOKA 3KBWA 1G7UA 3F4WA 3WLSA 1HN1A 2DZTA 4ZFCA 3RX3A 4GI6A 4HK7A 2OU4A 2JALA 4CCZA 3QQ1A 3CV1A 1WX0A 4JOMA 9CGTA 1EOKA 8A3HA 1R2TA 1UD2A 4DB7A 1ICPA 2X41A 3IPWA 3F03K 1YE6A 1PAMA 2OKTA 1FKWA 2ZZ5A 3Q58A 3QTGA 1CB7B 1S5TA 2BWGA 4ZA0A 4NI8A 2WMGA 3AIUA 5AECA 1W3NA 1UH4A 4TVDA 2ZZ2A 1A80A 1TVNA 2F7FA 1PX8A 1BSIA 5D2VA 3CEUA 1K8YA 3LM7A 3PZUA 3RO6A 2P10A 4QS5A 3KE0A 1G7VA 3SIZA 1A5SA 2ZXAA 2YCJA 4TOQA 5DCDA 1IR2A 1THFD 3KZPA 2QPUA 3AIEA 5H91A 5C2CA 2ZWZA 1WKEA 2E1DA 4HGXA 4F2UA 3HF3A 4L6DA 4BQ2A 1K7FA 2WC4A 3KTXA 2X2GA 2Y62A 1UWIA 2HRWA 3TC6A 5HINA 1U1JA 4X61A 1KCZA 3CB3A 1IR1A 2OCZA 1JNDA 1EJWC 1VCGA 5DCEA 1AMKA 2PZNA 4LAZA 3M64A 4BI7A 3BAKA 3H55A 2VOTA 3BO9A 4JQAA 3EWZA 3MSRA 5C54A 3CHVA 1V3LA 1IWBA 1HP4A 4O0QA 1I4NA 3RPTA 1GOKA 4IPLA 3CLWA 4KCWA 3WDRA 2V3EA 2O4QA 3S3GA 1K9TA 5BZAA 1E6ZA 1KLZA 4ICMA 1XLAA 2PDWA 4ZZ9A 3GC5A 1PZ2A 4BQ4A 1KRAC 3CMGA 2J62A 3ZJKA 2Y7FA 5I0DA 3OB8A 3CAKA 5FI8A 3GVRA 1SSDA 1RAKA 1OCBA 4J3ZA 1XLFA 3TAKA 3BSHA 3GNNA 3K46A 1XD1A 1V77A 4XK2A 4PUDA 3O16A 3NYDA 2UWFA 3SCTA 4JEJA 3IWPA 3HMJG 1G4PA 2ZA3A 1XYMA 2GJXB 2BASA 1LBLA 2Z2UA 5CBJA 4FI4A 3U2OA 4GQBA 3Q67A 5BXTA 4MAVA 4Q6JA 1JI2A 3GVWA 1T5AA 2QCNA 3TJ4A 4GK8A 3P5ZA 3CJPA 2WHMA 2D2JA 5E09A 1GKPA 1H1ZA 3EOLA 1SFSA 5JQ9A 3B4YA 2W62A 3MU7A 3O8AA 1MRQA 3P60A 3THAA 2WNWA 1R6WA 3C5QA 2VM8A 3GC2A 4C60A 2OWWA 3VTRA 1IZKA 2DY3A 2VEGA 3ZVHB 4Z0JA 4IH3A 4DJFC 3HG2A 2BDQA 1E0TA 1FWSA 1ONEA 4AC1X 1VEOA 3GH5A 1EP2A 3DECA 3LCLA 4DX3A 3TFXA 3M0JA 3HA1A 2WMJA 1Q7QA 1C92A 3VM5A 4EX4A 3FVMA 3ZM8A 4GH1A 3PBWA 4P61A 2PD9A 2DORA 2WSRA 3LN3A 4NASA 3LS9A 1DIDA 4WGXA 3VD3A 1M3UA 2OZ3A 2NXGA 4PMJA 3SURA 2WHJA 8CGTA 2B7QA 3N6HA 2W0UA 1W3TA 4Q4KA 1I0DA 4FOJA 4IX2A 3DCPA 3K8LA 2O7QA 4D6HA 1EEXA 1WUFA 1A5MC 2PLCA 3LCXA 2XTKA 2CBIA 3SRKA 1BHGA 3R8GA 1HTIA 4I3GA 3BURA 1ZAJA 6TIMA 3RLGA 2Q8ZA 2MNRA 1VBGA 2PDYA 2F38A 4MJMA 3JUGA 4O1CA 2H3DA 3BW3A 1YYAA 3GKAA 3R10A 5K7JA 4PULA 4IT1A 2YFNA 2B7PA 2DQWA 1V51A 3ARYA 2J9ZA 3DIPA 1SO6A 1FUYA 1SGJA 5TAOA 1FWWA 3AHXA 4XAZA 1W1PA 4DO4A 3V0TA 4AIBA 3DFTA 1FXQA 2UBPC 4DWSC 3GBDA 3EPMA 5EMLA 3WLOA 3SR7A 4AEEA 3W4RA 3VIJA 4MSSA 1I1XA 1W56A 1OF6A 1E6XM 4KS0A 1DJYA 1ZPTA 1KQYA 1EH9A 4Q8MA 2IQ0A 1B4KA 1K02A 1Q66A 3K8MA 4GXPA 3ELFA 4AH7A 2VX7A 2Q3OA 1C8YA 4C6MA 4MFEA 3QM3A 1EUAA 3F4VA 4X9YA 3IAQA 4WR3A 4LAOA 1XIMA 2G41A 4UQBA 4Q4SA 4JTFA 1CX9A 2C0HA 5DEZA 4NRRA 5K9CA 2ZX8A 2CLOA 4F2BA 3N13A 2YCLB 2FPYA 4HNLA 3LBCA 1W5NA 3NOYA 4JYDA 3WNNA 4ZEPA 3VD9A 1KKRA 3C2RA 4Z1AA 3LNPA 4CUCA 4Q33A 3D3AA 3L65A 1MZRA 1VBUA 3VIKA 4S39A 1CXIA 4ATDA 3BGAA 2ATSA 3ARWA 1BTCA 3CC1A 4H6EA 4PGLA 4JNYA 1C8XA 1HXJA 1ESWA 2FZMA 3WDHA 4TV5A 3EDKA 2BTMA 1GOIA 2XVKA 2CCRA 3MKKA 3NDZA 1J11A 4EE9A 3KL0A 2W4XA 4OIFA 5CJMA 1TB3A 4LUIA 3VM7A 4M6PA 4ZQOA 2R14A 3S0CA 4ATLA 1IT0A 4KRUA 3P2VA 5DELA 3ORWA 4MOZA 1JDDA 4B2DA 4IIBA 1TUXA 3AI0A 3EXSA 3BMWA 2OEJA 5CPLA 4PC8A 1DKWA 4AVNA 4EKJA 4E5TA 1PS9A 3BZGA 2OLSA 3KHDA 1LT7A 4RE4A 4GJ1A 4L1WA 4H41A 2ALRA 3F7JA 3FAXA 2YA0A 5REQA 4MB5A 3C0SA 4WHBA 5CAHA 4IIEA 4WRHA 4WCJA 1TV4A 3A64A 2DGAA 5DBTA 4B15A 1TPDA 2QJHA 4C5ZA 4LXFA 5B80A 1QNRA 2DZSA 4GUIA 3P82A 1TE6A 3D46A 3KOWA 4RR4A 3CXOA 1IT7A 2OR2A 1YPFA 1ISWA 3BLKA 5I06A 4HNCA 2J77A 2Y85A 1WDRA 3BLLA 3SUSA 1SJAA 3FDKA 1D8WA 1GPWA 1YBQB 2D1ZA 3F4CA 3RNDA 1SMAA 4LS1A 3DFYA 4IGSA 5JBEA 1CGWA 3WQDA 4O11A 2PDXA 3MWCA 1A5AA 4A4AA 1JPHA 3FXYA 4J2PA 5SWUA 4EXQA 1V3HA 3N6JA 5G2IA 2NX3A 1XDLA 5AHEA 1XIBA 1UWQA 4MWAC 3T4WA 3WUFA 3OLGA 2VFFA 2ZXBA 5I3GA 3ANUA 1WAWA 1H41A 3PNUA 1M04A 4L65A 4TTUA 2Y1HA 4PEKA 4AWTA 2QULA 2PLJA 3VIOA 3OLIA 1W6TA 3KRBA 4ORMA 4HHLA 3P3BA 4DYEA 3CAQA 4V2XA 2FTYA 3EMCA 2HROA 3MMUA 1Q65A 2GZXA 3H2MA 3MHFA 4PRWA 4WY0A 4UUIA 3L12A 1YPIA 4N9CA 3R79A 1EGMA 2XINA 3FOKA 4Y8EA 2YW3A 1AMYA 1TV2A 3TN6A 3NSXA 3H12A 3O3RA 1EX1A 4OFCA 1B3YA 4RW3A 3TXZA 2CLMA 3WBYA 3V36A 3CHEA 1EIBA 3HO8A 1R46A 3VGGA 1XD0A 3PWIA 1DV7A 2BGQA 5E9AA 3W24A 3ZLFA 4YXGA 1SSGA 2V9DA 3TONA 2J7FA 3P67A 2AQWA 3M0IA 1M68A 2GGHA 3B04A 1CB2A 4BA0A 1F73A 3NO1A 1UG6A 2XFRA 3QOMA 4LVDA 2VTFA 3PG9A 1BYCA 2ZRVA 3WKZA 1NWTA 3CHCA 4NAFA 2FJKA 2V3FA 2ZVIA 4Q6XA 3TXVA 1CXFA 1UKQA 1DJHA 3OODA 1TO3A 4DO7A 3B0VC 3W75A 4DJED 4X60A 2AGTA 3EWDA 1A4MA 2DW7A 3W1TA 2P53A 1HKMA 1E1FA 4Y7EA 3AXXA 3HGJA 4UTLA 4FO4A 3KOZA 4I7VA 3W38A 5A8PA 1RVKA 2HE5A 1SZFA 2WSPA 3VGFA 1JZ2A 1E0WA 2CHNA 2PCEA 4H8UA 4JNZA 3SW6A 3LCFA 2R91A 3C6CA 1PJ9A 1DBTA 4L80A 4D8AA 3WD3A 4LVGA 2NV1A 2I5GA 1DL3A 3CV6A 3O6AA 1A5LC 1FWGC 2P8BA 3VIGA 1EYEA 3AUOA 4IPIA 5E0FA 1ELSA 1Q45A 4C6EA 3M41A 1FRBA 1XIIA 2Y0FA 4ZTXA 2J25A 3C86A 1H0IA 1RLDA 3OOQA 4O1EA 5EYWA 3GVQA 1V0MA 4WSHA 2JQXA 2A3BA 3ANYA 2JFEX 2D0GA 3QW3A 3LDVA 5I5RA 3T8LA 3VOIA 5IFTA 2EO7A 4PZVA 3UT0A 4QG9A 1OX4B 3QF0A 1O5XA 1G94A 2VZVA 4ZTYA 4K7YA 1UR4A 3R6IA 1GVYA 2ESCA 1KQZA 3P61A 1K9EA 2CLEA 3HFTA 3GK0A 2BG5A 3MV01 4IGMA 1DWFM 1EPXA 5EFDA 2FGBA 5JVLA 1S2AA 2BY0A 1SR9A 1L2UA 1UKTA 4CN4A 3UG5A 4DWSB 3SQMA 4A3QA 3SY1A 1F3WA 4S3GA 4NI3A 1A3HA 4B9ZA 1Q6FA 3OZPA 4JEQA 3MMDA 2WWCA 1E0XA 2ZZ7A 3E49A 4AIEA 3H26A 3S1UA 2V2CA 3IIZA 1V7AA 4O1DA 4HBKA 1XFBA 3NNTA 1SZGA 5DXXA 4RNHA 3UQNA 4O15A 5FIPA 3KVLA 4MB3A 5I79A 1R5YA 1XGZA 2DQXA 2NVDA 1TMQA 4FSAA 4LRSA 5CG7A 1P0NA 4NJJA 3TTEA 1EWDA 2DW6A 3AIQA 3ISIX 1VHNA 2DIEA 4G1KA 2ZC8A 4PMXA 1YTEA 1MFVA 4Z2GA 4XAYA 4FLOA 3VKKA 4NZ1A 3BCFA 2Z27A 1GONA 3I7RA 1Y0EA 3T07A 2E8YA 5KZ6A 1S1RA 1EL3A 3CIWA 1ZLPA 3UBPC 2IXVA 1ODUA 3KDOA 4REQB 4GHRA 3E96A 4KF1A 1E4MM 4GABA 3FSTA 4JTJA 3BLIA 4XSLA 1Z8AA 4LAMA 4LNYA 1X6UA 2J24A 4C91A 4MPQA 2FQIA 3H6OA 1J96A 2VDIA 5I3FA 1R9XA 4QAWA 1RY0A 1RBOB 4B4HA 2DSKA 5GVJA 3SUTA 1GJUA 3AJXA 3ANVA 3QKEA 3FJLA 3NM1A 3EEZA 2FB3A 5BMWA 1BVNP 4QQUA 3LM3A 4RDVA 4HN8A 1CBGA 1N8FA 3I6EA 3B8IA 4D6DA 1TFVA 4OBRA 1M03A 1PHQA 2OZ0A 2Y24A 2J27A 1UWSA 4GQGA 1EQCA 5E70A 2CPUA 3THUA 1KV8A 1VKFA 3NPUA 2NWRA 3L4UA 1RP9A 1PKNA 4M24A 3RCMA 1ONRA 2WCSA 2VRJA 1JEZA 2YX0A 2J74A 4S3DA 4C1NA 3SM0A 2Y63A 3ZJ7A 4L56A 3LMZA 1RJPA 1TVPA 2XVNA 3T0BA 4ATWA 2OQYA 5XIAA 3WYZA 3Q2DA 1Q5MA 3ZOAA 3COTA 4CD7A 1FXPA 1XRSA 3VIHA 3N2MA 3NL6A 1OIFA 1BWKA 1JD7A 4UBPC 1CYGA 3WLJA 3QC0A 3QMRA 5G4WA 3CQKA 5EMJA 3UZ5A 3FEMA 4QE5A 4MY8A 3WSUA 5C8BB 1VEPA 1SFJA 3WUGA 4NHVA 4TVUA 4BF5A 5M03A 3O63A 5EMMA 3MJYA 2KZHA 3TNBA 4QISA 3KTCA 2QLYA 5IRPA 4UNLA 5A6JA 4B3LA 1GKQA 1A0EA 4GC3A 3VOFA 3S2JA 2OEMA 4JQ3A 5D2WA 1QI5A 3CO8A 4JCMA 1J5SA 4S3FA 3NO3A 2C16A 3FJ6A 4LCRA 3FS2A 3QQ0A 4JTIA 1JZ5A 4ZO9A 3SFKA 2OLHA 4I7UA 1M9HA 4CCDA 3VNKA 1AD4A 4I9TA 2GL5A 1M7XA 2V63A 1IIHA 4GNVA 1G4TA 4D6JA 2DSWA 4LJ3A 2G3IA 1JULA 4JKKA 5D8WA 2AL1A 4A8NA 1MW3A 3KFTA 4E3VA 4ECLA 3OGRA 1X98A 3NR0A 1EGVA 2E67A 5HXMA 2D73A 2PEVA 2Z28A 3W23A 4MZYA 4PUMA 3G8RA 3A5FA 2YOCA 1V6XA 4QJ3B 5LA2A 1I60A 3TFCA 4LANA 3MP5A 1LQ2A 1WV2A 3NZPA 3HGSA 1H61A 3LLDA 2E9MA 2YFOA 1A47A 3C61A 5C0QA 5G4EA 1TJ2A 4XB3A 5FESA 1EZ2A 2FVMA 2PB1A 2A3LA 1I2NA 2NSXA 1JVNA 2YLLA 4GXMA 2ZUWA 3EX6A 1AQMA 3G1AA 3GVGA 2V5KA 3WMLA 2GYIA 2WJDA 1QI3A 4J3VA 4OQVA 3ABSA 4X2RA 4AEFA 3PUDA 2Y4SA 1KFWA 2EG8A 3HZ3A 1UR2A 1ZCOA 3UWEA 4AD0A 1X39A 4FHAA 4LU0A 4Q7IA 3W1PA 2YA2A 1NWSA 2NXIA 3DHDA 1UIPA 5AKQA 3M6YA 3WJZA 4HOXA 4Q4RA 2CHRA 2X1SA 5JBFA 2DPEA 1H0GA 3BK0A 4QLKA 4PN2A 5CSSA 1PTDA 4X0VA 3SCSA 4GJIA 2BHUA 3DESA 3TTQA 1NQ6A 5AC5A 4IMGA 1QHPA 4Q8NA 3CAWA 1ZJIA 1DJZA 2FIQA 1ZB5A 2ZE3A 3PSWA 3N4FA 3WENA 3TWBA 4EPDC 4BKNA 3RHGA 1EOMA 3VNYA 3P80A 2TPSA 3M0KA 4MDPA 3QHOA 4CQBA 1D2KA 3CUXA 4ZODA 3WQFA 5K2ZA 1V0LA 4A3RA 3C3UA 3P0XA 4PMYA 4U5KA 3C8NA 5AHNA 1V6UA 2VC5A 2GGIA 3T0TA 3QV7A 3D5HA 7ODCA 4ALDA 3LU2A 2CFFA 4PMQA 1YDVA 5A8MA 3W6LA 5C71A 1OFOA 3S9IA 1R3YA 3PZOA 3IEBA 4PMDA 2A3HA 3T2QA 1BYDA 1JPKA 1H49A 1YMYA 3BZJA 3WK0A 3QY8A 3S83A 1K7EA 4HCDA 4AC7C 1VGAA 1FHDA 2D3LA 3DYOA 2IKJA 2PWFA 3NSNA 1L2QA 4IQDA 3ENLA 4RZ4A 2X05A 2V8ZA 3U48A 4O14A 3TOPA 4F66A 5TQLA 3LHTA 2R1KA 2VQTA 5GNXA 3LRMA 4QE1A 1J0YA 1XRVA 4PUJA 1SVDA 4JTHA 4ENLA 1LQAA 1QNVA 5BYWA 4KWSA 3SUUA 4ACYA 2DUAA 4XVDA 4AD5A 1XH2A 1H7PA 2QR6A 1HGWA 3WQEA 4CEXC 3HGRA 2QCCA 3IIPA 3AYTA 2Y5JA 2D24A 4M5PA 3NQ8A 2ISFA 4CN6A 4GO9A 3NYZA 4HNTA 1S2VA 4QDMA 3MJMA 4Z0SA 4AY7A 2ZUVA 1Q8AA 3BICA 1JQXA 3NXLA 5M17A 3WLLA 1W1TA 5CC6A 1DTNA 2RDUA 4PMVA 4IG2A 1PDZA 3WFAA 1YXDA 1UZDA 3QYQA 1GHSA 1NDZA 3QEZA 1M1BA 3OVPA 4FK9A 2DT2A 1H63A 5ENLA 1VQTA 1JRCA 2ODOA 1Y7VA 2G97A 4XUYA 1EFZA 3DU0A 3LX9A 1EJXC 3E0FA 4IP7A 3L4TA 4YVXA 1TZZA 1H7NA 4IXXA 4G6CA 1B2YA 1ZFJA 2ANUA 3WNLA 1XPGA 4JQ1A 5B7ZA 2BFGA 1YQ2A 4DJFD 3EB4A 2Y6ZA 4RL3A 3I4KA 1VH7A 4OOZA 2VWSA 3S42A 1WNOA 2QEZA 3FA4A 4PFHA 4B5SA 1KBLA 1ECEA 2G4JA 2YCIX 3AHTA 4AIOA 2FZBA 5A69A 3U0HA 4ZL1A 1Y5VA 2V2DA 1ZAIA 3VKJA 3ME3A 4RW5A 3ABRA 5I77A 4RX0A 5HMFA 1VYPX 3BMXA 1T8XA 3UCCA 1WDQA 1AUSL 4Q4QA 3S9YA 1S46A 1G67A 4RV3A 5HWNA 2XUCA 3OBAA 1MDRA 4YU1A 1F8IA 1MDLA 3OYZA 3AIWA 1IT8A 1E3ZA 1HP5A 3VC5A 2V82A 3R0UA 4XIAA 2BGSA 3UGVA 4KWUA 2WLZA 4G7EA 3STEA 1QI4A 5HR7A 5HWJA 4CCCA 3GC4A 4KFOA 2PFHA 4H9MA 3TA6A 4LY8A 3GR7A 1NTHA 2BLEA 2C1GA 3S2MA 2FVKA 4LTSA 3PBGA 3VVGA 5PTDA 5MHBA 3W7RA 4X22A 3VKBA 1UIOA 1NARA 3T78A 5D09A 4FX6M 1E0VA 1E4IA 2QDGA 3G3DA 2W27A 3O1NA 1SO5A 1EXPA 1VJZA 1PSCA 5HBFA 1MMFA 1RBAA 4BFAA 3G1DA 4CQ8A 1GW9A 1OGGA 4LC6A 5M2FX 5GQBA 3AXMA 4Z17A 1UB3A 4F40A 2PGEA 3W76A 1U5VA 5A2AA 3LPOA 1ADOA 4ZBCA 5G2HA 4Z2IA 2GWGA 2EPHA 2WW5A 3T0AA 1HF6A 4EAYA 4JR5A 3GHRA 2VL4A 7REQB 1W9UA 5M3WA 2XFWA 4JTRA 3SY8A 2CXEA 3EWCA 4Z2JA 3GXFA 4DO6A 3BCDA 1KRMA 2DH3A 1LRTA 3IIOA 2BX7A 1GYLA 2PODA 2VUYA 3GTHA 2WKGA 1UZ4A 1PTAA 3T05A 1QCWA 3YPIA 4DJDC 4JDYA 3WBXA 3JR2A 4O57A 3EOEA 1PKYA 3EKLA 4LFYA 1KFCA 4E2OA 4XZBA 2XPKA 2V5CA 5AYIA 2PWGA 3FGCB 2DSZA 1JAKA 2IPGA 1XISA 2RH9A 1W3LA 4XD3A 1TPUA 1UD4A 3RUBL 3NDOA 5D9PA 4IXHA 3CM4A 1KFJA 3N4EA 1MFUA 4FNSA 1OHLA 1QASA 1NEYA 4G2DA 2O0TA 1TVLA 3W22A 2XM2A 1AW1A 4JQ2A 4MNJA 3T81A 1VRDA 1JUBA 5G1YA 4FNRA 1PYFA 1ZNNA 3VC6A 1H09A 1XYFA 2GUUA 3M9YA 4GQQA 1QK2A 1BGAA 4JICA 1FA2A 3VYLA 2JEPA 1YIXA 1WDSA 3OIHA 5GJPA 3ZR5A 2IQTA 4BWLA 3EWBX 1XBXA 3ERPA 4HA3A 3PTMA 2FJUB 1HNYA 4J3TA 1M53A 4F9JA 4CN1A 3M0LA 1P48A 1V6TA 2JE8A 1GVOA 3WL0A 1E15A 4AZHA 3VOGA 3WJSA 2HCVA 4JIQA 1J6PA 2OQLA 4LH8A 4G9PA 3F4DA 1P6WA 4GUHA 1KFKA 2GFTA 2R6OA 2OT0A 4YVVA 5IFPA 2E25A 2GVEA 1XF0A 3WQ5A 3GG7A 2HVNA 3UWQA 1DTUA 1EA9C 1TMHA 2PGWA 1FCVA 1QVBA 2DV0A 2PURA 2WB5A 3GHTA 4PRRA 5EL1A 1LRQA 1A5CA 4WD0A 3T9PA 3OGVA 4WOQA 3W3OA 3GBEA 1WOAA 4R3UA 4O0KA 3ALGA 4E4UA 1J93A 1UP3A 3SCVA 2ABAA 4XVEA 4CQAA 4GUGA 2Z29A 4HMCA 1XIGA 1DQUA 3SGUA 1EYWA 2XWDA 4MWAD 1M7JA 3T0DA 4C1KA 1WB0A 4A8IA 3DEQA 2PU1A 4F0RA 4QP0A 3QSTA 3CQIA 2HISA 2VGGA 2ZDSA 4QNWA 2QCGA 3KVMA 5HMSA 3RGTA 1XGEA 1VPYA 5AOUA 1QPQA 3KBVA 2Z6JA 4D71A 1PEZA 3VIIA 1REQA 3CTTA 4GYPA 1MO0A 1WZLA 2BXVA 2O7SA 1OVDA 3L2MA 3C2YA 5A2BA 3B0YA 4KGJA 1XKJA 1D7FA 4EXBA 3GNPA 3WH8A 5C9RA 2QJNA 1K1DA 1C8VA 3PJUA 2WZTA 2YL8A 1I1WA 2PRLA 2P0IA 4QM1A 4IISA 3I3DA 4LYKA 1HL9A 4RDYA 2OYKA 4AY1A 2NLYA 2E6FA 2FTWA 2AQVA 5TBOA 3FY1A 3L5LA 2PGRA 3ITVA 3N34A 1TA3A 4PODA 5FAJA 4H00A 2XIOA 3N9KA 3VNJA 1YDNA 4JIEA 1HVXA 5I3IA 1VFUA 4GG9A 1D3CA 2BBFA 1NM9A 1LRNA 1ODZA 2PTYA 5EBUA 4M19A 3TMLA 1W9PA 1UD8A 3WJXA 4F3HA 4CVWA 3H2OA 1QWGA 1GJPA 4F9DA 5BXSA 3QGAC 2XGZA 2FZDA 4EPEC 3AO0A 4F4RA 3TYDA 2Y88A 3T55A 2QS8A 3QY7A 2EQDA 3HG4A 3IS4A 2YB4A 2CYGA 1OFRA 3TQVA 2YBTA 3TV8A 4ERIA 1SM9A 3GHSA 1LLOA 4JS3A 1WPCA 3RFAA 1X96A 3WG6A 3SEPA 1CI1A 4QRNA 2GVJA 2DDXA 4D6FA 3RPMA 1L6YA 4LVAA 1R85A 3MB9A 2C91A 3WFZA 1AFSA 1AD1A 4NIRA 3K4WA 2QT3A 4P8WA 4WJEA 3R8HA 2CERA 2XISA 4HU8A 1KR1A 1W3JA 3VAVA 1OIMA 3LZ5A 4RZ5A 4UXDA 4IMFA 3GYEA 4WX2A 3STPA 3WH5A 2PWUA 1S5NA 1DOSA 1MEHA 4M3PA 4BI6A 1EDQA 4MPKA 4GFIA 3VGEA 3H4WA 1YE4A 4JFTA 3VDGA 3NFUA 3EWWA 4PSPA 3QR1A 4C6QA 3V1PA 4JDBA 3L5MA 5AHMA 3VNDA 1H5VA 1EO7A 4JKMA 1Y65A 1W1IE 2XGIA 1LG1A 4RNFA 4JTLA 3DXIA 3VU2A 3CPGA 3ZIZA 1L9WA 4HK5A 3D0CA 4FXRA 2CLPA 3VDCA 2W63A 3OHIA 2DZPA 4K8EA 5ABGA 3L21A 2OX1A 4B5TA 4UNIA 3VOCA 1B5TA 3C0LA 3WLPA 3IVTA 2CBUA 3L67A 3N9SA 4V1YA 1GOXA 4AD2A 3GAKA 3M5ZA 2POTA 1Q7ZA 4DZIA 3FJNA 2EBNA 2PD5A 3WMSA 4GIEA 3EB3A 4NZJA 2AAMA 1TQJA 1E1CB 2YCKX 4BF7A 1WO2A 2C13A 1HZYA 3K1GA 4N02A 1ZENA 8XIMA 3FKKA 1S2WA 1M6JA 3F5KA 3D47A 4V1XA 3L68A 3R43A 4JTKA 3ARQA 1DXIA 2JIWA 3MMWA 4PUNA 4W8BA 3NEHA 1X8FA 3M7SA 3AQUA 1GEHA 4A2SA 3VD7A 1X1ZA 1JUEA 4US6A 4U2YA 4V33A 3E0WA 5DFAA 3L7RA 3JZEA 1EJ7L 3KBSA 4Z08A 3C0QA 4RK8A 1QJWA 3I68A 3P5YA 1MI3A 3SN1A 3IK4A 1E6RA 3IARA 1WE5A 3CUHA 1SJDA 1EB3A 4AZ7A 1J5TA 4JBRA 2WANA 3WL1A 3DFHA 2C8NA 3FXGA 1XW8A 1ITCA 3SCPA 3ZZ1A 4E2BA 1QPNA 1PXGA 3EPNA 3PAOA 4FNQA 4BCEA 2FFIA 3RF9A 1VBJA 2V0TA 3GNXA 2HWGA 3WEZA 3QV8A 5FSDC 1QNPA 1MRAA 3W87A 2V69A 4GGHA 4Q8VA 1ISVA 1XUZA 5DCBA 2OSXA 5I23A 2ZTJA 4P2VA 4MZ1A 1ECQA 1CZ1A 3PZGA 1R2RA 3QR3A 3V5FA 1ZJBA 1UW9A 1W2PA 1CCWB 5JIPA 1RQHA 2F6XA 1PUDA 4HYVA 1O1ZA 2J7BA 4KRZA 3IJ9A 5A6LA 4PYSA 1KLYA 2J7DA 3NZGA 3BV7A 4XKYB 2VOMA 4I8DA 1G0CA 1UWAA 3QTPA 5BOOA 2XZ7A 3B8TA 1FOBA 3AMCA 3OVQA 4O12A 2HPMA 3C52A 1KM3A 2QJIA 4PSRA 3O6DA 5T9CE 2JK2A 1OFDA 4B5UA 1AVAA 1EC9A 2WVVB 3BSMA 4HMEA 1OM0A 4BS0A 1KO0A 4WLCA 4NNCA 1EJTC 1DORA 1W9VA 5CPQA 2OQHA 4LS2A 1F74A 5EU9A 4WSKA 2WBKA 4HA0A 1FTXA 2F9RA 3LHVA 1W0MA 1Y5XA 1FFQA 4GYKA 5C9WA 5CAKA 1IF2A 1W5MA 4O19A 4PB4A 1JPDX 2C7FA 3W29A 2E09A 4AD1A 4KCTA 2PWEA 2CHOA 5C9UA 3WEMA 4E4PA 1VS1A 3LXCA 3THQA 3Q45A 2B31A 3MP4A 5IDIA 1P0KA 3W82A 1HKIA 4AF0A 1KM2A 3VCRA 1S2UA 1W54A 2PS2A 3HGOA 1EHNA 4S3BA 1JAEA 4IP4A 1DIEA 4P8UA 3DZ1A 2H9AA 1G69A 4UWMA 1OGSA 5IDZA 1JQVA 3AXKA 1FVPA 1V8EA 3IVSA 4D6IA 3DN5A 4ONVA 3WH7A 1XX1A 2HE8A 2FGZA 3MV11 3UD6A 1A5OC 5XIMA 5K9XA 3REQA 1US2A 3N29A 3QSRA 3PUGA 1RD5A 5T8GA 3CHFA 4H9VA 3UY7A 2VVSA 3NQGA 5EMKA 1KNWA 4ZFMA 4HPXA 4AFYA 2PWVA 4MY9A 5DLCA 3DX5A 3NQ2A 5LNVA 4AZCB 3A9IA 1UUOA 3BGJA 3MUIA 4NZ3A 4GO8A 3CT2A 3MUY1 4Q3MA 4HN4A 3ARXA 4H83A 4UQEA 2VGIA 4U5IA 3AU2A 3RM8A 1FY6A 1KKOA 4B4FA 4B2DD 4N42A 1EDTA 4DF2A 8XIAA 4MLRA 2OOGA 1TWDA 3H53A 4JHOA 4BWLC 3TYZA 1KRBC 4R33A 2E9BA 3I10A 2OSWA 3URNA 1OC5A 4CCEA 2CZ5A 4KEZA 4PEEA 1IE7C 3A3WA 4PMNA 3ZR6A 4RDZA 3VOHA 1KD0A 1F3TA 1F05A 5KSWA 2QCHA 1UYQA 4NAEA 1KCKA 1QTWA 3JW7A 1N55A 1VPQA 4GYFA 3C3NA 2XN0A 3R12A 3DYMA 4P5UA 3DG7A 1LOQA 5HULA 3TLQA 2G8ZA 5FJRA 4IFKA 2Z4GA 4GUFA 3HQOA 4UTWC 3FYYA 1Y8BA 4PTVA 3MANA 4R7JA 2GQ8A 1AA1B 4JQ4A 4DZ5A 3AOFA 2F8QA 1UP2A 2WV8A 4NJGA 1PO9A 3GQYA 1UD5A 3SCNA 3AISA 3S5ZA 1QW8A 1T41A 2VENA 4LUSA 1E5NA 3DFNA 2KAUC 5HDRA 4XSMA 3EXRA 2I14A 4UTUA 2DVTA 1OF8A 1RPXA 5IHRA 2PE4A 2ISVA 2ZOXA 1Z48A 4UQDA 3V0UA 2ZRUA 3N4AA 2YL5A 3SY5A 3B0XA 3VNZA 5DRIA 3KRUA 1UPMB 1XP3A 3OTRA 4H9TA 1V5XA 3WUEA 3PS7A 4DI8A 2AL2A 1GW1A 1B57A 5LA1A 4JAWA 3KVJA 4GYPC 3QLDA 3POCA 1FKXA 4Y9AA 2OG9A 5FL1A 3N15A 3B0UX 4BZYA 2OXNA 1CDGA 3NA8A 2OPJA 2ACUA 4W88A 1XLDA 3PG8A 2ZE0A 2E1WA 1TG7A 3H4GA 7TIMA 5F4XA 3VD5A 3GSMA 3UWZA 3S5NA 4UFLA 1VR6A 2OFJA 4GISA 1OY0A 3EX3A 3VX0A 4GY1A 2YGYA 4P7RA 5FEWA 2UZ9A 4W7VA 3D3FA 1O6IA 1UD6A 3WQ6A 1DE5A 4TUFA 1HO4A 3UZWA 1J01A 4LT9A 4ROPA 4KEMA 4O28A 1Z6KA 3AYRA 1I2OA 2WVSA 3B8DA 2GSEA 4RZ6A 5E0CA 3WMCA 1Z7AA 3ITLA 3AIBA 4XTDA 4MG4A 2WM0A 4O53A 1US0A 3DDMA 1X7IA 3HQPA 3OBEA 1FWFC 1Z41A 4X2PA 4M0XA 4GVGA 3S1GA 3LOTA 1IEWA 1VHCA 4E38A 4CLMA 3PB0A 4GZ7A 3W7OA 1H51A 2PU0A 3MA8A 1QMLA 2ZA1A 4XZ9A 2CU0A 1UKOA 1E56A 5CGMA 3UCDA 3USZA 1NOUA 4FALA 4LEQA 4LVFA 2O56A 3ARZA 4XD6A 1GYNA 3W27A 1RZMA 4IUOA 1F8MA 3NQFA 1UR9A 4Z1BA 2CEQA 4DBEA 4CD4A 1ADSA 2XIQA 4A8RA 1U1HA 1LYXA 5AFDA 3ZYZA 2YCEA 3L4YA 3FA3A 2PF8A 2POZA 3KZSA 2XIJA 2QUTA 4FLQA 3NVDA 2X7WA 1FWEC 1PKLA 1VFLA 3MUZ1 4ICCX 4MIMA 1S2TA 1XH0A 3LCWA 5KINA 1JR1A 4J1OA 4ZMGA 2PDLA 3LB0A 3ZSSA 4PUKA 3G6MA 3OYXA 3B05A 2QDDA 2B4GA 1SZNA 2GSHA 2EKGA 5E6ZA 1CEOA 5U7SA 3HQ1A 2ZADA 2DZBA 2WMIA 4DELA 2GK1A 2Z1KA 3WD4A 2WCAA 4I9JA 3G1SA 3LI1A 1J79A 4JX4A 4PUWA 3IJ7A 3AMLA 4NJKA 1IGSA 4K68A 3CZLA 2WMFA 1BLIA 3W02A 1S5MA 5DO8A 1BWLA 2PBOA 4IGHA 3N2BA 3DHFA 3LV6A 4MNLA 1JDEA 1G4SA 3W7MA 1C9WA 1X1NA 4WDWA 3UG8A 3GFXA 4JTEA 2EF9A 3THCA 4M7SA 4GUJA 2OX4A 1LOSA 3O6YX 7PTDA 2EJAA 3IJIA 5HNUA 4H8NA 2XHYA 2F2HA 2ATMA 4N0RA 4FR1A 4R9OA 4F0LA 5D38A 1KM4A 4C6IA 4V27A 3UNTA 4UMAA 2YYTA 2H90A 4GC4A 4IJRA 1VBHA 3K13A 5I07A 2VX6A 2WNNA 4P7QA 2JGQA 3PPFA 3SJ3A 3W1QA 5DY2A 3P74A 1HIZA 3W81A 3HM7A 1O7AA 4H4IA 1FWNA 1L6SA 2HSAA 3MYPA 5FF3A 4H7CA 1ZBVA 4C6NA 4H6RA 1E6SM 3KP1A 2BSLA 1XYZA 3CUJA 4AMAA 3T1GA 3EA1A 4A2RA 4ML4A 5I6SA 5JU6A 4PRTA 3T44A 5D02A 1B9ZA 4G8TA 2G3MA 7TAAA 1WKDA 3EDDA 3S2LA 5AC4A 4O8AA 4FA3A 4LGXA 4AQLA 4BHYA 3LGGA 4FS9A 1CGVA 1QWKA 5E1QA 2E68A 4RKAA 3TVAA 3MS8A 1W1ZA 2VKZG 4FNUA 1Q6CA 4FNTA 1QNQA 3PUOA 3E2QA 3GIPA 5XINA 1OK4A 5LNSA 2PC8A 3S5YA 3UWUA 4LCSA 3BLDA 3TP4A 4KFPA 3WEOA 5FL0A 1OEPA 1P0BA 4QAIA 3VGDA 3N73A 1EC8A 3GW3A 5AYYA 4DAIA 3MI2A 4J28A 3QXBA 2WQPA 2VRQA 4U3CA 3N2TA 4LVBA 3VPLA 4IP5A 2VCCA 3VUPA 3G1YA 1W8GA 3PTQA 3PBVA 4I5RA 1VC4A 3GX9A 3DHUA 5IHSA 4L6OA 3EX1A 5IBXC 3MKCA 4NSBA 5CSYA 1HKVA 3DBPA 4O1FA 4EPKA 2DVXA 1SW0A 1H4PA 4DUVA 3N6QA 2P3EA 4LBRA 3IVUA 1M7OA 2ZZ1A 3GH7A 1ZCCA 1QAPA 3FDGA 4L6HA 1JDAA 1JCYA 2JKPA 5D33A 3B9EA 4PTDA 3WDPP 4GACA 3NQ6A 3T40A 3R1ZA 3HV8A 3QLLA 3TN4A 1PX4A 3QKZA 1YADA 1NY1A 4GVIA 2J9YA 3IGHX 3LLFA 1JZ8A 4NKCA 3V1HA 1XIDA 1IGWA 2I5IA 3H21A 2C14A 1QHOA 1Z3NA 3URQA 3W01A 4CQCA 3OJGA 3PK7A 3WNPA 4UZUA 3PPGA 1MEWA 4PUEA 1VFTA 4QITA 4C65A 1E9LA 1RA0A 4TU1A 4NNAA 4ZE4A 4XISA 1KBJA 3TJLA 2G0WA 4Q4OA 3I6RA 2HNEA 1CGUA 1OK6A 3TJXA 1QK0A 5HQMA 6REQA 3W2UA 1G01A 3AYVA 2RUSA 4DY1A 2YW4A 4GBDA 4BY3A 2VNCA 4NL1A 3NDYA 4UQCA 1Q4WA 2ON3A 4UR7A 4C6CA 1UR8A 3A9BA 4NP7A 1P4CA 4DWDA 1XYLA 5CXPA 2QCDA 3GH4A 2VDHA 3QR0A 3RDKA 3ZSTA 3TQKA 3KUMA 4HZMA 1FWJC 1E9IA 1YRRA 1P0EA 1OSEA 5DMMA 4KERA 1UC4A 3GB6A 3WMBA 4YTQA 3KRSA 3KOFA 1WXYA 2ZDRA 1UH2A 1XIEA 2NSOA 3GDRA 3ZWSA 1QUMA 1W31A 4HQVA 4CD6A 4NX5A 4AB4A 1E73M 2VCAA 1J6OA 4JTUA 4HT3A 5ABFA 4IMCA 2F6UA 3LPPA 3NEVA 3GTIA 4GLEA 3MQTA 5FF4A 1OGBA 2CETA 4CGTA 4AY8A 3V5OA 3VNMA 4R53A 1QR7A 1R3SA 1X38A 4LS0A 3UG4A 4K1WA 5C70A 4Q8WA 3IUIA 2IS7A 2Y7DA 4KKXA 2QDEA 3TQ0A 1KTCA 5AZ0A 5FJOA 4POCA 4O8RA 2VHLA 3WH6A 1TQXA 3NTYA 1JG9A 3NUKA 1ZRQA 2J78A 2BP1A 1KBIA 1EA0A 2NQLA 2E77A 3L4VA 4XTIA 2A85A 4XD4A 1UPPA 5CLTA 4NX0A 4UTJA 1CPUA 1JXJA 2VJXA 3H70A 4YCOA 5FJUA 3PUEA 1EF2A 2PTWA 4XX6A 1IXPA 1NDWA 3RLVA 3PFMA 5HATA 3BE7A 4TMBA 3WLHA 3HU7A 5A5WA 3AHYA 3ATYA 4CNOA 2Y61A 2O9RA 4J4KA 4OKDA 1O5QA 3B3DA 4MB1A 5MKGB 4JN6A 3EDEA 2W66A 5C2XA 2WNZA 1Z32X 4Q8PA 5AC8A 3W88A 2BVTA 1AW5A 3WELA 2YB1A 2QCMA 4LNCA 1BG9A 4ZE5A 2X1RA 2A7PA 1V6VA 5CPMA 1P5BA 4NYUA 4L9ZA 4IOTA 4CNNA 1UC5A 5DF0A 3WD2A 2CLKA 4OUEA 4QDPA 3BSGA 4P7NA 2X30A 2FH6A 2DH2A 3MUCA 1W5OA 4Y9NA 3WCZA 3R0DA 5K4ZA 3NQDA 1UA7A 1WQ5A 1OBAA