3H2FA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
269
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
total genus 95
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2fA00
4NILA 3BOFA 1TWZA 4D8ZA 4S23A 3H2OA 1Q8JA 4O1EA 2OGYA 4S3BA 4DJEA 2DZAA 2YCLA 2BMBA 4DB7A 3TZNA 4DAFA 3BOLA 4O0QA 3TYCA 1TX0A 4NL1A 2H9AB 4S3AA 4DJFD 2H9AA 3TZFA 3TYAA 4S3FA 1TX2A 4D9PA 4DJDD 1AD1A 3H2FA 2VP8A 4S3CA 4NIRA 4DJDA 1Q7MA 4S3EA 2YCIX 3H2AA 2VEGA 2DZBA 1TWSA 3TR9A 4D8AA 4S39A 4MWAC 4DJEC 1AJZA 2Y5SA 3H21A 4G9PA 1Q7QA 3H2NA 2Y5JA 3H24A 3MCNA 2Y0FA 3MCMA 4DJFA 3TYBA 4PZVA 3TYUA 4DJDC 2YCJA 3H2CA 3TYEA 3K13A 2DQWA 4NHVA 1AJ0A 1AD4A 1Q8AA 3H23A 3V5OA 1Q7ZA 4CCZA 4S3DA 1F6YA 4MWAD 4DJED 4C1NB 4C1NA 3H2EA 3H22A 3MCOA 3H26A 4O1FA 4MWAB 4MWAA 3TYZA 2YCLB 4DJFC 2VEFA 2E7FA 3NOYA 1AJ2A 2YCKX 3H2MA 4HB7A 1TWWA 3TYDA 1Q85A 4S38A 5JQ9A 4DAIA 4MWAE 1EYEA
chains in the Genus database with same CATH superfamily
1FWGC 2ZBTA 1B1YA 2QHAA 3NEHA 4E2OA 3ITOA 2GYIA 4BF7A 3SRDA 4WCJA 3HB9A 4OU1A 3WJZA 3GYEA 3WLOA 1RVKA 4S23A 3BAJA 1NF0A 5EMKA 4BF5A 2XSAA 2OGYA 4MJZA 1T7LA 3B8DA 1W1PA 4M1RA 3H8AA 3HGJA 1S2UA 1TVNA 3OU8A 3KLLA 2QQ6A 4H8VA 2QCHA 3KOWA 4AZCB 3VE9A 2C8NA 4OBTA 2X0SA 3MWAA 5C6MA 3NVDA 2OZ8A 5G5IA 3P6LA 4DM2A 5C7VA 1E1EA 3S6OA 3F03K 2YXOA 3USZA 3IIVA 3NAVA 4XBSA 3IJ9A 1TELA 4P8WA 3STFA 3I65A 3GXMA 3TROA 5MHBA 3ITCA 2Y0FA 5DCEA 4LAUA 4WDWA 5I00A 1B0IA 5T91A 1UWTA 1XLCA 1N8IA 4C6PA 4RE2A 2DFAA 4HA3A 5A6AA 3WUBA 4ZQNA 3SBFA 4AQLA 4UTIA 1QVBA 3S2LA 4C6BA 4JR5A 3O9NA 1Q45A 4HNVA 4G7EA 4ZE4A 1YDYA 4AIEA 4YYFA 3V0UA 2E3ZA 2A3HA 4PB3A 4RXGA 5GNYA 3T6CA 2A2IA 2WKJA 3HGOA 1UR2A 3AWNA 1W3LA 3KVMA 4ZTXA 3KP1A 4CQ8A 5ABTA 4U3CA 1O5QA 3LHVA 4HKPA 4Q8PA 2B81A 2BNJA 6TIMA 1WDSA 2YYUA 2YL6A 2PTWA 1J2BA 2OPJA 3LX9A 3F5LA 4NL1A 4IX2A 1LG1A 4N7QA 1TG7A 3E2RA 1L2QA 4RZ6A 3DHUA 2F9RA 3OTRA 1MW1A 3ZS4A 3RDKA 4GX9A 1T0OA 4GGBA 3GNDA 4L4PA 2WNQA 3EYPA 3RR4A 3NPWA 3UXIA 2VR5A 3PN8A 5A8MA 3WJSA 4ROPA 4JDBA 1RLDA 4U2YA 2BWGA 3DFQA 3WD4A 1F6PA 2PGWA 3G77A 4NI8A 2VC7A 1S3HA 3ARSA 4I9JA 4W93A 3W0KA 1EZ2A 1B4KA 1CGUA 4AWSA 1H62A 1PHQA 4E6MA 2WKGA 4BZYA 5D04C 3NNTA 3VOCA 3TN6A 1VH7A 3IV8A 3SJNA 4FB7A 2ICSA 2WPBA 2B7PA 4EPBC 2V82A 2YW4A 4PE8A 1AD4A 3L12A 4GFIA 3SCPA 3BJSA 4OOUA 4IMGA 2DSZA 3O6AA 5K9CA 2AQVA 1ZZMA 3MZ2A 4N42A 1US0A 2FFCA 2YA1A 1NJJA 5EFDA 1ZSXA 2OFJA 1KFLA 2A5HA 4W7UA 4EACA 3K8KA 1IIHA 3RU8X 4O1AA 4S1FA 3VFLA 2PGFA 4HNUA 1GVOA 2VFEA 5I78A 3P93A 3F2BA 1L2UA 5CSUA 4IIFA 5AYYA 5AC5A 3RXZA 1LRTA 4Z42C 2Q8LA 2VDIA 4Z1AA 3ZR5A 2J78A 2YBVA 1E4IA 2OTDA 5I3JA 2EPOA 3PZQA 4MY9A 4ORIA 1XH2A 2INEA 4GQQA 3M0IA 3EGJA 4MADA 4UQ9A 3UZYA 4GIYA 3THUA 4KGJA 3SRKA 1OFOA 3QFWA 2Y7DA 2YXXA 4FOJA 3UA4A 2TRSA 4AX6A 2PDGA 1OQFA 1KXTA 5ABGA 1XIIA 2DV0A 3NSMA 4Z2IA 2A3CA 1E1CA 1H7RA 2P76A 4PTXA 1PVNA 1KO0A 3WBAA 4FIRA 4W5ZA 1IGWA 2WMIA 1KXVA 4RE4A 2W62A 3W7HA 3VIMA 1Z89A 2XFFA 2W0UA 4K7VA 3LCXA 1NQ6A 2YA2A 4FALA 3WNNA 5KMYA 1CLXA 3E0LA 3RM8A 3VNIA 2VCBA 5EYWA 4HB7A 3GRIA 1ZQ5A 3RRAA 1VFSA 2GLKA 4HA1A 3FSTA 1XP3A 4M3PA 3DESA 4PTNA 3A12A 1C91A 2ISVA 4OHQA 3CQKA 1PKLA 4YPJA 3W7EA 2WJZA 2V69A 1HKKA 3QOKA 1JUBA 2Y88A 5HQLA 5CGMA 4GH3A 3N29A 2EPKX 3PUDA 1CXFA 4NSBA 2E6FA 2WOQA 1OX5A 1ZS2A 3BVJA 1XX1A 3TP4A 3QGVA 3LRKA 4HGXA 1XD0A 3VIGA 3AIWA 2E9BA 1YTKA 2OT0A 1O1HA 3LCIA 3GH5A 4QNWA 4MNJA 3SGZA 5CPSA 4E38A 3CAKA 1UD2A 3WQ5A 2J9YA 2VGBA 3UWEA 1GKRA 3JU2A 1WX0A 5BCAA 1WOBA 1GONA 3TW6A 1KCKA 4B15A 5GJMA 1DEDA 1NDWA 1QRQA 1XLIA 5FF4A 4E4UA 3IJLA 3DZ1A 2QCCA 1W56A 1F4AA 3GXPA 5JUVA 5CKSA 2X0YA 2VXNA 2PTDA 1UZHA 4FNQA 3WEOA 2OZ3A 1A5BA 4CN1A 3A4JA 1GOWA 5H8MA 1XLKA 2XH4A 2PDIA 1YHTA 4GPNA 1JI2A 2FPVA 4CU7A 4BI7A 1A5MC 3CMJA 5AVNA 4JYFA 2IQ0A 3LGGA 2PP0A 5HDRA 4DHGA 4B4FA 1Y5VA 3WLHA 2CLEA 2DIKA 2X1SA 4U3AA 1GZ1A 3W2NA 3WN6A 3TQ0A 1UZDA 1LF1A 4GVGA 4QS6A 5A1AA 1AZ1A 1ZU8A 3L4WA 1OX4A 1REQA 3UESA 2H9AB 3M0VA 5CC6A 2PSNA 4L9ZA 4HU8A 4C1LA 2YB1A 2V2DA 3MSGA 1LBLA 2Z1KA 4NZFA 3B0UX 3MZNA 5EMJA 3ALGA 4UOZA 5C9WA 3KRUA 2Q8ZA 1R2RA 4JYDA 2UY5A 2J7GA 4FEZA 2ZRZA 3SRFA 1P6BA 1YDOA 1UB3A 1JXKA 1LROA 4LAOA 1PUDA 4KT2A 1FP9A 3WBWA 1VFHA 4QTGA 2RDWA 4AXNA 5LIYX 1BWLA 3GKFA 3OVGA 1MSSA 5I3GA 4YTTA 3ZT5A 3DHFA 4EP8C 4JOMA 3MUAA 4ZO6A 1GKQA 1QTWA 3V0SA 1B4EA 4A2RA 2WSYA 5K4ZA 5BRBA 3EDKA 1WQ5A 3POCA 5AFDA 1I2OA 5KZMA 4ZQPA 4UMCA 4LB4A 3EDDA 2G4JA 1TO3A 3T42A 5CJ5A 2XIIA 5IHSA 4KESA 4I5RA 4JHMA 5G2WA 5BOEA 5LSMA 3U5YA 3AJXA 2NQLA 1LBMA 3FIGA 4BI6A 1W5QA 4MHBA 2YIHA 2VZVA 5GNZA 3FVDA 3WF1A 3CXOA 3GDLA 3CH0A 3ZYZA 2IPWA 3VX1A 4RE0A 1GVQA 4CNNA 5CBBA 1KM3A 3QH2A 4ICCX 2V63A 2EO7A 1XDJA 3K4DA 3VDCA 4JAWA 4QSFA 2Y1HA 2QJJA 4UXDA 1XYLA 2VEGA 2JKAA 4XKYB 4GY1A 3TR9A 3IJIA 2EXOA 1JRBA 3NQ2A 2WO5A 2ACUA 3BSHA 5CPNA 1QNRA 1EH9A 3ZLHA 2NV1A 1K6AA 3DUGA 3AS3A 4V33A 1EC7A 3SUVA 2XFWA 2INFA 2IKIA 4KQNA 4JZ5A 1XPGA 4N2YA 5E1QA 5KZDA 5C5YA 5C9XA 5GVJA 2H3BA 1FCVA 5FSDC 1U30A 2P5NA 4Y90A 2VURA 3JRKA 4KPLA 3T0BA 3E38A 1WNOA 4HMCA 3PUGA 3WH5A 3NQVA 4O8AA 1VJSA 3MV01 1PKYA 3DC8A 1J0KA 1XSJA 3GDMA 1SZRA 2CFFA 3BMVA 5F4XA 4PB4A 2ACSA 1FH9A 4CNPA 4F0SA 5JIPA 3M43A 1NP2A 3M07A 5KETA 3EWBX 2GFTA 4EIVA 3GNPA 3B0YA 1PO9A 1LQ0A 3CWOX 2REQB 3UNDA 1PWMA 1ZAIA 5G2HA 1A5UA 1XKYA 2E25A 7REQB 1R7OA 2HZGA 4ZSTA 3QZEA 3URNA 4A8IA 4GK8A 1ODZA 1IHIA 3QPEA 4DF2A 1QNOA 2WHMA 1TREA 3Q94A 5BYWA 1WE5A 1TJ0A 3I7RA 5FI8A 1WXYA 3GNOA 1OZQA 3P82A 3BMWA 4LT9A 3TN3A 3W1QA 4V28A 2VOTA 2G41A 5JBFA 1VLWA 3WQVA 1E43A 1GNXA 1XYCA 5K3VA 4LNYA 3DG7A 3RILA 4GE8A 2D22A 3SSJA 2OQHA 4XQ6A 1KTBA 4GMEA 2VX5A 4XO6A 3TW9A 2GUBA 4G2DA 2J7DA 1KM4A 3UR5A 1JIBA 2VCCA 2BY1A 4HHPA 3LBMA 5C9ZA 4K3ZA 4IP4A 3EOLA 4R7WA 1FXQA 1WOAA 3UZWA 3TC7A 4ACZA 1F3XA 3N2BA 3IIXA 1OK6A 3R7MA 3T1GA 3VNYA 2QUUA 4PTDA 1PCKA 5LA0A 1XPYA 3GXTA 4GYKA 3P8JA 1F7BA 3TKFA 1KFWA 5CZJA 4H2HA 4I7UA 3WENA 4JX6A 4FHAA 5DN1A 1TWIA 4O0QA 4LWWA 5K9XA 3WF0A 4JQ1A 4Y8EA 1K1DA 3GW3A 4MJ2A 2Z1XA 1FBAA 2GK1A 3M9YA 1BTCA 3RIKA 3URBA 3KBWA 2C1HA 2QR6A 4ZODA 5EMYA 4PCFA 2CC0A 2XM1A 2Y8VA 3AMGA 4UZUA 3DAQA 5U4NA 1XLHA 5AC4A 4BJHA 1OWQA 1OK4A 3I10A 2BHYA 5B7ZA 3O16A 3UJRA 3PPHA 1YW1A 4G7EB 3MP5A 1UD3A 3HG3A 5JBEA 3N2TA 4O4WA 4JPGA 3VIJA 4CN4A 4QR6A 2X0HA 2QLYA 1W5NA 2BFGA 2PB1A 4N02A 1G94A 1O5RA 5D9OA 3CTLA 3H22A 1TCMA 1OT2A 3UWZA 2VEMA 1OF8A 3MW7A 4UQCA 1E0VA 1QI0A 3WH7A 2G37A 4XVDA 3LTSA 4FAMA 4GJ1A 3R1ZA 4B16A 3R0KA 2DH3A 2V68A 2OYMA 1F76A 2ZADA 1JCYA 5AHNA 5CG0A 3U4FA 5I3HA 4HNCA 3AXHA 4M51A 5J8LA 4M6PA 5G4HC 1ESWA 4W84A 2NUWA 2D3NA 4DB7A 1OF6A 2FTWA 4HZ8A 1VIWA 3W22A 4YTUA 2Y70A 3WQOA 3FHAA 2Y63A 1UG6A 1MFVA 4KIRA 3INPA 4MFEA 3PANA 3VNKA 2J7HA 2PS2A 1CNVA 3UXAA 3LBCA 2QF8A 3R6IA 4B5VA 1X39A 2OB3A 2C0HA 4KCVA 3E96A 4D8AA 2XJ7A 3L68A 2QCDB 4DF0A 4S3GA 1M7OA 1FDZA 3MMDA 2INZA 2WJEA 4M80A 2D20A 3N2CA 1K3UA 4EAYA 1R7AA 2D1ZA 4H1ZA 3E12A 4CVUA 1AW5A 1OFBA 4C6KA 4D1IA 3NXFA 3SY1A 4LEQA 4KKXA 3EMZA 1H3GA 2E4TA 4TTUA 3TSDA 3H4GA 1M9HA 1QPOA 4ECLA 3CWHA 3MS8A 4S3DA 1EP1A 1KM2A 2J8FA 2J13A 1HO1A 3MDWA 2ISDA 2DSKA 2TYSA 2W61A 1XLBA 3NZQA 2PUZA 4AEOA 4NAFA 1Q6QA 3IWPA 2VEFA 2XIQA 2VWTA 3GDTA 5F2IA 4Z0SA 2QJMA 1U33A 3VUPA 5A8OA 3AMKA 4DY1A 2OLHA 2WNNA 1OVDA 4DVOA 3CO4A 3QTGA 2ZUVA 4Y9NA 4UMBA 5CQ1A 3M0LA 2R1NA 2QNEA 1BYCA 2NLYA 3UG5A 3TMLA 1Q2SA 3LQLA 1J18A 2XVPA 5C71A 4H83A 4JTUA 3MC5A 4WLCA 3B9AA 4H00A 4KEVA 1BF6A 4QRNA 4M6VA 4Q8QA 3QSTA 2Y5SA 3T0TA 3I4KA 3QTPA 3SN1A 1EDGA 3Q37A 4UTUA 4XTIA 3VO0A 2E5CA 4QITA 1CENA 1HFBA 1BRLA 3TCEA 4FX8A 5A69A 2JGQA 4M7TA 4AXKA 3E3HA 3AUOA 3G1XA 1XGEA 4MB3A 2BOGX 2Q6ZA 1QNQA 3I6EA 2CETA 3VMNA 1Q6CA 1IEQA 5LA1A 5BU6A 3W1XA 3R5EA 3CUFA 4D6CA 3ZWSA 3C2FA 2BOFX 4H7ZA 3EPOA 2BGNE 3NSNA 4KFOA 3PJXA 2VQTA 4DQWA 3PB2A 3ZM8A 1MI3A 3W76A 2X2YA 1VS1A 4JIRA 1QATA 2G95A 3KE0A 1TPUA 1UKQA 1KQYA 2DZPA 2W5FA 3AMCA 3RNDA 4UFLA 2PLKA 3TTEA 4ZZ9A 4MVAA 1JULA 4BFAA 4W87A 1X8CA 1YNQA 2P0IA 1SFJA 2PODA 4MY1A 1MRAA 1UBSA 1N8FA 3W7NA 1LLOA 2EG8A 5CZSA 4E2BA 5G2IA 3WF3A 3TUUA 1TZ9A 2A79A 2WVVA 3QC3A 4OV9A 4Q33A 2D0HA 2XHYA 5FJOA 3XIMA 2YDAA 3NUKA 4G9PA 1QW9A 3B05A 3KP0A 2PRLA 4L64A 2A7NA 3EA2A 1ME8A 4L6OA 2GGJA 1SMAA 1FWHC 1MUMA 4EK7A 1MVYA 1P0EA 2YPIA 3MUY1 3W72A 4XX6A 3N2OA 1WKDA 1JFXA 1HP4A 3QHMA 1DIOA 1KBJA 3AO0A 2IKJA 2Z4GA 1IE7C 3FKRA 3KL5A 4HMDA 2Z0IA 4UFIA 1H1YA 4JHZA 2P50A 5A6BA 5DT5A 1YBQA 4GKLA 3SAZA 1W17A 4HOWA 1QWKA 3FHQA 1FP8A 2VELA 1F9CA 4URIA 3SFWA 2OT1A 1OC7A 3KDOA 3QN3A 4DRSA 4PR4A 1J2WA 3CPRA 3FV9A 5D2WA 5JQ9A 1DORA 1AQHA 3QGKC 1OY0A 3S1VA 5CPQA 4B5WA 5DX7A 5IRPA 1KGXA 5HANA 3ARXA 3W7KA 7XIMA 1JDEA 5LNSA 1CGXA 4FLRA 1HL8A 1HGYA 4JKKA 3KDNA 3OYZA 1XWYA 1QI2A 1M5WA 4GRSA 2OJPA 4M8UA 5ECVA 1XYZA 1UPMB 1VEOA 2F2KA 1RK5A 3GW0A 1TJPA 3CIXA 4ZB5A 4EXQA 1JAKA 3OLGA 1DWGM 4BWLA 4S3EA 1XC4A 1FY6A 4PMJA 2V5CA 3UW6A 4Y7EA 1UIOA 4GINA 2QVHA 8RUCA 4FMVA 3MHFA 1F61A 5DO8A 3VPLA 5D8ZA 3ZLFA 1J6OA 4WIWA 1E73M 4XK2A 2ON3A 2PC4A 3NURA 3W37A 3H2NA 1OCNA 3IIOA 1UP2A 3B8TA 2V2CA 3PPGA 1OHLA 3B3DA 3GXNA 3LPOA 1FWBC 3ABZA 4C90A 1O1ZA 3VGDA 2VX6A 6REQA 4Y6GA 1FH8A 3OA5A 1JPIA 2R1LA 4O1CA 3GUWA 1VGAA 3IPWA 3PULA 4LF1A 3W1MA 1OFQA 4WSKA 3OZOA 4WZHA 1XLFA 3SY5A 3I6RA 5D38A 1HX0A 4JN6A 1TTIA 1XLEA 3L2LA 3VD9A 1H0IA 4Z2LA 4YN5A 4NX0A 2WB5A 4H9UA 5BW6A 2G3JA 4AD4A 2XVNA 3W4RA 2HBXA 4L9XA 2CNCA 3PSVA 2Q02A 1UC5A 3C2VA 3DFOA 2R8WA 3S5SA 3L0NA 3W7QA 4PEKA 5CZKA 5EKYA 1P7TA 2Y62A 2Y2WA 3MBFA 3VGGA 3S5NA 1FH7A 4IIGA 4Q8OA 1MQPA 2BBFA 4JBRA 3BOLA 2GVLA 3WUGA 3ZT6A 2HBVA 1YLVA 3WDRA 3S5ZA 1XF0A 1OFPA 2XH0A 3GVVA 4FF7A 4S3CA 1BD0A 1G4TA 5XIMA 3VFCA 2QMKA 3MV11 1Q4WA 1PZ0A 2Y7GA 1CECA 3TTYA 3U8GA 1P0DA 3UA3A 3W27A 3IAQA 2PF8A 2GZXA 1J0ZA 4C6NA 1J4EA 4LALA 4XSLA 1XL9A 5BU9A 2Z00A 2OKOA 4MNKA 2NXIA 1WZMA 4PBEA 2OG9A 2A85A 1DJYA 2NUYA 3H12A 3VD7A 3O8AA 3OZYA 4M29A 2DQWA 4PFMA 4IWWA 5KSWA 3WJXA 3VIPA 2P1FA 5G4EA 1UKPA 3MB9A 1WKFA 4GNJA 5K9DA 1WA3A 3TLQA 4PC8A 1TV2A 4PUEA 4OBRA 3FJLA 4GJJA 3E74A 1TB3A 1Q6OA 4PTWA 1ZJIA 3ARVA 3S2CA 4Z1DA 1ADDA 3Q4DA 4FR6A 1LWIA 3V1PA 2OO0A 1ZP3A 3GVGA 4DEFA 3PB0A 4QS5A 2X2GA 4MNLA 3PY2A 4J3SA 4QIUA 4KWOA 3WD1A 4X2RA 5LIKX 5A2BA 3KCLA 1W1B1 3KVJA 1JZ8A 1CPUA 2OEMA 5XINA 3ARQA 1Q7MA 3PNUA 3TC3A 3WK1A 3AIQA 2OODA 2HVMA 4P7LA 3WUEA 1O7AA 2PTXA 2Z1BA 1W3TA 2QCLA 2C71A 1E9LA 3GXFA 1BXNA 3VNMA 1KGWA 5FKYA 3RPDA 3NOEA 3AOFA 3M64A 4IIEA 1WDDA 3H7UA 1GCYA 2HK1A 3BWWA 4MKNA 4YXGA 2G3MA 3MA8A 3OHMB 1PCWA 3E0IA 4UTWA 4JCMA 1C3FA 1V77A 1MFUA 3LHWA 3H2EA 1EUAA 1NWSA 3JR2A 3F4DA 4A3RA 4AZ5A 4N9BA 3ABSA 4MWAA 1X8FA 4RE3A 4RK8A 3U48A 2WCSA 3FSUA 1TIWA 3TSMA 3WQ6A 2IPJA 3DERA 3DKJA 3M0KA 1RH9A 5K7JA 3B4UA 1IF2A 1HKVA 2E8YA 3TJXA 2WC4A 1W31A 4LGXA 2ZZ4A 2EKCA 3BCDA 1E15A 2ZXDA 5AC7A 4DJEA 2FMNA 2X41A 2YCLA 1I60A 1CBGA 3UCCA 4IT1A 4ZA0A 2NX1A 4F40A 1ONRA 1JCMP 1UH2A 3WD0A 4Z2GA 4E4PA 1LOSA 1S3TC 1TR1A 1VRXA 4LUSA 2RFGA 5I6SA 4PA8A 2WV8A 3HPSA 3W82A 5HNNA 2ZWYA 4E8CA 1RQHA 3U0HA 1EJXC 2ZUUA 2WMJA 1AJZA 1IEVA 4NX5A 1BYBA 2ZE3A 1DIEA 2KX9A 4TXEA 2DUZA 3QKEA 4F48A 4M6UA 3WQFA 3HURA 3TYBA 3KFTA 1GG0A 5FL1A 3IUHA 5LNUA 4HU3A 2J8GA 3MHGA 3LCGA 3T44A 1XGZA 4BCEA 3V5OA 2XIBA 3JZEA 3CT2A 4EPKA 1EEXA 4JYEA 1RY8A 1DBTA 3B8WA 1U5VA 2DT2A 2DDXA 3U6WA 1CZ1A 5F7UA 3I6TA 5LGXA 1TJ1A 1UMLA 4UNLA 2P8CA 4Z08A 3GG0A 2FPYA 2OEJA 3UZXA 5H1WA 4OJYA 1AMKA 1ZLPA 1E0XA 3MO7A 2CIPA 4AVFA 3IAPA 3WY1A 4RNIA 3WD2A 5KITA 1NAL1 4JD4A 5LNVA 4X9SA 1MQQA 4LXFA 3CYVA 1HKJA 3QBUA 3CNYA 2OLAA 2VD8A 4FOKA 4I5XA 3HPZA 2F8QA 3M16A 2YR1A 3NL3A 1XI3A 4ZO9A 4X63A 4PTVA 5IFTA 1B3XA 3N9RA 2ZC8A 3TH6A 2PFHA 3OIXA 2A0NA 4J40A 3NR0A 1ME7A 5CSYA 3KBSA 5F4WA 1QK0A 4WSJA 2C6QA 2WZHA 4TUFA 3LTYA 1BYAA 2PURA 4UNIA 2ABBA 4GO9A 1FDYA 3USBA 4MG4A 4LVFA 1ONEA 3BSMA 1KD0A 3E0WA 4IUGA 3GNRA 4Q4QA 3PBUA 1VIZA 1F6YA 2OKTA 3RF9A 3S42A 3TTSA 4RXFA 1A5AA 3C2RA 2A7PA 2V5KA 1QOPA 2PBOA 4GCAA 2V67A 2W4XA 1Y65A 4QDPA 2ZXQA 2Y8KA 5FF7A 3RGTA 3ZXWA 1R3YA 3SQSA 3HBLA 3P61A 4PUNA 2J88A 4Y9OA 1B3VA 3MANA 3C3NA 2ZUSA 5HQMA 1NH6A 3TAOA 4XISA 3QV6A 4ATLA 4HSHA 1WDRA 1QHZA 4MTVA 1XLGA 1DJXA 2AL2A 3QLLA 4B9YA 1BG9A 3QQWA 2PP3A 1L8NA 4DX3A 1FWWA 3LD5A 3CWNA 3LRLA 3LXAA 3SECA 1BRLB 1E0WA 2YL9A 4I3GA 3QLDA 5A6MA 1V7AA 2PDHA 3THAA 1DL3A 4W9TA 3NQAA 1SQ7A 1US3A 3IRDA 3NPUA 1OC6A 1R9ZA 4FX6M 1EX1A 3I4EA 4AEEA 1YRRA 4IXXA 3T0CA 4PULA 3UCQA 5AHIA 3CL8A 1YDVA 2VMFA 1YKWA 3L0GA 4RV3A 1GVEA 1H51A 1H09A 2ZA2A 1Z32X 1AZ2A 5E0KA 4LF2A 3WQEA 3AYTA 4PSPA 4IGMA 4AAJA 3NPXA 1Z48A 4QFUA 1XG4A 4XAFA 1FWJC 1VR6A 4AEFA 1AFSA 3FA4A 1AVAA 4NRRA 1ITCA 3GG1A 2F2HA 1E0TA 2DVUA 1A0DA 1J96A 2WVVB 3LY0A 3QHNA 1EQCA 4RW5A 3BCFA 1O5KA 1QOXA 1DJNA 4XVEA 4E8GA 2WMGA 1JYXA 3CQHA 3GTHA 2O9PA 3S5OA 2BVYA 1CLKA 2BVDA 4C6JA 2HQAA 1X6LA 3N3TA 5C55A 2UWFA 3C61A 4LVGA 4X60A 3LCHA 5AN7A 5B80A 1DQWA 4QJ4B 1TWSA 1RHCA 1VCGA 5A6BD 1E6NA 1RJQA 3OLEA 3KL3A 1SW0A 1C29A 5CZTA 3W1AA 1YBQB 3MCNA 3EXTA 5BOOA 2NW0A 1FWAC 3K4AA 2QIIA 1EJVC 1TCDA 4HZ6A 2YDQA 4KGLA 4UTTC 4O14A 3UWUA 2BDQA 4HOXA 4IQLA 4A8LA 1VBRA 4GLEA 1CIUA 4JQ2A 1GOXA 2POZA 3NPVA 1A4LA 2VHLA 3NZGA 4FO4A 4QX4A 4YHEA 3ECQA 4GKTA 5HAOA 3THCA 1WBJA 5LNRA 2RKXA 2R82A 4I7WA 5DY3A 3RN6A 4X0NA 2GOUA 4C7DA 2CWNA 3VOGA 4V15A 4GXWA 1XM3A 3B9OA 2ZRYA 1ZBCA 3N3MA 3OO2A 4N9EA 1HN1A 4A3YA 1GVFA 3CQIA 4ZTYA 1XCFA 3UY8A 3AYSA 4UTJA 2WMHA 4LAMA 3REQA 1V3HA 3M7SA 1XHGA 1B3YA 1G4EA 5EBUA 2TMDA 3SJ3A 1ZBVA 2Z29A 3IK4A 3WK0A 2JKEA 1D8WA 3VKBA 4V1YA 3U9IA 3PF3A 4YYCA 2DU2A 4L56A 4Q4KA 3TAKA 3VMPA 6REQB 2X05A 1DXIA 1EPVA 2VENA 3T0DA 4U2ZA 6TAAA 1GJUA 3R12A 4OBSA 1E4NA 4YLWA 2GGHA 4PL1A 4IMDA 1W3KA 2V3GA 3LN3A 3WNMA 3SGGA 1PZ3A 3CUJA 4QNEA 1B30A 3CZKA 2WSKA 3G1DA 3PWGA 4CD6A 2CLMA 2ZRXA 4JTEA 2I9UA 3N12A 1QWGA 5B7YA 4JHOA 2D0FA 2CLFA 4NNBA 1WAUA 4E3TA 3H4XA 5EU9A 3BLFA 1NOUA 3AHVA 1XQLA 3AHZA 4BQ3A 3CV7A 3VZXA 2P88A 1TTQA 1FWDC 3EAUA 1GZGA 1KV8A 3R13A 5DY2A 5I09A 2OZTA 5IM51 3VDGA 1K9FA 1W9XA 5JMUA 3ITVA 3NSXA 1SJBA 3QVQA 1THFD 4ZB0A 3NTYA 4PFHA 5AB3A 3CUGA 1XYMA 5HPCA 2QPUA 4IQDA 2C15A 3MTWA 3GNNA 3DG3A 4FNSA 1RAKA 3WLLA 4DUWA 1K7XA 3IIZA 3W23A 3HMCA 4FI4A 4C6FA 3MPGA 2OWCA 4WY0B 3SCRA 1V08A 2DJLA 2ZKMX 1BVZA 1OIMA 4P5UA 3M0HA 5I3IA 1K4HA 2J8TA 3GIYA 1MZRA 1WKEA 4B5SA 2PDWA 3H7RA 1BF2A 2DSVA 4Q32A 5C2CA 4W4QA 2WHJA 2GL5A 1C8YA 4D72A 4ACYA 1VJZA 5E0FA 1S5VA 2AGTA 4OTKA 3ENLA 5IOBA 3H24A 2OVLA 1DJZA 5C7HA 3W7DA 2NX3A 4WXZA 2BZNA 4WRHA 1KTCA 4ML9A 1X98A 3GKAA 2QDHA 4PMYA 2X09A 3TQKA 4LRSA 1JQVA 3SN0A 4KS0A 2EHHA 3H26A 1A3HA 4PODA 3W71A 3S1XA 1H2JA 1SFLA 1J5SA 1M01A 2IMRA 3N17A 3NIYA 2EQDA 7ENLA 5KEZA 4PRTA 3MQTA 3EWDA 4HCHA 1L6SA 3V5FA 1BTMA 3E0FA 3SCWA 1TQXA 2W3ZA 3M6DA 3W7MA 3BE7A 3QHOA 4P7OA 3QEZA 1TIMA 2WCAA 4DN1A 4AZCA 4UB9A 4XBKA 3GX9A 1TV5A 5C9UA 1PS9A 4HHHA 1OADA 3H2AA 2HRWA 3VNDA 4C7FA 1EHNA 3UT0A 2DZXA 1DXEA 1OGGA 4ZCWA 1YXYA 2CW6A 2HDJA 3R58A 4MUZA 2EG7A 1NY1A 3LI1A 4YHGA 1UASA 4GG9A 4MNMA 3KXQA 1FX6A 1R5YA 2ZX9A 4KWSA 2R6OA 1UWRA 4J3TA 1JNEA 2VFFA 4FLQA 3CM4A 4MZ1A 4D6FA 4GVFA 3SUTA 4UQBA 1VC4A 1CXLA 4DJED 1JYNA 1G67A 2DH2A 2Z25A 5CH9A 3MCOA 1DPMA 4HBKA 8A3HA 1A5LC 3AROA 2YCLB 3VYLA 1ZBWA 3WMCA 1QNSA 3W7RA 6ENLA 1I1WA 1YQ2A 5DXYA 3WG6A 4DLMA 4IZGA 3TYDA 4H8UA 1JZ2A 2VZUA 3RLVA 3KWXA 1XYAA 4ALDA 3E1F1 4LUSB 4GVIA 3RCMA 4X0VA 2BGSA 1QXLA 3G8RA 1A3WA 3KL0A 3LHUA 3VNJA 4Q8UA 4OE7A 4LCRA 3AALA 3ZT7A 3P14A 1W1YA 3WNPA 2RJGA 2QJNA 4KWUA 3TTQA 1SR9A 3WFZA 2PAJA 5M5DA 5BZAA 4J27A 4Q22A 4V27A 3RJYA 4NJGA 3UXKA 2ZX6A 3VINA 1JDAA 3N9SA 1R87A 3VTRA 3UVAA 3KTXA 1UWIA 4GH1A 4C6CA 3GC4A 1GK8A 4Y96A 3UG8A 4JNMA 3WNLA 1OIFA 4Q4RA 1DJWA 3IRSA 4M19A 3GAYA 3AAMA 3WK2A 5G1MA 3MMTA 2Y85A 1V51A 3AISA 4MYAA 4LS1A 4UC5A 5D2YA 1U2YA 3RFAA 1OFRA 1XISA 1S5NA 4X3ZA 2H8XA 3PTKA 4BF9A 2V3DA 1JF6A 3G1FA 5A6SA 2GWGA 1UD6A 3HA1A 5AHFA 1MDLA 1O12A 1PX3A 4TMCA 1OGBA 2VR4A 3TCSA 1T96A 1WDQA 4BQ5A 1HT6A 4NAEA 3LTPA 4F2BA 3W28A 3W7PA 4DAIA 4HU0A 3NZPA 3OPSA 1BG4A 1RP9A 3CHFA 1S1PA 3U4AA 3WX7A 3B9NA 4WXYA 5FSEC 1Q6LA 1JD7A 3EWYA 3SY8A 3TZNA 4UR9A 3KCOA 1W37A 1F2JA 2J7BA 2W27A 4NZCA 4PRRA 1IYXA 1V0KA 4IISA 3R89A 3ZSSA 1O4UA 4CUCA 1NFPA 4UR8A 5DFAA 4C60A 4ILSA 1F07A 2IPFA 3TK7A 1X7FA 3CC1A 3IACA 3LLDA 3W87A 3BH4A 2NSOA 2YOCA 4AWTA 3MUXA 2OYLA 1E6PA 1GPFA 1KCLA 1NWRA 4RUBA 3UGRA 1NOFA 3KHDA 1W1TA 2E1DA 3VD3A 1E70M 2VDHA 1V0LA 1EF2A 1FDJA 4FZIA 2ADAA 3LHTA 1H0GA 3J7HA 1DJHA 3G18A 1V79A 3W7JA 4ZEPA 5LXXA 2ZX8A 3O0FA 1E72M 3G24A 3WDQA 3OBKA 3W29A 1TMLA 2TSYA 5I06A 3S4TA 1UR0A 4XUYA 2FQIA 4UFHA 2PMQA 5JXQA 1DQUA 3PFMA 4HCDA 4MZYA 4Y9MA 3OZMA 1U1UA 1B57A 1J0HA 2Y7FA 3N2XA 5IDZA 3BV4A 4O1EA 4MZ8A 3LU2A 1IGSA 1GJPA 1ZAJA 3IGUA 4OUIA 4GY0A 1R3WA 1M53A 5I24A 2VUYA 1IIGA 4JXCA 3W2UA 2CCRA 3O6CA 3QFEA 4Q6JA 2FLIA 4UTMA 2VOMA 5AHLA 3AZSA 3T05A 4FNUA 1V4YA 2EF9A 1TQJA 1SVDA 3STCA 1PSCA 4UOJA 4F2TA 4GO8A 2OWWA 3R8HA 3T09A 3CPGA 3GC5A 1AODA 3IJDA 1XQKA 3QGAC 4O1BA 1NOWA 4CCEA 3GR7A 4H7VA 1EEPA 1PJ9A 3BICA 5LIUX 4UBPC 1D3GA 1UWUA 3A3WA 4UCGA 3Q67A 3M0YA 1HKWA 1SZGA 3LNMA 1V6WA 1B9BA 1W5PA 4ZQRA 3KBNA 2YCJA 1RBLA 4A22A 3M0JA 5D2XA 4TTGA 3AIVA 1Q8AA 7TAAA 1Z7AA 4GI4A 4V1XA 3EKZA 4O1FA 4GZIA 1X1OA 5DCDA 3GHSA 3KOFA 4XAYA 1V3MA 1I4NA 3IARA 3GNXA 3BGGA 4K39A 1UR9A 1Z8AA 4W8AA 1YYAA 5I02A 5D09A 3Q65A 3L5MA 1ALDA 4QDWA 3FN9A 4LV4A 3NYZA 3PFRA 3GYCA 1VBJA 2PWDA 4WJ8A 3E2SA 3LZ3A 3EX1A 4MLJA 3RAOA 1HNYA 2H9AA 3M0XA 2J6VA 1PX8A 1WB0A 3WMSA 4JFUA 1IT0A 1R8LA 2QZRA 4Z1CA 4L1WA 5FEXA 4F0HA 4GIRA 1IWBA 3PVFA 4LVAA 3S2MA 1W9VA 4NJKA 3K8MA 3SGUA 1ONWA 2RGMA 4YMZA 1TJRA 1N2VA 4GOAA 3NQ7A 3QRHA 4H9TA 4DXKA 1GEHA 4O12A 5JH2A 3QMSA 1FXPA 4GQGA 1JZ5A 5M03A 4H01A 3STGA 3ANYA 4QLLA 4R7OA 3R11A 4GC4A 1KBKA 1GG1A 2BGQA 3MI6A 1TYGA 3W83A 3W7LA 1JJKA 3CTTA 2IXUA 2WWCA 1J79A 3PPCA 2QCNA 3H23A 1ADOA 2VT0A 4C91A 2ZX5A 3SZ8A 3HG5A 2GQ3A 2VD9A 3W24A 2J62A 3RR1A 1XSKA 4JTIA 3EX2A 3UZJA 3IUIA 3BGJA 5CPLA 4OV4A 2V0TA 5FACA 5BXTA 2D2HA 2Z7GA 3LLXA 4DNMA 2B7QA 4J7RA 3QW4B 1ZJHA 2CKRA 4FX7A 4IMCA 2NXHA 4LW7A 3VIKA 4QEEA 3E6EA 4DLFA 3BLPX 1X96A 3PZGA 2ESCA 3HPAA 1G5AA 2VRQA 3VAVA 4AX7A 4LCSA 4GZ7A 3FK4A 3DHPA 4RX0A 3WLKX 1YTEA 3VD5A 4P8XA 4UQAA 4PMVA 2CBUA 2JE8A 3P0WA 3KVLA 3CIVA 3RUBL 3UEQA 3CYJA 3BC9A 1E6QM 4YVPA 2TPSA 3L7RA 3UG3A 5D8WA 2VVSA 3KOXA 1J0YA 3CGTA 2FH8A 5FAJA 4U10A 5A94A 2FDSA 3TV8A 4IUOA 2V9DA 4XAPA 3VX0A 1WDPA 1XRFA 3A9BA 4U5IA 1C8XA 1N55A 1OZMA 3GTNA 2ZDRA 1G1YA 5HJLA 3GLCA 3GVQA 3R79A 2YFOA 3ITYA 3S2JA 1V8EA 2QDGA 2QUNA 4NY2A 3LG3A 1DE6A 1U22A 3NO5A 5KTLA 1K02A 1Z69A 4MYXA 4AHPA 4C6MA 3WDHA 1NWUA 2FB2A 3KX6A 4RZBA 3MMWA 4AIUA 2NV2A 2Y24A 1M3UA 2CESA 3LDVA 4C6IA 3SM0A 4O8RA 2I7GA 3RPTA 2B0MA 3OOQA 3HM7A 1EA0A 3APTA 4LRTA 1I6NA 5GPRA 3T78A 3P67A 1S2TA 2I56A 3BJFA 4YVVA 2REQA 4S3BA 1GWJA 3VNLA 2YJQA 2BY2A 1J10A 1Q6DA 3GUGA 3T9PA 4HOZA 1GW9A 2Q09A 2FHFA 3POHA 7REQA 2O56A 3W2JA 2G8ZA 4FK9A 3LSBA 1GGOA 5E5CA 2J25A 3ITGA 3E2QA 2QAPA 1E1FA 3PZ9A 3WLJA 4UFMA 1IZKA 2CYGA 3CHDA 3BTNA 4P61A 5C0QA 1HO4A 1XLJA 1F6KA 4QHRA 1T40A 3ZJKA 4TX9A 3EXSA 2WCGA 4AB4A 3BQ5A 2YYTA 3WL1A 5FF0A 2VYOA 1JCTA 2VVNA 3O7UA 2YBUA 3K5XA 4U5KA 4KCUA 1FHLA 3N34A 5EL1A 4U28A 4IGSA 5D2TA 3OGRA 1IXQA 3BG5A 5FAGA 4DUVA 2VTFA 3KM8A 3BLDA 3WNOA 3U7VA 1F8MA 3VGBA 4B92A 3SO7A 1I8JA 4N6FA 2E6AA 1BSIA 3EBVA 4ZMGA 2C14A 1FWCC 3FJ4A 4IP7A 3N6HA 2DW6A 2NSXA 3AICA 4M5PA 3UJEA 1HF6A 2HNEA 2IPGA 3DDMA 4XB3A 4RZ5A 5D4YA 2ODOA 3NDZA 3KCJA 1KBLA 4LFYA 2R9RA 1XLDA 1GQLA 4XG1A 3EMQA 3WO8A 1U1HA 4GGHA 1POKA 4NIRA 1BHGA 4K6AA 4O10A 4QQ3A 1O94A 2O0TA 4KRZA 4RPQA 1A5CA 1A5KC 5LA2A 3OQEA 3NCOA 3F4NA 4H6RA 4L65A 1Q2RA 1DIKA 5EPDA 4LBUA 3TWAA 2DSUA 3CS2A 4HZMA 2QJIA 1S46A 1BQGA 1ZJAA 3MCMA 2H3DA 2YL8A 2WVSA 1IR1A 4AZIA 1V0NA 3A4WA 2XGIA 1WZLA 3K46A 2RHGA 1W1A1 1UH4A 1V3IA 4A3QA 1KFEA 3ARYA 1W3HA 4L4MA 4DJFC 4IXHA 3ANUA 3CZEA 1OCBA 3UXDA 4ONVA 3LQGA 1BXBA 4LUIA 3BW3A 3S1GA 1OEPA 1Q85A 2DVTA 1A5SA 1M68A 1R2TA 2O7SA 3CEUA 3CJPA 4B5XA 1LORA 3T2QA 5AYBA 1MEWA 1EXBA 3FS2A 3KOYA 4PUWA 4IPPA 1WBHA 1QI5A 4D1JA 5REQA 3BAXA 3FXGA 3TOPA 4M6QA 1TSIA 3PUOA 3OG3A 4YWSA 3PBYA 1DP0A 2VKZG 2F6UA 5D37A 1ZNNA 2VP8A 4WR3A 1DWJM 4P7QA 3P8IA 3A6OA 3LM3A 1I1XA 1C8QA 3ABQA 2VFIA 2RGLA 2F84A 4UZSA 1SSGA 4LUTB 2ZZ7A 2QCDA 2AMGA 4XKMA 5D9NA 1T5AA 4F66A 4OUEA 2HXUA 5BOFA 3LSCA 4YU1A 4K1GA 2QVNA 3SCTA 4GUFA 4LAZA 2BVTA 4CD4A 4NAEB 2WK2A 1DHKA 1RBOB 4I6KA 4CQDA 5EMUA 2YDSA 1XLMA 4QJ1A 1AL7A 8XIAA 4DI9A 4JTAA 2DEPA 2HNHA 3WFLA 2WW5A 4C6LA 3STEA 2FZBA 2BXYA 2HTMA 2YA0A 2D73A 3CL6A 1OB0A 1WV2A 3T4WA 3TFXA 3SCUA 3TVAA 2XGBA 1TTPA 2FZMA 4CKQA 3FAWA 1FA2A 4HSNA 5BWFA 4QJ3B 2F6XA 4K8HA 1C9DA 3W3OA 4R85A 3PR2A 3MP4A 2YGYA 3A47A 1XIFA 3ES7A 4NF7A 3T07A 4N9CA 3VVGA 1M7PA 4TU1A 3W2KA 2HROA 4ERAA 3D5HA 2OX1A 1Y0EA 3A5VA 2EPMX 1LG2A 4XZHA 1NDYA 3N18A 4IFKB 1QFEA 4DBDA 2QDEA 1GOOA 1HJWA 2V81A 2PC8A 2KZHA 3HGRA 3UCDA 3C0SA 3IJ6A 1WCGA 4IIBA 1QR7A 1ISYA 5EA9A 4I7VA 5IHRA 1W8GA 3NQEA 1JR1A 1KFJA 1HIZA 3MU7A 3BLOA 1MQRA 1Y7VA 3EX3A 5A8NA 3HOJA 1MXGA 2AKMA 3WKZA 2YB4A 2WXDM 1NEYA 2DVXA 3GTFA 1OFEA 4GIAA 4RDWA 3VOHA 1K7EA 3AYVA 3KBVA 3VOJA 5DBTA 4A29A 1MW0A 1ZENA 1POJA 2NX9A 4IG2A 5CC5A 5FEZA 2WVTA 2HS6A 2PZNA 2NUXA 5D33A 1OYCA 2AL1A 4D6EA 2ZQ0A 2YCEA 5E93A 4QG9A 3VILA 4EAMA 3TZFA 4IJRA 4XZLX 1W9BM 3N15A 4GZEA 1TTJA 3CZJA 1LQAA 4NUWA 2XU2A 5AECA 4FXFA 3AZRA 3THQA 4Q4PA 1Q13A 1IWPA 3TX9A 3R25A 4MWAC 4DWDA 4A35A 1ZFJA 3KOZA 2E8ZA 2UZ9A 2Y5JA 2R24A 1CW2A 1NFBA 2WAGA 2E6YA 3O2LA 1R0MA 1UP3A 2OSXA 1FVPA 1CGTA 4KEUA 5I0DA 4D6IA 3SW6A 2WBKA 4JN8A 2OWXA 1WXZA 4K8EA 1W54A 1MDRA 4ERIA 1JGIA 3LPFA 1BLIA 3FGCB 2DZVA 2EG6A 2C19A 3W38A 5M17A 5U7SA 4JTGA 1A4MA 4XBJA 4JN7A 4ZB2A 4W8LA 3GB6A 1LLZA 2P10A 1DIDA 1EF3A 1AQ0A 3TIMA 3AS1A 3I3EA 2YCKX 1BYDA 1OCQA 4XD5A 3LM7A 4ZFMA 2DUAA 1XSIA 3NJ3A 3P2VA 3S5YA 1HZYA 1F3TA 4CQBA 1M1BA 2J7EA 1OINA 3HN3A 3HV8A 1W2VA 1SU5A 2B7NA 3MY9A 4RDZA 2PDMA 3JVAA 4NU7A 3QYSA 4CEUC 1H60A 3AXMA 2G4FA 2CHNA 4WX2A 4D6DA 1V6XA 2A21A 4QXIA 5E09A 3GTXA 3WCZA 3PBWA 4I8DA 1JZ6A 4YNGA 4ADSA 2J75A 5LKYA 5A6JA 4GXPA 5I77A 4GVHA 1PL9A 4HNTA 3RLUA 1WPCA 3EEGA 3VDBA 1SO3A 1UPPA 1CGVA 2O9TA 2OO6A 1QPRA 2Z28A 4B5NA 4U31A 3QSRA 2ZUTA 1F4HA 2FGLA 3S83A 5F2GA 1GQIA 1TPB1 2CHOA 3BLIA 1S5TA 4ZOAA 5L6UA 1WAWA 3HQ1A 1UZ1A 3QPYA 2I5QA 4FNRA 1K8ZA 1SO6A 4H9VA 4CNSA 3U57A 4K68A 5CLTA 1Y5WA 1BPLB 1TV7A 3NG3A 1J8VA 3GVWA 1BAGA 3V4BA 3PZIA 4XUGA 3QZAA 2FMOA 3GY1A 3PPFA 1GVIA 3K2GA 1I2QA 2JEQA 3U2EA 3URAA 4G8TA 3IANA 4QISA 3RU6A 1PPIA 3L4TA 6PTDA 3U2ZA 3OG2A 3N4EA 1VRDA 1TZZA 4G5DA 3OVRA 5GNXA 1J93A 4QM1A 5IBXA 5TF0A 3ID7A 1XIDA 1TPFA 3U2OA 1KXQA 1OBAA 3OEXA 5A8PA 4F0KA 2VUNA 3L5LA 1JCNA 3A23A 4M81A 4XZWA 2YX0A 2TODA 3VIHA 4ENLA 1I0BA 4Z1YA 3GZ3A 2DQXA 1US2A 1KLYA 5J04A 2J47A 2QEZA 4G56A 2ZTJA 3HJEA 4NKCA 4DWSC 2H8ZA 3EDFA 4JY9A 4OGZA 2HE5A 3SDOA 3ZQ9A 4W5UA 3QC0A 3U7BA 1Y5XA 2D23A 3C56A 4W7VA 1GYNA 3BAIA 4JQAA 4FF5A 1UR8A 4NJIA 3C8NA 3I7QA 3W53A 3P60A 3A22A 4P8VA 1VHCA 2I5IA 4EKJA 3CT7A 2XM2A 3BCJA 3CBWA 3VZZA 3W07A 1OSEA 3K30A 1RQBA 4N0RA 3N73A 2CLIA 2Y89A 1C93A 3BARA 3K4WA 2V2HA 3WBEA 2O9OA 1C9WA 2FZNA 4ICNA 4KFPA 7PTDA 5HMSA 4HJFA 3RITA 1SJAA 2B31A 4WEVX 3AXXA 3CV1A 4NZJA 1EKOA 1V03A 4TMBA 1J6PA 4GWEA 2DT1A 2HJPA 5H2ZA 2VCAA 5I7GA 4JGDA 4DWSD 3QR0A 1RXOB 2HCVA 2DUXA 5BXRA 3EPMA 4O0ZA 1XGDA 3E0VA 3JZUA 1H7PA 5HMDA 4DWSB 3DGRA 1LCOA 3CMGA 2ZVRA 3G1RA 4FXJA 3TMQA 3LERA 1N82A 2QF7A 4UCFA 4L5ZA 2IQDA 4GFSA 4DZAA 4GX8A 2ZA1A 2EPHA 1H61A 4Q7NA 4NXKA 1CLVA 1R2SA 1WO2A 4PMXA 5XIAA 3FEMA 4KCTA 4B90A 4LTSA 2FPTA 1ZHAA 2POTA 4ATDA 4HNOA 3PZOA 4JTLA 2EJ1A 1IEIA 4B5UA 4CQAA 1SFSA 2WC3A 5CJNA 4DZIA 1MW2A 2OGJA 3SRHA 1CWYA 4PMRA 2W92A 3H70A 4PRWA 3LXBA 1UKTA 5FA5A 5AYXA 3BW2A 2FKPA 3BK0A 1BFNA 1A53A 4ADTA 1OFAA 4JTTA 3EOEA 3KHJA 4GD0A 4ADUA 5IFPA 3FEQA 3FDGA 2VGFA 1TRIA 2J9ZA 3S9IA 4L7ZA 3PWIA 3PJWA 1EP2A 1XCXA 1PKMA 5EY5A 2GVYA 1P48A 4KRTA 4NZ4A 4D8ZA 1P4CA 2HISA 1R6WA 1AQFA 2I17A 4DPPA 4H7CA 3NZRA 1TVLA 2J7FA 2CLPA 3LRMA 1KRBC 3CLWA 3V7PA 1OX6A 3VZYA 2GJNA 4M0XA 2PRHA 4I5UA 5ABFA 3PUEA 4H6QA 1VPQA 1W1ZA 3UJSA 3DFNA 4KEMA 1R38A 3O0KA 4PN2A 2CPUA 2UY4A 3ATYA 4NJJA 4L9YA 5TIMA 3EX6A 3VDAA 3GR8A 1QW7A 1PIFA 4GA8A 2CEQA 4WJEA 5HPOA 3NQBA 1ENUA 1TPWA 4B2DA 5J5RA 3UJ2A 4GYFA 2BX7A 4EOUA 4RDYA 3S0CA 3NL2A 4EWJA 1HUVA 3R8GA 2CBIA 1C90A 2IKGA 4NNCA 3W7GA 4C6DA 2R1MA 1GPWA 1ECQA 9XIMA 3OGVA 1E56A 3DCPA 3AMLA 4X2PA 2Z1VA 4MDOA 2ZFAA 3D47A 4O1DA 4XAZA 1JQXA 2ACQA 5REQB 3SI9A 3URQA 4NVTA 1LP6A 3SADA 1V02A 1P0KA 1DXFA 4Y2WA 3TDFA 1D3HA 2GJXB 2HV5A 4IL2A 3W75A 3WK3A 3UR7A 3UWYA 3VC5A 5CPOA 1UD8A 4I8YA 4A8NA 2UBPC 3UP8A 3WLNA 3DFTA 4AD5A 3BLKA 1LLWA 2DY3A 4JS3A 4PCSA 3MVTA 4HPNA 5DMLA 3SQMA 4AIBA 5AZ0A 3T08A 1UR4A 2PA6A 1QW8A 2QYGA 1AD1A 2QUMA 1MO0A 3KAOA 1VYPX 2E9MA 3ES8A 4MJ4A 4CD5A 1J9YA 2XH7A 2O92A 3BURA 4U4MA 1MXSA 3NVTA 4DBWA 1UKOA 4O13A 2HPMA 1ZP4A 2QCGA 2NWRA 4RJEA 4JTCA 3AS0A 2C3ZA 3W1NA 1GW1A 4AZ7A 1Z9AA 3GO2A 3LOTA 2XGZA 1KM5A 3AHTA 5EBAA 3OLDA 3CHVA 4A21A 4ICMA 3CAWA 2NVCA 4LVBA 1RJPA 4IMFA 4FP1A 4AD1A 5LIWX 5AHMA 1HJUA 1YE4A 3SSZA 4FA3A 1JL8A 3TTOA 4KBXA 2FVMA 3TA6A 1QMLA 4W89A 4UMAA 3VOFA 1PZ2A 1V3JA 4QLKA 4US6A 1XFBA 2VFDA 4WKAA 2JGYA 1V93A 4AMCA 2HVNA 4NP7A 4PCPA 2BS9A 1VLIA 3V1HA 2XSXA 6CGTA 2XG9A 3GU2A 1MMFA 1YE6A 3PZNA 1VCVA 3IIPA 4MAVA 1D3CA 3H2OA 3PK7A 3QYQA 1CTNA 2UY2A 1Q6EA 2OELA 2Z6IA 4R33A 1DHPA 3BV7A 1KC7A 3TYAA 1JFHA 1HJSA 4QE5A 2PCEA 4LQ1A 3L9CA 1Q6GA 3O15A 4JIEA 1VFTA 2ATSA 4PUUA 3M4HA 3VC6A 5EB8A 5IXEA 4YTSA 8TIMA 2G3IA 5DT7A 1NELA 1BGGA 4TO8A 3APGA 1GOIA 5HOSA 3L4XA 3DEQA 2PWVA 4I9MA 5D30A 3OODA 1QT1A 3VCNA 3E5BA 2VNCA 1UD4A 1AQMA 2VEIA 3H7VA 3TE9A 4LH8A 4QSHA 3UY7A 4WSHA 3B0PA 7A3HA 5H91A 4H41A 4IF2A 2CBJA 1Z6KA 4W86A 1YPXA 1HL2A 3MSYA 1AA1B 3OVPA 5HXMA 4GY7A 4IG2B 3MI3A 1EXPA 1UA3A 2WSQA 5DQPA 3LEPA 4KW2A 2GGGA 3EKGA 3M0MA 5H8UA 4JTSA 3VABA 4QG6A 1R3QA 1MRQA 3MDUA 4S38A 1DQXA 4O18A 3WLRA 2XINA 4XWUA 3TJLA 1XBZA 1Q4NX 3KRZA 3ZJ8A 1PTGA 3B40A 1Q8JA 2QAFA 5C2GA 3GFYA 1O66A 1HVXA 3KRBA 3P80A 4DYKA 1W1IE 2QS8A 1TX0A 1CDGA 4Z2HA 4S3AA 3G0UA 3FOKA 2X1IA 1H5YA 4XD4A 2X7WA 2WZMA 2FTPA 4DM1A 1YEYA 4DXXA 2XIMA 3N14A 2OSWA 4AIOA 5HWNA 4O53A 4MUPA 2CZDA 4ZL1A 4UTKA 1YNYA 1UZ4A 4EE9A 1IZJA 3W2LA 1PX4A 4EF8A 3BPWA 4ROQA 2E68A 4DELA 3WQ8A 2Q8XA 5L9FA 4GQ0A 4AD2A 1PBGA 3QV9A 4KWWA 3CHEA 2ZIDA 1NP0A 3DOPA 2BY0A 3UYCA 4ASTA 1QDSA 4WUIA 2J77A 3ELFA 1I2RA 4GYPC 5LHEA 2WQDA 1F05A 1VJIA 1M7JA 2C1GA 1KRCC 2D0GA 3LCFA 3QF0A 4AWEA 2PLCA 2WWDA 1SPQA 3MUCA 3SUUA 2RDXA 3D3FA 1B3ZA 3ARWA 2YXGA 3WLPA 1T99A 4QE1A 3UGVA 3WQPA 1PZ1A 4MDPA 1V6VA 1AH0A 4JEJA 5FF2A 4KERA 4DXVA 3B0XA 2GSHA 2OOFA 4RPPA 3EB2A 4L1XA 3D6NA 2DSWA 2DP3A 1BSLA 4HSOA 3W02A 1CXEA 1OC5A 1ONXA 5BXSA 1KNWA 4G7FA 3BO9A 4UTTA 2GOKA 3EWXA 2YCIX 2YW3A 5DMYA 2NQHA 1JPDX 2E67A 3RPMA 4JTFA 4F8XA 3UR8A 1SW3A 2YZ5A 3QPZA 1LYXA 2DZUA 4NYYA 2MNRA 1KW1A 2WZEA 4J3ZA 2PWUA 3CK5A 2X1UA 2E5DA 4CCZA 4WHBA 1GOKA 3NM3A 1L6FA 3L21A 4S2BA 3PTDA 3S8HA 1V7YA 1R46A 3UD6A 1QK2A 1B9ZA 4WD0A 2P8BA 4WY0F 2XFRA 4L6HA 5F2MA 2O4MA 4AF0B 1XINA 4HA4A 4BK9A 4IGNA 4X9YA 2QXWA 3F7JA 5T9CE 3W00A 2VFGA 2CLKA 2AQWA 1G7VA 1FWFC 4B3ZA 4AYSA 1RV8A 1UCWA 3LA4A 2HSAA 4WF7A 1H1NA 4J1OA 1R3TA 4WY0A 3W88A 3UBPC 4AU0A 2PRMA 1HKMA 1RPKA 1E71M 3C4UA 1I9CB 2BB0A 4AZHA 4A3HA 1P5BA 1PTAA 3CASA 3FA3A 3O07A 4PYSA 4OFCA 4WJXA 3TXZA 1W9DM 1XH1A 4AC7C 2W66A 4K8GA 1RALA 1Q63A 2PEVA 1S2AA 5LYRA 1EGZA 4K2SA 1R3RA 4DZHA 1DWAM 4ZXOA 4C6EA 4MSSA 1JZ7A 4J35A 1MEHA 3AIEA 1WXJA 2HK0A 4DYJA 1QPNA 3SURA 4GI9A 2NVAA 2FFIA 3OLIA 3FW6A 4C1NB 4WKHA 4JDYA 3PZVA 2B4GA 1C92A 1EQPA 1OJXA 3QY8A 3N25A 3QM3A 2VM8A 1R9XA 3U2CA 1WUEA 4FNPA 3LK6A 3Q58A 5A3HA 3GM8A 2QMJA 5H6HA 1EOKA 3HO8A 1KFKA 1W0MA 4FXRA 4HPJA 4IJBA 1B5TA 2RDTA 4IFOA 1A0EA 1CB2A 3V75A 2PF0A 4HN4A 1ZBKA 1AL8A 2FVLA 1EJ7L 3G5EA 4V2XA 2QW5A 4FXSA 4LYKA 1JUKA 4NYUA 2YKKA 1QU4A 2I16A 2E5BA 3B0VC 5DELA 3AIUA 3SB0A 1ZCCA 2PCQA 3GG7A 1MNSA 2XN0A 1XIMA 3ITLA 5FJRA 3HGSA 3BW4A 1H5VA 1NSJA 1VHNA 1XH0A 4IFRA 1F5ZA 3CU2A 1XKJA 5HQEA 1DV7A 4JY8A 3N6JA 3WL0A 1U5HA 3W1TA 3NWRA 4AHOA 2IQTA 5AHEA 5T8GA 3HFTA 1M65A 2Y5EA 4RNFA 5FEWA 3NO1A 5FL0A 1UC4A 2VZOA 3E49A 3PG8A 2Z2UA 4DJDC 1DWIM 1QUMA 1M7XA 3N13A 4HA0A 1EWEA 1MUCA 2XUCA 5DANA 2W6RA 2XDFA 4B4HA 3L4YA 4E2VA 2ATMA 1DOSA 3AJ7A 1C7TA 3UVIA 1RLCL 4UQDA 1K8YA 4LC6A 3ABRA 2FTYA 1W5MA 2C7FA 4JCLA 4ZR8A 2FZ8A 1F3EA 1ZL1A 4A3UA 2XVLA 4G1NA 5HK4A 3TN5A 4CVWA 5ABFB 3BOFA 1TWZA 4IPJA 4H2CA 2BLEA 4JNYA 3DC0A 3QKZA 4DYEA 1A0CA 3PBMA 2JF6A 3KBMA 1XR2A 1A47A 3RLHA 4I9TA 1JF5A 1MEIA 3PC0A 3F4VA 3M1ZA 2NQ9A 4B2DD 3PM6A 2C91A 2ZCGA 2GSEA 4GUIA 4C7GA 3BXWA 4DJDD 3APYA 1GKPA 3BANA 3UQNA 1IXOA 2D69A 4NI3A 3H4WA 2IUZA 4XZ9A 3QJAA 4WDUA 1X1ZA 4F3HA 3WH8A 1TRDA 3RJXA 3GK0A 2ZUMA 2PWFA 4YWIA 6XIAA 5AVHA 3W86A 5DEZA 3EMCA 1EYWA 1GOQA 4JTQA 3QW3A 3NXLA 3PWAA 3TNBA 4PB5A 3T8LA 4LNCA 4MJMA 4QCFA 4HNLA 2FVKA 2JQXA 2MUCA 3LGDA 3I7SA 3P84A 2VI0A 5I23A 1HP5A 3PBGA 4L4OA 3LPPA 3WDJA 5DF0A 5D32A 2D3LA 4O57A 1SO4A 5CCZA 4Q8TA 4OIFA 3UR2A 3WH6A 2ZWZA 4TX6A 1KB3A 4FLOA 4CCCA 3EA3A 3WLIA 4HPHA 2RDUA 4EVZA 3PAOA 4QE4A 2UV8G 2WZIA 4I9AA 3RMEA 4DBEA 4F2UA 2JALA 1KBIA 2C13A 5I3DA 4TVUA 1S2VA 4R9XA 4MKVA 4YL2A 4IOTA 1W1VA 1QPQA 2BSLA 3DFSA 3PSWA 2QDDA 4AY1A 4N9DA 1VYSX 2AQOA 2QGYA 3OBAA 4HHLA 2PGRA 2YL5A 1KBBA 4AC1X 3B8UA 2J79A 3LCLA 4MY8A 1GORA 3NGJA 4L80A 4S3FA 1ISWA 2QV4A 4DO6A 1JYWA 4Y9AA 1ZY9A 2ZE0A 3FCPA 3EB4A 2VFHA 1VB9A 1GVYA 3SQLA 1UUQA 2V3EA 3UWQA 3N2MA 4HMEA 5ABHA 4LX4A 1NIUA 7ODCA 4ES4A 5F4SA 3E9AA 1UD5A 3LS9A 1VPYA 4AD0A 2FGBA 3B8SA 2ZZ6A 4LVDA 1WUFA 4WKFA 3H2CA 4TIMA 3GDRA 1JD9A 2NZLA 2JK2A 3E2VA 2VRJA 1AUSL 4TVCA 1UMYA 4LSBA 3T7VA 4IQJA 4HJWA 3NQMA 3TJ4A 1TPVA 3QQ0A 2FYMA 2R91A 2VZTA 3ZJ6A 1KTNA 2GJPA 3LNPA 2PDCA 3P5ZA 1W32A 5D05A 3FDKA 4W88A 2CZFA 2R94A 4LPCA 4D2JA 4O19A 4LS0A 4PH6A 3V16A 1R30A 4OKDA 3DXIA 3BGAA 1EL3A 4OQVA 5DMMA 1L0PA 4WOZA 5HR6A 2GPTA 2ZDSA 5CPTA 4Y9PA 1IXNA 2GVGA 1Z44A 1K8XA 1RD6A 1ZRQA 1QI4A 2V30A 2L5HA 4LY8A 1DWFM 2CU0A 1JXJA 3WJWA 3PZMA 1D8CA 4FOUA 1ADSA 2VZSA 4D6JA 1JPMA 2WM0A 3VE7A 3O6YX 3CV2A 5RUBA 2WBGA 2ZUWA 5C2XA 1VBGA 5A8GA 3A5FA 3WYZA 4H04A 4NNAA 3LUTA 4UFJA 2RAGA 3MI2A 5FEPA 4XD3A 4CQ9A 2CXGA 2Y61A 3EDEA 3C0JA 4AMAA 1TPDA 3HMJG 3ARRA 5BWAA 3IJ8A 4OWGA 2ZRWA 4PGLA 2FB3A 2DT0A 1V02E 3BAYA 4M24A 2E77A 4KIEA 4L61A 3CUZA 3NQ8A 1QHPA 2R1PA 1UJQA 8XIMA 1LQ2A 2ABAA 3GHRA 3GU1A 4ZOEA 4N4PA 5T9BG 1K77A 3A4XA 2OMAA 3DN5A 3ZIZA 5LHFA 1PKNA 1AH3A 4NILA 4Q6XA 4LS2A 3ZLGA 5AOUA 1Q5MA 1IEWA 6ALDA 1GHSA 3A3HA 4IH3A 4AD3A 3R43A 2G3FA 1NDVA 2X42A 5MKGA 3RCNA 3GDKA 5M1TA 3TYCA 3MP3A 3ONBA 3C6CA 4J3XA 3W2MA 4XAGA 3MUZ1 1F73A 3MO4A 3MHUA 1EC8A 3GU9A 1E9ZB 1E40A 2VRKA 4GUJA 1VD6A 1ISZA 3EOSA 4UR7A 1Z41A 1AMYA 1TWDA 1PAMA 3BAKA 1X97A 3PP7A 4PMNA 2ZOXA 3W01A 3WQDA 3ZFHA 3EWCA 3ZR4A 3DHDA 5CBJA 4C6OA 1SFTA 5A95A 1KLZA 4JL2A 3NQDA 1B31A 4UFKA 1PDYA 3GXIA 3VCRA 1FCBA 1ICPA 4H9ZA 1J0JA 2X8RA 4HTYA 4R34A 5M2FX 4Q8WA 4JIHA 1J5TA 3VKKA 4O4VA 1XS2A 4AZ6A 2E0PA 1VP5A 3THDA 4JX4A 4HMNA 4PCNA 5DRCA 3AIBA 3E5PA 3W1LA 2UY3A 1CXKA 2BXZA 2G0WA 1XDMA 3NOYA 2FIQA 3UYIA 3DENA 1AH4A 2XVKA 3L4UA 2Q3OA 3T4CA 3LMYA 1ITXA 1E5JA 3Q45A 1DYSA 2JIWA 1QPKA 2P0OA 2OQYA 3IGSA 5AYZA 1BQCA 4W7WA 3B06A 4ZQOA 1ITUA 1E6ZA 2GUYA 1IT8A 1M03A 1FHUA 1YXDA 1TR9A 1PDZA 1F3WA 2OX4A 4W8BA 1A5OC 3EKLA 2NT0A 4TOQA 2Y7EA 1ZAHA 1RD5A 3DFHA 3VIOA 4P8UA 2IS7A 3I3DA 1XLLA 3V0TA 1EIBA 3NDOA 3G0XA 4XZMX 2CLLA 3W26A 4H4IA 4AYGA 1XUZA 3S1WA 1UWQA 3NFUA 4D6HA 3QR1A 3OQ8A 3F1QA 3F5KA 2O4QA 1JCXA 4WOQA 1MWOA 4AVOA 1W3IA 3M5ZA 3HJZA 1ICSA 2ZYFA 3CLMA 1GTEA 3UU0A 2EAWA 4QGCA 4TVDA 3BZJA 2CHRA 3KZSA 3T2PA 3LLFA 4EXBA 3M47A 1HTIA 5PTDA 3IUDA 3RM4A 1A3XA 3LPGA 1M6JA 1VFLA 3B9DA 1UIPA 2LLEA 1ZB5A 2NVDA 1EYEA 5ABEA 5BMWA 1XLAA 3GTIA 5I03A 5K4XA 1BEUA 2I9EA 4HNNA 1E5NA 1QAPA 3QOMA 5H8PA 1SMDA 4PBGA 4ZGYA 2WJFA 4JFSA 1FFRA 1RCOB 2CLOA 4AHQA 4EXAA 3QZ6A 2PLJA 4Q4MA 3W74A 1LT7A 4R27A 1R3SA 3WIJA 1VENA 1KQZA 2G96A 2ZZ5A 1S1RA 2Z27A 3CZLA 2GDQA 2WNWA 4ZE5A 4B9ZA 2ZICA 3QY6A 1FWIC 1RZMA 1ZGDA 5CBIA 4IICA 1K70A 4US5A 1RY0A 2OXNA 4AW7A 1VZWA 2VX4A 1ZPTA 2ALRA 1RVGA 3BZGA 4LC8A 1E4MM 1E1CB 1XDLA 2VC5A 4AWUA 1IR2A 2I57A 3CB3A 3ZSTA 3WLMA 4KMQA 4BR1A 4RR4A 3QV7A 3T81A 2WMIB 1LOLA 3STPA 1WKYA 1GYLA 1V5XA 4HZ7A 5E9AA 1GEQA 1TFVA 3TXVA 1ME9A 3FJNA 5D9MA 3T8QA 1E3ZA 1Q6RA 3SCNA 3L2MA 3EXRA 5CC7A 4K7YA 1ZALA 3DFPA 2C18A 3BDKA 1SZFA 4R7JA 2PTYA 4DO7A 4LCQA 3ITTA 4R88A 3ISIX 2GQ9A 1FCUA 2BVWA 1QASA 2WC7A 4WDTA 4UQEA 2PZ0A 3WBXA 4LAKA 1VEPA 4S3KA 2D24A 4XZNX 1GQKA 3M46A 1W3NA 2C79A 2YFNA 3MBDA 4P2VA 1E3XA 2OR2A 2X30A 3WMLA 3O63A 1RPXA 3EOOA 3A21A 2XSBA 1EA9C 2GDUA 3E02A 2WSRA 3W7CA 3GD6A 5EGRA 2BXVA 3LENA 3XISA 3IJ7A 3QMRA 1NM9A 3MWCA 4K1WA 4S39A 5DBUA 2W91A 4JNZA 4LOCA 1XXXA 1UYQA 4QAIA 1H7OA 1PYMA 4LEFA 2G97A 1EO7A 1TPC1 2WLYA 4LV9A 3EDJA 2FGZA 1TPEA 3RHGA 1DTUA 3D3AA 3AMDA 1G69A 2BTMA 2HPIA 2VEPA 3ARUA 1Q7ZA 5FESA 3KBJA 2O9RA 1YMYA 3VKDA 4QBXA 1JGMA 3AS2A 4MKSA 5JH1A 1TKKA 1Q65A 2ZZ1A 1ELSA 2VQUA 2DIEA 1X38A 2AMXA 2ZC1A 3NA8A 1VFUA 4PUMA 3GHUA 3DGBA 1M04A 1PIGA 2HEJA 1WZKA 2SFPA 4M1BA 4YTQA 5CXPA 3UJFA 9RUBA 1KKRA 5TNVA 1EJTC 4H9XA 2HWGA 2Z1WA 1R85A 4J3UA 3GS6A 4MPQA 2DZAA 5TD4A 4JIIX 4IPLA 1KRMA 1OX4B 1UA7A 1REQB 1KFBA 4AUBA 2XISA 3IGHX 2F7FA 3TONA 2F61A 3LCWA 2QIWA 3AHYA 4REQA 1K7FA 1K6WA 4WGXA 3WEMA 2EKGA 3W85A 3N4AA 5DLCA 5BRQA 1NF7A 4NJHA 4LUTA 4EANA 4LU0A 1KWKA 1LOQA 2XWEA 2VL4A 2PU0A 1HXJA 4DJFA 4PZVA 4J2PA 4LBSA 3R10A 1XYFA 1UBPC 4A6GA 3RCYA 3ABOA 5I3KA 3G6MA 4KFNA 4HD5A 5AZ1A 2C0AA 1U1JA 2XN1A 3FKKA 4DUOA 5HWJA 1SO5A 3HQPA 5IBXC 3N6QA 2QUTA 2Y6ZA 1VFOA 3GFZA 3P81A 1EPXA 3BMXA 7TIMA 1ZCOA 1CXHA 3EWUA 2FJKA 4C5ZA 1XYBA 3TW7A 3TQPA 4HPXA 5CZ0A 1H41A 4RL3A 2EBNA 3RO6A 3G0SA 3UWVA 3OA3A 1TA3A 4JTHA 4DBSA 1QBAA 3MKVA 4RNHA 5FJIA 4JQ4A 4JIQA 1UROA 1AW1A 4P7NA 1QNVA 1GQJA 5FJUA 1LJYA 3FJ6A 1XIJA 4PTMA 3OHIA 1D9EA 1QO5A 4H8NA 4IL0A 3P7YA 2PDQA 1EBGA 2QUVA 2J7CA 3HZ3A 1W2PA 2PDBA 4JIPA 5D2VA 1VF8A 3VXGA 2WQPA 1QJWA 3LYEA 1OM0A 1V6UA 1UWSA 1H49A 1QHOA 1VQTA 3ZMRA 1MXDA 3I68A 5AC8A 1NVMA 1YNPA 5CLWA 2PDXA 3FA5A 4GQRA 1FUYA 3P0XA 3H54A 2WSPA 3M5XA 1UQZA 3COTA 4MF4A 5A6TC 3K1GA 5EMMA 1FRBA 5FJPA 4IFKA 3AXIA 1JUEA 3ZVHA 2A6LA 5HULA 4H9YA 2WZTA 3GBDA 3B8IA 2AAAA 1GHRA 1RBAA 1SZEA 1V0MA 3IVTA 2V6AA 1AJ0A 5HINA 2I5GA 4M7SA 1CX9A 1BKHA 2G5WA 2E28A 4E5TA 3L5AA 3MSRA 4KF1A 3NYDA 3DBPA 1KM0A 5A2CA 4XZIA 4MB5A 3C0QA 1E6SM 4NRSA 1EIXA 2E09A 4WDXA 1XCWA 2NLIA 1NFGA 4JX5A 5LXEA 5JU6A 1EDQA 1O60A 3WLTA 4UIOA 4E0CA 1I2NA 3DIPA 2Z1SA 1KCXA 1FTXA 3W6YA 1S5MA 2ISFA 2V5DA 4C6QA 8CGTA 1GTHA 3EEZA 3IVSA 3KRSA 2J74A 3B03A 1RCXB 2QJGA 4ORMA 4GI8A 1E0UA 5CAKA 1UWAA 5I79A 1UOKA 3F2CA 1I45A 5KZEA 2ANUA 1D7KA 4O50A 5KZ6A 2PP1A 3UPBA 4QJ5B 3L4ZA 3IV3A 3PG9A 1KKOA 1SJDA 3PJTA 4IX0A 4A4AA 3BQ6A 3SFKA 1RQEA 1W5OA 2PLMA 3GVRA 1IT7A 3HV9A 2XVGA 3C5QA 1CCWB 4ERGA 2WPGA 1NTHA 1EZWA 4E8DA 2D2OA 3BG9A 3V5CA 1XD1A 3NQGA 4TX8A 1RA0A 3PAJA 3FGCA 2GGIA 1GVRA 4C1KA 2HS8A 5LGZA 4JQ3A 1KRAC 3KTCA 4GZJA 1QCWA 3QR3A 4UNKA 2A4AA 4GBDA 2R1KA 3Q2DA 5MKGB 2PDJA 2JKPA 4ACZB 4UUIA 3N1AA 4J2MA 3D46A 2AGKA 2PU1A 2I1OA 3VM5A 3UERA 5CG7A 3F4WA 2YDRA 1NDZA 1UHVA 1XRVA 2IXVA 1EGMA 3F5JA 4IM4A 2A3LA 3NM1A 4QP0A 3ZJ7A 2BASA 4IJCA 5E6ZA 1UW9A 1LT8A 2HXTA 3C8FA 2X40A 1QOQA 3VDHA 1L8PA 1B2YA 1TX2A 1VBHA 1GOMA 4J28A 4R5EA 2WANA 2PE4A 1D2KA 4F9DA 2GK1B 4JFVA 3RG6A 3W9ZA 1HGWA 5HR7A 3DFYA 4LYRA 5AYIA 2RJHA 2PWEA 1OYBA 3H21A 2ALDA 4J3WA 3OGSA 1FHDA 4QAWA 3GXDA 5FIPA 2OOGA 2OU4A 2PWHA 1E4LA 1YTDA 3OW1A 4XZBA 4O15A 4M82A 3AHXA 3RYSA 1DJIA 1GJWA 2V5LA 3M5YA 3GIPA 3G1SA 1YPIA 4AFYA 2V5JA 2XTKA 3WEZA 5K2ZA 1GVSA 1K9DA 3C2OA 2PWGA 3VI2A 1UOZA 4I6VA 3SR7A 2QCFA 2DZTA 3KS6A 1LRNA 2Q01A 4QLJA 4PSRA 5CSRA 2DGAA 1EGVA 3ORWA 1EBHA 4D8LA 4TR9A 3TNOA 3WF4A 1E9YB 1QBBA 1X1NA 4WK9A 4H9MA 2P3EA 2OLSA 3AQUA 4CD7A 1T6MA 3WFAA 3VM7A 1S2WA 3ICJA 1L6WA 1CGYA 4O52A 3PBVA 4MAZA 2VDGA 3AUJA 4HYVA 5TQLA 1OABA 2GJLA 3P74A 3ARTA 4RDVA 3AWOA 1M41A 1XIGA 1YDNA 1RUSA 2BHZA 3G3DA 1B3WA 3WDPP 3CAVA 2FHBA 2TAAA 4OOZA 2QGHA 5HNRA 4PMUA 3QV8A 2YLAA 3H2FA 1ZJBA 1LL6A 2J24A 1UQYA 1KV5A 3WLQA 5LIXX 5BROA 3G1YA 3B97A 4J9JA 3U5UA 3W25A 4Q3MA 3G6LA 4CU8A 1W3JA 1B54A 4NZ1A 3O05A 2EGZA 5I3FA 1LTDA 2V3FA 1TUXA 4INFA 5CPMA 2A1YA 4Z0JA 3SUWA 1J12A 4HQVA 1E6RA 4IHCA 3KW3A 4A05A 3WUFA 3I3BA 4K36A 3TWBA 1HJVA 4IGHA 3BLLA 4YCPA 3K13A 2XFYA 2GQAA 4Z1BA 3TA9A 2QPSA 1KM6A 4WGHA 4FS9A 4JKMA 2PDPA 4NT0A 1MNZA 4GUGA 1I0DA 1G0CA 4MB1A 2OQLA 4NAFB 3SIMA 3A3XA 4K38A 1KGUA 2R14A 2Y4SA 2WHLA 3WQ4A 3S1UA 5I07A 4JFTA 2WMKA 4O16A 2FDMA 4F0LA 4IPIA 3IJQA 1CGWA 3TOYA 3S9ZA 5HA7A 4US5D 2PDYA 3UXLA 5HJYA 1XJBA 3ANVA 4D9PA 1U5JA 4IQEA 4AZGA 3UPMA 3DBNA 3WQWA 4DWSA 3JW7A 2Z24A 5EMLA 4GQBA 3MSDA 4C5YA 1X6UA 1GUVA 3P62A 3RMJA 2YBTA 2QT3A 1R47A 1D7FA 4DI8A 2WNZA 4N6EA 1MZHA 3ATZA 1ML1A 4HCLA 2B7OA 1YXCA 3II1A 3M7WA 3PTMA 3UZ5A 4JTDA 6XIMA 2XZ9A 1EO5A 2D2GA 3UETA 4ATWA 1XV8A 3R94A 1HW6A 3R0UA 2XPKA 4AY7A 4RCXA 4UOQA 4UWMA 2X16A 1XG3A 3NL5A 4O54A 1Z42A 3M0ZA 1P1XA 1LUCA 3FYPA 5HATA 4NHVA 4O0KA 5HJXA 2A3AA 1K03A 5HNUA 1RR2A 3GZAA 4Q4SA 3OIHA 5E0CA 2QPXA 1O5XA 1EOMA 1RP8A 4PMDA 3WBYA 2G50A 2VWSA 5A6LA 3RO8A 2AOSA 3A4AA 2ZRUA 1DE5A 3AU2A 2ZVIA 5JBDA 1WP6A 1XIHA 1W9PA 1W8SA 3MKCA 5F2LA 2AKZA 4CEXC 3L65A 4JEQA 1LL4A 2ISSA 3BSGA 4R3UA 1PXGA 3S6DA 5A5WA 1ISXA 1ODUA 3SCVA 1WDWA 4R9OA 2BP1A 3LXCA 1TJ2A 1HQTA 4EF9A 3W7IA 9CGTA 3P3BA 4GCXA 1S5WA 1NU5A 2WLZA 3S47A 3FVMA 3N9KA 3HPFA 1G6CA 2P53A 3W6LA 1B3OA 2DT3A 4YIWA 4CQCA 3LI0A 3M44A 5GJPA 3G1HA 5DCBA 4D71A 4GISA 3FYOA 2FZ9A 1UKSA 3DG6A 1FWSA 2HE8A 1NARA 3SIZA 3B4YA 4RNJA 2NXGA 4RKAA 3CUIA 5FCZA 3QXBA 1MW3A 4DO5A 1ICQA 4KWVA 3VGHA 4BWLC 3W1PA 3CIWA 1R9YA 3TEVA 3OBEA 3HU7A 3F2DA 4HTBA 3R8RA 4B3KA 2ZRVA 2CWXA 5F1VA 1LM1A 2H6RA 5CAHA 4J5NA 4ZQCA 1TE1A 4IPNB 4YJ5A 3L67A 1VPXA 1PE1A 1CI1A 3IS4A 1PB0A 3ALFA 1V6YA 5FOOA 3O6DA 4LBRA 5C70A 1RSCA 1EX5A 4FIQA 3XINA 2CBVA 3WH9A 1HJXA 5CGQA 1KR0A 1BVNP 1EWDA 3AIRA 2WYSA 2OCZA 4REQB 1OYAA 1TZ7A 2GJXA 1QI3A 1P0NA 2ACRA 2DZWA 1UUMA 1R86A 2C16A 1W91A 1CEOA 2XZ7A 4MLRA 3BG3A 1CB7B 3N4FA 3DKLA 4IMAA 1H7NA 4ZQMA 3VKCA 4DJFD 5BMXA 3GC2A 1B90A 1IQ8A 1Y8BA 5ENLA 3BAWA 1OD8A 2J9XA 1Q66A 2YLLA 5LZLA 1CT5A 5G1TA 4ML4A 3P5YA 1XBXA 2J4GA 4F79A 2E40A 3HPXA 5BNKA 4JTJA 3QMTA 2V5BA 4H6KA 1P6WA 2GJRA 4UTLA 4GHRA 3EX4A 3VMOA 2PTZA 4GXMA 3U3HA 1L6YA 3C86A 5D03A 4MPKA 1E9IA 3KEHA 4ZOBA 4CNOA 3AU6A 3V3WA 3GSMA 1JEZA 3QQ1A 1PHWA 3WZ0E 1L9WA 3EA1A 4G6CA 1U83A 2GSJA 4OVXA 3NDYA 3NO3A 5FJTA 1TA3B 3ONCA 4XSMA 3NGFA 4HT3A 2Q3RA 2NV9A 2G3NA 4HYWA 4CCDA 1YPFA 3NL6A 2V8ZA 4ZO8A 2VX7A 5AKQA 2Z26A 2BG5A 4DIAA 2VC6A 2WM1A 1KA9F 1OFDA 2DORA 3UZZA 1PWLA 1V3KA 2NQZA 5BRPA 1G7UA 1KR1A 3WD3A 1AW2A 2X1RA 3R4IA 1TMHA 3G3MA 4JICA 1P7TB 4XIAA 3VD4A 5I2UA 1VFFA 4CN6A 4GUHA 2HMCA 3C3UA 4H6EA 4Q4OA 1OT1A 2FHCA 1CXIA 4BI5A 2ZXBA 3CQ0A 4IIHA 4FPSA 5EFFA 3TU9A 2ONEA 5CEWA 3CZ8A 3O1NA 1EJRC 3ZWTA 4OT7A 3ZVHB 2QULA 1C7SA 4LYQA 1E55A 3UNTA 1H11A 1WYIA 3GH7A 2VGIA 2E1WA 2NWSA 3ARZA 1TPH1 2XYLA 1PEZA 4GABA 1LWHA 3GAKA 2J6XA 2PD9A 3BJTA 2QV5A 1VYRA 2WVUA 3R0DA 5MF5A 3DYPA 3FY1A 5FD0A 1JCLA 2WHKA 2OYKA 1O68A 1A5NC 1F74A 3WELA 1HL9A 3FFSA 4AH7A 5DXXA 2CKSA 2EEXA 3W1RA 2EPLX 4F9JA 1HG3A 2KAUC 6A3HA 4Q8VA 3C0LA 2ZUNA 3W6MA 3AI0A 3PTQA 3QY7A 4HVXA 4PL2A 4MMWA 4XIMA 1BGAA 4GBUA 4YTRA 4H3DA 3H2MA 3IK2A 2BHUA 2BY3A 3OJGA 4UTWC 3M41A 1T8QA 4FSAA 3WQCA 4QCEA 4KRUA 3GH4A 1A80A 3PHAA 1WZAA 5GQBA 1Q6FA 3VIIA 4WQ6A 3IVUA 3LHZA 1EJUC 3LMZA 3L66A 3G1AA 3H55A 1SZNA 2Z2BA 3VUSA 4F4RA 4QEHA 3WJYA 4ZFCA 1NQKA 3OVQA 1P0BA 4PBFA 3CUXA 1AK5A 3C52A 3SCSA 4S2CA 1EB3A 1KXHA 4JFWA 1LDCA 1EJSC 3T55A 4EPDC 4A8RA 4TQTA 4DJEC 3O06A 4C65A 4GNVA 5M3WA 3CMFA 1VEMA 3SEPA 4KCWA 3NQCA 3S9YA 2GWNA 2JIEA 2WMFA 5HUOA 2VR2A 3CO8A 3YPIA 1NWTA 4K37A 4DZ5A 2EJAA 5BXPA 1RJRA 3ERPA 1JDDA 4GYJA 1N8WA 3NEVA 3BLEA 3MJYA 5FJJA 3HFYA 1AG1O 1K9EA 4LYPA 4PMQA 4MWAD 2QCEA 1TUFA 4JTKA 3LV5A 2F38A 3DI0A 4QG8A 1VBUA 2DPEA 4JL1A 4BEQA 4MWAB 4PUDA 1EUNA 3V36A 4NASA 3VIFA 1AJ2A 1KWGA 2VC9A 4XD6A 2ZTKA 2GDVA 1L6GA 4R53A 1JDFA 1XBVA 2DW7A 4WVXA 2PDLA 3DI1A 3L23A 1R3VA 4NG3A 4AY8A 3VCCA 4YS1A 2JBMA 3ME3A 3L0KA 3TN4A 1EDTA 1H7WA 4DAFA 1IXPA 3UWWA 1UR1A 2J66A 4GI6A 3W1UA 1YIXA 4M56A 5GJNA 2Z6JA 1I75A 5CGTA 3GBEA 4LUJA 1KM1A 3WNKA 1JNDA 2A3EA 2FJUB 3A24A 3PNZA 4GYPA 3RK8A 3W7OA 2VGGA 2FZDA 5C8BB 1PYFA 4BKNA 2CZEA 4HK7A 2CITA 3LB0A 1OCJA 1DJQA 3VOIA 4G1KA 4HU4A 4CNTA 4MGGA 4BS0A 4KH2A 2DJXA 1EHAA 3HQNA 3FXYA 4EWND 4BQ2A 4HYRA 4JKLA 2O7QA 2YSWA 4LJ3A 3T2OA 3LHYA 1CYGA 2D2JA 3N11A 3DH7A 3TLLA 4MOZA 1P6CA 2MANA 1FKXA 3LGEA 9XIAA 1UJPA 1XC6A 3VU2A 3VK5A 2BOEX 1SSDA 1H7XA</