2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
molecule tags Oxidoreductase
source organism Lactococcus lactis
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
4O8RA 1CX9A 4LY8A 5I3JA 3QW3A 5CG7A 2R91A 3LTPA 3TFCA 1KFJA 1DORA 5K2ZA 2C18A 3KHJA 3SIZA 3OVPA 1ZJIA 1XUZA 3GLCA 3E02A 3M5VA 3LX9A 2P10A 5AHLA 5C2XA 1YDNA 4NT0A 3THQA 5C54A 3P84A 1J5TA 1Z48A 3DH7A 2A21A 5HWMA 3W71A 4O13A 4I9AA 3DI0A 1O5XA 1VQTA 3IEBA 3O15A 1KFBA 1B4EA 1IXOA 3TXVA 1LTDA 4ONVA 4YXGA 4WY0A 1GZGA 2FPVA 3ZWSA 1WBHA 1QWGA 4ZQRA 1TRDA 5D2TA 3L5AA 2X1TA 1TPH1 3GDRA 4IUOA 1XI3A 2A2IA 1ZCOA 3WK2A 4ML9A 4Z0SA 3S5OA 3W84A 3QJAA 4DO6A 4XBSA 3BGGA 3WJWA 2QF7A 1UCWA 3PG9A 3JR2A 3PBVA 5MHBA 1TTIA 4O4VA 5HMSA 3GDLA 4GUJA 3B0PA 3G1SA 4O1DA 3BLFA 4R34A 3W7NA 2C0AA 2QUUA 4GJ1A 3KRUA 3FEMA 3VE7A 5F1UA 1KM6A 4O50A 4XWUA 4P2VA 1LDCA 5C6MA 3HJZA 3TMQA 4FF7A 4UTTA 5F1VA 1XFBA 1O4UA 2O7QA 1G7VA 3MP4A 3HG2A 1OYBA 1VLWA 2H8ZA 4CNPA 4LWWA 4O16A 3W7JA 1RR2A 4AMAA 4MJZA 2CLFA 3O8AA 4HKPA 1JCJA 2YYTA 2QUTA 3NQ8A 4E2BA 1XC4A 3NG3A 4NJIA 1SW0A 1LOLA 3SECA 3TQVA 4O54A 1YDVA 3GR7A 4UUIA 4JEQA 3SGUA 1Q6QA 5U7SA 2A0NA 4IPIA 2YX0A 5K9XA 3W2UA 3EXRA 3DFPA 3W88A 1NF0A 5KZMA 3CQ0A 2VEIA 3UWVA 3HIJA 4MY8A 4IGHA 3NDOA 3FIGA 2W0UA 3QW4B 3U8GA 1B57A 2C3ZA 4O15A 3GKFA 3L2IA 1TJRA 1ICSA 2AGKA 4AAJA 3DFQA 3P74A 3FA5A 3IVSA 1F73A 1T8XA 3B04A 3T78A 2C15A 4DO4A 3G1YA 3VNDA 4EVZA 3NQCA 4K39A 3LERA 3CTLA 3STCA 1OFPA 2YR1A 3M6YA 3LXAA 4JYDA 2Z6IA 4O17A 2CFFA 3G1VA 4O0KA 1V7YA 3S1UA 1XDMA 1GVRA 2B7OA 2BX7A 5G4WA 3UWYA 1KFKA 3G1FA 4O28A 1E51A 2FQIA 3LB0A 1OFOA 2NXHA 3TC7A 1EX5A 4JTTA 5DCBA 1QMLA 4OT7A 2ALDA 4ALDA 1FDYA 1G67A 4XTDA 1GOXA 1AW1A 5L9FA 4UR8A 5DXXA 1SZNA 1WX0A 1LLWA 5I3GA 5LZLA 2FPTA 4E2DA 2VFGA 3KVLA 3S1XA 5AYZA 5KZEA 2X2GA 5G1TA 1PHWA 4O14A 1UUOA 4OGZA 1TV7A 5DBUA 2A4AA 2BLEA 1SU5A 1QDSA 3A5VA 3T40A 2ZDRA 4RXFA 1YTKA 4QM1A 4A22A 4LV4A 5LSMA 3ABQA 5FF3A 3F4NA 2ZYFA 5F2LA 3HBLA 3E9AA 3W7EA 2RDTA 5AFDA 8TIMA 3C3NA 1YXYA 2HS8A 1WXJA 1OF8A 4PTNA 3A22A 2VELA 2BZNA 1T0OA 3SJ3A 3GXTA 1VCFA 3C2RA 3G22A 4FNQA 1A53A 4JD4A 4NVTA 3BO9A 3LBMA 4IXHA 5LHEA 4O18A 1QPOA 3TK7A 1QFEA 2V9DA 1QO5A 4GUFA 3G0XA 2JKAA 4Z1DA 3B0UX 4UTJA 2XN0A 2RFGA 3LRLA 4Z0JA 4ZZ9A 3L5LA 4YL2A 1K03A 2J88A 3H54A 4M6PA 3QFEA 2D73A 1NSJA 2W6RA 1XBVA 1Z42A 1Y0EA 6ALDA 1TPFA 1UB3A 5C5YA 2GPTA 2R94A 2V30A 4K7VA 3S8HA 5TQLA 4JX4A 2FIQA 3G1AA 2WSYA 1W37A 3EWXA 5EY5A 3C0JA 3EX4A 4LVAA 1IIHA 4HSOA 3U2OA 3KOFA 4WOZA 2VC6A 2A6NA 2GJLA 2TYSA 3G24A 3GAYA 3M47A 5BW6A 5LNSA 3SW6A 3MO7A 3NZ1A 3BW4A 1TPUA 1WA3A 2FFCA 3EWWA 1PCWA 4BI5A 1H1YA 3WJYA 1C29A 6TIMA 3LI1A 3LXCA 4LU0A 3P61A 3Q94A 5C55A 3LTSA 3HOJA 1VGAA 3BLEA 1THFD 3UWQA 1NAL1 5D2YA 2DP3A 5EYWA 3KVKA 1UBSA 1GTHA 2DU2A 3MYPA 3NPVA 3UWZA 3LRMA 1F74A 4HPJA 2E6AA 1I2NA 3L21A 3LHWA 1D9EA 4TO8A 4FNRA 4FX7A 3HGJA 4FHAA 2QAFA 3LHVA 5AHMA 2Y7FA 4ADSA 4QITA 3M5ZA 2Z1BA 4TIMA 1M7PA 4PEKA 4GWEA 4NU7A 4WZHA 1LRQA 1VCGA 1F05A 4K6AA 1CI1A 1TSIA 4RXGA 3WK3A 2E1DA 5IBXA 3LDVA 2WKJA 5EA9A 4FXRA 1T99A 3A23A 1N55A 3FJLA 5A5WA 3EWUA 2YGYA 5CZJA 3FJ6A 3UD6A 2E09A 4NQ1A 1PL9A 1GVOA 1TO3A 1GPWA 4LUJA 4PC8A 4DF0A 5KMYA 3TIMA 2JKPA 3ABSA 4DBDA 1EP3A 3PBYA 1MSSA 4LS2A 3EX3A 3RNDA 2HTMA 4DF2A 5EBUA 1EUNA 2C6QA 3P62A 4DO5A 2Q8LA 1GWJA 1X8FA 3HPSA 1Q45A 2JGQA 3VKJA 1G7UA 4JTHA 4UTWC 4WY0F 2Q3OA 1WYIA 1ZAIA 3NM3A 5FEWA 2E68A 5AHFA 3W7RA 2V5BA 4QISA 1K7XA 2Z6JA 3IIOA 1MEIA 4LRTA 3W1AA 1DQWA 2W79A 2WNNA 3CWOX 5G5IA 3L9CA 4UFMA 4ZMGA 1TV8A 2A85A 2WJZA 4RZ6A 3W07A 1KLZA 5D09A 3HG4A 1H5YA 1BKSA 4IMDA 2O7SA 5K3VA 4JTFA 2P1FA 1ME8A 1JUBA 3RK8A 5F4WA 3O63A 1TPDA 3GXNA 3LBCA 3TE9A 3MJYA 3R12A 1G4TA 1MZHA 4TMCA 3W2LA 1KV8A 2C16A 4MFDA 1P4CA 4AF0A 1TREA 3RFAA 4IX0A 4I7VA 2X16A 3WFAA 3W1LA 1JCYA 3BGJA 3QMTA 1AK5A 1R47A 2J9ZA 3B8DA 3MP3A 3EX1A 4U4MA 4JY8A 5CPMA 2Y61A 3FYOA 1S5TA 3V1PA 2A7NA 3TJXA 2CWNA 5G2IA 4Z1AA 2VFHA 1GQNA 3O6CA 3CLMA 2Y7EA 2CLHA 2YW3A 1W5PA 1G4SA 1D3HA 1IXQA 3S5ZA 4CQ9A 3GDTA 2J9YA 1MXSA 1SW7A 2E5DA 4XBKA 1YXDA 5SWUA 4FO4A 2NWSA 2NUWA 4LOCA 3STEA 4GUGA 3V75A 3QC3A 1GTEA 2NX1A 3W72A 4EF9A 4EIVA 2BSLA 2QCDB 3O1NA 2A7RA 4CLMA 1LBLA 1KFEA 2H3DA 2ABBA 4MY9A 4L4LA 3NOEA 5CZSA 3DKJA 3HG5A 4WQ6A 3PM6A 1EP1A 3T4CA 1RQBA 4KFNA 5DY2A 2QCMA 1F76A 4M7SA 1P0NA 2OT1A 5KTLA 2ZRUA 1LRTA 3B06A 1YLVA 2XN2A 1JJKA 2FPYA 3I7RA 4FX6M 3E96A 1OF6A 3TNOA 2CU0A 1WOAA 4XZ9A 1WV2A 1I8JA 3SI9A 3TA6A 4A29A 5AOUA 5DLCA 1VLIA 3CPRA 3RF9A 1SO3A 2YCEA 1HL2A 4EOUA 1JQXA 5HR7A 2ZQ0A 4QNWA 5F2IA 2WNQA 3PSWA 4MLRA 1C8VA 1TQXA 3QH2A 5EKYA 1LP6A 3W7KA 3EX2A 1GYLA 4JYFA 5L6UA 1FXQA 4X3ZA 1H63A 4LW7A 1B9BA 3HPZA 1W5OA 2V5LA 3N9RA 2E6FA 1KTCA 5AYYA 1MEWA 2A6LA 3B05A 3UPBA 1H7RA 4U28A 2CZEA 4K8EA 1I2RA 1OFRA 5CZ0A 4AHOA 3T55A 1OABA 1S3HA 4LS1A 1G6CA 1W54A 3S0CA 3A21A 3QRHA 2ZZ6A 3CEUA 5BOOA 2VFFA 2ZBTA 1DL3A 4FNSA 1WBJA 1G4EA 3HQ1A 2ZZ1A 4PODA 2YXGA 1I45A 4GXMA 2WO5A 4JX5A 3ANYA 4Z1CA 2OZ0A 4LC6A 3PBWA 4UTWA 3G3DA 2ATMA 3HGRA 2JK2A 3D0CA 4UXDA 5K4XA 3F4WA 4Y96A 3PUOA 2E6YA 3TAKA 4UFJA 3MI3A 1AG1O 4JTKA 4CCDA 3LV6A 4GUHA 4HPXA 5ABTA 4OV9A 4C1LA 2PRHA 2AAMA 4LS0A 1LRNA 1N8FA 5EPDA 4CCEA 2PE4A 2X30A 2Y88A 1O95A 4MZYA 1VRDA 3TC6A 3UXDA 4JTGA 3L0KA 4UC5A 2HS6A 3LLFA 1K8ZA 3B4UA 2QCNA 3EXTA 3W7PA 4MYXA 1TTPA 1ZHAA 1YDOA 2QJIA 3PB2A 4OHQA 2XFWA 3UY8A 1XXXA 4UFKA 1GEQA 2CW6A 2V2CA 4UTUA 1K02A 2FB3A 1PIIA 3IGXA 3P67A 4O1BA 3CM4A 3C52A 3GB6A 1OJXA 4FNUA 1QPQA 1A5SA 2G5WA 2Y6ZA 4MJMA 4DEFA 4YWIA 1SUXA 4WJEA 4PCFA 1SZEA 1SSGA 4S2CA 1TPC1 2OMAA 5DXYA 3LCFA 3O05A 3N2XA 4JTSA 3NL2A 4CNNA 4NX5A 3RLUA 5D2XA 3T7VA 3UY7A 5D38A 3W86A 1K3UA 1IIGA 3BVJA 4MUZA 5HULA 3OVRA 3KFTA 4JDYA 1GVQA 4LVFA 5FF7A 3DHDA 4IXXA 3PAJA 5D02A 1LZOA 4JN6A 2QUVA 4E0CA 1JQVA 4GC4A 3P82A 5AC6A 3UXAA 4AWUA 3W74A 1KM5A 3DFNA 2WOQA 4CQ8A 1KV5A 2Y62A 3I65A 4M7TA 2JKEA 2B0MA 3DHFA 2G96A 1EEPA 4K37A 2AQWA 3S6DA 1LYXA 3C2EA 3KRSA 4N6EA 5F2GA 1OYCA 2B7NA 3W7GA 3NL3A 4R53A 3M5YA 4K7YA 1DQXA 4IWWA 3W85A 1Q6RA 2ATSA 2V2HA 3DFSA 3PUEA 3EKLA 1DOSA 1NFBA 1J4EA 4A21A 3N2MA 5K9CA 1FWRA 2ISWA 1PHQA 3BLIA 2ZA1A 1K8XA 2CZFA 3LCLA 1DKWA 5D2WA 3W7IA 3MUXA 3U6WA 1XBXA 3PC0A 3W1UA 1EWDA 3N14A 4ZL1A 3EWBX 1H61A 1FWWA 1R2TA 1KBIA 1WDWA 1XKYA 5CSRA 4AHQA 1F7BA 1FY6A 1NVMA 1Z44A 1DJNA 2H90A 3RU6A 1FQ0A 2WQPA 3CEPA 1KBJA 1OFDA 4A2RA 2YDAA 4IX2A 4AWTA 3GAKA 2ISVA 3IVTA 3W75A 1JRBA 2IQTA 2ZRZA 2FDSA 7TIMA 3TROA 3W1RA 3GR8A 4JTUA 3QSTA 3NO5A 1TJPA 1S5VA 1I4NA 3OBKA 4N9DA 3I6RA 3BG3A 4Q33A 3LCXA 5D37A 3NPXA 1BTMA 2HMCA 1KTNA 3O6DA 4GUIA 3NEVA 4WXZA 2E6DA 3WJXA 3LCIA 1R2RA 4JXCA 4R33A 1UASA 1W3TA 1AMKA 3OVQA 4Y9AA 3MHGA 1ZALA 1OK6A 2ZA3A 1ALDA 3OA3A 2FJKA 3G18A 4FX8A 5FF2A 1H7NA 3DAQA 3PULA 4PL1A 3IIPA 3MHUA 4NNBA 3GDMA 3LV5A 5CKSA 3KAOA 1M6JA 3WK1A 4TU1A 3NQGA 4N2YA 5D04C 3THAA 2RH9A 3PG8A 2GQAA 3TXZA 3C61A 3W2JA 5TIMA 1J2WA 2R8WA 3H53A 2H8XA 4LC8A 3IIVA 5LNRA 2ZA2A 4KWVA 1RZMA 4O0ZA 1K7EA 4Z1BA 1OK4A 3RLVA 1SO5A 3BG9A 3HB9A 3MHFA 1PCKA 3VI2A 1RQHA 2VFDA 2NXIA 1L6SA 5J5DA 5LGXA 1EPXA 3PB0A 4OQVA 4UTTC 1BWKA 2QCLA 3GDKA 3TQKA 2ZZ5A 1OX5A 4S2BA 4AXKA 2ABAA 1MEHA 4IMGA 3RMJA 4K38A 1VZWA 2QJGA 1YXCA 3ABOA 5AN7A 4BR1A 5HWNA 5K7JA 2PRMA 3L0NA 3NZRA 3W7QA 3CHVA 4FB7A 4EWND 2TMDA 1QO2A 4DXVA 2G95A 4GFSA 5AB3A 1X1ZA 4WOQA 1H51A 4IQLA 5KZDA 1KTBA 4DPPA 4EF8A 4H4IA 2QCDA 1O5KA 1OHLA 1M7OA 3W7MA 2WNZA 3SGZA 3UQNA 4I7WA 2C13A 4TMBA 3W3OA 4ZQNA 4HHPA 4FIQA 1IF2A 2PRLA 4PA8A 1SZGA 1Q3NA 5D30A 3LHUA 3R2GA 3TV8A 3DI1A 3TU9A 2NX9A 3S1VA 4A2SA 5KINA 4M5PA 2ZZ2A 4AWSA 2NUYA 3IRDA 3CC1A 3C56A 5J5RA 4N9BA 4HSNA 3OG3A 4O10A 5HUPA 4UMAA 3S5NA 4FNTA 5CZTA 1I2OA 1GVSA 1LM1A 1TCDA 1PE1A 3M5XA 3T44A 1A5AA 3FS2A 1JCNA 1TB3A 3BARA 2QCCA 3CIWA 5F2MA 3P60A 4JYEA 2WSQA 1GG1A 1JCLA 4HIBA 4O53A 4JTEA 3EX6A 1TYGA 1F6KA 2Q3RA 1DVJA 1OX6A 1FUYA 1B4KA 3VFLA 4UIOA 3TX9A 3QPZA 1H1ZA 3EXSA 4RX0A 4X9SA 1G69A 1JUKA 1H7PA 1FCVA 1ADOA 4LUIA 4JTLA 2JGYA 1W3NA 2VENA 2DZWA 5AHIA 2H6RA 2Z2UA 5LGZA 2CZDA 3MYOA 2RDUA 3NQVA 4UMBA 1XBZA 3GKAA 2WSRA 1TPVA 3N73A 4JTJA 5A8GA 3L0GA 4JY9A 2VEPA 5T26A 3NQAA 5HINA 2QDGA 4GRSA 3QM3A 4KWWA 5H91A 3HPXA 3OIXA 2GVLA 1QPNA 1IXNA 2ZZ4A 3KVJA 5FEXA 3ZWTA 4AHPA 5F4SA 4IJBA 1LLZA 2YZRA 5E0KA 1KFCA 3G8RA 2C14A 3NVTA 2VFEA 4ORIA 4YCPA 4UFIA 2VFIA 3CU2A 1RV8A 3TQ0A 1W56A 3W1TA 2WV8A 1W5QA 3DKLA 4HNTA 1EIXA 5HQEA 3M7WA 2R14A 4NNAA 2QAPA 1A50A 4M6QA 2Y89A 4GNJA 4QNEA 3O16A 3PS7A 5LHFA 4YCOA 3L65A 2E5CA 3W7HA 2DZUA 2OX1A 1K7FA 3CWNA 2TPSA 4L4MA 1NEYA 1SZFA 2ZRYA 1OFQA 4HN4A 3STFA 1XUUA 2CLIA 3DFTA 3B0VC 1KFLA 2F7FA 3ZFHA 4I7UA 1HTIA 3S1WA 1L2UA 2CLMA 2EGZA 5E93A 1XDLA 3P80A 3SY5A 4X22A 1XL9A 2QKFA 1VC4A 2F84A 3Q37A 4MZ8A 4JGDA 3NNTA 5AC8A 1QOPA 3JRKA 3TH6A 3DU0A 1F6PA 2EKCA 2CLLA 2QR6A 3GNDA 1YADA 1VCVA 4XTIA 2EPHA 4LRSA 3PUDA 1FBAA 3B03A 4MPQA 4X2RA 1DBTA 1YTDA 4UTHA 1JCMP 4BI6A 3GVGA 5KSWA 4C1KA 1ME9A 3QYQA 2DZVA 3TUUA 3FOKA 3HG3A 4IPJA 1RPXA 1FWTA 3BW2A 3GK0A 3IV3A 5FF0A 1H7XA 2QCHA 2GVJA 2C19A 4RCXA 3LHTA 3R5EA 4ZQCA 5HWJA 1ZFJA 2Y7GA 3TDFA 3P5ZA 1KM1A 2VEKA 4Y8FA 1TQJA 3ATZA 3LCGA 3INPA 2C1HA 1I2PA 4MY1A 3LGEA 4MIMA 3W7OA 1TTJA 2BTMA 3W1QA 1YYAA 5G2HA 4YLWA 3W2KA 1F5ZA 3P81A 4ADUA 3LM7A 1LROA 2VXNA 2DZSA 3P7YA 1D3GA 3HO8A 4KFPA 1O60A 2DZTA 1VYSX 2TSYA 3QSRA 4NUWA 1VYPX 2A5HA 3MWAA 1ZENA 3M16A 1GJPA 1G4PA 2H3BA 1H7OA 4UNLA 5AHNA 4MVAA 1VS1A 1BWLA 1S5WA 3E49A 2ZFAA 3ZR4A 4ORMA 4BI7A 4DPQA 3QEZA 5CPNA 1GT8A 2ZZ7A 1W5MA 4QSHA 3LCWA 4DQWA 5KITA 4PH6A 5LNWA 1LOQA 1UUMA 4ICNA 4O4WA 5HR6A 3ZS4A 1Q6LA 4CNOA 2GOUA 4UTLA 3I68A 4BFAA 3A5FA 3GIYA 2VEMA 1SQ7A 2YPIA 3R8RA 3P5YA 4A3UA 1M5WA 3R13A 1QOQA 5FESA 1GVFA 2PCQA 3VCRA 2JBMA 4OE7A 2NLIA 4MKNA 3IGUA 3TSMA 1FWSA 3TFXA 3L66A 3M44A 3PVFA 1I2QA 4WY0B 2DZPA 4WXYA 1ICQA 2DJXA 3TMLA 3W2MA 3HMJG 4NJHA 1VYRA 1ONRA 4N9EA 4QQ3A 3HGOA 4GE8A 3EEGA 3M9YA 4AEOA 3DXIA 1EWEA 3W7LA 1W0MA 1QR7A 2I14A 5D05A 2NV2A 2I1OA 3W1MA 3W70A 3G8EA 1EA0A 1A5BA 3EWYA 3W2NA 1L9WA 3FKKA 3STGA 3OEXA 4H3DA 4JIQA 3DENA 4LVGA 4LTSA 3DBPA 1JUEA 3TSDA 4Q4KA 3SSJA 5BNKA 3Q2DA 4N02A 5FEPA 1FCBA 1OG0A 3SFKA 4ADTA 1OFAA 5DCEA 3QPYA 4HT3A 4O57A 2QCFA 3LOTA 1VR6A 1V5XA 3I7QA 3LHYA 1C9DA 1H7WA 4XKYB 3HGSA 2YW4A 5I3HA 1VPXA 2GVGA 3NPWA 2CLEA 2PC4A 5DBTA 3NGJA 4RR4A 1GG0A 1VJIA 2XN1A 3A9IA 3G1HA 3PY2A 4RLIA 1XCFA 4Z08A 3N19B 3LTYA 5EL1A 3W23A 2RHGA 2ZTKA 3M43A 5BMWA 1P0KA 3AO0A 3NQEA 1W5NA 1W3IA 1YPIA 4H6KA 4K8HA 4J9JA 4FXSA 4QIUA 3CIXA 5D2VA 2HSAA 1R30A 2GQ9A 4AVFA 2EF9A 1Z41A 1P5BA 4LV9A 1PVNA 3NYZA 1F2JA 3IGSA 3W22A 3BV4A 2PURA 4JX6A 3GX9A 3LLDA 2Y70A 1SO6A 1FDJA 1DV7A 3UWWA 4Y90A 3CT7A 3DGRA 3C6CA 5DELA 1TV5A 3O6YX 1SO4A 2YFOA 5DY3A 5U4NA 3MI2A 1KM0A 4TR9A 4FIRA 1EP2A 2EAWA 3TW6A 1U83A 4JICA 2FB2A 1TMHA 1MO0A 2I9EA 1WAUA 2ZTJA 3PWAA 4ZQOA 3KRZA 4CCCA 1H60A 4PL2A 2ZRVA 4BWLA 1R2SA 1W1ZA 5H2ZA 2CZ5A 4LNYA 4N4QA 3TKFA 2YYUA 3VE9A 4NNCA 3G1XA 4JDBA 3TCEA 1ZAHA 3HF3A 2Q8ZA 4N4PA 2KZHA 1ML1A 4TX9A 5DCDA 4QAIA 5AHEA 3N9SA 4O1CA 3PR2A 1SR9A 5LKYA 3WJSA 2V2DA 4RJEA 3QMSA 1TIMA 5GVJA 1IXPA 1HO1A 3QMRA 1VH7A 4BF9A 3E0IA 2A7PA 2LLEA 3NXFA 2V8ZA 4ZQMA 4XUGA 2CLOA 2B4GA 1TPB1 4WUIA 2VKZG 3W73A 1SFJA 3M1ZA 1T96A 5AYXA 4M6VA 3UNDA 4LVDA 1W8SA 2GJNA 3G1DA 3NQ2A 3N34A 2P0OA 3K30A 2NZLA 3PF3A 4UTKA 1DJQA 3MW7A 4G1KA 4RZ5A 4R7JA 3TW7A 3LRKA 1OFBA 2GQ8A 1SPQA 5IBXC 4OU1A 3W7CA 5TBOA 2FLIA 1HO4A 5K9DA 3M41A 3OHIA 2QCEA 4IOTA 3BK0A 3NL6A 4IMEA 3W87A 4JNMA 3EWZA 5F4XA 5BMXA 2RKXA 1BEUA 4WX2A 4UR7A 3LXBA 2QCGA 4AH7A 1P1XA 1Q6OA 3P8IA 1JCXA 4E38A 2YFNA 3GXPA 1SSDA 2GUUA 2OT0A 3UPWA 3W6YA 3F1QA 1CW2A 3C2OA 4JS3A 3TJLA 2G97A 5CPLA 5I3IA 2CLKA 3W7DA 4W9TA 3NPUA 4O19A 5IM51 1FCQA 3NR0A 4NXKA 5AC7A 1HG3A 1WQ5A 5LNVA 3QQ0A 3NL5A 4JIPA 1LBFA 1AW2A 2DORA 4BK9A 2Y63A 4Q32A 1KW1A 3NAVA 1LORA 4UFLA 1PS9A 3FLUA 4GBUA 1KM4A 3AJXA 3L68A 1VHNA 4FNPA 4AB4A 3W83A 1KM2A 3BW3A 4PFMA 4O12A 1JRCA 4DBEA 3NQDA 1GYNA 3H55A 3W9ZA 3PBUA 1H50A 5BRBA 4O52A 3MBFA 2ZZ3A 4S1FA 2ZCGA 4O1AA 2NX3A 3C2VA 2V81A 5EMUA 1DHPA 3C2FA 3SR7A 4MZ1A 1FX6A 4ZVJA 5HJLA 1OX4B 4BWLC 1TTQA 3FFSA 3LI0A 3NQ6A 3C8FA 4KKXA 3YPIA 3EKZA 4K36A 3P8JA 4NZJA 5D33A 3M0ZA 3TR2A 4DF1A 3GZ3A 3MP5A 2J6XA 1NF7A 3KX6A 3W76A 1ZAJA 3BPWA 1LCOA 1KA9F 1YTEA 1QAPA 1LBMA 3R89A 1PV8A 1SFLA 2A1YA 2BWGA 3S42A 2B7PA 2J9XA 3C4UA 5FEZA 2V0TA 2NXGA 3FKRA 3GNNA 2UV8G 3JS3A 3L67A 3W1NA 1L6WA 2E77A 3F03K 5D32A 1U5JA 4M19A 1TPEA 3PSVA 3IIXA 5I3KA 3KVMA 3NQMA 3GYEA 4MLJA 4MOZA 1KLYA 3G0UA 4YMZA 3KXQA 1AL7A 3S5YA 3DFOA 5E1QA 1QNVA 1N7KA 1X7FA 4RK8A 4RKAA 4UNKA 3W1XA 1O94A 2QJHA 2ZRXA 1KM3A 2V82A 4P61A 4XQ6A 2NV1A 5G2WA 4HNUA 3NQFA 2OCZA 2E5BA 3TAOA 1FCUA 1HFBA 5D03A 4NJJA 5I3FA 2X1RA 3ATYA 2YSWA 1QCWA 4IMCA 1RQEA 4UTMA 2Z0IA 4Y6GA 5K4ZA 1JR1A 4NJGA 2VOMA 3O06A 2ZRWA 1OFEA 2B7QA 1RD5A 4POCA 5HUOA 1OX4A 2OJPA 4NJKA 4JR5A 3E12A 2Y7DA 4XKYA 3MI6A 1WOBA 3IVUA 4IMFA 3Q58A 3QF0A 1FDZA 2QEZA 3MMTA 3TSBA 1SW3A 5CGQA 3UYCA 4UTIA 1UJPA 2RDWA 2DZXA 3NM1A 2EHHA 5DN1A 4B5NA 1OYAA 1X1OA 1AW5A 4DELA 5LNUA 5HNRA 1RVGA 3MBDA 1XBYA 2J27A 3CB8A 3SZ8A 1ICPA 2DJLA 4NX0A 2J24A 4QJ1A 2WPBA 3FYPA 1A5CA 3EB2A 4NXSA 1JVNA 3QZEA 3A24A 1R46A 1ZNNA 4OWGA 1TRIA 4JTIA 4MFEA 3O07A 3N3MA 1FXPA 1X6UA 3NQ7A 3USBA 3DZ1A 1OVDA 4OBTA 3I7SA 1VHCA 4UMCA 1YPFA 4FEZA 4OV4A 3S9YA 3BG5A 5FI8A 4MYAA 4ZQPA 1L6YA 3ELFA 3G3MA 1EUAA 1QPRA 3LCHA 2NWRA 1XM3A 4HNVA 4RZ4A 4CQAA 3L5MA 1H62A 2TRSA 1LOSA 2ISSA 2X1SA 4N6FA 4N9CA 4UCGA 1B3OA 1TPWA 4LVBA 3WJZA 3NA8A 5FF4A 2NUXA 4D2JA 3G0SA 4WD0A 1IGSA 5G4EA 1ZY9A 3WK0A 3W1PA 4UFHA 2BXVA 3ABRA 2Y85A 3UZJA 4KFOA 1FWNA 1JULA 1EB3A 4LT9A 5CPOA 4HNNA 4O11A 2FTPA 5G1YA 1W31A 2X1UA 1AL8A 2QDHA 3QQ1A 3IIZA 4AF0B 5CSSA 3UWUA 1K8YA 3LHZA 4RV8A 1ME7A 1HUVA 3UZ5A 4NZFA
chains in the Genus database with same CATH superfamily
3QW3A 1WDQA 1GKRA 1Z89A 2OLAA 1KFJA 3N3TA 1BPLB 1DORA 1XLGA 3AROA 3A3HA 3KBNA 2C18A 3OVPA 3VGGA 3KDNA 1XUZA 3M5VA 1ZTVA 2P10A 5C2XA 4OIFA 4OUIA 4QDMA 4MKSA 1Z48A 4Q4PA 2A21A 2WANA 2EO7A 4WR3A 4I9AA 3WDRA 1XV8A 1VQTA 3IEBA 2DSZA 5LIWX 1KFBA 3H2OA 1LTDA 1UD6A 1TE1A 3M0MA 2FPVA 1XW8A 1TRDA 1ZU8A 5D2TA 4C90A 4FSAA 1MUWA 3L5AA 1CGXA 3SUVA 3GDRA 1UKTA 3GWQA 2FHFA 3MDUA 3LPGA 4Z0SA 3S5OA 3DDMA 4EACA 2DT0A 4DX3A 3STPA 2WMIB 1VFUA 2D23A 4GACA 3WJWA 2QF7A 4DM1A 3WENA 2VI0A 3AMCA 3QPEA 1AODA 1QT1A 4I9TA 5I07A 4Z2JA 1R3VA 4R34A 1CXFA 4DJDD 4PUNA 3A4AA 4IT1A 4GJ1A 3FEMA 3WDPP 3R8HA 1DYSA 1N2VA 5JH1A 5C6MA 3QQWA 1RK5A 4JQ1A 1WXYA 4H8VA 2OEKA 4FF7A 2W4XA 4IFKB 1O4UA 2VRJA 3MP4A 3HG2A 1VLWA 4CNPA 2OVLA 2VL4A 2VX7A 3DBNA 1JCJA 1XIJA 4PEEA 3WMBA 2QUTA 3KOZA 3URBA 3NG3A 3VIMA 3LZ3A 4NJIA 1XRVA 3SECA 3ABXA 4YJ5A 1XG4A 1KGXA 4KEMA 3E5PA 3GR7A 2D3LA 2FZBA 4L61A 5U7SA 2OYLA 2A0NA 3BLDA 4IPIA 2YX0A 3W88A 3CQ0A 3UWVA 3O7UA 3OTRA 4IGHA 2RJHA 2A3HA 3FIGA 3VGEA 2QPXA 1B57A 2D3NA 4NF7A 3S46A 1F9CA 4QEEA 1TJRA 3ARXA 1PB0A 1HKWA 2HNEA 4UQBA 3FA5A 3EOEA 1W3KA 3B04A 1MXGA 5HQLA 3WLSA 3T78A 1R7OA 2C15A 3PFMA 1B54A 3NQCA 4K39A 4DN1A 1RLCL 3LERA 3STCA 1EPVA 2OX4A 1OFPA 3N12A 2XIQA 2Z6IA 1ZS2A 2J8FA 1WZMA 1XLMA 5AY7A 3G1VA 4O0KA 3RPTA 1JDEA 4DWSD 2UZ9A 2ZWYA 4IL0A 2B7OA 2BX7A 3FJ4A 4O28A 1UPMB 3CZEA 3T09A 4U3AA 2I7GA 3NYDA 3QKZA 2ZXDA 5L9FA 1ADSA 4UR8A 5FACA 4ZCWA 5LZLA 2ZICA 1Q66A 4B92A 3KVLA 2X2GA 3FHAA 4KRZA 1TR9A 2A4AA 3TTSA 4AZ5A 3T4WA 1QDSA 5EMKA 1UKSA 3R94A 2W9MA 3T40A 4J3TA 2NSXA 3F4NA 5F2LA 4R5EA 3U57A 3THDA 3SY8A 2CYGA 1XCXA 3WEZA 4GCAA 4GO9A 2BG5A 2R6OA 2WZIA 1T0OA 2WHMA 1K1DA 3G22A 3RO8A 4NVTA 3ARWA 1C8YA 3QGKC 3CV2A 5BWAA 4MWAE 2VZSA 4Z1DA 3B0UX 3T0CA 4UTJA 1HJSA 3LRLA 4WSJA 4MNJA 1UUQA 4Z0JA 3VGBA 4ZZ9A 3WMSA 1EBGA 1BLIA 3VC5A 5DO8A 2W6RA 5RUBA 1Y0EA 3HZ3A 3D6NA 2NVAA 3TYDA 4S3GA 4U3CA 4NASA 5A6SA 2GWNA 5FCZA 1FWJC 1OQFA 4QCEA 2V30A 1XLEA 4K7VA 4PULA 3FY1A 3MSDA 1J0YA 1S2CA 2P8CA 2FIQA 3UA4A 5I77A 3GUWA 1E4IA 2WSYA 1W37A 3SSZA 3OYXA 5EY5A 3C0JA 3S6TA 4LVAA 4P7OA 3S4TA 3HQNA 3MKKA 2TYSA 3GRIA 3M47A 3GG8A 3VX0A 3MO7A 3M64A 3NZ1A 3BW4A 4U10A 3AHVA 5T9BG 3CZLA 3WH5A 1WA3A 3EWWA 3SFWA 4AC1X 2QLYA 2YB4A 3TYZA 1QHPA 3WLNA 3LI1A 3LXCA 4LU0A 1A3XA 3DHUA 3Q94A 5C55A 1X97A 1VGAA 4KETA 4L9ZA 5D2YA 2PWHA 3KVKA 3VNLA 1GTHA 3NPVA 4HCLA 3A3WA 1KGUA 3NSNA 1XH2A 4W7WA 3LRMA 4L4OA 1CLVA 4B9YA 1F74A 4XAGA 5BOFA 1S5MA 2D2OA 3L21A 3LHWA 2J13A 3TQPA 4R7OA 4Q4OA 1ZPTA 2I57A 4FX7A 3HGJA 2QAFA 2PDJA 5AHMA 4C6PA 3MO4A 1PKYA 1RALA 3M5ZA 1E3ZA 5BCAA 2JF6A 4UCFA 1LRQA 2EXOA 2Q8XA 1CI1A 4RXGA 3GVVA 5IBXA 3LDVA 3APGA 1EC8A 4FXRA 1RLDA 3WQVA 3F5JA 1RSCA 3EWUA 4AZCB 2YGYA 3FJ6A 2OQHA 1PL9A 4LUJA 3WELA 5KMYA 1PWLA 2PZ0A 3NDYA 1EP3A 4LS2A 3RNDA 5TF0A 4KRUA 2ON3A 4DF2A 5EBUA 4BF7A 3VGDA 1UR0A 4IL2A 1IEWA 5CBBA 1GWJA 3HPSA 1C90A 1Q45A 2OGYA 3R0KA 4WY0F 4UTWC 1XD0A 5FEWA 2E68A 2EG7A 2BGSA 1K7XA 1NDWA 3PAOA 2VGBA 5EMYA 1L0PA 3W1AA 2FVMA 2FTYA 3CWOX 4UFMA 4Y9OA 3F2BA 1AJ0A 2RGMA 3HG4A 5CSYA 4AIOA 4GOAA 1H1NA 4JTFA 3URNA 4AEFA 2P1FA 3AZRA 5F4WA 1UROA 1XP3A 5LIXX 1G4TA 1H09A 1T5AA 1KV8A 3J7HA 3SIMA 4AZIA 1TREA 4JHZA 4DJFA 4WGXA 4I7VA 4REQB 3AOFA 1CZ1A 4HA1A 1IWBA 1JCYA 1QNSA 3QMTA 1RY8A 5C71A 2BXZA 2R1KA 1R47A 3AAMA 3MP3A 4CU8A 5A1AA 4U4MA 4EPEC 2WM0A 1S5TA 7PTDA 2A7NA 3TJXA 5XINA 3M0JA 1JD9A 4L6OA 2Y7EA 1W5PA 4S3BA 1D3HA 2HDJA 3S5ZA 3AHYA 3ZVHA 3UPMA 2V5JA 1YXDA 1EZWA 2NUWA 4BEUA 4GUGA 3ABZA 3V75A 3ARSA 2YOCA 2PLCA 5A6KA 3W72A 1S1PA 3AMGA 3BZJA 3IK4A 3QHOA 1LBLA 4MY9A 2ABBA 4L4LA 3VKDA 5AC5A 2BASA 4E8GA 2W62A 3HG5A 3TW9A 1GOKA 3PM6A 1EP1A 1RQBA 5DY2A 2QCMA 1P0NA 1JAEA 1CXHA 5KTLA 3URAA 4RPPA 3TNOA 1WOAA 1I8JA 4A29A 5DLCA 1PX3A 4ZFMA 1SO3A 1YNYA 5GNXA 1JQXA 4D6JA 3WQ6A 4QNWA 1GQJA 2WNQA 3IACA 3IANA 4Y9MA 1TQXA 3QH2A 2INEA 3W7KA 2GK1A 4IF2A 1GYLA 4JYFA 4L1GA 1FXQA 1RBLA 4X3ZA 1JYNA 3HPZA 2ALRA 4CNUA 3N9RA 2E6FA 5BYWA 1DJWA 3A4WA 4H6RA 2A6LA 3SM0A 1L2QA 4XVEA 4U28A 4K8EA 4NP7A 4UZSA 1OFRA 2GSEA 3S0CA 4HCHA 1E1EA 3QRHA 1Q2SA 1NP0A 2ZBTA 2OQLA 1CTNA 2J77A 2GDVA 4PODA 4H9UA 3QKEA 2OZ0A 1IV8A 2XM2A 1DIEA 2ATMA 3PTKA 4XSLA 5ABHA 3LENA 4U5IA 1UIOA 4L9XA 4WDXA 2E6YA 5C9RA 3MI3A 1AG1O 1UR9A 4CCDA 4HPXA 2ZX5A 4H9YA 2BGNE 1JYWA 1I60A 2AAMA 4LS0A 5EPDA 1N8FA 1DIKA 1JGMA 1FWIC 3ZMRA 1O95A 1VRDA 3TC6A 4L80A 5A8NA 2VMFA 4UC5A 4MSSA 3B4UA 2QCNA 3H26A 4MYXA 1KNWA 2OKTA 3PB2A 1XXXA 2CW6A 2DQXA 2V2CA 1QNPA 3WNMA 3IGXA 4GY7A 3CM4A 2CBVA 3GB6A 1UKQA 4WHBA 3PHAA 5CLWA 1TELA 1VKFA 4YWIA 1SZEA 1SSGA 3FAXA 4S2CA 4FAMA 5CPQA 5EB8A 4GZ7A 1EFZA 3W86A 1IIGA 2YXXA 2C0HA 1E9LA 4XO6A 5FSEC 4UOQA 5HULA 4JDYA 1DJZA 4LVFA 1P6CA 3E2VA 2CBUA 3PAJA 3VO0A 4B3KA 1XLHA 3FVDA 5I79A 4E0CA 3KLLA 1JQVA 5AC6A 3SBFA 2V3GA 1J5SA 4ZXLA 3W74A 2WOQA 3I65A 4ZENA 1VEOA 2VZVA 1E40A 3ARRA 1M04A 3EPNA 2AQWA 3C2EA 3KRSA 5F2GA 1OYCA 1DQXA 4GBDA 1E6PA 1B3WA 1HX0A 2F9RA 4R7WA 5K9CA 4QDWA 1PHQA 2XH7A 2O4QA 1K8XA 2CZFA 5D2WA 4GXWA 3U6WA 2VEFA 5D8WA 1R86A 1K4HA 3BE7A 3N14A 2P50A 3OZPA 4F0SA 1FWWA 1F7BA 1FY6A 2GDUA 1NVMA 1E4MM 2H90A 1FQ0A 2WQPA 4AWTA 1S2UA 2W61A 3IVTA 3W75A 1JRBA 4R27A 2PAJA 2DUAA 5D9OA 3O3RA 4M82A 4RZBA 1XYZA 3AMLA 3R4IA 1S5VA 3O6AA 2Z1XA 3I6RA 4R9OA 2BB0A 1BRLA 2QMJA 2HMCA 1WAWA 3NEVA 4E4FA 3VZYA 1UOZA 4GJJA 1UWTA 3EDFA 2VCAA 3VYLA 4JFWA 3EOUA 4LBSA 2YKKA 1E6ZA 4FX8A 3G18A 3DAQA 3DC8A 4XD6A 1ZBKA 3ALFA 1P7TB 3MHUA 5CH9A 3LV5A 3KAOA 4RV3A 1E71M 2RH9A 4C1NB 3JZEA 3U2CA 4B91A 1ISXA 5TIMA 1MDRA 1BWVA 4QDPA 3IIVA 2NQ5A 2ZA2A 3SCWA 2V3DA 4WJXA 1RVKA 1K7EA 1ITUA 4E4UA 1RQHA 1KXTA 3F7JA 5ABGA 1L6SA 1EPXA 6REQB 1M7XA 1W2VA 5I24A 1P7TA 4TV5A 1BWKA 3POCA 3H4XA 3ITTA 1OX5A 1UKOA 4H41A 5GQBA 3ITLA 1YXCA 4BF5A 4O1EA 2QGHA 1LUCB 3AIQA 1FA2A 4FB7A 1XRTA 4L9YA 4GFSA 3MTWA 3M0YA 1H51A 3W01A 3BL3A 4HOXA 3W7MA 3B8TA 3O9NA 2UWFA 2W63A 4ZQNA 2YIHA 2PRLA 4PA8A 5D30A 1Q3NA 3LHUA 1JXKA 3REQA 1EJUC 1J0ZA 3TU9A 1WKDA 4M5PA 3UZZA 3TN3A 1I1XA 4YWSA 4D8AA 3UXIA 3RCNA 5HUPA 5CZTA 1I2OA 4J28A 4FOUA 3BMWA 3P93A 4W5UA 3FS2A 4WDWA 3GH4A 1B3YA 4QFUA 3CIWA 5F2MA 3P60A 3TN6A 4MWAD 3ZJ8A 1TZZA 2ADAA 1ELSA 3AIRA 1MW2A 4JTEA 6CGTA 3EX6A 4P7NA 2WMIA 1V3HA 2WVVB 2E28A 3AXIA 2FGZA 4UIOA 2VGIA 1RJPA 3EXSA 3KWSA 4Q8PA 1ADOA 4JTLA 5DANA 1W3NA 1NOWA 5AHIA 5LGZA 4AUBA 2VWSA 3N9KA 4JTJA 3L23A 3TWBA 4AD2A 4GRSA 1O5QA 2GL5A 3QM3A 5H91A 1BXCA 2WBKA 3KOXA 3T1GA 2GVLA 2GJXB 2DIEA 5E09A 3B8UA 3NZGA 5DT7A 5E0KA 2I5GA 4Z17A 2WJFA 2C14A 3NVTA 1VJSA 2VFEA 3BOLA 2WVUA 4ORIA 2VFIA 3CU2A 2ZUSA 1XYFA 1TWDA 1TX2A 1DJGA 3QR0A 1W9XA 2POTA 1SGJA 1XYLA 4HPHA 3CUZA 4GX9A 2Y89A 1BHGA 4QNEA 3PS7A 5LHFA 3L65A 2OX1A 3N17A 1RCOB 1NEYA 3ZOAA 4HN4A 1M01A 4Q8TA 4BQ4A 3G6MA 2CLIA 2MANA 3VPLA 3ZFHA 5IFTA 3S1WA 2CLMA 3AHXA 4WSHA 3WL0A 3RJXA 1BXNA 1UR2A 1VC4A 3SCNA 3S2LA 2ESCA 5A8PA 1V0MA 4V15A 4XZNX 1FH8A 2X0SA 3KL5A 1US3A 2EPNA 4NZ3A 3PUDA 1ISVA 5DEZA 1XWYA 1AD4A 3LYEA 4LCQA 1D8CA 4C1KA 3E2SA 1W8GA 4XIMA 3TUUA 2VX4A 4LPCA 2FTWA 4IPJA 1PO9A 3WLQA 4Y9PA 3UFYA 4OUEA 1EGMA 3IV8A 3LHTA 4QE1A 4WKAA 2OXNA 4X63A 3TDFA 4Y8FA 3ATZA 2CLPA 3LCGA 3INPA 2C1HA 2WJEA 4X60A 1MQRA 1PAMA 4YPJA 1EEXA 5G2HA 2BMBA 4ZE5A 1LROA 4ICMA 2V63A 2FFIA 4F0KA 2XU2A 2RJGA 3SURA 4NZCA 4KFPA 1O60A 2DZTA 4C6OA 1VYSX 2CEQA 4DLFA 1V6TA 4FR6A 1VYPX 3MWAA 2I16A 3B0XA 1GJPA 2H3BA 2GJPA 1UQYA 1VS1A 4IIEA 1BWLA 4HJFA 4YHGA 4V1XA 2DSKA 3E49A 5LA0A 1UWQA 4ORMA 4BI7A 3QC0A 3TP4A 1GT8A 5C8BB 4QSHA 1Z9AA 4IUGA 4PH6A 3APYA 3BH4A 4XG1A 3ZS4A 4CNOA 3TTQA 4L6HA 1HN1A 4L64A 4PMOA 2PU1A 3GNOA 3A5FA 3GBDA 1G94A 3ZLGA 2VEMA 2BV9A 1SQ7A 3VNYA 5JU6A 1FKWA 1KXQA 3GVQA 3RR4A 2OO6A 3FK4A 3N1AA 5AECA 4FA3A 3VCRA 2JBMA 1GOMA 2GSJA 4Q7IA 1K77A 3N6HA 3C86A 4G2DA 4ZO6A 3O0KA 1NOFA 3N15A 3ZVIA 1VIZA 1ICQA 5M5DA 3W2MA 1VYRA 3VAVA 1ONRA 4GVIA 3S5SA 3HGOA 4GE8A 3DXIA 2I14A 3SCTA 2E7FA 3ENLA 3W1MA 5FJRA 1EA0A 1X39A 1DWFM 2V3FA 4PMNA 4BCEA 5I6SA 4HA0A 4LFYA 4P7RA 1EGVA 5EFDA 3VKBA 3FKKA 3W29A 1PZ0A 4IICA 3WD4A 1SVDA 1VPQA 3POHA 3DENA 3KM8A 4LTSA 4MJ4A 3TSDA 3VA8A 4GX8A 3M4HA 3Q2DA 1FWEC 3RXZA 1OG0A 1OFAA 4HT3A 1PX8A 2QCFA 1VR6A 2ZX8A 1V5XA 1QOXA 4W5ZA 4XKYB 2CXEA 9CGTA 2GVGA 2CLEA 2HWGA 2XN1A 3A9IA 4KGLA 4Z08A 3VDCA 4GY0A 2F2KA 3I4KA 3LTYA 2PDPA 5EL1A 3WUEA 4LUTA 2ZTKA 3NQEA 1V02E 1W3IA 4K8HA 3LNPA 1R30A 3N2CA 4HN8A 4PMZA 1UZ4A 4MAVA 1B2YA 3BV4A 1DV7A 3DGRA 3C6CA 3WH9A 1TV5A 1NM9A 1OCQA 5DY3A 4NZ5A 1ZUAX 3LLXA 4KCUA 3F4DA 1PIGA 4FIRA 4TR9A 2Y5EA 5CZKA 1KCXA 4JTQA 3PZOA 4G56A 1D3CA 1U83A 1MO0A 2I9EA 4UB9A 3FA3A 4MAZA 3PANA 1LL6A 4M24A 4CCCA 1W1YA 3W37A 5FSDC 3VXGA 1RA5A 4JKLA 3G1XA 3QGAC 2Q71A 3K8MA 1E9ZB 3EDKA 3DC0A 1Y5WA 5AHEA 1F3WA 4O1CA 4U33A 4LUTB 5M2FX 3NUKA 3PZTA 4E5TA 3E3HA 1EHAA 3H21A 5ECUA 4E8DA 1XLDA 3KZPA 1OIFA 1BVNP 3BANA 1TMQA 3WUFA 1IXPA 1HO1A 2A7PA 3MA8A 2V8ZA 2CNCA 2CLOA 2B4GA 1MVYA 1SFJA 1VF8A 1TG7A 1KCZA 2GJNA 3N34A 3OZMA 3RN6A 1YMYA 2IPFA 3KTCA 3ZSTA 2CHNA 3WUBA 4G1KA 4GD0A 3LRKA 1FVPA 1SPQA 5IBXC 3W7CA 4NZ4A 5TBOA 2FLIA 1HO4A 5K9DA 2WMJA 3VNZA 4ZBCA 3OHIA 4MG4A 3U3HA 2AL1A 4IMEA 5F4XA 5CAHA 5BMXA 2RKXA 1RHCA 3AMDA 3CUXA 4HK6A 1P1XA 3LG3A 3W25A 3P8IA 3EDEA 2PBGA 2YFNA 3GXPA 1SSDA 3CH0A 2DZBA 4HK5A 1XLFA 3B40A 3W7DA 4KBXA 4W9TA 4DYJA 1CGTA 1EO5A 2OGJA 5LNVA 3NL5A 1Y5VA 1E70M 4IFKA 1LBFA 4IISA 5T9CE 3R25A 3NAVA 2HK1A 4D6CA 3L68A 4FNPA 3W83A 5A6LA 3O0FA 4AFYA 1ITXA 4PFMA 2X2YA 2YCKX 4GK8A 1F3TA 4FOJA 4XB3A 2ZZ3A 4S1FA 1FWBC 4A05A 3C2VA 4C6KA 5EMUA 4GI4A 2JIEA 1XINA 4MZ1A 3HM7A 4P8VA 3B8VA 4E3VA 3LI0A 1OCBA 3NQ6A 3C8FA 4KKXA 3QVQA 5D33A 1S39A 3GU1A 4KH2A 3TR2A 3GZ3A 2J6XA 1QNOA 1ZLPA 3W76A 4GISA 3BPWA 1KA9F 1YTEA 3R89A 2B31A 2J9XA 1CPUA 3VABA 2V0TA 3GNNA 3FKRA 4H8NA 4KMQA 1WDPA 4H04A 4A3YA 2OOFA 2PWEA 1HKVA 3GYEA 5REQB 4ZTXA 4MOZA 1KLYA 2HQAA 2WQDA 1JIBA 3LD5A 3N6JA 2VUYA 3NVDA 2X1IA 1OADA 4NYUA 3SUSA 3DFOA 1F3EA 5E1QA 2PLKA 1DJHA 3V4BA 3BCDA 4PMDA 3AZTA 3OBEA 5JXQA 1NH6A 3TYUA 1JI2A 3UGRA 2Y1HA 2PA6A 1VD6A 3VOCA 1HFBA 3BAKA 4BKNA 4NJJA 4FR1A 4QR6A 1RQEA 1R3WA 4UTMA 1JI1A 3ARPA 1JR1A 4MPKA 1H3GA 4DZ5A 1ZRQA 4CQDA 3FYYA 1Q63A 3T42A 2X42A 2C91A 4GG9A 4IMFA 1BSLA 1UR3M 3PJTA 3GG1A 1HIZA 2VHLA 3MMTA 1RCXB 1SW3A 1PBGA 1UJPA 4LH8A 1KQYA 1T8QA 3NM1A 2EHHA 4MB5A 2PP0A 1VEMA 3UF9A 3T6CA 1N8WA 4KWUA 1RVGA 5ABEA 2J24A 5BXRA 4NXSA 1JVNA 2BFGA 3A24A 5FJPA 2WXDM 4OWGA 1TRIA 3O07A 4LF1A 3PTDA 3TA9A 3ORWA 3DZ1A 3CV7A 2IPJA 4ZFCA 1VIWA 1GOIA 3BG5A 3UJ2A 5FI8A 3U7VA 1TA3B 3LMZA 3WD3A 3ELFA 4UQCA 2VEGA 4MHBA 1EL3A 1S2VA 2ZE3A 4HNVA 2BVTA 1DIDA 3IAPA 2ISSA 2X8RA 5HNUA 3WJZA 5FF4A 3SN4A 3F2CA 4L4PA 3EPOA 4WD0A 5G4EA 3WF4A 1ZY9A 3CGTA 4RDVA 4J27A 2UY3A 1POJA 3WDJA 3AXHA 3RIKA 3TYAA 1JULA 5A6TC 3ZO9A 3H4WA 3CJPA 6XIMA 3MCMA 4GH3A 1QHOA 4O11A 2FTPA 1W31A 3IIZA 4C6EA 3C2YA 3ARYA 4CVUA 3N29A 4RV8A 1ME7A 1QUMA 4AZBA 4QTGA 2OSXA 1CX9A 4LY8A 2FDMA 4JTCA 3DG3A 4HPNA 2X40A 3JUGA 3KHJA 3SIZA 3NSMA 1M1BA 2O4MA 3GLCA 5AHLA 2IS7A 4NT0A 1T41A 1XJBA 5C54A 3W71A 3GTHA 1CB7B 3ITVA 4B90A 4JFTA 1B4EA 1IXOA 2V5DA 2PEVA 3MJMA 4ONVA 3GXMA 2G4FA 1GZGA 5A6BD 1TMLA 2AQOA 3S9ZA 1QWGA 4ZQRA 1H11A 5DMLA 1BVWA 3OGVA 3KOWA 4GIRA 1XQLA 2QZRA 1GOOA 4FLSA 1TPH1 1KRCC 1CDGA 1XI3A 2BY1A 3MV11 1NP2A 5KZ6A 3M46A 3MUZ1 2QXWA 4DY1A 3GZAA 3QJAA 3WNPA 4DO6A 3AICA 4XBSA 3BGGA 5C9XA 3IJ9A 5CC6A 4LYKA 3S6OA 4QHRA 4XZWA 3ZR5A 5HMSA 4F48A 3B0PA 3F4CA 1OG6A 2P5NA 4BA0A 2C0AA 4JTDA 2QUUA 1VFSA 1HNYA 1VEPA 1KM6A 2JALA 2A3AA 2P76A 3U9IA 1CXLA 1ZBWA 3IJ7A 4GA8A 4AMCA 4YYCA 4UTTA 3WQ4A 3VD5A 3SRHA 2Z2BA 2O7QA 1XHGA 3AQUA 3D47A 4AMAA 3WF0A 1BKHA 4HZ6A 5HJXA 1TKKA 3I3DA 2Y5SA 1JXJA 1SYTA 1TR1A 2YBVA 3AC0A 4DZHA 1NY1A 2PDWA 3GC5A 4E2BA 1MWOA 5FJIA 4QJ3B 1XC4A 3RPDA 3GIPA 2CETA 2XUCA 2ZXAA 3BSMA 1LOLA 1UW9A 4JEQA 4IJRA 3SGUA 3CZ8A 3ERPA 3K4AA 4RW5A 3R0DA 3W2UA 3DFPA 2VEIA 3CQKA 2IQ0A 4UQAA 2WMHA 4HU4A 4NG3A 1YQ2A 4RDZA 1DHKA 4JFUA 3N13A 3GKFA 1IR1A 4Z1YA 4HYWA 1I6NA 4AAJA 3VKKA 1XIEA 4XV0A 4Q8OA 3IVSA 1F73A 1YHTA 4NRRA 1R5YA 3G1YA 3FGCB 5CBIA 2QF8A 1CGUA 5IHSA 4HZMA 1SJCA 4GNKB 1EKOA 6XIAA 1CENA 1V7YA 1VAHA 5DX7A 1GGOA 1OB0A 1XDMA 3P0WA 1GVRA 3CXOA 1P0BA 3G1FA 1E51A 2V68A 2FQIA 3TZFA 3LB0A 4KCVA 1D7FA 3UR2A 2D20A 1G1YA 1QMLA 2ALDA 4ALDA 1FDYA 1G67A 1YRRA 1GOXA 4XTDA 3XISA 1Q65A 4GO8A 1SZNA 2HE5A 3WLMA 1SFSA 2FPTA 4P8WA 2VFGA 1XIDA 5H8PA 1UUOA 5LIKX 4OGZA 3GR4A 1TV7A 3ITYA 3E38A 3A5VA 4ICCX 1OGSA 3MCOA 1Q8AA 2XIBA 3EB4A 3TTEA 4A22A 4AG0A 3W02A 4URIA 3PPCA 2J78A 2QJMA 1QRQA 8TIMA 3VD3A 3C3NA 1ISYA 2HS8A 3KBWA 1WXJA 1OF8A 3BSGA 2YCLA 1RBOB 3SN1A 4KPLA 4ERGA 2VELA 2BVWA 3OLDA 3G1RA 1VCFA 3C2RA 4RNHA 3IGHX 1A53A 4JD4A 2XH0A 5E70A 3LBMA 1W9PA 3WQCA 3T0DA 3PPFA 1J93A 3VDGA 1IT7A 4GUFA 2D22A 2JKAA 4DJDA 4A4AA 1S2WA 2XN0A 2RFGA 4WJ8A 2CC0A 3L5LA 2NQHA 5JUVA 1V4YA 1RP8A 4M6PA 3GTXA 3LUTA 4DBUA 2D73A 4V27A 1NSJA 3QBUA 2YCLB 1XBVA 1F8MA 5FIPA 6ALDA 1TPFA 5C5YA 1UH2A 2GPTA 2R94A 1PX4A 1EYEA 4JX4A 2G3NA 2CBJA 2V38A 4RE4A 4C6FA 4A8IA 3EWXA 3U7BA 3EX4A 1FKXA 1IEQA 1IIHA 3U2OA 1AVAA 3CH9A 3RCYA 3ZZ1A 4B4FA 4QRNA 2P3EA 5KEZA 2BS9A 3P2VA 3PPGA 4F2BA 1ZGDA 3OVGA 4KRTA 2QNEA 3ONCA 3WJYA 6TIMA 1S1RA 3AYTA 4E4PA 3LQGA 1V6XA 1NDZA 1DWAM 3IJDA 3LTSA 3MUCA 3HOJA 3V35A 3AIWA 3VDBA 3BLEA 1NAL1 1UBSA 4PN2A 3BLKA 3IRSA 4GFIA 3BICA 1V0KA 4HPJA 3VC6A 2PSNA 1NWRA 2DQWA 2XHYA 4TO8A 2BHZA 4QITA 3TYEA 1JZ7A 1QVBA 4PUEA 1M7PA 4NU7A 2VVNA 1HKMA 1REQA 2C1IA 2OEMA 3CL6A 1TSIA 3WK3A 2E1DA 4G7FA 2WKJA 3EWDA 2R1PA 4XZIA 4I6KA 1N55A 3FJLA 5CZJA 2IKHA 2VCBA 3OLGA 5C70A 5AVNA 1HL8A 1GVOA 3OLEA 3N25A 3PBYA 1LT7A 4JPGA 1MSSA 3EX3A 1XIFA 3WFLA 2HTMA 3TN4A 3WH6A 2XGBA 4LY4A 3P62A 3FSUA 3THCA 3S83A 1CGWA 4DO5A 4UOZA 2WNWA 1G7UA 4EWJA 4M29A 9XIAA 3L4UA 3L12A 3U4AA 2E3ZA 5I7GA 4IP5A 4PE8A 3N2TA 8XIAA 3IIOA 1HP5A 2JFEX 1GW1A 2WNNA 5G5IA 4RZ6A 3SRFA 4LJ3A 4CNSA 1H5YA 3AFBA 4LX4A 2O7SA 1A0CA 1KCKA 1O1ZA 3VIJA 1FH7A 3TLQA 3RK8A 1TPDA 3LBCA 3TE9A 1JPKA 4TQTA 4TMCA 4HZ7A 2E1WA 1WO2A 2C16A 3GXIA 1P4CA 3MKCA 3WQDA 8A3HA 4AF0A 3U48A 1NTHA 4OOZA 3WFZA 4IX0A 2X16A 1X8CA 2O9PA 3W1LA 5IOBA 2OWWA 3TTYA 1X7IA 4DUWA 4HOWA 3FYOA 3V0SA 3R43A 2VD8A 4EX4A 4M8UA 3K13A 3B97A 2WM1A 4ZOCA 1Y7VA 2CLHA 4I6VA 1G4SA 2EJAA 2VGGA 3PZMA 2FVLA 3MUAA 3OGRA 4IIGA 1U5HA 4ZO9A 4CQ9A 3GDTA 3AUOA 2E5DA 2I56A 1UD3A 4A3QA 1XYBA 2CZVA 1UIPA 2ZUMA 3HJEA 4AD5A 3QN3A 1A3WA 5LIYX 1EJXC 4CU6A 3DESA 3DFYA 3BV7A 4XZBA 4EKJA 3E2RA 2PDQA 1MQPA 1Q2RA 4PMYA 5HDRA 3IK2A 2QCDB 1KFWA 1W9BM 3VOIA 1BYBA 3NOEA 5CZSA 2DVXA 3BJTA 1K70A 2AGTA 2VWTA 1O6IA 1KO0A 1JPHA 2VX5A 3GQYA 2ZRUA 1LRTA 3AIUA 2XN2A 3EA2A 2FPYA 3I7RA 4QEHA 3E96A 1KGWA 4KWOA 3KL0A 2CXGA 3SI9A 1JNDA 2NQ9A 5AOUA 1IZCA 1MQQA 3RF9A 4FMVA 4S39A 1A5LC 5HR7A 4GGHA 2G41A 5F2IA 3PSWA 3NJ3A 2WCSA 1C8VA 4RE0A 1O12A 1LP6A 2WZMA 2VD9A 2Z28A 1UD4A 5L6UA 4LW7A 1W5OA 1UC5A 2P0IA 1AMYA 2AQVA 4MNMA 5JQ9A 5AYYA 2CESA 3B05A 4PFHA 3W4RA 4GABA 4EAYA 3HFYA 3WN6A 5BU6A 3T55A 1H41A 1S3HA 1RD6A 1XCWA 1G6CA 1V93A 1W54A 3A21A 5A95A 2PWUA 3H2CA 2ZZ6A 1C9WA 1TV4A 3BMVA 2VFFA 2F2HA 2L5HA 3QV7A 1G4EA 2XWEA 4J3ZA 3ANYA 3UG8A 2O9RA 3G2GA 5BRPA 1XR2A 3OOQA 4UTWA 3G3DA 5IDZA 3CV1A 4DJFC 3HGRA 4N42A 3F4WA 4Y96A 2VQTA 4JTKA 5ABTA 4B16A 4C1LA 3U0HA 2GQ3A 2PRHA 3ALGA 1A4LA 4XSMA 2PE4A 1RP9A 2Y88A 4MZYA 3VU2A 2Z7GA 5GNZA 3WDIA 3L0KA 3LLFA 2A79A 2WVTA 4PRRA 4OVXA 5HJYA 1GEQA 2FB3A 1E5NA 1PIIA 1D2KA 3R0UA 1QPQA 2ANUA 1A5SA 4AD0A 1ZBCA 4W8BA 5DFAA 4FALA 1TPC1 3N2XA 3RGTA 3EMQA 4PMQA 3NL2A 4NX5A 1NDYA 5BROA 1KKOA 4MGGA 3W27A 2EPLX 1CLKA 2VZUA 3KFTA 1B1YA 1GVQA 1R85A 2PDFA 1W3JA 4IXXA 5D02A 1LZOA 1JNEA 2VRQA 4GQRA 3UXAA 1ESWA 1KM5A 2B81A 3WBWA 4INFA 3RM4A 3OPSA 7CGTA 1KV5A 3EDDA 4M7TA 4LBUA 4HYVA 3QY7A 3OW1A 3WQEA 3KS5A 4N6EA 3H2NA 1ZSXA 1H0GA 3NL3A 4R53A 4K7YA 2ATSA 4KQNA 3KZSA 3QXBA 1REQB 2V2HA 2V69A 3V0TA 4AZGA 1EXPA 1GKQA 1NFBA 2F61A 1J4EA 4F3HA 1KRBC 1C8XA 2XIMA 1LF1A 3VD4A 4ASTA 2ISWA 1OZQA 3L4VA 3I4EA 4JL1A 3RMEA 4GVHA 3WNNA 3W7IA 3MUXA 3GTFA 1XBXA 4HNCA 2JIWA 2YL6A 1R8LA 1QASA 3W1UA 1TUXA 3NO1A 4ZL1A 3EWBX 4REQA 3OGSA 4TOQA 1NFGA 1WDWA 1XKYA 3GC4A 3IJIA 1LQAA 6A3HA 3AXXA 1JG9A 5FJOA 3M0VA 5FL1A 2W27A 5I06A 4C91A 3WNLA 2FDSA 7TIMA 4RNJA 3W1RA 4S3EA 4C6JA 3GR8A 3WDQA 4C6CA 3NCOA 4JNYA 5D37A 1KTNA 1Q4NX 3O6DA 1OZMA 1ZBVA 3LCIA 2R1MA 3JVAA 5BU9A 4JXCA 4R33A 4F9JA 1OK6A 3WEOA 2ZA3A 1X6LA 1ALDA 2D1ZA 3OA3A 2FJKA 3V7PA 4PL1A 3ITGA 1Z8AA 3DCPA 4QS5A 3GW0A 4DWSC 5CKSA 1J0IA 1PYMA 3WK1A 3NQGA 4EP8C 3THAA 3C8NA 4AY7A 3PG8A 3TXZA 5MF5A 4LAMA 5GJNA 1J2WA 3USZA 5CJ5A 3CQJA 3PTQA 2OB3A 2H8XA 4LC8A 2ZOXA 1XDJA 4RL3A 2FZDA 4O0ZA 3UR7A 4Z1BA 1OK4A 1SO5A 4HOZA 4CN4A 2WW5A 2VFDA 1V0NA 3PB0A 3TQKA 3GDKA 1DWJM 4X0NA 4QLJA 5C0QA 3GE7A 5BXTA 4B2DD 1UKPA 4AXKA 4C7DA 4H01A 2WMKA 4F4RA 4GNVA 3P6LA 4JIIX 1U30A 1V6WA 4Q3MA 1QO2A 4DXVA 2G95A 1FWAC 3GFYA 3NIYA 1UP0A 4AIUA 4WOQA 2UY2A 4TX6A 4C6LA 1KTBA 4P8UA 4XUYA 2TODA 4AZHA 1TV3A 3SGZA 4AEEA 1D7KA 4DVOA 2ZC8A 4I7WA 4JIHA 5EMLA 4DYKA 2C13A 3M0LA 9XIMA 4F2TA 2FZ8A 4HHPA 2P53A 3R2GA 4KESA 2NX9A 2WLZA 4LB4A 4A2SA 3WLLA 1QW7A 2NUYA 4ZO8A 3KCLA 4MNKA 2VTFA 5A94A 3EEZA 4AISA 3MZNA 5D8ZA 2O55A 4HSNA 3OG3A 4AZ7A 4UMAA 1F4HA 5I2UA 3FN9A 3OA5A 3MMUA 3QV8A 1GVSA 3R79A 1X96A 1TCDA 1PE1A 3FHQA 4LSBA 1A5AA 3KS6A 2DIJA 1JCNA 1TB3A 4AVNA 4DXXA 1JZ3A 3GSMA 2ZC1A 5A3HA 1LLOA 4B9ZA 4HIBA 4O53A 1GK8A 1XLKA 1FRBA 1F6KA 2Q3RA 1HF6A 3CZGA 4KWSA 1FUYA 1B4KA 2IUZA 3KCJA 3B3DA 1TWWA 4G5DA 4X9SA 3E5BA 3AUJA 1JUKA 4QJ5B 2ZUTA 3U2ZA 3WBAA 2OYMA 2VENA 3WBYA 5FJJA 2BHUA 2BY3A 2J7EA 2SFPA 1KXVA 3MYOA 1XBZA 1HZYA 5I23A 1XH0A 3GKAA 2OLHA 3N73A 1KD0A 3MMDA 4JY9A 2FYMA 4J3XA 5T26A 3NQAA 1CXEA 4UTFA 1GONA 3T0AA 3M0KA 1JPIA 2TAAA 3B8IA 3OIXA 3HMCA 1QPNA 2ZZ4A 3KVJA 3NDZA 3ZWTA 2Q6ZA 1LLZA 1KFCA 2Z24A 3G8RA 4HMNA 1E73M 3FSTA 5CSUA 2WZEA 1RV8A 1YX1A 4NL1A 3CMJA 3DKLA 2J7DA 1NIUA 5CCZA 4Q8MA 1EIXA 3M7WA 4LAZA 5HMFA 4NNAA 2QAPA 1A50A 2Y2WA 4M6QA 2Z7KA 3AHZA 4YCOA 2E5CA 2ZRYA 2FMOA 3B0VC 3C0QA 4GKLA 2YDSA 1G01A 3TYBA 5GJPA 3P80A 4D1IA 3SY5A 1XL9A 2QKFA 2F84A 1W1TA 4IP7A 3RU8X 4ZODA 3VGFA 4PZVA 5AC8A 1QOPA 3DU0A 2EKCA 2QR6A 1XPYA 3GNDA 1VCVA 4Q4QA 4IHCA 1SJBA 4HVXA 6REQA 3GH5A 1VP5A 1R9XA 3G77A 1JCMP 4BI6A 1E6RA 5KSWA 3M07A 1ME9A 2J7BA 2ZWZA 3G6LA 3QYQA 3FOKA 2W5FA 1FWTA 4WKHA 1EGZA 4N7QA 3IV3A 3LPOA 2C19A 4RCXA 3R5EA 1ONWA 1ZFJA 2VEKA 2J74A 4HD5A 3JU2A 4LF2A 5A8OA 2H9AB 1Q6EA 1S5NA 2BTMA 1QBBA 3MS8A 1YYAA 4IQDA 3KBJA 3GU9A 3P81A 2REQB 1ZP4A 3LM7A 2VXNA 2BDQA 3NQBA 4PUJA 3PWIA 5A2CA 3GXFA 4F66A 2HZGA 2WVSA 4GI9A 2BXYA 1BYDA 4KGJA 3UEQA 3B8SA 3NGFA 3NZQA 1S5WA 1TE6A 4ROPA 4F40A 2OTDA 4DPQA 2ZZ7A 2DDXA 1W5MA 4DQWA 5KITA 1F6YA 2HJPA 5LNWA 4W89A 4TXEA 1Q6LA 3S2NA 2REQA 2GOUA 3KWXA 3AU6A 3BMXA 4Q4RA 4AWEA 3CT2A 3NOYA 3R8RA 1X6NA 1DEDA 4A3UA 4M1RA 1OD8A 3V5OA 3R13A 5FESA 3LS9A 1NFPA 3TSMA 4TTGA 1ISZA 1V6YA 1TUFA 3DUGA 4CD6A 3I3EA 3SEPA 1KWKA 2DJXA 3TMLA 3DG6A 1UWRA 1DJYA 3NFUA 3W7LA 2DW7A 2I1OA 1S46A 1JFHA 2J7CA 1A5BA 1FH9A 3W2NA 3STGA 3H2FA 1PKMA 3OEXA 4H3DA 3AZSA 4JIQA 5LIUX 2G3FA 3IAQA 4LVGA 3E2QA 2ISDA 4S3FA 4Q4KA 5A6JA 2PDNA 4N02A 5BNKA 4AC7C 2XVGA 3MC5A 2E67A 4I8DA 4O57A 1I0BA 3A64A 1XIIA 2XISA 3LHYA 1HKIA 3HGSA 1XLAA 4YU1A 3BSHA 5HQMA 4O1FA 2YCJA 2PC4A 5DBTA 3NGJA 1GG0A 3G1HA 1W9UA 2CCRA 3N19B 4QROA 3W23A 4H8UA 2IKJA 1A47A 1IYXA 4PUKA 1CYGA 1JPMA 3AO0A 3VD7A 4LUSB 2XTKA 4J9JA 4UZUA 2FMNA 2PTXA 2NSOA 1ITQA 3CIXA 4AVOA 4LV9A 1F2JA 1V8EA 1ZL1A 2X09A 4MWAB 3W22A 2PURA 4HYRA 3LLDA 3S47A 1SO6A 3IJLA 1A4MA 3ITOA 1P0DA 1SMDA 4Q6JA 1JYXA 3CT7A 3O6YX 4JZ5A 3MI2A 1RBAA 4W8AA 4YTUA 4HBKA 1EP2A 4UOJA 1EYWA 4W86A 2ZTJA 2DW6A 3PWAA 2Z25A 3UG3A 5FOOA 1H60A 2X41A 5H2ZA 2CZ5A 4LNYA 3TKFA 4P5UA 5FD0A 2YYUA 1J12A 2GJRA 4RPQA 1ZAHA 3PZVA 3GVWA 3RRAA 2KZHA 4TX9A 5DCDA 8XIMA 3MU7A 3BDKA 1GPFA 2OSYA 4UBPC 3PR2A 1SR9A 5LKYA 3WJSA 1XYCA 3U5UA 1R3YA 1VBJA 2BY0A 1TIMA 1UA3A 4GLEA 2PC8A 1Q8JA 3QMRA 4IM4A 3NXFA 3WD1A 4JKKA 4XUGA 2R82A 1TPB1 2VKZG 3W73A 4J1OA 4M6VA 5BXSA 2Z2AA 4EXAA 1W8SA 4LEFA 3NQ2A 2P0OA 4LCSA 1MDLA 1DJQA 2IKGA 3TW7A 5REQA 4C5ZA 1E5JA 4OU1A 3T2OA 4HSHA 1WDRA 2WHLA 4K3ZA 2C8NA 4IOTA 3BK0A 3WD2A 2IXUA 1NU5A 5HATA 1DE5A 1N8IA 2YB1A 3EWZA 5LYRA 4WX2A 1UR1A 1XICA 3KBMA 2Z26A 2V5CA 3UZYA 5C9WA 5J8LA 4E38A 2OT0A 2PP3A 4JFVA 3W6YA 3F1QA 2BNJA 3C2OA 5I3IA 2CLKA 1Q7QA 1FCQA 4NXKA 1WQ5A 2VQUA 5JBEA 4H2HA 2FHBA 6PTDA 3APTA 2Z29A 1KW1A 1LORA 4UFLA 3QY8A 4GBUA 1KM4A 3BAWA 2PCEA 2GVEA 4AB4A 4KEVA 3EAUA 4B5XA 3BW3A 1HUVA 4O12A 4DBEA 3NQDA 1GYNA 3H55A 1I1WA 2ZCGA 3BZGA 2NX3A 2WYSA 2EPOA 1UHVA 1ODUA 1TVPA 4ZB0A 1JZ6A 1FX6A 5HJLA 4BWLC 1TTQA 3AALA 3EKZA 2E25A 3P8JA 3GBEA 2AOSA 1CEOA 3ZQ9A 4DF1A 3MP5A 1NF7A 2PB1A 4WF7A 1K9DA 1QATA 1LCOA 4DM2A 1PDZA 1Q6CA 1BRLB 3S42A 5FEZA 2Z00A 2UV8G 2C1GA 3JS3A 4MKVA 1ITCA 3L67A 3W1NA 4U31A 5IFPA 1L6WA 3F03K 2VURA 4M19A 1TPEA 4MNLA 1MNSA 5I3KA 3NQMA 5HNTA 4DO7A 3KXQA 1AL7A 3AWOA 4IFRA 3CAVA 3OIHA 3DIPA 3BLLA 4GCXA 4RKAA 1KM3A 2V82A 1R0MA 4P61A 2NV1A 3ARQA 4HNUA 1BF2A 2YL5A 1MFUA 2QVHA 3ID7A 3ITXA 3ATYA 3MCNA 2ZDSA 1WNOA 1DPMA 1XYAA 3O06A 4AIEA 4ZGYA 5DF0A 4GVFA 1OFEA 2B7QA 4DJEA 5HUOA 1OX4A 4XD5A 1ODZA 2OJPA 4NJKA 1HW6A 4JR5A 4XKYA 4HZ8A 4FPSA 3CMFA 3IVUA 3LN3A 3QF0A 2QEZA 2QVNA 1VRXA 3CAQA 4WCJA 2XJ7A 4C6DA 1XF0A 4AZCA 2NLYA 1SJAA 4B5NA 1FWFC 1GNXA 4DELA 1WPCA 3VTRA 1ZCCA 1XLIA 1EO7A 1LG2A 3W26A 2WZTA 2DJLA 4QJ1A 4PUMA 2WPBA 1A5CA 1H2JA 3QZEA 1R46A 1ZNNA 2XFFA 4JTIA 5TD4A 4MFEA 3L4ZA 3FGCA 1QI3A 1TV2A 3NQ7A 1V3IA 3USBA 3H7RA 3QYSA 1OVDA 1VHCA 4LBRA 1OC7A 4J3VA 4D1JA 4S23A 4MYAA 1F3XA 4GXPA 1IZKA 1XRSA 1C3FA 3G3MA 1EUAA 3LCHA 3L5MA 1EC9A 4RUBA 1XIHA 2BOGX 2TRSA 2X1SA 4N9CA 3GFXA 1B3OA 3RYSA 2Z1KA 1V77A 4LVBA 3A12A 3NA8A 3LK6A 4D2JA 3T05A 1A5KC 1TWSA 5LXEA 1MZRA 1Y5XA 4GZJA 1QW9A 4JCLA 3ABRA 1QPKA 4Q7NA 4MDOA 5FJUA 5I03A 1UMLA 1DJXA 1O5RA 5G1YA 4E8CA 3EA3A 2QDHA 3QQ1A 1RK6A 3GG0A 3LSBA 4OKDA 5CSSA 3AHTA 1HJQA 4JQ3A 4NZFA 4LAKA 5I3JA 4ZSTA 1BYAA 3RG6A 2R91A 3LTPA 3TFCA 3WLRA 5K2ZA 4E6MA 4ACYA 4YHEA 1I0DA 1EJWC 1UWIA 1UWUA 3VIIA 4A6GA 3P84A 3DH7A 1IGWA 4O13A 3DI0A 4C6MA 4E2OA 4BQ3A 3O15A 4YXGA 4WY0A 4B5WA 2VO5A 2D0GA 3ZWSA 2E8ZA 4PMJA 4W7UA 5EBAA 3TONA 2X1TA 5E6YA 1PIFA 4IUOA 1WZLA 4DNMA 1ENUA 3OQ8A 2A2IA 1ZCOA 4ML9A 1UBPC 2DSVA 3NWRA 3CK5A 3LA4A 3M0XA 3QLDA 3LQLA 4PMUA 4GVGA 1WCGA 3CZKA 1UCWA 1E1CB 2Z1WA 1R3QA 2AL2B 1W1IE 3PBVA 2Y8VA 1JZ4A 3RDKA 5MHBA 4LYPA 4O4VA 4ZSUA 3GDLA 4GUJA 1NDVA 3G1SA 5I78A 5DQPA 3BLFA 2PGFA 1K6AA 1RJQA 2OWCA 4S3CA 1FP9A 3VE7A 1CXKA 5AKQA 1GOQA 4GI8A 4B5UA 4O50A 4XWUA 3V5FA 4P2VA 3MUIA 1LDCA 1S2AA 5CPSA 2G3JA 1HKKA 3TMQA 2GK1B 1C7TA 1NOUA 5C2CA 2E9BA 2GJXA 3EBVA 4IQJA 5E6ZA 1XFBA 1XLLA 2BP1A 1HVQA 3ZT6A 3UW6A 3K5XA 3WNOA 3LY0A 4JN8A 4LWWA 4O16A 4CUCA 1M68A 1R3TA 1RR2A 1E6SM 3EMZA 3O8AA 1P0EA 4MWAA 3NQ8A 4XX6A 4JTRA 3TQVA 4UUIA 3RUBL 4BZYA 3PJXA 3SJNA 2NV9A 2X0HA 4B2DA 1KBKA 3B8WA 3HIJA 1UYQA 5HANA 1E55A 3NDOA 4WSKA 3ZJ6A 2W0UA 2O9TA 3QW4B 4C6IA 1YPXA 2I5QA 3ES7A 1ICSA 4ZR8A 2AGKA 3FW6A 2F6UA 3DFQA 1QU4A 3P74A 1T8XA 2INZA 4Q8WA 4WLCA 4QLLA 1FWDC 4Q7BA 2X7VA 4LXFA 2XH4A 4J7RA 3VNDA 4EVZA 4QAWA 3SRKA 2CFFA 2PWDA 1DTNA 1QTWA 1XISA 3GDBA 5HA7A 3UP8A 1GCYA 1GKPA 4L7ZA 4EXBA 3UCCA 1OFOA 4MDPA 4HGXA 1EX5A 2RAGA 4K68A 3UJRA 5M1TA 3L2LA 5DCBA 4OT7A 1PZ3A 3LZ5A 4XZLX 3SADA 4GQBA 1WKEA 1WX0A 5I3GA 5CGMA 4S3KA 3BGAA 3S1XA 4FS9A 1UZDA 5AYZA 1UWSA 3OQEA 5LA1A 1PHWA 4J35A 4RE3A 4YTTA 4TTUA 2G3IA 2YXOA 5DBUA 5AYIA 1ECEA 2BLEA 2PDYA 2YBUA 1YDYA 2YA0A 4UR9A 4RXFA 4LV4A 3ABQA 5FF3A 3DYPA 3K46A 3ONBA 2OZ8A 3M7SA 2PZNA 2WKGA 1XS2A 4YTQA 1GYMA 3HURA 7ODCA 4HJWA 3A22A 5PTDA 4PGLA 1KCLA 3TYCA 1S3TC 1J0JA 4IXHA 3UXLA 5LHEA 1QPOA 1QFEA 5CGTA 4H9ZA 1ISWA 3E6EA 4CEXC 4V28A 3VVGA 1F4AA 3RHGA 2R9RA 5HAOA 3EOLA 4ATDA 4BQ5A 2ZVRA 3AU2A 1K03A 1XSIA 2J88A 3H54A 4QE4A 5AZ0A 4Z2GA 1Z42A 4H9VA 3UETA 2G0WA 5TQLA 2PWFA 1FHUA 1LUCA 1OEPA 2ZXBA 4I3GA 4UQDA 4HSOA 1FHLA 1B31A 2GJLA 1EOMA 2XG9A 3G24A 3GAYA 4DJED 5LNSA 2QULA 3SW6A 3AIVA 3TC3A 4U2ZA 2WMFA 3K8KA 4Y8EA 1TPUA 2Y5JA 2PUZA 3REQB 4ZTYA 4FP1A 3AYSA 2VNCA 3RM8A 1C29A 3P61A 3GHRA 4J40A 1TJ0A 4LYQA 3QY6A 2E9LA 3UWQA 1QWKA 3UG4A 1R6WA 5EYWA 1VFLA 2JEQA 1VBUA 4R9XA 1DIOA 3N04A 2E6AA 1I2NA 3GVRA 3B9AA 3SRDA 3P0XA 4FNRA 5BOEA 4FHAA 3LHVA 2AAAA 2Y7FA 4ADSA 2V5KA 3WQOA 3NO3A 3BUVA 3R1ZA 2Z1BA 2A3BA 4GWEA 3K8LA 1VCGA 4OTKA 4K6AA 5EU9A 3SCQA 1IE7C 1E6NA 3WLOA 1OT2A 4GH1A 3LM3A 2J75A 3A23A 2BOFX 2E09A 4NQ1A 4ZE4A 1GPWA 3ANVA 2WZHA 3GY1A 3TIMA 2JKPA 1EA9C 1AQMA 1TIWA 4J3WA 3VD9A 1YNPA 1R3RA 1XYMA 1UP3A 3IS4A 1CCWB 4AY1A 1QW8A 3UBPC 2Q8LA 1XGEA 4C6NA 2JGQA 4HU8A 5D9PA 3VKJA 2ZXQA 2G4JA 2WC4A 4DUOA 2Q3OA 1XFCA 1ZAIA 2WCGA 3H6OA 1WB0A 4O8AA 1FWHC 2Z6JA 4A8LA 3S2JA 1T6MA 1LL4A 3L9CA 4ZMGA 1TV8A 3QTGA 3DGBA 4Q8QA 2WJZA 3W07A 2OU4A 4C65A 1E0TA 1W2PA 4YVXA 5D09A 4LAUA 3GM8A 4IMDA 1LT8A 5K3VA 4H00A 2Z1SA 1WKFA 2YJQA 1ME8A 3MJYA 5HPCA 1TCMA 5JVLA 4XD4A 3VNIA 4BJHA 5JBDA 5M3WA 3W2LA 2HV5A 4NI3A 4MFDA 1Y65A 3RFAA 4US5D 2DSWA 3UESA 4AXNA 2NVDA 2X7WA 4KF1A 3WFAA 1GUVA 1PZ1A 1W91A 4GIAA 3WYZA 1KQZA 2J9ZA 3IUDA 3UWEA 1H49A 4JY8A 2Y61A 4Q8NA 3ZJKA 2CWNA 3CZJA 3K4DA 5G2IA 4Z1AA 3DYMA 2O0TA 3VILA 1IXQA 1F8IA 2PLMA 1HJUA 3UG5A 1SW7A 4CD4A 1L6GA 3FV9A 3KE0A 3SUWA 1J2BA 5LA2A 4LOCA 2VC7A 3L4TA 3UVIA 5F7UA 2X0YA 3KL3A 3EMCA 4NSBA 2BSLA 1JYVA 1GZ1A 1K9EA 2A7RA 6ENLA 3VDHA 3EDJA 1O1HA 5FAGA 4WQ6A 2ACRA 3T4CA 4KFNA 1A49A 1F76A 1V0LA 4M7SA 3LGGA 3B06A 1AH4A 2GLKA 1JJKA 1EDGA 2ACUA 4XZ9A 1XLJA 2BHYA 5E0CA 2XSXA 3CPRA 4EOUA 2P88A 3ME3A 3L4WA 1QI0A 2ZQ0A 4IPNB 3U4FA 5AZ1A 3VKAA 1LWJA 5EKYA 3ZLHA 3WEMA 3EX2A 1XGDA 4ECLA 1EH9A 1W17A 3RAOA 1H63A 2ISFA 3C5QA 1B9BA 2HPIA 2QV5A 5TAOA 3ICJA 4YN5A 3KBVA 1MEWA 4J3UA 1H7RA 3RX3A 1I2RA 1US2A 1GJUA 1OABA 1RJRA 4LS1A 3ZM8A 1YKWA 3OB8A 5JIPA 2FH8A 1DXEA 2PGRA 5FAJA 3EOOA 5BOOA 1DL3A 3OJGA 4FNSA 4IH3A 2DT3A 3GHUA 5I5RA 2ZZ1A 1VBGA 1G0CA 2EBNA 2YXGA 2WO5A 4JX5A 4Z1CA 4QX4A 4L65A 3HV8A 2JK2A 4UXDA 4UFJA 1A0EA 3LV6A 2J7FA 5FJTA 2OKOA 1MNZA 5A6MA 2X30A 5FL0A 3FX4A 4X2PA 4JTGA 2X05A 7REQA 2HS6A 4ACZB 4AX6A 3CNYA 1CECA 1E72M 1ZQ5A 3OZOA 3DHPA 4QG6A 1TTPA 1ZHAA 1YDOA 4OHQA 2XFWA 1QXLA 5CQ1A 3M0IA 1K02A 1RY0A 4O1BA 2YDRA 4H6QA 3C52A 4ZOEA 4HMDA 4H9XA 3PN8A 2Y6ZA 2HVMA 4MWAC 4DEFA 4WJEA 3PNUA 5H6HA 4Q4MA 2OMAA 5DXYA 3O05A 4DBWA 2EPMX 1XIBA 3EZ4A 4CNNA 3RLUA 3UY7A 3VZZA 1TZ7A 5D38A 3BVJA 1VBHA 1J79A 1AD1A 4MUZA 3D46A 4DUVA 3DHDA 4L56A 3QGVA 2VP8A 2QUVA 5C2GA 4GC4A 4AWUA 1XGZA 4ZEPA 3DFNA 2Y62A 2W66A 4AQLA 4M51A 2JKEA 2B0MA 3DHFA 2AKMA 2G96A 3W6LA 2BBFA 3S6DA 1LYXA 3CMGA 5EMMA 1GORA 3M5YA 3SCOA 1DP0A 4IWWA 1MUCA 3W85A 1UQZA 4PBFA 3HPAA 2J79A 2FZ9A 1DOSA 4Z2IA 1X38A 3ARVA 4F0LA 3MT1A 3N2MA 2VVSA 1J6PA 1PTAA 3VMOA 3BLIA 1R87A 2ZA1A 2A3EA 4QG8A 1J10A 3LCLA 1DKWA 1MW1A 3KUMA 2WCAA 4GINA 4ZB2A 2QPUA 3BC9A 2IQDA 1JF6A 1QI2A 1EWDA 4US5A 2J62A 2E40A 4HPGA 1R2TA 2MNRA 5CSRA 1C8QA 4AHQA 1Z44A 2OWXA 1DJNA 4MB4A 4IZGA 2FVKA 3Q65A 1KBJA