3H2FA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
269
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2fA00
1TWWA 4DJFA 4DAIA 3K13A 2YCLB 4NILA 1Q7QA 2OGYA 1EYEA 4DJDA 3TYAA 2VEFA 4NL1A 1F6YA 4MWAA 3TYUA 1AJ0A 4S3EA 4S3AA 4DJDC 3H2AA 2H9AB 3MCMA 4HB7A 4DAFA 4S3BA 2YCJA 4DJEC 3H2CA 2DQWA 4NIRA 4DJED 3TR9A 1Q85A 1Q7MA 3H2EA 4D9PA 4D8AA 4DJFC 1TWZA 3H2OA 4G9PA 4PZVA 4DJFD 3BOFA 4C1NA 4O1EA 1Q8AA 3NOYA 3H24A 3V5OA 2DZAA 2VEGA 3TYZA 4DJDD 4S39A 4MWAC 3H22A 4S3FA 2BMBA 3TYEA 4MWAD 1AD1A 4MWAE 3TYBA 2YCKX 2VP8A 3H21A 3H26A 4MWAB 1TX0A 2YCLA 4O1FA 3H2MA 4DB7A 2Y5SA 4O0QA 3H2NA 4C1NB 3MCNA 1TWSA 2E7FA 4D8ZA 4NHVA 3TZFA 2DZBA 3TZNA 1Q8JA 4S3CA 3TYCA 3TYDA 4S3DA 1AJ2A 3MCOA 2Y0FA 4S23A 4CCZA 4DJEA 1AJZA 2YCIX 2H9AA 4S38A 2Y5JA 3H23A 5JQ9A 1TX2A 1AD4A 3BOLA 3H2FA 1Q7ZA
chains in the Genus database with same CATH superfamily
4WY0B 3UR5A 3W27A 3NQCA 3NZ1A 3RR1A 5FEWA 3KRUA 4N6FA 2QCGA 4O10A 3T0AA 3T44A 5D2YA 5AHEA 1CBGA 2A79A 2PWDA 1QASA 1RY0A 3GVWA 2INFA 2D3LA 1T0OA 3V1PA 3FSUA 1JDDA 1I2PA 4QITA 5J04A 1L2UA 5BOOA 1JZ3A 4TTUA 6ENLA 2X0HA 1ZNNA 2EHHA 3VVGA 3FYPA 3G3DA 1JDFA 2AMXA 4PB3A 2OZ3A 1JCMP 1ENUA 4ALDA 2PRMA 1OX4B 3W2JA 3CHCA 2WM1A 4A8RA 2XU2A 3BG9A 4RXGA 5C7HA 4FAMA 3IWPA 3LXCA 1DWIM 1BXBA 4F2TA 1QU4A 2GJLA 5HNTA 1TTQA 1G1YA 4ZO8A 4CVUA 3RM8A 5RUBA 4BF7A 4JX6A 2DUAA 2R1PA 3QM3A 3QSRA 3DFTA 3LMZA 4UFLA 1XBVA 2EPHA 5D2VA 1E0WA 1A50A 4E4PA 2NSOA 1SW7A 4UFJA 2A3HA 3AI0A 1W1VA 3FSTA 4TO8A 2AL2A 1K9DA 4O1DA 4A8IA 2Q71A 2R1NA 1I1WA 3M0IA 2DJXA 2PTDA 4JOMA 5CKSA 2RGMA 3IGSA 1XD0A 3WIJA 2QHAA 3IGXA 2Q6ZA 3F4DA 5H2ZA 1Q2RA 3W22A 5D02A 3LUTA 1LCOA 4Q4MA 1A5CA 3XIMA 3NXLA 2O9RA 4RNHA 3W1TA 1TWWA 3W28A 3FEMA 4M6PA 4PCSA 5H6HA 2GSJA 3WQEA 2YCLB 1HN1A 5EMUA 3JVAA 1TR9A 1W3KA 1XLLA 3CZLA 1R46A 2DZUA 3A4JA 1AJ0A 3IS4A 3LHZA 1OIMA 5I24A 3EXRA 3KVKA 1OEPA 2WMFA 3N2OA 3PC0A 5DLCA 5F4XA 3DCPA 4TTGA 3ZT7A 2QDHA 2WCSA 4NF7A 5HINA 2VR5A 2DIJA 3SRKA 3OHIA 4GQRA 2PDNA 4MY9A 4IGMA 3NNTA 1Q45A 4GUIA 1H2JA 2QW5A 1E5NA 3GIQA 3E12A 1J10A 3NOYA 4QS5A 3CHDA 4LANA 2DZAA 2VD9A 1DJYA 2ZUWA 4H8VA 4B5VA 2VI0A 5C6MA 1V3LA 4ZGYA 3EPNA 3GDKA 5GNYA 1O5XA 2R8WA 3LNPA 3WBXA 3P80A 3VNMA 5I5RA 4NNCA 5FEPA 1IEIA 3O16A 4HZMA 4W8AA 3IJLA 3RMJA 5BXPA 1PYMA 3GTNA 4BF5A 3KVJA 4GYJA 2XM1A 4O1CA 2PWVA 4IP4A 3KHJA 1LRNA 2ZOXA 4HT3A 3QPEA 4PMJA 2PBOA 5CC6A 1GG1A 2ZUUA 1PHWA 3QMTA 4PTXA 3CEUA 2NUYA 1RLCL 4WGHA 4ZFCA 1V0LA 4JHOA 3L9CA 4ADUA 3ALFA 5D2XA 3E96A 4AD2A 3VCCA 1EWDA 2E5BA 1R47A 2VURA 4NAEB 1CENA 2WPBA 4C1LA 1CXEA 2BSLA 1H62A 4XZHA 3GDBA 2QUUA 1A5AA 1NH6A 2CYGA 3K4DA 4S2CA 4UNLA 1OFQA 1XICA 3TFCA 1UR8A 1IXQA 4QSHA 4MMWA 2UBPC 3H2OA 3NVDA 5BYWA 4YTSA 3RCYA 2ACRA 4NZFA 4XUYA 3EGJA 3BARA 1ZRQA 1UR2A 5D37A 3BW3A 1E1CB 3LLDA 1KD0A 2WM0A 2CLOA 5HA7A 2A7NA 5LIXX 4PMNA 2CU0A 3N9RA 4UQEA 2Z7GA 2PDQA 5EY5A 4XQ6A 2Y8KA 3WEZA 3TX9A 4U2YA 1TQJA 2JKAA 3MCNA 3KRSA 3UPWA 3AHTA 3NQ8A 2Q02A 2FMNA 3MP3A 3LENA 4GD0A 4S23A 3C2EA 3ZS4A 3CWHA 3EAUA 3ARRA 2D73A 3L7RA 1JVNA 1A3WA 3G1XA 2EBNA 1C8YA 5C0QA 2OO0A 2YL8A 3GR7A 3LGGA 4EPBC 1GOWA 2BB0A 1XBXA 5ECUA 4AEFA 5EA9A 4ZODA 1B54A 4PL2A 3CZKA 1ZBWA 2A7PA 1WBHA 3MU7A 4O28A 4MGGA 3P62A 4CEXC 3O6AA 1BYBA 1OF8A 1M04A 2E0PA 1J79A 2EJ1A 1QBAA 1JI1A 3BGAA 1PTAA 1UMYA 5CPOA 3UETA 3D47A 4C7DA 3BC9A 3W7OA 2Z26A 2B7PA 2ZRYA 2W66A 1K8ZA 2YKKA 4M51A 5BWAA 3ONBA 1R38A 5HAOA 4CCEA 1W1TA 4BFAA 2V9DA 2HV5A 2H8ZA 4GQQA 2VELA 4JTEA 3AZRA 4XZMX 4IM4A 2CBJA 4C1NB 1OK6A 7ENLA 3M1ZA 1C9WA 2OMAA 4CVWA 3SN1A 3C8FA 2J13A 1N55A 2Z29A 4S3CA 5M03A 4NU7A 1XUZA 2V5JA 2C13A 2GFTA 4KEZA 1DVJA 1FWCC 4H7VA 3N34A 2WVUA 1E4NA 3BCFA 5C7VA 4CQCA 2VQUA 4Y90A 2XVLA 5AKQA 3KS5A 1F6KA 2DU2A 5HNNA 2PF8A 3UFYA 3GNOA 1UWTA 3KBSA 2FZMA 1DXEA 5A6BA 3OLIA 2DSKA 1TV3A 2DW6A 2PAJA 3VOCA 4F0RA 1LWHA 1ONWA 2W61A 2D3NA 1TTIA 4H8NA 4PMZA 3GXTA 2ZRXA 3PZGA 1IIHA 3PPCA 1P6CA 3QR0A 1OK4A 4Q6JA 5XIMA 1M6JA 2HE8A 3ITGA 2REQA 4RDWA 3CASA 1CLKA 3O6YX 2QT3A 2Y24A 3OPSA 3IEBA 3GH7A 5D33A 5A6BD 3LXAA 1CCWB 3UZWA 1EGVA 3MPGA 1S5MA 4POCA 1PTGA 3V0UA 1L8PA 4ZQRA 3W7EA 6REQB 3GSMA 2VZTA 5IBXA 1KKOA 4H6KA 1A5UA 3PY2A 4C90A 1FVPA 3SRFA 1W9XA 1IWPA 4QFUA 1VIZA 2C1IA 4ZTXA 3BANA 3MV01 2CXGA 6XIAA 1NWRA 4UFMA 4GUHA 1J4EA 1NP0A 1I2QA 3W83A 1TPEA 1W9VA 4PFHA 3PUGA 3VMOA 1ZQ5A 3UCDA 4PCTA 2Q3OA 3FVDA 3YPIA 2UY2A 4QHRA 1C90A 4UMAA 4JIEA 3DG3A 4PMDA 1G4EA 4LC8A 4L5ZA 5AB3A 5D38A 3G1YA 2QJHA 2WVVB 1C8VA 4C6QA 1M9HA 4R34A 3C0JA 1VD6A 3TNOA 4E8GA 4DF1A 2VD8A 2W27A 3N12A 5A94A 1RJQA 1IHIA 4NZJA 3VD7A 4FF7A 5AOUA 5AECA 3KL5A 2WANA 2NV2A 3H22A 4B16A 3P60A 3AZSA 3SSZA 4DY1A 2VEMA 3SZ8A 4H2HA 4OTKA 3NPWA 1UWRA 5IM51 3HFTA 1PDYA 1I45A 2INEA 4FMVA 4XIAA 1VFUA 4R7WA 4PH6A 2OEMA 3RO6A 5BMWA 4F3HA 1VEPA 3UW6A 4C6NA 3NVTA 4AYSA 4BQ5A 1MYRA 3POCA 5GJMA 2ZCGA 2FZDA 1ZBCA 2VC5A 3GD6A 3O7UA 5LNUA 3HOJA 2FJUB 1QRQA 1WB0A 1W56A 3UT0A 2Q8ZA 3PTKA 4HMEA 4G7EB 4GLEA 5FJJA 1ADSA 2Y85A 2QPSA 5JU6A 3AMGA 3BG5A 4ONVA 2BX7A 4CQBA 3CZJA 1JDEA 2JGQA 1KM0A 4C5ZA 5BOEA 3WEOA 4JDYA 2XUCA 1KO0A 4GG9A 3OIHA 1W9PA 2CLLA 5DQPA 2QCHA 3W3OA 4XAPA 4M6VA 1XM3A 5DX7A 2WMHA 3W53A 1IGSA 1TKKA 3S8HA 3ENLA 4ZB0A 2DORA 3AS2A 2HE5A 2ZKMX 1US3A 3GIYA 4XZIA 4JFWA 2TSYA 1MNZA 1IXOA 3LPOA 4XVEA 3L65A 1XINA 3VUPA 2ODOA 3PNZA 5HJYA 1PEZA 3B05A 1ONXA 1PDZA 2X0SA 7ODCA 4LW7A 2CWXA 3E02A 4M5PA 3HTWA 2BY1A 4R7OA 1MEWA 3BLPX 5BCAA 4MNJA 3O6DA 1UHVA 1GHRA 1HG3A 3LV6A 4ZA0A 1MXDA 2IQDA 5BRPA 1E9IA 1CWYA 5FF2A 3SO7A 7CGTA 3OLGA 4M1BA 3U2ZA 4L4PA 2D0GA 1TRDA 4KFOA 1XISA 1FFRA 3VNJA 3K2GA 2PZ0A 1X7FA 2DP3A 4DWSC 2EPNA 1XWYA 3BLLA 3LCLA 3PPFA 1BD0A 1FCBA 3UVIA 1OJXA 3GG1A 5I00A 1JRCA 4W88A 3GG7A 1C29A 3L12A 1YHTA 2ZDRA 1W1ZA 2ZUVA 2QQ6A 4RZ5A 2KZHA 4JNMA 1TPVA 4LEQA 1JPIA 1ODUA 3E0WA 1XYCA 2GQAA 3S5ZA 3LLXA 4HNVA 2YBVA 3AS3A 2WAGA 3WCZA 2W0UA 4LCSA 4A3YA 4AMCA 5JUVA 3VGBA 2WV8A 1E43A 3VX1A 4P7RA 5EFDA 1AODA 4ENLA 4UXDA 4KFPA 2C19A 2HQAA 3SM0A 3TQPA 5IFPA 5E93A 4LOCA 3C2RA 2OZ0A 4K6AA 4C6OA 1FWDC 4MUPA 1WNOA 2C79A 2YCEA 4XZ9A 1OY0A 5U4NA 2G8ZA 2FHBA 2J9ZA 3RNDA 1UR9A 1PO9A 3DHPA 1I0DA 2VGIA 3R11A 3GZ3A 4NKCA 4I5XA 3VE9A 2AOSA 2ISSA 4H2CA 4JTIA 3IRDA 4FP1A 2Y0FA 1UB3A 2YCIX 2VX5A 3TN5A 3QQWA 3PBYA 3QV6A 1KM4A 2NT1A 1QW7A 4PE8A 3D0CA 4RK8A 2PDIA 4CD5A 3TJIA 1QPKA 8TIMA 3GG8A 3RRAA 3KBVA 4LY4A 4EWND 4AXNA 1VHCA 4NL1A 4Q4RA 1P1MA 3UWEA 3GXMA 5E6ZA 2QPUA 2E8YA 2ON3A 3HZ3A 4MM1A 4IIGA 4Q6XA 1GCYA 3TC6A 4RDZA 4RE0A 1CB2A 3FKKA 3MSYA 2FPYA 4JTJA 1RJPA 4W5UA 4EXQA 2WJEA 3FDKA 2GPTA 3BTNA 2O7QA 4CLMA 1F6PA 1VPQA 1LF1A 1QPQA 1P6BA 4AU0A 4K2SA 2I56A 4A3HA 5LIWX 3PJTA 4WCJA 1LYXA 4DIAA 2CESA 1C8XA 1WXZA 3W38A 3RX2A 1K9TA 3HPZA 5C54A 2VTFA 3RILA 3VGFA 3A24A 2E5DA 4IFRA 3ITVA 2VFGA 5FJUA 4G5DA 2PMQA 3CC1A 4PUJA 1B0IA 3CUFA 1BXCA 3ZR5A 3W1MA 4R9OA 4PUEA 5BU6A 2Y6ZA 3PNUA 2HPIA 2E68A 3CMJA 4N02A 1PX8A 3C8NA 3MV11 3S46A 1DXIA 3TMLA 3URQA 4E0CA 5C2CA 4JICA 1IGWA 1J2BA 4HCDA 1FH7A 2W62A 3ES7A 1B3YA 3NQ7A 1DIOA 2DIKA 3ZLHA 3MVTA 1I2OA 1RAKA 1JZ5A 2GQ3A 2QPXA 4HYRA 1E9YB 3B9EA 3A21A 4EACA 2A21A 1TA3A 2XN1A 1DQWA 4LQ1A 4QG9A 5E0CA 1DIDA 1H4PA 3W1PA 4Q4KA 2YDAA 4WIWA 4H6EA 2I5QA 3LHWA 4HB7A 3LA4A 4QAIA 4JQ4A 3SCPA 2GQ9A 5TQLA 4U3CA 1F5ZA 4GE8A 1L6FA 1HJVA 1YDOA 3OB8A 4JDBA 1XLMA 1J6PA 2PE4A 1ZB5A 1V0MA 3GFXA 5CZ0A 2IXVA 4RZ6A 4Q4QA 1J93A 1QOXA 2G50A 3B8TA 2NQJA 2GWNA 2IPFA 3HN3A 3RJYA 3TSDA 5CZKA 1CECA 1AMYA 3F4NA 2V2DA 4ZENA 5KZDA 4PUMA 4BS0A 1JUBA 3NFUA 4NNAA 3VIJA 1FX6A 4AWUA 1UOZA 2V82A 1VJIA 1V6YA 2PDUA 3TE9A 4ZQOA 4MZYA 3NO5A 1RHCA 2ALRA 1SFLA 4JPGA 1QXLA 3TA9A 3TCSA 1FH8A 4E3TA 3PZNA 4J35A 2QGYA 4HSOA 5FCZA 4LAUA 4ML4A 4TVUA 4ZOBA 1W17A 4URIA 3LQLA 1IE7C 2VX7A 1D2KA 3I3DA 4B4HA 1EUNA 4LEFA 3DH7A 3DI0A 1CXKA 3TTQA 5ABFB 2ZZ3A 2GGIA 3TN3A 1GJPA 1KFJA 3K46A 4N9BA 2V67A 3DFSA 3KDOA 3IV8A 1V0KA 2WNWA 5LHEA 3LYEA 3G1AA 2Y63A 1DHKA 2HVOA 5HJLA 1YBQB 5EMMA 3DENA 4DUWA 2ATMA 1LT7A 5G5IA 2OFJA 4FOUA 3GY1A 4AD5A 1VJSA 5E9AA 2ABBA 2GVGA 3WLMA 3LZ3A 4IWWA 2OELA 2VCBA 3AISA 2W6RA 1A53A 1SMDA 5B7ZA 3W82A 2UWFA 3K4WA 3SSJA 1FWSA 4PBGA 4KBXA 2V38A 1XGZA 1C91A 2P50A 3SADA 4Y6GA 5LHFA 4HK5A 3VAVA 1EGMA 4AY8A 2BG5A 3KWXA 3DG6A 5HQEA 1S2AA 4P8WA 4PTMA 1H0GA 1KLYA 4NYUA 4IJBA 5A8OA 1I8JA 4CQ8A 4IMAA 4D71A 3DGRA 3FAXA 1HJXA 4IT1A 3OG2A 4L1WA 4Q4OA 1UC5A 1E6RA 1EQCA 5FACA 4XBJA 5K2ZA 1JCLA 2QCFA 5HUPA 4QX4A 5HK4A 1UASA 3W71A 1BFNA 2FPVA 1H7WA 4DYJA 3SIZA 4E6MA 5HWMA 4AC1X 1G4SA 3EDDA 2DFAA 3S6TA 3SRDA 4CD4A 2E6AA 4Z2JA 4QLJA 2J8GA 1EX1A 2VR4A 3HFYA 1U83A 3JRKA 1PTDA 2ANUA 2PGRA 1RP8A 1WKEA 1KXTA 3N2TA 5G1YA 2C7FA 1DQUA 2R24A 1US0A 4J3UA 3DYMA 1KR1A 1E0VA 1DEDA 2ZE0A 4I5UA 2ZX5A 4M6UA 1UZ4A 1W2PA 5IDZA 4O57A 1NWUA 4ZR8A 2DH3A 4INFA 3ZVHA 3EDKA 5TAOA 2OB3A 3R58A 1UA3A 1ZCCA 2PDKA 2NQLA 2PA6A 4X0VA 3GXFA 3AXHA 2DSVA 5DN1A 4UUIA 2DDXA 1R2RA 2J8FA 3HURA 4N6EA 3WF4A 4M8UA 5HMDA 3GDRA 1PBGA 2VUNA 2VX6A 2J7EA 4J4KA 2FGZA 4N0RA 4KRUA 5MHBA 3DAQA 1OHLA 1EHNA 4RXFA 4AHOA 1ADOA 4FX7A 4GVGA 4XKYA 3WYZA 3HPSA 3I4KA 1QHOA 1MEHA 2V3EA 4DNHA 2VX4A 4F0MA 1FCQA 3PTDA 4I7WA 4DJFA 4NRSA 3RX3A 4X63A 4FNPA 3HMCA 3WLHA 4XUGA 1FDJA 4H83A 4L4MA 2J7FA 3WUEA 1QI0A 4FA3A 3NZGA 1UW9A 3VZYA 3IUIA 1S5TA 3BICA 5CPLA 2DH2A 4AH7A 4DJDC 4E2OA 5FI8A 5LKYA 4X9SA 3T0BA 3N25A 3K5XA 4D6FA 4HHMA 5G2WA 3H2CA 4N9EA 2J62A 1DE6A 3W81A 4XO7A 3OA5A 2XINA 2ZUTA 1FWHC 1I2NA 2QULA 1W6TA 3HG2A 4DJFD 1FRBA 6XIMA 1B3VA 2FVKA 1W3NA 2DY3A 2OOFA 5DCDA 1MVYA 2FH8A 3H4XA 1J0KA 1DL3A 3F5JA 4EAMA 1GVFA 2HJPA 5A2BA 4B5TA 1QNOA 1PSCA 4O11A 1F3WA 4MJ4A 3CPUA 3FX4A 3ZJ7A 1BSIA 1DJHA 4WK9A 2VP8A 2YR1A 2FPTA 3R4IA 1VENA 3KTCA 1JCNA 1LUCA 4G6CA 5I02A 3CUHA 1U5JA 5EPDA 1QOPA 1S2UA 2P3EA 4W8LA 4CQAA 1G4TA 1UD5A 3DYOA 1EB3A 4W86A 3U4FA 3ARYA 1V6WA 3GO2A 3G0UA 2BDQA 3VU2A 3WNMA 1BTMA 3NQFA 4ZOCA 1PE1A 3FA5A 3D3AA 1S39A 1KLZA 3UYIA 4IXHA 5D09A 1FCUA 3ZM8A 4JTUA 4UCGA 4NASA 3UNTA 3W23A 2WZEA 3CLWA 3MBFA 2QUTA 3VTRA 4KEMA 2BVWA 3NA8A 1Q6CA 3QHOA 4DJEC 1XYMA 2X1UA 4L9ZA 3G1HA 5FJRA 2QDEA 3CIVA 4Q8VA 3VFLA 5CXPA 2DT3A 2D2OA 2WHLA 4NZ3A 3QMRA 4H04A 1XDMA 3GDMA 3WY1A 5JH2A 1XLEA 5FF4A 3S47A 1D8CA 2OX1A 2C91A 3OQEA 4HZ6A 4HPXA 3SW6A 1LL4A 4HCLA 3VKKA 1E72M 3S2JA 4FX8A 3TW7A 2GJPA 4PB4A 1EZWA 1BRLA 3WF3A 2OO6A 1AJ2A 4N2YA 1VQTA 2VRJA 1R3TA 4LYRA 3CHEA 1XUUA 3N13A 2C18A 3MBDA 2CNCA 3N19B 3H4WA 4XWUA 3BV7A 1FWNA 3WDRA 3W1NA 1HKVA 1OFAA 3FVMA 2WJDA 4AC7C 1G94A 1VFMA 2WZTA 4Y7EA 3R2GA 3AWOA 4CNUA 5L9FA 8XIAA 3SAZA 1O4UA 1WKYA 3L4XA 1XYAA 1W3JA 4ZQCA 4O1AA 5AVHA 2XTKA 1VF8A 3LLFA 2D20A 3W75A 2HISA 1OFOA 4HA3A 3MKKA 2YBTA 3KTXA 3GAYA 3LV5A 1SQ7A 3LDVA 2G4JA 3AIUA 1FHUA 2TPSA 1F05A 4W8BA 4OWGA 4W7WA 1E4MM 2ZTKA 4H8UA 4GI9A 3U4AA 3G1DA 4K8HA 2ZX8A 4QBXA 5E09A 2OU4A 1TSIA 3PUDA 2IPJA 3FAWA 4Q8OA 5A6AA 5D4YA 3LEPA 5CBIA 1Q63A 2TODA 1YPIA 1UR3M 4AY7A 4PCFA 1A5NC 5CZTA 3V36A 3B0PA 5BWFA 4UCFA 1W3IA 1JIBA 1PJ9A 3PJXA 1B4KA 3RXZA 2PTXA 1BF2A 1OCJA 4J27A 1GTEA 1UIPA 4DUXA 5IHRA 3UEQA 4IG2B 4O18A 4NHVA 5FKYA 3ANUA 2A7RA 3OP2A 5CCZA 1DWJM 2ZZ5A 3UXLA 3TCEA 2WMIA 1JAKA 3WG6A 4GZ7A 3W7LA 1WXYA 1WZKA 4RNJA 3WD3A 4LSBA 3KL3A 3P0XA 4DPQA 3RLUA 2QJIA 1TG7A 2FVLA 1HF6A 1R9YA 1O5QA 5E5CA 1GKPA 1T7LA 2PRLA 3A13A 1P0EA 3NM1A 3DKLA 3AMDA 3LQGA 4PBFA 3JU2A 3VIHA 1F8IA 1P4CA 4BEQA 2PZNA 1K9FA 4V33A 3EKLA 2XH0A 4O53A 1UR1A 3VMPA 3NWRA 1F4HA 2X30A 3VCRA 2XGZA 3EDEA 3GXNA 2BODX 1NARA 2AQVA 4GX8A 2CEQA 1S5VA 2DVUA 1XG4A 3LI0A 1K1DA 4P8UA 3ZLFA 3CV6A 3HV8A 3WNLA 2VDGA 3NQMA 1ALDA 3HQPA 2YZRA 1ME9A 4B90A 4DEFA 3VA8A 3GTIA 1UBSA 5HBFA 1XIMA 6TIMA 2Z24A 1QCWA 1LG2A 3TOPA 1UWQA 2WKGA 3CT7A 4GQ0A 2PGWA 1G9HA 3TWAA 3W72A 3GTFA 3U7BA 3N17A 1L6YA 5I3GA 2VFFA 4HPJA 3BOLA 4DF2A 2WSQA 4REQA 4EPDC 2ZE3A 3GNNA 3V5CA 1XXXA 2H3DA 1GQKA 4QE5A 1YXYA 4R3UA 1HJSA 2I7GA 3SJNA 4UTLA 4ZE4A 2D22A 2J24A 1NWSA 1WBJA 7TAAA 2O4QA 3N4FA 2VZUA 3BAIA 3CHFA 3JR2A 3W29A 5HWNA 3A4AA 4L6OA 3IANA 5LSMA 3S6DA 4QLLA 4CN4A 4PYSA 3VNDA 1TJPA 4ILSA 4GC3A 1AVAA 1TELA 1Z3NA 1PAMA 4B5XA 3MI6A 2EPMX 3EKZA 2ZVIA 1JCYA 2A85A 4QAWA 3MYPA 1SO5A 1IEXA 1KR0A 3GLCA 1PL9A 1V02E 4JTAA 2Q01A 4L9XA 2BFGA 3U7VA 2PLCA 4KCUA 4PRWA 1GOKA 2PBGA 3BLFA 3SUWA 1CNVA 2QIIA 4EP8C 4GGBA 3I6RA 1X6NA 3GU1A 4DYEA 4C1KA 2NXIA 5A8QA 3CUIA 3KBWA 1NEYA 1RPKA 5K3VA 1RK6A 1LOLA 1XKYA 1JZ7A 5F2IA 1MFVA 3ABXA 4LUSA 3MCOA 1DOSA 4E8CA 2XHYA 5A6KA 3P3BA 1V77A 3PSWA 2JKEA 1P0BA 4HJFA 1HVQA 2OTDA 4DQWA 3S5OA 3LGDA 3MUAA 1MXGA 1YTKA 5K7JA 3LZ5A 3SBFA 3ZVHB 4Z1BA 5BXRA 5PTDA 3M07A 1TMLA 1DJXA 1R87A 2O9PA 2V3FA 4EX4A 4B3LA 3WNNA 1W9BM 1H5YA 4J2PA 5DO8A 2R14A 2PCEA 2PU1A 2YXXA 3ZXWA 1ICQA 2TMDA 4DXKA 1KBLA 1TVLA 2RHGA 3MY9A 1D7FA 2PWUA 3GBEA 1MUCA 3IPWA 5EMYA 3VC6A 3WDQA 3ZYZA 4YHEA 4AZHA 2I9EA 5DXYA 2FZNA 4XD4A 1GZGA 3VOIA 1F3XA 1QBBA 2X05A 3GB6A 1E0XA 4HGXA 2Q8LA 3KOXA 4LV9A 3GU2A 3UJ2A 2PDXA 2DSWA 5D9PA 3TP4A 5HNRA 2Z27A 4O15A 3SCVA 3UERA 2PWGA 1ZJHA 1LLWA 4ACYA 2ZXAA 1ZZMA 1FY6A 4DBUA 3EX4A 2WWCA 1GVIA 4FS9A 1HZYA 1HNYA 3PS7A 2D2JA 2AQWA 2YL6A 3FJLA 4WOZA 4A22A 1JNDA 3B4UA 1XRSA 4OOZA 1TZZA 2AGKA 1QI4A 3VIKA 3CH0A 2GSEA 1M7OA 3KP1A 4XZBA 3EXTA 1FFQA 2DGAA 3DN5A 2VO5A 3AXMA 4PSPA 1NTHA 2Y1HA 4UTWA 4L7ZA 2DQXA 3E5BA 2CLHA 4QLKA 2E1WA 5FJIA 3W0KA 2NLIA 1WOBA 4DZIA 3IUHA 4OZOA 4S3BA 1BF6A 4IGSA 3UJRA 2XZ9A 2H3BA 3O05A 2W79A 2F9RA 3OLDA 4IMCA 3L4TA 2VGGA 1BKSA 3S5NA 1XD1A 1NP2A 3UBPC 2PDJA 3BURA 4MZ8A 5FA5A 3IIZA 1E51A 1DWGM 3ZO9A 3D6NA 2CFFA 4WQ6A 3UYCA 3LOTA 2RDUA 3UD6A 2GGEA 4MWAE 1KC7A 3UXIA 2Y61A 1AQHA 1ZALA 3CZ8A 2QXWA 3V16A 2FZ9A 4F0KA 1NIUA 3DHFA 4Z1AA 4H6RA 3H2NA 3PZIA 2E7FA 3KZPA 3M5YA 2ZA1A 3HPFA 3T8LA 2OJPA 1U33A 4GVIA 3L2LA 3HO8A 4ADSA 4UFKA 1XGDA 4D1JA 1KCXA 3GR4A 3OLEA 1KCKA 4PODA 1Z48A 5FESA 2PI6A 2FGBA 3HB9A 2CLKA 3FIGA 3W1LA 2W5FA 1BVWA 3W6LA 4WY0F 1LQ0A 4LNCA 1JZ4A 3B06A 3VNYA 3FN9A 1FWJC 1ONEA 3T2QA 3AXKA 1VYRA 4HIBA 3TAKA 3RHGA 1I4NA 3W25A 1M3UA 4DNMA 2BVDA 3SGZA 3EB4A 1CGVA 3ICJA 3DC0A 3CQKA 3RU6A 2QKFA 4GI4A 1F3TA 4EPKA 1W31A 1P0DA 4G9PA 2QCEA 4FSAA 3P93A 2CBIA 3PZQA 4PTNA 2JBMA 3SURA 3UG5A 1V6UA 2ZRVA 1NF7A 1X1OA 1GQNA 1M41A 2W91A 1XP3A 3FYYA 4OKDA 3SUUA 1N8FA 4ZCWA 1QHPA 5LA2A 1ITUA 3GK0A 1NVMA 3VNLA 1M1BA 3PB0A 3URAA 3AFBA 1SGJA 1VFSA 3EOEA 1Z44A 2DZSA 4CD7A 3STGA 4CCCA 4B2DA 5J5RA 1PZ0A 5MKGB 4HNCA 1V4YA 3ABZA 5G2IA 4FO4A 4B91A 4IICA 1H50A 5FF7A 2Z7KA 3EX6A 3DBPA 1E3ZA 3ARQA 3G18A 5H8PA 1EYWA 3TUUA 3VNKA 4BI7A 4NI8A 1VFTA 3C2FA 4IMDA 2E40A 3IVSA 4OECA 1TPWA 3O06A 4EXAA 4GJJA 4RZBA 1TVPA 1RCXB 5HULA 4LCRA 4DUVA 2JKPA 2VEFA 4YL2A 1Q6OA 4O13A 4ZOAA 4MAVA 1ECEA 3C61A 2X7VA 5DCBA 3CUJA 1NDWA 4GGHA 4B2DD 2PUZA 1P1XA 1S2WA 5CPSA 3W07A 1Q7MA 3CTLA 4IL2A 4KKXA 3TSBA 3BMXA 4JTTA 1EH9A 3NEVA 3K30A 3MP4A 4LUJA 4N42A 3T0DA 1JL8A 4PUDA 3EDFA 4HPHA 3K8LA 3MDUA 2UY4A 4LUTA 4IP5A 3TW9A 3RR4A 3M0LA 4PC8A 1BEUA 4HN4A 1YYAA 1E71M 2Y8UA 4P7OA 4IXXA 4O4WA 3KX6A 1AL7A 3FXYA 1KFCA 4LB3A 4JXCA 1GONA 4D8ZA 2QZRA 2G95A 3BSMA 3DI1A 1SFTA 1JXJA 4GACA 4IL0A 2POZA 1XRFA 4UNIA 1S1PA 2UZ9A 1ZJAA 2RDWA 3WNOA 1ZBVA 3CS2A 3DU0A 1E4IA 2NQ9A 1LDCA 4BHYA 1WDPA 3ZJ6A 1EQPA 4IQEA 1BSLA 2NUWA 1TO3A 3PZUA 1LTDA 3N18A 1PWLA 1VFFA 1ZAJA 3IVTA 4A4AA 2FB3A 8A3HA 2FFCA 1UD2A 4BWLA 4GQBA 4KCTA 3H12A 3RJXA 3MWCA 1U1UA 1Y65A 3PZOA 1UUOA 3AHVA 4RV3A 5FSDC 4HU4A 4JTHA 3N9SA 4TX8A 4HU3A 4O50A 1NSJA 2F38A 4GJ1A 4Y9NA 1P48A 3L4WA 3LPFA 3O6CA 2BBFA 4US5A 4HNOA 2CBVA 4HKPA 5E6YA 3WD0A 1C8QA 4GC4A 1EIBA 5CGQA 3ZT6A 1POJA 4N9CA 2BOGX 4IQLA 3N2CA 9XIAA 1W1A1 1XIIA 3WDIA 3BSHA 3P8IA 1H60A 3WK1A 2V5KA 4O8RA 3TZFA 5K4ZA 4AZBA 4MADA 3CH9A 3D46A 3THAA 3GZAA 2YW3A 1YDYA 2TYSA 2E6FA 4IOTA 3VI2A 2CLEA 3H70A 1YPFA 1JGIA 1CGUA 1DYSA 1ZS2A 3S1VA 1BYCA 3G1RA 4US5D 2PTZA 3TQVA 3L0KA 4LNYA 5A3HA 1VZWA 4DYKA 3SR7A 1KRCC 3LG3A 4FF5A 4LAKA 1O12A 2A3CA 4ACZB 1H7XA 2X41A 3C0LA 4C6FA 4KRZA 3UJFA 3AMLA 1EJXC 1OT1A 3GM8A 3C0QA 8XIMA 2D0HA 3V5FA 2KAUC 2J74A 3C5QA 4XZLX 4P7NA 2CZEA 1J6OA 2GJXB 2VEPA 3MUCA 1MQQA 3MTWA 3OQ8A 3ABRA 3Q45A 1RPXA 4K7YA 2VFDA 1UOKA 3JW7A 5FJTA 3WFAA 3H4GA 2Y7FA 1W1B1 4JD4A 4IUOA 5D2WA 4QQ3A 3BQ5A 1UWIA 1EDGA 4XX6A 1MW2A 2VYOA 1AW5A 3A6OA 5B7YA 2XVKA 4CU8A 1D8WA 1KXHA 1TZ7A 2HVMA 3OBKA 3IAPA 4PUUA 1KM3A 4HU0A 3V35A 1AMKA 1VGAA 3ZLGA 2Y4SA 3FHQA 1Q8JA 4DWSA 3KAOA 4C60A 3MMUA 1L8NA 4U28A 3RUBL 1EOMA 1XL9A 3QY8A 1MFUA 2YW4A 1Z69A 3T2OA 1RQBA 5ABGA 4DPPA 1Q3NA 4CU6A 1QPRA 3TN6A 1DP0A 5I03A 3BLIA 1KTBA 4LRSA 1XLKA 4PB5A 2QF7A 2X2YA 1XIHA 1XIGA 4LT9A 4S3GA 3STEA 3EOLA 4DO6A 3NQDA 1LM1A 3HG3A 4W93A 3T40A 3VIFA 4DXVA 4JTKA 3FEQA 4A35A 1BGAA 1KWGA 4Q8NA 2BXZA 4OV4A 4OUIA 1XCFA 4DWSD 2AQOA 2QDDA 1YKWA 2O9OA 4IP7A 2I9UA 2NVCA 1HJWA 3FGCA 1YLVA 4P8VA 4D1IA 2HK1A 4OV9A 2NUXA 3OGSA 3CBWA 2PDMA 1FDYA 4UQCA 3WX7A 3BOFA 3S3GA 3P84A 4ROPA 3HGRA 4C6MA 4Q7IA 1AQMA 4AZCB 5C9RA 4LALA 2A3LA 1BXNA 1JZ6A 2J6VA 2WZIA 2MANA 1E55A 4M3PA 3NQAA 2QLYA 4A2SA 1OX5A 2E3ZA 3PUEA 3DGBA 3AQUA 2TAAA 2WVSA 4Y96A 7A3HA 1O60A 4DN1A 4RNIA 2WC3A 3TH6A 3F4VA 4LVGA 3VDGA 1ISWA 4AMAA 1U5VA 2ESCA 1GVYA 3VIOA 1X39A 2PEVA 3GTXA 4PUNA 5DT7A 1WUFA 1V5XA 1E6NA 1LOSA 3ME3A 3PWIA 5I3FA 4NT0A 4IX2A 3IIOA 5LIKX 2UY3A 3CGTA 4YMZA 2HRWA 4R85A 1ZTVA 2VWSA 3MJYA 3MMDA 1RH9A 4U5IA 2VHLA 1JCJA 4MTVA 4AX6A 2BHYA 2CXEA 4MJZA 4GKLA 4AF0A 1GPFA 1ZCOA 5A6SA 1WDSA 1WAWA 3FW6A 4GQGA 4JAWA 1HGYA 3MI3A 4B5UA 5CJ5A 2OSWA 1EA9C 4O4VA 1V0NA 4JKMA 2QR6A 2YXGA 3TQ0A 1L0PA 1HIZA 1REQA 4GI8A 1DHPA 5EMLA 3GVGA 3UJEA 5A1AA 3SGUA 2VDHA 4Y9OA 3B8SA 2VJXA 3W7IA 3FKRA 2IS7A 3U0HA 3M0ZA 2XN0A 3CMFA 1X98A 2PLJA 4QSFA 4GNJA 1UQYA 2PDYA 3N73A 3P8JA 4LUYA 5F1UA 4WKAA 4GMEA 4PUKA 1K9EA 3PJWA 2ZX6A 3KXQA 1KFEA 2BVYA 3H53A 3G1FA 4IGNA 3VD3A 1W5MA 3PZVA 2EXOA 4G8TA 3ZJKA 2CCRA 3S4TA 3WQGA 3AZTA 5REQB 3BAXA 3VOFA 3QQ0A 1UJQA 2PDPA 3TJ4A 4C65A 1FCVA 3BCJA 2VWTA 4XAGA 4CEUC 4JTFA 4DZHA 5I77A 2L5HA 5KZEA 3PBWA 3BQ6A 1SZFA 3ANVA 1I9CB 1VIWA 4LAOA 2GDQA 2PP3A 1VS1A 4PULA 3S42A 4D6CA 4HTYA 2FZ8A 4BJHA 3L4ZA 2WBGA 4GI6A 2IQ0A 5I3HA 1KM5A 1XCXA 4JKKA 4D9PA 1EPXA 3S0CA 3WQ4A 1SFJA 3ARSA 1G01A 2EG7A 4JL1A 4KGJA 1ZJBA 3RK8A 2XYLA 3CMGA 1B1YA 3NOEA 1PX3A 1VP5A 4TVDA 3SY8A 4HA0A 5BW6A 3WD2A 1IEVA 1W9UA 2WJFA 2RH9A 1XJBA 3FFSA 2B7OA 1OINA 4YTQA 4GZIA 4EXBA 3ITOA 3KBNA 1A3HA 2YPIA 5AYBA 4HYVA 4IFOA 4JBRA 3ABSA 3L21A 4IFKB 4NXSA 1K7XA 3MHGA 3F4WA 4I9AA 1WOAA 3QHMA 3OHMB 3NQBA 3AHZA 1J0HA 1RP9A 2F8QA 4MAZA 1ME7A 3RO8A 2TRSA 1OFRA 1F2JA 4IIBA 1IYXA 1A47A 3VOHA 2NX3A 1Z8AA 5J8LA 4YS1A 5ABHA 1N7KA 1S2CA 2X8RA 4KWWA 4FNTA 3MT1A 4EF9A 3CIWA 1ODZA 3UG4A 4OE7A 4A6GA 3GXPA 5LNRA 4C6DA 2QF8A 1QHZA 3BE7A 4WSJA 3VFCA 2QMKA 3W7QA 1Y5WA 4EF8A 3LHVA 1R3YA 2XGBA 5FF0A 3OVPA 3GC4A 5GPRA 3SFWA 2PD5A 3H54A 3R8GA 5KMYA 5HXMA 5HMEA 3UWQA 4G1KA 4JIIX 1QR7A 2NT0A 1BYAA 1BVZA 4MY8A 2H8XA 3WDHA 4K39A 1YX1A 4JFSA 4GRSA 1CGYA 3NQ2A 2PODA 1TUFA 2BZNA 2A4AA 2BLEA 4AZ6A 5DMYA 1YADA 3NL6A 2DT2A 1WV2A 4JZ5A 3MO7A 3CWNA 5A95A 4FLQA 3F7JA 1KRMA 3QY7A 1MZHA 4HN8A 3FA4A 1X38A 4JIPA 4PMYA 4ZL1A 1T6MA 3QFEA 4ERAA 2XWDA 2IKHA 1AD4A 3A12A 3F1QA 1QOQA 1YIXA 5CZJA 3B8DA 3LX9A 2HSAA 3EWBX 3LMYA 4MSSA 5FD0A 3CHVA 2WMGA 4O17A 2INZA 3GVRA 4GYPA 3JZEA 1MWOA 4DO4A 2IXUA 4Z42C 3FJ6A 1VJZA 2NVAA 2ZQ0A 3DFYA 1IWAA 1EDTA 3TYUA 1JRBA 1IXNA 2ZZ7A 3I6TA 2OKTA 4GINA 1T40A 1DJZA 1VBHA 1BG4A 5A6JA 1JPMA 3KLKA 1W9DM 1W5NA 3SIMA 1LRTA 5AHLA 5M17A 1QI5A 3I4EA 1KFKA 4IQDA 3HF3A 4WSKA 4IX0A 4H41A 1RCOB 1J0YA 4D2JA 3EMQA 4CNNA 4ROQA 1OADA 3AOFA 4FHAA 1E6XM 3AXIA 4MZ1A 2DV0A 1V7YA 3WQCA 3QSTA 1FHDA 2OZ8A 5GJNA 5LZLA 1XYFA 1Z6KA 1E0UA 4MYAA 4AWTA 1EJVC 1G69A 4Y9PA 1J11A 3W1XA 4TMCA 3IV3A 3RM4A 3GW3A 1LQ2A 2Z00A 3WUBA 1K8XA 4Q8PA 2GK1A 3LSBA 4QJ3B 3RITA 3ZFHA 1VRXA 4A3QA 1N2VA 5I3DA 2ZZ4A 3EX3A 1KFLA 3C3NA 3QV9A 5K9XA 2NSXA 1TMHA 2EKCA 3GG0A 2YFNA 5EYWA 3AICA 4DJDA 4Z2KA 1E5JA 1R7OA 2CITA 3AJ7A 1PV8A 3DG7A 3PZ9A 1QK2A 3VM7A 2IMRA 2WCAA 3VILA 4K38A 4AIEA 3W9ZA 5G4HC 2FTPA 1FWTA 1UBPC 1XSJA 3V4BA 2FQIA 3M5VA 4FK9A 4JTCA 1Z9AA 4PN2A 1PX4A 3GHSA 2FHCA 1RD6A 4Z2HA 1LZOA 4FI4A 4WRHA 3EOSA 1FWEC 5HR6A 2Q8XA 3MKCA 3F2BA 3CO4A 2YA0A 5IOBA 1EDQA 3WN6A 4DJDD 1PKLA 3B0XA 4G56A 3NR0A 2MUCA 3R0KA 4GX9A 4MFDA 1QFEA 3A22A 3STCA 3W02A 4JX5A 5HJXA 3VIPA 2YBUA 4AD0A 1CXFA 1P0KA 2XPKA 1V6XA 2PTWA 3TW6A 4CNTA 4ZB5A 4O1FA 1KBJA 2Q3RA 2YL9A 2YLLA 1L2QA 1LLOA 1Y5VA 4RZ4A 2PGEA 5HR7A 1R3RA 1GQIA 4RV8A 1DORA 1JYVA 1HT6A 6ALDA 1GYNA 4CCZA 4L64A 1B4EA 3QR3A 1XX1A 4LJ3A 2AGTA 1AQFA 1YTDA 3ATYA 1VFLA 5CZSA 1SMAA 2ZBTA 7REQA 3UG8A 4GNKB 5HMFA 4WR3A 3FOKA 3VKJA 2E9LA 4HOWA 9RUBA 4ZMGA 3W7NA 4IUGA 3BOXA 3RX4A 2VC9A 2E25A 4Z0SA 1EC9A 5BXTA 1B30A 1XSKA 1US2A 4HYWA 4EKJA 1GEQA 4K7VA 2RKXA 3IIVA 5CC5A 2H9AB 1UZHA 3MCMA 3KZSA 4ZXOA 4GO8A 5I0DA 4OBRA 3R8RA 3WNPA 5JBFA 3L23A 3WK3A 3H2EA 4KH2A 3VNIA 5FOOA 2NV1A 3FYOA 1D3GA 5GVJA 3QXBA 3KEHA 4WJEA 3RPTA 1T8XA 1OBAA 3G0SA 1Z41A 2PCQA 2ZIDA 3WLPA 3K8MA 3S1GA 5F4WA 1IR2A 1Q13A 2DPEA 1I75A 4FNSA 1UUMA 4LBSA 5FJPA 4E38A 5T9CE 1UROA 2O56A 2WXDM 1ZY9A 2E09A 1JCTA 1XLFA 2XISA 1E9ZB 4H1ZA 2ZX9A 4KPLA 1PVNA 1V8EA 2ZX7A 2PDLA 4EAYA 4EOUA 1TWIA 4FNUA 1UP3A 1KGXA 3MQTA 3K1DA 2PDFA 4IQJA 2I5IA 3BG3A 2QCDA 1W1PA 1GVSA 1XSIA 4TU1A 2D2GA 3EPMA 1OYBA 4R33A 2VFEA 3SCUA 2OYLA 1V02A 4U10A 1QWGA 2X1IA 6A3HA 1KNWA 1OC5A 1JZ8A 3SB0A 2E8ZA 4GZEA 3EKGA 2Z2BA 3KOWA 1MW3A 1IV8A 3MKVA 3GDTA 3B8UA 2RJHA 3A23A 2MNRA 5I2UA 2ACUA 2AKZA 3I7SA 3QW3A 1UKTA 1UR0A 3RF9A 4E5TA 2G3JA 2VEGA 1HP4A 5EL1A 1HX0A 1GJWA 1FBAA 2QVNA 3N6HA 1LJYA 3W2KA 2PDGA 2DW7A 1UMLA 2EO7A 4J3TA 4K1GA 2CIPA 2B7QA 3H26A 1LL6A 1YDNA 1JEZA 3U6WA 3OZOA 1CLXA 2CHRA 1ELSA 3H7UA 4HPNA 3HM7A 1H7NA 1KRBC 3TZNA 3LK6A 3U2CA 3VNZA 3BVJA 4MB4A 3VKAA 2B31A 4QDPA 2WKLA 4PGLA 3E6EA 2VC7A 1UR4A 3JS3A 2PDCA 1XW8A 1RZMA 1VBJA 1XIDA 3P7YA 4HA1A 2IPGA 3UZZA 1EYEA 1CTNA 1R86A 3RLHA 1NOUA 3WLOA 4MB5A 3G5EA 3P14A 3J7HA 5CSSA 4U5KA 1ZU8A 1UYQA 1N8WA 3EOUA 1F74A 1E1FA 1E4LA 1MDLA 1GKQA 1H7OA 1N8IA 3WQ8A 1ECQA 4AG0A 2C0AA 4B5NA 3LD5A 4J28A 3AIWA 2A3EA 5HQMA 3GKAA 2ZRZA 2BTMA 1JR1A 4QDWA 4ZSUA 4ZZ9A 1LBFA 1RALA 1RQHA 1KM2A 3FJNA 4ADTA 3ES8A 3EWYA 2F2HA 4GXWA 3KCJA 1IEQA 2GOUA 2Z1WA 3ID7A 4WY0A 2YCKX 3W73A 1SVDA 2ZXBA 3OOQA 1DKWA 1DTNA 1M5WA 1Q6GA 2DZPA 3QPZA 2OLSA 2G4FA 1K3UA 1J9YA 4AYGA 3T05A 4TOQA 1M7XA 3W7JA 2QUMA 2VL4A 3EEGA 2JF7A 3GH5A 3QKEA 1J0JA 3G1SA 3E2RA 4LVAA 4NVTA 4Y9AA 1U1JA 4ZOEA 1RQEA 1I0BA 4DO7A 3NL2A 4BI5A 1JPDX 2GJNA 3R10A 3VGHA 4JFUA 1BWVA 4UZUA 3V18A 2JGYA 3BAKA 3P0WA 3UY8A 1OX4A 3IJ7A 1BPLB 2GUYA 2V81A 4JYEA 5T8GA 3GW0A 3QGKC 4RKAA 3W7DA 4MWAA 4MIMA 5M5DA 1AG1O 2EPKX 3EBVA 2OYKA 2X16A 3WKZA 4LYKA 3BLEA 8RUCA 3HQOA 1HP5A 3P5ZA 2ALDA 3FXGA 4UFIA 2RDTA 3O07A 2OVLA 4L56A 1UD4A 3N14A 2GLKA 2ZUSA 4CN6A 1FWBC 4O1EA 4XAYA 2RJGA 3KE0A 3KRBA 2PTYA 1QW9A 3BXWA 4BQ3A 4JN8A 4TV5A 3QGAC 3QLDA 4TIMA 2VCAA 2PGFA 5DANA 4MWAD 3WQWA 4FXRA 1A4MA 2NWRA 1GVOA 4GO9A 4YN5A 2XSXA 2X0YA 4ZSTA 1WO2A 2OKOA 3ZR4A 1OX6A 2OXNA 3QGVA 2J6XA 3F4CA 1UD3A 2YCLA 4QISA 2VM8A 4H01A 4DF0A 3GNDA 4N4QA 1U5HA 1BHGA 3WQ5A 3THDA 1UWAA 1JD7A 1ITXA 4TX9A 3NL5A 3WLSA 2PWEA 2ZTJA 2Y7EA 3QYQA 4MKSA 5LGXA 3O63A 4XIMA 3CAQA 3KUMA 1ZHAA 3M46A 4ORIA 3M47A 1F3EA 1LLZA 1QUMA 1OD0A 3VCNA 3GIPA 3C2OA 4M29A 2VUYA 4YTRA 2AL2B 4XSLA 2J8TA 3VD5A 4FEZA 2DT0A 4LAZA 3QKZA 1EIXA 2G0WA 4YU1A 1HJQA 4D6HA 5G4EA 4Z0JA 2ISDA 3ARXA 1TPFA 1O1HA 3ARTA 4IJRA 1J8VA 2FHFA 2VENA 2YCJA 5F2MA 1EP2A 1X8FA 3B9AA 4GVFA 1CX9A 4WXYA 1OSEA 3MB9A 4DJFC 1NF0A 3EYPA 4MB1A 3AIQA 5BMXA 1K4GA 1RLDA 4DXXA 2GK1B 4MOZA 2PP0A 1ZFJA 1OYAA 2WHJA 3AIRA 3TYEA 1X6UA 1E6SM 3AIEA 3IAQA 1SYTA 2QMJA 4KT2A 3CYJA 3N4AA 4C6BA 3LRMA 2XFFA 4AZIA 1M7JA 1A5MC 5KTLA 3NQEA 2OR2A 5JH1A 3L68A 1AW1A 3OO2A 5JXQA 3NCOA 3SCQA 4AQLA 4NUWA 4NAEA 3PFMA 1VKFA 2WHMA 1EJRC 2FYMA 3A64A 3NEHA 3WO8A 3GE7A 4UZSA 1EP1A 5D9NA 1GNXA 2E67A 1DE5A 1NOWA 3N1AA 3AHXA 2P0OA 2CW6A 1S3HA 1H49A 4KERA 4RX0A 1TIWA 3FV9A 3USZA 2XH2A 4HA4A 2R94A 3FCPA 5D04C 1KBBA 1F4AA 4JNYA 4O14A 2G3IA 3EDJA 2Z0IA 1E1CA 4WDTA 5C9UA 4AEEA 2FGLA 4A21A 4UB9A 2YDRA 4QS6A 3T2PA 3GRIA 4NYYA 2IKGA 3E0IA 4XV0A 3M5ZA 3W26A 3W7MA 1GPWA 3R0UA 5CLWA 4UR7A 1Q85A 1PIGA 3M43A 2DSZA 4J5NA 6TAAA 4ICCX 2ZICA 3UNDA 4EPEC 4QTGA 4LRTA 1TE6A 1KRAC 1FHVA 3BJTA 1UKOA 4NJGA 1B3ZA 2QV4A 5EMJA 4GFIA 2ONEA 3AS0A 4WJ8A 4UQAA 3F2CA 2V30A 3KCOA 1PCKA 4D6DA 3IJDA 4UOJA 4GUFA 4IMGA 4M19A 4TQTA 2QJNA 3FNDA 3N6QA 4Q22A 1Y5XA 3GNPA 1XIJA 2YSWA 5A2AA 1FXPA 3VX0A 4BK9A 1K02A 1W32A 3UJSA 2ISWA 1KQYA 4GKTA 2XFRA 1QWKA 4RPQA 3M16A 3B9DA 3OJGA 1VFOA 5AY7A 4BQ4A 2X1RA 4Q32A 2DUZA 1KXVA 3GNXA 3B8WA 4BEUA 4JIHA 4S3EA 5HANA 4KMQA 3UG3A 1VCGA 2JIEA 3BJSA 4LVFA 2F7FA 3WH5A 3WUFA 3AWNA 3KL0A 1MSSA 4K3ZA 4N9DA 1GK8A 5FEZA 2ASHA 1L9WA 4ZQMA 1VBUA 3OIXA 3T9PA 4RE2A 1QT1A 4DI8A 1CEOA 5CEWA 4DO5A 2GSHA 3TVAA 4C1NA 5AHMA 4RDVA 4AX7A 3PBUA 1XLAA 4JHZA 2D24A 4IZGA 3OZPA 4MFEA 2XWEA 1Q65A 2DZXA 1VCVA 3Q4DA 2E4TA 3GNRA 1GORA 3CU2A 3O8AA 3BZGA 3W1UA 5LXXA 2E6YA 2HZGA 1GHSA 2Y5SA 4O0QA 3M0YA 3PTQA 5E1QA 3UPMA 1JI2A 1JYWA 3KP0A 3OZMA 1W5PA 1NFGA 4P61A 2BOEX 3HBLA 1OC7A 3OBAA 5AZ1A 1DJQA 1DWHM 2V0TA 3MJMA 4UTTC 1BGGA 1V6TA 4Z08A 5AN7A 2JEQA 4HVXA 2YXOA 4OVXA 5EMKA 3M41A 3LPPA 1AK5A 5L6UA 3VKBA 1ZENA 3TDFA 3WK2A 2A0NA 4GFSA 4AHPA 2HNHA 5HNUA 2V3DA 3Q2DA 2W92A 3BLKA 3USBA 3HQ1A 3RAOA 3ONCA 5D2TA 2IQTA 2OQYA 3IIPA 2EAWA 4LS1A 1HQTA 4LCQA 1LOQA 3REQA 4BA0A 4M80A 3U48A 5HWJA 1L6WA 2YIHA 3STFA 3EWWA 3T4CA 4PTWA 5HATA 1ZP3A 4Q7BA 4E8DA 1SW0A 3I7RA 6REQA 4PMQA 4JIQA 3PG8A 3DFOA 1XRVA 3M0JA 1O95A 2HWGA 3EWDA 3IGHX 4IIEA 2BMBA 3WLIA 1BQGA 5AYIA 2ZXDA 1GT8A 2E6DA 1A5SA 1ICSA 5JIWA 4D8LA 4L80A 1AH0A 3G0XA 3V0TA 3BAYA 4PEKA 4FIRA 2Z1VA 3GUGA 2NW0A 1E0TA 1KTCA 4TVCA 3W87A 1Q6EA 3R1ZA 2HS8A 3OU8A 5CG7A 4S2BA 3ISIX 2REQB 4HCHA 3S5YA 1QJWA 1GVEA 4S1FA 2WVVA 1XRTA 4XBSA 2V5BA 4DAIA 3M5XA 4PMXA 3DFHA 3DEQA 3W7HA 2YX0A 4WOQA 2E77A 1DWFM 3VKDA 2EF9A 1R9ZA 3ZR6A 2PDWA 1PZ1A 2I14A 3E38A 3QV8A 2P8CA 1EJWC 4KWSA 4XISA 3GHRA 4B9ZA 3II1A 4XB3A 4R5EA 3O0FA 3UR2A 1E6QM 3EX2A 4WUIA 2ACQA 3ZQ9A 5SWUA 2GWGA 3R43A 3XISA 3SCRA 2G96A 5DBUA 3RLGA 4PEEA 2HS6A 3CB8A 1VCFA 1H3GA 3I6EA 2HXUA 1LORA 3S1XA 1CXLA 1RCQA 2ZADA 1T8QA 3VDBA 1O1ZA 4WDUA 2B7NA 4Q8WA 1ESWA 3H8AA 4JEQA 3CV7A 3KDNA 4C7FA 3L4VA 2EG6A 3MI2A 1KXQA 4G7EA 3IK2A 4HMDA 5HQLA 1W91A 4MWAB 5F7UA 3BZJA 1QNPA 2HDJA 3HG4A 3RFAA 1PB0A 2C16A 3G22A 4AIBA 3T6CA 5IXEA 1OQFA 4MY1A 4JCLA 3WEMA 4RW5A 3HMJG 1ZJIA 1OABA 3TN4A 3LRLA 1OT2A 6PTDA 2V63A 3LCXA 4RE4A 4RE3A 4NAFA 1W5OA 3ZWSA 4GPNA 4D6JA 4OGZA 1JPHA 2HXTA 4NILA 4E2BA 4KEVA 3HJEA 3A5VA 3NGFA 2G41A 3S2NA 4A2RA 1YMYA 4IISA 1JZ2A 1QK0A 2NXGA 1ONRA 3VC5A 4F40A 4WF7A 5H91A 4ZEPA 1DIKA 1DJGA 4HK6A 1GWJA 3HGJA 3QZ6A 2FLIA 4GA8A 3WLKX 3GS6A 1IZKA 2OLHA 2J7DA 1XH0A 5AHFA 3RGTA 1QNQA 3NZPA 1JNEA 3MSRA 2VGBA 1W5QA 3NG3A 2QCCA 3AU2A 3WBAA 4RNFA 1ISVA 4H8HA 2I17A 1EPVA 3KVLA 3CQ0A 3T0TA 4DVOA 4L1GA 1R85A 3ANYA 3AS1A 3P6LA 2W9MA 4AFYA 2EPOA 4NZ4A 3NGJA 2PP1A 3SUTA 5G2HA 1ISYA 3B8IA 3BH4A 4AWSA 3VIIA 3WUGA 2EG8A 2V5DA 3BK0A 4B5SA 3AROA 1J5TA 1LWJA 2WJZA 5CJNA 4MB3A 1ZSXA 4CUCA 5CPNA 1AH3A 3SN0A 3VGGA 5K9DA 1AUSL 3BWWA 3WNKA 1NDYA 1O7AA 4F9JA 2F6KA 2C6QA 3O0KA 2YOCA 1Q6QA 1TR1A 3GBDA 5FAJA 3TJXA 3OGVA 1J2WA 4KGLA 1MRQA 1KBIA 3K4AA 2J77A 1ML1A 4WJXA 3T4WA 3TXVA 1A0CA 2WQPA 4H3DA 4XO6A 5HUOA 3VKCA 1ZAHA 5LNSA 1AH4A 1CPUA 3L4UA 1JCXA 4Q8TA 2YLAA 3BMVA 1MW0A 4M7TA 4KIRA 3M44A 3RU8X 3AMCA 5A2CA 2WSKA 1EC8A 2I5GA 1ZAIA 1EKOA 3NPUA 4I8DA 1JJKA 3CV2A 3LCIA 3CQJA 2NVDA 1EC7A 5ENLA 2PFHA 3IJIA 3AJXA 2ZZ2A 3T42A 1OG6A 1TMQA 4YYFA 3PF3A 2VQTA 1C7TA 2OX4A 1EF2A 2W4XA 1XQLA 1YW1A 3QW4B 4JN6A 3AC0A 1CIUA 2YGYA 2BS9A 3H55A 4GY7A 1FTXA 2R6OA 3L67A 4UTWC 4LF2A 3WF1A 3W1AA 1CXHA 4O54A 3UXKA 1AD1A 3COTA 3N4EA 4HJWA 3NZRA 2HPMA 2VZVA 3JZUA 1UCWA 1M53A 1B9ZA 1P7TA 2QCLA 2VMFA 4NP7A 3ABOA 1SR0A 3Q67A 1HKKA 1K77A 3EX1A 2AMGA 5EBAA 2P8BA 1QPNA 1JULA 5D9MA 4US6A 4F4RA 3E49A 3WLJA 2JE8A 1J5SA 5AFDA 1QPOA 3E9AA 5EBUA 3R0DA 4AWEA 4UMBA 4R9XA 4MVAA 4J40A 2QEZA 1ZGDA 4F79A 3NZQA 3T09A 2UY5A 4D6IA 3DFPA 1OD8A 4KW2A 4AD3A 2B0MA 3N29A 4GY1A 2CETA 1WZAA 4ZVJA 3KM8A 3S83A 3SUSA 3LTPA 2C3ZA 4LU0A 3APYA 1E40A 4X3ZA 3P2VA 5CH9A 1EXPA 4NG3A 3K1GA 2VXNA 4HNLA 3VD9A 4AZGA 1WKFA 5F2LA 1WCGA 1XH2A 2JALA 1FP8A 1XBZA 2P88A 3QTPA 4O0KA 2WC7A 1O66A 3WMLA 3DXIA 3TYZA 5TD4A 1EWEA 1JPKA 3BJFA 3VMNA 4XAZA 4J9JA 4JHMA 1XG3A 3AIBA 1JFHA 4IHCA 1X97A 5I3IA 2RFGA 3WLNA 1IF2A 3MUXA 3A3HA 1RSCA 3DBNA 1F73A 4AIOA 2Z6JA 3PZTA 1GEHA 2J27A 4WX2A 5DRCA 3W2LA 1SJAA 4PRRA 4GH1A 4F2UA 1UJPA 3RCNA 1JUEA 3DFQA 1ZBKA 4X0NA 3CK5A 1EEPA 4HZ7A 1H11A 2IKIA 3UU0A 2OQHA 4QROA 5IDIA 1NOFA 2WB5A 1W3TA 4B4FA 3BMWA 1LL7A 3CQHA 4IGHA 3GQYA 3CAWA 3V0SA 1UPMB 3UCCA 1R7AA 2Y89A 3KBMA 3IJ8A 3QPYA 3TLQA 3MMWA 4JKLA 4GCXA 3HPAA 3UESA 2Z4GA 3GUWA 1W0MA 1WP6A 4PCNA 5ECVA 3LBOA 2C15A 2P1FA 3A9IA 3GC2A 4B3KA 1NDVA 1TRIA 3CPGA 5HPCA 3F2DA 1Z7AA 1TA3B 1BG9A 2P76A 1OIFA 4QJ4B 4YCOA 4QM1A 3TIMA 1XIBA 4W85A 3E1F1 5TIMA 2XH4A 3VD4A 4MDPA 1VPYA 2A3AA 1EX5A 1U2YA 2WC4A 3CLMA 3VPLA 4UQDA 4LX4A 2FDMA 3A47A 4YVXA 2OPJA 2VOTA 2FZBA 4FNRA 3WLTA 1SU5A 2X09A 4FR1A 4XAFA 3IGUA 1EA0A 1WX0A 3G8RA 3TK7A 4WDWA 1X7IA 3H6OA 4W9TA 3REQB 5ABFA 1RK5A 5F4SA 3A3XA 4N4PA 5I06A 1J12A 4UTIA 4TX6A 1WUEA 3DESA 2ZVRA 3FA3A 3BV4A 1ADDA 1G4PA 4HPGA 4BCEA 3EXSA 5AYXA 1OZQA 1YNQA 1YBQA 1Q6RA 3DFNA 2G3FA 4KESA 1P43A 5BU9A 1VRDA 3EWCA 3A9BA 2Z1XA 4AY1A 5KZMA 3S2MA 1X6LA 1PKYA 4QJ5B 3V75A 2YA2A 1XYLA 1MZRA 1GJUA 2HMCA 3DDMA 4MJ2A 1GW9A 3ZWTA 3QH2A 9CGTA 3GC5A 1ISZA 2ZYFA 5G1MA 2XM2A 4C91A 5LIYX 4M0XA 2VCCA 5MF5A 1S5NA 5D03A 5CPMA 5LXEA 3DX5A 2GUBA 2J78A 4PTDA 1L6GA 3MA8A 2GVYA 1J96A 4R27A 4G2DA 4XZWA 5KINA 4BWLC 1EP3A 3WK0A 4QEHA 3RPMA 2IPWA 3Q94A 4R53A 5DY3A 1JG9A 2D69A 1SSGA 1O6IA 3VUSA 4TR9A 2XIBA 3I3BA 1W54A 1PWMA 4CU7A 3WFZA 2V5CA 3QOMA 1R0MA 3WJWA 4QEEA 4IPLA 1TPC1 1V7AA 3TYDA 5AC6A 4CN1A 3GX9A 3CAVA 3PULA 3P81A 5C71A 3BW2A 2Y5JA 1FWIC 4HNTA 2WZHA 5I23A 3A4XA 2BXVA 2GVLA 1HO4A 3NQGA 3E0LA 1SPQA 3SRHA 5FIPA 1OFPA 4DLMA 1F6YA 2VZSA 4OBSA 4I3GA 3NUKA 1QNSA 5CQ1A 2V8ZA 2H6RA 4Z2GA 4KCVA 4A05A 1G0CA 4QDMA 4Y8EA 3U3HA 2XJ7A 3R94A 1B90A 4WXZA 4LS2A 3QEZA 4C6JA 2DQWA 1AZ1A 4LPCA 2PRHA 4OHQA 3ARVA 2GDUA 2A5HA 1Z89A 2J4GA 4PFMA 3CT2A 5E9XA 3RLVA 4GVHA 4LXFA 5D9OA 4GZJA 3QZEA 3I3EA 4YWSA 1CW2A 1GOOA 2ZA3A 4NAFB 2DSUA 1YTEA 5A6TC 1XDJA 3PTMA 3S9ZA 2FMOA 3LCWA 3UZXA 3W84A 2JQXA 4L4LA 2G5WA 2V6AA 4O12A 2O9TA 3TXZA 2CZFA 1OM0A 4Z1DA 4NJKA 2SFPA 2FB2A 1GKRA 2QAFA 1JQXA 4FPSA 4QP0A 1ISXA 2WSPA 4ERGA 2FTWA 5B80A 2WNZA 1XS2A 4ML9A 3FY1A 3LB0A 2ZUMA 1V3JA 4IPJA 1UIOA 3NO3A 2DZVA 3GYCA 1FH9A 2PSNA 2VRKA 4ZO7A 4K1WA 3TSMA 3IIXA 4EANA 5C2XA 2XVGA 2CHOA 4XKYB 1M01A 2P5NA 4JTDA 3W01A 2X40A 2HBXA 1VPXA 1HKWA 3CPRA 5F1VA 2QJMA 3B0UX 3M0KA 2FJKA 3DERA 3BGGA 3RG6A 4M81A 2VEKA 2V2CA 4AISA 1OCQA 3CEPA 1NWTA 1QNRA 3SQSA 1F9CA 5DY2A 5DRIA 1EJUC 1MI3A 2OEKA 5DFAA 3P74A 3L0GA 3MP5A 3LU2A 3HGOA 2A6NA 3HGSA 1FWFC 1CGXA 2IUZA 3M0MA 1VBGA 3PAOA 4ES4A 4JTSA 1RBOB 1OYCA 3CUGA 2UV8G 3AYRA 5C2GA 3EOOA 1Z32X 3MHUA 2CERA 1H41A 2POTA 3M7WA 1XPYA 1E15A 2VRQA 4Y8FA 4CGTA 1GG0A 1Y8BA 5LIUX 3GHUA 4GY0A 3R8HA 1YRRA 3FJ4A 3W7CA 1R8LA 2OCZA 3RRXA 5HDRA 2D23A 5AC8A 1WDQA 5IRPA 4IMEA 3EB3A 1ITCA 1C93A 1NAL1 3T08A 3UGRA 4YNGA 1SO4A 1K6AA 3PHAA 1FWGC 3WH6A 2VOMA 4N7QA 4UTHA 2R91A 1IEWA 4WD0A 3K13A 5CPQA 1O94A 2OGYA 1LUCB 4L9YA 3GKFA 4F8XA 1DTUA 1GGOA 3INPA 4EVZA 3THUA 1TYGA 3WBYA 3NPXA 2O0TA 1P7TB 3O2LA 5I7GA 8CGTA 3QJAA 2WCGA 3ARZA 3M0XA 3WF0A 1JYNA 4LVBA 4HNNA 1J0ZA 2GVEA 3VINA 3IUDA 4PUWA 1Q66A 2PF0A 4H19A 1XLHA 5D32A 2G3NA 4A3RA 4CCDA 1Q8AA 2VEIA 4KWUA 3IACA 4W7UA 4LTSA 5CJMA 3WF2A 2P3ZA 5A8NA 3EWXA 5E0FA 4ZFMA 3MANA 1HO1A 4OIFA 3P67A 3LGEA 5CLTA 4IF2A 3I7QA 1RUSA 2OWCA 3SQMA 3QOKA 5HMSA 3QVQA 2Y5EA 3KW3A 2NLYA 3WD4A 1KGWA 2Z2AA 2J7HA 1ZUAX 4AD4A 1OCBA 1G7UA 4GUJA 2WHKA 3PP7A 1DJWA 1EF3A 5JBDA 4S38A 1RVGA 1MDRA 1R6WA 4HZ8A 3M9YA 2YB4A 4JY9A 2XVPA 1YXCA 1EEXA 1SZEA 2X42A 5A8PA 2HROA 1AQ0A 3CB3A 3OBEA 3PJUA 1BQCA 2Z6IA 1PPIA 1VYPX 1CGTA 3URBA 2HEJA 2W3ZA 5CSYA 1SJCA 2DZTA 1BRLB 2GL5A 1RBLA 5A5WA 3BPWA 4DM1A 2QAPA 1SJDA 2V2HA 1Q4WA 3MDWA 1Q6DA 1S38A 2J47A 1XFBA 3W1QA 2PPGA 2FDSA 3HG5A 2LLEA 3HQNA 4M24A 2C1HA 4MLRA 2GGHA 1ZP4A 2VC6A 2A2IA 3CV1A 1EJ7L 2CBUA 1YNYA 1NFPA 4IG2A 2GZXA 1XQKA 1GVRA 1YQ2A 3A4WA 4S39A 2PC4A 2ZZ6A 3DKJA 4XD6A 1RJRA 3ITYA 1JDCA 3NTYA 3W76A 2J7BA 1EXBA 3LXBA 4FLSA 5LA0A 1GZ1A 3IJ6A 1QI3A 3SY1A 3AUOA 1H63A 1G6CA 1TCDA 4LVDA 3NDYA 3W6YA 4DELA 3ZOAA 1UD8A 1OB0A 2WPGA 3L5LA 3QTGA 2Z25A 4CKQA 4Z2LA 1HJUA 1SO3A 3UR7A 3UF9A 3WMCA 1B9BA 2RAGA 1SJBA 3G77A 1NY1A 3MSDA 1LROA 3MHFA 4A29A 4UTMA 4GYFA 1DBTA 4GUGA 1R3QA 3EA3A 4J2MA 4P7QA 1K7EA 3VE7A 1IZJA 5AVNA 5CAHA 2F61A 2R9RA 3QN3A 3L5AA 4GXMA 3LHUA 3FK4A 4MKNA 4FXFA 2R1MA 5XIAA 2WKJA 2WMIB 3PN8A 3TLLA 4Q33A 4I6KA 1LWIA 4NIRA 2B81A 1VBRA 4UC5A 1TWZA 3C86A 4IPPA 1IQ8A 1E56A 5HPOA 3BL3A 1A80A 4D72A 1TTPA 2YA1A 3L2MA 1HKMA 7XIMA 4OT7A 3SECA 4LFYA 3PPHA 3AALA 1D3CA 3WQDA 3MVIA 4YPJA 4FXJA 4JR5A 2DT1A 2R1KA 3BLDA 1JYXA 3O9NA 1T5AA 2QUVA 3G2GA 2R1LA 3A3WA 3M6YA 2ICSA 3OW1A 2XZ7A 2H90A 3GTHA 1A49A 3OA3A 3QY6A 4WLCA 4K36A 3OYZA 3AUJA 1YDVA 3SEPA 4U31A 3NYZA 4FR6A 4NZ1A 2HNEA 2ZWZA 1XI3A 1C92A 4L6HA 5IFTA 1PYFA 3OODA 2WK2A 3BLOA 3N15A 4BR1A 4MF4A 4X61A 3W24A 1Q6FA 3MC5A 2FFIA 2VKZG 4QGCA 2J66A 3W2UA 5A6LA 2KX9A 3ITCA 1OCNA 1IXPA 5E70A 3PG9A 4A8NA 4UQBA 4H9YA 4ZO6A 1HKIA 1ICPA 1AW2A 3L2IA 4REQB 2BASA 7TIMA 5KSWA 3STPA 3AIVA 3TOYA 3LTSA 4PMVA 1Q4NX 3NQ6A 1Y0EA 3QFWA 3AXXA 4GYPC 3WMBA 5F2GA 1V3MA 3PBVA 1UH2A 1UH4A 3S9IA 1JUKA 2V68A 1E6ZA 1UA7A 3TYBA 2ZZ1A 5H1WA 1F76A 1V6VA 3WJYA 5EFFA 5KITA 3F5KA 3W00A 2E9MA 4YHGA 3H21A 1VLIA 2GDVA 1R9XA 2C1GA 1OGBA 4CNSA 1YE4A 1FHLA 1G67A 1AZ2A 1SFSA 2OQLA 1XR2A 1XV8A 4RL3A 3B03A 3LTYA 4AXKA 4UMCA 3TAOA 3TYCA 2RDXA 3QYSA 2PWHA 1R3VA 1M65A 9XIMA 2OWWA 1WZLA 3OTRA 4IPIA 3VOGA 4MNKA 3SGGA 5U7SA 4IPNB 3NDOA 3E74A 3HV9A 1CB7B 5T26A 3C0SA 2J75A 5G1TA 1EGZA 1TUXA 2YJQA 1NELA 2DZWA 1T96A 2NX9A 1EUAA 1S5WA 4F9DA 3R79A 4XG1A 1RXOB 3NXFA 4QCFA 4O52A 5KEZA 4GH3A 4LUSB 1K6WA 3ELFA 2BXYA 4H9TA 5FL1A 2G97A 3WQPA 1PZ3A 4YYCA 3IK4A 1EBHA 3LI1A 4KFNA 1WKDA 4YJ5A 3CQIA 1E1EA 4XK2A 1POKA 2YZ5A 2VZOA 3LPGA 2O55A 3GFYA 1TFVA 3UA3A 1W37A 3TTEA 1OWQA 5BZAA 1BWLA 3UZJA 2BVTA 2QNEA 4W5ZA 3PB2A 1PUDA 4H6QA 3CL7A 4WSHA 2F6XA 4ZBCA 3TEVA 2NWSA 2QJJA 4Q8UA 3WDJA 4PRTA 3EMZA 3N9KA 1KM1A 2V69A 3ZVIA 1E73M 5TF0A 4C6KA 1EL3A 3NL3A 1VC4A 4P7LA 7PTDA 1UZ1A 3R6IA 4XBKA 5ABTA 1EZ2A 3Q37A 3WD1A 4YLWA 4NJJA 1TPUA 3WLLA 1R2TA 2GUUA 3PWGA 4MLJA 2ISVA 3EB2A 1W8SA 1TX2A 1FKWA 1Q7ZA 3ZMRA 2O7SA 4H00A 1TQXA 1UKQA 2XFYA 1WPCA 5AC4A 5FAGA 3T1GA 2BGQA 1R3WA 1XC4A 5CC3A 3KVMA 1KTNA 1TE1A 1NQKA 4EWJA 4Q8QA 4LAMA 3T81A 4DM2A 4W84A 3E2VA 3N2XA 2XN2A 1XLJA 4MDOA 3T8QA 1HKJA 2F6UA 4NY2A 2ZRWA 1RA5A 3TJLA 4JS3A 5JIPA 2GGJA 2P0IA 4M82A 1GOIA 3JUGA 1S2VA 1FWWA 4R88A 1KFBA 4X2PA 4WVXA 4NJIA 4JTRA 3WBWA 3GHTA 2ZC8A 2C14A 4TV6A 3TNBA 1IZCA 4KEUA 4D6GA 1TB3A 4GIEA 2CKSA 1ZLPA 3QC0A 3WL0A 1Q6LA 3WJXA 4BI6A 3I68A 1TWSA 5BXSA 1X96A 1GQLA 1EO7A 4H7CA 4RR4A 4S3DA 3KRZA 1XFCA 4LYQA 1P5BA 1PIIA 4Z2IA 3EA2A 3BCDA 1LRQA 1NU5A 4I9JA 1N82A 2BV9A 1JFXA 1YEYA 5I07A 2EGZA 1TJ1A 4QR6A 1XYBA 2OZTA 3RCMA 1DXFA 4HSHA 2C0HA 1TJRA 4CD6A 4BZYA 1Q7QA 3LRKA 2VGFA 2E28A 4AD1A 1RR2A 1GW1A 3O1NA 1QO5A 5H8UA 1U1HA 4FX6M 4GISA 1EJTC 4J7RA 2BHUA 4UR9A 1Z42A 1WDRA 4IIHA 3CNYA 1H5VA 4UIOA 4JFVA 3GR8A 3WQ6A 2BWGA 2BGSA 5E0KA 1NFBA 1EFZA 3M64A 4JNZA 1XKJA 4GYKA 3GVQA 5I78A 4YIWA 1FA2A 2EEXA 1ZPTA 3MSGA 1LG1A 1TZ9A 3C4UA 2IKJA 4KWVA 3GVVA 2YDQA 3ABQA 2VVSA 2F84A 5MKGA 3QZAA 5GNZA 1KQZA 3PM6A 3W88A 4OU1A 2J7CA 3ARWA 2BNJA 3MUZ1 2YDSA 1F61A 1BLIA 2WQDA 4NNBA 1H1NA 1VEOA 1XDLA 5BRBA 3B97A 5H8MA 2J9XA 4UTTA 1S3TC 1S2TA 1Y7VA 4UWMA 4HTBA 2DJLA 4KETA 3WENA 5T9BG 4V27A 1HL8A 2VR2A 3GFZA 1TV7A 2RUSA 1SZNA 1KCLA 1WE5A 2PURA 1FKXA 4NJHA 3E0FA 1XLGA 2Y7GA 3TV8A 4AUBA 1S46A 3GXIA 3R12A 1W1IE 4AZ7A 5D05A 4DUOA 3VGEA 2NQZA 3LBMA 1K4HA 4M56A 3DYPA 2F2KA 2WMJA 2ZA2A 4UR8A 2OODA 3UWYA 5C8BB 1VAHA 1Q5MA 2J25A 4NZCA 5CGTA 1DJIA 4H9ZA 1LQAA 1EO5A 2CLMA 2QS8A 2YYTA 1J18A 3UWZA 1TV5A 1KM6A 3SCWA 4HHHA 1MMFA 1OFDA 4AW7A 5LA1A 4J3WA 2BOFX 3P5YA 3WQVA 4HD5A 4PL1A 1THFD 4HHLA 3SI9A 3SN4A 3D5HA 2XH7A 3E5PA 4K8GA 4LS0A 2ZRUA 4OUEA 3AO0A 3DOPA 1UZDA 4G7FA 3G6LA 3LHYA 4XKMA 5LYRA 2QJGA 1OVDA 4QJ1A 5LGZA 3DHDA 3V7PA 1XIEA 4DHGA 4ZQPA 1RV8A 3S2LA 3W7GA 4XSMA 4J3ZA 2XIOA 1FUYA 3R5EA 5C9XA 3WELA 2AAAA 2BY0A 1B3WA 2NX1A 4F48A 3LN3A 4OFCA 4AAJA 4LUTB 5IBXC 3N2MA 1ZL1A 3DZ1A 1FWAC 1HXJA 4YCPA 1QDSA 3M4HA 4F0HA 2JK2A 2Z1SA 5D30A 4MPQA 1VEMA 4PR4A 4IIDA 5I09A 2ISFA 4DZAA 4GIAA 4I90A 3WMSA 1B31A 1FWRA 3RYSA 1U22A 4JQAA 2WYSA 3H2AA 4Q3MA 3B0VC 3NQVA 1X8CA 5FL0A 3RIKA 1B2YA 1WA3A 2CPUA 5A8MA 5BNKA 5M1TA 2ZFAA 4K68A 4JYDA 3G3MA 4HOXA 1IIGA 3SCNA 4AVOA 3SDOA 3LM3A 3KOYA 4GBUA 2VT0A 1C3FA 2FKPA 4FLRA 4KCWA 4MWAC 3WLQA 1LT8A 3R13A 1J0IA 4WHBA 1TPH1 4JIRA 2QUNA 1JDAA 4ATWA 2E5CA 1K03A 2BHZA 1H1YA 1PHQA 3W85A 1BYDA 3VDAA 3WH8A 3N3MA 4DB7A 4Z1YA 3T7VA 1EHAA 3LCHA 3GXDA 2JFEX 2Z1KA 4ACZA 4ERIA 1V3KA 1F7BA 3W2NA 3UPBA 5KETA 1H51A 3MUIA 3ZT5A 4NSBA 2J9YA 3TMQA 1P6WA 3V3WA 4Z17A 1FQ0A 4IH3A 5AHNA 4F2BA 2GJXA 3EMCA 3S9YA 1JD9A 4DI9A 3WBEA 1M03A 2YYUA 4AHQA 4HBKA 1H09A 4IMFA 2O4MA 1HW6A 3PFRA 3BDKA 2FH6A 5C55A 2CWNA 2ZUNA 4J3XA 5CGMA 2X1SA 3VIMA 4PMOA 4XTIA 4KRTA 4X22A 3S1WA 5FF3A 1HL9A 4H9VA 4RPPA 4H9XA 3RPDA 4I5RA 3APTA 3BSGA 3ZIZA 4MNMA 1LP6A 4YTTA 4UOZA 1I1XA 4QIUA 4NRRA 2I57A 4TMBA 4PZVA 3B9OA 3KOZA 1B3OA 3H24A 1UP2A 5CPTA 4AEOA 1GZJA 2A1YA 4OJYA 3DHUA 4DBWA 1TREA 1O68A 4GWEA 3NDZA 3CIXA 4MYXA 4C7GA 1KW1A 4KIEA 4YTUA 1UPPA 4JTGA 4XTDA 3C3UA 1CZ1A 3B9NA 4UTJA 4FIQA 1NJJA 4ZE5A 3LHTA 3L5MA 3HJZA 2X1TA 3DECA 1UKPA 3I10A 2XVNA 2OYMA 4RDYA 1SR9A 3TC7A 1PXGA 3SY5A 3EZ4A 3IJ9A 2X7WA 4Q7NA 1XBYA 3XINA 1F07A 4QE1A 3NM3A 3CO8A 1QAPA 1ME8A 1QTWA 1MNSA 4GJIA 1GYMA 2VDIA 3TROA 3WLRA 4U3AA 4EIVA 5I3JA 2QDGA 1MW1A 3UA4A 3K8KA 4HU8A 4NXKA 4YXGA 1PZ2A 3WZ0E 1TV2A 2WVTA 4LY8A 4DLFA 4Y9MA 1TJ0A 3KS6A 4AZCA 4DWSB 1QNVA 3NURA 3RN6A 4UTFA 5JMUA 2GVJA 2DIEA 4QCEA 3W4RA 2WNNA 1V03A 3QF0A 1UWSA 2VVNA 2YB1A 1U30A 3MMTA 3UZ5A 2A3BA 1GUVA 4FB7A 4LH8A 4BF9A 1GOXA 4WDXA 1JF5A 1KV5A 1VFHA 1Q2SA 3W37A 3N3TA 3T78A 1RA0A 3EWUA 3MWAA 3PANA 2XFWA 3RM9A 3FHAA 4M1RA 3CZGA 2Z1BA 2CLPA 1TVNA 4A3UA 1SZGA 3FGCB 3G8EA 3N11A 2ZDSA 1RBAA 2EKGA 1IWBA 4D6EA 4C6LA 1QI2A 3PUOA 1OG0A 3AYTA 4CNPA 4TUFA 4NQ1A 3BAJA 1CYGA 2DVXA 3PBMA 4MG4A 4DJEA 2EJAA 1AJZA 1TTJA 3HU7A 3UWVA 2OSXA 3T07A 3SCOA 5K9CA 3GDLA 3L0NA 3N6JA 1F8MA 2XSAA 4GBDA 3PR2A 2WSRA 4C6EA 3M0VA 4DX3A 5BRQA 1DWAM 2OLAA 4JQ3A 3VDCA 2YL5A 3ATZA 4QE4A 1KBKA 3B8VA 4V15A 4UQ9A 2PC8A 3VK5A 3UXAA 4L65A 1T41A 3FDGA 3IARA 3VOJA 1HVXA 4ZTYA 3LNMA 3MYOA 4AIUA 4V1XA 5EU9A 3OEXA 3QV7A 1I60A 5AC5A 3VO0A 3TA6A 3FLUA 1PCWA 4A8LA 4DJED 4AVFA 2AL1A 3OVRA 4U33A 4W87A 2QV5A 1VYSX 5AZ0A 3TFXA 6CGTA 3ORWA 2G3MA 2ATSA 3ARPA 4KF1A 1DV7A 4O0ZA 2CZVA 4E3VA 3ERPA 4BQ2A 5CBJA 3CUZA 4LF1A 4MPKA 3UWWA 3C2VA 1OF6A 4S3FA 4WEVX 4AF0B 3R89A 1HGWA 4KQNA 4XD3A 1PIFA 5REQA 4XVDA 1C7SA 1MUMA 1UWUA 3CUXA 3QMSA 4ICNA 2GOKA 1C9DA 2NQHA 1AA1B 3NSXA 4I9TA 2XIJA 4HK7A 4V28A 1SZRA 3TC3A 3QR1A 4O1BA 1A0DA 4JL2A 3TQKA 1REQB 5EGRA 4E2VA 3GH4A 2OEJA 1SW3A 2W67A 4FALA 1FDZA 2EPLX 4J3SA 5CC7A 5A8GA 2W63A 4UOQA 2PS2A 1UUQA 4MNLA 4MJMA 3IVUA 5GQBA 1BTCA 1O5RA 3TWBA 2ZXQA 1JAEA 1HTIA 4ATLA 3W1RA 1MXSA 1CXIA 2GGGA 2V5LA 3CL8A 1MRAA 4FOKA 1XC6A 2D1ZA 1KV8A 4H7ZA 3UY7A 4CQDA 3APGA 3BUVA 1LBMA 2I1OA 1UQZA 2FTYA 2AKMA 3UCQA 1XF0A 2QIWA 3DC8A 3B40A 4QG6A 2OT1A 4ORMA 4D8AA 2JEPA 3NPVA 2ADAA 1A5LC 3GU9A 4IFKA 4JTQA 3H7VA 4IJCA 4DBSA 4OBTA 4CD8A 1R2SA 3C2YA 2WOQA 3W7PA 3OVGA 2QYGA 3POHA 1EOKA 4V1YA 4C6CA 4X9YA 3SQLA 1BKHA 1LBLA 4WKHA 5FEXA 4ICMA 5K4XA 3PPGA 4Y2WA 1TWDA 2QGHA 3WDPP 3AYVA 1BAGA 1D3HA 2CLFA 2XDFA 4MKVA 4QNWA 4LB4A 1IT8A 3KCLA 2DEPA 4W4QA 3PBGA 5C70A 3TU9A 4JX4A 3HIJA 5CG0A 4PSRA 1T99A 3WL1A 3KOFA 1QATA 1VH7A 3R25A 4QG8A 3VIGA 3OYXA 1IT0A 4XZNX 2Q09A 4J1OA 1XLDA 1EBGA 1XYZA 4XD5A 3URNA 3OVQA 1M68A 4CQ9A 5CSRA 1V79A 2BY3A 3TTYA 4U4MA 1X1ZA 4JTLA 3N2BA 1H0IA 5JBEA 4B5WA 1TIMA 3VDHA 4O16A 3CZEA 1A5BA 1UH3A 3UVAA 1OC6A 4HHPA 3BGJA 3AMKA 3MUY1 4PBEA 3UQNA 1A5OC 3GAKA 2GYIA 5GNXA 4RCXA 1SM9A 1YXDA 4WGXA 3U5UA 3WJZA 1VLWA 4GCAA 2D2HA 4U2ZA 3LCFA 2RGLA 3VM5A 1CT5A 4J3VA 1XGEA 3OGRA 5IHSA 3IJQA 4LUIA 3G1VA 2CZ5A 1GVQA 1GQJA 4WKFA 2DUXA 4ZB2A 3H2MA 4JFTA 1FXQA 1OGGA 4UNKA 4LC6A 1V93A 3E2SA 1JGMA 3TR2A 3BO9A 3L4YA 2DZBA 5FJOA 3TTOA 4HQVA 4L6DA 3NO1A 1WQ5A 2XIMA 2WO5A 1HUVA 3H23A 1VHNA 5HOSA