2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
4NXKA 1FX6A 3EWBX 3CM4A 4C1KA 4WOZA 1OFEA 5EKYA 1SR9A 3TAKA 4Z1CA 5CZSA 3MYPA 3UQNA 1MEWA 2G97A 3NG3A 3DH7A 3INPA 4HNUA 2GPTA 4I7UA 4DPPA 5CPLA 4DO5A 5A5WA 4DBEA 5I3IA 3IIVA 2JGQA 5AYXA 5E1QA 4EWND 1XBZA 1TV5A 3NNTA 6ALDA 2G95A 5BOOA 2X16A 3A24A 4UTMA 1L9WA 4ORIA 1FXPA 4BI7A 3M16A 3MI2A 1QNVA 1KM2A 3DHFA 4RXGA 2EGZA 3M1ZA 1XM3A 5D04C 2EKCA 2LLEA 1JJKA 1SSDA 4XBSA 2CZ5A 1XL9A 2FPYA 4ADTA 4CQAA 4RCXA 4LV9A 2FIQA 1ICSA 1RQEA 4CCCA 4JNMA 4R53A 3O16A 3GZ3A 4X22A 4R7JA 2TPSA 3L9CA 3MP3A 4ZQOA 5FF2A 3DFPA 3SECA 4HNTA 2VELA 4YWIA 3DKLA 2DZVA 2A7RA 4UTTA 3TK7A 3CIWA 2Y6ZA 3DFQA 3O15A 4UTJA 3LDVA 5DBUA 3GAKA 1H7OA 2QCCA 3NQCA 1F73A 1HL2A 3PBVA 5LSMA 4M6VA 3DFOA 1CW2A 3UY7A 3CU2A 3NDOA 3IGSA 1G69A 3LHVA 3M6YA 3G1VA 4O4VA 4FX7A 4ZQCA 1AW1A 3Q37A 2Y7FA 1ZAHA 1DKWA 1RQHA 2RDUA 1J4EA 2VFHA 3LHUA 3PG8A 3R8RA 3LCGA 2YZRA 2Z6IA 1QMLA 1TPH1 5G1YA 4YL2A 1B3OA 2A5HA 4XKYB 3EX1A 3MP5A 4FNUA 3CC1A 2J27A 3PS7A 4IX2A 1Q45A 4DBDA 4JX4A 3DKJA 4O11A 3HGRA 4LS0A 3E9AA 1VGAA 4UUIA 3S1UA 1OF8A 4JTSA 4AXKA 3AJXA 3BPWA 1YLVA 2FB2A 5EPDA 1LBFA 3QH2A 4AWTA 1KM0A 3M47A 4N4QA 3L0NA 2E5DA 1ZENA 3G22A 3KRSA 4UFIA 4E2BA 1LRTA 3P84A 4NJIA 2GVLA 4NVTA 5HULA 3IRDA 3TQKA 4OBTA 3TXZA 1F74A 4O1CA 3CPRA 1SUXA 1R2RA 1WAUA 4NJHA 3EWZA 2YCEA 3LLFA 2QJHA 1SZNA 2WNQA 3MBDA 3BW4A 3LI1A 4IXXA 1TIMA 1SO4A 3HG4A 1LZOA 4GUGA 5J5RA 4JYEA 3NQ2A 4WY0B 4N9CA 3DFTA 4O10A 1TCDA 5D02A 2D73A 2QCLA 3F1QA 1SFLA 2ZFAA 2Q8LA 4LY8A 4DF2A 2V2CA 2PE4A 3E02A 1GVQA 3M43A 4HNNA 3STFA 1Q3NA 2YGYA 1GYNA 3G1SA 2A4AA 3HG2A 2FDSA 2GUUA 3L5AA 4UTUA 1KFEA 2QR6A 3GXNA 3VI2A 1QPRA 4XWUA 3W7DA 3OBKA 4RK8A 3TSBA 4HPXA 1GWJA 1ZFJA 7TIMA 5FF7A 3HO8A 3HPZA 1H5YA 4ZQNA 4UR7A 5I3JA 3ABRA 4MVAA 4O0KA 1GEQA 4GXMA 1PHQA 2A6NA 1SZEA 5F1VA 3W7OA 4IMFA 1TYGA 2C13A 1TSIA 5LGZA 3C2EA 4NNBA 3GDTA 2GOUA 1VPXA 3FEMA 5F1UA 5D30A 2HS8A 5LGXA 3KHJA 4FB7A 3O1NA 2V5BA 2Y7DA 3EWXA 5LNVA 1G4TA 2Q8ZA 4IOTA 1YDVA 4O54A 4YLWA 3MJYA 3BW2A 1LLWA 3TROA 4RJEA 3GB6A 1A5AA 1TV8A 4Y9AA 1ICQA 4N9BA 5L9FA 4W9TA 1JRCA 3DENA 3QW3A 2NUXA 1F76A 4XZ9A 4Z0JA 5KSWA 4FNTA 2IQTA 1FBAA 3STCA 1J2WA 3CEUA 1D3HA 5AHLA 3QRHA 5K9DA 2ZQ0A 5ABTA 1RZMA 5HQEA 3WJXA 4OV4A 1CX9A 3W2NA 4JN6A 1X1ZA 3QW4B 1F2JA 2VC6A 3S5OA 4O1BA 2WSYA 3R13A 3A21A 3NPUA 3HF3A 3NXFA 4FNRA 4CNPA 2CLOA 1JQVA 1GQNA 5AC8A 1P0KA 5EA9A 2QUTA 4K38A 1WOAA 2V5LA 5HUOA 4GFSA 1Q6QA 2WO5A 1R47A 3DZ1A 4AH7A 4BFAA 4WY0A 2A6LA 1GVSA 5EMUA 1U5JA 5DLCA 4LVBA 3BG5A 4JY8A 1QAPA 1KM4A 3SY5A 1YPFA 1YADA 3PY2A 4UXDA 4Z08A 2PCQA 3GAYA 5FI8A 1Z48A 2O7SA 3TSDA 1XBXA 1JULA 3SGUA 1LROA 1B9BA 3MUXA 1XBYA 2CZEA 4MUZA 4BF9A 3M5XA 1VLWA 1OX6A 1OYCA 4Q32A 4RZ4A 5D2TA 1YXYA 2Z0IA 3PG9A 3GYEA 6TIMA 1KW1A 3A5VA 2X30A 5HNRA 4UCGA 1H1YA 4IXHA 1A53A 4CQ8A 2VEPA 3S42A 3EXRA 4ALDA 2ZZ7A 1ZAJA 1K7XA 3M5ZA 3QSTA 4DF0A 1AL8A 4DO6A 4JDBA 4MYAA 2NXHA 3PC0A 1V7YA 1JCMP 2Y89A 1VYSX 3R2GA 3OVQA 1FY6A 3B8DA 4HSNA 2NX3A 1AW5A 4UIOA 1UUMA 4RR4A 3WK2A 4JS3A 3T4CA 1O60A 1I2RA 3HMJG 4ZL1A 2GVGA 4GUIA 5LHEA 1WDWA 4TX9A 1PS9A 4Y6GA 1F6PA 2Y70A 3EXTA 1MZHA 4MJZA 2RDWA 1H51A 4I9AA 3FIGA 3ZS4A 2DZUA 2QDGA 1XC4A 2WQPA 4FEZA 4MPQA 2VFFA 1RVGA 3FYPA 4OGZA 1EP3A 3LHWA 3BV4A 1YDNA 2WKJA 4X3ZA 4XQ6A 1G4SA 1DOSA 1LTDA 1FCUA 1H1ZA 3E0IA 1I2PA 3HB9A 4EVZA 2YPIA 1VYPX 1Z44A 3NQ7A 5HWNA 4K6AA 1ZALA 4NJGA 1B4EA 2WSQA 3PF3A 4QNEA 2H3BA 3BGGA 3TNOA 3ZR4A 1B4KA 4KFNA 3LRLA 4M7TA 2E6FA 3I7QA 2DZWA 4QQ3A 2WV8A 1KV8A 1OK6A 5CZ0A 3LHZA 3CQ0A 1SO5A 1XUUA 2NUWA 2ZCGA 3NA8A 3NQAA 1X6UA 5KINA 5DCBA 3W76A 4JTHA 3BO9A 1KA9F 1KM6A 3PUEA 3LLDA 1W0MA 2PC4A 3IIZA 4GE8A 4MIMA 1QOQA 2Y63A 3H53A 4BWLC 3MP4A 3FA5A 4O12A 4MOZA 2ZA2A 4O50A 3W1LA 1H7NA 2NWRA 2Q3OA 5IM51 2C3ZA 5LHFA 5FEXA 3YPIA 5D2WA 4LTSA 1V5XA 3TDFA 3TE9A 1UUOA 5FF4A 1H7RA 3NR0A 1W31A 4MFDA 4IJBA 2Y61A 4MY9A 2V0TA 3BLFA 3PSWA 1OHLA 2EAWA 4Y96A 2YX0A 1OFBA 3W7LA 4TMBA 3U2OA 3M0ZA 1IF2A 3W1PA 1KTCA 3PWAA 3RK8A 1TPC1 4EF8A 3NQMA 5C54A 4NT0A 3W7GA 4DELA 4PA8A 1UB3A 3SR7A 4DXVA 3N14A 3W75A 3LB0A 1M6JA 1ZCOA 4RV8A 2Y62A 3ABQA 3L2IA 1QPOA 4RKAA 1Q6LA 1R2TA 1S5TA 2ZZ5A 3LHTA 3SZ8A 3EKZA 3EWWA 3LX9A 3PULA 2ABBA 1AW2A 1VS1A 2TRSA 1SW3A 1L6YA 3PUOA 1OK4A 2J9XA 2ZDRA 4BI5A 2VXNA 3W85A 1BKSA 4NX0A 3TAOA 3RFAA 3EXSA 2OMAA 3NQDA 2RDTA 1TREA 1LDCA 3GKAA 3TU9A 1F5ZA 3KVMA 1LCOA 4PODA 2DJLA 4HKPA 4PL1A 5HMSA 1XDLA 4UTWC 3W86A 4TMCA 2E5BA 2E68A 4OE7A 4JIPA 1OF6A 2TYSA 1Z41A 3H54A 5I3HA 3GXPA 2CFFA 2Z6JA 1EA0A 3TX9A 4PFMA 1VYRA 1ADOA 5MHBA 1SPQA 2JBMA 4K8EA 4AHOA 3UWZA 5CZTA 3W1AA 4BI6A 1IXQA 2R14A 1NF0A 1DQXA 2DP3A 3C6CA 5D2VA 4NNAA 1F6KA 4FNPA 1PVNA 1R2SA 4JY9A 2DJXA 3LCXA 5EBUA 3ZFHA 3KAOA 5TBOA 1DL3A 2XN2A 4JTEA 2DORA 3D0CA 4AAJA 2BTMA 4LT9A 3IIPA 4MKNA 4ADUA 2XN0A 1LOQA 1FWSA 1OJXA 2YYTA 3UWUA 3W73A 1OYBA 2B7QA 3B0UX 5AHEA 3T44A 3THQA 3G0SA 4KWVA 2ABAA 1KFCA 3OHIA 4UTWA 4DF1A 1QOPA 3BG3A 3LHYA 4QM1A 2B7OA 2F7FA 4AWSA 4EF9A 3C8FA 4ML9A 4ORMA 2QF7A 2Z2UA 2HSAA 4LWWA 5FF0A 1KM5A 3CT7A 1ML1A 1YYAA 3GDRA 1M5WA 1NFBA 2YFNA 2CLIA 3G1HA 3W9ZA 1PCWA 3TQVA 4JEQA 3OIXA 1OFAA 3DXIA 1W5PA 4U28A 4UFMA 4N02A 2A2IA 4NJJA 1SW0A 1XFBA 5K9XA 4JX5A 3WK1A 3GX9A 4P2VA 4KFPA 4TU1A 1U83A 1L6WA 3S5ZA 4FIRA 3TSMA 2QAPA 1FWTA 1OVDA 3P60A 3UWYA 1N8FA 5DCDA 1TPB1 2C1HA 3T40A 1WX0A 5G4EA 4Z1BA 3G0UA 4H6KA 1AK5A 4FO4A 2X1UA 4A2SA 5KMYA 1DORA 1M7OA 3W1XA 1W8SA 4UMCA 4GJ1A 2NUYA 3SW6A 3B0PA 2DZTA 3W7JA 1OFPA 4UTLA 2V2HA 3LCWA 2ZZ2A 4XTIA 3W23A 4Z1DA 3NQEA 3GIYA 3P81A 5EL1A 1LBMA 4HPJA 4JTIA 4JTFA 3C52A 2GQ9A 2H3DA 1I2NA 3MO7A 3ZWSA 3C61A 1G7UA 5G1TA 3QQ0A 2A0NA 4GC4A 2NWSA 2R8WA 3P61A 3IVSA 4JTKA 4FHAA 4K37A 3H55A 3PSVA 4ADSA 3GDMA 1H7WA 4WQ6A 3W88A 4A2RA 1SQ7A 1NVMA 1XI3A 2YSWA 3LXBA 4NNCA 1ONRA 2QEZA 2EHHA 1IIHA 1BWLA 2B7NA 3W7CA 3LRMA 3G24A 1O5KA 1W3TA 2VENA 4UFLA 4DO4A 3TV8A 2EF9A 1K7EA 1W5NA 2OX1A 1QFEA 2QCNA 3T55A 1JUEA 3W7HA 2C0AA 4O16A 3NQVA 2OJPA 3P8IA 1GG0A 3LCHA 5AHFA 3WJSA 4DQWA 2HS6A 4N2YA 1K7FA 5A8GA 3UWVA 5D32A 3W1NA 2ZRUA 1OFQA 4FXRA 1O95A 4UFKA 1CI1A 4LV4A 1A5SA 5BMWA 3OG3A 3M9YA 3NL5A 3L5MA 3A23A 3GR8A 1SU5A 4IPIA 3LRKA 2NXGA 1TRDA 1TRIA 3G0XA 4N9EA 3S1VA 2H6RA 5K4XA 3DHDA 1GTHA 1J5TA 3GK0A 3N73A 2QUVA 4QNWA 3PVFA 4IMDA 3NO5A 4IUOA 1QWGA 5G2HA 1RV8A 1T99A 3L67A 4B5NA 1H50A 5G5IA 4DPQA 1VRDA 1T0OA 1P1XA 4A21A 4GUFA 2YDAA 2JKPA 1UASA 3V75A 4K7VA 3QPZA 4M7SA 1RD5A 3FKKA 3LTSA 1ME8A 1WBJA 2X1RA 2ISVA 3UZJA 1FWRA 2I1OA 5U4NA 2C18A 3TMLA 3G1YA 2JGYA 4X9SA 4Z1AA 5AC6A 5I3GA 4E0CA 3CWOX 3MBFA 1H62A 1TPDA 3P80A 5D33A 2OT0A 4UNLA 1OABA 1H63A 2CWNA 3BG9A 3I68A 3W72A 2RFGA 1PHWA 2C14A 1IXNA 1EB3A 3VFLA 4EOUA 4JYDA 5F4SA 3DFNA 4ZQMA 3I6RA 5KTLA 3K30A 2R94A 3UZ5A 3NL3A 3CHVA 4AHQA 2VFIA 3NVTA 1KFJA 2X1SA 5E0KA 1YTEA 2RKXA 3HG3A 3SIZA 1UJPA 3W3OA 1N7KA 3QZEA 5IBXC 3M44A 3GKFA 1O94A 3E12A 3TJLA 4ZVJA 1LYXA 3P8JA 3FJLA 1OYAA 2G5WA 1GVFA 3IGXA 3RF9A 3W7RA 4A22A 1TTPA 5I3FA 2WJZA 2NX9A 3NM1A 2QJGA 4UR8A 3U8GA 1FCVA 1RPXA 1YTKA 1Q6RA 3CLMA 4YMZA 5F2MA 4K8HA 2ZRZA 4LW7A 3SFKA 2DZSA 3KFTA 2WSRA 3RNDA 4R34A 2C15A 3EWUA 3DFSA 4UMAA 1KBIA 1AL7A 2ZRVA 5DY2A 3TA6A 5AN7A 4S2BA 4UTHA 4YCOA 4J9JA 3F03K 3ANYA 1VC4A 2A7PA 1EPXA 2ZBTA 3BLEA 3CWNA 5DBTA 5K7JA 1GVOA 1KLZA 5G2IA 4H3DA 1LOSA 3W84A 2PRHA 3W2KA 3TIMA 2V30A 5LKYA 5KITA 3NOEA 1VR6A 4JGDA 3L0KA 4O15A 4QISA 3RLUA 2CLHA 1A5BA 4CLMA 1HO4A 4KFOA 1EWEA 3TC6A 1KLYA 5C6MA 1VQTA 3P5YA 5BNKA 4JYFA 1MSSA 5AFDA 2H8ZA 5CKSA 1NAL1 3P5ZA 5CSRA 1W5QA 3EX4A 4XUGA 3G1FA 3LM7A 3O06A 2QCFA 3JS3A 3UXDA 5HWMA 4K39A 1YDOA 3W2LA 3CEPA 3HGJA 5U7SA 2NXIA 4L4MA 3FOKA 4LVAA 3O07A 1TMHA 1VH7A 4WZHA 1KFBA 4WX2A 3ATZA 1MEIA 1LM1A 4O4WA 1C8VA 3BGJA 5LZLA 5F2LA 3HGSA 3S6DA 3GDLA 3C4UA 4QAIA 1KTBA 4CNOA 1SFJA 1VZWA 2NZLA 3GNDA 4TR9A 3UPBA 3S8HA 2VEIA 1ALDA 4OT7A 4O14A 1L6SA 3MI3A 1YPIA 1SW7A 1K8YA 2V81A 4O13A 1P5BA 2QDHA 4MZYA 3VNDA 1NSJA 4O52A 4RLIA 4LNYA 1DV7A 4CQ9A 2CLKA 1VHNA 2X2GA 1TPEA 3NQ8A 1IXPA 3IGUA 3C2VA 2GJNA 5H2ZA 3W7IA 1HUVA 5F4XA 1UBSA 1JRBA 2X1TA 2GQAA 2E77A 4FIQA 2ZZ6A 3UWQA 1TTJA 3MW7A 3UWWA 1P4CA 3NQFA 4EIVA 3WK3A 1KTNA 1GPWA 4ONVA 2I9EA 2ZA1A 2VKZG 4H4IA 3R89A 3V1PA 3EB2A 3S1XA 3F4NA 5K2ZA 2W0UA 5CPOA 5I3KA 5BMXA 2V82A 3N9SA 2A1YA 3PB2A 1TV7A 5AOUA 3BVJA 2ZZ4A 3N2XA 2B0MA 4A29A 2FLIA 1G7VA 3NQGA 2CW6A 4GBUA 2ZRXA 3FLUA 4OU1A 1IXOA 4O53A 1HFBA 1W37A 5K3VA 3GDKA 4M6PA 5AYZA 3C3NA 3P67A 4WD0A 2CLMA 3TJXA 3G18A 2QCDB 4XBKA 4IMGA 5D2YA 2KZHA 1H7PA 2QUUA 5CPNA 1TB3A 4Y8FA 1FCQA 2R91A 3CTLA 1ME7A 2CU0A 4MY8A 2Q3RA 2OCZA 2TSYA 4NZFA 1LRNA 4HSOA 3N2MA 3LV5A 1EP2A 2YFOA 3WK0A 3BW3A 4LVGA 1D3GA 1GJPA 3O05A 5EY5A 3G1AA 1BWKA 1YXDA 4S2CA 3GVGA 2CLEA 1AMKA 2ISSA 2ZTJA 3LV6A 5K9CA 3O6YX 1OFDA 1JR1A 2JKEA 3TMQA 1W54A 4BWLA 3B04A 1YTDA 5SWUA 1VCVA 1W3NA 1WBHA 2PURA 3EKLA 4NJKA 3S9YA 2JK2A 1XKYA 1S3HA 3IV3A 3SGZA 3LXCA 5HINA 1F7BA 4AHPA 1VCFA 3USBA 1S5WA 3HJZA 1GG1A 1C29A 3W1MA 1RR2A 3I7SA 4UNKA 5KZDA 3QJAA 3P62A 2VFDA 5TIMA 3G3MA 2F84A 1FWWA 2BLEA 5CPMA 1H60A 5HR6A 1JCNA 5C55A 4NQ1A 1G4PA 5D37A 1JCXA 1TPUA 1FUYA 4GNJA 4O28A 2I14A 3T7VA 5LNRA 1OFOA 4IWWA 5HJLA 5D38A 3UXAA 2YR1A 1SZGA 4JIQA 2PRLA 3GNNA 3JRKA 3RMJA 2A7NA 1AG1O 2FPVA 2HTMA 3L65A 2W79A 2P1FA 3CB8A 3MMTA 2C19A 3L21A 3TCEA 1TJPA 3TW7A 4C1LA 3MI6A 5J5DA 1W3IA 5DXYA 3Q58A 4YCPA 4JD4A 3O6CA 3O63A 3SI9A 3Q2DA 2J9ZA 4YXGA 3PAJA 3QSRA 3ABOA 4O1DA 1QPNA 5EYWA 5LNUA 2VOMA 3M5YA 1HO1A 1OX4B 3MHGA 3NPXA 4UTTC 3PR2A 3THAA 3GLCA 5CZJA 3DBPA 2QCDA 2QKFA 5E93A 1ME9A 2TMDA 5BRBA 3QMTA 1ZAIA 1TJRA 2ZRWA 3M41A 2PRMA 4JTUA 3PBWA 1I2QA 3FJ6A 1O4UA 3NL2A 4KKXA 1JCYA 3LXAA 3O8AA 4XTDA 2QCMA 3TQ0A 3PUDA 3LCFA 1ZHAA 3Q94A 4L4LA 3G8EA 3FFSA 3E49A 2C16A 2UV8G 3PM6A 1LBLA 4HNVA 2VEKA 2E6AA 4Q4KA 1WA3A 1X7FA 4JTGA 1EUNA 1DQWA 3OA3A 3W2JA 4O18A 3LBMA 5DY3A 1EUAA 4K7YA 1KM1A 3WFAA 2FPTA 4UTIA 4N6EA 4PCFA 4CNNA 5L6UA 5BW6A 1XXXA 3R5EA 4FNQA 1GTEA 1T8XA 1TTQA 3FYOA 4LRTA 4NX5A 4FNSA 3ABSA 4CCEA 2H8XA 5DCEA 3RU6A 4UC5A 3EX6A 1QR7A 3L66A 3O6DA 5LNSA 3W7NA 4LC6A 1R46A 1XDMA 4I7WA 4ZZ9A 1GVRA 1HG3A 3AO0A 4NZJA 4N6FA 1BEUA 2NV1A 1ICPA 1W5MA 3DGRA 1VJIA 1H7XA 4QITA 1TTIA 3QFEA 3MWAA 2A21A 3G3DA 1NF7A 4RZ5A 5HR7A 4N9DA 1W56A 2FQIA 3W71A 1KV5A 4AF0A 1Z42A 3NL6A 4AMAA 2CZFA 1FCBA 3DAQA 2YW3A 4LVDA 1QCWA 2EPHA 1ZNNA 1DBTA 3QPYA 4FF7A 2YYUA 3HG5A 3TXVA 1LORA 1WQ5A 3S5NA 3OVPA 3IVTA 3PB0A 5AHIA 2QJIA 3G1DA 2ZZ1A 3SJ3A 3L68A 1K8ZA 1K03A 4LRSA 3LGEA 3W87A 4O17A 1TO3A 5HWJA 1M7PA 5KZEA 3HIJA 4M19A 3DI0A 4NU7A 3LOTA 1G67A 4JXCA 1OX4A 4FX8A 4WOQA 1LP6A 2VFEA 1OG0A 2WNZA 4AB4A 4Z0SA 2P10A 4CCDA 4WY0F 4K36A 3TFXA 4WXZA 3EX3A 4ZQRA 1SSGA 5AB3A 1TQJA 3LTYA 1EIXA 4QIUA 2GQ8A 2ZA3A 3W2UA 2DZXA 5DELA 2AQWA 2VEMA 2DU2A 4OWGA 1SO6A 3IIXA 4HT3A 1PV8A 5GVJA 2HMCA 3JR2A 5D2XA 2Y7EA 2FTPA 1XUZA 4GUHA 4WXYA 4RZ6A 1MEHA 2J6XA 2DZPA 3EX2A 1G6CA 2NV2A 1FDZA 1LRQA 1I8JA 1KFLA 4IGHA 1JVNA 4JTTA 5T26A 3L5LA 1XCFA 4MZ1A 2P0OA 3DI1A 4UFHA 3CIXA 3A22A 2ATMA 4BK9A 1FWNA 4QJ1A 3S1WA 2E09A 3NPWA 4LS2A 2QCEA 3KRUA 3M5VA 4OHQA 2E1DA 1ZY9A 4TIMA 4RX0A 4I7VA 1Y0EA 1K8XA 3LI0A 4IMCA 3HBLA 4MZ8A 3TW6A 2OT1A 2BXVA 1QDSA 2G96A 3HGOA 4O0ZA 5LNWA 4DEFA 4OQVA 3B03A 2BZNA 3S5YA 4M5PA 2CLLA 1K02A 4JICA 2JKAA 4JX6A 2WPBA 4LS1A 3TH6A 3VE9A 3W6YA 4XKYA 3W2MA 3R12A 4X2RA 3W7MA 2ZTKA 1THFD 2J24A 4U4MA 4FXSA 3EWYA 3UD6A 3TUUA 3WJWA 2QAFA 1KBJA 3TFCA 3EEGA 3W7QA 2NLIA 4IPJA 3W7KA 4HN4A 3KVKA 2FB3A 3NYZA 1JQXA 3OEXA 3KVLA 3U6WA 1OFRA 1VCGA 2ISWA 2E6YA 4JTJA 3P74A 4IQLA 4LC8A 4O57A 3VE7A 1GYLA 2Y85A 1W5OA 4JR5A 3W70A 2C6QA 4WUIA 3WJYA 2VFGA 5C2XA 1QO2A 2GVJA 2Y7GA 4MFEA 4JDYA 3QQ1A 1QPQA 4O19A 3N9RA 4O1AA 5KZMA 2V2DA 2ALDA 4PTNA 1GZGA 4Y90A 3B06A 4OV9A 1IGSA 1XBVA 3LBCA 4GWEA 4AEOA 3TKFA 1F05A 1EWDA 3NQ6A 1GT8A 1LLZA 5IBXA 1WXJA 4POCA 4HHPA 3DU0A 3MHUA 1A50A 3BLIA 3IVUA 5AC7A 5F2GA 1JCLA 3KVJA 3HOJA 3A5FA 3ELFA 2Z1BA 4E2DA 1FXQA 3QMSA 3GXTA 1I45A 5AYYA 3VKJA 2E5CA 3C2FA 1R30A 2FFCA 3P82A 1JUKA 4PH6A 2A85A 3S0CA 2GJLA 2BX7A 4WJEA 3ZWTA 1TQXA 1A5CA 3W83A 3W74A 3LERA 3MHFA 1C9DA 3G1XA 3W1RA 4MY1A 4HIBA 1VHCA 3IIOA 4IMEA 1S5VA 3WJZA 3F4WA 1EEPA 3LTPA 4LOCA 4A3UA 2NX1A 4MLRA 5TQLA 3RLVA 4ZQPA 4PC8A 2ATSA 1BTMA 3W1TA 4UFJA 3N19B 3KX6A 3C2OA 1RQBA 3I65A 5AHNA 1SO3A 1X1OA 4NUWA 3NEVA 3W22A 1MXSA 3TC7A 1DHPA 4QSHA 4UTKA 3T78A 4M6QA 1SZFA 1JUBA 2FJKA 5D03A 3STEA 4O8RA 5CGQA 1EX5A 2QCHA 3W7EA 3N3MA 4RXFA 4MLJA 5D09A 3C2RA 3QM3A 5F2IA 2V8ZA 1T96A 5AHMA 2H90A 3N34A 2XN1A 5FESA 1L2UA 1LOLA 4KWWA 3W07A 1D9EA 3SSJA 2WOQA 1PIIA 1TPVA 1QO5A 8TIMA 5DXXA 3NAVA 4AWUA 2E6DA 4ZMGA 1TPWA 3NZRA 1DJQA 3OVRA 2RH9A 3M7WA 2Y88A 2ZRYA 1P0NA 1DJNA 3QYQA 3UPWA 4Q33A 3B0VC 3GR7A 4ICNA 3KOFA 4GUJA 3MYOA 3NZ1A 3ATYA 2J9YA 1WOBA 1VLIA 3LCLA 5D05A 2BSLA 1KFKA 3W7PA 4LUIA 3PBUA 1G4EA 4MYXA 2ZZ3A 4PL2A 2AAMA 3W1UA 2W6RA 3QMRA 3QC3A 3LCIA 1UCWA 5FEZA 3BARA 1ZJIA 1KM3A 3B4UA 4S1FA 3E96A 3HQ1A 5DN1A 2XFWA 2AGKA 4D2JA 3QEZA 1FQ0A 5FEPA 5F4WA 3PBYA 2CLFA 4LUJA 1WV2A 2O7QA 1E51A 2BWGA 5G4WA 3HPSA 2V9DA 1EP1A 1B57A 4PEKA 1IIGA 1I4NA 1FDYA 1N55A 3G8RA 1DVJA 1TPFA 3HPXA 4MJMA 1X8FA 5FF3A 1GOXA 4AVFA 2CZDA 5C5YA 1YXCA 5HUPA 4JTLA 1PE1A 3STGA 4FX6M 3C0JA 1H61A 4NXSA 3TR2A 4R33A 1K3UA 2YXGA 4UMBA 3UNDA 4E38A 3VCRA 4BR1A 1O5XA 4G1KA 2B4GA 5K4ZA 3A9IA 3L0GA 3UY8A 3QF0A 5CSSA 1OX5A 1PL9A 1HTIA 1I2OA 2YW4A 1W1ZA 1JCJA 1Q6OA 3C56A 2ZYFA 5H91A 2RHGA 4IX0A 5FEWA 4LU0A 3FKRA 3UYCA 4GRSA 3KRZA 1PCKA 3KXQA 2OZ0A 4P61A 2B7PA 3P7YA 2WNNA 2J88A 4TO8A 3NGJA 3FS2A 4N4PA 3B05A 3NM3A 1NEYA 2QCGA 3W1QA 3IEBA 3I7RA 3NPVA 4AF0B 1WYIA 3BK0A 5CG7A 1FDJA 5G2WA 1MO0A 4LVFA
chains in the Genus database with same CATH superfamily
4NXKA 3PZIA 1F3XA 5JH2A 2GWGA 1V93A 3XISA 2W67A 3CM4A 3U48A 1RLDA 2R1MA 4Y9PA 2HPIA 2WHJA 1I75A 5IDIA 1SR9A 3C0LA 2ZX8A 4Z1CA 3KTSA 3MYPA 4C6CA 3E0VA 4HBKA 2XTKA 1MNZA 1NDVA 4QLJA 4DPPA 4DO5A 1DWHM 3IIVA 2JGQA 3QY6A 5AYXA 5E1QA 1JZ6A 4LCRA 5BOOA 4QDWA 4XO7A 3RCNA 5J8LA 1XCXA 4WKAA 1QNVA 4W7UA 4MGGA 4UR9A 2EKCA 5D9NA 1Q5MA 3M46A 1JJKA 4H83A 1T41A 3IS4A 1BTCA 3SRDA 4RCXA 4LV9A 1BRLB 1RQEA 4CCCA 4WHBA 3O16A 3EDEA 1CGVA 2TPSA 5FF2A 3TOYA 4HU0A 3DFPA 3SECA 4HNTA 4NZCA 2J62A 4AVNA 3MTWA 3VYLA 2VT0A 2A7RA 4F40A 1NU5A 4RE0A 2EQDA 3VIGA 2Y6ZA 4HMDA 2BBFA 4Q6JA 2ZUNA 3VUSA 3U57A 3SY1A 3MDUA 1HL2A 1CW2A 2YCIX 3CU2A 3IGSA 5AKQA 1JPIA 1G69A 3G1VA 3N25A 4TV5A 4FX7A 4OUIA 3Q37A 4AG0A 1UKQA 1ZAHA 3VNYA 1J4EA 3CZEA 5CSUA 2PDFA 4W7WA 3PHAA 2PMQA 2YZRA 2DZAA 3JZEA 1QMLA 4U5IA 3OB8A 4NAEB 5G1YA 3WF3A 2GVEA 1YHTA 4YL2A 1B3OA 5CLTA 2G0WA 4ZTYA 3GXFA 1B54A 4B5WA 1Q7ZA 4O11A 1V3JA 2V6AA 3GNPA 3MWCA 3E9AA 4L1WA 5HMDA 1GKRA 4AXKA 3F2DA 2WSPA 3AJXA 1E71M 1XPGA 4WVXA 3WH8A 4OBSA 5EPDA 1E0WA 3QH2A 1KM0A 4UOZA 4MUPA 3G22A 3KRSA 1LRTA 3VMOA 1YKWA 2P53A 4NJIA 5HULA 1RVKA 3OG2A 1TE6A 4XD4A 3TQKA 4OBTA 2VX5A 1IHIA 1R2RA 4NJHA 2GFTA 2QJHA 1U33A 2WNQA 4AIBA 1JG9A 5J5RA 4JBRA 3NQ2A 5DMLA 5FAJA 3DFTA 4O10A 5D02A 2D73A 2QCLA 4GFIA 1LT8A 1SFLA 3QZ6A 1KCXA 2Q8LA 3ID7A 2V2CA 1S2AA 4JNYA 3M43A 1NDZA 3G1SA 1KCZA 2GUUA 3WD0A 3BLOA 4C6QA 3QGVA 4HPXA 1EFZA 4IL2A 1DIEA 4GNVA 5FF7A 3HPZA 4MNMA 2BOGX 4ZQNA 2YOCA 1NDYA 4PSPA 3ABRA 1X98A 3ORWA 4PUMA 3W24A 3T05A 4GXMA 2GJXA 2A6NA 2IQ0A 4TVDA 4IMFA 1TZ9A 2FHBA 3WQCA 4NNBA 3KL0A 3FEMA 2J7GA 1WUFA 3KHJA 4CN6A 4D1JA 3KS5A 3N2CA 1UROA 2V5BA 2Q8ZA 1X38A 1ESWA 4YLWA 3BW2A 1LLWA 3GW3A 4XD3A 2G41A 3QW3A 2NUXA 1F76A 1J2WA 3QRHA 1UC5A 1TJ2A 5K9DA 2PP0A 1BKHA 3A3WA 2IKHA 3QW4B 2MANA 1F2JA 3KUMA 3AUOA 2VI0A 2WSYA 3MVIA 3BLKA 3NPUA 2QVHA 4ZA0A 2GGHA 4IUGA 2HWGA 1P0KA 5EA9A 2QUTA 3VA8A 2AOSA 2VVNA 2O9OA 2VGIA 3OYXA 2WO5A 2NLYA 4FS9A 1R47A 3DZ1A 4BFAA 2RJHA 1BYDA 2PLKA 1U5JA 3BMWA 5JBEA 2ZADA 4JY8A 1L8PA 4J4KA 1YPFA 2IXUA 1FWHC 4XKMA 3SCUA 3GAYA 1W3HA 3AXHA 1XBXA 3CHFA 3K46A 1LROA 4RW5A 2OQLA 1ZL1A 2VX7A 1OX6A 2QPSA 4Q32A 2Z0IA 3BWWA 3R7MA 6TIMA 1KW1A 2VL4A 3DFHA 2DW6A 3CZ8A 2FZ9A 1JF6A 4IT1A 2GOKA 3LPFA 3OZPA 1K6WA 3HPAA 2PU0A 4CUCA 1K7XA 4PTVA 4DJFC 1N82A 2PWUA 2QNEA 2VDHA 2IKJA 3PC0A 5DO8A 2Z7KA 2RUSA 2Y89A 1VYSX 3TN3A 5I07A 1FY6A 3B8DA 2NX3A 5EMLA 2BNJA 3ZQ9A 4RR4A 3RMEA 4ZL1A 1CENA 4ATDA 1UR2A 3H23A 4FPSA 3AIQA 3SRKA 2GK1B 4TX9A 2AQVA 1F6PA 3BE7A 3FVDA 2RDWA 1W1B1 2PP3A 1TG7A 4H8VA 3LYEA 2PZ0A 3B9NA 3K2GA 1E5NA 3PTMA 4IHCA 1PJ9A 2VZSA 3RUBL 4JQAA 3BCJA 1C93A 1BLIA 1OC7A 1VYPX 1KBKA 3NQ7A 1SYTA 2ASHA 2V3EA 4K6AA 4DUOA 2FZNA 1XIIA 2WSQA 3ENLA 2CITA 3REQB 4S39A 4QNEA 2H3BA 3BGGA 3TNOA 2FMNA 3LRLA 3SCOA 3KLKA 3SN0A 4M7TA 4DJED 2W5FA 4QQ3A 3GU1A 1OK6A 3LHZA 4Q7IA 3M64A 2OKOA 3D3FA 3WG6A 1KBLA 4PCSA 3WQWA 2W27A 3I4EA 2ZCGA 2BVDA 3NA8A 2Y8UA 3P14A 5LXXA 4KCVA 1GVEA 4QDMA 4I5RA 5DCBA 2O55A 3LLDA 1QOQA 2Y63A 4QROA 2WMFA 1G1YA 4MOZA 2ZA2A 3VGBA 4LF1A 2Q3OA 5IM51 3IPWA 3TDFA 1SR0A 4MFDA 3AFBA 2HV5A 4Z2GA 2XIIA 3PSWA 1OHLA 1EIBA 2XINA 1PEZA 1UWRA 4TMBA 3AMLA 3RK8A 1TR1A 4WCJA 2X09A 2D2JA 1TPC1 3ES7A 4EF8A 3W7GA 2O92A 1ONXA 5AZ1A 2E9LA 3N14A 3ITOA 1QW8A 1M6JA 4RKAA 3L2IA 4ROPA 1S5TA 3MMUA 1EOKA 3EWWA 1HP5A 3CV1A 3CH9A 3CWHA 4B5TA 4DBSA 3MY9A 2J9XA 2PPGA 4BI5A 5E09A 1JFHA 3TLQA 3UNTA 2HJPA 4H6EA 3WF4A 4PCTA 2QIWA 3BQ6A 3NQDA 4HA1A 3TU9A 3GKAA 3KVMA 4M0XA 2G3NA 4Z1YA 4QS5A 1J8VA 1ISVA 4TXEA 2NQJA 5I3HA 1Z69A 4QGCA 2Z6JA 2FGBA 3TX9A 3N17A 3HQNA 2JBMA 2Z4GA 3FHQA 3W1AA 1NF0A 3C6CA 3TP4A 3B9EA 4XAGA 3EWCA 1B3YA 2BVYA 3V3WA 1W9PA 3UZZA 1CGWA 3AROA 3ARVA 4J2MA 3LCXA 5EBUA 2BY1A 4HQVA 1DL3A 1OY0A 2DORA 4JTEA 1YBQB 1POJA 4LT9A 3IIPA 4PB5A 5A95A 4ADUA 2YA0A 2YYTA 3W73A 3THQA 3G0SA 1A4LA 1J0KA 4DI9A 3N2OA 4O8AA 3BG3A 3LHYA 2F7FA 4AWSA 3C8FA 5T8GA 4ORMA 1MRAA 4LWWA 5FF0A 4DM2A 3CT7A 4AZ6A 5FKYA 3GDRA 1M5WA 1NFBA 2CLIA 1PCWA 1UZDA 4JEQA 3DC0A 2VCAA 1ITXA 4CD6A 2Z1XA 2PGWA 1Y7VA 4NJJA 1SW0A 4JX5A 3KS6A 1P48A 1ZTVA 4TU1A 3S2NA 1J6OA 2XVNA 3CPGA 1OVDA 3K8MA 4Q8MA 1EBHA 3AISA 4J7RA 5DCDA 5FAGA 1WX0A 3ERPA 3UJSA 3DN5A 1AK5A 2P3EA 2HXUA 1KXHA 5KMYA 4HMEA 4GJ1A 4LAKA 1OFPA 3UP8A 2V2HA 3LCWA 2ZZ2A 3W23A 1UP3A 2YL9A 4L4OA 2CIPA 3ZT6A 1RLCL 4H6RA 3M0MA 1REQB 3GIQA 2XFRA 1WKEA 5T91A 1CECA 1DIDA 4JTIA 5GJNA 4JTFA 2GQ9A 3MO7A 1O5RA 3QQ0A 3VIPA 5EFDA 1MMFA 3USZA 4GC4A 2NWSA 1LUCB 4FHAA 4K37A 1M7XA 4KWOA 3GDMA 4WQ6A 3U0HA 1UW9A 3SUUA 2P5NA 1NVMA 4RDVA 3LXBA 5H6HA 1CGXA 1BWLA 1OB0A 4WGHA 1TA3B 4UZSA 1K7EA 2PWEA 1QNSA 1MWOA 4YHEA 3GQYA 3T55A 2WKGA 4C65A 1WCGA 2B31A 4WKFA 2NVAA 2HS6A 1K7FA 3RHGA 3UWEA 5A8GA 3CPUA 4K1WA 1SJDA 3HFTA 2YZ5A 4W84A 1AJZA 1KCKA 1OFQA 1P0EA 2Z7GA 4GACA 4WGXA 2PDNA 3UGVA 1QI5A 3A23A 3BTNA 1SU5A 1TVLA 2NXGA 1VBUA 1FP9A 3S1VA 4M24A 4I6KA 4KQNA 4MNLA 4IIDA 1J5TA 4QNWA 1RK6A 3PVFA 1EC9A 2VWTA 3UF9A 1F61A 4IUOA 1XV8A 4LYQA 3M07A 3UYIA 5A6JA 2XISA 1EGVA 1YRRA 4Q8VA 5G5IA 1M41A 4DPQA 4IFRA 2JF6A 1T0OA 5CBJA 2CBVA 3L4UA 4KCWA 3TC3A 3WQDA 3NQBA 2ISVA 4L5ZA 1FWRA 3MUY1 3G1YA 4E0CA 2BV9A 3RCMA 3TN4A 4H8HA 1TPDA 3HM7A 3P80A 3NURA 5D33A 3HTWA 2OT0A 4NY2A 3AWNA 1QXLA 4TTGA 1EPVA 2CWNA 3GBEA 5PTDA 3M0KA 3LENA 4F0LA 3I68A 7REQB 5BU6A 3GO2A 3VFLA 4JYDA 2QPUA 4JEJA 3LQGA 3WBEA 4D6JA 5KTLA 5IOBA 2R94A 1O6IA 3K13A 3AMGA 4AHQA 1KFJA 5E0KA 4GC3A 3PWGA 2RKXA 3HG3A 1GOMA 3W3OA 1N7KA 1EJVC 5IBXC 3FAWA 2TAAA 1O94A 1VBHA 3GKFA 3LNMA 4DY1A 1E6XM 1V3MA 1TWWA 1OYAA 1WDDA 3E0WA 1GCYA 3IGXA 3UCCA 1QK2A 4GY1A 2NW0A 3W7RA 3RAOA 4A22A 3SQMA 1B30A 2O9RA 5D4YA 3VUPA 3PJUA 3U8GA 1FCVA 3BJSA 1YTKA 4DJEC 4LEFA 2FZMA 1Q6RA 4CEXC 2ONEA 3OZMA 4GX9A 1A4MA 4GG9A 4LW7A 1QNQA 2DZSA 3LUTA 3DFSA 1V6TA 3TA6A 4UOJA 5AN7A 2QGYA 3ANYA 1QHPA 5DMYA 2A7PA 3LMYA 3BLEA 2HRWA 1U22A 5K7JA 2Z00A 4XZWA 3OU8A 1QBAA 1JZ5A 3AZRA 2BOFX 2QMJA 5GJPA 4JQ4A 1K1DA 3RU8X 3TIMA 1XH2A 4QISA 3RLUA 1VIZA 1RSCA 2CLHA 1A5BA 2IPWA 4TOQA 5XINA 1V4YA 1KLYA 5HK4A 3OODA 3P5YA 1HKKA 4JYFA 1WZLA 2PEVA 3A3HA 1E3XA 3E74A 5CSRA 3EX4A 3DX5A 3LM7A 3O06A 2PDBA 1HJWA 5HWMA 3LU2A 1MDLA 1NTHA 3RX4A 4D71A 3HGJA 2RGMA 5U7SA 2NXIA 4L4MA 1FWBC 2QYGA 4IQJA 3O07A 2W66A 4HCLA 1KFBA 3ITGA 3R4IA 1MEIA 1QVBA 3I3EA 1AQHA 1IWBA 2VDIA 3GDLA 3ZO9A 3C4UA 1HGWA 1P43A 1TJ1A 1SFJA 4TR9A 4UCFA 1RAKA 3S8HA 1Y65A 4FP1A 5M5DA 3E0LA 1E4MM 3SGGA 2V3DA 1L6SA 1BSLA 2JALA 1QBBA 3EGJA 1YPIA 1SW7A 1K8YA 1P5BA 4U3AA 2QDHA 4O52A 3U9IA 3NQ8A 3EOLA 3C2VA 2GJNA 1MRQA 4F0HA 1HUVA 5F4XA 2NSOA 1EF2A 1OIMA 2GQAA 3UWQA 1TTJA 1BWVA 1YQ2A 3TYAA 3LZ5A 1H49A 1DP0A 1XSKA 4ZO7A 2JFEX 2ZA1A 3R89A 4K68A 4WKHA 3WLKX 3DC8A 4Q22A 5CPOA 5JU6A 3N9SA 2A1YA 2ZX7A 1FHLA 3BVJA 4Q8TA 3PZTA 3IARA 3ZSTA 3FA4A 5CQ1A 5JIWA 2VNCA 4O53A 1UG6A 1GW9A 4HOWA 4F2BA 1WB0A 4WJ8A 1EJXC 4RUBA 1DWJM 4IMGA 1V6XA 3WIJA 1S46A 1H7PA 1OC5A 3OO2A 3CTLA 2R91A 1ME7A 4KPLA 3WMBA 3EMZA 3KWXA 1VBGA 3G6LA 2YFOA 3BW3A 1R7AA 3GE7A 1D3GA 1GJPA 4XVEA 4XB3A 5EY5A 1NH6A 5JH1A 2CLEA 2ZTJA 5K9CA 3JW7A 1OFDA 2F2KA 1K8CA 4RE4A 4CNUA 3TMQA 1A0DA 4AUBA 1HKIA 2XM1A 5SWUA 1EHAA 1W3NA 1HF6A 3UJ2A 1DJZA 2A79A 2JK2A 3VKDA 1S3HA 2VVSA 3W81A 5HINA 4XZMX 2Z1WA 4M8UA 4WDTA 1C29A 1P6CA 1RR2A 3I7SA 3FK4A 3QJAA 3P62A 1AZ2A 1FWWA 3LY0A 5CPMA 4YU1A 5HR6A 3CL7A 1ZQ5A 5BRQA 3N04A 1TPUA 4GNJA 4O28A 3R10A 3DHUA 1AJ2A 2UBPC 5LNRA 1OFOA 4BS0A 4IIHA 1TWZA 2ZUWA 4IGSA 3U2CA 1SZGA 4AXNA 1O7AA 3GNNA 3QR0A 3WH5A 3RMJA 4OIFA 4QR6A 1AZ1A 2C19A 4PMYA 5HPOA 3VIIA 1GQIA 4DNHA 2AGTA 3TW7A 3BAKA 1UP2A 5FJJA 2BVWA 7ODCA 3O63A 4YXGA 2OLHA 3ABOA 5LNUA 2VOMA 4MWAB 1XIEA 2W63A 3MHGA 3KBWA 4H9ZA 3GLCA 4GQBA 1K9TA 2QKFA 3SCTA 5E93A 2CYGA 5A6LA 3NXLA 4LCQA 5BRBA 1DJWA 3N6JA 1GOKA 1TJRA 3M41A 3TW9A 5LIYX 3E38A 2WWCA 3FJ6A 3LXAA 3O8AA 3WY1A 5GJMA 5JIPA 2WLYA 3TQ0A 4DRSA 2GL5A 2PGEA 1YMYA 1KXQA 3AC0A 3FFSA 4MJ2A 4WLCA 1LBLA 4HNVA 1D2KA 3KL5A 2VEKA 4GZIA 4AYGA 1WA3A 3OA3A 3W2JA 2V3GA 1OCJA 1EUAA 1Q6DA 4K7YA 4LAMA 4N6EA 3WF0A 4PCFA 3R58A 3AIEA 3PZGA 1H1NA 1ZRQA 1T8XA 4OFCA 4FNSA 2H8XA 4UC5A 5A2BA 2WWDA 5LNSA 4YPJA 2INFA 4I7WA 1RALA 4KEVA 1HG3A 1BEUA 3GXDA 4ZO6A 3C5QA 4QITA 1TTIA 3G3DA 3UR5A 2OZ3A 4EAMA 1ZLPA 3L12A 1FCBA 1PZ2A 4H9UA 3D46A 2H9AB 1QCWA 2QDDA 1PDYA 1RCQA 2BG5A 2BP1A 5HOSA 3HG5A 1LORA 4LYPA 4AD1A 3OVPA 4GYPC 1Z9AA 1V0LA 4IP7A 4J3TA 2OU4A 1K03A 2E0PA 5CPQA 1M7PA 5KZEA 1US3A 4M81A 1R5YA 4Y7EA 3GG8A 3T08A 3WUGA 4G1NA 2QQ6A 4HNLA 4FX8A 1ZBKA 1LP6A 1V6VA 2DQWA 3N6QA 1O1HA 1MXDA 4Z0SA 2W62A 1I60A 3AHVA 4CCDA 1PO9A 1HW6A 4U2YA 5CEWA 4LBRA 5I24A 3EX3A 5AB3A 4AZCA 3HQPA 1EIXA 4QIUA 4IQEA 3WNMA 1US0A 3UFYA 3NJ3A 2AQWA 1CCWB 1SO6A 1UYQA 1BRLA 3A13A 3MKKA 1PV8A 4GYPA 3JR2A 1X39A 2Z1VA 2Y7EA 2FTPA 4DAIA 4ICCX 2VC5A 4QS6A 1QPKA 4ACYA 1LF1A 2PDLA 1ZBWA 1KFLA 1E40A 1XCFA 3V0TA 3EA2A 2P0OA 1NWSA 3FYYA 3S83A 3BURA 4M80A 3VIMA 1A5KC 1LWIA 1BVZA 1AD4A 2PDXA 2J78A 2Z24A 2QCEA 4IF2A 1MUCA 1HJVA 3KOYA 4XIAA 1Y0EA 1K8XA 3GFXA 3MV11 1DE6A 4MZ8A 2OT1A 3A47A 2G96A 3H7RA 4S3KA 1UWAA 3BMXA 1XLIA 3ZJKA 3OW1A 1R9XA 4DEFA 4QJ3B 1O1ZA 1RY8A 1SVDA 3S5YA 3I3DA 4LBSA 4JICA 1K77A 4LS1A 3TH6A 2XZ9A 3VE9A 2QW5A 3F4DA 4X2RA 1U2YA 4EPKA 1THFD 1OGSA 4NYYA 1OM0A 1QI0A 4NF7A 3WLNA 3BC9A 2XWEA 3W7KA 2PF8A 4HN4A 3NYZA 2NT0A 1K70A 2G3JA 1J96A 3TYBA 3T0AA 3P74A 4XV0A 4IFKB 3VE7A 3KBVA 3GXMA 4J40A 2Z25A 3PZUA 1XGEA 2VFGA 2Y8VA 2GVJA 1R9ZA 4JDYA 1L8NA 2ZC1A 3N9RA 1HJSA 4KWUA 2ALDA 3KM8A 1HJQA 3R0UA 2VWSA 3PPHA 4XAZA 4AEOA 5H8UA 1EWDA 1GT8A 4UOQA 4POCA 4BHYA 1IEXA 3PZOA 3DU0A 3MHUA 1VBJA 1RJPA 3MU7A 1GKQA 4A3RA 1DYSA 3NZQA 3UPMA 4B5UA 1WNOA 1FXQA 3WYZA 5C2CA 3CV6A 1I45A 5T9BG 3VKJA 2E5CA 2BY0A 3CUIA 4EAYA 2WMIB 3S0CA 2GJLA 4F8XA 2BX7A 1BGAA 1TQXA 1CXKA 4AISA 4GZJA 1A5CA 4HIBA 3IIOA 2Q02A 4JKLA 1S5VA 3ITCA 2PDPA 3WJZA 1QNRA 4CQBA 3NSMA 2VEFA 2BGNE 3LTPA 3TZFA 3LQLA 4A3UA 4I90A 3CMGA 2F6UA 4ZQPA 1EA9C 3P2VA 4Z2KA 1MQPA 4OOUA 4U5KA 3WH7A 5HMFA 3SFWA 4Q3MA 3NEVA 3SUSA 3IJ7A 3GFYA 4M6QA 4HYVA 1HX0A 5D03A 4H6QA 4MADA 3GHRA 4ZOAA 3W7EA 3DUGA 4KIRA 5LIKX 3DHPA 5DFAA 4MLJA 3BZGA 5AHMA 2H90A 3I4KA 1E5JA 1BYBA 4W86A 2ACRA 2XN1A 3DEQA 1DJIA 1L2UA 1QO5A 2WPGA 5DXXA 1KBBA 4ZMGA 4GISA 3NZRA 1DJQA 3TTOA 2RH9A 3M7WA 1HVQA 2ZDSA 2Y88A 3GR7A 1VEPA 3GH7A 4ICNA 3KOFA 3MYOA 2ZUTA 3CO4A 3LCLA 5D05A 3SM0A 4LUIA 3ECQA 4UQEA 5RUBA 4PL2A 2W6RA 3W1UA 2E7FA 4D1IA 1W3JA 3PTDA 1E9ZB 1KM3A 3ARWA 3HQ1A 4DLFA 4D2JA 3UEQA 3EA1A 3PBYA 4ERIA 1WV2A 2V9DA 1EP1A 5C0QA 1HN1A 1FDYA 1Q4WA 1N55A 5EMJA 3GXIA 1FVPA 3AMKA 5CAKA 3HPXA 4JTQA 4H41A 1D7FA 4XZHA 4JQ1A 4LAZA 5CJMA 4C6PA 4AVFA 1IEIA 1E0XA 1BVWA 3SEPA 1B90A 5I02A 2BDQA 4ZE5A 1K3UA 4UMBA 3UNDA 3SCPA 4RW3A 4PMUA 3UJRA 3AHTA 3B40A 4KS0A 3C8NA 2GK1A 3ABZA 4AYSA 4FLSA 1HTIA 2YW4A 4XAPA 4R88A 4AD4A 2PGRA 4ZOEA 4KT2A 2ZYFA 4QQUA 3FKRA 1PCKA 2GGEA 1M01A 3UG4A 3M4HA 1NOUA 3P7YA 5H8MA 4QBXA 4Y9NA 4U3CA 3WMSA 3WF2A 3AQUA 3VGFA 4N4PA 2OSXA 1MFVA 1NEYA 1VFOA 3NPVA 1MFUA 2Y8KA 1BG9A 4DBUA 5G2WA 1OGBA 3GDBA 3G77A 9XIMA 2XUCA 4WK9A 3REQA 3TAKA 4BF5A 3UQNA 4D6DA 4HN8A 4J27A 4E2VA 3INPA 1OADA 1KRAC 2AKZA 5A5WA 4DBEA 5I3IA 3M6DA 3B9OA 4EWND 1XBZA 1JZ8A 5HAOA 2X1IA 3DOPA 2F61A 2G95A 1FOBA 4UTMA 5BU9A 4BJHA 2C71A 3M16A 3MI2A 5HPCA 5JXQA 2HVOA 3DHFA 2EPLX 5D04C 4W7VA 2J47A 1JEZA 4XBSA 3VIHA 4Q8UA 2J66A 4LFYA 4MM1A 4P7NA 2FIQA 1JIBA 1XIGA 5D8ZA 3RO8A 3NDZA 1XC6A 3W00A 1A5UA 4X22A 5CC7A 3WLIA 1XWYA 1XISA 4B3LA 3DKLA 3WLTA 3TK7A 1GQJA 2QMKA 5CC5A 1JNEA 3LK6A 4NI8A 1S2TA 3O15A 4YHGA 2DIJA 1TWIA 4UTJA 5DBUA 1XDJA 3GAKA 1H7OA 2QCCA 1YNPA 3DFOA 2FJUB 3FDKA 5BRPA 1IZJA 3ISIX 4XUYA 2PWDA 2Y7FA 2GJXB 3PG8A 3LHUA 4TX6A 3B8UA 5BXRA 4OBRA 1LJYA 4W5ZA 4XAYA 1EC7A 4C5ZA 1GHRA 4ICMA 1TPH1 3U2EA 3PBMA 5CGTA 3CC1A 3MKCA 1L6FA 1Q45A 3DKJA 5A1AA 4LS0A 5D9MA 4EX4A 3S1UA 1OF8A 4U31A 4DYEA 3MANA 2ZUSA 1ISXA 1W1YA 4TVUA 2DH2A 1LBFA 3F2CA 1M65A 3WO8A 4CD8A 1UKSA 2I57A 1E1CA 2YXXA 3M47A 3L0NA 4WSKA 2E5DA 4GVGA 4UFIA 3ZIZA 4E2BA 2O0TA 4PMOA 3OLGA 3BSHA 3AIBA 4KGJA 4S3CA 3T42A 8A3HA 3LLFA 3ZXWA 3MBDA 1G0CA 1LZOA 1DWFM 3L2MA 1TCDA 5CG0A 1J6PA 4JTCA 2D1ZA 5CC6A 3E02A 3WLHA 1GVQA 3ZVHB 1VB9A 2YGYA 3EOSA 2TODA 2FDSA 2PTDA 3L5AA 1KFEA 3GXNA 4W5UA 2FH8A 4QG8A 2X8RA 3GH5A 4MNKA 1QI3A 3OBKA 4AC7C 4RK8A 3TSBA 3QV9A 3AIRA 3I6EA 3VU2A 1EJSC 4UR7A 4XZIA 3ZR6A 5GNXA 1EEXA 4MVAA 4R7OA 1DJGA 1TYGA 3GDTA 1REQA 5F1UA 1QRQA 4MWAD 1TCMA 2BVTA 2HS8A 4BCEA 1T8QA 4FB7A 3EDDA 1L0PA 3AS3A 3VIKA 4IOTA 4AD2A 3MJYA 3RITA 4GYKA 4C91A 3OBAA 3GB6A 1A5AA 5AC5A 2GWNA 4NIRA 3MPGA 1LUCA 4N9BA 4Y9AA 4W9TA 1JRCA 3P0XA 1ZP4A 4XZ9A 3STCA 2BFGA 4V15A 2EEXA 3HJEA 1NWRA 2ZQ0A 4KRTA 1PSCA 4NZ5A 4GGHA 5I06A 2HROA 4OV4A 1CX9A 4Z17A 4ERGA 3A4XA 4O1BA 3GNOA 3NXFA 3T8QA 4FNRA 1GQNA 1PX4A 2XIMA 4BQ5A 1IR1A 1XS2A 4K38A 4RDWA 3DYMA 2DFAA 3W29A 4GFSA 1XH1A 1WKYA 4WY0A 3JUGA 3Q67A 1AH3A 4W8LA 1IR2A 5F7UA 7TAAA 1FKWA 3BG5A 3VGDA 4NRRA 3B4YA 4LJ3A 2O56A 2VR5A 2NQZA 1RP8A 3FN9A 1XG4A 3TWAA 1GQLA 4DWSA 3SGUA 4NAFB 2F6XA 1B9BA 3H4WA 1XBYA 2CZEA 2OR2A 3AXMA 3ALGA 3RRAA 2PTZA 5JVLA 2HQAA 3LD5A 1RCOB 3S3GA 1A53A 3RCYA 4CQ8A 4JKMA 3L4WA 3S42A 3EXRA 4XZLX 1DJXA 1UR1A 1AQMA 1AL8A 1BF6A 4JDBA 3N4FA 2NXHA 1EX1A 1V7YA 4IISA 1QUMA 4H2CA 1WKDA 3H7UA 4UIOA 4HSNA 4EPEC 4FF5A 2IW0A 1UPPA 3CS2A 4JS3A 3T4CA 1Q7QA 3V18A 5A8MA 1A3HA 4K3ZA 1EHNA 2PDHA 1WDWA 3AHZA 3EXTA 3WN6A 1MZHA 5FSEC 2DVXA 1UKTA 1RVGA 4OGZA 1YW1A 1EP3A 4Y9OA 5ECUA 3BV4A 4X3ZA 3RR1A 2BY3A 1PWMA 3GHSA 4XQ6A 4QLKA 1DOSA 1P7TB 1FCUA 3E0IA 3PZQA 3HB9A 1CIUA 4C90A 1Z44A 1UR8A 2YXOA 1XIMA 4X61A 2VCBA 3SY8A 3PF3A 1UMLA 3ZR4A 2QGHA 3GHTA 4F0RA 5E9XA 4PBGA 3I7QA 2VC7A 4AX7A 1UQYA 2DZWA 1JZ3A 1EJ7L 1VPQA 4K1GA 4NYUA 2WHMA 2GSEA 2D20A 1P1MA 4Q8WA 3NQAA 5KINA 1A5OC 2HE8A 3BO9A 4GK8A 4S3JA 3IK4A 1KA9F 1W0MA 3IIZA 3IV8A 3H53A 3MP4A 2CETA 4JIEA 3GUWA 2FTYA 2UY4A 1JI1A 5LA0A 4LTSA 3L4ZA 5FF4A 1DWAM 1D8CA 2QV4A 5DMMA 4IJBA 3ARRA 4FOKA 1OWQA 2V0TA 3VKCA 5EBAA 4HD5A 1FHUA 1S5NA 2EAWA 5EGRA 4MB5A 2YX0A 3W7LA 3PWAA 1IF2A 3W1PA 1KTCA 2J8TA 3UG3A 3T6CA 1EJUC 1A0CA 1KR0A 3URAA 3S2JA 3K4DA 5C54A 4FXJA 2YA1A 1W8GA 4PA8A 4R7WA 4XBJA 4HNOA 3H26A 2Y62A 4DB7A 1R2TA 1Z8AA 2ZZ5A 4PCNA 2MNRA 1Q6CA 3R43A 1XLMA 1PKMA 2TRSA 3SBFA 2EPMX 4J5NA 2J7BA 1CYGA 2ZDRA 1BKSA 3A64A 4IH3A 1B9ZA 1ZJBA 2XIBA 1E1FA 2VOTA 5TNVA 3QLDA 2OMAA 1F4HA 2WZMA 2DJLA 1J0IA 2E68A 1OZMA 1GHSA 4OE7A 4HZ6A 2TYSA 2VM8A 3GXPA 1EA0A 3FEQA 4I3GA 5MHBA 2V5DA 3KBMA 1NELA 4K8EA 3BGAA 1DQXA 5D2VA 4FNPA 5A6BD 1PVNA 3CUXA 1R2SA 2JE8A 4JY9A 2DJXA 3E6EA 4NZ3A 3URQA 2DT0A 3ZFHA 3KAOA 3QGKC 3D0CA 4M29A 3ZSSA 3UJFA 2XN0A 3B0UX 2B7QA 5AHEA 2X41A 3T44A 4CN1A 1JDFA 2KX9A 4KWVA 4J3WA 3AMCA 4DF1A 2CXEA 3VVGA 2OZ8A 3WQFA 4WDXA 4QM1A 4CKQA 1S2UA 2B7OA 4KESA 4ML9A 2J4GA 4GQ0A 1JCTA 2Z2UA 1KM5A 4J3ZA 5G1MA 1JPKA 2YFNA 1YE6A 3W9ZA 3G1HA 1C7TA 3TQVA 4QEHA 3IJLA 4RNJA 1AQ0A 2CEQA 4N02A 1Q6FA 3VNJA 1NP2A 1XFBA 2YCKX 3KDOA 2RJGA 4P2VA 1F3TA 2J7HA 3RN6A 1U83A 1UD8A 2R24A 4G56A 3T40A 4ES4A 4H6KA 1AMYA 1NWTA 4FO4A 5FACA 1DORA 2IQDA 4MWAC 1W8SA 2FTWA 4UMCA 4HGXA 1S38A 3EDJA 2DZTA 2YL6A 4FLQA 4UTLA 3NGFA 1XW8A 3NQEA 3QKZA 1AODA 1E72M 3ZLGA 1FHVA 4GABA 2E4TA 1JL8A 1F3WA 2HZGA 4JPGA 2DQXA 5LA2A 3ITYA 3C61A 1G7UA 2A0NA 4IIGA 5FOOA 1PTAA 3AU6A 3IVSA 4ADSA 3H55A 4J3SA 3W88A 1XI3A 2E9BA 3TA9A 4M6UA 2WVTA 4PRRA 1ONRA 4RL3A 2QEZA 1ZPTA 3KCOA 1JD9A 1BQCA 2EHHA 4GVFA 2HCVA 3C86A 4UFLA 4DO4A 1W5NA 3FVMA 3V7PA 1QFEA 1JUEA 1LQAA 3W7HA 4ECLA 1GUVA 4UQBA 4MWAA 1XLKA 1GG0A 3LCHA 3GC2A 3WJSA 2EG6A 4DQWA 4N2YA 1BD0A 3CL8A 3UWVA 2C0HA 3CUHA 4FXRA 1O95A 4UFKA 3EPOA 3G2GA 4PYSA 3SRHA 1TMQA 3OG3A 3WLPA 3M9YA 3NL5A 4X0NA 4CU8A 2W91A 4P8XA 1Q65A 3GK0A 1VJSA 5CPTA 1PZ1A 3WD2A 1J11A 1BPLB 4ZB0A 4PMZA 4GA8A 4PUDA 4ENLA 1T99A 1AJ0A 1VRDA 3HZ3A 1J12A 2JKPA 3QPZA 4B91A 4M7SA 1RD5A 3LTSA 3JU2A 2C18A 1E15A 4MKVA 2PDIA 2JEPA 3NSXA 5I3GA 3CHDA 3MBFA 1H62A 3PP7A 4QCEA 4UNLA 1DTNA 3M0HA 1UBPC 3WH9A 3L4YA 2DSKA 3BMVA 3BANA 3CV2A 1JNDA 4FA3A 2RFGA 2C14A 2REQA 4F0KA 4UQ9A 1XLCA 1RBLA 9XIAA 1W9VA 1EZWA 3DFNA 4ZQMA 3I6RA 3UZYA 3UZ5A 3WF1A 1J18A 1DTUA 4WSHA 3CHVA 2ISDA 4J3XA 2DIKA 2X1SA 4YJ5A 3F2BA 1UJPA 4HA4A 4YWSA 1RA5A 3E12A 3WFLA 4ZXLA 1CEOA 2VUNA 3P8JA 4H8NA 4Z42C 3FJLA 4IFOA 2V3FA 4Y8EA 1GVFA 3THCA 3BOXA 1E9LA 3H2CA 1IEWA 4OTKA 4C6KA 5I3FA 3N6HA 3GU2A 4CU7A 3NM1A 2QJGA 4UR8A 5BZAA 3XIMA 3VIFA 3H21A 4K8HA 1O68A 1TELA 3KFTA 4CD5A 4LAUA 3N15A 3CASA 1B3XA 3H70A 6REQB 2ZRVA 4UTHA 3PANA 3U7BA 1EPXA 3VZZA 4IM4A 2CERA 3CWNA 4ZO8A 2D3LA 4Z2JA 3L2LA 4M1RA 3UXLA 1ODUA 1KLZA 1Q6EA 1E6NA 4H3DA 4XX6A 4X63A 5MF5A 1LOSA 3W84A 3V5FA 5LKYA 2ZICA 3NOEA 3L0KA 1C92A 1IZCA 2G37A 1EJRC 2PODA 3H24A 3QBUA 4Q4MA 5C6MA 2D24A 4C6BA 1VQTA 4TVCA 2CXGA 4DXXA 3BLDA 3VZXA 1TVNA 3M7SA 5CKSA 1W5QA 4XUGA 3G1FA 4US6A 4K39A 1E6QM 3BICA 4DJDD 4L80A 3W2LA 1V6WA 4I9JA 1ZJHA 3GH4A 3CBWA 4WX2A 1V03A 3HV8A 4DAFA 4O4WA 2HPMA 5LZLA 5F2LA 2XIOA 3CT2A 2WZEA 2WHKA 4Q4QA 1QOXA 1KTBA 2KAUC 4CNOA 1PYFA 2NZLA 3H7VA 1B1YA 1SGJA 3S1GA 4O14A 3L7RA 3MI3A 1UD3A 4QJ5B 1E73M 2V63A 4IFKA 2ZWZA 2RGLA 4RLIA 3VXGA 4LNYA 2ZKMX 2PTWA 4XG1A 3W7IA 3M0IA 2WJDA 5HXMA 1UBSA 1JRBA 4RPPA 2E77A 3MW7A 1P4CA 2J7EA 4QDPA 3WDRA 3AXIA 3WFZA 1GPWA 4ONVA 5A8QA 2I9EA 4H4IA 3L4XA 1UD4A 3F4NA 3VOJA 5K2ZA 2WBKA 2V82A 3VX1A 3VGEA 1A5LC 3N2XA 3EWDA 2OG9A 4XK2A 4A29A 2FLIA 2V69A 3NQGA 3B0XA 3GTXA 5IFTA 2E9MA 1IXOA 2O4QA 3P67A 4H7CA 3TJXA 3HA1A 1N8IA 3ITTA 4BZYA 3G18A 2VX4A 5A8PA 3S4TA 5LA1A 2KZHA 3PZVA 3OGVA 2QUUA 1TB3A 1FCQA 5DT7A 5LYRA 1HXJA 5GQBA 1H4PA 3M0JA 3KBNA 2TSYA 4NZFA 5A6BA 4HSOA 1ZCCA 3ZLHA 5BXSA 1UR3M 1EP2A 3WK0A 1I1WA 3O05A 3G1AA 1BWKA 1KFWA 2EBNA 3LV6A 3WLMA 1Q8AA 4PBEA 1JR1A 4BWLA 1UJQA 3DYOA 1P0DA 4AY7A 4FR6A 3R11A 3QV8A 3SGZA 3TTEA 1DWIM 3W1MA 1W9UA 4MG4A 1KWKA 5KZDA 5TIMA 5A6AA 4PN2A 2IS7A 1C9WA 5C55A 4TQTA 3MT1A 4NQ1A 1LL7A 1FUYA 1MVYA 1E55A 2Y24A 3VOIA 3K1DA 4GIRA 4IWWA 5HJLA 3CQJA 1B3VA 3GD6A 3MUZ1 3B0YA 4G7EB 2VZOA 2A7NA 3U4AA 1U30A 1AG1O 2HTMA 3L65A 2P1FA 1XLDA 3L21A 4ZTXA 1TJPA 2XWDA 3MI6A 1E43A 1XLHA 4JD4A 2YCLB 3WD4A 3SI9A 4L65A 3QSRA 1CB7B 4O1DA 3GIPA 1QPNA 3UR8A 2YKKA 3M5YA 1Q7MA 3NPXA 1TUFA 3THAA 3OJGA 5CZJA 7CGTA 2QCDA 5HNNA 1ME9A 4C6NA 2TMDA 3FSTA 1GKPA 1OEPA 3QMTA 2ZE0A 1IE7C 2G4JA 2WC3A 3VDGA 2PRMA 3PBWA 4GQQA 3PBGA 1O4UA 4IPNB 4AZCB 2WSKA 4PBFA 3NIYA 5DF0A 4L1GA 3LCFA 4L4LA 3KE0A 3G8EA 3CTTA 4ZO9A 2PDYA 1V3HA 3C0SA 4Q4KA 4F9DA 1EUNA 5FJOA 1KM1A 2GLKA 2QDEA 2FPTA 4UTIA 3CQHA 4I9TA 1EGZA 2Y1HA 3CAKA 1KQYA 1XQKA 1TTQA 3FYOA 4LRTA 2X7VA 5DCEA 4CCEA 4JHZA 3H6OA 2W61A 2V5CA 4YTRA 3N18A 2WZHA 2D0FA 3WBYA 3WMLA 3GBDA 1FWGC 5D9PA 3AO0A 4NZJA 3N12A 4S3AA 4AZ5A 2NV1A 1W5MA 3DGRA 1H7XA 4GBDA 2GDUA 3MWAA 1NF7A 1QI4A 4N9DA 1KV5A 2CZFA 1HKJA 2YW3A 4LVDA 3GHUA 3ARTA 2J8FA 1UD5A 4R9OA 3QPYA 4FF7A 2YYUA 3W53A 2QF8A 3TXVA 3S5NA 4B90A 5AHIA 4HHLA 3T2OA 1R6WA 3G1DA 3UBPC 3SJ3A 2BHUA 2NQ9A 4OKDA 3LGEA 3W87A 2WVSA 4LYKA 3HIJA 4AY1A 3OP2A 1MW3A 4HPGA 9RUBA 3CMFA 1XSJA 4PZVA 4WOQA 3VNMA 5KETA 5BWFA 1U5VA 2VFEA 1OG0A 1V6YA 3U4FA 4RDZA 4WY0F 3MC5A 3TFXA 4G7FA 1DWGM 4S3DA 3LTYA 2GQ8A 2OFJA 2ZA3A 2XIQA 3W2UA 2DZXA 2FGZA 4GYFA 5DELA 5BOEA 7XIMA 3VABA 4IIEA 5D2XA 2OLAA 1W2VA 1XUZA 4GUHA 4WXYA 3MJMA 1PX3A 1MEHA 1UWQA 2J6XA 3H2NA 2QLYA 2VTFA 1S2VA 2FFIA 3ITVA 2NV2A 1KC7A 1I8JA 2WMJA 3FCPA 5T26A 4MZ1A 3DI1A 3LM3A 3NZPA 2SFPA 4UFHA 4EKJA 4UQAA 2B81A 1KCLA 1UR9A 2ATMA 1FWNA 3U7VA 2E09A 3B9AA 3MSRA 2A3LA 3MSYA 1KGWA 4Q8PA 1MUWA 3M5VA 2XH7A 3H2MA 3ARSA 1O12A 2E1DA 1HKVA 1IGWA 2Y2WA 3URNA 4DJDC 4C60A 4QJ4B 1Y5WA 2WVVB 3LI0A 4IMCA 5A2AA 3HGOA 3KOZA 5A8NA 4PRTA 3MKVA 1NFPA 2BZNA 4M5PA 2V38A 3NYDA 2JKAA 2WPBA 3R12A 1EO7A 2ZTKA 4LQ1A 4U4MA 4FXSA 5CJNA 3VX0A 1UR0A 1UOZA 3UD6A 4Z2LA 4A8IA 3TFCA 3W7QA 2NLIA 3KW3A 2WW5A 3LPOA 1JYNA 1SM9A 1E4NA 1WXZA 2XFFA 1LG2A 3OEXA 5C9UA 1JYVA 1VCGA 2ISWA 4FR1A 4JTJA 3N4AA 4IQLA 3HV9A 3N13A 2OQYA 2E3ZA 4PUKA 1CNVA 1GYLA 4DJDA 1W5OA 2PTYA 4IPLA 4CCZA 1XLBA 2OB3A 3THDA 4JFTA 2QULA 2O9TA 3OYZA 2X0YA 4F0MA 3WQ5A 2VQTA 3J7HA 4O19A 1PX8A 1QJWA 4MF4A 3OHMB 3LN3A 4ZXOA 3U3HA 1IGSA 3TKFA 3WELA 4A8LA 1F05A 1TV3A 1NQKA 1EC8A 1LLZA 1WXJA 1BF2A 4QAWA 3HN3A 3ZVHA 4HHPA 4JOMA 3VGGA 3GFZA 4B5VA 1MI3A 4YTTA 3M0LA 3HOJA 2OZTA 2Z1BA 3MUAA 4E2DA 1JPHA 3NCOA 5IFPA 4DZIA 5HATA 2WANA 2OYMA 1OBAA 4MTVA 2FFCA 4PH6A 4NZ4A 5XIAA 2XH0A 4IJRA 1XRSA 1UZHA 5DX7A 1NJJA 2FVKA 3KEHA 4URIA 3DBNA 3LERA 3MHFA 4R85A 3R25A 4GVIA 4MY1A 4QLLA 1VHCA 4OECA 2QJNA 1T5AA 4LH8A 4E3TA 3FV9A 2E25A 4H9XA 5HA7A 3V16A 4KWSA 5TQLA 3RLVA 4PC8A 1MNSA 5JUVA 2BXZA 1BTMA 4UFJA 1QU4A 1AA1B 3UZWA 3KX6A 1BYCA 3I65A 2NT1A 4D6IA 5AZ0A 3TC7A 4F0SA 1ZBVA 1SZFA 1DXIA 2FJKA 4PB3A 3STEA 4O8RA 2OYLA 1EX5A 2XU2A 4AD3A 2OO0A 4MWAE 1PWLA 4ZCWA 5BROA 3SO7A 2J7FA 2IUZA 3C2RA 3QM3A 2V8ZA 3EEZA 3WQEA 4W89A 3MCOA 2XPKA 2DIEA 4MDOA 2WOQA 1TWDA 3A3XA 8TIMA 4WRHA 4AMCA 4F48A 3BL3A 2FVMA 3QN3A 1GONA 3NAVA 4AWUA 1TPWA 4AZHA 3OVRA 4PMQA 3L4VA 3B3DA 1AD1A 3O2LA 2ZRYA 3I3BA 3WDPP 2WAGA 2OEKA 1X96A 3LPGA 3NZ1A 3ATYA 1G4EA 4MYXA 2AAMA 3QMRA 2INEA 4L6DA 4NAFA 4MNJA 5DN1A 3WEMA 2XFWA 4HNCA 3QFWA 5F4WA 3GWQA 4P8WA 1A0EA 1XRVA 2PZNA 1MW2A 1SJBA 1IT7A 3KL3A 2XG9A 5JBDA 3MMWA 4NKCA 2HBXA 2HVMA 1DVJA 5DEZA 1UA7A 1X8FA 2E67A 1O5QA 4TUFA 2PF0A 4C6EA 4JTLA 1PE1A 3STGA 4FX6M 2PFHA 1H61A 3PZNA 3TR2A 4QCFA 3VCRA 4BR1A 4G1KA 5K4ZA 3NVDA 1R3TA 3GSMA 4XISA 2I9UA 1OX5A 5E0FA 4HZ8A 1PL9A 1QNPA 4J35A 2J7CA 4INFA 2CBIA 2W9MA 1JCJA 2YA2A 2RHGA 5FEWA 2BY2A 4GRSA 3KRZA 4QSFA 4YVVA 2DSZA 2I5GA 4KCUA 4Q8NA 3GVQA 1LWHA 2WNNA 3WD3A 3FS2A 3NM3A 2VUYA 5KEZA 1P7TA 1WYIA 3BK0A 3H22A 3RJXA 1MO0A 3QXBA 4LVFA 1E3ZA 1JPDX 1XF0A 4GD0A 3VNZA 1FX6A 4WOZA 5C7HA 3W25A 5EKYA 3A6OA 4HU3A 2JIWA 3ZVIA 4LANA 2G97A 4REQA 4HNUA 1J01A 4G2DA 3VD3A 3PPFA 5CPLA 2DDXA 3BOFA 4NSBA 5ENLA 2JF7A 1TV5A 1J2BA 3NNTA 1SFSA 1VRXA 1E1CB 2PDWA 1OD0A 3A24A 3QKEA 3SAZA 4BQ2A 1L9WA 4KBXA 1FXPA 4NG3A 2CC0A 1XYLA 3WEOA 1NIUA 2EGZA 2YDRA 1E9YB 1XM3A 4YYCA 3CJPA 1SSDA 4L9ZA 1R3YA 2CZ5A 2FPYA 1I0BA 3UESA 2GDQA 3O0FA 1ZSXA 4AD5A 3RX3A 1ICSA 1PXGA 1EGMA 4R53A 5ABGA 3CAQA 4R7JA 5C70A 4P8VA 4EXQA 3EAUA 3WLOA 3L9CA 4HYWA 1HT6A 2OEMA 2VELA 1FRBA 3KZPA 2DZVA 5E70A 4UTTA 2WKLA 3WDQA 2BODX 3CIWA 1CPUA 2BHYA 1GPFA 4L56A 2G3FA 3DFQA 1HJUA 1N2VA 3VM5A 4ZOBA 3NQCA 1JDAA 3GRIA 1EXBA 3UY7A 3AXXA 3NDOA 1TV2A 3A9BA 3LHVA 3M6YA 4UTFA 3DG6A 1DKWA 2RDUA 3ABXA 3R8RA 3E5PA 1H3GA 4L7ZA 3LCGA 5I23A 3WNOA 3RM8A 3OLEA 4DXKA 1VF8A 4CVWA 2A5HA 4J28A 4XKYB 2D3NA 3MP5A 4YIWA 3H2AA 1EKOA 4IX2A 4JX4A 4D6CA 1FWEC 2ZXDA 3H8AA 3K8KA 3T0BA 3E2QA 3TNBA 1EDTA 3PPGA 2ZX5A 3DIPA 4Q7BA 1YLVA 2GJPA 1ENUA 2BMBA 1F8IA 3QOKA 3RM4A 3IJQA 4AWTA 3EOOA 5FJRA 4MMWA 4N4QA 2PB1A 4EP8C 3P84A 2GVLA 4NVTA 1GGOA 3GNRA 3SUVA 4JQ2A 1G9HA 3S6OA 4O1CA 3CPRA 1SUXA 4GGBA 1WAUA 3CZJA 1ODZA 4Q4OA 1SZNA 1PUDA 4IXXA 1TIMA 1SO4A 3HG4A 5ABFA 4JYEA 4WY0B 2RAGA 3R0KA 3F1QA 1JAKA 1AQFA 4DF2A 2PLJA 1XCWA 2XH2A 3STFA 2O9PA 3DECA 3IUIA 3R6IA 2A4AA 3HG2A 2XJ7A 2F2HA 1KD0A 2HISA 4CQCA 4UTUA 4DWSB 3VI2A 1QPRA 3VILA 4XWUA 3W7DA 3LA4A 1QHZA 1EDQA 4D9PA 1GWJA 3E1F1 3HO8A 1H5YA 1KR1A 4X2PA 2I5QA 2ADAA 4O0KA 1PHQA 3Q65A 1SZEA 5F1VA 1PIGA 3CH0A 3O6AA 2C13A 5LGZA 3C2EA 3IK2A 5REQA 1K9FA 2UWFA 4MSSA 3PN8A 3T07A 3V5CA 5HMEA 2WCAA 4YTSA 1PB0A 1CXHA 1SMDA 5LNVA 1AVAA 3PJWA 4PMDA 1YDVA 3ZJ6A 4A35A 1E6ZA 1Q66A 3IJIA 4RJEA 1ICQA 3CAWA 4C6OA 3DENA 4ZFMA 4Z0JA 2XSXA 2IQTA 5FJIA 1XLFA 2QZRA 4OZOA 2WMHA 3WJXA 3SCNA 2PGFA 4A05A 2VC6A 2PDGA 2CKSA 2PDQA 3R13A 3F4CA 3A21A 4I5XA 1W6TA 3HF3A 1A3WA 1GVYA 4ZB5A 1POKA 1JQVA 3APYA 5TD4A 1OC6A 2D23A 4V1XA 4RNHA 2V5LA 1R3WA 1Q6QA 4GH3A 2VZUA 4AH7A 3PNUA 2A6LA 2HVNA 1GVSA 2QS8A 4MKSA 3W27A 1UKOA 4LVBA 3ITLA 1XYAA 5E5CA 1QAPA 4R5EA 3SY5A 1YADA 1FH7A 4UXDA 1GOQA 1Z48A 3TSDA 4HOXA 5BYWA 2VMFA 4B15A 4G6CA 1EXPA 4DYJA 3MUXA 4BF9A 3M5XA 5LIXX 1VLWA 5C7VA 1U1UA 4DLMA 3IJ6A 1OCQA 2X30A 5HNRA 4JNZA 4UCGA 1H1YA 3QHOA 4IXHA 4MHBA 1VP5A 2ODOA 3OBEA 3KP1A 4A3HA 1VKFA 1FWDC 4EANA 4C6MA 3QSTA 2ZUVA 1D8WA 3QTGA 2CHNA 4DO6A 1K9DA 3ANUA 4GCAA 4PMRA 2QIIA 1JCMP 3SRFA 1CT5A 3OVQA 3GM8A 1UUMA 1H5VA 1LLOA 3WK2A 1O60A 1I2RA 3HMJG 4GCXA 4GUIA 4AC1X 1PS9A 2V68A 4AU0A 3GW0A 3VTRA 1ITUA 1EH9A 3OPSA 4MJZA 4GQRA 3TYCA 4I9AA 3FIGA 2OPJA 2DZUA 2WQPA 1XC4A 4MPQA 3MUCA 4B9ZA 2VFFA 4GY7A 3FYPA 1YDNA 2WKJA 3ARPA 4JTDA 2CBUA 3VDAA 2XVKA 2AMGA 1H1ZA 1JZ2A 5BOFA 3DG3A 1I2PA 1BVNP 1XHGA 4AIEA 3VO0A 5HWNA 2ZVIA 4IZGA 1ZALA 4NJGA 1B4EA 4DBWA 3C0QA 4KFNA 6REQA 2BGQA 3RG6A 3IACA 2WV8A 1KV8A 3N9KA 3AWOA 4FAMA 3H4XA 1X8CA 1CXLA 4JKKA 2Q8XA 1ECEA 3TTYA 1X6UA 1TX2A 3II1A 4JTHA 1ISZA 1KM6A 1E0TA 2YB4A 3QPEA 4GE8A 4MIMA 8CGTA 2HE5A 3OZOA 3MDWA 1B0IA 4O50A 1HJXA 1A5MC 1UC4A 5CCZA 2NWRA 4IPPA 5LHFA 1GW1A 1XYMA 2YBVA 3YPIA 5TF0A 1V5XA 3TE9A 4JFUA 3OGSA 4FALA 1H7RA 3NR0A 4BQ4A 4MB1A 1W31A 1GNXA 4MY9A 3QHNA 3BLFA 4O1EA 4E6MA 4JL1A 4B92A 4P7QA 1OFBA 4LNCA 4DJFD 1DHKA 3U2OA 3FA3A 3JVAA 3PFMA 1BAGA 5I03A 3NQMA 3AYRA 4E8DA 2OODA 4HMCA 2A3AA 1UB3A 1V02E 4EVZA 4RV8A 1XICA 3ABQA 1NP0A 1XIFA 3B8WA 1A47A 2XIJA 3LHTA 2PSNA 3EA3A 3PULA 1UWSA 2ABBA 2PI6A 4FZIA 1H11A 2DSUA 1VFMA 1UUQA 3W85A 4K8GA 3RFAA 1JDEA 2GSHA 2FMOA 3OQEA 3TWBA 1B31A 2HK0A 2RDXA 1F5ZA 4PODA 1LCOA 4HKPA 4PL1A 1PKNA 3LGDA 4UTWC 3H2OA 4TMCA 1EOMA 6CGTA 3NWRA 4JIPA 1OF6A 3WDIA 1Z41A 1VAHA 3BAXA 3W37A 1TX0A 3SQLA 4PFMA 1VYRA 4C6JA 1ADOA 3CUFA 4AHOA 1CZ1A 4BI6A 1IXQA 1OCBA 1V3LA 2DP3A 3HPFA 4NNAA 1F6KA 4C6DA 3IJ8A 3KLLA 2OX4A 4F79A 3UW6A 3VDBA 1WDPA 4CEUC 2PA6A 4UWMA 2A3HA 5TBOA 4LCSA 2XDFA 2ZIDA 2BTMA 2AL2A 3BXWA 4MKNA 1LOQA 1FWSA 1OJXA 4GY0A 3UWUA 1OYBA 3U5UA 5CAHA 4PFHA 4UQCA 1VD6A 2EKGA 3OHIA 4UTWA 1QOPA 2UY2A 5JBFA 1Z89A 5E9AA 4ZGYA 4H7VA 2QF7A 5DQPA 4BF7A 1W1TA 4JFWA 1ML1A 1YYAA 1DIKA 3M0XA 1UPMB 1R0MA 3WNPA 4QX4A 1R8LA 1S1RA 7ENLA 3OIXA 3DXIA 3UR2A 3APGA 4UFMA 1Y8BA 1U5HA 5K9XA 5MKGB 2MUCA 3WK1A 3GX9A 3AS1A 3IANA 4GZEA 4KFPA 4UB9A 1L6WA 3S5ZA 3K5XA 4FIRA 1FWTA 1NFGA 3KTCA 1TPB1 4F66A 2C1HA 1PTDA 5FL1A 4V28A 4Z1BA 3G0UA 1CLVA 3EDFA 3VINA 2I17A 4A2SA 5HNTA 3W1XA 1Q2RA 4XSMA 3TLLA 1FTXA 2D2GA 5A94A 3W7JA 4XTIA 1C8XA 3LNPA 3VNKA 4B16A 1PZ3A 1H41A 3P81A 1W1PA 4V33A 4L9XA 3WLJA 5EL1A 2G3IA 1LBMA 4HPJA 2REQB 5FD0A 1I2NA 4W85A 5G1TA 4G7EA 2R8WA 3IJDA 3VMPA 4JTKA 1OCNA 3PSVA 5FJTA 5FSDC 3SB0A 4A2RA 1SQ7A 4KW2A 4YVPA 1GORA 2Z27A 1AH0A 3MS8A 1IIHA 3W7CA 1CXEA 2YCLA 3G24A 5FCZA 1QK0A 1O5KA 3RDKA 1W3TA 2VENA 3TV8A 2OX1A 2QCNA 4O16A 1PKLA 2V67A 3NQVA 4HP5A 5AHFA 4QP0A 4V2XA 5E6ZA 2GDVA 1WZAA 2NSXA 5EB8A 3VOHA 1VIWA 4HHMA 2Q71A 3DDMA 4FMVA 3QY7A 1CI1A 5G4HC 5KZ6A 1A5SA 4GXWA 3WBXA 3L5MA 3GR8A 4IPIA 5I00A 1IWAA 2BASA 2IMRA 3EPMA 3KTXA 4P7RA 4N9EA 1GTHA 1XP3A 4HJFA 2QUVA 3UERA 4IMDA 4BEUA 4CD4A 1B2YA 3VCCA 2WZTA 4LBUA 3QZAA 3U5YA 1CWYA 3URBA 1TFVA 3A12A 1RV8A 1IWPA 3CL6A 1S3TC 3WH6A 4B5NA 1JF5A 1E1EA 3SADA 4A21A 4GUFA 4JIRA 2J74A 3ZMRA 3LLXA 3V75A 4K7VA 1US2A 4M3PA 3FKKA 1ME8A 1WBJA