4AU0A

Hypocrea jecorina cel6a d221a mutant soaked with 6-chloro-4- methylumbelliferyl-beta-cellobioside
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXOGLUCANASE 2
publication title Rational Design, Synthesis, Evaluation and Enzyme-Substrate Structures of Improved Fluorogenic Substrates for Family 6 Glycoside Hydrolases.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 132
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4au0A00
1OC7A 1QK0A 3VOFA 4B4HA 1BVWA 1OC5A 3A9BA 1OCNA 3VOJA 1UP0A 3RPTA 2BVWA 1DYSA 3VOGA 4A05A 4I5UA 3VOIA 2BODX 1UOZA 4AU0A 1HGWA 2BOEX 1OC6A 1UP3A 2BOGX 2BOFX 1QK2A 4AVNA 3A64A 4I5RA 4AX6A 1OCJA 1QJWA 3RU8X 4B4FA 4AX7A 1TMLA 3VOHA 3ABXA 1CB2A 4AVOA 1UP2A 1OCBA 1GZ1A 1HGYA
chains in the Genus database with same CATH superfamily
4RCXA 4CNSA 3TEVA 4I5XA 4QDPA 3T2QA 3SUTA 3KZSA 2AKMA 4UTWA 4EPKA 7REQA 4BEQA 2G4FA 3M0VA 4RL3A 2NQLA 3WEZA 1HO4A 2WAGA 4Y90A 2YZRA 5FKYA 2WWCA 3CZKA 4FIQA 3TUUA 1H1ZA 2E9LA 1DJIA 8TIMA 2OOFA 3UYCA 3EBVA 3RPDA 3GY1A 5DEZA 1AMYA 1H5VA 1YBQA 3WH5A 2X1SA 3R79A 2NWRA 3B0YA 1ZAHA 3MUZ1 5KITA 3WEOA 1Y5VA 1FWRA 3VABA 5A5WA 1QI5A 4DO4A 4JTFA 1FKWA 3KTSA 3KVJA 3C5QA 1J5SA 4RLIA 4A3UA 2FYMA 4JKKA 3B9EA 5HPCA 2BVTA 3RNDA 1XV8A 1GVEA 3P84A 3PZTA 3FYPA 1SW7A 1DWIM 3U2EA 3ANYA 3IVUA 4IPNB 5LSMA 3O2LA 3WCZA 2D3LA 4RW5A 2FGLA 1FOBA 1XIIA 3GAYA 4LF2A 4W9TA 4WY0B 2WM0A 1XUZA 1JUKA 4CQBA 3PJUA 3UWZA 5F1UA 7TAAA 2XSXA 1MWOA 5C2CA 3MS8A 1A0EA 3F4CA 3G1XA 3N18A 3TZFA 2PWHA 3G2GA 5IBXA 3EOUA 4Y96A 4C1NB 4ZMGA 3BG9A 1A5OC 2PUZA 2NLIA 4AVNA 1YHTA 1TG7A 3EWZA 3CLWA 5AKQA 5LA2A 2BTMA 4YTUA 1OK6A 2V3EA 3BLDA 3ITGA 1UWRA 5LXEA 3ZIZA 1WQ5A 1E0UA 3M16A 4GJJA 4DB7A 2ZUSA 3NZ1A 4JY8A 3H21A 2EPKX 3MV01 1CEOA 2YYUA 4O50A 1JZ4A 1Q6OA 1SU5A 2OQLA 1IIHA 1V0NA 5XIAA 3HFTA 4AUBA 4CQ8A 3WLLA 4GYFA 2R14A 4GQBA 3MP4A 2YX0A 3UZZA 4HJWA 3VDAA 4HPGA 2C7FA 2FHFA 3OPSA 3W53A 4EIVA 1VC4A 2Z1BA 3E5PA 1W54A 5AYYA 2BP1A 1OT1A 1UA3A 4RDZA 4UFKA 5I78A 4LYRA 4GUJA 3W2KA 3TC3A 1RQEA 2RDTA 3H23A 5AN7A 5E0CA 3FSUA 3DG3A 4E4PA 2REQA 3INPA 4Y8EA 4RV8A 2WOQA 1Z48A 3NL5A 5G1MA 2XG9A 2PP3A 1GZGA 2V9DA 2I7GA 5AHNA 1Z3NA 1SFJA 1XLLA 1RA5A 3GG8A 3TSDA 4J3VA 1J0JA 2XSBA 2P1FA 3M0XA 1F3EA 3WQCA 2ATSA 4PRTA 4I9MA 3OG3A 3VILA 3J7HA 3TW7A 4Z1BA 1XYLA 5B7ZA 4ZBCA 3IGSA 1FWNA 4LX4A 2PDUA 4DXVA 1W3KA 5ENLA 2BASA 1NSJA 3W22A 3GHUA 4UMCA 1PZ0A 2WMHA 4AY1A 3PUDA 4I3GA 4TMBA 4QE4A 5L6UA 4MB5A 4O1AA 2C18A 2CYGA 3VKKA 2PDGA 4Y7EA 4JN6A 3T09A 1BVNP 2XGBA 5H6HA 4JY9A 1HKKA 1XH0A 2Y4SA 4H01A 1RVKA 3RLVA 4L5ZA 1N8FA 3NG3A 3TSMA 3WH8A 3UU0A 2DV0A 3I68A 3M5YA 1RSCA 5LNVA 2CEQA 3PZUA 3VNJA 2BWGA 1PS9A 1N82A 1S38A 4G7EA 3ABSA 5CGQA 4KF1A 1EF2A 4MY9A 2HK0A 3AUOA 3HPXA 4LY4A 3BCDA 2O92A 2DGAA 2FZMA 2POZA 1PKYA 4NYUA 4NAFA 5CZ0A 4RW3A 2G3FA 1VBRA 1ONRA 2OFJA 2QCDA 1DJZA 1TB3A 1HUVA 1YLVA 4EPEC 1RLCL 3KTXA 3F2CA 3DBPA 4ZSUA 4L61A 3RFAA 3CIWA 3N4FA 5G4EA 2YJQA 4AIOA 2OYMA 1ZCCA 1ISXA 2PDNA 3GU2A 3PBGA 3NQVA 2WHLA 3NL3A 5GQBA 4C7DA 4HPXA 3O8AA 2V3FA 1W3LA 4LV9A 1EKOA 1QOQA 3ICJA 2YYTA 3QQ1A 3O6AA 4BQ3A 3GH5A 4UR9A 4MAZA 3ORWA 2NT1A 2XVLA 2RDUA 4A3RA 3MJYA 1BRLA 3POCA 2FZ9A 2DT2A 4FHAA 2WVSA 1EP3A 4N02A 1D8CA 1X98A 2J7GA 2ACSA 3DIPA 2A3AA 2Y8KA 4OOZA 1DORA 1VENA 3AYSA 3P67A 3I6TA 1NDZA 4A29A 1QBBA 3VNDA 5C7VA 4WVXA 3TE9A 1LM1A 4Y9AA 4ZA0A 2FB3A 3AALA 3R11A 3ZT7A 3KM8A 1W3NA 4V1YA 4B5VA 4N9EA 3CUHA 1XCFA 4RZBA 4QISA 2DY3A 1EDQA 1VFMA 2J6VA 3BURA 3KCOA 4Z0SA 4ONVA 3VUSA 3N14A 3SCWA 4AWSA 3RG6A 4F2UA 1W1IE 2XDFA 4YWIA 4WKFA 1GVFA 1TPC1 3NAVA 4X61A 4GXMA 3CQHA 3E38A 4IL0A 4C7GA 1W1PA 4H6QA 4KGLA 1M3UA 3NPWA 3LSCA 2IUZA 3AIWA 4AHQA 1LORA 3N04A 3USZA 3KOZA 4W8LA 2YXGA 2P0OA 3IWPA 1R3SA 4NZFA 1S5MA 1OF6A 4FF5A 5EFFA 2DZWA 3KRSA 1IQ8A 1DJYA 4HOZA 5LNWA 4KFNA 1QW9A 3APGA 4US5A 3L9CA 1NY1A 1W5NA 4UFLA 3IIOA 1MXDA 1I6NA 1Q7MA 3QC3A 3DFPA 4C6DA 3LPOA 2JIWA 3U5YA 5CC5A 2Z29A 3QJAA 4UQEA 1A5AA 3E2RA 3RHGA 2MNRA 4R27A 1XQKA 3T9PA 4US6A 3KZPA 2R91A 5HPOA 1V4YA 2FDMA 3NQGA 3W02A 4HA0A 5DMNA 4LVAA 3TN6A 2YLLA 2A7PA 3QKEA 3A9BA 3RX4A 4X60A 1DIKA 3MBFA 3TN5A 5DCBA 3RMJA 1A47A 3LCGA 5A6JA 2VFHA 2WQDA 3W2LA 1UROA 2HV5A 4XIAA 2W6RA 5FJTA 3FA3A 1B4KA 2QGHA 1E0TA 1XFBA 1CXHA 5FOOA 4XUGA 3KBJA 4N9DA 2V69A 5D2XA 3SN4A 4Z2GA 4ZFMA 4RE2A 3ZO9A 3CAQA 4ZQNA 5DANA 4Q8PA 4RJEA 3T2PA 1GVSA 4MGGA 2GWNA 4JDYA 1UASA 3N11A 3JZEA 2HK1A 1O68A 4EKJA 5CXPA 5CSSA 1RCOB 4N9BA 1ME8A 4O52A 2AAAA 3KRUA 2E3ZA 1HL2A 4BKNA 3E0VA 1NDWA 3SUVA 1K7EA 3EEZA 1QDSA 5A94A 3HU7A 3REQA 4OE7A 3I4EA 5F4XA 1XICA 2PI6A 2XN2A 1CLVA 1F76A 4AD4A 3H55A 3M7SA 1ZY9A 4UZUA 3T78A 5DCDA 1QI0A 3SY8A 3H8AA 2OO0A 2ZRVA 4OUEA 2WNQA 3BV4A 2WMGA 1NAL1 4UB9A 5I3FA 1E56A 2YGYA 4M6VA 5C9ZA 1LRQA 3NGJA 3TYAA 3OVQA 3S46A 4QXIA 4LUTB 1VS1A 4BF7A 5JH1A 3WQEA 5EPDA 1E15A 3TSBA 4Q7IA 3B03A 4K36A 4HA3A 5AVHA 3G1RA 2W67A 2PZ0A 4W86A 1NWUA 1RAKA 1B3XA 9XIAA 2OSWA 1DPMA 1OD8A 3UETA 2XIIA 4HNCA 2P3ZA 4EXBA 4B4FA 3G1AA 3K4DA 2VR5A 1E71M 3P62A 2A3LA 1R0MA 4W87A 3W24A 2YA0A 4ZE5A 2BY3A 4HNNA 4NASA 3VKBA 3PSVA 1W8SA 2XISA 2VX4A 1WDPA 3PJWA 3OYZA 1DJNA 3N3MA 4Q6XA 3F7JA 1UH3A 1KWGA 4KMQA 4PUKA 3L5LA 5T91A 1RD6A 4O14A 4I7WA 5KZEA 2HROA 1YNPA 4PSPA 4CLMA 2VDGA 3C0LA 4QE1A 4LYKA 1ZJBA 1A3HA 3QHMA 3C56A 4O53A 4GXPA 3SRKA 4DBWA 3P74A 3TK7A 2H90A 2DVUA 3MV11 5CPOA 4KRUA 3N29A 1WDDA 3QRHA 4PTNA 1JNEA 4QR6A 1TR1A 1P6WA 2ZVIA 3WQWA 4L9XA 5HNUA 4JTJA 2XIJA 3OJGA 1MXSA 1ISYA 1A5NC 3VO0A 4IMGA 2WVUA 2D0GA 3WO8A 2SFPA 1LUCA 5F7UA 3LEPA 4J9JA 3XISA 1R2TA 5CC3A 4JL1A 4Q8QA 2PRLA 3CTTA 3H54A 3WUEA 1Q6CA 3EMZA 1TJ2A 2GUBA 1EPVA 5BNKA 2XFFA 3BAYA 3G3MA 3M9YA 3O05A 4A21A 5A6TC 1QRQA 1SGJA 1GJUA 4S3FA 4MWAD 5KZ6A 1QUMA 1KGUA 2DFAA 2D73A 4ZE4A 3GFXA 1OGBA 1E55A 1KFJA 4RE3A 3KVKA 1DQUA 4DLMA 1FWHC 1E4NA 4GWEA 1KQZA 1KFLA 2P76A 1HQTA 2Q71A 1ECEA 4JTUA 1WKYA 3OQ8A 1A5UA 3GSMA 4HVXA 1UCWA 3FVDA 1AW1A 1QI4A 1JCNA 1LBFA 4QG8A 2CU0A 4UOQA 4DUWA 4RXGA 3RN6A 8XIMA 3MDWA 3UCCA 3ZSTA 2PBGA 4PMOA 3WMLA 3ABRA 4NX0A 1J12A 1V79A 1XYFA 3N4EA 4A2RA 4GBDA 1VFTA 1KV5A 5F2IA 3CUXA 2WZHA 2DT3A 3IV3A 1KFBA 1XRTA 4WHBA 2DIEA 2C1HA 4BF5A 4D6IA 3W9ZA 3Q37A 3QN3A 2GSHA 3RDKA 4JNZA 3BZJA 1HNYA 4ZZ9A 4QHRA 4AXKA 3VZYA 2QEZA 3WYZA 3TC6A 2CLKA 4PUNA 2D0HA 1WZLA 5AOUA 3P5ZA 3EWYA 3AOFA 2BFGA 3W7QA 1GG0A 1RK5A 1X1ZA 3G1FA 5LNRA 3U4AA 5CPLA 1PHQA 3PWIA 4GMEA 4GABA 1U83A 3ONCA 3ME3A 2YIHA 3K30A 3BJFA 4WZHA 1V3MA 1K3UA 3PZOA 1FRBA 3AMLA 3V5OA 4FNUA 2NT0A 1DVJA 1U22A 5G5IA 4XVEA 2VC5A 4XBSA 3QQ0A 1XLJA 3IJ6A 1FHDA 4S2CA 4Q7NA 3W37A 2PWVA 4RPQA 4YN5A 3UG5A 4A3YA 1W5PA 5JUVA 1VEMA 1ODZA 5C9WA 4PUEA 3V0SA 3PZNA 3M6DA 1XCXA 1T96A 3H22A 1XH2A 2O0TA 4S2BA 3WLOA 1RP9A 1O1HA 4ZXLA 3DI1A 1VPXA 3W27A 3L65A 2PDWA 1BQCA 5BYWA 5TD4A 3AU6A 2PDIA 4E4FA 1CIUA 1ZZMA 2XN0A 4QLJA 4GPNA 1PX3A 1TVNA 3TMQA 3OTRA 4O1EA 3W38A 4IQDA 1ODUA 1YNYA 3OHIA 3TMLA 3HV9A 5IHRA 4XAGA 4TVDA 4KCWA 5LA0A 3AYRA 3FK4A 5F1VA 3N13A 3SJNA 1QNOA 1U1UA 4LJ3A 7REQB 1XLGA 1JZ3A 1PYFA 1XLMA 1GQLA 3WLQA 4RZ6A 4JBRA 2QAPA 1S2WA 1IZJA 3CU2A 3VUPA 4YHGA 4YTSA 1PZ3A 3OIHA 4W88A 4W89A 4GQQA 3CT7A 4MY1A 1PIIA 5BWFA 3ABZA 4MZ1A 3GAKA 3NQ7A 1VFUA 4ZO7A 5FSDC 4CQAA 3TW6A 3ARUA 5ECUA 4K8GA 4TTUA 4QP0A 2QCGA 1YE6A 4JYFA 3KS5A 4CNOA 1X8CA 2IW0A 2AMGA 3BMWA 3FKRA 4U33A 2PDXA 3WDPP 5I09A 3N6JA 3NOYA 2GUUA 5BOEA 3BQ5A 2YL6A 5I6SA 1VPQA 4HU4A 2VZOA 2E1WA 1EEXA 1I75A 3T0AA 3W07A 3ALGA 3LHUA 1R85A 1QNQA 3B8TA 4OQVA 4P8VA 1BVWA 2HS6A 3NDYA 3WF1A 2ESCA 5CC7A 1WXYA 1YE4A 3BH4A 3MI2A 4B3ZA 4M24A 1PTAA 5DF0A 2QJIA 2YCKX 4GGBA 3GUGA 3S2LA 4G1KA 4PFHA 3ES7A 2Z0IA 2YSWA 3TYEA 1K03A 4IXHA 4YLWA 1ADDA 1O60A 3CO8A 1JNDA 1P0BA 4GC3A 4GFIA 3UBPC 4JXCA 1BG4A 4XO7A 4LS0A 1GOWA 3ZXWA 3HGJA 4F0LA 2HNEA 4FA3A 3GNDA 1AMKA 3CHVA 1KWKA 3A4AA 3HPAA 5XINA 4TTGA 1WO2A 3UEQA 4JQAA 3B8WA 1XR2A 5LIWX 4ICMA 1VJIA 3N2OA 2F6XA 3P80A 4CD8A 1E6XM 2QJMA 4ZGYA 3QM3A 3MKKA 3EZ4A 2DW6A 4D9PA 4G1NA 5DLCA 4L64A 3S2NA 2CZVA 3TKFA 4EPBC 2DZSA 3SECA 3W86A 1NIUA 4LXFA 2PRHA 4HPNA 3FA5A 1G4SA 3BAJA 5CEWA 2D24A 3B04A 3S4TA 4OKDA 2YKKA 4CD7A 1WZAA 2ACQA 1CI1A 3P14A 4Z1YA 4LW7A 1ZGDA 4QBXA 4XKYB 1F4AA 1W0MA 1DYSA 1YPFA 3ZJ6A 3FEQA 1P7TB 3UW6A 3SEPA 4Q33A 1THFD 2EJ1A 3CPUA 5TF0A 1CLKA 3S1WA 1AQMA 1UP2A 4PB5A 4D6CA 4E2BA 1VGAA 1VFHA 5D04C 2OYKA 1XDJA 2CBJA 2PBOA 5C5YA 3A3HA 1W2PA 4JTAA 4MB3A 1D3CA 2UZ9A 1CB7B 1I1WA 5D32A 1B30A 1XS2A 3TQ0A 3I3DA 4A22A 5REQB 2NUYA 3R94A 2X1IA 3PFMA 2WNWA 3ARYA 1GTHA 1RR2A 3G0SA 1OC5A 1YPIA 2DZAA 4DZ5A 2HWGA 2EPLX 4ZB0A 4H9ZA 4AB4A 2XFWA 1TTJA 5DMYA 1S2CA 4HZMA 2HSAA 2ZZ2A 2CZ5A 3TOPA 3GTHA 1Q4WA 1MEWA 3F4VA 3MSGA 4HHPA 2Z00A 3VGBA 1XLEA 2R1NA 4NY2A 1LRNA 3GU9A 1GYLA 4EANA 5HR6A 2BG5A 4YXGA 4Q8UA 1VKFA 4F0MA 3CMGA 2A0NA 1ZNNA 2IKHA 1SFLA 3WD2A 1RY8A 3O63A 1R3RA 1J96A 4QE5A 4JTSA 1CLXA 4MNMA 5ABFA 3KWXA 4GZIA 1VRXA 1W5MA 2ZZ1A 5A3HA 4JIRA 1W9VA 2B31A 4WKHA 1X6LA 3WKZA 4BJHA 3SCUA 3SCSA 5AYIA 4CQ9A 1RJQA 3QV8A 4QJ5B 1GKPA 2WSKA 1MFUA 4G7EB 3FHQA 3SAZA 1JUBA 4C6QA 4JTLA 4FS9A 3N9SA 3UG8A 1Z41A 3HGSA 3MJMA 3RLGA 4JTCA 2HISA 2TODA 2FPTA 4NAFB 4ZQRA 5DRIA 5CLTA 4EX4A 2QCDB 4ECLA 1KXQA 4W93A 4UC5A 1XDMA 3MUCA 2G3IA 4HT3A 1DQWA 3AYVA 4IGMA 1G1YA 2E09A 4IX0A 1SFTA 1H1NA 4DF0A 4C6BA 3DX5A 3GIPA 4HK7A 4MNLA 4AEEA 3DENA 3B0VC 4PMYA 2WKJA 3U57A 1SZNA 2NVCA 3EA3A 2BHYA 3EPMA 1BRLB 4KEZA 3SUUA 2OKTA 1T7LA 1BGAA 1KW1A 2HMCA 4PSRA 1FWBC 3IEBA 1C8YA 3S2CA 1UZDA 2FHBA 3B9DA 4OECA 4NI3A 3LM7A 1KRCC 2OPJA 5CPMA 1KXHA 4GI9A 1E51A 5D9PA 3DG6A 1NELA 4OHQA 3RX2A 4PB4A 2UY4A 3GVQA 3T42A 1ISZA 3IJ9A 2YW3A 4JIHA 4V1XA 1G4EA 3KBWA 5CG7A 1J79A 1IIGA 4C90A 3KWSA 5SWUA 5A6BD 4RNFA 1XXXA 1HW6A 4CNNA 3HZ3A 2DZBA 1DHPA 2D20A 3V5FA 2TAAA 4HCLA 1UW9A 2PE4A 4K68A 4CVWA 4JIEA 2PDKA 2QCNA 3ZSSA 4QJ1A 3EXRA 4JHZA 3OU8A 4O8AA 4G8TA 1TCDA 2DP3A 1A53A 2OLAA 3TR2A 2VRQA 4PMRA 4K2SA 3P5YA 4Q4OA 1BVZA 4MY8A 4GUHA 5M5DA 4QS5A 3W1NA 3CMFA 4J3ZA 1DE5A 3HG5A 4P8UA 3PULA 3FEMA 1EHNA 1US3A 4GJIA 1OZQA 4JHMA 3NPXA 1TYGA 4LYPA 1GOKA 3QPYA 1K9TA 6PTDA 4DI8A 1B3ZA 5AYXA 3JUGA 4DBUA 1X39A 1VYPX 1ENUA 5DQPA 1CGWA 3GDRA 5FJOA 1NP2A 1UWIA 2XM2A 1KBKA 2OSXA 4O0QA 2E0PA 1E6SM 4LAUA 3VAVA 3UJSA 4UMAA 2J25A 1K77A 3KFTA 1M7XA 2J77A 3AI0A 4J2MA 1UKSA 2WM1A 4XQ6A 2E67A 1MZRA 4YCOA 2YDSA 1MVYA 4J3TA 1OBAA 3WK0A 1HJUA 1ZJHA 1ZAIA 4AMAA 2VR4A 3V5CA 4DJFD 3QMSA 1DJHA 3EDFA 1FWDC 3L0GA 1A5MC 1FWWA 3L5MA 3DH7A 4U10A 2PTZA 3KBNA 4YU1A 2ZUUA 1Q5MA 4Q22A 3TFXA 4HBKA 1AZ1A 2AQWA 3AMCA 4KKXA 1NARA 3R5EA 1Z69A 3T0DA 2PCQA 2IKGA 1B90A 1EQPA 4O1DA 1EEPA 4R7JA 3W7DA 3KL5A 2W66A 3MANA 3C52A 2WZIA 3DBNA 1BGGA 3OP2A 4BQ2A 3FHAA 2PF8A 2I56A 1YMYA 5K9CA 1CXFA 3BGAA 2YBVA 3GTNA 4PMZA 3WF0A 3M1ZA 2Z1XA 2W61A 3ABQA 3WJSA 3ABOA 1WOAA 1TV5A 4FNSA 2Y0FA 4XZMX 3VOJA 4XKMA 4M1RA 4U2ZA 2D2OA 1OCQA 4AU0A 3FYOA 4UTHA 3B8DA 2J47A 2QDGA 1NF0A 1VRDA 4ACYA 4XSLA 3NQ2A 3WH9A 1J5TA 2W27A 3A3WA 2Y85A 2PA6A 5E6ZA 1H61A 2NV1A 4IH3A 3E74A 5BXPA 2PTXA 1G9HA 1CX9A 3QVQA 4R53A 1JZ8A 1LWIA 3BSHA 3W71A 1ISVA 3LX9A 1ALDA 4AISA 5JH2A 5BMWA 2W62A 3FXYA 3C3UA 1V3KA 1TWZA 3WDHA 3EDKA 2XFYA 4CCEA 1LF1A 3OZYA 5D03A 4KCUA 1I4NA 2Z7GA 4HSHA 3TONA 2NSOA 3JZUA 1R8LA 2V3GA 4IIBA 3WJXA 1P1MA 2YCLA 2ZKMX 1HP4A 1O5XA 4L56A 2YB4A 5D8WA 4QJ3B 3EXSA 1RBLA 3TLLA 4H2HA 2VZTA 4UQ9A 2WZEA 5KINA 1G7VA 3W7HA 4AXNA 2RUSA 4FK9A 1ONWA 1O7AA 4PTWA 3SR7A 4HN8A 4HJFA 2ZC8A 4GBUA 3DC0A 4EWND 3T05A 1WAUA 1MI3A 3P82A 4AHOA 1X6UA 4B15A 1E9ZB 3VGFA 1XWYA 3CQIA 1B3VA 1V03A 1DE6A 4CGTA 5E1QA 1U1HA 1TQXA 2FVMA 1W9PA 4FNTA 3G6MA 4ZEPA 2ZCGA 3BLKA 2WHKA 2EF9A 2Y88A 3RPMA 1Q6FA 1RLDA 2P88A 3MUXA 4I6VA 4AF0B 4GKLA 5HINA 2VQTA 1TJ0A 3MMTA 3IACA 1LLWA 3TYCA 5DELA 3ARTA 2CITA 3SSJA 3KHDA 4NQ1A 1LUCB 4XTIA 5CC6A 3NPUA 4F9DA 3OVPA 2Q3OA 3SUWA 1U5VA 2J78A 1E72M 3B4YA 4B2DA 4HZ7A 4N9CA 1OFRA 3U2OA 5BXRA 3P3BA 5FD0A 2VGFA 1HG3A 2GJNA 2ISDA 1NOFA 1OYAA 2VEGA 3GVVA 1WUEA 3NO1A 3NZRA 2QPSA 5BCAA 4B3KA 1DWAM 2FVLA 5M17A 4W5UA 2ZX5A 3R1ZA 1HJSA 2V30A 1SO6A 3QZAA 2XIOA 3ARRA 4JTEA 1G6CA 3PSWA 5EMUA 3IV8A 4XZWA 4CN6A 1UD5A 1ZP4A 1E9YB 4CKQA 1TE1A 1J9YA 5CGMA 3GC5A 3FS2A 2GZXA 3GKAA 4GYKA 4PCNA 8A3HA 3MTWA 3ZWTA 1UMLA 2GJXA 3WJZA 2IKJA 4FXRA 2NUWA 1A0CA 1UPMB 3L4VA 3QZEA 4TV5A 3KP1A 1ML1A 1GGOA 2VX7A 4C6CA 2WVTA 3LXCA 1KRAC 1F5ZA 1P4CA 4AEFA 4DJDD 3LUTA 3W2UA 3BAKA 3BG5A 3KXQA 1A80A 1S5VA 1T6MA 1L6SA 1KTCA 3KW3A 4O15A 3UXAA 3WENA 4CU8A 4KRTA 1MQPA 4QRNA 2C91A 4HA1A 1FDZA 1XBXA 1Z32X 1FCQA 1IXOA 3A64A 4D6EA 1Z42A 2VVNA 4CQDA 4J28A 3SCNA 3WL1A 1UWSA 1D7FA 1JIBA 4WXZA 4H8NA 1W3HA 2PU1A 1UBPC 3NDOA 4C6MA 1CT5A 2PDLA 2ZQ0A 4P8WA 4MPKA 2JALA 2JGYA 1VBJA 3M0YA 3QYQA 2GGJA 1KCKA 3TYZA 1AL7A 3AXIA 2P53A 3AS3A 2HRWA 3JU2A 1BF6A 3QBUA 4HTYA 1ZENA 2VKZG 3BMXA 1LJYA 4J27A 7ODCA 2ZZ6A 3LOTA 1X7FA 3H2EA 1ZAJA 1UD6A 2XIMA 2EG6A 4GE8A 1W9DM 3EAUA 4PC8A 2VWTA 1DJGA 2CLEA 3ITYA 3CJPA 1HJVA 4FXFA 2VR2A 4DN1A 4DNMA 3DFOA 1DJWA 1PV8A 2E5BA 3AXHA 5G2IA 4HOXA 2VTFA 5A8MA 4ADUA 2XIQA 4KFPA 2YXXA 4HZ6A 4HHHA 4ICCX 4LSBA 3NR0A 1I2OA 1K1DA 5A8QA 4AX7A 5HNNA 3U7BA 3TYUA 8CGTA 4PBFA 3ONBA 1Y8BA 1E40A 5FJPA 4AZCA 3WNOA 4I5UA 2XGZA 2UWFA 3EWDA 3W28A 2P50A 4NJIA 4Q7BA 1JCXA 3BICA 5I7GA 2GVJA 4H8UA 1ZUAX 1QT1A 1PXGA 4O12A 5CBJA 1V02A 3WMCA 2BLEA 3IRDA 4TO8A 4HK5A 4LPCA 3OLGA 1E6QM 3W7GA 3DHFA 1AL8A 2CC0A 4UCGA 3LCHA 1KLZA 5LIYX 2WKLA 3ZMRA 2G0WA 4MWAC 4GOAA 1NOUA 4WSKA 2I5IA 2VDHA 2PTYA 3QC0A 3NQBA 1K8CA 3F4WA 3GZAA 3CHCA 3PG9A 1Y5XA 3KLLA 3II1A 6TIMA 2IPJA 3TN4A 3GR7A 4S3CA 1BKSA 2BOEX 4P7RA 4MJZA 5FIPA 3IS4A 3WDRA 1IYXA 3BV7A 3K8KA 3N6QA 4BI7A 3W74A 4CCCA 1JYWA 2Y61A 3UERA 1WKFA 3AIBA 2PCEA 3PNZA 3L66A 4GVHA 4TU1A 4J5NA 3SSZA 4IF2A 2WK2A 1XPYA 2ZTKA 4DNHA 2ZE3A 2VFDA 4X3ZA 4G6CA 5DMLA 2ZXBA 4UTFA 4GH1A 4GCAA 3PF3A 2QDEA 4EE9A 5D05A 2OVLA 2JKPA 2DSWA 3NTYA 1TV2A 3QQWA 2BB0A 2Z6IA 2YA2A 4FAMA 4UTUA 3JVAA 2Q8ZA 5PTDA 3W70A 4DY1A 4JOMA 2D23A 4KCVA 5F4WA 1JL8A 2H8ZA 4YYCA 1EQCA 3MWAA 2RGMA 1F6KA 1JRBA 1ZLPA 2VZUA 1OYBA 1RALA 1M7OA 4WGHA 3CV6A 4HU3A 4NAEA 4UTLA 3DXIA 4XK2A 3MZNA 3W82A 3LTSA 1OFBA 4O4VA 4W85A 1S1PA 4HU0A 2PLJA 4H9YA 4AZBA 3CQ0A 1R87A 5MKGA 4DQWA 3W7IA 4Q4PA 4ROQA 1BD0A 2C0AA 1OY0A 1XRSA 2DVTA 2FGZA 4F79A 1IT8A 2E6DA 1OCBA 1AJ0A 4QGCA 4OWGA 1PL9A 1XLKA 1BXBA 3DKJA 2RKXA 5DO8A 4UR8A 2EGZA 1W3TA 4MUZA 3GTXA 1M6JA 1R3QA 2A7RA 1JPMA 2WXDM 2OT1A 2VVSA 5AY7A 3LZ3A 2D22A 1GZJA 3DFTA 2OWWA 1T99A 2O56A 2DUXA 4V27A 4HK6A 1AH0A 1GQKA 1BYDA 4U4MA 4PCSA 1TO3A 3LN3A 1OFQA 1S5NA 3PZQA 2YZ5A 3WD1A 4F0RA 3N9KA 4KIEA 1LOLA 1UWUA 3CL6A 1CGYA 4G2DA 4DPPA 3LGEA 3P8JA 4NZCA 1E6PA 4KBXA 2QDHA 2XUCA 2ZDSA 4FZIA 1MUCA 4GX9A 5EFDA 3AICA 4M0XA 3M43A 2AGTA 3NM3A 2R1LA 3GB6A 3RR1A 3MYOA 1UKQA 2X7VA 1QK2A 3U6WA 3VCRA 4JR5A 1HFBA 3B9NA 1PBGA 1NWTA 3UJ2A 4MUPA 4S1FA 1HJWA 2WMFA 4Z42C 4QDMA 2C79A 3M0JA 3HPFA 1NF7A 4HN4A 4M6UA 4PYSA 1KM5A 3THDA 2CHNA 2C8NA 2XH4A 1EC9A 3FGCB 3BLPX 4GZ7A 1D7KA 4FXSA 3CXOA 1JYXA 1KNWA 4Q8WA 3T8LA 2OLHA 2KZHA 1BF2A 1TWDA 1E9LA 1FX6A 3UJEA 3LM3A 2H9AA 3STPA 5G4HC 1GTEA 1VJSA 1HVXA 4A4AA 2I17A 4FF7A 3VIKA 1XIGA 2Y62A 2J6XA 4MZYA 5DXXA 5DY3A 1XYAA 4GVIA 5EYWA 1B4EA 3UJRA 2G3JA 2OEKA 1UOZA 1EH9A 1CGXA 3UP8A 3BGJA 2Y24A 1JEZA 4PR4A 1R3VA 3BAXA 2VGGA 1L8NA 4K3ZA 3R8HA 5AHIA 4P8XA 3ITTA 4C60A 2OWXA 2Q8LA 3BPWA 2VUYA 2GK1A 1R3WA 3LGDA 3M64A 4KIRA 3POHA 4O16A 2DSKA 3NURA 1EYWA 1TRIA 3PB0A 1LBLA 1HKIA 4MPQA 1P1XA 3MHGA 3QLDA 4NYYA 2BHUA 2VC6A 3OZOA 3LRLA 2HE8A 2WBKA 3LPPA 3QXBA 4JTKA 3V0TA 3GQYA 4UTTA 3TW9A 1Z89A 1SVDA 3AC0A 3HIJA 3QYSA 1ZPTA 3NYZA 1S3TC 3P7YA 1RCQA 2E5CA 5T9BG 3N6HA 3MY9A 1SMAA 4WD0A 4GIYA 3NUKA 1UUOA 2NQHA 3BJTA 2Z27A 1XIFA 1ZALA 3CK5A 4N6EA 4PMUA 4A8LA 4GO8A 5I07A 5HATA 4NNBA 4GGHA 3T8QA 1O5KA 1N55A 3UWVA 1PDZA 2PURA 4B5SA 4KFOA 1DQXA 4H04A 2ALRA 2NX3A 4MIMA 3FN9A 1B1YA 1W1ZA 4ZXOA 2PP1A 3TNOA 1V6WA 1BXNA 2C1GA 5A2CA 4M7TA 1TJPA 4JQ3A 2WWDA 4AWEA 4DI9A 1CTNA 4Z2JA 4GYPC 1TA3B 1V93A 1XIEA 3PZMA 2YOCA 3U3HA 3U5UA 1B57A 3W7CA 5HMSA 4JICA 2OU4A 4EPDC 3UVIA 5I24A 4QLKA 4ATLA 1S1RA 3SCRA 3RLUA 1FWJC 1VPYA 1SPQA 5CJNA 3D3FA 4H8VA 2PSNA 3S47A 2QUTA 3E5BA 3PBYA 2ZUNA 4IHCA 2W9MA 1ICQA 2E9BA 4PB3A 3A3XA 1XD0A 2C3ZA 3L7RA 3OEXA 3KX6A 3IUHA 3M0IA 1K6AA 3O16A 1R3TA 3I10A 2EXOA 3RO8A 1MFVA 3GXFA 1EP1A 1REQA 3UY8A 5I79A 1US0A 1QTWA 1PCKA 3A12A 4PL2A 2PPGA 3CPRA 4KPLA 2BVWA 3K1DA 1LL7A 3NSXA 5ABEA 3OLEA 4DIAA 5M3WA 4LB3A 4N42A 3V36A 4N4QA 3LY0A 1QHPA 1EC7A 1V6XA 3GVGA 3GUWA 1EO5A 3TTYA 4UTIA 1FH8A 3CZGA 3BW3A 1J18A 4K38A 4BI5A 2DQWA 2WHJA 2ZWZA 2VL4A 5IM51 2VRKA 2W63A 1WKEA 4GLEA 4FLQA 3SIMA 1QNRA 2ZZ5A 1CGTA 5G4WA 4IMDA 3ITOA 1SJDA 3B4UA 3LMYA 1MEIA 4AX6A 1KBIA 1Q3NA 1PTGA 1IHIA 1FWEC 4UFJA 1K8ZA 2OR2A 2OEJA 1B31A 4ICNA 3P93A 4WOQA 1LTDA 1VZWA 3PWGA 1UZ1A 3VIOA 2R1MA 1SZRA 3ARWA 3MI6A 3HJEA 1LZOA 4PBEA 1B0IA 3WFLA 1XFCA 3MVIA 2GOKA 1OX4A 2BGQA 1EHAA 2FPVA 2NV2A 3Q45A 1TPVA 1FTXA 4ZO8A 2PU0A 1JFHA 4Q3MA 1BTCA 1C9WA 1EZWA 1AJZA 3SI9A 4C1KA 1Y7VA 5JXQA 2D69A 4NVTA 4Q32A 2ZRUA 3VFCA 3R43A 2A3HA 3LDVA 1UD3A 4WSHA 2WNZA 1G4TA 3G3DA 1WE5A 3GK0A 2PDJA 2WJDA 3HOJA 5KMYA 2NVAA 2J4GA 5LIKX 1GQJA 2NQZA 1A5SA 1JD9A 1B2YA 4XZBA 1X1OA 1UR1A 3B8UA 4NZ4A 3UWEA 4LQ1A 3W26A 1UG6A 4OBTA 2HS8A 3CNYA 5D02A 2PD9A 1KGWA 2Y63A 3C8NA 3EEGA 1O5QA 4DXKA 3T0BA 1YDNA 4F4RA 1D9EA 3G1VA 4R7OA 3ZVHA 1DWGM 2BOFX 3ZYZA 4QQUA 3GLCA 4GZJA 1IT7A 2QJNA 1XKYA 3PPGA 1QO2A 3KRBA 3TZNA 4IFKA 3GFYA 1YDOA 3HMCA 3I7RA 1V3HA 2YFOA 5HMEA 3LBMA 3ZOAA 4M6QA 1EFZA 4DZAA 3CAKA 4R85A 3HQNA 3NGFA 2ABBA 4DYEA 4XBKA 1BSIA 2V5JA 2VENA 5EMLA 4Z08A 2XWEA 4Z2KA 3E9AA 3M41A 1SSDA 1Q85A 3W1TA 1J0HA 3B8IA 3M0MA 3VINA 1XBYA 4O1CA 1GVOA 2LLEA 2VEMA 1TPDA 2E9MA 2EPNA 5CZTA 2PWFA 4AIUA 4Z0JA 2I9EA 3VD4A 2GWGA 5CSRA 2YPIA 2VFIA 4RPPA 4Q8VA 3NEHA 4IFRA 3WNNA 4M29A 2VI0A 1X1NA 1TX0A 4ZTXA 2QR6A 4O19A 2OX1A 4ZB2A 3O7UA 4US5D 1F05A 1KTBA 5FJIA 1N7KA 1GVQA 5T8GA 3F4NA 3OA5A 3CZ8A 1OHLA 1ISWA 2BDQA 1VHNA 4MKSA 4XZ9A 1U30A 3MUY1 3PM6A 4AMCA 4XVDA 2A3BA 3C2FA 4U31A 1AD1A 1RVGA 3MHFA 1KCZA 1RPXA 4DJFC 1A5LC 1HXJA 2QNEA 3L0NA 1D3HA 4LVFA 1EXBA 1ZHAA 4V15A 3AZTA 5C0QA 1JDCA 1B5TA 3VOHA 4RNIA 1FWIC 4HMEA 1NU5A 3T7VA 3GE7A 1K6WA 2PDPA 4HHLA 2ODOA 1V6VA 1MZHA 4X2RA 1F61A 4ALDA 3QV9A 1XGEA 4D1JA 6CGTA 1MQQA 3MCMA 3COTA 4Z1DA 5BXSA 3MVTA 5I3DA 4N2YA 1EP2A 1CWYA 3STGA 4BS0A 3QGKC 3OVGA 4H4IA 5CPTA 3GC2A 1J93A 4C1LA 2CLMA 1YADA 2GJXB 4K37A 2WBGA 1XD1A 4QSHA 3VD3A 3QR0A 3GTFA 3U8GA 2R24A 4WF7A 3GXTA 2UY2A 2V5BA 5J04A 3P8IA 3BW4A 5I3KA 2BMBA 3UA4A 4UR7A 2GJRA 4AD2A 2ZIDA 3GIYA 4URIA 2I16A 4HU8A 3W1AA 3FLUA 1VYRA 4HD5A 2GSEA 1FHUA 3G1HA 3MCNA 3FJLA 3GNRA 4Q4SA 1YIXA 4D6FA 3CPGA 5E6YA 4UUIA 3GC4A 2OT0A 1M04A 3C8FA 1C8VA 5J5RA 4LUSA 5DN1A 4EWJA 3RIKA 1JCMP 1JVNA 3U4FA 1SJAA 4J35A 1JFXA 1UWQA 2J9ZA 3FDGA 2GPTA 1BWLA 4M7SA 3FY1A 4JIIX 2PWGA 8XIAA 2VJXA 4RXFA 1QCWA 4E3TA 1LLOA 5DX7A 3BGGA 3E1F1 5DBUA 2HTMA 5B80A 4M1BA 3PANA 3PS7A 2CETA 3E0IA 3DFQA 5HK4A 3R13A 2BGSA 4GCXA 1P6BA 1ME9A 3TTEA 3EX3A 3OHMB 3TJLA 4WLCA 1HKVA 2DT0A 3MU7A 2ZZ4A 3UR5A 3N19B 3WD0A 3JR2A 2VOMA 3VGEA 3EX4A 3HURA 5H1WA 3ARXA 1PCWA 3BCFA 3QOMA 3MQTA 3NA8A 3N2BA 1M41A 3KBSA 3DHUA 1QR7A 2QCCA 3W7OA 4Z2LA 3CQKA 3EOEA 5EMMA 2V63A 1WPCA 3S1UA 1UOKA 3C2VA 2FH8A 1XBZA 4FNQA 3THAA 1EJUC 2POTA 4Q4MA 1IEVA 1LG1A 1QI2A 2QYGA 2EAWA 1SW3A 1TPH1 3LNPA 3WLRA 4A05A 3T81A 3IVSA 3RITA 4CVUA 2CZEA 1LQ2A 1TRDA 4L1WA 1UR3M 5JBDA 2QW5A 3Q58A 5CAHA 1V6UA 3S9YA 4MNKA 3LK6A 4JTGA 4MFEA 1FWCC 5FACA 4HOWA 3EMCA 1QNVA 1LYXA 5BRQA 5ECVA 3W85A 5EA9A 4GO9A 2EKGA 4H41A 1SO3A 4S39A 2QUNA 1IWBA 3E0FA 4F0SA 2OSYA 3E6EA 1XINA 1FH9A 5BROA 3WJYA 1GG1A 1JZ7A 3RM9A 3UGVA 4RE0A 3WG6A 2ASHA 4HB7A 4IICA 3H4XA 3SRDA 3O07A 3T4CA 1M03A 4BWLC 1K02A 3IANA 3EA1A 2W92A 1FDYA 3TCEA 4JIQA 1PTDA 3W01A 4EXQA 4BEUA 2GVYA 2R1PA 2YR1A 3AROA 3TCSA 3PPFA 3H4GA 3IAPA 1Q7ZA 3KRZA 4JEQA 5A6KA 3S9ZA 3EOOA 4DJDC 3K46A 4GIRA 5CPQA 3QGAC 3K5XA 5AYZA 4TIMA 2E77A 2CKRA 3THQA 3LTPA 1R38A 3LG3A 3H53A 4TVCA 3AXXA 4N6FA 3EGJA 2Y8UA 3UWQA 1G4PA 3BLOA 4DPQA 3TAOA 1EB3A 3EMQA 3G0UA 2X1TA 5I23A 4ZQPA 1T5AA 4FO4A 3VX1A 2X1UA 3TYDA 1YPXA 4LEQA 5AB3A 1AQFA 2Y5SA 5MKGB 1GQNA 3QZ6A 1TKKA 3BAIA 3ZFHA 2WKGA 3ZR6A 1TTIA 2HVMA 1KCLA 3TP4A 3GDLA 4UBPC 1JDAA 1BFNA 3W7PA 3LRMA 3QTGA 3B0UX 2IQDA 1JXJA 1XLDA 2A3CA 3GH4A 1E0WA 4Y9PA 1KO0A 3EX6A 3C61A 3QY6A 2BBFA 2EPMX 1XRFA 1Q45A 5I77A 3ALFA 3WLHA 3TN3A 1QVBA 2Y7GA 2ADAA 4ACZB 2XINA 3CV7A 3GG0A 1R46A 1UQZA 2EPOA 1ZTVA 3RCMA 3GDMA 3HBLA 3H26A 5TAOA 3G1DA 4WDWA 4GX8A 4OZOA 2VUNA 1W1VA 3SRFA 3AMDA 4WY0A 1OC6A 1VAHA 5HJYA 1AG1O 3IK4A 4LCQA 2Y1HA 3WDQA 1MSSA 4JKLA 3UCQA 3QV6A 4LUIA 5EMJA 3ZS4A 1TJ1A 1YKWA 3PP7A 1WCGA 3NQAA 3BOXA 1IEIA 3AS0A 1E0XA 3SY1A 3T40A 3L2MA 3E2SA 3VIFA 2UY3A 1QXLA 2BXVA 2QJJA 7CGTA 2VCCA 1PB0A 2JEQA 2VCBA 4K6AA 2NQ5A 1DL3A 3CWOX 2UV8G 1HZYA 3PJTA 1KM1A 1EL3A 4I8YA 3LI1A 3EOLA 3MO7A 3GIQA 5FJUA 1JPHA 4JS3A 2QMKA 1TWSA 4YCPA 2X42A 3L67A 2QCMA 3S3GA 4HTBA 1OQFA 4U5KA 2CHRA 1AH4A 2OB3A 5A6BA 4HCDA 4HZ8A 2OGYA 5F2GA 1E4MM 1P43A 3FYYA 4DZHA 3IJ7A 2OYLA 1PAMA 5FF4A 2PDMA 4CD5A 5TIMA 1TIWA 3H2CA 4ZOEA 1FQ0A 1YEYA 3XIMA 4JFVA 3SDOA 4K1GA 3UJFA 3SCQA 1YTEA 3APYA 4D8LA 4BQ4A 2VEPA 4KGJA 2YCIX 3LBCA 1LP6A 3VIPA 2PLCA 4NZ3A 1FWTA 4OBSA 3HB9A 5AVNA 1YNQA 3H2NA 2V82A 3NSNA 2J27A 1F8MA 4AC7C 1YDVA 3RU6A 1YQ2A 2P0IA 2W3ZA 2ZXDA 3R2GA 5HNRA 4O8RA 3FAWA 1GORA 2A6NA 2FTPA 2ZWYA 2GK1B 2A21A 3RAOA 4O18A 3R25A 4XWUA 4CNPA 4JYDA 1FVPA 2QKFA 1PDYA 3VNYA 1I2RA 4L4PA 2FMNA 3GYCA 1MUWA 4GINA 5U7SA 2VX5A 4LUYA 2DZPA 4M81A 3VD9A 3VGDA 2H6RA 4FI4A 4FIRA 4FLOA 3RILA 5A6MA 2AQOA 1T8QA 3M07A 1X96A 1ZBKA 1U5JA 3FV9A 5AHFA 3MCOA 1EJRC 2TMDA 3PBVA 3C2EA 2EQDA 1Q2RA 3CQJA 2PD5A 2HXTA 1OFAA 3EB3A 3VC6A 4MDPA 3QSRA 3BSGA 3AS1A 4DWSB 3O6YX 2F2KA 1PX8A 1RQHA 2CKSA 1JPDX 4D8AA 3S5NA 3HG4A 4TVUA 3BLFA 1UJQA 3DFYA 5LGZA 4JL2A 3NO5A 1IEWA 3QHOA 1UJPA 1UC5A 3IJ8A 4XISA 5FEZA 1EXPA 4GQRA 1UD4A 3P81A 1M53A 3TVAA 3RUBL 4MTVA 4NJHA 4GI6A 1GEQA 1R6WA 2DT1A 2NVDA 1Q63A 2IQTA 2QAFA 2INZA 4IQEA 2IS7A 3I7QA 1FXPA 2B7NA 1MW3A 1H3GA 1EDTA 5EMKA 4XO6A 4DO6A 4BFAA 3K8LA 1WBHA 4FSAA 3LERA 3G1SA 4NILA 2DORA 3BXWA 4MJ2A 3RYSA 3N1AA 1QBAA 3LBOA 4KWOA 1L8PA 2X7WA 2G50A 3TA9A 4PMNA 1EJTC 3UR2A 3GRIA 1GOQA 1F8IA 4HNLA 1CGVA 1XYMA 3LA4A 3SZ8A 5E93A 1DOSA 1WAWA 4DJEA 3R6IA 4PCPA 3EPNA 4U3CA 2OQYA 1YDYA 1RP8A 2J7DA 1S5WA 3PBUA 3BW2A 1B3YA 1EX1A 4M5PA 3E3HA 2Z4GA 3UZ5A 1REQB 4B9YA 4WEVX 5HMFA 4D72A 2DZUA 2HCVA 5FJRA 1MRQA 2DJLA 3NL6A 4B91A 3LSBA 1QW8A 1CPUA 3ES8A 1JULA 4LB4A 2CPUA 2Z1WA 4X9YA 4WDUA 4DM2A 3PZ9A 4TV6A 2J62A 1X8FA 3IIZA 3GFZA 2RDXA 1W37A 1UA7A 4NUWA 3GXIA 4HMCA 4C7FA 1M7JA 4HYVA 1V08A 5EY5A 3H6OA 1K7XA 1KGXA 2WHMA 2V38A 3IGUA 4XUYA 4GG9A 5I03A 1TVLA 2O4QA 2EEXA 1GZ1A 1W1B1 2Q02A 2VZSA 1U5HA 1FDJA 2C15A 4R7WA 1B54A 1W9UA 3UR7A 4F2TA 2QPUA 1QAPA 3LQGA 3T1GA 1AW2A 2H8XA 1XLBA 1K7FA 3P60A 4OV4A 3FCPA 1WDSA 1H7NA 1UZ4A 1V6YA 1R2SA 1GVIA 5KETA 2NQJA 1OX4B 3WFZA 1ZJAA 2A4AA 1DWJM 3SQSA 1IWPA 2PDQA 4LWWA 1K9EA 3OYXA 4PN2A 4J4KA 3NO3A 4LVDA 2XWDA 1PZ1A 3T0CA 5CZKA 3MHUA 2ZZ3A 4YVPA 1GPWA 4WR3A 2ACUA 3HN3A 2CZFA 3VIGA 3SQLA 3VI2A 1E5JA 4AD0A 2GQ9A 1BWVA 4A6GA 3WLMA 2GVLA 3I3BA 2FZ8A 5BRBA 4NZJA 2WLYA 1V02E 4L9YA 2J7CA 1H1YA 2J7BA 4XZLX 3G0XA 4PRWA 2OJPA 3CGTA 3FXGA 2A85A 2J66A 4ATWA 4O57A 1FWGC 3WSUA 2JIEA 3BK0A 5BOFA 1WBJA 1KB3A 3E2QA 1QW7A 3ZVHB 2FTWA 4BQ5A 1E0VA 4JX5A 1G01A 2PZNA 4V28A 5HDRA 3CZEA 3BMVA 5HJXA 3PPCA 3L2IA 5HAOA 4PMVA 4AYGA 3QFEA 1Q2SA 3SO7A 4IFKB 3CV1A 1I2NA 4C6OA 3B9AA 1GHSA 3T08A 6REQA 1UR4A 2HEJA 1BG9A 3P6LA 1H4PA 4FB7A 4PMJA 4AHPA 3AXKA 3WMBA 2XTKA 5C7HA 4J3WA 2ZFAA 1GYMA 4LYQA 3PUGA 4UFHA 3U2CA 5A2AA 1XIHA 2E1DA 2G3NA 2J9YA 2QVHA 3VDGA 4JTRA 4O11A 4BWLA 4LV4A 3M0LA 4GQGA 1W9XA 5E0KA 5F2LA 1J0YA 1PEZA 3UNTA 4I9TA 1TR9A 3GKFA 3WDJA 5HJLA 1EJ7L 3VKAA 1TFVA 5CPSA 1ZRQA 3SIZA 1Q6LA 4D6DA 1VD6A 2ZRXA 1YTKA 4B5WA 5CSUA 2WC7A 3Q65A 1R9YA 3MW7A 1QOXA 3TOYA 4M3PA 1QPOA 3NQEA 3FA4A 1Z8AA 2DQXA 3R12A 4W7WA 5A8NA 1XDLA 4H9MA 4JNMA 2A5HA 2W4XA 2IMRA 3W29A 1O12A 2GQ3A 2CZDA 4Z2IA 2E8YA 1TSIA 3BDKA 4RV3A 1R30A 1W2VA 5ABHA 1EYEA 4QJ4B 3E12A 2WSYA 3VX0A 4DRSA 5C70A 1EA9C 2ZUVA 5DRCA 3HO8A 4LUTA 4L4OA 1HKWA 5I5RA 2GUYA 1RK6A 3VNZA 5I3JA 3M7WA 4HNUA 3EKZA 4UOZA 1OYCA 4LRTA 2FJKA 1JAEA 4UTKA 2DZVA 1U1JA 1POKA 3GDTA 3NL2A 3EWWA 4EOUA 3Q94A 3AIEA 3VCCA 3IARA 3LENA 3G22A 2CBUA 2VRJA 3EKLA 2TRSA 3L4YA 1UR8A 4NNAA 4JCLA 4Y9MA 4KERA 4FEZA 3NPVA 2GQAA 2RJGA 1AODA 5IRPA 3WUGA 3C2OA 4IPIA 4PA8A 4RKAA 4ZO9A 4YWSA 5AC5A 1OM0A 4XB3A 4CEXC 2GJLA 1V7AA 2CNCA 3B40A 1CCWB 4B5XA 3WNMA 3QFWA 3P0XA 3FVMA 3VE9A 5C2XA 3L4WA 2QUUA 3LTYA 5A1AA 1KRBC 4IGSA 1RV8A 3DFNA 4UCFA 1OWQA 1SO4A 1ZB5A 1C91A 4CD6A 4CNUA 5I02A 3ITVA 4WCJA 4K8EA 4BI6A 5D4YA 1JCTA 2JKEA 5KTLA 3ATYA 4GY0A 4MF4A 1J0ZA 4GUIA 1DV7A 4L1GA 3CTLA 4LNYA 4DM1A 1EWDA 3ABXA 4HNTA 3SQMA 2D2GA 4E4UA 1TZ9A 2OZTA 3KOWA 3W1MA 2OEMA 4FX6M 4X63A 4QX4A 1WXJA 3UNDA 2PRMA 1BYAA 2PP0A 2FKPA 3FFSA 2VFEA 3LHTA 1VJZA 3AIUA 1E43A 5CPNA 3VA8A 1XM3A 4UOJA 3WQDA 2VNCA 3L4TA 4E38A 1H60A 1MMFA 4LUSB 3WIJA 2AQVA 4LRSA 4L6OA 1DIDA 4I9JA 1FFQA 1YXCA 3V7PA 4AG0A 3CM4A 2NQ9A 4XG1A 1ZS2A 4FNPA 2J9XA 2WPBA 4NP7A 4LGXA 1R9XA 1GOXA 2VM8A 3DYOA 3O3RA 3A4XA 2QZRA 4Y2WA 3ZWSA 1OG0A 2FH6A 2Y6ZA 1D3GA 3QSTA 2WZTA 4OJYA 4M82A 5IOBA 1J2BA 2AOSA 2VDIA 3ARQA 4U3AA 4M51A 2PC4A 4F8XA 1FXQA 4Y9OA 4UQCA 4IG2A 3I3EA 2OMAA 2PWUA 4O54A 1FH7A 1KBLA 4KWWA 3FJ6A 1Q65A 3EYPA 1VIZA 3MSRA 1V5XA 2ZYFA 3VMOA 1CXLA 3E0LA 3E49A 3UD6A 1TV7A 2WV8A 3IUIA 1V3JA 2B81A 4H9TA 3T0TA 2OZ0A 4TX8A 1ICPA 3OA3A 4I7UA 3CC1A 4NXSA 4YIWA 1DBTA 3VOGA 1YBQB 1HJQA 4JFSA 1VCGA 3V4BA 4ES4A 2FZBA 3L5AA 4O10A 4U28A 3K13A 1B3WA 3MMDA 1UIOA 1UWAA 3BCJA 6XIAA 2OZ8A 3PAOA 5GVJA 3D47A 2XN1A 4QS6A 1Q4NX 3Q4DA 1VH7A 2ALDA 1XF0A 5C8BB 3DUGA 4KEVA 3V3WA 3G18A 4GRSA 4EK7A 4WSJA 3CHFA 2ZVRA 4OU1A 4HSOA 1TE6A 3TFCA 2DDXA 2I1OA 4AZHA 2R82A 4B4HA 3N2XA 2PB1A 4B2DD 4ML4A 4HMNA 3AMGA 1D8WA 3ITCA 4RZ5A 5TNVA 3ECQA 3ANVA 3GNOA 1NFBA 3VZZA 5D2WA 3VNKA 1JPIA 2BVYA 3TNBA 3HPZA 3URQA 3MO4A 3GNNA 3OZPA 1EBHA 3LMZA 1D2KA 4YPJA 3CAVA 5DY2A 4LBRA 3EWCA 1B9BA 6XIMA 4LALA 3AHZA 3A5VA 3PZVA 2XVNA 4ILSA 5G1YA 3D46A 2QMJA 4J1OA 3LLFA 1EUAA 1KBBA 3HGOA 1UHVA 5EU9A 4F0KA 1O66A 1Y65A 2I5QA 2CLHA 5HNTA 3WD3A 3NM1A 2F8QA 2YDQA 3IGXA 4I90A 5KZDA 2F7FA 1JI1A 1RPKA 1MRAA 4IIFA 1DWHM 4AWTA 1V0LA 1DIEA 1DJQA 1C93A 3ZVIA 5AHMA 4HCHA 2HVOA 4NRSA 2FGBA 3HQ1A 1NWRA 1JDEA 1XLIA 5DFAA 1RHCA 2QCHA 4B16A 3CEPA 1AUSL 2XFRA 4DUXA 2W0UA 3LCFA 2QCLA 1RBAA 3NNTA 4PULA 3S2JA 3OBAA 3GW3A 4WDXA 3W72A 2QUVA 4Q8TA 3ZZ1A 4E3VA 4NSBA 3GDBA 1W91A 1CZ1A 1E5NA 2DH3A 2WC3A 1TMQA 2O9TA 3C6CA 3IPWA 1G7UA 2JKAA 3GXMA 1HGWA 3PZIA 3GXDA 4IFOA 2REQB 1J0IA 1LOSA 3NSMA 2J74A 3VGHA 1GHRA 2AL2A 1QPKA 4XD4A 1EDGA 3KL3A 4QAWA 1DWFM 4POCA 2BS9A 4E5TA 3HJZA 1AD4A 2P10A 2Z2UA 4K1WA 3ANUA 2CLPA 2IXUA 3SB0A 2HPMA 3DKLA 3SY5A 4MDOA 3FIGA 4H3DA 1Q8AA 2WJZA 3QH2A 3W2NA 1AZ2A 2F61A 1H7OA 3WF2A 1P0EA 4O1FA 1QO5A 4DYKA 3W83A 3AQUA 1A49A 4J7RA 4G9PA 2PDFA 3LHVA 4PH6A 4KWVA 1I0DA 1S39A 3DAQA 3GWQA 5DXYA 2VYOA 3OGRA 3ISIX 3ARSA 2GVEA 2VC9A 4GVFA 3UA3A 2IPWA 2YW4A 1UP0A 2BXYA 3QLLA 2QF8A 3L12A 3WF3A 1X7IA 3OIXA 3IUDA 1QHZA 4LUJA 1SO5A 5BXTA 5AFDA 3G5EA 3QV7A 2EG8A 2DIJA 6ENLA 5LYRA 2E28A 4FR1A 4ZQOA 2FTYA 3SFWA 1OFPA 1J11A 1UMYA 1NDVA 2DSUA 2A2IA 5LIUX 2OXNA 3GNXA 1VLIA 3GXPA 2Y5JA 1F74A 5DCEA 1WZMA 4DO7A 1C9DA 4FNRA 1JD7A 4CD4A 1UUQA 2J7FA 4TUFA 2ISWA 1PHWA 2X41A 4MWAE 4YJ5A 1BQGA 3SGGA 1MQRA 4IJBA 3TQKA 4OVXA 1X97A 5AC6A 2X0YA 1NVMA 4OV9A 2E7FA 3OODA 2AAMA 4D6HA 1QNSA 5E9XA 2G5WA 1JI2A 4S3GA 2G3MA 1Q6QA 1LBMA 1YXDA 1W56A 4UMBA 4JTQA 1TUXA 1R86A 3ATZA 1YXYA 4F40A 1F2JA 4Q8OA 1FCVA 3GTIA 3AZRA 1OT2A 5K2ZA 1GPFA 4XKYA 1J4EA 1HIZA 1H0GA 2EKCA 2WSRA 3DEQA 1P7TA 1BAGA 1VCVA 4A2SA 2PF0A 1OZMA 4AYSA 3LCIA 5A2BA 1H62A 4PL1A 3AJ7A 2OTDA 2YA1A 3PTMA 3RJYA 4LAOA 1OCNA 3CUFA 4DLFA 1IXQA 4GACA 1KRMA 3AIVA 5H2ZA 4ZODA 3V75A 4NT0A 1XGDA 2OO6A 3D0CA 5REQA 4N0RA 3SN0A 2D2JA 3H2OA 1LG2A 3CZJA 4IMAA 3NIYA 3CZLA 1C8XA 2V2HA 2CBVA 1AJ2A 4AZ6A 4KQNA 4KRZA 3LS9A 3KOFA 2OODA 4AAJA 3G6LA 3DN5A 1SFSA 5BU6A 2CERA 3EDDA 3ZJ7A 2WO5A 4GUGA 1CDGA 4GH3A 2JBMA 1EC8A 5IFPA 1XX1A 4H9XA 3W84A 5G1TA 2PWEA 3M44A 3RGTA 2INEA 4UFMA 3PY2A 3TIMA 3A21A 1KM6A 3TWBA 3OB8A 3MZ2A 3R4IA 4HKPA 1K70A 1IZKA 4XAFA 3E96A 4C6JA 3LD5A 2QV4A 4IIDA 4RDVA 2ZUMA 5GNXA 4OOUA 2HDJA 4PTXA 1SMDA 3W2JA 3MKVA 5EBAA 2GSJA 1F4HA 1QI3A 5BWAA 3NDZA 4I8DA 1DKWA 1PE1A 2J8FA 3ITLA 1N8IA 3WX7A 5IHSA 1CBGA 1NFGA 2QQ6A 1EO7A 1SR9A 2Y2WA 1NEYA 3H24A 3C3NA 1LROA 3EXTA 4P7NA 5E70A 2WJFA 5G2HA 3KTCA 4LFYA 4CCZA 2VWSA 3NZGA 1RD5A 1QJWA 4HSNA 2ACRA 2XVKA 4S3BA 5A6LA 3VNIA 4MZ8A 4W5ZA 2PLMA 1LCOA 1PWLA 4LVGA 2PC8A 4RX0A 3RX3A 1TELA 4TX6A 1VBHA 1XIDA 4UTJA 2BODX 3A22A 4IIGA 1R47A 2HBVA 5A6AA 2OG9A 3KS6A 4A35A 1QATA 4B90A 2XH7A 4EP8C 4JFUA 3VOFA 6A3HA 3BO9A 2VGBA 3DZ1A 2VFFA 1NH6A 3MA8A 3W75A 3VIIA 3NQ8A 3L21A 1GWJA 1E3ZA 2C71A 3KOXA 3GHSA 4HPHA 3OQEA 4RK8A 1TVPA 4ORMA 1JZ6A 3UPBA 3M0KA 3L68A 4NRRA 3IIVA 3GHRA 3R0KA 3TH6A 3L4UA 4MLJA 4HMDA 3TDFA 3MT1A 2I57A 3REQB 3UPWA 1M9HA 4JTTA 1RA0A 1XG4A 2W91A 3FJ4A 3H70A 2CHOA 3WBAA 4X9SA 2GL5A 1OFEA 1KFEA 4AEOA 1VLWA 3P61A 1MDRA 4JIPA 3O15A 3G77A 3SCTA 1ZJIA 1RQBA 4MM1A 1HL9A 4WKAA 3SADA 5AHEA 5J8LA 3BAWA 5K9XA 5E9AA 2BV9A 2ON3A 1IGSA 1VFFA 4S3EA 3LV5A 1T8XA 2Y70A 1QFEA 3NVTA 5HBFA 2ZRWA 4R88A 3LHYA 4JFWA 1BSLA 2VX6A 2Y7FA 2G97A 4GD0A 3NOEA 2ZXQA 4N4PA 4XZHA 2D2HA 1I2PA 1R9ZA 4BR1A 4IZGA 3EKGA 3VGGA 1FCUA 1DXEA 2C19A 3UG4A 1Q8JA 4XD3A 1HN1A 1H11A 3M5XA 5AZ1A 3WBXA 4MNJA 4YTTA 2J7EA 3F03K 2V68A 3RO6A 3W0KA 4QQ3A 1Q66A 4PCFA 4ZL1A 5FESA 2ZA3A 5D8ZA 4QEHA 4LC6A 1P0DA 4R34A 1OGGA 2VZVA 1UQYA 2RGLA 1EIBA 3HF3A 2A7NA 2J79A 3CHDA 3KCLA 4PMQA 2YBTA 4HP5A 3S5ZA 2J88A 2XVGA 1Q6GA 5K3VA 1Q6RA 1IZCA 4DWSD 4CNTA 4CQCA 4Y9NA 4HYWA 3HPSA 3JS3A 2ZRZA 6REQB 4FXJA 1KC7A 3CH9A 1XYZA 3S42A 1QASA 2XVPA 4PUJA 3GH7A 1JCYA 4DBSA 1E6ZA 1TPEA 3LCWA 3VU2A 5AYBA 2ZC1A 4M19A 3OGSA 4B5UA 4DVOA 1VB9A 3CUGA 5I3HA 3WDIA 3FW6A 2QT3A 4NKCA 3WN6A 1UIPA 1PJ9A 3EWUA 3NCOA 2E25A 2WSPA 2FJUB 4WJEA 1E4LA 3H4WA 4UNKA 1DP0A 3NFUA 4F48A 1KM3A 3TQVA 5IDIA 4IP4A 4A8RA 1KXTA 5JQ9A 3PN8A 3AIRA 3H7RA 4FR6A 4IOTA 1JDFA 4BCEA 3RRXA 4B5NA 1E1CA 4MB1A 1LDCA 1OCJA 4MKNA 1A3XA 3B3DA 4R3UA 3UXIA 2NXHA 2PTDA 4B92A 1L2QA 5EB8A 3LLXA 1MO0A 4XIMA 3AAMA 3C2YA 3PHAA 1VQTA 4FP1A 3EWBX 3VKDA 4PCTA 2ZUTA 1BPLB 2Z1SA 1BYBA 4INFA 1KR1A 3E0WA 3ARZA 4NNCA 1W17A 3UWYA 2V5DA 1GONA 2XPKA 3UWUA 2ZTJA 4KT2A 3ZT5A 3WNPA 2E5DA 4UZSA 2YBUA 3UWWA 1C7TA 2NUXA 3UXDA 3KBMA 4E2VA 1WP6A 1IV8A 3K2GA 4LS2A 4DZIA 1GOOA 1GOMA 3KLKA 2ZDRA 1UB3A 4L7ZA 5CZJA 1IGWA 1XPGA 1E73M 2NXGA 1M7PA 1RBOB 4WOZA 1I9CB 3T6CA 1KV8A 4PZVA 4S23A 4H9VA 4ZOBA 4PUWA 1HP5A 4TMCA 1PYMA 3H12A 5FF0A 4WX2A 1JUEA 2JK2A 3AHYA 1MDLA 2NX1A 3GYEA 3WLIA 1JYNA 1MXGA 2CXGA 1S2VA 4IL2A 3U48A 5KSWA 4C91A 4QM1A 1SW0A 1XGZA 4HA4A 1N8WA 2VC7A 1M68A 2WPGA 3UYIA 3ZJKA 4AIEA 4I7VA 4I5RA 3VOCA 3S6OA 4GVGA 5HA7A 2G41A 2GDQA 4IGNA 1SZGA 1IR1A 5BOOA 2QCFA 2V2DA 2GDUA 4AF0A 2Z24A 5TBOA 4S3DA 3USBA 3NWRA 4FOUA 3WLKX 3URNA 5M2FX 4JX4A 4AFYA 4D8ZA 3HV8A 2XH0A 3CASA 3RU8X 4B5TA 5FF2A 4RZ4A 1HGYA 1ZQ5A 4KETA 4QCFA 4A3QA 4FX8A 3W76A 5EL1A 3EDJA 3CAWA 2QIWA 3VNMA 2E40A 1VFLA 2QPXA 4NHVA 4FOJA 4PEKA 4OGZA 2I14A 3HTWA 4KEMA 1ONEA 1OX6A 1XIJA 1EWEA 2WVVA 3SGZA 3S1GA 4LEFA 3W1XA 1QHOA 4QCEA 2ISFA 2OKOA 4DXXA 2VELA 4UNLA 4IX2A 5D2VA 3LPFA 1GVRA 4IG2B 4AZ5A 5D38A 4GA8A 1CW2A 4AW7A 4NX5A 3U2ZA 4QLLA 3ZLHA 2OX4A 2R1KA 4GFSA 1SJCA 5LHEA 1LLZA 1EGVA 3T2OA 5GJMA 3SRHA 5BU9A 3IIPA 4LCSA 1JG9A 1PKLA 3MP3A 1NP0A 2DPEA 2GGEA 1TX2A 3O0FA 4H9UA 2PDYA 3OGVA 1B9ZA 3VYLA 4WDTA 2VURA 3MKCA 4JPGA 4P2VA 3WQPA 1MW0A 5BW6A 3AFBA 4GIAA 4GI8A 2QV5A 1FWAC 4L6DA 4EF9A 3I4KA 1NM9A 4KCTA 1XISA 3GX9A 1DJXA 3UZJA 1SUXA 1S2UA 3MMUA 2DZXA 3LXBA 2NX9A 3W1RA 4MFDA 1W1YA 2DH2A 2QVNA 4AZ7A 3AHXA 4RE4A 3URBA 1AQ0A 2EJAA 4RNHA 1I8JA 1P5BA 2GQ8A 4GJ1A 3V18A 5I06A 4ZOAA 4ERGA 1CXIA 1DXFA 4IT1A 4IQLA 2FIQA 4IPJA 4DYJA 3VTRA 2OQHA 3O0KA 3D5HA 3WQ4A 1QPNA 4DF1A 1JF6A 3S5OA 3PBWA 3TQPA 3HA1A 1C8QA 1VHCA 3TU9A 4GNJA 1XLCA 3NXFA 1Q6DA 3CLMA 2NV9A 2TYSA 3BLIA 4BY3A 1LT7A 4J2PA 4PE8A 3OG2A 4S3AA 2RJHA 4JHOA 4IP5A 1F6YA 1K4HA 1QU4A 1A5BA 1R3YA 3APTA 4JNYA 3W4RA 5DMMA 3XINA 4DWDA 3LGGA 5C9XA 2OELA 1K9DA 1UR2A 5FEWA 4D2JA 2ZX9A 3OBKA 4NZ1A 3F1QA 2Q09A 4DBEA 1XW8A 1XHGA 1EUNA 5FL0A 2V5CA 1L0PA 1PSCA 5D9MA 4O28A 3G8RA 1FHLA 2O9RA 3TWAA 2GVGA 1S46A 3DESA 2Z6JA 1FP8A 2TPSA 2HBXA 5LZLA 3AWOA 1ITUA 4ZQMA 4XTDA 5G2WA 1V51A 1L6YA 1MYRA 3CWNA 1OFDA 2QLYA 3FX4A 3RCYA 5GNZA 3I6EA 1W9BM 2Z28A 2AL2B 3CL8A 4ADSA 2PFHA 2EBNA 3WH7A 5XIMA 2CCRA 1KLYA 1HO1A 4AQLA 3W7JA 4L80A 6ALDA 3N73A 4IQJA 4L6HA 3IRSA 5CH9A 3TA6A 3CL7A 3OOQA 1EJSC 2PLKA 1FY6A 1OF8A 1BKHA 2X0SA 1YYAA 1HKJA 3NVDA 1UKOA 1ZP3A 3UZXA 4ZCWA 4M80A 1SZEA 1UUMA 5AC4A 3TR9A 3EPOA 4MYXA 4IUOA 4RDYA 1HVQA 3W23A 2HE5A 3W73A 4PODA 3W7MA 3CO4A 4QSFA 3FOKA 1ITQA 5I2UA 1P0KA 3WF4A 4ENLA 3C2RA 1V7YA 1S2AA 3M4HA 3KUMA 3A23A 1WDQA 1WDWA 1E70M 3WBYA 3N3TA 3TLQA 2GGGA 2I9UA 4GC4A 4NZ5A 3ZM8A 1XP3A 4JN7A 3UCDA 1DHKA 3U9IA 5D9NA 5H8UA 1P6CA 3KHJA 1XYCA 2MUCA 5ABFB 3VCNA 3M6YA 2FHCA 1ECQA 1LL6A 5D09A 4IJRA 4W8BA 1OGSA 2X40A 3UT0A 3B0PA 4JN8A 3N9RA 2FFIA 4GXWA 3KE0A 5HULA 4RR4A 3P2VA 2D3NA 4C6EA 2EO7A 1CECA 2JE8A 4YTQA 7TIMA 5FL1A 3MB9A 1TV8A 4CUCA 4E0CA 5A6SA 1JZ5A 3PNUA 4FLRA 1TPB1 2Q3RA 3RF9A 4ZQCA 4AWUA 3ZLFA 5HWNA 1PX4A 1CYGA 1R2RA 2VEKA 1RJPA 1S2TA 3M5VA 4W4QA 4CN1A 1BEUA 3B9OA 3SW6A 3VNLA 1J2WA 3VDBA 4MYAA 5CBIA 1EJXC 2C0HA 1K8YA 1RZMA 4O4WA 7A3HA 3VIMA 4ASTA 1H63A 1V3IA 4F2BA 3BQ6A 1XKJA 4H00A 3QEZA 1FUYA 2V8ZA 4EACA 1H2JA 3WBWA 2YCEA 2JEPA 2XJ7A 5K7JA 5FEXA 4Z1AA 3STFA 4J3UA 3UESA 1F07A 1MW2A 3SBFA 1KFCA 1I1XA 4PTMA 5HXMA 4OIFA 1G67A 2IPGA 2Z1KA 5IDZA 2X2YA 3IJIA 3WK2A 3VD7A 3R58A 1POJA 5I3IA 2DIKA 5CJMA 5DBTA 2ZUWA 4MLRA 3A5FA 2WQPA 4AD3A 3WMSA 2E8ZA 4H6KA 1VYSX 4GZEA 4BA0A 1G69A 1M5WA 2VQUA 2DZTA 3VM7A 4LNCA 4LAKA 2IPFA 5CAKA 1A3WA 4PTDA 2YL5A 3LRKA 2VT0A 4JX6A 4KEUA 4K39A 4QITA 1WKDA 1UP3A 4ZB5A 4LT9A 1BTMA 3BUVA 3SN1A 3W3OA 2HXUA 4H6RA 3BOFA 3NQFA 2XM1A 2ICSA 3FGCA 2IXVA 3HQOA 2C16A 5H8MA 1BYCA 2YDRA 2IKIA 1U33A 4BHYA 3E2VA 2C1IA 4KS0A 2GJPA 3SJ3A 3MWCA 1I2QA 1WV2A 4R33A 2PGEA 4LAMA 3R8RA 3KVMA 2JF6A 3ARPA 2C6QA 3OLDA 1OADA 2H3BA 4LF1A 1AK5A 2DW7A 4JQ1A 4KH2A 3S5YA 2B4GA 5FA5A 5EKYA 1GCYA 2CWXA 4F3HA 4JTHA 2HVNA 2IQ0A 3CV2A 1TMHA 2VOTA 3AO0A 3PZGA 2WMIA 1CXKA 4R9OA 4GQ0A 3B05A 9XIMA 2Z2AA 1E1EA 2GGHA 2FPYA 1Q6EA 1C7SA 1ZBCA 1VF8A 1XQLA 2YLAA 4IJCA 4JFTA 4MSSA 3GVRA 3D3AA 2YL8A 3LHWA 3VMNA 2KX9A 2ISSA 3GZ3A 3MDUA 2XHYA 3KBVA 1E6RA 3UZWA 3PBMA 2BXZA 3ZQ9A 4MHBA 1F6PA 4H1ZA 3THUA 3K4AA 2P8CA 3W6YA 1Z44A 4XAZA 3UVAA 4N7QA 1JCLA 3HG3A 3VXGA 4XD6A 3MI3A 1NJJA 3OLIA 1H49A 1K9FA 1EGZA 3PG8A 4Z2HA 1E4IA 4EAYA 2FQIA 4JEJA 1TV4A 1A4MA 3K4WA 1GQIA 2O7SA 3N2CA 1M65A 2Y7EA 1X6NA 3ZR5A 1HKMA 3CEUA 1C3FA 5FCZA 1FWFC 4YVVA 2V6AA 5CZSA 3VKCA 4IIEA 3R10A 3VE7A 4NL1A 3DGBA 4PUUA 4LAZA 5LHFA 2RH9A 3QMTA 2VEFA 4B3LA 1XYBA 1ITXA 2E6YA 2B7PA 4H83A 2CFFA 1V77A 3SCVA 3T4WA 7PTDA 5I0DA 1C92A 3DI0A 1O94A 3WQ5A 3EB4A 2OCZA 3IJLA 1KR0A 2CLFA 3N2MA 1O1ZA 3EDEA 1PKNA 3SM0A 3AMKA 3SFKA 2Y89A 7XIMA 1GK8A 1GKRA 1RH9A 3WQVA 1H5YA 4H7VA 3RM8A 1TA3A 1EJVC 3F5LA 4AD1A 4DF2A 2BOGX 1TQJA 4PUMA 1JXKA 1WA3A 1M01A 3F4DA 4CN4A 1ZBVA 1R5YA 3LPGA 3LI0A 1FKXA 4XZIA 4AZIA 3AIQA 1XSKA 1V8EA 3W7NA 1UH4A 3VZXA 1KM2A 3CHEA 2JGQA 5HQEA 4X0VA 4IP7A 2ATMA 3WEMA 1BHGA 1Y0EA 4AD5A 2HPIA 4GK8A 3CMJA 4QFUA 2A79A 1JQXA 5C55A 1WUFA 5F2MA 3MSDA 1PVNA 3TROA 5JIWA 4MWAA 4PRRA 1WYIA 2EPHA 1TPFA 2YCLB 5FF7A 4DUVA 5D37A 4AY7A 4LS1A 4IXXA 1LWHA 1QPRA 2BGNE 4QG6A 4JD4A 1H7PA 2ZA2A 3NQ6A 3QGVA 3IAQA 1YW1A 3GBEA 1TTPA 1EPXA 4W7VA 2GLKA 1W1A1 2PDHA 5CKSA 4CU6A 4XBJA 3IJDA 3QTPA 1GEHA 3WJWA 2V5LA 4XAPA 3HGRA 3WELA 3AJXA 1S3HA 2V81A 5FI8A 2XSAA 4TX9A 4AY8A 1LWJA 2G96A 4RDWA 2NZLA 3I7SA 4C6FA 3MC5A 1KTNA 4AVFA 5HANA 1G94A 2H3DA 2AGKA 4IWWA 3RK8A 4IMFA 4BK9A 1XSJA 4E8CA 1HT6A 4ATDA 3IVTA 5BMXA 4D6GA 3UZYA 3A47A 3LHZA 1GKQA 1LQ0A 1S5TA 3WLSA 3BJSA 3N4AA 4JCMA 1VR6A 3EX1A 3BTNA 2ZE0A 4P7OA 1FFRA 1OFOA 3C0QA 3PWAA 2V3DA 1K4GA 1J8VA 3HFYA 1E1CB 2YL9A 3LCXA 4MMWA 2OOGA 5L9FA 3BLLA 3PTQA 3L0KA 4PMDA 2P5NA 1R7OA 2V67A 3STEA 1GJWA 4H6EA 2YB1A 3C4UA 3B06A 4NIRA 4DJED 2WLZA 4P7LA 3LNMA 5C9UA 3AHVA 5HMDA 1AQHA 4UXDA 3O6DA 4C5YA 2BZNA 2WSQA 5HUPA 1W5OA 3RMEA 4F0HA 2QJHA 3KL0A 1NQKA 2YCJA 1U2YA 4WJ8A 2C14A 4L4LA 3F2DA 4OFCA 5GJNA 1KCXA 4ZTYA 5CBBA 2G95A 5K4XA 5DT7A 3DCPA 2E6AA 3TX9A 4NXKA 3RM4A 3VMPA 1ZBWA 1ITCA 4K7VA 3M5ZA 1PKMA 4W7UA 4GHRA 5LGXA 3IJQA 1WNOA 3VDCA 1W1TA 2GDVA 3NXLA 3W1UA 3W00A 4IIHA 3F2BA 2ZXAA 1HTIA 3I65A 4QNWA 3STCA 2YXOA 3P0WA 1XLAA 3Q2DA 3FKKA 3H2FA 1E1FA 3A13A 2D1ZA 3U7VA 4IPPA 2YDAA 3VOIA 5EBUA 5E5CA 3PC0A 4E8DA 3S8HA 1EOKA 1TWIA 2QCEA 4QG9A 4V33A 4YL2A 1WX0A 4ML9A 1KD0A 1PIGA 4ZVJA 3MBDA 3BOLA 4OT7A 1J6PA 5EMYA 2C13A 4UTTC 4NF7A 1YRRA 2QIIA 5JIPA 1OVDA 3SCPA 2WMJA 1TUFA 3TYBA 4DELA 2GYIA 1FBAA 1NQ6A 4UIOA 1TTQA 5D2TA 4DWSC 3GR8A 4AH7A 1EJWC 1Z9AA 3LCLA 4DX3A 4FX7A 2DSVA 1T41A 2DEPA 4JQ4A 3IIXA 3S1XA 4YYFA 3GBDA 2WJEA 4TXEA 1SR0A 2WVVB 3ELFA 1LQAA 1EIXA 3LU2A 3RPTA 4HPJA 1O95A 4QIUA 4D1IA 5FSEC 3A4WA 2GGIA 3BWWA 3NQCA 2NWSA 3CIVA 1NWSA 5LXXA 1F3XA 3MPGA 3SCOA 3EA2A 4I9AA 4FPSA 4CU7A 4AZCB 1WB0A 1E3XA 2V0TA 5D33A 1JDDA 4O0ZA 3W6LA 3VIHA 3JW7A 3WLJA 1GNXA 4C65A 3W81A 1RXOB 2WCGA 1H7XA 3FDKA 5ABTA 4J3SA 1ADSA 1JJKA 1XRVA 4PTVA 1ELSA 2VCAA 3LQLA 2O4MA 3KDNA 5M03A 2WW5A 1QOPA 1PUDA 3CBWA 3SUSA 3W87A 4DAFA 3BLEA 1CNVA 3PVFA 1KBJA 3BSMA 1IWAA 3H7UA 3DECA 3AWNA 2J13A 5BZAA 1PO9A 1IE7C 2ONEA 3WUBA 1SSGA 1OSEA 4OBRA 3W6MA 3BARA 2DUAA 3TV8A 2F2HA 4FLSA 3RLHA 1UZHA 2BY1A 5EGRA 4GI4A 3BC9A 5J5DA 2NLYA 2R8WA 1MNZA 4F9JA 3NJ3A 1C29A 1IR2A 3W7LA 1XIBA 2AMXA 2D0FA 3QF0A 3QR3A 4DHGA 5K4ZA 4REQA 5CSYA 1Q7QA 4HGXA 1X38A 3RRAA 3TC7A 2FZNA 3VFLA 2Q6ZA 5CQ1A 1NDYA 4QEEA 1QK0A 1IXNA 4GYPA 3KDOA 4C6NA 5CG0A 1XG3A 1Z7AA 2QS8A 1EGMA 1GW1A 1RUSA 2Z26A 1FHVA 2FVKA 3OVRA 4MADA 3GO2A 1HX0A 4NU7A 2J7HA 4ZFCA 4YS1A 8RUCA 3BVJA 1OJXA 3WQFA 4DEFA 1UC4A 1JYVA 1XJBA 2ZOXA 5D9OA 2X05A 2RHGA 3KVLA 3CWHA 1DIOA 3IGHX 2HZGA 4UQBA 2V5KA 4JAWA 2CLIA 2VP8A 3PPHA 3M47A 2FDSA 2XZ7A 4TR9A 4IPLA 4JGDA 3W1LA 5LA1A 4MJ4A 2QGYA 4XV0A 3I6RA 4NAEB 1E6NA 4JTIA 1M1BA 1XL9A 5HOSA 1AVAA 3VM5A 5FAJA 2O7QA 4ERIA 3S6DA 3O1NA 5LKYA 4E6MA 2ZX7A 3WFAA 4UTMA 4IUGA 1QMLA 2B7OA 5JBFA 5TQLA 1PIFA 4I6KA 3KAOA 3PK7A 1QNPA 3T44A 2JFEX 4S38A 3VK5A 4UFIA 3GNPA 5LNSA 1JR1A 2QF7A 2FZDA 3PFRA 3WZ0E 3AUJA 3V1HA 1W8GA 2CESA 2PAJA 4CEUC 1K8XA 4A8NA 4L1XA 3Q67A 4M56A 2E4TA 1OABA 4C6PA 3W7EA 5IXEA 2CWNA 1JCJA 1GOIA 4ZR8A 3BE7A 4JZ5A 3O9NA 1OK4A 1P0NA 5A8PA 1A0DA 1SJBA 2G37A 1JGIA 3N17A 1WZKA 3H7VA 3PR2A 4NG3A 1DXIA 1ZFJA 2O55A 3CB3A 3SURA 3W7RA 1QPQA 1GJPA 2F9RA 3UF9A 4C1NA 1EA0A 3MMWA 4YNGA 5AECA 2Y7DA 3GU1A 1NFPA 1TREA 3KCJA 2E68A 1MW1A 3LB0A 3W25A 5H8PA 3MSYA 3RJXA 5IFTA 4P5UA 1KXVA 4MJMA 1NOWA 2L5HA 3PJXA 4HNVA 3L4XA 3VVGA 1KM0A 1WDRA 1XLHA 1EOMA 3BZGA 3PTDA 1TCMA 2JF7A 5U4NA 1KM4A 2F6KA 1AFSA 1SM9A 3C86A 3S83A 4U2YA 1L2UA 3N15A 2CIPA 3R0DA 1A5CA 3OBEA 4O0KA 3WQ6A 2H9AB 3MP5A 3WY1A 1DTNA 2BY0A 1UBSA 4HHMA 4HNOA 1O4UA 5GNYA 2CLOA 4RNJA 4HYRA 4BF9A 3AISA 2PGRA 3D6NA 1DEDA 3AZSA 2R6OA 2X16A 3B97A 3GD6A 4P61A 1V0KA 3BG3A 1R7AA 1VEPA 9CGTA 3W7KA 4PUDA 3NEVA 3PTKA 1TZ7A 2DJXA 1N2VA 3B8SA 3CB8A 4TQTA 5LNUA 2VO5A 4WQ6A 4LOCA 1LRTA 1IT0A 2HQAA 1J6OA 2QULA 3A9IA 3CH0A 2OZ3A 2PDCA 1XSIA 1MEHA 1V0MA 1WXZA 4ROPA 2B0MA 4XD5A 2CBIA 1LT8A 3HQPA 5JU6A 1CENA 4KWSA 2TSYA 4WGXA 3WK1A 3WLTA 4L4MA 1UR9A 4GY1A 1RCXB 3W1QA 3FJNA 5AC7A 2PTWA 3S2MA 3ID7A 5FJJA 3TXZA 5HQMA 3WBEA 1GYNA 2CXEA 3MUAA 4ACZA 2DVXA 1J10A 4FMVA 4LH8A 3VPLA 1XC4A 5ABGA 3RXZA 1V3LA 4XSMA 4K7YA 3DYMA 3WNLA 2G4JA 1CXEA 5KEZA 1FA2A 4OTKA 2WC4A 2KAUC 1IF2A 3OZMA 4DJFA 1HF6A 2Y8VA 3QHNA 3WD4A 2INFA 2O9PA 1H7WA 3KOYA 2XYLA 3AU2A 5CLWA 3S9IA 4JQ2A 4NI8A 4W84A 2GFTA 3ARVA 2VD9A 2XIBA 3CUIA 3N2TA 4JTDA 3DOPA 5HWMA 3N12A 1QWKA 1O6IA 1VBUA 2ZBTA 3DU0A 1OC7A 4J3XA 2WCAA 3C0SA 4QNEA 3V35A 3GW0A 3MUIA 3TTOA 3S0CA 4NJJA 4X2PA 1PWMA 2BSLA 1UD2A 3VC5A 3M0ZA 4R9XA 3GM8A 2QDDA 4B9ZA 5AHLA 4YVXA 2WYSA 3QY7A 4UQDA 3AXMA 3R7MA 1MUMA 2BHZA 1DTUA 4WIWA 2WMIB 1TIMA 2VGIA 4EAMA 1KA9F 1O5RA 4ZSTA 1JPKA 3WUFA 2FFCA 4G56A 4ZENA 4UTWC 1VIWA 2J24A 1W5QA 1IXPA 3L23A 3DGRA 4G7FA 1E9IA 4MB4A 1JGMA 1GT8A 2WZMA 4KW2A 1L9WA 3NQMA 3QY8A 4EXAA 1H7RA 3DC8A 1I45A 3G24A 4RUBA 3GVWA 1UKPA 1US2A 3WNKA 3H2MA 3KP0A 3NZQA 3V0UA 3CYJA 3LXAA 4ADTA 2ZRYA 5MHBA 1OD0A 2WANA 2NW0A 5JVLA 4H7CA 4W8AA 1UYQA 4M6PA 1W32A 4IISA 3ZT6A 5RUBA 4E2DA 4LU0A 6TAAA 2OWCA 1F3TA 1FCBA 5A8OA 1W3IA 4Q4QA 4LC8A 1XLFA 2BNJA 3O06A 5GPRA 5HWJA 4DWSA 5T9CE 1VFSA 3FSTA 3M46A 1G5AA 3RCNA 3LV6A 1XI3A 1KQYA 3CT2A 1CGUA 4LANA 5JBEA 5CCZA 1XBVA 3TJXA