2BSLA

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bslA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bslA01
1OFQA 1K7FA 2DZUA 2X1TA 3L0KA 1FDYA 1YLVA 2H6RA 2YR1A 2YW3A 3PM6A 4GC4A 5AC7A 3OIXA 3UWWA 2VELA 3G8EA 3M44A 2QUTA 1G7VA 3NAVA 1VGAA 2OJPA 2QCLA 2ISVA 4NU7A 5F4SA 4D2JA 3TQ0A 4MFDA 5I3KA 3PG9A 5L6UA 2E6FA 4NZFA 3M0ZA 3LRKA 4LU0A 2VFHA 1F2JA 1YDOA 1JCXA 4TIMA 4CCDA 4Y96A 4UTTC 3NVTA 2ZRUA 2Y89A 4FHAA 5KZEA 4O13A 3W1UA 5TBOA 2EHHA 3GKFA 4CQ8A 2V5LA 1MEHA 3BK0A 2Z6IA 3W1MA 2A21A 4Q33A 4C1LA 5AYYA 3W83A 1XBVA 5EYWA 3RLVA 3W7LA 1K8YA 1YDNA 1EWEA 3NQAA 3LRLA 4X9SA 4YCOA 1O94A 2YCEA 4UUIA 4ZL1A 1H7NA 1TJPA 2VEKA 1IXPA 1TRDA 4IMEA 4BWLA 4EF9A 1I8JA 2H8XA 4ZQOA 3SIZA 4LC6A 5K9XA 1U5JA 4K36A 4O12A 3T7VA 3GB6A 1SW7A 5BMXA 3ELFA 1FCUA 1SSDA 4GWEA 3FEMA 4MJMA 1K8ZA 2YZRA 4RCXA 4NNCA 1YTDA 3HO8A 4QJ1A 3NQDA 3UXDA 4DELA 5LKYA 1K7XA 3BPWA 1GZGA 1X1ZA 3PB2A 4LVDA 3W86A 2VEMA 3MHFA 4PTNA 1I2OA 3B0PA 3Q58A 1XCFA 3LV6A 3FKKA 1UUMA 3C0JA 3M5YA 3TFCA 1LM1A 3S5ZA 4MPQA 3CTLA 4JTGA 2V2CA 4OQVA 4HPXA 1SZGA 1ZAHA 1A5AA 4E0CA 2VXNA 1XBZA 3E12A 2R94A 4RZ4A 1J5TA 1SO6A 4FNQA 1ICQA 3BLEA 1A53A 5F2IA 1FDJA 3NNTA 3TCEA 3G1SA 3KOFA 3NQ6A 3M16A 1RPXA 2A5HA 3NQ2A 1P5BA 3T44A 4O18A 2WV8A 5AC6A 1DL3A 1Z48A 1IF2A 3EWUA 3KVKA 3QPYA 5CGQA 1ALDA 1YXCA 3INPA 3IVTA 3H53A 1R2SA 3AO0A 2WJZA 4A21A 5ABTA 4TX9A 2QEZA 5LHFA 1DV7A 1BWKA 4CQ9A 5K2ZA 4LNYA 4NX0A 3NZRA 4A3UA 4DXVA 1PVNA 2ISSA 3FS2A 3GR8A 3UWQA 1FQ0A 1H7PA 1LRTA 4XUGA 1YYAA 2O7QA 4JIPA 1L6YA 3GYEA 4Z1CA 1RQHA 5D33A 3LCIA 3RFAA 3TR2A 4AF0A 1VLWA 1G67A 3G22A 4UFJA 1AG1O 4OT7A 1C8VA 1D3HA 2G95A 3W2MA 4WJEA 1IGSA 3IGUA 2VEIA 2NV2A 4PFMA 1AL8A 1X7FA 2B7NA 3QSTA 4AB4A 2CLFA 3E0IA 1B4EA 2B4GA 3GZ3A 1Z42A 3W2LA 4MY8A 1LOLA 1I2PA 1OX5A 3R13A 5K7JA 1FUYA 1FWRA 3MI3A 1LBLA 4A29A 1M7PA 4GRSA 1K8XA 3QF0A 1T8XA 5EMUA 2NXIA 5AYZA 5C6MA 4KFNA 3EWXA 2FDSA 2Z6JA 4H3DA 3S1VA 4M19A 4JTHA 5HNRA 4XQ6A 1TJRA 4WQ6A 4O50A 3C2RA 2PRLA 3IGXA 5G5IA 3DFSA 2WO5A 3UXAA 5BW6A 1EP2A 1TSIA 1XC4A 5I3IA 2EKCA 3O16A 1AW5A 3WK0A 1YDVA 3G3MA 4ZQNA 3NQEA 4EWND 2FPTA 3EWBX 5CG7A 1A5SA 3PVFA 3P60A 5T26A 5KZMA 2EGZA 1R2RA 1OYAA 3LHWA 2BX7A 2FQIA 4RV8A 3SECA 3VFLA 1ZALA 6TIMA 3NQ7A 1EP3A 3BG5A 3QW4B 4WD0A 2GQAA 1TPUA 3WJZA 3PBYA 3NEVA 1KA9F 2A4AA 3MHGA 3PF3A 1VHCA 3BV4A 3TXVA 1M7OA 1KM2A 3O1NA 2ZTKA 1WX0A 4K38A 1RV8A 4BFAA 3A24A 1EX5A 3KXQA 1H50A 1NF7A 1H62A 1H7OA 2NWRA 3N73A 3TSMA 3PB0A 1KV5A 3C2EA 5FI8A 2CFFA 3I68A 4CCEA 1KV8A 3P7YA 2C13A 3CEPA 3BW2A 5FEPA 3A23A 3VCRA 4IGHA 2Y7EA 4JTLA 2A6NA 3W84A 2Q3RA 2E5BA 3YPIA 2DP3A 1KFLA 5KSWA 4MZ8A 2R91A 1TV8A 3DFPA 2Y7DA 3TU9A 3CLMA 1X6UA 3LCWA 4RX0A 3P5ZA 2YW4A 3ABRA 1SQ7A 3P80A 3KX6A 4DO4A 3W7CA 4EF8A 3EX2A 1EA0A 1VJIA 3N9SA 1KM4A 2WOQA 2ZA1A 1TPEA 1PL9A 3N34A 3EWYA 3W7MA 3LCLA 3TROA 1MEWA 2C6QA 3QEZA 4MZYA 3IRDA 5EKYA 4OV4A 1VCFA 1VYPX 3O63A 5G1TA 1PE1A 3F1QA 2YFNA 3PSWA 3GDKA 3T40A 4ALDA 1FY6A 3PR2A 1WDWA 4FF7A 1EEPA 4Y90A 3LERA 1FXPA 1SPQA 4ZQRA 4LS2A 5GVJA 1EUNA 3LB0A 5CZSA 1KTBA 3MO7A 3C8FA 1IIHA 5K9CA 2X16A 4O16A 5U7SA 5F2LA 3T78A 4ADTA 4BK9A 4XBKA 5D32A 2QDGA 1LZOA 4U28A 2GQ9A 4MY9A 3NDOA 3G1HA 4AHPA 2WSQA 1JCJA 4JTEA 1WV2A 5I3HA 3W2UA 1CI1A 1DBTA 1O5XA 2GQ8A 2VC6A 1LBFA 3S5YA 3VNDA 1JUBA 3NM1A 1W31A 5HWMA 5HQEA 1YTEA 4M6QA 3G1AA 5CPMA 3QSRA 3BLFA 3GLCA 4JEQA 1OYCA 1WQ5A 3E96A 3A5VA 2Y61A 2DZSA 5EBUA 5LSMA 4HNUA 4QM1A 3G24A 2I14A 4AVFA 2H8ZA 2RFGA 4O57A 3GDLA 3GNDA 4JY8A 1VPXA 2F7FA 3IV3A 4ORIA 4XZ9A 1W5MA 2RHGA 3FJ6A 5G1YA 1VC4A 4MLRA 5CSSA 3M7WA 1ME9A 5D37A 3IIZA 4FIQA 1F6PA 2A2IA 4HNVA 1JCYA 1F73A 4N02A 2C14A 3MUXA 4QQ3A 4LV9A 3CQ0A 2QUUA 3FIGA 4JTUA 2CU0A 3L0NA 1TPC1 4Z1DA 2AGKA 4KFPA 3OG3A 4WY0F 1B3OA 1R46A 2Y62A 5DN1A 2DZXA 4UTTA 4JDYA 2H3DA 2ALDA 1VQTA 3IVSA 1I4NA 2OMAA 2ZZ3A 2E6AA 4JYFA 5CZ0A 2FFCA 4CNPA 2A0NA 3O8AA 2W0UA 4AWSA 1ZJIA 3DH7A 1IXQA 4IMGA 5CKSA 4FNPA 2VFEA 1XM3A 1L9WA 3NXFA 3PS7A 1P0KA 2ZBTA 3W7KA 3QMRA 1VCVA 4KFOA 3I7SA 3LHUA 4JN6A 1GG1A 2X1RA 4WXYA 2CLIA 2WSYA 4DF1A 3U2OA 3CB8A 3Q2DA 1DQXA 5G4WA 5LZLA 3LHZA 4CNNA 1SW3A 1NEYA 3KRZA 5KTLA 3QH2A 5DLCA 4JICA 1G6CA 1OG0A 4K6AA 1ZENA 3NR0A 2WKJA 3QZEA 4O0ZA 4WZHA 3NQGA 2A6LA 3LTYA 5EPDA 1N8FA 4PEKA 1UUOA 3W74A 4R34A 1XDMA 1QPNA 3G1XA 4M7SA 4CNOA 3W71A 4QISA 1GPWA 3G0SA 2GPTA 1I45A 4UXDA 4UTKA 1HO1A 4MYAA 2TYSA 2NX3A 3EKLA 3DHDA 4N2YA 3W2KA 3LOTA 5AHMA 2E5DA 2WPBA 3W72A 3THAA 4AWUA 1RD5A 4Y8FA 3TK7A 5HR7A 2A1YA 3CU2A 1JCMP 2NXHA 3I7QA 4GUFA 3OVPA 3TQKA 2JKEA 5MHBA 3TA6A 1KFJA 1UBSA 3KFTA 4O10A 4BR1A 3L67A 3QW3A 4XKYB 4XWUA 3GIYA 3W07A 4O4VA 1LRNA 2JK2A 1W0MA 3TUUA 5LNSA 1NF0A 3O6YX 4MVAA 4WOQA 2B0MA 4XTIA 3P74A 3CWNA 2PURA 4UFKA 5D2XA 2C19A 4NJGA 4IX0A 5AHLA 1WBHA 4LRTA 1L6WA 3DFQA 1QOQA 1G7UA 4JX4A 1F74A 3FYPA 4IPIA 2BSLA 4AEOA 5EY5A 3M1ZA 3NPVA 1TPWA 4NX5A 1SZNA 3W7QA 4QAIA 1QPQA 4JXCA 5D2WA 3BGJA 4AH7A 3LXBA 1EUAA 4L4MA 1JRBA 4DQWA 5G2WA 2Y7GA 3MI2A 3BGGA 1QWGA 1W3IA 1VH7A 2EPHA 1D9EA 4E2BA 4NJIA 3SGUA 1OX4B 3TJXA 6ALDA 3PY2A 3QQ1A 3H54A 3L21A 3TKFA 3HF3A 3DENA 1VR6A 3B04A 4OU1A 3W7NA 3EX3A 4Z0SA 2QCGA 4Q32A 1NAL1 1FBAA 5IM51 3RK8A 3T4CA 1ICSA 2J24A 4NZJA 2XN2A 3LCHA 1KLYA 4K39A 3W70A 1Q6RA 3S1WA 3HIJA 4YL2A 1RZMA 3NL5A 1TCDA 1RVGA 1KTCA 3W7OA 3M41A 1P0NA 4O52A 2EAWA 4WOZA 1RQEA 4B5NA 3QMTA 1GVSA 3NA8A 3QQ0A 3SR7A 3TV8A 1JR1A 3IEBA 1W5NA 4HIBA 4HT3A 5K4ZA 2E68A 3GK0A 4UTJA 5F2GA 5LHEA 1O60A 1QMLA 3MI6A 4NNBA 3H55A 5AHIA 2Y70A 1AW1A 2EF9A 3EX6A 1TV7A 1W3TA 1WA3A 5IBXA 1JCLA 3PBWA 3W7RA 1G69A 2TMDA 5DBTA 1DJNA 2F84A 1OFAA 3HGOA 1ONRA 1QFEA 2TSYA 1BWLA 1OFDA 3STFA 3EKZA 4UFIA 1ADOA 1PHQA 4IMFA 4LUIA 3HPZA 1LCOA 1F76A 4JR5A 3W3OA 1YXYA 4MYXA 1O95A 1GYLA 3NPWA 5TQLA 3P8JA 2XFWA 4N9CA 3S5OA 4UCGA 3C61A 3UWVA 2DZTA 4JTSA 4UTWA 2E1DA 4O1CA 2CLHA 3O05A 3B05A 1TTQA 4NNAA 3RF9A 3R8RA 4O8RA 1PCWA 4N6EA 1XKYA 4ORMA 3NQVA 5K3VA 1QAPA 1OF8A 1MEIA 1GVOA 1PIIA 2QCHA 4IXXA 4KWWA 1TTIA 3EXTA 2GOUA 1F05A 2QCDB 3G18A 5D38A 5DCEA 2ZTJA 3WK3A 3W85A 4JTFA 4UR7A 4MZ1A 3D0CA 4UNLA 3G1VA 3GNNA 4QITA 4UR8A 1TYGA 3TMQA 3BLIA 4LVBA 3L0GA 1GEQA 2Y85A 3PBVA 1KFBA 1AL7A 1ZAIA 2ZRWA 1GT8A 5FF0A 5KITA 3BG9A 3UZJA 5CPLA 3UPWA 1FCBA 3TMLA 3LM7A 1QO5A 3F4WA 3Q37A 4LC8A 3UWYA 1W5QA 3FYOA 1V7YA 2FPYA 5FEXA 2DORA 1R2TA 4GFSA 3GDRA 3S9YA 1KBJA 3HGSA 4UFLA 2CZFA 3WJXA 1H51A 1W3NA 2X30A 1S5WA 1PV8A 4NXSA 3E02A 4KWVA 3SI9A 4BWLC 2G96A 1DHPA 3TAOA 3LX9A 1XDLA 3PBUA 1TRIA 4AMAA 3HG2A 1OFBA 4HN4A 3S1XA 3GXPA 1I2RA 4RLIA 3VE9A 5BOOA 3C2FA 3TX9A 2P10A 2X1SA 1VLIA 3I7RA 1W37A 3KHJA 1DQWA 4L4LA 3CHVA 4LOCA 1LTDA 4XKYA 5CZJA 3BARA 1HG3A 4NJKA 2QJIA 4S1FA 3IIPA 5AN7A 5H2ZA 3EXSA 3WK1A 4IPJA 3QFEA 2E6YA 3JS3A 4U4MA 1G4TA 3FOKA 5SWUA 1TO3A 4MY1A 4LY8A 2X2GA 3W76A 2I1OA 2ZFAA 1SO5A 3U8GA 2X1UA 5LNVA 1Q6QA 3P8IA 3W7DA 1VRDA 2AAMA 1KFCA 4A2SA 3B4UA 1QO2A 1GVFA 4YLWA 3S8HA 4W9TA 1SR9A 2J9ZA 3TW7A 1I2QA 2QUVA 1U83A 1YPFA 2HS6A 2WNNA 1TQXA 2J88A 4ZQCA 3I65A 4LV4A 3MBFA 3G0UA 1JUEA 4UTLA 3P61A 1TB3A 5D2VA 4QIUA 4I9AA 1KM6A 3NOEA 1EB3A 1BTMA 4UMBA 4UMCA 3ATZA 5BMWA 2E5CA 1JULA 1ZFJA 4UTIA 2Q8LA 4ZVJA 1OX4A 1S5TA 3W7IA 1TIMA 3CC1A 4HNNA 1DVJA 2VEPA 1WOBA 2FJKA 4O15A 3M9YA 5D2YA 1K02A 3ZR4A 3G1FA 1GVQA 2PE4A 1F7BA 3UYCA 1I2NA 3HG4A 1B4KA 1SSGA 5CZTA 5HMSA 3QC3A 5E0KA 1NFBA 3CIXA 1VS1A 2GUUA 2C15A 1FWTA 5HULA 4RK8A 3OA3A 4UIOA 1XI3A 3R12A 4RZ5A 2V30A 5E93A 3CIWA 3NQFA 4JTIA 3QRHA 1S3HA 2A7NA 3M43A 1MSSA 3C2VA 4FX6M 4UTUA 4EIVA 5FEZA 4O53A 5HWJA 1XXXA 3TW6A 1XBXA 3OHIA 1ZNNA 1FCQA 1N7KA 1NSJA 2P0OA 4C1KA 1JCNA 4A22A 5DY2A 1H1YA 1NVMA 4FNRA 4FNSA 2QAFA 5DXYA 3S5NA 5BRBA 4NVTA 3M5ZA 3MJYA 1V5XA 4JNMA 3M47A 3DFNA 2C3ZA 2CZDA 1YTKA 2E6DA 4NQ1A 4HSNA 2ZRVA 2V5BA 3IIVA 4TO8A 2NUXA 3M6YA 3HG3A 4IMDA 5F4WA 2NX9A 1RQBA 4Y9AA 1HTIA 5AHFA 1XBYA 3LCGA 1PHWA 3GAYA 2PC4A 4N9EA 2YX0A 4WUIA 4BI6A 1Q6LA 1SW0A 2B7PA 1X1OA 2QCNA 1VCGA 2RDUA 1TV5A 2TPSA 3SFKA 1TPB1 1EWDA 2YXGA 4GUIA 4FIRA 4DPQA 5J5DA 3A9IA 3BG3A 3KVJA 4DF2A 5D02A 3DU0A 3DXIA 5I3FA 2QF7A 5FESA 5HUOA 3W1NA 4MJZA 2RDWA 3R89A 3VKJA 4O54A 2HS8A 4RKAA 5H91A 1T99A 3USBA 2TRSA 2GVLA 2XN1A 4OBTA 3QYQA 1TMHA 4Z0JA 5C2XA 1T0OA 3TFXA 4PA8A 4TMBA 5EL1A 5U4NA 4YCPA 1SZEA 2P1FA 3TDFA 4R53A 4NXKA 2QCDA 1H60A 1TPDA 3CEUA 5DY3A 4R33A 2ZZ6A 4TR9A 2PRMA 3G3DA 2ZA2A 2RDTA 4GUGA 2C16A 3G1DA 3NYZA 2D73A 1QCWA 3NQMA 3ABSA 1H7XA 2Y7FA 3THQA 3W22A 1QPOA 5DCDA 1F5ZA 1GVRA 1OFOA 2VFIA 3MW7A 4HSOA 2PRHA 3W7PA 1PCKA 4O28A 1G4SA 1ICPA 2V82A 3L5LA 1GJPA 4JS3A 2ZZ5A 3MBDA 1QR7A 4FNUA 5FF2A 4NT0A 1F6KA 3NQ8A 3HPXA 1FX6A 2J6XA 1HL2A 4K8HA 4JIQA 1LLWA 2A7PA 3G8RA 3HGJA 4EVZA 1MO0A 1TQJA 2C0AA 2QCMA 1JUKA 2CLKA 2UV8G 1MZHA 5AYXA 1WAUA 4IQLA 3DKJA 1R47A 3SZ8A 3LCXA 3L66A 5KMYA 4BI7A 4UTHA 1OJXA 4FNTA 2H3BA 2E77A 4GE8A 1LROA 5LNWA 1ZCOA 1J2WA 3W7EA 1K03A 4S2CA 2ZDRA 4RZ6A 3LI1A 3ABOA 1Q45A 3N2MA 4PCFA 3HGRA 3C2OA 3MHUA 3W2NA 1OK4A 2JKAA 4WX2A 2CW6A 1YADA 2PCQA 2NX1A 3HOJA 5LNUA 2Z1BA 5D04C 2Z0IA 4IJBA 4FX8A 4RXGA 3PUEA 1KM0A 5FF7A 3NL2A 1G4PA 4UNKA 1QPRA 2A85A 4A2RA 1S5VA 2W6RA 1H7WA 5EA9A 3PC0A 3WFAA 4EOUA 3L65A 4JDBA 2ZZ2A 4NJJA 3EEGA 4WXZA 1E51A 1ZY9A 4R7JA 1UASA 3W88A 3W1AA 1G4EA 1QDSA 3DHFA 1QNVA 2I9EA 1H63A 3LLDA 3QMSA 2VOMA 3DZ1A 5AC8A 3LTSA 1KM3A 1AMKA 2Q8ZA 2NWSA 4JTTA 1Q3NA 4N4QA 3UWZA 4MIMA 2V2DA 3S6DA 4DBEA 2ATMA 2NZLA 4LTSA 3TE9A 1GTEA 4PL2A 3JR2A 5CSRA 4ADUA 2GJLA 2V8ZA 2BXVA 2ZZ4A 4G1KA 1OF6A 3L68A 5E1QA 2DJLA 3O6DA 4M6VA 3LBMA 3CM4A 4XTDA 2ZRYA 4PH6A 3E49A 2QAPA 4JX6A 2GVGA 3IGSA 3TAKA 4RXFA 3IIOA 1OFPA 3NQCA 3W1RA 3T55A 3R5EA 3ZWSA 4AHOA 1W1ZA 3PUOA 3PWAA 3RMJA 4H6KA 2NV1A 3IIXA 2JGYA 1WBJA 1FCVA 1LDCA 2YSWA 3DI1A 1M5WA 3MP5A 4LS1A 4I7UA 4UC5A 2B7QA 3UY8A 1AW2A 2QCCA 3G1YA 4O4WA 2ABBA 2V2HA 2BLEA 2HSAA 4RR4A 2G97A 5CPOA 3LCFA 3F03K 4OV9A 3IVUA 2GVJA 3LI0A 4LVAA 4AHQA 2R8WA 2ZA3A 1IIGA 2KZHA 4JTJA 4MFEA 2FB2A 2HTMA 2YGYA 4NUWA 3U6WA 1SUXA 5KINA 1UJPA 3HJZA 3GVGA 3GKAA 4CLMA 1H1ZA 3UNDA 1UCWA 2Y6ZA 3AJXA 1VYSX 4AXKA 1HFBA 4JTKA 1KFEA 3MYOA 3SJ3A 5CPNA 1BEUA 2CWNA 1KLZA 3TNOA 2BZNA 1L2UA 5A5WA 1W8SA 1TTJA 3W73A 3TIMA 4X22A 3HBLA 4O1BA 2FTPA 1A5BA 2QJHA 4DBDA 1IXOA 5F1VA 1W56A 4GBUA 3FJLA 1KM1A 3STGA 4UFMA 5DXXA 1WXJA 3W1TA 1YPIA 3LTPA 3LHYA 3NL3A 4X3ZA 3C6CA 2RKXA 3B8DA 1D3GA 4IXHA 4LVGA 4YXGA 2CZEA 4JX5A 2FLIA 3P81A 3LDVA 3N14A 3HQ1A 2E09A 3W9ZA 2ZYFA 1J4EA 2BTMA 4ICNA 4M7TA 2NUWA 1OFRA 1EP1A 3V75A 4DO5A 4YWIA 5LGZA 3CWOX 3WJWA 3GX9A 3BVJA 2ZZ1A 3K30A 2CLEA 3HMJG 2OZ0A 4PL1A 4LRSA 5AFDA 4X2RA 4JD4A 4O1AA 1A5CA 1Z44A 4UFHA 1LLZA 4QNEA 1FWWA 3N3MA 4H4IA 4N9BA 2AQWA 1TTPA 5F4XA 2C1HA 3W1QA 4ZMGA 2ATSA 4K37A 1Z41A 5G2HA 1GYNA 4HHPA 4GNJA 2V81A 4LT9A 4NJHA 1Q6OA 3C4UA 1C29A 3KRSA 4UTMA 4S2BA 1VYRA 5LNRA 2XN0A 3W7GA 1RR2A 4O0KA 5L9FA 3JRKA 5D30A 3EWWA 1R30A 3L5MA 1LOQA 3W1XA 4LW7A 2J27A 4HNTA 1OK6A 1UB3A 4JGDA 3P62A 3GAKA 2O7SA 1WYIA 3MP4A 3GXNA 4WY0B 2W79A 4ZZ9A 8TIMA 1JVNA 3O6CA 4BI5A 5K9DA 4POCA 4MOZA 2V0TA 1H5YA 1DJQA 4TMCA 3N2XA 1OYBA 4PC8A 4JYEA 1THFD 4I7VA 3WK2A 3OVQA 3V1PA 4LWWA 2J9XA 4KKXA 4FX7A 1MXSA 1A50A 4ML9A 1XUZA 4GUHA 2Z2UA 4JYDA 1KM5A 2YPIA 1GOXA 5G4EA 4QNWA 3O07A 1TPFA 4E2DA 1JRCA 2G5WA 3LHVA 2WQPA 3LHTA 4J9JA 3ATYA 3S42A 3UY7A 5HINA 3UZ5A 2Y88A 3S1UA 3EX1A 2VENA 3FFSA 3ZWTA 3UWUA 1FWSA 1EIXA 2CZ5A 2ZZ7A 3W75A 2FIQA 3F4NA 5D2TA 3DGRA 3FA5A 3C56A 3TC7A 5D05A 1P1XA 3PULA 5KZDA 1FDZA 2ABAA 1OVDA 3W6YA 1LP6A 5IBXC 3O06A 4N9DA 4FO4A 5FF3A 5LGXA 5AHEA 3PUDA 4FEZA 4CQAA 2B7OA 5AOUA 3DKLA 3W23A 5HWNA 3C3NA 1KW1A 5AB3A 2GJNA 4M5PA 1SO4A 1K3UA 2QDHA 3NG3A 2VFDA 5C55A 1OHLA 3OBKA 3L5AA 5TIMA 1DORA 4ONVA 3UD6A 1X8FA 3TSDA 3LV5A 1C9DA 2YFOA 3W7HA 2QKFA 4MLJA 3ABQA 1M6JA 5F2MA 4BF9A 4Z1BA 3EB2A 4LVFA 3HPSA 1VHNA 2QJGA 2DZPA 3W1PA 4IMCA 1GWJA 3DI0A 4UTWC 3NL6A 3C52A 4IWWA 3GR7A 2WNQA 1CW2A 3MWAA 1H61A 5FF4A 2VFFA 3NGJA 3STCA 1WOAA 1GG0A 1LBMA 3DFTA 4OE7A 4JY9A 2CLMA 1TPH1 2DJXA 3KRUA 1XFBA 5AHNA 3KAOA 3L2IA 4M6PA 4OGZA 1FXQA 4HPJA 3E9AA 3RU6A 3P5YA 2WSRA 1DOSA 5HJLA 4DPPA 4GXMA 3O15A 3GDMA 3KVMA 3B03A 3M5VA 4RJEA 3P67A 1LYXA 2RH9A 2OT1A 1ZAJA 2OCZA 4N6FA 3I6RA 4N4PA 1KBIA 4O17A 3STEA 3W1LA 3DBPA 3HB9A 3P84A 3LLFA 3EXRA 1KTNA 4PODA 2BWGA 1W54A 3SGZA 3BW3A 5HUPA 5FEWA 3GXTA 2J9YA 3B06A 3UPBA 2CLOA 1FWNA 1VZWA 1GQNA 1SFJA 1Y0EA 3ANYA 3NZ1A 1JQVA 1EPXA 1SZFA 1AK5A 3NM3A 3CPRA 1GTHA 3QM3A 5K4XA 1KFKA 4TU1A 4Z1AA 2FPVA 2YYUA 1L6SA 3EWZA 2QCFA 4LUJA 3PSVA 4AAJA 3WJSA 3QPZA 1HO4A 2V9DA 3LXCA 3W7JA 1O5KA 3SW6A 4CCCA 2JKPA 3TH6A 3ZS4A 4Q4KA 4FB7A 2LLEA 3WJYA 4DO6A 4K7YA 5HR6A 2ZRZA 3PG8A 1TPVA 3BW4A 2YYTA 4FXRA 1B9BA 4O1DA 4IUOA 4MKNA 1XUUA 5DCBA 4GJ1A 4DEFA 3W87A 1PS9A 4OHQA 1N55A 4OWGA 4P2VA 5F1UA 3SSJA 1W5PA 2QR6A 2YDAA 5J5RA 4O14A 2WNZA 1ME7A 3LBCA 1JQXA 5C54A 2CLLA 4Y6GA 3OEXA 5C5YA 1BKSA 3P82A 4ZQMA 4IX2A 3OVRA 3MMTA 5I3JA 3A21A 3FKRA 1ME8A 1LOSA 3MYPA 2VKZG 2FB3A 1DKWA 1T96A 4O11A 3UQNA 5D03A 4AF0B 3G0XA 5BNKA 2C18A 5I3GA 4WY0A 4I7WA 2ZRXA 3RLUA 3R2GA 3TXZA 2NLIA 1O4UA 4ZQPA 4IOTA 4E38A 3LXAA 3S0CA 4QSHA 3LRMA 2OT0A 1TREA 3TC6A 3SY5A 3N19B 3A22A 3BO9A 3NO5A 1OFEA 1HUVA 1SO3A 2VFGA 4YMZA 1K7EA 3B0VC 3NPUA 4GUJA 4LS0A 3PAJA 1QOPA 5DELA 1SU5A 1ZHAA 4ADSA 3ZFHA 3VI2A 1OX6A 1LRQA 1YXDA 2OX1A 1H7RA 1P4CA 3EX4A 4DF0A 3RNDA 4K8EA 1CX9A 2A7RA 2R14A 3HG5A 1IXNA 2IQTA 3L9CA 5A8GA 2ZQ0A 1W5OA 4P61A 3TQVA 4XBSA 1LORA 2DU2A 4UMAA 2JGQA 3LGEA 1B57A 3W2JA 2ISWA 2Q3OA 4O19A 2JBMA 4HKPA 2HMCA 5G2IA 3DAQA 7TIMA 3VE7A 4FXSA 4MUZA 3KVLA 2ZCGA 3TJLA 5DBUA 3MP3A 3B0UX 4K7VA 3DFOA 1JJKA 1XL9A 3CT7A 3FLUA 1SFLA 3GDTA 3TSBA 1ML1A 2DZVA 2NUYA 2NXGA 3NPXA 4Z08A 3QJAA 2DZWA 5D09A 4AWTA 3M5XA 2Y63A 1OABA 3Q94A 3N9RA 3A5FA 2QCEA 2H90A
chains in the Genus database with same CATH superfamily
2X1TA 1O1ZA 1YLVA 3BC9A 3M4HA 3O0KA 2Q01A 3PM6A 3SM0A 2QUTA 2XVLA 3BQ6A 1DWHM 1GUVA 1E6ZA 3RILA 4AXNA 2PGRA 5CBBA 1IEWA 3H4XA 4J3SA 5BROA 3M0ZA 1BXNA 1B30A 1QU4A 4NZ5A 2PD9A 1P48A 4CCDA 2Q8XA 1TUFA 3VGGA 2XH7A 2Y89A 5ECVA 3REQA 2XINA 5TBOA 4CQ8A 2DEPA 3LMYA 3W1MA 3SAZA 4A3QA 3WSUA 4HMEA 4ACYA 1XBVA 3DYPA 1UMYA 5EYWA 3RLVA 2WYSA 2Q09A 3LPGA 4GX9A 3O9NA 4V27A 4F9DA 4ZL1A 2QT3A 3W27A 1XLLA 5DMLA 2J7BA 3KWSA 4WKHA 3NCOA 2BOEX 3WO8A 2H8XA 4LC6A 1OIMA 3MSRA 1J12A 1DXEA 3VNZA 4ATWA 3H26A 3PZ9A 3GB6A 3SJNA 3ARRA 4NAFA 2CC0A 1IZKA 4IIDA 4B5TA 1ODZA 4S3BA 1TWSA 2R82A 3DEQA 1NDYA 4NNCA 3CL8A 2HNHA 2WVVA 3UXDA 5LKYA 3PZUA 2VGIA 1GZGA 4LVDA 3WIJA 2PDXA 3DG6A 1K9DA 2VEMA 4PTNA 5KETA 3LV6A 1UUMA 3C0JA 1OC6A 4E8DA 2XTKA 4MPQA 3UVIA 4DZHA 4OQVA 5MKGA 4LPCA 3WQPA 1XBZA 3TP4A 3S47A 1J5TA 4DJEA 1SO6A 5A6BD 5F2IA 3BLEA 1A53A 3NNTA 3SCOA 3G1SA 1UMLA 3IPWA 3UCDA 3WBXA 3KVKA 1A0DA 2DFAA 1SGJA 4GJIA 4F40A 1KXTA 4D72A 1YXCA 3H53A 5HANA 4A21A 3URBA 3CMJA 3MKKA 4KH2A 1BWKA 3NZRA 1PVNA 3GR8A 1QI3A 1XLDA 3WLOA 1JYNA 4IZGA 4GY7A 4AD0A 1JD9A 1CENA 3TOPA 1O5RA 2BXZA 3RFAA 4AF0A 2J66A 3QPEA 4UFJA 4J1OA 2R1LA 3T4WA 1W1TA 2G95A 3GW0A 4WJEA 3IGUA 4PFMA 3WLNA 3N9KA 2CZVA 4QR6A 3W2LA 1A0CA 2F6UA 3R13A 1XINA 1FWRA 1TR1A 4WF7A 2JF6A 1LBLA 1M7PA 4GRSA 1T8XA 5EMUA 1ZBCA 2ACUA 2MUCA 4KFNA 4H3DA 3IJ9A 3ENLA 3BXWA 3GUGA 4WJ8A 5A8MA 3VX0A 1GEHA 3IGXA 4I8YA 2WO5A 4HBKA 4QLLA 2VX5A 1Z89A 3AS1A 3VKBA 4AY8A 3O16A 1S2VA 3BMWA 2ICSA 2FDMA 5T26A 4JL1A 5KZMA 3LHWA 1KCZA 4RV8A 4HPHA 3DC8A 1CGTA 1ZALA 6TIMA 1HX0A 3QW4B 4WD0A 2FHCA 1FHVA 1RD6A 1TPUA 4FLSA 4HA3A 3NEVA 2YCLA 2DQXA 3P2VA 3MHGA 3PF3A 4FR6A 4DO7A 2HROA 3O1NA 2ZTKA 2P76A 2PI6A 4L6HA 3AHVA 4NP7A 1T8QA 4K38A 4BFAA 3E5BA 1H50A 1NF7A 3D47A 3GXFA 3N73A 3CZGA 5FI8A 4Q8TA 4IL0A 5I77A 4PUJA 1KV8A 3FX4A 4JQAA 4E4UA 2XG9A 3BW2A 4GIEA 4PCPA 3M07A 2VUYA 4DYJA 4AIOA 4MB1A 2Y7EA 3E0FA 3GSMA 4JAWA 1O66A 1A49A 4KPLA 4JKKA 1TV8A 2EQDA 5FD0A 1L8NA 3GC5A 3TU9A 1OM0A 3NZQA 4S3DA 1PWMA 3AYSA 3WLLA 3O7UA 2IXUA 1XCXA 3VTRA 1BXBA 2P0IA 4D8LA 3P80A 3KX6A 2VVNA 3W7CA 2V68A 2DDXA 4R5EA 2WOQA 1IR2A 3WQFA 1Y5VA 3EWYA 2V3EA 4XZWA 1KCXA 3HQNA 3LCLA 3EBVA 1MEWA 4Y8EA 6TAAA 1VCFA 3AXIA 3F1QA 5I0DA 3LPFA 3GDKA 1AODA 3PR2A 3P0WA 3ZVHB 4CD6A 1EEPA 2GJPA 1FXPA 3ZO9A 5GVJA 4ZQRA 3FJNA 2CXEA 1M1BA 2CHRA 4DX3A 1IIHA 4ZTXA 1HKKA 2G3MA 5U7SA 5F2LA 3T78A 4AZCA 3AJ7A 4X9YA 2QDGA 4S3FA 1J93A 3DYMA 2GQ9A 4MY9A 1R5YA 2HJPA 4AHPA 4PTXA 1CI1A 1XRSA 2QV4A 3AC0A 2VC6A 4IISA 1KRAC 1JUBA 1W31A 3H6OA 3KTCA 3TJIA 1EEXA 4UOJA 4M6QA 1MMFA 4U5KA 1E71M 1X98A 3B97A 3E96A 3UERA 1WDSA 2Y61A 2DZSA 2RFGA 4JFUA 4IMAA 1CGVA 3IV3A 4E4PA 4PMVA 2GDQA 1W5MA 4W7VA 3NGFA 2Y5EA 5G1YA 1VBJA 3BQ5A 2A2IA 4HNVA 1KR0A 3OQ8A 2C14A 4LV9A 4UQBA 4C7FA 4GH3A 2Z1SA 3KRBA 4ZOBA 5I07A 4PMUA 3FIGA 3L0NA 3S3GA 2PFHA 2DIKA 4H41A 1B3OA 4JDYA 4YIWA 3ARQA 3IVSA 1I4NA 1OCBA 3DYOA 5CZ0A 2HE5A 2FFCA 4CNPA 4FAMA 1K9TA 5GPRA 5H1WA 2REQA 2GSJA 2Q02A 3DH7A 1IXQA 4GCXA 5CKSA 2DUZA 3PS7A 1GQJA 4IHCA 2FFIA 1V0KA 4FLOA 3I7SA 5ABFA 2V5DA 1DJWA 1QPKA 4JIRA 3AS2A 2BASA 2WZHA 2GVYA 3LG3A 5KTLA 3QH2A 4JICA 4JQ4A 3MCMA 4K6AA 3GWQA 3RDKA 4QE5A 2WKJA 2BP1A 4QE4A 4WIWA 5DQPA 1DJZA 3N6JA 4KW2A 1BF6A 3HN3A 3LTYA 4F2TA 5EPDA 4Z2HA 4R34A 4GIAA 2X0YA 4LUSB 1XDMA 1QPNA 3G1XA 1TA3A 3PNZA 4M7SA 3VZYA 2GPTA 4KESA 3AIEA 1PDZA 3LS9A 5CBIA 4N2YA 1FH8A 2DSWA 5I02A 3URQA 4W8AA 2WPBA 3PFMA 1Q4WA 3L4WA 2G4JA 1ZCCA 3S5SA 4Y8FA 3VKDA 3E38A 2NXHA 3I7QA 3TQKA 3AMCA 1UC4A 4XKYB 4XD4A 1LRNA 1HKWA 4HNOA 3JVAA 3B8WA 1EO5A 1JDCA 3TUUA 5LNSA 1NF0A 4UB9A 5I09A 2QJMA 1WZKA 2E9MA 3MUIA 4XAGA 3P74A 2PURA 3VOIA 5D2XA 3RG6A 4NJGA 3OGSA 1D3CA 1WBHA 3Q4DA 4DVOA 1L6WA 4RPPA 4JIHA 4FZIA 4JX4A 1G5AA 1TJ0A 1UWUA 4EAMA 4C7GA 5AVHA 2OODA 2JF7A 1F74A 3BURA 2BSLA 4AVOA 4C6LA 3KL3A 3NPVA 1LWHA 1TPWA 4IQEA 2BHYA 4QAIA 3QN3A 1QPQA 4LAUA 2JEPA 3T2OA 3OYZA 3RM4A 3ERPA 3AIWA 3AQUA 1W9VA 2V3DA 4M3PA 3TYDA 3UCQA 3BSHA 2PDIA 3WH9A 4R7OA 4KWSA 3SGUA 6ALDA 3PY2A 3H54A 3HF3A 1WB0A 1V0LA 1J01A 1A3XA 4Z0SA 4NKCA 4D6CA 1FBAA 2QZRA 1S2AA 1TR9A 4NZJA 2INEA 5I24A 3S1WA 1PPIA 4YL2A 5A6KA 4MAVA 1UH2A 1Z8AA 1ONXA 1DIEA 1DJGA 4QDPA 2WVSA 4J2PA 1HJQA 3W7OA 4AC7C 1P0NA 4WOZA 2X09A 3QQ0A 3SR7A 1CB7B 3SQSA 1JR1A 1MXDA 1W5NA 4HPNA 1O60A 4JFWA 1AW1A 1TV7A 1WA3A 1EOKA 5IBXA 2D2JA 3KEHA 2PP3A 1G69A 4MWAD 1DJNA 3WQGA 1BWVA 1OFAA 4QEEA 1ONRA 2J7EA 3V4BA 4DBSA 1BWLA 3STFA 4R9OA 4L7ZA 1G94A 2IPGA 3OIHA 2E8ZA 4C6DA 4LALA 2OELA 1F76A 4JR5A 4MG4A 1YXYA 3IARA 4MYXA 4A3HA 1O95A 1GYLA 4HJFA 3E2VA 1QWKA 1SJBA 2X41A 3P8JA 3PJWA 3UA4A 3S5OA 3UWVA 3TC3A 1YNYA 3VABA 1K4GA 4NNAA 2OWXA 1PCWA 3QGAC 5E9XA 3OQEA 1ZTVA 5K3VA 1QAPA 1GORA 1PIIA 4OUIA 1IR1A 2DVXA 3SCVA 4HGXA 2J78A 2QCDB 2Q6ZA 1BYDA 1US2A 3W85A 4Z1YA 1NWSA 3VIFA 1DWAM 2XIQA 1TVPA 1E6XM 3G1VA 3GNNA 3PPCA 2YB4A 4M8UA 3BLIA 3L0GA 3K2GA 5I00A 1FTXA 4HK5A 1HL8A 1R7OA 1XYMA 3UZJA 1HP4A 2POZA 4C6CA 5AC5A 4Q22A 1FCBA 1GK8A 3TMLA 3F4WA 3UWYA 3BAXA 4GNKB 1ADSA 1W5QA 3H8AA 3OJGA 3N4AA 2DORA 3FVMA 4GFSA 2ZXAA 3GDRA 3BAIA 3HGSA 3WLRA 1V6YA 2CZFA 1H51A 3BOFA 3ZOAA 2AQOA 1S5WA 3QLLA 3GNRA 3E02A 3SUWA 3U57A 1O68A 4MUPA 4GFIA 3AZSA 1EIBA 4GISA 4HN4A 3IWPA 1I2RA 4ZB5A 1VPYA 2P10A 2WAGA 1VLIA 2HVMA 1W37A 3KHJA 4KBXA 4J3UA 4UZUA 3PHAA 2QJIA 4JKLA 1B2YA 3DG3A 4S1FA 4DWSC 3IIPA 4HN8A 5A6MA 3EXSA 2YCIX 3H23A 3QFEA 1SMDA 5HATA 1KGUA 3FOKA 3K8MA 4B2DA 4ZFMA 1TO3A 4U33A 1V8EA 2X2GA 2AMXA 4WSKA 5EFDA 4O8AA 2XVPA 1SO5A 4BQ5A 2X1UA 4JL2A 1VRDA 2AAMA 3U2ZA 3B4UA 1JFHA 2JEQA 2VYOA 5XIMA 4WK9A 5C0QA 4S3GA 2XSBA 1I2QA 2VDHA 1U83A 1YPFA 5C2GA 4U10A 5BXPA 3GVRA 3G0UA 2HEJA 2QIWA 1BLIA 3P61A 5JVLA 1GNXA 3NVDA 1OBAA 5D2VA 3L4YA 4UQEA 4I9AA 4I5XA 4GVFA 4GXPA 1JULA 4UTIA 4X63A 3M0IA 2Q8LA 1OX4A 3ID7A 4Y9NA 4PCNA 4DXXA 5A6AA 3T2QA 1CLKA 3M9YA 4V15A 1ISVA 1GVQA 3FNDA 3WLJA 1F7BA 3AALA 3FXGA 1J79A 2NVAA 3QC3A 4YTQA 5E0KA 3GNOA 1NFBA 1W1A1 5FJPA 3REQB 3OA3A 5LXEA 2BGSA 4Q7BA 1QOXA 4MM1A 3BOXA 3C2VA 4F0RA 3UG5A 5FEZA 2DVUA 2QPSA 1XXXA 3TW6A 1XBXA 4PMZA 3VDCA 2P0OA 4C1KA 4MNLA 1XLCA 1NVMA 4FNRA 4H6RA 5GNXA 3AYTA 2FTYA 4AZ6A 1ZP3A 4NIRA 4IP4A 4DUXA 1Z3NA 2E6DA 4M56A 1FKWA 4HSNA 4EXBA 3NWRA 4A8RA 1UWRA 1K9FA 3M6YA 3GW3A 1WNOA 2OX4A 1HTIA 2YX0A 1SW0A 2B7PA 2P53A 5JH2A 1F3EA 3DC0A 1TV5A 1BTCA 1XIBA 4MJ4A 2TPSA 1R3TA 3SEPA 4GUIA 1R8LA 5J5DA 5D02A 3N17A 5CBJA 1VPQA 2WKLA 4MJZA 3R89A 1E1FA 1T99A 4W93A 2GVLA 2BGQA 2VZTA 3NJ3A 4OBTA 2GGHA 1CDGA 2HBVA 1J96A 1TMHA 4GI9A 4S23A 1W9UA 2CCRA 4KCTA 3CYVA 5U4NA 1NJJA 3MZ2A 1TPDA 3CGTA 5DO8A 2ZUNA 2VD8A 4B5SA 1XV8A 3H7VA 4H6QA 3G3DA 5A6JA 2PLJA 5I79A 2C16A 3GQYA 2NQZA 3GDBA 3AMLA 4XO6A 4TX6A 3ABSA 1CGUA 3SCWA 2Y7FA 3W22A 1F5ZA 2R24A 3H2NA 1DJHA 2VFIA 3MW7A 3U9IA 5GQBA 4B3ZA 2PRHA 3UZXA 3HFYA 3GU2A 4IJCA 3KL5A 3LQLA 3URAA 3VUSA 3L5LA 2ZZ5A 1QR7A 4JN8A 3HPXA 3U5YA 1FX6A 4QSFA 5AY7A 3C2YA 4AX6A 1MO0A 4DZAA 2UV8G 3MU7A 4S3JA 5CC5A 3DKJA 2FHFA 4Q6JA 3SZ8A 4V1YA 3L66A 4BI7A 1YE4A 1CXFA 4FNTA 1XD0A 2E77A 3FHAA 1Q6GA 3WELA 1BKHA 1ISYA 5LNWA 3W7EA 1K03A 3CHEA 1TVNA 1AQHA 2C91A 2ZDRA 3UJ2A 3MDWA 2HNEA 4LY4A 3MHUA 4PZVA 4WX2A 1OIFA 2Z1BA 1YMYA 2GDVA 3BDKA 3II1A 1YNQA 1UD8A 3NL2A 1UZDA 4NG3A 1U5VA 3QVQA 4A2RA 1DWGM 3NDZA 5EA9A 3IAPA 3PC0A 4LAOA 5GNZA 1MW1A 1KXHA 4JDBA 3EEGA 4R7JA 3W88A 1S5NA 3V0SA 3DZ1A 2VGGA 3LTSA 1KM3A 1AMKA 2Y8VA 1WUEA 2NWSA 4JTTA 1OINA 4WDTA 3KOWA 4B5WA 4AVNA 3ICJA 4ERIA 4ADUA 2GJLA 2PD5A 2GK1A 4PUMA 5E0FA 3L68A 1RJPA 1UKOA 3RJYA 2QYGA 4CKQA 4XBJA 5BRQA 3QV6A 4JX6A 1RHCA 4RXFA 3OW1A 3AHTA 3W1RA 1TWWA 3ZWSA 4Q8UA 3JZEA 2F8QA 1HVXA 2CIPA 2JGYA 1WBJA 5M17A 1LDCA 1C91A 3DI1A 2BOFX 3B8UA 2Z24A 1PZ0A 2CPUA 2OEMA 3UY8A 1AW2A 1J0ZA 3EA3A 3XISA 3B9NA 3S83A 3A4XA 4RR4A 5CPOA 3OZOA 1VFSA 4OV9A 1EA9C 2GVJA 3PTMA 1IIGA 2IQ0A 2HTMA 2YGYA 3CO8A 3EDFA 4NUWA 3U6WA 1X6LA 3GVGA 4ZB2A 2VGFA 3GKAA 3PTKA 3UNTA 1UCWA 3ES7A 4XV0A 2QJNA 6A3HA 3HU7A 1ODUA 1WDRA 5A2AA 2WK2A 3MY9A 1A0EA 4KIEA 7REQA 3TIMA 3MS8A 4JFVA 4IQJA 1E1CA 4US5D 4DWSA 1A5BA 1XDJA 2QJHA 3K46A 4YNGA 1W56A 2VL4A 3RPTA 1KQZA 3KM8A 2A3AA 3WNOA 1QNOA 3WH6A 2RKXA 3B8DA 2ON3A 4YXGA 1RK5A 3SRKA 3MZNA 4LF1A 3HQ1A 3W9ZA 4GI6A 1KFWA 4ICNA 2NUWA 2FGZA 1SFTA 3Q67A 4YN5A 2I5QA 1EHNA 1J6OA 1FWIC 3WJWA 3AWNA 3BVJA 5JXQA 1P6CA 3F4DA 3WZ0E 3F5KA 2CLEA 3HMJG 1X8CA 3GG0A 4LRSA 4B4FA 5AFDA 2CBIA 4HMCA 4JD4A 1A5CA 1Z44A 3R58A 2V6AA 1LLZA 1E4MM 3N3MA 4H4IA 2X40A 4N9BA 4AG0A 2WXDM 5FL1A 5F4XA 2W66A 2ATSA 3UU0A 4O1FA 1Q6FA 4XAPA 4LT9A 4NJHA 5E6ZA 3BSGA 1DWFM 2L5HA 3C4UA 1V7AA 3SUUA 4F0MA 3R4IA 2BBFA 4A35A 7A3HA 4S2BA 1GPFA 1AZ1A 1LWJA 3L5MA 2VDIA 3WQWA 4IGMA 3W1XA 1JCTA 1M04A 1CIUA 5LA0A 3QHOA 1UB3A 3B0XA 3GAKA 4IL2A 3V5FA 1XLEA 1K6WA 3DCPA 9XIAA 2CERA 3Q65A 3O6CA 2VZUA 2IW0A 3N6HA 2V0TA 1DJQA 1JPIA 3N2XA 4H7ZA 3VGDA 1Q4NX 2WANA 1EGVA 3BLDA 4TUFA 1R3VA 4C6JA 3V1PA 3OODA 4KKXA 1A50A 2Z2UA 2FVMA 4PR4A 4QNWA 3O07A 4AEFA 1JRCA 3L4UA 2PTWA 1XLJA 1FFRA 1AUSL 2GSHA 2WQPA 4J3WA 4URIA 4LYRA 3NTYA 5HINA 3UZ5A 2Y88A 2VENA 3ABZA 2AKZA 3V1HA 3QV7A 3WY1A 2CZ5A 2BG5A 2FIQA 2Y4SA 4JIEA 3DGRA 3WQEA 4D6IA 3LSCA 3TC7A 5KZDA 2ABAA 4LJ3A 2DUAA 5FF3A 5AHEA 4K2SA 1PB0A 4RDYA 3O3RA 3W23A 3B9OA 3C3NA 5AB3A 2GJNA 4M5PA 1SO4A 1WPCA 3SRHA 8XIAA 3L5AA 4Z2IA 2GJXA 4ZO6A 3KE0A 3ZLGA 3TSDA 3W7HA 4MLJA 4QGCA 1RCOB 1M6JA 1JDAA 2RAGA 3MKVA 1V0MA 3VNKA 3M46A 4PMDA 1VHNA 4AYGA 1EGMA 1SVDA 3IK2A 5D9PA 1O6IA 4UTWC 3C52A 5TAOA 1NU5A 2WNQA 2WMIA 3E3HA 2EPLX 1H5VA 4M29A 1LBMA 4OE7A 1TPH1 5J8LA 4UOZA 3KRUA 1HW6A 3VAVA 3FJ4A 1XFBA 3N4EA 4DM1A 2NQ9A 2TAAA 2W5FA 4L56A 4M6PA 4HPJA 3P5YA 5LIUX 4HK6A 1YW1A 1REQA 1C3FA 3QZAA 2OT1A 3GHSA 1ZAJA 2OCZA 3H7RA 5HOSA 3I6RA 3C0QA 4N4PA 1K77A 3DBPA 4CD4A 4GQQA 2VCCA 1VEOA 3TCSA 3NFUA 1RJRA 4CQBA 4D6JA 3SGZA 4MNJA 2DZAA 3QKEA 3AOFA 3L2MA 2YL6A 4CD7A 5AVNA 2QF8A 3NZ1A 1AK5A 3NM3A 4PUEA 4H00A 5HNTA 1H2JA 2CKSA 2OG9A 3EWZA 1UZ1A 4AAJA 5HA7A 3WJSA 3QOMA 2V9DA 3LXCA 4IPLA 1Q6DA 3SW6A 1J0KA 1DWJM 3TH6A 5KZ6A 3ZS4A 4Q4KA 1M03A 2NVCA 1RA5A 5CAKA 2R1PA 1TE1A 1ESWA 1J18A 2VR4A 4Q7NA 5HR6A 4UZSA 3GVVA 1B9BA 3WMSA 2WLYA 5DCBA 2XVNA 2ZVRA 4DEFA 4Z2LA 1PS9A 2J7FA 4OHQA 4PTWA 1YNPA 3SSJA 3MVTA 1W5PA 4EE9A 2WNZA 1DE5A 1NELA 5FA5A 3GUWA 4ZQMA 1ISWA 5I3JA 3TTEA 2HRWA 1UH4A 1LOSA 1MQQA 2FB3A 4O11A 4E2OA 2C18A 5I3GA 2R9RA 2DSKA 3KDOA 1BAGA 4WY0A 1VFHA 2NQ5A 3RLUA 3LXAA 3S0CA 3AHYA 3SY5A 1TFVA 3WQ8A 3E1F1 1OFEA 1JG9A 1SJCA 1UQYA 4L6OA 4YMZA 4YWSA 1E56A 1GKRA 4LS0A 1YBQA 1J8VA 5DELA 4FR1A 5CAHA 4ADSA 3VI2A 1OX6A 2FH8A 3R43A 4I5UA 4C1NB 1GZ1A 3L2LA 1PTGA 5G4HC 1CX9A 2R14A 4XBSA 1UJQA 4H19A 4DJED 2DU2A 2HK1A 1E55A 3LGEA 4DYKA 5A6LA 2Q3OA 3GG1A 2FZBA 3U0HA 3ALFA 2C1GA 4FXSA 4BCEA 3WEMA 5HJYA 4GVGA 4L1XA 4HZ8A 3WMBA 3RM8A 2BY1A 1SFLA 3GDTA 1UKPA 4H8UA 2Y24A 1NFGA 2NUYA 3SUSA 1PKNA 1QNRA 5D09A 1PDYA 4AWTA 3B8SA 1OABA 2YCJA 1EDQA 2XYLA 3VDAA 3Q94A 3NURA 5IFPA 2H90A 1OFQA 3L0KA 3MWCA 2YW3A 5AC7A 3OIXA 3UWWA 1PKMA 5T9CE 2NQJA 2Z1WA 1G7VA 2WVTA 2QCLA 5F4SA 4D2JA 1ECEA 5L6UA 2E6FA 1VFMA 5JU6A 3LRKA 3ECQA 1F2JA 1YDOA 2VZVA 1EKOA 4Y96A 3HMCA 4UTTC 1R0MA 2J7CA 3NVTA 4ENLA 4FHAA 3KTSA 3KTXA 3W1UA 1DE6A 4O13A 1T7LA 1MEHA 4IF2A 2O55A 3QTGA 1C7SA 4Y2WA 5IXEA 3W83A 2X7VA 4KEVA 4J28A 1V6UA 2CHNA 2XDFA 1K8YA 1EYWA 3LRLA 4YCOA 1IWBA 3WNKA 4XVEA 3W81A 4XG1A 1IXPA 1EJTC 4IMEA 4QAWA 3VKKA 4EF9A 4PUDA 2GGGA 2Z4GA 3UZZA 4LAKA 4PTMA 4HZ7A 5F7UA 4JBRA 3D6NA 1SW7A 3W00A 3CUHA 4GWEA 4DLMA 4MJMA 1KCKA 5DMYA 1CXLA 3NQDA 4AZIA 1QJWA 1X1ZA 1ZLPA 1OCQA 3W86A 3VIHA 1I2OA 3FKKA 5C9WA 3DOPA 3M5YA 3A9BA 1LM1A 3IK4A 1U1JA 3VM7A 2A3BA 4HPXA 2ZKMX 4AC1X 1SZGA 1A5AA 1B54A 3E12A 4RZ4A 3TCEA 1FDJA 1ZPTA 4GHRA 2I57A 3RCNA 5CCZA 3KOFA 3M16A 4QFUA 3VA8A 3A12A 1P5BA 2GZXA 3AIQA 4HQVA 2WV8A 1DL3A 4F0HA 3QPYA 3IVTA 4ZSTA 2WJZA 4WHBA 4TX9A 5LHFA 3NIYA 1PX3A 1DV7A 4WLCA 4A3UA 4DXVA 1OZQA 4AIUA 5FCZA 3LN3A 5A94A 4BZYA 5HXMA 1H7PA 1EXPA 2YDQA 1YYAA 4HOXA 1L2QA 4RW3A 1UA7A 3GYEA 5D33A 3LCIA 2G50A 1G67A 3CUJA 2DUXA 4OT7A 1C8VA 1D3HA 2G3NA 2IMRA 2E28A 3W2MA 1IGSA 1Z7AA 3QSTA 4NYYA 2GWNA 4QP0A 3E0IA 6ENLA 4KETA 1B4EA 4Q8NA 3IUHA 3M0VA 1JPDX 4MY8A 1OX5A 4HHHA 5FOOA 5K7JA 3H2CA 4Q7IA 4A29A 2H9AB 3ZM8A 1LG1A 2G37A 5DFAA 1D7KA 1JNDA 3UEQA 2FDSA 2Z6JA 4PMNA 4M19A 1H49A 3C2RA 3JW7A 3DFSA 1POJA 4HYVA 3UXAA 3MPGA 4JHOA 2HV5A 3T0AA 5BW6A 1EP2A 1TSIA 2D3LA 3GG8A 1M01A 3GTFA 2AGTA 3G3MA 3NQEA 4EWND 4G7FA 2UZ9A 4GYPA 3MTWA 4BJHA 4GK8A 1R2RA 3TYUA 2BX7A 2WSPA 1BG4A 1EBGA 5IDIA 1XHGA 3NQ7A 3BG5A 1UG6A 2FH6A 1V02A 2GQAA 3U2EA 2INZA 1Y8BA 3VCNA 4QG9A 1ZJBA 2YJQA 3N6QA 3AS3A 4AD4A 1UPMB 2OLHA 4DUWA 1ITQA 2NWRA 3TSMA 3PB0A 2CFFA 3ZT6A 3PZQA 1R3QA 4GABA 3TWAA 2C13A 3CUGA 3H4WA 3A23A 3VCRA 3LUTA 3UFYA 3MANA 4IGHA 2A6NA 3W84A 2VEGA 2Q3RA 2E5BA 2Z00A 5KSWA 4MZ8A 5M03A 4MB4A 2PTZA 2ZX9A 1MVYA 4IIEA 4RX0A 3SB0A 4DNMA 4C60A 1WDDA 4L6DA 4LCQA 1MFUA 3WDQA 4EF8A 3EX2A 4NZ4A 1EA0A 3N9SA 1TPEA 1GW1A 1PL9A 1KKRA 4JCLA 3W7MA 4K8GA 3TROA 1UWQA 1E72M 3I4EA 2C6QA 8RUCA 4MZYA 1ITUA 3QKZA 2XM2A 2BMBA 3DFYA 1VYPX 4A8IA 1QK0A 2YLAA 1FY6A 3VINA 3CZJA 4FF7A 1SPQA 1EUNA 4GI8A 2DSVA 5CZSA 3KBJA 1SM9A 3MO7A 4PB5A 1UD5A 4HYRA 1QHOA 5XINA 2X16A 3WBWA 2XM1A 3SRFA 5D32A 4S3AA 6XIMA 3GIQA 1NIUA 2WSQA 1JCJA 1WV2A 1B1YA 4C6KA 3AU2A 2J7GA 4J3VA 1DBTA 1VEMA 4QTGA 3J7HA 2GQ8A 1LBFA 3S5YA 3S2MA 3VNDA 3KCJA 2DT2A 4AW7A 1X7IA 3NM1A 1VP5A 1J9YA 3VOFA 3TJ4A 5HQEA 1EGZA 5CPMA 5CJMA 1QT1A 2Z2BA 3BLFA 2MNRA 2WLZA 1WQ5A 4W5ZA 3A5VA 4HNUA 4QM1A 2I14A 2H8ZA 2DVTA 4O57A 4JY8A 1VPXA 4XZ9A 2VC5A 2RHGA 2DT0A 1PKYA 4MLRA 5CSSA 5D37A 1XIMA 1OB0A 3OPSA 1F8IA 1JCYA 3O2LA 1YE6A 3KLLA 1UOZA 1PZ3A 1DYSA 3FA3A 4HA0A 3CQ0A 1MUMA 4XISA 2AGKA 4HU3A 4KFPA 5A8PA 3OG3A 1R46A 4K3ZA 4UTTA 1W17A 2OWCA 2ALDA 3DBNA 2E7FA 2OMAA 4S3EA 3GH4A 3BLLA 2ZZ3A 2E6AA 4XB3A 1MXGA 3O8AA 1XYZA 4JNYA 5A6SA 3VMOA 3UZWA 3KOXA 5AKQA 2WM0A 3VIIA 3GD6A 3NXFA 4B92A 2ZBTA 2BNJA 3W7KA 3QMRA 3WX7A 4HNLA 3C0SA 5ECUA 1VCVA 2P5NA 4X60A 4CU8A 4M24A 3LK6A 2WSYA 1Z6KA 4L9ZA 1TE6A 3NDYA 1DTNA 1DQXA 5G4WA 1FHUA 5LZLA 2PSNA 4CNNA 5JBEA 1NEYA 3R8HA 4Z2KA 3KRZA 3P14A 1OG0A 3N13A 4PUNA 4QX4A 3NYDA 1NY1A 1JPKA 3NQGA 1FH9A 1VIWA 3MUCA 3T07A 4U2ZA 3IJLA 2VC7A 3CJPA 2V5CA 4QISA 3RO8A 1ZU8A 1I45A 4UXDA 3CZLA 2TYSA 3EKLA 3DHDA 4OKDA 5A2BA 2FGLA 3ZSTA 3W72A 5I06A 3A64A 4EPKA 3THAA 1JDDA 3M0XA 1JCMP 2OYMA 2CBUA 2OTDA 5FJRA 3KFTA 2V38A 1U33A 3L67A 3WFZA 4AY7A 2J79A 4O4VA 1QNPA 4TVUA 1KB3A 4NF7A 1X1NA 1B0IA 4DY1A 4J35A 1Q66A 2C19A 3V0TA 4D71A 4LRTA 3DFQA 1QOQA 3ZMRA 1ZQ5A 3V36A 5CC6A 2PWHA 2DIJA 1G7UA 1JPMA 5H8UA 2PLCA 4GOAA 5AYIA 3CHDA 4AEOA 3M1ZA 1LT7A 2OFJA 1GOWA 3FA4A 3K4AA 4NX5A 3VX1A 2A3HA 3W7QA 1XIFA 4NRRA 2VVSA 1FA2A 1MNZA 4BQ4A 1EYEA 2E4TA 2PDPA 3BGJA 2NSXA 1PJ9A 4AH7A 3LXBA 4L4MA 2CXGA 3RR4A 4C6IA 1JRBA 1OC7A 3BOLA 2DW7A 2PGWA 2RUSA 4KWUA 3IJIA 1AJ2A 2ALRA 3ZVHA 1D9EA 4NJIA 3T6CA 3PJUA 3TJXA 4ZSUA 3L21A 3TKFA 2VCBA 1JZ8A 2IKGA 2YBTA 3DENA 1JZ3A 1P0DA 4NRSA 3EX3A 2PAJA 1V3LA 1UQZA 4GZEA 1A5KC 1NAL1 1O5QA 3RK8A 4DLFA 3KCOA 1HVQA 2MANA 3UXIA 3C0LA 1KLYA 5HDRA 1M3UA 1RZMA 1AH4A 4B2DD 4A6GA 2EAWA 4B5NA 1DJYA 3QMTA 3OZYA 1VD6A 4LF2A 1GVEA 3TV8A 4KEMA 1REQB 1R9YA 3CZ8A 3L4ZA 1BGAA 1BD0A 1H11A 3D46A 4QS6A 1UKSA 1UZ4A 3GK0A 4UTJA 4RV3A 5E5CA 4ERAA 1UBPC 2VHLA 3WD0A 5LHEA 1PEZA 1V3KA 4K1GA 4NNBA 3UGVA 3H55A 5AHIA 2Y70A 2FJUB 1YX1A 3PBWA 3W7RA 1EJRC 3PBGA 2W4XA 1Y65A 2VR2A 2F84A 4JN7A 5CG0A 2CESA 3VNIA 1OFDA 3EKZA 1GHRA 1U30A 3K1GA 4LUIA 2P88A 1LCOA 2VURA 3VZXA 3NPWA 4A3YA 1FWFC 4N9CA 1AZ2A 3B0YA 2PDLA 3QR0A 4UCGA 2DZTA 4JTSA 4LANA 1XH0A 1RH9A 3B9DA 3G6MA 1TTQA 3R8RA 1MUWA 3ONCA 2V5JA 1MQPA 1NQ6A 2BOGX 3B9AA 2EJAA 2ZDSA 3EXTA 3BE7A 5CQ1A 5D38A 1W8GA 4KCWA 1OY0A 2VMFA 4JTFA 3OGVA 4UR7A 2VRJA 3VOJA 3D0CA 3TMQA 3RITA 2PTDA 1K1DA 4KEUA 3BTNA 1J0HA 4RE2A 1UP3A 1XGDA 1JYVA 1AL7A 3BJSA 1ZAIA 3H2OA 4WEVX 3BG9A 4PB4A 3DHUA 4JQ1A 1CWYA 3LM7A 1QO5A 4LUSA 4RUBA 5H6HA 4EPDC 1BPLB 3ITYA 3KUMA 1I75A 4UFLA 3EYPA 3PWGA 2OLSA 4MMWA 3WUBA 4QJ3B 4KWVA 2PMQA 2UWFA 3LX9A 8CGTA 1XDLA 3KCLA 1TRIA 4AMAA 2Q71A 3HG2A 3S1XA 2KX9A 3TX9A 4S3KA 4G56A 1H4PA 4L4LA 3CHVA 4OOZA 1LTDA 4XKYA 5CZJA 1HG3A 2Y8KA 2GGEA 2HK0A 4LYQA 5C8BB 3DIPA 1TV4A 1WKYA 3WK1A 2J7DA 4U4MA 4G7EB 3GXDA 1UW9A 2NQHA 3F5JA 1H0IA 2J25A 2I1OA 4H9TA 3TYZA 3W7DA 1UROA 3TZNA 1KFCA 4AUBA 3S8HA 4W9TA 3CPGA 2EG6A 3PJXA 4DJEC 1SFSA 2G0WA 2QUVA 2D24A 2WNNA 2J88A 3QLDA 4LV4A 3K13A 1JUEA 1G0CA 4QIUA 3MUY1 1W2VA 4J40A 1SMAA 1KM6A 1E5JA 2YB1A 1BVZA 4UMBA 4UMCA 4KIRA 3ATZA 5BMWA 2E5CA 2FZNA 3GFZA 4C7DA 1S5TA 4PRTA 4NZ1A 4QS5A 4UCFA 2VEPA 1KGWA 2VNCA 2FJKA 1JZ2A 2PF0A 5EMYA 3UYCA 2PP0A 4ATDA 5HBFA 4I6VA 1XJBA 1I2NA 1SSGA 5C70A 3SCPA 4ROPA 1VS1A 2GUUA 1D2KA 4KS0A 1QW9A 2JIEA 3OOQA 1GGOA 3R12A 4RZ5A 3CIWA 3TVAA 5EU9A 4JTIA 4UTFA 1UH3A 3GTIA 5H8PA 2D3NA 3IV8A 1EJWC 4FX6M 4O53A 1NM9A 1V03A 3RXZA 4AU0A 2YXOA 5E9AA 3OHIA 1ZNNA 5DY2A 4FNSA 2QAFA 3M5ZA 3MJYA 1CBGA 4HVXA 2I16A 3DFNA 1XIIA 5T8GA 1V3IA 2C3ZA 3SADA 2CZDA 1YTKA 3OBEA 3XINA 2V5BA 3TYEA 4H9ZA 9CGTA 3UZYA 2XGBA 2X0SA 3R11A 5EMKA 4D9PA 4IMDA 1CNVA 5F4WA 1I9CB 1XBYA 3LCGA 1PHWA 4N9EA 4KRUA 2E8YA 1GQLA 2YXGA 1FHLA 2WPGA 3EPOA 1B5TA 2ZUMA 3KVJA 4DF2A 1UD6A 3DXIA 4IPNB 2WWCA 5I3FA 2QF7A 3A47A 3LPOA 5HUOA 1ZGDA 1Z69A 3VZZA 1K6AA 1SJAA 1TKKA 3DGBA 5H91A 1HJSA 3APYA 1V79A 5DANA 4Z0JA 1GOMA 3TEVA 1SZEA 5C7VA 2QCDA 3CEUA 2ZZ6A 4TR9A 4MJ2A 3ZJ6A 3MJMA 3QHNA 3PANA 2QGHA 3BWWA 3G1DA 1WP6A 2D73A 3W38A 3NQMA 4AFYA 4YYCA 1H7XA 1LG2A 3BCFA 5C9UA 3OP2A 3KS5A 1GVRA 1OFOA 3PK7A 2J7HA 3GBEA 1ZBWA 1PCKA 3OZMA 4G5DA 4TXEA 1R7AA 1GJPA 4JS3A 1UD4A 5FF2A 1TJ1A 1F6KA 4NT0A 4KGJA 4GKLA 4DWSD 4FOJA 5FL0A 3KDNA 4HZ6A 4EVZA 2C0AA 5A95A 1XLKA 1XSJA 4NZCA 4FLRA 4XAZA 2Y8UA 4JKMA 1R47A 1SYTA 1OJXA 3AUOA 1UR8A 3VKCA 3WBEA 3BAJA 1LROA 1HXJA 3HQPA 1J2WA 4QJ4B 4XIMA 4S2CA 3NO1A 1Q8JA 1IEXA 4RZ6A 1N82A 2OLAA 3LI1A 4WSHA 4PCFA 3HGRA 3W2NA 5LA2A 5C9RA 2NX1A 3HOJA 2FZ9A 4GI4A 4FX8A 4RXGA 3ARSA 2P50A 4Q4SA 1MRQA 1QPRA 1TVLA 2BFGA 2A85A 1S5VA 2W6RA 3P3BA 4C6NA 2X2YA 3SGGA 1W3HA 3MUAA 2YCKX 2ZZ2A 4HU0A 3W82A 3SCQA 3BH4A 4OVXA 3UXKA 1EF3A 3CMGA 3EB4A 4ZE5A 2VOMA 2YBVA 1E6NA 5AC8A 1JF6A 3ORWA 3S6DA 4LTSA 3AZRA 3TE9A 1GTEA 1V6VA 2ZUUA 4PL2A 4AD5A 3JR2A 4Q8PA 1DTUA 4G1KA 4IG2B 4B5UA 1OF6A 1JNEA 1HJUA 3CQIA 1R86A 2G4FA 4M6VA 2Z7GA 3QY7A 3AWOA 2ZRYA 2BVWA 2QAPA 2GVGA 2POTA 3IGSA 3TAKA 2ANUA 2PDWA 3S4TA 4ZODA 3RRAA 1RVKA 1OFPA 3AXXA 3NQCA 3T55A 3R5EA 1R3SA 3OYXA 3ZR6A 4AHOA 2W3ZA 4QE1A 1QI4A 3R0UA 3F2CA 2B7QA 2QCCA 3PTQA 4O4WA 2ABBA 3G77A 4MKVA 3IVUA 2YL9A 3CS2A 2WCSA 5CPSA 4AHQA 2R8WA 4J7RA 3CAKA 3CHFA 1OT1A 3WQ6A 1IEQA 2KZHA 4MFEA 6CGTA 2WBKA 2QMJA 1E3ZA 1E6QM 1SUXA 3HJZA 4PBGA 4PGLA 4CLMA 2ZICA 1VAHA 3ARTA 1OGSA 3LGDA 3AJXA 1TWZA 2WWDA 1E70M 1E9YB 4TV5A 4Z42C 5LIWX 1V51A 3CL6A 1HN1A 3CB3A 2FHBA 1BEUA 3TNOA 3WD2A 2BZNA 1L2UA 1WZAA 5A5WA 4QLKA 1TTJA 1WKEA 1VF8A 2BXYA 3FN9A 2FTPA 2WW5A 4DBDA 5F1VA 4GBUA 2NVDA 3C3UA 3R7MA 5C71A 1DIDA 1XYAA 2CETA 3LM3A 4LNCA 3W1TA 3LTPA 3NL3A 3UT0A 2AMGA 3C6CA 5BWFA 1DIOA 2JALA 1D3GA 1FWBC 1WE5A 3ZYZA 2FLIA 3S2LA 3P81A 2ZYFA 3T42A 2BTMA 2X42A 2PCEA 5LXXA 4L9XA 3V75A 3PN8A 2VX7A 2VP8A 2ZZ1A 4KQNA 4PL1A 2EBNA 4JPGA 3CLWA 4UFHA 4GGBA 5BOEA 4NYUA 2AQWA 2YKKA 3W1QA 1SJDA 3WLMA 4ZOAA 2WMJA 3PZOA 4K37A 3BJTA 1QUMA 1GYNA 4HHPA 3T0BA 3MDUA 4W5UA 4I8DA 3WCZA 1XS2A 2V81A 3IS4A 4FPSA 1Q6OA 1Y5WA 4F8XA 2ZC8A 3GZAA 4WSJA 1VYRA 5LNRA 2XN0A 4FS9A 2WMFA 2FMOA 4O0KA 3JZUA 3JRKA 4GY1A 3H22A 1R30A 1O1HA 4XD3A 1P1MA 4J4KA 4C6OA 4LW7A 3M0MA 4PUWA 4JGDA 5CLTA 1IE7C 3IAQA 2O7SA 4PUKA 4F79A 1WYIA 2XZ7A 3ZLHA 1S1PA 4ZZ9A 2VI0A 1CTNA 3AXMA 3T0TA 3SN0A 5K9DA 4POCA 4MKSA 1J0JA 4MOZA 3V7PA 1HF6A 1OYBA 5EMLA 1TWIA 3UJEA 2D2HA 1H1NA 2VX6A 5FSDC 1CEOA 4LWWA 3R1ZA 4FX7A 1FOBA 4WR3A 2PDFA 1ONWA 1S38A 2YPIA 1GOXA 5J04A 1XIDA 1OCJA 1TPFA 2OSYA 1IGWA 4S3CA 3W24A 3S42A 3UY7A 1S2WA 3UWUA 1FWSA 2QPXA 2ZZ7A 4GX8A 3W75A 1UR1A 2V67A 4PE8A 3ZSSA 1W1YA 1FDZA 2W91A 5IBXC 3O06A 1H41A 4FP1A 4CGTA 4FO4A 5LGXA 4FEZA 1KKOA 2B7OA 5AOUA 1X38A 5HWNA 4H2CA 5DT7A 1K3UA 2PTYA 2XIJA 3EWCA 4MWAA 1MNSA 3E74A 1OHLA 3UD6A 2O9TA 4MDPA 3ABQA 2VT0A 1IWAA 4GQGA 4E8CA 2PC8A 4AD2A 1F6YA 3PWIA 3SDOA 5HQLA 3EB2A 5BXSA 3HPSA 3CAQA 3RM9A 4X0VA 5CGMA 2DZPA 2G3JA 4WDXA 2F61A 3DI0A 4DI8A 1S2UA 4DUVA 2OGJA 4PMRA 3ARWA 3MWAA 3TTYA 1TZZA 5JMUA 5FF4A 2VFFA 4EWJA 3GG7A 1GG0A 4JY9A 2CLMA 2YZ5A 1PYMA 3RYSA 1E9IA 1PTAA 1OCNA 3R6IA 2DGAA 4ZXOA 2FZDA 3RLGA 2YA0A 3UP8A 1UWIA 3RU6A 5IRPA 4ZOCA 1DOSA 1KWKA 3FGCB 5HJLA 4GXMA 4NY2A 1W91A 3GDMA 3M5VA 3PFRA 3P67A 3KZPA 2RH9A 3LPPA 1MUCA 1R3RA 1PAMA 4LBRA 1XSIA 3UG3A 1RUSA 4WJXA 1Q6CA 3EXRA 1AQFA 3TWBA 1E0WA 2BWGA 1W54A 3CUFA 3CBWA 4AZHA 9XIMA 2EXOA 3E2RA 5FEWA 4F2BA 3RMEA 2PDBA 1GW9A 2QGYA 3UBPC 2P8BA 3CASA 3OLDA 1SZFA 3OU8A 4TU1A 3S6OA 2YYUA 1S46A 3WF0A 1GKQA 2BODX 1C8YA 1XPYA 1UD2A 2GDUA 4OBRA 1V77A 1RK6A 3T05A 2GVEA 1GKPA 1TWDA 4AZGA 2ZRZA 2GOKA 1TPVA 2I9UA 3BAKA 1XX1A 2GWGA 4GXWA 4FXRA 1XLGA 1RCQA 1XWYA 4I9JA 4IUOA 1EBHA 4GJ1A 3W87A 1AJ0A 1C7TA 2QR6A 3KBWA 3OG2A 1JQXA 5C54A 3LSBA 5C5YA 1BKSA 3P82A 3PPFA 3R25A 3CPUA 3FVDA 5JUVA 4IQDA 4JIIX 1QK2A 3A21A 3VFCA 4CEUC 3MYPA 2VKZG 1T96A 4DYEA 4Q4QA 2XUCA 3G0XA 4I7WA 1VBHA 2ZRXA 1GOOA 1AFSA 2NLIA 3WEZA 1GOKA 4BS0A 2VQUA 4QSHA 5CXPA 2HVOA 3RJXA 3LRMA 1WXZA 3N19B 3NO5A 1HUVA 4ZBCA 3QY6A 3CAVA 7XIMA 3AICA 3N12A 1ZBVA 3ZFHA 1LRQA 1YXDA 2ZC1A 3FDGA 1XGEA 4A3RA 3TZFA 4DF0A 3HG5A 4TTUA 1IXNA 5E0CA 5I7GA 2INFA 7PTDA 2ZQ0A 4P61A 3EMQA 1LORA 4UMAA 2OYLA 1B57A 5EGRA 2O9PA 3RN6A 1P0BA 1RAKA 3GNPA 4E5TA 4P7QA 2GJRA 5GNYA 2JBMA 2OSXA 3LA4A 3PZGA 5G2IA 3DAQA 1E4IA 2QNEA 3QV9A 1XL9A 1QRQA 3MCNA 2DZVA 4OOUA 3NPXA 4I3GA 4H9XA 4Z08A 3H2AA 4DHGA 2PDNA 2ZUTA 1ELSA 1SZRA 1RXOB 3A5FA 1EHAA 1NFPA 2QCEA 3S46A 1K7FA 1TELA 1FDYA 1BXCA 2H6RA 2YR1A 4GC4A 3AISA 2VELA 1XRVA 3G8EA 1ZS2A 1QVBA 3NAVA 1VGAA 2OJPA 2ISVA 2D69A 3VIKA 1LL6A 4V1XA 5I3KA 3PG9A 4D1JA 4NZFA 2V63A 2VFHA 1JCXA 4TIMA 2YDSA 1VFTA 5HAOA 3CV1A 3WD4A 2PUZA 1E6SM 2ZRUA 1QNQA 4MADA 4HTBA 4RDZA 5KZEA 4CQCA 3GKFA 4P8UA 3SCTA 3E6EA 2V5LA 1GVYA 4H8VA 3BK0A 1T40A 5AYYA 3ALGA 4EAYA 1S2CA 1UZHA 3IGHX 3K4WA 3W7LA 4AIBA 4L4OA 2R1NA 4GY0A 1EWEA 3NQAA 4Q8VA 2PDYA 3S2CA 1H7NA 1TJPA 4BHYA 2VEKA 3TW9A 4BWLA 1C90A 7TAAA 5A3HA 1CYGA 1I8JA 2KAUC 3SIZA 5K9XA 4K36A 1YIXA 2XIIA 5BMXA 2PDJA 3CAWA 3AIBA 4E2VA 1UKTA 3FEMA 4RPQA 2YZRA 4RCXA 2WHJA 3HO8A 2XH0A 2JIWA 1K7XA 3BPWA 2DH2A 1L0PA 3MHFA 3V18A 2QS8A 3B0PA 2OOGA 1F4AA 1XCFA 1Q2SA 2UY4A 1WUFA 3S5ZA 1EXBA 3CTLA 1KCLA 4JTGA 2V2CA 5C9XA 3AIUA 1ZAHA 2WQDA 5FKYA 5TF0A 2VXNA 2ZX7A 2R94A 3PNUA 5HNUA 2J13A 5HJXA 4FNQA 3NQ6A 1RPXA 2A5HA 3KLKA 3NQ2A 4O18A 1P6WA 5AC6A 3L4TA 1Z48A 3EWUA 1ALDA 3INPA 5ABTA 3EDDA 3KHDA 4UQ9A 4CQ9A 1T6MA 3E5PA 5K2ZA 3H12A 2FZ8A 4LNYA 4NX0A 5JBFA 2ISSA 3FS2A 3UWQA 1HKJA 1FQ0A 1EJVC 5B7YA 2O7QA 1L6YA 4Z1CA 1RQHA 3RO6A 3PBMA 3A4JA 1CXEA 4PSRA 5DT5A 3G22A 2RJHA 2ZWZA 1AG1O 4Q8MA 3U4AA 2E1WA 1K70A 2VEIA 1AL8A 2BHZA 4EACA 4AB4A 2CLFA 3OZPA 3EZ4A 1RBOB 3GZ3A 1EC7A 3G2GA 3MI3A 4W7WA 3PZMA 5CLWA 4TV6A 1K8XA 4C1NA 1OEPA 5AYZA 5C6MA 3OVGA 1JYWA 3RR1A 2X7WA 3D3AA 3WQCA 5HNRA 4XQ6A 3CQJA 1BSLA 5FJIA 4D1IA 4HMNA 1UD3A 1J0YA 3HPFA 4GYJA 4A4AA 5CC3A 1XC4A 1HP5A 3GVWA 2EKCA 2VWTA 4ZQNA 1I0DA 3EWBX 5CG7A 1RJQA 1AQMA 2VZOA 2EGZA 4CN6A 2QLYA 1OD8A 1N2VA 1EP3A 1NP2A 2BVTA 3ES8A 1OD0A 3WJZA 3PBYA 1BG9A 3TNBA 5C9ZA 5EBAA 2A4AA 4PN2A 1VHCA 3BV4A 1XG3A 4EK7A 1M7OA 3V16A 1VBUA 1WX0A 1RV8A 3A24A 1EX5A 3KXQA 1XLMA 4UWMA 1EJXC 1H62A 3C2EA 1EPVA 3SY8A 1Q85A 3I68A 4DJFA 4CCEA 3P7YA 4HZMA 3W0KA 4LYPA 2NV9A 4JTLA 2J62A 3URNA 3YPIA 4IICA 3UR8A 1KFLA 5E09A 2R91A 3UF9A 4DJDA 3DFPA 5AC4A 3CLMA 3RGTA 2NT1A 3LCWA 3IUIA 2YW4A 2XIMA 4WVXA 1MW0A 3ITXA 1XYFA 2VZSA 3F2DA 3BAYA 3WL0A 3HV8A 1KM4A 4PMJA 2WHMA 3OBAA 3N34A 4JFSA 4BQ2A 1XP3A 3FW6A 3IANA 1Q63A 2ZUWA 1OGBA 1T5AA 1OGGA 3V5CA 5EKYA 4P5UA 4OV4A 5TD4A 3O63A 5G1TA 1PE1A 4GYFA 1XYBA 2YFNA 3F2BA 4ALDA 3QXBA 3OHMB 3VGHA 3AIVA 4GINA 1EDTA 4IGNA 2YL5A 2ZVIA 4LS2A 1A5NC 4IFRA 3LB0A 3UGRA 2EPKX 1V3JA 4M81A 3VO0A 2AOSA 3CK5A 4O16A 4ADTA 1CECA 4XBKA 3TQPA 1XLFA 2WNWA 3AFBA 5FAGA 1XR2A 1E4NA 4D8ZA 2D0GA 3PP7A 1J10A 1LJYA 1M53A 3W2UA 2J74A 1ECQA 1MZRA 1HJWA 2J6VA 4RNJA 1TCMA 3E0VA 4PRWA 4KF1A 2GSEA 1N8IA 1F8MA 5HWMA 1I1XA 3G1AA 4UNIA 4D6FA 3GLCA 2OKTA 1OYCA 1V93A 1UR3M 4R3UA 3GRIA 2VD9A 4P8VA 5LSMA 3CNYA 3G24A 3H7UA 4LAZA 3GDLA 1A5OC 4DB7A 2PB1A 3M0HA 2F7FA 4ORIA 3OLGA 3WFLA 3FJ6A 8A3HA 3M7WA 3GNXA 2BY0A 3ARPA 5H8MA 4U5IA 1QBBA 5A6TC 1F73A 2OGYA 4IFKB 3MUXA 4QQ3A 4ZO9A 2QUUA 4Z1DA 1Q6EA 3BZJA 2XH4A 1M9HA 1W3LA 5DN1A 2DZXA 4XO7A 2H3DA 1E6PA 1VJZA 4FLQA 2W0UA 3C86A 2HXUA 3U2CA 3VUPA 2NSOA 1F07A 2H9AA 2VFEA 1L9WA 4NAEB 3PZIA 3V5OA 2EEXA 3U3HA 1JF5A 4KFOA 4JN6A 3HM7A 1CGYA 1GG1A 3WUEA 1P0EA 4L80A 1QXLA 1TIWA 2CLIA 4ZOEA 3M0KA 3COTA 2QDDA 4DF1A 3CB8A 4PTDA 1XLIA 2F6KA 1P7TB 3LHZA 4MWAE 3BUVA 5DLCA 1ZZMA 2ZE3A 1ZENA 3QZEA 1H09A 1R9ZA 2A6LA 4IJRA 3VIJA 1ZRQA 1N8FA 4PEKA 2CBVA 1UUOA 3WNLA 1ZL1A 5BWAA 1JPHA 1GPWA 4UTKA 2GGIA 1CLVA 3W2KA 3LOTA 1MRAA 2E5DA 4H2HA 4QEHA 5T9BG 1F3TA 4QG8A 2PZNA 1RD5A 4D6GA 3TK7A 1XQLA 5HR7A 2VO5A 4M1RA 2BY3A 2A1YA 1FP9A 1ITXA 4GUFA 3OVPA 2JKEA 4ZCWA 1UBSA 4BR1A 3QW3A 4XWUA 2JK2A 1W0MA 2EKGA 3QR3A 4OBSA 3O6YX 4XIAA 2B0MA 4XTIA 4H8HA 5JIWA 4UFKA 4YYFA 5CJ5A 1J2BA 3E2SA 2BV9A 3GTHA 4ZTYA 4Q4PA 4RDWA 1E5NA 2ACQA 3FYPA 3WD1A 4IPIA 5EY5A 1KWGA 1RLCL 2WMGA 3HV9A 3WNPA 1LT8A 4MWAB 1PXGA 2FKPA 4ERGA 1AVAA 2ZE0A 1XF0A 3MI2A 4YHEA 1E6RA 3BGGA 3LQGA 1QWGA 3B4YA 3WNMA 3AMDA 1NQKA 3CYJA 4E2BA 3GE7A 4JHZA 1NDZA 3QQ1A 3KBSA 3B04A 4DBWA 1JDFA 1XYCA 1UC5A 1UPPA 2PGEA 3UYIA 2JE8A 1ICSA 4K68A 2J24A 3H2MA 2XN2A 2B31A 4K39A 1Q6RA 2FZMA 3HIJA 3NL5A 4XZHA 1TCDA 4QG6A 1K9EA 1RVGA 1KTCA 5G1MA 4TOQA 4O52A 4P7OA 5AECA 2Z1XA 2PZ0A 3BICA 4HHMA 1GZJA 5AZ1A 2V3GA 5ENLA 2XJ7A 2ASHA 3N25A 1QMLA 2PP1A 2ZXBA 3EX6A 4Q8OA 3KBNA 3MT1A 1JCLA 2WCAA 1CLXA 1OWQA 3QGKC 1KRCC 4KWOA 2V3FA 2QVHA 3USZA 1E43A 4UFIA 4GCAA 1ADOA 4IMFA 4ACZB 4F9JA 1BGGA 3PZTA 2WKGA 1WXYA 4BKNA 1KBLA 4AY1A 3MCOA 1PTDA 1GONA 5TQLA 2XFWA 3RLHA 1PX8A 4CU7A 4LB4A 1N8WA 3ITGA 4JTRA 1CXKA 2E1DA 2CLHA 3O05A 1XYLA 3B05A 4AQLA 1W1IE 4N6EA 1XKYA 1EH9A 3NQVA 3SQLA 3QFWA 1OF8A 1MEIA 4CD8A 3I3DA 4XAYA 4PSPA 2QCHA 4DAIA 4IXXA 4KWWA 2GOUA 3G18A 1JAKA 3WENA 3N11A 2FYMA 1DP0A 1WKDA 3QV8A 4I5RA 3WK3A 5D4YA 3ANUA 4UNLA 3POCA 4QITA 4UR8A 1TYGA 4ML4A 2Y85A 2WJEA 4MHBA 3CT2A 3O6AA 1D7FA 3W29A 2ZRWA 3UPWA 3K8LA 5CC7A 3VC5A 1E15A 2GYIA 1A4MA 5FEXA 4F4RA 1MQRA 3WQOA 3VOHA 3S9YA 4GMEA 1GJWA 1S5MA 1JZ4A 2HPMA 1XH1A 1PV8A 3WQ4A 4NXSA 4H04A 1G01A 4AWEA 2G96A 3MMUA 2OEJA 3PBUA 2XFYA 1OFBA 3GXPA 5BOOA 3VE9A 2O0TA 3C2FA 4HPGA 3CH9A 1TJ2A 3I6TA 2YLLA 3WG6A 1DQWA 2P3ZA 4IM4A 3BARA 4NJKA 5AZ0A 5H2ZA 4IPJA 3RX2A 3A3HA 1G4TA 1FKXA 2VCAA 2D22A 2EJ1A 4DUOA 4P7LA 5IHRA 4TX8A 3W4RA 1Q6QA 3P8IA 4A8NA 4D6EA 1QO2A 1GV