4AU0A

Hypocrea jecorina cel6a d221a mutant soaked with 6-chloro-4- methylumbelliferyl-beta-cellobioside
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOGLUCANASE 2
publication title Rational Design, Synthesis, Evaluation and Enzyme-Substrate Structures of Improved Fluorogenic Substrates for Family 6 Glycoside Hydrolases.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
total genus 132
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4au0A00
1OC5A 4B4HA 1QK0A 1UP3A 3VOFA 4AVNA 4AU0A 2BOFX 2BVWA 4AVOA 2BODX 3RU8X 3VOHA 1UP2A 4AX6A 3RPTA 1QK2A 1UOZA 3A9BA 1HGYA 1OCNA 4I5RA 2BOGX 3A64A 3VOJA 1OCJA 4B4FA 4AX7A 3ABXA 1HGWA 4I5UA 1CB2A 1UP0A 4A05A 1OC6A 1GZ1A 1OC7A 1TMLA 3VOIA 1BVWA 1QJWA 2BOEX 1OCBA 3VOGA 1DYSA
chains in the Genus database with same CATH superfamily
5ABEA 1OQFA 5ENLA 1XYFA 2J9YA 1GQNA 3H26A 4HOXA 2ZX8A 1GPWA 2J7DA 3CTLA 4KCVA 4KCUA 1GQIA 1VYPX 3MBDA 2GVEA 3WUGA 2BHZA 3MPGA 4NJHA 1XIEA 3LNMA 4TTGA 2VWSA 4XQ6A 1VD6A 3TTSA 2WKGA 2GGHA 2V6AA 2BY3A 4IH3A 4P7OA 1NWSA 3JRKA 4H00A 1IYXA 5K9DA 3KOFA 5DCDA 4BWLC 3WQEA 3QR3A 4AZCB 3V75A 4FX7A 1U33A 3AXXA 3QGKC 4AIBA 2GOKA 4S3FA 4U31A 4WX2A 4E6MA 5DEZA 2A7PA 3PY2A 1IZJA 3HU7A 4JDBA 2OKTA 3SRFA 3SGZA 4GUFA 1DE6A 1LL6A 4KCTA 4LX4A 1V4YA 4NIRA 3ZVHA 4LT9A 1ME8A 2QCGA 3AXKA 3VCRA 3B03A 3AALA 5DY2A 5A6KA 3EWCA 3FK4A 5A6TC 3HGRA 1UR2A 3HF3A 4YTSA 1V77A 3UERA 4NX0A 1HP5A 1X6UA 1ONWA 2CLMA 3W2JA 1QW8A 1SFJA 3S5ZA 3OVQA 1GYNA 2YW3A 4IXHA 1RA0A 3I7QA 3MCOA 3G1HA 4KWOA 2XGIA 5AB3A 5CGTA 2C1GA 1FX6A 3U3HA 3CBWA 1CDGA 1KFJA 5JIPA 3N2BA 3M0IA 3RLHA 4UFIA 4PTNA 1T0OA 1PX3A 4XZMX 2I5GA 4RXFA 1UP0A 3TA9A 4AC1X 4CQCA 1F07A 3GVVA 2FFIA 4MAZA 4ERIA 1B3YA 4PRTA 4KRZA 1I2RA 5D33A 4IX2A 3EMQA 4RZ6A 2A0NA 3QQ0A 4LCRA 3VCNA 1UH4A 2YXGA 2GVGA 2OVLA 1CXKA 1DBTA 1FKWA 3MTWA 3KP1A 1KBJA 4OV4A 2ZA2A 3M47A 2BHYA 2R1LA 4DJFC 4NZCA 3FXYA 3IRDA 2VOTA 2XTKA 1P48A 4NL1A 3G1XA 4H9UA 1XLAA 4TVUA 4ZQNA 3PZTA 7A3HA 2XWEA 3QV9A 1ZB5A 1ICPA 1DJNA 3OPSA 1XINA 3UJSA 4MDOA 2ONEA 4ADUA 4Q4KA 4HNLA 1GOWA 2AAAA 2ZUUA 1GG0A 4B3LA 5A1AA 3I3DA 2OEJA 4G5DA 1J6PA 5KZ6A 4FS9A 3CZJA 2D3NA 4YVXA 1ZRQA 3GTNA 3S6TA 4O53A 2ICSA 1BKSA 2QKFA 1JPMA 2XINA 4U5KA 5HNNA 2HROA 3CQHA 3TP4A 3WD4A 3BLDA 5C9XA 4NZ1A 1I2NA 3WD3A 4PE8A 1A50A 3MU7A 3OGVA 4W93A 4K8HA 4JYFA 1WX0A 1EGVA 3ZMRA 1R38A 1EP1A 2P10A 2ZXDA 3VOGA 4P61A 3QOKA 2XG9A 4L65A 1JZ2A 1VQTA 1PE1A 4AXKA 2PDJA 3GTIA 1W2VA 1F3TA 5CPOA 4A4AA 1D3CA 4OVXA 4B2DD 2Q8LA 2W66A 1WDRA 4ACYA 3VGDA 1SFSA 3SN1A 4M24A 2DGAA 1I2PA 3HQPA 4Q8QA 3CQKA 4NHVA 2BHUA 3MB9A 3EKZA 1AD4A 1SO3A 3PZ9A 3QR0A 4HPXA 5E93A 4DN1A 1E1CB 2Y8KA 5HDRA 4JTUA 3TNOA 3AHVA 4J3TA 4P7RA 3UWQA 1BD0A 5LHEA 3E74A 2G0WA 2RDXA 3L4VA 2YBVA 1GORA 2QF8A 1ZCOA 1VP5A 2PP3A 2RDTA 1HQTA 3M07A 3RR4A 2XVNA 3B9AA 3WNNA 3S1UA 1V6YA 2VX4A 1E9YB 5GQBA 3HG3A 3WLMA 4F48A 1EC8A 1FCUA 3A24A 2Z1BA 3MCMA 1JPIA 3WQPA 4LAUA 4JDYA 2E9BA 2DDXA 3OODA 3B3DA 3DIPA 3WLTA 3ARZA 1DXEA 4AH7A 3OHMB 4EX4A 2FYMA 3QGVA 3S2CA 4UCGA 4MB5A 4DBDA 4QBXA 3LU2A 2REQB 4D8LA 5FEWA 1FCQA 3MMDA 3G77A 2DVTA 4CGTA 4KF1A 5D04C 1W1VA 2J7CA 3NNTA 5CEWA 4MB4A 3RX3A 5G2HA 2WM1A 1M6JA 4QDMA 2C13A 1UH2A 3WZ0E 5KETA 2AGTA 3OIXA 4CNTA 5D4YA 4ZBCA 3W82A 3ITXA 4UWMA 3JW7A 5M1TA 3HV9A 5HPCA 1L6SA 2V2DA 4JXCA 1VBJA 2X1TA 4E8GA 1NELA 4J35A 1FDJA 1I6NA 1VHCA 4DZAA 3M5XA 3P3BA 3GU2A 1P7TA 5FCZA 1W9BM 3AXMA 1KA9F 3H70A 2EHHA 2XIIA 3ZWSA 1M1BA 3FDKA 1F4AA 4L9XA 4HT3A 5EMMA 5H2ZA 2ZZ7A 3UXKA 4YN5A 4U5IA 4K3ZA 5AC6A 4AHQA 3VGHA 7REQA 1GZJA 4WDXA 3W1XA 1CT5A 3WBAA 1FHDA 1NFPA 1QCWA 3S2MA 4QE4A 3N14A 4LYQA 1EYWA 3E3HA 1NY1A 4RK8A 2G8ZA 2QDHA 4EPBC 1I45A 3TC7A 4Z1DA 4BS0A 1EKOA 2PTYA 1FFQA 2FB2A 1H63A 1POKA 1F73A 3AYTA 4MFDA 4LV9A 1AMYA 3FN9A 1W3LA 1RY8A 2E0PA 4H04A 1CECA 1MFUA 2PZNA 1TJRA 2VZOA 4QQUA 2ABBA 1GKRA 3CIWA 1RLDA 2IKJA 3LK6A 1S2TA 3UWVA 2D23A 1JJKA 1W5QA 4DZHA 1MW2A 2DUZA 4BF5A 4TIMA 1UMLA 3CL8A 2NZLA 4XZNX 3DFYA 4KEZA 5CSYA 2R82A 1AH4A 1OHLA 3EX6A 1J8VA 1K7EA 2ZZ3A 1TA3B 4X9YA 4F66A 2EQDA 2HNEA 1J11A 4M0XA 4PH6A 2C3ZA 1HJVA 3CPUA 2OZ3A 1PJ9A 3VKCA 2J6XA 3IWPA 2YPIA 1VCGA 3AOFA 2GSHA 1NARA 2H8XA 4MJ4A 3JR2A 3BE7A 4CEUC 4HZ6A 4AZ6A 4DF1A 1UP3A 2GJPA 3M64A 3PBWA 1FWSA 3FXGA 1JFXA 1E6RA 2YFNA 2RHGA 3W27A 4GYPA 3RX4A 4PR4A 1M53A 3GR4A 1XDJA 1V3JA 2ZUWA 3DEQA 2VJXA 3TA6A 4JTLA 4N9EA 3M6DA 1A3HA 1V3MA 3TX9A 1I2QA 2I14A 1VPXA 2PODA 8TIMA 3WIJA 4JFUA 1MYRA 2Y88A 2GUUA 1JZ4A 2FVLA 2PDKA 2X0HA 3SUWA 2WHKA 3NVTA 2EPOA 5DN1A 1X39A 3UWEA 4F79A 1HJXA 4PMZA 1M04A 4C6MA 2V3GA 3LNPA 1QAPA 4ZB0A 2TPSA 2RJGA 3CJPA 1JD9A 3CLMA 1UA3A 4AWTA 1JYVA 5H91A 3E0IA 3VABA 1VCVA 2J24A 4JY9A 3VKDA 1NF7A 4Y90A 2Z7KA 3ZS4A 3H4WA 1FWEC 3UD6A 3BAJA 1XGDA 3DYMA 4M19A 2WVUA 2YL6A 2Z2AA 4IG2A 5D03A 4YHEA 4I5RA 4IISA 3NDZA 3PBUA 3WEZA 2F2HA 5REQB 1JZ7A 2NQHA 3KBSA 4DEFA 2ZWZA 3VCCA 4GABA 3IUHA 3N2XA 5J5DA 3RO6A 3QQWA 2QCDA 1BYCA 2R24A 5HR7A 4Q6JA 3B9EA 4UTKA 5I3FA 4DJFA 4DPPA 1UWRA 1UR4A 4BK9A 5A3HA 1REQB 3LTSA 2BGNE 4H9VA 2V81A 2EEXA 4O18A 3OVRA 1FH7A 4L5ZA 2IXVA 1EEXA 2PDWA 1B4EA 2NVDA 5H6HA 3C3NA 6REQB 1DWHM 4DYEA 3KBVA 5CJNA 4MVAA 3IVUA 5A6BA 2FGLA 1LWHA 2NUWA 4WUIA 1DWFM 4NZ4A 1R5YA 4MKNA 2QCCA 4FZIA 3MKVA 5LIKX 1S5TA 2YGYA 3E2RA 2GK1A 2OZTA 2VC9A 1BGGA 4EACA 1MZRA 4NNCA 1W31A 3BGJA 2G95A 5T9CE 2B7PA 3C61A 4ZL1A 4LVBA 1EJXC 2OEKA 3H4XA 2OG9A 1UP2A 1E3XA 4OWGA 4AZ7A 5BYWA 3W74A 3MMTA 4AEEA 4I5UA 4H9ZA 5BXPA 4FX6M 3IANA 5BCAA 1GVSA 4Y8FA 3P81A 5D9PA 4ADTA 2C79A 4JQ3A 2ZRXA 4R53A 5EGRA 3OQEA 3FEMA 4C6OA 2XVGA 4LWWA 5A95A 2G3FA 1Q63A 3P5YA 1FWJC 1NOWA 3H22A 1R46A 1MRQA 2PWHA 1QRQA 1CGXA 1ZY9A 3M5ZA 2RDUA 4RKAA 3BMVA 2NQ9A 1M5WA 3WLKX 4YMZA 1O5KA 4MPKA 1S2UA 2PD9A 1XL9A 3UWWA 2WC7A 1OIFA 4TQTA 5G1YA 4HSHA 5EY5A 3UGVA 3KHDA 5CC6A 1JDCA 5DANA 1TJPA 1H7PA 3B0XA 4DXVA 4A2SA 1K9DA 3PSVA 3OP2A 5KZMA 2B81A 2HEJA 3D3FA 3VD9A 1UD6A 5F2MA 2PEVA 3KZPA 4MGGA 2PGRA 5I6SA 2YA1A 1N82A 1OBAA 1HJQA 1PB0A 3LZ5A 1PIFA 4XD3A 6ENLA 1QU4A 4BI6A 4X3ZA 2BGSA 3KDNA 4HSOA 3USBA 4N7QA 3TQVA 4ORIA 1VFOA 1KLYA 3ITYA 2DIJA 1UHVA 2FTPA 1ITUA 4KWUA 3PJTA 4UBPC 2XGZA 3U2ZA 2GVJA 2QUTA 3N34A 4WCJA 2FH8A 3RJYA 3GK0A 1BFNA 4Q33A 1K4HA 3TN3A 3BLKA 4UTMA 5I09A 1QWGA 3LLDA 4GFIA 1MDRA 2VVSA 3RG6A 4OZOA 2VFIA 2WNZA 1TJ1A 3SUVA 3KHJA 1KW1A 8RUCA 1BRLA 3ZT5A 2X2YA 5PTDA 1TJ2A 3UESA 1UPMB 4YXGA 3A4JA 1PKNA 3AC0A 3DC8A 3WQ6A 3TYBA 1VR6A 9RUBA 3EMCA 5CBJA 1FUYA 1HO4A 4HP5A 3GG0A 1RSCA 1XX1A 2J9ZA 4G7EA 4C60A 1NOFA 3HOJA 1F6YA 5F7UA 1XM3A 1R2TA 2KZHA 3P61A 5KITA 2ZRYA 4UOJA 1JF6A 4BQ3A 1Q65A 2W6RA 4JY8A 4B5SA 4JL1A 1Q7ZA 2PWFA 4PN2A 4HNUA 2E8YA 3IJIA 1KV5A 4CD8A 1GVFA 3I68A 2PUZA 3CHDA 4UZUA 3W6YA 5EL1A 4S38A 4RR4A 4C6BA 3ARVA 1FH8A 1T99A 3D5HA 3RYSA 1FWNA 5AYIA 1SO5A 1HW6A 2BZNA 1GYLA 3FSUA 2UY3A 5BU6A 2ZBTA 2OJPA 2PCEA 1GJPA 1S1RA 1IXQA 1VCFA 5BU9A 3PJUA 1U83A 4UMBA 3FHQA 1JNDA 2P3EA 2ABAA 3VDGA 1CWYA 4GJ1A 4URIA 3G5EA 2Y62A 1UWUA 4XK2A 1OIMA 1QHZA 1IV8A 3CV1A 4FIRA 2VCAA 1ESWA 3QZEA 4PBFA 1AODA 2WPGA 4W85A 3LTYA 3IRSA 4CN4A 4ERAA 1F76A 1V0LA 4GVHA 1L2UA 1OFDA 3WNMA 5CSRA 3T0DA 4GRSA 2HPMA 4PMQA 3N9KA 4CEXC 3FOKA 5E0CA 3W6MA 2ZZ4A 2XVPA 1J6OA 2WC4A 4GJJA 4C6DA 4IIBA 3PPGA 1VAHA 3COTA 1AW5A 4QLJA 2A2IA 1W2PA 4M29A 2DW7A 4QSHA 1VGAA 5I07A 1CX9A 5CSUA 3KL0A 4JQAA 1EC9A 1Q6FA 3USZA 1G94A 4J5NA 1CXFA 3AS1A 3R5EA 2VEIA 3VD7A 4M6QA 2C18A 1KD0A 3TLLA 1QHPA 3DG7A 2FPVA 1WYIA 5GPRA 1KQZA 4Q4SA 3BVJA 4H7ZA 5T91A 3ZLFA 1Z89A 3VYLA 2Z29A 1TTQA 1ZP3A 3ZT6A 1QHOA 2HBXA 4E2OA 4ATLA 2ZKMX 2BBFA 4RE4A 4Q8WA 2V5LA 2R1NA 4DY1A 2C1HA 1F6PA 1Q6OA 3KRSA 1AL7A 3IJ6A 1G4TA 1PEZA 1KM1A 1M68A 2W4XA 3L7RA 4X0VA 3L4YA 2R91A 1J93A 3NO5A 4P7QA 4LH8A 4TUFA 2OODA 4AZCA 3MO4A 5I3JA 1LZOA 1WNOA 1ZJAA 1YKWA 2YYTA 2IS7A 1R3QA 4CLMA 3L12A 1OYAA 3A9BA 2XH0A 1EGMA 3KS6A 1E6XM 1GYMA 4ZB2A 4IQEA 5C70A 2PPGA 4RUBA 2V5DA 3N12A 3GXMA 3NZPA 4E8DA 1XR2A 3URBA 3VD4A 5A6JA 1A0DA 1XSIA 2Q3OA 4GKTA 1J10A 3B8VA 1TPH1 1FWHC 5D2YA 3CLWA 1G0CA 4ZQOA 2VR5A 2OYLA 1HXJA 1E0UA 3Q45A 4RL3A 3TWAA 1KBLA 3QPEA 3NJ3A 3VNYA 2ZC8A 4NG3A 4OT7A 1PPIA 5D05A 4BEQA 1M3UA 2VKZG 2PDMA 1EJVC 2JF6A 1BTCA 2C16A 4JTHA 4TXEA 3PZNA 3C56A 5BRPA 2ZXQA 1UJQA 1S2AA 2YYUA 3F4NA 4DO7A 4IFRA 2JK2A 1V6TA 8XIMA 4OKDA 1ZUAX 3N29A 3SRKA 4FALA 5TF0A 4V28A 3G1AA 1OFQA 3CUIA 3C2RA 1NTHA 1PIGA 3VIFA 2XIMA 1ZL1A 1K70A 5D8WA 2TYSA 3EWZA 3I7RA 3CMGA 4PYSA 3CB8A 1KWKA 3TYDA 3S2NA 2FPTA 3RMEA 3PBGA 5C9UA 1UD2A 2XM2A 3J7HA 5D32A 3LM7A 4OECA 2B4GA 2WXDM 2X42A 3N18A 1UMYA 1EJWC 3EMZA 2OR2A 2ISVA 3IIXA 2OYMA 3VM7A 1XW8A 4GIYA 4ZXLA 2H9AA 1E56A 3GG1A 4LB4A 3W4RA 1UUMA 4A2RA 3ES7A 4UTIA 1TRDA 2G3NA 1GW1A 1S3TC 4AAJA 4A35A 1YBQA 2A85A 6TAAA 1GT8A 1F8IA 5I02A 2GPTA 3S9IA 4PMJA 4IQJA 3W1AA 5LSMA 1D9EA 1O7AA 3OZOA 3LCLA 3O6CA 1XF0A 5TQLA 5A8NA 2I56A 4JTTA 1IEWA 2VL4A 1PUDA 1RBAA 4Y2WA 5EMKA 2EG6A 4WY0B 1TPEA 2E1WA 3QC0A 3N6JA 1RK5A 2TODA 4M6VA 3PBYA 1PZ1A 4X0NA 3LGEA 4A3YA 1H1NA 3SUSA 3Q94A 4NAEA 1I60A 3WH7A 3GUWA 2QF7A 3Q65A 3GBEA 3AU6A 1JI1A 1IQ8A 2ZFAA 2Y70A 2Q02A 4BJHA 4GUIA 3P8IA 1P43A 4JKKA 1SZFA 4UTTC 1J01A 1E6PA 1WPCA 2DV0A 4DWSC 3VM5A 4G7FA 4O16A 3VKJA 2VI0A 4O17A 1LM1A 2OLHA 3KM8A 1ISWA 1QT1A 1UOZA 2V0TA 1Q4WA 3PN8A 3BXWA 2PLKA 3AIRA 4AZIA 4ENLA 1P0BA 2OKOA 3VK5A 3P2VA 4JN7A 4DNHA 4JTRA 1S46A 3GXPA 4XZLX 4F4RA 4O4VA 3A4XA 1ZBVA 3G0XA 1JGIA 4G8TA 4JIEA 1VIWA 3OW1A 3GHRA 1FWIC 1A3WA 3HZ3A 3NQBA 1Z44A 4AVFA 2D69A 3B8IA 3HV8A 4MFEA 4D1JA 1OFBA 4E2VA 2F7FA 1Y5VA 1AZ1A 2QUVA 4FP1A 4PL1A 4J2PA 1QI0A 2ON3A 2ZUVA 3VNLA 3T0TA 3CL6A 2YCKX 4HK6A 3BLPX 4JR5A 4K36A 1QPQA 4GNJA 3NEVA 4N2YA 2YZ5A 1UR9A 3WH6A 4Q4PA 5KTLA 1X97A 2CLHA 3VDBA 1U2YA 1YDYA 5FSEC 1PTDA 1LUCB 1DJZA 3KL3A 1SFLA 3TNBA 1OX4B 4E38A 6ALDA 4PUEA 3F4CA 2VFHA 4FNTA 3VC5A 3F7JA 1JAKA 4L1XA 3SECA 4ZO8A 4WDUA 3TQPA 3W00A 4ZEPA 2GJLA 2CBVA 1KFWA 1LBMA 4U3CA 4AWEA 1JNEA 2VMFA 3SCWA 1KV8A 4REQA 3K13A 4UCFA 5DT5A 1FWCC 5D2WA 3W7OA 1PV8A 3MJYA 1MWOA 3DI1A 4ZXOA 4UFLA 4L6HA 4I9TA 2VC7A 2HSAA 3BAIA 2Y8UA 1J0JA 1AZ2A 1G1YA 3ID7A 3MP3A 4C7FA 1S5MA 2NLIA 3LHYA 5JXQA 3U7VA 2AL2B 1Q3NA 2OSWA 3CMJA 4R27A 4JKMA 1JGMA 2QIIA 5CG7A 1V51A 3ZYZA 3U6WA 4HYRA 1CGWA 4UR8A 2X16A 1OZMA 3OGSA 1RK6A 3DESA 5E0KA 3BLIA 2PFHA 1XIDA 3NPXA 3VIKA 2BY0A 4Z2GA 1RPKA 1CZ1A 4IZGA 4LS1A 1CIUA 1UQYA 1E72M 1ZNNA 1PYMA 4C1LA 4WJ8A 1UW9A 4A29A 3TONA 4CVWA 3ABZA 4GFSA 4EAMA 1DKWA 4HN8A 3CO4A 4AD5A 3M0HA 1YHTA 1HFBA 5AYYA 5H8MA 3T0AA 3RR1A 1TA3A 3S5OA 3U7BA 4ICCX 3AZSA 3RU8X 3MP5A 4QTGA 5T8GA 1TFVA 3TC3A 3LPOA 3UQNA 2DJXA 3VOIA 2SFPA 3WBEA 1EJSC 3RRXA 1LQ2A 5GJPA 1KFBA 1US3A 2X8RA 1MMFA 4E5TA 1PHWA 1M7JA 2QCEA 3EB3A 4J27A 3UCCA 3CEPA 4WSHA 1H7RA 1DE5A 3MUY1 1UKOA 3W75A 1AG1O 4B16A 4GGHA 4AD3A 2NQ5A 4A22A 4HJFA 4C6QA 1K9FA 4KETA 1O12A 4LCSA 3K5XA 1C7SA 1UR1A 2WWCA 3W24A 2G96A 4ZR8A 3T1GA 3TZFA 1VFSA 1KGXA 2PF8A 1YNYA 3GDRA 3N25A 3G1VA 3KWSA 1TRIA 2IQ0A 2VUYA 5I79A 1EA9C 1TCDA 4KEUA 4CQDA 1EUNA 4CCZA 2O55A 2W67A 4LUSB 1O1ZA 3PTKA 5LKYA 4QE1A 3W02A 2WMKA 4QDWA 5F2IA 3TJXA 1TUFA 4JIHA 1UKPA 4E2BA 2VC6A 3V7PA 2PWEA 4KW2A 2XDFA 1FXQA 2VX6A 1Q6DA 4HCLA 2VR4A 3PNUA 1SZRA 2P53A 3V16A 3CUGA 3SCRA 4IQLA 3DFTA 1U5VA 5TNVA 1OGSA 3UZXA 2R94A 4HHHA 4XSLA 3KLKA 3LI0A 2YKKA 4D1IA 2L5HA 1XIGA 1N8IA 2X30A 2WM0A 1SFTA 3NZ1A 3ZR6A 1XGEA 3GHSA 3CQ0A 1VFFA 3M46A 2PMQA 4BCEA 2BODX 1HVXA 1DJHA 3ZOAA 1NP0A 4IIGA 4OU1A 1JYWA 1VBUA 4B5XA 3PJXA 4JL2A 1REQA 3C0JA 4GI9A 3L0NA 2WZHA 3CO8A 1JYXA 1OYBA 5HMSA 3TTQA 1ZALA 1YE4A 3PPHA 4XX6A 4JYDA 1SW3A 3PWGA 1PKLA 1Q6GA 4LC8A 3BC9A 1JG9A 5EPDA 3AS2A 3ALGA 1VF8A 2CWNA 1OK6A 2GQ8A 2OX1A 2VEKA 4QG9A 4QJ1A 1IR1A 4JTEA 1G01A 1VYRA 1W9UA 4GO8A 4OFCA 4ZO9A 1W37A 4EIVA 4QISA 1VEPA 2ZZ2A 3N2TA 4FLRA 4DNMA 3BSGA 2PWVA 3LMYA 4QDPA 2CBUA 2XFWA 3TEVA 4I5XA 3HJZA 4AFYA 4NJKA 3LCXA 3SCUA 4N4QA 4IUGA 1HJWA 2O9TA 3IUDA 3LV6A 3O3RA 3P67A 5JBEA 1Y0EA 3W28A 1TMHA 1A3XA 1JQVA 4CUCA 1CLVA 1GEHA 1C8QA 1ZAIA 3MHFA 4DYJA 3QMSA 3NL5A 3NPVA 4DWSA 1I4NA 1TV3A 3LCIA 1W9VA 3M0VA 4H9TA 4O0ZA 5C7VA 1EJ7L 2O7QA 2ZIDA 3FIGA 2I5IA 4G6CA 1O4UA 4NILA 3TN4A 1UH3A 3HB9A 4XBJA 3HJEA 4W5UA 4DAIA 4LY8A 3CHFA 1AD1A 1DXIA 1KBIA 2QHAA 4K1WA 1Y8BA 4BQ2A 3AMDA 2HQAA 4XAYA 4O1BA 4UFHA 1R2RA 1E73M 1KXHA 2PDBA 3ICJA 3MI2A 3UEQA 3T09A 5FAJA 4US6A 4RDVA 4M3PA 1D2KA 1KFLA 5D9NA 3N3MA 3RITA 1MVYA 4MTVA 2E8ZA 3E5PA 1M9HA 4PL2A 1EPVA 3B05A 4FX8A 4JZ5A 3OLDA 5LHFA 1ME7A 3FVDA 2WC3A 4DF2A 4UOQA 2IKHA 4CD4A 4NKCA 3OIHA 3I7SA 3R79A 4UNLA 4LPCA 3R10A 1WOAA 4Z0SA 1DQXA 1YYAA 4O8RA 2ADAA 1EHAA 1LLOA 1YTKA 3TYAA 4RDWA 3N11A 3IUIA 5I3KA 1I75A 3LMZA 5CGQA 5U7SA 3WMSA 4DAFA 3LXBA 3PANA 3W2NA 3W7IA 2QQ6A 1GVOA 4PEEA 3H12A 2DT2A 2P76A 4YVPA 3H8AA 3L2IA 3LBOA 3UPMA 4XVEA 2A3BA 1BF2A 4DPQA 4W87A 3AYSA 2PS2A 3RM9A 1X6LA 4LU0A 3DUGA 1W5MA 5GNYA 4C6EA 3SQSA 4PCPA 1JFHA 3C6CA 4JN8A 3CUJA 3PS7A 1KFCA 3URNA 3TTYA 1H0IA 1GUVA 3EXRA 5CSSA 2V5BA 3T7VA 4N4PA 4NVTA 1VFLA 3EKGA 2Z1VA 1XLEA 4IGMA 2EKGA 3HBLA 4K7VA 2I7GA 4HCHA 4WJXA 4Z2LA 4EVZA 2XZ9A 2D2OA 4IMGA 2C8NA 1GHRA 3HG2A 4IMDA 4XZ9A 1WZKA 3N1AA 3PAOA 2CNCA 4RZ5A 3RLGA 1IWAA 4KESA 3FYOA 2BY2A 4DUWA 4FNUA 3WJWA 3CIXA 3PUGA 3TIMA 3BG9A 2XN2A 3ZO9A 3LXCA 3FYYA 3G0UA 4YJ5A 3E0VA 1EIBA 1JXKA 4FNSA 4UFMA 4JFTA 2EPKX 2FDSA 1DJQA 3DG3A 4JNZA 4IICA 2OU4A 4QAWA 1EH9A 2RGLA 3BUVA 2V8ZA 3S5YA 3UR8A 1XLGA 3HQ1A 4IGHA 4YNGA 4JN6A 3ME3A 4DELA 1G9HA 3RX2A 2C0HA 4ICMA 1H4PA 3N2OA 4JPGA 4HGXA 4LS2A 1TR1A 1JZ8A 3BOXA 2XIJA 5TD4A 4ZCWA 4G9PA 4AYGA 2GQAA 4LF1A 3W7KA 1P0DA 1BG9A 3T40A 3VIPA 4CNUA 3BLOA 5A6MA 3ELFA 1LROA 4AG0A 3FGCB 3JZEA 1EX5A 2C0AA 4YWSA 4I9AA 4HOWA 3REQB 1F3XA 4A3HA 1LWJA 5FKYA 2CEQA 3AYVA 1D7FA 4CVUA 4R3UA 3LG3A 3N19B 4MF4A 3KS5A 1W5PA 2RUSA 4LCQA 2GWNA 2VEGA 3W7QA 4IJBA 3LY0A 4NP7A 1TQJA 2J27A 4JNYA 2OWCA 4IPLA 1GCYA 2YCLA 3BARA 3BG5A 4Q6XA 4HHMA 5KSWA 1OG0A 4UFKA 1YX1A 3GD6A 5D2TA 1DEDA 1H7OA 2ZC1A 4I8DA 4LVDA 4JYEA 1B4KA 4HU8A 2GDVA 5IBXC 4FI4A 4RDZA 1NFGA 2B7OA 2MNRA 1WE5A 2GFTA 1FHVA 4J3WA 2BVTA 1QBBA 2XSAA 2V68A 4DJFD 4Q4OA 4XAZA 4OQVA 3RLVA 3LM3A 3BQ5A 4GQQA 3UZZA 3FA4A 2OO0A 2YDRA 3PZOA 1BYBA 2Y5JA 3WELA 1QI3A 3QVQA 3ABXA 3BAWA 3F2CA 4GD0A 1M01A 1ONXA 1GPFA 1QJWA 3FSTA 2FPYA 1ZS2A 1OC5A 4HBKA 4AVNA 4MYXA 2D1ZA 3GKFA 4D8AA 2VZTA 5A6BD 1UQZA 2ZWYA 3LCFA 4Y8EA 3SUTA 2UY4A 1FWTA 4AHPA 4AY7A 4UTJA 1HGWA 2CC0A 3VUSA 3S2JA 3TTEA 3PTDA 1YPXA 5MKGB 3G1YA 3QW3A 4OBRA 3SN0A 2DZPA 1XRTA 4L4PA 3AIVA 4C5YA 2EG8A 1IXOA 3B8SA 3MMUA 1NWRA 3FCPA 3VNIA 2E28A 1C7TA 4J2MA 4FXFA 4D6CA 2J7EA 3ANYA 3PC0A 2CW6A 3F03K 1WO2A 3UG5A 5C71A 1TB3A 3JVAA 4ZQRA 4GE8A 2Y2WA 3GH5A 1U22A 4QLLA 3LXAA 1J0YA 1B31A 5HUOA 3AIEA 5GNZA 2QJNA 3T44A 3GNXA 3R7MA 1GVRA 3HGJA 5EB8A 5FJTA 2A3LA 2E6YA 4ML9A 4DLMA 4AHOA 4PUNA 3NIYA 2FHBA 2GSEA 1B2YA 5LYRA 2VT0A 4ZOBA 4NJIA 5I0DA 3EX1A 4M1BA 3SY5A 2OSXA 2Y5EA 2PSNA 1A4MA 1ADSA 2PTZA 1AL8A 4RLIA 1Y7VA 4XIMA 5D2XA 4AF0A 5FJPA 4ZENA 4Z42C 1RHCA 1E1EA 3NQAA 4ZFCA 2BNJA 3C0LA 3PZMA 2ZX6A 5CPMA 1N2VA 3MC5A 3LTPA 3NUKA 2TAAA 1L6FA 1I8JA 1UBSA 4H1ZA 3AIQA 3D3AA 2YCIX 1WCGA 5FJJA 2VELA 1P0NA 4W86A 3LPFA 4FOUA 4UFJA 5AN7A 3TV8A 1OY0A 1TIMA 4GX8A 1MEIA 2HDJA 3ABSA 3VX0A 4DJEC 2QGYA 4IP7A 4RE2A 1XIMA 5AOUA 1K77A 1V8EA 2IKIA 2YIHA 1Z9AA 2G3JA 3GNPA 4WY0A 1N8FA 3EBVA 1EXBA 4CNOA 3LRMA 1QMLA 4E3VA 1HT6A 3UZWA 2YX0A 3IACA 4ZZ9A 4C91A 5F2LA 1XRSA 4Q8OA 1RALA 1ZJIA 3T2PA 4W89A 3RIKA 4DM2A 3KEHA 1R0MA 2NX1A 1TPDA 2RJHA 4V15A 4JNMA 1V6VA 4I6KA 1TJ0A 3MUIA 3AUOA 2ALRA 1EEPA 2Z2UA 3SURA 4B91A 1DORA 1SSGA 1K6WA 5ABTA 3QW4B 1L6WA 5KZEA 3SM0A 1TZ9A 3QTGA 4S1FA 1G69A 2XH7A 1XBYA 4S3BA 5FEPA 3U9IA 4BKNA 1KCLA 1G4PA 3WBWA 5HK4A 2EJAA 5FA5A 4A3UA 1Q13A 1JCJA 1GHSA 3SDOA 2WNWA 1A49A 4XD5A 3CU2A 4DJDA 2VOMA 3NQDA 2XH4A 2V5KA 4ROQA 5C7HA 1A0EA 3O9NA 3OLEA 1BVNP 1VPQA 1OG6A 2OPJA 1EYEA 1WXYA 1XH0A 5RUBA 1PSCA 3AQUA 2Y7EA 4ZO7A 2PA6A 4D2JA 4JIRA 4LUIA 1J4EA 4U3AA 1J0ZA 2WCSA 3F5JA 2VTFA 2WMHA 1HGYA 2Y8VA 4UQAA 2BS9A 3VOJA 3U48A 1VEOA 5J04A 3AXHA 3WD2A 5M17A 5C5YA 2QCNA 5D09A 2YXOA 3E0FA 4XUYA 1ITQA 5L6UA 3U2CA 2E6FA 5DX7A 4XV0A 1GTHA 1BKHA 4HU3A 1WKEA 2OQYA 3WMCA 1MNZA 1ZP4A 3JU2A 5AYBA 1OX4A 3WH9A 4N6FA 1EF3A 3NZRA 4K37A 1GZGA 4HNCA 4KT2A 3ZR4A 1UROA 4WK9A 3ZLHA 4RPPA 3PWAA 1RZMA 1JPHA 3OEXA 2GVLA 3WFLA 1EJUC 2XN0A 3CQJA 1QR7A 3P80A 2IPGA 2HV5A 3HPFA 2VCBA 3S0CA 4WSJA 1GQLA 1A5KC 3PHAA 2PE4A 1R85A 1VKFA 4UTLA 2DVXA 4EAYA 2PGEA 3RO8A 1V3HA 4AD4A 2OWWA 4B9YA 5AC7A 3DYPA 4Y7EA 3LCHA 3HURA 1BYAA 1QASA 4CQ8A 4PUDA 1V3LA 3INPA 3D6NA 1XC6A 3SY8A 2NV9A 2XIQA 1L8NA 3L23A 1E70M 4NAFA 4RNIA 3QM3A 2YA0A 4AC7C 4D6EA 4QJ5B 4O0KA 1A47A 2OLSA 3K1GA 2PGWA 2BGQA 1R3VA 5C9WA 2YB1A 3GVWA 4PMVA 3WNLA 1GGOA 1SMAA 4EP8C 4C90A 2DSUA 3DBNA 3L2MA 5A6LA 3UXAA 1UOKA 3W6LA 2CHRA 1IWBA 1Q7QA 1QVBA 1FWRA 2J8GA 4PCTA 3B97A 3CZKA 3CWOX 2PLMA 4CNSA 2CESA 3QPYA 3QMTA 4ZQMA 2HPIA 3W2KA 1TV7A 4XD4A 4HK7A 3AHYA 3SCVA 4AWSA 1AW1A 3K2GA 3Q37A 4RW3A 4S2CA 3L9CA 3KVJA 4H8NA 3QMRA 3OU8A 4JFVA 4A05A 3GDKA 4W5ZA 3VDHA 4R85A 1J9YA 1KM5A 4GZEA 4GQBA 4XTDA 3UG4A 4LEFA 3QLLA 3EX4A 1QK2A 3UZYA 3TJ4A 2VZUA 3NSMA 2BOGX 3CZEA 3HMCA 3HFTA 1JRCA 4M6UA 1CXLA 5IBXA 1GOOA 4UQ9A 5DMLA 5CKSA 3L4ZA 1IIHA 1L9WA 1TPWA 3IJQA 1ISVA 4GXMA 1MQQA 1CGTA 3I6EA 2BX7A 3KAOA 1PBGA 3RGTA 3W1MA 3TWBA 1HTIA 3CM4A 3QSRA 2NUYA 5EA9A 1RP9A 3S5NA 3I3BA 2VDHA 1GW9A 4RZ4A 4UR7A 3ABRA 3AJ7A 4O10A 3G6LA 3BAKA 5E9XA 1UR3M 1X1NA 1U1HA 3SJNA 4HA1A 3WLLA 3GM8A 5C54A 2VFDA 1XPYA 3DHFA 4I7WA 4KMQA 2NXGA 3WDPP 3NGJA 3AWOA 3HMJG 3CXOA 3THDA 3FJ6A 4ILSA 1RQEA 3DX5A 3QH2A 3AHZA 1UJPA 3W37A 4LUSA 4D6HA 3EA1A 4YPJA 5HINA 5D37A 1FWGC 1HZYA 2BOEX 4N9DA 4JTIA 4HCDA 3W7HA 3KCOA 2FDMA 2QXWA 5LIUX 3RM4A 2BG5A 1VLIA 3BV7A 1MW3A 2XU2A 4MJMA 3GVGA 1F4HA 5A2BA 2PURA 1E4MM 1P6WA 4H9MA 3WSUA 1JVNA 5FSDC 1UKQA 2FMOA 3C8NA 3NQ7A 1FVPA 2YOCA 3B4YA 3M0MA 4JTCA 2C15A 1VIZA 4AXNA 5A2CA 1NAL1 1KKRA 1KR1A 1E5NA 4G1NA 4MG4A 3LGGA 1JF5A 1R7OA 2J7FA 4GBDA 2XSBA 4AMCA 5CZKA 4MNJA 5ABHA 1XLCA 2J62A 4GUJA 4BY3A 3AZRA 5CLWA 5ABFB 3PF3A 2FMNA 3PG9A 4AZBA 2Z26A 3LB0A 4US5A 1EDTA 3AU2A 4O28A 1OT1A 5D9MA 4J4KA 4BEUA 4JGDA 4CQ9A 3H53A 2QLYA 1OD8A 3M4HA 3W7JA 2DT3A 4IP5A 5BMXA 2F6KA 4Q4RA 3IIPA 5M2FX 2WNQA 2TSYA 1TYGA 1S2VA 3WYZA 4F0LA 5HNRA 3UVIA 4B3ZA 2FIQA 1BXNA 1W9XA 3MV01 3UZ5A 2JEQA 5EKYA 1ZAJA 2POZA 3MDUA 2FZDA 4OE7A 4PTMA 2Y1HA 3GWQA 4FSAA 4GINA 5CZSA 2F61A 1Q8AA 1IEXA 1SW0A 4LUYA 1XKYA 2CZVA 3H2OA 4YL2A 5D9OA 1M65A 1OB0A 4ACZB 3S5SA 3GNRA 1CTNA 1DPMA 2YDQA 4GVGA 2E6AA 3W7EA 1UA7A 1S5NA 4LEQA 1F7BA 2HE8A 3B0UX 3VZZA 1RQHA 4IX0A 1OFOA 1HIZA 3IJ8A 5IOBA 1M03A 4QRNA 2OLAA 1UD8A 3IEBA 1I2OA 5G5IA 4O1FA 1A0CA 3GC4A 3E6EA 1YXYA 1EZ2A 1HKMA 4HIBA 7CGTA 1XHGA 4JQ1A 3WCZA 3SFKA 3SW6A 1RCXB 1GJWA 2A3AA 1DTNA 2VVNA 4U4MA 1W3NA 2JGYA 5I3GA 1XC4A 2D2HA 1AQ0A 5AYZA 3P84A 4BQ5A 1V5XA 2DZVA 4K6AA 1HVQA 1UASA 2OMAA 2B7NA 1UR8A 4IOTA 4HTYA 1SUXA 1U5HA 4E4UA 1ZCCA 4WZHA 4YHGA 4Y9AA 1KXVA 2UWFA 4YYFA 3AROA 2QIWA 1QUMA 4KWWA 2C91A 1PVNA 2WHMA 5GJMA 3TOPA 3WJXA 1X1ZA 1D3HA 2FH6A 4IFKB 3N3TA 4HYWA 2E5DA 3WQ8A 4QNWA 1OEPA 4F0HA 2EXOA 2DFAA 2CKSA 3SCQA 1TV4A 1YMYA 3KOYA 4MNLA 1K4GA 3TROA 3W2MA 2BASA 1J18A 1XBZA 3WLSA 2ZXAA 4K7YA 1U1UA 5FJUA 2XPKA 4DQWA 4DZIA 3Q67A 4EPDC 4YWIA 3NQFA 4F3HA 3ALFA 4ADSA 1HNYA 4GYPC 3UJFA 4EXQA 1EX1A 4H8UA 3LUTA 1DL3A 2EF9A 4RXGA 3VPLA 2R1KA 1RAKA 2ZZ5A 3WH8A 1ZTVA 1LOSA 1Q6RA 4Q8NA 3LI1A 4E0CA 3G3DA 3BURA 2OEMA 5ECVA 1NEYA 3WQFA 9XIMA 1LBLA 3K1DA 2BXZA 1UZHA 3NO3A 3TE9A 2PDCA 2CWXA 1SZGA 1OCQA 4PTXA 1TIWA 1L8PA 3BV4A 3CHCA 5HOSA 3TK7A 1CYGA 4OIFA 4CQAA 2DZBA 1RVGA 1CXEA 3VIJA 5HQMA 3FKKA 1X38A 2RDWA 1TVLA 5K9XA 2NWRA 2I57A 3VGBA 3H6OA 2V5CA 1UUOA 5CH9A 4PULA 4D6IA 1UD3A 5CPLA 3VIHA 4F0RA 4YTUA 2FVKA 1TELA 2GSJA 1TR9A 2DORA 2Q01A 2BVYA 3W25A 4FHAA 1IZCA 3GZ3A 5EMYA 3K4WA 4Q4MA 4JD4A 3QRHA 2XIOA 4N02A 5LZLA 1HL9A 3QZAA 2V3EA 1G4SA 3NQ8A 1JCYA 4JEQA 2V2CA 2YL8A 3G1DA 3OA5A 4Q8MA 1PZ3A 4CKQA 3CT2A 4PCFA 1ZBWA 1CXHA 1JULA 1VENA 3G1SA 4NZJA 4HZMA 4KRUA 3WL0A 3L68A 2J7GA 3BSMA 4LXFA 3DYOA 1FWBC 3THUA 2GOUA 5I78A 3EB4A 1B3ZA 2VGFA 3FGCA 4YIWA 3RFAA 3P60A 4O12A 3VKKA 4N6EA 4IMCA 4GY0A 2QW5A 3WQGA 2ACUA 2ISDA 2HMCA 4HA0A 2CPUA 3IJ7A 2V69A 1ALDA 3KL5A 4UQBA 2GJXB 2DH2A 5BOFA 2PTDA 5I00A 2VZVA 4FMVA 4UNKA 2WMIB 1S38A 3NL3A 4O52A 4FLQA 5IHRA 1OWQA 1YTEA 3G2GA 2QGHA 3S9YA 3GNNA 2ALDA 1I1WA 4FK9A 1NFBA 1JYNA 1H7XA 3EPOA 1JZ3A 4CN1A 2EO7A 1H0GA 4JOMA 3A22A 4K38A 4BR1A 4FB7A 1QNRA 2DSWA 3Q4DA 1C91A 5CPNA 4ZQCA 3WEOA 5A8OA 3YPIA 2X1SA 1E6QM 1G4EA 2GQ3A 3MP4A 2VEPA 4HNTA 4PRRA 4UUIA 3ZJ8A 1TPFA 3DHDA 2A6NA 3KLLA 1UKTA 3L21A 1XV8A 3WF0A 2QV4A 1KQYA 3DGRA 2VRQA 1HKWA 3BICA 1ZJBA 3O2LA 4IJRA 4DBEA 4Q8TA 1E9LA 3W0KA 1HL8A 2YA2A 2JEPA 1OK4A 3UNTA 2OT0A 1VB9A 1F6KA 3LHTA 3MHGA 3VGFA 1H7WA 1TPC1 4LB3A 4I8YA 3B4UA 4PMDA 3LLFA 4C6FA 4OUEA 2FZMA 4K68A 2FLIA 3PUEA 3TW7A 9CGTA 1N55A 2Z7GA 3DKJA 3L4XA 3TZNA 1BQGA 4ZO6A 3H2NA 4EANA 5AHNA 3TN6A 1VBRA 3W81A 3P14A 3H23A 2HXTA 3FA3A 3MI6A 3DFNA 3CH0A 2WPBA 5AC4A 4NRSA 3WD0A 1E0VA 2A21A 4RJEA 2V30A 4DHGA 4DIAA 1WZLA 3CPGA 1XYAA 3UJRA 2HNHA 4F40A 1RD6A 2HVMA 3T0CA 1N8WA 3W38A 3NO1A 4Z1CA 1P1MA 1V79A 2ZRZA 2YBUA 3T07A 5E5CA 2HBVA 4Q7BA 3W01A 3HTWA 4J9JA 5LIWX 4ZODA 3EDKA 2XYLA 5EMLA 4DWSD 3R1ZA 1X1OA 1CB7B 3OVPA 2FZ9A 5IRPA 1YE6A 1AJ2A 4WVXA 3STEA 3WK3A 4BA0A 1KFEA 1W17A 1O6IA 1NVMA 2CZ5A 2NT0A 4CNPA 2E1DA 5IDZA 4FEZA 1XP3A 4ROPA 1NDWA 2IUZA 5FL1A 4PMUA 3PULA 1WDPA 1XCXA 4HMEA 3S1WA 5LNUA 4WHBA 2E40A 2JIEA 3TFCA 4UTWA 4C1NB 4LVAA 5EBAA 4MUPA 2A3EA 4RE3A 1XRFA 3B0YA 1BG4A 5CZ0A 4JTKA 3U5UA 1LBFA 2O9PA 4DI8A 4KEVA 3QV7A 5A6SA 3LENA 1XXXA 4ICNA 8A3HA 2W9MA 1NH6A 1MXSA 5BWFA 4GI8A 3PZVA 3STGA 3S1VA 2QDGA 2WMFA 4NF7A 2PDHA 3C3UA 1EBHA 4LV4A 4H8VA 3UXLA 1QPKA 4INFA 1GK8A 1YNQA 3GO2A 4U10A 4C6KA 1NIUA 3DERA 1A80A 1EQPA 4HPNA 3GDBA 1F05A 4JEJA 3DENA 3WG6A 4M8UA 4QCFA 1V3KA 4IUOA 1BVWA 4JFWA 1SJDA 1MUCA 3G18A 1DQWA 4H8HA 1C8XA 5A2AA 2ZTKA 2IPJA 3H21A 4TMCA 1YDVA 3G1FA 4QNEA 1SO6A 5DELA 1WB0A 3ARWA 5I2UA 5JMUA 1CB2A 2WSQA 2OQHA 4PTWA 3KWXA 4AMAA 4PUMA 4LVFA 3M7SA 3PUDA 4LRTA 3A6OA 3DI0A 1Z41A 4IL2A 4UNIA 1P4CA 3QHMA 2CU0A 5IFTA 1K6AA 3M0ZA 4MWAB 1ZQ5A 3MBFA 3T0BA 4EWJA 3TAOA 4I9MA 4KRTA 2ZYFA 4BI5A 1H1ZA 4HB7A 1OABA 1WXJA 3QQ1A 4QLKA 1J5TA 4AD2A 3EXTA 5CXPA 1XISA 5D2VA 3H4GA 3PZIA 4HPGA 1S2CA 7REQB 4HSNA 3W22A 3NQMA 3E5BA 4NSBA 5I77A 5B80A 4JQ4A 3GBDA 3OHIA 2Q8ZA 2B7QA 3THCA 4JFSA 3KVLA 1XYLA 4GCXA 4M80A 2Z27A 1CEOA 3PZGA 3U2OA 2Y24A 3WF2A 3FJNA 2DPEA 3AHTA 1PO9A 2VENA 2J8FA 2IQTA 4IQDA 2Y7DA 1XFBA 1IXPA 1OC7A 4PRWA 2A79A 2GYIA 3SAZA 1KBKA 3EEGA 1WA3A 3JS3A 4FLSA 4XIAA 2Y6ZA 3H2AA 3UY7A 3AMCA 1YDOA 2ZDRA 3NM3A 6TIMA 1SYTA 3M9YA 3NSXA 3WDRA 4B5NA 4IPJA 1C8VA 3O0KA 3MUCA 2R1PA 1HL2A 1P6CA 1UC4A 1H50A 2QDDA 3QYQA 2XZ7A 4EK7A 3KX6A 2VO5A 4DRSA 4V33A 1Q7MA 3OTRA 3QYSA 1SZEA 1TVPA 4NUWA 1EGZA 3DFPA 3MVIA 3UXDA 3WMBA 4DO6A 5J8LA 1NWUA 4W8AA 3F2BA 3MHUA 4W9TA 1KRBC 1GKQA 3ZJKA 3H7VA 1EDQA 3V4BA 3ITTA 1K02A 1LOQA 2E9MA 1RBOB 1KXTA 1RUSA 1XSJA 1HKJA 3N04A 1DVJA 1E55A 4L4MA 1ECQA 3QHNA 1G67A 1TZ7A 2HK1A 3ARYA 4NQ1A 3MKKA 3PBVA 1NDVA 7ENLA 3GW3A 5HQEA 2DQXA 3PR2A 1XPGA 2DQWA 4MIMA 2CLKA 1WQ5A 1ZBKA 4WKHA 3URQA 3ZIZA 3THAA 2BWGA 1CPUA 2OFJA 3SEPA 4J7RA 5GVJA 4AB4A 5BOOA 3FYPA 4YU1A 3MUAA 3O05A 4TVCA 1SR9A 1KM6A 4OOUA 4HNVA 1ML1A 1XJBA 3STCA 1TTPA 4NJJA 3TJLA 4FAMA 3P62A 2CLFA 2QVHA 3DCPA 3IGUA 3S3GA 4JX5A 2EPNA 1H3GA 3MVTA 1A5MC 1RQBA 3N17A 3EXSA 1VC4A 1C9WA 3RMJA 1GEQA 1QNSA 3SSJA 2V3DA 3EKLA 1S5WA 1SZNA 4D6JA 1AJ0A 4UC5A 2DZSA 4P8WA 4B5VA 1V02E 3WLHA 4JTSA 4UMCA 3BG3A 3LRKA 1B9BA 2NV1A 3FKRA 2GL5A 3T2OA 1DXFA 1W1PA 1ELSA 3AJXA 3RNDA 3FA5A 2PRHA 5CPTA 5C9RA 3P0WA 2QYGA 2Q6ZA 4HZ8A 2GQ9A 2RFGA 4K8GA 4KEMA 2GLKA 3MUXA 1JIBA 1XCFA 2J47A 2DT0A 4PFHA 5FESA 1PCWA 1IZKA 2GGJA 4GUGA 3VO0A 1D8CA 4ZFMA 4RV3A 3U4AA 4LAOA 3FY1A 4Y9OA 1IT7A 5CAKA 2WK2A 4NZ5A 2JF7A 4H9YA 3AIWA 1E4LA 1CBGA 4GHRA 1C8YA 2VUNA 3ZWTA 3V5OA 1NM9A 3WQCA 3FHAA 4C6CA 2XWDA 5EMJA 3W87A 2QULA 1U5JA 4P2VA 2WVTA 3VU2A 3TCEA 2QJIA 1I1XA 1CGYA 4NYYA 1R3WA 2F9RA 5FJOA 2ODOA 1JCMP 2OWXA 1W32A 1XQLA 4S3EA 4WGHA 1ZENA 5EU9A 1ITXA 2CLIA 4QEEA 1RXOB 4KWVA 2W5FA 3VINA 4DX3A 3W53A 2YL5A 2VD9A 1T6MA 2CXEA 4AZHA 1Y5WA 3BAXA 2X40A 2X2GA 3K4DA 1FA2A 1JQXA 4Q8PA 2W92A 2QNEA 3ZSTA 1V6XA 3MANA 3M5YA 4DB7A 3U8GA 3POCA 4LS0A 1Z7AA 2HVOA 3VNKA 3E2QA 1GJUA 1PYFA 3LX9A 3S6DA 2FGBA 1VH7A 4B92A 9XIAA 4CCEA 4FA3A 1S1PA 2Y7GA 3STFA 3EYPA 1G7UA 3TYUA 1W1IE 3H55A 1F61A 2GDUA 2NX9A 1GOKA 1R3RA 4P8UA 3KCJA 5B7ZA 2YZRA 5CCZA 3R11A 2WZMA 2BP1A 5ABFA 4R7WA 1EOKA 3S83A 3LBCA 2GGGA 3GXFA 4ZSTA 3CNYA 4CNNA 3W7CA 2P3ZA 3B8DA 5MF5A 4BI7A 1K7FA 3UY8A 2WAGA 1LWIA 3M0XA 2IXUA 4EF8A 1GTEA 1XLMA 2WCGA 3NEHA 2Z2BA 1QI2A 2WBGA 2ZQ0A 3ZJ6A 3VGEA 3NCOA 1LLWA 4H6EA 1DWJM 2ATSA 3BJFA 1KGUA 2XISA 4DJDD 2YLAA 4Q4QA 3Q58A 2TMDA 2POTA 2PTWA 4AZ5A 1P0EA 1QXLA 1FQ0A 4OTKA 4ECLA 2GZXA 4A6GA 4Q22A 3I65A 3ARXA 2WSRA 2E6DA 3DAQA 5DMYA 3RCYA 2E9LA 5K9CA 3BCDA 3DFSA 2BDQA 3EX3A 4PSRA 3PPFA 1SU5A 3BZJA 1LTDA 4CN6A 5AECA 3FW6A 2GGIA 4YYCA 2NT1A 2QS8A 3M16A 3O6YX 3QPZA 4PCNA 1XLBA 2VGIA 1UD4A 5AZ0A 4DUVA 1L0PA 5LGXA 3ENLA 1SJAA 3H7RA 3B06A 3NSNA 1GONA 1E9ZB 5JH2A 2NV2A 4MMWA 5K4ZA 2PC8A 2PRLA 3N13A 1WDSA 3GY1A 3SRHA 4RV8A 3M0YA 4MLRA 3V5CA 2HK0A 4KBXA 1OF6A 2YDAA 3O07A 3OYXA 3BLFA 3BK0A 5A8GA 3AFBA 3RDKA 1LF1A 6XIMA 3QXBA 1AUSL 5SWUA 3KBMA 1V6UA 4H01A 3GAKA 1ADOA 3QY8A 2EPMX 3NQCA 5JU6A 2WLYA 1NSJA 2D2JA 4L61A 4KPLA 3L5MA 2UV8G 3E38A 1YLVA 3TUUA 3RCMA 3IJLA 5GNXA 4QIUA 4DYKA 4AY1A 2FKPA 1A5LC 1MUMA 2WQPA 3WDHA 1H62A 4A8LA 3W70A 3GU1A 3C2VA 3LZ3A 4JCLA 3GNDA 4M7TA 1SW7A 1ZU8A 1MZHA 1K9TA 4V1YA 1PS9A 3P74A 5BXTA 4MKVA 1TCMA 4IXXA 2P50A 3VX1A 1YDNA 3ABOA 3TSDA 2VDGA 3SGGA 3B0PA 1XBXA 4TTUA 3NG3A 3TVAA 4QFUA 3W88A 5G2WA 4NRRA 3QBUA 3BGGA 3LERA 4MYAA 4RW5A 2ZX5A 5FACA 3GSMA 3LSBA 4PC8A 5DRCA 3VI2A 1B3VA 5I3HA 1GOIA 3EA2A 3B9NA 2CITA 2VZSA 4HJWA 4PEKA 1KM0A 1ZAHA 2OTDA 1T40A 5LXEA 1UBPC 2VD8A 4AEOA 1JCLA 4AEFA 3DHUA 1O66A 1ZZMA 1MRAA 1XYZA 3NQ2A 2ISSA 1M41A 4J40A 3EOEA 1ITCA 2Z1SA 4GQRA 4BF9A 1WP6A 2QJHA 1I9CB 3NL2A 3G6MA 1H09A 4O15A 2W61A 3UR5A 1GZ1A 3M0KA 1IR2A 1PKYA 3OZMA 1XD1A 4MOZA 4MLJA 2WSYA 3S9ZA 3XISA 2BV9A 3C52A 1T8QA 5C0QA 3O7UA 2AAMA 4XVDA 4PUKA 1FTXA 1TKKA 3O8AA 3EDFA 4I6VA 3UG3A 4AU0A 3LHZA 1WKFA 3PP7A 2ESCA 1R86A 3CL7A 3I10A 4ZB5A 1PAMA 2Y85A 1AH3A 5BMWA 1V0KA 4NNAA 4ZOEA 4IIDA 4C6PA 3VNDA 5M5DA 1TTJA 3CZ8A 3B40A 3GXTA 3KRBA 2OGYA 1S5VA 4DI9A 2OOGA 2HTMA 1AJZA 4UOZA 2V67A 4HMDA 3WENA 1KO0A 1PHQA 3MSGA 3ANVA 3BL3A 3CQIA 1UZDA 1TPVA 3BQ6A 1FP8A 1JPKA 4LANA 2PWUA 3IAPA 2VNCA 3FNDA 4GG9A 4L1WA 3WLOA 3M5VA 4DM1A 1XS2A 1LLZA 3ARPA 4LAKA 3BTNA 3C4UA 3KRUA 4GLEA 5CJMA 3ZT7A 2KX9A 3S42A 3LCWA 4A8RA 2GJXA 2I5QA 4LNYA 3K46A 1OZQA 1K1DA 4ES4A 1V6WA 2XSXA 3EWDA 3AS0A 2ZX9A 2WMIA 2ZZ1A 3R6IA 4H6KA 3AICA 3C0SA 1LT7A 4HMNA 4UZSA 3ECQA 2ZOXA 1EA0A 3EX2A 2A1YA 1OF8A 2XVLA 3WF1A 1OGGA 4RPQA 4XWUA 4JCMA 1TWWA 3IGSA 3VTRA 1V7YA 1HKKA 2GJRA 2LLEA 3VOCA 5BW6A 4ALDA 4J28A 5LNSA 1FDZA 4O54A 4W88A 3WDQA 1SGJA 5G1TA 3EOSA 1LJYA 2P0IA 3R4IA 4IPNB 4QM1A 3APYA 1R7AA 3SQMA 3WN6A 3MQTA 3NXLA 2H3BA 1OCJA 5G1MA 2INEA 3W29A 2VXNA 5AVNA 7TIMA 5DY3A 1R9XA 3W7RA 3AI0A 3FS2A 2QJMA 4R7JA 5FF3A 1D8WA 4W7VA 4LQ1A 3POHA 4US5D 3SI9A 3WK2A 3S8HA 2HS8A 3WQWA 3UXIA 3N2CA 1E1CA 2HS6A 4ZOCA 1VLWA 2H9AB 5C8BB 3F4WA 2PDLA 1TMLA 2YBTA 4UQEA 3CAKA 3NQGA 3IJ9A 1QDSA 3A3XA 2H3DA 3MZ2A 4WQ6A 2G97A 1YBQB 3BJSA 1V3IA 3GE7A 1WV2A 1X96A 5BNKA 1WZAA 4A3RA 3LEPA 2FZBA 1BHGA 1CGUA 4DJED 3NM1A 2WCAA 1H41A 3I4EA 1XCWA 3MKCA 1IEIA 3DBPA 4LTSA 1BLIA 3BSHA 2PF0A 2BOFX 1JCXA 3AS3A 1XDLA 4GYFA 3S1XA 3N9SA 4L80A 4LJ3A 3VIGA 1DJWA 5E09A 3GHUA 1IGWA 1SJCA 1FBAA 2REQA 4FR6A 1AMKA 3GFZA 2YSWA 3A4WA 5C6MA 2VX5A 1UWTA 1EBGA 4P8VA 3DU0A 1QNOA 3GFXA 3LHUA 1IWPA 5FI8A 2WKJA 2PP1A 2CZFA 4NAEB 2X0SA 3TFXA 2NXIA 5MHBA 4ZGYA 2EPHA 3DH7A 4GY7A 5DMNA 2D3LA 4TX9A 1GVIA 4ATWA 5HNTA 4TO8A 1WZMA 1E9IA 3V35A 2IKGA 2V5JA 4GNVA 4DVOA 3VUPA 5FF2A 4C1NA 4MY9A 1E43A 3ERPA 2CZDA 2VR2A 1OT2A 6CGTA 1V7AA 4AX7A 3R0UA 1GWJA 3ZR5A 1F5ZA 2PDPA 4YLWA 4GQGA 1C90A 2NSOA 3VOFA 3PBMA 3TC6A 5HXMA 4F9DA 5AZ1A 3W84A 5F2GA 2E09A 1FOBA 4JAWA 1W9DM 1OINA 1GVQA 3TSMA 2WKLA 1OSEA 3UW6A 2ZUMA 1YTDA 3UBPC 4M5PA 2R8WA 3I6RA 1UCWA 1YNPA 2J74A 2X1UA 4CCCA 5FD0A 5FF0A 1Q6QA 2E5CA 3G3MA 4LSBA 4GACA 2XFRA 3LHWA 3P7YA 3HQOA 3BW4A 1VRXA 2Z6IA 1FDYA 5DO8A 2A4AA 5AHLA 2PBOA 1DHPA 3IK2A 4Q7IA 4OUIA 3T9PA 3A12A 5C2CA 2NWSA 5DXYA 3BMXA 3SUUA 3WJZA 5XIMA 3VDCA 3MW7A 1MNSA 5HR6A 1IE7C 4GGBA 2QV5A 2PLCA 1I0DA 4E2DA 3ZFHA 3H2MA 4IM4A 4KQNA 2FGZA 1QBAA 2YXXA 3SSZA 3VIOA 4EPEC 3VD5A 3DC0A 4MWAA 2DSZA 2Y89A 3H54A 3IIZA 1KWGA 3PG8A 1KCXA 3ZZ1A 1MSSA 4REQB 4B15A 4ZQPA 4M56A 4R7OA 5KZDA 1Z6KA 2PI6A 1W1ZA 4GXWA 3W76A 1XQKA 2AQWA 3EGJA 3BGAA 5E6ZA 3GHTA 4HKPA 3AIUA 3BMWA 3NQVA 4XAPA 5L9FA 3WNPA 1JI2A 4QR6A 2QCMA 4CU7A 4AYSA 2FFCA 2VC5A 4F0KA 2GDQA 3N4EA 6A3HA 4Y9MA 4GIAA 3N2MA 1BXCA 3BCFA 3GDTA 1XFCA 4LNCA 1IF2A 3BOLA 3F1QA 4O57A 3UCQA 3LYEA 4JHZA 2E3ZA 4Q8VA 2Z0IA 3GH4A 2CHOA 4Q7NA 1LL7A 3C8FA 1VPYA 4J1OA 3SFWA 4QEHA 4JKLA 1OYCA 2CETA 3EOOA 2EPLX 4K8EA 2I1OA 2WMGA 1Z32X 4RDYA 1LL4A 3HFYA 3W1TA 4GVIA 2RKXA 3LV5A 1KXQA 4LF2A 3UT0A 3EWWA 1LP6A 5J5RA 1F9CA 5CQ1A 4IMEA 2MANA 5LIYX 1B1YA 2BVWA 2OXNA 3GR8A 3NXFA 2FQIA 2RH9A 2E7FA 3VMNA 4KFPA 4K2SA 5DT7A 3VILA 5C9ZA 4Z2KA 3RM8A 1T41A 1HN1A 3UJEA 3C5QA 4WKFA 5CG0A 2XUCA 3MWAA 1FHUA 5D02A 2D0GA 3GYCA 2NUXA 5FF4A 4GK8A 3TMQA 2HRWA 5JQ9A 2V3FA 1VJSA 5REQA 2Y7FA 4BWLA 1S3HA 1ISZA 3QFEA 1V02A 3G8EA 1Z8AA 4IIHA 1ZSXA 3GIQA 2VEFA 4EWND 3PPCA 1W1YA 1DWGM 4LYRA 3BW3A 4MY8A 4CQBA 1H1YA 2HCVA 3AO0A 2BXYA 5G2IA 4Z2JA 3UPWA 2WJDA 6REQA 4S3AA 1AA1B 1UIOA 1FWFC 2GUYA 3O6AA 4F0SA 4S3DA 4MSSA 4AZGA 5DMMA 3AAMA 4GJIA 3P0XA 2Z25A 1V03A 3OQ8A 2H6RA 4L4LA 2B31A 2DU2A 4GA8A 1W3IA 4FIQA 4LAMA 1YADA 2NQZA 3RHGA 4X2PA 3P8JA 1OFEA 3T2QA 4PZVA 1JDDA 1A5OC 4MADA 3VZYA 1R6WA 3QKZA 4B9ZA 3WUEA 4D72A 3IK4A 3CHEA 4FO4A 4EXBA 4WLCA 1NJJA 1QPRA 3QY6A 4YCPA 2CERA 1EQCA 1TVNA 3C2OA 4FLOA 3UFYA 3PTMA 4OJYA 1ADDA 4KIEA 1H61A 4ZTYA 3UETA 5T9BG 4M82A 1VZWA 4NI3A 3BCJA 3EDJA 3F5LA 3R58A 3IAQA 2VGBA 2DZTA 2J79A 4E4PA 3HG4A 3V36A 1K8ZA 1GNXA 4IGSA 4FNQA 3HGOA 3WUFA 3L0KA 2VDIA 1CLXA 4QGCA 5XINA 4WOZA 1WDWA 1WAWA 1BVZA 2PU1A 3R13A 3KZSA 2BLEA 1MFVA 4RE0A 2AMGA 2V38A 1OM0A 2DIKA 3SZ8A 1UC5A 4F2TA 1IT0A 5AHIA 1A5NC 4GBUA 4GOAA 2OSYA 3MA8A 3V1HA 1S2WA 1W56A 1M7XA 4WEVX 3VMPA 1EUAA 4UQCA 4TMBA 4Y6GA 3MY9A 2VGGA 1JAEA 1LG1A 2G50A 4N0RA 3ZJ7A 3KXQA 1QNQA 4W8LA 2VP8A 3W1RA 4KFOA 8CGTA 2BMBA 4JICA 1HKVA 1LDCA 2FZNA 4Y9PA 2VFFA 4S2BA 5CC7A 1PKMA 4H19A 5JUVA 1OADA 2ZUSA 4X2RA 1UD5A 4PODA 4DJDC 2DSKA 7ODCA 3ZVIA 3U57A 1VFUA 1KM4A 4OGZA 4GO9A 1QOPA 1WDQA 1AW2A 4QS6A 3WLNA 3BZGA 2AQOA 1C93A 1XLJA 3EOUA 3FJLA 3V0UA 1GVEA 2ISWA 3W85A 4O4WA 3W9ZA 3VNMA 3OBEA 1M7PA 4RX0A 3C0QA 1F74A 3N6HA 4DWSB 3UCDA 3PVFA 4J3UA 3GU9A 1K3UA 4NZFA 1KGWA 1LORA 2O9OA 4Z1YA 2VYOA 2P1FA 1BWLA 1NDYA 2WYSA 1E3ZA 8XIAA 3FDGA 3GR7A 5E70A 1C92A 4MDPA 1ISYA 3UA4A 4GYKA 3CUHA 1R87A 1B30A 1W1A1 1JDFA 2IMRA 1EJTC 2I16A 3ITGA 3APTA 2ACSA 4H83A 4OBTA 1ZBCA 3DFQA 1YPIA 3NOYA 1XLHA 3P82A 1JUKA 2BSLA 3KOXA 4S3CA 1ICQA 5FIPA 2YCJA 3AMLA 1J0IA 4KCWA 1ODUA 5HJLA 4JQ2A 2BVDA 4NX5A 1EXPA 2R6OA 4LALA 2ASHA 1K8XA 1UWIA 3NR0A 3RCNA 2DUAA 3U4FA 4XZBA 1KM2A 3CAQA 4XBSA 1GQKA 3VMOA 1TWSA 3W1PA 3S4TA 5HWNA 1E4IA 2ZUNA 4WJEA 5HANA 5C2GA 4XZIA 1P0KA 3MSDA 3WDIA 4B3KA 5LXXA 3OJGA 1PZ0A 1RJPA 4LUTB 4W8BA 3L4TA 2H90A 1W8GA 1W54A 2O4QA 4PB5A 4HA3A 2R9RA 2V2HA 4NNBA 1J79A 1KR0A 4WR3A 2C1IA 3UJ2A 3DZ1A 2P0OA 3UWZA 1AH0A 3BPWA 1LQ0A 1Q5MA 2C7FA 1EO7A 1BSLA 2ZX7A 4PGLA 2PDUA 3LS9A 2NXHA 3QLDA 1PDYA 2YB4A 4P7LA 4WXZA 4IMFA 3UPBA 1A5SA 4D6DA 4J3VA 2OZ8A 1DHKA 1VBHA 3RK8A 2INZA 3RU6A 4H3DA 4I3GA 1QWKA 3H2CA 3CV2A 3CPRA 1AQMA 3UYCA 3QTPA 3ZSSA 4BFAA 2WSKA 3OBAA 3MSYA 5D38A 3GXDA 1RLCL 1T7LA 3IV3A 2OX4A 3C2YA 1B57A 4PTDA 4Q32A 3N9RA 3GXNA 2PB1A 2WQDA 3E2VA 1R9ZA 4PTVA 1ENUA 4XZHA 2YJQA 2I17A 4M7SA 3ATZA 4X60A 1LRTA 3EWBX 1TWZA 3H2EA 4H41A 1GOQA 4V2XA 2Z1WA 4O50A 5I5RA 5G4WA 2BXVA 4AY8A 4WD0A 3UP8A 1XYBA 3GNOA 3IS4A 3L5AA 3E02A 2I9EA 3H7UA 3VZXA 4HTBA 3KUMA 5F4SA 5CLTA 5XIAA 2Q71A 1V0MA 4HOZA 1R3SA 3QHOA 2FB3A 5C55A 5M3WA 2JKPA 3EDDA 5DFAA 2VWTA 1W1TA 2PRMA 3TTOA 3TQKA 4MKSA 1LCOA 1KLZA 1JEZA 3SGUA 2BFGA 4BF7A 3ARRA 3WDJA 2ACRA 1H7NA 3OOQA 4LYKA 5FAGA 3E9AA 4EF9A 1ICSA 4Z08A 4I9JA 5BRBA 3ARQA 2PDXA 4W84A 1TREA 3TYCA 3GXIA 1X8CA 1WOBA 5BZAA 3PFRA 1OCNA 3E49A 2YR1A 5CZJA 1R30A 4D6FA 1ZPTA 3KRZA 4YTQA 2F8QA 4M1RA 2YCLB 4U2YA 3RUBL 4DO4A 1EWEA 2Y4SA 4HQVA 2NLYA 3W86A 1H49A 4AVOA 2AKMA 2QAFA 5DCBA 4YCOA 3K4AA 2ZCGA 1H11A 4NJGA 2A3CA 2OGJA 1W6TA 4L6DA 4C6IA 2J13A 5CPSA 3H24A 2ZTJA 4XUGA 3E96A 3GAYA 4O19A 4RCXA 3NQ6A 1UG6A 4QP0A 3TH6A 4GYJA 3L2LA 3CMFA 3PWIA 1RPXA 5HATA 3MMWA 3CWNA 4GPNA 2PLJA 1H5VA 4DLFA 3VFCA 2X09A 4A21A 3HM7A 2DVUA 1KBBA 4LUJA 2QEZA 3WLIA 2P88A 1TE1A 4H2CA 1YPFA 1QPNA 3E12A 1YEYA 4PCSA 1TWDA 4S23A 5HWJA 2PU0A 1G5AA 1EFZA 5AHEA 1FXPA 4JHOA 3XINA 2QJJA 4EOUA 3GX9A 1E4NA 4QJ4B 4CD5A 4PFMA 2IPFA 1XH1A 4J3SA 4LBSA 4Z1AA 3EPMA 5EFFA 4QG6A 1R3YA 2HJPA 3SRDA 2QMJA 5I06A 1DIDA 3KVKA 5G4HC 1LYXA 2Y61A 4B4FA 3GVQA 4R9XA 2AGKA 3R89A 1ZLPA 4DUOA 1QPOA 4QSFA 1O5RA 4JS3A 4WIWA 3VKBA 1O5QA 5IFPA 1ZHAA 2FJUB 1N7KA 2DT1A 1IHIA 3C86A 3EOLA 4E3TA 1WBHA 3R8RA 3RPMA 4TX6A 3T81A 3MV11 2GUBA 2ZVIA 3S6OA 3BAYA 3OLGA 3A9IA 4XTIA 2Z24A 3NURA 5IXEA 3W7DA 3M43A 2EGZA 3CUZA 1MEWA 4S3JA 1IXNA 1XRVA 2CHNA 3T08A 2HZGA 2XN1A 5K4XA 4AUBA 1VS1A 3KOWA 4MPQA 3GDLA 1MO0A 4I90A 4PMRA 3K8KA 2Z1XA 4W7UA 2WWDA 1XIHA 1RV8A 1OX6A 1YRRA 4MAVA 3W2LA 3WJYA 4GNKB 4AF0B 1RJRA 4FF5A 5BWAA 1UZ4A 3RF9A 3CWHA 5LGZA 4G2DA 1DWAM 1UB3A 2ZADA 2VURA 3D46A 3TDFA 2AQVA 4LBUA 3ARUA 4ZOAA 1XIFA 2W0UA 2P8CA 2ZUTA 4NI8A 2J77A 3GIYA 2H8ZA 3T6CA 1XG3A 3GS6A 4ZVJA 4V1XA 3S46A 2XFFA 2WZIA 4ORMA 3TN5A 2YCEA 5CAHA 2WW5A 3LQGA 2W3ZA 2XHYA 2E25A 1WUFA 4GY1A 5DF0A 1XUUA 2G5WA 2J9XA 2PTXA 3LN3A 1PL9A 1Y5XA 3WQOA 5LA0A 2GVYA 3GFYA 5I3IA 4JX4A 3W2UA 1PTGA 2Z6JA 1LUCA 4M81A 3ABQA 3CYVA 1KNWA 4XG1A 1VJZA 4JTFA 2YFOA 2OZ0A 1TV5A 2PP0A 3SCTA 1KC7A 1Z3NA 4FNRA 2FHFA 1CLKA 4LFYA 2A7RA 2WNNA 1KKOA 4HHPA 3K8MA 3QV8A 2AMXA 3GG8A 4NY2A 1DIOA 4IFOA 2ZA3A 3PUOA 1BF6A 2EKCA 3IVSA 3HPZA 4H7CA 2PZ0A 2XH2A 3NFUA 4F2UA 4U33A 3RAOA 1X7FA 2UY5A 4ERGA 1LRNA 3I4KA 4R9OA 3WBXA 4PMOA 5A5WA 3N4FA 1MW1A 5IDIA 2VM8A 3HPSA 3WL1A 1POJA 2D2GA 3ITCA 5DLCA 1T5AA 4DUXA 3MYOA 3O63A 1B54A 1DYSA 3GW0A 1B5TA 4LGXA 4L4OA 1R47A 5H1WA 3URAA 1B90A 2AL2A 2NQLA 1KB3A 1BPLB 1C3FA 3PSWA 5HBFA 3G1RA 4WSKA 2CZEA 3PAJA 4XSMA 4DXKA 4HZ7A 2D20A 1XSKA 3T4WA 3B9OA 4EKJA 3WLJA 2XGBA 4TX8A 5AHMA 2CIPA 2O92A 1MXGA 2QAPA 1OVDA 1TMQA 2G3IA 2W62A 3GKAA 4BZYA 2C6QA 1P6BA 3OZYA 5HQLA 4GKLA 2ISFA 1XD0A 2CLOA 3GQYA 4ZTXA 2WHLA 1A5BA 4MB1A 5HMFA 3CS2A 1EIXA 3NWRA 1RCOB 4CU6A 1BWKA 3R12A 5F4WA 4H7VA 4ZMGA 1CNVA 1DOSA 1NU5A 2WSPA 4PBGA 3V3WA 3LCGA 3A23A 6XIAA 3W26A 3IIOA 3VD3A 4TV6A 1L6YA 5D30A 5A8PA 5G4EA 1RBLA 4JIIX 2HISA 4IJCA 2G37A 3AIBA 1YXDA 3ISIX 4XO7A 2WHJA 3CAWA 4NAFB 1KM3A 1GKPA 3HGSA 1US2A 1B3XA 1VRDA 3HPAA 3OO2A 1ZFJA 3BH4A 5C2XA 3WQVA 2YW4A 2WZTA 4ZE5A 3RN6A 1KTBA 4TU1A 2IW0A 1BEUA 3I3EA 3DGBA 1E0TA 4X22A 2KAUC 2PD5A 4JTGA 1IEVA 2Y5SA 5HA7A 3OBKA 5LNRA 1A5CA 1ZGDA 2UBPC 4D8ZA 4QJ3B 4IIFA 1D7KA 1XIIA 1PWMA 1TWIA 4FOKA 3HQNA 3FAWA 3KE0A 2I9UA 2QPXA 4I7VA 1WDDA 3EWUA 3DDMA 4XO6A 3HA1A 3QN3A 2FHCA 3B8UA 3WMLA 2X1RA 1XLIA 2A7NA 3ONCA 3AYRA 5ECUA 3GYEA 3WQ4A 3EAUA 4CU8A 1E0WA 1XLDA 3F4VA 1TX2A 1HUVA 1BTMA 1VBGA 1L6GA 4IGNA 1RVKA 1FP9A 4IHCA 4MZ1A 3VE7A 2X0YA 4XISA 3FLUA 3T4CA 4IIEA 1V93A 3V0TA 1HF6A 1CGVA 1LT8A 2CBJA 4QE5A 2QCLA 2Z28A 3MCNA 3LLXA 4LYPA 1PX4A 1W3KA 4JHMA 1QTWA 3T05A 2YLLA 2E5BA 2ACQA 1HKIA 4N9CA 5CJ5A 4LW7A 4YTRA 4JTJA 4CCDA 2D22A 4S3GA 1G6CA 2F2KA 2JIWA 4NXKA 4FPSA 3IGXA 3VDAA 2Q8XA 2G4JA 2UZ9A 1DV7A 2JALA 4DZ5A 4HHLA 4GI4A 4WF7A 5I24A 2ATMA 1XKJA 3ZM8A 1JL8A 1H2JA 1JUBA 3D47A 3BDKA 3VA8A 2Z1KA 5AYXA 1W8SA 1FKXA 1TV2A 3QSTA 3PTQA 4NZ3A 3WLPA 5KINA 1ECEA 1B9ZA 1DIEA 3NGFA 5JIWA 2ZRWA 4UTHA 1A4LA 1TZZA 4WY0F 3ZQ9A 1NDZA 3TR2A 1O95A 2X05A 1Q2RA 3MS8A 4UTWC 4LAZA 3WUBA 4PMYA 1LRQA 2PAJA 1XG4A 4GIRA 4ZSUA 4DXXA 2CFFA 5U4NA 4C1KA 3TR9A 2CLLA 1EC7A 1JCNA 4PMNA 1OC6A 3SJ3A 4FXSA 3NYZA 4UXDA 1VHNA 1J12A 4W4QA 4ZE4A 2AKZA 3WBYA 2O9RA 1HG3A 1Q45A 4Y96A 3R25A 3ORWA 4PB3A 4MB3A 4B2DA 3GH7A 3AISA 3R8HA 4YTTA 4R5EA 1UWQA 5BROA 1S39A 4UQDA 2HE5A 2OQLA 3GRIA 3GG7A 1MQRA 3T8LA 2V63A 4JTQA 4E8CA 2OB3A 4TVDA 1X6NA 2WVSA 3JZUA 3MUZ1 2O56A 3C2EA 1DP0A 1UIPA 1UPPA 4JIQA 5AY7A 2DZAA 3WQ5A 3TMLA 3LA4A 4J3XA 2WJEA 5IHSA 1BAGA 2WVVB 5BOEA 5KMYA 4KFNA 1KCKA 2HVNA 1W3JA 4Z0JA 5EYWA 1KRCC 1IIGA 4IWWA 3KBJA 4IPPA 1MDLA 3ONBA 2G3MA 4HK5A 1XI3A 4QS5A 4MJZA 2PC4A 3LPPA 2AOSA 3T42A 3VNZA 3ATYA 3W07A 1RH9A 2QCFA 4IP4A 3TSBA 3QGAC 1W3TA 4JTDA 1E40A 2JBMA 3BW2A 3N15A 3VAVA 4HPHA 4QROA 4MJ2A 1FRBA 3A5VA 3KBNA 3LPGA 4UR9A 1MW0A 1QFEA 5BRQA 5CBIA 3R8GA 4RNFA 4OOZA 7XIMA 3CIVA 1EL3A 4P5UA 3FV9A 3V0SA 4UTTA 2WV8A 1MEHA 1V0NA 2B0MA 2QUUA 4TR9A 1LQAA 3LBMA 3UYIA 2QMKA 5HJXA 2FTWA 1XLLA 6PTDA 1OFAA 4S39A 4L56A 2VRKA 3E0WA 5FEZA 4XKMA 4X63A 4JBRA 1J2WA 2NVAA 2F38A 3AWNA 3OG2A 2X7WA 1GQJA 5AC5A 3LRLA 4GWEA 1F8MA 4GH3A 4YVVA 3N73A 4AD0A 4WXYA 2IPWA 1O5XA 3MDWA 3CTTA 3NDOA 1YW1A 1NQ6A 1EO5A 3EPNA 2CXGA 2WLZA 5K7JA 3EEZA 5A8QA 5CBBA 1EWDA 3CK5A 3N4AA 3FX4A 3L4UA 4MWAD 1E6NA 2BY1A 1T96A 4JTAA 3GTHA 3BANA 4KH2A 3SQLA 3XIMA 3PNZA 4XKYB 3ARTA 1E0XA 3U0HA 3WQDA 4X9SA 4WGXA 1A53A 1BQCA 3KTCA 4HPJA 3IGHX 3MO7A 1WKDA 5EFDA 2NVCA 1XUZA 1Q2SA 4X61A 4HMCA 4U2ZA 1CI1A 1W1B1 1PX8A 5I7GA 2D0FA 4LUTA 4H4IA 3QJAA 3NZQA 3A13A 3W71A 3W7NA 3QV6A 1JPDX 4AW7A 2CBIA 4AISA 3HO8A 2RGMA 1HJSA 1PCKA 4L6OA 1E6ZA 4AWUA 1FFRA 3LQLA 3SCPA 5JBFA 2XFYA 3CC1A 4I7UA 4D71A 4IF2A 2WANA 1BWVA 2Z00A 4FNPA 3CEUA 2X1IA 4QG8A 3OA3A 4AIEA 4O1AA 4Z2HA 3KVMA 3B04A 5FF7A 3QC3A 4JIPA 2OT1A 1EF2A 4PBEA 2W79A 3CB3A 3ZVHB 3REQA 4OHQA 5HWMA 2BB0A 2WOQA 2A3HA 3AMKA 3SCOA 1EHNA 3WX7A 4DWDA 2J25A 3IARA 3KP0A 4GCAA 3P5ZA 2Y0FA 5DCEA 2VFEA 1RR2A 3RJXA 3A3WA 3TAKA 1E5JA 3VNJA 4O11A 3U2EA 3DG6A 3TKFA 1JCTA 1DTUA 2HWGA 1SMDA 1E71M 1XIJA 3O16A 3FVMA 1HX0A 5I23A 4F2BA 1CCWB 3EB2A 4F8XA 1EB3A 2WO5A 2WZEA 1R8LA 4HU4A 3E0LA 4QHRA 2OCZA 5FJRA 5FJIA 5CPQA 3DXIA 4GI6A 2QZRA 2F6UA 1YXCA 3NVDA 2VX7A 2DIEA 4H9XA 5LA2A 3WKZA 3FFSA 4H6RA 3K8LA 4ML4A 1KTNA 2QCHA 3V1PA 1CENA 3O1NA 1RCQA 2QUMA 4LRSA 3OGRA 1OX5A 2FJKA 5LNWA 1JUEA 1TTIA 3KFTA 1DQUA 4W7WA 3ZLGA 1PIIA 1YQ2A 3DHPA 3WF4A 1SR0A 1FWDC 5TAOA 4M51A 2J78A 4CD7A 2JGQA 2DSVA 1F3EA 3RXZA 3NL6A 3VIMA 3WEMA 2ZZ6A 1O68A 3B0VC 1IT8A 5M03A 3NDYA 1QNPA 3FEQA 4C7GA 4KGJA 3R0DA 1TQXA 2XIBA 3CZLA 1K7XA 3GC2A 1UKSA 1OJXA 5E0FA 5MKGA 4DO5A 2PDQA 3V5FA 3W3OA 5DRIA 4UTFA 4FXRA 5T26A 3B9DA 1KTCA 2DH3A 2ZICA 2NSXA 2E68A 1GG1A 5LIXX 1JZ6A 1P5BA 5DBTA 3CUFA 4FR1A 3R0KA 1AVAA 2J88A 3OZPA 1LOLA 1FCBA 4H6QA 3E1F1 3T55A 1US0A 2YDSA 3QEZA 4H2HA 3IJDA 4A8NA 1PWLA 4P8XA 3NA8A 4L9YA 1XWYA 1KRAC 1Z48A 1TX0A 4K39A 2ZVRA 4O13A 5CC5A 4HNNA 4MHBA 2DW6A 4L64A 4TV5A 4GISA 1AQFA 4GMEA 1QNVA 3NTYA 5E6YA 3SY1A 4GC4A 2AL1A 3Q2DA 4WKAA 3OYZA 3DKLA 1MI3A 2JFEX 4MZYA 2WB5A 4LY4A 3CZGA 2PGFA 4C6NA 3ITVA 2QJGA 4MM1A 4OBSA 3NYDA 4B5WA 3W72A 5FL0A 3HIJA 4TOQA 4O1DA 3HN3A 2XJ7A 3A3HA 3OLIA 3TW9A 4PSPA 3UGRA 3MI3A 2A6LA 1XH2A 1R3TA 1A5UA 1MUWA 5TIMA 5AKQA 4ZA0A 4HVXA 1XLKA 2QPUA 5DBUA 3BLEA 3MYPA 4EPKA 4XAGA 3WH5A 3NZGA 3R43A 3S1GA 4NXSA 4C5ZA 3KTXA 4LVGA 2CYGA 3PM6A 1PDZA 3WY1A 2D73A 4AIUA 1Q6LA 3W1NA 3O0FA 1QOXA 3L66A 3TOYA 2FVMA 3FAXA 5A69A 3UNDA 3KW3A 4O14A 5KEZA 1NWTA 5TBOA 4GVFA 3KDOA 4BHYA 3WNKA 2WMJA 1C9DA 1Z42A 1FH9A 1J96A 4G56A 3SBFA 1QW7A 4XAFA 3M0LA 4L7ZA 2DJLA 3LGDA 3W73A 5D8ZA 1F3WA 2DEPA 5CZTA 3O6DA 2VQUA 1RD5A 3GTFA 3VIIA 1O94A 3WFAA 3UR2A 1UR0A 1JDAA 2G41A 1UWAA 2J66A 4PB4A 4AIOA 5LA1A 1E6SM 1DIKA 1CW2A 4GZJA 1NQKA 1EP2A 1DJGA 2GWGA 5JVLA 5H8UA 2MUCA 3SO7A 4PA8A 1P7TB 3N6QA 1OFPA 1Q85A 3V18A 1RJQA 1XIBA 3NAVA 4O0QA 3PFMA 3VKAA 3QFWA 5BXRA 2DY3A 1NP2A 2G4FA 4S3KA 4MZ8A 2ZXBA 3M1ZA 5A94A 1ONRA 4DBSA 1HO1A 1UUQA 3DFHA 7TAAA 3L4WA 5IM51 5HAOA 3CUXA 2DP3A 1Y65A 3UA3A 3W7PA 3UR7A 5F1VA 3L0GA 2VFGA 1FHLA 1Z69A 2X7VA 3C2FA 2ZRVA 3NPUA 2RAGA 3W23A 2CLEA 4UMAA 1R2SA 3UWYA 3G24A 5B7YA 2EBNA 4PUWA 4ASTA 4PUJA 3EWXA 3BLLA 4C6JA 1DJIA 5CC3A 4KIRA 3VOHA 3TJIA 4Q3MA 3MT1A 1K03A 1GOMA 2ZRUA 3W7MA 1W0MA 1UZ1A 3GLCA 4MNKA 3WLRA 4LC6A 1W91A 3WD1A 1JXJA 3KBWA 2V82A 3CAVA 2FTYA 1M7OA 2J7HA 1AK5A 1J2BA 1J0HA 4HU0A 3NOEA 1XLFA 3BOFA 4MWAE 3CH9A 2W27A 3PZUA 2O0TA 4GZ7A 4MUZA 1T8XA 2PBGA 3UZJA 2QPSA 3IPWA 3A4AA 1TE6A 1TUXA 2J6VA 2J7BA 1JZ5A 2R14A 1FWWA 4O8AA 3E2SA 5JBDA 2XVKA 1EDGA 5I3DA 4GQ0A 1HJUA 4AX6A 5K3VA 3R2GA 4KS0A 4L1GA 3THQA 3VC6A 1FCVA 3PZQA 1JD7A 3GTXA 3MWCA 1XBVA 3HG5A 1EP3A 1H60A 3EWYA 4HNOA 3QOMA 4DBUA 4R88