3H2FA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
269
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGEFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 95
structure length 269
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2fA00
2DQWA 2VEFA 2VP8A 3H2AA 2Y5SA 4DAFA 5JQ9A 1TWSA 4PZVA 4DJFD 3MCNA 1TX0A 3H24A 4O1EA 2YCLA 1AJ2A 2OGYA 4MWAA 4S3FA 4NIRA 3H21A 1AD1A 4S39A 3H2EA 4MWAD 3NOYA 4DJEA 3V5OA 1AD4A 1TX2A 4S3EA 3TZNA 2E7FA 3K13A 1F6YA 4DJED 1EYEA 4HB7A 3TYUA 4C1NB 1Q8AA 4D8ZA 3MCMA 4DJFA 4MWAB 1AJ0A 4S3BA 3H22A 4DJDA 2Y5JA 2Y0FA 3H26A 3TYDA 4NHVA 1AJZA 4DJFC 4S3AA 3TYAA 4DJDC 1Q8JA 2VEGA 2BMBA 2YCKX 4NL1A 3TYCA 3TYBA 4DJDD 3BOFA 3TZFA 3TYZA 4G9PA 1TWZA 4S3DA 2YCLB 4NILA 4CCZA 1Q85A 3H2OA 4MWAC 1TWWA 1Q7MA 3TYEA 4DB7A 3H2FA 4O0QA 2YCJA 4MWAE 4S23A 2DZBA 3H23A 4D8AA 2H9AA 3H2NA 4DJEC 2H9AB 3MCOA 4C1NA 1Q7QA 1Q7ZA 4S3CA 3BOLA 3TR9A 4S38A 4DAIA 2DZAA 4D9PA 4O1FA 3H2MA 3H2CA 2YCIX
chains in the Genus database with same CATH superfamily
1F8IA 2XJ7A 3W81A 2W3ZA 1KR1A 4W8BA 3RU6A 2HXUA 1D3HA 1U1UA 4RDVA 3S46A 2GJNA 4WJEA 4AX6A 4QG9A 4HPJA 3TWBA 1RP8A 2MUCA 4GYFA 1DJQA 5G4EA 3UW6A 2Z29A 4ZENA 1A3XA 3EOOA 4LH8A 1QDSA 3W87A 4HNNA 3MKCA 1J0KA 4URIA 1TWDA 2V5KA 1RH9A 1UP0A 2XGZA 4MPKA 1E0WA 2QEZA 4CNUA 3LRKA 4IM4A 2R1NA 1ZAIA 3TWAA 3WCZA 5I3IA 4B91A 3NOEA 2A2IA 2XTKA 3U7BA 3GK0A 1TTQA 2PC8A 3GH5A 4JFSA 4XV0A 4M29A 4D8LA 3M5XA 1IGSA 3UFYA 1E3ZA 3INPA 3GX9A 1GOXA 3UXIA 1BYDA 1AH0A 2O56A 1JCYA 2V8ZA 3WY1A 1A5BA 1BGAA 3TP4A 1KR0A 3L4WA 4Z1AA 5J04A 5DBUA 3O0FA 2ZZ7A 2WC4A 4I9MA 4ZOEA 3OBAA 1VS1A 1TWSA 1VRDA 4PUUA 3RLUA 5FEPA 3CQJA 4JFTA 5I07A 3FYPA 4V27A 1J0JA 3SN1A 1ZJHA 2Q8LA 4S2BA 4JGDA 4W7UA 5FF3A 4D6IA 4LY8A 1RLCL 2Z24A 2GDQA 2GOUA 2CZEA 1CXFA 3THDA 2WHKA 4H41A 5F4WA 2J62A 5T26A 4ZFCA 3R79A 2R9RA 4W93A 2VC9A 2QCHA 5I3HA 2E5DA 3WDQA 4UFMA 3ABXA 3G1HA 2Z6IA 3ELFA 4EF8A 3IWPA 5K9DA 2GQAA 1VIZA 1K6WA 4DNHA 8XIMA 1I2NA 3HPXA 3LEPA 1Q2SA 2X41A 3AICA 2YDQA 4G7FA 3FK4A 2CITA 1GVSA 2V3DA 2GJXB 1P4CA 1BHGA 5CPQA 1XLDA 3BLLA 3GXNA 4ROQA 4ZXLA 2XGBA 3WN6A 1H51A 3N04A 1TJPA 1UG6A 2ANUA 5FF0A 1O6IA 4ROPA 1ZENA 1RCOB 4HMDA 3LLXA 1NELA 4JTLA 1CXLA 3ABQA 2X1TA 3TVAA 1IGWA 4TX9A 2GVEA 3H4WA 2NT0A 1J9YA 1ZALA 1DWHM 4PRWA 3TTOA 1JNEA 1OX5A 2E0PA 1D7FA 4J3XA 3F4VA 4QJ5B 4RX0A 3MDUA 4A6GA 4B4FA 5BNKA 1F05A 3FIGA 1BQCA 2RJHA 3CWHA 5HJLA 4LUSA 1WDSA 3L5LA 1F6YA 3LHVA 3F2CA 3LPGA 2IXVA 4EOUA 1SMDA 5I09A 1KQZA 3HQ1A 5LSMA 2E8ZA 1HN1A 2DY3A 3CUGA 2V68A 4GUJA 4FS9A 1XLIA 2YL9A 4ZVJA 2GVGA 1TTPA 4JTFA 3OOQA 4X60A 2ISWA 5BU9A 3WYZA 3NXFA 3TYAA 4LUIA 4B3KA 3GR7A 5LA0A 4UQCA 1UIPA 3NDYA 1OABA 2Y88A 1Q66A 2CZDA 4P8UA 2AMXA 2OX1A 1WDWA 3FJLA 3WK1A 4XX6A 2Y8UA 1LM1A 2BHUA 4QAWA 1XL9A 3WDRA 4B5VA 1Q4WA 3OZMA 3PTMA 2DW7A 1GT8A 5EMUA 3T55A 2YCEA 3B0YA 4CN1A 2ZX5A 3CV6A 2YKKA 4LYRA 1B57A 1EL3A 5I3GA 5HAOA 1R87A 3R12A 4AZ7A 4BF5A 2QUMA 4HMNA 1R3YA 2PGEA 3DCPA 3B40A 2WVSA 1ZCCA 3SSJA 1NSJA 3CZ8A 1EA9C 1W5MA 4M6UA 3WEMA 5E6ZA 3U3HA 4FOUA 1TMQA 3OEXA 3OA3A 1OFAA 3KDNA 4ATDA 3GNXA 1QMLA 1JI1A 3KBMA 3F4NA 3UGVA 5LHEA 1B3YA 3SN4A 1PB0A 4IIHA 4JTRA 1WDPA 3FY1A 4HHHA 3KOXA 3P81A 1GOIA 5CSRA 4W87A 2PLKA 4NRRA 1L6FA 1DWAM 1NQKA 4PMRA 4JICA 5D8WA 2PU0A 2P50A 1V7AA 2VXNA 3XISA 2I9EA 3RGTA 2NX3A 3CQIA 3ABSA 3PWIA 1PAMA 3PUOA 4Q8PA 4XIMA 4Z17A 7TAAA 4D71A 4GXPA 1SFLA 2SFPA 3MZNA 3PP7A 1QK0A 4NSBA 3BMXA 3NQ2A 4Q8OA 2HS8A 2QUTA 3D3FA 1E9LA 2Y7DA 5EGRA 4XAYA 2IQTA 1XGZA 4TVUA 4FOJA 2V3GA 2ISVA 4P7LA 5D2TA 2X05A 2XINA 3W6YA 2QCMA 4QEEA 3E9AA 3MQTA 1OZMA 4M51A 1A5AA 1LBLA 3ONBA 2FB2A 1W1VA 2IMRA 4Z0SA 3PZ9A 3NJ3A 5H6HA 3TJXA 3VIGA 1EIBA 2ACRA 3NSXA 4AEOA 1E56A 1B9BA 3DFSA 4EPDC 3FHQA 4J3WA 2Y24A 1UQZA 4IIEA 3UWZA 1ZTVA 3UCCA 1I6NA 2BG5A 4PUEA 4IGHA 3AIQA 3H21A 5FESA 2CKRA 1R7OA 2PDGA 1EJTC 6TIMA 3N19B 2F6XA 4U28A 1PE1A 1QR7A 3T40A 3VYLA 3WLIA 4FNSA 5ABGA 1OHLA 4Z2GA 3VMOA 1A3WA 5C70A 3VCCA 1QHZA 2DDXA 1B4KA 2ZRVA 3NEVA 1VKFA 3A21A 3QR0A 3B8DA 4CVWA 1OG6A 2WQDA 3M0LA 5A6JA 2YBUA 3ID7A 2VR5A 3O9NA 3TX9A 1U83A 3B8WA 3W7KA 1DE5A 3MUCA 3OTRA 1MFUA 5BRBA 1IEWA 4FX8A 3VNDA 1JDEA 4OE7A 1WKDA 4I3GA 3W7DA 3EOUA 3UY7A 3GXPA 2OPJA 3CT2A 1WDQA 3MCOA 4GZIA 2TODA 2YA2A 3N15A 1SU5A 4R34A 3GH7A 1DTUA 4DPQA 3CT7A 3L0GA 3R8RA 1Q6GA 4O8RA 3OG2A 4O0KA 5ECUA 1VYSX 3I6RA 3R8HA 5A8OA 3H2AA 3CAVA 3O6AA 1EWEA 4GUHA 1TX0A 1PPIA 4DYEA 8RUCA 1LROA 2ZA2A 4HOWA 4S3FA 5BXPA 3M0ZA 1OWQA 2DH3A 1O5XA 3C8NA 3FJ4A 4RW3A 2PCEA 4J3UA 2ZC8A 2PDNA 2JIEA 3QY6A 5A3HA 1CGXA 4MTVA 1RR2A 3TMQA 2FMNA 1N7KA 3SUTA 1R85A 3UR2A 5M5DA 3BLOA 2FVMA 2OX4A 1AH4A 2GWGA 1VPYA 5CLWA 1A4LA 2QYGA 3MMDA 1C9WA 2F84A 4DJFC 4PTDA 2PRMA 4S3AA 1REQB 3ERPA 3S8HA 4O1BA 3UXAA 5BOFA 3BAJA 3PG9A 1K7XA 4F0SA 3L66A 3RMJA 4FSAA 4GH1A 1V0LA 3R0UA 3WJWA 1DJXA 1EA0A 1S39A 4KW2A 3SURA 4C6PA 3A47A 2YW3A 1TRIA 3AZSA 3U2CA 2E25A 3AIUA 4EIVA 4AIOA 3K2GA 1WUEA 1GJUA 3G1XA 2GGGA 2AL2B 3A4AA 3UGRA 1RA5A 1M7OA 2BXZA 3JU2A 2J8GA 3S5SA 4O18A 3C2YA 5BMXA 1TZZA 3VX1A 4X0NA 3B05A 2J47A 4HMCA 4IGSA 2NXIA 3MI6A 3WJYA 1EC8A 3LGGA 1Y5XA 4EXBA 3GHRA 4RXFA 4PBEA 2WNNA 1H1YA 4M80A 1YXYA 2WYSA 3IGHX 5CEWA 4LUJA 4PMUA 1CT5A 2NSOA 1F07A 3TROA 5BCAA 3URQA 3MBDA 3GBEA 2Q3RA 4Q7BA 3CPGA 2C8NA 3ATYA 3OIHA 3UVAA 3E1F1 3WH9A 1Q6LA 1Y8BA 3QQ0A 4RL3A 1QHOA 5KZ6A 3B8SA 1YNYA 4CU8A 3QR3A 1JVNA 5MKGB 3VGFA 4GC3A 1R38A 4QSHA 4QDMA 1H7NA 2PWUA 1LDCA 2GJXA 3SI9A 2YXGA 3AJXA 4B5TA 3OIXA 4M8UA 3WBYA 4FF7A 4E8DA 4NNAA 1NF7A 2DZVA 1KCLA 1DHKA 2XN0A 1TPEA 3TOYA 2CLFA 2HRWA 3CMJA 4FF5A 1ZAHA 2Z6JA 1ZZMA 3AHZA 4GI8A 3KOZA 2FZ9A 1OGSA 3PN8A 5AHEA 3BJFA 1AQ0A 1E1EA 3FGCB 4S3JA 1XRVA 3VIOA 1QRQA 1FH7A 1OF6A 4H2CA 4LAKA 4BEQA 1K7EA 1LBFA 1RD6A 2J7FA 3UWWA 3WFAA 5HNNA 1WZKA 1R9ZA 3NQEA 1HVXA 3KOFA 4TO8A 3USZA 1MXSA 1IIGA 2CZFA 2QIIA 3W7NA 3KBVA 4IGNA 4TUFA 3W22A 1FX6A 3RO8A 1JGIA 3YPIA 4I5UA 2OMAA 1ZBWA 2W92A 4AMCA 5C9XA 1FP8A 2PWVA 2EPOA 4K37A 2BTMA 4GQRA 1MRQA 2QVNA 4ML4A 3WG6A 1GEQA 4M19A 2MANA 4MJ4A 3LOTA 3EOSA 2NQ5A 4UQEA 1CLXA 4EACA 2AAAA 3S5YA 5CC6A 3WLQA 1DHPA 4O0QA 3I3BA 4OQVA 5I0DA 3W02A 2R1PA 4MJZA 1MUWA 5KITA 3CTTA 4QG6A 3PJUA 2REQA 4TMCA 3SCQA 1JCJA 4NZJA 4RLIA 4C6CA 4KFPA 1RAKA 3EKZA 3NUKA 2QGYA 4LT9A 1KGXA 2A79A 4H4IA 4M7TA 3V0TA 3BUVA 1LUCB 4F48A 3PPGA 3W7JA 2QCDB 1UD2A 3NQ6A 3O05A 1UKPA 3M6YA 3W7PA 4UMBA 3VCRA 3TLLA 5D38A 1T99A 1B30A 4L6OA 3N2MA 1RCQA 4KFNA 1WNOA 2TSYA 4F2TA 2VFGA 2P8BA 1LWIA 5HMSA 4NXKA 3TAOA 1VRXA 1B1YA 3WLNA 4O1AA 3SN0A 1DE6A 1ECQA 3FJ6A 5IXEA 3SUSA 4C6KA 3P3BA 4FK9A 4EPEC 2QJJA 1VCGA 3DENA 2AL1A 3SCUA 1NDZA 3Q58A 3WEZA 2XHYA 2DP3A 4YJ5A 3KBNA 1QWGA 5HNUA 2QDEA 2FGZA 3NZQA 3VNKA 1JNDA 4PCFA 3VE9A 3SQMA 4IFOA 1B2YA 2JALA 5L9FA 3CWOX 2NSXA 4JS3A 3VOCA 2TPSA 3CPUA 3H8AA 3USBA 4LFYA 3AXIA 3W6MA 3KRSA 3PY2A 5A95A 4RXGA 1E72M 2YDRA 1UZDA 1XKYA 4F3HA 3KEHA 4LYPA 1A5MC 3RAOA 3LHUA 1X6LA 3SFWA 3EPNA 4S38A 3U4AA 2OWWA 3VKAA 3N11A 3WDPP 2W9MA 3N4EA 2IPWA 2HE5A 1NOWA 3UPWA 3HPAA 3N29A 4FX6M 5HMFA 4OUIA 2F2KA 3VM5A 3AXKA 3B8UA 3HZ3A 3WQ5A 4LEQA 4L4PA 2YCLA 4ORMA 4W5ZA 3WQ4A 1D8WA 2JEPA 5L6UA 2Y2WA 3F4CA 4PCSA 4UZUA 2XFYA 3PZGA 4KIEA 2HJPA 2E67A 4ZGYA 3B8TA 4WR3A 1E6RA 1ZP4A 3IJ8A 2HNHA 3W72A 5AB3A 4PEEA 1GQJA 3AI0A 1EQCA 1FVPA 3WBAA 4BQ2A 4BS0A 4E5TA 4XO7A 1DBTA 4QRNA 3KXQA 4UNLA 1NWRA 3QV8A 1VJIA 1CBGA 2BGSA 3FJNA 2FJUB 1V3MA 3ARQA 3L4XA 3BLIA 2J74A 1YPXA 2VGIA 2Z1WA 3C2VA 1XIMA 4AFYA 3E02A 4AVFA 1OFRA 2ZKMX 1VBGA 4Z1BA 4UB9A 2AKZA 3UJRA 2OO0A 3UD6A 1OCBA 5FJUA 4HA3A 2ACSA 2Z1BA 3AFBA 5DCDA 1OD0A 4PE8A 4NJGA 2Y61A 4PCTA 3RDKA 3AHXA 4DJEC 1C8XA 1IWPA 4N9CA 5FJIA 6A3HA 1CB2A 2ZRYA 3AO0A 1GPFA 1RBOB 4WZHA 4OKDA 2CPUA 7A3HA 3IAQA 1BPLB 4DBEA 5CKSA 3VZZA 2DQWA 2J13A 3BAXA 3DG3A 1I0BA 3WNMA 2PP1A 3G8RA 1E6SM 4WD0A 3TQPA 1K9DA 3ITOA 3NO5A 1ML1A 4HHPA 1CLVA 1XFBA 1ZCOA 2PFHA 4UCGA 3ZSSA 1M65A 3WLTA 1XYCA 1WXJA 1CB7B 3C0LA 3BW2A 3QRHA 2NQLA 3RXZA 4GXWA 1FHLA 5CJMA 1OB0A 2ZICA 5EL1A 4KBXA 1FCBA 3VZXA 2WVVB 5G2IA 3GHSA 1ADDA 1B4EA 1YLVA 4AZGA 2D3NA 2OODA 4JFUA 2X09A 5JU6A 1T8QA 2I16A 2QZRA 2VCAA 3GFYA 5EMLA 4MZYA 2D20A 3HGJA 1JZ6A 3M5ZA 3M9YA 2VRJA 5U7SA 3SGZA 1VENA 2PI6A 2YBVA 1JDDA 4RJEA 2QV4A 4R88A 2FMOA 4GIYA 3OLGA 4CLMA 2YDSA 1V8EA 2RHGA 1KCKA 3PAJA 1FWAC 4FX7A 4XKYA 2GVLA 4AX7A 1XYZA 2PDJA 3HG3A 4W89A 4GY7A 5D8ZA 2Q02A 1CNVA 1WZLA 3OW1A 1ZHAA 1A3HA 3U0HA 3LB0A 1ISVA 2XIOA 4MSSA 4YIWA 3LCFA 4ZSTA 5CZJA 4JTJA 4C1NA 1XRTA 3UERA 1YBQB 3UA4A 1W1B1 4NNCA 2XH7A 2R14A 1S38A 4LF1A 3CZEA 4IL2A 4LVGA 3QZ6A 3WMSA 4P61A 4D2JA 5I00A 1UR2A 4C7FA 3CUXA 4JHOA 5HQMA 4UUIA 4TTUA 1G6CA 3KM8A 5DELA 1H0GA 1WZAA 2BVYA 2NLYA 2WWDA 3FGCA 2HPMA 1TG7A 4WUIA 5HULA 4O1EA 5TF0A 1E5NA 4ZE4A 4ZO9A 2VM8A 3L4TA 1H4PA 1T7LA 1OCJA 4TR9A 4NJHA 2VZVA 2C91A 4HNOA 4LCSA 1TIMA 1AQMA 1MW2A 2WM0A 4RZ5A 5I02A 4X22A 3GD6A 1SZFA 1H63A 3TW7A 4NAFA 2ZZ1A 3NO1A 4V1YA 3CZLA 2VVNA 5T9BG 4PEKA 3H7UA 3GG1A 1H62A 4CNOA 1GYNA 3NO3A 2UZ9A 4GQ0A 5EMJA 4ZO6A 3BTNA 3WX7A 5ABEA 2J7GA 1W3LA 3TQVA 5EBUA 2PPGA 1AL8A 2BOFX 3UESA 4BK9A 5FA5A 2OEJA 3M07A 3SADA 5DMNA 1XXXA 4H7VA 1MEHA 4NP7A 3NZRA 3S42A 1EBHA 4AZCA 1MUMA 1BYAA 2HBXA 1R46A 4UMAA 3TN3A 2PC4A 3TQKA 3FV9A 1GOQA 1A47A 4QCFA 1E73M 1HKWA 1US3A 3GU2A 3SUUA 3GHTA 3PAOA 2D3LA 4HTBA 1S5WA 3FCPA 1A5CA 2X42A 3EBVA 2QAFA 4OOZA 2CXGA 2ZRWA 5F4SA 1WAWA 4XKYB 3IK2A 1KV5A 4P8WA 4K39A 4A3YA 3G2GA 6REQB 4HJFA 1NFPA 3P0WA 3VOHA 1BYBA 2OELA 1ME9A 1XDLA 4WEVX 3CH9A 4DJED 4HU8A 5A5WA 3I7RA 4M56A 3EKLA 3MUXA 3MSRA 4OBSA 1EOMA 1XC6A 2A3CA 2ADAA 3V4BA 1MXGA 1HTIA 4DNMA 3ARYA 3GVVA 1P0KA 3AMGA 4UTWC 4L56A 1ZBKA 3QJAA 1YXDA 3S9IA 4HCHA 3S1GA 4O53A 5D2VA 2E09A 4IJCA 2W91A 2J27A 2CZ5A 4ZBCA 4WLCA 2FIQA 3RIKA 3GIQA 5HATA 4KEVA 1QK2A 3TEVA 2IPFA 3H2NA 1EEXA 4LNYA 1YIXA 1MNZA 3O07A 3UWUA 2YFOA 3TR9A 2WJFA 4V15A 4EXAA 4XBSA 4HA0A 4D1JA 4EX4A 3MI3A 4OBRA 2FB3A 3LTPA 5I3KA 1R3TA 3H24A 4N9DA 1IT7A 2V5DA 3WFZA 1ITXA 4ZA0A 3CIWA 1AD1A 1YXCA 4V1XA 4KETA 5A2BA 3F1QA 3BICA 1QW9A 5D37A 3IUIA 1JZ8A 2XFFA 5BXRA 4NUWA 4MYXA 4KIRA 2WZTA 1PWLA 4GGHA 4MY1A 3UCDA 3IJDA 4RE2A 2OYLA 1YX1A 3THAA 9XIMA 4IJRA 4UR9A 2R8WA 1JFHA 2GGIA 1GORA 1FKXA 3P62A 3TN5A 4LANA 3C56A 1ZS2A 5A8MA 4AF0A 4DZHA 3GUWA 1PWMA 3QC3A 1C3FA 4DBDA 2AMGA 1TJRA 3UZYA 3WNKA 3NZ1A 2Z1SA 4FNQA 2HNEA 4G9PA 1M03A 2BDQA 2WSKA 2YCLB 3HV8A 3QN3A 2B81A 2PD9A 2GJRA 4GZJA 3IVUA 2QULA 5ABFA 3T44A 2ISSA 1TQJA 2CLEA 3MHUA 4EP8C 4Z2JA 1UROA 1O5RA 3ARRA 3DYOA 2PP3A 3N6JA 1Q13A 3H54A 5E0CA 4FO4A 4S3KA 5A6MA 4AHQA 3LZ5A 1TRDA 1GZGA 4CQCA 4FEZA 3TJ4A 1UC5A 1UD3A 4GA8A 2OWCA 1ISYA 1TTIA 3KHDA 4NT0A 2I1OA 4E0CA 1M41A 2D1ZA 6CGTA 4Q4KA 1W3JA 2OO6A 2NVAA 1EDGA 2P88A 2Y85A 1LG1A 3AOFA 2YB4A 3BPWA 3LLFA 3Q65A 1TREA 2DEPA 3AUOA 3EOLA 4OWGA 4OZOA 4YMZA 4CQBA 4LAMA 1EX5A 4GE8A 1S5VA 3C86A 3WBWA 3NURA 1DJYA 3A12A 4Z42C 3VDCA 1B31A 2D0GA 3WLMA 3C8FA 2AGKA 3ZQ9A 1P0BA 1FWIC 2Y5JA 4IP5A 5JUVA 4FNPA 3MW7A 1V79A 2DH2A 4JCLA 1GK8A 1ICQA 4IX2A 4XAGA 2XIQA 3VAVA 3DFPA 4GLEA 3T4WA 3I7QA 4DPPA 4PFMA 1HJWA 4KWOA 2AL2A 3HQPA 1NJJA 1W2VA 4YCPA 1I1WA 3W2LA 4GABA 2J7EA 2GJLA 1SW0A 3GXDA 4ADTA 4HU0A 4FP1A 1U1HA 4BY3A 4LV9A 1N8IA 3ARUA 1I2PA 1D3GA 1YTKA 2EG6A 5BXTA 3OLIA 1BG9A 4NKCA 1EGVA 1DWIM 4A8RA 5A6LA 1QNVA 1W3NA 1S46A 3STFA 3W24A 3C2OA 3FYOA 3R13A 1FH9A 4AMAA 4GK8A 3L0NA 3NQGA 3NDZA 4YVXA 3EX6A 5M1TA 4AWSA 3CM4A 2E68A 3NVTA 4HNLA 4XO6A 2UY2A 4V28A 1XP3A 4F4RA 3Q94A 5E93A 1EOKA 2F7FA 4XD4A 1KXVA 3GE7A 3PPHA 3W1XA 5AZ0A 1GNXA 5CPTA 1PKYA 3KTXA 4GACA 3S9ZA 2I5IA 4Q4QA 2D23A 1M7XA 1TE6A 4NJJA 4W4QA 4PTXA 3TYBA 2FVLA 3RMEA 2UV8G 2J7CA 1WUFA 1P6BA 3CIVA 4ML9A 2WOQA 4AD1A 3T09A 5D9MA 2GGHA 3FKKA 4CCZA 1W3HA 1V3HA 3I10A 2OLHA 3P8JA 1POKA 3ZXWA 3SGGA 3VGBA 2XN2A 3S6DA 3ARTA 3WSUA 3QY8A 7CGTA 1F6PA 1QOQA 1UD8A 4LQ1A 2PE4A 4ACZB 5AYZA 3FHAA 1BWLA 1UP3A 3JRKA 1E9ZB 1EHNA 1M6JA 3CEPA 2OVLA 5K4XA 3DFOA 3KFTA 1WOBA 1V6TA 3R43A 3G6MA 1M7PA 4MJ2A 3ARXA 1QPRA 3RPMA 5LHFA 1BXNA 3DERA 4TXEA 2OXNA 4K8EA 2H3BA 3NPUA 5BRPA 5KMYA 3L23A 4EPKA 4XD3A 2WQPA 2DJXA 1KFWA 3VUSA 4N6EA 3MANA 2ACQA 3TYUA 2BB0A 3W38A 3WBEA 3UNTA 1F74A 4WDTA 3FVMA 4HNUA 4C60A 2OYMA 4HK5A 5C5YA 3HO8A 1OX6A 2FQIA 3GSMA 4AZIA 1K7FA 3VKBA 1EP2A 4ZQNA 3P67A 3S83A 1FWNA 4I9TA 3UF9A 2BMBA 2R94A 2AAMA 4UQAA 5AHIA 3GDKA 2PDXA 3I6EA 2DPEA 4I8DA 4LPCA 4GH3A 1BYCA 3QGKC 3BSMA 2YFNA 2OYKA 4IX0A 2XWDA 3S1UA 1UYQA 3J7HA 2POTA 3KE0A 4H9VA 2ZXQA 1FY6A 2X1RA 4LSBA 1CGVA 1SYTA 1TV8A 4O52A 3OYZA 1JYWA 4L4MA 4NF7A 4GKTA 3TA9A 3TQ0A 2QDDA 4AQLA 1KNWA 3AZTA 3E38A 4JHZA 3IUDA 4L65A 4PL1A 2WCAA 4E3TA 3CYVA 3M41A 4IG2A 4CN6A 4ZE5A 1AA1B 3BLEA 5IDIA 1TE1A 1AD4A 1W1IE 5F2LA 1W9BM 2UY5A 4IMFA 3SY1A 3GXMA 3A3HA 3I3DA 5CAHA 4HPXA 2OB3A 4Q4OA 4B16A 1G67A 4Y9PA 2E28A 5EYWA 1EH9A 4LCQA 1S5MA 3MI2A 4Q6XA 1VFHA 4DWSB 4ZFMA 1SJDA 3NQAA 5CJ5A 3RCNA 2WKJA 1A80A 2VZSA 4AU0A 1A0EA 3WNLA 4MY8A 4H3DA 1Z41A 4NU7A 1UR0A 3S4TA 3PPFA 4M24A 3MWCA 3UP8A 2EJ1A 3IARA 3CXOA 4NASA 4AYGA 4J3VA 2DZBA 3GG7A 3PUDA 2QMJA 3O2LA 3CMGA 1V0NA 3EXRA 4JTUA 4K6AA 1F5ZA 3QYQA 1EWDA 2POZA 4P7RA 4Y9MA 3BCFA 1TV4A 1ZUAX 1ZNNA 4KEZA 3BH4A 4HPHA 1HJVA 1QPOA 2CEQA 2OEKA 3OG3A 1H0IA 1IWAA 5I7GA 5FAJA 4GKLA 4QSFA 4JEJA 1Z48A 2O4QA 2VO5A 3QW3A 4NZ4A 4DWSD 1E1FA 1HKVA 2A7RA 4MWAD 4DJEA 1FWTA 3DGRA 4O12A 4AD0A 3W26A 2PGRA 1A49A 4N2YA 5D9PA 1WO2A 1U33A 1RXOB 1Z69A 3E6EA 4IP7A 1V5XA 2J7HA 3G5EA 1GQLA 2DT0A 1ODZA 4JYDA 2PZ0A 9RUBA 2YBTA 3EPMA 4TQTA 4C7GA 1UJQA 3S2LA 2J6XA 3W25A 3NTYA 4QJ1A 3NM3A 5ABTA 3VXGA 1P1MA 4YHEA 4GBDA 2GJPA 1JPIA 3NG3A 4Q4RA 1V6UA 3L4ZA 1PZ1A 3EEZA 1OD8A 3MVIA 3W73A 1G9HA 4DB7A 4HZ7A 4B90A 2ASHA 5XIAA 4WCJA 1JZ3A 1GQKA 4N02A 1JAEA 5B7ZA 3GW0A 4RW5A 5ABFB 2CERA 2X0HA 3OQEA 1OK4A 4QS6A 4MZ8A 5REQA 3H4GA 1XJBA 3ZVHA 1RK5A 4ZQMA 1N2VA 1JAKA 4YNGA 4A35A 2QCEA 1IXPA 1I2OA 3ICJA 4LVFA 3W76A 1KLYA 3M0JA 4GCAA 2G50A 4UXDA 1UWUA 5GJMA 3REQA 2D2HA 3P60A 2EXOA 3AWNA 4J35A 1UWTA 1QTWA 3ITGA 1J2BA 2WZEA 1GOMA 3K8KA 5IHRA 1WA3A 5I3FA 4GYKA 1MEIA 4TVCA 4C6BA 4DO7A 4BEUA 3H4XA 1EFZA 3VD7A 5E9XA 4ZTXA 2ZA3A 2BVDA 4DJDA 4DO5A 4ZB2A 3MP3A 1WOAA 1UWQA 4Q8WA 1KXTA 2WZHA 3WF4A 1PEZA 4FZIA 2ISDA 2XDFA 2CCRA 1PJ9A 2V9DA 3M46A 5K9CA 5HWJA 3HIJA 1JD9A 3S5NA 3NQFA 1ZY9A 5FJRA 5JBFA 1PTGA 1DPMA 2VWSA 2IW0A 4BR1A 5XINA 2CWNA 4KWUA 2VGFA 4U31A 4IFKA 5CAKA 4ILSA 1KBLA 1GCYA 2ZZ4A 1ENUA 1DWFM 1F4HA 3OBEA 3HFTA 1HQTA 1X38A 3BAYA 4UOQA 4IIDA 2E5BA 1MW1A 1Q6QA 4R9OA 1YMYA 2WV8A 1Q7QA 5JXQA 1OEPA 1UKQA 5E0KA 4RDYA 1SPQA 1CGWA 4CU7A 1HKMA 2QKFA 1SUXA 4GO9A 3URNA 4OV4A 3NL2A 2FGBA 2AOSA 3GIYA 1W9VA 2DSWA 3SZ8A 3GYCA 2VC7A 1EDTA 1VFLA 4YTTA 4ZQRA 1AK5A 3S1WA 2O9OA 1JCLA 3TW6A 4QBXA 2E77A 3MU7A 2I17A 5A94A 3WNNA 4AIUA 2A6NA 5DFAA 4Z2HA 3AZRA 4LNCA 4IPPA 1L8NA 1LWHA 3T8LA 3STGA 1T96A 4MNJA 1G69A 4YYCA 1GPWA 1AFSA 3GTFA 4NZFA 4YTQA 1LRQA 3HBLA 4MZ1A 3KBSA 3LG3A 1R5YA 4HYWA 4WJXA 3QGAC 5AN7A 1XBXA 5ENLA 2W0UA 3ANUA 2F9RA 1D8CA 4OBTA 5HWNA 2FZNA 2D2JA 3W75A 4JDBA 3L67A 7PTDA 3D0CA 3N9KA 4IFKB 4JTKA 1S5TA 5JIPA 4QP0A 2VELA 2ABAA 1CDGA 3CAQA 4Q4MA 1GOWA 2Z2UA 1JJKA 1JDFA 3T78A 4S23A 1R6WA 4XAPA 1JXKA 3OU8A 4DIAA 4AHOA 6PTDA 4DY1A 3GH4A 2YSWA 3W23A 4DVOA 2GQ9A 1E70M 4RPQA 1KKRA 3WLOA 2VKZG 1OGGA 3BDKA 5I3DA 2CBIA 3L0KA 5CBJA 5DBTA 1E9YB 5CBIA 2PB1A 4WOQA 4A8LA 3V1PA 1N55A 3BG9A 4W7VA 4Y6GA 4FB7A 1D7KA 5C9UA 1Q6EA 2PEVA 3WJZA 3QHOA 2GYIA 4WIWA 3WKZA 4FNUA 4PUKA 4U4MA 2WMHA 2AGTA 2FZBA 2XH4A 3ZR5A 1VEOA 3GVGA 1A5NC 4ONVA 1J96A 2UBPC 3WH8A 4DX3A 3QH2A 1M53A 4K1GA 3UR5A 5I2UA 1Z32X 2CBJA 2EHHA 5AVHA 4O0ZA 3L2MA 3T1GA 5FKYA 2ABBA 3FDKA 4PSPA 4NJIA 3O8AA 4CUCA 4YTSA 4NHVA 3ZT7A 2O0TA 3LERA 4J3SA 1HJXA 2EG8A 2WPBA 3N73A 4GZEA 1X8CA 1JYNA 1IXQA 2VX5A 3IIPA 4QLLA 2YLAA 2VZOA 4GHRA 3AWOA 3MP4A 1KRBC 3UYIA 4PBFA 1VHNA 5IOBA 1R3VA 4MWAC 4AC7C 3OLDA 5TBOA 2J75A 2X1SA 2DSVA 4GD0A 3DESA 2RGLA 3W85A 2GFTA 3CQKA 4WKHA 1XCXA 3W27A 1K9TA 2IPJA 1XI3A 2IPGA 2NLIA 1KM6A 3FN9A 1KM5A 4I8YA 2DIKA 2VX6A 3GFXA 1KM4A 5FL1A 1H3GA 2QJGA 4QDWA 3FNDA 3MO7A 2YL6A 4DM1A 3U2OA 4F0LA 3NL5A 5AC4A 2JGQA 1CGUA 4GI9A 5D33A 4PMQA 1EO5A 3RCYA 2NX1A 2EKCA 1BRLA 3WIJA 1H5VA 3SDOA 2V6AA 4KESA 4KWSA 1W5NA 3TE9A 3GM8A 1QJWA 3IS4A 3UETA 1X39A 1J01A 3ZOAA 3GNDA 3W01A 5AYBA 1JDAA 4N9EA 7REQA 1M9HA 5FSDC 4WVXA 2BLEA 1WE5A 1YNQA 3AXMA 3G24A 3P82A 3R1ZA 4K2SA 2PDYA 1XUZA 5E09A 3VOFA 4KCWA 7REQB 2QMKA 4HZ8A 3URBA 1XV8A 2P3ZA 4R5EA 5FF2A 2PDHA 4RV3A 4V2XA 2DU2A 1I75A 3IIXA 3W29A 3E5PA 1S5NA 4S3DA 4DN1A 3LM7A 1EEPA 1ICPA 2OSXA 3VD5A 3KLLA 2QVHA 3WK0A 3VI2A 1Z9AA 1H09A 3TSBA 2AQOA 3THUA 4ALDA 3PFRA 4XZNX 1SR9A 5AECA 3H12A 5M17A 4D9PA 1QI2A 5K4ZA 1TJ2A 1VFOA 1HXJA 4ZSUA 1L6WA 4S3GA 1Q6DA 1NDYA 4JEQA 1ODUA 5CSUA 4RPPA 2WMJA 4PMXA 5FSEC 1P1XA 3SAZA 1J93A 1AJ2A 1KWKA 2A21A 4W88A 1QXLA 1YW1A 4IQLA 3FVDA 3R10A 1RALA 3ABRA 3PVFA 3ZFHA 3VDBA 3MJMA 3CZKA 2XN1A 1TR9A 2ZUTA 4HA4A 2WB5A 2FHBA 1H61A 1NP0A 3VOIA 1UR4A 4WRHA 2E5CA 4DF0A 1K02A 2OQYA 4ZB5A 3W28A 4FR6A 4IL0A 4PTNA 3ZT6A 3W1AA 5A69A 3PM6A 3WQ6A 1UR8A 2Z1VA 2QJNA 5T91A 5I06A 5I77A 1T41A 3NGFA 2VT0A 4O10A 1P48A 4WF7A 3RFAA 3MMUA 2WLZA 3WUGA 2XFRA 1YTDA 4ECLA 4GNKB 1RHCA 1EBGA 4CD6A 3M0MA 4E38A 4FNRA 1CTNA 3WUBA 5EFFA 1R2TA 4TV5A 2R6OA 3NDOA 4CQDA 3UJFA 3WDJA 1Q7MA 2CLIA 3KZPA 2WC3A 4ZOAA 4DELA 3T0AA 4B3ZA 3MHFA 4H00A 1JRBA 2J25A 3K46A 3RF9A 4L1WA 3PTKA 2G3JA 1FWCC 1BFNA 2A3HA 1DORA 4DAIA 2VFEA 1TCMA 4QISA 2E9MA 4XVEA 3N2OA 3ZJ7A 3NEHA 3DAQA 2XIBA 4GIRA 1UD4A 3WLSA 4P5UA 5D9NA 3CZGA 2YL8A 3EB3A 3C0QA 1PCWA 1FP9A 5BWFA 3TSMA 1FDZA 2HCVA 2NX9A 2D0FA 3ZJ6A 3P80A 1VH7A 2PTXA 2RDWA 2JGYA 3T9PA 4XQ6A 2ATMA 2D2GA 1AJ0A 4X9SA 2V2HA 4UTFA 1LF1A 2E40A 4JD4A 3VNZA 4UR7A 3PUEA 1VBHA 3HJZA 4IICA 2Z2BA 4YYFA 3KAOA 3WD4A 1A5LC 4FIRA 2PODA 1MW3A 4HQVA 3KRUA 3OB8A 1U2YA 3TLQA 2PLCA 2NV2A 3K4WA 4C6JA 4U2YA 1KTCA 4OJYA 2J78A 2QCNA 1US0A 2VFHA 4GIAA 3WH5A 4HVXA 4UFIA 2XVNA 4O28A 4GOAA 2W4XA 3MC5A 1RBLA 2Y70A 2WM1A 3LGEA 4UTLA 4A3HA 1DYSA 5DMYA 1XLKA 2XVPA 4JR5A 4Q33A 4B5NA 4KMQA 1REQA 2PLJA 3B9AA 2GGJA 3WQFA 2YGYA 3KHJA 1VD6A 4N7QA 3HMCA 1ONRA 1YDNA 3Q45A 1V02E 3PZTA 3ZWTA 3O7UA 2CWXA 4QLJA 2OTDA 2C13A 4MDOA 1PDZA 4PUJA 3RJYA 3G8EA 2V30A 6XIMA 1XSIA 4LXFA 1BD0A 3MP5A 4YCOA 3HJEA 3SBFA 1J79A 3BL3A 1J18A 3S47A 3UG3A 5I78A 4C1KA 4U5IA 5C54A 4LUTA 5DO8A 2OQLA 1VYPX 1C90A 3T2OA 1HX0A 3IJ6A 1EKOA 1QASA 3VDHA 4GNJA 2XISA 5F7UA 2ISFA 2X1IA 3UZWA 1H11A 2GUBA 4DUOA 3S6TA 4M6QA 1HGWA 2G4FA 4Y7EA 4O4WA 4XZHA 1OYBA 1NH6A 2BOEX 3TZFA 3R8GA 3QY7A 3W7QA 2FFIA 1R9YA 2JF6A 4RE0A 2XH0A 2RDTA 4HSOA 2BODX 3EWBX 4KPLA 3MUZ1 3LCLA 4QNEA 3IRDA 3MUY1 4ZOCA 1CYGA 3QPEA 1RSCA 2CBUA 5HNRA 3VE7A 1J5SA 2OZTA 3W1MA 2P76A 3K4DA 1J0HA 3LHYA 1GQNA 4A3QA 3A64A 4MOZA 1P5BA 1JXJA 5F2GA 4N6FA 2GSEA 1OM0A 2VD8A 1G01A 2BXVA 3TH6A 4XBJA 1BF6A 2HMCA 2QXWA 1ZFJA 2YA0A 3I7SA 1W9UA 4I5RA 4UMCA 2FLIA 3WQOA 4DBUA 1XICA 4D6EA 3U5YA 5GQBA 1Y5VA 3EDJA 3GKAA 4AEFA 2DORA 3T2PA 5KZEA 3BCDA 3PJWA 3RM4A 3M0KA 3BO9A 1PCKA 1BKSA 2VURA 1EXPA 2Y7EA 4E2VA 1C92A 1I2QA 1XIEA 4X3ZA 5KETA 3GAYA 2QGHA 4O1CA 3G1AA 2J7BA 1T8XA 1PHWA 3F7JA 3PUGA 1FOBA 2CESA 2ZVIA 2ALRA 1X97A 5RUBA 4IPNB 2DV0A 4QR6A 3L21A 4QS5A 4NAEB 1ESWA 4KRTA 2X8RA 3TTYA 3B8IA 4D8AA 4C91A 3NQMA 2C19A 3LXBA 1TB3A 4US6A 3ARWA 5LIYX 4IMCA 4C90A 5DRCA 4LS2A 3GNRA 3KRBA 1VB9A 4Y9AA 4EAYA 3I3EA 5H91A 3V5FA 4B3LA 3AS3A 3IIOA 1CXKA 3O06A 2P1FA 3FEMA 4MPQA 2R1MA 3DN5A 4OU1A 3E2SA 1HO1A 2OJPA 2F6UA 3TN6A 1GKPA 1EQPA 2NW0A 1TMHA 2A3BA 9CGTA 2HVNA 1H7XA 2EPMX 2I7GA 1CGTA 2REQB 4LBUA 1VCFA 5AOUA 2ONEA 4JZ5A 2C6QA 2GOKA 3NQDA 4DM2A 1SW3A 5HQLA 3TK7A 4MYAA 1XLJA 4UTWA 4FXRA 4P7NA 5F1UA 2QPSA 2TMDA 3OBKA 1TPB1 5PTDA 4B5SA 2BOGX 1B3XA 2X1UA 5F4XA 4DWSA 3H70A 4XD5A 3DG6A 1XS2A 3RLGA 1PTAA 1XG4A 4H8HA 3TMLA 2CXEA 5HMEA 2NUYA 2Y1HA 1LOSA 2FKPA 1V51A 3FW6A 1P0DA 4W8LA 3DGBA 2TAAA 1U5JA 3MB9A 1EPXA 3MDWA 4AEEA 4PB5A 4UC5A 2H8XA 1BRLB 1R3RA 2ZTKA 4S3CA 1F8MA 4I7UA 3VNIA 3CO4A 3LY0A 5D9OA 4GYPC 1XIGA 4DYKA 3VK5A 3QLDA 2CC0A 2YL5A 3WF2A 2GUUA 4QM1A 4LUYA 4UCFA 1ONWA 4DHGA 1TJ1A 1BG4A 4IWWA 4AIBA 1U22A 4Y9OA 3QHNA 2OQHA 4DBSA 4IJBA 3W83A 3W2MA 2V5JA 3AHTA 5EBAA 1B54A 1FHVA 1RJQA 4R9XA 1XCWA 3SSZA 3APGA 2OOFA 1K4HA 1KBJA 3FXGA 4Y8EA 4OOUA 1UUQA 1TCDA 3JZUA 4AY1A 3VU2A 2CLKA 4XTIA 1JYXA 3KTCA 1VFUA 4MB5A 3DX5A 2FPTA 4DI8A 3P8IA 3E0FA 6TAAA 4KRUA 4UR8A 4GQQA 4ZCWA 4LALA 4Q32A 1NFGA 4M6PA 1YEYA 1RLDA 3E0IA 5BOEA 3U2EA 4TTGA 3CV7A 4EAMA 1E4MM 3WQVA 5D05A 2VR4A 3R2GA 2JKEA 2V81A 1C29A 1YKWA 3E12A 3OJGA 1A0DA 3W7HA 3H2FA 3RHGA 3GQYA 1TV7A 1VEPA 1GGOA 1CLKA 3OZOA 1G0CA 3HURA 3GVRA 2GDVA 3L2IA 4F0MA 1B3OA 8TIMA 1EZWA 4LAOA 4E2DA 3KL3A 3CHCA 3M6DA 4W5UA 2Q3OA 1DEDA 5JMUA 3VCNA 2B7OA 4GUGA 5DQPA 3AS2A 1C7TA 4I90A 1KFJA 2NWSA 4J27A 4NI3A 1LJYA 4OGZA 3VKJA 2BFGA 1XYBA 4GNVA 4EPBC 5CGQA 4JN8A 3U4FA 5DMMA 4UTMA 3S5OA 4AY8A 5C9RA 1Q4NX 1KXQA 4YHGA 1AW2A 2XVKA 3B0XA 3BLFA 3NL6A 4JYEA 3W74A 3KWXA 4ICCX 3QMSA 1FWFC 3W84A 3QW4B 3UJ2A 1G4TA 4PUWA 4PMOA 1OFPA 3PTQA 5HBFA 4CQ9A 1DIOA 1U30A 2HS6A 1WDDA 3EX2A 3IV8A 2VEMA 3ALFA 3MSDA 4QE5A 1RD5A 4AY7A 1KLZA 3SCNA 3WJXA 1EF3A 1AODA 4WK9A 5AHFA 4HOXA 1TA3A 4UTTA 2PTWA 4GC4A 4LC8A 1KTNA 3B0VC 2GPTA 2CLPA 1XPYA 5I03A 4JTHA 5LNSA 3E2RA 4J40A 4I9JA 1DQWA 3H2CA 2ZDRA 1JL8A 5B80A 1DXEA 1B0IA 1K6AA 3BURA 1TTJA 3LHZA 4QAIA 4HYRA 1ZU8A 1XIDA 4M82A 3ANYA 3CWNA 3T7VA 4JQ4A 4B2DA 2J24A 4MWAA 4HSNA 2WSQA 3GLCA 3KCOA 1Y7VA 3OVRA 3WLJA 3WFLA 3P5YA 3MBFA 4XAZA 2Z26A 2HWGA 1TELA 3JZEA 5FF4A 5LNUA 2PD5A 3UJEA 1UZ1A 3P5ZA 3CZJA 1BXCA 3VDAA 3AMKA 4O19A 4X0VA 1DIEA 4MNKA 3ZLGA 3Q37A 4TX6A 4U3CA 1AMKA 4DWDA 3VGEA 4ZB0A 1QHPA 2GVJA 3GC5A 1VBUA 1BWVA 4MVAA 3GWQA 1RJPA 1WV2A 3HM7A 1UOZA 4A8NA 2HSAA 2GVYA 2NT1A 5J8LA 3UXLA 4QDPA 4NQ1A 3GXFA 3MY9A 1Z42A 1LG2A 1W1ZA 4CCDA 4PRTA 2ZCGA 3MTWA 5C7VA 1A4MA 3W4RA 3HV9A 3L4UA 1C7SA 4DLFA 1UA7A 4OTKA 3BJTA 2C79A 5CPLA 3NNTA 4GINA 4KEUA 5HNTA 3DFNA 3CQHA 3S1XA 4QJ3B 2DJLA 2B31A 2VX4A 3LUTA 1JCMP 3WK3A 3WLPA 3RJXA 4YL2A 2CLOA 2DVUA 1VZWA 4IQEA 4PUMA 1A5KC 4GWEA 1QW8A 3BV7A 2GUYA 4ZO8A 1U5HA 3EX1A 4HN8A 3G1VA 3MJYA 5E6YA 1SO6A 1XX1A 1VGAA 3GR8A 3QR1A 5IHSA 4D6HA 2E8YA 2ZX9A 3AYVA 5JH2A 1LP6A 5JBEA 2IKJA 2NQZA 3PWGA 1IXOA 4C7DA 1BTMA 2HBVA 4YTUA 3WBXA 2E6DA 3OHMB 4WXYA 4ZZ9A 2O92A 1QUMA 1G5AA 2WHJA 2WBKA 4MFDA 3P6LA 5TD4A 1B9ZA 2XPKA 4HA1A 3V35A 1AQFA 1T6MA 3LPOA 2O55A 5LZLA 4WQ6A 1OX4A 3E0LA 3E3HA 2DIEA 4RR4A 1ZL1A 3PANA 3E96A 1W56A 1W8SA 1UC4A 1Q65A 5CPNA 4IMAA 2V3EA 4PMZA 3UWYA 3VOJA 3SCSA 3SECA 4GZ7A 4GX8A 4J7RA 5GJPA 1OADA 3MYPA 1HKKA 1W1PA 2KAUC 3A9IA 1GOOA 3H7RA 5M03A 2FH6A 4L1GA 3RRAA 2ZX6A 4UTUA 3LCGA 3TR2A 1OQFA 1JUKA 2VEFA 4F9JA 4H9MA 4RZ4A 1ZJBA 3TDFA 1LQAA 3HN3A 3BARA 1Q3NA 3FKRA 3C2FA 1ADSA 1FFRA 3KDOA 1XDJA 2WKGA 1QOPA 1NOUA 4QCEA 2X16A 4XZIA 2NVDA 3V7PA 4K8HA 3EXTA 4DO6A 5H8PA 1JGMA 2BZNA 3VMNA 3ITTA 3A4XA 1BF2A 3APTA 5JVLA 1ISWA 3MV01 2ZRUA 3LHWA 3LN3A 2P0OA 1XDMA 4RNIA 2Q8XA 4MWAB 3LM3A 2C15A 3VKCA 1W0MA 3GNOA 4G1KA 2VJXA 3WUFA 2PGWA 5BWAA 3P74A 5DMLA 1BGGA 1IT0A 4F66A 1SQ7A 1QNSA 2EEXA 2VD9A 2PBGA 2ZBTA 4L5ZA 1UUMA 2EPNA 2V5CA 2W79A 2WNQA 3EX4A 1IR1A 1E1CB 3RPTA 4J2PA 1PKLA 3SY8A 4JXCA 3M16A 2PDCA 2VMFA 4G7EB 4MFEA 2PWDA 2JKAA 3BGAA 4XVDA 1CECA 3U7VA 3ABOA 5AC7A 4JTCA 1KW1A 1O94A 3ECQA 5IFPA 2BS9A 3BW3A 1PHQA 3AHVA 3U2ZA 1GVOA 3DC8A 3ZM8A 4E8GA 4RK8A 1UR3M 1T40A 3VD3A 2ZWYA 3TN4A 4Z2LA 1O60A 2Z25A 1K8YA 4DJFD 1PYMA 4RE4A 2PDFA 3LBOA 4NZ3A 4MDPA 5EFDA 3O6CA 4Q7IA 3IJIA 4HZ6A 2Z00A 5BOOA 5T9CE 5FEWA 1LLWA 5AHLA 4J4KA 1XQLA 4AHPA 3PNZA 2WK2A 2RKXA 3COTA 2HISA 2QJHA 1PYFA 2GQ3A 2JQXA 2ZZ5A 3WLHA 2RAGA 3QMRA 3IANA 4WY0A 2YJQA 4JBRA 2VHLA 2VDHA 1N82A 3LBMA 2YDAA 3WL0A 4JKKA 3REQB 3GDRA 5G4WA 4A4AA 3TAKA 4C1LA 3UG5A 3PULA 2Z0IA 3UZJA 1FWSA 3CC1A 1UKTA 1HZYA 4MHBA 4WXZA 2PSNA 2QUUA 4D72A 3HPZA 4LWWA 2QDHA 4IIGA 3GR4A 4IMGA 1W31A 1W8GA 3T08A 3CASA 4UQBA 1AW1A 2Z4GA 3ZIZA 4Q8UA 1H50A 2BY2A 1WKEA 1E43A 2EPKX 1JR1A 3DHDA 3AXXA 3QLLA 1AH3A 4CQ8A 2ZZ6A 4KRZA 3EXSA 2QIWA 4JFVA 1LRTA 3LS9A 4B92A 1RUSA 2PDQA 1JD7A 4MIMA 2Y5SA 2QCLA 4HHLA 1QATA 4JIEA 3H55A 3Q67A 2WNZA 4G56A 3LZ3A 1JZ4A 1RPXA 4XSLA 4HGXA 2W5FA 3W9ZA 1XWYA 4A3UA 2Z1KA 4V33A 2X2YA 3QV7A 5EA9A 4AWUA 2E9BA 3NZPA 4E6MA 3K8MA 4PH6A 3EDKA 3RG6A 2ZE3A 1GZ1A 1JQVA 4HK7A 1LYXA 4IP4A 1MEWA 4ICNA 1VAHA 1FHUA 3CIXA 3RR1A 3G1SA 3VTRA 3WF1A 4W7WA 4PSRA 2AKMA 1HT6A 1BEUA 1DXFA 4DJDD 1YHTA 4BJHA 2GZXA 4UFKA 4DI9A 3CLWA 4OVXA 4P2VA 1H49A 4WHBA 1QPQA 1JG9A 4YWSA 1YE6A 3E2QA 1JULA 3SM0A 1L0PA 5IBXA 3WMBA 3FYYA 5CZ0A 2VZTA 1XBVA 3P14A 4UFLA 1H41A 1EZ2A 1EXBA 4EVZA 1B5TA 1O68A 3NM1A 2VWTA 1PO9A 8CGTA 1TPFA 3H53A 3SW6A 4M81A 3LNPA 3MUAA 2P8CA 3P84A 5AZ1A 2WLYA 2Q01A 4LF2A 1IR2A 2BASA 1QW7A 3L5AA 1OVDA 2Y8VA 5I6SA 2WJDA 3QYSA 1BQGA 5CC3A 4B9ZA 3EB2A 1PVNA 3A13A 2QS8A 3F5KA 2VC5A 3WQEA 3LI0A 4Q8QA 1EHAA 1VYRA 4M1BA 2PTZA 3NOYA 2QF7A 4JIHA 1KBBA 1I60A 4FNTA 4X2PA 1IHIA 5AHMA 3EEGA 2B7QA 5H1WA 5FACA 3LGDA 1LCOA 2OG9A 2WVUA 1AQHA 1QCWA 3UCQA 4GI6A 4BA0A 8A3HA 4IG2B 1MDRA 1KCZA 3GC4A 4I6VA 4JPGA 3CTLA 4E4PA 2X7WA 1S2AA 5DXYA 1TV2A 3UWQA 3V0UA 1OC5A 3NYZA 4H6EA 1UWIA 3WQDA 5ABHA 1OBAA 2YOCA 2HROA 2PA6A 3W7GA 4MB3A 4ADSA 2D24A 3OGVA 4MWAE 3B0PA 3MUIA 1CX9A 2JK2A 2PMQA 3T6CA 3PF3A 1LT7A 3ZS4A 1PSCA 3B9DA 5E5CA 5FJPA 2CFFA 2QNEA 3CMFA 1HF6A 3UVIA 4O15A 4FALA 3AQUA 3IGXA 1Q6FA 2DVTA 3WD3A 3OO2A 3EZ4A 2QV5A 5LIXX 4QE1A 3AIVA 4GPNA 2Q6ZA 1LZOA 4Q22A 3GDTA 4GBUA 3MV11 4JNMA 5HPOA 2ACUA 1FCQA 3U9IA 5CG7A 3WMCA 3UZXA 3V5CA 1MSSA 3RU8X 4BF7A 2ZZ3A 3CHEA 1XCFA 2ZXDA 4U3AA 3ZSTA 1KFEA 3P0XA 4ZMGA 1U1JA 4TVDA 3G1DA 5LNVA 2NV1A 1V3IA 4WY0F 2NZLA 1AJZA 4PGLA 1W5PA 1QWKA 3GW3A 1EUAA 1P7TA 2VENA 2WCGA 2V38A 4G1NA 3WELA 4PODA 3C6CA 1KKOA 3RUBL 1B90A 4EXQA 4X9YA 1PKNA 1M68A 4GI4A 2PDLA 4BQ4A 2D69A 4DXVA 3W1RA 3IK4A 1PS9A 4Z1YA 1KO0A 1E6XM 4AG0A 1KM0A 1K9FA 4HN4A 4LB4A 4GMEA 5E9AA 4ATLA 3W1PA 3KCLA 3EOEA 2WC7A 4I9AA 4GUFA 4XZWA 1J11A 4YXGA 3ZJ8A 3B97A 1DVJA 2V67A 4XG1A 4H2HA 2HXTA 2PDUA 2ZWZA 3SY5A 3EA2A 2F8QA 1QBBA 4LUTB 4A8IA 1MZHA 3GFZA 1IE7C 2BX7A 3DKJA 5IFTA 4GGBA 1E40A 2E6YA 5H2ZA 3BK0A 7ENLA 1FWDC 1IWBA 4AH7A 2ZUVA 1E9IA 4QROA 1EJWC 3GNPA 5A2AA 3VFLA 1E71M 1SJBA 1V3JA 5CJNA 4TV6A 3GDBA 4AD4A 3O1NA 3NL3A 4HNVA 2FGLA 1PIIA 1QPNA 3II1A 3R6IA 2C16A 4ERGA 2HVOA 4JX4A 4G2DA 4NYUA 3JS3A 3VIPA 3LRLA 4JIPA 2E1DA 1PL9A 1QNRA 2VEGA 4RNHA 4D6DA 2WMFA 2XVGA 4FR1A 1H7PA 3EWYA 3DKLA 3K4AA 4J2MA 3W07A 1WAUA 3IEBA 4NILA 2QCFA 2IQ0A 1CXHA 1MZRA 2BHYA 1MRAA 1XIIA 3ORWA 3HGSA 4MLJA 1GVEA 2Y63A 1LBMA 3M64A 3VIJA 4MM1A 3HQOA 4NNBA 3I4EA 1DOSA 2V69A 4LW7A 3H6OA 2QJIA 3HG2A 4Y90A 4ASTA 3DC0A 4Z1DA 4PB4A 2WZMA 3BLPX 1W9DM 1G1YA 3LV5A 3EDDA 1XD1A 3TXZA 1T5AA 2ZXBA 3HG4A 1Q6CA 4FIQA 2YCIX 4EE9A 1XF0A 3P2VA 4C65A 3AALA 3G1FA 4DF2A 1L9WA 1I9CB 4AUBA 3QFWA 1LL6A 2H8ZA 5AHNA 1W5QA 1RVKA 1HP5A 1WBJA 1YYAA 1X1OA 1FA2A 4PB3A 4HU4A 1UQYA 2VGGA 2XUCA 4H9YA 4ADUA 1I0DA 3R11A 5CZSA 3SQLA 4OT7A 4R3UA 3OP2A 2CETA 2A3AA 1ALDA 1H60A 6ALDA 3WLKX 5IBXC 1XR2A 1BWKA 4N9BA 5AYYA 3ZR4A 3FS2A 3GG0A 4IH3A 3H26A 1F6KA 1A50A 5IRPA 2YW4A 2IKHA 1M1BA 4MNMA 4Q8NA 5D2YA 7TIMA 4GXMA 1R2SA 4GFSA 2NXGA 4KGLA 2Y7GA 5G2WA 4QITA 3W00A 5IDZA 1EC9A 2CLHA 3VD9A 1TKKA 4PC8A 4JTDA 5FJTA 3URAA 3W1TA 2ZDSA 2F61A 1ITCA 4DUXA 1IIHA 3HFYA 1UZHA 4BI7A 5FCZA 4UQDA 6XIAA 3O6DA 3VC6A 2YYUA 2RH9A 1HL2A 1B3VA 4M0XA 2L5HA 4O8AA 1F3EA 1TVLA 3EMZA 1TPWA 4O17A 1TJ0A 5HJYA 1DIDA 3TNBA 1SZNA 3GVQA 2CLMA 4UTKA 4HNCA 3PZMA 4F2UA 1BSIA 3W7EA 2ZVRA 5F1VA 3W7RA 2JEQA 2FTYA 3RR4A 1VIWA 3EWDA 3KP0A 4UQ9A 5CC7A 3V5OA 4H6RA 1J6OA 5DRIA 1NOFA 3XIMA 4CU6A 3G3MA 2QCCA 5FEZA 4HBKA 1F9CA 3G1YA 3ARVA 3B03A 3DFTA 4JNZA 5BU6A 3OGRA 1WXYA 2B0MA 3TTQA 2WZIA 1QNQA 3PSVA 5G1MA 5KZDA 4KFOA 4W85A 4ORIA 3TXVA 1AZ1A 1TR1A 2XFWA 4L9ZA 3W37A 2A5HA 2ZUWA 3I68A 1RPKA 3S9YA 5D32A 3W7LA 1H1NA 3W2KA 1UBPC 3N6QA 1FBAA 1F3WA 1M7JA 3PHAA 1IEQA 3LCHA 3VM7A 2NWRA 1ZBCA 1XYMA 1NAL1 4KWVA 3CK5A 2H9AA 3IGUA 1GKRA 4J28A 4B9YA 4J9JA 4GYJA 2E9LA 1KFLA 4WKFA 4BQ5A 1DJGA 5U4NA 1WB0A 3G6LA 4F0KA 2DW6A 1WX0A 3C3NA 3BSHA 2X7VA 3SCVA 4FLRA 4BHYA 4LBRA 5FOOA 1R7AA 1O95A 3KOYA 1TPC1 3SGUA 4HT3A 3G1RA 4FI4A 3FLUA 4JL1A 2J8FA 3LV6A 3DI0A 1J4EA 2WSPA 1QI5A 4S3EA 2Y62A 1GYMA 3T8QA 2VOTA 2PDBA 3DECA 3DXIA 1MW0A 3BMWA 5D09A 5A2CA 4AISA 3WD1A 4I7VA 1JPMA 3EKGA 4NVTA 3A23A 3W1QA 1XUUA 1SFTA 4Z0JA 2VQTA 3FA5A 1CPUA 3NPXA 4DLMA 3DUGA 3FFSA 3HTWA 3VO0A 2H90A 4REQB 3CLMA 1JZ2A 3P61A 2XU2A 4AXNA 1OC6A 3S2NA 1CCWB 4MKNA 2WSYA 4K38A 1BVWA 3SB0A 3AS0A 1TV3A 2CHRA 1YQ2A 5A1AA 2OU4A 4IGMA 1JIBA 5FF7A 1X7FA 1YDYA 3DH7A 1ISZA 1OX4B 5I3JA 1O66A 3GNNA 1V3LA 3DHUA 1KV8A 3ONCA 4L9XA 2ALDA 5C71A 2BGNE 4AZCB 1HUVA 4EK7A 1W9PA 1UPPA 2ZQ0A 3WQGA 2P3EA 1QAPA 3EYPA 1K8ZA 5AYXA 1VJZA 3PC0A 3TW9A 2WO5A 2ICSA 3LCWA 3VKKA 1X1NA 1I4NA 5JQ9A 2BP1A 8XIAA 4PA8A 1G4SA 2CHNA 5AC8A 2MNRA 1XH1A 4WGHA 2Y7FA 2XVLA 4JIQA 5BRQA 1RA0A 5M2FX 4S39A 4A3RA 3NSMA 1TIWA 4ZO7A 4E4UA 4EWJA 4NZ5A 1SGJA 2WVTA 3VZYA 4F8XA 4JTSA 4B5UA 4XISA 1RP9A 4PFHA 1XGDA 1JFXA 4I6KA 4JTIA 4HK6A 4GX9A 3VVGA 3UU0A 4U5KA 1H5YA 4ZQOA 1KXHA 3UG8A 4JFWA 3LMZA 2O9PA 1RZMA 4REQA 4MY9A 5FD0A 2O9TA 3D47A 3PBGA 4LBSA 4X2RA 1UB3A 3LI1A 2OGJA 3V16A 2PU1A 4OIFA 1UUOA 3SEPA 3G0XA 3W1UA 3VIHA 1WBHA 2R1KA 3EDEA 3WK2A 3PZQA 4G5DA 2W61A 3N2BA 2FH8A 1W5OA 1YBQA 1JZ7A 2OSWA 1DQUA 3ES7A 1DWJM 1JUBA 3K30A 4CD7A 4UFJA 3A9BA 1XIJA 4LS0A 3BZGA 1NWSA 4Q8TA 4AZ5A 5EB8A 1UW9A 4RZBA 3TU9A 2CU0A 2OKTA 1KTBA 1R3WA 1O5QA 1S2WA 4GRSA 1VPQA 4MUZA 3ZYZA 4YS1A 3UA3A 1IF2A 3W7IA 3ITLA 4DRSA 1DQXA 3HPSA 1VPXA 2HK1A 3STCA 3G3DA 3A5VA 2J9ZA 4JN7A 2WXDM 3H2EA 4D6JA 3CH0A 4PUDA 3EAUA 1GVYA 3TZNA 1HJQA 4Y96A 1XW8A 3GG8A 3SRKA 4GY1A 4DXKA 3I6TA 4YWIA 4DWSC 5HINA 5DY2A 3AAMA 2A85A 3AC0A 5D2XA 1EO7A 4FAMA 4AB4A 4PUNA 2CW6A 2PP0A 1X6UA 4M1RA 3VPLA 4RZ6A 1W2PA 2XWEA 4JTAA 4OECA 3N17A 1IEXA 3HPFA 1CW2A 3IPWA 2PWFA 2XH2A 3RX2A 4E4FA 3QZAA 1G4PA 3BW4A 1TA3B 4H9ZA 1ITQA 2PCQA 2FVKA 1PV8A 3O3RA 4OUEA 2QHAA 5I5RA 3D5HA 1KM1A 4PMJA 5FEXA 3ENLA 3BV4A 2H3DA 1QPKA 3VD4A 3VFCA 3IGSA 4LYQA 4GJIA 3RM9A 1YPIA 3VMPA 3PSWA 3IJLA 1IZKA 1K4GA 1OFBA 2P0IA 4RUBA 1VEMA 3W82A 3QBUA 4O54A 1W54A 2A0NA 3E0VA 5TAOA 1OFOA 2VRKA 1WDRA 4BI6A 4L64A 3O63A 1EF2A 1RQBA 3UYCA 1OCNA 1W3IA 1J6PA 2W62A 2XSXA 3EX3A 1HKIA 3UY8A 4UBPC 1A5OC 2WWCA 3F5JA 2Z28A 4FXSA 2P10A 1RVGA 3ZMRA 1XIHA 3W7OA 1BKHA 2NUWA 3VIMA 4PMVA 3C61A 1US2A 3ARSA 1NY1A 3OODA 1ZB5A 1IZCA 4WDUA 1GVRA 4HMEA 5FJOA 3TOPA 4NXSA 3GO2A 2YZ5A 2C7FA 2WMKA 1NP2A 4K1WA 1VLIA 1E5JA 2J77A 4HSHA 4HD5A 2BY0A 1EJVC 1XLEA 3OLEA 3RO6A 6ENLA 1Z8AA 1QFEA 3CL6A 4J3TA 1K8XA 4ATWA 3PWAA 1HL9A 3M43A 4IUGA 3RCMA 2PRLA 2PUZA 4CVUA 3SUVA 1UH4A 3GIPA 2I57A 2C1GA 4KF1A 3AIWA 4HOZA 3RYSA 2BBFA 4PTWA 3POCA 3WNOA 3PJTA 3L12A 1KM2A 2Y4SA 2JF7A 1XYLA 3SJ3A 2OEMA 4L6DA 1ADOA 2NXHA 2ON3A 5HR6A 5DLCA 3NXLA 1VFSA 3TTEA 4UNKA 3W0KA 1ISXA 4IOTA 2ATSA 2GLKA 3CNYA 1SJAA 4XZ9A 2HZGA 5LNWA 4B5XA 4FXFA 1K8CA 3PZNA 1DJHA 1OFQA 4C6NA 2OLSA 1LOLA 5JBDA 4US5D 4QFUA 4N4PA 1LRNA 5CC5A 4LYKA 3TUUA 1VFTA 1E3XA 5M3WA 3N18A 4BI5A 1A53A 4JKLA 1UJPA 2DZSA 1KFBA 2FTWA 1EJRC 1JPDX 3GU9A 3BG3A 1PZ0A 2PDWA 2VDGA 1UPMB 2V3FA 2IKGA 1SO3A 2OZ8A 4C6DA 3M0VA 3QMTA 3W3OA 2ZE0A 4XUGA 1XHGA 3NQ8A 2QCDA 2C0HA 3B4YA 2BVTA 4N42A 5GJNA 2VFFA 4RCXA 4CNNA 4QXIA 2G97A 2VVSA 1KB3A 3N6HA 1QO5A 1X6NA 1QU4A 1E15A 3R58A 2IQDA 3EA1A 3BSGA 1RQHA 1YDVA 1E4NA 4C5ZA 4MLRA 3BAWA 4X61A 3SRDA 3KX6A 3AROA 3K1GA 2HEJA 3LMYA 3TNOA 1DJNA 5C6MA 4GJJA 4O13A 1K3UA 1HW6A 2BVWA 2DT1A 2GL5A 1EJUC 3KP1A 3HGRA 1OCQA 3W1NA 1P6WA 3AYRA 3QOKA 3IIZA 3W1LA 1FCUA 1Q5MA 3EWUA 4GIEA 3N14A 4O1DA 1GUVA 3W7MA 2WBGA 4CNSA 2HVMA 3QV9A 1TX2A 3CAKA 1PDYA 3AYSA 5CGTA 2QQ6A 2J9YA 3KW3A 3BLDA 3LU2A 4INFA 1Q8AA 3WQCA 5AVNA 3WH7A 4U10A 3S1VA 1FXQA 3GZAA 1CGYA 2WCSA 2YXOA 3QQ1A 4M5PA 5DX7A 1VCVA 5DT5A 1F61A 2PTDA 4LB3A 2QUNA 3WQPA 3N2XA 3A24A 3VA8A 3L68A 5EY5A 1UR1A 3WMLA 1W1YA 3AMLA 3QSRA 1IXNA 1HP4A 3N4AA 3FX4A 4UTIA 4ZTYA 4GFIA 1O1HA 2B4GA 3F2DA 2BXYA 2FPYA 3PBUA 4E3VA 3CUJA 4RDZA 1YTEA 1H7WA 2RGMA 4DEFA 1PUDA 3L2LA 3A6OA 4P7QA 3T2QA 1S2UA 1Q7ZA 2C3ZA 2VUNA 3R25A 1TZ7A 1SFSA 1R30A 4NJKA 5A6AA 1HIZA 4MF4A 1P0NA 3LXCA 4MMWA 1E51A 2P5NA 1NARA 4JL2A 1UMLA 4AIEA 1E0XA 4O57A 2DSKA 1QI3A 3RILA 4WSHA 4XKMA 4XAFA 4ERIA 1XPGA 2O4MA 1OYCA 3NYDA 1QNOA 2QLYA 2V82A 4GJ1A 1Z7AA 1WKYA 1XLBA 4RDWA 1DIKA 3SCRA 3ANVA 1MNSA 2GWNA 4H1ZA 4WJ8A 5CQ1A 5LXEA 3M5VA 5CSYA 3VC5A 4YN5A 1RCXB 3CPRA 1J10A 4NZ1A 1HFBA 4LGXA 2DT3A 4LJ3A 3ZVIA 4LAUA 5C2CA 2DIJA 3SCTA 2ZADA 3GTHA 5C7HA 4R7OA 1GEHA 2JFEX 2GK1B 3UXKA 4F79A 1E4LA 1N8FA 4UZSA 4BWLA 1UWAA 1M01A 4Q4SA 3R0KA 1XSKA 3SQSA 3CAWA 2A1YA 1OJXA 2OKOA 2BNJA 1S1RA 3ZLFA 4A29A 4L4LA 3M0IA 4Y8FA 2PWHA 2VCBA 2Y6ZA 4JKMA 3DIPA 5EMYA 2CIPA 1RJRA 4D6CA 1W91A 1SR0A 2OGYA 2ESCA 3BAKA 4D6GA 4AVNA 3PBWA 5DXXA 2A4AA 4DXXA 2B7PA 2D2OA 2W6RA 2A3EA 4Q3MA 2C1IA 1NF0A 1ICSA 3T0DA 4L7ZA 3BMVA 1RBAA 1K70A 5KEZA 2WPGA 2VC6A 1PX3A 3C0JA 1VBJA 4AZBA 1OK6A 2OCZA 2I14A 3VGHA 3U8GA 1J2WA 3WDHA 3L7RA 4P7OA 1OFDA 1C91A 3JVAA 2J6VA 1E0VA 5A8NA 3LYEA 5CG0A 4EF9A 1YDOA 5DN1A 4IQJA 2OZ0A 4C6IA 3N1AA 2C0AA 4Z2IA 2G41A 4J5NA 1SFJA 3ZO9A 1XIFA 4RV8A 3XINA 4CNPA 3MYOA 2XSAA 5GNZA 3VGDA 4ZOBA 2WHLA 2YR1A 2GSHA 3PK7A 2X2GA 2PDPA 3OZPA 4IMEA 1AG1O 1V77A 1OC7A 4GO8A 2J9XA 3MSGA 4JQ3A 1CEOA 1W6TA 3M5YA 5BROA 4KT2A 2EPHA 3ZWSA 5I23A 3WF3A 2VL4A 5LYRA 1TWIA 4LOCA 3UPBA 4LRSA 3WD0A 1SZGA 1EPVA 4A2RA 2VFDA 3TA6A 2DSUA 2FHCA 1OT1A 2ODOA 1HJUA 3DEQA 3M0XA 2FJKA 2PRHA 4HP5A 4PBGA 4IT1A 5AY7A 3AU2A 3LTYA 3BAIA 5REQB 1UMYA 3HA1A 2ZUUA 2F38A 1FWEC 2TYSA 2RUSA 1QI0A 7ODCA 4GCXA 3E49A 4JOMA 4IXXA 3VILA 2ZUSA 1TUXA 4DJFA 4C6LA 3HF3A 1EIXA 1Z6KA 4S3BA 1L6GA 5JH1A 4C6FA 1J5TA 1AW5A 1V0MA 4NZCA 5C2XA 3KL0A 5JIWA 1EB3A 4M3PA 2DUAA 1JZ5A 2W67A 3EWWA 4QHRA 1OFEA 5AC6A 1LLOA 4TU1A 3BQ5A 4F2BA 1IT8A 4O16A 1WP6A 2QJMA 1MQQA 2B7NA 1TZ9A 2O9RA 4FLSA 4WY0B 1HGYA 2NV9A 4UFHA 1XIBA 4IISA 3DBPA 3G77A 4KEMA 3SIZA 1W17A 4ACZA 1FTXA 1GVQA 3NGJA 5HR7A 4KQNA 3GTXA 3U5UA 4MUPA 4XWUA 3ABZA 4H6QA 1GG1A 3OVPA 1RY0A 4JN6A 3RK8A 4LCRA 2CZVA 1HG3A 1V03A 1DKWA 1MXDA 4E2BA 4TMBA 3LA4A 3VNLA 5G4HC 3H7VA 4AF0B 1QI4A 3KS5A 4AWEA 4PZVA 4KCTA 1DL3A 3NCOA 3T0BA 3M4HA 3CL8A 5EKYA 4LX4A 4LY4A 2IXUA 4JHMA 4B5WA 2NVCA 3IIVA 3IAPA 1V93A 3EMCA 4KWWA 4DUWA 2XSBA 5D03A 2ZIDA 3L4VA 3APYA 2WJEA 3WL1A 1Y65A 4R53A 3W86A 3B9OA 1Y5WA 3AMCA 3PZVA 2VRQA 4AD2A 1E1CA 1NM9A 1G7UA 1XLLA 1KRAC 3TCSA 2HPIA 4CGTA 1XLFA 4JAWA 2YCKX 2G3NA 3A5FA 1WYIA 3ITYA 5HWMA 3MHGA 1Z44A 1DJWA 1FCVA 3BGGA 4XZMX 3N3TA 1X98A 4IF2A 4JCMA 4S1FA 4GVGA 2NQJA 2PF0A 1VLWA 5A8GA 1C8VA 1JF6A 2ZUNA 1HVQA 4RE3A 1XINA 1NEYA 3CB8A 5IM51 1CXEA 4H6KA 2DZXA 3JW7A 2J4GA 1L2UA 3BOLA 4W9TA 3QVQA 5K9XA 4R85A 3MPGA 3DOPA 2GK1A 3GDLA 2R24A 1ONXA 2BV9A 1XFCA 3QF0A 2C14A 3GYEA 3LHTA 2HQAA 2OT0A 1JCNA 3UR8A 2VR2A 2VEPA 3POHA 1SZEA 3AUJA 3NVDA 1NWTA 4H9UA 1PX8A 2C1HA 2INZA 3LLDA 1JPHA 1S3TC 2QPXA 1H2JA 4ZXOA 3N34A 5LIUX 4NY2A 1V4YA 3AS1A 1I8JA 4NAEA 4Z2KA 4WDXA 1X8FA 2E1WA 1F73A 3DDMA 2RDXA 4E2OA 3ME3A 2EG7A 5TIMA 2VCCA 2VOMA 2X30A 1MVYA 2XM2A 2YB1A 4BWLC 5HPCA 1N8WA 3IUHA 4UTJA 1L8PA 3KVJA 2ZUMA 5CPSA 4YU1A 2BY3A 1TPUA 3GBDA 1W1A1 5CH9A 3K5XA 2YPIA 4PYSA 3L9CA 1KBIA 1QOXA 3ALGA 3TYCA 1A5SA 2A3LA 4JTGA 1HL8A 5CZKA 4W84A 1O7AA 3B0UX 4JDYA 3GVWA 5DCBA 1VP5A 5AC5A 1FWBC 2QR6A 2QAPA 4JTTA 3FOKA 1LLZA 1EGMA 2G95A 3LENA 3P93A 1AVAA 4I5XA 3LBCA 3UT0A 5LKYA 3DFYA 3JR2A 4L4OA 4Z1CA 3B9EA 3KUMA 3UWEA 1CI1A 2HV5A 3O15A 5CGMA 4H8NA 3W2JA 1ECEA 3NPWA 2VFIA 1BAGA 1FQ0A 3K8LA 2YZRA 1OZQA 2FZDA 5MF5A 5BMWA 3BG5A 1R86A 1VC4A 4O4VA 4HNTA 3UZ5A 2V63A 1XH2A 4QX4A 1MYRA 3CV1A 1Q6RA 2A7PA 2EAWA 2ZRXA 3B04A 3GC2A 2ZA1A 1UZ4A 3KS6A 3LPFA 4XD6A 4D8ZA 2YA1A 1PIGA 1RK6A 4XSMA 3U48A 2VEKA 5HOSA 5H8MA 4C6QA 3UQNA 3OVQA 4WKAA 2PDIA 1UKOA 4PCPA 3DYPA 3QQWA 5AKQA 3A3XA 3N9RA 3B8VA 2R82A 1JQXA 3EWZA 5HMDA 3SCPA 1FDYA 4KERA 3R94A 2I5QA 4F40A 4E8CA 1XLGA 1B3WA 4LRTA 3O6YX 4OFCA 3QTPA 1MO0A 4Z08A 3BANA 5HXMA 1JEZA 3EDFA 1JI2A 5CXPA 3E5BA 3L4YA 3IJQA 3U57A 4AXKA 3LQGA 1K03A 3S2JA 1K77A 4K3ZA 1KA9F 3HU7A 5BW6A 4DO4A 1MWOA 1YPFA 1PZ2A 1KQYA 3GXIA 3MO4A 1SJCA 1ME8A 1V3KA 3CB3A 3MVTA 2Q09A 3UZZA 5C55A 4WDWA 4DAFA 1OG0A 1Z3NA 1MI3A 3CHDA 5BZAA 1UR9A 3QZEA 3VIKA 5CZTA 4NYYA 3QFEA 3BLKA 3ZLHA 2D22A 2WVVA 1BSLA 3PZOA 2R91A 2A6LA 3AIRA 4HJWA 3TONA 4AVOA 2QUVA 1DTNA 3CU2A 2DUZA 4RNFA 5MHBA 3PR2A 5A8QA 1THFD 4GYPA 1J0ZA 2QPUA 4RNJA 1JF5A 2BWGA 3PNUA 5G2HA 5E0FA 3N2TA 3K1DA 2DZPA 5A6TC 3LCIA 3S3GA 3QPYA 5BXSA 4TX8A 5LXXA 3OA5A 3T05A 3TC6A 2Q71A 4L9YA 4HPNA 5E70A 3QM3A 4CEXC 1SW7A 3QPZA 3NPVA 1C8YA 2ZXAA 1XGEA 3C3UA 4KH2A 1A0CA 2FFCA 5KSWA 3T4CA 3LQLA 3GTNA 4UOZA 1NFBA 2E4TA 4C6OA 4CNTA 3T0TA 4IZGA 2HTMA 4H9TA 4JY8A 2ZX7A 4YLWA 1IV8A 1KRMA 2WMIA 2VYOA 5G1TA 2QT3A 3C4UA 3CEUA 1KFKA 2INFA 3G0UA 2PBOA 4EKJA 1EDQA 3H23A 4LC6A 4H7ZA 2PWGA 3LTSA 4OHQA 2Z27A 3ES8A 5FI8A 1V08A 2RDUA 3QXBA 1S1PA 2P53A 3FA4A 1MQRA 4PRRA 4CKQA 3W2UA 2G96A 3GB6A 3QGVA 4HYVA 4IIFA 4HPGA 5D30A 1HJSA 2VP8A 3IJ7A 3CUFA 3S2CA 1EGZA 3V1HA 4MB1A 1J12A 1SM9A 1W9XA 1XBYA 2V2DA 1EX1A 2O7SA 3PS7A 3T42A 1DV7A 1PX4A 1E0TA 4ERAA 1AZ2A 4BFAA 3EMQA 4ICMA 1X7IA 3TJLA 4NAFB 1UD5A 2VI0A 4QEHA 2V0TA 2VNCA 1ME7A 2YX0A 3VKDA 4Q7NA 3SJNA 2BSLA 4GQBA 3GHUA 1V02A 4JNYA 3MZ2A 2X0SA 1TVPA 2OFJA 1GONA 1SO4A 4FXJA 1SO5A 4PL2A 5GPRA 1UBSA 4MKVA 4OV9A 3W70A 1BVNP 1JCXA 1J0YA 1TPDA 1YRRA 5G5IA 4ZODA 1R3SA 3RM8A 3WZ0E 2YLLA 4HU3A 5HK4A 4CD8A 2OR2A 2G0WA 1XG3A 4A22A 3R5EA 1R9XA 5AYIA 3NQVA 1EJXC 4DZIA 1UD6A 1VFFA 2PZNA 3M7WA 1JRCA 2NQ9A 4WGXA 4M7SA 1SVDA 2JIWA 3QC0A 3BGJA 1ZBVA 3BZJA 4I7WA 2EGZA 2E6AA 3ZR6A 1TV5A 3AHYA 2PS2A 3CQ0A 1A5UA 3BCJA 1O1ZA 3KCJA 3KBJA 4QNWA 3UJSA 4IFRA 1AUSL 3CUHA 3SIMA 3R7MA 1ONEA 4IPLA 4UTTC 3SRHA 1LWJA 1KGUA 2CBVA 5FL0A 3W71A 1LOQA 3LRMA 4AD3A 1Q45A 3GRIA 3RX3A 3A4JA 3M0HA 1XH0A 1S3HA 2BY1A 2V5BA 4EWND 5HA7A 3NIYA 1S2CA 3NA8A 4HB7A 1IYXA 4A05A 1EJ7L 4IMDA 5F2MA 1KRCC 1DWGM 1F3TA 4WSKA 4CN4A 3THQA 2GSJA 3TV8A 4JY9A 2DFAA 4Q8VA 4IPJA 1X1ZA 2G37A 2I5GA 5FAGA 3MMWA 3DFHA 4PCNA 2CNCA 1SMAA 3WLLA 1KD0A 3KOWA 4NI8A 3O0KA 1GHSA 4AC1X 1RV8A 3V3WA 4H04A 4CQAA 3NWRA 4ZEPA 1WPCA 3V36A 5A8PA 3W6LA 4AZHA 5DCEA 3EPOA 2VQUA 4XZLX 1TSIA 1GVFA 2OSYA 1H1ZA 3AXHA 2DZUA 4MAZA 2V5LA 3N9SA 3WQWA 3C5QA 2Y8KA 4D1IA 1GG0A 2DGAA 4JTQA 1FWHC 3CYJA 2WANA 3QV6A 4NX5A 1EP1A 2UY4A 4AYSA 3UEQA 5LGZA 3M44A 1D9EA 4LVAA 3CV2A 3KLKA 2ZZ2A 1E0UA 1E6QM 1MFVA 4GISA 4YPJA 4WSJA 1XLCA 2XM1A 1XLHA 4J1OA 1HO4A 3D6NA 4O50A 3VINA 1GOKA 3C52A 4HKPA 2J79A 3KBWA 2WAGA 4GVHA 2NUXA 1LQ2A 3NAVA 2W27A 1OYAA 3UNDA 1YE4A 1V6YA 1F76A 1UHVA 3PG8A 1EUNA 1KCXA 3PBYA 1CXIA 1O5KA 2YXXA 1ITUA 4O14A 5LA1A 3EA3A 3UBPC 2AQWA 4IPIA 1XQKA 1QNPA 3VNMA 5DF0A 2RFGA 1Q8JA 5LNRA 5HDRA 1VJSA 3BOFA 1C93A 1F4AA 3UR7A 4HCDA 3A22A 3H2OA 4R7WA 3TYEA 2D73A 1NU5A 3AIBA 3GAKA 3SCOA 4G6CA 3M0YA 4LAZA 1FH8A 1V6VA 1PBGA 2Z7KA 4XBKA 3F5LA 3CHVA 4XUYA 3N4FA 3F03K 3BWWA 3VDGA 3T81A 4XB3A 2WKLA 3E0WA 5MKGA 1KWGA 4O1FA 1AMYA 3H2MA 1GWJA 3T0CA 1EC7A 1TPH1 3AMDA 3TSDA 4K7YA 1UP2A 4H19A 5EU9A 1E6ZA 5XIMA 2ZTJA 1H7OA 3CUZA 5D2WA 3OPSA 4R7JA 2E3ZA 4IIBA 1EJSC 2J66A 2XZ9A 3RITA 5EMKA 2YIHA 5EMMA 1TVNA 2W66A 1GTHA 3AIEA 1DP0A 4K8GA 1V0KA 3U6WA 1SSDA 3DI1A 3K13A 4R33A 3PZUA 1I45A 1NTHA 3UPMA 4C1NB 3WLRA 3CO8A 1W3TA 4QJ4B 5A6BA 3ISIX 2I56A 1MMFA 3WF0A 4QLKA 1W37A 3KTSA 3FAXA 1KGWA 2PGFA 4LU0A 4DJDC 3V0SA 3CUIA 5CPMA 4AD5A 5ECVA 3BE7A 4NRSA 5LA2A 3ITVA 3LK6A 3WO8A 1UH2A 1Q85A 4UNIA 1OT2A 5HANA 1HKJA 4YTRA 1P6CA 1LORA 1JYVA 3A4WA 2Z2AA 2H9AB 3AYTA 2XIMA 4B15A 4EANA 1J0IA 3TJIA 5KTLA 4G8TA 1LQ0A 1ZLPA 1FKWA 1R8LA 1UASA 4LTSA 2VX7A 1TUFA 2Y89A 4H7CA 1BLIA 3KVLA 5CLTA 1M04A 3KVMA 3NQ7A 4K7VA 2G8ZA 3QKEA 2DT2A 1FRBA 2YYTA 2ZX8A 3MCNA 1FWRA 1TPVA 2Z7GA 4NIRA 1OGBA 1WXZA 4B4HA 1CWYA 4JTEA 4GY0A 1W3KA 3RLVA 4YVPA 1FWGC 2X40A 2HE8A 3A3WA 4ZL1A 5A6BD 3C2EA 4GVIA 3M1ZA 4FMVA 3G18A 5SWUA 4XK2A 3HMJG 3G22A 3MKKA 3P7YA 1GW1A 4N0RA 3B06A 3BXWA 4RKAA 4BZYA 1NQ6A 3S6OA 1Y0EA 2G3IA 3TYDA 3F4WA 4QQUA 1QVBA 4L1XA 3WENA 2IUZA 2QCGA 5A6KA 3I65A 1P43A 1TYGA 4LVBA 2DUXA 3F2BA 3HGOA 2QF8A 1ZJIA 1QBAA 3WEOA 1JCTA 3HB9A 4ZQCA 3UXDA 1C8QA 2IKIA 2E6FA 2G3MA 2PF8A 1V7YA 4JX5A 3QTGA 1E6PA 1K1DA 4M6VA 4DUVA 1TO3A 2O7QA 2HK0A 5J5RA 3SUWA 2DZAA 2PLMA 2PAJA 3BOXA 3EGJA 4JIRA 3ZJKA 1PXGA 3TTSA 4PTVA 4ZQPA 3S2MA 3AU6A 3NSNA 1JUEA 2VEIA 3N13A 1XRFA 2D0HA 1AL7A 5DANA 4MGGA 2XZ7A 3CBWA 3LCXA 4CCEA 4BKNA 4Q6JA 4LS1A 4C5YA 4HHMA 3T07A 4UTHA 3FSUA 4KCVA 4MKSA 2UWFA 1IEIA 2EPLX 1EYEA 1GYLA 2DZWA 3UG4A 5C0QA 1JDCA 1KM3A 3SFKA 4QTGA 3LD5A 4CCCA 2VGBA 1K9EA 1HNYA 3M7SA 1WQ5A 5LIWX 4GQGA 5FJJA 5DEZA 3LXAA 3WD2A 3TFXA 7XIMA 3WH6A 3KRZA 1G4EA 2PTYA 2EKGA 3L65A 2KX9A 4BCEA 3BC9A 1E6NA 4DQWA 3TFCA 3DG7A 3W2NA 3AJ7A 4ZR8A