3H2FA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
269
Chain Sequence
b'MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2fA00
2E7FA 3H2MA 2VEFA 3TYAA 4O0QA 1EYEA 4D9PA 3H2EA 4NILA 1AJZA 3H21A 3V5OA 1AJ2A 4DB7A 3TYUA 4S39A 2YCLA 3H2CA 3TR9A 3TYEA 4S3FA 2H9AA 1Q7MA 4DJFA 1TWWA 1Q7ZA 3TYCA 2Y5JA 4DJFC 1Q8JA 3TYBA 4DJDA 4DJFD 3H2AA 3TYDA 1Q7QA 1TWZA 1AD4A 4DJDC 4O1EA 3MCOA 4HB7A 1AJ0A 2YCLB 4C1NB 2DZBA 4DJDD 3K13A 4CCZA 1AD1A 4O1FA 4NL1A 1TX0A 4MWAE 2VEGA 4G9PA 2DZAA 3H2OA 3TZNA 4PZVA 2YCIX 3H2NA 4MWAC 4S3BA 1TWSA 1Q8AA 4MWAD 4S38A 3MCNA 3TYZA 2Y0FA 3H22A 1Q85A 3NOYA 4S23A 1F6YA 3MCMA 2H9AB 3BOFA 4DJEA 4D8AA 2BMBA 3H24A 3BOLA 4MWAA 2OGYA 4DJEC 2YCKX 4S3CA 4DJED 2YCJA 2DQWA 1TX2A 4S3EA 5JQ9A 3H2FA 4NHVA 3H23A 4DAIA 4S3DA 3H26A 4D8ZA 4C1NA 4MWAB 2Y5SA 3TZFA 4DAFA 4S3AA 4NIRA 2VP8A
chains in the Genus database with same CATH superfamily
4FIQA 4KWUA 4JYEA 4YPJA 4AY1A 5HOSA 3UWWA 4C6FA 4QE5A 4WDUA 3LCFA 1HF6A 1DTNA 4H6KA 4XTDA 5DF0A 2DZPA 3UF9A 3PZTA 1XDLA 4QTGA 3LNMA 3DENA 3ARSA 3RMEA 4XAYA 4E5TA 5DY3A 1LORA 1AD4A 2FH6A 1QCWA 5BCAA 2WQPA 4PMOA 3U4AA 3DKJA 3UJSA 2OQLA 1VPYA 3VDGA 4HP5A 4PZVA 2QUUA 3N1AA 1XHGA 3MVTA 1W1PA 2F8QA 4MG4A 4U31A 1VFLA 3DFQA 4C6PA 1VLIA 4O1BA 4DJEA 5FCZA 4GYFA 1EUNA 4ICMA 4KF1A 1US0A 2O4QA 1MXSA 3QN3A 4NQ1A 1GOMA 3GC5A 1KR1A 3SZ8A 2O92A 4Q8QA 1SZNA 2KX9A 2R94A 3MV01 2P5NA 3MUIA 4UTTC 4J28A 1M9HA 1GEQA 2FKPA 1HKMA 2V69A 4Q4KA 5ABTA 2JEPA 3KUMA 1V6XA 5LA0A 1SPQA 2XJ7A 4LOCA 4BK9A 2EHHA 4AYSA 3UESA 3QLLA 4ZOBA 4JXCA 5FSDC 1VQTA 3GU2A 2GJRA 1PV8A 4AQLA 1EF2A 5BZAA 4RNFA 2JE8A 3PJWA 2EJAA 2CNCA 2WZTA 5IXEA 5JBEA 5HATA 2QAFA 4WDXA 3OVGA 2VCCA 2H8ZA 5IBXA 2TRSA 2YDQA 5C5YA 3GS6A 4PTXA 1KWKA 1YDYA 5CZSA 2Z1XA 3RX3A 2GJPA 3QFWA 4QP0A 1KD0A 2VQTA 3IWPA 3WK1A 2V3FA 3LDVA 1TTQA 3ITXA 1A5BA 2NLYA 3HQOA 4NXSA 2GWGA 2Y1HA 3EEZA 5EPDA 3VKJA 1P7TB 1F8IA 4AHOA 1FWSA 3JZUA 3T40A 5AC8A 1XLMA 4LVBA 3RRAA 4IGHA 1R9YA 4B92A 3NQ8A 2V2DA 1OF6A 4BI7A 4YTSA 1E9YB 2WCGA 3CZJA 3WL0A 1JCJA 4FLOA 1TV8A 3KRUA 4GX8A 2O55A 4GJJA 4FNQA 2CHOA 1C93A 3O0FA 4YTTA 1DPMA 5KMYA 3ZR4A 1J0YA 2ZRXA 3EDFA 4Q33A 4L1GA 4JPGA 1JAEA 4ERGA 3A4JA 3O0KA 4WLCA 2BDQA 1GW1A 3RJYA 3MUXA 1B0IA 1MMFA 4Y90A 1WQ5A 1F6KA 4RZ4A 4C6BA 3MZ2A 3U7VA 4O8RA 3TK7A 4EACA 2VEIA 4XZLX 1TJ1A 1ONWA 3SRHA 3T0CA 3TE9A 4NASA 3PJTA 1BYAA 4MNKA 1FX6A 2QCDB 1ZCOA 3KVJA 1TREA 4NZJA 1EXBA 4JY9A 4GLEA 1S5TA 5HMEA 4MNJA 2WYSA 3RLVA 3CS2A 3LZ3A 4JFWA 4X63A 4XZMX 3EWCA 5CC3A 1DVJA 1PKLA 1DJYA 1KFLA 2PMQA 1OYBA 7A3HA 1F6YA 4E8DA 2QCEA 2X7VA 4W8LA 1V8EA 1K1DA 1DE6A 3WKZA 1GOXA 4LCRA 1M68A 1WXJA 1FKWA 2DW7A 3F2BA 4FK9A 4MB4A 4ACZA 1AA1B 1M7XA 5D05A 1XR2A 4LEFA 4KS0A 4WK9A 4JHMA 1VHNA 1J8VA 4FALA 3TFXA 2Y62A 1S2VA 3LHWA 1QFEA 1VGAA 3R79A 1RR2A 2E7FA 2ZX7A 2GSHA 2YL9A 2VOTA 4W87A 2WK2A 1VH7A 4GUFA 4LY4A 3VD9A 3IIZA 1N82A 1ZSXA 2PTDA 3NL5A 4GISA 4RPPA 3G0SA 4LNYA 2ZC1A 4HMDA 1V6VA 2WPGA 3APGA 1H63A 1K8CA 2E8YA 1I2QA 4ZA0A 1PEZA 3BANA 1DBTA 4ZFCA 4NZ3A 1C7SA 4N9CA 2A0NA 3H4XA 1IWAA 6A3HA 4KEVA 1TWZA 3WEZA 2OMAA 3PPFA 3U7BA 5T91A 2YFNA 3EOOA 4TV5A 2PFHA 4E4UA 3E1F1 2BLEA 3A4AA 3CWHA 4NYYA 4IIEA 3PM6A 3CHCA 4LWWA 2C14A 3S1VA 2J7BA 1YDNA 3EA3A 3UXDA 2VTFA 2NQHA 4CU7A 3SCUA 4I5XA 1Q6CA 1V77A 1YXYA 4M6VA 3UCDA 3IACA 2AQWA 1TPH1 2PWEA 3VK5A 1EJTC 1VBJA 2DDXA 1L0PA 1XBVA 3ZT5A 4GPNA 5KTLA 2ZRYA 3W72A 3PWIA 2QPXA 4AVFA 1GTHA 2OZ0A 3GDTA 4FX6M 4U2ZA 3FW6A 4OTKA 3CBWA 5REQA 3HB9A 3CIWA 2OSYA 4AHQA 2OLAA 3CAKA 4FB7A 1G69A 1L8NA 3IEBA 3OBEA 3M6DA 4HJFA 1IXOA 4DPPA 2VP8A 4XK2A 2FB3A 4TO8A 3N4EA 5AZ0A 3KL0A 1F4AA 2UBPC 4TTGA 1IT0A 4DQWA 2WSKA 3ALFA 3P81A 5GQBA 2PE4A 3TMQA 3G18A 2ZXDA 4WHBA 5A6KA 4KPLA 3D0CA 5F4WA 3G0XA 3JVAA 4MGGA 2ZZ2A 3PF3A 2QMKA 1BQGA 1MQPA 3CV1A 2VD8A 3PNUA 2YB4A 2XFRA 1KGXA 2P50A 3NWRA 1BYBA 1LL6A 1B90A 1K8XA 4DUOA 1EBHA 2YFOA 4R88A 3MHUA 2P76A 2DUXA 9RUBA 4WOZA 2ACUA 3WQPA 1NP2A 1DWAM 3GHUA 3VCCA 1E40A 2ZDRA 3I7RA 4ZMGA 4ZL1A 8RUCA 3SCTA 1Q45A 3CJPA 1QPKA 1FWFC 4FZIA 4MZ1A 1SZEA 3AALA 3B8SA 4BQ4A 1XQLA 4GQGA 2ODOA 3GFXA 3CV2A 3W9ZA 2OFJA 4GC3A 4NHVA 3NPUA 4S3DA 2PBGA 2OQYA 4JFTA 2ZIDA 3SSJA 3DFHA 1I0BA 2O9RA 2GLKA 1JPDX 1DJQA 4Q8OA 3GIPA 1E1FA 3U8GA 5HR7A 1MXDA 2NLIA 3G1HA 4PCFA 1ONXA 3RK8A 1TPFA 3GK0A 4A4AA 4L9ZA 2WBGA 4O11A 3EX1A 3LCGA 1K02A 1EOMA 3RUBL 3E74A 3IUDA 1O95A 3V3WA 1J01A 1VFHA 1WDWA 3ZXWA 5JVLA 1TPEA 2YSWA 3HPFA 1U22A 3UEQA 1DXFA 1D8CA 2FQIA 3UNDA 4Q6JA 4UNLA 1MZRA 3BV7A 3P8IA 4H6QA 3SCSA 3KL5A 4QNWA 4MJ4A 4DY1A 4DVOA 3N73A 3W6MA 3EAUA 1OSEA 1TV4A 1XH2A 2NQ9A 2JGQA 3QXBA 1RY8A 3WFLA 3RJXA 1J0HA 2QIIA 3G1YA 1XGEA 5SWUA 3MCMA 4PC8A 1DWJM 1TV3A 4PMJA 1V3KA 3TA9A 4KWSA 1DJGA 2GL5A 4Z1CA 2VGBA 5AVNA 2W0UA 1XYCA 2C71A 3RNDA 4IXXA 3QM3A 1V7AA 3T4WA 4P7NA 4OVXA 1W6TA 1XSJA 5G4WA 1G67A 1CT5A 3KBWA 1JGIA 4C6JA 3EMCA 4CQBA 2CETA 1UR9A 2RGMA 5LGXA 5DT7A 3BCFA 3Q94A 2PI6A 4K1GA 3ZOAA 3CUFA 4ZQNA 4GH1A 5I3JA 3LV6A 4ERIA 4IFRA 2PWUA 3EWUA 4NZ4A 2B0MA 3QR0A 3FDKA 4GRSA 3FAWA 3GNXA 4Y8EA 3V4BA 1VCGA 3AJXA 3H2AA 3ZS4A 2RAGA 3LTPA 4LYKA 1KGUA 7CGTA 3LLXA 6REQA 1WXYA 2CLMA 3WLJA 1BLIA 5ECVA 3G6MA 4EXBA 2DGAA 5I78A 1DWGM 4R7JA 1JZ8A 3C2EA 1Y8BA 2I9EA 5U7SA 1U33A 4DPQA 1KRCC 5H2ZA 3R12A 1ONRA 2ATSA 2Q3RA 2I5GA 2Y7DA 2JF6A 5AZ1A 1G7UA 4QBXA 3G8RA 3GVRA 3W7CA 4N6FA 2E6DA 3G5EA 1A5CA 2GOKA 2YZ5A 3CHDA 1X1OA 3W7RA 2WSPA 4IMDA 3O6CA 3C2OA 9XIMA 2WVSA 1R86A 3EDKA 2AQOA 3H26A 5G4HC 2NV2A 4IQLA 2IPWA 2F84A 1DJNA 5JBFA 2GQAA 2XIJA 3PTKA 4PCNA 3LPPA 1W3KA 1DIOA 1KV5A 4K3ZA 1S5WA 3GXPA 4HNNA 4ADUA 4MDPA 3RU8X 2BTMA 3QQWA 1GG0A 2Q3OA 2PWVA 2JK2A 1KRAC 3VABA 3B9NA 4QLKA 4JX5A 3S1XA 1RBAA 3W1UA 3T8QA 1S1PA 3LMZA 3T4CA 5KEZA 3ZVHA 4A6GA 2PLKA 5TBOA 3WQGA 5REQB 1VLWA 1V93A 3DFPA 2WC3A 4Z2JA 3S9ZA 1HXJA 1C8VA 1VZWA 4FXJA 3GZ3A 1UUOA 1EA9C 2Z7GA 1M41A 5CGQA 3AIWA 3BTNA 3GLCA 2I7GA 2FGZA 1X6NA 1F6PA 2W27A 3M5ZA 4HU4A 1WDQA 4RCXA 3SB0A 3F2DA 4S3BA 2Z1VA 1EWDA 1AQ0A 3O3RA 1B1YA 1YBQB 3S5YA 5DRCA 1CGUA 2NSXA 4PSPA 1V3LA 4YCPA 5AHFA 2VX4A 2INEA 2HPMA 5A5WA 2Z4GA 1XIFA 2HE5A 2DH3A 4EAYA 3W38A 2BY2A 2ZRWA 4K7YA 2UZ9A 5MF5A 3GG8A 4JTQA 2WZMA 4ZSUA 4B2DA 3GWQA 3R0DA 4A35A 3HA1A 2FZNA 1MNSA 3SRDA 5A8NA 3C8FA 3N2BA 5TQLA 2AGKA 4AZ6A 4AX6A 2D0FA 4UTFA 4P7RA 1MQQA 1ZJIA 4ZSTA 3C2YA 3PBGA 7XIMA 2W62A 4QROA 4FXSA 2IW0A 5LZLA 1BXBA 4FA3A 1RA5A 1YADA 1IIHA 3RYSA 3MMDA 2ESCA 1A5NC 3U3HA 3NZGA 1P6BA 1R3TA 1L9WA 3GVVA 3TTSA 5CAHA 3LY0A 3MCOA 3W7OA 3K13A 1BRLB 2BNJA 2DORA 3GU9A 3G1VA 3WDIA 4CCDA 1C90A 1D8WA 4UR8A 1S2CA 2EJ1A 4UWMA 2QJMA 1KCLA 3ES8A 3UBPC 2ZXAA 3TW6A 3UGRA 3AWOA 2BB0A 4A29A 1Q2RA 4PUNA 4YU1A 3G2GA 1R7AA 3WSUA 5CJMA 1SJCA 1BSIA 4X9YA 2VXNA 4MF4A 2VEMA 2VGFA 2QCMA 4PUKA 2CZEA 4E2VA 1KWGA 3M5VA 3GW3A 2GSEA 1TYGA 2POTA 3PZOA 1W5PA 5F2GA 2DQWA 1FVPA 2VZSA 1NQ6A 2AKMA 1Q4WA 2C0HA 3EMZA 1A5LC 5LHFA 2A7RA 4REQA 4FR6A 5HAOA 2WHMA 1MUMA 1PO9A 3W2LA 4XVEA 2J7DA 3DAQA 4M51A 5DN1A 5C0QA 3FNDA 4DF0A 3TJIA 3CAVA 4E6MA 3N19B 4JQAA 3UCQA 1PWLA 3AMDA 3LBMA 4H19A 3F03K 4RDVA 5IFTA 4HD5A 1OC5A 1R85A 2ZRZA 2PBOA 4IIGA 1TO3A 4KIRA 5C71A 1OY0A 1QI3A 1LP6A 2DSWA 4M81A 4JDBA 3AC0A 4KERA 2DFAA 1A3HA 1UQYA 4H9TA 4DO6A 2PC8A 2OKTA 1ISYA 4GQRA 3LPOA 3WYZA 1ADDA 3MUAA 4D6GA 2J7EA 3HMCA 5HNNA 2QCCA 3S2JA 1QT1A 4OOUA 1OX6A 4ATLA 3B9OA 1TZ9A 1R3YA 1YX1A 4F9JA 2B7NA 4OOZA 2H6RA 1EGVA 4UQBA 3OZPA 2PB1A 7ODCA 1TELA 3AAMA 4ZB2A 3IANA 3SW6A 2BOEX 1UBSA 3E3HA 3CK5A 1FH9A 1OFRA 2BVDA 3IK4A 4XD3A 2G96A 4DZ5A 4WUIA 3W1PA 3NZRA 3K1GA 2QNEA 1SYTA 5I7GA 1W56A 1JXJA 1T5AA 1WPCA 1OFOA 4QR6A 3CUXA 3N9KA 1Q5MA 2DT1A 4JBRA 1HJSA 2BG5A 5I3KA 2A79A 3TCEA 2Y2WA 2D2HA 3EPMA 2FZMA 5LNVA 3RDKA 4N42A 1HP4A 2QLYA 1UD3A 3ZIZA 3W74A 4HIBA 2UY3A 3C6CA 2ZDSA 5HWNA 3W2UA 4GZEA 2BFGA 2EXOA 1VPQA 1WBHA 3O05A 4W8BA 1J10A 1QR7A 2V38A 3CQKA 5EKYA 5A94A 3SRFA 4G9PA 6ALDA 1CENA 4AFYA 4UQCA 5AYXA 3WENA 3CMFA 2ZE0A 3CZEA 3IIXA 2PDBA 1CWYA 1YMYA 1CXIA 4UQDA 4GH3A 4Q8MA 2Q01A 2BY3A 3AU6A 2ATMA 1KGWA 5DY2A 1PX4A 4LGXA 4G1KA 1AW2A 1E43A 4GZ7A 3UCCA 4GNJA 3SO7A 2P0OA 3QGVA 1YKWA 6ENLA 2YCJA 3S2NA 4GUIA 1HL9A 1A49A 2ZUTA 1ISWA 4JCMA 5AY7A 4BEQA 4LS0A 4GFIA 1W3TA 4K6AA 3LOTA 4AWSA 4LF2A 3NYDA 3HO8A 1XDJA 4H04A 1UKQA 1VFSA 1V0NA 3AXXA 3GNDA 1VEOA 3M44A 1OYAA 1LUCA 2D2JA 3A21A 5C2GA 1QJWA 5D8WA 3K8MA 1R3VA 3VIFA 4IM4A 2INZA 1KB3A 3EA1A 2PGEA 2HMCA 4H2HA 3IJQA 5J04A 4LYRA 1U2YA 3JU2A 1WP6A 4OE7A 3ZJ8A 4A8NA 4FXRA 1FP9A 1O4UA 2XINA 1QOQA 2E25A 4WQ6A 4PMNA 2CEQA 4XBJA 1W54A 5AYBA 1R47A 1Q6DA 1FH8A 3WD3A 4O57A 1A4MA 4F0HA 1FDJA 4LXFA 3RCYA 4A3YA 2OEJA 4GIAA 3KP1A 2ZBTA 4GJIA 2CCRA 2FHFA 3A22A 2DEPA 7TIMA 4HA3A 2ZUSA 1UKTA 1EQPA 4OBRA 3E02A 1VJZA 2HZGA 3PB2A 1P43A 1HKJA 3PBWA 3W02A 2ZX5A 1AQFA 4F2TA 1F76A 2V67A 3AROA 4MB1A 5FJUA 3VM7A 1HJXA 5AYZA 1V0KA 1XG4A 3VINA 4PMZA 1HQTA 2WHLA 4L9XA 4H9UA 2YL6A 1EO7A 1DIEA 4K7VA 4CVUA 3FVMA 4J3UA 3UY7A 4NYUA 3E0LA 2WMKA 4H6RA 1UWTA 3GC2A 5AN7A 4BWLA 2ADAA 2WWDA 2OT1A 4GBUA 2UV8G 1GKRA 3M5XA 4PMXA 2E5BA 2VUYA 3QH2A 4ZO7A 1HKWA 3B06A 3EYPA 2H9AA 4NJIA 1IR2A 3DGBA 2VZOA 4HN8A 5A8QA 3VDBA 1LBMA 3COTA 2J8TA 3DX5A 4HB7A 2UY5A 5I3HA 2BVTA 4O1FA 3ZLFA 4UFLA 2YBUA 4PEKA 1JUBA 3TN4A 2E4TA 3C56A 1QMLA 3SCNA 3MVIA 3LUTA 2PRMA 1A47A 1E0UA 1Y5WA 4C7DA 2MANA 1XLAA 1B9ZA 3OTRA 3NO5A 1P6CA 3VNZA 1ZAIA 4Y9NA 4JTIA 4DXKA 3IJ7A 1AZ2A 1QOXA 1W9UA 3THDA 4UOQA 4PMQA 2XZ9A 4QG8A 1V02A 5LXEA 1U5HA 1XLLA 3LCLA 4LY8A 3SECA 3R6IA 3ITYA 1MNZA 1Q65A 3E0FA 4IPPA 1FWWA 1F4HA 1ME8A 4JQ1A 3LHTA 4JFSA 4WX2A 1XLBA 3ATZA 4IUOA 1QHZA 1GZJA 4J3VA 1BD0A 5CZJA 4FOUA 2IMRA 4YN5A 3LN3A 3W53A 1JQVA 1FFQA 1RK5A 2YW4A 4BF5A 3DC0A 1XLFA 4DJFC 5HJYA 4D1JA 3M7WA 3TYBA 4DYEA 2R9RA 3LHUA 4XKYA 1V03A 4ZGYA 1KQYA 4M82A 4ZOAA 3EDJA 2QUMA 1SO5A 3EXSA 4PE8A 4E4PA 1PKMA 4G8TA 4KCVA 2R1PA 4P8VA 4N0RA 5A69A 1G01A 4DUVA 4BQ3A 3C5QA 1DL3A 1PKYA 1TPDA 2XG9A 1UD6A 3KHDA 2UY2A 1TRIA 4H1ZA 1UR4A 3WCZA 4O1DA 2W61A 4Y96A 4M8UA 1RZMA 5DBTA 2C15A 2YR1A 3ABOA 3SUWA 1MWOA 2QS8A 3B97A 3WELA 3UPMA 2E8ZA 4YVPA 4UTWA 4MHBA 3DU0A 1MEHA 1O12A 4JKKA 1BWVA 1Q3NA 4FNUA 4HPJA 2Y5SA 3NPWA 3QW4B 4ZXLA 5XIMA 4IQJA 3LQGA 1RVGA 2AAMA 6TIMA 1HO1A 1O1HA 1JCNA 1E70M 4D8LA 2WM0A 2QJJA 5TAOA 4GD0A 2YCLA 4KKXA 2CKSA 4DXXA 3NO1A 2TMDA 4QLJA 3CZ8A 4WGXA 3OVRA 5BYWA 3A4WA 2X05A 5K9DA 1EF3A 5C6MA 4GYJA 4Q22A 4W84A 3KL3A 3B8TA 3MHFA 1O66A 3N4AA 4LNCA 2CBJA 3SCRA 1WV2A 3BGJA 3L0NA 4PH6A 2FGLA 1WDRA 1OWQA 4ZBCA 3STEA 3W6LA 4QGCA 3AHZA 1G5AA 3QRHA 4H7ZA 3AIUA 3F4VA 1XLJA 4DUXA 1KFKA 3CC1A 1JQXA 2G3MA 3GH7A 3TROA 2B81A 3LXBA 3HQ1A 5FAGA 2XHYA 4H9MA 3W7QA 1OFEA 4IOTA 5K9XA 1L6WA 2J78A 4ZQRA 2C1HA 1EP2A 3IIPA 5FA5A 2FPTA 2LLEA 4MWAB 4O50A 3P0XA 2XSBA 3KCJA 2E6FA 3U48A 1Y0EA 1KTCA 4QSHA 3KDNA 1AFSA 4MNLA 3SUSA 4AEFA 1XYZA 3NGFA 1BSLA 3AHXA 1QTWA 1BWKA 3EWXA 5JXQA 4W86A 4RE3A 4NRRA 4C91A 1F61A 1AJ2A 3WBWA 3P3BA 2P53A 4O8AA 5I3DA 3E38A 1M04A 3IIVA 4GBDA 5CQ1A 2Y5JA 2VC9A 4JIIX 1E0XA 4IQEA 2DZUA 2J6XA 1XBZA 3VKBA 5D2XA 1KBLA 5FD0A 1EUAA 1J2WA 4UQ9A 3UG8A 1S2AA 1KFWA 3IGXA 4J3SA 1VKFA 2VFFA 1S2UA 1BVNP 1CYGA 1H3GA 3W81A 4HSNA 4CN1A 2VEGA 2P1FA 1JF5A 3I68A 3TJXA 5BMWA 2EPNA 3T8LA 1H41A 5AC5A 5E9XA 2W66A 1GJWA 5JUVA 2Q71A 4H3DA 1P48A 4IIBA 3N2TA 1Q85A 1SR9A 2A3AA 2OZTA 2H9AB 1ZPTA 3AWNA 1G9HA 2ALDA 2CZVA 1XLKA 1PX3A 3L66A 1QK2A 2NUYA 4NNBA 3WNNA 3CL7A 4BS0A 1XIIA 5GJMA 3D47A 3WFAA 1XL9A 1H7OA 4M1BA 2J74A 3GYEA 4IISA 3OB8A 4FPSA 3C4UA 1KV8A 5LIUX 2D3NA 2ZX9A 3UJFA 3T07A 1LL7A 1LWHA 3MMTA 2JEQA 1PAMA 1XSIA 2WHJA 2OSWA 3MY9A 2YBTA 4L56A 3NR0A 1HGWA 2F61A 5E70A 2CKRA 3GTFA 4O1CA 4J27A 4D9PA 1WXZA 4JQ4A 1UROA 4V33A 1N8IA 5FF2A 4PMYA 2CLKA 5HUOA 4QAIA 3EX2A 3G1SA 1EGMA 3HGRA 1KC7A 3W70A 3GNNA 1H7NA 5MKGA 2HNEA 3G1RA 3A3HA 1AZ1A 1Q7QA 3O1NA 4DBSA 1Z32X 4N02A 3LBCA 4X2PA 3GBEA 2QHAA 4PL2A 4C6NA 3ANYA 4DBWA 4LB3A 1RY0A 5DRIA 3KOZA 1LZOA 1XKYA 2CXEA 4FOJA 2DIEA 5HK4A 4HN4A 1MFVA 1EDQA 2VT0A 4QRNA 1R2TA 4QISA 1GUVA 2NW0A 4ATWA 3GXIA 4WIWA 2J47A 1N7KA 1KKOA 4GUGA 5C9UA 1W17A 5H8MA 3TOYA 4L7ZA 4YTQA 1XH0A 4M56A 4JTUA 5CZ0A 1F3XA 3TLQA 1OINA 2E68A 3TJLA 1VFOA 1PX8A 3TKFA 1OF8A 4F2UA 3WH8A 1JNEA 3ISIX 3AYSA 2DUAA 2WNQA 4X0NA 2FDMA 4BY3A 4BA0A 3W7DA 3WH9A 2XH7A 1EEPA 5BXRA 4FP1A 5DMNA 2W67A 4PUEA 1TWWA 4AW7A 4J2MA 4B16A 5H8UA 1YTKA 3GXFA 2PA6A 3LK6A 1E5NA 4K36A 3WQ8A 4EX4A 3VIGA 2CXGA 2WAGA 2WNNA 1H60A 3KBVA 3BC9A 4TUFA 1ZUAX 3QJAA 1Q6GA 4WOQA 3TNBA 4N6EA 3W25A 1WCGA 3RAOA 2Y7EA 4Z42C 4U5KA 5A2BA 1X1ZA 3V75A 4PUDA 1V51A 4P7OA 3G1AA 1TV2A 3SSZA 5I5RA 1YE4A 3GR8A 3LHZA 4TX8A 5DT5A 1EXPA 2OQHA 1KTNA 1UHVA 1ZAHA 2V5LA 5T9BG 3R1ZA 3H2FA 3NQGA 5CLTA 5D32A 1ISXA 1W1TA 4XG1A 2Q09A 1S2TA 4HHHA 3P67A 3ABSA 3ECQA 2PDIA 4BFAA 4UMAA 3GR7A 3T2QA 4I90A 3XISA 3GG1A 4LPCA 4JIRA 2YA1A 2ZZ5A 2YB1A 4HYVA 1OFAA 5EFFA 1BEUA 4AIOA 3MC5A 3TH6A 2CC0A 5F7UA 2J7HA 3O9NA 1DJWA 2ONEA 3WQWA 1K77A 1ICPA 3I6RA 4IGSA 5D2YA 3T1GA 2DVUA 4HZ7A 3W01A 1PZ3A 2VD9A 1A3WA 1RLCL 1UD5A 3WK0A 3R8GA 2CYGA 3ONCA 5HWJA 3FK4A 3EWYA 1WKFA 3WLHA 5LKYA 5IDIA 3S9YA 5D03A 3FGCB 1KM4A 3FV9A 3GFZA 1DQXA 3WNMA 2AL2A 2ICSA 2WJEA 5FF3A 2IQ0A 3B0PA 2JFEX 4Q4PA 1FOBA 2ACRA 2D20A 3UP8A 5FKYA 3IGSA 1XIBA 1AMYA 4HPHA 1KFBA 2ZUNA 2X41A 4PBFA 5HPCA 3S1WA 5ENLA 2WMIB 3ARTA 1Q63A 3Q58A 4WDTA 3VIMA 4I9TA 4CEXC 3PJXA 4JYDA 3SUUA 3NTYA 4XUYA 3CGTA 4RX0A 4KFOA 3VNMA 4MAVA 1EB3A 4YJ5A 3UZYA 4CNOA 1UP3A 4AISA 1KM6A 1MW1A 4RE2A 3K8KA 4Q4OA 1QO2A 4QG6A 5EYWA 2BBFA 1RBLA 3TYAA 1H0GA 3T0AA 3UVIA 1U30A 1T6MA 4A2RA 3ARZA 5LYRA 5IOBA 3VDHA 3UU0A 4GGHA 4J4KA 4Q4SA 2W4XA 4AZCA 3N2XA 1MI3A 1Q7MA 1TPC1 1O60A 4JEQA 5D38A 5DQPA 2VYOA 5BROA 3THCA 3VNJA 2YA0A 4LC8A 4AC7C 3PANA 1XIGA 2E1DA 5K7JA 1V6TA 4KT2A 3OW1A 1UC4A 4AD3A 4DRSA 4IMFA 3NQVA 3WQ4A 4MZYA 4XKMA 4Y2WA 3K1DA 3E0VA 5BXPA 5TIMA 4MLJA 1Z42A 2NQZA 1SR0A 2PF8A 2B31A 4B5SA 2A3BA 3BDKA 2V5CA 4S2CA 3PNZA 4U28A 1CXFA 1W37A 1DJXA 4ZQPA 3B03A 4WKHA 1XLEA 6XIAA 2FVKA 3W23A 2VR4A 2CZDA 4QE1A 4EF9A 3BZGA 4AZGA 4F0SA 2VURA 3VU2A 3W1RA 3TLLA 4GNVA 3ABZA 2WB5A 3OLDA 2CESA 4V15A 3N6JA 2V68A 3WMBA 2PTXA 1J0IA 1KKRA 4QJ3B 2XVNA 4YCOA 2J25A 5PTDA 4H8VA 1KFEA 1WZMA 3BLPX 2QGYA 3LG3A 4RE4A 1MFUA 1WDSA 1UA3A 1CZ1A 1PHWA 1TCMA 8XIAA 4I7UA 1E1CA 4AZBA 1AL7A 3OHIA 1E9ZB 5A8MA 1XRTA 4DEFA 1XYLA 4JNYA 1XICA 3TQ0A 1UUMA 4K8HA 1GQIA 2V63A 3UWEA 4OWGA 3SEPA 2WWCA 1LF1A 4C6KA 1FDYA 2HBXA 2YKKA 4QXIA 5FF7A 3RILA 5FJPA 3SRKA 2WHKA 3N3MA 1J0KA 4KCWA 1OX4A 4V28A 1XQKA 3VX1A 1YNQA 4D6IA 4I7WA 3RM8A 3Q2DA 3VC6A 3LM3A 3PZGA 4JTCA 3SN1A 4QNEA 4KEUA 4FF5A 3CV6A 1RCXB 1TA3A 2G0WA 3BJTA 1MUCA 2WV8A 4EIVA 4MYXA 3ZR5A 1YLVA 3NL6A 4B5VA 4BF9A 4QHRA 3PULA 2ZUWA 3W75A 1W5OA 5J5DA 4ERAA 2BV9A 1K7XA 4NRSA 1EJXC 4YHGA 3H2MA 3EGJA 5FF4A 2VEFA 3WMLA 2IPJA 3A64A 4H83A 3LV5A 1ZU8A 5FESA 1EIBA 3MV11 3GSMA 1O94A 3DHUA 4R7WA 1JXKA 2HBVA 5A6BA 2JKEA 4FLQA 3R5EA 3IUHA 3PUEA 1L2QA 3B05A 5CBJA 4TMCA 1N8FA 2X30A 3GFYA 3UR2A 3RR1A 4DJFD 1PSCA 3MDUA 3GDKA 2P3ZA 4WY0A 1S5MA 3H7RA 1KBBA 4C90A 5JIWA 3GUGA 1L6GA 3FS2A 3VDAA 4HJWA 2AOSA 3W82A 1PS9A 4XIAA 5M17A 2D3LA 4QFUA 3MBFA 1J6OA 3FY1A 4P7QA 4MFEA 5DMYA 4PTVA 1M1BA 4IMEA 4R3UA 4W85A 1JDCA 1V6YA 4W7UA 4JIQA 2BMBA 4L1XA 1EC9A 5I24A 5HPOA 2OGYA 4ML9A 3ZO9A 3MDWA 2VGGA 2V5JA 4AD1A 1NF0A 1GW9A 1FWCC 3GH4A 4XQ6A 4J2PA 5B80A 4OIFA 3NA8A 3U6WA 4E3VA 3AZTA 1LYXA 3BQ6A 4YL2A 3UYIA 3V5CA 4ECLA 3AUJA 3T81A 1DOSA 4L65A 1R38A 5A6BD 1ADSA 4F0RA 4HCDA 4ZO9A 4LU0A 2O9TA 4J3TA 3B04A 1ZP4A 1EJWC 2A3CA 3WJZA 1ZAJA 3HGSA 3QW3A 1CXEA 1EQCA 1T96A 3V5OA 4N4PA 2QMJA 4TV6A 5DMMA 2E6YA 4B5NA 1GK8A 2PSNA 3T0TA 3MSGA 1TPUA 2G3IA 3TYCA 4AXNA 2V6AA 1E6RA 1RVKA 1ZALA 1J93A 3EOSA 4O19A 4RZ5A 3S2CA 3BK0A 3VKCA 1UASA 2E6AA 2NT0A 3Q37A 1TX0A 1PCKA 4LBUA 3WLMA 4HOXA 4FAMA 1DEDA 3JUGA 5I79A 2QULA 3WJSA 3NFUA 3G77A 3H2NA 2OKOA 4PFHA 1FWEC 2VX7A 1O5QA 2FYMA 2VKZG 4M6QA 2WC7A 2PDCA 4L1WA 4NI3A 1A5OC 1B3XA 1LDCA 4O10A 4Z08A 2YCKX 1IT7A 3W27A 1KM0A 5CXPA 3VMOA 4CNTA 2P8BA 5AOUA 4IQDA 5D9MA 3UXKA 5LIYX 4UMCA 1FWTA 2VMFA 1D9EA 2VL4A 3WEOA 3L65A 1F3EA 5HINA 3VOCA 2CHNA 1LROA 2XISA 3TQVA 2NQJA 1XG3A 3FA3A 2A6NA 3PJUA 3W2NA 4I9AA 3W37A 3B9DA 3Q4DA 3NOEA 2NXHA 4GY0A 3GTHA 3B8IA 1Z41A 1A5UA 1K9EA 5FEXA 1UIPA 4ML4A 1OM0A 5K3VA 3R10A 4LUYA 5G2WA 5A3HA 1DWFM 2H90A 4IWWA 1GQJA 3NQCA 5D2WA 1SMAA 4DJDA 1Z44A 1CIUA 2I9UA 4ZVJA 3WD2A 1CTNA 4C6QA 1F07A 4FMVA 3SADA 3MP5A 1GYLA 4E38A 1I9CB 3NVTA 1V7YA 2Z0IA 1FWGC 2V3EA 1EDGA 3EPNA 1XIEA 2RDUA 1OFQA 3WH5A 4Q3MA 1F7BA 1PL9A 1EP1A 2ISSA 2C91A 1I4NA 3B8WA 3HGJA 3HG3A 3NEHA 4MZ8A 3P0WA 1ZNNA 1VEPA 3KWXA 3QSRA 3NZ1A 1WKDA 3ERPA 4AB4A 1VCVA 4NU7A 2DW6A 4LS1A 3P62A 5AHEA 5EBUA 3WK3A 4ZTYA 3WQOA 5ECUA 2EPKX 3P82A 5DLCA 2PP0A 3MU7A 3KTXA 1NOFA 4LUIA 3PY2A 4GIEA 4IXHA 1BHGA 3ELFA 2EPLX 5E6ZA 1I6NA 2C16A 2DUZA 4FS9A 2A4AA 2C1IA 1OX4B 4J1OA 3TC3A 1AG1O 5HMSA 1PTAA 4ICCX 3O07A 2ON3A 4DBEA 3KOYA 5LNSA 4XV0A 4F4RA 2OYLA 4DBUA 2F6XA 5AHNA 1V3MA 5G4EA 1UB3A 3T55A 3V5FA 2CITA 2ANUA 1QPRA 4HU0A 3VGEA 1BGAA 4XB3A 2PLJA 3VOJA 2R1NA 4V1XA 3GZAA 1QW9A 1EPVA 4DZIA 3POCA 2F6UA 3EXRA 3V16A 2YCIX 4FNTA 4IFKA 1TKKA 4S38A 4XD5A 3TNOA 1DWIM 3M0LA 4IPJA 4HU3A 1F3TA 3AMKA 3T7VA 3MUY1 4MAZA 4D8AA 3T42A 2G3NA 2I57A 3PPGA 2PAJA 3TWAA 4WY0B 3F1QA 1XM3A 3BSGA 1OCQA 3W26A 4F66A 2IKGA 3USZA 1C8XA 3LQLA 1X96A 4WJXA 1A5KC 1SO6A 1CGVA 3P84A 4ADSA 1J96A 2ISWA 4C6IA 2BVYA 1Q6FA 2R24A 4K2SA 9XIAA 2Y63A 2X40A 1NWUA 3BOLA 2CERA 3C0QA 3VNYA 4ALDA 3FJLA 1JVNA 5LA2A 4H01A 1EYEA 4XD6A 4G7EA 4N2YA 4JX6A 3PBVA 1QATA 4QEEA 3H2CA 1PE1A 1Q6LA 4XSLA 3WNKA 2PTWA 3AZRA 1J0JA 3CLMA 4XAGA 3A47A 3SAZA 1EJ7L 4JFVA 1B2YA 3U4FA 4Q8UA 4GXPA 4AAJA 2PDQA 4LW7A 3KVKA 4I3GA 4CCZA 4NZ1A 1TQJA 1T8QA 2CLPA 4O1AA 4WDWA 4JL1A 1RXOB 4HZMA 3O06A 2EKGA 4O54A 5KZMA 5FL1A 2HTMA 2VGIA 3MA8A 4PB4A 4PUWA 4ZO6A 2NVAA 4NX5A 3PAJA 4JTAA 3DECA 2FFIA 3RGTA 1GPWA 1YPXA 1AH0A 2OOGA 3PC0A 3DUGA 3S0CA 5D37A 4R27A 1XINA 3IGUA 4ZODA 3M0XA 3UZWA 3W87A 1S5NA 5EU9A 1H1ZA 1GQNA 1JL8A 2WKLA 3CZKA 3LCHA 3W1LA 1M65A 4ZE5A 1ENUA 4H9XA 2X7WA 3QR1A 2NWSA 4X3ZA 1ODZA 3GDBA 2QW5A 1VFUA 4ZB5A 1REQA 1X6UA 4BKNA 4N9EA 2IKHA 2QV5A 4AD2A 4XUGA 4KGLA 1P1MA 4QQUA 1OYCA 1E6SM 4IP5A 4O4WA 1A53A 3LLDA 4FX7A 3KCLA 1FXPA 4RNJA 2PWGA 5D02A 3LGGA 1XISA 2Y70A 4B5TA 1RJRA 4AC1X 4LUTB 1LLOA 3VFCA 3L5MA 4LSBA 2D24A 2D73A 1TPVA 1Q66A 5CPLA 2E0PA 5HULA 2A3EA 3G6LA 5FOOA 4M0XA 1KBJA 3OIHA 3SCPA 4HPXA 2VQUA 3QVQA 3PZMA 1UQZA 5LIXX 4XBKA 2EBNA 4DF2A 1MUWA 1V79A 4JHZA 1DXIA 2FMOA 1VIZA 3EDEA 1W3LA 4NX0A 3K2GA 2HS6A 4DWSB 2X1RA 1UMYA 3P6LA 3WJXA 5G1YA 3S2LA 1PB0A 3ITLA 3NDOA 2XZ7A 1PUDA 2XM2A 4GOAA 1H11A 4CQ9A 4FF7A 3N15A 3LS9A 1K8ZA 1J6PA 1GJPA 1JJKA 1XI3A 2DSVA 5IM51 3W7MA 3A3XA 2NUWA 1XS2A 3EB3A 1IEQA 1E4LA 1WZLA 2WCAA 2V81A 1W9DM 3P74A 5CJNA 4Q4MA 2ZA1A 3W7IA 1EJRC 3CMGA 2H8XA 5T26A 7REQA 5DELA 2PDXA 1KXVA 3LX9A 3OU8A 2A5HA 3REQB 1RCOB 2J66A 1FHVA 4CVWA 1OHLA 3EX4A 2PPGA 2C7FA 4PBGA 3EX3A 3BWWA 1CGXA 2FGBA 2O4MA 2XH0A 1SFTA 3G1FA 1KRBC 4UTMA 2OO6A 3S83A 4QJ4B 2FJKA 3F2CA 5CLWA 3GXDA 1KCZA 2QIWA 4RJEA 2QCGA 3L7RA 3E2VA 2ALRA 1R7OA 2G8ZA 4R33A 2PUZA 1AD1A 3DHDA 9CGTA 3SCWA 3URQA 2BOFX 3TEVA 2PTZA 1UH3A 4NP7A 4S2BA 5BU6A 2GYIA 4JTTA 3OVQA 2V2CA 4LFYA 5D33A 1GVEA 3PP7A 4U2YA 3BO9A 1QNVA 1XSKA 3LTSA 4YYFA 2Y7GA 1GHSA 4V2XA 3W76A 3NOYA 3HN3A 1UJPA 1KFCA 4JTGA 3DOPA 2AAAA 2WJDA 1AH3A 1LM1A 3RFAA 1PYFA 1GONA 2G3JA 3U2CA 5F1UA 1VR6A 2G3FA 3I10A 3UR7A 5HWMA 1J11A 1HIZA 4IJCA 4CD5A 3VZXA 4I8YA 1N55A 1CXHA 3SGZA 4IG2B 3BGGA 3KOXA 2WCSA 1OFPA 4GGBA 1OK6A 3RLGA 2JALA 2A7NA 2HQAA 3GIQA 2P8CA 1F5ZA 1SQ7A 3L4ZA 3TDFA 2YXXA 1KM1A 2HCVA 2I1OA 3GG7A 1PPIA 2A3LA 4Q4QA 1H49A 1HFBA 1UWRA 1ZY9A 3THUA 3H2EA 5I2UA 3KXQA 3GUWA 2PC4A 3A9IA 2BS9A 1GYMA 4E8CA 3AFBA 4OGZA 1AL8A 3NQ6A 1MW2A 4HCHA 5F4XA 1GVIA 3WZ0E 4XO7A 3AI0A 2C8NA 4DWDA 3W7PA 1IHIA 3O63A 3VO0A 4C5ZA 1F05A 1FH7A 3C2RA 2E77A 2EG8A 1TB3A 4Q8WA 2VCBA 5D2TA 1JG9A 3LMYA 2NXIA 2R91A 1UPMB 5CPOA 1FRBA 2CLFA 2YXOA 1ZTVA 4MKNA 4G7EB 1HG3A 3K5XA 3P60A 3VYLA 3CTLA 2BY0A 5C8BB 4D72A 3NEVA 2NX1A 2ZA2A 4Z2IA 2WVVA 3B9EA 4AIBA 2QYGA 3DIPA 2XGZA 4HHLA 3GW0A 1ZBVA 4ONVA 3N2CA 2Q8XA 4MM1A 1QW8A 2VDGA 2ZX8A 5BOOA 3GE7A 1YE6A 1O5KA 5BOEA 2H3BA 2CLLA 1PJ9A 2CLEA 2VC5A 2DZTA 1R5YA 4JQ2A 2DZXA 2XIQA 4JIPA 1DJHA 3UR8A 4OZOA 4GZIA 4L4PA 4JX4A 1PZ2A 2XN0A 1Z89A 1SZFA 4DO5A 1CGWA 1BG4A 1YNPA 1W2PA 1PHQA 4JZ5A 1NDYA 4PUJA 3P7YA 5FJRA 3UGVA 1LLZA 4FNSA 3UA4A 5A6AA 2XIOA 5DCBA 4GI6A 3QPYA 3S1UA 1LWJA 1EL3A 3U2EA 4LYQA 2PU1A 4IIHA 1LCOA 2V8ZA 4D6HA 5BNKA 4J3XA 3HIJA 3HGOA 2ZRVA 2REQA 3WH6A 4LYPA 1E4IA 1JCYA 2OYMA 1I45A 4O12A 1YIXA 3Q65A 3EOUA 3NQDA 1I2PA 5BRBA 1XX1A 2QPUA 1SFJA 5HJLA 1ZB5A 4XD4A 1W5QA 3S5NA 1KLYA 4UTHA 4FO4A 3AS3A 3VD4A 3KHJA 4HK5A 3VE7A 4B3ZA 5C2XA 1LT8A 2GWNA 1U1HA 2V0TA 2YLLA 1OVDA 4LBSA 2VUNA 2GDUA 2WQDA 3P61A 5ABFB 3CZLA 1E0VA 2OEKA 2J4GA 1MW3A 3A12A 4JNMA 5EGRA 3IIOA 2OB3A 1JEZA 4L61A 1JCTA 3U2OA 3VD5A 3RU6A 5AKQA 2E5CA 2GGEA 2PODA 4D6DA 1A5AA 1F3WA 1XGZA 1X8CA 1SUXA 2J8FA 3HV9A 3S5SA 4PN2A 1HJVA 3IRDA 1LT7A 4HOWA 3IUIA 4PYSA 1QI2A 1UR0A 3DYOA 4NAEA 1EJVC 2NZLA 5G1TA 3SIMA 1GVYA 3H2OA 3KTSA 3GX9A 2OR2A 1M01A 1ELSA 2Z6IA 3GB6A 3TSMA 3OZYA 1IE7C 1HZYA 4X0VA 3MYOA 3E5BA 2GDQA 4AU0A 1QRQA 2OYKA 2V9DA 4U3CA 1EP3A 2OU4A 4GY1A 3U5YA 2E5DA 1ZZMA 2VC6A 1RV8A 1TWDA 1AW1A 4H8UA 1EX5A 3GDRA 1XD1A 3KP0A 4XZWA 4EXQA 1P0DA 3ZLHA 3H24A 3WO8A 4DJEC 3BH4A 3BQ5A 1E3ZA 2QVNA 4OQVA 4HA4A 3SBFA 1A0CA 3QHOA 4MY1A 4NKCA 2W5FA 2OJPA 3E0IA 3DC8A 5EMKA 4UTKA 3TW9A 3BAJA 4QDPA 3MP4A 1WDPA 4DUWA 2Z24A 2SFPA 4HKPA 3ANVA 4R5EA 1P0BA 2XFYA 1QBBA 4FNPA 3VGFA 2JKPA 3PSWA 4OUEA 2HRWA 3VKDA 3HPZA 1E55A 3W7HA 4CU8A 3R4IA 1XC4A 1LQ0A 3VTRA 2DH2A 3VXGA 3V1HA 1GWJA 3TR9A 3S46A 3TTEA 1V3HA 4O28A 4OV4A 2OO0A 4PRWA 1B30A 3K4AA 3TV8A 4BZYA 3GM8A 3OZMA 3GG0A 5HJXA 3VA8A 4KFPA 3I6TA 4DI8A 5IBXC 3OBAA 1PVNA 2WLZA 3VNLA 1OIMA 4FLSA 1LBFA 2QDHA 2YYTA 3HPAA 1ME7A 1ECQA 3WQVA 5HDRA 1U1UA 3WQ5A 3B40A 1C8YA 4I5RA 1T8XA 4YLWA 2PWHA 4Q8VA 1LJYA 1XLIA 1EO5A 3GDLA 3T78A 1Q8AA 1V6UA 4C65A 4AG0A 3HV8A 4ZB0A 3WBEA 3QTGA 3FKRA 4B91A 3UNTA 4ZQOA 3H55A 3G3DA 1V0LA 1E56A 4GWEA 2ZTJA 3UY8A 4RNHA 1R6WA 3WD4A 1O6IA 1XFBA 5C55A 3DBNA 3W1NA 4C7FA 2C0AA 1P6WA 3ZM8A 1SMDA 2QT3A 2WSRA 1NM9A 1UYQA 1NWRA 2DU2A 2GVYA 4IUGA 1H51A 4QEHA 1K03A 5HQEA 3EBVA 1Z6KA 4BF7A 4ZOEA 3BAKA 1TQXA 2E9MA 3L4WA 2ZTKA 3MSDA 5I23A 3PB0A 2R1LA 1SW0A 3R13A 2ZFAA 1TJPA 1HN1A 1Z9AA 1FTXA 2P88A 3ZJKA 3PZ9A 2WVVB 4YNGA 4BR1A 2VR5A 3AHYA 3ZFHA 4WEVX 3PFRA 1DQWA 2G4FA 4S39A 3WQDA 3V18A 2PF0A 5JH1A 2YA2A 3ARUA 3HTWA 3W84A 1GNXA 3ITOA 1P0NA 1MSSA 3APTA 2HROA 4J3ZA 5G5IA 3L68A 1W0MA 4NJJA 5EL1A 5BRPA 3GO2A 1WUEA 4DYKA 1HVQA 1C92A 3VGBA 1F73A 3M0HA 3FSUA 3GKAA 3POHA 4GKLA 4QS5A 3W7EA 1JRCA 3A4XA 3QKZA 1RALA 1MQRA 1E0TA 5FEWA 1FWJC 1DWHM 1YW1A 3RLUA 3L67A 3M4HA 3A5VA 1TJ2A 1DQUA 1I75A 4UR7A 3HFTA 5CGMA 3E2QA 3SUTA 1P0KA 5CKSA 3ABQA 3FYOA 2ZXQA 4LH8A 1DJZA 4LRTA 3BUVA 1EZ2A 2WMFA 3AUOA 3LHYA 3U5UA 3KDOA 2ZC8A 1B3WA 4PMRA 1Y65A 1GEHA 1GORA 2FHBA 1TR1A 2D2GA 2DSUA 2REQB 5C7VA 2IUZA 4L4LA 1E9LA 3ID7A 1OGBA 5JMUA 5FSEC 4ACZB 5LSMA 5FAJA 1GOIA 2OGJA 4ZQMA 2FPVA 1CX9A 1R8LA 4LB4A 4X61A 2WJZA 1TTPA 4LX4A 4P8XA 4JIEA 5I03A 3O6YX 1HJUA 3CWOX 1QAPA 3UWQA 4JTEA 3D5HA 2PU0A 4W4QA 1MZHA 1C3FA 4JKLA 3FIGA 2DZBA 4Q8TA 5HNTA 3M0IA 4HK6A 3MP3A 4XAZA 5C2CA 4UOJA 2EG6A 3WUFA 2X2GA 1PDYA 4WXZA 3OA5A 3W73A 2GZXA 2Z28A 1LRTA 3I3DA 2GJXA 3TXVA 3QZAA 4OFCA 1UW9A 1M7OA 3H22A 4JCLA 4A2SA 1M3UA 4B5XA 1KR0A 4H8NA 2QCNA 3BOFA 3WLSA 1QDSA 4GFSA 5DANA 3PTQA 3BLKA 4WCJA 2IS7A 3AYRA 4HYWA 3ARPA 2JKAA 3N04A 4XISA 3N3TA 2PDUA 3UJRA 1O5XA 1E6QM 2QXWA 3MMUA 1J5SA 4JYFA 4KW2A 3AIVA 4AEEA 4KESA 3MPGA 2CBIA 2ABBA 4MUPA 3OO2A 4AZIA 4LVDA 2G5WA 4O0QA 3JS3A 1IWBA 2QVHA 5BW6A 3H7UA 4F2BA 3BLOA 4BI6A 1E4MM 3LPFA 2HXTA 4POCA 3CQ0A 4W5ZA 1NDZA 1EYWA 4LEQA 3AYTA 5K9CA 4RE0A 1K9FA 2H3DA 3G0UA 4J7RA 3VC5A 3BG5A 3NXFA 2CW6A 4ES4A 2XVKA 4CCEA 1K4GA 1OX5A 2A3HA 4HPNA 3UZZA 3ITVA 1Q13A 3QY7A 2DIKA 3GTIA 2X0SA 4IP4A 1IGWA 2WKJA 4H4IA 3BOXA 4IFOA 1ADOA 1RJPA 3MI3A 3FKKA 3DFYA 5J8LA 1E4NA 3ARWA 2GVGA 1X39A 4YIWA 5GVJA 5H6HA 2YX0A 3MUZ1 2VI0A 3E9AA 4JTDA 4AWUA 2X2YA 2Y24A 3IS4A 1L8PA 4IZGA 1OZMA 3KBSA 1QWGA 1CGTA 3QFEA 2FH8A 2DSZA 5A1AA 2IQDA 4M6PA 5IHRA 1OT1A 5FACA 3S9IA 5AECA 1R3RA 2PZNA 5D30A 4UTTA 3U57A 2ZZ4A 3VE9A 2ZUUA 1UZ4A 4GYKA 1QHOA 2D0HA 4MJMA 2ZYFA 1DIDA 4KRUA 4XSMA 4JDYA 2W91A 1UD8A 2J9XA 3R7MA 5I06A 3WLNA 1NY1A 1JCLA 4GKTA 4AZ7A 3AXIA 3I7SA 1XLGA 3OA3A 3NM1A 1JZ7A 2FZBA 3L2LA 3WDJA 3CH0A 4YVVA 4O53A 1UPPA 3F4CA 3WJWA 2XFWA 4Y7EA 1J79A 2ZOXA 3ZWTA 4G6CA 4EAMA 1UBPC 4WKAA 2X1UA 3RMJA 3NO3A 1H62A 1RA0A 1K70A 1UKOA 3CUZA 2BASA 1VD6A 1P7TA 4NI8A 2E9LA 3CZGA 4UQAA 4ZCWA 3WLRA 2VRJA 3PWAA 3R8RA 1YDOA 3ARQA 3SJNA 3W7JA 2ZUVA 3RN6A 5CEWA 1IR1A 4XVDA 4FI4A 1AW5A 2GUYA 2QV4A 3LM7A 4TOQA 3GTNA 1UZDA 2DT3A 2ZRUA 3L4VA 3TVAA 3IVTA 2E40A 2AMXA 5B7ZA 4ZZ9A 3PZQA 1LG2A 5CSUA 4I8DA 4RUBA 1RLDA 3RHGA 1EFZA 3HG4A 5KINA 3L4TA 3QEZA 4W5UA 2DZVA 4H7VA 5EMLA 3W29A 2IPFA 4F48A 2Z25A 3BLLA 3MQTA 3R11A 1WKEA 4Q8NA 2CBVA 3BG9A 2Q8LA 3QV8A 4US5D 1VHCA 2WANA 3UYCA 3IJ9A 1W1B1 5CJ5A 1VFTA 2A6LA 3LEPA 3O6DA 3VNKA 3GNRA 5AC4A 3DFNA 1ZL1A 2WLYA 5T8GA 5GJNA 3PK7A 7TAAA 1IEIA 3CUHA 3I3EA 1B31A 4WKFA 2GUBA 2EF9A 3WUEA 1ZBWA 5LNUA 1IXQA 4YYCA 5BWAA 4TQTA 3LI1A 1XW8A 1KM2A 4QX4A 2A21A 1JZ2A 2GPTA 4EP8C 4GVGA 1NH6A 3GNOA 1C9DA 3LI0A 2FJUB 4HPGA 4TVDA 4G1NA 1Q6RA 3BLEA 4CD7A 4DELA 6CGTA 4NY2A 7PTDA 3WDPP 3BURA 3CO8A 2JGYA 1I1XA 2RUSA 3K8LA 1JYWA 4ZXOA 6REQB 1RK6A 1QO5A 2Z7KA 3DCPA 4PUMA 4D71A 2WOQA 3TQPA 1SW3A 3CB3A 4PRRA 1EZWA 1IEXA 3NDYA 3N6HA 2QPSA 4XAPA 3TN6A 5AYIA 4Z0JA 3WF4A 1BTCA 5A6JA 2TSYA 1KO0A 3ENLA 1UUQA 5BWFA 2JF7A 2W79A 3TTYA 4AXKA 4R7OA 3FX4A 3IK2A 3FJ4A 3SY5A 3AQUA 3W7NA 1GYNA 3ZT6A 2YIHA 3AISA 1J18A 1XYAA 2XVGA 3URNA 4HSHA 2XSAA 5AHIA 3KRBA 1BF6A 3OP2A 1ZFJA 4PSRA 4XZ9A 3M1ZA 3LERA 4RV8A 3KE0A 5E09A 2PDMA 1X7FA 1A50A 2ZZ7A 4JGDA 1E6NA 4IIDA 1NP0A 3WLLA 3B0VC 3BW4A 3ZYZA 1KLZA 1FWDC 1CLXA 4HYRA 1H50A 1UD4A 2Z29A 4GYPC 4F0MA 3TYEA 2BHYA 3FJ6A 5HNUA 4MKSA 4ZQCA 5DO8A 4URIA 1ZLPA 3RLHA 1XDMA 4Q32A 1EGZA 1QPNA 3W1XA 5XINA 1MO0A 4W9TA 3AIBA 3ZVHB 2V82A 5CZTA 4OBSA 3AS0A 1XPYA 2YW3A 3GAYA 4RNIA 2ZZ3A 4TXEA 5DCEA 3BW3A 3FLUA 5H1WA 5CPSA 3E6EA 5LNWA 1JGMA 3JZEA 2WMJA 3WLIA 3FXYA 2ZA3A 2HVOA 1NDVA 2PDGA 5C54A 1XIHA 4M5PA 3RX4A 1GT8A 2JQXA 3JW7A 4LC6A 4A8IA 4IMGA 4MUZA 1I8JA 3HQNA 3VD7A 3TN3A 1BXCA 1K9DA 3AIEA 3S6OA 5D2VA 1XLHA 3GY1A 3TONA 3ARVA 4BHYA 4B3KA 2DP3A 3CHVA 4XWUA 4MPKA 5KITA 5DXYA 4DM2A 1N8WA 3PUOA 3GH5A 3UXAA 3ZSTA 2DZSA 3T0DA 3LZ5A 2WKGA 3IJ6A 2YYUA 3P5ZA 5E6YA 4GVHA 1LQ2A 1GGOA 3GD6A 3KRZA 3G3MA 4F40A 5CPQA 3SCOA 3T0BA 2DSKA 2WXDM 5A8GA 1EOKA 2GGGA 3DG7A 1JD9A 1JF6A 3UWVA 1VYPX 1K7FA 3CQJA 3I4KA 4PFMA 4FNRA 1US2A 1TWIA 2BHZA 4A3HA 4CCCA 2VEKA 4HMNA 2OX4A 4ROQA 1HT6A 2QJNA 1P5BA 3WUGA 1BGGA 1WB0A 2WO5A 1EH9A 3U2ZA 4EWND 3LB0A 2WSYA 3BAIA 2ISVA 3S42A 1SSGA 2AQVA 2EO7A 2F6KA 4IX0A 4RDZA 1EJSC 3GBDA 2PDNA 2KZHA 2ACSA 1LQAA 3W1QA 4U5IA 1P0EA 3W7KA 1JR1A 5BRQA 5TF0A 1J9YA 1TTIA 3EDDA 4Z1BA 3BMWA 3T2PA 4LS2A 4NUWA 4S3CA 4DJED 3VFLA 1I0DA 4LALA 5DX7A 3MANA 1RHCA 1PIFA 2E1WA 1NTHA 4LANA 4W88A 4MY8A 2V3DA 2VFEA 2EPHA 3W1MA 2NX3A 4NAFA 5A2CA 3GYCA 1BWLA 3RPDA 4LUSA 3T44A 1POJA 5KZ6A 1IZCA 1J12A 4PTMA 8XIMA 2CPUA 3HBLA 2WBKA 1KBIA 4R34A 3ANUA 4REQB 3KVLA 3AU2A 4GQBA 3QGAC 2QDGA 3W1AA 2ZX6A 3VIKA 3STCA 3LBOA 3QPZA 3W6YA 3QQ1A 3UZ5A 4U10A 3NQEA 4PL1A 1RQHA 4D6JA 4AWEA 2WPBA 4WSHA 1Y7VA 1R3WA 1JZ5A 1GQKA 3QF0A 3QV9A 4H41A 6XIMA 2Y88A 2GOUA 2OZ8A 2IQTA 3KLKA 4YHEA 2XWDA 1IT8A 3QC3A 5CZKA 3NL2A 1G94A 4JKMA 3KW3A 1JD7A 4E3TA 1X8FA 4GIYA 1GZGA 2NWRA 5A6TC 2OWXA 1Q6EA 3WNLA 1NFBA 3ITCA 4LAUA 3THQA 2FVMA 3UWYA 1QVBA 3IAQA 2QGHA 3K30A 1B3YA 4EK7A 4GHRA 5EMJA 1TMLA 2HEJA 4FEZA 1XCWA 1CI1A 2PDYA 4NXKA 3A3WA 1YTDA 1NVMA 1CBGA 4C1KA 5U4NA 2Q6ZA 1RP9A 1S5VA 2WZEA 3QTPA 3LXCA 1KXQA 4WSJA 2UWFA 4L4OA 3DFSA 1CDGA 4UTIA 3U0HA 4CD4A 1ESWA 4GI8A 4Z2GA 2Z2UA 4OHQA 3T6CA 1UP0A 3VNIA 2FTPA 5CG0A 5IRPA 2G41A 4E2OA 2WNZA 3AMLA 3GTXA 3W86A 2C13A 3FDGA 1QBAA 4O52A 3E2RA 6PTDA 1O5RA 1FKXA 2HSAA 1L6FA 5C9WA 4GO8A 1NSJA 3NQAA 2J62A 1Q8JA 1OB0A 3HQPA 3FAXA 3RCNA 1UR3M 3A5FA 3DGRA 3DZ1A 1XCXA 5I09A 1RCQA 3N18A 4W8AA 2YDRA 4JIHA 3M41A 1GOOA 2E09A 1C9WA 1CXKA 2CLOA 2QJHA 1GTEA 2V5KA 1JPHA 2XGIA 1GOWA 3CH9A 3W28A 2HK0A 3B0XA 3D46A 4NG3A 3WLKX 3MO4A 4Q7BA 1TUFA 1OC6A 3S5ZA 1C91A 3B0YA 4IP7A 3BZJA 3BCJA 1CGYA 3UPWA 2WZHA 3IV3A 2ISDA 2DJXA 1UA7A 3N13A 3APYA 3E12A 3W1TA 2J9YA 1LTDA 3EB2A 1TMHA 4PB3A 2Z1BA 3MSYA 4Z2KA 2C1GA 1EBGA 3M0JA 2C18A 1RPXA 3GXTA 3G22A 2FIQA 4QCEA 3RX2A 3TXZA 1K4HA 1R9XA 4HA1A 2J88A 5RUBA 1H7XA 1Q2SA 2WM1A 3E96A 1EC7A 2D69A 5I3GA 3L0GA 5JU6A 1VFFA 2VM8A 3VMPA 3VOHA 4HOZA 2CHRA 1S3HA 1FWAC 3LSCA 5AB3A 1IV8A 3DN5A 3PS7A 3WY1A 1FWNA 3AICA 4O17A 1JCXA 1JZ4A 1RP8A 1OIFA 5A6SA 4KWVA 2YL5A 4W7VA 3RR4A 3BJFA 4ZR8A 2XSXA 4UBPC 4H9ZA 4HTYA 1YHTA 4W93A 3ZVIA 1BTMA 1VJSA 3KEHA 4A3QA 4Z1AA 1LUCB 1FCQA 2IXUA 4OBTA 4O1EA 3OQEA 3VOGA 1J0ZA 2XH2A 4ZEPA 1YBQA 1JDFA 2Y8UA 3VKKA 2BXZA 3AXMA 3LGDA 1POKA 3PPCA 3NQFA 4CLMA 1E1EA 4MWAC 2NT1A 3DFTA 2QJGA 4J9JA 1JAKA 2OVLA 4I6KA 4BQ5A 1UKPA 2X0YA 1NIUA 1YQ2A 3R43A 4EWJA 3WBXA 4IMAA 4PRTA 1VENA 1W91A 1TVPA 1FHLA 1QPOA 1Z69A 2I56A 4QS6A 4NJHA 3FJNA 1FXQA 3OIXA 2I5QA 3WLTA 4WZHA 1AH4A 4LAKA 1OG0A 2GGIA 5D4YA 3PG9A 1UOZA 1DORA 3TZFA 4CQCA 3WNOA 3MSRA 3AHVA 4JD4A 3L0KA 2J7FA 1UCWA 3UD6A 1WO2A 3WJYA 3CO4A 3SCQA 3R2GA 4W7WA 4BWLC 5CBBA 4DB7A 2ZWYA 4P7LA 1BRLA 2I16A 1PWMA 4NNCA 3MKCA 1EHAA 3KZPA 1FFRA 2FB2A 3CYVA 3WG6A 5EMYA 3UZXA 1E3XA 4NAFB 4MNMA 4MADA 1LBLA 3AMGA 1R2RA 2J24A 2XDFA 3DG6A 2FMNA 1ISZA 2OLSA 4LUSB 2P3EA 1UC5A 1E72M 3DESA 3SI9A 2QAPA 3UG3A 4CNNA 2I5IA 3JRKA 1PZ0A 1I1WA 4GI9A 1TVLA 5DFAA 1X7IA 3USBA 2YDSA 1DTUA 1S1RA 4AD4A 1CEOA 3G8EA 4S23A 1SM9A 3L23A 2PLCA 3AS2A 2ACQA 4AF0A 1F74A 3ARYA 5GNZA 4OU1A 4UFKA 3EWZA 3W85A 4KWWA 4ATDA 2J7CA 1KM3A 2XPKA 1B4EA 3I4EA 3DYPA 1GOKA 1SJDA 3VGDA 1VP5A 3SQLA 4LVFA 4AY8A 3M0YA 3NQBA 4K37A 3WDQA 4AD5A 5EMUA 5LNRA 1FWHC 1UD2A 3MMWA 4L64A 1ITCA 4JNZA 2D22A 3KX6A 2XVPA 3P14A 3KS6A 4P5UA 3D6NA 3W22A 2G37A 4GK8A 2B7QA 4DLMA 1JNDA 3OGRA 3NJ3A 3KS5A 3FEQA 3IJDA 1Q7ZA 5B7YA 5CH9A 3GVGA 3W24A 1XF0A 4KQNA 3NL3A 3PR2A 3C0LA 3T08A 5EFDA 3N2MA 1WOAA 4RW3A 2PRLA 1E15A 3VCNA 4N9DA 4RZ6A 3C86A 2BGNE 1XH1A 2ZUMA 1OADA 1W32A 2OXNA 1WBJA 3HZ3A 4BEUA 3UQNA 3E5PA 4XKYB 1CB7B 1UR8A 1THFD 1KCKA 5CBIA 2JIWA 3ALGA 1PDZA 1GHRA 4J5NA 3KBMA 3GRIA 5I3FA 1T7LA 2PCEA 3ME3A 5C9RA 4YS1A 2PP3A 4CNPA 1YXDA 1VFMA 1A5MC 2VR2A 4Q7IA 1DJIA 3SY1A 1E51A 3EX6A 3HF3A 1Z8AA 4DHGA 3VD3A 1X1NA 1I2OA 1I2RA 4GY7A 1V6WA 1TX2A 5IHSA 4QM1A 3THAA 3II1A 3M64A 4HCLA 4DNHA 3H23A 4JOMA 3VUSA 5I00A 2EGZA 4UTWC 4R9OA 4IIFA 3L2IA 4DO4A 4C1LA 3WBYA 2HK1A 3WH7A 2J13A 1GKQA 3H21A 4HNUA 2FDSA 1A80A 3WMCA 4F8XA 4R53A 1W5NA 4I6VA 1T40A 2PDLA 3DBPA 4KGJA 4KCTA 4KIEA 3BLIA 2NQLA 4GUHA 5GNYA 3GC4A 2OTDA 3PZIA 2HWGA 3EPOA 5HQLA 2YCLB 1AODA 5KETA 4GYPA 1R9ZA 3OYXA 4MFDA 3EB4A 3PUDA 2QUVA 5G2HA 1ME9A 4MB3A 4TIMA 3OLEA 3RITA 4HNCA 2E67A 3C0JA 3KCOA 2VFHA 1WX0A 5AC6A 4O4VA 3L4UA 3ZMRA 3OLIA 2CU0A 4PTNA 3CMJA 3EKZA 4PB5A 1HJQA 2EPMX 4PMVA 3PHAA 4KCUA 4EPBC 3KVMA 5M3WA 4U33A 3FEMA 5F2MA 3SQMA 5C7HA 5TD4A 4RDYA 3VOFA 4F0LA 5AYYA 3LXAA 4QDMA 3IARA 1HNYA 5FEZA 3STPA 2QZRA 4O0KA 1FCUA 2O0TA 1BYCA 1IWPA 3IV8A 1H7RA 2A1YA 1VC4A 1TSIA 3CL8A 1G6CA 2OLHA 1OJXA 4Y6GA 2WMGA 2IKIA 4C6EA 1UG6A 1ZHAA 3OQ8A 3UVAA 2NV1A 2X09A 1K7EA 3F5JA 4JTFA 4Y8FA 1TE6A 5KZEA 1MYRA 3GXMA 3F4DA 4PR4A 5CCZA 3UJ2A 2CIPA 3L9CA 4AZ5A 4R9XA 5GJPA 1HO4A 4UR9A 1NAL1 1J4EA 3R0KA 4GXWA 1H0IA 1HL8A 3MKKA 4ORIA 1T41A 3I7QA 4JQ3A 4RW5A 2VFDA 3H4GA 3KM8A 2GDVA 5EMMA 3NVDA 3BV4A 5F2LA 4RXFA 1SJAA 1V3IA 1S39A 3TZNA 3VNDA 1CLVA 3MO7A 4TVCA 2RDXA 5A95A 2MNRA 1WZAA 1M7JA 2DJLA 1S38A 3KBNA 5F2IA 3W2JA 1W9XA 4NVTA 3VCRA 2PURA 3S3GA 3TFCA 3WDHA 1V4YA 5FJOA 4QCFA 4CQDA 3QHMA 1E0WA 1EKOA 1D2KA 2V3GA 1HUVA 1XYFA 3UW6A 2Z1SA 1XKJA 5FJIA 1TMQA 5ABGA 2R6OA 4WY0F 3UA3A 3QBUA 2EKCA 1D3CA 3RO8A 4FR1A 4H00A 3MJMA 2HVMA 1XBYA 1PTDA 4B2DD 1VBRA 3SFKA 4DBDA 4AZHA 3HPXA 4KWOA 3CAWA 1UWUA 3UR5A 3L12A 5HR6A 4AF0B 3B8VA 1IIGA 2ABAA 3MHGA 3NCOA 1L6YA 4NJGA 2X0HA 3F4WA 4LJ3A 3BMVA 1WKYA 3XIMA 7ENLA 2PWFA 1EIXA 4U4MA 3QQ0A 2YL8A 3DDMA 1TV5A 5JIPA 4LUJA 3STGA 2Z2BA 3UXIA 3AXKA 3R0UA 2VDIA 1FDZA 1WNOA 1CXLA 3R25A 4PEEA 2B7OA 3SQSA 4IICA 3BGAA 3QHNA 5MKGB 1G0CA 3HOJA 4BI5A 1CB2A 2PP1A 1TRDA 2ASHA 1JI1A 1W2VA 3DG3A 3RG6A 3M0MA 2GQ8A 1E9IA 3S4TA 2GVLA 3NIYA 4QITA 3LCXA 4X60A 3OG2A 4ZENA 5CSYA 3LYEA 1MRAA 1JULA 5I3IA 2XU2A 3IJIA 2IKJA 2WNWA 1BXNA 2W63A 3ABRA 5EB8A 1OGGA 1DYSA 3QR3A 1BKSA 4I7VA 3VIOA 4HK7A 4MJ2A 1B5TA 4UTJA 2Q02A 1WZKA 3QYSA 2G95A 3ZZ1A 4WRHA 1UWAA 1H1YA 4M1RA 1ZS2A 2GFTA 4ADTA 4KEZA 4DNMA 4DN1A 5E1QA 4NJKA 2ZCGA 2OWCA 3LU2A 4BCEA 3RPMA 1QWKA 3MI6A 2ZXBA 4JN7A 3J7HA 4XAFA 3RCMA 1GCYA 4RV3A 4ICNA 2XVLA 1ZBKA 1RD6A 4JTKA 1EJUC 2RFGA 3GXNA 2O7SA 3S6DA 4DJFA 1UH2A 1W9PA 2HV5A 1IEWA 4GQQA 5A6MA 4AVOA 1R30A 2HNHA 4IT1A 1W1VA 3ABXA 2GJNA 4WSKA 3HPSA 3ZWSA 3FOKA 3BAWA 4LRSA 1IZJA 3IJ8A 3TAOA 4G56A 4E0CA 1D7FA 1ODUA 4Y9MA 4L6OA 1NEYA 3O7UA 3DERA 4C6DA 3NQ7A 5L6UA 1TFVA 1W1A1 4HQVA 4MPQA 1T99A 3CWNA 2XN2A 3UFYA 3W83A 5G2IA 2W92A 4Q4RA 1KW1A 1SO4A 4JFUA 1RUSA 2FTWA 5HMDA 2DPEA 5DEZA 4PTDA 1UJQA 4QG9A 1MDLA 3QC0A 1R46A 3EOEA 4A8LA 3UETA 3DH7A 3R89A 3W0KA 3EXTA 3AS1A 4A3RA 5LIWX 1H5YA 4M24A 1P4CA 2Y85A 3CLWA 4HNLA 5E5CA 1FP8A 4IJRA 5G1MA 4M7TA 4DZHA 2RKXA 1AJZA 2DY3A 2RJGA 4PODA 2J75A 4O13A 5KZDA 3V7PA 4J3WA 4EANA 1E6XM 3PN8A 1XLDA 1LOLA 1RJQA 3ITGA 3URBA 4IGMA 2OODA 4GI4A 4DLFA 3W00A 1X97A 4LF1A 4HZ8A 3ARXA 5L9FA 3KOFA 4LV9A 3LRKA 3VKAA 3CXOA 5KSWA 3BXWA 3WBAA 3EZ4A 5HUPA 4KFNA 4LAMA 1ITUA 2JIEA 2DT2A 4IH3A 3VGGA 2F2HA 5J5RA 1B3OA 2WW5A 3CIXA 3VPLA 3MWAA 3WUBA 3ARRA 2NSOA 3CUGA 1NARA 5JBDA 4AMAA 1KFJA 4GG9A 3NYZA 2XWEA 4NNAA 4Y9AA 1YYAA 3C3NA 2D23A 2AL2B 3IJLA 2QCFA 1ITXA 1SFSA 1KQZA 2B4GA 1FQ0A 1ZQ5A 3VILA 4MWAA 4LCSA 3MTWA 1M5WA 3N9SA 4GUJA 3H53A 3WD1A 4MSSA 3CHEA 1QXLA 2Y7FA 3SJ3A 2C19A 2ZZ6A 3NGJA 2VFIA 4PTWA 1SO3A 3DXIA 3OODA 2XN1A 3NSXA 4F79A 2VJXA 4K39A 4TU1A 1OEPA 5BMXA 4B90A 5ABHA 3ATYA 4A05A 1TUXA 2YOCA 1AVAA 2HJPA 4CQ8A 3TSBA 3M5YA 4A21A 3NPXA 1XIDA 4IHCA 3UPBA 4ZOCA 2J6VA 3CIVA 3ZQ9A 3RM4A 1ZENA 3MJYA 4S3FA 1A0EA 2QDDA 3CV7A 1E71M 4QIUA 1FWRA 1PIGA 1KBKA 2DT0A 3VAVA 5CGTA 3AO0A 1YEYA 3FHQA 4AZCB 1WA3A 4NL1A 1SFLA 4N4QA 2WVTA 3W2MA 4KMQA 1GVFA 1ZCCA 1GKPA 3LCIA 4MWAD 4C6OA 1AQHA 2XIBA 4GVIA 4EVZA 3N29A 4ZE4A 2NV9A 1TG7A 4X9SA 2OT0A 4CN4A 3WDRA 1HGYA 3MB9A 2GGJA 3INPA 3CASA 3QMRA 2D2OA 4FIRA 3BSMA 4LAZA 4A3UA 4RR4A 1XWYA 2B7PA 4UC5A 1AQMA 4P8WA 4GX9A 3S2MA 2WSQA 4X2RA 3W2KA 3P5YA 3N12A 3QLDA 1JYVA 1JUEA 4AH7A 5CPTA 3C61A 4D6CA 3GAKA 1QASA 2QCLA 1QI0A 1FCBA 1K3UA 2Z00A 4HNOA 4U3AA 3H54A 3SM0A 5FEPA 4EPDC 3K46A 2ISFA 3MWCA 3N2OA 1WAUA 3O16A 5EA9A 2AL1A 3B3DA 4Z0SA 3RXZA 1XYBA 2EG7A 1VBUA 3PPHA 4DXVA 1EA0A 3FXGA 4FX8A 1E1CB 4EF8A 2RJHA 4XTIA 5AHLA 2VX6A 3LSBA 2W3ZA 1OCBA 4D1IA 5HBFA 1ZRQA 3GQYA 3QYQA 1DHPA 4ROPA 3V36A 3Q67A 1GVOA 1YPIA 2ZWZA 4GO9A 4UB9A 4WR3A 1V08A 4UTLA 5E9AA 4HVXA 1GZ1A 5E0KA 3W07A 3TYZA 4CNSA 2Y0FA 2INFA 4IL2A 3TJ4A 4F9DA 3HMJG 1XFCA 1Q6QA 3TN5A 2BX7A 4XO6A 3HG2A 3LD5A 2NVCA 1UMLA 2E9BA 2VEPA 2V30A 4TX9A 1UKSA 3EWBX 3WL1A 3VM5A 1PXGA 3AIRA 1GVQA 3TP4A 4HMEA 3BSHA 1VRDA 4S3EA 4RK8A 1UR1A 3RM9A 3BMXA 8A3HA 3M0KA 4DIAA 2HVNA 1JPKA 1W5MA 2Y5EA 2CWXA 2G4JA 3NQMA 4EOUA 1TA3B 3RPTA 4RL3A 1JDEA 2CLHA 1G7VA 1UZHA 3TIMA 4H9VA 3BJSA 1QUMA 4XZBA 4GXMA 3NPVA 1PZ1A 3GU1A 5M5DA 3OOQA 4M80A 3O15A 2RDWA 3IAPA 1QNOA 3M6YA 3MBDA 4R85A 5FL0A 2R1MA 2D1ZA 3TX9A 1HP5A 4QJ1A 3TC7A 1MXGA 3AYVA 1JDAA 3OVPA 2QR6A 1C7TA 4ORMA 3A13A 4ILSA 3PSVA 5AFDA 1YNYA 3MUCA 1VIWA 3WF1A 2BODX 1OBAA 4X22A 1ZJHA 1WUFA 3FHAA 4UZUA 4MKVA 2XTKA 2GUUA 1HVXA 1NELA 4EE9A 4PCSA 4HTBA 3N17A 1D7KA 2ZADA 4AVNA 3YPIA 1OFDA 3NXLA 2XIIA 5DXXA 3V1PA 1PBGA 3NURA 3L2MA 2RDTA 1KNWA 5LHEA 1BG9A 1XRFA 3UG5A 4OUIA 3MI2A 4YXGA 2X8RA 5CC7A 3VIJA 5FJJA 3CAQA 1SJBA 3WFZA 1JPMA 1QNRA 1OK4A 1S46A 3HJZA 3B8UA 2VRKA 4IPIA 1VYSX 2OCZA 1US3A 3C2FA 4NF7A 3NUKA 1XXXA 4KRTA 3SY8A 2O9OA 1X6LA 5BOFA 5IDZA 4B9YA 4CQAA 2J7GA 3PG8A 5BXTA 1EEXA 4C7GA 1H7PA 2OWWA 1ISVA 3XINA 1JCMP 5CG7A 2GVEA 1DKWA 1B57A 4CEUC 3FGCA 3WQFA 4UOZA 3W71A 2VCAA 2NVDA 2VWSA 3WEMA 4O16A 3VIPA 3DHFA 3BLFA 3TWBA 1ITQA 1O68A 2BVWA 3KLLA 1Z48A 1XCFA 3SFWA 2WMIA 3FYPA 4DF1A 1XGDA 4LT9A 1K6WA 4UNIA 1AMKA 2E28A 3IPWA 4PGLA 4GIRA 2CLIA 3WLPA 4AWTA 1W1YA 3FN9A 2BGQA 3GVQA 1UH4A 2YBVA 4Y9OA 3GHSA 1NU5A 2VVSA 4GA8A 1S3TC 3TR2A 3B4UA 3M9YA 3TU9A 4YTUA 3SIZA 5JQ9A 3SR7A 1K8YA 1LLWA 3H70A 4JICA 3VIHA 1MDRA 1NWSA 1X38A 3PWGA 1Y5XA 2Z1KA 3STFA 4LTSA 1M7PA 4Q6XA 1UIOA 1QK0A 5LGZA 4US6A 2OOFA 3VUPA 4DWSC 2PDKA 1XUZA 3NM3A 2Y8KA 3KZSA 1W9BM 5I0DA 3QV6A 3TYUA 2OZ3A 4GINA 1HKVA 4C6LA 3KTCA 1D3GA 3SN0A 4K68A 4HBKA 2VC7A 4JTJA 4EKJA 4YWIA 1A5SA 2C3ZA 2F2KA 3ORWA 4DJDC 2PEVA 5FJTA 2IPGA 3KAOA 4OKDA 4GC4A 5E0FA 4FHAA 2Y61A 4JTSA 1OABA 4UCFA 5TNVA 4UFMA 4FOKA 4N7QA 3BVJA 3MCNA 4K1WA 3LGEA 1Q4NX 4HNTA 4IJBA 3NQ2A 5M2FX 3WLOA 3N14A 4MMWA 2FFCA 3H6OA 3TAKA 3T9PA 3VI2A 3M43A 3NSMA 4WXYA 3BARA 3QOMA 2Y8VA 4LCQA 4AIUA 1ZP3A 1VPXA 1OGSA 5CC5A 3PTMA 2X16A 2HXUA 1XLCA 2E3ZA 1JFXA 5M03A 2PGWA 3ZT7A 1W9VA 4DAFA 1V0MA 2QF8A 3GVWA 1LRQA 4NIRA 4AHPA 1M53A 4QJ5B 4O18A 4GMEA 2OX1A 1XV8A 3B0UX 4EPKA 4UTUA 4XZIA 3H4WA 3D3AA 3QGKC 5AHMA 1UZ1A 1GG1A 3WX7A 2R14A 4GNKB 4A8RA 1DIKA 2PLMA 2HE8A 4G2DA 3E49A 3TTQA 4MY9A 4AUBA 4RPQA 4S3GA 1OQFA 5GNXA 1BQCA 3MZNA 1TJ0A 3P2VA 5A6LA 1N2VA 3ES7A 3BAYA 5C9ZA 3BCDA 5CPMA 4Z17A 2DVTA 3G1DA 2VZUA 2IXVA 3T2OA 1H09A 2I14A 3CQHA 1JFHA 4M7SA 4MWAE 3NG3A 3H8AA 4NSBA 3OBKA 3UWZA 3HJEA 4G7FA 3WMSA 4QQ3A 4L80A 2VX5A 4IL0A 1BF2A 1J2BA 1OG6A 2XH4A 1BPLB 3M16A 1W8GA 1RAKA 3RRXA 2V5DA 4L4MA 4CKQA 1NJJA 2DIJA 4Z1DA 3N34A 3LA4A 1ECEA 1EDTA 4IFKB 1OD8A 3TQKA 2Y6ZA 3IVSA 1NDWA 3W3OA 5GPRA 3A23A 4L6DA 3WQEA 3KFTA 4UQEA 4S1FA 4WVXA 4UFIA 4B3LA 4DAIA 2G97A 1PCWA 3QZ6A 1E73M 1A0DA 4IPNB 3QOKA 4UNKA 2F7FA 1OCNA 1BYDA 4Z2LA 2BXVA 1QU4A 2WZIA 1Q6OA 2J8GA 3RIKA 5CC6A 4H9YA 3PVFA 5D09A 4WJ8A 4L5ZA 4ACYA 3HFYA 4NILA 5DBUA 4C6CA 2HS8A 1C29A 2QDEA 3C3UA 3ICJA 1CCWB 3PBUA 2ZQ0A 3OGSA 4W89A 2PWDA 3OPSA 5K2ZA 2POZA 4AIEA 5ABEA 3U9IA 3EMQA 2V2HA 3FCPA 3TYDA 3QZEA 4ZFMA 1KCXA 4D6EA 3FFSA 1U5VA 3R8HA 5CAKA 4V1YA 2DZAA 3LTYA 1U5JA 1VEMA 3NZQA 4TMBA 4H6EA 3VDCA 1IQ8A 1G4SA 1TTJA 1H1NA 1EPXA 3UG4A 2VWTA 2EEXA 5K4XA 3F5KA 3UJEA 1ML1A 2BGSA 1VAHA 4DO7A 1FBAA 2UY4A 1V02E 5E93A 3HURA 3GKFA 2JBMA 4PUUA 3WF0A 4MOZA 4FLRA 4YVXA 4CNUA 4LBRA 3CTTA 1FHUA 3M7SA 1SVDA 3VZYA 3T05A 5DMLA 3KWSA 3LRLA 4DI9A 1SSDA 4WD0A 3QMSA 4LQ1A 3JR2A 1TZZA 3BICA 1G4EA 3IGHX 3VIIA 1NOUA 2BY1A 1REQB 2OSXA 1FUYA 2KAUC 1LOSA 3C2VA 3O6AA 3LHVA 3AOFA 5I77A 2Z6JA 3GHTA 1HX0A 1TV7A 4V27A 4BQ2A 1FHDA 1HKIA 3CPRA 5A8OA 1MVYA 4KH2A 4PA8A 1QNQA 1KXHA 2YJQA 1LG1A 2J79A 4NT0A 3ZSSA 5LA1A 1TCDA 4CUCA 3CT2A 2Y89A 1OD0A 3F5LA 4WF7A 4AEOA 1JZ3A 3W7LA 1AUSL 2G50A 2AMGA 4CD8A 4TR9A 1R2SA 3UXLA 1R0MA 1ZGDA 3C52A 1IXPA 4XZHA 1Z3NA 4QAWA 4O15A 3CPGA 3NZPA 4JY8A 5D9PA 3N6QA 3QKEA 1KA9F 3V0UA 4YMZA 4B9ZA 1H4PA 5FI8A 2XIMA 2O56A 1LL4A 2QCHA 4O14A 5F4SA 4M3PA 1C8QA 8CGTA 4L6HA 3LRMA 5I07A 3MS8A 1WOBA 1XIMA 3AHTA 3CU2A 4Q7NA 1PKNA 4H2CA 2O7QA 4WGHA 2NQ5A 2ZVIA 1BVWA 3FSTA 2QF7A 3EA2A 4UUIA 3PZNA 1FWIC 1U83A 1DP0A 4IPLA 3A24A 1G1YA 1SZGA 4P8UA 1HJWA 3QY6A 3DHPA 1E6ZA 7REQB 1IYXA 1OZQA 1GQLA 2DZWA 4E2BA 1IEVA 3ZJ7A 4XZNX 1G4TA 2NXGA 2CZFA 3EEGA 2PCQA 2Z2AA 1HTIA 3GR4A 1O1ZA 3DFOA 4OT7A 5BXSA 2YLAA 4RKAA 3K4WA 4H7CA 2W9MA 4IMCA 4B5UA 3CYJA 3IVUA 3QPEA 3WIJA 3LLFA 2Z26A 4I9MA 3WF2A 4TVUA 3SGUA 1E5JA 1R87A 4CGTA 1GVSA 1U1JA 2XM1A 2PGFA 1B3ZA 8TIMA 2Q8ZA 2O9PA 4P2VA 1RQEA 1L2UA 1LOQA 3CEPA 1TVNA 1CNVA 1ZJAA 2PZ0A 5LIKX 3N11A 3QV7A 2VELA 3S8HA 1XRVA 5AVHA 5DCDA 3WN6A 1TR9A 4XIMA 1X98A 2GK1A 3L21A 1BFNA 4DX3A 4C1NA 1ONEA 3TW7A 4Q8PA 3SN4A 2HDJA 1W1IE 1FA2A 3KRSA 3MT1A 1HL2A 3R58A 1TZ7A 3S5OA 3M46A 5AC7A 3RF9A 4WJEA 3N9RA 3G1XA 3WK2A 3N25A 3R94A 1OFBA 3M0VA 4OJYA 4Z2HA 3CNYA 1W3HA 1YPFA 2W6RA 1R3QA 4GJ1A 2XGBA 4LVAA 2BHUA 3SCVA 3URAA 2YGYA 4FSAA 2EPOA 1W3JA 1NWTA 4E8GA 1EX1A 1RSCA 2YXGA 1AJ0A 1A4LA 1TJRA 5C70A 3LCWA 1XC6A 4HA0A 1XRSA 2EQDA 3MW7A 4DZAA 3GNPA 2FLIA 3A6OA 2YDAA 3VGHA 1F2JA 3UT0A 2C6QA 4B15A 1EHNA 3F4NA 3H12A 1UWQA 4Y9PA 3C0SA 4K38A 2V5BA 2ZZ1A 3HM7A 1VBHA 3FYYA 2VZTA 3CT7A 2QKFA 4OV9A 3AMCA 3BAXA 4HHPA 2P0IA 5I6SA 4ZO8A 5LXXA 2Z27A 1NFGA 3AIQA<