2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
1BEUA 4X2RA 2A6LA 4JR5A 4JDBA 3WFAA 2BZNA 4XZ9A 3THQA 3G1DA 2CLKA 5G2HA 5KMYA 3IGSA 3O1NA 2C0AA 2YYUA 1VPXA 5D2VA 2QAFA 4K38A 3E02A 4OU1A 1J2WA 5SWUA 3P7YA 4L4MA 4YCOA 1RQEA 3H53A 5G5IA 4JTSA 3EWZA 1MEHA 2FB3A 2V2CA 3DXIA 3EKLA 2C16A 3SSJA 2NXGA 3M7WA 1JUEA 3ZWTA 3DENA 3HO8A 1K8XA 3L0NA 3P80A 3G1AA 3STGA 3O6DA 1DVJA 2QR6A 4NNCA 2NX1A 1OHLA 1SW7A 3VE9A 4FX6M 3PS7A 4GUJA 1UASA 4UTUA 1O5KA 4EF8A 2C1HA 1OX4B 4UTHA 1DQWA 2PE4A 1IXOA 5CKSA 1F73A 1EIXA 4UXDA 4LRTA 1Z42A 1KLYA 3QQ0A 2CLHA 7TIMA 1XL9A 3VI2A 1NAL1 4XUGA 2ZZ1A 3TNOA 1S3HA 3W7IA 4AMAA 1K7EA 4UR8A 1MXSA 2Y7FA 3HBLA 4YL2A 4XBKA 3GKFA 4NJIA 1ML1A 3TJLA 3EX6A 3W2LA 4I7VA 1C29A 3LHUA 3NL3A 3M5XA 5K9CA 4EWND 1EWEA 2EAWA 1OG0A 3G1YA 3R12A 1FWTA 4IPJA 4O1AA 5F2MA 5CPOA 5F4WA 3G0XA 1W3NA 4MLJA 1HG3A 1VYPX 3B06A 5HJLA 1EX5A 1NVMA 1F6KA 4MIMA 1TREA 2Y89A 1W5PA 4OT7A 1W8SA 1X7FA 2FFCA 2AQWA 3W1NA 2DZSA 3PG9A 2V2DA 5D30A 1SZEA 5LNVA 1KFKA 2DZTA 5DBUA 3GDTA 4DXVA 3TX9A 2VFIA 3FS2A 3MI2A 3L21A 4BR1A 4NJHA 5EY5A 4Z1AA 3O05A 4KKXA 2YX0A 1YPFA 4UTJA 4R7JA 2FJKA 4RJEA 1W0MA 2G5WA 1NF7A 3MWAA 4NXKA 1V7YA 2CZFA 3IVUA 3ATZA 4LOCA 1QPOA 1G6CA 1HUVA 3KRSA 4RZ6A 2ZDRA 2JBMA 5D09A 1RV8A 1SU5A 1G67A 1ZCOA 2A2IA 1IIGA 2E6YA 4Z1DA 3G0UA 1LLZA 3W87A 3EWWA 4ZVJA 4XKYA 3HPXA 1Q6OA 1SFJA 1G69A 3ABRA 3SJ3A 1W1ZA 4UFMA 1W3IA 1OVDA 1GJPA 4RKAA 3PUDA 3QSRA 3LTSA 2P0OA 2DZUA 1OFBA 3C2EA 2NX9A 3PBUA 2EF9A 2GPTA 2V5BA 3CPRA 3EX4A 1KTCA 2CZ5A 1GG0A 3C2VA 4Y90A 1KTBA 3PC0A 4JIQA 4OV9A 3W83A 4PH6A 1W5MA 3NXFA 4M6PA 1RQBA 5CPLA 3DFSA 4UIOA 3A21A 5AHIA 2ZZ6A 4NZJA 3L68A 4X9SA 2V0TA 3NQ8A 1JRCA 1WBHA 4S2CA 5DCBA 1ZAIA 4KFOA 3LCFA 3W7JA 4NJKA 4O15A 3UWUA 4M6VA 3U8GA 2YSWA 4AHPA 3QM3A 3W2KA 2BX7A 1FWWA 4C1KA 4ZZ9A 1WOAA 2V82A 2WSYA 4LS1A 4L4LA 3ANYA 3STEA 3TKFA 1QWGA 2FIQA 4JYFA 5FEWA 3TSBA 5EL1A 4AAJA 3S0CA 5C5YA 3BLEA 5K9DA 1H62A 2ATMA 3T40A 4FEZA 1W37A 4WY0F 3GAYA 4KFPA 2Y88A 3M0ZA 1XBZA 2VEKA 3CM4A 1PIIA 1DJNA 3NEVA 2R91A 1P0NA 4RV8A 4GNJA 4JTTA 3CEUA 4A21A 1CX9A 1GVRA 4UNKA 3Q37A 1FDYA 4JD4A 3QW4B 5I3FA 3FOKA 2TPSA 1QAPA 1G4SA 1Z48A 4MJZA 3W9ZA 3C6CA 4MPQA 1KM3A 4OQVA 2PC4A 2H8XA 1C9DA 1YYAA 4LVGA 2Z2UA 1B57A 3WJWA 2W0UA 1YPIA 3LHWA 2X16A 2X30A 1PVNA 5FEPA 4O50A 5E0KA 2NX3A 4O4WA 4CLMA 5FESA 3WJSA 1OK6A 3NQEA 3SZ8A 2HSAA 3L5MA 3W7MA 3P84A 3UWQA 4N2YA 3L2IA 4YWIA 2ZA2A 3QQ1A 3NVTA 3UWYA 4RCXA 3DI1A 5HR6A 1WBJA 1LCOA 3UD6A 1TTIA 4HNVA 3GB6A 3Q58A 3W3OA 3FKRA 3C61A 3SW6A 4ONVA 4TIMA 1XUZA 2P1FA 3NZRA 4MYXA 4QQ3A 3LTYA 4R34A 3G3MA 2BLEA 4TR9A 1QCWA 3BLIA 4O0ZA 2PRLA 5KSWA 1YXYA 3LHYA 3L5LA 2E68A 4NVTA 5LHEA 4ADTA 4WD0A 1ME7A 1A53A 3MW7A 1SZNA 3LBMA 4FXRA 3DFTA 4LWWA 4UFIA 3PR2A 4HNTA 1PHWA 1H60A 4WX2A 1RQHA 1T8XA 3TFCA 2V5LA 1G7VA 2TSYA 2QAPA 3PWAA 5LGZA 4O19A 3W6YA 2WO5A 4I7UA 4DEFA 2JGQA 1KA9F 1SZGA 3HF3A 4JTKA 4MKNA 3TW6A 1K8YA 2ISVA 5FF0A 1F6PA 2Z6JA 3N3MA 1QMLA 3NYZA 1SQ7A 1XBYA 5DXXA 1ZY9A 4M5PA 2YW4A 3O8AA 5F2GA 2YW3A 2TYSA 1KM5A 4NT0A 3LDVA 3P8IA 4UC5A 4O18A 4JTJA 3UZJA 3G1VA 2TMDA 4PCFA 4JTIA 1TPWA 2ZBTA 1H7PA 3SIZA 2QCHA 3QC3A 1OYBA 1SFLA 4K39A 5KZEA 1LRNA 4ZQCA 3TXZA 3G8RA 2ZZ5A 4O53A 3DGRA 5U7SA 3KFTA 3TQVA 2NWRA 1I4NA 5FF4A 2YXGA 4C1LA 4E0CA 5I3HA 4G1KA 2ZA1A 2O7QA 3OIXA 4O1CA 3ABSA 2ZQ0A 1GVFA 2WNZA 2QUTA 3BG3A 3W1PA 2A0NA 4A22A 3MYPA 5CG7A 4LRSA 4RXFA 3C52A 4BF9A 4DF2A 5CPMA 4MZ8A 3STCA 4LVAA 4JGDA 4BK9A 1XI3A 1HTIA 4NJJA 2DP3A 4JIPA 1I2PA 2QCFA 2A7RA 3NPUA 3QW3A 3WJXA 3P62A 3LHVA 4BWLA 3S6DA 1WOBA 2OCZA 3O07A 3MJYA 3GXPA 1O95A 3PUOA 1V5XA 4Z0SA 3W1MA 3W76A 1I2NA 1XXXA 3P5ZA 3L9CA 1VLWA 5E1QA 3TSMA 2YGYA 4HPJA 1XBVA 2ZTKA 2XFWA 3MBDA 4BFAA 3IIPA 1AL7A 2J9ZA 4IXXA 4TO8A 2Y63A 2Q3OA 4JYEA 2QJIA 3S8HA 1H51A 1G4TA 3S9YA 3LXBA 2NZLA 3W7DA 1S5WA 4MOZA 3TK7A 3QJAA 4RR4A 4FNRA 1FCQA 2ISWA 4K8EA 5J5RA 1CW2A 2BTMA 2ABBA 5HULA 5LHFA 5K2ZA 1F05A 5CZ0A 5FF3A 2YFOA 3I7SA 3H55A 3IIVA 3IIOA 4UR7A 3EWYA 3SR7A 1SO3A 5G4EA 1VS1A 2NLIA 3G1FA 1GQNA 4BI6A 4CQ8A 3HGJA 4HIBA 3FJLA 2Y7DA 5I3KA 3W70A 1JULA 3LCGA 4KFNA 4EIVA 1H1YA 3L65A 1DL3A 1CI1A 3NGJA 4O17A 1KTNA 5IBXC 2RKXA 1R30A 2E5BA 3UQNA 3RU6A 1BKSA 1W54A 5E93A 1M7OA 1TPFA 3S1XA 4XTIA 5DY2A 1W31A 2PCQA 4JX5A 2FPVA 1ZHAA 1MEIA 2QCDA 2E77A 5HQEA 1UUMA 2EGZA 3G1SA 3I65A 1JQXA 3LERA 3QEZA 1ZALA 2A7NA 2DU2A 4GE8A 2B4GA 3TQ0A 1EP1A 5G1YA 1SSGA 1O5XA 4M7TA 4HN4A 4DO6A 3NM1A 1QPQA 2H3BA 4IOTA 3W1RA 3W1TA 4UNLA 3ABQA 3DFQA 2VXNA 3UXDA 1KBIA 1WX0A 3PAJA 2F84A 1U5JA 3BARA 2OX1A 3LCIA 3W2UA 1RD5A 2WV8A 1SPQA 4Q33A 1JUBA 3N73A 1KW1A 1Q45A 1GVQA 4W9TA 2Q8LA 5IM51 3P81A 1LROA 4FNUA 2QUVA 1DORA 3DFNA 5CSRA 1LP6A 4PODA 1R46A 4O1BA 3DHFA 5DCEA 3KVLA 2QCDB 4LVDA 3CTLA 4POCA 1ZENA 1U83A 5LNSA 4Y96A 1FXQA 1KFCA 3W22A 3HPZA 4ADUA 3OVRA 4AWSA 1PS9A 3W84A 5AHLA 5D2XA 1VLIA 4AVFA 2X1UA 3SY5A 3U6WA 3M16A 3W86A 1YTDA 4J9JA 1YDNA 3R8RA 4CNOA 2YYTA 4UTWA 4KWWA 1IXNA 3RNDA 2CLOA 5AC7A 4UMBA 3QRHA 3MUXA 2A4AA 3MBFA 2DZXA 4N02A 1EB3A 3KAOA 4FNSA 1R2SA 1OFEA 1Q6RA 1VCFA 4ZMGA 3NQGA 4WZHA 3INPA 3ZR4A 4NU7A 3IV3A 4MYAA 5AOUA 5CGQA 3LGEA 4PL1A 3O15A 5AHFA 3TDFA 5L6UA 2VENA 3HGOA 3N34A 3FIGA 1GWJA 1T99A 4E38A 1M6JA 5DXYA 4Z1CA 3SI9A 5DBTA 2GQAA 1PCWA 3B05A 1FDJA 5K4XA 1AG1O 1I45A 3SGUA 1GOXA 5EA9A 4JDYA 2I1OA 2ZA3A 1LOSA 3LCLA 3LM7A 3FLUA 5GVJA 4HPXA 4JNMA 2Y7GA 2E6AA 4DPPA 3OEXA 3NQ2A 3G3DA 5D38A 4NQ1A 2BSLA 2Y62A 1ICSA 4JICA 3GR7A 4HSOA 2C18A 3G18A 4FO4A 3QYQA 1JCYA 2H6RA 4UTLA 1YADA 3DKJA 3R5EA 3W1UA 3BVJA 3C0JA 1OFQA 5EPDA 3DHDA 4JX6A 1JRBA 4MY1A 2YZRA 1AW5A 3UY7A 1ADOA 1QOPA 4JTUA 1F5ZA 3PB0A 4JY9A 4LTSA 1BWKA 1FCUA 1FWSA 4DELA 2WSQA 2RDTA 2E1DA 3CQ0A 4ZQRA 3M5YA 3LBCA 2GUUA 1XBXA 3M47A 3WK3A 3W71A 4QSHA 5D33A 4ZQOA 1VYSX 3EB2A 4LC8A 5BNKA 2FPTA 2I9EA 4FB7A 2FDSA 2V2HA 3VKJA 3T78A 1XC4A 1JVNA 4TMCA 1KV5A 3PBWA 1TPC1 4GRSA 1D3HA 4UFLA 2ZZ2A 3TV8A 1QO2A 3MHGA 3NR0A 3QPYA 4UUIA 1TSIA 1JCNA 5AB3A 1WDWA 3QMSA 1OK4A 3UPWA 1OYCA 1QPNA 4N6EA 1BTMA 2QCLA 1GG1A 5AYYA 3FYPA 4N4PA 3JRKA 1VQTA 1VYRA 4I9AA 4WQ6A 3GDLA 2CZDA 3A24A 1XFBA 2R14A 1LLWA 3W7GA 4PFMA 4CNNA 4O16A 1VCVA 5U4NA 3LCHA 5F2LA 3GX9A 3DFPA 5G2IA 3L5AA 3GNNA 1SR9A 3IGUA 2NUWA 3TQKA 1K7XA 4MFEA 4IJBA 2H8ZA 4IMCA 4JS3A 1H7OA 1A50A 1QOQA 3W7HA 3NPXA 3FA5A 3M1ZA 1DBTA 4MVAA 4AXKA 5DCDA 1WYIA 2OMAA 1PL9A 2QCMA 3QMTA 3TXVA 2ZZ7A 3BO9A 4NX0A 3GNDA 1VCGA 3MI6A 3F4NA 2UV8G 3N9RA 4Q32A 1YLVA 3LI1A 3TC6A 1ME9A 4N9EA 3VNDA 3NQMA 3TAOA 5LZLA 3QPZA 5D32A 1EP3A 1J5TA 3W73A 4MY8A 2P10A 3TE9A 3CWNA 2A85A 3PSVA 1OFRA 3GIYA 2ZRXA 5IBXA 3CT7A 3ZFHA 1UB3A 5D02A 3OBKA 1LZOA 3IVSA 4CQ9A 1WXJA 3M43A 4FNPA 3QZEA 1K3UA 3P5YA 3W7RA 4Z08A 3I6RA 1TV7A 3MMTA 2CLEA 4PEKA 3IIXA 3A9IA 1H7RA 5CSSA 3NQCA 3G24A 1W3TA 1FUYA 3OVQA 4RX0A 4LY8A 1HFBA 4EVZA 3LV5A 3HG5A 1OJXA 5KINA 1DV7A 1FBAA 2NUXA 4ZL1A 4MZYA 5HWMA 4DF0A 2NUYA 3LX9A 2E6FA 3M5VA 3MP3A 2FLIA 4AB4A 1UUOA 4Q4KA 3FYOA 1KM0A 4RXGA 4CCEA 3P8JA 2OZ0A 2YR1A 5AN7A 1H7NA 1H7WA 4JTGA 2E6DA 4ML9A 3EWXA 5K9XA 2JKEA 1K7FA 3W7EA 2QCEA 3WK2A 4DBEA 5HNRA 3BW4A 4FIQA 4UTKA 1J4EA 3QMRA 2Y85A 4HT3A 3S1VA 1Q3NA 3A22A 2WJZA 1H50A 1L6YA 1Q6QA 1F76A 1ZAHA 1GPWA 5CZJA 1W5NA 5FF7A 4NNBA 3MP4A 2WNQA 1YDOA 5TIMA 3GYEA 5MHBA 3I7QA 4FF7A 3HB9A 4ZQMA 2ALDA 2NXIA 1K03A 4UTWC 3KVJA 1FCBA 5HWNA 1GEQA 3G22A 5CZTA 3CHVA 3IIZA 4AWUA 4NX5A 3I68A 1ICQA 3PY2A 4LV4A 5EKYA 3S5YA 1G4EA 4BI5A 3UYCA 4UCGA 1KFJA 1ALDA 2HS6A 1TV5A 1X8FA 1FXPA 5EYWA 1KFBA 3TAKA 3E12A 1LRQA 3B8DA 5LKYA 2A5HA 4GUGA 2QF7A 3UNDA 2DJLA 4BI7A 1NFBA 3QSTA 1OFAA 3IGXA 1H5YA 4AWTA 2J6XA 1X1ZA 3M44A 3VCRA 1Q6LA 1VJIA 1TO3A 3DI0A 5F1UA 3W7PA 2HTMA 3DZ1A 1TYGA 1FX6A 5DY3A 3NAVA 2QKFA 4O11A 5G4WA 1OX5A 1G7UA 4LU0A 4P61A 4S2BA 1TQXA 1ME8A 1LDCA 3LHZA 3YPIA 2B7QA 3A5FA 1TPB1 2BXVA 3HQ1A 4IX2A 4MJMA 2DZVA 4ADSA 2VKZG 2G97A 1LBLA 1FQ0A 1OFDA 3MO7A 4K7YA 1F2JA 4DO4A 4K36A 5KITA 2GVLA 3NQAA 4S1FA 3GZ3A 3B04A 2WKJA 4IMFA 3EX3A 2GQ8A 1W5OA 1LOQA 4YXGA 5KTLA 3P61A 1D9EA 4NXSA 2CFFA 3ZWSA 2VFFA 4OE7A 2PRMA 4O28A 3CEPA 3N14A 5BOOA 3T7VA 1SUXA 3TC7A 2JGYA 4GC4A 4NNAA 2DZWA 3TW7A 1L6WA 2VOMA 3UXAA 2QCGA 1I8JA 2JK2A 4FNQA 4YMZA 1MZHA 1H1ZA 4LS0A 3M41A 4TX9A 4JN6A 2QCCA 3IVTA 3CIWA 5EMUA 5A5WA 6TIMA 4QNEA 1SO5A 3VE7A 3Q94A 1L9WA 3NPWA 2QCNA 3NQVA 1JR1A 1YTEA 2G96A 1WV2A 3W72A 1PCKA 2GVJA 2J9XA 4RLIA 1LRTA 5AYXA 1TRIA 5BRBA 3P67A 2XN1A 4DQWA 3W2JA 2J27A 3KOFA 2WNNA 3BGJA 3NQFA 2DORA 5D2WA 1T0OA 4ORMA 3LRLA 4JYDA 1YXDA 4Z1BA 1JCMP 3AO0A 3B0PA 4QAIA 3PM6A 4M6QA 5FF2A 1AMKA 2ZZ3A 5CZSA 3GDMA 4PL2A 2VFEA 1JQVA 2J88A 3W88A 3LI0A 3FKKA 5AHNA 3PSWA 1O94A 3EXRA 5D37A 1SO6A 1IGSA 5KZMA 5FEXA 1IXPA 2V8ZA 2VEPA 4N4QA 2Z0IA 4JXCA 4ALDA 3T4CA 3LRMA 1I2QA 3OA3A 3P60A 3W74A 1B4EA 4UFJA 4O4VA 1KM6A 2FTPA 1RPXA 3RMJA 2C19A 1S5TA 4LT9A 5ABTA 2PURA 4LS2A 3HG4A 3S1WA 2VFHA 2C15A 1FWRA 2CLFA 1H7XA 4KWVA 4LNYA 1NSJA 1LBMA 4AF0B 3TA6A 2GVGA 4UTMA 5I3IA 4HNNA 4IWWA 4M7SA 3LB0A 2A1YA 4Z0JA 3W7LA 1ONRA 1DQXA 1TCDA 4IMEA 3S5ZA 1FWNA 2NV1A 5HR7A 3HGSA 2EHHA 3TH6A 3L0KA 1X6UA 4LUIA 3UPBA 3KVMA 2HMCA 3RF9A 1TIMA 2F7FA 1H63A 4GXMA 5F4XA 2ZRWA 2GOUA 4UTIA 4O14A 3GK0A 3C4UA 3HG2A 5HWJA 1FDZA 3T44A 3UWZA 3NOEA 3KHJA 2YPIA 5LSMA 3EWUA 1SZFA 4JX4A 1OYAA 5C54A 1WA3A 4LVFA 1YXCA 4U28A 1XDMA 3FEMA 2E5DA 1VGAA 2EKCA 2W6RA 4O13A 3HJZA 3MI3A 1G4PA 2OJPA 2ZCGA 4QJ1A 3B03A 5C55A 1N55A 4EOUA 2RDUA 3LCXA 3LXCA 3EEGA 2CU0A 3GVGA 1VR6A 3FJ6A 1KBJA 2QUUA 2TRSA 4JTLA 5KZDA 1Z41A 3S1UA 1LTDA 1O60A 4O0KA 5TQLA 5AYZA 3LOTA 4GJ1A 4ZQPA 1RZMA 1TTJA 1SW3A 4PA8A 3GDKA 2VEMA 2G95A 1PE1A 1TRDA 1UJPA 8TIMA 3BV4A 1MO0A 1SO4A 4MFDA 5H91A 1TPUA 2X1RA 3ELFA 3NL5A 4GUFA 3GXTA 1DKWA 3QFEA 3CC1A 1F7BA 3TJXA 3BPWA 3NDOA 1S5VA 4UFHA 2ZZ4A 1GTEA 1VHCA 3EXSA 2B7OA 3AJXA 3PG8A 3N2XA 3E9AA 3GAKA 3GR8A 3ABOA 2RH9A 2B7NA 1KFLA 4WXYA 2V9DA 3F03K 1IF2A 4UMAA 3WK1A 4A2RA 4JY8A 3HOJA 1HO1A 3FFSA 4DBDA 2HS8A 2NXHA 1RR2A 4WOZA 5AHMA 4GFSA 1JJKA 1QPRA 2X1TA 1M7PA 3C2OA 4RZ4A 2QDGA 4AHOA 4BWLC 2VFGA 5HMSA 2CWNA 3R13A 1R2RA 3KRUA 2YCEA 5T26A 3G0SA 5EBUA 3O6CA 2Y6ZA 1IXQA 3R89A 3GDRA 4UTTC 4JEQA 4MZ1A 3TROA 4MUZA 5D05A 4HKPA 5HINA 3STFA 4PTNA 3N19B 3OG3A 3BG5A 4I7WA 1LYXA 1N8FA 3K30A 1KM1A 1R2TA 3BGGA 2CLIA 3BLFA 2C6QA 2WQPA 3DFOA 3ZS4A 1I2RA 2A7PA 5I3JA 4LVBA 5LGXA 4UMCA 5HUOA 1AK5A 2RDWA 1JCXA 2DZPA 2FB2A 1M5WA 3W75A 4LUJA 4XBSA 4DPQA 4IGHA 3DU0A 4K7VA 2BWGA 1HL2A 2EPHA 1TPDA 5F4SA 3E96A 3TIMA 3W1XA 2NV2A 1W5QA 5AFDA 3W2MA 2CW6A 2CZEA 4O52A 3KX6A 3OVPA 4YCPA 5K7JA 4CNPA 3SECA 2VFDA 1H61A 3UWWA 1P5BA 3JS3A 3L67A 1AL8A 5BW6A 2H90A 1TPEA 3L0GA 3S5NA 3M5ZA 1JCLA 1FCVA 2IQTA 2CLMA 3BK0A 3HG3A 3NL6A 3PVFA 4O54A 3MHUA 2R94A 3NQ6A 2QDHA 5D2YA 4FNTA 4ORIA 4CQAA 3MHFA 1KM2A 4O1DA 1D3GA 1YTKA 3EXTA 4N9BA 4O10A 4QISA 4IX0A 3N9SA 3R2GA 4NZFA 4K8HA 3LLFA 2ATSA 5G1TA 2DJXA 3IEBA 1OX4A 1OF8A 3MP5A 4N9DA 3B0VC 3NZ1A 3BW2A 1EUNA 3NPVA 1OFPA 2X1SA 3D0CA 1LM1A 1GVOA 3SGZA 1FY6A 2WOQA 3E49A 4H3DA 2QJGA 4XQ6A 1ZNNA 4GUIA 1VH7A 3E0IA 4K6AA 4X3ZA 1VHNA 3BW3A 4OGZA 1PHQA 3G1HA 1PV8A 3EWBX 3ATYA 3HPSA 3WK0A 4IUOA 1ZJIA 2X2GA 4A29A 2J24A 2V81A 2WPBA 4WOQA 5DN1A 2Z1BA 1P0KA 3WJYA 3IRDA 1OABA 2ZYFA 3RK8A 3O63A 3MYOA 3DH7A 3HMJG 4OHQA 4MLRA 2E5CA 1TJRA 3TUUA 1GYLA 1L2UA 4Y9AA 1ICPA 3W7CA 4JTHA 2RHGA 1TTQA 2V30A 4QM1A 4JTEA 4LV9A 4HHPA 1TJPA 2XN0A 4N9CA 5FEZA 1SSDA 2Q3RA 1TPH1 3GXNA 1GTHA 4GBUA 3KVKA 4QITA 1TB3A 3H54A 4WXZA 2RFGA 5FI8A 2Y7EA 5HUPA 3W2NA 2VEIA 3I7RA 4FX8A 4AHQA 4DO5A 5LNWA 4NUWA 3PUEA 1K02A 2C13A 1EPXA 2PRHA 3PULA 2B0MA 2GJLA 5C2XA 3TCEA 4LW7A 3HIJA 3P82A 4EF9A 2D73A 2ZRUA 1TQJA 1WQ5A 3F4WA 1C8VA 5C6MA 3GKAA 3TU9A 5F2IA 3M9YA 1BWLA 3THAA 3JR2A 1GT8A 5H2ZA 2E09A 3LLDA 4QNWA 3RLVA 3VFLA 1A5SA 2KZHA 1EUAA 2H3DA 3W1AA 1IIHA 3TMLA 2B7PA 4QIUA 1VZWA 3LXAA 4WJEA 2A21A 3O6YX 4E2BA 1A5AA 2A6NA 2ISSA 3SFKA 2FPYA 1QFEA 4IMGA 5I3GA 1OF6A 4A3UA 1A5CA 4K37A 3G1XA 3W7KA 4LC6A 3NG3A 3QF0A 1QDSA 1OFOA 1VC4A 1YDVA 3G8EA 4FIRA 3QH2A 1KV8A 1QO5A 1TV8A 4IXHA 3PF3A 1UCWA 1HO4A 4RK8A 4CCDA 2NWSA 5BMWA 1R47A 1MEWA 2GJNA 1VRDA 1AW1A 3T55A 1XDLA 4FHAA 3V75A 3LRKA 5D03A 5AHEA 3C3NA 1KLZA 1THFD 1TMHA 2GQ9A 1T96A 4IPIA 3M6YA 3TSDA 1QR7A 3UZ5A 1B4KA 2AAMA 4D2JA 2Y70A 5L9FA 4FX7A 3LCWA 4RZ5A 3O16A 2I14A 3NA8A 2FQIA 1DHPA 3W07A 1DOSA 3W1LA 3W7OA 4XTDA 1EP2A 1X1OA 2YDAA 3CB8A 3B4UA 1JCJA 5K4ZA 3C8FA 3UWVA 1OX6A 2QEZA 4R53A 3USBA 5D04C 5F1VA 6ALDA 5AC8A 3TMQA 3NQ7A 5LNUA 4AH7A 1EWDA 1WAUA 5DELA 3BG9A 1KM4A 3NL2A 2J9YA 3DBPA 4R33A 3W23A 1GZGA 3EX2A 3UY8A 4Y6GA 4A2SA 1QNVA 2OT0A 5TBOA 4UTTA 2JKPA 3CIXA 5DLCA 2W79A 1ZFJA 4DF1A 1EEPA 4CCCA 5CPNA 4O12A 3S42A 1XM3A 3KRZA 3C2RA 1GYNA 2ZRYA 1SW0A 4WY0B 3TFXA 3LTPA 3PB2A 3Q2DA 3W7NA 4WUIA 3HGRA 1N7KA 1KFEA 3A23A 1DJQA 1E51A 3C2FA 4XWUA 4IQLA 1AW2A 2AGKA 1K8ZA 3RFAA 3OHIA 4GUHA 5G2WA 4OWGA 4XKYB 3LV6A 1B3OA 3DAQA 2OT1A 4MY9A 3W85A 2ZTJA 1RVGA 5BMXA 2Z6IA 5A8GA 2ZRVA 3PBVA 1GVSA 2O7SA 2C14A 1LBFA 3CU2A 4YLWA 1I2OA 4TU1A 4GWEA 2CLLA 5J5DA 1LORA 3B0UX 4X22A 3NNTA 3NO5A 4H6KA 3KXQA 2JKAA 1MSSA 3C56A 2WSRA 3DKLA 1NEYA 1TPVA 2R8WA 5AC6A 1XUUA 4O8RA 4U4MA 2XN2A 3O06A 4M19A 4WY0A 5D2TA 1B9BA 1F74A 1P4CA 3EKZA 4UFKA 3TR2A 1XCFA 4ZQNA 1A5BA 1JUKA 1XKYA 2ABAA 1L6SA 1Z44A 4O57A 4P2VA 3S5OA 4NJGA 1UBSA 3U2OA 2VELA 2LLEA 2QJHA 3F1QA 4HNUA 4N6FA 4IMDA 2VC6A 4OV4A 4TMBA 1W56A 3RLUA 4HSNA 5K3VA 3NM3A 2C3ZA 3P74A 4OBTA 1O4UA 1TTPA 3EX1A 3NQDA 4B5NA 3W7QA 4ICNA 4E2DA 1EA0A 1LOLA 3CLMA 4H4IA 2Q8ZA 3A5VA 4AF0A 3W1QA 4AEOA 4Y8FA 3PBYA 2YFNA 2ZFAA 3LHTA 5LNRA 2ZRZA 1ZAJA 3L66A 3N2MA 1NF0A 2Y61A 1Y0EA 4PC8A 3CWOX 4JTFA 3GLCA 1P1XA 3V1PA 4FXSA 3WJZA
chains in the Genus database with same CATH superfamily
5A6LA 1M53A 3U4FA 3WX7A 4X2RA 1W8GA 4JR5A 4JDBA 3THQA 3MY9A 5G2HA 1YNYA 4P7OA 3O1NA 3JU2A 5G4HC 5D2VA 2QAFA 5T8GA 1J2WA 1ZJBA 2VGFA 4L4MA 4NL1A 4GI6A 5CGMA 4QSFA 3VABA 4NZ4A 2J8GA 3H4XA 2FB3A 4PTMA 1VFOA 2C16A 2VO5A 1J5SA 2Q09A 3S5SA 3ZWTA 3L0NA 4PULA 1XYLA 4F0SA 4H41A 1OHLA 1SW7A 1V6XA 5BRPA 3VE9A 2GK1B 1WE5A 4J1OA 3PS7A 2RUSA 4EF8A 5CKSA 2NQZA 1Z42A 2WPGA 3QQ0A 2CLHA 1EGMA 3WD0A 2PGWA 2OWCA 4DXXA 4US6A 1BVZA 3UP8A 4XUGA 2ZZ1A 4UR8A 1E72M 4NZ1A 3VNYA 1TCMA 4NJIA 2PTWA 1ML1A 3EX6A 1WPCA 3LHUA 1BG4A 1TV2A 1TA3B 3HQOA 1YPXA 3NL3A 2G3NA 3M5XA 4G6CA 1EWEA 1FWTA 4O1AA 1XLBA 2XIOA 1K6WA 3ZMRA 1F6KA 3N15A 1W5PA 4Q8PA 1Y5XA 4MM1A 2DZTA 1CGVA 4FLRA 3TX9A 3TLLA 1S2AA 4AXNA 4NYYA 3O05A 1IHIA 1GVYA 2PDGA 3MWAA 3SJNA 2EJ1A 3CH9A 1K8CA 4H04A 3OA5A 4LBRA 2AKZA 1YKWA 4ZO6A 4XVEA 5A6SA 4JN7A 2XIMA 2JBMA 1RV8A 2FMOA 1G67A 4EACA 2A2IA 1IIGA 2E6YA 1XINA 1JYNA 2VI0A 3RXZA 1BYDA 1S2TA 1LLZA 3W87A 4ZVJA 4XKYA 3HPXA 2P0IA 1SFJA 1DIDA 3SJ3A 2REQB 1W3IA 2YL5A 2WZEA 3QSRA 3LTSA 1K9DA 4HA3A 2DZUA 4N7QA 4HVXA 3NVDA 3EX4A 1E6NA 3DOPA 3UZYA 1GG0A 3GXFA 1KTBA 3PC0A 2R6OA 4JIQA 4PH6A 3HQPA 3U2EA 3BLPX 3AMKA 3AMDA 2QJMA 1YHTA 5M1TA 5CPLA 3UZXA 3MT1A 3M0VA 3S2JA 3SCQA 1JRCA 3R11A 1ZAIA 4KFOA 3M64A 3GUGA 1Q2SA 3LCFA 3VMNA 4X61A 2VDGA 4AHPA 4U5IA 2PZNA 4CNTA 3SCPA 5A1AA 3VMOA 4PMUA 1XLJA 2TODA 3TKFA 3MB9A 3EPMA 1MUMA 2V69A 5ABFA 2X8RA 1R7OA 2WMHA 1E55A 1ZCCA 3BLEA 2XGBA 3SY8A 1DJYA 1LL7A 3T40A 3WCZA 1PJ9A 3REQA 1PWLA 4U31A 1TELA 4KFPA 2DVTA 3CM4A 4D6IA 1PIIA 3SN0A 3NEVA 3WQFA 1AQ0A 1P0NA 3ZR5A 2PDMA 4JTTA 4A21A 1CX9A 1XH2A 4E3TA 2INEA 1Z48A 1TZ7A 4MJZA 3W9ZA 1L2QA 3RM9A 1RA5A 1KM3A 4YHGA 1XLDA 4KEUA 2C91A 1C9DA 1YYAA 4HZ8A 3GUWA 4F8XA 4F48A 4B9YA 3OIHA 5FESA 2OEKA 2PF0A 5EGRA 2CKSA 1RY8A 2EG8A 2PDUA 4W88A 4NI8A 3VUSA 1AD4A 4JFVA 2ZA2A 3QQ1A 3NVTA 4AZHA 1OC7A 1E4IA 1W2VA 3FK4A 1B3WA 3ERPA 4HNVA 3Q58A 4FR1A 4ONVA 4MPKA 1EGZA 2RGMA 3LTYA 3WZ0E 1DIKA 1QCWA 4O0ZA 2PRLA 3P3BA 5KSWA 3W38A 4GNVA 2OQYA 1XH1A 3QV9A 3MW7A 1HIZA 2P3EA 3KL0A 2WW5A 3II1A 4LWWA 4IJCA 4UFIA 3WD2A 3NQBA 3UG4A 3MCMA 1H60A 4WX2A 1OGGA 1T8XA 5CPSA 3RHGA 3IRSA 2TSYA 1CIUA 1X38A 2EG7A 3ZT6A 5LGZA 2PU0A 1IWBA 3W6YA 2WO5A 4GZ7A 4I7UA 4D6GA 1S2CA 2JGQA 1PKNA 1KA9F 5GNXA 4PYSA 1HKIA 4G5DA 4N42A 1JD9A 4DM1A 5FF0A 1F6PA 3VKCA 3N3MA 1WKYA 4H01A 2TAAA 1XBYA 4ZO7A 1TV3A 1PWMA 1ZY9A 3BAWA 2YW4A 3CV2A 4JQ1A 1DJZA 4M29A 1LQ2A 2AL2B 3EOOA 4UC5A 1X6NA 2BGNE 1CLVA 5JQ9A 3IK4A 3G1VA 4JTIA 2ZBTA 3KOWA 1K70A 3WMBA 4LX4A 3PWIA 1LRNA 3IUHA 4UNIA 3TXZA 1BSLA 3GYCA 3WLSA 4GZEA 1P6CA 1I4NA 3AJ7A 5CC7A 1B9ZA 1UIPA 2YXGA 3FYYA 4W7VA 4C1LA 4E0CA 5I3HA 4G1KA 4OIFA 3OIXA 3D46A 3ABSA 1S2VA 2ZQ0A 4IQDA 4HTYA 4AZ5A 3W1PA 2A0NA 2ZWZA 2VZOA 1ISZA 4BF9A 4WR3A 3RRAA 2XWEA 4JGDA 3B97A 3CQJA 2FMNA 1HTIA 2O4MA 1REQA 2QIIA 2QCFA 4A3HA 3NPUA 3QW3A 3WJXA 1W9BM 3EBVA 2NLYA 3H8AA 3GXDA 3IANA 2IXUA 2WMIA 3UWEA 2XVNA 1UR9A 2GWNA 4K1WA 3PUOA 3P5ZA 1V93A 1PB0A 7CGTA 3ISIX 1VLWA 4QDWA 3ITOA 4HPJA 4ZE4A 1PX3A 1V08A 1Q6GA 3IIPA 3QGVA 1AL7A 3NTYA 2J9ZA 1MI3A 4IXXA 1KCLA 1L8PA 4WDXA 2Q3OA 3S8HA 3UT0A 3UXKA 3S9YA 1UW9A 1QI5A 2NZLA 4IIFA 2VD8A 4FNRA 2ISWA 4O8AA 2I57A 3ARQA 1F05A 5A6TC 5FF3A 2R1NA 1W3KA 2WAGA 4V1YA 1E1CA 2HJPA 5DEZA 2XIJA 4J2PA 2NV9A 3W29A 3WDIA 5M17A 1UH2A 2PFHA 2NLIA 3ARVA 3Q67A 3WH6A 4Z2JA 3PBMA 2Y7DA 1Q6EA 1JULA 4KFNA 1H1YA 3KDNA 1DL3A 3U7VA 2A3BA 3NGJA 1KTNA 1NQKA 3OTRA 2PLMA 3BMXA 2DT3A 3BAYA 3TN3A 4JHOA 4QE1A 4GI8A 1CGTA 1R30A 1W54A 4TV5A 1TPFA 4DHGA 3G2GA 3PZGA 1EQCA 3CAQA 4MADA 1W31A 3B40A 2WM1A 3QY6A 4H7ZA 1J8VA 4GQ0A 4GACA 1UUMA 2EGZA 2HZGA 1ZALA 3W4RA 2DU2A 3OZPA 3TQ0A 1QI3A 2XWDA 1B90A 4M7TA 4ML4A 3NM1A 1R3TA 5RUBA 5LIUX 1RP9A 3UXDA 2BB0A 5H6HA 3WH9A 1F4HA 1F4AA 1KBIA 1S2WA 1WX0A 3BARA 3SBFA 1Q6DA 5HJXA 4XAYA 2NSOA 4Q33A 1EJVC 3N73A 1KW1A 1GVQA 5IM51 1LROA 1CGWA 2QUVA 1R46A 3UG8A 3FHAA 3DHFA 3KVLA 3CTLA 4DUVA 1OB0A 4EPBC 1KFCA 3HPZA 1QBBA 3OVRA 4AWSA 3W84A 4W5UA 1XH0A 1VLIA 4WKHA 2X1UA 3U6WA 2J7BA 3M16A 4J9JA 4GY7A 1YDNA 3C8NA 4CNOA 3VZYA 3MANA 3FSUA 4LCRA 1TA3A 1RK5A 3NJ3A 2CLOA 4A3QA 5AC7A 4UMBA 4C6MA 3I3EA 4GKLA 2ZC1A 5EB8A 4FNSA 4YTSA 1OFEA 4AVOA 1VCFA 5A95A 1FP8A 5L6UA 3HGOA 1EEXA 3QLDA 1Q85A 4E38A 1E6SM 4ZEPA 4W85A 4Z1CA 3H2NA 1O6IA 5K4XA 2YCIX 4EK7A 3HA1A 1HXJA 2OSYA 2WCAA 4YVXA 1LOSA 4A8RA 4MWAB 3LCLA 4RV3A 1SFSA 1JAEA 2W27A 1ZP3A 1ISXA 3N2BA 4Y7EA 4ZOBA 1ICSA 4HSOA 3G18A 2F2KA 3QYQA 4AYGA 4WSKA 3EOEA 3PZUA 2WKLA 3P14A 4LANA 3R5EA 1V03A 3BVJA 3IJDA 1EYWA 1ADDA 4H9XA 3H12A 2G41A 4Z2GA 3UY7A 3UJ2A 1QOPA 1F5ZA 3PB0A 1E9YB 1BWKA 3KEHA 1FCUA 1HW6A 3AQUA 1P7TA 3KE0A 2J47A 2CNCA 3WK3A 2E8YA 4DAIA 5D33A 3EB2A 3TTEA 1ZQ5A 1DWIM 4FB7A 4PBEA 1E70M 1XLAA 2V2HA 3OLGA 4OTKA 3VKJA 1KBKA 1JL8A 1JVNA 2OGYA 4TMCA 4HPHA 1TPC1 4GRSA 4KRZA 1D3HA 2ZZ2A 1BHGA 2XIQA 3TV8A 3NR0A 3MKCA 1Y65A 1TSIA 1JF6A 1WDWA 4L56A 3QMSA 1PZ0A 1FWBC 1QPNA 4N6EA 1BTMA 2OEMA 5AYYA 1P0BA 4IG2A 1VYRA 1FH7A 3GDLA 3MSGA 4HOXA 1RCQA 3A24A 2R14A 4CNNA 5U4NA 3ARWA 5GJMA 2QW5A 4HGXA 4AIOA 4M1BA 3BV7A 1SR9A 4DNHA 4IJBA 3B8WA 4G56A 4IMCA 4JS3A 4YTQA 2CYGA 1PTDA 3NPXA 3M1ZA 3VGFA 1IQ8A 2DPEA 4X0VA 4IJRA 2ASHA 3QMTA 3TXVA 2ZZ7A 5FIPA 3MI6A 1TVLA 3BE7A 2UV8G 3TC6A 1ME9A 1ECQA 3SY1A 1EF3A 4AC1X 4KESA 3C0SA 3FV9A 3PSVA 1OFRA 1NDYA 1XDJA 3GIYA 4PUKA 3BURA 1LZOA 3IVSA 4XZWA 4CQ9A 1XLHA 1UD2A 3MCOA 3WL0A 4DZIA 9RUBA 3IIXA 4H6RA 5CSSA 5C2CA 3G24A 4Q7IA 1FUYA 4LY8A 3RPMA 3HG5A 1KXQA 4XZBA 1D3CA 3B4YA 3OOQA 1YBQB 5HWMA 5DRIA 5TD4A 2HBVA 4DF0A 1BD0A 1F07A 2FLIA 2P88A 2FZMA 4B9ZA 1UUOA 4F40A 4Q4KA 1KM0A 3P8JA 1J79A 2W63A 1H7WA 3VIFA 4ML9A 2D3LA 4RNJA 5K9XA 1K7FA 4K1GA 3PTQA 2R24A 1J4EA 3QMRA 2QS8A 4W87A 1Q3NA 3A22A 3PUGA 3UPMA 2WJZA 4CEUC 2PD9A 1Q6QA 5GPRA 3VNJA 1M9HA 5CZJA 1N82A 3BCDA 5FF7A 3GHUA 5A2CA 1CPUA 1E9IA 1VBHA 2PTZA 3I7QA 3HB9A 3B9DA 3WYZA 3OBAA 4ZQMA 4OOZA 1FP9A 3PJWA 4C6IA 3V1HA 3IIZA 5HNUA 1K4HA 5A2AA 3S3GA 3I68A 1TV4A 3RCNA 4UCGA 5CZKA 4HYWA 1CGXA 1LRQA 3B8DA 2A5HA 1QVBA 2DUAA 5AVNA 2OSXA 1U30A 1Q4NX 1U5HA 4G1NA 4HOWA 1QXLA 3IGXA 3M46A 3WSUA 1I1WA 4Y9OA 4ZTYA 3W7PA 3E2QA 3DZ1A 3PZNA 5AVHA 3CHFA 2XDFA 2QKFA 1ZPTA 3AHZA 1G9HA 1G7UA 4LU0A 2VZSA 3A5FA 3AIVA 3KRBA 2BXVA 4ECLA 2HVMA 3HQ1A 4IX2A 1LBLA 1QNRA 4Y9NA 3F4DA 3WN6A 4YPJA 4BKNA 2BGQA 1EHAA 1F2JA 4DO4A 3CUGA 1XIEA 3OLDA 5KZ6A 4S1FA 5HMEA 1FVPA 2WMIB 4ACYA 3LY0A 2FFIA 4AUBA 5E6ZA 5A6JA 4Q8VA 3ME3A 1TZ9A 4PB3A 4L1XA 2EQDA 3CEPA 3E0WA 3TZNA 1SUXA 2JGYA 4GC4A 4ZENA 4HU8A 4JEJA 4Q8MA 4X9YA 3M41A 2QZRA 2D0HA 4JN6A 2XM1A 3CIWA 4A8IA 1V3IA 4UOZA 4QNEA 3EA2A 3OHMB 4HN8A 1L9WA 3NPWA 5AECA 1YTEA 1XLMA 4RLIA 1VBJA 1EZ2A 3N6JA 1WDDA 5I5RA 1GEHA 3P67A 5FA5A 4DQWA 4AZCA 3ARPA 1UP3A 1UROA 3EWCA 3VIOA 1D7FA 2DORA 3AIEA 4ORMA 4JYDA 4Z1BA 3B0PA 4B5TA 2HE5A 1UP0A 3GDMA 2O9OA 2VFEA 1R86A 1JQVA 4K3ZA 3WG6A 3VINA 3W88A 3FKKA 4XD6A 5CPQA 1O94A 3QXBA 4TVCA 3TR9A 3UERA 4PMZA 1IXPA 5FEXA 5KZMA 4JXCA 3WD1A 3VMPA 4E8CA 1GORA 3LRMA 3W74A 1B3YA 1JI1A 4RW3A 3CIVA 3WL1A 2DVUA 3E0FA 3K13A 4MB5A 2C19A 4LT9A 2V5CA 2QJNA 2VJXA 2C15A 1FWRA 4UQDA 2CLFA 4LNYA 4HMDA 1W9VA 1NJJA 5C9ZA 1F3EA 4FK9A 3BAJA 4HNNA 4IWWA 3VGEA 3LB0A 2A1YA 2X7VA 5IDZA 2ZOXA 3IJ6A 1C90A 2XH4A 4HYVA 3W7LA 2W66A 2F6XA 3WLPA 4PE8A 1X98A 3S5ZA 2YB4A 2NV1A 3UGVA 3EDDA 4LUIA 2YCLA 2DW7A 2BS9A 3PWGA 2VVNA 3KW3A 5F4XA 2ZRWA 1ZLPA 4UTIA 3LK6A 4NAFA 1S46A 4DJFA 4JX4A 1OYAA 1KBLA 3AHTA 3UZWA 1IEWA 3KZPA 4LVFA 4J3VA 4C91A 1YXCA 2Y4SA 1XDMA 1XIGA 4KWUA 2XU2A 2O4QA 1E0UA 1H5VA 4UQAA 1GQIA 2OO6A 3LCXA 3LXCA 3WD4A 3WDRA 4DJDD 4AIBA 1KBJA 1DJGA 1JGIA 1W3LA 2QUUA 2UY4A 4GVGA 5KZDA 1LTDA 5CSUA 1UWSA 4O0KA 3V35A 5AYZA 3GTHA 1TTJA 1SYTA 4ZO8A 1UJPA 4XZMX 8TIMA 1SO4A 4MFDA 2YXOA 3ITYA 2PDPA 1P48A 4QDMA 2ZUSA 3NWRA 3QFEA 3ARXA 1F7BA 3BPWA 1CCWB 3UF9A 2XPKA 5E5CA 1UZ1A 1VENA 1MQPA 1RPKA 3ID7A 4WXYA 4ASTA 4AW7A 2GJPA 2J13A 3F03K 3WK1A 2ZX7A 4A2RA 4IHCA 3OLEA 3APGA 1XC6A 3KOYA 4WOZA 5AHMA 2YBUA 4IM4A 1E4MM 1NY1A 3K1DA 4NAFB 4M82A 1QPRA 1HJVA 3SRKA 2QDGA 4I5RA 2CWXA 1JZ4A 1DIEA 2CWNA 1RAKA 2FZ9A 1XIHA 4JEQA 4ATWA 4HKPA 5HINA 3STFA 4PTNA 3N19B 3BG5A 4XUYA 4I7WA 1R2TA 2DH2A 3BGGA 4C6QA 4FP1A 4MNKA 2C6QA 5JH1A 4XAGA 1D7KA 1XW8A 3DFOA 1JCXA 2FB2A 3W75A 2V6AA 3WQOA 4RNFA 1J10A 3E96A 3W1XA 1PKYA 2PBGA 3W2MA 2CW6A 3LD5A 3KBVA 3M07A 4O52A 1A3HA 1NQ6A 1HF6A 2R1LA 4YCPA 5K7JA 3SECA 2VFDA 1HVQA 3L67A 2QPUA 5BW6A 2H90A 1UWQA 3UJSA 4IIDA 3EDEA 3S5NA 3ZSTA 2VX7A 3HG3A 3V5OA 1H09A 4O54A 2R94A 3NQ6A 1S39A 2QDHA 2PU1A 4ORIA 4CQAA 3MHFA 4O1DA 1KM2A 1MRAA 1YTKA 3FA4A 4QISA 3VD3A 3N9SA 3R2GA 2OWWA 4IFRA 4NASA 3W24A 4MGGA 1TMQA 1R3SA 3WF3A 4AWEA 5IFTA 1UD5A 2ZX9A 1LM1A 1X6LA 3SGZA 1FY6A 2WXDM 3KTCA 4H3DA 2QJGA 4MMWA 1J11A 1EKOA 2OU4A 4K6AA 1PHQA 1GOIA 4L9YA 4INFA 1ZJIA 3XISA 2J24A 1J0ZA 2V81A 4WOQA 4GK8A 5JU6A 3VOJA 3WMCA 3RK8A 2QGYA 1KQZA 3MYOA 1PIGA 4GXPA 4OHQA 4MLRA 1DWAM 1R9XA 3U7BA 1L2UA 2Z1VA 2R9RA 2I7GA 4Y9AA 4JTHA 2RHGA 4QM1A 4YJ5A 3GXNA 3LPFA 2Y1HA 4JAWA 4GBUA 4L6DA 1EHNA 3KCLA 4WXZA 4NHVA 5FI8A 5HUPA 4DLMA 1XRSA 2VEIA 2MANA 4DO5A 5LNWA 1K02A 1EPXA 1OIMA 1T8QA 3T81A 1V77A 2PRHA 3OU8A 1CXEA 4CCZA 2B0MA 4GCXA 5CC5A 1TQJA 2Y8UA 1VEOA 1PKLA 2GSHA 4R7OA 3GKAA 1KWKA 2OYLA 3JR2A 5H2ZA 2WSPA 2BDQA 5C7HA 2WYSA 3DECA 4QNWA 1KGWA 5HATA 3VFLA 1A5SA 3FVMA 1U5VA 3N2TA 3LPPA 3O9NA 3SUUA 3TMLA 3HV9A 2Z25A 3IWPA 3MA8A 1C7TA 1OG6A 1VFHA 3LXAA 5BWAA 4E2BA 3GIPA 1JZ3A 2ISSA 2FPYA 3VDHA 4A3UA 3EPOA 5EMMA 1A5CA 4K37A 1O5QA 3W7KA 3NG3A 3QF0A 3WLJA 1EJXC 4FIRA 3WENA 3TTOA 3QZAA 2J4GA 1UCWA 3EWDA 1P43A 2Z24A 1A5LC 4CCDA 5C7VA 1KRMA 1GZ1A 4GGHA 1G1YA 2NWSA 2GJNA 1AW1A 3T55A 5ABHA 4HK5A 1UP2A 4AZ7A 2VURA 1Y7VA 3LRKA 5AHEA 1RK6A 1ONXA 1R3QA 2ZX6A 1TMHA 3CUXA 3T1GA 3DEQA 4HZ7A 3M6YA 1OC5A 1AJZA 5DMYA 3WQ8A 1VFTA 3MVIA 2FGBA 4KQNA 5L9FA 3LCWA 3GHRA 3KS5A 4M56A 2UY3A 3TONA 1Q7ZA 1DHPA 3W07A 1GQKA 3W7OA 1TFVA 1X1OA 2YDAA 3CB8A 3B4UA 1JCJA 3AS3A 1FWIC 3WBXA 3T4WA 1OX6A 2QEZA 4R53A 4LYPA 3USBA 3TTSA 5F1VA 3NQ7A 3EMZA 3GNRA 5MKGA 1KRBC 1FWJC 1W1YA 4URIA 2CBVA 2NVDA 2WWCA 4PRRA 3RM8A 4K68A 3CIXA 2QUMA 3ARUA 3M4HA 4CCCA 5CPNA 4O12A 4GQGA 7PTDA 3HURA 3S42A 3STPA 1EC7A 3TLQA 4EX4A 3FDGA 1RCXB 4Q4SA 3IAQA 3LTPA 1RCOB 3CK5A 2ZXAA 3PAOA 4HHLA 4PZVA 1DJQA 1E6XM 4LBSA 2DEPA 3RFAA 3E38A 4OWGA 4I6KA 3W85A 2Z6IA 3W28A 3DERA 3AZSA 4Q7BA 2QPXA 4GINA 2O7SA 2C14A 3MJMA 1HP5A 1LBFA 3KBMA 1CXFA 4TU1A 5J5DA 3VKBA 1FKWA 3DN5A 1LORA 3B0UX 2VL4A 1C91A 3NO5A 1BRLB 4ZBCA 3TYAA 1NOWA 3KL5A 3CUFA 3E1F1 1DWJM 1EA9C 2XN2A 1HL8A 3O06A 2HXUA 2D69A 1LT7A 3Q65A 4M19A 1JDFA 4B2DD 3EKZA 2IW0A 1XCFA 1CWYA 1XKYA 4P2VA 1DXFA 2X0HA 3U2OA 4H9MA 3VX1A 3F1QA 4N6FA 3WDPP 4OV4A 4TMBA 1OT2A 5K3VA 3NM3A 2GUYA 3NQDA 2Q8XA 4B5NA 4ICNA 4E2DA 1EA0A 2Q8ZA 3W1QA 3CQKA 3KS6A 2HPIA 3LHTA 5LNRA 1V3LA 3VILA 1UOKA 4KMQA 5AC4A 3L66A 4I9MA 1W6TA 1NF0A 4JTFA 1P1XA 1QNPA 3RM4A 2V3EA 2A3AA 1NTHA 4FXSA 5I06A 5A6AA 2WHJA 4WKAA 2BZNA 4NZCA 1GGOA 1MW2A 2YYUA 1PZ3A 1LT8A 3E02A 4OU1A 4D72A 1RQEA 1UWAA 3PFMA 1TR9A 3EWZA 2CCRA 2V2CA 3DXIA 3EKLA 3SSJA 2GFTA 5GQBA 3Q45A 4BCEA 1JUEA 2YZ5A 4JNYA 4REQA 3P80A 1PEZA 1UKSA 3AXXA 3WH7A 4S3FA 4JL2A 4IFKB 2HEJA 4FX6M 4WHBA 4U2ZA 1MW0A 4BHYA 1LL4A 2HCVA 2A79A 3SO7A 2BOEX 1DQWA 4ZB5A 4LUTA 2JFEX 1KLYA 4KRUA 2GYIA 1XL9A 3VI2A 2NVAA 8CGTA 1E4LA 4AMAA 4ATLA 2Y7FA 2CEQA 2ACUA 3N4FA 4YL2A 4XBKA 3CBWA 4QS5A 3RDKA 3PP7A 5M2FX 4I7VA 3DG3A 2VR2A 2VX4A 4LSBA 2Q01A 3F2CA 3CAVA 4GQRA 1R3YA 2EAWA 3VCNA 3KL3A 2YL6A 1K1DA 2BXZA 3F5KA 3VNZA 1W1IE 1W3NA 1Q66A 4J3UA 1EX5A 1NVMA 3TYDA 2DV0A 2Y89A 4OT7A 3RO6A 3PPHA 2XFRA 3SCOA 4DXKA 1VFLA 1KFKA 3T08A 3A3XA 1BVWA 4DXVA 3FS2A 4NJHA 4Z1AA 5PTDA 3C3UA 4PUMA 4PUJA 4GZJA 4CD7A 3SUWA 2YX0A 4UTJA 4R7JA 2FJKA 4HA4A 1DJWA 2CZFA 7ODCA 3VCCA 4YIWA 3IVUA 2JALA 4RZ6A 3QKZA 1UHVA 2ZDRA 4Q4OA 2DQWA 4C60A 3ITGA 1SU5A 4AC7C 1C93A 3G0UA 3UG5A 5AZ1A 3EWWA 4E8GA 3AXHA 4Q4QA 3UZZA 1Q6OA 1WKDA 1SJAA 3ABRA 3BOLA 5C9WA 3BJFA 2EG6A 3PUDA 4IIGA 3PTMA 2GPTA 1XCWA 1O1HA 3BQ5A 4KH2A 3ZXWA 4Q8OA 1BVNP 3NZQA 4Y90A 1PPIA 3NXFA 4GCAA 3VO0A 2H9AA 4GOAA 4CKQA 4B5UA 2V5DA 4UIOA 1JGMA 4NZJA 4HB7A 3L68A 2V67A 4PRWA 2JQXA 1UD3A 4GYPA 3W7JA 4O15A 4BF5A 4M6VA 3U8GA 2C1IA 1O7AA 1KCXA 3E2RA 4DI8A 4GVIA 1TKKA 1JYWA 1D8WA 1RBOB 1FWWA 2QIWA 1WOAA 1JNDA 2V82A 3SRDA 4RPPA 3TCSA 1QNSA 4M80A 2UY5A 1QWGA 3WQPA 4JYFA 3RJYA 4AAJA 5C5YA 5K9DA 4C65A 4QJ5B 2A3EA 1OM0A 3OYZA 2EPMX 1W37A 1A0CA 1XQKA 2YDSA 4A6GA 1EPVA 1NOUA 2R91A 3KWXA 4B15A 2DDXA 1JD7A 5A6KA 2PSNA 2HNEA 2WZIA 1M7JA 5I3FA 3Q37A 4JD4A 3FOKA 2TPSA 3UYIA 3ANVA 4LBUA 3C6CA 2PTYA 1XPYA 4UBPC 5HMDA 3CLWA 4OQVA 5HMFA 4HD5A 6TAAA 1B57A 1V02E 2W0UA 4ZXLA 3LHWA 5FEPA 2X16A 4O50A 2NX3A 4O4WA 4UWMA 2YLAA 2FHBA 3VOCA 3K4DA 2GJXA 3LG3A 3TJ4A 1A49A 1WDQA 3UWYA 3VC6A 3EOSA 1TTIA 4J5NA 3FKRA 3SW6A 3WNPA 3RPDA 5EBAA 1RH9A 3NZRA 4MYXA 4QQ3A 1JZ7A 3G3MA 1R3RA 2BLEA 1L6FA 3V5CA 2PDBA 1YXYA 3FDKA 2Z28A 2E68A 4NVTA 5LHEA 4ADTA 4ATDA 2V3FA 4WD0A 1A53A 1S3TC 3LBMA 2IPWA 1KCKA 3DFTA 4XD5A 2WLZA 3W26A 3WUBA 4IPPA 4HNTA 1PHWA 4EKJA 1V3MA 2V5LA 1W9XA 2QAPA 2PDNA 4O19A 1ZB5A 4DEFA 1SZGA 3TOPA 3LMYA 5MF5A 2AKMA 1JFXA 3TW6A 4IUGA 2ISVA 3IJ7A 2EO7A 1QMLA 3VNIA 2XYLA 5DXXA 4M5PA 3O8AA 5F2GA 2YW3A 3W6LA 2TYSA 1KM5A 4H8HA 3PHAA 2GGGA 3E5BA 1YW1A 2J77A 3UZJA 2TMDA 4PCFA 2VUYA 1GKPA 3DG6A 4U2YA 3HZ3A 2QCHA 4ERGA 3QC3A 1OYBA 2POZA 1QHOA 4K39A 1V6TA 3MUCA 4CNUA 4Q6JA 4OECA 3DHUA 2XVLA 4H9VA 4ZFCA 3WLTA 2PWFA 3AHYA 1T6MA 4O1CA 4LUYA 3I4KA 2QUTA 3BG3A 3THUA 1B3VA 5B7ZA 3ITVA 1QATA 3NEHA 2OQLA 5CG7A 1V4YA 3C52A 2EKGA 5CPMA 3S6OA 1CECA 4MZ8A 4F9DA 4UOJA 2WVTA 3B8UA 3AYTA 4JIPA 4WDUA 4CVWA 3AAMA 2A7RA 4PUDA 1C8XA 1KCZA 4BWLA 1W9PA 2FHCA 2OCZA 3PZMA 3TTQA 3O07A 3GXPA 3VUPA 1SGJA 2ON3A 1V5XA 3VGHA 2ZUTA 3CZEA 3L9CA 3O6AA 3NFUA 5E1QA 2YGYA 1ONWA 3TYEA 1XBVA 4C5YA 2PPGA 3PANA 4GZIA 3GD6A 3ITXA 4AZIA 1H51A 1G4TA 4DJED 1XLIA 2DIEA 1HZYA 3W7DA 1S5WA 1HJQA 1XLLA 3CMGA 4ZTXA 4RPQA 3AIQA 4MHBA 4K8EA 3SCWA 5J5RA 2ABBA 5K2ZA 1E56A 5CZ0A 3I7SA 4IIBA 4XISA 4G7EA 3IIVA 4UR7A 1U2YA 3EWYA 4HNOA 2CITA 3GR4A 4J2MA 5G4EA 3AIWA 1VS1A 3WLLA 4BI6A 5BCAA 1UPMB 4GYPC 4CQ8A 4HIBA 3LA4A 3FJLA 4GQBA 1B31A 4L4OA 5I3KA 4HPGA 4JTDA 1CI1A 4HNCA 4DZHA 5HANA 2DT1A 1JNEA 4CU8A 4U10A 3QLLA 3LZ3A 5IBXC 4MAVA 3S1XA 4Q8QA 2E9LA 2X0SA 2PCQA 4LUSB 1BTCA 1ZHAA 2QCDA 2BY3A 3FY1A 4M0XA 5HQEA 1NM9A 3G1SA 3I65A 3CUJA 4I5XA 3RLGA 3IJQA 1MUWA 1Z89A 3LERA 1CDGA 2VQTA 4GE8A 1SVDA 2FTYA 5AYBA 1O5XA 3VZXA 4HN4A 4IOTA 1GPFA 2VXNA 3D3FA 5GJPA 1SPQA 4JFSA 4W9TA 2CERA 4U33A 2EEXA 2Q8LA 3M0LA 4GJIA 2Y24A 4X60A 1DORA 3AALA 1NP2A 4PODA 2HVNA 3MVTA 4DLFA 5DCEA 3HU7A 1O5RA 1XSJA 4LVDA 1ZENA 5LNSA 5I09A 1Z69A 3R6IA 2WANA 3R25A 1J12A 4WGHA 4H9YA 3GXMA 1MDLA 2QPSA 2YYTA 1PO9A 3B9AA 1UWRA 1OCBA 3THCA 3QRHA 3R0UA 4C6KA 1TR1A 2DZXA 3SCTA 3WQEA 1Q6RA 3ZYZA 3EGJA 5AOUA 3VAVA 3PZQA 3O15A 1TJ0A 1XLCA 4NI3A 2O9TA 5AHFA 3GHTA 3N34A 1W1B1 2QF8A 1GWJA 1T99A 3PJXA 3LU2A 3LGDA 2UZ9A 1M6JA 5A8MA 5DXYA 2J7CA 5DBTA 2YOCA 1JYVA 1FDJA 1I45A 2YKKA 4JDYA 4GG9A 2I1OA 2XISA 3F4VA 3VD5A 4HMEA 3LM7A 3FLUA 4JNZA 3PTKA 2EPKX 2VVSA 4ZB0A 3O0FA 3NQ2A 3PBGA 3G3DA 5D38A 2Y62A 3L4UA 3AHVA 3GR7A 2C18A 4FO4A 1JCYA 2H6RA 1JXKA 4GC3A 4Q3MA 3FNDA 2WWDA 4UTLA 2R1MA 3K46A 3GBDA 2XM2A 3C0JA 5GJNA 2Y8KA 4JOMA 3RIKA 3DFYA 4MY1A 4L1GA 3CTTA 2E28A 3VD4A 3RILA 1V0MA 3SUTA 3I10A 1E71M 3GNXA 1LL6A 4YVVA 3LBCA 2GUUA 1XBXA 4WIWA 3W71A 4XKMA 4ZQOA 1IEQA 4LC8A 4QCEA 3K5XA 2I5IA 1E0TA 3U5UA 2FVLA 2FPTA 1MQQA 3T78A 1KV5A 3WEZA 4P7QA 1M1BA 3MUIA 3MHGA 2I56A 5BYWA 3MC5A 2Y5JA 3QPYA 4E4FA 1DXIA 2RJHA 1I60A 1ZU8A 3MDUA 1VQTA 5JIPA 4I9AA 4WQ6A 1ZJHA 3AMLA 3SIMA 1XFBA 4HA0A 3W7GA 3OJGA 4PFMA 3GH5A 3PZVA 1VCVA 1OCNA 1XSIA 4LH8A 3GX9A 3R8HA 2GLKA 2XIIA 3GNNA 4H9TA 5TNVA 4D6JA 3CB3A 3IGUA 3TQKA 4HHMA 2H8ZA 1NWUA 2AL2A 3ALFA 1H7OA 2JIWA 4S38A 3QBUA 3ITLA 5FL0A 4XK2A 4D6EA 3RJXA 4MVAA 3IJLA 4AXKA 3VNKA 4Q22A 5DX7A 3WNLA 3BO9A 4NX0A 3GNDA 1VCGA 4CGTA 4Q32A 1TWZA 1XLGA 1YLVA 3LI1A 1Q63A 4IFKA 4D1JA 5H8MA 3LLXA 5LZLA 3QPZA 4YHEA 3F2BA 1EP3A 3W73A 3JZUA 3GQYA 4MY8A 1E6RA 2BHYA 3OZOA 2P10A 2G50A 1YQ2A 3G77A 5AC5A 3C2YA 4JIHA 1TVPA 4C1NA 1BGGA 1UKOA 3CT7A 3XIMA 5D02A 3M43A 4FNPA 3QZEA 1QW8A 3CV7A 2HDJA 3I6RA 3PNZA 1MVYA 3DHPA 4B4FA 2QDEA 3NQCA 1GOWA 1W3TA 1ZBCA 1Q2RA 1HFBA 3LV5A 5KINA 1OJXA 4MZYA 2VWSA 4MUPA 3P6LA 3GW0A 5HPCA 1V02A 2BVDA 4Q8NA 2AL1A 2WLYA 4UQBA 2JKEA 3N9KA 4QEEA 3K2GA 3WK2A 4QXIA 4FIQA 2QVNA 2YDRA 1A3XA 2Y85A 4HT3A 3SGGA 3S1VA 3WLOA 3ZJ7A 2HPMA 1L6YA 1VFSA 1F76A 4C6PA 2GDUA 1CXLA 2OB3A 3W81A 4DWSB 4IIHA 2WHKA 5TIMA 4LEQA 3TJIA 3ZLFA 1L6GA 1B54A 3GFYA 2CETA 3CS2A 1AQFA 3VDAA 3VIGA 2ALDA 2DT2A 4AFYA 2P53A 3COTA 3KVJA 1FCBA 5CC6A 3G22A 4AWUA 3BLOA 5FJUA 4IGMA 1EJUC 2HS6A 3WQVA 2PD5A 4GHRA 4C7GA 1X8FA 2RAGA 3QV7A 3E12A 2WMKA 2ZIDA 2QGHA 3URQA 3AWNA 3P0WA 1XLFA 3UG3A 1OFAA 2XZ7A 2SFPA 1H5YA 2DUXA 1YE6A 3OO2A 1X1ZA 4UQ9A 1VBUA 4XIAA 1XF0A 5F1UA 4LAMA 1ODZA 1HX0A 4ZO9A 3UR5A 1CT5A 3VDGA 2VC7A 2F38A 5DY3A 3NAVA 3UCCA 4MF4A 1M01A 4IIEA 4S2BA 4LUSA 2GK1A 1TPB1 4KGLA 4MWAE 4QP0A 1EXBA 3N11A 4S3JA 1UJQA 1NWTA 1OFDA 1A5OC 4BQ4A 2GGJA 2PDIA 2VCBA 4K36A 1FA2A 2GVLA 4ERIA 3NQAA 9XIMA 1IT0A 2BHZA 3B04A 1FRBA 3MSRA 3K4AA 1ITXA 1TWWA 2PWHA 4AZBA 1NDWA 4A8NA 1LOQA 3MU7A 3P61A 4WKFA 1XV8A 4REQB 3WMSA 1O68A 3ZWSA 2O55A 5BOOA 3T7VA 4DWSD 3TW7A 3EB3A 3UXAA 4S3EA 3ES7A 4IH3A 1MNSA 4GLEA 1H1ZA 4LS0A 4I3GA 1PYFA 6TIMA 5A5WA 2E8ZA 3TYUA 3GFXA 3VE7A 3AUJA 3WF1A 1QTWA 4PMOA 1WV2A 4HZMA 1ISVA 4NG3A 5BXTA 1Q7MA 3SSZA 3WF4A 3MZNA 4AX6A 3GC4A 3ZIZA 1VIZA 2PGFA 3A3HA 2V68A 4PMXA 2D20A 1YXDA 1E15A 1X8CA 1JCMP 2JF7A 3AO0A 3R1ZA 3U2CA 3KLLA 1AMKA 5CZSA 2FH8A 4S39A 3V4BA 3E0LA 4DVOA 4DWSC 1VFUA 3CL8A 4KEZA 4PTXA 1WZMA 4HK7A 1KNWA 1PKMA 1SO6A 5LIYX 1B1YA 4HK6A 3CXOA 2Q6ZA 4UQCA 4W4QA 2Z0IA 4ALDA 2D0GA 4O4VA 1KM6A 3N17A 2FTPA 3N2OA 5HJYA 3A9BA 2CKRA 5E9XA 2GL5A 4LS2A 3FJNA 4KWOA 1BF6A 2VTFA 3HG4A 3S1WA 2C71A 5FJIA 4KWVA 3QGAC 4TUFA 1LBMA 4JQ2A 4C6BA 4UTMA 3AU6A 4MWAD 4Z0JA 5CAHA 2XHYA 4A8LA 1EBGA 2OZTA 1TCDA 3MMWA 3VIPA 3U2ZA 2Z7GA 4AD0A 3EPNA 5AYIA 3RF9A 2HNHA 1TIMA 1UQYA 5AY7A 2HBXA 3V36A 4IP5A 3GK0A 3CWHA 3HG2A 1GZJA 1R7AA 3NOEA 3TYCA 3KHJA 3MKKA 3EWUA 4FXJA 4NIRA 3M0HA 4DB7A 2PGRA 3LSCA 3FEMA 3D3AA 2O0TA 1VGAA 4F2BA 4O13A 4CQBA 3MI3A 4GVFA 4DBWA 2OJPA 4G7FA 4C6LA 4QJ1A 1N55A 2WMFA 4EOUA 4X2PA 1Q13A 1C3FA 4JBRA 3EEGA 3GVGA 3MUZ1 3QV8A 2TRSA 1DWFM 2C7FA 4LB4A 1AZ1A 1XYBA 3WD3A 3LOTA 4GJ1A 4ZQPA 1UR4A 1SW3A 1XGDA 4RUBA 1EQPA 1NDZA 1W3JA 3GDKA 2VEMA 3K8LA 2G95A 3S2LA 1PXGA 1VAHA 1QOXA 2Y8VA 1ZGDA 2HROA 2WVVB 2VQUA 4UFHA 3SCVA 5LIXX 3EXSA 4DBUA 2PWUA 4EPDC 4L7ZA 1EJRC 4XZNX 2B7NA 2A3CA 1RVKA 2VYOA 2ACQA 4GIRA 4DBDA 2HS8A 1JAKA 2WHLA 4TQTA 4GFSA 1JJKA 3UA4A 2AQVA 1M7PA 4UB9A 4RZ4A 3EDKA 1T5AA 5LA0A 4EANA 3R13A 3KRUA 3FXGA 4H19A 5T9BG 5EBUA 4KBXA 4HMNA 5B7YA 2Y6ZA 4L5ZA 3R89A 1PZ2A 3CO8A 4UTTC 2D23A 1UUQA 3TROA 4MUZA 5D05A 2R1KA 3OG3A 1R5YA 2YA2A 3TEVA 4RW5A 3PTDA 2UBPC 5I3JA 5LGXA 3L2MA 4UMCA 2RDWA 4B92A 4IGHA 3DU0A 4YNGA 4EXAA 4HCHA 3U4AA 3E0VA 3TWBA 5LIKX 2NV2A 1W5QA 2J6VA 2POTA 3GH4A 2PA6A 3OVPA 2B81A 4CNPA 3BJTA 3B8TA 2XFFA 1TPEA 2AMGA 3OGRA 3QHMA 3WBAA 1JZ8A 4QG9A 2E9MA 2CLMA 3PVFA 4V27A 3MHUA 4C1NB 3MS8A 5D2YA 2NVCA 4C6FA 4DBSA 3PPGA 3R0KA 3N29A 5CPTA 4DJEA 3ECQA 4Q4PA 4JCMA 1E3XA 3VDBA 4NZFA 4B5WA 1EL3A 4K8HA 4PUUA 2RGLA 2ATSA 3MP5A 4N9DA 1GVIA 4LUTB 3BW2A 3T07A 3NPVA 1OFPA 3JW7A 1FHLA 4CD6A 3HPAA 4RE3A 4ROPA 2WOQA 1ZNNA 3CV1A 4E2VA 3ZR6A 4OGZA 3IPWA 3B8VA 4XO7A 3EWBX 1H49A 3HPSA 2DY3A 4IUOA 3VDCA 1QU4A 2X2GA 3PN8A 3CQIA 4BA0A 1ITCA 3WFLA 2Z1BA 5DMMA 1ZBKA 4MDOA 3ZO9A 1HGYA 3IRDA 3OQEA 3N12A 5C2GA 4X63A 3O63A 3S83A 1UA3A 2IKIA 2E5CA 1KQYA 4DWSA 5XINA 1ICPA 1TTQA 4JTEA 4LV9A 4HHPA 1TJPA 2Q3RA 2XINA 4GH3A 3WDHA 1XP3A 4BEQA 1HGWA 4N0RA 1US2A 3N6HA 1WDSA 3UR8A 3W2NA 3LEPA 3O2LA 1J0HA 2XG9A 4Y8EA 3BOFA 2W61A 4IPNB 3PULA 2GJLA 4JIIX 3TCEA 3IUIA 4GA8A 3IJIA 4EF9A 2ZRUA 4CNSA 2P8BA 3RX3A 1HVXA 3TU9A 2EPLX 1BWLA 1CXKA 2PWDA 2VDIA 3RLVA 4GD0A 3OZMA 4FA3A 2BP1A 3W1AA 2FZ8A 1OGSA 3MKVA 4JTRA 3TNBA 1H11A 1EBHA 9XIAA 2FGZA 4QR6A 2BY0A 3O6YX 1A5AA 2A6NA 3L12A 1DHKA 1QFEA 1OF6A 1RSCA 3DYPA 3RCYA 3B9NA 4U5KA 4ZOEA 3ABZA 3AICA 4LC6A 3CMFA 1OFOA 1ZJAA 1NWRA 3M0XA 1J93A 3QH2A 1KV8A 3RYSA 1QO5A 2HQAA 2WNWA 4IXHA 4LJ3A 4ENLA 1DPMA 3PF3A 1HO4A 4RK8A 2IXVA 3R79A 1JFHA 3C5QA 3LMZA 1MEWA 2OSWA 1E0WA 3V75A 1IE7C 5HOSA 3F7JA 3A64A 4W5ZA 2ZUUA 1TWIA 1AH4A 1THFD 2GQ9A 4MNLA 3UXLA 3MV11 4WGXA 1KB3A 4PCPA 2VGIA 4Y2WA 3O16A 2I14A 2FQIA 3W02A 1P6BA 4DJEC 3W1LA 1PYMA 4EP8C 1QHPA 3UWVA 5J04A 1J96A 3GY1A 3PK7A 5D04C 4B5XA 1XRVA 1WAUA 5D8WA 5DELA 1EJTC 1R8LA 1FHDA 4R33A 4XD4A 3W23A 1ZS2A 1WAWA 2WCSA 2I17A 2IPGA 3UY8A 2ZXQA 4Y6GA 4A2SA 3AIRA 4EPKA 2JKPA 2W79A 1EEPA 1XM3A 3KRZA 3C2RA 1GYNA 2ZRYA 5T91A 3ITTA 1UOZA 3W7NA 2VGBA 3LNPA 3HGRA 3A23A 3C2FA 1JPDX 4XWUA 4IQLA 3VYLA 1RP8A 3OHIA 3DAQA 2OT1A 4D6CA 3T2QA 3WQ6A 3WQGA 1Z32X 2ZTJA 1RVGA 2VRKA 5ABGA 5A8GA 1W3HA 2ZRVA 4QG6A 4CN1A 3PBVA 1GVSA 3VNMA 5ABEA 4YLWA 5ABFB 3W00A 3R43A 2CLLA 1QNQA 4YTUA 3ES8A 2YCKX 1EXPA 4ZSTA 4GQQA 1IZJA 3APYA 3OBEA 4H6KA 4F0HA 3BH4A 4GIYA 3CUHA 1IEVA 3HMCA 1XUUA 5FSEC 2VT0A 5EMYA 5D2TA 3FA3A 4JHMA 2ABAA 1Z44A 1RLCL 2FZBA 2QJHA 3S4TA 3W6MA 1WO2A 1IR2A 3APTA 3N1AA 4HSNA 1QHZA 5FD0A 1C8QA 2C3ZA 2WJEA 1O4UA 1TTPA 1NU5A 3AS0A 4AD1A 3CLMA 3K8MA 2ADAA 4AEOA 3ZM8A 1MNZA 4J4KA 2YFNA 3CHCA 1ZAJA 1VPQA 5IRPA 1D2KA 1BYAA 4PC8A 1V3JA 3GLCA 5DF0A 2F61A 3WJZA 3F5LA 2VC9A 4IICA 1BEUA 2A6LA 4LAUA 3G1DA 2CLKA 4IQEA 3MUAA 3WNKA 1R3WA 5A69A 4K38A 1U1UA 3VX0A 4YCOA 2FVKA 5G5IA 4E4PA 2ZVRA 3JZEA 4JL1A 3D6NA 4RL3A 2C8NA 3M7WA 4GXWA 5CJMA 4ZE5A 3HO8A 1K8XA 3MQTA 2JEQA 3O6DA 1DVJA 2NX1A 1EO7A 2Q71A 4V15A 5B80A 1RJQA 1UASA 1O5KA 1XIDA 1CB7B 1F73A 4UXDA 2D22A 4CD8A 4J3TA 1NAL1 1F3XA 1S3HA 3S2NA 1K7EA 2X41A 1GKRA 4AZGA 3SQMA 3TJLA 3W2LA 1C29A 3LBOA 3W0KA 4S3CA 3VD7A 3ANUA 1G5AA 1Y5WA 3RCMA 4C5ZA 3BDKA 3G1YA 4IPJA 3GNOA 3QC0A 5F4WA 4OVXA 3AXMA 3G0XA 4MLJA 4C90A 1BAGA 1IGWA 3T09A 4MIMA 2WC7A 2NSXA 1EJSC 4Z2HA 1R38A 3WQCA 1W8SA 1X7FA 4R9OA 3PG9A 5D30A 1SZEA 5DBUA 2VFIA 4R3UA 4BR1A 1OC6A 2X1IA 5I2UA 4KKXA 1YPFA 3DBNA 5CXPA 2G5WA 4LF2A 1UKTA 4PMNA 4FLSA 3ZVHB 3UEQA 4NXKA 1ADSA 1CXHA 3HN3A 3ATZA 5HDRA 4LOCA 1NARA 4JTCA 1QPOA 1HUVA 3KRSA 1A80A 2XGIA 1Q65A 4HA1A 5D09A 4X0NA 5D8ZA 1ZCOA 1UR0A 4MB3A 2X42A 3AUOA 1G69A 3Q4DA 1W1ZA 1XCXA 1OVDA 1GJPA 4RKAA 2P0OA 4ZOAA 2J8TA 1Q8JA 4I5UA 4K2SA 2PP1A 4HNLA 4US5D 1F8MA 3PBUA 2EF9A 2VEFA 3CPRA 3QV6A 3WLQA 1UD8A 4PSRA 4LQ1A 3H7UA 1P7TB 1LG1A 1KTCA 2CZ5A 1IT8A 1XRFA 3W83A 3RUBL 5FAJA 1N2VA 3DFSA 4U3AA 4X9SA 2V0TA 3NQ8A 4JZ5A 1WBHA 4S2CA 3VM5A 1GOMA 3RN6A 3H2AA 1PIFA 5HXMA 4KETA 4NJKA 4AY7A 2YSWA 3BZJA 4OFCA 3GIQA 3QM3A 3W2KA 2BX7A 1ISWA 4D6DA 4ZODA 1GOKA 3MCNA 3AYRA 2PLJA 4EPEC 3ANYA 1E6QM 3L23A 3TSBA 5EL1A 3S0CA 2ATMA 3WLRA 1XRTA 5FCZA 2Y88A 3M0ZA 2KAUC 1XBZA 2ZX5A 4W8LA 2VEKA 2QLYA 3D47A 4AX7A 4RV8A 3U0HA 1EYEA 4FS9A 2FTWA 4JKMA 4CN6A 5TF0A 1GVRA 4UNKA 2ESCA 3HPFA 3VGGA 1QAPA 5DQPA 3RG6A 1QWKA 4I8DA 4MPQA 2J78A 3DGBA 3E2SA 2H8XA 3V16A 3CPGA 4LVGA 2Z2UA 3WJWA 4IPLA 1YPIA 4WF7A 3ZSSA 3WJSA 2BHUA 1J2BA 5LA2A 4BZYA 3NQEA 3SZ8A 2HSAA 3L5MA 3ARTA 5XIAA 3L2IA 1TJ2A 4RCXA 3MV01 5I02A 2XVKA 4PUWA 1WBJA 3T8LA 3GB6A 4B91A 3GVQA 3B8SA 3VPLA 1XUZA 4R34A 4OUIA 2ISDA 1V6YA 3MTWA 4M51A 2PLCA 1GVEA 5IOBA 4DJFD 5REQA 2NT0A 5CBJA 3LHYA 2E9BA 1B3ZA 2W67A 2WC3A 2X09A 1ME7A 4QE4A 1SZNA 3H26A 3LQGA 1XD1A 1FWFC 4DZAA 1T7LA 4WDTA 1Q6FA 2INZA 3TFCA 3R8GA 1BXCA 5H8PA 4QJ4B 1G7VA 5IHSA 4DY1A 2E25A 3PWAA 3V0SA 4JTKA 2E7FA 2BFGA 3VIKA 4AYSA 2PP3A 3ARRA 4PMYA 3H4GA 1PSCA 4QGCA 1C8YA 5BU6A 1FWHC 1SQ7A 1CYGA 1IWAA 3KHDA 1PDZA 2WBKA 4O18A 4JTJA 3GM8A 3CT2A 1HNYA 4L61A 3SIZA 1SFLA 5KZEA 4EXBA 4ZQCA 1S1RA 4O53A 3DGRA 3TQVA 5FF4A 1E5NA 2O7QA 5IHRA 4D6HA 4J35A 4C7FA 1FKXA 1S5NA 3CZLA 2WNZA 1F61A 1M7XA 1EGVA 4H7CA 2OPJA 3N2CA 1V8EA 1JPMA 3ARYA 4JCLA 4DF2A 3QHNA 4LVAA 4WJXA 3IAPA 4BK9A 5C9XA 1XI3A 5FJJA 3NXLA 2NW0A 3EDFA 4LB3A 1I2PA 3ABXA 1IR1A 3AZRA 3LENA 3P62A 4Z2KA 3LHVA 2OWXA 3S6DA 1WOBA 3KTSA 3MJYA 2VCAA 4KF1A 3GVRA 4IMAA 4HSHA 1O95A 2NQLA 1GK8A 2IPFA 1HQTA 4IP4A 4S3AA 4PMDA 4M8UA 7TAAA 2OR2A 4E2OA 2ZTKA 3GNPA 3P0XA 3UU0A 3MBDA 1DTNA 4BFAA 3OZYA 2VUNA 4IZGA 1U1HA 4YN5A 4JYEA 3GH7A 3DC8A 4MOZA 4UQEA 3TK7A 3QJAA 1FCQA 1CW2A 5HULA 1NDVA 3UESA 5DFAA 5LHFA 1M65A 5HQMA 2OYKA 3H55A 2G4JA 3IIOA 1XX1A 2HXTA 3SR7A 2L5HA 1JEZA 3RPTA 5HPOA 3G1FA 5LXEA 3WLMA 4FMVA 4IG2B 1BSIA 5JXQA 3W70A 3LCGA 4XVDA 1H0GA 4KGJA 3NCOA 2V3DA 3AMCA 1EDGA 2VOTA 3AS2A 5CEWA 2E5BA 3GVVA 3UQNA 3T0CA 5E93A 3T0TA 3EA1A 3U5YA 5HAOA 3C0QA 1MEIA 3HFYA 2YCJA 2AOSA 1JYXA 4RZBA 2VM8A 2QVHA 1JQXA 2AAAA 4CEXC 5G1YA 1SSGA 4WJ8A 4DO6A 3G6LA 1QPQA 2H3BA 3S1GA 3AU2A 3W1RA 3L4WA 3W1TA 1VEPA 1JG9A 4PMVA 3ABQA 3DFQA 4AD4A 2XVGA 2ZVIA 3PAJA 1KRAC 2OX1A 3DG7A 1JUBA 7REQB 1Q45A 2JF6A 3EKGA 4ZOCA 3CAKA 4Z42C 3P81A 4FNUA 2X0YA 5CSRA 1LP6A 2WVUA 1CZ1A 2QCDB 2ALRA 2QNEA 4POCA 1U83A 4JKLA 1TMLA 2CBUA 2PGEA 3W37A 1JF5A 5AHLA 2GSJA 5D2XA 4ZFMA 4I6VA 3SY5A 7A3HA 3W86A 3SADA 1YTDA 1H4PA 2NQ5A 4EAMA 4Q8WA 3I6TA 1P1MA 1TUXA 1LUCA 2W92A 4KWWA 2J74A 2PDQA 2YL8A 1EOMA 1GNXA 1MQRA 3MUXA 2A4AA 3MBFA 4N02A 3KAOA 3B8IA 5FKYA 4ZMGA 2JEPA 4WZHA 1AFSA 3INPA 2ACSA 3QTGA 4NU7A 3ZR4A 3IV3A 4MYAA 5CGQA 2HK1A 3TDFA 1NIUA 2VENA 3FIGA 4H9ZA 3AMGA 6XIMA 2C1GA 3SI9A 1RUSA 2WQDA 5JMUA 1FWDC 1AG1O 3L4ZA 4KCUA 3UW6A 2ZA3A 1DXEA 4WEVX 2A3LA 1GOQA 5GVJA 1LQAA 2ZADA 3GXIA 4HPXA 4JNMA 2E6AA 4DPPA 1SZRA 3AIBA 1AQHA 4NQ1A 2BSLA 3H2MA 4JICA 3VIJA 1IWPA 3KCJA 3QY8A 4LCQA 4JN8A 3L4YA 1CGUA 3GC2A 4M81A 4LAZA 1FOBA 1OFQA 2QXWA 3UXIA 2VWTA 3REQB 4GH1A 4JTUA 1XGZA 5D9NA 3R0DA 1BXNA 2HISA 3MUY1 2WSKA 4F9JA 1YNPA 4DELA 2WSQA 1UMYA 2E1DA 3UA3A 3CQ0A 1YIXA 2Z1XA 4ZQRA 5IFPA 3M47A 3ZQ9A 3WLKX 4QSHA 4TTUA 3GDBA 1VYSX 3PNUA 3POHA 2ZXDA 2GDVA 2I9EA 2FDSA 1JI2A 1XC4A 3ZLGA 1AZ2A 3PBWA 4GY0A 3XINA 4FOKA 4UFLA 4C6DA 5AZ0A 2ICSA 4W93A 1HN1A 4WSHA 4AEEA 4MJ2A 4UUIA 1JCNA 2FJUB 3EDJA 1OYCA 2VRJA 4R85A 2D24A 2QCLA 1GG1A 2VX5A 2BVYA 3TC3A 4N4PA 2D2JA 4DUWA 3JRKA 2G3MA 4FF5A 2CZDA 1LLWA 1ENUA 1OT1A 1JDEA 5HNTA 4ILSA 2OX4A 5I78A 1SMAA 3LCHA 2IS7A 5F2LA 1UYQA 5G2IA 3QR3A 3L5AA 1UZ4A 4JKKA 5KETA 3BUVA 4UOQA 5BXPA 2NUWA 5C0QA 1IT7A 4MFEA 1UA7A 4JQAA 1A50A 1QOQA 2C0HA 3NGFA 1DBTA 4AD2A 2WVSA 5A8NA 1EH9A 1PL9A 2QCMA 4QAWA 4P5UA 4IL2A 2VRQA 4XBJA 3M0IA 1FFRA 4N9EA 3VNDA 5D32A 1X39A 1M68A 1OD0A 4GGBA 2HK0A 2A85A 3GSMA 3ZFHA 3GFZA 5H1WA 1UB3A 3B9EA 2PWGA 1WZKA 1K3UA 3P5YA 2NQHA 4JTAA 3W7RA 2IMRA 3H7RA 1TV7A 1VBRA 3MMTA 1X7IA 3A9IA 1H7RA 3OVQA 4RX0A 3RMEA 1DV7A 2NUXA 4PCNA 4ZL1A 3UJFA 9CGTA 5E6YA 4NF7A 1F8IA 4R88A 1YDYA 2O9PA 3LX9A 2E6FA 3M5VA 3MP3A 6A3HA 3N18A 4MKVA 3FYOA 3MDWA 3WH8A 3MO4A 2PI6A 4QCFA 5D9OA 4R27A 4B5VA 3GTIA 2YR1A 1VIWA 1UWIA 4JTGA 3FGCB 2J7GA 1W9DM <