3H2FA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
269
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2fA00
4DJEA 2DZAA 3H26A 3TR9A 4MWAB 2VEFA 2H9AA 4D8AA 3BOLA 1EYEA 2H9AB 3TYUA 2Y5JA 4DJDA 4O1EA 2E7FA 4D8ZA 4S3FA 1TWZA 2VEGA 3TYZA 2DZBA 4O1FA 3H23A 1TWSA 4PZVA 1TWWA 3H2MA 2VP8A 4C1NA 2OGYA 4D9PA 3H2FA 4S3DA 4DJFC 3BOFA 4CCZA 4DJFD 4C1NB 3K13A 3MCMA 4NL1A 3TZNA 3MCNA 1TX2A 4HB7A 1F6YA 1AJ0A 4MWAD 4DJED 4O0QA 1AJZA 2YCLA 3H2OA 4NHVA 3H21A 3TYCA 1Q7ZA 4S3AA 1Q85A 2YCLB 2Y0FA 3H2AA 3TZFA 2YCKX 4DJDC 3TYDA 4DJDD 3H2CA 1Q8JA 3H22A 4S3EA 4G9PA 1Q7MA 4S39A 5JQ9A 4MWAE 1AD1A 1TX0A 3H2EA 2BMBA 4MWAC 3TYAA 4DJEC 2Y5SA 2DQWA 3H2NA 3TYBA 3MCOA 4NIRA 3H24A 3NOYA 4S38A 4NILA 4S23A 2YCIX 3TYEA 4DJFA 3V5OA 4S3BA 4S3CA 1Q7QA 4DB7A 2YCJA 1AD4A 1Q8AA 4DAIA 4DAFA 1AJ2A 4MWAA
chains in the Genus database with same CATH superfamily
4AEOA 1W1IE 2YKKA 4LUTA 2XIMA 5BZAA 3SCQA 3A23A 5IBXA 1V6TA 4AG0A 3EWXA 1JCMP 3RILA 1WYIA 3QV8A 4FNQA 4A3QA 4YTRA 2Z24A 3BLFA 3P67A 5HPOA 4KS0A 1TWWA 2NX1A 3AI0A 1LBMA 1E51A 2YFOA 3UZZA 5CPMA 5AYIA 2OPJA 3A4XA 2JK2A 3VNZA 4UNKA 1K77A 3IJ7A 1WKFA 4O8RA 2WVSA 3W0KA 4MZ8A 2OG9A 3E9AA 4Q8UA 4IIFA 4KT2A 5E0KA 2IKIA 2ABAA 3KOWA 4CNPA 3MS8A 3DDMA 3WDQA 2C16A 4AZGA 1E4LA 3SGUA 2PAJA 5BROA 1BG4A 1E5NA 1MUCA 5HXMA 3F7JA 4B3LA 4GXPA 2E8ZA 1X39A 1V0MA 4N2YA 4NJGA 4N42A 4BQ5A 3QGAC 3R5EA 4PEEA 3T05A 3KLLA 1QHZA 2ZICA 1IEVA 1RZMA 5FEPA 4IWWA 1FWJC 3W1QA 3LRLA 3VKKA 1MO0A 2WVUA 4OV4A 3M0YA 3BAYA 3SRKA 3QM3A 3VOCA 2VYOA 4P8WA 1WDWA 1V0KA 3MZNA 3VD7A 4GO9A 4GXWA 4M0XA 2GLKA 4FZIA 4DUVA 1KGXA 4QJ3B 1J96A 4QLKA 4JHOA 2J7GA 3CNYA 4ORIA 5AECA 1JGMA 1XHGA 3GUWA 5L9FA 3RMJA 4HPXA 1UPMB 3GIPA 1ZFJA 2FGZA 5CJ5A 1P7TA 4YTSA 4GKTA 3BLLA 2XIQA 3H12A 4IMCA 3RPDA 2WPBA 1V6XA 2G3IA 1DWHM 1EDQA 2WOQA 4MB5A 5D03A 1VS1A 2BXVA 2OLAA 4GIYA 2QAPA 1Q6QA 2WSKA 1PKMA 3PVFA 1B57A 2FLIA 3CPRA 1TPFA 4RK8A 1QR7A 4ES4A 3M5YA 1GOOA 1QI0A 3NO1A 5DT7A 1VH7A 3UPMA 3FAWA 3W7QA 5GPRA 4AY8A 3S1WA 4Q8WA 3HQOA 3TQ0A 5ECVA 5CSSA 3HQ1A 1J6OA 5REQB 2NVAA 5LKYA 3S2NA 5M1TA 3VNYA 1OX5A 1ZHAA 2QCNA 4OV9A 2WWCA 2W63A 2WMJA 1K6AA 1V8EA 4D72A 5FEXA 2BG5A 1PCKA 1J6PA 3MU7A 4PRRA 2W6RA 3I7RA 3APGA 4I7UA 4Q8VA 2REQB 5JBDA 1JZ8A 1WOBA 2CLHA 4JICA 3IIZA 4ZCWA 2GJXA 1Q4WA 1TV2A 3OIHA 4H19A 1KV5A 4A05A 3BH4A 2XTKA 4M56A 4FF7A 5CC7A 2MANA 4ZEPA 3KOXA 1ZJAA 3WNPA 3ZLGA 4D6GA 3PFRA 2OGYA 2CU0A 3B03A 4NF7A 2L5HA 4DUOA 1YADA 2R8WA 1H2JA 1IT0A 1JCLA 1RXOB 3W07A 4H7ZA 4XD6A 3CAQA 3H53A 1SR0A 2ZVIA 2ZRZA 4H9ZA 3HMJG 4L61A 1V3JA 3RX2A 4NZFA 1W3HA 1FKXA 1TTQA 2DIJA 3DFSA 3QF0A 4PYSA 1ZUAX 3E0LA 1K8XA 3A13A 4Y90A 2Z7KA 4O54A 5ABTA 1ZU8A 2GQ8A 3W24A 5BMWA 2B7OA 1U30A 3CYJA 4LVBA 5FKYA 3RCYA 1CXLA 5LZLA 1TFVA 3UWQA 5AC5A 2J7HA 3VDGA 4LCRA 3PZOA 1J18A 1EO5A 2J8GA 1H09A 3WLSA 1RQBA 3AXKA 3R79A 3C2YA 4K36A 2PDKA 4RZBA 4QSHA 3SIMA 1PEZA 1ITQA 2VX5A 3EX3A 3UJFA 1I8JA 4HYVA 4HZMA 3WQ6A 3SCPA 1TCMA 3NQDA 1XCFA 2NT0A 3DYPA 2BY1A 3THCA 1REQA 2VGFA 3VDHA 5G4HC 4LPCA 4DHGA 4PULA 4ZFCA 2VP8A 1UB3A 4GWEA 4H01A 2F2HA 2J79A 1VF8A 4EANA 2CESA 1ZBKA 3XISA 1FWDC 1QOQA 4LTSA 3GDMA 4MAZA 1J93A 4CD7A 1XLJA 3IANA 4JQ3A 4RE2A 3P0XA 4GVIA 3UR5A 1N8WA 4R34A 2OYLA 1Q7ZA 4PCPA 4Y8EA 1BWKA 1ZAHA 3T0CA 3U9IA 2DZXA 4K8GA 4ONVA 1UWTA 3CZEA 3GSMA 2VNCA 5LXEA 2NSXA 2IKGA 1Q6GA 3OGSA 3WUEA 1JR1A 1LLOA 3DBNA 3WNKA 5FJOA 4EAMA 5KETA 4DZAA 3W84A 3UWWA 1JYWA 1KRCC 3CEPA 2A3LA 3S4TA 3T2OA 2JALA 4O12A 4O4WA 3PNUA 4O18A 3DFYA 4TXEA 2Y24A 1RD6A 3UT0A 1E4NA 4X2PA 1AJ2A 1XG3A 1ISYA 4Z2LA 3O0KA 2TPSA 4K7VA 3NG3A 3WQWA 3VNMA 2Q6ZA 3EDEA 1P0BA 1GYNA 3FVDA 2PP1A 4Q4SA 3W86A 4JTJA 3W7DA 2BVYA 1GQKA 1EQPA 3GIQA 7ODCA 2W5FA 3VNLA 5DY2A 4UFJA 4D1IA 3VDCA 1OCBA 3W2KA 4DBEA 5C9ZA 3PULA 2G3MA 3MSRA 5F2LA 4H4IA 1B0IA 1ME8A 4PMQA 4NYYA 3T4CA 1W1TA 1Y5VA 4I8YA 3LCGA 1SO3A 1FHLA 4ZE5A 1XLEA 5EB8A 2DSKA 1FWIC 4KPLA 3NQEA 3O3RA 1W0MA 3NM1A 4HZ8A 1VBUA 3I6TA 3MI3A 4X9SA 5G1TA 4M7TA 3HGJA 1WQ5A 1BF2A 4EKJA 3ABQA 4I5XA 3SY5A 2V38A 3SUVA 3UJEA 4DBWA 2XN0A 3STPA 3B04A 2J7FA 3GXNA 1UQYA 3BV7A 1KLYA 2Y8VA 1AL7A 2X41A 3RO6A 1E6QM 1QXLA 3PPFA 4CCDA 1Q7QA 1PCWA 3P81A 5H8MA 3WLMA 1OADA 3CL8A 3P8IA 4IIEA 4M1RA 4OIFA 1B3WA 1KWGA 2YX0A 3TXZA 5AY7A 3OTRA 4LGXA 2QJMA 1KM5A 4LALA 4NZCA 3VDBA 3WNLA 4NZ1A 1PIFA 1Q63A 4O57A 3W6YA 1Q6DA 2R1PA 3EB2A 4CU8A 3NUKA 1QI4A 4UUIA 4FNUA 4AC7C 3BPWA 4GPNA 4DF2A 1EBGA 2C13A 3ARYA 1FHVA 1FOBA 2X0SA 1BTCA 4B5SA 2GJPA 4Q4PA 1MQQA 3RPMA 4QG6A 4QDWA 2EF9A 2P10A 3NDOA 1UR1A 2CZEA 2PU1A 4O11A 1EPVA 1XG4A 3TN6A 4C7DA 4IG2A 3N6QA 3GR8A 4O0KA 4FX8A 2NV9A 3OEXA 1W1VA 4E2BA 4Q8TA 4B5NA 1QK0A 2VRJA 2XGZA 3P0WA 3QSTA 1H11A 4JFVA 3UR8A 3IWPA 3ELFA 1ODUA 3QW3A 4ZTXA 3CMJA 1P6CA 3DZ1A 4BQ2A 3UNDA 4DBDA 1V3HA 3AMDA 2PGFA 1WO2A 2ZZ4A 5D9NA 4DXVA 4QJ4B 2OO0A 4GVHA 3H54A 3WLHA 2NQ9A 3WFLA 3NQGA 2QGHA 3WBYA 3GFXA 5DRIA 4E2OA 4JNYA 4R27A 3FGCA 2QGYA 2Z6JA 3HMCA 2WHKA 3MB9A 5CPNA 3CB8A 2POZA 2PP0A 5ABGA 1F3WA 4QITA 1CXHA 5I07A 2OSXA 4ZOBA 3TWAA 3OA3A 4EXAA 3ATYA 1JXKA 4K6AA 4W89A 3IJDA 3BLEA 3AROA 2FFIA 5H6HA 3S2LA 3QMSA 1W3NA 1MWOA 2BFGA 3V18A 3NL6A 4AIOA 2YCLA 1M03A 1QNRA 4UR9A 2RJGA 2A7NA 4WSJA 2GZXA 3U8GA 2PDCA 3IARA 2XSBA 4UMBA 3CUGA 1TUFA 5I03A 4H1ZA 2V2CA 4O10A 3WIJA 1FWWA 4KIEA 4KEVA 2NUYA 2ZUVA 3K8KA 2QR6A 2VELA 1S5MA 2ACSA 2ZQ0A 1PHWA 3G1DA 4CQCA 4DPQA 5AC7A 3K1DA 3EA2A 5TIMA 3QKZA 4GX8A 3MBFA 2QIWA 2A7RA 1SYTA 1ML1A 3PBYA 3GW0A 1T0OA 3K1GA 2A3EA 4I5UA 3VD9A 1N8IA 2D0FA 4EVZA 3VXGA 4JX5A 5I06A 3URNA 5I09A 5CC6A 1S3HA 4W9TA 1F8MA 5C2CA 4TMBA 4X2RA 3KTSA 3WUFA 1XP3A 3MZ2A 3ZJ6A 1XLFA 2WVTA 1VGAA 4O1CA 3MT1A 5A6AA 2YPIA 4XK2A 5CSUA 5ABHA 3VC5A 1QFEA 1RHCA 2H3DA 1OHLA 4KCWA 3RF9A 4O1BA 3QBUA 3WQEA 3WD2A 4QE1A 2X16A 3CQ0A 3CHCA 1NIUA 5C2XA 4PMJA 4UWMA 4FX6M 3ZLHA 3T8QA 4Q6JA 3GU9A 5D32A 1NFGA 2BTMA 2YBTA 2IW0A 1JUBA 6REQA 3BQ6A 3S9ZA 4HQVA 4RX0A 1PWMA 4GC4A 4MKNA 3VNKA 4PMDA 3TMLA 1XINA 4IQEA 2IQDA 4MZ1A 4ZOAA 2E1DA 3TDFA 2E40A 4UTMA 4JNZA 4UQEA 3STEA 1I2PA 3GX9A 3HG4A 2J74A 6PTDA 7REQB 1C91A 3G6LA 5C71A 2DY3A 3M0XA 3W7PA 4KEZA 4U4MA 3NQ7A 4J28A 4Y2WA 5DFAA 1VPXA 2VQTA 4UZUA 3AHVA 3W22A 5L6UA 1RPKA 3SI9A 2GYIA 5HA7A 2PZ0A 3UERA 2NXHA 1XD0A 3SUSA 3BW2A 3ITGA 1RJPA 2XISA 3N13A 2PDUA 4M81A 3GQYA 3K46A 3LXAA 2ANUA 1QASA 2VEFA 1PKLA 2Z2AA 2PDQA 1VFTA 1SO6A 4HNCA 5HNTA 1JFXA 2VEPA 5A95A 4QJ1A 3WLLA 2GWNA 5D2TA 3M6DA 4PE8A 4W87A 1D7FA 3HM7A 3VZXA 3WEMA 2WBGA 2AKMA 3I4KA 1H51A 1VRDA 1KD0A 3M0KA 3FXGA 1RPXA 3D3AA 1Q2SA 1VRXA 2GQ9A 2PDJA 4DJED 2FHCA 1NQKA 4CNNA 4IMFA 1EJVC 3TAOA 1YE4A 4O19A 3GH5A 2F8QA 4LS2A 4GQBA 2OR2A 4NXKA 1I2OA 2PWFA 1IE7C 1HL2A 3AIEA 4HGXA 4J3SA 3IGHX 4HA3A 3APTA 4IFKB 1ECEA 2PLMA 5FSDC 3LXBA 2BY3A 2RDTA 2DZPA 4XKYB 3IGUA 1JDAA 4S2CA 3B4UA 1DIKA 1TZZA 4FOJA 2D2GA 4XQ6A 5AVNA 3R10A 1ICQA 2J8TA 2YB4A 3FVMA 4C5ZA 3DOPA 3MI2A 4PTDA 3N6HA 3UG8A 1QDSA 2YCJA 4WD0A 3UBPC 5E1QA 3W38A 4HVXA 4U2ZA 1SM9A 5HNUA 4LVAA 3CTLA 4DJEA 3RO8A 3BCJA 3N11A 4YYCA 2OT1A 5GNXA 4HK7A 4CLMA 3WH5A 2XZ9A 2V82A 3CWOX 1R3SA 3EDJA 3G18A 1XLGA 4O53A 4L9YA 1ONXA 3EMCA 4W85A 2VX6A 4IPPA 2JEPA 2PWVA 1O7AA 3AIQA 5HJLA 2GDQA 4YL2A 3W81A 3CWNA 4KH2A 3LSCA 2JEQA 2SFPA 3H2MA 1PL9A 3LG3A 8XIMA 3PPGA 2DJXA 2ZRYA 4XBJA 2YYUA 4ATDA 1OINA 3BE7A 4AX7A 2BBFA 2PFHA 3L68A 2RGLA 2ZZ1A 4F66A 2V2DA 1JZ7A 1XW8A 4M6VA 1NAL1 3KDNA 1Y65A 3O2LA 1UG6A 4G5DA 1BAGA 3N17A 2ALRA 3GZAA 4CD8A 1T40A 2P8BA 2G41A 3QPYA 1D2KA 1TZ9A 2ACRA 3W7RA 2PUZA 3WQFA 2KZHA 4MB3A 1OGSA 3B8UA 1RVGA 2ZUTA 6XIAA 1UUMA 3G8EA 2DIKA 4Z2HA 2O4QA 5C9XA 1MMFA 3P8JA 4GISA 1QNVA 2BY2A 1KTBA 3NAVA 3B9AA 3VOFA 4QISA 3WMLA 4QNWA 3H7RA 1C8VA 1S1PA 4GMEA 1KC7A 1E6PA 4UQDA 2WXDM 1MZRA 3HBLA 2E25A 2GJLA 3N2XA 1DTNA 1NU5A 1EOKA 3LMZA 4GI6A 1PYMA 4Q4MA 1EXBA 5J5RA 3B9DA 1TIMA 1VLIA 3VK5A 3TX9A 3VCNA 3PY2A 2I9UA 1H7OA 5JBFA 1XPGA 1E9ZB 2Z1VA 1U83A 1CT5A 2I14A 1IGWA 2A4AA 3KVKA 3N73A 1G01A 1X98A 1TUXA 1EPXA 3OVRA 4LCQA 3CJPA 3HURA 4OWGA 1W5QA 3W4RA 4TVDA 4RNIA 5FIPA 4OHQA 3W1XA 2HWGA 3H70A 3VE7A 5DMYA 4IHCA 4NRSA 3Q2DA 2ATSA 4BEUA 4R85A 1SO4A 3CQJA 2Y1HA 3N3MA 4ML9A 1RK5A 1UKSA 3V75A 1E40A 5A2BA 4TVUA 4PODA 1I1XA 1YW1A 1BVNP 3ITLA 2XIIA 1G94A 3NDZA 3RU8X 1AMKA 1F4AA 1X7IA 4QEHA 5DMNA 4F4RA 1MFUA 4J3UA 1EGZA 1GJUA 1YXCA 4BF5A 4U10A 1AD1A 2E77A 3WX7A 4J5NA 3DHFA 3E38A 4Z1DA 1U2YA 3LHYA 4R7WA 3CZGA 4PFHA 4MYAA 3GWQA 5AYYA 1JIBA 1O1ZA 3NVTA 4S38A 4K3ZA 4PEKA 2F6XA 4DWDA 5IXEA 5HMSA 4H6KA 3UCCA 4GBDA 5ECUA 2WNQA 4DXXA 4H8UA 4GXMA 1AL8A 1UUQA 4RNJA 2O9OA 1UA7A 1L6SA 3W2MA 5LXXA 2ZZ7A 1KM2A 1PE1A 4FNTA 1KKRA 3PUDA 1WKEA 2X40A 3ANVA 3MSDA 3K30A 1ISVA 1S5TA 2F6UA 3VIPA 2PDWA 2W79A 3VD5A 3TVAA 4EK7A 1EC7A 1RSCA 3E3HA 3T2QA 4CD4A 3HPSA 3K4AA 2UV8G 3KVJA 5EU9A 4PUEA 2ZX8A 2HBVA 1HO4A 4QQUA 5HK4A 1CNVA 1RBOB 2FZ8A 4NAFB 5TQLA 2BHYA 1KGUA 5BOEA 2D69A 4LUJA 1A5MC 2PTDA 2VKZG 4NVTA 3B05A 4MMWA 2IUZA 2OKTA 2NWRA 2GDVA 2PEVA 3W7LA 4V33A 2VCCA 5REQA 2DZUA 5AHMA 3CLMA 1VLWA 4AH7A 1ZP4A 1QOXA 4GACA 3V5CA 4IFOA 1LLZA 7TIMA 1T7LA 3HA1A 1JCTA 4H6EA 3BSMA 3VIHA 1WNOA 1OABA 1R3VA 3QPEA 1P0EA 1IT7A 1DIDA 3W71A 1JAKA 2REQA 3DBPA 4JXCA 3EMZA 3JS3A 2X30A 1CTNA 2Q8XA 3G3DA 3G1VA 1BSLA 4AWSA 1GG0A 1OD0A 3BG3A 5D04C 3C2RA 1V7AA 4IXHA 1UZDA 3IVUA 1CXKA 3V0SA 1CB2A 4PMZA 3UXKA 1EH9A 3KEHA 1X6UA 3S5YA 4FHAA 1LT7A 3SQMA 3NQFA 1D8CA 4IMEA 4YJ5A 2VVNA 4PFMA 3TV8A 2HS8A 1PTAA 4NI8A 1E71M 3MPGA 1B3YA 5HQLA 3ZVIA 4GIEA 5BXPA 1UIPA 3CPUA 2PF8A 1VPQA 2EG7A 1OVDA 1BD0A 2FDSA 1BTMA 2JIEA 3O1NA 2BS9A 5IHRA 4Y9AA 1HL9A 1VFFA 4ORMA 2D73A 3KL5A 1G9HA 2CKRA 1IZCA 4JEJA 4MVAA 4UFMA 1JRBA 5CSYA 3QPZA 3GDKA 4EWJA 3GDRA 3W29A 3PZGA 1PB0A 3PBVA 4LB3A 3VGBA 3C6CA 3IJ8A 3O05A 2E67A 2VGBA 3N1AA 1YXDA 3RLVA 3A9IA 3LD5A 4WKAA 5A8PA 3P3BA 3P80A 2PGWA 1B4KA 1LP6A 1CW2A 4HA4A 3OLEA 3DG6A 3PWGA 1PDYA 4Q4OA 1UC5A 2D2OA 1EXPA 3RPTA 1UD6A 3QGKC 2ZE3A 1WZLA 4YWSA 4RE0A 3MP5A 1UOKA 3EWUA 3SUWA 3CL6A 1C7SA 1NWTA 3BJTA 3WLRA 3QGVA 1UMLA 3GTXA 1NOUA 3P2VA 3WLQA 1HGWA 1OF6A 2P88A 3QXBA 3GTHA 3BO9A 1HGYA 3LI1A 3W7JA 1L8PA 2DH2A 1LWIA 1H5YA 3NM3A 4R53A 5CGQA 3RLGA 3GU1A 2BMBA 1XLMA 1GOKA 1SU5A 1WV2A 2PSNA 4JOMA 2G4JA 4B92A 2DZTA 4GYJA 3CU2A 2IMRA 3GLCA 3LHWA 3TYEA 2ALDA 1XYFA 3FOKA 3QV7A 1TV8A 4NJKA 5M3WA 3R8HA 5AYXA 1Z42A 4XTDA 5T8GA 2XM2A 1E0WA 2C15A 2Y7DA 4R3UA 2AQWA 1RR2A 1XIGA 4J3ZA 3ZM8A 4S2BA 4AZ6A 2ISSA 4CEUC 1U22A 1HX0A 4ZO6A 5GQBA 2PBGA 1KM0A 3VIFA 3AISA 1YDYA 4H6RA 1W9BM 3WYZA 4MKSA 2CBIA 1EX1A 2FKPA 4CGTA 3T44A 1BYAA 5A8OA 3UXIA 3H4WA 2QDHA 4FXRA 6A3HA 1G4SA 1S3TC 2PB1A 4GYPC 4NZ4A 2VD8A 4AD4A 1OIFA 1W6TA 3WDRA 3K13A 2EO7A 5FJRA 4XVDA 1OYAA 2PC8A 1CGXA 1GQLA 3T42A 4NAEB 3IJLA 4XUGA 2D3NA 3C8FA 1ONRA 5CZ0A 1UIOA 2EEXA 1EJTC 2ZA3A 3RIKA 4FXSA 3IJIA 4I7WA 5DRCA 3NTYA 4CU7A 1IEQA 1DWIM 4Z0SA 3CQHA 3HQPA 3OG3A 4P7RA 4AEEA 2XJ7A 2CBJA 1EA0A 3EKZA 3PJUA 1Q6LA 3CGTA 4KMQA 4ZGYA 1YXYA 1FQ0A 1HJWA 2WCGA 4QAWA 1KM4A 4JR5A 3T55A 2HISA 2QDDA 3BWWA 1LM1A 5G2WA 3SFWA 1TMHA 4S3BA 4KCVA 4EE9A 3EOOA 2O56A 1EJUC 4GD0A 5F4SA 3UQNA 5BW6A 1UZ4A 1E43A 5HINA 4DLMA 3B8IA 4WY0B 3OVGA 1JDFA 2CC0A 3GD6A 3O6YX 4GZIA 3VD4A 3L4XA 4Z1YA 3DC0A 4WXZA 1QAPA 4DUWA 1WZKA 2WVVB 3TYUA 1J0JA 1VJIA 5FJPA 3OQ8A 3WLNA 1GEQA 4KESA 1XGEA 1L6YA 5CLWA 1SZRA 1F3TA 2F38A 1TG7A 2YDQA 1BHGA 3K8LA 1VEOA 2VD9A 2PZNA 5BU6A 2ZBTA 2O4MA 3SQSA 1O5RA 5HQMA 3W85A 1IYXA 3GY1A 1R6WA 1FWGC 4NG3A 1SZGA 3EYPA 1TA3B 1VD6A 2X05A 4Z1BA 2DGAA 3SN0A 4FXJA 1V0NA 7TAAA 4ACZB 5HWJA 1QBAA 3W01A 5K4ZA 5HNRA 3LLXA 1JPMA 3H22A 3IJ9A 3A12A 3ABRA 5A69A 4ZZ9A 2ZDRA 2FPYA 1GQIA 3GXMA 4GY0A 2D0HA 2QPUA 1DQWA 4MJMA 5I3DA 3OJGA 2CNCA 5EMMA 3T9PA 1GQNA 4UNLA 2GL5A 5A8MA 4TX6A 3ES8A 3E0FA 1KBIA 2HE5A 1R2RA 2VX4A 4HTYA 4FX7A 4WZHA 1KW1A 2X1RA 1HNYA 4RDYA 1W8GA 2E4TA 2ISFA 4OOZA 4HYRA 1W1YA 3KAOA 2QPXA 5J04A 3H26A 3QSRA 1TKKA 4MWAB 1RCXB 2E68A 4Z08A 4N02A 1BRLB 3GBDA 1SJAA 1TCDA 1D3GA 2GOUA 1I9CB 3Q58A 3SN1A 3VE9A 4PMXA 3AHYA 1TV3A 4RKAA 4RXGA 1OC6A 5AHFA 4ZR8A 2BVDA 3KRUA 3MUZ1 4PA8A 1SUXA 3T81A 1LCOA 3USZA 1P43A 2CBUA 2PLJA 2QV4A 1VYPX 1E4IA 3TTSA 4AIUA 1OC5A 1YPFA 4NQ1A 2VRQA 4O0QA 2WJZA 3DFQA 4D2JA 4NHVA 2GVYA 3NFUA 1P1MA 2ZZ3A 3LDVA 3FY1A 3RLUA 3T09A 1RCOB 4QCFA 4YCOA 3UY8A 1S2WA 1Z6KA 4UNIA 4O14A 3O07A 2EJAA 3L23A 4C91A 1DWGM 3T7VA 1KBJA 3ARPA 4P7LA 3UEQA 4H9YA 3PUGA 3GS6A 3VNIA 2PCEA 5D2VA 2ISVA 1M9HA 3ALGA 2J75A 4CVUA 3W1MA 2DVUA 8XIAA 1UJPA 1HVQA 4IQDA 1Q5MA 2ONEA 3T4WA 4AD1A 4LBUA 3PZTA 3E2SA 4U28A 3WLOA 1BVZA 1KFCA 4O16A 4X60A 3RUBL 4MKVA 4XZ9A 3BMXA 2WWDA 5LA0A 3WJYA 4DM1A 3AC0A 2J7CA 3WK1A 4AMCA 1D3CA 2CCRA 4WOZA 3AMGA 2YB1A 5TD4A 3HQNA 4X0NA 1ONEA 3ZJ8A 1A5BA 2FB3A 1O6IA 2C19A 8A3HA 4Z1AA 3C4UA 1G4EA 5MHBA 3OVPA 1P48A 1M6JA 5HJYA 4LANA 4S1FA 3OG2A 3D46A 3UXLA 1YMYA 1JZ2A 2PC4A 3P6LA 1C92A 4ZQCA 3QW4B 3TAKA 4E8DA 3H8AA 1BYCA 3OYXA 1XI3A 4FXFA 3UW6A 4GVGA 2C3ZA 1ZP3A 3W7NA 3M0JA 3M64A 2B81A 3F5LA 3NPUA 1GEHA 4AC1X 1M1BA 3LYEA 3UZYA 5C6MA 4LAOA 1XYZA 2XSXA 4FO4A 1ZRQA 3DKLA 4PUMA 4B9ZA 3C3NA 1EP1A 4QM1A 1ISXA 3VCCA 3QR0A 2OXNA 1ZQ5A 1NELA 3CUXA 3VILA 1Q6RA 2WMKA 1SFLA 1TPWA 1S5NA 2O9RA 3FSTA 1I2RA 2VMFA 1GHSA 7REQA 4Q22A 4XB3A 4LV4A 5CZSA 2F2KA 4PB5A 4H8NA 3PN8A 2E28A 3PANA 4Z0JA 4LAKA 5EKYA 3CTTA 2VEIA 4EXBA 3KZPA 1UCWA 3S9IA 2QDEA 3KTCA 3QYSA 4CN6A 3EDDA 3NQAA 1JULA 1N55A 4IGNA 4PCFA 4GZJA 3W00A 1JYVA 5CBBA 4F79A 5HR6A 1TWDA 4Q4KA 5HATA 4GQ0A 4QS5A 4H7CA 1W2VA 1MRAA 2ZYFA 3F2BA 1TB3A 1EL3A 1XIBA 4QAIA 2GQ3A 1GVQA 2NQJA 1AH4A 3BL3A 3ZMRA 4LFYA 2I9EA 3T08A 3KWXA 1MW0A 4DN1A 3N2TA 4LRSA 4HMNA 3WLJA 3WFZA 1IXOA 1YBQB 1QTWA 3PM6A 4AHPA 3AXHA 3AUJA 4OU1A 1K8YA 4U33A 3NQBA 3INPA 4AXKA 2CLMA 4G56A 4FK9A 2PWEA 2HS6A 3FA5A 4HCHA 2X2GA 3KM8A 3WZ0E 1KV8A 3W75A 2CHOA 3WD1A 2YJQA 2C1IA 3F4CA 2JGYA 4IFKA 3WJZA 3L5LA 1NEYA 1KBLA 1DL3A 3H7UA 1EDGA 1NDZA 4XKYA 4DF0A 5D2XA 4Q4QA 4JFUA 1TYGA 4ZO8A 5AFDA 1CXFA 2V6AA 4B9YA 4JTKA 3HJEA 4NILA 3P84A 4GINA 2Y88A 2PS2A 3TC3A 3C3UA 3SCSA 1EUNA 3QOKA 2PDMA 3AMCA 4ZTYA 1QBBA 1AW5A 1KXTA 2A7PA 1XM3A 1XLHA 1QNSA 5JXQA 2Z1BA 5FJTA 4ZO9A 4L56A 3UR2A 2X1TA 3LLDA 3ARSA 3U2CA 4AB4A 4M3PA 3QQWA 2WANA 1E6NA 2OKOA 4E0CA 3C61A 2NW0A 4AYGA 3RR1A 4G1KA 1BXCA 3RM9A 3L9CA 1FDYA 4N7QA 4LF1A 1R9ZA 1W3LA 1Q6FA 4PB3A 1HUVA 3SIZA 2Y62A 3RM8A 3A3WA 1W3KA 3LPOA 2WMHA 1JUKA 4QP0A 3B06A 2WQDA 3N19B 4BWLC 4YMZA 2VL4A 2HCVA 4YPJA 3OHIA 3ANYA 3EBVA 3T0DA 4J4KA 2C6QA 4TTGA 1LTDA 5AHNA 4DYJA 3D3FA 3VKDA 3FYYA 2GDUA 4RZ4A 4RE3A 3AHXA 5DT5A 3Q65A 3ATZA 4NZJA 2QEZA 1CPUA 1BGGA 2PF0A 5EMUA 3IRSA 4GZ7A 1QVBA 4PR4A 2BDQA 1G7UA 1KFLA 1THFD 2EG6A 2H8ZA 5TNVA 2XWDA 2AL2B 3OPSA 4WK9A 2J78A 3GTNA 3WNOA 3AJ7A 5FJUA 1KM1A 4G1NA 3ABOA 4OQVA 1XQLA 4I5RA 2X7VA 4QNEA 3TJIA 1OX4B 2WZHA 4GUJA 3I7SA 1CYGA 2WLYA 4JKKA 2XUCA 1CLVA 1REQB 4U5KA 1WKYA 1LQ2A 3ZR6A 1PV8A 2ZUUA 3MV11 1W5NA 5CSRA 3REQB 5T9CE 1X1NA 6ALDA 4O17A 1JUEA 4MLRA 4CQ9A 4EPDC 4N9BA 5D2YA 1XUUA 4PL1A 2JF6A 5DBTA 4TOQA 4JTTA 2V0TA 3KVMA 4I9AA 5HUPA 1DJQA 3W7CA 4AD0A 4XZIA 1SMAA 3MCMA 4PUNA 2CLLA 4H2CA 2J62A 1F6YA 2VJXA 2XH4A 1ZB5A 4UOZA 4UOJA 2R6OA 4M1BA 4RV3A 4BEQA 1VQTA 2Q8ZA 2IKJA 2QDGA 4JTQA 3WBAA 3KE0A 2YCKX 5AHIA 2VDGA 3NYDA 2YL5A 1BSIA 3B8VA 4GX9A 1W54A 4IMAA 5AC8A 1ECQA 3S83A 1EBHA 3QTPA 4KRTA 3UWEA 4CNUA 4W7UA 3C0JA 2NXIA 1BQCA 2W66A 2OWWA 1KTCA 5EA9A 1VBGA 3P62A 4CU6A 3S5ZA 3ANUA 3EGJA 2PWHA 1ADOA 4UCGA 3AXIA 1VB9A 1A4LA 4LVFA 4G6CA 1JFHA 4KW2A 3RGTA 1FP9A 3WD3A 1AVAA 2J7BA 3W37A 2DZAA 4MFDA 5EMYA 1ISZA 3PWIA 5DF0A 5LIXX 2BP1A 3I65A 3OIXA 3G6MA 2FZBA 2INEA 2RH9A 1BKHA 1W1A1 1NFBA 5K9XA 4P8UA 1PUDA 4GY1A 1FWSA 3DIPA 2EPOA 1KB3A 2IPFA 2YL6A 4HP5A 2VUYA 3ZQ9A 1DPMA 3HGRA 3UG5A 3S0CA 5I6SA 4YWIA 2HEJA 2W91A 1LWHA 1EJXC 5FESA 1IR2A 3VMPA 3HN3A 4AFYA 3SADA 4P5UA 2VI0A 2ON3A 4NAFA 4O8AA 3E0VA 1SR9A 4FEZA 3L4UA 5JU6A 4V27A 2G97A 3A9BA 3E5BA 1MI3A 1K02A 1AQFA 3L66A 4M5PA 1OCJA 3R7MA 1RA0A 5XIMA 3V4BA 2VFDA 2PTWA 4Y9MA 5H2ZA 3AIWA 3TLQA 1KRMA 1PX8A 3UVAA 4U2YA 3LN3A 2YXGA 1FWAC 1WXJA 2V69A 3PSVA 1X1OA 1XDMA 5CPTA 2HMCA 2A3CA 4GUHA 5A5WA 2RHGA 3GHUA 3SBFA 1K3UA 3G1SA 4RZ5A 4GUFA 3CS2A 3TW9A 4JHMA 3MDWA 3IV8A 4WX2A 4IFRA 3POHA 3GXDA 4KWVA 1VJZA 1IWBA 4YCPA 4DI9A 4JKLA 3W6MA 1EP2A 2DORA 3L0NA 4LY8A 1R5YA 1WE5A 1VIZA 3F5JA 4ACYA 1ICSA 1V5XA 2CEQA 3DERA 4U31A 3M0LA 1YNPA 1MUMA 5H1WA 5CG0A 1VFMA 1HKIA 1JZ5A 1HT6A 5IDIA 4MZYA 4MB4A 2NUXA 3T07A 3WQ5A 3MI6A 4UTTC 2PDGA 1TX2A 3LNMA 3QH2A 4N9EA 3ZR4A 3VUSA 1UOZA 3SGGA 4MHBA 4O1DA 1LROA 2OWCA 2HNEA 3DECA 1V4YA 5LA1A 3A4JA 4C6NA 3UZXA 3GG7A 3LQGA 2GJNA 5U7SA 1MUWA 2OB3A 4ADSA 3BCFA 5BOFA 4Y9PA 3HGOA 1HJQA 3AMKA 3CAVA 4HU8A 3M0ZA 1DEDA 1R3QA 3G77A 2POTA 1DE6A 5I77A 2XH7A 2Y2WA 3GTFA 3SN4A 1L2UA 1PO9A 3LB0A 4C6CA 1DJGA 1XLCA 4UTTA 1JAEA 5FL1A 1F6PA 1RLDA 4JYFA 5HNNA 3VM5A 3U48A 4D8AA 2A1YA 3O9NA 4A3HA 4C60A 2ZXBA 3O15A 4E4PA 2INFA 1GVOA 3QTGA 1DIEA 4MUPA 5ABEA 3WLPA 4JD4A 3O7UA 1K7XA 1J4EA 1M68A 3VKJA 2DZBA 3QKEA 4HNUA 5A8QA 1ZNNA 1E6ZA 4PTNA 3LUTA 4KCTA 3T8LA 3AICA 3D47A 4KEUA 2UWFA 3UXDA 4MY9A 2WC3A 4XZMX 3W7GA 1I75A 5I24A 4F2BA 1CEOA 1EX5A 5DY3A 1YYAA 2DUAA 2JIWA 4DUXA 4HNTA 3MHGA 1IWPA 1LUCB 3JU2A 3OW1A 3I3DA 9CGTA 2QW5A 2W92A 2Q8LA 3WH6A 2RDUA 1FXPA 1SFJA 3COTA 3W2UA 1VC4A 1R9XA 1F3XA 4WGXA 3QY7A 1EJ7L 2BHUA 1S2UA 1O5XA 1H4PA 2G0WA 3H7VA 4MJ4A 1F8IA 1T96A 5EMKA 3GXPA 5E9XA 1Z7AA 3C8NA 4DVOA 1M7XA 4JIIX 5GJMA 4ICCX 2QCCA 3CZKA 3VAVA 3VGDA 4YNGA 3ARXA 3G2GA 4GI8A 4LS1A 3Q45A 1C93A 4PMYA 4H3DA 1MYRA 3WF4A 2UY4A 4HKPA 1XDLA 4HPHA 3OLIA 3WSUA 3W74A 1VFLA 3S2MA 4WJEA 2FMOA 1UH4A 1K9TA 3B8TA 4JIEA 5I0DA 3LM3A 1H1ZA 3WNMA 5BXRA 3FLUA 1JZ3A 5LIUX 3VC6A 3E96A 1B9BA 2QKFA 3BGGA 4OUIA 3ARTA 4FLOA 3FKRA 3WDPP 3A21A 2NV1A 3SY8A 2CW6A 2HQAA 1S2VA 5FD0A 4NAEA 5FI8A 1G67A 3WH9A 1TQXA 1IV8A 3PZIA 1M53A 2V3GA 1CCWB 3BAJA 5BRBA 2WMGA 4BS0A 4GIRA 4JZ5A 2DZWA 2C79A 5IDZA 4DO4A 3LBOA 4L1XA 1GKPA 1Q65A 4FR1A 3QJAA 1ZALA 2QCLA 4W7WA 1GZ1A 1TE6A 1E0XA 3W70A 4NSBA 2C14A 5A6SA 1OCNA 3AIRA 3KBNA 5AZ0A 3UR7A 2YSWA 5LHEA 2HTMA 4XBSA 4WY0A 1Q8AA 4LEFA 1X6NA 2QULA 2Y6ZA 3VIJA 4PH6A 3SB0A 2C91A 2BOEX 3AIUA 1CB7B 3LPPA 1FA2A 2G3FA 2WVVA 1QPOA 1UWQA 1QWGA 3L4TA 4DWSC 2CPUA 1W31A 4Q4RA 3VIGA 3G3MA 1U1JA 4E2VA 2ZKMX 2CLEA 2NX9A 4QROA 1TWZA 2HVMA 1NWUA 2ZVRA 3I3BA 3JZEA 1R9YA 3QYQA 4B2DD 3VABA 1TMLA 2CERA 2BOFX 4DI8A 2WQPA 3AXXA 2J88A 3BGAA 3EX4A 1TA3A 3VIMA 1KRAC 4MWAD 1KO0A 4A35A 2EG8A 3C2VA 3CUHA 4PN2A 4ACZA 5LNWA 5G2IA 1J79A 3MC5A 1ZJBA 1ELSA 5CKSA 4IL2A 1T8QA 3F2DA 4FNSA 5KTLA 5T91A 5I3JA 1XIFA 5F4WA 2VZVA 3V16A 3BW4A 3NSMA 2A5HA 4O52A 3V36A 2X7WA 2BY0A 3JUGA 1TIWA 4MNJA 4B5TA 2CZDA 1SFSA 4RR4A 4L1GA 4ZB0A 2YXOA 4NNAA 3GG1A 3FNDA 2CHNA 4XV0A 3SQLA 2Y61A 1LBFA 2X8RA 1E6RA 3SZ8A 4GH3A 2BVWA 3C0LA 4B2DA 3ZJKA 4JYDA 4H41A 1FWCC 4FIQA 2OSWA 2JFEX 4GQGA 3DXIA 4MWAA 4LBRA 1H7RA 5IOBA 2HPMA 3LNPA 1OG0A 3GKAA 1LL4A 5LNSA 4FNRA 4JY8A 5GJNA 4H9UA 4LB4A 1JPHA 1UKOA 1YDOA 4GJIA 4FIRA 3GVWA 2MNRA 1TRIA 3STFA 2A79A 1IEWA 4L80A 3HZ3A 5F2IA 3I6EA 7ENLA 1YQ2A 3TLLA 1DVJA 2VFHA 4CCZA 5D8ZA 3UA3A 4JBRA 4FMVA 3WFAA 1AQ0A 1HF6A 4B3ZA 4A6GA 4V28A 8CGTA 1EHNA 1FKWA 4Z2KA 1D7KA 3GC5A 3BLIA 1UP2A 3MTWA 4HHLA 4I3GA 3ID7A 5BU9A 2WB5A 3QVQA 4L64A 1FWTA 3KOZA 4I7VA 1HP4A 3E74A 3UP8A 1G0CA 1H61A 3GXIA 1KRBC 1LOQA 1WA3A 1DQUA 1Z9AA 2OCZA 5DQPA 4N6EA 4MYXA 1C3FA 3BCDA 4A2SA 1W1B1 3BC9A 2UZ9A 4FAMA 5A6MA 1KFJA 1MDLA 1XV8A 4QCEA 3G0XA 3AAMA 1PZ0A 4ECLA 1UKTA 1EUAA 1WDQA 1I0BA 3P93A 3WQOA 2Z0IA 4Q3MA 3QZAA 1DWFM 3SR7A 3D6NA 4C6MA 2AOSA 2Y5JA 1QI3A 3PNZA 3T1GA 1ZAIA 4AY7A 3E6EA 1XYMA 1Z32X 1NWRA 1CWYA 2PD5A 3RDKA 4DM2A 2ASHA 1RAKA 3WCZA 2JF7A 4FA3A 3SURA 4PZVA 3NL5A 4O28A 2ACQA 1H5VA 2BXZA 3MHUA 3BLDA 2Z7GA 1V3LA 4QBXA 3PJXA 4F0RA 5EFFA 3B0YA 1H62A 5A94A 1RLCL 2E6FA 7PTDA 3BAWA 3MDUA 3QHNA 3ARQA 2FZ9A 1W3IA 1A5KC 2QHAA 1KWKA 2FZDA 2J6XA 4AD2A 3MUCA 2EBNA 4JEQA 2VC7A 1ONWA 3VKAA 1R0MA 4D6EA 5BWAA 1H1NA 1YKWA 4ZSTA 4MIMA 4IPJA 1XH1A 2A6NA 5IFPA 2FPTA 1PBGA 1Q6EA 2VZUA 1UQZA 1CGYA 4XVEA 1OYCA 3KBWA 4R33A 3UCDA 2ESCA 4UR7A 2CLOA 5AYBA 3PP7A 4NX0A 5HUOA 2E5BA 3CAKA 1XSIA 3B40A 2CETA 3AWNA 4AZ7A 2F7FA 2QUUA 1FTXA 1JQVA 2IPWA 1JRCA 1JI1A 2GUYA 2IPJA 5E9AA 2FZNA 3W6LA 4M51A 4F0LA 3U7BA 1EYEA 3LBCA 4N9CA 2XGBA 4Q33A 1FVPA 2V30A 1SQ7A 4R9XA 4Z2JA 1XGDA 1E55A 4O1EA 1TVLA 1SFTA 1TR1A 1LZOA 1XRVA 1Z89A 4AQLA 1SGJA 1R2TA 3UZ5A 1WKDA 1YBQA 2NQHA 4D6IA 4MPQA 1V0LA 4Q8OA 1VJSA 3SRHA 4PRTA 5BOOA 1JEZA 2VWTA 2ZRUA 3EKLA 1G6CA 4GFIA 3C86A 1QRQA 3K4DA 1OX6A 4HA1A 3VNJA 1HL8A 1K7FA 1PPIA 3NXLA 2ZADA 1AJZA 2CHRA 3E49A 1B2YA 5CXPA 3ZFHA 4JTEA 5LA2A 5D37A 3HGSA 2D20A 2UY5A 3KRSA 2TMDA 1GVIA 3VOGA 2RUSA 4OVXA 2VR5A 4IISA 1RJQA 3H2EA 3KL0A 4W5ZA 2DU2A 2OEJA 1S2AA 2H8XA 2ZA1A 2QCMA 3T40A 3SY1A 2A21A 4PSRA 3W26A 2Q02A 3EWWA 4DO5A 2AAAA 3RJXA 1E0TA 4AHOA 3FYOA 2A0NA 3WQGA 3EX2A 4JL1A 4CKQA 3WEZA 4L1WA 4EPEC 4F9JA 4DYKA 4EACA 2BGQA 2O7QA 3HIJA 3PBUA 2PTZA 2WNNA 1GNXA 1DYSA 2E7FA 4K7YA 1I2QA 4ALDA 2AQVA 3DUGA 7XIMA 2DSWA 1GJWA 2WZEA 3PZQA 5G5IA 1QPKA 4JTLA 1NP2A 3CC1A 4MDPA 4WLCA 1WZMA 4TMCA 2BZNA 3BOFA 1MEHA 3NL2A 1QOPA 4C1NB 5HBFA 3HTWA 4J35A 4UCFA 4MPKA 1XLBA 2DSZA 2QCDB 1EA9C 1V93A 4MOZA 3VMOA 1E9YB 2BX7A 1K8CA 4Y6GA 3TSDA 1UR3M 3WF3A 1YLVA 5A2CA 4U5IA 1UBPC 3G1FA 5FA5A 1WXZA 2WHJA 3DGBA 1TV4A 1VFOA 3HU7A 1QK2A 3TONA 2VM8A 5HMEA 4MLJA 2AL2A 4UTUA 3SJ3A 2IXUA 1GGOA 4WOQA 4ADTA 5CJMA 5BYWA 4OZOA 5H91A 3M6YA 1U33A 1IXPA 1OX4A 3ALFA 3H4GA 3WL0A 1GKQA 5AC4A 3WDJA 1GK8A 1T99A 2ISWA 2WO5A 3IK2A 2BXYA 4BJHA 3ZXWA 4AMAA 1QI5A 2Y7EA 1MZHA 1FWRA 2J4GA 4NP7A 3VX0A 2OWXA 7CGTA 5DCDA 4GKLA 2FGLA 2FZMA 2WMIB 3REQA 3SCTA 2Z25A 1RD5A 4M82A 2Y4SA 4JYEA 2XWEA 3PJTA 3BV4A 4CNOA 1TPH1 3RCMA 1IEXA 3TTOA 1UP3A 2VVSA 1V6YA 3AYRA 2WJDA 1H63A 3VA8A 1CZ1A 5F1UA 4NX5A 4ZOCA 1E1FA 1B3VA 3GG8A 4HSOA 1EZ2A 3UVIA 5SWUA 1A5OC 3WMCA 5H8PA 1UHVA 3W7MA 3TIMA 1Z8AA 4JN7A 3H2OA 3W82A 3CYVA 5IFTA 4NJHA 3RU6A 3CT2A 3TSMA 2PLCA 4AZCB 5A2AA 2KAUC 1KCKA 5BMXA 3L4VA 3V35A 3RK8A 1JCNA 1L2QA 2XN2A 3B97A 3N25A 2WC7A 4K37A 2HZGA 4IJCA 3L4ZA 3P7YA 3TNBA 3R2GA 3HF3A 1G69A 2WJEA 3LCXA 2G37A 2QJIA 5BCAA 4PGLA 4Q7NA 3GUGA 1BPLB 1LOLA 1GTEA 1RQHA 5HOSA 1WDDA 3R6IA 4JY9A 3NZRA 3C2OA 3MO4A 3LCLA 4XAPA 3NSNA 3UD6A 2GPTA 4ERIA 1UR8A 4HT3A 4PMVA 5A6JA 3DN5A 4MDOA 3BURA 4CCEA 4I8DA 3FA4A 1F3EA 4NKCA 4CQDA 3MWAA 4ZA0A 1G4PA 4E8GA 4LNCA 1FDJA 1NOWA 4O50A 3NQ6A 3N14A 2QCFA 2Z1SA 3NPVA 2VGGA 2DW7A 3FX4A 4J3VA 2QF8A 3THDA 4PBGA 4I9MA 2QPSA 3LU2A 1Z48A 1IEIA 2Y63A 3VKBA 2GFTA 2VHLA 2YR1A 1LBLA 2J27A 4IZGA 1NFPA 3NEHA 3KL3A 3DFPA 4IIHA 2EQDA 1E72M 1XH0A 3S6DA 4C6EA 1JD7A 4S3EA 1Q7MA 3URAA 2OODA 4RW3A 2A3BA 1Y0EA 2YDAA 1VKFA 3DGRA 1W9PA 1DQXA 4UXDA 3GAKA 3C2EA 1W9DM 2DJLA 4GNKB 4N9DA 4QQ3A 3M4HA 1GTHA 1PAMA 5A6LA 4A29A 3B9NA 1QO5A 4UOQA 1NDYA 1XKJA 2XFYA 2ZTJA 3E12A 4K1WA 3CIWA 3CXOA 2XHYA 2YA0A 2CZVA 1DP0A 4S3KA 4WF7A 3ONBA 3GB6A 1PWLA 5T26A 3SFKA 3GH7A 3ZT6A 2OEKA 1I6NA 1JF6A 2PTXA 1LRNA 4M8UA 5G1YA 4E2DA 3ARWA 1UWSA 4X9YA 1RVKA 2FFCA 2NZLA 4FR6A 3CT7A 3MW7A 2E5DA 5DCEA 4XX6A 2XYLA 2XM1A 2WPGA 4HSNA 4A3RA 4WKHA 4AVOA 3EWZA 3CV7A 3AZRA 5MKGB 1UC4A 2PI6A 3V0UA 3MSYA 2VZSA 1J0ZA 3GRIA 3AYTA 3QFWA 2VZTA 3BMVA 1E3XA 3C0QA 3DFHA 3GAYA 4F48A 3FK4A 1IIGA 3DU0A 4L9XA 4HTBA 4WVXA 2NQZA 2W0UA 4W8BA 4LT9A 2VT0A 3FDKA 4U3CA 1FWEC 4A3YA 4UQBA 1T6MA 3KBMA 4IGSA 3V7PA 1X8FA 4J27A 3F2CA 3VDAA 3T0AA 2C0AA 1K9EA 3N9RA 4S23A 3CHFA 3MSGA 2NUWA 3NR0A 4RDVA 1ZTVA 3G1AA 4HYWA 4DYEA 2JGQA 4WY0F 3WQ4A 3IIPA 4PCSA 4MY1A 1ADDA 3P74A 4OFCA 1M7JA 1VYRA 4GH1A 3T78A 1JD9A 3EOSA 1AH3A 3IV3A 5B80A 4WJ8A 1F7BA 1TWIA 2PD9A 4QDMA 9RUBA 4RNFA 4W93A 2R24A 4C6OA 3M41A 3ZSSA 4RE4A 4POCA 3GNRA 3R4IA 3LY0A 3S1UA 1B3ZA 1H0GA 4MJZA 4PMUA 5CAHA 3M9YA 2Z27A 4IJBA 2QUVA 1B30A 4AHQA 4P2VA 4US6A 4HA0A 1LUCA 2Z29A 3I3EA 1KGWA 3WJSA 1XIHA 5D05A 4BR1A 1UR0A 3I4EA 5J5DA 3W73A 1EKOA 3VO0A 1ZS2A 4M6QA 4MWAE 1UJQA 3IUHA 4NUWA 4DO6A 2E6DA 2OZTA 3EWYA 9XIMA 3A5FA 4AVFA 2D0GA 3R43A 1XCXA 1E0VA 1FH9A 1XH2A 3TP4A 3N15A 2MUCA 1DXFA 4HJFA 4KEMA 1SJDA 2CWXA 1TTJA 4LC6A 5C54A 1H7WA 3D0CA 4L6DA 1DWJM 2DVTA 3FAXA 5CC3A 2WZMA 1H60A 1Q2RA 1JPIA 4RW5A 2QUTA 1XICA 3V1PA 2W9MA 4GNVA 3IRDA 2VQUA 4ZB5A 4S3GA 4XISA 1YPIA 2R94A 3B8SA 4ZB2A 3QQ1A 4DQWA 1IWAA 4TV6A 4JTRA 4LW7A 3SRFA 1B3XA 2ZX5A 1UASA 4WQ6A 4M7SA 4OT7A 1F76A 1EC9A 4YLWA 3CH0A 3BXWA 1MW2A 1Y5WA 3LENA 2WCAA 5EMLA 1WBJA 5F2MA 1M41A 3P60A 3ENLA 3EX1A 3WLIA 3BTNA 4DZIA 4IGHA 4P61A 2ZZ5A 4INFA 1EEXA 5I78A 2OMAA 4L4OA 1A53A 2NWSA 3C2FA 3CZLA 2ZCGA 3NL3A 3S47A 1A49A 2WM1A 4Q7BA 3FXYA 4WXYA 2QXWA 1ITXA 1AW1A 1R8LA 3U3HA 1CGTA 3L21A 1XRSA 1L6WA 3N9SA 1ADSA 4QIUA 1GKRA 4WR3A 1W5PA 4E3TA 3N2OA 2GVGA 3I10A 5EBUA 3LCWA 3LCHA 4NZ3A 4YHEA 1TPC1 3AJXA 4NIRA 3TC7A 3H55A 4CN4A 1C9DA 3UYCA 5FF0A 1X8CA 2GGEA 2XIOA 3PS7A 4X3ZA 3R8RA 5EBAA 5CPSA 2ZDSA 1KR0A 4DAFA 1TTIA 2OX1A 3ZT5A 3W83A 1S38A 1K8ZA 3B3DA 6XIMA 4HU4A 2EPKX 3NQ8A 4IPNB 1SZEA 3KXQA 1QMLA 2OELA 1QJWA 3TR2A 5HQEA 3M07A 4FF5A 4LQ1A 5T9BG 5CCZA 2D3LA 1ISWA 5FF7A 5C7VA 4H8HA 1EFZA 4X0VA 2WCSA 4BCEA 3OZMA 4GK8A 3GO2A 4YTUA 2HV5A 1EJWC 1O1HA 4A8LA 3KWSA 2R91A 3MHFA 4GUIA 4E5TA 4LAUA 5CBIA 1UWAA 2I5IA 4XZHA 1X97A 1CI1A 3W1NA 2G96A 2GSJA 5AZ1A 5C9WA 1LDCA 2Q01A 3CZ8A 1FRBA 2AKZA 1OFRA 3MP4A 4TU1A 2QJHA 4WJXA 1I1WA 1IGSA 3MY9A 4L4LA 2H3BA 3EDFA 3ME3A 3CUIA 5LNUA 4PBEA 3NSXA 1B9ZA 4BKNA 5F4XA 1GOQA 1BQGA 1W5OA 4Q6XA 1VYSX 5I7GA 3W7EA 2AQOA 2RKXA 3C56A 4AWUA 2C8NA 2V8ZA 2NLYA 4ASTA 2QMJA 2C0HA 1KFWA 4UBPC 1EEPA 3UETA 4HZ7A 3VVGA 4DBSA 3G1YA 1TVPA 2ZXQA 2EKCA 4M24A 5D4YA 3U5UA 1GVFA 1UKQA 1L8NA 3L2MA 1H1YA 3A3XA 3U6WA 4HNVA 2HBXA 3KBVA 1T5AA 3VD3A 2OU4A 5EL1A 2ZA2A 4ZQPA 3WK0A 3BANA 4EX4A 4ADUA 4L6HA 3CQIA 3H21A 3TYCA 4AISA 3R13A 1DXEA 4QEEA 3ITVA 4HOWA 3WH8A 1G4TA 3IACA 1ZENA 4BI7A 3L65A 2Z26A 1FHUA 3M0VA 1ZLPA 3TROA 4Y7EA 1TREA 1GYMA 4JFTA 1O5KA 1XLIA 5E6YA 2C1GA 2WSYA 1VIWA 3MKVA 8RUCA 1CXEA 1J0KA 1N8FA 2GWGA 4O4VA 2G5WA 3N9KA 1VCVA 1EP3A 5CZJA 1GW1A 3W2NA 3PZMA 3QZ6A 1VCGA 4IF2A 3EOLA 3WKZA 2BGNE 1KXVA 3UWVA 3VGFA 4C6PA 2V81A 3BAXA 4JX4A 3W72A 5FF3A 4PB4A 3W9ZA 1F07A 4LAZA 2P0OA 4KIRA 4JFSA 2QV5A 3EPMA 4JTDA 3AIVA 2X1IA 3AIBA 3W1TA 2JE8A 2XPKA 4D8ZA 4JIPA 4XD3A 3JRKA 4F0MA 1E1CA 4XIAA 4F3HA 3OZOA 1JCYA 4AD5A 2E0PA 2Q09A 4HK5A 4J3WA 5D2WA 4YVVA 3LX9A 1TELA 2XZ7A 3BVJA 4CEXC 4S3JA 1FH8A 5C5YA 1PTDA 4JX6A 1NP0A 2GSHA 1UKPA 3GFZA 3MCNA 3DFTA 3DYMA 3L0GA 1NM9A 5EPDA 1QPNA 4CD5A 4HIBA 3HPXA 1DHKA 2TODA 5XIAA 2V2HA 4H8VA 3R1ZA 1W56A 2A6LA 3GZ3A 4M80A 4G7EB 4WIWA 1F5ZA 2FTYA 3M16A 4AWTA 3VI2A 5I3IA 1MRQA 3W1RA 1BKSA 1M04A 1JF5A 3TFXA 3BJFA 3FEMA 2DV0A 4KWUA 4C1LA 1VFUA 2X1SA 5I3FA 4B16A 2KX9A 1LYXA 1I2NA 2W27A 4MB1A 4KQNA 1F6KA 3W1UA 1EIXA 3FCPA 3PG9A 3O0FA 3CUZA 3U5YA 1TR9A 2QLYA 4D6DA 1CGVA 1WDRA 4M19A 3KP1A 3HG5A 3FN9A 1QT1A 1WP6A 3B8WA 1C29A 1L6FA 1A0DA 1EB3A 1MQPA 1J10A 2OQLA 3H4XA 4HN8A 3ARUA 1OZQA 3BMWA 1SW3A 2I5QA 4RPPA 2VTFA 4URIA 5LGXA 4JN8A 3GE7A 2OSYA 1H3GA 3WEOA 4FOKA 2E9LA 4GC3A 3VINA 4NL1A 3TZNA 4W88A 1DJHA 1XBYA 4K68A 3G0UA 2ZRWA 4QSFA 2ZUNA 1FWBC 1NQ6A 4QXIA 2QNEA 2XG9A 3ARZA 4IMDA 1UPPA 3HFTA 3UNTA 5BWFA 3W7HA 3GYCA 4IP5A 2V5CA 2J7EA 4ZODA 1CGWA 5C8BB 5FEWA 3TZFA 5A8NA 2J66A 2Z2UA 3GW3A 4BZYA 3N4EA 1WAUA 4CVWA 3O16A 4W8AA 1XQKA 3NQVA 4X63A 3B4YA 2DT1A 5D9MA 1GZGA 3F4DA 4D8LA 3RXZA 1EGMA 1H7XA 4KWOA 1QCWA 1M7OA 3M5ZA 3JW7A 4JQ1A 2V5JA 2O7SA 3CO8A 4MG4A 4B5XA 1JCXA 3CAWA 4GNJA 1HKKA 1SW7A 3HG2A 1D9EA 3OZYA 1A0EA 2NQLA 5TBOA 4PCTA 3UZJA 4MF4A 1YRRA 1AD4A 4EP8C 3POCA 4KWSA 4V1XA 4MAVA 1XR2A 2P8CA 5EFDA 2OFJA 3AHTA 4G8TA 4MM1A 3TR9A 4R88A 5I5RA 1E6SM 5PTDA 1MW3A 1BF6A 2DUZA 2ICSA 2H9AB 3CMGA 3ICJA 3LZ5A 5FAJA 3UGRA 4CCCA 3VZYA 1E4MM 1U5VA 3NO3A 1UD2A 3RM4A 3LM7A 4JQ2A 5DMLA 1L0PA 1YTDA 4NY2A 3L0KA 4UQAA 4C1NA 4Z42C 1HTIA 3PAJA 3VOJA 3TE9A 4LS0A 1AODA 2QCDA 3NOEA 4EWND 4YTQA 1H49A 3WF0A 4Q32A 4PUJA 4AXNA 4OKDA 3T6CA 4XWUA 5CBJA 3UYIA 5EY5A 1P0DA 2DSVA 2Y85A 3FV9A 3AU2A 2ZUSA 4G7FA 2GGGA 3SJNA 4S39A 2J24A 2INZA 3CQKA 3WH7A 1VBHA 1HJVA 3G22A 1RA5A 4K8EA 2YBVA 1R3RA 5HMFA 2OYMA 4PUKA 4KCUA 4XG1A 3T0TA 3HFYA 1JPKA 2QJGA 4BF9A 3ABXA 1BLIA 3FJNA 1YTEA 3HJZA 3RLHA 3V5OA 2FJUB 3SECA 4GQQA 5I79A 3SAZA 4LF2A 1GWJA 2HXTA 2O92A 5LIWX 3STCA 1LG1A 3KHJA 1OK4A 4IQJA 2CKSA 2R1KA 4LBSA 2RDWA 2WMIA 2GVEA 3O6AA 2OLSA 4LC8A 3WMBA 2PDBA 4ENLA 3VNDA 4AYSA 4JTFA 4N0RA 5E93A 3BQ5A 2QS8A 3RYSA 2NSOA 1KCXA 3F5KA 4S3FA 4MY8A 4BA0A 3DI0A 3DFOA 2VEMA 4DY1A 3TUUA 4D9PA 3ZVHB 4DJFC 1PJ9A 3PTQA 4DJFD 3OYZA 1P6WA 1NF0A 4C65A 3M0IA 2OQYA 3Q67A 1ZBWA 4AUBA 4HNLA 4C6JA 3A4AA 1KM6A 3TCEA 1WX0A 4XO7A 3FJ4A 2FH6A 1YIXA 4JTSA 1NJJA 4R7JA 3AOFA 2QT3A 3CO4A 4AZCA 3KHDA 1FUYA 3S8HA 4IMGA 3ORWA 3KUMA 4Q8QA 1U1HA 1ICPA 3R25A 1DTUA 2YL9A 1OCQA 3IUDA 2ZXDA 3VM7A 3DYOA 3E2QA 1F9CA 3NZ1A 1W9UA 4A8NA 1MNZA 2FH8A 2I5GA 2ZWZA 3RX3A 4DJFA 1FCQA 2P3EA 3OA5A 4GA8A 3KTXA 1J11A 3OZPA 4WGHA 5BRQA 3GVVA 2J9XA 3SCVA 3N3TA 1GONA 4MJ2A 3MANA 4MADA 4IJRA 3MMTA 1KFEA 1R87A 3QY6A 5TF0A 1GVYA 3QLDA 2EJ1A 3KOYA 3WY1A 4IP4A 4AZ5A 4LYKA 1IIHA 1NY1A 1UD4A 1MEIA 1O68A 2CWNA 1A5AA 2BHZA 2OYKA 1TWSA 3NZPA 1GVRA 3LRMA 1SSDA 2V3EA 4J3TA 1AMYA 4R5EA 1B54A 1V08A 3BJSA 2Z28A 1KCZA 4WDWA 3S46A 3CV2A 1BWLA 3U2EA 1H7PA 2BASA 4FLSA 2DH3A 5I00A 5HMDA 1MDRA 3OQEA 4PTVA 1F74A 2NV2A 2I17A 3BZGA 3BSHA 3AS3A 3MMDA 1UA3A 6ENLA 5DN1A 1LL7A 4GYPA 3R12A 3A64A 1G7VA 3CM4A 2YOCA 3GKFA 1K1DA 1VEPA 4YTTA 4WCJA 3H2NA 1LG2A 3V5FA 1UD5A 2XVGA 4ZO7A 3S9YA 3IVSA 1OFAA 2PURA 3M7WA 4N4PA 3QQ0A 1BG9A 3R11A 3WK2A 3RITA 2P1FA 4LU0A 4NXSA 4E3VA 1DE5A 2C71A 2PDFA 2W3ZA 4E4UA 3P5YA 4FALA 1AH0A 4OE7A 4B5WA 4ZQMA 1GG1A 3RRAA 1U1UA 2OVLA 3PPHA 4NRRA 1R3WA 2P53A 3DX5A 3VX1A 3W7IA 3HV8A 4D6CA 2HNHA 3PPCA 1OYBA 5HAOA 1E56A 3VZZA 3DH7A 2A2IA 2DW6A 3EPNA 4DIAA 5HR7A 3NDYA 3WF2A 1OB0A 3QZEA 3PTMA 2VFEA 3LV5A 4IL0A 3NJ3A 1IHIA 3GBEA 4JDBA 3MMUA 4CQBA 3DHDA 2GUUA 1RY0A 3LGEA 3QHMA 4NASA 5MKGA 1K7EA 1K4GA 4DWSB 3W1AA 3WN6A 3T0BA 1AJ0A 3FYPA 3S1XA 3S2JA 5LGZA 4E6MA 3GHRA 2G4FA 2FQIA 5LHFA 3VFLA 2ISDA 1AG1O 2ZIDA 1VFHA 4H2HA 1YTKA 1XX1A 3WMSA 3E1F1 2PP3A 4J2PA 3FJ6A 1UWUA 3L2LA 1V02A 3NQMA 4QGCA 3YPIA 3SUUA 4F2UA 3U7VA 1JPDX 1DOSA 4BK9A 4KGJA 2OOFA 1X7FA 3IIXA 3BK0A 4ML4A 4IT1A 4C6QA 4H9VA 3CPGA 2UBPC 5K9DA 3THUA 3S5NA 4F40A 2PA6A 4REQA 1V77A 3U2OA 2XGIA 1F05A 4IICA 2VR4A 3G1HA 3AMLA 3QMRA 2VX7A 3TH6A 2OT0A 5LSMA 5AB3A 1RP8A 4LH8A 3ZJ7A 1WAWA 1Z41A 4EF8A 1A5LC 2J9YA 2BNJA 4US5D 4K2SA 1J12A 3F4WA 4KRZA 2FHFA 1XYAA 1K4HA 3T2PA 4TVCA 5BRPA 3N18A 3MA8A 1EJSC 2VDHA 4UFKA 1XLDA 4HB7A 1QNOA 1LORA 3ES7A 3PFMA 2EGZA 1A80A 4AX6A 5KZ6A 4DNMA 1AUSL 2VFIA 2E6AA 4XKMA 3LGGA 1CECA 1W5MA 3GC4A 2CYGA 1ESWA 4DBUA 4DJDC 4DJDD 4CQ8A 2DFAA 5E0CA 3VTRA 3TN4A 1FWNA 2ZRVA 1A5UA 3QOMA 3I7QA 1XXXA 4IUGA 1ZSXA 3NZGA 4QR6A 4UTFA 3LCIA 2XVLA 2ZUMA 2CXEA 5K7JA 3LLFA 2WSPA 1AQHA 4H9XA 2GOKA 3VIIA 1P6BA 2Z00A 4J9JA 4US5A 1PXGA 2X0YA 1POKA 1ME7A 5JVLA 1KTNA 2PU0A 2CLKA 4Q8PA 3GHTA 3BG5A 2I56A 1JJKA 4ZQRA 4GY7A 1ZPTA 2WV8A 3WJXA 2WHLA 3MJMA 3TN5A 1B3OA 1DJNA 1VBJA 1XFCA 4JL2A 2Z4GA 3HPAA 1FWHC 1Q6OA 4DJDA 3PJWA 4L65A 1HKVA 1XBZA 1KFKA 3C0SA 3BW3A 3MYOA 2E9BA 3GDBA 4KRUA 2PPGA 2B4GA 5E0FA 1FFRA 2PRLA 4TO8A 3ZLFA 1EWEA 3S6OA 4LVDA 4XZNX 3LV6A 3S42A 3L4YA 2E1WA 3QR3A 3H2FA 3A4WA 4F0KA 3AUOA 1BYBA 3HV9A 1PIGA 1FCBA 2ZC8A 4LYPA 4CUCA 3N34A 1XGZA 2WLZA 3PR2A 2B7QA 1HN1A 2HRWA 1KFBA 4W4QA 2IPGA 5E70A 1OBAA 1W17A 1AQMA 4LAMA 3WUBA 3NWRA 3WQCA 3WD4A 1FDZA 2J25A 4GQRA 1E73M 3IUIA 1OZMA 1BYDA 4UR8A 1Q3NA 4B90A 1RK6A 2PWUA 3USBA 1CXIA 1JZ6A 3CIXA 3F4NA 1UWIA 3CWHA 1C90A 3CUFA 2YGYA 2D23A 1GYLA 1R30A 3CV1A 3B0UX 1B1YA 2HXUA 5FEZA 2WKJA 2P5NA 3N2BA 3QEZA 3PAOA 3VGGA 2GK1B 1YNYA 3BARA 5TAOA 1OF8A 4LRTA 5CPQA 2QUNA 2OEMA 5K3VA 1QHPA 3TU9A 4DPPA 3TNOA 4H04A 4QDPA 2PWGA 4AAJA 1UZ1A 1CBGA 1MQRA 2PTYA 2HVOA 5CAKA 1VFSA 1EO7A 3IEBA 1OK6A 2DSUA 5C7HA 1K03A 4QG9A 1GT8A 5JIPA 1EF2A 1POJA 1SJBA 3IGXA 2HK0A 3WQVA 4ILSA 3VGHA 3L5AA 3OBAA 3K8MA 2OQHA 1UR4A 1P0KA 3WL1A 2PDYA 2B0MA 2CLIA 2HPIA 1OG6A 2V5DA 3KZSA 3OBEA 4P7OA 2NVCA 1XYCA 1P0NA 3P5ZA 2VUNA 5JMUA 3FSUA 1WDPA 4DJEC 1Q4NX 4AD3A 3CIVA 3UPWA 3LSBA 1M01A 4NJIA 3TCSA 5FF4A 1RP9A 3VKCA 1QUMA 3SM0A 2YXXA 1SO5A 1IR1A 2DPEA 1TO3A 4DO7A 5GNYA 1XIIA 3UG4A 1C8QA 5CJNA 1W37A 5CH9A 4LYQA 4E4FA 1A4MA 1V7YA 2VZOA 1XWYA 1BXNA 4DAIA 1RALA 1XLLA 1HKJA 1KR1A 3CMFA 4DZ5A 1A5NC 1ENUA 2FVLA 1R85A 4D6JA 2PGEA 4EIVA 5KMYA 5C0QA 3VU2A 3SO7A 3GDLA 3VPLA 2I57A 3F1QA 3MO7A 4DNHA 1NH6A 1T41A 5K9CA 4ZXLA 4RDZA 5C2GA 3KLKA 3M47A 4Q8NA 3URBA 1KBBA 3CASA 5D33A 1WBHA 3TYZA 4ROPA 4JTAA 2H6RA 1GW9A 1UMYA 2XDFA 3UGVA 1A5CA 4A8IA 4WRHA 4JIRA 2YDRA 3WD0A 2E3ZA 4LUSB 3TK7A 2UY2A 2PDPA 3BAKA 4L6OA 1DJWA 3LTYA 4XO6A 1LF1A 2IXVA 3FKKA 4FPSA 3W7OA 3ABSA 1AK5A 1GOIA 4IX2A 4W86A 3L5MA 4I90A 1V6VA 1SZFA 1QW7A 3KCJA 2W62A 2OGJA 3TXVA 3WK3A 2EPMX 1TE1A 1HJXA 3C52A 3AWOA 2B7NA 1JVNA 3ONCA 3MJYA 3TC6A 3TA9A 1IT8A 2FGBA 1PZ3A 1NTHA 3LHZA 6TAAA 1EDTA 4KWWA 2VOMA 1UR2A 4BWLA 1MXSA 1OEPA 1PIIA 4PSPA 1YHTA 3M0HA 3CHVA 4PMOA 1XIDA 4R7OA 4LVGA 1A3WA 3TJXA 4YVPA 2HK1A 5HJXA 1AZ2A 3EDKA 4NU7A 3SCOA 2XVPA 2Y5EA 2X42A 3I6RA 1BVWA 1ITUA 4G2DA 5M5DA 2IS7A 1W1ZA 1Y5XA 5G4EA 2R82A 1ZY9A 2NQ5A 1KKOA 5HANA 4FB7A 1OFQA 4JN6A 5FJIA 2YZRA 2ZZ2A 1XIJA 2WNWA 2YCEA 3IS4A 1U5JA 1TJ2A 2W61A 2RJHA 3IAPA 3QC0A 4V15A 3H23A 4C6LA 2VDIA 3AS2A 4PC8A 4D6HA 3CUJA 4KFNA 2GVJA 1XLKA 4QRNA 3TTQA 3DESA 3TOPA 2JQXA 4ERGA 3QR1A 4GG9A 5CPOA 1I45A 4QE4A 4UMCA 3M43A 1Z3NA 5BNKA 4GIAA 5FJJA 1F73A 3VOHA 3IIVA 4NNBA 4J2MA 4DXKA 2WZIA 2JKPA 3M5XA 4GBUA 1FXQA 2AMXA 2NLIA 2QF7A 4G7EA 2VEKA 1LWJA 3A24A 2BWGA 4EAYA 1R46A 3NA8A 1WDSA 1XJBA 1OGBA 1J5TA 3OB8A 3M44A 2VO5A 3EWDA 3LERA 3QFEA 1R38A 1XIMA 4OBTA 4AY1A 1AA1B 3AU6A 4XTIA 2TSYA 3NOYA 1PX4A 2VCBA 1ZJHA 4IH3A 5CQ1A 4MFEA 3SRDA 4YIWA 1YPXA 3HPFA 2Y7FA 3IJQA 3K2GA 4B15A 2YYTA 1JG9A 1TJ1A 4UB9A 3UJSA 2NX3A 4AZHA 2V3FA 4LX4A 2X2YA 5FF2A 3R94A 3MKKA 3CEUA 2O0TA 3FHAA 3MQTA 5DO8A 3M0MA 1JYNA 4DEFA 5KZMA 3WQ8A 4A2RA 4ZFMA 2DT3A 4P8VA 1XYLA 1P4CA 1OY0A 4IPLA 4UTLA 2ZE0A 4MGGA 4XZBA 1QO2A 2ZWYA 2DDXA 3QC3A 4O1FA 4L5ZA 3RR4A 3EZ4A 2E8YA 4K1GA 1A5SA 1I0DA 2A3AA 3P61A 2Q3RA 1NDWA 2FTPA 5KSWA 4PTMA 4XBKA 3LHVA 4GZEA 5K2ZA 4J3XA 1XYBA 3DAQA 3THAA 4BF7A 3E0WA 5LYRA 4GYKA 1ZL1A 1WUFA 1US2A 1O95A 1XUZA 1GOMA 1R7AA 3TWBA 1RQEA 4N6FA 3DG3A 4F0HA 3PZ9A 1OT1A 4TV5A 2NVDA 2FVKA 4OJYA 4UTHA 2CZFA 4QFUA 3J7HA 1R2SA 1AZ1A 4JFWA 3U2ZA 2VGIA 4ZQOA 3TFCA 3KBSA 4TX9A 1Z44A 4XAZA 4FLQA 5RUBA 3BZJA 3IIOA 3NZQA 2H9AA 3R0UA 3NGFA 3R0KA 2FPVA 2VENA 3G24A 1EC8A 1KXHA 1UROA 3GNXA 5D09A 3L7RA 3SCRA 4W84A 1GPFA 1HKMA 3PSWA 2GUBA 4LOCA 1A47A 2DVXA 4XSLA 4C7FA 3NIYA 3S6TA 4PUWA 3RAOA 3L12A 3RJYA 2V5BA 1NARA 4WDUA 4RCXA 3FS2A 3PTKA 4EPBC 5A6KA 1MXDA 1PVNA 4OBRA 4YS1A 2WSQA 3EEGA 4P8XA 3NO5A 3H2AA 2J77A 3A3HA 3PUOA 2QIIA 2ZZ6A 1QW8A 1XCWA 2GGJA 1XD1A 3TTYA 3ZT7A 3TQPA 1XFBA 2YA2A 3II1A 3LQLA 1N82A 4UFIA 2VR2A 4FI4A 1KM3A 3CK5A 4QE5A 4I9JA 1PZ1A 1NF7A 4WKFA 1RV8A 2ZC1A 3FDGA 4CNTA 1ZAJA 2V63A 1LL6A 2I1OA 4CNSA 3BSGA 2XVNA 5ENLA 4XAGA 1X38A 3H24A 4JS3A 3AFBA 1JDEA 2YCIX 5KZEA 1S5VA 2VCAA 2WMFA 1E9IA 1S2CA 2HJPA 4HMEA 4LWWA 5AC6A 4JGDA 1UUOA 2EPHA 3DENA 1BGAA 1HQTA 5LIYX 5ABFB 2YL8A 5DX7A 1IXQA 4Z1CA 1FFQA 2G3NA 5FL0A 3VCRA 4OBSA 3A22A 1UH3A 4Q7IA 2WKGA 4QJ5B 3SW6A 1GZJA 4HHMA 1EYWA 3QV6A 1ITCA 1HFBA 2F6KA 3GNPA 5LIKX 4XUYA 5DLCA 1LOSA 1X1ZA 3ZVHA 1TPVA 3LS9A 4GABA 1CX9A 5E6ZA 2C7FA 1V02E 1XF0A 1SMDA 4ZQNA 1FCVA 1GOWA 4UC5A 4ICMA 3PZUA 4KGLA 2X09A 4Z2GA 4HZ6A 3B0VC 1UD8A 3O63A 4K39A 3ITCA 2B31A 4JTGA 5CLTA 5D9PA 3LHUA 3OODA 1W3TA 1NWSA 3AYVA 3SCNA 3N29A 4LYRA 2WK2A 1J0HA 3KS5A 3KCLA 1OD8A 1XLAA 2IKHA 4UTJA 1GHRA 1PTGA 1ZBCA 4XIMA 3CHDA 1LQ0A 1ZJIA 3S1VA 1QPQA 1HKWA 4GGHA 4TX8A 2VC9A 4JAWA 4YYFA 2ADAA 2TYSA 3W27A 3RX4A 4ICNA 5CZTA 1WCGA 4IQLA 1XSKA 4CD6A 4RJEA 4IIGA 1HXJA 2PLKA 2J7DA 4LJ3A 3WELA 4JQ4A 3OOQA 2PODA 5C70A 1WUEA 4A22A 2QCHA 3IVTA 4IPIA 1QI2A 2CBVA 3AS1A 3TJLA 4LEQA 3IPWA 2HE8A 1TPUA 4C1KA 1H0IA 2P3ZA 4PMRA 1EGVA 1TRDA 5BXTA 4RZ6A 3UU0A 5DELA 2J6VA 1CENA 1I60A 2PDNA 2XFRA 3TN3A 1OGGA 3OGVA 1VHNA 3LHTA 4UFLA 1V51A 3WUGA 4HD5A 4ZVJA 4C6DA 3EWCA 1TZ7A 4RNHA 1O60A 1OJXA 1WPCA 5I3GA 4XAFA 3PG8A 4C5YA 3TTEA 1B4EA 4XD4A 3WO8A 1YEYA 1DORA 4PL2A 1XPYA 4PUUA 4W7VA 1BXBA 4Y8FA 4D1JA 3TW6A 2FB2A 5CG7A 1OM0A 3A5VA 1GCYA 1OWQA 3LXCA 3N4AA 4HOXA 5DMMA 1OFEA 3JZUA 3QHOA 3G0SA 4NJJA 4QG8A 4DWSD 2OJPA 1TQJA 1IF2A 2A3HA 2PWDA 2ZX7A 1JDDA 1Q6CA 4DRSA 1HO1A 3EOEA 4HHPA 3NXFA 4UQCA 1A3HA 1VHCA 2AL1A 1S46A 1DBTA 2PMQA 1GOXA 2ZOXA 4M29A 4H9MA 3LEPA 2VURA 3WQDA 4CN1A 3PBWA 2PDLA 2YA1A 3N6JA 5I02A 5LNRA 1H50A 3RHGA 5EYWA 2V9DA 4NI3A 2QJJA 2E6YA 4ZMGA 4DWSA 3E02A 4I9TA 4QLLA 1XBXA 4WHBA 1V3IA 3TW7A 5HPCA 1H7NA 1TMQA 3KBJA 1K70A 2VFGA 4RUBA 3KRZA 1X6LA 1CIUA 3N04A 3OP2A 3WBEA 2QZRA 5GNZA 4GUGA 1OFDA 3OLGA 4XAYA 2VC5A 3GYEA 1S39A 1PHQA 1LLWA 3HB9A 2VRKA 4GO8A 3UY7A 1C9WA 4KETA 3KVLA 5HWMA 1UP0A 2VFFA 1EF3A 2V68A 3B0PA 4X61A 3Q4DA 3W02A 3QY8A 2XU2A 5A8GA 1A50A 3GVRA 1EHAA 4JCLA 2HDJA 5D8WA 1PX3A 2J8FA 1TV7A 2QCGA 1SZNA 1A3XA 4M6PA 4HU3A 7A3HA 1A0CA 3SSZA 1BFNA 5C55A 1FBAA 3UJ2A 1SPQA 5CEWA 2CIPA 4AF0B 3U57A 5A6TC 2P50A 4H6QA 4CQAA 3APYA 1JDCA 3N2MA 2EKGA 2OOGA 1JXJA 1VCFA 4D71A 1JGIA 2GQAA 1XL9A 3NURA 1RBLA 2FDMA 3E5PA 3Q94A 4XD5A 3FJLA 1J2BA 4F2TA 3SEPA 2CZ5A 2AGTA 4PMNA 3AZSA 4BFAA 4JKMA 4I6VA 3ECQA 5I23A 3ZYZA 4S3DA 1OFPA 5FAGA 1W1PA 1W32A 2EPLX 1XIEA 2BOGX 1PKNA 4OECA 2F9RA 1E3ZA 1R7OA 5HDRA 1UW9A 3WENA 4PBFA 3EOUA 2Z1WA 2Z1KA 4TIMA 4RV8A 3KCOA 4IIDA 4QS6A 3SSJA 5B7YA 2FHBA 2XVKA 4IUOA 4O13A 2VXNA 3H2CA 1Q8JA 2LLEA 2R1LA 3HPZA 3B8DA 2XFWA 4DX3A 2WJFA 2RGMA 1XRFA 1DXIA 3BLPX 1C8YA 5I3KA 4GLEA 2BVTA 1S2TA 2H90A 1DJIA 3NQ2A 1HW6A 2HSAA 5CGMA 1WZAA 1Q66A 3S5OA 2D1ZA 1BEUA 4XZLX 2PE4A 4S3CA 3EAUA 4EOUA 4ZENA 1DJYA 3WLTA 2E5CA 3ZWSA 4LUIA 1E1CB 2YLAA 2YDSA 3GH4A 3ISIX 4MTVA 5G1MA 4KKXA 1OQFA 4R9OA 4HPJA 3W1PA 2W67A 1UH2A 2D24A 4OOUA 3V1HA 2PCQA 4LUTB 5B7ZA 2O9TA 1RCQA 3BLKA 1IXNA 3RG6A 4Q8MA 2QQ6A 1NVMA 3KOFA 5IM51 3TJ4A 4V1YA 1XISA 1RH9A 5JH1A 3MV01 6TIMA 3GM8A 4J7RA 4HU0A 1ZCOA 3OBKA 5AKQA 2R1MA 3EXTA 2WAGA 5J8LA 1Q13A 5HULA 1R86A 3U4FA 3RN6A 3R58A 5JUVA 1P5BA 3AALA 4E8CA 1FX6A 1QNQA 4U3AA 2PDXA 1LRTA 1Y7VA 1MW1A 4EF9A 1DIOA 3W76A 2V67A 4TQTA 1YDVA 2E9MA 4G9PA 2D2HA 2DEPA 2OX4A 2WKLA 2OZ8A 2RFGA 3R8GA 4W5UA 2W4XA 3UESA 1W9XA 3NPWA 1PDZA 1FHDA 3RFAA 3MUIA 1WXYA 3LRKA 4KBXA 1JZ4A 1PSCA 3RNDA 4LNYA 2C18A 1TSIA 1H41A 3KS6A 1VENA 1N7KA 4MNLA 3O6CA 1DJXA 3JVAA 3R0DA 5I2UA 2GK1A 3SDOA 1E9LA 4D6FA 5FSEC 2FTWA 4ZXOA 3LK6A 3S3GA 3OLDA 4GFSA 2CLPA 2IQ0A 1EOMA 4IGMA 4AZBA 1V6WA 4ZSUA 5K4XA 3QRHA 3EB3A 3SCWA 5FOOA 2JBMA 3WNNA 1P7TB 3MUY1 5JH2A 4GI4A 1QWKA 1QU4A 3LPFA 4C6IA 4YN5A 5FCZA 3D5HA 4HK6A 1S5WA 1V3MA 3IK4A 2Y89A 4J40A 3GC2A 3W2LA 4WDXA 3F4VA 4S3AA 3WG6A 3MUXA 4HMDA 4UZSA 4O1AA 1VAHA 3TYDA 1O66A 5D38A 4HHHA 3WF1A 4JHZA 1DV7A 3GXTA 4RDWA 2BLEA 3FA3A 3ZR5A 4AIBA 4ZL1A 3EX6A 1TJRA 3W88A 3VGEA 5DXXA 2WHMA 3ZOAA 4FLRA 3U4AA 1BWVA 4X22A 5G4WA 3W53A 1XBVA 1CDGA 3UWYA 4C90A 2R1NA 1KXQA 4DZHA 2IQTA 1F2JA 4Z17A 1CGUA 2EHHA 4UIOA 3XIMA 1KQZA 1ZCCA 4XSMA 4B4HA 1RBAA 2FYMA 5KEZA 3LA4A 1ZZMA 3DCPA 3M1ZA 4GOAA 5M2FX 1JQXA 3GVQA 2ZX6A 2Q71A 2OO6A 1YX1A 1J9YA 5AHLA 4HN4A 2GJXB 1EWDA 1J8VA 1LJYA 1O12A 5JBEA 2V5KA 3F03K 1U5HA 1M5WA 1XC6A 4LUSA 2AGKA 1RY8A 4QHRA 3PB2A 1N2VA 4HNOA 4V2XA 1PYFA 1UZHA 3NQCA 4WEVX 1YNQA 1J2WA 4ZOEA 4HJWA 4UMAA 1FWFC 2PBOA 2GGIA 3B9EA 5DBUA 3VYLA 3S1GA 1AW2A 3LZ3A 3LI0A 5CC5A 3PZNA 3TSBA 1O5QA 4C6BA 1E0UA 4UTIA 2G8ZA 3PC0A 3TYAA 1L6GA 1K9DA 5KZDA 4BQ3A 3AZTA 1IZKA 2P76A 1OSEA 1X96A 1FP8A 2DZSA 3AHZA 4LSBA 4RPQA 1W9VA 2WNZA 4C7GA 1OFOA 3E2VA 3G1RA 1HZYA 4K8HA 3ZIZA 3MWCA 4MSSA 4ERAA 1R3TA 5IRPA 2AAMA 3RCNA 4KFPA 1ME9A 5D9OA 4H83A 1WB0A 4GHRA 3DKJA 4WSHA 1HVXA 1VZWA 2RDXA 1QATA 4H7VA 3CZJA 3MUAA 4GCXA 5E09A 3TQKA 1TTPA 1V6UA 3NCOA 2E09A 2DT2A 1S1RA 3EPOA 4NT0A 2I7GA 3NYZA 1KQYA 3MMWA 4YHGA 1KNWA 3MYPA 3OHMB 3WDHA 5F1VA 1FCUA 4AZIA 1B31A 2NT1A 4JIQA 3WJWA 4JCMA 3EA3A 1K6WA 5DCBA 4I6KA 2J9ZA 3EXSA 3M5VA 4GJ1A 3PZVA 1HG3A 5A3HA 3CLWA 1EQCA 3OGRA 2X1UA 3MBDA 5CGTA 3VIOA 2Y5SA 4AEFA 3ZO9A 5C9RA 5AHEA 1C7TA 1US0A 5E5CA 4HPGA 3DC8A 5JIWA 3TYBA 2WZTA 2OZ3A 1E70M 8TIMA 5I3HA 4NZ5A 1J01A 4NYUA 2EXOA 3BOXA 2F84A 2FJKA 4E38A 2WSRA 1F61A 3CBWA 4Z2IA 3UJRA 2Y8KA 3EB4A 4KFOA 5A1AA 2F61A 4IM4A 2B7PA 1VEMA 3IJ6A 3LTSA 1ODZA 1IZJA 3U0HA 3GTIA 3M7SA 1OT2A 1R47A 3KFTA 4BHYA 1XC4A 1VR6A 1UD3A 3Q37A 1J0IA 2YFNA 1DJZA 3E0IA 1GUVA 4JIHA 2GVLA 5AVHA 3NGJA 3IGSA 3BDKA 2ABBA 3C5QA 4MNKA 3DHUA 3PK7A 4ROQA 1DHPA 2XSAA 1EZWA 1ALDA 1NDVA