2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
2YW3A 2J6XA 2W6RA 1YPFA 1DORA 4OE7A 5D33A 1QMLA 1GJPA 3QSRA 2DU2A 3C0JA 3TQVA 4DO6A 1F5ZA 2O7QA 2ZRZA 3ABRA 5U7SA 3FLUA 3GKAA 1Q3NA 3A5VA 4GC4A 3FYPA 5KMYA 2QCGA 2A0NA 3G1HA 1JULA 1PCWA 1FWSA 1XBYA 3LHUA 3LXBA 5K4XA 3W22A 3TH6A 4L4LA 1I45A 1VC4A 3S0CA 3LHVA 1XDLA 3G1FA 1PVNA 5ABTA 3W2MA 3DZ1A 4N9EA 4Q32A 3WJSA 5GVJA 3GR8A 1ZALA 4IUOA 4GUGA 1J2WA 1WYIA 3PBUA 1AK5A 1LZOA 2R14A 5EPDA 4LVFA 4DF0A 2E5DA 1P0NA 1RV8A 2V2DA 4EVZA 4O53A 3LGEA 3F03K 3TCEA 2ZRWA 1XDMA 4OGZA 4MKNA 3VKJA 3PBVA 3L5LA 3B0VC 3WK0A 3S1XA 1TRIA 2V2HA 1W5NA 3S8HA 3W74A 2ZZ7A 3W1TA 3WJZA 3UWVA 4HNVA 1Q6RA 4FNTA 3BO9A 3L0NA 3HPXA 4JY9A 3V1PA 2CLLA 3SI9A 1YYAA 3HQ1A 2B7QA 2CLEA 2CLFA 2VXNA 4O4VA 2EPHA 2JK2A 1VR6A 5F2MA 1QFEA 4LU0A 3NPXA 1DL3A 5AOUA 3T4CA 4MY8A 4C1LA 4MY1A 5A8GA 1THFD 1YLVA 3T7VA 3FS2A 3MWAA 1QO5A 3VCRA 3W87A 4JIPA 3UWYA 5AC8A 3W1RA 3FKKA 2FQIA 1ZAJA 4NNAA 3S5OA 4MYAA 3NQMA 3DXIA 1EWEA 2YDAA 4WOZA 3E9AA 3TMLA 4DO5A 1RQEA 3DFTA 2ZRYA 4AH7A 2QF7A 2QCLA 3Q37A 4ZQRA 1F7BA 5DCDA 1LRQA 4Q4KA 3DAQA 3MUXA 1JVNA 3INPA 1MEHA 3UYCA 2B7NA 2ZTJA 4NZJA 3EWUA 1W5MA 5TIMA 4OV4A 3W88A 3TKFA 3TNOA 3QFEA 1L2UA 5AHLA 4UFMA 2XN2A 2BZNA 3ABSA 4GUIA 3W2NA 3W7EA 3P5YA 1OFBA 2WV8A 2FB2A 3G1XA 2V81A 3MW7A 3NL5A 5AHIA 1KTNA 2VENA 3C2FA 3OVRA 4M19A 3LHWA 2VEMA 3NQEA 5KSWA 1YADA 2GVLA 2RDWA 3CU2A 3C2EA 3LHTA 3MP3A 2WOQA 5D2XA 2C3ZA 2OMAA 3W07A 3E0IA 3BVJA 1I2OA 1TSIA 4I7VA 3T40A 1LDCA 4UTTA 3VE9A 3NQ7A 1QDSA 2A5HA 1LORA 4LNYA 4ZQMA 4DELA 4MFEA 5FEXA 4UMAA 2C6QA 3LCFA 4P61A 1OFEA 2HMCA 4IMCA 3W7KA 2C1HA 1ZCOA 4POCA 3GDTA 5EY5A 1LP6A 3AO0A 1P1XA 3HMJG 3KHJA 4N9CA 1XXXA 4WQ6A 1YTKA 4Z0JA 2NXGA 1KTCA 1LLZA 1TPUA 1H5YA 2CLOA 4NQ1A 4RXGA 3GB6A 4QNWA 2H8XA 3N73A 3TSMA 3L0KA 2Y88A 2GVJA 3A23A 4BWLA 2F84A 4Z1BA 3W1XA 5AN7A 1SW7A 4JD4A 3PBWA 5D04C 5D02A 3W1LA 3C2VA 4UTHA 4BI6A 1GQNA 5LNUA 3GVGA 5LNWA 3CHVA 4TR9A 5L9FA 3HGJA 3DKJA 2DJXA 1S5TA 2JGYA 1NF0A 3NQ6A 3NYZA 3I7QA 3UY8A 4O8RA 4MYXA 2E77A 4ADUA 4FXRA 4WOQA 3LX9A 3HG4A 1NVMA 4PODA 4IX0A 3QMRA 1K8YA 4UC5A 5K9DA 1OFAA 3CWOX 3W72A 5KZDA 1JQXA 3FOKA 2ISVA 4YCOA 1I2RA 1LCOA 3IVSA 3P84A 2XN0A 5AHFA 3SFKA 2FB3A 4FB7A 4HPJA 4WY0B 3TV8A 3C3NA 3ABQA 3FIGA 1P0KA 1TV7A 4UFJA 5D03A 3SW6A 1G4TA 3HG2A 4UR7A 1W56A 3H54A 2I9EA 5BOOA 3QQ0A 4N9BA 1H51A 3BLEA 2DP3A 5BNKA 4AWUA 2CU0A 3PY2A 5LHEA 3PC0A 3NPVA 3W70A 3W7NA 4U4MA 4KFPA 2ZRXA 3CPRA 5DELA 2C19A 3HPSA 3W85A 2H8ZA 1LLWA 2CWNA 4JTFA 4MJMA 4ZL1A 1RPXA 3G1YA 5D2YA 2QCNA 5FESA 1EPXA 1K03A 2JKEA 2VEKA 1ZFJA 1ICQA 1HO1A 2V82A 1LM1A 3LLFA 2QCDA 4UNKA 1FCUA 3G0SA 1PHWA 3FYOA 5FEWA 3W1MA 1K7XA 4N2YA 3IIXA 3QC3A 4K38A 3LV6A 4LC8A 3GXTA 3QW4B 2FJKA 4UCGA 2CLMA 1KBIA 3P5ZA 3W7DA 4IMDA 2GQAA 4LVGA 1DQXA 1X1OA 4XKYA 4GUFA 3HGRA 1GT8A 2H3BA 3W3OA 4A2RA 2IQTA 3TW6A 2VFFA 4RZ4A 2X30A 3P60A 5HR7A 5TBOA 1GTHA 4LV9A 4UIOA 5CPMA 3WK3A 3W7MA 3A24A 4O15A 3L2IA 3M6YA 1KBJA 1NEYA 1EP2A 3M44A 3CT7A 1KM0A 3HIJA 4NVTA 3E02A 5D32A 3EX2A 4O57A 5EL1A 3TXZA 3A9IA 4UTLA 5D05A 1VYSX 3MHFA 2YYUA 3R5EA 3QSTA 3O06A 2V8ZA 1F6PA 1FDZA 2Y85A 3KRUA 1X8FA 4RZ5A 1JUBA 1KLYA 4IQLA 5EYWA 2GOUA 5IM51 4NNBA 5AYYA 3KOFA 1O5KA 2X1UA 1PV8A 2OZ0A 1VCVA 3MBFA 2C16A 3ZWSA 5I3JA 5H91A 4HHPA 3O1NA 5CG7A 2QCFA 3LCGA 3PBYA 1LROA 2OT1A 3I6RA 5LGXA 2J27A 3WFAA 1Z48A 5G1TA 3GKFA 3S9YA 1QPRA 1UCWA 3S1WA 1K8ZA 3W1PA 1VS1A 1MSSA 2A6LA 2ISWA 1DQWA 2YCEA 4XTIA 3R2GA 2B7OA 3P8IA 1H7PA 2GQ9A 4IPJA 1KFKA 1D9EA 4YWIA 3OBKA 3NQCA 4NZFA 4HNNA 3CEPA 1Z44A 4AB4A 3MYPA 1K02A 3G1DA 1H60A 2QUUA 5AYXA 3P67A 3TQ0A 4EF9A 3C56A 2Z6JA 1OX4A 1ME9A 5I3IA 2NUXA 3C4UA 1AW1A 1OFRA 1H7XA 3TAKA 1TRDA 1XBXA 3BARA 1Q45A 4LS2A 3LERA 2Z2UA 4DPQA 4JTKA 3UNDA 4S2CA 4UTUA 2Y6ZA 1AW2A 4MIMA 2E6YA 4OWGA 4OQVA 2TYSA 1T96A 3GK0A 3ZR4A 2C15A 3AJXA 3KXQA 5AFDA 3TIMA 4BI7A 4ADTA 1GG0A 4M6PA 3M5XA 1QPNA 4JY8A 4TMBA 3KVJA 4CCEA 1XUUA 1WX0A 1KTBA 1TPEA 2CZFA 4O54A 1JCJA 2CZ5A 1WAUA 2VOMA 3CEUA 2Q8LA 3QZEA 5HINA 3C52A 3GAYA 4JTSA 1DV7A 2ATSA 1C9DA 1ML1A 4HKPA 3IVTA 1JCNA 4GE8A 3G24A 1L6YA 3HJZA 2BTMA 4O1BA 1R2RA 1H1ZA 3IIVA 3W76A 3M1ZA 3NPWA 4S2BA 3R12A 1A5CA 3QQ1A 1DOSA 3UZJA 4PA8A 1H63A 1FQ0A 2GPTA 1OF8A 3W7JA 1KM5A 3A5FA 4A3UA 1O94A 1GWJA 1G4SA 3W7PA 5A5WA 2YXGA 3G8RA 3NZRA 3EWYA 5FF0A 2ATMA 4N4QA 1KV5A 5KINA 1MEWA 2Z6IA 5D2WA 5D09A 3PR2A 3W86A 4UTJA 1GG1A 1L9WA 1AL8A 3CIWA 5FF7A 2CZEA 3HGSA 3G1VA 1BTMA 1EX5A 4PH6A 2A2IA 3PG9A 1UB3A 3PSWA 1UUOA 4A29A 3PULA 3NEVA 4FX6M 4CQAA 2WSQA 3QMSA 1G69A 3TJLA 4UTIA 3MI6A 1F73A 3GX9A 1JRBA 1CW2A 3B8DA 5AHEA 4GNJA 1NFBA 3NZ1A 3GXPA 1TPVA 4M6VA 5FF2A 2YFNA 3W84A 4Z1AA 3PUEA 3DKLA 1SFJA 3O15A 3M5VA 5LNSA 1C29A 1IXQA 1B4KA 3EEGA 3IIPA 3E96A 2ISSA 2NV1A 2OCZA 2QDGA 2EKCA 2WSRA 1LTDA 4WY0A 4ML9A 5C54A 2QKFA 3CIXA 5IBXC 5MHBA 1W3TA 1M5WA 2H90A 2PCQA 1V5XA 3GXNA 2NWRA 3EWXA 3N14A 4ORMA 1OX5A 3IGUA 4K7VA 3KFTA 2G95A 1OYCA 2WPBA 1HFBA 3P62A 3SGUA 5AC6A 2J24A 3MHUA 1VYRA 1DBTA 3L0GA 1PHQA 3BGJA 1RZMA 3B03A 1XI3A 4XWUA 5AHNA 3N34A 3B0UX 2FLIA 1EEPA 2R8WA 4IXHA 3OEXA 1MO0A 1SPQA 3P82A 4JTGA 4O1AA 1T99A 2Y63A 3P74A 2C18A 3ZWTA 1VJIA 3NG3A 3ATZA 3CB8A 1GVRA 3OHIA 3IEBA 1FCVA 4FXSA 4AWTA 5C5YA 1KM2A 4CNOA 3THQA 1K7FA 4NT0A 2WO5A 1PCKA 5CZ0A 3ZFHA 4FX7A 3E49A 4JDBA 1Y0EA 1F74A 2ZZ2A 3SGZA 3EX3A 4O10A 3NL3A 2E68A 2ZRUA 5DN1A 4TU1A 5CPOA 4UXDA 3TMQA 1E51A 2A1YA 3R13A 4W9TA 1JCMP 2JKPA 1H7RA 1A5AA 3IGSA 1S5WA 4FNSA 1G7UA 2I1OA 1CI1A 1VZWA 1TV5A 1ME8A 3WJYA 4CLMA 1U5JA 1IIGA 3UXAA 1WA3A 2ZA2A 3P8JA 3KRSA 1I2PA 3MO7A 3Q2DA 2DZXA 3JR2A 4X3ZA 3WJWA 1TPFA 2R94A 3IRDA 2Q3OA 3YPIA 5EBUA 2HS8A 1JQVA 4RZ6A 2RDTA 4RR4A 5D30A 3TC7A 3U8GA 4KFNA 3C2OA 4GRSA 1SSDA 3B4UA 3RLVA 5CKSA 1SR9A 1Z41A 3LHZA 1TPDA 4HSOA 1GEQA 3NVTA 3LTPA 4WY0F 2A21A 4LVBA 4N4PA 4FEZA 3TA6A 2AQWA 3G0UA 1KM6A 5CGQA 5FI8A 1TQXA 3BW4A 2P10A 4XTDA 3W2LA 4LWWA 3GNDA 5BMXA 3JS3A 1OFQA 4O17A 4NUWA 5KITA 3IV3A 3F4NA 3VFLA 4TO8A 3QM3A 4YMZA 4KWWA 3BG5A 1UUMA 2YSWA 2QAFA 3KVLA 3CM4A 4RXFA 3S5ZA 2E6AA 3HOJA 5K3VA 5U4NA 4FHAA 2YX0A 4X2RA 2LLEA 3EWZA 5HUPA 1BKSA 2NUYA 4NU7A 2NXIA 2QUTA 1KLZA 5HMSA 5F2LA 3GYEA 3DH7A 4O12A 3BW3A 2EAWA 4NNCA 3W7HA 3LXAA 1FWRA 1YXDA 3GNNA 4UFKA 3TUUA 2V5LA 4EF8A 2E5CA 5AC7A 1VQTA 2H3DA 2JKAA 4O1CA 4GWEA 5D38A 2Y7DA 1QR7A 3DU0A 3T55A 2NX3A 1F2JA 1ICSA 1F76A 5DCEA 4FNUA 5E0KA 3CQ0A 1R30A 3SJ3A 4WXYA 3USBA 2A85A 1D3GA 1UBSA 3TXVA 1HO4A 2ABBA 3EKLA 1YTDA 3VI2A 3NQFA 1SW0A 3IVUA 4AMAA 1M7PA 1KM4A 1SFLA 2GQ8A 1G4PA 3ATYA 3BG3A 4CCDA 4JTUA 4JTEA 5HWNA 1UJPA 2VFEA 4E0CA 4MZ1A 4JTJA 5HQEA 4IPIA 1LOSA 3VNDA 3RFAA 1HTIA 5CZJA 1NAL1 4WXZA 1EUAA 3I68A 4QIUA 2C14A 1OFPA 1SO3A 3NA8A 3P80A 3QRHA 5FF3A 3GDLA 3I7RA 1XC4A 1J4EA 2YFOA 3EXSA 2YGYA 3DBPA 1TTJA 3TE9A 3GDKA 4K36A 3UWQA 4UTWA 5CZSA 3DHDA 4DBEA 5CPLA 2E6DA 2C0AA 3LRMA 4O52A 3W75A 4Y6GA 3W71A 2ABAA 3N9RA 5I3HA 4WD0A 4UTWC 3LCLA 4JYEA 4UUIA 1WXJA 3S5NA 4PL1A 2Z1BA 4K6AA 2DZSA 5C6MA 3C6CA 4NX0A 1G6CA 5CPNA 1WBHA 3HG5A 2BX7A 4N02A 1RQHA 5DXYA 3STEA 2BXVA 3UWZA 3CTLA 4K39A 1T8XA 1XUZA 1GYLA 4RKAA 2DORA 3W1UA 3W7CA 1KV8A 1MZHA 4YXGA 4Z0SA 4ZZ9A 3LDVA 3U2OA 3OG3A 3TFXA 4ZVJA 3OVQA 1ZAHA 4OBTA 3TDFA 4AHOA 4N9DA 2B4GA 3LM7A 1TREA 1FX6A 4JX4A 4LC6A 1G67A 1JUEA 3QYQA 5IBXA 4LTSA 1Q6OA 4O0ZA 3NAVA 3WJXA 3W83A 1UASA 1QWGA 3KX6A 3STFA 4M5PA 3N9SA 1XM3A 1N55A 3TQKA 1TO3A 3P81A 3EB2A 1LRTA 3Q58A 1LBFA 1QCWA 4O13A 4XUGA 4NJGA 5DLCA 5DBUA 3W2KA 4DO4A 4TX9A 2J9ZA 2PRMA 2JBMA 2A7NA 1XBZA 4MUZA 1ME7A 3PSVA 1O5XA 1K3UA 1FWTA 4OT7A 2YR1A 3L5AA 2X1TA 2FFCA 1QOQA 1R2TA 2FTPA 1F6KA 3PF3A 5D37A 1NF7A 3HG3A 4GXMA 3LBCA 1YDNA 3ANYA 4E38A 1U83A 2X2GA 4G1KA 5C2XA 2XFWA 1OVDA 1HUVA 5LHFA 1SW3A 1V7YA 1OG0A 3GIYA 4H6KA 4O11A 3STGA 3NDOA 3CWNA 3LV5A 3O16A 3MMTA 4K7YA 1QPOA 1W8SA 2EHHA 2ZA1A 2TPSA 4WJEA 2E09A 2GUUA 1FXQA 3DHFA 2FDSA 3G3MA 6ALDA 2AGKA 3ELFA 2NLIA 2NUWA 2ZZ3A 2VFIA 1FDJA 1JR1A 1QAPA 3L5MA 3PB0A 4MZ8A 1MEIA 4BF9A 1O60A 3QJAA 4RLIA 3THAA 2NV2A 2KZHA 5KTLA 2ALDA 4LUJA 3P7YA 3W2JA 5CZTA 1ZY9A 2VEPA 2DZUA 3M7WA 4LS0A 1TCDA 2GVGA 3BLFA 5HWJA 4OU1A 1W37A 1DVJA 1LOQA 3KRZA 2CLKA 3U6WA 3C2RA 4LVDA 3W9ZA 3DFNA 1P4CA 4NJKA 1IXNA 4PTNA 2W0UA 5J5DA 1WDWA 4DXVA 3G1SA 3GAKA 1OX6A 4UTTC 4QAIA 5K9XA 4NX5A 4HSNA 3RLUA 2W79A 4M6QA 3S42A 2P0OA 2ZA3A 5EMUA 3S1UA 3W6YA 4QISA 2A6NA 1TPWA 4I9AA 3BG9A 3LI0A 2OT0A 4FF7A 4UR8A 3MJYA 1FCBA 2TSYA 4DF2A 3DI1A 3DI0A 2ZRVA 4DQWA 4NJJA 2WKJA 1D3HA 1CX9A 4DPPA 1G7VA 3ABOA 1VPXA 4UNLA 3TFCA 4AAJA 2PC4A 3W7LA 4Y96A 3MI2A 4P2VA 4TIMA 1GYNA 3CLMA 1OFOA 1VLWA 4AHPA 4UTKA 4KFOA 2DZVA 2HTMA 2JGQA 3PUDA 2PURA 4JIQA 4DEFA 1B4EA 3TC6A 4MVAA 3OIXA 3E12A 5G4EA 2QCHA 4JEQA 5BW6A 1SQ7A 2B7PA 2QCMA 3W1QA 1GVQA 4XBKA 4X9SA 4YL2A 1YTEA 4Y90A 1OYBA 3BGGA 3G1AA 1BEUA 4HPXA 4UMBA 4OV9A 1VH7A 4S1FA 3LBMA 3A22A 5DBTA 3G18A 1ZAIA 3T78A 2ZFAA 2GJLA 2J88A 4UFIA 3LTSA 1N8FA 1K8XA 3MP4A 3EXTA 4LRSA 3QPYA 4LOCA 1TPB1 3MBDA 3GDMA 3KVMA 4WX2A 4DF1A 1S5VA 1SZEA 4FNPA 2BSLA 3NM1A 3H53A 4ORIA 1GVFA 4C1KA 3TU9A 3M43A 4QSHA 4O50A 5E93A 5H2ZA 4E2BA 4K8EA 4MLJA 3L67A 3FKRA 1SU5A 3I65A 2A4AA 4IWWA 4UFLA 1I2NA 4BR1A 4K8HA 3JRKA 4UTMA 3L66A 1WOAA 2C13A 4MZYA 3NNTA 1W54A 5LZLA 1YXCA 3W1AA 3PS7A 4IMFA 3SIZA 2Y89A 1TB3A 4R53A 3HBLA 1TMHA 2UV8G 5D2TA 1FDYA 3DFOA 1H7OA 2DZTA 1PE1A 2D73A 5DXXA 1YXYA 3B04A 3STCA 4QQ3A 4LV4A 5HR6A 3TR2A 3QPZA 5HULA 4H3DA 1VHNA 4X22A 3M5YA 2QJGA 3GLCA 4AF0B 2QR6A 4JYDA 1AMKA 3TROA 4WUIA 4YLWA 1DKWA 4JN6A 1K7EA 3TK7A 4IMGA 5E1QA 3HB9A 5FEPA 1WOBA 4RJEA 1FUYA 4AXKA 4CNPA 3LRKA 1JJKA 1VGAA 1R2SA 3O05A 3BLIA 1XFBA 1TTQA 5D2VA 1FCQA 3NQGA 3WK1A 2ZTKA 1SUXA 3S6DA 1WQ5A 1NSJA 1KFCA 4JTHA 3LLDA 2WQPA 2Y62A 5HNRA 3UY7A 4H4IA 1M7OA 3PG8A 1DJNA 4L4MA 1VCGA 1A5BA 1W3NA 2CZDA 4JTLA 3I7SA 5F4XA 1GOXA 4LVAA 1VCFA 4Z1CA 1W5PA 4JGDA 1OK6A 1W0MA 3W73A 4XBSA 4QM1A 4CQ9A 1IXOA 1TIMA 2Y7GA 8TIMA 4IMEA 4JX5A 2YZRA 2VELA 4LW7A 1TPH1 4NXSA 5I3KA 4YCPA 1YPIA 4O14A 2PRLA 1PL9A 1ADOA 1EUNA 2VKZG 3EX1A 3LCXA 2QUVA 4IGHA 3MP5A 3L65A 1AL7A 1XKYA 2PRHA 1W3IA 4NXKA 1KFJA 4Y8FA 4QITA 5F2IA 1H1YA 2FPTA 5G2IA 4ALDA 1IGSA 4O1DA 3B0PA 4BI5A 4XQ6A 3W23A 1SO5A 3VE7A 1H61A 5F4SA 3KAOA 4I7UA 3RNDA 5HJLA 1AW5A 2RH9A 3RK8A 4NJHA 1GZGA 3N3MA 2CW6A 3DFPA 1T0OA 1G4EA 4AF0A 4Y9AA 1B3OA 1KW1A 1L6SA 2FIQA 2DZPA 1OX4B 2NXHA 1EP3A 1A50A 1KFEA 5KZEA 1QPQA 4QJ1A 2BLEA 1OYAA 5AB3A 3M9YA 2P1FA 4HN4A 1SO4A 3UPBA 3O63A 1TV8A 4ZQOA 3NQDA 3RF9A 5G5IA 5DY2A 3SR7A 2J9XA 3DFSA 4LS1A 4MJZA 2TMDA 3NO5A 5DY3A 3S5YA 2Y7FA 1IIHA 1S3HA 2CLIA 3SY5A 3N2XA 1Q6LA 3TW7A 3W7OA 3LTYA 2FPVA 3P61A 1JCLA 2RKXA 2VC6A 1ZENA 3W1NA 3IIZA 1H62A 1W5OA 1H7WA 3W7IA 4ICNA 1TJPA 4RK8A 5AHMA 4CNNA 3W7GA 2V0TA 3UWWA 1I8JA 1FY6A 4IOTA 4PEKA 2ZCGA 4PFMA 2PE4A 4O19A 3BW2A 2A7RA 3MYOA 4RV8A 5F4WA 1TTIA 2BWGA 3T44A 4LUIA 4LT9A 2QCDB 4Q33A 2ZBTA 1FWNA 4MPQA 1Z42A 4BWLC 1VYPX 4KKXA 3FA5A 1P5BA 3O07A 2Y61A 4LRTA 2NZLA 3IGXA 1RVGA 2QCCA 1RR2A 2WNQA 1FBAA 3LHYA 2EGZA 2G5WA 2CLHA 4UFHA 4HNTA 5SWUA 1MXSA 3PWAA 5FF4A 4DBDA 4PL2A 1HL2A 4JDYA 1VLIA 1ONRA 5LSMA 4FO4A 3N2MA 3D0CA 3UQNA 1LOLA 3KVKA 3NL6A 1OJXA 4RX0A 3MI3A 2QJHA 2Q3RA 1FXPA 3NXFA 3LB0A 3G8EA 4PC8A 4CCCA 1VRDA 1R47A 3QW3A 2ZZ6A 2ZQ0A 3TSDA 2Z0IA 4AWSA 5LGZA 1EIXA 4IJBA 4R33A 1YDVA 1Q6QA 3L21A 3G22A 5KZMA 4M7TA 1H7NA 4HNUA 2QCEA 4EOUA 4JNMA 3LCIA 3LOTA 1RD5A 5HUOA 2QDHA 3F4WA 3RMJA 1OK4A 4JYFA 1EA0A 3TAOA 1KM1A 1JCXA 4M7SA 4A2SA 3UZ5A 1ALDA 1I2QA 4HIBA 3EWBX 4MOZA 4GUHA 2NWSA 5G2HA 2WSYA 3BV4A 1PS9A 1RQBA 4Z1DA 5T26A 1DJQA 3HGOA 2E1DA 2V30A 5F1VA 1OFDA 3O6CA 4R34A 4ZQNA 3GZ3A 1FWWA 3O6YX 2QJIA 2XN1A 3LCWA 3IIOA 5LKYA 4AHQA 2F7FA 3R8RA 3CC1A 2OX1A 2EF9A 3PM6A 4FIQA 3O8AA 4KWVA 4UMCA 1IXPA 2R91A 1EWDA 1OF6A 4RCXA 2TRSA 4GFSA 5I3GA 5G2WA 1IF2A 3LCHA 2ZYFA 4U28A 4NJIA 3M0ZA 2AAMA 3NQAA 4FIRA 1AG1O 1TPC1 3ZS4A 1SSGA 4O18A 4O16A 5TQLA 5K4ZA 1EB3A 2Q8ZA 4CQ8A 5EA9A 4AEOA 2ZZ5A 3C61A 1BWLA 3B06A 1JCYA 3EX4A 3M16A 1JUKA 1XBVA 1WV2A 3TX9A 1W1ZA 5G4WA 2H6RA 3NOEA 3FJ6A 4JXCA 2WNNA 4ADSA 1KA9F 4ZMGA 1ZJIA 1PIIA 3MHGA 4A21A 3EWWA 3NL2A 5BRBA 3N19B 1R46A 1TQJA 4BFAA 5K2ZA 1DHPA 4MLRA 1M6JA 2WJZA 3M47A 1LBLA 7TIMA 3S1VA 3GDRA 5HWMA 1EP1A 4QNEA 3L9CA 4JX6A 4D2JA 2QEZA 4A22A 3G3DA 3C8FA 3A21A 1YDOA 3QEZA 1QOPA 1BWKA 2NX1A 1TJRA 1JRCA 1TYGA 3LI1A 3W7QA 1OABA 1X6UA 1W31A 5G1YA 1A53A 3FEMA 2OJPA 2YYTA 4WZHA 4I7WA 4ZQCA 4BK9A 3L68A 1WBJA 6TIMA 3NQVA 5F2GA 3DGRA 1QO2A 4GJ1A 3HPZA 2HS6A 3PAJA 1A5SA 4N6EA 2G96A 4ONVA 2NX9A 1B9BA 5CSRA 1F05A 3W2UA 3TJXA 4AVFA 3G0XA 1QNVA 3GR7A 4JS3A 4HT3A 1O95A 5C55A 2QAPA 2Y70A 3DENA 5K7JA 3QH2A 5EKYA 3EXRA 2VEIA 3UWUA 1ZNNA 4XZ9A 3LRLA 1J5TA 2O7SA 5CSSA 4PCFA 4JTTA 3H55A 1GPWA 4Z08A 1SZGA 1LBMA 3PUOA 5LNRA 1GTEA 1VHCA 3OA3A 3OVPA 3UD6A 2ZZ4A 1ZHAA 3FJLA 4FNRA 1TTPA 3NPUA 2V5BA 4IX2A 2RDUA 3R89A 4MY9A 1X1ZA 3SECA 4O4WA 5BMWA 2YW4A 1KFLA 1HG3A 2B0MA 2V9DA 3FFSA 1KFBA 3PVFA 4EIVA 3HO8A 5J5RA 2CFFA 2J9YA 5F1UA 4JR5A 1N7KA 3NGJA 4TMCA 1GVOA 1X7FA 2E5BA 2HSAA 2V2CA 4EWND 1O4UA 1KM3A 4J9JA 2ZZ1A 2X1SA 1ICPA 1H50A 3NM3A 1B57A 4LY8A 2Y7EA 3EKZA 4O0KA 3Q94A 1L6WA 1LYXA 3NQ2A 1OHLA 1SZNA 3F1QA 2FPYA 4JTIA 3RU6A 5L6UA 2X16A 3W7RA 3V75A 1I4NA 3DFQA 3BPWA 3UXDA 4E2DA 4MFDA 2RHGA 2E6FA 4XKYB 1XCFA 2ZDRA 3HF3A 4N6FA 3SZ8A 4JICA 1C8VA 4GBUA 5DCBA 3TSBA 2VFDA 3QMTA 3NQ8A 4O28A 3UPWA 5FEZA 2I14A 3LXCA 3PB2A 2YPIA 1LRNA 2A7PA 2DJLA 3QF0A 4K37A 4ZQPA 3EX6A 3WK2A 1W5QA 4B5NA 2VFHA 3M41A 3B05A 4OHQA 3M5ZA 2X1RA 4FX8A 1SO6A 4R7JA 2DZWA 2WNZA 3NR0A 2VFGA 5LNVA 5I3FA 2RFGA 4FNQA 4GUJA 1XL9A 3K30A 2GJNA 2G97A 4IXXA 5AYZA 1GVSA 3SSJA 5K9CA 3BK0A 3O6DA 1SZFA
chains in the Genus database with same CATH superfamily
1F3EA 1YBQA 1QMLA 1UZDA 1WUEA 1RBLA 2DU2A 3AXKA 3C0JA 3TYUA 2HCVA 4EACA 2ZRZA 3FLUA 3GKAA 1TZ9A 1J8VA 5T91A 1XIIA 3WELA 2I16A 3GNRA 2QCGA 4OOUA 2GQ3A 3G1HA 4PBGA 1PCWA 1XBYA 3H4XA 3UU0A 3LXBA 3W22A 1S2UA 4V2XA 4IIGA 3TH6A 1LWIA 1R8LA 1K6WA 4Y2WA 3VOJA 3G1FA 3CH0A 3GU1A 3DZ1A 3WJSA 2IS7A 3GR8A 5HQLA 4HCHA 1AK5A 3N17A 2R14A 1RUSA 1P0NA 3E3HA 3WNOA 2IPWA 4GO9A 1JDDA 4EVZA 2GFTA 3R43A 1KCZA 3NYDA 4O53A 3TCEA 2C1IA 4MKNA 3B0VC 4M8UA 1T7LA 1TRIA 4F0HA 2ZZ7A 1FKWA 3W1TA 3WJZA 4HNVA 3LSBA 4A8NA 1ZBWA 4QJ5B 2XSAA 5LIKX 2DT0A 4HVXA 2CLEA 5FA5A 2VXNA 2JK2A 4IH3A 3EB3A 3NPXA 4QG6A 3T4CA 1OGBA 1GOOA 3WCZA 1UH2A 3MWAA 2L5HA 2Y8VA 3LD5A 4GH1A 3FKKA 3QZ6A 3S5OA 2GGEA 2JE8A 3E0FA 2QW5A 2NVDA 3L12A 1FHDA 3DXIA 4WOZA 4M1RA 2ANUA 4FF5A 3QV9A 4QR6A 1XF0A 4IP5A 1A80A 1IEIA 2ZRYA 2QF7A 3DAQA 3MUXA 1JVNA 5FIPA 3W25A 3U57A 4E4UA 3GFYA 4JQ2A 1XD0A 2PFHA 1DWGM 4Q4SA 5A6SA 1E1CB 2XN2A 3UJ2A 3H24A 1Q4WA 4WKHA 2YA2A 1XP3A 4C6JA 2GGIA 5CAKA 3P5YA 3TN4A 2FB2A 2DDXA 2R1KA 3LPPA 4JNYA 3CK5A 4WK9A 4F2UA 2FVKA 4OJYA 5AHIA 1KTNA 3C2FA 3OVRA 2XIBA 1CNVA 2IMRA 3NQEA 1YADA 1Q6EA 3RRXA 3C2EA 5D2XA 2C3ZA 1V02A 4Q8PA 1B3VA 3E0IA 1BRLB 3F7JA 2W62A 1I2OA 5JUVA 3FVMA 1G01A 1LDCA 4Q22A 3MANA 1RCOB 4MFEA 5FEXA 1J9YA 3A3WA 1Z3NA 2C6QA 3PJUA 1Y65A 1OFEA 2HMCA 1ZBKA 4EAYA 2C1HA 4IZGA 4HNLA 1QNQA 2HVMA 3BAIA 3NXLA 2EPKX 4RNIA 3AO0A 2XH0A 3QQWA 3H2MA 1XXXA 2V5KA 4BEUA 3V5FA 4OUIA 1H5YA 2W92A 3VOGA 4RXGA 4QNWA 3ARVA 2YL8A 1J10A 3B8SA 1WDQA 3H7VA 5CPQA 5AN7A 3VTRA 3BZGA 4JD4A 1KR1A 5D02A 4C6IA 5BWAA 4YU1A 5LNUA 3GVRA 3DKJA 2QGHA 1W9XA 4ZXLA 2GGHA 3I7QA 4XV0A 3F2CA 3LM3A 3T08A 4FXRA 1VEOA 5BU9A 1NVMA 1CXEA 4PODA 3VX0A 2OX4A 1CZ1A 2GWGA 1JGIA 3OZPA 3CWOX 5KZDA 2D2HA 3FOKA 2ISVA 3MJMA 4YCOA 4G9PA 1LCOA 1EJUC 4HPJA 3C3NA 3DG3A 4GK8A 2PDBA 4UFJA 1T41A 5CLTA 2IUZA 1W56A 4M6UA 3ZJ8A 2O4MA 3QQ0A 1S3TC 3AS3A 2XHYA 4PMDA 3FY1A 3VIJA 2WW5A 2ASHA 2B31A 3WMSA 1V6TA 3KZSA 2HE8A 4PTDA 3W70A 4US5A 1E1EA 3APGA 3VZZA 5DELA 1H49A 4Q8NA 2F6XA 3AFBA 4GVIA 4IL2A 2H8ZA 4R27A 1LLWA 2CWNA 1NTHA 4QAWA 1OG6A 4LF2A 1K03A 2JKEA 3FSTA 3SAZA 3R0DA 1ZFJA 3O3RA 2V82A 4S3FA 2OZ3A 5FJUA 3H12A 4UNKA 5ECVA 3O7UA 2BVWA 2EEXA 4N2YA 4DWSD 1QNOA 3QC3A 4PUJA 4LC8A 1KGUA 3VUSA 4LF1A 4H8HA 1BVWA 4MWAA 5LIUX 1KD0A 4LVGA 1GT8A 4HMCA 3NFUA 1FWHC 2PD5A 4RZ4A 5A6BA 1NM9A 3P60A 1DEDA 4QLJA 4F4RA 5HR7A 1GTHA 1WKEA 3WK3A 1MXGA 3BLDA 1L8PA 3GFZA 4JFWA 1EP2A 5GJPA 1J2BA 2PS2A 3CT7A 1QTWA 3DFYA 3EX2A 3A9IA 4IIHA 2E40A 2EBNA 2V8ZA 1F6PA 1FDZA 2XWEA 2Y85A 1JUBA 1KLYA 4JN7A 4IGMA 1TUXA 5IM51 3OB8A 4UZSA 1VCVA 3ZWSA 4GI9A 3GM8A 4FXJA 2GK1A 3WFAA 4YHGA 3TWBA 5A1AA 1MSSA 2C79A 2ZVRA 1EDQA 2VCCA 2A6LA 3R2GA 2B7OA 4HJFA 3AHZA 4XB3A 2I7GA 1KFKA 3NUKA 4A3YA 4IJRA 1R9XA 1Z44A 3TZNA 2BNJA 4S3EA 2XVLA 4DNMA 3IUDA 3MYPA 5LA2A 4NRRA 3VNIA 7TAAA 2DPEA 5AYXA 2WZHA 4MGGA 2Z24A 3EPMA 1UKTA 3WLSA 3NTYA 5I3IA 3C4UA 2HVNA 1AW1A 2GVYA 1H7XA 5CC3A 4H1ZA 4Q7NA 4C7FA 1Q45A 4G5DA 4LS2A 3GTFA 1OZQA 1V3KA 1AW2A 7REQA 1IZCA 1D7KA 3OHMB 5M17A 1NH6A 3ONBA 3EMZA 3OZOA 1S2TA 4YVPA 1XG3A 4OQVA 2XWDA 2TYSA 1T96A 4IICA 1QNPA 3GK0A 3AJXA 3ZR4A 1W17A 4ADTA 2CERA 4IIFA 4D1IA 1PYMA 4YN5A 1U1JA 3QKEA 2DH3A 1WX0A 4LJ3A 1CXIA 2VOMA 4E2VA 3CEUA 3RCYA 2WZEA 3B9DA 2XJ7A 1GUVA 3U4AA 4Z17A 1Q63A 5E70A 4W7VA 2FHFA 4HOXA 1PWMA 3HFTA 4HKPA 3WUGA 1JCNA 4GE8A 4JEJA 1F6YA 4C60A 4I90A 2BTMA 5I2UA 2OKTA 4H2CA 3KEHA 2O0TA 1A5CA 3QQ1A 4AW7A 2W67A 1H63A 4HMDA 1A4LA 4EP8C 2GPTA 1I1WA 3ANVA 2Z27A 5AYIA 3AQUA 3A5FA 4A3UA 3E5BA 4U3AA 1GOWA 3THUA 3NZRA 5FF0A 1BG9A 1KV5A 2WMHA 5F7UA 2REQB 1A5OC 2HBXA 1BYAA 5JH1A 3B8VA 3PR2A 4AU0A 3EA1A 4UTJA 2JEPA 5IHSA 3GFXA 2OWWA 3CIWA 2CZEA 5CSUA 2F2KA 3G1VA 3ZT6A 1BTMA 1FKXA 2ZX6A 3GTIA 4B5VA 2A2IA 4WLCA 4NI3A 3LENA 1DJIA 3TJLA 1G69A 4JIHA 3FDGA 4M51A 4HA4A 3B8DA 4U33A 1NFBA 2R6OA 4WJ8A 5IOBA 3NO3A 1TPVA 3WNLA 2F6KA 1UP3A 4Z1AA 3PUEA 1O12A 2PUZA 5G4HC 2EKCA 4W5ZA 3WO8A 5C54A 4ML9A 1R3SA 3DOPA 3WQVA 4K1WA 5A8OA 4ORMA 1M7XA 1E70M 2VYOA 1L6FA 4ERAA 2G95A 1OYCA 2WPBA 5HPCA 1AD1A 5CGTA 3K4WA 1B5TA 3BGJA 4GNVA 4KW2A 4IMAA 4LEFA 2P53A 1EJSC 2FLIA 5AVNA 1SPQA 3WDQA 2XIMA 2Y63A 4KMQA 4ERGA 5JU6A 1VJIA 4AD3A 3DECA 2CWXA 1FCVA 4AWTA 1WKDA 5C5YA 4FR1A 3IUIA 3B3DA 3ZFHA 1FWGC 2INZA 4J28A 5EBAA 3SDOA 3ZJ7A 4UZUA 3CZJA 4BF7A 4QFUA 3CMGA 4ZBCA 2E68A 1UA7A 4IP4A 1XLJA 5CPOA 3PUGA 4W9TA 3IGSA 1G7UA 3CBWA 4ECLA 1J0ZA 1E4IA 1IYXA 1O5RA 2XFFA 2VZOA 3WD1A 4CLMA 1TWIA 4B5WA 1U5JA 1IIGA 3UXAA 1WA3A 1PZ0A 4HK5A 3RLHA 3KRSA 3MO7A 3RYSA 2P5NA 1BWVA 2NV9A 2Q3OA 4B9YA 5EBUA 2HS8A 2ZICA 4RZ6A 2RDTA 1F3TA 1W1A1 1TFVA 5FJTA 1V0NA 2GJPA 1H1NA 5CC5A 3C2OA 1GQJA 5G1MA 4YYCA 4GQQA 3SCNA 3NVTA 3WUBA 4HSHA 1DPMA 1HVQA 3G0UA 3BW4A 3TTYA 4B5SA 3W2LA 1OFQA 4XZNX 4C91A 2PODA 1QK0A 4ZCWA 3BG5A 3KVLA 4H9UA 3NDYA 5A8NA 3KLLA 2ACSA 3WMCA 3BQ5A 2NUYA 4NU7A 4V28A 1KLZA 4RW3A 4RE2A 3CV2A 1YXDA 3AS2A 4EF8A 1VQTA 3N13A 1XG4A 2H3DA 4O1CA 5FKYA 3AAMA 5D38A 3UXIA 1PKNA 1E9IA 3ECQA 3KBNA 1ICSA 3AISA 1F76A 3E0LA 4ZFMA 4GLEA 4PEEA 1WO2A 3GSMA 1SW0A 2GQ8A 4LYQA 1V6YA 4TTGA 4MZ1A 4QCFA 1DIDA 1EJVC 3FHQA 2QJJA 4IPIA 2E9BA 3RFAA 3DG7A 2GJRA 1UWAA 4L6DA 1OFPA 3MVIA 1XRVA 4B2DA 4S3KA 4DJFC 1T6MA 4XKMA 3NO1A 4K36A 3UWQA 2UWFA 5CPLA 2BY0A 1PJ9A 4Y6GA 2BY1A 3FAXA 2HZGA 3N9RA 1PX3A 2Q02A 2Z26A 4JYEA 4PL1A 3DN5A 2MUCA 1G6CA 4Q4OA 2CBVA 3ITXA 2A79A 2XGBA 1N2VA 4N02A 2VRJA 3QTPA 3CTLA 3F5JA 1XUZA 1GYLA 4RKAA 2DORA 4DLFA 3RN6A 5EMJA 1MZHA 4YXGA 3TC3A 4ZZ9A 3LDVA 2WC4A 3WIJA 2BMBA 2FMOA 1DE6A 2ZUSA 1SJDA 1FWJC 2PDHA 2FJUB 4N9DA 4Y8EA 3QZAA 1XIDA 1G67A 4F40A 3W81A 2ESCA 2VT0A 2XIIA 1VD6A 5FJRA 1XIBA 1JZ6A 3T0DA 1QWGA 1KCLA 4M5PA 4FLQA 4JQ3A 1TO3A 3VDCA 1LRTA 4CN4A 4KEUA 4O13A 3QV8A 2ZXAA 3VNKA 1BAGA 4DO4A 2VEGA 2JBMA 4HMNA 1ISWA 3URQA 4D71A 3R4IA 4XZMX 3N9KA 1SM9A 3TNBA 2OGYA 1QOQA 1R2TA 2FTPA 2CIPA 3RCMA 4E38A 4QXIA 2HXTA 2X2GA 4G1KA 1JPIA 4QS6A 4DAIA 4GPNA 5FJPA 1Q6FA 3H2FA 4H6KA 2DGAA 1H0IA 3AMLA 4H9XA 3LV5A 3O16A 4K7YA 2Z1XA 4JPGA 1Y5XA 2AL2A 1NFPA 1E3ZA 3DHFA 2PP3A 4JQ4A 1O7AA 3ELFA 5A6BD 2ZZ3A 2Y2WA 3UJSA 3ZVHA 2VGGA 1FDJA 1W2PA 1O60A 4RLIA 3PZUA 3SB0A 2CPUA 2J4GA 1XLLA 2KZHA 3LNMA 3P7YA 3W2JA 1ZY9A 2VEPA 3APYA 1UMYA 1TCDA 2GVGA 1ITUA 2GUYA 5HWJA 4OU1A 5A6KA 1E55A 4WVXA 3AXMA 2CLKA 2VZVA 3UVAA 1GHSA 3W9ZA 3OQ8A 1P0DA 3CZ8A 4NJKA 3VXGA 1VFSA 2J8TA 3SEPA 3IUHA 1IXNA 3WQ6A 1WAWA 5J5DA 2F8QA 3WNNA 1V0LA 2ZWZA 2PDFA 1XGDA 4QAIA 9RUBA 3AIQA 2IQ0A 3Q65A 1K9TA 1LUCA 3S42A 2P0OA 4L9XA 4WKFA 1OIFA 1TPWA 4U31A 3BG9A 3MSGA 1C7TA 2OT0A 4KH2A 2D69A 1ZUAX 4CVUA 4Z2LA 2Z7KA 3SY8A 3T2QA 2F38A 1U33A 3EMQA 4DPPA 1G7VA 2W5FA 1JZ7A 1E0XA 2PF8A 4UQBA 3VAVA 1K77A 3E38A 2E25A 3CLMA 1XYLA 1PB0A 4UTKA 1YE4A 4GQBA 2JGQA 5CC6A 4JIQA 5H8PA 3VU2A 3TC6A 3OIXA 2IKHA 2PWDA 1XKJA 5G4EA 2QCHA 4XD5A 2QCMA 4YL2A 1GVQA 4Y90A 1OYBA 1MFUA 1BEUA 5DBTA 3G18A 3MQTA 2GJLA 2J88A 4UFIA 5ABHA 1N8FA 1K8XA 3VIIA 3PZQA 3EWDA 2P8CA 2BSLA 3PFRA 3NM1A 1IT8A 3U5UA 4L56A 5HK4A 4C1KA 1F61A 3CZGA 4BQ4A 4GHRA 3QPEA 1KXTA 2FZNA 2I56A 3AC0A 2PI6A 3L67A 3UERA 4Q6XA 5FAGA 5XIAA 4K8HA 2P76A 2C13A 4MZYA 3KS6A 1V7AA 3W1AA 3S9IA 4IMFA 1E9ZB 2Z29A 1MQQA 3RCNA 3T6CA 3SUSA 1R85A 3HBLA 5JBEA 2R24A 3WQPA 2VTFA 3F4CA 2NQZA 3KE0A 4AXNA 3QPZA 2OLSA 4H3DA 1VHNA 1TZ7A 3WDIA 1BVNP 4MNKA 3GLCA 4AF0B 3TROA 4WUIA 1Y7VA 3KTXA 4AD1A 4IMGA 2Z4GA 5E1QA 3HB9A 4EXAA 1KQYA 3UZYA 2PTXA 1FUYA 4AXKA 3S9ZA 3LRKA 1JJKA 4EE9A 4NY2A 3MUY1 3O05A 3BLIA 1IWPA 5D2VA 3R1ZA 1K8CA 3WK1A 3I10A 2ZTKA 3GBDA 4NYUA 1SUXA 4AX7A 3S6DA 1VBUA 2NT1A 2ZXQA 1XYMA 1DJNA 5BXTA 1VCGA 2PGWA 1W3NA 2CZDA 3VNLA 3L2MA 4H7ZA 4ML4A 3I7SA 1GOXA 4DM1A 1VCFA 5E0FA 5FJJA 4XBSA 2D0FA 1TIMA 4NKCA 3KCOA 4IMEA 4KIRA 1V3LA 2YJQA 5CEWA 2OQLA 1V79A 4D8ZA 4XAPA 1YPIA 5GPRA 3TOPA 1UKOA 4EK7A 2VKZG 1AL7A 1EHAA 1XKYA 4J35A 1W3IA 4QBXA 4QITA 3BAKA 1H1YA 5F2IA 4ALDA 1IEWA 3NCOA 2E7FA 4H6QA 3B0PA 4BI5A 4WJXA 4XQ6A 3PZOA 2ZUUA 1SO5A 3ZLHA 3KP0A 5F4SA 2XGIA 4I7UA 5HJLA 2HNEA 4O1FA 4NJHA 4YJ5A 2CW6A 4CUCA 3DFPA 1WZLA 4Y9AA 5TAOA 3ITTA 4BHYA 2OO0A 3CV7A 4DJFD 4GMEA 2FYMA 3NSMA 4V1XA 4S3GA 3UWEA 2CETA 3M9YA 1SO4A 3NQDA 2J9XA 3DFSA 5DY3A 2TMDA 4OIFA 2YDRA 1EEXA 1JZ2A 2HISA 1S3HA 3VD3A 4FSAA 3W7OA 3P61A 4DAFA 4B5XA 3ZSTA 3IIZA 3MSYA 4GVGA 4RK8A 2V69A 4CU7A 4DUXA 1S46A 4PEKA 4JHZA 1RPKA 1A5NC 3BSGA 4AC1X 3AZTA 1UWIA 3MY9A 4HZ6A 4LUIA 4LT9A 3RRAA 2QCDB 2ZBTA 1P6CA 1PIFA 2DH2A 2GDUA 2DZAA 1E3XA 4XD6A 2QCCA 5A8MA 2WNQA 3LHYA 2CLHA 1XRFA 1PZ2A 1MXSA 3PWAA 5FF4A 4XZLX 3AMKA 3WLNA 4DBDA 4MB1A 5CQ1A 1MRQA 3WUFA 3AYSA 4A6GA 4KF1A 2VURA 3UQNA 3UR2A 1LOLA 3W29A 3CGTA 3EOUA 3MI3A 4XISA 3NXFA 3PPHA 2POZA 1DYSA 4PC8A 1RJQA 3TTEA 3A47A 4X0VA 3CO8A 1R47A 2ZZ6A 2Z0IA 4K68A 4NIRA 1A0EA 5E5CA 7CGTA 4IFKB 4HHMA 1QASA 1FH9A 4RUBA 1UR0A 4WCJA 4JFVA 4P7RA 4P8XA 1HKKA 3IJDA 2PU1A 2V67A 5HUOA 3Q67A 4GXWA 4NAFA 3TAOA 3WQEA 4ACYA 2SFPA 4A2SA 2BY2A 4HIBA 3EWBX 2FGLA 1XINA 4GUHA 1U1HA 1RQBA 3TLQA 1YNPA 2E1DA 1OFDA 3KBWA 3O6CA 1EC9A 4IQJA 1WE5A 3ISIX 4N42A 1RVKA 4IUGA 3KL5A 3O6YX 2XN1A 1XDJA 2F7FA 3XIMA 3CC1A 3PM6A 4RDZA 4FIQA 4XUYA 1OINA 1IXPA 3ZQ9A 1P1MA 3P2VA 4CD4A 3DHPA 1EL3A 2TRSA 4GFSA 3CUIA 2OZ8A 3A12A 4U28A 1N82A 4CU8A 4D8AA 1ENUA 2Q01A 4A3RA 1XRTA 1AG1O 3CB3A 1DWHM 5DANA 4O18A 4GIAA 5BROA 4TV6A 4HU3A 5E9AA 4J4KA 1FHVA 2Q8ZA 4U10A 1J0YA 4AEOA 1BWLA 3WBYA 3EX4A 3M16A 3MMDA 5A6MA 4PUMA 4LPCA 5G4WA 4C6QA 3FJ6A 4F0KA 2FZMA 4JXCA 2QDDA 3NOYA 3MHGA 1GVYA 3O0KA 3C0LA 3N19B 1FWAC 1TQJA 4BFAA 4YTUA 5K2ZA 1DHPA 3W0KA 5HWMA 1EP1A 3AICA 2PEVA 5A6JA 3L9CA 2UY4A 4D2JA 2QEZA 3UR7A 5BXPA 3WF1A 1XIMA 3SCVA 2FZ8A 5EMLA 1I9CB 1YDOA 3QEZA 2NX1A 4BEQA 3UZXA 1TJRA 3WL0A 3LI1A 3W7QA 1A5LC 1GOMA 4GO8A 1OABA 3C5QA 1W31A 2YL9A 2HEJA 1LQ0A 4DUOA 2P50A 4WZHA 2YBVA 1GNXA 2PWHA 3OZYA 1WBJA 4KEZA 5F2GA 4KIEA 2QULA 1I1XA 2YZ5A 3S83A 1VFUA 3VGEA 1ZJBA 1XLDA 5DFAA 4RPQA 1TV2A 5E6YA 2HS6A 4UB9A 1BXNA 3OPSA 2WM1A 1B9BA 1Z8AA 1F05A 2J78A 3TJXA 4AVFA 3G0XA 3GR7A 1US3A 3WL1A 3MS8A 4Q8MA 5EKYA 3A4XA 2RJGA 3VM7A 1ZP3A 2AL2B 4Q8WA 3EOOA 3LRLA 1J5TA 2O7SA 2BGQA 1WZAA 5CSSA 4PCFA 2PWUA 3H55A 4JTTA 4WEVX 1SZGA 1CGTA 3PUOA 3VO0A 4QJ3B 2WZMA 1HNYA 4HOZA 1C92A 3UD6A 3ARXA 3FJLA 1HL9A 3TN6A 4MY9A 2HVOA 4HZ8A 4W88A 1KWGA 3L4TA 3AXIA 2EG8A 3W26A 3PVFA 2G50A 5I77A 1UROA 4MM1A 4QS5A 2HSAA 2IPGA 4LY8A 5JIPA 3EKZA 1XICA 4BQ3A 4XBJA 4HNCA 3RU6A 4DYKA 4S23A 1TR1A 2QDEA 4L61A 1DJYA 3CAQA 3V75A 2G4FA 3GG0A 3W7RA 3DFQA 1MXDA 4W86A 2E6FA 4FOUA 3O9NA 2HK1A 3GTNA 3WD4A 3WX7A 2YL5A 4JICA 1P0BA 2VFDA 2BODX 5HNNA 3UPWA 2CBJA 3HPFA 1POKA 1Q8JA 2FTWA 2GSEA 1LRNA 3QF0A 3OZMA 4K37A 4PCPA 4QE1A 1JAEA 3EX6A 1W5QA 2OO6A 1DHKA 1GQKA 3THDA 5HMDA 4JAWA 4OHQA 4C7DA 4U2YA 1RK6A 3OBEA 2PTZA 3J7HA 2PDYA 1R5YA 3KDNA 2E9LA 1XL9A 1EDGA 2XM1A 3PTMA 5K9CA 3SSJA 1GVSA 4B5TA 3W02A 3BK0A 3VD4A 1DORA 3QSRA 4R7OA 3U5YA 4M3PA 1S5MA 1RH9A 4W5UA 2D24A 3LSCA 4GC4A 2WC3A 3FYPA 5KMYA 4G2DA 5REQB 3E2SA 2ACRA 3LHUA 4DO7A 4P5UA 3WUEA 1I45A 4CD6A 2GDVA 1EA9C 4LAOA 4PRRA 3DHUA 4JQAA 1LJYA 1PVNA 4ZSTA 2VGFA 3W2MA 3U2ZA 4Q32A 1W3KA 4DIAA 1R9ZA 4GUGA 3GDBA 1J2WA 4PTXA 2XH7A 3PBUA 4MAVA 3VK5A 1LZOA 5EPDA 4DF0A 3G5EA 1RV8A 3NDZA 4ZOBA 8XIMA 1QI0A 3KZPA 3LGEA 5C8BB 4OGZA 4HHHA 4ZFCA 3L5LA 2JFEX 3LNPA 2V2HA 1W5NA 2C71A 4BJHA 3S8HA 3BZJA 3UWVA 3MWCA 4FNTA 1EYEA 3DIPA 4U5IA 3SI9A 1QHPA 1YYAA 2A3EA 4IIDA 3PWIA 4EPEC 1TG7A 1BSIA 3ZYZA 2EPHA 1RJRA 3VA8A 1VR6A 1ADSA 4S3BA 5F2MA 1JF5A 3AYRA 1JIBA 2RAGA 1VP5A 3CUJA 4MY8A 1OM0A 3BMVA 3U48A 4B90A 3VCRA 2INFA 4JIPA 1ADDA 4WHBA 3UWYA 3ARRA 2FQIA 1W1IE 1ZAJA 2OU4A 4DZHA 1OGSA 1EWEA 2YDAA 3BSMA 3E9AA 3MO4A 5D8WA 4DO5A 1KGWA 4K3ZA 2QIWA 3M7SA 1YX1A 4AH7A 4AEEA 2O4QA 3R94A 3PZVA 4IF2A 2WC7A 1BYBA 3INPA 4PULA 2B7NA 2ZX7A 2OLAA 4D6IA 1W5MA 2XINA 2DUXA 1MZRA 3W88A 2W3ZA 3QFEA 2PC8A 4UFMA 2X2YA 2BZNA 3ABSA 4GUIA 3W2NA 2VP8A 2WBKA 1ESWA 1A5KC 2V81A 3NL5A 3E5PA 3THCA 3GXDA 3AROA 2BHUA 1Y5VA 3I3EA 2VEMA 2BVDA 4TVDA 3BLOA 3CU2A 3LHTA 2WOQA 3W07A 2J47A 3R0KA 4L9YA 4MADA 4UBPC 1VBGA 1TSIA 3VC6A 1B2YA 2YBUA 1PKMA 4J40A 4UTTA 3NQ7A 3VOHA 3I4KA 1QDSA 4MTVA 1LORA 3UFYA 1ZB5A 3CQHA 1IT7A 3LCFA 3P14A 3W7KA 4X61A 4KETA 1QW8A 2JIWA 3QV6A 4Y9NA 3W6MA 3HMJG 3C2YA 1P6BA 4PZVA 4DI9A 4JTDA 4S3CA 1NWTA 1YTKA 3WQCA 3DYMA 3W28A 3CZKA 1L6GA 1LLZA 1W2VA 2FVMA 1H4PA 3II1A 2WCGA 3L0KA 5DQPA 2PWEA 1XFCA 1WDSA 2OB3A 5I6SA 3A23A 4Q7BA 4BWLA 2F84A 2BOFX 1LG1A 4Z1BA 1EGMA 3IPWA 2Q6ZA 2YL6A 2ZX8A 3PBWA 1A47A 3W1LA 4BI6A 3GNXA 4M82A 3GYCA 5FJOA 3GVGA 3MVTA 4TR9A 1R3VA 1NWRA 3VDBA 2JGYA 1NF0A 3NQ6A 2Y1HA 3N12A 4MYXA 2E77A 5A3HA 3LX9A 3GUWA 1UH4A 2Y0FA 2PLJA 1AZ2A 3QMRA 3UZWA 3S2MA 5DT5A 1K8YA 4UC5A 1OFAA 4JTAA 3W72A 2GYIA 2GSJA 1WNOA 4WDUA 2XN0A 5AHFA 3TV8A 3P0WA 3ABQA 3FIGA 4RV3A 1UOKA 2YLLA 1F07A 1G4TA 3AIEA 2IW0A 2ZX9A 1GHRA 3H54A 4N9BA 1H51A 3BLEA 6REQB 1M41A 5BNKA 1X97A 4Z2IA 3ALGA 4LAZA 1DIOA 1EGVA 1DJWA 3PAOA 3A6OA 3KTCA 3CPRA 3EPOA 2ZC1A 3V1HA 2X0HA 3W85A 5AVHA 4ZL1A 2G8ZA 3GH5A 4D6EA 3V3WA 5FESA 1EPXA 4XZWA 1ICQA 1RSCA 4NZ1A 1LM1A 3LLFA 5JXQA 2WZTA 1B90A 1SJCA 5A2AA 3EYPA 5DX7A 5FEWA 3ME3A 4K8GA 4HGXA 1H0GA 3HM7A 4H9ZA 2Q09A 1KBIA 3CYJA 4W8AA 3SQLA 2GQAA 4XKYA 4GUFA 3ZT7A 3W3OA 3AIRA 1LWHA 3G77A 3T9PA 2VFFA 1DWIM 5ENLA 4LV9A 4ZE5A 4UIOA 1C3FA 3GC5A 1VJSA 2PMQA 1EXBA 2DV0A 4O15A 3L2IA 3M6YA 2D2JA 4NZ5A 1KM0A 5DO8A 2WWCA 5D32A 3FDKA 5EL1A 5D05A 3R8GA 2VQUA 3MHFA 3R5EA 3JVAA 2VDGA 5HBFA 4Z2KA 2GOUA 4DHGA 1XR2A 1MVYA 3M6DA 1O5KA 3MBFA 2WNWA 5I3JA 1EF3A 4HHPA 5HNUA 1LROA 3HV9A 2OT1A 3I6RA 3O0FA 2E8YA 1I6NA 1Z48A 3GKFA 1JZ4A 3S9YA 1RP8A 1K8ZA 4XAFA 3W1PA 1VS1A 3NSXA 4N7QA 2BBFA 3F4DA 5EMMA 2ISWA 2YCEA 4TX6A 4XTIA 3HTWA 4F9DA 1KFWA 1GONA 3PZMA 3QLDA 3OBKA 4PUNA 4E5TA 1OSEA 3CEPA 1PZ3A 1UA3A 3VIHA 1W9PA 4GY0A 3WEZA 3G1DA 2FKPA 2PDXA 4GC3A 1ONXA 1GCYA 3C56A 2WVVA 2Z6JA 2DVTA 3N2TA 1EOMA 2NUXA 3BOLA 4DJDA 2G0WA 1DXFA 5C9UA 1M01A 3BARA 3LERA 1ZGDA 1EBHA 3DYOA 3R0UA 2PAJA 3UNDA 4S2CA 4UTUA 4MIMA 2PDQA 2Z2BA 1MQPA 2WKLA 5JQ9A 3T1GA 3UEQA 3TLLA 3SY1A 1U5HA 2IPFA 5BOFA 1Q2RA 1ELSA 4BI7A 4JY8A 4TMBA 1KCXA 3RPDA 3CV1A 3SN4A 1XUUA 4GI4A 1TPEA 2CZFA 1JCJA 3AMCA 2CZ5A 3WZ0E 4Q8VA 4GYJA 3QZEA 4FMVA 1Y8BA 3C52A 2J7DA 3VGGA 4R3UA 4JTSA 2ATSA 2XPKA 1T40A 2DVUA 4D6HA 1NDZA 1QBBA 3AHXA 1B0IA 4KESA 3W76A 3M1ZA 3N2BA 1H11A 5C9WA 4KRZA 4OBRA 1RY8A 3SUVA 1BG4A 3WYZA 2FH6A 1KM5A 3V0SA 5HPOA 2VR4A 5FSEC 2YXGA 1A5UA 1UR1A 5A8PA 1EJTC 2Z6IA 5D09A 3SRDA 1GG1A 1AL8A 3HGSA 3W27A 3RJYA 1V08A 1W1PA 4JHMA 4PH6A 3UR5A 2DIJA 4PBEA 1PDZA 3PSWA 1HJUA 5IRPA 4LYRA 5DMLA 3PULA 6XIAA 3CUGA 3NEVA 1XLFA 4DBUA 4CQAA 5HMEA 1VBRA 4GCAA 1FTXA 1U22A 3NZQA 4Q8TA 1CW2A 2OEMA 5AHEA 4GNJA 4QX4A 3LY0A 1CXLA 4NYYA 3BUVA 1QHOA 1XLHA 4HK6A 2ZVIA 3W84A 2NVCA 3S2LA 3K8KA 3M5VA 1C29A 4D6DA 1B4KA 4REQB 2BS9A 2OCZA 2NV1A 1B9ZA 3GW3A 3R10A 3LGDA 2D0HA 1ECEA 1WDDA 1JD9A 2QKFA 3CIXA 5IBXC 1NQ6A 2OODA 2OVLA 2PCQA 1V5XA 2VX5A 3N14A 3TJIA 3ANUA 3MB9A 3IGUA 1L0PA 2YXOA 4ZO8A 1MUWA 3D46A 3OTRA 3P62A 2J24A 1DBTA 1UPPA 2RUSA 1RZMA 3B03A 1TX2A 2PDNA 2NQ9A 5AHNA 3B0UX 3SADA 2YA1A 4IXHA 2Y5EA 1KRCC 1EXPA 4O1AA 3SGGA 3IWPA 3P74A 1FWFC 3ZWTA 3CB8A 1UG6A 3OHIA 1WDRA 3WDJA 1W1B1 3GC2A 5E9XA 1K7FA 4NT0A 1PCKA 3S6OA 2BXYA 2I5IA 3E49A 1F74A 2HBVA 5M03A 4CNUA 1KRAC 1VIZA 3NL3A 2J7HA 4CKQA 2ZRUA 1JYVA 4TU1A 2A1YA 2HDJA 3R13A 3WF4A 3SIMA 1S5WA 4FNSA 2GUBA 2AGTA 2I1OA 1CI1A 1VZWA 3T81A 1CLVA 1TV5A 1ME8A 3WJYA 3MZNA 5JIWA 1JF6A 3MT1A 1NP0A 3FCPA 4KCTA 3PBMA 2WM0A 4JBRA 3EA3A 1I2PA 3Q2DA 2DZXA 1HKWA 1S2CA 1TPFA 3IJ6A 1LQAA 1FA2A 3YPIA 1UD4A 3NURA 3VIPA 1EPVA 1X7IA 3BXWA 3EDKA 3U8GA 1AUSL 1SSDA 3B4UA 4AVOA 5CKSA 4HSOA 1TPDA 4WY0F 2A21A 4P8WA 4LVBA 4FEZA 3TA6A 2BB0A 1KM6A 1ISYA 5FAJA 4L9ZA 3K4DA 1XH0A 3F4NA 4LAMA 1BTCA 3WKZA 4ES4A 2VX6A 2XU2A 4DX3A 3APTA 2QAFA 1JZ3A 1SZRA 3FW6A 5IHRA 2XIQA 3S5SA 3S5ZA 2E6AA 1HX0A 5U4NA 1XSKA 2BY3A 1PTDA 5HUPA 1BKSA 2ISDA 4J27A 5HA7A 1CBGA 2VNCA 1DWJM 1BF6A 3DH7A 1HP5A 1OGGA 2EAWA 4NNCA 3LXAA 4S3AA 1FWRA 3IV8A 3BAYA 2WMFA 4UFKA 2KAUC 5AC7A 2YOCA 4G7FA 2JKAA 5BOEA 5B7ZA 3JZEA 1XV8A 1Q6CA 3DU0A 4HBKA 1DTNA 4WDWA 2NX3A 4HD5A 4DB7A 1TKKA 3ZT5A 5I09A 5E0KA 3CQ0A 1R30A 3USBA 4WXYA 2J74A 1HO4A 3RDKA 3TXVA 3EKLA 4MNLA 4GYFA 4XX6A 4KT2A 3VI2A 3IGHX 4AMAA 2C1GA 1KM4A 5LIWX 3ATYA 4CCDA 5HWNA 4JTUA 4JTEA 1TVNA 3CS2A 2VFEA 4E0CA 4JTJA 1Z6KA 4TOQA 3VNDA 3CUXA 4FALA 1NAL1 4WXZA 1EUAA 3I68A 5JBFA 1IEVA 2C14A 3P80A 4JIIX 4LXFA 5FF3A 3I7RA 3KTSA 3R11A 1JGMA 1S38A 3DBPA 3D3FA 3BTNA 1TTJA 5CZSA 3DHDA 3WQOA 4DBEA 4RDWA 4AZ7A 3ERPA 3W75A 1M53A 1UHVA 3R79A 4DWDA 4WD0A 1TWWA 3LCLA 4UTWC 4UUIA 1WXJA 3WQGA 1CB7B 3BICA 1E0WA 2J25A 5C6MA 4W87A 1XIHA 3C6CA 1RAKA 3VABA 1RQHA 1POJA 4HPGA 1DJXA 4K39A 5CG0A 1MI3A 1T8XA 3KLKA 1HZYA 3W7CA 1KV8A 4Z0SA 1FVPA 4JZ5A 3TFXA 3LYEA 4HA1A 1UUQA 1ZAHA 3TDFA 4AHOA 1G1YA 3MSRA 2WHLA 1LUCB 4PMXA 4QLKA 2XZ7A 1FX6A 1QW9A 4JX4A 1YBQB 3IAQA 5C71A 3AXHA 3M46A 1JUEA 3QYQA 3OP2A 4LTSA 1Q6OA 4O0ZA 1P6WA 7REQB 4EXQA 3TR9A 3M07A 3DGBA 3QBUA 3P81A 3EB2A 3AWOA 5GJMA 1SYTA 4FLRA 1IEXA 4GIYA 2WMIA 4NJGA 5I79A 4ZEPA 1JZ8A 1F4HA 3AXXA 4Y9OA 2J9ZA 2PRMA 1WUFA 2A7NA 4LYPA 4XZHA 2G3MA 1ME7A 1L8NA 2ZC8A 4BKNA 4GIRA 4P7OA 4F0RA 2J6VA 1FH8A 2PU0A 2PDPA 1PAMA 5D37A 1E40A 5MKGB 2VZUA 3ANYA 3H6OA 4AY8A 4IPPA 1HP4A 1HUVA 3DG6A 5BU6A 1WZKA 2E0PA 1OG0A 3GIYA 1LT7A 5TD4A 5ABFA 1NDVA 1QPOA 3KHDA 1W8SA 2EHHA 1C9WA 2ZA1A 2TPSA 4WJEA 1OCNA 2NW0A 2BFGA 4Q6JA 2VVSA 3H4WA 2NLIA 1HJWA 1DWFM 1YKWA 3CL7A 3AI0A 2VFIA 2ZX5A 1ISVA 1QAPA 2QJNA 3L5MA 3THAA 4JKKA 4LUJA 3VDAA 2PZ0A 2DZUA 3M7WA 4OOZA 2ZIDA 4KERA 3ARPA 4IFOA 5D8ZA 3BLFA 3FJNA 4AQLA 3ZJ6A 1VFTA 2Z1VA 1Q5MA 4GXPA 1P4CA 4GD0A 1QI2A 3KOXA 4F2TA 1CLKA 2YCJA 4Y7EA 1W1TA 3GAKA 4GABA 4NSBA 3AZRA 3T0TA 3A9BA 2HXUA 3RHGA 3AIWA 4M6QA 2ZA3A 3GIPA 4MUPA 3S1UA 5EMUA 2E3ZA 2A6NA 4DZIA 3V16A 3LI0A 3V35A 4UQCA 2DW7A 3W6LA 1MFVA 2G41A 4W7UA 3DI1A 2ZRVA 4NJJA 5E6ZA 1D3HA 1FP8A 2DQXA 1TX0A 4ATLA 4B3LA 4AD2A 1ZQ5A 3TFCA 3RIKA 3QHMA 3W7LA 5I24A 2AOSA 5BWFA 1OFOA 4AHPA 3BLKA 4OKDA 2EPNA 4KFOA 4RE4A 4Z42C 3PUDA 2PURA 3M0LA 4ZSUA 1EJ7L 1J0JA 1VKFA 2A3HA 4NP7A 1SQ7A 2XVKA 3W1QA 1YTEA 2P88A 1CEOA 3CHDA 2WSKA 4JCMA 4S1FA 4XSLA 1PWLA 3N29A 4JFSA 4XVDA 2ZFAA 4IL0A 1TJ2A 3LTSA 1JNEA 4ZO9A 3QGAC 2CC0A 1GQIA 4MWAD 3EXTA 4YNGA 3QPYA 1JI2A 1VEPA 1UIOA 3Q4DA 4FNPA 2DSUA 2BXZA 4JL1A 4FZIA 3M43A 5I5RA 5JBDA 3ITCA 2OTDA 5CBJA 2X0SA 4Q4RA 5T9BG 2G4JA 2GJXA 2XVGA 3I65A 3AUJA 5C7HA 2A4AA 3LN3A 1Q4NX 4IWWA 1I2NA 3OGRA 3JRKA 2OYLA 3ZLGA 1BF2A 1JDAA 3VOIA 1BVZA 5E09A 1UD3A 2Y89A 3WD0A 1HIZA 4TVCA 3ABXA 4YTSA 5D2TA 4YHEA 1MW3A 1XIJA 1H7OA 2DZTA 1B31A 2D73A 3M0HA 3DUGA 5HR6A 4ZTYA 3BCJA 5AKQA 2WVSA 4X22A 2WVUA 4Q7IA 2QR6A 4JYDA 1XCXA 1AMKA 3POHA 4IG2A 3CPUA 1DKWA 4JN6A 3BLPX 1RBOB 5FEPA 3WDRA 3FA4A 4IQDA 3VNJA 3OVGA 1TTQA 3PN8A 4J3VA 3D47A 4PTVA 2DY3A 3AS1A 4GVHA 3AJ7A 1RLDA 5CBIA 1H2JA 2Y62A 2BHZA 2WWDA 3GNOA 3ZM8A 1P43A 4GA8A 7ENLA 3KM8A 4KEVA 3OO2A 2QNEA 1A5BA 4A8LA 5EGRA 4JTLA 3ZIZA 3W73A 4QM1A 4CQ9A 2Y7GA 3CJPA 8TIMA 3ALFA 2YZRA 4G8TA 3C0SA 3FA3A 3C0QA 4O14A 1TE1A 1XIGA 3LA4A 2Z7GA 1KFJA 2VDHA 3SN1A 3BCFA 4O1DA 1E9LA 3UR8A 2YA0A 1R7AA 3W23A 2WZIA 3VE7A 4DY1A 3KAOA 4ZB5A 1E4MM 4B3ZA 2RH9A 2V3DA 1GZGA 3N3MA 3N18A 4L65A 5A69A 4PMZA 4AF0A 4HOWA 2PLCA 3WQWA 2DZPA 4JN8A 1KFEA 1QPQA 5B80A 4NL1A 1OYAA 1V93A 3GUGA 1V0KA 4HN4A 3A3XA 3BL3A 2TAAA 4LS1A 4MJZA 3ITYA 3S5YA 2X1IA 3FJ4A 3SUTA 1FFQA 2V5JA 4LANA 1Q6LA 2YDQA 2VC6A 4NASA 3S46A 1BGAA 1OT1A 1W5OA 1QW7A 1CTNA 3H2CA 2RGMA 4JL2A 5ABFB 1P7TB 2V0TA 3UWWA 1I8JA 4E8CA 3E0WA 4H8VA 3WH8A 2WYSA 4C6FA 2ZCGA 1X1NA 2FDMA 4O19A 2A7RA 4F48A 4RV8A 3HQOA 3K13A 3T44A 2EPLX 4Q33A 1QHZA 2REQA 3PHAA 4KKXA 4BA0A 1MNZA 1P5BA 3REQB 4AUBA 3O07A 2QMKA 4LRTA 2NZLA 3IGXA 1RVGA 3S1GA 2EGZA 4HNTA 1S2AA 4C65A 3RX2A 1QRQA 3N25A 5LSMA 4FO4A 4Z2HA 2GSHA 3N2MA 3QR3A 3V18A 1O1ZA 4GY7A 3KVKA 5AECA 1OJXA 1J93A 1QATA 1Z9AA 3MCNA 4PR4A 1J96A 2Q3RA 3RJXA 1FP9A 4I5XA 4RE3A 4CCCA 4DZAA 2Z28A 2PGRA 2ZQ0A 4C5ZA 4GBDA 3L21A 1Q6QA 4PB4A 4W84A 3EOSA 1ZJAA 3TTSA 1H7NA 4HNUA 1W3LA 3LOTA 1RD5A 3NSNA 1NWUA 2GZXA 1KC7A 4JYFA 4LAKA 1KM1A 4H8NA 4W8LA 3FEQA 3PTQA 3UZ5A 2CEQA 5HMFA 1QPKA 4PRWA 4PUUA 4DJDC 1A3HA 3VYLA 3WBWA 4LSBA 1BPLB 5T26A 3W24A 1SMDA 2V30A 3H8AA 4R34A 4S3DA 3TTOA 3IIOA 4MDPA 2OX1A 3O8AA 1OF6A 1GKPA 2VRQA 3UG8A 2B81A 3T07A 4DYEA 3LCHA 3SCQA 1JPKA 4NJIA 3M0ZA 1V0MA 2AAMA 2PTYA 4ZOCA 3UETA 6XIMA 1TPC1 3ZS4A 3WNMA 3VINA 1EB3A 1P7TA 4WGXA 1Q85A 3BQ6A 1HJVA 5BXRA 2D0GA 2BVYA 3LEPA 4HZMA 4V27A 3BSHA 3GHTA 4ZOAA 2AMXA 3LQGA 3TX9A 4D9PA 2H6RA 3NOEA 3BAJA 1RD6A 3LS9A 2Y8KA 2I57A 4O8AA 2BHYA 3QGVA 1EOKA 2PDIA 3MCMA 4L1XA 3M0MA 1LBLA 7TIMA 5M2FX 3S1VA 2HNHA 3BWWA 2X05A 4PUKA 2JEQA 3SCPA 3GG8A 3K1DA 1J0HA 3MV01 1F8IA 1TIWA 3F2BA 2R82A 5G1YA 1A53A 2PF0A 2OJPA 1FWEC 4LUTB 1MUMA 4I7WA 1ZU8A 3QVQA 3L68A 4DWSC 4J3UA 3DGRA 1RXOB 4GJ1A 1RY0A 1A5SA 2OSXA 3CQJA 1P0EA 1UP0A 1CENA 5I23A 1ODZA 1SFTA 1ZBVA 1O95A 4TXEA 3TN3A 2VEIA 1WP6A 4NRSA 3UWUA 1VBHA 3VX1A 1ZNNA 8A3HA 1XISA 4Z08A 1LBMA 5DRCA 1M1BA 1S1PA 2E4TA 1MW1A 3SURA 3OA3A 1VHCA 4M80A 1ZHAA 4IX2A 2V5BA 1XQLA 3N4EA 1ZCCA 4KWUA 3UGVA 4PBFA 5BMWA 5FSDC 2YW4A 3EOEA 2B0MA 1E15A 3FFSA 1XLGA 3PTDA 3UZZA 3H2AA 2CFFA 3QKZA 5CXPA 4QROA 2YCLB 1N7KA 3LMYA 1O4UA 4PUDA 1ICPA 3DDMA 3NM3A 2VC7A 1GYMA 1L6WA 1LYXA 3NQ2A 5BRQA 1OHLA 5DMMA 1EO7A 1SZNA 5H8UA 1UJQA 3BOFA 4EANA 1IV8A 2X16A 3CT2A 5LA0A 3UXDA 4E2DA 4MFDA 1VFHA 4MHBA 3T4WA 4GOAA 3OU8A 2UBPC 4LNCA 4H04A 4NHVA 3SZ8A 4MJ2A 3DX5A 3TSBA 2PDUA 3QMTA 4ZENA 2VGIA 4QDMA 4XG1A 5XIMA 1KXHA 4ZQPA 4DJEA 3P3BA 3HURA 2QIIA 3TYZA 4GACA 3M5ZA 1NIUA 5CC7A 4R7JA 3HQNA 2DZWA 4KEMA 4U2ZA 2NSXA 2PP1A 1RA5A 2VFGA 5I3FA 3WF2A 4FNQA 4DNHA 4EAMA 1ZZMA 2G97A 5AYZA 1WKFA 2OSWA 2VD9A 3G2GA 4PB3A 3O6DA 1SZFA 2YW3A 2J6XA 2W6RA 1XC6A 1R3YA 2GDQA 1F5ZA 5U7SA 4XD4A 3PZNA 1Q3NA 5HAOA 4WSHA 5CSYA 3A5VA 4WGHA 2A0NA 1JULA 3L4ZA 5KZ6A 4QJ4B 3KBVA 2O9RA 1JDEA 3L4UA 4PMVA 4UNIA 5GJNA 3IJ9A 2J7FA 2XG9A 1M9HA 3SCOA 3LHVA 4GI8A 1XDLA 4PMRA 1PUDA 2Y5SA 3B9EA 1ODUA 1OT2A 2VO5A 1NOFA 3BDKA 2DT3A 4GKLA 4F9JA 1WYIA 3QC0A 4LB3A 3EA2A 1QUMA 2VMFA 5C2GA 5HNTA 1JAKA 2ZUVA 3F03K 1R0MA 1E72M 3VKJA 5CPTA 3PBVA 1EZ2A 2DIKA 1RHCA 5A95A 2R1NA 3N11A 3GXIA 2OYMA 3BO9A 2J79A 3HPXA 3H7UA 3FGCB 4JY9A 3UF9A 1C8QA 3V1PA 2CLLA 2YB4A 1VF8A 1NDWA 3HQ1A 4AMCA 1GW9A 2B7QA 1XLAA 2CLFA 4AVNA 2CNCA 4AZBA 3H7RA 2GL5A 3OQEA 1DL3A 5AOUA 1ZS2A 3UJEA 1FOBA 4C1LA 1THFD 3T7VA 3FS2A 1QO5A 5AC8A 4AIEA 3W1RA 2WMKA 3ARYA 4MYAA 4OUEA 3TMLA 1UD5A 1A0CA 1E9YB 3BV7A 3DFTA 3CUZA 3QGKC 3Q37A 3AWNA 1F7BA 3ZR6A 3HU7A 5DCDA 3RGTA 2PDCA 2XM2A 4R88A 2VUYA 3ITVA 4G7EB 1MEHA 3OBAA 3UYCA 3PK7A 2ZTJA 5CLWA 3B9OA 4HNOA 3R6IA 1L2UA 2HWGA 1VPYA 4XAYA 5AHLA 3W7EA 3RM9A 4HA3A 4LCSA 2VZSA 2AQOA 4CD7A 1OFBA 4XD3A 2GGJA 3E0VA 1MNSA 4X60A 3MW7A 4JTRA 2VENA 3UESA 3EGJA 3LHWA 4KRUA 3V7PA 1U1UA 2RDWA 1PDYA 3MP3A 2OMAA 2V5DA 3MZ2A 4AZCA 4C6EA 4I7VA 3AMDA 3WFLA 3QFWA 3T40A 3VE9A 5AY7A 4I9TA 4ZQMA 1MW0A 4YWSA 3F4VA 2CHOA 4UMAA 3UP8A 4AG0A 4JQ1A 4HMEA 4IMCA 3WH5A 1XWYA 3D5HA 4MAZA 3SRFA 1UZ1A 5EY5A 1P1XA 3RPTA 3OLIA 4EXBA 1R3RA 3RXZA 2PDMA 2O9OA 1E1FA 4WQ6A 1D7FA 4CEUC 2NXGA 3BE7A 1KTCA 1KBKA 1TPUA 2CLOA 2IQDA 1JPDX 2PDGA 3TSMA 2PBGA 4OVXA 3L4XA 2PDKA 5HJXA 4ROQA 3RMEA 4FLSA 2GVJA 1B54A 1KR0A 1C8YA 3NZGA 1SW7A 5DEZA 3WLQA 3WD2A 3C2VA 4UTHA 4DM2A 2D2OA 1GQNA 1FWDC 4C6LA 1TWSA 5L9FA 1Z89A 3HGJA 4NAEA 2DJXA 1S5TA 4CD5A 3NYZA 1BQCA 3UY8A 4O8RA 2VVNA 3N6HA 3AU2A 4P7NA 3BGAA 1JFHA 3VMOA 3EB4A 3SCSA 4IX0A 1W6TA 1YW1A 2OGJA 3LBOA 3BANA 3NIYA 1JQXA 4D6JA 4D8LA 2Y8UA 3IVSA 3P84A 1GOIA 4PN2A 2FB3A 1M03A 4WY0B 3T0AA 3MUIA 1WPCA 3SW6A 3A3HA 2BOGX 4I5UA 4UR7A 1YPXA 5KEZA 1AH0A 2I9EA 5BOOA 4PUWA 1E6PA 1HJQA 3U9IA 4AWUA 1YIXA 2QMJA 1NU5A 3PY2A 3A4AA 4W7WA 5BXSA 3PC0A 3NPVA 3W7NA 1GOKA 4KFPA 2DEPA 1GKQA 2ZRXA 2C19A 1IWAA 4JTFA 4MJMA 1RPXA 2YXXA 1O5QA 3FXGA 4WDTA 1W32A 2VEKA 3REQA 3P6LA 4C6KA 2D1ZA 3G0SA 4FPSA 3BMXA 2PWGA 3FYOA 3W1MA 4BQ5A 3IIXA 2QF8A 1PZ1A 4XAGA 3QW4B 3GH7A 4UCGA 4DBSA 3TYCA 3MKCA 3P5ZA 2AAAA 3PZTA 4AIOA 3WY1A 1KXQA 5M1TA 2D3LA 1P48A 1Q66A 3M0KA 3TW6A 4L7ZA 3TW9A 3ARTA 3PPGA 5CPMA 3W7MA 3A24A 1S2VA 3VILA 1K4GA 4JTQA 3QYSA 3M44A 4ZO6A 3DEQA 4UTLA 3LG3A 3QSTA 3CAVA 2BASA 5I07A 4IQLA 5EYWA 2G37A 4YVVA 5AYYA 4NNBA 3DC0A 2VEFA 3KOFA 4LY4A 1E4NA 3BLLA 5AZ0A 2C16A 4UCFA 3CQIA 3HMCA 4IQEA 5FD0A 3WQFA 5CG7A 2QCFA 4LGXA 4CCZA 4E6MA 2J27A 2DSVA 4GKTA 1QPRA 1UCWA 3S1WA 2PGFA 3WFZA 2WQDA 4FR6A 4I9JA 1KKRA 4UOZA 3M0IA 3VIGA 1DQWA 3ITGA 3P8IA 1H7PA 2GQ9A 4C6OA 5HANA 4YWIA 5JH2A 4US5D 5AC5A 2VX4A 3WLTA 3GXFA 4AB4A 1UW9A 2A3BA 6TAAA 4DN1A 3E1F1 4KGJA 3EAUA 1H60A 2QUUA 2I17A 3P67A 3TQ0A 1RCXB 4DUWA 1F3WA 4L4OA 5EFDA 2OEJA 3ARZA 2UY2A 2FVLA 1OFRA 3MKKA 4QDPA 1M04A 3VGHA 2Z2UA 1YNQA 2D23A 3TVAA 3V36A 1BQGA 2CESA 4TV5A 4W93A 4WR3A 2Y6ZA 1PX4A 2PWFA 1O6IA 2E6YA 4OWGA 4ERIA 1ZL1A 3COTA 2AKZA 5AZ1A 3VM5A 4J2PA 2C15A 3KXQA 5AFDA 3TIMA 1H5VA 1GG0A 4M6PA 4G56A 4KWOA 1QPNA 3WG6A 1UMLA 1T8QA 1W3HA 4MWAE 4ICMA 3CH9A 4O54A 1JD7A 2F6UA 1WAUA 2EG6A 2POTA 4IPNB 2OKOA 2Q8LA 2J62A 4IIEA 5H8MA 3UXLA 4FI4A 1ML1A 4LYKA 4EKJA 4CNTA 1LL7A 3VZXA 4FLOA 1IZJA 3SCUA 1UC5A 2XIJA 3G24A 1UYQA 2AQVA 3URNA 4GJJA 4GJIA 4QRNA 1DIEA 3EDEA 3ES8A 3UG4A 3UZJA 4PA8A 1J0IA 1OF8A 3W7JA 3VDGA 1EC8A 2CXGA 2NQJA 2RJHA 1O94A 3H2EA 3MA8A 1GWJA 1G4SA 2OQHA 3W7PA 3PTKA 3AYTA 4GINA 3E2VA 2DZBA 3EWYA 3L23A 1B30A 1A4MA 5KINA 2EQDA 4ZGYA 1GW1A 1MEWA 3RM4A 1XSIA 5FF7A 4Y9PA 4PCSA 1DIKA 1X38A 5J04A 3PG9A 4OZOA 1GVIA 3IRSA 1UB3A 3UG5A 1UUOA 2OWXA 4I8DA 3OG2A 3HZ3A 2WSQA 3QMSA 3ITOA 3MI6A 1F73A 1E73M 1EF2A 1US0A 9XIAA 4MDOA 4WKAA 4L80A 2X7VA 1Q6GA 4GYPA 5GNXA 3FX4A 1PEZA 2NSOA 4RDVA 1ONEA 3BJSA 3UBPC 5REQA 1IXQA 3CMJA 3EEGA 2WVVB 3IACA 2WLZA 3IIPA 2QDGA 3FAWA 2WSRA 2QV4A 2VZTA 2HK0A 1U5VA 3WDHA 1M5WA 3ARWA 1NY1A 3GXNA 3EWXA 2ICSA 1OX5A 2GVEA 3HJEA 3UG3A 4K7VA 3SUWA 1BKHA 1K9DA 1HFBA 3MHUA 4ZTXA 1PHQA 3PNUA 3NJ3A 2OXNA 2I5QA 1JI1A 1XI3A 4XWUA 3WDPP 4C5YA 4HTBA 1EEPA 3GHUA 3OEXA 1SFSA 4JTGA 4XZIA 3I6EA 1T99A 1UKSA 2C18A 4BCEA 3GY1A 4JNZA 1GVRA 2ADAA 5BYWA 1KBBA 5PTDA 3IEBA 3LMZA 4FXSA 1KM2A 4CNOA 3THQA 3W53A 5EFFA 4FP1A 6PTDA 2CBUA 4FX7A 4JDBA 3RILA 3GU9A 3NEHA 1J11A 1NWSA 2D20A 4XO7A 3ZMRA 5DN1A 3TMQA 4UXDA 3O2LA 1E51A 2YBTA 1H7RA 4BS0A 2NQLA 6ENLA 1OCJA 2QPSA 1JXJA 3FN9A 3OW1A 2WMJA 3P8JA 2FH8A 4UTFA 2NQHA 1CGVA 3JR2A 4X3ZA 3FK4A 4B5UA 1TA3A 1JQVA 4FS9A 3GS6A 4GNKB 2XTKA 2ZADA 4RR4A 5D30A 1NDYA 3TC7A 1DJZA 4GRSA 3AIVA 3TQPA 4H6EA 4OFCA 1W9BM 1SR9A 1Z41A 3LHZA 1GEQA 3LTPA 5J8LA 1HGYA 4N4PA 1OIMA 5C0QA 1VFOA 4JKLA 3QR0A 4W8BA 1HKMA 1TJ1A 4XTDA 4LWWA 2FZ9A 2Y4SA 5BMXA 3JS3A 4NUWA 3IV3A 3K8LA 3T2OA 1NJJA 3VFLA 4TUFA 1XLBA 3LZ3A 4YMZA 1OEPA 4KWWA 3WQ5A 4AZHA 1FWBC 1E0UA 2FZDA 3CM4A 4FHAA 4X2RA 1E6NA 2LLEA 3EWZA 2V68A 2NXIA 5I00A 3BW3A 3SN0A 3W7HA 4GX9A 1T5AA 3N6QA 3TUUA 1BSLA 1HQTA 2E5CA <