4IMEA

Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164a mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIKHYYDSIIEATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVAFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSSEKVAFAKELKAKYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-acetylneuraminate lyase
publication title Structural Basis for Substrate Specificity and Mechanism of N-Acetyl-d-neuraminic Acid Lyase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida subsp. gallicida
total genus 117
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4imeA00
4WY0B 4X3ZA 2DZVA 1R30A 2BX7A 1K7XA 1XC4A 1MZHA 2E5BA 3QYQA 4WY0F 3PR2A 4N6EA 5K9XA 1FX6A 4Z0JA 3TU9A 1GVOA 1FWTA 4AMAA 3LHYA 2ZZ7A 1Y0EA 3CM4A 4E0CA 3BG9A 1GVQA 1J2WA 3DI0A 3V1PA 4C1KA 1YDOA 2YR1A 4OE7A 4PA8A 3W7NA 4A22A 3HBLA 4MJZA 1OFPA 4MYXA 3W1AA 3NM3A 1XBZA 5A5WA 5HR7A 1OFEA 3UQNA 2DJXA 3W73A 3EWWA 2NX1A 2FDSA 3O6YX 1A53A 2C3ZA 1TO3A 2PURA 2CZFA 3W74A 3ABRA 3DXIA 1EWDA 4MFDA 1TQXA 3PBWA 4Z08A 1IXQA 4FNQA 3EEGA 4K6AA 1OFRA 1TCDA 4GRSA 3LRMA 1Z44A 1G67A 4LVAA 3LI1A 5F2IA 4GFSA 3P7YA 4LOCA 4OWGA 4MKNA 5LHEA 2I1OA 2RH9A 4LS2A 2FPYA 3PB2A 3P5ZA 3A9IA 1T99A 3UWZA 2TRSA 3SY5A 5F4WA 2ZRVA 2X1SA 3C2EA 3KOFA 4O1DA 5EA9A 3W2MA 2NZLA 1TMHA 4FX8A 5G5IA 1ICSA 4E2DA 1B4EA 4ZZ9A 1GJPA 1ME8A 3TV8A 4JGDA 2P0OA 1KM2A 3G1HA 4OU1A 4DF0A 3HGSA 4JEQA 1OX5A 1RV8A 3HOJA 3W7KA 3G1SA 4UR7A 2G96A 3GXTA 2WSQA 4LS1A 3BW3A 4UTKA 1W37A 1GTHA 4O1AA 2YXGA 4ICNA 3MO7A 4LW7A 3LB0A 1M5WA 4J9JA 1KFCA 2PCQA 3G0UA 4E38A 2WJZA 1GT8A 4ZVJA 1OK6A 4U4MA 1K3UA 1TV5A 5H2ZA 2WSYA 3BG5A 3KAOA 1H7OA 1XUZA 5BMWA 3N14A 1JCYA 4R7JA 1Q6LA 4HPJA 4P2VA 4M19A 2CW6A 4JDYA 4LV9A 3HG4A 6TIMA 3IGSA 1BWKA 5DY2A 4O52A 5FEWA 3W87A 3DGRA 4A3UA 3MYPA 3EX6A 3L0KA 4IQLA 2VFDA 1S5WA 3IGUA 1ZENA 3GLCA 5EY5A 1O60A 4K37A 3L66A 3L65A 3M5XA 5FEPA 3QZEA 1G4SA 2V9DA 1PL9A 1LLZA 2RDWA 3TE9A 4UFHA 3TXVA 2EAWA 3N2MA 3N19B 5G4WA 3TJLA 1DQXA 3QJAA 3P81A 3WK2A 4QQ3A 1EUAA 2YFNA 5CKSA 2BTMA 3MWAA 3P61A 1EB3A 1T96A 4IJBA 3LCIA 3ZWSA 4I7VA 1TPDA 1DBTA 2ZZ2A 4UFKA 2A1YA 3LHWA 3LLFA 2E77A 4K36A 4RXGA 3EWBX 5CZSA 4AWUA 1UCWA 2ZYFA 1YYAA 2Y89A 4PTNA 2VKZG 4GUJA 3M7WA 1ZNNA 3A24A 1I45A 4XZ9A 4PODA 4AF0B 1F73A 3TFXA 1VRDA 3SSJA 2YCEA 5F4SA 3P84A 4YCPA 1RZMA 4NJJA 3V75A 4UTUA 1OK4A 4IX0A 1SFJA 4UMAA 4A21A 1VCFA 3BG3A 2Y62A 2VEIA 3E02A 3C0JA 4O14A 4JD4A 4E2BA 1FWWA 1TTIA 3UXAA 3BLFA 3N73A 3JRKA 1LRQA 3GIYA 3IIVA 1QO2A 5DBUA 1LLWA 5CPNA 7TIMA 4CQ8A 3PBYA 1P4CA 3S42A 3E12A 4XTIA 3QM3A 5TQLA 3EX3A 3F4NA 3MUXA 4X9SA 3CEUA 1P1XA 3A5FA 1VCVA 4JX6A 3G1AA 1H7RA 3W86A 1XM3A 3KVJA 4UTLA 2CLHA 1IXOA 5D33A 1KM6A 4DO6A 2G95A 3WJXA 4HNUA 3F1QA 3M16A 3S1WA 4XWUA 3W71A 1T0OA 1AW1A 5D37A 1TPH1 4NJIA 2E6DA 2NV2A 3TQ0A 3M0ZA 3O15A 3BK0A 2XN2A 3LERA 4RZ5A 2YFOA 3WK3A 2NUWA 5HJLA 1W8SA 4PC8A 3WFAA 2E6AA 1HG3A 3TQKA 3MP4A 4LU0A 1A50A 2GVGA 4A2RA 4CCDA 4AWSA 3WJWA 1F7BA 1XI3A 3UXDA 3D0CA 2PE4A 3GB6A 5SWUA 4UIOA 1NAL1 2ZBTA 2ZA3A 4MY9A 3N34A 4RZ6A 3L9CA 3BO9A 4O16A 1LOLA 3C61A 3PSWA 5D09A 3G1YA 3CLMA 4LVGA 4K7VA 3H55A 3MBDA 4H4IA 2QCGA 3FYOA 1F76A 1H61A 4RCXA 4MLRA 3K30A 1FWRA 1N55A 3W9ZA 2ISVA 4Y90A 3SGZA 2PRLA 3EXSA 2DORA 1RR2A 3TAOA 3TMQA 3TW6A 3E96A 3IVTA 1I2OA 1VLIA 2ALDA 4EF9A 3WK1A 2QJHA 3C56A 5LGXA 3C2RA 1PCKA 3R13A 1K8ZA 4KFNA 3QMRA 3THAA 1G7VA 1LDCA 4LC6A 1W5NA 3C3NA 4ZQPA 3NOEA 3MJYA 3MMTA 4EF8A 1SSGA 2YYUA 4AEOA 1WAUA 4WXYA 1PV8A 3AJXA 4N2YA 4HT3A 4I7WA 1F6KA 3UWUA 2EPHA 2Y7EA 4S2BA 1JRCA 2QUVA 4LRSA 1CI1A 4FIQA 3TSBA 2A4AA 2A7RA 3TCEA 2OT1A 3NG3A 2QUUA 3P74A 3P8JA 1QDSA 5F2MA 3LHUA 1G69A 1JRBA 1W3IA 1H51A 1HO4A 1LRNA 3WJYA 1JVNA 3LV5A 1OYBA 4M6VA 2DZPA 3FJ6A 5HUPA 1VQTA 1GPWA 3QEZA 3PF3A 4GC4A 1KW1A 4OV9A 1KTCA 3QW4B 1NF7A 2YSWA 4XKYB 1KM4A 5AB3A 1QFEA 4O0ZA 2V81A 3T55A 5K2ZA 4HNVA 2X2GA 2BZNA 3UZ5A 1JULA 5CSRA 1O5XA 1WOAA 5CZ0A 4O13A 3AO0A 3UY8A 3RFAA 4GUFA 4HNTA 1TYGA 2A6NA 2NLIA 3IVUA 1V7YA 2ISWA 3U8GA 3CQ0A 5AHMA 1OX4B 2I9EA 3B4UA 3HGOA 5GVJA 5FESA 4HN4A 2E6FA 5L9FA 2J27A 1L2UA 5KITA 1Z48A 1S3HA 3EB2A 4WZHA 2OX1A 4LTSA 2B0MA 3EX2A 3BW2A 1RVGA 1CX9A 4NT0A 4TIMA 1DL3A 1ZAHA 5AHLA 4CCEA 4WQ6A 5D04C 5CZJA 3DI1A 4O0KA 4Q32A 4O28A 3S1VA 3EX4A 3OVQA 2Y70A 2BLEA 2AGKA 2P1FA 3S9YA 4HIBA 4Z1BA 3IGXA 2GQAA 4O17A 1UASA 1W5MA 1LCOA 4R33A 3ZS4A 3S8HA 2QJIA 3TC7A 3CIWA 1K03A 3NQVA 1J5TA 1H5YA 2ABAA 2Y61A 2R91A 3GVGA 3QSRA 1KV8A 3I7RA 5C55A 4HSOA 2ATSA 2I14A 2G5WA 3THQA 3VNDA 4FX7A 3TDFA 1Q45A 2EGZA 4LV4A 5EMUA 1U5JA 3W7MA 3HG3A 1SUXA 3W84A 4PH6A 2V30A 1KBIA 3HO8A 2YPIA 2VXNA 2GPTA 3NAVA 2Y63A 1O5KA 5FEXA 2VFEA 5DCDA 2B7PA 4YLWA 1YDVA 3DHFA 4NNBA 2CLKA 3DFSA 3EXRA 2NXHA 4H3DA 3NDOA 2ZRWA 4JNMA 4FIRA 3NQCA 2CFFA 3BW4A 2NV1A 2WSRA 3DENA 5HNRA 4Y96A 2GQ9A 4AHPA 3LCGA 4MY1A 4MUZA 2ZRUA 1QPNA 1QOPA 2C1HA 3SIZA 3OBKA 4PL2A 2YW3A 4JN6A 4XBSA 1YTEA 3LI0A 3W23A 5CPOA 1BWLA 3G3DA 2GQ8A 3GZ3A 3W2UA 2J9YA 1GG0A 3LCXA 4Z1AA 3NL6A 4MZ8A 2V8ZA 5U7SA 1XDLA 5J5RA 3MP3A 1D3HA 3HPSA 4QAIA 4WY0A 1JQVA 3S0CA 2O7SA 3RLUA 3EWUA 3STGA 5KSWA 4Z0SA 1FCQA 1BTMA 3HQ1A 4S2CA 2QR6A 1GG1A 1SFLA 3GKAA 2YX0A 4Y9AA 1WQ5A 3EWXA 2CZEA 1MSSA 4ML9A 2VFFA 2Z6JA 1ALDA 1B4KA 5K4XA 1SR9A 3NQEA 2DU2A 4LT9A 4IMFA 2FLIA 5LKYA 5D32A 3GDKA 1XBXA 1LYXA 1TTPA 3QQ1A 1WX0A 4KWWA 2V5LA 3W7HA 1Q6RA 3PUDA 2ZRZA 1SO5A 1W5OA 1LROA 4WUIA 1DHPA 2H8XA 3DZ1A 3ABOA 4NVTA 4YL2A 1G4TA 3IVSA 1IXNA 3HPXA 1UUOA 5LNUA 2OT0A 3W1LA 1OHLA 4NX0A 2Y6ZA 2Y88A 2V2DA 2X16A 4TO8A 3N2XA 3C52A 2ABBA 1H60A 3MHUA 2TPSA 2NXIA 1ZCOA 2J9XA 5DCBA 4O15A 1GTEA 3NZ1A 4OV4A 3L2IA 4FHAA 3BARA 3LCFA 4JYDA 2ZZ4A 3RK8A 3S6DA 2YDAA 2J6XA 2R14A 1OFOA 3ATYA 4UMBA 1L6WA 2OJPA 1TPFA 2WPBA 4QM1A 2QCEA 4WX2A 5EPDA 1OF6A 2E09A 1AL7A 3LLDA 3N9SA 3W1PA 3WK0A 1AK5A 1Z42A 5I3JA 4MPQA 1I2QA 2QCCA 1QAPA 4GJ1A 3GX9A 3VE7A 1D3GA 2X1TA 3NEVA 1R2SA 3M5VA 3GDRA 5AYZA 5HQEA 4NXSA 4LVFA 3TW7A 4Y8FA 1WOBA 3FFSA 4XUGA 3UYCA 4YWIA 3UD6A 4JY8A 1M7OA 3NPUA 5D03A 4BI5A 1KFJA 1FCBA 4BK9A 3KX6A 4HNNA 4CQAA 2QAFA 2HSAA 2Q8LA 4TX9A 2CLMA 2NWRA 1ML1A 4AHOA 1VH7A 3TK7A 4FNUA 3JR2A 1A5AA 1K7EA 5L6UA 1VHNA 1XCFA 4O11A 4FX6M 4DO5A 3LTYA 2VFGA 3W1UA 1VS1A 3C2OA 1SZFA 1Q3NA 5H91A 3DU0A 1FXPA 5LNSA 4N9BA 3M44A 4FNPA 1LOQA 3S5NA 2WKJA 4NQ1A 5DY3A 3W76A 4IPJA 3W7JA 1O4UA 4IWWA 1NVMA 2Z6IA 5AYXA 1AW2A 1OG0A 2QAPA 3BLIA 2B7NA 1TPC1 2QKFA 1HTIA 1M7PA 2WOQA 1W56A 4JDBA 3G18A 2ZZ3A 5G2HA 3DKJA 3MI6A 1W54A 3W1RA 1ICPA 4RLIA 4YXGA 3TSDA 1W5PA 1OYCA 4AXKA 4MZYA 4JTIA 2E68A 4BF9A 5D2TA 3LCLA 4IX2A 4N4PA 3OEXA 3OHIA 3KXQA 3MBFA 1TRDA 3CC1A 4ADSA 3BPWA 3NQFA 1OX6A 4JYEA 2H3BA 3T4CA 2ISSA 3VI2A 2CLOA 1VLWA 2IQTA 3W7LA 1VYPX 2AAMA 3P60A 1SPQA 1H7XA 1F5ZA 2QCMA 3UPWA 3G22A 1W31A 1H7NA 4ZQRA 4ZMGA 5KINA 1QCWA 3PY2A 4HPXA 4Q33A 5AC8A 3LCWA 5CGQA 4OGZA 1KTBA 3PM6A 3P80A 3MYOA 4RZ4A 2QJGA 2JGYA 4NJGA 3W7RA 4FF7A 4QNWA 4EVZA 2ZZ6A 3B8DA 3MW7A 4M6QA 1H62A 3TR2A 2WNZA 1VPXA 4R34A 5FF0A 3NGJA 3KRSA 5I3KA 4XTDA 4AWTA 1CW2A 2ZQ0A 2CLEA 3PBVA 1YDNA 5AOUA 2ZTJA 4UNKA 3A21A 3TXZA 3W07A 3BVJA 1WBHA 2P10A 3NQ6A 1FDYA 4P61A 3A5VA 5CG7A 4JYFA 3PC0A 4HHPA 1KM1A 3VFLA 3NVTA 1ZAIA 5DXYA 3M41A 5K4ZA 2QEZA 4UUIA 4A29A 4DBDA 1LRTA 3TNOA 2QUTA 4MFEA 4CNNA 2XN0A 1KFLA 1TTJA 4K8EA 4JTUA 5BMXA 5C54A 3Q37A 1G4PA 3PG8A 2NXGA 4JXCA 3B0PA 5T26A 3UZJA 2OMAA 3RU6A 1JUKA 3OIXA 3IIZA 4WD0A 3B05A 2GVJA 1WXJA 2BXVA 5AHFA 3HPZA 5CZTA 4ZQMA 3W7IA 3MHGA 4JTEA 5DELA 4BFAA 1J4EA 1VR6A 3BV4A 4UC5A 1A5CA 5G4EA 3C2FA 1B3OA 3KVMA 1RQBA 2QDHA 4EIVA 4JS3A 1ZHAA 4NNAA 3PUEA 2VOMA 1XBVA 2OZ0A 2E5DA 2OCZA 2ZRYA 3QMTA 3GNDA 1FUYA 4LY8A 2JKEA 5D2VA 3I6RA 4UFMA 4CNPA 2VEMA 1C29A 3NQGA 4PFMA 1TV8A 2XFWA 4BI6A 1KFEA 3R8RA 3MP5A 4IMEA 4KKXA 1L6SA 1I4NA 1ZAJA 2Q3OA 4UFLA 4DF2A 1OYAA 2DZWA 3F4WA 2QF7A 2HTMA 1VCGA 1EP2A 1JR1A 1VYSX 1W3NA 4ZL1A 1A5BA 1DVJA 3OVRA 3IIOA 2A0NA 1TRIA 4FNTA 5LGZA 1DKWA 3NZRA 5BW6A 1HFBA 3NXFA 5F1UA 2DZUA 5EYWA 3TROA 4UMCA 4JTHA 1VHCA 1JCLA 1OFBA 2JKAA 1H7PA 3M47A 2QCDB 3I68A 1XBYA 2X30A 1QPOA 3FLUA 4GUHA 4N6FA 3NA8A 3G1XA 1DQWA 4B5NA 3GXPA 4Q4KA 2C6QA 3PULA 3HMJG 1AW5A 3W85A 1LBMA 2R8WA 3YPIA 4DO4A 3M5YA 3GR8A 2AQWA 3ATZA 2C16A 3E49A 4LS0A 5D02A 4GXMA 3CIXA 2FB2A 3TX9A 4ZQNA 3PSVA 1LBFA 4NXKA 2DJLA 3NL3A 3H54A 2DZSA 3W72A 3B0VC 1K7FA 3JS3A 2ZA1A 3W2KA 3TSMA 3W1NA 1N8FA 3LBCA 4O4VA 1PIIA 1TV7A 4TMCA 3M6YA 2DZTA 3NL2A 1C8VA 2GJNA 2GVLA 2HS8A 3M9YA 4Z1CA 4UXDA 4WOQA 1SU5A 1NF0A 2F7FA 3O07A 4ADUA 4ONVA 4UTIA 1SW0A 5G1TA 2Z2UA 1XUUA 3NQMA 3W7GA 3QRHA 3LTPA 1AL8A 4XKYA 2XN1A 5MHBA 1EX5A 1SW7A 2ZA2A 1TPB1 1FDJA 3H53A 2RHGA 3SJ3A 5EKYA 5CPMA 4JTTA 3FA5A 3GDLA 3SR7A 1SO3A 1YPIA 3HG5A 2ZZ1A 4PEKA 1PVNA 3Q94A 1EEPA 3O63A 1OX4A 1PS9A 4HKPA 4UR8A 4UCGA 3NNTA 3NPXA 3R5EA 2W6RA 5DN1A 1GVFA 1XXXA 3LXBA 2NX3A 1EWEA 3S5ZA 1IXPA 1JCMP 3GAKA 5G1YA 3LXCA 2FFCA 4DF1A 3NPVA 3TFCA 5FEZA 2FPVA 2W79A 1IIHA 3P82A 2A21A 3TUUA 2H8ZA 2C15A 2Z0IA 3SECA 1F05A 2Q8ZA 1QNVA 3RLVA 4FEZA 1V5XA 3W70A 1KTNA 4S1FA 1LORA 2E6YA 1TPVA 3G0SA 4POCA 1GWJA 3GR7A 1RD5A 1OFQA 3FKRA 4L4LA 2VENA 2J9ZA 2TSYA 3SI9A 4K38A 1W5QA 1VYRA 2CLIA 1H7WA 3TQVA 5D2YA 4O54A 1XDMA 3T40A 4DBEA 3MI2A 3CHVA 3NPWA 3W7DA 2GJLA 4RX0A 4LRTA 1FWNA 4K8HA 2CLLA 5K3VA 5KZDA 2CZ5A 2JBMA 3B03A 1IGSA 1X7FA 3SZ8A 1UB3A 3PG9A 3LXAA 2W0UA 2Y85A 4ZQCA 4H6KA 1JCNA 3E0IA 4OBTA 3G8RA 1E51A 4KFOA 5K9DA 1ME9A 2Q3RA 3LOTA 2PC4A 3NO5A 1KM3A 5FI8A 1GVSA 4O4WA 1K8YA 5EBUA 1ZALA 4O19A 1BEUA 1X1OA 3G1DA 3L21A 1Z41A 2V2HA 4NNCA 1HUVA 3CEPA 2JGQA 5EL1A 3TAKA 1VZWA 3EXTA 3STCA 2BSLA 1KBJA 1NFBA 3MHFA 3VCRA 3ABQA 4MLJA 2FJKA 1OFDA 1I2RA 4IMCA 2DP3A 3W83A 2ZFAA 1H1YA 3UY7A 4AH7A 4GUGA 2A5HA 3SGUA 4XBKA 2PRHA 5TIMA 5KZEA 4JX4A 3B04A 3M5ZA 3L68A 3EWZA 3LRLA 1KM0A 3C4UA 5HINA 1JUEA 1YPFA 3QMSA 2C19A 3HGJA 4N4QA 4O1BA 3UWQA 4TR9A 1FCUA 3W1TA 2ZTKA 1EP1A 1DJQA 2C0AA 2WNQA 2X1RA 3IV3A 4WXZA 4AAJA 4UTWC 3PVFA 2FIQA 3R89A 4UTJA 3G1VA 2V5BA 3I7SA 1F74A 1TJRA 3L0NA 5DXXA 3BGGA 1JCJA 5HMSA 2VFHA 3W6YA 5E93A 3W7PA 2G97A 3LHVA 5LNRA 1X6UA 3R2GA 3LHZA 4KWVA 3O06A 4OQVA 4NUWA 1FCVA 1GZGA 3PAJA 2RDUA 5F2LA 4LVBA 1WYIA 2GOUA 4UTWA 3LDVA 1QOQA 5LNWA 4NU7A 4C1LA 4MYAA 1VJIA 3EWYA 2ZDRA 3W7OA 4UFIA 4K39A 1QPQA 4CLMA 4DEFA 5KTLA 3R12A 5BOOA 2A6LA 1VC4A 4JX5A 2B7QA 3S1XA 4UTTC 3USBA 3G8EA 2WQPA 3LCHA 3G0XA 4MJMA 5DCEA 4IGHA 3NL5A 3T7VA 3W1MA 2LLEA 5F1VA 4JICA 4N02A 5AHEA 2C14A 5IM51 4L4MA 2A85A 3O6DA 3CPRA 3NYZA 4CCCA 1TREA 1FXQA 4UFJA 1DORA 4O57A 3HGRA 2VELA 5F4XA 1KM5A 3L5AA 4UTTA 4M6PA 5DLCA 2RKXA 3IIXA 2J24A 5KMYA 3HB9A 1K8XA 2NWSA 2B4GA 3PS7A 4NJKA 2YZRA 2PRMA 1JCXA 1JQXA 5BNKA 3HJZA 3W1XA 3DFQA 5LZLA 1PCWA 4JTJA 4LC8A 1UUMA 3FKKA 5K9CA 3I65A 2E5CA 3ZFHA 1Q6OA 5ABTA 4FXRA 2TMDA 3E9AA 1IF2A 4DPQA 1KV5A 5D30A 5FF3A 3W75A 2JK2A 1OJXA 5I3IA 4N9DA 2RFGA 3KRUA 4X2RA 2JKPA 4I7UA 2VEPA 2NUYA 3DFTA 3W1QA 4TMBA 5E1QA 1YLVA 3T78A 2D73A 3DFOA 2Y7GA 2Y7DA 4O18A 3F03K 2CLFA 4LVDA 4MZ1A 1TPUA 4YMZA 5HWMA 3STFA 1YTDA 1KFKA 4LUIA 3KRZA 1TPEA 1U83A 1PHQA 4LNYA 3S5YA 5LNVA 2KZHA 4GE8A 5HR6A 1P5BA 4MY8A 5KZMA 2HS6A 3O05A 3VE9A 5IBXC 2V82A 4OHQA 1VGAA 4ZQOA 1MEWA 3QF0A 2YYTA 2WO5A 2WNNA 1W0MA 3DKLA 5A8GA 4MVAA 3G1FA 5AN7A 4JTFA 1EIXA 5C5YA 1ONRA 4JR5A 3RF9A 1SSDA 1TTQA 5J5DA 1JUBA 4AF0A 2A2IA 5IBXA 5TBOA 3DHDA 3A23A 3TC6A 3B06A 3IRDA 4N9EA 4YCOA 1WDWA 3UPBA 1R2TA 1XKYA 1EPXA 1GOXA 3QH2A 3W7CA 2EHHA 1DV7A 1TPWA 3P62A 4JY9A 4X22A 4IMGA 1LM1A 5C6MA 1LTDA 1X8FA 3W3OA 2B7OA 2C13A 1KLZA 5FF7A 3O16A 1D9EA 1KLYA 3OVPA 5HUOA 2E1DA 2QCHA 3RNDA 1N7KA 3FS2A 3SFKA 3WJZA 1MEIA 4JIPA 2J88A 4IXHA 2FPTA 1T8XA 4IXXA 1P0NA 1FWSA 3FJLA 2O7QA 6ALDA 1L9WA 3NM1A 1G4EA 1I2PA 4M5PA 4A2SA 1DOSA 1YXDA 3UWYA 1NSJA 5U4NA 1EP3A 1AG1O 3CB8A 1QPRA 4DPPA 3LX9A 4NX5A 3M1ZA 4FB7A 3LBMA 5K7JA 1KA9F 3DFPA 1PHWA 1SZGA 1GYNA 1W3TA 4BR1A 4Y6GA 3W2JA 1O95A 3KVLA 2Y7FA 2V0TA 3W2NA 4QIUA 3B0UX 1WV2A 2QCNA 1O94A 1WA3A 3QQ0A 1H63A 1R2RA 2DZXA 2V2CA 2QCFA 2NUXA 3GYEA 3FYPA 3TA6A 3Q2DA 4QSHA 1H50A 1PE1A 3HIJA 4BI7A 1R46A 1I2NA 4O8RA 4NZFA 1SQ7A 3CTLA 3QSTA 4FO4A 3TH6A 4M7TA 1LBLA 3LGEA 4OT7A 1FDZA 4D2JA 4GUIA 3TJXA 1THFD 3W7QA 2QDGA 4IOTA 2H90A 3STEA 1WBJA 4JTKA 5G2WA 1SZEA 1SW3A 3DFNA 2FQIA 5CPLA 5D2XA 3C2VA 2ZRXA 3GK0A 2A7NA 3TKFA 4NZJA 1C9DA 1FY6A 1H1ZA 1X1ZA 3MI3A 4DELA 5HWJA 3INPA 4JTLA 3O8AA 1JJKA 4W9TA 3QW3A 4EWND 4NJHA 5FF4A 1G6CA 5AC7A 3IIPA 1AMKA 3Q58A 4ORMA 3UNDA 1RPXA 5HULA 1GVRA 5F2GA 5D05A 1GQNA 2H6RA 4BWLC 4RXFA 4UTMA 5FF2A 3BGJA 2HMCA 1OF8A 3PWAA 3T44A 4AHQA 3FIGA 1GEQA 1ZJIA 1W1ZA 3ABSA 3NQAA 3PB0A 4WJEA 5D2WA 4CNOA 3KFTA 4FXSA 4O53A 3W22A 1MO0A 3W2LA 4K7YA 1LP6A 3G24A 1XL9A 3U2OA 3GNNA 4N9CA 3CWOX 1ME7A 1QWGA 4MIMA 2QCDA 3W7EA 4LWWA 4BWLA 1QMLA 2F84A 5I3FA 3UWVA 4GWEA 4DQWA 3SW6A 4JTGA 1P0KA 3LM7A 4PCFA 1RQHA 4M7SA 1NEYA 4PL1A 1LOSA 3NQ2A 4G1KA 2CWNA 2UV8G 3I7QA 4IMDA 4IPIA 3L5MA 4CQ9A 3G3MA 3GAYA 1YTKA 2FB3A 3IEBA 3S1UA 2WV8A 1ICQA 3ELFA 3LRKA 4ORIA 1XFBA 1TB3A 1L6YA 3QPYA 5I3HA 4RK8A 1SO6A 5I3GA 2QCLA 1UBSA 1ZY9A 1ZFJA 4GBUA 3VKJA 3O6CA 8TIMA 4AVFA 3EKZA 3N9RA 3PBUA 2A7PA 2EKCA 4QNEA 3S5OA 3TMLA 4JTSA 4RJEA 1QO5A 4XQ6A 4LUJA 2VFIA 1F2JA 3BLEA 5AFDA 1SZNA 5D38A 3QPZA 1UJPA 4AB4A 5G2IA 3UWWA 4O50A 5AHNA 5LHFA 2ZCGA 1HL2A 1OFAA 2NX9A 1Q6QA 1GYLA 3GXNA 3CU2A 1F6PA 3EX1A 2BWGA 1I8JA 3M43A 5BRBA 3ANYA 1OVDA 1FQ0A 2VC6A 3P5YA 3WJSA 2GUUA 4WOZA 1QR7A 3QC3A 4O1CA 3P67A 4U28A 2H3DA 2YW4A 4O12A 2R94A 1LZOA 1ADOA 4QJ1A 1YADA 4RR4A 3L5LA 1B57A 4EOUA 5DBTA 5LSMA 4R53A 2TYSA 1K02A 1B9BA 3CT7A 1R47A 1EUNA 4ALDA 2Z1BA 3HF3A 1KFBA 2CU0A 1YXYA 3P8IA 3NQDA 3GDMA 5C2XA 3U6WA 1BKSA 3C6CA 4I9AA 2ZZ5A 1FBAA 3KVKA 3GDTA 4TU1A 4RV8A 1S5VA 1HO1A 4IUOA 2X1UA 1A5SA 1M6JA 3OA3A 3FEMA 4GNJA 1TIMA 4HSNA 2VEKA 3DBPA 4O10A 2C18A 1MXSA 4DXVA 3NR0A 3LHTA 3NQ8A 4Z1DA 3ZWTA 3LTSA 4QISA 3C8FA 3O1NA 5E0KA 1IIGA 3DAQA 1G7UA 4FNRA 3PUOA 1TQJA 3A22A 3RMJA 3KHJA 4FNSA 2CZDA 4MOZA 4ADTA 3L67A 3W88A 3N3MA 4JIQA 1EA0A 3DH7A 3HG2A 3ZR4A 2RDTA 1DJNA 1RQEA 1TJPA 3LV6A 5AHIA 4QITA 1YXCA 3CWNA 1OABA 2FTPA 3L0GA 2EF9A 5CSSA 4UNLA 3EKLA 3TIMA 1S5TA 2YGYA 2ATMA 4RKAA 5HWNA 5AC6A 3FOKA 5AYYA 4KFPA 1TSIA 3QFEA 1MEHA 3NQ7A 3GKFA 4UTHA 3OG3A 1SO4A
chains in the Genus database with same CATH superfamily
1FKXA 4X3ZA 2DZVA 1R30A 1U5HA 4REQA 3VGGA 1QUMA 2GDVA 3SCVA 1SYTA 1DP0A 3PR2A 4KRTA 1V6WA 2OSXA 4Z0JA 3TU9A 4PUWA 3RPMA 1FWTA 1ITQA 2YLAA 1VFMA 1H3GA 1W1A1 1GVQA 1BXBA 3G5EA 4U31A 3V1PA 2Z1WA 4C1KA 1YDOA 3QHMA 3S9IA 3W7NA 4XAFA 3HBLA 4ASTA 1BG9A 1RHCA 4PRWA 3W1AA 3NM3A 1XBZA 2DIJA 5HR7A 3E6EA 3QTPA 4DWDA 1OFEA 4EAMA 4JTQA 3BAYA 2DJXA 3W73A 4D6EA 4CD6A 1RLCL 4CQBA 3NGFA 2C3ZA 4FXJA 1OZMA 2WM1A 3GBEA 1E70M 3DX5A 3PPFA 3ARYA 2VR2A 3AS1A 3EEGA 4K6AA 1JI2A 3VIIA 1MVYA 1RCOB 4ROQA 4GFSA 3N2CA 4CEUC 1DIDA 3E2VA 3P7YA 4GQ0A 4OWGA 5LHEA 4MF4A 4X63A 4K68A 2BOEX 1N82A 3EZ4A 2FPYA 4MNJA 3P5ZA 3VNLA 3A9IA 4DUXA 1T99A 3K2GA 2ZRVA 1F61A 1YMYA 1LG1A 3SIMA 1HJVA 3K8MA 5EA9A 4FX8A 1DJZA 4LFYA 4E2DA 4R85A 3H7RA 1M7XA 2PWVA 2VZVA 4JEQA 1NM9A 1UWRA 1MUWA 1B5TA 2VRQA 2WSQA 4YVPA 4H19A 1W37A 4LW7A 3LB0A 1M5WA 4J9JA 6XIAA 2BS9A 2D3LA 1YHTA 4UQAA 3G0UA 4E38A 2OO0A 5AVNA 2WC4A 5ECVA 4JIIX 4Q4OA 2VD9A 2WSYA 1NQ6A 4R9OA 3AU6A 3CQKA 3VINA 4Q8TA 3B9DA 3MSGA 4P2VA 3MDWA 3ORWA 3IGSA 3W38A 4D6DA 5BROA 3MYPA 4GI4A 3H22A 2XH0A 3NURA 3L0KA 2J7EA 1Z3NA 3IGUA 2Z7KA 5EY5A 4EPKA 3L65A 3WMBA 3M5XA 3AS0A 4EXBA 4FF5A 2WSKA 2J7DA 5A6TC 1A5NC 4L6DA 1JZ3A 4IUGA 3TE9A 8XIMA 4UFHA 2EAWA 3N2MA 3N19B 5MKGB 3BANA 1LQ0A 2BTMA 3P61A 2OKOA 1EB3A 3L4WA 2W62A 4WKAA 4DJDC 1E6PA 3WENA 4I7VA 2ZZ2A 4PUKA 1R3QA 2C1GA 5CZSA 4LCSA 3CMGA 1B9ZA 2GUYA 4HBKA 4BS0A 4A8IA 3EYPA 4GUJA 3IAPA 3FY1A 1PTGA 1VRDA 2BGSA 3N2BA 3UA3A 2YCEA 1CECA 1FFQA 4DJDA 5I00A 3AIVA 4IP7A 3UR8A 2GSJA 3KM8A 3V75A 4UTUA 3NDYA 1OK4A 4ROPA 4UMAA 2E8ZA 4LEQA 2Y62A 3E02A 4O14A 4RDWA 3UXAA 3BLFA 2XTKA 2EPNA 3JRKA 3NTYA 1B3XA 2XH4A 4FOUA 4G56A 3WEOA 7TIMA 3I4EA 3S42A 2HROA 4MKSA 3F4NA 4PGLA 3A5FA 3BWWA 4MDOA 2ZUVA 4AZ6A 2POZA 1IXOA 1NP2A 1U2YA 4DBSA 5D33A 4KRZA 2E4TA 2G95A 2WZIA 1PKMA 4PYSA 4S3AA 3AMCA 1Q7QA 2HRWA 3W71A 5D37A 4NJIA 4ATWA 3M0ZA 4LYPA 2YFOA 3D46A 5HJLA 3URNA 4PC8A 1TIWA 3WFAA 1GQJA 4L1XA 1A50A 1GZJA 4A2RA 4KBXA 2HDJA 4UQEA 4UQCA 5SWUA 3GB6A 1GZ1A 2Z1VA 1V02E 2ICSA 4LEFA 3OODA 1I0DA 2ZXQA 3NUKA 3PSWA 7REQA 1UC4A 1NOUA 5FA5A 4H4IA 3CHEA 1H61A 4RCXA 4ATLA 3K30A 2C7FA 4GHRA 1XYCA 4AY8A 1N55A 4CD8A 1DJYA 4Y90A 3VKKA 4MGGA 3IVTA 1I2OA 2P50A 4JKKA 2ALDA 1TJ2A 3WK1A 2VX4A 1BYDA 4KFNA 3A13A 3QMRA 4CVWA 3QY8A 1W9PA 5DF0A 1EJWC 4LC6A 1W5NA 3TN6A 2GVEA 3NOEA 1SSGA 3BV7A 4JZ5A 3GH7A 2XINA 1QI5A 4L9YA 1S1PA 2EQDA 3P3BA 1J0IA 1TV4A 9XIAA 4LPCA 2EPHA 2Y7EA 4S2BA 4C60A 1JRCA 1Q65A 3AHZA 2J75A 2A7RA 3SCPA 3TCEA 3II1A 3NG3A 2QUUA 4DI9A 5F2MA 3QXBA 1VJZA 1LF1A 2WVTA 1KRMA 1EBGA 2ZKMX 5E5CA 3KRBA 1YPXA 1UWQA 1XRTA 1OYBA 4M6VA 1OD0A 1PZ2A 2HV5A 4JQ2A 4J3WA 4PUNA 3BICA 1GPWA 3WD4A 4GC4A 4OV9A 4KPLA 3BJSA 1KTCA 5JBFA 5AB3A 4FI4A 2Y8UA 3HQOA 4HNVA 5IFPA 4ACYA 1JYVA 1RCQA 4I8DA 3AYTA 1O5XA 5CZ0A 4O13A 1UPMB 3M7SA 1E4MM 1TYGA 3Q4DA 4C6JA 2CXGA 2ISWA 2I9EA 3B4UA 3HGOA 3P93A 4HOXA 3BAJA 4HN4A 1IV8A 1JDAA 5EMYA 4WZHA 2OX1A 3ZVHA 2B0MA 1EYEA 3EX2A 3IARA 1CX9A 4NT0A 4XSMA 4GCAA 1XSIA 1S39A 4JHOA 4QR6A 1WZKA 4B2DA 4KF1A 3OVQA 4Q8OA 2AGKA 2P1FA 4H83A 2P53A 3M0VA 4UQBA 4O17A 2DGAA 2D69A 1GKRA 1NELA 3GNXA 5LIXX 4PRTA 3TC7A 3WDRA 2GL5A 4XV0A 1R0MA 2R91A 3SCTA 1KV8A 4GKTA 3I7RA 3SSZA 1GQLA 2I14A 4DUVA 2PDCA 4GGHA 3M0KA 3DERA 2QMKA 4GOAA 3TDFA 4JQ3A 2EGZA 2VURA 3HFYA 4LV4A 3CTTA 5EMUA 4LF2A 3ABZA 3TW9A 3W84A 1ZCCA 2CIPA 4PN2A 2VVNA 2GPTA 3N1AA 1BYCA 2Y63A 3VM7A 4YLWA 1YDVA 1KBBA 4H3DA 2QIIA 4ZOAA 3CMFA 3BW4A 4I5UA 1JFHA 4Y96A 2GQ9A 4AHPA 3AALA 3I4KA 1GHRA 1ZPTA 4ZB0A 5FKYA 2G3FA 3SM0A 2NQLA 1KC7A 3WQWA 3VA8A 3A3HA 3SUVA 3LCXA 5CQ1A 3NL6A 4MZ8A 2V8ZA 5U7SA 5J5RA 1QNQA 3CQIA 1D3HA 4BQ3A 3SUUA 1JQVA 4Z0SA 3UESA 4DM2A 3AHVA 1BTMA 2AGTA 3SY8A 5KEZA 1SFLA 2YX0A 2PWEA 4Y9AA 4IP5A 2CZEA 1KR0A 1VPYA 2VFFA 1EJSC 2DU2A 1WKDA 3DUGA 2GWNA 4IMFA 5D32A 3BAXA 4RE2A 3A64A 1LYXA 4KWWA 2V5LA 2X0YA 3PUDA 4JCLA 4DBUA 1SO5A 4F2UA 3R0UA 2H8XA 4QLLA 1UQYA 3EA3A 1KWGA 3KDOA 5I3DA 1QW7A 3DZ1A 1KO0A 1WE5A 3TLQA 4QROA 3ABOA 4C6IA 2PP0A 4NVTA 5BCAA 5LNUA 1UUOA 2OT0A 2R1KA 2JE8A 1OHLA 5I23A 2WWDA 2ABBA 4UB9A 1AZ1A 3VKDA 2VCBA 4FHAA 3S9ZA 3S6DA 2YDAA 1SMDA 2QJNA 2J6XA 2R14A 3QZ6A 1U1JA 3POHA 3N25A 4TVCA 1FTXA 2VGBA 5HANA 3IPWA 7ENLA 4WX2A 5GJMA 1AL7A 3N9SA 4HHHA 4BEUA 1R9YA 3QHNA 1AK5A 2XZ7A 5I3JA 3U3HA 3T0AA 4PTWA 1O7AA 1FA2A 1O12A 2DUAA 4GJ1A 3NQBA 2X1TA 2PF8A 1R2SA 3KL3A 2YB4A 3GDRA 1US2A 2R9RA 2DSZA 4GD0A 5HQEA 1MDRA 4B5TA 1EJUC 3GU2A 2UY5A 4Y8FA 5E9AA 3PUGA 3NPUA 4R3UA 5D03A 1KFJA 4NSBA 2ZADA 3GTHA 3PZ9A 4CQAA 3FVMA 2VT0A 3EMQA 2CLMA 2CITA 2JIEA 4OECA 4GO9A 2XVNA 3VDHA 3MU7A 4FNUA 1A5AA 2F9RA 3BH4A 5L6UA 4QDPA 3O3RA 4Y9PA 1VHNA 4FX6M 3RILA 4KWUA 5CSYA 4LUSB 1E9YB 1WNOA 5LNSA 3GG1A 4NQ1A 1HJSA 2O56A 4IPJA 4IWWA 2DSVA 2Z6IA 1TG7A 1WKEA 4Z2JA 3QKZA 4L9XA 3CUGA 1HTIA 5MKGA 4PMNA 3REQB 1W54A 3W1RA 5CH9A 2OZ8A 2XVKA 1FWCC 3GWQA 1W3HA 3VDAA 4BF9A 3TN5A 1P0BA 1TRDA 1QK2A 2PTDA 4US5A 4NASA 4B9ZA 1OX6A 2DFAA 1PEZA 3T4CA 2ZE0A 3VI2A 1VLWA 4OIFA 3W7LA 1ZBKA 3BQ6A 1SPQA 3NSXA 1H7XA 2VNCA 1F5ZA 2FH8A 5C2GA 1BYAA 1TKKA 4ZMGA 3H2FA 1U22A 3LCWA 2OLAA 4IL0A 1KTBA 4G9PA 2PDHA 3P80A 3MYOA 1XIMA 2QJGA 3QOMA 2JGYA 4FF7A 4M6QA 3G77A 2Q8XA 5FF0A 1CW2A 3GNRA 3DCPA 3VKBA 4W86A 2VM8A 3ITXA 1X39A 4AXNA 1XLJA 1AVAA 2F2KA 4LNCA 3IJLA 1WBHA 1PZ0A 4LGXA 1BLIA 3A5VA 3N6QA 3WYZA 5HOSA 4JYFA 1TX0A 2J47A 1PO9A 2PWHA 3M41A 3IUIA 1LRTA 3RXZA 3TNOA 2YIHA 5JBDA 3BMXA 4DHGA 1TTJA 5C54A 2NXGA 1QNPA 4E3TA 2EPKX 2DSUA 3B0PA 5FJPA 1KKOA 2OMAA 4PUMA 4WD0A 3RR1A 3T2QA 1R7OA 1FH9A 3GC5A 1VRXA 5CZTA 1M68A 3W7IA 4JTEA 5DELA 5FSDC 3BV4A 4H7CA 3WNLA 4JL2A 3C2FA 1RQBA 4EIVA 3LEPA 4JS3A 4AY7A 3TWAA 2VOMA 1BF2A 4CU8A 2E5DA 2G3IA 1FUYA 1YW1A 2FGBA 2EKGA 5FJRA 3NQGA 4PFMA 1TV8A 3FA4A 4BI6A 1KFEA 2PTZA 4QEEA 1L6SA 1I4NA 2Q3OA 5TNVA 1OYAA 3HV8A 5BXSA 2NVAA 1VCGA 1VYSX 3KZSA 1M01A 2VL4A 1UKTA 2BOGX 3HQPA 1AD1A 4Q22A 2FYMA 3KOYA 5F1UA 1BGGA 1P43A 4UMCA 1VEMA 4E4UA 3H7VA 1RCXB 3KOXA 3THCA 1H7PA 4DO7A 2QCDB 2QHAA 1AH0A 3D6NA 2YKKA 3L4TA 3FLUA 4P7RA 3NA8A 1XRSA 3GXPA 1O5QA 2C6QA 3ONBA 1AW5A 5I0DA 4FR1A 3CGTA 4DZAA 3M5YA 3ATZA 3E49A 2H9AB 4HMCA 5D9NA 2FB2A 5JU6A 5IXEA 1LBFA 4IPPA 3NL3A 3B0VC 4I5RA 4ILSA 1GVEA 3E3HA 3TYUA 4QAWA 1HL9A 4O4VA 4TMCA 3NL2A 1R9XA 2HS8A 4Z1CA 4A6GA 3O07A 3T6CA 4ADUA 4PUEA 2Z2UA 1XUUA 3WD2A 3NQMA 3QRHA 3LTPA 5E0CA 1EX5A 3MKKA 1K8CA 3FA5A 1SO3A 2F6UA 4YTQA 3HG5A 2XIJA 2HXTA 2PWGA 3H26A 4PEKA 3Q94A 5I03A 2NQ9A 3CT2A 4HKPA 4UR8A 3NNTA 4HA1A 3QPEA 2OZTA 1IXPA 1E3XA 4QS5A 4KESA 3LXCA 2FFCA 4DF1A 3TFCA 4KMQA 5FEZA 2PBGA 2W79A 4JFSA 1PKLA 1EZ2A 1F07A 3ITVA 1QNVA 4XUYA 3W82A 3E5BA 3PJUA 3TN4A 3ALFA 1XQKA 3AHYA 4IJRA 1W9BM 4IM4A 2VDHA 4POCA 2B31A 1OSEA 4C6CA 3GR7A 3AMDA 3H2OA 3W26A 4P7LA 1RD5A 4HCHA 1VYRA 5JQ9A 4Q4RA 4DY1A 3T40A 3CHVA 3XISA 3IV8A 2CLLA 3TJIA 3MY9A 4MADA 2JBMA 3RIKA 3WLLA 2J8GA 2PDBA 2P3EA 1X7FA 3PG9A 4WDTA 3LXAA 4H6KA 3A12A 4F3HA 4KFOA 4GISA 1H2JA 2X0SA 4NRRA 4H7VA 3UP8A 3ARXA 4O19A 3G1DA 4XAGA 4XKMA 3L21A 3WIJA 4ERAA 4AMCA 1UC5A 3TAKA 2XWEA 3STCA 2FGLA 3NYDA 1P0EA 1RA0A 4I9MA 2DP3A 3N13A 2Z25A 3VVGA 2A5HA 2O4QA 4XBKA 1HX0A 5EFFA 4YHGA 3GHSA 3B04A 3FYYA 5HA7A 5ABGA 1DIOA 3BOLA 3EWZA 4AEFA 1ONWA 3IJ6A 1V02A 4OJYA 2DIKA 1FCUA 4C91A 3FDGA 2ZTKA 5LIUX 4DXXA 5A95A 3CK5A 3MJMA 3W0KA 4UTWC 1Q7MA 1E6NA 1TJRA 1T8QA 3L0NA 1J79A 2CESA 3VU2A 3WELA 5E93A 4GVFA 2G97A 5LNRA 1X6UA 2PZ0A 1RSCA 4OQVA 3AZTA 4NUWA 1J8VA 7ODCA 1GZGA 4L56A 1GOIA 4LVBA 1WYIA 1V03A 2FVMA 1CLVA 4UTWA 1NP0A 5AC4A 3LDVA 1QOQA 3BTNA 3AHTA 4C1LA 2X41A 1VJIA 3EWYA 2ZDRA 4IMAA 3W7OA 1MW2A 4CLMA 2A3AA 3R12A 3ZT5A 4WKHA 4TOQA 4MB3A 4FPSA 5DCEA 3DN5A 2OYLA 4N02A 2A85A 3VGDA 3DEQA 3CPRA 3GVRA 4ACZB 4XD3A 3N4FA 4D9PA 2HVMA 3VILA 2IPFA 2XIIA 4M6PA 3S47A 5KMYA 2NWSA 1ESWA 2WPGA 3MZ2A 3PS7A 4NJKA 5A2AA 4F9JA 4RE4A 2PRMA 4WEVX 2RJHA 3MUY1 2G3JA 2W3ZA 2P8CA 4QLKA 3N2OA 4IIDA 5BXTA 2CKRA 3WLIA 3FKKA 1IWPA 3E0FA 1EC9A 1UR0A 2YXOA 5M1TA 4P8VA 1Q6OA 1NWSA 4FXRA 3ZXWA 4INFA 2ZVIA 1XINA 2PZNA 2RFGA 4YJ5A 4AISA 2JKPA 4I7UA 2VEPA 1NDVA 2WCAA 3WQ8A 1ITUA 2EG8A 4ZOCA 3MKVA 1WZAA 3D5HA 4F0LA 4LUSA 2Y7DA 4MZ1A 1S2WA 1YTDA 4GVIA 4RNHA 4LUIA 4LB3A 5LNVA 1WDQA 4LUTB 4GQGA 2PGRA 2IKIA 1DWGM 5KZMA 3V7PA 5E0FA 1J6OA 3GNOA 5IBXC 1DXFA 3CV1A 2AKZA 4OHQA 1PSCA 4ZQOA 3UG3A 4UQ9A 3REQA 4PTMA 3OW1A 3PHAA 1A3XA 3DKLA 1UOKA 5A8GA 1R3YA 3G1FA 4JTFA 5C5YA 4OUEA 4AIOA 1XGEA 3RF9A 1SSDA 3A4AA 3ZO9A 5ABFB 1VFHA 5IBXA 4ZXOA 1NWUA 3CZ8A 3IRDA 4GABA 1O66A 1EPXA 1GQKA 1GKPA 3M0XA 3QH2A 3SCOA 3THDA 1EXBA 3ARSA 2EHHA 4IMGA 1LM1A 5C6MA 2XM2A 5FF7A 1H0IA 1XH2A 5FSEC 1N7KA 2YDQA 3WJZA 1AJ0A 4HHLA 3CHCA 2UY2A 4CGTA 4GQQA 1MZRA 2J88A 2DH2A 2FPTA 1Q4WA 1L9WA 1VBRA 4RUBA 3H70A 1Q6FA 3UWYA 3GW0A 1NSJA 1BFNA 1L8PA 5U4NA 1EP3A 1SFSA 1AG1O 2O55A 4DPPA 3HPAA 3LX9A 3GH4A 4YYCA 4CU6A 4C6KA 3M1ZA 4XIAA 3LBMA 5K7JA 1KA9F 3SGGA 3W2JA 1O95A 2C91A 2WB5A 3U7VA 4HOWA 2Y7FA 3W2NA 1UD6A 4QDMA 2DZXA 3RCNA 2QCFA 2NUXA 3Q2DA 4QSHA 1H50A 4DVOA 1GVIA 1JPDX 3NZQA 1S5MA 4J3TA 1JPMA 4V2XA 4KGJA 5LIKX 1YNYA 1O5RA 3WUGA 3KTSA 2PS2A 4G8TA 3SQMA 3QSTA 1IHIA 4QSFA 4E8CA 2XFRA 2GGJA 4GUIA 1THFD 1OB0A 1KRAC 1WBJA 3BCDA 5G2WA 3DFNA 4MWAE 1V3HA 3GK0A 2A7NA 1XQLA 1CGXA 4OTKA 3M0YA 5FOOA 3QW3A 3AAMA 1BGAA 3UF9A 3S83A 3RMEA 3GVVA 3BMWA 4ORMA 4KW2A 5HULA 3CZJA 4DB7A 3SB0A 4JAWA 1MRQA 1MYRA 4UTMA 2REQB 4GVHA 3V35A 1W1ZA 3ABSA 7TAAA 4HYWA 2VP8A 3NQAA 4E2OA 3PB0A 5E70A 4CN1A 1JYXA 3NZGA 4O53A 3CNYA 1DXIA 3OQ8A 4HCDA 3BZGA 3WDQA 1V51A 4HNOA 3A4JA 1ME7A 3CWOX 2QCDA 1L6FA 3CV2A 1W9DM 3W7EA 2F84A 2HK0A 4C65A 1CEOA 4J5NA 5E6YA 3K1DA 3PWGA 1HVQA 2OZ3A 4JIRA 4PL1A 2ZUUA 4R27A 1LOSA 3SY1A 1JNDA 2UV8G 3I7QA 4IPIA 3L5MA 4J3XA 4V27A 4CQ9A 4G1NA 4JIEA 4W93A 3AXMA 1YTKA 3KW3A 4ZENA 4GZ7A 4XZBA 3LRKA 2H9AA 4WR3A 3LA4A 1XFBA 4AEEA 1L6YA 2W67A 5I09A 1SO6A 3M46A 3A47A 1ZY9A 3MS8A 1CPUA 4AVFA 3EKZA 1YNPA 2ACSA 3N9RA 2A7PA 2EKCA 4QJ3B 4QNEA 3E38A 3TMLA 2XGZA 1UD3A 1VPQA 3CO8A 2BXZA 4D71A 5D38A 4IZGA 1QXLA 2ZVRA 2PDYA 3UWWA 1H41A 1K9TA 4RE3A 1J0ZA 1HL2A 2XH2A 3GXNA 3EB4A 5BZAA 4IICA 1I8JA 3M43A 3P5YA 3ANYA 2VC6A 1MQQA 2FZ9A 4QLJA 4O1CA 4RW3A 1Q7ZA 2CHRA 1LZOA 1XS2A 1ADOA 1YADA 4GC3A 3U2CA 4AIEA 1EO5A 5HMFA 5BYWA 4XG1A 5DBTA 1FVPA 4R53A 4GYFA 3GQYA 1RY0A 3PFMA 1K02A 4Q8WA 2Y24A 1R47A 3VIMA 1Y7VA 5CLTA 2J7FA 2CU0A 2D2JA 1YXYA 1UROA 3RUBL 4PCTA 5C2XA 4I9AA 2ZZ5A 4V15A 1BXNA 3UT0A 4U3CA 1HO1A 3A4XA 1SJBA 3B0XA 1A5SA 3KP0A 3O6AA 3FEMA 4HSNA 2VRKA 2ZX5A 4DXVA 3MSRA 3UWEA 5J04A 5DO8A 3LHTA 3M64A 3WSUA 4DYJA 4KS0A 2AMGA 3JVAA 4FNRA 3CYVA 1H49A 3TQPA 3VTRA 4IQJA 4ADTA 1KXHA 3L67A 4PBFA 3N3MA 3R0DA 3RPDA 5BWAA 4ZEPA 2PDUA 2E1WA 2BVDA 1RQEA 3H8AA 2VX5A 3CWNA 2FTPA 4KIRA 3FK4A 1NH6A 1DIKA 5HWNA 5HMEA 3CHFA 4ZOEA 1JYNA 1TSIA 3NQ7A 3OG3A 3LSBA 3PTQA 5AY7A 3AIWA 1B54A 1XC4A 1MZHA 3UG5A 4JBRA 2GK1B 3S4TA 2WMIB 3ZR5A 1BYBA 1GVOA 1RAKA 3CZKA 5HJXA 4B5SA 4E0CA 3BG9A 1J2WA 2QJMA 1K6WA 1WUFA 4IIFA 4HMEA 3G2GA 4J3UA 2CXEA 1CB7B 1FHVA 4A22A 4MJZA 1HJXA 1OFPA 4MYXA 2WVSA 3LZ3A 2HCVA 2DQWA 4C1NB 5A5WA 3KOWA 3FJNA 2FMNA 1A53A 1B90A 2Q01A 3VGHA 1E56A 1PDZA 1UP0A 3ABRA 1WZMA 4A3YA 3I6TA 1IXQA 4FNQA 2WMJA 5IFTA 1TCDA 2PI6A 4GBDA 4GRSA 1D2KA 3LI1A 2QPSA 1JDCA 3ZLFA 1KD0A 5REQB 4Z2LA 1S2TA 2I1OA 2RH9A 3WH6A 4A05A 5H8PA 3IWPA 3L7RA 5F4WA 1ZP3A 1UKOA 3KOFA 1TMQA 3T4WA 1WUEA 3H24A 1E0VA 2NZLA 3AQUA 3O0FA 5G5IA 5FJTA 3PTMA 4ZZ9A 3APGA 4ACZA 1MWOA 4JGDA 4LYQA 4OU1A 1OX5A 5JMUA 2J13A 4ZODA 3HOJA 5C9XA 2ZUNA 3G1SA 3GU1A 2E28A 3U57A 1V08A 2WHKA 1SVDA 2E0PA 3S6OA 4ERIA 1BG4A 1ODZA 2YCJA 1PX8A 3RITA 2UY4A 1Q6DA 1BF6A 3ONCA 2G3MA 2WJZA 1GT8A 4ZVJA 2D2OA 2W27A 3EPMA 3KAOA 1Y5WA 1H7OA 3D47A 1XUZA 5BMWA 2J78A 2A3EA 5TD4A 1JPIA 1Q6LA 3HQNA 2E9LA 3LMZA 1EO7A 5TAOA 1FRBA 3E5PA 3RO6A 1BWKA 1V77A 5DY2A 2O4MA 3ARZA 5FEWA 2J7CA 4EPDC 3DGRA 4WSKA 3EX6A 3K4AA 5EMLA 2DZBA 5BRQA 1VP5A 1JF5A 1SFTA 1B1YA 1VB9A 2ISDA 1QI0A 1E6QM 1PL9A 2V9DA 2RDWA 1QNRA 2UZ9A 4B16A 1EUAA 2YFNA 2ZWZA 1EH9A 3MWAA 4LUTA 2PWFA 4O1EA 4IIEA 3KBWA 4IJBA 1DWHM 5A6KA 1Z9AA 3LCIA 1JAKA 1FWHC 2E77A 4G7EB 4K36A 2VHLA 4AWUA 4GZIA 3G6MA 4ZR8A 5FIPA 4MMWA 2ZYFA 1YYAA 1V0LA 3H21A 2Y89A 1X6LA 2VKZG 1ZNNA 3A24A 2NV9A 5JH2A 2PLMA 4LAKA 5ABFA 1JPKA 3P84A 2ZICA 4NF7A 3WBWA 5AYIA 3IJDA 2SFPA 1FH8A 2IMRA 3R8GA 4A21A 1VCFA 3BG3A 2VEIA 1GPFA 3IAQA 1FWWA 1CWYA 3N73A 1LRQA 3GIYA 3IIVA 2XM1A 2O9OA 4Q8PA 5CPNA 3SCUA 4GA8A 3PBYA 1P4CA 2CYGA 2OU4A 3KS5A 4UZUA 2OB3A 4GIAA 1VCVA 2YB1A 1TELA 1XIEA 2IUZA 1QHOA 1KM6A 2RGLA 3VNMA 3WJXA 4QBXA 5LYRA 1CGWA 1GOQA 1T0OA 1HZYA 1TPH1 2E6DA 4S3FA 4C6LA 3LERA 4ZO7A 4RZ5A 4NI3A 3ICJA 4B4HA 2O92A 3NXLA 2XJ7A 3TQKA 1JI1A 3MP4A 2EPLX 5C7HA 1PB0A 3EOOA 3MUZ1 2GVGA 1UH3A 3VZZA 4CCDA 1Z89A 5DX7A 1XI3A 1NDZA 4DZ5A 4RPPA 1NAL1 3CUHA 2FVLA 3MUAA 1XLHA 1XISA 3KL5A 2X09A 2QIWA 3HURA 1W1B1 4O16A 1LOLA 3UFYA 4JQ4A 1ISWA 4UWMA 3G1YA 1VJSA 2WKLA 2BVTA 3Q67A 4LVGA 1FWFC 2WYSA 1NARA 2IKHA 3KTCA 1B3ZA 3CV7A 4JQAA 3VDGA 1W91A 3EXSA 2DORA 1RR2A 4ZE4A 1REQB 4EF9A 2QJHA 3ITTA 5LGXA 1A3WA 1ZQ5A 3R13A 3OLDA 1IEIA 3HA1A 4RNJA 1YE4A 3B8UA 1G7VA 3QR1A 1JDEA 3BLPX 3MMTA 1A5MC 2YYUA 1FWDC 1WAUA 3R11A 1GW1A 2FZBA 4LALA 4H8NA 1F6KA 3OOQA 1V0NA 1KQZA 3UWUA 2QUVA 4LRSA 1CI1A 2X0HA 3N11A 3GHRA 1O1ZA 1XX1A 1WPCA 4H7ZA 1QDSA 2PAJA 1G69A 1JRBA 3N4AA 2HZGA 1H51A 1XWYA 3LV5A 4F0MA 3S2JA 1CYGA 1C92A 3RG6A 1NF7A 4XKYB 5AKQA 2W4XA 2WW5A 2CLPA 2QGYA 2O9PA 4O0ZA 3T55A 3WFZA 1UZDA 2X2GA 2NQJA 3R1ZA 3UZ5A 1AJ2A 2PF0A 4A3QA 1DJXA 3AO0A 3ZSTA 3POCA 2DSKA 4GUFA 2A6NA 1JNEA 3IVUA 2NVCA 1HJUA 4JTCA 4TVUA 2BOFX 3CQ0A 3O9NA 2E9MA 1E5NA 1UA3A 1XC6A 1GOWA 4UNIA 5L9FA 1L2UA 1W9VA 2OO6A 2XIMA 3RM4A 4KEZA 3BW2A 4NZ4A 5MF5A 5D04C 3GS6A 5CZJA 3DI1A 3GFZA 4O0KA 1PX4A 4Q32A 4O28A 2Y70A 3CAWA 3WQCA 3S9YA 1J6PA 4HIBA 4GYJA 3SBFA 3IK2A 4X9YA 3IGXA 4L64A 1IEVA 1ISYA 3ZS4A 1W5MA 3AU2A 1AODA 3S8HA 1R38A 1W3KA 2QJIA 3OA5A 3NQVA 2KX9A 1J5TA 2FVKA 1H5YA 3WFLA 3R7MA 2UY3A 2Y61A 3GTXA 4BQ2A 3T42A 1VENA 4ZCWA 3QSRA 4DNMA 1Z32X 3E74A 1KCZA 4J3ZA 2IPGA 2QXWA 2ATSA 3WLTA 3VNDA 1DEDA 4B92A 1PUDA 2VGIA 5LA0A 2QUNA 1V93A 3STPA 1J10A 2V30A 3KCLA 4LANA 2YPIA 1XRFA 1TZZA 2DW7A 2MUCA 4IIHA 3APTA 1F4AA 1JZ4A 2B7PA 3W28A 4DYKA 3DHFA 2Y5SA 3AXIA 3ITOA 4L6OA 3BLKA 3NDOA 3NQCA 2NV1A 5HNRA 4TXEA 3RCMA 4MY1A 2YCLB 2OLSA 1QOPA 2C1HA 4YTRA 4PL2A 1KRCC 3W23A 1JYWA 1RJPA 1BWLA 3G3DA 3W2UA 3IUDA 1GG0A 1XDLA 2QW5A 3MP3A 3SCRA 4TX6A 4S2CA 4W89A 2GK1A 4FSAA 2WMIA 4ML9A 3WF0A 1ALDA 5K4XA 1SR9A 4P7OA 1KRBC 3NQEA 1NOFA 3UPMA 5DT5A 3BCJA 5LKYA 3QV8A 4LAZA 1UPPA 1XBXA 1WX0A 2BASA 3UZZA 4IT1A 4QTGA 3AXHA 5CBBA 1LROA 2GDQA 3NOYA 4J3VA 2NQHA 2A3CA 4C6BA 4YL2A 3IVSA 4C1NA 3CH0A 3CUIA 2VWSA 3L23A 3WUBA 4UQDA 2V2DA 3DOPA 2X16A 3AXXA 3N2XA 4LYRA 3CJPA 1H60A 3MHUA 4MDPA 3LNMA 1WZLA 2NXIA 5JUVA 1GTEA 6TAAA 3L2IA 4L65A 3BARA 4JYDA 4D1IA 3RK8A 3EOUA 5REQA 2ZE3A 2ZXAA 3CL8A 3ATYA 1IR1A 2OJPA 2WPBA 5D9PA 1QW9A 2E09A 2VO5A 3AROA 1YDYA 1K77A 3W1PA 5JBEA 5CGMA 3D3AA 4LSBA 2ZDSA 5FACA 4IISA 3GX9A 3NEVA 3M5VA 3WZ0E 2WLYA 4WSJA 3TW7A 3VOIA 5TF0A 1Y5XA 3L4YA 4ICMA 4YWIA 3UD6A 4HU4A 4BI5A 9RUBA 1ZLPA 3AISA 4HNNA 1R3RA 2Q8LA 2IPJA 4TX9A 2NWRA 3H7UA 3VK5A 4QGCA 1HW6A 3PNZA 1WDPA 1VH7A 5KETA 4X60A 1QRQA 3PPHA 3VX0A 1OGGA 2RUSA 4IFRA 3MCOA 4F9DA 4J1OA 3LTYA 1AQHA 2VFGA 1SZFA 3TYCA 1FXPA 3WX7A 4N9BA 4FNPA 3C3UA 3U5YA 4W8LA 5DY3A 4GGBA 1PDYA 1MFUA 2Y5EA 3QHOA 2JF7A 3W7JA 1NVMA 1W1PA 4XAYA 4ZGYA 3KWSA 1VFLA 1AW2A 2WOQA 1W56A 5XIMA 3DKJA 2VCCA 1ICPA 2I56A 4RLIA 1YX1A 4OZOA 3H2MA 4X61A 1OYCA 4RW5A 4JTIA 3CS2A 3LCLA 2V5JA 4AZ7A 4G7EA 2F6XA 4BF7A 3BPWA 3NO1A 4L4OA 4Q8MA 4JYEA 2AAMA 3P60A 4C5YA 4FXFA 4MUPA 4IL2A 3ID7A 2QCMA 3G22A 4EWJA 3P6LA 2G8ZA 1JZ7A 3PY2A 3L4UA 2WZEA 2HPMA 3QV7A 5CGQA 4OGZA 1CBGA 3TZFA 1CDGA 4FLRA 4EVZA 3MW7A 3TR2A 2GGGA 2QDDA 5I3KA 1VFOA 4AWTA 1OM0A 1A47A 3UETA 2CLEA 3U2EA 3PBVA 1QJWA 2VEGA 4F66A 5AOUA 1ZTVA 2X1IA 3TXZA 4WRHA 4S38A 3W07A 3NQ6A 2P10A 1FDYA 5CG7A 3WF2A 1IR2A 4HHPA 4QDWA 3VFLA 3NVTA 5DXYA 1VEOA 3GO2A 4F0RA 2VDGA 4L61A 2Y1HA 4CNNA 2XN0A 1GONA 3Q37A 1G4PA 3MQTA 3PG8A 3K4DA 4B15A 1H4PA 1ISVA 5CZKA 1R7AA 1VBJA 3OIXA 2CERA 3QY7A 2GVJA 5AHFA 4ZQMA 7A3HA 1AJZA 4BFAA 5A6BD 3OZPA 4UC5A 4S3EA 3ZT7A 1KGXA 4AYSA 1B3OA 1ZU8A 3KVMA 3UCCA 2HNHA 1ZHAA 2EBNA 2OZ0A 1UWIA 3QMTA 2JKEA 3FNDA 3IJ8A 4NZ5A 4UFMA 2VEMA 1C29A 2Y8KA 2XFWA 1J11A 3MP5A 3VOHA 3KP1A 4DF2A 3MVIA 3GTIA 4LBRA 3MV01 3OBEA 2HTMA 2PEVA 3H2CA 5HATA 1W3NA 2NT0A 1REQA 4HPNA 8CGTA 4AW7A 1IZCA 1DVJA 3OVRA 3IIOA 1A4LA 1TRIA 3MSYA 1DKWA 4I3GA 5FL1A 1CB2A 2DZUA 5EYWA 1JDFA 2INZA 3CL6A 1UR3M 2TODA 2F6KA 1OFBA 2DY3A 1GHSA 4S3BA 1Y65A 3M47A 2X05A 2X30A 3W4RA 1QPOA 4B5NA 1GW9A 2FHCA 2L5HA 3D3FA 1V3IA 1RJRA 3GIQA 4LAOA 2YDSA 1LBMA 2R8WA 4AD5A 2C16A 1SJCA 1VF8A 2PTWA 2Z1XA 2ZUWA 4F2BA 4GXMA 4OFCA 1UWSA 3WY1A 5DFAA 4NXKA 1TMLA 1UR4A 3T1GA 1V3JA 2VYOA 2ZA1A 3MUCA 1N8FA 3LBCA 5A8PA 1TV7A 4R7WA 1RUSA 1G1YA 1U1HA 3OO2A 1EFZA 4UXDA 3URAA 1XKJA 4WOQA 1NF0A 1C7SA 1C91A 3F2BA 4XKYA 1SR0A 2XN1A 5CXPA 5MHBA 5M03A 2E67A 2J7HA 4R5EA 1FDJA 1AD4A 4GCXA 4I9TA 3UCQA 5G4HC 2RHGA 3OP2A 3B8SA 5CPMA 3PBMA 4JTTA 3URBA 3SR7A 3A6OA 3S6TA 3T9PA 1UKPA 3B8WA 2G50A 1XF0A 1QPKA 2QYGA 2W6RA 3WLRA 1GVFA 3MWCA 4V33A 1BSLA 1EWEA 4TQTA 3MDUA 3GAKA 2FPVA 2WLZA 1E1CA 1IIHA 2A21A 5AC5A 2V3FA 1W32A 3A9BA 4WDXA 2H8ZA 1UH2A 3O7UA 1F05A 1DYSA 4FEZA 1EKOA 5C9UA 4S1FA 1LORA 4HNLA 3G0SA 1WXYA 2EG7A 2W61A 3FKRA 2HQAA 3SI9A 4K38A 1W5QA 2CLIA 3AYVA 3CL7A 4O54A 5I7GA 3GNPA 4RX0A 1QBAA 4LRTA 1FWNA 4C6MA 4Z2IA 1CNVA 1LUCB 2J7BA 4M80A 3HPFA 3A3XA 1CCWB 4HPGA 4FLQA 1XLCA 1K4HA 3EKGA 3H4XA 3PPGA 3SZ8A 3WBEA 2W0UA 2Y85A 4ZQCA 1J12A 2DZAA 1E51A 3ZVIA 3R58A 5K9DA 1ME9A 1TJ1A 2PC4A 1GVSA 4O4WA 1CXIA 1M3UA 1ZALA 1WO2A 1BEUA 1X1OA 1Q2SA 4TTUA 1W1TA 4IIGA 4H9XA 2PTYA 4P7QA 3KBSA 3EXTA 3MHFA 2FJKA 1OCJA 1LWHA 2YCLA 3OYZA 4IMCA 1GKQA 4GI8A 1LL4A 3W83A 5KZ6A 3V4BA 1H1YA 4AH7A 3VIOA 4GUGA 2PPGA 2PRHA 5TIMA 5IDZA 1MQPA 4GY7A 2XZ9A 3M5ZA 1XRVA 1XYFA 4N4QA 4O1BA 1OCQA 4IFKA 4N0RA 3VC5A 3VMNA 2CKSA 3UWQA 3W6LA 4F0HA 4YWSA 1DTNA 2VOTA 3ZOAA 4DNHA 2WNQA 2X1RA 4LF1A 4AAJA 3PVFA 3R89A 4M3PA 4UTJA 3I7SA 1AH4A 3FJ4A 1V6TA 1JCJA 1C8XA 5HMSA 3GHTA 1VBHA 3EWDA 3W7PA 1K4GA 2ZX6A 2BXYA 4WCJA 3LHZA 3O06A 1KNWA 3UZWA 3GVQA 1W2VA 2RDUA 4LH8A 4H9YA 1TV3A 3PNUA 4NU7A 2PLKA 1MW1A 3F4VA 1MNSA 1N2VA 3U4AA 1V6UA 1VC4A 3S1XA 3USBA 3SEPA 4BF5A 1UJQA 3G8EA 2WQPA 3LCHA 3G0XA 3GM8A 4A3RA 4DX3A 2LLEA 1QHZA 2QLYA 5F1VA 2YXXA 1QWKA 1IT7A 3NYZA 5CPSA 3ARVA 1Q5MA 3HGRA 3EMZA 4HYRA 3U48A 2Y4SA 4YTTA 3IIXA 2J24A 1K8XA 2B4GA 2J8TA 3ALGA 4HZMA 2YZRA 2J74A 5BNKA 3W1XA 5LZLA 3E0LA 7CGTA 1XLKA 5K9CA 5ECUA 1HKWA 4WGHA 2WMFA 2XIOA 2WWCA 1PBGA 4PEEA 5ABTA 4IF2A 2C79A 3A3WA 3E9AA 4B90A 3GVWA 3SCWA 2E3ZA 2JK2A 3KL0A 1OJXA 2OWCA 2I57A 4GZJA 2Q6ZA 4KQNA 3ZR6A 3RPTA 3M0LA 4CNSA 3W1QA 1R9ZA 4TMBA 2BGNE 3L12A 4C7GA 1ZUAX 4D6HA 3J7HA 1YLVA 5B7YA 2D73A 5C70A 3T0TA 1BQGA 2Y7GA 4XB3A 3E0WA 4O18A 4LVDA 1PKNA 6ENLA 1D3CA 3STFA 2WBKA 5EBAA 2R1LA 3QC0A 1KFKA 4JCMA 1TPEA 1PHQA 1A4MA 2R1PA 4LNYA 4KCTA 1P5BA 4MY8A 5GQBA 1G0CA 5EB8A 3M4HA 1F3EA 4J2PA 4B3ZA 2D24A 3TTYA 3VNIA 1JEZA 3WBYA 2J66A 2UWFA 1F3TA 1R85A 5ABHA 3V5CA 2WNNA 2JEPA 1W0MA 3AMKA 3ECQA 4UOJA 5AN7A 4JR5A 4HB7A 1EDGA 4DAFA 1UMYA 3TNBA 4XZIA 4AF0A 2A2IA 3DHDA 3A23A 1R3WA 2GGIA 5A2CA 1HGWA 4L1WA 4YCOA 4W7VA 2EO7A 1XKYA 2A79A 1GOXA 2BBFA 1Q4NX 1RA5A 2ACQA 3VDBA 4EXAA 1TWSA 1LTDA 3VD5A 1X8FA 3UA4A 2B7OA 3W3OA 1KLZA 2OWXA 1D9EA 3WLSA 1KLYA 2E1DA 1LQAA 1TUXA 4JFWA 1QK0A 3WQDA 3AWNA 3NIYA 4IXXA 1BD0A 3FJLA 3VIHA 1ZBVA 3NM1A 1G4EA 3WG6A 1I2PA 4HP5A 2J4GA 2VDIA 3EMCA 4A8RA 3QV6A 1JZ2A 2WJFA 4HK7A 4GH3A 1DE5A 1GYNA 4Y6GA 2BHZA 1AMYA 5C9ZA 3UR5A 4QIUA 3AWOA 4Q3MA 1D7KA 1TA3B 2YBVA 4H01A 1R2RA 4L6HA 3FYPA 3TA6A 4JNZA 4MPKA 5I06A 2CEQA 4BZYA 1JZ6A 2BY2A 4AX6A 1R46A 1SZRA 3SRKA 1SQ7A 4U2ZA 1QHPA 3PZOA 3QR3A 1X97A 4M7TA 1OY0A 3LGEA 2J77A 4PE8A 4DN1A 4CVUA 2ASHA 2FTWA 4IOTA 3WL1A 5T91A 2WMKA 1RY8A 2VGFA 2OQYA 1SZEA 4H6QA 5CPLA 2ZRXA 1EDQA 3W25A 4PB3A 4F4RA 1C9DA 2ZUTA 1D8WA 1H1ZA 3MI3A 3INPA 1HKJA 4JTLA 5GPRA 4D8ZA 1HP4A 4W9TA 5BOEA 5A6SA 4NJHA 5FF4A 4Q8VA 1C8YA 1I6NA 1UD2A 3ZLGA 4GJIA 3IIPA 1AMKA 1AZ2A 1Q63A 1DJWA 2GFTA 1RPXA 3UJRA 4EX4A 2IXUA 4FS9A 4CQDA 3AIQA 1OF8A 4UBPC 3DHUA 4YVVA 4UZSA 1CLXA 4WJEA 5D2WA 2YL6A 1F4HA 3OLEA 4D6GA 3KFTA 4J27A 1KXTA 1MO0A 2OSYA 3W2LA 1JFXA 2PDPA 4JIHA 3G24A 1XL9A 3U2OA 3R0KA 4N9CA 3EPOA 1NDYA 2QJJA 5C7VA 5I3FA 1QOXA 4PCSA 3UWVA 2YOCA 3SW6A 3RLHA 4JTGA 3VUSA 1P0KA 6XIMA 1RQHA 1E4IA 3BCFA 2V3DA 4W7UA 4IG2B 4C6QA 3H2EA 1YKWA 4GX8A 3IEBA 4EKJA 2WV8A 4Q8QA 1JIBA 4K2SA 3QPYA 4G2DA 4XX6A 1C93A 3UERA 2QCLA 1UBSA 3N12A 4GBUA 1H11A 2DQXA 3VKJA 8TIMA 2IXVA 3NSNA 4PBEA 1XGDA 3TTOA 2FZNA 2PODA 1QO5A 4XQ6A 2FMOA 1PYFA 4MAVA 1A0EA 4MM1A 4B5XA 1JD9A 1BPLB 4DLMA 5ENLA 1ZJBA 5IHSA 3T07A 1GYLA 1T6MA 1F6PA 2BWGA 5BRBA 1FQ0A 1JDDA 1M9HA 3GXMA 1OC7A 2GUUA 3QC3A 5DRCA 4MAZA 4UOZA 4NL1A 1EDTA 2R94A 4GJJA 2BVWA 4HN8A 4B9YA 1TX2A 4QJ1A 2JFEX 1W8GA 1UHVA 3ZT6A 3K46A 2XIBA 5LSMA 2TYSA 4GH1A 4XO7A 4B91A 1UMLA 1KCKA 5FJOA 4H9TA 3ZYZA 1MMFA 1BKSA 3AIUA 2E25A 3KVKA 3GDTA 2QT3A 3BSHA 4TU1A 2WZMA 3UGRA 2X1UA 4H6EA 1M6JA 3PK7A 5ABEA 3KOZA 4O10A 3HU7A 2C18A 1MXSA 3LM3A 3WNKA 3QVQA 4CD7A 1OQFA 3NQ8A 4Z1DA 1SMAA 3SUWA 5EMMA 2C8NA 5GNXA 4BCEA 4D1JA 1LUCA 3LTSA 3WDIA 3GUWA 4NIRA 3MCMA 3DAQA 1G7UA 1TQJA 2VZUA 3Q65A 4FNSA 2PU1A 3ARPA 4MOZA 3VCCA 2VQUA 2PDWA 4AYGA 4DUOA 3HG2A 3ZR4A 2WVVA 2PDKA 1DJNA 1KGUA 4PFHA 5AYBA 1I9CB 1ZSXA 1OABA 2EF9A 3EKLA 3TIMA 1S5TA 5B80A 2YGYA 5AC6A 3FOKA 4U2YA 5DQPA 3TC3A 3QFEA 1MEHA 1A3HA 4WY0B 3CPUA 4WF7A 4ZO8A 2HBXA 1X96A 2C1IA 2BX7A 1ZJHA 3OGVA 2OOGA 3HTWA 3CB3A 3UW6A 3O2LA 1UD8A 2GJPA 1EC8A 1K9DA 2VUNA 4N6EA 5K9XA 4WDWA 4OVXA 4H9MA 3IJ9A 3ZJ6A 4AZCB 1XYLA 4Z2KA 3IANA 5HAOA 1NOWA 2D2GA 4B5WA 4Q4MA 4PA8A 1JD7A 1T7LA 4WGXA 1HKIA 1H5VA 2ZXDA 4US6A 1IYXA 1QNSA 3EWWA 2NX1A 2FDSA 4NG3A 3O6YX 1WB0A 1TO3A 1DQUA 2CZFA 4W88A 3VDCA 3NJ3A 5CC5A 3W74A 5E09A 3PTKA 1EWDA 4MFDA 1TQXA 3PBWA 4Z08A 5HXMA 1KXQA 4Q8UA 3S2MA 2WQDA 3LRMA 3MCNA 4LBSA 2VMFA 1E9LA 4LOCA 1UOZA 4MKNA 4PSPA 3VD4A 3UZYA 4Y2WA 2AQOA 3GUGA 1TUFA 1V7AA 3UWZA 1PIFA 2X1SA 3C2EA 3T2PA 4E6MA 3W2MA 4GI6A 1ICSA 1GJPA 3H4WA 3TV8A 2POTA 2P0OA 3G1HA 3DC8A 3HGSA 4ZSUA 1RV8A 3BSMA 2QDEA 3RX2A 1VKFA 3GXTA 3PFRA 4AC1X 4LS1A 2FHBA 5H8MA 2Y0FA 3MO7A 4ICNA 4C6OA 2Y2WA 4D6IA 3EDJA 3BLLA 4OBRA 3P0WA 4U4MA 3CXOA 3T2OA 2W63A 3T0BA 5H2ZA 4XSLA 3DBNA 1ELSA 2OXNA 4R7JA 1GJWA 4M19A 3DFYA 5A6LA 4JDYA 2PDIA 3I10A 4LV9A 3F4CA 3ERPA 1FWAC 6TIMA 1OIMA 3W87A 3EDKA 3OHMB 4HK5A 1TVPA 2VFDA 3VXGA 3S2LA 1ZENA 4AX7A 4GNVA 1O60A 2NT1A 4K37A 3EDFA 3NO3A 4OOUA 1GJUA 4XD6A 3B0YA 1N8IA 1E15A 3HV9A 3RO8A 1LLZA 3H2AA 5M2FX 5G4WA 2VZTA 4PUJA 3TJLA 1DQXA 1EHNA 3QJAA 2ODOA 4P7NA 1J0HA 4YPJA 1T96A 1OCNA 3DC0A 1E4LA 4HSHA 1UWAA 3K13A 1TPDA 3OGRA 4UFKA 2A1YA 3LHWA 3LLFA 1IZKA 2X40A 3EWBX 1UCWA 4MKVA 3MTWA 2PFHA 1OADA 4F0SA 1OEPA 1E0XA 3M6DA 2F61A 1I45A 4PODA 3WF1A 5H6HA 1F73A 3TFXA 2GDUA 3SSJA 3ITGA 5F4SA 4BQ4A 2BNJA 3BUVA 4NJJA 2HVOA 1MI3A 2B81A 4IX0A 3SRDA 2D2HA 1SFJA 1XLGA 2XSAA 3C0JA 2JF6A 2HE5A 4E2BA 2R6OA 1Z7AA 3KTXA 2OYKA 1GK8A 1S3TC 1LLWA 4CQ8A 3BXWA 4NP7A 4XTIA 3QM3A 5TQLA 2VEFA 3EX3A 4X9SA 4ZSTA 3MB9A 3CEUA 1P1XA 4JX6A 3G1AA 3ITCA 2XISA 1XM3A 3KVJA 1EZWA 3WH9A 4DO6A 1XCWA 4HJFA 3SN0A 4HNUA 4HTBA 3M16A 3S1WA 4XWUA 1CXEA 2WC7A 3T81A 5IDIA 3WLNA 4HU0A 3AUJA 3O15A 3BK0A 2XN2A 3CV6A 1W8SA 4JQ1A 1GOOA 1YIXA 4TV5A 3MO4A 4IH3A 4LU0A 1TA3A 2E7FA 4P8UA 3WBXA 3BE7A 1F7BA 3UXDA 2ZBTA 2PDXA 4MY9A 2WHMA 3N34A 4YS1A 4RZ6A 3BO9A 1YNQA 4JKMA 3CLMA 4KT2A 3H6OA 3MBDA 2QCGA 3NCOA 3FYOA 1F76A 3HN3A 1WP6A 1FWRA 3USZA 2G37A 2VVSA 1F3XA 1XJBA 3SGZA 2PRLA 3TAOA 2ZIDA 3TW6A 3M0MA 3FV9A 1M04A 3EOLA 3E96A 1VLIA 3C56A 1PCKA 4WLCA 2F2HA 1EBHA 2HK1A 3ENLA 3LPFA 5CAHA 1P48A 3THAA 3C3NA 3CZLA 3MJYA 2FTYA 2O9TA 3R94A 4NRSA 3C0LA 3U5UA 1PPIA 2ZOXA 1G9HA 3ES7A 1R5YA 4I7WA 2WMHA 2YL9A 4EACA 5I07A 1NWTA 4FIQA 2ZC1A 4Q6JA 1C8QA 2XFFA 2OT1A 3P74A 5HQMA 4A3HA 4BHYA 1UP3A 4IG2A 1W3IA 3VIPA 1LRNA 3WJYA 2VC9A 1JVNA 2VR5A 2PLJA 3VCNA 2DZPA 3FJ6A 1P6CA 3CAVA 6PTDA 3BMVA 3R10A 3QEZA 3PF3A 5LXXA 4GINA 3QW4B 4RZBA 1RBOB 2YLLA 3MVTA 3LY0A 3THUA 1QBBA 2IW0A 2XSXA 1PTAA 1W3LA 1WOAA 2WJDA 3APYA 2BP1A 4F40A 2X7VA 3U8GA 5AHMA 1OX4B 2AL2A 2YDRA 3B8TA 3SCNA 1SJAA 1LT7A 3ANUA 2J27A 3CIVA 3VYLA 2HEJA 1EEXA 3PPCA 1S3HA 3EB2A 3LGGA 2RDXA 3SDOA 3I3DA 2ZX9A 4RDVA 1DL3A 1ZAHA 1V4YA 2WCSA 5FCZA 1QVBA 4CCEA 4WQ6A 3KUMA 4J3SA 1XLFA 3CUXA 3B9AA 2BLEA 3CQJA 1K9FA 1NJJA 2GQAA 3F7JA 3M0IA 1UASA 2V3GA 4R33A 3WQFA 3GY1A 1E72M 3SURA 3CIWA 1K03A 3WD1A 5FJJA 1FKWA 1FP8A 2HISA 2ABAA 3DDMA 3GVGA 2VX7A 3ZIZA 4D72A 2DIEA 2G5WA 3THQA 4ZFMA 3VUPA 3CYJA 3W37A 2ADAA 1U5JA 3W7MA 3HG3A 3N2TA 1SUXA 2BVYA 3WNOA 2CCRA 4J7RA 3RN6A 2OGYA 3EGJA 1VBGA 2VXNA 3RM9A 1NFPA 2KAUC 3T0DA 5DCDA 4LCQA 4NNBA 2CLKA 4D6CA 2BY1A 3S2NA 3EXRA 1X38A 3DENA 4XD4A 2VZOA 3W00A 4MUZA 5DT7A 1QPNA 3WLQA 5G1MA 2YW3A 4JN6A 1A0DA 2VCAA 3LSCA 3TOPA 4XBSA 3LI0A 3LYEA 4PMZA 3WEMA 3EDDA 4HQVA 3VO0A 3HPSA 4QAIA 4WY0A 3STGA 1QW8A 3RLUA 5KSWA 1FCQA 3KBJA 1UKQA 3GG7A 2V5CA 3HQ1A 2YBUA 3OYXA 3LZ5A 3QY6A 1JGMA 2Z27A 1GG1A 4GACA 3GKAA 3IACA 4XIMA 3QTGA 4S3JA 3EWXA 1ZP4A 2CETA 2Z6JA 2BMBA 4J35A 3SO7A 4AZCA 5AZ0A 4PTXA 4Z2HA 1TTPA 3QQ1A 3W7HA 3F5LA 1NTHA 4WUIA 1DHPA 5CBIA 3EB3A 4YTUA 3PZVA 1G4TA 4C6EA 1IXNA 3HPXA 1QATA 4GY1A 2QZRA 3W1LA 4IPLA 1XYMA 4W87A 2Y88A 5CSUA 1KCLA 4ZE5A 3AIBA 3C52A 3QOKA 1S2VA 9CGTA 1UR9A 2TPSA 1ZCOA 2J9XA 4O15A 5XINA 3LCFA 2X42A 1X1NA 3R79A 3KLKA 2F38A 3JW7A 4CD5A 1OFOA 1JXKA 4UMBA 4GG9A 4QM1A 1TPFA 3LLDA 3A4WA 2JEQA 3WK0A 1Z42A 4MWAD 4MPQA 4MJ4A 5JXQA 1G01A 4CN4A 3RAOA 2HXUA 4MHBA 2V6AA 4HYVA 4U10A 4Y7EA 2GGEA 4NXSA 5JVLA 4LVFA 4S3DA 1GYMA 1WOBA 3B9EA 3FFSA 4XUGA 4FA3A 4KWOA 1CXFA 1FWIC 4BK9A 1L6GA 3KX6A 3WN6A 2QAFA 4JN8A 4YTSA 3UG8A 1J96A 4GNKB 4QG9A 3TK7A 4D6FA 5BOFA 3JR2A 1K7EA 1FWJC 2WAGA 1PIGA 2VX6A 3LPPA 4H8VA 4DO5A 4XK2A 3W1UA 3TN3A 1VS1A 1C7TA 3C2OA 1KWKA 1LOQA 1Z8AA 2WKJA 4KIEA 3W29A 3PZUA 4QE1A 5BU6A 2VR4A 3UNTA 4YU1A 2V69A 4I90A 5AYXA 1NIUA 1TWZA 4E2VA 3BLIA 2B7NA 1TPC1 4PB4A 3SUSA 1B2YA 3BLDA 4JDBA 4Z42C 5G2HA 3GIPA 1VBUA 3T05A 4GI9A 1W5PA 3AFBA 2E68A 3RX3A 3BZJA 4U5IA 4IX2A 3OEXA 1VFFA 3MBFA 4R9XA 2VC5A 3CC1A 1CXKA 4ADSA 1AH3A 2BODX 2X8RA 2H3BA 2PDLA 3WNPA 2CLOA 1KBKA 2IQTA 3ZQ9A 3CWHA 3EOSA 3ZM8A 1E71M 5I24A 1RK6A 2BV9A 3MPGA 5HDRA 8A3HA 1EF3A 3R4IA 2QUMA 4M6UA 5KINA 1QCWA 4NAEA 4PCPA 4AQLA 2W66A 1Q6GA 3SN4A 4CEXC 1BQCA 2PWDA 1J5SA 1B3YA 4YYFA 2OR2A 3PM6A 4RZ4A 1US3A 2CC0A 4B5VA 4NJGA 3W7RA 3WH8A 3MSDA 2ZZ6A 3B8DA 4R34A 2XGIA 3W24A 3VM5A 1JL8A 1WAWA 2ALRA 4XTDA 2VWTA 2YL5A 3UJ2A 2ZQ0A 1IWAA 4FLSA 4FK9A 1CXLA 2ZTJA 1RALA 1FFRA 3A21A 4NAFA 2DPEA 2NVDA 3BVJA 1WXZA 1YBQB 1B30A 1LWIA 1U30A 3IJQA 3WQOA 3NVDA 3PC0A 1KM1A 1HF6A 4JEJA 1Q66A 4UUIA 3ARRA 4A29A <