2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
1AW5A 3DFNA 2Y88A 3GDLA 2CLMA 5TIMA 2GJNA 3UQNA 3VKJA 2V8ZA 2ZRXA 3UPBA 4RK8A 2DJLA 4FIRA 3V75A 5G1TA 1EWEA 4XWUA 3G1DA 7TIMA 4BK9A 3PSWA 1XFBA 3O8AA 2PURA 4FNTA 3TK7A 3PBVA 5K4ZA 4MIMA 4K37A 1GT8A 3S9YA 3DU0A 1THFD 3BW3A 5DCDA 4HPJA 1WXJA 3BW2A 4D2JA 2YYUA 5D09A 5LNWA 1XBYA 3L0KA 3GXPA 3P61A 4LVAA 3TSMA 1D3HA 2E1DA 3M5YA 3HIJA 4N9EA 6ALDA 3CTLA 1C29A 2ISVA 4K8HA 3SY5A 3W2UA 1Z48A 3W72A 2R94A 3R2GA 5LGXA 1VR6A 3HO8A 5CZJA 2HS6A 4GBUA 2YFOA 5C55A 2OT0A 2HTMA 3G1XA 4IQLA 1G67A 1Z44A 3MI6A 1WX0A 3BVJA 1TPH1 1NAL1 3MMTA 3MUXA 3TMLA 1EWDA 1SW0A 2I1OA 3MW7A 2B7OA 1XBZA 3HPZA 3S1VA 4KKXA 2QDGA 2Q3RA 3NPUA 1K03A 4FXRA 3CWOX 2JKEA 4FNRA 3TMQA 1RQHA 3ABSA 3W71A 2ISWA 4TIMA 5CGQA 3FJ6A 2G95A 3GNDA 3BK0A 1KFKA 1FDYA 1H7RA 3AJXA 1SUXA 1S5VA 5KSWA 4LS0A 3EKLA 1Z41A 3GYEA 3UXDA 3GNNA 1NF7A 4JDYA 2Z6JA 5F1UA 3QYQA 4RCXA 3G1YA 1KTCA 5K9XA 5DBUA 2H3BA 2YW3A 3C3NA 3E96A 2YYTA 5EBUA 4O10A 1OFEA 3S6DA 2X2GA 3E0IA 2PE4A 3L9CA 2CW6A 4H6KA 1IXOA 2XN2A 3UD6A 1SFLA 3IIVA 4JICA 1AW1A 4QJ1A 5F4SA 3DHFA 3OBKA 4JY8A 3CM4A 2ZZ5A 3O06A 1PCKA 3ZWTA 4UTTC 1VCVA 2ISSA 4ORIA 4RX0A 1VYSX 3WK3A 2X1RA 5K9CA 1GVSA 4JIQA 1XUZA 1EIXA 4JX4A 3KVMA 4UTWC 1HO1A 4UMBA 3S42A 2ZA3A 3NL2A 1LOQA 1XDMA 3BG9A 3EX3A 2BX7A 3A22A 1AG1O 1OHLA 3P74A 4DQWA 4FNQA 2E5BA 4P2VA 2Y7EA 4A22A 1O95A 1K8ZA 5I3HA 1GVOA 4LUJA 4LC8A 4Z0SA 4OV9A 2EGZA 5CSSA 1YTKA 1TPB1 1G4EA 4S1FA 4IXXA 3P81A 4JTFA 1SZNA 1RR2A 1OFPA 1X8FA 5DXYA 4AB4A 1MEHA 3TROA 4QISA 2NZLA 4MYAA 3MYOA 4OE7A 1QWGA 1LBFA 1OX5A 3LI0A 2DZUA 3M5VA 1Z42A 5CZTA 3W07A 3SI9A 2NLIA 3A21A 2F84A 4UIOA 4B5NA 1G7VA 1TTJA 2ZDRA 3D0CA 4UFMA 2B0MA 1B3OA 2WQPA 3P5ZA 2LLEA 4S2BA 4YCOA 3NM1A 4Q4KA 4LV9A 4UTTA 4DO4A 2YSWA 4QQ3A 3HBLA 4HPXA 4WY0B 1SFJA 2CLEA 1OABA 4BI7A 3ABOA 2H90A 3QF0A 1X7FA 4Q33A 1L9WA 3VNDA 2QF7A 3HGRA 5CZSA 1QPQA 3T7VA 1WDWA 4UFJA 3W22A 5AHEA 4CQ8A 3Q2DA 3O6DA 1HUVA 3A9IA 2A7NA 2Y85A 1LRTA 2NUYA 3DAQA 2E68A 3GDTA 1TPUA 4UFIA 3TNOA 2XFWA 4FX6M 3W1AA 3I7SA 3U2OA 4HSNA 4IMCA 1SO6A 5D30A 4FNSA 3TQVA 3V1PA 1Y0EA 1NVMA 3HPSA 2G97A 3W7PA 1L2UA 3SECA 2OMAA 4W9TA 4MY9A 1RV8A 2ZRVA 3P5YA 1KTBA 3S1XA 1SW3A 2ZRZA 5FI8A 2TYSA 5H91A 3TXZA 2NV1A 1SW7A 3B0VC 3WK1A 3W7CA 3HG4A 3GR7A 1YTDA 3B04A 2RDUA 2C16A 5K2ZA 4O1BA 2A7PA 1R2TA 5I3IA 5K7JA 1LDCA 5G2IA 3DXIA 3M43A 4XBSA 2PC4A 4NJIA 1P0KA 1W5PA 3TW7A 1FCQA 2BTMA 1LBMA 1ZENA 1A50A 1VYPX 2YCEA 5LSMA 3PF3A 2YX0A 3TC6A 4NJGA 3ELFA 2NWRA 1K7XA 4EF9A 3G1HA 3C52A 3QQ0A 3N9SA 5HUOA 1VQTA 4UC5A 4WX2A 4DPPA 3ATZA 1SU5A 1XKYA 2DU2A 1VC4A 1TB3A 4ZZ9A 5FEPA 4K39A 3S5OA 3LHTA 5EL1A 1S5TA 2FPTA 1R2RA 2WNZA 1RQBA 1XI3A 4CLMA 2BSLA 1SSDA 1SZFA 3NL6A 4C1KA 4WY0F 2OCZA 3UWZA 4NT0A 4X22A 1JUBA 4POCA 3ZR4A 3QPZA 4FEZA 3M5XA 2ALDA 3G1SA 3K30A 1X1ZA 4MUZA 1Q6LA 4WY0A 4KFPA 3O07A 3P7YA 3DFOA 2WOQA 2O7SA 1M7OA 3CEPA 5BW6A 3NQDA 5FF3A 1Q6OA 5DELA 5CKSA 3W7QA 4XUGA 3SIZA 4QNEA 4ADUA 2PRMA 5FEWA 2QUVA 3GAYA 3THAA 5H2ZA 1H7OA 5AFDA 2AGKA 2WV8A 1QDSA 4H4IA 3I65A 1I2NA 2FTPA 1EUAA 2ZBTA 4UTLA 3L5LA 3UWUA 3GDRA 3SZ8A 5HUPA 3M9YA 1D9EA 3BPWA 3EX1A 3UWVA 3UYCA 4JTGA 2C3ZA 3C8FA 3MWAA 2B7QA 4HT3A 5K3VA 4MY1A 3NQEA 1VS1A 5E1QA 4JYDA 3FEMA 3S1WA 4UR8A 1A53A 2OT1A 3LCWA 1W56A 3WK2A 2ZTKA 3CPRA 2NV2A 1N8FA 3LTSA 3IIOA 3W74A 4CNOA 2WJZA 4FHAA 3W9ZA 3WK0A 3I68A 3HG3A 1OVDA 3TAKA 3L0GA 5LGZA 3CWNA 3SR7A 3GX9A 3KRSA 2X1SA 3TW6A 3CHVA 3I7QA 4JIPA 5IM51 3QC3A 1ALDA 4KWVA 1GJPA 2JKAA 2OZ0A 4LV4A 4O13A 3W1QA 3DHDA 4P61A 3HG2A 4DELA 1LLZA 1I2QA 3STGA 2WSQA 1JR1A 4JDBA 1L6YA 4CNPA 2C6QA 3EWBX 3M47A 2A0NA 1KBJA 4WJEA 1OFRA 1P5BA 3THQA 4JEQA 1W5QA 2QDHA 4RZ5A 3DFPA 5CZ0A 4M6VA 1JUEA 1OFAA 1A5AA 3NXFA 3Q37A 4OU1A 4LRTA 2BZNA 3TXVA 2A2IA 1I2OA 1TPC1 2V2CA 1TMHA 1KM6A 1TJPA 5TBOA 4QAIA 4LTSA 4O57A 3P84A 3NQGA 1RZMA 3FS2A 3GXNA 3VE9A 4QIUA 5T26A 2Z0IA 1H7WA 4MFEA 4NZJA 2RH9A 1K8XA 3I7RA 1UCWA 4FNUA 3WJWA 4I7UA 1LM1A 3L21A 4UR7A 1Q6QA 4N6FA 2FB3A 1TIMA 3HJZA 4ZL1A 5G4EA 4Y96A 1BKSA 4O28A 4LVBA 4MZ8A 5GVJA 2WNQA 1WYIA 3C2VA 1IIHA 3L68A 3NM3A 1AMKA 1UB3A 3VCRA 1FUYA 1FX6A 1RQEA 1H7PA 1YPFA 1TCDA 2C15A 5DY3A 4LWWA 3W1LA 3M6YA 4GNJA 1TREA 3N73A 3WFAA 1YPIA 2Y70A 3LCIA 1TV5A 3G8RA 3PULA 1GVFA 4N9BA 2C13A 1OK4A 3PBYA 3LHVA 1T99A 1J4EA 1KTNA 3M0ZA 1ZHAA 4O50A 3RNDA 4JTJA 3PG8A 3LRKA 3NG3A 4WUIA 4PL2A 5FEXA 4QNWA 1GVRA 3KVKA 3L65A 1G69A 3T55A 2J24A 1G4PA 4NVTA 3W1TA 4ZQMA 2QCCA 4HNVA 5CPLA 4XKYB 4LC6A 1U83A 4M6PA 3T40A 5ABTA 3OIXA 2A85A 2O7QA 2X1UA 1T96A 3LBCA 3OA3A 4FF7A 2W79A 3LTPA 2EHHA 2ZQ0A 2VFEA 1SO4A 3GZ3A 2GQ8A 5HULA 3W7JA 2FB2A 1YTEA 4O4WA 4XZ9A 1KM2A 5D38A 1K8YA 2PCQA 4FXSA 3LLDA 4M6QA 3UZJA 4MLRA 2NX9A 3CEUA 4GUHA 2HS8A 3GXTA 5F2IA 5LNUA 5DN1A 2JGYA 2NXIA 3MBDA 5K9DA 3MYPA 2PRHA 3QW3A 3NOEA 4PEKA 4R7JA 4WD0A 1TPDA 1VH7A 4NXKA 3EWZA 1FCUA 3NQMA 2F7FA 1OX6A 3NGJA 3A23A 1JCYA 5I3FA 4FB7A 1EP2A 3N19B 3W7RA 2VFHA 2CWNA 1ME8A 1QPRA 4A3UA 3GDMA 2ZTJA 2WSRA 2A7RA 3P60A 3W7MA 4PODA 1VJIA 1H5YA 3FYPA 2EKCA 2ZZ1A 4UFHA 5U7SA 2A4AA 4JTTA 4OBTA 4AHPA 2FIQA 1JCJA 4IPJA 4CQAA 3W76A 3LRMA 3MO7A 1TPEA 3OVQA 1O5XA 5KMYA 1OFQA 3VFLA 5AHIA 1A5CA 4A2RA 1ZAJA 4WOQA 1W5MA 2ZZ6A 2ZFAA 4FX7A 4I7WA 1OF8A 2XN0A 4OT7A 4L4LA 5CSRA 3EXRA 4YCPA 1TRDA 3PSVA 4NNBA 4I9AA 3EX2A 4O0KA 4R53A 3UWWA 1FBAA 1H61A 3O15A 1QO5A 3MP5A 3E02A 3MP3A 5AN7A 3W2NA 1OX4B 4Q32A 3W1UA 1W3NA 1ZFJA 3M7WA 3NZ1A 1K7EA 4GE8A 4I7VA 1W5NA 3W86A 1QNVA 2FLIA 1JCNA 4DF2A 2DZWA 5EYWA 4TX9A 3SGUA 3BG3A 3HF3A 3AO0A 1LOLA 3WJXA 1FDJA 4A21A 2H8ZA 1YXCA 2RDWA 2Y7DA 3GKFA 1F6KA 4CQ9A 1H63A 2C0AA 1QPOA 4C1LA 3MP4A 4XQ6A 1H7XA 3G1VA 1CI1A 3DI1A 3N34A 2X1TA 1RD5A 3W88A 3RLUA 4N6EA 4WXYA 1TTPA 1OFDA 1WQ5A 3DGRA 3NPVA 2YXGA 5BMXA 1LP6A 5L9FA 2QCEA 3UZ5A 5LZLA 5I3JA 4EVZA 1LTDA 1WAUA 2ZZ2A 3CIWA 2IQTA 3W1MA 3LB0A 3TFXA 1CW2A 4HSOA 3FA5A 4A29A 4AWTA 4O53A 5HQEA 2DZVA 4HNUA 4H3DA 1EP1A 4UMCA 2Z1BA 4CCDA 5G1YA 5I3KA 3DI0A 4AAJA 1X1OA 3LXAA 5DBTA 2QEZA 3QSTA 3R12A 3DENA 5AC7A 3A5FA 3QPYA 1XBVA 4GUGA 1PVNA 4LVGA 3FOKA 5AC6A 3HOJA 3EX6A 1YDVA 3LHWA 5IBXA 3FLUA 3ABQA 4ML9A 1F05A 4N9DA 5TQLA 1B57A 1GWJA 3PM6A 2FFCA 3O63A 3S5YA 4ICNA 1DBTA 1QAPA 1UBSA 1J2WA 1M6JA 1MO0A 3H54A 1BWLA 4R33A 3G3DA 2Z6IA 2QCMA 2VC6A 3L5MA 3KFTA 2C18A 3TQKA 1AL7A 1XL9A 5D2VA 4ZVJA 1D3GA 1CX9A 1XDLA 2FDSA 2E77A 1GTEA 4JX6A 1KFEA 1K7FA 1PE1A 4K7YA 4JD4A 2XN1A 5HINA 4EWND 4JTHA 3LCGA 3EWXA 3PY2A 3L0NA 5KZEA 1QPNA 1O5KA 3B0PA 1BTMA 4UFLA 3R8RA 4ZQPA 2I14A 3G18A 4RXGA 5KINA 6TIMA 4YLWA 3CC1A 2P0OA 2YGYA 5HWNA 3O1NA 3P8JA 1OYBA 1PL9A 1XC4A 3TU9A 5J5RA 2C19A 3ABRA 2YDAA 3RMJA 1DHPA 4ADTA 3W2JA 1SQ7A 4LRSA 1VHNA 2VEKA 1F7BA 4PL1A 1XXXA 2YFNA 3R89A 3MBFA 2QJGA 1KM4A 4LS1A 3IGSA 1KV5A 2ZRWA 3L66A 3DFSA 4S2CA 4UTJA 2J9YA 1DORA 3TKFA 4UTKA 5D33A 4AWUA 3W2KA 1A5SA 2H3DA 3O16A 1GOXA 3TSBA 3TX9A 4UFKA 1FWNA 1G7UA 4DO6A 3KRZA 5AC8A 2E6DA 2VFDA 4GC4A 4AVFA 2ZA2A 1OK6A 2PRLA 4LS2A 3N2MA 4ADSA 3W7EA 5FF7A 1W54A 1VLWA 1B9BA 2CLLA 2I9EA 4IWWA 4RR4A 5U4NA 1RVGA 2NXGA 3QFEA 1N7KA 1TJRA 4AF0B 2GVJA 3NQFA 5C6MA 1YXDA 2CZ5A 2E5DA 4FO4A 2HSAA 3OVPA 4IX0A 4XTIA 4YL2A 3GR8A 4ORMA 2TMDA 4EF8A 2Y89A 2YPIA 2YR1A 4GUIA 1FXQA 3EWWA 3USBA 2DZPA 3PAJA 1VPXA 1PHWA 4HN4A 2YW4A 3WJZA 3GLCA 3W3OA 1TQJA 2GVGA 3GK0A 3JRKA 1IXPA 4GXMA 4O1AA 2GOUA 3LM7A 3VI2A 2QCFA 2VOMA 1WA3A 4AWSA 4UXDA 4JTSA 3W87A 1A5BA 2FPYA 1T0OA 1F2JA 1KM0A 5D03A 1OG0A 4NZFA 3YPIA 3M41A 1V7YA 2A6LA 2G96A 3W2MA 1GQNA 1YDNA 4O11A 2NUWA 5KZDA 4LY8A 3LRLA 5D2TA 3CQ0A 4MY8A 3TJLA 4LW7A 4O1CA 3BG5A 2H6RA 1DJQA 1KFCA 3C2RA 3NQ7A 3PBWA 1I45A 5F4XA 4L4MA 5BRBA 4NXSA 1B4EA 2QR6A 3RF9A 1VYRA 1LLWA 3MHGA 2OJPA 3P8IA 1HTIA 2NX1A 5FF2A 1W5OA 5E0KA 5D05A 1KM5A 4K36A 4MLJA 5LNRA 1ZNNA 3MI3A 5D02A 1L6WA 2VELA 2Z2UA 1GG1A 1OFBA 1S5WA 2FPVA 1LZOA 3IEBA 2ZYFA 1AW2A 1IXQA 5AB3A 3GAKA 4ALDA 3NQVA 1M7PA 5EY5A 5F2MA 1LORA 5HJLA 4UCGA 4LOCA 3P67A 3LCXA 3T44A 1W3TA 1ZY9A 4MOZA 2J27A 2C1HA 4DEFA 2ZRUA 1ZCOA 2V5BA 3E49A 3C61A 2OX1A 2CLFA 2QKFA 1JQVA 4Z08A 1EPXA 3CU2A 1W31A 5SWUA 5A8GA 1KA9F 1QCWA 5F2LA 2BWGA 4IPIA 3ZFHA 4LT9A 4ZQRA 3NAVA 5DCEA 3GDKA 1SZGA 5HWJA 5LNVA 5KZMA 3LLFA 4CNNA 3TV8A 4EIVA 2VFFA 3TDFA 2V0TA 3NQCA 4IOTA 4PH6A 5HMSA 4GFSA 4ONVA 1MEWA 3PVFA 4LUIA 3CT7A 4IMFA 5FEZA 1NEYA 4AHOA 3QSRA 5G4WA 3G1AA 1TQXA 2ZRYA 4NX0A 3G3MA 5AHNA 4RZ4A 1H1ZA 4JR5A 3F1QA 3PUDA 4UTHA 5C2XA 4GUFA 1TPWA 3G24A 4U28A 2DP3A 3PUOA 3EEGA 3W83A 3HG5A 3E12A 1C9DA 2GVLA 3Q58A 4GJ1A 2ATSA 1DQXA 1YDOA 4NJJA 1IIGA 2Q3OA 3DKJA 4YWIA 3BARA 4DO5A 3TQ0A 1YYAA 5C5YA 4TMBA 4M5PA 4RKAA 1Q6RA 1W0MA 3KVLA 3W75A 1EP3A 3C0JA 3NQ8A 3KHJA 1HO4A 1I2PA 4IUOA 1PCWA 4JYFA 5DLCA 3NQAA 1VLIA 2WNNA 4AHQA 4OGZA 4NX5A 3W85A 1LRNA 3PR2A 4WQ6A 5LNSA 1X6UA 2CZDA 4J9JA 4M7SA 2VFGA 2RHGA 2NX3A 4MZ1A 2CLKA 5AHMA 4Z1BA 2VEIA 2D73A 2QJHA 2BLEA 4QITA 3W7HA 1GG0A 1ME7A 3HMJG 3DKLA 4YMZA 5D37A 3B06A 3F03K 2AAMA 4HNNA 3W7IA 2CFFA 3TCEA 5I3GA 1JCXA 3FJLA 1DVJA 2V9DA 4OV4A 3QM3A 1AL8A 1LCOA 3QRHA 4O17A 1KFLA 1GYLA 1R2SA 1KBIA 2DZSA 2QAPA 3MI2A 2DZXA 4O54A 3ATYA 3O05A 4FX8A 5G2WA 1JUKA 4MFDA 5G2HA 4BR1A 4O8RA 1UASA 1FDZA 3OEXA 2CLIA 5EMUA 4JTKA 2RDTA 2GUUA 3HB9A 4ZQNA 3W7GA 1R30A 4KWWA 3W84A 2J6XA 1GYNA 1SPQA 4O15A 3NYZA 1ME9A 1NFBA 5FF0A 3U8GA 4G1KA 4AEOA 2JK2A 4E2DA 5L6UA 2V5LA 4CCCA 2TSYA 3LX9A 1OFOA 1KLYA 3NNTA 4ZMGA 3GIYA 1JJKA 4ZQCA 4A2SA 4WZHA 1EEPA 4LNYA 4BWLA 1FCVA 3IIZA 1YLVA 4RJEA 3NVTA 5CPMA 4BFAA 3C2OA 3G1FA 4JN6A 2VFIA 1EA0A 3W7LA 2ABBA 3OHIA 3RK8A 3U6WA 4XTDA 4FIQA 4N02A 4Z0JA 3KAOA 1ZALA 4PFMA 1SZEA 5F4WA 2Q8ZA 3W6YA 1LOSA 3E9AA 1JULA 1W37A 1TV7A 1R47A 1MZHA 3C6CA 4X3ZA 1MEIA 3CB8A 4MJMA 3VE7A 5EPDA 1ONRA 3IV3A 5DY2A 1P4CA 3W1PA 1ADOA 2EPHA 1FXPA 2WSYA 1FWSA 1K02A 4RLIA 3OVRA 2ZCGA 2ZZ7A 5AYZA 2E5CA 3LV5A 1GVQA 4DF0A 4BI6A 1PV8A 5CPOA 4MPQA 3SW6A 4XKYA 5DCBA 5IBXC 4TU1A 2Y7GA 5CPNA 2W6RA 2ABAA 1RPXA 1TTIA 3BLEA 4TO8A 3BGJA 1ZAHA 4OQVA 3LXBA 1Q45A 1O4UA 1O94A 4LVFA 2QUUA 2A1YA 1XBXA 1ZJIA 1WOBA 1MSSA 3C2EA 3B0UX 4O1DA 3M44A 4WOZA 2Y62A 4AXKA 5HWMA 1VRDA 4UTUA 2B7PA 3MHUA 1I2RA 4MKNA 4NUWA 3IIXA 4U4MA 3KXQA 2QUTA 3UY8A 2V2DA 1C8VA 2A5HA 3EWYA 4QM1A 1PHQA 5AHFA 1KV8A 1LRQA 3TH6A 1FWWA 4GRSA 1LROA 5C54A 3PWAA 1U5JA 4M19A 3TC7A 2R8WA 4KFNA 4IMDA 3NL5A 3UWQA 5D2XA 1TRIA 1F73A 5HNRA 2CZFA 5A5WA 3S5NA 4Z1CA 1QR7A 2CU0A 4Y9AA 1VHCA 4NNCA 1P0NA 1G6CA 1VZWA 2YZRA 4ZQOA 3LCHA 2GJLA 3BLIA 4JTEA 1WBHA 3M16A 1JRCA 1JQXA 5LHEA 2NXHA 3QMSA 3HGSA 3PG9A 3QMTA 2V81A 1I8JA 3GB6A 3L5AA 1DV7A 1GZGA 2EF9A 5F1VA 3UXAA 1LYXA 4FNPA 3PB2A 1H60A 3G0SA 1F5ZA 3IGXA 1F76A 5J5DA 5KTLA 3W7NA 2A6NA 4IJBA 1T8XA 3QMRA 4MJZA 1PIIA 4UTWA 3T78A 2TPSA 4K8EA 5D32A 4O0ZA 4O12A 3FIGA 3NQ2A 1DQWA 3DBPA 3CIXA 3LHZA 1WBJA 3B8DA 1OX4A 4AH7A 1JCMP 4RV8A 3ZS4A 2Y63A 2TRSA 2E09A 3SSJA 2H8XA 3HQ1A 4NJKA 3G22A 1UUOA 4AMAA 3ZWSA 2R91A 2UV8G 1WV2A 3FKKA 4QSHA 3LCLA 4E2BA 3WJSA 3N14A 1G4SA 4Z1DA 5KITA 1WOAA 4E0CA 4UNKA 3NPWA 3HPXA 1F74A 4K6AA 1W3IA 3B4UA 2B7NA 4MYXA 4GUJA 3EXSA 1Q3NA 4CCEA 1TYGA 4HIBA 1P1XA 3QW4B 4DF1A 2JKPA 4DBEA 3M5ZA 3IVUA 2CLHA 2JBMA 3QQ1A 1KFJA 3KX6A 3P62A 4UNLA 1SO3A 2J9XA 3LHUA 3C4UA 4O4VA 1TV8A 1IXNA 5BNKA 3IGUA 4TMCA 2J88A 3N9RA 4O19A 4M7TA 1SR9A 1JCLA 4IX2A 3H53A 2E6YA 3M1ZA 4O14A 2HMCA 3IIPA 1B4KA 5LHFA 4HHPA 1AK5A 1QMLA 3NO5A 1F6PA 4IMEA 2RKXA 3EXTA 3LOTA 3W1RA 4NU7A 5MHBA 3BV4A 4DPQA 5CG7A 3DH7A 3BGGA 3TJXA 5G5IA 5D2WA 4XBKA 3LERA 1TO3A 3FFSA 4JXCA 3MHFA 4MZYA 3SJ3A 2E6AA 2FQIA 1BEUA 4PC8A 1XCFA 3LV6A 3KVJA 2B4GA 1HG3A 4UTIA 3I6RA 3TIMA 3P82A 3G0XA 3RLVA 3N2XA 2NWSA 2P1FA 4OWGA 3Q94A 5AYXA 3W73A 1ICPA 3NEVA 2WPBA 2P10A 4DBDA 4RXFA 4O52A 1QOPA 3H55A 4N4PA 1IGSA 3LI1A 4YXGA 1QO2A 1ZAIA 2A21A 3R5EA 1W1ZA 4E38A 4DXVA 2QCDB 1DOSA 3BO9A 4PA8A 4O16A 2KZHA 3A24A 2Q8LA 3UY7A 3W7DA 4EOUA 5LKYA 3W1NA 3W23A 3LXCA 1VGAA 3IVTA 1TPFA 2QCGA 3GKAA 3S8HA 4HNTA 4JYEA 1KFBA 1GEQA 1SO5A 3QH2A 2GPTA 1FY6A 4LVDA 2QJIA 2X16A 3UWYA 4X9SA 2J9ZA 3SGZA 3N3MA 5DXXA 2FJKA 4WXZA 4NQ1A 2BXVA 1FWRA 4LU0A 1TTQA 3JR2A 4IXHA 3PUEA 1S3HA 3R13A 4IMGA 3B05A 4JS3A 3S0CA 1KW1A 3TE9A 1M5WA 3O6CA 4K38A 5EKYA 2R14A 1DL3A 3UPWA 5D2YA 2QCNA 2DZTA 3PB0A 4JY9A 3PBUA 1H62A 2Y6ZA 4RZ6A 3F4WA 2VEMA 1FWTA 3STFA 4BI5A 1DJNA 2QCHA 3TUUA 1HL2A 3NDOA 3LCFA 4JX5A 3MJYA 3O6YX 1H7NA 1JRBA 3LHYA 1H50A 1KLZA 1LBLA 1OF6A 3NA8A 3QZEA 4UTMA 1OYAA 5BOOA 5HR6A 2V2HA 1XM3A 2GQAA 3TFCA 3FKRA 3W70A 1KM1A 1W8SA 3RU6A 4NJHA 3EX4A 3HGJA 3S1UA 3L2IA 3W1XA 3DFQA 2WO5A 4JGDA 3OG3A 1E51A 2ZZ4A 1ML1A 2DJXA 3PC0A 4Y6GA 3G0UA 3GVGA 3LDVA 3W7KA 3ANYA 3A5VA 3CLMA 3NZRA 2ATMA 3W2LA 3BLFA 3HGOA 2QCLA 3IRDA 3UNDA 1G4TA 1KM3A 1FCBA 4O18A 2VEPA 3C2FA 4NNAA 1UUMA 2X30A 5K4XA 2CZEA 1N55A 4AF0A 4TR9A 1DKWA 2ZA1A 4MVAA 3P80A 1ICSA 1MXSA 1ICQA 2Y61A 4Z1AA 1FQ0A 3NL3A 3LGEA 1SSGA 5D04C 2E6FA 5AYYA 4PCFA 2GQ9A 3C56A 1HFBA 5AHLA 5E93A 3L67A 1OJXA 4JTUA 1EB3A 3STEA 5FESA 2QCDA 1H51A 3NPXA 3IVSA 3LTYA 1EUNA 1O60A 3PS7A 2DORA 2W0UA 3SFKA 2VKZG 3BW4A 3FYOA 2G5WA 4UMAA 2VENA 3INPA 3T4CA 1VCGA 1XUUA 2VXNA 1BWKA 1NSJA 3W7OA 2AQWA 3KOFA 3EB2A 1I4NA 1UJPA 2NUXA 1JVNA 1EX5A 1VCFA 1J5TA 3DFTA 1QOQA 4UUIA 3TA6A 3TAOA 3RFAA 1YADA 3F4NA 1K3UA 4Y8FA 3TR2A 2C14A 1L6SA 1V5XA 2JGQA 2QAFA 2V82A 5BMWA 2Y7FA 3STCA 3DZ1A 4BF9A 1TSIA 2CLOA 1IF2A 3G8EA 4KFOA 8TIMA 5AOUA 3NR0A 3QEZA 1TPVA 4K7VA 3KRUA 5F2GA 3QJAA 4X2RA 3JS3A 2V30A 1YXYA 5FF4A 3WJYA 1OYCA 1PS9A 1R46A 5HR7A 1GTHA 4N2YA 2ZZ3A 4JTLA 2WKJA 4JNMA 4R34A 4N9CA 4BWLC 3B03A 2EAWA 3EKZA 1GPWA 3NQ6A 4HKPA 4OHQA 3LBMA 4Y90A 4N4QA 4PTNA 1QFEA 3EWUA 4GWEA 2RFGA 1H1YA 1NF0A 4IGHA 4JTIA 3S5ZA 3TSDA 5EA9A
chains in the Genus database with same CATH superfamily
4ZO7A 1AW5A 3WLHA 3IUHA 4Q4PA 4NL1A 3VKJA 1DXEA 2ZC8A 3HJEA 3TA9A 4FIRA 5CJ5A 4QG8A 3THCA 4AWEA 2DH3A 4ZTYA 3O8AA 4V2XA 3FCPA 5EFFA 3TK7A 1EC9A 3NGFA 2YBTA 3BLOA 3ALGA 1XWYA 5DCDA 4HPJA 3KWSA 2Y2WA 1L0PA 1XBYA 5A6TC 3GXPA 4LVAA 2HWGA 4CUCA 1D3HA 4XZNX 2OELA 3I3EA 4HZ8A 1C29A 1HT6A 1P6BA 1XSJA 3W72A 3R2GA 1VR6A 4M1RA 5CZJA 2WHJA 2OT0A 1RA0A 2J75A 2QUNA 1EWDA 1FWEC 4JQAA 1WKFA 3K1DA 5I06A 1XLKA 4E4UA 1RK6A 2HVMA 4GQRA 2OWWA 4H6QA 3EDFA 3T8QA 3DC0A 1K03A 1UH4A 3CWOX 3LA4A 4FNRA 3W71A 5B7YA 2ISWA 4TIMA 1OC6A 5CGQA 3FJ6A 2G95A 3NZGA 1VFLA 3GNDA 1KFKA 1FDYA 5I3DA 2NSXA 4RUBA 2I5IA 1S5VA 4LS0A 5EMLA 1NF7A 3VIIA 2Z6JA 1PZ2A 5G1MA 1E55A 5HJYA 3G1YA 5K9XA 3VFCA 1LL4A 4Q3MA 3RO8A 5EBUA 4N42A 5LYRA 2PE4A 3L9CA 3T8LA 3HU7A 3IIVA 2VO5A 1PJ9A 2PA6A 3DHFA 2V5KA 4JY8A 1AODA 3CM4A 1PCKA 3EA3A 2CC0A 1VCVA 4UTTC 4ORIA 4PTWA 4RX0A 1VYSX 4MF4A 2X1RA 2R1NA 1B3VA 1QNRA 2Q02A 3CL6A 3QFWA 4G1NA 2BX7A 2Y7EA 4A22A 3DFHA 5JBFA 5CJNA 4UBPC 2EGZA 1DEDA 5CSSA 4D6FA 2PDLA 1HJXA 1G4EA 4S1FA 2ZX6A 1KGXA 1RR2A 1OFPA 3FDKA 4QISA 4E8DA 1B90A 3MYOA 1OX5A 4D6JA 4K8GA 2WZTA 1Z42A 3BMVA 3TC3A 3W07A 4B5NA 2ZDRA 1FH7A 3D0CA 5FSDC 4JFTA 1R87A 3RAOA 2B0MA 3P5ZA 4YCOA 3RLHA 4LV9A 3HFYA 4KS0A 3QTGA 2YSWA 4QQ3A 2DQXA 4J3WA 3K4DA 1O1ZA 3OP2A 2E7FA 1V02E 3CZEA 2HRWA 2OWXA 3HGRA 3SUUA 2CZVA 2FZDA 1X38A 1ZGDA 3A9IA 3A47A 2A7NA 1T41A 1XGDA 2NUYA 4C91A 2E68A 1UJQA 2XFWA 3W1AA 1EDGA 2BVDA 4OOUA 3U2OA 4HSNA 5D30A 1SO6A 1R9XA 3TQVA 1Q66A 2G97A 1L2UA 3KBNA 2ZRVA 2YLLA 3BCDA 2NT0A 1IT7A 2ZRZA 4M51A 1QHPA 1QT1A 1POKA 3MY9A 1PIGA 2PLKA 1B0IA 3WK1A 3HG4A 1GOIA 1YTDA 1UP2A 1F8IA 4ENLA 5IFPA 4PMUA 2E9BA 3LMYA 3K8MA 2OOFA 3E0FA 1R9ZA 1FCQA 2J62A 1JZ8A 1ZENA 5LSMA 3PF3A 2DIKA 4NJGA 2DSWA 4EF9A 1EL3A 3QQ0A 4F0MA 4V27A 4CKQA 3N9SA 2PD9A 3A12A 4WX2A 3ATZA 1XKYA 3VKKA 1CGVA 1FKWA 1TB3A 1ISVA 3FA3A 5FEPA 2ASHA 5BXSA 4FOJA 1NELA 2WNZA 1EGVA 4E3TA 3VDAA 1SSDA 4GO8A 1ISYA 3W4RA 3TJIA 4Q8OA 2VD9A 1S2AA 1PAMA 4POCA 3ZR4A 3QPZA 4LBSA 2A3CA 4S3DA 1VIZA 1V51A 1OINA 4FEZA 3M5XA 2Z1KA 4J3XA 2OR2A 3NURA 2IUZA 4LANA 1HXJA 4XD6A 4MUZA 2Y24A 4DM2A 1JF5A 4WY0A 1M53A 4JTQA 4AIBA 2WOQA 1M7OA 3NQDA 5FF3A 1Q6OA 4DWSD 3K4WA 3SIZA 1PKYA 4LY4A 4QNEA 2PRMA 4ADUA 3GAYA 3CL7A 3PANA 5H2ZA 5AFDA 2YKKA 2ZADA 1OGGA 1V02A 1QDSA 3I65A 4IL2A 1VENA 4I9MA 4PMRA 4HA4A 5A6BD 2VZUA 3EX1A 4IQEA 1A49A 2G50A 4JAWA 5BZAA 3MWAA 1QU4A 5E1QA 4JYDA 3S46A 5FJPA 1A53A 2OT1A 4JKLA 2ZTKA 1CECA 1TJ0A 2NV2A 3CPRA 2V38A 4CD5A 1R9YA 5C70A 2WJZA 1OCJA 4AX6A 1OIFA 1W9BM 1NY1A 3HG3A 4C6DA 5CGMA 4LAOA 3GX9A 5HATA 1R86A 5C7VA 5IM51 2JEPA 3CL8A 4KWVA 2NQ5A 2OZ0A 2XUCA 3W1QA 3DHDA 3HG2A 2CBJA 3SFWA 4JDBA 1L6YA 2C6QA 4M82A 1WDQA 1KBJA 3SBFA 3AIRA 9RUBA 1X96A 2Z1XA 3DFPA 3QLDA 5CZ0A 1TMLA 1MRQA 1JUEA 4CVWA 1HKIA 4XZIA 1UH2A 3TYDA 5B80A 4OU1A 2VD8A 3HV9A 2WM1A 2XVGA 1UMYA 2PU1A 1EKOA 1SFTA 2WJFA 1W6TA 1EIBA 1FVPA 3KRBA 5TBOA 1CENA 4CU8A 3ZVHB 2VCAA 3P84A 4DJEA 3NQGA 3VE9A 1CBGA 4QIUA 3AFBA 1H5VA 4DY1A 1HIZA 3T0AA 2YA0A 1K8XA 3I7RA 4FNUA 1E4MM 2GGHA 1Q6QA 4C6PA 2FB3A 1TWDA 1M7JA 1XH0A 4YTTA 1V7AA 1W1A1 4Y96A 4O28A 3APYA 2VTFA 2WVSA 4H19A 3BDKA 4MZ8A 3LENA 3C2VA 1IIHA 3NM3A 2X2YA 1CB2A 3UZXA 1QATA 1TCDA 3UJSA 4HHHA 2EPOA 2YBUA 2XYLA 4KIEA 1TV5A 1CLKA 4N9BA 4L56A 3PBYA 3AXKA 1XIGA 1T99A 2HBXA 3UCQA 1ZP3A 4ZTXA 1ZHAA 2W3ZA 3RRXA 3URAA 3W1TA 3TR9A 4B3ZA 4NZCA 1GYMA 4IG2A 5CPLA 4JIIX 4XKYB 1U83A 1TJ1A 5ABTA 3OIXA 2DDXA 3MV11 1AJZA 3GG0A 1EYWA 1V0KA 3MT1A 1V6TA 3QXBA 3V0SA 1W1VA 4PRWA 5FACA 3NXLA 2PZNA 2W62A 3GZ3A 3H12A 1CDGA 4W89A 2HPMA 5HULA 3W7JA 2FB2A 2YL8A 3T9PA 1K8YA 1Z6KA 4IISA 2PCQA 4FXSA 1RJRA 4D6IA 3KP0A 1WE5A 2IKIA 3F5KA 4M6QA 4OFCA 3GXTA 4F48A 5F2IA 3H2EA 3POCA 3WH9A 2ESCA 3MBDA 3MYPA 3AISA 2PRHA 3QW3A 4S3JA 4R7JA 1TPDA 1VH7A 4NXKA 1V3IA 2F7FA 3FAWA 3A23A 4G6CA 5I3FA 4FB7A 3AXXA 3N19B 1ME8A 2W67A 2OLAA 3TYAA 4FK9A 1UD8A 4S3CA 4AIUA 3GO2A 2A7RA 4TVCA 1WPCA 1U1UA 4W5UA 3VNYA 1UR8A 1VJIA 5JVLA 4ZCWA 4UFHA 2ANUA 2VUYA 1EOKA 3WIJA 4AHPA 3CUZA 1IZJA 1JCJA 3WENA 3ZR6A 3RDKA 1UIPA 2WJEA 1O5XA 1A5CA 4A2RA 3U3HA 1RCQA 1YQ2A 2FH6A 1TX2A 2WMIA 2ZFAA 4CVUA 4FXJA 4RNJA 4FX7A 4I7WA 2QVNA 5HNTA 5EMYA 2WAGA 3PSVA 3UZWA 1JF6A 3BC9A 4I9AA 3RHGA 5GQBA 3UWWA 2FH8A 1EF2A 1GONA 1F3EA 2HEJA 1TZZA 4G8TA 4Q6JA 1ZFJA 3M7WA 1K7EA 3DX5A 3U2CA 1HJWA 1SJCA 2J7EA 3V3WA 5EYWA 1XLFA 3B9OA 3SGUA 3B9EA 2CERA 4JQ4A 1FDJA 1K9EA 1HKMA 1F6KA 1S39A 1H63A 4GYFA 3K4AA 3BOFA 1MRAA 1AH4A 2C0AA 1QPOA 3B0YA 2VR2A 5HA7A 3MP4A 1PWMA 3G1VA 2WMJA 1CI1A 3VIGA 4XIAA 5KETA 1TTPA 4H6RA 1WQ5A 3NPVA 1OCNA 1LP6A 4D8ZA 3VD3A 1VRXA 1WAUA 1WDDA 2ZZ2A 3LB0A 4PBGA 1Q8AA 4INFA 1V6VA 1ZP4A 4A29A 1U5VA 1ITCA 1GNXA 3MANA 4OOZA 1EP1A 4CD4A 2Z1BA 5G1YA 4GIEA 5G4HC 4MG4A 5I3KA 3I4KA 3ZLHA 1QPKA 4U3CA 3R12A 4GI4A 1UKTA 3B97A 2QXWA 2OQYA 5ECUA 5IBXA 4V28A 3IJ6A 1PBGA 1GW1A 3KE0A 1XLHA 3MZ2A 1DWGM 3RPDA 1VFUA 4ZBCA 5JMUA 4HN8A 3Q65A 1BWLA 5AYBA 2Z6IA 3EAUA 2VC6A 3L5MA 2PDKA 3WFZA 2PTZA 1AL7A 2P8BA 1XL9A 4IGMA 1IZKA 3MJMA 1QW7A 1XDLA 3NZQA 1AUSL 3AJ7A 3CLWA 3JW7A 3UESA 1F4AA 3WY1A 2XN1A 5HBFA 1Q65A 3UXLA 3L0NA 3F4CA 1P7TB 3WQCA 4AUBA 1BTMA 1AQFA 3AXIA 5BU9A 4J3TA 1KWKA 4JQ2A 1NDVA 1CGUA 5BXPA 2ISDA 3VGEA 1PL9A 3TU9A 2NLYA 4DM1A 3RMJA 1SJAA 1DHPA 4WKAA 3W2JA 4LRSA 1VHNA 1IT8A 2W66A 2ZUUA 1TA3B 1DJZA 4HYRA 3WF0A 1FWCC 1ODUA 1XSKA 3F4VA 2QV4A 3W2KA 4MJ4A 3KRZA 2PDIA 3OODA 3OYXA 4JNYA 3W7EA 2Z2BA 1E0WA 3S2JA 3QBUA 3UU0A 2E0PA 1E5NA 1XINA 3ARRA 1QBAA 3GC2A 3CAKA 1VFMA 2CLLA 4AU0A 2RGMA 3WCZA 2I9EA 4JHOA 4AYGA 1P6CA 1YNPA 2NXGA 4DUOA 1TJRA 1JPMA 1KCKA 4HK6A 3NCOA 5C9WA 1HKWA 1G94A 3LQLA 3CMFA 4IX0A 1C7SA 4ORMA 3FY1A 4KCVA 3DECA 4GUIA 1UG6A 1FXQA 3WQEA 5AC4A 3BCJA 1PHWA 2YW4A 3CZ8A 3GH7A 3GLCA 3RJYA 3W3OA 3FAXA 5CAKA 3NDYA 5HQLA 4DIAA 4GXMA 2GOUA 2QCFA 2VOMA 4OECA 4HYWA 4UXDA 4JTSA 4E2OA 2FPYA 1T0OA 1KM0A 5D03A 3RO6A 3YPIA 1AH3A 3GH4A 1V7YA 2A6LA 3VMNA 4XVEA 4O11A 1PDZA 3LRLA 2VM8A 2I56A 1L6GA 5BU6A 3CQ0A 3VNZA 4KWSA 1D8WA 1NIUA 3NQ7A 1HX0A 3V4BA 3T0BA 3PBWA 3IJIA 4L4MA 1HQTA 1LLWA 2PDNA 1ENUA 3KW3A 4L4OA 1XRTA 1OY0A 3CO8A 1A5UA 4HA3A 2D1ZA 2BDQA 3R6IA 5D02A 4FZIA 3QV6A 3ANVA 4M8UA 1NOFA 3RR1A 1EJVC 4WSKA 3CASA 3KOYA 1T5AA 5FAGA 1AW2A 1MW0A 3GAKA 2INEA 1M7PA 5EY5A 1LORA 2PWGA 3LCXA 3CNYA 4AIOA 3KLLA 2C1HA 3VMOA 4MTVA 3SCOA 3KOXA 2V5BA 5HANA 2OX1A 3BOLA 3ZM8A 1JQVA 1PWLA 4AD0A 2P50A 5A8GA 4NSBA 1TV3A 3RCNA 4IPIA 3D6NA 4LT9A 2NQZA 3NAVA 5DCEA 5LNVA 3STPA 2VEGA 1WZKA 4JL1A 1V6YA 7TAAA 1WZLA 3MTWA 2R1LA 3NQCA 4MB4A 5HMSA 1S46A 1HGYA 2KAUC 1R7OA 1MXDA 5FEZA 1R5YA 1GQLA 4DJDC 5CG0A 1ECQA 3CBWA 3IRSA 3R79A 2PD5A 1A80A 3CS2A 2DSUA 4RZ4A 1H1ZA 1RJQA 3F1QA 2D0GA 2XH2A 4GUFA 4C7FA 2DP3A 3PUOA 3EWCA 3EEGA 3WDIA 1RY0A 3HG5A 1XLAA 1IIGA 1XSIA 3DKJA 2ZX8A 5BOFA 3DEQA 2WMFA 3BARA 4H9ZA 1XYBA 1UWIA 4RKAA 1Q6RA 1W0MA 4PUUA 1Z7AA 4RE0A 3OGSA 1Q6GA 1HO4A 4KH2A 4IM4A 4IUOA 4KBXA 3NQAA 4AHQA 3V1HA 2BFGA 3AYSA 5I78A 4M7SA 4LPCA 1PTGA 3SUTA 2I7GA 1X6LA 5AHMA 4L9YA 1K8CA 4UOQA 4AVNA 2V3FA 3A6OA 3HMJG 4Q7IA 5D37A 3WN6A 4JIEA 7CGTA 2AAMA 4KETA 2CFFA 3FJLA 1DVJA 2V9DA 3NDZA 3EOEA 3QM3A 2GUBA 3IPWA 4HD5A 2DZSA 2QAPA 1DHKA 3WZ0E 1I9CB 1ITXA 2DZXA 3SCTA 5CJMA 3DESA 1GVEA 4UOZA 4MFDA 2EPNA 5G2HA 4BR1A 1UASA 1FDZA 3WDRA 3ZVHA 2C91A 4QLKA 4TTUA 4ERAA 1M04A 4ZQNA 1VFFA 2Y1HA 1XKJA 2PI6A 5LIKX 4PE8A 2VX4A 3U8GA 2JK2A 2VDHA 2FMOA 1E1CB 3GVQA 1W1TA 1OFOA 1KLYA 2YL5A 1UWTA 1NDWA 3GC4A 3GIYA 2G4FA 1JYVA 2MNRA 2WNWA 4WZHA 1EEPA 5I03A 1IEQA 1K70A 3E2RA 4W8AA 1FCVA 1U1HA 1J01A 4IPLA 1REQA 3WELA 5AC5A 2ABBA 3OHIA 2ACUA 4IJRA 3H21A 1SGJA 4PFMA 2RDXA 1JL8A 3VK5A 3T0CA 3ZIZA 2W5FA 3AU2A 1DWIM 3E9AA 1JULA 4AEEA 1TV7A 1R47A 3C6CA 4KPLA 1ONRA 1P4CA 1HF6A 1ADOA 2WM0A 1FWSA 2PDBA 3ZJ7A 1K6WA 3WQFA 3WX7A 2ZCGA 2ZZ7A 5BCAA 3KM8A 2E40A 4JEJA 2QUMA 4EPDC 3ICJA 2GSEA 2PC8A 1LG2A 3W24A 3SW6A 3QLLA 4XKYA 5DCBA 2XZ9A 4KIRA 4FAMA 4TU1A 2Y7GA 5CPNA 1ZL1A 4LEFA 4HMEA 3KBMA 3TZFA 3H2AA 1QI4A 4L1XA 3LXBA 5A69A 1CXLA 2XH0A 2WC7A 1O94A 2A1YA 1ZJIA 3C2EA 2DV0A 1XYZA 1JCTA 1WXZA 2B7PA 4MKNA 3MHUA 1J0KA 1V4YA 2FGBA 4LFYA 4EANA 3KXQA 4DO7A 4G9PA 2V2DA 2FTWA 2A5HA 4QM1A 3A3HA 5AHFA 3A13A 1FWWA 3TN6A 3RM8A 1UQYA 3U7VA 2XGIA 1Z8AA 1ZJBA 3PWAA 5F7UA 3G2GA 2BHYA 1U5JA 4M19A 3TC7A 2R8WA 2J8GA 2O56A 4KFNA 5IDIA 4IMDA 5FKYA 3WNOA 4IFKB 2P0IA 3UWQA 4QLLA 2CZFA 3PN8A 1Q6DA 3R25A 4Z1CA 1QR7A 2CITA 2XISA 4Y9AA 1W17A 1P0NA 4ZQOA 4EPBC 3SADA 3M16A 1EXPA 3PG9A 3QMTA 4WRHA 4XKMA 1DV7A 1XG4A 4DZ5A 4FNPA 3R11A 4RNFA 3IGXA 5J5DA 5KTLA 2A6NA 5C9RA 3WL0A 1PXGA 4IJBA 4MJZA 2XHYA 1M1BA 3TW9A 3T78A 2TPSA 4XSLA 2OSXA 4O0ZA 4O12A 1DQWA 4QCEA 4GK8A 3LBOA 3KDOA 3LHZA 1WBJA 1JCMP 3ZS4A 3VKAA 1Q8JA 3IUDA 2TRSA 4GKTA 3VOFA 3SSJA 1TR1A 3D46A 1L8NA 1UUOA 3KL0A 2R91A 4AZHA 1A47A 3AHTA 1T7LA 1RP9A 1E73M 4E2BA 2VX7A 1CCWB 1WOAA 3REQA 4GI9A 4QROA 4K6AA 3EEZA 1Q3NA 4CCEA 4HIBA 1P1XA 4IIEA 4ZB5A 1UOKA 3ALFA 4DBEA 3OB8A 2Z7KA 3P62A 1E6PA 4UNLA 3LHUA 3NYDA 4O4VA 3WNKA 5BNKA 4UCFA 1JZ5A 3IAQA 3WD2A 1SR9A 3T0DA 3UR7A 1W3JA 3H53A 1F6YA 5C0QA 3P0XA 3VGGA 3V36A 2R9RA 4QX4A 4REQB 5REQB 3HQNA 3W38A 3EXTA 3M7SA 1E9LA 4W8LA 4C6BA 3QTPA 3TZNA 5MHBA 1VBUA 5CG7A 3LPGA 3GXIA 4XBKA 3SUWA 3EBVA 1FRBA 1TO3A 3CIVA 4JXCA 3SJ3A 2FQIA 4JFWA 4PC8A 1Q4WA 2D22A 1GGOA 1TIWA 5EMKA 1BD0A 1W8GA 3KVJA 1HG3A 4E8GA 3QGKC 3I6RA 2EBNA 3URBA 1WB0A 1Q7ZA 4NAFA 3N2XA 4OWGA 2XSAA 3AWOA 4K68A 5AYXA 3NEVA 4US5D 5C71A 3U48A 2WPBA 3N6JA 1P43A 4N4PA 3LSBA 3OG2A 4E38A 4HNLA 1GQJA 3H2NA 2QCDB 3IWPA 4B5VA 3TOYA 3PPCA 1DOSA 3BO9A 4PA8A 4O0QA 2HCVA 2KZHA 2Q8LA 1NJJA 4EOUA 3W1NA 1WDRA 3W23A 1VGAA 2QGHA 3TTYA 3S8HA 4BQ3A 2GPTA 2YXXA 3OLEA 1P7TA 2QJIA 1R38A 4YVVA 2J9ZA 3SGZA 3N3MA 4ROPA 4ZODA 5DXXA 2FJKA 3RX4A 3VNJA 1H0IA 4LU0A 2ISFA 4IXHA 1KW1A 4DN1A 4NI3A 2X0HA 4EPEC 2Q01A 4W84A 2R14A 5D2YA 4GQGA 3PBUA 4RZ6A 3F4WA 3RYSA 1DJNA 2GLKA 2QCHA 2FFIA 3LCFA 4JX5A 1TA3A 2OEMA 2RAGA 5XINA 3DG7A 3WBEA 3LHYA 2X7VA 7XIMA 2DEPA 1OF6A 3NA8A 3QZEA 4UTMA 5BOOA 5T8GA 1G0CA 3WMLA 4IIHA 4XO7A 2GQAA 2BY2A 3EDKA 2WO5A 4JGDA 1DIDA 3PC0A 2OXNA 3G0UA 3GVGA 3GBDA 4ASTA 3CLMA 3QHMA 3W2LA 3BLFA 1RPKA 2Z26A 1FCBA 4O18A 2VEPA 1W3HA 3C2FA 4OVXA 3V0TA 1KBBA 3MCMA 2X30A 2OG9A 2XH4A 3S9IA 3NO1A 4MVAA 1MUCA 3P80A 3I6EA 1DJGA 1ICQA 1FQ0A 1X39A 3NL3A 5CLTA 2NT1A 3LLXA 2IKGA 1V6WA 3C0SA 4GHRA 1M9HA 4H41A 3RILA 3IARA 4GYJA 4GLEA 4Z17A 2AQVA 4R3UA 1XR2A 2DORA 3SFKA 1LWIA 2VKZG 3BW4A 1SR0A 3FYOA 3XIMA 1UZHA 4IMAA 4U5IA 4X60A 1BWKA 1KRCC 2NUXA 3KBWA 4YPJA 1VCFA 4HQVA 4B2DD 1J5TA 4PUWA 3TAOA 3V7PA 4KT2A 5JH1A 9XIAA 2RGLA 1VD6A 1JD9A 5DMLA 3ITTA 4DNHA 2YL6A 2CHNA 4WDUA 2JGQA 2QAFA 2V82A 1XISA 3QN3A 3OOQA 3DZ1A 1AQHA 3OU8A 3BXWA 5AOUA 1M68A 4WKFA 4P7OA 4K7VA 3MUAA 4NYYA 4ATWA 4R5EA 1YXYA 4DJFA 1GTHA 2V3GA 2WKJA 2POTA 4ZB0A 3WO8A 1WAWA 4OIFA 4ZO8A 3M0XA 1QI0A 3AHXA 1UW9A 2C1GA 2ZKMX 3S2LA 3QV9A 3BAWA 4GWEA 4JIHA 3TN3A 2RFGA 4OUIA 3WBAA 5A8PA 1JZ3A 1PYMA 1EFZA 3TSDA 5EA9A 3DFNA 2IXVA 1U5HA 3MPGA 1TWIA 3UG3A 2GJNA 2XIMA 3W28A 4HB7A 3KBVA 2V8ZA 4B5SA 2ZRXA 2AL2B 3V75A 1LWJA 1FTXA 1S5NA 2YDSA 4YN5A 5ECVA 4HTYA 2PDPA 3T81A 1UWRA 4I5RA 1MI3A 5K4ZA 4MIMA 4YTSA 3TLQA 3DU0A 4Q8WA 1W9DM 3UVIA 3BW3A 1IEVA 2GDQA 4D2JA 3VC6A 3L0KA 3P61A 5FJIA 3HIJA 5CZKA 2ISVA 3SY5A 3DERA 2X7WA 5LGXA 1EBHA 4GBUA 4IQLA 2WHKA 1Z44A 4C6LA 3MI6A 1O5QA 2DSZA 1TWWA 3CQIA 2AMXA 4XG1A 4HMDA 1OM0A 3O9NA 3DHPA 2I1OA 4WGXA 2PDWA 4H9UA 1XF0A 4DAFA 3BGAA 2W92A 2BS9A 4W7VA 1PEZA 2QDGA 1E70M 2GGIA 2DPEA 1JDDA 2JKEA 4AC7C 1RQHA 3ABSA 4RDWA 1K4GA 3WKZA 1IQ8A 4H6EA 3AJXA 1Z41A 1JDFA 5KEZA 2VNCA 5F1UA 4AZIA 3N25A 4PZVA 3NWRA 1J79A 2RJHA 3E96A 4UOJA 2YYTA 4C6QA 3S6DA 3AUJA 1Q6EA 2F2HA 4QJ1A 5F4SA 3PZNA 2Y0FA 1C92A 3O06A 4W87A 3ZWTA 4QDPA 1RA5A 1EGZA 5H6HA 2CPUA 3ONCA 4JX4A 1MQRA 4MWAB 2CHRA 1HO1A 4UMBA 3MV01 1XDMA 3NSXA 3P74A 4FNQA 4P2VA 2O55A 3CUJA 4L6OA 1O95A 5I3HA 1UP3A 1E1CA 4GY1A 4Z0SA 3PTDA 3C86A 3MA8A 2I16A 3P81A 2XZ7A 2XIJA 2OSYA 2EPKX 4WLCA 5BWFA 3NVDA 2X8RA 5DXYA 4AB4A 2BY1A 3K5XA 3TROA 4X2PA 1JZ7A 4J3UA 4HTBA 3LI0A 3M5VA 5CZTA 2NLIA 3IJ8A 4UIOA 1GOKA 1TTJA 1PKNA 3SIMA 1HKVA 2WQPA 4S2BA 2VMFA 3NM1A 4Q4KA 1QI3A 3A3XA 3HBLA 1I0DA 1LQAA 2WZEA 1SFJA 1FOBA 4BI7A 3NSMA 1NARA 5A6AA 4Q33A 2WXDM 1L9WA 2XIIA 4GABA 3GFYA 4UFJA 3W22A 4CQ8A 1Q7MA 1HW6A 4F66A 5LIWX 3WF3A 2DT2A 1HUVA 3GG7A 4BHYA 4W4QA 4C6KA 2VRQA 3BQ5A 1R3SA 4A8NA 4IMCA 3C2YA 4EK7A 2V63A 2VR4A 1YBQB 5HPOA 3HA1A 3W7PA 4LJ3A 2A3AA 4B9YA 1CXFA 4MY9A 2DW6A 1S2UA 3M0JA 5JBDA 1AD1A 4DYJA 1SW3A 4PTDA 4XBJA 1TFVA 5FI8A 5H91A 3W26A 1DE5A 1SW7A 3B8VA 1Y5WA 3B04A 4RW5A 1G01A 2A7PA 1R2TA 3AMGA 5K7JA 4EXBA 1LDCA 3P0WA 3CHEA 4MNLA 4UQBA 1K9FA 8RUCA 1NDYA 2CXGA 1W5PA 4D1IA 5IXEA 1LBMA 2KX9A 1I6NA 5FJTA 4QAWA 2VQUA 1J2BA 5EGRA 3TC6A 3ZT5A 1FWHC 4I3GA 3ELFA 4GC3A 4F9DA 1CYGA 1UMLA 3KZSA 2O92A 3BMXA 4GO9A 4IFKA 5HUOA 4UC5A 4JCLA 4DPPA 1BXBA 2X09A 3KOWA 1RLCL 3W00A 1VC4A 4E6MA 1A4LA 1TG7A 1VFSA 4NP7A 3WQPA 1BSLA 4UZUA 2ACRA 1XI3A 3D47A 3VOCA 2PODA 1R0MA 3NL6A 3CUFA 3PUGA 2OCZA 1ONEA 2CNCA 2WC4A 2OKOA 1QNOA 1ADDA 1VPQA 3ABZA 2ALDA 3G1SA 3K30A 2FZBA 1DWAM 4KRUA 2NV9A 3AZTA 2J7BA 1PPIA 3SGGA 3P7YA 1J0IA 5A6MA 5CKSA 2ZE0A 3W7QA 1A5KC 5M2FX 4TVDA 2ON3A 5FEWA 2VL4A 4H8HA 1NP0A 9XIMA 2AGKA 3S2MA 1HGWA 4H4IA 2DT1A 3CZJA 5CBBA 4QSFA 3HPFA 4H83A 3B9DA 2XTKA 2ZXDA 5HUPA 1SJBA 1D9EA 3BPWA 4QEEA 3UWVA 4QQUA 1IEIA 4MADA 3UJEA 3UYCA 4JTGA 5I07A 1XRFA 3C8FA 2B7QA 3U57A 4GVIA 4KEVA 5M5DA 5DT5A 4GI6A 3WLMA 2DZAA 4KEMA 1ZJAA 2D2GA 3WK2A 1W56A 4B4HA 1WNOA 1I75A 1QI2A 4QS5A 3VINA 1UR4A 2FTYA 2GWGA 3KBSA 3W9ZA 4DJEC 3WK0A 3I68A 3L0GA 4REQA 3SR7A 5REQA 4H2HA 1R3RA 4LB4A 3CHVA 3I7QA 4JIPA 2CWXA 4XZMX 3VYLA 3QC3A 1ALDA 1GJPA 3DYOA 5E9XA 3MB9A 1G5AA 3IK4A 2WSQA 1JR1A 2VHLA 3MWCA 4ZA0A 3EWBX 3P2VA 2A0NA 3VPLA 2NQJA 1W5QA 1IT0A 4FLRA 2J25A 4JOMA 2ADAA 4HMNA 3NXFA 2XINA 3VOHA 2JF7A 3Q37A 3UVAA 1XIIA 3R0DA 2BZNA 2P3ZA 1I2OA 1KM6A 5FJRA 2ODOA 2WYSA 3A3WA 4LTSA 4O57A 3UG5A 3WEZA 1V08A 1RZMA 5T26A 1G9HA 1H7WA 4UB9A 2HZGA 3S6TA 4QE1A 2GGEA 2QLYA 2R6OA 1LM1A 1ZBKA 2CLPA 4ZL1A 5G4EA 3F2DA 2GYIA 2Z1SA 1TWZA 4M1BA 2YDRA 2YCJA 4X63A 2WNQA 2XWEA 4IH3A 3LM3A 3WNMA 4UNIA 4LF1A 3VILA 2BOGX 1FX6A 4HCHA 1IEXA 3WYZA 1M3UA 3MS8A 5D8WA 3IJ9A 2Y8VA 3QKEA 1GPFA 2XVNA 1OBAA 3N73A 3CPGA 1UD6A 3G8RA 2C13A 1Z32X 1I0BA 1WDPA 4J2MA 1GKPA 1XLGA 3MC5A 1QHOA 3BE7A 3OZPA 1MVYA 1J4EA 4ZGYA 1KTNA 2WC3A 4QR6A 2ZUTA 3LRKA 3NG3A 4WUIA 2QF8A 4QNWA 1GVRA 3KVKA 3T55A 2J7DA 1G4PA 4D6DA 1S2VA 3SO7A 4LC6A 4M6PA 1EBGA 2X1UA 4NI8A 2POZA 3OA3A 4AVOA 4FF7A 2W79A 4C6OA 2ZQ0A 1GKRA 4PTVA 4WK9A 4G56A 2WSPA 2EPLX 3BAKA 3WQ8A 2Y8UA 1YTEA 5PTDA 4XZ9A 5GJNA 2O0TA 3WBXA 1UR3M 2VYOA 4AD5A 1RBLA 1N8WA 1J10A 1HJSA 3E2VA 3UZJA 3VGFA 4L64A 3CEUA 2YZ5A 2HS8A 5MKGA 3W0KA 2JGYA 4PMQA 4YJ5A 1W91A 3FJ4A 3NOEA 4PEKA 4ZXOA 2WLZA 7ODCA 1JPIA 3HFTA 1EP2A 2EG8A 4XX6A 6CGTA 2VFHA 4F0HA 4DVOA 3MKKA 1UROA 4QG9A 4A3UA 4XAPA 4B92A 2WSRA 5KZ6A 2GOKA 3F5LA 1X1NA 4MPKA 2ZZ1A 5U7SA 1PTDA 1EHNA 3R1ZA 1FWBC 4W8BA 5KMYA 4ZEPA 1OFQA 1QWKA 1IWPA 3SRFA 1OF8A 5JIWA 5CSRA 3EXRA 2OGYA 4MGGA 3EX2A 1AJ2A 4R53A 2HK0A 4F3HA 3AYRA 1QO5A 3MP5A 2E3ZA 3VDHA 1BYDA 4Q32A 4ZOAA 4GNVA 2GJPA 1W3NA 3NZ1A 4GE8A 4I7VA 3W86A 3N4FA 3VIMA 2VZVA 1BG4A 3N18A 5CPTA 3AIUA 3WJXA 1BQGA 4A21A 4MWAE 1YXCA 2OO6A 2WSKA 3V0UA 2Y7DA 3GKFA 3GS6A 4L5ZA 2F6UA 1KXQA 4ZR8A 4KCTA 4GKLA 2IPWA 4F0KA 1X6NA 3W88A 3RLUA 4JPGA 2PGFA 1DTNA 3C8NA 2YXGA 3GFXA 3F2BA 2O9OA 1C8YA 4XAZA 5L9FA 4GY0A 3UZ5A 5LZLA 1WZMA 3BLLA 3GH5A 1LTDA 1QW9A 3OW1A 1YEYA 3W1MA 3FA5A 3HM7A 3UW6A 4H3DA 4UMCA 4CCDA 3N11A 1NWTA 4OTKA 3LXAA 2QEZA 1FHUA 3KTCA 5A2AA 1RUSA 2G3MA 4GMEA 4Z2JA 3KTSA 2OKTA 1OT2A 5A6LA 3LHWA 3EKGA 2D2HA 4ML9A 3WQWA 1F05A 5TQLA 1B57A 1FWJC 2CESA 4QJ5B 3CYJA 2FFCA 1EO5A 2XM2A 1MNSA 3AROA 1XJBA 3TYCA 1QAPA 5I6SA 4FMVA 1MO0A 3S6OA 1OEPA 4JTDA 4S23A 5HK4A 3W6MA 1XLEA 3TNBA 4GNKB 3DCPA 4XK2A 5BRPA 4R7WA 1VBJA 1F8MA 4KCUA 1D3GA 1CX9A 5I23A 2E77A 1K7FA 1GZ1A 3ZR5A 4K7YA 4JD4A 2BY3A 1V3JA 3LCGA 2WHMA 5KZEA 2P5NA 1QPNA 2GQ3A 4UFLA 3R8RA 2I14A 4RXGA 5KINA 1CEOA 1TWSA 6TIMA 4YLWA 4LYPA 1W2VA 2RUSA 2YGYA 3KZPA 3PZQA 3SRDA 3P8JA 1XC4A 3R8HA 3CGTA 5J5RA 3O6AA 3ABRA 2YDAA 3L4XA 1SJDA 1DIEA 3WNPA 2WCGA 1SQ7A 2JF6A 2VEKA 3VC5A 4MWAA 1XXXA 2YFNA 3MBFA 4X9YA 4LS1A 4EACA 2HK1A 3MMUA 4I6VA 4S2CA 3TKFA 3AI0A 1A5SA 2H3DA 2ONEA 3O16A 3TSBA 4NZ4A 3GFZA 4GVFA 4UWMA 4DO6A 2PU0A 1JZ2A 3CV2A 5FL1A 3O7UA 4AVFA 1KNWA 4LS2A 2PRLA 2WMGA 4S3KA 3N2MA 3H23A 5C2CA 5FF7A 4J27A 1W54A 2ZWYA 1UIOA 3CK5A 3TN5A 3O3RA 4IWWA 4RR4A 5U4NA 1RVGA 3A4AA 3QFEA 5DO8A 1N7KA 3UGRA 4AF0B 2GVJA 1YXDA 1UUQA 2E5DA 4FO4A 2HSAA 1OZMA 3E6EA 2Q6ZA 3G6MA 4XZWA 2TMDA 1D8CA 3ISIX 2FJUB 3USBA 3UP8A 1JG9A 3PAJA 3H7RA 2XIQA 1VPXA 5GNYA 3UR5A 2QNEA 3WJZA 2GVGA 3N4AA 1A5NC 1NWSA 4RL3A 1IXPA 1ISXA 3NZPA 3VI2A 5A3HA 1PYFA 3CZKA 2VOTA 5EMJA 3KL5A 3W87A 1A5BA 1NOWA 4RNIA 1SYTA 4JIRA 1HNYA 4GQQA 1QTWA 4GFIA 3LGDA 4AZCB 5FOOA 1QK0A 2G96A 3CHFA 3W2MA 4IFRA 2YCLA 2NW0A 5E5CA 1YDNA 2OLSA 6PTDA 2X0YA 2IS7A 1XLJA 4MY8A 3AYVA 2WPGA 3BJSA 1DJQA 1BYBA 4HU0A 1B4EA 1XLDA 3DYMA 2PWUA 2OJPA 1OADA 2V69A 2PWEA 2NX1A 3ZLGA 5E0KA 5D05A 1KM5A 4MLJA 2OQLA 1ZNNA 3MI3A 4LUYA 1GOWA 1XH1A 3FK4A 1DXFA 3GU1A 2VELA 2E67A 2Z2UA 4IIBA 4GVGA 1GG1A 2PEVA 3WLIA 1S5WA 2ZOXA 2FPVA 4NZ3A 3S47A 3SN4A 4DX3A 4N7QA 4FR1A 1V6UA 3B3DA 1IXQA 4ALDA 3NQVA 5HJLA 5F2MA 2DW7A 4LOCA 3H26A 2HXUA 3T44A 1A3WA 1LUCB 4HPNA 5DRCA 4JTRA 1MQQA 1SMAA 2J27A 1RP8A 3BUVA 4DZIA 1K6AA 2ZRUA 5GPRA 1ZCOA 3E49A 3TYZA 3C61A 4L1GA 4RDYA 1B3YA 1AZ2A 3ZFHA 2AOSA 1E6NA 5A6SA 5KZMA 3LLFA 1UPMB 2VFFA 5HMEA 4Q4RA 1EJWC 4MM1A 4ZB2A 2DZBA 4ONVA 1EJ7L 4LUIA 4IMFA 4NY2A 1Z3NA 1GK8A 1V03A 3G1AA 1A5LC 2DGAA 5H8UA 1JDAA 1MUWA 3C0QA 5AHNA 3SCWA 3VKBA 4JR5A 3VGBA 3PUDA 4Q8NA 4ML4A 1QASA 1TPWA 1XPYA 3GVRA 4U28A 4W7UA 1F61A 3E12A 1C9DA 2GVLA 3IV8A 3Q58A 1D2KA 2ZVRA 4DWSB 1YDOA 3FYYA 3V16A 2Q3OA 3CB3A 4YWIA 3WLQA 4DO5A 3FXGA 5C5YA 4TMBA 4M5PA 4PMVA 1FHDA 3ZOAA 3VOGA 4UQDA 1EP3A 1R3WA 3C0JA 3S1GA 1I2PA 3APTA 1J6PA 3BQ6A 2HV5A 2H9AB 4GIRA 3VD9A 3PR2A 3LPPA 1HN1A 3AZSA 2CZDA 4J9JA 3GQYA 2XIBA 3ABXA 2EO7A 4J1OA 1LL7A 3MUZ1 2NX3A 2VEIA 2D73A 2QJHA 2BLEA 3W7HA 3KCOA 1GG0A 1ME7A 3HURA 1QK2A 3WH5A 3F03K 4HNNA 2Y5SA 1V0LA 3W7IA 2W9MA 2JE8A 1KXTA 4R88A 1LCOA 1XIJA 4O17A 3AXHA 1DP0A 1KQYA 4PN2A 2ZDSA 2DT0A 1LQ2A 3TWBA 4GCAA 5MF5A 3ATYA 1EC8A 3SY1A 4CNUA 1JUKA 3MUIA 2HDJA 4XSMA 4B3KA 4KWWA 2J6XA 3TTEA 1HZYA 1SPQA 4O15A 1CPUA 1ME9A 1NFBA 4AEOA 2GFTA 2PWHA 2V5LA 2TSYA 3NNTA 4TVUA 4DWDA 5CCZA 3GTFA 5ABHA 3S2CA 4HPGA 1W1YA 4A2SA 3CYVA 3U4FA 2PWDA 1RHCA 7A3HA 5FIPA 3WF2A 3GNXA 3IIZA 2VURA 3DHUA 1V79A 1YLVA 2BY0A 3WMCA 2VFIA 3DG6A 3G77A 3WEOA 4Z0JA 2VVSA 1ZALA 3H2CA 3H4GA 4QEHA 6XIAA 1Q2SA 1SZEA 3EMCA 1C9WA 1JZ6A 5DANA 2Q8ZA 3W6YA 1ISWA 1LOSA 2DIJA 3UXKA 2OWCA 3WEMA 1W37A 1MZHA 4FR6A 1P48A 1KXVA 1MEIA 3CB8A 4MJMA 4HZ7A 1L2QA 2WSYA 4Z1YA 5AYZA 4OZOA 2PDXA 4US6A 2IPGA 2YXOA 1PV8A 3E1F1 1YIXA 1J6OA 2INFA 3HN3A 4QFUA 1BVNP 2W6RA 3MDUA 1TTIA 4ACZB 3BGJA 4KQNA 4OQVA 2YA2A 2Z4GA 4BZYA 3AIWA 3PTMA 5EBAA 2AKZA 2QUUA 1WOBA 1MSSA 3LD5A 3B0UX 2BASA 3UF9A 5HWMA 4BQ4A 4UTUA 1EGMA 4NUWA 4AD1A 4Q8TA 2PBGA 4L61A 4I5XA 5JU6A 1ZZMA 2OYLA 3EOSA 5I02A 4YHEA 3IJQA 1LRQA 4XO6A 3H4WA 1SVDA 2WVUA 3DGBA 1VBRA 4LYQA 2QT3A 4WDTA 5LA2A 3NL5A 3UR8A 6REQB 5D2XA 4Q8UA 4DZHA 6A3HA 1H2JA 1H4PA 4IPPA 3MQTA 5A8MA 3CH9A 1XV8A 4NNCA 3BLDA 1G6CA 1B1YA 2GJLA 3BLIA 2G4JA 2I9UA 3ARUA 1S2CA 3HGSA 1I8JA 4D6HA 2EF9A 3KCJA 5F1VA 2PGEA 1LYXA 4CEUC 3L4ZA 1F5ZA 3QGAC 2FZMA 3R7MA 1B3WA 5LIUX 2INZA 3ITXA 1AJ0A 1NH6A 4Q7NA 5D32A 3FIGA 4P8UA 1FWDC 1C90A 4FA3A 4GGBA 2Y63A 3E2QA 2WLYA 2Y5EA 3H6OA 2H8XA 3HQ1A 4NJKA 3G22A 4Q6XA 3FKKA 2F2KA 3WJSA 1G4SA 4HU4A 5KITA 2PDCA 4UNKA 1F74A 5HMFA 2B7NA 4GUJA 1TYGA 4DF1A 4GY7A 2CLHA 3WF1A 1XYFA 3KX6A 1UPPA 2J9XA 1IEWA 1TV8A 4MJ2A 1UP0A 3BURA 4C5ZA 4DJDD 1MQPA 2MUCA 3GTXA 1WZAA 1MFUA 2E6YA 3M1ZA 4PUDA 4XD5A 2HMCA 4M29A 3USZA 1TKKA 4Z2GA 1AK5A 1QMLA 3WUBA 1W3KA 3AMKA 2VX6A 4IMEA 2RKXA 3CQJA 3RN6A 3DG3A 3EPNA 2JFEX 1L8PA 3IS4A 3APGA 4DPQA 1HL9A 1KGUA 3FNDA 4DBWA 1H0GA 4W5ZA 2J13A 2Z29A 5A95A 5CBJA 3LV6A 2PS2A 1O68A 4KEUA 1VIWA 2A3HA 4Y7EA 4HNCA 3BMWA 4EAYA 1E9YB 4X0NA 3WLJA 3RLVA 2CBVA 2P1FA 3GHUA 3Q94A 1ICPA 3CAWA 2P10A 4DBDA 4RXFA 4O52A 1QOPA 2UBPC 3XISA 1POJA 1GQIA 3M6DA 1OG6A 3R5EA 3ME3A 1XGEA 3NOYA 4LAKA 3GNOA 5H8MA 1JXKA 3FJNA 1KKOA 3PJTA 3A24A 4B16A 5LKYA 2Z1VA 1P0DA 5AVNA 4HNTA 5HAOA 1GEQA 1RALA 3QH2A 4YYCA 4LVDA 4X9SA 3W53A 1UWUA 4C7GA 3DC8A 3ZJ8A 5JUVA 1UKSA 2BXVA 2NVCA 1TR9A 4H7CA 1FWRA 3TP4A 1TTQA 1UR0A 3JR2A 4MAVA 3PUEA 1S3HA 3R13A 4IMGA 1MDLA 3S0CA 2OYMA 5EKYA 3UPWA 2QCNA 1H62A 3GZAA 4RW3A 3TUUA 2HNHA 4F2BA 5XIAA 1H7NA 3B8SA 1BTCA 9CGTA 2UWFA 3PPGA 4S3GA 3MMWA 1IWAA 1XG3A 3H2FA 3E5PA 5HR6A 2V2HA 3MKCA 1EZ2A 1PIFA 3WUGA 1XCWA 3ARSA 3EX4A 4EKJA 2QPXA 4ROQA 3OG3A 1E51A 2ZZ4A 1ML1A 1E4NA 4S38A 2R1PA 2FMNA 2VGBA 2ATMA 3NTYA 5A6JA 1G4TA 1MNZA 3N6QA 6ENLA 3M64A 4TX8A 5K4XA 2PAJA 4AF0A 4TR9A 1A0CA 4KF1A 2ZA1A 4B9ZA 3WSUA 1EDQA 2X1IA 1SSGA 4U5KA 1MZRA 5CSYA 1HFBA 3SDOA 2JQXA 3L67A 1Q6FA 4BEUA 3PJUA 1UZ1A 2AKMA 4DJFC 3H4XA 1HVXA 1A4MA 3NPXA 3TONA 2OZTA 3LTYA 3PS7A 1GQKA 1X97A 2W0UA 4V1YA 3FXYA 3U5YA 2GSJA 1TVNA 2ZC1A 3T4CA 2E9MA 1VCGA 4LXFA 1Y8BA 2VXNA 5TAOA 3B8TA 4AZCA 3UA3A 2J77A 5DEZA 4D6CA 1EX5A 4UUIA 1JAKA 1O1HA 2PP3A 3WDPP 4Y8FA 2EG6A 3TR2A 2C14A 1J93A 1E4LA 1ZS2A 4GPNA 1MFVA 1TUFA 3WLTA 2BGNE 4BF9A 1IF2A 3G8EA 4DI8A 1L6FA 4YNGA 3QEZA 5CC7A 2V5DA 4BQ2A 4X2RA 3JS3A 4BKNA 1U30A 5FF4A 3WDHA 3LS9A 1KBKA 1PS9A 1H3GA 1R46A 3VDCA 4N2YA 3W81A 4JTLA 3WQ4A 5TD4A 4R34A 3PJWA 4N9CA 3KL3A 4BWLC 4Q8PA 3SCUA 3VM7A 1E6XM 1XH2A 2Z00A 3EWUA 5EMMA 2YB4A 1NF0A 2QJMA 4IGHA 1JIBA 3E2SA 3S5ZA 4HNOA 3PWGA 2FZNA 3T07A 3TTOA 1BHGA 2BMBA 3WD1A 3UQNA 4PGLA 4PUKA 2OO0A 4I9JA 3F4DA 5CSUA 3EA2A 3MSGA 4J2PA 4RK8A 4D6GA 3QHNA 1EWEA 3AS2A 4XWUA 3KLKA 7TIMA 2PDUA 2QGYA 1W32A 1XLLA 1ZBVA 3GHSA 1XLCA 4K37A 1GT8A 4JQ1A 3JUGA 1THFD 3SSZA 1WXJA 3BW2A 3N04A 4A3QA 4I8DA 4Y9OA 5LNWA 3AHYA 4YU1A 2HVNA 4LH8A 2J7GA 1EYEA 3TSMA 3AQUA 1JI1A 1S2WA 3CTLA 4OUEA 4K8HA 4L4PA 3W2UA 1XICA 1Z48A 2R94A 3HO8A 2HS6A 4M24A 2I17A 1RAKA 2YFOA 5C55A 1GVIA 1IV8A 4HU8A 1XLMA 3G1XA 4B5XA 1HJQA 1G67A 3MUXA 3MMTA 5I0DA 3VAVA 3L7RA 1J0HA 4D72A 3W01A 3HPZA 3S1VA 4KKXA 1D7KA 4JFSA 4XZLX 3NPUA 1KRAC 2QVHA 3SQLA 2DSVA 4FXRA 5A6BA 5C9UA 4YWSA 3TMQA 2J4GA 1XX1A 3B40A 2H9AA 1LG1A 3BSHA 5KSWA 1BYAA 3EKLA 3B4YA 4NASA 4LBUA 3ZJ6A 2C0HA 3QYQA 3WNLA 1WUEA 3PZMA 4DZAA 2IMRA 4PMOA 2H3BA 1BGAA 4B4FA 3VO0A 3C3NA 3D3AA 4O10A 1OFEA 2X2GA 3E0IA 2CW6A 1IXOA 1SFLA 1AW1A 1IWBA 3N1AA 3OBKA 3QKZA 2ZZ5A 4NILA 2ISSA 3WK3A 2HJPA 1GVSA 3MSRA 2IXUA 1XUZA 1EIXA 2BXYA 2P3EA 3KVMA 1WUFA 3S42A 3WLKX 3GTHA 3BG9A 3A22A 1OHLA 1PZ1A 4DQWA 2EJAA 1K8ZA 2F6KA 1GVOA 2BOFX 3LPOA 4LUJA 4Q22A 4OV9A 1YTKA 1C8QA 3H24A 4C6NA 3NIYA 1SZNA 1E6SM 3MMDA 1X8FA 3TWAA 2Y5JA 1MEHA 1A5MC 3RX2A 3R94A 2NZLA 1LBFA 4D71A 2V67A 3K1GA 2F84A 1FH9A 2EJ1A 3ORWA 3VVGA 1G7VA 3VIHA 1ZTVA 3CHCA 3W27A 4P7LA 2LLEA 4RPPA 4MNMA 4TV5A 2ZUMA 4PBEA 1OGSA 4WY0B 3ZYZA 1OABA 1UR2A 4E3VA 3SRKA 2H90A 4H9VA 3QF0A 3KEHA 1V77A 1QPQA 1M03A 2MANA 4M56A 1JYNA 5AHEA 4DAIA 1CB7B 4L1WA 4MB3A 4QLJA 2Y85A 4LQ1A 1UKQA 3GBEA 5AZ0A 1LRTA 3ARQA 3DAQA 5M17A 1BRLB 5FJOA 1TPUA 4UFIA 3WLPA 4FX6M 1MWOA 1UOZA 2XGZA 3HPSA 1C8XA 2OMAA 4ERGA 4ACZA 3WBWA 1E5JA 3QV8A 2EPMX 2YB1A 5H8PA 2VRKA 1KTBA 3QY8A 2XPKA 3S1XA 4IIDA 1UZDA 3B0VC 1ZRQA 4H9XA 3W7CA 2ZX7A 3CHDA 3GR7A 5D9OA 3EDEA 2V6AA 4J35A 5G2IA 1DWHM 3DXIA 1Y65A 3M43A 4XBSA 4ZE5A 4O1FA 4PMXA 2TODA 4Y8EA 4PFHA 2BVYA 1NM9A 2BTMA 2YIHA 1A50A 1VYPX 3OLIA 3URQA 2Q09A 3EDDA 3G1HA 2D24A 3FSUA 1ONXA 3FHQA 1VQTA 1V6XA 6REQA 3CMGA 1XIHA 2DU2A 1FP8A 4TUFA 4ZZ9A 1FHVA 4K39A 4I90A 4IL0A 1E9IA 1S5TA 1DJXA 3AU6A 4LYKA 2PUZA 3VM5A 1RQBA 4XV0A 4CLMA 2BSLA 1R7AA 4C1KA 4WY0F 5A94A 3UWZA 4CEXC 1JUBA 4DUVA 1OGBA 1MMFA 4FLOA 3SB0A 3W82A 1GHSA 1X1ZA 1F07A 1Q6LA 3WMSA 4DLFA 4HYVA 4GGHA 1GEHA 3M0IA 2O7SA 3CEPA 1EA9C 6XIMA 3RPMA 1BXNA 5DELA 5BROA 3ZVIA 1R85A 3VUPA 3THAA 4WF7A 3FVMA 3VD4A 1AQMA 3R4IA 1I2NA 1S1RA 1EUAA 2ZBTA 4P7NA 3UWUA 1YMYA 3GDRA 4LYRA 3SZ8A 3Q45A 4LUTB 3GXDA 3SJNA 3B9AA 4A3HA 2QS8A 1KCLA 3PZIA 4XD3A 4HT3A 4PB5A 4R9XA 2HNEA 1VS1A 1S3TC 2A3BA 3LTSA 3IIOA 4CNOA 1Z89A 1M7XA 4KRTA 4BF7A 2ZX5A 4HOXA 3UZYA 1J0ZA 3CWNA 3VCCA 3KRSA 3WQDA 3P14A 1NWRA 5HNUA 5TF0A 3J7HA 2Y8KA 4H7ZA 2IKHA 3II1A 1N2VA 4P61A 4DELA 3GHTA 1CTNA 1IR1A 2L5HA 1C7TA 3GVWA 3M47A 4JL2A 1OFRA 1Q5MA 3ZSSA 1P5BA 1JAEA 3THQA 2QDHA 4RZ5A 4JFVA 1ZQ5A 4LSBA 2PP1A 3CV7A 4LRTA 4TV6A 4AQLA 3S3GA 4AYSA 4XAYA 2A2IA 1GCYA 3L12A 4GA8A 4Q8VA 3RRAA 2VRJA 4QAIA 3W6LA 3WH6A 2VT0A 2G37A 4MFEA 2C79A 2DT3A 4NZJA 2ZUVA 3V5CA 3VCNA 2RH9A 5J8LA 3WJWA 3UCDA 4N6FA 3HJZA 3B9NA 4WEVX 4EXQA 2W91A 1BKSA 4LVBA 1PKLA 1UQZA 1WYIA 3L68A 2VC5A 1AMKA 1B2YA 1UB3A 3VCRA 1FUYA 4QDMA 1RQEA 2C15A 2HROA 3VNKA 5DY3A 1BF6A 4IP5A 3M6YA 3BAJA 3GW3A 4GNJA 1VAHA 4H01A 3IACA 1YPIA 2Y70A 3WFAA 1LT8A 1XHGA 4XIMA 3BZJA 1GVFA 2F6XA 1KFWA 1BWVA 5FL0A 4FALA 4KWUA 4LALA 4H8UA 1E3ZA 1E1FA 1DXIA 4AMCA 3M0ZA 2ZICA 4O50A 5E6ZA 3UEQA 3CT2A 3PAOA 5FEXA 3L65A 5C8BB 4AEFA 2J24A 3UT0A 4ZQMA 1HKKA 3P93A 3FA4A 4FOUA 1KQZA 4HNVA 3T40A 4PEEA 1BG9A 3OTRA 2O7QA 3LBCA 3SCVA 3EWDA 3LTPA 4C6EA 5I2UA 3VOJA 3A4WA 1Y7VA 2VFEA 1SO4A 2DIEA 4GJJA 3S4TA 3LQGA 3LNMA 2GQ8A 3KTXA 1E0TA 3KOZA 5GJPA 1KM2A 5D38A 1FKXA 4RZBA 3EGJA 4CD7A 5IHSA 3FSTA 3LLDA 3S83A 4PRTA 4MLRA 4HBKA 2NX9A 5DN1A 1XIFA 3CV6A 2D2JA 3VTRA 3NO3A 2YJQA 3EWZA 3NQMA 4UQAA 1OX6A 4NRRA 4G7EB 3MO4A 4WR3A 3C3UA 1DPMA 1QPRA 1D7FA 1GOQA 2XVPA 3GU2A 4HK5A 2ZTJA 1XLBA 2VWTA 3W7MA 3QPEA 4PODA 4FOKA 2FZ9A 3T2QA 2HE8A 2EKCA 2GVEA 2A4AA 3W25A 2G41A 2FIQA 1CGWA 1AZ1A 1R3VA 4IPJA 4CQAA 1UH3A 5AY7A 2PDJA 3LRMA 4GBDA 1TPEA 3OVQA 1BFNA 2BHZA 1ZAJA 4WOQA 4CU6A 2D3LA 2ZZ6A 1JDCA 2XN0A 3ARWA 4OT7A 4L4LA 1Q7QA 4YCPA 4NNBA 2WMKA 1EPVA 4O0KA 8A3HA 5AN7A 3W2NA 3KWXA 5C7HA 5M03A 3PHAA 5CXPA 3TQPA 1QNVA 2FLIA 1JCNA 4DF2A 2DZWA 4TX9A 1ZU8A 1VJZA 5CPQA 3EB4A 2H8ZA 4PB4A 3UZZA 2RDWA 2DVTA 3MVTA 3CV1A 2QIIA 4CQ9A 1AFSA 3OZMA 5A6KA 4C1LA 1K9DA 4XQ6A 1DJYA 1PX3A 1IHIA 1XQKA 2X1TA 3F2CA 4H1ZA 4WXYA 1OFDA 3PNUA 2GWNA 3ARPA 3A9BA 4B5WA 3RU8X 3OO2A 3VX1A 3LUTA 2G3FA 4GD0A 1B54A 3L4UA 4EVZA 2GJRA 4WJ8A 2IQTA 2UY5A 5EFDA 1V3HA 1CW2A 4GXWA 2QDDA 4HSOA 3RGTA 4AWTA 4O53A 5HQEA 3BAYA 3EZ4A 4JBRA 3DI0A 4AY7A 2OSWA 4JHZA 1X1OA 2QYGA 5DBTA 3CTTA 3QSTA 3DENA 1XBVA 1PVNA 4LVGA 4WJXA 5AC6A 3HOJA 2IKJA 3EX6A 4XUYA 1YDVA 2VDIA 4DJED 4PUJA 5I24A 3L4WA 3U4AA 2OB3A 1QNSA 3FLUA 1W1IE 3WD0A 1CGYA 2DVUA 3KP1A 3PM6A 4J3ZA 3OA5A 2GJXB 3H7VA 3I4EA 3N2BA 3L4TA 4HGXA 3N17A 4MWAC 3T09A 1A0DA 3CUHA 4R33A 3G3DA 4BCEA 1BF2A 3O0FA 2QCMA 3KFTA 1HP5A 1EOMA 3TQKA 1EC7A 3KS5A 4QE4A 4DBSA 4QG6A 1IYXA 5HINA 4EWND 4JTHA 1RXOB 1XC6A 4KCWA 3PY